3SUUA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with gal-pugnac
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suuA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suuA02
1C7SA 2D3LA 1GORA 1EHAA 1Q6GA 3QOKA 3AI0A 1UWTA 3OBAA 3VIJA 3ZT7A 2EXOA 2GJPA 2WAGA 1QPKA 4M80A 1GUVA 2DGAA 2DSVA 3U7VA 3E1F1 3WDRA 4ATDA 4BS0A 1E0WA 2DT2A 1H0GA 5CSYA 5JBEA 4BQ5A 1XD1A 5C8BB 5IXEA 4BF7A 2Z1SA 4PTVA 5CGMA 1HN1A 2PB1A 1TVNA 1BYCA 2CKSA 4B9ZA 1W9UA 5I77A 5AY7A 3LPGA 2JEPA 1K9EA 3WDJA 2ZX7A 1UH4A 3AHTA 4B16A 2XG9A 1UR8A 1CXLA 1UOKA 3ZOAA 1JXKA 1ZB5A 2VZSA 3SCTA 1JDDA 1JYNA 4D6GA 3ECQA 5FL0A 2VOTA 2FHCA 3PN8A 1C7TA 4ZE5A 1JNDA 3ZSTA 1RH9A 1VBRA 1XD0A 4HU0A 4NZCA 4QDMA 6CGTA 1J9YA 3AICA 1E72M 2ZUUA 3AISA 3AS3A 4K68A 5I3DA 3K8MA 4KGLA 4DWSD 1W3JA 1CGTA 1V08A 2VTFA 2G41A 1TA3B 1GPFA 1AQ0A 1EDTA 3NSXA 4UTFA 1B3YA 3VM5A 1JZ4A 2Z1KA 2WMKA 1VEPA 4LYQA 1XV8A 3EDJA 3BGAA 1KCLA 3WQVA 2D20A 1AVAA 1OIMA 3VMOA 1E4LA 1TMQA 4JKKA 4AD4A 4W5ZA 3W82A 5EB8A 4F79A 3JUGA 1VJSA 3ALFA 1OT2A 1CBGA 2FH6A 5E6YA 4B3LA 5LA1A 3ARQA 3BAIA 4E8DA 4W93A 3MUY1 2WVTA 2YOCA 3N11A 1UR1A 4BCEA 1NWSA 5D9MA 3RJXA 3ARUA 3B9EA 2GVYA 1UD5A 4GO8A 4MJ2A 3WSUA 3CZ8A 1V6VA 3OLIA 1JF6A 2D2OA 1ITCA 2GK1A 5D4YA 4HMEA 2IXVA 4CUCA 4WIWA 4V2XA 4KMQA 2DPEA 3BAYA 1XH0A 1GOQA 4YHEA 1QNOA 4D6DA 4UOQA 5BCAA 3N9KA 3O2LA 4UQBA 3WMBA 4KH2A 4WKAA 3CTTA 2WLYA 2VRKA 1WZKA 4JL1A 4YN5A 3QR3A 3J7HA 2QV4A 4EKJA 3N12A 2X1IA 4CVWA 2E8YA 4IM4A 4JCLA 3DECA 4D6FA 3CPUA 3SCPA 1MVYA 1XRVA 1WCGA 1WNOA 1CGXA 4YHGA 2CEQA 1G01A 3NYDA 3RPMA 1JZ6A 3CLWA 4OBRA 3CMJA 3NUKA 5CLTA 4WKFA 2XM2A 3F5LA 3VX0A 2W61A 2WMIA 4J3TA 1CDGA 2ZWZA 3DYPA 3SURA 5FOOA 4J7RA 5I23A 1GOWA 3GNPA 4AZ6A 3AROA 1VENA 3FY1A 1CLVA 5AYBA 1LG2A 1W91A 2WVVB 1UWSA 1HVXA 2WVSA 3PZMA 1MFUA 2GSJA 2PWEA 4CN4A 4M1RA 4DWSA 2OSWA 4D6CA 2X0YA 3WUGA 1XSJA 3EYPA 1MXGA 2B31A 2J78A 1RD6A 1GNXA 4JFUA 3N13A 2E0PA 4OIFA 4FLRA 1K9FA 2VVNA 3L4WA 2A3CA 1US3A 1QNPA 1E3XA 4L4PA 1WDQA 5TD4A 4XZWA 4NRRA 2YLLA 2QMJA 1WAWA 3CZJA 5HBFA 2J7EA 2VC9A 4AZGA 5A2CA 3DHUA 2BXYA 5A6SA 2XVKA 2PBGA 2DT0A 1EQPA 4P8VA 1JDAA 2E4TA 1E70M 2EJ1A 4XX6A 1EO7A 3WUBA 2J47A 1W9PA 1QNSA 2QLYA 4FF5A 3VVGA 4N0RA 1LL7A 2F61A 1NP2A 3IJ8A 3WKZA 4D6EA 3QHMA 1KGWA 2PC8A 3RCNA 4UQAA 2EPOA 2W66A 1XCWA 4S3JA 4E2OA 1DHKA 4AYSA 1QI3A 3QOMA 4HP5A 3PZOA 3VIKA 1UKSA 2A3AA 2UY5A 3OZPA 3KWXA 3U5UA 1Q6DA 4ZXOA 1K9DA 1H3GA 4QAWA 3W0KA 1M01A 2YLAA 5E0CA 1BAGA 3GZAA 1ISXA 4Z2HA 3ARYA 1Q6FA 1W2VA 3FN9A 3MMUA 1PX8A 4UOZA 3ARVA 1C8YA 2YL6A 4UCFA 1HJUA 4JFVA 3CO4A 5M3WA 1HP5A 4HMCA 2ZE0A 4W86A 3IAPA 5JIWA 2VX7A 1CIUA 5LA2A 3ZM8A 4UQDA 5A6AA 1E6QM 1BVZA 1R87A 4BQ3A 1ZBVA 1UYQA 2YL9A 2YA2A 1HJXA 2XWEA 4M8UA 3N15A 2WB5A 4AZ7A 4QCFA 4PMXA 1D2KA 3WEZA 2ZXQA 4IISA 3APGA 1V0LA 4U2YA 1A47A 2VCBA 2J25A 4ZXLA 4MNMA 1KWGA 1E9LA 2WPGA 3SCNA 1KWKA 2YKKA 5GNXA 1SFSA 3KE0A 4PSRA 3SEPA 1E5JA 1NWUA 4GINA 4ATWA 3UG4A 3GXDA 3QHOA 1OT1A 2X05A 1B9ZA 4GKLA 5A8OA 1I75A 2XYLA 1W2PA 2DH2A 3PZTA 4S3KA 5JUVA 2JIEA 3AXHA 2UY2A 3ARRA 2XUCA 5BROA 3POCA 1I1XA 2WSKA 1HJSA 1JAKA 1KFWA 1BF2A 3AXXA 5A3HA 1WZLA 2WBKA 1GQJA 3MMWA 3PZUA 4W7UA 2V3DA 3W53A 3ZT5A 3QHNA 1WDPA 4AZBA 1W1VA 3UCQA 3CUJA 3CGTA 1E40A 4OBSA 1GW1A 2OYMA 3CUGA 1IV8A 1OBAA 2QPSA 1B1YA 9CGTA 1WKYA 3I3BA 5BXSA 2J8FA 4KWUA 1JZ8A 3RM8A 3WH6A 3K8KA 2VT0A 1IZJA 4WSKA 4AZCA 4L4OA 1VFMA 1E43A 3TA9A 5FL1A 1HIZA 3AZSA 4HMDA 1OB0A 1R86A 1LL4A 4MB1A 3CUFA 4GO9A 2WKLA 1BGGA 5DF0A 4D72A 3F4VA 1TCMA 2PBOA 1WDSA 3TOPA 4ZEPA 1ESWA 1SR0A 2DQXA 5M03A 3POHA 4PTWA 5HDRA 2CESA 4OJYA 4RE2A 2OYLA 3VNYA 1GZJA 4CKQA 4HPHA 2AOSA 2NT0A 3WF0A 3VM7A 3W25A 4YPJA 4P7NA 3UG3A 4C7FA 2D0FA 3BLKA 3W24A 4UQEA 3VX1A 1E15A 1LWHA 2W62A 3GNOA 1G1YA 3WEMA 2GJRA 1EO5A 1JYWA 5DEZA 4D6HA 4HZ7A 2BXZA 2XFYA 1OGGA 4CCDA 1UD6A 2WCSA 4EK7A 5ABHA 4UFKA 1E71M 3ARWA 2CHNA 4U3CA 2YBUA 1QW9A 1OGSA 1ZBKA 3K4AA 2YBTA 1NOWA 3AIQA 4M81A 2V3FA 4UQCA 3WH8A 1CECA 2VZUA 1AQMA 1PZ3A 2O92A 3HU7A 2VCCA 3THDA 2BS9A 4R27A 4LXFA 4PUDA 1JXJA 1E6RA 1GVIA 2BFGA 4H8UA 3T2QA 1FFRA 1E6SM 2X8RA 2WBGA 4RE4A 1FOBA 3AJ7A 5E6ZA 1E0XA 1OWQA 1QI0A 2E40A 3WDHA 3EDDA 3W6LA 1QVBA 2XFFA 2V5CA 2XIBA 1TA3A 3N1AA 2YJQA 3WFZA 1Y7VA 3VO0A 4PMYA 5DFAA 5I6SA 3GM8A 1FH8A 4HOZA 5A6MA 1L0PA 2OWXA 3L4XA 1JL8A 3T09A 3TTOA 4M24A 5A2BA 3AFBA 2VZOA 2PWDA 2YL8A 1XSKA 1UH2A 3OLDA 3VIPA 4TVDA 2BY2A 3GXFA 3AS1A 4CD8A 4MDPA 4C7GA 3LPOA 1V3IA 2GDUA 3DYMA 5I24A 4J3WA 5I5RA 3WNLA 1BPLB 4XV0A 3WL0A 2J7CA 1H4PA 1BG4A 5A2AA 3RDKA 4J27A 4LYRA 3UR7A 3AOFA 2WMHA 4WKHA 3WY1A 3IJ7A 2EPKX 3F5KA 1HJQA 2JF6A 1HKKA 1W9XA 3W26A 1SYTA 4B9YA 4CU8A 1PAMA 1GQIA 2IUZA 4UR9A 5E70A 5I79A 5DMYA 3PZGA 2VVSA 1OGBA 3AHYA 1VFFA 2G3IA 4ZE4A 2E9BA 3WN6A 1CGWA 1NOUA 2BV9A 1H0IA 1CGVA 4MDOA 1HKJA 1UR9A 3FW6A 1DTUA 1QI5A 2WC4A 1G9HA 4AEFA 4M82A 3KL5A 1U33A 1CXKA 3RILA 3OGVA 2MANA 3SIMA 5JBDA 4U33A 1VF8A 2VX4A 2BHYA 3WNKA 3EBVA 1XH2A 1NH6A 3GBEA 2PWGA 1AMYA 1MW1A 1OSEA 1H1NA 3VD7A 1E1EA 1VB9A 1UKTA 4U5KA 3CH9A 3BSHA 4PYSA 5GPRA 4MADA 3TP4A 1E6PA 1FFQA 4XUYA 4UFHA 3VD3A 2DSWA 2DSUA 