2W6RA

Crystal structure of an artificial (ba)8-barrel protein designed from identical half barrels
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
233
structure length
223
Chain Sequence
b'MQRVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADKALAASVFMRELKEYLKSGQAVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
publication title High-Resolution Crystal Structure of an Artificial (Betaalpha)(8)-Barrel Protein Designed from Identical Half-Barrels.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 69
structure length 223
sequence length 233
ec nomenclature ec 4.3.2.10: Imidazole glycerol-phosphate synthase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2w6rA00
1JCNA 2YPIA 3E9AA 3LTSA 3DFNA 3M6YA 2P10A 1FWTA 4IJBA 1TSIA 1VR6A 1SZEA 1EA0A 5AC6A 1KFBA 5DCBA 1UUMA 4UFMA 4MZ1A 1BTMA 2CLLA 1VHCA 5LNUA 1FX6A 2X1SA 3QQ1A 3GDLA 2BX7A 4UFIA 1A5SA 2H3BA 3C2VA 5BRBA 5D04C 1YPIA 3R2GA 4JTKA 4PFMA 3M9YA 3O8AA 4AAJA 3DFSA 3L9CA 1QR7A 1ZNNA 4IX2A 3NA8A 2C6QA 4O0ZA 1DQXA 2W0UA 5CGQA 3F1QA 3U8GA 4FNRA 1X8FA 5T26A 4LUIA 1F7BA 1N7KA 2GOUA 3DI1A 3L2IA 4WD0A 3CM4A 3HG4A 4LV9A 1I2RA 4BFAA 1KBIA 3UYCA 1HTIA 2TRSA 3W7GA 1IXQA 5DY3A 3L66A 1SO5A 1GVRA 2E6FA 2J27A 3NPWA 1M6JA 2NUYA 5BNKA 1LOLA 3BGJA 3MI3A 5AN7A 4NNBA 4CLMA 3GZ3A 5E93A 4GUHA 2YFNA 2DZUA 5DCEA 2E5DA 2NUXA 4LU0A 3E02A 3BW3A 1DHPA 1MO0A 3GR8A 3RLUA 2DORA 4IXXA 3W7MA 3EB2A 3DKJA 4AH7A 3PUDA 5EMUA 1BWKA 1YTKA 1OYCA 1H62A 3CEPA 3DHDA 2O7SA 3QEZA 1EUAA 2ZRYA 3AO0A 4IGHA 3R13A 3U6WA 2QUTA 1YXYA 4N6FA 5AHFA 3UWVA 3W86A 2YYUA 3PAJA 3LCIA 1GZGA 4IMFA 3GAKA 3O63A 2WOQA 4UTUA 4RCXA 1BWLA 3B0UX 2R14A 1IXNA 5CPMA 4EOUA 3NNTA 3OG3A 3LXAA 4A2RA 3L0GA 3OIXA 4XBSA 3MP3A 1TTJA 3HO8A 3MBFA 1TRIA 3I65A 4GUJA 5IBXA 2QUVA 3B0PA 2LLEA 2QCDB 3M1ZA 3SSJA 5DCDA 2DU2A 1AW5A 1DJQA 1R30A 3N73A 4Z1CA 2PCQA 2ZBTA 4MFDA 5K4ZA 1Z41A 1AMKA 3BG9A 1Y0EA 2DZPA 4UTJA 2PRLA 1XBVA 5FI8A 3W7DA 4AWSA 4N4QA 3PUEA 1S5VA 4KKXA 5K9CA 1GPWA 1XBYA 1H63A 4K36A 4AXKA 1EUNA 4IPIA 2QR6A 3UD6A 3LB0A 4LC6A 2CZDA 4JX4A 2DP3A 1H60A 4ZQRA 2E5BA 3UZJA 2G5WA 1Z42A 3LHZA 3HGJA 2H8XA 3NQ8A 3HG2A 5BOOA 1XBZA 1KM5A 2H90A 1P4CA 3FIGA 1EX5A 2ZRWA 1OX4A 5MHBA 1RV8A 2FPVA 3TAKA 1TQXA 3LHUA 1KFJA 4O57A 3W7PA 3GXPA 5D37A 1ZCOA 2OCZA 4IX0A 4PTNA 1UB3A 4POCA 4H6KA 1XKYA 4L4LA 4O4WA 2VOMA 3W1UA 1MEHA 3W73A 3VCRA 1SZNA 1LM1A 5I3IA 4JN6A 3GXTA 4GWEA 3M5YA 2X2GA 3HGOA 4HT3A 2VFDA 1N8FA 3K30A 1PCKA 1AW2A 1HL2A 4N9BA 1R2RA 5E1QA 5H2ZA 1WOAA 2WNZA 2FPYA 1VJIA 1JR1A 1RZMA 3T4CA 3PS7A 4ZQMA 4EWND 3Q37A 4UNKA 2ZZ7A 3RU6A 2JK2A 2PRHA 1ZJIA 2YR1A 3DKLA 3W76A 2GQ9A 5G4WA 1I4NA 3B06A 3W22A 4NNCA 5KZDA 3DU0A 1PV8A 2FB3A 3I7QA 4M6PA 4UMCA 4OU1A 2QCGA 4X2RA 2WSQA 3NPUA 4UTTA 5D30A 1G7VA 3KX6A 1VYRA 2ZYFA 5AC7A 3A5VA 3F03K 4DF0A 1PE1A 2ZRUA 3C0JA 2XFWA 3P61A 4BF9A 5FF4A 1K7EA 4JXCA 4JYEA 1SSDA 4OT7A 2G96A 3MYPA 3GB6A 2BLEA 3P5ZA 1JUBA 1GT8A 1DOSA 1EEPA 1AL7A 1OJXA 3OVPA 1LBLA 1YTDA 5HULA 3KVKA 4TMCA 2PC4A 4JS3A 2NXGA 3OHIA 8TIMA 3CQ0A 3TFCA 4IQLA 1KW1A 5LHFA 4O14A 3NL5A 3WK1A 4JYFA 1LRNA 2B0MA 3KAOA 1YTEA 5F2LA 1IXOA 3PB2A 4UIOA 5AYXA 5LGZA 4DEFA 3IIPA 5LHEA 4LV4A 2J9YA 1QPOA 3WK3A 1OK6A 3M0ZA 3W07A 2ZTJA 4JD4A 3EX3A 3C2OA 4PA8A 4Q32A 3LBCA 1LYXA 4FX8A 3VE7A 1H5YA 5F2MA 1NAL1 1K8XA 3VI2A 3RFAA 5U7SA 3EEGA 3HBLA 4MZ8A 1I2PA 1M5WA 4S1FA 4AHOA 2FQIA 2PURA 1XFBA 4O16A 2X1TA 5TBOA 2QCDA 4GXMA 3TR2A 3DFQA 4GNJA 2C18A 2I9EA 4CCCA 3TXZA 1KLYA 2I14A 4GUGA 1OX6A 1AG1O 1K02A 3DI0A 1KM3A 3HQ1A 2VFGA 1GTHA 3W1XA 4OV9A 1KV5A 4NNAA 4WQ6A 4GE8A 4KFNA 1QNVA 3EKZA 2A85A 3WFAA 4MJZA 1YLVA 4YXGA 4WY0B 3GKFA 5AHIA 3IRDA 1AL8A 4NJIA 3HPSA 4QQ3A 2ISVA 5HWNA 5CZSA 1VCVA 2CZEA 5LSMA 3NYZA 3SR7A 1G67A 4O50A 1GOXA 3DFPA 1LOQA 1RQHA 4FIRA 4A29A 1K03A 5DBUA 1H1YA 2Q3OA 3W83A 4AVFA 3QQ0A 3LCXA 5FEZA 4MOZA 3DH7A 3NEVA 1OFEA 3S5OA 3P80A 1WX0A 4GJ1A 2ZZ6A 2X1RA 3IGXA 1FWWA 4X3ZA 3W23A 1YYAA 1FCVA 5G2IA 3HG5A 1A5BA 1VGAA 3CT7A 1EP2A 4OQVA 5CZJA 1TPH1 3T78A 2H6RA 5TIMA 2VEMA 4XZ9A 1SW7A 4O1CA 3R5EA 1JRBA 2VENA 3P60A 1OFDA 4JIPA 1YDNA 5G1YA 5C54A 1NFBA 3KVJA 2C0AA 5D38A 1K3UA 1PHQA 3EWWA 3IGSA 4BWLA 3TJLA 2BZNA 4CCDA 1W31A 1V5XA 3QZEA 3ZR4A 3H54A 5LNVA 3QW3A 4PH6A 2NXHA 1FCQA 1TV8A 1DJNA 5EKYA 1QDSA 4Z08A 3W75A 2VKZG 1AW1A 1W5NA 2EF9A 4FXSA 4ADTA 3W2UA 4LT9A 3W1AA 4CQ9A 4UTWC 1S5WA 5FF7A 3NZ1A 2VFFA 1EP3A 3S1WA 1KM0A 4RJEA 3MHUA 4JX6A 1YXDA 3DFTA 4ZQOA 3OEXA 2QCMA 1L9WA 4YCOA 4JY8A 3W7KA 3W6YA 1XBXA 2EGZA 1H61A 1WBJA 4HKPA 3S1VA 4KWWA 2Q8ZA 5AYYA 1IXPA 1S3HA 3H55A 4NX5A 2Y7DA 5KSWA 2W79A 3W7EA 1ICSA 3GDRA 5KINA 2YDAA 3ZWSA 3B0VC 2HTMA 1KBJA 2DZXA 1LBFA 2ZTKA 3KXQA 1W5OA 3S5ZA 2WPBA 3TXVA 2JKPA 4JIQA 4M7TA 3QSTA 5HR7A 4L4MA 4O53A 1ME9A 2DJLA 4E38A 1SFLA 3UXAA 4MPQA 2CLKA 5EY5A 2E09A 2E5CA 3LCWA 1QMLA 4NUWA 2ZZ2A 5F4WA 5GVJA 3FLUA 3W87A 1ZENA 4JTIA 4MYAA 3WJZA 3BO9A 4AMAA 1Q6QA 5AB3A 1H7WA 3UWYA 1B4KA 1KA9F 2V9DA 3JR2A 2VFHA 3UPBA 3W7JA 3G0UA 2GVGA 3CIXA 1RQEA 3PC0A 3TU9A 4FO4A 1PS9A 2IQTA 3WK0A 4TIMA 4GRSA 3C61A 1B4EA 4IMCA 5DELA 4RKAA 1F74A 1KM1A 1YPFA 3CWNA 3M47A 3M5XA 3PSVA 1GVFA 1NF0A 1QO5A 5J5RA 1ADOA 5AHLA 