4KW2A

Crystal structure of a putative uncharacterized protein (bdi_1873) from parabacteroides distasonis atcc 8503 at 2.32 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
240
Chain Sequence
ADWKVGIQTWTFHNLTLMETLDKTQQLGMGYAEAFFFQELGAPFPKETYLNYDLSDDNCALLRHEFKIRGIKPIAFGVASYGTNEEWDKFFAFAHKIGAHIVTVEPELNQLDYIESLAKKYDMEVAIHNHPASAEVVEKALKGRSPLMGVCADIGHWKRVGEDPLKNLQKLSGRIKVAHLKDLTDKMEDATWGTGILPVKAFVNELKRQHFNGLISIEYDDFKSDIQEIRNSLEFLQKCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Uncharacterized protein
publication title Crystal structure of a Putative uncharacterized protein (BDI_1873) from Parabacteroides distasonis ATCC 8503 at 2.32 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 77
structure length 240
sequence length 245
ec nomenclature
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4kw2A00
5XIMA 3CQHA 3VNMA 4E3VA 3GNXA 3AYVA 4X63A 3BZGA 3DBNA 3KBJA 1XLJA 1XLHA 4PFHA 4ZB2A 2X7WA 5EMLA 1DIDA 4QDPA 5J8LA 5TNVA 3XIMA 4HNOA 1O1HA 4GJJA 1GW9A 3AALA 5XINA 3C0QA 2I57A 3IUIA 5I7GA 1XLCA 3UVAA 4K3ZA 4QEEA 3IUHA 4G56A 4GLEA 3M0VA 1XYCA 2XINA 2ZVRA 3M0YA 2GLKA 3M0HA 1QT1A 1BXCA 1XLIA 1XIBA 1XP3A 1XYBA 1XIEA 3KBVA 3ITTA 1K77A 4XSMA 2HCVA 3KBSA 3KCOA 3WQOA 3BDKA 1XLAA 2QUMA 3KBWA 4QE4A 1D8WA 1YX1A 2QW5A 4US6A 3ITOA 8XIMA 3ITYA 2ZDSA 4ZB5A 1XLFA 1DE6A 2HK0A 3IUDA 1A0CA 3BWWA 3M0XA 3P6LA 4HGXA 3N4AA 9XIAA 3KBNA 1A0EA 1XIJA 2X7VA 1S5MA 4XIMA 3UA3A 4A8RA 3CWHA 3C0SA 1XICA 4QEHA 1XLDA 5AVHA 3C0LA 2NQ9A 3UA4A 3VYLA 4GQBA 3VNIA 2GYIA 1XLBA 3AAMA 4W4QA 3U3HA 4OVXA 5FA5A 4YTQA 4QE5A 6XIAA 1QTWA 2XISA 4XKMA 3U0HA 4XIAA 1QUMA 5H6HA 4A8IA 5B80A 1OADA 3AYTA 3FVMA 3LMZA 3KCJA 5EMJA 3TVAA 7XIMA 3QYSA 3VNJA 2NQJA 3BANA 2I56A 1XIMA 1S5NA 1I60A 3ITLA 2J6VA 2XIMA 1XIIA 4J4KA 4PGLA 4A8NA 3QZAA 5XIAA 3TC3A 3BZJA 4QDWA 1CLKA 3M0LA 1BXBA 1XLKA 4YTUA 4EACA 3KCLA 4YTTA 4Q7IA 4YTRA 1TZ9A 5B7ZA 2QULA 1XYLA 3ITXA 4X61A 4A8LA 2G0WA 5EMKA 3UXIA 1A0DA 1DE5A 2QUNA 3DX5A 4KW2A 9XIMA 3M0MA 1XINA 3XINA 1XIDA 3CQKA 5B7YA 8XIAA 1MUWA 2HK1A 2Q02A 2G4JA 1MNZA 1XYAA 4HHLA 2GVEA 4ZBCA 1XIGA 3NGFA 3CNYA 3KBMA 4LNCA 2GUBA 4EAYA 1DXIA 4YTSA 3P14A 5AVNA 1I6NA 4X60A 3VNKA 3OBEA 4DUOA 5H1WA 3QXBA 2NQHA 3CQIA 3KWSA 3L23A 3XISA 4XISA 4QE1A 6XIMA 4ZB0A 1XIFA 1XIHA 4HHMA 3KTCA 4K1GA 4GJIA 1DIEA 4XSLA 1XLEA 1XLLA 3JU2A 5EMMA 3CQJA 3QC0A 4DVOA 1XYMA 3VNLA 5C9ZA 3UU0A 1XISA 1XLGA 1XLMA 2OU4A 3ITVA
chains in the Genus database with same CATH superfamily
4ZVJA 3PUOA 1BQCA 2QR6A 1WXJA 3APTA 3VM5A 1MDLA 3UESA 1E3XA 3ARWA 2QVHA 4MJMA 1MW1A 3IJQA 2G96A 4S23A 1A3HA 1W1A1 3OQEA 5CSYA 4TV5A 4NT0A 1Q85A 1HKWA 4Y9NA 4CCZA 4IMFA 3N9KA 3RRXA 3KVLA 4LV4A 2FZBA 1KM4A 3UNTA 3EOUA 2DJXA 2PDLA 1S2TA 1TJ0A 3LCFA 3GZAA 1XUUA 4Q4KA 4JX6A 4XZ9A 3IANA 1ISXA 2UZ9A 2FYMA 3THAA 3TYUA 4LUYA 4GZ7A 3CS2A 1DJYA 1XIMA 2J6VA 1I2PA 2P10A 3CHEA 3M0LA 4Y96A 2ZYFA 3WEZA 3NL2A 4JTDA 2NX1A 5K9XA 1J6OA 4NNCA 1LL6A 3FSTA 3CBWA 3VKDA 4M7SA 3G1VA 3FJ4A 3CNYA 3LQGA 1JRBA 1RVKA 3GLCA 5CZJA 1RY0A 4CQAA 5H8PA 4ROQA 1R2TA 1VRXA 1J11A 1Q8AA 1I2NA 3KRBA 3GTNA 1PPIA 3VGEA 4D8AA 3S0CA 3N2TA 2ACRA 3WMLA 2QCFA 3STFA 1FH8A 4OT7A 2CXGA 3S1UA 3EDEA 1VH7A 2Y89A 1HVQA 1F4HA 2VT0A 2PLMA 5J5DA 1ZJIA 1H7NA 3W7KA 4O15A 1J96A 1E55A 1H5YA 1PL9A 2BY1A 3STCA 3E2SA 1JYWA 4W8LA 2ZUWA 4ERIA 3KTSA 1L8PA 4Q4SA 3PZMA 2CIPA 3S42A 4W85A 3L0NA 1DWIM 5HUPA 5PTDA 5AHMA 1NU5A 1V3LA 3II1A 4H7ZA 4XIMA 4A8RA 3C0SA 1D3GA 1F8IA 1ISVA 1ICPA 3NUKA 3VD4A 4GJ1A 4N2YA 3DYOA 3VD5A 3R25A 4ZSUA 3U0HA 2E68A 1W1PA 1V79A 2RDTA 4M6PA 3CL6A 1VYSX 4PL2A 3AS3A 1Q6FA 3POHA 3GG1A 3VGGA 4PZVA 2AGTA 1BRLB 1IT7A 4MKNA 2Y6ZA 4UTHA 2FHBA 4U5KA 2PGWA 2OX1A 2QUUA 3W0KA 3GK0A 1NWRA 1A49A 1XFCA 1ITXA 1NSJA 3P93A 2VFDA 3NGJA 4RW3A 1G9HA 2QJMA 1QNPA 4Q3MA 2NQHA 4BS0A 3IVUA 5GJPA 4H2CA 2C71A 1CNVA 2F2KA 4CN6A 3UETA 1OC5A 3LGGA 1M7PA 2ATSA 4RUBA 1E6ZA 3TXVA 1YDNA 3FN9A 4GISA 3GAYA 2BMBA 1JZ7A 1V93A 4H4IA 2OWCA 3AXXA 3VE7A 3KHJA 4KCTA 5K7JA 5AC4A 2QDDA 1V6TA 3OU8A 1C8XA 1XC6A 1I2OA 4K3ZA 2OYMA 2GVYA 2ZX5A 3AWNA 3P81A 5A3HA 1QBAA 4B5NA 5IFPA 1BKSA 1WKDA 2DT3A 2POZA 4RZ4A 3WQOA 4NYYA 4D8LA 4QE4A 4HB7A 3RILA 4D6DA 2YL9A 4C6MA 4F0MA 1KFWA 1UKTA 2CKSA 1OC6A 1IXNA 1NF0A 3U7BA 2ZRXA 3OIXA 2BBFA 2YCLB 4M6VA 2OCZA 3L4XA 5CLWA 1ZJHA 2QLYA 2XIMA 1XIIA 3RXZA 1KM2A 1WYIA 1GQNA 2QUVA 4LH8A 1U22A 4DJED 1W9XA 2Q02A 4QITA 1RJRA 3CH0A 4QIUA 3OZYA 3B9AA 4DZ5A 1OY0A 4IQJA 4J3WA 2GJPA 1IR1A 1EIBA 3EXSA 3AIUA 3H7UA 2G3FA 4CEXC 3WUBA 1FY6A 2L5HA 1EH9A 3MUY1 3W1TA 3LHYA 3LGDA 1D2KA 2HPMA 1VYPX 1UWUA 4PFHA 2WVTA 3E0FA 3T4WA 3DIPA 1NDVA 4AQLA 1JUKA 5AYXA 3T9PA 2ATMA 5FA5A 1RJQA 4NZCA 1TPVA 2C3ZA 1ZSXA 2GDVA 4ZEPA 3BE7A 3TAKA 3ZJKA 1XSKA 1Q66A 2DH3A 4MB5A 3TUUA 3VU2A 3EWUA 4D1JA 4B3ZA 4PBEA 3QV9A 1K70A 3M41A 1A5BA 1VHCA 4IGHA 2GUYA 3UJ2A 4AEOA 1BXBA 5B7ZA 1QPNA 1ICSA 4YCPA 3BAYA 3IGUA 4ICMA 2VZTA 1LBLA 2E67A 1TO3A 3EOSA 3MKCA 3ABSA 4HPJA 1FWDC 3F2CA 1QHZA 1XRFA 3GYEA 5A6MA 4NY2A 1HF6A 4I7VA 4J7RA 3FFSA 3SFWA 2ZADA 1W1YA 1TELA 1B3VA 1G7UA 1MVYA 1S2WA 2CLFA 5D38A 2JFEX 1ONRA 2VGIA 1OIFA 4Q32A 1JZ6A 4B5UA 1LQ2A 2VFGA 2VI0A 1EX5A 3HBLA 3T2PA 2PTWA 3ABZA 