2PB1A

Exo-b-(1,3)-glucanase from candida albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-b-d-glucopyranoside at 1.9 a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
394
structure length
394
Chain Sequence
b'AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XOG1
publication title Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A
rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 154
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pb1A00
5AY7A 4X0NA 4RL3A 3GH7A 1UKSA 5LA1A 2G8ZA 1CBGA 2F61A 2VCAA 4PUDA 4QLLA 3W24A 3ZO9A 2E9LA 2ZX9A 2ZUUA 3PZIA 4AZ6A 3E1F1 4HZ6A 4GO8A 5A95A 6TAAA 3ZQ9A 5E09A 4L4OA 1UH4A 4CKQA 4P7QA 4MDOA 3WUGA 3QHOA 4GZJA 2BVDA 2ZX7A 1R87A 4PCTA 5I6SA 3HN3A 2DSKA 4TXEA 5BXSA 3FXYA 3AOFA 1KWKA 3PTKA 3EYPA 1J01A 2PC8A 4ZE5A 2OSWA 4UNIA 5BXTA 1JFHA 1GPFA 2EQDA 1WZLA 1BFNA 1RH9A 3WDJA 1WDSA 1GOIA 1BF2A 1HJUA 5BYWA 3U5UA 2W61A 4KWUA 2J8FA 4N0RA 3GBDA 1PPIA 3VGDA 1EDGA 4P8WA 4PSPA 2Y4SA 3A4AA 3VM5A 3W37A 3L2LA 5AC4A 2A3CA 1EIBA 3SCWA 1CTNA 3A47A 1BGAA 3U7BA 3PZOA 4AIOA 6CGTA 2PWFA 1JDDA 4PMQA 4HU8A 1M04A 2GJXA 2J7HA 2W5FA 1VJSA 2XVPA 5I5RA 2GDVA 3UR8A 3ZJKA 4LPCA 5BXRA 1JZ4A 3VD9A 2EPOA 2Q8XA 4N42A 3B9DA 4Q22A 1RPKA 1J9YA 1J11A 1JNEA 3L4WA 3OZPA 3AMCA 1CXEA 4JCLA 3U7VA 2XTKA 3WD1A 2ZUTA 2VRJA 4XB3A 1HVXA 4B3KA 1M7XA 2EJ1A 4TX8A 1GOQA 5D9PA 5IHSA 3PN8A 2D23A 2D1ZA 4AIUA 1FH8A 2WMKA 7CGTA 3TTQA 2UWFA 1QI0A 3CZEA 1BLIA 4GZEA 1GW1A 1HKMA 4PMXA 1P6WA 4D6FA 3AMKA 4PRWA 1E0WA 1R86A 3RILA 1BYAA 1W2VA 1HN1A 4PYSA 3NSNA 4TX6A 1V3KA 4LGXA 1WB0A 4NF7A 3ARWA 3MV01 2VVSA 2G41A 2WZHA 2FDMA 3L2MA 1BVZA 2WMIB 1LL7A 5JBEA 4KMQA 3BSHA 2X2YA 4CD6A 1MYRA 1VEOA 1PX8A 3SIMA 1TMQA 1UWRA 1QBBA 1TCMA 3VGFA 3FY1A 4CN6A 4HOWA 3CLWA 2VOTA 3CTTA 4LYRA 3AS0A 4PTXA 4S3KA 4FMVA 4CD8A 5DF0A 4UFKA 3TP4A 1BGGA 1SMDA 4P8UA 1C3FA 3BAWA 1FP8A 1GHRA 3K4AA 1OT1A 2WMFA 3WMBA 5GNXA 4WF7A 2UY5A 1HJXA 3L4UA 3SCPA 4JCMA 3OGSA 4V28A 4U31A 4JAWA 1HL9A 4ATDA 3ARVA 2GK1B 2C7FA 1UQYA 3OLGA 1V3IA 1ECEA 1CXHA 3AIUA 1HKKA 5I23A 3CIVA 5CG0A 1JGIA 4JIEA 1NOWA 3MUY1 1KXTA 4XV0A 2ZXDA 1ODZA 4J27A 3GXDA 1IT0A 3EBVA 2DEPA 1OB0A 5E70A 1JAEA 2JIEA 4WIWA 1UH2A 1WCGA 2NT0A 3N17A 1ZBKA 1EH9A 4U3AA 4JHZA 3NJ3A 1AMYA 4A3YA 4QAWA 3VGBA 3MMDA 1V03A 3IJ7A 1VFUA 2XGBA 2YJQA 4AMCA 1WPCA 1JFXA 3IJ9A 2WHKA 1J0JA 1G5AA 3N04A 3OA5A 2JE8A 4ML4A 1B0IA 1JYWA 2YDQA 1CGYA 4UZUA 4AYSA 5C8BB 5FOOA 2J7EA 3POHA 1BYDA 3AIBA 1K9FA 1LLOA 4JFSA 4CU6A 4J3TA 1Q6CA 4AD4A 5JIWA 3RJXA 1QNPA 3VDHA 1CPUA 2WKLA 4M8UA 1E1EA 2EPLX 2J77A 1E6XM 1NM9A 2FHBA 1NOUA 2BY0A 2XVLA 1OT2A 1E6NA 4WKHA 1V6WA 4PEEA 1V02E 1XH0A 5A8OA 1HXJA 5A6LA 2CPUA 1OSEA 2GUYA 2J47A 3RM4A 3VMOA 2WMIA 3SCUA 1VFOA 4XUYA 1D3CA 3AISA 3U57A 2O9OA 2DIEA 4PTMA 5AYBA 1QHPA 1QNSA 1PIGA 2DSUA 4V27A 4GI9A 3WDHA 5ABFB 3ZJ7A 4ZXLA 1W9DM 2EO7A 1AQHA 4UQBA 4J3WA 1NP0A 1VEMA 1CGVA 2V3FA 3ARZA 2VT0A 1B3VA 4UQEA 2D3LA 2GSJA 3WF1A 5DMYA 3M6DA 3ALFA 1B31A 4FLOA 1UKOA 5EFFA 2J4GA 1R8LA 4WKFA 3SCOA 2VR5A 4W85A 1B3WA 2WB5A 3I3DA 4RE4A 2DSVA 1N82A 1CXKA 5A6AA 3DYOA 2EPMX 2TAAA 4AEFA 2WPGA 1AQ0A 2G3NA 3UCQA 3CUJA 1D7FA 3AICA 3EDFA 2VX6A 3AIWA 3EMZA 4QDMA 3A4WA 2X05A 2EPKX 3AROA 4EK7A 4BCEA 1MQPA 2VRQA 1UYQA 2B31A 3T08A 1W9PA 4XX6A 1E6PA 3IANA 1J0KA 2E40A 2JIWA 2E0PA 2D0FA 2VZUA 1VAHA 3VD7A 1W9VA 1NWRA 5JBFA 1UR0A 4AZBA 3KWXA 1J0IA 3RO8A 4CCCA 4W7VA 1W1PA 5KZ6A 4J3VA 1OIFA 1KXQA 2VZVA 4X0VA 2D24A 1XYFA 1X6NA 3AZRA 5A1AA 3QOMA 5EFDA 5DEZA 5M5DA 5EMYA 3GXIA 4AZCA 3NDYA 3NYDA 2WCSA 5CPSA 3TTSA 2J7FA 4UTFA 3BLPX 4D72A 1JD9A 2WBGA 1W3KA 3WELA 1L8NA 1V3JA 4AD2A 3WMCA 5FL1A 1AQMA 1MXGA 3ARRA 1C91A 2YIHA 5A6SA 1CNVA 1DHKA 4A4AA 4PBGA 3HMCA 1HF6A 1E3XA 4KGLA 4ZEPA 1KQZA 4Z2JA 4M1RA 4OZOA 3GM8A 2NT1A 1E0XA 3A4XA 1JDAA 1UWQA 3VPLA 2YL6A 4B15A 3FN9A 1V0KA 3SUWA 3IAPA 4BQ4A 2YL8A 3B9AA 4DUWA 2ZX8A 1WE5A 1UWTA 3MUZ1 3POCA 1OCQA 3PZTA 1QW8A 4H04A 4UR9A 3ZT7A 4BA0A 1DEDA 5TD4A 2XFRA 3VDCA 4LYPA 1KB3A 1MW3A 4BQ2A 2ZUNA 2CEQA 3VIFA 1E6RA 2Y5EA 4IISA 1Q6FA 4B9ZA 1OM0A 1X1NA 2QV4A 3NDZA 2AAAA 1ISYA 1EHNA 3T2OA 4CU7A 4D6HA 1BYCA 4E2OA 1WDQA 1E3ZA 2Y2WA 2VL4A 1ISXA 4F79A 2D0HA 4Q7NA 4AD1A 2OWCA 3NUKA 4U5KA 2DT1A 3BXWA 1ZS2A 2PI6A 5A2CA 4OKDA 1NWSA 1CXIA 2GJXB 2VI0A 4CGTA 2IXUA 2VURA 2E9MA 2PBOA 2AMGA 4S3JA 4J3XA 1FP9A 1E55A 1MQRA 1JZ8A 3CUGA 1J10A 2DDXA 5I79A 3IJ8A 1V0MA 3OBAA 1GZJA 2XWEA 3AMLA 2O9RA 3WEMA 1J18A 1GOKA 5A3HA 5FD0A 1Z32X 3ZJ8A 2FHFA 3UG5A 3AZTA 3L4XA 1UWIA 4ZFMA 1DWIM 1MQQA 1C92A 2W92A 4MNJA 4GZIA 1UKPA 5JUVA 4AISA 4QFUA 1KXHA 1I1XA 2J74A 2YA0A 2OWXA 3VD4A 3MKKA 1TVNA 5ABEA 3PZUA 3AMGA 3PZNA 3AXIA 3WD3A 4MJ2A 2E8YA 3CBWA 1V6UA 1X6LA 2CESA 2VO5A 1E1FA 4P7OA 4LXFA 3VNZA 4MB5A 1BSIA 3EDKA 2WZIA 1EGZA 1JZ7A 1UWUA 4IM4A 4UFLA 3ZSTA 4TVDA 5JIPA 4AZ5A 3D5HA 2D22A 3F5KA 4GQRA 4HA3A 1J12A 2X1IA 4H8HA 1HNYA 1HT6A 1H1NA 2VQTA 3VX0A 2WCAA 3F5LA 8CGTA 1JDCA 1W9BM 1JZ2A 1KWGA 1M01A 1E4LA 1OD8A 4MPKA 3MO4A 3WENA 4JL1A 2XSAA 4GIAA 1Q6DA 2CCRA 3AHTA 5CZKA 1E5NA 1GQJA 4XZWA 5IDIA 4NZCA 1GQLA 3O6AA 1DWJM 2WM0A 5GPRA 1JI2A 3W26A 3ARPA 4AIEA 3QHNA 4QLKA 2J7CA 