4KW2A

Crystal structure of a putative uncharacterized protein (bdi_1873) from parabacteroides distasonis atcc 8503 at 2.32 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
240
Chain Sequence
ADWKVGIQTWTFHNLTLMETLDKTQQLGMGYAEAFFFQELGAPFPKETYLNYDLSDDNCALLRHEFKIRGIKPIAFGVASYGTNEEWDKFFAFAHKIGAHIVTVEPELNQLDYIESLAKKYDMEVAIHNHPASAEVVEKALKGRSPLMGVCADIGHWKRVGEDPLKNLQKLSGRIKVAHLKDLTDKMEDATWGTGILPVKAFVNELKRQHFNGLISIEYDDFKSDIQEIRNSLEFLQKCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative uncharacterized protein (BDI_1873) from Parabacteroides distasonis ATCC 8503 at 2.32 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
molecule keywords Uncharacterized protein
total genus 77
structure length 240
sequence length 245
ec nomenclature
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4kw2A00
3AAMA 1XIDA 1BXCA 3C0LA 4PGLA 5EMMA 4ZB5A 5XIAA 4XISA 1A0CA 3VNMA 2XINA 4EACA 3ITYA 5EMLA 3KBVA 4A8IA 9XIAA 4HHMA 4LNCA 2GUBA 3UU0A 4ZBCA 3C0SA 4GJIA 1YX1A 4A8NA 3KCOA 1XIEA 3ITOA 1GW9A 2G4JA 5EMKA 1XP3A 3KCLA 3ITLA 3LMZA 1XIJA 1XIHA 3M0LA 3P14A 3XISA 1BXBA 1XLFA 4DVOA 5C9ZA 5J8LA 1XINA 1D8WA 3KCJA 3IUHA 2OU4A 1S5NA 1XLMA 1XLKA 3KBMA 3XINA 4QE1A 1DXIA 1XLCA 3DX5A 2GLKA 3VNIA 3GNXA 3DBNA 3KTCA 4Q7IA 1XISA 3AYTA 4K1GA 3M0VA 3VNJA 3FVMA 3BZGA 3JU2A 3CNYA 2ZVRA 4QE4A 1TZ9A 2HK0A 4YTUA 4GJJA 3KBWA 4E3VA 3ITXA 2QUMA 4A8LA 1QUMA 4QDPA 3UA4A 3L23A 3AALA 3M0MA 3IUDA 5B80A 1XIBA 2I56A 2NQHA 1XYCA 3WQOA 1QT1A 4XKMA 4HGXA 4YTTA 5B7ZA 3N4AA 4J4KA 3KWSA 5I7GA 1CLKA 1O1HA 5EMJA 2QUNA 8XIAA 3TC3A 4GLEA 4HHLA 2G0WA 4A8RA 1MNZA 4X60A 1S5MA 1XYMA 3TVAA 3AYVA 3CQKA 1XIIA 3ITVA 3NGFA 4YTSA 3BANA 1XLDA 3KBSA 2GVEA 1XLJA 2X7VA 3KBJA 4X61A 4DUOA 1XLLA 4GQBA 1XLBA 2ZDSA 3ITTA 4QEEA 1XICA 4K3ZA 1DE5A 2HCVA 3CQJA 4X63A 3BWWA 4YTQA 1XIGA 5FA5A 1XYAA 3XIMA 3KBNA 3OBEA 3M0HA 3QYSA 4QDWA 3VNLA 3M0XA 4XIMA 2Q02A 1DIDA 4PFHA 1MUWA 3QZAA 3U0HA 2HK1A 2X7WA 2J6VA 1XLEA 3BDKA 1DIEA 5H6HA 3UXIA 3VNKA 4QE5A 5B7YA 3M0YA 7XIMA 4ZB0A 2XISA 2NQ9A 1A0EA 3BZJA 6XIAA 4XIAA 9XIMA 1K77A 1XLGA 1QTWA 3IUIA 2GYIA 4ZB2A 4YTRA 3C0QA 3QXBA 5H1WA 3CQHA 5AVHA 4HNOA 3P6LA 2I57A 1I6NA 4KW2A 5XIMA 1XLHA 6XIMA 1A0DA 1XLAA 5TNVA 1XYLA 3CQIA 3UA3A 1DE6A 1XIMA 1I60A 2XIMA 3QC0A 4US6A 4EAYA 8XIMA 4QEHA 5AVNA 2QULA 3UVAA 2QW5A 1XIFA 1XLIA 4G56A 4XSMA 3CWHA 4OVXA 4XSLA 4W4QA 2NQJA 3VYLA 5XINA 1XYBA 3U3HA 1OADA
chains in the Genus database with same CATH superfamily
1WCGA 4DWSD 3I6EA 1WZAA 3AI0A 3WUBA 3GRIA 3NXFA 1EHAA 3OA3A 3WK1A 1UWTA 4IMFA 3NL3A 2YJQA 4M1BA 1NF7A 2XU2A 3JR2A 2RFGA 3UCDA 3KOZA 1KXTA 4UNKA 1XYFA 4AXNA 4DF2A 1JZ6A 3BG9A 5A6SA 2XFRA 1NJJA 3LHVA 1JYVA 5HNUA 1ME7A 2YXXA 4H2CA 1K9FA 2XFYA 2GK1B 1WNOA 2QR6A 3SIMA 1BAGA 3OW1A 3E9AA 3APYA 1HJSA 3TKFA 3ALGA 1R86A 4LOCA 1NH6A 1IEXA 4YCOA 2QUUA 4RXGA 4UTKA 1LWIA 3LI0A 5HMDA 1R0MA 1PHQA 1TJ0A 5K7JA 3L21A 1F3WA 2ZWYA 3ZT6A 1BSIA 2WCAA 5TIMA 1P6CA 1DBTA 4E0CA 2XGBA 2W62A 1T40A 4H6RA 1V6YA 5I6SA 3S47A 4XG1A 3AISA 5H6HA 5HQEA 5G1MA 4D6HA 4PMRA 4ILSA 4RW3A 1GHSA 4XAGA 4NY2A 2G3IA 5AC7A 3S2JA 2FZNA 3IVUA 3CQIA 1GNXA 1Q8JA 3G8RA 4LPCA 5CLWA 3L4VA 3UZ5A 3WFAA 1EX1A 4RCXA 1D3GA 5IDZA 1JYNA 3CXOA 3EX4A 5DT5A 2D73A 4LUIA 2RJHA 3BJSA 2DGAA 1W8GA 2WNWA 3IJLA 4QXIA 3W73A 4EACA 1TWWA 4LNCA 4AD5A 3UZWA 2ESCA 3UU0A 3EOEA 1E5JA 4M8UA 5EMYA 4HJFA 3RHGA 5CG7A 4D8ZA 4IICA 1O6IA 3U2ZA 5CZKA 5H8UA 1J01A 3BG5A 4JFWA 3R89A 3CUZA 3N13A 3RJXA 3SUWA 3WNOA 1F07A 3OYXA 1Z6KA 2C71A 4UFKA 3TZNA 2GUUA 3L23A 3DI0A 1V02E 3W23A 1FFQA 3C52A 3N18A 3TJXA 4AEFA 2Y5SA 5T8GA 4HNVA 1JFXA 3KAOA 1ZU8A 3R6IA 4L64A 4S3FA 1GEHA 1ZJAA 4BEUA 2H8ZA 2PD5A 4NVTA 3CQJA 3EGJA 2ZZ1A 3IRDA 3VIIA 3S9ZA 1UP2A 1D3CA 1DXFA 1P0EA 2ACQA 1R38A 2I57A 4XVDA 1E0WA 2Z7KA 2QV5A 2XIMA 2LLEA 3TAOA 1JQXA 3W3OA 7PTDA 1TPC1 2QJJA 1TE1A 3T9PA 1RR2A 4XBJA 1IZJA 1A4MA 2XINA 4G1KA 2E67A 4Z2GA 2W9MA 3OLGA 3TQ0A 3MCNA 4AZ6A 3UG3A 1MXSA 2ZTKA 4FR6A 1QBBA 4UCFA 3NDZA 2WSKA 5REQA 3EA2A 3HTWA 2WWCA 1H4PA 4QM1A 1XUZA 4AY8A 1K03A 4MKSA 4JTRA 3LOTA 4GHRA 2BP1A 2J6XA 3IK2A 3W1LA 2Y5EA 3SCWA 2WSYA 3B04A 5B80A 4S2CA 3CZKA 4XAFA 4GY0A 3S5OA 2O9OA 3FW6A 1A5KC 4LGXA 4Q8WA 4UQDA 2DQWA 4O57A 3VGBA 4PL2A 2V0TA 3HM7A 1UWIA 3SJNA 3GTNA 4U5IA 4PRWA 5F7UA 5GQBA 4U4MA 3QY8A 1X6UA 1WYIA 1BQCA 4S3JA 4C6BA 1XL9A 5DXXA 1WP6A 3FXYA 4A2RA 4HMCA 4P8VA 2FGBA 2XN1A 1V8EA 1QATA 5HWMA 2VRJA 1ZGDA 2Z1BA 1ZJBA 3ANUA 8TIMA 3T4CA 4R5EA 4HMDA 3P3BA 2W61A 4LWWA 4ERIA 2C91A 3GXTA 3RCYA 2XGIA 3PG8A 1TJRA 3UJ2A 4LX4A 3GY1A 1LT7A 1LT8A 3OLDA 4MMWA 4C5ZA 2FPTA 1UUQA 4NRRA 4PMJA 3ITYA 3NYDA 1R46A 1JCYA 5CXPA 1YHTA 1Q6LA 3FFSA 4DPPA 1CWYA 5D37A 4AWSA 1JNDA 1PZ0A 1M3UA 2RDTA 3I7QA 3O8AA 3BG3A 4K1GA 3UG5A 1VLWA 4E38A 1UUMA 4C90A 2JF6A 2WZHA 1X7FA 1MEIA 2UV8G 3Q2DA 1V7AA 4FS9A 5T26A 5IHRA 3IK4A 2QDGA 3TSDA 1TPFA 2VO5A 4YWSA 3P81A 2KZHA 1TV5A 1DKWA 4DWSC 3AROA 1Y0EA 5HWJA 4OBSA 2OOGA 4WKFA 3RX2A 3SCRA 1B31A 1B57A 3PF3A 4JTKA 5M3WA 3ARZA 3FGCB 4LT9A 1FCVA 3P7YA 3GXIA 1WKFA 4DBUA 4P61A 3WDPP 4E2VA 4DZIA 3BCDA 5HDRA 1ME9A 2X1SA 4NU7A 1IEVA 5REQB 2UY2A 5FESA 2V2HA 3A3WA 5I23A 4NX0A 1R5YA 1KV8A 3P62A 4EWJA 1F73A 