2D0GA 2D0HA 3T08A 1JIBA 2Q8XA 4B3KA 5AYIA 1JNEA 2WYSA 3AIBA 1ZBCA 1DWJM 2Y4SA 1CEOA 7CGTA 2VQUA 4GIAA 4MNJA 1DWHM 3VTRA 3ZIZA 4PEEA 5M5DA 3IANA 4MB4A 4MNLA 1NWRA 3NDZA 2WVVA 3M6DA 4D1IA 4EANA 3WQ5A 1UR0A 1JZ5A 4TTGA 3FHQA 1M7XA 3KL0A 3TTYA 3W38A 1C91A 2VR5A 5D8WA 1WDRA 2WXDM 2BY0A 1C90A 1W3LA 1UWUA 1NOFA 1ZL1A 4U3AA 4PSPA 3AMGA 3THCA 5HOSA 3WBAA 3UR8A 2VRQA 4AD1A 5AC5A 5CSUA 1UKOA 3AXIA 1UWRA 1UD2A 1UD3A 1MYRA 1CGYA 4AZHA 3AZTA 5BYWA 4MAVA 2ZUNA 3RO8A 3VIMA 4TX6A 3EDKA 2E8ZA 6TAAA 2D1ZA 4FLSA 1NARA 1CENA 3WNOA 2WM0A 3WMCA 1RP8A 4W84A 3TTSA 4KRUA 2VO5A 3T0DA 1HF6A 4JKLA 3VGBA 1JAEA 2CITA 2UY3A 3I3EA 1GJUA 2J7FA 2BVDA 3TTQA 3KZSA 4Z2LA 4W8LA 3W28A 3W81A 1G5AA 4F9DA 1PIGA 2ZX9A 2XFRA 1U2YA 5CPSA 1W3KA 2J7BA 2XM1A 4AW7A 1HX0A 4HA4A 1PBGA 5DO8A 1ZJAA 1EGZA 1W1TA 3LMYA 4M56A 1GOOA 2G3MA 3VIOA 2CIPA 2WSPA 2GFTA 1V6XA 3W29A 2JEQA 3AHXA 1K6AA 5I0DA 3GDBA 1O6IA 3IK2A 4HZ6A 1W3HA 1KBBA 1UWIA 3UG5A 3VD5A 4H8HA 5CPTA 2TAAA 3O9NA 2DH3A 1ZU8A 1V02A 1J12A 2CBJA 3ZJ6A 4W5UA 2OWCA 2C7FA 4UFJA 2OSYA 2XTKA 4GZIA 2C0HA 3WD0A 3VGEA 3O6AA 1ODUA 2VUYA 5A95A 4JFWA 3LPPA 2Y5EA 1UR4A 2OSXA 3AZRA 1TUXA 4JL2A 1ISZA 2ZICA 2CBUA 4WK9A 3VU2A 2BY3A 2BY1A 3AIEA 3SUVA 1M53A 4J3SA 1ISYA 1GJWA 3IAQA 2BVTA 1TE1A 2NW0A 4Q7NA 4LPCA 3A6OA 3CHDA 2ZIDA 1EHNA 4XZBA 3PTQA 4OUEA 2ZUMA 2BNJA 1NQ6A 3T0AA 3HN3A 4W7VA 5BXTA 3SCQA 2J77A 5KZ6A 3AHVA 1H11A 3GH4A 1XC6A 1JF5A 3A4XA 5HPCA 4XB3A 4TOQA 4HTYA 1FP9A 4GXPA 6A3HA 3GXMA 1GOIA 3L4YA 4JFSA 2BVYA 2A3BA 2WWCA 3SCSA 2CBVA 5CG0A 7TAAA 3WQ8A 1TFVA 3EDFA 4CD6A 2CYGA 2Y24A 1EXPA 1D7FA 5LA0A 5M17A 3SUUA 2D24A 4ZFMA 4WJXA 4AWEA 1YHTA 2J7DA 2XWDA 4QLLA 2E9LA 2WMJA 3II1A 1KQZA 3A47A 3RMEA 3BMVA 4BA0A 2WCAA 1DWFM 2VR4A 1H2JA 3AIRA 3W4RA 4X0NA 1DWAM 3VDBA 3W27A 1E4MM 4LGXA 1VEOA 1C3FA 3HMCA 4GQQA 4P8UA 3SCWA 4FLQA 3CMGA 3OG2A 1G0CA 3S2CA 2X0HA 2J7GA 3DHPA 7A3HA 5ABFB 2DIJA 1LG1A 1EQCA 2WVUA 4GI6A 3WNMA 4OOUA 1CYGA 3VDHA 5FCZA 3ZMRA 1IZKA 1V6UA 1XHGA 1KXVA 1BGAA 1WP6A 1E6NA 1J0KA 3MS8A 3WH5A 4IPNB 4PUEA 5CJ5A 1R7AA 2WHKA 1YQ2A 3VILA 8CGTA 1FHDA 3AMKA 4C91A 4NRSA 4J3UA 4V28A 3CUIA 1NP0A 4Y7EA 1BYBA 1MQRA 5CGTA 4D6IA 1CXHA 5FKYA 5A6KA 3N17A 3NSMA 2OYKA 3L4VA 1GQLA 4E8CA 2YA0A 1Q4NX 2WNWA 3VGDA 3MU7A 3WF2A 3GXIA 1FHLA 2ZOXA 3RIKA 2WZHA 4LX4A 5ABGA 2J62A 3FNDA 4W89A 3OZOA 1ZBWA 3FXYA 2G3NA 1QNRA 2GJXB 2HISA 4D71A 1FA2A 4TTUA 5IHRA 4M29A 8A3HA 1FH7A 3AS2A 4CVUA 1RPKA 1EOKA 2ZXBA 1UG6A 1J01A 4QLKA 2JALA 1UUQA 5F7UA 4ML4A 4KRTA 2EEXA 2A3EA 1BYDA 1WO2A 2X2YA 4OZOA 2C8NA 1EA9C 3MUZ1 2V5DA 4URIA 1E73M 2CETA 3ARPA 3VDAA 1EDGA 4J3VA 2EPNA 3VOCA 2YDQA 2VX6A 1PPIA 4Z2IA 1I1WA 1GCYA 2IXUA 1CXEA 2PWFA 4PMNA 2XVPA 3MMDA 4UOJA 2J74A 3DC0A 1B3ZA 1CNVA 1VJZA 3WDQA 1HKIA 2CERA 3BAWA 1E5NA 3MSGA 5BXRA 3RM4A 2W91A 5A94A 3ARTA 3HJEA 1V3MA 3WQWA 1DWGM 3TONA 2FHBA 3ALGA 4J3XA 4AZIA 3GYCA 2G3JA 4P7RA 2CHOA 3W6MA 4R5EA 4JCMA 3L4UA 1PEZA 5DT7A 4HOWA 4QLJA 1KR0A 4U2ZA 3QGVA 1DEDA 2QMKA 1JZ7A 3SCVA 4DUXA 1X6NA 1B3WA 4W85A 1M04A 3LPFA 3I3DA 4NSBA 4LQ1A 4TUFA 3CHEA 2WC3A 2WW5A 4JHZA 5LYRA 2V38A 3CBWA 1V03A 2CBIA 1R85A 4OKDA 2DT3A 2Y8KA 3WUFA 3ZO9A 1V3LA 3NJ3A 2WANA 4BQ4A 1GVYA 4A3YA 3WQ6A 1TR1A 1D3CA 2DIEA 2CCRA 3WH7A 5EBAA 4AZCB 1KR1A 4E4PA 1HL8A 4W8BA 4BQ2A 1KXQA 3PZIA 1K9TA 1VRXA 4MB5A 2BHZA 5D9NA 4TVUA 4BZYA 3SUWA 1JZ2A 2W4XA 1QHPA 1XYFA 1LWJA 1AQHA 4PMUA 4MTVA 1C8XA 1XYZA 2WC7A 2J75A 3ZSSA 2CKRA 3F5JA 1JI2A 2DSKA 4AIEA 1UA7A 1CWYA 2D22A 1E3ZA 3L4ZA 3IJ9A 1MQPA 1OCQA 4HZ8A 2X09A 3NSNA 4MB3A 1VBUA 2WZEA 1C8QA 5EFDA 3WEOA 5I78A 5IFTA 5D9PA 1UD4A 3AIVA 4AZ5A 1SMDA 2FHFA 3G6MA 4UNIA 3BAXA 4F8XA 3K1DA 3AHZA 4U31A 3BH4A 4PMZA 4GI8A 1V0NA 1US2A 5E0FA 1HVQA 1S46A 4MPKA 5A8NA 4A3HA 3VGFA 4HA1A 4RE3A 4KGJA 5A1AA 5FIPA 1GQKA 4GQRA 3EMQA 5KEZA 1HT6A 1V3HA 5C70A 2XJ7A 4GZJA 4ACZB 1VFOA 4J28A 2XHYA 3B9AA 4F66A 4P7LA 2O9OA 4AXNA 2F8QA 4LYPA 3VIGA 5D9OA 3OLEA 1EDQA 3VIIA 5E09A 1CPUA 2E3ZA 1KB3A 2AAAA 2QF8A 1E6ZA 5A69A 2XVGA 1ZS2A 1W9DM 3MO4A 4PN2A 2O9TA 1QI4A 3DYOA 3VDCA 3PZNA 2QPUA 4Z2JA 2YA1A 3D5HA 3PZQA 1SMAA 1E55A 3WD3A 2XSAA 1Q6CA 2OLHA 1VEMA 3RM9A 2ZXDA 2ZWYA 1E4IA 3WD4A 1OINA 3BCDA 4FLOA 1UQZA 2JFEX 3OA5A 1PZ2A 2DDXA 3VPLA 4AEEA 2W92A 1X1NA 1QBAA 3G6LA 2NSXA 4X0VA 1BSIA 1HP4A 4DUVA 1BVNP 4AISA 1J0YA 1H41A 4H04A 3OGSA 4NF7A 2XIIA 5A8QA 4AMCA 3PBGA 4PMRA 5CPQA 4PTMA 4WLCA 1JYVA 2WCGA 1UD8A 1UKPA 3D3AA 4ACYA 1OD0A 1J10A 2WLZA 3CHCA 4QFUA 3AQUA 2VZTA 2Y2WA 3ZR6A 5E9AA 4CN1A 4JAWA 3WD2A 1J11A 3ZT6A 2F2HA 2JF7A 3FAWA 3GNRA 4H41A 5CXPA 2Y8VA 1UWQA 2G8ZA 3AIUA 4W88A 1J0JA 2VRJA 5ABEA 1E4NA 1GHSA 3WNNA 1JFHA 1B90A 1GOMA 2WMFA 1BYAA 3SCOA 4H2CA 5EFFA 2HVMA 1BLIA 1CGUA 3S6TA 5HPOA 5JBFA 4P8XA 2UWFA 2ZX6A 1MW3A 2VZVA 2G4FA 1J0IA 1JD7A 1OIFA 4B15A 1QHZA 3VGGA 4UFIA 3WBEA 4FK9A 4UZUA 5D8ZA 3M7SA 3GTNA 4MAZA 4HOXA 3KEHA 3VNZA 3PZVA 4UZSA 5AC4A 1B30A 3T2PA 3AMLA 1HL9A 1IT0A 1HKMA 2XPKA 4ATLA 4TVCA 2J79A 3CZKA 3W37A 1JI1A 1W32A 2ESCA 3WF3A 4HU8A 1KCKA 4UFLA 2PI6A 5BRQA 3VGHA 1E56A 2EO7A 2PWHA 1ITXA 1JYXA 2W67A 3U5YA 4TXEA 1W9VA 1MFVA 3VD9A 1L8NA 1WB0A 