3SUUA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with gal-pugnac
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase/hydrolase inhibitor
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suuA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suuA02
1EXPA 4DWSC 1BLIA 4MB3A 4PMUA 4PMOA 3VOCA 2XM1A 2EPMX 4BCEA 2J7GA 3MS8A 3BMVA 3U5YA 1GOOA 1UD2A 3VDBA 1FA2A 5CXPA 4W84A 1UA7A 4U2YA 2CETA 4JFVA 5BROA 1FH9A 1E40A 3VIMA 1EHNA 1E9LA 3T09A 1IT0A 3PZGA 3AS1A 5CPSA 4QCEA 4OZOA 1FH8A 1LG2A 2GJPA 4NI3A 1BFNA 4D72A 5HXMA 1HX0A 2VCCA 3AMLA 2VQUA 5F7UA 4E8CA 2J4GA 3PZ9A 4MB5A 3ZM8A 2XIIA 1CZ1A 3OLEA 4GZJA 4QP0A 4J3WA 4W87A 3ARWA 1NWRA 2J7CA 3VIJA 3MSDA 1W3JA 2J47A 2CBJA 1MYRA 2D0HA 5A94A 4ACZA 2GDUA 5FD0A 1BVNP 1UKOA 4GXPA 3ZJ6A 1PEZA 3VUPA 2Y24A 4GIAA 1KB3A 2GDVA 3W81A 1G0CA 2XGIA 3AMGA 4P8WA 3A6OA 3UR8A 4W8BA 4L4PA 3WH8A 4U5IA 3VIPA 2E9BA 4OOZA 4J3UA 3MUAA 1V3HA 4X0VA 2OLHA 1B0IA 2WHKA 1B3ZA 1EQCA 2XPKA 2VZSA 5IFTA 4LXFA 1OM0A 1ECEA 1PZ3A 4BF7A 2HISA 5LA1A 3OGRA 3CMGA 1GUVA 1VFOA 1CEOA 1J10A 1C92A 3WH7A 1KQZA 1V0KA 1YHTA 2OWCA 1TVPA 4D71A 4GI6A 1HL8A 1CLXA 3B9DA 4C7GA 4BZYA 4PMQA 3UG5A 2VT0A 4MNLA 3CHCA 1HJVA 2YA0A 1JZ3A 4F9JA 4D6JA 5HNNA 4FF5A 1QNRA 4V27A 3VGBA 1DWFM 2GJXB 3IJ7A 2CHOA 4H41A 3SCPA 5HOSA 1KWGA 3ARVA 1D3CA 2WMHA 4FLOA 4D1IA 2EPNA 3HJEA 2D24A 3DHUA 3NCOA 4MDOA 1CENA 1CGWA 1H0GA 4TXEA 4MPKA 3UG3A 1V3JA 4R27A 1J01A 1UD3A 5AY7A 3L4ZA 3L4WA 1HP5A 2BVTA 3W0KA 5BWFA 1VJZA 4KMQA 3RMEA 1WP6A 1EDQA 3SUTA 4W7VA 4Z2IA 4M29A 1TVNA 2WZIA 2YL9A 1K9TA 3QHMA 1V6WA 1DWGM 5CLWA 2CCRA 3RO8A 2DIJA 5ECUA 3D3AA 1QBBA 1OWQA 3WIJA 4W8LA 2W91A 3ALGA 3PTMA 2ZIDA 1PIGA 1KQYA 1GCYA 1JZ2A 3WNMA 2V3EA 2YDSA 2B31A 1NWUA 1B30A 1DEDA 3SUUA 4LYRA 3BMWA 4EK7A 2XVKA 1GZJA 2RGLA 1JF6A 5BXPA 5I77A 3IK2A 1JYNA 1JD7A 2AAAA 