4ATLA 4GJ1A 5FJIA 5I2UA 1G4PA 4EPKA 3KDOA 4UZSA 5D2XA 4B90A 5DBTA 2I7GA 1Z41A 3PZUA 4DAIA 4ACZA 1BKSA 1XM3A 1WA3A 3GLCA 3WK3A 4LUTA 5DCBA 5DY3A 1G7VA 1UC4A 4H4IA 2CLHA 1AW1A 2R91A 1GVFA 1TA3B 2INZA 4UQAA 2WM0A 4N42A 3QKZA 2D23A 5D02A 5HPOA 3R10A 2QCFA 1UUOA 4QJ4B 1FHVA 4QG8A 2J25A 2VDHA 4IISA 3GG1A 4YHEA 1P1XA 2VEPA 1EA0A 3DYPA 4NUWA 2V3GA 4JX6A 3S9YA 3V35A 1F3TA 1FX6A 3MKVA 4WQ6A 2O9PA 3U7VA 1CXEA 1V6WA 3W24A 3MV11 2XIJA 3O6AA 4I9MA 4JR5A 3GYCA 3LV5A 4GINA 4KWSA 1ZSXA 4GY1A 1ISWA 4LRTA 3BAXA 3VOGA 2EG7A 5HATA 4OFCA 3VTRA 4K37A 4PUEA 3SUSA 1R9XA 4FNSA 4OKDA 2VFFA 2J13A 5E0KA 3G77A 4JTLA 4MIMA 5BMWA 2C19A 3TYDA 1TV7A 1GOKA 4DYJA 5T9CE 2D2JA 6REQA 4Q6XA 3R1ZA 2VCCA 3TN6A 2WMIB 1WDRA 2QCMA 4Q8TA 1KNWA 3SCPA 1A80A 4W4QA 4GUJA 4RZBA 2BMBA 2ISVA 3CUHA 3CHCA 3ARVA 5BMXA 1OD0A 4PGLA 4F0SA 4BWLA 4WSJA 2CWXA 1WV2A 3C86A 4GC3A 4JTQA 3MUIA 4NG3A 4AF0B 2ZRYA 4PMYA 1E3ZA 2Y70A 4QSFA 5C71A 2DV0A 4H7ZA 3TC7A 4PA8A 5D9NA 3PP7A 5FF3A 4DF0A 4HN8A 4I7WA 1ZBVA 1NIUA 4Y6GA 4DM1A 3TN5A 5HXMA 4LAKA 3N2OA 1W3TA 5D33A 3DFHA 4AC7C 1E43A 1HJWA 3VKBA 3CAKA 4GIRA 3T81A 2QJIA 4DYEA 3W7LA 2EO7A 4LVFA 3L4XA 1K02A 5FJUA 4Z1YA 3GTIA 3MO4A 1KBBA 3B9DA 3V18A 3VOCA 3WMCA 5C7VA 2ZUWA 1HNYA 2EPOA 4K2SA 1AK5A 2CC0A 2Z25A 2X7WA 3ZLFA 4AU0A 5A6BA 2QAFA 3NZRA 3F2CA 4WF7A 2HV5A 1HGWA 5DLCA 1LF1A 2J24A 4YTRA 7CGTA 4ACYA 2P3EA 1PKLA 3OPSA 1XPGA 5E9XA 3OQ8A 4O13A 3THDA 2RKXA 4QCEA 4XKYB 3H12A 3LGEA 2W91A 1XBZA 4O4WA 3GB6A 2OT0A 1F8MA 3E5PA 3GDTA 4WKAA 4AH7A 4R7JA 2ZRUA 5LZLA 3CWOX 5DF0A 1PBGA 5AHEA 4ADUA 4OV9A 1LZOA 3KUMA 5J8LA 1W9PA 1MQPA 4UTTC 4O4VA 4M6QA 3RRXA 2AGKA 1UW9A 1MZHA 3G1HA 4IT1A 4L56A 3DH7A 2B81A 3M0VA 2IUZA 4E6MA 4C6IA 5RUBA 3GAYA 1E9ZB 3VKAA 4HOXA 3BLEA 1TPVA 3OBAA 1IEQA 3SN1A 1JRBA 2Z0IA 1OFQA 1PCKA 4XKYA 4XKMA 2RH9A 3BLDA 1VJIA 2PAJA 2HVOA 3VDGA 4GZJA 1JZ8A 1YNQA 8XIAA 4MYAA 1LOLA 3DHPA 1LUCB 1TQJA 4MHBA 4MZ8A 5G2WA 4C6QA 4DX3A 1Z69A 4UIOA 2NVDA 1G9HA 4F66A 4XZMX 3W7MA 1KM5A 3QH2A 3CHEA 1M6JA 4JY9A 5KITA 4Q4QA 1UR2A 3V0TA 3M43A 3VCCA 4B5XA 4ZB0A 3V0UA 3AIVA 4J3TA 1IWBA 4V27A 4I9AA 1FWBC 1H7NA 3USZA 2O9RA 4C6NA 3K30A 3TMLA 1PVNA 3DHDA 3CIVA 2EPMX 2VVSA 3GXFA 4GY7A 5AVNA 7ODCA 3DKLA 4PCSA 1C93A 2GQ3A 2A6NA 2Z1KA 3EX6A 3DU0A 1VKFA 4H6KA 3NEVA 1GJPA 4MFEA 4UZUA 1JZ5A 1TTJA 2ZADA 3CT7A 1OFAA 4L9YA 3N17A 1RPXA 1TE6A 1VJSA 1ZJHA 2NT1A 1KCKA 1KXQA 4ACZB 2EGZA 2YDQA 4RJEA 1BF6A 3W6YA 4A3RA 1UWUA 4S3EA 3N11A 2Y62A 4B2DA 1R8LA 4Q8MA 4NZ4A 4UQEA 4LUYA 3BO9A 1GYNA 1QUMA 2BSLA 1UYQA 1KBIA 2C1HA 3SY1A 5D09A 1GVSA 1IIHA 3GD6A 1F2JA 2P5NA 1L6WA 4Q8NA 3DIPA 1W8SA 1PKNA 1GQNA 3Q65A 1U30A 2WMJA 3AHVA 6REQB 1WDWA 1GKPA 4D6CA 1X6LA 3EPOA 2FQIA 1VFOA 3EB3A 1A0EA 1KD0A 2CZEA 3BZJA 1CGVA 1TTPA 4LY8A 1W1A1 3JS3A 2FVKA 1GEQA 4R88A 4FXRA 3UJEA 2W27A 4UOZA 3BW3A 5U4NA 1KFJA 5HNNA 1XHGA 2NQJA 1YTKA 3VYLA 3IGUA 3W7CA 2ZA2A 1CGTA 2C14A 3C0LA 5E09A 4WDUA 1REQB 2VUNA 4N2YA 4KCUA 4RDZA 4AD1A 3T0AA 2PZNA 4GNVA 5HR6A 3S5ZA 3EDEA 1EEXA 4LS1A 4QS6A 3CEUA 5FAJA 4UQBA 4IX0A 2G96A 4J1OA 3P8IA 3AUOA 1DWFM 1H11A 2VZTA 4M29A 2VCBA 2XH0A 2WVTA 4HTYA 1IGWA 1Z42A 1BD0A 3GNNA 3UWVA 3HFYA 3QGAC 1DJIA 4US5A 1JDAA 1TJPA 4MLJA 5DMYA 3RLHA 3T8LA 3M46A 3TK7A 2HVNA 1HT6A 4URIA 4RL3A 2VRQA 2DZUA 4UTLA 1X1ZA 3A21A 3KP1A 2FB3A 4L7ZA 1RSCA 2ZZ6A 1LRTA 3VNKA 1WXZA 4MSSA 4X2RA 1OX4A 1ALDA 1ELSA 3IIZA 1F8IA 3WG6A 4B2DD 5C9XA 3P80A 3NXLA 3W74A 3TCSA 5BNKA 3H7UA 4MY1A 1X6NA 4YU1A 4HYRA 3CMGA 3B8WA 4DLFA 3DFPA 4L4PA 3NNTA 4C6PA 1JZ7A 5AHNA 3ZO9A 2PDLA 1Y8BA 1H49A 3OODA 2QPXA 2J7DA 4JTCA 2VWSA 3F4WA 1E0TA 4DO5A 3ZIZA 4O28A 4UTMA 4EPBC 3VIMA 1R3SA 1WOBA 4AZCA 2DPEA 3WBXA 4INFA 1Y65A 1CGYA 1VBJA 4S38A 3OVRA 2YB1A 2YW3A 2PDMA 2A3BA 2J9YA 4PMUA 4HK5A 4OV4A 1OZMA 3GDKA 1IHIA 2BB0A 3EPMA 4HK6A 4HHPA 1EPXA 1XWYA 5HQLA 2OEMA 2ZDSA 3WLRA 4TV5A 4KRTA 1AW2A 2X8RA 1JULA 1OCNA 3VD3A 1V0MA 4XZWA 4XUYA 3A3HA 3P0WA 1RQBA 2BASA 5DELA 1H51A 2BY1A 4QSHA 4JIHA 2FZ9A 1R3VA 1NY1A 4JICA 3UG8A 3RDKA 4EPEC 4UFJA 2QW5A 1QXLA 3LLDA 5H8MA 3EKGA 2ABBA 2CWNA 1ZAJA 2EPLX 4W93A 3WNLA 1XIDA 4MWAE 1P4CA 5FF2A 3A12A 3OGSA 3ZSTA 3UY7A 5EB8A 4HHMA 1LG2A 2PGRA 1B4KA 2PMQA 3D3FA 1XIJA 4X22A 3ZJKA 2FMNA 5A8QA 2XH4A 3MJMA 1D8WA 3D5HA 3E6EA 4AZGA 3GZAA 1O5XA 5FAGA 4ERAA 5CAHA 3T6CA 3RM4A 1LQ0A 1UKPA 4JTFA 1MFUA 2VEKA 4OE7A 4C60A 3HJZA 3UA4A 3IUDA 1TVLA 1C8VA 3O05A 3BGGA 4PYSA 3N34A 3PSVA 1O1HA 2PDYA 2FTPA 2Q8XA 4B3KA 3NZ1A 1XIIA 2NV2A 1R30A 2Z1WA 3WLNA 1XLLA 1UC5A 1FWWA 2CBJA 2QDHA 3S2LA 4XZHA 1C3FA 1ISZA 1JRCA 2X42A 2NVCA 1M03A 3PBVA 4XBSA 1K7FA 4GKTA 2OLAA 4IFKA 3M0HA 1SFSA 2O92A 2R9RA 3E5BA 4CNPA 2DT1A 5I3IA 3AC0A 3HQNA 3FVDA 4L5ZA 1Q5MA 2XISA 1PZ1A 4HBKA 3H26A 6XIAA 3SO7A 2GJXB 3TXVA 3WK0A 3QXBA 5H1WA 2F2KA 3HO8A 3QHOA 5ABTA 1Q6RA 1V77A 1GZGA 3D0CA 5TNVA 5TF0A 2VGFA 1KC7A 5A2AA 5JH1A 1TR1A 1SQ7A 1MDRA 1KRCC 5D4YA 2RDUA 4UB9A 1ONRA 1WKEA 1AW5A 3MSGA 1G4TA 1A5CA 3VMNA 1H2JA 1Z9AA 4KS0A 4M6UA 4WGXA 4FNTA 3TYBA 3KS5A 5AFDA 3ZJ6A 4KCVA 4YLWA 1ITXA 1Z7AA 4F3HA 4OJYA 2I16A 2O4MA 5AKQA 4HPNA 2PCQA 1UCWA 2VM8A 2VYOA 3IIOA 1RALA 4ZQPA 4AY1A 1O5KA 4K68A 3QKEA 4S23A 4PUJA 2FFCA 3GNOA 2V5JA 2VMFA 2ZXBA 3VDAA 