3WNPA 2W4XA 3EDJA 2DT2A 2XIIA 3N1AA 5A2AA 1GNXA 4UFJA 2ZUWA 3S2CA 1PIFA 3UEQA 3VMNA 3AQUA 1WKYA 4EE9A 1IV8A 1U2YA 3WD2A 1QNQA 1EO5A 4P8XA 2IXVA 1EOMA 2CETA 1WZMA 3I3BA 1OIMA 4FLRA 1UH3A 2BXZA 3ZT6A 4FLQA 3QR3A 5FIPA 3WQ8A 1LL6A 5I78A 1ZBVA 3WQ5A 1GVIA 1DWGM 1UG6A 1H5VA 2A3HA 1KCKA 5HOSA 2NW0A 2OYMA 1OD0A 5FCZA 1J0YA 1Q6EA 1UOKA 3WNMA 2J7DA 2O9TA 4MDPA 1BPLB 4AEEA 4D71A 3D3AA 1ITCA 2E9BA 4NRSA 1XRVA 2ZOXA 3W27A 1BTCA 3UG4A 3CHEA 1W3LA 3WDIA 2V5CA 1Q6GA 4RE2A 2FH6A 3VGHA 2UY4A 1NOFA 4UOQA 3DC0A 3RMEA 2QPUA 2ZIDA 2F2HA 3WFZA 1JAKA 4IPLA 2XJ7A 1GJUA 4PMDA 2OSXA 3WH9A 4W8BA 3W6MA 4MB4A 1E73M 2OWWA 3BSGA 3GXFA 1UD6A 5F7UA 1WDPA 5ECUA 4TTUA 2WMGA 2A3BA 2BY3A 3W28A 2J7BA 3VO0A 2CBJA 1W32A 3W38A 1GORA 1UZ1A 2CBVA 3VDAA 4X9YA 3WH5A 3WNLA 1DWHM 2ZE0A 4OBSA 2VNCA 3U5YA 2DSZA 1EOKA 3DHPA 8A3HA 4M29A 1WP6A 2BV9A 5M3WA 2QPSA 3WQ6A 5D8ZA 1QOXA 4GI8A 3GXMA 4MADA 4B16A 4AXNA 2VR4A 1VBRA 3CHDA 1C7TA 1UR8A 4JFTA 4TOQA 3K8KA 2D3NA 4W87A 2PB1A 2PWGA 2BVTA 5ABGA 1FA2A 3CHFA 5BCAA 4W8AA 4U2YA 3VU2A 4OJYA 3CZGA 4P7LA 4TUFA 1UWSA 4UFMA 7A3HA 2CBIA 3VM7A 1ZJBA 1R85A 3OGRA 2E3ZA 5CPQA 1K9TA 1HVQA 3MANA 5A2BA 3GDBA 1VB9A 2YA1A 2WBKA 3CPUA 3EDEA 3PZ9A 1MWOA 4WK9A 3TOPA 4HPHA 3BAIA 1E72M 4D6EA 3CGTA 4LYQA 1EHAA 1RP9A 5IXEA 3FHQA 3GH4A 4R5EA 1HJSA 1B3XA 3DECA 3WDQA 5E6YA 2XWDA 5D8WA 3VNYA 4UOZA 4DUXA 2GJPA 1JF6A 2CERA 5KEZA 1CLVA 2V3GA 4B9YA 3FAXA 3LPFA 3WUEA 2WSKA 4Y7EA 3VMPA 1V08A 4AY1A 2WANA 3W81A 1QI3A 1QHOA 2J75A 1H49A 1XC6A 4W7WA 1LL4A 4UQAA 5E0CA 3ARSA 4HZ7A 4JFUA 4AZCB 2XPKA 4CD4A 2ZICA 5JBDA 2VQUA 1UR1A 4MB1A 4UFHA 1C8XA 5HXMA 3VILA 1L0PA 3OB8A 2CYGA 1MXDA 4W89A 1SR0A 3OGVA 3W6LA 3WN6A 1WDRA 4D1IA 3T2QA 3AS2A 1HKJA 3MSDA 4DWSB 1HKIA 4D6CA 1ZU8A 3CZLA 1ZBWA 4HU0A 3PBGA 3VIGA 4J3SA 3AIEA 3MU7A 5CLTA 1F4AA 1V02A 4CUCA 1B1YA 1OINA 5C71A 4TVUA 3WSUA 1VEPA 2VRKA 4TTGA 1VIWA 1LF1A 1YHTA 3NSXA 3VIMA 1SMAA 5LA2A 5HDRA 1GQIA 3AYRA 2XVGA 7TAAA 1HX0A 1JXKA 2CBUA 5BWFA 3BLKA 4D1JA 2YLLA 3GNRA 1FHDA 4AWEA 1ZB5A 3WEZA 4YHEA 2ZX5A 4R27A 1V0NA 3S6TA 2YOCA 2AOSA 3PZQA 1JD7A 3HJEA 3KE0A 2ZWYA 2JF7A 3UETA 1VFFA 4EKJA 1XHGA 1JYNA 1V0LA 1JNDA 1EDTA 2ZXBA 1XD1A 3B8SA 4CD7A 4PMNA 3OG2A 3WQWA 4QLJA 3VOCA 1XV8A 2CKSA 4W84A 3AS1A 1JIBA 5DO8A 1HJWA 2WVVA 3ZM8A 1TG7A 1H4PA 4NRRA 1UD8A 2DPEA 4B3LA 4JHOA 1CIUA 1GJWA 1JF5A 3QHMA 4W8LA 1XCXA 4LX4A 3MS8A 3RIKA 1OGSA 4U2ZA 4PN2A 3UR7A 1VENA 3WUBA 1UKTA 4AD0A 1G1YA 3O2LA 2CITA 1KGXA 3CUIA 1JYXA 3ARXA 2DT3A 4HA1A 1E4MM 2WVTA 4HTYA 2WHMA 4AZ7A 2VVNA 1W9UA 5EB8A 2W62A 2WMJA 1M53A 2BHUA 3ALGA 1E71M 2VTFA 2CXGA 3SUSA 1C90A 1GCYA 4W86A 1W1TA 2WMHA 3LMYA 4H8VA 3CZKA 1C93A 2QMJA 2ZUMA 5E6ZA 3AIQA 4KRTA 2WZEA 5ABHA 1UA3A 2A3AA 5M17A 3GNPA 3VD5A 3W4RA 3PTQA 3ZSSA 4DWSA 3W29A 2W66A 3MMUA 5I3DA 4GO9A 3AMDA 3L4TA 1CGTA 3CHCA 4IUGA 4H41A 1LG1A 3EMCA 4CCEA 4DUVA 2OYLA 3VIJA 1W1YA 1E0VA 4PSRA 4MJ4A 3RM8A 3B9EA 2PF0A 1KGUA 4OIFA 2CKRA 4XZBA 2Z1KA 4V2XA 4E8CA 3WF3A 3FNDA 1W3JA 3SUTA 1TE1A 4F66A 1TVPA 4F8XA 3VVGA 3PZGA 1IZJA 1V6XA 2QMKA 1UQZA 2J79A 2Z1SA 2GFTA 2DH2A 1DWAM 1H09A 1A47A 3BAYA 3K4DA 4ZE4A 2FHCA 2E4TA 4P8VA 1JXJA 4FK9A 2JALA 3VDBA 1GONA 1VFMA 2WCGA 3AXHA 2J78A 1ISVA 3MSGA 4UQCA 3OLEA 4M81A 3SUVA 2WWDA 3BMVA 1UR2A 1XD0A 2QLYA 4UQDA 2XUCA 1CYGA 2V5DA 3ZR5A 4FLSA 1E15A 1CLXA 1MVYA 1E4IA 3TTYA 2VX5A 1UR9A 2DQXA 1VBUA 5LA0A 4ZENA 4FF5A 4BS0A 1QHZA 3N18A 2J62A 1HL8A 3BAXA 5D4YA 2OLHA 3PTMA 3N11A 2UY3A 2X0HA 4KRUA 4W88A 2OSYA 2F8QA 4YPJA 2ZUVA 1UZ4A 2VMFA 1QBAA 3AHZA 1BQCA 4D6GA 2ZXAA 3WF4A 1KGWA 1TUXA 4GINA 4DWSD 4Z2GA 3LPPA 4DWSC 3T0DA 4EAMA 3CZ8A 1TA3B 3WL0A 4NSBA 1C8QA 3L4YA 2BHZA 4ZXOA 4EANA 2ZX6A 1U30A 1MW0A 1XH2A 2BXYA 3L4ZA 1V3LA 5A6KA 3AI0A 1DTUA 3ARUA 4MTVA 1E9LA 1UD4A 3ZMRA 3WMSA 1W3HA 4U33A 1PZ2A 5C70A 4WLCA 5A6BA 4Z2IA 3CO4A 3PZMA 2XVKA 3FHAA 4PMUA 1E43A 2CHOA 1UUQA 2JFEX 1PAMA 4OOUA 3LPGA 1HIZA 2VX4A 2QF8A 2BNJA 3VGGA 3DHUA 4BQ3A 3W53A 3ZR6A 4HMCA 3SURA 2OYKA 1H3GA 1H2JA 3K8MA 1US3A 2Y24A 2XFYA 1U33A 2XM2A 4URIA 1KXVA 5CGMA 1PBGA 1QI5A 1H0GA 4Z2LA 3SCNA 4QCFA 3BAJA 4W5UA 5BROA 1NWUA 2V38A 4D6JA 5M03A 1ZBCA 4PMYA 2CIPA 2CHNA 3CUHA 1RD6A 4OOZA 4YHGA 4QCEA 1BVNP 1K6AA 2ESCA 3K1DA 2EPNA 2WNWA 2BHYA 3WQVA 2DH3A 4BQ5A 1XYZA 1UR4A 1OGGA 2YL5A 2EXOA 3AS3A 1JL8A 1BG9A 1E6SM 3II1A 4WSKA 1UD2A 1WNOA 5I77A 1GOWA 1US2A 1QNOA 4E4PA 2EBNA 4ACZA 4P7NA 3KL5A 3WL1A 2WVUA 3BGAA 5A69A 3MUAA 5A6JA 5CGTA 4JKMA 3WD0A 5CQ1A 3VTRA 4U3CA 3CZJA 2VZTA 1I1WA 4M80A 2PWDA 1Y7VA 4GQQA 2JEQA 4PMVA 3HU7A 4GI6A 4J28A 1EA9C 1GQKA 3WDRA 1TA3A 1VRXA 4MNLA 1ODUA 3SCSA 5A6BD 2Y8KA 3OZOA 4PMRA 2XYLA 2D0GA 4W7UA 4CVUA 4PTWA 4HOXA 3AIRA 3GZAA 4AZGA 3PHAA 3WBAA 3AYSA 4A3HA 1OBAA 2RGMA 3KL3A 4HPGA 3THCA 1SFSA 3WH7A 4CN4A 2FGLA 4DM1A 1KFWA 2VZSA 1GVYA 2C0HA 4P7RA 3VGEA 3UESA 1I75A 2XM1A 3GNOA 2FH8A 1R7AA 3N15A 2JF6A 1BAGA 3AXXA 2NSXA 2PWHA 1W91A 2O9PA 4JZ5A 2GDUA 3WFLA 1E5JA 1H0IA 4HMEA 4H8UA 5IHRA 2WHLA 5I0DA 1LG2A 3WY1A 3OLDA 1D2KA 3OIHA 1K9DA 3WF0A 1LQ0A 1CEOA 1H41A 2GVYA 1B3ZA 4AC1X 2WVSA 1W9XA 4GPNA 1G0CA 1E6ZA 3AHVA 3SCTA 2WW5A 3WKZA 2IUZA 2UY2A 2WSPA 2J8GA 2WLYA 2WYSA 