2WBKA 2QLYA 4V2XA 4FLRA 4JCLA 4QLJA 2TAAA 3RILA 4AYSA 2YDQA 1HF6A 1CXHA 2ZUWA 1Q4NX 3APGA 3BAJA 2W5FA 4PUDA 1RP9A 2DT1A 1M03A 4JKMA 2WKLA 3WQVA 5A6KA 5A2AA 1JL8A 5BXTA 2UY4A 4R5EA 1LG1A 4WKAA 3CO4A 3AHTA 1L8NA 2VCAA 3WDPP 3OGVA 3O2LA 1UWRA 2G8ZA 3WQWA 3AXHA 1CXEA 1HIZA 1H49A 3OZPA 4S3KA 3WBEA 2J8GA 5CGMA 2YJQA 1HP4A 4GZIA 4F8XA 2YBUA 3ZOAA 4E8DA 3U57A 4MNMA 4PTXA 3W26A 1XGZA 1OIMA 4PSPA 1HXJA 1FHDA 4OBRA 1QI5A 1ISWA 3AYSA 3JUGA 4CVUA 1UWSA 2VI0A 1UG6A 4UQCA 2YDRA 1LWHA 3RM9A 2WW5A 2YL8A 3VDAA 1FFQA 3SCRA 4HOZA 1AVAA 5DMYA 3AIBA 3AXIA 1EOKA 3CZ8A 3NIYA 3N15A 1V0NA 1W3HA 4BA0A 2VCBA 4W5ZA 2E0PA 3L4UA 4JZ5A 3AS3A 3MANA 2WCGA 3L2MA 4W86A 2XUCA 4C7FA 3AMKA 4W7WA 1CIUA 3OG2A 3K8LA 5ABEA 1V3LA 3WENA 2JALA 1NH6A 1QI3A 1GJUA 3N18A 1I1WA 4Z2GA 1LL4A 2ZUSA 3QHNA 1VJSA 3DC0A 1F4AA 2PBOA 3QHOA 4ZXLA 1KBKA 2EO7A 4JHZA 5FL1A 3W4RA 4F66A 3VGEA 4U33A 3T2OA 2J77A 2D3LA 2ZUNA 3WL1A 2V38A 1BG9A 5KEZA 2W92A 4MTVA 2J78A 3N17A 4ZEPA 2VX6A 2V3FA 1XCWA 3F5KA 4AEFA 3WNNA 3M7SA 4HMEA 5BYWA 2JE8A 1NP2A 3THCA 2CESA 3ARQA 1ITXA 3SUWA 4D6FA 4UQ9A 3WNKA 3WD4A 1OGSA 4OJYA 1NOWA 3W53A 3AOFA 5A6BD 2NT0A 4NRRA 3PN8A 4P8XA 3NJ3A 1B3XA 2CKRA 2EQDA 3GTNA 1FH7A 1OBAA 5DT5A 2XSAA 2BFGA 1GVYA 1BTCA 2X0YA 3UESA 1TZ7A 3KE0A 3ARPA 3II1A 1W1PA 2EPLX 3GH7A 3T0AA 2W63A 3UG4A 4ZFMA 5GQBA 2BY3A 3ARYA 2V3GA 3ARTA 1C91A 2ZXQA 1DWHM 2J7HA 1EDGA 5JIPA 3AIEA 3AROA 1GOIA 5HPOA 5EFDA 4UFMA 2BY2A 2J62A 2XHYA 1UR1A 4PTMA 1CXKA 1BPLB 3K8MA 4DM1A 1XYFA 5DEZA 5I23A 2CNCA 2CEQA 1TFVA 2BNJA 2WVTA 3FW6A 5CPQA 4V28A 4AD4A 4TX8A 1ESWA 2D20A 4AXNA 2G3JA 4JCMA 4OKDA 3MV11 2BY0A 1QHOA 2F2HA 3AIRA 4ACZB 1E6ZA 1M7XA 4BS0A 2WBGA 1LF1A 5KZ6A 5JIWA 1GQJA 4XV0A 4AZIA 2WM0A 1UD4A 3PZVA 5I2UA 2W62A 4CUCA 5M03A 1JZ7A 3A4AA 2VRQA 2ZUTA 3WEZA 3VMPA 2OYKA 1W9BM 5HDRA 2UWFA 4J3TA 