2IPJA

Crystal structure of h3alpha-hydroxysteroid dehydrogenase type 3 mutant y24a in complex with nadp+ and epi-testosterone
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
321
structure length
321
Chain Sequence
SKYQCVKLNDGHFMPVLGFGTAAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mouse 17alpha-Hydroxysteroid Dehydrogenase (AKR1C21) Binds Steroids Differently from other Aldo-keto Reductases: Identification and Characterization of Amino Acid Residues Critical for Substrate Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
total genus 109
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2ipjA00
1US0A 4Q3MA 2IKIA 2HE5A 4XZHA 2P5NA 3V0SA 2ACQA 3WG6A 4XZNX 3WCZA 1ZSXA 1Z3NA 2IPWA 4DBSA 3COTA 3R94A 1HW6A 4FA3A 1S1RA 5LIUX 5LIYX 3WBWA 3CV6A 3LUTA 3WBXA 1ADSA 1C9WA 4XZMX 4PUWA 2PDNA 1EXBA 2WZMA 2PDFA 4QXIA 4JIRA 2PDXA 2HEJA 3NTYA 3RX4A 3BUVA 2IS7A 2HDJA 2HVOA 3V35A 2I16A 1LQAA 2A79A 4H7CA 4GQGA 3O0KA 4LBRA 3V0UA 2HVNA 1PWLA 4YVVA 3UG8A 3WBYA 3UZYA 1MI3A 4GCAA 2FZ8A 1PZ0A 4YVXA 4XAPA 1S2CA 4ZFCA 4DBUA 1IHIA 3G1RA 3UGRA 2R24A 4GA8A 1ZGDA 4Q7BA 2FZBA 4XVDA 4GABA 3GHRA 2PDCA 3ONBA 3UZXA 5HNUA 1AH4A 5JH2A 1IEIA 2PDHA 1Z9AA 2CLPA 2PDYA 5C7HA 2I17A 1X97A 3LQLA 3Q67A 4LBSA 3BCJA 4LAUA 2PDKA 3ONCA 4IJCA 4PR4A 1K8CA 4QX4A 1T40A 4YVPA 1PZ1A 4XO6A 4G5DA 4YS1A 1AZ2A 2PDQA 1JEZA 3KRBA 4H8NA 3EB4A 3V0TA 4L1WA 2PDBA 4JQ4A 3M0IA 3T42A 4DZ5A 1S2AA 1AH0A 1RY0A 3CASA 4PUUA 4WDWA 1Q13A 3G5EA 3P2VA 1Q5MA 1EF3A 2BGSA 1YNPA 3VXGA 4OTKA 1S1PA 2IPGA 3LZ5A 4XZLX 3BV7A 2C91A 1OG6A 2F38A 4JTAA 4XZIA 1YNQA 4L1XA 3GHSA 4WEVX 4JTDA 2PD5A 2PDLA 4LAZA 2DUZA 2WZTA 1M9HA 4IJRA 2PFHA 5DANA 4FZIA 1QRQA 4WRHA 2FZDA 4FALA 5JH1A 2IPFA 1VP5A 3LZ3A 3LNMA 2ACSA 2AGTA 4I5XA 2ALRA 3B3DA 1RALA 3GHTA 1Z8AA 3M4HA 1AFSA 5AZ1A 5KETA 1R38A 1T41A 2ACUA 3QKZA 1SM9A 3N6QA 4JIIX 3UP8A 4ICCX 4DBWA 4NKCA 2IKJA 2PDWA 2INZA 1GVEA 1ZUAX 1RY8A 4YU1A 2IQ0A 2FGBA 3DOPA 3EB3A 3R43A 2PD9A 1VBJA 1X98A 1FRBA 3V36A 2F2KA 4JTQA 3H4GA 4PRRA 1PWMA 4WDTA 3UZZA 4JQ2A 1J96A 3RX3A 4EXAA 4EXBA 4MHBA 1EKOA 4HMNA 2HV5A 3EAUA 2NVCA 3MB9A 4RPQA 1YE6A 1XF0A 3S3GA 1YE4A 3CMFA 4XK2A 3UZWA 4JQ3A 2HE8A 4JQ1A 4R9OA 3R8GA 4PMJA 3R8HA 2J8TA 2VDGA 3FJNA 3LN3A 3UFYA 1HQTA 2PZNA 4JQAA 3CV7A 3M64A 3GUGA 1LWIA 4JTCA 3LENA 3R7MA 3R6IA 3LEPA 4XVEA 2DUXA 2PDPA 3Q65A 3H7RA 1XJBA 4HBKA 3DN5A 4AUBA 4PRTA 4ASTA 5M2FX 3C3UA 3BURA 2PF8A 3LD5A 5HA7A 2IPJA 5AZ0A 4LB4A 2FVLA 2IKHA 2PDJA 1X96A 2FZ9A 3UWEA 3MC5A 3D3FA 1AH3A 4LB3A 2DV0A 4WDUA 4XO7A 1MRQA 4GQ0A 3CAQA 3FX4A 2ACRA 2NVDA 1QWKA 2ISFA 4QR6A 4WGHA 2PDUA 2PEVA 2PDMA 1Z89A 4IGSA 2IQDA 3CAVA 3RX2A 2PDGA 2BP1A 3O3RA 4GIEA 5LIKX 3N2TA 4QBXA 3H7UA 3LBOA 5HNTA 4F40A 1EL3A 3U2CA 3F7JA 4JTRA 3LQGA 5LIXX 2QXWA 4WDXA 5LIWX 3R58A 1ZQ5A 1PYFA 3GHUA 2PDIA 4FAMA 4GACA 4JIHA 1AZ1A 1XGDA 1MZRA 2INEA 2IKGA 2R9RA 3UYIA 1A80A 2BGQA 1UR3M 3ERPA
chains in the Genus database with same CATH superfamily
4RDYA 3ARTA 4NJGA 1P4CA 3CQIA 1THFD 5EMYA 2DIEA 1Q85A 2IXUA 3O06A 1OM0A 3M0KA 3QMRA 1FWTA 2CPUA 3T0TA 1EX5A 1ADSA 3NPUA 2UY4A 1K8YA 3VKBA 1FWCC 1LROA 4Y6GA 2BNJA 5DO8A 4DYJA 4F0KA 3VE9A 3AMLA 3FSTA 3Q45A 4C1LA 2J6XA 1ZJHA 3OP2A 5ABGA 2G3NA 3DX5A 3OU8A 1NFBA 1D7KA 3R89A 4EWJA 1BKSA 2H90A 2CESA 2ZKMX 8CGTA 2ANUA 5H8MA 2CZEA 1XR2A 1JUKA 5IDIA 5I3FA 1M65A 1XLBA 4A05A 1XD0A 1YDYA 2QGYA 4ZGYA 2EQDA 4IT1A 4MDPA 4U28A 1F8MA 4GQBA 3GXNA 4DYEA 2BOFX 1JCTA 4JTGA 3CAKA 5B7ZA 4IL2A 3O9NA 5HULA 2CWXA 2WSQA 4IMFA 3TCSA 3QPEA 5A2AA 4JL1A 3SGZA 3ELFA 3O0FA 1R9XA 1GUVA 1CGVA 3GNNA 1H0IA 2YFOA 4TOQA 1K6WA 3ONBA 2DIJA 4A3QA 3GH4A 5LA2A 4NJJA 1CXHA 3PZOA 5BWAA 4ES4A 1AH4A 4HU3A 3PSVA 1W3IA 4CN1A 2YXXA 3EWCA 1LT8A 2PA6A 4HNCA 1IWAA 1HJQA 2PBOA 3HG2A 3MMUA 1IWPA 1J0KA 4IOTA 1RBOB 2GK1A 2PLKA 2HK0A 1AMKA 3WQCA 4JKKA 3H24A 1B3XA 3RO6A 3Q58A 4B2DD 4LEQA 5HPOA 5GVJA 3EB4A 3MUCA 2G50A 3VIHA 3W1LA 3QYSA 1DVJA 1AH0A 4UFLA 2BTMA 4QROA 2QS8A 1KM6A 4AZ7A 1E5NA 3P84A 4JKMA 3S83A 3W7NA 3GKFA 3TN3A 2V63A 4Q7IA 3N9KA 5AY7A 4YHGA 2JE8A 2EEXA 1I9CB 1XIJA 2G0WA 2PTDA 4JNYA 5A6JA 2JK2A 2PTWA 2Z24A 2BHUA 5ABEA 2OZTA 4ML9A 2WHJA 1RK5A 4IIHA 3GIYA 2OGJA 3EWBX 5I24A 1B3YA 5F2MA 3PWIA 4HA4A 1WOBA 1ICSA 2Z1SA 3M43A 5K3VA 3CTLA 1F6KA 3VUSA 1T96A 2VMFA 2QCCA 5AC6A 1ODUA 1XYBA 4HZMA 3I4KA 3EWWA 4HT3A 4F9JA 3VPLA 4NXKA 3M6YA 3KEHA 3WUBA 2OZ3A 1GONA 1AFSA 4DUOA 4W8BA 3PNZA 3TJ4A 3NQAA 2JF7A 4ERGA 2WKGA 5U7SA 5A8PA 4NSBA 4ZODA 4YL2A 1RCOB 2INZA 3OGRA 5EGRA 4PCFA 1RXOB 1NOFA 1CECA 3OIHA 4QTGA 2BY3A 2Z27A 3AC0A 4X3ZA 4UR7A 1X98A 1R7OA 2QW5A 4JNZA 3OVRA 1US3A 1NWRA 1UROA 3KRSA 3MMDA 1TTIA 1HO4A 2ZX5A 1X6LA 1T7LA 5AHNA 4UQCA 3PPFA 1KTCA 2XN2A 3W2JA 1TPVA 4JTLA 2ZC1A 4HQVA 3MB9A 4C5YA 2XUCA 4QLLA 2F6KA 3SCSA 4X0NA 1XM3A 4LVGA 3NVTA 3TOYA 3UWYA 4MVAA 4KCTA 3S5SA 1WBHA 5G4WA 4D6IA 4Q8NA 3VIGA 3UG3A 1S46A 4Q4QA 5C70A 2D3NA 1MUWA 2ZWZA 4LUJA 2PLJA 3OPSA 3WQ8A 3A3WA 1MNSA 5E5CA 3U6WA 2QIIA 4LC8A 3VKJA 2FFCA 3W2MA 3O6AA 4QJ3B 3LENA 3R7MA 3LEPA 2WMJA 5DY2A 5G4HC 2WBGA 2V5BA 2ZXAA 4A3YA 1L6FA 1J2BA 1W1YA 3G1SA 7REQA 4YTSA 3WYZA 3M0XA 1BQCA 2BLEA 4D71A 5FJUA 