2PB1A

Exo-b-(1,3)-glucanase from candida albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-b-d-glucopyranoside at 1.9 a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XOG1
publication title Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A
rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 154
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pb1A00
4E4PA 1TG7A 2IUZA 4GQQA 4IPLA 4ZENA 4ZXOA 4WJXA 3WDQA 1VB9A 4F8XA 1O6IA 3WQ6A 3GH4A 3GH7A 1QVBA 3ZOAA 2Y8VA 4HMDA 3QGVA 2CCRA 3WH8A 1B0IA 4WKFA 1UOKA 3DHUA 2XSBA 1FFRA 4D71A 4BQ2A 1DHKA 2ZUTA 4L4PA 1UH2A 4PSPA 1V6YA 1DEDA 1HJVA 4QLJA 2JF7A 2OYKA 5D9OA 2OWWA 1JYNA 1H1NA 3VGFA 3KL0A 4NF7A 4PMUA 2WZEA 1JZ2A 3U7VA 1W1VA 5A6LA 2WYSA 1HP5A 3AXHA 1LL6A 4GZIA 5A8QA 5JBFA 1EIBA 2JALA 1BHGA 1V6WA 1MWOA 1BYAA 2DH2A 3BLKA 2XUCA 2V3DA 3AHTA 3GNRA 5DO8A 1JF6A 4TTGA 1JI1A 4MPKA 3KEHA 3SCOA 2XHYA 2ZUSA 4HZ6A 3CLWA 3ARSA 4BA0A 2E9LA 3A47A 2FHFA 2OWCA 5DT5A 2J7HA 1W9BM 1B3ZA 3PZMA 3WDRA 1E4MM 5I3DA 3WN6A 4XZWA 1LL4A 2YL5A 3VD3A 1JG9A 2V38A 1MXDA 3OBAA 4PMDA 5GNZA 3RM9A 4AZ7A 3AHVA 1EDQA 2WVTA 2O9RA 1Q6EA 5D9PA 1QHPA 4L4OA 3VGBA 4F9JA 5E6ZA 4JL2A 1QNPA 4MADA 1WE5A 1BPLB 2GDUA 1WDRA 1KXVA 4ACZA 2PI6A 1BVNP 5CJ5A 2BXZA 4PMNA 1KBBA 1E70M 2YL6A 5IDIA 3N13A 1HJXA 3QHOA 1H0GA 2W4XA 5HNNA 1JNEA 3AMLA 2ZUMA 3N17A 4CVUA 2A3BA 3ALGA 3AHZA 3THDA 4HU0A 2E0PA 4MB5A 2DSKA 2XVGA 3NDZA 4ZEPA 3CO4A 4H7VA 4UCFA 4AZHA 1TMQA 3DYOA 5LA0A 1CGXA 2ZXDA 5CPTA 2DQXA 1ZS2A 3NSXA 4AISA 4AY1A 3DC0A 3WEOA 1LQ0A 1CIUA 3FXYA 5CLTA 1UWTA 1ESWA 4QCFA 4HMEA 4X9YA 1DWAM 5M17A 2ZX5A 1CXKA 4XX6A 3NCOA 4ACYA 1XSKA 2YL9A 5FL1A 3II1A 1D3CA 3KL3A 1UWQA 1B2YA 2ZOXA 2VZSA 1W3LA 1J0ZA 3WFLA 1G5AA 3ARZA 1FFQA 3T09A 2PWEA 4TVUA 1NWRA 5C8BB 3EMCA 4IM4A 4PTMA 4W86A 3W24A 5ABFA 1NP2A 1C8QA 3RJYA 1V3IA 4KH2A 1GOOA 4E2OA 1E1FA 2WHLA 1VF8A 1JAEA 3WQVA 1WZLA 5A95A 1CGVA 5KZ6A 4PBGA 4AEFA 1LG2A 5HPCA 3WNMA 1K9TA 2XIIA 4U2YA 2CXGA 1ITXA 2VT0A 4BCEA 1JDAA 1UHVA 5FKYA 1CZ1A 2O9PA 1V3JA 1W1YA 3GH5A 4MB3A 1UKPA 3OG2A 1FP9A 1ODZA 4ACZB 4W5UA 2E3ZA 2J7EA 3BAIA 1UWSA 1U30A 2WMJA 5AYBA 3N04A 3GNOA 2YLAA 1NH6A 5BRQA 3EDFA 3MKKA 4J3UA 5DEZA 1E3XA 2WC7A 4PMOA 1R7AA 4P8VA 1KWKA 3PN8A 1GQKA 2W61A 3AISA 2YL8A 3VD9A 4AZIA 1UD6A 2VZUA 3CHFA 3K4AA 3PTQA 1OIMA 4WLCA 1PAMA 5D9MA 3WNPA 3S2CA 2PWHA 3VUPA 3ZMRA 3AYSA 3LPPA 1P6WA 3THCA 3WF4A 4AD1A 2BVDA 1GOMA 3VGEA 1DWHM 1J0HA 2WC4A 3ZSSA 1W9UA 1TA3A 5A6SA 3W37A 3HU7A 3VINA 1H4PA 2CKRA 5E9AA 4UQCA 4EANA 1ZJBA 1QI3A 4Z2LA 1JXJA 2BV9A 4LYPA 1XCXA 1E0XA 3AYRA 3IANA 2WWCA 2AAAA 3VIPA 2O9TA 2G3JA 5CQ1A 1FHLA 1JYWA 2Y4SA 2QHAA 1WKYA 4MAVA 2XFYA 1Q6CA 2YBUA 1PZ3A 3B9EA 3VM7A 2W92A 5ABFB 1E6XM 2WC3A 3VX1A 3WF3A 1HL8A 1ZBVA 2ZXQA 1AQMA 1UG6A 3AIQA 1RD6A 3WF0A 3O9NA 3MMWA 4C7GA 3AOFA 2WVSA 4PTVA 4PMZA 1VFFA 3FHAA 3HN3A 3CHCA 2A3HA 1E0VA 1GQLA 4UNIA 3EBVA 3WDHA 3WQWA 1EQCA 3U7BA 4CD8A 2WNWA 1GJUA 3PZTA 1MW0A 2WMIA 3UR7A 3MUAA 1G1YA 1E6PA 2BHZA 3TA9A 1W32A 3AMCA 4LXFA 2EXOA 3AS3A 1Q6FA 5CG0A 1EH9A 4UFIA 2NT0A 2XWEA 3B9DA 3UEQA 1NARA 2V3GA 2XFFA 4D6JA 4P7RA 4PEEA 1WB0A 3VKKA 1CGUA 4TX8A 1KFWA 1V3LA 4CUCA 2J4GA 8A3HA 1US2A 3IJ8A 4GXPA 2XGIA 3LPGA 3MANA 3W4RA 4E8DA 4AZ5A 1IZKA 2JFEX 5A2CA 3WDPP 3AHYA 4D6GA 1JDCA 2WCSA 3UG4A 3FW6A 3DYMA 1M53A 1J18A 3PZ9A 2ZICA 1H3GA 4HPGA 3ZT6A 1E5JA 1GCYA 3OA5A 1TVNA 2OYMA 3W6LA 2WKLA 1V6VA 2WMKA 1CGWA 1QHZA 4OOZA 1UWRA 3VIIA 1HXJA 1BG4A 3U57A 1W9DM 2VL4A 1C3FA 4HA4A 1JFXA 2YJQA 3GXFA 1IZJA 1E72M 4W84A 4NZCA 1FHDA 2CHOA 4KGLA 1HVQA 4D6EA 4KMQA 4AIEA 4WF7A 1KBKA 2A3CA 2EEXA 1RH9A 1UA7A 2J7GA 2VMFA 5D8ZA 5A8MA 1VBRA 2YA2A 1B3VA 3VIGA 2CBUA 1NWUA 1HKIA 3ARPA 1UR4A 4JKLA 4M8UA 2F2HA 5A2BA 4H8VA 5E6YA 1D7FA 4JL1A 1XH1A 2WMIB 1CGTA 1JIBA 3TOPA 4M29A 3L4XA 2WXDM 1UR9A 2V5DA 1HKKA 1EO7A 4GI9A 2D23A 1V3KA 4NRRA 2QMKA 4YHGA 4Q7NA 4N0RA 4AZGA 1LL7A 2VCBA 3VD5A 2C8NA 5A6MA 3IAQA 4KRTA 1BGGA 1E15A 1E6SM 4UR9A 5BCAA 3AFBA 1G9HA 3WNKA 2PWDA 4MAZA 2DSVA 4Z2KA 3SCUA 1VAHA 2V3EA 3W28A 3W81A 1I1WA 1HL9A 2E4TA 4D6HA 2Y2WA 1KR1A 3AMKA 1EHAA 5I23A 1E73M 1KXQA 1J0JA 2BVYA 1EOMA 1FH9A 5A94A 4J28A 1B30A 3B9AA 3AHXA 3MMUA 2BHUA 5GPRA 1M01A 3AZTA 4JHZA 1XGZA 1OT2A 3VNYA 4TVCA 1XD1A 1KB3A 1UD2A 2VZVA 2DT0A 5A8PA 2YKKA 4Z2GA 2VVSA 1VEPA 3TTSA 3WH6A 2JEQA 4JAWA 3WY1A 1LJYA 2WB5A 4V28A 4Z2HA 3VIHA 4TXEA 4CCDA 1CYGA 1XV8A 2E8ZA 2CESA 3WL0A 2GSJA 3A6OA 3WF1A 1GOKA 4CVWA 2NT1A 2Z1KA 3CUGA 5ABGA 4Z2IA 1OB0A 1HKJA 4C7DA 2EQDA 2ZWZA 2E8YA 2XM1A 3SCTA 4MNMA 3CHDA 1GNXA 1CPUA 1B31A 4JFSA 2DSZA 3SCNA 5A1AA 5JIWA 2VURA 4Q22A 4URIA 4YHEA 4BQ3A 4D1IA 5C71A 1HF6A 1K6AA 3DHPA 1E4LA 3GDBA 2YDSA 3HJEA 5C70A 3CBWA 2EPLX 3W26A 2BY2A 2CBIA 3W53A 7A3HA 2F8QA 3N9KA 4MNJA 1JAKA 4UZSA 3SUWA 4JKMA 3KZSA 4LPCA 4S3JA 1G0CA 2CITA 4UOQA 1DP0A 3K46A 3ZO9A 1UD8A 3L4VA 1J0KA 2VQUA 5CLWA 1AMYA 2J7DA 2DSWA 1GOQA 2FHCA 4EK7A 4AIOA 3F5KA 1UUQA 1EDGA 2QPUA 2ZXAA 2FDMA 1E56A 1MW2A 3EDKA 1E43A 3MUZ1 3SUTA 4PMYA 1WO2A 2AOSA 1XHGA 4GQRA 1QNRA 3TTOA 1BYDA 1CEOA 4P8UA 2WHJA 1OCQA 2BY0A 1WP6A 2OWXA 3CUJA 2WHMA 3EYPA 4J27A 2BFGA 4CN6A 4MTVA 