2W6RA

Crystal structure of an artificial (ba)8-barrel protein designed from identical half barrels
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
233
structure length
223
Chain Sequence
MQRVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADKALAASVFMRELKEYLKSGQAVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
publication title High-Resolution Crystal Structure of an Artificial (Betaalpha)(8)-Barrel Protein Designed from Identical Half-Barrels.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 69
structure length 223
sequence length 233
ec nomenclature ec 4.3.2.10: Imidazole glycerol-phosphate synthase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2w6rA00
2A7PA 1YDVA 1ML1A 3NNTA 3DI1A 1G7UA 2ZYFA 5GVJA 4UIOA 5AC7A 1ZNNA 2D73A 4JD4A 1Q45A 3VKJA 4D2JA 2VEIA 1S5TA 4LRTA 3LTSA 1H7OA 2V2CA 3CC1A 5E0KA 2ZZ5A 1DBTA 4FO4A 1JUEA 1PIIA 1I8JA 4IMGA 2BWGA 1VCGA 4AVFA 1YTDA 2NLIA 1PV8A 1ZAJA 2QCHA 5HWMA 3L2IA 3W1QA 1H50A 4N2YA 1IXPA 5K3VA 1QOPA 1LTDA 4UUIA 2DZXA 3W2NA 5J5DA 3B0UX 3TAKA 1TQXA 4JXCA 2O7QA 3ANYA 3E96A 4IXXA 5D37A 3PBWA 4M5PA 3GVGA 1VGAA 5IM51 3W1UA 2JKEA 2XN2A 4X9SA 1WQ5A 1FWNA 2GVGA 3M6YA 3TMQA 3W7MA 1R2TA 4UFLA 2NXIA 2W0UA 1SZNA 1JQVA 4QNWA 3QW3A 4HSNA 3L5MA 3P80A 3TA6A 1XBXA 3SGZA 3QFEA 1ME9A 3LM7A 4MVAA 2CWNA 4N9EA 1OX4B 2RDTA 5AYZA 3MP3A 4OWGA 2Y7FA 4CNPA 3C61A 1EUNA 3DFPA 4UTWC 2QUVA 1G6CA 3SY5A 5FF2A 2E5DA 3W22A 3N9SA 1YDOA 2ISSA 4O14A 3NZRA 3TDFA 4ZZ9A 2EKCA 4Y8FA 1I45A 4LNYA 1BKSA 1TREA 2HS6A 3A23A 5G5IA 1TPFA 3CU2A 3P74A 1HTIA 4RR4A 1PCWA 3F03K 3W84A 2XN0A 4PL2A 2V5BA 1X1OA 4PC8A 5LNUA 1K03A 2VEPA 3STEA 3I7RA 1GOXA 5I3FA 1DL3A 1NVMA 4UMBA 1O5KA 1JCYA 1ZALA 1SU5A 3P5ZA 3SW6A 3HG4A 4JDYA 2WOQA 5LNVA 5CSRA 4JX6A 4GUJA 2RDUA 3C2FA 4C1KA 5IBXA 3BV4A 2Z6IA 1D3GA 5CZTA 4DF2A 1FQ0A 3KRSA 1PVNA 4XWUA 1IXQA 1ZAHA 2J6XA 3UWZA 4IPIA 3PS7A 1VHCA 3EWUA 3FA5A 1XBYA 3GNDA 4Y9AA 3DFNA 4IQLA 3EXRA 3UPWA 2QDHA 3O16A 1O60A 1FCBA 1VQTA 3TQ0A 4LU0A 4QSHA 1LROA 2FIQA 4MY8A 1P1XA 3W76A 1Q6OA 4EF8A 4MJZA 2NWSA 2QCCA 3W7GA 1H7WA 3UD6A 2E77A 3QM3A 4DF0A 1TV8A 2WQPA 1YTEA 3BG9A 4AH7A 2Q3OA 3E02A 3UQNA 1GEQA 4O1DA 3ELFA 4O4WA 1KBIA 2WPBA 2GUUA 1T99A 1QPOA 2ZA2A 3BK0A 1V7YA 3KVLA 4DBDA 2GQAA 1C29A 4UCGA 2ZA3A 3ATZA 3W2MA 3HGSA 3N9RA 4ALDA 2JGQA 2UV8G 2W79A 1QPQA 3FYPA 1JUKA 1H7PA 3W1TA 4O16A 2A4AA 2H3DA 3W7CA 1FWWA 1OFDA 1XCFA 1AL8A 3EEGA 1KM3A 1H51A 1NF7A 3JS3A 1H7RA 3P60A 2V81A 2CZDA 7TIMA 3WK3A 3R13A 1KFJA 4Z1DA 1VYPX 1XI3A 5HR6A 1WAUA 5D02A 3DHFA 3IIOA 3W74A 2QDGA 1CX9A 1DKWA 1H7NA 2ATMA 3M5XA 3SGUA 5BW6A 5I3HA 4AF0B 3M5ZA 1IXNA 3W6YA 3BLEA 3UWUA 3NEVA 4M6QA 2B4GA 1QR7A 2B7QA 4O15A 3SFKA 3N19B 2ZRXA 1J5TA 3TC6A 1QNVA 5EY5A 3RFAA 2V30A 3W2KA 3DBPA 5K4XA 1VZWA 2QUUA 3GR7A 1OVDA 3KVMA 3RLUA 1SO5A 3A9IA 2A7NA 3L5AA 4JTSA 5AHMA 3R2GA 4GC4A 4ZQPA 4WY0B 3PBUA 5DCDA 4AXKA 3T7VA 4EF9A 5F2LA 5AHLA 5EYWA 2X1RA 4Z08A 1X6UA 3QQ0A 3BVJA 5CZSA 1W1ZA 4O8RA 3BPWA 2RDWA 3MP4A 4AMAA 3L66A 4IMCA 4O28A 3NA8A 4S2BA 1GTEA 3EWXA 5HINA 3E49A 1KFBA 3HG2A 3UXAA 1KV5A 1QCWA 4O52A 4WX2A 3W9ZA 4YMZA 3RNDA 4UFHA 3M7WA 1R30A 5AYYA 5DY3A 1LBLA 3FJ6A 3LGEA 3A21A 4W9TA 3HGOA 2FPVA 2I1OA 1MXSA 2E5CA 1GG0A 5FEZA 2W6RA 3NL6A 3VE7A 2C18A 1FWRA 1YPIA 4A2SA 1OF8A 3LBCA 4WUIA 2ZQ0A 5AOUA 3NR0A 3IVSA 4E38A 1TTJA 4N6FA 3IGUA 3W87A 3P8IA 3RU6A 1EWEA 2BSLA 3PSVA 3CM4A 1G4SA 3BLIA 3FOKA 2DU2A 5FEXA 4Z1AA 1FCUA 4TO8A 1H5YA 2E1DA 1HFBA 1KM6A 1RPXA 2QCDA 4O11A 1KTCA 5F1VA 2Q8LA 3TKFA 4YCOA 1ALDA 5AFDA 1W5MA 2J9YA 2E6YA 1XC4A 3WJWA 1T96A 4UTMA 2A2IA 1JCLA 4MY9A 1X7FA 3OEXA 4H3DA 5D30A 3STFA 5F4XA 1TPWA 3W7LA 3UY8A 3QC3A 3HF3A 2WNQA 2FQIA 1VCVA 3THQA 1EB3A 1VLWA 5C55A 3T4CA 4UTWA 3SR7A 4LRSA 5D2XA 3QJAA 3F4NA 3QSTA 1ZY9A 3LXAA 4O53A 2WSQA 3HPSA 1KTBA 1EX5A 4CCDA 5LHEA 2C19A 1SZGA 4LY8A 4CNOA 1CW2A 2VFDA 3IIZA 1AK5A 2V0TA 1SO4A 3W7NA 2YXGA 3HIJA 3QH2A 4JR5A 4NX5A 2AQWA 3NQ8A 1KBJA 4JTIA 3JR2A 1HUVA 3BARA 3G0XA 2ABAA 2V5LA 2ISWA 4G1KA 3BGGA 2RKXA 4KWVA 1FWSA 1O4UA 3LERA 4E2BA 4R33A 3BW4A 1Q3NA 5HNRA 3WFAA 3NQCA 4JNMA 2X2GA 3L0NA 4UNKA 5K4ZA 2OJPA 2Y6ZA 2A21A 4GNJA 4BWLA 2VFEA 4MIMA 4UXDA 1ONRA 3K30A 3GK0A 3TFCA 1JRBA 5EMUA 3GKAA 1FDZA 2PE4A 3EWZA 2OT1A 3GLCA 1G67A 3LCHA 1V5XA 1OX6A 2QJGA 3GZ3A 4TIMA 1AW1A 2EF9A 3NXFA 4GRSA 4NJIA 4CNNA 3P5YA 4K38A 4MZ8A 1XBVA 1L6YA 4TX9A 4LV9A 3RF9A 3QW4B 4PH6A 2JKAA 1MO0A 1Q6QA 1QOQA 4UFKA 3O6YX 3DENA 1Z42A 2GPTA 3T78A 2VELA 4OE7A 5F2GA 4HSOA 3PUOA 2Y85A 4Z1BA 3SZ8A 1XBZA 2EGZA 4QNEA 3W7PA 3WJZA 1L2UA 1WDWA 4JTGA 5EBUA 5D33A 1SW3A 1L6SA 3B4UA 5DELA 2A0NA 5FEWA 3CWOX 4OV9A 2J24A 1QWGA 1X1ZA 3BLFA 3L0KA 4B5NA 3FIGA 3LB0A 4MZ1A 3P7YA 2Z6JA 3VFLA 3DU0A 3OBKA 3P8JA 1Z41A 1EP1A 2BXVA 3S1UA 1OF6A 2A5HA 1QPRA 1TRDA 3NGJA 3LTPA 3I7QA 1ICQA 3G1FA 4MJMA 1Q6LA 4O17A 4K7YA 2R14A 3G3DA 4Z1CA 1O5XA 1R2SA 2OT0A 4AHPA 5KZEA 4PFMA 4LC8A 4GXMA 3ABOA 5FEPA 4K7VA 2HMCA 2Y61A 1LOSA 2CLOA 2OX1A 3GR8A 3HBLA 4Z0SA 1W31A 4JS3A 3W1NA 4BI7A 1ZFJA 4JICA 1B4EA 1R47A 3S1VA 4ZQNA 4MYXA 3W83A 1C8VA 3S42A 1OABA 2EHHA 1SSDA 1GG1A 1OFOA 5EA9A 3RMJA 1YDNA 4PTNA 4DBEA 3SECA 1K02A 1JQXA 2BLEA 