5D9MA 5ABHA 4IXHA 4AU0A 4JNMA 3POCA 2XWEA 3T0CA 1ISWA 2GQ8A 4H4IA 4WXZA 4WDUA 2OWCA 4ROPA 3LXBA 3BOFA 3GQYA 1S5VA 3SJ3A 7PTDA 2GWGA 1UQYA 1AL8A 3K1GA 3ATYA 4TMCA 5EFFA 2C0AA 3TV8A 4Y90A 3S1GA 3KL5A 4LW7A 3L0GA 4G9PA 3ISIX 3I7SA 1R3YA 4GNVA 2CCRA 3HO8A 5LIWX 4GIYA 1ZQ5A 3MVIA 4D6DA 2VQUA 1W5OA 2PCQA 4E0CA 4GACA 1J4EA 2FTWA 5FJOA 1CX9A 1UR3M 3GDBA 3MANA 1VENA 2IKIA 2HNEA 1E40A 4I9TA 3AXIA 3H2EA 1ME9A 3AIWA 4JCLA 1JCXA 4RV3A 1Z3NA 1OGSA 4DBSA 4FF7A 3DFNA 3VDGA 4JY9A 3B8IA 3IUDA 1ISZA 1M01A 1QI3A 2PWHA 1E6ZA 3WF2A 3LUTA 4FXFA 1GYNA 4QISA 3BCFA 2OPJA 4O15A 2OU4A 1CB2A 1GOIA 3TTQA 3GE7A 1KO0A 3K4AA 5CJ5A 5LHFA 3MCOA 2PDFA 2HEJA 3VNJA 3MU7A 3ZYZA 1TV3A 3ARPA 1UUOA 2DH2A 1XDJA 1L2UA 2FZMA 4GKTA 4BEQA 3RUBL 1UUQA 4CN6A 2F9RA 1E70M 4LBRA 4Z0SA 3D5HA 4MWAB 3V0UA 3H53A 4EE9A 3MDWA 3VGHA 3VVGA 5M3WA 2P10A 3UPMA 4PCTA 4BI6A 1AQHA 3W6LA 3ALGA 5D02A 4Z2GA 2BOEX 3SI9A 1E0VA 4REQA 4XAPA 4PODA 1OCJA 4QQUA 5LXXA 2Z26A 1X1NA 1LCOA 5IBXA 4JDYA 1XLMA 2VD8A 3G8EA 2VT0A 4NZ5A 1ZL1A 5IOBA 4GK8A 3OLGA 2ISDA 4GABA 2QAFA 3S1UA 3TOPA 2BY2A 3IK4A 5G1MA 3REQB 5IHRA 4EF8A 4H9YA 4F0SA 2J88A 4JN8A 2CLPA 1NH6A 4PC8A 1I8JA 4XQ6A 3OGSA 3LRKA 4WOZA 2D69A 3PF3A 2A0NA 2VGGA 4W88A 2O4QA 4N0RA 3XISA 1TWIA 2NV2A 3LI0A 3P0XA 4O17A 4AHQA 2HMCA 1H09A 6TAAA 4M29A 1W9UA 4G5DA 3WQEA 4JTJA 4B2DA 2J74A 4UBPC 3TZNA 1OFOA 1VFTA 2V3GA 1A5BA 1E9YB 1JZ3A 3AJ7A 4U3AA 4RE3A 3W1MA 4HVXA 2FVKA 1JUBA 4PUUA 3W2KA 1EGZA 2ZDRA 3CUFA 4BF5A 4HU0A 1OGGA 2E1DA 3FKRA 5I02A 4E2VA 3TE9A 2VEMA 2CFFA 5A6BA 1V02E 3R0DA 4BQ2A 2VC5A 3BLFA 5CH9A 2CXGA 3I7RA 1TRDA 3TNBA 4DWSB 1GYMA 3BVJA 1WO2A 3LXCA 4GJ1A 4M80A 1I0BA 1D2KA 1D3HA 5ABFB 1TE1A 3PPGA 3DHPA 4QJ1A 1TQXA 4FNUA 1B0IA 3SW6A 4XAFA 5KTLA 3JUGA 2A3EA 1GGOA 2H6RA 5CG7A 1AW1A 1C91A 3AZSA 3WNPA 4JFUA 1FWHC 3ID7A 2ACUA 4D6FA 3LY0A 4JIIX 3BJTA 3VUPA 1CGXA 2FPTA 1V0KA 3LI1A 1TREA 3RMJA 2WV8A 1F3WA 1AJ2A 2IKJA 2PGEA 4O0QA 3DENA 4NNBA 3WF0A 3P7YA 4P8XA 5FAJA 2A3HA 2YOCA 2Y5EA 4DO4A 1J2WA 4LNYA 4EANA 1YADA 3L66A 2D0FA 4L9YA 4JTQA 1NAL1 4MNKA 3STFA 3ZIZA 4LUIA 4WDTA 4DB7A 1S5MA 2W61A 3DFQA 1BWVA 4TV6A 3ITLA 5BU6A 3RNDA 4MHBA 4TIMA 2XFYA 4ERAA 1KKRA 1DQUA 4IH3A 1QWGA 3WD4A 1YE4A 2DSWA 2PGWA 2XVNA 5GJPA 1QHOA 3N04A 2DVUA 1AL7A 3G3MA 4M1BA 2E77A 3DYOA 4MYXA 2YLLA 2OYMA 2AQOA 1XLEA 2VDGA 3NYZA 4MY1A 3STPA 3GFZA 4B90A 1E6XM 1SW3A 2HS8A 1J9YA 4O13A 1A5MC 1Y5WA 1QNVA 3L2MA 1YXDA 2XJ7A 3KTSA 1Q6OA 2E6AA 3QZEA 3D6NA 4YJ5A 3S9ZA 4C1NA 3ITYA 3HQPA 2JBMA 4UQEA 3URAA 1W3KA 4DF0A 1REQA 1UZHA 4QLKA 1JZ8A 5DCBA 2EF9A 3VDAA 2XIQA 4O16A 1ISXA 4IJBA 2EXOA 4V1XA 2D0HA 1L2QA 1XCWA 1LT7A 4R27A 3C8NA 4RX0A 1FCVA 2WVSA 3NDZA 1DWIM 4DY1A 1ZNNA 2JIWA 1B3VA 1SR0A 4UQ9A 3RJYA 1EYEA 1SMDA 4GY0A 4OUIA 5EBAA 3VNZA 5AHFA 4PUDA 3PZVA 1A5AA 3LBOA 4LWWA 3SUVA 3APYA 5HNTA 5CZTA 3VMPA 1UWQA 3WD2A 2QUNA 4F66A 3TEVA 4LS1A 4O4VA 3RLUA 1PX8A 4R34A 1NDYA 1QI5A 3BL3A 1POKA 3BOLA 2J62A 4PB4A 2G97A 4LBUA 2ZRXA 1B31A 1VQTA 3PG8A 3LBMA 3TC7A 4OECA 1CW2A 2GJPA 2G5WA 1E1EA 3W01A 3W6MA 3KP1A 3II1A 3OW1A 4XZHA 5LGZA 3NQ2A 4LTSA 2ICSA 4J3TA 3TNOA 2PZ0A 4ZQCA 1K03A 4LANA 4FX8A 5REQB 4HMEA 4IUOA 3GG8A 3VX0A 1SQ7A 5FF3A 4D6GA 4J2MA 4MOZA 3DFYA 4UTWA 5LIYX 4BK9A 3WBWA 4KETA 3TYCA 4ZE4A 3PWAA 5FF4A 4XZMX 2CEQA 2W6RA 3F1QA 4UTLA 3DHUA 8XIAA 1E71M 3LCLA 4U10A 2DSUA 3NQBA 2IS7A 4HPHA 2I16A 2YR1A 1BLIA 4OBSA 1XYAA 4P8UA 5KZMA 4H7CA 1YDOA 3HFYA 1S38A 4OOZA 5GQBA 3GU2A 4A8IA 3LCWA 5HATA 1BTMA 4MZ1A 2NSOA 4Q8TA 4HYWA 4S3DA 1W2PA 2QPXA 3NOEA 1WXZA 4DJDA 2VEGA 5T91A 4YVXA 1N8IA 3QTPA 4ALDA 1WAUA 1JL8A 4I6VA 4NAFA 3G0SA 2ZVRA 4KEMA 2EHHA 1P5BA 2DP3A 3RXZA 1A4MA 3RJXA 2GUBA 2PU0A 2BXYA 3KCOA 2FHBA 1ZTVA 2QNEA 3LPOA 2YXGA 4MNJA 3GU1A 4PTWA 4A35A 1SJBA 1KM1A 4LALA 4AF0A 4GZIA 4B4HA 1EXPA 1RSCA 1WAWA 2V3EA 2F61A 1FH7A 6XIMA 3K5XA 3UT0A 2WMHA 3SSZA 2F2HA 1ML1A 4EF9A 3O63A 4PTDA 1Z41A 1XCFA 3FDKA 5EA9A 2GFTA 2PDKA 2REQB 2PBGA 2WJEA 1MO0A 4B5UA 5CGTA 3FA3A 1Y5XA 1HNYA 4N6FA 4KS0A 1JPIA 1KM3A 3H2AA 2ZBTA 4NAFB 4HU8A 4EPDC 5M1TA 4FEZA 3IEBA 4Z08A 1RY0A 4EVZA 2WOQA 2V69A 1OCNA 4I7UA 2QCEA 3ZWSA 4CU8A 1M7JA 3G1DA 5I5RA 1OFRA 4MY8A 4HNLA 3KOWA 3OZPA 5AYZA 1S1PA 3VD9A 2YLAA 2ATSA 2PODA 3C2FA 3SCUA 3S5YA 5CLTA 5AHMA 1KW1A 3UWUA 1VAHA 1T6MA 2X42A 1FWRA 1AG1O 3QMTA 5C9XA 2Y8KA 1W56A 3T07A 4GYKA 2X30A 4JTDA 2NX1A 4IP7A 3DHDA 1NF7A 2YCJA 1XD1A 2CZ5A 3VI2A 2X0HA 1LBFA 1XYFA 3GZAA 3FEMA 3W26A 3OHIA 3AYVA 1K9FA 2FIQA 3W2LA 1UH4A 2AQVA 3SZ8A 4N9DA 5G2HA 1TPDA 1AJ0A 1SVDA 3BXWA 3D0CA 3M47A 2X16A 3QPYA 3PANA 3VCNA 2BDQA 1RUSA 3RITA 1CNVA 4POCA 2QPUA 3GDTA 3PG9A 3ORWA 2DT0A 5CSRA 2IQ0A 1VYSX 5FEWA 5C0QA 2OLHA 3DOPA 3T9PA 3F4CA 5F4WA 4E8DA 4K1GA 1KV5A 1TQJA 2WBKA 1BVNP 1O5KA 5RUBA 1VFUA 5F1VA 3WZ0E 2D73A 1F05A 2VOMA 1YEYA 3UG4A 3E5BA 3M0VA 4D1IA 2X40A 5DY3A 5E93A 2OSYA 4X61A 2Z1KA 4CNPA 4WCJA 4PTVA 4K8EA 2FTYA 1I1XA 5CLWA 4NJKA 2WAGA 2GVEA 4LGXA 4B5VA 5J5DA 4WQ6A 4C6LA 3TJXA 1XX1A 2WZIA 1Y5VA 3NL5A 4GYFA 3W81A 2BASA 4LYRA 4A22A 2I5GA 3GR8A 3UA4A 4S39A 1H4PA 2DZSA 1XIFA 3L67A 1W8SA 3ARXA 2E6DA 3RCYA 4U3CA 1TV5A 1XBVA 2C13A 3SBFA 1UKSA 3E5PA 4JTKA 1B9BA 4K8GA 