2GQAA 4UZUA 3M7SA 3EDJA 3CZ8A 4MHBA 2GQ8A 2BHUA 1A5LC 2HVNA 3CB8A 3PR2A 3RK8A 4FPSA 2YIHA 3ZSTA 2CKRA 3SJNA 5TQLA 3S9YA 2ZRYA 5M5DA 3W1PA 4C60A 5I3IA 4L7ZA 4NIRA 3THUA 5CPTA 3E2RA 3KS5A 5BXPA 4G2DA 5HNUA 4AISA 1K9EA 1SZGA 3UWVA 4U33A 4KEVA 3A23A 4G6CA 4QR6A 1FP9A 3P3BA 1FDJA 1IZJA 1ESWA 1ZZMA 3BLDA 2ZZ4A 2NV9A 3MSRA 4Y2WA 3EX6A 1X98A 1PKNA 1TIMA 3QRHA 4JYEA 4UMAA 4I5RA 3HIJA 4WUIA 2V3DA 2A3HA 3TONA 3M0KA 4YTSA 5HOSA 3F1QA 1CZ1A 4PN2A 5I09A 2W63A 1M53A 2EBNA 4TMCA 4Q8UA 1T99A 2OJPA 3GNRA 4JTGA 3ENLA 3MMTA 4DF1A 4NZ4A 3A5FA 3DEQA 1XL9A 3VKBA 4F66A 2BSLA 4XD5A 2V82A 2HSAA 4IQLA 4P8UA 3LK6A 3QY7A 4JTHA 1AJ2A 1WDQA 2ZKMX 1RUSA 4XAZA 5F1VA 2CBVA 4RDWA 3K13A 2D0HA 5ECUA 2YB1A 4Z2HA 4P7OA 3Q94A 2X1TA 2PDBA 4LUSA 3N2XA 1ZPTA 3GB6A 1QATA 1CGUA 2NXGA 2FH8A 2BNJA 4JPGA 3RNDA 1DHKA 4WCJA 4Y9PA 3EX2A 1PCWA 3F5LA 2R14A 1NM9A 4RE3A 1W5PA 3VIJA 4RX0A 4ATDA 4ADUA 1EOKA 2DU2A 4R9XA 2VVNA 3SIZA 2OMAA 1L0PA 5KEZA 3URBA 4GMEA 3W6LA 1OADA 3CLMA 3LLXA 3BMVA 2ZUUA 3SN1A 1YDOA 3C8FA 3NQ6A 1XSJA 2D2HA 4KEMA 4FB7A 1FWWA 4JTSA 1EBGA 5F4SA 3JRKA 3N18A 4NP7A 1RBOB 2UY3A 3GE7A 2YR1A 1TPUA 3WDJA 1NVMA 4C1LA 5EYWA 4HCDA 1AMKA 2ZZ7A 1A53A 3ANVA 1MI3A 1SO3A 1RP9A 3MUZ1 2Q71A 3NDZA 3KZSA 1VD6A 4ZXLA 4L65A 3LHVA 1D8CA 4D6FA 4ZB2A 1E0XA 4FNQA 4QDPA 4AZHA 2RUSA 3SDOA 4HNOA 2CESA 4MMWA 1P43A 4ILSA 4S2BA 2ISFA 1BRLA 2ZVRA 5EBAA 2RGLA 4AD4A 1A4MA 4AHOA 2NSOA 4LRSA 2AQOA 3HV8A 4C6LA 3J7HA 1VFTA 1FUYA 1A5UA 4LV9A 2DW7A 4B5SA 3VYLA 3PTKA 1YBQB 2YA0A 3HQ1A 3IAQA 2P8BA 4PTMA 3MP3A 3O0FA 5LNRA 3QOKA 1XBXA 2PCEA 4FOUA 4HNVA 5JBEA 2BVDA 2BVYA 1W3JA 4LW7A 1JDDA 3PBVA 3NZGA 3I4EA 4PRRA 3KX6A 4UFLA 1K7EA 3MJMA 4O19A 1AH3A 4C6FA 4O1FA 2DZBA 4R53A 2FTWA 4TTUA 1E6SM 3BURA 4C91A 1Y0EA 3AXHA 4W87A 2YCKX 3TCEA 4FXRA 4XZNX 4RNIA 2QCGA 4US5D 2YCLA 4L64A 5IOBA 4NZFA 3ANUA 1FQ0A 4PCFA 4MB1A 2P0OA 1FWJC 4A22A 5FJPA 1OQFA 1KXQA 2CFFA 2E77A 1W3HA 4DYEA 2INEA 4PTNA 4FXFA 2GGIA 4JYFA 3ZWSA 4CU8A 4TQTA 2HTMA 5AHFA 1GOXA 3EBVA 5AYZA 3QPEA 4I90A 2NXHA 3M4HA 1IZCA 2UY2A 3NO1A 4RJEA 3S5OA 4JTAA 2OB3A 1KGXA 3GY1A 2OEMA 4UTWC 3OVGA 3PBYA 3WQ5A 1WNOA 2ZOXA 4FLRA 2X40A 2CBUA 3SUUA 4GVIA 3NPUA 1TPH1 3QMRA 2WCAA 4OV4A 3HOJA 2Z1KA 3VZXA 2BY3A 4O17A 4DUVA 5E9XA 2GOUA 3UG3A 1CPUA 4WX2A 3MCOA 4R34A 1K6WA 3XISA 3VMPA 2BASA 2W0UA 1W3IA 2VENA 3AXIA 3VIFA 3C2RA 3S2MA 4HHMA 4GWEA 1R2SA 4L9YA 5D2TA 2ZX7A 3B3DA 4CD4A 3EXRA 4JIIX 2OFJA 1LLWA 3GQYA 2PDWA 1GOQA 4GX9A 4ZO6A 2TYSA 2FGZA 4KFPA 3NQGA 4IICA 5D04C 2WC7A 5IRPA 4PMOA 2W6RA 3NSXA 1N82A 3GUGA 3W1NA 4HSHA 4MJZA 3OPSA 3WQDA 4OU1A 4XZLX 2V38A 4TV6A 5E6ZA 3W9ZA 1PZ3A 1G01A 2YLLA 2NQZA 1Z32X 3AIBA 2I16A 1XRTA 3CMFA 4N7QA 1Y8BA 1B3YA 1S39A 3F4CA 1A3WA 3VIKA 3NXLA 3EX3A 4J1OA 4ACYA 3PF3A 5C2GA 1W54A 2FJKA 3TC3A 1XF0A 3LS9A 3DHDA 1G7VA 1J8VA 1ZS2A 4S3EA 1XG4A 2ZVIA 4GXWA 3WQ6A 1LTDA 4EXQA 4PB5A 4XX6A 3OBEA 5HXMA 3PZ9A 3BCFA 2YL5A 2AAMA 4FNRA 3BK0A 3UY8A 2B7NA 3F2DA 3WQ4A 3ZR5A 3WMBA 1TIWA 3M43A 3OYZA 3GBDA 4CD8A 3WFZA 3BGGA 4C6KA 3BSHA 5I2UA 1AW2A 2VWSA 1R7AA 4U5IA 2FQIA 1E4MM 3N9SA 1T96A 5T9CE 3W53A 1X1ZA 5IDIA 1DP0A 2CBJA 3DG6A 3RPDA 1AD4A 3PPFA 1HL8A 1LOLA 2DQWA 3OG3A 2BS9A 4PUEA 2QQ6A 1GORA 2DQXA 3UA3A 3NSMA 5DBTA 4YHEA 3RITA 8RUCA 4UXDA 3OTRA 2G37A 5D9MA 4PTXA 2WNWA 3TJXA 2PAJA 2RDWA 5HMDA 4BF9A 3TR2A 1QI5A 2ZIDA 3RLVA 1K4GA 4JFTA 4ZA0A 1P0BA 1XH2A 4BI7A 1XXXA 2DSKA 1FBAA 3L2LA 3KCLA 2X2YA 1XPGA 1JFXA 1ME9A 4IUGA 1EP1A 4H3DA 4IFRA 1ADSA 4HA0A 4UQBA 3NVDA 1S5TA 4MNJA 2Y4SA 4GIRA 1BLIA 3RLGA 2HE5A 3LEPA 3LBMA 4AF0B 2QKFA 3EKLA 2IPWA 2ZZ5A 4NYUA 4OWGA 1NWUA 4OUEA 4GI6A 1J01A 2E4TA 5CLTA 3IRDA 5A6SA 1GOIA 2E6AA 4E8GA 3WJXA 4H01A 4JN8A 2EHHA 5CQ1A 2VRKA 5GNXA 1H62A 2WZHA 2IS7A 4EWND 1M5WA 1WCGA 2DUAA 4EP8C 2QHAA 4XAGA 4FNSA 3H4GA 2EPMX 2O7QA 3PPCA 2PF8A 1YX1A 2WCSA 4EPDC 4ZB5A 5FJIA 1A0CA 4LUTB 3NNTA 2C0HA 4I5UA 1OZMA 2VFFA 3GDBA 3NQDA 2NUYA 4XTIA 3OIHA 2D0GA 1F4AA 2GYIA 6TIMA 3G1AA 4J2MA 2DVXA 4BEUA 4KCWA 3RPTA 2DORA 5HWMA 3COTA 3IJDA 4Z17A 4CNTA 3U5YA 3NZQA 2WSYA 1FKWA 3GAKA 3MV11 4K7YA 4RCXA 1DE5A 5I00A 4XV0A 3HMJG 1E6PA 3V0TA 1Q7QA 3ID7A 1M03A 5BNKA 3WMSA 5M17A 3VOGA 3MKVA 1K02A 4FXSA 3HF3A 4JOMA 4YWIA 3MP4A 4C5ZA 1XS2A 4YPJA 1UR0A 3BOLA 4GIAA 2P0IA 2CYGA 5I3HA 3GKFA 1UZHA 1YBQA 1G4PA 5G4HC 5BXSA 1XLLA 3MKKA 3ZM8A 1XYZA 2CLOA 4PFMA 5CZKA 1OBAA 3WH6A 1OSEA 1UD3A 3R13A 1LQAA 3EOOA 2ALRA 1KM6A 4KCVA 3WNMA 4JIPA 4M1RA 1KQZA 3DBPA 1LWIA 1T5AA 1VPXA 1AZ1A 5A8MA 4B90A 3W73A 3M46A 3BDKA 3OLDA 1JZ4A 2BLEA 3NYZA 3LGEA 2J7GA 1YE4A 5EPDA 4YIWA 3G18A 3BW2A 3W2NA 1GJWA 3IJ8A 1XV8A 1LBFA 1K6AA 4Z0SA 1QASA 3UZJA 3K8MA 3EXTA 3R8HA 5AC7A 6ALDA 2Y7GA 2Z4GA 1EDGA 4FK9A 4QCFA 4JIQA 3W81A 2XVKA 4FX6M 5EB8A 3SR7A 5LNWA 4H19A 3STPA 4F0LA 1GEQA 3CEUA 1QR7A 3KDNA 5J04A 1LDCA 3W1UA 4HKPA 1RPKA 5F4XA 4J3SA 1OFAA 1XYFA 2AL1A 3HQPA 3W02A 1G1YA 1HJSA 4FHAA 4DX3A 4DUOA 4BF5A 2VTFA 4K2SA 4TXEA 4FF5A 3G1YA 1EGVA 3NQ7A 5JBDA 1J5SA 1NOUA 3IIZA 3KOYA 4F0HA 4B2DD 5HJXA 4NNAA 4W9TA 1DIEA 1BWKA 3BG9A 3PWGA 2PDCA 1F74A 3VNLA 2VCCA 3NOYA 1MFUA 4GE8A 3S6TA 3LERA 3VNMA 4EWJA 2J9ZA 3QHNA 3TROA 4KFOA 3EEGA 4DJDA 4RV3A 1NJJA 4BQ4A 3FV9A 3IUIA 3AHZA 