4KW2A

Crystal structure of a putative uncharacterized protein (bdi_1873) from parabacteroides distasonis atcc 8503 at 2.32 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
240
Chain Sequence
b'ADWKVGIQTWTFHNLTLMETLDKTQQLGMGYAEAFFFQELGAPFPKETYLNYDLSDDNCALLRHEFKIRGIKPIAFGVASYGTNEEWDKFFAFAHKIGAHIVTVEPELNQLDYIESLAKKYDMEVAIHNHPASAEVVEKALKGRSPLMGVCADIGHWKRVGEDPLKNLQKLSGRIKVAHLKDLTDKMEDATWGTGILPVKAFVNELKRQHFNGLISIEYDDFKSDIQEIRNSLEFLQKCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a Putative uncharacterized protein (BDI_1873) from Parabacteroides distasonis ATCC 8503 at 2.32 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
total genus 77
structure length 240
sequence length 245
ec nomenclature
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4kw2A00
4QEHA 2QULA 1A0EA 4EAYA 2NQ9A 1XISA 5B7YA 2GVEA 3OBEA 3AAMA 3LMZA 2GLKA 4XSLA 3C0LA 1XLBA 8XIMA 3BANA 1XLJA 4A8IA 2XISA 4YTSA 3IUHA 1DE6A 3BWWA 5FA5A 2G4JA 4ZB5A 3CQJA 4XSMA 5C9ZA 1XLLA 4XKMA 1DIEA 3NGFA 1CLKA 4HHMA 4GJIA 3BZGA 3DBNA 2QUMA 3M0MA 4YTQA 3M0VA 2QW5A 4K1GA 2X7VA 5AVNA 4PFHA 3CQKA 3VNIA 3UVAA 3L23A 3XINA 3UA4A 1XYMA 1DE5A 3WQOA 5XIAA 3QXBA 1XLIA 3U3HA 4QE1A 3CQIA 3KTCA 1XYLA 3KBSA 1GW9A 3ITVA 4DUOA 3M0YA 3KWSA 7XIMA 2J6VA 4YTRA 2HK0A 1XYCA 4KW2A 1XLGA 1XINA 4XIAA 3QC0A 4ZB2A 3FVMA 1XIJA 3M0LA 4LNCA 2NQJA 9XIMA 4OVXA 3ITOA 3VNLA 3VNJA 2ZDSA 3XIMA 5B7ZA 4W4QA 1XIFA 3KBMA 1QUMA 1BXBA 1D8WA 2I57A 3IUIA 4X60A 4DVOA 3M0XA 4ZB0A 4US6A 5I7GA 3ITLA 3ITYA 1O1HA 1XYAA 1XIGA 3DX5A 3ITXA 3P6LA 4G56A 5EMMA 4A8LA 1MUWA 3AALA 3U0HA 1DIDA 3VYLA 3KCLA 3XISA 1XLMA 5XINA 4QDWA 1I60A 1XIIA 1XLEA 2OU4A 4GJJA 5EMJA 3VNKA 5H1WA 1S5MA 3CQHA 3KBWA 4X63A 3KCJA 1DXIA 3TC3A 4Q7IA 4EACA 3KBJA 1XLDA 3AYVA 4HHLA 5XIMA 3VNMA 4QE5A 3N4AA 4QEEA 4YTTA 3M0HA 1XIBA 1QTWA 1XIDA 3JU2A 4GQBA 1XLHA 4QDPA 6XIMA 4QE4A 4HNOA 5H6HA 2Q02A 8XIAA 1TZ9A 3UU0A 3CNYA 5TNVA 4HGXA 1XIEA 1XLFA 5EMLA 1A0CA 4PGLA 2ZVRA 1QT1A 3KCOA 5AVHA 1XYBA 3CWHA 3QZAA 2NQHA 1XLKA 4J4KA 2HK1A 1XLAA 2XINA 4A8NA 9XIAA 2QUNA 2I56A 3AYTA 3IUDA 3QYSA 1S5NA 2X7WA 3KBVA 5J8LA 5B80A 4XIMA 1XP3A 1XIMA 1K77A 4A8RA 1XIHA 6XIAA 2XIMA 3BZJA 4YTUA 1YX1A 4XISA 3GNXA 3ITTA 2G0WA 5EMKA 3UXIA 2HCVA 3P14A 1A0DA 4E3VA 3C0QA 4ZBCA 1BXCA 1MNZA 4K3ZA 2GYIA 3TVAA 1XICA 2GUBA 3C0SA 1XLCA 4X61A 3UA3A 3BDKA 3KBNA 1OADA 1I6NA 4GLEA
chains in the Genus database with same CATH superfamily
4B3LA 4RJEA 3F03K 2GVEA 5DMMA 4JNZA 1GTHA 1S5TA 2HDJA 3MHFA 4QJ3B 3BWWA 3RF9A 3VK5A 1JUEA 3BZGA 6REQA 3ATZA 2ZCGA 1OT1A 3G6MA 3N3MA 1RD5A 1BVNP 1KBJA 3B8IA 1R30A 1JD9A 3NQCA 5HJYA 4I8YA 3GK0A 5BMWA 2YCJA 1F07A 3BH4A 3WK2A 1TTPA 2IKIA 3MKVA 2BZNA 3OZMA 1J93A 1VKFA 1BD0A 4US6A 1GYLA 3MSYA 4LUSB 2J4GA 2FB3A 2WC4A 1W9UA 4D6JA 3KCJA 1I9CB 4IQLA 1OYAA 4GZEA 1Q5MA 2W27A 2PRMA 2BHYA 4HNOA 2NLIA 3FIGA 1IF2A 3RLUA 3OVQA 1SZRA 4RZBA 4K7YA 3KOXA 3AIQA 4BQ5A 3CU2A 2ZRXA 3W71A 4PE8A 3F2CA 2Y63A 3TA9A 1KM6A 4LS2A 3MMDA 4C91A 1KV8A 1G4PA 5HAOA 4TVDA 2J7BA 4UFJA 3M5ZA 2X16A 1FWDC 4IGMA 1GVEA 3K1GA 1P48A 1QAPA 3SR7A 3BW4A 4LYQA 4UB9A 1F3EA 3TXZA 1AQHA 3BANA 4UWMA 1NOUA 1NY1A 1KCXA 1AL7A 4WF7A 1TX2A 4JOMA 3ERPA 1DXFA 1HN1A 2GVLA 2VUYA 4IOTA 1NWTA 3R2GA 1TV4A 4YTQA 2D0FA 3BAKA 3M0VA 4QLJA 1RD6A 1U5JA 2XPKA 2ALDA 1BWLA 1NQKA 1WZLA 1G9HA 3URBA 2YZRA 3GH4A 2I5GA 3ABRA 3BICA 1ZQ5A 3WG6A 3BVJA 4H9UA 5IM51 2GJLA 4OGZA 3EWXA 4AZGA 4P7QA 4XIAA 4LEFA 2FTYA 1A4MA 5LKYA 5REQA 3UZ5A 4DVOA 3ITLA 6TAAA 4JQAA 1H1ZA 3NNTA 3MTWA 3MV01 4B4HA 3F4NA 7A3HA 3T0BA 4IQEA 3V18A 4DO6A 3GLCA 1JDCA 2E7FA 2QVHA 1WZKA 4UTTC 3AIEA 3M4HA 4ATLA 2VEGA 2CEQA 1S5VA 1DVJA 4KIRA 1JXKA 1KGXA 4ZEPA 3TN6A 4KIEA 2BOGX 3W22A 3N2XA 1YTKA 2BY2A 1CLVA 4W5ZA 1V6UA 2QEZA 4XISA 3ITTA 1GCYA 1A0DA 3AHYA 1VBRA 2VMFA 3KM8A 3EDEA 4O50A 3A4AA 4DUWA 2OCZA 1G7UA 2ISDA 1EWEA 2QXWA 3UGRA 2JKEA 4IMFA 5JXQA 3TFCA 2DT0A 4GZJA 4U2ZA 4NZJA 2OLAA 3ONBA 1SZNA 1XR2A 2D0GA 4PL1A 1AD1A 5C6MA 1VF8A 4M81A 3IARA 1VBGA 2OYMA 4XO6A 2VR2A 2Y24A 1R3SA 3AICA 1OX4A 3OA5A 3UZZA 2PZNA 5CC7A 1LUCA 2A7NA 4F0HA 4WSKA 3GG1A 5DRIA 2J9ZA 4GACA 5G2IA 4DAFA 3B8UA 5E9AA 2CZFA 2V8ZA 3UG8A 4C6DA 2QAPA 3LM7A 3NDZA 5EMJA 1CEOA 1I2PA 2Y4SA 4L6OA 2Y8UA 3QPEA 4O11A 4PMQA 3U48A 2WMGA 3BG5A 3F5LA 4UMAA 3K8LA 3MUY1 4JTIA 4EP8C 3QV8A 2DEPA 4DZHA 3AISA 2R94A 4IP5A 1YPFA 4PBFA 1QI0A 3VD7A 2PODA 1WDQA 1BWKA 5DCBA 4JN6A 1WBHA 4OHQA 1ISXA 4XAFA 3GVWA 5DO8A 3U9IA 1KQYA 1AMYA 1YADA 3IJ6A 3HA1A 4GNKB 2A3AA 1REQB 4ORIA 2AKMA 4UMCA 4FXRA 1X6LA 2BY3A 3WQOA 2INFA 1VJSA 2UY5A 4CVUA 1UMYA 3G1FA 4LGXA 4B5WA 4B2DD 1B31A 2HK0A 3C86A 4DELA 4FLRA 2XN1A 2A5HA 2BWGA 3N6QA 3VNDA 4TVCA 5I6SA 3HGSA 4FIQA 4FLQA 4WKHA 1TUFA 2WO5A 3WL0A 2RDUA 4ASTA 3UQNA 3UZJA 2G37A 3ZJKA 3QMSA 2Z26A 3JS3A 4HN4A 2QCDB 4A21A 4HZ6A 4EOUA 3IIXA 3I6TA 2FIQA 3RU8X 1MQRA 4P8UA 4F0SA 1BEUA 3LRKA 2W63A 4MAVA 4G6CA 5CJ5A 4O17A 4C5YA 1ME8A 3SEPA 3THUA 1QPKA 2ISVA 1IEVA 1AH3A 1FCBA 1SMDA 3H2MA 3DG6A 4D6FA 3NURA 2QUTA 5T8GA 3IJIA 1QHZA 2FZ8A 1J6OA 1V03A 3L2LA 4M7SA 5A95A 3W1RA 2Z2AA 1QATA 3L4WA 2INZA 5J5RA 1FKWA 3CWOX 1KBLA 4MGGA 4JQ2A 4HNTA 3TVAA 4QISA 1NOFA 1X8CA 4PTDA 5DMNA 