2PWFA 2CNCA 2E9MA 3QR3A 1R87A 1UD3A 1V03A 1R8LA 5AC5A 5FL0A 1S46A 2J8FA 2RGLA 1X6LA 1BAGA 4W93A 3RM8A 3CZKA 1HIZA 3BSGA 5ABHA 1ITCA 4JIEA 1QI0A 1LLOA 3M07A 4MDPA 2J47A 2WKGA 2GJRA 1H5VA 2W67A 3MUY1 1AQHA 1HJWA 4GO8A 2J8GA 3WD2A 2VX6A 1XCWA 3CMJA 4PCSA 4AD5A 1WNOA 3U5YA 3UETA 1GOWA 1DWIM 3CZJA 1TE1A 3EDJA 1E5NA 3AQUA 4BS0A 4WIWA 2ZX7A 3SCRA 2XVPA 4DUXA 3VIMA 2PWGA 4TOQA 3UERA 3ZM8A 4PYSA 1UKQA 4TTUA 3SUUA 1GQJA 4UFMA 1VFMA 3PZIA 4HA1A 3LMYA 3EMQA 5ECUA 3BAYA 5D8WA 1V0NA 3SUVA 3AS1A 2D3LA 2E9BA 3WUEA 3CUFA 1B3YA 3ZIZA 2VRJA 5A6BD 1NWTA 1JZ6A 4EKJA 3QOKA 4CU7A 3AXXA 4JFTA 2WWDA 2AMGA 4FK9A 4R5EA 3ARWA 2XVKA 3VMPA 3VD7A 1PX4A 5A6BA 3WH9A 1E4NA 1GZJA 2VUYA 3TONA 1XSJA 2F61A 2WCAA 3MU7A 3GXDA 2Z1SA 1K9EA 1ZBKA 2YA1A 3M7SA 3RIKA 4U5IA 4W8LA 3WL1A 4W89A 4B16A 1E4IA 4E8CA 3VIKA 4JHOA 2WAGA 3WQ4A 5HXMA 3GM8A 3VDBA 2GJXB 5FCZA 2XM2A 1UQYA 3KL5A 3G6LA 1ISYA 1QNSA 4MB1A 4AW7A 4FLSA 4M24A 2VOTA 4D6CA 5HOSA 1E6RA 1W9XA 4UQBA 1NWSA 2YLLA 3K8LA 4MJ4A 1CXEA 2WBGA 4OOUA 4AC1X 3MV11 3PZNA 2XTKA 2A3AA 2FHBA 1C8YA 4WSJA 4X0VA 4ATDA 1IV8A 1C7TA 4B9ZA 1H09A 4MJ2A 1QI5A 1JYVA 5E09A 1XYFA 3EDEA 2YBTA 4UOJA 1VEMA 1UYQA 2VI0A 2VQTA 1QPKA 3TTYA 1BGAA 1GHSA 2EJ1A 3OLGA 1E40A 2CBVA 1UKOA 2DSUA 1OIFA 4H04A 1HX0A 4U33A 5AY7A 1K9FA 2D3NA 4K68A 2DPEA 1EXPA 1B3WA 1NP0A 4J3XA 4AD4A 3SIMA 1QW9A 3VGDA 1OINA 3E1F1 2WMFA 2YDQA 3VILA 4CKQA 2IXUA 1C93A 4XUYA 1H11A 1U33A 5EB8A 2D24A 3WEZA 3AI0A 1JGIA 1OGGA 4W8BA 5CPSA 5CSUA 4NSBA 1UQZA 4BZYA 4UFHA 1V0MA 3AS0A 4Z2JA 2J75A 1C8XA 1WZKA 1NOWA 2DT2A 3SEPA 3BCDA 2D20A 1H41A 1OGSA 3AJ7A 2EBNA 1H2JA 1ZB5A 1SR0A 3CMGA 4PTXA 5BXRA 3W82A 5F7UA 3NSMA 4ZFMA 1V3HA 3ARRA 4PCTA 3VX0A 4JFWA 3ZSTA 1DWJM 4QAWA 3MSDA 1CGYA 3WMSA 1QHOA 4W7UA 4JFUA 1TR1A 4PMQA 5DMYA 1C91A 5E70A 3T2OA 3ZJ6A 2OLHA 3RPMA 4PN2A 2WZIA 1FA2A 5GNXA 5GQBA 2EPKX 3ZR5A 4XZBA 1GPFA 1CECA 3CZEA 4CD5A 2XGBA 4W5ZA 1OD0A 1QOXA 3A4AA 1BVZA 2ZX9A 1HVXA 5E0FA 3PHAA 4IISA 2O9OA 4B3KA 2CEQA 1KGUA 2J25A 1W3KA 1HP4A 1KGWA 5EFDA 5A6AA 2D0HA 4AXNA 2X0YA 4GIAA 3OGSA 2WCGA 4OJYA 1MW3A 2X09A 2ZE0A 2X1IA 3JUGA 4LYRA 4OIFA 2J78A 2JIEA 1JYXA 3WEMA 4FMVA 1E9LA 5BXTA 1CLVA 2ZX6A 2J7CA 4CGTA 1TCMA 5HDRA 3GNPA 3QOMA 4UQDA 3K1DA 1MXGA 4P7QA 3I3DA 1CDGA 6A3HA 3K8MA 3SCVA 1ISWA 4GZEA 1CENA 2HISA 1LWJA 3AIWA 4NRSA 3UR8A 2XPKA 2DGAA 3IAPA 3IK2A 1ZU8A 3UG3A 1MVYA 1ISVA 2FH6A 2WHKA 2ZUWA 3W29A 5FOOA 5IFTA 1E3ZA 1WDSA 3NIYA 5ABEA 2G4FA 1V0KA 2VX7A 1BG9A 5I77A 4J3SA 4CCCA 1VEOA 3ARTA 3GTNA 1JZ7A 1BFNA 2A3EA 3ARYA 1V02A 4ATWA 3WD3A 2GJPA 3W38A 2VJXA 4D6IA 3MUIA 3TP4A 1UA3A 3WENA 1GQIA 4PMVA 1XRVA 3VPLA 4AD3A 3WKZA 2YA0A 3WBEA 1JZ8A 1XH0A 2VX4A 3A4WA 1HKMA 1OSEA 2Y5EA 1QW8A 4JKKA 2VC9A 3VIJA 4P7LA 1CXFA 3BAKA 3UESA 4M1RA 1W3HA 3BAXA 2XIBA 3VNZA 4BQ5A 3LPOA 3L4WA 5FIPA 4PSRA 4UFJA 1AVAA 1VBUA 4GKLA 3AIBA 1FH8A 1JNDA 4OBRA 2J7BA 3VGHA 1M7XA 1MQQA 2G3MA 5JIPA 1VIWA 1CNVA 3OZOA 5DFAA 2WLZA 3FNDA 1KCKA 3L2MA 4W7WA 3WELA 5EFFA 4ZE4A 2VX5A 1HJUA 2J74A 3W27A 3VU2A 6TAAA 3G6MA 2X2YA 3WH7A 3U5UA 2X05A 1GORA 1WZAA 2WW5A 3N1AA 2BHYA 1E1EA 1W2VA 4FLRA 4OBSA 3OB8A 3GYCA 3POCA 1US3A 1UZ4A 4H41A 3AMGA 1SMAA 4WK9A 3O2LA 3MS8A 3MSGA 3CGTA 1M03A 3BMWA 5M03A 3J7HA 1W1PA 4HP5A 4KRUA 1J9YA 4JZ5A 1EHNA 1PIGA 2D1ZA 1UR8A 3CH9A 2WLYA 3WD1A 3PZOA 1VRXA 1UD4A 4F79A 1DWFM 1GONA 1W2PA 2DEPA 3RCNA 1E6QM 2C0HA 4PUEA 4YPJA 1A3HA 4BQ4A 4UOZA 2UWFA 3WQ5A 1W9VA 4OZOA 4W87A 3VIFA 3F5JA 3AIRA 4C7FA 3RJXA 1KR0A 2VZOA 5I5RA 3VGGA 1O7AA 4LX4A 4QCEA 3PBGA 3ECQA 2PBOA 4GPNA 1BLIA 1C92A 2J79A 3GXIA 4AD2A 1DTUA 2VZTA 4GI8A 4V27A 4AZBA 1TFVA 3CHEA 3AXIA 5M5DA 1YQ2A 2G8ZA 1XD0A 4IPNB 3L4TA 1BTCA 3ZQ9A 4W88A 1A47A 1WCGA 1JZ3A 3OIHA 1KQZA 4QLKA 3DYPA 2PBGA 1SMDA 4M81A 3VMOA 1LG1A 2UY5A 4OUEA 5HBFA 1RP9A 1HNYA 1EO5A 3WMCA 2FGLA 5CZKA 4U5KA 3ARUA 3PZQA 4A4AA 1KXTA 2VTFA 3PTKA 1V0LA 1CWYA 4XV0A 2XVNA 1FH7A 2VVNA 1XH2A 2CETA 3BGAA 5CGTA 4YN5A 3SURA 4XB3A 2OYLA 2PC8A 4WKHA 1EOKA 4UFLA 1GHRA 2X8RA 2WMHA 3WNOA 2WBKA 1WZMA 4LGXA 2UY2A 4GZJA 2W62A 1B1YA 3MO4A 4QLLA 3T0BA 4UQ9A 3A3HA 1HN1A 3L2LA 1Y7VA 4UQEA 2CERA 3N18A 4D72A 3CUIA 2GJXA 2PB1A 3VDAA 5I79A 1VJSA 1UD5A 1UKTA 3PTMA 4KWUA 4CD4A 2WSPA 2O92A 4UFKA 4HOWA 2WZHA 2EPOA 1PPIA 4PUDA 3VO0A 3M6DA 3VIOA 5A8OA 4ATLA 1C90A 3CTTA 2BXYA 1ISXA 4DWSB 1I1XA 2UY4A 2OSWA 1RP8A 2J62A 2W5FA 4AWEA 1M04A 5CSYA 1G01A 3FAWA 1UWIA 4QP0A 1X1NA 1VFOA 3GZAA 1OGBA 4H2CA 3T08A 2FH8A 4RE3A 1B9ZA 4D1JA 4R27A 5BROA 2GK1A 3O6AA 5JBEA 5IFPA 3OGVA 5BWFA 2E40A 3CIVA 1E55A 2EPMX 2PF0A 1VJZA 4HA3A 5IHSA 1TUXA 3ZJ8A 3NJ3A 4CU8A 3F4VA 1EGZA 1HJSA 3OZPA 4EE9A 4J3VA 5IXEA 1G94A 4P8XA 3RM4A 3AZSA 5I24A 2Y24A 2Y8KA 3RDKA 1NQ6A 2ZIDA 1NM9A 4LYQA 4BF7A 2VO5A 1QNQA 1W3JA 1B90A 5EMYA 5HPOA 1WAWA 2JIWA 1WDPA 4AZCA 2XVLA 2XFRA 4IUGA 4D6FA 2RGMA 5I78A 3BH4A 4MNLA 3GXMA 2GFTA 3I3BA 3WMBA 4MDOA 4U2ZA 5D9NA 4TUFA 2D2OA 4FF5A 4FLOA 3ZT7A 2DT1A 4TX6A 1FP8A 2B31A 3WBAA 1OM0A 3BXWA 1V6XA 4HZ7A 2BS9A 5BXPA 2TAAA 4DWSC 3L4UA 1UKSA 2ZUNA 1PBGA 1B3XA 1JDDA 2WSKA 2DDXA 4HMCA 4PRWA 1E6ZA 4J7RA 1GJWA 3AICA 2YOCA 4CD7A 1QNOA 4MNKA 5AYIA 4AD0A 3PZVA 