2IPJA

Crystal structure of h3alpha-hydroxysteroid dehydrogenase type 3 mutant y24a in complex with nadp+ and epi-testosterone
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
321
structure length
321
Chain Sequence
SKYQCVKLNDGHFMPVLGFGTAAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Mouse 17alpha-Hydroxysteroid Dehydrogenase (AKR1C21) Binds Steroids Differently from other Aldo-keto Reductases: Identification and Characterization of Amino Acid Residues Critical for Substrate Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 109
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2ipjA00
3F7JA 1ZQ5A 1LQAA 4GACA 2NVCA 4WDUA 1A80A 3Q67A 4YU1A 2FVLA 1LWIA 3UZXA 1AZ1A 1EXBA 3Q65A 1R38A 3ONCA 4Q3MA 3UP8A 2FGBA 2HVOA 4ICCX 1AH3A 2F38A 3LEPA 4JQ1A 4PUWA 2IQ0A 4OTKA 2I17A 3GHTA 1Z3NA 3UZYA 4JTDA 1X96A 3R8GA 4IGSA 1K8CA 1RALA 1Q5MA 3GHUA 4XZLX 3M0IA 1AH0A 1ZGDA 5AZ1A 4YVXA 3DOPA 3O0KA 2PDNA 2PD5A 4GABA 4IJRA 1PZ1A 1AZ2A 4DBUA 2IKHA 4RPQA 3LD5A 4R9OA 3CAVA 2PDUA 3R7MA 2DV0A 4EXBA 4PRRA 1Q13A 4XVEA 3V0SA 1Z89A 1YE6A 5KETA 3V35A 2PDMA 3WCZA 4YVPA 4G5DA 4DBSA 2PDJA 3V0TA 2HDJA 2IPFA 3B3DA 3WBXA 5C7HA 1VP5A 2CLPA 2FZDA 1PYFA 3UG8A 2BGQA 4ZFCA 4HMNA 3LBOA 3CV6A 4FZIA 2PDIA 3FX4A 2PFHA 4XAPA 3WBYA 4ASTA 1US0A 4JTRA 2PDPA 4MHBA 4L1XA 2ISFA 2QXWA 3M64A 3R94A 4LAUA 4JTCA 3LQLA 2WZTA 3LNMA 4XO7A 1ADSA 4DBWA 1PWMA 3UFYA 4L1WA 4YS1A 3UZZA 1ZUAX 4JIHA 5M2FX 4FA3A 2PDWA 5LIKX 4FALA 4QR6A 1GVEA 4WDXA 1C9WA 2PDYA 4AUBA 2VDGA 3CV7A 2J8TA 4XZIA 3BUVA 4GCAA 1ZSXA 2HEJA 2IPGA 3N2TA 4JQAA 2FZ8A 4H8NA 2PDKA 4FAMA 1RY0A 3RX4A 3GHSA 4QBXA 4PMJA 1EKOA 2FZBA 3LZ5A 4HBKA 1QWKA 3LUTA 4DZ5A 3EB3A 3MB9A 3D3FA 3RX3A 1M9HA 2PDBA 2NVDA 2IS7A 3MC5A 2HV5A 3WG6A 2BP1A 4WGHA 3O3RA 3LN3A 3UGRA 4LB3A 1MRQA 3CASA 2R9RA 3EB4A 4XO6A 2IKIA 2DUZA 4JTAA 2ALRA 3VXGA 5LIYX 5HA7A 3CAQA 2INEA 4LBRA 2PDGA 1IHIA 1S1PA 2PDFA 4PUUA 4GQ0A 3CMFA 4QX4A 5LIXX 1OG6A 4LBSA 3R43A 4JQ3A 1T40A 2PEVA 5JH2A 1MI3A 5LIUX 3G5EA 1AFSA 3DN5A 4JQ4A 3EAUA 5JH1A 2PD9A 3KRBA 1S2CA 4XK2A 3WBWA 2HVNA 1JEZA 1X97A 3R8HA 3M4HA 3ONBA 4JTQA 3NTYA 2F2KA 3GUGA 1EF3A 4H7CA 2I16A 1PZ0A 4JQ2A 2IPJA 1Z9AA 4JIRA 1EL3A 5DANA 4XZHA 3H7UA 2R24A 1T41A 2ACSA 2WZMA 2IKGA 3UZWA 1IEIA 4Q7BA 2PDCA 4IJCA 3G1RA 2ACUA 1RY8A 1UR3M 2PF8A 3ERPA 4QXIA 2INZA 2IQDA 4NKCA 4I5XA 3COTA 1XF0A 2AGTA 4WEVX 4YVVA 1QRQA 4XZNX 4XZMX 4LAZA 2HE8A 5HNUA 4XVDA 3V0UA 3H4GA 3QKZA 2FZ9A 5AZ0A 4F40A 3BURA 1YE4A 4GA8A 4JIIX 3RX2A 2PZNA 2IKJA 2DUXA 1S2AA 1S1RA 3V36A 3H7RA 2PDXA 2IPWA 1SM9A 1FRBA 2ACRA 3GHRA 3N6QA 2A79A 1YNQA 2BGSA 4WDTA 1X98A 3R6IA 3UYIA 3R58A 1XGDA 3U2CA 4PRTA 3BCJA 3UWEA 3C3UA 3LQGA 4WDWA 3LZ3A 4EXAA 3P2VA 1VBJA 2C91A 1HW6A 4LB4A 4PR4A 5HNTA 2PDHA 4GIEA 3LENA 1J96A 1AH4A 1HQTA 4GQGA 2ACQA 3BV7A 2PDQA 1PWLA 3FJNA 1YNPA 2P5NA 2PDLA 1MZRA 1XJBA 4WRHA 3S3GA 3T42A 1Z8AA 5LIWX 2HE5A
chains in the Genus database with same CATH superfamily
1RR2A 4FX6M 1HKKA 3F5JA 1OT1A 3TU9A 4JNYA 3G1HA 4BI7A 4NP7A 4DUOA 3E2SA 1C90A 4XQ6A 3LSCA 1UA7A 3UCCA 3CM4A 1OFBA 4KCVA 2WJFA 1E6XM 1UD6A 2FGBA 4UTLA 2XJ7A 4GI6A 3I65A 4Z2KA 4EWJA 1I0DA 4X3ZA 2F9RA 4YWIA 5CBJA 1UIOA 1EJTC 1I45A 4ORMA 3WD1A 3CPGA 1I4NA 3BMXA 4HOWA 1EX1A 1HKJA 4IMAA 4A21A 1CIUA 4G56A 4IJRA 4EVZA 1U22A 2E5DA 3P81A 3CUIA 4RE2A 1TV5A 1EJ7L 4AZ6A 3CZJA 1UQZA 2PGWA 4UNLA 2NSXA 3VD9A 2QHAA 3SECA 5D9MA 1DORA 4JL2A 5H8PA 2C0AA 2D2HA 3VKCA 4UBPC 2JGYA 3GQYA 4OBRA 5IRPA 3AIEA 3DBPA 4ZQRA 2PDJA 2WSPA 3B8UA 3WH8A 3EA1A 1F3WA 2CERA 2AL1A 4JTEA 3TNOA 2QCCA 1TJ0A 3EWBX 4QISA 1UZ1A 4UMBA 3WNOA 1NFPA 2HS8A 1RBLA 1SR0A 1YXCA 2CLHA 5AC6A 1D3GA 3W76A 3OA3A 4JTKA 3NJ3A 2PC4A 2PFHA 3WBYA 1JF5A 3BK0A 4W7UA 2ZZ2A 2AQWA 2FB3A 3DESA 2EGZA 3WL1A 4EKJA 2Q8ZA 3KTCA 1BRLA 3F4WA 1X1ZA 4F48A 4MB4A 2WK2A 3WDQA 1Z44A 2I57A 1OYCA 2D1ZA 1UH4A 3EPOA 1YXDA 3CBWA 3SY8A 3THCA 4BA0A 4KERA 3HB9A 1ZJIA 1FQ0A 3P93A 4BHYA 2XIQA 3RHGA 3GC4A 1WKDA 2QZRA 1C9DA 2PF0A 4CN6A 2VDGA 3U4FA 2WNNA 3IARA 4UC5A 1E0UA 2RHGA 4MWAC 4XKYB 3G3DA 1NP0A 3GHSA 3N2CA 1EXPA 2I9EA 1DJGA 3PTQA 2YYUA 3VGFA 2XIMA 2NT1A 2XSBA 3VDCA 3UJRA 4ZTYA 1BGGA 1L6WA 1S5VA 2PTYA 2RAGA 2ZXAA 3P74A 4FR6A 1DP0A 2O56A 4LV9A 3MC5A 3GU2A 1GVOA 4FO4A 4E6MA 5CCZA 4NSBA 2HISA 2QJHA 1QAPA 1E4LA 4XKMA 1I2PA 3SN1A 1UKOA 4XD5A 1I1WA 2VC7A 3E2VA 1AJ0A 4UFHA 1IE7C 1FH7A 1OFRA 1MWOA 3M0YA 1D2KA 1SJCA 3AMDA 4QX4A 3W3OA 5FF7A 3GFYA 3R43A 4EF8A 4AXNA 5XIAA 1VFOA 3GG0A 1R3VA 3QY7A 4WY0A 5JH2A 1MI3A 3DC0A 3IVTA 4S39A 2PODA 2J74A 3TQ0A 2W63A 3LY0A 2RJGA 2NQ5A 5D33A 1XLJA 2Z4GA 1XG4A 2Z1BA 2VC6A 2CHOA 1Z41A 1UWSA 4MJ4A 3S9YA 2CLLA 1E5NA 3SUVA 2I5QA 1QI5A 1F5ZA 2VNCA 4RNHA 2J9XA 1H2JA 4K8GA 4MZYA 1QU4A 4QE5A 2QCGA 3CEUA 4HYWA 4S3GA 3NO3A 1BPLB 4LUSA 5EY5A 1QNVA 4RL3A 3LU2A 3PC0A 1G5AA 3C8FA 4JFVA 4M80A 4C6QA 1DYSA 1HJQA 3ABSA 1KGXA 4B15A 1U1UA 2ACSA 4G7FA 3A64A 5ABEA 1FHLA 2EG6A 4NZ3A 2H90A 3HJZA 5TF0A 3TA9A 5F2GA 4PCPA 2I7GA 3UA4A 1V0LA 4MJMA 2XDFA 4E8CA 3ERPA 1FFRA 1C3FA 3FYOA 1RP9A 3U8GA 2GOUA 4NXKA 3FNDA 1ZY9A 4KCWA 1ZAHA 2XVGA 1Q6DA 3AIQA 1NF0A 2OPJA 3P8JA 1R87A 3PBUA 3GVQA 5BYWA 2OG9A 1NM9A 