3G18A 4JIIX 3P5YA 3N9RA 4PRRA 2IXVA 3QBUA 1H61A 3ZJ8A 4ZTXA 4S2CA 3L4XA 3M6DA 1T99A 3QQ0A 3U57A 1T8XA 1JFHA 4RPPA 2QPUA 5DMLA 2IKHA 3SSZA 5AFDA 3W00A 4YU1A 3AHZA 3ARXA 3P61A 4GY0A 2OLSA 3GXDA 4ZXLA 3TZFA 1FCVA 1TWIA 4IPPA 2Z25A 3SRFA 4Z0SA 3BW3A 4JYEA 4WZHA 3VIHA 3QV7A 3Q58A 2DIEA 4E8GA 1Q6FA 2WV8A 4IZGA 3HQPA 1XIGA 1Z7AA 3CHFA 4S3BA 3PF3A 3SZ8A 4WOZA 1P5BA 2DZBA 3RK8A 3DHUA 3Q67A 3EMQA 1DTNA 5AECA 4GUIA 1A5UA 1UIPA 3WK3A 2E6YA 4IMCA 1R0MA 3SURA 4OUEA 3KDOA 2AGKA 1LQ0A 1V6XA 1PYFA 3TMQA 5G4WA 2WQDA 3LPPA 3O0FA 2WLZA 4PMYA 2A3BA 3VKCA 1W3JA 2D69A 4EPKA 1PCWA 1QBBA 2WYSA 1P7TB 2V5KA 5HULA 3NM1A 3VDGA 4N9DA 3LHTA 3RM9A 4GI6A 1X98A 2PMQA 5AZ1A 4NX0A 1KXTA 3KRUA 3O6AA 3EKLA 3M44A 2CLKA 4NG3A 3WQWA 1X97A 3ZSTA 1SFLA 2OPJA 4RDZA 2XWEA 3HG4A 2MNRA 2CBVA 2QYGA 1R86A 3KBSA 4OJYA 2Y7FA 1FHUA 3WDJA 3LM3A 2GQAA 5A2AA 3CBWA 1CECA 2WNNA 3L12A 3EB3A 4B90A 3MCNA 1W1VA 2FVLA 2A2IA 2XFFA 3KOFA 2PDWA 4LT9A 4HA3A 3VOHA 4BI7A 2X0HA 2FGBA 2BODX 4IIGA 3CAQA 3NQBA 4JHOA 4IH3A 3G1YA 3QYQA 1FDZA 1I45A 2B31A 3MMWA 4HU3A 3W02A 3GC5A 3GR8A 3MCMA 1I75A 8CGTA 4N9EA 1V6YA 1IEWA 1XYFA 2O7QA 3ITGA 2GGIA 3VUPA 2E8YA 4F4RA 5AVHA 3U2EA 1R3WA 2VDGA 4H6EA 5E6YA 2OGJA 3PPFA 3UZXA 4IIEA 2ZUMA 4W89A 2IW0A 3O07A 3O16A 1XRSA 2H6RA 1QNOA 4RZ6A 4AF0B 5PTDA 5F2IA 2G3NA 5A2BA 2Z1KA 3HURA 3UPWA 1TMLA 2YXGA 3TNOA 4U31A 4DIAA 5FJJA 1AD4A 4PCSA 3QN3A 3THCA 4GVHA 2X7VA 2R82A 3KX6A 1BF2A 3QY6A 3TW7A 1LL6A 1J12A 3FKRA 3T2QA 4AG0A 3ARRA 4C6NA 2FGLA 3B9OA 4M3PA 1H49A 4GGHA 1TV3A 3KP0A 3H4GA 1OB0A 2V3EA 4FX7A 1G1YA 5DQPA 3QFWA 3S46A 1GOIA 3GXPA 2W67A 4OVXA 5HWNA 3RLVA 2QUUA 4Y7EA 4JL1A 4AVOA 2P53A 2XVLA 2ZICA 1NFBA 3NUKA 1O95A 4JTTA 1CGUA 4Q4KA 1NF7A 4X0VA 3WNOA 2C79A 4WKFA 1KXQA 2VO5A 4IMEA 3AZTA 5AKQA 4GIRA 2PDBA 2AQWA 4L6DA 1GVRA 3WENA 4PL2A 1GQKA 3W7NA 3PR2A 4MWAA 2P8BA 2WVTA 4JDBA 3WH8A 1JQVA 3ENLA 4YHEA 2NQHA 4AZBA 2ODOA 4O54A 3UNTA 2PLJA 1J0IA 1OK6A 4HNUA 4IG2B 1XIHA 3BAXA 3GDLA 4CQ8A 3KXQA 1KXHA 3NPWA 1OCJA 1K9DA 1YE4A 4FHAA 3BJFA 5DCEA 7TIMA 3ZS4A 1ZZMA 3M0ZA 5HJXA 3IGUA 4R27A 3GG8A 1F6YA 2VFHA 4YTSA 1P0NA 3QZEA 1NDVA 2P1FA 3G5EA 1KBBA 2WMJA 3OVPA 3EOEA 2DUZA 3HMJG 4K1GA 4QAIA 3UVAA 4Y9OA 1CXFA 2DJLA 2YR1A 4RNHA 4JCMA 3V35A 1WXYA 1IR1A 2GSEA 3A4WA 1DJYA 2NXGA 3ORWA 3KL3A 1F3TA 1SYTA 4YVXA 3WLIA 1US3A 2OEMA 5F4WA 2V5CA 3C52A 1JDDA 4MKNA 3TJIA 1A47A 2NXIA 3BLFA 3T7VA 5I7GA 2YL5A 4A4AA 3DX5A 1A5MC 1IV8A 4JQ4A 4H3DA 4R88A 3UWVA 1J11A 3W7IA 3A3WA 3KS6A 3PZGA 3I7QA 4KGLA 5IDZA 4AXKA 2EQDA 3MI6A 4FNRA 1TQJA 4YTTA 3W83A 4BI6A 4GGBA 2CBUA 4FX6M 4PGLA 1POKA 1A5OC 3LCIA 3MHGA 2QDDA 2B7NA 4ERAA 1TKKA 3NQ7A 2VQTA 1W5OA 3CZEA 5AC4A 1EO5A 1PCKA 2RAGA 1VHNA 5KTLA 3T1GA 3WYZA 4JKLA 2A6LA 2I1OA 2Z1VA 3H2CA 1RPXA 1KA9F 2HE5A 4TV6A 3UJFA 2VEIA 2HEJA 4GFSA 3FEQA 4C1LA 1AH0A 1KXVA 3CEPA 2XH2A 1UZ4A 4JTCA 2DZPA 3TE9A 3PS7A 5XIAA 1OX5A 4CCZA 4IGHA 4O8RA 5BOEA 4LUTB 1IGSA 5ABFB 3WF0A 3H23A 4DJFC 3VNJA 4EKJA 4BKNA 1MQPA 2DSWA 3W2MA 2F2KA 2O4MA 3OJGA 3OQ8A 2F6XA 4FF5A 2WHJA 3E0VA 2DZAA 4PB5A 1TRIA 4CVWA 1M9HA 1D8CA 2A21A 2OU4A 3TC3A 4U5IA 3STFA 1LWHA 5M2FX 1XLDA 1H5VA 2PWFA 5HATA 4ZFMA 1PWLA 5M1TA 4NNBA 3WH9A 3TTEA 4KQNA 2Y0FA 4XV0A 1W9DM 2X2GA 3S1GA 2IXUA 2BXYA 5AHIA 2QUNA 5I03A 1VBJA 3B97A 1OCBA 3MP5A 4B9YA 1EA9C 4AZCB 2PDPA 2V2DA 4GNJA 2YLAA 4PULA 3ARTA 4PFMA 4LS1A 3NTYA 3LCWA 3LERA 4ML4A 3BCDA 3HJEA 1KM0A 2WOQA 4KEMA 3PUEA 3CGTA 4DO5A 1LBFA 1OD0A 2NLYA 1QW8A 4P5UA 4Z2LA 1F9CA 2I9UA 3E6EA 1ESWA 3TJXA 3CLMA 3G1VA 1QR7A 4IL0A 1DTUA 1EQCA 4WOQA 1BVZA 2VZTA 5LYRA 4FMVA 3CQIA 4CU7A 3VKKA 2XIIA 5E0FA 4XBSA 4YTRA 3UY8A 1KV5A 1NDYA 3IJ9A 2VX4A 3P82A 3ARYA 5EU9A 4DWDA 3WMSA 4FB7A 3AFBA 3PC0A 4XWUA 1K7FA 4IXHA 3FYOA 4P7LA 4JR5A 1LQ2A 2PD9A 1G69A 3EOSA 3ARQA 1TMHA 1E3ZA 5JBEA 3HGJA 1LRTA 1AQ0A 1QJWA 2GGJA 3SCSA 1OZQA 4MNKA 1TE1A 3WLMA 4YMZA 4BY3A 1VFLA 4H2HA 4PC8A 1S1RA 3GZAA 2F38A 4D8ZA 4HCHA 2DORA 2TRSA 4URIA 4JEQA 2YSWA 4YYCA 3QV9A 2XM2A 4GISA 4Q8TA 3D3FA 4Z42C 3PB0A 1UKPA 3I6RA 3BZJA 1TZ7A 3HB9A 3OG2A 2XH4A 3LMYA 4Q6JA 1EX1A 3TWAA 2FZDA 4QNWA 3STGA 4PTWA 2ZTJA 1MW0A 3LPFA 4Q7BA 4S3GA 3WNKA 5I23A 4PODA 3TW9A 3TMLA 4R7JA 1J96A 4ZQMA 3VDCA 1W2PA 3LZ5A 4XX6A 4Y9AA 4F0MA 1KGWA 4IP7A 1K8YA 2VRKA 2NQLA 3R8HA 3FFSA 3OBAA 2GSJA 3HPXA 3P62A 4QQUA 1TRDA 2I17A 2ZUTA 5FAGA 3T44A 3REQA 2V6AA 4K7VA 4NI3A 3PWIA 4HCDA 1HJSA 3NQVA 3B3DA 1O94A 2ZX6A 1E51A 5E09A 2RFGA 3C0JA 4DWSC 4DUOA 1GG0A 2BOFX 2YXOA 1Z69A 3UF9A 3ARPA 5JIPA 1MFUA 2Y61A 3ID7A 4QG8A 1IXOA 4O1BA 3U4AA 1Q4NX 4LY8A 3IS4A 2ATMA 1EDQA 3Q94A 4ATWA 3VZZA 1BF6A 2X30A 2Y5EA 3G1SA 1C8QA 1PL9A 3NSNA 1SSGA 1BPLB 2QGHA 2X1TA 1DP0A 4P8VA 5DELA 3RIKA 1UWIA 5HMDA 4AC1X 2P0OA 3DGBA 4GQBA 1WDWA 3BO9A 1XSJA 4UCFA 3O7UA 3S2MA 4QLKA 3KVKA 3VILA 2OLHA 5F4XA 3QLDA 1PKLA 3LN3A 3AZSA 2ZZ1A 3R94A 4DNHA 1HX0A 2I16A 1FWHC 3BGAA 3M16A 1PZ1A 4DJDA 2BGQA 1WUFA 3NPXA 2GJXA 1X7FA 1V6TA 1YW1A 4O28A 3GBEA 2V2HA 1R46A 1YE6A 4JFTA 4BA0A 1LORA 2DDXA 4KMQA 1ICSA 2JGQA 2QZRA 1Q7ZA 4CNTA 4PRWA 3KEHA 4L9XA 1TJPA 1KCLA 5G4EA 2RGLA 3LSCA 4AMCA 3QXBA 3P8JA 4QE1A 4YWIA 2VVNA 3MWAA 2HS8A 2ZBTA 4W7VA 2P88A 3BLDA 1GQLA 1QOQA 1EZWA 5EA9A 