3SUUA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with gal-pugnac
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase/hydrolase inhibitor
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suuA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suuA02
4WK9A 3SUWA 1BQCA 1DWGM 4M8UA 1VFUA 3HMCA 1RP9A 4AD3A 4CD7A 1CTNA 3SCUA 2UY3A 2OYKA 4MNJA 4UQBA 3OLGA 1UD2A 4GZJA 3PN8A 3BCFA 3BH4A 3AICA 3S2CA 2QPSA 3S6TA 5CQ1A 4OBSA 2PWGA 2C8NA 3J7HA 3MMUA 3VDCA 4B3KA 1MQQA 3WD1A 3WNLA 1LG1A 1G0CA 2VQTA 4DWSB 1UWTA 5I77A 4ZE4A 3GH7A 2W61A 1L8NA 2YL5A 2Z1KA 5CZKA 2DSVA 3WFLA 3VINA 4D6IA 3WQ6A 2BVTA 3GXMA 1CGVA 1GVYA 1KGUA 1OB0A 4B16A 2VOTA 2XM2A 4U31A 4BS0A 1K6AA 1GQIA 2DIEA 2ZX9A 3BAJA 1ZJBA 1W2VA 1O6IA 3SUUA 5CSYA 4S3JA 1L0PA 1EHNA 5DMYA 4HP5A 2GDVA 3W27A 3SURA 1W9UA 3IANA 3T0BA 5A8QA 3CZ8A 2J74A 5E9AA 1E4LA 4MAVA 2NSXA 1E4MM 2ZUWA 3L2LA 1V08A 3VNZA 3WQVA 1H5VA 1J11A 4HA4A 3NSNA 3TTSA 1VBRA 2WMIA 4LYRA 3WH8A 4OOUA 2D3LA 5I78A 2DT0A 4FMVA 1UUQA 3U5UA 5A94A 1TR1A 2GSJA 1UWUA 3VD3A 3PZUA 5D9NA 2FH6A 1WPCA 1WZLA 3BAWA 1JYVA 5E0FA 3D3AA 1SMDA 3FY1A 1JL8A 2EPLX 4E8CA 5IHSA 2BNJA 4D71A 4M82A 1QOXA 1NQ6A 4BA0A 4W86A 2VNCA 5FIPA 3MKKA 3CHDA 2WMJA 2UY4A 2WK2A 2XVPA 4AISA 3SCPA 1GNXA 3AS1A 4XX6A 1CEOA 1BG4A 3VD9A 1F4AA 1VBUA 1B90A 1GJUA 1ZL1A 4UZUA 1CIUA 1US2A 4OBRA 4EKJA 1M53A 3EMQA 3WIJA 2ZX5A 4DWSC 1ECEA 1KBBA 5FL0A 3THCA 3WL0A 1HJSA 2ZUSA 2BFGA 4JKLA 4HOZA 4PUDA 1JFHA 5I0DA 2WVSA 2X0HA 5EMYA 5E6ZA 2F61A 5BRQA 1JYWA 4FK9A 1KGXA 3A4WA 1W3JA 2J47A 3RMEA 5A2CA 2J7FA 5JBFA 4UQEA 1KWGA 2WMFA 1NOUA 4CCCA 4AIUA 5A2AA 5A95A 2X1IA 1CZ1A 4V28A 3F4VA 3SUVA 2A3EA 1E3XA 3F5LA 3BXWA 2D3NA 3VM7A 1NP2A 9CGTA 1I1XA 4Q22A 1HKKA 1ISYA 4HU0A 1VF8A 2QV4A 4WSKA 4P8UA 1XGZA 1CBGA 1CXKA 4H7VA 1BYAA 1UKPA 4P7RA 1WAWA 5M3WA 1VEPA 4U5IA 2V5DA 3UESA 2CBUA 3WH6A 4IPNB 1W1PA 3AHYA 2DT2A 5LA2A 1BYDA 1FH7A 2J78A 4AZ7A 2E40A 4Z2GA 1NOFA 4PMOA 4WF7A 4H41A 3L4ZA 2BVDA 5AYIA 1DWAM 4GZIA 2CHOA 4HMEA 5TD4A 4PN2A 1Q6FA 3W37A 3RDKA 2IUZA 1QI0A 3LPFA 4AD1A 1HKJA 2BHYA 3EDFA 4D6JA 1E56A 3AS3A 3G6LA 4W84A 2DH2A 3WENA 3ZM8A 1ZBVA 1B0IA 1FHLA 1V0NA 3EBVA 3MSDA 3N12A 2XWEA 4DWSA 2PWHA 3T2PA 4UFLA 1GQKA 5ABGA 5D9MA 1BHGA 1GHSA 4JAWA 4PCTA 1W9VA 2ZOXA 3KE0A 3E1F1 1ZBKA 4PMRA 4A3HA 3A6OA 5I3DA 1DEDA 1WNOA 2BVYA 2ESCA 4PMNA 4E4PA 2WYSA 3GH5A 1HKMA 4AIEA 2YOCA 2V3GA 4BF7A 2WC4A 2VJXA 4J28A 2E9BA 5EBAA 3OGRA 4PMXA 2WLYA 1XCXA 2JIEA 2WAGA 1RP8A 1R85A 1OGBA 2WBGA 2A3BA 1Q6GA 1MW3A 2FDMA 1H0GA 2G8ZA 1CGWA 3APGA 1JYXA 1XD1A 8A3HA 1AQ0A 4PMDA 1W1VA 3SIMA 3TTQA 1UD5A 2E4TA 4JHOA 1WO2A 5GNYA 3AROA 4KH2A 2FHFA 1BYBA 2YJQA 2WHMA 1WZMA 2WB5A 3CZJA 3WQWA 3VGDA 4MTVA 3UR8A 2JE8A 4UNIA 4NZCA 1E71M 3UR7A 1DHKA 5A8PA 3ZIZA 4N42A 4X0VA 1WZKA 2EBNA 1GOMA 4GIAA 2XFFA 2ZXBA 3PZQA 4UFJA 4ML4A 3CO4A 4W7UA 4DUXA 1ZBCA 3WD4A 1GPFA 2V3EA 4D1JA 4JFTA 1WDPA 3U5YA 3CTTA 4D6FA 2DEPA 4NI3A 5BWFA 1US3A 3CHEA 3F5JA 4CN4A 5EFDA 1V02A 3WEMA 1HJXA 1UHVA 2Y8KA 4UR9A 3AIRA 5A6SA 1J0IA 3UG4A 5GNXA 1UWSA 4W93A 1V0LA 4K68A 1QNRA 1E55A 4QLJA 1UKOA 4JCLA 3U7VA 4DM1A 1NARA 4LYQA 1V6VA 2EO7A 4UFMA 1KGWA 2W91A 3FNDA 2BY3A 1XV8A 4JZ5A 3AMDA 1IZJA 3WDPP 5FD0A 1CXFA 1MXDA 1QW8A 3SCNA 2A3CA 2WSPA 2CXGA 1E1EA 3AHXA 1HJVA 4HMCA 3JUGA 4PBGA 1GHRA 4J3TA 2J7CA 4P8XA 1QI2A 2F2HA 1UOKA 1QNSA 1I1WA 4AZ5A 3BAIA 3PZ9A 3PZMA 3ARQA 3PZVA 1UKTA 2CHNA 3W6LA 3GZAA 2XFYA 5ABFA 3W38A 2FHCA 3QR3A 2DGAA 3RO8A 2AMGA 1G1YA 4FLRA 3I3DA 1NH6A 2E9LA 2VI0A 3PTQA 1JZ6A 4KGJA 4D6GA 2DSKA 3BCDA 1J10A 3M46A 4H8UA 5BYWA 2W92A 5A1AA 3MMWA 2DIJA 2XSBA 3O9NA 1FA2A 1ESWA 3WY1A 3L4UA 5F7UA 1JAEA 3POCA 3DYMA 1OD8A 3AIUA 4JL1A 1X1NA 3RM9A 4TXEA 5M5DA 3AIWA 2WZHA 1WP6A 4KRTA 1EDTA 2D1ZA 5LA1A 2MANA 5A2BA 5A6JA 3HU7A 4CU8A 1IV8A 3OLEA 3NSMA 3AMCA 4HPHA 4D72A 3ZJKA 2CERA 1CECA 1A47A 1WCGA 2WCSA 2WMIB 1P6WA 5D9PA 2YL6A 3K8LA 1B3XA 5HNNA 2VCBA 4QCEA 2FGZA 2X8RA 2ZX8A 1H49A 4MB3A 4URIA 2OSXA 4MNMA 5JIPA 1JZ8A 2YBUA 2BHUA 1HL9A 4DUWA 3ZT6A 3MS8A 1JXKA 3AHZA 3PZOA 1QHZA 3THDA 3ZOAA 3VD4A 1VFFA 3VIIA 5A8NA 1J0KA 5CGTA 1DTUA 1TMQA 3VDAA 2ZUTA 2VTFA 4TX6A 5HXMA 2D0GA 3VX0A 2VT0A 3RCNA 4F79A 1VFMA 2X09A 2J79A 2QF8A 4UFHA 1JZ4A 3VIGA 3VTRA 1HJWA 1BLIA 4P8VA 3AXIA 1W9BM 1OIFA 2YA2A 3AXXA 3WDRA 2G4FA 1CGYA 2WVUA 1E73M 1G5AA 3QOMA 1KCLA 2AAAA 1BGGA 3CZLA 4PMVA 5DEZA 1D7FA 1G9HA 1U2YA 2VVNA 1E6ZA 4AZIA 6CGTA 1JG9A 7A3HA 4OJYA 1E9LA 3WDQA 3NJ3A 4AZHA 4YPJA 1OGSA 1JDCA 2Y24A 4XZWA 5CSUA 3DHPA 3VM5A 4BZYA 1EQCA 2DH3A 3ARRA 4HZ7A 4KRUA 1E4NA 2WNWA 1E3ZA 2TAAA 3NSXA 3CUJA 3AIBA 4LGXA 4LX4A 3WD2A 2EPOA 5A6LA 5CPSA 4C7GA 3VIMA 4A4AA 1UZ4A 2YA0A 3BAKA 4C7DA 1UWRA 3FAXA 4E2OA 4L4PA 4H04A 2Y8VA 5LA0A 4PMZA 1OIMA 2VRJA 4DUVA 1NOWA 4A3YA 3MUZ1 1VB9A 1E1FA 3WMBA 1XSJA 3CMJA 1CPUA 3GM8A 3WQ5A 2WPGA 2XVKA 2WHJA 1KR1A 1EDQA 4PEEA 4W85A 5HDRA 5A6MA 3PZTA 3VPLA 1AQMA 4PMYA 3VMOA 1B9ZA 1GOIA 4EE9A 5E09A 5A6AA 2XM1A 1W1TA 1RPKA 3A4XA 2VZOA 1OGGA 2CITA 3ALFA 3MU7A 4F9DA 1VENA 5IHRA 5D9OA 1NWUA 2ZUMA 1TG7A 1D2KA 1B3YA 2PBGA 4QLLA 4PTWA 3TP4A 1HP4A 3TOPA 1JXJA 2VURA 3DHUA 3VO0A 