2PB1A

Exo-b-(1,3)-glucanase from candida albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-b-d-glucopyranoside at 1.9 a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A
rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords Hypothetical protein XOG1
total genus 154
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pb1A00
4MNLA 1ECEA 3LPFA 1JI2A 1GOQA 1H3GA 2QV4A 3VDCA 6TAAA 3WH7A 4TX6A 1E6SM 1VFFA 3IAQA 2WCAA 2PI6A 3W82A 3GNRA 3MUIA 1EHAA 4FLRA 3AS2A 3VGDA 4F79A 4PMNA 1UWRA 3W53A 4BA0A 1E5NA 1J18A 4JKMA 3VM5A 3CMJA 3ZJ7A 1UWUA 4PTVA 1XH2A 3CMGA 1CLXA 1UD6A 2NT0A 1TR1A 1AMYA 1VEMA 4UQCA 3ZIZA 3VIHA 3KE0A 3ZT6A 5AC4A 1JF6A 1UR4A 3DYMA 2EPLX 1C8XA 5I5RA 3U5UA 5I3DA 1MVYA 5A95A 1E56A 1UKPA 2J62A 4AXNA 4EANA 4F8XA 4HA1A 2NT1A 2PF0A 3AHZA 3LPOA 3AHXA 2XSBA 2DGAA 3VKKA 1UD8A 5E09A 1W9PA 1QHOA 3NSNA 2XUCA 3A47A 5D9MA 3MV11 1DWJM 3RM4A 1JI1A 1W2VA 3VD5A 4J3UA 3VDAA 1CXFA 1PX8A 3A4AA 3QHOA 5A6BA 3SCOA 1C8YA 1UKQA 4RE3A 2AAAA 1EDGA 2XGBA 1OT1A 3WF0A 3AFBA 3AS1A 4ML4A 3ZSTA 3W37A 5GNZA 3M7SA 4UNIA 4H7VA 4RL3A 1XH1A 1RP9A 2YJQA 1BFNA 4Q22A 5GNXA 2FH8A 3CHFA 1UH2A 3W81A 5I23A 1JYVA 3WFLA 3ALGA 2XTKA 3CPUA 1E71M 4MDOA 1CENA 1KBKA 3WQ8A 3L4XA 2DPEA 4CD5A 1V3LA 4OZOA 3KWXA 3L2LA 3N13A 1WPCA 4UTFA 1EO7A 1D7FA 2EXOA 1HL8A 5CPTA 4OUEA 2J7FA 4JFVA 2Z1KA 4TOQA 5BRPA 1OM0A 2B31A 1LWHA 2A3AA 1J0YA 3BAJA 4JCLA 5AYIA 3T08A 1WE5A 2VZVA 2BXYA 3MANA 4BQ3A 3IANA 4MNMA 1ZJBA 2G3MA 1MFVA 2CETA 1W1YA 1S46A 1JNDA 1V03A 1CXEA 4DM2A 2BVYA 1U2YA 1C93A 1QOXA 4QLJA 5E9AA 3EDFA 2CBIA 1CXKA 2FH6A 2D3NA 5BWFA 3ZJ6A 3TTOA 4TVCA 1ZBCA 3WH8A 1ZJAA 4W89A 2EEXA 2WSKA 3RJXA 1V0MA 4A4AA 1PBGA 3I3BA 4CKQA 2YLAA 5A8MA 1UD3A 2D1ZA 1V02E 3CUGA 2WHJA 4P8XA 3JUGA 3NYDA 1BAGA 1VIWA 4LGXA 4WKFA 1UA3A 1W91A 2CHOA 1KXVA 2J7CA 3WNOA 4AEEA 2WVVB 3W26A 5LA2A 4D71A 1E43A 2VCCA 3EYPA 2E40A 2XWDA 1XD0A 1AQMA 2VX6A 3BC9A 4AIOA 2YBUA 1WZAA 3FXYA 1RD6A 4E2OA 2V3DA 4CCDA 1W3HA 5I24A 7TAAA 3OZOA 3N18A 2BHUA 5A6LA 5JIWA 3BH4A 3BLKA 5A6MA 1BVNP 3SEPA 4CN1A 4PMUA 2YL5A 2X0YA 4CU7A 2VX4A 2O92A 1OWQA 2XM2A 4PMYA 2WMIB 3PZGA 1DHKA 4A3YA 4KGJA 2PWHA 4AD4A 7CGTA 1KGXA 2VI0A 1TA3A 3VGHA 1AQ0A 1QW8A 1GQJA 1HKMA 1TCMA 5FD0A 2WZHA 4GI8A 2Q8XA 1V08A 2WHMA 2G41A 2Y8VA 1UG6A 5A8NA 5M3WA 1VEOA 2W5FA 3M6DA 3S6TA 4B3KA 1WP6A 4JHOA 3WQ6A 3AIVA 3QHNA 3PZ9A 4QAWA 3TOPA 2XM1A 5CJ5A 3AHVA 1WCGA 5A6JA 5I2UA 3VU2A 2DIJA 1JZ3A 4W85A 4JCMA 2YL9A 4X0NA 2WMJA 1CBGA 4ACYA 3BMWA 3SCPA 1CIUA 1IZJA 1SMAA 4JFWA 4U5IA 2UY3A 3AIQA 1U33A 3M07A 3VGBA 3TTSA 1E4MM 2EQDA 2D24A 5M17A 4CD6A 5ECUA 5HDRA 4P8UA 2UY5A 3OIHA 5CPSA 5CZKA 5ABFB 4PN2A 3U7VA 1OBAA 5ABHA 2XWEA 3CBWA 4CN4A 1NOWA 2VJXA 3AIWA 4B15A 4LYRA 3PZQA 2BHZA 3AMLA 2ZICA 1EIBA 3CTTA 3EMCA 3T0DA 2VQUA 4OBSA 3UCQA 1NH6A 5A2BA 4MB3A 1WO2A 3WIJA 4F9DA 4D72A 5HNNA 2BVTA 4S3KA 2VRKA 2XJ7A 3CIVA 3BXWA 1FH9A 2PBGA 1GPFA 3OLDA 4PMXA 5HBFA 4CU8A 4MADA 5ABFA 1HJUA 1JIBA 1JXKA 4CGTA 3SUWA 3GNOA 2V38A 4LX4A 3AIEA 2WZEA 3VIMA 3QR3A 1OT2A 1E6PA 1KCLA 2V3EA 3VD7A 2D20A 1B2YA 3F5JA 3T2QA 1ZL1A 2CKRA 1HF6A 3ARSA 3VMPA 1HNYA 4UFHA 1M03A 1Q6DA 4GQQA 3WKZA 1CGWA 8A3HA 2EPMX 1C92A 4CCEA 2VQTA 1XC6A 5E0FA 2J4GA 2CXGA 4JAWA 1JDAA 4GZIA 5M5DA 3WF3A 2VR5A 1UD2A 1QI5A 3T09A 3G6MA 2WHKA 4J3TA 3GXFA 2UY2A 7A3HA 3ALFA 4GKLA 3VUPA 3UETA 4AZHA 2WNWA 4CN6A 1GOMA 4D6CA 2Y2WA 3OLIA 2E8ZA 1HP5A 1BHGA 1E4IA 4A3HA 4HMDA 4JZ5A 1UWQA 4WIWA 1UA7A 5FIPA 1G0CA 4DM1A 1ZBKA 1QNSA 1RP8A 4AZIA 3PZVA 1WDSA 4KH2A 1BQCA 2GFTA 2VVSA 1H5VA 3AIBA 1E5JA 1YHTA 4GO8A 3QGVA 3VIFA 2DSKA 2WMKA 4WKAA 4QCFA 4PYSA 1UHVA 3GZAA 3AHTA 3PHAA 5CG0A 3POHA 6CGTA 4JKKA 1ISZA 2DT2A 2WVUA 5AY7A 1GUVA 1NP2A 4M29A 2WC7A 4BQ2A 2VVNA 1CNVA 3W25A 5E70A 5A6AA 5HXMA 1WZKA 4W86A 1ISWA 3U5YA 5CLWA 3BAYA 4EK7A 4R5EA 2YIHA 2ZUMA 5JBDA 2YDSA 1H4PA 1V3HA 2X09A 3KL3A 4M81A 3PTKA 1W1VA 2J7DA 1DWHM 1HT6A 5CGTA 3AS3A 1QHZA 4M82A 3AIRA 1JG9A 1GZJA 3RO8A 4WK9A 2G3NA 2XFRA 1H0IA 1PZ3A 4JFSA 2W91A 3O6AA 1B3YA 3BMVA 2PC8A 4LXFA 2V3GA 1J9YA 4JL1A 2DH3A 4AISA 3AICA 3VIGA 2MANA 4E8DA 1YQ2A 3THDA 5DEZA 1DP0A 1J0IA 2WLZA 3TP4A 1XV8A 3ARWA 2YA2A 3FAXA 3VTRA 4UFJA 4P7QA 2O9OA 1X6LA 2WLYA 1FHDA 4PMQA 1GOOA 2C0HA 1E6QM 2AMGA 2WCSA 3BAXA 1IZKA 2GJPA 3WQ5A 1EA9C 2YLLA 4PMZA 3W28A 5BYWA 3MMUA 3ZT5A 1BLIA 3WQ4A 1VJSA 2XVKA 4DUVA 3AISA 1KQZA 2WMIA 4CD7A 1CYGA 1XSIA 2YOCA 4BCEA 1JDDA 2OLHA 1DEDA 3N17A 1F4AA 3FW6A 3WD1A 4UOZA 5A6KA 4HOXA 3VILA 3WDIA 2XVLA 2ZXDA 2X1IA 4J28A 1PPIA 3ZM8A 3WMCA 5CGMA 2CKSA 3MSDA 3BCDA 1X6NA 4PBGA 4XB3A 4K68A 4AW7A 3GYCA 3IAPA 4ZXOA 3HU7A 4JHZA 1OCQA 4C7GA 2EJ1A 1LF1A 4MAZA 2EPOA 1E70M 2E9MA 2EPKX 2QF8A 4XZBA 4LPCA 1DWIM 1KXTA 4GI9A 5HPOA 3APGA 1L8NA 1QVBA 4QLLA 5I78A 1WZLA 4GINA 2PWGA 4D6FA 1OB0A 3QOKA 3WEOA 1UZ4A 4MTVA 2A3EA 3VMOA 3EMQA 4PMRA 4TTGA 1I1XA 3QOMA 3MU7A 1CDGA 3U57A 3TA9A 2FHBA 2VCAA 1KFWA 1B3WA 2FGLA 4LYPA 3WNPA 2BY2A 4HOWA 5ABEA 2WAGA 4HA3A 4GPNA 4U2YA 2BXZA 3L4WA 3E1F1 5E6ZA 3HJEA 5IXEA 3WUEA 1H09A 2Y24A 1D3CA 3A6OA 3NJ3A 1HJVA 4J27A 3K8KA 5A8PA 3BSGA 2CPUA 3KZSA 1GJUA 2ZXAA 4N42A 3TONA 5LA0A 2VR4A 