5AN7A 3B0YA 4UC5A 3FW6A 5JQ9A 2AQWA 5A8PA 1VFOA 4MUZA 1WKYA 3HGSA 4DUWA 1JPHA 1ZP3A 5JBFA 3MP5A 2J62A 4HGXA 5HQMA 5D9OA 1RK6A 3NSNA 2YZRA 2VDHA 5FF7A 3C2FA 4MWAB 1Q7MA 1UH3A 3UQNA 1U5JA 1GVYA 4HZ6A 3B97A 1FHUA 1W2VA 3ZR6A 1F76A 1H7OA 3FX4A 4V33A 3GNOA 4AH7A 1LT8A 2JALA 4A8NA 1AH4A 3R10A 1ISYA 2R1PA 4X61A 4MWAC 2PSNA 2QPUA 3DX5A 8CGTA 2D0FA 2QCLA 2F2HA 3TNBA 5A1AA 1DJWA 3ZXWA 4HD5A 5TF0A 2C0AA 3UJFA 2NQ5A 3MY9A 3LY0A 3VD3A 1HFBA 1FWCC 1X8CA 5G2HA 3CGTA 1EQCA 2J7DA 2O4MA 1FHVA 4L9XA 5DFAA 4FLSA 1A80A 3A5VA 1J79A 5HATA 1NF7A 2J74A 4DF0A 2YOCA 5C55A 3W75A 1XDMA 1X6LA 3EB3A 1OFPA 4CNOA 3A9BA 1SZNA 3O9NA 2KZHA 4E3VA 3CV6A 1B1YA 2V2CA 3VOJA 5HINA 5F7UA 1ZP4A 5KZEA 1QMLA 3EWZA 1E72M 4F2BA 4QISA 1NP0A 3GDTA 3R43A 4G56A 2QCMA 3LHWA 3CWOX 5BRBA 3KBSA 4UQAA 4P61A 4Q7BA 3ITOA 3T4CA 3V1PA 4D71A 3SECA 1S3TC 3GDMA 4ZO7A 2R1MA 4B91A 4FLQA 2OT1A 1AL8A 4AEEA 3W2LA 3S3GA 1SPQA 4XIAA 3KVMA 4FSAA 4JQ1A 1YXCA 2YXGA 2V81A 3IJ6A 4JL1A 2HVMA 6TAAA 3A4AA 3CPRA 8XIAA 4DN1A 4ZOBA 1XIGA 1DXFA 1MO0A 1AD1A 5LA1A 1VS1A 1I6NA 4X60A 2GGJA 1IEQA 3HJEA 4UR8A 3DI0A 2GFTA 1SQ7A 1G4SA 3OEXA 1HKIA 2BB0A 3EOLA 1XLEA 4GH1A 2ZZ2A 3B05A 5U7SA 1T8XA 1TQXA 4O1EA 4FP1A 2Z6JA 3SCPA 2ZXDA 2V5LA 1SJAA 2Z2UA 1LWHA 3WH5A 1XRSA 1QWKA 3Q58A 3QSRA 3O07A 3SGGA 3BC9A 3PULA 1C29A 4LVFA 2WZIA 2JE8A 4I7WA 1XR2A 2IQTA 2XM1A 3W87A 2QF8A 4AF0A 4YHGA 3AZTA 1O4UA 4R7JA 3T07A 3L4TA 3K2GA 4JTRA 2VZVA 4XKMA 2PDJA 1FDYA 2EGZA 1FRBA 4E4PA 5CG7A 2A6NA 2XGZA 4ZFCA 1BVWA 4ZSTA 4G7FA 4DYKA 3E1F1 3P8JA 4PODA 3DC0A 3EWXA 3UJRA 4RNFA 4H8UA 4P7NA 2WM1A 4GYPC 3W7OA 1OGBA 4WVXA 2HK1A 1M65A 2Z27A 3VIPA 1TR9A 2WO5A 1PZ1A 4DUXA 4LUTA 2V3GA 2QNEA 2WYSA 4NASA 3VILA 1C8VA 4XZWA 2GVLA 4ECLA 3G1XA 1JF6A 4O1CA 1HKMA 2QIIA 4H6KA 4XZIA 1PX4A 3T09A 4EPKA 5XIMA 3TYZA 1DJZA 1ZRQA 4S3CA 1SW7A 1JVNA 3W1QA 4GJJA 3ABOA 1KO0A 5CC3A 1TREA 2O55A 3B8DA 1XKJA 1VKFA 1BTMA 3I6RA 4GH3A 4QEEA 3BO9A 1RD5A 1MEIA 4WK9A 4MAVA 1L9WA 3LRKA 4IX2A 5HBFA 3HG2A 5L6UA 4OGZA 4OQVA 1MXGA 1XSIA 3BV4A 2HBVA 4DZIA 1X7FA 3WNLA 5FIPA 3EA1A 4WRHA 3MCNA 5KETA 4NHVA 2ABAA 1FWSA 1BSLA 4NILA 1UBSA 3KWXA 2VO5A 1Q6RA 3KCJA 3BMXA 4C90A 3IACA 2PRHA 1NDYA 4DWSA 4BFAA 1SUXA 1G4EA 2BXYA 3H54A 4WEVX 3VIHA 3TEVA 4DPPA 2Q3OA 3LDVA 7ENLA 4JKLA 3WQGA 3BAIA 3ZLFA 4AWEA 4Z1BA 2ZTJA 2YYTA 4LVGA 3RR1A 2IPJA 5FL0A 3M7WA 5GNZA 1F9CA 3MHGA 5I23A 1KBIA 4R88A 1HKJA 1TTQA 1RK5A 3RO8A 1XIFA 3GU1A 3RX4A 3W2JA 4ZXOA 2XM2A 4AYSA 7REQA 3WLIA 3W70A 4IJBA 5C2CA 1XLHA 4XKYB 1OCBA 1UWIA 3AI0A 2XU2A 4ZQNA 2CLIA 3TTSA 1I0BA 4PUWA 4ES4A 1C3FA 3BAKA 3SI9A 4FX7A 2ACQA 3SQLA 1D3HA 2HBXA 3QH2A 5I3JA 3KBWA 1QJWA 5CKSA 5D32A 2ZDSA 1GUVA 4JEQA 3WUEA 1R0MA 3HPSA 3T0TA 2XVGA 3V3WA 1QXLA 4QS6A 2EJ1A 1NOFA 1W5QA 4WD0A 4LBUA 1KR0A 7TIMA 4B4HA 5I3DA 3GKAA 3O3RA 2Z1XA 5HNNA 4RXFA 4JTQA 4LC6A 4EACA 3WD4A 5FAGA 2Z7KA 1HIZA 3UW6A 3AROA 1XX1A 1E9ZB 1TV3A 2FLIA 4DBEA 3TN3A 4Y8EA 4IL0A 1M7XA 3KL5A 4QLLA 3H6OA 2BTMA 1RY8A 3CUXA 5IBXA 4JR5A 4XAPA 4DJFD 3WLNA 2F9RA 6XIMA 3LTPA 1B3XA 3WF1A 2QJIA 3MCMA 4B4FA 4MWAA 4XD3A 3UY7A 2UV8G 5DMYA 4UTJA 4AWUA 1DPMA 2XIQA 4K8GA 3L21A 5LA2A 1X39A 4HMCA 4TOQA 4GQ0A 2ZUNA 3NZ1A 4LRTA 3R8RA 3PC0A 3W1MA 1K9DA 4IIGA 4XD4A 2WJDA 3UXKA 2Y62A 3OLGA 4MZYA 4JKMA 4U2ZA 5CGTA 5EFFA 3B0UX 2ALDA 4Q8PA 2VX5A 1S5MA 5CZ0A 3HMCA 3DG7A 4MG4A 1K7XA 1MUMA 3UYCA 4ZENA 2A0NA 1GOWA 2J78A 4QG9A 1WDPA 4UQ9A 2R91A 3TTYA 2P50A 4W8BA 4BA0A 2PWDA 2VR4A 4DHGA 5BROA 1IZKA 2FIQA 2G5WA 3H4WA 2GZXA 1HUVA 3GDLA 2C14A 4OBRA 2TPSA 3D46A 3I4KA 2R82A 4Q22A 2Q8ZA 3QY6A 4JTUA 4QTGA 1OFDA 3PY2A 3D5HA 4U4MA 3B9DA 3UWQA 3QZ6A 6A3HA 2AOSA 3KTXA 2PGEA 1RLDA 4UFKA 1G6CA 1I75A 2VDIA 2Q3RA 3K4WA 5AHLA 3P2VA 1JDEA 3NQMA 3WIJA 3WEMA 1S46A 3LNMA 3OLIA 1XISA 3WJWA 1CBGA 1O60A 1QPRA 4G8TA 3RO6A 2J27A 1WX0A 3GXIA 1P5BA 4MLJA 2DIJA 3WF4A 4EXAA 3QV6A 1VENA 1B90A 2WOQA 2VFEA 4DYJA 1BF6A 3N12A 4I9TA 5HK4A 4JQ2A 4UTMA 1ZL1A 4Z1YA 3I65A 1K4HA 4L80A 3UXDA 4GY0A 1OEPA 3UPBA 1KB3A 4IH3A 1KFEA 3FOKA 2TRSA 3CUJA 3QYSA 3AIEA 1EF3A 3UWZA 5EU9A 3BZJA 3JW7A 5HMSA 4ZQOA 3VDBA 3WY1A 4DXVA 3VUPA 5A8QA 4IIFA 1JFHA 2HXTA 1XINA 4J3TA 4LAOA 3RU6A 4HHLA 3Q67A 1SVDA 4XAFA 4WKAA 2VR2A 4NAEB 3TYEA 2YDRA 1UQYA 2VHLA 2Y2WA 5DELA 3S47A 4DO4A 1KWGA 5I77A 3BW3A 3MO7A 3BPWA 1KD0A 3OQ8A 4AZCA 5C54A 4K8EA 4CU6A 5KSWA 1XCXA 1MW3A 2C1IA 1QNRA 4RZBA 1A5KC 1WKEA 3ABRA 4GBUA 1GKQA 1ZENA 3LRLA 3EWCA 1WZMA 1TMHA 2QCNA 1KFBA 1V3HA 3IUHA 3A3XA 5HULA 3RAOA 3ZOAA 3GHUA 3QEZA 4AIUA 1NOWA 2DUXA 3O6AA 1H7WA 3C2YA 2AKMA 3IUDA 2FZ9A 1W91A 3MI3A 4LB4A 1PHWA 2TODA 4QJ1A 4G1KA 2W67A 3KRSA 1TPEA 3AMCA 4BQ2A 2GQ3A 3L0GA 4QROA 1KTBA 2XISA 2OG9A 1T8QA 4M56A 4TIMA 3UEQA 1MXSA 1JZ5A 1V8EA 3C6CA 1TRDA 4DO7A 2DIKA 1UD5A 1K3UA 4LAUA 1D7KA 1ZBVA 1LP6A 1FXQA 3O0KA 3UVIA 2C7FA 3WLKX 3TTEA 1W3LA 1RSCA 2J7EA 1TKKA 1EDQA 5HWJA 3QV8A 1XRVA 2Z6IA 1UKQA 3HPZA 1SFLA 4FALA 1SMDA 3PPGA 4I3GA 3LA4A 5JXQA 3L4UA 2EKCA 2V5CA 2P8CA 2DZPA 3B0PA 3VOHA 3H21A 4HOWA 3LENA 2R24A 4LOCA 2XH7A 2CC0A 3MZNA 2VZUA 4MY8A 1LLOA 3QGAC 1L2UA 3PTMA 4WXYA 3EWDA 3U4FA 2W66A 1TWIA 4Q8NA 3LCXA 4MOZA 1GG0A 1SGJA 3N25A 3WD1A 3T0DA 3PZVA 4HYWA 1EJXC 5E0FA 2YCJA 5ABFB 4P8XA 