3SCSA 3KL5A 2WANA 1UQZA 2CESA 4RE3A 4YHEA 4AD2A 3ARWA 4CVUA 3NDZA 4CU6A 3DYOA 3CHFA 4HMDA 3N17A 1VAHA 2ZX6A 4OOZA 4IISA 2VCAA 2A3HA 1KCKA 2ZICA 3AIVA 1E40A 2EPKX 2VR5A 5C71A 3KL0A 3WNNA 1ISWA 1W91A 3VOCA 4W8BA 2CPUA 4Z2HA 3ARXA 5HPCA 1UA7A 1C90A 1MW1A 1CDGA 1NM9A 1XCWA 2PC8A 2YL8A 5AYBA 3WD0A 3N04A 3MV01 3N1AA 3K1DA 4U33A 2Y2WA 1JDAA 1W9XA 1V6WA 3SUTA 5JIWA 2GUYA 3WF2A 3AHTA 4UFKA 2DSWA 3EDKA 3GXFA 1M01A 2XWDA 4ZFMA 2WKGA 1HJQA 1D3CA 4RL3A 4XZBA 1CWYA 3GYCA 1J9YA 2WZIA 3HN3A 3PTKA 2W4XA 4TVUA 4W8LA 1FP9A 3OG2A 1TZ7A 1JNDA 1DWHM 4BQ5A 2DSUA 3NCOA 1HKIA 5A8OA 4IM4A 3AZSA 3VGFA 1QVBA 1V3MA 3OZOA 3G6MA 1V6YA 2WBKA 4P8WA 4PTVA 1JGIA 3VDBA 4JIEA 2G3NA 1Q6EA 1AQHA 3AHVA 1C92A 3FHQA 3PZIA 3AMGA 3K8MA 4JHZA 1XHGA 4J3VA 3WMSA 3OIHA 3UCQA 1H0IA 2W5FA 2WVVA 4ZXLA 5FL1A 1KBKA 3WF0A 3CIVA 3VIHA 3W53A 1B3WA 3WEZA 2O9OA 4B3LA 2J75A 3MMDA 5DT7A 1E6RA 1B1YA 4MJ4A 2CEQA 5ABFB 4L4OA 3OA5A 3A3HA 1XD0A 1C8YA 2B31A 4AIOA 3GNRA 2JF7A 4PYSA 2OYLA 1J0ZA 2J7HA 4PMQA 2E3ZA 2W66A 4GI9A 4X0NA 5ABEA 1CYGA 4BQ3A 1RH9A 3VIOA 2FHBA 1M7XA 4P7LA 6A3HA 2XHYA 1F4HA 1PZ3A 6TAAA 4MNLA 4GINA 4AC1X 4D6DA 1XYFA 4H8VA 3K8KA 5GPRA 3ZSTA 5JUVA 4UOJA 1J12A 5FOOA 2V5CA 3UEQA 2YLLA 1HVQA 3WUBA 1W2PA 1XSKA 1E0XA 2YDQA 2WC3A 3L4TA 5BXPA 3VIPA 2EXOA 1KFWA 3WSUA 3I3BA 4NRRA 3VX1A 2J77A 3BLKA 3BMVA 1C3FA 2PWDA 1MFVA 3M6DA 1MW2A 2GK1B 2WWDA 1TVPA 4TX8A 4TTGA 3SCWA 2J7DA 3KEHA 1UR8A 3W82A 5HOSA 3SCTA 4AEEA 1X6LA 3ARPA 4XV0A 3RM8A 4QAWA 3WKZA 4HPGA 5JBDA 4NSBA 4GPNA 4D1IA 2E9MA 1R86A 3GDBA 3B9EA 1UG6A 3K4AA 1XSIA 1TCMA 1W9PA 3CPUA 4OIFA 7CGTA 3VNYA 1OD0A 2J8GA 2WLZA 2VZUA 2ZWZA 2BY2A 2Q8XA 4U2YA 1HIZA 1EXPA 2JALA 2CCRA 2VX4A 3M7SA 1XRVA 1UR1A 3IJ9A 3MUIA 4ZENA 4H2CA 1HP5A 4J3SA 4AWEA 1FP8A 2VL4A 4MPKA 4F66A 2XUCA 3FN9A 2JIWA 4XUYA 4GO9A 1B2YA 1HL8A 1KXQA 2VC9A 3NDYA 5LYRA 3T08A 2OYMA 4UQCA 4F9JA 2ZE0A 1VRXA 3MO4A 3TA9A 3WNOA 3GBDA 4B15A 3LPGA 3BSHA 1CGUA 4B9YA 3CUHA 3LPPA 1EGZA 5FCZA 1TVNA 2IXUA 4W87A 1KR0A 4C90A 2D23A 3VVGA 3ARSA 2OWXA 3CUGA 2EEXA 3WBEA 4UOZA 5D8WA 1LWHA 4BCEA 2VZVA 1LQ0A 1JF6A 1J0YA 1PPIA 4ACYA 2OSWA 3UERA 4HZ6A 3B8SA 4LXFA 3DC0A 4R5EA 1H11A 4AY1A 1ITXA 3B9DA 3WEOA 1CXEA 1UD3A 4HU8A 1HVXA 2DPEA 3LPOA 3CMGA 3KWXA 1UYQA 5M03A 4ZE5A 1U30A 3QHOA 3W81A 4V2XA 3T0AA 1OSEA 2OSYA 4AMCA 3RJXA 4XB3A 4GXPA 3WD3A 3CZGA 1N82A 3U7BA 2YDRA 3UG5A 3ZJ7A 1VFOA 3WDHA 2D2OA 1UZ1A 1NWSA 4JFVA 4PTMA 4EK7A 4PCSA 1EOKA 2WM0A 1S46A 3FAWA 1TFVA 1LLOA 2X2YA 1QW9A 2BHZA 1KQYA 5D8ZA 5BRPA 3ARZA 3AYRA 2YA1A 1BGAA 4MDOA 3VILA 4P7OA 1GVIA 4MB4A 3TONA 3CUIA 3EDJA 4JFWA 3AYSA 4D6HA 1GQLA 1BAGA 5HPOA 2XGIA 3FXYA 1QNOA 2J7EA 4EAMA 4GI6A 1B3ZA 3TTOA 1KWKA 2QMKA 2ZUNA 5ECUA 2VO5A 2CYGA 1VEOA 3W4RA 1J0JA 1H4PA 4PMUA 4FLQA 2CBJA 4CN6A 1ZS2A 1IZKA 5I79A 1GONA 4ACZB 3NYDA 3BGAA 3VDHA 1PIGA 4HA1A 3UETA 2XGBA 5IXEA 3VGHA 1GZJA 5I23A 4U3CA 1X6NA 4MADA 3W29A 3IJ7A 3T2QA 1HN1A 1QI3A 1EDGA 1BF2A 1ITCA 2QHAA 2GK1A 2ZX7A 2CKSA 3N18A 3N11A 5A8MA 2GDUA 3WMCA 2WSKA 4UQAA 5CG0A 2XIIA 4JFSA 4N0RA 7TAAA 1JFXA 2ZIDA 1MW0A 1BTCA 2PF0A 1UH3A 1W3KA 5FKYA 4JCMA 2X05A 2E0PA 3VGBA 1B30A 3LMYA 1QI4A 5EB8A 3T0DA 1OM0A 1QI5A 3L4WA 4WJXA 4HA3A 4UTFA 5KEZA 3QHMA 1MWOA 2GFTA 4KGLA 1W3HA 1JZ2A 1CLXA 3T09A 5CLWA 2XIBA 5A3HA 1ZB5A 1Q6DA 4W8AA 4B9ZA 3PZGA 1FOBA 4UZSA 3RIKA 3ZSSA 4LYPA 4CD6A 4GQRA 1MFUA 3F5KA 1GCYA 2QMJA 3AIQA 3BAXA 4M56A 5I5RA 1W32A 2WVVB 4BQ2A 1BVZA 3CZKA 1CLVA 3WUFA 4DM2A 5M17A 4D6CA 4IUGA 1MVYA 5I2UA 3M07A 2CIPA 1W3LA 1M03A 1TA3B 1GUVA 3ARUA 3L2MA 1FFRA 3MV11 1JF5A 1E5NA 4E8DA 4Z2IA 3WF3A 1EOMA 2VVSA 4OKDA 5I6SA 4AXNA 2VUYA 5A6BD 5A6KA 3WN6A 2PWFA 1W9DM 3VD5A 3EMZA 5C8BB 1WB0A 2YL9A 3OGVA 1J0HA 4RE2A 3AMKA 4C7FA 4AEFA 4GI8A 2VZTA 1NWTA 4TVDA 1JZ7A 3SEPA 2G3MA 2RGMA 1FH9A 2V3DA 3CUFA 3OLIA 4IPLA 1H1NA 4Q7NA 3BAYA 3GXIA 3PHAA 1Q4NX 1XH2A 1SFSA 1JDDA 4W5UA 4AZ6A 5BXTA 4LPCA 1GJWA 1DWJM 1CENA 1KXHA 3SCRA 1JNEA 2HVMA 5DO8A 3DECA 2WW5A 4BQ4A 2DDXA 1HXJA 4GO8A 5GQBA 3GNPA 1VEMA 1CGTA 4JL2A 2GJXB 1H09A 3QHNA 3CBWA 1E0WA 4UQ9A 3ZT5A 1E6PA 3AI0A 3W28A 4D6EA 1UKSA 1XC6A 2V38A 3MUAA 1DWFM 2IXVA 2XJ7A 4MB5A 5KZ6A 1UQYA 1J01A 2XVGA 3ZQ9A 4ACZA 4CD8A 1O7AA 1WDQA 2QPUA 2V3FA 3OGSA 2DSZA 2WHLA 2E8YA 1RD6A 2A3AA 1UKQA 1XYZA 4OUEA 1G01A 2OLHA 1PX3A 3VUPA 1R7OA 2G3IA 5BXSA 1VIWA 2VCCA 1ZBWA 2EPNA 1K9EA 4PSRA 3VD7A 4UCFA 5BROA 1H2JA 3VU2A 1MQPA 1PEZA 2XFRA 1FH8A 3WQ8A 1QNPA 4Z2LA 1OCQA 1EO7A 2PI6A 1KXVA 3IAPA 4CU7A 3WUEA 4HOXA 1OINA 2YIHA 4W7WA 2OWCA 2J7BA 3VIKA 4PSPA 3AS0A 2GJRA 3AISA 3AMLA 5CPQA 1UH2A 3VIJA 3L4YA 3GNOA 3WDJA 1UR4A 5DFAA 4WKAA 1EHAA 1NWRA 1V6UA 1LF1A 3O2LA 4CD4A 1ISVA 3SCQA 4U3AA 2JFEX 1KXTA 2VX5A 3ARVA 1OWQA 3SUSA 3BC9A 1WZAA 4QP0A 3WQ4A 1WE5A 4JKMA 3W25A 3CHCA 1CNVA 4F8XA 3AOFA 4HZ8A 3AZTA 4U5KA 3AIEA 4W5ZA 4MAZA 4AZCB 1E6XM 2YBTA 3WDIA 1ISXA 2WCGA 4J3UA 1JD7A 5D4YA 3ECQA 5E6YA 3UG3A 4CVWA 2PB1A 3AXHA 3KL3A 1C93A 3NUKA 5CPTA 4QLKA 5E70A 3SCVA 2AOSA 2JEPA 2YDSA 1UD4A 5A69A 1H3GA 1PJ9A 4MDPA 3POHA 1M04A 1DWIM 1TA3A 1VJSA 2RGLA 2VZSA 2QLYA 3U57A 5BXRA 1J18A 3AJ7A 4H8HA 3VIFA 2D24A 5ABHA 3OBAA 