2W6RA

Crystal structure of an artificial (ba)8-barrel protein designed from identical half barrels
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
233
structure length
223
Chain Sequence
MQRVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADKALAASVFMRELKEYLKSGQAVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
publication title High-Resolution Crystal Structure of an Artificial (Betaalpha)(8)-Barrel Protein Designed from Identical Half-Barrels.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 69
structure length 223
sequence length 233
ec nomenclature ec 4.3.2.10: Imidazole glycerol-phosphate synthase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2w6rA00
2FPYA 5DN1A 1EB3A 3CEUA 4XKYB 3M43A 2H90A 3LDVA 1YTEA 3RLUA 2W79A 4JX5A 4MZ8A 2RHGA 4JD4A 4NZJA 1KFCA 2CZDA 2ABBA 4NT0A 3B4UA 3TJLA 4MZYA 4RJEA 4UTUA 5D2TA 3UY7A 4HNNA 4QNEA 3A5FA 2Q8LA 2GPTA 4O54A 3W70A 2E09A 2C13A 2NX1A 4N9CA 4IX2A 1MEWA 3DKLA 4X9SA 1KM4A 5LNRA 2E1DA 2G96A 2QDHA 2TRSA 1P4CA 1WBJA 3W7NA 1FCUA 3BG3A 1QOPA 2EAWA 2JKEA 4WXZA 3SGUA 2OT0A 4DF2A 4UFLA 4UNLA 1FXPA 3G0XA 4LU0A 5G1YA 1TREA 4K39A 4MY9A 5AC6A 1H61A 3LCGA 4FXRA 2WV8A 1KFLA 3KAOA 3UZ5A 4LVAA 1G7UA 3DI1A 1EX5A 2VENA 1LOLA 5IBXC 3NM3A 2E6YA 1TPDA 1S5TA 4DF1A 1BTMA 5CPOA 3A5VA 3GDTA 4DBDA 4RXGA 3G1YA 2C15A 5F2GA 3BARA 5CSSA 5AHFA 3UYCA 3LBCA 4DXVA 1TQJA 5DXXA 1PCWA 4I9AA 1YPIA 4XTIA 3BLFA 4A3UA 3KVJA 3M7WA 2QEZA 1JCNA 5KZMA 3LHYA 3W2UA 4XZ9A 3O05A 5F4SA 1NF0A 3BK0A 3PBVA 3GDKA 4MZ1A 1RPXA 4JTIA 1GZGA 5K7JA 2QCDA 1YTKA 2QJHA 5LNSA 4ORIA 3NL3A 4MVAA 2ZZ5A 3PAJA 2B7OA 4JTKA 1H7RA 3BO9A 3SECA 2PRMA 5BNKA 3R2GA 3MI6A 2GVJA 3UWYA 3D0CA 1B3OA 2RKXA 3DU0A 3A22A 1CW2A 3G8RA 1W8SA 1WXJA 3P5YA 3MI2A 3S5OA 5K2ZA 3GNNA 2X16A 3S0CA 3IGUA 2NX3A 5HQEA 4JY8A 4XBSA 1D3HA 3S1XA 4XTDA 2V81A 5AN7A 3TSBA 3DFNA 3DFOA 3G0UA 3S6DA 2CU0A 4WQ6A 3C6CA 2NX9A 4GRSA 3TW7A 2VFGA 4JX6A 2R14A 3A9IA 5HWJA 3R13A 3H54A 4UTMA 4LNYA 2G97A 1IIHA 1K7XA 4IXHA 3JR2A 3R12A 3W73A 4O14A 2BZNA 4DPQA 2WJZA 4NNCA 3STCA 5HINA 2RDUA 2ZZ3A 3CT7A 3F1QA 1F6KA 4O16A 4JTFA 3GXTA 4QAIA 4MYAA 1L6WA 2Q3RA 3W3OA 3EEGA 3DI0A 1FWWA 1W5QA 4FB7A 5I3FA 3M44A 3TH6A 1WOAA 4N6FA 1ZHAA 5D02A 1D3GA 3C56A 3PF3A 1LROA 1DJQA 4IUOA 4LVDA 4JTLA 4O15A 4QNWA 5K9DA 4NQ1A 1W31A 3WFAA 4G1KA 1M6JA 4Q4KA 4JDBA 4RCXA 4CCCA 5C2XA 5KZDA 3G18A 4UC5A 1EP3A 4LRTA 3EWZA 4GUGA 3P5ZA 1LRNA 4NZFA 1OG0A 4NJKA 5K4ZA 3AJXA 2JK2A 1H62A 1KV5A 2VXNA 1H7NA 4AMAA 4FX7A 3O63A 1EUAA 4QM1A 3STEA 4UNKA 3S1WA 1IXQA 2X1SA 3GDRA 3W7EA 5HWNA 1AMKA 1DOSA 3N73A 1M7OA 1P0NA 1LZOA 4U28A 3FJLA 1G4TA 4FIQA 5F2MA 2RDWA 4UTWC 1GJPA 1XXXA 2BWGA 2ZCGA 1TIMA 5U4NA 4AF0B 5IM51 4FNQA 2C19A 8TIMA 3W7QA 5FEWA 3GNDA 1SW7A 1WDWA 2CLMA 4WZHA 3NM1A 2FB2A 3NNTA 2H3DA 3NQ2A 3PB0A 2ISWA 2Y7FA 3UWWA 3W72A 2I9EA 3TV8A 2I1OA 4ZMGA 1DHPA 3CM4A 3NAVA 4FNTA 4OQVA 1LBMA 4NJHA 4OT7A 5CPNA 1T0OA 3GAKA 3OVRA 2XN0A 1PCKA 2YSWA 3A23A 4ZVJA 3CHVA 2PRHA 5KSWA 1MEIA 4RX0A 3BW2A 4PODA 4LVFA 1YYAA 4A21A 1PV8A 3LCWA 5AYXA 3W7DA 3MHUA 3ABOA 5HULA 3FS2A 3W7MA 4WX2A 5AHIA 5K9CA 3G3DA 4Y9AA 1VS1A 1G6CA 1VH7A 2A2IA 2VFDA 3GR7A 3MP5A 3LRMA 5FI8A 3HG2A 3LTPA 3SY5A 4UTJA 1SQ7A 1BWLA 2A6LA 3FJ6A 2LLEA 2WO5A 4O28A 5C5YA 3W1AA 1T96A 2OZ0A 4DO4A 2PURA 2NZLA 4PEKA 1GVFA 3LHTA 4M6VA 3EWUA 1SFLA 1TO3A 5FEXA 1GTHA 1DV7A 2CLFA 3T44A 1GYLA 1SO6A 3W23A 1R46A 2TSYA 1TMHA 3NQGA 3GX9A 1UUOA 4OHQA 5DY3A 5FF3A 1YLVA 3GXNA 3M41A 2DU2A 1GQNA 3ZR4A 2A85A 4E2BA 1DORA 1EUNA 3KRSA 4Z1DA 4GUIA 3LHVA 3W7IA 6ALDA 4X2RA 2AQWA 2RDTA 5LNUA 4O50A 3O6DA 1T8XA 2ALDA 4N6EA 5BOOA 1P5BA 4Q32A 1AK5A 2C0AA 2O7QA 3ABQA 1YTDA 2J9YA 3GDMA 1W0MA 4UFIA 4MJZA 3T55A 1QCWA 3S1VA 4E2DA 1CI1A 5DBTA 5HUOA 1F5ZA 1VR6A 3L2IA 1TTQA 2JKAA 2WSYA 3HG5A 5CSRA 1NEYA 4UMAA 3QSTA 1X8FA 1OFOA 3NEVA 4CNPA 3NQ6A 3B8DA 3T4CA 5D2WA 3CPRA 4ZQCA 2Q3OA 3CEPA 4O8RA 1OX4A 1XBZA 3GDLA 1I8JA 5BW6A 1FWRA 2YR1A 3E02A 3WK3A 4UFMA 1PE1A 3IIPA 4JICA 4LS1A 3NZRA 1YXCA 2H8XA 3S8HA 1SPQA 2DZPA 3G24A 2NUYA 1JJKA 3M6YA 3LB0A 4HHPA 2V2DA 3C2VA 3DENA 4B5NA 1VCVA 2J6XA 5L9FA 1EEPA 3UWQA 3LCFA 1A5CA 3HQ1A 3ZWTA 3TC7A 2ZA3A 3HGSA 4HNUA 2A0NA 1M5WA 2DORA 4JNMA 1LLWA 4Y90A 1ME7A 1KW1A 2C16A 2NXGA 2VFEA 3W86A 5AHLA 3VCRA 5J5RA 2ZZ2A 3N19B 1XBVA 3GIYA 4O17A 4KFPA 2Y88A 5I3HA 3EX6A 2ZBTA 3W2KA 4O1AA 1MZHA 2AAMA 2DZUA 1XKYA 4HSOA 5LKYA 3O16A 4UFKA 3W22A 2VELA 1QWGA 3KXQA 2WNQA 4YCPA 1C29A 4N9EA 4TMBA 4NXKA 3WK2A 3NPUA 1VLWA 4I7WA 2ZTKA 2B7PA 3LHZA 4GFSA 4P61A 3ANYA 2G95A 3MW7A 4X22A 1GEQA 2A5HA 4JY9A 5HR7A 2J88A 3N2MA 2ZTJA 2ZYFA 5KMYA 4R53A 3U2OA 4FEZA 4AEOA 1BKSA 2ZFAA 3P60A 3W87A 1QFEA 4E0CA 3S1UA 4UIOA 3FKKA 3WJSA 4QJ1A 1Y0EA 2WNNA 2H3BA 4PTNA 1K7FA 3PG8A 4Z0SA 1TV8A 2O7SA 1TJRA 1GVQA 5AYYA 2XN2A 1VLIA 2E77A 5D03A 3TJXA 3BPWA 4LOCA 1O60A 1GPWA 3U8GA 1NAL1 1BWKA 3UWZA 1KBIA 4IXXA 2DZVA 1OHLA 1DJNA 1YXYA 3SIZA 1EWEA 1QAPA 1RQBA 4IMDA 2J9ZA 3HF3A 3HPSA 3LGEA 3L66A 3QFEA 3BG9A 3I6RA 3AO0A 4RLIA 2NLIA 5CZ0A 4H3DA 1V5XA 3G0SA 1AL7A 4DF0A 2RH9A 3NPVA 4O13A 4NJGA 1SO5A 5DCEA 1IIGA 2OX1A 4NXSA 1S5WA 4BWLA 5F1VA 3CU2A 1V7YA 1O5KA 4EWND 3TFXA 5DCDA 