2XSAA 1J10A 3L4YA 1F4AA 3FN9A 4AMCA 5A8NA 4MB4A 2D0GA 2WPGA 3WD4A 4ZXLA 4J3WA 1OT1A 2CHNA 2YDRA 1JFHA 2VR5A 2OSYA 2W63A 2QV4A 3K8KA 1JI2A 1PJ9A 3PZGA 2IXVA 3MMDA 3CZ8A 3WD0A 1GUVA 4W85A 2CPUA 1CTNA 1Q6DA 3EMZA 3IJ7A 1ZBCA 5LA1A 4DUVA 2BY1A 1EDTA 2GDVA 2W91A 1QI4A 4D6DA 1JD9A 2GK1B 4DUWA 1N82A 3BLPX 2G41A 3ARXA 4PTWA 2QLYA 1L0PA 1ISZA 2VNCA 3N12A 3D3AA 2ZUVA 4M80A 1V6UA 3KE0A 4V2XA 5LA2A 3GBDA 3OLDA 1U2YA 1FOBA 4AZ6A 4RE2A 4S3KA 5A3HA 1IT0A 1BYBA 1ZBWA 3GBEA 3SUSA 1UH4A 3K4DA 3VTRA 3AROA 3ARVA 8CGTA 3MV01 3ARQA 2ESCA 5BRPA 3L4ZA 4AZCB 3WH5A 4CN4A 3FY1A 1QI2A 1H49A 4UTFA 3S6TA 4HZ8A 4PMXA 4W8AA 1NOFA 3VDHA 4M82A 4H8HA 5D4YA 3W6MA 1XC6A 3VOCA 3IJ9A 4WKAA 5IHRA 4CD6A 4QFUA 1PIFA 4HU8A 1WPCA 4JCMA 3AIVA 1DWGM 1E6NA 3SCSA 3T2PA 3CPUA 3OLIA 1E0WA 2NSXA 5I6SA 2CKSA 1KCLA 2Q8XA 3CZGA 2J77A 1TVPA 3BSHA 3WUFA 1UZ1A 2ZXBA 2DH3A 2ZUUA 4P7NA 1JD7A 1V02E 1ECEA 5I2UA 3T0DA 3WQ8A 3PZUA 2D22A 4AYSA 1MQRA 3LPFA 3NDYA 3SCPA 1KWGA 4H8UA 1JXKA 3RILA 1UR0A 1F4HA 4X0NA 2JE8A 2NW0A 1CBGA 2X0HA 2EO7A 5JBDA 5A6KA 1MFUA 1GVYA 5KEZA 3AIEA 1MYRA 4CU6A 2OSXA 4AEEA 4CCEA 1J11A 2JEPA 1BSIA 3VDCA 1MW1A 3BAJA 1UWUA 1W9PA 3NYDA 5TD4A 3ZR6A 4P7OA 1V3MA 2ZX8A 3I3EA 1XSIA 3NSNA 5E0CA 4UQAA 3ZJ7A 5A69A 3EDDA 3WNLA 1SFSA 3BAWA 2YIHA 4JCLA 2DT3A 2C7FA 1PZ2A 3A4XA 1KQYA 1JL8A 2CBJA 3T0AA 2GUYA 2XJ7A 1OBAA 4B15A 1BYCA 1CXHA 1Z32X 2DIJA 3F5LA 3WSUA 1J0YA 4TVDA 2BY3A 1AQ0A 3OLEA 1ODUA 2ZWYA 3FAXA 3WUBA 3W0KA 1TA3B 2WVUA 1C7SA 4B3LA 1KXHA 4FLQA 2GVYA 1ZJAA 3VMNA 4UZUA 4F9DA 3AMDA 2VRQA 2D0FA 3B8SA 2G3NA 4ML4A 2WVVA 1K9DA 1D2KA 1CXLA 5GNYA 1R86A 3NUKA 4AIUA 1PX3A 3WUGA 1JF5A 5A6JA 3BC9A 1I75A 2UY3A 1GW1A 2JF6A 1V08A 5AC4A 5JUVA 4HTYA 4KGJA 5CPQA 4NI3A 1HT6A 2VRKA 1J0IA 3UG5A 1XYZA 4JFVA 7CGTA 1E71M 1GOIA 3KWXA 2J7FA 1J01A 1R85A 3APGA 5BXSA 5A2AA 2XYLA 2VCCA 5DF0A 1CXIA 1Q6GA 4EAMA 2WMGA 2VR4A 3DECA 3WIJA 2CIPA 1VENA 4PMRA 3D5HA 1PX8A 3QHNA 3CZLA 1EA9C 3AS2A 1QBBA 1J12A 1Q4NX 4HOXA 1OWQA 3VM5A 1OD8A 1UH3A 3N11A 5CGMA 2W66A 3OGRA 3RMEA 1CLXA 1R7OA 5I0DA 1SYTA 1YHTA 4LQ1A 4GI6A 3WDIA 3WFZA 3BMVA 4HOZA 3WF2A 2WK2A 1WDQA 2WM0A 7TAAA 1NOUA 1MFVA 2EPNA 3CUHA 3FHQA 1JZ4A 1W91A 3SCQA 6CGTA 4W7VA 4GINA 4ZE5A 3ZT5A 1UR1A 1JZ5A 2FGZA 3M46A 2XG9A 1EQPA 1PEZA 9CGTA 4CN1A 5BYWA 1KGXA 1VFUA 3N15A 1LF1A 3VD4A 2WVVB 1HJQA 3QHMA 4U31A 3AZRA 3RO8A 1RPKA 2V5CA 5FD0A 2BNJA 4J3TA 5CXPA 2G3IA 3UCQA 4B9YA 4A3HA 2QF8A 4DWSD 2BVTA 3W25A 2DIEA 1UR2A 4F66A 4WSKA 1H0IA 3ALFA 4RL3A 3WNNA 3TTQA 4P8WA 4DWSA 4U3CA 2XWDA 3BCFA 3WDJA 2HVMA 2V3FA 3AIUA 4DM2A 5EBAA 2QPSA 1GVIA 4QDMA 3VVGA 1L8NA 1MQPA 4U3AA 1X6NA 2QMJA 3SCWA 1ZL1A 5DT7A 4M56A 4OKDA 5M3WA 2CYGA 4A3YA 3POHA 5LYRA 4N42A 2VCAA 2MANA 1BQCA 3ZJKA 1TZ7A 1QBAA 4HPHA 3HMCA 3T2QA 4Y7EA 1LWHA 1W1TA 4GO9A 4RE4A 2WANA 4DM1A 1BF2A
chains in the Genus database with same CATH superfamily
4ZB0A 4E4PA 1B5TA 1TG7A 4DBSA 2IUZA 4ZENA 1TTJA 4ZXOA 5DELA 3NO1A 1H7OA 2PRLA 2GQ9A 3F4CA 3LLDA 3QYSA 3GH7A 2A7RA 3ZOAA 5EA9A 3UWQA 3QGVA 1BKHA 4DVOA 1B0IA 4MY9A 3R13A 5BRBA 4HNCA 4L4PA 4PSPA 1DJYA 4MOZA 3HPAA 2OYKA 1H1NA 2R94A 3ABSA 1GK8A 3SJ3A 3N6JA 5AC8A 1W1VA 3V16A 3LBMA 4NZ5A 4AMAA 2YCJA 3PWIA 2PP3A 3URBA 2I7GA 5JBFA 3RG6A 1PSCA 1GKRA 4YCPA 2Y0FA 3G77A 1BYAA 3DI0A 1KW1A 2CLIA 2A7PA 2V3DA 3AHTA 4Y8EA 1PYFA 3IARA 4JYEA 3M9YA 1FDYA 1JI1A 2G0WA 3UGVA 1S5MA 4NNBA 3SCOA 4HZ6A 3CLWA 2X1TA 3A47A 2PCQA 4HYVA 1KRAC 3A9BA 1XDMA 2DVUA 5DT5A 3CTLA 4HYWA 1QOQA 3WDRA 3QZEA 5HANA 5I3DA 2PGWA 3H2AA 4MWAA 1P43A 3FYPA 2YZRA 2IMRA 5GNZA 3VKCA 4AZ7A 1EDQA 1T0OA 4FXFA 1Q6EA 1P5BA 4L4OA 2OGYA 4X63A 2GWNA 3H21A 1WDRA 1DKWA 4ZQNA 3UXDA 4A05A 2FB3A 1H63A 3IV3A 2YL6A 3N13A 3GU9A 3QHOA 3TCSA 1H0GA 1PKLA 5HNNA 5D32A 2QJGA 4IFKB 2Q09A 3P81A 3ALGA 4HU0A 1O60A 2E0PA 2VFIA 1F7BA 2Y6ZA 2DSKA 3G1VA 1TX2A 5G4WA 2BDQA 4NG3A 5HAOA 1TMQA 2KZHA 5LA0A 1QPRA 4E6MA 4B5NA 1JUKA 2DQXA 1GYMA 4AY1A 4FNPA 3WEOA 1J2BA 2PDBA 5KZMA 2NZLA 4M1BA 1ESWA 4TX9A 4QCFA 1H1ZA 4MKNA 3QSRA 4REQA 1CXKA 4ACYA 1AQFA 1XLKA 2YL9A 4C65A 2CZEA 3HF3A 4WXYA 3GYEA 4UR7A 2VZSA 4FNRA 2IQDA 2CXEA 3T09A 3WK1A 4ERGA 1THFD 3BWWA 4X9SA 3A3WA 4PTMA 4FXSA 1C8QA 4DI8A 4DYJA 1IXQA 1V3IA 4E2OA 1E1FA 4JN6A 3GDLA 3WLHA 1X97A 4NXKA 2IPFA 1ITQA 2XIIA 1KKOA 1V5XA 3GHSA 1CZ1A 2V69A 3EZ4A 3GH5A 3CLMA 3OG2A 1TWIA 4W5UA 3BICA 1YE6A 2V5JA 4LAUA 2WMJA 5I06A 2VEPA 3GNOA 2C71A 1HQTA 3RITA 1NH6A 3MKKA 1GYLA 4PMOA 1WKEA 3OHIA 1I60A 4P8VA 1SSDA 5BOFA 2VZUA 3DFSA 3MP3A 2YX0A 3K4AA 3AYVA 3VUPA 2PTZA 4G7FA 3AYSA 4CEUC 4HB7A 1P6WA 4D8AA 2BVDA 3VGEA 2AQWA 2WC4A 1TA3A 4DJFD 2RUSA 4MMWA 5A6SA 2QS8A 2QJJA 1SFJA 4O10A 2BV9A 2Z00A 4LYPA 5DY3A 3BLLA 1EJSC 5IRPA 3HQPA 1XLAA 4D2JA 3IANA 5AHIA 2J66A 3N19B 2D73A 3VIPA 1WA3A 1Q6RA 3S5YA 5CQ1A 1K4GA 1Q6CA 2HDJA 3OA3A 1AD1A 3GR8A 1C9WA 4DPQA 3DEQA 1XYMA 4XG1A 3O1NA 4G6CA 1AQMA 4I3GA 3G3DA 3AIQA 1RD6A 3O9NA 1F5ZA 4ICMA 4C7GA 2WVSA 4PTVA 1M65A 3SIZA 5LIWX 5FEPA 4C6IA 3LTPA 5DCEA 3WQWA 3KVKA 4PH6A 1OX5A 4CD8A 2WNWA 3UZWA 3MUAA 4QE1A 1G1YA 1E6PA 3P2VA 3MSRA 3GHRA 3AMCA 4IMGA 4KFNA 1M9HA 4QE4A 3IACA 1O5XA 2YZ5A 3O07A 4RW5A 