2W6RA

Crystal structure of an artificial (ba)8-barrel protein designed from identical half barrels
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
233
structure length
223
Chain Sequence
MQRVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADKALAASVFMRELKEYLKSGQAVVVAIDAKRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structure of an Artificial (Betaalpha)(8)-Barrel Protein Designed from Identical Half-Barrels.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
total genus 69
structure length 223
sequence length 233
ec nomenclature ec 4.3.2.10: Imidazole glycerol-phosphate synthase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2w6rA00
3M7WA 1YPIA 3NZ1A 3UXDA 4FX6M 3RK8A 2XFWA 1KTBA 3LHTA 3LTPA 4UFKA 2OZ0A 1LLWA 2I1OA 4N6EA 3L66A 1T96A 3F1QA 3QW3A 4LVAA 3W7MA 3R2GA 2CZDA 4OGZA 3W1RA 2BLEA 1ICQA 3THAA 2YGYA 4LW7A 1ZY9A 1J5TA 1K03A 2Y62A 3MHGA 4Y6GA 1GTEA 3NR0A 4XQ6A 4JTGA 3NGJA 4JX5A 2H3DA 3MO7A 5H2ZA 2Q8LA 3QPZA 2GJLA 2ZCGA 1OFPA 4YMZA 3TC7A 2PCQA 5EMUA 1OK6A 3VKJA 1H1ZA 3THQA 3KVJA 1XDLA 2PC4A 2JKAA 1LDCA 1VHNA 3GAKA 4UMAA 3DBPA 3W7LA 1TPFA 2VEPA 1JCJA 1G4EA 4MZ1A 4Y90A 1OF6A 3CQ0A 2QDGA 4ORMA 5IBXC 4JTLA 4NZFA 4EF9A 4UFLA 3SGUA 1M7PA 1TTJA 5KZDA 5CPNA 3LHYA 2YYUA 4RXGA 4S2CA 3PAJA 4IMGA 3M0ZA 3EWUA 4PEKA 5LGZA 1JCNA 4JTSA 2YYTA 3G1VA 1YADA 2A7RA 1VRDA 2PRLA 3A21A 5DELA 3WJWA 1FWRA 3FA5A 1LCOA 3A23A 5C55A 1M6JA 4HHPA 3KRUA 3QSTA 1FWNA 3G8EA 4BWLA 3NQVA 3STEA 3P61A 4J9JA 1GZGA 3W85A 2WNNA 2O7QA 5K9XA 3UWWA 4DF1A 3R89A 4RR4A 5D03A 5HNRA 3S6DA 1TCDA 3ABQA 1R2TA 2CW6A 2QJIA 4R53A 4N9CA 1OYCA 4WOQA 4LC8A 4B5NA 3R5EA 2E68A 5BNKA 3VCRA 5G2IA 2DZPA 4BI7A 1VCGA 3BARA 1GVFA 1W56A 2CLIA 3GDMA 4JEQA 1PHWA 4AVFA 3QJAA 1A5SA 4HNNA 3W6YA 3NAVA 2QEZA 3MYPA 3UNDA 2WSYA 4DPQA 4O50A 4GJ1A 4RV8A 1W31A 3S5NA 1R47A 1KM4A 1LOQA 3LI1A 2NV1A 3QEZA 2VKZG 3HGRA 4RCXA 3G0XA 5AHFA 3FOKA 2VENA 3RLUA 1Z48A 2VELA 3ZWSA 1NSJA 1BKSA 4WY0A 1NAL1 1IGSA 5AHNA 1KM3A 3W1MA 3MP3A 3QMRA 4Q32A 4D2JA 4UR8A 1SFJA 3HBLA 5F2LA 1B9BA 5G5IA 2VFGA 4FNQA 4JDYA 4EF8A 2GOUA 2VFFA 2WKJA 3NQ2A 3DI0A 1TSIA 3LXAA 4ZZ9A 3I7RA 3EXRA 2DZWA 4HSNA 3CHVA 3S1XA 1VYRA 4WD0A 2GJNA 3IVTA 3G0SA 3S1WA 2Y6ZA 4K8EA 1XC4A 1WA3A 3WFAA 5D37A 3IGSA 1L6WA 4U4MA 3MP5A 1KW1A 4N4PA 4ZVJA 2BWGA 1H62A 1GTHA 2QCDB 3DKJA 3QFEA 3LHWA 2X1SA 4UNLA 4OQVA 5HINA 3DFNA 3ABSA 1JQVA 4O4VA 4O14A 3ZS4A 2E6YA 1MXSA 5U4NA 4EWND 5D33A 1RV8A 1WOAA 5HWJA 4GRSA 4Z1BA 1G69A 2CFFA 4QNWA 2QAPA 3KXQA 5K3VA 2LLEA 1K7EA 2Q3RA 1LRNA 3B04A 3W7JA 5G4EA 3S1UA 3CLMA 2ATSA 4UMCA 5KINA 3OVRA 1H7PA 3L2IA 5DLCA 2NV2A 2R8WA 4O8RA 5LNRA 2ISWA 2QJHA 3W84A 3GR8A 3LTSA 3OG3A 1W5OA 1W0MA 1T8XA 3QZEA 3P82A 2HTMA 1TPUA 3G1AA 3PBWA 3NPXA 4GUIA 3BVJA 3NVTA 4MVAA 5C54A 5L9FA 2CLKA 3P60A 3W7OA 2EPHA 4S1FA 3TSMA 4E2BA 1KM1A 3SR7A 4JTTA 4N9BA 1ME8A 3E96A 4I7VA 5AC8A 3PM6A 5FEPA 2GQ8A 3NL2A 1XBZA 4UUIA 4KFNA 3S0CA 2J27A 1AW2A 2DZSA 1BWLA 4MZYA 1JULA 3W7EA 2AQWA 4O10A 3GZ3A 1TB3A 4ZQOA 1H51A 1H63A 4XBSA 3IGUA 1GPWA 3LHZA 1I8JA 3NPWA 3W70A 5LGXA 4WY0B 1ZCOA 3BLIA 2DZUA 3G22A 5TBOA 3K30A 4W9TA 3FJLA 1SO5A 1AMKA 4ZQNA 5AYZA 1J4EA 1O4UA 5D02A 5BMXA 3T7VA 1CX9A 3A9IA 1F74A 5LNVA 1OX4A 4HNVA 1P0NA 1TTPA 2Z6IA 3T4CA 5F2IA 3MHFA 1QR7A 2OT1A 1K8ZA 3LCGA 3HIJA 3W2NA 1JR1A 3QPYA 2UV8G 4LC6A 1F05A 3HG3A 1B4KA 1SQ7A 4OE7A 4RX0A 1FX6A 2ZA2A 5DBUA 3CWOX 5G1YA 1PCKA 1MZHA 1TPDA 3GB6A 4PCFA 3T44A 4C1LA 1FDZA 1FCVA 5I3HA 2VXNA 5CPMA 2I9EA 4MY1A 3EEGA 4XZ9A 1VLWA 1X1ZA 1JCLA 4X9SA 1F5ZA 1QPOA 3TV8A 4ML9A 1GG1A 3L65A 2VEIA 4M6VA 1RQHA 1JRBA 2RH9A 2E6DA 1SO4A 5F4XA 1UJPA 3CU2A 2DZXA 5H91A 1G7UA 4WY0F 5KTLA 3GDKA 1DL3A 5E0KA 1T0OA 4AMAA 5LHEA 3HF3A 1QNVA 5A8GA 2CLMA 2ISVA 4QISA 3G1HA 1BEUA 1OX5A 3P8IA 1W3TA 1Q6RA 4O1CA 4O52A 1NFBA 2ZRWA 3IVSA 1X7FA 4FNRA 3N9RA 3B03A 1EEPA 1IIHA 4A2SA 3E12A 1ICPA 1RR2A 4ALDA 4A2RA 4GFSA 4NJHA 4UTWC 3LGEA 1F7BA 4FX7A 4LUIA 1QWGA 3ANYA 3HGJA 1G4SA 3WK1A 3ZFHA 3USBA 2YZRA 5CZ0A 2YR1A 4RZ4A 4LWWA 5AN7A 1ADOA 1SSGA 4O1DA 3GVGA 1ME9A 3L5AA 2E6FA 4QSHA 4QNEA 3RNDA 1TPB1 2V8ZA 2ZRVA 3TMLA 4O15A 3M1ZA 2ZRUA 4MKNA 3CB8A 3P81A 3STFA 3RF9A 2BX7A 2ZRXA 3NQDA 4I7WA 1P4CA 1D3HA 1OG0A 1KFKA 3LTYA 4FXRA 4PFMA 1GWJA 1LBMA 3QH2A 2E6AA 4PTNA 3R8RA 4L4LA 1YXYA 3MMTA 4WOZA 2YPIA 1TTQA 4LVBA 3O63A 1IIGA 1T99A 1H7OA 4OWGA 3I6RA 4AWTA 4JIQA 4TMBA 1ZAJA 5FF4A 5EKYA 4DO6A 3EWWA 1ZNNA 2WOQA 1DJQA 1F73A 1XBYA 2C18A 3M5ZA 3FFSA 3B8DA 2ZRYA 3IIOA 1I4NA 2B7PA 3BO9A 3E02A 2P1FA 2ZTJA 3C52A 4Y9AA 3CWNA 1Q45A 1O95A 3G18A 4HN4A 3MI2A 4NJKA 4UXDA 3LHVA 3QSRA 2FFCA 1THFD 1NVMA 3QMSA 4BR1A 2B4GA 5AC6A 4AB4A 1FBAA 5T26A 4LS2A 4A22A 4GBUA 2ZYFA 4JDBA 5AHIA 1YLVA 3LRMA 2FLIA 1L6SA 4A3UA 2EHHA 1QDSA 2FDSA 4NXKA 3L0GA 4OV4A 2DJXA 3NYZA 1E51A 2Z0IA 2Y7GA 3G1SA 2CLHA 4FNPA 1UUMA 3N14A 3DZ1A 4FO4A 1TPVA 2QAFA 3NPVA 3C2EA 3TJLA 1TQJA 4P2VA 1OFAA 1GG0A 3ABOA 3HQ1A 5KITA 4KFOA 4O4WA 1LM1A 4LRTA 4MY9A 3W1AA 3M41A 4E38A 4JICA 4ZQCA 2CLEA 4K38A 1O5KA 5HWMA 3W83A 1UASA 5KMYA 3NPUA 4ADSA 2R94A 1EA0A 3PG9A 5AFDA 3DKLA 1KM6A 3FKRA 3G0UA 1Q6LA 3VE7A 5E93A 5G1TA 2C13A 1WOBA 1A5AA 3FLUA 1W1ZA 1C8VA 