2W6RA

Crystal structure of an artificial (ba)8-barrel protein designed from identical half barrels
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
233
structure length
223
Chain Sequence
MQRVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADKALAASVFMRELKEYLKSGQAVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structure of an Artificial (Betaalpha)(8)-Barrel Protein Designed from Identical Half-Barrels.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
total genus 69
structure length 223
sequence length 233
ec nomenclature ec 4.3.2.10: Imidazole glycerol-phosphate synthase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2w6rA00
2GUUA 3SY5A 2R91A 3EXRA 3UXAA 3LHYA 4JEQA 2Y6ZA 4NU7A 3LHTA 3UWWA 1IIHA 3SIZA 4PC8A 2YPIA 1SO4A 3E02A 5D30A 4N4PA 4KFNA 4YMZA 1LZOA 4DQWA 1GWJA 3HPZA 3W22A 4K36A 5DXYA 1QFEA 1VYPX 3HF3A 3UWUA 2ZZ3A 3T40A 1OHLA 4UTMA 4N4QA 1GVSA 5FF2A 2NV1A 5HWMA 1T96A 1GVFA 3GDTA 2V82A 2ATSA 3SJ3A 2J6XA 1EX5A 5F2LA 1N7KA 2NUYA 2Y7DA 3R12A 3CIXA 2VXNA 4AAJA 3ZS4A 1KM6A 3A5VA 3DI0A 2Q8ZA 5D2WA 3T55A 4LRTA 4OGZA 1TYGA 4YL2A 4GE8A 1JR1A 4BF9A 4K39A 3IIOA 3S8HA 1VYRA 4E2DA 4QQ3A 5E1QA 4RLIA 4RJEA 3FYPA 1VCVA 3GYEA 3W73A 4MYXA 2QCLA 4A2SA 2EPHA 3BLFA 1HO4A 3T7VA 3G1HA 3G8EA 3I65A 3M44A 2PC4A 4MYAA 2GJNA 1KM2A 3EB2A 4CQAA 1FDZA 3G0SA 4L4MA 2XFWA 5LHFA 4IPJA 3B06A 1GPWA 1YXDA 3S1XA 2QUUA 1P5BA 3M41A 3PULA 2TYSA 4EOUA 3GDLA 3G1AA 3QM3A 1XBZA 4JIPA 5LNSA 1G7VA 2GQAA 3TFCA 2VFHA 3M5YA 2VOMA 3AO0A 3ZFHA 3VKJA 1RQEA 3Q58A 4GWEA 3TMLA 4GUJA 2WSRA 4UFIA 1ME8A 4IX0A 1Q3NA 4RZ4A 1B4EA 4XKYA 4ZQNA 3LCWA 4E38A 3EWWA 1LDCA 1KFBA 3LCXA 1LBLA 4MPQA 3IV3A 3TNOA 1OFOA 5FF7A 2HS6A 2OCZA 4QIUA 4PA8A 3OVQA 5DBTA 3VI2A 3DFNA 1RR2A 3N19B 1A50A 1I2RA 1GT8A 2ABAA 3RLVA 4KWVA 5A8GA 4NNAA 3JRKA 3NNTA 1QO5A 2X1SA 5DY3A 4WQ6A 1TJRA 1SFLA 3RK8A 3N2MA 3DHDA 2DZWA 1XCFA 4ZQRA 3CC1A 1QR7A 4XQ6A 3W75A 5LNWA 3BLIA 2B7PA 4R33A 1EWDA 2W0UA 1M6JA 3PC0A 3NL6A 3LV5A 4IWWA 1KBIA 2P0OA 2Z6JA 5D37A 2UV8G 2C1HA 3M6YA 4FO4A 3W76A 1FQ0A 2NX1A 3PG9A 5CSRA 3LCLA 4UMBA 3KHJA 4IUOA 4LV4A 3NL5A 1W56A 1J5TA 4CNPA 5CGQA 2PE4A 2ZZ7A 5DCBA 4JX4A 2V81A 1VRDA 4EIVA 3MHGA 5BOOA 3W07A 1JULA 5E93A 2VFGA 2NUXA 2ZA2A 4UTJA 4BWLA 1OX6A 5D38A 3P61A 1SZGA 4CCCA 1WXJA 2QCMA 4M6QA 1ADOA 3CB8A 4JTIA 2X2GA 1K8XA 3LHUA 3LERA 3TXVA 5AHLA 2QCHA 1JJKA 4O4VA 4GUHA 3W1XA 3G24A 2EAWA 4MUZA 4DEFA 1WX0A 3QH2A 5K9DA 3H55A 4L4LA 4A29A 2TMDA 5IBXA 1J2WA 5F4XA 3MJYA 1LRQA 3G3MA 2QJIA 4JTGA 4UUIA 4U28A 3S6DA 3E0IA 4QISA 2JK2A 3G1VA 4MY1A 3P74A 2WNQA 1JRCA 4MOZA 1I4NA 4UFJA 3QQ1A 4PEKA 1KLYA 1GG0A 1OG0A 5U4NA 1TTQA 3EWBX 5K4ZA 3ABOA 4UTIA 3W1RA 5AYYA 1TO3A 1UUMA 3HMJG 1Z42A 5MHBA 3LCIA 1JCLA 1WOBA 5U7SA 2A6NA 2CLMA 1X1OA 5K3VA 3W2LA 1AW2A 2EF9A 4OQVA 1HTIA 4WY0A 4O16A 3PAJA 5LKYA 3TR2A 3QQ0A 1OFAA 4S2CA 4BI5A 3O63A 3I7RA 1YDVA 2B7NA 3QC3A 3PM6A 1GVOA 4ML9A 2FTPA 4HPJA 3STGA 3QZEA 2JKPA 4NJHA 3GKAA 3U8GA 2YFNA 4DF2A 2DORA 4WD0A 3F03K 4LS2A 1S5VA 1TJPA 3M5ZA 4UR8A 3P82A 1G67A 3TKFA 5HR7A 4UCGA 1SW3A 2RDWA 5G2HA 5G4WA 2QCFA 3YPIA 3RNDA 3WK1A 2VFDA 4M7TA 1R2SA 2DZSA 1D3GA 2OMAA 3FKKA 5KITA 3MHFA 1SSDA 3P8JA 2QCNA 4N9DA 1BEUA 2J9YA 3UY8A 2FDSA 4AH7A 3GXPA 1JUEA 3W7CA 2VELA 2Y88A 1JCNA 4R53A 3MHUA 4UTTC 3TK7A 3W2NA 3L0NA 4LUJA 1DV7A 4JX5A 1YXYA 3W86A 3N2XA 2YX0A 3CT7A 2D73A 3DKJA 1ICSA 5TBOA 1QPNA 3ZWTA 1G6CA 3NZRA 5LNRA 3P67A 4NNCA 3W1TA 2FLIA 1KLZA 5G2WA 1YYAA 1OYCA 1WDWA 4PH6A 1OX5A 1VR6A 1SFJA 1B3OA 2Y62A 2ZZ4A 2QDGA 2CWNA 3N73A 2QEZA 2ZFAA 3C2OA 3FEMA 4POCA 4WY0B 1T0OA 1W37A 2XN1A 1V7YA 3W9ZA 1LROA 1SW7A 4AHPA 2A7NA 4Y8FA 4FNQA 3THQA 4NT0A 3TAOA 3DGRA 4YCOA 1DORA 4XUGA 1AL8A 3CM4A 1FWNA 1FWTA 3HPSA 5DXXA 1W31A 3S9YA 3MP5A 1G4PA 2VC6A 4GC4A 3GIYA 3QF0A 3C61A 1KTBA 3MUXA 4NJKA 5HWJA 2JKAA 3N3MA 4X22A 2X1UA 4DELA 4K8EA 3HJZA 3M47A 3W2JA 4M6VA 2WNZA 2CLEA 2BTMA 2CLIA 4RV8A 3LX9A 3NEVA 3UD6A 1FWWA 2YCEA 4JDBA 2TPSA 4JTSA 3C3NA 4A3UA 4ADTA 4PTNA 4OE7A 3B05A 1EP3A 2WNNA 2NX9A 5EMUA 4FNUA 3NPVA 1H7XA 2CLKA 4JY9A 4Z0SA 3QSTA 3EXTA 1Q45A 3W7PA 1LOSA 4O13A 2ZRZA 3EXSA 3S5ZA 1FBAA 1DOSA 3WJXA 1VZWA 2J88A 2CZEA 1QPRA 4R7JA 2Y89A 3R89A 1WV2A 1ONRA 4NJJA 3PVFA 1TV5A 1EP1A 1EA0A 4O50A 4EVZA 4HNTA 2WO5A 1Z48A 2V0TA 3T44A 5AHNA 1OJXA 3VCRA 4GUGA 3W2UA 4IMGA 3HO8A 5DCEA 1D9EA 4IPIA 5HWNA 1FX6A 1PVNA 1JVNA 1G69A 1EPXA 2C3ZA 1H1ZA 4RXFA 2OZ0A 4FX7A 2BLEA 3NM3A 1YTKA 4UTWA 5HINA 4UFLA 3B0PA 3GNNA 4D2JA 4QITA 1G4TA 1VC4A 3ABSA 4XWUA 2NXHA 3Q94A 4IMEA 3KVMA 3TMQA 3R13A 1ZNNA 1FWSA 3KXQA 3OVRA 5TIMA 1SZFA 4O1BA 3HQ1A 4UTLA 1YDNA 1W5MA 3TH6A 2X16A 1THFD 5C5YA 4H4IA 1HG3A 4IJBA 4AVFA 4OT7A 2Z1BA 1KFJA 3NA8A 3UY7A 3O16A 4HKPA 1SQ7A 5AC7A 4OWGA 4MZYA 4MLRA 1TTJA 4O28A 5CSSA 1WA3A 1N8FA 5CZTA 5DLCA 4GBUA 3RMJA 1YXCA 5D05A 4FX6M 3W1UA 4K7YA 4N6EA 4HNUA 3G22A 4QNEA 4LWWA 4FHAA 1XUZA 3NQEA 1N55A 1H7OA 4LOCA 3CEUA 2ZA3A 4QAIA 4KKXA 3A22A 3LRLA 1H1YA 2DJXA 3M7WA 1R47A 2Y70A 4UC5A 5C2XA 2V2DA 3QYQA 2ISWA 1WAUA 1KV5A 3L68A 4DBEA 4X9SA 2YXGA 4R34A 4AWTA 3MP3A 4CNNA 3W70A 1F6KA 3GDRA 2BZNA 4XTDA 3OHIA 3PS7A 4O12A 2A7RA 4FNPA 1IXQA 3DAQA 2JGQA 