3DECA 4QS6A 4AX6A 3AIRA 5AYBA 1MYRA 1R85A 4AUBA 7XIMA 1A0CA 2Y85A 1VBRA 4H1ZA 1GK8A 1YXCA 3C5QA 1HKJA 3NJ3A 1ZCCA 3C3UA 4TTUA 3WMLA 4R85A 4PMRA 2CBIA 4AZ6A 3G1YA 4DO6A 3NEVA 3IACA 1JYXA 2QJIA 3LHUA 3VOGA 3CT2A 3D3FA 1UR1A 1DJWA 4Z1AA 1LWJA 4NQ1A 5BYWA 1LLOA 3NR0A 2XPKA 2DV0A 4XO7A 1PVNA 1MRQA 1BHGA 3DHFA 3O6DA 1B3ZA 3H21A 1OX4A 3BLKA 1RD5A 1IGSA 4UFMA 1HXJA 1Z89A 4DPPA 1NF0A 3JS3A 5CXPA 4NZFA 2ZZ4A 4NASA 2CKRA 2PDGA 3UWVA 2WYSA 1OCQA 3N2TA 1SW0A 2G4FA 5CPLA 5HJLA 3REQA 4Q6XA 3NM1A 4MB1A 3EWUA 1ZBVA 2QDHA 4HTYA 3L68A 1OF8A 2GOUA 3CQHA 4JTRA 2QXWA 1XIGA 4E5TA 3R13A 4LX4A 3VC5A 1QPQA 2X1IA 3OA3A 4ZOAA 4I6KA 3AWOA 1DIEA 3NNTA 4V27A 1JZ2A 2POTA 1TMQA 5F2LA 3FNDA 4J3XA 3W88A 3IANA 2ZA3A 3BARA 1W31A 3MY9A 5I09A 4B3ZA 2TAAA 3S4TA 1ZSXA 3NCOA 3GBEA 4X2PA 4K7VA 4LEFA 2IPWA 2X8RA 3BG9A 2GLKA 3B97A 4O57A 4IQEA 3UJSA 1Q6FA 3QMSA 4G7FA 5T9CE 3GU9A 3SRKA 1GOWA 2PWDA 3NFUA 1Z7AA 3BAWA 4H2CA 3BZGA 1SW7A 1WDRA 4ZFMA 4GPNA 1EYWA 4PUWA 2PDNA 2A3AA 2HS6A 3K1DA 2TODA 3S9YA 4CUCA 4Q4SA 4WOQA 3DFTA 5G1YA 2C0HA 3EOSA 1IQ8A 5FL0A 4QLJA 4GI6A 4LF2A 1XDMA 4K39A 3CMGA 2GGJA 5FSDC 3H26A 1H1NA 1QBBA 3MKKA 3R25A 2HVMA 5TIMA 3WBYA 2C18A 1WXYA 1KWKA 1NDWA 4NZJA 3CZKA 1FBAA 4HOXA 2X1SA 4RZBA 2DZXA 2Z1XA 5CAKA 4GGHA 3QZAA 1O7AA 5G2IA 3OTRA 1GEHA 4GX9A 2G3MA 2Q09A 4CCZA 5BMWA 4DO5A 1XLAA 2ZICA 2XWDA 4LU0A 4O52A 4O4WA 1JDDA 4KRTA 1HZYA 4W7UA 4IGMA 3TFXA 5FJRA 1H7WA 5AHEA 3NIYA 4G8TA 3TJIA 3OA5A 5M5DA 4P2VA 1I45A 4HZ7A 1XPYA 3G6LA 3ZR5A 3LQLA 4KFPA 4LAUA 1QW8A 3NL3A 1U33A 4UC5A 1YLVA 5FL1A 1ISVA 1BQGA 4BF7A 3MMTA 2I7GA 1K8CA 1UH3A 2Y70A 1GPWA 2J7CA 2FLIA 1UWAA 4CNSA 1G4PA 5JBFA 1VCFA 3KRBA 4UCGA 3W7LA 3M16A 3MYPA 1XW8A 1ME7A 3O15A 3I6RA 5AYXA 2PWGA 1UZ1A 4LOCA 1O4UA 2YCKX 2QEZA 1TG7A 4US5A 1DWJM 3L4UA 4NZCA 4R5EA 1Q5MA 3VM7A 1ZENA 1LRQA 1PJ9A 4ML4A 2ZTKA 1K70A 1XLKA 5A8MA 3KAOA 1AMYA 3LDVA 5TD4A 5LKYA 3W83A 5LGXA 1M7XA 2F6UA 4AD2A 3BLLA 3HQOA 1OGBA 4HNVA 1MFUA 3MV01 2F38A 1NWSA 2ZZ6A 3FKKA 5BRBA 5C9ZA 3ABSA 1IZCA 1Z6KA 4E8GA 1FDJA 1YNQA 3WLQA 1GOMA 3HF3A 4HNOA 3WD1A 2NXHA 5BNKA 4Y9MA 3IV8A 1NELA 4PMDA 1CZ1A 1W1TA 6PTDA 1RLDA 4CEXC 3TYEA 4Z2LA 1KD0A 7REQB 1VYRA 2FHCA 2ZA2A 1H62A 1LTDA 4KGJA 4NT0A 4IGHA 1X6NA 1G6CA 2Y5JA 3M46A 3NZPA 4Z42C 4FLRA 4Y2WA 4D6CA 3TTSA 3GYEA 3ZJKA 1JCYA 3BMVA 3NZQA 1PKYA 4AIOA 1I2RA 1WPCA 1KM2A 2QHAA 3M7WA 4A3RA 1CPUA 4YHEA 1ZUAX 4B3KA 5BRPA 3HQNA 3WK0A 2G3FA 3QBUA 1DTUA 4V1YA 2QJHA 2PD9A 5KINA 1UJPA 4GIAA 4PRRA 2WSYA 2OSXA 1MW1A 3N6HA 5D04C 2PAJA 2X1RA 3HG4A 1TPC1 2VZSA 3CLWA 1KKOA 1M03A 2G37A 5I6SA 1PCWA 2WQDA 3LOTA 5F4XA 3TROA 3MHUA 1JI1A 3JW7A 3DBPA 3IGXA 2CXEA 2NT0A 3MYOA 3AMCA 1KFBA 3KTCA 5LXEA 4HK5A 1OABA 2ASHA 3U0HA 1Z44A 1SZEA 1JF6A 4PTXA 3PULA 1QATA 2PB1A 4DLFA 2GL5A 5A2CA 2X1UA 3SN0A 2RDTA 1OD0A 1UKTA 3WENA 3LCGA 2J8TA 3PHAA 5PTDA 2GUUA 5BRQA 4GO9A 4GINA 1OINA 5G1TA 1FWIC 4BQ5A 2YFNA 3DDMA 4TUFA 1PDZA 5H8PA 1TCDA 2V9DA 3LX9A 5C5YA 3N2OA 4HNTA 1UZ4A 3W1AA 3WDRA 3DN5A 3UXKA 2GPTA 1SPQA 3WQGA 1W9XA 1KFEA 2ZUNA 2GVGA 3GC5A 5LHEA 5AZ0A 1ZFJA 1OBAA 3DIPA 3JU2A 2J8FA 1EJ7L 5D2XA 3WDQA 3OHMB 1FWEC 4RNFA 4CNTA 4F0MA 3B8WA 3WLKX 1YMYA 2Y62A 3W7MA 3ITGA 3NG3A 3PM6A 3FJLA 3PFRA 2YBUA 1DXIA 4D9PA 3ABQA 1OYAA 3WLRA 4DYKA 1N8WA 3CAVA 3W1RA 1P7TB 3S5OA 5F2GA 1TKKA 2CLMA 3IAPA 3DC0A 1AQ0A 4CD5A 1GPFA 3AS3A 4QDPA 4FXSA 4F40A 4US6A 3AZRA 5I3GA 3FHAA 1XLIA 1EH9A 3LTSA 5AHIA 3M44A 4V28A 1O5QA 1ZB5A 4HB7A 1EP1A 5D38A 7A3HA 1BFNA 4EACA 1HKKA 2VR4A 5D03A 3ERPA 1EBHA 1ZPTA 3E0VA 4PBEA 1Q6RA 2HE5A 4IMDA 2NLIA 1PIFA 3GTFA 1OFEA 1MDRA 3QGVA 4Y9NA 4TR9A 5BOFA 3COTA 3DXIA 2E67A 4HA1A 4CU7A 1QASA 3P6LA 2WHLA 1NJJA 1EGVA 1RA5A 4IQDA 3DI1A 4DF1A 1CLKA 1OC5A 3L2IA 2WW5A 3WLMA 4QEHA 3WX7A 4PTNA 3N13A 1VFSA 1QNPA 3H22A 4QXIA 1VLIA 1IWBA 1EC7A 3SRHA 2ZUSA 1KQYA 5HINA 1VFOA 3LMZA 3WQWA 5I23A 1QHPA 1O94A 3BG5A 4QE4A 2E8ZA 3A5VA 1QNRA 1RCXB 4L1GA 4LFYA 5EB8A 4Q4OA 4GI8A 4FI4A 5FF2A 1IXPA 5LNRA 2W91A 3UG8A 1M53A 2QIWA 4Y9PA 2YCLB 2OZ0A 3MVTA 2XHYA 4TX8A 3K8KA 2TMDA 2WCGA 2Y7GA 2FZ8A 1EUNA 1M1BA 4H8HA 1ZCOA 4H6QA 1WZAA 1NP0A 4P7RA 1P6CA 1OCBA 5A8GA 2C14A 4XBSA 4IP5A 3BO9A 3ABXA 3M0HA 2Z25A 3IGHX 3PJUA 4BFAA 3JVAA 3GKAA 1BD0A 1W1B1 1S3TC 3PP7A 4PULA 3VD4A 4JTTA 1XIDA 5CC6A 1JZ5A 1EEPA 4PCPA 3DGBA 2NQZA 5A8NA 4WIWA 5BXPA 4DWSD 5EU9A 5D4YA 3QEZA 1XSKA 3QQ0A 4WF7A 4PL1A 1C92A 4G1NA 4CQ8A 2DT2A 1UKQA 1XL9A 4LUTB 1E1CA 4UFJA 4QDWA 1EO5A 4H9MA 3BQ6A 1PZ1A 1QU4A 1OD8A 2XIMA 4UMBA 4WSHA 3TQ0A 3THUA 5HK4A 5TF0A 4J3SA 1C90A 4ENLA 4J3ZA 4EPBC 4MY9A 4GI4A 1MNZA 3SQSA 3NQ8A 9RUBA 1TZZA 3NPVA 3NDOA 5KITA 3KOFA 4RZ4A 1A5OC 1QNQA 3O8AA 2OQYA 3F2BA 4I9MA 5G5IA 1JULA 1EF2A 1ODZA 3CPRA 1K77A 1UR0A 2Y5SA 4JIEA 3D46A 1OWQA 4NX5A 2J9XA 1F4HA 1FP8A 1OC6A 4A3HA 2E6FA 3WNLA 4O12A 3QV8A 1HX0A 1V0MA 5CQ1A 3LLFA 1VR6A 4EXQA 3WH5A 3RRXA 3HJZA 5D2YA 2CLEA 3CBWA 1M9HA 4BQ3A 3TSDA 4WRHA 2BFGA 5HXMA 1FWJC 3SUTA 2IPFA 1ITQA 1QI4A 4D6JA 3XIMA 4M6PA 3AJXA 1TPWA 2ACSA 4I5XA 1MUMA 3KW3A 1UD3A 3QF0A 1SFTA 2VJXA 1PO9A 3L65A 4DNMA 1E5JA 4B92A 2VEFA 3A47A 3EDKA 1UPMB 1XLJA 1JI2A 4KW2A 4DBWA 1MSSA 1DHPA 5A1AA 4DI8A 3UXAA 