3CUHA 1P6WA 3SCRA 1H5VA 1LQ0A 1UQYA 3WDIA 1J0HA 3VIFA 1Z32X 1UH3A 1J18A 5DT5A 1WZAA 1V3KA 4RL3A 3VKKA 1CZ1A 2JE8A 2RGLA 1JGIA 1GHRA 5A6JA 1MQQA 3WL1A 3AYSA 4WSJA 1BG9A 3MKKA 2GK1B 1CXIA 3VMNA 2XVNA 5BXPA 5HXMA 1WZMA 1F4AA 4H8VA 3WENA 1BFNA 2WZIA 3L4TA 2YL5A 3K8LA 3OLGA 2WKGA 3WMSA 5CQ1A 2CPUA 2FH8A 1DWIM 1LL6A 1UZ4A 1RP9A 2WK2A 4P8WA 1XCXA 1HJVA 3PTKA 1UR2A 2EQDA 1VAHA 1WE5A 4CD5A 1UZ1A 4CU6A 1CLXA 1ISWA 1E6XM 1PX4A 4Q22A 5ABFA 3CZGA 2YDRA 3MV01 4AD0A 3BAJA 3WELA 1ECEA 1EOMA 3WF1A 2XGIA 5BRPA 3GBDA 1XSIA 3ARZA 4DUWA 3BAKA 1MXDA 3MUAA 2DSZA 3ZQ9A 2ZUWA 1R7OA 4D1JA 1B3XA 4W8AA 2DT1A 1VIWA 1QBBA 1F4HA 1N82A 3MV11 1UA3A 2VCAA 5EMYA 3AYRA 1B2YA 2VJXA 4HA3A 2ZX8A 1MW2A 2WMIB 3L2MA 4PMQA 3PZ9A 3KL3A 1QNQA 4DM1A 2WHLA 3MANA 2V3GA 3BSGA 3EMZA 1W9BM 3UERA 1V0KA 3A4WA 1U30A 1E0VA 1JZ3A 2WMGA 3M07A 3OB8A 3GH5A 1V0MA 1PIFA 4JHOA 4H7VA 3PHAA 2BHUA 3ZR5A 1UHVA 2VI0A 1JFXA 3MSDA 5C71A 1GONA 1PX3A 4DWSB 2J4GA 3VIHA 4AC1X 4AD3A 4JFTA 1C93A 2GJXA 4U5IA 4D6JA 3WUEA 5A6BD 3AS0A 4F9JA 2J8GA 5FD0A 5IFPA 2A3HA 2OWWA 4JZ5A 4PRWA 2ZUVA 4MNKA 1WPCA 1FP8A 4CD4A 4PMDA 3ZJ7A 3BLPX 2YDSA 2UY4A 1W1PA 2NT1A 2W63A 3K4DA 1ISVA 1V3JA 1B3VA 3UEQA 2DEPA 4JIEA 4C90A 3A3HA 1HNYA 3NDYA 4V27A 4Z2KA 1QHOA 2VURA 1G94A 1KQYA 1W1YA 2VNCA 4QCEA 3WH9A 3BCFA 1NWTA 1DP0A 1LF1A 2E9MA 2CXGA 3EMCA 3GH7A 3WFLA 3AMDA 3SUTA 5GNZA 1QI2A 3ZJ8A 4A4AA 1KGUA 1NM9A 1JG9A 1V02E 3WD1A 4C7DA 4GI9A 3T2OA 4PMVA 1XGZA 2FGZA 4QP0A 2J7HA 2FGLA 4P7QA 2VX5A 2VL4A 2GUYA 4PTXA 5ECUA 3CZLA 3U57A 5CZKA 1TG7A 1ODZA 2VQTA 1CTNA 5A8MA 1J0ZA 4W7WA 3B8SA 3U7BA 1OM0A 3SUSA 1GOKA 2FDMA 3BC9A 4DM2A 2WHMA 4CCEA 1X6LA 3BXWA 2ZUTA 4PCTA 3WDPP 4PBGA 1VFUA 3ARXA 1E1FA 3VMPA 3WIJA 1XH1A 2ZUSA 1O7AA 2ZXAA 1LJYA 4NI3A 4WF7A 5GNYA 5IHSA 1QOXA 1BTCA 4EE9A 3AMCA 2EPMX 3N18A 3K46A 3FHAA 1KBKA 1M03A 4N42A 1BHGA 2O9RA 1TZ7A 5CLWA 2V3EA 4IUGA 4AD5A 3A4AA 2PF0A 3UESA 2D3NA 4AIOA 1FH9A 2GDVA 1A3HA 3B9DA 3UETA 2RGMA 4AIUA 1H09A 4CU7A 5A6LA 4AD2A 3SCUA 4JKMA 4OOZA 4TX8A 1JD9A 5JIPA 4MJ4A 1PJ9A 2ZX5A 3AIWA 1KXTA 1MWOA 1ZJBA 3ZJKA 4CN6A 2AMGA 1HJWA 1V6YA 1KGXA 3OGRA 1TVPA 2XSBA 5BWFA 1B31A 2VMFA 1KXHA 3RJYA 4AY1A 3PTMA 4EAMA 2XGBA 2YIHA 4DWSC 2D23A 5A6BA 1H49A 4FMVA 4Z2GA 4UQ9A 3VINA 5HNNA 1Q6EA 4P7OA 3NIYA 3FAXA 1B0IA 5A8PA 1EIBA 4HPGA 2QHAA 1UKQA 3CIVA 2WWDA 4IPLA 1HXJA 2EPLX 1C92A 4GPNA 3VD4A 1MW0A 3M46A 4PMOA 1V6WA 3ARSA 3L2LA 5GQBA 3EDEA 3VUPA 4UFMA 5IDIA 1CXFA 2XVLA 1R8LA 2JIWA 3WNPA 2O9PA 4ACZA 2CNCA 4PCSA 3CZEA 4ZENA 4CCCA 3WF4A 2WHJA 3BMWA 2W5FA 3T0BA 1LLOA 3NCOA 4CD7A 2EBNA 3CHFA 4X9YA 1JDCA 1QW8A 3MUIA 1BQCA 4CGTA 5I2UA 4W87A 1EH9A 3WQ4A 3N04A 4GZEA 1OD8A 3OIHA
chains in the Genus database with same CATH superfamily
3Q45A 4JR5A 4HHLA 3AI0A 4B2DA 3K13A 3W7JA 1XWYA 3FDGA 3VIJA 2EXOA 1WDDA 1QPKA 2BGNE 2DGAA 1B57A 1XLFA 3VZYA 2DT2A 3CQ0A 3DAQA 4K1GA 4PB5A 5JBEA 4BQ5A 1XD1A 3CIWA 5C8BB 3TC3A 2Z1SA 3ANUA 3EWXA 1HN1A 2PB1A 1TV8A 1BYCA 2G5WA 3LLFA 4FNUA 4DBDA 4GABA 3K1GA 5JH2A 3LPGA 3BL3A 3WDJA 1PCWA 1EX5A 5CZ0A 5C9ZA 2ZZ4A 4FSAA 1UOKA 2B7NA 3ZOAA 4UWMA 1JYNA 3QY7A 2YCLB 1UC5A 2VFFA 1O1ZA 2VOTA 3ZSTA 4MY8A 4PL1A 2QS8A 2ZUUA 1LRNA 3AS3A 4KGLA 1QPQA 4YTRA 1KCXA 4Y8FA 1EDTA 3NSXA 3V0TA 1AW5A 1XW8A 4UTFA 3VZZA 2Z1KA 2WQPA 1P0KA 1XPYA 3RPDA 1PWMA 1XV8A 4UTWA 1KCLA 3WQVA 4JYEA 2D20A 1XYAA 2A7RA 1AVAA 1OIMA 1JUBA 1E4LA 1TMQA 4JKKA 2OG9A 4AD4A 4EF9A 9XIMA 3JUGA 2G95A 3ALFA 2FH6A 5MHBA 3ARQA 3TW6A 3MUY1 4HU3A 1LYXA 4EPKA 3GKAA 3HPXA 2IS7A 3E0VA 4HT3A 3P74A 2GQAA 5LIUX 3TJXA 1NWSA 1H50A 3NZPA 3EB4A 4NAEA 4XIMA 4L4MA 3DOPA 4O1FA 4ZOBA 4Y9AA 4GO8A 1FWSA 1V6VA 3OLIA 5FJRA 2WZMA 1JF6A 4CUCA 4WIWA 4OUIA 3JZEA 5AYXA 1W5QA 1TJPA 4MLRA 1QNOA 3GG1A 3KBWA 2NQLA 1ZRQA 3M47A 1Q63A 5CAHA 4O4VA 3S9IA 4UQBA 5DMMA 2PGFA 3FA4A 3CTTA 1UASA 4NVTA 4FXSA 2VRKA 1VKFA 1XXXA 4JL1A 2R1MA 1A4MA 1ADOA 3U0HA 5HNTA 3C2RA 4I9MA 3J7HA 3SY8A 5FF0A 5AB3A 1UR3M 2ZE3A 4D6FA 3PVFA 2NV1A 5AHNA 3PAOA 1WCGA 4EXBA 5G4WA 2ZTJA 4H8NA 3OW1A 3NYDA 2WJFA 3RPMA 1JZ6A 3Q67A 4H7CA 1G7UA 3GKFA 3NUKA 4ILSA 2XM2A 4O14A 3V75A 4NP7A 5KZMA 4N9BA 4J3TA 1W5OA 3LTPA 4QQ3A 1K3UA 3DYPA 4NYUA 1B9BA 3SURA 2Q3OA 4AZ6A 2VFEA 1VENA 1R3TA 4FP1A 3W2UA 1R9XA 5F2IA 3WK1A 5DMLA 4WDWA 4WY0B 4DWSA 4UMBA 3CEPA 3EYPA 3UWWA 5G4EA 4JFUA 2F9RA 4I8DA 3W1RA 4FS9A 2PDMA 3LHVA 3HQOA 4NQ1A 2VVNA 3BTNA 3EXRA 3QYQA 4IP5A 1QNPA 3IUDA 3MC5A 1E3XA 4LUTA 3LRLA 2TRSA 5RUBA 1VS1A 1WAWA 5HBFA 4Q4KA 4RNFA 3ZVHB 4QJ4B 1XUZA 4LOCA 2Z24A 4FOKA 1R3QA 5HAOA 4L6DA 2PBGA 4RE0A 2Z28A 3WUBA 4ADTA 3H2EA 4FF5A 4N0RA 1XIMA 1NP2A 3G5EA 1M7JA 3WKZA 3QHMA 4UQAA 2EPOA 3LENA 3FS2A 4S3JA 4AYSA 1QI3A 3DKLA 3H2MA 4Q8WA 2UY5A 5HULA 2YGYA 3W3OA 4PCNA 4K1WA 4I7UA 1CI1A 1N55A 1BAGA 2PLCA 3ARYA 3W83A 5CEWA 4JIHA 5HINA 4S1FA 2BWGA 1C8YA 3C0JA 4V1YA 3QQWA 3CO4A 4EPEC 3OP2A 3TU9A 2WNZA 5LNSA 5C9XA 3URNA 5JIWA 3L0NA 1WDWA 4BQ3A 2BB0A 1UYQA 3K2GA 4H9UA 3PBVA 1HJXA 3GDLA 2WB5A 3U4FA 3WEZA 4IISA 1FXQA 2GVEA 3BMXA 4HB7A 1Q7ZA 4AHOA 4U2YA 1A47A 3RLVA 3HG5A 2VCBA 4MNMA 1KWGA 5C7HA 3T4WA 2WPGA 3MJYA 3PTDA 4FHAA 1SFSA 3KE0A 