4WXYA 3TQ0A 2XN1A 1ALDA 1LDCA 5FESA 2AGKA 1EP1A 3MYOA 4Z1CA 2TYSA 3LCIA 3HJZA 3Q37A 1L6SA 5LHFA 1F2JA 1S3HA 3MP4A 5TIMA 4UR7A 4Y96A 3IEBA 3ZWSA 1G4PA 3OA3A 3ATYA 3F03K 3TK7A 4DEFA 1C8VA 2EPHA 4FO4A 3S42A 2CLHA 4RK8A 3W7LA 3SSJA 3NQMA 3WJZA 3TXVA 1MEHA 3W85A 2ZRUA 1UASA 3O6YX 4M7TA 4AHQA 1XI3A 1FDZA 1F6PA 3PY2A 4EOUA 2QKFA 3W7OA 4KFNA 3RNDA 4L4LA 3PG9A 3PVFA 5EBUA 4IPJA 3OVQA 3NZ1A 1ZY9A 1R2RA 2EF9A 4UMBA 5CPLA 2QF7A 2YFOA 5K3VA 3QH2A 1O95A 3EXRA 4O52A 4UTIA 4IPIA 1N7KA 3SW6A 1OABA 1KM5A 2Y70A 4L4MA 5D2XA 3TROA 1HG3A 1NFBA 1W3NA 3RF9A 4RR4A 5BMXA 1SUXA 4FXSA 5D05A 2YW4A 1ZFJA 4IWWA 3W7CA 4UXDA 3CWOX 2R8WA 3MJYA 2FDSA 3UPBA 4JTTA 1JRCA 3C2EA 1H7WA 3W1NA 4Z1AA 1H50A 1KFBA 5HJLA 2PCQA 1Z48A 4JGDA 1TTIA 2X30A 3TUUA 3DFQA 4TIMA 3T40A 1W5MA 3B0UX 1JCMP 3R8RA 4HN4A 1FWTA 3L5LA 5F1UA 4I7VA 4BI5A 4QQ3A 3S5NA 1VZWA 1G67A 3NQEA 1ZALA 3MHGA 3I7QA 3A21A 1TPH1 1QPRA 1VRDA 4UTHA 1SW3A 3C3NA 4LWWA 3OG3A 4UTWA 3LM7A 1MXSA 2QCFA 3FIGA 4CQ9A 1ZAJA 5G5IA 1EWDA 1NF7A 3W88A 4YMZA 4FNSA 1TPVA 3QZEA 2CLEA 2QAPA 2YW3A 5AC7A 1FY6A 2V5BA 3P81A 1UBSA 2VFFA 5LNWA 1THFD 2VKZG 4UTKA 3ZFHA 4Y8FA 1WX0A 1H60A 1H7XA 1H7OA 2TPSA 1ICPA 3PSWA 4LVGA 2ZRYA 1JQVA 3C2FA 3W71A 5G4EA 2NUWA 2V82A 2EKCA 1GOXA 2YYUA 3LHUA 5LSMA 2E6AA 3B03A 4DQWA 3GVGA 2Y7GA 3VE9A 4NU7A 1TTPA 2FFCA 3TNOA 1Q3NA 3I7RA 3HG4A 4MIMA 2W6RA 1A5BA 1B57A 2UV8G 1RQHA 4IX0A 1TPWA 1WV2A 5A8GA 1S5VA 4M6PA 3LCHA 3USBA 4R34A 5FF0A 5EYWA 4O4VA 1TSIA 4PCFA 3C52A 3W7JA 2C1HA 4YCOA 5U7SA 4BF9A 3MBDA 2X1UA 3NA8A 4LS2A 1GVOA 3WK1A 1GVRA 2BTMA 2GVGA 2E6FA 1ZENA 1WA3A 4JTSA 1KBJA 2A7PA 2Y89A 1O4UA 2V2CA 3UNDA 1OFAA 4A2SA 4AXKA 3LXBA 4LVBA 4GUFA 3TQKA 4NJJA 5G2WA 5AHEA 1SO3A 1SZGA 2IQTA 1GT8A 3IVTA 3L67A 1SO4A 4LS0A 3M47A 2YGYA 3BV4A 1W5NA 3ATZA 4PA8A 3UXDA 2DZSA 4QITA 3BLIA 2Y62A 3KX6A 3W2JA 5AHMA 5DELA 2PC4A 2Z1BA 2JGYA 1G4SA 4DPPA 2X1TA 3GB6A 3NGJA 4ZQNA 3TCEA 4M7SA 3B0VC 1TYGA 2WSRA 1KM0A 1LCOA 2QCNA 3QYQA 5MHBA 3DFTA 3NPWA 1XDMA 4O12A 3GYEA 1VGAA 4S1FA 2YX0A 3NQAA 5F2IA 1KTCA 3GKAA 3P8IA 3C2OA 4XQ6A 3E49A 2Y7DA 4PH6A 1LOSA 4BR1A 4POCA 5G2HA 3TAOA 1AW2A 2DZTA 1K03A 3DFSA 3B0PA 3EKLA 3FYPA 1H1YA 1YPFA 4AWTA 4KWVA 5I3IA 3ELFA 4AF0A 1TV5A 3BW4A 4R7JA 3E12A 4LY8A 1I4NA 5DLCA 4K7VA 3NQDA 3CTLA 5CG7A 3HGRA 3KFTA 1QPQA 4GNJA 4AH7A 4RZ4A 2VEMA 3W1QA 1MSSA 3LRLA 2QUVA 5LHEA 4K38A 3P61A 3IIZA 1OF8A 1GVSA 4O57A 1OJXA 3IIOA 2ISSA 4EIVA 4FF7A 3QMSA 2H6RA 3NL5A 4GUHA 4O0ZA 1B4EA 5KZEA 2ZDRA 5AHNA 2QCHA 1H7PA 1DQWA 1XUUA 3L0KA 1A5SA 2ZQ0A 5FF4A 4AAJA 4MLRA 1PS9A 4A2RA 4WOZA 1AW5A 3L0GA 3Q58A 2YZRA 3IIXA 4PL1A 4ZL1A 3TKFA 1QDSA 4QIUA 3DZ1A 4XBKA 1SW0A 1XM3A 4I7UA 4UTTA 4CNOA 3UQNA 3K30A 2FLIA 1VC4A 1VHNA 5FF7A 3I7SA 5SWUA 3O06A 4YL2A 5EA9A 1LYXA 1L6YA 4TMCA 1JR1A 2Y63A 3C4UA 3JS3A 3L5MA 2NWRA 1QPNA 3EXSA 3G1FA 2Y61A 1FCQA 3FLUA 2ZRXA 2Z0IA 1TB3A 3PS7A 4OU1A 3R5EA 1R30A 1W56A 1RV8A 1KLYA 2HS6A 2C3ZA 3RFAA 1ML1A 4UCGA 4JS3A 3W1XA 3DXIA 4YLWA 4OBTA 3EX2A 3B06A 1OX4B 3CIXA 1LLZA 3W2LA 4D2JA 2DP3A 3G1AA 3O8AA 3BGGA 3HB9A 3NQ7A 4WY0B 2Z6IA 1XDLA 1KM2A 1KV8A 2B7QA 3KHJA 2QCLA 2BLEA 3N2XA 2DZWA 1OFDA 4IOTA 2X1RA 5LZLA 3L5AA 1QR7A 3RLVA 5FEZA 1I2QA 1LBFA 5FEPA 1J5TA 4H6KA 1I2OA 2A1YA 1VHCA 4TX9A 3G22A 3W76A 4O0KA 2BXVA 5AOUA 2ZRZA 1W37A 1OX5A 5HWMA 4K8HA 1A50A 5G1TA 2FTPA 2CLLA 3SJ3A 2A7NA 1JRBA 3SFKA 3PBUA 1HL2A 3G1DA 2QCMA 4CCDA 5HMSA 5F4WA 4KWWA 1SZNA 2WSQA 4JYEA 2CZ5A 3W7RA 1P1XA 2YPIA 1WQ5A 3PUDA 5DXYA 1ZAHA 2A6NA 3W1UA 4ZQPA 1SZFA 3BW3A 4LV9A 2Y85A 3BG5A 1RQEA 4GC4A 4R33A 3NR0A 1J2WA 1K7EA 2D73A 3KVLA 1H1ZA 1EPXA 3LERA 3NO5A 3CC1A 3M5ZA 3TX9A 2ZRWA 2ZZ6A 3PUOA 2CZEA 4JN6A 3FOKA 3TFCA 4IQLA 3LCXA 4HNTA 4K37A 5LGZA 1TPUA 1IF2A 1UUMA 5EMUA 4BI7A 2W0UA 1JULA 3LRKA 1R2SA 2YCEA 2V2HA 2Q8ZA 3W07A 2HS8A 1G4EA 4HT3A 3PC0A 2CLIA 4Q33A 3G1VA 5E1QA 1KM6A 3CIWA 1WBHA 1ZCOA 4LC6A 4OV4A 2E6DA 3UWUA 5IBXA 3CB8A 1QNVA 3G1SA 3P7YA 3GAYA 4LC8A 1Z42A 1FBAA 3E96A 3FEMA 3QSRA 4FNRA 4NNAA 3O1NA 3M1ZA 3P67A 1DL3A 3I65A 2XFWA 3FYOA 4UFHA 2V0TA 4E38A 4KKXA 4N02A 1J4EA 1H63A 2QR6A 3G1HA 1TJPA 3WJWA 3TMLA 3C0JA 1RR2A 4K8EA 3W7HA 2RFGA 4FIRA 3IVUA 4MY1A 4NUWA 1JCXA 4ZQOA 4AWSA 2FB3A 1Q6QA 1ZJIA 4N4PA 1JVNA 1JUKA 5KINA 1SU5A 3QJAA 1VCFA 2C6QA 3LV5A 4NX5A 3STFA 4JEQA 3HPXA 3QF0A 3W1TA 3DKJA 2CW6A 4JTHA 3Q94A 1YDNA 3A24A 1OK6A 3EWBX 3IIVA 3NYZA 3QEZA 3BGJA 1JCLA 1TPEA 3HIJA 4JTUA 5CZJA 4YXGA 4ADSA 1RZMA 1FCVA 2GUUA 4GWEA 4JR5A 4JIQA 2FQIA 4IMEA 1K8XA 2ZZ1A 1W1ZA 3LTYA 3MBFA 1OFQA 2B4GA 3GK0A 1FX6A 3HGJA 3THAA 1L2UA 1SFJA 3NG3A 4O1DA 2GJLA 2QJGA 3W2MA 3LXCA 3NXFA 3EKZA 3GR8A 4H4IA 1L9WA 4JX4A 3HO8A 1O94A 2E68A 5D04C 4K36A 1JCJA 3BVJA 4AHOA 2JKPA 1K8YA 3MMTA 2C14A 4NVTA 3L68A 4XKYA 5EY5A 1Z41A 4UMCA 1PVNA 1TRDA 4QISA 1WYIA 4Y6GA 3THQA 5EL1A 1XFBA 3W6YA 3TDFA 5FF2A 4OV9A 1H5YA 4BK9A 2R94A 1X1ZA 1DBTA 4MPQA 1SSDA 5D33A 5L6UA 3QRHA 4M6QA 3PB2A 2ZA2A 2OT1A 5GVJA 3EX1A 4GXMA 1U5JA 2QUTA 2ZRVA 1PL9A 1SZEA 3HPZA 3C61A 2YXGA 5C55A 3H53A 3M5VA 3MHFA 1P0KA 3TQVA 4PL2A 3F4NA 1G7VA 4ZQRA 3P62A 3TIMA 2P10A 1FXQA 4TR9A 3GLCA 3HG3A 5CGQA 3TW6A 2J9XA 3TSDA 3W2NA 3NL6A 3NL2A 3W83A 3MYPA 3NOEA 3PR2A 