4POCA 3WJSA 1P5BA 3S5YA 1DV7A 1XCFA 5D38A 1HFBA 1VYPX 3QQ0A 4NNAA 3RLVA 4JXCA 3UY8A 1KBJA 5G2HA 4O57A 3OVPA 4K36A 3B0PA 5HJLA 3GYEA 3LX9A 1H60A 1KV8A 3SGZA 1EWDA 2V2CA 1SU5A 4Q4KA 1S5VA 1GJPA 2GQ9A 4JTFA 4HIBA 2E09A 2NX1A 3DI1A 5CZJA 3TFCA 3R12A 1LRQA 3G1DA 5SWUA 3PB0A 2I14A 1OYAA 4MLRA 4TMCA 2EKCA 1FQ0A 1N55A 2DZTA 4IX2A 3O1NA 4CCEA 2QKFA 1AK5A 3BPWA 3B0UX 5F1UA 4RXFA 5HUOA 5K4ZA 3V1PA 1FCQA 3EX3A 3HB9A 1JJKA 2NWRA 5EYWA 5MHBA 4JD4A 1L9WA 1VYSX 1YTDA 5D04C 1YDVA 7TIMA 3PB2A 3IEBA 3QF0A 3GDRA 1WQ5A 2H8ZA 1KFLA 1ZALA 3W1QA 3W7DA 3M47A 1OFEA 2Y85A 2PRMA 3WK0A 1ZAIA 3PSVA 3TC6A 3BLEA 4FHAA 4KKXA 3KVKA 5K4XA 3TQKA 3A5VA 2A6NA 2H6RA 5HWNA 3NQGA 2BTMA 4UMBA 3NNTA 3IVUA 4M5PA 4HSOA 4O1BA 2V5LA 3W75A 2CZEA 5CPOA 3Q58A 3W07A 1DJNA 2A4AA 2HSAA 1I2OA 4NX5A 3W1XA 4Z1AA 2BZNA 3HGOA 5AHMA 4NU7A 1TQXA 4JYEA 1OX6A 5J5DA 3LCLA 4RZ6A 5EA9A 1SO3A 1SUXA 2HS6A 3LDVA 1MEWA 4XTIA 4NT0A 1MEIA 1H7WA 2CZ5A 3NQMA 5ABTA 1AG1O 2C0AA 5DN1A 2PE4A 1VGAA 4O16A 4UTWA 3W74A 2ZFAA 3EKLA 4O0KA 3D0CA 4DELA 1U83A 4CCCA 1YXCA 1Q6QA 5KZMA 1XUZA 3NO5A 3W88A 4K6AA 1LOSA 1SZFA 3I65A 1OABA 1W8SA 3B4UA 3W22A 3FS2A 1YTKA 4LVFA 2YFOA 5F4WA 5EPDA 5CZSA 5LNWA 5IM51 5K9DA 5AHLA 3L21A 4AWSA 3DGRA 2FQIA 4M6QA 4O11A 2DORA 4M7TA 3W1UA 1F76A 3JRKA 3LCXA 3EX4A 4Y96A 2AAMA 2A6LA 1SW0A 3NQCA 3CEPA 4WQ6A 3Q2DA 3HPXA 1ZENA 2VC6A 2V81A 1B57A 4UTLA 2TSYA 5DXXA 2Z1BA 1BWKA 1DOSA 4Z0SA 2JKPA 2WPBA 4GWEA 4DO4A 4ZQPA 5F4SA 1TPEA 3TU9A 1RQBA 4WUIA 4UTJA 2E5CA 2GQAA 2A5HA 1PCWA 3F4NA 3KRSA 1WX0A 3DHFA 4GUFA 3W1PA 4AXKA 1JQXA 3KFTA 3DFSA 2RFGA 3N9SA 3MP4A 4YCPA 4CLMA 5DXYA 3NXFA 1F2JA 3TROA 4JIPA 4L4MA 3CIXA 1FWWA 2B7NA 3GXTA 2RHGA 5BOOA 1W5PA 5AYYA 3HO8A 4N4QA 2ISSA 2W79A 3TH6A 2J9ZA 3EX1A 3DH7A 3QC3A 4PA8A 1HL2A 2TRSA 2G95A 3TKFA 4IJBA 3C3NA 1TV5A 4JS3A 3LBMA 5I3IA 1SPQA 3W1NA 5F2MA 2J9XA 3W2JA 2ZZ5A 3A24A 3W1LA 3WJZA 3H53A 4IX0A 1RQEA 2WNQA 1S5TA 3KRZA 4UTIA 4PH6A 4RKAA 2X16A 1GVQA 4QAIA 1UUOA 4I7UA 4GUGA 3SIZA 1PIIA 3FYOA 2A0NA 1LP6A 3LLFA 4K37A 3QQ1A 3VNDA 4LUJA 4UR7A 2X1UA 4AEOA 4UNKA 3GDLA 1U5JA 4HNUA 4PL2A 1KTNA 1TIMA 3EWZA 3Q37A 2Q3OA 2OJPA 3M9YA 1H7RA 4CNOA 4JTEA 2C6QA 4RZ5A 4JYDA 1QPRA 5I3KA 1A53A 4O1AA 3B06A 3SZ8A 4H4IA 5AB3A 1KTCA 1OFOA 4NNCA 5D30A 2B7OA 4QIUA 5I3FA 1D9EA 1WYIA 3P8JA 3TMQA 4LVGA 4JY9A 4NVTA 3W7PA 1OFDA 4JTKA 3V75A 1V7YA 4NUWA 4GXMA 5CKSA 4ZQMA 4O28A 3CM4A 3GDTA 3M43A 3TSDA 3KHJA 1LTDA 4HKPA 3C61A 4GNJA 2Y63A 2EGZA 1DKWA 4JR5A 2NUWA 4O54A 3LRKA 3TQ0A 3I68A 2QUVA 1SFLA 1HUVA 1XL9A 5FF7A 3OA3A 5FEWA 3UXAA 1IF2A 1NF7A 5D2VA 1C9DA 1H5YA 1A5CA 3RMJA 4XTDA 1Z44A 1ZHAA 2OT0A 1L6YA 3BK0A 4DBEA 3N34A 2NUXA 3WJXA 4YCOA 2C14A 2OX1A 1ZFJA 1S3HA 3HPZA 1UBSA 3LXCA 1F6KA 4UTHA 4RLIA 2EF9A 3NQAA 4O18A 3ATZA 2EAWA 1DBTA 1CI1A 4OT7A 2NXGA 4M6PA 2RKXA 3T78A 3CEUA 5E1QA 4ADTA 4UTUA 1QPNA 2VFDA 3L5LA 3W7RA 4O53A 2DZVA 3FIGA 3LB0A 2B0MA 3UPBA 3CPRA 3LM7A 5FF2A 3NG3A 1GYLA 5DCDA 3C2RA 4O0ZA 1C29A 2QUTA 3PF3A 3L5MA 2QR6A 1XUUA 2Z6JA 4LU0A 4Q33A 2Y61A 4UTKA 2F84A 4QITA 2PRHA 1VZWA 3PBYA 3EKZA 1YDNA 3NL5A 3PC0A 2ZZ7A 3W72A 1V5XA 3W9ZA 4MY8A 3MYOA 4DXVA 1ICSA 1P1XA 3FYPA 3MJYA 1Q6OA 2H8XA 1KBIA 3INPA 4XUGA 1XI3A 3P67A 1IXPA 2ALDA 1OHLA 4CNPA 4EVZA 4JTJA 3W86A 4LTSA 2DP3A 3NQEA 2ZA1A 4UCGA 5K9CA 4CQAA 1B4EA 4S2BA 2X2GA 4Z1DA 2O7SA 2FTPA 2Y88A 1IXQA 2KZHA 5FF3A 3TA6A 3GXNA 2ZDRA 4IMDA 1EPXA 2A85A 2G5WA 2TYSA 3PBVA 3G8RA 3KVMA 3LV6A 3TNOA 3OVQA 4KWWA 3W23A 1SO6A 5U7SA 5GVJA 3EWYA 2ABAA 3UWZA 4MFDA 1TYGA 2GVLA 4DF0A 1LORA 4MFEA 4UFJA 1A5BA 4WXYA 1Q3NA 3P5ZA 2WSQA 4HPJA 2WV8A 1KFJA 1X8FA 1QOPA 5F2GA 1PS9A 1RVGA 3W7QA 3H55A 5EL1A 4IPJA 2YFNA 3I7QA 4FIRA 4IPIA 1K8XA 2WJZA 2NUYA 5K2ZA 4AH7A 1KFBA 4JN6A 4PC8A 2ABBA 1H50A 1I2QA 2CLFA 4N2YA 3PULA 2ZZ6A 2C19A 1EUNA 2R91A 4WZHA 2NX9A 3NOEA 1O5XA 3C56A 3C0JA 1TREA 3P80A 3GAYA 4AF0B 3BW4A 4HT3A 4LVDA 1TV7A 3IIZA 1VS1A 4YXGA 1ZAHA 4K7YA 3N73A 2ZZ1A 3LCWA 2ZRZA 4IXXA 1NF0A 1W5NA 2YX0A 4NX0A 2E5BA 3BW3A 3QM3A 1G7VA 1QO5A 1QMLA 1TRIA 3OIXA 4X3ZA 2VFHA 4U28A 3EXTA 3NQFA 4MZ8A 1H7XA 5KZEA 3NM1A 1H61A 1I2PA 3LCFA 1TO3A 1XFBA 3O8AA 3BGGA 3O6DA 3O15A 3MW7A 4I9AA 4WXZA 1CW2A 1SW7A 3G3MA 5A5WA 3L68A 4JTIA 2Z2UA 3TAOA 3TFXA 1WAUA 4JGDA 3DFPA 3IRDA 5CSRA 5DY3A 3SY5A 2YDAA 1QO2A 2F7FA 3GLCA 1GQNA 2CLOA 5D32A 4CCDA 3C2OA 2NXIA 1KA9F 2VFIA 3ATYA 5HUPA 4AHPA 4CNNA 1VLIA 2FB3A 1Z42A 5LZLA 1D3GA 5BMWA 4HPXA 4R33A 2JKEA 4XBKA 3ELFA 2W0UA 3E0IA 1EP3A 3A22A 2C16A 1DVJA 2QF7A 3EWXA 2WSRA 4FNTA 4O19A 5D2XA 1HG3A 3PUDA 4WX2A 5AHEA 3O06A 1RZMA 1SR9A 3W1TA 4A21A 2VEMA 2G96A 1TPWA 2QJGA 4LNYA 4ICNA 4X2RA 2Q8ZA 3SJ3A 1FCUA 2J24A 2QCFA 1F6PA 3DAQA 4JYFA 2W6RA 2A7PA 2A2IA 4K7VA 5I3GA 2JK2A 1HO1A 5D09A 1TPH1 2HS8A 2C1HA 5DBTA 4N9DA 3UZ5A 1BTMA 3MWAA 1M5WA 2NZLA 1QOQA 1OFBA 1YPFA 3KOFA 5I3JA 5KSWA 1GOXA 4BK9A 1GVOA 1MO0A 4GC4A 4N6FA 1W37A 2Y7FA 3SFKA 3NQ6A 2V5BA 5CPLA 3S5ZA 2A1YA 4AHOA 4PL1A 3M16A 1LZOA 2V2HA 3UWVA 4K8HA 3BGJA 4JX6A 3W71A 3KX6A 1FWSA 1XBVA 1Y0EA 5HULA 2NXHA 1EWEA 4BWLC 4ZMGA 2TPSA 3T40A 3NZRA 4TX9A 1Z41A 3GXPA 1B3OA 1NEYA 4WJEA 1JCYA 4MJZA 2NWSA 1UB3A 1KLYA 3DFOA 2V9DA 3HOJA 3TW6A 4ONVA 