3FYOA 1XI3A 3W1PA 3ABOA 3FKKA 2CLEA 3CTLA 1T0OA 3SW6A 2OT1A 4LOCA 3F4NA 2YW3A 1MXSA 2NV2A 3CB8A 1QCWA 1F05A 2FIQA 1FXPA 3IVSA 4K37A 2ZA2A 4U4MA 3NAVA 1SR9A 3RLVA 3CLMA 3IIZA 3O06A 3L0NA 1E51A 3BLFA 1EPXA 4JX5A 5DLCA 3STFA 1ZHAA 1KTNA 4Z1AA 3UWZA 3FJ6A 3EWUA 4ADUA 3EXSA 3QMTA 4NJHA 4HNVA 5DN1A 1ZAIA 4GBUA 1NF7A 3GX9A 1SSGA 1WV2A 3GYEA 5CG7A 3QJAA 2C1HA 4K7YA 1TMHA 5EPDA 1P0KA 4LVGA 1M7OA 3EX1A 3LHWA 2G97A 3HOJA 2C13A 1FCBA 1TPDA 1H7XA 1VYPX 2J88A 2QCNA 3LLFA 5HINA 3L65A 4TU1A 2A21A 3UPWA 1WOBA 2QF7A 2WNNA 3P84A 4X9SA 1PHWA 1F73A 4ZVJA 1H7PA 1SO4A 4GUFA 3IIXA 5FF0A 1LTDA 3C3NA 3W2LA 2DZTA 3SGUA 2OJPA 4RR4A 1W54A 2ZA3A 2TPSA 1CX9A 2UV8G 2HMCA 1CW2A 3O1NA 1G7UA 4O12A 4XTDA 5F2IA 1H51A 2FB2A 4X22A 3ABQA 3LRKA 3LOTA 3TA6A 3G22A 1OF8A 5HR6A 4LWWA 3W88A 1LRQA 4N4PA 3V1PA 4N9EA 3BGGA 3UY8A 2V81A 3LXBA 4S2BA 3L5LA 4FXRA 1SQ7A 1W5PA 3B4UA 2XN0A 2QCHA 2J6XA 1G6CA 2FPTA 4UFJA 1IIGA 2EAWA 3W72A 1T8XA 1ALDA 3G1FA 1J2WA 2YFOA 1X1OA 1S5TA 3ZWTA 2CZFA 1GG1A 3CHVA 3W3OA 4XBKA 3LLDA 4AB4A 3B04A 3W1RA 3I6RA 3TKFA 5EBUA 2OMAA 4UTHA 1F6KA 2QUUA 3O6YX 1W37A 3O6DA 1QOQA 3C4UA 5HUOA 1Q6RA 1O4UA 7TIMA 5AC8A 4QNEA 1W1ZA 2V30A 4Y8FA 5A8GA 4LUJA 1VHNA 5CPNA 1KLZA 3STGA 5K9XA 2Q8LA 2WNQA 1L6WA 4TO8A 4O54A 5FESA 5LNRA 3NDOA 3TSBA 3WJWA 4MLJA 1LLWA 3UXDA 1NSJA 2C15A 3A24A 4RZ6A 1U83A 4HSOA 3SI9A 3FJLA 2QCCA 4UR8A 5CZ0A 2VXNA 2ZZ5A 3QF0A 4JDBA 3TSDA 1XCFA 3Q94A 4RXGA 5HWMA 4R7JA 1LZOA 2CLFA 4JYDA 5I3GA 4AF0B 3GR7A 4WUIA 2NX9A 2A2IA 3P62A 3S6DA 3UWQA 1W8SA 1SZGA 4GUIA 5IBXC 3KVMA 2ZFAA 1VYSX 3QH2A 4BK9A 3TMLA 4UNLA 3L67A 3LCLA 4FF7A 4JR5A 5DXYA 3N2MA 4UFLA 4LTSA 3P74A 2TSYA 3WJXA 1H50A 5HQEA 4E0CA 4NX0A 3BW4A 4FNSA 5D2WA 3EWBX 1W5MA 5LNSA 1XXXA 2GVJA 2GJLA 2WSYA 5FEPA 3W7LA 1SU5A 2Y85A 4TR9A 4DO4A 1FDYA 4QIUA 2JGYA 3LV6A 1J5TA 4O15A 2R8WA 3S42A 1KFKA 3KOFA 3UY7A 3W1NA 3NO5A 4WXYA 5I3KA 1G4SA 1SUXA 3BV4A 2Z0IA 2JBMA 3HPZA 2YYTA 4JTJA 1TTPA 3TX9A 3NQ2A 4JDYA 4O10A 3LBMA 1VC4A 4LVBA 4FNPA 1OFRA 1RQBA 1VLIA 4JTTA 3GXNA 1A5CA 1O95A 2C3ZA 2E6AA 2FFCA 3CPRA 3BARA 4BI7A 4P61A 3R89A 4JTLA 3QRHA 3ABSA 1LORA 1JUEA 1LP6A 3DXIA 1M7PA 2A0NA 4RZ5A 4K8HA 5AHMA 5DBTA 3HJZA 2Y7GA 4ZQCA 1OX5A 1JUKA 1L2UA 3DZ1A 2VFEA 2ALDA 2ISWA 5TQLA 4BR1A 2ZA1A 3W7HA 3NQGA 4AWUA 3LHYA 4Y9AA 3WJYA 3G8RA 3DAQA 2TYSA 4QITA 2Y7EA 4O1BA 4UTLA 1GG0A 3A5FA 4ZQPA 1L6YA 5AOUA 5K9DA 2QAFA 3NPVA 4LW7A 1D3GA 2QJGA 2F7FA 3IVTA 3W1TA 4XKYB 3S1XA 1OFAA 3NQCA 1WDWA 3RF9A 3IIVA 4HNTA 3W7NA 2A1YA 5U4NA 4UTTC 1LLZA 1W56A 1F5ZA 4QJ1A 3M16A 1OVDA 4NVTA 1C9DA 3MI6A 1JQXA 5D2YA 1GVOA 5CPOA 2JGQA 3E96A 1UBSA 4YCPA 3NM3A 5CPLA 2Q3RA 5D03A 4MKNA 4I7WA 2QKFA 1ME8A 2ZCGA 5CKSA 3KVLA 3IV3A 4IUOA 3G0XA 4N2YA 4LRTA 2ZRZA 4FNTA 4YL2A 3I7RA 2J9ZA 4NJGA 4MY9A 1UCWA 4IXHA 2RHGA 3OVRA 3NQAA 3NM1A 4J9JA 1DV7A 3W2KA 2CLOA 1A53A 4GFSA 4Z0JA 1TTQA 2V2CA 4A22A 3MUXA 4K39A 1H1ZA 3SIZA 2GQ8A 4LS2A 5EYWA 4OE7A 2A4AA 1Z44A 3KRSA 1FUYA 4EVZA 4UFHA 1EWEA 1P1XA 1JVNA 4UTIA 3R12A 3HMJG 2ZQ0A 2QJHA 3ZS4A 5FEWA 2E77A 4O8RA 2ZDRA 2CLMA 1R47A 3PB0A 4AF0A 1JCXA 1TCDA 3GDTA 2YW4A 1OFBA 3EX6A 3NR0A 1I45A 3LCFA 5BMWA 4K8EA 1WAUA 5HUPA 3G3DA 3MJYA 1A50A 3B03A 2KZHA 4MYXA 3TW7A 1H7NA 4CCEA 4UC5A 5D05A 1H7OA 2DZWA 5AHEA 4C1LA 1ZY9A 1TB3A 1VZWA 3SZ8A 3NL6A 3W7CA 1OYBA 1B3OA 3NQ7A 5AFDA 3AJXA 3H53A 3VNDA 2NZLA 4O13A 1SZFA 1IIHA 3N3MA 5J5DA 3G1SA 3Q58A 4ZQNA 2FLIA 1UJPA 3MBDA 3HB9A 1GVSA 5K4XA 3W2JA 1K8ZA 2H8ZA 1THFD 4FX6M 3S8HA 3BW2A 1ICPA 3LI1A 4WZHA 4Z1DA 1NVMA 3FS2A 4OBTA 1K7FA 5LKYA 1LROA 1R2TA 2AAMA 1WBHA 3G8EA 3G3MA 2B4GA 3N34A 2YX0A 4N9CA 2A6NA 2E68A 4KFPA 5KMYA 3GDMA 1TRDA 4FB7A 3MWAA 5KTLA 3FOKA 1EB3A 1T99A 3LXCA 2ZRXA 3LV5A 1OF6A 2X30A 3UZ5A 1VS1A 3MP5A 4ZL1A 1AK5A 2E1DA 2ZRVA 3P8JA 4O1AA 5G5IA 3N9RA 4RXFA 2I1OA 1EWDA 3NZRA 3C6CA 4FX7A 4OGZA 5ABTA 3G1HA 3G1XA 4HSNA 2A5HA 3GDKA 1HUVA 2VEKA 5C5YA 5E0KA 4GC4A 1GJPA 2W6RA 1KFCA 4O4VA 1PL9A 4ADSA 1D9EA 4MFEA 4BWLC 3LM7A 1SW0A 2RDTA 3L21A 4H3DA 4MUZA 3U2OA 2FJKA 1W3TA 3W9ZA 5C2XA 3PUOA 1KM2A 4FEZA 3RMJA 4KWVA 4HNUA 1QWGA 3EWXA 1G4TA 1OK4A 1GYLA 1LRTA 4NU7A 2B7PA 4TX9A 4E2DA 1G4EA 3IEBA 3GVGA 3SJ3A 5HNRA 1L6SA 5HWJA 3T55A 2ZZ3A 1MEWA 1TPC1 2R91A 2ISSA 4IMEA 3V75A 1XM3A 1T96A 5K7JA 5I3FA 3IVUA 1O5KA 3NVTA 5G2WA 1OABA 3W71A 4I9AA 4QAIA 5DXXA 4MY8A 5IM51 3EXRA 4LNYA 4A21A 3G0SA 4XKYA 4DF2A 3RNDA 4NJKA 1SPQA 1QPQA 4YMZA 1TPWA 3WK2A 4M7SA 1TIMA 2ZZ1A 3TROA 2CWNA 3PG8A 3VE9A 1OX4B 2CLIA 4ML9A 4NZFA 2VC6A 3TFXA 4CQ8A 3KRUA 2G95A 3PBYA 3NQMA 3L5MA 3KHJA 3BG5A 5D2TA 4Q4KA 3TH6A 6TIMA 3TNOA 1YADA 2YGYA 1PVNA 2XN2A 3G1YA 4CNNA 3GNDA 4MZYA 3JRKA 3NL3A 1V7YA 3P7YA 1JCMP 2Y7FA 3NGJA 3O6CA 3CU2A 4O0KA 4C1KA 2FTPA 3NL2A 1TQJA 1OFPA 3P8IA 2QCFA 3A22A 1LBMA 4FNUA 3T44A 3N14A 4WY0A 3QMRA 1YDOA 2OT0A 3LCGA 3TMQA 1D3HA 4MVAA 2QEZA 4IMGA 2AQWA 4ALDA 3F4WA 2QCLA 1GYNA 2GJNA 3FYPA 1DVJA 4LS1A 4HIBA 1DL3A 4AHPA 1P5BA 4O17A 1KTCA 2Z2UA 1J4EA 3KRZA 2NWSA 1DKWA 1FDJA 3NQDA 3LERA 3PBVA 3C2FA 2WJZA 3STEA 4R53A 1WXJA 3GAYA 3LX9A 4ICNA 4WXZA 1XDLA 3W1LA 2RDWA 3GIYA 2A6LA 1ZAHA 2EKCA 3SGZA 3S0CA 1YXCA 4AWTA 2B7NA 1PCWA 4W9TA 3MHGA 4Y6GA 1O5XA 3P5YA 3EX4A 