3CH9A 2J7FA 3F4VA 1E71M 1HVQA 3WEMA 3S6TA 2VNCA 1MFUA 3ZR5A 4PRWA 4BQ4A 2VOTA 4ACYA 3VILA 1A47A 3VVGA 1CLVA 1US2A 4GKLA 4ATLA 4B15A 1KFWA 3SCWA 3WELA 2XVGA 2YIHA 1UKPA 3FAXA 1BG4A 1EOMA 4UQDA 1V3IA 2QMKA 2WMIA 4Y7EA 3VGDA 2WHMA 1R8LA 1UH4A 1H11A 4BQ5A 3CZJA 1WZKA 1XH2A 4MAVA 1XD1A 1R7OA 2QPUA 4MDPA 3I3BA 1UYQA 2WCSA 3ARRA 1K9FA 8CGTA 3BAYA 1GNXA 1J0HA 3TTYA 1GJWA 4HPGA 1WNOA 2WSPA 2X09A 4IUGA 5E70A 2IUZA 1JZ5A 4JFTA 1HJWA 1VBUA 2BV9A 1UD8A 4CU8A 3QOKA 5CLTA 4D1JA 2UY3A 3MUIA 4TOQA 1G1YA 2A3EA 1ZBVA 1DP0A 2EPOA 3ARUA 1CWYA 2XVLA 1W9PA 5DO8A 3BLKA 3K4DA 3M6DA 1H2JA 2WC4A 2ZUVA 2WWDA 2YBTA 3FXYA 3POHA 2WANA 1MW1A 3WNPA 5IFPA 1C8YA 1KXTA 1WZLA 3VGHA 1E1FA 4U2ZA 1ZBWA 3W24A 3NSNA 1XRVA 4PUEA 4ZE5A 3L4XA 5FOOA 1ZU8A 1GQIA 4UZSA 5D9PA 1ODZA 3CZEA 2ZXBA 4HA4A 5E09A 1JFHA 3IJ9A 3NDYA 3T2QA 2JFEX 3IANA 3AHYA 7CGTA 3VTRA 2CBVA 1C7SA 1EDTA 1NWTA 1G5AA 3I3DA 4UOZA 2E9MA 3IJ8A 5LA2A 1D2KA 4C91A 4M82A 4KWUA 2V3DA 4UQEA 3SCOA 4AZ6A 3MSGA 2GUYA 1QI4A 4OIFA 3ZT6A 2Y5EA 1R7AA 4D6HA 1WDPA 5ABHA 3UERA 3KL5A 1CGTA 4KH2A 5AC5A 3GZAA 1PBGA 4H8VA 1V0LA 3FY1A 3WNLA 1UKTA 3U7BA 3AQUA 5I0DA 2ZE0A 5HBFA 4U3CA 5CGTA 3MMDA 1HVXA 4J3XA 1H09A 1B1YA 4AC1X 1VENA 1DWAM 1E15A 2XM2A 5A69A 3MUZ1 5D9NA 1J12A 5CG0A 1HL9A 4H2CA 4XZWA 5EFFA 2YA2A 1GORA 4HZ8A 3WFZA 4P7NA 1W2VA 5I79A 3DYPA 1JZ8A 5DFAA 4UZUA 4IISA 2DSZA 5C70A 2WVVA 4CGTA 2YOCA 4KRTA 1PX8A 2J7EA 1UZ4A 3VNYA 1KCKA 3PZNA 1TA3A 1J18A 4AISA 3VMNA 4AZHA 3NUKA 3L2LA 2VO5A 1LQ0A 1NM9A 2XWDA 4HU8A 3WUEA 1ITCA 4LQ1A 2X8RA 1W3KA 2ZUUA 3KEHA 2NT1A 3WF4A 1KCLA 1V03A 3CLWA 2W4XA 2BHYA 2OYMA 3NYDA 4HPHA 2X0HA 1CXIA 3RJYA 1E4MM 3FNDA 1MFVA 1E1EA 1XHGA 3WF3A 4P7RA 1E55A 2Y2WA 3NDZA 3BC9A 1E43A 3WD1A 4L4OA 4A4AA 3W82A 3BAKA 4P7LA 3CUIA 4TUFA 3TTOA 3VD5A 4P7QA 2BXZA 3VO0A 1QBAA 5ABGA 3UETA 4TVDA 