2NV9A 3FYYA 1V0KA 4JTUA 2H90A 3O6CA 1XW8A 5FJRA 3R7MA 1H5YA 3BG9A 4LYRA 3HGRA 3WDQA 2C13A 2CIPA 5TF0A 3NQ2A 4NUWA 2UZ9A 1F7BA 1FUYA 1B9BA 2POZA 1W1B1 3QTPA 2ZYFA 1DJNA 3V5CA 1DWAM 4QRNA 3W1PA 4AU0A 3N18A 3DI0A 3L65A 1XLFA 3H2FA 1FKXA 1OBAA 2MANA 4L65A 3ZT5A 2POTA 3PJWA 5D8WA 4QJ4B 4KCVA 1ITUA 4F2UA 3NZQA 1V3KA 1E56A 3G0SA 4GH1A 4JTGA 3R0DA 3UNDA 1ZAJA 2Q3RA 3ONCA 3AWNA 4HA0A 4JTDA 3W25A 2R24A 1TJ1A 4G7EA 4E8CA 1XLLA 2Y5JA 2YCIX 3LS9A 3OLEA 3P93A 3BOLA 1XKJA 4HU4A 4AD1A 4ICCX 4LVDA 1UR3M 2Y88A 4H1ZA 2P3EA 2PRLA 2YOCA 4KCTA 1C29A 1ZNNA 1K8CA 3QC0A 4OT7A 2QMKA 3P84A 2VNCA 4WQ6A 1YXYA 2PD5A 5AHNA 5CZJA 3MUIA 4OV4A 3I6EA 1OFEA 3B8DA 1SW3A 4YCPA 4DX3A 2YL9A 3ZOAA 4N42A 2WPGA 1KLYA 3BLIA 4X63A 4H9YA 3T55A 4E6MA 4D8LA 1ZAIA 3I7SA 1VPYA 1XDJA 3LHVA 1JI2A 3N4AA 1PKMA 2VFEA 1UKOA 3E0IA 3K46A 4ADTA 1NP2A 1UWQA 3NQDA 2QT3A 2VOMA 3A9IA 4J4KA 3VM7A 4D6EA 3RHGA 3RYSA 2D73A 3KBVA 1MRQA 2VEPA 4NYUA 5KZMA 4DJFD 3WNLA 4U3CA 5DBTA 2EJ1A 3N13A 1JULA 3RPMA 3NYZA 4BEQA 3RX4A 2OEJA 3GHSA 4QEHA 1Q7MA 3QZ6A 4WX2A 3OVGA 3QMTA 3F4VA 3TCEA 1FHVA 3SN0A 3PNZA 1E4MM 2Y7GA 1O6IA 3GHRA 3M0MA 3K4AA 3CB8A 3FAWA 1U33A 2WW5A 3TXVA 2VRQA 4MDOA 4K37A 5H8PA 4L80A 1HT6A 1G4SA 1TVLA 1TIWA 1J8VA 1Y5VA 3EA2A 3WK1A 2JIEA 3TTSA 1HJXA 2G95A 4CNPA 1UKSA 3UYIA 1XINA 3WDHA 1OQFA 4HIBA 2VHLA 5M3WA 3A3HA 2CWXA 4ZVJA 1DQXA 3LV6A 3GB6A 1PVNA 3B4YA 1W6TA 3PUGA 3HZ3A 3EKZA 4WY0F 1VRDA 1QVBA 2VC9A 1HJQA 1Q8JA 4H8UA 3POCA 3MB9A 5I24A 3LBMA 4TMBA 4RDWA 4AZ6A 1P0KA 4JHZA 1Q6DA 4NJKA 1M7OA 3NQMA 5CPQA 1W3TA 1ZUAX 4ML9A 3FA4A 4NAEB 4POCA 4XK2A 4HU0A 4K38A 1FX6A 3RFAA 1JXJA 4O4VA 1MQQA 4ZXOA 2V67A 4LCRA 3LHZA 4GG9A 3TZNA 3N2MA 4TVUA 1UHVA 2ZRZA 1SU5A 1ISZA 4A3UA 5I78A 4RPQA 3S2CA 2DZSA 1O66A 1W9VA 1TPC1 2YA1A 2JFEX 4WJEA 1ITQA 4JTJA 5AHFA 2FVKA 3SRKA 4FOJA 1FHLA 4G8TA 3CQKA 4DM2A 5CPLA 4IF2A 4YLWA 2WANA 1E0WA 1GG1A 3BSGA 1SFJA 1UQZA 2C1IA 1I0DA 2PTDA 1OFBA 2V9DA 2HPIA 4WEVX 1AJ0A 3MQTA 1KWKA 2O0TA 4U33A 3MP3A 5BOOA 4MM1A 4B16A 3EKGA 3D0CA 3LCLA 1UBSA 5HMFA 1IEIA 1K4GA 4IFKA 5E70A 2VGIA 4ES4A 3VIIA 4HSNA 4GXWA 5F7UA 1VC4A 3VDHA 1AZ1A 1OY0A 3KHJA 2E09A 3PWAA 3T07A 3SIZA 2J77A 1OYCA 3EWWA 1SPQA 5IXEA 1O5QA 4DWSD 2BSLA 3D3AA 9XIAA 3FAXA 4GUHA 1J10A 1YX1A 4A3RA 2QIIA 3IPWA 1BTCA 1WXZA 1HFBA 4AVNA 3RR1A 3PM6A 1JDEA 4LOCA 4C7GA 1JNEA 4NHVA 4N6FA 4NT0A 5ABHA 3B04A 3L5MA 4R3UA 2PBGA 2E9BA 1RQEA 4GYPA 3WMLA 2GWGA 2NT1A 4TO8A 2WXDM 3W74A 2V5BA 1OM0A 1AW5A 3WF2A 5C9WA 3QM3A 5GPRA 3W6MA 4ADUA 3GFYA 3OA3A 5CPMA 1S1PA 1XSIA 1L2QA 3UYCA 1JJKA 3ZVHB 1KCKA 1LCOA 4IWWA 2PDKA 4QLLA 3HF3A 4FA3A 3DC0A 2ZZ4A 1TMQA 1C91A 2DJXA 3C3NA 5DF0A 4AC7C 4PMOA 1MSSA 1RVKA 3VGBA 3LV5A 3FJ6A 3OLIA 3EA3A 4X9SA 1ZJHA 5FIPA 1ECEA 4XD4A 3MJMA 3TIMA 3WNMA 1ZSXA 1Q8AA 5F2MA 3WF3A 4C1NB 4BCEA 4LX4A 5LNVA 3GVRA 5K4XA 4LXFA 2PGWA 2B81A 4E4FA 4JBRA 3SY8A 1JZ6A 2ZC1A 2CLIA 4NZ4A 2CPUA 2WKJA 3S2JA 3N17A 4Q3MA 3R13A 1R3VA 4JFWA 3M5VA 1MYRA 2BOEX 4B5NA 1VLIA 2VKZG 4PR4A 3DFTA 4O0ZA 4PMXA 4NU7A 1F4AA 4LY4A 3I3BA 4PCPA 4QAWA 1ZRQA 2O7SA 3NL3A 1DE5A 3NO3A 3OO2A 3FDGA 1J4EA 2WHLA 4E5TA 4J1OA 4JFUA 4UMBA 1YTDA 5C9XA 5G5IA 2XGBA 1GQNA 5FJPA 2ZDSA 2YFOA 2CLHA 1YEYA 1XIFA 4EWJA 1PIGA 3EWZA 3GBDA 3KP1A 4L9ZA 1ENUA 4XZLX 5I3FA 1UA3A 5H1WA 1OWQA 4GBUA 2JK2A 1RBOB 1VGAA 3V7PA 3AIUA 4HHLA 2GVGA 4IPJA 4A3YA 5KEZA 2V38A 3JU2A 3GHTA 1K4HA 4HZ7A 3DFPA 4Y2WA 4A2SA 1TWZA 4O1CA 4M82A 2QCCA 4UC5A 1XWYA 3GO2A 4RV3A 1I1WA 4IISA 1C9WA 1V79A 5F2GA 2E3ZA 2ABAA 4C6QA 3NR0A 4LB3A 1XSKA 4PUWA 2PWUA 2OQYA 1OVDA 1ZTVA 2E68A 2XHYA 3A5VA 2J7DA 2G41A 1LBMA 5A69A 1Q3NA 2RDXA 1S39A 2I14A 4H6RA 4AFYA 3DFYA 2DH2A 4D6GA 1BSIA 1XDLA 3IIOA 3CUGA 5CZTA 2ZZ2A 3H2EA 3SCPA 4RE2A 3SUUA 5AN7A 3CEUA 2PP3A 2AL1A 4Z2IA 5JVLA 3TLLA 2R1MA 4X3ZA 3THDA 1OZMA 1YXDA 3BPWA 3BK0A 1XQKA 4HYWA 2WZEA 1XBVA 3H12A 4Z2KA 2GSHA 1UKTA 3H2AA 3S2NA 4JPGA 3L0NA 2FB2A 3W82A 3URAA 2A3CA 4RXFA 2FFCA 4MMWA 1S2WA 5DT5A 1F8IA 3RM4A 4KWWA 3M43A 3MVIA 5EGRA 1FH8A 3U2CA 5C7HA 3VMPA 4LALA 3C2FA 1R2SA 1EKOA 1CB7B 3ABXA 4Y9NA 5D9OA 3E02A 1D2KA 1BTMA 1XHGA 3P7YA 1W3KA 4HGXA 4DPQA 1GQJA 2A0NA 3V16A 1HXJA 4XAGA 4WR3A 2QJHA 1GONA 4XIMA 2ZC8A 2C0HA 1P0EA 4L64A 3QHOA 3UJRA 3PZTA 4TV5A 2XSAA 4GC4A 4ZBCA 4AIEA 4DI8A 1X6UA 4PEEA 2WAGA 4GLEA 3DYMA 4AW7A 4AD5A 4MNMA 4EF9A 4A05A 3WLQA 2I5IA 1ZAHA 3WEOA 3NL6A 4JTAA 3P0WA 3OOQA 2OZ3A 2GJPA 4HHMA 1MRAA 1MZHA 2PB1A 1HKWA 1HJWA 5LSMA 4KT2A 2QGYA 2RH9A 1AUSL 2OZ8A 5I07A 3E96A 4NRRA 2CZVA 4RE4A 4K8HA 3M0KA 2YBVA 3NA8A 3U3HA 3N9KA 3EWUA 5M5DA 1R47A 4Q7NA 2WVVB 3EX1A 1E1CA 4MJ2A 2HJPA 2HBVA 1RP8A 2QPSA 2X41A 3GNDA 2ZZ3A 3ZXWA 4JTLA 1YDVA 3BAWA 3RRAA 1HP4A 3QSRA 4WCJA 4C6KA 4XZBA 1MXDA 4YVVA 2OOFA 3BSHA 1BWVA 3ELFA 3KWXA 1R2RA 1ZGDA 3CUHA 3OYXA 1SR9A 1PZ3A 3FXYA 3W6LA 3M1ZA 4QE4A 2I9EA 4GIEA 2TYSA 3PTDA 1XIEA 4DHGA 4GVIA 1QOXA 1H7OA 4B5XA 1R6WA 3VGDA 3BQ5A 3GH5A 1QASA 2ZVIA 3GW0A 1A5AA 4RK8A 4AX6A 1M7XA 3T0DA 4FX8A 2VX6A 3FHQA 2NQZA 5CJNA 4AD2A 3BDKA 1PX3A 4MFDA 1V6VA 2Z1SA 2V5JA 9RUBA 3TNBA 3Q45A 1DYSA 1WDPA 4ZB5A 2I7GA 3NFUA 3W85A 4JNYA 1RSCA 2OEKA 2Z6IA 1ZB5A 4F8XA 1M7PA 1FXPA 4QNEA 4GIYA 1BYBA 3I7RA 5CLWA 2XU2A 2WZIA 1UMLA 