3W6MA 1KQZA 4J27A 2BXYA 3ARTA 1QBAA 4NF7A 4AD0A 1ZU8A 2BS9A 1QPKA 3W0KA 1EA9C 1V3JA 1PX4A 4YN5A 2W62A 2WMHA 1BVNP 4M81A 4UFIA 1EQPA 1KB3A 5DT5A 4MJ2A 4CUCA 2YLAA 4MNKA 3FHAA 4KWUA 3K4DA 3W24A 1R7AA 1XH0A 4GZEA 1MYRA 1SYTA 5CGMA 4MB1A 1E4IA 4FLSA 3RM4A 1E6NA 3WNKA 8CGTA 2BY0A 3ZMRA 1JI1A 2J7GA 2J62A 1FHDA 4HOWA 3EDDA 2GJXA 1V0KA 1UH4A 1UWIA 2W67A 3ZJ6A 5IDIA 4CGTA 2EQDA 1R8LA 2J25A 4P7NA 4YHGA 3ZO9A 2CBIA 3OZPA 1TUXA 2O9TA 2VX6A 2PBOA 3AFBA 1TE1A 4AD4A 2ZUUA 2XVLA 4S3KA 3BMWA 2FH8A 1QNQA 1JZ5A 2UY2A 1B31A 1UD6A 4KMQA 1R87A 2E8ZA 1HNYA 3WL1A 1V3LA 2O92A 2ZWYA 1Y7VA 3GXDA 1EIBA 2WVTA 3VGEA 4Y7EA 3ZJ8A 3WNPA 4AZGA 3NIYA 1H41A 3TTYA 3DYPA 4OZOA 1GOQA 2C0HA 3FW6A 1LL6A 2WKLA 3VKKA 2CETA 1V02E 4QFUA 3OB8A 1AMYA 1I75A 3MUY1 4U2ZA 3KZSA 1MXGA 3VGGA 4AD5A 4HTYA 4WSJA 3N13A 1C7TA 3O6AA 5CJ5A 3D5HA 5CXPA 2CNCA 1OT2A 1JYNA 1K9TA 3ZR5A 2W63A 2F8QA 1YHTA 3IJ8A 5CLTA 4R27A 4QDMA 1E6SM 5JBEA 3AQUA 5BCAA 2WZEA 2VMFA 1U33A 1V3IA 3WH7A 2UY5A 3AZRA 1AVAA 1E15A 3ARYA 1WDSA 2WXDM 1GOKA 3RJYA 3OLDA 1LJYA 1SR0A 1C7SA 4ZEPA 3CH9A 2D20A 4QCFA 2EJ1A 1NP0A 3MSGA 4W7VA 4GKLA 3A47A 3WUGA 1LL7A 1JIBA 3HJEA 3L4XA 3WELA 4WKFA 3QGVA 2WMKA 1LG2A 2G3JA 4Z2JA 4AZCA 2CBVA 4M24A 4PRWA 2J8FA 4AZBA 1LWJA 1B3VA 3I3EA 3W26A 2D22A 1E43A 1OBAA 4P7QA 4TVCA 3CZEA 2ZUVA 2ZXQA 1E5JA 2BXZA 1XH1A 4TTUA 1K9DA 3EDEA 2ZXDA 1WDRA 3K46A 1BPLB 4RE4A 4CN1A 3II1A 1HJUA 1BYCA 1HX0A 3PBGA 4J7RA 2XYLA 3GTNA 2DT1A 4CCEA 4ATLA 1PBGA 4M29A 1ISZA 1UR2A 4ZXOA 2GVYA 1Q6CA 2Z1SA 4WLCA 4DWSD 1BG9A 5C70A 3MANA 1OT1A 2JF6A 1CXIA 5IFTA 4WIWA 1CGXA 4AYSA 5A6BA 1PAMA 1CXHA 1GOWA 1V6XA 2XSAA 1IT0A 1C8XA 4J3WA 3L4VA 4CKQA 2EPMX 3B9AA 5AC4A 1YQ2A 1Z32X 4FLOA 2NT0A 1E70M 2XG9A 2NW0A 1A3HA 2CKRA 1JAKA 1WKYA 2FGLA 1CXLA 1E0VA 2O9RA 4C91A 1HF6A 2HISA 3IK2A 2XTKA 1C91A 3WBAA 1BSIA 2VQUA 1ZJAA 1ODUA 1QBBA 1E6QM 1JD9A 4PUEA 2OWWA 2WCAA 4V27A 1UD8A 5I24A 2BY1A 3GH4A 1JI2A 4LQ1A 3WH9A 2PWEA 1V03A 3RPMA 2G41A 2NT1A 2Y5EA 4WKHA 5HBFA 2VRQA 1SMAA 1GOOA 3N15A 3WFZA 2WMGA 1PZ2A 3ZT7A 2BV9A 2DT3A 4FF5A 3VMPA 4X9YA 4ATWA 3QOKA 2C7FA 3PZNA 3EYPA 5E0CA 2JEQA 3WNMA 4UQDA 1G94A 1ODZA 1UA3A 3RILA 2J4GA 3A4AA 2WHKA 1E72M 4J3XA 1GQJA 1QHOA 1V0MA 4UOQA 1DP0A 4TUFA 3ZR6A 2VRKA 2UWFA 1W1YA 1VJZA 1BFNA 1K9FA 1HT6A 1UR9A 4W89A 4CCDA 3BSGA 4W88A 3T2OA 3EMCA 1V3KA 4M80A 3N9KA 1PX8A 2Y4SA 1EH9A 3WF4A 5GNZA 3CLWA 3PTMA 1QHPA 5DF0A 2ZXAA 3WH5A 4JFUA 1UWQA 5AY7A 2D0HA 4PTXA 2D0FA 3WF1A 2XPKA 1GORA 1MQRA 5AC5A 2VX7A 2XVNA 1EO5A 2WWCA 3SCOA 4AW7A 4ATDA 4NRSA 4JKKA 2DQXA 4CD5A 5IFPA 3GBEA 4Z2KA 1C8QA 1PIFA 2GJPA 1GW1A 2YKKA 3IAQA 2O9PA 1JZ3A 5EFFA 1V3HA 1FFQA 4TOQA 4EANA 4GQQA 3BLPX 3AS2A 3VMNA 2VR4A 1LL4A 1UR0A 3ALGA 3CGTA 2WC7A 2X0YA 4M1RA
chains in the Genus database with same CATH superfamily
4WK9A 1BQCA 2IPGA 4M8UA 5FJUA 3P5YA 3HMCA 1RP9A 4LNYA 4CD7A 4PC8A 3IK4A 4JYDA 3NZPA 1I0DA 4Y8FA 4PB4A 1KFKA 3BCFA 5LNWA 1SZGA 4MFEA 4LV9A 3VCNA 3CL8A 3QV9A 1OADA 5K9CA 3PUEA 4LYKA 2WPBA 3DFYA 3OTRA 4IFKB 1XRFA 1BKSA 4HHLA 4OBSA 4NP7A 2PWGA 3KZPA 4I9TA 3MMUA 3EWXA 1SZEA 5HR6A 4EPKA 2QDHA 1XINA 2E28A 1LRQA 1G0CA 1UWTA 3N29A 3KOFA 1G6CA 1FQ0A 2QJGA 2YL5A 2Z1KA 3SRDA 1GTEA 1XBZA 3IWPA 3DG7A 3VINA 2BVTA 3PJWA 1GVYA 1OB0A 7REQB 4TU1A 4B16A 1JCMP 1FXQA 1K6AA 3C8NA 2DIEA 3A64A 1ZJBA 1W2VA 3P14A 4IH3A 5CSYA 1ZLPA 3F1QA 4S3JA 3DH7A 3LHWA 1L0PA 5HMDA 2V2DA 3GXPA 1W9UA 2F84A 1R9XA 1J4EA 2ZBTA 4MAVA 3OU8A 3WLNA 2NSXA 1OG0A 3WQVA 4O13A 4L9YA 2Q8LA 4PB3A 2IQTA 4ZOCA 1VFLA 3PJUA 1XPGA 2QYGA 4RV8A 1PHQA 3WH8A 2D3LA 1A4LA 4RXGA 2L5HA 4IGHA 1UUQA 5CGQA 3TNOA 3U5UA 3LCFA 5T9BG 1EEPA 3V75A 4LC8A 4WDTA 1YDOA 3BSMA 3PZUA 2FH6A 1WZLA 3C5QA 3BPWA 1GQNA 3G3DA 3VCRA 2BNJA 4YTTA 4MVAA 1XS2A 4BA0A 3MKKA 2RDXA 2WMJA 2UY4A 2WK2A 1G67A 1GNXA 3AS1A 4Q4MA 3CT2A 3VD9A 4LCRA 1IT7A 4IMDA 3UZZA 1ZL1A 1R47A 1QT1A 1US2A 3C3UA 1TJPA 3AXMA 1M53A 3EMQA 4EKJA 3WIJA 2ZZ7A 3S8HA 4DWSC 2VM8A 3THCA 3WL0A 1IXPA 3PWIA 2CLKA 3VE7A 1HJSA 3N2XA 1YEYA 3B40A 3FXGA 4PUDA 4A8RA 2X0HA 4D2JA 1P0DA 4PUNA 2RFGA 5DLCA 3W72A 4H9UA 3PG8A 3Q94A 3L5LA 4RZBA 2NQ5A 3OA3A 4QJ4B 4AIUA 4V28A 4BKNA 3SUVA 3H54A 3F5LA 3BXWA 1NP2A 3DGRA 1HKKA 1VF8A 4DLMA 3HB9A 1WAWA 4U5IA 2V5DA 4LAKA 4Q4QA 2VFFA 5CH9A 5DBTA 3UCCA 3AHYA 1Y5WA 1OY0A 5LA2A 1BYDA 1E1CB 1FH7A 3BK0A 3L66A 4Z2GA 1V77A 4H6EA 4AVOA 2GZXA 4WF7A 1NTHA 2CHOA 1T8XA 4CLMA 2NLYA 3WLIA 3KRZA 3EKZA 1QI0A 3MHUA 4AD1A 2BHYA 3EDFA 4ICMA 1E56A 3E38A 4FA3A 2Z2AA 2C1GA 3K5XA 1B0IA 4JOMA 3N12A 3F2DA 1S1PA 2XWEA 4DWSA 4Y96A 1PZ1A 1XIGA 1VLWA 5CJMA 4UFLA 4RDZA 2PAJA 5ABGA 1BHGA 3UNTA 2VFDA 3PJTA 4PCTA 1W9VA 4M7SA 5K2ZA 4FR1A 3E1F1 1QCWA 4P00B 1DEDA 1WNOA 3H55A 2FDSA 5HMFA 2VWSA 4ZBCA 5F1UA 2QGYA 1VGAA 4W4QA 2DZWA 3GY1A 1QW7A 2PDJA 3NVDA 2YOCA 2OG9A 4NILA 1T5AA 3OZMA 4TX9A 4UNKA 4GH3A 2WAGA 4H9MA 4JY8A 1R85A 3R5EA 4JX4A 2A3BA 3WK0A 3OP2A 4X60A 1OFOA 3IV8A 3RN6A 2E09A 3A12A 4O10A 5TQLA 4G8TA 3NOYA 2ZZ4A 4DO6A 5SWUA 3TZNA 3AROA 4KH2A 1D3HA 2WHMA 2WB5A 3CZJA 3WQWA 2ADAA 4G2DA 2VWTA 4MTVA 1XG4A 3UR8A 4XD3A 1SZNA 2XIQA 4XZLX 3KHDA 3ZIZA 2IKJA 2VGIA 4S23A 1WZKA 