4KW2A

Crystal structure of a putative uncharacterized protein (bdi_1873) from parabacteroides distasonis atcc 8503 at 2.32 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
240
Chain Sequence
ADWKVGIQTWTFHNLTLMETLDKTQQLGMGYAEAFFFQELGAPFPKETYLNYDLSDDNCALLRHEFKIRGIKPIAFGVASYGTNEEWDKFFAFAHKIGAHIVTVEPELNQLDYIESLAKKYDMEVAIHNHPASAEVVEKALKGRSPLMGVCADIGHWKRVGEDPLKNLQKLSGRIKVAHLKDLTDKMEDATWGTGILPVKAFVNELKRQHFNGLISIEYDDFKSDIQEIRNSLEFLQKCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a Putative uncharacterized protein (BDI_1873) from Parabacteroides distasonis ATCC 8503 at 2.32 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
total genus 77
structure length 240
sequence length 245
ec nomenclature
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4kw2A00
3KCJA 3P14A 1BXCA 5XIMA 4X60A 1D8WA 5H1WA 1XLFA 3CQKA 3UU0A 4A8LA 4J4KA 4A8IA 2XIMA 1XYLA 3CQJA 3VNLA 3ITOA 2Q02A 3M0HA 1K77A 4XSMA 1XIDA 5XINA 1XLDA 4HNOA 3TC3A 5B7YA 3QXBA 1DXIA 1DE6A 3KBVA 4PFHA 5TNVA 1I6NA 1XICA 1XLMA 1XLHA 3VNKA 1S5NA 4QE4A 4ZB5A 9XIMA 4EACA 2HK1A 3TVAA 1YX1A 1XIHA 4GQBA 5I7GA 1XLCA 4QDPA 7XIMA 1XIBA 3CWHA 1TZ9A 2J6VA 1XLJA 1S5MA 1XLLA 1GW9A 1XLBA 1XYMA 1XIIA 1CLKA 3AALA 1XINA 4QEEA 4DUOA 4E3VA 2GYIA 3P6LA 3DX5A 3KWSA 3L23A 2I57A 2NQHA 2XISA 4A8RA 2HCVA 4ZBCA 4YTQA 3C0LA 2GUBA 3KBNA 4W4QA 4GJIA 5J8LA 1I60A 4QE5A 2NQJA 4QE1A 3M0VA 3JU2A 4X61A 3KBSA 1OADA 3ITXA 3UA4A 3DBNA 3KBWA 3VNJA 3OBEA 3VNIA 4Q7IA 8XIMA 1XP3A 1XYAA 3IUHA 4DVOA 1XIMA 2G4JA 3CQHA 5AVNA 4EAYA 5B7ZA 3NGFA 4QDWA 4X63A 3IUIA 3ITVA 1QT1A 3M0XA 4QEHA 1QTWA 3LMZA 9XIAA 1XIFA 3CNYA 3KBJA 4GLEA 1DIEA 3KCOA 5XIAA 2G0WA 4ZB0A 4YTRA 3U3HA 5C9ZA 3FVMA 1QUMA 5AVHA 5EMLA 3VNMA 4OVXA 3C0SA 1XLIA 4HHLA 3QYSA 4GJJA 4YTUA 3VYLA 2NQ9A 5EMKA 3UVAA 3ITYA 5EMMA 1BXBA 3BDKA 5EMJA 2XINA 4PGLA 1XYBA 3C0QA 2X7VA 2ZDSA 1MNZA 3QC0A 4HHMA 3M0MA 4YTSA 3AAMA 3AYVA 3GNXA 4XKMA 1A0CA 3QZAA 1XIEA 3ITTA 4LNCA 4KW2A 1XLKA 5FA5A 3UA3A 2X7WA 3M0LA 1O1HA 2QUNA 4A8NA 3ITLA 1XLGA 3U0HA 5H6HA 1A0EA 2OU4A 2QW5A 1A0DA 1XISA 3BZGA 3CQIA 3UXIA 3XISA 2GLKA 3KTCA 3XINA 5B80A 1XYCA 6XIAA 2QUMA 4XIAA 1DE5A 3AYTA 1MUWA 3BZJA 3N4AA 1DIDA 4US6A 4XSLA 4ZB2A 3BANA 3WQOA 3IUDA 3BWWA 1XIGA 4XIMA 4YTTA 4HGXA 2GVEA 2I56A 3XIMA 1XLAA 4K1GA 1XLEA 1XIJA 8XIAA 2QULA 3KBMA 3KCLA 4K3ZA 2HK0A 6XIMA 3M0YA 4G56A 2ZVRA 4XISA
chains in the Genus database with same CATH superfamily
1W1VA 4BHYA 2JQXA 1SO6A 4IIDA 3PTKA 4D8ZA 3IACA 4Q6XA 5GNXA 5A6AA 1H7RA 3PG8A 1GG1A 1EOKA 2QDDA 3FS2A 3MWCA 5KINA 3QLLA 2CZVA 4H83A 3UPWA 3CPUA 3GH5A 1QATA 3MDWA 3CUGA 3SN4A 4V28A 2DP3A 4UTKA 3KBSA 1KBIA 1HGYA 2WZEA 2FIQA 3GKFA 2XSAA 1IV8A 1H7NA 1NP2A 3BGJA 5IRPA 3NZRA 1LWIA 3PNUA 4L4LA 1ISXA 1ZP4A 1L6FA 3GXTA 1XLIA 4R9OA 1BXBA 5D03A 1NWRA 4PGLA 1O5RA 3WLMA 2C7FA 4AEFA 4M19A 4L9YA 5HMFA 4YTSA 3N13A 1GVSA 1H0IA 5M17A 1E55A 2I1OA 1W9PA 3QQWA 1E5JA 3IJ7A 2CESA 4M6UA 2DH3A 3TLQA 4D6IA 4TIMA 1HJWA 3OU8A 4FZIA 1EP3A 1S5WA 3STCA 3UG5A 1ZJHA 1RY0A 1CWYA 1TTQA 3CEPA 4YTTA 2QR6A 3KLKA 4O18A 3CT2A 3OA5A 2X40A 5FJIA 3V5CA 4Q4KA 5CZJA 4BQ5A 2BXZA 2PDGA 1GPWA 3RITA 2QPSA 1FCQA 1BTMA 4H6KA 2E8ZA 4GI8A 4X2PA 1EYWA 3URNA 4INFA 1A5SA 3S0CA 3WFAA 3PBVA 1CGWA 4Z2GA 1KWKA 3T08A 3L4WA 3ELFA 4F3HA 4QBXA 1GOOA 3GB6A 5HQEA 5GPRA 3W2LA 4GHRA 3E2SA 1XP3A 1E4NA 1XSJA 1IQ8A 3JVAA 1C8YA 1BG9A 4WLCA 2J77A 4YJ5A 4LS0A 4PTWA 4S2CA 4WY0F 1PWMA 2RDTA 1I2RA 3HBLA 4KIEA 4HHMA 1GOIA 2OELA 4HBKA 3A4WA 3EDKA 1PS9A 3QZ6A 1TB3A 4LNCA 3PJUA 4PB4A 3UXLA 4F0SA 1VJSA 3LI1A 2RDWA 4DJDC 2DY3A 3QV9A 2OLSA 3H22A 3GQYA 2ZVIA 4AHPA 4F8XA 2W4XA 1V0KA 4HGXA 3W24A 3AMGA 2D0HA 4Y9OA 4IIGA 1DWFM 3BJSA 4JFWA 1KFJA 4PB3A 1WXYA 1Z48A 2XFFA 1DV7A 3S6TA 4E2BA 1NU5A 2ZDRA 3ZJ6A 4DJFA 1PZ0A 3G0XA 2OLAA 4KT2A 2OJPA 1K7FA 2PZ0A 1UZ1A 2CZFA 2GK1A 3NOEA 2DW7A 3WUGA 2GK1B 1A5UA 2VUYA 4DZHA 3MB9A 4NQ1A 1JR1A 2CLMA 4UOJA 2DZWA 1CLVA 1Q6LA 3N4FA 4HSHA 3B8IA 3IRDA 3GHUA 4OECA 3ZM8A 5A3HA 2Y88A 4WIWA 2ZUTA 4DBSA 1OSEA 1BG4A 2WXDM 4D8LA 3GR4A 3KBJA 1EPVA 2QCLA 1TWWA 2QJJA 2HJPA 3HJZA 4PUJA 3QYSA 2VI0A 3ES7A 5EMKA 2V8ZA 2WV8A 2J6XA 1TREA 3AIBA 3N34A 1LL6A 4BR1A 4UTWC 3I10A 4LXFA 4P61A 4E8CA 1MQQA 4AC7C 4FALA 3CXOA 2BWGA 3CH0A 5A6BA 2CZEA 3ARRA 1IXOA 1B3VA 1WKYA 5DY2A 3M7SA 1L8PA 3LLFA 3FGCB 4AD0A 4FOKA 4YCPA 3W26A 4GUIA 4AYSA 4PRRA 5F2MA 5U7SA 1P5BA 3CAVA 4N7QA 5JBFA 3KBMA 3FYOA 5CPTA 3VNLA 2R91A 1E3ZA 4W85A 1C92A 4IP4A 3L66A 3WBYA 1THFD 3E96A 3WFLA 1FX6A 3TSBA 3BJTA 4QE4A 1G01A 4IGNA 4RE0A 3CBWA 2DSZA 1SM9A 7XIMA 2WJDA 3CAQA 4RKAA 4ZFMA 3E1F1 4ERGA 3WQVA 3KBNA 3AZTA 1QHOA 4IIBA 4ZZ9A 1BHGA 5BXRA 4O15A 2AKMA 1KKRA 3G1VA 2JEQA 3CL7A 5D38A 3KRBA 1ITXA 1H5YA 2VKZG 1XCXA 1PKYA 5MHBA 3UZYA 1HNYA 2FTYA 3W1UA 3SGGA 4JY9A 3Q67A 3JZEA 3H55A 3TZFA 2XN0A 3FXYA 3SQSA 1XRVA 1QR7A 3W7DA 3PSVA 4IMEA 5KETA 1B0IA 4DBEA 3TMQA 3TR2A 1PKMA 2BHZA 4PTDA 2WKLA 4MPQA 2J24A 1W3IA 4BQ4A 3VOFA 1B4KA 4XZBA 4FK9A 4B5SA 5LNWA 1AW2A 2EXOA 2E9MA 3I3BA 1WXZA 4HHPA 1O5XA 1OYAA 2R1LA 5I06A 3UJSA 4Z42C 4L1XA 3DXIA 3HQOA 4FI4A 3PZQA 5HINA 4U3CA 2V5LA 2PI6A 2OZ3A 5TNVA 1PDZA 2ZUVA 4JEJA 3WJWA 2HK1A 5C6MA 2IUZA 2E5DA 