2DUAA

Crystal structure of phosphonopyruvate hydrolase complex with oxalate and mg++
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
290
structure length
283
Chain Sequence
MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphonopyruvate hydrolase
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
total genus 105
structure length 283
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2duaA00
4KS0A 2V5JA 4MF4A 3QV7A 3SRHA 1XG4A 4B5WA 1A49A 4L9ZA 3I4EA 4ROQA 3VAVA 4KRZA 2VWTA 3N25A 2VGGA 2DUAA 3R4IA 1DXEA 3E5BA 4FXFA 1PKYA 3M0KA 4QGCA 4JPGA 2HROA 2VGIA 2XDFA 3U2ZA 3FA4A 1E0UA 1OY0A 3LYEA 1T5AA 3BJFA 3QLLA 4WJ8A 1A5UA 2BG5A 3SRDA 3SRFA 4IMAA 3KTXA 1AQFA 1Z6KA 4LSBA 2VWSA 4B5VA 1VBHA 1IZCA 4FXJA 4QG6A 1S2UA 1SGJA 3GG8A 4RPPA 1KC7A 2R82A 4B5TA 3ME3A 5JVLA 1DXFA 4YNGA 3M0JA 3FA3A 4TV6A 2E28A 3EOOA 1DQUA 1VBGA 4G1NA 3G2GA 4IQDA 1JDEA 1F61A 5TAOA 1S2WA 1KBLA 4KCVA 3BJTA 1F3WA 1ZJHA 2HRWA 1PKNA 3HQNA 1O68A 2DIKA 1A3XA 3QZ6A 1IGWA 4IP7A 3HQOA 2OLSA 3SRKA 4B5UA 2QIWA 1PKMA 2HWGA 3EOEA 2XZ9A 3IS4A 3OYXA 3PP7A 2XZ7A 2VGFA 2ZE3A 3QV6A 4L7ZA 1O5QA 2VGBA 1E0TA 1A3WA 3B8IA 4TV5A 2HJPA 2L5HA 4KCWA 1ZLPA 4KCTA 3GR4A 2X0SA 3E0VA 3EOLA 4B2DD 3HQPA 3EZ4A 3OQ8A 4YJ5A 4HYVA 1F8MA 3GQYA 1M1BA 3OYZA 3QV9A 1S2TA 4KCUA 4L9YA 2G50A 3LG3A 4B2DA 1F8IA 3T07A 2V5KA 2KX9A 3QV8A 4MG4A 1PKLA 4QG9A 3T0TA 1S2VA 4HYWA 1F3XA 1PYMA 1XG3A 4B5SA 3E0WA 3PUGA 3T05A 1M3UA 1GGOA 4IQEA 4DRSA 3KHDA 1U5HA 3QQWA 4L80A 1U5VA 4QG8A 1O66A 3QTGA 2WQDA 3MA8A 3P0XA 1UJQA 1MUMA 1DIKA 1OQFA 4B5XA 3H6OA
chains in the Genus database with same CATH superfamily
4D6FA 2DVTA 1XYMA 2NT0A 3O6YX 1JXJA 1IGSA 4HNVA 3DHFA 4D6IA 4FLSA 4MUPA 3DFSA 2VNCA 1E0WA 4YTTA 2G97A 2FDMA 2PZNA 7ODCA 1H61A 3VNYA 2QCCA 1H5YA 1JFXA 4Q6XA 4KWVA 3C56A 2BTMA 1LG1A 5F4SA 2EPMX 1KM5A 4NSBA 1QK0A 1WXZA 2ZKMX 3QFEA 4GUIA 2NX9A 1SJDA 3VO0A 1NIUA 1O6IA 1BG4A 4C6BA 1R7AA 1A3WA 2G3IA 1GVEA 3TZNA 3I10A 4WJEA 4WKAA 2QEZA 3V4BA 5MKGB 1GPFA 1HKMA 4JTUA 1X6NA 2W67A 3AISA 5ABFA 4HPHA 4N7QA 1JUKA 4RX0A 3V1HA 3EEZA 3LHUA 3A9BA 4MJ4A 3W1PA 4XZLX 1RP9A 1UROA 4M56A 2H9AA 1XBZA 2CZEA 3FA5A 3BOXA 4UTWC 3REQB 5FCZA 3B8VA 1LORA 2G3JA 2ZDSA 2YDRA 2CPUA 4FPSA 1MYRA 3OODA 3P3BA 4EK7A 2X1RA 3I3EA 1ZAHA 4ZTXA 1FP9A 3TTEA 1JYXA 4C1NB 4LUYA 4C6PA 1V0KA 1UC5A 8XIMA 3M46A 4GBDA 5D02A 4GINA 4DUWA 3LUTA 4G5DA 4YMZA 3GXMA 5DMNA 1GG0A 3HQ1A 2IMRA 1UR4A 1UKOA 4EF9A 4AZ6A 1PX4A 1RLCL 1V3LA 2EPNA 5FI8A 5FESA 5CXPA 3DFOA 3XIMA 1EGMA 2QJGA 1AQ0A 3IGHX 3CO4A 2OQYA 1W3JA 1J6OA 4U2ZA 1AH0A 4W93A 5AHFA 1KFBA 4BWLA 3U48A 3KUMA 3HG4A 3NYZA 1KFJA 2YDQA 3KL3A 2CITA 3EYPA 4TVDA 3N4FA 2QW5A 3TNOA 3KOXA 3LQLA 1UWUA 1TVNA 2YXGA 1YX1A 1OHLA 3N04A 5H8UA 2OTDA 2GOUA 5D2TA 3CQKA 4HCDA 1K4GA 4LTSA 3LB0A 1FWHC 1IZKA 4XTDA 3SCNA 3ITGA 4O53A 1J4EA 1M6JA 2Q71A 1XIHA 1S1RA 3W6MA 4DBEA 3I4KA 3UGVA 3TC7A 2FFIA 3N9KA 1W1YA 2NUXA 3VU2A 1MXDA 4ZO6A 3FGCB 3WLLA 2X09A 4KF1A 1CPUA 4V1YA 1DYSA 3PJTA 1KM0A 5AVNA 4AWTA 2W4XA 4A35A 2O4MA 2G4JA 3ZS4A 1EJSC 2OB3A 2P0OA 5D2WA 5D03A 3J7HA 4TX6A 3LGGA 1EJVC 1N82A 2X2GA 3UY8A 5KEZA 4JFWA 4PC8A 2ALDA 2DZWA 1H0IA 2PEVA 4GO9A 4DY1A 3D3FA 3T40A 2R9RA 2RDUA 3TN5A 4EACA 4I9AA 3TYAA 1GOIA 2Z28A 1KTBA 3C5QA 4NNAA 3GU1A 5D38A 3B8UA 3N19B 5AKQA 1NDZA 2V69A 3PPCA 2QUMA 4JEQA 4R3UA 4QSFA 4QDMA 1JDCA 2D2JA 4CUCA 1B5TA 1VFTA 3ES8A 2ZRYA 2ADAA 3EX1A 3PP7A 5FIPA 1ZBVA 3GSMA 1KCLA 1UWTA 2P88A 3FY1A 5AHLA 3M6YA 3UR2A 4UFKA 4M7SA 3VA8A 2JALA 1IXPA 2H3DA 1Z32X 5KZDA 1MRQA 4IJBA 2O56A 3CPGA 3QC0A 1PHQA 2Q01A 3DUGA 4CD5A 4Y9NA 4HU3A 1V02A 3GDLA 4L80A 1U5VA 3BLPX 3MHFA 2QUTA 2GGIA 4H7ZA 4LAZA 3VMNA 5CEWA 3KBMA 4N4PA 4ZR8A 5HJYA 3WNPA 5E5CA 2BOEX 1XBVA 2W91A 4GH1A 2IKHA 5DT5A 2ZZ1A 1VEPA 2BG5A 3W7RA 4N9CA 1VYSX 4AHOA 4CQ8A 1VBHA 1KQZA 2NWSA 3ES7A 2WJDA 1FWDC 4H6KA 1BWKA 2A7PA 3TQPA 2ZA3A 1Q6FA 4MY8A 2P3ZA 2VCCA 4NKCA 1IYXA 3WF3A 3VFLA 1BLIA 2IKGA 2ABBA 2Y61A 1IWBA 5D9NA 3EEGA 2DJXA 5C2GA 1E5NA 4QISA 4MYAA 1BSIA 5GJMA 4AXNA 4NL1A 4PMNA 3ANYA 1Z89A 4Q8NA 4A8NA 1MUCA 3NSXA 2GJPA 3MUY1 2BVYA 2XFWA 3CQJA 5JH1A 3KL0A 4RUBA 3TROA 1XISA 4QE1A 3T09A 4AB4A 1FOBA 1CX9A 3QJAA 4GY1A 2ZZ5A 1OG0A 3LPFA 4PRWA 2ISDA 5AC5A 1KKOA 3ERPA 1EL3A 3WELA 1NTHA 2WQPA 5DXXA 4C6DA 2E7FA 4UCGA 3KVJA 9RUBA 3FAWA 3E0LA 4A8IA 1IHIA 3PFRA 1M7OA 2FJUB 2VWTA 5D2XA 4AISA 3G1VA 1UIPA 3DG7A 4X60A 1W56A 2XFFA 4QTGA 3WQFA 2OSXA 4S3KA 2J7FA 4H19A 5EMMA 3SFKA 3QRHA 4MKNA 2W6RA 2PDLA 4EWJA 3AYRA 4QJ1A 4C7DA 2NVDA 4G1NA 2GUBA 2Y8KA 3APTA 5EBUA 3G8EA 1HFBA 4DLMA 4BK9A 5EFFA 1VFLA 5IDZA 3USZA 3SURA 1MI3A 1O68A 3UW6A 4C7FA 3LV5A 3PZTA 3QC3A 3ZXWA 2PD9A 1RCOB 3SUSA 3REQA 1XIGA 3G1RA 1BHGA 1XH2A 3CJPA 3SY5A 3T7VA 1A5KC 2Y1HA 4BA0A 1X38A 4H8VA 2NUWA 2YXOA 3UJSA 3ORWA 1HJWA 4L9YA 4C1NA 1H62A 3F03K 4J40A 4AVOA 1Z41A 5A2AA 2JIEA 3VILA 1E1EA 3ISIX 3ATZA 1VJIA 4PN2A 3S83A 4YU1A 3WK0A 2W3ZA 3QW3A 3CMFA 5A3HA 4IL2A 3PB2A 4I3GA 1DJNA 2Y88A 2V5JA 1KR1A 2D73A 1KV5A 1RHCA 3CUXA 3LCXA 2AMGA 4IIEA 4BI7A 3CPRA 2XDFA 2W5FA 4H9VA 4QS5A 1JZ8A 1GVRA 2PDCA 4A2SA 1HJQA 2B7PA 2FB3A 4DXVA 3UETA 2NQ9A 1VIZA 1XD0A 