2EBNA 3NVTA 3KVJA 2ZXBA 1OCNA 3N6HA 3RITA 1B5TA 3S2MA 4XKYB 3WD4A 3LRMA 1XLKA 3CTTA 1SUXA 4ZGYA 1PKMA 1GEHA 2J6XA 3Q65A 5BWFA 1D8WA 3CHEA 4E2DA 4CN4A 3QRHA 3GFXA 4GXMA 1IGSA 1TUFA 3DFNA 3MCNA 3GDTA 4UR9A 3PUDA 4ZO7A 3W83A 3WBWA 1UWSA 1AD1A 3S3GA 1J96A 1V0LA 5LIYX 4IHCA 1YW1A 4QLJA 3U7VA 2A21A 4DM1A 2OELA 2E77A 4LY4A 4O15A 3MSYA 5I06A 1PDZA 5FD0A 1MXDA 3F7JA 4JR5A 2A3CA 1O4UA 1TJ1A 3DFHA 1E1EA 5JQ9A 1AL7A 1UP0A 2VELA 4MPQA 4DHGA 3TJXA 3I65A 1QNSA 1I1WA 4N6FA 2AL1A 3T0CA 3ARQA 1UKTA 2CHNA 5XINA 1XL9A 4I6VA 2FHCA 3QR3A 3W38A 1EYWA 2DGAA 3HGRA 4O4VA 1HO1A 2RH9A 4M5PA 3XINA 1K1DA 3BCDA 1MXSA 3MWCA 3MMWA 4V1XA 3PPHA 1FA2A 3L4UA 5F7UA 1YYAA 4KBXA 3ZWSA 1OD8A 4JL1A 3FVDA 2PDLA 3DFOA 1XUUA 1WP6A 3EXTA 4DJDC 5A2BA 5A6JA 1GTHA 1IV8A 2HROA 3QV8A 3NSMA 3AMCA 3RFAA 4HPHA 4D72A 1XLEA 1TKKA 1SJBA 4ZOEA 1CECA 2HSAA 2ZA3A 2A6NA 1P6WA 3P93A 1OYAA 1B3XA 4YLWA 5HNNA 2HXUA 3IUDA 2VCBA 5D2WA 4QCEA 4E2VA 2BHUA 1TREA 1WAUA 5K9XA 1M3UA 2PLCA 5DQPA 3GU1A 1BF6A 1DTUA 2FVKA 3MB9A 4N4PA 4NZ3A 4NNBA 1IXNA 4FP1A 2DFAA 1Y5VA 2XH7A 4F79A 1FCVA 2J79A 1VP5A 3VIGA 4P8VA 3AXIA 1FUYA 4JX5A 3NZGA 5GVJA 3GHUA 3IIXA 5HWNA 4KEUA 4LAZA 1LYXA 3FJNA 2I16A 5DEZA 2I17A 1U2YA 2VVNA 3FVMA 2YZ5A 1JG9A 4OJYA 3N2OA 3R13A 4AZHA 3NJ3A 4DJDA 1JCNA 4PH6A 2AL2B 3QTPA 4YPJA 4XZWA 3DHPA 1EQCA 2DH3A 3ARRA 3C56A 2FB2A 2WNWA 4O1FA 1GPWA 2CZVA 2C3ZA 1I0BA 5A6LA 2QF7A 3G1YA 2DUXA 3VIMA 4A4AA 3ATZA 1UWRA 3ITGA 4L4PA 2VRJA 1U1JA 1CPUA 4O0QA 3T4WA 1PWMA 2XVKA 3KTXA 4J3ZA 3GIPA 2WHJA 3I6EA 3L23A 3VPLA 1AQMA 3JRKA 1B9ZA 1DJYA 1H7XA 4K38A 1WX0A 2PP3A 1OHLA 1IF2A 3AAMA 5A6AA 2XM1A 3W7LA 1RPKA 3A4XA 1OGGA 4LU0A 3MVIA 4F9DA 3LLFA 3HO8A 3P82A 1VENA 2ZUMA 3FEQA 4IL0A 3TOPA 1JXJA 3DHUA 1FKWA 1UCWA 3VO0A 3KL5A 3LM7A 3QJAA 4YHEA 3ANYA 1FDYA 4H19A 3DYOA 3HMJG 3CHFA 3N17A 1AMKA 2ZX6A 4KT2A 1EUNA 1VLIA 2A7RA 5FEPA 1LLZA 3S1VA 2A3HA 2YSWA 1W5OA 2D2HA 1E40A 4ZTYA 1CCWB 3G1XA 2AKZA 2ISFA 3H4WA 3WNNA 3HGOA 5HK4A 3SFKA 4Z2HA 2E6FA 3ARXA 4WX2A 3WBYA 4YVVA 2YB4A 2QDDA 3S9YA 1SO3A 3MP4A 2A6LA 5G1MA 2Y2WA 3NGFA 1JDAA 1W9XA 1I2QA 2GUYA 5BW6A 3EDKA 4HYRA 1S2AA 2XWDA 2PP1A 2J6VA 2ZRWA 3CPGA 1EFZA 1MZRA 1MUWA 4E2BA 2WZIA 3HN3A 4W8LA 1XYAA 2GUUA 3OG2A 5A5WA 4BQ5A 1OCJA 1XKJA 3C61A 4GY0A 1PHWA 5FI8A 4MKSA 3G6MA 1V6YA 3PPGA 2ACQA 1JGIA 3VDBA 1V5XA 1QPNA 3ZZ1A 3AHVA 3LTSA 2ZRXA 2QCGA 2ATMA 3V18A 3K8MA 4F0RA 3OIHA 1EJXC 3TE9A 3GRIA 3FSUA 3H12A 1LP6A 2E6DA 2Z00A 5FL1A 1IIGA 3T78A 2TYSA 4IMCA 4H1ZA 3UXKA 3TJIA 2J9XA 3HV9A 3CU2A 4MJ4A 1QJWA 2DVTA 4XD4A 3W7JA 1TMLA 4WSHA 2B31A 3W7MA 4QS5A 4F2BA 3E0LA 4RV3A 1J0ZA 1P5BA 3LS9A 1YXDA 3W86A 4I9AA 1ZALA 4X0NA 2AGTA 4NYYA 1XP3A 2DZBA 1V8EA 3VIOA 1LORA 4IQEA 6A3HA 3VDGA 3AU2A 2HNHA 2GQAA 4D6DA 4MOZA 5JUVA 4UOJA 5K4XA 1DOSA 1KKOA 1S2UA 3H8AA 3LHVA 3TYBA 1E0XA 2OEMA 4RUBA 3VIPA 1KFWA 3W23A 3VX1A 5HWJA 2J77A 1M9HA 3THQA 2YBVA 2GK1B 1UUOA 2QW5A 4PUKA 3KEHA 4LH8A 5IOBA 3W82A 3TC6A 5HOSA 1IHIA 4C60A 2ZZ2A 3ARPA 4XV0A 3WKZA 5I3FA 4HPGA 2VD9A 2E9MA 1PCKA 1R86A 1F3EA 3GDBA 3B9EA 4O1CA 4L80A 1W9PA 3CB3A 3CPUA 7ENLA 3NZRA 7CGTA 2R14A 1FHUA 3W2JA 3UNDA 3KS6A 5FAJA 2VP8A 1AH3A 2J8GA 2P1FA 3UPBA 2VZUA 2YPIA 4U2YA 2CWNA 5DXXA 4AWUA 4X9SA 3VZYA 2A7PA 1FWNA 2J9ZA 4ZENA 4J3SA 2Y0FA 3NZQA 4XTDA 3RX3A 5CC3A 2PGWA 5AN7A 4FXRA 4RPQA 3CB8A 3T08A 1HL8A 3NDYA 5CG7A 3MO4A 3S6OA 2X7WA 3WLSA 3CUHA 3LLXA 2GGEA 1KR0A 4C90A 5AKQA 4UOZA 1F05A 3BCJA 1ITQA 4XWUA 3TDFA 1GJPA 1NFPA 3IPWA 5ECVA 1LQ0A 2C18A 1THFD 3M0IA 3TMQA 4EWJA 4R5EA 1ITXA 3B9DA 1W1A1 4JS3A 1XKYA 2DPEA 3IEBA 5BMWA 3FSTA 1EJUC 1C8VA 4MF4A 4V2XA 1VFSA 1UP3A 2OSYA 1NVMA 4XB3A 2GVJA 4N9DA 1LM1A 3CZGA 3L0NA 3UG5A 1UZ1A 1NWSA 4EK7A 3MI3A 4HD5A 4PCSA 2WO5A 1Q85A 4KQNA 6XIAA 1OFDA 1TJRA 1S46A 2GVEA 2X2YA 1Z9AA 5D8ZA 5BRPA 1DTNA 4UC5A 5I3JA 2QJIA 3G3MA 4FI4A 3VILA 4P7OA 1Z3NA 1R3YA 3DHFA 3EX4A 3GTXA 3OW1A 5HPOA 5A8GA 3FXYA 1QNOA 2J7EA 4EAMA 3BG3A 4WEVX 1KWKA 2VO5A 3VNDA 1JVNA 2QIIA 1H4PA 1KRMA 1S5MA 3CQIA 5CZSA 4Q8PA 1ZS2A 1IZKA 4G7FA 4NU7A 3DAQA 4HA1A 3O6CA 3UETA 1O60A 4DQWA 1TPWA 3MBDA 2Y88A 4GGBA 1GZJA 4PRRA 3STCA 4LY8A 2QUTA 3AJXA 3W29A 3IARA 4QE4A 4NJKA 3GU2A 3PSWA 2B7QA 2RUSA 2DZVA 1X8CA 1HFBA 5BOEA 1YADA 1R3VA 2ZX7A 1TQJA 5FJJA 4MLJA 3GD6A 1K03A 1XYLA 2C13A 2G97A 4N0RA 4S2BA 2NQ9A 3NGJA 5AB3A 3UR2A 3G1AA 4FF7A 1RCOB 5FKYA 4ZFCA 2Q02A 1XLGA 1E9ZB 5EB8A 3T0DA 1M65A 3B0PA 4HCLA 3QHMA 1MWOA 2GFTA 1JPKA 4DY1A 4KGLA 3P84A 1LROA 4C6JA 5CJNA 4NJHA 4HYVA 2R8WA 2WM1A 3QSRA 3T09A 5CLWA 1ZB5A 4W8AA 4B9ZA 2YYUA 3RIKA 4GQRA 1US0A 3F5KA 4UB9A 2PDMA 3P80A 4ADUA 3B04A 5I3IA 1H7NA 3CPRA 4GE8A 1BVZA 1XRTA 2XINA 4DM2A 1Q63A 3PULA 4HNCA 4GD0A 4Y9PA 3CEPA 3M07A 4FNPA 1XFCA 1TA3B 2FZ8A 3L2MA 4X22A 1IR1A 1E5NA 4GBUA 1EP1A 2VVSA 1KTCA 4AXNA 2I9EA 2Y70A 2VUYA 4GNKB 3SFWA 4MZ1A 3WN6A 2PWFA 3S5YA 3NPUA 3CQJA 4WRHA 3AMKA 1FY6A 1F3WA 4AEFA 1LWIA 3B4YA 4TVDA 2CLMA 3USBA 3SEPA 2YXXA 5FEWA 2RGMA 6REQA 3RX2A 1EBGA 4C6LA 1KA9F 4Q7NA 1J6OA 1PL9A 3PHAA 1XH2A 4O0ZA 2AGKA 5BXTA 4LPCA 4BWLC 1DWJM 1FCQA 4QNEA 1W5QA 3DECA 3QC0A 4AAJA 4L61A 5HA7A 4GO8A 5GQBA 3QKEA 3ID7A 