1QO2A 4Z0JA 2NV1A 1FDJA 3FKRA 2G5WA 1C9DA 2QCDB 5I3GA 2FIQA 3KVKA 3MO7A 4FX8A 1Z44A 3HMJG 1KM3A 1Q45A 1TQXA 2X2GA 2P1FA 4MFDA 2VOMA 3W1RA 5D38A 3W9ZA 1X1OA 1OVDA 1R2TA 3UD6A 1VYRA 4GJ1A 4ADUA 3IV3A 1AL8A 2PE4A 3N9SA 4ICNA 3LX9A 1LM1A 5D2YA 2A21A 2B7NA 1R47A 4KFOA 4ZQMA 3CQ0A 2WKJA 1I2PA 4M19A 4O19A 1CX9A 3DGRA 4GE8A 3N3MA 4UTLA 2JBMA 3LOTA 4RZ5A 2QDGA 4BWLC 2QCEA 4AVFA 1TRIA 5AB3A 4MYXA 3UPWA 4BFAA 3U6WA 1EA0A 1N55A 3JRKA 5ABTA 4BI6A 1K3UA 3INPA 1IXNA 3OHIA 2QAFA 4CCEA 3DBPA 4OE7A 5F4XA 3V75A 1VJIA 4RXFA 2Y7EA 4A29A 1QMLA 2DJXA 4ZZ9A 3W75A 1SSGA 3FFSA 4ALDA 3I68A 2ZZ7A 4DO6A 1VCGA 4O1BA 5TBOA 1XL9A 1TCDA 3W1MA 3N14A 3UY8A 1IGSA 1BEUA 3GZ3A 3NDOA 1XUZA 4K6AA 4X3ZA 2VFHA 2B0MA 2YFNA 4DBEA 2VC6A 2Z2UA 2QCGA 2DJLA 2GVLA 1SR9A 1UB3A 4IGHA 2R91A 3NQCA 3DH7A 4EF9A 1KFJA 1YADA 3PM6A 5DY2A 3QC3A 2CWNA 3W7PA 3C8FA 3EWWA 3DAQA 4JTGA 4AHPA 1IXOA 3TC6A 3ZS4A 4QSHA 2FPTA 1WOBA 4N2YA 3RU6A 1JUEA 1HFBA 3B04A 4C1KA 4HKPA 5DBUA 1JUBA 4JIPA 3O6CA 5TQLA 4TO8A 2E5CA 1EP2A 4GUJA 1OFEA 2E5DA 4NX0A 2CLOA 3E9AA 4JTEA 1GYNA 3LXAA 3H55A 5D2VA 1F74A 1PIIA 3M9YA 3O07A 4MUZA 4PFMA 2DZXA 3PSVA 4WD0A 3VFLA 3P84A 4U4MA 3VKJA 3YPIA 4CNNA 1F76A 3M0ZA 1XCFA 4M5PA 4JYDA 1LORA 4XUGA 4A22A 1JCYA 5CZSA 3S5ZA 1IXPA 1OFRA 1RVGA 5G4WA 4HNVA 2ZZ4A 5H2ZA 4LV4A 3GKFA 3Q2DA 3QM3A 3M16A 2GQ8A 2ATMA 1TPB1 2VFIA 3LCLA 3NQFA 1VYSX 1OYBA 4WY0F 3EWXA 1FUYA 4DO5A 3QW3A 3OEXA 3MWAA 5KITA 5LGXA 1KLZA 3RK8A 4TU1A 3KVMA 2VEKA 3UXAA 1LTDA 4MY8A 5D30A 4O53A 1G69A 1UJPA 3LLFA 1PHQA 2ZA1A 4RV8A 2EGZA 1AW1A 2P0OA 3B05A 1I45A 5K4XA 3EXTA 5BMWA 4EF8A 3TR2A 4IJBA 4GBUA 2QCCA 1GTEA 1ICSA 5I3KA 5I3JA 4S2CA 2J27A 5C6MA 4PC8A 3PUEA 3N9RA 1FWNA 1GWJA 1XBXA 4W9TA 3TE9A 1GG0A 1O5XA 3TA6A 2Z6JA 5EPDA 3T7VA 3PBYA 3LI0A 1MO0A 4IMGA 3QMRA 1OF6A 4JTJA 3SI9A 1GG1A 2NUXA 4HPXA 3V1PA 1ICQA 2J24A 2VEIA 1AG1O 2HTMA 4N4QA 2KZHA 3LTSA 3SZ8A 5E0KA 3HGOA 1K02A 4LUIA 1NSJA 1ME8A 3E0IA 3G8EA 2TMDA 4IMCA 3TSMA 3GXPA 4LRSA 4MFEA 1QO5A 2QJIA 4LT9A 3W1PA 5G2IA 3M5XA 2ATSA 1OFPA 2V5LA 4N9BA 5HR6A 5EKYA 4HIBA 3LI1A 3WJXA 2WPBA 3S9YA 3CWNA 3L9CA 2FPVA 3P74A 2YYTA 1KFEA 3OIXA 1W54A 5CZTA 4NJIA 1I2RA 4JDYA 3L21A 4FNPA 1YDOA 4JXCA 1FQ0A 1KFKA 1ME9A 3S5YA 5BRBA 3FA5A 3UWVA 1W3TA 1W3IA 1ADOA 1OK4A 3IGXA 1LOQA 3MUXA 3DHDA 3R89A 4ADTA 1JQXA 5HNRA 3C2RA 1WAUA 1E51A 3TXZA 1F7BA 3TAKA 1QPOA 1F73A 4EVZA 1FDYA 1TV7A 4Z08A 4N9DA 4CQ8A 5KTLA 3PBWA 3STGA 5E93A 1YXDA 3F4WA 1TPFA 1A53A 3VE7A 1H51A 3ABRA 2VEPA 4S2BA 1X6UA 3NQ8A 2I14A 4WY0A 3W74A 1B9BA 2NXIA 3OVPA 4Z1BA 3O15A 1HO1A 2QUUA 2HMCA 7TIMA 1KTBA 2GQ9A 3P80A 1NVMA 3LV6A 3M5YA 1UCWA 3L0NA 4UUIA 3QPYA 3NVTA 3NQVA 3P8JA 1B4KA 4RKAA 5DCBA 1DKWA 1YDVA 1Q6LA 3IGSA 3DFPA 3PWAA 5D32A 5CKSA 2F84A 4FNUA 1OFBA 3W7KA 4LW7A 2A7RA 3ABSA 1K8ZA 1PHWA 3LBMA 2WQPA 4K7YA 4WJEA 5C54A 3NPXA 3BLEA 3SGZA 2ABAA 3OBKA 1W5PA 2NXHA 1ZNNA 2GJNA 2V30A 3HOJA 1KM1A 2ISVA 4RZ6A 3W7GA 4O18A 2FJKA 3EX4A 5F2LA 4O11A 1OX6A 1LBLA 4HPJA 4MLJA 2F7FA 4DELA 2V9DA 1Q6RA 2WOQA 3MP3A 4ONVA 4P2VA 5T26A 1HUVA 1D9EA 3T78A 1U83A 1W5OA 3VNDA 1VQTA 1TTJA 5K9XA 4OGZA 1ZAIA 2BSLA 1DQXA 3G1XA 2H8ZA 1A5AA 4UTTC 1KTNA 1OYCA 2E5BA 3QMTA 3KRUA 4UFJA 4AWUA 4CQAA 2GOUA 1FCBA 4MOZA 4IMFA 1M7PA 1F05A 2NV2A 3DHFA 3HBLA 2HSAA 3W84A 1EIXA 1VYPX 5H91A 4CLMA 2GQAA 4MKNA 5D37A 6TIMA 1XC4A 3P82A 5HUPA 3WK0A 1KA9F 1HTIA 3QW4B 4UR8A 2JGQA 4XWUA 2WNZA 3EWYA 2V8ZA 2CLKA 5CPMA 4MJMA 3WJYA 3KRZA 3G3MA 2CFFA 1VPXA 3UZJA 4LUJA 4NNBA 4FHAA 3W1LA 1ONRA 3MI3A 2Y6ZA 2CZFA 2YDAA 4JYFA 1I2NA 4ORMA 1X7FA 4YWIA 3N34A 4WOQA 2EHHA 3RMJA 2C18A 2OCZA 1N8FA 5AFDA 5J5DA 2A4AA 5LNVA 1LRTA 1DVJA 4O4WA 3QPZA 3VI2A 4LTSA 4O10A 1T99A 4WUIA 4AB4A 4ML9A 4J9JA 3LLDA 1LRQA 1RD5A 4OWGA 3TMQA 2OMAA 4O1CA 1FWSA 2OJPA 3L65A 1XBYA 3PULA 2BX7A 5D09A 1HO4A 4FX6M 4C1LA 3QQ1A 3IVSA 1Q6OA 3EX3A 3CLMA 3LHWA 1QOQA 1LP6A 1OYAA 3IRDA 3TU9A 2NWSA 5A5WA 5AYZA 5AC8A 1TPC1 2PRLA 3KOFA 3QQ0A 4HSNA 3SR7A 3EB2A
chains in the Genus database with same CATH superfamily
2AGTA 3R79A 2FPYA 1JPKA 3S1GA 5DN1A 1EB3A 4A8IA 5M2FX 2H90A 4DUXA 3G77A 4JX5A 1XLBA 1H11A 4OUEA 1KFCA 4U31A 3RG6A 4TX6A 2WC3A 4AD3A 2Q8LA 4ROPA 2P8BA 3IJ8A 4AZ6A 1W8GA 4O54A 3VYLA 2NX1A 2WZHA 4IX2A 3DKLA 3PBMA 5LNRA 1W9PA 1P4CA 4IGNA 3WH5A 3URAA 2PB1A 3HU7A 3NOYA 1XRTA 2OVLA 3A4JA 2G3JA 1FXPA 3G0XA 1WDPA 4LU0A 2VZOA 1W3LA 1H61A 3ISIX 5I78A 3LCGA 3F2BA 3KAOA 3OTRA 4LVAA 3LK6A 2VENA 5IBXC 1MUWA 3NM3A 5MKGA 1S5TA 1ZBKA 1KRCC 1BTMA 3RMEA 3VIMA 3VUPA 3ARZA 3GYCA 5CSSA 2I5IA 3CPGA 4KEVA 1EJXC 3UYCA 4DXVA 3GIPA 4I9AA 3UETA 1YPIA 2VX4A 3BLFA 1XIFA 3KHDA 3KVJA 3R7MA 3PWIA 4AC1X 5KZMA 3LHYA 3PJWA 4KGLA 4XZ9A 3WBXA 1MFUA 4MNLA 1NF0A 3BK0A 3WF3A 4Q8UA 4W4QA 3GDKA 3KOYA 3AXIA 5K7JA 5HBFA 1YTKA 1RAKA 1PXGA 4PBFA 1HW6A 4ORIA 2XU2A 4MVAA 4A3HA 3VK5A 3PAJA 3MSDA 1XC6A 1HKKA 3M0KA 3ZT6A 4M82A 4HPHA 2GVJA 3I10A 3EZ4A 1B3OA 2RKXA 5HNTA 1GOQA 3UG8A 4IG2A 1WXJA 3P5YA 5K2ZA 4LCSA 3SEPA 1JYNA 3IGUA 1AUSL 3B3DA 2V81A 3DX5A 1R9ZA 3K5XA 2NX9A 4GRSA 4CN1A 5HWJA 3F2CA 1IIHA 4P7LA 1PZ2A 2IKJA 3T0TA 1FWDC 3H24A 4LYKA 3JR2A 2P0IA 3W73A 2Z25A 1UR9A 5CC3A 4B90A 2WJZA 3STCA 3BGAA 1S1PA 2ZZ3A 