5CSSA 2GVLA 3HGRA 1LDCA 1NEYA 3FA5A 3MYOA 4XTIA 3M44A 2NX1A 1VCGA 5F4XA 1GEQA 3THAA 4DXVA 2V0TA 4R34A 4QSHA 2J24A 1MSSA 1TV7A 4S2CA 1TPFA 1W3NA 1P0NA 1HG3A 3OA3A 3W70A 1ONRA 5LNWA 3G18A 4LVAA 3R8RA 4UFKA 5D09A 1TJPA 3S1UA 1KFEA 4JTFA 4LVFA 2YZRA 1R46A 5L9FA 3EKLA 3GKAA 1JJKA 2NX3A 1Q6OA 3HIJA 4JTHA 3UQNA 2VELA 1WQ5A 2DJXA 5FF2A 3W85A 4XUGA 6ALDA 2H3DA 1Q45A 2YCEA 2B7QA 3N2XA 3PF3A 1QO2A 4DELA 2WQPA 3LHTA 4PCFA 2JKEA 3DBPA 1LCOA 4MIMA 1GVQA 4HPJA 4RV8A 5C6MA 4DO6A 1JRCA 2V5LA 3P82A 3QMSA 4UMBA 1DBTA 1FCUA 3W7RA 3MI2A 5F1VA 1MEIA 4UXDA 3YPIA 5BMXA 4JNMA 4ORMA 2C16A 1UASA 3BK0A 1XDMA 2CW6A 1OG0A 1Q3NA 1FY6A 4R33A 1OHLA 3IGUA 4OHQA 3TC6A 3TQVA 1XUUA 2Z1BA 4K6AA 1PIIA 2CFFA 4K7VA 5A5WA 5KITA 2QCEA 3IIOA 2HS6A 4Z0SA 3TJXA 2NWRA 5F1UA 1TPB1 3SECA 4JY9A 2RH9A 1TYGA 4JTSA 5I3JA 3UWWA 2J9XA 3MP4A 4AEOA 1KM6A 1F6PA 3PBUA 1H7RA 2QJIA 5HMSA 1KM4A 2YSWA 3NQVA 1MZHA 5G2HA 3N9SA 3STCA 3QC3A 4N6EA 2Y6ZA 4UUIA 3FFSA 3QPYA 1XL9A 1ZAJA 3ZFHA 4HNNA 1RPXA 2B7OA 4M6QA 5CZTA 1WA3A 5EA9A 3CIWA 4IOTA 3W84A 5H91A 1OFOA 3MO7A 1QAPA 3B05A 4LC8A 3PY2A 3W1QA 2Y63A 3C56A 3GLCA 2PE4A 1TPUA 4NQ1A 2Y62A 4JTGA 3W1MA 4CQAA 4JGDA 2X1UA 4B5NA 3BVJA 3HG3A 4HN4A 3QYQA 4N02A 3FEMA 4O52A 3LDVA 1C29A 2V2HA 4ZMGA 3WJSA 3CC1A 3M41A 3G1VA 3L5AA 3PR2A 4U28A 2QDHA 2P0OA 4FIQA 2GPTA 1GWJA 2ATMA 5DY2A 2Y89A 2ZZ4A 2F84A 4Y96A 2WV8A 4M6VA 3M5ZA 1TREA 1K7XA 4UR7A 1TO3A 2WO5A 1YDVA 1JCJA 3NQFA 5K2ZA 2C14A 2V82A 1HO1A 5LZLA 3ELFA 5KZMA 4LY8A 1WYIA 1VLWA 3PVFA 3QSRA 3NQEA 1OYAA 3TC7A 5F2GA 4WJEA 4O19A 4YLWA 1RR2A 2VEPA 4NXKA 3LCHA 4EF9A 1VRDA 4ORIA 3PWAA 4E2BA 1K8YA 3TW6A 4PODA 1OFQA 5LGXA 1TPVA 4DPQA 1JULA 1X7FA 3QPZA 4JTUA 3EWYA 3S5YA 3E0IA 3MMTA 3RK8A 3HPXA 5FEXA 3LTYA 3ATZA 1X1ZA 2YXGA 3Q2DA 1JCLA 2O7QA 1KFLA 1F76A 4H4IA 4DF1A 3I68A 1GTEA 1JQVA 2CU0A 5SWUA 5AYZA 1QFEA 3TV8A 1N55A 4M5PA 5G4EA 3LGEA 1GQNA 3G1AA 3GK0A 4ZZ9A 1EP1A 3T40A 4LVDA 3NQ6A 4BI6A 4MY1A 1VPXA 5HJLA 5K3VA 2OX1A 3NXFA 3TAOA 4IPJA 4PL2A 5EL1A 3C8FA 3NOEA 1CI1A 1XC4A 2RKXA 4NT0A 1TTIA 3QM3A 3VKJA 3LHVA 2BSLA 2X16A 3B8DA 3TQKA 2BWGA 3ANYA 4DQWA 1IF2A 4I7VA 2DZVA 4K38A 4PL1A 1I8JA 3D0CA 3OVQA 1HO4A 1DORA 3TUUA 2CZ5A 4HHPA 3T7VA 5F4SA 1ME7A 1ZALA 1KTBA 3MW7A 2HS8A 4LRSA 2P1FA 3W2MA 3UNDA 3SFKA 2Y88A 4NZJA 2D73A 2JKAA 4Y90A 1I2OA 3BLIA 3VFLA 1ML1A 1FXQA 3DENA 3GNNA 1QPNA 3DGRA 4UMAA 3TQ0A 4AHQA 4BI5A 2Z6JA 4JEQA 3W74A 3A23A 4RZ4A 3QFEA 2ABAA 3I7SA 3TSMA 3EX2A 3HGSA 3C2EA 5D2VA 3FKRA 1QPRA 2NV1A 2QAPA 3HF3A 1BKSA 3PBWA 4UTWA 4NJJA 2NUWA 4XQ6A 4MLRA 1FQ0A 4DBEA 4M19A 1A5AA 1SW3A 1RD5A 4FNQA 2E6DA 4Z1BA 3JS3A 1FDZA 1W0MA 3W2NA 4WX2A 2Z6IA 2NXIA 3PG9A 4IMDA 5D02A 3S5NA 1ZFJA 1X6UA 5D2XA 1B57A 4LS0A 1XUZA 2BTMA 2V5BA 3G1DA 2VEIA 3O07A 4WY0F 2EHHA 5BW6A 4A2SA 1VH7A 3W7OA 3DFOA 4WOZA 2FDSA 2OZ0A 4UCGA 1FWNA 3BLEA 1FBAA 1U5JA 3USBA 1TJRA 5G1TA 4EF8A 2DZSA 4DBDA 3M7WA 2WKJA 2BXVA 4O1DA 4A3UA 4O28A 3P81A 1O94A 3M43A 5CSRA 3LTPA 1Q6LA 3PULA 3E49A 3TDFA 1LOSA 3L0KA 5D33A 1O60A 4RX0A 2RDUA 3EXTA 1DQWA 3G24A 2ATSA 2EPHA 4P2VA 3W7QA 3NPXA 4I7UA 1VQTA 4HPXA 4JICA 3MHFA 4DO5A 4N9DA 3TIMA 1G69A 4G1KA 3LRMA 2GUUA 1SO6A 3OBKA 1EIXA 1I2NA 3CWOX 1TV5A 3NG3A 4IWWA 4OV4A 1JCYA 3LI0A 3M5VA 4YWIA 4EIVA 5L6UA 2HSAA 4RK8A 2C19A 3THQA 1B9BA 2PRMA 4O18A 4UTKA 1C8VA 4PC8A 3KFTA 2QDGA 3UWUA 4CNPA 3S9YA 3CEUA 4PEKA 4XWUA 1ICQA 3INPA 3L68A 1VCFA 2Y61A 3TE9A 2XN1A 1FWRA 4FHAA 1I2QA 4WOQA 3C2RA 2CLHA 3A21A 4D2JA 3N19B 3W7IA 2TMDA 4ONVA 4O11A 1BEUA 1SFJA 4CNOA 2GQAA 2VFIA 4RLIA 1HFBA 1KV8A 3PSWA 1F2JA 3DHFA 2E6YA 1TPEA 3TCEA 3O05A 5AHNA 3ABRA 3TK7A 4KFOA 3BG3A 1UUOA 3C52A 4MJMA 2A7PA 4UTMA 3LRLA 3O16A 5FF3A 2NLIA 2RFGA 3PM6A 2AGKA 1W5QA 1SO3A 3BPWA 2WSRA 1W3IA 3O15A 2ABBA 5KZEA 2A7NA 1RVGA 4OWGA 3SY5A 5C55A 4NXSA 3E12A 4DPPA 4QM1A 1FWSA 2R94A 2Y70A 5D32A 2V2DA 1IGSA 1Z48A 3EWZA 1G4PA 1QOPA 5I3HA 4QNWA 1R2SA 2V8ZA 3A9IA 4Q33A 4QISA 3P67A 3ATYA 4JTEA 4TMBA 3QW4B 2A7RA
chains in the Genus database with same CATH superfamily
4ZFMA 3OB8A 3TYZA 1FWTA 2BFGA 3P0XA 4H2CA 5I6SA 2VEFA 1EA0A 5DCBA 1UUMA 5JBFA 4MZ1A 2QULA 1G5AA 3VKAA 3AMKA 3KHDA 3R2GA 3KBWA 3KLLA 3O8AA 5C2CA 3LPFA 1ZNNA 3ARWA 4W7UA 1OB0A 3LZ3A 4QQUA 3S47A 1AD1A 3U8GA 1O68A 4DAFA 2OFJA 4WDTA 4CCZA 1VENA 4GFIA 1F7BA 1N7KA 2BASA 4AVOA 2X8RA 4LAUA 4WD0A 3VC5A 4BFAA 1KBIA 3UYCA 4B3LA 1HTIA 4MWAD 3W7GA 5DY3A 1W1VA 3L66A 1SO5A 3FCPA 3M0KA 1H4PA 5JBEA 1M6JA 2E9MA 3BGJA 2I5IA 4CVUA 2WM0A 3RR1A 3ITXA 3WUEA 4RNFA 3UPMA 2NUXA 4LU0A 1DHPA 3NQBA 1MDLA 2B81A 4IXXA 1E6ZA 3RM9A 1YTKA 1OYCA 4JKLA 4LEQA 4AY8A 2O7SA 1JEZA 3WDRA 5FJIA 4LCRA 3AO0A 4RL3A 1MNSA 1MYRA 3LCIA 4IMFA 3GAKA 1NTHA 3LQGA 3A3XA 1IXNA 3ECQA 1E4LA 2ZXBA 3FV9A 2P3ZA 1O1HA 1LQAA 4FPSA 3LXAA 1GHSA 3MP3A 1XX1A 1LG2A 3UVIA 1KQZA 3MBFA 1TRIA 4UNIA 2VDGA 4LYPA 2XH4A 5IBXA 3GWQA 1A3WA 3MWCA 4PSRA 3M1ZA 3SSJA 1DJQA 1LF1A 2FMOA 1J8VA 4Z1CA 4XD5A 1AMKA 2QQ6A 4CNSA 1S3TC 3H4XA 3LGDA 3A64A 4M8UA 4UTJA 4R27A 2W61A 2XYLA 3WMSA 5K9CA 1GPWA 3LQLA 1UR8A 1EYEA 4HPHA 5TNVA 3HQPA 1N82A 3UD6A 5EMLA 4LC6A 3SCOA 1U1HA 3QOMA 1ZUAX 1BXNA 3EDEA 3SSZA 3WEZA 1H60A 1TVLA 1FVPA 1XYLA 4QE1A 2G5WA 3UZJA 