3SGZA 1LCOA 4JYEA 3HG3A 4JTUA 4FEZA 4JTHA 4X2RA 4O0ZA 1F7BA 1LTDA 1TPUA 4AB4A 3W7DA 1W1ZA 4FIRA 4K8HA 5FEWA 3L67A 3BW3A 1DQWA 4K7VA 3CEPA 2C6QA 1M7OA 3O07A 3NGJA 5F1UA 2O7QA 4IMCA 2DZTA 2E5BA 3HGSA 2ZZ2A 3P8IA 4IXHA 2Z6IA 3QMRA 1MO0A 1VCFA 2Y85A 4MJMA 1GG1A 3BV4A 3NQCA 1KA9F 1RQHA 1KM5A 2F7FA 2JKEA 2VFEA 2HSAA 3CTLA 2HMCA 2GQ9A 3JR2A 3PB0A 2R14A 3CQ0A 3M5XA 5CPNA 4DF1A 3FS2A 3UZJA 4UTHA 3W84A 3K30A 2CLFA 3LI0A 3NPUA 4BFAA 3NO5A 1GOXA 4CLMA 4YWIA 4JIQA 3SGUA 3QMSA 4BK9A 1TPFA 5HNRA 4LUIA 1IIGA 4IX2A 1KM1A 2A21A 3NQVA 3PSVA 2E1DA 5HJLA 1Q6LA 1EUAA 4ADUA 1OK4A 1B9BA 3G0XA 3HPXA 3QW3A 5I3HA 4AXKA 2F84A 1J4EA 1ICPA 2VFIA 1GTHA 1NFBA 5FF4A 1VLWA 4PL2A 1TPB1 3QMTA 4A2RA 2DP3A 2O7SA 1HUVA 4MVAA 5CZSA 5KZEA 3UPBA 3WK2A 2QUVA 6ALDA 1XDMA 4I7WA 5AYZA 5AHMA 2X1TA 1OFBA 2OT1A 2I1OA 1P0KA 2RKXA 3UQNA 4DPQA 1GVRA 1A5BA 4WUIA 4P2VA 2G5WA 2YFOA 3MBFA 1H60A 3EX6A 5DN1A 2QKFA 1R30A 5CZJA 4RZ6A 5AFDA 1OFQA 3Q37A 5CKSA 3L5MA 1KW1A 1ME7A 1SR9A 1TRIA 4M19A 1K7XA 4MY9A 4O53A 5EYWA 5D32A 2A7PA 3UYCA 2I9EA 1A53A 3M16A 1OFEA 5K9CA 4LW7A 1K7FA 3IIPA 1XKYA 3NQ6A 4LV9A 5D2XA 3ATYA 5D2VA 1VJIA 3LXCA 2PURA 1SU5A 1K3UA 2ZTKA 4WY0F 3W1LA 3STFA 3ELFA 1FWRA 4JN6A 2H3BA 2V2HA 2YR1A 2VEPA 1VS1A 5G1TA 5C54A 1IXOA 1PIIA 3M9YA 2C13A 2EGZA 1ALDA 4Y9AA 4O10A 1O5KA 3IRDA 2ZA1A 3W7RA 4LC8A 1UB3A 1RZMA 1O95A 2J27A 1YLVA 1X6UA 1R2RA 4Z0JA 1RD5A 2ZQ0A 2IQTA 2H6RA 4OV9A 3R2GA 4DXVA 2C0AA 3L5LA 4EF9A 1LRTA 4K38A 1JUKA 3MW7A 2Z0IA 3UXDA 2QCDA 3DKLA 4HHPA 1IXNA 3LI1A 2PCQA 4N02A 4NXSA 4WXZA 2DU2A 1KFLA 1TPDA 3B0VC 4ZQCA 2B0MA 1CW2A 1ICQA 2QCCA 1TRDA 3W72A 1LYXA 1YADA 5F2IA 4O8RA 5FEPA 4N2YA 4Q4KA 2BX7A 3C52A 3KVLA 4C1LA 3CU2A 1A5SA 3P5YA 4AHQA 1Z44A 4TU1A 4TX9A 3CWNA 3W7GA 2QF7A 4MZ8A 5I3KA 2OX1A 3PUDA 3TE9A 2CZFA 3UWQA 4QJ1A 4YCPA 3TSBA 3SR7A 4A22A 2Y7EA 4RXGA 3L0GA 1ZY9A 4O1DA 4FX8A 3I7QA 1ZAHA 2NWRA 3WFAA 2A0NA 2Z2UA 1OYBA 2X30A 3QPYA 3HG5A 5H91A 3BVJA 5HUOA 3DH7A 1F2JA 4XZ9A 5EA9A 4ORIA 2NX3A 2QUTA 5FESA 3NQGA 1TV8A 4U4MA 2ZRYA 3C56A 3FIGA 4O54A 4O14A 1C9DA 3A5FA 1OYAA 3NG3A 5HMSA 1W5NA 2G97A 3S42A 1JRBA 4O57A 4Z1AA 1XBYA 3W7NA 3U2OA 4YXGA 5FF3A 1P1XA 2R8WA 2OJPA 1FY6A 3C0JA 1O5XA 3TSMA 3DFSA 1VH7A 3GZ3A 3S1VA 2P10A 1TTIA 1HL2A 5FEZA 4M5PA 3E12A 3GNDA 2RH9A 2V5BA 5DBUA 3O15A 4ZQMA 1GYLA 3BGJA 1SO6A 4JTTA 1W3TA 3PUOA 4I9AA 2B7OA 4FB7A 3L5AA 3DZ1A 2A6LA 4OU1A 4O4WA 5C6MA 4NZFA 2CU0A 1HO1A 3QEZA 1HFBA 2CLLA 2E09A 3A9IA 3DI1A 4FIQA 5ABTA 3WJZA 3W2MA 3M5VA 2CZDA 2V30A 5CPOA 2QCEA 5L9FA 1ZAIA 3GLCA 3OEXA 4JY8A 1JQXA 4J9JA 4LC6A 7TIMA 3BPWA 4UTWC 3GR7A 3GKFA 3SI9A 5AYXA 4DO5A 3HGOA 4I7UA 2V5LA 3DFQA 4FNTA 4ZQPA 3NYZA 3LTPA 1OX4B 3MI3A 4PL1A 1ZJIA 3LRMA 5GVJA 4M6PA 1O4UA 4JX6A 2X1RA 2V9DA 3STEA 3AJXA 1L9WA 5KSWA 2QAPA 4G1KA 2YGYA 1XI3A 1G4EA 3MBDA 2E68A 1XUUA 3B04A 4ZZ9A 4GXMA 1KBJA 3LCFA 4ZMGA 1ML1A 1LLZA 3W7IA 4GUIA 1OFDA 1PCWA 1AW5A 5I3FA 2J9XA 2FPYA 1D3HA 5KINA 3A21A 1QCWA 4LRSA 4MFEA 5HR6A 4WX2A 4NXKA 1GVQA 4N6FA 4JTLA 5AHIA 1NEYA 3S1UA 3SFKA 1UASA 4TMBA 5AOUA 2Y7FA 3SW6A 3TIMA 3W1MA 1YDOA 5K9XA 1TTPA 5BNKA 5CZ0A 5AC8A 1FUYA 2DZVA 5F4WA 4UFMA 1QPQA 3H54A 2QCDB 5KTLA 3G8RA 4CQ8A 2NUWA 2TRSA 1OX4A 2A1YA 1OFRA 1FCBA 2OT0A 3G1YA 3HIJA 3W74A 4NUWA 3MYPA 2WSYA 3SZ8A 4NJGA 1QDSA 3W1QA 4PFMA 1Q6QA 2BWGA 3G1SA 4ADSA 1UBSA 2Y61A 3M0ZA 5LSMA 1IGSA 2WSQA 4Z08A 1A5CA 5T26A 2Q8LA 5DCDA 2E6DA 1FCVA 4DO6A 3L65A 1LLWA 3NR0A 5A5WA 3TUUA 1PCKA 2G96A 1M7PA 2BXVA 3LTYA 1B57A 1W5PA 4X3ZA 4ONVA 5BRBA 1W5QA 2NXIA 5G1YA 2YDAA 1I45A 1NVMA 3WK0A 3GB6A 2FQIA 4TR9A 3O6CA 2PRLA 4BR1A 4JDYA 1VHNA 3IIXA 3TC7A 2YW3A 3W23A 1B4KA 4JGDA 1MEHA 2ISVA 2ZRXA 3WK3A 3KX6A 3DENA 4WOQA 2DZPA 3G1XA 1TPC1 3LHVA 2A5HA 3CWOX 1AG1O 1VLIA 4ZVJA 3QPZA 3NPWA 3W7KA 4LTSA 3USBA 2R94A 1ME9A 3V1PA 4UTTA 1IXPA 3W87A 1Q6RA 3E9AA 1TV7A 3HBLA 3ZWSA 3BW4A 2W6RA 1XDLA 3A23A 4S2BA 2HTMA 3HB9A 2PRMA 2QAFA 1MEWA 3TQ0A 4EWND 4HN4A 4UMAA 3NQAA 3TROA 4OHQA 5K4XA 1LORA 1EB3A 2FB2A 3LRKA 3C2FA 3W7LA 3RFAA 5D04C 5F4SA 1U5JA 3WJWA 3FLUA 4NQ1A 3NQFA 1EIXA 3IGUA 3CLMA 5I3GA 2H90A 2YW4A 3FFSA 2GVLA 1DJQA 4H3DA 2ZZ5A 1X8FA 2NV2A 1BTMA 3GDKA 3W7OA 5H2ZA 2QDHA 4JTJA 5L6UA 3M1ZA 1SZNA 4DF0A 1DQXA 2FB3A 4XBSA 3OBKA 1H51A 1OF8A 3EX4A 1QPOA 4IGHA 1QOPA 5J5RA 1JCJA 4S1FA 3EWUA 1WOAA 4O11A 2BSLA 3W1PA 2NLIA 1LBMA 3C6CA 1VYSX 4O1CA 4Y90A 3TDFA 4GRSA 2E6AA 2WQPA 1KM4A 4O18A 3L0KA 1GJPA 2J24A 3FJ6A 3TJLA 1JCYA 2E5DA 4QSHA 4LS0A 1DHPA 4IQLA 1H62A 3DXIA 2C18A 4TIMA 3VE9A 1WYIA 3T78A 1FXPA 1LOLA 1EUNA 3HOJA 3JS3A 1MEIA 1UJPA 5KMYA 3GDMA 4EF8A 4WOZA 2C15A 2FFCA 2NWSA 3INPA 4JYDA 1F05A 3UWVA 2XN0A 3RF9A 1I2NA 3UWYA 3N14A 3O06A 4UFKA 3NM1A 1K02A 4O0KA 2TSYA 4QNWA 4KWWA 5DELA 5J5DA 4UIOA 3W83A 2C16A 4JXCA 1K8ZA 5SWUA 3GK0A 3F1QA 3S5OA 3M43A 2ZTJA 3W71A 3LM7A 4RR4A 4HPXA 3O1NA 5K2ZA 4K37A 4Q33A 2JGYA 1FXQA 3BLEA 1MSSA 4UTKA 4NVTA 4RKAA 5FI8A 5IM51 3PBVA 4LVGA 1GQNA 1W5OA 1W54A 1EP2A 1H7RA 3TCEA 5EKYA 2B7QA 5HQEA 1QAPA 3IVTA 4H6KA 3W1AA 3W1NA 3LTSA 4AWUA 1KM3A 1VGAA 4DO4A 3ATZA 2W79A 1NSJA 3KOFA 4CQ9A 3IGXA 5D2TA 1YTEA 3G0UA 3NQMA 1LP6A 5BMXA 4M7SA 2GJLA 4Q32A 1TB3A 5G4EA 1AL7A 1A5AA 