1X6LA 1JGIA 4JL1A 3PZUA 3PZOA 4PTWA 4JHOA 5AYBA 1AMYA 1FFRA 2ZOXA 4YHGA 1KGUA 3SIMA 4D6CA 1LL6A 2ZICA 4AZGA 3L4YA 1R85A 3EMZA 4Z2KA 4HA3A 4QDMA 4XX6A 2O9PA 3ZT7A 1ZL1A 2QPSA 5GPRA 3WQ5A 3BAIA 3FHQA 1K9DA 1JZ6A 1EIBA 2YA1A 1KBBA 3ZJKA 3HN3A 2EEXA 4C90A 1JI2A 2XTKA 1JDCA 4PMXA 2W67A 3S2CA 3N1AA 1GHRA 4H8HA 4RE2A 1UQYA 3B9AA 3WMSA 2WMKA 3GNOA 1K9EA 1NOUA 1UWQA 4LPCA 3VINA 1ODUA 1UR8A 4JKKA 4ZENA 4A3YA 5E0FA 2CXGA 3O9NA 1RP8A 2VRKA 3VKKA 1TR1A 3ALFA 2JEPA 3RIKA 3AIUA 1HKJA 5IXEA 1B3WA 3SCVA 3WDRA 3VD4A 4CU7A 2DEPA 4CCEA 3ZJ8A 5A6AA 3AICA 4CD4A 4D6DA 2VZVA 1DTUA 3CBWA 7TAAA 1V02E 5A6BA 1E6SM 4D6EA 1H4PA 1MQRA 2X1IA 7A3HA 3PZMA 4JIEA 1E4NA 1OT1A 3VIKA 3PZTA 3VU2A 1R86A 4DWSA 3VD7A 1O6IA 1B9ZA 3EDFA 3KL3A 2CHNA 1JD9A 2J7BA 1W9VA 2G41A 1CDGA 2FHBA 1W1TA 2WMFA 4B3KA 3SURA 5A6LA 2G4FA 3G6LA 1BYCA 1G01A 3VNZA 4HP5A 4B9ZA 2A3AA 2JEQA 2WAGA 4P8UA 4QLLA 5JBDA 3IAPA 5D9MA 1BYBA 1ISVA 2YLAA 2J75A 2DH3A 1E5NA 3W25A 2C8NA 2XGBA 4EKJA 2GK1A 4AW7A 1QOXA 2BVYA 3EDJA 1VFMA 2XVNA 1UH2A 1WAWA 5CPTA 1H5VA 1TCMA 4PSRA 5A1AA 1UH3A 3VPLA 3HMCA 4IPNB 3SCQA 5E9AA 1E6PA 1EO5A 2D0GA 4U5KA 1QPKA 2JIEA 1ZBCA 4XZBA 2D2OA 3W38A 1X6NA 3W29A 4HZ7A 3VIHA 5A8NA 3AZSA 5A6SA 2J8FA 3THDA 4P7OA 1MW0A 4W8AA 5CJ5A 3BXWA 4RL3A 2WMIB 3SCUA 2VRJA 2JF6A 1DWJM 3WD2A 5A8QA 4FK9A 1WB0A 2VL4A 1JAEA 1JG9A 3AXXA 2YL5A 5DT7A 1CGVA 1UQZA 2A3CA 3OB8A 2VR5A 4AZ7A 3G6MA 1JIBA 4GINA 4PMYA 5BRQA 1WDRA 1E6XM 2WPGA 1ZB5A 4Z2JA 4JAWA 1WKYA 3VX0A 1MW2A 1JNEA 5LYRA 1OSEA 1BGAA 5BXRA 1KXHA 1KGXA 3WDHA 1HKMA 3BSHA 3UR7A 4CCCA 1WE5A 1W9DM 4D6IA 2WYSA 4UFKA 4RE3A 2YKKA 1WZMA 2VVSA 2DSVA 3K4AA 3WD0A 1ZJBA 1B90A 3AMDA 2V5DA 3WMCA 1DWIM 1QW8A 1QNPA 2VZTA 2PWHA 1ZBKA 2WVUA 1HJQA 1CNVA 2VZOA 1TMQA 2CYGA 1TUXA 2D3NA 4B16A 1UZ1A 3GNRA 1E6NA 5CQ1A 1WDQA 3RPMA 1LWJA 1EH9A 3BLPX 