5IBXC 4F40A 5LYRA 2REQB 2DUAA 4ZB0A 4P7RA 2Y7EA 3QGVA 4UR7A 4B5TA 4AWUA 2WVTA 3UWUA 4X0NA 5J5DA 3BGJA 2NZLA 3TP4A 3G77A 1P43A 4AZCA 3VOJA 4HU0A 1UROA 3IK4A 4C6OA 4S38A 3MWCA 1ZJHA 4TMBA 2G3JA 3N19B 5G2WA 1KFWA 4HA0A 4PRTA 2E8YA 2IXVA 4LY4A 2ZVIA 2XH2A 3ITTA 1JFXA 3CZKA 3PP7A 4AU0A 1JYNA 2A3CA 4JYDA 4D2JA 3U2EA 3D5HA 3W6YA 2J7CA 5J8LA 2R94A 2PC8A 4LWWA 1PWLA 3TYDA 3LHUA 2RDTA 1OG0A 4HNTA 1ME7A 4WRHA 3S9IA 2Z24A 3ARRA 1MQRA 3W38A 4NT0A 4H7VA 2W91A 5K7JA 1E4NA 3I6RA 4GIRA 2FVLA 3LPOA 4JFSA 1PE1A 3UZXA 3N3MA 3NZQA 4NAEA 4GGBA 1NQKA 4RNFA 1BGAA 1J0YA 3TOYA 5AHLA 1H51A 1VAHA 2WO5A 3TEVA 1M04A 3MHFA 3B4YA 4OTKA 1XLAA 3AS3A 2A4AA 5GNYA 2VC9A 2VUNA 4MOZA 5ECVA 1R8LA 3WQOA 1SU5A 1DTNA 3NWRA 4HMCA 4GNJA 3VCRA 3DI1A 3H22A 2W4XA 1SZEA 1RAKA 2DQWA 4GLEA 2VRKA 5DT5A 2NUXA 1HJSA 1YBQA 2PDUA 4KFNA 3SSZA 3SW6A 4Y6GA 2FTWA 3LTSA 4PTDA 1RUSA 2ZRWA 3AHTA 4HNVA 1OYBA 4O0ZA 3IIPA 3EDDA 1IR2A 1MFUA 2G4JA 1K1DA 3EXSA 3D46A 4N4PA 4M7TA 1XDLA 4QNEA 4Q8UA 3RLHA 3BAXA 2QLYA 1F61A 2ZUVA 2ZZ5A 5AHIA 3V75A 4A2RA 3BICA 1DWJM 1QPKA 1H63A 1K9TA 3L0KA 1TJ1A 1Z6KA 4HMNA 3GKFA 3FKRA 3M9YA 3MCOA 4EAYA 4QSFA 1ICSA 1LJYA 4XZWA 4EPEC 1FWDC 1K6WA 1FOBA 1AUSL 3MT1A 2OQLA 1HVXA 3IEBA 5B7YA 3SRHA 3ZJ6A 1JCLA 1PB0A 3ANYA 1R5YA 4MZ1A 3E74A 3WLNA 4BWLA 2GPTA 1H1NA 4J28A 2AAAA 4PB5A 1LOQA 1J18A 4JHZA 1EDGA 3JR2A 4AD1A 5A2BA 4NASA 3W23A 4IPLA 3B9AA 2UWFA 1SZRA 3MJYA 1DV7A 1M03A 4GQRA 2ZRVA 4QJ1A 3VCNA 3Q94A 4HVXA 4QR6A 4WDXA 2YA2A 1GQNA 1TUFA 1E43A 3A47A 3DX5A 1U5VA 4IIFA 2PSNA 1MW0A 3C2FA 3QTGA 1IZJA 1GQJA 1XQLA 2W61A 4KRUA 3KZPA 1EGMA 3LZ5A 5C55A 2PB1A 4JHOA 3VOGA 1XD1A 3HOJA 4WQ6A 1TPVA 1R3SA 1V5XA 4Q32A 3QRHA 1ZP3A 2YCIX 1LT8A 2WJDA 1LZOA 2R9RA 2OSYA 1VIWA 1R9YA 3I3EA 3R4IA 3HA1A 3SRKA 1XGEA 2HBXA 1TPDA 3CV2A 3L2IA 3PBVA 4RZ6A 4I5UA 4ZSUA 3LYEA 5EU9A 1OG6A 5HPCA 4NRSA 1OGSA 1XIMA 1GJUA 2BMBA 4PL1A 3E3HA 3REQA 3DN5A 2QJIA 4IPIA 1R6WA 3NXFA 1E0TA 3KCOA 6A3HA 3KRBA 3VNDA 3C86A 4GI4A 4HJWA 4OFCA 2Y8UA 3CIWA 3TOPA 4H8VA 4AD2A 3RDKA 4C7GA 4WR3A 1O95A 3EKGA 2QVHA 5F4XA 4A3UA 3VMPA 1GYNA 5BROA 2POZA 4JTQA 4QFUA 3URQA 1XS2A 5GQBA 2ISDA 3EMZA 1FCQA 2ZX9A 2Y7FA 4JQ2A 4PUNA 1DJWA 1EPVA 4B5NA 2DPEA 3LK6A 4FNPA 4GWEA 3URAA 4A05A 1BHGA 3VGHA 1LBLA 4IUOA 2YLLA 3M0MA 5H1WA 4XZHA 2HVMA 3MJMA 4DEFA 5CPLA 1TJRA 5FI8A 1A5NC 1OQFA 4OT7A 4JS3A 1EBGA 4Y90A 4XAYA 4C1NA 3GVRA 2VFEA 5I78A 2V6AA 3W02A 1AW2A 4M82A 3C2EA 4QXIA 4G2DA 1UD2A 2C16A 3HG5A 4G1NA 3DU0A 2VFDA 1UUOA 1XL9A 4XZNX 3UNTA 2OT1A 1J5TA 4LVDA 4M6PA 1A53A 1EEXA 3GIQA 5TNVA 1GOXA 2V2HA 1PX4A 2FZ9A 1VBUA 5AKQA 1JJKA 4H6QA 1XIIA 1HGYA 1S2AA 5CGMA 4NNCA 4JTGA 3NPXA 2EJAA 1RA0A 2YZ5A 1BG4A 4CU7A 2A79A 3URNA 1JR1A 1OSEA 1WBJA 1PKMA 5EMUA 4R7JA 5CJMA 1F3EA 2CC0A 5KMYA 4HU3A 3AAMA 1XG3A 3ITGA 3CV1A 1W5PA 4DM1A 2HMCA 1WOAA 3C2OA 3A3HA 4LALA 4DXVA 1Q2SA 1GZ1A 2QQ6A 1MEHA 1EA9C 4A8RA 1XR2A 4H04A 1NWUA 4XV0A 4GISA 2X7VA 3TMLA 3QR3A 2H9AB 4MPKA 4UTTC 2Y70A 1AG1O 4BR1A 7A3HA 3WJSA 1TO3A 1PIFA 1UD8A 4J4KA 4IZGA 4Y9MA 4DO4A 2DDXA 3RM4A 1BWLA 3FVMA 2P5NA 4WXZA 3AIBA 1B4KA 3BGAA 3AUJA 4C6IA 4Z2GA 2WPBA 1EIBA 1A80A 2EPMX 2J9ZA 5F1VA 2G96A 1AZ1A 2BVWA 3ISIX 1V0KA 1FWRA 3W7LA 4JQ1A 4O8RA 4XB3A 1MMFA 1I8JA 3M6DA 4W5UA 3SFKA 3VU2A 3C0SA 4X2PA 3WN6A 2OLAA 4F3HA 1X96A 2OWCA 3QY6A 5HK4A 3G1VA 1KGUA 4Q6JA 1RALA 1AJZA 2DP3A 4W93A 3M0JA 3L4WA 3OVPA 1QI4A 3BOFA 2IMRA 2PDNA 3TXZA 3NCOA 2IKHA 3AYVA 5HJXA 3GK0A 4J3UA 3FXGA 3VIMA 2VXNA 1E9YB 3OTRA 3GUWA 3P60A 1U30A 1CLXA 3H6OA 2YL8A 3FHAA 2WC3A 1UP3A 3ITOA 1I0BA 2HK0A 4WKFA 2PDMA 1LRTA 1WAUA 3WCZA 2W66A 1DJYA 4QDPA 4GCXA 1O6IA 3GTIA 4NXSA 3WMLA 4YMZA 4RE4A 1A5CA 7REQB 3EMCA 1RJPA 1Q6GA 3C2VA 3HBLA 4WJ8A 4NY2A 4DJEC 2R82A 3TN5A 2CBJA 1Q7QA 4GO9A 5I77A 4CNTA 5DRIA 2OO0A 3KWSA 2YW3A 4H01A 3BCDA 1US0A 3B97A 4JTRA 1MRAA 3A4XA 2R1LA 3S1VA 3T07A 4NZ1A 2BHYA 5FF4A 4MLRA 3TQVA 2TYSA 1V7YA 2YCJA 5CAKA 1REQA 1FHVA 1ELSA 4L1WA 2ZFAA 4Q8WA 2YJQA 4BF9A 1GVFA 3NM1A 1PX3A 1FWIC 4PB3A 3HJEA 3CIVA 4UFMA 5AVNA 4YTSA 5IXEA 4RW5A 3SDOA 5HJLA 4CNUA 1I1XA 1S5TA 1UJQA 2PDYA 3RRAA 4FMVA 3ME3A 5D30A 2D23A 3PBYA 3HGSA 1LOSA 5ENLA 3QR0A 4ECLA 2FZ8A 1SSDA 4ICNA 4DJDD 1HJUA 1S5WA 3NYDA 3WFZA 2Q8LA 1JNDA 4MNLA 1XRFA 4MDPA 4FR1A 3LBCA 2QDDA 4DELA 4BFAA 4GYJA 1RCXB 4L6HA 2YSWA 3L67A 3NR0A 3SQLA 2HV5A 2YYTA 1GYMA 2ALDA 1YTKA 2DSKA 4LS2A 4BKNA 4L6OA 1ME8A 4PTXA 4XG1A 4L9XA 2QW5A 3O8AA 3NDZA 3LBMA 5AYBA 2TPSA 3FN9A 3WJYA 3MMTA 4ERAA 3IK2A 4RNJA 3CAQA 3QOKA 3PAJA 1QHOA 2DT0A 1VJSA 3QH2A 3KRSA 2PDGA 4LTSA 2E7FA 1S1PA 1TV8A 2NV2A 5I6SA 1M6JA 1OJXA 1UUMA 1HXJA 3L7RA 3IJ6A 1KBKA 1NDVA 1O94A 1OADA 2NLIA 2VEGA 1OD8A 2ZRXA 4FPSA 1OT2A 2QCEA 3CUXA 4JQ4A 1XIDA 3W7HA 4R53A 2P1FA 3KP0A 5LNSA 1CZ1A 3R0DA 5M1TA 3WLTA 3UBPC 2UBPC 3UW6A 5HMSA 1EC7A 2A5HA 3WUGA 4PCTA 2A7NA 2BWGA 4KMQA 4GIYA 2POTA 4XIAA 1HP5A 4EOUA 1E9LA 5H8UA 5FEPA 4XKYA 3TW7A 3QEZA 5PTDA 3LV5A 3MANA 3T0DA 4CN4A 3CZ8A 3MSRA 1O12A 3OLGA 1T96A 3AXKA 3RGTA 3DFSA 3EPNA 1HJXA 4TTGA 4KPLA 4YXGA 4I7UA 2OZ0A 3FJ6A 4DJDA 3KOFA 3GS6A 3AC0A 4MTVA 4GC3A 3H24A 1EJWC 1Q8JA 2MUCA 4Q7BA 3NSXA 1ODZA 3UXAA 1PYMA 4J3WA 4Q4RA 1BF2A 