3BGJA 2CW6A 5DN1A 3W1RA 8TIMA 5CGQA 3GAKA 2VEMA 1TJRA 3DAQA 1WX0A 4M19A 3HGJA 4LT9A 3C3NA 3OVQA 4JGDA 5L6UA 4LVAA 4AWUA 1P0NA 1ZJIA 1U5JA 4UTHA 3LHUA 1GWJA 3GDMA 3TH6A 1XKYA 4NZFA 4BK9A 1GTHA 4JTKA 2Y62A 3GKFA 3ZWTA 1I2QA 1LDCA 1XFBA 3PB0A 3U8GA 3R12A 2A7RA 2Z2UA 3DI0A 3G8EA 3EX3A 5A5WA 4E0CA 4N4QA 4NXKA 4UFMA 1OFPA 3LDVA 2QCMA 1TPEA 4FNPA 5LNSA 4MOZA 5G1TA 3KXQA 3B05A 4P2VA 3M9YA 2GJNA 2CLEA 4KFPA 3UWYA 4WZHA 3NL3A 1QAPA 4A3UA 2CLMA 2QAFA 2VFHA 4NNCA 3QQ1A 4XKYA 2ZZ2A 2DJXA 1OG0A 4NVTA 4UMCA 1TPC1 1P4CA 1TV7A 4RKAA 5LGXA 5LSMA 1G4TA 3LCFA 4TMBA 3KRZA 3NQ7A 4RXFA 1TPH1 2A1YA 3PR2A 1KLZA 4K8EA 1DORA 3A22A 4XTDA 5DCBA 3BW2A 1KM4A 1K3UA 3ZS4A 3CTLA 3AO0A 5CPNA 3O8AA 4POCA 3YPIA 3CB8A 3LCGA 2YGYA 4HNTA 2P1FA 3NM3A 4ZL1A 1W5OA 1NEYA 3NPXA 3W07A 3S5NA 2ZTKA 3HPZA 3F4WA 1TQJA 4JYFA 2BZNA 5HR7A 2PRHA 4UR7A 4WOQA 1YADA 3Q37A 3QSRA 3SI9A 3O63A 1AW5A 2RH9A 3WJSA 5G2WA 2TSYA 4RZ5A 3TX9A 2QCDB 3UZ5A 3BG3A 5BMWA 4OU1A 3S6DA 2OMAA 1R2RA 1ME7A 6TIMA 1JCMP 2BX7A 1QO2A 3TROA 4QAIA 4WOZA 2Q8ZA 4OT7A 1S3HA 3QMTA 2FPYA 5CSSA 1QFEA 2ZDRA 2DZPA 2QCEA 2PRLA 3LHVA 3BG5A 4JTUA 3E9AA 3WK1A 4XZ9A 5HUOA 1F6PA 1KW1A 1SZFA 4Z0JA 2X1UA 1DOSA 3P67A 1BEUA 4NZJA 2CZFA 1H1YA 3W7QA 1VHNA 3KFTA 4KFNA 3CHVA 4MZYA 4CCCA 2VENA 2WSRA 3G1AA 4N9DA 2Y7GA 1A53A 3RK8A 4DXVA 1KM0A 4JYEA 1VYRA 4IX0A 5FESA 3KVJA 2GOUA 4KKXA 4BF9A 3LV6A 3MO7A 1EIXA 3PBYA 5TBOA 2B0MA 2FB2A 5AHIA 4BI6A 3P84A 3GB6A 1JR1A 5G2HA 4N9BA 2C6QA 2TPSA 3GAYA 1YXYA 3W1PA 2WO5A 1PS9A 3TW7A 1H63A 2I14A 2NV1A 1MEHA 3LCWA 4ZQCA 1N7KA 4LUIA 4LC6A 5DBTA 2ISVA 4JTLA 3PG8A 2YDAA 3KVKA 3V1PA 3DZ1A 1TPB1 4PEKA 4O1AA 2ZRWA 3R8RA 4JIQA 5D38A 4LVGA 2GVLA 4LWWA 3T44A 3N73A 4I7VA 3UWQA 2H90A 2OZ0A 3ABQA 4H6KA 3UNDA 2Z0IA 4IPJA 3MBFA 4N4PA 3PUDA 3TXVA 1HO4A 3C52A 4K39A 3LI0A 2G97A 2P10A 2E6FA 3FJLA 4HNVA 1TTIA 2X16A 2X1SA 4JYDA 2G96A 1F7BA 4FB7A 5ABTA 2C15A 3TMLA 4FF7A 3UWVA 1HG3A 3NYZA 5DCEA 1M7PA 2Z1BA 1EA0A 4UTTC 3UPBA 3P62A 5D03A 3CIWA 3SSJA 2FJKA 5G4WA 4WQ6A 3G22A 2C13A 5AB3A 4MFDA 2A6NA 1GVRA 1S5WA 4O13A 2NUXA 2NZLA 3MUXA 3W7RA 2C1HA 1GVOA 4JDBA 4DPPA 3OG3A 1UBSA 1MEWA 1N8FA 4LS2A 1QO5A 3A5FA 2KZHA 3NL5A 2B7OA 1UASA 1TYGA 3TSBA 2G95A 3IIVA 3NZ1A 1SW7A 3GNNA 1JCJA 3MP5A 1FWTA 4HNUA 3L5LA 3NO5A 1WOBA 3TJXA 3GYEA 3O6CA 5FF0A 5CZ0A 4IX2A 2QCNA 4LS0A 4R53A 3R5EA 4GUIA 3GXTA 3LXBA 1C9DA 4WD0A 3I6RA 4UTJA 1I2RA 4Q33A 3TQKA 1JVNA 4Q4KA 1WOAA 3W7JA 1W54A 1N55A 2C14A 1LOLA 4ZQRA 1JUBA 3KX6A 5G4EA 2H6RA 1FCQA 2EAWA 4LTSA 1DHPA 2OCZA 4HT3A 5H2ZA 4R34A 4UTLA 4WJEA 4DO5A 4H4IA 4ONVA 4GJ1A 1Z44A 2AAMA 1B3OA 2PC4A 3TU9A 2FLIA 2ZRUA 5L9FA 4PA8A 4ADUA 3ZWSA 2Y88A 3PY2A 4ORIA 2V2HA 3B03A 3OIXA 2DP3A 3D0CA 3W88A 1TIMA 1FX6A 3W1MA 2QUTA 4DF1A 1TV5A 1RZMA 5FF4A 1HO1A 2CZ5A 2VEKA 3NQVA 2ZA1A 5LKYA 4UC5A 3E12A 1VCFA 2B7PA 4FEZA 1YYAA 1I4NA 2NV2A 3WK2A 3PC0A 1WA3A 1OX4A 2QF7A 3F1QA 1OFBA 5T26A 1FXQA 3S5OA 3BO9A 2NUYA 2IQTA 4L4LA 4NNAA 1DV7A 2E6AA 4MYAA 4O10A 3NQDA 2J27A 4A22A 4NQ1A 3G0SA 3GIYA 3W1LA 4O1CA 2Y7DA 1R46A 2PCQA 1G69A 3TW6A 1TPUA 2HSAA 2DZUA 4LUJA 1W5NA 1KM2A 2CU0A 4HNNA 3C2EA 3TNOA 2HTMA 1G4EA 1IF2A 1LZOA 3LCXA 4X22A 3N34A 4I7WA 2PURA 5EKYA 3SIZA 3W3OA 4NT0A 4JTJA 1FCVA 4PL1A 3EXSA 1OFAA 3U2OA 3EKZA 5AC6A 3W7EA 2E09A 1CI1A 4KFOA 1JULA 4YXGA 1LRTA 4IMDA 2ZRVA 4O57A 1DQWA 3PSWA 5LHFA 1Z48A 4RJEA 4ADSA 1K8YA 3EWBX 4FIRA 3QRHA 4M7TA 5F4SA 3NOEA 3TXZA 2EPHA 2ZTJA 2Y63A 3LX9A 1WYIA 3NQ6A 3QF0A 2F7FA 4O54A 3CQ0A 2JGYA 4QISA 3Q94A 5FF3A 3Q2DA 1GVQA 3G18A 2X30A 1YPFA 3N14A 1W8SA 3DFQA 1TRIA 3H55A 3GXPA 1ZHAA 1L6WA 2V2DA 3VI2A 1KM5A 1J4EA 4TMCA 1H1ZA 5I3KA 4DELA 3PAJA 4OBTA 3GDLA 5K2ZA 3HPXA 1ADOA 3G1XA 5DY2A 1SUXA 5BOOA 5I3GA 2NWRA 2E6DA 3PF3A 1M6JA 3IIPA 4CQ8A 4RZ6A 4YL2A 5F2IA 1W56A 4Y6GA 3TIMA 4E2DA 5LGZA 1QMLA 3LXCA 4O12A 3W71A 2P0OA 5KZDA 4O4VA 1MEIA 3GDTA 1OYAA 1KFEA 3DFSA 2H8XA 4XTIA 5AHNA 5U4NA 1WV2A 4FNUA 2WV8A 3MYPA 3NQEA 1YXCA 2CLHA 3USBA 1JRCA 3KRUA 3EXTA 3LCLA 3DFTA 3UY7A 1H61A 1UB3A 2TRSA 2DZVA 3L9CA 3NG3A 3TSMA 4O19A 4QITA 1UCWA 4EOUA 1QDSA 1SPQA 4FX7A 1FY6A 1AL7A 3MWAA 1G4PA 1LM1A 1LLZA 4LS1A 1F74A 5K7JA 1OYBA 1KFLA 3TK7A 5HQEA 1PCKA 4HPXA 4AF0A 1K7EA 4YWIA 2R91A 1LOQA 3SJ3A 3CWNA 3O05A 1YXDA 3MJYA 4U4MA 4NXSA 3BW3A 1TPVA 4DO6A 3Q58A 4AHOA 3G1YA 1GT8A 3FLUA 1HL2A 2E68A 2WKJA 4K6AA 3AJXA 3ZR4A 4CCEA 4S1FA 3NQMA 3TE9A 5EPDA 4WY0A 5AC8A 5CZJA 2VKZG 3MI2A 1VH7A 3E0IA 3W70A 1NF0A 4FIQA 4R7JA 4EVZA 1PHQA 2C3ZA 1VR6A 1OJXA 1ZAIA 4MFEA 2FB3A 5HJLA 3TJLA 5J5RA 3DFOA 2AGKA 2V9DA 1A5BA 4WXYA 4AWTA 3C6CA 3FFSA 1WBHA 4OQVA 3L68A 1F05A 5G2IA 2VFFA 2GJLA 1H62A 4XUGA 2QCLA 2A6LA 5CPOA 4IUOA 1XXXA 2QAPA 3P61A 1SO6A 3TFXA 4YLWA 2DZTA 2YW3A 1FDJA 3RLVA 4A29A 4WXZA 1DVJA 3C8FA 3WJYA 1GPWA 3R89A 1TO3A 2R8WA 2FPTA 1KLYA 3HQ1A 1GYNA 4IMFA 4CQAA 2RHGA 1LRQA 4JX4A 1UJPA 4DQWA 3LHZA 3IEBA 1TTQA 2LLEA 4IOTA 4WY0F 2PRMA 1AG1O 4TU1A 3M41A 1DQXA 4JTFA 1ICPA 2YW4A 2QKFA 4ZVJA 3B06A 2F84A 3NM1A 3O1NA 1LP6A 1JCXA 1VYSX 2CLKA 2WNNA 2GVJA 5I3JA 1F76A 1IIHA 2B7NA 3W85A 3TQVA 3PULA 3EB2A 3GDRA 1ME8A 3NPVA 6ALDA 1SW0A 1IXOA 3TC7A 2C16A 5EL1A 5F1UA 3W72A 1F6KA 4YCPA 3CEUA 3PWAA 