1IV8A 2CKSA 1PJ9A 2DGAA 4YHEA 2WWCA 1E6RA 1QI0A 4AEEA 2PB1A 1B3VA 1J0KA 2VMFA 1JXKA 1BF2A 1VFUA 1ZS2A 1F4HA 4W7UA 4JFUA 3NSXA 3DYMA 4HZ6A 2CIPA 2WZHA 2E8ZA 5A2BA 4UOQA 5GNYA 3WH6A 4GQQA 2ZWZA 3CHFA 2FHCA 3QR3A 4MB4A 4IPLA 4QAWA 4J7RA 1XH1A 1VIWA 1SMDA 4W5UA 4WSKA 3K46A 1V08A 3AYRA 4HOWA 1SR0A 4ATDA 3AZRA 3D5HA 1PZ2A 5I24A 2JF7A 3BSGA 1G9HA 1W32A 3SUSA 3B9EA 3WD3A 4WIWA 4XB3A 4K68A 4MB1A 1RD6A 4GI9A 3WN6A 3LPGA 1G94A 1NP0A 2A3BA 1LLOA 1D7FA 3T2PA 3GXDA 3HU7A 3VD3A 3W28A 2WLZA 2WVVB 4PN2A 1HN1A 3WMBA 4S3JA 1UOKA 4CN6A 2WSKA 2OSWA 4PMDA 2GVYA 1TA3B 1E70M 4HTYA 2F8QA 1EO7A 4B3LA 1XCXA 2CBIA 2W61A 2XFYA 4MNKA 4X9YA 2DIEA 1I75A 3WDQA 4AZCA 4U3AA 1V6UA 3EDKA 1WO2A 4CCDA 1B2YA 1BVZA 2DQXA 1PPIA 1V3MA 4M81A 4WK9A 2FHFA 4J3VA 2Y4SA 2D23A 1H1NA 1E3XA 4J27A 4AD0A 3RJXA 3ZIZA 2C7FA 4M8UA 1ZJAA 3W37A 2VX5A 2AMGA 3F5JA 3TOPA 1LJYA 1W9XA 2VUYA 4U31A 4ZXOA 4LYPA 3OGSA 4UQBA 1GQLA 4MJ4A 3WSUA 3MUY1 4DUWA 1VEPA 1XV8A 3ZJ7A 2VZUA 1E5JA 5TD4A 4W89A 3WKZA 2E4TA 2PF0A 3WF0A 5FKYA 3LMYA 4JKLA 4BQ3A 1E3ZA 1N82A 5E0CA 1JXJA 1MW3A 2EBNA 4CVWA 3M46A 3U5UA 4UTFA 3N04A 1PAMA 3CZGA 1QHPA 3BGAA 4HMCA 3LPOA 4KGJA 1QNQA 1P6WA 3TONA 1CECA 4GI8A 2ZX6A 2WHLA 3BAXA 3U7VA 2FGLA 1W3LA 3W6LA 1C8XA 2WC3A 5M17A 1XH0A 4MJ2A 3CUGA 3WUGA 4M80A 5A8MA 2DH2A 3MMWA 1NWSA 3NSMA 4AD2A 5ABFA 3DECA 2CPUA 1PX3A 1J0IA 1IZKA 3GM8A 2QV4A 4Z2HA 4GQRA 3PZQA 4UCFA 1LL7A 1E56A 3ZSSA 3CZLA 4TTUA 2X05A 3WQ6A 4ZE4A 1FOBA 1JF5A 1V02A 3ZR6A 1GOWA 3EMQA 4PMVA 4C7DA 1Q6CA 1EGZA 4DWSB 2E3ZA 3L4TA 1VFFA 4PCSA 5FIPA 3K8KA 1GOMA 4WKHA 3AIQA 3FAWA 2C0HA 5I6SA 5LA0A 2YLLA 4CD7A 1M01A 3AFBA 2VQTA 1Q6DA 2VTFA 3WH9A 4MNJA 2ZUMA 4W93A 2AOSA 2PWEA 2ZXDA 2CERA 3CUHA 3PTKA 5BXSA 1HKIA 4TX6A 2BS9A 4FLQA 1W9UA 3GBEA 3GYCA 5EBAA 2OSXA 3KWXA 3M07A 5D4YA 4NSBA 3A4XA 1R87A 2O9OA 1UR9A 2FDMA 