2OB3A 4DRSA 4BHYA 1UP0A 4XKYA 1YIXA 4DO6A 3K5XA 1GVEA 2QCDB 2NXGA 1QWKA 4JR5A 4AAJA 1US2A 1X7IA 3IJ8A 4KETA 2BLEA 1XRFA 2OOFA 3B4UA 4JIHA 5DMNA 1Q2RA 1DQXA 3QC0A 1J2WA 3WDPP 3AHYA 4D6GA 1JDCA 3BLDA 4LRTA 3L0KA 3MWCA 3FW6A 4HK7A 2PURA 1ME8A 1P0EA 1PE1A 2WKLA 2WMKA 1CGWA 3M44A 1UWRA 4QG8A 4RDWA 3RFAA 4XAGA 1BG4A 3NQ7A 4LANA 3MA8A 3GR4A 1HUVA 2YB4A 4GBUA 2XH4A 1RQEA 4CLMA 1EB3A 4RPPA 4KMQA 1O5QA 1KBKA 2RDTA 4ADSA 4PC8A 3V3WA 2A3CA 3K2GA 3T07A 2J7GA 3GU1A 3ITVA 4A2SA 3KBNA 4G1KA 3C2EA 3M0YA 1NWUA 3KCOA 4QNWA 1OCJA 2ZA2A 4J40A 2F2HA 5A2BA 2HPIA 4JL1A 2WMIB 1CGTA 3A5VA 4M0XA 3TOPA 3WX7A 3E0LA 4E4FA 3STCA 3VA8A 4X3ZA 4H7CA 1SSGA 1P6BA 3QBUA 3KVLA 2XIOA 4GI9A 2QMKA 1LL7A 2VCBA 4UR9A 5JXQA 2ZQ0A 3M0MA 5TIMA 1G9HA 5JVLA 1DVJA 2X2GA 1UMYA 3TVAA 2V3EA 2NVCA 3KOWA 1H61A 1I1WA 1HL9A 1BQGA 4QJ3B 1FKXA 4D6HA 3AMKA 2QJMA 3M5XA 1J0JA 4MZ8A 4RR4A 3TNBA 1WX0A 4J28A 1B30A 3MMUA 2BHUA 4DZAA 4IICA 3AZTA 2GL5A 1OT2A 4O0QA 4TVCA 3OBEA 4XK2A 3ABRA 3TOYA 3SSJA 3QLDA 4FNSA 3R4IA 2E1DA 1B3OA 2PLMA 5FEWA 3LN3A 4PB5A 3LBOA 4JTTA 4MZ1A 3SDOA 1Z89A 4MJZA 4YCOA 3WLSA 3WY1A 3IRSA 1LJYA 2WB5A 2J27A 2BGQA 1XLMA 1LT8A 1CYGA 1XV8A 1WXYA 6XIMA 1OC5A 2GSJA 3QJAA 4UC5A 1GOKA 2NT1A 1W37A 3Q67A 1OB0A 1P1MA 2ZWZA 3NO3A 4ES4A 2E8YA 1DHPA 2PS2A 3SCTA 1LWIA 2GGJA 4MNMA 3CHDA 2XH2A 3NL6A 3PC0A 1I0BA 2DSZA 3UD6A 4JS3A 5JIWA 4NHVA 1VP5A 2VURA 4URIA 1IIHA 3ELFA 3KTXA 4O28A 1HF6A 2R91A 1LZOA 1WOAA 3RX3A 3WJYA 3U3HA 2F8QA 3QMTA 1YNYA 2NUYA 3SUWA 4D8LA 4M7SA 1TQJA 3W76A 1OJXA 3RRXA 4JNZA 3G1SA 2VEMA 3RHGA 1M7JA 4ENLA 4UOQA 2P8BA 1DP0A 1UD8A 4DJDC 1DORA 2W0UA 2ZZ1A 5CLWA 2DSWA 1GOQA 3C86A 3F5KA 4AIOA 4XWUA 2FYMA 1UUQA 3N25A 3UQNA 3ZWSA 3CAVA 3SQLA 1E56A 1MW2A 1QATA 3EDKA 2P0IA 4FALA 4LCSA 3MUCA 2CLMA 1XHGA 3HFTA 1A5CA 3H70A 1YW1A 2P10A 1QNRA 5AZ1A 1BYDA 5BOOA 3S2LA 4P8UA 4WY0A 2BY0A 1WP6A 7PTDA 1WUFA 4CN6A 3GAKA 1XGDA 2CNCA 3QR3A 3M5YA 1RJPA 3M1ZA 1R8LA 3H7VA 2VD8A 4O50A 1TTPA 1SJCA 3BSGA 4RXGA 3QFWA 1QI0A 1EUNA 1ZSXA 3EWWA 3M07A 1DJGA 1UR3M 3QGKC 1CX9A 1RJQA 1BXNA 4B5UA 1V6TA 2W67A 4K8HA 3N2MA 3MUY1 1OYBA 3GHTA 3STFA 1RK6A 3WD2A 1BF6A 1TWZA 5KTLA 2CLLA 1TZZA 3WLNA 4BS0A 2ZX7A 3V36A 3NR0A 2PWGA 4TOQA 5C9ZA 1W5OA 3BW2A 4PYSA 1VFMA 4HA1A 3LMYA 2FZBA 2PLKA 3QV7A 2DZXA 5ECUA 1MUWA 1HW6A 2CWXA 1KM5A 3GTIA 3CUFA 1B3YA 3ZIZA 3O16A 2NX9A 2Z26A 2ZKMX 1NWTA 4A6GA 3AXXA 4JFTA 2WWDA 4U28A 1JCXA 1EKOA 2AMGA 3K13A 5CPNA 1IEVA 5A6BA 1TWDA 3GLCA 1E4NA 2VUYA 4MFEA 1XSJA 4LAKA 1R2RA 2F61A 1Q65A 3RIKA 1L2UA 1UUMA 4W8LA 4B16A 1E4IA 1IT8A 3EOLA 3PBMA 4WDWA 1TIMA 4JHOA 1POJA 3ZLFA 2XZ9A 3GB6A 2GJXB 5HMFA 1P4CA 3KDOA 2VYOA 4GIYA 3RXZA 4MB1A 4M24A 1J6OA 4D6CA 1YBQB 1E6RA 1YMYA 3VOFA 4D9PA 2WNQA 2YLLA 4E2BA 2CZDA 3H4XA 1XQKA 3MV11 1BWLA 3PZNA 1OY0A 1C8YA 2PU1A 3UZJA 1QAPA 4ATDA 3I10A 4NJJA 1JCNA 1NDVA 3PAJA 2PSNA 1AODA 4OQVA 2BMBA 1UYQA 2HE5A 4GCAA 3T6CA 1BGAA 4GY1A 3OLGA 3NQ6A 1P7TB 4JICA 1G4SA 1OIFA 4H9XA 4H04A 3V35A 3OYZA 4U33A 5AY7A 1K9FA 2D3NA 3TW6A 4TMCA 2FZ9A 4OE7A 3RCYA 1IWAA 2DPEA 2TPSA 4L4MA 4J3XA 3E2SA 5BZAA 4AD4A 3SIMA 1ADOA 1OINA 2YDQA 2GQ8A 4QGCA 4H2HA 4M5PA 2JKAA 3DFYA 4GACA 2D24A 3MBDA 2QDEA 3UR5A 3AI0A 4W8BA 3L21A 4NSBA 3MO7A 3TAOA 3BPWA 6TIMA 1AW5A 2A21A 4ZO7A 1LYXA 3GU2A 4BZYA 4AC7C 1V0MA 2R82A 2I17A 3OEXA 5IDZA 4EAYA 2DZTA 1OFEA 5F2MA 3MJYA 3MCNA 2EBNA 3CMGA 2SFPA 5F7UA 3TXVA 1ICSA 1A5MC 1V3HA 4PCTA 3VX0A 4HT3A 3TYEA 4Q8NA 1OFBA 2IS7A 4XAPA 3H54A 3UA4A 2E5DA 4GJJA 3RGTA 4DYKA 4XD4A 1L6SA 3W6YA 3H8AA 3TJXA 2X40A 5L9FA 3ZJ6A 2OLHA 3RPMA 1UBSA 1GVRA 1FA2A 4LALA 4AHQA 3TQPA 5T9BG 2ZTKA 2W79A 4W5ZA 1OD0A 2GWGA 1QOXA 3QFEA 1BVZA 2ZX9A 1D9EA 1HVXA 4A21A 2J24A 2PDUA 1K8CA 3GX9A 4HK5A 2FLIA 2E6YA 4NYYA 1Q3NA 1W1A1 2D0HA 1ZJHA 3XINA 3OGSA 2GOUA 4OU1A 2ZE0A 2X1IA 1L6GA 3VKBA 2J78A 3MWAA 3MZ2A 3M43A 4FMVA 3RLHA 4I6KA 3EX4A 1TCMA 3M0IA 3OODA 3R0DA 3EWZA 4P7QA 1CDGA 4DJDA 2BWGA 4IX2A 3VCCA 4GZEA 3DFPA 1CENA 4PRTA 1LWJA 1OZQA 4JEQA 4EXAA 3IAPA 3PSWA 4MKSA 4UCGA 4EF9A 3UG3A 1ISVA 3W1UA 2E68A 3C61A 3W88A 1WDSA 1KC7A 4B5TA 4WY0F 1V0KA 4H9ZA 5I77A 4L1WA 3ABQA 1I4NA 3FIGA 2QGYA 1BFNA 3S5SA 2PD5A 1H7XA 3DC8A 2Z2BA 2P76A 5F2GA 4Q3MA 2VJXA 1KD0A 1EZWA 3WENA 4IT1A 3GFYA 3I7RA 4G1NA 1XLHA 3WKZA 1XLGA 2RKXA 5CC3A 3GC5A 5JH1A 3P80A 1TIWA 2NXHA 5K9DA 1VBGA 1UUOA 3A4WA 4HCDA 4JKKA 1UC5A 4MHBA 3M6YA 4GJ1A 1XPYA 1ZZMA 4PSRA 4O17A 4LC8A 3NNTA 3HURA 1FH8A 5GJMA 1KRMA 1VIWA 1VYSX 5DFAA 2PP0A 1FDZA 2NV1A 2VELA 4ZE4A 1HJUA 4A22A 3WK2A 3G6MA 2Z2UA 2KX9A 1GORA 2Y8UA 1E1EA 3DU0A 4Q4MA 1KCZA 4WZHA 4GQ0A 2C1GA 3POCA 1US3A 4H41A 5G4HC 1ZAHA 4FX6M 3Q4DA 1M03A 4JX6A 4H6KA 3W7KA 4AB4A 1J9YA 3PJUA 1Q2SA 3CH9A 2PDWA 1CLKA 2DZSA 3EKLA 1DWFM 5G2HA 2C0HA 4PUEA 4YPJA 3UPMA 4UOZA 3VIFA 1A0CA 1U1UA 1TPEA 2BXVA 2XIQA 3KFTA 4MUPA 5I5RA 1SFTA 1E1CB 1WDWA 4LX4A 1KRCC 3PBGA 3ECQA 3PBUA 2PBOA 3SY8A 4AD2A 2J79A 3GXIA 1DTUA 2VZTA 1HKVA 3DFNA 3KBMA 5M5DA 3FA3A 5HQLA 4QAIA 4BFAA 1GKQA 2YBVA 1BTCA 1EL3A 2HCVA 2OGJA 1R30A 2EG8A 1JPKA 2PDYA 2UV8G 2C15A 4HN8A 3MP4A 1SGJA 1HNYA 1IXOA 4UMBA 1RCXB 4QG6A 4NNAA 1CWYA 1FH7A 2VFGA 2CETA 5CGTA 