1OYAA 4A2SA 4WGHA 3GIPA 1VFUA 5CPMA 3M0XA 1NIUA 3U7VA 5BMXA 3VKCA 4D72A 4QHRA 4ZL1A 5E9AA 2QS8A 3MT1A 4WIWA 3IGHX 4IPLA 1CXLA 2DPEA 4EF9A 1EO7A 4V1YA 3NPVA 3TFCA 4X9SA 3CIXA 3DUGA 1LUCB 3B9NA 1KCLA 3MANA 3KL3A 2NWSA 2FPYA 2VM8A 3L4YA 1EJ7L 4XKYA 2Q8LA 4CUCA 3KW3A 4BI6A 3O1NA 4C7DA 2D3NA 2G3JA 3QTPA 4S39A 1K9FA 4KIRA 1I1WA 3W7DA 2HDJA 2GUBA 4UCFA 4QAWA 4ZOEA 1TVPA 4ZQPA 1R3RA 1HN1A 1DHPA 3H55A 1KCXA 4FOJA 4YXGA 1DJNA 4O18A 1NEYA 5C6MA 1E0TA 2VEFA 4LAZA 3A13A 4TU1A 4AG0A 1TR1A 1ITCA 4HTYA 3T8QA 2R8WA 4IOTA 3DZ1A 3VUSA 3M47A 3N6QA 4IMGA 5DN1A 1U83A 3G2GA 4J27A 1XGZA 3VABA 3WH8A 5I06A 1H1YA 1DIDA 4Z08A 3WNOA 1YTEA 3EKGA 5FKYA 1EJRC 1JQVA 2VQTA 4NZ5A 3FGCB 4US6A 5DBUA 5BW6A 1OT2A 3R11A 1PX3A 4CD6A 2I14A 1IHIA 3MI2A 1PB0A 4YCOA 4X22A 4ZR8A 2H9AB 2A7PA 2HISA 4C6NA 4M29A 1YPFA 1FP8A 2Y0FA 1MXDA 1BAGA 2PLJA 1QTWA 5FF3A 3VFLA 4O4WA 2NSXA 5CCZA 3E0WA 4M1BA 1F07A 1C7SA 1WO2A 2QDEA 4J3UA 2FHCA 1S2AA 3WQ8A 2Z29A 3B4UA 3V75A 4I7UA 3M0MA 2WPBA 3VOCA 2ZTKA 1UWTA 2CXEA 1A5CA 1GZGA 3G5EA 4JTIA 2QAPA 1EA9C 3QHOA 3P14A 3URQA 1KKOA 1L6WA 4UOJA 1H7PA 2IPGA 1V08A 3L7RA 3BAXA 1XCWA 4CLMA 1VC4A 1O1ZA 3FLUA 3OVPA 1OABA 2PDIA 3S1VA 4PMUA 4B92A 4OBTA 1P1XA 4MF4A 1ZJBA 1PKMA 1LRTA 4GKTA 1EO5A 5GQBA 1EUAA 4NXSA 4JIRA 3D47A 3CPUA 3H8AA 1KKRA 2D1ZA 4FIRA 3RLHA 3KM8A 4DBSA 4KCUA 2ADAA 1EPXA 3CTTA 4Q4MA 1UCWA 1UWSA 2PEVA 2QPSA 1UJPA 4ZOAA 1JPIA 2Y8VA 1M6JA 1UR8A 1XLDA 1RH9A 1HX0A 1ZCOA 5ABEA 1ONEA 4HOZA 3SCSA 1TYGA 3SZ8A 3HFYA 4J40A 3S46A 1VLIA 1PWMA 1W8GA 4B16A 1P0KA 2VVSA 4FO4A 3SRDA 1F8MA 2NVCA 1RA0A 3W82A 3WDPP 2FDSA 2VUYA 3LSBA 2CITA 3GM8A 4IISA 3CAQA 3CMGA 1TWZA 1UD8A 1W1VA 3LXAA 3ZJ6A 1KRBC 4W84A 3CZJA 2ZX9A 5BRPA 3QR3A 1GZJA 1PS9A 4JDBA 5CJNA 3PFMA 5HPCA 3OHIA 4DM1A 4Y8FA 4NUWA 3ZS4A 2FPVA 3PFRA 3VGFA 2VYOA 2Y61A 2ISWA 4CVWA 3ZWTA 1NFPA 3SN4A 3WKZA 1TPB1 3CV1A 3GWQA 3T0CA 2YDSA 4BY3A 3RJXA 2YCEA 1GEHA 5AYIA 1Z7AA 2DEPA 1ONWA 4NL1A 4IP7A 5CBIA 1A5SA 3WK0A 2OO6A 2DZAA 4EVZA 1PE1A 5FJRA 1W31A 2NT0A 2Z0IA 3MI6A 3JZUA 4ACZB 2QUMA 1TZ7A 4H9TA 3AWOA 2OQHA 1JPDX 4NAEA 4G7EB 4HNTA 3VINA 2Y70A 1A5MC 4LYKA 1HTIA 4HK6A 1JG9A 3M5ZA 3THCA 3WH9A 2A3AA 4A05A 4AVNA 1FWBC 5DXYA 4E4UA 3T42A 1UH4A 5ABGA 3U9IA 1CGXA 6XIAA 3FDGA 4PC8A 3HGOA 1QPOA 4MNLA 4M81A 3FAWA 3L2IA 4V28A 2NQJA 4GIYA 3C2VA 3DGBA 1LG2A 3I7SA 3BTNA 4LANA 1Z48A 4QLJA 2ESCA 3S6OA 3I6TA 1RCOB 5M1TA 1IEWA 3KZPA 2ONEA 5AOUA 4DO6A 1R6WA 2J77A 4DBDA 5D09A 4HYRA 4F0SA 4UFHA 4UOQA 4M0XA 1EXPA 3NVTA 2FFCA 4N9EA 3HV9A 4WDTA 3KS6A 3N34A 2E5CA 4LVDA 4HQVA 1GVSA 3O16A 2PC8A 1WZAA 2W79A 3RGTA 1KBBA 3IJLA 3ZSSA 1N55A 5HANA 3N73A 3LB0A 2GWNA 4RXGA 1Q3NA 1R9XA 3V7PA 2ZRZA 1QW7A 1UJQA 3ZQ9A 1DORA 1NFGA 1N8WA 1FWAC 1C9DA 1CB2A 2P3ZA 1TTPA 4BZYA 4A3QA 1F61A 2CU0A 2A4AA 5M03A 3H22A 8XIMA 3TIMA 3AXMA 2X0SA 4D1IA 4F2UA 2VRJA 2Y63A 3IGSA 4XVDA 3WDHA 4LBSA 1AQMA 3N6HA 5DO8A 3CQ0A 4PB4A 4GRSA 3NPWA 4TX6A 4D6JA 4KEUA 3RU8X 2QT3A 3VMOA 2I5IA 4PTDA 5BU6A 4MUPA 3L4WA 2ISDA 1JUBA 4F0RA 4D8ZA 4J5NA 1OFRA 2GSEA 1UOZA 3PBUA 2J13A 4JNZA 4Z42C 5A95A 3GXPA 1DXEA 3VXGA 4AVFA 2ZICA 1BVNP 4UTKA 3R12A 2WKGA 4JN6A 1I1XA 1P4CA 2GVEA 6REQA 1K1DA 3CAVA 4UMBA 2YW4A 3LD5A 3R0UA 3TJLA 3WL1A 5E0KA 3KAOA 1A47A 3HFTA 4GUFA 4JQ4A 3WD0A 2VDGA 2E25A 4PE8A 4S2CA 1POKA 4DXXA 2BP1A 2QAFA 1GNXA 2MUCA 3AJ7A 2NLYA 4WY0F 3S2LA 3DFOA 4HJFA 4ATLA 3FA4A 3T78A 3SO7A 1EJSC 1JCLA 1TWDA 2A3BA 4GNVA 5FJTA 1LUCA 1X1OA 3QGKC 3N3TA 3C0JA 3MZ2A 5REQA 3B8IA 2W62A 3LI0A 4H7VA 1R87A 4JD4A 2PURA 1AL7A 2F38A 4J3VA 1O68A 2HJPA 3ITTA 1MUCA 2OTDA 2H6RA 2PMQA 1REQB 3TQPA 2QCHA 3QC3A 3T6CA 3QOMA 1EWEA 2BZNA 3QKEA 2VEKA 3FAXA 4OOUA 5FF2A 5FSDC 5CH9A 3HPXA 3BV7A 3T0BA 3L66A 3OA3A 2CZDA 3WMCA 3CWNA 2D2OA 3WELA 4Y6GA 3W7CA 2A6LA 3IJ9A 4A8IA 2A79A 2WM0A 4DI9A 4K6AA 3SUWA 2Y8KA 3HJZA 1E9YB 1ZTVA 4CU7A 1WUFA 1GGOA 1HJVA 1R3YA 1AFSA 3PTQA 4RE0A 3VD7A 2CZEA 3SUSA 1BGAA 1CXEA 1ODUA 5CG0A 4M51A 4CNPA 1DVJA 5CC6A 3PWAA 3FGCA 1R9ZA 4GCXA 2X16A 3LLFA 3R58A 4ONVA 4QNWA 1E56A 4IHCA 3ZLHA 3WQFA 3DDMA 4LY4A 3KRUA 2CLMA 5A8NA 5BOEA 3BLOA 3KP1A 3VFCA 1AQFA 2H9AA 1ITUA 1JL8A 1KCZA 1HZYA 1GYLA 3WQWA 1I2RA 3KRZA 3DBNA 3ZMRA 1H50A 1ZAHA 4UTUA 3W83A 2I7GA 3SCOA 1DIOA 3BJFA 4WJ8A 1KC7A 2J24A 1V5XA 2WB5A 3HG4A 3TMLA 1XIEA 4K36A 1V6YA 4LF1A 1XBVA 1GJPA 2IUZA 3BWWA 1A3XA 1M1BA 3RX2A 2IKJA 2GWGA 3SJ3A 2X7VA 2WHLA 1HNYA 1TB3A 2NQ9A 3MMUA 2O9PA 5MKGB 4IJRA 4CEUC 3G0UA 2IMRA 1TRIA 3OW1A 4C6CA 5D8ZA 4YYFA 4QS5A 4AIBA 4D6HA 2W91A 1JYXA 4X2RA 3QZAA 2RDXA 5A6TC 3WNKA 4JX4A 1Q5MA 1EGMA 2QULA 2ZZ3A 2B7OA 2YX0A 3KEHA 2DZUA 1WUEA 2OEKA 2PLCA 2BFGA 4XZHA 3SFKA 1IXQA 2OQLA 1GYMA 3UG8A 4AMAA 3QXBA 4AXNA 4A3RA 4L56A 1PAMA 1TWSA 4J2PA 1W3KA 1DQUA 4ZB0A 1PVNA 4GBDA 3GG0A 3RMEA 1GOMA 1CT5A 2CCRA 1HO1A 1WOAA 3OGVA 1H63A 1R3SA 3SADA 2V8ZA 2F84A 1HGWA 3CZKA 3RCNA 3QQ0A 2P76A 1FWTA 3WK2A 4HZ7A 4JHOA 1R30A 1CW2A 1VQTA 2J47A 4HCLA 1XIBA 2Q09A 3U4AA 3F03K 3T1GA 1Z8AA 1P7TB 1PUDA 2FVMA 3T55A 5CAKA 2OELA 3EWWA 1DWFM 4AY1A 1KCKA 1S2VA 2OPJA 3SCNA 3WQVA 1PX8A 2V9DA 3DFNA 4LUSB 1XGDA 1R85A 3K4AA 3GG8A 2FZ8A 1FVPA 5FEPA 3RCYA 1X7IA 5AFDA 3RUBL 1K7FA 1CGWA 2HV5A 4F3HA 1KFKA 3DXIA 2HVOA 