2WHJA 3SUVA 1XSIA 3ARXA 1W1VA 2GK1B 2IXUA 4AD5A 1UKSA 2BY1A 1OT2A 1GPFA 2E9LA 1B3YA 5CSUA 5A6MA 6A3HA 3T0DA 4NZCA 4TVUA 3LPPA 1UR0A 4UFJA 3VIIA 5BCAA 1US3A 2WMJA 5C8BB 2G3IA 2Y8KA 3ZO9A 4H8UA 3ZSTA 4GZEA 3CUJA 3CZKA 1B31A 2MANA 5FCZA 4LGXA 4XUYA 3WEOA 2Y8VA 1E0VA 3VIOA 1BYDA 2FH6A 1MQQA 3GXFA 3AHVA 2WKGA 4MAZA 1M04A 3WY1A 5IDIA 4ATWA 1J0YA 3CUFA 1W91A 3AI0A 4WSJA 3ARSA 3RM8A 3E1F1 2PI6A 1YQ2A 3OZOA 3WFLA 3GH4A 4UR9A 1E73M 3EYPA 3AS0A 2FGZA 4UNIA 4GO8A 2JIWA 1WCGA 2V5CA 3N12A 4E4PA 1JDDA 1OINA 2NSXA 2EPKX 4HOXA 1VAHA 3GNPA 5JBEA 2G3NA 1OD8A 1HNYA 1QVBA 4AD1A 3BH4A 1S46A 3OIHA 2BHUA 1MXDA 4KRUA 3SCSA 1QI2A 2VVNA 3OLDA 4GO9A 3I3EA 1E4LA 1I1XA 3WUBA 4M24A 1HT6A 1C7TA 3W6MA 3VX1A 1BQCA 3N11A 3MV01 3PHAA 1BGGA 4OUEA 4PCTA 4CD5A 1U30A 3CTTA 3AIWA 1V6XA 2CBUA 3F5LA 3W27A 1J0JA 3ZT5A 1UKQA 4IM4A 3UCQA 1MWOA 5BRPA 2QMJA 1CGUA 2WC7A 1J9YA 1UHVA 1VEMA 3SCTA 4HA1A 4PMRA 5A8PA 2IXVA 2XIBA 1GOQA 1K6AA 5C71A 4AMCA 3ARZA 1JYVA 1UWIA 2DSKA 2F61A 3TP4A 1IZJA 1KR0A 1CPUA 4OBSA 1NOFA 1BSIA 4P8VA 2BXYA 1OGGA 4PBGA 1Q6GA 1E0XA 1QNSA 4PMZA 2ZX5A 4J28A 1WPCA 2WVSA 3A3HA 4N42A 4D6GA 4KGLA 1OD0A 3WL0A 4QFUA 2GJRA 2D1ZA 1U2YA 2ZWYA 3IAQA 2XYLA 4PMNA 4YN5A 4MADA 1E4IA 4PYSA 2XFFA 4F79A 3AJ7A 5D8ZA 2NW0A 4M1RA 1UWUA 1C93A 1V0MA 3K1DA 5DF0A 2CITA 4Q22A 1M53A 1KR1A 1JI1A 1CGXA 4AZBA 1C90A 2G3MA 1L0PA 1PX4A 1W1YA 1GOKA 3OBAA 1XD0A 3AMCA 3T0BA 3GDBA 4Q7NA 1XSJA 3VIGA 1SFSA 2ZX8A 1UR2A 1XC6A 4RE4A 4WJXA 4CD8A 8A3HA 1XYZA 1BYAA 2PC8A 2X2YA 4OOUA 1DHKA 5HPCA 1FP8A 5CSYA 3UEQA 2WXDM 1EHAA 4AZCB 1UWTA 1XSKA 1JDAA 4W88A 4PTVA 3VGFA 4TVCA 4GPNA 2XWEA 1HJUA 4CN4A 1H41A 4WKFA 1VF8A 1ISZA 4UOJA 3WQ4A 1GHSA 3O6AA 3EBVA 3TTQA 3RM4A 1HJXA 3AS2A 3VD9A 3VDHA 3QGVA 2VX4A 5JUVA 5IHSA 5IHRA 5EB8A 4EE9A 1JYWA 4JL2A 4DUVA 3GH5A 9CGTA 4E2OA 4JFWA 1KXVA 