4FALA 4NZ1A 4MJ2A 3WJXA 3IJDA 1OFDA 1A5NC 4MDOA 3LI1A 1RBOB 1AODA 4MJMA 3W84A 1LORA 1JAKA 2V5LA 2XUCA 4WY0B 3S5NA 1EH9A 3EOOA 3LSBA 4RPPA 1R3WA 4F9JA 5H8PA 1YE6A 3BUVA 3W76A 2ZOXA 1E56A 1MUMA 3L2LA 2E09A 4GPNA 4MUZA 1I45A 1MW1A 2BGQA 1M53A 4IFOA 5CPQA 1N8FA 3SSZA 1OYBA 3EDFA 4MY8A 2PLMA 4WOQA 3WLMA 2PURA 3VIOA 1VZWA 1S2UA 6PTDA 2NQ5A 5A6KA 3H4GA 4OBRA 2BHUA 4F0HA 1J79A 3KXQA 1XGEA 2BX7A 4LYQA 3TV8A 1POJA 3ATYA 4FNQA 2FZMA 4JYFA 4AQLA 2YL8A 1M01A 1TRDA 1IT0A 5FL0A 4D6EA 3PUDA 4LC6A 2C8NA 3PC0A 4JPGA 3E0VA 5HMFA 3N2TA 2ZKMX 2WNQA 4RDYA 1EJSC 3ISIX 2HJPA 3A5VA 1P0KA 5F4WA 5G2HA 4A35A 2IQTA 3DN5A 3CZGA 3GNPA 4OIFA 2E6YA 1XS2A 4DB7A 5HAOA 4ES4A 2DVTA 3FY1A 2ZC1A 1MDLA 3KDNA 1XYMA 1LYXA 2R8WA 1F4HA 2V5DA 1K3UA 3G3DA 4S39A 3WD3A 3CHVA 3NZPA 4MVAA 2X40A 3AS1A 4UXDA 4CN6A 2O4QA 4BJHA 1BHGA 1Q4NX 3M0XA 3R11A 2O9TA 4UFLA 4JTSA 5HPCA 1OQFA 2NQ9A 2NX1A 3PUEA 3DZ1A 4CUCA 2WNNA 3EWWA 2PC8A 2DSVA 4LYRA 3I68A 3A24A 4DJDD 3VKKA 2GDVA 2WV8A 2EF9A 3QJAA 3CLMA 1K70A 3MY9A 4L4LA 2IPJA 1W3LA 5CQ1A 4BQ3A 2VEMA 1B9ZA 4MZ1A 5FEWA 4I8DA 1XSKA 1DTUA 4IMCA 2OZ3A 1MRQA 1K9DA 5XIAA 2PDUA 2UY4A 3W25A 1UIOA 2TRSA 4KEVA 1TZZA 2ZDRA 3OZOA 2AMGA 3GE7A 3M6DA 1MFVA 1XIHA 4JBRA 3EMQA 4HOWA 3TTQA 4ZOBA 3SEPA 3CM4A 4W5ZA 1GWJA 1H7XA 1QJWA 4CVWA 2WSPA 2BNJA 3VMPA 3O6CA 3IARA 1J0JA 1UD2A 2Y0FA 4YWIA 5HNTA 1T96A 1KLYA 1Q66A 3OP2A 3RAOA 1CIUA 3DKJA 1ADOA 4S3AA 3PB0A 3T0BA 3WLHA 4RE4A 1X39A 3ME3A 3PJXA 4MJ4A 3GR7A 2BXVA 1PE1A 3PPGA 1JCNA 1UBSA 2E40A 5CKSA 1H09A 3QZAA 3C8FA 3MUZ1 2WSRA 1JGMA 3FA4A 3N73A 2V38A 2F8QA 3UG4A 1U22A 4N4QA 2J66A 4LU0A 2PWDA 1Q13A 4MY9A 2DZVA 2EG6A 5LA2A 1P7TA 4C1NA 5BXTA 2NW0A 3NIYA 4E2BA 2PP3A 4O1CA 1E1FA 2XGZA 3GH4A 1E5NA 2E6DA 5C54A 3AXKA 5IOBA 4AD4A 2VUYA 3F4DA 3WH7A 2BHYA 5HR7A 2DQXA 1H61A 1O4UA 2OWCA 3UCQA 2ZZ5A 3T42A 4BF7A 1UA3A 4U3CA 2VGIA 2CLMA 3M0LA 4NRSA 1XLFA 1F74A 1FY6A 4RDVA 3N2XA 4JKLA 1HJQA 2QMKA 1D3HA 1O68A 2WCSA 3B06A 2A3EA 1G6CA 2X05A 1RP9A 3W01A 4Q32A 1SJCA 3VM5A 1C9WA 5F2LA 1IZCA 3SGZA 3SRFA 1PTGA 2JK2A 4OGZA 4ORIA 4I90A 4FOUA 2XH2A 3EWUA 3HMJG 2V30A 3E2QA 2Q3OA 3VUSA 1CLKA 3NM1A 1EO5A 4HYWA 4ZO6A 1RBLA 4KIRA 4MNJA 3VIPA 4GLEA 3NEHA 1KBJA 1AD4A 1N8IA 3PJWA 2Z27A 1DP0A 3SN4A 4LVDA 1E9LA 1C7TA 3QV7A 4US5D 4M5PA 4GIYA 3G6LA 1JCTA 3UVIA 4XD4A 4FLQA 4I8YA 1DIEA 2YW4A 3S1UA 4IIDA 1FWCC 3KVMA 5IFTA 3VIFA 3FKRA 1AH3A 2XIOA 4O15A 5EMUA 1VHNA 1HGYA 3LM3A 4BQ2A 2VZSA 4PMDA 4IIHA 3JZUA 3BMXA 2TAAA 2HS6A 1TQXA 2BDQA 3AO0A 4ZO7A 3BGJA 2QCDA 3WDHA 4TR9A 3QPYA 1XYZA 1GOMA 2HDJA 4F48A 2Y8KA 4XISA 3F7JA 3QMTA 4Y9MA 4XO7A 4RX0A 2HBVA 4O53A 1MRAA 4WSKA 4NKCA 3RIKA 3ITLA 1QHOA 5KZ6A 2VTFA 6A3HA 3LA4A 2PTDA 4G5DA 4GUIA 4AX7A 1ECEA 2VR4A 4HK7A 1KRAC 3EOSA 3K46A 1NARA 3FSTA 3W7JA 3SCVA 2VGBA 4NIRA 4AZHA 4KRUA 3UP8A 5CG0A 2Y63A 3TJLA 3GK0A 4NHVA 3CV1A 7A3HA 3GH5A 3W7PA 4XZ9A 2Q09A 5I06A 3W0KA 1YW1A 3TA6A 4IP5A 5A6AA 4WDTA 4MKVA 3P2VA 3WF1A 1DE5A 3NQGA 1OJXA 5F2MA 3B8UA 5JBDA 2ZE0A 4CD4A 3RPDA 5AC8A 4KH2A 3HG3A 4D9PA 4TTGA 3W7IA 1NVMA 1PYFA 3AHXA 5CSUA 3P6LA 4GXPA 2RHGA 4GYFA 1HQTA 3EXSA 5A6JA 3A64A 1KRBC 3MCMA 4EXBA 3VDHA 3SFKA 3G0UA 4EXQA 1GVQA 4P7LA 4G8TA 1UROA 3A22A 1CGXA 1W0MA 1RY8A 2R1MA 2NXHA 4K6AA 4HKPA 3OU8A 2BOFX 5BZAA 5AHMA 5G1TA 1HL9A 1G69A 2UY3A 4K8EA 2PDQA 5D8ZA 1VP5A 1QPKA 4IGMA 2BXYA 3CV2A 1CZ1A 2WSQA 1YYAA 2VZVA 3HQ1A 4D8AA 3LD5A 2ZVRA 2NLIA 1NDWA 4NAEB 3LBCA 3K4WA 2Z1SA 1DIKA 3LMYA 2IPFA 3IRSA 4QTGA 5AC4A 3P84A 1AQMA 2VQTA 3DERA 2IKIA 3TJIA 3N2BA 3C2RA 3KL5A 4A4AA 5J5RA 1B0IA 1OFEA 4UFHA 1GCYA 3QHNA 5GJPA 5BCAA 1OY0A 3QRHA 6CGTA 1XIGA 2D2GA 3U9IA 3REQA 2GGJA 3UXIA 4C6DA 2EKGA 4CQDA 1V0KA 2VC6A 4IPIA 2GPTA 1GOXA 3M44A 5D03A 2DJXA 4HA1A 1XRFA 2CERA 3DGRA 4JTTA 3WH9A 5D2TA 3W70A 2HXTA 4LW7A 1IIGA 4AAJA 3CYVA 1XDLA 1BXNA 4A29A 4QEHA 1HW6A 1HVQA 4MZYA 4B9YA 3S1GA 1NWUA 1ITCA 3F03K 3SCOA 4MNMA 3ID7A 3E0LA 4FHAA 1QVBA 4CN1A 3CTTA 1J93A 2POTA 3ONBA 3GZ3A 3I4EA 4UTJA 3CUXA 2CKRA 1GW9A 2G4JA 4ZFMA 2PRMA 1ONWA 3KVKA 3PBUA 3H7VA 4JNMA 2WAGA 5MF5A 4H2HA 4Z2IA 1I2PA 4HOZA 2QT3A 2VR2A 1ZBWA 1BRLA 1US2A 1W6TA 5E1QA 3GIPA 1FKWA 8CGTA 4F2UA 4GCAA 4BFAA 3WJWA 1REQA 1HX0A 5A8GA 1M04A 1DJWA 3W2KA 2VD8A 2WWDA 1J2BA 3G1XA 3UD6A 2CHOA 1ZY9A 4I5UA 1KQZA 2NQHA 4QS5A 3T44A 3EBVA 5C9WA 2XIIA 3GS6A 3PZGA 2A4AA 3WLLA 5B7ZA 4N9BA 4K38A 3HF3A 2WM1A 4KEUA 1UPPA 5ECUA 3MVIA 2E9LA 2CZ5A 3NO5A 1UQYA 3P8JA 3AXIA 2ISDA 1G0CA 3RR4A 2PE4A 3GW3A 3I6TA 3PANA 4JYEA 1XLEA 1X96A 2OZ0A 2REQB 3EWDA 2GGHA 1Q6GA 3VOIA 4H9MA 2ALRA 2FPVA 4H6EA 1CECA 1WDDA 5FOOA 1PKMA 1WAWA 1FHUA 2BODX 3CS2A 1YLVA 4TVUA 2JKEA 1QFEA 3PZMA 1FTXA 2OSXA 1S2TA 1XV8A 4ROQA 3QF0A 3WNMA 1ZPTA 5JMUA 2FZ8A 3TA9A 2NSXA 1HL2A 5FJTA 3LYEA 3AXXA 4JIPA 4DN1A 3VC5A 2V5CA 3LQLA 3EXTA 2CLPA 3ORWA 4GQGA 3PTKA 3V1PA 1AJ0A 5CPNA 3ZT7A 1YBQA 5HJXA 2FDSA 5D2WA 2A7NA 4XK2A 3W81A 3LCIA 2C3ZA 3PWGA 2BOGX 4IOTA 3T0CA 2ZZ4A 3NTYA 1BQGA 3N4AA 2GZXA 3ARXA 1E4NA 1QNPA 3EWCA 2YFNA 2C6QA 2BLEA 1JFHA 5C7HA 4X61A 1KFKA 3WQ8A 5AY7A 4PUNA 2XM1A 1EOMA 1E55A 4KERA 4IPPA 4Z1BA 1ONEA 3W7HA 4QE5A 2YCLB 3C6CA 1E6PA 1VEMA 4CNOA 2F6UA 3GDBA 4FNPA 5T9BG 4R9XA 4KEMA 2YDAA 1CXIA 1XYLA 