3K4WA 4S3AA 1LG1A 3WK3A 3WDJA 5A6MA 4BY3A 3LLXA 3E9AA 4MWAD 1PAMA 5A2BA 2HTMA 1JNDA 1X1ZA 3U5UA 4Q4PA 1NSJA 1R8LA 4R88A 1ZP3A 2YCIX 3KL0A 3V36A 4HMCA 2QJJA 4AWTA 1V08A 5DELA 3ZWTA 1KNWA 3CYVA 4JHZA 3VIKA 1Y7VA 3QQ1A 3AUOA 3AQUA 4IG2B 3FY1A 1P6WA 1MW0A 4ZMGA 1JDAA 1E4MM 3RFAA 2WC4A 3S2CA 4MFEA 3EX6A 2WHKA 4G56A 4JYFA 4N42A 1S5NA 4H6EA 2C8NA 3W73A 2V2CA 2AAAA 8RUCA 1WKFA 3USZA 4JTFA 3CMFA 4OJYA 4FMVA 3WD3A 2HE8A 4XBJA 2GYIA 3WK1A 4DZIA 3NQ6A 3I3BA 1RPKA 2A1YA 5FSEC 1PE1A 4Z2IA 1NU5A 3FLUA 1E6PA 1V51A 1LYXA 1R6WA 3CV7A 4AHOA 5H2ZA 3WLNA 4Z1DA 1EWEA 2BXZA 1IEWA 5EMLA 1C29A 4OIFA 3UXDA 4UFKA 1BTCA 1GOOA 1OQFA 4AWEA 4CCDA 4S2CA 3THAA 5LSMA 3QZ6A 3DFSA 3PS7A 2XIIA 2D24A 2Z7GA 1EA0A 2B7QA 2FVLA 4JD4A 1BXBA 2QDEA 5B7YA 4LQ1A 1KRBC 1YBQB 3AICA 4DUXA 3S0CA 2GQAA 4A21A 1UA7A 1A5CA 2V30A 4IIEA 4AIBA 4LB3A 1MQQA 2WNZA 1MUCA 2XG9A 2XH4A 2NVDA 1XINA 4QR6A 3PY2A 3HURA 5XIAA 3HPZA 3UR5A 4PCNA 3BPWA 3PZNA 3QY7A 1KGUA 3VIMA 4ZO6A 3WO8A 3VABA 2GGHA 2X1TA 2BX7A 5AN7A 1Q8AA 1VLWA 3NQEA 1MW3A 6CGTA 2OODA 2YBTA 3FYYA 1OFBA 1OB0A 5DMNA 1JRBA 4Z1YA 3VMOA 3PBGA 1K7EA 4XAGA 5IBXC 4A8LA 2PDIA 1E72M 4FLOA 4HIBA 3G18A 3DEQA 5DRCA 3VIPA 1YPFA 3ZVHB 1NY1A 5C54A 1JCMP 5DF0A 2BGQA 3MUAA 4GI9A 4PRWA 2P5NA 3QGKC 1V3JA 3DUGA 4RUBA 3MJMA 2QR6A 2P76A 2HQAA 3C56A 2BY1A 2UBPC 1HTIA 1EJSC 3E74A 1SJAA 3B8VA 3MUY1 1TIMA 2XFFA 2BMBA 2VX7A 5T26A 2C7FA 2CYGA 1ICQA 3MCNA 5CBJA 1D3GA 3KTXA 4J9JA 1UR8A 1TJPA 1EXBA 4W7VA 4GLEA 3SIZA 4JIRA 4OFCA 3I10A 3E96A 4D6EA 2GDUA 2OSWA 3ARUA 2ZXQA 5C2CA 4PBGA 3BLDA 4FS9A 4W86A 1F6YA 1UYQA 3K2GA 4FNTA 4O1AA 3MUXA 3W1NA 3GWQA 4FLQA 4XD3A 2DH3A 3GVWA 3E12A 3PZUA 4DHGA 3SY1A 2NQJA 4CVWA 1IR2A 3SR7A 3UZYA 4PA8A 3CH9A 2VX6A 1LORA 3CL7A 1IV8A 1JQVA 3CWHA 4YWSA 2FJUB 1GVFA 2HISA 3BLIA 1FHLA 1KGWA 4XVDA 1V3MA 5DLCA 1KXVA 1NP2A 3AIVA 4XSMA 5MF5A 2PDCA 1I0DA 4LCSA 4DZHA 5DCEA 2DJLA 1Q6QA 2A21A 3EX4A 3GNXA 1SR9A 3A24A 3CB8A 2RDXA 3HM7A 1R3WA 1E73M 2PE4A 3VGGA 3IRDA 4XWUA 4BI5A 1U1HA 5BMXA 2C79A 1R5YA 3T81A 1TSIA 1EFZA 3NGFA 1KR0A 3KBMA 1H61A 5DMYA 3VDCA 1V6TA 1WKEA 1P0BA 2WSRA 3HGOA 1QNOA 2PRHA 4BCEA 5CSUA 2YL5A 3ABOA 2RFGA 1PUDA 2XVLA 3O05A 4H8NA 3CV1A 3HGSA 1KFCA 3A64A 4IICA 2YA2A 4ACZB 4O8AA 3CAWA 2OOGA 4M8UA 1QTWA 4WVXA 3ZJ7A 5TQLA 1IT0A 2BY0A 2A3LA 3EWYA 3U5YA 2VX5A 2O4MA 3CC1A 4QFUA 3RLVA 2D3LA 3A22A 2QT3A 3AALA 2W63A 2E40A 1VFLA 3INPA 1LQ2A 1L8PA 4NAEB 1FX6A 1SGJA 5HAOA 5T9BG 4C65A 5I03A 4B9ZA 3W2NA 1QI2A 4XB3A 4M82A 1TTQA 2V2DA 3W25A 4QRNA 5DANA 2XIOA 3DG6A 2C1GA 4DM1A 4ADTA 1PZ3A 1NFGA 5CAHA 1ZJAA 2OVLA 1UR2A 3IJLA 5DMLA 1KFJA 2XSAA 1XBYA 2QMKA 1PV8A 5F2IA 3SY8A 3L5MA 1ENUA 4NRSA 3GHTA 4AH7A 2CZVA 4NYUA 4I7WA 1T41A 5EYWA 3OG3A 3N6QA 3B9OA 3H70A 1DP0A 3O2LA 3NUKA 4H9VA 2A3CA 1FOBA 3BSHA 1MEIA 1JGIA 4PYSA 2PDWA 3ZSSA 5C71A 2Z0IA 1GVEA 2VELA 4LYPA 4MJMA 4PUMA 2YZRA 3EXRA 4H9ZA 3RK8A 2CLKA 2X2GA 1GVSA 4LVDA 3VNMA 5CPTA 2NT1A 3GDMA 4K38A 3VIJA 2DT3A 3AHYA 1XRSA 2QQ6A 5HNRA 2BSLA 1E0TA 1KBBA 5HJYA 3M0LA 1E15A 2J25A 2J9YA 1XUUA 3W2UA 1UD5A 3VD3A 1E9LA 3QH2A 5CPOA 2FPYA 1CTNA 2Y24A 1F74A 4S3EA 2J77A 4F79A 3RGTA 4UR8A 1TRIA 3TONA 1DXFA 2Z29A 1VF8A 3GIQA 4H41A 1E4NA 4ILSA 3IK2A 4IPLA 4J40A 5LNSA 4C6FA 4UTMA 2WCSA 5FCZA 4LC6A 3HPFA 1C7SA 4R7WA 2EJ1A 2Z1WA 3JRKA 3HV9A 5DT5A 1FHVA 2G41A 5I79A 5ABTA 2FQIA 3SCPA 2WMFA 4KCVA 1TR1A 1J11A 3DYPA 4I5RA 4FNSA 1BRLB 4IX2A 5CPSA 1KRMA 1FA2A 1RV8A 1TUFA 2HWGA 3R6IA 3WEMA 2YW3A 4QG6A 3AHZA 1LF1A 1K02A 4LVAA 1OJXA 3EOOA 4M19A 5AC5A 3BAJA 1OT2A 5IFPA 4JN7A 1LUCB 3W7HA 4Q8VA 2Y63A 4C6QA 2IPJA 4JL2A 3T2QA 5IDZA 3UR7A 2DZUA 2XZ9A 2FZ9A 2ZIDA 3MMWA 2PC8A 4U33A 3OJGA 3WEZA 4ZTXA 3B0UX 1FDYA 4PUJA 3QV9A 2VDHA 5E0KA 1LRTA 4A2RA 4J7RA 3PSWA 1T8XA 3CZ8A 4H00A 4FXJA 4RE4A 4MM1A 4ADUA 2WB5A 2IQDA 3EDEA 3WDPP 4X22A 4PFHA 1UQZA 1BF6A 5I3JA 1JNEA 4WGXA 2WHMA 1P0KA 3P80A 3RR1A 3GXTA 1Q7ZA 2KAUC 4ORMA 4QE5A 4S3BA 4QHRA 3EPNA 1OZMA 2WLYA 3CWNA 1WDQA 4GO8A 2GVYA 4FK9A 4LY4A 3ENLA 3GYCA 1YYAA 4BQ4A 2ZYFA 1WOAA 1PYFA 4MAVA 4AWUA 3PZQA 3PWGA 4E38A 1T5AA 4FX7A 2Z2UA 4OZOA 1QW9A 4XAYA 2R9RA 4B9YA 4ERIA 3OLDA 4O10A 4O1BA 4M1RA 1XYMA 3BC9A 3EB2A 3UJ2A 1M3UA 1P43A 3WCZA 1KFWA 3SUUA 2V5JA 4W84A 3B8DA 2VZTA 3NYDA 4JHMA 3N17A 3N9SA 1S1RA 3SFWA 4WUIA 1FH8A 2C1HA 3EDFA 4S3KA 4IUGA 4QNEA 1O66A 5FEZA 1NDVA 2RDUA 1PCKA 3VKAA 3GX9A 4D1JA 4MF4A 2F6XA 2Q71A 1Q4WA 3W7RA 2Q02A 3W07A 5MKGB 5K4XA 2VR2A 1C7TA 3LCFA 3WF1A 3O0KA 2G4JA 3W85A 2X41A 1DPMA 2UWFA 4J27A 1HG3A 2ZADA 1D8WA 4U5IA 2WJDA 1XIMA 3C61A 2FDSA 3V5OA 5D05A 2DQWA 3W02A 2YBVA 3PVFA 4OV9A 3V4BA 1VJSA 3WEOA 5B80A 4CQBA 4PTMA 3VOIA 3NZGA 1KA9F 1ZGDA 1E51A 2ON3A 2RJGA 2QUVA 2OR2A 3V16A 3BG3A 4AEFA 4PGLA 3RAOA 4PMNA 4MPKA 3SIMA 3HFTA 4AC1X 2J9ZA 3VNIA 4KCUA 5I06A 1FKWA 4IIGA 4IGNA 4WJXA 3TQKA 1VZWA 2QCDA 3R0UA 4EIVA 3N15A 2E5BA 3CXOA 3TTYA 3FEQA 1EC8A 4BJHA 2OQHA 3FDGA 3NPWA 1GOQA 1V0LA 4QX4A 4IPPA 3WQDA 4UTHA 1W6TA 4AW7A 1XG4A 4XO6A 9CGTA 3VE7A 2BVYA 4ZE5A 1W0MA 1PYMA 2VRJA 3P74A 3IV3A 4ECLA 3P60A 5EY5A 3W70A 3VOFA 4MJ4A 4MKNA 1M41A 2XFWA 3G24A 3OGVA 3AOFA 3E0IA 4XZBA 2WVUA 1AJZA 4RDWA 3G5EA 4QQ3A 3ZJ6A 5HQEA 