3IEBA 3W7JA 3KAOA 3LGEA 4LNYA 3LBCA 4FNRA 4RCXA 1MXSA 5EY5A 4Y96A 4UNKA 4ZL1A 2RDTA 1H5YA 3N34A 5F2GA 4AMAA 3MP4A 4LVAA 3S5YA 5LGZA 3KRSA 3BGGA 3I68A 3EWXA 4IMDA 3OVPA 4YLWA 2Y7GA 2P1FA 3W3OA 3O6DA 4LVBA 4LU0A 1K7EA 2H8XA 2EHHA 4O17A 1BKSA 1DBTA 3NL2A 4C1KA 3KRUA 4AWSA 5KZMA 3NDOA 1QWGA 2RFGA 1PV8A 1VCGA 3C2EA 1H7WA 5BW6A 1TREA 4XKYB 1FCQA 4AEOA 4Z1CA 1U83A 1FCUA 3P60A 1S3HA 4MY8A 2NZLA 1H7NA 5CPMA 1QO2A 4N9BA 2CZ5A 1L6YA 4UR7A 3KRZA 4PCFA 2DZUA 1SPQA 3NQ7A 1RV8A 1H50A 1SSGA 2CFFA 3PR2A 3R5EA 3NPXA 3EWYA 4N9CA 1ZALA 2RHGA 3IVSA 1KM0A 3NXFA 4ICNA 1P4CA 3LXAA 3IIZA 1AK5A 1CX9A 3W88A 2WV8A 2A85A 5IBXC 3PF3A 1I2OA 1KFCA 5D02A 3OG3A 3P62A 1M5WA 3TU9A 2RDUA 1VQTA 1S5TA 1G4SA 3TQVA 4UTUA 5CG7A 2KZHA 3F4WA 4RZ5A 5EBUA 1XFBA 1QOQA 3QFEA 1ZENA 4Y6GA 4JS3A 3BG5A 2WPBA 3CHVA 1SO3A 3UNDA 4JICA 3G1FA 1L6WA 1S5WA 2AGKA 2VEKA 4MJZA 2V8ZA 2FPVA 3L2IA 3LCGA 4FF7A 3TX9A 4GJ1A 3VFLA 1OABA 1L2UA 1QMLA 3W2KA 4ALDA 3SECA 3LDVA 2ZZ1A 3U6WA 1YPFA 3LB0A 4MKNA 2ZRVA 4WZHA 4BI7A 2JBMA 1QNVA 3MWAA 1PHWA 3GAYA 5AC6A 3GVGA 1GZGA 3STCA 3NOEA 1W3IA 3B8DA 1T99A 3CIWA 1I2QA 3MMTA 3HGJA 3UWZA 4KFOA 2LLEA 3QRHA 5DY2A 2CLOA 4HNNA 5LZLA 5LNVA 1UCWA 4B5NA 5AHFA 3DFTA 3LOTA 3B4UA 4MIMA 1RVGA 4AF0B 3NL3A 3A24A 3NVTA 2ALDA 3LHZA 1XBVA 1JUBA 1AMKA 3PY2A 1K03A 4JNMA 2QJHA 2I14A 5LNUA 1F73A 3TSDA 2FIQA 2ZYFA 5LGXA 2ZBTA 2A4AA 1X7FA 1O60A 4LY8A 2B4GA 1KFEA 1JQVA 5K7JA 1CI1A 3L9CA 3PG8A 1ZAJA 3PWAA 3S0CA 4NNBA 3W7EA 4JYFA 2ABBA 4PODA 1VHCA 4ORMA 3BG3A 3OIXA 1O94A 1R2TA 3FJLA 2H8ZA 4O15A 3FOKA 3FA5A 1W0MA 3SSJA 1TPWA 3ABQA 2A2IA 2PRHA 4XBKA 3G18A 3TC6A 1W3NA 3O8AA 1XC4A 3DBPA 3S1WA 1OVDA 4AF0A 3P81A 1F74A 5F1VA 3PUEA 4A21A 1C29A 1GTEA 1K8YA 2Q3OA 4IMFA 1SZEA 1H7PA 1F6PA 6TIMA 1TIMA 2EKCA 2FJKA 3HG2A 3QSRA 5G2IA 3W7HA 3WJSA 2ZRWA 1EWEA 4K6AA 1XL9A 4QM1A 4RK8A 4TMCA 3MYOA 3FYOA 3V75A 3EX3A 3THAA 3C8FA 4GFSA 4IOTA 3BARA 3W7MA 3P84A 3MO7A 3KFTA 3UPWA 1Y0EA 1GEQA 1KTNA 1PE1A 4GNJA 2AQWA 2YYUA 1TPH1 3O05A 2ATMA 3T4CA 2H3DA 1EEPA 3E49A 3QW4B 3E96A 2FPTA 1OF6A 3TFXA 1RQBA 1SO5A 1T8XA 4RX0A 5C55A 3LV6A 3VE7A 1H61A 2VEMA 3IIVA 3S5NA 3P7YA 4E0CA 1JCMP 4HIBA 4CNOA 1YTDA 4BWLC 1F76A 1DKWA 3EX2A 3I6RA 3N9RA 1UUOA 3ANYA 2HS8A 5AN7A 1LBFA 1H63A 3D0CA 4FXRA 1E51A 4FNSA 5E0KA 4MZ1A 1GYNA 1R46A 3GX9A 4NX5A 3PSWA 1DVJA 3GXTA 2QR6A 4OBTA 4N9EA 3TW6A 5I3JA 5D09A 3DFOA 2AAMA 2C14A 3P80A 2Y63A 3EWZA 3R8RA 3W6YA 3TA6A 4DBDA 4LS1A 2QCGA 3LLDA 5EPDA 1RPXA 3HG4A 4HT3A 3ZR4A 3BK0A 1WBJA 1KTCA 2ZCGA 1NAL1 3LBMA 4TO8A 3DHFA 4GUFA 4JTEA 5HULA 3KVKA 3PBUA 2VFFA 4HSNA 1TMHA 3H53A 4O52A 1MZHA 1L6SA 1Z41A 4NZJA 1TSIA 3EKZA 3MI2A 1PS9A 3NQDA 1LM1A 4O1AA 1TCDA 4JTFA 1KFKA 3L21A 3MI6A 4UMCA 1NF0A 1FDJA 2E77A 2DZXA 4O19A 4Z1BA 1DL3A 5D2YA 2GPTA 4UXDA 3W7QA 1X1ZA 2GVGA 3KVJA 3TV8A 2E5CA 2J9ZA 2WJZA 3WJYA 2E6YA 3QJAA 3FKRA 2GOUA 1OK6A 3C4UA 3LXBA 4JTKA 4NX0A 3TAKA 4HSOA 4JD4A 3HGRA 2G95A 3G1DA 3B03A 3PBWA 1SUXA 4CCDA 1AW1A 1LOQA 3W85A 2CLHA 2WOQA 3VNDA 1TPVA 5TQLA 1TQJA 1WQ5A 3GXNA 1W8SA 1VPXA 3UZ5A 3C2VA 3L66A 2YZRA 1BWLA 3O6YX 1Q6OA 1I8JA 2ZDRA 2V2CA 3TXZA 2CW6A 1XXXA 5FEXA 2GVJA 1DJNA 5FF0A 1JCXA 4MFDA 4FXSA 4BI6A 1FDYA 3NAVA 2VKZG 3IGSA 4LT9A 4OV4A 1KV8A 4DPPA 2GQ8A 3DFPA 2Q3RA 4AHOA 3BW2A 3Q2DA 1NF7A 1P0NA 2ISSA 3DU0A 3GR8A 4UNLA 4LVFA 3IVUA 3N9SA 5G5IA 1PHQA 2VENA 5D03A 4Z1DA 1I2PA 3RU6A 1YPIA 4CCEA 1TQXA 3B0UX 8TIMA 5KZDA 1SW0A 1XM3A 3EX1A 2YYTA 2YSWA 1IF2A 3PB2A 2QJGA 1ZCOA 2XN2A 4MLJA 1LRNA 4HNVA 4I7VA 4JR5A 1C8VA 3LCHA 3C2RA 2E6FA 5I3IA 1V5XA 2VEIA 3EEGA 1F5ZA 5D33A 3ABRA 2NXGA 3TW7A 4WXYA 1PL9A 4WJEA 5BMWA 3BO9A 4XTIA 4E2BA 5CPLA 5AB3A 3BG9A 4UFHA 1OFPA 3NQ2A 4W9TA 1TPEA 1WBHA 2C19A 2ZRUA 3P5ZA 1ZHAA 3TJXA 4P61A 3LHWA 1XBXA 5HUPA 3GAKA 3PBYA 3TQKA 3OA3A 3LLFA 2DJLA 5LHEA 2ZZ6A 4KFPA 1ZFJA 5AHEA 3RLUA 3EKLA 4NJIA 5EL1A 3CPRA 2WKJA 4LVDA 1G7UA 5F2MA 3G3DA 3I7SA 3F4NA 4ZQOA 1BWKA 3NZ1A 3NQ8A 4IXXA
chains in the Genus database with same CATH superfamily
3SY5A 2GFTA 1RVKA 4ZTXA 3KL0A 4DLFA 3CQIA 1WZLA 5D30A 1RCQA 1E0TA 1R0MA 2G8ZA 4YVVA 2DFAA 4N4PA 4YMZA 4DQWA 3W22A 3APYA 1UJQA 3UWUA 1JZ3A 3QY7A 1UWAA 3C0LA 3RJXA 3EMZA 4UTMA 4N4QA 1GVSA 2DSKA 4L4OA 1OT2A 2G41A 4KCTA 4LF2A 2E40A 3GDTA 1FWJC 4PTXA 1EA9C 5F2LA 3B8IA 1EFZA 3VOHA 1TWWA 1XG3A 1RXOB 1U1JA 3AIEA 1O66A 1DJXA 3R12A 3CIXA 3WUFA 2VGBA 3A5VA 3GO2A 1EL3A 3LM3A 3T55A 1KO0A 1XSIA 1KRAC 1RALA 4BF9A 4H00A 3IIOA 5HNNA 1VYRA 4E2DA 3J7HA 1F6YA 5E1QA 3AS3A 5LYRA 3FYPA 1VCVA 3KCOA 3S46A 3GYEA 1UKOA 3RCNA 4PMQA 2BV9A 2EPHA 3T7VA 4J7RA 3G1HA 2PWFA 4JHZA 3M44A 1MNZA 4W85A 1PZ0A 2GJNA 1KM2A 2ISFA 4B9YA 2F2KA 4E2VA 3VM7A 1J11A 3RPMA 3S1XA 3QGVA 5ECUA 4AZ5A 1ADSA 3M41A 4QDWA 4D9PA 3QM3A 1AFSA 4L1GA 5LNSA 1G7VA 3M07A 2VOMA 3ZFHA 3ZVHA 2OXNA 1QTWA 2WSRA 2XH0A 1Q3NA 4ZQNA 3LCWA 2VR5A 4GYJA 5I23A 1KB3A 1KFBA 4MPQA 3TNOA 1JZ6A 3TCSA 1OFOA 5IOBA 4QIUA 4OECA 1QW7A 5DBTA 2W62A 5T9BG 4HSHA 1RR2A 1Y65A 1FHUA 3FN9A 2XWDA 1P43A 4NNAA 2WZIA 2XFFA 3MTWA 4MNMA 4WQ6A 1C7SA 1TJRA 1SFLA 5A2CA 1S1RA 1XF0A 2YA1A 1EJRC 4QE5A 4R88A 3DHDA 1B3ZA 3SCQA 4ZQRA 3WBXA 1EQPA 3W75A 2B7PA 3MV01 4YTTA 2FMOA 1HGWA 4DUOA 