2V3DA 4ONVA 4XG1A 1EJUC 4GBUA 1QDSA 3RU8X 3CLWA 3S1GA 3CV2A 4C60A 5C6MA 4TV6A 1UUQA 2Y62A 3L21A 1DQUA 4KPLA 3S4TA 5BMXA 4PTXA 5I3DA 3GNXA 1XIJA 3KRUA 5EMUA 4MTVA 4UTWA 3N3MA 3GO2A 2DIKA 3LPGA 6PTDA 5B7YA 3HG5A 3QZEA 3FGCA 1YNPA 1TO3A 4Q4KA 3SCSA 1JIBA 5B80A 4YTUA 1SZGA 1XYCA 1JI1A 5CC7A 7TIMA 2UZ9A 5A6BA 1RUSA 3UPWA 3CUZA 3P82A 4E2VA 3TXVA 3TFCA 3CS2A 2J27A 2V5KA 4XX6A 3W01A 1AH3A 1XUZA 4MGGA 4QJ3B 3GG0A 2GSJA 1GONA 3ALGA 2F7FA 3OA3A 3EX2A 1XX1A 3ZO9A 4G1KA 2J9ZA 4AWSA 1UOKA 1JCJA 5HPOA 3QY6A 4QG8A 4J3TA 2ZZ4A 4YWSA 3O7UA 1VPXA 1AJZA 4J2MA 5JU6A 4C5YA 3AU2A 4GABA 4GD0A 2J13A 6TIMA 3RYSA 2YPIA 1R38A 2DUAA 2G0WA 3E5BA 3M0VA 2GQ9A 3B0XA 3MSYA 3IPWA 2XH4A 4O13A 2OWWA 3QLLA 3VUSA 4WZHA 3BGGA 3QSTA 3NA8A 2MUCA 1XLKA 4P2VA 1TTPA 3PUDA 2HTMA 1PIGA 4FB7A 5HMDA 2CYGA 3PWGA 3HIJA 4WHBA 3DI1A 3TSMA 4DX3A 3M1ZA 3L5AA 3LU2A 3SCVA 3BXWA 1EB3A 3U2OA 3W7QA 1E6RA 2OEJA 1KM6A 1W1VA 3NO3A 1W9DM 3TMQA 3VIOA 1GK8A 1OX4B 2WYSA 4DO7A 1JCLA 2Y2WA 1D7FA 3BGAA 1FKXA 2VX7A 1QU4A 4DIAA 1C91A 1DHPA 1OIFA 2YA0A 1U1UA 3VGHA 2E4TA 3JR2A 4RV8A 3DN5A 3VCNA 1KRBC 4GHRA 4HYRA 3POHA 3QMSA 3W83A 4UR8A 1CGTA 2OELA 3KRSA 3NQCA 3LM7A 1RBOB 3WQ8A 3TXZA 3KHJA 2Y7FA 1VD6A 1JEZA 5FEZA 3TU9A 1L9WA 4E3TA 4Z1CA 3HGOA 1E72M 2VCBA 4A3YA 1H7RA 1CNVA 1UUOA 4D6GA 3WCZA 2C1IA 4P8XA 4HJFA 3AHZA 1XYAA 1HJXA 1EIXA 2Z1SA 3TVAA 2HPIA 4Q7BA 3RNDA 5G2HA 1W3NA 1HKKA 2VGGA 3W9ZA 3G1XA 3WX7A 3MI6A 2PS2A 2PODA 5BU6A 4MZ8A 3ZFHA 2GJLA 1X8FA 3LRMA 4KWSA 1QPOA 2QPSA 1BYBA 3F4VA 3WLQA 5LYRA 3RLGA 3GWQA 1C8VA 4DUOA 4UTFA 1S5MA 1H7NA 1ECQA 4LAOA 4GJJA 2FB2A 2PU1A 1DJIA 4G8TA 3BJTA 3WO8A 2WSRA 3GDMA 4PMVA 4MNLA 5CLTA 1XRTA 2GSEA 3QW4B 3II1A 4HIBA 4R7JA 1XCXA 3PN8A 4KKXA 1G0CA 4CN1A 4UMBA 4JBRA 2IQTA 3TA6A 3GW3A 5AZ1A 4KIRA 2HJPA 3RILA 1PCKA 3F2CA 1I2QA 5HNUA 1HZYA 3CUIA 1Q4NX 1UWQA 1W9XA 4JCLA 2GVLA 1TA3A 4WX2A 4JFUA 3MO4A 3WBXA 4J35A 3A3WA 5I3GA 1F6YA 2RUSA 3DHDA 4E0CA 3TFXA 4AEFA 1GNXA 4HOXA 1ICSA 1EX5A 2D24A 1UPPA 1E0VA 1W54A 1OFPA 5F7UA 5C2CA 3K8KA 1GVFA 2D20A 1R86A 1JGIA 3TQKA 3LI1A 2CBIA 4CN6A 1QW9A 2QXWA 3EWBX 3FNDA 5CJ5A 4BJHA 5I02A 5HPCA 2WVUA 1J5SA 4NYYA 4HQVA 4QGCA 1ESWA 3TCSA 1JCTA 1QBBA 4WJ8A 3G1AA 3CYVA 5E0KA 5CGTA 4US5A 3S5ZA 1XLCA 5BYWA 5FF7A 3UR8A 1VP5A 1V5XA 4GIRA 3G1SA 1EP2A 1C9DA 1Y7VA 3G3MA 5D4YA 4JTIA 5AC8A 3B8DA 1XGDA 1Z48A 4CU8A 1VFUA 1XD1A 2P8CA 3W7IA 4ZA0A 3DYMA 4XZMX 1UQYA 1OC6A 3TTYA 5FJOA 2ZXAA 5KMYA 2EEXA 3EXSA 2D1ZA 1PDYA 1VKFA 3TQ0A 4WKFA 4HHMA 2Z6IA 1T8XA 1N8IA 5JMUA 1IEQA 2XSXA 1XIIA 3R94A 1LT7A 3KOWA 6XIMA 4IX0A 4B9ZA 4JKMA 3WDHA 4M51A 5A94A 3CU2A 1G4TA 4LX4A 4UMAA 3MY9A 1EXPA 3OIXA 2FVMA 3F4NA 3QXBA 4I5XA 1TV2A 2EPOA 2QCGA 2GPTA 2F84A 2ZIDA 1GJPA 1E9LA 3HV8A 3ZJ7A 3DIPA 3U4AA 3W7HA 4KMQA 2I5IA 4W8LA 1VLWA 4YWIA 4XO6A 4TUFA 3WMSA 3XISA 3UZZA 2YBTA 4YYFA 2CLMA 1DKWA 3EBVA 5IXEA 2GVEA 3DECA 2PF8A 4PMZA 3AO0A 2HPMA 4PBEA 2QAFA 1LJYA 3WDQA 2XWDA 4C6OA 3CQHA 4GY7A 1JCYA 1FP8A 1V0NA 4QQUA 4J3UA 1UH2A 5HQLA 4NX0A 3RXZA 2BY2A 1X6LA 1Z44A 4D1IA 3HQNA 3H2AA 2GVYA 3W7JA 4C7GA 1O5QA 3LXAA 4NI8A 3S9ZA 2V5DA 4EPDC 5I3JA 3OZYA 4FLRA 3OVGA 1H49A 1R3YA 4XQ6A 1XP3A 4ZGYA 1NFGA 3OLGA 4ADSA 2X2YA 3JU2A 4N02A 4XZNX 2BXZA 4I9JA 1B9ZA 3KBVA 1Z3NA 3TMLA 2ZBTA 4WY0A 5CSSA 5DEZA 2CHRA 3JVAA 2YR1A 1YPFA 4IMFA 4HU4A 5DBTA 2H8ZA 4D6HA 1HF6A 1ZFJA 2C0AA 3GDBA 3VNIA 4PODA 3S42A 1H41A 5JUVA 1GKQA 3NM3A 1NSJA 1TX0A 4JIHA 3L68A 1LOSA 1J5TA 1SO3A 4ZVJA 1AL7A 4GK8A 5AYBA 1S38A 3AHYA 3K8MA 2BHYA 1UCWA 5LNUA 1HKVA 2VC6A 4LRTA 3M0KA 3RM8A 1OX4A 2V3FA 1VFMA 2FDSA 4U2YA 3DBPA 4R53A 1QW7A 3QR0A 3H2EA 1TX2A 4XAYA 4A21A 3B0YA 4CNOA 4QE5A 2J7DA 3W1NA 1BD0A 1I0DA 1QNVA 4MM1A 1EPVA 3S5NA 4FIQA 4IT1A 1Y5WA 3LRLA 2FLIA 1CGVA 3RPMA 3GH5A 2C71A 3S2CA 3SB0A 3BK0A 2CHNA 3GTNA 3VNKA 1OYBA 2FVLA 1M7XA 5DRIA 4N6EA 1W37A 3P2VA 1H7PA 1OFEA 1F5ZA 2XISA 3NQEA 4HOZA 3V16A 4ATLA 4J3WA 1JDDA 3TOYA 4OV9A 1T0OA 3CMGA 3OLEA 2F9RA 3MT1A 3UPBA 3GYCA 2VR4A 3QQ0A 3S5OA 1NFBA 1NAL1 4J27A 1CI1A 4GI6A 4QS6A 5AC7A 4DNHA 1K70A 4MFDA 4JD4A 3VIHA 4RDVA 3ZSSA 4JZ5A 3UVIA 1JPKA 1S2VA 3APYA 1J6PA 1UASA 3U5YA 4B5SA 4HTYA 5I06A 4MNMA 2DJLA 3L7RA 3C86A 2G3FA 3MMTA 2D3LA 3W81A 5A8GA 3GFZA 1A50A 4H83A 1BG9A 1MEHA 6REQB 1VFOA 4ERGA 1LQAA 4IGMA 1VAHA 4TIMA 2W61A 2REQA 1Q8AA 3LSBA 4MWAE 1RH9A 1RZMA 5FSDC 1BXNA 2F6KA 2R1MA 4ZB5A 4UTUA 1GZGA 1DWFM 4ZB2A 1G67A 3BDKA 3UWQA 1OJXA 4PMYA 4V2XA 3V0UA 4XBJA 1P6CA 1W91A 1MQRA 5G2IA 1HP4A 5LNRA 1G4PA 3W24A 3TAOA 3B0UX 2YFNA 6XIAA 4CVWA 4B5UA 1OINA 3R12A 3PF3A 2XZ7A 2QCFA 1KO0A 5BCAA 3QR3A 1JNEA 4DELA 4LOCA 5AVHA 1JR1A 3GIYA 5ECUA 5FJJA 3OQ8A 5FJUA 1QNSA 3JRKA 2Z0IA 3K30A 4DI9A 4DI8A 2YCKX 2CLIA 3IJLA 4CU6A 3EWCA 2PFHA 1AZ1A 3SW6A 1UP2A 5JBEA 5DELA 2PDXA 3THAA 2P10A 1GCYA 3QQWA 1UR3M 1W9BM 2BASA 3EGJA 4EAYA 4Y9PA 1BTMA 1CTNA 2ZXDA 5FJRA 3CZGA 2E5CA 2ZXQA 3GDKA 1FH9A 2WMJA 3MSGA 3UXIA 4LNCA 1ZHAA 3TUUA 4PCSA 1PV8A 4A29A 1LLOA 3HG3A 2VELA 3PBVA 3S46A 1A5OC 4DZIA 3UPMA 3ZVHA 3MJYA 3BQ5A 4HPXA 4JY8A 4M8UA 1TRDA 2C1HA 4KIEA 1QXLA 3FA3A 4EVZA 1HVQA 2YX0A 1DWGM 2YZRA 4NZ3A 4BI6A 3R13A 2FTPA 5A2CA 1RJPA 