4ZL1A 1YMYA 1Y5XA 1R46A 3PY2A 1SMAA 3IWPA 1I9CB 4F0KA 4H9YA 5D2XA 1ADOA 3RR1A 2QCMA 4MJZA 4A3YA 1XP3A 3PJWA 3LMYA 1S3HA 4MY8A 2QULA 1WAWA 3H4GA 4JYFA 5I09A 2VEPA 4M1RA 4GA8A 3P0XA 1N7KA 3G0UA 4F0MA 4B4HA 3L23A 3H7RA 3ARVA 1H1ZA 1JVNA 2IPWA 1L9WA 2ZZ7A 4ZXLA 4IOTA 4QEHA 3SURA 1SPQA 3STPA 2VVSA 4O8AA 1P0KA 3VMOA 3V5OA 4O16A 4OBTA 3HPZA 3HZ3A 4GUJA 5E1QA 2ZA1A 4MNMA 4LNYA 4CQBA 5DLCA 3TIMA 1SQ7A 4WJEA 5HNRA 2VUYA 4J3TA 5CJ5A 1Z42A 3KS6A 1DWIM 5FAJA 1B57A 3EDEA 1ONXA 3ZQ9A 4PR4A 4EF9A 1MDLA 4ZQCA 2NX3A 3B8TA 3WK3A 2EPKX 1KQYA 1A5BA 1JPDX 1JPIA 4M29A 4N6FA 4QE1A 4L80A 3T78A 3K8LA 3ALFA 1GCYA 2XWEA 4FSAA 4B4FA 3E38A 2PDLA 1TA3A 4D71A 1XJBA 3OO2A 4ERIA 1UYQA 1OZQA 4F0LA 3CZEA 3F7JA 1UZDA 1ECEA 5C54A 4JDBA 3VIHA 1UB3A 3B4UA 3G3MA 4ATLA 3CL6A 5DMLA 3KP1A 2E6YA 3OPSA 4UIOA 4MSSA 3H53A 2GUUA 5C9WA 1EIXA 1EUNA 2XUCA 4LAKA 3EWXA 4W8BA 3LEPA 1VBGA 3IGXA 2A3HA 5DN1A 1V3LA 2WC4A 2QYGA 1H61A 1VFHA 1Q5MA 5CKSA 1UHVA 1QW9A 3LA4A 4S3KA 1BD0A 1R3RA 1E70M 1N8FA 3CWNA 1LWJA 4OQVA 2F84A 3MYOA 1W1ZA 5A6KA 4A8IA 1LLOA 1QXLA 4I8DA 1HKVA 4NYUA 4QE4A 1I75A 2YA1A 4JTTA 3R2GA 2DH3A 5E09A 3AS0A 5C9UA 3W00A 1K70A 3C0QA 3CB3A 1GVYA 1KM0A 3AS2A 4H6KA 1IEWA 2Y24A 3B9DA 1NAL1 4U3AA 1OK6A 3WLHA 2Y5SA 4MZ8A 2ODOA 3GBDA 2A3BA 3NAVA 1Z48A 5A6JA 3S9ZA 4GG9A 4GUIA 1B90A 1C8QA 2FFCA 2RGMA 3CUGA 3H2FA 4JHMA 3TJXA 3BJSA 3LLDA 5ABFB 5FD0A 3TYZA 1OFEA 4GUGA 3UY8A 4AG0A 2Y61A 1JYVA 4DNHA 1K3UA 3DYMA 1XRVA 2UV8G 1E6ZA 4Y9OA 2Z7GA 1L6SA 1OBAA 4E4PA 3AUOA 2W0UA 4IFOA 3LQLA 4QG9A 1HKMA 3W22A 3V4BA 1XCXA 3F4VA 4S2BA 1HG3A 3M5ZA 5JBDA 1YPIA 2RDXA 5KZDA 3W1PA 4Z2HA 4AC7C 5AC7A 1Q6RA 3IVSA 3WQ4A 1FWTA 3PVFA 4JIHA 1BYAA 4RCXA 1FWBC 1IWBA 1KNWA 3FA4A 4L1GA 4AHQA 1DHKA 3XISA 2QPXA 3BMWA 3FSUA 3GO2A 4J9JA 4FP1A 1MYRA 2XH4A 1LCOA 3GR7A 3GH5A 1GORA 2E09A 3W07A 4KEVA 2XIJA 1KW1A 4E38A 4MFDA 3SY1A 3GTFA 3VGGA 2W9MA 2FHCA 1MSSA 3A12A 1CGUA 5HDRA 2CETA 2ZRYA 2J27A 4O15A 2A85A 3IVUA 4O1AA 1SFSA 4KW2A 1UD3A 3PULA 1UMYA 3OZMA 4GQQA 3QSRA 2R91A 4QTGA 3JU2A 4Q4MA 1VPQA 3VNIA 4IX0A 2QGYA 3ZT7A 4AXKA 1XC4A 4XO6A 5K9XA 5D2WA 2WBGA 2DUZA 3HV8A 4FOJA 2QPSA 2VVNA 4AMAA 5REQB 3V18A 3PAOA 3VKDA 2D24A 3LNPA 4JGDA 1TCDA 4HP5A 3C8NA 3OZYA 1C8VA 4NL1A 1ZP4A 3GYEA 3S4TA 4F4RA 5LIUX 2PU1A 3G5EA 2C15A 3KLKA 2WANA 2B81A 1ITQA 1HN1A 1KFLA 3UY7A 1JXKA 5BNKA 1WUEA 3MZ2A 1US3A 3U48A 2CFFA 2J7DA 4YTQA 2QDGA 1YQ2A 1FWAC 4QLJA 4UR9A 5IFTA 2XSAA 5AN7A 3T2OA 3NTYA 4O28A 5LXEA 3GDMA 2VC5A 1J0IA 4LS1A 4FHAA 1T7LA 3UZJA 4ADSA 3W7KA 3U5YA 3E0LA 4U28A 4DLFA 2F6UA 2FIQA 2OVLA 3G22A 3B03A 3EX6A 1OFDA 3MTWA 4GH3A 4C6DA 3N4AA 3BW2A 1CGTA 3LPGA 4YYCA 4YTTA 1OY0A 2OGJA 4D6EA 2PDCA 2BDQA 2ZUNA 1RY8A 2C1HA 2CU0A 2INZA 3N2XA 4R27A 4BY3A 3C2YA 3C6CA 2DIEA 4CNPA 4WEVX 1UWTA 4DAIA 2XHYA 3NQMA 4HN8A 1JXJA 3K1GA 1ZL1A 1ZAJA 3TKFA 2NUWA 5BXRA 4W87A 1UH3A 4TV5A 4ZBCA 4DF1A 2RFGA 3TCEA 1NIUA 1W9VA 1T5AA 1U1JA 4BEQA 1JYWA 1JD7A 5A8GA 3L4VA 2O4MA 6PTDA 3RUBL 1W5MA 3G1AA 4DO5A 1JUBA 2OT0A 4O57A 4FNRA 2WM0A 3PWIA 2Z7KA 1W3IA 4M6VA 2CLKA 1J4EA 1KBBA 3U2CA 2O7QA 3NL2A 5CPOA 1ENUA 5EKYA 3DKLA 2PMQA 1H7RA 4MDOA 3ZSTA 4IMDA 2DZPA 1WX0A 5CQ1A 1RQBA 4EXAA 4MIMA 4CQAA 4GNVA 1W1B1 5HNTA 4S3JA 2X8RA 3EX2A 4GJ1A 1AODA 4JFUA 1AH4A 4C6MA 4Q8TA 4C6CA 1CWYA 4PUDA 3UA3A 3CWOX 1V6XA 2Z26A 3VD4A 3NDOA 1ZRQA 5A2CA 4JN8A 4XTIA 3TC7A 4S3FA 1P6CA 3GG1A 3VGDA 4DBDA 3S3GA 3URBA 5TAOA 1FDJA 1FKWA 4A2SA 2HE5A 1J2WA 1AW5A 3W1NA 4W88A 4JEQA 1Q85A 2QJGA 1CXLA 1R2SA 4ZO6A 1S5NA 4PL2A 4PMNA 1ZBCA 3CXOA 1I60A 2E5BA 4DYJA 4GH1A 4QEEA 3QMTA 3KBNA 4FI4A 3UZ5A 5I03A 2GVLA 1M65A 1KC7A 4GYPC 1DL3A 4PEEA 2AQOA 1ZAIA 2V82A 3W81A 3RCYA 4UZUA 3T4WA 2RDUA 3HV9A 4PTNA 4AQLA 1S39A 3RIKA 3LCHA 1JDCA 3O0KA 1OC7A 2PD5A 4GABA 1H5YA 3B9NA 1VYPX 3W2UA 1E4IA 2GK1B 4PRRA 4MNJA 4N02A 4H9ZA 2HZGA 3E02A 3T7VA 3MUCA 7XIMA 5IOBA 4YVPA 4DJFC 1WDDA 3G24A 1LRNA 4A3RA 4PTVA 1C8YA 4B2DD 2ZCGA 1V8EA 1V3IA 1PYFA 1V51A 4CN1A 3E5PA 3A9IA 3TK7A 5AFDA 1RK6A 4NNBA 3EWDA 1MQPA 2DSVA 3AYSA 3OQEA 4HYVA 1B3YA 3NZPA 5FJUA 1GKPA 1VR6A 2GSJA 4A22A 3VNLA 2O92A 1V3HA 3WEOA 2NX9A 4L9ZA 1IT8A 4LAUA 4FLQA 2NW0A 1P0EA 1PKNA 1PWMA 2V2DA 4REQB 4HNNA 2Z2UA 3K4WA 3PSVA 3Q37A 4U5IA 2Q71A 2YDSA 5LA1A 4IGMA 3F5KA 2GJXB 3WDJA 4HB7A 4IX2A 3IV3A 3W85A 5KZ6A 4IPNB 4XZ9A 2ZYFA 1W9BM 2CNCA 4Y9NA 3TA6A 5HMEA 5LIKX 1Q6QA 1CLKA 3E9AA 3F4DA 4RDWA 5C9RA 3K1DA 1GQKA 4J3SA 2YDAA 3CIXA 3W01A 2VFFA 3CV7A 1CXHA 3KL0A 3STFA 3BLKA 1ZSXA 2WHKA 3T09A 3U57A 4Z0JA 3IJIA 5C71A 1OC5A 4AEOA 3ES8A 4ILSA 2GJNA 3MZNA 2FJUB 4C60A 5FIPA 3ARXA 3QHOA 4IFKB 1EKOA 3UQNA 4IMCA 1EP3A 2AMGA 1E40A 3DDMA 2VP8A 3LV6A 3S2NA 3H2AA 2PDBA 4NZCA 3UG3A 2CXEA 4RNIA 3ARQA 3R13A 1J6OA 3GZ3A 2GGHA 3B40A 5LNRA 3SUWA 3EB4A 4HOZA 3GC5A 1ISXA 1B1YA 4B2DA 2B7PA 2Y8VA 5G4EA 3RAOA 3WO8A 3PK7A 4HQVA 4Y96A 3CH0A 3CAWA 4XUGA 1AQMA 1I2OA 3LM7A 2B7QA 2HNHA 3DFHA 1CXFA 1F73A 3LPFA 1PAMA 2X0SA 3CHCA 4FIQA 3V5CA 1FY6A 1SO3A 3BAYA 3ARUA 2HNEA 2ISSA 1VYSX 4R88A 2V3GA 4JYEA 1FWGC 4HCLA 4EP8C 4DI9A 2Q3RA 4JY8A 1GVQA 4WGXA 2ABAA 3TN3A 3CPUA 1FWSA 4DWSD 4NRRA 3A24A 1E51A 1VKFA 5E9AA 4DYKA 2FYMA 3APTA 1E1FA 5DXXA 