5BW6A 2QJJA 4WIWA 1I0BA 4GY1A 1B30A 3TP4A 4O57A 4GK8A 2D2HA 4S3KA 3M0LA 2QCLA 4IXXA 4XG1A 1QNVA 5HANA 4HNVA 1WQ5A 1FWWA 1OYBA 2WKLA 3VYLA 3H2OA 3U5YA 3LGEA 1EHNA 1XXXA 3F2BA 4DLFA 3IJ8A 3W7HA 4JN8A 1ITCA 1H2JA 2VWSA 1X8FA 1P4CA 3T42A 1A50A 4UFHA 1XQLA 2JIWA 4V15A 1R5YA 2W6RA 4UTTA 3DH7A 1HJUA 1QMLA 5EMLA 1MW2A 5E6ZA 3WLPA 3UR2A 1G94A 3GNOA 1JYWA 4GY7A 3EPOA 1A3HA 1X96A 2E77A 5FSDC 1E43A 3NQ8A 2GQ9A 1AJ2A 4TX6A 2CWNA 1HGYA 2PDNA 5DCDA 1KTNA 1E9IA 3VC5A 1IE7C 5A6AA 2J62A 2NW0A 5IHSA 5ABEA 1R38A 1DE6A 1D3HA 1TSIA 3AXMA 1BKSA 1GKQA 1D3CA 4NXKA 1U83A 3FSUA 2QKFA 3VNYA 1JEZA 1TZZA 3MKCA 2UY2A 3ZYZA 3C4UA 1EC8A 1J2WA 4CD8A 2QIWA 1JFXA 4PCNA 1G67A 1GZGA 1KR0A 4PUKA 2ZUWA 1GYMA 4P2VA 3N6JA 1XIJA 3RLGA 1EHAA 3SQMA 1EGMA 3TTOA 3OIHA 4E2VA 2REQA 3MO4A 3TX9A 1XJBA 4LUTA 5HNRA 2QV4A 2Z0IA 2ZX9A 3VGEA 1W8GA 3EBVA 4MHBA 1W5PA 1JZ2A 2W91A 2ZRWA 3UGVA 4AZ5A 2FZNA 2EPMX 3SN4A 1GKRA 4Q22A 1DWGM 5A1AA 1XIMA 3E2SA 3NO1A 4OTKA 4A8RA 1GJPA 3P3BA 2PGEA 3UXIA 3PZNA 3P14A 3VE7A 4OE7A 1PJ9A 3WQDA 2WVSA 5E0CA 1F61A 2DT2A 4RCXA 4IMDA 4L4OA 3WNNA 4AZCA 1GOXA 4BF9A 3PUOA 4HOWA 5G1YA 3PZVA 3W84A 1P1XA 3ALFA 1KD0A 4XKMA 1EJXC 2P76A 3LB0A 1NARA 4IMAA 4ZQOA 4KETA 3AMKA 3USBA 3VGHA 1QNQA 2B4GA 2NXHA 4FF7A 4AIUA 2GOUA 3GQYA 1EEPA 4K8GA 4P7OA 1XUZA 4D6HA 4NJIA 1CGVA 5D9PA 2R6OA 3JW7A 4MLJA 3CMJA 2J6VA 4KEUA 4KEZA 3UESA 3WJWA 2DQWA 4BHYA 3ITOA 1A49A 1Z9AA 3LNPA 1V0LA 1AQFA 4C5ZA 1PKYA 3W28A 1QNPA 1OF8A 2PC8A 3T0CA 1AJZA 1XS2A 3T09A 4AWEA 1O1HA 2Q01A 4HPHA 3IVTA 3MJYA 5CG7A 3VIPA 3VAVA 1W5MA 1U5HA 4PYSA 3VPLA 1F8MA 2IPGA 3L2MA 2YBTA 1N8WA 1L2UA 3SIMA 3UWUA 2OT1A 4HSOA 1QI5A 4ZENA 3T4CA 3OIXA 1BLIA 5AYIA 4MUZA 4FALA 2OX1A 2AOSA 3UG3A 1KR1A 1VFTA 1FDYA 1VH7A 3OODA 4JTKA 1ADDA 2WWDA 1IT0A 5A8GA 2D22A 4JIHA 3T4WA 3HIJA 5FJTA 2HS6A 3TOPA 1R3RA 1WA3A 4A22A 5JU6A 1VEPA 2V30A 3BL3A 4HPNA 3IV3A 4QS6A 1PIFA 2ZZ7A 1JYNA 3INPA 4UZUA 1W9BM 1DIKA 2P8CA 1NSJA 1RA5A 1CCWB 5IRPA 3NPVA 1LF1A 2JF7A 3FGCA 1KFEA 5L9FA 1BRLB 1LT7A 1ZPTA 4IIHA 3KW3A 2IQDA 1C8XA 4N2YA 2NVCA 4NJGA 1YKWA 3AXHA 4ZGYA 1JCLA 3FVMA 2CC0A 4WUIA 4XZNX 3MUCA 1Q63A 1ZY9A 5M03A 2HPMA 3M5YA 3N2OA 5HOSA 2FH8A 2PWVA 5D2YA 2DVXA 3RILA 1EYWA 4QDWA 4KWSA 1S5MA 1JDFA 2PWEA 3C2YA 1TQXA 1JZ5A 1EGZA 2NVAA 4Q8MA 3EX4A 3KVMA 2AGTA 3BGGA 5BZAA 1U1JA 1C9DA 3R1ZA 1YXCA 1XDMA 5HUPA 3CL6A 2PU0A 4C65A 4H9VA 1EXPA 2X1SA 3M7SA 2OMAA 1XUUA 4DPPA 3W2JA 3DKJA 4D1IA 2VOTA 3CAVA 3R4IA 2QCNA 4LEQA 3GY1A 2PLMA 3S6TA 3MI3A 5HK4A 4WSJA 3GHUA 1J6PA 2AAMA 2WWCA 3IVSA 1RJQA 4REQB 2WMIA 4M8UA 3WLOA 6ALDA 3NG3A 3KUMA 4I6VA 4YNGA 4UTHA 5AYYA 4F2TA 3TN5A 2HV5A 1HP5A 4O52A 2YPIA 2Q8ZA 2FDMA 1E0UA 4LH8A 5HWMA 1UD3A 5LIXX 3UWWA 3GAYA 3AXIA 4RNJA 5CKSA 2Z1WA 2C16A 4KW2A 3J7HA 1JDAA 2AL2B 1HKMA 3UETA 3GYEA 4J40A 1HKIA 5AZ0A 1YNQA 3VFLA 3ANUA 2V81A 4IJCA 1PDZA 4MJZA 3M0IA 2YXXA 1QXLA 3M6YA 3N29A 5I0DA 2EPOA 1W3NA 3PG9A 2QJGA 1WUEA 1E6SM 3LHWA 1ZP3A 5C7VA 4Q8UA 1DHKA 2OKOA 4XKYB 1BKHA 4WD0A 3CHVA 2JKAA 1Z3NA 1R3QA 4YHGA 2VFFA 2VX7A 7ODCA 3G2GA 4OV9A 4AD3A 4RDYA 3W4RA 3KS5A 2WKGA 5D2WA 3DC8A 5CZSA 4RNIA 4K8EA 1OHLA 3SCQA 2GUUA 2CNCA 1L9WA 2G5WA 4K3ZA 1QI2A 3GDKA 5K9DA 4X61A 1M68A 3C5QA 1W5QA 2VR4A 3JUGA 4PMVA 2ACQA 1AMKA 4NP7A 2WK2A 5CPNA 2VYOA 1ODUA 3U6WA 2W4XA 4PBGA 1GQIA 4QX4A 5JMUA 1WKYA 3LG3A 4GYJA 4Z17A 1JAKA 2BDQA 4IHCA 1RJPA 3QW4B 3DBPA 3KE0A 2A6NA 4EANA 1SJBA 4IUGA 2OWXA 5DXYA 1NF0A 4KGJA 4H00A 1GJUA 3UERA 3L66A 3L67A 4CD6A 1IZKA 3UA4A 3NXFA 4A2RA 1KFWA 2NX9A 5CGTA 3VI2A 2Y6ZA 4ZOEA 3CAKA 1SM9A 2QR6A 3RCMA 3WJZA 1OC6A 3UWZA 3UPBA 1M03A 1O5KA 4J2PA 1IQ8A 2V68A 4XUGA 5FJOA 2CFFA 5D9MA 5GVJA 4X22A 3H7UA 1YMYA 2VC6A 3TYBA 3XIMA 4W8LA 1V6WA 4H8NA 4LAMA 3TTQA 3GE7A 4WY0A 1D3GA 4I9JA 1FVPA 3RXZA 3XISA 1GEQA 4HYRA 3V4BA 3VNKA 1X7IA 4O19A 3B0YA 1WDRA 2GK1B 4Z1BA 4UTKA 2AKZA 2Z6JA 5C9UA 3U5UA 3TFXA 8TIMA 1VCGA 2ZFAA 3CUZA 1EL3A 1QT1A 3IGSA 5IHRA 1GVIA 2XINA 4A8NA 3VKJA 3EX2A 3TQPA 4W85A 3RUBL 4H7VA 4IUOA 3WNPA 3FDKA 4DZIA 4AIBA 4QQ3A 4GPNA 3TYEA 2HRWA 5LIUX 2RDWA 2DZWA 4BQ3A 2PTXA 3HN3A 1CLXA 1YIXA 2FVMA 3MBFA 1A5NC 4HOXA 2ZA2A 4HBKA 2ZUVA 4M1RA 3HFTA 1KO0A 2VT0A 1W3LA 4YIWA 3S5ZA 3WDPP 2C1GA 3DFOA 4C7FA 6REQB 3BAJA 4WGXA 1HIZA 2J25A 2R1NA 3BOFA 4Y9MA 3H4WA 3R0UA 1ZBVA 2UY4A 3MDUA 4EIVA 3PNUA 1E9ZB 4NX5A 3WY1A 1F05A 1K02A 4PA8A 3GNPA 2J24A 3DAQA 1TPFA 5LNUA 1TR1A 2VL4A 2WZTA 3CT7A 4IICA 1VEOA 1J01A 4B15A 2DY3A 2D3NA 3KOYA 1IWBA 1Q6OA 1Q45A 4D1JA 5A6BA 4LFYA 2Y85A 3GFZA 2VWTA 4J27A 3LEPA 5EL1A 3HFYA 1RQBA 5K7JA 2BHZA 2YZ5A 1WE5A 4EXBA 4XD3A 3UCCA 4P7RA 7CGTA 4R85A 4KCWA 2XIMA 2WJDA 4BF5A 2ZUSA 1V4YA 4NSBA 1S2UA 2WLYA 4GC3A 3WD0A 1K03A 1XL9A 1CNVA 4A35A 2HE8A 3GSMA 3MA8A 3NQGA 2VZVA 1JPMA 3MUXA 3MBDA 3MO7A 3PZOA 2IKGA 2OZTA 2XVGA 1XLBA 1RZMA 3PVFA 2OO6A 3CQJA 3JVAA 4GI4A 4FS9A 1BQGA 2QUMA 4BQ2A 2WSRA 2G97A 3XINA 4NKCA 3VIMA 3FK4A 4Q4QA 1RY0A 2XN0A 4Q6XA 2Z2UA 3RNDA 4JIPA 4S3AA 2IPJA 1YPIA 1JPIA 4IX0A 1H1YA 1JAEA 2XH0A 1FWIC 4GQGA 1MDLA 3O3RA 4ADSA 1M53A 3VNLA 2RJHA 5B7ZA 3BTNA 3FLUA 3QKEA 1O4UA 5REQB 1JZ4A 4O0QA 1WX0A 1V7YA 1TCDA 3OZPA 4UNKA 5D04C 2VJXA 3VIFA 1QFEA 3N2BA 2WMHA 3BLLA 2WM1A 3E9AA 