5DMYA 2VVSA 1RD5A 2OSWA 2QNEA 3AXMA 3DKJA 4P5UA 4KERA 1JQVA 3MYOA 1T40A 2VX6A 3W0KA 4CEXC 4IP4A 2PF0A 3QHNA 4RW3A 1QI3A 5I3FA 1GORA 1XLLA 1I2RA 3UJ2A 3DFPA 5JBDA 4HA3A 5E0FA 3ABXA 1F05A 2BV9A 3KZSA 1WO2A 3FYOA 1LM1A 3LG3A 3BLFA 3FYPA 1LDCA 4PEEA 3FDGA 2DW6A 4TTUA 4Q8UA 2ZX7A 1EUNA 3EX4A 1HG3A 2X30A 3BARA 4XKYB 4AZGA 3E38A 2F2HA 3NURA 2GSHA 3MA8A 1KGWA 2OEKA 3VM5A 1AK5A 2OU4A 2OZ3A 4X9YA 1GUVA 3EMQA 3F4CA 4AD1A 4TO8A 2HROA 1S39A 4L4LA 3STGA 3CMJA 3SCOA 2OWXA 1KCKA 2X41A 3C2YA 1XLMA 3FJ4A 2J24A 3KVMA 1Y65A 1FFQA 3WDRA 3LY0A 1HL9A 3WL0A 5M03A 4DJFA 4FHAA 1ZGDA 3BAYA 1KTCA 3ZQ9A 2VOMA 1KRCC 4HNCA 4BS0A 3EWWA 4JAWA 1DIEA 3MS8A 2PDMA 2Q02A 1R46A 1UC4A 2PDBA 1FWIC 1W1ZA 2IXVA 1S3HA 1E9ZB 2BODX 2XZ9A 3E3HA 2A7NA 3BSMA 4AZ7A 3EDKA 3Q2DA 2IXUA 4TV5A 1EA9C 4DNMA 4OHQA 4ZO9A 1UJPA 1LQ0A 1UD8A 4O19A 3EX3A 1KV8A 4CCDA 2H6RA 1C8QA 1YTDA 2NZLA 4J3ZA 4P61A 2BFGA 5KSWA 4GX9A 1K8ZA 5A6JA 2Z26A 2YLAA 4KWUA 5ENLA 4DZ5A 1Q6CA 1XGZA 3CAQA 3UD6A 4ILSA 4AZ5A 5BZAA 4H04A 1EJ7L 4JTJA 2YDSA 4X63A 4M6PA 2CWNA 4ECLA 3I6RA 4F2TA 5XINA 4NF7A 3W3OA 3LX9A 3WJYA 4Z1DA 4RZ5A 5HBFA 4J2PA 1IWAA 4N4QA 1UD5A 1MDRA 4NT0A 3GR8A 3NUKA 4NZJA 4IPIA 3UP8A 3W7GA 3IV3A 5GNYA 5M17A 1YHTA 4WF7A 5KZMA 3MYPA 4IMCA 4PULA 3TOPA 1WDRA 2O92A 4IIFA 2QKFA 1TPC1 3A3HA 1GOWA 4G9PA 3BLKA 5DO8A 2VMFA 2HRWA 3N6HA 3P93A 2JF6A 4GACA 2GJXB 1V6TA 1LP6A 4O52A 5E09A 2OLSA 4KESA 1PKMA 2PLJA 2HQAA 1YTKA 2OX1A 3W1XA 1XGEA 4L64A 2VC7A 3LZ3A 5TF0A 4J3VA 2C14A 3QYQA 2Z00A 1YE4A 3NGFA 1Q2SA 1Y5VA 3MP3A 3P62A 3GUGA 1ZP3A 4JHOA 1V3JA 6REQA 4QSHA 4F2BA 4IPJA 2VFHA 1UA7A 1YDNA 3FCPA 4KBXA 2BSLA 1JFHA 4CU7A 3N34A 4DVOA 2E8ZA 4XZIA 7TAAA 5HNNA 1EJWC 1GTHA 4MKVA 2HDJA 3SN0A 2E9BA 3S3GA 3TW9A 3VX0A 4S39A 1MQQA 4PFHA 3AS3A 1YDOA 3UYIA 2PGRA 5HAOA 3AXXA 2R6OA 2O9TA 1ITXA 3BG3A 3GX9A 2EKCA 2HVOA 7A3HA 2DW7A 4NRRA 3UWWA 1KWKA 4XO7A 1QPNA 4LPCA 2AQVA 4Q32A 1ZTVA 1FY6A 1P43A 4DEFA 1AMKA 2QDGA 4PBGA 3VVGA 1XF0A 2TODA 2PRLA 3ABZA 3WBWA 5BRQA 3UJFA 4PMQA 1OK4A 5D9OA 2W92A 5I23A 3DHUA 1Q6QA 1YTEA 4W7WA 1OFQA 1P0NA 2PSNA 1MWOA 1NJJA 1QWGA 3CEPA 3ZLFA 1KNWA 2QCLA 4KQNA 2QUUA 2QMKA 3AHTA 2ZA2A 1BPLB 4BFAA 2OG9A 1WDDA 2JGQA 2PUZA 3AIUA 4RE3A 1B30A 4L61A 2VEMA 4UR7A 2OCZA 5E6YA 1ZL1A 1XR2A 3LBCA 3T81A 3UGRA 2JKPA 1GOQA 1ZU8A 2VHLA 4H9TA 5HQMA 5CPQA 3WK2A 1P48A 4ZODA 4F0MA 1QHZA 3PHAA 3LNPA 1R2TA 4UOQA 3H12A 3VIJA 4MJZA 5A6MA 1NF7A 2DT3A 1H7XA 3EB4A 3CTLA 2ZVIA 1JF6A 1I9CB 4GYFA 3UXLA 4WEVX 3E12A 3WYZA 2P50A 2WNWA 4BR1A 1OCBA 4O0KA 2WMFA 2KZHA 4PB3A 3UCDA 3AWOA 5REQA 3W86A 2V5CA 3BV4A 4NG3A 3BZGA 2JIWA 3D6NA 2KAUC 1CXKA 1ZAIA 4LB4A 5CGQA 4Y9OA 3SCQA 1HTIA 1DQXA 2WV8A 3W85A 4IMGA 1EYWA 2FKPA 4QDPA 3TC6A 3N12A 2XIOA 5FJTA 1ZY9A 1IIHA 1P6BA 5G1TA 3V35A 3GNRA 3IS4A 1IEXA 2PRHA 1UA3A 4XTIA 3FHAA 3GBEA 4BF5A 3N11A 1K6AA 3R5EA 1GVSA 2PWDA 1NQKA 5XIAA 4ADTA 3CZEA 1F8MA 3GH4A 2FGZA 5CKSA 1ZAJA 3N14A 1W6TA 3VOGA 1QO5A 2Q3OA 1FDJA 4H8NA 4UNKA 3IUIA 3QN3A 2Y85A 3CAWA 2O7SA 1K02A 1E56A 1Q7QA 1LLWA 2PZ0A 4CNTA 5A5WA 1JRBA 2BB0A 4ZQRA 1O95A 4BQ5A 4PE8A 2WPGA 3QR1A 2WB5A 3FKRA 4LU0A 4XBKA 4AEEA 3S5SA 1H50A 3W82A 2VGIA 4ZO8A 3N2TA 3O8AA 3NCOA 2YBVA 4ATWA 2VEPA 2GL5A 4LS2A 5LA0A 4ZXLA 4O4VA 3CEUA 4R9OA 1SSGA 4DXXA 3AROA 3UR7A 1LTDA 3M0JA 1Q66A 4L5ZA 4R7WA 3VFCA 1BWLA 2J9XA 2VUNA 5H2ZA 1SMDA 4DWSB 4NP7A 4UOJA 2OT0A 1AG1O 4GQRA 4R27A 3ARVA 1GT8A 3B06A 4FXSA 1ELSA 1BVWA 5A95A 3FDKA 3NQ8A 2Z25A 4GQ0A 1OX6A 3LTPA 4K38A 1VCFA 5IFPA 1MSSA 1DPMA 3BC9A 3B0VC 4I7UA 1NU5A 2D23A 1BQGA 4JX4A 4Q4PA 4UNIA 3WQ6A 1XS2A 2BXVA 4FOUA 3EZ4A 3KLKA 1GVIA 4HYVA 1FWAC 3MQTA 4M7TA 3RLVA 4MAZA 5IM51 5AN7A 1L8NA 1TSIA 4JIQA 3ATYA 3GKAA 4NJKA 1DWAM 1N8WA 1MNZA 1XRFA 3M5VA 4MIMA 4XSLA 4MAVA 4PSPA 4ML4A 4Z2IA 1CW2A 3LDVA 4Q8OA 1GVYA 4BQ4A 1PCWA 1WP6A 1FQ0A 1CGUA 3O05A 1XUUA 1AH4A 2VDIA 2ZA1A 2OGYA 4JQ4A 4GOAA 4GWEA 2E3ZA 1UD3A 2VXNA 4W85A 5I09A 3E1F1 4C6CA 3L4VA 1OY0A 3ARWA 2BP1A 4I8DA 3GG7A 3SRFA 2QHAA 3URQA 3M0YA 4EANA 3CWHA 4B5VA 2DY3A 3TDFA 3QLDA 4IZGA 4A2RA 3QTPA 2DIJA 3DDMA 3VPLA 4JHZA 1NOWA 3P67A 2YKKA 2ZUNA 2C8NA 2OQHA 3RLUA 4M82A 2XVKA 1R8LA 3WFLA 3WJSA 5I0DA 3DU0A 5A8NA 1OF6A 4HK7A 2EO7A 1VPQA 2O9RA 4W4QA 1TMHA 3UU0A 2B31A 2ATMA 3TIMA 4S3EA 2X1SA 4DF0A 3N73A 2NQZA 4LS1A 1EUAA 3CL6A 1R3TA 3LHWA 3GE7A 2R1NA 3NXFA 2PTZA 3USBA 3NDOA 1NQ6A 2FZ8A 2PDWA 4ZOAA 2IW0A 3I6TA 3E0WA 4JHMA 2OKTA 3VI2A 1CGXA 2HISA 2ASHA 3NYDA 3KX6A 4U5KA 4X9SA 1ML1A 5D32A 1NEYA 3ZJKA 3KDNA 1VB9A 4FK9A 5H1WA 4YHEA 3ZMRA 3THUA 3DERA 4GC3A 1NP0A 3W2UA 2FMOA 1G9HA 5PTDA 3W2MA 4UOZA 2X8RA 1FXQA 4CVUA 1IQ8A 4PTVA 3G2GA 1GG1A 3L5LA 1GQKA 1K9TA 5D2VA 4GJIA 4RKAA 1YE6A 4KEZA 4GKTA 4UTIA 4HNTA 1RBLA 1CXHA 3LLXA 4O0ZA 3IAPA 3TN4A 1MW0A 1W17A 7XIMA 3P81A 4XB3A 5HJLA 1VEMA 1FUYA 4S3CA 5DCBA 1I0BA 1JYVA 5DFAA 1TIWA 2CXEA 2CESA 5CSYA 5HMSA 3WSUA 4RNHA 1B3YA 3CB8A 1QASA 5KITA 4UUIA 5HULA 2DSUA 3PJUA 3QV9A 4XUYA 3KL5A 5HWJA 4ORMA 3C2EA 4K68A 5GJNA 3WNNA 1H7OA 3NDZA 3H7VA 1WBHA 2B7QA 2DSKA 3L5MA 5G4WA 2DZTA 1TUXA 3MMUA 1L6FA 1Q5MA 1MRAA 3E2VA 3UWVA 2RDTA 3ZR4A 3VDBA 1SZEA 1OFDA 4ROPA 4NX5A 3A9IA 