1RLCL 1R8LA 4OZOA 3CL7A 1MDRA 2PWVA 3CAKA 4FR1A 1FFQA 4JEJA 4NAFA 1BYAA 1KR1A 4L1WA 5EMKA 3UZYA 4ZGYA 3OLEA 1ZUAX 3WF3A 3K1GA 4YMZA 2H90A 2PDPA 4O0KA 4LS0A 1ZCCA 3G77A 4ACZA 2EAWA 1TTJA 1SM9A 3KVJA 4G7EA 4XISA 3VDAA 2EF9A 3CHDA 4DXKA 2JKEA 3W4RA 1UW9A 2ZRVA 2YW3A 1H7XA 2PRMA 3DHFA 4GACA 2WK2A 3QQWA 2J8TA 2ZA2A 1JNDA 2WSPA 3V1HA 2QJGA 1UC4A 4JQ3A 3PG8A 3CZEA 5XINA 4A3HA 1V6VA 2I57A 4RNHA 5BMWA 4AWTA 3A21A 3C4UA 3TSMA 2PDHA 3KHDA 2A3CA 2HCVA 2E9LA 3W7QA 4WY0B 4LUJA 3MUAA 3MA8A 4UFJA 3CHVA 6PTDA 3CO4A 2V5KA 3HA1A 2WLZA 3UA4A 3ALFA 2JK2A 3P80A 3DG3A 4QJ4B 3WLPA 3W86A 1JXKA 3CV2A 3NZPA 4GC4A 3BQ5A 3NL3A 2PDGA 1UZ4A 1ISZA 3BLFA 2WHJA 4DM2A 3W7JA 1H51A 1Q13A 2WZMA 2QCCA 3BOXA 2XVLA 4A8LA 1VGAA 3N17A 3W72A 3GIQA 3ARPA 3A4XA 3AUJA 1LT7A 4K7VA 5D9NA 5CZSA 4AEFA 3WBXA 3RYSA 4IP5A 3V0UA 2GDUA 3UNDA 3RPMA 5A2CA 1QNQA 1U5HA 4AW7A 3N9RA 4ZQMA 5LSMA 1SZFA 2Q8XA 1JPKA 3GXDA 3M9YA 4RR4A 1GVIA 2QGHA 4X3ZA 3KE0A 2DUZA 2IPFA 1LG1A 4IIDA 2XH2A 2XZ7A 1LM1A 3CZGA 2ZWZA 3CMJA 2GJRA 2VCBA 4O8RA 1O6IA 5HR7A 5LKYA 1K03A 4M24A 1AZ2A 1TJ2A 4HK5A 3CO8A 3E96A 3DAQA 3EDFA 5BXTA 2DVUA 1V3JA 3VX1A 3QM3A 3S83A 4IWWA 3H26A 3OBAA 2ZA3A 4UR7A 3GTHA 1JCTA 5D2VA 3TKFA 1BXCA 3AJXA 4EF8A 1FDZA 4QQ3A 4KRZA 1FXPA 1E1CB 3TTOA 4ERGA 3W2KA 3CUZA 1T41A 3N4AA 4AX6A 3KOFA 3NQEA 4RZ6A 3AIWA 3VDHA 1R5YA 4GUIA 1VFHA 1FOBA 2XIOA 3N4EA 4MJ4A 3FY1A 5AC8A 2JEPA 5CZTA 2A85A 4C65A 2VXNA 3ANYA 3AYTA 2XUCA 1LL7A 3HO8A 5XIAA 1EJUC 3P0WA 1GTEA 4Q7IA 3SQSA 1RCQA 1U5VA 3ONCA 9XIMA 4FR6A 1Y65A 1PZ2A 2X1UA 1TVLA 3SY1A 1F6KA 4ZTYA 1REQA 1YNQA 1CYGA 1IE7C 1SFJA 2WPGA 4QFUA 2XSAA 4EANA 1AG1O 3WZ0E 1TWWA 3QFWA 1EZWA 2D23A 1J0YA 3EAUA 4C6PA 3W7RA 5G2WA 3UCDA 2FVKA 2F6UA 3ZVHB 2TMDA 4JTJA 2C13A 4UWMA 1S5WA 2JGQA 3ZIZA 3F4VA 5FD0A 3R1ZA 3EPNA 1EQPA 4D6CA 3ATZA 2W27A 4PRWA 1OB0A 3CB3A 2Z25A 2PD5A 4O1AA 4Z1DA 4IPNB 5DANA 2LLEA 3O6DA 1M68A 1UKOA 4PCTA 5AYBA 4Q6XA 2XN0A 3CUFA 3DECA 1PEZA 2VEPA 3S1GA 2BGNE 3M0JA 4U31A 1YE6A 1ZHAA 2EEXA 4Q8TA 1J2WA 3I7QA 1TJ1A 1FCBA 2PI6A 5HPOA 4P8WA 3PJTA 4XB3A 4P7LA 4GKLA 4IZGA 4O10A 1P6CA 1FWGC 4IIBA 4AY8A 3G1FA 4NVTA 3KXQA 3SRHA 3OO2A 1O5XA 3FA3A 4LGXA 1CXIA 3PZUA 5DCDA 1JPMA 3RLUA 1MW0A 1OIMA 1ZNNA 4G1NA 2WMKA 1XW8A 3LCHA 2J6XA 1C9WA 3MJYA 1FKXA 2UY5A 2PF0A 4TX8A 2Y88A 1US2A 4M5PA 1NWTA 1W8SA 1WOBA 2V5JA 1HP5A 1H49A 4NU7A 5LGXA 1IXPA 3L5AA 2X42A 3TH6A 3RM4A 5MKGA 4AZIA 1NQ6A 3WLMA 4XG1A 5E5CA 2OKOA 3PUDA 1QI2A 5TD4A 1QI4A 3DOPA 4KWOA 1H61A 2VCAA 2J75A 4Z1CA 3XIMA 2XN1A 3A9IA 3HURA 1O1HA 1Z42A 2QV4A 1LJYA 1Q6CA 3C56A 5FEZA 5HAOA 1S1RA 1EL3A 2C1GA 2XFYA 1WB0A 3LPPA 4JFWA 2J8FA 2VX4A 1C91A 3A4JA 1IGWA 3F5JA 6ENLA 1BWVA 1A0EA 3ZT6A 2WNQA 4HMEA 3QSTA 3OP2A 1UP0A 4NZJA 2SFPA 3MB9A 3G0XA 1J0ZA 1JIBA 1UIPA 2GL5A 1W17A 3VNJA 3DH7A 3TC7A 1B3OA 1Y5VA 1NDZA 5J5RA 3BLKA 3DHUA 5CSRA 1DJGA 1Z6KA 4KW2A 4W89A 3IARA 5AYYA 2XJ7A 2E1WA 1DV7A 3E74A 4PMJA 2H3DA 4FF7A 1HW6A 3MMDA 3G3MA 1RPXA 2WAGA 3BOFA 1P7TA 1EC8A 2DY3A 2EPNA 3I3EA 4O28A 1BYBA 3EMZA 1GTHA 3APGA 1O5QA 1UD2A 3N2MA 5A2AA 4JKKA 4XBKA 2A2IA 3TCSA 4JIEA 1GT8A 2DH2A 4CD5A 1FA2A 4YVPA 3RIKA 4I9MA 4L6HA 3LHUA 1VAHA 4OE7A 1GOOA 4LX4A 4PEKA 3H2OA 1K8ZA 4GNKB 2B0MA 3A6OA 3MC5A 1X8FA 3N6JA 3PZNA 3W37A 1Q45A 3M5YA 3CTLA 1UKPA 4HN4A 4K8HA 5D03A 3WBYA 1ECQA 3R4IA 1B0IA 2Z2AA 1QBBA 2VP8A 3TW7A 2QPXA 5LXXA 3NQ2A 4M7TA 1E4IA 1Y5XA 1YADA 2GGEA 1PYMA 3G0SA 3H2CA 1W9DM 4H41A 1W9PA 3V5CA 3PANA 3UFYA 2C19A 3E0VA 3UR5A 5HR6A 4I8DA 4DB7A 2VURA 4NG3A 4WR3A 3FJLA 3VIOA 3G1DA 2Z1WA 4B9YA 1QO5A 2VR5A 5EBUA 1IWAA 3LXBA 2ICSA 3VNZA 2X1RA 3QMSA 4WY0A 2PTXA 4JHZA 3O6CA 4KBXA 2R1NA 4IPJA 4C6DA 2IQ0A 2QVNA 3HGRA 5JIPA 4HP5A 4PMQA 2XGIA 2E6FA 1PYFA 2PWUA 1E43A 2XIBA 4GGBA 4JFVA 3WJSA 3V36A 3VE9A 3ARTA 1Q63A 1WZLA 2D20A 3SN0A 2I9UA 5CPSA 2VEGA 5CPLA 3S5ZA 2FGBA 3UGVA 4KPLA 1DE6A 2J7HA 4IP4A 3UPMA 1LRNA 4NI8A 5CPOA 1UG6A 3CIWA 1NELA 1PZ0A 3TK7A 3UWYA 4UQDA 2PWHA 3AS2A 4UTFA 3H12A 2OOFA 4MKVA 4J35A 2WNNA 4D6EA 4O16A 1YKWA 5CGMA 1I60A 4LUIA 4EKJA 1BXNA 1VP5A 3PS7A 2INZA 2WVSA 4KQNA 3WYZA 3BUVA 1IXOA 4LBRA 1Q6LA 1X6UA 4Y9OA 4HIBA 4KT2A 2EQDA 4ZBCA 3HGJA 2PWGA 1BFNA 5D33A 3G8RA 1V02A 1H41A 4JNYA 3RFAA 1SR9A 1TUFA 1E1CA 4Y9AA 1DL3A 3LCIA 4LU0A 1POJA 3QJAA 5FJOA 2XPKA 4Z2LA 4O12A 2XH0A 3P7YA 3GTXA 2VOMA 2GJXA 3URNA 3EX4A 3TJ4A 3OVRA 3NQFA 4PUUA 1UP3A 5BOOA 4CCEA 1Q6GA 1EB3A 2EPOA 3R7MA 3C5QA 5D2XA 1UR9A 5BRQA 2VUNA 1TA3B 1JD9A 1Z41A 3H23A 4NJKA 3OODA 3TWBA 1XP3A 3LN3A 4CNSA 1JRCA 2YL6A 3OA5A 1MEHA 5LIYX 3VMNA 3CPGA 1JNEA 4WF7A 2OSXA 3CYJA 4XZBA 2YJQA 3E2QA 4GVGA 3IEBA 1VF8A 2BGSA 4W4QA 5C8BB 1NDWA 2QZRA 2QUTA 1B3ZA 2PFHA 2EJAA 4DJDC 4MTVA 3BANA 1LRQA 4RNJA 4J4KA 3HTWA 3TNOA 1V6UA 2A3EA 5C9XA 4C6JA 3ZVHA 4KWUA 2JIEA 3S5SA 1A50A 1DQXA 3INPA 4UFMA 4GUGA 1GQLA 3VZYA 2FDMA 2QGYA 2RAGA 3C3UA 2ZUMA 4N4QA 3VNKA 3AYRA 3U2ZA 4DBUA 3T7VA 3T2OA 5CAHA 5DLCA 2E9MA 3I10A 3L23A 4K38A 5K3VA 1E6QM 4Z2GA 3ARXA 5BU9A 3LHTA 4MJ2A 2Z00A 4H00A 1JZ8A 3T44A 4GJIA 2DSVA 1IQ8A 3N1AA 1UMLA 4UMCA 3C52A 2HS8A 4H83A 2JBMA 3FVDA 4I9JA 2WLYA 3LRMA 4DZHA 1W1TA 1PBGA 2B7QA 1RA5A 3SCWA 1UASA 2JF6A 3M6DA 4GLEA 3WLSA 4LYPA 2I9EA 4PUDA 4W88A 2WMHA 