5CPTA 3WDPP 1ISZA 5A8NA 1E6QM 2XG9A 5E0FA 5IFTA 3BC9A 2VJXA 1Q4NX 3J7HA 5EBAA 5HNNA 1NH6A 2CNCA 2ZWZA 5CLWA 3ZOAA 1J0HA 3O9NA 1IZKA 2EEXA 2HVMA 1CGWA 1NQ6A 1OWQA 2HISA 3SUUA 3AIVA 2WVVB 4CVWA 1EDQA 4JKLA 4U5IA 5A8PA 1TZ7A 4MNMA 3BMWA 2VX7A 1DWFM 4BF7A 1EXPA 1GOMA 4AD3A 1LWJA 3ARQA 3DYMA 1E70M 2BY1A 1UA7A 3NCOA 5CSUA 2WXDM 3I3EA 4JFWA 5IFPA 1B2YA 3ECQA 3AFBA 1G94A 4NI3A 3VX1A 4W5ZA 4TVCA 4AZIA 1A3HA 1G9HA 3KL0A 3N13A 2X0YA 4C7GA 1VF8A 3N9KA 1ESWA 1GHSA 3RJYA 3BCDA 5DT5A 2WK2A 2WC7A 1CXFA 1YQ2A 3W25A 1ISWA 4HMDA 1XCWA 3M07A 4KGJA 3DYPA 4CD5A 4HZ8A 4H2CA 3TA9A 2BS9A 3A3HA 2DGAA 3GYCA 3WF2A 3VKKA 3VUPA 4AW7A 2XSBA 5AC5A 3OLIA 3APGA 4KH2A 1FOBA 3MV11 1JZ6A 5A6MA 1ZL1A 4D6DA 3WD4A 3F5JA 3T0BA 3WIJA 1H11A 5CJ5A 2FGZA 1BYBA 1JYVA 1W1VA 3VIPA 2ZXQA 4PMZA 4F9JA 1KCLA 3T0AA 1BHGA 1WZAA 2BY2A 1CZ1A 5FKYA 2YDRA 3SCVA 2YLAA 1O6IA 1W2PA 2VC9A 1E40A 1V6YA 3PZVA 4UCFA 4YN5A 1PX3A 2DIJA 5A8QA 2G3IA 2MANA 3WUFA 5BXPA 1V3HA 2ZUSA 2YL9A 3FAWA 1CENA 3BCFA 5GNZA 2G3MA 2XVNA 3KEHA 3WNNA 2J25A 1WO2A 2G3JA 3WBEA 5DFAA 3WH6A 5D9MA 1O7AA 3ZT5A 2WWCA 5HPOA 3G6LA 1HJQA 1JZ5A 2XGIA 1QPKA 4WSJA 1LWHA 2V3EA 1C7SA 1TFVA 3M46A 4K68A 4IPNB 1ITXA 1KR0A 3SEPA 3FW6A 5CXPA 1WAWA 5CSYA 5HBFA 4HP5A 3CH9A 3NSMA 4UQ9A 1FFRA 1PEZA 2GK1A 1M03A 4HOZA 3VIKA 1G01A 1PZ3A 1HJVA 1UKQA 3QGVA 3WQ4A 4Z2HA 1CGUA 1MFUA 3WEOA 2WKGA 4H7VA 3EMQA 2X8RA 2YA2A 4AZHA 3NIYA 3GBEA 5D9NA 1HP5A 1NARA 3WNOA 5I24A 2YBTA 4C7FA 5GQBA 1B90A 3W82A 3SCRA 1CWYA 1MFVA 3VIIA 1DP0A 4F9DA 1NP2A 1R7OA 1QW9A 2W63A 3BAKA 5LYRA 5A8MA 4ATLA 5D9OA 3RDKA 1F4HA 1JG9A 1EQPA 3RM9A 3N12A 1V6VA 2G4FA 3ZIZA 4JL2A 4MAZA 5FL0A 1MW1A 1C8YA 2VCBA 3M7SA 3JUGA 4MNKA 2D2OA 2JEPA 2WLZA 2XIBA 9CGTA 2BFGA 1PX4A 1B3YA 1NWTA 2WHJA 4L4PA 3THDA 3UERA 5AYIA 3VIHA 5E9AA 1EQCA 6A3HA 1GOOA 4UZSA 4PTVA 1CXLA 2V3DA 4CU8A 1XH1A 5BRPA 4CN1A 1JZ3A 3AHXA 4RE3A 2W67A 3F4VA 3VIOA 1QI4A 2XHYA 3MUIA 1MW2A 3ZJ6A 3WNKA 2BVYA 4WKAA 5ABFA 1PJ9A 2VZOA 1KBBA 2VCCA 3IAQA 4M82A 3K46A 4GXPA 4AD5A 3GH5A 3TONA 3CMGA 4Z2KA 1JI1A 1SYTA 3ARYA 1EO7A 1XSJA 4LQ1A 4E8DA 4HA4A 3K8LA 3TTOA 1KBKA 2PWEA 3AJ7A 1HP4A 3KZSA 1KQYA 4BZYA 4MB3A 2YKKA 2J7GA 2YBUA 4GKLA 1KR1A 1J0ZA 4PMOA 4C7DA 1V3MA 3VD3A 1CGXA 3VINA 3RPMA 4M24A 4ATWA 3SCQA 2WC4A 3UG3A 1CECA 5HPCA 2C8NA 1K9EA 3L4VA 1LJYA 2X09A 1FH9A 3GTNA 2A3EA 4MAVA 3AZSA 4DM2A 1FHLA 4PCSA 1UHVA 4J7RA 5A94A 4JFVA 3IK2A 2W91A 2QHAA 3CUFA 4ACZB 1AVAA 1QNRA 1B9ZA 4ACYA 1QVBA 1XSKA 2PBGA 3A6OA 4D6IA 3WH8A 3BH4A 5I2UA 3AHYA 4QP0A 2O92A 1UD5A 1E56A 2DT0A 4JKKA 4W93A 1BG4A 4OBRA 4OUEA 3ARTA 1XGZA 1OGBA 5BRQA 1RP8A 2YDSA 4PUEA 1GUVA 1ZJAA 3T2PA 3G6MA 1XSIA 4J3UA 1E4NA 2WC3A 2E8ZA 3CMJA 1FFQA 2XFFA 1S46A 4UFIA 2VUYA 2GJRA 3MMWA 5GNYA 1QI2A 3RCNA 2DSWA 3T09A 1WZKA 1FH7A 4UOJA 1CDGA 2Y8VA 3EDDA 5DT7A 3W0KA 1UD3A 2RGLA 1VJZA 1TR1A 3LPOA 4M56A 4WJXA 4CCDA 2D20A 3QOKA 1B30A 2WAGA
chains in the Genus database with same CATH superfamily
1FHVA 3PTDA 1UKSA 5LA1A 4Q33A 2VCAA 4QLLA 5DANA 3W24A 1LUCA 2ZUUA 3RG6A 3PZIA 3E1F1 3RHGA 4IJBA 1JPHA 3I7RA 2CLLA 1C8VA 2C71A 2HE5A 4Y6GA 4MDOA 1B57A 1R87A 4PCTA 3L23A 1TV8A 4HN4A 1WV2A 5F1UA 3S5OA 4PGLA 2I57A 4Q8UA 4LBRA 3STCA 1IYXA 1JFHA 1WZLA 1BFNA 3WDJA 1M9HA 1ZALA 3GG7A 1H7NA 2ZCGA 3L21A 5BYWA 2W61A 1A5UA 3LHYA 4N0RA 2Z7GA 3VGDA 3A4AA 2PDNA 4JDYA 3L2LA 1GJPA 2KX9A 4B92A 1T5AA 3VI2A 1EIBA 4GJ1A 1CTNA 1TV4A 3PZOA 2PWFA 3GKAA 1XJBA 2J7HA 2XVPA 2NV1A 2GDVA 5HATA 3O6CA 4HYWA 3USZA 4MKVA 2Q8XA 4N42A 3B9DA 3GK0A 4WSHA 1RPKA 1J9YA 3PSWA 1JNEA 3L4WA 3G1AA 1OFRA 4UTWC 1TVLA 3U7VA 1KBIA 1I2RA 4YL2A 4Z1BA 3E2QA 5LHFA 3NL5A 3UR5A 4YTSA 4B3KA 1M7XA 4UTKA 4IQLA 2D1ZA 1FH8A 4K38A 3TTQA 4RNIA 4JN8A 2E25A 4C6JA 2J13A 1GW1A 4PMXA 4TV5A 1OVDA 2XGZA 1E0WA 3R94A 1Y65A 1BYAA 4O12A 3W7DA 3ITXA 3S9ZA 2PWVA 4DZIA 1FWFC 1HN1A 3NSNA 2NUYA 4MWAC 4FNPA 1WB0A 3CO8A 4DLFA 2QGYA 3ARWA 3MV01 1TWIA 2FMNA 4NF7A 3BZJA 4LBSA 3OYZA 1BVZA 2WMIB 1A5KC 4EOUA 4PRTA 2FZBA 3BSHA 4I5UA 4ZTXA 4CD6A 1E0UA 3V5FA 2WZMA 1TMQA 3V1PA 1TCMA 3VGFA 3FY1A 4HOWA 3CTTA 3W2JA 4INFA 4S3KA 4FMVA 3E0WA 3ZYZA 1NDWA 3MUCA 3TP4A 4P8UA 3N2XA 4RK8A 1GHRA 5B7YA 3A5FA 3K4AA 2UY5A 3IGXA 3L4UA 3CYVA 1IEIA 4U31A 4ATDA 4Y9PA 3W02A 1UQYA 4O54A 1V3IA 3W7QA 1HUVA 1OX5A 1HKKA 5A5WA 1P1MA 1AH3A 1NOWA 5IRPA 5AFDA 4H3DA 4LBUA 1KXTA 1ODZA 1RK6A 4J27A 3C2YA 2IQTA 4AHQA 3RUBL 1D3HA 3EBVA 1OB0A 1KV5A 2JIEA 3SY8A 1WCGA 3N17A 4XZLX 1EH9A 4JHZA 3NJ3A 4IMCA 4LCSA 4PULA 3MMDA 2WNNA 4NZ1A 4RZBA 4FOKA 2OMAA 2W0UA 1H7OA 4DAFA 5FJRA 1LTDA 4X22A 1JYWA 1A50A 1Y8BA 1G6CA 1W5NA 1BYDA 3AIBA 2VELA 3ABOA 3DG3A 3CWHA 1Q6CA 4ML9A 4QXIA 4AD4A 4RDZA 1DJWA 1QK2A 2YYUA 1E1EA 1GVSA 2EPLX 2FHBA 3NTYA 1SJDA 2BY0A 2FKPA 3M0ZA 1V6WA 3FJ4A 1HXJA 4XZ9A 4XQ6A 4HVXA 1I2NA 4G56A 1R6WA 3U57A 2O9OA 3GU9A 2DIEA 1UB3A 2GLKA 3WX7A 4QE4A 3H4WA 1F74A 3R6IA 2VENA 4GI9A 2INFA 4O50A 3NO1A 3UY8A 3ZZ1A 3WLMA 1VEMA 4R85A 4DF1A 2V3FA 3ARZA 1B3VA 3B8IA 3IJ6A 2GSJA 3NWRA 4S3BA 3WF1A 1OFAA 4HCLA 1XISA 4A2SA 1NDYA 3W1TA 3ALFA 1B31A 4FLOA 2GVEA 3TCSA 1RBOB 3A3WA 3K13A 3SCOA 4W85A 1B3WA 4QISA 4R53A 4Y96A 2ONEA 5F4XA 1AW2A 1NFBA 