2O55A 3WLKX 1TB3A 3U3HA 3S6DA 3W28A 2A4AA 4GIEA 1PKYA 1UKSA 4YTQA 2V38A 5G4HC 4ONVA 1P0BA 2XJ7A 3DX5A 4JXCA 1J01A 3H7RA 4Y8EA 2V3FA 3STEA 2E8YA 4C6QA 4R88A 3PC0A 3PANA 3LHYA 2YCLA 3EOOA 2OLHA 2QKFA 3H70A 2G3IA 5BXSA 3ZLHA 1VIWA 3ZLGA 2PMQA 3VD7A 4F40A 3V4BA 1SO4A 1H2JA 4EX4A 3QFWA 4IFOA 4DXVA 4DBWA 1FH8A 4Z2LA 4C6NA 4DF0A 3MHFA 2ISDA 1KXVA 2EKGA 4HOXA 2PTYA 4W7WA 1TCDA 4BWLA 1V7YA 5I07A 2HXTA 5IDZA 3PR2A 5D33A 1VCVA 1MI3A 1NWRA 1K6WA 1NF0A 2OCZA 5IRPA 3HURA 3M41A 3NEHA 4O14A 3SUSA 1WZAA 3PBUA 3CT7A 4QP0A 4GX8A 3W25A 1CNVA 1RQHA 3EA2A 3PPCA 3AZTA 2NV9A 4W5ZA 1E6XM 3WDIA 4OU1A 4J3UA 3B05A 1PTDA 1JD7A 2ZVRA 3GDRA 4IQDA 2PB1A 3KL3A 5E70A 1YXCA 4AIBA 5A69A 1PJ9A 1I9CB 4UR8A 3TN6A 1EJTC 3URNA 2P8BA 1S5VA 3R4IA 3V5OA 1QUMA 4N2YA 4IUOA 3G18A 4GYJA 4R7OA 5BXRA 4YCOA 2NV2A 5GJMA 2NUWA 4Q4RA 5ABHA 3GX9A 1Y8BA 1Q65A 4GVGA 2BXYA 4QITA 2C15A 2RDWA 4NF7A 3B4UA 1EGVA 3MI6A 3UG8A 4A8NA 4AD0A 2BGNE 1KLZA 3TTEA 4KRZA 4QG8A 4UFIA 3USZA 3CNYA 2I56A 4O1AA 4CUCA 2P50A 1BXBA 1BWVA 1YRRA 3UZXA 1ONRA 1R7AA 2PDPA 5T26A 2B7NA 2W27A 5BOOA 4MB1A 1E4IA 8CGTA 4H7ZA 4AY8A 4N6EA 4NJGA 4XVEA 5DXYA 3ZMRA 1F5ZA 1JI1A 3G5EA 4XZNX 3W73A 2FKPA 1V0KA 1UH4A 2PTDA 4NXKA 1GVEA 4A3RA 3R25A 2CFFA 2EKCA 3ZJ6A 1Q6RA 4YHGA 4GYPC 1K7EA 2XN2A 4XSLA 2FMNA 3KCLA 3BMWA 4S3KA 5AHFA 4H6KA 1UD6A 4H7CA 4K7YA 1R87A 3CL6A 2E8ZA 4WDXA 1JGMA 1XISA 1EIBA 3HQNA 1XIMA 5AHMA 1EL3A 3WNPA 3NIYA 1H41A 3TTYA 3H21A 1GOQA 1TTIA 2EHHA 5HJLA 3VUSA 3T4CA 3GDKA 4KEVA 3H23A 3OODA 1A5SA 1TV3A 3T0TA 2ZZ5A 2CNCA 1TSIA 3E9AA 3N14A 2HMCA 5LSMA 2RAGA 1AH0A 1YHTA 3IJ8A 1BRLA 3V5FA 4NZ1A 1OFBA 1TWZA 4UTHA 2BOEX 4A35A 3CV6A 1E6SM 2WJDA 5HQLA 2ZZ1A 4HSNA 2UY5A 3AZRA 3VYLA 3TNBA 2WXDM 1GOKA 1RA0A 2E5CA 5HR7A 2Q3OA 3OLDA 3TSMA 4ILSA 3M0MA 3RO6A 3R89A 2BMBA 4ZEPA 3W7KA 1XLCA 4GYPA 3GTFA 2YYTA 1AW1A 3MSGA 4GKLA 5G5IA 3KBWA 5RUBA 3NPVA 1LL7A 6REQB 3L4XA 4NJIA 1SO5A 2WMKA 2FZDA 5H2ZA 2CBVA 4Y9OA 4M24A 4PRWA 1B3VA 2ZUVA 2ZXQA 1DQWA 1S3TC 4I8DA 1XM3A 1PB0A 1I4NA 2FIQA 3EDEA 2ZXDA 3BOXA 2PDHA 3KHJA 3TQPA 3SO7A 4CN1A 3BJTA 2VC5A 1BYCA 1DQUA 3GTNA 2J9YA 1PBGA 4Z1CA 1ISZA 3W7QA 1Q6CA 1UC4A 4KESA 1OT1A 4UXDA 2JF6A 1GKRA 3UGVA 2QCDB 4S3FA 3NO3A 4DRSA 5A6BA 2VDHA 1E9IA 2O4MA 1E51A 3L4VA 2EPMX 3NO5A 2NT0A 4UUIA 1E70M 1NF7A 3C2RA 2CLLA 1FDJA 3UJ2A 2FGLA 1CXLA 5BMXA 1GG0A 9RUBA 1C91A 3UXAA 4QEEA 4C5YA 1QBBA 1VFHA 1HO4A 1JD9A 4PUEA 1P0KA 4I90A 2OWWA 4V27A 2YDAA 2BY1A 3WO8A 2CXEA 1JI2A 4R33A 5F2MA 1F9CA 3W7DA 2NT1A 4US5D 3KW3A 2WMGA 2BZNA 4QAIA 2H8ZA 1XI3A 1XICA 2DT3A 1YIXA 4FF5A 2QIWA 3R58A 3B8IA 3PZNA 4G6CA 5E0CA 4S3CA 2ZCGA 1ODZA 3QPYA 5AFDA 3A4AA 5DANA 4X3ZA 4ICNA 1C9DA 4UOQA 3ZR6A 4TUFA 4US6A 2FPTA 3SI9A 3H2EA 3RYSA 5JMUA 4B5SA 1HT6A 2GQ8A 2HVNA 4XBKA 1ZAHA 1V3KA 1PX8A 1BSLA 1DJNA 3BE7A 3HG2A 5GNZA 3UU0A 3UZWA 1QRQA 1RLCL 1XQLA 1A0EA 2D0HA 3WBXA 1EF2A 2OU4A 4U10A 1YE6A 3ZWTA 1GORA 1QASA 4QNWA 1SZFA 3V1HA 5HANA 4LTSA 1R3QA 3UVAA 3FDKA 5IFPA 3ELFA 4REQB 1RXOB 1OF8A 2DY3A 3MCMA 2D2JA 1GW1A 2YKKA 3OVGA 3IAQA 3ITXA 1JZ3A 3CAWA 3G24A 3U2OA 3PF3A 2ZA2A 1GG1A 3VMNA 3KBJA 4H9YA 1BXCA 4ADSA 1MRAA 4JNMA 1WQ5A 2VFHA 4HK5A 3HG3A 5E5CA 3VFLA 4DNHA 2JKPA 1XDJA 4IIBA 1M6JA 1SW3A 3SUWA 3LRLA 4AD3A 2AKMA 3SCUA 2V9DA 1VPXA 3OLGA 3LNPA 3QY8A 4GZJA 4UTKA 1B9BA 1P4CA 1D7KA 3DXIA 3DI0A 2DQWA 3S2CA 3H4XA 2QPSA 1PYFA 3QMSA 2NZLA 5C9ZA 3J7HA 4A05A 3UJEA 3DG6A 3E2VA 1K02A 4H4IA 4A2RA 5I77A 4LB3A 4HNVA 3WFLA 3QYSA 3KTSA 3WQ6A 5CZTA 2I9UA 2XM2A 4U31A 3H2OA 2HCVA 2IPJA 2ZX9A 3GIQA 5C6MA 2NUYA 3SUUA 3K4WA 3GXNA 3THAA 5DN1A 3SURA 1DXIA 4B2DD 2GGGA 3T0BA 3CZ8A 3FGCB 3WJYA 1YBQB 2J13A 4QXIA 4LUYA 3T05A 1E4MM 1SVDA 2V81A 3YPIA 3R94A 3E02A 4HA4A 3S5NA 1VBRA 2WMIA 1TPEA 4L6DA 4OFCA 4OOUA 4O50A 5AECA 1EP3A 4C6IA 2R1PA 3GKAA 3LDVA 3B8WA 3LYEA 3QVQA 5A94A 5I3KA 2GSJA 4YCPA 3XISA 2QR6A 1XLLA 3AWOA 1JYVA 5E93A 2DZUA 5E0FA 1FKXA 1SMDA 3FY1A 3ZVHB 5IHSA 1QOXA 2PU0A 1NQ6A 1LCOA 1S2TA 2VNCA 3TW7A 2X1UA 3LCXA 4WDUA 2XVPA 4POCA 4IICA 3WLPA 4XX6A 1CEOA 3QY7A 1GJUA 1MO0A 1O1ZA 4OBRA 5EY5A 3PFMA 1G7UA 1ECEA 1KBBA 2PU1A 3O7UA 1JR1A 2D73A 3W7EA 1R9ZA 1JFHA 3QZEA 2WVSA 4JIHA 2Z24A 5CPMA 3SSZA 2OLAA 3TR9A 1SQ7A 1KGXA 5DRCA 3B3DA 2WMFA 4CCCA 3APYA 5A2AA 4UTIA 4G1KA 2X1IA 1CZ1A 3F4VA 2A3EA 3PM6A 2GDQA 1SJDA 1KV5A 3VM7A 2D3NA 9CGTA 4Q22A 4WGXA 4AX7A 4WSKA 4HNLA 3GTIA 1DJXA 2PRLA 1CXKA 4E8GA 4H7VA 5G4WA 4P7RA 3KP1A 5M3WA 1VEPA 1GVRA 4MKVA 3R7MA 6TIMA 5ENLA 1VRDA 3SY8A 4Q7IA 2J78A 1P1MA 1FCBA 1XBXA 2JKEA 4GQGA 3BLLA 2QUMA 1ZP3A 4Z0SA 3SIZA 4ZB2A 3DKJA 2CZEA 2OEJA 1AUSL 5TD4A 4ENLA 4PN2A 3W37A 1T40A 3WK2A 1HKJA 1FXPA 3NTYA 3AS3A 2PP0A 2GPTA 1ZBVA 2CLPA 4XAZA 1FHLA 3MSDA 3E74A 3UJRA 1RJPA 3SGUA 3WJXA 3M6YA 6ENLA 2I57A 2Y89A 5D9MA 2QCEA 2ZOXA 2PURA 4PMRA 3TLQA 5I3DA 2BVYA 2ACUA 2ESCA 2F6XA 4PMNA 4E4PA 2WYSA 4HSOA 3CASA 1RV8A 3GH5A 4AIEA 3BOLA 4DJED 2WC4A 4MWAC 2ZE3A 4OWGA 1XBVA 2POZA 2WLYA 1HL2A 3ITYA 3APGA 3HG5A 1PVNA 1JYXA 1XD1A 5AVNA 3I6TA 3LCGA 3SIMA 3WQPA 1C29A 4QJ1A 3TTQA 5GNYA 2FHFA 4GJIA 3C86A 2JE8A 3DUGA 2PCEA 3G1SA 1E71M 4NZ5A 4GQBA 3QZ6A 1K3UA 3MBFA 