1Z42A 1OT2A 3HGJA 2R1LA 3HG2A 3LPGA 3NQ8A 1G1YA 3U4FA 4B15A 4UZSA 3TAKA 1TQXA 3LHUA 1HF6A 4H6RA 1QI4A 3NZQA 5BWFA 3AALA 3VYLA 1E71M 1ZCOA 3ANVA 1P6BA 2OCZA 4QFUA 3TYAA 1UJQA 4POCA 4O4WA 4JOMA 3AISA 3VM5A 5I3IA 2P53A 4GWEA 1FWAC 3QGVA 1JFHA 1N8FA 3B9EA 2Q8XA 1AW2A 2YB1A 4N9BA 2XGIA 5E1QA 1MXDA 2WNZA 1XRVA 1IR2A 3Q37A 5A8MA 1CGXA 6TAAA 2C1IA 3AS0A 4FOUA 1HVQA 3W22A 3GTHA 1MRQA 4HHMA 4H9YA 3VD9A 5AVNA 4XSMA 1YE6A 1XICA 4H04A 4UMCA 4OU1A 3H2FA 4E3VA 4X2RA 3NPUA 2CBUA 4UTTA 1AQMA 4AIOA 1TWZA 4CEUC 3FHAA 4P5UA 2DIJA 3KX6A 1VYRA 2INFA 3A5VA 1CCWB 3S9IA 1U2YA 1Q8JA 3C0JA 3RG6A 3P61A 1ECQA 4ZOAA 5FF4A 4JXCA 3WQOA 3HU7A 2BLEA 3A3WA 4M0XA 3P5ZA 1EEPA 3L4ZA 3OVPA 1LBLA 3ZQ9A 3KVKA 2HWGA 1W17A 3L4TA 2NXGA 8TIMA 3TFCA 1LL6A 4IQLA 3GR4A 5J8LA 4XZWA 1KRBC 3DYPA 5LGZA 4PRWA 1XV8A 1BGAA 3EX3A 4GNKB 4M56A 5GJPA 3QLLA 4PA8A 7ENLA 4X63A 1LYXA 3PBGA 2Z1KA 4JQAA 3Q67A 3VE7A 3HA1A 1K8XA 4NAEB 4WIWA 1QNOA 5U7SA 3BJFA 4MWAE 4S1FA 4AHOA 4HHHA 4BA0A 4HMDA 2YBVA 1KXHA 2CXGA 2I9EA 4GUGA 1SVDA 1AG1O 1GEHA 5ABHA 1TR9A 1W9XA 4BKNA 2Z1WA 4GZJA 4Q4RA 3EDJA 3L4YA 4H8HA 1YLVA 3DCPA 5AHIA 3IRDA 5CEWA 4IIHA 1AL8A 3OIHA 4CN6A 5CZSA 4D8ZA 3NYZA 1NP2A 4HP5A 4A29A 1K03A 4DZ5A 2Q3OA 3W83A 3QQ0A 1LQ2A 3FEQA 2XH2A 3WH7A 1SMDA 1SYTA 4GJ1A 4DZAA 3IGXA 3AIVA 1HW6A 1XLEA 5I5RA 3VCNA 1IWAA 5G2IA 1A5BA 4IGMA 3CJPA 1EP2A 1MXGA 4OQVA 5CZJA 3N6HA 5GJMA 3T78A 2YA2A 2DH3A 2O9OA 2V63A 1N8WA 1GUVA 1RSCA 4UQAA 1YDNA 4QROA 2Z1XA 5C54A 1NFBA 4XIMA 3QYSA 3EWWA 2Y5SA 5A6AA 2BZNA 5FKYA 1W31A 3RRXA 1CXHA 3ZR4A 4ASTA 1WE5A 3QW3A 1RXOB 1TV8A 4KETA 2J77A 4AZ5A 1AW1A 1XD0A 1M68A 4ADTA 3W2UA 3U2CA 4UTWC 3SURA 1S5WA 5FF7A 4NIRA 2QIIA 3JUGA 3VD4A 3NJ3A 4JX6A 1FFQA 4DY1A 5D4YA 3OEXA 3T09A 2E0PA 4YCOA 3W7KA 3W6YA 3M0VA 4TTGA 3VGFA 4HKPA 4KWWA 2Q8ZA 5AYYA 1XIHA 2D0HA 2W79A 3CYJA 2VO5A 2DIKA 5KINA 6XIMA 3UU0A 3ZWSA 3B0VC 3VOHA 3BOLA 3KXQA 1ZPTA 3EA3A 2WPBA 4JN8A 2JKPA 4JIQA 3WDJA 3QSTA 1K70A 4CUCA 4L4MA 2CETA 5IFTA 3RR4A 2DJLA 3VZYA 3CHCA 4M81A 1DWHM 4MPQA 3OBAA 4F0RA 2E09A 6ENLA 2E5CA 2Q6ZA 3LCWA 4DUOA 4HMNA 3IJQA 1IHIA 4JTIA 2J25A 2V9DA 3S83A 2YCIX 2VFHA 3EOOA 3UPBA 3T1GA 1GOMA 3GC4A 4EXQA 1XYBA 1YW1A 3PC0A 1OADA 3EDFA 4FO4A 3WK0A 1E9YB 3SQLA 1B4EA 4IMCA 3CH9A 4HPGA 5CZKA 4HNOA 1JF6A 2VX5A 4LANA 3CWNA 1HKMA 3C86A 1GVFA 5J5RA 2DT2A 1QUMA 1ZLPA 4NAEA 1QHPA 1A0DA 2CLEA 3FKKA 2OT1A 1JZ4A 5BCAA 2XDFA 3CB8A 2FIQA 1FXPA 3UG4A 4BJHA 1SR9A 3CQHA 3A6OA 1C90A 1EPXA 2FJUB 5DLCA 3TOYA 1GOOA 3MSRA 4CGTA 4B4FA 9XIMA 1J10A 3QMTA 4KWSA 4HNVA 1ISXA 3MVTA 4WKFA 1DJWA 1SSGA 1L6FA 2FMNA 3GYEA 4N42A 5CLTA 3COTA 4A3YA 1P0KA 2CESA 5TAOA 2PTDA 3GVQA 3LHWA 3HOJA 3M0JA 2Z2AA 1V6XA 1TPDA 1VYPX 1DWGM 1UIOA 3L65A 3QHMA 2QDEA 1X6NA 2GOKA 2IKHA 3N29A 4ZVJA 1FP8A 4AY7A 5ABEA 5DMYA 1BTCA 1JDAA 3GHUA 4RR4A 3R94A 1K9TA 4A8RA 2UV8G 2D24A 8XIMA 3KDOA 4IPNB 3E5PA 1H51A 2FB2A 1L6GA 3LRKA 3T2QA 1DJYA 3LOTA 1NY1A 1LRQA 2HISA 4R5EA 3V1PA 3P2VA 2J7CA 3BGGA 3PZNA 2G3MA 4WK9A 1XRTA 2V81A 4LH8A 4F48A 3L5LA 1H0GA 3P6LA 2DW6A 2GJXB 2J6XA 1JZ5A 4UFJA 3P0WA 3W72A 3DG3A 1J2WA 1E5JA 3IGHX 2YFOA 1S5TA 1O5QA 1GNXA 3AZRA 1AFSA 3LLDA 3I6RA 1NDVA 3TJ4A 3RXZA 4H9VA 1W37A 1I60A 4JHMA 3C4UA 5HUOA 3VNYA 2H9AB 2V30A 4LUJA 1VHNA 5K9XA 4AFYA 4LF2A 3HV9A 1A4LA 3R58A 5LNRA 3SCVA 2QUMA 3LN3A 4NRRA 1LLWA 2CHOA 3A24A 4IG2A 3FJLA 5CZ0A 2D3LA 3D46A 1GKPA 2VXNA 3ES8A 2GUYA 1XS2A 4KCWA 1KRAC 2AMXA 1T41A 4CU8A 4R7JA 1LZOA 3VDHA 2PTYA 4HHLA 1EJXC 4ZEPA 3P62A 1OBAA 3UWQA 4B5VA 4YTSA 4GUIA 2BY0A 4BK9A 1DXFA 3TMLA 3AUJA 3L67A 3LCLA 4FF7A 5DXYA 1XIJA 3PNZA 1YMYA 4JIIX 3P74A 3QY7A 5FJTA 4W7VA 3WJXA 1RK6A 5HQEA 4E0CA 1MVYA 2VURA 1QI0A 4FNSA 2QMJA 5D2WA 1A80A 3GTNA 2PD5A 3VGBA 1FH7A 1SU5A 3W7LA 3VKDA 4QIUA 4F4RA 5HATA 4DI9A 3UY7A 1SJAA 3W1NA 3LY0A 4DWSD 1GK8A 5I3KA 1G4SA 4TXEA 1HJWA 5D9MA 3W82A 1NJJA 4IHCA 3ZO9A 3MTWA 4NY2A 4O10A 2OGYA 2OZTA 1XYZA 1VLIA 1C8QA 2QVHA 1A5CA 3MS8A 2FFCA 3TN5A 3KWXA 1MW2A 4I9JA 4BI7A 1DWIM 4P61A 1OT1A 4JTLA 2Y5JA 1HJXA 3W4RA 1LORA 1H49A 1JUEA 3DXIA 3QHOA 1LLOA 3R11A 1M7PA 4J7RA 2PLCA 4DM1A 3HJZA 5E9XA 3DG7A 2X1IA 1XISA 4DJDC 1OX5A 1XJBA 1L2UA 1UA3A 2VFEA 2ZUTA 4LYKA 4FK9A 4BR1A 1E43A 3W7HA 3GQYA 4AWUA 3BJSA 4Y9AA 3T0BA 3OYXA 4P7NA 3OLDA 1TVNA 3DAQA 4QITA 2Y7EA 4HVXA 1TX0A 2F6UA 1BF6A 3DFYA 5AOUA 1XPGA 3BMXA 4R7WA 3TWBA 1NQKA 5EU9A 3S1XA 3NQCA 5I00A 5BXRA 2GJXA 3GHSA 4OECA 3W02A 1H2JA 1S39A 1SJDA 1OVDA 2VD8A 4HNLA 2J8TA 4X2PA 3QV7A 5A8PA 3MC5A 4LBUA 1GVOA 1PYFA 3FW6A 2E7FA 3VILA 3NM3A 1C91A 4I7WA 2DUXA 3N1AA 2G50A 3I3DA 3GH5A 3PTMA 3AZSA 1KBBA 2Z00A 1P6WA 3OYZA 1F3EA 2H9AA 1FHLA 4NJGA 3BURA 4L80A 4MY9A 1R9YA 3MA8A 4QDPA 4J9JA 3W2KA 2WJDA 4Z0JA 2V2CA 2OOGA 2XU2A 4A22A 3MUXA 3RMEA 3N2OA 3R8HA 2GQ8A 5GNZA 2A4AA 3KRSA 5D9PA 1FUYA 2FZMA 1EWEA 2NW0A 4F9DA 2OU4A 2DZAA 2CBJA 4JIRA 5LXEA 4W8AA 1KRMA 3PB0A 1TCDA 1OFBA 3EZ4A 1I45A 3FJ4A 2X0HA 1V51A 3AC0A 4WDUA 1PX3A 5AHEA 1TB3A 3NL6A 3UW6A 2QS8A 1ZJBA 3AJXA 1EL3A 3H53A 5JBDA 3VNDA 2NZLA 1FA2A 3L4UA 4C5ZA 4PE8A 3G1SA 3Q58A 2C79A 2PLKA 3MBDA 3HB9A 1GVSA 5DMMA 1K8ZA 2WLZA 2OZ3A 3MB9A 3BW2A 4GYKA 1JI2A 4OBTA 2VGFA 1R2TA 1UH4A 1WBHA 2B4GA 