4N02A 4JTHA 1LBFA 1X6UA 3LRLA 4GE8A 2ZQ0A 3P7YA 2ZZ3A 5FF0A 3EB2A 4DPPA 1H1YA 1YXDA 5D05A 1RD5A 1R30A 1K8YA 3LERA 4Z08A 4FXSA 1OJXA 4GUHA 6TIMA 3NQ7A 4LOCA 4M7SA 3C2FA 5F1VA 3U6WA 3W7CA 4G1KA 4MPQA 3NL6A 4NXSA 5HR6A 3F4WA 4QM1A 4IMFA 5C5YA 4A29A 3W7KA 2GPTA 5LNUA 4FIQA 4QQ3A 1OF8A 5BRBA 2Y89A 4N9EA 4LV9A 3UD6A 3HPSA 4NJIA 3GNDA 3B0VC 2C3ZA 3E49A 1EP1A 3DFTA 5FEZA 4YL2A 1LYXA 3QRHA 4IUOA 3TXVA 3CC1A 3PG8A 2Y70A 2V0TA 3GIYA 2NX3A 4CQ8A 1ME7A 3WJYA 3OHIA 2ZA3A 1VQTA 3C8FA 4NJGA 3AJXA 1SW3A 4ADUA 4GUJA 3BG9A 1TJPA 2V30A 3WK3A 1VHCA 4UFHA 4MIMA 4AF0A 4UTTC 4TO8A 3G1XA 1N7KA 1VC4A 2XN1A 1KLZA 1GT8A 3DXIA 3PUEA 3PY2A 3TX9A 4NQ1A 1I2RA 8TIMA 4AWUA 5K7JA 3HG5A 5FI8A 3PS7A 1PL9A 1G67A 1G4TA 3TQVA 4JNMA 3GKFA 2WNZA 1GVSA 5TIMA 1EB3A 1GYNA 1QAPA 1XM3A 3EX6A 3PR2A 4DBDA 3HG2A 5C2XA 1K3UA 2OCZA 3P74A 4MYXA 1LLZA 3E9AA 3KVLA 4FB7A 4MOZA 3T55A 3A5FA 3S42A 2D73A 2GVGA 4ORIA 2WQPA 4OV9A 2JGQA 4E2DA 4Z1CA 3WK2A 3HG4A 3CT7A 4TU1A 1MEHA 1JUKA 3R13A 3W2UA 1QCWA 3UWQA 5EY5A 3W3OA 4DQWA 3TK7A 3U8GA 3W2MA 5HR7A 4UC5A 4IQLA 5EBUA 3W76A 2X1RA 2YXGA 4LY8A 4X22A 2GVJA 3W2LA 1EP2A 3UZJA 1SSDA 3N2MA 1KM2A 4LS0A 4KWVA 1KFCA 3H54A 4NJJA 5IBXA 3S8HA 2PURA 3DENA 5HQEA 4O17A 3GK0A 2TMDA 5TQLA 3SI9A 3MI3A 4XKYB 4ZQRA 2ZZ4A 2E1DA 1K7FA 1XKYA 3TUUA 1O94A 3BG5A 4LT9A 1DHPA 3IIPA 2RDUA 4MLJA 2FPVA 3AO0A 3NDOA 2HMCA 4DO5A 3MBDA 1PV8A 3BW2A 3TW7A 4FNSA 1EX5A 3LCHA 3MUXA 3TXZA 5J5RA 3L67A 4P61A 3M5YA 2V2DA 3M5VA 1JCMP 3NEVA 3LBCA 1A50A 3O6CA 3MBFA 4JTUA 2YW4A 1TTIA 2H3BA 1I45A 3O07A 4TIMA 3GKAA 1PHQA 2CWNA 4JY8A 5DCEA 4RK8A 3S1VA 4AHQA 1W5MA 3IIVA 2JBMA 4DEFA 5CGQA 5CZTA 2VEKA 4O13A 1WDWA 3W2KA 1FY6A 3W7GA 4BI5A 3M6YA 1TMHA 3ZR4A 3W7NA 4YWIA 3N3MA 4Z0JA 4MUZA 1ML1A 5CSSA 3LXBA 4NNBA 1ALDA 1S5WA 1JUBA 2CU0A 1QPQA 4DF2A 3BV4A 3ABRA 3MI6A 1L2UA 1X1OA 5D2TA 1EUAA 3IIXA 2FPYA 2G97A 4XWUA 1XXXA 4MYAA 3SECA 4C1KA 3O05A 2OMAA 4LRSA 2FB2A 5C6MA 2A7NA 5FESA 3IGXA 2AGKA 1FXPA 2B7QA 3GR7A 3O16A 1GEQA 3TAKA 3RFAA 4R7JA 1TV8A 3O6YX 1EIXA 2Y7DA 1O60A 2V82A 4TR9A 3TE9A 1W3NA 3QW4B 2ZTKA 4Y8FA 1WBHA 2QCDA 4R34A 3FEMA 1QFEA 4XKYA 2FPTA 2QUUA 3NM3A 2ZBTA 4UFIA 3UWUA 2R14A 4IMEA 3PUOA 4BI6A 4EIVA 3HJZA 2E77A 2Y7EA 2J9YA 1LROA 2WO5A 1AL7A 3C2VA 3P5YA 3EWBX 4FEZA 3P84A 2J88A 3DU0A 1OX4B 2CZFA 1R2RA 1OK4A 5FEXA 4OHQA 2YCEA 1G6CA 2BSLA 1FCBA 3VE9A 3LV5A 3M44A 1WV2A 1VCVA 3C6CA 3IV3A 1TPC1 3U2OA 5BW6A 1VH7A 3SSJA 3GNNA 1DORA 3LHUA 2QCNA 3HMJG 4RJEA 1VPXA 4OBTA 2DU2A 3S9YA 1JVNA 3OEXA 3W7HA 1FWTA 1KM5A 1WXJA 1LOLA 3LCIA 2XN0A 3M5XA 3S5OA 1H7NA 2VOMA 3L9CA 1OVDA 2YSWA 4NZJA 3RU6A 3CIWA 3TIMA 2JGYA 1FUYA 5AOUA 3P62A 1YYAA 4BFAA 3L0KA 4FNUA 2RDTA 5AYXA 1PE1A 1OYBA 1W5QA 1JUEA 4HNTA 2A21A 1KV5A 2DJLA 2BXVA 4H6KA 1ZJIA 3JR2A 3LLDA 3VFLA 5G4WA 3LI0A 3UY7A 3STGA 3NL3A 5LNSA 1K02A 5LSMA 1SZNA 1AW1A 2CLLA 3W7IA 1VJIA 4QJ1A 3G24A 4LS1A 3C4UA 1DQXA 1OFQA 2NLIA 4FF7A 4KFPA 4PODA 3LOTA 1IXOA 3EX2A 4FX8A 2QCLA 2QCEA 3YPIA 5CG7A 3N2XA 3JS3A 1MSSA 1LBLA 1SZEA 1UCWA 3VI2A 3I7SA 1M7OA 1PVNA 3ZWTA 2X1TA 1G4PA 1W3IA 4IWWA 5AC7A 3W87A 4UIOA 3NA8A 3FKKA 4OU1A 1RPXA 3DHDA 3PSWA 2ATMA 2QCCA 3PBUA 1N8FA 2QCHA 3HGSA 3TR2A 1WBJA 5DY2A 2VFEA 1ONRA 1YTEA 3CTLA 5LHFA 3F03K 4M19A 2X30A 4BF9A 3UYCA 1AL8A 2QCGA 3G3DA 1TRDA 1FXQA 4H3DA 3BLFA 4EOUA 2YW3A 1AW5A 3B05A 4O12A 3TCEA 4AAJA 1YDOA 1FDJA 1R46A 1J2WA 3L0NA 3G1FA 2H90A 3PVFA 3W73A 1HO4A 1HTIA 3SW6A 3BG3A 1JRCA 2IQTA 1P0KA 3N19B 2RDWA 1GVRA 3DFQA 1FDYA 1K7XA 2XN2A 4MJMA 1I2NA 5HMSA 3TSBA 3UQNA 1VR6A 1R2SA 2QDHA 2J6XA 1LRTA 3PWAA 3G1YA 1SZGA 3TDFA 1JCXA 2E5DA 5G2WA 4IMCA 3QYQA 3NQ8A 1XDMA 6ALDA 3UWYA 1XBXA 1W54A 4E0CA 3FJ6A 4LV4A 3STCA 3UPWA 1OFRA 4IXHA 3EXSA 4UFMA 5L6UA 1KFEA 2P0OA 1DQWA 2C15A 4CQ9A 2P10A 4YLWA 4ZL1A 5D2WA 4JX4A 4IGHA 4UTMA 1VCFA 2ZZ2A 2QCMA 3OBKA 1KM0A 1TJRA 4UTTA 3Q94A 3MHUA 3GX9A 4K39A 1IXNA 5DCBA 5D2YA 4IOTA 3TJXA 5LKYA 2FIQA 2FJKA 3QMTA 3KAOA 2GUUA
chains in the Genus database with same CATH superfamily
1XLLA 3PZ9A 3LPFA 3RK8A 4DUVA 1EXBA 5HATA 3LTPA 2ZWZA 3PZUA 3ITGA 4ACZB 1M9HA 3QW3A 2C7FA 3GU9A 3QHMA 3TW9A 4MGGA 3WUEA 3THAA 2ZUSA 1XLEA 2QPUA 1AA1B 1KXTA 3VX1A 1XCXA 4R9XA 3N11A 2FHBA 3CHCA 3VKJA 3KVJA 1XDLA 4XSLA 2GDQA 1HNYA 1BHGA 1JZ8A 2J66A 3TJIA 4LB4A 4RL3A 4WDXA 3CZGA 4XZMX 4P5UA 1OF6A 4FF5A 4E3TA 1S39A 4MF4A 4NZFA 3WLTA 3KS5A 3VGGA 2ZDSA 2WSPA 1NWRA 3AIVA 1TTJA 5KZDA 1BSIA 4ICMA 3PAJA 1U1UA 3ZO9A 1TX0A 1AD4A 4P8UA 3NUKA 1JCNA 1Y5XA 1XH0A 4JTSA 5I0DA 3DGBA 2XVGA 1YADA 2A7RA 5DELA 4XAFA 3A21A 3FA5A 3A23A 1ODUA 5I2UA 2ZVIA 3QSTA 1FWNA 3G8EA 4XO6A 4DO7A 3HQPA 2YCIX 1O7AA 3WFZA 2PLJA 4DF1A 2OVLA 5D03A 4HTYA 1TCDA 3ABQA 3DG7A 1R2TA 2XISA 4QG8A 3T2QA 3R5EA 2O4MA 5BNKA 2VWTA 3BCDA 3GDMA 4JEQA 1MUMA 4AVFA 2DIKA 3ZOAA 1PB0A 1ZU8A 4IJCA 4DPQA 4J7RA 1KR0A 1OGGA 3S5NA 4Q4SA 1R47A 2W63A 3VILA 2ZUMA 2NV1A 3WUFA 1QOXA 3HGRA 4RCXA 4U10A 3GS6A 4AX7A 1U5HA 5AHFA 4H8HA 3VVGA 2WKLA 1Z48A 4BS0A 1NSJA 1JF5A 4LYRA 1IGSA 3MP3A 3QMRA 5BWFA 2HNHA 4W93A 1ISYA 1HGYA 1S2TA 5G5IA 4B3KA 2VFFA 1RPKA 3DI0A 3SCRA 3LXAA 5HNTA 3I7RA 2YA2A 4L1WA 1HVQA 4HSNA 1UMYA 3UW6A 3WBYA 3ZMRA 1GVIA 1R86A 5DANA 4K8EA 