2NQHA 1RA5A 4MYAA 1HJVA 5CJNA 2V63A 1AQ0A 2X0YA 4HQVA 1FWWA 3SCUA 4FB7A 4E4PA 3GH7A 4MSSA 1WOAA 1ZHAA 3GU1A 3T2OA 5JBFA 4JTLA 1WKFA 4QNWA 5K9DA 4G1KA 2Z2BA 1M6JA 4JDBA 4RCXA 4GH3A 4A6GA 3G18A 4LRTA 3TR9A 3H23A 4GUGA 3GVWA 3S5SA 4PSRA 4I9JA 3MS8A 1OG0A 2I17A 5BRQA 4XV0A 2JK2A 1KV5A 2VXNA 3O63A 3UG4A 4FOUA 3STEA 1EQPA 2VGBA 4UNKA 5IRPA 3GDRA 4HZ7A 1DOSA 2E4TA 3WUGA 1M03A 2J77A 4JBRA 3MMWA 1P0NA 4KCUA 3VMPA 3LYEA 2VVNA 3FJLA 3TYDA 1G4TA 4J1OA 5F7UA 1NFPA 1XXXA 3W25A 5IM51 2F6KA 1BYDA 3W7QA 5DF0A 7TAAA 3KBMA 3GNDA 2O55A 4WZHA 3PZNA 2FB2A 5CC6A 2H3DA 3NQ2A 4AIEA 2ACRA 4HU0A 3TYAA 3UWWA 2I9EA 1MXGA 3VOHA 2AQVA 1AVAA 4NJHA 4C6EA 5IFTA 3FHAA 3GAKA 3M07A 1IEVA 1TA3A 3BAJA 5B80A 3AWNA 4GINA 3A23A 3KE0A 4UOZA 3OLEA 3A64A 1W1IE 4MUPA 3BAIA 4LVFA 5D9NA 1TX2A 1UH4A 1NM9A 2A3AA 2X8RA 3MHUA 3CASA 2PWGA 4B5XA 3R8HA 1G6CA 1R7OA 3THCA 2VGFA 3LTPA 4UTJA 3IPWA 3FJ6A 3TTSA 1T96A 4DO4A 1FVPA 1US2A 1PDZA 5E0CA 1Y5WA 5G4HC 5TNVA 3QY7A 4WVXA 4FR1A 4CD4A 1FWBC 4UQEA 3GX9A 1HIZA 4PUNA 3IV8A 3IJQA 1EUNA 1J0HA 3CV7A 4Z1DA 1QT1A 4DWSB 2ASHA 1T8XA 4EXBA 1RBLA 1AK5A 2DUAA 3O2LA 1YTDA 1CXLA 1E6SM 3GDMA 4MJZA 4IJCA 1IQ8A 1QCWA 3BSMA 3GFZA 5HUOA 1CYGA 3FSUA 2OEMA 4UMAA 3A4AA 5I6SA 3QSTA 1OFOA 5D2WA 3T1GA 2WCGA 1UMYA 4ZQCA 2BY0A 4O8RA 3RJXA 5EMJA 5FACA 5BW6A 5AVHA 3WK3A 2J75A 3IIPA 1IWAA 1CXIA 4TQTA 3G24A 3UJFA 5C8BB 3T0BA 3M6YA 3WQDA 3UERA 3C2VA 3UU0A 3DENA 4B5NA 5LIXX 1TMLA 4MNKA 1UPPA 4D6EA 3HQ1A 1BVWA 4NZCA 3TC7A 4D1IA 3HGSA 1L6FA 1KKRA 1AD1A 4AZCA 4JNMA 1W1TA 1Q6DA 2PDUA 3O6AA 3RU8X 2AKMA 2NXGA 4H9MA 2ZZ2A 3N19B 1EHAA 4F66A 2E7FA 1W2PA 2Y88A 5I3HA 2DGAA 3EX6A 4ZB0A 4HSOA 2Z27A 4UFKA 4DUOA 4G1NA 1QWGA 3PNZA 3AS0A 2WNQA 4UQBA 3WK2A 1ZU8A 5BZAA 4GFSA 3WF0A 1GKQA 4PMNA 3M0HA 3IJIA 4B15A 4JY9A 2J88A 3BJTA 2ZTJA 4R53A 2D0GA 3FXYA 2R24A 3VGDA 2FHBA 3WNKA 3P60A 1IV8A 4E0CA 3S1UA 4YTQA 2G3IA 1VFOA 1BYBA 4PTNA 3ZR6A 3TZFA 3PG8A 1CENA 4JTQA 1TJRA 5AYYA 1KO0A 1M1BA 2PDCA 5FKYA 4Y9MA 1BD0A 1GPWA 3LQGA 1KBIA 1EWEA 1QAPA 3E5PA 4MPKA 1RXOB 3E2RA 4IMDA 2J9ZA 1PB0A 3LGEA 3L66A 3QFEA 4PRTA 2NLIA 4K3ZA 2FH8A 4H3DA 2RH9A 4NJGA 1TWDA 1O68A 2F38A 1QHPA 4NXSA 1HJQA 3VCNA 2EPMX 1J0ZA 5F1VA 1F07A 1R86A 2X09A 4W5ZA 1JI1A 4PMZA 4QJ5B 1ALDA 1EP1A 3MYOA 1H0GA 2PI6A 3SM0A 3Q37A 1L6SA 3WDHA 1DIOA 1F9CA 3ZWSA 1W9DM 2QGHA 3OA3A 3URQA 3F03K 4IPLA 4PULA 3N1AA 4YS1A 1CLKA 4KS0A 3NQMA 5CBJA 2WKGA 1MEHA 2OOGA 1RK5A 2BODX 1JPHA 3CPUA 4AHQA 1FDZA 2BVYA 2QKFA 1XIBA 2DW6A 1ZSXA 1EPVA 1MNSA 2ACQA 1ZCCA 4JKMA 3J7HA 4HZMA 1A5NC 2J13A 3VNZA 3QH2A 1O95A 4IPIA 3KWXA 4RZBA 4UZUA 5AECA 3OGRA 3CZLA 2J7CA 3M4HA 4NKCA 3SN4A 3VDCA 1HG3A 1UWAA 3GHUA 3TOYA 3ZR5A 3UESA 3VTRA 3E0WA 1NDWA 1XP3A 1X98A 3UPBA 4ATWA 3DIPA 2PD9A 2ESCA 4JQ3A 1PYMA 4H6EA 3W1NA 3VD7A 4JIHA 2XWEA 1QNOA 3TUUA 1ONWA 2A3BA 3HURA 2MUCA 3FDGA 3B0UX 1MMFA 5GNXA 4GVFA 4BI5A 3OBEA 4M1RA 1G67A 3KZPA 4GKTA 1LG1A 4H19A 4YU1A 1QPRA 4UTHA 2Z29A 4UTWA 3LM7A 4NZ1A 1H41A 3MSYA 5G5IA 1EWDA 1NF7A 3W88A 1WCGA 2XVKA 4YMZA 4XD4A 1TPVA 3UBPC 2YW3A 3WLKX 2V5BA 1NP0A 3CL6A 1THFD 3KL3A 3II1A 3UZXA 1WX0A 3GXFA 1ICPA 2XFRA 3EDKA 3NSXA 5CXPA 2ZRYA 2IMRA 4R5EA 1GHRA 3VGBA 3OYXA 3WELA 1E5JA 1P1MA 3CHFA 3LHUA 3EA1A 3GM8A 1K4GA 2E6AA 3B03A 4HA3A 2FFCA 5CJMA 3D5HA 3HG4A 1H3GA 1V0KA 2ZOXA 1UC5A 2W6RA 1ODUA 1B57A 4WF7A 2UV8G 1XIJA 5A8GA 1WV2A 3WDJA 3EEZA 4AY1A 2VDGA 2YZ5A 2IPGA 1GGOA 3C52A 3MBDA 3E0VA 4AEFA 1CCWB 2GVGA 4JTSA 3E2VA 1O66A 2Y89A 1CLVA 2DT0A 3UNDA 4A2SA 3LXBA 4LVBA 3SURA 2NT0A 4GUFA 1BTCA 3ENLA 3L7RA 1WB0A 4NJJA 4G2DA 2GK1A 2CESA 2V3FA 1E6XM 3IVTA 1TUFA 1WDRA 4IIDA 1EX1A 1VFUA 1BG4A 2V3EA 3VNKA 3MUY1 3BV4A 4B3ZA 1W5NA 4PA8A 2DZSA 4C6BA 2GWNA 5J04A 1VFSA 1DWGM 4S3CA 4F0LA 2PC4A 1G4SA 1M68A 1Q65A 4LUTB 4ZQNA 4TTGA 3B0VC 2WSRA 3UGRA 1LCOA 2XM1A 3QYQA 5MHBA 3DFYA 4O12A 3WYZA 4AY7A 1XHGA 4OTKA 3HPFA 3VKKA 1XLIA 3RLHA 1E1CB 8XIMA 5G2HA 4FXFA 1DYSA 2CWXA 2VTFA 3WBEA 3EKLA 3FYPA 4P7RA 4MHBA 1H1YA 4AWTA 5I3IA 3ELFA 4EP8C 4R9OA 1I4NA 3APTA 4D72A 3MSGA 1QPQA 4GNJA 4AH7A 1CXHA 4QDPA 5FL1A 3W1QA 4GPNA 3LRLA 1J6PA 3FA3A 4JL2A 1C7TA 1OF8A 2FMNA 2PLMA 3DEQA 3CV6A 3QMSA 1F8MA 4O0ZA 1UD3A 5KZEA 1AD4A 2ZDRA 3DOPA 3UF9A 1H7PA 3M6DA 4XB3A 4QLJA 4PR4A 3VKBA 4FZIA 4MWAC 5FF4A 3VGEA 4MLRA 1J96A 4LYRA 1KCLA 4WOZA 4B5SA 1D7KA 1HJSA 2V69A 4PL1A 4WGXA 1A3HA 1V03A 3AUJA 4XX6A 1JG9A 1XM3A 3K30A 1VC4A 1VHNA 5GQBA 3VO0A 1GPFA 1ZZMA 3H26A 1XLJA 4HNLA 1PZ0A 2FKPA 1J9YA 3TN4A 2FHCA 4Q8OA 4KWUA 3S6TA 4I6KA 3EXSA 5CLWA 4GCXA 2Y61A 3P93A 1K6AA 4DYKA 2Z0IA 3WF1A 3SN1A 3LMYA 4OU1A 3R5EA 3ARXA 4HTYA 4GBDA 1UWQA 4YLWA 4OBTA 3W2LA 4LFYA 4DWSA 3PFRA 4E3VA 3GG7A 2B7QA 3SCRA 4LBRA 2PDWA 3R0UA 1EJWC 4F3HA 3W0KA 2X1RA 3KBVA 2WMJA 3AXXA 3RYSA 5FEPA 4CNSA 3WUFA 4H8VA 4IFKA 1J5SA 1J5TA 4GI4A 4H6KA 1QBAA 2A1YA 4TX9A 1HKWA 3G22A 3S2MA 2BXYA 3VNJA 3ZLGA 1KXHA 1W37A 2REQA 3MCOA 4K8HA 5I2UA 5G1TA 1J01A 4S3BA 5CEWA 2ZDSA 2A7NA 1JRBA 3G6MA 1HL2A 2WM0A 3WENA 2QCMA 3ITCA 1SZNA 2CZ5A 2W27A 4FI4A 2YPIA 3PUDA 3GTHA 1ZAHA 5E70A 3G5EA 3TQPA 2GUYA 4M80A 1EYWA 3D46A 1SZFA 1Q4WA 1RQEA 3NR0A 4Y9OA 4TVCA 3TTQA 1U33A 3KVLA 3ZLHA 1H1ZA 1EPXA 4J3VA 4F2BA 