1EB3A 1EF3A 3TW7A 1YNPA 1A5NC 5BZAA 1OFQA 2P8BA 3F5LA 3UBPC 3URQA 3W23A 3CPUA 1LOSA 2VWSA 1J0HA 3KOYA 3CUGA 1UWSA 4XTIA 4AZBA 3PBWA 5ABFA 3LHTA 3NL6A 5F1UA 5FI8A 2GJLA 1YHTA 3ARSA 4O1FA 1HL8A 4L1XA 1JPDX 4ORIA 3MI2A 2XH0A 3L9CA 4NYYA 4WHBA 4QCEA 2J66A 3WDIA 4JS3A 5JBEA 5DFAA 4U31A 4JIQA 4S2BA 1K7XA 5A8QA 3KVJA 1XI3A 1H50A 1GZGA 4ACYA 1AK5A 5CC5A 4BWLC 5AZ1A 1MXSA 4CKQA 2CKSA 1ELSA 3SAZA 3N73A 1DIOA 5D2WA 4KWVA 3GG7A 3AYTA 2NV9A 3WMSA 4E6MA 3H6OA 1S2UA 4BHYA 4NKCA 4C6EA 3YPIA 1ZBCA 3IVTA 4YU1A 5I77A 2GGGA 3VD5A 2A7NA 2FGBA 2O56A 2J7BA 2XM2A 3ZLFA 4ZL1A 3BLEA 4GYPC 4UCFA 2ZX7A 4HPNA 2W27A 1XBXA 1GKRA 3E38A 4DLMA 3B0XA 4FP1A 2XVGA 4NG3A 4YTRA 3UVAA 1J0YA 1GZ1A 3RX3A 4IFRA 4MDOA 1W3NA 2Z1BA 5BWFA 2JKEA 5EKYA 2ZVIA 1G69A 4Z2KA 3K8LA 1E3XA 2I56A 3NVDA 4C7DA 2W67A 4OV4A 3H2MA 4DJFA 2B4GA 1V3HA 4G7EA 4FHAA 1U5JA 2V38A 2YKKA 2ZX8A 4V33A 4OHQA 1QCWA 4ZBCA 2I57A 1PTGA 3DGRA 2DZVA 1GQLA 3VILA 1HGWA 3AYSA 1R30A 3UEQA 3Q37A 1E9ZB 4XIMA 3BJSA 4GUIA 2ALDA 2R82A 3QKEA 1TJ2A 2VGFA 1Z48A 1PX3A 3KZSA 4XX6A 4C1KA 2OQLA 3M64A 5JVLA 1CGUA 4UQDA 1RA0A 1WYIA 5AECA 1UCWA 3W28A 1VRXA 1IT7A 4WY0B 2VZUA 4C6IA 1ICPA 2WWDA 5EFDA 3EA2A 1Q2SA 3UQNA 2B0MA 3BURA 2Y8VA 1WQ5A 3W24A 3L4WA 5E0FA 4GX8A 1OADA 1KLYA 3U3HA 4GC3A 4NHVA 4ZQOA 1PKMA 1TYGA 2D1ZA 5FD0A 1LL7A 3GW3A 2FMOA 1WB0A 2O9OA 5CPQA 3VZYA 1KBIA 1GORA 2Q01A 4GD0A 2GK1B 5I3IA 4WGHA 4EAMA 1Q4NX 4ZR8A 1J0IA 5HUPA 3GDKA 4XIAA 1V3IA 1MZHA 2VGBA 5A8OA 1K6AA 3E3HA 2J78A 4IHCA 3K30A 1NM9A 3B9AA 3KCLA 1OC7A 5FEPA 2OT1A 4CQAA 1RJPA 3I7QA 4XZWA 3PJWA 2WO5A 4MUZA 4PN2A 3GFXA 3SURA 4IL0A 4IQLA 4GFSA 1D8CA 4QEEA 1REQB 3LERA 4PSRA 1K7FA 4DVOA 2ZXDA 2WVVA 2PS2A 3JZUA 3BV4A 3UYIA 1JPHA 4TVDA 4L4OA 2BVWA 4LAMA 1G0CA 3OLEA 4NIRA 3MO4A 2ACQA 1MVYA 3P14A 4PUNA 4M6VA 1PDYA 3WF3A 3IGSA 1B9ZA 2J75A 3U2EA 1HKWA 1FQ0A 2BHYA 3T6CA 2FGLA 4I5UA 1DEDA 1DWHM 4O8RA 1B5TA 1K9TA 1BKHA 3UPBA 1MFVA 3CYJA 1TV2A 3J7HA 1FKXA 2PURA 2VOTA 3BAKA 4GBDA 1BEUA 2INFA 3WJXA 1H5VA 1K8XA 4DWSA 3U7VA 4IIBA 4DJEC 3QR3A 3NTYA 1XLCA 2HDJA 2DVXA 1LLWA 2OKOA 4H6RA 4GUJA 5T8GA 4QJ4B 1LL6A 4PMQA 1F8IA 2HPIA 3VIOA 4W4QA 3GVQA 1H51A 4CD8A 4MLJA 3RM9A 4DXXA 4AVFA 3GAKA 1VCVA 5ECVA 2QAPA 1GTHA 1VPQA 4D6HA 3TWAA 1H11A 1YNYA 1EPXA 4GCAA 4UB9A 1KB3A 4MMWA 1HKVA 3O07A 4FF5A 1W2VA 4U2YA 2DZTA 1CENA 4DBUA 4DBEA 1R9ZA 1TVLA 1JDFA 1SMAA 1PHQA 4JGDA 3OEXA 1WUEA 3UZXA 3PBVA 4JFWA 1NIUA 3PTDA 4FXRA 3EX2A 4L9XA 1Q6DA 3BWWA 1IEIA 3TA9A 1PXGA 5GNYA 2PWVA 1A5KC 2NUWA 4IMGA 2I17A 1RAKA 4AXKA 2DJXA 3SRFA 1SZFA 3A4XA 3AS2A 4HK7A 4H9UA 3SY5A 4D72A 1DYSA 2VR5A 5E70A 4UQBA 1W9DM 1A0DA 4IMAA 1PBGA 4HU4A 2ABAA 3STCA 3ES8A 4H3DA 3V0TA 3ZVIA 4PE8A 5REQA 4O28A 1K3UA 1EQCA 6ALDA 1NVMA 2FTPA 1H41A 1N7KA 1A50A 1WBJA 2DSKA 2E3ZA 2HBXA 2O9PA 4H2HA 3SCTA 4EPEC 4RNIA 4GQRA 1H2JA 4C6MA 4Q33A 3KP0A 1H1ZA 3ZT5A 2ONEA 4JKLA 3V75A 3P8JA 5D9PA 1XPGA 3NOYA 4LT9A 1G5AA 3EYPA 2FB2A 1V79A 3WFZA 4W87A 2IUZA 1UP3A 1DWAM 1T99A 5XINA 3R5EA 1F61A 1UOZA 3VTRA 2A4AA 3W1UA 3VD7A 1SFSA 2FZDA 1OX6A 2PGRA 1G67A 3FCPA 3UNTA 1VP5A 1C8VA 2YW4A 2AL2B 4JX4A 3L0KA 4ZO7A 3SQMA 2FVMA 2ALRA 3NEHA 4E2OA 3WELA 4N9EA 1MQRA 1RR2A 2PP1A 3DG7A 2PF0A 4HJFA 1CI1A 4HP5A 1V3KA 5KETA 1UIOA 4ROQA 3GVVA 1LZOA 3CWOX 4ICCX 3A3HA 4J3UA 2E09A 3TC6A 1E4IA 1RPXA 2J79A 3ZXWA 1L6WA 3GVGA 3N4FA 3DERA 1MXGA 3H8AA 3CIVA 4CCCA 1UMLA 1WZLA 3NSNA 5GNXA 1WNOA 3R43A 3EXTA 1H7PA 1DKWA 2YA1A 3VC6A 3OQ8A 1US2A 1L6SA 1UR9A 3DCPA 3WMCA 4DWSC 4NNCA 3IWPA 1TMHA 5JIPA 3A12A 4QGCA 1TA3A 2VP8A 4RDZA 4XSLA 1VS1A 3F5KA 4CD7A 1V93A 2JEQA 3ITVA 2VDIA 1KXTA 2KX9A 3WLPA 2ISVA 3VGBA 4Q8QA 1WKYA 3LMYA 3SO7A 1PKNA 4XK2A 2QPSA 3JR2A 3CEPA 4GJIA 4V15A 3DFHA 3E0FA 3PBMA 4PMJA 2CERA 1VRDA 4HZ6A 1TJRA 2FZNA 1J6OA 4F9DA 1YW1A 3TLLA 4JX6A 1R0MA 2XIBA 4OVXA 4OKDA 5AB3A 1H7XA 1XRFA 2Y88A 4XVEA 3CQKA 3M5VA 2QCNA 3ZR4A 3M5XA 1XJBA 3S1VA 3GK0A 1TZ7A 1E6NA 3WL1A 1F4AA 4L65A 1JDCA 3C3NA 3RU8X 4YXGA 3W0KA 1UWTA 3C6CA 3C4UA 2JFEX 3AHTA 3H7VA 4GWEA 4EOUA 2GUYA 1OFAA 4XG1A 4DBDA 3CAQA 1GVYA 2ZQ0A 2D2OA 1HIZA 1UBPC 1QWKA 1R3VA 4UMAA 2YB1A 5HMFA 4KEUA 1E56A 1JPMA 1VFMA 2XFRA 2FYMA 3N4AA 4YIWA 3C0LA 4GVHA 3VO0A 1H7NA 2LLEA 5LIKX 4O53A 4Z2HA 2YL9A 3MV11 2D2JA 3QOMA 4JFVA 2BV9A 5E6ZA 2E5DA 3ZVHA 2PP0A 4PEEA 5CG0A 4GISA 5ECUA 4YTTA 4HYVA 4ATLA 4E3TA 5IM51 3HPSA 5DN1A 3LS9A 3AMGA 1AZ1A 5GJNA 1MZRA 1W3JA 2WMGA 1G9HA 2XINA 4AZCB 2OZ8A 1ZRQA 3WJZA 4L61A 3AZTA 3ITXA 3R10A 2OGYA 2V5DA 4XZNX 4ZEPA 1KXHA 3GIPA 1I4NA 2ZUWA 2POZA 1O5XA 4TO8A 5HQLA 1J6PA 1SU5A 1H3GA 4C5ZA 1TTPA 1UP2A 1W91A 5CPNA 1S2TA 4CU6A 1R7AA 4N2YA 4FA3A 5LIUX 2CHRA 1JD7A 4H7VA 5CC3A 4S38A 4AX7A 2JKPA 3GB6A 2P1FA 5I0DA 1MW2A 1OEPA 3TN5A 3P5ZA 1NFPA 1YBQA 1ZBWA 1J5SA 5DXXA 3VCRA 1GKPA 1GW9A 3AO0A 4C6KA 2BZNA 4JX5A 3TYAA 3PB2A 2C71A 4AY1A 3IRSA 3QR0A 2WNWA 3CHEA 5I3HA 3TQPA 4AIUA 3RMEA 3ARVA 1W3TA 2YA0A 1HJUA 3AROA 3W87A 2WPGA 4L80A 2W3ZA 4A6GA 1S2CA 4FR6A 1QO2A 5HUOA 1L6YA 3DG3A 3V5FA 4JYDA 5EMJA 1IHIA 1RK6A 3KVKA 5CKSA 4OU1A 4LS0A 1IXQA 1E1CB 4PMZA 4QSHA 4HA3A 2DU2A 3B05A 1H7RA 3ARYA 1P1MA 4J35A 2Y8UA 1I6NA 4AEEA 4RXGA 3VKCA 5HMSA 1QOQA 3F4NA 4LJ3A 