4FHAA 3A5VA 1D3HA 4RCXA 2ALDA 2O7SA 1BWKA 3LLFA 4DPQA 4LW7A 4IMEA 3B0VC 3OVRA 1A5CA 1B9BA 2ZFAA 3G1VA 3W2JA 1XDLA 3G1DA 3HG5A 1MZHA 4A21A 1W3IA 4XQ6A 1RQHA 2TYSA 5F4WA 4FXSA 2YFOA 3OHIA 4K36A 1F73A 5AHEA 3S1XA 4MY1A 3S0CA 1WBJA 4UFJA 5DBUA 5E93A 4JEQA 4XBSA 4RV8A 1H60A 1O94A 1LRNA 2CFFA 2NX3A 2Q3RA 2XFWA 4NJHA 2QJHA 5KSWA 1KA9F 3NL2A 4GUHA 2CLFA 5K9DA 1RVGA 4ZQMA 2JBMA 1GYLA 1XL9A 5D09A 1NFBA 4Q32A 4U28A 2VC6A 1I2NA 3G24A 1F5ZA 4A2RA 5I3IA 5DLCA 5U7SA 1U83A 1RV8A 5FF7A 1PE1A 4LV4A 3H54A 3OVPA 4NU7A 3W73A 2YCEA 4BWLC 3TSDA 3PVFA 3IRDA 1VC4A 5K9XA 5CPMA 4DEFA 4O18A 1WXJA 2WNZA 1OFEA 1SSGA 5AN7A 3LLDA 1FBAA 4N02A 3C2OA 5D04C 1ZENA 4OHQA 4FXRA 5C5YA 2QJIA 2ZBTA 2ZRYA 2YFNA 1W3NA 2HS8A 5A8GA 4PODA 4JN6A 3W75A 3HJZA 4AB4A 4GUFA 4IJBA 3NPUA 1KFKA 3DGRA 3QPYA 4GE8A 3ATYA 2ATSA 3C2RA 1LYXA 3MHFA 4IWWA 5FI8A 3THAA 1XDMA 4RZ4A 2GQ8A 3W86A 2DZSA 1L9WA 4NUWA 4QQ3A 3IV3A 3W2LA 2I9EA 5C6MA 3KAOA 4JY9A 2VXNA 3DKJA 3LCIA 4FX8A 1UUOA 2J88A 1IIGA 5CG7A 3LBMA 1KV8A 3FKRA 1P0KA 4QIUA 1T0OA 3W7HA 3C2VA 2YR1A 3QMRA 3QZEA 1OX5A 2Y7EA 4IGHA 5AHFA 3G8RA 1AMKA 1XUUA 4NNBA 2QCGA 4JIPA 4LOCA 4K8HA 3W7KA 4UMAA 2ABBA 5HUPA 5HWJA 4O0ZA 3FKKA 3MI6A 5MHBA 4UR8A 1E51A 3LRKA 3LRLA 1B4KA 4UNLA 4HIBA 1OFRA 3T55A 3STCA 4UTKA 4KWWA 4QJ1A 1GVFA 3M43A 4LVFA 3JRKA 3PG9A 4P61A 1K8ZA 1VS1A 1THFD 5KITA 3S9YA 2YYUA 2ZCGA 4MLJA 2V82A 3M44A 2ZZ7A 3FEMA 2JK2A 4CQ9A 3IGXA 3PM6A 3NAVA 1LORA 3QMSA 2YX0A 3B0PA 3B8DA 3LI1A 3EX1A 3TR2A 1GZGA 4TR9A 3DKLA 3MHGA 3QPZA 5D2YA 2YYTA 3ABRA 4HKPA 5D2WA 1TTPA 3QYQA 1W5PA 3O15A 3IGSA 2ZZ3A 1EP2A 1GJPA 4I7UA 4ORMA 1BTMA 2A85A 4CLMA 5C2XA 3UZJA 1W0MA 3MBDA 5TQLA 2CLLA 3GX9A 1A5AA 1FDYA 1KTNA 2DORA 2QEZA 3MMTA 4FNQA 3EX2A 3PUEA 1O95A 3B04A 4RX0A 1EWDA 3IVUA 3PB2A 4UFIA 5D2TA 1F2JA 3HG3A 1NAL1 3GDKA 3I65A 4ML9A 4IXHA 1B57A 3ZFHA 3CT7A 3TV8A 3NDOA 2Y70A 5LZLA 2E5BA 4K37A 2NX1A 2R94A 1I2OA 3UWWA 5F2MA 4NJJA 4JTHA 1W3TA 3HOJA 1A50A 4O1BA 1Q6RA 4Y90A 2YPIA 2GQ9A 5AYXA 1M7OA 2WJZA 3CPRA 1PL9A 2H8ZA 3S5ZA 1EEPA 4XKYB 1TB3A 1KM1A 3N3MA 2C0AA 4RK8A 5LNWA 3VE9A 3IIXA 2WSYA 3TUUA 1RQBA 1P5BA 2BTMA 1ICSA 2CLIA 4M6VA 1UUMA 1K7FA 3W7DA 3S8HA 5D2VA 4N9CA 1S5VA 2RFGA 4PCFA 5HULA 3I68A 3MI3A 2QR6A 3M5YA 4NJKA 2J9ZA 2NX9A 3HGRA 1TSIA 3H53A 2G5WA 4LVBA 4MKNA 2J9XA 2YSWA 4RXGA 2ZZ1A 3S1WA 3UXDA 3L67A 3LV5A 3O06A 3G1SA 1K7XA 5K9CA 3NPWA 5DXXA 3G1HA 4XBKA 5D32A 4AAJA 4X3ZA 3G0UA 4O50A 2H3BA 5H91A 1M5WA 2ZZ4A 3DHDA 3M47A 5DXYA 1K8XA 1QPNA 3M16A 1YTKA 1KFCA 5LNRA 4AHQA 3QEZA 1DJNA 3P82A 4ICNA 1LBFA 3NQAA 4O0KA 4OGZA 1YLVA 4AWSA 5BMXA 3HB9A 4MLRA 3I7SA 3T40A 3PBVA 4J9JA 3U6WA 4GFSA 1EP3A 3CLMA 4DO4A 3LRMA 3O07A 4M7SA 3W7OA 3IVTA 1VJIA 5IBXC 1OFQA 4JTTA 1BWLA 3CEPA 1SZEA 1VLIA 4LVDA 1GQNA 2ZRZA 4JTEA 4ADTA 4FNSA 1IGSA 3NQGA 1AW2A 1PHWA 4UTIA 4EWND 2YZRA 2JKPA 1FUYA 4HHPA 4N6EA 3LTYA 5BNKA 3C56A 1J2WA 1OK6A 3N2MA 3EWYA 4M6PA 2QCFA 1A5SA 3NVTA 2FDSA 1VPXA 2DJLA 1ZCOA 1OK4A 1SFLA 3W1AA 3NQ2A 1Y0EA 2X1TA 2NXGA 4S2CA 1T8XA 3M0ZA 3M5VA 2TMDA 1SFJA 1NSJA 2V8ZA 3S5YA 4BI5A 3LHTA 1LLWA 4GBUA 3VNDA 1OHLA 1XM3A 3M1ZA 1SQ7A 4X2RA 5D05A 3ABSA 4MPQA 2NUWA 5E1QA 4FNTA 3WJXA 4ZQOA 1EPXA 4ZMGA 4BFAA 2FTPA 4L4MA 3MHUA 3W23A 4MUZA 3GXNA 1TCDA 1GVSA 4JX5A 3L21A 5KINA 3EX6A 3EX4A 4UTTA 1TPDA 4RLIA 3STGA 3A24A 4NX0A 3EWWA 3V75A 3INPA 3HO8A 4Y96A 4AEOA 3FYOA 3TAOA 3DH7A 4UTUA 3MW7A 1TMHA 5C54A 4QM1A 1VRDA 1W5QA 3LHYA 3NQFA 1XUZA 3HMJG 1FXPA 1JCNA 1D9EA 5HMSA 3L0GA 3LHWA 1I2PA 2ZZ6A 3C0JA 3EKLA 3OA3A 4BR1A 5KMYA 3G3MA 1MSSA 2CZEA 5KZMA 4C1LA 4FNRA 1JJKA 4FX6M 3L65A 4EIVA 1G7VA 2DZWA 5HWNA 4OV4A 1RQEA 3W7IA 3TCEA 4GWEA 1LCOA 2NXHA 3KHJA 1H7XA 3WK0A 2VFGA 1OYCA 5BRBA 5SWUA 3O6DA 1TJPA 3CIXA 3LOTA 4HN4A 3DXIA 3FS2A 5CKSA 5CPLA 2FFCA 3VCRA 2VOMA 4JY8A 5TIMA 4HPJA 5KTLA 3N2XA 4GUGA 1SR9A 4NJGA 3C4UA 3MYOA 1DJQA 1X8FA 2VFIA 1W37A 5G1YA 1SO3A 1RR2A 3W2UA 1RD5A 1LBMA 3KOFA 2XN1A 3UYCA 3W1XA 1EUAA 4I9AA 3P81A 2Y89A
chains in the Genus database with same CATH superfamily
3QZ6A 3WUEA 1CGTA 2ISFA 3GS6A 1EJXC 5F7UA 1GGOA 2PWVA 1H0IA 2VEIA 4LRTA 1GQLA 3UR7A 3LTSA 2W27A 5E0KA 2ZZ5A 4I9MA 1OZMA 3LMZA 3A4AA 1PIIA 2BWGA 4RE2A 4AVFA 1S2TA 3L2IA 1TIWA 2DIEA 4PMQA 1IXPA 5K3VA 1TVNA 3W2NA 3VDGA 3M0LA 2GFTA 2O7QA 5D37A 3H4XA 4M5PA 3GVGA 1T5AA 1PWLA 3I6EA 3R0UA 3W1UA 1JGIA 4NY2A 2FTWA 2X42A 5BROA 3TMQA 1FWAC 2E7FA 1AQHA 3W7MA 2NXIA 2W0UA 1NP0A 3SFWA 1SZNA 2J7GA 3QW3A 3CAQA 2HWGA 4MVAA 4NSBA 3F5LA 1MW3A 1RJRA 1U5HA 1MNSA 4IF2A 2BASA 4PMJA 2D0HA 4UTWC 5FF2A 4RPQA 1NWUA 2E5DA 3W22A 4ZFMA 4QEEA 3E2RA 2ISSA 2YXOA 1BKSA 4IFOA 1HTIA 5M2FX 3W84A 1BG9A 1E5NA 2XN0A 3C0SA 5LNUA 3OU8A 1K03A 1GOXA 5I3FA 3LZ3A 1JCYA 3EDKA 1S2UA 1T41A 1XC6A 4HA3A 1QPKA 4GUJA 2RDUA 3CUIA 2X7VA 1D3GA 2AQVA 4NRSA 1Q6GA 2BVWA 2FH6A 2GDQA 3PPHA 2WMJA 2X40A 3PS7A 8A3HA 1TWDA 3FA5A 3GNDA 3GTNA 5CBJA 3N4EA 3HJEA 3UPWA 1F07A 1EGMA 3ONCA 3D6NA 2OELA 3TQ0A 2VHLA 1VB9A 5EB8A 1LROA 2FIQA 3KOXA 4MY8A 3W76A 4RDZA 2OO6A 2ZDSA 4XIAA 3VABA 1X38A 5C0QA 2PDBA 3QM3A 1F8MA 1CXEA 1YTEA 3VGGA 4AH7A 1X39A 1GEQA 3BZJA 4ATLA 3MO4A 2WPBA 2XIMA 1QPOA 1X6LA 3AS1A 3SDOA 1ITUA 4GQGA 4C6BA 3AMCA 1ZJAA 