4PSRA 1WUEA 3GIYA 1E5JA 4GINA 5JMUA 3M0MA 3R7MA 1OYCA 1OT1A 4ZL1A 5A8OA 1I75A 2XYLA 3M5ZA 2PDIA 4XZMX 5JUVA 3AXHA 1SO5A 2AGKA 1TX0A 1DXEA 5BROA 3POCA 2WSKA 1HJSA 1KFWA 1UB3A 1HKWA 1WZLA 3MMWA 3IJIA 3ZT5A 4AZBA 5C9UA 5D38A 3KTSA 2EG7A 3SQMA 1W1VA 3NPXA 1QTWA 1MEHA 3CGTA 3CUJA 2CLOA 4OBSA 4DBUA 3TZNA 4DEFA 1OBAA 3F7JA 5B7ZA 1U1HA 4Y2WA 4KWUA 3SADA 2GJNA 4UNKA 2VT0A 4WSKA 2QCNA 2GGGA 1QW7A 4AZCA 4L4OA 3GC2A 5FL1A 1HIZA 1ZHAA 1EFZA 5CJNA 3S1GA 4A8NA 4ZA0A 1BVWA 1BGGA 4TV6A 3F4VA 4X63A 5HJXA 1SR0A 4OWGA 4PTWA 3NA8A 4OJYA 1GZJA 3UWUA 1DYSA 4HPHA 2AOSA 4BI5A 3VM7A 1PDYA 1YPIA 3W25A 1RLDA 4L9ZA 4P7NA 3UWVA 3CNYA 4C7FA 1DJXA 2PDBA 1MNSA 4X3ZA 2R24A 1K6WA 2W62A 3GNOA 2HPMA 1EJXC 4MWAD 4D6HA 2GGIA 3W7DA 2WCSA 4I6VA 5ABHA 4UFKA 4LAMA 4IPIA 2NLIA 1E71M 4U3CA 4S3AA 2YBUA 1QW9A 1ZBKA 2OGYA 2YBTA 3MWCA 2GUUA 1XM3A 3TA6A 4E2VA 3WH8A 1G69A 9XIAA 1G4SA 3W87A 1KRAC 1AQMA 2FZNA 5U4NA 4UR7A 4KCTA 3HU7A 5C2XA 3D6NA 3QYSA 2GDQA 4R27A 3B8DA 3MZ2A 2NUWA 3WJSA 3QY8A 4H8UA 1ZTVA 3E38A 3O6DA 1E6SM 4LAKA 3ZFHA 3Q58A 2I16A 1FWJC 4C6MA 3IUHA 5AKQA 2OXNA 4JEJA 3O6CA 1IHIA 2XFFA 1TA3A 3N1AA 1I2NA 1ML1A 4IFKA 3W7HA 1A5OC 1VZWA 1J93A 3PJWA 5DCBA 5I6SA 5A6MA 1FH8A 1XICA 3CB3A 5CSSA 3TTOA 1KM5A 3AFBA 4OFCA 3URBA 4RNIA 2YL8A 4JYDA 3C0QA 2HK1A 4NILA 1XFBA 3AS1A 1S5TA 5KITA 3F4NA 3TCEA 1VJIA 2C14A 2ZBTA 5B7YA 3GFYA 3TUUA 1BPLB 2FTWA 3VNLA 5U7SA 3DBPA 4UTIA 3IJ7A 4M5PA 2REQA 3LXAA 3AU2A 5E9XA 1W9XA 2PD9A 1XLBA 4FR1A 4IX2A 1X97A 3M0LA 5I79A 5H91A 3VKBA 4NX5A 2WQDA 5F4XA 3W86A 4YL2A 3BV7A 2XH2A 3E0IA 4UUIA 2O4MA 2G3IA 2E9BA 4DY1A 4X2PA 1B3OA 5LIKX 7XIMA 4O4WA 2XIQA 1CGVA 2QW5A 1TPFA 4KEVA 3W75A 3KCJA 2I5GA 2LLEA 3F4DA 2ABAA 1QI5A 2WC4A 1G9HA 4AEFA 3FLUA 4M82A 3EX4A 1S5WA 3H22A 4QE4A 3RXZA 3B9NA 3SIMA 1XI3A 2BHYA 4FX6M 3T81A 1XH2A 4CEUC 1FKWA 1EGVA 2IKIA 4IIDA 3BSHA 3KVLA 4XKMA 3BCJA 4WUIA 4GJIA 2QCEA 5GPRA 5HNRA 5J8LA 4WHBA 2QIWA 3HMJG 5AFDA 2D0HA 4B5VA 1JIBA 1FDZA 4B3KA 4S3BA 2WYSA 3HQNA 4GCAA 1ZBCA 4AF0A 4I9AA 2Y4SA 1CEOA 7CGTA 1DWHM 1TREA 4MB4A 3ZS4A 4RLIA 3PP7A 1EJVC 1NWRA 4MNLA 3OVPA 4Q4PA 3RUBL 1UR0A 1JZ5A 5LXXA 1EX1A 1M7XA 5D32A 4A8LA 1W3TA 3KL0A 3L65A 4JGDA 4JTCA 1DKWA 1WDRA 2WXDM 1JJKA 1NOFA 4PSPA 3AMGA 3R4IA 5HOSA 2P53A 3ZVIA 7REQA 4DJFA 4AD1A 1PB0A 4MUZA 5AC5A 3W76A 4NZ4A 3TZFA 2J13A 1IYXA 1UD2A 1CGYA 5XIMA 2OQHA 2UBPC 2JBMA 4MAVA 5PTDA 4PUWA 3UPMA 3URQA 4YXGA 2E8ZA 5I00A 1ME9A 4RV8A 3K30A 4DBSA 4QISA 1HF6A 4HHMA 5HATA 3R43A 5HMEA 3CQIA 3DKJA 1GJUA 3STCA 4Z2LA 3KZSA 2DJXA 2ZX9A 3F4WA 1POJA 1XR2A 2V5BA 3QQ0A 1PBGA 5DO8A 1EGZA 4HCDA 5T9BG 2CIPA 3N2TA 4TU1A 1V6XA 2Z1VA 4JQ1A 3W29A 4I7VA 2JEQA 3KLLA 3AHXA 3PJTA 1O6IA 3O07A 4HZ6A 1KBBA 2ZVIA 1RAKA 3VD5A 3AXKA 3BZGA 2PZNA 1ZU8A 3EX1A 4NASA 3ZJ6A 1PV8A 2HBVA 4UFJA 2OSYA 1I2OA 2XTKA 3NQGA 4DIAA 3O6AA 3O0KA 4JFWA 3LPPA 4WOZA 1UR4A 2ISWA 3OQEA 5GJPA 3EWUA 1GVQA 1MMFA 3VU2A 3TW9A 5F2LA 3RCMA 1SO3A 5K9DA 1RCQA 5A6TC 1TPB1 1MSSA 3QFWA 1ISYA 5EIYB 5G4HC 3IAQA 4HPNA 4S2CA 1UROA 4C6NA 4UIOA 2F6XA 1JCXA 4M1BA 3WLLA 1QJWA 3OPSA 2Z2UA 1ENUA 1FWTA 4JXCA 3PTQA 2ZUMA 2A21A 2H90A 3L5MA 4NAFA 4PUNA 3S5ZA 3KWSA 2GVJA 1XC6A 2QJHA 3T8QA 3MHGA 4KW2A 5HPCA 2HE5A 2RJGA 2IQTA 4XO6A 1KBJA 3GXMA 2ZDSA 2GYIA 1SSDA 2A3BA 1TZ9A 4QG9A 5CG0A 2QUTA 4YMZA 1TFVA 3EDFA 3P5ZA 2PDNA 5DLCA 1D7FA 2QF7A 1DV7A 4WJXA 5KZEA 3N4FA 3TAOA 5HWMA 3RGTA 3C5QA 3BMVA 4A3QA 4BA0A 1AUSL 2VR4A 3P82A 2CLIA 3OVGA 1ICPA 4YCPA 1U83A 1E4MM 4BEUA 3NL5A 4U4MA 2YW4A 4UTWC 4P8UA 1S2WA 1DIKA 1WOBA 3FJ6A 2DIJA 2DVUA 4O54A 1IZKA 5G2HA 2ZA1A 4GI4A 2QDEA 3R11A 1XHGA 4GYPA 4LAZA 2ZDRA 3DIPA 3GX9A 1YPXA 1ZP4A 3S47A 4PUEA 1R7AA 3TQ0A 2Y7DA 3KHJA 4LFYA 2QCMA 3VILA 4J2MA 3AMKA 3OG3A 3TN4A 1JR1A 4NJKA 3G1HA 4Y7EA 1J5TA 3URAA 2ZA3A 1CXHA 3N17A 2OYKA 4XISA 4H6QA 3VOHA 3UD6A 2CZFA 1K7XA 2YA0A 3H53A 3VGDA 3MU7A 3GXIA 3N3TA 3CXOA 2HV5A 5D37A 3COTA 1J96A 2J62A 3V7PA 3DH7A 1ZBWA 3TCSA 5FJJA 4NKCA 1OFRA 1FA2A 4IQDA 4TTUA 5CPMA 2GQ8A 4JYFA 3SSZA 3B8VA 2IW0A 3OTRA 2FZMA 4RW5A 2TPSA 1GYLA 3RYSA 1UUQA 3KOXA 1N8WA 3VZXA 4K39A 2PC4A 4C6BA 1WO2A 2A1YA 2C8NA 3MUZ1 1U5VA 1E73M 5EL1A 1VLWA 3OU8A 3KS5A 3WQPA 2Y1HA 1L8PA 1I1WA 2Y89A 5AHEA 3W22A 3B8IA 5CZTA 4UOJA 3UCDA 2PDFA 5B80A 3BAWA 4ZB0A 4US5D 3MPGA 3RM4A 5A94A 3HJEA 1V3MA 1YMYA 1H5YA 4DPQA 4AZIA 3IEBA 3A12A 4GACA 1FX6A 2B7OA 2QZRA 4DF0A 1PEZA 1AH3A 1JZ7A 1L6GA 4MFDA 3UU0A 3SCVA 4W85A 1H7PA 1TCDA 3LPFA 3I3DA 3CHEA 4I5UA 2WW5A 3LM7A 2CBIA 3S83A 4DPPA 1QUMA 3ZO9A 2Y8KA 3PUGA 4LNYA 1V3LA 3TN3A 4S3GA 3PAJA 3WQ6A 3MT1A 2DY3A 1WBHA 2CCRA 4AZCB 3G0UA 3QR0A 4E4PA 2HMCA 4K7VA 1W1IE 5H8UA 1KM1A 1TJ0A 5BOEA 1XLHA 3AWNA 1CX9A 4BZYA 1FWFC 1JZ2A 2DORA 2FB3A 2GGHA 1XYFA 3NM3A 1KV8A 1AQHA 1S5MA 4LW7A 1XYZA 1KD0A 2F84A 3QTGA 3AYVA 3F5JA 2EKGA 3CM4A 3L9CA 1TTJA 1YBQB 4AIEA 1CWYA 4LY4A 3SRKA 1OCQA 1TPC1 4DYJA 1UP2A 1FCUA 3E49A 4M7TA 1VBUA 2WZEA 1EPVA 3WEOA 3MCOA 2RUSA 2WNQA 5D9PA 1XLIA 3AIVA 3DFPA 5MKGA 2X7VA 2P3ZA 3G6MA 4PGLA 4UNIA 2X16A 4O50A 3M0YA 3K1DA 2FTYA 3H2NA 5FF3A 4PMZA 1LT7A 4GI8A 5A8NA 4MHBA 3EPNA 3H26A 1K4GA 3UBPC 2EJAA 