4IWWA 3C5QA 2PUZA 2UV8G 2C1HA 2GSHA 3GYCA 4M1BA 4C6QA 3PG9A 3T2QA 1VFUA 4UMBA 5HJXA 5GJPA 4DAIA 4IUOA 1CNVA 1WZKA 1J5TA 5FKYA 5CGQA 2PE4A 3H4GA 2V81A 4HPGA 3WELA 1OQFA 5BOOA 5E93A 1PKLA 3VC5A 3CMGA 5EFDA 4IFKA 3P61A 4CCCA 1WXJA 3FXGA 3PPHA 4JTIA 4GABA 2PF8A 3LHUA 1JJKA 3UEQA 4YTSA 3CGTA 3G24A 5IHSA 3WDQA 3U5UA 4TVDA 4A29A 2TMDA 3VGGA 4DY1A 4JFVA 2PC8A 1LRQA 2XSAA 2E1WA 3LA4A 4JTGA 3UERA 2XH7A 2YBUA 2VVNA 3DFYA 4M80A 3S6DA 5I2UA 1PTAA 3BMXA 4W89A 3OYXA 4MY1A 2BGQA 3KWXA 2FKPA 5T91A 1KLYA 1AH0A 1OG0A 5U4NA 1Q7QA 5HNUA 3R1ZA 2Z7KA 3WEZA 4A3YA 5AYYA 5GNYA 3GVRA 1Z42A 1YIXA 2A3CA 1SJBA 1V93A 1JCLA 1L6FA 2XUCA 3MA8A 4GA8A 1UPPA 3IV8A 4AD5A 5CPTA 4PMZA 2YB1A 1AW2A 3ABZA 3DYPA 3TR2A 3I7RA 3GH7A 4PUEA 1UA7A 4PZVA 4JHOA 2ACRA 2E25A 3FX4A 2FTPA 5FJUA 3IJQA 2WM0A 3OIHA 4LBRA 2DQXA 5LIYX 4L56A 4NJHA 1M1BA 3GKAA 5DEZA 2YBTA 2Z27A 1JDCA 2QW5A 4LS2A 1BG9A 3QOKA 3VCCA 2JF7A 4UCGA 5HDRA 1AZ1A 1TX0A 5G2HA 1TWZA 3C2YA 3PTKA 5G4WA 4F0HA 2V67A 3RNDA 3V36A 4DB7A 1DWJM 4ERAA 5HQLA 1QNOA 1IE7C 5KITA 2J9YA 3ANVA 4HZ8A 4JL2A 2Y88A 4R53A 1VJSA 2VCBA 3P14A 1DV7A 3BANA 3TYBA 3O0FA 1JF5A 1XIHA 1YQ2A 3MUAA 5LA0A 2D73A 1C9WA 3NZRA 2BHUA 2B81A 1OC6A 4NNCA 4PB3A 3DG3A 4F40A 2WHLA 3H2MA 2HDJA 1OX5A 1DWAM 5C9WA 1SFJA 3R0KA 2QDGA 1T0OA 3WEOA 2WVUA 3W9ZA 1SW7A 4AHPA 3THQA 4YCOA 3CM4A 1FWTA 1VPYA 3HPSA 4HCHA 1E3XA 4HD5A 3MP5A 2CCRA 4GYFA 1G4PA 1GHRA 2O4MA 1MFUA 3DCPA 3PZIA 1BSLA 3C61A 2ZKMX 4X22A 3HJZA 1LG2A 2J25A 1RY8A 3LX9A 4MF4A 1FWWA 2YCEA 4OZOA 4HP5A 3C3NA 2R1PA 4YN5A 1EP3A 1BRLB 6XIAA 1QWKA 1Z32X 4DJEA 4F2UA 1WDRA 5GNXA 1PDYA 5IFPA 1JI2A 4U10A 1L8PA 2CLKA 4JY9A 3TTEA 1Q45A 3QC0A 1LOSA 1MXDA 1LWJA 4WHBA 5FJJA 3GXFA 2OG9A 4V33A 3S5ZA 2Y5EA 2BY2A 4CGTA 1FHVA 1NQ6A 2QVHA 2CZEA 4MB1A 2HNEA 3R89A 1ONRA 3N15A 1TV5A 3URQA 4A3HA 2GUYA 3H2AA 4B3LA 4MMWA 1ADDA 5AHNA 4NI3A 4IPPA 3W2UA 4GUGA 4WJXA 1JGIA 3HO8A 3EKGA 1D9EA 3Q4DA 4PCSA 5JBFA 1H1ZA 3RRAA 3R8HA 3PZMA 3HV8A 1AH3A 2OLAA 2OZ0A 3WLHA 4ZFMA 3NM3A 2ON3A 1YTKA 1BLIA 4UTWA 2FGLA 1E56A 2QMJA 1G4TA 1CTNA 1UIOA 1H1NA 4D1IA 2FMNA 5GQBA 1POJA 3BAKA 3GFYA 1ZRQA 5HMDA 1F9CA 3H2CA 4CNSA 5CLTA 3ZT5A 2DH3A 3QHOA 4TX8A 1TE6A 3SQSA 2P0IA 5C5YA 3A13A 2DW7A 3SY8A 4IJBA 2X8RA 3PWGA 1PYMA 3O16A 4GMEA 4HKPA 1SFTA 3HV9A 4LUSA 1RBOB 5CSSA 1C7TA 1HXJA 4RL3A 4GBUA 1W3JA 3RMJA 1XWYA 1YX1A 1MQQA 5D05A 4ATLA 1AQFA 1DYSA 3G22A 4QNEA 1K9EA 4UNIA 3E74A 5M03A 4HNOA 1REQA 4YYCA 2PCEA 3OTRA 3CEUA 2ZA3A 4KKXA 3LRLA 1H1YA 3TR9A 3M46A 4UC5A 3T0TA 4RE4A 5C2XA 2ISWA 3RLGA 3RM4A 1KV5A 1GKQA 3B4YA 4DXKA 4X9SA 3TN6A 2WBKA 4AWTA 4H04A 3E5PA 4YHGA 4QP0A 4TVCA 1E9IA 1Q66A 2BZNA 3OHIA 3PS7A 3VABA 4Z2JA 2XGBA 1EXBA 4AYSA 3SGZA 5I06A 4DZIA 1SMAA 4JYEA 3HG3A 4X2RA 4O0ZA 1LTDA 1TPUA 4AD2A 3WFZA 4CQCA 4K8HA 2EBNA 3L67A 2XVLA 3BW3A 1DQWA 2ZC1A 5BCAA 3VPLA 1DWIM 2O7QA 2DZTA 2E5BA 4GZ7A 3KW3A 2DVUA 4MJMA 1KM5A 3ZVHB 2BB0A 4BEQA 2JKEA 1HKWA 1ISVA 3CTLA 1QI0A 2GQ9A 3GW3A 3GBDA 3S2MA 5CPNA 4LUYA 1C8XA 1JAKA 3FS2A 3UZJA 5C2GA 3NSNA 3POCA 3EPOA 2PDHA 4Q8UA 4BFAA 3WLRA 4XZBA 3NO5A 6A3HA 2IPGA 3SGUA 4LYRA 3KDOA 4I9JA 4IX2A 2PZ0A 4GKLA 2PF0A 3KZPA 1TV2A 4GHRA 3TYCA 1JPIA 3DESA 5A6BD 2VP8A 1GTHA 3GSMA 4TTUA 1UR3M 2CIPA 1BPLB 1VLWA 2BS9A 4A2RA 1UG6A 2OPJA 3R4IA 1QT1A 3UPBA 6TAAA 2P53A 1O68A 2VJXA 5A6AA 2YDSA 3COTA 4M81A 5B7YA 4M8UA 1N82A 1VBRA 2I1OA 4DPQA 5BOEA 4YJ5A 3WQ6A 3C86A 1H60A 5FJRA 5CZJA 1R30A 1V0LA 2XFYA 4RZ6A 3M6DA 2J7HA 1OFQA 3SRDA 2RJGA 4PUUA 4PBGA 1F3XA 2TAAA 4AD3A 1VF8A 5EYWA 2A7PA 2I9EA 3M16A 4LAUA 5EGRA 4JQ2A 1K7FA 3NQ6A 3U2EA 2P3ZA 2FZMA 2QGYA 2EXOA 3IARA 3W4RA 1FWCC 2HQAA 3SBFA 2PURA 3BQ6A 1R9YA 4MWAC 3PBGA 1KD0A 4QEEA 4XAYA 3K2GA 1Q7ZA 1AH4A 5C54A 3ITLA 3LZ5A 3TTQA 3IJ9A 1IXOA 1GK8A 4IL2A 1PIIA 4QLKA 3M9YA 2C13A 1A5LC 1XRVA 2EGZA 4O10A 3IRDA 2ZA1A 1HKIA 1XLCA 1YLVA 1DXIA 4S3JA 2IQTA 2H6RA 4OV9A 1MW3A 3L5LA 3VD4A 1GCYA 4GGHA 1TWSA 3LI1A 4UWMA 2PCQA 4N02A 4B16A 1JPKA 4MSSA 4ZQCA 3CZEA 5JH2A 2QCCA 4GXPA 1LYXA 4QDMA 5FEPA 3KVLA 1A5SA 1E3ZA 4I3GA 1IWPA 1IZCA 2QF7A 5I3KA 2OX1A 2VX7A 1L2QA 3VXGA 1FH9A 2W61A 4QJ1A 1JIBA 3WBEA 1B3YA 5A6LA 1A5NC 4BEUA 4IPNB 4CN6A 1H0IA 1QW8A 1OC5A 2V5DA 3H2NA 3RX3A 1OYBA 1PXGA 4FZIA 5HUOA 3BLLA 2D2HA 4AZIA 5EA9A 1A4LA 3BOXA 3T2OA 1EPVA 2NX3A 5FESA 4WGHA 1TV8A 4AZCB 1C9DA 3NG3A 3VNIA 1XYZA 1JRBA 1EC7A 4O57A 4OTKA 1XBYA 3U2OA 3ZLGA 2L5HA 1P1XA 4D6DA 1KWGA 2OJPA 1FY6A 2WJDA 1PUDA 1O5XA 4GVIA 3AU6A 1PAMA 2P10A 3URNA 5I79A 5FEZA 1Y5WA 1IQ8A 1J0KA 3WL1A 1E6NA 3GNDA 3MSYA 2QHAA 5DBUA 1U5VA 3RLHA 4QAWA 2BFGA 1SO6A 1TZ7A 5HA7A 4DYJA 4I9AA 4FB7A 3AMLA 4OU1A 1IT7A 5FJPA 3CS2A 2CU0A 4UCFA 3QEZA 3BLOA 3UXIA 1HFBA 2E09A 3IGHX 5PTDA 3A9IA 3WJZA 1IZKA 1XGEA 2CZDA 5L9FA 1OIFA 3GLCA 2D22A 2V5KA 3N3TA 4LC6A 1EGZA 4JN7A 3GR7A 4EACA 3POHA 2WB5A 3HGOA 1BVZA 4I7UA 3A3HA 2PD5A 4ZQPA 3N04A 3W53A 3MI3A 3LRMA 1LG1A 5GJMA 1TZ9A 2V9DA 3STEA 5B80A 3PPGA 5KSWA 3KZSA 3CZLA 3WMBA 4DWDA 1XLJA 1UR9A 4YTUA 1XUUA 4ZZ9A 4GQRA 1HF6A 1ML1A 4J5NA 4U5KA 1XH2A 2D2GA 3T1GA 2VR2A 5I3FA 1G01A 2FPYA 1D3HA 3VM5A 4NXKA 3S1UA 1OM0A 1TTPA 5CZ0A 3VDBA 1FUYA 4XB3A 2DZVA 4HCLA 4UFMA 1JFXA 2J7BA 2QV4A 3A4JA 