3CL7A 3PZQA 4PRTA 1LLWA 1U5JA 1GPFA 4GCXA 3HFYA 4GG9A 2R1KA 4D6FA 1YX1A 2DEPA 2DVUA 5EFDA 2FMOA 2Y8KA 3AIRA 3TFXA 1V93A 3LCIA 1ONXA 1FWAC 1L6SA 4IPJA 4W93A 1KM4A 2NXGA 5D2XA 1PIIA 3SGGA 2VGFA 1OYCA 1QNRA 3SZ8A 4FXFA 4FXJA 4LYQA 1ADDA 2EO7A 3FNDA 5G2WA 2BY3A 1XV8A 3NG3A 4MWAA 3WDPP 1SSGA 3ABSA 3LTPA 3SCNA 1XYBA 1LRNA 4IIGA 2CXGA 3BGJA 1HJVA 4HMCA 2DZSA 4FOKA 4YYCA 1Q7QA 2WQDA 5LHFA 2HNEA 4P8XA 4YIWA 1IT8A 2A0NA 2P8CA 3PZ9A 4UNLA 3PZMA 2Y6ZA 3ITTA 4GCAA 4Q4PA 4QX4A 3M4HA 3WLJA 5ABFA 3HQOA 3W02A 4PUJA 4DYEA 3LEPA 2VI0A 1UIPA 4Q8MA 1J10A 1DXFA 2W92A 5A1AA 2NVCA 3STPA 3IGSA 3NURA 3O9NA 1ESWA 1F76A 4JTHA 1J8VA 4K8EA 4RZ4A 2WZHA 4KRTA 4OT7A 4GY1A 4E4FA 2MANA 4O52A 1J2WA 3NAVA 1RY8A 1TR9A 1FWWA 4KCVA 4K6AA 4AUBA 4JIQA 3SRHA 3A9BA 1A47A 2WCSA 2WMIB 1OX4B 1H5YA 3CHVA 1A0DA 5HQEA 1EJVC 4I5XA 1XLMA 3M5ZA 2DUZA 3O15A 2ZX8A 4PCFA 2OSXA 4FHAA 4QSFA 1JZ8A 1POKA 1PXGA 3DU0A 3WFAA 4P02B 2O0TA 2RDTA 3FA5A 3AHZA 1J5TA 4GACA 4W9TA 1QHZA 3THDA 3ZOAA 4I3GA 4YYFA 1VFFA 3VD4A 3LI1A 4WQ6A 5FA5A 5KETA 4MYAA 4DBDA 3UPWA 3PVFA 4TX6A 5HXMA 3VX0A 3RCNA 4IMFA 4HK6A 4A22A 5C0QA 1HJWA 1BLIA 1F8IA 1XLFA 2YA2A 3AXXA 1ONWA 5AOUA 1KM2A 4QTGA 1E73M 1R3SA 3QOMA 1KCLA 5FSDC 3VKAA 1DORA 1FCUA 3Q58A 4PBFA 4L4LA 3MUCA 4ZB0A 4MHBA 3BZJA 6CGTA 1E6ZA 4AZIA 1XIDA 5C7VA 5U4NA 3AC0A 1E9LA 3V0TA 1MSSA 1TYGA 1N7KA 3EAUA 1OGSA 5FF3A 2EF9A 3KRUA 1ZJHA 3QZAA 1ME8A 3IVTA 3UCDA 3TV8A 3W2UA 3NSXA 3CUJA 3IUIA 2Z7GA 4H9VA 4QHRA 4LGXA 3WD2A 2MNRA 2VEIA 1KM1A 3UJSA 2AQWA 4Z17A 3EPMA 1UZ4A 3BAKA 3FYYA 2IKHA 1TIMA 1Q7ZA 1WXYA 3FAXA 4E2OA 2Y8VA 4PMZA 4DUVA 4A3YA 3MUZ1 3TFCA 1E1FA 3LERA 3GM8A 1DJHA 3RF9A 3WQ5A 3HPAA 2Z7KA 1ZNNA 1Z8AA 1EDQA 3IGUA 4W85A 2E1DA 4ES4A 1O68A 3CIXA 2G37A 1GOIA 2BWGA 4DZHA 3T1GA 1SM9A 3MUXA 1W1TA 1X8FA 1A4MA 2VZOA 1A5UA 2CITA 3PNZA 1W3NA 3ALFA 3MU7A 2R91A 4UR7A 4I7UA 2QDGA 1NWUA 1B3YA 2DP3A 1RHCA 4NNCA 4ZODA 1EXBA 5FJPA 2VURA 4G9PA 2E5BA 1NU5A 3GW0A 3OBEA 2CESA 3LCWA 4CVUA 5CC7A 5EMJA 4AMAA 3LSBA 2WSQA 4Z08A 3U6WA 2V0TA 4LSBA 1FBAA 4RNFA 1AODA 2VCAA 5HMEA 3P0XA 3I7QA 1IQ8A 1N55A 4GISA 2FZBA 4FIRA 1FWHC 3C52A 4Q33A 1W91A 1HGWA 4ZO9A 5L9FA 5HPCA 1UA7A 4EPEC 4S3EA 4HNOA 3HGSA 4BY3A 2IQDA 2QVHA 4QJ3B 3WD0A 3N04A 3MV01 3RMJA 1Q8JA 3LN3A 4U33A 3ZS4A 3H2MA 3P0WA 3SUTA 2UBPC 2Z1VA 3AHTA 4UFKA 1DKWA 2FJKA 3CAQA 1HJQA 5EMMA 4C6FA 1MDRA 1OFEA 4RL3A 4XZBA 1CWYA 4I5UA 3QW3A 3G1VA 1J9YA 3DCPA 1DWHM 5K7JA 1HKIA 1WA3A 5A8OA 4IM4A 2V5JA 3VGFA 1XLAA 3D0CA 4ML9A 4H01A 2Z0IA 2V67A 4CNNA 1IXQA 3T40A 2G3NA 3W88A 3FHQA 1OX6A 3PZIA 2GWNA 1EBHA 2R24A 1JDEA 3UCQA 3BZGA 1W5MA 4KPLA 1XIEA 3UXIA 4DF2A 3WF0A 4PUMA 3OPSA 3VIHA 1R3WA 3W53A 4RK8A 5D05A 3GXTA 4ADTA 2O9OA 2J75A 1HZYA 1VQTA 1Q7MA 2PRMA 2OR2A 1B1YA 3BG9A 3E12A 5ABFB 3BL3A 1XD0A 4AIOA 1VPQA 1VH7A 3VAVA 4PYSA 2OYLA 2WJFA 3CQHA 4AF0A 1JCYA 4PMQA 1FWDC 1WOAA 3LGGA 1CYGA 1H51A 1DIOA 1GKPA 3E0IA 1J93A 1M7XA 4P7LA 3A21A 5GJPA 2F7FA 4J2MA 3TH6A 3MT1A 1W8SA 4MNLA 4C6MA 4C5ZA 3KBSA 1XYFA 4H8VA 3IJ6A 3BWWA 1J12A 4FXSA 3WUBA 5F1VA 2X1SA 3QQ1A 4QJ5B 1XSKA 2WC3A 4E3VA 5LIXX 3H53A 4RPPA 1AQFA 4QE5A 2BB0A 2OKOA 2QS8A 3BLKA 4PEKA 2PWDA 3P2VA 1PS9A 5J8LA 3MI2A 2ODOA 1MW2A 4DF1A 1Z48A 4TX8A 4ZCWA 3SCWA 4MG4A 1QOQA 3OOQA 1TX0A 1B57A 1UR8A 5I03A 5D04C 5CPLA 3SCTA 4AEEA 4QAWA 4BF9A 1GKQA 3BOFA 4D1IA 2CC0A 4QG9A 1F6KA 3TQVA 4NVTA 3VNYA 2W6RA 3NOEA 1UC5A 2BY2A 3M5XA 1HIZA 1EXPA 2QVNA 2CCRA 7XIMA 1XRVA 1UR1A 1HP5A 4AWEA 2FZ9A 3R10A 2VL4A 3DBNA 5CCZA 4GO9A 1B2YA 1KXQA 5LYRA 1UPMB 2PDKA 1NJJA 1S2CA 2ZE0A 4XIAA 1NFBA 2OVLA 3GBDA 1N8WA 4B9YA 4DBUA 2TPSA 5FCZA 1RY0A 2IXUA 4LRTA 1WBHA 2D23A 3VVGA 5CBBA 3CUGA 3B8VA 5D8WA 2VZVA 4LANA 5LIKX 5G4EA 3EA3A 1Q6QA 3M0YA 5JXQA 3P6LA 4JTUA 2E6YA 1PPIA 3SGZA 1ZSXA 2P3EA 3BQ6A 2INEA 4HZ6A 3DFQA 1ECQA 1EZWA 4N9EA 3FA4A 4DVOA 5HMSA 3T42A 4EXQA 3OIXA 3GB6A 3V35A 4JTDA 3KX6A 3KWXA 1UYQA 6PTDA 4BI5A 4XIMA 1EC7A 1K7FA 3RJXA 3M64A 1LUCB 1N82A 1LRTA 3WDHA 1A3WA 3NQ7A 4HSHA 5AYXA 4JFVA 4M51A 4PTMA 5A6TC 1QPQA 3H7UA 2WM0A 5KSWA 3OHMB 2CHRA 1REQA 1RPXA 3TC7A 3IIVA 3G2GA 1SU5A 3AYRA 3MKVA 4ECLA 3SBFA 1BGAA 4MDOA 4KFOA 1XLBA 5LNRA 3UW6A 4ROQA 3WLHA 4YWSA 1DL3A 3AALA 3UYCA 1BAGA 2IW0A 1UZDA 2RKXA 3QW4B 1GOXA 3UGRA 4XK2A 4GVHA 1VJIA 2YZRA 4JN8A 4HN8A 4LT9A 4IP4A 4WUIA 5REQA 3NQEA 3N25A 4DZ5A 2QMKA 1ENUA 1EIXA 1ZRQA 4DI9A 4XAFA 4IX2A 5I79A 4ACZB 2NV1A 3NYDA 3EWDA 1PIGA 2A5HA 1U1UA 3W2MA 3FA3A 3EOSA 2J88A 2PA6A 5IXEA 2PZ0A 2I1OA 1RJRA 1ICQA 2Y5SA 1FWJC 3IJ7A 5K3VA 3TU9A 1HN1A 4O11A 4GJ1A 5TAOA 4XTIA 1EDGA 1ITCA 1L2QA 1QFEA 3U8GA 2CZ5A 1IXOA 4RE0A 2CKSA 3N18A 1R0MA 2GDUA 3ES7A 2WSKA 2XIIA 2J66A 4JFSA 1F73A 1O5XA 1JFXA 5KZMA 4MIMA 1OCBA 2G50A 2C71A 3KM8A 1BTCA 4O4WA 4HBKA 3QM3A 1UH3A 2PDXA 3L5MA 4JCMA 2X05A 2VR2A 3VGBA 1B30A 1QI4A 3G8RA 1OM0A 3L4WA 4WJXA 3UA3A 3QKZA 4O16A 1DIKA 3N9SA 4LUSA 3ZSSA 4LYPA 3QLDA 5FACA 2QMJA 5FESA 3HZ3A 3E2SA 2W79A 2XSXA 1TWIA 1W32A 1MRQA 2Q09A 4JY9A 4YVXA 2WSYA 4EF8A 1CLVA 3R1ZA 3TA6A 1MVYA 1DJQA 1EPVA 4DJFD 1GUVA 5AC8A 5AYZA 3S1XA 1POJA 4Z2IA 4PB5A 1KV8A 4IJCA 3IIPA 4N9BA 3IV3A 2NVAA 1W9DM 