3T2PA 3FOKA 4IQLA 3LCXA 4K37A 4MB1A 1A80A 3FX4A 3LS9A 1IF2A 3N6QA 5CGMA 5EB8A 3QN3A 1RY8A 3TTEA 2HS8A 3M7SA 4HT3A 3PC0A 1JAEA 4W84A 3ABZA 1KM6A 1QPKA 3N2BA 3AMDA 5IBXA 4GIAA 3SUUA 1FBAA 1WDSA 3M0MA 2X40A 4RE4A 3OLGA 3WD1A 3MUIA 3WNMA 1DL3A 1MYRA 3PTQA 1UJQA 1D8CA 1NJJA 3B8WA 2GL5A 3D3FA 2MANA 1XYZA 1TJPA 1MW0A 1V6XA 3RRAA 3V5FA 1PTGA 4AD4A 4MY1A 4AU0A 1JCXA 4ZQOA 4AWSA 2FB3A 3WD4A 1WZLA 4L64A 1FWJC 1ZJIA 2J7GA 4XD6A 1JVNA 3ARPA 2FJUB 3HPAA 2XVNA 3MVIA 4FF5A 4NX5A 2VL4A 3IJ6A 3W1TA 4ES4A 3CUZA 1FH8A 4U5KA 3IIVA 3NYZA 4D8ZA 4PUDA 3PFMA 1JCLA 5CZJA 2CHOA 4ADSA 2QV4A 1FCVA 1DJHA 2OEJA 3MB9A 1UPMB 4AIOA 1OFQA 3GK0A 5A8MA 1TCMA 1A5KC 4BA0A 3EKZA 4H4IA 4RNIA 1NELA 2E68A 2QVHA 3WQGA 4AD1A 5D04C 2Z1KA 3BVJA 3LENA 1J18A 2JKPA 1R38A 1UD8A 5C9UA 4KW2A 2DVTA 1CB7B 5EY5A 2CEQA 2W92A 4UMCA 2J66A 3FSTA 1XFBA 2A3EA 4H6QA 3W6YA 5IDZA 9RUBA 1H5YA 3LG3A 2JALA 5D33A 3K46A 4TVDA 2GLKA 3PB2A 1QW8A 3CUJA 2YXGA 4HTBA 4XIMA 4PL2A 3LGGA 1KXQA 4QTGA 1IZJA 5TAOA 1XPGA 2VC5A 2CBIA 1HVQA 1FXQA 4PCTA 1W1A1 3W2NA 3NL6A 1I75A 3W83A 3V4BA 6REQB 3MDWA 1QO2A 1XH2A 2XH4A 2G5WA 1C9DA 4V33A 4AW7A 5I3GA 4PN2A 4AIBA 2FIQA 4FX8A 4AUBA 1Z44A 1D2KA 3EA2A 3W9ZA 1R2TA 3UD6A 4ADUA 1P0BA 4U3AA 5CC5A 4A8NA 3LX9A 1G5AA 1LM1A 5D2YA 4DAIA 2ZKMX 4B3LA 1BAGA 4IPNB 1UQZA 5AC5A 1I2PA 4UQ9A 1AZ1A 3N3MA 2JBMA 4D9PA 2QDGA 4Q3MA 1BF6A 1PX4A 3UPWA 3U6WA 5C9RA 3LBOA 1K3UA 5LA0A 4LYQA 2QAFA 4RDYA 3RJYA 3ARTA 3V75A 4XAPA 1K6WA 2DSKA 4RXFA 1BSLA 3N4FA 5I24A 1LF1A 2R1NA 4C6LA 3UZZA 4ALDA 5JU6A 2WJEA 2VUYA 4DO6A 1VCGA 3SQMA 5TBOA 1RJPA 1XL9A 1J11A 2PBOA 1TCDA 2XIJA 3N14A 1BEUA 4X3ZA 4LH8A 4DBEA 2QCGA 2GVLA 1B3VA 2RUSA 2FVKA 2R91A 3AS3A 4LBUA 1NARA 3AU2A 3PM6A 5A95A 2CWNA 3R11A 3THDA 3C8FA 3DHUA 1W9UA 4C6CA 4HNOA 3R0DA 3WLPA 1C9WA 3TC6A 2W5FA 4DI8A 3B8VA 3ZS4A 3HFTA 2FPTA 4FK9A 4N2YA 3ARUA 3M0IA 1BXBA 3OZYA 1HFBA 3WG6A 3B04A 4JIPA 1E0WA 4ZCWA 4CGTA 2WHLA 1IWPA 3FW6A 1A0CA 3E9AA 3I6TA 3FCPA 1GYNA 4MMWA 1F74A 3M9YA 4DJDD 4C6MA 1GOOA 4PFMA 2QJJA 2BY2A 2W61A 4QJ3B 2HISA 3VFLA 1UKSA 1QI5A 3VKJA 3YPIA 5LXXA 1XCFA 5DANA 3IACA 1ZTVA 3L2LA 1OC5A 2G50A 4XUGA 4A22A 4Q7NA 5CZSA 3PZQA 3BICA 4LX4A 1RVGA 4HSHA 3WMBA 2WHKA 1EJTC 4DLFA 3OO2A 3M16A 4G7FA 2ATMA 3KBSA 4NF7A 4RDVA 3POCA 3NQFA 1BSIA 2WYSA 1OGGA 4WY0F 4KH2A 1B3WA 3A4WA 4DO5A 1C91A 2JFEX 1IYXA 4L61A 1J0YA 5KITA 2WB5A 2PGEA 1HGWA 3E1F1 4TU1A 1V02A 1KBLA 2VEKA 1JAKA 1UJPA 4AYSA 1OM0A 3VZXA 1GHSA 2VP8A 2V67A 1B2YA 1L0PA 4GBUA 5A6MA 1GTEA 5I3JA 3IUHA 3NYDA 4PC8A 3PUEA 3CZGA 1GWJA 1XF0A 1J2BA 2VGIA 1IT7A 4IIHA 4W9TA 4CN6A 3SCWA 2Z6JA 5EPDA 2G41A 3BSGA 1MO0A 4ASTA 5CLTA 4AWEA 4JKLA 2HNHA 3V1PA 2HTMA 1E0VA 3P0WA 1DIEA 3HGOA 1NSJA 1ME8A 4GYPA 3G8EA 3GXPA 2AL1A 2ZUVA 1QO5A 2QJIA 2KX9A 4LT9A 2PDGA 4PUMA 5FJTA 5G2IA 4F8XA 3M5XA 2ONEA 2HROA 4N9BA 4B2DD 3KTXA 1CT5A 1R9XA 3LI1A 3FXGA 3CWNA 2WMIB 3GXDA 1W54A 5CZTA 4JDYA 4HYVA 4JXCA 3KTSA 1FQ0A 1KFKA 1ME9A 5BRBA 3UWVA 1W3IA 1CXKA 2OKTA 1VFHA 1AH4A 3TONA 3R89A 1EF3A 3QLDA 3WLJA 3LGDA 3WBAA 5DEZA 1E51A 4AYGA 3TXZA 2HWGA 2CLPA 3TAKA 5BOFA 3AAMA 3CS2A 4KRTA 1FDYA 1TV7A 2QW5A 4CQ8A 4F2TA 3OW1A 1UZ4A 1KB3A 5HANA 1A53A 3RPMA 3VE7A 1KGWA 2VEPA 1E1FA 2W67A 4KCWA 3WEZA 3O15A 4QG8A 1WUFA 3N18A 4CEUC 1FWHC 1TV4A 3P80A 3M5YA 1UCWA 1E4MM 1WZAA 2QS8A 3QPYA 1DP0A 4KERA 2VYOA 3P8JA 1B4KA 3H7RA 2R1MA 4UCFA 2ANUA 3M0VA 3RM8A 3ABSA 1K8ZA 4AY8A 1PHWA 4EAMA 2WQPA 4MJ4A 1G0CA 2GGJA 1IT8A 2C1GA 5IOBA 3SGZA 1WAWA 3V1HA 5CBBA 1TWIA 3OBKA 1RPKA 5F2LA 2DUXA 1LBLA 3D47A 4EX4A 2WOQA 4GO8A 2QMKA 2WVVB 3CHEA 4P2VA 2WBKA 4QS5A 2J62A 1U83A 1W5OA 1VQTA 4H04A 1TTJA 1KRBC 2WVTA 1HVXA 4JIEA 2BSLA 1DQXA 1UD2A 4UTTC 4YTRA 4PYSA 4JIIX 3KRUA 1LT7A 1GW9A 5I03A 4CQAA 1FCBA 2DQWA 3UFYA 3DHFA 3HBLA 3W84A 4A8RA 4HP5A 2GQAA 4MKNA 1Q4NX 1UP0A 2I16A 3UZWA 1KA9F 4F79A 5EMKA 3CL8A 4UR8A 4XWUA 3EWYA 4HA1A 1E40A 3UG5A 2WHJA 4JHMA 3ARWA 4LUJA 4D6IA 4NNBA 3GNXA 4FHAA 2XVGA 5IDIA 4GGBA 3W1LA 3CZEA 2ALRA 3MI3A 3EGJA 2Y6ZA 2CZFA 4M1BA 4AG0A 3VD4A 2IKGA 1I2NA 3MJMA 1X7FA 3SUTA 4EPDC 1UR3M 3REQB 3QPZA 4LTSA 1T99A 5AY7A 1NDZA 1GOMA 3PTDA 2OMAA 1W3JA 4O1CA 4XZLX 1FWSA 1UR4A 1OY0A 3PULA 1JPDX 1J0IA 3CQIA 4FX6M 3QQ1A 1SVDA 3C2YA 3EX3A 4E8CA 3LHWA 2WBGA 3TU9A 2NWSA 1JF6A 2P50A 4H2CA 4V1XA 2IPWA 2IW0A 4XKYB 1DIDA 3RLUA 1PTAA 3OU8A 4ZENA 3USZA 3EAUA 4X61A 2O56A 2VGGA 3B4UA 5D2TA 1POKA 3UY7A 5JXQA 1TJ2A 3VABA 3ARYA 2GPTA 3W70A 2VJXA 1UD6A 1Z3NA 4HZ8A 4OBRA 2WZEA 2G96A 4Q8MA 5HPCA 3IUDA 2J7FA 1QOPA 3GTFA 1S2WA 4WXZA 1OC7A 4DZHA 4ZOCA 3AMKA 1Y5XA 3FEQA 3GU9A 3GD6A 5LIWX 4EXQA 3CH0A 3WUBA 1R3WA 1YNQA 4FXRA 1KFLA 3PZIA 5XIMA 3DI1A 2I56A 4L65A 1W1PA 3CMJA 4JQAA 4INFA 4OOZA 3G1YA 1GVYA 3BLDA 2C15A 3BARA 1QI2A 4OKDA 3XISA 3BURA 2D24A 1REQB 1TR1A 4EPEC 4IFOA 1TQJA 4HMDA 2YA1A 1C92A 3HZ3A 1DQUA 4XTIA 1BRLB 3PK7A 3M7WA 4I5XA 1JCNA 3LPPA 3O05A 5F4SA 3JZEA 3QHNA 6REQA 2XSBA 3W29A 5EU9A 1XLAA 3F4VA 3S9ZA 3NL3A 3SECA 4ZSUA 5FL0A 3RX2A 1XLGA 5M1TA 3LY0A 3D0CA 1CW2A 2VZSA 3G8RA 1W8SA 4C7GA 1A5UA 3S5OA 2P88A 2PDQA 1V6WA 3GNNA 3S0CA 2UZ9A 5HQEA 4XBSA 5CPQA 3PZMA 2WANA 2XGBA 3UGVA 3DFNA 3DFOA 5HQLA 4M29A 4LGXA 3TW7A 4JX6A 