3BCJA 2GJRA 4D1JA 1A49A 2WANA 4AD4A 4FB7A 2PCEA 1F4AA 1CBGA 1WKFA 4B16A 3LV5A 2X30A 3CQKA 2OKTA 2QJJA 3MP5A 1XYFA 4O1AA 2QV5A 2VR5A 3RHGA 4EPKA 3OGSA 2I56A 3GG7A 2TODA 3G1XA 4HSNA 1DJXA 1HUVA 1WDDA 2DDXA 1PL9A 1D9EA 3LM7A 1FKXA 1SW0A 4H3DA 4MUZA 3U2OA 4P7QA 3TZFA 5C2XA 4FEZA 1KM2A 3RMJA 1XIDA 3EWXA 1OK4A 1GYLA 5AECA 1FRBA 3E2VA 1VEPA 4E2DA 2IUZA 3NCOA 4W5UA 3APGA 5HNRA 1L6SA 2A3CA 5HWJA 2ZZ3A 1MEWA 1TPC1 4M1BA 1A5KC 2GVEA 3WF3A 1QPKA 1T96A 3IVUA 2RGMA 3NVTA 2GL5A 1Q6FA 4CNTA 4QAIA 3F4VA 4PUMA 1ISVA 3EXRA 3J7HA 1XLJA 2R1KA 3AHZA 6REQB 2QW5A 3TTSA 4NJKA 1QPQA 3NXLA 5C9ZA 3R4IA 1TIMA 3AMGA 3TROA 1H5VA 2JF6A 2CLIA 4QBXA 1T6MA 2VC6A 3PZUA 3TFXA 3AXMA 4CQ8A 1T5AA 3NQMA 1JXJA 2OO0A 2D2GA 1XW8A 2PZNA 5D2TA 5HOSA 1EEXA 1UKSA 6TIMA 1ZU8A 3TNOA 3KWSA 3UJRA 4IICA 3W38A 1EC9A 3UEQA 2WCSA 2JIEA 3SCUA 2ON3A 3CV7A 4RE4A 3NGJA 3CU2A 3ZVHB 1OM0A 4LAKA 1BQCA 4B4HA 4K1WA 1DXEA 3A22A 2P8BA 1I0BA 4LAZA 2OG9A 3W01A 3QMRA 1YDOA 2OT0A 2V38A 1EYWA 1D3HA 2QEZA 2AQWA 1VBRA 2WC4A 4AD5A 2WVUA 3F4WA 4MB1A 2QCLA 2PDLA 4HIBA 1DL3A 4AHPA 2WQDA 3VNIA 2BDQA 3KP0A 2Z2UA 3UYIA 1MZRA 4HZ8A 1FDJA 3NQDA 3LERA 3C2FA 2WJZA 3STEA 1V3JA 3LX9A 3VKBA 4HYVA 2D2JA 4DX3A 4WXZA 3GTIA 2RDWA 1UD4A 2EKCA 1S1RA 2QF8A 2XTKA 3M0YA 4IF2A 4W9TA 3OZYA 4QG8A 2GVLA 3HGRA 1LDCA 4DXVA 2V0TA 4R34A 3BOXA 1TV7A 4S2CA 1TPFA 3EGJA 1AH0A 1PPIA 2WMIB 1P0NA 3W70A 1ONRA 1UR0A 5D09A 3GUWA 1GOIA 4LVFA 4M80A 2YZRA 1R46A 1JJKA 1Q6OA 1VFFA 3HIJA 1FHVA 3UQNA 1KGXA 1XIIA 1WQ5A 5EFFA 5FF2A 3PWIA 4XUGA 1JGIA 1Q45A 2WZTA 3N2XA 3OA5A 4PCFA 3LHTA 3VINA 3DBPA 4I5XA 4HPJA 3BL3A 5C6MA 7REQB 1MI3A 3QMSA 1Q2RA 4V1YA 3W7RA 4Z2GA 3CWHA 3MKCA 3BAJA 3AHYA 4ZO8A 4LAOA 1V3HA 1FKWA 5BMXA 5A2CA 2C16A 4ZB5A 1OG0A 3PTDA 1B3XA 4PBEA 4FZIA 4DYKA 5DT7A 4CN4A 4K7VA 4ZOEA 3DEQA 2BVWA 1EJWC 4Z0SA 3VOCA 3WBYA 5F1UA 3RO6A 4JY9A 6A3HA 5I3JA 4I5UA 3UWWA 4QS6A 1H09A 1X6LA 1UMYA 1AJ0A 1QK0A 2UWFA 4LYRA 2QJIA 4UTFA 3QV8A 3I3BA 6REQA 3QC3A 3QLDA 2IKGA 1EKOA 1E0TA 1X7IA 3WMBA 3GZAA 3OTRA 5H91A 3SY8A 3TN6A 2HNHA 3C2YA 4JNZA 3RJYA 1OFOA 2EG6A 1QAPA 3B05A 3RU8X 1E4IA 1TJ1A 3W6MA 4NQ1A 2WZEA 4JTGA 1UD5A 2PUZA 2YOCA 1L2QA 4JGDA 2X1UA 3HG3A 3VMOA 5FSDC 4JQ3A 3H4WA 1XLBA 4O52A 3LDVA 4RDYA 1C7TA 2C7FA 3KRBA 2IPWA 4Z2HA 5I06A 3RGTA 3L5AA 3ZVHA 7PTDA 2QDHA 1W9DM 2GPTA 3UG3A 1UH2A 3F4DA 3GU1A 4FR6A 1UZ1A 3U7VA 1UZHA 4AEEA 3HQNA 1E72M 2WO5A 3O6AA 3PN8A 1EJUC 1YNPA 4HJWA 1W1YA 2EPKX 3AAMA 3IWPA 1Q63A 1UWTA 1TZZA 4P8WA 1VLWA 5JU6A 2HPMA 3PVFA 1YHTA 3F7JA 3NQEA 1OYAA 1V0LA 5F2GA 1HP5A 3V0SA 1IYXA 3LCHA 3PWAA 4AWEA 4LGXA 4HOZA 1TPVA 4DPQA 1TE6A 3EWYA 4B5UA 3MMTA 1NU5A 2V6AA 1XLGA 4IQEA 1S1PA 3W28A 3C0LA 4GH3A 1JCLA 4EACA 1KFLA 1UR1A 1PBGA 3I68A 2VZSA 3RX3A 1E6SM 1KCLA 1N55A 3HTWA 4M5PA 2WMIA 3C5QA 4GQQA 5C9RA 1XHGA 3G1AA 1PXGA 2G3JA 4E3TA 2JEPA 1WZAA 5K3VA 5DFAA 5EL1A 3VIGA 4PCPA 3NOEA 3GSMA 2XGZA 2C0HA 3LHVA 1J0YA 5JH1A 3TQKA 3ANYA 3U5UA 3WSUA 1O1ZA 1R9ZA 3DHPA 2BOFX 2RDXA 4PL1A 4R9XA 3MUZ1 3D0CA 4JCLA 4Q8UA 7REQA 3TUUA 4UQDA 3CS2A 3T7VA 3LA4A 2W5FA 3OODA 4U3AA 2OSYA 1NH6A 1KTBA 1X38A 3UCCA 1JAKA 3SQMA 2WWDA 4DHGA 3FDKA 2JKAA 2YIHA 3CUZA 1JGMA 1FXQA 4GIYA 8A3HA 4DUVA 2NQ5A 4AHQA 4MWAC 4EKJA 2ABAA 2DSVA 4PCSA 5D2VA 2NV1A 2QAPA 2PDWA 2PLJA 3WF1A 2I5GA 2I57A 4LUSB 4UTWA 4XQ6A 1E1CB 5BYWA 1SW3A 3CO8A 4FNQA 1VFUA 4XZBA 4Z1BA 1ODZA 5IDZA 1H41A 4XO6A 2E9LA 4WX2A 3VCCA 3PG9A 1DJHA 2AMGA 1ZFJA 1C3FA 4LS0A 1BAGA 4XZLX 1XH0A 4YYCA 4PFHA 4ENLA 4ERAA 4WY0F 3RILA 4PN2A 2FDSA 4WOZA 2OZ0A 4EF8A 5RUBA 3UG5A 3GXIA 3WQWA 1P0BA 2IKJA 4A3UA 1NFPA 3P81A 3LTPA 4XAFA 3KLKA 1V0NA 3LK6A 1VFHA 3L0KA 1O60A 1DQWA 2BMBA 3OVGA 2NSOA 4I7UA 5B7YA 4HPXA 4JICA 5A94A 3MHFA 3N13A 3K4DA 1C93A 1NOUA 3WNPA 3WLLA 4IWWA 3M5VA 3LI0A 3CL7A 3EYPA 5L6UA 2C19A 3THQA 1B9BA 3KCJA 2OOFA 4GNVA 2DY3A 3O2LA 3CMJA 1JYVA 2GJPA 4IP4A 3W37A 1B5TA 3T81A 4PMQA 3SFWA 4PEKA 5XINA 3C0SA 3HM7A 1VCFA 4PMXA 3A21A 3N19B 1E6RA 1V6TA 3W7IA 2XIMA 4Y9PA 3XIMA 3GUGA 2VFIA 3PSWA 2IW0A 4Z2KA 3TCEA 5AHNA 3IUDA 4D71A 4AQLA 2FTWA 1YIXA 4GKLA 1EJTC 4ZSUA 2NLIA 3H2OA 4GK8A 2QXWA 4WKAA 1SO3A 3BAWA 4H9ZA 1D8WA 2PWGA 2A7NA 3V35A 3SY5A 4HU8A 1Q5MA 1C8XA 1P7TB 1J6OA 2XVPA 2XINA 1Z48A 2DSUA 3IJ9A 4QNWA 2E67A 2VHLA 4NI8A 2QT3A 2TAAA 4TMBA 3QW4B 3GXFA 1JCNA 3KDNA 5M3WA 2IPGA 3KOWA 3CV2A 4XAGA 1VR6A 3FA4A 3MSGA 4MKSA 4FOKA 4XSLA 2CLLA 2PWEA 4UFIA 3GDLA 4Z17A 3C2VA 2XZ7A 4Y8EA 1UR2A 3EBVA 3DFSA 3L9CA 2VQUA 1F3XA 2E4TA 4IIGA 2Z27A 4WSHA 1DQXA 1ITQA 4AC1X 1C92A 2W0UA 3EDKA 3U57A 3MZNA 3GH7A 4IPPA 4UOQA 1Y5WA 4GZ7A 3L12A 1PSCA 4FNRA 2AAAA 4GJJA 2GOUA 1DIKA 1A4MA 2HPIA 1CXLA 4LV9A 3AU2A 4ILSA 4V28A 2TRSA 1IXQA 1E3XA 2FZDA 1M1BA 4LYQA 2J27A 2PP1A 2WHLA 3NPWA 5BNKA 1LOLA 4NNBA 3QR1A 3GZ3A 1LT8A 4GUHA 2DZUA 4W7WA 4Q8OA 4KERA 2FZNA 2GWGA 4OFCA 3EB2A 3AYTA 1UP3A 3PUDA 4HGXA 3MDWA 3U5YA 4EPEC 3CEPA 2NVDA 1EUAA 3T0CA 2QUTA 4N6FA 4YHGA 1GQKA 3WNOA 3WH8A 1UZ4A 1GZGA 4FS9A 2XH7A 1S2VA 1BWLA 5FJUA 2CC0A 1U5HA 4W8BA 1POJA 2X42A 1J11A 2DVXA 1ZB5A 2I17A 4FLOA 4GYFA 1NQ6A 3HO8A 3W6LA 3PWGA 5FOOA 2QCDB 2XIOA 1TVPA 1XGDA 4B9ZA 5DCDA 1HKJA 1RCQA 3N73A 3VZXA 2PCQA 2W92A 2PWDA 4GZIA 