4NJHA 3UXIA 4KWWA 4GG9A 1F3EA 4W89A 5AHLA 3AXHA 3EGJA 4C7GA 4IPJA 4JY8A 3TLQA 4IFKA 5C7HA 1BWKA 5H8UA 1ZP4A 1GQKA 5A6LA 4IJCA 5KMYA 1G7VA 2CZFA 4A8RA 1QJWA 4RNJA 3WQPA 3NPXA 2XTKA 1XXXA 3KUMA 1XLFA 3AUJA 1RJRA 2D22A 1L9WA 4LVBA 1IE7C 3C52A 4L1WA 2V6AA 3FGCB 4FR1A 1ALDA 3LGGA 3WQ4A 1IYXA 1KXQA 2OEJA 6TIMA 2XISA 1KCZA 3KZPA 5CGQA 3NL2A 1IF2A 4L4LA 3GY1A 3N3TA 4GE8A 1HP4A 4Z2JA 1W9BM 1ITUA 3WUEA 2R94A 1XLLA 2VEPA 3PFMA 5HPCA 4OTKA 3ZO9A 3PNUA 2MNRA 3K8MA 1KRCC 2I9UA 2WMKA 3U4AA 3IPWA 2FGZA 1KCKA 3IJQA 3UF9A 2WJFA 4XD6A 3W37A 2ZRVA 4JTAA 3LCIA 4U2ZA 1JFXA 1OF6A 3T2OA 1QK0A 2W66A 4DZAA 1W1A1 1KQZA 2YL6A 4G7EB 5JXQA 1ZU8A 1EWDA 3UCDA 2JALA 3F4VA 2AGTA 3WUFA 5I07A 3CIWA 3QRHA 2A6LA 1RALA 2D2GA 3M4HA 4YTQA 4B5TA 4UNIA 1XFBA 3FOKA 4WD0A 2ZC8A 1GYLA 1C93A 3MI3A 3G1VA 3LM3A 2QUMA 3EMCA 1S5TA 2RHGA 1Q7QA 1FFRA 1A3XA 1ITXA 3THDA 1TPUA 5FF7A 1S2WA 2PCEA 3EB3A 1PX4A 3IGUA 1BPLB 1KRAC 1GVRA 4X0VA 2GSEA 1R46A 5H1WA 4W85A 2P3EA 1QT1A 2E7FA 3FAXA 3OYZA 3RLGA 1O95A 2WPBA 3W22A 3TMLA 4MYAA 4LVFA 4L6HA 4WJ8A 1ZBKA 4XTDA 4AC7C 4NZ3A 2FJKA 4JN6A 3M5ZA 3OZMA 5C9RA 4B5SA 4GZ7A 1RHCA 3CUIA 3ITTA 2VURA 2JF6A 1EZWA 4AISA 5HQMA 1TX0A 2W0UA 3W86A 3WQ5A 2VO5A 3F03K 2RGMA 2Z6IA 1GQJA 3BAIA 2IQTA 4CQ9A 1F76A 4BWLA 3QXBA 2V68A 2YJQA 4DJFD 1GT8A 1SO6A 2ZFAA 2YCLA 3TMQA 3WY1A 3U48A 2PU1A 3B9EA 3UYCA 1FY6A 3ECQA 4M51A 3ZLHA 3GG0A 5D32A 2NUXA 4ZB2A 4JTHA 1XV8A 1KWGA 3UGVA 5TNVA 3TJLA 1CT5A 3E1F1 2O7QA 4US5D 2FH6A 3AHVA 4LAOA 4HCHA 4H9TA 5E9XA 2DPEA 1K4GA 1GG1A 3BZJA 2FMNA 1W32A 5BOEA 3IIXA 4AMCA 3URNA 4HSHA 2D20A 4BEUA 4F2TA 4C6CA 4JCMA 4IG2A 4DAIA 4CEUC 3BGJA 3NXFA 2VFHA 3KFTA 1EJRC 1H60A 4S1FA 4FSAA 4RR4A 1VGAA 1TJ1A 3M7SA 2E4TA 2EKCA 3F2DA 1S39A 1KBJA 1EL3A 3PTKA 4GVFA 3F7JA 4XD5A 3VCCA 4HNUA 3QN3A 4AF0B 5LIXX 3A3XA 1DV7A 1RH9A 4NX0A 1FHDA 4R7OA 3T7VA 1EP2A 3GHUA 5GNZA 2O55A 1SFLA 5DQPA 1A80A 1G4EA 3H2OA 1ZLPA 3E02A 3PBUA 2Z7KA 3V0SA 1XLGA 1BSLA 1V6VA 4O19A 3BANA 1JG9A 2ESCA 3T1GA 4O50A 3CEUA 2ZZ7A 3BSMA 2Q3OA 4P7NA 3A21A 3I3DA 4GBUA 5AKQA 1V77A 4E2DA 1AD1A 4ICNA 3E49A 1W17A 2V5CA 4MLRA 3S6OA 4CGTA 5I7GA 3ARZA 3WNOA 4IMEA 3W7IA 3QM3A 3A5FA 3VGEA 3BUVA 2YXOA 1XH2A 3BW2A 3EWDA 5A95A 3SJNA 4QCFA 4JTSA 3W6YA 2P0OA 3O16A 4YWIA 2W92A 4IXXA 3ZMRA 2OYKA 1FTXA 3TQVA 5L9FA 1PWLA 3Q94A 4FNPA 3T4WA 4AYSA 4YYCA 1MI3A 1QI0A 1W9VA 1SYTA 4GUFA 1VCGA 1ONRA 3EPOA 3TAKA 2NXIA 3TSBA 2WVVB 1F7BA 2CHNA 2R1LA 1I2OA 3QHNA 1WA3A 2XDFA 1PIGA 4AZ5A 4U4MA 3VYLA 2R24A 1G4TA 5HMDA 2VTFA 2PC4A 1XIEA 3VU2A 4X9YA 2VFEA 2DT1A 4AG0A 1LLZA 3W7OA 3DU0A 5HNUA 1TA3B 2NWSA 3UWZA 3ZJ8A 3WLJA 2ZRUA 3P62A 1CBGA 4B15A 2PDYA 3QHOA 2PPGA 1D9EA 9XIMA 2UY3A 1BXCA 1CYGA 2GWNA 3NAVA 3V1HA 4ZSTA 1ZY9A 3ANYA 4J4KA 2YDQA 2VI0A 4TX9A 4NUWA 3SSJA 4DWDA 4MUPA 4DRSA 3BH4A 5CGMA 4P7OA 3NQCA 3P0WA 1QVBA 4GC4A 5D33A 5JU6A 3T8LA 4JQ4A 1C8XA 3W7GA 3S6TA 1HL9A 1RP9A 1WDPA 4PL2A 4FX6M 2OOFA 3TYBA 4YCOA 1B4KA 1D3CA 2E6YA 3HGRA 3QTGA 1SJDA 5A3HA 3TK7A 1GHSA 1WUFA 3LV5A 3ARQA 1O68A 1JIBA 3UD6A 3FVMA 4BR1A 4GRSA 4G6CA 4NRRA 1HF6A 2QDDA 4IZGA 3USBA 3A4JA 4B4FA 3S2NA 4IIDA 5CEWA 5BXSA 1B3OA 3HMJG 3CUHA 4WEVX 2BODX 1AUSL 3GXMA 1FDZA 1CGYA 1W37A 3I6TA 2ZUTA 5D37A 4FALA 2PWUA 2A6NA 2YPIA 2NQHA 5D8ZA 3S2LA 1O1ZA 3MSDA 4UUIA 1FCQA 1BAGA 4GNKB 2NSXA 4HPXA 1EA9C 1OX4B 1T8QA 2J7GA 3EZ4A 3KWSA 3WD0A 1XBZA 4M7TA 3KRUA 1M6JA 4UTJA 3N19B 4JIPA 3QSRA 3WIJA 2ZTJA 2CLLA 3DI0A 4O1DA 4HHLA 4M3PA 1RY8A 5FAGA 4ZB5A 1XLHA 4IX0A 3RLHA 3RU6A 2VC7A 4MZ8A 3OVPA 3W7DA 3TYZA 2Q8ZA 2WCAA 2F2KA 3V5CA 1SO3A 2Y0FA 3TTEA 1B1YA 1PWMA 1QOXA 1TCMA 2YDAA 3NQFA 4NXSA 3UZZA 3FVDA 1OSEA 3VOJA 1ZS2A 1G1YA 4JTIA 1XGEA 1DE5A 1QMLA 1BG9A 3GUWA 3TXVA 3GTHA 1F07A 1POJA 2PWFA 4XUGA 1GQNA 3BAXA 2BVTA 1YE6A 3P82A 2IMRA 1PL9A 3CUJA 3G3DA 3SM0A 1EX1A 2VVNA 1XFCA 1LOQA 1JYWA 3UZWA 3RPMA 4L4MA 4HK6A 3UY7A 4N7QA 3HV8A 1VIWA 2AL1A 2A3BA 1FCUA 4UTTA 4RV8A 3KBVA 1M5WA 1XH1A 1OIFA 4GFIA 4FIRA 4L9ZA 4W9TA 3S5ZA 1VH7A 3PTQA 2BHZA 5CBIA 3SUWA 1I60A 3L2LA 1FWAC 1EUAA 2DUXA 2PDPA 1VBGA 2F8QA 1VD6A 4PBFA 3H12A 3L21A 5LA0A 1RQBA 1W1IE 2R91A 5M2FX 2H9AB 4GH3A 2VNCA 4Q8OA 1JAKA 3N2MA 2E8YA 2CLHA 1RD6A 2PDJA 3S42A 1X96A 1J10A 1IT8A 4LYQA 4N6EA 3AIEA 1WV2A 4R53A 4FLSA 1TV4A 3B40A 4NZ1A 1V3LA 3P93A 3M9YA 3VFCA 4I8DA 5DT7A 1CWYA 2EJAA 1QUMA 1GHRA 3W7PA 3NA8A 2CNCA 6REQA 5FIPA 3TIMA 4GIEA 4XUYA 5EMMA 2B7NA 3H7UA 4O1CA 1K1DA 5FEXA 1O60A 4Y96A 2HJPA 4DJFC 3TR2A 3E2RA 1EDTA 3FN9A 4YTUA 3RPDA 1JXKA 3EEGA 2NQ9A 3UPWA 3VKDA 4UOJA 3VX1A 3CO8A 4KQNA 3GH7A 1RVGA 2NW0A 2Z6JA 3FS2A 3WUGA 3KS6A 3M1ZA 4HSOA 4JIHA 3WLOA 4J1OA 3GS6A 4C7FA 1XDLA 3LHZA 5CCZA 5KZ6A 4E4UA 4C6JA 3AIBA 5G4EA 3A6OA 1JZ4A 4Z0JA 3VINA 1VFHA 4AB4A 3AS1A 4DNHA 3WLTA 1V6XA 2B31A 2CHOA 5FJJA 2EG7A 1R3RA 1UIPA 4ZQRA 3OBKA 1C9WA 2OTDA 3L5AA 3W7QA 3C2RA 3IIPA 4RLIA 4ZXOA 3A9IA 4KMQA 3E0LA 3PUEA 1YDNA 3RX4A 3LNPA 2F7FA 3I65A 4TVCA 5DMMA 1EBGA 4HHHA 1FWFC 2DUAA 3NQDA 4UTUA 3KBNA 2ZA1A 3C2VA 5C55A 1WDSA 2P8CA 3MHGA 4K3ZA 1R3SA 1Q2RA 2GSJA 3MWCA 3HG5A 2YIHA 5FACA 2DDXA 3JZEA 3RIKA 2PRLA 2ZCGA 2WZEA 3MUIA 1EJVC 1DTNA 2BS9A 4J2PA 1JXJA 3BLPX 4LPCA 2QMJA 3UCCA 