2R14A 4GJJA 3N6HA 3R13A 5T8GA 3H54A 1XWYA 3S4TA 1XYMA 1RVKA 2PP3A 2G97A 4IXHA 3KBNA 3GC5A 5ENLA 2BZNA 4DPQA 4I8DA 4QG6A 1XSJA 4NNCA 4DVOA 4G5DA 1Z69A 1W3KA 2CCRA 1TFVA 4JTFA 4L5ZA 2Q3RA 3WLQA 1RK6A 1W5QA 1WKDA 3TH6A 2E8YA 4LF1A 2XJ7A 1EDGA 3C56A 4CD5A 1LROA 2V3GA 2JIWA 2XIQA 5HOSA 3BAWA 1W31A 3WFAA 5FJJA 1CGWA 3H2OA 4Z1YA 5C2XA 4DJEA 3EWZA 4IT1A 4M0XA 2VWTA 2VC7A 3B8TA 3P5ZA 1LRNA 4GY7A 5FJPA 4NZFA 2CXGA 2WHMA 4Y9PA 4KCTA 3AJXA 4LY4A 1H7NA 4AMAA 1T41A 5EBAA 4QM1A 4QFUA 3S1WA 1IXQA 2QLYA 3CMGA 1YDYA 5AVNA 1M7OA 4C6NA 3OLIA 2QT3A 1M9HA 3T8LA 4FIQA 1VBJA 4IMAA 1XLCA 3OODA 1GJPA 1TIMA 4AF0B 4QGCA 1E6ZA 3WMCA 5A2BA 1QK2A 5AYIA 1CGUA 2CLMA 3NM1A 1JEZA 4PBEA 4R9XA 1YKWA 1MRQA 4HK5A 1AA1B 3PJXA 2GGIA 3PB0A 3H2FA 3C0QA 2WAGA 2OQLA 3DFHA 3UP8A 3W72A 3TV8A 2I1OA 4ZMGA 1VJSA 1E9YB 4DBWA 3NAVA 1DTUA 2WLZA 2QXWA 4OT7A 4EAYA 1T0OA 3OVRA 2XN0A 1EKOA 3E6EA 1MEIA 4RX0A 3BW2A 5A6BA 2ZUWA 3LUTA 3N04A 5CCZA 4JCMA 2F8QA 3RM9A 4A21A 5AYXA 3LCWA 1KQYA 4JFWA 3MPGA 4LPCA 4WX2A 2ZXBA 3W02A 4Y9AA 3UNTA 3AUOA 3E3HA 2A2IA 2VFDA 1MQRA 4XVDA 4DXKA 4WKFA 3FN9A 1SQ7A 3CQKA 3WQVA 4Y2WA 1J12A 2LLEA 4ECLA 1LUCB 1R3VA 1XD1A 3N4AA 2OZ0A 2JEQA 2PURA 3AZSA 4M6VA 3EWUA 3N17A 5FEXA 4I3GA 1MXDA 2CLFA 1ZQ5A 1IEIA 2PWUA 1GYLA 4C6OA 1R46A 4RE3A 2FZBA 4V2XA 4DIAA 3Q65A 3BQ5A 3OBAA 2OR2A 2ZE3A 1X7IA 3W7IA 3WQCA 4ZSTA 4X2RA 2AQWA 1AODA 3TVAA 1RBAA 4N6EA 1FWAC 2P53A 5BOOA 4XO7A 5AKQA 2J9YA 1B31A 1W0MA 2PLCA 3L4WA 3GVQA 5D9PA 5DBTA 1F5ZA 3BLOA 2WMIA 1TTQA 3LSBA 3HG5A 4H83A 1NEYA 5A8NA 1VB9A 4QG9A 3AXKA 3T4CA 5JMUA 2Q3OA 1GZ1A 1UG6A 1OX4A 2I5QA 3GDLA 1D7FA 3QYSA 3BDKA 2YR1A 3E02A 5JH1A 1DTNA 4JICA 1NOWA 3R6IA 2XTKA 3SRKA 2G4FA 1YXCA 1EJRC 1R3QA 2PDNA 2NUYA 1JJKA 3VOCA 4X0VA 9XIAA 1EQCA 4HN8A 2V2DA 6XIAA 3DBNA 3H8AA 2J6XA 2INEA 4ZO8A 3UWQA 5L9FA 3LCFA 4MKVA 3QR1A 4A3QA 1TKKA 1PWLA 3B8IA 2C16A 5AHLA 4REQB 4YVPA 4J2PA 3SBFA 4KFPA 4Z2GA 3KBWA 5CH9A 1L8PA 2J7BA 2ZBTA 4O1AA 1MZHA 2NQLA 3BL3A 5LKYA 3N4EA 4PB4A 4PE8A 2I5GA 3LPOA 3DG3A 1H09A 1IR2A 2ZVRA 4YVVA 4CCZA 1DJIA 4YCPA 1C29A 4W87A 3NPUA 3WY1A 1VLWA 4GI6A 3LHZA 2B7PA 4D8LA 4H2HA 1P48A 1AMYA 3M0LA 3R94A 4CD8A 3ANYA 2VD9A 4GVHA 1W6TA 2XZ9A 4X22A 3AHXA 4QSFA 1UZHA 3N2MA 2ZYFA 4G7EA 4FEZA 3E2SA 3MDUA 3P14A 1BKSA 2ZICA 1QFEA 1AFSA 1GVIA 4UIOA 3EWCA 5E6YA 4QJ1A 1Y0EA 2H3BA 4ZE5A 1K7FA 4JAWA 1CGVA 3KM8A 3VIPA 1HF6A 1XG4A 3VMNA 2XN2A 1N82A 2E77A 2O92A 4LOCA 4OJYA 4PTDA 3UWZA 4IXXA 2DZVA 4W8AA 3OGSA 1YXYA 3VCCA 1K9TA 3LA4A 4JL1A 4D71A 3I6RA 1P6BA 3AO0A 3ZLFA 5BXTA 3QV7A 1V5XA 1AL7A 1B3YA 3NPVA 1DJYA 2HXTA 1SO5A 1IIGA 1F8IA 2CIPA 1V7YA 5HNUA 4EWND 3TQ0A 3MCNA 3QZ6A 4TUFA 4Z1CA 2TYSA 3LCIA 3HJZA 4PMYA 5LHFA 3GNOA 2GDUA 5LIYX 3MP4A 1P0DA 3UW6A 4Y96A 3NIYA 1G4PA 5CSYA 3TK7A 1OIMA 2EPHA 5LIKX 2GGEA 2IS7A 3SSJA 3WJZA 4L1XA 2R1LA 1PX8A 4M7TA 2VDIA 1DWHM 4Z2KA 4RDZA 1XI3A 2EQDA 3BLPX 1UP3A 3RNDA 3VNMA 1B30A 2PU1A 3PVFA 5EBUA 4IPJA 3V7PA 3RITA 3OVQA 1HZYA 3NZ1A 1IEXA 2EF9A 3EBVA 4UMBA 5CPLA 2CBJA 2QF7A 2YFOA 5K3VA 3E0FA 3EXRA 3EMZA 2BHZA 4QDWA 4UTIA 1OABA 1KM5A 2BASA 1V4YA 1NFBA 5MKGB 3F5KA 3E2QA 1OD8A 2O9PA 2DSVA 3AMGA 3UJEA 2YW4A 3N12A 1LWJA 4FMVA 2R8WA 3MJYA 3A3WA 6CGTA 4JTTA 1JRCA 1OWQA 3T08A 4C7DA 1H50A 2PCQA 4JGDA 3A4XA 2X30A 2HXUA 4YHEA 4D8AA 2Q6ZA 1KWKA 3DFQA 1W5MA 2I7GA 3CL7A 4PTVA 2Q02A 5F1UA 3AROA 1QNRA 4KPLA 3ITXA 3S5NA 3NQEA 4C6DA 1VP5A 1N2VA 1EYEA 2HK0A 4KBXA 2OELA 1REQA 3VM5A 1MW2A 4BCEA 3VZZA 5CQ1A 4IG2B 2Y8KA 3PNUA 1A3WA 3JU2A 4GQQA 2WCSA 3V5OA 2NLYA 3P81A 1UBSA 2VKZG 1H60A 1H7XA 2TPSA 5CAHA 4GZEA 4J3SA 3W00A 3OP2A 4LB3A 5D9OA 1MI3A 1JQVA 1UA7A 3S6OA 4HCHA 1EOKA 3GVGA 4RE0A 3UR5A 2Q8XA 1WDQA 2R9RA 3I7RA 2EKGA 1YIXA 3APGA 1A5BA 1RCOB 4IPPA 2OOFA 5GJMA 4IX0A 4M6PA 5JIWA 3TEVA 5A3HA 4L6OA 4XG1A 3UJSA 4EANA 5FF0A 4GLEA 2YA2A 7PTDA 4GQRA 1TSIA 1WXZA 3VGGA 2BY3A 2E25A 4BF9A 1B1YA 3NA8A 1Q2RA 1GVRA 2BTMA 2YXXA 1HJUA 3W01A 1KBJA 4YTUA 2V2CA 5IHSA 1OFAA 1OIFA 3TYUA 4LCRA 2BGQA 3GW3A 3TJIA 2YLLA 1UKQA 3UVAA 5G2WA 1SO3A 1SZGA 1DXIA 4EK7A 1GT8A 3DYPA 3L67A 3WBWA 5JBEA 2XIBA 1FHDA 2YGYA 2FVLA 3F5JA 3KEHA 1DWAM 3UXDA 1MUCA 1Y5VA 4HOZA 2Y62A 5AHMA 5DELA 2CBVA 2Z1BA 2JGYA 2V3DA 1XW8A 2OQHA 2GJRA 3N6JA 4GY1A 1KM0A 1H4PA 1UZ1A 4WSJA 3ERPA 2WWCA 3WH6A 1VGAA 4S1FA 3QXBA 3TYBA 3IAPA 2F9RA 4XQ6A 4PH6A 1LOSA 2QHAA 3I4EA 2GGHA 1AW2A 3B0PA 5DQPA 2FZ9A 3Q4DA 4KWVA 1WKYA 4AF0A 5ECUA 2AMGA 3TYZA 3BW4A 3QV6A 4B9ZA 1ZB5A 3NQDA 3HGRA 3KFTA 3KRBA 3QTPA 2YL8A 3SB0A 1F6YA 2VEMA 1W2VA 3ZMRA 1PJ9A 3AIWA 4DAFA 3WQEA 5BWFA 1TMQA 4DBSA 2ISSA 3VXGA 2QF8A 3KOZA 4GUHA 1H0IA 1OEPA 1HKJA 4OVXA 1MW1A 3ONBA 3EOEA 4H9TA 3L0KA 2B31A 1I9CB 1PS9A 3FHQA 3Q58A 3T05A 2PODA 4J28A 1QDSA 2OLAA 2DQXA 1TG7A 4HMEA 1R3TA 5GJPA 4XBKA 1SW0A 2MNRA 5M5DA 2GDQA 4UTTA 4CNOA 3VX1A 4C1NB 4IFRA 4A3RA 4EACA 3TW9A 5FF7A 2WPGA 5SWUA 2J7DA 1K9DA 2PCEA 4W7WA 3T2QA 4UWMA 4TMCA 2Y63A 1FWFC 3C4UA 1LUCA 4P7QA 1QPNA 4F4RA 2OXNA 3G1FA 2PDXA 2Z1XA 3SUWA 2WQDA 3MV01 1F3WA 1ZP4A 2WSPA 1ZBCA 3RIKA 2WMFA 3WBYA 3PZTA 4HHMA 1FP9A 2HS6A 1ML1A 4C6IA 2X0HA 2HVNA 1AJZA 5I77A 5AYBA 2DP3A 4WY0B 2PDPA 2Z6IA 1KV8A 2BHUA 3KHJA 2QCLA 3NURA 7ODCA 