3KTCA 5B7ZA 4DAIA 3FV9A 3M41A 3Q94A 3W74A 3KBJA 2CLKA 4JFSA 3ARSA 3TYZA 2DSZA 2OODA 2YCJA 3BMWA 3BO9A 3C6CA 3C8NA 1VS1A 2Z27A 1W1B1 1FDYA 4JL2A 4B5TA 1J01A 2PDQA 2ZZ2A 4J4KA 3NGJA 3MCNA 1B3VA 1FXPA 3OEXA 1M41A 4LUSB 3STFA 3RUBL 3CWNA 3LPPA 3CTTA 2YYTA 2PWVA 3M4HA 4TVUA 5J04A 2WCSA 3CAKA 1PJ9A 4RZBA 3T0CA 1L2QA 2ZX6A 3MW7A 4JQ3A 3AZSA 3PTMA 3PY2A 1E5JA 3L0NA 4V1XA 2W27A 2JK2A 4JTKA 1QUMA 2NSXA 1NWUA 3URNA 4ZOBA 3IUDA 1JUEA 3HURA 4LXFA 1TV3A 2CBJA 3GQYA 1ZJBA 1RLDA 1YBQB 2IKIA 1UIOA 3R79A 1HN1A 2QMJA 4CCEA 1P7TB 3GTIA 2WSQA 1F3XA 4U5IA 2PWUA 1H1NA 1VF8A 3BLLA 1EO5A 1DL3A 2DQXA 3VIFA 2PBOA 2QPXA 5AY7A 1TJ2A 1SZNA 3O1NA 2VD8A 4DWSA 4GXMA 3KBNA 3B03A 4AFYA 5CAKA 2WMIB 1J2BA 1J93A 4C6JA 1L6GA 3NQGA 1OD0A 3WD3A 1NP2A 3CUFA 3BLEA 1AW1A 2XIMA 3G24A 3W76A 1O5XA 1EJXC 4ACYA 4C6LA 4EOUA 4GH3A 3R0DA 3DBNA 5AHIA 4DBWA 2XWEA 3CUGA 4MWAB 3SR7A 5I03A 3MSRA 2PLMA 2VFIA 4AVFA 1VPYA 3QPZA 3N2XA 1TPEA 1OYCA 4HN8A 4FSAA 4XK2A 4HA4A 3HPZA 1UR1A 3VCRA 3SZ8A 3NOYA 3RCNA 5I07A 1UH3A 1F7BA 2ONEA 1EDGA 1OB0A 3OA5A 5DMLA 5CGMA 3E5PA 5DMMA 4Q22A 1LZOA 6TAAA 1YIXA 1UP0A 3H8AA 4GCAA 2ZC1A 2WNNA 3MI3A 2ZZ6A 1TWSA 1XICA 1VENA 4Z2HA 1QATA 3P5YA 2OYKA 3AQUA 2JEPA 2NT1A 4GVIA 2XINA 4HK5A 1XFCA 3A22A 1L8PA 5FL1A 3A24A 4LAMA 4W88A 2CKSA 1UR8A 4F48A 5DN1A 2FMNA 3ITVA 5KZ6A 3K13A 4XWUA 2YXXA 4HNLA 4X0NA 3UXKA 4XKMA 4FNRA 4Y90A 1MFVA 5C70A 3PBUA 4P7RA 1QJWA 5I3KA 4EP8C 2QUVA 3CUHA 2XIQA 4DWSD 1R9XA 4JTEA 1BGAA 3BAIA 5EU9A 4MZ1A 5TQLA 4FZIA 3NQFA 3NR0A 1JJKA 1CXIA 5GNXA 1E6XM 3VD9A 1R30A 4UFIA 3IANA 4F8XA 2ZVRA 4QM1A 1WAUA 1K7XA 4JNYA 3P60A 4JDYA 4GPNA 1TZ7A 4JEJA 1WOBA 4HPGA 4RZ6A 5C7VA 1P4CA 3T0AA 2DORA 3BSHA 1MDLA 4AHPA 2WJEA 3TJLA 1K4HA 2W66A 2HK1A 1A5AA 5RUBA 2IS7A 1N7KA 3C61A 4B2DA 4PTNA 3WDPP 1VCVA 1MO0A 2PP1A 1TMLA 2I5QA 2CZ5A 1XRVA 1SW3A 5IDIA 2ZE0A 1AL8A 4H8HA 3RO6A 2FZDA 2P5NA 4QNEA 2CBUA 1L6YA 3LS9A 5HDRA 1LG2A 3WD0A 4FOKA 1OWQA 3BWWA 3CWOX 4WDTA 2PGEA 1OCJA 4AMCA 4CD4A 1IIGA 2I5GA 4YTRA 1QAPA 4IPNB 3U2ZA 3U7VA 1YKWA 2NQHA 4ZE4A 3W6YA 4CNSA 5JQ9A 3QF0A 3QM3A 1UR0A 1W5PA 1R9ZA 2IQDA 5ABTA 1NWTA 1ISWA 4UFHA 1XBXA 1XIBA 5K9DA 2NQJA 2FH6A 5J5DA 4ZFMA 3EKZA 5LA1A 3RAOA 1FWBC 1PWMA 2W9MA 3JW7A 5CZJA 3IEBA 2FZ9A 1M53A 1E9IA 4JYEA 1KM1A 3W07A 2Y63A 2JQXA 3ID7A 1KLZA 3RJYA 5F2GA 3WNMA 1G4SA 4HK6A 4N2YA 4IGHA 3MCMA 4F0HA 2O4QA 7PTDA 4TOQA 3SUTA 1W3IA 2DV0A 2GYIA 1PL9A 1WZLA 2ZCGA 4GKLA 3MKVA 1XHGA 2VOTA 5C71A 4DBSA 4TX9A 3TYCA 1V6UA 2Z7KA 2PD5A 3VE7A 4K7YA 1HNYA 3F4WA 3W1RA 2ZX8A 3U4FA 4EXAA 2WO5A 1FWWA 1UBSA 1NELA 4CQDA 2W63A 2VD9A 5F4XA 2GQ3A 3ITOA 1DJWA 2AOSA 5D8ZA 1IWPA 1RD6A 5CSUA 3PZIA 3W6LA 2OQLA 2QIIA 4XZWA 1O66A 3BG5A 1PUDA 3P0XA 2E5DA 2H9AB 5HR6A 2AKMA 2NVAA 1N8FA 3WLRA 5HUPA 5G2WA 3WBAA 4B5NA 3PBMA 3R4IA 2PDUA 1P1XA 4NJIA 2DT1A 2C7FA 1SMAA 2CKRA 5C9UA 2WVTA 3E96A 2E6FA 3BAKA 4QHRA 2CIPA 4MB4A 1JUBA 2ZICA 3C2FA 4Y9MA 1D3HA 3LM3A 3UWUA 4JIRA 1UD2A 2GZXA 3RJXA 4D2JA 1T6MA 2FPTA 2INFA 3C2RA 3S2MA 9CGTA 3HU7A 1Q85A 4V27A 1LF1A 1YBQA 3O15A 1IR2A 3GIPA 1NWRA 4JTSA 4S3JA 1TJ1A 4WDWA 3WNKA 3WBEA 3K5XA 3WLNA 3LK6A 2HXUA 3XINA 2JKEA 4XAZA 3AMCA 1YEYA 3KRZA 4IJCA 5E0CA 4BQ2A 4KRTA 1CECA 3G3DA 1DOSA 2AQOA 3A3XA 4DM2A 2Z24A 4X2RA 3O6CA 1OFOA 2WMIA 4BEQA 1SU5A 2Y0FA 2WNQA 4E8GA 2B81A 2D0GA 2ACQA 3RCYA 3TP4A 2VEGA 3UVAA 2A1YA 4IMDA 3K1DA 2EKGA 2YL5A 1UR9A 4LGXA 1FFRA 3AJXA 3HPFA 3LBOA 1PVNA 1ISZA 2FFCA 3L66A 4MWAA 2ZX9A 3TKFA 3V0TA 4Q7IA 2VKZG 3G1HA 4EXBA 3U6WA 4KEUA 1H1ZA 2H8XA 2QS8A 3LNMA 3EB3A 3B0PA 1W3TA 4GXWA 1KRMA 2GJNA 3KAOA 1MEIA 3WQOA 2QCHA 3ZT5A 3BSGA 3IJDA 4OECA 4IX2A 1U1HA 1V03A 5LIXX 4FXJA 3L23A 4JS3A 3GFYA 2VRJA 2DEPA 3BW2A 4GQBA 1ZS2A 1H11A 1XLGA 2EF9A 3ARPA 1WDQA 3OLIA 4UC5A 1PSCA 2QV4A 5G1MA 1RCXB 4HHPA 4QE4A 3SCRA 2BVTA 4PUEA 2G96A 2ZTJA 3B3DA 3KZPA 4AQLA 3WLIA 3LMZA 4FS9A 2ATSA 2PTDA 3N6QA 1OABA 2QCMA 1KRAC 2HWGA 2XUCA 4GMEA 4S3GA 5I00A 1RY8A 1K9EA 1OM0A 1E0TA 1W3KA 3TV8A 1YDVA 4QFUA 3WNOA 3AUJA 1WE5A 2ICSA 4HCLA 4MYXA 2ON3A 4GUFA 1YLVA 3TTQA 3N29A 2J6XA 4CD7A 4E2DA 3W75A 4L6HA 5EBAA 1DJYA 4FX6M 5C0QA 3D5HA 3T0TA 4LY8A 2BX7A 1X6UA 4Z0SA 1WKEA 2A5HA 3ONCA 4QLKA 3MUIA 3KOZA 1E9YB 4B3LA 1F9CA 1J79A 2QYGA 3LHYA 3WEMA 2VFGA 3EOSA 2XVGA 4I5RA 4RJEA 2ZRXA 1ENUA 3CZJA 4DHGA 1M5WA 1THFD 2PMQA 1E6SM 3FXGA 3I4EA 3T2QA 4HBKA 1Z9AA 2EHHA 2R1KA 3SCTA 3TYEA 4KEMA 5AB3A 5C9WA 5CZTA 3SN1A 5IHSA 1XLFA 3N17A 2GGGA 3L9CA 1KFWA 2YL6A 4PUMA 3H4XA 4JXCA 1N55A 3RDKA 2PDIA 4XVEA 1F6PA 2YL9A 5A6LA 2ACRA 3BCFA 3L4ZA 3LMYA 3AI0A 3C3UA 1RV8A 3NQAA 5JIPA 4UQBA 1XW8A 4KFNA 1MMFA 1V02E 1R9YA 4QBXA 4DYKA 3BANA 2VZOA 4J5NA 3VZYA 4B16A 4MLRA 2OLAA 5A1AA 4DJDC 4UBPC 4UB9A 3ZJ6A 5FEXA 5CG7A 1EJTC 5FL0A 4JNMA 3BAXA 1PTGA 4X2PA 3WD4A 3HB9A 4F4RA 3UG3A 4GUJA 2ISVA 1XLIA 1JYNA 3NQVA 6ALDA 2Y5JA 1C8XA 4OTKA 3RR1A 2GDVA 4F79A 1XDMA 1G69A 1PTAA 1S5TA 1XIEA 2CBVA 3A21A 4V33A 2E9MA 4M3PA 3W29A 1UKTA 5BMWA 4DRSA 5T91A 3OHIA 2OGJA 3RX3A 3TWBA 3W2KA 5K4XA 3PG9A 2HE5A 3L4WA 4AZCA 2V3GA 3EPNA 4QAWA 4ALDA 3TYDA 2ZC8A 4F2UA 4ZFCA 1V0LA 4PSRA 3A4WA 2E77A 2WK2A 4GIYA 3AWNA 4AX6A 5C54A 3UERA 