3M0XA 2OEMA 4AD1A 1V93A 4U4MA 2PDBA 1E3ZA 3MVIA 4PRRA 3QFEA 4L4OA 3WELA 3MV11 1CXEA 5FJOA 1XS2A 1EXPA 4LCSA 4KPLA 4OQVA 1OINA 3TNBA 2BY1A 5U4NA 1RV8A 1RK6A 2HE5A 1G69A 1HKMA 2QAPA 2FMNA 4GX9A 1US2A 5LIWX 2ATSA 5KINA 4G7FA 1WZMA 3QY8A 2I5QA 4O8RA 3V0UA 4GVHA 2QJHA 1GOIA 3LTSA 4D71A 3OG3A 3KLKA 1W0MA 1T8XA 3QZEA 3P82A 1H11A 3WF1A 2QGYA 1KBLA 4GUIA 3NVTA 5L9FA 1P43A 3P60A 2EPHA 1EKOA 1HJXA 4JTTA 1ME8A 5AC8A 1KRCC 3U5YA 5FCZA 3NDYA 4C7DA 4KFNA 4YYFA 1JCTA 3ARZA 2DZSA 1BWLA 4LB3A 4MZYA 2YA1A 1H51A 4QCFA 1EBGA 1BYAA 1FHVA 3IGUA 3UYIA 1TV3A 1AQ0A 4ZB0A 3NPWA 3TYBA 3F5LA 2WXDM 5TBOA 5CLWA 3J7HA 2ACQA 4W9TA 4KCUA 1SO5A 1AMKA 4GY7A 5D02A 1WKFA 1J12A 3T1GA 1F74A 2WJDA 5LNVA 2Y8VA 1BYDA 2PODA 1HQTA 1VEMA 2Z6IA 4US5A 2EEXA 3MHFA 1S1PA 1K8ZA 3LCGA 3HIJA 4LC6A 1YX1A 3WF0A 1F05A 4PCSA 2DSZA 3CIVA 1TUFA 2VNCA 1KXHA 3BZJA 4YVXA 1PCKA 1GW9A 1TPDA 4KCWA 4PCFA 4TVCA 5I3HA 4HZMA 3EEGA 1VLWA 1X1ZA 1F5ZA 3GG0A 3AUJA 3BQ5A 1GG1A 3L65A 1RQHA 3S6TA 4GHRA 1JRBA 2HCVA 4GOAA 1SO4A 1Q4NX 5F4XA 1UJPA 3CU2A 1G7UA 1F6YA 3GDKA 1DL3A 4AMAA 5LHEA 1OSEA 3T0CA 1DXIA 1P7TB 4PMUA 3SCOA 5ENLA 2CLMA 3ZM8A 3WF3A 2MANA 3G1HA 1BXBA 1RP9A 1XYFA 3IVSA 3LBOA 5HQMA 3DX5A 4A2SA 3QKZA 3RG6A 2I57A 4F4RA 4ALDA 1EJUC 4GFSA 4A2RA 1EOMA 4HA0A 5AECA 1QWGA 3QLDA 3HGJA 3ALGA 3ZFHA 2JQXA 3BCJA 2XSAA 1ADOA 4PB3A 1MNSA 4UQBA 4QSHA 3AI0A 5ABGA 2ZRVA 4O15A 1GKRA 4NASA 3RF9A 1NP0A 2BX7A 4RE2A 4E8CA 2ZRXA 4Q4RA 1WKEA 2X42A 1GWJA 1LBMA 3QH2A 3KP0A 3BTNA 3KEHA 3MMTA 4HU3A 1JPHA 2P53A 3OBEA 4JEJA 3QYSA 7A3HA 3I6RA 2BHZA 4JIQA 3NVDA 2BXZA 3IJDA 4DO6A 3EAUA 2PA6A 2WOQA 2DQWA 3B8DA 4Z42C 3VIHA 1R9XA 1DJGA 3WH8A 3E02A 2ZTJA 4IL2A 4Y9AA 1JDFA 3CO8A 1O95A 1HJVA 2E25A 3LA4A 4AZ7A 4M1BA 1THFD 3L4XA 2HVMA 2XGZA 5AC6A 1IWAA 4Y7EA 1FBAA 1EQCA 4A22A 1UR4A 1VEPA 2XTKA 5A8MA 5IHSA 2EHHA 3E38A 1QDSA 1UD6A 3L0GA 2IXUA 2GWNA 2DJXA 1K9DA 4GIAA 1XYMA 3NGFA 4BQ5A 1LG1A 2D0FA 1KRAC 4FP1A 4NF7A 5E5CA 1J0JA 3DESA 3DZ1A 4H7ZA 3NPVA 3TZFA 1Q4WA 4JNYA 3TJLA 4PRWA 1B2YA 2XSBA 5A8PA 1JPKA 4W7VA 4KFOA 4O4WA 4MY9A 3R8GA 1S2VA 3M41A 4E38A 4ZQCA 3A4WA 4K38A 2PP0A 1AD1A 4H9YA 1AODA 3DKLA 1KM6A 3G0UA 1HN1A 1C8XA 5E93A 1HGWA 4W89A 3FLUA 1RBLA 1DEDA 3FEQA 1XCFA 3H21A 3RLVA 2VVNA 4I8DA 3OVPA 3B0PA 3F2BA 3LX9A 1KV8A 3SGZA 1EWDA 4JTFA 4ROPA 2E09A 2NX1A 3TFCA 4QLJA 3WMLA 3WUBA 3AHXA 3PB0A 1OZQA 3GG1A 1J9YA 1GW1A 2IKIA 3UESA 2OYKA 1I9CB 2XUCA 2BOGX 4TUFA 4CCEA 1MRAA 1XHGA 3B0UX 3WYZA 5F1UA 5HUOA 4L80A 3EX3A 5EYWA 1RHCA 2VR5A 2CZVA 1YTDA 2O9OA 2P0IA 5D04C 7TIMA 2WQDA 3U2ZA 2P3ZA 5I24A 4C5ZA 2A3AA 3W7DA 2DH3A 4PMNA 2Y85A 4CU8A 3PSVA 3GVRA 4FHAA 1FTXA 4KKXA 3KVKA 1RD6A 5A2AA 4Y9MA 1KXVA 3TQKA 4K8GA 2V5LA 2F38A 2WZTA 2YZ5A 3UXLA 4CU7A 5CPOA 3QN3A 1XLAA 2HISA 4Z1AA 3W1XA 1UC4A 1OX6A 3NWRA 5J5DA 3NEHA 1XYZA 2REQA 2ZE3A 3LQGA 1EJXC 1SO3A 2FGBA 4JCMA 3GNRA 4NT0A 4YN5A 3UVAA 4GYJA 2CZ5A 1VFHA 3NQMA 5ABTA 2J75A 5EB8A 1CGUA 3WBAA 1UKTA 2PBOA 3ES7A 3VZYA 3VIJA 4DELA 4CCCA 3GHUA 1YXCA 3FGCA 2J7DA 1Q6QA 3CYJA 3PPCA 5KZMA 3N4EA 1G94A 3AWNA 4K6AA 2DIJA 2QYGA 1OABA 3W22A 3FS2A 1VIZA 3WLRA 2VZSA 3W81A 1EBHA 1WZAA 3WD0A 5AHLA 1X1NA 4HA4A 2WZEA 3IANA 4M7TA 1JYVA 1QBBA 3JRKA 2VI0A 4Y96A 1D3CA 3NQCA 3CEPA 4AZ5A 1ZENA 4CEXC 2V81A 1V6XA 1HX0A 4GWEA 4DO4A 3TU9A 1RQBA 2J7CA 1WUEA 1KCZA 4AVOA 8XIAA 2I17A 3CUJA 4M1RA 1PCWA 3F4NA 4LANA 1S2WA 4IG2B 4AZIA 2XPKA 3MQTA 4AXKA 2E67A 4O1EA 5C9RA 3REQB 1J6OA 5E9AA 3IUIA 4YCPA 3CPGA 4D6HA 4IQJA 2ZX5A 4L4MA 3F4DA 3GNOA 5GPRA 4UNIA 5AYYA 4WKHA 1UP0A 5JMUA 4IJBA 3C3NA 1TV5A 3WDJA 3LBMA 4AD4A 4RE0A 2J9XA 1ZP4A 3W2JA 2P5NA 1IQ8A 3A24A 3W1LA 3SCTA 3WJZA 3H53A 3GU1A 4PH6A 4C65A 4C6LA 1LWJA 4AXNA 1OT1A 4QAIA 5EU9A 3MJMA 4QJ5B 3QBUA 3LLXA 4ZE4A 1IZCA 2WM1A 4UQEA 2D0HA 4K37A 3SEPA 3QQ1A 1H4PA 1MDRA 4A4AA 3OZYA 1XRFA 1O68A 3GDLA 2BGQA 3GW0A 3KCLA 2J8FA 4HNUA 3H8AA 3ARVA 3OHMB 3S2CA 5GJNA 1H7RA 2E9BA 3JVAA 4CNOA 4JTEA 1WDSA 1A53A 1FWGC 4V28A 3KTSA 2JE8A 1RK5A 3P3BA 3M0KA 4X0VA 3B8TA 1Z69A 2CPUA 1Q8AA 1IT0A 1V7YA 2DT3A 4NUWA 3VNYA 1W9UA 3O7UA 3OIHA 3TSDA 3NSXA 3SUTA 2WVVA 1DKWA 4GA8A 2D2OA 1NELA 1HKJA 1A0EA 4CN1A 5FEWA 1IF2A 1FWEC 3D5HA 5D2VA 3GVWA 1BRLA 1JAEA 4Z1YA 1TWZA 2DPEA 1L6YA 1CT5A 4GZ7A 3N34A 1ZJHA 4H19A 5HPCA 3B40A 3AU2A 5CPQA 3OO2A 4V2XA 1S3HA 1TKKA 3G5EA 2R1PA 3HM7A 3LXCA 1F6KA 4UTHA 3QTPA 3MDUA 5CPSA 2BBFA 1CI1A 3O9NA 1QVBA 2NQZA 1QPNA 3W7RA 3BAIA 4KWSA 5BXRA 2RGLA 2BDQA 3KWSA 3NG3A 3I4EA 1GYLA 4R27A 3D3FA 4O0ZA 3JUGA 3GZAA 1GOMA 3PF3A 1YHTA 1V0LA 7XIMA 1SJBA 4QITA 3EBVA 4NZCA 3IJ8A 2VRJA 3KRBA 3PBYA 5LIUX 3W4RA 9CGTA 1YDNA 1ZRQA 3PC0A 2ZZ7A 3W72A 3MYOA 1VBUA 2IKJA 2DY3A 2H8XA 4XUGA 1XI3A 3P67A 1UR9A 3JU2A 1IXPA 4PUKA 2UY5A 4MB5A 3W86A 2DP3A 2ZA1A 2PF8A 4Z1DA 2PDIA 2O7SA 3GTFA 2KZHA 5FF3A 3TA6A 2ZDRA 3S2JA 1GQLA 2X7VA 4MHBA 4HVXA 3B0YA 3ARRA 4PMOA 3K1DA 5U7SA 1KCLA 4TOQA 1KWKA 5HAOA 2ZIDA 5LIXX 4MFDA 1TYGA 1JIBA 6A3HA 4UFJA 3AAMA 5E6ZA 5DT7A 4I6KA 4H2HA 1CXFA 4IH3A 3VD3A 3TR9A 4GI8A 2J7HA 4DBSA 1KFJA 3PZVA 1IE7C 1RVGA 2W61A 1E1FA 4LBSA 4ICCX 3H4WA 2PDFA 2YFNA 4OBRA 2NUYA 4D1IA 2ABBA 4AISA 1I2QA 2CITA 4QX4A 5M2FX 2BASA 3CL6A 2ZZ6A 1EUNA 