3C2RA 2ZWZA 1Y5WA 4AX7A 3V75A 1KRAC 1GW1A 2IS7A 1ALDA 1LOLA 1XLAA 4X2RA 1W31A 2DZXA 4PBEA 4Q4MA 1PZ0A 1SJDA 3EDDA 2B7OA 2BLEA 1GVOA 4MVAA 3W2LA 1TTQA 3EOOA 3N15A 4GO9A 2H9AA 2EHHA 2ZA3A 3MI2A 3FXGA 2GVJA 3CV2A 2E67A 3B8WA 3OB8A 2WSQA 3T08A 1HF6A 1K70A 1BVWA 4KWUA 1I2NA 1XFBA 3PULA 4O16A 4ZE4A 3UR7A 2QLYA 3TEVA 4TX9A 4ONVA 1I2QA 2VEMA 4FNPA 5FF2A 4AY8A 5G1TA 1FWBC 2HZGA 4F9JA 2CBJA 3T78A 5CEWA 1LTDA 3GG7A 1VD6A 3MUZ1 2A3EA 2INEA 1UZHA 3LI1A 5KZEA 2DZUA 3ZR5A 3BMVA 3CV7A 1UD6A 4U4MA 3CYVA 3PFRA 2CBIA 1BHGA 2G3JA 1LUCB 5FI8A 2VX5A 4ROQA 3WQEA 1ISYA 2WSYA 3URNA 3QTGA 5BRQA 4I9MA 3S3GA 4UQBA 4CCDA 1FBAA 3LHUA 3VUSA 3W87A 2VR5A 2PDIA 1DXIA 3JZEA 2BGSA 4O15A 4W9TA 1I2RA 4XZIA 1BG4A 5TAOA 2PURA 3QGVA 2D2OA 4E0CA 4M80A 4Q33A 1L0PA 2HVOA 3U7BA 5FACA 4X2PA 5HXMA 5I2UA 3VOIA 5I5RA 4I7UA 4KERA 1SMAA 3MZ2A 3DOPA 1Q65A 2G3MA 3BC9A 4LRTA 1FWJC 4N9CA 3TYCA 1OFPA 1H3GA 3W01A 1HL9A 1UUQA 1UD2A 5A6TC 5EFFA 3WH5A 2WCAA 4QROA 3NGFA 3RPDA 2IPWA 4MYAA 3NO5A 1R3TA 1KRCC 3W7OA 4BK9A 1M6JA 3N25A 4MOZA 3ABOA 3EEZA 1E5NA 4QSFA 1GW9A 1Y8BA 3ZMRA 4DWSA 1TV5A 4W8AA 1WB0A 1WZMA 3S9ZA 1AZ2A 3UWYA 1WO2A 3WLTA 1UQYA 1YBQA 3ZT7A 1OFRA 4X0NA 3AC0A 3I3DA 4EPBC 4KESA 4N02A 3VCNA 2C8NA 3NOYA 4GI9A 3BURA 3VZYA 1RP9A 4EVZA 1EF2A 3PBGA 4MJ4A 1DJXA 3HBLA 3DHDA 3DESA 3VVGA 1CB2A 4R9XA 1GZ1A 3L68A 1F3XA 3AYVA 2GUYA 1IHIA 4QEEA 1XLHA 2C1HA 4U28A 2PDMA 3RJXA 3QH2A 2JQXA 4FIRA 2CHRA 3AJ7A 1QO2A 1NEYA 3YPIA 2BVYA 3FS2A 3STCA 4QXIA 4YL2A 4AWTA 4M51A 3GX9A 4O0KA 2AQOA 2ZKMX 2GJRA 2QF7A 4AIOA 1EJSC 1NOWA 4KF1A 4B5UA 2GYIA 3VMNA 1EOKA 3SGUA 5F2LA 1EX5A 1GZJA 1NTHA 1O1ZA 3ZT6A 3WQGA 2QCEA 4QCEA 1ISVA 3KVLA 3G6LA 3ZR6A 4C90A 1KBIA 1JQXA 2BY1A 4GX9A 1OABA 5H2ZA 4PCFA 2D2JA 1JPHA 4CEUC 3LPOA 4GE8A 1XX1A 5RUBA 3CMFA 4I90A 1HO4A 3HQOA 4BJHA 3AO0A 1WBJA 5D9NA 3PSWA 3LNMA 5BXRA 1SZGA 3WN6A 3VM5A 3GAKA 2C14A 3LRMA 5T91A 4IFRA 1HNYA 9XIMA 4AYGA 3V0SA 3QOKA 1NH6A 4ZB0A 3WD2A 4KRTA 2C0AA 5EMMA 7TAAA 1GOMA 3EX3A 3T8LA 1TVPA 2VC7A 4M5PA 2YB1A 2Y70A 4ZTYA 5CSUA 4PUNA 4LUJA 3B9DA 3E0LA 4EACA 4NASA 1QPNA 2PZ0A 5HBFA 2CLFA 4B92A 5IBXC 5C2XA 3GKAA 5A8QA 5HQEA 4HZMA 3SI9A 1PTDA 5FEPA 5HNTA 5DT7A 4MB4A 2SFPA 4S38A 4FNQA 1RK6A 1ISWA 1H09A 3O6DA 3W7PA 4WGHA 1DQUA 1K9EA 4QSHA 4MAZA 4AHOA 3A6OA 3NQEA 3BMWA 1GORA 3SQSA 2A79A 1EGVA 1YDOA 3UW6A 2W62A 1FP8A 3W7LA 4OQVA 1J5TA 2PLCA 1TR9A 3N4FA 2DSUA 1E55A 4UNLA 3OEXA 3K5XA 4P61A 3QEZA 1QU4A 5T26A 1AFSA 1CTNA 4W7WA 3V1PA 2X2YA 1PYMA 4M1BA 1TPEA 3T05A 1TELA 1W9PA 1Q6EA 3AOFA 1Z44A 1GOKA 1SW7A 1XBXA 5T9BG 3HGOA 3RMJA 4ZQCA 3WQ8A 2DUXA 3ABZA 4F66A 1WPCA 2YL6A 4E4PA 1W1A1 5A6SA 3CPUA 4HMDA 1X38A 1E6RA 3ZLGA 1VLWA 5DX7A 3FX4A 5E9XA 1J0KA 1LOSA 1OIMA 2ONEA 4DQWA 5LNWA 3AS0A 1EUNA 1E6ZA 3F7JA 1T8QA 3TDFA 2VCCA 3S5OA 3PTMA 2O9OA 3CUIA 1LDCA 4E2DA 1VAHA 3G8RA 2PP1A 3AI0A 3Q65A 4C6IA 4J28A 4Q8PA 1CGYA 3PZQA 2F8QA 1ITXA 4O13A 5JIWA 4P7NA 3P81A 4YTUA 3EMZA 1VR6A 4G1NA 4XB3A 3GNXA 3WD4A 1AVAA 3HQ1A 3QHNA 1W37A 3FKKA 5LGZA 4GQRA 1IT7A 3CPRA 3GUGA 4RUBA 1QHOA 3TR9A 4E2OA 4YS1A 1BYCA 5BNKA 4NQ1A 4C6JA 1V02E 3UY7A 1R7OA 4AY7A 4Y90A 2PCEA 3WEZA 1GVFA 4UOJA 4PFHA 1E1FA 4I6KA 1ZENA 1KTBA 3HPSA 5HUOA 2CITA 2VZUA 1UPPA 2IMRA 1TV2A 2VFIA 2Z4GA 3O0KA 2ZX8A 5HNNA 3WF1A 5CGQA 3B0XA 4EX4A 2QV5A 3R11A 2AQVA 2OSWA 2YDQA 3THQA 3O06A 3GG0A 2HROA 3LX9A 4QFUA 2OSXA 1T0OA 5DY3A 2Z28A 2ZX7A 3UWEA 3E74A 3L4VA 1H60A 1V8EA 2YCLA 1GOQA 4LAKA 1GKPA 3CPGA 3WQ4A 1WAWA 4HHHA 4I5RA 3W37A 1XG4A 3PSVA 6ENLA 5D05A 4F79A 3R12A 3KBJA 1FFQA 1ZBWA 1ONWA 1XIDA 4H9TA 3WUGA 2BX7A 5ABGA 2F6UA 1RUSA 2CZEA 3TYDA 4LTSA 3PFMA 4Z2JA 1XYBA 1JR1A 1NDZA 1V51A 3WFLA 2EG8A 3H7RA 4MWAB 4MZYA 5C9RA 1DV7A 4QJ1A 1UH3A 2W61A 3H70A 1JGMA 4M6QA 4Q8NA 3NDOA 1FXQA 4GYKA 1K9TA 3L4UA 3LSBA 2H8XA 1UOKA 5FAJA 4G7FA 1MXGA 4MSSA 5LXXA 4B4FA 3B0VC 1DJWA 2DZTA 3WFZA 1R87A 4PMDA 3SCWA 1W1IE 1VIZA 4DYJA 3ZO9A 5I3JA 3FA3A 3CHDA 4LCSA 4NVTA 3W26A 4ACZA 4GVFA 3S5SA 3AIBA 3B06A 1AH4A 5FF4A 2PDGA 2J9YA 4JTFA 1G7VA 3MVTA 3K13A 3W1MA 1NWUA 1RLDA 4MJMA 2QDGA 3H2NA 2BHUA 4ZB2A 4DF1A 3U4FA 3MT1A 3W38A 1R3YA 1DIOA 1MUCA 3UD6A 4W87A 2GFTA 2PTYA 1EB3A 3URQA 3HPAA 1DJIA 3L4ZA 4Z1CA 4N9BA 4IGSA 1V3MA 2YA0A 4HNNA 4O18A 1RY8A 4AY1A 3UXAA 1XI3A 4QDPA 1UIOA 3LU2A 4OZOA 1Q7QA 3E49A 1RHCA 1ML1A 4HTYA 3MKKA 4WXYA 3AYTA 1W1YA 4H4IA 4BR1A 3NPUA 3ZFHA 4IL2A 4GA8A 4CCEA 1B57A 4IMGA 5LNRA 3A4XA 4MNLA 2PC4A 3FYPA 4ACYA 1IIGA 2HISA 4CNOA 3ZR4A 1QWKA 2WHMA 1EP3A 2BGNE 4CQCA 1IEQA 2G4JA 4HSHA 1LP6A 3QQWA 4S2BA 3SW6A 2FPVA 4Y6GA 4FP1A 4F3HA 4J3XA 1GNXA 3E5BA 5DY2A 1ZL1A 5FEXA 2WJZA 3CUJA 4MYXA 5MKGA 3ARZA 1IZJA 4R5EA 4US5A 1UJPA 1PX8A 1PXGA 3AMCA 1E0VA 2W79A 3S0CA 1GWJA 3OZYA 1QUMA 4EXAA 3SM0A 1RR2A 3CIVA 4FAMA 2GDQA 2DW6A 3MP4A 3FA5A 2V69A 5FEZA 2VD9A 2QCHA 4MPKA 1AW2A 4UR7A 2GOKA 4ZSTA 1MFVA 3QF0A 1UWTA 1TWSA 3FOKA 1MZRA 3O9NA 3RJYA 3GYCA 5BRBA 4LF2A 1HVQA 1HKVA 1UCWA 4Q4RA 2XG9A 3PK7A 2ZTKA 4KBXA 4C6FA 3GIYA 1ECQA 3BLOA 4IP4A 3UXKA 3PBUA 2CLPA 4Z1AA 4HT3A 4L7ZA 3E12A 3M9YA 1HJVA 4ORMA 4EK7A 3FN9A 1H7RA 1ZU8A 2E5BA 1VFUA 2YL8A 2JEPA 3BE7A 5C9ZA 2FFIA 4I5XA 3W75A 4M6UA 2QDEA 3LQLA 3OGSA 4P8XA 4D72A 3MSDA 3P60A 