1W1TA 4P7OA 3G6LA 5I79A 2A3HA 4D1JA 4X0VA 4B3LA 2VUYA 3ARZA 2PWFA 5E6YA 1IT0A 1V6XA 2F61A 4M56A 1H11A 4WSJA 4AC1X 5A2CA 3WF2A 1HIZA 4PCSA 2WB5A 2PWDA 3AJ7A 3CZLA 5C8BB 1MQQA 3ARTA 1HKIA 1UWIA 2E4TA 2XFFA 1NWTA 3AMGA 3EDJA 4YHGA 2BHYA 5JBFA 4H8UA 3IJ7A 1US2A 4J3VA 4MDPA 3WN6A 1J10A 3WDJA 3WMSA 1J0JA 4AY1A 5AC5A 1JZ6A 1VENA 2WVTA 8CGTA 1ZU8A 2WANA 2ZOXA 4HPGA 2ZWYA 5JUVA 4JIEA 6A3HA 2A3CA 1I75A 1CGUA 3SCQA 2AOSA 3WNLA 4CD4A 3WL0A 2QPUA 1BSIA 2WM0A 4QLKA 3VMNA 5DT5A 2QHAA 1R87A 3BCFA 2J74A 1W9VA 1UQYA 5CPQA 2X05A 4UQBA 2VZTA 4BS0A 1UKTA 2BY1A 4EAMA 4CVUA 3ECQA 4ATDA 3CUJA 5BXPA 4Z2GA 1D2KA 1TVNA 3SUUA 4L4PA 3NUKA 1ITCA 2CESA 2JIWA 3CZEA 3CH9A 1FA2A 1ISVA 1UR8A 2BVDA 1BYAA 2WXDM 1FHLA 1LG1A 3K8LA 3CUIA 1UR2A 4W8AA 2WVSA 4XX6A 2W63A 2ESCA 4UZSA 2X0HA 2ZE0A 1SMDA 2VZUA 1MWOA 2WWDA 3VIKA 1DWGM 1G94A 3ZR6A 2WC3A 5DFAA 4W88A 4AEFA 1GHRA 2WVVA 2WBKA 2W67A 1O6IA 5D4YA 2J77A 1EQPA 4NRRA 4OIFA 3VIOA 5EFFA 1NWUA 4W8BA 3ARUA 1LLOA 1UUQA 1CTNA 4AZBA 4ACZB 1FP9A 4TUFA 1QNOA 1E1EA 5FOOA 2XFYA 3CO4A 3OLEA 1AVAA 2W92A 2WBGA 3I3DA 2ZX8A 2YA1A 1VRXA 4PMDA 4M80A 2GK1B 1NWSA 4FLSA 3AZTA 3T2PA 1KB3A 4XV0A 3SUTA 3FHQA 3L2MA 3WD2A 4AMCA 4DWSA 1DTUA 3UR7A 2JALA 3D5HA 4HZ6A 1UKOA 2ZX7A 3RCNA 5DO8A 1RH9A 4MNJA 1UD5A 1B3VA 3ARXA 1FOBA 3WBEA 4TX8A 2YBTA 1E9LA 3VGGA 1E4NA 2EO7A 3VDHA 3W0KA 4P8WA 2PWEA 1XRVA 1TG7A 2E0PA 1N82A 2W62A 2DEPA 2YDRA 4PCTA 2DSUA 1O7AA 1MXGA 1GW1A 1ZB5A 2EBNA 3VX0A 1KBBA 5DF0A 2J8GA 4PSPA 1C8QA 4F66A 1NM9A 1C91A 2CBVA 3OA5A 1ITXA 3TTQA 1E0VA 4YHEA 2O9PA 5A94A 2JEQA 2FDMA 2XGIA 1H1NA 4Y7EA 2VT0A 1JAKA 3OLGA 2CITA 1OSEA 3A4WA 4CD8A 1NWRA 5BXSA 2ZUWA 4NSBA 2WZIA 2YKKA 2XSAA 1VBUA 3VD9A 1Q4NX 3BLPX 4CU6A 3WSUA 5A6SA 2VZOA 2BY0A 3L4UA 1OD8A 2J7GA 1UR1A 3WNNA 1KCKA 1BG9A 4UCFA 2IXVA 3K8MA 2XHYA 3HMCA 4QCEA 1JYNA 4FMVA 2F8QA 3U7BA 1OIMA 4CCCA 1ZS2A 3VVGA 4AZCB 3WH5A 4URIA 2WHLA 1UR0A 3D3AA 3GH4A 1V3IA 2RGLA 3W6MA 2CEQA 1MQRA 3RIKA 1Z32X 1GONA 1M7XA 4BF7A 1OGBA 1GQKA 3GM8A 1R7AA 2GDVA 3MS8A 4UOJA 2O9RA 5HOSA 2BY3A 2VRJA 1PIFA 2XVNA 1UWTA 4AZCA 1HJXA 5C70A 4DUXA 1EXPA 2GJRA 3DECA 5FCZA 3WDQA 3PZNA 3RDKA 9CGTA 3OBAA 3PTMA 4IM4A 2DT3A 4UFIA 5ABGA 1XCXA 4IISA 3I3EA 4UQAA 1H0GA 2C8NA 5JBEA 1PAMA 3RMEA 2V5CA 2G3JA 1FP8A 1E40A 3RM9A 2OWXA 1Y7VA 3AXIA 4NF7A 2VRQA 1E6RA 1E15A 2WMGA 1JXJA 1B30A 1LL6A 3MMWA 1HJQA 3DC0A 2O9TA 3SCUA 4BZYA 2VZSA 3OB8A 4FLQA 1VAHA 1QW9A 3SIMA 4DUWA 4UQ9A 5C71A 1R7OA 2IXUA 3AMKA 3EDEA 1UWSA 3L4VA 4V2XA 4AZ5A 3VX1A 4U31A 3ARRA 2Z1SA 3B9DA 1VF8A 3VPLA 3RILA 4Z2JA 4UR9A 3CGTA 2XYLA 4C7DA 3BGAA 5LA1A 1VB9A 3GNPA 2JE8A 3CUFA 4U2ZA 1HXJA 1PX3A 2DH2A 1GCYA 4AIEA 4FLOA 5E0CA 1QI2A 2DT1A 5CQ1A 1E55A 2EPNA 1US3A 3GH7A 1EOKA 3N11A 3ZJ8A 4AD5A 3WD4A 3SCTA 4KRTA 3BAKA 4W93A 4OOZA 4FK9A 5HPCA 4W7WA 4ZXLA 4MNKA 1BGAA 4WF7A 1HVQA 1E1FA 1RPKA 2ZUVA 5A6BD 2E3ZA 4M24A 2UWFA 3THCA 4PEEA 1OGGA 2JF6A 1OGSA 4C7FA 2VC9A 1AQHA 3WDPP 1JFHA 3MO4A 5IHRA 1KXQA 3W29A 5I77A 1Q6GA 3B9EA 3WY1A 1OIFA 1B90A 2ZX6A 3VM7A 5A69A 3MUZ1 2Y8KA 2BS9A 3N12A 3T0AA 4UFLA 5TD4A 5DMYA 1CWYA 1C90A 3PZIA 4D6IA 1W1PA 5FKYA 3WFZA 1ISYA 3GBDA 1XSKA 1JDCA 4P7LA 4ZE5A 3W6LA 1H2JA 1A47A 4H2CA 3GXDA 1DWAM 1Q6CA 4ACZA 2XPKA 4BQ4A 3DYOA 5EBAA 4HMEA 3VNZA 4OJYA 1V3KA 3AMDA 3NDYA 3ARQA 1C7SA 4CVWA 2NW0A 1W9DM 2ZUTA 2OSYA 1VFUA 3IJ9A 5A8OA 5A1AA 3PZMA 2NSXA 2TAAA 1E0XA 1NARA 2WC4A 4H04A 1F4HA 3ZSSA 3ZOAA 3UERA 4W5UA 3J7HA 4NI3A 3A4XA 4HP5A 2W66A 3SCSA 4D6DA 5FL0A 3WENA 3DHUA 5I6SA 3WD0A 2WMFA 3MUAA 1GORA 1KQYA 2GSJA 2XG9A 2ZUSA 1QNPA 2J8FA 2D23A 2OSXA 3AMCA 1GQIA 1HJSA 1KGWA 1QPKA 2DT0A 1KWKA 3NSMA 4J3WA 4D6GA 3W38A 3PZOA 4DWSD 3AXHA 3CLWA 1J11A 3SUVA 4H8HA 1ISXA 1WZMA 1HJWA 1V6WA 1P6WA 4RE4A 3WH6A 3WL1A 1BPLB 1TVPA 3OG2A 5GNYA 1L0PA 1V0NA 1HVXA 4WJXA 2D22A 2J47A 3KL0A 3K1DA 4MJ4A 1E6ZA 4HU0A 3CZJA 4Z2IA 2DSWA 5A8QA 1ZBVA 1UH3A 4ZEPA 5A3HA 3EDDA 3CZGA 1BF2A 3RM8A 3A3HA 4KRUA 2D2OA 4OBRA 3HN3A 1GOKA 1ESWA 2J79A 5FL1A 1W3LA 3VOCA 3K4AA 1UD4A 4J7RA 4HU8A 1CPUA 4GZJA 2WKGA 4UQEA 3GDBA 4HZ8A 4Z2KA 5I0DA 4P7RA 4M8UA 1HKJA 1B3XA 1XH0A 1QI0A 3N1AA 2XVGA 1SR0A 1JZ8A 2YL8A 2G8ZA 4V27A 2QLYA 1KXHA 2DSVA 3SCNA 1JAEA 1XSJA 4AYSA 3EBVA 2CBUA 3GH5A 1W3KA 2WWCA 1LWJA 4CUCA 2RGMA 2CBJA 1WKYA 1FH7A 1JD7A 1JYWA 1CECA 1TUXA 1HL9A 1UYQA 2UY4A 3W24A 3VD4A 2ZUUA 2WW5A 2JEPA 4Z2HA 3WUGA 2OSWA 5CXPA 4JKLA 1HP4A 1VFMA 3WDHA 1LL4A 2ZIDA 3F5LA 4NRSA 2Y5EA 4KMQA 3OGSA 1MYRA 5JIPA 3WELA 4HMCA 4J3XA 1JNEA 3AROA 1G5AA 2DIEA 4QP0A 3BAIA 5D9NA 2WK2A 4RE2A 3N9KA 1UH4A 1JZ2A 4H8VA 1B0IA 1E3ZA 2J7HA 3AI0A 3UG3A 1XYFA 1E6NA 3FN9A 1MFUA 2QPSA 3VGEA 3MKKA 1WDRA 1DWFM 1FFQA 4GXPA 5GPRA 5D8ZA 1W9BM 1W32A 3O2LA 2IUZA 5BXRA 2J25A 4U33A 4HZ7A 3AYRA 1JZ5A 1J12A 1NOUA 3IK2A 2A3BA 2E8YA 2ZUNA 1CXIA 2GJXA 1E0WA 1LG2A 1GOWA 4V28A 1V3JA 3T0BA 4X9YA 4U5KA 4ZE4A 3II1A 1BVZA 1NQ6A 2X2YA 1EOMA 2V3FA 4B16A 1V02A 3VO0A 1CZ1A 3SUSA 3VGFA 2CIPA 2PB1A 3AQUA 4XUYA 4W87A 2OYLA 4AZ7A 3S2CA 3ZT7A 2FHFA 2ZX5A 2D3LA 2HISA 3EMZA 4ATLA 3POCA 2OWWA 3WDRA 4D6JA 2J78A 3AYSA 4B9YA 4D1IA 5M03A 1QBAA 1QHPA 3SCVA 3PZTA 4PTMA 5IFPA 3WMBA 