3M1ZA 5ECVA 4GUGA 1JCJA 1WKYA 4JN7A 1NQ6A 4PULA 4G7EA 3NR0A 1W17A 1RQEA 1SZFA 1SSGA 1WUEA 4GK8A 4DJED 1FXPA 2PA6A 4GISA 4LYPA 3DG7A 1F6PA 1F05A 1VBGA 4JQ3A 3DFQA 1JEZA 4IP7A 3I7SA 3W72A 4A8NA 4HN4A 1OG0A 1P7TB 3GYEA 4S1FA 5JQ9A 5CCZA 1UJPA 4D8LA 5F4SA 1TMLA 1Q7MA 1AD1A 2XVKA 3L9CA 3VGGA 2NVAA 1MYRA 4E3VA 3LX9A 1L6GA 2OYLA 1RJRA 3WMLA 3W00A 3AJXA 5K9XA 2IW0A 3UERA 1ZLPA 4NJJA 2OVLA 2D3LA 3F4VA 2CLLA 3C2EA 3UZXA 3FYPA 2VRKA 4NXSA 2VVNA 4DM2A 3CMJA 1AH0A 4HU3A 1LRNA 1NFGA 3WQFA 2NUYA 5BWFA 1FWFC 2ZX5A 3GHRA 1FHLA 3OGRA 5GNZA 1WDSA 2HE8A 3E2RA 1XD0A 3IUIA 3SY8A 8RUCA 3NUKA 4LY4A 1XBVA 3B0PA 1JYWA 3MJYA 3ONCA 3F5KA 4ZL1A 1BG9A 1WDPA 3UF9A 2A2IA 3RYSA 1VPXA 1C29A 1XJBA 4QG9A 3UVAA 3POCA 3IVSA 2YFOA 3MVTA 1XCWA 3TYAA 1IT8A 2Z28A 4GX8A 4IJBA 3PTMA 2YBVA 3TYZA 3SI9A 3AFBA 3W1RA 4GXMA 3ZVIA 2ZUTA 1OCJA 3F5LA 3BOFA 2Y24A 3C0SA 4GJIA 2V5BA 4OECA 4QLKA 1Z44A 3LMZA 3XISA 4QBXA 2QCCA 2GSHA 3W7KA 3NSMA 1GQKA 1JPDX 1O7AA 3V1HA 5DMLA 1G01A 1MQRA 4BF9A 1THFD 1JAEA 1W2VA 3KHJA 2OR2A 3MV01 3WLOA 1VYRA 2KX9A 3WQ6A 5CC5A 1ZBCA 1L6YA 3UPWA 3NPWA 2X0SA 2PDFA 3TVAA 2A3LA 5CC6A 3LTPA 4KWVA 4RZ4A 2G3MA 3QQWA 4LEQA 1RD6A 5LNWA 5K4ZA 1T8QA 2E1WA 5DO8A 1FDJA 3AU2A 1ONXA 3FJNA 4AEEA 3AXMA 4IZGA 3KRZA 3M0YA 1R7AA 1X98A 3MMDA 1KM0A 3WD0A 5C9RA 3BQ5A 3H2CA 5FCZA 4TQTA 3L12A 3PZ9A 4W89A 3V5CA 5K9CA 1DJZA 1H7PA 3V36A 5CC7A 2OODA 5M03A 3DC8A 1TA3A 1OK6A 3E96A 1W9DM 4J3XA 1R3YA 3E38A 1YTDA 3BLFA 5IXEA 3QFEA 4GZIA 4IMDA 4WR3A 2Z4GA 1ICPA 2ZWZA 2FGZA 3GH7A 1W1YA 1ZQ5A 1PX8A 3ARSA 2QAPA 2PTXA 1S2WA 5EBUA 1A3WA 1XQKA 1XINA 1GVOA 3LXBA 3TFXA 2OXNA 3K4AA 4XQ6A 4H9YA 4M3PA 2WC4A 3QW4B 2ZA3A 4QNWA 4Z0JA 5A69A 3CK5A 3E0IA 3UGVA 2WVVB 3QV8A 1XKJA 2FIQA 4IPLA 4E4UA 3BAIA 3UPBA 4IL0A 1ZBKA 4DAFA 2YBUA 1IWAA 1LLZA 1UA7A 1W3NA 5JU6A 1JZ4A 2V3FA 4JS3A 3F4CA 4W9TA 5LXEA 1EJVC 4XIMA 1G4SA 5CBBA 1V93A 3FIGA 2HSAA 3ARWA 2X1TA 3I3EA 3VGEA 3WUFA 4B5VA 3FDKA 2GQ8A 1V6TA 3VVGA 4C6CA 4FMVA 4HPHA 1UH2A 3WF0A 4GYPC 2EKCA 1TTQA 3DYOA 3ANYA 4N7QA 1OIMA 3PPHA 2YDRA 2MNRA 1R3RA 3LHUA 1M5WA 4L1XA 4NJKA 3MWAA 4IPNB 4WKHA 1LG1A 3FA5A 4NI3A 3TR2A 1DL3A 3H7RA 2ATSA 1PV8A 2Y7DA 3VDCA 5BRQA 1XC6A 2REQA 4G7FA 4XWUA 4DLMA 3NM3A 1O12A 4FLSA 5F4XA 4WJ8A 4FR1A 2DVUA 1S1RA 1FP8A 2VJXA 3HG4A 3GKAA 5CGTA 2VDIA 5I79A 4UR8A 1FVPA 2DIEA 1PYMA 5G4EA 2YR1A 1J12A 1HKKA 4I6VA 5EL1A 1K9TA 1W1PA 3A9BA 4KFOA 2W3ZA 3GVQA 5KINA 3L4UA 1E6XM 4R34A 3HQOA 3P74A 2WC3A 1TWDA 2V69A 1GYMA 3TC3A 3OA5A 3K4DA 4DJEC 1K6WA 4GVHA 1G5AA 1SO5A 1GORA 1BVWA 3W26A 1EP2A 1FWSA 2VX5A 1MEWA 3W2JA 1GUVA 4NZCA 1MUWA 2W92A 4GBUA 1TPUA 4MLRA 3JRKA 2EHHA 3G22A 3W7EA 3C2FA 3N19B 1ZUAX 1E4MM 1WZKA 4M56A 5E6ZA 4ZB2A 1OX5A 3G1RA 2WLZA 3MBDA 3U2OA 1E6SM 6ENLA 1V79A 3GAKA 1UH4A 2TSYA 1M68A 8A3HA 2QCDB 2DUAA 3BLIA 3RCMA 4UUIA 1KCZA 3R0UA 2YOCA 4B3ZA 1S1PA 4LS0A 4QR6A 4OUIA 1ZP3A 3AUJA 2A3AA 4J27A 3DENA 3EEZA 3MA8A 4JCLA 4FAMA 1R2TA 3TOYA 4HPXA 4O0QA 3QEZA 1HVXA 1A5BA 3WD1A 4O54A 1SFJA 4AIUA 3KLLA 1ZS2A 3UT0A 1VFUA 3HPSA 2PLCA 1BWKA 4NYUA 2F6KA 3GG7A 3A5FA 1OABA 1BKHA 3AS3A 4J3SA 4PCPA 3TDFA 3WMBA 3N6HA 2QCHA 1MEHA 4D6GA 3N4EA 4ADTA 4BZYA 1IE7C 3U8GA 3UFYA 1DVJA 3W6LA 1EC8A 2Z6IA 2FPYA 3QR3A 2HS8A 4CNTA 4EOUA 2HTMA 2O55A 4LNYA 3ZFHA 3RK8A 1ML1A 3BVJA 2PWVA 5GJNA 1P43A 3CU2A 4O1FA 1QI4A 4ERGA 4U2ZA 2ZXQA 2UBPC 1FHDA 3KVLA 4JCMA 3RITA 2E6AA 4WDXA 4ZO9A 4PB3A 2VELA 2D69A 1CI1A 5HQMA 2RUSA 4ZFCA 3H24A 1PUDA 3N9SA 2A6LA 2J7FA 4LS2A 3PAJA 1FA2A 1K4GA 1TPWA 4S3BA 5AYYA 3BV4A 4YS1A 3G5EA 4Z17A 4MB3A 3AWOA 3S5SA 1UD8A 4L6DA 4PCFA 1Z3NA 3R8RA 1UASA 3B9EA 1V0NA 3K8LA 4XO6A 3EXRA 3EMCA 1GJUA 5LXXA 3RM9A 1LLWA 3S2MA 4ICMA 1A5UA 1JF5A 3NOYA 1KCLA 1F3XA 2F6XA 3SCSA 2HE5A 1SU5A 2HNEA 3TWBA 1JF6A 1UIPA 5BWAA 3TIMA 3TTOA 1OG6A 4KWUA 1K8XA 2IXUA 2WHMA 4W84A 4X3ZA 1J0ZA 3AYVA 3KRUA 4KESA 1WBHA 3RF9A 3BPWA 1XLBA 4M80A 3L4WA 3LNPA 1EX5A 3K13A 3V75A 2Z2AA 3GSMA 4J3ZA 2VZOA 3K8KA 4NNCA 4GI8A 2WXDM 2Y6ZA 2HVMA 3B40A 1ZALA 3WLJA 1Q2SA 3KRBA 1XXXA 4WY0A 1FWDC 1DOSA 1CXHA 2P53A 1R9YA 1KM3A 4JKMA 2OEKA 1VRXA 4NL1A 3S2CA 3AHYA 2PWUA 3HG2A 3VE7A 5I3KA 2WMKA 2V63A 2FMOA 5DEZA 3OTRA 4PBFA 3VKCA 1KFWA 2X1UA 1JPMA 4FOKA 1ZZMA 1US0A 1H1ZA 1BF2A 4LUSA 3MMTA 3SR7A 3AXHA 3VC6A 5E6YA 4JIIX 1LROA 3SQLA 1LBLA 2WHKA 4BF5A 3MMUA 3B0VC 3LGDA 3TTSA 1MW3A 3O15A 1TVNA 2YGYA 1JUKA 4H3DA 3QGVA 7REQB 4C6FA 4GNKB 1WX0A 4POCA 3TE9A 2A3CA 3DAQA 5CBJA 4Y9PA 3LV6A 2QJMA 5DQPA 1XR2A 3REQB 1TIWA 4JIQA 3VIGA 1GOIA 3Q67A 1L8NA 1YADA 4O0ZA 4J9JA 1OBAA 1KXHA 2GJLA 1E15A 1H0IA 3MPGA 4D6JA 1RAKA 2PDIA 1Y5WA 4JDBA 1VHCA 3RRAA 1OCQA 4YVXA 1SZRA 2O7QA 4JEJA 1E0UA 5C70A 1P48A 5FJRA 4R3UA 3L4ZA 5BOEA 3FAXA 4F0LA 2WBGA 4IP4A 3V7PA 1CLXA 5DBUA 4EF9A 4HZ7A 3S46A 5TBOA 2ZVIA 1BXCA 2V3EA 3UETA 1TX2A 2FHFA 4GQ0A 4H7CA 4JEQA 1V3LA 1R3TA 3CC1A 2FYMA 1IWPA 1OFOA 4EAMA 1I0DA 2GFTA 4DO4A 1MI3A 5DCDA 4ML4A 2V82A 3G18A 4NAFB 3NAVA 1Q6QA 1OINA 3JU2A 2DH2A 1Y5VA 1VCVA 2CBUA 4JQ4A 3H54A 4PB4A 1EC7A 3G1AA 3GR4A 1IT7A 3SZ8A 1V08A 5JBFA 3R0DA 3A23A 1YPIA 2YYUA 4R53A 1GOOA 1YKWA 4ZSUA 4LF2A 3O0KA 2H6RA 2ISSA 4W86A 3KBNA 2XWEA 2PDWA 2XFFA 1JYXA 4BCEA 3FX4A 1EDQA 4UOQA 2OQLA 4LFYA 