2ZA3A 1XH1A 1HKIA 4RNIA 3LA4A 1QPQA 4XKMA 3W1TA 1O5QA 4O16A 2A4AA 1O5RA 2PGEA 5FKYA 3ZOAA 1XCFA 3DUGA 5CSYA 1KM3A 3QHNA 1X96A 2F9RA 1FFRA 1V08A 4D1IA 3JS3A 3V0UA 2R1NA 1NFGA 4GC3A 3SY1A 3WK3A 2ZX6A 3R13A 1KFJA 4LBSA 1VYPX 4CGTA 1AD1A 5D02A 3DHFA 3KS6A 1XLAA 3QTGA 1F3EA 1NDZA 3ZZ1A 4LB3A 3RG6A 3RLGA 1H7NA 3S6TA 4A8RA 1IXNA 4MWAD 2JF6A 1NH6A 1QR7A 2B4GA 2B7QA 5FJRA 3UWEA 3N19B 2ZRXA 3TC6A 4MWAB 1NM9A 3XIMA 4OOZA 3DBPA 2CIPA 1VZWA 1TJ2A 1MMFA 3BCDA 2XSAA 1IT0A 4LUSB 3KVMA 2QDDA 2D2JA 3BSGA 1ZUAX 4JKKA 3CYVA 3L5AA 4JHOA 4JTSA 1XH0A 4Q8QA 4YS1A 3N12A 4EF9A 1MFVA 2X1RA 4Z08A 4EWJA 3A4WA 1W1ZA 4XSLA 4LEQA 3T81A 3MS8A 2D0FA 3NA8A 3SCWA 5C9XA 2P76A 3VX1A 4DJEA 3E49A 3UXAA 3VD3A 1K9EA 4UFHA 3T0TA 1BGGA 1R85A 3P3BA 3VTRA 3LGEA 4W9TA 3UJFA 1QJWA 4IPPA 4XB3A 1FHVA 4AY8A 4HTBA 1ECQA 3VE7A 2Z24A 1FWRA 5DFAA 3E0WA 5AOUA 3IVSA 3VD4A 3IUIA 4F48A 3IGUA 2BSLA 3BLIA 3FOKA 1J0ZA 1UPPA 1RA5A 1IEXA 2E1DA 2QCDA 4YCOA 1ALDA 2J9YA 3WJWA 3K13A 1T96A 3SURA 3DN5A 4MY9A 3OEXA 2ODOA 3SBFA 3VOGA 3SN0A 3UY8A 3WD2A 2WZTA 4G7EB 1GKPA 4UQAA 1B5TA 1VCVA 3M0IA 3A3WA 3BAJA 1MQPA 4ZO7A 1BGAA 1HIZA 5I24A 3TYAA 3WNLA 4UTWA 4LRSA 4FPSA 3VM5A 4LAKA 3NVDA 5LHEA 4E5TA 3FSTA 1CW2A 4L7ZA 2CETA 3GVRA 2V0TA 3RX4A 4JIRA 4FOJA 2QNEA 4NX5A 2WMFA 4JIIX 5LIWX 2V5DA 1XLCA 1S2AA 3NQ8A 3WBAA 4JTIA 3JR2A 4DNHA 2V3DA 1E56A 1TVPA 3EMQA 4PRRA 4KWVA 5FAJA 1WXYA 1O4UA 4X0NA 4R33A 5HNRA 3WFAA 3HV8A 1XIBA 5K4ZA 4WLCA 2A21A 5A2CA 4MIMA 8CGTA 1JPIA 2G4FA 3BXWA 2XSBA 5FJOA 3TFCA 2PDFA 4ML4A 1FDZA 2PE4A 1I60A 2YOCA 3T09A 3LGDA 1V5XA 5JH1A 3AYVA 4HZ6A 2XFFA 4G2DA 2EF9A 3NXFA 5C71A 2ASHA 3WQOA 2DZAA 4PRWA 1D8WA 3BCJA 1XBVA 1UD5A 4PH6A 2JKAA 4ES4A 2TAAA 1Q65A 1XGDA 3JUGA 4AZBA 2QQ6A 3V36A 2GPTA 1M04A 1C8YA 3T78A 4EACA 1FKXA 3PUOA 1E40A 4DYEA 3W7PA 3CZJA 2GGEA 4LPCA 3CAKA 1B2YA 4JTGA 3EOEA 2YBTA 1L6SA 1US3A 1OSEA 1HKVA 1HKWA 1QWGA 3L0KA 1VFFA 3FIGA 3ZLHA 2Z6JA 4L4PA 3DU0A 3OBKA 3P8JA 1Z41A 1E9YB 3S1UA 4LF1A 1OF6A 1V51A 1DIOA 3WH6A 4MB1A 1ICQA 4OVXA 3VMPA 3F2CA 4IIHA 1UR9A 1W1B1 3G1FA 3HFYA 4P8XA 5HBFA 2J7EA 1XYFA 2R14A 4C60A 2G3IA 3G3DA 1V0NA 1OIMA 3CHDA 3IJDA 4IISA 2OT0A 4LC8A 1ELSA 1RVKA 3PHAA 1LG2A 1CLKA 1XV8A 4FLQA 1LOSA 2CLOA 2IS7A 2A3HA 2AL2A 4UOQA 5C9WA 3W1NA 4BI7A 1ZFJA 3GYCA 2QV5A 1RPKA 1ONWA 4DJDD 4QRNA 1EO5A 4MB5A 4ZB2A 3S42A 1VJZA 4PTNA 4DBEA 4EAMA 4HVXA 1XIHA 1K02A 3KWSA 3PZQA 2BLEA 7REQB 5DN1A 3W1RA 4GH3A 1TJRA 3DAQA 3UCCA 1WX0A 3E0FA 4AX7A 1LT7A 3OYZA 3NZQA 3T6CA 1QNPA 4AWUA 1XRVA 5G1MA 1A3WA 5FCZA 4PULA 3LHUA 2BOGX 4FOUA 2XISA 3NCOA 1MXGA 2RJHA 3ZWTA 1XF0A 2YCKX 1XFBA 3PB0A 3R12A 2A7RA 3DI0A 4MTVA 3EX3A 1BLIA 4E0CA 4UFMA 3LDVA 2VURA 4FNPA 5LNSA 5G1TA 4K1WA 3ERPA 5TD4A 4P5UA 3WLSA 4KFPA 4L9XA 4GYPA 3NL3A 3RO6A 1SJDA 2CLMA 2QAFA 4PMXA 2VFHA 4XKYA 3Q65A 1OG0A 1DJGA 1CGYA 2Q09A 3SO7A 3RM9A 1TV7A 4EXQA 1EYWA 4F0KA 1JCTA 3PR2A 4XTDA 3BW2A 1K3UA 2O9RA 3ZS4A 1VBGA 3E2SA 1YHTA 2CKRA 4POCA 3CB8A 3LCGA 3OBAA 1XQLA 5EGRA 2INFA 1WZAA 1W5OA 4Q8OA 2ZTKA 3QY7A 2Z00A 1R87A 3KOYA 2BZNA 4UR7A 5CCZA 1Y7VA 1CXKA 1DJYA 1AW5A 2Q01A 2GSJA 1M03A 5G2WA 3PPFA 5BMWA 3C3UA 4CNSA 2HJPA 1JCMP 3AAMA 3AXHA 2BX7A 2WYSA 1QW9A 3U2CA 1QO2A 3TROA 4DI8A 2BNJA 1V6YA 4I90A 2NVCA 2UBPC 4PGLA 3QMTA 1QFEA 4U5KA 4H83A 3LHVA 2CC0A 1C8XA 1DHKA 4XZ9A 1KW1A 5FACA 2EG6A 4Z0JA 4A4AA 3N6JA 1MVYA 3P67A 5DMNA 4NZJA 1VHNA 4ZENA 3FN9A 4J7RA 3E0VA 1J0HA 3KFTA 4KFNA 2E28A 1P6WA 4CCCA 2VENA 4GGHA 2NQZA 1DJHA 1KM0A 1UUQA 1JNEA 3PP7A 3KP0A 1J0KA 2CWXA 2GOUA 4KKXA 2CITA 4BF9A 3LV6A 3MO7A 3QYSA 3DERA 5TBOA 2HROA 2FMNA 3CMGA 4F0MA 3GB6A 4LYQA 3U0HA 5LYRA 1JR1A 2QUNA 4C91A 3GAYA 2DSUA 2XGBA 5XINA 1PS9A 3TW7A 2I14A 5I3DA 4ZQCA 1KQYA 4LC6A 5BXRA 2ISVA 4KMQA 4C1NB 3KVKA 1K6AA 2Z1SA 1JDFA 4FI4A 1P6BA 3V1PA 1TPB1 4O1AA 2VCBA 5CAHA 1W1VA 3UR8A 4GYJA 2OZ0A 4H9MA 2ZWZA 1FTXA 3WEMA 1J01A 5EFDA 2E40A 3TXVA 1HO4A 3CUFA 3LI0A 2YXXA 2G97A 2REQA 2P10A 4JYDA 3WUFA 4LAZA 4B5VA 2C15A 1CGXA 4DJFC 3BANA 1GOOA 1I9CB 1J0JA 4W86A 4UTTC 2E8YA 4F0SA 3PZIA 3CIWA 4TOQA 1M65A 2BXYA 4DN1A 1HT6A 3G22A 4ZTYA 1JPHA 4XAPA 1S5WA 1W9UA 1GVOA 4INFA 3VNJA 3IAPA 3WQDA 3F4DA 1ZB5A 4G5DA 3OG3A 4FZIA 1SR0A 2GWGA 3GXIA 2VDIA 4LS2A 1FRBA 4W8AA 3A5FA 2KZHA 3NL5A 2B7OA 1UASA 3AUJA 4IL2A 3TSBA 4NZ1A 4O8AA 1XYAA 2B31A 1XRFA 1JD7A 3L5LA 2PTDA 3NO5A 3GYEA 2QCNA 1Z9AA 4R53A 2XDFA 3UA3A 3SUSA 1C9DA 2P3EA 3C86A 3PPCA 4Q33A 4FP1A 5I0DA 4Q4KA 4L5ZA 2XFYA 3OLGA 1N55A 3UNTA 3AROA 3TYEA 5G4EA 2H6RA 1IEQA 4LTSA 1DHPA 4PCNA 3LY0A 1V6WA 3RPMA 4WJEA 4AD4A 4JNYA 5A8OA 2BOFX 1Z44A 3VDHA 2ZVIA 3AICA 2PC4A 3GG7A 3O9NA 2HCVA 1DTUA 4PA8A 4D6IA 4ADUA 2GQ3A 3ZWSA 3PY2A 4ORIA 2P8BA 2DP3A 1TIMA 1FX6A 3SY8A 5FF4A 4EK7A 3BSHA 1CTNA 3WEZA 2FVKA 1PZ2A 4IHCA 3UGVA 5ABFB 1VCFA 4PBFA 1XCXA 1I4NA 3WK2A 1XX1A 1BSLA 4KS0A 1OX4A 4IIEA 3FCPA 4QROA 1AQFA 2HVNA 3B9OA 4IP4A 4QS6A 2ISDA 2I7GA 4O10A 4P7NA 1PZ1A 2ZVRA 3LPPA 1UR1A 3CPUA 3NSXA 2HSAA 1LQ2A 3AYTA 4GI8A 3CO4A 5BU6A 1WCGA 2NQ9A 4LAUA 5IRPA 2YIHA 4ATWA 1Q6FA 1OG6A 4M6UA 1OFAA 4GG9A 4AVOA 1M53A 2E09A 4KFOA 4IMDA 2ZRVA 3WENA 4ZSTA 4R9XA 3PSWA 3ANVA 1HN1A 2ALRA 5EMJA 4IT1A 2HBXA 1K70A 4GVIA 3GU2A 