2R91A 3W6MA 3TYZA 5HNUA 4MTVA 1P0BA 3C56A 3TYEA 3C0JA 1H0GA 3C8NA 4OZOA 3N1AA 2PDUA 4J5NA 3VIIA 4HT3A 3N18A 1ADSA 1N8IA 1T6MA 4YXGA 1ZAHA 2PDHA 1XWYA 1CCWB 4IXXA 4C91A 3TLQA 1XSIA 1W5NA 5FJJA 2RJHA 2E5BA 4Q4OA 1J0HA 4HSHA 3CWHA 3T2OA 3H23A 3UJ2A 1UD8A 1UH2A 5GQBA 2YDQA 3GVQA 3EXTA 4HD5A 4PBGA 1UKOA 1TO3A 4AD0A 3BGGA 4GJIA 2ZUWA 3O15A 3HZ3A 1M03A 4AD5A 1OCBA 3L68A 1WAUA 1XIMA 3DFPA 3OU8A 1KNWA 3VKDA 5CSRA 4CD5A 1QO2A 4C6NA 4G8TA 1EEXA 2YCJA 4CGTA 5CBJA 1SJDA 2NXIA 2X1IA 1VLIA 5HA7A 1I0DA 1VIWA 4PULA 1YIXA 3OGRA 4PFHA 4XBKA 3E0IA 1QTWA 3MTWA 3NIYA 4FNTA 4O19A 4C6JA 3WQVA 5AHEA 4U31A 3E3HA 2FMOA 6XIMA 1UR8A 1R3WA 1UH3A 4GLEA 2J79A 4S3BA 2QJGA 3GDBA 1FCUA 4QEHA 4LEFA 2W6RA 1C93A 1E6NA 2XH4A 3U5UA 4K7VA 4DWSB 4TX6A 2ANUA 2JK2A 1TPH1 2HS8A 3ZLGA 1DYSA 5DBTA 3UZ5A 1W2VA 1M5WA 2NZLA 4L6DA 4X2PA 4D72A 4HNLA 1QNSA 5MKGB 4GC4A 3DFHA 3WNNA 3ALFA 3EEZA 4XISA 1HZYA 1W3LA 6ENLA 3WH9A 3QY6A 3S1GA 3PZIA 1QNQA 2PGRA 3VINA 4JIIX 3AISA 3WQWA 2F8QA 1NWSA 3VNMA 2O4QA 2FGLA 1LZOA 3WNMA 3FK4A 4JX6A 1IWPA 4EACA 1GQIA 4Z2GA 2TPSA 4S38A 2WM0A 1Y65A 3NZRA 1DXEA 2Z1SA 3LK6A 4V27A 2WZMA 1MRQA 1KLYA 4A8IA 1BVZA 3CZEA 4ONVA 4JTHA 1LBFA 1TV2A 3LRLA 1TR9A 3IJIA 3SAZA 3EB2A 4UZUA 2GDUA 3UGVA 1R30A 3LERA 4CD7A 2PD5A 3BLOA 5FJTA 3WF2A 4OFCA 6TIMA 4M7SA 3C2FA 3CMJA 2VZTA 5F1VA 4ZBCA 2FKPA 3SJNA 3AYSA 4MPQA 3EB4A 4BF5A 3DC8A 4GGBA 1NP2A 3CUXA 4GISA 4GI9A 3B97A 4L4PA 5LNUA 1OF8A 1ONEA 3DHPA 4NJIA 3P93A 3VUSA 3E49A 3L2LA 5FEZA 3DN5A 4YL2A 1LYXA 3U9IA 4IUOA 3HFTA 5A95A 3VYLA 4CQ8A 3WJYA 4LAMA 3OHIA 2WBKA 4IGSA 1VPQA 1OIMA 4PUWA 1XGEA 1Q7ZA 3AJXA 1E3XA 1A5OC 1M7JA 1UZHA 1VHCA 4UTTC 1EJSC 1C9WA 1DJXA 1N7KA 1Q6CA 2WAGA 4MNJA 2REQB 5I6SA 5JUVA 4NQ1A 1I1WA 5FI8A 2XWDA 2E9LA 1G4TA 2W62A 3TQVA 4JNMA 1GHSA 5A8NA 3CT2A 4HJWA 4FLSA 2WVTA 4LUYA 3OGSA 2DIEA 1SJAA 1K3UA 3APTA 4FMVA 3JZEA 1M41A 1YE6A 3F5JA 1LLZA 2GVGA 1AJZA 2DW6A 4OV9A 4Z1CA 2AMXA 3KL3A 3CT7A 2QJMA 5LIKX 3ZZ1A 1MEHA 1JUKA 1C90A 3W2UA 4HQVA 2IPFA 1QCWA 3UWQA 3CHDA 4GI4A 4DQWA 4W87A 3W2MA 4UC5A 1XYAA 5EBUA 5D9MA 4W8AA 2YXGA 2GVJA 5BROA 4GYKA 3AALA 4R7OA 1KM2A 4LS0A 4KWVA 3EDJA 4NJJA 3KWXA 1JGIA 3DENA 4O17A 3ZSTA 1WE5A 5TQLA 1R3QA 2GGEA 1E55A 4XKYB 2WMIA 2ZZ4A 1TA3A 2ZADA 4HMNA 1ECEA 3PK7A 2A3LA 1HP5A 3BICA 3S83A 4FI4A 1O94A 1XGZA 1GONA 4MLJA 1DIKA 3BOFA 5FOOA 4L65A 1OC5A 3MBDA 2XINA 4CNTA 2CNCA 2WCSA 3GYCA 3MUXA 4F2BA 1BRLB 1XH2A 4MWAB 4P61A 3IJQA 3KCOA 2V2DA 2Q71A 5FJIA 3KOYA 1JCMP 3O6CA 3F7JA 3MBFA 4JTUA 4JFUA 2BB0A 2H3BA 3O07A 1C3FA 5D8WA 4RK8A 5DCEA 4ZTXA 2VM8A 3IIVA 5TAOA 4MJ4A 2XIBA 1SZRA 1WXZA 4H9TA 1XSJA 2V38A 3W2KA 3GXFA 3SCPA 2PWUA 5FSDC 4BEQA 1TMHA 2J25A 4DN1A 1XIIA 1FWFC 4MUZA 4H9UA 2WPGA 5C70A 1ALDA 1TWWA 1JUBA 2CU0A 4GX8A 3KLLA 2XFYA 3ABRA 2FZ8A 2J4GA 4K1GA 1X1OA 1I0BA 5D2TA 3GE7A 1EJVC 4W7UA 2GWGA 3IIXA 3SUWA 3K4WA 5I07A 4C1KA 1HJSA 2Z27A 3C5QA 2OMAA 3PTDA 5C6MA 1E70M 2J7EA 5A6MA 1HKVA 3IGXA 2PDCA 3VDBA 2YL9A 4WDTA 3ZLFA 1G01A 2Y7DA 2XGBA 1V3JA 4Y8FA 1RCXB 4GG9A 4R34A 1OBAA 2OFJA 5EBAA 2QUUA 2NQJA 3PUOA 4BI6A 3CZJA 4QJ3B 3HJZA 3PUGA 3TTEA 3H2FA 5IRPA 5BZAA 3P84A 1E4LA 1FWDC 3DU0A 4IF2A 1OX4B 1REQB 1ITQA 3DECA 4BJHA 1R2RA 4E2OA 1XIJA 5D9PA 3S2NA 1J11A 3MUAA 3VE9A 3LV5A 3M44A 4HOZA 3C6CA 1TPC1 3U2OA 1MQPA 1AH0A 3T0TA 1TG7A 3QPEA 3OZOA 3HMJG 3BDKA 1REQA 3B4YA 2FVMA 3SRFA 1VPXA 1JI1A 1WXJA 1PAMA 2XN0A 2YJQA 3W24A 1QW7A 2Z29A 1B3YA 2FZMA 1BQCA 2CKSA 2E40A 4OBSA 3TYCA 5A6AA 4NZJA 3CIWA 3CV6A 4IFKA 4RE4A 4DWSA 1XP3A 4OTKA 5AOUA 3P62A 3F2CA 3L0KA 4JIHA 4OOZA 1R7AA 2V5DA 1JUEA 3VDGA 1XLIA 4E4FA 2Q8XA 4XZLX 3JR2A 3VFLA 2DUZA 5G4WA 1UMLA 1B9ZA 3NL3A 2CLLA 3F5KA 1VJIA 5DRCA 3QOKA 3CL8A 4KFPA 3LOTA 4FX8A 4FSAA 2QCEA 3YPIA 3WNKA 3JS3A 4B5UA 1LBLA 1M7OA 1PVNA 4I9JA 1W3IA 3IS4A 5FL0A 4Q8OA 4IWWA 1LG2A 2R82A 3QZAA 4X60A 2J77A 1R3SA 3W87A 1UOKA 3FKKA 1HJQA 3KL0A 3WQ8A 5C9WA 2QCCA 3PBUA 5BOEA 2QCHA 3R11A 1I1XA 4HHLA 1AFSA 2VFEA 4QQUA 1BGAA 3NO1A 1YTEA 3CTLA 4B5WA 3F03K 2X30A 1TRDA 1FXQA 3BLFA 3R0KA 3B05A 3TCEA 3URNA 3AMDA 5JH2A 3AXKA 3GW3A 2I7GA 2Q02A 8CGTA 4Q22A 3S5SA 2EG8A 2IQTA 1P0KA 2EXOA 2E9MA 3N19B 2RDWA 3CV2A 3S47A 5A6BD 4IIDA 3RO8A 1FDYA 4C7GA 2XN2A 2D3NA 2W5FA 2DVXA 3TSBA 1VR6A 2V5JA 3R6IA 4Q4PA 2G50A 4J35A 2D23A 3G1YA 3PBGA 3SADA 1P0EA 3AXMA 3GH7A 4MNMA 3QYQA 1Q13A 1XDMA 6ALDA 1R6WA 1W54A 2H9AB 3QKEA 1OFRA 4IXHA 3EXSA 4WK9A 2KX9A 2GJRA 5JBDA 1VBJA 3H2EA 4RPQA 2D2HA 4ZL1A 4PUJA 1M1BA 4IGHA 1QHOA 1VCFA 2QCMA 3UJSA 4IPNB 3MUIA 4PTVA 1TJRA 3MHUA 4EK7A 3UR2A 5I3DA 1IXNA 4DLMA 4PZVA 5D2YA 4ZB5A 2L5HA 5LKYA 6PTDA 2DUXA 2FIQA 2JF7A 3UZZA 1E6QM 2EPLX 5T26A 1OD0A 4HMEA 3KDNA 1YPIA 5T91A 3N25A 3NZ1A 4IZGA 3UXDA 3VNLA 1XRTA 1KTBA 1PIFA 3LHTA 1XJBA 4UFKA 2OZ0A 2XH0A 1CLXA 1B3XA 4RDVA 4XAZA 1BG4A 2Y4SA 2WJFA 5ECVA 3F1QA 1R5YA 3W7MA 3R2GA 4OGZA 3W1RA 1ICQA 1VAHA 2YGYA 1K03A 1GTEA 3NR0A 4PBEA 3EOUA 4UR9A 4GACA 4JX5A 1BAGA 2H3DA 3MO7A 1E43A 8RUCA 2Q8LA 2FFIA 4FS9A 2VR4A 3W28A 4YMZA 3N17A 1OFPA 3SM0A 4G7EA 4IP5A 3UERA 1E0WA 3K2GA 4YTRA 3W7LA 4F79A 1FWJC 1JCJA 4JFVA 3IRSA 4Y90A 3ZJ7A 2XVKA 4ORMA 3ZR5A 4KCTA 4EF9A 3KOWA 3WLHA 4NAFB 3SGUA 4F0SA 1VFOA 