1SPQA 3VOJA 3DGBA 3LQLA 4AF0B 3OGVA 1OFQA 1J0HA 3NA8A 4JQAA 3P67A 4HG6B 2HBXA 4GI8A 2VZTA 1JZ7A 1YXYA 1UJPA 2G3MA 3OLIA 1VFTA 3W9ZA 4HA0A 3GXIA 3BG5A 2J27A 1JDDA 4W5UA 4AZ6A 5I3HA 1QWGA 3N2BA 3DEQA 1RVGA 4EPBC 2HVMA 3VKCA 4DXKA 4AFYA 3UWWA 3UR5A 4CEXC 3GNPA 2Q71A 2GJXB 2BG5A 4DI8A 1H09A 3QHNA 5EU9A 3EB3A 4DLFA 3R2GA 3S0CA 3CYJA 3OQEA 2V5KA 1BD0A 3ISIX 4D6EA 4AYGA 4XISA 1Y5XA 1WV2A 2SFPA 1QNVA 4EP8C 3TW9A 3M44A 1SW0A 5E1QA 4CQDA 1K4HA 3ZXWA 4AVFA 1TPVA 1OC6A 3OGSA 2P88A 1RD6A 4IPIA 1OFRA 1UKQA 3F4DA 2F6UA 4AEOA 1G01A 3OO2A 4GUFA 1R7OA 1KTNA 3FCPA 4QSHA 3MW7A 1CB7B 4UCFA 3PBMA 3K30A 3VU2A 3UWVA 2FB3A 1RK6A 1QNPA 4BF5A 4Q6JA 4MYXA 2CLIA 4FS9A 1J6PA 2OB3A 2YCIX 2ALRA 5B80A 3IJIA 2MUCA 3JU2A 4TV6A 5BOFA 1OINA 3LGDA 2OWCA 2J7BA 1YKWA 3GDLA 4K37A 2GJRA 3AISA 3AMLA 3JR2A 1DPMA 3L4YA 4LAUA 4WKAA 3KRBA 1CI1A 3OYXA 4O57A 4N7QA 3I10A 1LF1A 3P8IA 3C2OA 5DMMA 4GI4A 4CD4A 4Y9AA 4U3AA 3UWYA 3MZNA 3PPFA 1JUKA 3BC9A 4BHYA 2Y7EA 3DI1A 4N02A 3FFSA 3WQ4A 4JKMA 3CHCA 1ADSA 4HZ8A 2PC4A 3KDNA 5HNTA 4AZCB 3SN1A 4L64A 2YBTA 1ISXA 2OLSA 5D4YA 1IR2A 1B54A 4CVWA 3GHSA 2I5GA 4MFDA 3SB0A 3RPDA 5CPTA 4QLKA 4CNOA 3EWZA 2AOSA 2KZHA 3KVLA 4GVIA 1PCWA 3GVWA 2H8XA 3LRKA 3POHA 1M04A 3NQMA 4HN4A 4Q4SA 3BLOA 1J18A 3AJ7A 4H8HA 2VGGA 3I6RA 4O0KA 2QCLA 1G4PA 1ZU8A 4M6UA 2BS9A 3W0KA 2YX0A 4HU4A 5AC7A 4WXYA 3V7PA 1YNQA 5D09A 1EA9C 1MNSA 3KUMA 4YN5A 5REQB 4KEMA 1BVNP 4M81A 5EYWA 1EQPA 3WQDA 4KWWA 2OOGA 2PDNA 3LUTA 2ICSA 4XAYA 3PBWA 1KTBA 1JPIA 3NL6A 4KWUA 3K4DA 3W24A 4MZYA 4BK9A 4D8LA 5JVLA 1Z41A 5CGMA 1HKWA 2XU2A 2J7GA 2J62A 4ZQNA 3CAKA 1G4EA 1QTWA 4DZAA 1UWIA 4QS6A 2W67A 4WOZA 1R8LA 3GR7A 4HPNA 2V30A 4OUIA 1JPHA 3OZPA 1TUXA 1TE1A 4BR1A 4AD4A 4Q8NA 1J5SA 4JQ4A 2FH8A 2RDUA 4PULA 3S5OA 2UY2A 2Z2UA 4Q8WA 1DBTA 4KMQA 1TV7A 4NASA 1HNYA 1V3LA 1XWYA 2OJPA 1W37A 1K7XA 3VK5A 2GJLA 4Y7EA 1X97A 4O8RA 1EWDA 1KFEA 2RJHA 3L65A 1K8XA 3CMFA 3DYPA 2EG8A 2C0HA 3BW2A 2QJMA 2WKLA 3M0JA 1O5RA 3KP0A 3VKKA 3OB8A 3REQA 3KZSA 4NKCA 2EAWA 1TTQA 3VGGA 4AD5A 4HTYA 4WSJA 1X38A 4F48A 3GG7A 2BOFX 3N13A 3TLLA 1C7TA 3O6AA 3R8GA 3UFYA 2WKJA 5CJ5A 3D5HA 2YW4A 4WY0B 2W63A 3GS6A 5EA9A 2O4QA 1K70A 3B0YA 4MWAE 1EPXA 4PMJA 1XPYA 1JUEA 4G1NA 2V82A 3F4NA 4S38A 4QDMA 1KFCA 1PYMA 3AQUA 2Y7GA 4M0XA 1KNWA 1AVAA 3LHTA 1E15A 3ARYA 1WDSA 4M7TA 3TC3A 1TPC1 3A3WA 4CQ8A 1KRCC 4FALA 3RG6A 1LJYA 2HRWA 3LQGA 4CCZA 1C7SA 3G1FA 3W71A 1NP0A 4HJWA 4B5VA 2XIJA 3G22A 4L9ZA 3WUGA 3C3NA 4B91A 4GUJA 5EMLA 4HGXA 3TN4A 4WKFA 3QGVA 1LG2A 1OX5A 4HT3A 3XIMA 2WZTA 2J8FA 1DVJA 4AZBA 2OO0A 3I3EA 2GQ3A 1ZY9A 3VOFA 1OBAA 3C2EA 3M0LA 3CZEA 1G4SA 3ITOA 2BXZA 4TTUA 1K9DA 4E5TA 4M6QA 1OZQA 1WDRA 3K46A 1ZZMA 4HMNA 3L21A 3NWRA 1XLJA 1NDZA 3PBGA 1R2TA 4TO8A 3GAYA 3H2CA 4S3GA 1UR2A 2GVYA 1WYIA 3MDWA 1BG9A 5C70A 3CJPA 3MANA 3QGKC 5J5RA 4AU0A 5IFTA 4E4UA 1X98A 4HVXA 1XDLA 2JGYA 3GO2A 3A5FA 4KCUA 5LKYA 2WQPA 3W7IA 1P0NA 4Z42C 1XF0A 1VZWA 4LALA 2XG9A 3NM3A 5FEZA 4LVFA 4XUGA 2CKRA 1JAKA 1WKYA 2Q6ZA 4C91A 1E0VA 1QR7A 1HF6A 3TKFA 2HE8A 3IK2A 3WBAA 1ODUA 1FWSA 1E6QM 4MKNA 1UD8A 2X41A 3N4EA 2PWEA 4FB7A 2W9MA 3HPFA 3RPMA 4WKHA 3TWAA 2VRQA 5H8UA 3N15A 1GOOA 1UROA 2BP1A 1A53A 3ZT7A 2FTYA 2BV9A 3EWUA 1FWGC 1XR2A 3GG0A 3EGJA 4I6KA 4X9YA 5I3GA 3QOKA 1VS1A 3EYPA 3NXLA 3QEZA 3BO9A 1Z44A 1XBYA 1K8CA 3KFTA 5CPNA 1E72M 3H2AA 3LGEA 1GQJA 1QHOA 1SJCA 1IEWA 5H1WA 2VRKA 5FF0A 1VJZA 4CCDA 3A23A 3T8QA 4UTTC 4E6MA 4B5TA 3VKBA 4CQCA 3S46A 4M80A 3N9KA 2VD8A 3EWBX 2Y4SA 4JQ2A 4FNRA 2GJNA 3SRKA 3WF4A 5LNUA 5AHEA 3CLWA 1FWIC 1QHPA 1XIBA 3M1ZA 1F3XA 1AH4A 4PTXA 1IWAA 4E3TA 2HE5A 3FEMA 4WY0F 3W74A 3WG6A 4V33A 1MQRA 2GGIA 3KDOA 4QG6A 3RK8A 4C65A 4K1WA 2WWCA 1DJZA 1LT8A 4AW7A 2HVOA 3URAA 1LBFA 3H4GA 4ATDA 4CQBA 1Z6KA 1BKHA 4Z2KA 2Z4GA 2ZVIA 4L56A 3RGTA 1E9YB 3CEUA 5EFFA 1V3HA 3WK3A 4EANA 4GQQA 3BLPX 1CB2A 1UR0A 1WDDA 3CS2A 3SJ3A 1MNZA 3CGTA 3JZEA 4RNIA 4JQ3A 1B3WA 1QPRA 3VI2A 1U1HA 3HV8A 1VFUA 3V5CA 2R94A 1TV2A 3MZ2A 2UY3A 3N2CA 4GFSA 4UQBA 1UD2A 2V2HA 4MUPA 1EWEA 3BH4A 4UTTA 3WX7A 1ICSA 4AXKA 2REQA 3QPZA 3NO1A 2BSLA 1H60A 1A5AA 3L67A 3VDCA 4B3KA 5CBJA 1MQQA 2VQTA 2D69A 4MJZA 4DWSB 1O95A 3B8UA 4B4HA 3GH7A 2W61A 4C1NA 3WLMA 5HUPA 3W6YA 3MQTA 4CQ9A 3E0FA 1NY1A 3GXMA 3E5PA 4DYKA 1EC9A 4XAGA 1KGUA 2VOTA 3I68A 1GQIA 1AW2A 3BAJA 5C9WA 3N2MA 3REQB 1EGMA 5DMYA 2A1YA 2GDVA 3W27A 1NDWA 1E0TA 1HG3A 1YTDA 1I45A 2OGJA 3JW7A 1E4LA 5FAGA 2CZFA 4TV5A 2ZUWA 2Z6IA 2QV5A 3NSNA 4LYRA 1I8JA 2HS8A 4Z1DA 3DIPA 1H7PA 5I78A 2B4GA 2DT0A 4IT1A 3BLEA 4FMVA 4RLIA 1YNYA 1VBGA 4K2SA 4BFAA 3V1PA 3L68A 2DV0A 2QCCA 5D9NA 3LLDA 2ISSA 1JPDX 1WPCA 2YB1A 3BAWA 4CNSA 4DUOA 2Z26A 1OFPA 3VC5A 4H00A 1JL8A 4E8CA 5M1TA 4W86A 2VEGA 1UOZA 2JQXA 3NZ1A 3CHDA 3R0DA 1SR9A 3SCPA 1UPPA 3UA4A 2GQ9A 1GYLA 1VBUA 1VCFA 2DZTA 3M0VA 1CIUA 2Y1HA 4LVGA 4LRSA 1RJQA 5FL0A 5LNVA 3QV6A 1W1ZA 2NQZA 4GK8A 2ZUSA 5IBXC 1W56A 4JKLA 5EMYA 5AC6A 2F61A 8TIMA 1UMYA 5BRQA 1JYWA 3S9ZA 2PTXA 2H3DA 5JBFA 1XC4A 3RR4A 3DESA 1NOUA 1GYNA 2ZDSA 3AUJA 4GVFA 1E3XA 1UW9A 3W85A 3M0XA 4Q7BA 2QV4A 1YPIA 3V36A 4P8UA 1XGZA 4Z1AA 5JU6A 1A5MC 3VKJA 