5I7GA 3IVUA 4UCGA 3T07A 4ZTYA 3W87A 3ARYA 2YB4A 2GSJA 4G9PA 1EJVC 1TTJA 1T8QA 1GHRA 4CUCA 4Y9PA 3W88A 4Q7IA 2NV2A 2PRLA 5DCBA 2FDSA 3PANA 3CV1A 1VF8A 2DGAA 2J9ZA 4M6PA 2PDKA 3FXGA 4NZ3A 4IMGA 1C9DA 2C1HA 1H1YA 1GZ1A 4EPDC 5LSMA 4DY1A 1MRAA 1DTNA 4O16A 3MMWA 2BDQA 3L0KA 4PCNA 1JXKA 3NO3A 4TX9A 3K4AA 4WUIA 3L5AA 4JKMA 1Q7MA 3C2YA 3L0GA 4QNEA 4RW5A 4DQWA 4AMCA 1BSLA 5H6HA 4KRZA 1C7SA 3R25A 4CQDA 4NJJA 2I9EA 4UOQA 4HB7A 4B2DA 4HNTA 3GNOA 1TPB1 3IUDA 1EA0A 1RQHA 1X6LA 4WJ8A 4KCWA 2J7CA 4Q4OA 5FCZA 3LG3A 1VRDA 5FJTA 3L0NA 3WF4A 3DI0A 4JAWA 4HVXA 1AD1A 3ITOA 3BUVA 4I9AA 4IGHA 3AMCA 3AHZA 1BFNA 3RO6A 3TOPA 1VCGA 1XLHA 3URAA 1JCJA 3C2RA 5IM51 1SW7A 1YX1A 2WMGA 3NIYA 4ASTA 2FMOA 1A47A 2C0HA 1XIBA 4DJDA 3TH6A 4J5NA 1KM3A 3NQ2A 1QHPA 1D3CA 4KS0A 4DUOA 2J62A 3UFYA 4J2PA 4YPJA 4XV0A 1UHVA 3WK2A 5KZDA 1Y65A 1ZAIA 5A2AA 4IXHA 3R2GA 2Z2AA 3WLNA 2IPWA 4XKYA 2QCMA 3GAYA 4XKYB 3ARTA 4ZB0A 2OB3A 3POCA 4V33A 2OVLA 1SZNA 5FL0A 4ZOCA 3AHVA 3ITYA 2VVSA 3GX9A 5HR6A 1A3XA 3V7PA 2A2IA 3BG5A 2ABBA 1XYFA 3I6TA 4N9EA 2YJQA 1JZ8A 4LCSA 2RUSA 4FIQA 2QAPA 4LF1A 4N4QA 4UQDA 3VD4A 4BFAA 1GYLA 1J96A 2P8BA 1EZWA 1QW9A 3SW6A 1FWGC 1YRRA 3WYZA 2HPIA 1D8WA 4O54A 3HG4A 4HYWA 1E0TA 3CZJA 4UFJA 2XVPA 4A8LA 4M0XA 5G4WA 4UTWA 3SN0A 4TTUA 5F2IA 3MV01 4GQRA 3A47A 3C0JA 1KV8A 4L5ZA 1TPC1 3LGGA 2Y62A 4NHVA 1XIHA 1XW8A 1V6TA 1C8XA 2P3EA 2OSYA 3LHTA 4FX8A 3G2GA 5J04A 3VM7A 3UZWA 1V3MA 3N29A 1TQJA 2V69A 1AH3A 2IKHA 5G4HC 4IL2A 1PIGA 1SR9A 4AZGA 4QISA 3STGA 2XIOA 4CCDA 1EDTA 4KFNA 5CZ0A 3TXZA 1NFPA 2WAGA 4YL2A 1EIXA 4M81A 4GD0A 4UFLA 2PCQA 1W3NA 2A21A 3UWWA 3W9ZA 3MP5A 3W38A 1JDFA 3KZSA 4KCUA 5CBBA 4E8GA 4QITA 2W9MA 2WPBA 2ZWZA 2ON3A 3NL6A 3LHUA 1DQXA 5E5CA 1YPFA 4C6MA 1Y0EA 4I8DA 4RZ5A 4WGXA 3G77A 1MQRA 1AG1O 2G96A 4P8UA 1VFFA 4LAKA 1CW2A 4CCEA 2Z2BA 5A2CA 3GO2A 5L9FA 1YW1A 1CT5A 4NI3A 4ZB2A 4GVHA 2PWEA 4Y7EA 2BLEA 4C6BA 1TTIA 2DVXA 3V1HA 3NQ7A 3MV11 3ONBA 1J0ZA 3LMYA 4N6FA 4CNOA 2YA0A 4XSMA 1GVEA 5C71A 3N04A 3IGSA 3GTIA 5D33A 1BD0A 4LEFA 1BVNP 4Z2KA 1Q6OA 3GDBA 4E0CA 1JPDX 4FP1A 1VJIA 4DX3A 1FOBA 3VIHA 3WMSA 3G3MA 1E51A 4ZBCA 4TMBA 4BQ3A 3UY7A 4WGHA 1AQFA 4AG0A 2L5HA 2VDHA 3VIFA 3DBNA 2X0HA 3FVDA 1RP9A 5K4ZA 3P81A 4E2OA 1S3TC 4F4RA 2YXGA 3M44A 4NIRA 4GXPA 4C6OA 4LVBA 3FX4A 3I6RA 1WZMA 1UR0A 2PDCA 3IEBA 3W1PA 3C2VA 1C7TA 3WLJA 1WOBA 2E6AA 2Z1KA 3QRHA 3PBGA 3W29A 2VFGA 3QM3A 1R9YA 3D6NA 1AL7A 3N2XA 2CBUA 1W91A 1B54A 4LSBA 3M0LA 3UETA 4EPKA 3NNTA 3UR5A 5IDIA 1A5BA 1W8GA 3F5KA 1G4EA 3N3TA 1V8EA 4UQCA 4LAOA 3PZ9A 2QIWA 1XFBA 4RL3A 1SGJA 1F6KA 1R9ZA 2WMFA 3CZEA 2HE8A 3T6CA 4I5XA 3TUUA 4I9JA 2QS8A 4UTLA 1PX4A 4NY2A 4GXWA 5I6SA 3IK2A 4GVGA 1RH9A 4NZ4A 4OT7A 2VD9A 3WD0A 2R94A 3BOLA 4Z0SA 2Z1VA 5CC3A 1EGZA 1F05A 1IEQA 1E1FA 1EF2A 5FEPA 3ZJKA 5CJMA 2YSWA 3PUOA 3WLRA 1HT6A 2D0FA 1CXFA 1HJQA 4X3ZA 1B3XA 4PULA 1OFAA 3TOYA 4PMVA 4HK5A 3BCDA 5FF2A 4HNCA 3VGFA 5LHEA 3O63A 3BLFA 3S2CA 4F2UA 4LBSA 4H6RA 1ONEA 3BCFA 2ZXBA 3MKCA 3FJ4A 1DJXA 1VENA 3S5SA 4YTRA 4LF2A 3RLVA 4R7JA 2E0PA 3EWUA 1YHTA 3GXDA 3W81A 2HTMA 4YYFA 3GFZA 2Z0IA 8TIMA 1M7PA 4S23A 1GVYA 1PTDA 4LUYA 4NSBA 5ECUA 3HPSA 2NSXA 3STFA 3TJXA 2BX7A 3VI2A 4M8UA 3TW9A 4K8HA 3A22A 2P1FA 1NIUA 1TPDA 1RD5A 5GJNA 4QJ3B 3UWQA 1UIOA 4JZ5A 5RUBA 3LENA 1AK5A 1OC6A 5CSSA 3QC3A 3RYSA 5DMLA 1K6AA 3LBMA 2VP8A 1CGYA 4K1GA 2QULA 3M5YA 1K9TA 1E56A 5DT7A 1E6SM 4HA4A 4PFMA 4B92A 1MZRA 3IANA 4YU1A 2WW5A 4JTGA 3FJ6A 3CLWA 1UD2A 3NA8A 3WCZA 4GC4A 4J3VA 3N19B 3ZT6A 1IEWA 3VFLA 1RVGA 1NTHA 4HCLA 4QEEA 4MJMA 1FDZA 2EQDA 3E9AA 5FAJA 2C16A 5AKQA 2NSOA 2FVKA 1FWAC 4P5UA 2G3JA 5AYZA 2V0TA 5AVHA 1AA1B 2AQVA 5AHMA 3AFBA 1WDWA 4ZXLA 1TYGA 2ISWA 1E0WA 1FH7A 1W2VA 1ZZMA 3FHAA 3U2EA 1QJWA 5FEXA 3R79A 4O0KA 5BCAA 3UA3A 1TWDA 2DU2A 1WQ5A 4GKTA 3IAPA 2WC3A 1YE4A 4AH7A 2ZZ7A 2NT1A 3DYPA 5LXXA 4EKJA 1OIFA 1E0XA 3CT7A 4MNLA 5LA2A 3F2DA 1ZQ5A 3MWAA 2XM1A 4NJKA 5AFDA 3WZ0E 1PWLA 2NXHA 2CBVA 4NNAA 5LGZA 1QI0A 3BPWA 2GWGA 2PD5A 1YYAA 4QRNA 4AD2A 2VZVA 3WK0A 4AIUA 1EJTC 1EJSC 2BOGX 2Z7KA 3W53A 2PGWA 3TONA 4TV5A 4O10A 4H1ZA 4XBKA 3KAOA 2D2OA 2Y7EA 1VHNA 3CUZA 3EEGA 3EXRA 2O4MA 4ADUA 1R2TA 3FKKA 1GNXA 3KVLA 3UBPC 1Y8BA 2ZUNA 4JYEA 4AXKA 2W6RA 4A8RA 4LOCA 4XB3A 3ZSSA 5A5WA 1XRSA 1TE6A 4C1KA 3GFYA 2NUWA 1LCOA 2Z2UA 2I9UA 1QO5A 3NYZA 5KMYA 1JQXA 1E9LA 4HMCA 4WDTA 4NJGA 3WQWA 5BOOA 1FH9A 3VK5A 1JCTA 2NQLA 2VCBA 4L61A 1X96A 4K68A 1MXGA 1E71M 4GUHA 2R1PA 3P62A 4D71A 3PTQA 1RAKA 2VZTA 2I5QA 3O0KA 2Y63A 1W3LA 3A5FA 1XLGA 2WSRA 1JYXA 3E5PA 2D0GA 4A35A 1Q6EA 1HQTA 2WO5A 4WDWA 1HKJA 1O12A 3ZT7A 4E4UA 3MTWA 3PULA 2Y89A 4YVXA 3TN5A 1KGUA 3EOUA 2V5DA 1OBAA 3THUA 3LCWA 2QGYA 3AXXA 2RGLA 3ANYA 3UYIA 3V0TA 4ZQRA 1V51A 2J78A 4DJFD 3DFQA 1RJQA 4MNKA 2Y61A 3P61A 1B3OA 1RK6A 3F5LA 1C9WA 3VE7A 2ZZ6A 2JGYA 1XLCA 3AHTA 4G1KA 4EF9A 2YLLA 4LAZA 4UMAA 1UC4A 2VDIA 3Q45A 5E93A 4M1RA 1JIBA 1UD6A 3PJXA 4QROA 4ZFCA 1U1HA 2J7HA 5DRCA 1GZJA 2VHLA 4DO4A 3WBEA 3W7MA 4JCLA 1JD7A 7CGTA 2G0WA 5F2GA 4MM1A 1HG3A 1EP1A 3A3XA 2OR2A 4LYRA 3UR2A 1FKWA 1QBAA 5EPDA 1XUZA 4JQ4A 6A3HA 1WV2A 3B9DA 1BLIA 1JUBA 1Q4WA 3L21A 4GYFA 5A6LA 3T2OA 1I8JA 4FO4A 6ENLA 1ZRQA 1MYRA 3RU6A 