1EF2A 4INFA 2IQDA 3ARPA 3S46A 2J7FA 4DXXA 4IMGA 3EWUA 3B9AA 2F6KA 1OM0A 3D46A 1QW9A 1VRDA 1FWRA 4GZEA 1M6JA 2UWFA 3KRUA 3LY0A 4JHOA 3VMPA 4BWLA 3KDOA 4J9JA 1GZGA 3ONCA 5I02A 2O7QA 1TJ0A 3UWWA 7REQA 4QTGA 3R89A 4GVIA 5HNRA 5AYIA 2WZIA 4D6DA 4ZXOA 4N9CA 1OYCA 4LC8A 3OJGA 4B5NA 4DWSC 1S2AA 4EXQA 3VCRA 2DZPA 1VCGA 3T8QA 5FJPA 5EFFA 1PHWA 3EMZA 4QE1A 4HNNA 1A5SA 3W6YA 3UNDA 1Q66A 4GJ1A 2WLZA 4RV8A 1KM4A 2BGNE 1PKYA 4AY7A 1IT7A 3GXIA 3I6EA 9RUBA 3FCPA 2VKZG 1RJRA 4RDZA 4JFTA 2QVNA 4M6UA 3AZSA 2FVLA 1K8CA 3FOKA 4ERAA 4Q7NA 1NAL1 3KUMA 3VNJA 4UR8A 4D2JA 1S38A 3BSGA 5IHRA 1U5VA 3FJNA 4L9YA 2VFGA 4JDYA 3UPMA 3WEOA 2NSOA 4K1WA 4W5UA 3EXRA 2DZWA 3O6AA 4WD0A 1TVPA 4GNKB 1L0PA 1FP9A 1Q6DA 3DC0A 1XC4A 3WDIA 2ACRA 1L6WA 4ZVJA 2BWGA 1H62A 4XZBA 3WH5A 2QCDB 3LHWA 1XC6A 1FKXA 2ZKMX 1EL3A 5HINA 3T2PA 4AU0A 2O9TA 3WL0A 3FAXA 1MXSA 2VP8A 4GRSA 1JDAA 2EPKX 3KXQA 2YA0A 5K3VA 2LLEA 4HP5A 2ONEA 3RMEA 3RCYA 1PTGA 3CJPA 3B04A 4TV6A 1NQKA 4JKKA 3GG7A 3CLMA 5A94A 2Y5SA 3AS0A 1H7PA 4DVOA 4GIEA 5DLCA 2NV2A 2VDHA 3PTQA 3WH6A 2F2KA 5IDZA 4PTDA 3PPFA 2Y2WA 3VKCA 2HTMA 2VGBA 1TPUA 4QG6A 3PBWA 1PDYA 2CLKA 3FDKA 4H1ZA 4D8ZA 4AUBA 3THCA 3W7OA 4S1FA 3ZT5A 3TSMA 5AZ0A 1KM1A 3VGEA 3SO7A 4N9BA 4ECLA 3PM6A 4LPCA 2XIJA 4UUIA 4IICA 3TTQA 2J27A 2PLKA 4ZO6A 3W7EA 1XQLA 2CHRA 4ZQOA 3FY1A 1WZKA 1GPWA 3LHZA 1I8JA 3MZNA 4Q8NA 5A3HA 4WY0B 1ZCOA 5LGXA 3WLNA 2O55A 3K30A 4L6OA 3FJLA 4ZQNA 1MFVA 3VDHA 2FTYA 4YYCA 2BOEX 3AZRA 3V5CA 3A9IA 1VEOA 3WLLA 1Y8BA 2QPSA 1OX4A 5T9CE 3M0YA 3T4CA 3WQDA 1QR7A 1VPYA 3W2NA 3CXOA 4RPPA 1B4KA 1SQ7A 1KQZA 2ZA2A 3PWIA 1CGXA 3CWOX 5G1YA 3KL5A 1B54A 1MZHA 1E0XA 1VBHA 3GB6A 3SFWA 1FDZA 5CPMA 2I9EA 4NSBA 4XZ9A 1JCLA 4X9SA 4R5EA 3SUSA 2VEIA 1XINA 3LS9A 1S5MA 4AIBA 3SQSA 2VTFA 4AZHA 1NTHA 2HE8A 1BD0A 5I78A 1QNVA 3UWEA 4RNIA 4LXFA 4QISA 1BEUA 4F40A 4O1CA 4QXIA 4RDWA 2ZRWA 1X7FA 4XD3A 4IFOA 1CDGA 3TOYA 1ZJBA 4ES4A 5KEZA 4CQCA 3NQBA 4P7NA 3E12A 2CLPA 1ICPA 3B9NA 1F7BA 2QULA 4FX7A 4LUIA 1A0CA 3MSYA 5TF0A 1UZ1A 1FHUA 2YR1A 3A6OA 1JYNA 4RZ4A 5GNZA 5AN7A 3AIRA 2ON3A 2GUYA 4GQRA 1D8CA 1ME9A 1VFMA 3L5AA 2E6FA 4QNEA 3BGAA 2VX5A 3RNDA 4PUDA 3BCFA 1F61A 3BLLA 3TMLA 1KCXA 2X09A 2ZRUA 4QGCA 4RV3A 3STFA 3STPA 1H09A 3NQDA 3HURA 1P4CA 1OG0A 4NZ5A 4NAEA 3MS8A 3VNIA 1R8LA 4P8WA 3R8RA 4L4LA 4E4UA 2YPIA 4M29A 1T99A 4ZOBA 4OWGA 4TMBA 1GEHA 1IHIA 4HA1A 3HN3A 3N2OA 5EKYA 4QFUA 2XHYA 3EWWA 3K46A 2C18A 3M5ZA 3FFSA 1K4GA 2ZRYA 3H2NA 1I4NA 3CWNA 4HN4A 3MI2A 2IKHA 3QSRA 2ZUVA 2FFCA 1JZ5A 3QMSA 2B4GA 2OWXA 3USZA 2YL5A 3T0BA 3WN6A 4CKQA 3EDKA 4UQ9A 4JDBA 3EDFA 1A5LC 1F8MA 3LRMA 4QG9A 2FLIA 1W9DM 4A3UA 1WKDA 4OV4A 4GO8A 1E51A 4P7OA 1JD9A 2Y7GA 3G1SA 2CLHA 1UUMA 3L2MA 4B15A 1ISZA 3N14A 2PBGA 4JTDA 4JNZA 4FO4A 2QAFA 3MCMA 3SCUA 3C2EA 4DJED 2P76A 1OFAA 3GH4A 1MW2A 3HQ1A 2QJJA 3CZKA 3FGCB 4LRTA 1R87A 2QQ6A 4ZGYA 4JICA 2VZOA 1JPIA 1HIZA 2CLEA 3M0VA 3BZGA 3WLSA 2VT0A 1EA0A 1E56A 1Q6LA 3VE7A 5G1TA 2PZ0A 1W1ZA 4DYKA 4POCA 3MB9A 1BTCA 1DV7A 1HFBA 3A12A 1QNRA 3PNUA 4NNAA 1Y7VA 3WIJA 4RZBA 3UY8A 2D2JA 2C91A 5DMNA 3PZTA 1O6IA 4FZIA 1SU5A 1S5VA 1GJPA 4HIBA 3DI1A 1XIHA 1XLBA 1LRQA 5ABFA 5SWUA 3NTYA 5J04A 4L5ZA 1E6XM 5G4HC 1OYAA 1B90A 4U5IA 4MLRA 2ZXAA 4L6HA 1R3YA 2DDXA 2IQ0A 4AFYA 1N55A 2OZ3A 4IX2A 3O1NA 3MWCA 4V1XA 5C9XA 2QKFA 1E0UA 3BPWA 4DWSD 5DMYA 5K4ZA 3HB9A 2NWRA 4EAYA 1CGWA 4JD4A 2J6VA 4ZO9A 1VYSX 2HV5A 1YDVA 3PB2A 2JEQA 3QF0A 3QV9A 5TNVA 4BQ4A 3MC5A 1NOWA 4YJ5A 3H2AA 3RJXA 1WQ5A 2H8ZA 1KFLA 2VUYA 3CQIA 5JBEA 3M47A 1OFEA 1J0ZA 1ZAIA 2AKZA 4NY2A 1LQ2A 4NZ1A 5XIAA 5K4XA 2A6NA 5HWNA 2BTMA 4UMBA 4B16A 3NNTA 3IVUA 2ZC1A 3TC3A 1T41A 1DJNA 2A4AA 3CH9A 1R9ZA 2BZNA 3HGOA 4GZIA 5AHMA 1GZ1A 3GHRA 3LCLA 4RZ6A 5HMDA 3LZ5A 1FFQA 3RIKA 3DYPA 1SUXA 1MEWA 1L6GA 4QE4A 5H8PA 5BXSA 1RCQA 1H7WA 5DN1A 2Q6ZA 2AMGA 3EKLA 4O0KA 1MMFA 1DWFM 2OX4A 2NSXA 3XISA 2PDJA 3KBMA 2NVAA 1J0YA 1OGBA 3NO5A 4ML4A 4ATLA 5DEZA 1LOSA 3I65A 3B4UA 4XAPA 2YDSA 4DJEC 1RY0A 1YTKA 4Z2HA 4NYUA 4LVFA 3L21A 1NDZA 4M6QA 1E4IA 3K5XA 3R7MA 3LSCA 4GQGA 4EXBA 4ZB2A 1SW0A 2IPWA 1NDVA 4WQ6A 3AFBA 3CUHA 5KETA 1EDTA 3SBFA 1B3WA 2PP1A 2TSYA 2ODOA 2Z1BA 1BWKA 1E5JA 4CNSA 4GXPA 2G0WA 4ZQPA 6XIAA 4KBXA 5F4SA 4DJDC 2OYMA 1O1ZA 2P88A 4WUIA 3B9OA 4B91A 2E5CA 3OTRA 1WX0A 4KETA 1UUQA 5ABEA 2PDPA 2OTDA 1JQXA 3DFSA 1SFTA 4WGXA 1FOBA 3FSTA 2RUSA 3MP4A 1AQFA 4CLMA 5DXYA 4FR6A 3GR4A 2R6OA 3TN3A 3U0HA 1EZWA 4IGMA 2B7NA 3GXTA 1JPDX 2NT0A 1CXHA 2G3JA 2ISSA 1DJZA 2W79A 3TH6A 3EX1A 3DH7A 3E5PA 4PA8A 3OZPA 4QCEA 1HL2A 1K4HA 3BAJA 1WO2A 4B3ZA 1OEPA 4KEUA 3MSDA 2GL5A 3H12A 5F2MA 1QPKA 2OLHA 3B8SA 3MKVA 1V51A 1RQEA 2WNQA 4IX0A 3UXIA 3KRZA 4H7VA 4REQA 3LYEA 2X16A 4F9JA 4I7UA 4GUGA 3SIZA 4J3SA 2NQ9A 1V3IA 3FYOA 1XICA 4I9MA 1MQRA 3VNDA 4LUJA 1FWBC 1DIOA 4GVFA 4HA3A 3N6JA 1U5JA 1DWJM 1MW3A 2BG5A 4PL2A 3MCOA 2HPIA 1OZMA 3Q37A 2WC4A 4ZODA 2OJPA 3M9YA 3OW1A 1RUSA 1UPPA 1Q65A 2C6QA 4RZ5A 4HK5A 4JYDA 1QPRA 4O1AA 3MKKA 4ZENA 4ZEPA 2V3EA 3HPFA 5JIPA 5I3FA 3BQ6A 1E4NA 1FWAC 2OGJA 3P8JA 4LVGA 4NVTA 3W7PA 1NOFA 2C1GA 3V18A 4E8DA 3HJEA 4IT1A 3BAXA 2GQ3A 5CKSA 2G4FA 3ITYA 4ZQMA 3TYUA 3CM4A 2HQAA 2GJXA 3M43A 3CK5A 