2PSNA 4MFDA 2HXUA 5I79A 5EMYA 1Y0EA 4DM2A 2DZPA 4PTDA 1L0PA 2VC9A 4GX8A 4AWSA 4N4QA 1YKWA 1S5VA 3PUEA 2VZVA 3OPSA 1RBAA 1EUNA 4PB3A 2W66A 7CGTA 1E55A 4PUJA 3ZIZA 4ZQRA 2E5BA 3KBNA 4F0KA 2FVMA 4PB5A 3UJSA 3AIEA 1GVYA 1ISZA 3RX2A 4F9JA 3T0TA 3WN6A 5EB8A 3NSNA 1OX4A 5MHBA 2FPVA 4NZ3A 3AI0A 5FAJA 2WVTA 4FAMA 3CZJA 4H8VA 1ZJHA 4O57A 3TTYA 3W7PA 4LF1A 1RD6A 5ABFB 1OEPA 2E1WA 2W4XA 4GPNA 1XFCA 1UB3A 5EMMA 3WF0A 4H6KA 2P50A 4LALA 3TYDA 1MEHA 1SZNA 4LQ1A 1UWAA 4ROPA 1M7XA 3GXTA 4DJDA 2PB1A 1CTNA 4U33A 3K30A 4BF7A 2E28A 5H2ZA 3EDDA 1R2RA 4C6IA 1WOAA 4ZCWA 3E1F1 5E5CA 4GA8A 3T4CA 3PS7A 3WQ5A 4EWND 4OUIA 3OU8A 5CBIA 3WD3A 3OLEA 1ISYA 1VRXA 2VT0A 2PRHA 3NFUA 3AMLA 1X8CA 4RPPA 3FGCA 2C8NA 1EA9C 1PV8A 4M6PA 4M3PA 1TZ7A 2P88A 1W3JA 1SM9A 3MV11 5D30A 1G7VA 3IUIA 3CAKA 3FVMA 3F03K 1TCMA 2ZRUA 3WD4A 4XB3A 1DPMA 4BF9A 4W86A 5HNUA 1MDRA 4OT7A 1SSDA 1EDQA 3MYPA 2A3AA 5ENLA 4S3DA 1OJXA 1SR0A 2V3GA 4GCXA 2GGGA 3OHIA 3CQ0A 3N12A 3FYYA 4I5RA 4O14A 1OG6A 4PUWA 3AYSA 2D23A 2IKIA 4UZUA 4F2BA 1IXOA 4F8XA 5AYXA 3LLXA 4DEFA 3RX4A 3WUBA 2CBVA 2J9YA 3T42A 4DWDA 3WK3A 3T6CA 1OK6A 1PB0A 4DBWA 4YIWA 4FMVA 4IP7A 4Q32A 3LBCA 5C9XA 4FX8A 1WO2A 1I1WA 4KT2A 5F2MA 1ITUA 1GVIA 3SRDA 4FI4A 3EEGA 3DUGA 4MZ8A 3ZXWA 1M5WA 3HMCA 3T8LA 4XD6A 5G1MA 2PURA 4C6QA 1EIBA 1KXTA 3RAOA 2QCDA 1MW0A 1E9IA 5H8PA 4IP5A 1N8IA 1IEIA 4KWUA 4CCCA 3TXZA 3WD2A 4CD8A 1X96A 1KLYA 4CU6A 2GSJA 1K02A 4ZR8A 4HBKA 2VGGA 2VFGA 4JL1A 2YLAA 3CAVA 1KV5A 4NNAA 3IJ7A 3EB3A 1QNVA 3WFAA 4AD1A 3IRSA 3QZAA 4WY0B 4GACA 4NJIA 3HPSA 2ONEA 2WMGA 5HWNA 2NT1A 1G67A 4O50A 2OEMA 1E5NA 4EPBC 2WHKA 2F6XA 5FEZA 3KOZA 4MOZA 4IL2A 4S38A 1ELSA 1OFEA 3RJXA 1FWWA 2O55A 2I16A 2PDHA 4NAFB 1TPH1 2H6RA 3R5EA 5C2GA 1BVWA 2VENA 5ABFA 1PTAA 4JIPA 5G1YA 3R0DA 5CC7A 3S9ZA 1J2BA 3KVJA 1Q65A 3HPAA 2C91A 1PHQA 3IGSA 1V6VA 4GGHA 1V8EA 1RVKA 3A4WA 4CCDA 1V5XA 3VPLA 3RLGA 2IQDA 5LNVA 1HX0A 1FCQA 4QJ4B 1DJNA 1RP9A 5ECUA 5EKYA 4PEEA 1M65A 2EF9A 4B9YA 4A3RA 3GM8A 4LT9A 3NZ1A 3WMLA 1IQ8A 3CO4A 5HJXA 2QCMA 1L9WA 3AWOA 2VR2A 2FHFA 1ZQ5A 3AHTA 4HNCA 1H61A 1AH3A 2CYGA 1LJYA 1IXPA 2YBTA 5KSWA 3QBUA 1WDRA 3GDRA 1U30A 3KL3A 1Z8AA 4PMVA 1XLAA 1LBFA 2ZTKA 5H8MA 5A6BD 3EMZA 1KKRA 4O1FA 3M6DA 2QMKA 4M7TA 4PMDA 2ANUA 4O53A 2J7EA 1WAWA 3W26A 4CU7A 4ZXOA 3DHUA 3QR3A 1VKFA 2J7HA 2CLKA 5EY5A 2OWXA 4RZBA 2BHZA 2ZZ2A 4YTUA 5BZAA 4YPJA 4N7QA 3E6EA 1O6IA 4AMAA 3WQEA 4UR9A 3VMPA 3DIPA 2EG8A 2NVCA 2EEXA 4Q8PA 4YVXA 3W7JA 4DJDD 3WBEA 3QKZA 2V5CA 4LUTB 3OOQA 3TU9A 4MAVA 1PS9A 1J0KA 2IQTA 2OPJA 1VP5A 4GRSA 2PLMA 4KEVA 2ICSA 1KM1A 5KEZA 5DMLA 4M29A 5BOEA 5H6HA 1XI3A 3QC0A 2X0YA 1SMAA 3W1PA 1R7AA 3N2BA 1EGMA 3B8UA 4E6MA 4GIEA 2WMHA 4XZIA 4DWSC 1KO0A 2YW3A 2WAGA 5A2BA 1F05A 1DXIA 1V6WA 4PTMA 1AUSL 1XLMA 2DQWA 3G6LA 3IIZA 3WQ6A 1XC6A 1R3WA 3BLFA 2HE5A 4JX5A 4L7ZA 3STFA 1ZHAA 4GCAA 1CGYA 4WRHA 1QBBA 3CQJA 2YA0A 3ARVA 4H9MA 1J79A 4GBUA 3OBEA 2Y2WA 2C1HA 1TMHA 1QW7A 5EPDA 4LSBA 1M7OA 1UKPA 2G97A 4MB4A 3QY8A 2RJGA 1RY8A 3LLFA 5HINA 1UP0A 2A21A 3UPWA 5XIMA 2YZ5A 4DI8A 4X9SA 2EPMX 3V5CA 3SCNA 2V3FA 3H23A 4I6KA 1H7PA 4GUFA 1WKEA 5FF0A 4NAFA 1LTDA 2QPXA 3E0VA 3C3NA 4FSAA 2OJPA 3GD6A 2ZA3A 1G7UA 4RE2A 3ABQA 3OW1A 3TQPA 4IISA 1QRQA 4NL1A 3W88A 4N4PA 1T7LA 3JW7A 4N9EA 4AXNA 3LXBA 1GKRA 3SGGA 1S2CA 4A6GA 1Q6EA 1E56A 2XN0A 2PTWA 3UJFA 2YBUA 1IIGA 2EAWA 2XJ7A 2HEJA 4FA3A 1BQGA 3W3OA 2PEVA 2VYOA 4XBKA 1CPUA 3TTOA 3B04A 2CHRA 3V5OA 2QUUA 3O6YX 4ZSTA 1UHVA 3O6DA 4D8LA 1Q6RA 4AZBA 1O4UA 2O56A 3WLSA 1W32A 2VZUA 5AC8A 1M01A 4Y9OA 2GUBA 4QNEA 2O4QA 4GOAA 3VUPA 1KLZA 3STGA 4D6GA 1UH3A 2Q8LA 4TO8A 4O54A 4Q8MA 3LBOA 3TSBA 4IIEA 4MLJA 1E9LA 1DJGA 4INFA 3ID7A 1XIFA 4RZ6A 1V0KA 4UR8A 3ZSSA 1JNDA 3QF0A 2CERA 3TSDA 4RXGA 2ACRA 5I3GA 4DNMA 3GR7A 4LUTA 3S6DA 4HJFA 1HKVA 2Z29A 1NELA 1VYSX 2ZE3A 4UNLA 3QTGA 4JR5A 2A3EA 2VRKA 1HXJA 4LTSA 3SN0A 2TSYA 1H50A 4C91A 3TA9A 1XLDA 3EWBX 4XZMX 3CZKA 3SDOA 1XXXA 2WSYA 5FEPA 2Y85A 2J47A 4IFRA 3VKCA 3LV6A 3U0HA 1J5TA 1K6WA 1MQPA 3N2TA 3TLLA 3W0KA 3G6MA 3CQIA 5JH2A 4CEXC 4OOUA 3BV4A 2CZVA 4HMEA 5HK4A 3HPZA 2YYTA 4MTVA 4JTJA 1V03A 1TTPA 2D2OA 3NQ2A 2VX6A 3LBMA 1XG4A 4JTTA 3GXNA 1JZ8A 3BARA 4DLMA 1PZ3A 2NSXA 2JEQA 3CZGA 3MKVA 4GI4A 3ABSA 1LP6A 3WDPP 3RO8A 5IDIA 5AHMA 5DBTA 2AQVA 2BHYA 3TTEA 4IH3A 2PI6A 1W3HA 3HFYA 1W9BM 4GBDA 2X0SA 2VDIA 4XD4A 3WBAA 4DBUA 3BLPX 5A6MA 2ZX8A 2Q71A 2GQ3A 3OQ8A 4F0HA 2QJMA 3PTKA 3NPVA 1WCGA 4LW7A 3CAQA 1J0JA 5HNNA 4RW3A 2F7FA 3IVTA 3W1TA 4XKYB 3OZOA 3B4YA 3NEHA 1EJ7L 2ZWZA 4JEJA 1S2AA 5ECVA 4QAWA 4MWAA 2A1YA 1SJBA 1LLZA 1KXQA 3QGAC 4PR4A 4QJ1A 4BF5A 1L8PA 3M16A 4G9PA 1QK2A 4PYSA 4MF4A 1C9DA 4NVTA 3MI6A 1YRRA 5D2YA 3RUBL 1V6YA 1UBSA 2HCVA 3EB4A 1GOWA 3TTQA 4B91A 2QKFA 4HSHA 3WNKA 1O7AA 1UKOA 2ZCGA 5A6KA 1JF5A 5LXXA 1VJZA 3G0XA 3UF9A 1J01A 4LRTA 1ZJAA 4F0LA 3I7RA 2J9ZA 4YN5A 2PFHA 5AZ0A 4JQ2A 2DSKA 3VMNA 3BLKA 2CLOA 2PP0A 2E9BA 1W91A 2QPUA 1QI2A 4C5YA 2F8QA 4LS2A 4OE7A 4C90A 3IARA 1Z44A 4EVZA 2WWCA 2ZUUA 3TZNA 5EFDA 4IFKB 1Q66A 3R12A 3V7PA 3ZS4A 2QJHA 1FWDC 1FOBA 4EPDC 2CLMA 2YW4A 2IS7A 5BMWA 2KZHA 4L64A 3EPNA 1H7NA 1Q13A 5D05A 5I2UA 3AFBA 1H7OA 2DZWA 1ZY9A 1YDYA 