3B8IA 2ZTJA 5DQPA 1JZ6A 2F6KA 1WYIA 4DBSA 4Q8UA 1MUCA 4O54A 2BGQA 4C90A 4MB4A 2WZHA 3Q2DA 3G18A 3NO3A 3PPGA 2WHLA 4WSKA 3DFQA 4KWSA 3GXPA 4LEFA 5C70A 2ZX9A 3VI2A 1KM5A 3TQPA 4TMCA 1EL3A 1H1ZA 3M0KA 3G1XA 5BOOA 4HNLA 1CCWB 1JDEA 1R6WA 3FVMA 3PF3A 1AA1B 3TIMA 5LGZA 3VXGA 3VIMA 3W71A 4Q3MA 3GXDA 3GDTA 2DVXA 1OYAA 2H8XA 4ICCX 3AWNA 5U4NA 3UERA 1WV2A 2WJDA 4JN8A 4FNUA 3MYPA 3NQEA 4Z2LA 2CLHA 3USBA 2VJXA 1RLDA 3EXTA 1NY1A 1UP0A 4H7CA 1E15A 4O19A 4KW2A 4GY7A 1QDSA 4DJFA 1G4PA 1LM1A 4EXBA 1F74A 2ZC1A 5K7JA 3NTYA 5DF0A 1KCKA 3PZMA 3IACA 1PCKA 1DE5A 4HPXA 1X7IA 3E38A 1K7EA 2FJUB 4YWIA 1ZBVA 4RPPA 1U1JA 2R82A 1LOQA 3CWNA 4FALA 2V3FA 1IR2A 3A4XA 4C6JA 2E68A 4L6HA 2WKJA 1PAMA 1Q2RA 4JTRA 3GWQA 4U31A 3PTMA 1RJPA 4QHRA 1EPVA 7TAAA 5AC8A 2OZ3A 4AZ5A 1F9CA 1HKKA 1QI3A 1OGGA 1FWFC 1NF0A 3GTIA 1UBPC 1UD4A 2C3ZA 1OJXA 9XIMA 1KC7A 2Y24A 1ZAIA 4MFEA 3MKKA 5J5RA 2AGKA 3WD3A 1W9DM 4OQVA 3S4TA 1EX1A 2MUCA 2O92A 2A6LA 3LEPA 4D8ZA 1P48A 3RAOA 1KRBC 1SO6A 1KBLA 2Z27A 5I00A 2DZTA 1E9LA 3PJUA 3RLVA 5BOEA 4PMNA 2FPTA 1XLFA 5A6KA 1KLYA 2XINA 4DJED 3KHDA 4IMFA 4CQAA 1BVNP 3GFZA 3S2LA 3LM3A 4DUOA 3IEBA 2LLEA 1K9DA 4TU1A 4CKQA 2Y8UA 4ZVJA 1BYAA 1FWIC 2PZNA 1ZGDA 3TW9A 2HPIA 2VI0A 1N82A 1KO0A 4B5WA 1LP6A 1TA3A 1S3TC 2PLJA 4MSSA 4LUTB 1K4HA 5I3JA 1OCJA 1F76A 2V63A 3APTA 1OT2A 3ZJ8A 1A3HA 4ZBCA 3EB2A 3KLKA 6ALDA 2F38A 3AZSA 3RLHA 3TC7A 1XP3A 3W72A 4A35A 1F6KA 4HMEA 4OBSA 3CEUA 4L6DA 3PWAA 4M51A 2D3LA 2O7SA 1TV4A 1OWQA 3DFHA 3OVRA 1A5CA 1RLCL 4DLMA 3G1DA 1V0MA 3AIUA 5B80A 4P8UA 4FXSA 3DHPA 1DJIA 1V03A 4K36A 1JFHA 3URBA 3QXBA 4JEQA 3B8VA 2CFFA 2J62A 1IQ8A 3EOUA 5LXXA 5KSWA 3AISA 2O0TA 4ZOAA 1J9YA 2JBMA 5HANA 2SFPA 1GYLA 4UCFA 3H24A 2PAJA 1OGSA 4C7DA 1NFBA 3VOFA 4U28A 1UWTA 2BVTA 2VC6A 5HMFA 1MUWA 1U83A 4PTXA 3F7JA 4LV4A 3WL1A 3B8WA 3II1A 4NU7A 1NWSA 4W5ZA 4GNVA 1E6XM 3TSDA 1VEPA 2FVLA 2UWFA 4W85A 5K9XA 1NDVA 1BVZA 4G9PA 3URAA 2WNZA 1OFEA 2GVEA 1EF3A 5FJJA 5AN7A 1PO9A 1ZENA 1OGBA 2ZBTA 1MW0A 3EEZA 1KCZA 3GG8A 4GY0A 4PODA 1J12A 3N04A 3UPMA 4GUFA 4IJBA 4GGBA 1GNXA 3I6TA 5ABGA 2FZBA 2G3MA 2HZGA 3MC5A 3DGRA 2F61A 3APYA 2CBUA 3FA4A 3MT1A 4IWWA 3A12A 2GQ8A 4C6FA 3G5EA 1L9WA 3CASA 2PD9A 4NUWA 4HHHA 1AUSL 1VKFA 3MUZ1 2I9EA 1HXJA 3KAOA 2AL1A 1LUCB 2VXNA 3PNUA 3ITTA 1KB3A 2WHMA 4A8NA 3W7HA 2YR1A 3TWBA 2QULA 3G8RA 3WNKA 4LOCA 2GL5A 3R8HA 3VKDA 5HWJA 4H9YA 2WZEA 1E51A 1ZJHA 2E8ZA 2WSKA 3IJ6A 3LRLA 3VGDA 1KKRA 1R3WA 1X1NA 5CC7A 3STCA 1E6RA 1RXOB 1XRTA 1BQCA 2WMGA 3S1GA 5IFTA 4QJ1A 2AL2B 1GVFA 3M43A 3PG9A 4P61A 8XIAA 1K8ZA 1R7OA 3LMYA 1CPUA 1FWEC 2V82A 3OGVA 3ABXA 1E9IA 1V3MA 2ZZ7A 1TR9A 5C9ZA 2JK2A 3U3HA 3IGXA 3KCLA 2ZADA 3TR2A 3JZEA 3DKLA 2VX5A 2DUZA 1YNPA 4HKPA 2WXDM 2XFRA 4J3SA 4RV3A 3IGSA 3ME3A 4TVCA 4BF5A 4DHGA 4CN1A 1CB7B 1J93A 2P5NA 1KTNA 5DT5A 5C2GA 1RBAA 2DORA 3MMTA 1L8PA 3WF1A 4GKTA 4YU1A 5MF5A 3VNKA 4KGLA 4Q7NA 3H7RA 4GOAA 3SN4A 4PUJA 3I65A 4HU4A 4ILSA 4Q22A 1BAGA 3TV8A 2UY5A 5EBAA 4PB5A 4K37A 4V15A 2PLKA 3EDJA 4TUFA 5F2MA 1W9BM 1PKLA 1A50A 2W5FA 4U3AA 3RM4A 4Y90A 2NW0A 2GQ9A 2PDUA 4Q7BA 3S5ZA 1EEPA 4XKYB 1UIOA 1SZRA 4U5IA 2IXUA 4EAYA 1UR0A 1ODUA 1H11A 4B5SA 2CLIA 1K7FA 1AJ0A 3BQ5A 7A3HA 1E3XA 1VIZA 1CENA 4LCRA 3S8HA 3WLJA 3N25A 4N9CA 1UIPA 4US6A 2FGLA 3S2NA 3I68A 3MI3A 2NX9A 3B9EA 3W6LA 1E9ZB 1UD3A 4GFIA 1XW8A 4IUGA 3IS4A 1EJVC 3GY1A 2YSWA 4PUMA 1CDGA 1BXBA 3WQ6A 1W1YA 1W9VA 1RBLA 3G1SA 1K7XA 4DZIA 1DEDA 1QI5A 2YCLB 3IUDA 4AAJA 2VDGA 3M47A 1K8XA 1QPNA 2GSHA 1YTKA 1Q7MA 5LNRA 3QEZA 3P82A 4YTRA 2Y1HA 4HN8A 4AWSA 3I7SA 1VAHA 1Q7QA 3SUTA 1UR2A 3VIJA 3CL6A 4C6OA 3TYDA 4PMUA 3FEQA 3CLMA 1Q13A 4LYPA 2Y5SA 3LRMA 3KM8A 2W66A 5I06A 1WKYA 3IVTA 1VJIA 1U1UA 3WLKX 4JTTA 1SZEA 4LVDA 2ZRZA 4GQRA 3ZR6A 4FNSA 1IGSA 1AW2A 1HL9A 4HZ7A 3D3FA 4JTDA 3A47A 4QG9A 1E5JA 1FUYA 1DWJM 2PFHA 3SQSA 5GPRA 1QNOA 1GONA 4KRUA 1A5SA 2EO7A 3MU7A 1B54A 3ZVIA 4C6CA 1B90A 2DJLA 1ZCOA 4PMZA 1OK4A 3WIJA 1SFLA 3W1AA 3NQ2A 1T8XA 3M0ZA 1XSIA 1A49A 3M5VA 2TMDA 3BLPX 1IZJA 1IE7C 3VOJA 1NSJA 3S5YA 1JDDA 4BI5A 3AQUA 3RO8A 1HGYA 1MFUA 1NFPA 3VNDA 2WMIA 3U2EA 1XM3A 3LUTA 4M1BA 1W2VA 4UZUA 1SQ7A 2OOFA 4MPQA 5DO8A 4FNTA 5BWAA 4ZMGA 2FTPA 4L4MA 3S2CA 4GIRA 2W9MA 1NU5A 1R3RA 4JX5A 4HA1A 3UJ2A 4BEUA 2PF0A 3CYJA 4C7FA 3MA8A 1UPMB 3U57A 2HPMA 2FMOA 1KD0A 4NX0A 1R7AA 1S1PA 3V75A 3INPA 3HO8A 2P88A 3QQWA 5JBDA 1TMHA 4IQEA 1NQKA 1I1WA 1UZDA 4BA0A 3NQFA 1XUZA 3OIHA 4E3TA 1XLKA 1V6VA 2VO5A 1D9EA 2BB0A 1POKA 3B9AA 3L4UA 3BAKA 4G8TA 4N7QA 5KMYA 4S3DA 1MSSA 4B90A 5KZMA 4FX6M 3L65A 3PZNA 5D4YA 3WEOA 4U33A 1CXFA 3WFLA 5HWNA 2BV9A 2GGJA 4OV4A 2NXHA 2VFGA 3VD9A 1OZQA 3KDNA 3CIXA 3C0LA 4HN4A 4EPKA 2I5QA 2OSXA 1TKKA 4JY8A 4YN5A 4F3HA 1H0GA 4HA4A 5C9RA 4JTCA 1C9WA 2E3ZA 1X8FA 1XGEA 1W37A 1WZLA 5G1YA 1SO3A 1RR2A 1GCYA 1BWVA 2EPLX 1ZTVA 4KEVA 1J96A 1EDQA 1V8EA 3VGFA 2A7PA 4PUWA 4Q4PA 3VZXA 1EJTC 3BOLA 3DI1A 2XPKA 5IHSA 1E3ZA 3KDOA 4UIOA 4MM1A 4MNLA 2Z1WA 1NDYA 3KE0A 1QBBA 1GZJA 1REQA 3CV1A 4P7RA 4YWSA 3RCYA 1YTDA 2NLIA 1PV8A 1K1DA 3FDGA 2D2GA 1ENUA 3W1QA 4HU3A 4N2YA 1LTDA 4UUIA 2VEFA 3B0UX 5J5DA 1D7KA 3G1RA 1W3HA 3ANYA 3E96A 4IXXA 3GZAA 1VGAA 3NYDA 5IM51 1TX0A 