3ID7A 3VIGA 1IHIA 1OFDA 2VHLA 3VVGA 3RLVA 1XINA 3NCOA 5FIPA 5CG0A 2O9TA 1LBFA 1K77A 5DMMA 1I2OA 4LEFA 3UR2A 2DY3A 4PTWA 3KCJA 2BXVA 4AZCB 2PDFA 2E9LA 1SJBA 2CLLA 4FLSA 1Q63A 1EFZA 2GWGA 1X96A 4KIEA 1TV3A 4CNUA 1FHVA 3G1DA 2D3LA 5F4WA 4HOWA 4XZWA 1SMAA 3W7RA 3ONCA 1BXCA 5DXYA 1WQ5A 3T6CA 2G8ZA 1RH9A 1HX0A 2A6NA 3SQLA 2BOEX 3GSMA 4Q8PA 3W1UA 1PYFA 2VCAA 1J2WA 1QU4A 1XIGA 3FGCB 3V0SA 3OQ8A 4L9XA 2J7EA 3LERA 4DZIA 3K8LA 3F4CA 2PMQA 2ZRWA 3PUOA 4JHOA 4JN6A 2ACUA 3FJ4A 4RUBA 1W3HA 1FWCC 1Q8JA 2ADAA 3LRKA 1R2SA 2Q8ZA 1IT0A 4C6JA 5E1QA 3G1VA 3VIIA 4Q8TA 3WNLA 2PDKA 4LC6A 4OV4A 3CAWA 2E6DA 1KXTA 1QNVA 4QHRA 3GAYA 5T9BG 1Z42A 1JFXA 4YTTA 2CXEA 3ZO9A 3IARA 2YCJA 2HPIA 1T6MA 2WCAA 3P67A 1GKRA 2XFWA 3WLSA 2VMFA 3GS6A 4E38A 4KKXA 1J4EA 1H63A 1XIIA 4J5NA 1TR9A 2QR6A 1TVPA 1XX1A 3C0JA 4GQ0A 4QQUA 4FIRA 4DX3A 1V8EA 2BBFA 1CBGA 2CKSA 4F0KA 1JUKA 2WNWA 1SU5A 1V3KA 2EEXA 3HQNA 2VC9A 4JEQA 1V0LA 2OZ3A 4DJDC 3V35A 1YDNA 3EWBX 3BJSA 3R10A 3AWOA 3B0XA 4YXGA 2QNEA 2YLAA 4WDTA 2DVXA 3ABXA 1SMDA 4JR5A 4JIQA 3SY8A 2FQIA 2HE8A 1HNYA 1K8XA 2OWCA 4IH3A 3LTYA 3VOFA 3MBFA 1PKLA 2B4GA 3OVGA 2PFHA 4O1DA 4WLCA 2GJLA 2QJGA 4WSHA 4WRHA 3DYMA 5C0QA 1JZ8A 3UPMA 1U1JA 3W2MA 3RX4A 1Q6EA 3LXCA 2VURA 1XD0A 3GR4A 3HO8A 4JX4A 1WO2A 4LALA 4WK9A 3CV1A 2YKKA 1K8YA 2FTYA 3MMTA 4UBPC 2YCIX 3FA4A 3GNRA 4W7VA 4CD7A 1FKWA 3ITYA 3L68A 3RLGA 4H9XA 1GKPA 4CVWA 1TRDA 1M3UA 4Y6GA 5EL1A 2D22A 1MQQA 3TN5A 4OV9A 5T91A 4P8UA 1ITXA 1X1ZA 1DBTA 1CB2A 2WJFA 5L6UA 2C8NA 4CQBA 2ZUUA 4Q8QA 3EX1A 2QUTA 1PL9A 4LAKA 1SZEA 1GQLA 3C86A 3H53A 3M5VA 4MB4A 5A6TC 3MHFA 5H8MA 3PAOA 3F4NA 2QJMA 1G7VA 4ZQRA 3WMLA 3TIMA 1XYBA 3ITLA 3HG3A 5DMNA 2J9XA 4P7NA 3NL2A 1ZL1A 2VEGA 1EC7A 3L4VA 1JNEA 1TUXA 1T40A 1U1HA 3FKRA 4HA4A 4ZXOA 2QCDB 1U30A 3ANVA 5BWAA 2VI0A 1KM3A 1Q45A 1TQXA 3ZJ7A 5D38A 3VD3A 3UWEA 2G37A 1VYRA 4GJ1A 1C7SA 3ZSSA 4ATDA 1AL8A 2PE4A 5A6LA 3CUGA 1FHUA 4WKHA 3VOIA 1XLMA 2B7NA 4KFOA 1US3A 2NQ5A 3CQ0A 1ZJAA 4W93A 1CX9A 3DGRA 4GE8A 4NL1A 3N11A 1QXLA 3CMFA 1VBRA 2QCEA 1UA3A 1EA0A 4BFAA 3SRFA 1Q7ZA 5ABTA 4K1GA 7A3HA 3U5YA 3OHIA 4OE7A 5F4XA 2WZTA 1R3YA 5DO8A 4FALA 4A29A 3RR4A 1QMLA 2DJXA 3W75A 1SSGA 3FFSA 2ZZ7A 2YDQA 4MB5A 3GO2A 2X7WA 3W1MA 1IGSA 2V6AA 3GZ3A 3IJLA 1EJVC 3NDOA 3SFWA 2YFNA 2Z2UA 1VFLA 1SR9A 1UB3A 2INZA 3Q67A 3DG6A 3DH7A 2EG6A 2X05A 1KFJA 1YADA 3PJTA 5DY2A 1SGJA 3VNLA 4JQ2A 3W7PA 1CIUA 4DNHA 1J6OA 3DAQA 2VRJA 3HV9A 4DHGA 2ICSA 4XK2A 4J2MA 4F48A 5ABEA 4RV3A 4QSHA 2PF0A 3BE7A 4IQJA 2WXDM 3JVAA 2VZUA 2GK1B 3UXLA 3QY6A 3KDNA 4R27A 2G3NA 4WJXA 1Q5MA 3EOLA 4TO8A 3GY1A 1EP2A 1OFEA 2E5DA 1XIDA 2DW7A 3C5QA 4W8BA 2CLOA 2WW5A 1AQMA 3CUIA 3ITTA 3LXAA 4L9ZA 5D2VA 1KXVA 1PIIA 3EOUA 5H8PA 3NQBA 3PSVA 5B7YA 1AH3A 3WH8A 1RD6A 3SIMA 3P84A 3U4FA 1US0A 4JYDA 3CUHA 3JW7A 3WEOA 5I5RA 4GGHA 1ZLPA 1DEDA 3S5ZA 1OFRA 2HE5A 4PMRA 4XZNX 3S47A 4GD0A 4LV4A 1XGDA 3GKFA 1E73M 3PP7A 3QM3A 4I5RA 4AMCA 3ME3A 3BCJA 3LCLA 1RCXB 4HD5A 3EWXA 1FUYA 3V18A 3QW3A 1XG3A 3OEXA 3IUIA 3GW0A 2C71A 1UWUA 2PTZA 4FP1A 3FNDA 1E71M 1LTDA 1VKFA 4DJFC 1G69A 3LLFA 3WNNA 4QR6A 3AISA 5D8WA 3N15A 2QQ6A 2EGZA 2P0OA 3ZOAA 5K4XA 4W5UA 2CBUA 2XVLA 2QCCA 4C60A 1ICSA 4JFSA 3UXIA 3OA5A 5C6MA 3CYJA 4RL3A 3LD5A 4L6DA 1XBXA 4TOQA 3CK5A 3TE9A 1O5XA 1ONEA 3BTNA 3PBYA 3LI0A 2BGNE 2VRKA 3SI9A 1GG1A 5I00A 4PMXA 2NUXA 2GVYA 2PGWA 1ICQA 3NWRA 2VEIA 1AG1O 3WH9A 5BU9A 4QDMA 3LTSA 5E0KA 2J8TA 2NSXA 3E0IA 4B16A 1XYFA 2QDEA 1NQKA 2W91A 4FLRA 1OFPA 2V5LA 1NY1A 4TVUA 3S2JA 3TP4A 2OWWA 5EKYA 4JIRA 4HZ6A 1PDYA 2PWVA 2Y8VA 4US6A 3L9CA 1OC6A 4BJHA 4Q8WA 1KFEA 3OIXA 4C1NA 5I0DA 3WLRA 1I2RA 4X63A 4JPGA 3M0JA 3OZMA 1W3TA 5M03A 2I9UA 1LOQA 3CB3A 1M7XA 1W9XA 3PZUA 5I06A 1IZCA 4IFKB 1F73A 4O1EA 1OSEA 3RUBL 4N9DA 4DYEA 3PBWA 3STGA 1MQPA 4F2UA 1TPFA 5HATA 3ZJ6A 2HDJA 4H8NA 3ABRA 5TF0A 2REQB 2L5HA 4S2BA 4NZ3A 1X6UA 3W4RA 3VILA 3MZ2A 2I14A 2FVMA 4WY0A 2QUMA 5EMYA 1O12A 2QUUA 1UROA 1QVBA 7TIMA 1KTBA 4JKKA 1V6VA 3OLDA 1EDQA 1V77A 5A8QA 3NQVA 4RKAA 2YBTA 1Q6LA 3IGSA 3VMOA 3DFPA 3PWAA 5CKSA 2F84A 5GNYA 4LW7A 4S3JA 1PZ3A 4K7YA 4WJEA 3G2GA 4ERIA 3S2NA 4IIEA 3H2NA 3HQOA 5HA7A 5DRIA 4HBKA 4H00A 1PKYA 1ODZA 2GJNA 2V30A 3AYSA 3HOJA 1KM1A 1TWZA 3W7GA 3IWPA 4C5ZA 1EXPA 3EKGA 2PDBA 3WSUA 4MLJA 5HPOA 3M0YA 4H01A 1ZS2A 1VEOA 2V9DA 4I5UA 4DELA 3I3BA 4LUSB 3WQPA 1HUVA 1XISA 3KLKA 5C7HA 1D9EA 1Q13A 1PX3A 3AFBA 3MVTA 3VNDA 2EPNA 5K9XA 1S38A 1BQCA 4OGZA 4XKMA 3G1XA 2H8ZA 1A5AA 3FV9A 3FGCA 5HK4A 1KTNA 3QMTA 2GOUA 2F2HA 4DI9A 1QW9A 3AOFA 1M7PA 4X0NA 2BOGX 3M64A 1HGYA 2GJXA 5D37A 1OCNA 1XC4A 3P82A 2JGQA 3CO8A 4QBXA 4MJMA 1VPXA 2R6OA 4KGJA 4JNYA 3RRXA 3KBJA 3MUZ1 1FWIC 3VA8A 3QC0A 2YDAA 1GW1A 4JYFA 4ORMA 4YWIA 4WOQA 3RMJA 2OCZA 4GH1A 2GSHA 1DVJA 3N25A 1O5QA 4ERGA 2WLYA 2FZ8A 2WM1A 1B9ZA 3VI2A 5GPRA 1E70M 4O10A 4LANA 1ISWA 2IQDA 2PUZA 4ML9A 4J9JA 4AB4A 1RD5A 4OWGA 1BKHA 4GHRA 4FSAA 3TMQA 3VC5A 4OFCA 1E6NA 4FAMA 1XLEA 3DCPA 2ZADA 5H1WA 4MWAD 4C1LA 4HMNA 1K4HA 4DY1A 1E72M 1Q6OA 4L1GA 3CLMA 1OYAA 3IRDA 3WFZA 1GQJA 3WLOA 3FYYA 5AC8A 3KOFA 5AC4A 3ARVA 3EB2A 3L4ZA 3OYZA 1Q8AA 5A6AA 3M43A 3LDVA 2H9AB 1V93A 3PANA 4MZ8A 1O7AA 3QBUA 1M7JA 