5A2BA 2O55A 2Q8XA 2NUWA 5EMYA 3TQPA 1NQKA 1O6IA 4CN1A 4NUWA 4NASA 3SZ8A 4NJGA 1QDSA 1EYWA 4KBXA 3OZMA 3Q45A 4ADSA 1UBSA 3M0ZA 4KEZA 1QK2A 2WSQA 1A5CA 4PYSA 1FCVA 4JKLA 3GNRA 2WMGA 3RO8A 3L65A 1LLWA 4M1RA 1QBAA 3G77A 4PMDA 2QJMA 1TMQA 3EOSA 4N7QA 1UWUA 3B97A 1J6PA 3WFLA 4J3TA 3WK0A 3GB6A 1KBLA 1NU5A 1VBUA 3TWBA 4A4AA 2GVYA 2YL8A 4BR1A 5E0CA 1ESWA 1VHNA 2CHNA 1C8YA 4HNLA 2YW3A 1LT8A 3W23A 3MC5A 1MEHA 4MTVA 2VQTA 1IEVA 4DYEA 2DZPA 1TPC1 1RH9A 3LHVA 4EE9A 3HPFA 4ZVJA 4IP5A 3W7KA 3OVGA 2F6XA 2R94A 1ME9A 3W87A 5M2FX 4GOAA 2VMFA 2INEA 1YMYA 1NTHA 3ZWSA 3AXXA 2PP3A 3BW4A 2W6RA 4GYPC 3CAQA 1XDLA 3A23A 3MDUA 2DSVA 4GI4A 4J2PA 4EWND 1LORA 2ZVRA 1EJ7L 2WPGA 3TYEA 3SUWA 3W7LA 1CXIA 2E8YA 3LMZA 3CLMA 3A47A 5I3GA 2YW4A 1J0HA 4B2DA 1JPMA 3CPGA 2C1IA 3SQLA 4HBKA 2FVMA 2NV2A 1V79A 4ILSA 5H2ZA 5AVHA 3ZZ1A 2QDHA 4JTJA 5L6UA 1P1MA 1E15A 3W6MA 2E0PA 4X0NA 4GIYA 1XH1A 4IGHA 1W9UA 4ZR8A 3W27A 4BA0A 5REQA 4C6IA 1JCJA 3VK5A 2PGRA 2PMQA 2BSLA 1BD0A 3W1PA 2PDMA 1VYSX 3BOLA 1DP0A 3W82A 2WW5A 1KM4A 4O18A 2OLHA 4HJFA 2J24A 3TJLA 1QI4A 4QSHA 4QS5A 4TIMA 3W01A 3UXLA 2X0YA 2ZUVA 3V3WA 1UZ4A 1RBAA 1E4LA 2ZE0A 4NP7A 2R1MA 1F05A 2O9PA 3UWYA 3CQKA 4Y8EA 3QLDA 4UFKA 1MVYA 3NM1A 4L4PA 1HW6A 2Z4GA 4X9YA 4KWWA 3PPFA 3F4DA 4JXCA 3WQDA 3F1QA 1XLKA 1W3KA 3LM7A 4HPXA 3O1NA 5K2ZA 3MS8A 4FLOA 3BLEA 2X2YA 4R27A 4UTKA 3MQTA 4NVTA 3KS5A 3IJDA 2QV5A 1GQNA 3VKAA 5ABFB 1PKMA 1S2TA 1EP2A 3LLXA 3VNYA 3VIIA 2YCLA 4H7ZA 3EBVA 4W5ZA 5HQEA 3IVTA 2QNEA 3AWNA 1KM3A 1AJ2A 4QE4A 4XZLX 2PLCA 1PO9A 2OTDA 4CQ9A 3AZSA 2HROA 1YTEA 3NQMA 5BMXA 3G1RA 2GJLA 2X40A 1TR9A 3N4AA 1SZRA 4A8NA 3LGEA 3T81A 1FP8A 3KEHA 1EC8A 3ANUA 3P6LA 2RDTA 5B7ZA 3N34A 3T08A 4GQGA 4AMAA 3MP4A 5LA1A 2PDIA 5J8LA 4FLRA 3LPOA 3W3OA 2Q09A 5CC5A 1UZ1A 1XSKA 4LU0A 2PD9A 4PB5A 2DPEA 4PTDA 4MJ2A 4MNJA 4WGXA 1LL7A 2HEJA 2FTWA 3BLPX 3C2EA 1JZ8A 3GVWA 5BW6A 3WO8A 1UH2A 3U4FA 1FCQA 4MDPA 4CUCA 4Z1CA 3QR3A 3WLMA 2WLZA 2F61A 1S3HA 2NZLA 1H7NA 4V1XA 4QJ3B 3WLQA 1XPGA 4AY7A 1SPQA 2C0HA 2VEFA 2HVMA 1NJJA 4GY7A 1H50A 5FD0A 1PSCA 1Q6DA 3R5EA 2D0FA 3EWCA 4QE1A 3R94A 1ZALA 1KM0A 5LIWX 3EMQA 3MUZ1 1J0ZA 3LXAA 3V5FA 1XRTA 1CX9A 5IBXC 1E6PA 3T0DA 4IGMA 1S38A 1I2OA 1KFCA 5EU9A 3OG3A 4WDTA 3P62A 1M5WA 2RDUA 1VQTA 1S5TA 4NG3A 4PEEA 4UTUA 7TAAA 3EDJA 3F4WA 1XIBA 2P8CA 1QHOA 2PGFA 1EJTC 1XFBA 4PBEA 4TVUA 2WPBA 3NDYA 2AGKA 2VEKA 4HCDA 4MADA 1EO5A 3LD5A 2PDWA 3UGRA 3RXZA 3AIRA 3AOFA 2VR4A 3SECA 1XLFA 2ZZ1A 2Z2AA 4MKNA 3AISA 1QNVA 1PHWA 2AOSA 3LG3A 4LUTB 1W1VA 4PSRA 1GZGA 1E9YB 5I07A 3STCA 3B8DA 3MMTA 2SFPA 2NQ5A 4IICA 5DY2A 5LZLA 5LNVA 3LOTA 3B4UA 1VBHA 4FP1A 3LHZA 1AMKA 5E9XA 3VAVA 3U7BA 1Q4NX 3WLNA 2FIQA 2A4AA 1X7FA 3B40A 1LF1A 2WHKA 3R79A 3PWAA 4ASTA 2ABBA 4L1WA 3IANA 3FEQA 2XHYA 1K70A 1XIEA 4U3AA 2H8ZA 1F61A 2WMKA 3FOKA 1OGGA 1L8NA 4JOMA 3WF4A 2WYSA 3JZUA 1TWIA 3HPAA 2OKOA 4GYPA 3TC6A 4H6QA 1XC4A 3IUDA 3AS2A 4AZCA 1CXHA 2J77A 3MDWA 2A3AA 2E3ZA 1GTEA 4INFA 4WSHA 4IMFA 1H7PA 6TIMA 3TONA 1OGSA 3VGEA 3WJSA 1XL9A 4S3GA 3EPNA 3ID7A 3C8FA 1BVWA 1R3RA 2OEMA 2GJXA 4HZ7A 2G4FA 3CJPA 3QV7A 3MO7A 4ZE4A 1Y0EA 3V5OA 2AQWA 2YYUA 4FK9A 4C6JA 3T4CA 1OD0A 3E49A 3ALGA 1JFHA 1E6XM 4Y9PA 3TFXA 2D24A 1T8XA 1ZJHA 4HK7A 2J79A 5C55A 4E4UA 1E55A 1H61A 1E5NA 5DQPA 4HIBA 1YTDA 1GONA 2I5QA 3M7SA 1AA1B 2HXUA 3UR8A 1RJQA 3D0CA 2VZUA 4FXRA 1CDGA 4MZ1A 3TN4A 4NX5A 1HKJA 3GXTA 2EPLX 3CL8A 3NZPA 4OBTA 2XIJA 3FAWA 2VRQA 3TA6A 3ZO9A 4DBDA 4LS1A 3BAXA 1RPXA 3BK0A 1WBJA 3LBMA 2XIQA 4GKTA 4TO8A 2VEGA 3N1AA 2HNHA 3DC0A 3KS6A 3PBUA 2Z1WA 5F7UA 2AL2B 4O52A 3BSHA 1J18A 1C3FA 3P0WA 4NZJA 3NDZA 4B90A 2CKRA 5DMNA 1PS9A 4EP8C 1LM1A 2VX6A 4Q8PA 3QTPA 4UMCA 3WF3A 4W8LA 2DZXA 4Z1BA 1B30A 3CUHA 3W7QA 1UWRA 3KVJA 4X61A 4CN4A 5CAHA 1YNPA 4PMJA 3A9BA 3KCLA 5HQMA 2PP0A 4WRHA 1TR1A 3U2CA 2PSNA 4ZE5A 1UD4A 4GJIA 3JVAA 4ZOCA 1V8EA 4H01A 5BXPA 2G95A 2VX5A 1SUXA 1AW1A 4C65A 2CLHA 3URAA 3VNDA 3K8KA 4M24A 2OO0A 1WKEA 1H3GA 3C2VA 3MSGA 1LWIA 1W1YA 2ZUUA 3IJIA 1QNRA 3ARVA 3SCVA 4GVFA 3DEQA 2BG5A 2ZDRA 1TFVA 4J3SA 4AWEA 2FFIA 1QU4A 3XINA 4R9OA 4XZHA 1XGDA 4ATDA 1PTDA 3FV9A 1BYDA 2Q3RA 4Y2WA 1NF7A 1UD2A 3DU0A 5HJYA 4B5XA 3W25A 1GVYA 2VENA 5D03A 4IHCA 4Z1DA 3BUVA 3KDNA 4I9MA 4HU0A 2DSZA 3IK4A 1X7IA 1SW0A 1HKVA 4BQ5A 1ZCOA 2XN2A 3VFCA 3PJWA 5CZKA 4HNVA 4I7VA 2QVNA 3C2RA 5H1WA 1OSEA 1F5ZA 1CB7B 1OCJA 1PL9A 1GORA 1E4NA 2VVSA 2XH4A 5BMWA 3BO9A 3IUHA 3BG9A 4QX4A 1V3KA 3LHWA 1XBXA 3EEZA 3W28A 2Y8UA 2DJLA 3AJ7A 5AHEA 3RLUA 1A0CA 3N2OA 5EL1A 4J1OA 1WKDA 2WKJA 1J5SA 1US2A 3G3DA 2EO7A 3I7SA 3WUGA 2HWGA 2WLYA 4QXIA 1BWKA 3NZ1A 3NQ8A 3LSCA 5G4HC 1WP6A 1K4HA 1LQAA 4LB3A 3LHYA 4JEQA 4JAWA 3UWWA 1WDSA 3GRIA 4PMVA 3SIZA 2ZUWA 2YPIA 2DW6A 1SO4A 3CV6A 1VFFA 3WL0A 5AZ0A 4KFNA 1LZOA 4K36A 3HF3A 2WC7A 3EYPA 1G1YA 4MWAD 4IFRA 3OGSA 3V18A 3RG6A 3W38A 4DJDC 2XG9A 1OEPA 5FF2A 2PWHA 3RPDA 2QUNA 1GVFA 2ODOA 1E1FA 2V82A 4C90A 1N7KA 3LBOA 4RW3A 3EOLA 4Z2HA 2VDGA 4K2SA 4DBWA 1M65A 2VXNA 4RV3A 3T8QA 1KM6A 3DI0A 5D2WA 3M0YA 3OLDA 3HFYA 4LRTA 4XSLA 3L4WA 1TYGA 1CZ1A 1U33A 4ROQA 4GE8A 3SCTA 1JR1A 4K39A 3WNMA 1X97A 4WSJA 2E28A 4HOWA 4DJEC 1HL8A 4RJEA 3UCCA 1R86A 2PFHA 