4H9ZA 3SRDA 2A0NA 4GY1A 4HCDA 5DMMA 3H2FA 2EPMX 2XISA 2V9DA 4Z1CA 1DVJA 4KERA 4C6CA 2PDJA 3EDFA 4I5XA 1W8GA 1MNSA 1N55A 3EMZA 3EKLA 3TCEA 2EPKX 3IIZA 2DZAA 4C6EA 5I3JA 1K6WA 3GDTA 3NQAA 3KOYA 2JIWA 2VZUA 9XIMA 3VD7A 2PCEA 4I9JA 1NWRA 1B4KA 1IQ8A 4FOUA 4LEQA 1EPXA 1W1PA 4Z1YA 5HAOA 4J3VA 1OIFA 4ERGA 2D24A 3WCZA 2INEA 5A1AA 4MSSA 5BZAA 5EMYA 4AZCA 3MT1A 3IV8A 2PTDA 3BLPX 4LY8A 2V2DA 2G5WA 4Y8EA 4YTTA 4JTDA 4AD2A 3WMCA 2VXNA 1C91A 2X42A 1R2TA 3STPA 2YIHA 1LCOA 3LI0A 1YXCA 4PBGA 4IOTA 5G1MA 4E2VA 1YXYA 4M1RA 3B9NA 5MKGB 4OFCA 4OZOA 1J93A 3G2GA 3K2GA 1PB0A 4JX6A 3VPLA 1FUYA 1XINA 2YL6A 5EKYA 4B15A 3FN9A 2OB3A 1J5SA 4GISA 4HHLA 1TQJA 1WDWA 4DUOA 2ZX8A 3PBYA 1PCKA 4Y9AA 1PYMA 1UP0A 4Z08A 3PZTA 1ICPA 4DBSA 1LOQA 1GQNA 3I6RA 3CWOX 4C6LA 4DJDA 5KETA 4QSFA 3P5ZA 5TD4A 3LBCA 2XFRA 1MW3A 3KLLA 2QCCA 6XIAA 1O95A 2CEQA 2Y5EA 1KFKA 5H91A 4B9ZA 5K9CA 3IWPA 4YCOA 2RKXA 2W6RA 3HV9A 3T2OA 1QASA 5DCEA 1BYCA 3TW6A 3PS7A 2VL4A 3T8QA 2DT1A 3GIYA 5FJUA 2NWRA 2I14A 1A49A 1CXIA 3V16A 5F2IA 3CWNA 3TQVA 2VURA 1FWBC 2E9MA 2PBOA 2R24A 2OGJA 4F0HA 4J3XA 7TIMA 1E55A 1ZHAA 3S5SA 3W76A 1GZJA 3AMLA 8XIAA 2O9RA 3WEMA 1LRNA 2OOGA 3ZJ8A 3AZTA 3F4DA 3VNKA 1WUFA 3WQFA 3KS5A 2OR2A 1MQQA 1C92A 4Q4RA 2WO5A 3WMLA 3MKKA 3PZUA 2Q71A 3AMGA 3PZNA 2IQ0A 3WD3A 4DHGA 4F0MA 2CESA 3N25A 3C2EA 4MB5A 1O1HA 3L5LA 2ZBTA 3W1LA 5C7VA 1VFTA 4KWSA 2PDLA 3ES8A 4N7QA 1O12A 4UFLA 3ZSTA 1S3HA 1LLWA 4AZ5A 4GABA 3D5HA 4IMAA 1EKOA 2Z27A 5G4EA 3BJSA 4HA3A 1YIXA 4H8HA 5A6TC 3TFXA 4ADUA 2JQXA 1U5JA 2Z26A 3EWDA 5HANA 1SO5A 3IJLA 4K1GA 3WENA 3TSBA 2HPMA 4CEUC 5K9XA 4WXZA 4BY3A 1T8XA 2XSAA 2W27A 3BK0A 4YMZA 2C1IA 3AHTA 5CZKA 3SFWA 5IDIA 4NZCA 2Y0FA 4GUIA 2VUNA 2PFHA 4UNLA 4Q8OA 2R1LA 3ARPA 3ZWTA 3RR1A 1Z44A 3WLSA 3S2NA 5A2AA 3VMNA 1XUUA 3B40A 4EE9A 1RPXA 2P53A 1U2YA 2JGQA 5CH9A 2PODA 3SGZA 2P0IA 1EO5A 1TWDA 1L6SA 4S3GA 4UNKA 2IXVA 2Z2AA 2ZDRA 1TV3A 3IGUA 4FLRA 1WXYA 1EYWA 3IJIA 4Q7BA 3QR3A 6ALDA 4K39A 1LL6A 3W1UA 1ZBVA 1GVIA 3ITGA 1UG6A 5HOSA 2C3ZA 4ICMA 4GBUA 2ODOA 3WNMA 4CQDA 1AG1O 3EEZA 1T7LA 2O9TA 3W7CA 4D71A 4CNOA 5LXEA 2FZDA 1ITCA 1AQFA 2ZOXA 3W27A 4HT3A 4NI8A 3UG4A 1EGVA 3E3HA 3WDIA 1Q6GA 3VGHA 2UY4A 3LGDA 3M0KA 4QJ5B 3SY5A 3DC0A 3ZWSA 3RMEA 2QPUA 3GR8A 5D2WA 5HINA 1GJUA 4JTLA 1HO4A 1XWYA 3W6MA 4MB4A 4A3QA 4L1GA 3ELFA 1O94A 4TV6A 2OWWA 3GXFA 1LORA 1C9DA 1A3WA 3TN6A 1KM4A 4CNTA 5BW6A 4MZ1A 3W28A 5CG7A 2CBJA 3LGGA 1KKRA 1W32A 5AVHA 4V1XA 3VDAA 4IIHA 4HNVA 3WNLA 3W3OA 1DWHM 2VNCA 3P82A 4RPPA 1E1CB 2ALDA 1OYCA 2BV9A 3LQGA 3A5VA 1W3NA 5M3WA 3WQ6A 3A9BA 2PDWA 2V8ZA 2VR4A 1VBRA 1GGOA 1F5ZA 2INZA 3CHDA 4TOQA 1FA2A 3QZEA 2BTMA 3VU2A 3CZGA 1HZYA 4DJEA 3H2CA 3B8DA 2DZVA 1ZJBA 3I7QA 1RA0A 1R85A 3OGRA 2E3ZA 5CPQA 2UV8G 3O1NA 5BMWA 1HVQA 3GDBA 1BQGA 1OG6A 3QKZA 4K7YA 3E0LA 2VFFA 1ZLPA 3VE7A 4FA3A 1EHAA 3M0HA 3QRHA 5IXEA 4R5EA 4LB3A 1Q85A 1B3XA 2X0SA 4GBDA 2NSOA 3DECA 3WDQA 4O4VA 1RCQA 5CPOA 1TQXA 2DZXA 2F38A 1TIMA 1XGDA 3TU9A 3H8AA 4AEOA 1XIJA 4Z1DA 3VMPA 3JU2A 1QI3A 2GGHA 3O16A 3L9CA 2V6AA 2JBMA 3TJLA 3ARSA 4B4HA 3IEBA 4X2PA 4HZ7A 3LLXA 2CLOA 3N6JA 2E77A 3F7JA 4NX0A 4C6KA 1UR1A 1H5YA 1JPDX 5E9XA 1GG1A 4UFHA 4C60A 1TKKA 5HXMA 3B0UX 3QLDA 3T4WA 4DJFC 3PUGA 1GTHA 1CI1A 3W6LA 1WDRA 2J9YA 3UBPC 3T2QA 3VOGA 3MSDA 5HJXA 3BQ6A 3KBMA 4HQVA 1IT8A 1GPWA 2E5BA 2PRLA 5EPDA 3AIEA 5CLTA 2GOKA 3V4BA 3LRMA 3FFSA 1B1YA 3BW2A 1OINA 2Y88A 3T55A 1VEPA 5AHFA 1LF1A 5JMUA 3VIMA 4LTSA 1YPFA 3URBA 3IRSA 1QR7A 2HK0A 3WK2A 3GNRA 1FHDA 2QVHA 1DE6A 4JGDA 4R27A 4O1CA 2YOCA 1XM3A 3PZQA 4IP5A 1JCMP 2ZWYA 3UETA 2YCJA 2E5CA 1XHGA 3LXAA 1JNDA 2HJPA 4WZHA 2Z2BA 4AVOA 4PMNA 3OG2A 4QLJA 3G3MA 3C3UA 5DCDA 1XV8A 3U4FA 3W7OA 3CL8A 4GNJA 3ZM8A 1TG7A 5EMMA 1UD8A 4B3LA 2DJLA 3BQ5A 4AIBA 4IXXA 3QHMA 1EBGA 2HXUA 3MS8A 3WLPA 3LZ5A 2XU2A 1SJAA 1FWAC 3CUIA 3VNLA 1XFCA 1JYXA 1E4MM 2WVTA 4HTYA 3F2CA 2WHMA 4AZ7A 1X97A 2CWNA 5EB8A 2DORA 2W62A 4LF1A 4JNMA 1M53A 1Q6RA 4XAGA 1XUZA 3MB9A 1JPMA 2VTFA 1Z42A 1C90A 4V15A 4W86A 2HS6A 2WMHA 1XKJA 2OLAA 2X1TA 3CZKA 4JNZA 4N4QA 5I3HA 1XW8A 3ES7A 4MHBA 4GZ7A 3M16A 5ABHA 3H12A 1UA3A 2A3AA 2C79A 1VH7A 3W70A 3PTQA 4QROA 3ZSSA 1SU5A 1G7UA 3CHCA 4Q8MA 4GYPA 1LG1A 4REQA 2DZUA 1ZENA 5T9BG 3QFEA 3IS4A 3B9EA 5TAOA 1OX4A 1PIIA 3DI1A 4OIFA 3OTRA 1AL7A 3NO5A 2V2CA 3WF3A 2RH9A 1ZCCA 3FNDA 1TE1A 2NXHA 1EJUC 1Z69A 3L0GA 5AYZA 2C14A 1QOPA 3PZGA 3W00A 4RDYA 1U83A 1UQZA 3MP3A 3LNPA 3NQ7A 5TBOA 2ZRUA 1DWAM 1A47A 3UYCA 2J24A 2E4TA 4P8VA 3PG9A 3VDBA 3BOFA 1VFMA 2WCGA 4FR1A 4AF0B 1AJ2A 1ISVA 3MSGA 5FF4A 1QUMA 1U22A 4M81A 1O66A 1XD0A 4UQDA 3EA2A 1CYGA 2V5DA 4WRHA 4FLSA 4QSHA 2PP1A 2VX5A 4L4LA 1VBUA 3WBXA 3W7IA 2CLIA 2DP3A 1QHZA 2Y6ZA 3CEUA 2Y89A 2G0WA 4MLRA 1HL8A 3N11A 2X0HA 4KRUA 1PDYA 3FKRA 2F8QA 2ZA2A 1UZ4A 3URQA 4HKPA 3LRKA 4A8LA 3EB4A 4DXXA 2ANUA 3MTWA 2OZTA 1AD1A 2PGFA 3AHZA 2X1RA 2GQAA 3CAWA 2ZXAA 6REQB 3B8WA 2OVLA 1RCOB 4WCJA 4DWSC 3G1XA 3WL0A 4HNOA 3AU2A 1C8QA 1CX9A 4HHHA 3GRIA 1XLHA 4Z0SA 3QMSA 2ZX6A 2ZVRA 4S3CA 1MW0A 1XH2A 2BXYA 3VDGA 1V3LA 3Q65A 3V5OA 3ZMRA 4O57A 3GAKA 4L6DA 1VYPX 4WJ8A 2V67A 3CO4A 4CQCA 4FZIA 3UWEA 1X8CA 3PZMA 