4MY1A 3SRDA 1ODUA 1HJUA 2J75A 2UBPC 2X7VA 3B97A 1IZCA 3FHQA 1GOKA 3GAYA 1D7KA 1K9FA 3P0WA 4YVVA 2CERA 3DFNA 4LF1A 5AYZA 2QCEA 5DY2A 2YFOA 4KRUA 1XBYA 1TPFA 2CNCA 3CHCA 4GCXA 3W7NA 4WUIA 1VFSA 3NVTA 4L9XA 5AFDA 3A64A 4AX7A 1A3XA 1EJRC 1FCVA 4HJWA 4PUDA 4PA8A 2WKLA 2PGFA 3EB2A 4MADA 1EHNA 4QEEA 1Z7AA 1BGGA 1XIFA 2DSWA 4B15A 1ZLPA 2GVGA 1IT8A 4FNUA 4I9TA 4PRRA 1HL8A 1RQBA 2AL2B 3D0CA 1UR2A 4LUTA 3VD4A 1U5JA 1M7PA 1QHOA 3BV7A 1NDVA 5GPRA 4QG9A 4MNJA 1ONWA 2GQAA 1BYAA 2GUUA 2JFEX 5T9BG 1IZJA 2QDHA 3TWAA 4WOQA 3GZ3A 1PZ2A 3SY8A 4IFRA 4XSMA 3IJQA 4W7VA 3BJSA 2EBNA 5CZKA 5AHMA 4JIPA 1FCBA 3L4XA 5D05A 4BCEA 3FSTA 2P8BA 3NG3A 1QNOA 4PFMA 1OCNA 5CCZA 1QI4A 5E93A 2Y7GA 1H0GA 5L6UA 3SIMA 3SM0A 3ZVIA 1E4LA 1Q3NA 1E6PA 1WBJA 4JDBA 4D6JA 2WHKA 3GXFA 3VUPA 4JTQA 1O1ZA 4GNVA 4EX4A 4PZVA 2XTKA 1IEVA 4DJEC 1PYFA 1J96A 1GTEA 3BVJA 4IQLA 4C5ZA 4LUIA 3BLIA 3VIPA 3VX1A 2ZUSA 4RXFA 5CH9A 4CCZA 3IJ9A 3RPDA 1L6SA 3T9PA 3C2VA 2V2CA 4WQ6A 5C7HA 3AOFA 1U1JA 4C6MA 3RM9A 2V68A 3QV8A 4N9BA 2ZWYA 3RIKA 4HD5A 5C2XA 2VZUA 2FJKA 3GTXA 4K2SA 3W7LA 3CZ8A 3R8GA 3PUGA 4LY4A 5EMKA 2CC0A 2VC9A 5K7JA 1WKFA 3WEOA 3H26A 4Y7EA 1C3FA 1V7YA 2WQDA 3S9YA 1BXBA 1DIKA 2DVXA 2Z1KA 1XCFA 3CV1A 2WJZA 3QV7A 3ITXA 4Z08A 4W89A 1IXNA 2XN1A 1RXOB 1XLJA 2V38A 5G4EA 5CPNA 4IPPA 3TCEA 3AAMA 3WH8A 4M81A 1GYNA 1JDAA 2PDNA 1VGAA 3WQEA 1FHVA 2GUYA 4GYPC 1QWKA 3JZEA 4A4AA 1EYEA 3C2OA 1KFEA 2HVNA 4GI4A 2CWXA 3Q58A 3H7UA 3VM7A 4PUUA 1IXOA 4Q8MA 4ZB0A 4AD3A 2J7GA 4IL0A 3ALFA 3OVRA 4GISA 1IGWA 1RALA 4R85A 2VC5A 4FNTA 1P0DA 1FWCC 5E6ZA 1HO4A 4CNNA 5G4HC 1WKDA 1FTXA 3VIIA 2R8WA 1TE6A 1VRXA 3NNTA 4Q8WA 3LCWA 3A12A 4JTDA 5BNKA 3KBSA 4KEVA 1OT2A 3LD5A 3F5KA 3RM4A 4W5UA 1O5KA 2QCDA 4IIHA 2VTFA 1ADDA 5XIMA 2VO5A 3WQ5A 2JGYA 4PEKA 5CPMA 3LCFA 1OK6A 5DANA 2QLYA 1AODA 1CXLA 3PBGA 4I7VA 3DFQA 4GX8A 4I6VA 1OFBA 4O16A 4DZAA 1EP1A 3NQ6A 4I90A 2H90A 3WN6A 4AY8A 4PYSA 3GC4A 3W7CA 4O54A 3HPAA 3M7SA 1ZQ5A 4NZ1A 3A6OA 1S2AA 1X39A 4RE2A 2A3LA 4JYFA 2J7HA 1XRSA 5E1QA 5ABEA 4HN4A 2J6VA 1R5YA 3HA1A 3WKZA 5AYYA 2P1FA 5BU9A 2NXGA 5BXSA 1E1CA 2JE8A 4O1EA 3VOJA 1VRDA 4WDXA 1FHDA 3CUJA 3VKBA 5DCEA 5LXEA 2AL1A 3UCCA 1US3A 4FALA 4HA0A 1K6WA 2Q8XA 3OG3A 3P80A 3RU6A 2V8ZA 2VGFA 1T96A 2ZYFA 2C18A 1E51A 4KCTA 3G6MA 3A13A 3BQ6A 1W8SA 4Q8TA 1LYXA 4GLEA 2EQDA 2I1OA 5BOOA 1Q6LA 1OD8A 1D9EA 5EA9A 3H21A 3OP2A 1TA3B 3IGUA 3ONBA 1KXVA 3CXOA 5FF4A 1JPMA 3ARZA 4A3QA 4P7OA 4Q8VA 3MZNA 1GW9A 1ISYA 4CEUC 2F6UA 5TBOA 3ANUA 3MCOA 3KOYA 1KFKA 3HMJG 4MF4A 1LBMA 1ZJAA 3HM7A 3N1AA 4TTGA 1EZWA 1ZCCA 3BAJA 4L9ZA 1TWIA 4ROQA 3WD1A 3U2CA 4DJDA 2Y70A 3TSDA 1XXXA 1R2SA 4OGZA 4WSHA 1MW1A 4R7OA 1T5AA 3M43A 1EHAA 3KTXA 4G7FA 3W73A 1CBGA 1SW0A 5CJMA 3E2RA 3BLDA 4X0VA 2AL2A 3BW3A 4RDWA 2XIBA 1WQ5A 2CHOA 4OBTA 2PC4A 2PCEA 1CYGA 3I7QA 4GJ1A 4G7EA 3T2PA 2XM2A 3DFHA 3SCPA 3Q67A 4C90A 1TYGA 4J1OA 1QOPA 2WANA 4JIEA 3I65A 4JTHA 1M04A 3W84A 1AW2A 2BGQA 1E3ZA 1UH4A 2D0FA 4LBRA 2VJXA 4YVPA 3MDWA 3DG6A 1KWGA 1ZPTA 3B4UA 2XH2A 1FWRA 5HXMA 3CHFA 3OYZA 3WENA 4FO4A 3M5ZA 1EXBA 3MI2A 1SW7A 3AYVA 3RX2A 4LB3A 4LBSA 4C65A 2PRMA 1DQWA 2YCEA 1A0EA 1W9PA 1S5VA 2ZRZA 1JZ7A 3B8SA 4YTQA 2FTYA 1EEXA 3WH5A 3BOLA 3EDFA 3MVTA 1A4MA 4Z2GA 2OZ8A 4V15A 4Z2LA 3OGSA 3HG2A 1H63A 2NLYA 1PKYA 3DHPA 4OKDA 1E1FA 3HGJA 1JZ2A 3WMCA 5T26A 5HINA 1PXGA 4DJDD 3ME3A 3CV7A 2DP3A 3H2CA 1LRTA 3LXCA 4LCQA 1F61A 1BQCA 1KGXA 2OSYA 3WUBA 1RJRA 2R94A 4XZBA 2I9EA 4US6A 2NX3A 4L4OA 3TR9A 3A23A 3QGKC 4FMVA 2G4FA 3RRXA 4ACZB 1XC6A 3HN3A 4HSOA 1KXHA 4XD3A 4HMNA 3AZRA 3RK8A 3NZPA 1GZJA 2DQWA 3GG1A 5EL1A 4F9DA 5TIMA 1U30A 4RE4A 3NZQA 3P7YA 1KFCA 1W1IE 2BBFA 3PSVA 2FGBA 8A3HA 3WH6A 3SEPA 1U22A 2Z7GA 3IIVA 3L2IA 3BURA 3WLJA 1ZNNA 4WY0B 3OBAA 3CV6A 1LUCA 4FEZA 3WF4A 4IQEA 3N9RA 1ME9A 5FJPA 4E8CA 3VIKA 4MB1A 3E02A 1UWAA 4DJEA 1OT1A 3G1YA 2YLLA 3ZR5A 5HANA 1LRNA 1REQB 2GLKA 4NQ1A 3BW4A 2EPLX 3SUUA 2QF7A 4GQQA 3VKAA 3MV01 4LVAA 4KFPA 5DQPA 4NXKA 1PB0A 1M68A 1KCZA 1UZDA 2ZRVA 4MZYA 5CAHA 2PA6A 3NM1A 3M9YA 3R89A 1EOKA 1DWIM 4QROA 4UR9A 2Q8LA 3SGZA 5FACA 2GFTA 2EG6A 4IIGA 1A5SA 4JYDA 4K8HA 2A3BA 1TZZA 1BRLB 4DYJA 1J0ZA 3OVPA 4GFSA 1CGYA 3H7RA 2VCAA 2CLOA 5A6BD 4IUOA 3PAOA 2Z2AA 2POZA 1MXSA 3PNUA 1UYQA 4Y8EA 3GHUA 2BY3A 3RO8A 4NZ4A 4JKLA 3H53A 1V3IA 3N13A 1JVNA 4GYPA 3DGBA 3QZAA 1CLXA 3GBDA 1TUFA 1G7UA 3PJWA 1AFSA 2G8ZA 1J12A 1FH8A 2VFEA 3OG2A 2HK0A 3KS6A 4IJRA 2WKGA 1GQNA 4QITA 4UZUA 1O1HA 3GU9A 1US0A 3MP5A 4O18A 5HWNA 3C0JA 3S2JA 4O1CA 4DJED 3FA4A 4IFKB 4JGDA 2QJHA 1CB7B 4CCCA 5BXRA 3D46A 2REQB 2A4AA 3H55A 4M19A 3VYLA 2C13A 2PB1A 5D04C 4BKNA 4IG2B 1RY0A 3EWYA 1UD4A 4ZSTA 1HIZA 2XJ7A 4PMXA 4DO5A 1CB2A 1B90A 3DFTA 3WUFA 5HMFA 4IWWA 4ZENA 1TPH1 3N15A 3QVQA 2YB4A 5LIWX 1SFTA 1OZQA 1SFSA 1GEHA 4D1JA 1FWJC 1W2PA 3H54A 4NAEB 1R47A 2HBVA 3LPOA 4XAGA 3T1GA 4GY0A 1QNQA 1NFPA 4D6EA 4IGSA 2XVNA 1QI2A 2HNHA 3FOKA 3GD6A 1K7FA 2DDXA 4O12A 3AIEA 2QCNA 1ZJIA 3MUXA 1JG9A 1BVZA 4PMRA 3LV6A 4K7VA 1BYDA 3S6TA 1H3GA 4QLJA 4M6VA 4AD2A 4WR3A 4LYPA 1QPRA 4F40A 4PBFA 2E5BA 3Q4DA 2X7WA 1MW2A 1MNSA 2OYMA 3S1WA 3I6EA 1WDSA 4F9JA 1B2YA 2I17A 