3BAYA 3WLQA 4ZO6A 3H26A 1UWRA 1SZFA 4JPGA 5MF5A 3PZGA 4E8CA 5K4XA 3W2JA 1J0ZA 2H8ZA 3UWEA 2YCKX 1THFD 4YNGA 1ICPA 1XYAA 3LI1A 4GMEA 3VZZA 3FS2A 3GE7A 5DQPA 3IJIA 4YJ5A 4E4FA 3G8EA 3M0IA 2ACSA 3RPTA 4PMNA 3F5KA 4WVXA 4DZHA 4JZ5A 5FJRA 1AZ1A 2D20A 1D7KA 3MWAA 2G8ZA 2IQ0A 5KTLA 3I4EA 3FOKA 1T99A 3A4AA 3LXCA 3TYBA 2C1GA 4ZL1A 1PWLA 2E1DA 3B9OA 2PGRA 1B1YA 1EWDA 2PDYA 3C6CA 4EK7A 1EPVA 1MW1A 3ARSA 4LCSA 1MRAA 2KX9A 3ITLA 2VEKA 2Y1HA 3BAXA 3UBPC 1PKYA 2J8GA 4O4VA 4L4OA 4MFEA 4LX4A 2A3LA 3L21A 1W3TA 4NU7A 2B7PA 1RALA 2J7BA 1S5NA 1G4EA 2OZ8A 4QXIA 2CCRA 3GVGA 3BGAA 5AYBA 3UR5A 4C7DA 3T55A 1JZ6A 2R91A 3V75A 4MNLA 1O5KA 3W71A 2XVGA 5A8OA 1VFTA 3A13A 4QE5A 4MY8A 4IQJA 2I5QA 4LNYA 4A21A 3G0SA 4XKYA 1TWWA 4DB7A 4YHEA 2PF8A 1TUFA 3N15A 4M7SA 2NLYA 2CWNA 4NZFA 3BLDA 3KRUA 3MSYA 3PBYA 1B3YA 1QW9A 1EO7A 4Q4KA 3TH6A 4MM1A 1VEOA 1CB2A 3ZMRA 2YGYA 3KTCA 4CNNA 3GNDA 4HU0A 4AZ6A 4KCVA 4MZYA 3NL3A 3P7YA 5A8NA 1JCMP 1QHOA 3NL2A 4LCQA 1IEQA 2QCFA 4FNUA 2DT3A 3VUSA 1HGWA 3N14A 5C0QA 3B3DA 3K8KA 5D9OA 3BV7A 3LCGA 4MVAA 2WHMA 4IMGA 1U1JA 3FYPA 4LS1A 4PRRA 3PFRA 1P5BA 1M03A 3WIJA 4QG6A 4IFKA 2QHAA 1WZMA 1J4EA 4UQEA 1A5MC 4NSBA 4S3KA 3H70A 1DKWA 5FJJA 2QIWA 1B3ZA 3RDKA 4R53A 1WXJA 4ICNA 3VNLA 1XDLA 3GG0A 1Z89A 2A6LA 4GQ0A 3F2BA 3R79A 5ABGA 4ES4A 2DIEA 4AWTA 2B7NA 4P8UA 4G1NA 2BY1A 3CIVA 1RA0A 6PTDA 1E0XA 4JL2A 4JTCA 4U2ZA 3T05A 2P8CA 1CT5A 1JPMA 3M44A 5F4XA 3THAA 5I78A 3UP8A 1MSSA 3A9BA 3CV1A 3SRKA 1P0EA 1W3NA 1ZBKA 4I90A 3OA3A 5LNWA 4LVAA 4UFKA 4B2DD 3VGHA 4RV3A 1TJPA 2FVKA 2FZ8A 1HJSA 4JTFA 3VDCA 3EKLA 3GKAA 2NX3A 2W67A 4JTHA 1M04A 5LIKX 2DJXA 4W87A 3L23A 4IL0A 1RLCL 3H7RA 2H3DA 2YCEA 3K4AA 1QO2A 2UY4A 2EPLX 2JKEA 1GVQA 3IAQA 4BZYA 1OGSA 2ACUA 4DO6A 2V5LA 2HE8A 4XKMA 2BXZA 3CAWA 3ITYA 2EXOA 3G2GA 1MEIA 4UXDA 3ENLA 3YPIA 3ZYZA 1DWFM 1GVEA 1WB0A 1UASA 1CGWA 2R1MA 1XDMA 1R3RA 1OHLA 3CK5A 1E0UA 1UBPC 3TC6A 3VA8A 1ZS2A 1XUUA 3WD0A 1VAHA 1PIIA 1KRCC 3BC9A 5KITA 4WCJA 4V1XA 3DG6A 3SCQA 3MSDA 3IIOA 2DV0A 3TJXA 2RH9A 1TYGA 4ATLA 3IJ8A 2J9XA 4X60A 4LPCA 3MP4A 4AEOA 2D3NA 3TWAA 4DN1A 3KCOA 5HMSA 1KM4A 1TA3B 3N9SA 3ONCA 3THDA 5EBAA 4B90A 2Y6ZA 1XL9A 1ZAJA 1RPXA 1HIZA 1YNYA 1Q6CA 2WVSA 1RY0A 2OWWA 3FAWA 3FY1A 4R7OA 2Y63A 3GLCA 2PE4A 1TPUA 2Y62A 3UCDA 7ODCA 5HJYA 4CQAA 2WYSA 5FJOA 4B5NA 4US5D 3FEMA 4K1GA 1YEYA 1C29A 2V2HA 3QGKC 3P93A 3CC1A 4GJIA 1QI5A 1DQUA 3PPHA 1MUMA 1GWJA 3WNLA 1TUXA 2ATMA 2VRJA 2F84A 4NG3A 5I7GA 1TO3A 2YKKA 4JFVA 4IIFA 1YDVA 2V67A 1VIZA 5A6LA 2V82A 1BWVA 1HO1A 3FK4A 1H1NA 2XISA 3ELFA 3WLOA 1X97A 5AKQA 4D6HA 4LY8A 1WYIA 3KL0A 2VCAA 1ADDA 1DWAM 3T2PA 4WJEA 4JTQA 4MNJA 4O19A 4YLWA 5C71A 2VEPA 4GISA 2C71A 3STPA 1EQPA 3S2MA 3G77A 3VOIA 1R5YA 4J3TA 2XHYA 2OVLA 4ATWA 1JYXA 1OC6A 1BD0A 2X7VA 4JTUA 3WLRA 1F61A 1PKNA 3S5YA 3URQA 1GJWA 4DWSB 3LTYA 3Q2DA 3BSMA 1K77A 4XUYA 2O7QA 1VPQA 2G4FA 4QEHA 4H4IA 3QN3A 4DF1A 3SCTA 4ZBCA 5C7VA 3EKGA 5SWUA 4R3UA 3WUFA 3TV8A 1TJ0A 3GFXA 8RUCA 5I07A 2V3EA 3LGEA 1EP1A 4F66A 3NQ6A 4BI6A 4MY1A 3KL5A 3NDYA 3WD1A 1VPXA 3LD5A 3PZMA 1OCJA 3C8FA 3B8SA 1ZL1A 1DYSA 1CI1A 3CHFA 4Q4QA 3N4AA 3VKJA 3QM3A 3KP1A 2X16A 5GNXA 1VBJA 2DT0A 3QPEA 3K4WA 2DZVA 1JYNA 3OVQA 1HO4A 5F4SA 1SZRA 3N6JA 3GC2A 3WFLA 4C6JA 1ONWA 1WXZA 1TWIA 2HS8A 3KUMA 1TIWA 1UQYA 2D73A 1I2OA 2FDMA 3AMCA 3UJ2A 4E5TA 1ML1A 2F61A 1V7AA 3GNNA 1EBHA 3DGRA 3FSTA 3K5XA 3VGDA 4S3EA 1CGVA 1UOZA 3TSMA 3HGSA 3C2EA 3FKRA 3SO7A 1QPRA 2WPGA 4S3JA 1PWMA 2PMQA 3PBWA 4NJJA 3KS5A 1D3CA 4M19A 3H22A 1RD5A 3JS3A 4KW2A 3TYUA 3W2NA 1MNZA 1TA3A 3BANA 2Z6IA 3B0YA 2NXIA 1MW3A 5D2XA 2J62A 1TR1A 1XUZA 2BTMA 2V5BA 4LUYA 1GOQA 1A5UA 3O07A 5BW6A 3W7OA 2Z7KA 4C6BA 3DFOA 1JZ2A 1FBAA 3USBA 2WC7A 3NUKA 2WKJA 2BXVA 4O28A 2OGJA 1CZ1A 3E49A 1QATA 3TDFA 3POCA 5D33A 4RX0A 1CGTA 3G24A 2ATSA 2EPHA 3W7QA 4AY1A 3A12A 3PPFA 1RP8A 4FLSA 4N9DA 4Q7BA 4Y9NA 1V02A 4MKVA 3WL1A 4QRNA 2RJHA 2GUUA 1SO6A 3OBKA 3G1RA 1XR2A 1TV5A 1ZGDA 4OV4A 1YE4A 4MDPA 1JCYA 4YWIA 4BY3A 4EIVA 2ZUWA 2HSAA 2PRMA 4GX9A 4EWJA 2CKSA 4O18A 4UTKA 4G7FA 3W29A 4MGGA 2QDGA 3S9YA 2BBFA 1OINA 4ZA0A 3FJNA 1ICQA 3E2QA 3VD3A 1JG9A 2P3EA 3TE9A 2XN1A 4WOQA 5A2AA 1I2QA 2CLHA 4MG4A 4D2JA 1NP0A 4DWSA 3ZVIA 1OY0A 1UOKA 4TX6A 4XIAA 2TMDA 2V5DA 3WMCA 4O11A 4D6JA 3RCYA 1XSKA 2GQAA 3KOYA 4IG2B 4HK7A 1HFBA 3DHFA 2VQTA 3ABRA 4KFOA 3BG3A 1UUOA 3C52A 1A5OC 4MJMA 4UTMA 1SFSA 1QBAA 1EDTA 4D6CA 3BPWA 2PDQA 2WSRA 4KGJA 1W3IA 2Q02A 1RVGA 4NXSA 4LFYA 3C0QA 1DEDA 4DPPA 3F5JA 3VU2A 2Y70A 3SEPA 3K1GA 2V2DA 1EJRC 3EWZA 3WH6A 4MJ2A 5FACA 4AEFA 2NVAA 1BG4A 1R2SA 4RNJA 2V8ZA 4EXBA 4Q33A 3ARTA 1XG3A 2A7RA 4IGSA 3M0HA 3GG1A 2I7GA 2YPIA 3E9AA 3DFNA 3M6YA 1LQ0A 4IJBA 1TSIA 4NZ5A 1SZEA 3VK5A 3B8WA 4UFMA 3MCOA 1VHCA 4W85A 3CZEA 3LPOA 3MMWA 2X1SA 3QQ1A 2BX7A 3VABA 2POTA 1AODA 4M82A 1AQ0A 5BRBA 1KQYA 3M9YA 4U2YA 4WKHA 4AAJA 4BCEA 4K2SA 5I02A 4JKKA 4HZ6A 4ACYA 4KCTA 3NA8A 2PTXA 5CPTA 4O0ZA 4XK2A 5A6TC 2I9UA 2O9TA 3LSBA 2GLKA 2DVTA 2PDUA 1X8FA 4PGLA 5DF0A 4GGBA 4KRTA 3DI1A 1KBKA 4GIRA 4GVGA 3CM4A 1I2RA 5TD4A 5T9CE 4ZODA 3VX0A 4AMCA 3MI3A 5AN7A 4CLMA 1TZ9A 2ZIDA 5E93A 3WQPA 3PZOA 2YFNA 4HPNA 4QG9A 2E5DA 2G3NA 3E02A 