4DJDD 3VOIA 2CHOA 3P62A 1RZMA 3RRXA 4OOUA 4PODA 1A5MC 1HIZA 2QUNA 1JCNA 1QPNA 2QF8A 3VGGA 3DHUA 3W53A 4MWAE 3HPSA 4Q8TA 3QPYA 1WAUA 4B5TA 3Q45A 1HGYA 2XFYA 3T6CA 4B2DD 3V35A 2NQZA 4NXSA 1OYAA 4URIA 5D32A 1PBGA 4Z2LA 3W85A 3SCNA 3CNYA 3P60A 5BROA 1NWUA 1JDFA 2V38A 4Q32A 2JK2A 1H7XA 3NL2A 1GEHA 4QITA 4OOZA 4YHGA 1VBGA 3DC8A 2ALRA 1XIDA 1BVNP 1K6AA 1KW1A 4QEEA 2ESCA 2Z1WA 2EPNA 4FXFA 4H2HA 2BHYA 2VGBA 4BQ5A 1XYZA 2A7PA 1LLZA 1UR4A 5CPMA 3FJ6A 3JRKA 1JRCA 2EXOA 3AS3A 3QFWA 3EWZA 3II1A 4WSKA 3F03K 2XZ7A 4E4PA 3QGAC 5E1QA 4QEHA 3C56A 3WL1A 3MJYA 4IIDA 1F76A 1OFQA 5A6JA 4O4WA 3PJWA 3P0WA 3VTRA 4JEJA 1FWNA 2YR1A 4AQLA 3BG5A 3FA4A 4IP4A 4GQQA 4NAFB 4J28A 2Q02A 4C6QA 4DN1A 1TA3A 3OZOA 5BWAA 4PMRA 3UJ2A 4CVUA 1NELA 4LT9A 4HOXA 3AIRA 3F1QA 4AZGA 5LGXA 2HRWA 3WBAA 1UMLA 4XAPA 1OBAA 3ANVA 2BBFA 2FGLA 3RRAA 3C3NA 1GVYA 2C0HA 1H62A 1RALA 3R8RA 3TDFA 1UBPC 1WUEA 2NSXA 1S5WA 1W91A 2O9PA 4JZ5A 5AC8A 5TF0A 5IHRA 2WHLA 5I0DA 1LG2A 1SR9A 3EEGA 3NAVA 2QKFA 2XH4A 3OLDA 1D2KA 5AN7A 1L6YA 2HPIA 3STGA 3G1DA 3WF0A 1LQ0A 1B3ZA 1XBXA 2GPTA 4P61A 4NAEA 5LIWX 1W9XA 4GPNA 1E6ZA 2IKIA 4K8HA 2WSPA 2J8GA 2GWGA 5A8NA 2YCKX 3H4GA 4HJFA 3VXGA 4N4PA 1Q4NX 5G1TA 1N8FA 2IPWA 1NH6A 5CLWA 3ZOAA 1J0HA 1TJ1A 1IZKA 3GU2A 1LQAA 2X1UA 4H6RA 4ALDA 4MUPA 4PCPA 1DWFM 1EXPA 2JGYA 3ARQA 3O05A 3MVTA 3DYMA 3SQMA 1E70M 5CSUA 2WXDM 1HKVA 2Y61A 5CJNA 5IFPA 1B2YA 4GXMA 2A85A 1DBTA 3JVAA 4F0SA 5H2ZA 4LC8A 4TVCA 3EXRA 4AZIA 1UJQA 1VF8A 3RXZA 1ESWA 1GHSA 3KOZA 3RJYA 4EIVA 4J35A 1DOSA 5TIMA 3P61A 4HZ8A 4H2CA 2BS9A 3TUUA 3A3HA 4MJMA 3I6EA 3B04A 3WF2A 3AYTA 4P5UA 3QBUA 2OEKA 4J40A 2XSBA 5AC5A 5CBBA 3OLIA 4KH2A 3ABXA 3F2BA 4FIQA 5IM51 4YU1A 3WD4A 4BR1A 5CJ5A 2FGZA 1BYBA 1W1VA 3VIPA 5HWJA 5I03A 2E6FA 1WZAA 3E96A 2BY2A 1X6UA 1CZ1A 1TPUA 1EXBA 3GTXA 1R9YA 4MYXA 2X41A 1W2PA 4HHPA 4UB9A 1V6YA 5JH2A 3LI1A 3O6YX 2V2HA 4AY8A 3UU0A 3WUFA 4IX2A 2YL9A 1CENA 2TPSA 3BCFA 2XVNA 3O06A 3QMRA 4LUSA 3WNNA 3L7RA 1K70A 2J25A 2G3JA 1IXQA 3CM4A 4LB4A 2CLFA 3TA6A 3CUXA 1DJGA 5HPOA 3IIXA 3LTPA 3KRSA 2QDHA 4K68A 4ZMGA 1ITXA 5D2YA 3SEPA 5CXPA 3BJFA 2IPFA 5U4NA 5HQMA 3AXMA 3SAZA 2XH0A 5HBFA 1DJZA 3CH9A 1UR3M 3AJXA 1OFBA 3IVTA 4A21A 5BOEA 5DLCA 3VIKA 2Z6IA 3R10A 1KFLA 1HJVA 3QGVA 4JTAA 2DJXA 1QPRA 5MHBA 1MFUA 3UW6A 2WKGA 1X98A 3WLHA 2YA2A 2R8WA 3D47A 3L0KA 1NIUA 4S3EA 4X3ZA 1X39A 3DESA 2AL2A 4KWWA 3SJ3A 3KDOA 1NARA 3HG2A 1LT7A 4LH8A 4NY2A 4C7FA 3KLKA 3TC3A 3UZ5A 1EFZA 3AWOA 4GH1A 4WDWA 4S2BA 1R7OA 2W63A 4ECLA 3GSMA 3D6NA 4ATLA 1TPH1 1GK8A 3MWCA 3NYZA 2P1FA 7REQB 4EF9A 3EWXA 3HG5A 4LAKA 3GXTA 2ZRVA 5REQB 5FL0A 3TYDA 4BWLC 3NGFA 3I6TA 2C1GA 4WY0A 5DMLA 3M0XA 3MDWA 4DIAA 3GNNA 3FDGA 2PE4A 1NWTA 3W1XA 4YYCA 1DQWA 3PUEA 1FWCC 5AYIA 2OJPA 1M3UA 3MP5A 1CXLA 4N02A 3NPVA 1F6YA 4BF9A 3MZ2A 2W79A 3AHXA 3W7NA 1Q63A 1U1UA 4OU1A 1QTWA 4GOAA 4NQ1A 2NQLA 3ABRA 3THQA 3BJTA 3F4VA 4YNGA 1QI4A 2XHYA 4EWND 3LHWA 1NU5A 4XZNX 1PJ9A 2VZOA 2DQWA 1KBBA 3GHUA 3VKBA 2I56A 1XG3A 1F3TA 2QJJA 3TONA 2CZFA 1EO7A 4LQ1A 3TTEA 4HA4A 3K8LA 4K2SA 3TTOA 2PWEA 2NLIA 3KZSA 4FAMA 2YKKA 4GKLA 3KOFA 1J0ZA 5C5YA 2X7VA 3VD3A 1CGXA 2Z0IA 3VINA 2WC4A 3AUJA 2A5HA 1CECA 1MDLA 2H9AB 2X09A 4MAVA 4RZ5A 5J5DA 1PS9A 2A3LA 1U1JA 4PCSA 4ZQMA 3AAMA 2GSHA 4J7RA 5A94A 3JS3A 4JFVA 4F48A 3CU2A 3IRDA 1P0EA 4MFDA 1B9ZA 5AVNA 4ACYA 2PDFA 3CIWA 3GO2A 2PLJA 3SRKA 1SO6A 3DHDA 4Q4KA 3AHYA 3DAQA 3KFTA 3GVGA 4B5UA 4JKKA 2OGYA 1KFCA 5HNUA 4JIRA 2F6UA 1NF7A 2OCZA 3DFTA 1GUVA 4PA8A 3H21A 1PWLA 3G6MA 2E6YA 2WC3A 4UTTA 2E8ZA 5XIAA 3RCNA 2HWGA 3A64A 4RDWA 2HBXA 2OKTA 1XIBA 1FBAA 1T99A 4F2UA 2WJDA 5HR7A 1WX0A 1R3TA 5LNRA 4DZHA 4HBKA 5EMKA 2GZXA 1LRTA 4XIMA 1J6PA 1DIDA 1VJZA 1JPIA 4CCDA 1P43A 3HPZA 2Y63A 4C6NA 1E6RA 4IL2A 1K4GA 3VOJA 4WVXA 4CLMA 3KW3A 3DGBA 3L2IA 3GH7A 4MLJA 4RL3A 4J2PA 2DZWA 1Y0EA 2G8ZA 2NX3A 4AYGA 2OT0A 2OPJA 1CBGA 1XIFA 3ZO9A 4EPBC 3RX3A 4ZB0A 3GDKA 4LYKA 3W1QA 4HZ6A 4GO8A 1KLYA 1S2WA 4NNBA 3ZQ9A 1UH4A 1ZGDA 1DJHA 4CKQA 3VZYA 3SI9A 4MY8A 1BSLA 2ZX7A 1SJBA 3UJRA 5I6SA 2RJHA 2ICSA 2Q8LA 3P6LA 5BXSA 2HVOA 1FDZA 3FXYA 2YGYA 1KWKA 1XYLA 2CZEA 4UNIA 2Y8UA 1OFPA 4C6FA 3R1ZA 4WDTA 4IG2A 5CC6A 1XIMA 4OECA 2YDAA 2NUWA 2GOUA 3GBDA 4ZQPA 1EDGA 1PXGA 1WQ5A 3EPNA 3EOUA 5AC4A 3R13A 3SCWA 5CCZA 1F3EA 3PPGA 3A47A 3WO8A 3E5BA 4AIOA 1TPWA 1JDDA 4PMQA 4HU8A 5E93A 2W5FA 4D2JA 5I5RA 4G2DA 4LPCA 1XIEA 5BXRA 5K3VA 4QS5A 1KRCC 1J11A 4QNWA 5C9WA 3G1FA 1CXEA 4AU0A 3WD1A 1V5XA 4L1WA 4GH3A 2ZUTA 4XB3A 1KRAC 1HVXA 3W1RA 1JDEA 4TX8A 3HBLA 1VJIA 3PN8A 1XQLA 2OU4A 3USBA 2R1KA 1EJSC 2UWFA 2GQ3A 2VHLA 4NT0A 3WZ0E 4D8AA 3VFCA 2GSEA 4N9EA 5BRBA 4KFPA 3RILA 5DBTA 2QZRA 1RJPA 3O8AA 4PYSA 4MWAD 1S3TC 3N6QA 1XLIA 1V3KA 3OU8A 3IIOA 1SFLA 2MNRA 5T9CE 1ZY9A 1UWAA 2G41A 3ZVHB 3EPOA 1LL7A 1OFDA 5JBEA 2EKCA 2VFEA 1MYRA 1VEOA 2QPXA 1YDNA 1LOLA 1UWRA 1QBBA 2P3ZA 4CN6A 2VOTA 3CQKA 4M7SA 1KCXA 4BFAA 3AS0A 4HTBA 1BGGA 3GZ3A 5AHIA 4KEZA 3BAWA 3KVKA 1V77A 3N3MA 4WF7A 3SCPA 3OGSA 4Q3MA 1YNYA 3QYSA 1JPKA 2QGHA 7ODCA 2GK1B 3OLGA 3E6EA 3F4CA 3KTCA 3M4HA 1XYMA 4TIMA 4Q8WA 1CXHA 4PUNA 3AIUA 2HEJA 4IXHA 3LCGA 3G18A 1JGIA 3BWWA 