2ALRA 5HK4A 3BG3A 4XBSA 2RFGA 3O6CA 4PUWA 2YCJA 1RY8A 3DU0A 3N4AA 3PBWA 3VD7A 7A3HA 3JUGA 2GQ9A 2F38A 1JDAA 2V5BA 3EX4A 5CAHA 2X8RA 1JCNA 1SW3A 4K37A 3E0LA 5D30A 3BLIA 4IMDA 1IIGA 5A6SA 3H4WA 5DXYA 1KB3A 5XINA 1OYBA 1YQ2A 2WSPA 3W74A 1PTGA 3T8QA 3D47A 2PRMA 3UNTA 3OZMA 3K13A 4JN6A 4UNLA 4C7FA 3PM6A 5A1AA 3CUFA 2OLHA 5BXTA 4YHEA 2P50A 3NQMA 3WO8A 4QJ4B 3O6YX 2QDHA 2GDVA 3IIOA 1G7UA 4XZMX 3R5EA 3LRMA 1KFEA 3FKRA 1ZTVA 1VRXA 1X1OA 4ICCX 3FSUA 2V30A 1EHAA 3A4JA 1Q6FA 4UR9A 2Y2WA 3BGGA 3KEHA 3KVMA 3H70A 4JDBA 1UKTA 2J88A 3SGZA 2Y6ZA 4JTIA 3Q37A 1SJCA 3RX3A 2Y7FA 1DIDA 2W67A 2BXVA 3QKEA 4C60A 1MEWA 3LSBA 4UFKA 1P1MA 1NDVA 1US0A 3WLSA 3Q94A 4EE9A 3VDCA 3W7EA 3PJTA 3SCOA 1XSIA 3AC0A 3TAKA 5LKYA 1UA7A 2Z29A 4YNGA 3HFYA 1XD0A 1ADSA 4GABA 4IM4A 3OIXA 4J27A 2GUYA 2A7RA 1NH6A 1MNSA 3RXZA 4QLLA 2I5IA 3ARPA 3M0ZA 3QPEA 3VIMA 4DB7A 1R87A 3ZR6A 4ICMA 3FLUA 1CXKA 4L7ZA 4YYCA 1UD5A 4ZEPA 3HN3A 3VE9A 2QHAA 4PA8A 1BQGA 2YLAA 4A22A 2PLKA 3DHFA 2MUCA 3NEVA 3OA3A 2JBMA 3S5YA 2FFIA 2I5GA 1VJZA 3DFOA 4AIOA 4O1FA 2V68A 3OZPA 3HMCA 2GGEA 4Y8EA 1PCKA 1PEZA 3NXLA 4JR5A 3BO9A 4K2SA 2WBKA 1QW8A 4UQAA 3DENA 5EFDA 3ITTA 4IP5A 3KTSA 2UY2A 1XJBA 3WNPA 3ARQA 2H9AA 4B2DD 3CV7A 3GG1A 4CNTA 3DKLA 3UG3A 5D09A 1FWJC 2EEXA 4HP5A 4OE7A 1QAPA 3KDOA 4MY1A 1ICPA 5C9UA 3T2QA 1HTIA 2NV9A 2OWCA 4J3SA 3VKKA 4FXSA 2KZHA 3BOFA 4EAMA 3KCJA 2WQPA 4X60A 2GFTA 2B7PA 2YYUA 1SJBA 1GYNA 4UNKA 3TNBA 4QIUA 3NZPA 3F2BA 4C6JA 5B7YA 3W2KA 4LCRA 3D3FA 5FACA 1XYZA 1TPFA 1W1ZA 2NVCA 3NQCA 4ZQPA 1X39A 3NXFA 3L4XA 4J3TA 2HQAA 2QKFA 3ICJA 1GJPA 1GVQA 5T26A 2F7FA 3TWAA 1Z41A 2NQHA 4GPNA 4WRHA 1D3GA 2J7DA 3R58A 4O8AA 4Q22A 4B5VA 1UWRA 1WDPA 1A3WA 3AU2A 3QMTA 3SY1A 2E3ZA 2JALA 3D0CA 3LHZA 3AJXA 4HKPA 2VJXA 1OX5A 2D69A 2I17A 2PPGA 5K9XA 1O5KA 1ONRA 2ZADA 3DUGA 1SMDA 3EX2A 4PRWA 3KOYA 1VYRA 3MC5A 1V3JA 4IH3A 1NSJA 1WZKA 3BLDA 2PDJA 4FNSA 5HMSA 1B9BA 1QASA 2B0MA 3UJ2A 8RUCA 1GEQA 3GBEA 3W85A 1J93A 3DAQA 4O1EA 3IJQA 1XX1A 4D1JA 5J5RA 3UPMA 4Q7BA 4AD3A 4RE2A 4TTGA 3G22A 1UQYA 2O4QA 5EGRA 1L2QA 3BWWA 1E70M 3KS6A 3LQLA 1XQLA 2PE4A 2JF7A 4ZSTA 1DJWA 3MT1A 4XISA 1OK4A 2ANUA 1LQ0A 2QIIA 4UQBA 1K3UA 3G1AA 4HZ8A 3H2OA 3K1DA 4QQ3A 4MFDA 2QDEA 3RJYA 3MI6A 1C8VA 4AIBA 4DI9A 3STPA 3NQ8A 3RCYA 3MCOA 1MDRA 3WD3A 1D3HA 2Y24A 1AD4A 5C8BB 3B0XA 5LA1A 1N8IA 2VFIA 5CLTA 4BF5A 4CVUA 4GYPC 1HP4A 1NOWA 1BYDA 2ICSA 1KFLA 2NQJA 5IOBA 4BS0A 1BGGA 4YLWA 2BS9A 4X22A 4P7OA 3C2FA 2HZGA 2G37A 3QY6A 1M41A 3IJ9A 1K4GA 3F4VA 3SGUA 4AF0A 2ZCGA 3T1GA 3MPGA 4AF0B 2WVSA 4LY8A 4JIQA 4RCXA 4RE3A 3ITCA 2X1UA 3HPFA 2DORA 3GNDA 3KVJA 2VEGA 3GW0A 3L5MA 4JTJA 3WDPP 3O16A 1VFHA 1N8FA 1WDRA 2AOSA 5BU9A 3ISIX 1JGIA 4QG8A 1KXVA 2E25A 3BL3A 2PCEA 3GKAA 4YS1A 3EBVA 1J79A 3AS0A 1FH8A 1PAMA 2VR4A 3K30A 3QOMA 4FR6A 1DJHA 6CGTA 4LTSA 5EMUA 2WB5A 3VGDA 4IGSA 3PSWA 4F2BA 3NPWA 4EP8C 1TCMA 1B4EA 2HK0A 1K8ZA 3U9IA 1XLFA 5A69A 3BLKA 1JYNA 2NT0A 3PJWA 2VR5A 2ESCA 4HA0A 2VR2A 1H7OA 3VD9A 3EWDA 4M7SA 3DC8A 3ZJ7A 3O9NA 1R47A 3NWRA 3CWHA 1S2VA 1UP2A 1EEXA 3HO8A 4Y9MA 5FEZA 3DX5A 1GORA 4R5EA 3W7NA 3VM5A 1RALA 5EL1A 2NX9A 4J7RA 4CD7A 3PB2A 1FDJA 2J79A 2ZXDA 1JCXA 1KRAC 3KBWA 2NWRA 3TJLA 1SSDA 1XS2A 2Q3OA 3F4CA 3LXCA 1YLVA 3FVMA 4ZOAA 2D2GA 3EA2A 1Q5MA 2VC5A 4M51A 5LNSA 2TSYA 1GQKA 5EKYA 3W1RA 3Q2DA 3VNZA 2HVOA 3B8DA 2O9PA 2IQDA 1I1XA 4OBRA 4XAFA 4CNNA 5EU9A 5HAOA 4LAUA 2MNRA 3FN9A 1LUCA 3UXKA 3H4XA 1EUNA 4MJ4A 4I7VA 2ZRZA 1HKVA 1C91A 2Z25A 5A8MA 3HGOA 1ISWA 2F84A 4A3QA 3WBXA 1UG6A 5FESA 1W6TA 3ATYA 5A8QA 2VENA 4B5NA 2G3MA 1UPPA 1GGOA 1O7AA 3FHQA 3S47A 3ARZA 3M43A 1UD3A 2WBGA 5LA0A 4HJWA 1B30A 1X8CA 4CNSA 1OB0A 3GUWA 1X6UA 4UCFA 3A24A 3EXTA 1OFRA 1TMHA 1T8XA 3PNZA 2DW6A 5A8PA 2WJEA 1RBOB 1MEIA 3VCNA 3GDLA 3DFSA 4G8TA 4HIBA 2VOTA 4RNJA 1GKRA 1Q6CA 3TYEA 1HP5A 2C1IA 2XM2A 2G3NA 3BAJA 2OG9A 2DSUA 4WX2A 5I3GA 2CZ5A 3B05A 2XFRA 2YKKA 4D6HA 2XSXA 3E2VA 4QSHA 2E6DA 3IIXA 2QDGA 1MFVA 1O5QA 3AS2A 4IFOA 1VEMA 4MB3A 4RZ6A 3U3HA 3F4DA 2AKZA 3OW1A 4LBUA 4W84A 1O60A 2Y7GA 4HOWA 5I3FA 1ICSA 4H7CA 1UH3A 3USBA 1PUDA 3GVQA 5CKSA 3F4WA 5I79A 4O12A 1B9ZA 3KOWA 3I3DA 5FI8A 1PE1A 2ZZ5A 1EJUC 2OOFA 1R8LA 5LXEA 1YXCA 5GNYA 4NASA 2AGTA 3N18A 4CU6A 3B06A 3URBA 3L2IA 3M5XA 2OEMA 1XXXA 2PDIA 3FNDA 1WXJA 1A5AA 4NJHA 1FDYA 1LG1A 5AYIA 1AVAA 3GC5A 2EHHA 4OHQA 3HB9A 4K7YA 3SUWA 1LL7A 2IS7A 4GUFA 3W7LA 2UBPC 5JVLA 3PF3A 5E0FA 5M5DA 1RHCA 1Z9AA 3EB3A 4GQBA 4WCJA 4UTUA 1QU4A 6TIMA 1JNDA 2EPOA 2A3AA 1S5MA 2DIKA 1TQXA 1RP8A 1UWIA 4MKVA 2XIQA 2GJNA 1TKKA 1WAWA 4IF2A 5LIYX 4QLKA 4Y9AA 5CC5A 5HUPA 5CSYA 3P2VA 4L64A 3NL3A 3O15A 1TJ2A 2E77A 1J4EA 4A2SA 2P3ZA 3LTSA 4GO9A 2DT0A 3EWCA 3EA3A 1K7XA 3CNYA 3OTRA 4O1CA 3PTMA 9CGTA 3W84A 2X1SA 4B16A 2OZ8A 1S5TA 3KFTA 4KBXA 3A3WA 2X2GA 2WSYA 4WD0A 1FWCC 1VHCA 4H6QA 3LSCA 2ZUUA 3S1UA 5AHLA 3N9RA 1N2VA 3DHUA 3UR8A 4U4MA 3AAMA 1EYEA 4JTRA 4HNLA 4LALA 4R33A 1LBMA 4NRSA 4HYRA 4GYPA 1KO0A 3QGVA 4GUGA 4LUJA 3B8VA 2BY2A 3I7QA 3R89A 2OWWA 3PVFA 4FX6M 5C5YA 3WQOA 2YL6A 4FPSA 3UR7A 3DYMA 4V1YA 1U1JA 3OGRA 2OT0A 5EBUA 2P88A 3APGA 1JI2A 1VZWA 2RDXA 3JRKA 4HD5A 3W86A 4JDYA 4DUVA 1I6NA 4HTBA 3C4UA 1QPRA 1NM9A 4Q8OA 