5BXTA 4MB4A 1H41A 1HN1A 2ZWZA 1E3XA 3GBEA 5EFDA 2X8RA 1EQCA 3CZ8A 2E9LA 4W7UA 3PZUA 4U3CA 3AXXA 4GO9A 3WEMA 1XYZA 5EMYA 1LJYA 1CGYA 3AHYA 3PTQA 3M46A 4TVUA 4HOZA 1H49A 3WNKA 1KWGA 4OOUA 1EDQA 1V6UA 5BCAA 3NSXA 4F9JA 4PMVA 1MW0A 1PEZA 3VIPA 1W3JA 5CLTA 1R8LA 1R86A 3KEHA 1B9ZA 4U3AA 1K9EA 4WKHA 4IPLA 1KGUA 3IJ8A 1GHSA 1M01A 4GQRA 1MQPA 3L4YA 3WQWA 3N04A 3NCOA 4PMOA 3UG4A 1CXHA 3FNDA 3VIJA 1JD9A 3O9NA 3WBAA 4L4OA 3RPMA 1BYBA 4DWSB 3WNMA 1B3ZA 3ARYA 3GTNA 5BRQA 3ARVA 4LYQA 4PUDA 1ODZA 1EH9A 1SYTA 2WPGA 1UOKA 1PIGA 2J7EA 2ZXBA 4WSKA 3ZMRA 1WDQA 5AYBA 3L4ZA 4NZCA 1LL7A 3OGRA 4PRWA 4Q7NA 1A3HA 4B9ZA 1M53A 3PBGA 4OKDA 1MW3A 2J7BA 5A2AA 1X1NA 3EDKA 1GOIA 1TA3B 2JIEA 1ODUA 2FGZA 4AD2A 4Z2LA 3KL5A 4D6HA 3SCRA 4AD1A 3ZR5A 1IV8A 1VFOA 1TZ7A 1GJWA 3WD3A 4KWUA 1VJZA 2XIIA 4ATWA 5KZ6A 3W27A 1NP0A 3OZPA 4IUGA 4P8VA 1QI4A 3GXIA 1EHNA 4MB1A 1MW2A 2FHCA 2Y4SA 4D6EA 3UEQA 1VBRA 4TXEA 1E72M 4W8LA 2DDXA 3UG5A 3TTYA 2D0GA 2GVYA 3N15A 1K6AA 1JFXA 2BNJA 3VNYA 2DQXA 3MSGA 1W9UA 1BYDA 3AZSA 2CERA 3UESA 1E4LA 4LQ1A 4P7NA 1EDTA 1QNQA 4ZENA 3WF1A 3VINA 1C7TA 3ARPA 1CGVA 1FFRA 1G9HA 4YPJA 1U30A 3BSHA 4E8CA 3F5KA 1JZ4A 1JF5A 4AIUA 2PBOA 4XZWA 3MV01 3MMDA 1UR9A 2CCRA 4MJ2A 4EE9A 2YL6A 1CGTA 1TMQA 4UQDA 2WMHA 3VDBA 1TFVA 2C7FA 1EO5A 4MPKA 3NDZA 1W2PA 1J01A 3FAWA 2BV9A 2WKLA 2VX5A 2WSPA 1K9DA 2VX7A 1JYXA 1G1YA 5LYRA 1K9FA 3PN8A 2OYKA 3AS0A 2YA0A 3CUHA 4TTUA 4JL2A 3BAWA 1V6YA 3CHDA 4M1RA 1C3FA 1ZBWA 5D9OA 5F7UA 3K4DA 1B1YA 1UQZA 1WDPA 4AD0A 2E9BA 1M04A 2J75A 3CZKA 4MB5A 4GI6A 1OINA 2CYGA 2XVPA 4W5ZA 1CLVA 1QI3A 1GVIA 5CSUA 3WUFA 5GQBA 1E6XM 1BTCA 2QMKA 4S3JA 1JGIA 1LQ0A 3UR8A 1V0LA 3W4RA 1NOFA 3SURA 2JFEX 3WF4A 4ZFMA 1K9TA 4PTWA 4MAVA 2VOTA 4EKJA 1J0KA 4IPNB 4YN5A 2XIBA 4HTYA 4DWSC 3WEZA 4AWEA 4PTXA 5CSYA 4J3SA 2GJXB 1E73M 1FH8A 3T2OA 5IDIA 2F2HA 2QMJA 4H41A 4PUEA 1XCWA 1MXDA 1J0ZA 3ZQ9A 2V5DA 1W9XA 1JZ7A 3LPGA 4UZUA 1XD1A 4AZ6A 4HA4A 4GZEA 1TE1A 2VMFA 1VEPA 3ZO9A 3F4VA 2CNCA 2BFGA 2W61A 2VL4A 3DHPA 3FHAA 1Q6FA 3B8SA 1QBBA 3SCWA 2YDQA 3FY1A 4BQ5A 1XGZA 3ZJKA 5BROA 1BGGA 4WLCA 4AZGA 1B31A 1V3MA 5EB8A 3CHCA 3VD3A 2WCGA 3MUY1 2OYMA 2VO5A 3CHEA 1JL8A 3RJYA 1MW1A 3LMYA 5KEZA 2VNCA 3K46A 1EGZA 1WNOA 5DT7A 1BG4A 4UOQA 1HX0A 1CGXA 2GK1A 3L4TA 1PZ2A 3LPPA 2GUYA 5D9PA 5D8WA 3WH9A 2ZX9A 3GXMA 2VTFA 3AZRA 3WQVA 5IHSA 2GDUA 2G3IA 2ZXQA 4JFTA 1I1WA 1QNRA 3AOFA 1XHGA 2CHNA 3OGVA 1J0HA 5IFTA 4KGLA 4HPHA 4W7VA 1KR1A 2HVMA 4QDMA 4W84A 3QHMA 1SFSA 1CEOA 3B9AA 2G4FA 2JF7A 3VIIA 1CXLA 1GVYA 2WYSA 3NIYA 3DYPA 1Q6EA 1UZ1A 4E4PA 1BYCA 4QFUA 1OD0A 1GNXA 4AD3A 1WAWA 2D0FA 4N0RA 1HKKA 1R85A 2W4XA 1G01A 2DSZA 3AIUA 4UFMA 4FF5A 4UFKA 1V6VA 4GIAA 1PX4A 4PSRA 4TVDA 2VCBA 1UKSA 2D0HA 1V0KA 4R27A 1KR0A 4JFUA 1WB0A 1GQLA 1PJ9A 2OWCA 2VURA 3WUBA
chains in the Genus database with same CATH superfamily
3W23A 1MNZA 1ECEA 3H21A 5HWNA 6TAAA 4LANA 1U5VA 3LXBA 3IAQA 2WCAA 2PI6A 4EWJA 3GNRA 1HW6A 3DHDA 4FLRA 4IIBA 1YDVA 1CX9A 3OU8A 3N2TA 1OFQA 1WYIA 3NQFA 4PMNA 3L68A 4TMBA 3QJAA 3D46A 3CMGA 1UD6A 1T40A 1AMYA 1YRRA 3KRSA 1VEMA 4MGGA 1XUZA 2QIIA 3KE0A 3ZT6A 3TJLA 5AC4A 1JF6A 1UR4A 3E2QA 4G5DA 5TBOA 1E0UA 3U5UA 2R6OA 8XIAA 1MVYA 5A95A 3DOPA 3W85A 3GFYA 1IEWA 4DJEC 4EVZA 4CEUC 3LPOA 2DGAA 1FCBA 3SRHA 1UD8A 3NSNA 3A47A 3BARA 3CT7A 1FWJC 5FA5A 4LOCA 4O1EA 4IT1A 4J3UA 3ABZA 3BO9A 3DKJA 2HDJA 1LT8A 3W87A 3IRSA 3CQ0A 2AAAA 2XGBA 3WF0A 4NU7A 2Z25A 1NEYA 3ZSTA 1DXIA 3O05A 4LV9A 1S5MA 1MI3A 3KHJA 3N9SA 3A9IA 2C0AA 3SFWA 1G69A 2Q8ZA 5JXQA 1DKWA 2L5HA 4AYGA 3WQDA 1UH2A 5I23A 1DJXA 2R8WA 2PCQA 1KKOA 3ABQA 1VP5A 3LSCA 3W2UA 4RW5A 3ALGA 3DXIA 4MDOA 3S9YA 4BF9A 3TH6A 4CD5A 3HQPA 2H8ZA 2EXOA 3S5ZA 1OFRA 1UP2A 3KHDA 4RNJA 4WDUA 4MZ1A 2QF7A 2A3AA 4JCLA 2BXYA 3MANA 4GVGA 3TR2A 1XLIA 3N73A 1XLJA 2G3MA 1XC4A 3L5LA 4JOMA 5E1QA 1S46A 1JNDA 3IGXA 3B40A 4DM2A 2BVYA 2QEZA 1C93A 1GVOA 5TIMA 3IEBA 2AGKA 2PDUA 1CXKA 4NQ1A 1VH7A 5I7GA 4ONVA 1PB0A 1R9YA 3ZJ6A 4TVCA 2IS7A 1ZBCA 3WH8A 1XPYA 2WSKA 3RJXA 2FJUB 4A4AA 3S8HA 4AC7C 1C29A 1A5BA 3PUGA 3EXTA 3A9BA 1V02E 3CUGA 3NYDA 1YE6A 4Q7BA 4IJBA 4YTQA 4F40A 2P10A 4WKFA 4YTTA 1TSIA 4AEEA 2WVVB 2NXHA 1NSJA 5CBBA 3UCDA 2VCCA 3EYPA 1S3TC 3E74A 2XWDA 3ZS4A 3H2OA 4AIOA 2FPTA 3CU2A 7PTDA 3VDGA 1SFJA 1LT7A 5K7JA 4C6QA 3A5FA 2INEA 1YW1A 4CCDA 3U4AA 5JIWA 3PC0A 3BH4A 3BLKA 4MUZA 3WQPA 2CLMA 4WZHA 4PMUA 3PNUA 3QZEA 4H6QA 4QDPA 2VX4A 4ECLA 1OWQA 2XM2A 4PMYA 3E0VA 1DHKA 4U4MA 1FDJA 2PWHA 3T44A 4AD4A 2BX7A 1KGXA 2VI0A 4LUSB 3VGHA 1AQ0A 2R82A 4W9TA 3ZR4A 2JQXA 3OZMA 3LQGA 1V08A 2PP3A 3GUGA 2BOGX 5CG7A 1UG6A 4H6KA 5C0QA 5CKSA 1H1YA 5AFDA 3M6DA 2XZ7A 2DU2A 1UPMB 5AYYA 4JEQA 4K2SA 3BOXA 2GJLA 2GPTA 3AIVA 2GL5A 3PZ9A 3TOPA 1KFJA 3HIJA 1WCGA 5I3HA 3V75A 5A6JA 1XLGA 2DIJA 2YW4A 1JZ3A 4W85A 4I7VA 5CAHA 1JPIA 4ACYA 3BMWA 1VPYA 4HSOA 1CIUA 3PBVA 1LUCB 2W3ZA 2PDMA 3C0JA 2TRSA 2UY3A 3VOGA 3UXAA 1FXQA 3CWNA 1KCXA 4OUIA 4KBXA 3GXTA 3URQA 2NWSA 2RDTA 4GK8A 1YTEA 3QM3A 1JULA 5DN1A 1US0A 3OIHA 4HU3A 1J6OA 2YDAA 3FCPA 5CPSA 5CZKA 5ABFB 1OBAA 2Z26A 4JIPA 2VJXA 4L9ZA 4B15A 2HSAA 3VOHA 3AMLA 5DMLA 5JH2A 2TMDA 