1M6JA 3T0TA 4NKCA 5EU9A 1OF6A 3TLQA 5T91A 5AC6A 1XCFA 4V1YA 3E02A 3GXDA 3WLIA 1IT0A 3A22A 3DH7A 1L9WA 5E70A 1UH2A 3WQEA 3TC6A 3G0XA 3NEHA 2ACSA 4QAWA 1VFUA 3S6DA 1TPFA 1EUAA 3MVIA 1H61A 4H8NA 2V30A 2FVKA 3LV5A 1N8IA 1OY0A 3N04A 2ACQA 1AODA 1Q5MA 3SN4A 2YDQA 4UZUA 4AYSA 3POHA 3L0NA 3EWYA 4PEKA 4XAZA 2CHRA 1LM1A 5FAJA 3W7GA 3KRZA 1QNPA 1CPUA 1RBLA 2J77A 1E6XM 1NM9A 3OQ8A 2XVLA 3ORWA 4B5WA 3RCMA 1OT2A 1E6NA 1Z9AA 1UUOA 3RN6A 3HQOA 3MCNA 4PEEA 1V02E 5A8OA 5A6LA 3Q4DA 1OSEA 1ZTVA 2J47A 3FKKA 2WMIA 3CB3A 3S2JA 1D3CA 3AISA 3KBNA 4GCXA 5L6UA 5AYBA 3UPBA 1KFEA 2FFIA 1LRQA 1QHPA 4OV4A 3QC3A 1PIGA 1QAPA 1YNPA 2F2KA 5LHEA 2QT3A 1EUNA 2EO7A 3R4IA 3EB3A 4O52A 3APTA 1AQHA 3K1GA 1NP0A 1OCJA 5E5CA 4AB4A 2RDTA 1QCWA 4DBDA 1CLKA 3HGSA 3PC0A 3W7EA 1UKOA 1KM2A 1ZUAX 3HG4A 1DV7A 1K8XA 3NA8A 1AH0A 1BWKA 4GUJA 2DSVA 3H7RA 1CXKA 4QS6A 3IIPA 5E0KA 2WPGA 3TN4A 3PY2A 2P0OA 1ME7A 3UCQA 3CUJA 2G97A 1JULA 3E49A 1GTEA 3AIWA 3S1VA 1K4HA 2X05A 2Z4GA 3AROA 4EK7A 4BCEA 1MQPA 1BRLB 2XSXA 5FSEC 4CQ9A 3T08A 1W9PA 3AYVA 4AFYA 3IANA 4LS2A 1KV8A 2E0PA 1OG0A 1A0CA 1O5QA 4FO4A 2D0FA 3SFKA 2QJGA 1MMFA 4C1LA 1W9VA 4KKXA 1SJCA 2F84A 2OG9A 4PMJA 3WK3A 1QWGA 3RO8A 4CCCA 1J2WA 2DZPA 4J5NA 5J5RA 4X0VA 3BGGA 3MPGA 1X6NA 3OVGA 2VEKA 3AO0A 1SO4A 3GXIA 4KWVA 3NDYA 5CPSA 3REQB 2PDHA 3DFOA 3LD5A 3TTSA 1E0TA 2X1SA 3MJMA 2WBGA 3WELA 1OADA 1V3JA 3JW7A 3NGJA 4POCA 1BF6A 4L56A 4JTFA 3OYXA 4O13A 5A6SA 3F4NA 4A4AA 2ZDSA 1XDJA 3IVSA 1ZAJA 5G2HA 1F61A 1WXZA 3FEMA 3GM8A 1EX5A 1LUCB 2GVLA 2C18A 3R8HA 1V0KA 8TIMA 4WOZA 5K7JA 4ZO6A 3KRUA 3B9AA 1KFBA 1WE5A 3C0JA 3POCA 4NZ4A 3EX4A 1OCQA 3QM3A 4GG9A 3G22A 1QW8A 4H04A 3TVAA 1FCBA 5HJLA 1LOSA 5FJOA 3EAUA 4LYPA 3UGVA 2O4MA 1UROA 2HZGA 1BKSA 4IISA 1Q6FA 2ASHA 3DXIA 3MMTA 3FOKA 1OM0A 1B3OA 1X1NA 1RHCA 3SRHA 2BODX 3QV8A 1WA3A 1XYBA 3QEZA 4BEQA 3NDOA 1OFEA 1WDQA 1XP3A 1A4MA 4F79A 4Q7NA 2B81A 3BXWA 5FSDC 4OKDA 1NWSA 5I00A 2BGQA 2VI0A 3HJZA 2IXUA 4NVTA 1UMYA 3I10A 1WDDA 3VCNA 1JZ8A 3CUGA 4HK7A 3VABA 1V0MA 1VHNA 3QSTA 5C2XA 1ECQA 1MEIA 2FPVA 4EACA 5B80A 1J18A 1JCXA 4I5RA 1KFJA 1UWIA 2O7QA 4TX9A 1M41A 4ZFMA 4XTDA 4MNJA 4XWUA 5AECA 5JUVA 4ZQOA 2OWXA 4ROPA 4LALA 1REQA 4MJ2A 3CBWA 1V6UA 4IUOA 1DXEA 2PAJA 3H4XA 3JR2A 1OHLA 1POJA 3CB8A 2PEVA 5DMNA 4EX4A 2FLIA 2EG8A 1JUBA 3WYZA 4ZR8A 1ZP4A 2PGEA 5LSMA 4HIBA 1K03A 4GQRA 1YLVA 4QTGA 1J12A 3CC1A 3E12A 2PTZA 2PMQA 4DJDC 3VX0A 1BD0A 3NG3A 1SSDA 3F5LA 3BGJA 3GWQA 1JDCA 4D8ZA 1E9YB 3QYQA 2P88A 3TYZA 1JZ2A 1RLCL 3TYBA 1RBAA 4IFKA 3SJNA 3MYOA 4JL1A 1S2TA 3W7KA 3ABZA 3T81A 4GIAA 1FQ0A 5F4WA 1GYLA 4A29A 4CQ8A 2DVUA 2JKEA 1GQJA 1SPQA 1FWWA 3CAQA 3KBVA 3UXIA 1TWSA 3P2VA 1JI2A 1MI3A 3W26A 2FTPA 3P7YA 4XAFA 3EWBX 4MG4A 3A24A 5AOUA 3WNPA 4ICNA 4Q4SA 2DT2A 2PURA 1EF2A 4QE1A 1GNXA 1LROA 3S2CA 3FYOA 3IV3A 3CQJA 3WG6A 1QNQA 4FSAA 4DBEA 4P8XA 2CETA 1WZMA 4Q7IA 1H60A 2BXZA 1YYAA 4IJRA 4O16A 4AXKA 3WQ8A 5I78A 3WQ5A 3A12A 2W9MA 2A3HA 3TW7A 3TWAA 2NW0A 1YKWA 5D37A 1I60A 1UOKA 2Z1BA 2C91A 2J7DA 3LN3A 1BPLB 4MDPA 5ECVA 4CNPA 5HR6A 3COTA 2E9BA 3W7LA 2UBPC 1DPMA 1GKRA 3TYEA 3TZNA 2FH6A 3NQFA 1NOFA 1PL9A 3GVWA 3W7RA 4YS1A 3WFZA 1XPYA 3NXLA 5I07A 4PMDA 2OSXA 1RQBA 3WQDA 2GJNA 4BK9A 4UTHA 3BSGA 2C0AA 1UD6A 1ELSA 1WDPA 4TTUA 5LIUX 2A3BA 2YCLB 2OQHA 4WR3A 1PKNA 1UUMA 2FZ9A 1S5MA 3CLMA 4HCHA 2CBVA 2X2GA 3WH5A 3ZLFA 2ZE0A 4OBSA 2QW5A 2DSZA 1EOKA 3DHPA 8A3HA 3N2MA 3DFYA 4M29A 4G7EB 3QR0A 1S1RA 2MUCA 3NL3A 3NQ8A 2QPSA 1QOXA 4MADA 1I2QA 4B16A 4CCZA 2G37A 3UYIA 4JFTA 3CQIA 2BVTA 3CJPA 1FDJA 4N6EA 3N34A 2AKZA 1H50A 3G0SA 1X38A 3M0VA 4AHPA 1UWSA 3CV2A 3VZZA 2POZA 2CBIA 4ADTA 3LXCA 3O07A 1GYNA 2XZ9A 3LCXA 4NILA 1KLZA 3MANA 4PZVA 3QV7A 1VB9A 1EWDA 1GEQA 3RMJA 1MWOA 3VNDA 4HPHA 4WXYA 4AWSA 1KRBC 3AUOA 3OJGA 4LYQA 1RP9A 3GH4A 4ZL1A 1HJSA 3UJEA 2VP8A 4K1WA 1RVGA 4F0KA 4JTSA 4EPDC 4BF5A 2WSYA 4Q8QA 3E0IA 2V0TA 2ZZ4A 4DUXA 2GJPA 2CERA 1IHIA 1CLVA 4R9XA 3LPFA 4KBXA 3U2ZA 3TSMA 2DUAA 3IUDA 4AY1A 2WANA 2PZNA 1EIXA 5HUOA 2PP3A 2PLKA 1X1OA 4EP8C 1XC6A 2PDKA 3C86A 4W7WA 3GC4A 2ZRXA 1CB7B 4AZCB 2XPKA 2ZICA 1F7BA 4IIEA 3QPEA 3MDUA 3N9RA 4MB1A 3U3HA 1VCFA 1AUSL 3VILA 2CYGA 1MXDA 4S1FA 3OGVA 3TIMA 6ENLA 3B0XA 3NFUA 3WN6A 1YTDA 3ITCA 4D1IA 4HD5A 2Q09A 3URNA 2FJUB 1ZU8A 3H6OA 4MFEA 3CZLA 1ZBWA 3T05A 4B3ZA 2YCEA 4HU0A 3PBGA 4J3SA 3MHFA 3MU7A 3LTYA 2OQLA 1MDRA 4QG6A 4XKMA 1VIWA 1E1CA 1SMAA 5LA2A 4LC6A 3W9ZA 3QV9A 1EA0A 5BWFA 4D1JA 4AWEA 4AH7A 1FX6A 5LGZA 1V0NA 2A21A 3KE0A 3HJEA 2HSAA 4FI4A 1VFFA 2BOEX 1DJQA 4EKJA 3XIMA 1D7KA 1EDTA 4BI5A 1UOZA 3B8SA 4K7VA 3VOCA 2CKSA 5DO8A 1HJWA 2WVVA 2SFPA 3DFNA 4ILSA 4JHOA 1GJWA 2D2HA 4FNQA 4L64A 4PUUA 4XUGA 3GFYA 2A79A 3AALA 1EJRC 2OZ8A 1HGWA 1G4SA 3C0QA 4KCUA 3NQ2A 4PR4A 3GUGA 2VVNA 3NM1A 1W9UA 2I5GA 4O15A 4O8AA 2NXIA 3NEVA 2Z7KA 3BLOA 3B8UA 1KO0A 3W2UA 4WHBA 1ML1A 3ALGA 4OBTA 3B05A 3MCOA 2CXGA 3SUSA 1TSIA 5FEPA 3LCLA 3GHSA 2O55A 1FDYA 4S2CA 1C93A 3DGRA 4XG1A 4PH6A 4PCFA 5CPLA 1LDCA 2VEMA 4KQNA 3W29A 4ZQRA 3MMUA 5BU6A 5I3DA 2Y7DA 1CGTA 4GJIA 4XTIA 2H8ZA 1RJQA 4K8EA 4PSRA 3MUXA 4MJ4A 3RM8A 1XFBA 3M5YA 4F2BA 3B0PA 2CKRA 1S1PA 3GDMA 1V93A 