2P10A 1F74A 1FVPA 3L4ZA 5DFAA 4UCGA 1KCLA 4WOQA 1IXNA 3N9SA 4K36A 1A5LC 3MWAA 3ZO9A 3BOLA 5I3JA 2KAUC 3NZRA 4QJ3B 2DW7A 5DY3A 1CGYA 2VWTA 5DANA 3GG7A 5LA0A 4KEZA 4JX4A 1PO9A 2DY3A 2F8QA 3TC3A 1G94A 4DY1A 2ZIDA 4NI3A 1Q8AA 4AVFA 1H5VA 2VEMA 4R7WA 3TR2A 3FLUA 3WLKX 1BWVA 1KD0A 2HS6A 2O7SA 1V93A 1EUAA 3ABRA 5JIWA 1VGAA 3POHA 1N8WA 4N9DA 1LQ2A 3ALGA 3COTA 3T4CA 1XF0A 3WZ0E 5HAOA 1H7XA 1L2UA 1Z69A 1B4EA 3OODA 3R8RA 3MVTA 2PP0A 2WSYA 2EEXA 5H91A 3V0UA 2XZ7A 2W79A 4X61A 2DZBA 4E5TA 1ONRA 3DFOA 2PRLA 1KWKA 3AROA 2IKJA 1O5XA 3P6LA 2DUXA 4Q8VA 3LS9A 4DUWA 1Q7ZA 3BLFA 5LA2A 4HK7A 3FKKA 2D22A 3LGGA 1QBAA 4AWTA 2PWFA 2V9DA 3B0UX 3VC6A 4C90A 4ZODA 1ZHAA 1F3TA 2DZVA 3NIYA 4OOZA 1EJUC 4Q7NA 1TPWA 3MMWA 3TSMA 2YW4A 3IAPA 3T9PA 2J9YA 4IMEA 2YX0A 4DWSA 1SMDA 2P3EA 5BWAA 2BXVA 3OGRA 3ABOA 4IQEA 2OWWA 1C92A 1QOXA 2VZTA 4L64A 1I2NA 4I9JA 3VTRA 4H9XA 1KM3A 4PH6A 5DQPA 2ATMA 3HPXA 1A47A 1X39A 3GFZA 4H9MA 4DJDC 4FX8A 4TU1A 1TELA 1GGOA 3WD0A 2ZWZA 1HNYA 2W27A 1TSIA 2PU0A 3IGSA 6ALDA 2YGYA 1V02A 1LOLA 5ABHA 4KGJA 4KCTA 3EXTA 2JK2A 3BC9A 3AZRA 2JKAA 3AJXA 5CPMA 1C7SA 3PBMA 2P0OA 4PTMA 2OODA 3HQNA 3FA3A 3SRFA 5F2IA 2FH6A 4I6KA 1K8CA 4GVFA 2NT0A 4O10A 3W83A 1BYDA 3WEZA 3MKVA 3W9ZA 4TVUA 3WDPP 2Y63A 1EC9A 4HSNA 2B7OA 1KFEA 1VPYA 3PJXA 5HUPA 4XISA 1M68A 2ZA3A 2OOFA 4XVEA 3VINA 3VVGA 4TTUA 3QOMA 3IUIA 4GZIA 4QQUA 2GGIA 3KL5A 5CZTA 3UPBA 5GJPA 1QPNA 4ZE5A 2CCRA 4P61A 5C7HA 3LXAA 1D8CA 2FZDA 2A6NA 4MPQA 1V6UA 4E4FA 1DWFM 3W1UA 1VD6A 2HXUA 4GVGA 4UQEA 2V5BA 3E0FA 3CYJA 5BOEA 2BTMA 4FNTA 3QPYA 5BXPA 3SN4A 3VC5A 1EDTA 1QI3A 2VO5A 2YDQA 3VOHA 3WYZA 3NOEA 9RUBA 2X1SA 3V3WA 5MKGA 1VFMA 5I3KA 3M64A 3OIHA 4GPNA 4JTCA 2VD9A 4NJKA 3S1UA 9XIMA 1K7EA 3WLQA 1H49A 2ZKMX 4ZOEA 3GNPA 5F1UA 4UTKA 1B31A 2VCAA 2DEPA 1XH2A 1V0NA 3WBEA 5EMLA 4D8LA 1FP9A 3C2RA 3FIGA 4PMUA 4GNKB 4UCFA 1P6BA 4FB7A 1AQ0A 2WW5A 3OB8A 1QVBA 2VR2A 2OEJA 3A6OA 1VFFA 1HKWA 4O0QA 1V03A 4R85A 2MNRA 3WQWA 1H41A 4Q4QA 1WCGA 3OGVA 2FPYA 4URIA 2XIBA 3I7SA 3UD6A 1GW9A 4QROA 2ZXDA 3FYPA 2DZUA 1RV8A 3N18A 5AVHA 2VDIA 4UFJA 3MW7A 2QT3A 3EA2A 2PWHA 3LN3A 5D03A 4CCEA 1G9HA 4FF7A 1RCOB 4JKMA 1KGWA 1Y8BA 3TZFA 3M5XA 4GZ7A 4LBRA 4MGGA 3S1GA 4DVOA 2ZX7A 3CC1A 3KCLA 6XIMA 4ADTA 1QNSA 3A23A 4O50A 4HZMA 3WQ5A 4ZE4A 2QGHA 3SCWA 1V6VA 2PZ0A 2BS9A 4CQ8A 1EJXC 3LTPA 4ATDA 2DJXA 2BXYA 2X2GA 2WVVB 5FSEC 3RG6A 1QW8A 4U10A 3WUFA 4PBGA 1E0WA 5HWNA 3KCJA 3O6DA 1LM1A 1T99A 1YKWA 3EB2A 4JTUA 3WLRA 3FW6A 4N4QA 2ZA2A 2J7HA 1FCUA 4HMEA 1YRRA 2PGRA 3DKJA 3R0KA 5FA5A 3W24A 1W3JA 3USZA 4J7RA 2ANUA 4RV3A 1EYWA 1ZJAA 2IPJA 1EOMA 1Z9AA 5HXMA 5C8BB 1JZ2A 4UOJA 2GJRA 3QVQA 2FGZA 3GU1A 1OVDA 2Y7GA 4HNOA 4AD5A 3TFXA 5JVLA 3WUBA 1KM4A 3Q58A 1AD4A 2YXXA 1UBSA 3MUAA 1SZNA 1NP2A 2DGAA 3IRSA 4GC4A 5CLTA 4KIRA 1ME9A 2FB2A 2CLEA 3EWYA 1JQVA 1YNYA 4AYSA 3ZYZA 1O66A 2W6RA 4S1FA 3H4XA 5HULA 4KETA 3MP4A 1GUVA 3EOLA 4XVDA 4L4PA 3KWXA 2QUUA 3P14A 1EZ2A 5D04C 4PUMA 3BLLA 2G95A 2PWEA 5J5RA 4PBEA 1DIDA 7ENLA 5DEZA 5JBFA 1HO1A 4ZO8A 1F3XA 4GUHA 2BY2A 1RQEA 4OKDA 2ACRA 5BU6A 3U9IA 5KINA 5CC6A 5AHMA 3ZR4A 2P88A 1X98A 2YA0A 2WB5A 3R6IA 3VABA 3MSYA 1I6NA 2VX6A 3KVLA 4GY1A 3EA3A 2JKPA 4JNZA 4Q8MA 3O6YX 4D6GA 3WJXA 3TJLA 4TVDA 3LCIA 3TE9A 2WMIB 1HZYA 1VCVA 3G1XA 4WHBA 2WSRA 1RD5A 2C91A 3QV7A 3LGDA 2IXUA 3N4EA 3VNMA 3N11A 3PZ9A 2D73A 3QN3A 1O7AA 1IGSA 4AF0A 3BV7A 3INPA 1RCQA 4BEUA 3L0NA 2J13A 1E6NA 2QCDA 4HPNA 1DWAM 5J04A 3BL3A 4DZIA 3FGCA 4OJYA 4KRTA 1E1CB 3VGBA 1YIXA 4XZBA 3H21A 3TAKA 4GACA 3KW3A 1IV8A 4JPGA 1G7VA 3SIZA 3P5YA 3RRXA 4Q3MA 1G4SA 3RLGA 1DVJA 1N8IA 1E6PA 4TX9A 5HR7A 3GFXA 3UEQA 3EDFA 1G7UA 3HQPA 3V16A 3SM0A 2MANA 3SCSA 3KLLA 2QV5A 2JIEA 4H4IA 1H7WA 3CS2A 4M0XA 4RPQA 3A5FA 2V0TA 2DV0A 1JAKA 1YDYA 3IGHX 4WD0A 3TTEA 4JBRA 4QSHA 4ZMGA 3M0LA 2O9PA 1GZJA 2GDQA 4LVBA 1VP5A 4AX7A 4H83A 1L0PA 1A5UA 1U2YA 3LHVA 1WNOA 1ZBKA 2BGQA 1ZLPA 2O55A 5E0KA 1A49A 1FHDA 2OZ8A 3SGGA 3CUZA 4I6VA 3OYXA 1JUKA 2DVXA 1VHCA 3GXMA 3A5VA 4H1ZA 1JZ3A 1EDQA 4ASTA 3QLLA 2BX7A 1XLIA 4K3ZA 2ISFA 3D0CA 2TAAA 1VEMA 3TLLA 5KEZA 1P0NA 3BW4A 3BXWA 4CD8A 3DGBA 2ZX8A 2R1MA 7TAAA 3OJGA 5C9ZA 3KEHA 1V02E 1E1EA 3LSBA 2J47A 1OFQA 1ADDA 2WZHA 4J35A 4YS1A 4LH8A 4PN2A 1MEWA 1LL4A 3I6EA 5BXSA 1HKIA 3WK1A 3KS5A 4YTUA 1OFOA 1V6TA 1FDZA 1XHGA 2YL5A 1DOSA 3SQMA 4Q4SA 3UXIA 3GNDA 1PZ2A 3N6JA 2Z1KA 1ICQA 4U3CA 2QCFA 2ZBTA 4Y8FA 2V3DA 3EOEA 4S3CA 5A69A 3FCPA 3RMEA 2JF6A 4DXXA 4GK8A 3MI3A 4JTJA 2EPOA 1TV3A 1EHAA 1JRCA 4AEFA 3RJYA 1MXSA 4EX4A 2VCCA 1XBZA 1TIWA 4M3PA 3EEGA 2FJKA 2TRSA 3JW7A 3O6CA 3NNTA 3VM7A 3XIMA 3LDVA 3WNPA 3QMRA 4OIFA 1B30A 5EA9A 2VQTA 5ABTA 4IF2A 1U5HA 5SWUA 3CO4A 1U83A 4TO8A 4LOCA 1AA1B 2VZVA 3QZ6A 1RXOB 1FWCC 2E1DA 2HWGA 1ICPA 2J25A 1B5TA 1VLIA 3EBVA 3ZVHA 4UNIA 1KWGA 3ZM8A 1FXQA 4PUUA 3W29A 4GQ0A 1A4MA 4Y9PA 3BARA 1QNOA 3FHQA 4LBSA 4C6NA 8A3HA 2LLEA 3PPCA 1TZ7A 3VGEA 2QAFA 1XCWA 1ONEA 1XBXA 1CPUA 1DKWA 3QFWA 4F2TA 3T0AA 1HL8A 1TWIA 2CXGA 3S83A 4XD3A 3T0CA 2DIKA 2AQVA 2WPGA 4DHGA 4FXRA 2QCLA 1DJIA 4XAFA 1LWHA 4BQ5A 1TTQA 3W4RA 6TIMA 4GVIA 4AIOA 1HJWA 1PXGA 4PMRA 4L4MA 3PHAA 5A6LA 1NDZA 2EPLX 1O5RA 