1GQKA 2E6FA 3WLTA 3MCNA 1UIOA 3GVWA 2XJ7A 4GZJA 1DJYA 4WDTA 1C8VA 1SW7A 4P7LA 1HGWA 2F8QA 4KETA 3MHFA 4HA0A 4IJRA 5F4SA 3QPYA 2E3ZA 4DWDA 1KB3A 1ZS2A 4FNQA 1W9DM 2O9TA 4IX0A 3U9IA 3D3FA 4IFKB 4BR1A 3PZQA 1DL3A 3R2GA 2BG5A 5D2YA 5FSEC 2OFJA 4C60A 2PWUA 3MY9A 3RM9A 5J04A 2ZXDA 4KERA 1DJGA 1UQZA 2VWSA 3DEQA 5CBIA 2KZHA 5I09A 1ONWA 3OA5A 3FVMA 1ONEA 1QR7A 3VAVA 2NXIA 4G6CA 2J88A 4GXMA 2I5QA 1NFBA 3EX6A 3MP5A 3W88A 2P10A 4X0VA 1BSIA 3S9YA 2QAFA 4Z1CA 1P7TA 1H7RA 4IL2A 2PDWA 3P84A 1UD8A 3CV1A 1UKPA 3D3AA 1YNQA 3CHCA 1EUAA 2RDXA 2QNEA 4N9EA 4O8AA 1KTCA 2OU4A 3QRHA 1TPH1 4CN1A 4RPQA 2F2HA 3FAWA 4H41A 3M0HA 5CXPA 2Y8VA 1UWQA 2G8ZA 3AIUA 1J0JA 5CSRA 1VHNA 1AA1B 5F2MA 3WNNA 2E5DA 1JFHA 3DENA 1GOMA 4HQVA 1PVNA 1IIHA 2WMFA 3FSUA 3DFQA 3S1UA 2PDGA 1RUSA 3TQKA 2OZ0A 3QEZA 5JBFA 1N2VA 2FMOA 2ZX6A 8TIMA 2G4FA 1J0IA 4XBKA 3SFKA 1QHZA 3CS2A 3QVQA 3VGGA 4PA8A 4HOXA 4GC3A 4UZSA 5AC4A 1QWKA 1B30A 2V2DA 2QJJA 3RITA 2XPKA 4TVCA 3LY0A 4AEOA 3WF3A 2WJDA 3C56A 4UFLA 1Z44A 2ZCGA 3W7EA 3A3XA 2QKFA 1JYXA 2W67A 1XBYA 4Q8TA 3APYA 3PSWA 4AF0B 3SCRA 1LQ0A 3WDIA 3G1RA 4LTSA 1GYMA 1UH3A 1J18A 4MWAE 3CPRA 1IF2A 2ZRYA 2RGLA 3CT2A 3BLEA 3AYSA 1JULA 5AYYA 3T78A 5TNVA 2ISSA 1GT8A 4JTTA 3SJNA 2J9ZA 3WENA 1GEHA 3O05A 3LHWA 1P0DA 2V2CA 3KP1A 2OR2A 1EWDA 4ZFCA 1GVEA 3P8IA 3VOGA 2WK2A 4GYFA 3WLIA 5CPNA 4MOZA 1UZ1A 1YDVA 1CLXA 3KCLA 2FPTA 4JTJA 1QT1A 1XYCA 3A24A 3CZGA 3MV01 3PULA 1YDYA 4WGXA 5E5CA 1NTHA 3WELA 3S6OA 1A49A 2XGIA 4ZCWA 3CL6A 3QMRA 2XZ7A 4F40A 2QGYA 3UZYA 4G2DA 5HR6A 2Z27A 2ZUWA 1QBBA 1Q65A 1U1UA 4YCOA 3ITTA 5G2WA 2VCAA 2WO5A 1B2YA 2XSXA 2VJXA 2C0AA 2ZX8A 4I9TA 5JXQA 2WMIB 3CQKA 3PZ9A 4DZAA 4DM1A 3EMZA 2AL1A 3FFSA 3UERA 3A4WA 1U30A 1QNVA 3G1XA 3M07A 1A5LC 4LALA 1SO6A 3ZR5A 4GNKB 2VI0A 1JFXA 3VCCA 1OC7A 1GONA 4HSOA 4HNCA 2P0IA 3WQGA 4D6JA 2X1RA 3INPA 1NSJA 2A3HA 4WSHA 2OWWA 3BZJA 4JZ5A 3GFXA 1TTIA 1P6CA 2QPXA 4O15A 4CD4A 3CV2A 3EOUA 3I7RA 1PKYA 1LBLA 2YDSA 1W1PA 1ISVA 1HZYA 3A3HA 1HNYA 1DPMA 1KA9F 1N8IA 1GEQA 4M19A 3RLHA 1FRBA 1GKRA 1RVGA 4QITA 1AODA 3U4AA 5T91A 2Q02A 1PWLA 3IPWA 1KQYA 4Q4MA 3OZMA 4HYWA 1LF1A 2E9MA 2CXGA 3GH7A 3WFLA 1QI2A 1NM9A 1JG9A 1V02E 4C7DA 4GI9A 1YYAA 3T2OA 4PMVA 1TV2A 2FGZA 4QP0A 4P7QA 3IVSA 2VX5A 4OE7A 3GTHA 3PPCA 1ITUA 2AQOA 2DZVA 1X8FA 3N2OA 4G1KA 2VQTA 4J4KA 5A8MA 3B0UX 3B8SA 1IEXA 3QV6A 4B2DD 1BF6A 1GOKA 1VLIA 3STEA 1R46A 4GIYA 1KKOA 3PUDA 3F4CA 4L65A 4DJFC 2WHMA 1T5AA 2QJNA 1SSGA 1A5KC 3ARXA 1MNZA 1XH1A 2ZUSA 4F0SA 1O7AA 4HD5A 1XPGA 4WF7A 1K8YA 3R8RA 3N18A 4AIBA 4L5ZA 3FHAA 1PYMA 3G1YA 3QN3A 1O94A 4IUGA 4AD5A 2PDHA 4Q6XA 3B9DA 1FCQA 5EMLA 5C5YA 1A0DA 1R3VA 1H09A 1BRLA 5A6LA 2I9EA 3PNUA 1S2UA 3V5CA 1MEWA 1V8EA 3N2MA 4EAYA 2Z2AA 4CN6A 3UWQA 1H1YA 5LHFA 1V6YA 2W27A 4GIEA 2I56A 3SECA 3RJYA 4AY1A 5CC7A 2Y8UA 4PB4A 1H49A 4FMVA 1TE6A 4GUGA 2VEKA 4G56A 4Z2GA 3VINA 4O1AA 4YTTA 1Z6KA 4P7OA 4CQAA 1OFBA 1O68A 1UKQA 4XZ9A 1UZHA 2OX4A 1I9CB 3LCWA 4MPQA 3M46A 3GR7A 1V6WA 3L2LA 5GQBA 3VUPA 1CXFA 3C61A 2C1HA 4AHPA 5HMFA 4ACZA 2QV5A 3CYJA 4F0MA 4FB7A 3CZEA 2EAWA 3C0SA 3Q2DA 3WF4A 3BMWA 3EGJA 3T0BA 1LLOA 2X30A 3PUEA 4A6GA 4CD7A 1JPKA 1O95A 3CHFA 4ZODA 3G1VA 3DGBA 1OVDA 5LHEA 1BQCA 4W87A 1GVSA 3WQ4A 1OFAA 5DQPA 5EMKA 2C3ZA 5HQMA 2PU1A 3H7VA 3S46A 1GORA 3QOKA 5K4XA 4Q4OA 2WAGA 5DRIA 1ZPTA 3OHMB 2GUBA 3WQDA 2DSVA 4M3PA 3E12A 3GXNA 3WDRA 4L1WA 4QNEA 1XGDA 3GU2A 1KFBA 5EA9A 1GPWA 3EWBX 3SIZA 1SQ7A 1DIOA 1H51A 4QS6A 2VFGA 4YJ5A 5I77A 2WSYA 3CLMA 1KRCC 2JEPA 1Z89A 2QAPA 4B16A 3APTA 1AW2A 3HG2A 1UR8A 4JD4A 1ZB5A 1JDDA 3O0FA 4ZE5A 4DJEA 1XD0A 4HU0A 3HGOA 4NZCA 1J9YA 3ABRA 2J24A 4L9XA 4ERAA 3E2RA 4JTSA 3K8MA 1FWDC 1W3JA 2E6DA 4DWSD 3NOYA 1V08A 4GYPC 4RCXA 2WPBA 1GPFA 3QW3A 2QJIA 1AQ0A 2QXWA 2D69A 1VEPA 1PIIA 4LYQA 4LUSB 3EDJA 5CC5A 4MMWA 2FZ8A 3TYDA 4W5ZA 1QXLA 1EA0A 1JRBA 5EB8A 4F79A 1VYPX 4OT7A 4HIBA 4QRNA 3STFA 1OT2A 5E6YA 3M41A 4E8DA 3L12A 4JN8A 3G8EA 1DIDA 1PKLA 3JW7A 3MO7A 3N11A 5AC7A 4IMEA 2G96A 4QAIA 2INZA 5HANA 3ARUA 3FYPA 3B9EA 3JVAA 2GVYA 1UD5A 4MJ2A 3WSUA 2VFIA 1L6WA 4BJHA 2E67A 3HF3A 3P0WA 1B4EA 1FWBC 1VQTA 2D2OA 4YYFA 2E1DA 2GK1A 3KDNA 5D4YA 2IXVA 2CLPA 4NJJA 4NZ3A 1XH0A 5I03A 1KRBC 3CK5A 3HM7A 5BCAA 3NO1A 4G5DA 3N9KA 1XF0A 1R0MA 1EBHA 2QT3A 1Y5VA 4ZTXA 2CZEA 4AU0A 4E3VA 3ATZA 4UB9A 2C1IA 3QR3A 2Q09A 3ELFA 3LHTA 3N12A 2DU2A 2VGGA 4IM4A 5AHLA 1TQJA 3SCPA 4R88A 5DBTA 4IL0A 1ICQA 3S9ZA 1CGXA 1XFCA 3GHSA 2CEQA 3UP8A 3CLWA 3PPHA 4OBRA 3CMJA 5CLTA 3F5LA 3LCHA 3B0XA 5BZAA 2W61A 3HGSA 1DJZA 4HK6A 3CJPA 1IXPA 3RCYA 4HN4A 1IWAA 3TWBA 3PB0A 3FY1A 4IH3A 2WKJA 2WVVB 3DN5A 3BPWA 3PZMA 2JGYA 4FNPA 1MFUA 3G3DA 1S3HA 1QRQA 1OG6A 2O7QA 2POTA 3OVRA 2B31A 2J78A 1GNXA 3S1VA 4MIMA 2E0PA 3A5FA 4OIFA 4XD6A 1TJ1A 3ME3A 1K9FA 3OJGA 4QJ3B 1K70A 3CIXA 3KM8A 1DJQA 4F3HA 2ZZ1A 3AXMA 2PDLA 2A7PA 1SGJA 4HYRA 1W37A 2YLLA 2QMJA 4BFAA 3CZJA 1EZ2A 1SJCA 4RNHA 2VC9A 2GWGA 4PFHA 1QO2A 2XVKA 1O5XA 4OV9A 1VP5A 4P8VA 1JDAA 5DY3A 2E4TA 1E70M 1R30A 1NEYA 4XX6A 1T7LA 1K7EA 2J47A 5I3FA 1W9PA 2DW7A 1POKA 4FXRA 4WEVX 3RR4A 3LSCA 4UMAA 3W1PA 3IJ8A 2ACUA 3PUOA 