1ISVA 3C61A 4FOUA 4GNJA 3VOCA 3IARA 2PTZA 2Y63A 5HNNA 1ITCA 2EGZA 1US3A 4JR5A 4ERGA 2NUWA 3LRKA 3ISIX 3MUY1 3TQ0A 3I68A 1SFLA 5FF7A 2IMRA 4H9ZA 4HMDA 1B3VA 1C9DA 1A5CA 1UKSA 3RMJA 3WDRA 1Z44A 2WMFA 4IIEA 3PTKA 2CETA 4YCOA 5H8UA 1PWMA 2GYIA 1ZFJA 4AQLA 5HQLA 1ZBCA 1TJ2A 3GXMA 2VD8A 1UBSA 1UA3A 3PPGA 2OXNA 1PO9A 4RLIA 4A8LA 2EAWA 1DBTA 3MZ2A 6REQB 4OT7A 4DUXA 3I3EA 1KQYA 1WDRA 5LA1A 3KTCA 3ABXA 4UTUA 4D1JA 4WHBA 4PCPA 1O12A 3FIGA 3TN4A 3CPRA 1UJQA 3HQNA 5DCDA 2GSHA 3LSBA 1VJZA 1DQUA 3VGBA 1BPLB 1KR1A 1NOUA 3KOZA 1XD0A 2PRHA 2OB3A 1LLOA 4GCXA 1CXKA 3EKZA 3VMOA 1LQ0A 2NQ5A 1P1XA 3N15A 3FYPA 1Q6OA 2ALDA 4D6IA 2J47A 4GGHA 3UVIA 2WMKA 1LT7A 4MKVA 1UIPA 1B4EA 4DZHA 2GGHA 1NDWA 1BLIA 3WLOA 2FTPA 2Y88A 1IXQA 3DYOA 3L12A 1EPXA 2G3NA 4JHZA 3G8RA 3OVQA 4JBRA 3EWYA 2ABAA 3UWZA 4LCQA 4GK8A 2GLKA 4MFEA 1A5BA 3VDAA 2ZUTA 4OVXA 4Z2IA 3DUGA 2Y1HA 3P5ZA 3AS1A 5BRQA 4Z2KA 4CQBA 5F2GA 1PS9A 2VZUA 5M17A 4KEMA 3I7QA 4ZFMA 3AIQA 1K8XA 4HK7A 1FH9A 1V6YA 4JN6A 4IPLA 5BXTA 1H50A 9XIAA 4J2PA 1HKKA 3S4TA 2BVDA 4F9DA 4PR4A 3NOEA 3ARTA 3P80A 2XWEA 1UZ4A 4AF0B 5CGMA 1J0KA 4LVDA 1TV7A 3IIZA 1VS1A 4CQDA 1E73M 2D20A 1QNOA 2ZRZA 1E9IA 1NF0A 5AVHA 2PDYA 4XB3A 4M82A 4G9PA 1E0TA 4LYKA 1DJYA 2CEQA 3SRDA 3BW3A 4F3HA 1G7VA 1QO5A 3OIXA 3ITTA 2WBGA 3TTYA 4X3ZA 2VFHA 5LXXA 3WD4A 1H7XA 5KZEA 4B5VA 1Q7MA 4Q8WA 4WKFA 2V69A 3CO4A 3CUFA 3MW7A 4I9AA 1SW7A 3G3MA 3C0LA 3TAOA 3TFXA 1UD4A 3WO8A 1JZ4A 3IRDA 3RM4A 3SY5A 2YDAA 3GFYA 3AHZA 2F7FA 2P8BA 2QT3A 2HDJA 1GQNA 1U30A 1ZCCA 1KA9F 3AIWA 1ZSXA 3BJSA 4FXFA 3N2BA 2JKEA 2XH7A 3SCVA 3A22A 2D22A 3PJXA 1MW1A 2ALRA 1V08A 1DVJA 1ZB5A 3U48A 2ZXQA 5D2XA 3PUDA 4WX2A 1ZP3A 3O06A 2VEMA 2YL6A 3ORWA 1TPWA 4UQDA 4BQ2A 5DX7A 1IGWA 4IG2A 3W0KA 1HO1A 5D09A 5GJPA 4RUBA 4W8LA 1OFBA 1YPFA 3KOFA 4H6QA 4YIWA 5A2CA 5E9XA 4HYWA 1QXLA 3WLIA 1WXYA 3H26A 4AHOA 4PL1A 4QAWA 1V4YA 2FYMA 5DMMA 4K8HA 3BGJA 1PZ2A 1Y0EA 1EWEA 4BWLC 1RXOB 3NURA 3IAPA 4MJ2A 1KRBC 2PTWA 1UHVA 2XVNA 3WG6A 1NEYA 4XZIA 1W9PA 1W1B1 4LUTB 3HOJA 3HQOA 2OWWA 1X6UA 1AH4A 4GE8A 3R79A 2ZZ3A 5FF0A 2Z1VA 1H1YA 3MU7A 4HPNA 3KZPA 3M07A 1W1IE 4ROQA 4TXEA 1OJXA 4IQEA 1UOZA 3ES8A 4GUHA 4JN8A 4LOCA 1SGJA 2CCRA 3W7CA 3AC0A 1IR1A 3NL6A 1SMDA 4QM1A 5C9UA 3W7KA 4Z2JA 1RAKA 2Y89A 4PMXA 1A3HA 3SIMA 3UCDA 3GNDA 3B0VC 3FSUA 4A8NA 4JQ4A 4DM1A 3DFTA 3G1RA 3WQ6A 3TXVA 4FLRA 3SURA 3KE0A 4ZO8A 2Y70A 4XG1A 3GIYA 1GYMA 3IAQA 4MAVA 1M3UA 2GK1B 4NJGA 1B31A 1R9YA 4DZAA 3BG9A 4PUEA 3WK3A 1TE1A 4TO8A 3MDWA 1JDDA 3LPOA 1VC4A 3UCQA 1KLZA 3DXIA 3WSUA 1EYWA 8TIMA 4LX4A 5K7JA 3HG5A 3PS7A 5CC5A 1ZBWA 3GKFA 4QROA 3RLHA 3T08A 3VD4A 4S3EA 4MYXA 2HXUA 4MOZA 2ISDA 3A5FA 4X9YA 3S42A 2D73A 3BMVA 2JGQA 1POJA 4E2DA 3V3WA 1J8VA 4DYEA 2XVPA 7CGTA 3Q45A 3SN0A 1T40A 5EY5A 3W3OA 3TK7A 1JL8A 4HNOA 2X1RA 2WNWA 3W2LA 1EP2A 1O1HA 1SSDA 4DZ5A 3N2MA 1V0KA 4D6EA 1ITUA 3PN8A 1KFCA 3H54A 5IBXA 4H8VA 4AEFA 5HQEA 3GK0A 3KBWA 4ACZA 4Q8MA 2E1DA 1XR2A 1XKYA 3TUUA 1UKPA 1GKPA 1D7FA 2ZX9A 2RDUA 2PUZA 2FPVA 3APGA 4S3FA 1JXJA 2HMCA 3H22A 3CBWA 3BW2A 3NSNA 3L4TA 3EKGA 2GGIA 5J5RA 3L67A 3A3HA 3RCNA 3M5YA 3WZ0E 3EPNA 4GY0A 2JIWA 3C3UA 4CVWA 3NEVA 3LBCA 2BGSA 1ELSA 1FWCC 2YW4A 3GU2A 3S2LA 4E8GA 4ZR8A 5CQ1A 3BAKA 2IPJA 3GRIA 4BQ3A 1PYMA 1QK0A 2CWNA 4A35A 3S1VA 5C8BB 2PDWA 1W5MA 3E6EA 3AICA 4MAZA 5CGQA 3L4ZA 4A3RA 4CEUC 1A80A 1V6TA 2Z4GA 3W7GA 3AROA 4J2MA 1EC9A 1E6PA 4JN7A 4C6QA 3N3MA 4LUSB 4GQBA 3LXBA 3U7VA 2GFTA 1QI0A 4IIBA 3BV4A 4RW3A 3MI6A 1L2UA 1GK8A 1EUAA 4ZSTA 1RALA 3B8IA 2WC3A 3H24A 2A3EA 3SECA 1WCGA 1K9TA 3O05A 1BWVA 3B8UA 3PFRA 4G1NA 2ZX7A 2AOSA 4B5TA 2AGKA 1JG9A 3O16A 1GEQA 1YNYA 4DJFD 1FFRA 3O6YX 2UBPC 5I06A 1EIXA 2I5GA 1O60A 2V82A 3FW6A 3PTMA 4TR9A 3SCWA 2FGZA 1W3NA 3QW4B 4DUWA 1DE6A 3CQHA 3EDDA 6CGTA 2PPGA 1WBHA 1QFEA 3E5BA 1XPYA 2FPTA 3NM3A 3ZJ8A 3UWUA 4DAIA 4BHYA 1NWTA 2WO5A 4XK2A 1AL7A 3IUHA 3P5YA 2Z25A 3WQGA 3GY1A 3ZQ9A 1V3KA 3HPAA 3GIPA 2CZFA 1OK4A 1G6CA 4FR1A 3UGRA 4UZSA 3A47A 3IV3A 4HU8A 2WSKA 4C1NA 5BW6A 3RUBL 1VH7A 3GNNA 1RJQA 1HJUA 3WH7A 3BV7A 3FDGA 4DJDD 4F0MA 2YLAA 4M8UA 1FWTA 4NRSA 4HNCA 2PDGA 2OZ8A 1H41A 3PWGA 2IS7A 3L9CA 3QLLA 4A3QA 2YSWA 3SSZA 1XIDA 3CMGA 1FUYA 2CERA 4N42A 1YYAA 2XJ7A 3MVTA 2RDTA 2PEVA 1XLGA 1XV8A 1Y5WA 1OYBA 1TX2A 3GTXA 4OIFA 1J01A 3VIFA 5I23A 1WKYA 3CHFA 4HNTA 1J93A 2BXVA 1OCQA 1TMLA 5H8MA 5CXPA 4NZ3A 1VB9A 1OT2A 4AC1X 3UY7A 3STGA 5LNSA 1F3XA 1K02A 1PSCA 3AS3A 6TAAA 3G24A 1V3MA 4QHRA 4IUGA 2R1LA 3EX2A 3WNPA 1D8WA 3W26A 3N2XA 4A8RA 4D6JA 1MSSA 1W2PA 4HHMA 1UCWA 2J8GA 2X1TA 3SB0A 1R3RA 1QU4A 1Q85A 1RPXA 2BP1A 4ERIA 3KHDA 1GVEA 1E40A 1XKJA 4YTUA 4PMDA 1GORA 2BODX 3HGSA 2QLYA 2DW7A 4G7EB 1TWIA 3DG6A 4AW7A 1IZJA 1AL8A 2QCGA 1VENA 4H3DA 5E0CA 1TWDA 2YW3A 2B31A 1U33A 1PX8A 4OECA 1R46A 4DJFC 2AL2A 1HO4A 1HTIA 2XIQA 3BG3A 1BXNA 1ZGDA 5C9ZA 3VOGA 4GY1A 4PCNA 5LA0A 1I2NA 3E2QA 1R2SA 1LRTA 3PWAA 2B81A 4XBJA 4AWEA 2UY3A 4J3ZA 1JCXA 5G2WA 2XZ7A 3NQ8A 5AC5A 2CIPA 3N9KA 1DTNA 1TIWA 1XBXA 4CVUA 5EMYA 2RJGA 4E0CA 1AQMA 1PPIA 1WDPA 3IK4A 1RBAA 4UFMA 2QV4A 1KFEA 5CC7A 4S3AA 2EPMX 4JX4A 4UTMA 2ZZ2A 1PZ0A 4WSHA 1UW9A 2QIWA 4IOTA 3VD5A 3TJXA 3FA4A 2VZVA 