3MWAA 3T0DA 2LLEA 2WSRA 1V79A 3DGRA 3VC5A 1A0CA 1WO2A 1X1ZA 3W7QA 3T1GA 2DZUA 2HE8A 3H2NA 3CIVA 1FH9A 1BKSA 1UIOA 3TCSA 1EZWA 2NV9A 1HJUA 4GYJA 1JIBA 3QH2A 1B4EA 3GNOA 2OKTA 4L1XA 2C6QA 3AIEA 2WZEA 3DN5A 3VIMA 3GW3A 1B2YA 3F5JA 3Q4DA 3BLEA 3IJQA 3VCRA 3T07A 1Q6DA 4I9MA 1WKFA 8A3HA 2PGEA 1Q8AA 2QVHA 3W2KA 2NV2A 1C92A 4CCEA 3MHGA 4JD4A 1J5TA 3RX4A 4MG4A 4UR7A 2VR5A 3MT1A 1UD2A 2ZZ4A 1QI5A 1SW7A 3G6MA 3STEA 3GXFA 1H62A 1BD0A 2IMRA 2PDNA 4IHCA 3CV2A 4GCAA 3ALFA 3LMZA 3NZPA 2WNWA 4D6CA 2E6YA 2E8ZA 1BHGA 1E4IA 3RK8A 3PZVA 1WDSA 4KH2A 1BQCA 2GFTA 3KDOA 3AIBA 1E5JA 4GO8A 4OV9A 3WO8A 4WKAA 4QCFA 3NXFA 1L2UA 5CG0A 4Q4QA 1Q13A 3O3RA 3P84A 1VFLA 1ISZA 1T96A 2DT2A 3HOJA 4DBUA 5LIXX 1GUVA 4MLRA 5FI8A 1EX5A 3HJZA 3A64A 1DJGA 2VVNA 3W25A 4UXDA 1KBJA 3H6OA 4W86A 3SGUA 1UMLA 3AWOA 1NY1A 2F7FA 3GYEA 4JBRA 1RD5A 3HPAA 1V3HA 2X09A 1F3WA 3TZFA 4LVBA 4M81A 2GVEA 1W1VA 4JQ4A 4R7WA 1DWHM 1GVQA 2PLCA 3QW4B 3TQVA 4WK9A 4PCPA 1XIEA 4NP7A 3H7UA 4DJFC 2G3FA 3BMVA 1I2PA 2J13A 3TAOA 1O1HA 4JL1A 3KBSA 4LW7A 3VIGA 2MANA 4M6PA 5LHEA 2VELA 5DEZA 3RUBL 3MDWA 3S0CA 2YA2A 3FAXA 3VTRA 5KZDA 4FOJA 3ES8A 2WLYA 4PMQA 1W1B1 2AMGA 3C86A 1R3TA 4YYFA 3GG0A 3WQ5A 4FA3A 3DZ1A 1EA9C 1S5NA 3W28A 3QY8A 2X1UA 2RJHA 3AISA 2WMIA 1U22A 1E1CB 1XSIA 1UROA 1M3UA 1UJQA 3S1GA 3EWWA 1A80A 1W3NA 4UOZA 3LOTA 3F7JA 4HOXA 1F07A 3NGJA 3MP3A 4J28A 1S3HA 3MSDA 4PBGA 2CLIA 5DMMA 4AW7A 3IAPA 3M41A 1S2WA 1I45A 4MAZA 2EPOA 2E6FA 3V7PA 3NPWA 4GRSA 4Q33A 3P3BA 1L8NA 5D03A 5C9RA 4QJ1A 2PDFA 3MPGA 1UZ4A 2A3EA 5ABTA 4PMRA 3AYVA 1YPXA 3MU7A 3U57A 3QYQA 2FGLA 4LYPA 2VR2A 4HOWA 3RU6A 3BQ6A 3BLIA 4HHPA 1LRTA 3B4YA 1D3CA 1H51A 4G56A 4J27A 3DX5A 3K8KA 4GYFA 4RE0A 6REQA 4LAOA 2YCLB 2JGQA 3F2DA 1DE5A 2QQ6A 3OHMB 4YNGA 3TONA 3ZFHA 4ZB5A 1PV8A 1W5NA 3G6LA 5I79A 2A3HA 1KCZA 4KEMA 4PB5A 3QQ0A 3ARZA 5E6YA 1A5KC 2EJAA 3UZJA 4LB4A 3P8JA 1WXJA 2E77A 3USZA 2PAJA 4H7ZA 3RF9A 1DJWA 4HBKA 3WF2A 4PCSA 5C8BB 4HSHA 1MQQA 1L6SA 2NXIA 1UWIA 1XGDA 3LI0A 3RFAA 3SRKA 5JBFA 3MJMA 4DLFA 1US2A 1TPUA 1J10A 4A3QA 3GVRA 3WDJA 4EPKA 1J0JA 3VNIA 2P0OA 1JZ6A 2WVTA 5JUVA 2ZWYA 2HTMA 4JIEA 4PA8A 1OCNA 2A3CA 1YADA 3QR0A 5AC8A 5I3GA 5J5DA 3WNLA 4NL1A 3WL0A 4BY3A 1Q2RA 4QLKA 4H83A 3VK5A 4M51A 1LQ2A 5DT5A 1R2TA 1DHPA 2QHAA 2Z7KA 3ANYA 4J5NA 5FEWA 2VWTA 4PUNA 3BCFA 3S6OA 1UBPC 4UC5A 5CPQA 3FKRA 4V1XA 5DXYA 4C6LA 4BS0A 2VP8A 4N4QA 3WLQA 4CVUA 4ATDA 3CUJA 3E5BA 5BXPA 1TVNA 4GACA 1K8ZA 2CESA 3CZEA 3CH9A 1FWWA 2Q02A 1ISVA 5EY5A 4G1KA 1UR8A 4ZVJA 4O8AA 1DV7A 1XX1A 2PDLA 3S2MA 3MBDA 3K8LA 3HQNA 1UR2A 1W8GA 4W8AA 3QPZA 3QSRA 2FZNA 2WVSA 2WZMA 4M6VA 3TOYA 1D8CA 4DJFD 1XLHA 3H55A 2O4QA 4UZSA 1SMDA 2OT0A 4AY7A 3VNJA 4GYPC 3TSDA 4O1CA 2IPJA 3E49A 1G94A 3S42A 4AEFA 1GHRA 2V68A 2W67A 5DANA 4ZZ9A 1OJXA 3TAKA 5D4YA 4IIEA 3TQKA 5EFFA 5CPNA 2DZWA 3HGJA 1UBSA 3ARUA 4NX0A 5HATA 4TUFA 3NNTA 4HNUA 3EWUA 3CO4A 4IIDA 1ZAHA 2W79A 3HPZA 2WBGA 4O16A 4QE4A 3I3DA 2Y89A 4O18A 3ITCA 2NXGA 3NQ2A 3BCJA 1JPMA 2GK1B 1NWSA 3CWHA 1ZRQA 2NVDA 2QUMA 3OYXA 2QS8A 3QMSA 2F2KA 2ZFAA 3FHQA 4HT3A 4G9PA 4AMCA 4HJFA 4JQAA 3UA3A 3D5HA 1UKOA 2V8ZA 2ZX7A 1RH9A 3N4FA 1PKLA 2F9RA 2UZ9A 3INPA 1EWDA 4QEEA 3W0KA 2X16A 2VOMA 2DEPA 2YDRA 3SDOA 3A12A 3SB0A 1ZB5A 4BWLA 4MFEA 4HVXA 2ZDRA 3VX0A 4BI5A 3NO1A 4C6JA 4B2DD 1IQ8A 1ITXA 3TYAA 4Y2WA 4PODA 3TTQA 3TE9A 4ZMGA 3EB2A 4EF9A 2FDMA 2XGIA 1H1NA 3KX6A 2YB4A 1Q4WA 3PBYA 5CSSA 3KVLA 2PRMA 1NF0A 4HNCA 1JAKA 3IIZA 5AHFA 3LCIA 1TPB1 4JTAA 1OSEA 3LLDA 1O68A 3PJUA 4O13A 2ZUWA 2WZIA 3PM6A 2P5NA 4A2SA 4CU6A 4O28A 2GUBA 4L9YA 3L4UA 4RXFA 1OD8A 1KCKA 4GG9A 4UCFA 1XLCA 2CZVA 2XHYA 3HMCA 1D3GA 2FVLA 1VS1A 5KSWA 2P50A 2F8QA 3GU9A 4QIUA 1ZS2A 5EU9A 4HYVA 4AZCB 3IGSA 1VBGA 1Q66A 2WHLA 1UR0A 2Z29A 3CNYA 2RGLA 1G4TA 1MQRA 2I9UA 1Z32X 4UBPC 1OGBA 1CB2A 3GM8A 1EGVA 1TELA 2O9RA 4PFMA 3QC0A 2BY3A 4F2BA 2QCDA 4FNTA 1N8FA 2XVNA 2DFAA 1HJXA 3E0FA 4DUXA 1EXPA 2I56A 3TJIA 3AU2A 9CGTA 3W2JA 2QCCA 2DT3A 1FXPA 4CCZA 5JBEA 1I0DA 4E5TA 2OWXA 1BRLA 3QY7A 1E15A 3MKVA 1JXJA 4MY9A 1LL6A 5C9ZA 3EKGA 3UJFA 4X2PA 4DUWA 2OZTA 5C71A 2ZZ6A 1R7OA 4UTWC 3WLRA 3BLDA 4AZ5A 3OYZA 3SN4A 1K03A 3WK3A 5F1VA 4PUUA 3LHYA 5EPDA 2YXXA 5B7ZA 3GLCA 2HVNA 3QV6A 1FWGC 3V0TA 3BGAA 1XLKA 3GNPA 1TV3A 1PX3A 3ITOA 1GCYA 3U2EA 1MRAA 1LBLA 3GRIA 5CQ1A 2EPNA 1US3A 3GH7A 3OBKA 4ZXLA 1E1FA 1TRIA 4RJEA 1FHVA 1UR3M 1T41A 4GJ1A 5CPOA 1OGGA 4REQA 3QC3A 2JF6A 5C6MA 1KXQA 3CIWA 5HR7A 1Q6GA 3B9EA 1FTXA 2WJFA 3L12A 5DMYA 3G3MA 3VXGA 3RRXA 2ICSA 4D6IA 2KX9A 4KT2A 3NL6A 4DZ5A 1H2JA 1M7OA 1Q45A 6XIMA 4ACZA 4C6FA 4EACA 3CV6A 4WSHA 1TQJA 2IPFA 1J2WA 3WLSA 5J5RA 3B9NA 3QSTA 1W9DM 1A50A 5A8OA 3IJ6A 5A1AA 2R1NA 3TFCA 3PBWA 3ZSSA 3M5XA 3ELFA 1M1BA 5GJNA 3V35A 4NI3A 4D6DA 2GUUA 4Z1CA 4DXVA 5I6SA 3WD0A 1K8XA 1GORA 2XG9A 1QNPA 2OSXA 6XIAA 1QPKA 2DT0A 1KWKA 2BASA 4XAGA 1UZDA 2ZA1A 3W38A 2XN1A 3IIOA 3AXHA 3GSMA 3VZYA 1Z44A 1ISXA 1W37A 4HQVA 4WXZA 1WZMA 1ZAJA 5FF2A 2HS6A 2PTYA 1TVPA 3EEZA 3OG2A 1L0PA 4JN8A 1XIBA 3N19B 3PJXA 1V0NA 4Q4SA 5H2ZA 5HNTA 2V2DA 5D2XA 4A21A 4IG2A 3MVTA 3LHTA 2PODA 3S46A 3S9ZA 4ZEPA 5A3HA 3GFXA 3A3HA 