3URBA 5DFAA 3HQPA 1K7EA 1UR8A 1FWIC 4X0NA 2QCNA 5H2ZA 1LUCA 1TTIA 2NX9A 4UQ9A 4C6JA 4IJRA 1VFFA 1EYEA 4HNCA 2HXUA 3DG6A 5F2IA 1L2UA 2GGIA 2E0PA 1JDDA 1OGGA 1VB9A 2FJUB 1PWMA 4ZB5A 5LNSA 3W7QA 3KBVA 2I9UA 1DQUA 3HURA 4DBSA 3EKLA 3T05A 3P93A 3BLKA 1TMQA 3W6MA 3K5XA 2J77A 2QGYA 1MXDA 3EDKA 4PRRA 4JIRA 3IJ9A 4QHRA 2F7FA 3VA8A 3B0UX 4IFKB 4R7OA 4I5RA 3KOFA 1JDEA 2PU1A 3W27A 4GABA 4MDPA 4LCRA 3S42A 2ZFAA 2ZICA 1QO2A 4KKXA 1Q6FA 3AZRA 1BYCA 3BAYA 1EP1A 3F4NA 4YYFA 2WHLA 2IKGA 4GG9A 3L0KA 1I2NA 5CPLA 4HU4A 2ODOA 4L6OA 1RJQA 4DI8A 1CB7B 5KSWA 5B7YA 3S1XA 3MYPA 4LYKA 2C1IA 3A47A 2VWTA 3K1GA 9XIMA 4LBSA 4UMBA 4HMNA 3C0QA 3WLSA 2A21A 2H3BA 1RVGA 4ALDA 1I6NA 3IJQA 3TQKA 4H8HA 3VABA 1UZDA 1ECQA 3NDYA 1UZ4A 3QQ0A 1UD6A 3WY1A 4G56A 1T99A 4BI6A 3LCHA 5ABEA 3LRLA 2PWEA 4RNIA 1A0CA 3CPGA 2AL2A 5E70A 2BOEX 3CUGA 3AOFA 4PC8A 3R13A 4RW5A 4GYPA 3IV3A 4Z1AA 2ZZ3A 3UWQA 5TQLA 3IIPA 4DVOA 1P1MA 4PE8A 3KOWA 4UTWC 2PRLA 4LSBA 3BV7A 1NP2A 3FHQA 3AIUA 1DJXA 1XUUA 2J9ZA 1PO9A 1IXNA 4WIWA 2DEPA 4B4FA 1AG1O 1B4EA 1H7OA 3VK5A 3B8IA 2QPSA 5H91A 3ATZA 2GVEA 4J2PA 4KPLA 2CLIA 1EXBA 3HZ3A 1SO6A 1HKWA 1XF0A 3BWWA 2PDJA 3UWWA 1D7KA 4P5UA 1AL7A 3RN6A 1UD5A 3WQPA 5PTDA 1FH8A 1OK4A 3LHTA 1RCOB 2Y4SA 1K8ZA 3B8VA 4P7OA 1FCQA 1HUVA 3ZVHA 4ENLA 4IL2A 3FAWA 1XH2A 1FH9A 3JVAA 4ZCWA 5DANA 4B5UA 4D6DA 2GJPA 4JFTA 3TNOA 1MW0A 4PMXA 3BJTA 3A13A 1V7YA 4HZ6A 2PLJA 3TSBA 1OX6A 3TLQA 1WOAA 4H1ZA 3IUHA 1S5NA 4AC1X 2EJ1A 2HZGA 4O16A 3O63A 4DUVA 4W8LA 4BI5A 3GNXA 5BRBA 3SUUA 1IYXA 3UESA 5GNXA 4EX4A 1QOXA 4WXZA 2HWGA 4XTDA 3R4IA 3T1GA 1KM2A 3IGSA 4FO4A 4BK9A 3MUCA 3WCZA 2NV9A 5FSEC 4GQRA 4IQLA 4YTSA 3LNMA 1MUCA 5D8WA 4D1IA 5TD4A 3OHIA 3VILA 4F0KA 1UB3A 2OPJA 3N9KA 2NXGA 4HSHA 4XD3A 4ZQRA 1E1EA 3L65A 2QVHA 2E77A 1PCWA 5HJYA 3QLDA 4IQJA 3T08A 2YBTA 3HN3A 2W6RA 1QWKA 3LZ5A 1MXGA 3BOLA 4O11A 1ZRQA 2XFWA 1O5RA 1OFRA 1W9XA 3FN9A 3VGHA 2XIBA 1KBLA 4CNSA 4AYSA 2FB2A 5TAOA 1X7IA 4O18A 3SQSA 1QK2A 4GVIA 4A8IA 3SCTA 1OCBA 3HGSA 3C3NA 2J7BA 3G2GA 1MNSA 1YEYA 2XH7A 5HUOA 3TP4A 2Y88A 1Q65A 4JDYA 4FIRA 4REQA 1IXOA 3RJYA 4QE1A 3W53A 3O06A 1LL7A 3ZLGA 2VEFA 1ENUA 2YCLA 2CYGA 1VBHA 5I07A 1RXOB 3WF2A 2VKZG 2OMAA 4GYKA 1VCGA 3NURA 1NOFA 3L5MA 4OT7A 1RQHA 3PWAA 2G0WA 1A5OC 1FWRA 2CU0A 2HISA 2PDNA 2P8BA 4DBEA 4C1NB 3VDBA 5AYXA 4DY1A 3VCRA 1EUAA 4PUDA 4MB1A 5LGXA 3WZ0E 3FYOA 1OYCA 3OG2A 4AUBA 3B97A 5LNVA 3ZS4A 1DIDA 3G1FA 4HMEA 4XB3A 1OT2A 3RO8A 2GYIA 4I3GA 3A6OA 3Q58A 4HNOA 2F38A 5XIMA 3B0YA 2OCZA 2FH6A 3G1SA 4BS0A 4MYXA 4WJEA 1IV8A 4J3UA 1SPQA 1EPVA 2G3JA 1DWIM 4RZ6A 1TPEA 2ACRA 4OU1A 3VM7A 5KMYA 5LIKX 3BE7A 4KMQA 4RPQA 4D6FA 4JN8A 3CZJA 4NILA 2Z7GA 3WL1A 2BS9A 1GYLA 1XH0A 4CNNA 3W1AA 3GUGA 2QF8A 5I3HA 4KFNA 2CXGA 3EOLA 3WQGA 2INEA 1ZAIA 3NVDA 3VMOA 3UYCA 4CEUC 4YIWA 3OB8A 4C5YA 4Z08A 4R9OA 3MZNA 1ESWA 3N6JA 5ENLA 1E0XA 3MI2A 4KEZA 2R94A 4IQEA 3JZEA 3CAVA 1Z48A 1QWGA 3UGRA 3SUVA 3LRMA 3IEBA 3CUJA 3VO0A 3LS9A 3STCA 1ITQA 3CLWA 2WMIA 4NX5A 3CQKA 1KM4A 3H8AA 3W7NA 3UJFA 1TKKA 2DORA 2J7HA 3QV9A 4KT2A 3EMZA 4J35A 3EYPA 3FJ4A 1EGMA 2OO0A 4UNIA 4EXAA 2ISFA 1CPUA 1TCDA 2Q02A 3O07A 3J7HA 4F0RA 3RO6A 4E3TA 3SIZA 3CV7A 1CT5A 2HROA 4LALA 2E1DA 3MYOA 3NPVA 4Q4KA 3YPIA 3BW4A 1IEWA 1V03A 2E8ZA 3TFCA 2W79A 3ZWTA 4BHYA 5I77A 1XIMA 3U7BA 3AYSA 3LLFA 2WZEA 4A21A 5I09A 4L4OA 1FRBA 3LB0A 2E7FA 4YMZA 3WO8A 1E1CA 1DJNA 2PDBA 4QISA 3IVTA 4B91A 2V67A 4CD6A 4BWLC 4NZJA 2WO5A 5SWUA 4UR9A 3CH9A 5J5DA 4V1XA 5D38A 3THAA 3TW9A 3E49A 1QI0A 5AOUA 1DXIA 3BH4A 4MG4A 3TLLA 1J18A 4I7UA 4WY0F 2ZX7A 1BTCA 4TU1A 5A6LA 3AHZA 3CZLA 5C8BB 5FI8A 3M5ZA 1LBMA 4OZOA 1GVEA 1UZHA 2XHYA 4AIEA 4UR7A 1UKOA 1DJGA 3STFA 1XYCA 1P0DA 1YXYA 2P88A 2PGFA 3LDVA 2VFEA 1BSLA 2VL4A 2YKKA 3ITVA 2EJAA 3D47A 2XIQA 4JKKA 1R47A 4WX2A 2Y61A 4C6KA 1GKRA 3BCJA 3TONA 4LRSA 3HGJA 3N2CA 3DXIA 2CPUA 3GO2A 3HOJA 5I3FA 2OJPA 4PEEA 3KL0A 2CESA 2YXOA 4C6EA 1L6FA 3CQHA 4DO6A 5I03A 3TROA 2NXIA 4W87A 3E12A 3OJGA 3ARPA 4DXKA 4Y9NA 1UH3A 3TTYA 4HJWA 1SGJA 2DW7A 4FXSA 4JFSA 4WOZA 2QF7A 2PP1A 4ZOEA 3VKJA 4O1BA 1HKIA 2J88A 4Q4PA 1D7FA 3KW3A 3TMQA 3PTDA 1B9BA 2R24A 2QIIA 1UWSA 3MHFA 4HHHA 4IUOA 1S46A 4ZZ9A 4N9DA 3W1MA 1OVDA 4HT3A 4PBGA 3VGDA 1EF3A 1H50A 3DI1A 5D9MA 2IKJA 1VEPA 3FVMA 3AQUA 1SMDA 3CIXA 2V5KA 2QZRA 5HJLA 2EXOA 5AECA 1EXPA 1VF8A 1J10A 3AMLA 3PNZA 1UR1A 2IXVA 4CKQA 1W1TA 1F76A 5EYWA 5FIPA 2VGGA 2Q6ZA 4Y96A 5A5WA 3LTYA 2GOKA 3OVPA 5F1UA 2Z2UA 5GJMA 3OBEA 2ZZ7A 5FACA 3FXGA 1JD7A 3ARQA 1Z89A 3R58A 2YA2A 1SR9A 4XV0A 3IIXA 4H41A 2XVNA 1NP0A 4GCXA 2XZ7A 1NWSA 5CSYA 2I5GA 3TN4A 4O50A 2ZTJA 1E9YB 2JGYA 5JVLA 1PDZA 3QLLA 4MPKA 4QLLA 3ABOA 3O7UA 2OLHA 3GUWA 3VNYA 3G0SA 3M0IA 3GIYA 5M17A 1OGSA 1YPFA 5AHIA 1EFZA 1EL3A 5CJNA 3R7MA 4OHQA 1P6BA 4UTTA 2QGHA 4PMZA 1VFSA 1G7UA 5EGRA 4UQCA 5JIWA 4ZBCA 4PTVA 5MHBA 4UC5A 3SGGA 3RLGA 4AHQA 1K6AA 3GM8A 3GFXA 4NASA 3MHGA 1AMKA 5MKGB 5HA7A 4HSNA 1H7WA 1ME8A 2JQXA 4HCLA 1O66A 2WZTA 2YSWA 5C5YA 2R14A 3CB3A 4DHGA 2WHJA 1IR2A 5CPSA 1CEOA 1MSSA 1DIOA 2F2HA 4A2SA 1POKA 3PUOA 2PBOA 2I1OA 1S38A 4YVPA 2MUCA 4LVBA 1B1YA 2VC5A 5AYZA 3L2IA 3HIJA 3INPA 1OD8A 3QYSA 2ASHA 1MVYA 4JYDA 3QZEA 5BXPA 3C2OA 7XIMA 