5E70A 4MYXA 3AUOA 2QCLA 2PDKA 3MCMA 3BLFA 5D9MA 4C6LA 3RPTA 4PMUA 2PC4A 2C7FA 2J62A 4MYAA 3WQEA 5JMUA 1FDZA 4L4MA 1FHDA 1GNXA 4DWSD 4H9YA 1FWAC 3B06A 3XIMA 1GPWA 5KEZA 3E0WA 4NAEA 4RUBA 3VNLA 1EOMA 4JIPA 4I9TA 3TFCA 1FFRA 1YNQA 5I3DA 3VKJA 4GWEA 1W1PA 1XD0A 4UFIA 4ZXOA 1B4EA 2HISA 4XKYA 4E38A 3BGAA 2EKGA 3EWWA 4I5UA 3L4UA 4QLJA 1VEPA 2OCZA 1Q8JA 1WUFA 1FH7A 3D46A 3N4EA 3N19B 1A50A 2ABAA 4LH8A 3UR7A 4KWVA 5MKGB 4LB4A 3U7VA 1NWSA 1JZ4A 4C91A 3NNTA 4D8AA 4GLEA 2RGMA 5DY3A 2X09A 4HPHA 2Y24A 4Z2KA 2ZXAA 4J3VA 4JQAA 1XLIA 3VVGA 4HOXA 3R7MA 1QR7A 5LNWA 1EWDA 4FPSA 1M6JA 2PODA 3PC0A 2FZDA 3GUWA 1MYRA 2P0OA 5A6TC 2DUXA 3PAOA 3R6IA 3FJNA 3M6YA 4FO4A 1ZU8A 3CLWA 2NX1A 4HOZA 2GGIA 1V3LA 2GL5A 1TA3B 4CNPA 1V3MA 2ZZ7A 3VYLA 4CKQA 3W07A 3GG1A 3PZOA 2QQ6A 4BWLA 2NUXA 4UTJA 1OX6A 5D38A 3H2FA 3CB8A 1KCXA 3D3AA 4RDVA 4LAZA 2VT0A 3GVVA 3LERA 3TXVA 3A4WA 4O4VA 1E6RA 3MU7A 4XZWA 3A4AA 4DEFA 5FSDC 5K9DA 5IBXA 1BTCA 2A3BA 3G3MA 4NZCA 2XWEA 4L6OA 4UUIA 3FK4A 1UUQA 3G5EA 2WMJA 3L4YA 2CPUA 3NQBA 3GTXA 4QISA 2VRJA 5LIKX 2VOTA 3P74A 3WNLA 3B8UA 1K77A 4UFJA 5KETA 3QQ1A 4PEKA 4MWAA 3EZ4A 1UHVA 3S9ZA 1TTQA 4UTIA 3F5KA 2ZXBA 1V08A 2WMFA 3BURA 1TO3A 3KUMA 3HMJG 1V51A 3LCIA 3TWAA 3NURA 4AUBA 3VMOA 2OODA 1X1OA 2NQZA 1V6YA 1GEHA 2EF9A 4OQVA 2YA2A 3TZFA 4HN8A 4O16A 3PAJA 3V5CA 7REQA 1XFCA 5LKYA 3BDKA 4BI5A 4WLCA 3O63A 1GVOA 4ML9A 3KP0A 2EPNA 2PTXA 4HPJA 3SCUA 4Y7EA 3STGA 2QIWA 1E0UA 1BWVA 3K4DA 2JKPA 2YFNA 4UZUA 4NHVA 2DORA 4E8CA 3BC9A 1TJPA 1P7TA 5HR7A 2NT0A 4LAOA 1SW3A 1QI5A 2PA6A 2QCFA 3YPIA 4M7TA 3UJSA 1R2SA 4Q4SA 3VOJA 2GJXB 4F66A 3DOPA 3FKKA 5HXMA 3MHFA 1SSDA 2QCNA 4REQA 1BEUA 1SJAA 1TUXA 3GXPA 4R7WA 3CH9A 3ZQ9A 3TK7A 3VDCA 3MY9A 5C7HA 8A3HA 4LUJA 3N6JA 3W86A 1X1NA 3HQOA 4JPGA 4EXAA 3CT7A 4KGJA 4EWJA 1ICSA 3NZQA 3QZAA 3MT1A 3WQGA 3ZWTA 1M53A 5A69A 2Z24A 3AQUA 4NAFA 3T4WA 2PDNA 3P67A 3WN6A 1VFOA 2FH8A 4KESA 2FLIA 1KLZA 4ENLA 2WCSA 3EB4A 3UR2A 1VR6A 1B3OA 1EYEA 3CL6A 3DYOA 4PCTA 1XYBA 1XLMA 3C2OA 4WY0B 4WF7A 3AMKA 4Y8FA 4GQ0A 3VOFA 4L1XA 1DORA 4FLQA 1A4MA 1FWNA 5DXXA 4UQ9A 3S9YA 3I3EA 3DFHA 3AMGA 2PDGA 4NI8A 2VC6A 4HNCA 2FHBA 1KTBA 3MUXA 4U31A 5HWJA 2JKAA 3N3MA 4LPCA 3EDKA 2X1UA 4DELA 4L9YA 1ZTVA 3BZJA 2UY3A 2CBVA 1WUEA 3WD2A 3NEVA 3UNTA 4DZHA 1KGWA 4PTNA 4OE7A 3GHSA 4XD4A 3I3BA 1ZLPA 1DTNA 2NX9A 1X8CA 2VUNA 4V1YA 3RX2A 1I6NA 4DUXA 4C6FA 1UP3A 3NPVA 2XVGA 3WNOA 3QSTA 3EXTA 3QFWA 3OO2A 4O13A 2ZRZA 3EXSA 1DOSA 9XIMA 1MRAA 3TN3A 1ODUA 4Y9OA 4X2PA 2OWCA 2J88A 4ZO6A 1QPRA 2AKMA 2XPKA 3EB3A 1WV2A 3NZGA 4NJJA 2VZSA 3AXMA 4O50A 2BY3A 5DANA 3E6EA 1F8IA 3OODA 2V0TA 2IKHA 3T44A 1WPCA 2HRWA 4MG4A 1OJXA 3I6EA 4IMGA 4F0SA 1N8WA 1XCWA 3B3DA 1JPDX 1JVNA 3K5XA 1EPXA 4FMVA 1RUSA 3B8SA 4JFWA 1ZJAA 1W3HA 4I5RA 3FA4A 4ICMA 4YTQA 3REQB 4D2JA 3ABSA 3UGVA 3ZT7A 1Q2SA 3Q94A 2OWWA 3TMQA 3CHEA 3R13A 1ZNNA 1FWSA 5TIMA 4O1BA 2IMRA 3HQ1A 4UTLA 3S1GA 1AUSL 1YDNA 4B5UA 1BQGA 2R1KA 2ZADA 2X16A 3B8WA 1T5AA 2V38A 4QG9A 1GVEA 3S2CA 3TZNA 1RLCL 1E6SM 3RUBL 1E1EA 2QZRA 2Z1BA 3LMYA 4PRRA 2PTZA 3WLSA 3ARXA 3RX4A 4OWGA 4O28A 1Q65A 2NQLA 1WA3A 2ZXQA 3ME3A 3GE7A 3JZEA 1XX1A 5CZTA 2QJJA 1Q6GA 1YXCA 4OOZA 3FY1A 4LWWA 5DMMA 3NO3A 1GOKA 1B31A 1UR8A 2C1GA 4QAIA 2OGYA 2XIMA 2DJXA 3ARRA 1R47A 2Y70A 3VOCA 2XIOA 2V2DA 4O1EA 1GKPA 3IAQA 1UH4A 4DBEA 5E6YA 1NFPA 1A47A 1CGTA 3CV1A 2VUYA 3W70A 1F6KA 1JXKA 3NXLA 1EJUC 1PIGA 4ZB2A 3DAQA 3KTSA 1GQKA 1IR1A 4FEZA 1F7BA 4K1WA 4AB4A 2WKLA 2CHRA 1CGUA 3CEPA 2EQDA 2C6QA 3NGJA 4IMCA 2PU0A 4W86A 2ZZ2A 2PS2A 3P8IA 4PMRA 1MO0A 1VCFA 3MVTA 2ZUTA 3A3WA 2Z1SA 3BV4A 3ZT6A 3SIMA 1WDQA 2F7FA 2VFEA 4GXWA 3GS6A 2HSAA 4DJFC 2R14A 3AFBA 4GNVA 4H1ZA 1R3TA 3K30A 3RGTA 3CTTA 3PFMA 1U1HA 3PZUA 3DDMA 3SRHA 3OLGA 3LGGA 2J6VA 4BK9A 4F0LA 4LUIA 1GKRA 4J2MA 5JVLA 4HU4A 3NQVA 1JCTA 3AALA 3VZZA 2E1DA 1EUAA 1MFVA 2J78A 3SCPA 5DRIA 1B9BA 3PJUA 3WY1A 1GPFA 5I3HA 4AXKA 2PAJA 3V0UA 1QHPA 1NFBA 2GDVA 2NLYA 3BV7A 1HL9A 1RAKA 2QMKA 2O7SA 4MVAA 5CZSA 3A4XA 4S38A 3II1A 1QBBA 2QUVA 6ALDA 4B2DD 1XDMA 4I7WA 1NOUA 3D6NA 3TEVA 4PN2A 1OFBA 4Q7NA 1R8LA 2YBVA 1GVRA 2ZUSA 1A5BA 1PKNA 2YFOA 1D7KA 3EX6A 5DN1A 5AFDA 3K13A 4JBRA 2YDRA 3SM0A 3L5MA 1EF3A 1KW1A 1ME7A 1I1XA 3AU2A 1P6CA 5LA2A 1SR9A 1K7XA 4MY9A 4O53A 3UYCA 1OFEA 3ITYA 1F4AA 2ZE3A 3M0VA 4JQ4A 4P8UA 2PI6A 1FTXA 1VJIA 1CXFA 3LXCA 2P3EA 4AFYA 4WY0F 3STFA 1FWRA 2VI0A 2V2HA 1Q5MA 3DHUA 2VEPA 5G1TA 2CITA 3QV9A 4AG0A 1HP5A 2BHZA 2IUZA 4DUWA 4OUEA 1O5KA 3MJMA 1TE1A 4LC8A 1OCNA 1UB3A 4PMXA 4MB4A 1R2RA 4Z0JA 1RD5A 2ZQ0A 2XGIA 3R2GA 3BE7A 3TOYA 1XLAA 4AZHA 1LRTA 1JUKA 3MW7A 2Z0IA 3UXDA 2QCDA 3GW0A 4NXSA 3HM7A 2XGZA 3K1GA 1KFLA 3SN1A 5FACA 3B0VC 1V6VA 1CW2A 1ICQA 2FTYA 4N2YA 4XSMA 2BX7A 5D9NA 4C6DA 3C52A 5EMLA 3CU2A 2XZ9A 1Z44A 4H83A 4TX9A 1WXYA 4MZ8A 2F9RA 1E1CA 3PUDA 2CZFA 3TSBA 1UR0A 4QJ5B 4A22A 1V4YA 3L0GA 4O1DA 2QUMA 3CT2A 5IRPA 2A0NA 1NWTA 1OZQA 2VD8A 1PB0A 3QPYA 5H91A 1F2JA 1KCZA 4TX6A 1GOMA 3C56A 3FIGA 4O54A 5AECA 2G97A 3BAYA 4LALA 4Z1AA 4YXGA 4MPKA 5CBBA 4I8YA 1KRMA 4GIEA 3UG3A 3BWWA 3TSMA 7CGTA 2J8TA 1TTIA 3APTA 1ZL1A 3E38A 3B9AA 3BH4A 2RH9A 1OCBA 3AMDA 3O15A 1E0VA 2HE5A 3K1DA 