4KRUA 2E7FA 4OBRA 1GOKA 2J79A 4O0KA 3QZAA 4J7RA 1CPUA 5T91A 3BLOA 4R33A 4RX0A 4K39A 4AU0A 1EYWA 4Z2KA 1XLAA 1QPRA 1B3XA 1QI0A 1LLWA 2XH7A 3MQTA 4QSFA 1KXHA 4JICA 3SCNA 3BANA 3BZGA 1XSJA 4OT7A 4NNBA 1ICSA 4AG0A 4FNQA 1WKYA 1JYWA 2Q71A 1Z42A 1TUXA 1HL9A 3IS4A 3WBXA 2OKOA 3VD4A 4KFPA 2DZAA 2WW5A 4FP1A 4JTRA 3KBVA 4Z2HA 4S3EA 1XFCA 3BV4A 2OSWA 5CXPA 2JK2A 2R91A 3A22A 3PUDA 4GWEA 4WD0A 5JIPA 3WELA 1JNEA 4QP0A 1N7KA 4XVEA 3BAIA 2WK2A 5AHLA 1UH4A 1TV2A 1B0IA 3S9IA 3UG3A 1XYFA 3N3TA 2QVNA 3PWAA 4FALA 5DBUA 2YPIA 4KWSA 3VGEA 3MKKA 4FS9A 2HMCA 4ZSUA 1DWFM 2V2HA 4F2UA 5GPRA 3VOJA 1PVNA 3E0WA 2J25A 2Y0FA 4QROA 1NOUA 2A3BA 4KCWA 1KRBC 2KZHA 1XWYA 1GOWA 1L8PA 4U5KA 3SM0A 1GKQA 4ROQA 5IBXA 2X2YA 3O15A 1FWCC 3TJXA 2FJKA 4TV6A 3USBA 1V02A 4GVIA 4ZODA 2PB1A 3AQUA 4W87A 1IWPA 3S2CA 4S2CA 2D3LA 4FNUA 2YFNA 2C91A 4D1IA 1M65A 4GXWA 4DAFA 4NX5A 3R0UA 3PZTA 3HTWA 3PK7A 4PULA 3QZ6A 2FQIA 5BXTA 3GO2A 4Q8TA 5CZ0A 4MB4A 1H41A 2QYGA 3BICA 4XD4A 3Q65A 3GBEA 4QX4A 5CPLA 4C1KA 4XKYA 3PFMA 1JUEA 1JUBA 3B8DA 4N6EA 3UWYA 3F4DA 1LJYA 1UUMA 1CGYA 3UBPC 4HOZA 1KWGA 4QG8A 3ZWTA 4KCVA 3NSXA 3I6RA 3GQYA 4NIRA 4F0HA 4O53A 1Y65A 4DJDA 1RVGA 1GVEA 4NKCA 1XJBA 3TKFA 3KOFA 4LT9A 3GZ3A 2OVLA 3GC4A 4E4FA 3IUDA 2PLMA 3SN0A 4B92A 1IF2A 3FNDA 3VIJA 1FCVA 3RPMA 1S2TA 4ZQCA 3K2GA 3FDGA 1XYMA 3XIMA 2VYOA 1ODZA 3GU1A 1PIGA 4PTDA 3O8AA 3ZMRA 3S5OA 5AYBA 3L4ZA 4CNSA 8XIMA 5LIYX 3JR2A 4FX8A 1A3HA 4RPQA 1L6WA 3O07A 2MNRA 1GOIA 4N6FA 2JIEA 3Q67A 4JTCA 4LAKA 1T99A 3QFWA 3WX7A 2FGBA 1X7IA 5G1MA 3KP1A 4H9MA 1XISA 1GKPA 3Q94A 4LWWA 1KV8A 2ZRYA 1QWGA 1RQEA 3GIQA 3HA1A 4B5VA 1YIXA 4DF0A 4ERIA 3BW3A 2RDXA 1AH4A 4QNEA 1MW2A 3CYJA 4GNJA 4LS2A 4B5TA 4XZHA 3N15A 2BNJA 3ITYA 2VC7A 3E96A 4GUJA 1W9UA 3EX1A 3WK2A 1NQKA 1W3IA 2CERA 4UTJA 1D9EA 4QXIA 4CEXC 2EKGA 3BSHA 4NZ5A 4FXJA 3ATZA 1DE6A 2WSYA 3KCJA 2QJNA 2AL2A 2CCRA 2ZTKA 4MJ2A 5DMNA 4DZHA 3JW7A 4JQ2A 4KFOA 1VHCA 1NVMA 1EO5A 1J01A 3FAWA 2PDGA 2BV9A 4Z42C 3U0HA 5SWUA 1K8CA 3MP4A 4EXAA 4US6A 5LYRA 1K9FA 1I9CB 1I0BA 4JPGA 3NQGA 2IPGA 3QYSA 1J5SA 3FYYA 1PWLA 1LZOA 4WY0A 7TIMA 1V6YA 1OEPA 5D2TA 2NQ9A 1KM0A 4KEUA 5K4ZA 5T8GA 3W3OA 2QIWA 1DIDA 4GY7A 1B1YA 1V77A 4ZOAA 2E9BA 2A1YA 4MB5A 3H26A 2F6XA 2GJNA 1KA9F 2V63A 1OINA 3TYDA 2XVPA 3ERPA 1QI3A 4W5ZA 4EF8A 2INFA 1EBGA 2D2JA 1EJRC 1E6XM 1P43A 1BTCA 1YXYA 3UR8A 1XIHA 2QZRA 3SURA 2PURA 3EX3A 5C7VA 3EX2A 4PTWA 4MAVA 4YL2A 3OQ8A 1IEIA 4AX7A 1F8MA 4DWSC 3WEZA 3DI1A 5CSYA 4MSSA 3O0FA 1KM6A 3ATYA 2ASHA 3SRFA 3T2OA 5IDIA 1PYFA 5HA7A 4R34A 2G5WA 3R2GA 4LF2A 4OVXA 2QMJA 2Z1VA 3LPGA 4UZUA 1XD1A 3LHZA 3BVJA 4GY0A 3UWZA 2VMFA 2BFGA 2VL4A 3TC7A 3PTDA 9XIAA 3ITGA 2YDQA 1QTWA 1XGZA 3ZJKA 4XZIA 3NQ8A 4JTLA 2OB3A 1OYCA 2WCGA 3MUY1 3BE7A 2J24A 3V4BA 1MW1A 4I9JA 2CLKA 3GVQA 4DYEA 2HK0A 4N9DA 1QK2A 3LPPA 2GUYA 1POKA 3GXMA 2VTFA 5HINA 2GDUA 3UYCA 2ZXQA 2GQ3A 2A6LA 2CHNA 3UZYA 4XZNX 2DJLA 3GUWA 3VKCA 4O10A 4HPHA 2VKZG 4QDMA 1GTHA 4W84A 2QJIA 1FWHC 4C1NB 3L7RA 3F4CA 5BW6A 3B9AA 3TMQA 4DBDA 2G4FA 2JF7A 3NL2A 4WY0F 4BF5A 1GVYA 1QCWA 2ON3A 2QR6A 1IXOA 4PUMA 4JYEA 1BYCA 1VJIA 1UOZA 3E12A 2QXWA 1WQ5A 4AD3A 1EFZA 2D0FA 1R85A 1G01A 3AIUA 3G8EA 4UFKA 3EGJA 2PTDA 1PX4A 2Y7DA 5GJPA 1UKSA 2D0HA 4XG1A 1V0KA 2V67A 1P4CA 5CC3A 1VRDA 1TO3A 4JFUA 4US5D 1GQLA 1PJ9A 1I2RA 2F84A 4MNLA 1JI2A 4Y6GA 1H3GA 2PDQA 2Z4GA 4TX6A 3WH7A 1VFFA 4DUOA 1KRMA 4AF0A 4YCPA 3R13A 3BURA 1UWRA 1QMLA 1H63A 3MI6A 3RLGA 5CPMA 1J18A 5BU9A 1ONEA 3VM5A 3CMJA 7ODCA 3FJNA 4G2DA 4AX6A 1S2UA 3DHFA 3R12A 4DYKA 2P76A 3ITVA 1ZCOA 3ZIZA 2OCZA 3VIHA 1UC4A 1TZ9A 1B3OA 3PS7A 5I3JA 5I5RA 4J4KA 5G4EA 1BEUA 4EANA 4WQ6A 1P48A 4HA1A 4F8XA 2D2GA 4ICCX 2NT1A 4JIHA 2QAFA 3NQMA 3PWIA 4F4RA 4FAMA 1SFTA 1W9PA 3TVAA 2XUCA 3QXBA 1FWSA 4R88A 3WQFA 2V9DA 2I17A 3A4AA 3QHOA 2XISA 3SCOA 4HN4A 1VPXA 1RJQA 3AFBA 3AS1A 5H8UA 3W37A 1BXBA 4ZTXA 3V3WA 5K3VA 4H7VA 1RALA 4DBSA 3U2OA 3W1MA 1UC5A 4QSHA 2OQHA 4S3DA 3BSMA 4GUGA 1ICQA 1TR9A 3W81A 1JYVA 3U2ZA 2KAUC 1ZP4A 4S3AA 3U8GA 1SJBA 4WXYA 3CPUA 1E71M 2NV1A 4F0MA 1EP2A 1HO4A 1V3LA 3L2LA 1EO7A 1NF7A 1QU4A 1HL8A 4OUEA 1D8WA 1FWBC 5BRPA 4LS1A 2FPVA 3CLMA 5T26A 2RUSA 3VZZA 1VFSA 3KBWA 4MNMA 1P6CA 1ZJBA 4LAMA 3NQ6A 3ZLHA 3C0QA 1FWIC 5JU6A 1QNVA 2QUTA 3DFPA 4QLJA 1ME7A 3EDFA 1ICPA 3HFYA 4ADUA 3SY1A 2D3NA 3LRKA 5I09A 5LHFA 4QS6A 1ZJAA 4W89A 3WQOA 1W3TA 1V0MA 3EWBX 1OHLA 4JYFA 1XRTA 3DI0A 4DXKA 1PBGA 5AYZA 4LV4A 4GJIA 4CKQA 3NQEA 4HK5A 3LN3A 2WHJA 4P8XA 2PDWA 5D38A 4CNNA 3MI2A 4DN1A 4KEZA 1OC5A 1HFBA 3W26A 2ACQA 3I6TA 4D71A 1E43A 4UUIA 2E40A 5HNUA 1XD0A 4QJ4B 2YBUA 1SR9A 3ICJA 2QCNA 3KLKA 1WZAA 3FXYA 2C1GA 3M0VA 1GG0A 4C6CA 4GA8A 4FNRA 5I24A 3OZOA 3N18A 5A6MA 1KNWA 2QUNA 3SEPA 4CN1A 4PBEA 1UMYA 3IVUA 1T8XA 4P61A 3ZVHB 2FZ8A 1TPDA 4PZVA 1FWRA 2CZDA 1QPOA 4J1OA 1QW8A 3SR7A 5FD0A 4NG3A 3YPIA 4JTTA 3W7KA 2WHMA 1FWEC 1PIIA 4Q4OA 2Y8VA 2W5FA 3UVAA 4XIMA 1TRDA 2AQWA 4NI8A 4B3KA 3A4JA 1TWWA 4GE8A 1HUVA 3LTYA 3WQ6A 3B06A 3ZVHA 3AHVA 4WDTA 3LCXA 3G1YA 1W54A 1DIEA 4X0NA 3SO7A 3WJYA 3DFYA 2CWNA 2Z7GA 3SCPA 1ML1A 3ABRA 1SMAA 4JFWA 3MZ2A 3GIYA 3VI2A 5HANA 2VFFA 