3FJLA 5EFFA 1DPMA 3RLVA 1LWJA 4PMNA 4CCEA 4X0VA 1J8VA 4KW2A 5AZ0A 1A0DA 3M6YA 3TWAA 3QY7A 3CASA 4QROA 5DXYA 2HEJA 2B7QA 2VURA 1F3EA 3SFWA 3T78A 3WDRA 4KGJA 3Q4DA 4V33A 3QY6A 4XZNX 4GD0A 2VC9A 1ZHAA 1BFNA 4LAUA 3NQEA 1YDOA 3PFMA 1L0PA 1TV4A 2CZDA 3OEXA 3GC5A 3PY2A 1QRQA 4B9ZA 5I0DA 1BTMA 3N9RA 2DDXA 3EKZA 4WDWA 4LANA 1JNEA 3PB2A 3HGOA 4HU0A 3GHSA 3W1NA 3WD2A 4JL2A 3S6TA 4FXFA 3GTFA 1U2YA 3Q37A 4MWAA 3L2MA 4JN6A 2DZBA 1TSIA 4IUGA 4WVXA 2TPSA 3M0KA 3STEA 3H2FA 4AZIA 4UTWA 1PHWA 3W86A 3LXCA 4JL1A 1DQWA 2Z6JA 5JIPA 3KBJA 3AIQA 3TYUA 2QV4A 2IPWA 2ONEA 4YHGA 1W56A 1XYAA 3G1DA 4ASTA 4RNHA 5G5IA 1E51A 1JR1A 2QS8A 2W67A 1YDVA 3QHMA 4K1WA 4E4PA 2C18A 3ABXA 4PL1A 1UP3A 4Q4MA 2D22A 4Q8PA 4XIAA 3QQ1A 4KWWA 4CQ8A 2PD9A 4EE9A 3GNRA 1VS1A 2ZRWA 2J4GA 3PZTA 4OOUA 4HA4A 2VX6A 3HPAA 2EEXA 1VENA 4JQ2A 3IAPA 3UJSA 1CDGA 3CGTA 5A94A 4RV3A 1JG9A 3GHTA 2AL1A 4DRSA 1JPIA 1JJKA 3K1DA 3MUAA 2YL5A 1B2YA 1EJRC 2PWFA 2F9RA 3IGHX 1EDGA 4J40A 4PTMA 1ADSA 5BXSA 4R33A 3FS2A 1PJ9A 1U5VA 1BXBA 3MZ2A 3KCJA 4P7QA 3F2DA 3Q94A 4ZTYA 3BK0A 3CHDA 1UR4A 1BLIA 3MI3A 1CW2A 1U5HA 1VH7A 2YA1A 3H2AA 3LPOA 3PG9A 3AALA 4QRNA 4B5SA 1EZWA 3SUTA 1UD3A 4YTTA 1YMYA 2FHCA 1US3A 2GWGA 3ZQ9A 3B03A 3UEQA 2DP3A 4DXVA 1AQ0A 1GZ1A 3WDIA 3AIWA 4GOAA 3W88A 2X41A 3EWYA 1W3IA 4ZR8A 1C8YA 5LIUX 2DUZA 2XN2A 5DX7A 1SMAA 1KTNA 2CITA 1VRDA 4JX4A 4GKLA 5DMNA 2OT1A 2V8ZA 1JZ2A 3UWEA 4M82A 3R2GA 3GFYA 2PODA 3WD4A 2QKFA 3S4TA 3VZYA 1OC7A 1UBPC 3AIEA 5FF7A 1FCBA 1R6WA 4L9XA 3WBYA 1DE6A 1VIWA 1ADDA 4GBDA 3B05A 4J28A 1CXKA 5I5RA 1W3JA 1QI5A 1R9ZA 4XSLA 4JTGA 2ADAA 5DCEA 3AAMA 2E5DA 1XCXA 2CHNA 3OIXA 3PWIA 2UWFA 1HJVA 1SR0A 1XW8A 3KX6A 1FP9A 2C1GA 1FWHC 2QVNA 3P14A 4ZEPA 4K39A 1QAPA 1YIXA 4DF1A 4RV8A 1QCWA 2QCEA 3AMGA 2GWNA 4GA8A 4PMVA 3VIJA 4ZTXA 2J62A 3P0XA 3VCNA 2WMFA 2AL2B 3LCWA 3KBWA 1QW8A 3THUA 3V3WA 1EO7A 3L66A 3PBMA 3IIVA 5FJPA 1NSJA 4M24A 2DZSA 2WLYA 1TZ7A 3HG5A 3ARTA 5E0FA 2ZA1A 2R1PA 4NP7A 4B16A 3WUGA 1T5AA 4ZSTA 4IMAA 1MNZA 3T0TA 1XFCA 2WQPA 1E1CB 3I4KA 1J96A 4CCCA 4TIMA 2AQWA 2OGYA 3BURA 3W7RA 4TX9A 2X0YA 4L9ZA 4OUEA 4O1AA 3NZQA 2ZCGA 4ATWA 1QTWA 1HXJA 1A5SA 1XLHA 2GGEA 4QJ3B 1H7RA 5CJ5A 1NOWA 1I60A 4LB3A 4U3AA 4P8WA 4J5NA 1I8JA 5AB3A 4H04A 4H9ZA 3NQ6A 3R5EA 5LHFA 2AAAA 2FDMA 4HNNA 2J8GA 1TO3A 2VCAA 1QASA 3O3RA 2ZC8A 1UOKA 4MNLA 4MJZA 4ZXOA 1HF6A 4AZCB 1XIEA 2J7EA 3VU2A 1KXVA 4I7VA 7TAAA 3MP3A 1HP5A 1BWVA 1A5MC 3M16A 5BOFA 2OKOA 4HPJA 3QW3A 2PDGA 5CGMA 4ICCX 4JHMA 3KTCA 4G1NA 4Q8QA 3VNJA 4IFRA 1EBHA 3IPWA 4NXKA 4CNUA 3DESA 2QUMA 2VQUA 4RXFA 1HO1A 1V3IA 4GNJA 2IQDA 2QCLA 4MB4A 3UY8A 5D32A 1U83A 2OB3A 5AHFA 1KFLA 3OQEA 3H2NA 2DT3A 2HPIA 4IIGA 4TOQA 2GDUA 3LCXA 2ZE3A 1RHCA 3DFYA 4TV6A 5KETA 3RM8A 3O6DA 3VNLA 1ZCCA 3LY0A 2HK1A 2WOQA 3GR8A 4O10A 4WK9A 3BLPX 1C8XA 3R0KA 1PSCA 2FFIA 4Z2HA 2VP8A 1HIZA 2WW5A 2PC4A 4WXYA 4CQ9A 2ANUA 1X8FA 4GH3A 1JCMP 4W5UA 1XLIA 1FOBA 4DJFD 4Y7EA 2AKZA 4AVFA 3ZM8A 4NNBA 2C0AA 3I65A 1IXQA 4KCTA 2XYLA 4JXCA 1GG1A 3TR9A 3W28A 3MSDA 2Q01A 3SADA 3E02A 4UBPC 3N25A 3ZJ7A 3BL3A 4QNEA 2QJNA 4E8GA 2QJGA 3VX1A 1T6MA 1Q7QA 4B5WA 1FWJC 3WNKA 2E9MA 2PS2A 1O5QA 1CB2A 1Q8AA 1LP6A 2IMRA 1EA9C 3B4UA 4HA0A 2CBIA 2Z1XA 2Z00A 3HJEA 5BW6A 2OELA 1GONA 2ALDA 5CGQA 3EAUA 3B8SA 2OSWA 3DG3A 4IXXA 2C79A 1NELA 1J0YA 4V2XA 3NQCA 1V6VA 5A1AA 3ELFA 4P7NA 4HB7A 3R25A 1JD9A 4XVEA 2WCGA 2V2CA 1QK0A 3ENLA 3CL7A 3MS8A 3C0JA 3DCPA 2B4GA 5LKYA 4CQAA 5J04A 1LJYA 2EPNA 1CCWB 2YYTA 3GU2A 3W1TA 4N6FA 2HQAA 1FCUA 2A7RA 2HMCA 2DFAA 1JCXA 1JUEA 1ISYA 3SM0A 2NQZA 3AMKA 4AWUA 1M7XA 4WHBA 4CLMA 1X8CA 5LHEA 2VT0A 1Q2RA 2BVYA 2BY0A 3I3DA 3URQA 2QLYA 4Z2JA 1EJTC 2B7OA 2UY5A 1FH7A 2ZBTA 7REQA 2FKPA 3T40A 2E25A 4IGNA 1YX1A 3B9NA 3UYIA 1KO0A 5CC3A 4PFMA 3QBUA 3OOQA 4ZOAA 3AMDA 4OQVA 3C56A 4FPSA 1TJ1A 2G41A 2QNEA 3MSRA 4NAFA 1MO0A 2PF0A 3OO2A 3TQPA 2W66A 1NOUA 3WQVA 4Z0SA 4JY8A 5FEZA 2ZUVA 1E71M 2ZRXA 1WXYA 5L9FA 3MANA 5FSDC 5I00A 4A8RA 2EBNA 5BROA 3WBEA 4F0MA 3BANA 1ODUA 5I02A 4QLJA 4K3ZA 4ZE5A 4ZQNA 3NSNA 1KR1A 1J9YA 3UXAA 1V5XA 1TUFA 1UP0A 4IMGA 4AD3A 3OYZA 4GZEA 3CAQA 5EU9A 3W7OA 4LVAA 4CD8A 5DY2A 1O60A 1RBAA 5FF0A 4HP5A 3I7RA 2VR5A 4JNYA 3FKKA 4M7TA 3TJ4A 1QHPA 1TG7A 5ABHA 4S2BA 1ITUA 3QSTA 4JTAA 3LTSA 2Z1VA 3BSMA 2PEVA 3LU2A 1K4HA 1BVZA 4JZ5A 4DUWA 1ZCOA 3PZIA 4KIEA 4AIBA 1Z32X 4DZHA 3VOHA 3GU1A 1T7LA 2WKGA 2JIWA 2OO6A 3PAOA 4PMQA 1LTDA 1JI2A 5FKYA 3D3AA 1TV8A 3O2LA 3B4YA 5F1VA 3FA3A 4GQQA 4MB5A 1OWQA 4AXKA 4FSAA 3TU9A 1M7OA 4AZ5A 3R94A 1Q6CA 3EA1A 3UZJA 3BZGA 3EWZA 4W8AA 4Y90A 4DNMA 3M7SA 1HFBA 4N4PA 2YDSA 4AZBA 1QPRA 1M1BA 6TAAA 3CUFA 2Y8UA 1C9DA 5AYIA 3WUEA 3QTPA 4IG2B 3WQCA 3LCFA 3EEGA 5G1YA 3NA8A 1RK6A 3ANVA 3O9NA 3CPUA 4MOZA 4PTWA 2YIHA 4C6OA 3MDWA 1VBUA 3RCNA 2GJXA 3SRKA 4HA3A 5IM51 3T0DA 3NPUA 3A4JA 2I5IA 2DZWA 2G5WA 1D8CA 1B30A 1KRMA 1E73M 3IACA 4FA3A 3VOJA 4JTEA 4WGHA 2V68A 3ZR4A 2POZA 1BGAA 3W83A 3BXWA 4IXHA 4U10A 2WK2A 1NQKA 1KLZA 1U33A 2OZ8A 4E8DA 1TELA 2OFJA 4OVXA 3G1YA 3FHAA 2G97A 4O19A 1SSDA 3A9IA 5GPRA 3FYYA 2XSXA 3LBOA 1XGDA 3WQDA 3MB9A 1OB0A 3WLTA 2NUWA 1QO5A 2H8XA 3KLKA 2PU0A 3A4AA 4JFUA 1Q4WA 4AIOA 2C15A 4MF4A 4CU6A 1NEYA 4IGSA 1WE5A 3NVTA 