2WNZA 4CEUC 2CBUA 3WH6A 2FTPA 1A80A 4IPNB 1W1PA 2P0IA 3CUXA 2G96A 2KX9A 2DT2A 4HZMA 2QCMA 1QXLA 3C0LA 4NZ4A 2E40A 4BEUA 3A5VA 3KOZA 3UVIA 2BVDA 5AYIA 1DWAM 4GZIA 1PTGA 3O07A 4TIMA 5F4XA 4HMEA 1WXZA 3K13A 3N3MA 3FJ6A 3ANVA 3LPFA 4IFKA 4D6JA 4W84A 3ZM8A 4PL1A 2E1WA 1W3TA 3TMLA 1RQBA 4YS1A 4HQVA 2PWHA 2GVLA 3TOYA 1GQKA 1UB3A 2QCHA 1GHSA 5C5YA 5IBXA 3ABZA 1ZBKA 4A3HA 3A6OA 7REQA 3P60A 4WDWA 4ORMA 4DPPA 3B03A 3TCEA 4GKTA 1HKMA 5ABTA 2V3GA 4HNNA 4BF7A 4IPPA 2VJXA 2E9BA 2TMDA 5EBAA 3T44A 4PMXA 1XCXA 3W75A 1RP8A 1OGBA 1DV7A 3G1DA 4JEJA 1Q6GA 2FZMA 1MW3A 2FDMA 4O17A 4WGHA 3FJ4A 2OOFA 4O1DA 2G8ZA 1CGWA 3BUVA 8A3HA 1AQ0A 4PMDA 4XAPA 4Q6XA 4L5ZA 2E4TA 1WO2A 4US5A 1BYBA 3ORWA 1WZMA 3NL5A 2CLHA 4I7WA 3PS7A 5D2TA 3UR7A 3UZ5A 3QTGA 3W70A 5A8PA 4N42A 4X0VA 5KZEA 1GOMA 3GLCA 3WJWA 3CO4A 4W7UA 4JGDA 1Z69A 2R1NA 1ZBCA 4DUXA 3GYEA 4B5NA 2V3EA 4O1EA 3RHGA 1WDPA 3U5YA 1VBJA 1ALDA 4HCHA 3VXGA 4JBRA 4ZQMA 3I4KA 4HNTA 1QAPA 4A3UA 3WEMA 1HJXA 1UHVA 5A6SA 3L9CA 3ONCA 1J0IA 3UG4A 1XCFA 4HHPA 3A3XA 1VKFA 3FV9A 2UZ9A 2ZRVA 4M6VA 5HNUA 4UWMA 4KF1A 2HEJA 5LHEA 1UKOA 4JCLA 1N8FA 1NARA 3SRFA 2OODA 1PTAA 4O54A 1V6VA 4UFMA 2PEVA 3FDGA 4JZ5A 3O6DA 5D2VA 2BASA 2REQB 4R7JA 2UV8G 1CXFA 3C0QA 4FX8A 3BLDA 3U2ZA 4MJMA 1P1XA 3P5ZA 1V6TA 3JUGA 4J3TA 3W1UA 2J7CA 4ZQCA 1QI2A 1XGDA 4AZ5A 1EC8A 3BAIA 4QBXA 3CTLA 3W6LA 2NQJA 4QDWA 3QR0A 4J35A 2XFYA 3G0SA 3B9OA 1NFGA 1M41A 1G1YA 4J2PA 3I3DA 1NH6A 2E9LA 1YLVA 4PUUA 4KGJA 4FOUA 4D6GA 2DSKA 3M46A 5JH1A 1IZCA 3CIWA 4LBRA 1P7TA 2AQVA 3AWNA 2X2GA 4HYWA 1IEVA 5D37A 4K8HA 3DYMA 4D9PA 3RM9A 4TXEA 3W1RA 1EDTA 2D1ZA 5LA1A 1TJ2A 3HU7A 4L65A 2X1TA 3OLEA 4NAEA 2ZTKA 3ZYZA 3ZJKA 3EPOA 2CERA 2VC7A 1L9WA 3GVGA 1WCGA 1SSDA 3RLVA 4RJEA 3P62A 2YL6A 2KAUC 3PK7A 3TYDA 4LNCA 3G1RA 3HTWA 2YBUA 1HL9A 4DUWA 1ME9A 1UZHA 5F2LA 2LLEA 3MS8A 1TJ0A 3NQBA 3G8EA 5CGTA 1TMQA 3KLLA 4JTGA 4WOQA 2ZUTA 1JEZA 2VT0A 2X7VA 2A7NA 2X09A 3A24A 3NL2A 1JZ4A 3VTRA 5MF5A 4NYUA 5HJXA 4IIFA 1W9BM 3MO7A 3GU9A 2DZPA 4B2DA 4KIEA 4MWAD 1ZFJA 2G4FA 1CGYA 4JTIA 5AHNA 2OXNA 1G5AA 3UZYA 3UY8A 3CZLA 5H8MA 4PMVA 4AHQA 1H61A 1D7FA 1B3OA 1DJWA 4YTUA 2OTDA 5I09A 1YPXA 1JUBA 3LB0A 2TSYA 2HPIA 1S3HA 1JDCA 3CLMA 4H9XA 5CSUA 3L2IA 4XD5A 4Z1BA 4WD0A 4NT0A 1Q6OA 1NSJA 2PWVA 2TAAA 4DELA 5F2IA 4L9XA 4L6HA 4L1GA 3QLLA 4C7GA 1Q66A 3CWOX 2YA0A 4FX6M 4OE7A 3UZJA 1BWLA 3WYZA 1OIMA 1NOWA 1A5NC 1VB9A 1XFBA 3WMBA 3CMJA 1U22A 3UWEA 1G7VA 1QK0A 1GWJA 6XIMA 2DIKA 7TIMA 3TXVA 3HM7A 2GWGA 1LZOA 1I60A 3TJLA 3G0XA 5C9UA 3CWHA 5HDRA 5A6MA 4IP5A 5B7YA 3P61A 3W2KA 1W54A 3UWZA 3VMOA 4EE9A 4FNQA 3OVQA 5H91A 3SAZA 1D2KA 2PBGA 4PTWA 3TP4A 3IIOA 4NIRA 4JICA 4FIQA 3SCSA 4DJEC 2WZMA 2GSEA 4WHBA 4JD4A 9XIMA 3ARWA 4I7VA 1P6BA 4HMDA 2J24A 4IISA 1FWRA 2VKZG 3KXQA 1KCKA 3AIVA 1V79A 2VGBA 4GUGA 3OQ8A 2J8TA 3FOKA 2ISVA 4PR4A 4F0KA 3TQ0A 3LV5A 3Q67A 4EOUA 3VOCA 5FJRA 2CPUA 4JDBA 1C90A 1O1HA 2ISWA 1NM9A 2YL8A 5AYBA 3SR7A 3DDMA 2XH0A 1GYMA 2CU0A 1V6WA 4GOAA 3NQAA 2JGQA 3OHIA 3WF2A 4K7VA 1ELSA 3T6CA 4JEQA 1M01A 4ZFMA 2WKGA 4I9JA 1PZ0A 2Y63A 3MMTA 1AW5A 1XXXA 5HAOA 3BQ5A 1OFAA 1OK4A 2X40A 3GYCA 3I7RA 3PTKA 2ZDRA 1FP9A 3I7SA 1JNDA 3NCOA 4TMCA 4JTTA 4R9OA 1YDNA 1W17A 1Q2SA 2WBKA 4DJEA 4PTVA 2GL5A 3LHUA 2XN1A 4XO6A 4KIRA 2B7OA 4G56A 1C92A 4JHZA 2P53A 4J3VA 2BLEA 3TX9A 1CT5A 3LBMA 3S2LA 1H0IA 4H83A 3BJFA 1R2RA 3FYPA 1ZPTA 2WVVA 4JNYA 1SFLA 5J04A 1KBKA 4J9JA 2G4JA 3CIVA 4GNJA 2WNQA 4NUWA 2AL2A 3WEZA 4F0LA 2Q8ZA 4A6GA 3RU6A 3BARA 2CEQA 3S9IA 3LOTA 2V5LA 1EKOA 4L4OA 1Z89A 3SQSA 4FSAA 3W1PA 1D3GA 4FR6A 2C16A 4ZTXA 2E3ZA 5LNSA 4GI9A 1AJ2A 1P7TB 1W1IE 4GNVA 3WJSA 1RH9A 3A9IA 5CEWA 3PAOA 1XUZA 2WSRA 2XHYA 5CKSA 4I5RA 5FF7A 3NNTA 1F4HA 1ICPA 2NWRA 2P76A 2NQHA 6TAAA 4GINA 4AC1X 5I7GA 3K8KA 4XZHA 3ZSTA 3MYOA 3GNXA 1O5KA 1QU4A 4NAEB 5FOOA 3UEQA 2YLLA 1W2PA 2O56A 3KOYA 3GNDA 3W76A 5CC6A 2YDQA 3L4TA 3WSUA 4H6RA 3I3BA 4NRRA 1SW7A 1C3FA 4C6EA 3NDOA 2ACSA 4GGHA 3CAVA 3H6OA 1TVPA 3LBOA 3AYTA 4IZGA 3RM8A 3UF9A 1BTMA 5XIMA 3LY0A 2CLFA 2QT3A 1XSIA 4OIFA 1N8IA 1OZMA 2GYIA 3G0UA 5EKYA 1OD0A 4XG1A 2IMRA 4UTMA 2WLZA 3EKLA 2O7SA 4X2PA 4GA8A 1J79A 4GBDA 1DYSA 3IJ9A 3MUIA 4H2CA 1EF3A 3DC8A 1MEIA 1FP8A 3IS4A 3ICJA 4MPKA 3WLRA 2XUCA 2P3ZA 4F3HA 4XUYA 3ENLA 1V4YA 2VC9A 4LB4A 3PUGA 4UQCA 4V15A 4XVDA 3CQKA 3WNOA 3INPA 4B15A 4F2UA 3BSHA 3LPPA 1EGZA 2YCKX 4ZQOA 4YU1A 1JPMA 1WUFA 1R2SA 1H7WA 1LWHA 2OO6A 1JF6A 1DHPA 1J0YA 4MSSA 4ACYA 3UERA 2OKTA 3B8SA 4HCDA 3S4TA 5FF4A 3DC0A 4JTAA 2OZ0A 4AY1A 2XFWA 5DMLA 2X30A 2ZRUA 2PS2A 4KWOA 2OX1A 2Y85A 3LPOA 3DERA 2ABAA 2YR1A 1U30A 3QHOA 1H50A 3H26A 3T0AA 1OSEA 2Y61A 4IL2A 4GXPA 4LVAA 5CPOA 3WD3A 3ATYA 5LGZA 3U7BA 4CNTA 2D2OA 2NQLA 4K3ZA 1UASA 3U9IA 1KBIA 3MY9A 1GVSA 1TFVA 1OVDA 1LLOA 2BHZA 1KQYA 4CQAA 3DBPA 3HF3A 4WCJA 3ARZA 2ABBA 3KBVA 4FAMA 4LVBA 2QCNA 4PBEA 1SFJA 3NR0A 4JFWA 2ZC1A 3AYSA 1GQLA 1KCZA 2OZ3A 2XGIA 2G5WA 2GGHA 3P7YA 3H2FA 4H3DA 1B3ZA 1TZ9A 5D03A 3TTOA 1R9YA 1VEOA 1J0JA 4IP7A 3FIGA 4YJ5A 1DIDA 5G2IA 4CN6A 4NHVA 3SECA 4S3BA 1GONA 2E25A 2V69A 1ONEA 5H8PA 3VDHA 3GTHA 2EG7A 4PCPA 2YCLB 3S2JA 1XGEA