3AU6A 2PDQA 1MZRA 4WKHA 1GHRA 2WMHA 3WNOA 6REQB 4LGXA 2W62A 1B1YA 5CEWA 3AWNA 3T0BA 2YCKX 1HGWA 1RVGA 1WYIA 4G7EA 1XIFA 4OWGA 5I79A 1LRTA 4I8YA 4IFOA 2WSPA 2O92A 3IJIA 3BUVA 2EPOA 3OTRA 4DAIA 2GGIA 1MSSA 4GC3A 3VO0A 3VIOA 4AX7A 2OODA 3LZ3A 9XIMA 2OSWA 1RP8A 3M4HA 1M04A 3GSMA 4QP0A 5G2IA 3UGRA 3CXOA 2ZC1A 1X1NA 1IWPA 4QX4A 4NXSA 3GZAA 3SB0A 5GJPA 2FH8A 2CLEA 2WQPA 1P0DA 1M1BA 4JIPA 1B9ZA 4ECLA 2H3BA 4R27A 3SQMA 2GVEA 2FVMA 4ZZ9A 2HRWA 3PG8A 3QC3A 3ZXWA 3OGVA 2E40A 3CIVA 5KMYA 2EPMX 3OZPA 1EGZA 1KM6A 2B7QA 2OEKA 3S0CA 4EPKA 1KM3A 1UIOA 4P8XA 3T05A 4A3QA 1E51A 3UZ5A 2FPVA 3RDKA 1TJ0A 4LYQA 1XICA 4GABA 1JRBA 2TODA 3ORWA 1U5HA 3QW4B 1QNQA 3M16A 1U83A 4IUGA 4D6FA 3BH4A 4XAYA 1AJ0A 4RNHA 4AF0B 3BG3A 2D2OA 3VCRA 3TROA 1YYAA 3A64A 3ZT7A 3M0LA 3WLMA 1VKFA 5CCZA 1FP8A 3TQVA 3BXWA 5LIYX 3P93A 2BS9A 1NQKA 5BXPA 2TAAA 2OLAA 2DW7A 4OTKA 1UKSA 3RF9A 4NY2A 2XIMA 4PRWA 1OK4A 2QCFA 4XAZA 3AICA 3GW0A 4CD7A 1FCQA 1TMHA 4DAFA 3K30A 4H6QA 2X7WA 4QXIA 1J10A 4GLEA 3L4YA 3UJFA 3WLQA 5A8NA 4MB4A 2Q6ZA 4JTCA 4UTLA 4DNHA 3B0YA 2CHNA 1LQAA 2V5KA 1PJ9A 3PZGA 3G1HA 3MMDA 4JYDA 5FESA 2QNEA 2CPUA 2ISWA 3GG7A 3IJ7A 4GFIA 1R9YA 2NUXA 3TMQA 1QI4A 3M64A 4J9JA 2VP8A 1N82A 4ZQMA 3ARXA 3N12A 4M80A 3KE0A 4Q6XA 4H4IA 5LA2A 5FACA 3OLDA 4ROPA 4AZ6A 1EWEA 3W07A 4RE2A 4S3KA 3KOZA 4O4WA 3TYDA 1Q85A 3K4DA 3AROA 8CGTA 1LUCA 1GG0A 4FAMA 4C6OA 1BWKA 4AZCB 3WH5A 3P14A 4HHPA 4IJCA 3QPYA 5REQA 4PMXA 1NOFA 3ERPA 5D4YA 2IKHA 4FOJA 3WK3A 1ZP3A 3KWSA 1QWGA 1IF2A 1XLJA 5DCDA 3KLKA 4O14A 4AIBA 2PWUA 5BMWA 1SW7A 1DWGM 3OYXA 2PLCA 3SCSA 3CPUA 1UBPC 3QPEA 1FWAC 4DHGA 4IMCA 4Q8VA 2J77A 5AYZA 3BSHA 4P7NA 4DIAA 1JD7A 4Q4PA 4KWVA 3QEZA 4FIQA 3C2FA 2DFAA 3LPFA 3NDYA 5DY2A 1ECQA 1UR0A 3CV7A 1CBGA 1TRIA 3IV8A 5I3IA 1KTNA 3WJSA 1XLCA 4AEEA 3W7QA 2HVOA 2XN1A 1J11A 2JEPA 1BSIA 2AL2A 4J3ZA 2V6AA 3HGSA 4RCXA 4XBKA 1KCXA 5EY5A 5TD4A 5HWMA 3S9ZA 4AWTA 3SGZA 3BCJA 1KFEA 4AH7A 3R12A 2Y5SA 4PFHA 2ZX8A 3I3EA 1XIHA 1EGMA 3CQ0A 1DYSA 5TBOA 3ZJ7A 5A69A 2BSLA 3EDDA 3VOJA 2DT3A 4IIHA 4V33A 5DBTA 3A4XA 3PUDA 1OX6A 3B8DA 2XJ7A 1XBVA 5EPDA 4POCA 1Z32X 2Y70A 3NVTA 4TVDA 2REQA 1P6CA 3H22A 2ZWYA 4GMEA 3LK6A 4GUGA 2WVUA 3P7YA 2EAWA 4Y2WA 2GVYA 3VDGA 3N4FA 2F6KA 4F9DA 1F74A 1R9ZA 1IEIA 3E2VA 3KM8A 4GX8A 4ML4A 2QZRA 1CXLA 5GNYA 2Z1BA 4PEKA 5CC6A 3DBNA 4JQAA 5K9XA 1GW1A 3O3RA 3COTA 3Q45A 3WK0A 4KGJA 5CPQA 1YPIA 1HT6A 2NV2A 3EOOA 4RW3A 1XYZA 3T8QA 5K3VA 1XP3A 4ADUA 5A5WA 1TTIA 2AGKA 3HPZA 3QTPA 1L6WA 3M5VA 4S23A 2WJEA 1NDYA 3KOXA 5DF0A 1CXIA 3QKZA 1EX5A 3QR1A 2VKZG 2UZ9A 3P0XA 4M7TA 2DZUA 3S46A 4PMRA 1PX8A 3CASA 4GYJA 3AS2A 1QBBA 1J12A 4HOXA 4KT2A 3PS7A 3WJZA 3O63A 3VM5A 1UH3A 4WSHA 1CLXA 4Q7BA 3A12A 1SYTA 3HFYA 1R46A 1KV5A 3TSBA 2POTA 2GGGA 4NKCA 2GGEA 3W00A 1X7FA 1LOQA 1DJIA 1W91A 4Y9PA 3SCQA 6CGTA 2FTWA 5FA5A 1UR1A 2R9RA 3M46A 3UCCA 3PFRA 1EQPA 9CGTA 5FJRA 4LUSB 1RHCA 3UJEA 2OZ3A 3TDFA 1EJUC 3AZRA 4RDZA 3ATZA 3QSTA 2V5CA 5CPMA 4S3GA 1XFCA 4IIGA 2Y61A 2C6QA 2ZA1A 2XU2A 3PUOA 4NAEA 2HNHA 3C0LA 4DUOA 4F48A 5DRCA 4DWSD 3M0KA 1IZCA 2DIEA 1JCYA 3RUBL 4WSKA 2C0AA 2VEIA 4JBRA 3TN3A 1ENUA 2NQHA 3P5YA 2Y88A 3PWAA 4GOAA 1V93A 4J5NA 2BB0A 1GVIA 4QDMA 3A9IA 4IH3A 1X6NA 2QMJA 3SCWA 1ZL1A 2P1FA 5DT7A 4M56A 2GSHA 3RO6A 2VCAA 2MANA 5A8GA 3ZJKA 2CFFA 2HXTA 2ALRA 5CBIA 2Z1VA 3DCPA 4WHBA 3W7NA 4GQQA 4MM1A 1VPQA 3WDQA 1VB9A 2OZ8A 1O6IA 3UXIA 2BTMA 1PV8A 1A80A 3UJRA 1W1IE 2Y8VA 3L2IA 4NUWA 1XIDA 2CCRA 4LY8A 2CZVA 4WKFA 1UOKA 2XSBA 1ZFJA 1AG1O 4M3PA 1U5VA 2ZUTA 2QCNA 1DEDA 1HJVA 3C4UA 5D05A 2FFIA 2V9DA 3KW3A 4PMUA 3E38A 2CLOA 2WYSA 1HP5A 1FWGC 3HOJA 1EIBA 3ZYZA 5JQ9A 4E2DA 1EPXA 1JCJA 4JQ2A 1IE7C 1FQ0A 4A29A 1PCWA 1Q45A 2XUCA 1VHNA 3QXBA 3VI2A 2JGQA 3U9IA 2W6RA 1K1DA 3BW3A 3KEHA 2XHYA 1DBTA 4MWAD 3SW6A 5FF0A 4ZBCA 2J7HA 3IGSA 3NZGA 3CWHA 1KKRA 3PZMA 3R94A 1AH4A 3WN6A 4O19A 2YL5A 3IIXA 3VD3A 3MYOA 4C6PA 5LNSA 2V38A 1Z42A 2FGBA 1HTIA 4PMDA 3AHVA 3CQIA 3KBSA 4IFRA 5E5CA 1J4EA 5DBUA 2DU2A 1DOSA 4JL2A 1QNPA 4MADA 1SW0A 3LSCA 4HHLA 1BPLB 5AKQA 4ACZA 1AH3A 2PI6A 3FSUA 5CJ5A 4K36A 3BLIA 4DPPA 2BX7A 1E70M 4H3DA 1J5TA 1HJXA 4YYFA 4ZO6A 4H9YA 1A5NC 3NQ2A 4EPEC 3PM6A 3AMLA 4UTMA 3N17A 4G2DA 2A3BA 1KM2A 4YS1A 4MB5A 1OX4B 3ITTA 4JNYA 4H6RA 3CO4A 4ZEPA 2OFJA 1OCNA 4XSMA 3FYYA 2CC0A 3TN6A 2BGNE 4DLMA 1OZMA 4NJIA 1RA0A 1JPMA 1LQ0A 1CIUA 4IG2A 5CLTA 1UWTA 3IGUA 1PVNA 1DWAM 3GIYA 3BZJA 4XX6A 3KBVA 3KCJA 1P1XA 5FL1A 2V2DA 2I56A 3EX1A 1D3CA 3GRIA 4IMFA 4YWIA 1FY6A 2YXOA 1XRTA 1GKPA 1G5AA 1VFLA 4IF2A 4IM4A 3BJFA 3DXIA 5ABFA 2AGTA 4DQWA 2A6NA 1TUFA 2Q02A 2NX1A 1UB3A 3FVDA 4KH2A 1GOOA 2YYUA 4HHHA 4R33A 1ZCCA 4R7JA 4MWAB 1FHVA 3WQVA 5EKYA 3S9YA 4Y90A 5KZ6A 1WV2A 4AEFA 3LYEA 3G0XA 3WNMA 5LHFA 1K9TA 2YCLA 3ZLHA 3QV6A 2VT0A 4UUIA 1MI3A 1JDAA 1V3JA 3APYA 3DH7A 1UKPA 4RNFA 4GVFA 2J7EA 4B2DA 8TIMA 3HZ3A 3TC7A 3NFUA 4DF2A 3B0PA 5DEZA 5AHEA 2DUZA 3GWQA 3TKFA 4HU3A 1GQKA 2W61A 3VD9A 4AZIA 4L6HA 3V5CA 1OIMA 4WLCA 3WNPA 1SJBA 3VYLA 4GISA 4AD1A 1GOMA 2PDXA 4AVOA 2R1PA 4AY7A 3HTWA 1BRLA 4YLWA 3HU7A 4W9TA 2OOGA 4PL2A 3W9ZA 4UQCA 3DG7A 4REQB 4L80A 1JDFA 2VEGA 2G3JA 