4JTTA 3KBJA 2PDBA 2W4XA 1W2PA 3KOYA 3SUVA 2VCAA 1HO1A 2XFRA 2UWFA 2WM1A 2CLLA 4H8VA 3HURA 5ABTA 3W2MA 3SUTA 2GZXA 4S39A 1NOFA 3GNXA 1ZAIA 3WD3A 2F2HA 1JQXA 5AYXA 4DO5A 4IPLA 1K4GA 1ITQA 1YE6A 5GVJA 4M6PA 1O4UA 4F2BA 4JX6A 3WH6A 2X1RA 2QAPA 3AMCA 2POTA 3MBDA 2E68A 4LSBA 1KBJA 3BSGA 1LLZA 1BF2A 5FAGA 5TAOA 4AVOA 4GUIA 1V6XA 1PCWA 4D6GA 1HGYA 1RPKA 3A21A 4P7NA 3L23A 4WX2A 3F4VA 4JTLA 1E0WA 1CLXA 2WC4A 3GC4A 4NAFB 3UP8A 5HBFA 2HK0A 3SW6A 1BFNA 4H7VA 1R5YA 5BNKA 5AC8A 5F4WA 4MNKA 3UWEA 2OSYA 3S4TA 2TRSA 1FCBA 3CAKA 3G1YA 3HIJA 3W74A 5BU9A 2G4JA 5AY7A 3G1SA 5H8MA 2J7GA 5DCDA 4LYQA 3CUIA 4GPNA 1FWIC 4NZ3A 3S83A 1X6LA 4BZYA 2DZAA 3TOPA 3QZ6A 4R7OA 2GLKA 5AKQA 6CGTA 2I5IA 3WG6A 1M7PA 2BXVA 3LTYA 4X3ZA 4GYKA 4UQDA 4FF5A 1W5QA 5I7GA 2PTDA 3TP4A 1NVMA 1Q85A 1CXEA 3P93A 2ACQA 4B5SA 4TR9A 3V16A 2INFA 4IQJA 1ZSXA 3PFRA 1JZ7A 1WDPA 4D8LA 2ISVA 2XVNA 4U33A 2BMBA 1TELA 1MQRA 3WK3A 3L4ZA 4WOQA 4CEUC 4W7UA 1EC9A 4M6UA 4ZO9A 3DG6A 2A5HA 3CWOX 2QPSA 1AG1O 2W91A 4GCAA 3QPZA 3NPWA 3F5LA 2AMXA 1GOWA 3V1PA 4C6OA 1NDVA 3HBLA 4KCWA 5JIWA 4S2BA 3TYUA 3W29A 2HTMA 4S3FA 4KERA 1FFQA 1RJPA 3ZXWA 1W2VA 3ZLFA 4RNFA 5CPSA 2R24A 4UMAA 3NQAA 4QS6A 3CYJA 4KRUA 3LRKA 1GQIA 5BRQA 3JUGA 1M68A 3RFAA 1U5JA 1XW8A 3WJWA 2ZUMA 1EIXA 5DT7A 3N2CA 2H90A 4G6CA 3FFSA 3RM9A 1TVLA 1DJQA 3OBEA 4IG2A 2IXUA 2ZZ5A 6ENLA 1FVPA 1BYAA 1X8FA 1V03A 5ABGA 1BTMA 2IPWA 1BF6A 5A94A 3LS9A 1S2UA 1WXZA 4DF0A 4PTMA 4LJ3A 5A6BA 4DN1A 6REQA 3FJ4A 2O56A 4XBSA 3EX4A 1H0GA 4A8IA 1JAEA 4C6CA 1T7LA 1QOPA 3MZ2A 3VD7A 5J5RA 1JD7A 1IEIA 1W9VA 4O1CA 3UZXA 4Y90A 3RO6A 5HPOA 4GRSA 2X7VA 1GJPA 3PZTA 4C7GA 3VILA 3GVQA 4IQLA 1H62A 1BAGA 2JF6A 2C18A 3R58A 1WYIA 1RSCA 2AMGA 1EUNA 2FZBA 2CHOA 1MEIA 2Z26A 5KMYA 3GDMA 4TXEA 2NWSA 4JYDA 3UWVA 2XN0A 3RF9A 2RGLA 3VNKA 3A12A 3O06A 1EDTA 3SRKA 1EBHA 2EPMX 4DBUA 4QNWA 2YB4A 1ENUA 3VMPA 3KOWA 4NIRA 2PWGA 3CIVA 5ABEA 5J5DA 4UIOA 3W83A 1IEWA 5SWUA 3GK0A 1EXPA 3NUKA 3W71A 1HN1A 1GQJA 4K37A 2JGYA 2Y1HA 2W5FA 4IJCA 1MSSA 4JTRA 4E2OA 5FI8A 4D6IA 5IM51 2BODX 3BAIA 3PBVA 3B0XA 3IJ8A 2FZ8A 1W5OA 1W54A 1PZ3A 5EBAA 4HMDA 1EKOA 1HNYA 2B7QA 2ZIDA 2YJQA 3W1AA 4H6KA 2BBFA 3NSXA 1XIGA 3LTSA 1VGAA 1AQHA 3LK6A 4DO4A 4XZMX 1QXLA 3IGXA 2BASA 1Y8BA 5G4EA 3ONCA 1PYFA 4EPBC 1AL7A 2D23A 3UJ2A 1EJWC 1TA3A 2C8NA 4LNYA 3LBCA 4RCXA 5EY5A 4E8DA 3S5YA 2VZOA 3LN3A 3F2BA 1W8GA 3BGGA 3EWXA 1XLLA 4YLWA 3ZOAA 3UA4A 3O6DA 3MMWA 4LVBA 3QV8A 2EHHA 3EDEA 4XAGA 1DBTA 4F79A 4S3BA 4C1KA 5KZMA 1OY0A 3R8GA 3SSZA 3E2RA 1ZP3A 1QWGA 4AD4A 4DO7A 1XIJA 1S5NA 1H7WA 5A8NA 1MZRA 1TREA 4XKYB 1O7AA 1U83A 1FCUA 1LUCA 3W0KA 3N6HA 5CPMA 4NL1A 4H19A 5FJTA 2DUAA 3CHCA 4UR7A 4LCRA 3KRZA 1TJ1A 2VDIA 2HXTA 2DZUA 3NQ7A 3UPMA 1HVQA 1HKKA 3RYSA 3PR2A 4HTBA 3NPXA 5DFAA 4KIEA 3ARPA 4N9CA 2RHGA 3RRXA 4B9ZA 3RAOA 1NIUA 3NXFA 2V3DA 1P4CA 1AK5A 3W88A 2WV8A 3HTWA 3SUUA 3MKKA 3EDFA 1A5OC 5D02A 1MRQA 4DWSC 3MUIA 2JFEX 1JL8A 4L64A 3W26A 5G1MA 4GZEA 1WKFA 3ARZA 4ICCX 3ITXA 4ZSTA 3QFEA 3QR1A 3BG5A 2UZ9A 2GGJA 3OW1A 4I90A 3CHVA 3UNDA 4JICA 3G1FA 1L6WA 1S5WA 1R7AA 3TTSA 4MJZA 5LXXA 4XIAA 2IQDA 5M17A 1UOZA 4DJED 3VFLA 1QMLA 4ALDA 3B9EA 1MUMA 1NY1A 2O9OA 5TF0A 3RCYA 1VP5A 4HHLA 1JYXA 1M41A 1Q63A 3GAYA 4D6JA 5AC6A 3GVGA 4LAKA 3NOEA 1DJIA 3HQPA 1ZP4A 3CIWA 1I2QA 3VX0A 3HGJA 5I78A 4LBSA 2J7EA 1E5JA 5AHFA 4G9PA 1XSJA 2ALDA 4REQB 3WH5A 1XBVA 1BXBA 3KBWA 2DEPA 1K03A 5C9XA 2I14A 4RDWA 1VFLA 2RAGA 2OSWA 2WHJA 2OU4A 2BY1A 5LGXA 2ZBTA 4AW7A 4L5ZA 1KFEA 5K7JA 1UD3A 4ZB0A 4XBJA 5KZ6A 4ORMA 4JNYA 2PBOA 2AL1A 4EAMA 1O94A 3UVAA 4B91A 3FJLA 1E43A 3FA5A 5ABHA 1FWEC 3KLLA 1BGAA 4JQ1A 3ABQA 2CBJA 3W00A 3WUBA 3G18A 3U5YA 2NW0A 1R3SA 2VWSA 4GQBA 3P81A 4UQEA 5F1VA 1YE4A 3PUEA 7REQB 4A21A 2QXWA 3T42A 1C29A 1K8YA 2GDUA 1PKYA 1TIMA 2EKCA 4Q4PA 1MW1A 1UKPA 3QR0A 4TMCA 3FYOA 4FSAA 4GFSA 4IOTA 4W8BA 1Z69A 1LQ2A 1TV3A 2I5GA 1JD9A 3UPWA 2Q02A 1S2WA 1BQCA 2YCKX 3O7UA 2FZNA 3O05A 1HX0A 2ATMA 2H3DA 2BXZA 1EEPA 1EBGA 3QW4B 3E96A 3AYTA 1W9PA 1RQBA 1SO5A 1R3VA 2PWEA 4IG2B 1M7JA 4WIWA 4ZO7A 1HJWA 3IIVA 3S5NA 1PBGA 1JCMP 2WZMA 4TOQA 1DKWA 3EX2A 2VDHA 1SJCA 3E0LA 1D8WA 3HFTA 2BOEX 4XZIA 5AN7A 1H63A 2CESA 1GYNA 4J3ZA 2QPXA 5JBDA 2QR6A 3M4HA 5I3JA 5D09A 4Q3MA 3P80A 3EWZA 3BAJA 3LLDA 3AHYA 1J8VA 4J3UA 4HT3A 2FJUB 3VKKA 2ZCGA 4LUSB 1AQ0A 4GUFA 4HQVA 5C70A 2VFFA 2OVLA 4PUMA 1TMHA 2OEJA 3H53A 3VGFA 2HCVA 1L6SA 4U2YA 4KWUA 2OZ3A 5HMFA 1QW9A 1E71M 4AIBA 1NF0A 1FDJA 2E77A 1Q6EA 1X1ZA 1B9ZA 1H4PA 3TV8A 2E5CA 1CLKA 1PWMA 3ONBA 5CXPA 3VNZA 2WJZA 4B92A 3QJAA 3FKRA 2GOUA 3C4UA 4RDYA 1O1ZA 2IQ0A 1HJQA 3WH9A 2IW0A 3RCMA 2Z29A 4HSOA 4JD4A 3HGRA 3B03A 4CCDA 3W85A 1JNEA 1RA0A 2WOQA 1O5RA 1TPVA 2YXOA 1WQ5A 3GUGA 1W8SA 1CIUA 2ONEA 3TYDA 1U22A 3O6YX 3VGHA 1XISA 7A3HA 1Q6OA 1I8JA 4JIHA 3DHPA 3TXZA 1QJWA 1VBGA 1DJNA 5FF0A 1JCXA 3T0BA 1FP9A 3CBWA 1FDYA 2G50A 3NAVA 4BS0A 2VKZG 3IGSA 1KV8A 4HA4A 1SJDA 4DPPA 2GQ8A 3DFPA 1P0NA 2VURA 4KWSA 1JNDA 3ARSA 3PBMA 2ZX6A 1PHQA 3MANA 1YPIA 3FDGA 3Q67A 4EPDC 3L2LA 3S9IA 4ATWA 3O2LA 4QFUA 4ERGA 1IF2A 1QNQA 3PB2A 2XVKA 5AC4A 2QJGA 2DGAA 1FWHC 1SFSA 1E6QM 1LRNA 4FLSA 1R3WA 5I24A 2ZICA 2E6FA 4QTGA 5I3IA 