3N2CA 2JKEA 1NTHA 2XN2A 4X9SA 5E9XA 2GVGA 3M6YA 2D3NA 1R2TA 2CKSA 4QNWA 2PP0A 1LL6A 3VVGA 4XZWA 3SGZA 3QFEA 1ME9A 4D6HA 4N9EA 3H2EA 4U2YA 2PDXA 1OX4B 2RDTA 3MP3A 3PZUA 4WDWA 4IMAA 4RNFA 4CNPA 1K8CA 1EUNA 3DFPA 2QUVA 1G6CA 1XIFA 2J25A 1HNYA 4S3CA 3UZXA 3O0FA 4GXWA 4ZZ9A 2EKCA 3IV8A 3L23A 1I45A 4LNYA 3KRBA 3OW1A 1TREA 2HS6A 2V6AA 4KESA 5G5IA 4AVNA 1TPFA 1B3WA 4RR4A 2V5BA 1E71M 4GJIA 1GJWA 2DIKA 4K68A 1O5KA 2VL4A 1WZKA 1ZALA 3P5ZA 3N6QA 3HG4A 1P0EA 3PBGA 3L4VA 3BV4A 2OYLA 5CZTA 1FQ0A 1PVNA 4XWUA 3PTQA 5AKQA 2J6XA 1A5MC 1CB2A 3UWZA 1TMQA 1XBYA 3GM8A 3DFNA 3EXRA 4GX9A 2QDHA 3O16A 1O60A 1VQTA 4CQDA 4LU0A 4MGGA 3L2LA 2DT2A 3DYMA 4H8UA 4U2ZA 1P1XA 2VX4A 2NWSA 4GZJA 3UD6A 2I57A 4GO9A 2CCRA 3E02A 2JIWA 3U48A 4KF1A 2GUUA 3R43A 2YZ5A 1V7YA 1A5OC 4DBDA 2GQAA 4HOXA 1XYMA 4UCGA 4LCSA 3W2MA 4AZCA 3N9RA 2JGQA 3ARZA 1J5SA 1V4YA 2UV8G 1FHLA 5CEWA 3H2AA 3FYPA 3UZYA 1H7PA 4WKFA 1O1ZA 1CLVA 1FWWA 2IXVA 3PJWA 1AL8A 3EEGA 3W00A 3SRKA 3DEQA 1JXKA 4GQQA 2HK0A 4D1JA 1NF7A 2V81A 1HZYA 2CZDA 4DJFD 3POCA 4QAWA 5DMYA 5A69A 3C5QA 2EEXA 2ATMA 3M5XA 3SGUA 3GC5A 5I3HA 3M5ZA 1XWYA 1VBRA 3LPGA 4RZBA 3UWUA 3NEVA 2XWEA 5A6AA 4QE4A 2PSNA 4O15A 1P6CA 4GPNA 2QXWA 1W17A 3W2KA 1GW9A 5K4XA 1UR8A 4HP5A 3FJNA 2PDYA 3GXFA 3VMNA 5KETA 1OVDA 2A7NA 3R2GA 2XHYA 3T7VA 2P0IA 3RM8A 4OBRA 5EYWA 5HOSA 3SCVA 1DXEA 2D22A 3QQ0A 1KXHA 1FA2A 4GA8A 3MP4A 2I5IA 1V93A 3L66A 2IQ0A 4O28A 3ENLA 5DEZA 1Q6CA 3ZT6A 4QQUA 1GTEA 5HINA 3NWRA 1KV5A 4O52A 4WX2A 4A3QA 4F9DA 5HJYA 3UBPC 4YMZA 5B7ZA 1R30A 5AYYA 3K8MA 1CXLA 1NWTA 1KCXA 2FPVA 2I1OA 4C6NA 4LB4A 5GNXA 1DQUA 1MXSA 1QWKA 4LBUA 4NYUA 3NL6A 2C18A 3SCNA 1LF1A 1XLIA 1OF8A 3LBCA 4GI6A 2ZQ0A 3U5YA 4E38A 1FP9A 2OOGA 2R1MA 1RALA 5LA0A 1UZ4A 5HNUA 1EWEA 1G4SA 3N4FA 1FCUA 5C7HA 3GBEA 3KZSA 1UH2A 1UR4A 3TKFA 5AFDA 3H2CA 1QU4A 3E2VA 3M6DA 3MKVA 1XC4A 4A6GA 3AZTA 1OC6A 4UTMA 1W9XA 1NJJA 1J79A 4H3DA 1UG6A 3STFA 1C92A 1L8NA 2WNQA 3THQA 3VNZA 2ZE3A 4MWAE 3BAWA 5D2XA 3QJAA 3F4NA 3W82A 3UT0A 3EAUA 3QSTA 3LXAA 4O53A 3WG6A 2WSQA 3HPSA 1YMYA 4S23A 1JYWA 1SZGA 4LY8A 4CNOA 4CU8A 3IIZA 1AVAA 3QY8A 2YXGA 4RDVA 3G0XA 4TTUA 4ATDA 4REQA 4G1KA 4I9TA 4GLEA 3BGGA 1UC4A 2X09A 3LERA 4X9YA 2H9AA 1GQKA 3BW4A 3VX0A 4JNMA 2ZOXA 1UMLA 2FZMA 3S5SA 2Y6ZA 4MUPA 4D6GA 1XD0A 2PWGA 3U7VA 4UXDA 3K30A 2NLYA 4PRTA 1JRBA 2ZXAA 4TX6A 3EPNA 1TVLA 4Y9PA 1T40A 3WY1A 1CNVA 3CBWA 1AODA 2QJGA 2POZA 3P5YA 1QW7A 1XYBA 4R88A 4TX9A 5A6BA 3QW4B 1QOQA 1XHGA 2EJ1A 7ENLA 1Z42A 4OE7A 5F2GA 4Z1BA 1TV3A 1XBZA 4QNEA 1L2UA 1WDWA 1BRLA 5BXPA 1WXZA 1SW3A 2GSEA 4FXFA 4GINA 3B4UA 3HZ3A 2A0NA 5FEWA 4OV9A 2J24A 2WLYA 2WWCA 4FS9A 4MZ1A 1PYFA 3P7YA 1E6ZA 3TYUA 1UHVA 2A5HA 3LTPA 1SMAA 2O4QA 3CLWA 1CECA 1R3QA 4C5YA 1H3GA 1F6YA 2EQDA 5JBFA 1PX3A 4J35A 3BLKA 3MMDA 3P14A 4PSRA 1YX1A 4YVPA 5B7YA 3ARVA 1XIJA 4D6DA 1A0DA 4PFMA 2YA0A 3AHYA 4FXJA 4MKSA 5FEPA 4DLFA 2HMCA 3WELA 5M5DA 4Z0SA 3PZOA 1E70M 1YW1A 2QYGA 3S1VA 4ZQNA 5CLTA 3W83A 2MNRA 1C8VA 1OABA 1PJ9A 4L80A 3AS2A 2J8FA 4PTVA 1YDNA 3WLOA 3N1AA 8TIMA 3GAKA 2OFJA 1TMLA 5AVHA 7CGTA 2ZUTA 4UWMA 4LT9A 3C3NA 4DZ5A 3S2MA 2QUMA 4WDUA 2VQTA 4AIBA 1R9XA 1P0NA 1BD0A 1Q2SA 4MMWA 1GWJA 2YA1A 4HCDA 3TH6A 3LLXA 4NZFA 3BE7A 4BK9A 1GTHA 3AC0A 1LQAA 4NZCA 1Q5MA 3H23A 4PMVA 3U8GA 3ZLFA 9RUBA 3EKGA 2Z2UA 3CAWA 4XSMA 2QS8A 4NXKA 4KRTA 3ES7A 3PZGA 1AFSA 1I0BA 3RCNA 4AISA 3B05A 4P2VA 4M56A 3M9YA 2GJNA 2HNHA 4RW5A 3UWYA 3ZIZA 4WZHA 1B3ZA 2X8RA 3R0DA 1U30A 4NNCA 1QHZA 4BHYA 2ZZ2A 4JQ2A 1WUFA 3BL3A 4UMCA 3WKZA 3RX2A 3K8LA 5LSMA 3W37A 3L12A 2O4MA 3NQ7A 2DQWA 1TPH1 3EGJA 3AOFA 2A1YA 1DORA 1UA3A 4KH2A 3A22A 2J7DA 4CD4A 3CTLA 1CWYA 3O8AA 3IGHX 1NWRA 1VPQA 3NM3A 2ACRA 4ZL1A 3NPXA 3VM7A 5HR7A 2PRHA 3UF9A 4WOQA 1YADA 3Q37A 3SI9A 2RH9A 4RZ5A 4AD5A 5HQLA 5LIUX 4PUUA 2HE5A 3IARA 6TIMA 4DUXA 2GGIA 4Q6JA 3R0KA 1JZ3A 1V77A 1XLHA 5CSSA 2QCEA 2FTYA 2PRLA 4NF7A 4JTUA 4AMCA 3R11A 4NL1A 4IH3A 4HK7A 5HUOA 1SZFA 4JCMA 1HJXA 3FK4A 4CQCA 3W7QA 3QLLA 2GJRA 5HMEA 4MZYA 2E9LA 3A4JA 3GH7A 4H2CA 2Y7GA 1A53A 3MCMA 3EPMA 3NDZA 4IX0A 5FESA 5AZ1A 4PSPA 1EIXA 3QVQA 3BDKA 4MAVA 4IG2A 2B0MA 3SUVA 4PCTA 4BI6A 2G41A 3P2VA 3P84A 1IT7A 3SIMA 3T2QA 4N9BA 3ITVA 1YXYA 3CTTA 3C8NA 3LCWA 2NV1A 1MEHA 4HHMA 4LUIA 3KTCA 3PG8A 4ZEPA 3BOXA 5CGMA 4M8UA 3LK6A 4AC1X 4JIQA 2FDMA 4GZ7A 1EA9C 2PDCA 3LGGA 5I77A 2VEGA 2AOSA 2V5JA 5IHRA 4LWWA 4JNZA 1WPCA 2JIEA 3N73A 3UWQA 4BQ3A 2X05A 3ABQA 3DG7A 3VIOA 4GIAA 1HJQA 3VO0A 3GHTA 4IPJA 3MBFA 3ZSSA 1W1PA 3KBNA 2J75A 3PUDA 4D8AA 4FA3A 3FJLA 4HNVA 2X1SA 3BICA 4HCHA 4QCFA 1MXDA 2WW5A 3NYZA 2Y2WA 4ERAA 3A3HA 3GU1A 4Q7IA 3N2OA 2F2KA 3SSJA 3ZR5A 1BHGA 4L1XA 5G4WA 3W25A 1VEMA 1XICA 1ZU8A 4MFDA 4O13A 2KX9A 1V6UA 4EPDC 2C1HA 3ZT7A 1NELA 5IFPA 3VGBA 4JEJA 3OPSA 1UBSA 1G5AA 5FSDC 3CV6A 1MEWA 3OBEA 1QO5A 2XZ9A 4QJ5B 3FGCA 1TYGA 1S1RA 4XG1A 3GNNA 3UG3A 4HNUA 2J47A 3EA1A 2WM1A 5CZ0A 4F0RA 3ZSTA 4LS0A 4JQ3A 1GOMA 3BLLA 2PP3A 4JQ4A 3GXTA 3LXBA 4WD0A 4M0XA 4UTJA 2NQJA 3TQKA 4B3LA 1JVNA 4IM4A 1E6QM 2C14A 1LOLA 4ZQRA 1FCQA 1AQMA 3TTQA 5H8UA 1Q7ZA 4GACA 5H2ZA 2XSXA 4DO5A 2OQHA 4GJ1A 3WDRA 4C6EA 2AAMA 4AC7C 1B3OA 2WAGA 3W26A 5L9FA 5FL0A 1GJUA 2QVNA 