3AIQA 1TIMA 3CM4A 3M07A 3TTSA 4US5A 4I8YA 2EQDA 4CD6A 2GVGA 2WSQA 7XIMA 3KWSA 2WJZA 2OO6A 3U7VA 1IIGA 4A8IA 2NQHA 3CBWA 3AIWA 4LYRA 4HA0A 2BHZA 1DJHA 5TNVA 3OBEA 2VQUA 5A2BA 4LY8A 6REQB 2P0IA 4LBSA 3WIJA 1XIIA 2BVTA 3VA8A 4S3KA 3UZZA 2XJ7A 2D69A 1QOQA 2PBGA 2HNEA 4CU8A 2VFGA 3RHGA 1JXKA 3G1FA 2V38A 3C2VA 3QR3A 4GVFA 1OT2A 3KBMA 1E6PA 1XYBA 1S5WA 2CKRA 1HF6A 3VMPA 2ATSA 4ZQOA 3EOUA 2BOEX 2F6KA 4LNYA 3WKZA 3LA4A 2ZCGA 2VC6A 2NX9A 1CGWA 4TQTA 3UFYA 3BG3A 1QK0A 3P60A 1XC6A 1GG1A 2R9RA 4RW3A 2EG8A 4Z1DA 1HG3A 2CXGA 4TMCA 1JDAA 3KVKA 3ZVIA 2Y85A 2WJDA 3FOKA 4KCTA 3FS2A 4LCRA 2UY2A 4PR4A 4PB3A 1VBJA 2ZC8A 2NQLA 3FJ4A 2EPHA 4I6VA 1GYMA 4Q4MA 3OTRA 3UGRA 4GKLA 3VUPA 1GOMA 1ZENA 1HP5A 2HROA 5KTLA 3NOEA 1UA7A 3K13A 3M5YA 1QNSA 2VEFA 3N34A 3FVDA 1J79A 3G1AA 3R0DA 2VVSA 5EBUA 3QGVA 3VIFA 1H7WA 4JHMA 2Z1XA 4M5PA 4OFCA 3VE7A 4JKKA 4JX5A 3GHSA 1NP2A 2W27A 2H9AB 3V5FA 7REQA 3TYBA 5E0KA 1CNVA 3S1VA 3TMLA 1DPMA 3W7OA 5A6AA 5HXMA 3KCLA 1NDZA 3N4EA 1ISWA 4JEJA 3U5YA 5CLWA 3MHFA 3BAYA 4EK7A 2B7PA 3CPGA 4Q8OA 2QDHA 3UXLA 3PB0A 1JCLA 4KW2A 5JBDA 2YDSA 1H4PA 3FVMA 3PTKA 1EZ2A 2DW6A 1CLKA 5A6TC 4H9XA 1XLDA 2X7WA 3WFAA 3TQ0A 2ZZ5A 5D09A 4XZMX 2WO5A 4PCNA 3S5YA 4M82A 1K7EA 4L65A 2Q8LA 3RO8A 3NA8A 2HS8A 4IQEA 4LXFA 4QITA 2V3GA 1O60A 2V2CA 3AICA 3PG9A 3TYEA 2XIMA 3KW3A 3DG3A 3TP4A 1XV8A 1VC4A 3C2RA 3NZGA 2QGHA 4UTHA 2ABAA 4WR3A 1Y8BA 1FHDA 1XUUA 4IGMA 4FNSA 3BAXA 3M9YA 3OJGA 2GJPA 5HQEA 5CH9A 2ZE3A 4P2VA 2ZZ7A 4WDWA 3OIXA 2XVKA 4DUVA 2PUZA 3VZXA 3PR2A 3AWNA 3B03A 1TPWA 4QHRA 5KZEA 1DEDA 1XIJA 3TUUA 1F4AA 3VILA 3C3NA 2C18A 4JTHA 1XQLA 2AQOA 3ZM8A 5BRBA 3WMCA 1ITUA 2OEJA 2CKSA 1YPIA 4DWDA 4BJHA 2PZNA 4K68A 2X2GA 4GBDA 3GYCA 1XBXA 4ZXOA 1TJPA 3BJTA 4DZIA 1LF1A 3IVSA 3FYPA 4XZBA 3GX9A 1DWIM 4GI9A 3AYTA 4YJ5A 1ONXA 5HPOA 3DFQA 1TUFA 1W5PA 4GINA 2Y5SA 2VGFA 3FX4A 4AEOA 4X9SA 1RA0A 1DQWA 3R8HA 3VABA 4NVTA 2FVKA 3VMOA 2OZ8A 1TVLA 3E0LA 3NPUA 3QOMA 1EJUC 1R38A 3NWRA 3GAYA 4E8GA 1TPH1 3M5ZA 3E2RA 2A5HA 3HV8A 3H12A 4GPNA 4Q6XA 5EMJA 3DEQA 3L4WA 5E6ZA 3HJEA 2GLKA 3QW3A 1MMFA 3BG5A 9XIMA 3QPEA 1HJVA 4ADSA 1R46A 1KBIA 1AMKA 5A8PA 3P14A 1JPKA 1G4PA 2CPUA 1GJUA 3UXKA 2CLOA 4N42A 5LA0A 4IQLA 4HPNA 4O19A 4X3ZA 3E2SA 5KMYA 2Y7FA 5A8GA 1IT0A 2F61A 4PUWA 3W1TA 1AJ0A 2YCKX 4TV5A 3EB4A 3DG7A 4WSJA 1KFLA 5A2CA 4Z0JA 1HKWA 1GVSA 3KLLA 2DZVA 1REQB 2VDHA 2WB5A 3UQNA 4NJJA 1K4GA 1HKIA 4JY9A 4YHGA 2BHYA 4H8UA 1XYLA 3WMSA 4CNTA 1FWAC 2BWGA 2Z28A 3IRDA 4PL2A 1HL2A 1I75A 1CGUA 5KETA 2AOSA 4GIEA 3LUTA 4RDZA 2QPUA 2WM0A 3N9RA 3VMNA 3CMFA 1R87A 4QISA 4S3BA 1I6NA 2J74A 4E4UA 4AIBA 4ML9A 2X05A 4UQBA 1R6WA 2GOUA 4XISA 1UKTA 1GYNA 4EAMA 1V8EA 3W6YA 3SUUA 1XLFA 4YLWA 4L4PA 4BHYA 1P0KA 1RUSA 2BVDA 1BYAA 1U1UA 1Y5WA 2WXDM 2CXEA 4YWSA 1Q65A 4IJRA 4IP4A 2J9ZA 4WOZA 4JDYA 4C91A 1Q8JA 3W1XA 3G77A 1RK6A 2ZE0A 2VZUA 1MWOA 3T05A 3M47A 1OK4A 4LCSA 6TIMA 4W88A 2WBKA 4C6BA 3RX3A 4QBXA 2QCGA 3QGAC 2FYMA 4KIRA 3T40A 2NLIA 4RLIA 4RXGA 1EQPA 2J9XA 4NRRA 4PRRA 3VIOA 2X1RA 1NWUA 1SW0A 4HKPA 1T5AA 1J6PA 2QW5A 1LLOA 1CTNA 4AZBA 1P0EA 1O5KA 1E1EA 3QMRA 5AHNA 5MF5A 5AECA 2ZX8A 3CO8A 1XS2A 1IE7C 1VRXA 4GX9A 4M80A 4XO6A 1ZGDA 4Q8MA 1LCOA 2CLPA 4FLSA 3AZTA 3GDLA 4QG9A 4D8LA 4IJCA 3L2MA 2ZZ3A 4DWSA 2JALA 4IPJA 4M6QA 1XBZA 3OVQA 5DO8A 3NTYA 1DJIA 1FOBA 1W56A 4J35A 4EXQA 3PULA 3VGGA 3UXDA 2EO7A 3W73A 1S39A 4P8WA 1XRVA 2E0PA 1N82A 3EPMA 1OADA 2BBFA 3EEGA 3EOSA 4PCTA 1O7AA 4ZO7A 2EBNA 1KBBA 2J8GA 1EB3A 3SECA 4F66A 3F4WA 1Q7ZA 1C91A 4MWAA 3NQ7A 1YBQB 1E0VA 4L5ZA 1AD4A 1DJYA 4I9TA 2JEQA 1GVFA 3ABSA 3S1UA 2G4JA 3PAOA 3EKZA 3KUMA 3H2AA 1VYSX 4K37A 4JTDA 4ZBCA 2CITA 5BXSA 4UTTA 4LF1A 3ZZ1A 3CAWA 1XIMA 4CNUA 4V15A 1Q4NX 3BLPX 3ID7A 3MHUA 4O0ZA 1P0BA 1VYPX 2EKCA 4Y8EA 1IT7A 1UR1A 3WNNA 1BG9A 2IXVA 4LYKA 1EF3A 1VD6A 4FMVA 1WUFA 4CCCA 3HURA 4LS0A 1DJZA 1IWAA 3IV3A 5G2IA 1XDLA 4PRTA 3W01A 3SGZA 1TKKA 1LM1A 3W6MA 1WKEA 2CEQA 3MP5A 1GONA 1SVDA 1F2JA 4BF7A 4H19A 3Q37A 1R7AA 1RJRA 3MS8A 2RHGA 4ZO6A 2PTZA 2QULA 2IQTA 2QKFA 1UWTA 2INZA 1NDVA 3UNDA 3DBPA 2GOKA 3PJWA 2GJRA 1YXDA 5HUOA 2ZADA 3WDQA 3PZNA 2G50A 4O11A 2HVOA 4H4IA 4IM4A 2ISVA 4UFIA 1X96A 5ABGA 1PZ0A 3IV8A 3DIPA 4EXBA 4IISA 3I3EA 4DXXA 4LH8A 2HNHA 5IOBA 3NG3A 4NASA 2V5CA 2G3JA 1FP8A 1TCDA 1E40A 4NF7A 3MCMA 3C52A 3RMJA 3QVQA 2PP1A 2WMGA 3DC0A 3B05A 5LIWX 4YMZA 1WUEA 3LGDA 4XIAA 4FLQA 3W84A 4KWVA 3SIMA 3E5PA 1RR2A 4FOKA 2IXUA 3AMKA 1VCFA 3EDEA 2E09A 4V2XA 4Y8FA 3LRLA 4KS0A 3VX1A 3W9ZA 2B0MA 3KM8A 3B9DA 3VPLA 4HK7A 5LGZA 2QDDA 3FYOA 4Z2JA 2FPYA 3CGTA 2ODOA 1EP3A 1S1RA 3UPMA 3T55A 1VB9A 3CUFA 5IBXC 3CASA 1TWIA 4UNKA 3ZJ8A 2POTA 3WD4A 1RPXA 3SCTA 2I9EA 4KRTA 4OOZA 3WZ0E 3GG1A 4W7WA 4WF7A 1U83A 4AXKA 2ZUVA 3QLLA 2UWFA 1MRQA 3THCA 2PS2A 3M4HA 4FIQA 5U4NA 1KV5A 2VC9A 2X0SA 1AQHA 4QR6A 1JFHA 4FF7A 1MEWA 3UWUA 1UWAA 3N6JA 2ZX6A 1DQUA 3VM7A 5A69A 1A5LC 3MUZ1 2Y8KA 2BMBA 4XSLA 3KVMA 5DQPA 4P5UA 4UFLA 1SU5A 3LCFA 1CWYA 3PZIA 3GU2A 1FUYA 5CZJA 2RJGA 1YPFA 3LS9A 1XSKA 1JDCA 4P7LA 5FAGA 3GXDA 1DWAM 4Y9MA 2XPKA 3BLLA 3UGVA 2EGZA 3WLHA 3DYOA 3DFHA 5EBAA 5EYWA 1V3KA 4XO7A 3WQGA 