5EB8A 1VQTA 1SJDA 2OKTA 3E6EA 5BW6A 4YHEA 3S47A 3EX1A 3H7UA 5DMMA 3MUXA 2QCNA 1TPUA 3PJTA 3QBUA 4GBUA 1X7FA 1KTNA 3VAVA 4E4UA 1XLDA 1J0HA 4FLOA 4S3AA 3R79A 4JZ5A 1TRDA 2IQDA 1IZCA 3VNJA 2D3NA 2YFOA 3AXIA 4O54A 4OOUA 5BRPA 1BXCA 2PUZA 3BW3A 2VQUA 1J01A 3UVIA 4IIDA 3SN0A 3PF3A 3EOSA 4DXKA 4O1EA 2EPHA 2Q01A 1V4YA 5AZ0A 4HMDA 1YE4A 2XSXA 1XRTA 4PMOA 2BV9A 4M51A 1XWYA 3S1WA 2BY0A 3HPSA 2GQ3A 1GONA 4D6CA 1SM9A 3C3NA 2FVMA 3T81A 3NSNA 1GJPA 3PZNA 1S2VA 1OEPA 4PBFA 4WIWA 3MP5A 4PUJA 2JE8A 1BKHA 1QW7A 3HM7A 1Y0EA 2J7FA 3VKJA 3R58A 2R6OA 4AZ7A 2G3NA 2BG5A 3GZAA 4US5D 4QITA 2J24A 1A3XA 3BAIA 1ISYA 2CW6A 3M43A 2WLYA 3RPDA 4JNMA 1CGWA 1E3ZA 2FHBA 3P2VA 2DW6A 3KOWA 2PP3A 4LBUA 3BTNA 3HN3A 3NVTA 3LENA 4G7EB 4WSHA 3VYLA 1SW7A 1JCTA 3UJEA 3WSUA 4FNSA 2QF8A 1GOIA 1YDOA 3GTXA 1RD6A 2X42A 3TMQA 3IJ9A 4B5WA 3AU6A 3WQVA 1AK5A 3OVQA 1J12A 3RK8A 5I3FA 2GVEA 5D9OA 1EJRC 1MZRA 4UQAA 3RITA 1CBGA 4DX3A 3T42A 3H23A 4CCDA 3QXBA 3OBEA 1PPIA 4XBSA 2WCAA 1QHZA 2QUVA 3TN6A 4GYFA 3ORWA 4E0CA 1X8CA 4ZQOA 5I2UA 2Y0FA 3PTKA 1JDAA 1P1XA 1BFNA 2ZRZA 3PANA 4LSBA 5GVJA 4DI8A 4O52A 2E6DA 2DSWA 2OQHA 1DQUA 2O9TA 3CHFA 2PLMA 2D0GA 4RDVA 2ESCA 4B91A 3NQ7A 3LX9A 3F2BA 3E5BA 1PKLA 1X1NA 3K4AA 1AH0A 2FKPA 3DHDA 5CZJA 5IHRA 4PODA 4A3QA 3DOPA 4Z1BA 3PG8A 4MWAD 1WZLA 3VI2A 3W7QA 4R9OA 4WX2A 3L0GA 2C71A 1TE1A 4GD0A 3L4YA 3PFRA 3USBA 3WX7A 1YPFA 1OFPA 2C19A 4DWDA 5L6UA 3FV9A 1BTCA 4ENLA 1ZCCA 2BFGA 3F4CA 2FMOA 3FXYA 3HTWA 1R3WA 1R2RA 5LHEA 4US5A 4AD4A 1P48A 1OABA 1UKSA 2HCVA 1WUFA 3DAQA 5I23A 4P8WA 5E6ZA 2E77A 4ADUA 4KEUA 4NU7A 2C0HA 4HNUA 3G8EA 2ZADA 4AMCA 4NG3A 2E1WA 1CDGA 1GVSA 3CZLA 4MHBA 1W3NA 1W3LA 3SCNA 1TTJA 1LUCA 3IACA 3EWUA 2EG7A 2D2GA 1WDWA 1GVIA 1XLCA 2ICSA 4OV9A 4JX6A 3M0HA 1OB0A 3F4NA 1UR4A 5D8WA 1RVGA 3NL6A 3L21A 3W7CA 3MBFA 5IHSA 1L8PA 4PMZA 1SO5A 1FKXA 4W7WA 5M2FX 4KFPA 1QWGA 1MEIA 2QVNA 3BOXA 4IQLA 4YWSA 4ZENA 3KE0A 1BRLB 1BAGA 1SVDA 4P8XA 4XZIA 1VEOA 3VA8A 3O9NA 1CNVA 3CHVA 3SCPA 5LGXA 1V6WA 1Y5WA 3AFBA 4HPJA 4MWAA 3MMUA 4F79A 2G41A 3FYYA 5K4ZA 4OGZA 3PZVA 1G4PA 3M0XA 1S38A 3EX3A 3IUHA 2VFIA 4HPGA 4CKQA 5D05A 4ZO9A 4F9JA 1BSLA 4Q4OA 4GX9A 4LNCA 1DE5A 3WF0A 3EOOA 5CEWA 4D8ZA 3PR2A 2OYLA 1Q2RA 1SJAA 4JTAA 5E6YA 3WDHA 1E55A 3V1HA 3VDBA 1XISA 4GJJA 4RV8A 4AB4A 2PDFA 4HKPA 3LPPA 2E5CA 2WMKA 4OUEA 5KZEA 1VC4A 4UUIA 2PBOA 3YPIA 1E9ZB 4JQ3A 3A9BA 4BI5A 1JULA 4WJXA 1UP0A 4BJHA 2CYGA 2G50A 3WQCA 1QBBA 1SFLA 1K7XA 3TSDA 4E8DA 4BF7A 1XXXA 2X41A 4UR8A 3MYPA 4HK6A 1HUVA 3NL5A 5JUVA 1AL7A 4Q4KA 4GI9A 3N34A 3N25A 3WF3A 1TG7A 3AO0A 3BGGA 1VZWA 4BQ4A 1X97A 4MMWA 4WY0B 2DORA 1FH9A 1QCWA 5D2TA 6REQA 1ISWA 4H7ZA 3VOFA 3GUGA 4A3HA 1CYGA 1GTEA 3GVGA 1QK0A 1W9DM 1T8QA 2WM1A 2XVKA 2Q02A 1EL3A 5FSDC 3B0PA 2E4TA 1CXEA 2BASA 1SW0A 2XVNA 1KKRA 2WKGA 3QPEA 4ZOBA 4QG8A 1UR0A 1NFGA 4DLMA 4EIVA 4F9DA 2YL6A 3S46A 2NXHA 4JKKA 4ACZA 2P0IA 3T40A 5G4WA 3CUFA 5CG0A 3BZJA 4EPBC 1M7PA 3VMNA 4LUSB 3FAXA 3ABQA 3U7VA 2OJPA 4M19A 1CENA 3BSMA 3WNLA 3TR9A 3SI9A 2PTXA 3IRDA 3QQWA 4PFMA 2WVVA 3BURA 4UQCA 3AWOA 2PZNA 3L5AA 3UESA 1R2TA 1RQHA 3M0ZA 5IBXA 2GVYA 3CUHA 4UFKA 1FRBA 3DYOA 1YNQA 4GRSA 3VDGA 3WLIA 3GLCA 4Q8OA 4HYRA 3ZWSA 4C5ZA 2Z1WA 3OGSA 2VOMA 1EYEA 1WXYA 1W2PA 2J6XA 4LUTA 3CLMA 4PUEA 4HIBA 3C3UA 4BCEA 1JFHA 3PWGA 2XZ9A 1X6LA 2DT2A 4XAZA 4XUYA 3ZS4A 5C5YA 4ZB5A 4MNKA 5DF0A 2GQAA 3WLJA 1BEUA 1Q6FA 5EMJA 1ONWA 3AXHA 4AZCB 1W1TA 4W9TA 3ZWTA 1J96A 1GNXA 2CESA 1NU5A 1XV8A 1JGMA 2D69A 3MY9A 5D9NA 1ZCOA 2A1YA 1ZU8A 2P53A 4MJ2A 2WVSA 5CSUA 1TJ2A 3WK0A 3PSWA 4LV4A 3W84A 1R85A 2FZNA 3L65A 5D02A 3ZZ1A 5M3WA 1M7XA 2FHFA 1K9FA 3R25A 4RXGA 3WQDA 1E72M 1GOOA 1C29A 3W7GA 2ZE3A 4WSKA 3BANA 1J0ZA 1I2QA 2B0MA 4FNQA 1TJPA 3A3WA 3OIXA 2D0FA 4IT1A 4O14A 3PB0A 5D8ZA 1NQ6A 1F6KA 4MB5A 5T9CE 2YKKA 3T44A 1BLIA 1KO0A 2CLFA 4AFYA 2RUSA 3AISA 3BVJA 2Y89A 4X63A 2RGLA 3DFYA 4EPDC 2ISVA 4NX0A 3LGEA 1M01A 4U5KA 4NAEB 4DBUA 1OINA 1FDYA 1W54A 1RLDA 2RJHA 5HBFA 3NQ6A 1CX9A 3MQTA 1QNQA 1W56A 4Z1CA 2YCLA 2E28A 4KWSA 2Q09A 2ZX5A 5EL1A 4AC1X 3GTHA 1TWWA 2IPFA 4K8HA 2C1IA 3IAQA 3UU0A 4QG6A 5T26A 1Q4NX 3UG8A 3GC2A 1FWEC 1R47A 1YBQB 1XDJA 4ZFCA 1XICA 1V77A 2EO7A 3GDKA 1T8XA 3AICA 3JVAA 1UWRA 1YHTA 1L2QA 1EO5A 4DQWA 2PDIA 4NAFA 1ALDA 2AOSA 1GWJA 3PNZA 1VB9A 1NH6A 4S3BA 1OF6A 3PZOA 1P7TA 4G9PA 4IGHA 3MI6A 1SYTA 1KRAC 2NX1A 3FY1A 4MKSA 3U7BA 4U31A 1XLEA 1SFJA 3U2OA 4RZ5A 3DEQA 4LRTA 2QDHA 1GW1A 3NGJA 1WDQA 2BVYA 2XM1A 1PIIA 3TUUA 1TVNA 3PTDA 4AZIA 1E71M 4ZA0A 4JIQA 3WFLA 5FF0A 3S1XA 5FESA 2Y88A 5D37A 4PMDA 3IS4A 2RDWA 4INFA 3TQPA 2CZEA 1V6YA 3W25A 3WMSA 1U33A 5CJNA 3LXCA 3ARYA 1UR2A 3GXIA 1UZHA 2D0HA 5GPRA 1A4LA 2FZBA 5HQMA 1B3OA 1K8XA 1F05A 3NQVA 1DE6A 4B3ZA 3NQCA 3BG3A 1LQ0A 2V5JA 2Z2AA 4PA8A 2VURA 3T1GA 3KTSA 1WA3A 4ZOAA 3PBGA 4KKXA 2BP1A 3N13A 3O3RA 3BAWA 3EWWA 4S23A 3TYEA 1J0JA 4QRNA 1PTAA 4GI8A 2WKJA 3BCFA 4JAWA 3GVVA 4NILA 2IKIA 3N12A 1H7PA 4O17A 3W26A 1NWSA 2FH8A 3HPAA 4Y8EA 1BVWA 3K30A 3WK2A 3UPWA 1IHIA 4ES4A 5K4XA 4CEXC 1R3QA 3AMCA 4NUWA 5E70A 3WDIA 1JNEA 2J8FA 1OM0A 2J7EA 5L9FA 5M03A 2AL2A 4L65A 1O1ZA 3O16A 1J5SA 2CLMA 4GKLA 3QSTA 4L4OA 1IIHA 