3W7MA 1KNWA 2Q8XA 2GPTA 3MCOA 3FW6A 3QSTA 3NL2A 1U30A 4KFNA 4RW5A 3MUAA 2A4AA 3WX7A 4L4PA 1US0A 1XPYA 5K4ZA 1BG9A 3SCVA 3ATYA 2R91A 1PX4A 3ZJ6A 1RQHA 2PPGA 4WRHA 3OLGA 2X0SA 3W7JA 1UWAA 1H0GA 1YDYA 4ZA0A 3GTIA 3LPGA 1GEHA 4CQBA 2WCGA 1J0ZA 3NZPA 1FWTA 1WYIA 6XIMA 1TWDA 1E6QM 3HM7A 1G4TA 2GQ8A 2ZRVA 4GUGA 1TA3A 1G01A 2CXEA 3IAQA 2XVNA 4LAOA 1ZBKA 1I2OA 1QRQA 1W1PA 2WNWA 2ZA1A 1A3WA 2F61A 4OBRA 4INFA 4RE0A 3APGA 4HQVA 5BXSA 2CZ5A 2P5NA 4U3AA 5BCAA 1K1DA 3NEVA 1XCXA 3DERA 3C0LA 1C92A 4IGNA 3WQCA 5EMYA 3S5YA 1SO4A 5CXPA 4NAFA 1EQPA 3QGAC 3MMUA 3UVIA 2JKPA 1ONXA 2QQ6A 4JTQA 4C7DA 2Z2BA 1Z41A 3DFHA 5LGXA 3R79A 3MU7A 3REQB 1LL7A 1SO6A 4MB5A 3SRHA 4H7ZA 1MEWA 4E2BA 3O6YX 4U10A 5EFDA 3RO6A 1UR8A 5BWAA 3AHVA 3ZLFA 3GU1A 4HJWA 2E4TA 2EF9A 2WVUA 1H1NA 1R2TA 2V3DA 5GQBA 5TD4A 3G1RA 2VFDA 3E38A 2VENA 2PDHA 3VX0A 3GUWA 4XD6A 1KLZA 3N9SA 5T9CE 1Z32X 3BOXA 2P0IA 3C8FA 4KS0A 5BMXA 3TOYA 3OU8A 5FCZA 1OX6A 1I1XA 2EXOA 2CKRA 5D38A 5EYWA 2ZE0A 2RJGA 5HINA 1UR2A 2ZOXA 5HDRA 2BP1A 3VU2A 2J7EA 1J79A 5LNSA 4S1FA 3NL5A 1FFRA 4L56A 1EZ2A 2H8ZA 6PTDA 2WB5A 1GPWA 3AMDA 3WUFA 4AHPA 5U4NA 4D9PA 4B3KA 1XD1A 1K3UA 2TODA 4HA1A 3A24A 3WQVA 1CXEA 4FNSA 4QG6A 2F84A 5GJPA 1TX0A 2VZSA 3KTSA 3T2PA 2GJXB 2QDHA 3VO0A 1I4NA 1U1HA 2G4FA 1LOQA 5AYZA 1PO9A 1TFVA 3BV4A 1JIBA 3DECA 3W1LA 5CBBA 1WNOA 3CZKA 2D24A 2J7HA 2Z00A 1DJZA 5HR6A 2D0HA 1KCZA 4UBPC 4YVPA 3UT0A 1ONRA 3CZLA 3NVTA 3RX3A 5JUVA 3AS1A 1V0NA 5I3HA 3EAUA 3MYPA 2D20A 3E1F1 1HQTA 5FL1A 7REQA 4IPIA 3COTA 4FO4A 3KLKA 4LWWA 1P43A 3S5NA 5KITA 1XPGA 2WC3A 1ZS2A 3N3TA 1EBHA 2O9PA 4DUXA 3GTNA 2OELA 3KFTA 4K39A 4AZ7A 2QVNA 4JDYA 4DF0A 1EDGA 4DJEA 1HGWA 2OQHA 1OSEA 5BWFA 2ISWA 2IQ0A 4A3HA 4V27A 2ISFA 4HD5A 4FZIA 3SGZA 3A23A 1FWGC 1SJCA 1LLWA 1SSDA 2CW6A 1SGJA 1SJAA 1VFSA 4UTMA 1ADSA 4G1KA 1PEZA 2HVNA 4W88A 1LJYA 3GH7A 2WSPA 4IM4A 4GJ1A 4QGCA 3VOCA 5CGMA 4UQCA 1A5KC 3OBEA 3V5FA 3K4DA 3WBWA 3ZM8A 1E9LA 3VDBA 4KEVA 4H83A 1KFKA 1X1NA 3QW3A 3VIOA 2BVDA 3GR4A 3B9NA 4G7EB 4QITA 3T0AA 8RUCA 3TN4A 1ZHAA 1FWFC 3QY8A 7ENLA 1CW2A 1G4EA 2X1IA 4K2SA 2OZ0A 1OIFA 3AJXA 3SSJA 3SJNA 4R7OA 1W91A 1B2YA 1PDYA 1J9YA 4PMUA 5I77A 1F2JA 2VURA 2Y5SA 3SCRA 4G9PA 3HG2A 1JRCA 1B9ZA 1FWRA 4LSBA 2VQUA 4ICNA 3TAKA 3G77A 3L9CA 4WJ8A 3VIKA 2J8TA 1KM5A 3KDNA 1UASA 4L4LA 1KC7A 2J78A 4JCLA 2VELA 1TPVA 2VEFA 4NXSA 2E40A 1FDJA 4XTIA 1RALA 2UWFA 3DYPA 4UZSA 3V1HA 1TPUA 1TZ9A 5CPTA 3WO8A 1OJXA 5CQ1A 5CZKA 4CD4A 1F5ZA 4CD5A 4AZIA 3HOJA 4JX4A 3AYSA 3SO7A 4E38A 1Y5XA 5DRCA 1VEMA 1UH2A 5C8BB 3B9AA 3VD5A 3EDKA 2TSYA 1C3FA 3IVUA 4LVFA 4MZ8A 5EB8A 3ARVA 4A8IA 1IXNA 1F3WA 2PDUA 5FA5A 1RBLA 3G0XA 3N6HA 2EO7A 2ZXBA 3EGJA 1KWGA 2G50A 4WKAA 3TH6A 3F4CA 3WMBA 2QW5A 1H62A 4GABA 3NAVA 1ZALA 2AMXA 3MSRA 1PTGA 4PH6A 1KBKA 3G3MA 1VFFA 1WDSA 3QR1A 3FJLA 1H4PA 3KWSA 3PJTA 1R7AA 4GYFA 5FF7A 3WUEA 1QI3A 4CUCA 3ES8A 1CXLA 1DQWA 1DWHM 4PTNA 4HMEA 3GXIA 2OTDA 4V1YA 3AXXA 3VNZA 1UZ1A 3AIRA 4LS0A 1V5XA 1KM1A 3S47A 4HTBA 4J9JA 4LYPA 3KZPA 1T96A 5F4SA 4ZODA 4PSPA 1I60A 4K6AA 2R1PA 1B3OA 2PFHA 3N19B 4D8AA 5C2GA 1ZFJA 2BXZA 2FHFA 4O1EA 2QS8A 4GRSA 3IIPA 4GOAA 5G2WA 2Y1HA 2D3LA 1SVDA 2BV9A 2J79A 4GKLA 3TV8A 2VVSA 4ECLA 3ITCA 2Z7GA 3EB4A 5I3KA 4L5ZA 3ZZ1A 4NJHA 1CGXA 5CLTA 2PBOA 3GWQA 1UOZA 1DBTA 3CQ0A 3GW3A 2GUBA 4Z0JA 4MLRA 3NQ6A 4MADA 3LENA 1IZCA 3PTKA 1VS1A 5LIWX 5D33A 3S9YA 3LY0A 3NIYA 5HMSA 3A64A 1OF6A 5ABTA 2V3GA 1V0MA 4K68A 4CGTA 1YHTA 3PBWA 1EF3A 4JFVA 3LQGA 5FOOA 2DU2A 3HQNA 4D6CA 3QV6A 1DWIM 4PN2A 2OSYA 3DHPA 3P80A 4LNCA 5EBUA 1RK5A 5A8PA 1LLZA 3KVJA 1SFSA 4CNNA 4MTVA 4LUSA 2OQLA 2C6QA 2J8FA 4MIMA 1DIDA 1VYSX 1HTIA 4IIFA 3WH7A 4EE9A 1T5AA 3H26A 3ANVA 4IFKB 6CGTA 2EPKX 3QHMA 4DLMA 3ARUA 5A5WA 3P5ZA 3GXTA 3VCCA 4C6LA 3NSMA 2A7RA 2NUWA 3I4KA 3BARA 3KCOA 3QZAA 2EBNA 1W8SA 3IUDA 1ONEA 5AC7A 3K30A 1K6WA 4GI8A 3G24A 4J3UA 1G0CA 3RRXA 4MY1A 3EXTA 2HWGA 3TYUA 4BS0A 3UA3A 4DXVA 2EG7A 5DLCA 5D8ZA 3N4EA 2OT0A 4CU6A 4H04A 5LA0A 3EPNA 4LBRA 4PMJA 3SRDA 3PHAA 1G6CA 4H01A 2QF8A 4E3TA 5HNUA 3CTLA 1JRBA 2WZMA 2PGFA 1U22A 5C2CA 4UQ9A 1KKRA 3IK2A 4ZOAA 2W3ZA 2TAAA 4O1AA 4UIOA 5L6UA 3TU9A 2DSKA 1UBPC 2EPNA 2ISSA 4DYEA 1GT8A 1JCYA 2YYUA 1SZFA 1XKYA 1L6FA 3L4YA 4UFLA 2A3HA 4GUJA 3W1UA 1XBZA 4Y96A 2YFNA 2NQJA 2DPEA 4CNUA 4NILA 3M0JA 4PSRA 2OB3A 3F4DA 1E40A 1T7LA 4UFMA 2FJUB 4GUFA 1S5WA 3VGGA 5XINA 1UR1A 4HK7A 3PANA 4HOZA 3HPFA 1QBAA 5DN1A 4V28A 1XG3A 2OKTA 4RL3A 3WBEA 1KM2A 4NZ1A 4J35A 2HBXA 4W84A 5TNVA 1OFAA 1M04A 4KWOA 2PAJA 1O12A 2J66A 2X1RA 1XLKA 1MO0A 5GJMA 4IIBA 3GXFA 4BQ4A 1TTJA 2ZADA 1UP0A 1E4NA 1V3HA 1WOAA 4UOZA 1CBGA 2X0YA 1ZP4A 2FQIA 2BMBA 4J3SA 4JEJA 1XISA 4LVAA 1DXEA 4OKDA 2ASHA 3A21A 1SR0A 1YLVA 4RE3A 5FJIA 2Q6ZA 4GJIA 1RH9A 4PMZA 1HKJA 4DAIA 3QJAA 4P8WA 1BQCA 4ZQRA 1IEXA 1Z8AA 3CXOA 3TYAA 1QHPA 4DI9A 3BG3A 4UTWC 1K8ZA 1E6XM 4D71A 2CLEA 2BB0A 2PTZA 1BSLA 2WMFA 2XYLA 1OEPA 3N2CA 4B5VA 4X9YA 2ZE3A 1C7SA 4XZ9A 3EB2A 2RKXA 4U2YA 4YCOA 3WL1A 2Y62A 2J9XA 4C1KA 4AMAA 4UUIA 1DEDA 3OHIA 3AYRA 3O2LA 4XTDA 3L0GA 3W81A 2QUVA 4UFIA 3ICJA 2D23A 3DHFA 2XSBA 1LRNA 1QTWA 2XN2A 3CO4A 1E0TA 2Z1XA 1WV2A 2Q02A 3UU0A 4OWGA 2NUXA 1IT8A 4KPLA 4AD0A 