2V2HA 3OIXA 2PEVA 2QUTA 4DF1A 1TV5A 1RZMA 1HO1A 2CZ5A 3WQFA 5LKYA 2XGZA 1YYAA 1XJBA 2NV2A 2VZVA 3OYXA 1M3UA 2NUYA 1EDTA 1E1CA 4QJ4B 1DV7A 1VFLA 4MYAA 4B2DA 3CZKA 1UKOA 4A22A 1RUSA 3HQNA 3W24A 1R46A 2BFGA 1US0A 1XG3A 2IPJA 1UC5A 4LUJA 1W5NA 2ACSA 2CU0A 2GOKA 2I16A 1ZRQA 3TNOA 2HTMA 2VC5A 3RILA 1G4EA 1LZOA 4X22A 1VENA 3W3OA 2PGFA 4QR6A 4JTJA 4JQAA 3U2OA 1RK5A 4QDPA 3BAYA 3W7EA 2OYMA 1DPMA 1W32A 4D6FA 2NSXA 3G6MA 1BXCA 1Z48A 4RJEA 1TWWA 2FVMA 1IWBA 3QR1A 2MANA 2WVVA 3EWBX 3R6IA 4FIRA 4M7TA 5F4SA 4X0VA 2VRKA 2EPHA 3GHSA 1XIDA 2Y63A 3LX9A 4LX4A 1IWPA 3AMGA 3FNDA 2RUSA 4UR9A 4Y7EA 3Q94A 3AUOA 2X30A 3CXOA 3MCNA 3K4AA 4RE4A 5LIYX 3ALFA 3WLRA 2V2DA 4F2BA 3TC3A 4C65A 1J4EA 2BS9A 3T8LA 2VC7A 5I3KA 4DELA 4A3HA 3GDLA 3HPXA 1ADOA 5DY2A 2IPFA 1YIXA 2NWRA 4KETA 2E6DA 1M6JA 1WZMA 3IIPA 2J7BA 7PTDA 4Z2IA 4J3UA 4DAIA 5HK4A 1MEIA 3WDJA 3DFSA 1KFEA 1WAWA 3FAWA 4DZAA 5DX7A 5A8NA 3DFTA 3CV2A 1P1MA 2AAAA 1BPLB 3TSMA 4JIEA 4QITA 3QFWA 1AL7A 4MADA 2VRQA 2E9BA 3GR4A 2R91A 4KWOA 1X98A 1XIEA 3MJYA 4U4MA 1XQKA 2X0HA 3RPDA 1GQIA 1PB0A 1YKWA 3Q58A 3G1YA 2WKLA 2R24A 4PZVA 3WF4A 3AJXA 4NKCA 4V33A 4GNKB 1UH3A 4S1FA 3TE9A 1RSCA 3MUCA 3R8GA 4WY0A 2GJXA 3W27A 1VH7A 3MUIA 3KOWA 3WQ5A 3NQBA 2E9MA 4R7JA 2J6VA 3QV9A 3PZVA 4BF7A 2I17A 5JH2A 3RU8X 3TJLA 3K5XA 2V9DA 1E6NA 4LYRA 4F79A 4BQ2A 4MJ4A 3V5OA 4XUGA 1EGVA 3VOCA 3OA5A 5CPOA 2PBGA 3WNMA 1XXXA 4M1RA 4YLWA 1FWCC 2YW3A 3BTNA 4WXZA 1DVJA 3GIQA 5I23A 3R89A 4DJEC 2OU4A 3HQ1A 1AH4A 1UJPA 4DQWA 3FAXA 3VU2A 2JEQA 1TTQA 3W38A 2PRMA 4ZOCA 3M41A 4DXKA 1DQXA 3QKZA 2QKFA 1F4HA 1KKOA 4GQ0A 2G0WA 3AMLA 2F8QA 2F2HA 3O1NA 3R7MA 4DX3A 1QNRA 1VYSX 2CLKA 2WNNA 5E0CA 1HQTA 3IJ7A 2GVJA 2BGSA 2IQDA 3HMCA 1IIHA 2PWUA 1OIFA 1UP2A 2D2OA 4HQVA 2OWXA 3TQVA 3PULA 7ODCA 4JCLA 3VNIA 3DX5A 4Z2KA 2Z2BA 1IXOA 1OM0A 1EIBA 3QC0A 4HOWA 5F1UA 3KL5A 4IIFA 4FHAA 2ALDA 4DPQA 3NFUA 3BC9A 3GD6A 3B0VC 3TA9A 2ZFAA 3G1VA 4TV6A 1WP6A 1XDLA 4GYFA 3BLDA 3HG5A 4A21A 3KP1A 5FAGA 2TYSA 5F4WA 1QTWA 1V3LA 2YFOA 3OHIA 2EPNA 5PTDA 4PUKA 3I3EA 4QE1A 4MY1A 5DBUA 5E93A 3O3RA 1O94A 3PANA 6CGTA 3F2DA 2Q3RA 3ZMRA 1PX8A 2XFWA 3LSCA 4NJHA 3PJXA 4GUHA 2CLFA 5K9DA 8RUCA 3SCUA 1EXPA 1UKTA 2Z28A 4Q32A 4REQB 2J66A 1I2NA 4W5UA 1F5ZA 4A2RA 4QJ3B 1RV8A 5FF7A 2PPGA 2H9AB 3GE7A 3W73A 2YKKA 4NAEA 4AWEA 3SB0A 4ECLA 3IRDA 4HB7A 1A4MA 4KT2A 4EXAA 3W28A 2PMQA 4DEFA 4O18A 2QLYA 1R0MA 3ORWA 1FBAA 2E67A 2HS8A 4WEVX 3W75A 3NPUA 3MVIA 1D2KA 5CAKA 1PUDA 2ATSA 3MHFA 3V35A 5E9AA 1BRLB 2OTDA 5M17A 1YPXA 2OYKA 3UXLA 4JY9A 3DKJA 2BVDA 1YQ2A 2DH2A 3CZ8A 1PX4A 1VPYA 3MKCA 4C5ZA 5CG7A 3LBMA 3FKRA 2PDGA 2BY2A 3QMRA 4IGHA 3FY1A 3QZEA 4KEUA 4H01A 3AMDA 3SM0A 2JEPA 3WH9A 5MHBA 3E1F1 3T4WA 1B4KA 4PUNA 1Q8AA 4UNLA 2WSPA 4Q8NA 4FLOA 4HIBA 1G94A 1ZPTA 4UTKA 1AH3A 1VS1A 2WKGA 1THFD 3WMBA 3S9YA 2ZCGA 4MLJA 1V0LA 1TG7A 2QZRA 3FEMA 3F4CA 3EMZA 1ISXA 3PM6A 1TZZA 3QMSA 4BZYA 3MHGA 3QPZA 1XLEA 4GYKA 4AZ6A 4ZTXA 1PKNA 2Z1VA 2OKOA 5D2WA 2PU1A 1QXLA 1TTPA 2Y5JA 3QYQA 2FKPA 1GJPA 3A6OA 4I7UA 1LL4A 4O1FA 2W63A 4ORMA 2A85A 4CLMA 5C2XA 1W0MA 3MBDA 3LS9A 1A5AA 4GH1A 4JHMA 2PLCA 2Y5EA 2ZC8A 2OZ8A 4WF7A 1EWDA 5FA5A 2J4GA 6TAAA 3IVUA 1TWIA 2P8CA 4HMDA 4HPNA 4TTGA 4HSHA 4UFIA 2CZVA 1F2JA 1ADSA 3HG3A 3GDKA 4ML9A 1F61A 1XLBA 2V38A 3PBMA 1B57A 3CT7A 1X8CA 2EPOA 1QNQA 4JFUA 5LZLA 2NX1A 2R94A 4GYPC 4KCUA 1LJYA 4NJJA 4JTHA 3CUJA 5I79A 3HOJA 4O1BA 2YPIA 5AYXA 3MSRA 1A47A 3VNMA 3N3MA 5LNWA 3VE9A 1E1FA 4Z1YA 2WSYA 1ITXA 1FVPA 1P5BA 4V1YA 2BTMA 1ICSA 2HEJA 1VIWA 3LPOA 4DB7A 1XLJA 2ESCA 5D2VA 1JAEA 2DV0A 4QSFA 2CBIA 4W89A 2QR6A 3M5YA 3WQVA 2OLHA 3MSDA 4Y9MA 3H53A 1XCWA 1ISVA 4LVBA 4QTGA 3I10A 4D9PA 4RXGA 3S2JA 3DC0A 3UXDA 3L67A 3LV5A 1KXVA 5I09A 2PDQA 4ZO9A 3NPWA 2ZKMX 1IWAA 3G0UA 4O50A 2H3BA 3DHDA 3WQ4A 4OJYA 1O66A 3EPOA 4FR6A 1LBFA 4MPKA 4O0KA 4H8HA 5A6JA 4MLRA 4F66A 3T40A 3PBVA 3IJLA 1M7XA 3QOKA 2G37A 1UQZA 4YYFA 4J9JA 3U6WA 4XAZA 3GBDA 4GFSA 4I8YA 2D69A 2C79A 4DO4A 4M7SA 1ZBCA 6XIMA 4OIFA 5IBXC 4JBRA 1EGZA 1VLIA 1GQNA 4JTEA 2BY1A 3ES8A 1EZWA 5AY7A 2JKPA 3WLHA 4AD1A 3AXMA 3LTYA 4R7OA 2IKJA 3C56A 4Q6XA 5BNKA 1J2WA 3CQIA 4JTAA 1I0DA 3N2MA 3R94A 2Z2AA 3B97A 2XIIA 3NVTA 1H4PA 2FDSA 1MW1A 1UYQA 4BY3A 3VPLA 2E0PA 2X1TA 1JZ5A 2OSYA 2ZX8A 3UCQA 4S2CA 2OPJA 4ZB5A 1SFJA 2PP1A 3L4WA 5RUBA 2CHOA 2V8ZA 3U9IA 3Q4DA 4GBUA 1R3SA 2IPWA 1MI3A 1TCMA 3MQTA 5DMMA 4LALA 5D05A 1UD6A 2NUWA 5E1QA 1JDAA 1R9ZA 2D24A 3A9BA 2J7CA 2WVSA 4HJWA 1EPXA 2QJNA 4BFAA 4KQNA 3WDHA 3TOYA 1HP5A 3T2PA 1V02E 3WUGA 3L21A 1H1NA 1BVWA 1JF5A 3HQOA 1EJUC 4NYYA 2VVNA 5H8PA 3IANA 4UTUA 5C54A 3OTRA 1KXTA 4L1WA 4MWAA 4N0RA 1L0PA 1EJSC 1BYDA 3VA8A 4TXEA 3SUWA 3HMJG 3JW7A 4WKAA 4WCJA 2CYGA 3DIPA 4LUSA 3JVAA 4C6PA 4M80A 4FNRA 4IFRA 3URQA 2JE8A 1G7VA 1LWIA 5JXQA 1IZKA 4GWEA 2YCIX 4I5UA 2QGHA 3IK4A 4WK9A 3WK0A 5BRBA 3EB3A 3N3TA 1OB0A 3M0YA 3QKEA 1DIEA 4I6VA 4Q4SA 2VP8A 2VOMA 4HPJA 3B8TA 2X0YA 3FGCB 4MG4A 3MYOA 3V16A 3DC8A 1AH0A 4EKJA 3W2UA 4HD5A 3KOFA 3CT2A 1S2CA 1F4AA 1L6FA 4I9AA 3DYPA 4PL2A 2Y89A 1YDVA 2CXEA 4BQ4A 2W91A 1EC7A 3UYIA 4ZE4A 2PGWA 1O7AA 2ZYFA 5CC3A 3SCRA 1ZNNA 2D73A 3KS5A 4JD4A 1Q45A 3VKJA 2Y8VA 4LH8A 