2Z1KA 5F2LA 3U6WA 1Q2SA 1W3JA 4JIHA 3BG3A 2JKAA 1R2SA 1TVPA 4F8XA 3H24A 2QMKA 4RDVA 2GFTA 3MSYA 4GUHA 1TMLA 2DH2A 2R14A 3VNMA 4AY7A 1H09A 3BAYA 3I65A 3K4DA 4ZE4A 2FHCA 2BGNE 4GC4A 4KCTA 4GIEA 4FK9A 3OA3A 2J78A 4UQCA 3MYPA 4YIWA 1R9ZA 1MVYA 4GY0A 4O1EA 1Z41A 3ZR4A 2DQXA 4DO5A 4ROQA 1EWEA 3MHGA 2YXGA 4ZENA 2YCIX 7ENLA 1WOBA 3N6HA 4GYKA 5F1VA 4BS0A 1TPB1 4YWSA 2JKPA 2GGEA 4DQWA 2J62A 1Q6OA 2NVAA 3BAXA 3EX1A 2OLHA 3PTMA 3R12A 3GG8A 3R43A 4W88A 1GG0A 2OSYA 2FIQA 2ZUVA 1EJ7L 2VMFA 3WK0A 4F0LA 3HGOA 4M1BA 3LCHA 4IH3A 2QUMA 2V5KA 2E5DA 4GINA 4DWSD 5FESA 4QNEA 3D0CA 3RCYA 4HU4A 4EAMA 2YPIA 2VGIA 4GYPC 1VPXA 4ENLA 4GACA 1TUFA 4EANA 2CFFA 1R3WA 4US5D 1WKEA 3QPZA 3IARA 4QJ3B 1OK4A 3WMSA 4A8NA 4E2BA 3OW1A 4U33A 1R3RA 1PZ2A 4WLCA 3RLGA 4YCPA 3NZRA 3FHAA 4JQ4A 1UUQA 1WKFA 4EPEC 3LPGA 2VFIA 2BNJA 5EMLA 3ZR6A 4HMCA 5FJTA 3R79A 3E38A 3TJIA 1OQFA 2OELA 4LV4A 1YTEA 5GVJA 3ID7A 1OC7A 1EL3A 2QQ6A 1HG3A 1I0DA 4E38A 3GLCA 2QDGA 1KXVA 3EXSA 1QI5A 3BAJA 5F4SA 3HURA 1A53A 1F07A 5H1WA 4QM1A 4QCEA 1DIEA 4DYJA 4C5ZA 1ZJIA 1NVMA 4X60A 2AL1A 2QNEA 3ZS4A 4C6DA 3ITLA 3C0SA 3UGRA 1OGGA 4AX6A 1M5WA 2YL5A 3SGUA 1JL8A 1Q7MA 3RX2A 1WNOA 1OC5A 1QNOA 4ACZA 4P7NA 2OQYA 1KTBA 4LSBA 1LYXA 1Q65A 3W74A 5CGTA 4O1DA 3WD0A 3HPAA 5CQ1A 3A4JA 3WJYA 1XQKA 4IZGA 2BWGA 4JY9A 2BOFX 2PWDA 4RUBA 2PF8A 3OP2A 1YADA 3R0UA 1IF2A 1VKFA 4J2MA 4PMVA 2Y70A 3CAKA 4GI6A 5FF7A 5A6BD 1XBYA 4HPJA 4ZODA 4OQVA 4PE8A 2IPGA 3C2VA 1IE7C 4YVXA 3S46A 3THCA 4XVDA 4CN4A 1PE1A 3KRBA 3VGEA 4IGNA 3UESA 3KVJA 1XF0A 2FH8A 1H51A 2QIWA 4N2YA 3N15A 2JF6A 3G1SA 2E6DA 3AXXA 4YTUA 3W1MA 3G24A 2GDUA 1H0IA 1P0BA 1Q8JA 2EJAA 3WY1A 3OIHA 4FP1A 4FNUA 2RDXA 1K7EA 4NJJA 5SWUA 3SR7A 5LKYA 2FMOA 1G0CA 3GW0A 5JH1A 3AHVA 4LCQA 2WW5A 3WKZA 3M64A 5CPTA 1ISZA 1TX2A 2ZC1A 5IFTA 3BC9A 2NVDA 4UBPC 5HNNA 5DRIA 2CNCA 1XLLA 2ZWZA 2EEXA 1CGWA 1WOAA 2HISA 2WSRA 1P0KA 4XBJA 3QC0A 4CVWA 1EDQA 4JKLA 4U5IA 4MNMA 2QUVA 3PPHA 2FJKA 5D03A 3A13A 4AD3A 1A0DA 3SSJA 4AWTA 1AMKA 2BY1A 3N4AA 3MWAA 2BX7A 4JFWA 1AFSA 3AFBA 4UIOA 1A3HA 4ZOAA 3KL0A 3NZGA 4C7GA 3N9KA 2FPTA 1Q6QA 1XLMA 1DQUA 2HNEA 3W25A 4FX7A 4NAFA 3H70A 4KGJA 3T8LA 3NPWA 4LVAA 3L65A 3VUPA 4AW7A 4H19A 1S5NA 5JVLA 4JTUA 4JTRA 2HCVA 3RF9A 3B0YA 3TEVA 1QO2A 1XLAA 2ZXQA 4PMZA 1X7FA 3VFLA 2REQB 4WY0F 1BHGA 4B5XA 3CL7A 4ADSA 1TRIA 1O6IA 1E40A 2OZ0A 2Z00A 3P67A 4GX9A 1PDZA 3G8RA 3PBVA 2MANA 1MZHA 2QCEA 2ZUSA 4A35A 3FAWA 4MVAA 3O6DA 3TOYA 9XIAA 1WO2A 3WBEA 3GKFA 3H7VA 3WH6A 3KBJA 3GDRA 4Q6XA 4K3ZA 4DZ5A 1F8IA 2J9XA 2WWCA 4BJHA 5I3GA 3B0VC 2XGIA 1LWHA 4PL1A 1TFVA 4FNTA 4GHRA 3G8EA 3B06A 3PBMA 4HP5A 2O0TA 4NZFA 4UQ9A 1FFRA 3SZ8A 5D02A 1PEZA 4HOZA 4GGHA 3CEPA 3DG6A 3G3DA 4KW2A 1EEPA 4Z2HA 5C2CA 1CGUA 2Y7EA 1ONWA 3LTSA 2CLMA 3WEOA 1K7XA 4H7VA 4WEVX 2PDGA 3TROA 3QN3A 4RNHA 1JCLA 2ZZ7A 2PDYA 3NIYA 4O19A 2RJGA 1HP5A 5I24A 3HGJA 4PFMA 3OHIA 1IWAA 5GQBA 1ZAIA 3UWQA 1B90A 2QXWA 3W82A 3VIIA 4F9DA 3BARA 3GVVA 2Z25A 2X7WA 3BAKA 2Z6JA 3HMJG 1PKYA 3BTNA 5D9OA 3RDKA 5H8UA 1JG9A 1US0A 2VFGA 3N12A 3TV8A 8RUCA 1VHCA 3GS6A 3V5CA 1MW1A 2ZADA 1C8YA 2VCBA 4MY9A 5CC5A 2BFGA 1PX4A 1B3YA 4AVFA 1OF8A 3UERA 1IEQA 1EQCA 4PTVA 2V3DA 4XAYA 4M6PA 4JYFA 1H63A 2Q8ZA 2VC6A 3M6YA 4RE3A 2ZTKA 2Y7FA 3QZ6A 1TR9A 3MUIA 1W8SA 1MW2A 2PC4A 3ZJ6A 4O1FA 1TTQA 2BVYA 5FJPA 4WKAA 5ABFA 1AW1A 5EYWA 2VCCA 1PYFA 4XBSA 3GH5A 1IIHA 3GD6A 4JD4A 1XSJA 2B0MA 3UA3A 4MWAB 1KBKA 1KQYA 2Y62A 3PULA 5LNWA 3WJZA 2J7GA 3B8TA 1TPC1 4M6QA 2PZ0A 5I02A 3RPMA 4M24A 3UG3A 3FK4A 3WJWA 3F4WA 4G8TA 1EP3A 2C8NA 3TN5A 2V81A 3GTNA 2YX0A 3CT7A 3AZSA 4WJEA 2IKJA 5KITA 4QE5A 3KX6A 2XIOA 3NQGA 2QHAA 1AVAA 3E2SA 2R82A 1QVBA 3RPTA 3A6OA 4GGBA 1X8FA 1DORA 5I2UA 4O0KA 2O92A 2R9RA 1UD5A 1E56A 4FALA 1DTNA 4E4UA 5CZTA 7XIMA 4OBRA 4JYEA 4NZ5A 4OUEA 3TW9A 5BRQA 3XINA 2YDSA 2P3EA 4PUEA 3C0LA 2BMBA 4RNFA 1R47A 3H2EA 1S46A 2GJRA 5GNYA 4XISA 1XLGA 5REQA 2DSWA 2DW7A 5J8LA 1WZKA 2Z28A 1FH7A 3W75A 3KTSA 5AKQA 2NV9A 1CDGA 3PBWA 1KTNA 3DU0A 3EDDA 1DL3A 4UR7A 4X9SA 2H3BA 3BLLA 2CC0A 4RCXA 3W0KA 1UD3A 3BL3A 1TR1A 1IZCA 3S2MA 5CSSA 1NQKA 4JQAA 1B30A 2H3DA 3Q58A 2FZNA 1TREA 2F61A 2GGGA 4PUDA 3EX3A 2ZX9A 4H9TA 4AZ6A 1XR2A 5A95A 6TAAA 4H6EA 2QCGA 4L4OA 5KZMA 3QHOA 1L8PA 2BVDA 1UBSA 3CUZA 2DSKA 2CLPA 1AW5A 1KBLA 2FQIA 3AOFA 5HMFA 1IR2A 3M43A 2Z1XA 2C6QA 2PC8A 5EMUA 4IJCA 1RV8A 3BOXA 2OSWA 4IL0A 4B5SA 3WQOA 5BXTA 1GPFA 2EQDA 3NVTA 3KZPA 1RH9A 2H9AA 1BF2A 5IBXA 4E8GA 1LP6A 4KWUA 3FX4A 1PPIA 1W0MA 2Y4SA 3CQHA 4PSPA 1U5HA 1XRFA 4DELA 4GC3A 1SFTA 5CAHA 1VQTA 2RDUA 2FGBA 3BOLA 3DKLA 1BGAA 3BW3A 2PD9A 4KCWA 1XICA 4XO7A 1LZOA 4UTTC 1M04A 2GJXA 5A8GA 3BDKA 4ERIA 1VCGA 4PB4A 1JZ4A 3VD9A 2AKMA 5BMXA 3KHJA 4MGGA 4Q22A 2DIKA 3W1PA 3OZPA 4H6QA 1T6MA 1W1ZA 3XISA 1TTPA 2QJNA 2VRJA 3LERA 5HQEA 1JUEA 4GIYA 1UP3A 5AB3A 1EP1A 1GOQA 5D9PA 4LRTA 2TSYA 1N2VA 5K4ZA 1V7YA 2D23A 3SB0A 4AIUA 1M68A 2IMRA 2X40A 3MP4A 1QI0A 3QTGA 1I8JA 1SZEA 3CS2A 1BLIA 2E1WA 4GZEA 5CZ0A 1NSJA 4D6FA 4PRWA 3TJXA 1R86A 4OWGA 1W2VA 3NZPA 2HXTA 5AHLA 3CQ0A 3WBYA 5HWMA 4JIIX 3JZUA 4TX6A 4LGXA 4OVXA 4QGCA 4JICA 1UPPA 3L2MA 2NWSA 3OODA 1IXPA 1FKXA 