3W7DA 3UCQA 3OBKA 2BOGX 5D2YA 1R87A 2RAGA 2B4GA 3OIHA 1GQIA 2PDYA 2Q3RA 1US2A 4UTHA 3MWCA 3KS5A 3N4AA 3H2OA 4XVDA 1JULA 1TFVA 2BS9A 1O5RA 3R8HA 1PEZA 3N3TA 3GVQA 4UFLA 4NXSA 1ITUA 3ANVA 3ZVHB 1RK5A 5I78A 1O4UA 3T6CA 4OVXA 1Z42A 1XQLA 4L4PA 3O0KA 3HPSA 3PWIA 4O28A 4BF7A 1E15A 1TIMA 2INZA 2CZFA 2YGYA 3UBPC 2XFRA 3M5YA 4JX6A 2VX4A 5HOSA 4OU1A 4DJFC 1OVDA 2ZE3A 3ZLGA 3ENLA 4FNSA 4M29A 3W4RA 3WQPA 1JZ4A 1SYTA 2QJNA 1V6VA 1WDPA 2DUZA 3TYUA 1PZ3A 3Q45A 5F1UA 4LVFA 4ICMA 3T07A 3G5EA 5SWUA 1W31A 3M0HA 5K4ZA 1OFAA 1XG3A 3DENA 4F3HA 2WZIA 1LWIA 4AIBA 3VNZA 5DXYA 3M16A 5K9CA 2ZZ7A 3HOJA 2Y6ZA 4YIWA 4JFVA 5DX7A 3L67A 3DC8A 4YL2A 1TJRA 3VE9A 4KS0A 1OCQA 3BPWA 1DJXA 1HQTA 1ZBCA 1ZENA 4US5D 3WQGA 2GK1A 4ACZA 4K36A 3RCMA 1XYFA 4Z1BA 3GNPA 4Q6JA 2J74A 4QG6A 2FPVA 4Z2KA 3NIYA 3TC3A 4GI9A 2NV1A 2QJJA 4EKJA 1LOQA 2LLEA 5AOUA 3IVSA 5KTLA 2PPGA 1LWHA 4H6QA 3QY7A 4JKKA 5AZ0A 1XDLA 1DE6A 2ISWA 3VOHA 2O9PA 1E3XA 3ITCA 1QK2A 4JICA 5AC6A 2Z1VA 3KTSA 3UR5A 3GNOA 1EH9A 2CZDA 4ORIA 3C52A 1A0CA 2XU2A 1XPYA 1TG7A 2X0SA 3LCHA 3GUWA 4P7QA 3TW7A 3EOLA 1FA2A 2ZX5A 4PTMA 1REQA 4OUIA 4AD0A 1I2OA 1YRRA 2CETA 5BRBA 1RSCA 1J11A 1EC8A 4NIRA 2DIEA 2XM1A 3W87A 2VUYA 1VHNA 3H70A 2V5LA 1ZB5A 3CYJA 1R3RA 1NDWA 4YYCA 1BWVA 1QVBA 2Y8VA 1LBFA 2RHGA 4WSKA 4LVBA 3AC0A 4XIMA 3G6LA 3SQMA 5A6TC 1TJPA 5FJIA 4GG9A 1SO5A 4FOJA 3QKZA 1BRLA 5C9RA 2WSPA 3OGVA 4ZQCA 3HJEA 3V3WA 3NTYA 1AQFA 1OGGA 7ENLA 3SGUA 4FF5A 1UWSA 3DYOA 4U10A 1UWIA 1NOUA 1R3VA 2E28A 3EAUA 3VKCA 4RV3A 1RVKA 1EA0A 4LV9A 2ZZ3A 2WAGA 1S5WA 3MBDA 3M0MA 3G8RA 3RMEA 4DQWA 2ALRA 2DH3A 2YCIX 4H3DA 4IIDA 4HNUA 3G0XA 5T9CE 4CNUA 1DIDA 4PRTA 2WWCA 4EXQA 2X40A 4MPQA 1UKSA 1UBPC 1V79A 4W5ZA 1KW1A 3EWUA 4DAFA 3CQ0A 4B91A 4IQJA 3NPWA 1KBBA 3H23A 2HCVA 4UXDA 1DHKA 2KX9A 4JN8A 1TR9A 1XH1A 4IFKA 3AXHA 4H8UA 2RKXA 1KBIA 3BCJA 2BNJA 4O11A 1PO9A 2E6YA 5HK4A 1TV7A 2IQ0A 4Z0JA 3CIXA 2Z2UA 2YIHA 2Q6ZA 4IG2A 3EXRA 1UJQA 1P0BA 1D2KA 3R7MA 3S8HA 1NH6A 2AGKA 2V82A 3K4WA 4CN4A 4H9ZA 1KCXA 3SRHA 3ZT6A 3VAVA 3JZUA 2YCLB 3ABSA 3EX6A 4GO8A 4M5PA 1Z6KA 4YN5A 4MNKA 4ZSUA 2ZUTA 1EQPA 3LLDA 3VIGA 3GC2A 3M5XA 3KLLA 3KP1A 4FF7A 4NAEA 3DZ1A 2DU2A 2OKOA 3PSWA 1IR1A 3MDUA 3VOIA 4PMOA 3VMOA 1WX0A 3P74A 5GNZA 1LOLA 2GGJA 2A6NA 1F3WA 1S1PA 5L9FA 4HMDA 3R0KA 4AW7A 5A6KA 3QZ6A 5ECVA 1CGWA 3VZZA 1XC4A 2HS6A 3LHVA 3LGEA 4UNLA 2OOGA 3VGFA 3VOCA 1M65A 3KCJA 1ZCOA 3MWAA 2W79A 3KVKA 5AYXA 3DYPA 1FHUA 2VVNA 2GDQA 4IXXA 2J66A 3UXDA 1WXYA 4R5EA 1EOMA 3ZIZA 4TMBA 4D9PA 1FRBA 4E4UA 3VD5A 2ANUA 2J78A 2JEQA 4HB7A 4JTRA 5H91A 2ESCA 2C15A 2YBUA 4C6FA 3A4JA 4LC6A 4HT3A 2O0TA 5AHEA 4GA8A 1XKJA 4MLJA 1KTNA 5FF3A 3UJRA 4HTBA 1FX6A 1K9DA 3VD7A 3FAXA 2D22A 2UWFA 3FJ6A 4HZ7A 4PMJA 1A0DA 2J88A 1ICQA 4PGLA 3SBFA 4QLLA 1HT6A 1K1DA 3F2DA 1SO6A 4UTTA 4U33A 2Z29A 4XD5A 2J7EA 1QI0A 3KVLA 3LN3A 5M3WA 3AMLA 4A05A 5JVLA 2WLYA 3M0XA 4WSJA 3AYSA 5I79A 1DORA 4AUBA 3GVGA 1T41A 3BAWA 5REQB 3E0FA 1VR6A 1ONRA 4XV0A 3AXIA 1VFFA 1CENA 1SR9A 1PDZA 3FXYA 3VGGA 4EPBC 3VDAA 4R33A 1S3TC 1KXTA 2ZUVA 3W26A 3S5YA 3AALA 4M0XA 3WF2A 2CXGA 3T55A 5TD4A 1AQHA 1B9BA 3PR2A 1DXIA 1S2TA 3SO7A 4X61A 5HMEA 3UEQA 3GVWA 1F3TA 3EDDA 4N0RA 2VEFA 1VCGA 1K8XA 1L6WA 4KGJA 1ZBKA 2PDFA 4W9TA 3CHDA 5T8GA 5LIUX 1M3UA 4GE8A 1EC7A 1J8VA 4GNJA 3QMTA 3CL8A 4I8YA 4A6GA 4TU1A 1YPXA 2PDKA 3UWYA 1WAWA 2Z1XA 4UMCA 2X1TA 3W7KA 3VC5A 4XD4A 3BMXA 1UMYA 3AYTA 4QDWA 1A49A 4H7VA 3RR4A 4EE9A 1G4EA 5D30A 1TMQA 1RPKA 1W32A 4GUGA 1I75A 5F1VA 1V6WA 1JRCA 3W1TA 4S3BA 2J8TA 1J2WA 2HS8A 2UY4A 1OADA 1TQXA 1H2JA 5CC6A 3O63A 3T4WA 1XFBA 2BXYA 3MC5A 1VYPX 4I9MA 2XN0A 2TAAA 2ISFA 1XIDA 3LQGA 3ZSTA 2BDQA 5KINA 3JS3A 3AUOA 4GGBA 4OBSA 4FLOA 1ISVA 5CPLA 4H9YA 4O10A 1XKYA 5IBXC 3TN6A 1B54A 3W2NA 2NXHA 3ZJ8A 4LCSA 3HO8A 2X16A 3OO2A 1AJ0A 3HQOA 5A8PA 1DV7A 1PX3A 1UD6A 4OZOA 1TKKA 4E4FA 4BZYA 4OFCA 1RVGA 5AECA 3CO8A 4DB7A 2A85A 3PZMA 3UY7A 4H01A 1GOOA 2PURA 3PBWA 3GNDA 3A4XA 2YOCA 4FXRA 4MMWA 1QHPA 3BUVA 1I1WA 2BOFX 3EKLA 1KD0A 1NVMA 2F6XA 1F4AA 3U8GA 1W3LA 3OJGA 3OW1A 3MHGA 2VT0A 2WMGA 3TNBA 3R6IA 3M0IA 2CLPA 4ZE5A 2V2HA 1XYBA 2WLZA 1RQHA 2ZADA 3I3DA 4TQTA 2DGAA 4CQAA 1GHSA 2J8FA 5GJPA 4MJ2A 4B5WA 1GKPA 4RL3A 3KW3A 4WXZA 3TA9A 1UB3A 4DZHA 1Z8AA 3D3AA 5LIKX 5BOEA 1E0UA 1ZBWA 4XBSA 2BHZA 1A5MC 1PZ0A 4H41A 3WH7A 1T99A 4DJFD 4AY1A 3NEVA 5HJXA 1JZ6A 1E4MM 3R2GA 3H4GA 2VR2A 2R1LA 4AZBA 3IK4A 1EGZA 5LHFA 4L1GA 2NX1A 4PTWA 1AA1B 1PKNA 1JZ5A 4AXKA 1XYZA 3H4WA 1J0JA 2INEA 3L4YA 3ZLHA 3NZRA 2FHFA 3OQEA 2PC8A 2E0PA 1A3HA 2PI6A 3WLMA 5MKGA 4OIFA 1OIMA 1UUMA 4Q7NA 3LGDA 4L1XA 1R6WA 3GVVA 3B05A 4HSNA 1WNOA 4UQCA 4H9MA 4Z1AA 1QNRA 2FTWA 1YNYA 3TLQA 4K37A 2YCLA 2IPJA 3FEMA 5CG0A 3THQA 3RHGA 1WA3A 3KCOA 4E4PA 2PWFA 1YYAA 2BMBA 2FZNA 3GAKA 3CQIA 4WIWA 3NZGA 1PIFA 1CXFA 1CEOA 3ABQA 3MHUA 4B5XA 3SCUA 4R34A 4WVXA 1GPWA 3O2LA 3AS0A 2QPUA 4G2DA 2A0NA 3R8RA 3L65A 4RE0A 3LYEA 1XH0A 2WCAA 3M0LA 1JPDX 4TX8A 2ZRUA 3WLPA 4N9DA 1XV8A 3SSJA 1WUFA 1RBAA 2A3CA 3IIXA 1O12A 1TELA 3PZGA 2ZWZA 1ZP4A 5CPTA 5BXTA 2IPFA 3JUGA 3P14A 4F0LA 3WLKX 1PS9A 2QIWA 3F5JA 2RGMA 5ABGA 3C0SA 2QR6A 1K03A 