2DSKA 2PI6A 1HKVA 4GUHA 3VKDA 2NT0A 4PRTA 1VQTA 1I2RA 4GIAA 3CEPA 3UR5A 1H1YA 5E9AA 3URAA 5EMJA 4ROPA 4DJFC 1UHVA 2B0MA 2O0TA 5KEZA 4GMEA 3FGCA 3U48A 2G95A 4PTNA 4L6HA 4DUOA 4WCJA 2BY2A 1MZRA 4QEEA 4UTIA 4L4MA 4BA0A 5I24A 4V1YA 2C16A 4GH1A 4NF7A 4L65A 1OT1A 1A49A 3PUGA 4UMAA 3COTA 3EX2A 2EAWA 4MWAD 1KWKA 5ABGA 2KAUC 3IV8A 4C65A 3KTXA 4LBRA 7TIMA 1TREA 1C91A 1FKXA 5LYRA 5EPDA 2CEQA 2XM2A 1XYBA 2OX1A 4DIAA 3VFLA 3MBFA 4K8HA 2GVLA 4GI6A 2BFGA 3C61A 2VEIA 2GUBA 2GSEA 3OZYA 1AUSL 2J27A 1UZ1A 3KVJA 3GVGA 3UZYA 4B4HA 2C7FA 2QQ6A 3QR0A 4LCSA 1EYWA 1V02A 4JTIA 3W9ZA 4K7VA 2X2GA 5C2XA 5DRIA 2GLKA 4LV9A 3DBNA 1TX0A 4YXGA 2XWDA 5JH2A 1KTCA 1XDJA 3URNA 1PWLA 2PP0A 2W0UA 4ZA0A 2BZNA 1H3GA 3CH0A 2ZUNA 3BJFA 1K1DA 4M81A 2EPHA 3HPZA 3MWCA 2Z29A 1E9IA 1H60A 1VD6A 2PSNA 1HN1A 4Q7NA 3UWZA 1W5QA 3DHFA 5A2CA 3LN3A 4X60A 1SW0A 3MHUA 1QHZA 3RPTA 1TV3A 3M9YA 4N6EA 1XCFA 1A50A 2B7PA 4WJXA 2WJZA 3VZZA 2AMXA 1QMLA 4DI9A 2FTWA 1S3HA 3VNZA 1PX3A 1GOWA 4YL2A 2JEQA 5BRPA 3L4TA 3PPFA 2Y7FA 3AMCA 1XLAA 3ES8A 5C9UA 1GJWA 1TJ2A 1A4LA 2YCEA 4JD4A 1B3XA 2PPGA 3A3XA 5FF4A 1KTBA 4FX8A 1M65A 1N2VA 1QBAA 2PDKA 4REQB 4MFDA 1NTHA 1RK5A 3B8DA 3WDQA 4NAEA 3MW7A 1DJHA 1G67A 1CXLA 4I9TA 2SFPA 1WXJA 2PZ0A 1UR0A 3CUIA 3PNUA 1XLMA 1XLKA 4OWGA 2PB1A 1NDVA 3N6QA 1U1JA 2D3NA 4QQ3A 1XISA 1YDNA 1ODZA 1TFVA 1HKJA 1X38A 2J47A 4DWSA 1QNQA 3BSHA 4DELA 4XD5A 1PX4A 3SRHA 1JXKA 1NF0A 4K8GA 1RUSA 4GFSA 4NJHA 2WPBA 1UMLA 4LTSA 3KWSA 1NU5A 3LRKA 4HHLA 1A53A 1FWNA 2ACUA 1W5PA 3BMVA 2H9AB 1W2PA 4H9VA 4K7YA 4YTQA 4P7RA 2VHLA 2OG9A 3VIKA 4H83A 2NQLA 5K2ZA 3WLKX 1DWAM 3B3DA 4JTUA 3CPRA 2ABAA 4LXFA 1XRSA 4RE3A 2FTYA 2I9EA 3KS6A 4LBUA 5KZDA 1EGZA 1Y7VA 1PIFA 2WJFA 4LJ3A 3TZFA 3WBAA 2RGMA 3DBPA 4DJEA 4AHPA 3BICA 4TMCA 4Z2KA 3VZXA 1E6ZA 1E70M 4CCDA 4YPJA 5M1TA 5EA9A 1FWTA 4R85A 2QULA 2OYKA 1EQPA 4JHOA 1NDZA 3VUPA 1TRIA 3EWBX 1TUXA 9CGTA 1E3XA 4RNFA 3L0NA 1P6WA 4DWSB 5CBIA 2EG8A 1G1YA 4HZMA 2VC7A 2JIEA 3ALFA 2OLSA 1RVKA 2Y7GA 1XSIA 2PLKA 1W9BM 2W5FA 3MMWA 3BMWA 4GIEA 1E6NA 3GHUA 3ZMRA 3C8NA 3CZEA 4EVZA 5I78A 3MDUA 2RDXA 4YNGA 3AIBA 3OZPA 4DJDC 4Y9AA 2Y8VA 3G1VA 4ATDA 1HL8A 3O1NA 1EJWC 1B54A 3U2CA 2H90A 5I7GA 5CPTA 1GZJA 1C92A 3BTNA 3LXAA 3FSUA 2WJEA 5MKGA 1C90A 1XICA 2HCVA 2VEGA 2I14A 2QEZA 5FA5A 1KW1A 1H5VA 2FHBA 1EQCA 1GVIA 4HCDA 1XFBA 1U5JA 5E5CA 3TCEA 4MWAB 5D2YA 4FI4A 4GGBA 2O56A 4DXXA 2FVMA 3S9IA 1KR0A 1I75A 1KFCA 5AVHA 2OSYA 3KZSA 2G8ZA 1PDYA 4ZXLA 3SECA 1V3KA 1YNYA 2XPKA 3QC0A 1H1NA 4L1WA 2DSWA 1W5NA 1XIFA 3EB2A 1VCFA 2QHAA 3T8QA 3W1PA 3FDGA 3WQEA 4UOJA 1XRTA 3GDRA 4JFVA 4H8VA 2ZUMA 4F8XA 2E9BA 3NQDA 4BR1A 2CLKA 2JBMA 3WLQA 5FL1A 4ZQCA 3PZNA 2YCIX 2VXNA 4HCHA 3WX7A 2PGEA 1SW3A 1E4IA 2YLLA 2DIJA 3U6WA 1TYGA 4QFUA 1QNSA 4BEQA 3LPGA 3GVWA 4B5NA 5BOOA 3T07A 3H22A 2PCEA 1B3VA 3WYZA 1VFTA 3F1QA 3PR2A 3H23A 1YXCA 1O95A 1AL8A 3S1VA 1L8PA 4HNUA 4IGHA 1XPYA 3U2EA 3QTGA 2PTWA 3GC2A 1JUBA 3WFZA 4B3LA 1WZMA 3LEPA 4QGCA 4S3GA 3QR1A 4P8UA 3RU8X 4NZ5A 1ISVA 4MNKA 4M19A 1RCQA 3GXMA 1LCOA 3BAJA 4RNJA 5K3VA 3ZT5A 4IQDA 2VZUA 1RA5A 3SBFA 3VAVA 4XSMA 3R79A 3LK6A 4O1EA 3VINA 1TPB1 1J6OA 3WEOA 2DSUA 5EBAA 3IANA 1I0BA 4PB5A 1KGXA 5KZMA 2PFHA 1XX1A 3WBWA 1N55A 3NQFA 5L6UA 3QOKA 1XKYA 3UR8A 1F6YA 4A3UA 3KBMA 3CYJA 3W2NA 2HPMA 4W85A 3P5ZA 3KOYA 2R1KA 3W1QA 3SAZA 4AX6A 3G0XA 3NQ2A 3UR2A 4KETA 4EPDC 4JNZA 4IIEA 3VD4A 3K8MA 5T91A 2BVTA 3NCOA 2GK1A 4B5TA 4KRZA 4Q8OA 1VR6A 3M5YA 1JCLA 1J0HA 4GFIA 4PUWA 1XLJA 2X7VA 4EKJA 3BSGA 3NFUA 1V51A 3W4RA 2G3NA 2BG5A 4HNLA 2QDDA 3B9OA 2CLFA 4C7GA 3LLXA 4XX6A 4RKAA 5AC5A 3CBWA 1UWQA 2E5BA 3HB9A 1LQ2A 4QQUA 4RK8A 1EGVA 5BYWA 4UFIA 4Z1DA 2G4FA 3QVQA 1Q6EA 3OHMB 2J74A 1IXPA 2QPUA 3RLUA 4HIBA 1FDYA 3MI6A 2PTYA 3W02A 3S6DA 3PM6A 3MO7A 3S8HA 3IJ6A 4W88A 1WDQA 5E93A 3D46A 2PDXA 1EC9A 2V3DA 3U3HA 1WQ5A 4Q4SA 4B92A 1TWZA 3VFCA 2JKPA 3NPXA 2XSAA 3ITOA 3V0SA 1N8WA 3B8TA 1OM0A 2YL6A 3SB0A 1EKOA 5M5DA 2PWGA 4QIUA 2ZUUA 4RE2A 3H53A 5AHLA 5CJMA 3GWQA 4IIBA 3TOPA 3DDMA 4C1KA 3EOUA 3AYTA 1ICSA 1SFTA 2RJGA 5CLTA 3TN3A 1TZ9A 1M7JA 2HBXA 3UPMA 4FNUA 5DN1A 1UQZA 4UTFA 5HULA 4Z2LA 2WNZA 2R6OA 4UFMA 4YYCA 4QCFA 1E40A 4A6GA 1S2AA 3DFOA 4GRSA 4X63A 2XSBA 4LF1A 4LC8A 3GQYA 1EZ2A 1W9VA 4GX9A 3K2GA 4MPQA 4C7DA 2A0NA 3W87A 1S5VA 4AD2A 2NV1A 2WVVA 5BXRA 2BWGA 2YPIA 2VX7A 4CU7A 3LSCA 3MQTA 3SSJA 4NZFA 4QJ5B 1PKYA 4MKNA 5LA0A 4FX7A 4G9PA 3RPMA 3RFAA 4C91A 1OHLA 4ZMGA 3VNDA 4HTBA 1WO2A 2ZUSA 4NI8A 1JL8A 1GQLA 1T0OA 3SQMA 3GVVA 1XI3A 3OVGA 2CHRA 1Q6OA 3LM7A 4AWTA 3ZZ1A 3G6MA 3SDOA 4I9JA 3O6YX 1TMHA 1FWEC 2P50A 2YA0A 2E8YA 1I2OA 3GBDA 3GIQA 1VFLA 3IAQA 3TW7A 2PRHA 2OU4A 2R1NA 3AICA 4DWDA 3TXZA 3S3GA 3HU7A 2ZRZA 3IGXA 4GE8A 1UMYA 2X16A 3W7DA 1H0GA 3KL3A 4LH8A 4QE4A 4TX8A 2DT0A 3NQVA 4Q4OA 3S2NA 3PS7A 1CTNA 2F84A 4TTUA 1L9WA 2EQDA 3N4FA 1YDYA 3OZMA 4ONVA 3UBPC 4AYGA 3FV9A 4DYKA 4PZVA 2V2DA 1PB0A 4UWMA 1A47A 3LHYA 1KKOA 1QPNA 3NGFA 3RMEA 1OYAA 1Q7ZA 3QSRA 3SY5A 1G94A 4CVUA 4DQWA 1VYSX 2NX3A 3M41A 3HGRA 1R7OA 2V81A 2P0OA 2QYGA 1XG3A 3SCNA 3HPXA 4FOJA 4KQNA 2I17A 3U5UA 1VFMA 1AZ1A 1WBJA 1VLIA 3ABQA 1X97A 2ZIDA 3I6RA 3UXKA 3STPA 3P67A 1KBKA 3MUY1 3T2PA 3CIWA 2JE8A 