4PR4A 4IGMA 3EDFA 4IHCA 5AC4A 1K9EA 4JGDA 3KTXA 2EJAA 1E6ZA 4HMNA 2PD9A 5D37A 2CC0A 2CW6A 2EPHA 1ZB5A 2Y5SA 3BAKA 4QLJA 2FH8A 5I77A 2PWDA 4CQ8A 2O9TA 3DERA 2PWFA 4J2MA 5BRPA 4ZODA 5ECVA 4NZCA 1UWQA 4NYYA 4A05A 1XF0A 1KR1A 4HNNA 3IVSA 3GTFA 2ISVA 4P8WA 4DIAA 2IMRA 1ZJIA 2WJFA 3U4FA 3GXMA 3NQVA 4A4AA 1JGMA 1EX1A 3MSGA 3M6DA 3WQFA 3A3HA 2FKPA 3GTHA 3UEQA 1AH0A 3S46A 3O3RA 1U5HA 3QLDA 4US6A 3DHPA 4WK9A 2XH0A 3WQDA 1H7WA 3HTWA 3P0XA 3EEZA 1RQBA 3QTGA 1ZENA 4IFRA 1NY1A 4JTFA 4C6LA 4ZVJA 3KW3A 3NJ3A 2YCLA 3LBCA 2FZ8A 3U7VA 4JHOA 1NWTA 4B5XA 2YCLB 5AYXA 4Q4QA 1DE6A 2J7EA 1XUUA 3C52A 3VNKA 4DXVA 3VKJA 3TLLA 2XGIA 1IYXA 4MLRA 1TV3A 4BA0A 4JHMA 4UZSA 1KFBA 2OGJA 2YBTA 1CNVA 1GZGA 4LS1A 1HO1A 3O6AA 4XUYA 1K8CA 1ZL1A 3TX9A 3AO0A 2TAAA 3WLKX 3I4KA 2VMFA 1S2UA 1R30A 3EOLA 1O94A 4DF0A 2OXNA 3CTTA 2BHYA 4LYPA 1Q65A 3TYUA 1X8FA 3R6IA 3WJXA 5F7UA 5DT5A 3SRHA 4XK2A 5G1TA 3A9BA 4GX8A 3ZOAA 1S2CA 4AVFA 3VCCA 5DFAA 1J0HA 3V5FA 3GZAA 2FYMA 3PZOA 3ABQA 4RXFA 1RJPA 1TO3A 3DG7A 5HWJA 4N42A 2BY1A 5F1UA 4CQBA 4DNHA 4AD1A 3OVPA 1IF2A 2HRWA 3WQGA 4C6PA 2ZX6A 1JFHA 3T81A 4RNFA 3STEA 3K8LA 2EJ1A 3TQVA 6XIMA 2X09A 3L4TA 2XSBA 3WLHA 1M68A 2VD8A 1JRCA 2UWFA 4MF4A 1K8XA 3M64A 4US5A 3C3NA 1F5ZA 1DXIA 2Y1HA 2X2YA 4HNUA 5F1VA 4L4MA 1QO2A 5ABHA 1GVOA 1ME9A 4O11A 2J6VA 2Y8UA 3EPOA 2PGFA 1J5SA 4MY9A 1EKOA 2NZLA 4M6VA 2O7QA 3LZ3A 2G5WA 2WNWA 2VX5A 1IIHA 3RPMA 1OQFA 2OEJA 3WF2A 1C29A 1FWDC 5HDRA 4ENLA 3PY2A 3WQ8A 3T7VA 3AXKA 4ZL1A 1P0BA 4UWMA 4UFIA 1SO3A 3S6DA 1KXHA 1F3EA 2X41A 3AYVA 1UP3A 3W2NA 2Q01A 3ZFHA 3MS8A 3EDDA 1MZHA 2WJZA 4PMXA 4GKLA 4DXXA 4Y8FA 3RNDA 3TP4A 3WQPA 1DE5A 2CYGA 5CJ5A 2CITA 5A94A 1SYTA 1LM1A 4PTNA 4XZHA 3DGBA 2H3DA 4AD4A 3WH6A 2XZ9A 3SM0A 3NL5A 2EKCA 4MAVA 4XZIA 3W6LA 2QJHA 1KGWA 2VL4A 2GJXA 1Q2SA 3CUXA 1SJAA 2XVKA 3QMSA 4L65A 3MBDA 3QN3A 2AGKA 4RDYA 1TSIA 2NUYA 3TYDA 4J35A 3FJNA 3PBYA 1TPH1 4FLSA 5KITA 3H7UA 4ATWA 1KLYA 4WJEA 1UJQA 4K1WA 3UY8A 1SFSA 1XLJA 3SCVA 1X1ZA 4JIIX 4C6IA 1XG4A 2E40A 4F79A 3WLLA 1EQPA 3BARA 6TAAA 3MZ2A 4JY8A 4WEVX 1AJ2A 1O1ZA 1RR2A 5I5RA 5CCZA 5XIAA 1DXEA 2ZC1A 1DHKA 4B90A 4HU8A 3ONCA 1OZMA 3UWYA 1M7XA 3TTSA 2XINA 1FWHC 2PDXA 2F6UA 2V3EA 4G7FA 4GA8A 2Z26A 1ICQA 3C2EA 3AUOA 4KCTA 4KEZA 3ABSA 7REQB 4MG4A 4WQ6A 1MWOA 4HTYA 3MUY1 4PMYA 3PBMA 2VWSA 3RX4A 1P0NA 2BVWA 5FF4A 1W1PA 3EOSA 1V7AA 1J0IA 2ZC8A 3GFXA 3GYEA 3QF0A 4MGGA 4XD6A 4K38A 1XDMA 4RNHA 2YW4A 1W5PA 2ADAA 2ZXAA 4ILSA 4XVDA 5LNVA 1Z7AA 1B5TA 3G6MA 1LBLA 2FVLA 5HR7A 1CENA 4AFYA 1VR6A 5CGMA 3REQA 3G0SA 3REQB 3LNMA 2WNZA 1GVRA 1SR0A 4IPLA 2JKAA 3AS3A 2HV5A 3PFMA 3KP1A 2V5CA 1R38A 5FJJA 2QCDA 2CWXA 4CN1A 4NG3A 3P74A 3CWOX 3O7UA 3KE0A 1S5VA 3GYCA 3IUHA 4F9DA 1N8WA 1HFBA 3CTLA 4EANA 1CB2A 4X9YA 2FZDA 1VIWA 2V6AA 1DBTA 4GCXA 3OVQA 3TTQA 4TX8A 4F48A 3W76A 2VGBA 2PP0A 1KNWA 1KD0A 3VKDA 1PZ2A 4BEUA 1FVPA 1JDCA 1W32A 1H1NA 2BMBA 4PSRA 1LT7A 3UPBA 2XGZA 1L6YA 1UBSA 2IW0A 3M4HA 2ZRWA 1G1YA 1UCWA 4W86A 1RJRA 3WSUA 1KXQA 1AL8A 3VA8A 3AROA 2OQHA 4EIVA 3SADA 5D8ZA 3TR9A 3P80A 4GIRA 4UOZA 5IBXA 3E5BA 3CWNA 3MBFA 4NNCA 4F0MA 3C56A 4NXKA 1DPMA 4O57A 2O55A 2I14A 3AIWA 3IGHX 3T0AA 2BY3A 3EB2A 3O1NA 4C6EA 5HJXA 3BMWA 3G1XA 4BCEA 5A6MA 3AMKA 5LGXA 1P0KA 3TVAA 1TJ1A 3I7RA 4MJ2A 1GPFA 2CLOA 5DRIA 1WB0A 4G1NA 1SUXA 3WLTA 3VFCA 2XPKA 2ACSA 2JFEX 2PBOA 4I5UA 4P7QA 2OYKA 3UA4A 1ADOA 3F2CA 1TV5A 1B57A 5EMYA 3RHGA 4LVDA 1Q6RA 3MHGA 4QS6A 4HCDA 3AMDA 4KWWA 3GIPA 1MW0A 1OK6A 2O9OA 1FCBA 4JIPA 2D3NA 2TPSA 4Z2HA 1F7BA 5CLWA 1NP0A 1W9UA 2GSEA 4OVXA 4MPKA 5ABGA 1Z6KA 1SMAA 2PA6A 1PPIA 3AU6A 1RD6A 2YW3A 3OGSA 2ZUMA 5MKGA 1YTKA 3R8HA 3WQ6A 2HMCA 3CIXA 5MKGB 3ZVIA 1HX0A 3C6CA 2FH6A 4KEVA 1E9ZB 4FLRA 7ENLA 5CBJA 3KOXA 3RIKA 1SFJA 3CL6A 3E74A 4XIMA 4GINA 3GU9A 4LPCA 2W66A 1XIJA 3U2ZA 2D2JA 1B3WA 1VYSX 3IS4A 3OODA 3W7KA 3GDMA 1REQA 4E4FA 2ZA1A 2BGQA 2VGFA 3TV8A 1XIDA 1XLDA 4S39A 6PTDA 4LUTA 2UY4A 4A2RA 4TU1A 4ZB5A 4RDWA 4W7WA 4UFHA 4V1XA 3HIJA 1S2TA 1IGWA 2HVNA 1QCWA 3OVRA 4JX4A 4I9MA 2F2HA 3TK7A 1NOUA 5G1MA 3MP3A 3NQ6A 1W1IE 3WMBA 3G1RA 5AHNA 3EWWA 1TX0A 4EX4A 4H19A 3H12A 2VM8A 2X16A 5CXPA 1UWUA 1UD4A 4DVOA 5TD4A 1Z89A 3VKAA 2J13A 3MDUA 2AQOA 4O52A 4W8BA 4KWVA 3CMGA 2QV4A 4E6MA 4H3DA 3BLEA 5BOFA 1DJGA 3ZLGA 2UY5A 1G6CA 2E1WA 3WLQA 1UUMA 3GE7A 4HQVA 2QCFA 2QEZA 1YPXA 3THQA 1UOZA 1NQKA 4HU4A 1TWZA 1YDNA 4H2HA 1HKIA 2PF8A 2QJMA 3QW3A 4POCA 3GVGA 4JQ2A 4ZQMA 5GNZA 3RM9A 3M0KA 4JPGA 4XAPA 3WDQA 2H90A 4R9XA 1FWRA 2OKOA 2PDHA 3EX6A 3MSYA 2OSXA 2QGHA 3HPZA 5D9PA 4K36A 3W1TA 1J12A 4IJCA 3CHDA 1FCVA 3V0UA 3R0DA 4U2ZA 2E6FA 4RZ4A 2DEPA 4Q8QA 3RF9A 3LPPA 5H1WA 3DGRA 4NILA 4N4PA 1EWDA 1JAEA 2C13A 5CZKA 4Q8PA 1XDLA 1XKYA 3AI0A 1OG0A 3NAVA 2YOCA 3FA4A 3QBUA 2PDFA 3M16A 1HZYA 4RV8A 2CLPA 1V02E 2KAUC 3ZO9A 4C6CA 2BVTA 3S9YA 2O92A 3HOJA 1W1B1 3VXGA 4PUUA 4J3WA 5IHRA 4BK9A 3SJ3A 2PC8A 1E43A 1VFLA 1YTEA 2FZMA 1NEYA 2XH4A 2DZAA 3NGFA 1J18A 4QFUA 3NSMA 3PAJA 4BEQA 4D6FA 1GOXA 3K8KA 3GXFA 4JN8A 2FPTA 3VKCA 5T9BG 1E72M 5LNRA 2FTWA 1RQEA 2YX0A 5CPLA 1OT2A 4K6AA 5I23A 4NZFA 1JF6A 3E49A 1OF6A 4KIRA 5HA7A 2ZKMX 1VS1A 1GOQA 1V4YA 1E40A 2OU4A 3OLIA 4AY1A 5CAKA 2GGJA 4QR6A 