3QR1A 3CL6A 1VHNA 2P88A 4F48A 4BS0A 1ONXA 8A3HA 4IMCA 3U4FA 3F5JA 2J24A 1IZKA 4AEOA 2BOGX 5HMEA 2ZE0A 4FOKA 5D8WA 9XIAA 3N25A 3W72A 1EP3A 3BGAA 3LRMA 1QO5A 3W4RA 3EEZA 5HWJA 3SDOA 4MWAE 3W9ZA 2AL2A 3WFAA 4E4PA 3M07A 2OB3A 1WE5A 1TWDA 5DX7A 5J04A 1P48A 1E1FA 2PRMA 4PMXA 3VKKA 2OG9A 2VX4A 4X63A 2JKAA 3R2GA 1RVKA 2NLYA 1AQFA 3GSMA 4QG9A 2W79A 4WK9A 5FJPA 1XP3A 1JRCA 1EJUC 4IFOA 2HXTA 4E3VA 4YVPA 3W1PA 1V6YA 3UETA 3VNYA 1JAEA 5CJMA 3W1XA 1UWUA 2WKLA 3EOLA 1TMLA 1VJZA 3GC4A 3L12A 3WLLA 3NQVA 1G94A 4JTEA 3LU2A 2B7PA 4S3GA 3GXFA 2PDBA 2PTYA 1J12A 3ZQ9A 3KX6A 3L4XA 1C8YA 5F4SA 3TCEA 2NV1A 3CASA 4LCRA 2DZAA 3AWNA 1XKJA 3TP4A 2NUYA 2FHFA 1JPKA 3H4XA 4UZSA 3RR4A 4ZO9A 4C90A 3PZ9A 1AVAA 5FF0A 4PUEA 4GXWA 4HZ8A 3MW7A 2C19A 3WDHA 2EAWA 3LG3A 4QJ5B 1EPVA 3LYEA 4CCEA 4A29A 3K4DA 1WKDA 2I5QA 2W9MA 2WNQA 2VUYA 1J01A 2VEKA 4F0LA 3C2OA 1CEOA 1V02A 4LAZA 2WZTA 1QRQA 1QK2A 5TBOA 1L8NA 3LBCA 4NY2A 2QCMA 2ATMA 3QOKA 1S5WA 2OO6A 1J93A 1L6GA 1GJPA 3SCQA 3B3DA 3GNDA 5I3KA 3IIZA 5I3DA 3NO3A 3LHVA 1Q7MA 1TVPA 3WBEA 4F3HA 1UH2A 1UR4A 4WSKA 3VIFA 4PCSA 4H83A 1R86A 1HKMA 1G01A 4ACZA 3FJ6A 3MWAA 3EMQA 5A69A 1VIZA 2JGQA 3T2PA 1RZMA 1G7UA 3TW9A 4O11A 2H9AA 1BSIA 1FRBA 4DELA 2QVNA 3H4GA 2GOKA 1W1ZA 1KCLA 3H55A 3SCRA 1J8VA 3G0UA 1J96A 1KM0A 1QFEA 2OXNA 3TX9A 4EXAA 4Q8WA 3PUOA 2RH9A 3WBAA 3OZYA 4HPJA 2QJNA 3T4CA 4Q4MA 3FYOA 1W5PA 3EAUA 4QP0A 2J47A 1M68A 4EWND 1UD6A 1DBTA 3B03A 4IF2A 3LXAA 4K68A 1HVXA 2MANA 3B0PA 3QSTA 4HNNA 4MB3A 3IAQA 2VCCA 3EWXA 1OVDA 2RJHA 4KH2A 4GGBA 3KVLA 1HO1A 4LS2A 5LZLA 4URIA 1XIIA 4C1NB 2VD9A 3APTA 2OEMA 3UFYA 4GNJA 1HQTA 4N02A 1XHGA 1UP0A 7CGTA 3CK5A 1BYDA 3UWQA 3TDFA 1UASA 3CM4A 3Q65A 3O7UA 3CLMA 3EA3A 4MWAA 1XCXA 2WSKA 3N14A 4KKXA 3QW3A 7ODCA 1QPOA 1NOWA 2OX4A 3CO4A 1XICA 4Q4KA 1KCXA 3AAMA 2YYUA 4HTBA 1EIXA 1ONWA 3DFOA 3TW6A 3DKLA 4MIMA 4JXCA 4TXEA 1AH3A 3AISA 1BYCA 1Z32X 4AHPA 3T55A 4KWUA 2QCDB 3CJPA 1AW5A 2PDUA 1IGWA 2ZZ5A 4NI8A 3RX2A 4Q7NA 2FPVA 2BP1A 4EAYA 3THQA 3C86A 4LV4A 3PC0A 3M0MA 4KWSA 4S3FA 1LDCA 2Q3RA 3VA8A 1TWZA 5J5RA 1TPEA 3L0NA 5FJTA 5AFDA 4OE7A 2V0TA 2O7SA 4XISA 1WCGA 4AD0A 3FA4A 1YTDA 2VKZG 1ZAHA 4FAMA 2CIPA 2INEA 4KF1A 4GZEA 4ZQNA 1QPKA 1JF5A 4I8YA 2OLAA 1BG4A 3CIXA 1XWYA 4XKYB 1Z69A 1RJQA 2ZUVA 3EKLA 1U22A 4LH8A 4FPSA 3TAOA 2CW6A 2ZZ2A 2UY5A 4I3GA 3MUZ1 1BYBA 1OG0A 4CQCA 2DORA 2J7EA 3WJWA 2OWXA 1HL2A 5K2ZA 2PMQA 1XKYA 3ZLGA 1A0EA 4ZCWA 1YTKA 1CDGA 2H8XA 3LTPA 3L4VA 4ICMA 3WQOA 4W7WA 4RPPA 2IXVA 2PDXA 4KEVA 3GRIA 3W00A 3PZTA 4HCLA 3RHGA 4Q22A 4J3WA 3VK5A 5I2UA 3NXLA 1IIHA 3NM3A 2VZVA 3BGGA 2E25A 1LWHA 1XH0A 3GM8A 2VGIA 3MI6A 4GQGA 2QF7A 1X1OA 2F84A 3MQTA 3O1NA 5C6MA 3GTIA 3B9DA 3FYPA 5HJXA 1QOPA 5FKYA 2Z28A 1PKLA 4O0KA 3KDOA 1W8GA 3WK2A 1IR1A 4KFNA 1AODA 3MA8A 3OO2A 5AC8A 1VJIA 2QF8A 4G2DA 1TE6A 3UGRA 5HWMA 4DJED 3U57A 4KPLA 2QLYA 3AU6A 1N8FA 2R6OA 3GHRA 4GVIA 5CZ0A 1DIDA 3H2CA 4OOUA 3MBDA 4MADA 2BG5A 4F8XA 2G96A 1PHWA 4JR5A 1YIXA 2ZUUA 1ZALA 1A3WA 4CVUA 3B06A 5D2VA 4DIAA 4WKFA 3GTXA 3SCNA 2P53A 4W8LA 3UXLA 4J5NA 2R1MA 3HOJA 1ZAJA 2XH7A 3AMDA 2OJPA 1D7FA 3MDUA 2O92A 3PAJA 1JEZA 3L7RA 1U83A 3N4EA 4UZUA 1R3TA 4DJDD 4Y9AA 1Q66A 1OHLA 3NQGA 1OYBA 2A5HA 3EBVA 1TELA 4OQVA 2GGEA 4UTTC 5LNWA 5LNUA 3AFBA 2BGSA 2V3DA 3IS4A 4UNLA 1JQXA 4PH6A 4WR3A 1W3LA 1W1PA 1LJYA 4XZLX 1HJVA 3R4IA 2C91A 3QQWA 4CNUA 4M6QA 2WM1A 3CV2A 2CZDA 3PZMA 2QJGA 4AZIA 2J7DA 2DIKA 4AXNA 4A3UA 4JFTA 3QY8A 5GJMA 3VGFA 2PDLA 1A47A 3BCDA 1QPRA 3MSYA 4IJRA 4FZIA 4PMUA 2EPKX 3MP4A 2W5FA 2HZGA 4PB5A 2VRQA 1FCBA 1J0JA 2H8ZA 3KOXA 3T8QA 6A3HA 1R3QA 3LNMA 5C8BB 2GDVA 3QC0A 2X09A 4MNLA 1TWSA 3N2CA 2WXDM 3KRZA 4O14A 1Z8AA 1P0NA 2V81A 1JDEA 3UESA 1W3HA 2WMIB 2A7RA 1OY0A 1TV8A 1U1JA 3QKZA 3I68A 1YPIA 3GAYA 3GZ3A 4ZOCA 1NDZA 3G0XA 1FHUA 2DFAA 3C0JA 3GNPA 3MO7A 2BB0A 1HFBA 3TUUA 2EPLX 3DBNA 1IEXA 2FH8A 1RQHA 4L64A 3MKVA 1GG0A 4AFYA 1HN1A 1SZRA 3S6DA 3DESA 2Z4GA 1AQMA 2BVDA 3F4WA 3MP3A 3OLIA 1MRAA 3KLLA 1DJNA 1E4LA 4DUWA 4B5WA 5FESA 3OOQA 1S3HA 1VEPA 3ZZ1A 1EKOA 1YXYA 3B0VC 4FIQA 4EP8C 2DQXA 1KM5A 3UA3A 4MG4A 2YGYA 2IW0A 2Q6ZA 1B2YA 4ZTYA 5XIMA 1XIHA 3V3WA 1QBAA 4JEQA 4KFOA 3ABZA 2EPOA 5MHBA 4MZYA 2PLCA 1NARA 4JQ3A 3WLHA 4R9OA 3C8FA 1TO3A 3HJEA 4W5ZA 4NL1A 1VKFA 5I00A 2P0IA 3FJNA 4O0ZA 3QGAC 4LRTA 1CGTA 3WL0A 3WQ6A 1R47A 4NF7A 1FWNA 2PZNA 1I75A 3LPGA 1GWJA 4WKHA 2MUCA 1W9PA 3C0QA 4JOMA 4LUSB 2EPNA 3QV7A 3WKZA 2QV4A 2RGLA 2UZ9A 3GXDA 4L6DA 2VZOA 4DUVA 1CLXA 3T08A 2QUUA 3B4YA 3CS2A 1P6BA 1I2NA 2WM0A 3DH7A 2B7OA 4P7LA 5A6TC 3IJ7A 5JUVA 5HA7A 2CITA 3ME3A 2BBFA 3QJAA 4REQB 3UWEA 4GXPA 1TPFA 2AQWA 1YRRA 1U5HA 3F2CA 3CH0A 2I1OA 2Y6ZA 3FHQA 1W54A 3WMBA 1H49A 3IJ6A 3OODA 1QW7A 3CHCA 3TN4A 4DQWA 4H7ZA 4HCDA 3N1AA 5HWNA 3W84A 2R1PA 3EOUA 5EBUA 2PGFA 5E0CA 4QBXA 2OMAA 3H23A 2ZRYA 2AKMA 4YMZA 3B8SA 3CUZA 4RJEA 1FWBC 3B8TA 2EPMX 3OBEA 1RLCL 5M03A 1HJWA 2ZXBA 2GJXA 3VDBA 1DIKA 4QSFA 1SZGA 3HB9A 4MKSA 1AW2A 3CHFA 2D0GA 4RNHA 3D47A 3ALFA 5U4NA 3S2MA 3BDKA 4IIFA 1LRNA 1E9IA 2ADAA 3DZ1A 1DJGA 4KERA 5HOSA 3HN3A 4TV5A 3WG6A 3VM5A 4LUSA 1CXLA 3OZOA 1HW6A 4DJDC 5K7JA 2SFPA 1XSJA 5D30A 4M5PA 4JAWA 3VOCA 