3L68A 4F2BA 3E3HA 3P61A 4Q33A 2BHZA 2NWRA 4AISA 3PZOA 9XIAA 1PZ3A 1F7BA 2D0GA 3WIJA 4HVXA 2PGWA 3KCLA 2A7PA 2CCRA 3N3TA 4JAWA 5DT7A 4EANA 5HOSA 3WH6A 3VXGA 5D30A 2L5HA 5HBFA 1ZB5A 1TB3A 1QOPA 2GVGA 2V6AA 4M6VA 3H70A 5AC6A 3KTSA 1UJQA 5A3HA 3OIHA 2R1LA 2WZIA 5AZ1A 3W37A 3UZZA 2E5CA 2QUNA 2IQ0A 1J4EA 4RE0A 2OYMA 4PSPA 1DXEA 4FF7A 4GYJA 3QM3A 4XAYA 3WFLA 1MW2A 3EWXA 4H01A 3PFRA 1WB0A 2VX4A 1IF2A 1S2VA 3BLLA 3NZGA 5GVJA 2QCGA 3XIMA 3NQ7A 3VD9A 1UKQA 4PFHA 3RUBL 2FZBA 2J6VA 3U4FA 4PMOA 1UR3M 2EPKX 4AVNA 1QR7A 2OEJA 4FX6M 1B3ZA 3CO4A 1JVNA 1HO4A 2GQAA 4Z42C 1W37A 3QMRA 1QDSA 3RNDA 2YX0A 3KOXA 4Y9OA 3T2OA 1YPXA 3WQ4A 1H41A 1VIZA 4QJ1A 4H19A 3USBA 3VX0A 4M0XA 4E2DA 1VC4A 3N12A 1XBXA 4G2DA 3ZWSA 1KM1A 4LQ1A 1SUXA 2CZFA 4FEZA 4TO8A 3GU9A 1OFBA 3PPCA 4DO7A 1X1NA 3W29A 3G8EA 5IBXA 4J7RA 2CETA 1H62A 4NSBA 3DX5A 5CSSA 1NM9A 4QITA 5FEPA 1W5MA 3L7RA 3IWPA 3M0ZA 1MWOA 4PUUA 2FH8A 2JGQA 2HK0A 2IPGA 4LEFA 1WZLA 3E2VA 1WAUA 2Y7EA 3WENA 2I56A 3SURA 9RUBA 1OC6A 3CHFA 4IF2A 5ABFA 4AWEA 1EEPA 1JGIA 3NYZA 2ZZ2A 4OBTA 1TWSA 2FLIA 4PH6A 2J8TA 3WL0A 3RG6A 3LGGA 2Y5JA 3GX9A 1XH1A 1DHPA 3MU7A 3MC5A 4JTJA 2RGLA 2BY3A 3BARA 4AEOA 2WYSA 4CCZA 1W5OA 3W71A 2WPGA 2BVDA 2QIWA 1B3YA 1ZJIA 1B3OA 5C6MA 1J0KA 3TAKA 3CV6A 3IJ8A 1DHKA 3RMJA 1CENA 1YBQB 3U57A 1FBAA 1EIXA 3UCCA 5CH9A 2GQ9A 3LHWA 2E68A 1M41A 3NJ3A 3KEHA 4IPJA 4Z1CA 4TX6A 2X1IA 3L5LA 3TSMA 4ZGYA 3UJRA 3ECQA 1A5AA 3VOFA 1P5BA 2DJLA 4O8RA 3NL5A 3AYRA 3PTQA 2XTKA 3VNIA 3B9AA 4RLIA 1XBYA 2QDEA 4G7EB 2YZRA 3S83A 3CNYA 4FIQA 2INFA 5ABFB 1OFPA 1I4NA 1Q85A 4A8LA 2VOMA 1W3HA 3C2VA 2DZAA 2CLEA 3WQOA 1LLOA 4P2VA 1HG3A 2A79A 4J4KA 4XTIA 3QZ6A 4AMCA 4ADSA 1VPQA 2BGNE 2F61A 1UWRA 5A8MA 2WKJA 1G4EA 3NQBA 3UXDA 2FVLA 3FEMA 5DMMA 3WQ5A 5HINA 3BGAA 1E4LA 1KM6A 2X09A 4N0RA 1AFSA 4JIEA 3PULA 2NLYA 1PIIA 1GK8A 3EX3A 4PR4A 1QU4A 2QJHA 3ZYZA 2GUYA 1HKMA 2NWSA 3MP5A 3BW2A 5CEWA 1IZKA 3ZR5A 2NZLA 5LIYX 3N3MA 3W38A 3NDOA 4JQAA 5IBXC 8XIMA 3W07A 2CW6A 3CO8A 5CAKA 1KV5A 2YZ5A 3ZJ8A 1U1HA 1Q6DA 3E2SA 3GKFA 4QX4A 1GQIA 4FXJA 3KHDA 3CB8A 3M0JA 1QPOA 4KWOA 3GG8A 3ITGA 1PPIA 2FZDA 4PUKA 3W22A 1K8YA 1W1IE 4HU8A 4PCNA 1W1VA 1K7XA 3PN8A 3M5XA 1JPKA 4S3DA 1TWIA 2OQHA 3WJZA 2QUTA 4ZQOA 1ZP4A 1QNVA 5LA1A 5HWNA 3LCGA 1XIBA 2XG9A 3FNDA 3BLOA 3VE9A 2ZRVA 1JQVA 3WSUA 1XDMA 1L6SA 4UTUA 5FJOA 4I5XA 4PODA 3RILA 2BTMA 2HRWA 1AMYA 1SM9A 4PBEA 4ZVJA 4F40A 5LNRA 3GVRA 1YQ2A 4JX5A 5D2VA 5A6MA 2V9DA 1RP8A 2X2YA 4CN4A 2D24A 2VNCA 4MTVA 3W7GA 4M6PA 2CXEA 5E0CA 1BEUA 4CU8A 3AU6A 1XLGA 1W1ZA 3V5OA 4AFYA 1WKDA 1MMFA 2AAMA 5C2GA 1WUFA 4DNHA 1DWHM 2E4TA 2Y85A 3ICJA 4M1RA 3NSXA 2GGGA 2E3ZA 2TODA 2A1YA 5AYBA 2PF8A 4H8UA 3ES7A 4WD0A 3D6NA 3LG3A 3GFZA 4H9XA 3ZVHB 1GPWA 1J11A 2YCKX 2WKLA 3DEQA 1HJUA 1LBFA 4FLRA 3HPFA 2VFGA 5A2BA 2ZX9A 3S1WA 4O8AA 4ZOCA 4Q6JA 3SCQA 1EJXC 2DUXA 5GNYA 3FOKA 4C7FA 4AY7A 3KE0A 5LSMA 1PTDA 3N04A 3W1XA 2WBKA 4LUJA 3DHUA 1W91A 2Z26A 3BQ6A 3N1AA 2OWXA 2PBGA 4QAWA 1OZQA 4XAPA 3VGFA 4EIVA 4BY3A 2BGSA 5I3DA 3N15A 2QXWA 2ZQ0A 3KZPA 3W75A 4F2TA 4H9UA 3STGA 4ORMA 1UR9A 1SZGA 3P5YA 1HJXA 3CTLA 1S3TC 1CLVA 4GVFA 3T4WA 3DECA 4TXEA 3ARYA 4Y2WA 5LIWX 3ITTA 3RXZA 1VGAA 4M51A 3LERA 4K36A 2H9AA 4O12A 5IHSA 2DZPA 4MAZA 4XZLX 2NUXA 4CD7A 2IS7A 1FWGC 4WSHA 4R7WA 1H63A 2Q8ZA 3C4UA 2GDQA 4PUMA 3NO1A 1SFLA 1EHNA 1BYBA 3H55A 6XIMA 3BAWA 2DZTA 4Q7BA 2Z2BA 2P10A 2PDCA 3TNBA 3SN0A 4UMCA 2ZX8A 3PHAA 3GC4A 1XGZA 2P8CA 2C0HA 3MTWA 3L4YA 3UWYA 1OADA 3BC9A 1LOSA 4ZE4A 1EUNA 3VNMA 3CZ8A 3H2OA 2E28A 3UR7A 3LHZA 1PXGA 1S5WA 3PZVA 4IWWA 3C5QA 4XBKA 1DV7A 4ZQMA 2RDWA 1SYTA 2ATMA 4U5KA 4O52A 3SCUA 3M07A 1ZENA 2DZXA 4H00A 4L61A 3PJUA 3SW6A 2B7NA 2J79A 3V4BA 3SRDA 3DC0A 4TUFA 1R2RA 2J9XA 1CYGA 1YXDA 2XVGA 3WN6A 5JBEA 2TMDA 2WVUA 3BAKA 4OTKA 4GZ7A 2DIKA 3N29A 3JUGA 4R27A 1KGWA 3LUTA 3A4WA 1HTIA 1KB3A 4UCGA 1VJZA 1F4AA 4DJFA 3MCOA 1RV8A 5CZJA 2G3FA 1W9UA 5D05A 1R87A 2YB4A 3LQGA 2Q3RA 4E8CA 2Z24A 1BRLB 3KM8A 1Y5XA 1NDYA 1A3XA 1LDCA 1VPYA 2GJRA 2FJKA 2D20A 3NL2A 1SZNA 4YVVA 5FJJA 3UA3A 1W31A 1TPH1 3W2LA 1JDCA 3WNNA 1BVNP 4XAZA 4L80A 1KWGA 4E5TA 1KKRA 1ZTVA 2X0HA 4RDWA 2VFDA 3U0HA 1V6XA 3W2UA 4A3QA 1W1B1 2CIPA 3ABZA 3G3MA 4GGHA 2A5HA 3WEMA 4D2JA 2ACSA 2YL9A 1QPQA 1EDTA 4QAIA 2CZVA 5EMKA 1N82A 5CZTA 2J75A 2VFIA 2WJDA 5K9DA 4QG6A 5C0QA 1V4YA 1BPLB 3THQA 1ZL1A 3N14A 3XINA 4AD0A 4IHCA 1EJUC 1XLCA 2WVSA 2AQOA 3OVQA 3RGTA 3FCPA 3ITCA 1RZMA 3AWNA 3UWUA 1GG0A 4D71A 1CNVA 3EB4A 3QC3A 5EKYA 3NQ8A 1DJQA 2BXZA 4A3HA 5IRPA 3U4AA 5LIXX 4KGLA 3RX4A 1E72M 1D9EA 5KTLA 1DWGM 3ABSA 3LZ3A 3CWNA 1V3MA 3QGKC 4C6LA 1J2WA 5CPMA 1GQJA 5AN7A 1TV2A 4W7UA 3MSYA 5BU9A 4LAMA 1TIMA 2GJNA 2E6FA 3FEQA 4E4FA 1DWJM 1NWRA 1KCXA 1R85A 3AIRA 1V3JA 2VENA 1Z8AA 5K4XA 2XVPA 2YLAA 4LV4A 5G4HC 5D04C 4FK9A 4FLOA 3V16A 1KGUA 3LBMA 4DBDA 4F9DA 2CKSA 7ENLA 3WLPA 5LGZA 3TQVA 2CBVA 5LNUA 2P1FA 3T7VA 3ABRA 1KFBA 6ALDA 1MQQA 5A6BD 4TMBA 3HBLA 3KCOA 4GWEA 6TIMA 1XP3A 2X30A 1I1XA 5FEXA 1GW1A 1LRQA 3EZ4A 3EDJA 3POHA 3WDJA 4Q7IA 1B90A 4DEFA 3KWXA 4HQVA 1GPFA 2P0IA 1B3WA 4WZHA 2OOFA 3NG3A 5EY5A 1A5LC 3HV9A 2PDPA 2VDGA 3HV8A 4XZIA 4DJDA 3IJIA 3UQNA 2WC7A 2G37A 3TX9A 3GXDA 1O94A