5IM51 2W62A 3EMQA 1PHWA 3ABXA 1A3HA 4L9YA 1P1MA 2ABBA 3TLQA 3TWBA 3GXPA 3RPMA 1CGVA 4K8EA 4LQ1A 2J62A 1CGXA 3Q45A 2XH7A 4I5RA 2HVNA 5HWMA 1R7OA 2DZSA 2F61A 1W1YA 4GY0A 4X0VA 3N04A 3PG9A 3W1XA 1JEZA 1VHNA 1A0DA 3OHIA 3TCSA 4WK9A 3K4DA 4HHMA 3HO8A 4NJHA 2DQXA 3WJWA 1H09A 3TVAA 1XSIA 2GGJA 2VX5A 3R0UA 3ARTA 4QNWA 2BODX 2I16A 3W82A 2J79A 2GFTA 1M3UA 1ZNNA 1JZ7A 1PEZA 2OB3A 3QQ0A 3EGJA 2GUYA 3VD3A 2ZTKA 3BAKA 8XIAA 3P61A 3E2RA 4MWAE 4ROQA 1PZ3A 4O4VA 2R24A 3N29A 5U7SA 1WO2A 1B3ZA 1QR7A 2BOFX 2XFYA 1IEIA 2WSKA 2J77A 3W2LA 1SGJA 2CLIA 2VEFA 4CU6A 3MSDA 3CWHA 4RDYA 1VF8A 2EQDA 5K9DA 1TCMA 3N6HA 4ML9A 1A5SA 4QM1A 1R3TA 2YXOA 3UERA 1FP8A 4ROPA 3KRUA 4DNMA 3MDWA 1PL9A 3M6YA 3E0WA 3UXKA 1QDSA 1OGGA 2NXIA 4N9CA 3GH7A 1KM6A 4C1NB 4XAGA 1GG1A 1F76A 2PLCA 3IJQA 4M5PA 1XPGA 3RO8A 3IJDA 4FXSA 6XIAA 3C5QA 1EFZA 1Q45A 5HANA 5EMMA 1WB0A 3W1LA 4AZGA 1D8WA 3WD4A 5FJIA 1K6AA 2FDSA 1OX4B 2C8NA 1NJJA 1XGDA 2OR2A 4QJ5B 1GEQA 1TIMA 1KXHA 4PCNA 5AYIA 1KXTA 1VCFA 3ZFHA 5K3VA 5A8OA 3GH4A 1HFBA 1D7KA 3KM8A 1VBJA 4WSJA 1O5QA 2OQYA 2X40A 4LB4A 1AMKA 1SSGA 1KV8A 2YB1A 5GJMA 4M24A 3KOZA 3MV01 3KBJA 4DJED 4GQGA 2EXOA 3DHFA 1W8GA 2V3FA 2PCQA 4M6QA 4TUFA 1TKKA 1JL8A 1XFBA 4IP4A 1UBPC 3LERA 4V28A 4UTTA 2NUYA 5FACA 1WXZA 3D3AA 5LIWX 4IG2B 1QI2A 3N1AA 3G1DA 3ID7A 4J1OA 1XYMA 5LZLA 3JUGA 1LQAA 2NWRA 4N7QA 5JXQA 3WNNA 4YU1A 2ZICA 3QGKC 3DFPA 1J10A 1M53A 1TV7A 4LVAA 4AHOA 3ITLA 4RZ4A 5FCZA 3HIJA 2HVOA 3K8KA 1KA9F 2WJEA 5HMFA 3S6OA 3TYBA 2D20A 1KBIA 1YTEA 1FBAA 4HA3A 1DIKA 3KDNA 5A1AA 3KHJA 4E2BA 1GOQA 1DPMA 1PIGA 1MQQA 4IGSA 4C91A 1UR8A 1QT1A 2VGBA 3CK5A 4CD4A 5AZ1A 1XSKA 2VRQA 4HZ8A 1RHCA 3M5YA 1PZ1A 4CNOA 5CPQA 1J2BA 1NWRA 3NPUA 4I8YA 4V27A 1PBGA 4GHRA 4MM1A 5CPNA 3VCCA 4EXBA 2ZUWA 2E3ZA 3HF3A 5DY2A 1FWNA 1Q13A 1A5MC 4HZ6A 3UCDA 1XPYA 5FEZA 2WQDA 2AMXA 1WKYA 3GAKA 3TYUA 4FNUA 5AHFA 3CL7A 4HHHA 2V30A 3NFUA 1UPMB 1B9BA 3PJUA 2DZXA 4YHGA 2ZDRA 5C9XA 3MDUA 1Q6CA 5CC5A 4X9SA 3MKKA 2HQAA 2XH0A 1TE6A 1TV4A 5H2ZA 3GDLA 1QTWA 4QHRA 2X0YA 3R11A 1FWJC 4DJEA 3L2MA 2OEMA 4D6IA 3ECQA 7CGTA 3CUJA 3ZR6A 1F9CA 4K37A 4CCCA 1XLHA 3PB2A 4R9XA 4PMYA 3E12A 4AIBA 3QHNA 2GDVA 3FSTA 4MY9A 1PX8A 2Q8XA 1F6PA 4NJIA 1IXPA 4ML4A 1ZB5A 4BI6A 4D1JA 3SRDA 4WUIA 2A21A 2O9RA 4I90A 2E67A 3LM3A 1TR9A 3ITYA 2Z0IA 3NEVA 5AHNA 4MYXA 2VYOA 3OOQA 3O06A 1GVEA 1IQ8A 4DF0A 4QP0A 3O0FA 4I3GA 1UH2A 1MZHA 4RR4A 1O1HA 1REQB 4R5EA 4L7ZA 1BYCA 1XYFA 5IFPA 2Z6JA 3BLDA 2QUNA 1LROA 3II1A 2QJJA 4FAMA 1RY0A 2X2YA 1N55A 5G4HC 2BY3A 4A8LA 2Z28A 3G6LA 2UY2A 3FAWA 3GX9A 4F66A 1D9EA 4LANA 4XIMA 3DI0A 4H9UA 3LRMA 1RPXA 3PZTA 3WQFA 4H6EA 1M9HA 4NZJA 1W2VA 3IIZA 3WF1A 2WMHA 3BLPX 3RILA 3SJNA 4HN4A 3WBAA 3ARSA 3WLMA 1Q66A 1W32A 5D38A 4V33A 3ZT6A 3AHZA 3N3TA 4ZQNA 5I5RA 2PGFA 4DAFA 3ARZA 3THAA 1JDDA 2YDRA 2VTFA 1XLFA 1K8ZA 3F1QA 1TMLA 1NSJA 2F7FA 4UTWA 1WZAA 4R33A 2QS8A 1WKEA 1HIZA 1LBMA 3VDHA 2JALA 1OCNA 1FCBA 1V3JA 3LG3A 2WBKA 4LCRA 3P67A 1VIZA 4FOKA 4YNGA 3SIMA 1UWAA 3GDTA 3L9CA 3W1RA 3WBWA 4EANA 4J27A 1JRBA 5EMYA 2ZE0A 2RKXA 1XIFA 5G1TA 1PKYA 1JZ5A 1DQXA 1GQIA 3W70A 3LI0A 5C70A 3AIWA 4AD0A 1LLZA 3ONBA 1IT7A 2X09A 4KRZA 3QW3A 1DXFA 2F2KA 3HMJG 4ZB2A 4Q22A 3DBNA 5DCEA 4LAOA 3MUY1 2WNZA 4HNLA 2NXGA 4JY9A 4P7QA 4IQJA 2DVTA 2VCBA 2WZMA 1LP6A 3PS7A 2Z2BA 2REQA 2ACUA 4LYQA 2YZRA 5LXXA 4YCOA 1W1VA 3TW6A 2J78A 1LL6A 4UTUA 2DIJA 1OCQA 2E40A 5T9BG 1KR0A 1WPCA 2Q3OA 5AHEA 3W27A 1B9ZA 4IICA 4YVVA 3NUKA 4Z42C 2ZUUA 3I3BA 5FF2A 4YCPA 4FOUA 2Y4SA 1H0IA 5T8GA 1IXQA 1OWQA 3ZJKA 2GGEA 1XLKA 1GG0A 4HJFA 1XYCA 3GSMA 3AWNA 4AZ5A 2WOQA 3FEQA 1G69A 4JIIX 3RX2A 2Y5JA 2X1RA 3VNZA 1H60A 3W7IA 4JXCA 4NF7A 1UKPA 1BQGA 4NHVA 2Q6ZA 3GHRA 4YN5A 1BG9A 3S2LA 2I1OA 2ATSA 3IPWA 4P7OA 1PCKA 2OXNA 4PEKA 1MXDA 4JIPA 3OVGA 3A4WA 2GSHA 1Y65A 2V81A 1UIPA 5BWFA 2Y1HA 2Y5EA 4WKAA 2GL5A 2DT3A 1EQCA 3B04A 3KOXA 3HFTA 1IT0A 4JTFA 3W7DA 5HJYA 3VE7A 1GHSA 1L8NA 3ZLGA 3NG3A 1AW1A 1K9EA 5ABGA 1OX5A 3C52A 4C6EA 4E2DA 2Y8KA 4ZOCA 3M44A 3AS1A 3BJTA 4L5ZA 2WNQA 2QCHA 3DECA 3WLLA 3CGTA 5DRCA 2PAJA 1ML1A 5BZAA 4MUZA 2C18A 4NZ4A 4DM2A 3OG3A 2AKZA 1ZQ5A 1FHUA 1IZKA 3NPVA 3NA8A 1TMQA 2YOCA 1LLWA 1R7AA 4WDUA 5BCAA 5CPSA 1AMYA 1LWIA 5BXTA 1TTIA 4X9YA 1LORA 3C4UA 2ZOXA 2FZMA 3B05A 3QJAA 2XFFA 4ICCX 2ZUSA 1THFD 2VL4A 3WDRA 3NYZA 4PUWA 3FOKA 5HUOA 1TA3B 3RJXA 1CXIA 1S5MA 4YPJA 4JTDA 2YBUA 5KITA 5LSMA 1LT7A 1OCBA 4P2VA 4A29A 3I3DA 3EWZA 3UJSA 4C6JA 2G3FA 1HP4A 4LFYA 2V8ZA 1HVQA 5AYYA 1UWIA 3M7SA 3PPFA 3LD5A 1J11A 4KFOA 1PJ9A 1KKOA 3QYSA 3NQAA 2CZDA 2OYKA 4YYFA 3LRKA 1K7FA 5KTLA 3RYSA 1HX0A 1EPXA 4RK8A 2WVUA 4PZVA 5AC4A 4W86A 3HG4A 3E96A 1XW8A 2HDJA 2QDEA 3R12A 3WY1A 1KCXA 2G0WA 2FTYA 3WLSA 3HGJA 3W2KA 3ARPA 5C0QA 3TFCA 1M5WA 1JZ6A 3KVKA 2R8WA 3QGAC 4I9TA 3CTLA 4CVUA 2R1NA 4TOQA 3H2OA 1HJVA 6TAAA 3OLEA 2DZAA 3A4JA 2EF9A 1Q7MA 3I4EA 2PDPA 3QV6A 3NOYA 4E3VA 4BWLC 2QNEA 1W37A 1SO4A 4B5VA 1TFVA 1XSJA 1ADSA 2V5DA 3AIRA 4H3DA 3S5NA 3UFYA 2J7BA 1W8SA 4KESA 2YCKX 4RPPA 1KQZA 2E68A 3KVMA 1AQHA 3DHUA 2VEKA 1EO7A 1B3XA 1H3GA 2EBNA 3AMGA 3UETA 3LCGA 5JIPA 1DBTA 4GKTA 3WD2A 2PDWA 4FALA 2G3MA 2ZC8A 2OEKA 3T2PA 5AYXA 