3TA9A 4CLMA 1VCVA 1NOFA 1VEOA 2JEPA 2PWVA 5E6YA 1YDOA 4B5WA 1V0MA 4OIFA 3NM3A 1Q13A 1TMLA 3W0KA 4YWIA 3WQEA 4ROPA 3W02A 4L4PA 3GHTA 2ISFA 3AS1A 2CPUA 4M5PA 2POZA 4HOZA 3H21A 2EKGA 4X0VA 1PO9A 1WDQA 1AMYA 4EACA 4PMOA 2OPJA 1MUMA 2VELA 5AHFA 1JJKA 1H51A 5G4EA 1Q63A 2VGIA 3T40A 1QOQA 3PG9A 5CPNA 3L67A 5CG7A 4X0NA 3P8JA 1CDGA 1EIBA 3LHWA 2ZRYA 3ITGA 4XO6A 4B15A 1UR1A 5DBTA 4KGJA 3VNJA 3KX6A 4MVAA 4PH6A 3U8GA 1ISYA 3NCOA 1DJZA 5E0CA 3WLOA 2ZX9A 4Q4MA 1W1TA 2VEPA 1Q4NX 5K3VA 4C1NA 3WDRA 3G1DA 4MKNA 1Q45A 4C1NB 3GIQA 4PN2A 2QVHA 1F61A 3BV4A 4GQQA 3WF3A 3VDAA 1MVYA 1WO2A 3BC9A 3F1QA 2VQUA 1OHLA 3PWIA 2GOKA 3PTDA 3G24A 1W8SA 4I90A 2Z27A 1SO4A 2PDNA 3XISA 1CGVA 1JXJA 1XGZA 2UZ9A 4P7LA 1J11A 3MZNA 3WK1A 2WYSA 4XSLA 3P60A 1US3A 2C8NA 5HJLA 1PSCA 2ZA2A 3ABRA 1AZ2A 4G56A 2ZVRA 3WUBA 4YN5A 2C71A 1LYXA 2FGLA 5CGQA 1BKSA 4FXJA 1TJRA 1W2PA 4IPJA 3A4XA 3R12A 2GVGA 1PX3A 4YIWA 4AEEA 2A7NA 4L1GA 2BB0A 3P93A 1PKLA 3E02A 3RM8A 1PHWA 3M5ZA 1Q2RA 3SN1A 5C55A 3EOOA 1R7OA 1A5NC 1AW5A 3P0WA 4GJ1A 3GG7A 2W79A 2J75A 3N2CA 1E9YB 1LQAA 4FA3A 2PGRA 1KLZA 1Z32X 4J28A 3GSMA 4LANA 2ACUA 1AUSL 3WDIA 4QEHA 4HA3A 1OEPA 4ZQCA 4FHAA 1GT8A 3IJDA 1DTUA 2BFGA 2QQ6A 1BQCA 1P43A 2ZX5A 3WG6A 4Y6GA 3H4GA 3A9IA 3MHUA 3AZSA 2FHBA 4XAZA 3KUMA 5E0KA 3MW7A 1OABA 4QHRA 3CM4A 1IWAA 2ZIDA 1WE5A 3DDMA 3S2NA 4DEFA 4DWSD 3ARUA 1GVFA 1J10A 3CHFA 3AIVA 4RJEA 3BAWA 4UUIA 3QY7A 1M7JA 1U5VA 1A4LA 5AC7A 1LRTA 4GC3A 3QH2A 1H2JA 5C0QA 4TMCA 3MI2A 1RXOB 2DZXA 2GJPA 4MOZA 4IICA 2R14A 1VBRA 4PUNA 1CXIA 1EUAA 1PHQA 2YL9A 1ELSA 3BLLA 4W88A 5DF0A 2DPEA 2ALDA 3ZYZA 2PTWA 1KFCA 3NO1A 3KWSA 3QSRA 3OEXA 1KM0A 3U48A 3R8GA 1VC4A 1XKJA 3CAKA 5E70A 4FXFA 1QI2A 3RRXA 1G9HA 7TIMA 1QK2A 1CEOA 3IUIA 1IXQA 1Y5XA 5BWFA 4GQGA 1NQ6A 2OO0A 2W3ZA 4DJEC 3ID7A 1E6RA 4FS9A 2W61A 1J01A 3FGCA 3PZUA 4PUKA 3QV8A 1QI5A 3GM8A 1WOAA 4MZ8A 1EO7A 3D5HA 3QC0A 2OMAA 1EC8A 4DWDA 5BNKA 3I6EA 3U0HA 2YCKX 3QQ0A 3TAOA 4I3GA 2V9DA 3FCPA 1KFWA 3LCIA 1G4TA 3ERPA 5DMYA 1EF3A 2FB3A 5AC8A 2WHJA 2R24A 2XHYA 2OOGA 5AZ0A 4A6GA 1CTNA 4I7UA 4V15A 3NL2A 4US5D 3AICA 1BF6A 3CQKA 4CD5A 1DVJA 3LOTA 3S5OA 3NR0A 4NX5A 4RLIA 3VGEA 2ZICA 4YWSA 4XD3A 3V3WA 4S3AA 4UMCA 2XJ7A 4QDPA 3IIPA 1F73A 1FBAA 1KTCA 1OZQA 2XUCA 3H53A 4MDOA 4O1BA 4PCSA 2PGEA 3LXAA 3MMTA 1D7FA 4H9UA 4NZ1A 2C0AA 5FJRA 4X61A 4A3UA 3ITXA 4QAIA 3PWGA 4K7VA 1VGAA 4IQJA 1Q66A 4KMQA 2CXEA 3RLHA 5AHIA 5KZMA 1GONA 2FJKA 1N55A 5E6ZA 4ZENA 2C15A 5F2LA 4R34A 1K8YA 4YTUA 4DI8A 2PTDA 2ZX7A 2WVUA 4Z2JA 4OGZA 1TVLA 1FWBC 1S46A 1DXFA 3DECA 4F0RA 4NP7A 4L9XA 3NURA 5FA5A 4Q7NA 4MWAC 2FHFA 2CWNA 1L9WA 3B4UA 3BZGA 1AJZA 3LD5A 1RZMA 1JYVA 3XINA 3ZXWA 1LRNA 5AB3A 2R9RA 1MW3A 3EKGA 4LS2A 5DXXA 3DESA 1BYCA 1DOSA 8XIAA 3MUIA 2XDFA 5AC5A 1UASA 1IZKA 2MANA 1JYWA 2NWSA 4AD5A 1PTAA 3FV9A 3L4YA 4KEUA 3ENLA 2F6KA 4LJ3A 2WKJA 3EOEA 4M3PA 5FF7A 4LVGA 2QCNA 3P5YA 2DZVA 3TC3A 2QCGA 4A3RA 5KZ6A 3W37A 2IQ0A 3CV2A 4RK8A 4LRSA 3W6YA 3VZXA 1GEHA 2Z6IA 1NDZA 5AC6A 2JIEA 4EWJA 4ATDA 4H9VA 4GBUA 3B9EA 2VFEA 4FF7A 4JN7A 4B3LA 1EPXA 1LROA 2DZSA 5I3DA 2C18A 1EOMA 1AQMA 3WD1A 5JXQA 4IQLA 1EBGA 1S1RA 1YDVA 3SQLA 3HPAA 3GW3A 2W27A 4YVPA 4MB1A 2D22A 3THDA 1VFTA 4UTFA 3HPXA 4LUIA 3HF3A 4GX9A 1JZ5A 2E5BA 1EFZA 2C19A 1R3TA 1UUQA 3TTOA 3PP7A 1GQLA 4NAEB 4Q8UA 4B3ZA 3O2LA 1HGWA 3N11A 3LNPA 3OB8A 2OSWA 3HM7A 3M0MA 1VBHA 2VFHA 5ABFA 4YXGA 1DYSA 1XGDA 3E2RA 4JXCA 5ABFB 3UVIA 1A5CA 3QV6A 3LBOA 1XISA 3AHXA 4KEMA 2YCEA 5GJPA 4R53A 2FB2A 1IE7C 3OGVA 4GI6A 2XN1A 1MXDA 4MYAA 2GJLA 3UGRA 5K2ZA 4ZQOA 3NVDA 3W7IA 1K9DA 4KH2A 3ATZA 4RDZA 3V36A 2YDSA 1M53A 4UTTC 1FKXA 3T8LA 3DIPA 5I3KA 1L6SA 3ZS4A 3UYCA 3SDOA 4OFCA 4IL0A 2J8GA 4MJZA 1J0JA 4IJBA 2XIIA 4HZ6A 3ALFA 3HMJG 1FRBA 1BRLA 3ZLFA 2PEVA 4DLFA 4FLOA 1BRLB 1YNYA 3JU2A 3CLMA 4MTVA 5A6TC 1XFCA 1DKWA 1FHVA 3M9YA 1HN1A 1XBXA 4DF1A 1LWHA 2FFCA 4X63A 1FWSA 3M0XA 1YXYA 3SO7A 4I7WA 2ZE0A 3DFNA 4MADA 3GU2A 1IEVA 2PU1A 3LCXA 3PZMA 3G1FA 2QCHA 1EDQA 5EMMA 4LB3A 4L4OA 1GQIA 2PRHA 4RX0A 2PAJA 1F4AA 1J2BA 4GBDA 5E9XA 1XLKA 4B3KA 2WZIA 3PPCA 2QUMA 4C6KA 3IGXA 4AX7A 5DN1A 1HL2A 2WCGA 4BJHA 3KLLA 3SRFA 1TPWA 4DJEA 3LHYA 3RAOA 1Q8JA 2D23A 3E6EA 1TX2A 3MY9A 3M0IA 3CO8A 1F9CA 2OGYA 1OF8A 4WKAA 4GRSA 2XH2A 1DWHM 3CZLA 1FCUA 4D6EA 2P0IA 2OYMA 4C5ZA 1I0DA 3OHIA 1HKWA 4PUEA 3VIOA 1UQZA 4NUWA 4IQEA 2XFWA 3UWEA 1SPQA 5G1YA 2HCVA 4OZOA 2QZRA 3QQ1A 2G3IA 4QTGA 1CGUA 3INPA 4CCZA 4ERAA 2YYTA 3SRDA 1OFBA 2VC9A 2GUUA 1XIMA 4YVVA 4AYGA 5LNUA 3LQGA 3ABOA 1XBZA 1TG7A 3IJ8A 3LI0A 3W27A 3W1NA 1VLWA 4GJJA 1TJPA 4N9DA 3NQGA 3E2QA 5I09A 3W72A 4FOJA 5K4XA 1XC4A 2OFJA 4AU0A 3KL0A 5DQPA 2Y85A 3N9SA 3VAVA 2J47A 3K4WA 2PDYA 1KWGA 3W2JA 3GXNA 2FGZA 4L1WA 4IX0A 3ECQA 3CZKA 3VX0A 1L0PA 1UR9A 1YBQA 4UQ9A 1CPUA 4GZIA 2POTA 1XIGA 1YBQB 4MYXA 1XGEA 3TW7A 3NDOA 3VOCA 3WMLA 3NGJA 3LU2A 3SY5A 3RM4A 1WA3A 5M2FX 4Q32A 2G3FA 2J7FA 1HF6A 3G1YA 1UC5A 2OZ0A 1KCKA 4O1AA 2G95A 4D8AA 1YDYA 1E0UA 1P6CA 4J3ZA 2BV9A 3RILA 4MWAA 4DZ5A 3BAIA 4MWAB 4DUXA 2O56A 4REQA 4NX0A 4REQB 1XPGA 3I3EA 4D6CA 4GXMA 1QOPA 1VEPA 2CBIA 4I9TA 1OADA 1LLOA 1RK5A 1XI3A 3KS5A 4HN8A 2LLEA 4Z17A 4JTLA 5LIUX 3MSRA 3TYZA 3MYPA 5HNRA 