4D6EA 5CGQA 2PC8A 3C2FA 1IT8A 4IXHA 4IXXA 3V5FA 1IWPA 3PSVA 4HP5A 1UKSA 2A3AA 3OZPA 3NQMA 4BEQA 1Q6DA 2Z7GA 3PY2A 3GS6A 4UC5A 1DJNA 5K9XA 1ISXA 3NNTA 1FUYA 1R9ZA 2V30A 5GJMA 3MMUA 1PX8A 2PGRA 2Q6ZA 2ISVA 1FWRA 2PGWA 4V33A 2BMBA 3SRFA 1XIBA 1D9EA 4W86A 3GUWA 5LA2A 5A5WA 4F0KA 4UQDA 1E6QM 2IQDA 1IEQA 3LYEA 3SB0A 1ZBVA 1KLYA 4LJ3A 3FCPA 2YA2A 2TSYA 3NQVA 1CB2A 5TBOA 4AYGA 1QK0A 1R2SA 1PZ1A 1VH7A 2JKPA 1RHCA 4GHRA 4H9XA 3H24A 1UP3A 1D2KA 3TVAA 3EB3A 3ANVA 3ABQA 4Y9NA 3ANYA 3EKGA 3G3MA 1E9LA 5TQLA 3SCNA 1KWKA 1NDWA 4MUPA 2YKKA 4ADSA 5K2ZA 3A3WA 4LF1A 4S3CA 4GXWA 3GXDA 2FZ9A 2X05A 4GKLA 3HB9A 1K7FA 2WSRA 1W2PA 4V1XA 2DH2A 3PZTA 2PAJA 4IJCA 5H8MA 2UY2A 3ARRA 5LGZA 3BW4A 4A2SA 3QKEA 5A3HA 1BF2A 3QBUA 3V35A 3PZUA 4W7UA 2CLFA 4B5XA 4LV9A 2ZRZA 3WJYA 4NI8A 1BWLA 1OCNA 1YTEA 1E40A 2OYMA 3BG3A 1IV8A 1B1YA 4Y9OA 9CGTA 3I3BA 4GBUA 4L4LA 4JTLA 4F2BA 1JZ8A 1NAL1 3K8KA 1IZJA 1WYIA 3TA9A 1ITQA 3AZSA 3N6JA 1R86A 3T42A 1LL4A 4MB1A 3CHVA 3QSTA 4PL2A 3LBOA 4JX5A 1NY1A 4D72A 3TOPA 1WDSA 4ZEPA 3QF0A 3S4TA 2DQXA 1KO0A 1IGSA 3VNYA 3R58A 1Q3NA 3IIOA 4CKQA 2NT0A 4K38A 4YPJA 3UG3A 4E5TA 4UQEA 2CW6A 4M6UA 1LWHA 1G1YA 3WEMA 1EO5A 1JYWA 1FCVA 2BXZA 1OGGA 3GE7A 1UD6A 4EK7A 3BLOA 3ARWA 2AMXA 2Q8ZA 3EX2A 3AIQA 1EF2A 2V3FA 1PTAA 1GKQA 1D8CA 1ZAIA 3ZLGA 4LC8A 3MKVA 3R0DA 2VCCA 2BS9A 4LXFA 1JXJA 1Q2SA 3W2NA 4R7JA 5CKSA 2YCLA 4AVFA 3W1QA 5F1VA 3WG6A 2X8RA 3GVGA 5HWJA 4R7OA 3W85A 1F07A 1FOBA 3AJ7A 4UBPC 2RDTA 4HNVA 4A3UA 2V5CA 1W3NA 2BOEX 2CU0A 4G8TA 4PMYA 3GM8A 4HOZA 4FXFA 4XVDA 1SW3A 2P50A 1F05A 4MZ1A 3BGJA 4O0QA 4DJFD 5L9FA 2VZOA 3KXQA 1XIDA 1E9YB 2E68A 1DBTA 4C7GA 1HTIA 2V0TA 3LPOA 1RQHA 1F3WA 3W6YA 1QMLA 5DXXA 3WNLA 3NDOA 3WL0A 2J7CA 1BG4A 4OQVA 3RDKA 2DFAA 1H1ZA 1P1XA 5LNRA 2WMHA 1TQXA 2W9MA 2DUAA 4LY8A 1UWAA 4S2BA 1JPIA 4CQ8A 3PPGA 4M0XA 3W72A 3LBCA 2IUZA 3LBMA 4ROQA 3W1AA 4ENLA 2P76A 3NL6A 1EUNA 3CV7A 4NJHA 1V7YA 3P3BA 2VVSA 4KEMA 2GJLA 1CGWA 3TH6A 2Y5SA 2TYSA 4XD5A 4MDOA 1GGOA 1UR9A 2P0OA 4NX0A 3DFTA 3BV4A 4S23A 3CWHA 3KL5A 3GTXA 1U33A 3RILA 3UYCA 1XG4A 2FVKA 3GFZA 2F6UA 4N4QA 3GBEA 1A3WA 2WSQA 2NXGA 1FKXA 1OSEA 1TIMA 3H23A 3VD7A 1UBSA 2PFHA 3WMLA 4OBTA 4L7ZA 3P67A 2NWRA 2FB2A 3NQ8A 4Q8MA 4IG2B 4C6FA 3VD3A 1KV5A 3N9SA 1YDNA 2D0GA 2Y7GA 3CWOX 2F2KA 4C1NA 4IMFA 1JNEA 4AB4A 1QASA 3N2CA 1TIWA 1DWJM 1PHQA 2BODX 3S2LA 2I57A 4WRHA 3ZIZA 1IXNA 3GU1A 3AUJA 4D1IA 5DY2A 4EANA 4A2RA 5KSWA 3FHQA 5H8PA 2V63A 4DF2A 1RR2A 1XLGA 4WY0A 4TQTA 3W38A 5BW6A 1C91A 2VR5A 3DHDA 1XYMA 4YS1A 2HWGA 1O4UA 2BY0A 3WQOA 2HTMA 1F8IA 1W3LA 1UWUA 3GAKA 1MDLA 3R94A 4LUJA 4TMCA 3WBAA 3UR8A 4ZB5A 4IGMA 2YDAA 5CSUA 1UKOA 3JS3A 1UD3A 1F61A 3NOEA 3Q65A 4KFOA 4JNYA 2DUXA 1I2RA 1RCXB 4IWWA 3VIMA 1VRDA 3EPOA 3ZVHA 2D1ZA 4FLSA 1CENA 3P81A 1EP2A 2WM0A 3WMCA 3ITCA 1TR9A 4KRUA 1T8QA 4W4QA 1NF0A 3T4CA 4JKLA 3HA1A 2Y6ZA 4F4RA 5EMMA 3VNJA 2X2GA 2QUNA 1J79A 1KNWA 1M9HA 1OZQA 3THQA 4O1CA 2XFRA 1U2YA 4GUIA 3NXLA 4IP4A 5KETA 2OLAA 1GVFA 4LH8A 4XTIA 1W1TA 4QE1A 4RDZA 5DCDA 3L5LA 1GOOA 2OB3A 4EPDC 2AL2B 1YNYA 2GFTA 2XH0A 3M0KA 4NT0A 1J4EA 5I0DA 3GDBA 4AX6A 2C79A 2HNHA 5SWUA 2XIOA 4PULA 5CPTA 2TAAA 4X2RA 2DH3A 1GJPA 2BTMA 3BW2A 2V69A 2DZAA 4Q33A 4O12A 2CBJA 3G24A 2I5IA 1XDMA 4W5UA 1L6FA 4H9YA 3PFMA 3W1UA 4C6PA 3KRZA 2C0HA 5FJOA 1HUVA 3WD0A 3VGEA 1IR1A 1XIIA 1I6NA 4ZQPA 1U1JA 1XQKA 3OODA 3NZQA 3VABA 2OSXA 2XU2A 1ISZA 5D2VA 1KCZA 2BY3A 2GZXA 1JCTA 3SUVA 1XX1A 2QCHA 1M53A 4ZOEA 3NO3A 4KESA 2HE8A 1SZNA 2YYTA 1TE1A 2B7PA 1OF6A 4IMDA 2J66A 3E02A 4KWVA 2W0UA 1WXJA 2ZIDA 1EHNA 1F3TA 4XZBA 4E0CA 4L80A 4AG0A 4EVZA 3HN3A 1SJDA 3SCQA 1ZAJA 5KZ6A 2A5HA 3NURA 2CLMA 3VCRA 3LV5A 3E9AA 1XRSA 1JF5A 3A4XA 4HSNA 3PF3A 1GTHA 4G7EA 1YPFA 4TOQA 4GD0A 4HSHA 3TMLA 1THFD 4GXPA 2ZRXA 4A8RA 3T44A 1GOIA 2J8TA 2BVYA 1AJ2A 4PTDA 2WWCA 2CBVA 4OVXA 1TWSA 3TIMA 3P80A 3LB0A 4CD6A 4JTKA 4DJEC 2PDYA 1LTDA 4REQB 3DCPA 1GQNA 4HPXA 3VDGA 2E9LA 7ODCA 2B81A 4Q8NA 1B5TA 2FMNA 3BURA 1H2JA 2PDJA 3R8HA 1ME8A 3VE9A 4AAJA 2YYUA 2Y7FA 3W27A 1VEOA 3BARA 3HMCA 4GQQA 3LCLA 4ZQCA 4QX4A 2ISFA 5HNUA 4IIEA 3OG2A 3S2CA 3SFWA 2J7GA 3DHPA 4YYCA 7A3HA 4U10A 5ABFB 1EQCA 4OOUA 1CYGA 3SRDA 5FCZA 3ZMRA 1V6UA 5G2IA 4M51A 1KXVA 4E2DA 1WP6A 5F4WA 2RFGA 3CTLA 3MS8A 1JDFA 5CJ5A 4A29A 3LNPA 3UVAA 1YRRA 3RAOA 8XIAA 3EXSA 1AL7A 2QIIA 1AJZA 2XN0A 3DDMA 4NRSA 4J3UA 1NP0A 1FHVA 3TSDA 4PEKA 1BYBA 5CGTA 2WOQA 2W6RA 4GVGA 5CBJA 2VYOA 5A6KA 4EF8A 4MLJA 4LVFA 4A21A 2PE4A 4JTUA 1Q4NX 2WNWA 3WF2A 1PL9A 5EYWA 1FHLA 2ZOXA 3RMJA 1YXDA 2ODOA 3FNDA 3QLDA 1IEIA 3QY6A 3G1AA 3I4EA 3SGUA 3G1DA 1SFTA 1P4CA 1FH7A 3TK7A 3AS2A 4IICA 2E6YA 2C13A 1UG6A 4QLKA 2JALA 5F7UA 3GDRA 4ML4A 3TYCA 3HTWA 3OIXA 3UR5A 1V51A 2G0WA 2BZNA 4GE8A 1EPXA 2V5DA 3ARPA 1EDGA 5I07A 1EC9A 3KOFA 4NJIA 1PDZA 4ML9A 5CPOA 3VOCA 3P2VA 5DMNA 4JX6A 2OO6A 4Z2IA 1LCOA 1L6YA 4QS5A 5M2FX 1LDCA 3DC0A 2OT1A 1CNVA 1TPEA 2CERA 1DQWA 4YWIA 3VE7A 3BOFA 5BXRA 3M5VA 3ARTA 1DWGM 3PBYA 2FHBA 1I2PA 5DCEA 1IEVA 3FA3A 4J40A 2G3JA 1UC4A 4R33A 4GFIA 1V93A 4R5EA 1AZ1A 2YCIX 3SO7A 1XRFA 4JCMA 3NQCA 3L4UA 3G0SA 4Q8OA 1E9ZB 