4M6PA 1F76A 1QK0A 1FHLA 2JGYA 2QHAA 1WKYA 4GG9A 4HVXA 2IQ0A 1PZ3A 2E6DA 2VGFA 3QQ1A 2W92A 1E6XM 1W1B1 4PB4A 4A8NA 3VX1A 1HL8A 2AQOA 1R3SA 3W1LA 3PFMA 1XYCA 1UG6A 2Y62A 2L5HA 4I7UA 2QUNA 3PPGA 2QIIA 3R7MA 4C6QA 3AOFA 1WUEA 3L12A 1E0VA 1GQLA 4UNIA 3N9RA 2OJPA 3V0SA 4ZR8A 3UR7A 2RFGA 4E4UA 3ABOA 2BHZA 3N14A 3QY8A 4V1XA 1W32A 2O7SA 4LXFA 2EXOA 5H1WA 4YYCA 2PD9A 4DBUA 2V81A 1TKKA 4UFIA 4LSBA 3B9DA 1TV4A 5FSDC 1OK6A 2XFFA 4D6JA 3LTYA 3VKKA 5B7YA 4TX8A 2VR2A 1KFWA 1OF8A 1V3LA 3IUHA 4CUCA 2J4GA 4Q4OA 8A3HA 4GXPA 3LPGA 2Z0IA 3GY1A 3OZYA 3MI2A 4ZL1A 5A2CA 4YTUA 1OC6A 2E28A 1W3TA 4CNNA 1PTGA 3CU2A 2EGZA 3W2NA 4KCVA 1UJPA 3DYMA 1M53A 3ZT6A 2X30A 4X60A 4Z0JA 1GCYA 4JDYA 3CUZA 3OA5A 4I9TA 3I65A 1MUMA 3E2QA 3RRAA 1QHZA 4F0LA 1W9DM 3V18A 3LD5A 1AH0A 1PO9A 3H6OA 3T1GA 3CL6A 2A4AA 1LRQA 4DBEA 5G2WA 4WF7A 5F2LA 2E7FA 1Q7ZA 2IKGA 5B80A 4BEQA 4PL1A 2EEXA 1RH9A 2VWTA 5D8ZA 3AXMA 3S8HA 2ACUA 3MT1A 1I9CB 3VIGA 1RQHA 2W3ZA 1H62A 3ARPA 3QR0A 5AN7A 1UR4A 3W02A 4R34A 1EBHA 4GNKB 4R85A 1JIBA 4F0HA 3NZQA 3T7VA 3WLJA 2PU0A 1HKKA 1Z6KA 4J2MA 1EO7A 3GHUA 4N9EA 1V3KA 1FXPA 4IIEA 4YHGA 4N0RA 1XIJA 3HV9A 1FBAA 3AO0A 1H7PA 1E15A 1TZ9A 3GG1A 1OFPA 3HG2A 4EXQA 4GUIA 4XKYB 4MAZA 4IMDA 3SRDA 3YPIA 1G4TA 3SCUA 1VAHA 3W28A 3EPMA 3W81A 2I5IA 2E4TA 1F3WA 2P88A 3L66A 4WVXA 3EX3A 1KR1A 3KLLA 1HKWA 4R7OA 2FZMA 1QASA 5DRIA 2RJHA 4ZO9A 3TYAA 2I14A 3B9AA 1FWTA 4RK8A 3AHXA 4B3ZA 4FOKA 5GPRA 3CO8A 3VNYA 2XH7A 2OO0A 2QUMA 4J2PA 2CLFA 1MRQA 4B5VA 3GTHA 1AW2A 3O05A 1T96A 2VZVA 2GYIA 3H2NA 3EOSA 2YKKA 2ZVRA 4DLFA 3CC1A 4RZ5A 3FJ6A 2PDMA 4YVVA 3WH6A 4JAWA 5EMUA 3GG0A 1I2PA 2BASA 3SI9A 2CU0A 1XLEA 3W1NA 2E8ZA 4FX8A 3WF1A 2B4GA 3SGGA 4IGMA 3GR7A 5M1TA 1HKJA 2EQDA 4N6FA 1K6WA 3D47A 3OHMB 1KBJA 3PAOA 3U2ZA 4K7YA 4XZMX 2QJNA 1B31A 1EYEA 5A1AA 4GY7A 3TCEA 4HIBA 4D1IA 1K6AA 3DHPA 3GDBA 4XD6A 1TVLA 5C70A 4EWJA 1LM1A 3W26A 2GVGA 2PLJA 1R3WA 2CBIA 3S1VA 4MNJA 2ISSA 4L65A 1JAKA 4UZSA 2NLIA 3W7MA 4JKMA 4LPCA 4S3JA 2CITA 4A8RA 3LMZA 3KRZA 4FHAA 1QPOA 3L4VA 1RR2A 5MF5A 3PVFA 2FHCA 4EK7A 3R43A 3P62A 2FDMA 2ZZ6A 3TEVA 1GYNA 3TLLA 1ITUA 4L9ZA 1JCTA 4X2RA 4US6A 1KO0A 4KESA 3QZAA 1JGMA 5E0KA 1R2SA 3PPHA 3TTOA 4UIOA 2WHJA 3CUJA 4E3VA 1DTNA 3TYCA 4MTVA 3MHFA 2GQ3A 1R87A 3EX2A 1US0A 3F7JA 3I6RA 3G3MA 2NV9A 2J8FA 5FAJA 4Q4QA 4ZCWA 1ITCA 4JIEA 3W7OA 3STPA 3S6OA 3AAMA 2J47A 1HL2A 2GJRA 4O1BA 2DV0A 2EKGA 1ONWA 4RDYA 2BBFA 1VBJA 1YRRA 5AZ0A 5KSWA 2VX6A 1XCWA 3CMJA 5DN1A 5AVNA 1WOBA 5HQMA 3W86A 3UETA 3CPRA 4AY8A 3AQUA 3PUGA 3FSTA 2ZE3A 4WIWA 4CNPA 3ZWTA 2XVPA 2Z6JA 3IRDA 3SUUA 1TMLA 4FNTA 3VUSA 5FAGA 3BAYA 5D8WA 1V0NA 1VQTA 3WUEA 1NF7A 5A6BD 2GPTA 1X98A 2VENA 4EKJA 3G1DA 4CU7A 4IMEA 3MSYA 4OUIA 4FK9A 4R5EA 3W1RA 4UTUA 4PB3A 4FNUA 2PTDA 1YDNA 3TONA 3TA6A 2WCAA 3GXDA 2Z1SA 1ZBKA 4WY0B 5CZSA 7REQA 5PTDA 4W89A 4E8CA 3G1AA 3RPDA 3WQ4A 4FR6A 5LNRA 2FMNA 3PJTA 1TYGA 3GM8A 4N4QA 4CNTA 2XM2A 1O1ZA 3FDGA 1UQYA 1UP3A 3KL5A 1R3YA 3LHZA 1TPWA 2ZBTA 4FLSA 5E9XA 3LHUA 4UQBA 1NWSA 3BK0A 2WBGA 1MZHA 1UPMB 4OOUA 3TIMA 4CQ8A 4X61A 4AC1X 3E49A 4QIUA 4MKVA 2I5QA 3W1AA 2FHBA 1C7TA 4B9ZA 4WUIA 4MJMA 1JR1A 4NZFA 1XYFA 2IKJA 4UOJA 5L6UA 3BG5A 3UWUA 3TV8A 2VQTA 3TTYA 2AKMA 1G6CA 3FVMA 3NYZA 2ODOA 2EJ1A 1KFBA 2CZFA 4Q8QA 3EGJA 5HR6A 3HPSA 4K68A 3I7QA 3VE7A 2ZCGA 1QW9A 3E1F1 3VILA 2OXNA 4CKQA 2IXUA 1C93A 4RXFA 3DOPA 1F3XA 1H11A 4CNOA 1U33A 1IYXA 5EB8A 4GHRA 2E67A 5CSUA 4UTJA 4PCPA 1UQZA 5U4NA 1ZCOA 4XZNX 5FJJA 1BVWA 2DZVA 4UFHA 2FTPA 1TPUA 3SEPA 3BCDA 3IIVA 3S2NA 3C0JA 3P0WA 4EXBA 5HULA 3HG5A 1BXBA 2DIKA 3AJ7A 5HK4A 3LCWA 4PTXA 2A2IA 3LNMA 2ZADA 1OVDA 1B9BA 4LAZA 5LGXA 1FWBC 1CGYA 4LVDA 3GVRA 3WMSA 1QHOA 3N2TA 5C2XA 1TR1A 1EEPA 4PMQA 2OT1A 5DMYA 2F9RA 5AYYA 5E70A 3T2OA 2PP1A 1TPVA 5GNXA 5GQBA 2EPKX 3ZR5A 2OKOA 4ZQCA 2WSQA 3MMTA 4AWUA 4CD5A 2XGBA 2G50A 2OEMA 1MO0A 3PNUA 1PB0A 1F07A 1L8PA 1VRDA 3TQ0A 2O9OA 3H7RA 4LVAA 2D2HA 4B3KA 3FK4A 2CEQA 1SUXA 3H2OA 3WYZA 2J25A 1HP4A 4AWSA 1KGWA 2RDXA 1TV8A 3WQOA 4RE0A 4CEXC 2PCEA 2X0YA 4GIAA 3L0NA 2WCGA 4OJYA 2X09A 5FF2A 4NT0A 3P8JA 4JNMA 1E9YB 1PCKA 4OIFA 4H83A 1GVSA 4DEFA 2D2JA 3KVMA 3I4KA 4DJDD 5HDRA 3TMLA 3VNIA 4S39A 3K1DA 2HZGA 1MXGA 3GKFA 1XIMA 2CHRA 4L9XA 1AK5A 3AIWA 4NRSA 2HSAA 3UR8A 1VZWA 3WQFA 2Z7KA 4DBDA 1I45A 5C0QA 5A6TC 2WHKA 3SN1A 3FYOA 4KRZA 1E3ZA 3UXLA 4MFDA 1FVPA 3QW3A 5ABEA 3E0IA 5DANA 3A21A 4YVPA 4ZTXA 1RAKA 1VEOA 1JULA 3RLGA 3OPSA 2A3EA 3ARYA 3VE9A 5B7ZA 2IPWA 3A23A 3WLPA 1B4KA 3URNA 4O57A 4RV8A 5LIXX 3MUIA 3TP4A 2OLSA 5DXYA 3LRLA 4PMVA 1XRVA 1VHCA 4AD3A 3E02A 2YA0A 3NQDA 3NM1A 1IR2A 2PDPA 1XS2A 1JZ8A 1TSIA 1QW8A 5D2WA 1OFAA 1CXFA 4M1RA 3UZYA 3LSBA 3VNZA 2ZRUA 3L4WA 2QAFA 4UFJA 1C29A 4R53A 5CZTA 4EPBC 1W5MA 1V7AA 4WDTA 1A5BA 1FWRA 1O12A 4JIIX 1CNVA 3BQ6A 3OZOA 2WLZA 1NFPA 2E6FA 3Q58A 2QVHA 4KIRA 3BV7A 3GDRA 1SZEA 1DQWA 4BY3A 3W27A 6TAAA 3BJSA 2ZDRA 4MF4A 3U5UA 1GVQA 4JTEA 1W2VA 4W4QA 4JGDA 4G5DA 3CL7A 1RD5A 4YL2A 2I1OA 2QDHA 1Z8AA 4XSLA 1S2VA 5I3KA 3CJPA 4IOTA 3O6YX 3FA5A 2ISFA 1QO5A 1VFHA 3MSGA 4AHOA 3BMWA 1XJBA 5M03A 1NTHA 1W1PA 4HP5A 1PIGA 3DHDA 3TK7A 1S2CA 