2DSWA 4WLCA 2WMGA 2Z1KA 1CYGA 4LYQA 5A8OA 2EJ1A 4AZ5A 1TE1A 2DT2A 2DT0A 4PEEA 1PIFA 4CD6A 1RPKA 2J25A 1VBRA 4AIOA 2GJXA 2GFTA 3WUFA 2E40A 4QCFA 1H0IA 3MMUA 4CU6A 1UA3A 2HVMA 2VC9A 6CGTA 5M3WA 1W2PA 3AHXA 3J7HA 1Y7VA 1H3GA 4NF7A 3PZIA 2J74A 4A3HA 2WK2A 2PWDA 2BVDA 2YL6A 2O92A 1VRXA 3OLIA 1GVIA 5M5DA 3EDEA 1OGBA 2OWWA 1UUQA 3CPUA 3MO4A 1WDSA 2A3HA 3CHDA 1FP9A 4QLKA 2ZXAA 1ISXA 1Z32X 1KXQA 2XG9A 4H04A 3ZMRA 2XVPA 5ABFB 3VM7A 1QW9A 4AY1A 3GXIA 2O9RA 1QNOA 5A3HA 5AC4A 2XFRA 2WZEA 2DT3A 3QOMA 4URIA 1CXFA 2DSUA 3TTSA 2QHAA 1KWKA 1ISYA 1V6YA 4DWSD 2XJ7A 1O7AA 1NARA 2D0FA 3ECQA 4F9DA 3OLGA 5JBFA 5D9OA 1UD5A 5I3DA 2EXOA 1WZAA 2UY2A 2WNWA 2VX7A 1OCQA 4HU0A 1QHZA 2BHZA 3DHPA 1C3FA 1V6VA 3WH5A 1OB0A 5EMYA 1U33A 3VDCA 1OIFA 4W85A 3FHAA 5A95A 1AQ0A 3AIVA 1JYXA 1UR4A 1MXGA 3AHZA 3EDDA 1CBGA 4FMVA 3CHEA 3MU7A 3A4WA 4X0NA 1UD6A 1CTNA 1E72M 4DM2A 4AD3A 3WF2A 3CIVA 3FN9A 3RDKA 3PBGA 2GSJA 3VGGA 2DPEA 2O9TA 3VMOA 5E6YA 3SCNA 1JZ4A 4NRSA 1Q6FA 2W66A 1SMAA 1GONA 1HJSA 4HMDA 2WLYA 4FLSA 5A2CA 1CGYA 1MQPA 1BAGA 4WF7A 3BCDA 5I5RA 5FL0A 3PTQA 1CXLA 2Z1SA 2UY5A 2WB5A 4CN1A 1V3KA 1C8QA 3WBAA 1TG7A 1KGWA 3GXMA 4M56A 3VIFA 2D22A 1AQMA 2J79A 4AIUA 1GQKA 3KL0A 4AIEA 1Q6EA 3MKKA 3EMCA 4EAMA 4LX4A 5AYIA 2WCAA 5E6ZA 1E6QM 4TTGA 2PWGA 1VEOA 2ZX9A 4AWEA 1NQ6A 2OSYA 4JFSA 5A6JA 2DDXA 4YPJA 4N0RA 4H7VA 1A3HA 1J0ZA 2E8YA 1JNDA 5D8WA 3L4VA 1SYTA 5CZKA 1RH9A 3BCFA 3KZSA 3B8SA 2VURA 1HKKA 3OA5A 3VM5A 4ML4A 4B9YA 3LPFA 3CMJA 3WDJA 1FHLA 4UFIA 3T08A 4J3SA 3GBDA 2XSBA 1E0WA 2ESCA 3ZQ9A 3AZTA 3WF1A 4UFLA 2FH8A 4DUXA 2QF8A 1EA9C 1GW1A 1VB9A 2VJXA 2ZX7A 3CGTA 3N13A 5GNXA 3WDIA 2PBGA 1J11A 4UQAA 3WNOA 2PWFA 3BAWA 3RCNA 1JAKA 2J7DA 2OYLA 1MVYA 4Z2LA 1JFXA 3A47A 3SEPA 1BHGA 2OWXA 3DYOA 2VR4A 3POCA 4BQ2A 1AQHA 4CKQA 1EQPA 2Q8XA 5I78A 3TA9A 3N9KA 3WQ8A 3AISA 1X1NA 2RGMA 4UFHA 6TAAA 4EANA 5GNZA