4QHRA 1FWIC 5D2WA 4LQ1A 2ZZ3A 4JHZA 3R6IA 1V03A 4B3ZA 3WUFA 1FCBA 3EWZA 3O63A 3NJ3A 3W2KA 3LDVA 7PTDA 4HG6B 2P8BA 3GVQA 2XGZA 4LV4A 1XBXA 1CLKA 1D3CA 3WK0A 3W23A 3WO8A 1AJ0A 5EBAA 1E9IA 1BSLA 3N9RA 4ZO7A 1KXQA 3NEHA 3UWZA 3W7QA 1VRXA 5REQB 4C6IA 2BHZA 3LI0A 4KFPA 3SUWA 4EACA 1QHPA 1LWJA 1C8XA 4FOJA 3CEUA 4PBFA 1VCVA 2RH9A 2QUUA 3ZSSA 3R5EA 2CKRA 1ZCOA 2DSKA 4AMAA 4PUMA 2D22A 2HDJA 1MQPA 3UWYA 1F5ZA 1M6JA 1SPQA 4ALDA 3NR0A 4QG8A 3NSNA 1XIFA 4LB3A 1O12A 3NO5A 2ANUA 5I78A 5IFTA 2R8WA 3QQ1A 1UD4A 4AZ5A 4Y9MA 3BAXA 1BKSA 1NFPA 4YWSA 4O0KA 3UA4A 1V4YA 2BDQA 3CH0A 4Y9PA 5LGXA 1VBGA 1KFCA 4LCQA 4A3HA 1TV3A 2B4GA 3EPMA 4HA1A 4OECA 3LI1A 4GY1A 4KGJA 5DXYA 1Q6LA 2IKHA 4Q8QA 3UZJA 5EGRA 3EMQA 4R9XA 5KEZA 3MCMA 1JCMP 3GSMA 1F2JA 3B9AA 2O9OA 4GG9A 4LYPA 4EX4A 2QCCA 3N2BA 1EDQA 2CFFA 5HR7A 5E09A 1CPUA 2AAAA 2QF8A 1E6ZA 5C9WA 3VDCA 1QI4A 4CQBA 1V7AA 4ZQRA 3KAOA 3PZNA 1LUCA 4Z2JA 2YA1A 3LD5A 5JH1A 1IXOA 3LX9A 3T9PA 1SMAA 4C65A 2A79A 1UZDA 2PF8A 4JIIX 1VEMA 3OYZA 2H3BA 1W1B1 4CQ9A 3WD4A 1OINA 3BCDA 2CLLA 3S0CA 3R10A 2JFEX 3DFNA 3TJIA 1PZ2A 5T8GA 5K3VA 1LLWA 3I4KA 3LLDA 3WLOA 1AG1O 3G6LA 3TSBA 1HP4A 1G7VA 4XAPA 4DUVA 4F0HA 2DZBA 1K4HA 4ADUA 4AISA 1FDJA 3VC5A 4H04A 3OGSA 4H7ZA 3I6TA 5CPQA 4PTMA 4ES4A 1ZP3A 2NX3A 4LRTA 3WLNA 4ACYA 1OD0A 4JTDA 4XIAA 2WLZA 1P0BA 3B05A 1MUCA 4GIRA 3C8FA 5DN1A 3C3UA 4O13A 3QFEA 2VZTA 4Z0SA 2Y2WA 3ZR6A 5E9AA 3ZT6A 2JF7A 3GNRA 3JZUA 4XZLX 2JQXA 3L66A 2A4AA 4ORIA 3SBFA 5FI8A 1GHSA 1Q6OA 3V3WA 1BYAA 3SZ8A 4H2CA 2HVMA 3NTYA 1BLIA 4NL1A 4QM1A 5HPOA 5CCZA 1YXYA 2AKMA 1MW3A 1O5QA 2V5JA 2GGEA 4UFIA 3M1ZA 3RNDA 4TV5A 5D8ZA 1UUMA 3KEHA 3PZVA 3UNTA 2B7QA 3UFYA 1IT0A 2J79A 3CZKA 2ZRUA 1MZHA 3NEVA 2PI6A 5BRQA 5CZJA 1F9CA 1F73A 1E56A 3E3HA 3KVJA 4C1NB 3U5YA 1BWKA 4TXEA 1W9VA 1MFVA 2PRMA 1WB0A 2Z2BA 4RDWA 1P6WA 2FTPA 1H7NA 4C6CA 3BJSA 4WD0A 1Z32X 1KBLA 1XC4A 3KS6A 3QZAA 2JE8A 3OEXA 5A6JA 3TROA 4JQ3A 4WSJA 3MKKA 1CXIA 5BXPA 5HJYA 2D2HA 1BFNA 3L4TA 3OLGA 2CWNA 3WMSA 2VENA 4XTDA 3N19B 1LL6A 1UZ4A 4XG1A 1VPQA 1RP9A 1XCFA 3T55A 1TWDA 1HJVA 3B8WA 3N4AA 1WE5A 5FAJA 3LOTA 3P14A 3VFLA 3UA3A 2YZRA 1ISWA 4Q22A 2CC0A 2Q8LA 3R89A 3HFYA 2A6NA 2PLMA 1EOMA 5BRPA 2GOKA 5C9RA 3BAKA 3NM1A 1MXDA 4DZ5A 2DSZA 3ZQ9A 1B3XA 4W8AA 1RZMA 2Z6JA 3TN5A 1F4HA 1N82A 4GISA 3FJLA 5M1TA 1YLVA 1OX4B 1A50A 3KL3A 1QNQA 3MANA 1X98A 3RX3A 5EKYA 4BF5A 2E6AA 2WMGA 3B0VC 3M7WA 3PBUA 1V0MA 4H7VA 1SUXA 1KKRA 4H19A 3MSDA 1TB3A 1XG3A 3WJZA 4AC1X 3HURA 4AD3A 1JCYA 2Q71A 4LS2A 2PMQA 4J2PA 3AS0A 1JCNA 4F9JA 1WX0A 3HO8A 3VOFA 3HJZA 2ZUVA 3KBJA 1WPCA 3DXIA 5CJMA 3LU2A 1VIZA 2UY4A 3K4DA 2W63A 3UGRA 1B3VA 3IJ6A 4EPBC 2DEPA 4HN8A 4BWLA 4PE8A 4N9DA 3WJWA 4Z2KA 4GUJA 1DE5A 3IRDA 1G94A 3NG3A 1N7KA 2CHRA 2VNCA 4QCEA 3WH9A 1R3YA 2R1KA 3EMCA 3AMDA 3SUTA 5GNZA 2PP3A 3U2EA 1KGUA 1GG0A 3UYIA 1BD0A 1AMKA 1XGZA 1QWGA 4M6VA 4L1GA 2NVCA 2VL4A 5ECUA 1G6CA 3U57A 3QV8A 2HBXA 2GVLA 1FQ0A 3FGCB 1RBOB 1F6KA 5DELA 3A5VA 2GL5A 4W7WA 3U7BA 2SFPA 3SUSA 1HL2A 2PDCA 4DF1A 4G7EB 1D7KA 1NIUA 2R6OA 3BC9A 4IMAA 4CCEA 1X6LA 4KQNA 2NSOA 2ZUTA 3WDPP 3TQVA 3WZ0E 4UNLA 3WIJA 3FDKA 2ZXAA 3W71A 3MYOA 3U3HA 3IRSA 4LUYA 3L0GA 3AMCA 4FNSA 1J2WA 1P5BA 1M03A 4N42A 4MF4A 4HZMA 4J35A 2V3EA 4K8EA 1W3IA 3CO8A 4PCPA 3H2CA 4WOQA 2MNRA 3UESA 4C6OA 4E2BA 4AIOA 2GDVA 4MYXA 5DX7A 4AIUA 5LSMA 4CU7A 1M1BA 1NDZA 4TX8A 3G1SA 4OOZA 4DJED 3FX4A 3RN6A 3DX5A 5JIPA 3TN6A 1EJUC 3E2VA 3DI0A 1PJ9A 3T40A 3SGZA 1ZJBA 2AMGA 5HUPA 2D2JA 1YBQA 4CNPA 4F2UA 2W3ZA 3BDKA 1DOSA 3DHFA 1B31A 3UPBA 2VMFA 4ZZ9A 4RZ5A 3T0CA 5FJPA 4EAMA 4F0LA 4Z1AA 4FIRA 2DIKA 1PZ0A 4UQ9A 3ABSA 2QYGA 4WJEA 4UTHA 5HNNA 4QIUA 3B06A 1BXBA 2D73A 1D3GA 3SN0A 2QHAA 1PHWA 3KZPA 3CIVA 2WWDA 3S3GA 3VD4A 4TR9A 1MW0A 3EWYA 4PMOA 3C6CA 4GZ7A 3ARSA 1JUKA 3EDEA 5H1WA 2Q01A 2XVLA 4IT1A 2IQ0A 1R8LA 4QQUA 3MHUA 3MUCA 2ZZ6A 4MFEA 4PCSA 2GLKA 3LS9A 5FESA 3EWDA 2VR2A 1RD5A 1JDCA 3GY1A 3MMTA 2PA6A 2VHLA 5I2UA 1LM1A 1EH9A 1VBHA 3N04A 4XAYA 4GZEA 1OD8A 2D3LA 2JK2A 1RY8A 1Q6GA 3H54A 3AU6A 4GC4A 2JKEA 4EP8C 2E77A 2GJPA 3STGA 2ZTKA 3BVJA 1GUVA 3A4JA 1ZQ5A 3ZLHA 1FY6A 3U7VA 3E1F1 4MGGA 3FJ4A 2VEMA 5CSYA 3MBFA 4JTQA 1IEWA 2P88A 5IXEA 4BF7A 4PTVA 5GJNA 1W1A1 4FX8A 4JDYA 3TC7A 3C2OA 5CGMA 1TVNA 4LWWA 4B9ZA 3QLLA 3F03K 4AWTA 3I6RA 5AY7A 1UJQA 3A9BA 4RK8A 4PBEA 3AHTA 2XG9A 1RXOB 1FWCC 3SGGA 3NYZA 4IQLA 3UJSA 5I3GA 3ECQA 3LCFA 5FL0A 3TKFA 2ONEA 3PN8A 1C7TA 4JHMA 1JNDA 1PKNA 1RH9A 1VBRA 3ZWSA 3M0XA 1W8SA 3AAMA 4XBJA 6CGTA 1JGMA 3AISA 3BQ6A 4K68A 4KWSA 3W7RA 3GXPA 4K3ZA 1CGTA 2VTFA 4JTGA 3TYZA 1UW9A 5DBUA 5AZ0A 1TZZA 4HNLA 3BOLA 3VM5A 3NVTA 1JZ4A 5GVJA 2WMKA 3HGRA 4S3DA 3M6YA 3BGAA 4JQ2A 3VOJA 1XL9A 1W5NA 2AQVA 4DHGA 4UTTC 3TOYA 2P3EA 1VJSA 1CBGA 4YTSA 4O17A 1OYAA 2WVTA 3ZZ1A 3VOIA 3S5OA 1UR1A 5AVHA 4A22A 4H9MA 3BK0A 2VD8A 5G1YA 5D2XA 3B03A 2OQYA 1Q4WA 3NL3A 3T8LA 4EWJA 2ATMA 3CAQA 2ABBA 4N4PA 4ONVA 3LMZA 2PDQA 4YLWA 4V2XA 4KMQA 3TQPA 2DPEA 4KRZA 1SZFA 3R0KA 2HXUA 1SW0A 1GOQA 5EY5A 1SZEA 3SW6A 5CPLA 4UOQA 5AZ1A 4B90A 3WLPA 1H61A 2VM8A 4PCFA 3HPSA 3BSMA 4Q6JA 3WMBA 4R53A 2YXOA 