3H24A 4B5UA 3AXMA 1A49A 1PBGA 1LT8A 3NPVA 2HWGA 5FIPA 3VD5A 5G5IA 3A4AA 2PWHA 2GQ8A 4HPNA 3UVAA 3OG3A 1NDYA 3WLPA 2IKIA 2R82A 1V5XA 1SZRA 2XIJA 2JKPA 3VCRA 2R6OA 1Z69A 3FYYA 3A64A 2R1KA 3A6OA 3FAXA 3LEPA 4ICNA 2A4AA 3TCSA 1H1ZA 1ECQA 3SBFA 3NQAA 4FAMA 2CHOA 2PLCA 2PURA 3SRKA 1IR2A 2ZRXA 1PYMA 3ZMRA 3RR1A 4H2CA 1B3YA 1VBUA 3QHOA 1EB3A 5JBDA 4C6NA 4WSHA 3FA5A 3IRSA 4IT1A 1XH0A 2WM0A 1LL4A 4I6KA 3EGJA 4HA1A 3I65A 1AMKA 3SSZA 4LV4A 4GO8A 2X0SA 1ZS2A 3LPFA 4KFPA 2Y0FA 3RGTA 3OLEA 1X97A 4OQVA 1W3KA 5PTDA 3MANA 3CGTA 3AIRA 5J8LA 2HNEA 1UMYA 2CHRA 3LM3A 2XFYA 1GHSA 2YBVA 2AL1A 5LIKX 3TMLA 4QGCA 4HZMA 4PUDA 2QNEA 3KXQA 3LLXA 3DFPA 2VRJA 4JKLA 3T44A 1GG0A 5TBOA 4BI7A 2O0TA 5HANA 2ZDSA 3H2MA 4M29A 4C7DA 1NJJA 2DSKA 2IPFA 4C6DA 3ZSTA 4DZAA 1C3FA 3GVWA 3KTCA 3KOFA 3PBUA 5C2GA 2DVTA 3HQPA 4HSNA 1M3UA 2E28A 1HJVA 4XAGA 3WELA 2V63A 4HK7A 1EO5A 3W00A 4JS3A 3P5ZA 1C8QA 5JIPA 3ORWA 3NUKA 1VPYA 3PZGA 5HNNA 1L2UA 4GYKA 1BEUA 1QW7A 4AWEA 1R9XA 3GZ3A 1I45A 4PMDA 3PUEA 5I07A 3SFKA 3HGJA 3UG8A 1TRDA 1JAKA 1ZPTA 3AWNA 4AMAA 2INZA 1OD0A 3N6JA 2HBXA 1US2A 4GJIA 3LCGA 3M41A 3ARWA 4NJIA 3JS3A 2GQAA 2O9RA 2FPYA 1FWTA 4GLEA 1WBJA 1UOKA 3BMXA 1RPKA 4LYKA 3LS9A 4W8AA 3SQMA 2D3LA 3PPFA 1SJDA 1W17A 1A5OC 4NF7A 4H9XA 1UMLA 1W3HA 3SCSA 5D9NA 3SUUA 3MVIA 3BVJA 4CU7A 5F4XA 1ONWA 2CERA 4XZ9A 1M04A 3KRUA 2EPMX 2PSNA 3TJ4A 4XIAA 2Y8VA 2XVNA 1S1PA 3SAZA 3WN6A 1I2NA 3IPWA 3TJIA 1Y7VA 1DP0A 4WXZA 3BK0A 3W7QA 2CLIA 3G1SA 3SURA 1R85A 4AWUA 1KBKA 3A5VA 2E8YA 3QR1A 1TV2A 1MMFA 3T0TA 4JYFA 1K03A 3W7HA 3K4DA 1ZU8A 1M5WA 1XICA 3POHA 1BAGA 2Z1WA 1T41A 1IWBA 3F03K 1V0NA 4WKHA 4W89A 3W7OA 4QG6A 1OFEA 3O07A 3WIJA 1CLKA 3HGSA 4IPNB 5HBFA 2OX1A 5AECA 1JZ2A 4JNZA 4IP7A 4W87A 3BJFA 4G7EA 3P67A 4IIEA 1UR2A 2XWDA 4G7EB 4Z1YA 2VQTA 4W7UA 3WENA 1QNQA 4CU8A 1XYAA 4E8DA 1TRIA 4JIEA 2A6LA 3CIVA 4NI8A 3CASA 1BPLB 4A3HA 1ZALA 4KRUA 3B0VC 3CZGA 4L56A 1MFUA 4PMRA 3VYLA 1VPQA 1LTDA 1F07A 2YGYA 5HATA 1KCLA 3M5VA 4S2BA 1KM4A 5LIWX 1EP2A 4W5ZA 3T0BA 2QAFA 5ENLA 5D2WA 3S1WA 1TJ0A 3W1MA 1QNPA 1V03A 3N4EA 2FPVA 2SFPA 1WZLA 1TIWA 1TA3A 1KCXA 3MMDA 1TA3B 1D2KA 1ITQA 2GGIA 2NLIA 1JUKA 4HOXA 1ML1A 3JR2A 2TRSA 3HQNA 2V2DA 3S1XA 3CYJA 4FF5A 3RU8X 4U10A 1AQHA 2WQDA 3UZZA 3GAKA 5EA9A 4FIRA 3TEVA 5CSRA 5H2ZA 3DBPA 3QYQA 3WH5A 3GC4A 4N9CA 3EA1A 3P6LA 3L23A 4UTIA 3JW7A 2VRQA 4KKXA 2OT1A 4PC8A 4P7NA 4GFSA 3B04A 1KRMA 1ITCA 1MEHA 2FJUB 5A6BD 3QOKA 3C3UA 4MB5A 9XIAA 1NAL1 3DYOA 3KCOA 3CHVA 4PEKA 3OZYA 3W01A 2Y7DA 2V3GA 2JK2A 1OC5A 4CGTA 3B0YA 1TR9A 3QTPA 2PP1A 3S2JA 4Q8MA 4CEUC 4GNVA 1F6YA 1QXLA 2DZUA 2Q8LA 3PS7A 2VZOA 3MO4A 4R88A 2GWNA 3A12A 1OGGA 4CVWA 1UR4A 4Y96A 4UTMA 5JUVA 4UR7A 1P0EA 3L65A 2CBJA 1W5NA 4PMUA 4RDVA 4GQ0A 3W7CA 2WM1A 1HVQA 4IISA 4C5YA 1Q8AA 1KBJA 4HK6A 3GK0A 2J9YA 1ME8A 1BXCA 5LIXX 3H2FA 4HPXA 4UC5A 2GVYA 3V1PA 3SR7A 2ZBTA 3MJYA 2OCZA 4NAFA 3GNRA 1KTBA 2IXVA 1UJPA 1TE1A 4NAFB 3GXPA 4DPQA 2PDQA 2GZXA 2EF9A 4UB9A 4XX6A 1DHPA 5HOSA 3AOFA 2WZTA 3VOHA 1R3QA 1XHGA 1EL3A 4RUBA 2OYLA 2ZTKA 3VINA 1UZ4A 4E3TA 3WDJA 1F8IA 4GE8A 3K46A 4RZBA 3OOQA 1EBHA 3U7BA 3U2OA 1S38A 1FHUA 5HNUA 2NVAA 4IPPA 4DM2A 4I6VA 1EJWC 1PCWA 3ALGA 1ODUA 2E67A 4HU0A 3RMEA 1HW6A 2CETA 4XTIA 5BRBA 1KC7A 2A7PA 1H49A 1XC6A 2RDUA 3RLUA 1XR2A 4CNUA 4E5TA 1ZSXA 1OGSA 1H3GA 4RV3A 5LYRA 1EA9C 1W1YA 3SCTA 2Q09A 4FNTA 4GCAA 4GH1A 2GGHA 1XLEA 1OCJA 1H7XA 1ZGDA 5FD0A 3P14A 1E4MM 1PKNA 3HG5A 4OWGA 3CUHA 2DT3A 3FFSA 1GOWA 1X7FA 1D7KA 1R2SA 1Q85A 4KESA 5A8GA 1RLCL 3HU7A 3SY8A 5C9WA 2VO5A 4JL2A 3W7JA 1B31A 1C93A 2FMNA 1JZ4A 4LYQA 4LRTA 1XH2A 3WEMA 1UB3A 1WBHA 1HUVA 4DYEA 2EPKX 3N25A 1HKKA 1LP6A 4CD6A 2QCEA 3MUXA 4B5TA 4UQEA 3VGHA 1ZCOA 5I78A 3ZT5A 1GOKA 3EMZA 3TTYA 4JTSA 3WF0A 2C14A 3V16A 1QT1A 3OBAA 2VZUA 4Z0JA 1TPUA 1T96A 5DELA 4D6JA 1JNEA 3EDJA 3J7HA 1A53A 3OYXA 3VNYA 4IG2A 3GNNA 3TXVA 2CKRA 4IG2B 1QOXA 1POKA 4XKMA 5C7HA 2HXTA 4H41A 3L4VA 3GU1A 1JDEA 2XZ7A 1PYFA 1EGMA 2VYOA 3WUFA 2WNNA 3OZOA 2XU2A 5G2HA 3EAUA 4H9MA 4JIHA 5CQ1A 4DJDD 5BXPA 1H41A 3PC0A 5D2XA 2E09A 1UIPA 3A13A 5BW6A 2DZPA 1U5JA 5D2YA 1J6OA 4DF2A 3LA4A 1XH1A 4UMBA 1ZCCA 4F0KA 5C9XA 3UERA 3NPUA 1KV5A 4WSKA 2C6QA 3QW4B 4F0LA 2X0YA 3D3AA 5A6JA 1ALDA 1OINA 1OFDA 2PF0A 4J1OA 4IWWA 1FQ0A 3L12A 4IJRA 4GVIA 2FVMA 3MUAA 1YXDA 2D2HA 4U33A 2VCCA 4PL1A 2ZUSA 3KRSA 3GG8A 1CB7B 2GGGA 3APTA 4XZLX 1R3VA 1EWEA 4AC1X 3MCMA 1O95A 4A21A 2WZHA 4M1BA 3B3DA 3GIYA 3EX3A 2HVMA 3V5OA 4JX5A 4PB5A 1ZUAX 1LLWA 4UIOA 1JULA 3GLCA 5DO8A 1J0KA 1H0GA 3Q65A 3VO0A 2PDWA 2F2KA 3BTNA 2G41A 4Q33A 3LPGA 2EPLX 3B8SA 3GVVA 3UT0A 1YADA 1XIEA 4BF9A 2Z28A 1Q3NA 4AZIA 3N2TA 3CUIA 3EKZA 4WOQA 4GMEA 5CC6A 5DEZA 1LG2A 1JDDA 3UZJA 4DJED 4D6DA 4E2VA 2ISSA 1N82A 3VIIA 5XIMA 2QJNA 3C2OA 3I7SA 4FOUA 4NYUA 5AYYA 3KDNA 3APYA 1PX8A 3VIGA 3DFYA 4NZJA 5KTLA 5HULA 3SCUA 3HV8A 1U33A 3FEMA 3UW6A 2NLYA 5U4NA 3QV7A 3VVGA 1R0MA 4DBWA 2G4FA 3QHMA 1NF7A 4ACYA 3MUZ1 1XLLA 4QJ5B 1XINA 3TYBA 1LF1A 5JQ9A 2BVDA 3G8RA 1M9HA 4QE1A 3M0VA 3TQ0A 3WK3A 1HJUA 1SZGA 4IMFA 5B7ZA 3JZUA 1JZ7A 4MSSA 4MFEA 1A80A 4IQDA 4F0HA 1TR1A 2BTMA 3N15A 2WMHA 3PZNA 1OX4A 3K5XA 4HHLA 4S1FA 3GBDA 4Z1CA 1OX4B 4RXGA 