1SJDA 2E40A 4AU0A 3C86A 1WDWA 4HTBA 3ITGA 3KOWA 3WH7A 3TLQA 4KH2A 2R94A 3MV01 1L8NA 5I6SA 2HPIA 3U2EA 4B9ZA 5CEWA 3NO3A 1KLYA 2OR2A 1VEOA 3HZ3A 3BGJA 4QEHA 5AVHA 1TFVA 3OG2A 3WDQA 5BYWA 3FXGA 4RE2A 4GY7A 4KFNA 4LEFA 5K9CA 2OYKA 1QUMA 3SQMA 4Q8OA 3TTQA 2XVNA 5KTLA 3B4YA 3I6EA 1MW2A 1TV4A 1NY1A 4B5WA 2YFNA 3EA2A 3R2GA 1PKYA 1U2YA 4C6EA 5FL1A 2XZ9A 1CGTA 1OFQA 2C79A 1OK6A 4IQEA 4RDVA 1V51A 2GSHA 3UGRA 1JULA 3GHRA 1QW8A 5G4EA 3F2BA 1P0DA 2XGBA 4IGNA 4KWVA 4G9PA 1VFMA 4DPQA 3B0VC 2WZEA 4PCNA 4PSPA 2A1YA 5C71A 2DSUA 3W88A 4XSLA 2FPTA 1OG6A 5U4NA 3EMQA 2GQ9A 4MGGA 1QHPA 2TAAA 1C92A 1MNSA 2DT2A 4O57A 5DRCA 4CGTA 1R46A 1GW9A 2Y85A 3EDKA 3WENA 3W2MA 3H2FA 5IM51 1H11A 3NA8A 1E0VA 2F61A 1MRAA 4W7UA 1J0IA 1EJVC 4RK8A 1LROA 3VGBA 1U1UA 1CX9A 3CJPA 4MPKA 4PMVA 1JUEA 3S8HA 3CHCA 1LLZA 3O63A 3CWHA 4JY9A 3GSMA 5G2IA 3W07A 3WFLA 3IJIA 1EBHA 3FHAA 2G8ZA 3VIIA 2R9RA 5BXRA 4YTQA 4KKXA 4GINA 4TMBA 2XWEA 5LIKX 1HJXA 3WDIA 1QFEA 3N2BA 2FZDA 4PGLA 2ANUA 3PUEA 4QDWA 4U10A 2PB1A 4E2OA 3ITXA 4CQDA 1AH0A 4D6GA 1EXBA 3MHUA 5K2ZA 3MSGA 3JVAA 4UQEA 4EOUA 3N2CA 5DXXA 1TX2A 1DXIA 3GH5A 3BAJA 3RHGA 6CGTA 4LAKA 1QHOA 4J3ZA 3R94A 4WSKA 4IL2A 3IV8A 3PBMA 2DJLA 4DJEC 1OGSA 2WQDA 5DCEA 1EGZA 3IPWA 1EPVA 3GG7A 2O92A 5GJMA 1C7TA 3VNDA 2ISSA 3UU0A 1LYXA 2OU4A 1OZQA 3UPWA 1G69A 1I4NA 1TZZA 1UP2A 1BGGA 1LCOA 4DLMA 1S2CA 3ELFA 2GGGA 1YW1A 5G4WA 2PZ0A 3GNNA 3L5LA 4CQ9A 2YXOA 3GC5A 1S2UA 5I79A 1M7OA 1O66A 2E3ZA 3N4FA 2CWXA 2ZZ6A 3EKZA 4UFIA 3NDOA 3T81A 2CLLA 3GBEA 4E0CA 4PRTA 2W61A 4MWAE 4WHBA 4OVXA 2DVTA 4QE5A 3S4TA 2A7RA 1KWKA 1A4LA 1JGIA 4H6EA 3FYOA 1SZEA 4F40A 2C18A 4QXIA 3L65A 4DJDD 3VM7A 3ABXA 3MVTA 4RL3A 2ACUA 4AWSA 4DNMA 4K68A 5HUOA 3RN6A 2KAUC 2WMIB 4IPPA 3LV5A 1XG3A 4LALA 1JDAA 5IHRA 2D3LA 4DWSB 3UCCA 4AB4A 5AVNA 3FDKA 2D2GA 4FI4A 1X6NA 4JCLA 4C7GA 3BG5A 4L9ZA 3EYPA 2YB4A 5HQLA 4PTVA 4O54A 1R3TA 4H9YA 5DF0A 2CW6A 4S3BA 4DWSC 1TJPA 3DI1A 5A6BA 4GYKA 4GQRA 2JKAA 4XK2A 4X63A 1UWRA 4B3LA 3TN6A 3TZFA 1FWRA 4IMAA 4L4OA 1ZALA 1F3EA 3QZEA 1HQTA 5FJJA 4AC7C 7REQB 1P0NA 1F3TA 3QW3A 4W93A 2VWTA 1VCVA 1Z44A 3DKJA 4N42A 2X41A 1S38A 1K77A 2BHYA 2HMCA 1E1FA 3AOFA 4QG6A 2PDFA 4X9YA 2PDUA 1E5NA 3VC5A 1WAWA 3VI2A 3D0CA 2F8QA 1VCGA 5EA9A 2J25A 4F0KA 1ME8A 1QNSA 1EP2A 5D37A 1UB3A 5ABTA 2VMFA 2JQXA 4LY8A 1D7FA 1CLVA 4B5XA 2EPKX 4PCSA 4J28A 3WBAA 1GVOA 2X0YA 2G3MA 3TAOA 4A3YA 1JEZA 4JFSA 2CZFA 4CCCA 2PGRA 3QLLA 3MUCA 3GFZA 3AHVA 1ME7A 2XWDA 4JL2A 1UH2A 1TA3A 3N11A 4N6FA 4Q6JA 1W0MA 1TX0A 4JBRA 3NTYA 3QV7A 3GTFA 3LU2A 5FAJA 1KTNA 2B7PA 1L2QA 2ZUVA 4X2PA 4LNCA 4L4MA 3WO8A 4HNUA 2CLPA 4QBXA 1VEMA 4BI5A 1LWJA 2XSBA 5AHIA 2WMGA 4RV8A 3CL8A 1RQBA 1GW1A 1OJXA 1V3IA 2VFIA 1OX4B 4DBWA 4S1FA 3QYQA 1XH1A 3BZGA 3CUHA 4HNCA 4C1KA 1FWNA 4ORMA 3W23A 1GZ1A 4LVAA 2O9OA 2AL2B 1M41A 2VJXA 4I8YA 4ZO9A 4YLWA 3FSUA 4UBPC 2JF7A 4QGCA 4F79A 5IBXC 1FHDA 1KM5A 5M3WA 2EG6A 2YDQA 3BLIA 3O05A 1W5NA 3R5EA 4JNMA 4UTLA 1PIIA 1WE5A 1XIJA 3GUWA 4NJJA 1YYAA 1W9VA 3GVQA 3M64A 3DERA 1ZLPA 1X97A 3HB9A 4U2YA 1HJUA 1PTGA 3AMKA 5I3GA 3BJSA 1CDGA 1IEVA 4W7VA 1V03A 1XGEA 3FVMA 5E1QA 4Z1AA 4HPNA 3TR9A 1AJZA 2E5DA 3FNDA 3SCTA 2J8GA 3VCCA 5ECVA 4N9DA 1RD6A 3WBWA 1UUMA 4PMRA 3VX0A 2XHYA 3BL3A 2PGFA 1VBJA 4YWSA 3NQBA 3GXTA 4GGHA 5CSUA 2PU1A 3KUMA 1B4EA 5DT7A 3KWSA 3NQ8A 2E1DA 4F8XA 1TTIA 4HT3A 4LJ3A 4OV9A 2NVDA 4DO5A 4DELA 3G6MA 2X2GA 2J79A 4HHPA 3ECQA 3FJ6A 2R1LA 5CPNA 3W7MA 2WBGA 1XLGA 1XLMA 3M0HA 4ZQCA 2XH4A 3TFXA 1RP8A 4QSFA 3FA5A 3GDKA 1OD8A 4OTKA 3FHQA 5HNTA 3W76A 2EO7A 5JMUA 2FFIA 4O0QA 4RDZA 3BCDA 2BVTA 3AIRA 1UD6A 3QGVA 2Y7EA 2ZBTA 2DW6A 4QAIA 3YPIA 1PWLA 3G1HA 1OCQA 1DWJM 1AQ0A 3KDOA 4RKAA 1M01A 1KXHA 1ZBCA 4PA8A 1RXOB 3M5VA 2WVUA 2P53A 4W8AA 1SW3A 3NM3A 5D05A 1AQHA 3WK1A 1JCXA 3FEMA 1UIOA 3TQVA 1XM3A 3GHTA 2ZCGA 1GVEA 3TLLA 3SW6A 2OQYA 3M07A 2O9RA 4JYDA 2YGYA 1O5KA 3H7VA 4PULA 1QI3A 3FCPA 2AGKA 3C8NA 5CC5A 2V2HA 2OWWA 4PCPA 4S3FA 4ADSA 1H1ZA 2QF7A 1ADDA 2ZE0A 3MVIA 3CZLA 4JXCA 5LYRA 1OCNA 2O4QA 3PJXA 4XZMX 3NL5A 4K1GA 3ZFHA 3W7GA 3GFYA 1TJRA 2HEJA 3UXAA 2NW0A 5A6KA 2W4XA 5KZDA 4DWSD 4H04A 1E9LA 4PH6A 4AZCB 1QDSA 2VGFA 4MDOA 2WJZA 3QW4B 1KBJA 5D30A 1V6XA 2XINA 3O7UA 3E02A 3UZ5A 4DJEA 1SW0A 4UOZA 2XVPA 2P88A 3C2OA 4C1NB 1QK2A 3NDYA 5E70A 3V18A 1DBTA 1FCVA 9XIAA 3WLJA 3BSMA 3C0LA 3BARA 3CASA 4F48A 3GNPA 1UUQA 3O6YX 5JH1A 3DFSA 5H6HA 1E6NA 3S2NA 3ES8A 5A5WA 4PL1A 1BYDA 1H3GA 1OK4A 1UQZA 1GCYA 1KV5A 2I1OA 5E0CA 4POCA 5T26A 3P67A 1TQJA 3EDDA 5EL1A 4O52A 2WJEA 2CWNA 1Q4WA 4Q8MA 1Q2SA 2OWXA 2WMFA 4Z2IA 4Q7NA 5MF5A 1EKOA 1RCXB 5IXEA 3WQEA 2GJNA 4C6IA 1GPWA 5AECA 4IMCA 3UZWA 2XIIA 2D69A 3A22A 3EX1A 1W3TA 3THDA 5A8OA 1Q2RA 1UUOA 2P3EA 4I9AA 5HDRA 3H2AA 1H0GA 2FTYA 4LFYA 2NUWA 4XTDA 3WLHA 1P6WA 4FX8A 4U3CA 1FWIC 3TYBA 2VELA 1EHNA 1F05A 4AC1X 3DN5A 4CNUA 1XYBA 2GPTA 4GFIA 2WMIA 4MYAA 2V5DA 2DP3A 3GC2A 1US0A 1VFLA 3VDGA 4R33A 4TTGA 1GKPA 3KVKA 1P0EA 3U48A 1US3A 1YQ2A 4PUJA 5I3KA 4HNNA 3TJIA 4CD7A 4HMNA 3HM7A 4WJXA 4MWAD 3RMJA 1OGGA 1EJWC 4DZAA 3ALGA 2V6AA 2YXXA 3W26A 4GD0A 1XLKA 2ZC8A 2GOKA 1QO2A 1TV2A 4WDUA 3CK5A 2EPHA 3CHFA 2CLHA 3TP4A 3K5XA 1UC5A 5KMYA 1WDDA 5H1WA 2WCGA 