4WKAA 1ZFJA 1T40A 3KVKA 4IMGA 1WZKA 3W7MA 4LB4A 4MWAB 4EKJA 1TSIA 2X1IA 3W84A 4RZ4A 1BQGA 2PEVA 4JCLA 3CPUA 2V2HA 3A9IA 1MVYA 4ERGA 2V5LA 2ZRVA 3HV9A 3NAVA 1LUCB 1ELSA 2NV2A 2AAMA 2WMIA 3LQLA 1MRQA 3KBVA 2ACRA 4JX4A 1MUMA 4HJWA 4NU7A 3IGSA 1GOWA 4GGHA 3AROA 4RDVA 4DAFA 5C54A 3KHDA 4ICNA 1RJPA 2WVSA 4PUUA 3PWIA 1VCFA 3DERA 2GSJA 2PDPA 3O6YX 4CN4A 4M1RA 2X0YA 1LOQA 1XSJA 1RD6A 3AALA 4Z1BA 3N13A 2HS6A 5LIXX 4FLRA 3L4WA 1Z42A 4QEHA 1US3A 4GJJA 1KRMA 1XYLA 2ZYFA 4XWUA 5TD4A 4XZWA 1QOQA 3M0JA 4NRRA 1XKJA 1FHUA 3AWOA 2J7EA 4S38A 4XAZA 3RPTA 4AZGA 5A2CA 4L1XA 3DHUA 2Y88A 1F8MA 1WAUA 3EA2A 1FWGC 4IF2A 2DT0A 1EQPA 3SSJA 1OCBA 2WNNA 1PXGA 2HSAA 3VVGA 1YXCA 1GG1A 1DE6A 1D3HA 4GRSA 3FYYA 1AH4A 1KGWA 4Y90A 1XLKA 1AW1A 4DQWA 3HIJA 3I7QA 3VNMA 2YB1A 1XCWA 1DHKA 4MSSA 3ZR4A 3PZOA 4H6KA 3U5UA 3S2NA 4ZQOA 4FPSA 4HMNA 3W0KA 1RV8A 4B5UA 5L6UA 3I10A 3KTCA 5E0CA 5EBUA 4Z2HA 4MY1A 4DXKA 3R1ZA 2FZDA 5EJZB 2TODA 4UOZA 3ARVA 2A85A 2EG6A 6ENLA 4C6JA 5FJUA 1XS2A 3RFAA 4HMCA 1EJ7L 4EOUA 3NZRA 3IAPA 2CWXA 4JNMA 1CIUA 2NLYA 2F7FA 2VKZG 1BVZA 1R87A 3P6LA 1BTMA 3BJTA 1U5JA 1RLCL 4H9ZA 4HBKA 3BOXA 5DRCA 1VFLA 4N2YA 1H62A 4QCFA 4ZR8A 2FJKA 4QG6A 4PRTA 3APGA 4CNSA 1QFEA 3ERPA 2POZA 2J25A 4ZXLA 2C16A 1SO4A 3QMSA 1RBLA 5GNXA 3SEPA 5HMSA 4ATWA 1OK6A 4O11A 5BMXA 3UG4A 1TWWA 4Q32A 1B9ZA 4E4UA 3LGEA 3QPEA 4S3KA 1X8CA 3CASA 4WR3A 4IFOA 1XLJA 3VXGA 2Z1BA 2XUCA 1OX6A 1ALDA 4PFMA 2ZRWA 3PANA 1JAKA 2EKCA 2WBKA 1GQJA 4HGXA 2NQHA 3PFRA 4RJEA 3QHNA 3MI6A 4EIVA 4LYKA 2ATSA 4QGCA 3UCQA 4YTUA 4B4HA 2XINA 5IDZA 4HCHA 2PTZA 2QPSA 2PTWA 3KRSA 4FI4A 3GK0A 3DG7A 2J8FA 4JIQA 4O0ZA 1US0A 3NZGA 1HW6A 3RM8A 2OELA 4LCRA 4TMBA 1ZZMA 3T7VA 5ENLA 1VFMA 1E43A 4HMDA 3CUFA 4RW3A 2WKLA 5DF0A 4I90A 1KFKA 4BF9A 1EZWA 4H83A 5M03A 3HG3A 3POHA 2OYLA 4Q7BA 2C1GA 2JGQA 5CBBA 1DJIA 2PUZA 2OT0A 3DFOA 3WF0A 1TV4A 1UMLA 3RLUA 4FX7A 2D0FA 2FGBA 4GYJA 2BOFX 1LQ2A 1OX5A 4K7YA 1ZGDA 5I3KA 5FSDC 3QGAC 4HZ7A 2XFYA 3W9ZA 4WXZA 4MJZA 5LNVA 1FWEC 1EB3A 2CHNA 1A3XA 1OGSA 3K4AA 1I4NA 1NOWA 4P02B 4M81A 3FYOA 1XDLA 2VZUA 3GG0A 2R9RA 5AECA 2O92A 4YVXA 1SU5A 3W7CA 3THDA 4PUDA 4PR4A 1ICSA 2P5NA 2BFGA 3T2QA 1FFRA 2QGHA 4NIRA 5H2ZA 4V15A 1G4TA 3W02A 4DXXA 1AD4A 3IGUA 4KF1A 3DESA 1E0XA 5HUOA 1LQAA 3WDHA 1QI0A 2E40A 3VNDA 3W6LA 2XIBA 3W2JA 2ALRA 5DFAA 1OEPA 1L0PA 2OWXA 3T09A 1FWHC 4LUSA 1WV2A 1XSKA 4IPPA 1UH2A 2NUYA 3OLDA 4TVDA 1R2RA 4OHQA 1OQFA 3U48A 2GDUA 3SQSA 5I24A 2QDHA 4J3WA 3JR2A 3DU0A 3S2JA 5A2AA 3AOFA 2PSNA 4LRSA 4B91A 3QJAA 3UY7A 4H1ZA 3F5KA 1HKKA 3W26A 1SYTA 2DP3A 4J3ZA 4B9YA 1PAMA 4QNWA 3M64A 1JVNA 1GQIA 2BOGX 3RU6A 1UUOA 4PUJA 5DMYA 3M44A 1IXQA 4N7QA 2ZC8A 2OX1A 1X38A 1HGYA 3LTSA 1VFFA 3WN6A 1PSCA 1I60A 2OVLA 1EJWC 2BV9A 5KZDA 1H0IA 2KAUC 3ITXA 3NGFA 1OADA 1HKJA 1F74A 3W73A 2WZTA 4BWLC 6PTDA 1A4LA 1H7OA 3W7KA 3ORWA 1M7OA 1DTUA 5FEZA 4EXAA 2A3LA 1UP0A 1CXKA 2FVLA 3OGVA 1PYFA 2MANA 1F6PA 4U33A 1LRTA 3EBVA 4OU1A 4DNMA 1A5UA 5G1TA 3O15A 2H3DA 3GU9A 1MW1A 1H1NA 3TYAA 4IPJA 3TJ4A 1E1EA 6ALDA 4K8GA 1UKTA 4U5KA 3CH9A 1ADDA 5BU9A 5I3HA 4MADA 4QSFA 2VC5A 3TP4A 1FFQA 1S5NA 2CZ5A 1VD6A 3LGDA 2Q8XA 4GQBA 3SI9A 5AYIA 1XBVA 3QH2A 5G1MA 3PJUA 1ZSXA 2ACQA 3P8JA 4AUBA 4DRSA 3EKLA 3GLCA 4FIQA 2VQUA 4GIAA 4MNJA 2VGIA 3IANA 2WVVA 3UXLA 3WQ5A 1XBZA 4TTGA 4LBUA 4QXIA 4E3TA 2F38A 1E51A 3R12A 5E93A 3B40A 4S3FA 2NWSA 4X22A 4QROA 3PB2A 4LBSA 4NNBA 2C91A 1MEIA 4HNOA 1MYRA 4H2HA 4AZHA 1OZMA 3AZTA 5I7GA 3RO8A 3N3MA 4TX6A 2NX9A 4DVOA 1FWAC 3UWEA 2FFCA 3TTSA 2VO5A 1XIGA 3T0DA 4DZHA 3VGBA 3WLQA 1JAEA 4DLFA 3GAYA 3IJLA 3USZA 2J7FA 2BVDA 3P60A 3QMTA 3TTQA 4GY7A 4W8LA 1G5AA 4LS0A 3MP4A 3EA3A 4GX9A 3TX9A 2OJPA 1W3KA 3W7LA 1R3WA 2J7BA 2XM1A 4AW7A 1HX0A 3NQ7A 3RK8A 5ABTA 3KOWA 1ZJAA 1F76A 3LMYA 4M56A 2G3MA 2QR6A 3VIOA 2WSPA 1LZOA 4WDXA 4MKNA 4CEXC 1BWVA 4KCUA 3IK2A 1OHLA 4IGHA 4QR6A 1IR2A 1UWIA 2E09A 2BASA 4H8HA 3O9NA 3PK7A 4FEZA 1J12A 1SM9A 4KWWA 4ORMA 4GY0A 1TPWA 3C2EA 1ODUA 1YW1A 1JEZA 2J27A 5A95A 2Y5EA 1KTBA 1YEYA 2FJUB 3CC1A 3AZRA 4XKYB 3U2CA 3M43A 1XP3A 4WK9A 1TRDA 3AIEA 4Q4SA 4NZ1A 3HPAA 3NZ1A 3F2CA 4J3SA 1GJWA 4EWND 1A5SA 1X1OA 3OBEA 1S2TA 2NW0A 4Q7NA 1Y65A 4I8YA 3MSRA 2FVMA 3Q94A 3A6OA 3CHDA 3H70A 2QCFA 1GYNA 4UMCA 3H12A 3WFAA 2HRWA 3QM3A 2BVWA 4OUEA 3R0UA 2BNJA 1NQ6A 1K02A 1UIPA 3AHVA 4R85A 4FR6A 1H63A 2V5KA 1HO4A 3GWQA 3R8GA 3GH4A 1W17A 4TIMA 3HG4A 2VP8A 1FP9A 3WLRA 4A35A 2PDXA 3MBDA 4JFSA 4WCJA 4LSBA 3WQ8A 1YKWA 3GB6A 2CYGA 1C9WA 1EXPA 3EOSA 3XINA 3L67A 3MW7A 5LA0A 3SUUA 2D24A 3Q4DA 4AWEA 3O1NA 3HBLA 1MRAA 4QLLA 3II1A 4G7FA 1KQZA 3A47A 1Z8AA 2WCAA 3B0YA 1DWFM 1WOAA 3T0TA 3W4RA 2QUMA 1LBMA 1RK6A 4LGXA 3KRBA 2XZ9A 4L64A 1D8WA 4YIWA 1NFGA 2BX7A 3OBKA 4D9PA 2VELA 3MP3A 6REQB 4FNTA 5HQLA 2X0HA 3AYTA 1Q7MA 4B5TA 2C6QA 4MZ8A 3LM3A 2WVUA 1SJBA 2KX9A 4JNZA 1XLAA 4GI6A 3WNMA 3CT7A 4L6OA 3H2OA 4R3UA 1K77A 5LXEA 3SDOA 4ZTYA 1E6NA 3W7IA 1J0KA 3UZXA 2PURA 4HKPA 1ONRA 4IPNB 4WJ8A 4JTAA 4KIRA 7ENLA 2I1OA 2WHKA 3QC3A 1YQ2A 3QZ6A 8CGTA 1FHDA 1ONXA 1I45A 3CUIA 4GJ1A 3O06A 3BICA 2Z25A 2QEZA 3HPFA 5FKYA 4GK8A 3L4VA 1GQLA 4O10A