4JZ5A 4L61A 4IICA 4IZGA 5JUVA 2BXZA 1H7OA 2VZTA 2V2CA 3CC1A 3XINA 4Z2HA 4B4HA 3KCJA 1I8JA 4IMGA 3REQA 1EOKA 1TE6A 1VCGA 3L4YA 1PPIA 5HWMA 3TTSA 4FR1A 5TNVA 1CGVA 1P0DA 1H50A 1JZ2A 1QOPA 3B9NA 4BJHA 3TAKA 2PDJA 2A3BA 1IEIA 3ZJ7A 3CH9A 3PBWA 5LXEA 4OKDA 2EXOA 4PTWA 4JQ1A 1RK6A 2Y8KA 1FWNA 1F8IA 4GQBA 2HK1A 4UFLA 3IK2A 3VD5A 4N42A 4DUWA 1JQVA 2DSZA 2AKMA 2XVGA 1ESWA 3L5MA 3P80A 3TA6A 1XBXA 3ITGA 3LM7A 4XZIA 3VUSA 2XVPA 2CWNA 2DUXA 4HYRA 1S2VA 3NZPA 3N2TA 2CESA 4F9JA 3GVVA 3C61A 4YHEA 3PK7A 1E1CB 3N9SA 1WUEA 4O14A 3NZRA 5CH9A 4WHBA 3TDFA 4FSAA 3OZOA 4Y8FA 3WZ0E 2GK1B 3R1ZA 3WQGA 3P74A 1PCWA 1YBQB 3F03K 1X1OA 2DDXA 3SCQA 1VRXA 3I7RA 2PD5A 5EFFA 1NVMA 5CZKA 1SU5A 3HA1A 6REQB 2NT0A 4JX6A 2VX6A 4PE8A 2AMGA 2F6XA 1FWDC 5CBBA 3WLLA 5IBXA 4HPGA 4B16A 3OQEA 2EKGA 4Q4RA 3WBEA 5A95A 1IXQA 3L7RA 3WLNA 5ECUA 3H26A 4FLRA 4IPIA 4RUBA 3H2OA 3EWUA 4TQTA 4LAMA 3VOIA 3THDA 3UVAA 1H09A 2IKIA 2WVVB 4IQLA 1GOIA 3TN6A 4H1ZA 1XPYA 1FCBA 4GO8A 3B4YA 1B0IA 3TVAA 3MZNA 3WCZA 2QMJA 3VZZA 4DO7A 1Q6OA 4EF8A 3HQPA 4MJZA 2QCCA 4X63A 1R9YA 2GGHA 4IGSA 1H7WA 1POJA 2E77A 4XZNX 5HNTA 1OBAA 2EBNA 4AUBA 1TV8A 4JL1A 3BMWA 3OHMB 3WMCA 3UQNA 4O1DA 4H04A 1NQ6A 2AQOA 4GK8A 1W3KA 3BK0A 2WHJA 2GVYA 5CC6A 3BUVA 2RJGA 2Y4SA 4XD5A 2YBVA 3ATZA 4F40A 3QGVA 4ALDA 1FHDA 3LSBA 1V3HA 2ZXBA 4XX6A 2W79A 4G1NA 2VMFA 3VILA 1JUKA 1AD4A 2OXNA 4MJ2A 1W6TA 3W7CA 2C1GA 4MAZA 4G6CA 4S3JA 1G1YA 1OFDA 2BP1A 1U5VA 1H51A 4AG0A 7REQA 3P60A 4ZE5A 2ZX7A 1KR0A 4FAMA 3M0VA 3VNLA 2DVUA 1UWSA 1QI0A 2RGLA 5HR6A 4PBGA 3IIOA 3W74A 2QDGA 3E6EA 3FX4A 3WLTA 5BW6A 4UOZA 1D8CA 1UH4A 3BLEA 2Z7GA 1BKHA 3ARYA 2AGTA 3SFKA 1MRQA 1E72M 4J40A 2QUUA 4P8VA 4D6EA 1K77A 3GR7A 1A80A 3WYZA 1I75A 1R86A 4CVUA 3RLUA 1SO5A 3A9IA 4GC4A 4WY0B 2XVNA 5DCDA 4XD4A 2VM8A 1Z3NA 4AXKA 1S38A 4ACZB 5F2LA 4NAFA 1VFHA 4W7UA 3LYEA 3BVJA 5CZSA 1G01A 4AMAA 4M81A 1WDPA 5C7VA 2PTXA 3WLPA 4AY1A 4S2BA 4BS0A 3EWXA 1KFBA 2BG5A 3W9ZA 2GGGA 4G56A 2BY0A 3RNDA 4RDYA 3WH8A 1P0BA 5DY3A 1LBLA 1CXIA 4AXNA 3FJ6A 3VC5A 3WQ8A 3HGOA 2D23A 4BKNA 1EHNA 5MKGA 4L56A 1GG0A 3CGTA 2E25A 5FEZA 3TWAA 1EDGA 5HQMA 2YL8A 4A2SA 3NR0A 3KWXA 4DM2A 3CM4A 4AZGA 1V3IA 4TV5A 2I9UA 4Z1AA 4E3VA 1H5YA 1HFBA 1W5MA 4UQDA 1PTAA 2X0SA 1FWJC 2BHZA 1X7FA 4NZ5A 2QT3A 2UZ9A 3FSUA 5D30A 3W7LA 4AD2A 3QC3A 1HX0A 2VWTA 3MDWA 1V6TA 1W2PA 4B92A 1EB3A 3H4GA 2V5KA 3T4CA 2J8GA 3M7SA 3MDUA 1JXJA 2POTA 4YTSA 3TTYA 4MDPA 1M1BA 2J79A 4CCDA 1KTBA 2HISA 3P93A 2AKZA 1AK5A 2FZ8A 1SO4A 3W7NA 1XRSA 3HIJA 3QH2A 4JR5A 2IKHA 2AQWA 4QLLA 1KBJA 1HUVA 4Q4MA 4PCSA 3OO2A 2ISWA 1HP4A 3LZ5A 3UCDA 4L1GA 2RKXA 4Q4OA 3ZT5A 4DBUA 5LIXX 3WH7A 4E6MA 3L0NA 4S39A 2OJPA 3KL3A 3FVDA 4GNJA 3SEPA 4AFYA 4BWLA 2VFEA 4ROPA 2OX4A 3GK0A 5EMUA 3PAOA 1KGUA 4HZMA 4PMDA 2VZUA 4DYJA 3LCHA 4LQ1A 4CUCA 3GZ3A 4C1NA 1PIGA 3CS2A 4K38A 4NAEB 1E0XA 1L6YA 2VZSA 3NSMA 1IEVA 3SRDA 1Q6QA 3OB8A 3O2LA 3O6YX 5E6YA 1KR1A 3DENA 3PUGA 3K4DA 2VELA 4HSOA 3SZ8A 2R6OA 2EGZA 3WJZA 4QGCA 1S2WA 5EBUA 3MSGA 4GVGA 4S3GA 5HMDA 2OZTA 5DELA 3CL7A 2D2HA 3CZEA 3DHUA 1X1ZA 4CEXC 1ITCA 2CXGA 3V5FA 1FH9A 5CQ1A 2BXVA 1QPRA 1R5YA 4WSHA 3I7QA 3VGHA 2G3NA 3HM7A 1EQCA 4MJMA 3KBWA 1DWIM 3T0AA 4K7YA 3CJPA 3ZM8A 3ITLA 2CNCA 3ZYZA 1TZ9A 2OWCA 1VFMA 1I1XA 4AHPA 4GXMA 4W87A 1Q66A 4GIYA 4K7VA 2Y61A 2OX1A 3GR8A 3HBLA 2IW0A 3N2BA 4OECA 1W31A 3GSMA 4JS3A 3TJIA 1K4GA 1XG4A 5FOOA 1XR2A 2QPSA 2DH3A 1XS2A 2FZNA 3FA3A 3KTSA 1KQZA 1SVDA 1OFOA 5A8MA 2FGZA 3CPGA 2RDXA 1JQXA 2FFIA 1TWSA 3Q45A 1KRAC 1QK2A 4EPBC 2VEMA 3H2MA 3BJTA 3ITOA 3SCPA 4GI4A 2QPXA 2Q02A 1Z69A 4NHVA 3SSZA 1J18A 3DCPA 4B5XA 4LVAA 4YJ5A 3AXKA 1ZJIA 3TTEA 5CJNA 5BRPA 1SFSA 2BOEX 2FYMA 3T0DA 4JTKA 2VOTA 1J0IA 5CG0A 2Y62A 3TZNA 3GKFA 1I2QA 2Q71A 2PLMA 1B9ZA 3QV6A 3G8EA 4IP5A 3T0BA 3WX7A 5A5WA 3VDAA 1W9PA 4GZIA 1TPEA 4XO6A 3KXQA 3EOSA 3AYSA 2XGIA 4W84A 5AECA 3COTA 3VDCA 1QAPA 3CUGA 3EBVA 2WJEA 4DVOA 2Z1XA 2NQHA 2WQDA 2XJ7A 4HNOA 4NVTA 3ARXA 2HRWA 5J04A 2PDPA 2ZUMA 3W81A 4U3CA 2WZMA 3BWWA 1TPC1 1P4CA 4Y2WA 3GHUA 1G4TA 3LD5A 3U5UA 5ABFA 3DGBA 4TMBA 1KGWA 4E2OA 3GC4A 3KRZA 4AD3A 4AIEA 1KLZA 3MUY1 5DCBA 2OKTA 1KCLA 3AO0A 3YPIA 2YGYA 2P1FA 4DI9A 2QF8A 4J3WA 3EDDA 3S5NA 3SJNA 3AS3A 3S6OA 1JIBA 4JYFA 2Y0FA 4B9YA 1D3CA 4DYKA 1P43A 4E4UA 1IV8A 3H7VA 1U33A 2QCDB 3UZ5A 3WMSA 3BG3A 1VBUA 3FXYA 4OU1A 3S6DA 1CYGA 1ME7A 2Q8ZA 1N8IA 4OUEA 3EMCA 3MCOA 5HJXA 1M68A 2D0GA 2VRJA 1S3HA 2ZDRA 2DZPA 3BG5A 3E9AA 1W1IE 1E0WA 2YDQA 2XUCA 1F6PA 1W91A 4KIEA 1XYLA 5A1AA 1HJVA 4KCVA 3RXZA 2XIOA 3WLQA 1T6MA 4KPLA 1LG1A 2WSRA 4R27A 3G1AA 5AZ0A 4OOUA 3RK8A 5HNNA 5TAOA 3WNPA 4FOKA 1VYRA 4HJFA 3KVJA 4BQ5A 3PBYA 1F3TA 3M46A 2FB2A 5AHIA 1IT8A 3RX3A 4R9OA 2C6QA 1WE5A 4HA0A 2TPSA 1CEOA 3N15A 3W1PA 2J77A 1EYEA 2VGFA 2WO5A 1H63A 3RUBL 1YRRA 4YTQA 5DBTA 4UNIA 4JTLA 2AMXA 2YDAA 3T0CA 1WDDA 4GD0A 1DTNA 3RN6A 3DZ1A 2ZRWA 5D38A 2GVLA 5GJNA 1DE6A 1AMYA 2WMHA 3FXGA 4XVEA 2NVAA 2PODA 4XAFA 4HNCA 4I7VA 3ECQA 3TR9A 2OVLA 2PS2A 3W0KA 3TP4A 2XH2A 1E0UA 4K39A 4IPNB 2E6FA 1TTIA 3MWCA 2G96A 3KCOA 3S46A 3GNPA 1F7BA 1DXFA 3VCCA 4FB7A 5ABTA 3TCSA 3UR2A 3BGAA 2EG8A 1J6OA 4V2XA 1HG3A 3CWHA 3RR1A 3P62A 5D03A 4CN4A