4XD5A 1RCOB 4GIYA 2B7NA 4X2RA 4RR4A 3VC6A 1KGXA 2HROA 3VKBA 4S3FA 4DXKA 1DWAM 3R0KA 2ZFAA 3KVKA 4MUZA 3SI9A 4O4WA 2Z1XA 3W4RA 2PDLA 3T0CA 4AWTA 1MUCA 2PLJA 2UV8G 3S1GA 2Q8ZA 4H4IA 4ML4A 4Z1DA 3E12A 4GZEA 2BVYA 3M0YA 2Q3RA 3RG6A 3M46A 2PTXA 3NOYA 1FWFC 3VIKA 2BOFX 1NVMA 4HNOA 3F5JA 3N2BA 4MWAD 3QZEA 1XLMA 1XV8A 1S5NA 2VT0A 1W5QA 1MDLA 1KM5A 1TVNA 1E0VA 4AY7A 3BXWA 1KQYA 3IK4A 4E3VA 1G67A 4K39A 3RN6A 3P84A 1E6PA 2REQA 1MQPA 1F3TA 5EFFA 3T05A 1DJQA 2REQB 4JYDA 5FJUA 5CSUA 2OTDA 3GS6A 3TYCA 4BQ2A 5FOOA 1B1YA 4IFKA 3RLGA 1RUSA 4IFKB 4C90A 3B03A 4H00A 1X6NA 3Q58A 3CHEA 4AAJA 2XYLA 2NQ9A 5E1QA 1E6QM 2J8TA 5I3HA 1R5YA 5EMJA 1BWKA 2EPNA 3NO5A 1FY6A 1S2AA 1FHDA 2WVVA 4WZHA 1RV8A 3LLDA 3ZLHA 3EB4A 2WVVB 4UZUA 1RCXB 4DO5A 3B9AA 3SUTA 4GI9A 4O14A 3VGBA 3M6YA 5HMDA 2PP3A 2VEIA 1ZJBA 4IPIA 1KM1A 4PTMA 1SSGA 4KF1A 2OX4A 5I0DA 2YCIX 4MAZA 2PTZA 2E5CA 4XZNX 1CBGA 4Z1BA 1VAHA 1IT0A 3S83A 1CGTA 4JD4A 3DC0A 4KWOA 1XBYA 3FOKA 5DMMA 2GL5A 3EMCA 2EG6A 4ES4A 2WCAA 2VCAA 3O06A 4FR1A 4EF8A 3W83A 2ODOA 4GH3A 1IZCA 5T8GA 2J8FA 1R3YA 4C65A 2YXXA 1GOMA 3K8MA 4O1DA 2BZNA 4N2YA 3SUVA 1D8CA 1Y5WA 8XIMA 4RPPA 2B4GA 3W7GA 2Q8XA 3LYEA 2GDQA 2ZRVA 2DUXA 1RBLA 2DJXA 2YL5A 3GH4A 5AZ1A 2A3EA 3UWZA 4S3KA 4AEOA 1XDJA 1WNOA 3DG3A 1W0MA 1BYBA 3TSDA 3CEUA 2V3FA 3AIQA 2VVNA 3RJXA 4S38A 2Y4SA 2J7BA 3C86A 3AQUA 4MIMA 3LXBA 3HG2A 1F2JA 2J74A 4AW7A 3TA6A 2VUNA 1A0DA 3MP4A 3TCEA 2BBFA 5D9OA 2IPJA 4GGHA 3VDHA 1JF5A 3W1LA 1EH9A 3LCHA 2INEA 5K7JA 3WL0A 3FEQA 3IV8A 3OLGA 4R3UA 3WJYA 3WL1A 2PDBA 2YXOA 2DSWA 4EXAA 4ZMGA 3GG0A 3QPZA 3CB8A 4MZYA 1JZ6A 3WMCA 2OQLA 2D20A 1H4PA 1KM6A 4PMQA 4UBPC 1AQ0A 3KBVA 3G8EA 1XCWA 4MNJA 5DBUA 1AFSA 2D73A 4TXEA 3C5QA 1GVIA 1R3SA 4FX7A 3GDKA 2FZBA 2BG5A 1W3JA 3LTYA 2BASA 4GACA 2PB1A 3UZ5A 2TMDA 4JHZA 1OFOA 3BLOA 2R8WA 4ECLA 4I5RA 1LORA 2D1ZA 3LMZA 2ACQA 2PDMA 1LOQA 3NZGA 2H8ZA 1V6UA 4F66A 1KBBA 1W54A 3S2MA 3T9PA 2XGBA 2X42A 1A50A 3TKFA 1EJXC 4J3XA 4NNBA 2NXGA 4M56A 4LB4A 2E9LA 5AY7A 1PJ9A 3QZAA 3N73A 4H9TA 5I00A 3NQEA 5BZAA 1XYCA 3FYPA 2DV0A 1TZZA 2CKSA 1QNOA 2ZUWA 1E15A 1TTPA 3LV6A 3KP0A 1JZ3A 3GXIA 1E4LA 4WF7A 3NZQA 2ZZ3A 4P8VA 2CIPA 5ABEA 3P8IA 4PSPA 1V6YA 4L6OA 4S3BA 1IZJA 1W3TA 1EGVA 5G2IA 2CLEA 4GK8A 1OWQA 3NTYA 4XBJA 2R1MA 3VMPA 2XH7A 4BWLC 1H50A 1UKQA 5SWUA 3ARVA 5KSWA 1G7VA 3LHVA 4LH8A 1ODZA 4L6DA 1TELA 1OY0A 1UD8A 4L6HA 1XRFA 2BSLA 1W1A1 5CPSA 4QE5A 4PEEA 3MO7A 4WOZA 3CV6A 5E9AA 2CU0A 1WPCA 1HL8A 3DFHA 2PBGA 3S9IA 3WEZA 5HJYA 3UJRA 4FXRA 2YA1A 1UR8A 4QSFA 3QJAA 1ITUA 3D46A 3MKVA 2WNQA 5FSEC 4KERA 1TUXA 4ZE5A 1CLXA 2X1IA 3T2PA 1IWPA 3UP8A 2O7SA 2G50A 3KRZA 1Z42A 1QFEA 3O0FA 2CNCA 2GJRA 1V3HA 2PFHA 4C6QA 2QF7A 1G5AA 2C79A 1A0EA 5K9DA 3S6OA 2QVNA 3U4AA 5BU6A 4AZ7A 3WNNA 5FJOA 1XBVA 4JTEA 3GH7A 1MO0A 4AISA 2GVEA 1AH4A 3N12A 1H63A 3T4CA 4DN1A 3DOPA 3KM8A 1XM3A 1T6MA 3VMNA 3VZYA 2P0OA 4KPLA 3QVQA 4E2DA 4ZO9A 1GW1A 2DH2A 1E6NA 5TIMA 2DSVA 4TV6A 1W37A 1M03A 3A21A 4XG1A 4CNPA 3GR7A 1TZ9A 4D72A 4JTCA 3CMJA 4OUIA 1QBBA 3THCA 1I1WA 4U5IA 1EXBA 3VNIA 3BAYA 4QDMA 1X7IA 3DH7A 5FAGA 3P3BA 1RSCA 3H23A 3ZJ8A 2W5FA 3OG2A 3CU2A 2DDXA 3N2OA 3C0SA 1ZJAA 4O50A 3OIHA 1G4SA 2NUXA 4I8YA 4W8LA 3L5LA 3VUSA 2X7VA 4JOMA 1A4MA 1TIMA 3H2NA 2JE8A 2DUZA 3MJMA 1O1HA 1GQNA 4ML9A 3CHCA 2X05A 3GNPA 5M1TA 1F76A 3YPIA 2V2CA 1E5NA 3ANVA 1CXLA 2W63A 3BE7A 3PZVA 4HPJA 1I2OA 2VOMA 1EC9A 3UQNA 2KX9A 2F61A 4M80A 5JBEA 4JTDA 3E0FA 1O68A 4EOUA 1LWJA 5I3JA 4R7OA 2ZZ1A 3MHFA 3LCFA 2C3ZA 3PFRA 1PDYA 3URQA 4WXYA 3SCWA 3CPGA 4NKCA 1HXJA 1JD9A 1QPQA 4DPPA 2DT2A 1M65A 4S3JA 4ZXOA 3QGAC 2YDRA 2HNHA 4RW3A 1OVDA 1W5MA 3AALA 1TWIA 2UY3A 4OKDA 1ZAJA 2GOUA 4B4FA 1A5MC 1ZBWA 3SUSA 1ESWA 3NSNA 3N6QA 4IOTA 1I0BA 3NFUA 1V3IA 4JFTA 3PPGA 1F6PA 2QYGA 4DHGA 1PIIA 4ZA0A 3O8AA 3CMFA 3IJIA 4IIFA 2WSKA 2NQ5A 1X98A 2PTYA 2DQWA 1RA5A 4Q6JA 3QFEA 4IIHA 4BY3A 3W23A 3C0QA 4Q8VA 3WY1A 2VDGA 3ZIZA 1XWYA 3U6WA 4DYJA 3M1ZA 3UD6A 2WANA 4DO6A 2Y8KA 1Q6QA 2QMJA 4HZ7A 2CHNA 3QKZA 2ACRA 3W28A 4Z2IA 3K2GA 4GYJA 1RCQA 3VPLA 4QCEA 3S5ZA 3BZJA 4XD4A 2AL2A 4H9ZA 2Z1SA 2AL2B 3EYPA 3WUEA 1I75A 3PB0A 4Q4RA 3W07A 3WNKA 4GVFA 1O6IA 1PVNA 5D9MA 3HQ1A 5D04C 3M0HA 4NXSA 4ADTA 2Z6JA 2ATSA 4B91A 4G6CA 2P10A 1B90A 3R8RA 3FSTA 4DELA 1KCZA 3N9KA 1AJ0A 1K1DA 3W25A 3LTPA 4R27A 3GHRA 1E9IA 2XIBA 4LBRA 1I9CB 1P6WA 4GNJA 1XSKA 2ZA3A 4OBTA 3F4NA 1ISZA 4J9JA 1A5LC 1XYMA 4FNQA 2GYIA 2PU0A 3EPMA 3DKJA 1F74A 1FFRA 4XZWA 1YKWA 4LAMA 4YCOA 5CG0A 2P76A 3MYOA 3ZQ9A 2ZE3A 1VBGA 4PTVA 3QY8A 7REQA 4HYVA 1UH4A 3WF1A 1DWJM 4Y90A 2XWEA 1IT7A 4LGXA 3S2LA 3H54A 3BOXA 3WH7A 4BWLA 2ZYFA 4LX4A 2A1YA 3H2EA 3R4IA 1VYPX 4KETA 1UZDA 4ZO8A 3W82A 1T5AA 3BGAA 2TYSA 4DAFA 3B9NA 4MDPA 4LY4A 4EWND 1QWKA 2QCCA 4KWSA 4WDUA 2A0NA 1TUFA 3EX1A 1CXHA 4H7ZA 1HVXA 2E7FA 1TV7A 3TN3A 4S3EA 4OV4A 3NZ1A 1PL9A 1H5VA 2W92A 1UKSA 2FDMA 3G18A 4S3DA 2ZQ0A 4O4VA 2IQTA 3RK8A 2VEKA 3ZR4A 1NFGA 1R3RA 1UYQA 1JVNA 4C6FA 4AQLA 4GG9A 3N2MA 2RKXA 3IWPA 3UG4A 1ADDA 4FEZA 4JL1A 3TQKA 4UFMA 1J6PA 1WX0A 3N17A 5FKYA 2Z7GA 5C54A 3NPXA 3UXDA 1FP8A 1F3WA 2DJLA 1EDGA 2RAGA 2RJHA 3LV5A 3QPYA 1JRBA 3L68A 1Z44A 4LU0A 1W31A 2DVUA 3VABA 1F4HA 4GWEA 