1KXQA 3M44A 4HNNA 3QPYA 3IARA 5EYWA 1DJZA 1FCUA 2PDGA 4S23A 3IACA 3LEPA 3THDA 3UA4A 4WDUA 1Q7MA 1W1A1 4GFIA 4GYJA 4PCTA 3LLFA 1OG6A 2EJ1A 3NO1A 4MSSA 1B4KA 1RP8A 1W5OA 4MFEA 1B1YA 3BG9A 3I3BA 4PCNA 4DUVA 3NZ1A 1YXDA 4S1FA 2C91A 1B3WA 1LBLA 2G3MA 4RDYA 2Y8UA 2ZUMA 3KWSA 3NJ3A 2P53A 2RGLA 2XG9A 4H9XA 1WYIA 2IUZA 2WZMA 5HA7A 5JBFA 1NM9A 8CGTA 2D3NA 3CT7A 1XG4A 3MB9A 1VEOA 1RAKA 2PAJA 3B9AA 4MOZA 3AIRA 3N2CA 1W9UA 3TAKA 1C8YA 2QT3A 2FHCA 3QYSA 3GXDA 2CLFA 2WBKA 2DZXA 1Q63A 2OYLA 4DWSC 2GJRA 3WK1A 3O07A 3T0BA 3NO5A 1BYCA 1W5MA 4M80A 2B7NA 3SUWA 2YW3A 1QBAA 1QRQA 5M2FX 4BHYA 1TPUA 3QBUA 3BL3A 4LS0A 3B8IA 2J25A 3W37A 3U3HA 1H60A 3BGJA 4AIOA 1Y5XA 3GW0A 3ARUA 1CLKA 3GHSA 3URAA 2V2DA 1LL4A 2TYSA 5F2MA 2XH0A 2B0MA 4GNKB 3DH7A 4UTJA 1WPCA 2CLEA 1W0MA 2WSYA 3GHTA 3DESA 3IWPA 1E71M 3ARYA 3H2FA 3P8IA 2QGYA 1JD7A 3CB3A 2R14A 1GGOA 5BRPA 3WY1A 2HE8A 4HU0A 3PG8A 4NNCA 4QNWA 3IK2A 4RK8A 1J10A 3QGVA 3M64A 3KOFA 1TV5A 3TTSA 1QMLA 2G37A 1FH7A 4IP5A 3TK7A 3V36A 4QCEA 1SQ7A 1DXEA 2NWRA 3QQ1A 3WLTA 1F2JA 1XSJA 1DBTA 4QJ4B 1A80A 4C6NA 4JX5A 4NU7A 5FD0A 2MANA 4J7RA 4LANA 5E9XA 5CLWA 1SVDA 1A53A 5A6SA 1Q6GA 1I1XA 2DZUA 3LCIA 3SQSA 1IV8A 5CZSA 4C1KA 3DOPA 4E6MA 2QDDA 3NL2A 4KGLA 4LW7A 1GHRA 3QFWA 2CW6A 1X1ZA 3T8LA 4MVAA 1XINA 3B9OA 3PWAA 4EF8A 4LAKA 1I8JA 3G77A 3PZQA 1Q45A 1R3QA 1C93A 1XJBA 3E2QA 3GR4A 4FLQA 3POCA 1KBKA 2J7BA 2NXIA 1JCXA 2D69A 2FYMA 2DZPA 3VOFA 1GKRA 2G50A 3I68A 3ZM8A 3NL3A 3TEVA 3T42A 3MZ2A 1E0XA 1PYMA 1CXEA 3MKKA 1UMLA 4UFMA 2XIIA 1CIUA 3RFAA 2R24A 2FQIA 1U5HA 1SFLA 1XCWA 3EMCA 5IBXA 3OB8A 6ENLA 2A7RA 3ABOA 3EA3A 4R88A 2DZBA 2Q09A 3TTOA 4Q3MA 5D09A 2H3BA 3MO7A 4PTDA 4A8LA 5LHEA 3UQNA 3WH9A 5CPSA 5F2LA 3C3NA 2D0HA 5DLCA 1C7SA 1D8CA 4Y96A 1TWWA 3UZWA 1FWTA 5LA2A 4AIEA 5J8LA 4AZIA 2OR2A 2TRSA 3T8QA 4B92A 4IISA 3V1PA 3PPFA 5I2UA 1DP0A 3FKKA 3VABA 1HGWA 1LROA 1AD1A 2ISSA 5EPDA 3HMCA 2WJFA 2WZEA 4AZHA 1E43A 4ICCX 4QXIA 3NSMA 4QCFA 2WHLA 3IJIA 3K4AA 4O57A 1RA5A 1R2RA 4O0QA 1BFNA 1J0YA 3LTYA 5BXPA 3VNJA 3PS7A 4B4FA 5HR7A 3WBYA 4ENLA 2X42A 3MMDA 1TREA 3UZXA 1M1BA 1OFRA 4E5TA 3SQLA 1GOMA 1EIBA 4O1BA 4Q4QA 3FJNA 5I5RA 5MF5A 3GM8A 3S9IA 4KT2A 3R0UA 3LI0A 2CFFA 5IRPA 3AMDA 5JXQA 4E38A 1J0IA 2CU0A 1W2VA 3NOEA 2E8YA 3FLUA 5LKYA 3P6LA 2VDHA 1YXYA 4C6IA 1KR0A 1DJGA 2POTA 3TZFA 1HW6A 2VM8A 4FAMA 4HOWA 2V9DA 3S2NA 3UA3A 1DWHM 4NILA 3W00A 4LFYA 1YDYA 1UKPA 2R1PA 3VMPA 1VC4A 2WW5A 2OT1A 3APGA 4Y9AA 1A5NC 4YXGA 5K9XA 3WEZA 1KBLA 3OU8A 1PWLA 3K1GA 3V5FA 2BZNA 4DBDA 1POJA 3HPXA 1X1OA 5JH2A 3WJZA 3PULA 4IMEA 5U4NA 3BZJA 4Q4MA 2Y7DA 1R3SA 4CQBA 1MQPA 1GJWA 6A3HA 2YW4A 3R11A 3OZPA 4GVFA 1MZRA 3N4EA 3MTWA 2GOKA 3HQPA 3W88A 4CKQA 1XSKA 3E49A 3SJ3A 2VDGA 1SZFA 1HUVA 3BICA 3UZJA 2PU0A 1T7LA 1A47A 5AYIA 2HEJA 3HFYA 5IFTA 3MANA 1QTWA 4C6KA 1GZ1A 3ITTA 4JCMA 3GIQA 3PPGA 3W7EA 2CZVA 3GRIA 1GOXA 3FYYA 3CM4A 1ICPA 2NW0A 1HO1A 3VZXA 1XWYA 3LBMA 2Y7EA 1JYWA 3EPMA 1C90A 3GDTA 2JBMA 4LT9A 5IHRA 2Y4SA 1UZHA 1Q6RA 3MUAA 4ZQNA 2PE4A 5GVJA 3PK7A 4H6RA 4MWAC 3CH0A 3CHEA 1R0MA 4MUZA 3MVIA 5BROA 3G1FA 4O17A 2UY3A 2WHMA 3N2MA 2OO6A 5DY3A 1KM2A 2EG8A 1R7OA 3UT0A 3SJNA 3COTA 2E1DA 3NPUA 1OBAA 2ZRWA 4JN7A 1TV4A 1I6NA 3FN9A 2QUNA 1NF0A 2YA1A 4H6EA 2Z4GA 1TCMA 4HHHA 1L0PA 2DZVA 4RZ4A 2Y5EA 1Q6DA 3S6DA 3EA1A 1EWDA 5HNRA 3F1QA 4KFOA 3HJZA 3C4UA 2I7GA 2VL4A 2YB1A 1GYLA 4FX8A 3WK3A 3EA2A 3L0KA 1V4YA 3U9IA 3AIQA 2E68A 3TJIA 4FNPA 3NSNA 1F4HA 4MJMA 4WXYA 3NWRA 3TQVA 4BEUA 1QW8A 3IV8A 1BAGA 4XIAA 2VFDA 3KXQA 1BKHA 4ASTA 3RGTA 1TTJA 1VH7A 3K46A 5EMYA 4L6DA 1BXCA 3KFTA 3OBEA 4LBUA 3W23A 4K8EA 3P8JA 1E6NA 3MPGA 1EF3A 2OWCA 1K8YA 1EF2A 1ITQA 1E6QM 2DSVA 3M6DA 1AW5A 4W7UA 2NLIA 4I6KA 1XPGA 2GDUA 1DIOA 2QQ6A 4AEOA 5C5YA 4JTGA 1KC7A 3O6AA 4PUWA 3ZYZA 3IRDA 3WMLA 3VNDA 1XI3A 3GNNA 3UYCA 4AYSA 3L4UA 4E2OA 3EOOA 4M6UA 1IF2A 3DCPA 3WJXA 1ADSA 3LOTA 4RXGA 4KCVA 2F8QA 5FF0A 3MKCA 2QULA 5U7SA 1YNQA 3AICA 2C6QA 3NQ7A 2J7CA 4HZ6A 3NPVA 1KQYA 1VJZA 3EOEA 3LCLA 4W86A 3KCLA 3W27A 4S2BA 4N9EA 3O06A 5A6AA 4XAFA 3RLHA 3ARXA 4EPEC 1S2CA 3RRAA 3R25A 2VI0A 2RDWA 3SADA 1VBRA 1Q7ZA 1WZAA 3VNMA 2AMXA 2P76A 4D72A 2VZVA 1FWNA 3W71A 1HKJA 3PZ9A 2OZ0A 4JTFA 5AHNA 2BGSA 3QOKA 1WCGA 4NNBA 5F2IA 1FDZA 1LL7A 5EY5A 3PZNA 3UG4A 2O7QA 1H51A 5A69A 1MUMA 5H8MA 4L1WA 1KA9F 3IVTA 1JI2A 1M03A 3SN4A 3WMBA 2QF8A 4DM1A 3S47A 2C0HA 4JPGA 2RJGA 4MDOA 2Y89A 3VDGA 1ZUAX 3BJFA 4JIIX 2WC3A 4B3ZA 3DAQA 1KM4A 3CIVA 3HF3A 3VK5A 3F2BA 4OV4A 2WC4A 2R82A 2GWNA 1Q6EA 4UIOA 1JDFA 4NASA 4YPJA 4K39A 3RG6A 4QAIA 3NL6A 2W62A 1G7VA 3FJLA 5FEPA 3S1UA 1JCNA 4QEHA 3N9SA 1UKQA 1OZMA 4K1GA 3SRKA 3ZT7A 1PPIA 1EX1A 5D33A 3O16A 3CC1A 3UJEA 2L5HA 2UY2A 3PB0A 4EAMA 2NV2A 1A5CA 4CGTA 1J18A 1B3ZA 4CQ9A 2OLHA 8XIAA 1F8IA 2J47A 2GGEA 4MPKA 1QR7A 1W3HA 3V0SA 1Q65A 3ZR6A 2Z6JA 4LV4A 4IHCA 4KWWA 3NDYA 4ZMGA 1UOZA 1B57A 2XH7A 1ZSXA 4I7WA 3KHDA 5AC4A 1FWFC 1D3CA 2OJPA 4AMAA 1XYLA 4D6DA 3IRSA 1WZMA 2WVVB 3WLHA 4AZCB 1VIWA 1YPIA 4FX7A 2EXOA 4D8LA 3PAJA 2V5BA 2PWEA 1NY1A 2JF7A 2PCQA 2VWSA 1SJAA 3PC0A 3CIWA 5I24A 2PDJA 3L2LA 3BMVA 2OEMA 1PTDA 1J0KA 4B90A 1UZ4A 4L56A 2WWDA 