3UF9A 3SJNA 5DMMA 2G37A 4O0KA 1PUDA 3O0FA 1UD4A 2DEPA 1QOPA 3RCNA 1E6QM 1K8YA 5I02A 1K70A 4GBDA 1QU4A 3EB2A 2ZZ2A 5G1TA 1X38A 1KFJA 4W87A 3F5JA 2X1UA 3Q37A 4AVNA 2VFDA 2VZOA 2PRMA 3GVGA 4L6DA 4F2BA 4QCEA 4YTTA 3LXCA 3UY8A 1BLIA 1C92A 1HFBA 2QDDA 3W2JA 4GI8A 4AZBA 5AVHA 4AG0A 4HA0A 2F84A 1TR9A 3AXIA 4I7VA 1TJPA 1ICPA 1YQ2A 3GUWA 2G8ZA 5K4XA 3MVIA 5FJIA 2OR2A 1XD0A 1FRBA 3DGRA 4GNVA 4KFPA 2E5CA 2VGBA 4W88A 4NAFA 4UMCA 3NQ8A 1JZ3A 1T40A 1SMDA 4M81A 3VMOA 1XBZA 4OUEA 4O4VA 4IGNA 2FJKA 4K1WA 3MZNA 2DJXA 4TQTA 2VTFA 5CAKA 1V0LA 1PS9A 3ES7A 2XVNA 4XV0A 1XH2A 2R1MA 1KTCA 3F03K 1Z41A 4GQBA 1FWFC 1EOKA 1K7FA 4ZB2A 3RLVA 5HWJA 3GO2A 1RQBA 1ME7A 4UQ9A 2W27A 1A50A 1Y7VA 1P48A 2CERA 2NWRA 1GT8A 2WSRA 2GJXA 3LI0A 3OVRA 3S3GA 1XLDA 3JRKA 1YTEA 5D04C 1UKTA 4JPGA 4CD4A 3RR1A 2OT0A 1PPIA 1EBGA 3N2OA 4NJHA 3URQA 4PUDA 5A8OA 3CAKA 3CTTA 3GC4A 4JY9A 3LV5A 3M5ZA 1YXCA 3N3TA 2MNRA 4AWEA 3FAWA 1KM4A 5FF7A 3NQMA 1V77A 2B7PA 3C8NA 3L68A 4I90A 4TIMA 2GK1A 3O6AA 4RLIA 4S3BA 5C54A 1P7TA 5IHSA 3ZJ8A 3NJ3A 2WM1A 4EE9A 3GQYA 3FEQA 3RM4A 4S2CA 1NM9A 2OU4A 4UNKA 3W1XA 1W3JA 5EMYA 4C5ZA 1DJNA 4L9YA 2XVLA 5T91A 3WMLA 4XIAA 3S42A 2XFRA 3I3BA 3WMBA 3LY0A 4JTDA 4MDOA 5D9NA 3CV6A 3AJXA 2VEFA 3TH6A 4K2SA 3C0SA 3N73A 1V79A 2DT1A 4GGHA 3AUOA 2B31A 1V6XA 3SECA 3L4UA 1GW9A 3V5FA 1PBGA 2PTWA 2WSKA 4HMCA 1TE6A 1E6ZA 4U4MA 4JTQA 1GJWA 1UWAA 2AAMA 4WCJA 6ENLA 4MNKA 5AYIA 1MXSA 3PZVA 2XSAA 2FZNA 3FN9A 1HO1A 1F3EA 4A3UA 7XIMA 3I7SA 3PPFA 2WPGA 4K7VA 3U4AA 4YTSA 1JFHA 2OSYA 2W63A 3K8KA 3TUUA 1GUVA 2PDJA 2CLHA 2Z2AA 5LA1A 3H2CA 3MP5A 3I6EA 3IS4A 4PFMA 4AVFA 3N6HA 4D6DA 3CAWA 2QCHA 4C90A 2G41A 4L7ZA 2QLYA 1F05A 2VNCA 3D3AA 1T41A 1DXFA 3KUMA 3MKCA 4RDVA 3DUGA 3LB0A 1U2YA 4L56A 1FOBA 4LF1A 5A3HA 3NL2A 4ASTA 2Z25A 1KBIA 3SUSA 1UH4A 4WDUA 3ARVA 3IWPA 4US5A 3KAOA 1DIOA 5BRPA 3L4ZA 1FWCC 4JIQA 4O1FA 3UYCA 1ZNNA 4UTFA 3S6TA 4ZA0A 4FA3A 4M82A 2IPGA 3IUDA 3KRUA 4BR1A 3KHJA 5IHRA 3TFXA 4QFUA 1PIFA 4HU8A 5CJNA 1WPCA 4JCMA 1E6NA 3OLIA 3KP1A 3EWXA 4JTUA 3QRHA 2ABBA 1TVPA 1FWNA 3TSMA 5M2FX 2Y7EA 1UZ1A 5D37A 4ZQOA 2ZXBA 2DH3A 4QR6A 1V02E 1ECEA 1FDJA 3WQ8A 3WZ0E 2D22A 4PULA 1VIZA 3TN5A 1KWGA 4IL0A 1F6KA 1ML1A 1JXKA 2OG9A 5H6HA 3RILA 4NX0A 1F4HA 2EJAA 4A3RA 1VYPX 4BWLC 3AIEA 1MYRA 4CU6A 3B3DA 2VGIA 1A5KC 3NVDA 2YW4A 1CCWB 4LV9A 3VDCA 1MW1A 2DZWA 3NYDA 3ITYA 3ZR6A 4P7OA 1ZQ5A 5HUPA 1SM9A 2PZ0A 2C91A 1OFOA 3PJWA 1XLIA 3O06A 4N7QA 2H9AA 4RKAA 4UQAA 2ACRA 4QROA 2Z1XA 2YIHA 3BAWA 4JCLA 3C3UA 3HV8A 1E0TA 1PZ2A 1EX1A 4H9VA 3HG4A 1JL8A 2GUYA 4B15A 2VM8A 2EKCA 1BYCA 3FGCA 1YTKA 1J0YA 3LHVA 2H3DA 5E1QA 1EWDA 4MSSA 1XKJA 1K02A 3LCHA 3B9OA 2GUBA 4PR4A 4B3LA 3VMNA 3TXZA 4N6EA 4YWSA 1RZMA 2INEA 4UZUA 1T5AA 2Q3RA 4XZLX 2AMXA 2D0FA 2G3NA 1K9DA 1D2KA 2E1WA 4AIUA 2OKTA 1NY1A 1PX3A 2C14A 5CAHA 2FFCA 4QM1A 1I2QA 3U48A 2JF6A 1QNVA 2Y1HA 3GZ3A 4NI3A 1HZYA 4DYEA 1R9XA 4WJ8A 1J0IA 3DKJA 4BI7A 1XBYA 4UTKA 3PBWA 4IGHA 1GOIA 6PTDA 4S3DA 1XFBA 1R85A 3APGA 3W7RA 1S1RA 4M51A 5A2AA 1A5OC 1EEXA 3LXBA 3NEVA 5F1UA 4EAMA 4F4RA 2WMGA 2VR4A 3BARA 5JU6A 2AL2B 3CT7A 3D5HA 4GXWA 4Y9OA 3WLIA 3CZLA 1EA9C 5FEZA 3ITCA 3LV6A 4HHMA 5H8UA 4KCWA 4F3HA 5G5IA 3QPZA 3EPNA 3N11A 4DF0A 3RMEA 3NL3A 5I0DA 3O8AA 3OVQA 1TJRA 1YHTA 1GGOA 2OCZA 2FB2A 2VFEA 1VLWA 3BMVA 1B57A 3WF2A 1WDQA 1RLDA 2WM0A 7TAAA 1OC7A 3FHQA 1NOUA 3NPUA 1MFVA 2EPNA 3CUHA 4EIVA 2XSXA 4QS5A 3MTWA 3M7WA 5HNTA 2REQB 1QT1A 4W7VA 3WBXA 4ZE5A 3ZT5A 4I6VA 1JZ5A 2PPGA 4FP1A 1PEZA 6REQA 3GVQA 1DQUA 4IXXA 2ACQA 3GNDA 3THUA 1VFUA 3CB8A 1FKWA 3GW3A 1HJQA 3NQVA 4U31A 3RO8A 5FD0A 4NILA 4HN4A 4J3TA 4B5WA 1Z44A 2PTXA 3UCQA 3SQSA 3IVUA 4FOUA 4XTDA 3W25A 4F66A 3KTCA 1H0IA 3T4CA 5EMJA 4O54A 4P8WA 3AWOA 1JDEA 2XWDA 2HVMA 3CV2A 4N4PA 2QPSA 2BZNA 5HQEA 3GDMA 3UNTA 2QJHA 1GG1A 3V0UA 3POHA 2RJGA 4MUZA 2HBVA 5BNKA 1EP2A 4PUNA 3GD6A 4HPHA 1SO5A 3T2QA 1LWHA 4GO9A 3PNZA 4RE4A 3RM9A 3C8FA 4IPLA 1W3NA 2OQHA 4GE8A 2YR1A 4WJXA 4A8LA 4F8XA 3QV9A 5CJMA 3GH4A 3R11A 3H23A 1GEQA 4FSAA 4JQ1A 1G7VA 5KETA 1YPFA 5EL1A 4N9CA 3ZFHA 1WAUA 3DHUA 4H19A 4BQ2A 3TYZA 1UH2A 4R3UA 1V6YA 2JF7A 3EOEA 3PR2A 1KNWA 3PUEA 1JYNA 3BLFA 4NF7A 4PUMA 3UBPC 2WZEA 1JZ2A 4DY1A 3GXPA 4LS0A 3W71A 1IQ8A 4GD0A 5A8QA 5U7SA 1BHGA 1V6WA 4ALDA 3P8IA 1MWOA 4MPQA 3BL3A 3R5EA 3GNRA 3W1PA 1JF6A 3HQ1A 4NAEB 3LTSA 3GFZA 3ARSA 4BA0A 2E9LA 3A13A 1Y5VA 2FHFA 4Y96A 2H6RA 1W9BM 3WJWA 1R6WA 2O4QA 3VNLA 1LL4A 4JQ4A 1PZ1A 1JG9A 2ZC8A 1MXDA 2VC7A 3C6CA 5MKGB 1LBMA 4EVZA 2WVTA 3B8IA 1PL9A 3I68A 2GZXA 3LI1A 4NIRA 1QHPA 4UWMA 3W23A 4F9JA 3N29A 4M6VA 3R8HA 3SGUA 1W8GA 1K7EA 2GDUA 3P6LA 1KXVA 4H7ZA 1BVNP 2BXZA 5FJTA 4BWLA 2E77A 3GNXA 3E12A 3PBYA 2CLKA 1SZGA 1XXXA 5G4EA 2W4XA 3BOXA 1JNEA 3RCMA 2ZUMA 4ROQA 3E5PA 3LGEA 3R1ZA 3EWYA 3M47A 3MHGA 3NDZA 4JTLA 1F8MA 4H7VA 4UCFA 1BSLA 4AZHA 1G4EA 3DYOA 3C2YA 4HNOA 4S2BA 2CWNA 4IX0A 2ZXDA 3S1GA 5CPTA 3DC0A 4KFOA 3AALA 3N6QA 1P0BA 2Q71A 4HMEA 4X9YA 1JPHA 3D6NA 5M17A 2QV5A 4Q4SA 4CQDA 1GVFA 1TQXA 3NCOA 1XSKA 2OELA 3II1A 3KL3A 1UWQA 1MMFA 3S2MA 4Q8MA 2PMQA 1J0ZA 3WFLA 3KCLA 3ARZA 3CT2A 3IJLA 2PWEA 5HJXA 1NWRA 3EMCA 3W24A 