3AMDA 1C7SA 1A5NC 1XLEA 1AD1A 4DZAA 3CPRA 2E28A 1WKDA 1E0XA 1Z8AA 3PPHA 1F4HA 1OFEA 3GR4A 3KRUA 4X2RA 4W5UA 1XGEA 3J7HA 3WJSA 4C6IA 2W66A 2GWNA 5FL0A 3WENA 2J6XA 3DHUA 4JTKA 3MUAA 1KQYA 2GSJA 4QQ3A 2ZUSA 1GQIA 1HJSA 1KGWA 4ENLA 3UF9A 3TIMA 1RK5A 3FEQA 5H91A 4D6GA 2X1SA 3N29A 3W1NA 4DWSD 3T0CA 4NZ1A 3CLWA 4KQNA 1E9YB 5FEPA 4H7CA 5D02A 1V6WA 3R43A 4ORMA 3WL1A 4FR1A 4H6RA 2NZLA 3K1DA 1E6ZA 3BGGA 4XWUA 3IWPA 4E2DA 4R7JA 1S1PA 5A8QA 4GVHA 1W0MA 3T8LA 3EDDA 3UR5A 3CZGA 4W4QA 3RM8A 3PF3A 3HN3A 5FL1A 2Z24A 3VOCA 3K4AA 1UD4A 3VCNA 4HU8A 2MUCA 1TX2A 3GDBA 4HZ8A 5I0DA 4P7RA 1HKJA 1XBYA 5T9CE 5BOEA 3LZ3A 3LM7A 2GZXA 2XVGA 1JZ8A 2B81A 1J93A 2QLYA 3LNPA 4ZOCA 4KKXA 1W3KA 2XFWA 1V7AA 2WWCA 4MMWA 2XN0A 4E38A 2RGMA 2CBJA 3LCHA 2Y88A 1CECA 4GZ7A 5EA9A 4O1AA 1UYQA 1XIGA 3U6WA 2UY4A 4ZOBA 3W24A 2ZUUA 1DBTA 2ZRUA 1VFMA 2FZBA 3SBFA 2ZIDA 1F5ZA 3QR1A 4NRSA 1C9WA 3HMJG 1IXNA 1UPPA 3EAUA 3K30A 1KM5A 5LIUX 3AROA 2DIEA 4LJ3A 5JVLA 3NZ1A 4O57A 1SM9A 4IIHA 5AOUA 9RUBA 3KBJA 1NFPA 4NY2A 3V0SA 3CJPA 1QFEA 1E6NA 3RRAA 5PTDA 2E6DA 2JGYA 3A5VA 2AAMA 3QKEA 4LUJA 3TW9A 1JCTA 1DXEA 5D8ZA 3VNDA 3I7QA 1RJPA 1YLVA 1W32A 2IKJA 4HZ7A 3IK2A 2ZUNA 4J3ZA 5CSRA 4IFKA 1EUAA 1AA1B 5I03A 1TTJA 1LG2A 4V28A 1V3JA 3T0BA 3CT2A 2DZPA 1GKRA 3WK0A 2V3FA 1QPQA 4D8AA 5I06A 1CZ1A 3HBLA 3FLUA 4XUYA 3NO5A 4GYPA 2OYLA 5CC6A 4NAFB 2HISA 3KRZA 4KESA 3MMTA 2OWWA 4L6HA 2FIQA 4CQCA 1NELA 3TSBA 2FVMA 1EC7A 2W0UA 1QHPA 3SCVA 4GQBA 5IFPA 3SJNA 3ISIX 4NXKA 1OC7A 4EWND 1LBMA 2X42A 1E3XA 5EFDA 1EQCA 4DO6A 2XH0A 3CZ8A 2E9LA 4IGHA 2QUUA 3PZUA 4U3CA 4AY8A 3AXXA 4IMEA 3MYPA 1JJKA 3P0WA 3CS2A 3AHYA 4HIBA 2C1HA 1H49A 3O6DA 3WNKA 1EDQA 1V6UA 1HKVA 4XQ6A 2E5CA 1PKNA 4NZ3A 1IEQA 1F7BA 3KEHA 3VE9A 4Z17A 2FZ9A 1KGUA 3IJ8A 1M01A 4LC6A 2QDGA 4MIMA 3H2EA 3NCOA 4OV4A 1JD9A 3W1QA 2PA6A 4R53A 2DUXA 2FFCA 4K7VA 4DWSB 1PWMA 3WNMA 5BRQA 1OX4B 3LX9A 1EPXA 4UTLA 1UOKA 2ZXBA 4JNZA 4WSKA 3UWVA 2JBMA 3PPFA 2WOQA 4NZCA 1K4HA 4Q7NA 4PH6A 2PDCA 3GG7A 3NQAA 3IUHA 1GK8A 2FLIA 5A2AA 3TNBA 3GXNA 5TAOA 2EG6A 2VENA 3TWBA 4HNVA 4WDXA 4AD2A 3KL5A 8TIMA 1VFOA 3T4CA 4ILSA 5KZ6A 3W27A 4WGHA 2HZGA 1H7PA 1YBQA 5CBJA 4IUGA 4WOQA 3CWOX 1VR6A 1W1ZA 5HMFA 5I00A 1EJXC 4DX3A 1EHNA 3IK4A 2FHCA 3LCLA 3UEQA 2RH9A 2E5DA 1VBRA 4TXEA 3THAA 4ES4A 2GVYA 5BZAA 3CAQA 2FTPA 2DQXA 3WLJA 4MYXA 1O5QA 1WBHA 3L0NA 5D32A 3UESA 4D2JA 1E4LA 4LQ1A 4P7NA 1SO3A 2V0TA 3ARPA 1FFRA 1U30A 4E8CA 4K1WA 3ZWSA 3F5KA 1JZ4A 3A3XA 3NEHA 3LXCA 2ZRXA 4Y9AA 3P7YA 3MV01 1UR9A 4Q8NA 3Q2DA 1GYLA 2WMHA 3VDBA 2WV8A 4H00A 2Y62A 3NDZA 1EC9A 4C5YA 2OGJA 2WKLA 2VX5A 2GVLA 1VLWA 4CLMA 2PE4A 4KPLA 1H7RA 2FZMA 1JR1A 2YFOA 3AS0A 3G0UA 5AC6A 2OOGA 4KERA 4JL2A 3NZRA 3QV8A 3UR2A 2J88A 4M1RA 3RPDA 5B7YA 5HMSA 1UB3A 4LRSA 5F7UA 3C2EA 1SQ7A 4UTWA 3H4XA 1IEXA 4IMGA 1M04A 2J75A 3PPGA 3U4FA 3T42A 3AALA 1TTQA 1ADSA 4I7WA 5CSUA 2QDEA 4NYYA 3WUFA 3M0KA 3PUEA 4GXMA 1AK5A 4PMJA 1WX0A 3KTCA 4S3JA 3L0GA 1LQ0A 1V0LA 3LB0A 4UTKA 1AG1O 3WF4A 3WLKX 3T0TA 3B0PA 3R7MA 1D3HA 3N2BA 1H60A 4EKJA 3LRMA 3EWZA 4YN5A 1IIHA 1OK6A 3GDTA 1TPVA 4IFKB 4KCUA 3L9CA 4GH1A 1JCMP 1F76A 4ZQPA 1E73M 1FH8A 2V5KA 3ME3A 1V7YA 5FF3A 3BW2A 4PUEA 4FXSA 4H41A 4FR6A 1YDNA 4Q8WA 1W9XA 4NZJA 1KLZA 4AZ6A 3NL3A 2CU0A 3F4VA 3DHPA 4Z1YA 1QBBA 3FY1A 1CB7B 4ZCWA 1BGGA 4AZGA 3KP0A 1V3MA 4GI4A 4A05A 1R30A 4Q32A 3VD3A 4JN7A 2OYMA 5G2WA 4A2RA 5FJIA 4GUFA 2VNCA 5DT7A 1BG4A 1CGXA 3L4TA 4LVGA 2OT1A 1X97A 2OQYA 3UPBA 5IHSA 3TYCA 1LOLA 1Q7MA 3ONCA 1I1WA 1QNRA 3C2OA 3P62A 3OGVA 1XICA 1J0HA 3OZYA 3DERA 4PUKA 1WOBA 4K1GA 4FNPA 5FSDC 3QHMA 4PUJA 3EWXA 3RR1A 4DRSA 1CXLA 4S39A 1GTEA 2Z6IA 2WYSA 3DYPA 4FHAA 1UZ1A 3C56A 1FDYA 1TREA 4LALA 4MOZA 3I10A 3NOYA 1GNXA 1ZALA 1KFCA 1VFHA 4IQJA 4UFMA 3UYIA 1V6VA 4PSRA 1Q63A 4HHMA 4R27A 8RUCA 4A8LA 2NQ5A 4ZQNA 4K38A 2OWCA 1XR2A 3WJZA 4YU1A 3GNXA 2QV4A 3MW7A 3QEZA 1EHAA 4GQ0A 2CLEA 3MWCA 1XDJA 3FA4A 4LUTA 3W53A 3TXZA 1E5NA 4QAIA 4JKMA 2YZRA 3ZJ7A 3GC5A 1R3QA 4L4MA 2VHLA 3W75A 2NX1A 5EGRA 2NT0A 4AWSA 4R9XA 4N2YA 4TO8A 3STCA 3IIVA 1S38A 4F3HA 4WVXA 2OODA 1VCVA 2EPLX 5HK4A 3R5EA 1GGOA 3FKKA 3VKBA 2Z1BA 5I3DA 1JPDX 3FJLA 4DF1A 3ABOA 1E56A 5F2IA 1UKPA 5F2MA 1G67A 1NDYA 2PF0A 3V16A 3AHZA 3AHXA 2XSBA 4GFIA 3VKKA 3W1LA 1F6KA 1OFBA 3MV11 1TWZA 1RAKA 2A7PA 4XD3A 2POZA 1CXFA 1PX8A 2ZVIA 1BXNA 3LERA 1IR1A 3S1XA 1K77A 1XXXA 1UKQA 3R8GA 1EDGA 1FY6A 2P8BA 1OT1A 5IM51 1M5WA 3W72A 3M7SA 4RK8A 5DX7A 4RL3A 1KFBA 2YJQA 2ANUA 5GNXA 1OABA 2X7VA 4JQ1A 2FH8A 2YBVA 4DO5A 4EAYA 3H2FA 3CHFA 4WCJA 2IKGA 4LTSA 1F05A 1SJAA 3W76A 2VM8A 1CENA 1KBKA 4I90A 5D04C 2DPEA 4GGHA 1WPCA 4UTFA 1RQHA 4J40A 2XDFA 3EPOA 1AUSL 4NYUA 1RY8A 1D7FA 5CPTA 4JFVA 4UTTC 2Z1KA 4A29A 3SJ3A 2OR2A 4HNLA 2B31A 4NAFA 2VFDA 1A5SA 3BAJA 4KEVA 5AYIA 4QRNA 2VZVA 5G5IA 4BQ3A 4IPPA 3IANA 1MFVA 2CETA 1W1YA 3PVFA 4DPPA 3H23A 4MKNA 1Z69A 1QOXA 6ALDA 1OZMA 2CBIA 2IKIA 3B4UA 1IT8A 3LXAA 5BWFA 3JRKA 3TTOA 3EA1A 1TPC1 1KRCC 3MTWA 1HQTA 2HWGA 3NVDA 3T81A 5XINA 3PP7A 3JZEA 3R25A 4IOTA 4C6EA 1R47A 3LM3A 5DCEA 3NM3A 1VIWA 1UA3A 3ITTA 2DZBA 2V5JA 4LBRA 3STFA 1ZQ5A 4JX4A 4B5SA 3W1AA 