5D33A 2YCJA 3ABRA 3TW9A 3TW7A 4WXYA 4WJEA 4E2BA 3VKDA 4IISA 3WQ5A 4S3EA 3NQ2A 4IGNA 1K6WA 3VU2A 4IIEA 1ZHAA 3TJXA 2DQWA 5HUPA 3VNJA 3GIQA 3GAKA 2I16A 3B0YA 3IAPA 2ZZ6A 2IKIA 1ZFJA 4KFPA 4MDOA 1CPUA 5HANA 1XKJA 2WSKA 3ARWA 1QASA 2NV9A 5TQLA 4S3CA 2VL4A 2GUUA 4A8RA 4C60A 3WSUA 5FJOA 3UXAA 3DUGA 3VZXA 3ITTA 3K8LA 1OG6A 2AGTA 3E2VA 4PC8A 3H26A 3E02A 4WVXA 1GJWA 4AIUA 3M64A 1GWJA 3FHAA 5DXYA 1DJWA 1QFEA 1VYPX 1XRFA 2J47A 1JYWA 1OHLA 4PUKA 3E2SA 4PTVA 2NV1A 1FH8A 4LCSA 5CLWA 1CGYA 5FOOA 2ATSA 4MAVA 3SJ3A 2J6XA 1EX5A 1US0A 3PUGA 2NUYA 2OEKA 1GGOA 3L7RA 3UZWA 4AAJA 3ZS4A 2YL5A 4FOJA 3QY6A 4V2XA 1HZYA 1A5UA 3APGA 3EOOA 2PDYA 4RLIA 1LUCB 1YBQA 3MPGA 4JTCA 1UKSA 4GZJA 3AIUA 4L65A 1HO4A 3PZ9A 3R25A 3G8EA 4MJ4A 1JDDA 4IIDA 4CQAA 3G0SA 4XD5A 2XFWA 4IPJA 2E8ZA 2QUUA 4C6BA 2G37A 1XQLA 2G0WA 3NGFA 2DT3A 3GDLA 5DX7A 2PDPA 1GUVA 3OLIA 3PTDA 3AO0A 1RQEA 2WZTA 4GUJA 4RZ4A 1F8MA 3WMSA 4W84A 3IV3A 3S6OA 2Q71A 5FF7A 2HS6A 3AUJA 4HU3A 3DFNA 4DZAA 3CUZA 3QBUA 5BYWA 1I2RA 4HPNA 1GT8A 1IR2A 3RLVA 8RUCA 3E2QA 3JRKA 4L7ZA 1DPMA 2X1SA 3OP2A 3PPCA 1ELSA 3U4AA 3G2GA 3V35A 1M04A 3RK8A 3F5JA 4XQ6A 3BLIA 2EG7A 4R33A 3I6TA 2D3LA 1BRLA 4PCNA 3NL6A 4AYGA 1KBIA 5D37A 1OD8A 4ZODA 2ESCA 1FQ0A 3RDKA 1V3HA 5CSRA 3TLLA 1QPKA 3BJTA 2FVKA 4HA3A 1W56A 3XISA 1ZZMA 5DCBA 4JX4A 1VRDA 4KWOA 4EIVA 1IT0A 4Q6XA 3MHGA 2DVTA 1CXLA 2X0HA 3MCNA 3VIOA 1FWDC 2PB1A 1JULA 1QRQA 2XIIA 4P7LA 4QG8A 1XLEA 2W92A 1NOWA 2VC7A 3CZKA 2QCMA 4M6QA 1AJ0A 2QCHA 4HK5A 4MUPA 4DAFA 2PDXA 2Y8VA 3H21A 3RR4A 4GUHA 3L4TA 3W1XA 2EAWA 1MUWA 4MUZA 4ZA0A 4I8DA 4C6KA 1KQYA 1KBBA 4L4LA 1J2WA 2BOGX 3MJYA 2QJIA 3GHTA 3WBAA 4K1GA 1XCXA 4U28A 1WAWA 3VIHA 2INZA 3VDAA 3R10A 3E0IA 3UG4A 3G1VA 3ZVIA 4MOZA 2WNQA 3IJ6A 1I4NA 3MKCA 1TVNA 1V02E 3WDPP 1GG0A 1CWYA 3SCNA 3EWBX 1AQMA 5K4ZA 2DY3A 5MHBA 5XINA 3SB0A 3A3XA 3MWCA 3ERPA 2JEQA 4URIA 3SQMA 3ZM8A 3RU8X 2A6NA 4KCUA 1ZCCA 3TNBA 4C1NA 1NDYA 1POKA 3AYSA 3GWQA 1XLDA 1HTIA 2I56A 4F0MA 2YA0A 4WY0A 2MNRA 1OB0A 3QQ0A 1OFAA 4S2CA 4IH3A 1XHGA 4ACYA 1YDVA 3SO7A 3GC5A 1J12A 4AZ6A 3PM6A 5REQB 3DECA 5HPCA 3UCDA 1YW1A 1EO7A 1B1YA 1VFMA 3TTYA 4HMCA 3QZEA 4G7EB 2OSXA 1CECA 3U8GA 3WLLA 1WZAA 1X98A 1IT8A 3SFWA 3M5ZA 5HATA 2QGHA 4ZXLA 3TKFA 1XC6A 3WK1A 2VFDA 2GSJA 3PTMA 1TV4A 4PUWA 1UMYA 1UZHA 1PX3A 3P8JA 2ALRA 4N9DA 3H6OA 4AH7A 4XD3A 2VC9A 2VELA 2XTKA 1JCNA 4IP4A 3NFUA 4BQ3A 3CPUA 1XYAA 4WCJA 2ZWYA 3W2NA 3L0NA 1PX8A 1O12A 4JX5A 3D47A 1YXYA 1Y5VA 3N2XA 4Q8QA 2YX0A 4EAYA 3DKJA 1RLDA 2NVAA 3WNPA 3STPA 1QPNA 3CNYA 4ZFCA 1DE6A 1KNWA 3W1TA 5I77A 1DXEA 1I60A 1YYAA 4LEQA 1C91A 1WDWA 2J7DA 4PH6A 4AU0A 2Y62A 2ZZ4A 2BVYA 1UQYA 3CK5A 2YIHA 1LROA 4DUVA 4R5EA 3REQA 2GWGA 4NT0A 5C71A 1AL8A 3IJ7A 3BCFA 4MKVA 2JALA 1UZDA 1V7AA 2IKGA 2J74A 2CETA 4QCEA 4GC4A 3GIYA 3QF0A 4NJKA 4RPPA 1QUMA 3C8NA 3DIPA 4A6GA 2FDMA 3M47A 5A3HA 3W2JA 2WNZA 2BTMA 1UD5A 1EEXA 4RV8A 1KCLA 2GOKA 3UD6A 2XM2A 4JTSA 4PRTA 4ADTA 1PIFA 2WNNA 3OGVA 1LL6A 2F8QA 1E0XA 1RP9A 3BJFA 4FNUA 5HAOA 4E4PA 4D72A 3H12A 1H7XA 2Z2BA 4Z0SA 3W7PA 2WXDM 2R82A 3OB8A 1Q4WA 1FBAA 1R38A 3WJXA 1VZWA 3UCQA 4CU7A 3OA5A 2PPGA 4YS1A 3PVFA 1A3XA 1EP1A 4HNTA 2WO5A 1Y7VA 4GIRA 4YIWA 4E6MA 3L4XA 1GZ1A 3VCRA 4PCPA 5DCEA 4IPIA 1QHZA 2BOFX 4KMQA 2GGEA 1PVNA 1G69A 1W9XA 1PZ2A 4RXFA 4XK2A 1GW9A 3PZQA 2NVDA 9XIAA 2BLEA 5HINA 2VGGA 4UFLA 2G3NA 3B0PA 4QEHA 1SMDA 2OWXA 4FS9A 1DJHA 2FVLA 7ENLA 1ECEA 4IMEA 2NQJA 4JNZA 3WLOA 1XR2A 1V6WA 3OVRA 3THCA 4JIRA 4DM1A 1Z3NA 4GVHA 3TH6A 3WLJA 4FOUA 2D20A 2IXVA 4MB3A 2HJPA 4H4IA 1HG3A 3CUXA 2E67A 1KFJA 3UY7A 2J8FA 4HGXA 1XLBA 5CBJA 2GGGA 3PNUA 4MZYA 4KEUA 4MLRA 1OT1A 4M82A 4PTWA 4Y9MA 5DLCA 5A2AA 3KCJA 3WBWA 4FX6M 4K7YA 4K8GA 5DO8A 2Y8KA 5D8ZA 2E9LA 1XUZA 1N55A 1K6AA 4B5WA 1H7OA 4G5DA 3OG2A 1V6UA 1XS2A 3A22A 1WAUA 2HBVA 5BWAA 2YXGA 4R34A 2HV5A 1C90A 1XP3A 3GDRA 4XTDA 4O12A 4QJ4B 2A7RA 4FNPA 1IXQA 2JGQA 1LCOA 5JU6A 1S46A 1DWFM 4XZNX 5FEWA 1PDZA 3WH7A 1E40A 3ARTA 4K7VA 3O07A 5F1UA 4LCQA 1KXVA 1LLOA 3S47A 3T0CA 1SGJA 4IXHA 2Y85A 1GG1A 3NQCA 3QLLA 4F2TA 1CXKA 3D3FA 1FKXA 2WCGA 3PB0A 4M56A 3CQ0A 3M5XA 4DF1A 3CUGA 4Q4RA 3W84A 3THUA 3KE0A 4R3UA 1TUFA 4OKDA 3LI0A 2WJEA 4KQNA 1GOXA 5CQ1A 1Z8AA 4YWIA 4JIQA 3IACA 2REQB 4XUYA 1TPFA 4GY0A 5HNRA 1IIGA 2I9UA 3EGJA 2A21A 3FW6A 5HJLA 1Q6LA 2QS8A 2YZ5A 4ADUA 3G0XA 1VFSA 2PDLA 4U2ZA 2I57A 4YNGA 3W02A 4AC7C 1TPB1 2YCIX 2CLPA 3ES8A 3URBA 2DP3A 5KZEA 1AODA 3F2DA 4DI8A 5DMYA 2XISA 1W1TA 2YLAA 3FDKA 1VPQA 1S3TC 2X1TA 1E72M 4C6MA 3H70A 1P0EA 2RKXA 1E9LA 2D1ZA 3WH8A 3UQNA 4WUIA 4AZ7A 1MI3A 3MBFA 2WJFA 3RIKA 5I6SA 2PGWA 3QVQA 3Q37A 5I00A 5CKSA 2P76A 5XIAA 4M51A 1TRIA 3WUEA 2BGNE 3IJLA 3M0XA 5D32A 2OO6A 5K9CA 3IIPA 1XKYA 1C8QA 5D2XA 3ATYA 4K3ZA 1NARA 3WEMA 1XRSA 1SU5A 1E9ZB 1XJBA 2ZTKA 3IRSA 3W1LA 1M7XA 3ELFA 5AC5A 4JN6A 4CNTA 2H3BA 3WZ0E 4BCEA 4C6PA 1VS1A 1V02A 1NDWA 3UJEA 4MWAE 4AD1A 3DYMA 4V28A 1PTGA 4UQAA 5D9PA 5LIXX 1VIWA 1ALDA 2PDJA 3SY1A 1C93A 1TX2A 4PUNA 2R1NA 3W7RA 3BZGA 4C6EA 1TIWA 4AX7A 1FOBA 2CNCA 2J13A 1RZMA 1O95A 2J27A 1X6UA 3RHGA 4W4QA 5JIPA 3U0HA 3BTNA 1VBJA 2C0AA 4DXVA 4K38A 1FRBA 3CAWA 1HT6A 1ZGDA 3DKLA 1KWKA 4FAMA <