3SFWA 1NP2A 4JXCA 4XIMA 4KEMA 3GNNA 1Q6OA 4EF8A 3RNDA 1VF8A 4GIRA 4NNCA 3L67A 5A95A 1CGVA 2Q3OA 2H8ZA 1F6YA 1LG2A 2H8XA 3TN4A 4C6NA 1AA1B 3XISA 1ITXA 1REQA 4BCEA 3XIMA 4NL1A 4ADTA 5I3JA 2A3LA 1UHVA 4B2DD 3V4BA 3MJMA 2QYGA 1W1YA 3VK5A 1C8VA 1FP9A 4ACZB 2E3ZA 2GLKA 4GI4A 1U30A 3NPVA 2A5HA 5AYBA 4K39A 1ONXA 1RK5A 1S1PA 3QYQA 3U0HA 1NJJA 1M7OA 4OFCA 2EF9A 3LU2A 4XO7A 4FEZA 4NP7A 5ABTA 1MEHA 1E3XA 3FXGA 2WC7A 4G9PA 3ZVIA 3S2JA 3PN8A 3AISA 2G3FA 2YL8A 1R47A 3NOEA 1UD6A 2YFOA 1TV5A 5D9MA 3S2CA 1F2JA 2PWHA 2R1NA 3ITOA 2Z24A 4O1EA 3S6DA 3THCA 2QAPA 3H26A 1FHUA 3ZVHA 1DWHM 1J0HA 3KZPA 3T40A 4LFYA 1W9UA 5J5DA 3CYJA 3W37A 3EOUA 1H4PA 4IG2B 2CKRA 4TV5A 4YU1A 5E9AA 3VOIA 4EANA 1XC4A 5I7GA 1V4YA 1JXJA 5CC7A 1XCXA 1E0XA 4IP4A 3AYRA 5HR7A 2WWCA 2AAAA 2XINA 2O9TA 1E9IA 3GUGA 4MGGA 1JYWA 2FTYA 5AHNA 2Y4SA 4HKPA 3USZA 4MAVA 2XFYA 3ABZA 5IOBA 4I7WA 1O4UA 3B9EA 5EMLA 5ABFB 4XTIA 1QTWA 3WF3A 5CZJA 1ZBVA 3E74A 5C6MA 4PMJA 2QXWA 3NAVA 1DIDA 4Y9NA 5DXXA 4B4FA 4LTSA 1OF6A 3FHAA 3CHCA 2HQAA 2YCLB 4YIWA 1PIIA 2OVLA 3C2VA 1R0MA 1J5SA 1AJZA 1NFBA 4N2YA 3T0TA 2X41A 2ICSA 3AS3A 5DQPA 3W2KA 2HTMA 1EH9A 2XWEA 1XYLA 4XBSA 3UEQA 4NYUA 1NARA 4NQ1A 4PEEA 1WB0A 1TV2A 4IMAA 1RY0A 5F4XA 4K1GA 3R79A 4HU4A 4AHPA 2XGIA 1EYWA 3W4RA 4L64A 4E8DA 4AZ5A 2AKZA 3L5MA 4C6JA 1IZKA 3TLQA 1P0KA 3EA3A 1BRLB 1EJRC 1J18A 4GYKA 3PZ9A 2ZICA 1H3GA 4HPGA 3H24A 3N4EA 2PDKA 4BK9A 1TPDA 3VABA 1LBFA 1TVNA 2QCCA 3W6LA 4LAOA 4TV6A 1PWLA 1OQFA 1RUSA 1N2VA 2VL4A 2XISA 4MLJA 3G8RA 1C3FA 4HA4A 3N2CA 1LQ2A 2YJQA 1IZJA 4UTWC 2QJIA 2CHOA 4KGLA 4GH1A 1HVQA 2JQXA 2E5BA 3BV4A 4AIEA 1SZNA 1ZHAA 2VMFA 3HG3A 1J79A 3M0JA 1VBRA 3DDMA 1SVDA 1XG4A 3W3OA 3A5FA 4H8VA 3EA2A 2NQ9A 2WXDM 1UR9A 2V5DA 1LT7A 2WO5A 1R38A 3UZXA 3R89A 2D23A 2ATSA 4H00A 4Q7NA 1HGYA 3VD5A 5A6MA 1V8EA 3IAQA 1BGGA 1E6SM 2FVLA 3AFBA 2QGHA 2PWDA 2DSVA 4Z2KA 5KZEA 3ZLGA 3WFAA 5CKSA 1EHAA 2NUWA 3RK8A 5I23A 1KXQA 2BVYA 2A0NA 5A94A 3ES8A 2PDCA 4Z1AA 2PDGA 1M01A 4JHZA 1XGZA 3GC2A 4HQVA 1IXPA 1TPB1 3ZS4A 1ZPTA 2Y89A 1XD1A 4LH8A 3LM3A 1UD2A 5KINA 5A8PA 1EJXC 1EPVA 3R8RA 4GGBA 1YADA 4HPNA 4JQ3A 4Z2GA 3LEPA 3E0VA 1TO3A 4KEVA 4A2RA 1UASA 2VVSA 3LG3A 1LTDA 3DFQA 3V5OA 3TTSA 4EX4A 3MDUA 3F2DA 4Z2HA 4PTNA 3VIHA 1TPH1 4PUJA 2ZTJA 2CESA 3A6OA 4CVWA 1QUMA 2Z1KA 3F2BA 3CUGA 4MWAE 5ABGA 4Z2IA 4C7DA 4I5UA 1O1HA 3DFTA 3LDVA 1CPUA 1D3GA 2Y7DA 4Q22A 3LGGA 4NJGA 4YHEA 5BMXA 5C71A 3QMSA 1ZUAX 3RLUA 2YB1A 2YDSA 3QTGA 4NZJA 2PGEA 3HJEA 3CBWA 3B8TA 3W53A 3N9KA 1PYMA 2ZVIA 4UTHA 3DGBA 4QSFA 3UP8A 3WJXA 3VXGA 3KZSA 4XAFA 5D02A 3K1GA 1G0CA 4M6UA 3K46A 3ZO9A 1OX4A 4Z1BA 1FXQA 3LENA 5AB3A 3BGGA 1J0KA 1JUEA 1M6JA 3LZ5A 3WLRA 4BEUA 2J7DA 1JUBA 1ALDA 1WXZA 1YXDA 2GUUA 3WBWA 1S5VA 3VZZA 2QPUA 2ZXAA 2E25A 4H01A 2Z29A 1E43A 1QW7A 1B4EA 2QCGA 3MUZ1 1TWWA 4PMYA 3H4GA 1WO2A 4ZOAA 3V7PA 1M41A 4IXHA 3R6IA 1KRBC 3B8VA 3L65A 4GRSA 4M6QA 2G4JA 2ONEA 3UWYA 1ME9A 1CEOA 3VCNA 4IPJA 2WHMA 3EYPA 3TZNA 3E96A 1H51A 2PWFA 2E9MA 1UD3A 3CIXA 4HNVA 2BOEX 2XH0A 1X6LA 1BAGA 2HV5A 4H8NA 3KHDA 4PUWA 4W93A 3NQGA 3RM8A 3CZKA 1HIZA 4NVTA 4MYXA 1NIUA 4MDPA 2WKGA 1A4LA 3W2UA 4MLRA 2ZRYA 2Z27A 2PTYA 3G2GA 4DJEC 4PUKA 1HJWA 1GOXA 4GO8A 4EACA 2X42A 4AD5A 2Z7GA 3QLLA 3U5YA 4C6MA 3KOYA 4H9UA 1DWIM 3CZJA 1TE1A 1UPPA 3REQA 1E5NA 3JR2A 2FPYA 1H50A 3WQPA 1SJAA 3SCRA 1CI1A 4DUXA 3VIMA 3S47A 3WLOA 3WLTA 3UERA 3SADA 3EWDA 1UKQA 2YDAA 4N02A 4UFMA 3PZIA 3RU8X 2X7VA 4O11A 3SUVA 3DG6A 2E9BA 5FJUA 2POZA 4DB7A 2VRJA 4KWOA 3H4WA 1JZ6A 3MDWA 4GYPC 3CMFA 4LVBA 3OQ8A 4O13A 3SAZA 3ARWA 3VD7A 7TIMA 4QTGA 1TPFA 1W5NA 5K7JA 1VD6A 4K38A 2GGHA 3ABXA 4GCXA 1K9EA 2YA1A 3M7SA 3DBPA 4U5IA 3NPWA 4RJEA 1UZDA 3EKZA 2J6XA 2R14A 4XQ6A 1FWEC 3HQNA 4J35A 4AFYA 3EA1A 4YXGA 3GVWA 4LVGA 3VDBA 1JPDX 2ALDA 3U2OA 4WGHA 1R5YA 3IJQA 3G6LA 1ISYA 3WG6A 1VR6A 4AW7A 1WBJA 2VOTA 2LLEA 5FF4A 3MHUA 1W9XA 3TJLA 1H7NA 5CG7A 1CXEA 4UTWA 3HB9A 3HJZA 4C6LA 3UY7A 1V7YA 3PP7A 4WSJA 1IV8A 3MC5A 4MJ2A 1XCFA 2QEZA 3W7IA 1QI5A 3C3NA 4WEVX 5IM51 1JYVA 3CQJA 5E09A 3EDEA 2YBTA 3TZFA 2VI0A 3CEPA 1PDZA 2GOKA 1GHSA 3MY9A 2VOMA 2X0SA 3W7GA 4CNSA 1UKOA 3QM3A 2WNZA 4LOCA 4AUBA 4DXKA 4O8AA 2OZTA 1G69A 3PB2A 3QQ0A 4JY8A 1T99A 1EXPA 1B3WA 1JRCA 2P0OA 3D0CA 3VC6A 4XUYA 5H8PA 3IIPA 4S3AA 2Z6IA 4UMAA 1OGGA 5AFDA 3PG9A 4IGSA 3AS0A 2QULA 1S2TA 2J75A 1C8XA 3KXQA 1WZKA 1NOWA 2DT2A 3EWCA 7REQB 1OGSA 3LS9A 1K3UA 1H2JA 1ZB5A 3EAUA 5FSEC 1Q63A 1SR0A 2I57A 5HNUA 4F0RA 5BXRA 4GVIA 5H91A 3W82A 2PDLA 4ZFMA 4IQDA 1IWBA 2NX3A 3H2EA 1S5NA 4OV9A 4HNTA 4UNLA 3ZSTA 1LBLA 4UR8A 4ZTYA 4QAWA 3MSDA 1AD4A 2P53A 4W7UA 1GTHA 3PULA 4RZBA 2FDSA 2ABAA 1GQNA 5HATA 2GSEA 4PN2A 2WZIA 4E3TA 1WQ5A 2DORA 1GPFA 4MG4A 4MY8A 3N34A 4ZVJA 2Y85A 3KRBA 2WOQA 3K4WA 2F6XA 2I9UA 3AXKA 3I6TA 5E0FA 4JN8A 4Q4KA 4LU0A 2A6LA 3WQGA 1XPGA 1KGUA 1W3KA 5EFDA 4O1AA 3QMRA 4AU0A 5A6AA 3SSZA 4JTGA 5CGQA 4AXNA 4JTJA 1MW3A 2X1SA 3B0VC 3PJXA 1WDDA 3SZ8A 3FLUA 3G5EA 3SRFA 1JYXA 4YTQA 3M41A 2PDHA 3QOMA 4UQDA 1YXYA 4C1KA 3I3DA 2OQLA 1L9WA 1ISWA 3E3HA 3GDTA 2HISA 1XINA 3QY7A 4GX9A 3QZ6A 1LOLA 4HSHA 4P61A 1ZU8A 3VNKA 3IEBA 1EZ2A 4OVXA