4NJGA 4IGSA 1AQMA 2PDHA 3TJ4A 3PFRA 4PGLA 1K70A 1W5QA 4REQB 1RD6A 4X60A 1X8CA 2H3BA 3VOIA 2OEKA 2V3DA 2E25A 2ZQ0A 3BW4A 1C8VA 5A6LA 2BHUA 3SSZA 3TC6A 1BVNP 1KO0A 2YL5A 3FK4A 3KAOA 2X0YA 4CU7A 2O92A 3TYZA 4MF4A 2WMIB 1F61A 3PZGA 5AN7A 4KGJA 1E1CA 3UXIA 4NT0A 1TA3A 2E1DA 2F38A 3P67A 1GQJA 3P8IA 5EMKA 2VFEA 2TYSA 4L80A 2Y6ZA 4GI8A 2Q8XA 5C2CA 3W1UA 3W7CA 2PLJA 3TX9A 4TX9A 3TN6A 1NTHA 5A8NA 4B4FA 4DI8A 5MKGA 5DCBA 4UMAA 4QE5A 3QHNA 3KVJA 3DGBA 1R3SA 5CJ5A 4LUSA 1TJRA 5I2UA 4GLEA 2XH4A 4NAEA 4JCMA 2YL9A 5G1TA 1NDWA 4JGDA 5AZ1A 2BLEA 1IZJA 1EP1A 4U5IA 3NDOA 5BNKA 1F6YA 1J4EA 5H1WA 3L66A 1U33A 2BODX 2F6UA 4L64A 2D24A 5ECUA 4FO4A 4P8UA 5L6UA 2Q3RA 4GABA 4PN2A 1VFTA 1P1MA 1XINA 2RFGA 3LCGA 1NOWA 1MNSA 4DELA 1KTBA 3P6LA 5BU6A 2GGGA 3CTTA 2YZ5A 3QTGA 4OBSA 2P1FA 4XAFA 4F9DA 3PBUA 4D72A 4EPEC 1FBAA 2VRKA 1AZ2A 1ECQA 4E2BA 3BXWA 4Y9OA 3HM7A 1GPFA 3VNMA 3OLDA 1LBFA 4UTIA 4MADA 4AVNA 4NHVA 3N6HA 1DTNA 2O56A 2PPGA 3RN6A 4J9JA 2V3EA 2D20A 3XINA 3LV6A 2V69A 3SRDA 3T2QA 3E0IA 3ARSA 1I60A 4ASTA 1M03A 4L6DA 2OGYA 4I3GA 3SY5A 2XH2A 2FFIA 5J8LA 2XN2A 2VQTA 1T7LA 5LIKX 3FFSA 5E0FA 2J4GA 4HHHA 3NQCA 4XZLX 3DFSA 1ENUA 2GSEA 2WHKA 4GJJA 2OX1A 4N9CA 3FA5A 1ONRA 3AC0A 1R3WA 4BEQA 3CIXA 3UETA 4AZHA 1E0TA 3TWAA 4CN6A 2Y2WA 3S5SA 3KOYA 3OLIA 3RLVA 4YVXA 4A3HA 1SO6A 4HMDA 4JZ5A 5H8MA 4DM1A 1G0CA 2QCMA 1ZBKA 1RP8A 1PS9A 4WX2A 1H5VA 1P7TB 3CXOA 1YHTA 4F48A 2DSKA 2GVJA 1UHVA 4KF1A 2A4AA 3POHA 4I5UA 6CGTA 2G95A 1UP3A 5AY7A 3V1PA 3T6CA 3NR0A 2WC7A 3UJEA 2V81A 3DESA 3C6CA 1YX1A 4JX6A 1LTDA 3FSUA 1PDYA 1N8IA 5C5YA 1IZCA 3A23A 2YB1A 3BPWA 1XKYA 2ZUMA 3TSMA 1O5RA 1POJA 3APYA 3M7WA 3HQOA 3UZXA 5CBIA 2J7DA 4C6PA 4A8NA 1HT6A 4L9XA 3TZNA 1OX5A 2H6RA 3DFTA 5CGTA 2JKAA 1Z3NA 1KRAC 2JKPA 3AIRA 2G3NA 3LGEA 1H0IA 3O6AA 3ZYZA 4IUOA 4O4WA 1J9YA 3K1GA 4AISA 1P0DA 3THDA 1DP0A 2PDXA 2CHRA 2H8XA 4A8RA 3EOOA 2O9OA 1GVRA 5BOFA 1X6LA 3L5AA 5CJNA 4JXCA 2J8TA 2OO0A 3LHUA 1YKWA 1E6QM 2WCSA 4I6KA 1IZKA 4A22A 4PMZA 1ME8A 4D8ZA 5BYWA 2CLHA 1EPVA 3O7UA 4IMFA 1K02A 4AHOA 1VIZA 2VDIA 5CZTA 1FKWA 2Z1WA 4CD7A 1CYGA 4HCLA 3B8WA 1JDDA 3PG8A 2GGIA 2OLHA 3LCWA 4MUPA 3N17A 2VEKA 5A6KA 4MFDA 3WDIA 3RPTA 4BFAA 1XDMA 5B80A 1W17A 1Y0EA 3MVIA 2ZXDA 2DUAA 1PPIA 5DY2A 5CGMA 1I2QA 3RO6A 2X1TA 1QO2A 1TQXA 4Y9PA 5C7HA 3HFTA 1E70M 4XAPA 4WGXA 2EPKX 2RAGA 1KXTA 3APGA 5D30A 1GZ1A 3SADA 1WZLA 2DIKA 5FF0A 3C2YA 4HPJA 1IWBA 3VNLA 1MZRA 2PWGA 1OB0A 3QOKA 5CJMA 3EMQA 4TTGA 1RA5A 2O7QA 5HNRA 3H2CA 1YTKA 3BQ5A 4IPIA 3S83A 3DENA 5AHMA 4ZO8A 2VCAA 1B3WA 2BY2A 4C5ZA 5ABEA 2WAGA 4HA3A 3BMXA 4RZBA 2OEMA 5LNWA 2ALDA 5LNUA 5IXEA 1GW9A 3WUEA 1H09A 2Y24A 5FJPA 3A6OA 3MCOA 1AW5A 1R3RA 1NFGA 3UJSA 4QJ3B 2ZXAA 3CHVA 4XUGA 5DY3A 1OG0A 1W1TA 2QCDB 2O55A 4B2DA 1PSCA 4AQLA 3S5NA 4D1JA 1PCWA 4PTNA 3OHIA 2DQWA 3STPA 2PWFA 3EA2A 1V6XA 5AC7A 3GHRA 4M56A 2NUYA 4UMBA 3M0HA 3W7RA 3I6EA 4ZQMA 4UR8A 3AJ7A 2YCLA 1V4YA 1XRFA 1B9BA 3CYVA 3AMGA 3EDJA 4PE8A 3W7IA 3IJ7A 4MDPA 4J3VA 3UA4A 1CCWB 4IMAA 1JCYA 4YTRA 3H53A 2I1OA 2E68A 3CL8A 4AY1A 1VENA 8CGTA 4BR1A 4Y96A 2WANA 4HPGA 1K1DA 6A3HA 3LTPA 3R11A 3B04A 3G1SA 3EB3A 3SCQA 1XG3A 1REQA 1F3XA 2W9MA 2ZDSA 1OCBA 4QQUA 2FMNA 3E38A 1EEXA 4BWLC 2PGFA 3SQMA 1R2SA 2VZTA 2C19A 4AH7A 3S3GA 1TJ2A 1YYAA 1YNYA 4Z2GA 3DCPA 2B7QA 2JIWA 1FA2A 4OTKA 4Q3MA 1XIDA 3KCOA 3L67A 1V5XA 1SSDA 4XX6A 1RBAA 2W63A 4IMCA 3VIKA 2UBPC 2WC3A 2WVVA 3HF3A 5T9BG 4YWIA 1BWKA 4MVAA 4OIFA 4C6KA 4W8BA 4I5RA 1A5AA 1UUQA 4ACZB 4AWUA 5LSMA 1LWIA 1QNOA 5FOOA 2XFYA 1AL7A 4UMCA 3W7DA 5I3FA 5F4SA 3OLEA 1AVAA 2W92A 1S2AA 3EA3A 1XM3A 1W5OA 2YA1A 4PFHA 4PMDA 4RCXA 1BF6A 3EWDA 4B5XA 3T2PA 1JQXA 1I2OA 4XV0A 3UR7A 3WLLA 5RUBA 4HZ6A 4MNJA 1UD5A 3LK6A 1B3VA 5LXEA 2X30A 3WBEA 4NZFA 3VDHA 1H5YA 4FIRA 5IDZA 1PUDA 2W62A 1A5CA 3QV7A 2DSUA 4K8GA 1W8SA 1GW1A 4NAEB 5EMMA 4Q8UA 3VKJA 5DF0A 4XSMA 1DL3A 4PSPA 1L6FA 5CGQA 1LUCA 1NM9A 3C3UA 4EIVA 5M1TA 3KOXA 2CBVA 3B0XA 3OA5A 3HV9A 1J2BA 2O7SA 4DJFA 3W22A 5D2VA 4YHEA 2O9PA 4IX0A 4DO7A 4Y7EA 4C6NA 4DEFA 2VEMA 2VT0A 3UT0A 1AFSA 4YS1A 4JQ3A 3GDMA 3OLGA 2P8CA 4CD8A 2I7GA 1NWRA 5DELA 1OG6A 3QY6A 3RU8X 4EPBC 1A53A 3QN3A 1AODA 2YKKA 5CZSA 3KOWA 2FZDA 3OEXA 3WSUA 4WRHA 2CC0A 4LBUA 3TDFA 2ZZ2A 3KDNA 4ZL1A 2NLYA 2ACUA 5TQLA 1DJQA 3K8MA 1R2RA 4QCEA 3QLDA 4IWWA 1JYNA 1XG4A 3RCYA 1F74A 4NZ4A 3U7BA 4AHPA 3T4WA 5F4WA 1LYXA 5F2LA 1PZ1A 3D3AA 3GH4A 4QM1A 1V3IA 2PWUA 5JQ9A 2PRHA 3F2BA 3RIKA 3LNMA 1H7OA 2GDVA 4MY8A 1BTMA 1BWVA 3WMLA 1HGWA 1O12A 1TX0A 1XLLA 3FV9A 2VRJA 1PIFA 3W83A 4GYKA 4AZCA 3M0YA 1XYAA 1A5UA 4G7EA 4LSBA 2HCVA 3AAMA 3DECA 4CNOA 3ENLA 3RDKA 2H3DA 3GNNA 3P2VA 1XFBA 1XCXA 1MEIA 4UQAA 1H0GA 2NWRA 1PAMA 1Q6QA 1Y7VA 2VRQA 3UVIA 2VEPA 1B30A 3MMWA 1HJQA 2O9TA 4DJDC 3SCUA 3OB8A 1HZYA 1VAHA 1QW9A 3G0SA 4UQ9A 5FF4A 3QKZA 4WEVX 4UCGA 3RLUA 3GR7A 1G7VA 3G1XA 2Z1SA 3ORWA 4QEHA 4Q4PA 3RILA 1HGYA 3ANUA 4UR9A 4UWMA 4RPPA 4C7DA 1U5HA 2I16A 5LA1A 2JE8A 2DH2A 3GTIA 3V36A 1QI2A 2DT1A 1E55A 2RDWA 4BI7A 3HG3A 3N11A 1DQXA 1EF2A 2PGWA 4I7UA 2PDIA 4W93A 4FK9A 3M1ZA 5HPCA 4S38A 3NO3A 3TW6A 1ZNNA 4MNKA 1BGAA 4C1LA 1DOSA 2E3ZA