1SO4A 3ARRA 3CV6A 3WBXA 4UR9A 5KSWA 4GKLA 1QDSA 4YN5A 3MS8A 5BW6A 1XYLA 5CSYA 2J13A 5LNVA 1VEOA 3PPCA 3O6CA 1XSIA 1EJXC 3GFYA 1YQ2A 3GXIA 1KR1A 1UD2A 3V35A 3SGUA 4LRSA 1VBUA 1ITCA 4HJWA 4EPKA 1JYVA 4N9CA 1XIBA 3H2NA 3SECA 3G8RA 2HVNA 2XZ7A 2Y89A 1G4SA 3M5YA 1LBMA 5EMKA 4HKPA 2C6QA 1PZ0A 3ANUA 1DQWA 3IJ8A 3ABRA 3UWWA 1A5SA 3RM4A 4HHMA 2ZX9A 4IP4A 3MT1A 4GA8A 2ISSA 4Q7BA 2YZ5A 3ITCA 3AXXA 1XRVA 1WP6A 4C6NA 2GZXA 4P8VA 1JYNA 1Q6GA 1RP8A 2GDQA 1M7OA 1HUVA 3MBFA 1TPB1 4AVNA 5L6UA 3I4EA 3W82A 3RF9A 3GDLA 1OFDA 4JICA 4LBSA 2QV5A 4X9SA 1E0UA 1UWRA 2V2HA 1BXNA 1QHZA 4DX3A 4MTVA 4PR4A 3SUSA 4D2JA 5A5WA 3LGEA 4F4RA 2OELA 2BWGA 1K9DA 2QCFA 3CL8A 5C9WA 1WXJA 3BK0A 5HANA 1TB3A 3VNLA 2E0PA 3G1HA 4DZ5A 4KT2A 3NQMA 5FA5A 3QW4B 4EKJA 5FJIA 1W5NA 3PK7A 2QKFA 4MNMA 1GVOA 5IRPA 4UFHA 3VNKA 7ENLA 3SCOA 1JGMA 2TSYA 2NQ5A 1UBSA 1KFKA 1DJQA 3LM7A 1PEZA 3B4UA 1C9DA 3CTTA 3P67A 1UOKA 1U1UA 3EMZA 5DCDA 3N18A 3KVMA 2VL4A 1O5RA 2Z2BA 1DJIA 3FK4A 2QULA 1Q45A 3STEA 1XYCA 5CBBA 2AKZA 1K9EA 4Q32A 5A94A 3G1XA 3N9RA 2PD5A 3KM8A 3FFSA 1AA1B 5JH1A 4P8WA 3LZ3A 2A85A 1H0GA 4L6OA 1C8QA 1TJ0A 5IHSA 3WLIA 4JZ5A 2XSXA 3S46A 2AAMA 2W62A 3N2BA 4HN4A 3N34A 3T0AA 1SM9A 4QIUA 4MGGA 4KEZA 1E43A 1M7PA 4PMYA 3TKFA 2CETA 2ZE3A 2X0YA 3PUGA 3GR7A 4E8CA 2A2IA 2P50A 3TH6A 1QAPA 3AXKA 1V6WA 1DJZA 1Z42A 3WH9A 4XAZA 4ZENA 1SJCA 1VBJA 1OK6A 1CXFA 4GVGA 3WF4A 3B04A 2DEPA 1VPYA 1PIIA 4AD5A 4KCWA 3T44A 4LYKA 4ZQPA 1P7TA 4QDMA 1F6PA 2Y7EA 3TZFA 4EXBA 1I2QA 3PZGA 4HMNA 3SEPA 4HA0A 3NO1A 2NVCA 1LP6A 1TZ9A 5CZSA 1JJKA 2VENA 4D8ZA 3FIGA 2E5CA 3G2GA 1GQIA 2Y7DA 4NZ4A 2EO7A 5CZJA 3R8GA 2W4XA 3WQVA 1UW9A 1GOKA 2Y2WA 1RBAA 3AIQA 3EX1A 3EOEA 4IM4A 2BXVA 2G8ZA 2XGIA 5HR6A 4WY0A 3LLDA 3Q4DA 4AY7A 3DFPA 1X39A 3NURA 2HXUA 3TYDA 4OWGA 2FB3A 5HDRA 2J7FA 1TTJA 4YPJA 1RBLA 3EDDA 4PRTA 3IIOA 3EKZA 4ASTA 3CPGA 3RYSA 4KIRA 2EG8A 2VC6A 3G1FA 4MPQA 5KZEA 3U2OA 2ZWYA 4X60A 5A6SA 1ADDA 4AZGA 3GNOA 4Q8PA 4F2BA 2V3FA 3CZGA 3MC5A 1UD4A 4M81A 1H1YA 4NJIA 3PN8A 3UNDA 2OX1A 2R1NA 3G22A 3N12A 3URBA 5J8LA 3GO2A 4RKAA 4YNGA 2TRSA 2CLOA 4P7QA 5A6KA 2V5KA 1N2VA 3RILA 1O6IA 1FH9A 2VFIA 1V7AA 3FJ4A 4AY8A 3TWBA 7TAAA 4A8NA 3G1AA 1O12A 3UJRA 3NGJA 4JFSA 3WFLA 3CT7A 3NDYA 3CGTA 1CXEA 1P0EA 4HN8A 1L0PA 3M0YA 2J4GA 3APGA 3PB0A 1JZ7A 4LAKA 3HMCA 3ZR6A 1BGGA 1F9CA 1PTDA 2E68A 4KRZA 1FWDC 2PWEA 1XS2A 4DXKA 2Z00A 1XRTA 3KCJA 3WJSA 2WSPA 3FGCA 1CXKA 3R94A 2NXGA 4QE1A 1TWWA 3IARA 2FKPA 3LB0A 1J5TA 4J28A 5BOOA 1XC6A 4MKVA 2TPSA 4YYFA 3GXPA 1X8FA 3ITOA 3A13A 4WKAA 4UTFA 2UV8G 2EBNA 3MZNA 3C0SA 2WKJA 5K9XA 2WZMA 1EOKA 4AIEA 3HZ3A 4AYGA 2Y1HA 2VCAA 1UC4A 5I78A 4ZXLA 2G95A 3IJDA 2VHLA 2HVOA 4CLMA 3PZIA 3QVQA 3UY8A 1UG6A 3FXGA 4LUYA 1Q3NA 4UQAA 2HBVA 4MJZA 4LSBA 3W53A 2Z2AA 1UA3A 2YX0A 1ONEA 2HNHA 2PTZA 4YVVA 3ZOAA 3B0YA 5EMUA 3LA4A 2DZWA 2ZRWA 4K2SA 4P5UA 4K1WA 1EJTC 1XYZA 1EHNA 4IQJA 2C3ZA 3OIXA 4DPQA 1XG3A 1V5XA 1FP9A 1FWWA 3QHMA 2O9RA 1EDGA 3CU2A 2DGAA 2DSZA 3EX3A 4UMCA 5D09A 1LG2A 3R0KA 1YX1A 2DZPA 4MFDA 3LRLA 4UFIA 2DW6A 3E2VA 4UOQA 4DM2A 2WANA 1BF2A 3G77A 4DF2A 5DEZA 4WLCA 8XIMA 1A5LC 5G2WA 2PDHA 3I6EA 5FOOA 2GSHA 2VUNA 4K7YA 1E0XA 1YPXA 2ZUMA 1XLDA 1X97A 4WJEA 4ATDA 4N4PA 1UMYA 4R7JA 1W5MA 1KC7A 2YSWA 1R2SA 4F0HA 3WNMA 4I9AA 1TX2A 3SCWA 3V7PA 4KBXA 4L56A 1RCQA 3ANVA 4B91A 1IXNA 1P0DA 4IPNB 2PDQA 3GD6A 3DKJA 2RKXA 1VPXA 1NEYA 1WX0A 4NP7A 4WDWA 4AD4A 1Y65A 3WLSA 2PP3A 3TYUA 3P2VA 1JVNA 2V5LA 3LGDA 3BW4A 1KM4A 2JQXA 3VZXA 4GZJA 3WH7A 2CBVA 3VNDA 5DBUA 3M0JA 1F73A 3TTOA 4C6PA 2AOSA 3LZ5A 3UW6A 1B30A 3BSGA 2EGZA 4GHRA 3MPGA 2XVPA 3T05A 1Q8JA 1UZDA 4IPIA 4GY1A 3RG6A 2NVAA 4KRUA 3GHSA 4W93A 4CQDA 3UR8A 3K46A 3IJ9A 3NSMA 1GKQA 2WMIA 4GJJA 2EKGA 2VEIA 4A4AA 3IVSA 4ADSA 1HJSA 3A4WA 3L5LA 3HGJA 4JYEA 3FSUA 3GTNA 1B3WA 3CUXA 3MHFA 4AZCA 3SN4A 4PZVA 3S1XA 1MWOA 4CD6A 4V2XA 2YYTA 1UKPA 4KWOA 1VFFA 3CQ0A 2EG6A 1QR7A 1B90A 5DRIA 5CJNA 1TIWA 3BOXA 3IVUA 1CGWA 2VC9A 1EDQA 2PI6A 3LPFA 2NQLA 3GH5A 4C60A 2E9BA 3W27A 4QNWA 3MSRA 3FAWA 5GPRA 2QJMA 2OFJA 3VOHA 3FW6A 3ZSTA 4PEKA 1RQEA 4B16A 2NWRA 4K6AA 2HV5A 1EGMA 3LHWA 4J3VA 3U9IA 2X0SA 4PSPA 2QCLA 3A9BA 2OEKA 1OYCA 1UKOA 3OYXA 1H63A 3T40A 4DO7A 4KGLA 1SUXA 5SWUA 2JEPA 1XISA 5LA1A 4U5KA 4W5UA 2TYSA 4H8UA 2Q8XA 3BICA 1LQ0A 3GC2A 4JQAA 5E09A 1A49A 3LV6A 3GUGA 1LWIA 3OB8A 4RW3A 1JCLA 2WLZA 3FXYA 2ODOA 2ZRZA 4BZYA 3H7RA 4FOJA 4L5ZA 3H4WA 4QM1A 1Y8BA 2CWNA 3SB0A 2J7HA 3ZM8A 1MDLA 4ZVJA 5K9CA 1X7FA 3L4YA 2R1KA 4I7VA 5CZKA 2IKHA 1DJYA 4UWMA 3WJYA 3KL3A 1EC9A 2R8WA 3CZJA 3E6EA 3P3BA 4NILA 3LK6A 3S8HA 4PUKA 5JBDA 3PTMA 4XBKA 2ISFA 4QG8A 2PEVA 1OIMA 2PDMA 4TX6A 2HRWA 2XIJA 4M0XA 3DYMA 1NQKA 3KHDA 2I5IA 4XKYA 4AWSA 2RDWA 3SQLA 1ZAIA 1XQKA 3KDNA 1VBHA 2R14A 2X7WA 2DVTA 4WZHA 3WSUA 3W38A 3PAOA 2XU2A 3U2CA 3E0WA 4M24A 4LCQA 3L23A 3W7KA 4GYPA 1JCJA 3UZ5A 5BCAA 4LNCA 3HTWA 1E6SM 1V7YA 3B9NA 2HROA 1NWUA 1FXPA 3R79A 3NWRA 1UD8A 4GMEA 3RCNA 3CNYA 2GQ3A 3IUIA 1US0A 1KBLA 4W8AA 1R9YA 1SSGA 3RM8A 1EEXA 3VZZA 3UU0A 1FXQA 1U2YA 4D8AA 1DXEA 4JDBA 2OYLA 1HP5A 4ZQMA 2O0TA 4RL3A 4H8VA 5DXYA 3E2QA 1SO5A 4JHOA 3HG3A 2H3BA 1HJXA 1EJWC 1K8ZA 4Y7EA