3SBFA 3B8SA 4I3GA 1EYEA 2NWSA 4L6HA 3G22A 4JIQA 3FSTA 1D9EA 4JY8A 1B54A 2YCKX 3LOTA 3UG5A 2FTWA 1A53A 3WSUA 2GJNA 5U7SA 3O15A 1UC5A 2E9LA 2XFWA 3ZVIA 3MV11 3I4EA 1D7KA 1REQA 1TYGA 1XLJA 4JIEA 1ME7A 2ZX5A 2DW7A 2KZHA 1KRMA 1J0HA 1V7AA 2NX1A 2DZVA 3SADA 1RA0A 1E0XA 2JGYA 4BEUA 4DUVA 4V2XA 1FTXA 2C18A 3GFXA 4GHRA 1Q6CA 2FLIA 2ADAA 1DWFM 3KTCA 3VGFA 1NELA 1N8IA 1E70M 2PA6A 4XBKA 5AC8A 3NM3A 3ZWSA 2GQ3A 3LLFA 3G8EA 2QCDA 4Q8VA 3G1AA 5HPCA 1UWSA 4PUUA 1PUDA 2G96A 2OXNA 3UPMA 4GWEA 4H8VA 4TQTA 1XYAA 2IQTA 3SFWA 3LYEA 4XVDA 4M6VA 2QCFA 4QJ5B 4Q7IA 4AHQA 4ERIA 4LYKA 1P6CA 4FSAA 3DXIA 3CH9A 4AYSA 3KLLA 1QWGA 3DIPA 4H41A 4AEEA 4NF7A 4ZZ9A 2E28A 4TUFA 4JD4A 2CKSA 2EG6A 1WKDA 3VINA 3LXAA 4O4WA 4NNAA 1JYXA 4J3WA 3BLEA 3LI0A 3PTQA 5TBOA 1XRVA 3AZRA 1RXOB 2Z27A 1W9XA 4J7RA 3LBCA 3AIVA 1EC7A 1W17A 4DBDA 3NCOA 5GNZA 2J7FA 4H6QA 3UXLA 3B0PA 4CQDA 4LU0A 4F0LA 4TR9A 1EH9A 3W0KA 3OBKA 4UTIA 4ZOCA 4TMCA 1FY6A 4FOUA 4DRSA 2X05A 4E8DA 4N6EA 3UZYA 1KFLA 2WBGA 4DZAA 3GDMA 4NL1A 3H24A 1F6KA 1E1CB 2J75A 1CYGA 1O5RA 1A5SA 3I68A 3S42A 3STEA 2J6XA 4MDPA 1W2VA 4ZO8A 1NVMA 2NX3A 4JGDA 3KBWA 2O56A 4BF7A 4B2DA 4J2MA 5DFAA 3OTRA 2O92A 3VKBA 1CPUA 2ZUUA 1NM9A 4HA4A 4LBUA 1OGGA 2HK1A 2C19A 4TU1A 4FR6A 3CTTA 4LAUA 2ALRA 3LGGA 1JPDX 3ES7A 4GXMA 3CV6A 2A85A 1P7TA 1RJRA 4Y8FA 2AMGA 4CLMA 4TOQA 4N7QA 2NV1A 3JRKA 3C2VA 1ODZA 3W9ZA 1F73A 2WBKA 4WDUA 1HZYA 3AAMA 4JTEA 5M17A 4HN8A 3H54A 3RR4A 3ALGA 3FVDA 4NIRA 1VZWA 2ACUA 2PLKA 2VTFA 1LZOA 1QW7A 3PN8A 2PU1A 3T8QA 5A6JA 2E25A 5BU6A 1GOWA 1OFOA 3GS6A 1EP1A 1XF0A 2P3ZA 2X8RA 3BAIA 5CC3A 2NSOA 1EJWC 1UWUA 3AIWA 4XAPA 5I02A 1GHSA 1TPWA 1MEIA 4H2CA 3W7QA 1D8WA 5D03A 2R14A 4XUYA 5MHBA 5AOUA 4F48A 4NY2A 3W2KA 4LC6A 4U5KA 1N82A 5CAHA 1S2AA 5JQ9A 1Z42A 3H8AA 3UCDA 4XD5A 4BWLC 2QPXA 5H6HA 2GWNA 1TPDA 3QRHA 3DDMA 4M0XA 4FXJA 3D5HA 4NI8A 4GCAA 3HG5A 1W3HA 2VGFA 3HV8A 1H50A 1E71M 1ZCCA 2GZXA 3DI1A 3VABA 3OG3A 1UR0A 1MWOA 2PRHA 3S6DA 3W70A 4IJBA 3DU0A 4AEOA 4AF0A 3PG8A 3JZUA 3CLWA 1EUAA 2NQ9A 1LRQA 4FNTA 3R43A 1L6GA 3OP2A 2EPLX 4JYDA 1VB9A 3IUHA 4GINA 2NZLA 4MZ1A 4O53A 5KETA 3R58A 2EAWA 4BFAA 1UJQA 4A29A 2YB4A 1VRXA 3U8GA 1P6BA 4MUPA 5AC6A 2FJKA 1HL8A 3UJEA 1XYMA 2Y7DA 3RG6A 2EGZA 2OOGA 3H6OA 3K1DA 5A6LA 2C3ZA 3EA1A 1EFZA 3MC5A 3A5FA 3WK0A 1W3IA 4AUBA 3O63A 4GO8A 1KQZA 1UPMB 4XBJA 1P1MA 1L8NA 3WQPA 3WLJA 1N7KA 5I3IA 4JIRA 3ZSSA 1EJ7L 1LWJA 4IPLA 1DJGA 4TX8A 2REQB 3EDFA 1GYNA 2E0PA 4HNLA 2VUNA 1HUVA 1ICPA 3UP8A 1LT8A 3UWQA 3Q4DA 4Q4SA 3PP7A 1V3IA 4L9YA 1E15A 1FWCC 4GZIA 3NGJA 4ZMGA 4IG2A 1A5BA 2LLEA 3CWHA 1W1ZA 3LCGA 3POHA 4C6PA 1XC6A 5J8LA 4DM1A 3EXSA 1TE6A 2OODA 1N8FA 2WNZA 3SAZA 4O14A 3OPSA 4W5UA 3W7RA 4MPQA 4B5TA 4K1WA 1SO3A 4S3FA 5EPDA 1H0IA 5GNYA 3LLDA 3E2VA 4BI5A 3DCPA 5H8MA 4AXNA 1CXIA 1GPFA 2ZIDA 4JX5A 3EOUA 3ZIZA 4JQ3A 3BQ6A 3ZQ9A 2QJMA 3WEMA 3PBMA 4JL2A 3L5LA 1OGSA 5IFTA 4D6IA 1EJUC 2F6KA 3SCNA 1RCOB 1UYQA 5E1QA 5FSEC 5CBIA 1HKKA 3GKFA 3BJTA 3E0FA 1RLCL 2AAAA 4AWUA 1QW9A 4LF1A 2VD8A 3O05A 5IOBA 4UFKA 3R5EA 3B03A 1O68A 2W92A 4FI4A 1C8VA 4FLOA 1E6NA 4IIDA 4GNVA 4KKXA 4HK5A 3LCHA 1FOBA 4DBUA 3VIJA 1CXHA 3DUGA 3LD5A 4RLIA 3DENA 1XIIA 1Q4WA 5D2VA 3WBYA 3JR2A 1MW3A 3TC6A 3L7RA 2C15A 5CPSA 3WLRA 3VC6A 1JZ3A 4GFIA 2VI0A 4ZOBA 3VOFA 2VRJA 4AEFA 2I56A 5B80A 3EDJA 1OFQA 4DB7A 4IQJA 4HZ8A 3C2EA 4LRSA 2O9RA 3H22A 5A8MA 2QNEA 1CI1A 3EMCA 2DV0A 4YN5A 3IJQA 3QFEA 3KHDA 1TJ0A 5BXTA 5B7YA 2ZWYA 3GIPA 3CHCA 2OGYA 3PY2A 3IV8A 1E73M 3VKAA 4ZE5A 4QP0A 2V82A 1DIEA 3F5JA 1P0BA 4MFEA 3AU2A 3FJ4A 4B91A 3N04A 3C6CA 5D2TA 5CG0A 3FEMA 3AHTA 3SUVA 1TV7A 5ABFA 1Q6GA 3QY7A 2J27A 3GVQA 3FGCB 4MG4A 1P6WA 2XIOA 1NAL1 2PDCA 3BCJA 4PZVA 3V36A 2WNQA 2GDUA 3WCZA 2PDLA 2WCSA 1E6PA 4HVXA 2XIQA 2MUCA 4LCQA 3WJYA 2OO0A 5CJMA 1TJ2A 3CQHA 5LXEA 1IXQA 5ECUA 2PI6A 1TTIA 2FDSA 2NVDA 3W3OA 1KFCA 1XFCA 1KM3A 1PAMA 2QAFA 4DN1A 2ACSA 5AHMA 2A7PA 4I9TA 5IBXA 4CCCA 1JUKA 4FXFA 1JCJA 2PWGA 5CZ0A 3AMGA 3HPZA 5CSYA 4FXSA 4S23A 3IEBA 1HO1A 3KL5A 3H4XA 1M5WA 1BXCA 3RPTA 2BVWA 3B4UA 4C6EA 1OG6A 3DYOA 1T40A 5FESA 2DSVA 3VE9A 1BFNA 2BXVA 1YNYA 4YJ5A 2WSKA 2JBMA 1LYXA 2HTMA 1UKQA 2JALA 2R8WA 2HNHA 2BASA 3VXGA 8XIMA 2Y89A 1OC5A 3F4WA 1KB3A 1X1ZA 2WMIB 4C6BA 5A94A 4PMRA 3W29A 1VHCA 2HSAA 2I5QA 4FLSA 4CN6A 3G3DA 5HR7A 3M07A 1A80A 4UOQA 2Y2WA 2PDFA 4GCXA 3OZOA 2DT3A 3IRSA 3S1XA 5JH2A 1M1BA 4LAZA 4I7WA 1PB0A 5DANA 4C6OA 4I9AA 2W0UA 4FNUA 1PKNA 1CT5A 1UB3A 3EXRA 1NDWA 3O1NA 1PIIA 3QLLA 4X60A 3CAWA 3Q2DA 1TJRA 4IQDA 5ENLA 3IANA 4TIMA 2FTPA 4H9ZA 4L1GA 1XLEA 2ZRYA 4YPJA 1ZCOA 3F2DA 2D1ZA 3KTXA 3IIVA 2ZRUA 3TCSA 3GR7A 1H7PA 3CC1A 4QBXA 1A0CA 4LW7A 3TROA 2DVTA 3SCUA 1CXKA 3RX2A 1KKOA 3AUOA 2R9RA 1LQAA 4I8DA 3GU2A 1RBAA 5G2HA 3IRDA 3VCRA 2D2GA 4ENLA 3SY5A 3OQEA 7PTDA 1WDDA 3S83A 2GGHA 4JHMA 3AHXA 1VIWA 1LL4A 4QG9A 4CQ9A 1CENA 1TPB1 1GTEA 9CGTA 3KL0A 4O10A 1J0YA 4DXKA 4JS3A 2ZXAA 2E6AA 4F9DA 4PTXA 3H7VA 3KAOA 3RN6A 3G1HA 5D4YA 3SY1A 1FHDA 5A6BD 3LGDA 3A3XA 1EJTC 3W24A 1JF5A 1XYZA 3NQAA 3EPMA 1QNSA 4KRUA 4D6DA 4G2DA 3PPCA 4O1FA 2FMOA 2E8ZA 3TJLA 4MF4A 1NWSA 3L5AA 3AUJA 3ITYA 2GL5A 4EPEC 1RAKA 3DG7A 4WY0B 2YCEA 1XLMA 3NXLA 4JX6A 4GJJA 