3BLPX 2FZNA 1YTKA 4W86A 3KLKA 3QY8A 1E4LA 2B81A 5E09A 3TN4A 4C5YA 5M2FX 1FCUA 1JCMP 3TOPA 4E2DA 1YXYA 2PP1A 2W3ZA 1CGYA 1G0CA 1W9UA 2V68A 1D3CA 1B5TA 2A3LA 4UZSA 4R27A 4JDYA 1CENA 3SRFA 3S9IA 4QLKA 4XUYA 4L5ZA 4B3KA 2VEMA 1FX6A 2BDQA 3CIVA 3V5FA 3T0AA 3ABQA 3ZJ7A 2ZUSA 3TV8A 4YS1A 3PWIA 3B40A 3VK5A 3GU2A 3W71A 5AC6A 3G3DA 3TSDA 3WLRA 3T08A 4UIOA 1X1NA 1UR1A 5LNUA 3TN5A 1V0LA 2AMGA 4JHMA 1VRDA 1RZMA 3BJTA 3F4WA 4ZQRA 3LHZA 2HK0A 4HYVA 1KRMA 4IJCA 4NF7A 4E5TA 4GC3A 1CLXA 3GVVA 1VPYA 2W92A 4MPQA 4URIA 1B9ZA 3WJZA 1ELSA 4P7QA 1EC9A 3EA3A 3LOTA 4Z2KA 3T2QA 3TYAA 3E5BA 1Q7ZA 1OX4A 1QNOA 4JIHA 2AKZA 4REQB 2F6KA 5I5RA 4O8AA 2IXVA 1DWHM 2C6QA 1UA7A 1EA0A 2GGHA 2AL2A 1MUWA 1U30A 5A6LA 1AMYA 2WKLA 3P74A 5HNRA 2X8RA 1CXKA 1F3WA 2NV1A 3U8GA 1U1HA 2J7CA 4CQCA 1EP3A 4TVCA 7CGTA 4H8NA 4KGJA 4AZ7A 4GY1A 4J3XA 4GCAA 1VJIA 4KS0A 5HA7A 2NZLA 4IQDA 4JTEA 3B8WA 2Y5JA 1T40A 5EMMA 4QJ3B 1NH6A 4I6KA 2C8NA 3MU7A 1CWYA 5JIWA 3W1LA 5BWFA 3I3DA 2G3NA 1CB7B 1DJIA 2BOEX 2VD8A 1FWEC 4JZ5A 4HSOA 4HA3A 3CC1A 4MY9A 2PDYA 2HNHA 2ZA1A 4H9UA 2YPIA 1HL2A 1H60A 1D8WA 5LNVA 1F7BA 3U2CA 1MZRA 3ZR4A 3BVJA 2RJHA 4GO9A 5F2MA 4JCMA 4B5TA 2R1KA 4H8VA 3ZT7A 1E5JA 1G94A 1ZBKA 4QJ5B 1ICQA 1XLBA 4R7WA 1OHLA 5EGRA 2UBPC 3CUIA 2QCDB 5AZ0A 4ML9A 1EZ2A 1L6GA 3TC6A 4AHPA 4TVUA 2HNEA 2VL4A 2V5BA 2VC6A 1JI1A 1BVZA 3STGA 2IXUA 3E3HA 1XBYA 2Y5EA 3OZOA 5B7YA 5CBJA 2PE4A 4C6BA 1VFSA 3WLOA 1U33A 5AHNA 4FOKA 3RM8A 2CEQA 4QE1A 4HA1A 2QCEA 1JXJA 4HCHA 3R6IA 5MHBA 2V3FA 4NJGA 4YNGA 1HVXA 1NTHA 2BODX 4N0RA 1XYMA 4GUJA 5F1UA 2CNCA 3WUFA 3UBPC 1MZHA 1F73A 3GTIA 1KGWA 3L2MA 3TA9A 1AA1B 1V0MA 4QCEA 5EMLA 3WUGA 3SGUA 3L67A 2DZSA 3LI1A 3PK7A 1AW5A 3ONBA 4D2JA 3ARSA 5BCAA 4O4VA 5C0QA 4H9MA 2RHGA 3M0YA 1XLIA 3SAZA 3REQB 2WZTA 2ISVA 2WVVB 4YVXA 3W85A 4H9VA 3OGRA 1J10A 3UCQA 1RALA 1SSGA 4GNJA 1I0DA 4BCEA 2VGBA 4QP0A 4GQBA 4AD3A 3VCNA 1WXZA 3BLLA 4US5A 3THQA 3QF0A 3NQAA 5LNSA 2WC3A 2G50A 2XIJA 4HK7A 4XBJA 4H6RA 3GH7A 3IIXA 4D6IA 2ODOA 4H6QA 2Z1SA 1PJ9A 3F7JA 3WD2A 3TMQA 3Q65A 1FH9A 3SBFA 3RRAA 4GG9A 1BG9A 1RR2A 1PCKA 3L12A 4WKFA 3UT0A 4NRRA 3FKKA 3SCRA 3ATYA 4EAYA 5D2WA 1PTDA 3AHXA 3NOEA 4X0NA 5FJUA 4C1NA 3MUXA 3FK4A 4TX9A 3CEPA 3AFBA 3E0LA 3IS4A 2W9MA 2XFWA 1XIHA 3GR4A 2V67A 5A2BA 1CCWB 3P62A 3SY8A 3VOFA 3WL0A 2QDGA 2CZ5A 4HBKA 2JEQA 4ROPA 3WLQA 2YBVA 3NIYA 1VEPA 4AD2A 4K37A 3WK3A 1IEXA 2Y7DA 2H3BA 3PZTA 4NXKA 3P84A 3QMTA 3PAJA 3AALA 3AZRA 4M80A 1BKHA 3WSUA 2EXOA 4O1BA 3TE9A 1G67A 4IG2B 2I17A 5D8WA 1SO5A 1QT1A 3TOYA 1NP2A 2CPUA 3L9CA 1N8IA 3O2LA 3AISA 4WJEA 3ERPA 2YCIX 1MMFA 3LCLA 4IUOA 4C6QA 4A21A 4ALDA 5DY2A 1VR6A 1JR1A 3NWRA 1YDYA 3TX9A 4WQ6A 2OSWA 4MB3A 4E3TA 4GA8A 4LNYA 1THFD 3P60A 3BMWA 4XAYA 1VBRA 1QOXA 1N7KA 5GJNA 2OKTA 1CI1A 1W32A 4LSBA 1X96A 2XYLA 3W2UA 3CUGA 1EWDA 4XO7A 2INFA 4YTTA 8TIMA 3AMDA 3PSVA 3PNUA 1KBKA 2FKPA 3MW7A 5AB3A 2WHMA 4UR9A 2HWGA 3AU2A 1JAEA 4M8UA 3VNYA 1V3MA 3ME3A 5LA0A 3IVSA 4V15A 1ZBWA 5FF4A 3GXFA 1UKSA 2VGGA 1SU5A 5T8GA 1TPDA 2ZXBA 5T9BG 3FIGA 3WF0A 1XD0A 3TW9A 6REQB 1E0UA 4ZTXA 2REQB 2B31A 3DFYA 2OZ8A 3BSGA 2YZ5A 4A35A 5C2XA 4NKCA 4IFOA 4P8VA 3VGHA 2E28A 1WV2A 1MQQA 4FAMA 3L5MA 1WA3A 3S1XA 3VKKA 4BR1A 4RW5A 1MRQA 3MQTA 3NQCA 3PNZA 4WOZA 3KBVA 5D4YA 3VKAA 2VC5A 3W1AA 4NX0A 4BQ3A 3DU0A 1RBAA 1XLFA 4H2HA 5REQB 3ZVIA 4P2VA 5CJ5A 4PR4A 1S1PA 3LMYA 4KMQA 2HROA 4E2VA 2F6XA 3S6DA 4YN5A 3NURA 1S5VA 2CLEA 1KQYA 3M0ZA 1O95A 1W6TA 5IFTA 4Z2JA 3GS6A 2OOGA 4PMXA 3IAPA 1OWQA 1F2JA 1O12A 1UWAA 4OUIA 4EX4A 2WW5A 4JTFA 1WDSA 2J9XA 4Q8WA 1NFBA 4LPCA 2CZVA 3ORWA 2QUNA 4QQUA 3IIVA 2X30A 2FGLA 1MNZA 3AO0A 1O5RA 1OCJA 4EPBC 1CXFA 1QAPA 4DLFA 1EIXA 3IIOA 4MFEA 4ZE5A 3EMCA 3LQLA 4ICNA 2BOFX 2BV9A 3AHTA 3VDCA 4AX7A 2GVGA 4N9BA 1GVRA 4MYXA 4O14A 2OODA 3LX9A 4ASTA 2C15A 1V7YA 2XFFA 2RFGA 1JI2A 3PZOA 4WGXA 4AIEA 5A6AA 4REQA 2ZQ0A 4CKQA 1EYEA 2V2DA 4KERA 1E1EA 3Q4DA 4HU0A 4S38A 3NPXA 4OHQA 4S3KA 2AQVA 1R9YA 1KTCA 1QOPA 2GUUA 2V30A 3G24A 2WC4A 2DGAA 2EG7A 3PHAA 3N15A 1VIWA 5C70A 3TZNA 4E4FA 1W5OA 3PZGA 5C9WA 5TAOA 4A6GA 1J18A 4IXXA 1UD4A 5DCBA 3SB0A 3BGAA 4NZ1A 4FNUA 7XIMA 1DTNA 1OYCA 4R7OA 1EEPA 3ZYZA 3TYDA 1H7RA 5G1TA 1H2JA 4ML4A 5IHSA 1Z89A 4UUIA 4F9JA 4MM1A 2OSYA 2WWCA 3CQKA 5D9PA 1KA9F 1QVBA 3TYCA 2ZFAA 4KIEA 4HSNA 3OVQA 4UTTC 5K9DA 1IIHA 3L4VA 1J6PA 1I45A 3UP8A 3WX7A 4LS1A 5I3FA 4OBSA 2YA1A 3A3WA 3PB2A 1SMAA 2MANA 3TA6A 1KGUA 1NAL1 2OGYA 2PDXA 3DFPA 3V16A 1R2RA 3SCVA 4WXZA 3KOXA 2KX9A 2QCDA 4DEFA 1M3UA 3WNNA 3GXMA 5FF0A 2ZDRA 3EZ4A 4UTWA 5I7GA 1EYWA 2G41A 2RDUA 3UF9A 3W7EA 1I8JA 1K8CA 2ZRUA 1E70M 4XSMA 3TSBA 1PIGA 1PV8A 1TPFA 1W1B1 2BY0A 1H1NA 3AIVA 4AZBA 3LUTA 3WCZA 1DEDA 1GPFA 4QG8A 1LF1A 1IYXA 1XICA 2JKPA 1H5VA 3E5PA 4NX5A 1C8YA 1VHNA 3VNIA 1Z9AA 3BW4A 4N02A 3UZZA 5AZ1A 4RPQA 1WXYA 3UR7A 2BHZA 4IX0A 5HMEA 4HU3A 3VAVA 1CEOA 3B03A 5KZMA 4MDPA 4QRNA 3QPYA 1BYCA 3V5OA 3GDRA 1RJPA 4O1DA 1TV7A 2ZXQA 3E0IA 5DT5A 1A0DA 3S5NA 1KRAC 3W1RA 1GK8A 2DZTA 3NGFA 1OT1A 3A24A 3OYXA 3REQA 3FS2A 4OOZA 2Z1BA 2WVVA 4NAFB 5DQPA 4LCSA 3LBCA 3IK4A 1V77A 4A2RA 4XO6A 2PBGA 2PPGA 2PA6A 3LV6A 3U5UA 2XDFA 2DZXA 2EPLX 1V0NA 3V0SA 1GKRA 1IT8A 2DFAA 2UY4A 3UZXA 3QR1A 