3WNMA 5LGZA 4J2MA 3DHPA 4MKVA 1XKYA 1H1YA 1IYXA 5CZ0A 5FJPA 2HEJA 4UOQA 3S2CA 1UMLA 3B0YA 2HRWA 4Z17A 3QF0A 1HF6A 9CGTA 1BXNA 4XX6A 2ASHA 4N42A 1JCYA 2BY1A 2OX1A 5JMUA 1GJWA 4AEEA 3CLWA 2BVDA 1UCWA 5KSWA 4W84A 5E5CA 3EB3A 1CLVA 3RX3A 2VJXA 2IS7A 3UWQA 5MHBA 3BPWA 4O19A 2Z6IA 3WG6A 4RUBA 1XRSA 3W1QA 2E9LA 2QJMA 4X22A 3HG3A 1F4AA 3SZ8A 1XYLA 3A3XA 1XDMA 4TIMA 4F2BA 5A94A 1IWAA 5LIYX 5HA7A 2NQZA 3OHMB 3CMGA 3MA8A 5FOOA 3VNYA 3LTYA 4AY8A 4D6DA 3QFEA 5A6SA 3L2LA 3P0WA 3ITXA 1DJQA 4LAMA 1TX0A 3STEA 2XM2A 4RE0A 1YDNA 1AFSA 4IIBA 4NZ5A 4UMAA 3WH5A 5M5DA 1JGIA 4A8NA 1HL9A 3DFQA 3VX0A 5G2HA 4CLMA 1TZZA 2VHLA 2ZX6A 3L4XA 1VENA 1XGZA 3CT7A 2WAGA 2JQXA 3R8HA 4PULA 2OOGA 4X2RA 2JKEA 1NARA 2OWXA 3ITVA 5E9XA 1XBYA 1KM1A 3GWQA 3UR7A 2OLSA 4GXMA 2PTWA 2O9OA 1GEHA 3MKCA 2XWDA 3FJLA 3F2CA 3EDJA 1LG1A 3SUUA 1Q6EA 1JD9A 2ZZ6A 3WFAA 3J7HA 2I9UA 1JYXA 3RO6A 5CBIA 3OYZA 2QMKA 3LLXA 2XU2A 2PF8A 3UR2A 4CCZA 3W7RA 3CMJA 2E25A 4Y9AA 4QAWA 3W2MA 1V79A 3AXMA 5DO8A 2WCGA 1S2WA 5AECA 2HE8A 1TX2A 4B3LA 4GBDA 3LB0A 3QHMA 4K7YA 1RJQA 4C65A 4OVXA 1NY1A 1FWHC 5CAHA 3CZGA 2VD8A 4C6PA 4IXXA 4AD3A 1SO6A 1TMHA 1VFTA 1QNRA 2ZTJA 3W2JA 3WH9A 3W1AA 1UOKA 2H9AA 2P76A 3W87A 5D2VA 3UYIA 1XI3A 3GR4A 1A50A 1Q3NA 1XC6A 3MP3A 4LUJA 4AH7A 3BCJA 1SZGA 1EZWA 1TVLA 2QUMA 3UWEA 2XN1A 2E6FA 4H9TA 1YDVA 1EH9A 4DJFD 5LNVA 1HL2A 4M8UA 3W7JA 4WDWA 1F8MA 4QLLA 3T8LA 4G1KA 3GXTA 4NZFA 1BYBA 4CD6A 3G18A 3TJ4A 3AQUA 3N9KA 5AB3A 3GW0A 4M6UA 1VBRA 3CL8A 4CUCA 1TQXA 1W3TA 2CBUA 3S8HA 3RLUA 3FJNA 2IQTA 3BLEA 4Z1AA 1YNPA 3E1F1 5A8PA 1KBJA 2V3EA 3CH9A 1DIEA 1JDFA 4GXWA 3SCRA 1E0XA 3C0LA 3CQIA 1MUMA 3I7QA 4JKLA 1RJRA 4IMFA 1FWWA 1DWGM 2W5FA 3IANA 3VPLA 3ZVIA 2ZQ0A 3Q65A 3TROA 1EA0A 3UP8A 4AW7A 4XSMA 3SGZA 4UQBA 4QCFA 3JRKA 1US2A 1XCFA 1BF6A 3O05A 3GYCA 4GE8A 2P50A 4W8AA 4GQBA 1XYZA 3LI1A 1NTHA 3BQ6A 4YLWA 3R8GA 3P3BA 1MW1A 3GNRA 4GYPA 2CEQA 1H11A 1OIMA 1P6WA 3W73A 4YVXA 1XIHA 4H9VA 2FDMA 1OX4A 1MUWA 4LY8A 4I7WA 3OG2A 1AZ2A 5ECUA 4POCA 2B4GA 7REQA 1K03A 1XLBA 1Q6LA 5I7GA 3QR1A 2I14A 4U4MA 2V2CA 2X1UA 1W5QA 4ORIA 2J6VA 3BG5A 4IPPA 3SCVA 3TH6A 3SUTA 3VILA 4QJ4B 3PN8A 3M47A 1WQ5A 1SUXA 1DXEA 1M41A 1W1IE 3TSBA 3OLDA 4AWSA 5I06A 4QDMA 2J4GA 4WOZA 4BF5A 1W9XA 4DJFA 4Q7IA 1UKQA 1U1HA 4D6HA 2J8GA 3SCTA 4V2XA 3NXLA 1G6CA 5FKYA 1GVRA 4IG2A 4K1WA 3VFCA 1QK2A 1BXBA 3NDYA 1D3CA 5XIMA 2QMJA 4LCSA 1VCGA 4LW7A 3QZAA 4L1XA 1UP2A 2W67A 3MS8A 1UG6A 3R94A 3IIXA 1ZALA 4HA1A 4LYRA 4MB3A 2NQ9A 4TV6A 1EP1A 4GY7A 1UR9A 4A35A 4OUIA 2QIWA 3H2MA 3K5XA 3KFTA 3EX4A 2QEZA 4DN1A 1RBAA 3UZZA 1ZUAX 1J93A 1YYAA 4ZQMA 4IXHA 5C6MA 4W8LA 4JN6A 3W2NA 2G4FA 3KXQA 2A7PA 1PTGA 4LUYA 4LCQA 1C9WA 1VRXA 1WZKA 3TTYA 5CXPA 4ZEPA 1G1YA 1YEYA 4FS9A 3CYVA 4NQ1A 5CSRA 4JIEA 4Q4PA 1K77A 3CEPA 2VT0A 3AOFA 3UYCA 1UC4A 2PDKA 2QKFA 3PPHA 3GY1A 3PTMA 3KAOA 8CGTA 1UASA 4QBXA 3CQJA 1J9YA 3VZYA 3B8SA 1W0MA 4DZHA 3VZXA 1XD0A 2G37A 4O53A 3TTOA 3E0IA 2PLKA 3KX6A 4MAVA 4HBKA 3VUSA 4F0HA 4K1GA 1EEPA 2Y2WA 4AIEA 3KVJA 1TPH1 4WKHA 1XYBA 2E8ZA 1TUXA 1B0IA 3BAJA 1MW3A 3Q4DA 1XIBA 2Z25A 2VENA 3EXRA 2OGYA 3VXGA 3S6TA 2NSOA 3AZTA 1X6UA 3W28A 3U4AA 2XVLA 2PURA 1WYIA 3VUPA 3ZLFA 3AHVA 3BSGA 4PE8A 2BHZA 1GOMA 1IF2A 1CW2A 3HURA 2HBVA 2H3DA 4B90A 1G0CA 2V5LA 4HCHA 1VFUA 3G1SA 3O6AA 3NQ2A 1CI1A 4MKNA 3WNKA 4HOXA 1KTBA 5DXYA 3UG4A 1P4CA 1YW1A 4FX7A 3W7EA 4CQCA 4P7NA 1JPMA 1K02A 1A3WA 3B06A 1CB2A 3GNXA 7TIMA 4RLIA 4C6LA 1TYGA 4H19A 1J8VA 3WMBA 2A2IA 4FIRA 3PZIA 4FEZA 1XINA 3BH4A 4N6EA 1EF3A 4H7CA 1N2VA 1TPEA 3DH7A 3TN4A 4U2YA 1J0KA 1KR1A 4O1FA 1LG2A 4JIRA 3U5UA 4LC8A 3CHDA 3FEMA 2XINA 2QJNA 3W1TA 1JG9A 1UJPA 4DUXA 5A8MA 4S2CA 4V15A 5DELA 1RPKA 3VM5A 1T41A 1O68A 4ZSTA 2X0HA 3AALA 3FVDA 4IJCA 4WY0F 3RU8X 3G1RA 2GYIA 4RE3A 2V68A 3IIOA 4LT9A 4EPKA 2XN2A 3THUA 3WMCA 3ZMRA 1EF2A 1A5KC 4WCJA 2OZTA 1QRQA 3G1YA 4XBJA 1A0CA 5FJJA 1TREA 3QKZA 3QQ1A 4BK9A 1GHRA 1L6FA 3K8MA 4AZHA 3SGUA 2J75A 3SUSA 4UTWC 3ENLA 5JU6A 3DFNA 3GDRA 1PDYA 4U33A 3DIPA 3LLFA 3BQ5A 2I5IA 3LCFA 4B92A 2FPVA 3ZOAA 1FXPA 1H62A 4RJEA 1I2RA 2H3BA 4XBKA 2PRHA 4O1CA 4C1KA 3RCMA 4A6GA 4U2ZA 3RMJA 1ZBVA 3CJPA 1PSCA 1ZZMA 1NOFA 1IGWA 3S5ZA 4JCLA 1CB7B 3BWWA 3EDKA 4GIEA 3DFTA 4UWMA 1VPXA 1KCKA 1X1OA 1B3VA 3N2MA 1P5BA 3B0XA 1JZ4A 2NQHA 3L4TA 3ZT5A 3M1ZA 3CAKA 5A8QA 2X16A 5EGRA 1WP6A 1W1PA 2F6KA 1QNPA 3H7VA 5EYWA 1BTMA 1ITUA 1UWQA 4UQDA 4JOMA 4ZVJA 4JFWA 3ANVA 2BGSA 4DWSB 3W7PA 2VGFA 4IFRA 4E3TA 1RZMA 2CWNA 1W31A 3ZR5A 1IEVA 3OBAA 3M5VA 1R38A 1EJVC 1FUYA 3OEXA 2EJ1A 1NEYA 4Q8QA 5HWJA 4RW3A 1OCJA 4BQ2A 4I9MA 1Z3NA 2QIIA 3WF2A 2ZC1A 2HTMA 3WLPA 2EKGA 2ZVRA 3NQ8A 1W91A 1NWTA 1JQXA 5HQEA 1ZGDA 2W92A 2Y6ZA 1LDCA 3CU2A 4UXDA 1EOKA 2WQPA 1ZTVA 3SCOA 3BO9A 1E6QM 5BMXA 1A0EA 3OA5A 3W74A 3B8IA 5GNXA 3N17A 5ABFA 1Z89A 2VKZG 2PE4A 4FK9A 3S0CA 4ALDA 2A3AA 3KBWA 3NURA 5KETA 1K8YA 3V35A 5CGTA 2DZWA 3BMVA 4DBSA 3GBEA 1WV2A 3B3DA 3G0SA 3WBXA 3UG5A 3WKZA 3U3HA 5CSYA 5HPOA 4NJGA 3G0XA 4PTWA 5KZMA 5DMYA 2QR6A 2IUZA 2DFAA 5IDIA 3R10A 4IM4A 4QLKA 1KM5A 3NQDA 4HPHA 3S5SA 2NLYA 1KB3A 3DENA 1GYLA 2WMGA 1XUZA 2OCZA 4CGTA 4UMCA 1JAEA 3GNNA 1H4PA 4DBEA 2WHMA 2A3LA 