3VGBA 2PWGA 4F0RA 1DTUA 4NUWA 1CLVA 3STEA 3H2NA 4GZIA 2AAMA 3MMWA 1BF6A 1WUEA 3VDCA 5FSEC 1ZRQA 1HXJA 1G1YA 2A2IA 3FFSA 2CLHA 4J9JA 3MSDA 4EPKA 3HFTA 3NL5A 2WM1A 4H1ZA 5CC5A 2VFFA 4B2DD 1BF2A 2YZ5A 4HMEA 3WF0A 3VGDA 5CSRA 3GHRA 3SAZA 3IIZA 2RJHA 4ZQMA 3RX4A 4LUTB 1V6XA 3L4TA 4AH7A 4XISA 4JY9A 4UQAA 3Q65A 3WFAA 4M6QA 3WDIA 5F4WA 1U83A 3AU6A 4LCRA 3ABRA 1F73A 5M1TA 1KM3A 2EPHA 2QVNA 3ELFA 3FEQA 4IGNA 1MW3A 1V6YA 1ODZA 1V8EA 3V18A 4PL2A 3SI9A 3E9AA 3VIMA 2PBGA 4RPQA 1QPKA 4FXFA 3PTKA 5C9ZA 2FZBA 1FVPA 1Q4WA 4HP5A 4WK9A 3AMGA 3IGXA 2WCGA 4RPPA 4GI8A 4AYGA 1EWEA 3DX5A 4HHLA 3STPA 3GTHA 3WQWA 5BOFA 1FWSA 1IEWA 4FIRA 1EDTA 2VQTA 1J9YA 3T2OA 4POCA 4BQ3A 4O50A 3RITA 2OOFA 1MUWA 3WNLA 4YLWA 3UZ5A 4YCPA 3DGRA 1LT8A 4GZEA 4S2CA 2X0HA 4Y6GA 1EDQA 3IVUA 2V0TA 3Q37A 4LAUA 1V3KA 1SSDA 2XVPA 3IJ6A 3STCA 1JXKA 4AG0A 4ERAA 4DPPA 1P0EA 3O6DA 4PL1A 2E6AA 4QRNA 1D8WA 4KCUA 1HJVA 1DTNA 4UQDA 3AS2A 3ZWSA 5KETA 4G6CA 1W5NA 4MY9A 4S3AA 1C7TA 1EFZA 1EPXA 1OC5A 3WFZA 5BWAA 3R10A 2QJIA 2OZTA 3BE7A 3GXIA 2IPGA 5CZ0A 1FBAA 1HX0A 3EOUA 1H1YA 4U31A 4BI5A 2VQUA 8TIMA 4JL1A 4YS1A 1P6WA 2XFYA 1Q6OA 5LXXA 4P8VA 3SSZA 2XPKA 3FVMA 1LCOA 1LLZA 3IIPA 3LHTA 3N18A 3IJ7A 3QKEA 4GIEA 3UZYA 5FF2A 3VC6A 4J28A 3PZOA 3WF1A 5E70A 3IJ8A 2QVHA 3S0CA 1RK6A 3ZZ1A 1TVPA 3UWZA 3EDEA 2BVDA 1GJUA 4F0KA 1EGVA 1JNDA 2A79A 4J3XA 3W2LA 1DJQA 2A21A 4CLMA 2V63A 5A2BA 1VLIA 1MVYA 3PJXA 4LYQA 3DI0A 3MV11 3W38A 4HNOA 3B9DA 3GKFA 3NVDA 3IAQA 1GYMA 4H2CA 4WLCA 3KDOA 5H8PA 1K3UA 4UQEA 1TE1A 4ML9A 3RF9A 1VYRA 2UV8G 4QX4A 4ZTYA 4M1RA 1X98A 3DFYA 4JQAA 4CD6A 1V51A 1JD9A 2IPWA 3DXIA 4HYWA 4LF2A 5D9MA 4PUKA 2PLKA 2QCDB 4MWAD 3LENA 1ALDA 3WJWA 2OO0A 1YADA 3AIWA 4HU8A 5LIYX 3B8TA 1P1MA 1M01A 1ITCA 3AJ7A 3E0IA 3ITLA 1XQKA 3UF9A 3PNZA 4Q33A 3PUOA 4KRZA 1L2UA 2FVKA 2XSAA 4KETA 2AQWA 3OHMB 3GU2A 1I4NA 4P7LA 3KEHA 4AHQA 3GXNA 3W1QA 2YL8A 1XL9A 2Z1BA 4NYUA 4L65A 1IT0A 1UP3A 4O8AA 2GVJA 3QSRA 4WJXA 1TZ9A 1Q2RA 1E73M 4LQ1A 4A3HA 4D71A 5I77A 1E1CB 1HKIA 3AIVA 3IUHA 2YSWA 4ZZ9A 1TWZA 1VHCA 3WQVA 2RDXA 4O8RA 2WZTA 1ME7A 3TJXA 2FZMA 3EDJA 3H2MA 4RNIA 2TPSA 3LRKA 4UWMA 3WG6A 4NJJA 3I7RA 1FCQA 1JAKA 3KM8A 2ABAA 1B0IA 3CK5A 4GVGA 2F61A 1A5LC 2WVVA 4W8BA 1XLBA 3GZAA 1VQTA 4GZ7A 3EWXA 1F3EA 3E74A 1XLDA 1HVXA 4XKYA 4HPNA 1CT5A 1WDWA 3SIZA 4L6OA 1JCMP 5C9XA 4B4HA 3CH9A 1C29A 3UFYA 3VINA 4NZ5A 4B9YA 4PUNA 3I7SA 4LYRA 2AGTA 1AJ2A 1ONXA 4LWWA 3AMKA 9XIMA 2YA2A 3AS1A 4NY2A 2WMHA 2ODOA 2ZUWA 5LSMA 5M5DA 2BVWA 2ZQ0A 3V75A 1Y8BA 4CQCA 3LTSA 3MJMA 4PB4A 3ZOAA 2C16A 1E6ZA 1W9VA 1SUXA 4YNGA 2DUXA 4REQB 4KH2A 4AVNA 4OT7A 1PZ1A 3T78A 5TNVA 2E6DA 1JF5A 4QP0A 3TJ4A 5CJNA 1D3GA 5I6SA 1AUSL 4OOZA 5I3HA 4GUHA 2D2OA 5A8OA 2DFAA 4G7EB 3BH4A 5I7GA 1OSEA 3SY1A 4BY3A 3WUEA 1H4PA 3EWDA 2Y5SA 3HGRA 3PTDA 3HBLA 4KWOA 4LUJA 1GWJA 2QAPA 4D8AA 1JQXA 2ACUA 1AVAA 3F4DA 2JKAA 6CGTA 3LCGA 4JTCA 3QH2A 4DF1A 4GIAA 2B7OA 1T8QA 3PPHA 4DBUA 1FKWA 1PKLA 3P84A 4DN1A 3SGGA 3PFMA 2OX4A 4N6FA 3O9NA 1EP3A 1SFJA 2G3NA 2VYOA 3GH7A 2J77A 2CEQA 1BSLA 1BVNP 2HZGA 5BW6A 1W1TA 1V08A 2MNRA 3K4DA 1M7JA 1S5NA 3H6OA 2X1IA 4HZ8A 1ISXA 4PMUA 1N2VA 3U0HA 1X97A 3QHOA 1QO2A 5BWFA 4E8DA 3GR7A 3CT2A 1A5UA 3URBA 3TLLA 2V81A 4YCOA 3BLOA 3V7PA 3TYBA 1VFHA 5A8MA 4WGXA 2PP0A 4HSHA 3W28A 4DF2A 4WGHA 2GJXA 3DEQA 1K7EA 4PB5A 4Y8FA 2HBXA 2G5WA 1Z69A 1E4NA 4Q4OA 1R3WA 4UZSA 1H5VA 3ARRA 3W2JA 1K77A 1PX8A 3MUZ1 3QV6A 3BCDA 3RMJA 4F66A 3W1MA 4IIBA 4MB3A 1WZKA 1IE7C 5D9PA 7REQB 2OPJA 3G22A 1QNPA 4UQ9A 4LEFA 2XGZA 3GVRA 4B3KA 3M47A 3M7WA 4DPQA 3U57A 1XM3A 3CBWA 2NUYA 3L12A 4OBRA 1OC7A 3E2SA 1HP5A 4MDPA 3BOFA 2EAWA 2G95A 4JQ1A 3GLCA 1XLEA 3SCWA 3VCCA 1LUCB 3A5VA 1I2PA 2O9OA 3SDOA 1OQFA 1UG6A 2DZSA 3CL7A 1PBGA 1HJSA 2BGNE 2ZDRA 4ES4A 1G94A 3ECQA 2VRKA 4OOUA 1W5QA 4P8WA 4F0SA 1BKSA 1X96A 1W1PA 3LZ5A 1J0HA 4ATDA 2D2GA 4MKSA 4ZXOA 3IGSA 4ZBCA 1QPQA 2EGZA 3R43A 2CCRA 4JTAA 4W84A 5H6HA 3AZTA 4S3FA 5D8WA 1LRQA 1SR0A 5LNWA 3ARQA 2FIQA 2VEKA 3LSCA 3VGEA 1P5BA 3FX4A 1HKWA 2PLCA 3PBYA 4NVTA 4DO4A 5CBBA 2QDEA 4D6CA 4RW5A 4HA1A 3OOQA 2PP3A 2WXDM 3QPEA 4RCXA 4GXPA 3GK0A 3OYXA 2VGBA 1KB3A 5DRCA 3V5OA 1AZ2A 3FS2A 2GQ8A 4L4MA 3F5LA 4BF9A 2NSOA 1V3MA 1RJQA 2J79A 1QOXA 7CGTA 1WB0A 3NAVA 4YHGA 4X3ZA 2C19A 4U3AA 4S3DA 1QT1A 2R91A 4Q4RA 3H24A 4AWUA 1MXGA 2J9YA 4Z2JA 3E6EA 3FVDA 5ABHA 5K3VA 4OQVA 4INFA 4P8UA 3UESA 1EBGA 1H7WA 2A3HA 4GGHA 1OYAA 5J5RA 1EO7A 1LL6A 3BTNA 3QOMA 4U28A 3GXPA 3W53A 3G0UA 1O94A 3GC5A 3AHVA 1PE1A 3VKJA 3U2EA 4FA3A 3YPIA 2XVLA 4H7CA 4GZJA 1R85A 2F2KA 2VR5A 4IUGA 2UY5A 4PR4A 2Z2BA 1XDJA 3PTQA 1UW9A 2E9LA 4K8GA 4ZOEA 3WLSA 2HXTA 1U33A 3MU7A 4IF2A 2QJMA 2XSBA 2J8GA 4QIUA 5LGZA 1BTCA 2P3EA 4QJ5B 2V6AA 3G1DA 2RFGA 1QCWA 4IP7A 2XHYA 4UTKA 3CZKA 3N2BA 4AAJA 3O0FA 3NQ2A 4WOZA 2FPYA 3FK4A 2AKZA 1YW1A 3TH6A 4XZHA 3VXGA 2FH8A 3R58A 3W25A 3P5ZA 2FHBA 1KLYA 4M24A 3C8FA 3U7BA 4RDZA 4NAFB 1C9WA 3C0QA 4R9XA 1UZ1A 1VJSA 4O1FA 3S2LA 3UXAA 3W72A 4O14A 3VKKA 4NZFA 3PZVA 5DT7A 4OUEA 1FWGC 5CBJA 3D47A 1A5BA 3LXBA 3C0LA 3EXTA 1JAEA 2EPKX 1AD4A 4WD0A 4REQA 3RPTA 4RR4A 4XD6A 5DCDA 3S1VA 2VX5A 3TW6A 4AD4A