1XCWA 3QMTA 3KAOA 4KGLA 4FX6M 3S3GA 1QI4A 2XFWA 3LEPA 5CZKA 3VGHA 5CC6A 3RGTA 4N6EA 2EPOA 3L66A 4LVAA 4S3DA 1F3WA 2BLEA 4LW7A 1ONWA 4Y6GA 2MUCA 1XLCA 3PFMA 4GYFA 1EQPA 4AD2A 1A0DA 3QPZA 4JTRA 2ZCGA 1J5SA 1T7LA 5H1WA 2W66A 1H1ZA 2WCAA 2YOCA 3THQA 4W5ZA 1W1VA 2PC4A 1HL9A 2XM2A 3GAKA 1MVYA 1TPFA 3RN6A 3FVMA 1XPGA 3BSMA 1XW8A 4W85A 1KD0A 3MA8A 4JTLA 2HXTA 4WR3A 1PXGA 1PYFA 3LHYA 3MUZ1 3WLJA 1HL8A 2YYUA 2CBIA 5CJ5A 2INZA 2E0PA 4EAMA 3M0ZA 1YRRA 4XZWA 4NRRA 3LPGA 2QUNA 2XDFA 3G1VA 3II1A 1QHZA 2XSXA 1DWGM 1LCOA 5C55A 3F4CA 1BYBA 4REQB 4LEQA 3N2TA 3NQVA 1V7AA 3RAOA 2WNNA 1QK2A 4RR4A 1OQFA 3S6DA 2QJIA 2XFFA 3MPGA 1HF6A 3V5OA 2VYOA 4BI7A 1VKFA 1GVFA 4X61A 3QJAA 2QEZA 3MYPA 3EOSA 4O50A 2PGFA 4V1YA 2I16A 1XIEA 3LI1A 4GC3A 4AY8A 5CSYA 1LL6A 4AIOA 3CGTA 2PU1A 3QEZA 3M4HA 4EXAA 3M46A 3K8LA 4FAMA 3R43A 3D3AA 4XZHA 4O8AA 1KBBA 2VELA 2TAAA 1CXLA 3ZWSA 4H2CA 4WY0A 5I77A 2VCBA 4NG3A 1CBGA 4Z17A 2PDNA 3W1MA 3KW3A 4W86A 4Q32A 3BAWA 3WF4A 1B9BA 5A8OA 5LXEA 3CQKA 2GOUA 2XIIA 2WKJA 2PDMA 4ZZ9A 3WY1A 2OYLA 4GH3A 4Y9PA 2CYGA 4LF1A 3CHVA 3LD5A 5M1TA 1DWIM 4KW2A 3VGFA 3IVTA 4R3UA 3S1WA 2Y6ZA 1WA3A 2OGYA 3WFAA 3IGSA 4TVDA 2QW5A 1TJ1A 3S9ZA 3MP5A 1KW1A 4N4PA 5C7VA 3ARSA 3B3DA 4H6RA 3DKJA 4G56A 1RA0A 1E9YB 1PKLA 4UNLA 4D6FA 4EP8C 3PP7A 2W91A 3EB3A 1JQVA 2H9AA 1ZJAA 2E6YA 2O9RA 4EWND 3H70A 5D33A 3OLIA 4L64A 1UP3A 2VURA 1D7KA 2TODA 2J74A 1K7EA 1Z3NA 2Q3RA 4XX6A 1TELA 1VFLA 2G4JA 3M0IA 3VPLA 1V3HA 2QIIA 2F2HA 1QT1A 4UMCA 3OVRA 3L2IA 3VCNA 3PZQA 1DJHA 2R8WA 3GC5A 5LNRA 2PDXA 2ISWA 4YTTA 3WFLA 2PWFA 3W84A 4LBRA 3G1AA 3N3TA 4MVAA 3BVJA 2PGEA 2VX6A 4JPGA 1PUDA 4I90A 1GOWA 5CAHA 4E2BA 3E96A 4I7VA 5CCZA 4OUEA 3ITOA 5FEPA 3GBEA 2GQ8A 3NL2A 2QXWA 3VIMA 1XBZA 1XLFA 3UJFA 4UBPC 4JAWA 1KO0A 1YQ2A 1PX4A 4O10A 3GZ3A 3TP4A 2JALA 3ZVHA 3NZPA 5CH9A 1H63A 3W70A 3BLIA 3C0QA 1H2JA 2VO5A 4EPKA 3TYAA 4IP7A 3CAQA 4GABA 1F3EA 2C1IA 1J4EA 1O4UA 1W3HA 5BMXA 3OG2A 3E0VA 3T7VA 1M04A 3ID7A 4DXKA 1SR0A 3OVGA 1HP4A 3TZNA 1L8PA 1P0NA 4QRNA 3RRAA 5F2IA 4PYSA 1JFXA 4JFWA 2VC5A 4S23A 2Y8UA 3GG8A 3QPYA 3BOLA 3KM8A 1FX6A 5DBUA 4EWJA 2GZXA 1CB2A 1JXKA 5DO8A 3T44A 2KAUC 3QHOA 4ZFCA 4MY1A 4RE3A 1QPOA 3IV8A 1FP8A 3DYMA 2RH9A 2V68A 4YWSA 2VDGA 4XZNX 4F66A 1S1RA 1OC7A 1XIGA 2DZXA 4R7WA 3VOJA 5H91A 2PU0A 4WY0F 5KTLA 5E0KA 3UG5A 1T0OA 2OO0A 4B9YA 2DVTA 1ISXA 1JDCA 4AC7C 3VU2A 2RDXA 2PDQA 1OX5A 3P8IA 1W3TA 4O52A 1UR2A 2CC0A 1EEPA 4KMQA 4JIEA 4N0RA 1IIHA 1X7IA 1RR2A 5AVNA 3SRHA 4NJHA 1UYQA 2PDLA 3LGEA 1YBQA 1HT6A 5EMMA 3SY8A 3MV01 1AUSL 3WK1A 3ZT7A 2YZRA 3TWAA 1DWAM 5CZ0A 4LWWA 3AHVA 1L6FA 2ZE0A 3GVGA 1KXQA 3PBMA 1TPB1 2Z1XA 2I9UA 3M1ZA 4NILA 4WCJA 4KEVA 3KBSA 3WMSA 1UC5A 4S39A 1DIDA 1D3HA 3V36A 1MWOA 3LTYA 4FXRA 1MI3A 4HCHA 3A3WA 2E6AA 1YXYA 3PJUA 1F4HA 1TTQA 3CAWA 4XD4A 2ZXDA 4LVBA 3O63A 3BC9A 3DHUA 4Q8UA 4HCDA 1PTDA 5FF4A 3EA2A 2WMIB 1ZNNA 2BVTA 1DJQA 1F73A 5HOSA 3TEVA 4DUOA 1FKWA 4GBDA 3AXXA 1HVXA 5DMLA 1UQZA 3BO9A 5DRIA 3AWOA 5C7HA 3C52A 1WPCA 4B9ZA 3UU0A 1Q2RA 1EZ2A 4XD6A 4NJKA 3LHVA 2VC9A 1AZ2A 3O3RA 3IGHX 1NVMA 1QWKA 3GH5A 4H01A 1J96A 1A47A 4GBUA 1CIUA 3SUVA 2FZBA 1L6SA 2FDSA 1K6WA 1VF8A 4BCEA 1E1CB 2POTA 3NYZA 2Z0IA 1QHPA 3UG3A 1R38A 3WX7A 4I8YA 2PSNA 1TPVA 3W02A 1OB0A 1TQJA 4P2VA 1MW0A 2OODA 2OU4A 3BLPX 5KITA 2E1WA 1UR0A 3FAWA 1QI2A 2A79A 3WD3A 5FJRA 1VD6A 4AMCA 1UWUA 4IL0A 2W4XA 1O5KA 5HWMA 5CGTA 4ADSA 1H3GA 3PG9A 5AFDA 4C6PA 3FKRA 1U2YA 3AIUA 1IEVA 2CBVA 1RCOB 2C13A 1WOBA 1A5AA 1C8VA 3WJSA 3S5YA 1ODZA 3RM9A 4PMJA 4QP0A 4Y8EA 5HMEA 1CLKA 3E2VA 3UG4A 2QPXA 4DJFA 4B92A 3CS2A 4K36A 4FOJA 1V0NA 3VK5A 1P48A 1E9ZB 4PGLA 4PMQA 4Q4KA 4JTQA 2GQ9A 4QDWA 5CZJA 3B8WA 3R12A 4YVVA 3G1DA 4HYRA 4AEEA 2I14A 4TV5A 2XVLA 2EKCA 1YPXA 1FA2A 1FQ0A 2F61A 1BG9A 1X97A 2XG9A 1EGZA 1AK5A 3WLQA 4S3JA 1WUFA 3B9DA 5DFAA 1JJKA 2D0GA 3A64A 2CWXA 5MHBA 1TZ7A 1L9WA 4HGXA 1QATA 3MCNA 3IEBA 1ZALA 4MB1A 3WK0A 3BLEA 1E4MM 1P7TA 3BXWA 2QV5A 3A5VA 4BZYA 4M5PA 4HSOA 3W75A 2CZEA 1Q5MA 2XH2A 3F4VA 4LQ1A 3EA1A 2D1ZA 1I2OA 1UIOA 3LGGA 3SN1A 3VCCA 4NU7A 5HPOA 4JYEA 1E1EA 2PB1A 4S3GA 4H00A 1NIUA 3VAVA 2VWSA 5KZ6A 2HS6A 3LDVA 4O1FA 2QGHA 1OC6A 4LGXA 4Q7IA 1MEIA 2NLYA 5I00A 1AG1O 2C0AA 2D2GA 4HPGA 5E0FA 1UR1A 2PE4A 2PWEA 1VGAA 4E2VA 4O16A 3W74A 2ZFAA 4NAEB 1E15A 3D0CA 2R1KA 2EJ1A 4GNVA 2WC7A 1F07A 1N2VA 4Q8QA 4F0RA 4FK9A 3CUIA 4AYSA 3MUCA 1ADDA 4AZ6A 2G41A 3W88A 1JZ3A 3WQFA 1SZFA 3R94A 1IEXA 3GHTA 1WZLA 3S9IA 1FRBA 2YFOA 3N13A 5F4WA 3RPMA 5IM51 5K9DA 3M0LA 4AWSA 3MO4A 1PWLA 3FXGA 3V7PA 3LCXA 2A6LA 1V8EA 2VC6A 1B57A 2Z7KA 4UTLA 5DXXA 1RLCL 3TWBA 2PLMA 2JKPA 2WPBA 4F0HA 2O56A 4GD0A 3WCZA 1YMYA 2EO7A 4EPBC 4UTJA 3QQWA 4ZOCA 2BY0A 5BU6A 2GQAA 3QV7A 4NL1A 4I5XA 2VOTA 3KRSA 3RM8A 1J10A 3BANA 2EPNA 4GUFA 3W1PA 3KFTA 1W3JA 1LUCA 2AGTA 1QRQA 2YBTA 3N9SA 2HWGA 3PZOA 1F3TA 4GKLA 3L4UA 2CHOA 3AU6A 4PTWA 1W91A 3NXFA 1F2JA 3AHYA 3CIXA 2HK0A 3T0DA 1BQGA 5BOOA 1W5PA 4LFYA 4W84A 1ISWA 5M3WA 2J9ZA 2J7GA 2EBNA 3DFYA 1KWGA 2TRSA 2G95A 3TKFA 1XYLA 4AG0A 3AXHA 3FJ4A 4JS3A 5I3IA 4WF7A 4LY4A 3O0KA 4EKJA 3FN9A 3CZ8A 2HBXA 4C6FA 1GVQA 4D8AA 1UUOA 5CPTA 3G6MA 3ANUA 1VJSA 2DEPA 1LP6A 1PKNA <