3S6DA 2VR5A 3AU2A 1H7NA 5HR6A 1UD5A 3OBKA 4LVFA 3TQKA 2HSAA 3UJ2A 4US6A 1KLZA 3VIOA 1AQFA 1R86A 2VGGA 3MPGA 3E2QA 5D32A 1EBHA 4Z08A 1KTCA 2G8ZA 3B9EA 4R34A 2ZZ3A 2AGKA 3NQGA 3M07A 1YTDA 2D2OA 2BGNE 5MKGB 4E2VA 3L12A 1KV5A 3AZSA 4Q8PA 3S2JA 1GKRA 1JPKA 2IPGA 3W6LA 2W3ZA 4JQAA 3P7YA 3PPGA 3GU9A 4NNAA 4EAMA 1AJ2A 2CHRA 4W85A 2PWUA 4J2PA 2JFEX 4FF5A 3QW4B 2PCEA 1W5OA 5DCDA 1OFAA 3L66A 4IH3A 1E73M 1H7OA 3O07A 1HT6A 1U5JA 3UWYA 1XLLA 5REQA 3OW1A 2GJLA 3KZSA 1LF1A 3HMCA 2X1TA 4H8UA 2IW0A 1E6SM 4QDWA 5CH9A 1TTPA 3RM8A 2BVTA 5HINA 4LB3A 3IIVA 3RFAA 3U6WA 2C13A 1Q65A 3RN6A 3CASA 2XFRA 5CG7A 3TTQA 2CBVA 2ALRA 3AYRA 4LEQA 5BRBA 2INEA 3P8IA 4YL2A 1KXQA 1F8IA 3G1FA 2G3IA 5EMKA 4H2HA 4PB4A 1W5NA 2OSWA 3U2ZA 1VEPA 2BOGX 4B5SA 5EBUA 4HD5A 3STCA 1PCWA 3VIIA 1OIFA 4Z2IA 3DG6A 2C6QA 3DXIA 2WMJA 3QYQA 1V7AA 2WC7A 5JH1A 1C91A 4GOAA 4IGNA 1G01A 3MCMA 2WV8A 3GKAA 1KFJA 1QOPA 2JF7A 3THQA 6CGTA 4BS0A 1BWKA 2V5CA 2JEPA 3OU8A 1SZFA 3CQHA 4TMCA 3ELFA 3PZUA 3VIJA 1HTIA 3R5EA 4IP7A 1JI1A 2XISA 1PZ0A 3V1PA 1UWUA 3BSHA 1E9IA 3JZEA 3I7RA 1GZGA 2BSLA 2VI0A 5HQLA 5D2YA 2HPIA 1XLGA 1CT5A 1GOKA 1POJA 1MUCA 2ZZ4A 4K2SA 1TPFA 3P82A 4XD4A 2GLKA 3H2EA 3POCA 4V1XA 5C2XA 1A5AA 4B5XA 5F4WA 2D2JA 3CO8A 3QMSA 5BRQA 4GINA 4GZEA 5E0FA 2ISWA 1BQCA 3KBMA 3QLDA 3KOYA 2VZSA 2C3ZA 2X30A 1PHQA 3T2QA 3QKEA 4CU8A 4TX6A 3IJ8A 1X8FA 3C0JA 5AOUA 2OX4A 2C14A 1C93A 3O7UA 5TD4A 3BG9A 3JS3A 1WZMA 3D6NA 4W7VA 3SO7A 4NYYA 5CZSA 1SFTA 1DEDA 3OVRA 3M46A 2CKRA 3UVAA 3AHYA 3E0VA 3OP2A 1KFCA 2PDXA 4CD5A 3N6QA 3NGFA 4KWWA 4FXFA 3WUEA 3TONA 3I4KA 3P62A 1PTDA 4YIWA 3H4WA 2OLHA 1FA2A 3W37A 2XIIA 4QS5A 3W72A 3UWVA 4DZAA 4GXPA 2R1PA 5TBOA 2NVAA 3GVWA 4MAZA 3TJIA 4GFSA 3QY8A 4DIAA 4B3KA 4PSRA 5DMNA 3P5ZA 4C6FA 4OWGA 3M7WA 3T0BA 4N0RA 2OU4A 3KBSA 1JI2A 1JPHA 4Q33A 2R1KA 4RX0A 3EKLA 2I5GA 4W4QA 4EXQA 3W71A 4WVXA 3VIGA 3FJ4A 4J3VA 3B9OA 4NI8A 5K2ZA 1XIJA 1VBHA 3MHGA 5JBEA 2PRMA 4JTLA 3C56A 3T08A 3VKKA 3VKAA 3L5MA 2X1IA 4B16A 2ZDSA 1K4GA 2NVCA 4PYSA 3IGUA 4XD6A 1K9DA 3B8WA 3UT0A 1MNSA 4MG4A 1IXOA 2Z27A 2NQLA 4IWWA 4PCFA 2PBGA 4DO6A 4JTSA 5G2IA 4AF0B 1QJWA 4LJ3A 2GK1A 5DBTA 3TYCA 4B5UA 4M1BA 3QM3A 2QCDB 3WF4A 1TR1A 4H8HA 2BZNA 3NSMA 2EAWA 1F2JA 2ON3A 3FGCB 2ONEA 1XM3A 3ABZA 4XZLX 4M56A 4O1BA 4IJBA 4DYEA 3O63A 4ZTXA 4O1DA 2E6AA 1TZ9A 1RA5A 1EP2A 3K46A 1JCNA 1RH9A 3CAVA 2Z1SA 3IJ7A 3HG2A 3W7NA 3DYPA 1R0MA 2A7RA 1S3TC 3UR5A 3TW9A 5HMDA 3FFSA 5A6MA 3VX1A 4J5NA 5F4SA 2CLPA 1VYRA 2WXDM 3AIUA 1O5KA 5E0CA 4O12A 1JDEA 1QPOA 4REQA 4H6RA 3LRLA 1UKTA 1W17A 3GW3A 4LS0A 3NO5A 2CZVA 2GSEA 2GJXA 2PWGA 3FX4A 1JIBA 3GD6A 4RDZA 2HPMA 5TQLA 1IR1A 4V1YA 3RNDA 2ZXBA 2NV9A 2QXWA 1NDYA 1OYAA 1XYAA 3ATYA 1OZMA 4K7VA 3VOCA 4XO7A 1F7BA 5AC5A 3H12A 1V0MA 3M0VA 5CBBA 2A3EA 4IL0A 3CB8A 2WWCA 3ARWA 5F2MA 4IFKA 3WENA 1T0OA 4Y7EA 3AIVA 5B7ZA 1D3HA 1VH7A 1FCVA 4FA3A 2FMNA 3AJ7A 4I9AA 2PS2A 3O1NA 3VIKA 3W6MA 1MFVA 2YXGA 4QAIA 4L4LA 4GJIA 4FXJA 4UTMA 4GCAA 1E3XA 1AVAA 3DUGA 3CNYA 3N2TA 3QTPA 3ZJ7A 4UOZA 7PTDA 5JQ9A 4AY7A 2PPGA 1AL8A 4HSOA 4PMJA 4BZYA 3RLVA 4G8TA 2WWDA 4UQ9A 2GVGA 1RLCL 1S46A 4KS0A 1TRIA 3AI0A 3GE7A 4DZ5A 5C2GA 3MB9A 4G6CA 1MO0A 3PZMA 2WZEA 1SJBA 2XG9A 3UGRA 4KWVA 3SQSA 1BVZA 4ONVA 5A6BD 3TZNA 1NOWA 1B54A 3TAOA 4EK7A 1R30A 1W3KA 2DT1A 2WHLA 1NFBA 3DGRA 4D72A 2E9MA 4ZQPA 3LOTA 3WEMA 2CBIA 5EFDA 4IP5A 3DC8A 1XFCA 3WELA 4DUVA 3NVDA 3SAZA 4DPQA 1EJSC 4WZHA 2PEVA 1S2TA 4MYAA 3WQPA 1M7OA 1TPC1 2DSUA 3LHZA 1CXKA 1VLWA 3QZEA 2P8CA 3WQ8A 2BNJA 5BU9A 1VFLA 2HJPA 5C2CA 4GZJA 3UXDA 2PD9A 1WBHA 1OX6A 4QIUA 4J40A 3ZVHB 3BZGA 1QI0A 2V63A 1BVNP 1E6RA 1OHLA 3RXZA 4GX8A 5EPDA 1D7FA 4CNNA 4LU0A 2FGLA 5FEWA 3HPFA 3T0TA 2YLAA 1G4TA 5BOOA 2PP1A 1XUUA 3BDKA 1YPXA 1CCWB 3SEPA 2WSQA 3NM3A 3PZGA 1GTHA 1P0DA 2ZUMA 3ZSSA 4Z1DA 3RPTA 3A13A 4KGLA 1WDPA 3MSGA 2GDUA 4PFHA 3RF9A 3T05A 4EWND 3VFLA 1TV2A 1SR9A 5I3IA 2GQ9A 2YR1A 3CHEA 4AZBA 3UZWA 2ZZ1A 3TV8A 1PUDA 1FWFC 1DJXA 2GVJA 4MADA 3HU7A 5RUBA 1C7TA 4LYPA 3N2OA 2YL9A 2HROA 1UQYA 1TPB1 1QASA 2VZUA 4L6DA 1UR1A 1TVPA 2V67A 2BHUA 2WJZA 4AY1A 2NWSA 4LAZA 1Z32X 2GGGA 5A6BA 1MW2A 5I3DA 3TXVA 4ZCWA 4LF2A 1KFKA 4Z2LA 5DBUA 5F2LA 4UZSA 3AMKA 3BV4A 1S1RA 3V36A 1J6PA 1EC8A 1WXJA 2VR4A 3LXBA 1KRMA 2WLZA 1SW3A 3TYAA 1FH8A 2DZTA 3ATZA 2GZXA 1TWZA 3CQKA 4P5UA 3BLOA 3GDBA 4HGXA 3M0KA 4K68A 4EACA 3UGVA 3MUIA 4KWUA 4UTJA 4E8GA 4DWSC 3T8QA 2G5WA 1H50A 4HSHA 4UTIA 1QPQA 2BBFA 1DXIA 1UA3A 3KBVA 1R9ZA 1ESWA 3LQGA 1ZS2A 4NX5A 3CPRA 3B0VC 3TX9A 3W86A 3CT2A 4QCEA 4HCDA 3H70A 3H8AA 4H00A 1OK4A 1DIOA 2OZ3A 3QV9A 3L4UA 1UOZA 1PV8A 2YB4A 4LXFA 1MNZA 1HQTA 2YIHA 4RXFA 4C7FA 2ACQA 4IIHA 1TB3A 2PDQA 1QO5A 2WMFA 3W7MA 2DH2A 4OU1A 4PUKA 1TQJA 3N73A 4QQ3A 1IEQA 1DTUA 2AAMA 4UNKA 3QC3A 2H8ZA 2GUBA 1GQLA 4JN7A 3SSJA 1Q6OA 1DQWA 1GKQA 3F5LA 4F0SA 3O2LA 3W53A 3N14A 4AAJA 4PMXA 2GWNA 3I68A 4UFLA 1T6MA 4WF7A 1EXBA 4J3XA 3M41A 3W1MA 5H6HA 4DF2A 1LRQA 2F38A 4TR9A 5AYZA 1KFBA 1NF7A 3SR7A 5LKYA 1JF6A 2CITA 4KCUA 3WIJA 1BKSA 4XWUA 3ANUA 4S3EA 4LC6A 2O0TA 3GHUA 3N2BA 5M17A 4D1IA 3M0IA 4JDYA 2FPTA 1G4EA 4PMVA 4DPPA 2X05A 1GT8A 4JEJA 2CIPA 3V5FA 1E4MM 2A0NA 4JTIA