1MO0A 3GR8A 2OO6A 3W7MA 3CMFA 4GC3A 3DKJA 4S3GA 4AH7A 1EBGA 3VOGA 1EDGA 1BWKA 1H62A 4H41A 1B31A 3DHDA 3QEZA 2PWHA 3V1HA 3U6WA 1YXYA 4JTAA 3UWVA 3W86A 3PAJA 1CLVA 4GLEA 3ZOAA 2VVNA 2WOQA 4UTUA 4RCXA 3BMVA 3B0UX 1UYQA 4S3CA 2R9RA 4JTRA 3NNTA 4OJYA 3OG3A 3OIXA 4XBSA 1TTJA 4XAPA 1MMFA 3IS4A 5M03A 1VFOA 2VWTA 4BS0A 3I65A 5IOBA 4GUJA 1E1EA 2QUVA 1W2PA 3B0PA 2LLEA 2OX4A 4QJ5B 3GYCA 1U1UA 1QNPA 4A35A 2DU2A 1JZ7A 4HK6A 2X40A 1J6PA 2ZBTA 5K4ZA 1Z41A 4KPLA 3BG9A 5F7UA 3APTA 1OC5A 1XBVA 5FI8A 1B3WA 3VIFA 4ERIA 4KKXA 2OSWA 3P3BA 2WK2A 2HJPA 1XBYA 4KRZA 1H63A 3DYOA 1BKHA 3E2SA 4AXKA 4IPIA 3LB0A 2CZDA 1EF2A 4JX4A 3JZEA 3UZYA 3N6QA 2X41A 4HCLA 1KCXA 3IAPA 5FL1A 2AL1A 3LHZA 4O1EA 2H8XA 3PJTA 3MZ2A 2EO7A 5BOOA 1XBZA 1KM5A 1P4CA 1EX5A 3BQ6A 4MHBA 3KTXA 3KW3A 2ZKMX 1FH9A 3GXPA 1XIGA 5D37A 4DIAA 4IJCA 3FA3A 2VL4A 3IV8A 4IX0A 4PTNA 5M2FX 4JHZA 1Z7AA 3LMYA 2VOMA 1E9ZB 4GXPA 3V5FA 4PMUA 5DX7A 3W73A 1LM1A 2VGBA 1C7SA 1K9FA 4JN6A 3WQFA 3M5YA 3PTQA 2V5JA 4XO7A 5CJNA 4HT3A 3LGGA 2VFDA 1PCKA 4DVOA 1HL2A 2MUCA 3NZGA 3PZTA 4GH1A 2FPYA 1JR1A 1RZMA 1WUEA 3MY9A 2PDCA 4NZ4A 2YR1A 2BXYA 3W76A 1V3IA 5G4WA 1I4NA 4H7CA 1XCWA 5KZDA 3DU0A 1SFTA 2FB3A 3I7QA 4ECLA 2VRQA 3MUY1 2QCGA 4B3ZA 1DIDA 9XIAA 2HBVA 1XLHA 1XP3A 2J6VA 4MNMA 1XLKA 3V36A 4DF0A 1BPLB 1PE1A 3FDGA 4JFUA 2XFWA 1K7EA 4JYEA 1LWHA 3AHXA 4PCTA 1J96A 2FZBA 1GT8A 4J3XA 2Y8UA 1QNRA 1AL7A 1EHAA 3VKKA 3WEMA 2BY2A 1FWJC 2PC4A 3GW0A 3VXGA 1POKA 1KW1A 5LHFA 3UGRA 3WK1A 5IFPA 4JYFA 1LRNA 2B0MA 2WMKA 4J2MA 3PB2A 1B2YA 1XYMA 5LHEA 4LV4A 3CUIA 4TVDA 3W07A 2VCBA 2ZTJA 2GK1A 1RHCA 3FXGA 3VIHA 4L6DA 1E0VA 3SCSA 1NAL1 4NYYA 3VI2A 4LAMA 2F9RA 3RITA 4H9XA 1Y5XA 3ARZA 4YS1A 1I2PA 2FVLA 3E0WA 2R6OA 2X1TA 4O16A 4GXMA 4CD5A 2NQLA 4GY7A 2GDQA 3UJEA 3DFQA 2C18A 2OYMA 3PANA 4G5DA 3UNTA 2I14A 3CZ8A 4ZTXA 1CWYA 4A8LA 1R7OA 2PDGA 2FGLA 2REQA 3MV01 4H83A 1OCQA 4JBRA 3W1XA 5CCZA 4KFNA 4PMZA 4DXXA 3T0AA 4MJZA 4F79A 1W3KA 4HYRA 3OGVA 3WLMA 4QQ3A 4MNKA 2ISVA 5FL0A 1JDDA 5LSMA 2CZEA 3L4WA 1YBQB 3DFPA 1LOQA 2QGHA 4FIRA 3ME3A 4W88A 5DBUA 3LCXA 4D6FA 4Q8NA 3DH7A 3NEVA 1JDEA 1NWSA 2ZXDA 4U5IA 2ZZ6A 1YYAA 5E09A 1FCVA 3CL6A 1EJVC 1VGAA 2OLAA 4XZ9A 3SRHA 1SW7A 1PEZA 2IXVA 4O1CA 3O0KA 1JRBA 3P60A 1OFDA 3KOXA 3POHA 1E6XM 4GQGA 1W9VA 2WJFA 1ODUA 1OQFA 2C0AA 5D38A 1JPKA 4HD5A 2VC7A 4KWOA 3H54A 3OLGA 4KGLA 2NXHA 3BMWA 4KBXA 1GCYA 3G5EA 1EC7A 2G37A 4Z08A 2VKZG 2XFYA 2BGSA 3ZM8A 4CQ9A 1Q85A 2UY2A 2VFFA 3BE7A 4RJEA 4RE0A 3MHUA 1YXDA 1FWFC 3DFTA 4ZQOA 5T91A 4JY8A 1XBXA 1E6PA 1WBJA 3QV6A 3ARUA 2AOSA 3URBA 4DJFD 1ESWA 1GW9A 2Y7DA 2EPOA 3ICJA 3RM4A 1HGYA 3W7EA 1ICSA 3I6TA 2YDAA 4OVXA 2HTMA 5D9NA 2GFTA 1KBJA 2DZXA 1PTDA 1W5OA 2Q09A 2DW7A 4C1NB 4X0NA 4E38A 1CGUA 1AZ2A 2Z24A 1CIUA 1F3WA 1QMLA 3GW3A 4NUWA 3GVWA 5HQMA 3FLUA 3W87A 1ZENA 4MYAA 3WJZA 3BO9A 3BZGA 1FWBC 2J74A 4GI6A 2CHNA 1KA9F 3CUXA 2POZA 5HPOA 3ZLHA 2WSPA 4S23A 3GC5A 1PJ9A 5CSUA 1US0A 2GVGA 3CIXA 1RQEA 3GH4A 3GHRA 1O5RA 4Q8QA 2RGLA 3H2MA 5DELA 3KE0A 1F74A 3ARQA 3AMDA 3TEVA 3D3FA 3M47A 3M5XA 4W4QA 4AZCA 4L56A 5DMNA 1E6QM 3MUIA 2ZUNA 1NM9A 5AHLA 1XD1A 1VF8A 4C65A 1N2VA 2PZ0A 3ABOA 4J4KA 3FSUA 4AG0A 1T0OA 1BYBA 1V4YA 2YXXA 5I09A 1UD8A 1MXSA 1QCWA 3C8NA 3IVSA 2XIIA 2ZA2A 4NRSA 2BOGX 3CLMA 3O06A 3L0NA 3QVQA 3AIBA 4WGHA 3DDMA 4G7EB 5CJMA 2YA1A 3H7VA 4TVUA 3AIRA 1UROA 4H7VA 3VNZA 1DE6A 1NWTA 4NJHA 1BLIA 1XCXA 1ZAIA 3MUAA 3GX9A 3EOLA 2QPSA 5DO8A 5LA2A 5CG7A 3XISA 4GD0A 3WQGA 3XINA 1S2UA 3QTPA 4EE9A 3WNNA 2O0TA 1XRSA 1HJQA 1YBQA 2C13A 4QLKA 3PFMA 1EZWA 2QCNA 1LL4A 1DTUA 2QF7A 2WNNA 3TYEA 5A3HA 3P84A 4DJEC 2A3BA 3WYZA 1K9DA 1SO4A 2XIBA 2EJAA 4W5ZA 4O0QA 3W2LA 2DZTA 2TPSA 1ZSXA 2CBIA 4A4AA 3CXOA 3O1NA 4O12A 4KEZA 4XTDA 5F2IA 3ARPA 3EEZA 2YCJA 3TA6A 1EOMA 4KS0A 5CLWA 5HR6A 4PTWA 4AYGA 1RPKA 1WZKA 4XVEA 3II1A 2HRWA 5CC3A 1MQQA 2BVYA 5LYRA 1SQ7A 1B30A 2QCHA 1ITXA 1G6CA 4ICMA 3APYA 1T8XA 3G1FA 3DESA 1EJSC 2CZFA 4AD0A 3BAIA 4V2XA 4H6QA 3I6EA 4HTBA 1UP2A 3JVAA 3AXIA 3W1RA 5LIXX 3TKFA 2BVDA 3GNPA 5EBUA 4ML4A 1F6KA 1PKLA 1UD2A 1QOQA 2W3ZA 4FXJA 4KQNA 1BSLA 7TIMA 4NF7A 4Y8FA 4U10A 5CPNA 3MPGA 4FOJA 4NZCA 4C1NA 2XFRA 4XD3A 2WNQA 1L6WA 3MANA 2QGYA 5BOFA 4F40A 3UXDA 1Y65A 1NSJA 2C15A 4DUXA 1V08A 2DH2A 4HSOA 4CNUA 3MDUA 3T8QA 2ZZ5A 1FH8A 2R1NA 4NZ1A 4JDBA 2XSXA 3GVVA 1XCFA 4ZE5A 3Q94A 4HA1A 2E40A 4DNHA 4AF0B 1HNYA 1VB9A 2NX9A 4QX4A 2A2IA 1LWJA 1W8SA 4GG9A 4KCUA 3QFWA 3UA4A 2VMFA 4RDWA 3GU2A 5FAGA 4F2UA 4UFLA 3H2EA 2O92A 1I1XA 4E8GA 4QGCA 2BVTA 3ZR6A 4WDXA 4GI8A 4NKCA 3PZVA 5M5DA 5LNSA 2GJLA 2ODOA 2Z2BA 4TR9A 2PP3A 4DO4A 2JGYA 1WUFA 5CGTA 1GQJA 4O15A 3V4BA 2GSEA 3VD5A 2X05A 3OGRA 1IT7A 1R9XA 2E3ZA 4G7EA 4WXYA 4GXWA 5HDRA 5JIPA 3CT2A 2EPNA 3W24A 4QDMA 3TX9A 4HB7A 4JDYA 2QVNA 1VC4A 4LVBA 1UZDA 1RQBA 4BEUA 1JXKA 1O95A 2C3ZA 2E6AA 1KKOA 4F0SA 5HMEA 3E3HA 1XIBA 2BP1A 3FAXA 1I75A 4KEUA 2VWSA 3R89A 3GXDA 2A79A 1CXKA 4C6CA 3IJLA 2X2YA 1E4NA 2A0NA 2CWXA 4RW5A 4RZ5A 3PJUA 2Y7GA 4MMWA 2PDMA 1KWGA 1JUKA 2VTFA 1JIBA 1XQKA 2ALDA 5REQB 1E3ZA 1GPFA 4U3CA 1JL8A 2ISWA 1NDWA 3NOYA 1GYMA 5B7ZA 1EHNA 1VIWA 3NQGA 3GHTA 3WJYA 3CZLA 1OIMA 4C7GA 3O0FA 2TYSA 3N9KA 1DJZA