2E09A 3LLDA 3VTRA 3WF2A 3V4BA 3VIMA 5LHFA 3VZZA 1GHRA 1J4EA 4PYSA 4LTSA 1KRCC 3IK2A 3A12A 4GI4A 5C5YA 3GW0A 4GZIA 2ON3A 1EC7A 2FTPA 2PTZA 3W22A 1LOSA 2GJLA 4YJ5A 4NJHA 2X05A 2NVAA 2OX4A 4LEQA 3CM4A 1QU4A 1S3HA 3G1RA 4BHYA 3QBUA 3H4XA 5EMUA 3IJ7A 5HWNA 3VD9A 4AFYA 4IF2A 2WBKA 4IXHA 4B2DA 1Q6QA 4GZEA 3W01A 3B04A 1Z3NA 4GPNA 2C1HA 1LZOA 2AMXA 1HXJA 3LPOA 5E93A 2O7SA 1E40A 2CHOA 2WSKA 4I6VA 1JAKA 3CT2A 1WQ5A 2XG9A 3LPGA 4LXFA 3WEOA 1MSSA 4UQCA 4MNKA 3R79A 1E15A 4INFA 1Q4NX 4S3JA 1H0IA 2E0PA 4IG2A 2NT1A 1FWHC 4AIOA 1SYTA 1J0JA 3C3NA 1E3ZA 3LCWA 4Q8QA 4W5UA 1FHLA 2BXVA 4GYJA 1MQRA 3CQIA 2WSRA 2WMJA 3S2JA 3U2OA 1KW1A 4AZ6A 3TQKA 1YXDA 1TPC1 4F9DA 2WNZA 3W7NA 4IIHA 4Y90A 4DVOA 2FB3A 2PODA 4DJFC 3UJEA 4TO8A 2OEJA 5J8LA 1UR2A 4WSJA 3Q37A 3MDWA 2E6YA 4L6OA 2B4GA 2YFOA 4L4PA 1EDTA 4XWUA 4TVDA 3QLDA 1VJZA 2R6OA 3Q45A 1E0WA 3P5ZA 3VPLA 3WQPA 1FTXA 4E6MA 3IVTA 3SIMA 5KITA 3HG3A 3D6NA 2PDMA 4IPIA 1ITQA 4AZ5A 3W25A 3TW6A 3WN6A 3LPFA 2REQA 3LMZA 3OBKA 3GU9A 2CERA 3CLWA 1GVFA 4R5EA 4JS3A 5ABHA 3SSJA 5G1MA 3FEQA 1YHTA 3PP7A 1BEUA 1B30A 2ACSA 5EKYA 2BG5A 1XC4A 1UPPA 1HP4A 3EOEA 4YU1A 1HKKA 4YYCA 3UXIA 2VEIA 1UHVA 5FI8A 5T91A 1LQ0A 3EGJA 2OVLA 3OHMB 3I7RA 3KBMA 1HG3A 4LYRA 4AYGA 2E8ZA 3SY5A 3GR7A 4R9OA 4HU8A 3DYMA 1N8FA 3AZSA 5C9RA 4NJIA 2HE8A 3V35A 3IV3A 9RUBA 3M0IA 4AY7A 2J9YA 4DWDA 1MQPA 4ATWA 3WBEA 1RVGA 1IT0A 3H2MA 1HGYA 2XSXA 5G1YA 1XQKA 5A8GA 1V6WA 1HKVA 2CLKA 4BJHA 2DSZA 4IIEA 3BG3A 1KM0A 4X0VA 4AD0A 2CHRA 3F5KA 1HO4A 2NWRA 3JR2A 4I5XA 2Z26A 4K1WA 2IKGA 2Z28A 1GQIA 3NXFA 3SM0A 3E49A 2Y24A 2WKJA 4E8CA 1T6MA 1TUXA 1UMYA 3RCMA 1XLAA 2QW5A 3N29A 1BSIA 3FYYA 3N2OA 4V2XA 1TE6A 2XN2A 3AMLA 3F4NA 3W6MA 3W7LA 3A47A 2PRLA 1F5ZA 1SJBA 3MBDA 7PTDA 4AHQA 1VPQA 4R3UA 4ZCWA 1W9BM 2YDAA 3MUIA 1OG0A 5CPQA 3WLTA 1J0KA 1CGVA 1XI3A 3TDFA 1K9TA 2G0WA 4JN7A 5I24A 4GQQA 3UWEA 4KRTA 1W1ZA 2I5GA 3PJUA 4DAIA 1O94A 3R0KA 1WKFA 2YKKA 2XTKA 4W7WA 4PBGA 1L6SA 1MEWA 3K4DA 2D2JA 2G3IA 5LHEA 3NEHA 1GJUA 2WQPA 3M5XA 1PHQA 3A3HA 1NWSA 1XD1A 2F7FA 3JU2A 1IEIA 4HZ8A 5C9ZA 5FOOA 3P0XA 2DSWA 5JH2A 1XDJA 1XLJA 1PO9A 5TNVA 3KLLA 3ARUA 4QX4A 4NSBA 1WZKA 4UTTA 1RBLA 2JGYA 2DZVA 3W7HA 3P61A 2OZ0A 1HL9A 4NQ1A 3KCOA 2ZUTA 1XDLA 2PLKA 1SO6A 4C6OA 1FFRA 2BX7A 1P1MA 4ZODA 4OKDA 1SJCA 1E6RA 1IF2A 5L9FA 3AAMA 1XH0A 4F2TA 3WDRA 4D9PA 3F4DA 4F4RA 4FNTA 5DMNA 5KINA 4DIAA 2POTA 3N14A 4WDWA 3R89A 1CLKA 3GYCA 5F2LA 1MFVA 3FXYA 1UWQA 3NQVA 1YDVA 2WXDM 4PUMA 3OZMA 3D3FA 2ZZ1A 4KWSA 1GG1A 2FZMA 2NLIA 1VJSA 4BF7A 3SSZA 4Z0JA 1DJQA 1JQXA 3P5YA 3L4ZA 2VKZG 2FB2A 2HQAA 3EPMA 3WQCA 2VC7A 3DYPA 3AS1A 4NNBA 2YSWA 4EAMA 1AUSL 4BKNA 2VQUA 3USBA 4MAZA 5DMLA 3LCGA 2XFRA 1VIZA 1YNPA 4MKSA 4RDYA 1W2PA 2YA2A 4GQGA 1QPQA 3QPZA 3ARZA 3KBJA 1SZRA 1XPYA 4M6UA 5HJYA 1XQLA 4Y7EA 3MWAA 1ONXA 3ZZ1A 1OFOA 3I68A 4JICA 2QMJA 1UZDA 2OO0A 3SGZA 2DV0A 4WSHA 2WJFA 1VFFA 1BPLB 2PP0A 3ISIX 4CQ8A 1V02E 2V0TA 3H70A 3I3BA 3UR2A 1F3XA 2IQDA 5LIUX 2PWFA 1PTAA 2RKXA 2HZGA 1EF2A 1W56A 1GHSA 2G4FA 4LC8A 3GIYA 1B31A 4WLCA 4PTWA 3RR4A 1E51A 5HQEA 3U57A 4GHRA 3S5YA 3TVAA 5LZLA 4NI3A 3H2EA 1L6FA 4HZMA 4EK7A 5AKQA 5F2GA 5I07A 4IFKB 5CJMA 2GSJA 1XFBA 1A5NC 1VCFA 4H1ZA 1VBUA 3XINA 3NL6A 3SCQA 5JU6A 3MHFA 2DDXA 4GYFA 4GXPA 5LIXX 5F2IA 4N4PA 1CECA 3P82A 5SWUA 1ZAJA 2BVWA 2JIWA 3W29A 2QJHA 2PP3A 3VKJA 5TBOA 1LORA 3NCOA 3TXZA 1GQKA 4JY8A 5JUVA 4FNPA 1YPXA 3CQJA 3RF9A 4GX8A 5TIMA 2C91A 2QMKA 4HNLA 1SR0A 3B06A 1OF6A 1ALDA 3PSWA 5JVLA 3W7PA 3N19B 4L61A 1W37A 4HMDA 1WAUA 4IM4A 4M19A 3SEPA 2EG8A 3NAVA 3E38A 3GZ3A 1W1IE 1OINA 4XBSA 4CQBA 3S9ZA 2O56A 3GR8A 5D2YA 3VA8A 1B9BA 5FCZA 2HRWA 5FSEC 1HT6A 1TCDA 2WANA 2TSYA 1BTCA 1ZQ5A 3ARVA 3NO5A 3RX3A 1Y5WA 4HJWA 4PB3A 1DTUA 3W28A 2D24A 2Y1HA 1Q65A 1YIXA 3RJYA 4DJFA 4M82A 4UTIA 2Q01A 1E73M 2EKGA 3T8LA 1FCQA 4RE4A 1Y7VA 4HPXA 1SO4A 4EE9A 3H2NA 3UG5A 8A3HA 1SFSA 1JYNA 4PSRA 3W24A 4FS9A 1V0KA 1UR4A 1KLZA 1DJHA 3ITLA 1R3WA 3LZ5A 4XVEA 1B2YA 2FMNA 2VRQA 1QNVA 5A94A 4MY1A 4Q4QA 3Q2DA 4CVUA 3GRIA 3PN8A 3MMWA 4H7CA 2O0TA 4JTTA 3R0DA 4HHHA 3K8KA 1JCYA 3B9OA 4FA3A 2VX7A 4CN1A 1XKYA 4HPHA 1ISWA 4S3AA 1R3VA 1BG4A 3QTGA 2BY2A 2QEZA 1JJKA 3AS0A 3DGRA 1B3WA 3KFTA 3W7IA 3LG3A 3KTCA 2A5HA 3MYOA 3NG3A 4HVXA 5I03A 2Z24A 2PC4A 1ADOA 3OOQA 4AUBA 4BEQA 4B5VA 5K4XA 3MPGA 5FEWA 2X7WA 3IIPA 2PTYA 4JAWA 4DY1A 4ENLA 5H91A 4JTKA 3AHYA 5CSSA 1EEXA 2GJXB 1J0HA 1W5MA 3QVQA 2YLAA 5C7HA 3WLLA 3N13A 4ZE4A 3HN3A 4GYPA 3OJGA 3NFUA 4Y9MA 3BLEA 3ITYA 2C16A 3ZJ8A 1B54A 2E8YA 1VBHA 4IGSA 3R8GA 4JTCA 3WFAA 1KM3A 1ODZA 4L1GA 1JDFA 1AK5A 1JDCA 3M44A 1ZY9A 5KZ6A 4V1XA 4GVFA 4KRUA 4L4LA 5B80A 1HJQA 1UOKA 3VIGA 3WNPA 3ARYA 1UBPC 2VFHA 4P5UA 1TVNA 2E5BA 1Q6EA 1UYQA 4E38A 5H2ZA 1GYNA 1XYLA 4JTLA 4EXBA 3ZT5A 3PG9A 2V63A 4C7FA 1TSIA 4L1XA 3TWAA 5C9UA 1V4YA 1AODA 2Y7FA 3AYSA 4B15A 1N2VA 2VD9A 1EX1A 1XJBA 3WD3A 4O50A 1IR2A 5EMYA 4MIMA 1MYRA 3OB8A 2CHNA 1BWLA 1W3NA 4P7RA 1OX5A 3CT7A 4GK8A 4AD1A 1TPWA 3ITVA 3L0KA 3W3OA 3LYEA 3MDUA 4RLIA 4PMDA 4LQ1A 2RH9A 4UNKA 4O53A 3EB2A 5CC7A 4A3UA 3MWCA 1E9IA 3T05A 1DYSA 1FWFC 2IW0A 2VC9A 1SFTA 3ARQA 2QIWA 1KXTA 1UROA 1QCWA 3APYA 4GO8A 1ZB5A 2VZSA 1XCFA 3PTDA 3U3HA</