2XGIA 1MEHA 4ZCWA 3K8KA 2F2HA 1ZLPA 3EYPA 4M19A 4JKMA 1OD8A 2YW4A 3M0HA 5A6KA 1HL2A 2QCGA 4XQ6A 1LBLA 1VJZA 2FZMA 3PJXA 1M3UA 5MF5A 1H51A 4IX2A 4A3QA 2ZZ6A 1Q13A 1SQ7A 3K4WA 2PS2A 2FPYA 2X09A 4ZQNA 1CZ1A 1R8LA 4FOKA 3B0UX 3W7GA 1IR2A 3TQVA 2IPFA 2FZBA 4KWVA 4HMCA 4PMNA 1EOMA 1K9FA 2CHNA 4JY9A 1XD0A 1JG9A 1H7NA 3T81A 4PUDA 1V02A 2YDSA 1E72M 4HP5A 3HJZA 5CSSA 2Y8VA 2YJQA 4Z1YA 3NQFA 3W53A 1XRFA 1K7EA 2ZZ5A 4RV8A 1JZ7A 1EC9A 2VDHA 4XVEA 2XIJA 4CN4A 1XM3A 2FKPA 2XIBA 4WVXA 2XH7A 2XZ7A 1PBGA 5D02A 1C90A 3GTHA 3WQ5A 5AHEA 2WC7A 3SGGA 3TSDA 4MKSA 3OYZA 2OX4A 4M7TA 4E4UA 3CUXA 4I5UA 1QPQA 4AISA 1B3XA 1W54A 3QR3A 1EPVA 3KRZA 2Q09A 4NZFA 3I65A 2YIHA 2DUAA 3TWBA 2QHAA 2YBUA 1E3XA 1UG6A 1BGAA 3LCFA 3WDRA 3IJ7A 3SUSA 1VQTA 3A47A 5LIYX 4V1XA 3DG3A 1FCUA 4WLCA 3W88A 3LXBA 4UNIA 1BGGA 4QHRA 1XGDA 1S5NA 1XP3A 4S39A 1ADOA 1Z89A 3PWGA 3CZJA 1JVNA 3IWPA 3KBNA 3PPGA 1S2TA 2DFAA 1NJJA 1JCNA 2CU0A 3IK4A 1HW6A 1WXJA 3VIGA 5E0KA 1UA7A 3G1XA 1OK4A 4CKQA 3L2IA 2XISA 4IPNB 1G5AA 2F7FA 1UP2A 3O8AA 4WDXA 2YLLA 1AW1A 2BY0A 5GJNA 3OLDA 3L4TA 3PAOA 4HHPA 3TTYA 1UUOA 1FWNA 2ZXQA 3GVGA 4UR9A 2ZUNA 1XYLA 4F0KA 2Y7EA 5HMEA 2BBFA 1J0JA 1JCTA 4Z2HA 1XYCA 3S2LA 2DSZA 4KFPA 2EKGA 5BRPA 2QCMA 2JEQA 3WLHA 5E5CA 2HNEA 1XBYA 5C5YA 1QI4A 3W7CA 4HU8A 3W27A 5D09A 5GNXA 2Z1BA 2KAUC 2ON3A 4Q8WA 3AALA 2RDTA 4DXXA 1XGZA 3BW2A 4GKTA 1VCFA 3F1QA 2VM8A 1JGIA 2PWDA 4RW3A 3CASA 3BSMA 1E9YB 4MWAE 3STPA 3RAOA 3N12A 1VENA 4OBSA 2HXTA 2PP0A 5CPOA 4D2JA 1VP5A 1EJVC 3MW7A 2OYLA 4EWND 3SB0A 2FH6A 3E0WA 2UBPC 2OJPA 3MPGA 2FYMA 3GTXA 1M41A 4JTRA 1YYAA 2VP8A 1AK5A 1CIUA 1I6NA 5AB3A 3LLXA 4QTGA 2H9AB 2QULA 1VYPX 1V08A 1THFD 3WD3A 4ZO7A 1A5LC 4HCLA 2B7PA 3OGVA 4ROPA 4Y8EA 3UBPC 1NU5A 5HA7A 4ICMA 4R53A 3MY9A 3GC2A 4O12A 1WAUA 3U7VA 4FEZA 3A12A 1OT2A 3S1UA 1D7FA 4PCTA 4C6CA 3IAPA 2XGZA 4J3ZA 2DQXA 3PBYA 1PV8A 4ZQPA 5D32A 5LHEA 4UQDA 1CGTA 3T40A 5SWUA 4M29A 4V33A 4OU1A 4LVBA 1WCGA 1JCMP 4DEFA 3VKDA 4FK9A 3NYDA 1N55A 2OG9A 2YGYA 5JBFA 2W9MA 3UCQA 2XVPA 3RGTA 3VMOA 4XAZA 1R9XA 4NAEA 4MWAC 1UWRA 4RX0A 3ARWA 4OFCA 3CL8A 1H41A 1JUBA 1FP9A 3B8TA 1UROA 3WELA 1YRRA 2G0WA 2YX0A 2NSXA 3EOLA 3IJLA 1K6AA 2BG5A 1TREA 1QPOA 3HMCA 4HK6A 2TMDA 1Q85A 3N11A 3SQLA 5BU9A 3S1WA 3GNNA 1TPH1 5CH9A 3AMLA 1IWPA 1WKFA 1BYDA 3L23A 2WJFA 4DJFA 1R9ZA 1AA1B 1P0DA 3B05A 4DZ5A 2DGAA 1UD8A 4Z2GA 1FWEC 5HPOA 1NWRA 2XSXA 2X42A 3K8MA 4DWSB 3KOZA 3WIJA 1FCQA 4HPGA 1O7AA 2HQAA 3EWDA 3M0XA 3H55A 1NQ6A 1YBQB 4S3DA 2CZDA 3WMCA 5LIKX 3HO8A 5LHFA 4JKKA 1PHWA 3KRSA 4WJXA 4AH7A 4QR6A 3WKZA 3WH6A 3QOMA 5HJLA 3SECA 3IGHX 1S3HA 3TSMA 2E1WA 1JNDA 2E5CA 8XIAA 5JBDA 4PUEA 2C71A 2YDAA 2YW3A 3IACA 2XUCA 3QPZA 3LHYA 2CYGA 1V3JA 5I00A 5H8UA 3NEHA 1TB3A 2W66A 4J3VA 3VZXA 4JXCA 3FNDA 1VFMA 2WJEA 3N34A 1M7JA 1KFBA 4OOZA 4GBDA 3LTYA 3MYOA 4HB7A 2PDYA 2CCRA 2WMKA 2YDRA 5KZ6A 4WSHA 2DH3A 3DBNA 1OX4B 3GVVA 2KX9A 2RHGA 2PDXA 4KRZA 3CZ8A 4JYFA 3F5KA 1O60A 3H21A 4LB4A 5I3DA 1MW1A 4IFOA 1EDTA 2B0MA 1RVGA 3ITVA 3L21A 1Q6QA 3CJPA 1QOPA 2EJAA 2A1YA 3GTFA 2JF6A 4YYFA 1FH9A 4HJFA 4WDTA 3ZVHA 2DP3A 1X39A 4GX8A 5LA1A 1W32A 1J5SA 1LWIA 1RCXB 4W4QA 1CX9A 1DWJM 2WZHA 5IDIA 4RNFA 2PDQA 3CV1A 3VFCA 3TLQA 2L5HA 3AROA 5TQLA 2ABBA 4GVGA 3MDWA 3T6CA 3NDYA 3LBOA 4ZL1A 2DVUA 4C1NA 1XIBA 3C56A 1LM1A 1R85A 2A3LA 5D30A 3E2RA 3BMXA 1B4KA 3USZA 4OUIA 3C3UA 4F40A 3K2GA 4DO7A 3E3HA 2J74A 1MI3A 1UW9A 1FA2A 5FEWA 5FL0A 4LUIA 5F1UA 3RDKA 1OC7A 4LUYA 2BVTA 1F4HA 1X6NA 2PF0A 3I10A 1VBUA 3EWYA 1B4EA 2XTKA 1L6WA 1F6PA 1DOSA 1E4IA 4CQAA 4XZWA 3TONA 3RCNA 2FHCA 3R8GA 1YQ2A 4ZSUA 2VXNA 2J8GA 4YXGA 2G3IA 4EAMA 1ICQA 4QCFA 3W1NA 2VGGA 4HNCA 1Q66A 1CLKA 3WQFA 1RPKA 5AVNA 1Q2RA 4PUJA 2VCAA 2V3FA 3RITA 1GOOA 1U1UA 3BLPX 1UH4A 1QCWA 5EKYA 1L6SA 3VTRA 3TQKA 4M6PA 3GXMA 1EXBA 3WQ6A 5J04A 4LPCA 1Z48A 1C93A 4RDVA 5I06A 2PDJA 4JNMA 4AVFA 2OYKA 4Z1DA 5KMYA 3EX6A 1TVNA 2CESA 4G56A 3TQ0A 3WDIA 2G3FA 4LVGA 1TO3A 3RLHA 3GD6A 3TKFA 4H19A 2V63A 3B40A 4RZ4A 3QC3A 5XIMA 1CWYA 1ZBCA 5HQLA 5LZLA 3CIXA 5HQMA 1KFJA 5G4HC 2G8ZA 3DGRA 3CNYA 4HPJA 3U2ZA 2ZVRA 1TV8A 4C6MA 5AYBA 2YA2A 3QYSA 3GIQA 5CBJA 3NVDA 4DJEC 3C0QA 4S3CA 4JAWA 2PF8A 2H3DA 1HG3A 1NIUA 1A0EA 1OCNA 1DJHA 1XGEA 5G1MA 4AD4A 3LMZA 1J2BA 2OWCA 4ERGA 3M47A 4CN1A 3VD4A 4AZHA 4S3EA 4W93A 4QDMA 4DO4A 4RZ5A 1BXNA 4UQEA 1OG0A 1QPRA 4JTSA 1S3TC 1PS9A 4PUMA 4XZMX 4UR8A 1H7WA 3UEQA 3HG3A 4EXQA 3B9EA 2CERA 3DN5A 1MNSA 3QR0A 1V93A 1RV8A 2XWDA 3FY1A 4UCGA 3KBMA 1XCWA 4N4QA 1VBHA 4ZR8A 2PE4A 3LCXA 3U2OA 4Y9PA 1POJA 1GK8A 2PGRA 1F76A 2YCLB 1EJRC 4MB1A 1BAGA 2VFGA 5A2CA 3PBVA 3CZGA 1MVYA 3ISIX 4S3JA 1TWWA 2XM1A 1UUMA 1W5NA 4L1XA 1B3ZA 2BS9A 2YKKA 3VX1A 3W2NA 5C70A 3II1A 4LV4A 3FHAA 1NP0A 1VFHA 1UR4A 4DJDC 3HV9A 1DHPA 2Z24A 1PSCA 5DXXA 1E1EA 2HXUA 4PEKA 3W1AA 3V0UA 2NV2A 3M7WA 1F74A 4US5D 1V77A 1EIBA 3VOJA 4PB4A 2PSNA 2O9TA 4UTLA 1ZJIA 4GMEA 4MWAD 3CMGA 3OGRA 4UTFA 3BAYA 3W7DA 2WVVA 5A6MA 1XLIA 4ACZB 3M5XA 2C7FA 2QJNA 1Q6LA 5I79A 4LNYA 4YWSA 1KM4A 3W6YA 2W5FA 8A3HA 3RM8A 1WZAA 3R10A 1GGOA 3LUTA 3E2QA 4QS5A 3FV9A 4UQAA 1V3LA 4A8LA 3ITXA 3W2UA 3GC4A 1MDRA 2E6DA 4LQ1A 3FJNA 1NFPA 3A9BA 3OHMB 1LLOA 5K9XA 1UD4A 4QE5A