1PEZA 4NT0A 3VGFA 4DJED 3TJLA 4UTUA 2V5DA 4QLLA 2PTDA 4Q22A 3B8SA 2C13A 3R25A 4N9CA 4MNMA 3KL0A 4GYFA 1KM4A 3B4YA 2E1DA 2QDHA 2DDXA 3V36A 1I60A 1JZ6A 1FCUA 3BG3A 3QLLA 2JKEA 1YQ2A 3O7UA 4ZA0A 3QOKA 3SGUA 2PDLA 3H2CA 4DF2A 3WN6A 3AC0A 3RDKA 1HL8A 4N42A 1UWSA 4QAWA 1TREA 4K39A 4MY9A 5AC6A 1IE7C 2WV8A 3MA8A 1LLOA 3KUMA 1W1YA 1LOLA 4MGGA 3EPOA 5I79A 4RPPA 5D9MA 3T9PA 2E6YA 1OCQA 3ITOA 1TPDA 2EG8A 4GKLA 4DF1A 3GDTA 4DBDA 2XIMA 4RXGA 2YCKX 1NU5A 5F2GA 4D6JA 3GIQA 3FK4A 3D3AA 3LBCA 3PZOA 3QZAA 1ADSA 2WVSA 1LL6A 4GX8A 2QEZA 5CPSA 1R7AA 1FTXA 3PBVA 2PTXA 1ISZA 3HFYA 4MZ1A 2EPLX 1RPXA 1OGSA 1VF8A 3WX7A 4JTIA 5A6BD 5JUVA 2QCDA 5LNSA 4DO7A 4P7OA 2ZZ5A 2B7OA 4JTKA 1RP8A 1H7RA 4PRWA 1G01A 4C7FA 1ZP3A 1U5VA 3R58A 1UR0A 2ZX5A 4IQEA 4W85A 3DU0A 3A22A 4W88A 5JH2A 2X16A 7CGTA 2XH2A 3S1XA 4XTDA 5AN7A 2R1KA 2POTA 2CU0A 4PEEA 3PZGA 1A4MA 1P43A 3A9IA 2XH0A 3WQ8A 1L6GA 4UTMA 3P6LA 4LNYA 2PDJA 1HQTA 1J79A 1K7XA 2VX7A 3T8QA 3R12A 2BXZA 3BH4A 3PPFA 3RX3A 5HINA 2RDUA 1LL7A 3CT7A 4MM1A 4PB5A 3F1QA 4P8WA 4O16A 2DH3A 3TYEA 4XUYA 2DEPA 3W3OA 3EEGA 3DI0A 3SJNA 4AISA 4IHCA 3M44A 3CQJA 4N6FA 5D02A 1D3GA 3FVDA 1QHZA 4IL0A 4LQ1A 3WH7A 1DJQA 4IUOA 3POHA 1OQFA 3DN5A 1A5LC 3WKZA 3KW3A 3ARQA 4Q4KA 2OLHA 2XGZA 1EP3A 5D4YA 3F4DA 4GNVA 2BNJA 2OYMA 4NJKA 3WUEA 1H62A 4MDOA 1EUAA 4Y8EA 2XFFA 4JN8A 2X1SA 3W7EA 5HWNA 3G1RA 1AMKA 2OPJA 4NY2A 3JZUA 1A0DA 4NYUA 3QV9A 2QULA 1LZOA 3R1ZA 4U28A 5F2MA 2RDWA 4UTWC 5KETA 3L4UA 2ZCGA 4NHVA 1F3EA 1EEXA 5U4NA 4UQDA 3AYRA 1KBKA 4PB3A 4PTMA 5FEWA 1SW7A 1WDWA 5HMEA 5EFDA 2BG5A 3AHZA 4JFTA 1ISYA 4LAZA 4KRUA 1BGGA 1S2CA 4R85A 4FLQA 1VEMA 3GHTA 4Y7EA 1CDGA 3UYIA 1R3RA 4H1ZA 4NAEB 2DT3A 1SM9A 3CHDA 4OZOA 1H5VA 4FR6A 3GRIA 3A3HA 1UH3A 4HA0A 4RE2A 2FMOA 4GMEA 1T5AA 2X41A 1YYAA 4H9ZA 3VD9A 1QASA 2GSJA 5HULA 3FS2A 3W7MA 2GYIA 1FWGC 3SCPA 2Z7GA 5K9CA 4S39A 1VJZA 3G3DA 4YPJA 1E55A 2ZX7A 1VS1A 2QIWA 1XV8A 3LZ3A 1VH7A 4TX8A 5FSEC 3ZVHA 4M3PA 3VM7A 5CSUA 3WD3A 5CZKA 1W1VA 2Z28A 3W27A 4F9DA 1BWLA 3EDEA 3CUFA 4O28A 5C5YA 2IUZA 3W1AA 2NZLA 3O3RA 2E1WA 1P6WA 4PEKA 1GVFA 3LHTA 1ITQA 7XIMA 3RCMA 2DSWA 1GTHA 2XGIA 3T44A 4AZIA 4NZ5A 2YJQA 4GNKB 3EPNA 1UUOA 2VVSA 2E67A 4OHQA 1YLVA 3GXNA 1UWTA 2DU2A 3OG2A 4GZJA 2A85A 3ZR4A 4E2BA 1DORA 3KRSA 3LHVA 4XISA 2RDTA 5LNUA 2ALDA 2ZX6A 4L1WA 1P5BA 4Q32A 1BGAA 2C0AA 3ABQA 1TX0A 4XSMA 4HJWA 2XFYA 1MDLA 4UFIA 3BLLA 1OGBA 3L2IA 3LEPA 2JKAA 2NQZA 4JTDA 4BF7A 3ANUA 2PZ0A 1CXFA 3A13A 1Q6CA 2AOSA 3B8DA 4U5IA 4Q4RA 3E38A 3CPRA 3H12A 3PN8A 1XBZA 1WDDA 2BFGA 3NGFA 1I8JA 4D6FA 4UFMA 1PE1A 4LS1A 3NZRA 2H8XA 3QTGA 1SPQA 3I3DA 2W63A 5XIAA 3W28A 1JPMA 4B3KA 1WUEA 2OQYA 1JL8A 5C70A 1H49A 1VCVA 2OX4A 1EEPA 3HA1A 1XSIA 3EYPA 2Z00A 4DLMA 4NI3A 2NVCA 3ZWTA 1RJQA 5BXRA 2ZA3A 4QE4A 3CXOA 3UA3A 1VRXA 3WLIA 1QRQA 1U5HA 5HXMA 1XLFA 1ME7A 4QP0A 1KW1A 4XBJA 3ZIZA 4GXWA 3VOGA 3NZGA 2VFEA 2CERA 3W86A 4QS6A 3GIYA 1TELA 3W2KA 2UY5A 1XKYA 3O16A 3AYVA 4FS9A 4WR3A 3WQ5A 1JF5A 2VELA 1WZMA 3K4DA 4N9EA 3KS5A 1V3HA 4I7WA 2ZTKA 3BUVA 2HBVA 3VC6A 4P61A 3A6OA 1LQAA 2G95A 3MW7A 2OU4A 2A5HA 4LUSA 5HR7A 2GDVA 3S2LA 2ZUTA 3F5LA 1X97A 2ZFAA 3AALA 1QBBA 2QVNA 1OG6A 3W87A 3FKKA 7REQB 4NYYA 3B8UA 3KP0A 2RAGA 4Z0SA 4BQ2A 1DJWA 4H8HA 4MDPA 1VLIA 5D03A 4TV5A 1O60A 4MTVA 3A3XA 3SIZA 4ZR8A 4DWSC 1W9VA 3SRHA 3IK2A 3HF3A 1XICA 2GOKA 3CO4A 4R7WA 5EGRA 3R8GA 3BG9A 2Z24A 3H21A 4UOQA 2FHFA 3ZJKA 3ZQ9A 1XH1A 2PTWA 3G0SA 4DF0A 2HV5A 1DXFA 5DCEA 1JGIA 2OODA 2DT1A 3T09A 2OX1A 2GJPA 3MANA 1GEHA 3CU2A 4C6KA 4GQBA 4QE1A 1XRSA 3VFCA 3QR0A 2E3ZA 2Z4GA 3TFXA 5DCDA 4WXYA 3EDDA 1EGVA 5FESA 1NDYA 1JDFA 1KCKA 3C0SA 1F2JA 1S3HA 3QOMA 4G9PA 5TIMA 4UR7A 2C0HA 5E9AA 3ATYA 5E5CA 1O6IA 4DEFA 4FO4A 4GXPA 3AIEA 2O9RA 2CLHA 2Y5SA 4RK8A 3W7LA 4FOKA 3K4WA 2OZ8A 3D6NA 2ZRUA 3MT1A 1UASA 3O6YX 3AS1A 2DT2A 1F6PA 3PY2A 1UR8A 3MKCA 3W7OA 3RN6A 3WFLA 4ZODA 3PG9A 2ZX9A 3FVMA 4CD6A 1EO7A 2H9AA 3I6EA 4B5VA 5BXSA 2X2YA 4O52A 3GHRA 1N7KA 3SW6A 2Y70A 4V15A 2OKOA 3GWQA 5D2XA 3W53A 1EC9A 3GC2A 1MW3A 3QFWA 1YW1A 3RF9A 4RR4A 5ABFB 5BMXA 1EXBA 3GE7A 4FXSA 3RM4A 3W7CA 4E2VA 4UXDA 1UMLA 3TNBA 8RUCA 5JIPA 1QWKA 2HVMA 3C2EA 1H7WA 1XJBA 4OOUA 1XPYA 3GUWA 3WL1A 5HJLA 1E43A 3GBEA 2BY1A 1TTIA 4AZHA 4QXIA 4J35A 1NQ6A 2IPJA 4TIMA 1OD0A 1V6TA 4I9TA 4PSPA 3AHYA 4I7VA 1XS2A 3NO1A 2GZXA 3KDOA 2VD8A 1VZWA 1NOFA 1QNPA 1X39A 1ZALA 3A21A 1A49A 4CN4A 4JTAA 4LWWA 1MXSA 4EPBC 2QCFA 3K13A 1XRFA 3FIGA 4CQCA 4NI8A 3ES8A 4CQ9A 4I6VA 1WP6A 3ITGA 2W3ZA 3BAXA 4FNSA 4S38A 2CLEA 1V6UA 4OBSA 1FY6A 1CECA 3M0XA 4D6DA 3E0LA 4UTKA 1XIEA 4Y8FA 4WDXA 1H7OA 3BJFA 3CLWA 1QW7A 4HYRA 4DJFA 1FP8A 3PSWA 1NIUA 2YL5A 2DZAA 3C2FA 1NDVA 1JDDA 2EKCA 3CBWA 5LSMA 1RY0A 4JEJA 4MWAB 4L9YA 2Y7GA 3VE9A 4NU7A 1TTPA 4IZGA 1U1UA 4IUGA 8CGTA 3TNOA 1Q3NA 4MIMA 2TODA 3N2CA 2FFIA 4BQ4A 1RQHA 4KMQA 1S5VA 1FA2A 4ERAA 4J3ZA 3EPMA 3USBA 1YPXA 4JTCA 1XYAA 1IEQA 5EYWA 4PCFA 3W7JA 5U7SA 3WK1A 1DJGA 2E6FA 3SAZA 3L4YA 1X1NA 4YJ5A 2EBNA 1X38A 5LIUX 1BYAA 2Y24A 5AHEA 2OSWA 1UD5A 2IQTA 4AX7A 2WMHA 3M47A 4B5UA 1DHKA 1P7TA 1XCWA 2XZ7A 3ATZA 4O1FA 1VFTA 3BCDA 4QITA 3GFXA 3KX6A 3AS2A 1UBPC 2V68A 4DPPA 3GB6A 3NGJA 4M7SA 2ZV