5I02A 4FMVA 4DAIA 1IHIA 1VIZA 5IXEA 1JL8A 3WNMA 1GWJA 4AIEA 2WC4A 1ZBCA 1KW1A 2VC6A 3W1QA 3DEQA 3TSMA 4ZQNA 4LEQA 5GQBA 4W7VA 3SECA 3TE9A 1BWLA 3BMVA 1XQKA 7ODCA 4JICA 3TYAA 1G94A 2EO7A 1JG9A 3GTXA 1DJYA 4P7RA 3CZ8A 3VOJA 2H8XA 3GR8A 3W3OA 3MVTA 1TFVA 3KWXA 1OJXA 5CEWA 4DM1A 3M7WA 1HIZA 1OFQA 4Q4PA 1FXQA 4G2DA 3ARSA 1XD1A 3WH9A 2VWTA 3SJNA 1HO4A 2WKGA 4JIRA 3HGRA 1KM2A 3M0JA 3DG6A 4N02A 2Q71A 3NDZA 2VC7A 2BODX 3RFAA 4IUOA 1R3WA 4M82A 1GJWA 3IIZA 3TIMA 3MCNA 1ZAHA 5EB8A 1YEYA 4RPQA 1LJYA 5MF5A 1DJIA 3Q4DA 4Q3MA 3UU0A 3UNDA 4F40A 3BSMA 5L6UA 3W7PA 1S2WA 4QCFA 2H9AB 4WDXA 3QXBA 1DIKA 4CD4A 2PS2A 3R11A 3CIWA 1E73M 3AWOA 2WHMA 5D02A 4CKQA 4BF7A 1VFSA 4QXIA 1TMQA 1Z3NA 1LDCA 1EJRC 1ISVA 4Q8NA 1V6XA 2HS6A 4U5KA 2J4GA 4H8VA 4L80A 5BOEA 1Q7ZA 4W5UA 2GUBA 4ALDA 4EPEC 1LQ2A 2J66A 3M07A 3AISA 1UW9A 1YNQA 3UJEA 2YFOA 3VILA 3ITVA 3QFWA 4XAYA 3SFWA 3G3DA 3ES8A 2IXUA 1N7KA 2JKEA 5HPOA 2JIWA 2ZTJA 3UWUA 2OQYA 4MB4A 3W71A 3NDYA 2WVTA 1GTHA 1QPKA 4JEQA 5JH2A 1DQWA 2WK2A 4LWWA 3VOIA 1AW1A 5FF0A 1TCDA 3BLPX 3RCMA 2HS8A 2QPUA 3FW6A 4QNWA 1V79A 3DFTA 3UWVA 1GKPA 4CCCA 3GDTA 2DFAA 4U28A 4C7GA 3R0UA 8A3HA 3QEZA 1PIFA 1YMYA 3ABXA 5A8NA 2C1GA 2I56A 4ERIA 5JU6A 3WEOA 1P48A 2ASHA 3IGUA 2QLYA 4P8XA 4F2TA 2C91A 4W93A 1DJNA 1ZY9A 3CYVA 1EC7A 1DEDA 3SCPA 1JPMA 2V82A 4PFHA 2P5NA 4LVAA 4BI6A 5C2XA 5JIWA 3CUJA 4QAWA 5HWMA 3AIUA 5F4WA 3C8NA 2WOQA 1UKPA 1QNVA 4JKKA 1WDDA 3LERA 2BOEX 5DANA 1YNPA 3G1HA 1TPEA 5H8PA 1NDWA 4KQNA 1UWTA 3KHJA 1EXPA 1V3KA 2QJIA 1R7AA 4TUFA 3KL3A 5LZLA 5M03A 4Q8WA 1UZHA 3EWYA 1WUFA 4HSOA 4BI5A 1DWGM 3VNDA 4IZGA 1K7EA 2AQWA 3ZWSA 1UBPC 3RPTA 1IR1A 4H8NA 3R94A 4AZ6A 3NQDA 1NELA 2VEFA 4AB4A 1VD6A 4GGBA 3GRIA 1GYMA 2WHKA 3CO4A 1TZ7A 3W2UA 3SIMA 4O13A 4GISA 2QT3A 1LRQA 4RE4A 3WQCA 3BW4A 3HURA 1X38A 4YMZA 4IXXA 2VRKA 5C9RA 2ZXQA 4NRRA 1KBLA 3IARA 3DZ1A 1CYGA 3NG3A 3VDBA 5BXSA 5HWNA 3E0VA 3V18A 2WHLA 2VZSA 5D32A 4WJXA 4NZ5A 1T40A 3SCQA 1MSSA 1OCNA 4ORMA 2XVLA 2I7GA 3TFCA 4JBRA 1HJSA 2WPGA 1CXEA 4PYSA 3EXSA 4K8GA 1XPYA 1V0LA 2DZBA 2PMQA 1V08A 4OJYA 5DY3A 4B9ZA 3AMLA 3SCNA 3RUBL 4CD8A 3EWZA 3UCCA 4HPHA 1DIOA 3N3MA 4F9JA 4OUEA 5HUOA 2W0UA 1SU5A 3UJFA 1GW9A 1XL9A 1NWSA 2I57A 1R6WA 2WZMA 5D2VA 3C0LA 3HA1A 4LV9A 2WWDA 4N6EA 1CI1A 2FZ9A 2J27A 2F8QA 2B81A 1VFMA 4QJ1A 1MRQA 2BXYA 1HJXA 1I2QA 4JQ1A 2DT1A 3KOZA 2V3DA 1EX5A 2YR1A 3EMQA 5BMWA 1YPIA 3UF9A 1B2YA 4B9YA 1VCFA 1NWUA 2PWGA 4DWSC 3AXIA 4AX6A 3S5NA 3GNXA 4DO7A 1IT8A 4H01A 2V5JA 4U2YA 5CPMA 1ZFJA 3PZTA 3LB0A 5BROA 3H2AA 2A3CA 3EPNA 4A8NA 3CJPA 3G0UA 2QUTA 3UXIA 4H8HA 1BTCA 4DNMA 2B31A 2EBNA 2EAWA 2FLIA 3OVGA 4LFYA 3BANA 2ZX8A 4UTHA 2R1NA 1VQTA 1JCYA 1Q7QA 5I3IA 4M7TA 4JTTA 4AXNA 2BGNE 2Y5EA 1R46A 3L7RA 2IPGA 3K1GA 6ALDA 4AZBA 4GY7A 3E0WA 2YB1A 4JQ3A 1LUCB 3U2CA 2NV1A 1A3HA 1CIUA 4CN6A 1QVBA 4DUWA 1QRQA 1QI4A 4FB7A 2NW0A 2PUZA 4HHHA 4TVDA 4CEXC 3MU7A 3RMJA 1EHNA 4CQAA 4ORIA 3LX9A 5HMEA 1VP5A 2GDUA 5FJPA 4YTQA 3V75A 2TODA 2Z1BA 1I4NA 1Y5VA 1FWWA 3PHAA 3IJLA 4Z08A 5LHFA 3AJ7A 2DIJA 1UWAA 5DCDA 2QUVA 3EWBX 2W62A 1SZEA 2A79A 4QDWA 2CZDA 2YIHA 4MHBA 1SZFA 1D9EA 2VFFA 4NT0A 4U3AA 1TPVA 3TN6A 2HEJA 3BV7A 3NSXA 2H3BA 2JF6A 3WNLA 3CB3A 2EG8A 1CECA 1XYBA 5CH9A 2ISDA 4PBGA 4TQTA 3KL5A 1VFUA 3B8TA 4EPBC 3TU9A 1O4UA 1XG3A 2WMJA 4QQUA 5BMXA 1VLIA 2WMKA 1VKFA 2PDUA 2QW5A 1XCFA 1V3LA 4NU7A 4WSJA 1MW1A 2BHUA 1J0YA 4NL1A 2NVDA 3GTNA 3MMUA 2ONEA 1WZAA 3FY1A 5K9CA 1QNRA 3HZ3A 1QDSA 3SEPA 4HMDA 2PLMA 3VDGA 1H61A 3U57A 1K02A 3NEHA 4HNVA 1M01A 3GUGA 1EEPA 3QR3A 1DQUA 4FNPA 3N14A 2XIMA 4S3GA 2X1RA 4ZO6A 1FP9A 3IV3A 1E1CA 1BF2A 4HN4A 4OBSA 4TX6A 5D2TA 3WQ5A 2XN2A 1E1CB 2EGZA 2J7GA 4QS5A 1UUOA 1WP6A 2RJGA 1GQJA 1WDSA 3RR4A 5A8OA 4KCVA 1ZBKA 4XUGA 3W1XA 3N1AA 3S8HA 3B97A 1QK0A 4H04A 4PMNA 2QJGA 5EY5A 4IMCA 3MUCA 4ZTXA 3AZRA 2BNJA 2PZNA 4O17A 2Y5JA 2VX7A 1BWVA 3MKKA 4JFUA 1G0CA 2HE5A 3CQHA 1E6XM 2CLKA 3R10A 3FDGA 1QTWA 1U1UA 4KFOA 7PTDA 1OT1A 3EKLA 4TVCA 4D6GA 3CK5A 1EQCA 4ZGYA 3LPOA 4LC8A 1Q6DA 2E6YA 3EZ4A 4HMEA 9RUBA 2W91A 3WBAA 4TOQA 3WKZA 4H7VA 3VIJA 1ZBVA 1A0CA 4U31A 3BW3A 1ONXA 4UXDA 3VZZA 4H6EA 2QUNA 3L4ZA 4G5DA 4XTDA 3VUPA 1FFQA 1Q6GA 1RPXA 6XIAA 2YZRA 3OLDA 4PZVA 1S3HA 4O0ZA 5JMUA 1OC7A 4HT3A 1UROA 3XIMA 4LT9A 4GZJA 3V0SA 5C7VA 3SZ8A 3WD4A 4K8EA 2OO6A 1V77A 4JTQA 3AYSA 2P8CA 3WJZA 2ZWYA 2NX3A 3W73A 2XVGA 3TZNA 3VGGA 3W75A 3HV9A 1ZNNA 1BGAA 4GIAA 4DBDA 3NQFA 1JCMP 3O6DA 3QMRA 2AAMA 5CJNA 2AMGA 1PB0A 3C8FA 4Q8TA 4PMZA 2FGBA 1XRTA 3BG9A 3OJGA 3ZR5A 1XLBA 4M6QA 1R86A 2YL8A 4JX6A 2FTPA 2XISA 4CN4A 1U83A 3PN8A 5BRQA 2RGMA 1DWIM 3OPSA 4DRSA 1P4CA 3E3HA 5I2UA 2B7QA 3DI1A 3HG3A 1W5OA 2Y70A 3T42A 3WBWA 1Z8AA 1OD8A 3BAXA 4M24A 1FTXA 4GUJA 1ECEA 1TWSA 3E0IA 4PBEA 2GPTA 3ZWTA 3AXHA 4OOUA 1BSIA 1IXNA 1QWGA 1WKEA 4WKFA 2VGGA 4A29A 1M6JA 4J3UA 2EG7A 1BXNA 1SQ7A 2CLFA 1R2RA 1WAUA 3R13A 3AYTA 2NX1A 3VC5A 2J25A 1SVDA 2WCSA 3OBKA 1KRCC 2E68A 5ABTA 4MNMA 4JCMA 2RH9A 1YE6A 1CCWB 5DMNA 4A8IA 4OOZA 5T91A 4DWSA 3B0PA 1YTDA 3G5EA 3TC6A 5A95A 3LGEA 3DHDA 4DWSB 4UR8A 1UPMB 9XIMA 1RVKA 4LVFA 2FZNA 2PC4A 2VEMA 4AHOA 4LUSA 3I4EA 1OFPA 2X1TA 4QG9A 1XIIA 1NFBA 4LUSB 1PXGA 3OYZA 3WQ4A 1JPKA