2X2YA 4HZMA 1L6FA 3UPWA 5XIMA 5G2WA 3CLWA 4HN8A 3QZAA 3P5YA 4UTIA 4ERAA 1VBHA 5DF0A 3GIQA 1SMDA 1C3FA 4BKNA 4H7ZA 3W2KA 1FP8A 3WLTA 3U2CA 1OT1A 2WMFA 4JY8A 3WMBA 4L6HA 5GNXA 1HJXA 4JCMA 3W22A 4JAWA 3WLJA 3ARVA 2C7FA 2AGTA 2AAMA 2NQ9A 1GZGA 5CG0A 4JIEA 1YE6A 3MUY1 2EAWA 2NX1A 1XYAA 5C2GA 1IGWA 4A8IA 2VDGA 2Y85A 3M5VA 3OO2A 4X61A 1DKWA 1PHQA 4FB7A 4LVGA 1JCJA 1ZBKA 4U3AA 4H83A 3T4CA 4A3YA 3VGBA 4GNKB 1V03A 3M5ZA 2XGBA 2YJQA 2HV5A 5HMEA 4RNJA 2C1HA 1JFXA 3IJ9A 4DNMA 1XIGA 4EAYA 3OA5A 4ML4A 2JE8A 4KIRA 1QPQA 3SGGA 3AC0A 3LSBA 4UUIA 1Q7QA 4EF8A 2W3ZA 1H7RA 5FOOA 4XD3A 2J7EA 1LLOA 4J3TA 3PR2A 2ZZ2A 3CK5A 1RQHA 3C5QA 4OTKA 4GA8A 1P0NA 5BOFA 1NOUA 2ZA3A 1CCWB 1S2VA 1VLWA 4GFSA 1XH0A 1V4YA 2CPUA 3TWBA 3VMOA 5CKSA 3ZVHA 3SCUA 1VFOA 3L12A 4XUYA 4YXGA 1SO3A 3OBEA 1TTIA 4PTMA 3C2FA 2YZRA 1QNSA 3LX9A 1HKWA 2DSUA 4V27A 4D9PA 4J3WA 4UQBA 3W01A 3N2BA 4DPQA 1M65A 3S1GA 1F2JA 3M6DA 3GC2A 4CQBA 5EFFA 1FCQA 4O28A 2VR5A 1HFBA 1WYIA 3I3DA 2GUBA 2QJHA 5I3FA 4RE4A 1N82A 5I3KA 5A6AA 2QCNA 2TAAA 1JJKA 3GYEA 4JXCA 4O53A 4JX4A 4AEFA 2QCLA 3GR4A 3UZZA 4UTLA 5FJJA 1D7FA 3AICA 3YPIA 3HTWA 5EBUA 1NTHA 2PA6A 4L6OA 3EB2A 1JEZA 4LWWA 3FXGA 3GC5A 4MM1A 2A2IA 3IVUA 1FXPA 5TQLA 3BUVA 4QJ1A 3W07A 2E40A 3ABSA 4IFOA 4I8DA 4LAUA 3FVDA 3UT0A 5HQLA 1VAHA 1UR0A 4JN7A 5C9UA 4AZBA 1Z7AA 3NNTA 4JTQA 2V5JA 4Y9MA 3M1ZA 2OXNA 1YXDA 2VZVA 3TQPA 3KBSA 1XYFA 3AZRA 3QOMA 4FNSA 4L80A 4JQ1A 4PB3A 3UJSA 1YMYA 1NFGA 5AHNA 2J7FA 4UTFA 3WLOA 4MIMA 2VDHA 5IDZA 1W3KA 3FSUA 4C6BA 1I0BA 3MO7A 2QEZA 2VC7A 4RV3A 1BXNA 1LBMA 5FL1A 3ARRA 2PD5A 3G1YA 4DBUA 2E28A 3HMCA 1E3XA 4KGLA 4RW5A 3DX5A 1KQZA 1J79A 4Z2JA 4KWOA 4KPLA 1QRQA 4G7FA 3NPXA 1BWLA 3A4XA 1JDAA 3ERPA 4WOQA 4I9AA 4IIGA 1UWQA 5LXXA 3ONCA 3SUWA 2QJMA 6TIMA 4P2VA 4BEUA 4WX2A 3UWUA 2IW0A 4A22A 3M9YA 4DUWA 2ZFAA 4QG8A 3MUZ1 5H6HA 1J8VA 5M1TA 2R91A 3ZT7A 4UR9A 4KEVA 1EBHA 1YE4A 1DEDA 3VDCA 1KB3A 1XX1A 3N73A 2ZUNA 3S47A 4PTNA 3FA3A 4IG2B 4GXWA 2QV4A 3NDZA 4XZHA 1RY8A 1ISYA 2AAAA 1EHNA 4IIBA 3UXAA 1GVEA 4D6HA 3V1HA 1U5VA 4E2OA 4LAMA 1P7TA 1E3ZA 3KXQA 2OWCA 3NUKA 4U5KA 1ZS2A 4LUYA 2PI6A 4TR9A 1IEVA 1I2OA 1MRAA 1D8WA 2I5QA 3HPXA 1ME8A 1BRLA 2AMGA 3QXBA 4XK2A 3OQEA 2DDXA 4S3FA 2AGKA 4GD0A 4I90A 3OBAA 3UG8A 2F6KA 2XWEA 3HFTA 4NG3A 1JGMA 2FHFA 3Q37A 3UG5A 5RUBA 2ZZ1A 1GWJA 2R1NA 2W92A 4GZIA 1UKPA 1PKMA 4QFUA 4M51A 4UCGA 2J74A 3KWSA 3REQA 3U0HA 3VD4A 2PTWA 5ABEA 2QCDB 3RX4A 1RK5A 3AXIA 2E8YA 3N2OA 1X6LA 5HJYA 3S6OA 5TNVA 1E1FA 1XDMA 4P7OA 4LXFA 1VS1A 3VNZA 2J8TA 1BSIA 3EDKA 5CZSA 1EGZA 2VGGA 4I6VA 4IM4A 4NNCA 4UXDA 1K77A 4MZYA 1IXNA 3GTHA 4TVDA 5JIPA 3H53A 2D22A 3F5KA 3HPFA 1HNYA 3BLEA 3C8NA 2WCAA 4E0CA 1W9BM 1EGMA 4V33A 5FI8A 1B4EA 2ISSA 2FTYA 1KWGA 4S39A 1OD8A 1E4LA 4MPKA 3MO4A 4LUTA 4M0XA 3C8FA 5AZ0A 1KA9F 4N6FA 1Q6DA 2KZHA 2FZ8A 1E5NA 3TJ4A 4LVBA 4L4MA 3PFMA 4MOZA 1OX6A 4HNUA 5GPRA 1SZGA 4DPPA 1SUXA 4QLKA 4ORIA 2J7CA 3TNOA 5D2TA 2W4XA 3CH0A 4S3DA 4H4IA 3UXLA 2ZUWA 3LS9A 3UEQA 3GTFA 3QF0A 4ZOBA 2YW4A 3SSZA 5CSRA 3C2RA 2RDWA 2YFNA 1YBQA 1Q8AA 4C1NA 3Q2DA 5DCBA 1OIMA 1UH3A 3ZT6A 4FLQA 5FIPA 2HMCA 3BCJA 3K4WA 2V69A 1XPGA 3RK8A 1TJRA 1H5VA 2V82A 2OYMA 1OD0A 3HQ1A 1J0YA 3KDNA 3I4KA 2R1MA 1M7OA 2GQ9A 3G1VA 3QQ1A 3HB9A 4AEEA 5LNVA 4DBWA 2EPHA 3ANUA 2HBVA 1UC4A 3CHEA 3DFSA 3KOWA 1W3LA 3R0DA 2V5CA 3R11A 4RE2A 2GVGA 3BV4A 4UOQA 3V75A 4HGXA 5KZDA 2HQAA 2CZVA 3STFA 4G1NA 4HK6A 1TPVA 3WH9A 4W8BA 4ZOEA 4LRSA 1PSCA 3FCPA 1BTMA 3PK7A 1Q6LA 5ECUA 3PJXA 3VO0A 1VFLA 2BGSA 1PVNA 4IPPA 1UZ1A 3B9OA 1AJ0A 3MC5A 1RR2A 3U5YA 4L5ZA 4GI8A 2J6XA 4AXNA 3SQLA 4AC7C 2BZNA 4Q4PA 1Q4WA 4W87A 2PB1A 1D3GA 4DI9A 3GNXA 4Q8NA 3W7JA 5ABGA 5AHMA 5BCAA 2GJLA 6XIMA 4E3VA 1FWIC 4U2YA 4OJYA 2P50A 2GGJA 2YXXA 4MKSA 7A3HA 4GYJA 1YDYA 5D05A 3FGCB 2PLCA 4WD0A 2O4QA 3G1RA 2QULA 2YA1A 3EDEA 3EWUA 3GR7A 5GJMA 4OE7A 1A5SA 3TOPA 3BAIA 1E72M 3CGTA 4L9XA 3ISIX 1Y5WA 2VR2A 3H7UA 3BG9A 3S9IA 4JTEA 4CNUA 3TYUA 1NY1A 2VGFA 1V8EA 5E6YA 4R34A 3LDVA 1SQ7A 3VNYA 4UOZA 1OZMA 1Y5VA 1JF6A 5EA9A 2V3GA 1N8WA 3FAXA 4LUIA 4B9YA 3E2RA 2WJFA 3WUEA 1EC9A 1ICSA 4LU0A 4Y7EA 1V08A 3W81A 2VD8A 2OLSA 1V6TA 3C61A 1LL4A 4UQAA 3GXPA 5E0CA 1W31A 3LGEA 4JFUA 4GVIA 4CD4A 2V63A 4A8RA 5JBDA 4FNRA 4CQAA 1XLKA 1C8XA 1L0PA 3OB8A 3CPGA 4LFYA 3C2OA 4W89A 2NX9A 2QVNA 3UD6A 1VCVA 4HYRA 1UP2A 3AS2A 5C9XA 3A23A 1HKJA 5K9DA 4DWSB 1HKIA 2YCLA 3DFPA 3R8GA 1QWKA 4GFIA 4O1AA 4JIPA 5DXYA 1ZJHA 3B03A 1F4AA 4DJED 4LS1A 5CZJA 5C71A 1W3TA 1AA1B 4TVUA 3TKFA 5BNKA 1VLIA 3NSXA 4G7EA 4ZZ9A 3L68A 5HDRA 1GQIA 1LBLA 2XVGA 3AYRA 7TAAA 4HNTA 4RV8A 1GVRA 1SZRA 2CBUA 3S0CA 3BLKA 1PTDA 1ZB5A 1DJNA 3WEZA 4YHEA 2ZX5A 2IKHA 1F3WA 3IJDA 3W7PA 3V0TA 3PVFA 1PHWA 2H6RA 1QK0A 3JZEA 4O0QA 3T44A 1XD1A 4CD7A 4W84A 4AAJA 4IICA 1JCYA 1FHUA 4NRRA 2DPEA 1CIUA 4OT7A 1JF5A 3O15A 1XCXA 3ZLGA 2BG5A 2Z29A 4JTTA 3RIKA 1OGSA 4U2ZA 1TWWA 4PN2A 3UR7A 3WUBA 4FEZA 4C6IA 1TWZA 3LOTA 3O2LA 1VFHA 1KGXA 2A4AA 2Y5SA 3ARXA 2WZTA 3IGSA 4HA1A 4IPJA 4Z42C 3W1AA 4IQEA 5GJPA 3H2MA 3WJSA 5DX7A 3S5YA 1P0DA 4GYFA 1FCVA 3GG0A 1BXBA 3W88A 2WMJA 3O3RA 3NO3A 1YPIA 2BHUA 2H90A 1QMLA 2WOQA 1E71M 4XD5