chains in the Genus database with same CATH superfamily
1EXPA 4KW2A 4MB3A 4GIEA 1Q13A 4L64A 2XM1A 2YCKX 4Q8NA 5CAHA 2FLIA 3H21A 4D8LA 2FTWA 5CXPA 3OP2A 4W84A 1UA7A 3U2OA 1JGMA 4BR1A 2C1HA 3GKAA 4MYAA 5CZ0A 2YB1A 4JQ3A 3MPGA 3T09A 1U1JA 4FF7A 3KOFA 2P8BA 4QCEA 9RUBA 2HROA 3CLMA 4NI3A 1ZJIA 4D72A 1HX0A 3O6DA 2PDHA 4B2DD 4IJRA 1PKYA 4E8CA 3VNKA 1I60A 4C6JA 4JIRA 3PZ9A 3W88A 2XIIA 4TIMA 3LDVA 1XBVA 1KFLA 4W87A 3ARWA 1NWRA 2Q8ZA 3MSDA 1FWFC 3IK4A 4DNMA 2CZVA 2D0HA 3BMXA 5A94A 1KFJA 1EL3A 4O1DA 1KV5A 1PEZA 3BW3A 4YTUA 3W81A 4GIAA 4O1BA 3FEQA 4P8WA 2HV5A 2QJIA 4MUPA 1KM0A 3WH8A 4MMWA 2C6QA 4OOZA 2YBVA 3MUAA 4WXZA 5HWJA 1B0IA 1B3ZA 2XPKA 3LK6A 3RF9A 4WEVX 1F8IA 2D2GA 4L1GA 4IMAA 1PZ3A 6REQB 1WDDA 4J3ZA 5LA1A 3CMGA 3BSMA 5DMNA 3G1DA 4P02B 3BV4A 3A64A 5FA5A 3PPHA 4GQGA 1XYMA 4KESA 2HE5A 3W2JA 4RDWA 4K1GA 3IGUA 3HTWA 1HJVA 1TJ2A 3R43A 2O56A 3EWBX 3V0UA 1Z8AA 3VGBA 2GJXB 4GY0A 3IJ7A 2CHOA 4IGSA 3LRMA 3SCPA 1VQTA 4ZOAA 4LU0A 2HNEA 4BI6A 3MKCA 3WK3A 3TN4A 4D1IA 2EGZA 2PDNA 4MDOA 3KCJA 1D8CA 1M6JA 4CNPA 5AY7A 3W0KA 1VJZA 3BE7A 4KMQA 1XKYA 4S3CA 3DG6A 3GB6A 5BNKA 5T26A 3MI2A 5DCBA 1EJRC 4AIBA 4O1CA 1LBLA 3KLKA 1TVNA 4WRHA 1BKSA 1FX6A 5LNVA 3KOYA 4CQAA 3D3AA 3ENLA 1KD0A 4TMCA 1JPIA 4ROPA 4PUNA 5HK4A 4IH3A 1XLFA 4I9AA 2GSEA 4W8LA 2W91A 3ALGA 2NX1A 1KQYA 3WNMA 1NWUA 1YTKA 1B30A 3BMWA 1UIOA 4EK7A 2XVKA 3GSMA 4ZSUA 4ZODA 5JXQA 3MI3A 2ON3A 5J8LA 1QDSA 1EIXA 2NVAA 3QV9A 2TAAA 3RILA 4AYSA 2YDQA 2X16A 4O52A 3DERA 2OFJA 4KIEA 1DTNA 1EJUC 4XAPA 2WKLA 4ZOCA 3LCFA 3QYQA 4NJHA 5BXTA 4R5EA 4R34A 3RG6A 4WKAA 2PDLA 3LCXA 4L9YA 5IM51 3O63A 3O2LA 2B7PA 4WR3A 4U28A 3NVTA 4ZSTA 5FEWA 1N2VA 1WYIA 3PC0A 1HP4A 4F8XA 3MI6A 4O10A 1LOLA 2YBUA 3GU2A 3GW0A 4PTXA 3W26A 1XGZA 2QNEA 2QDEA 3GU1A 4KWOA 3LCLA 1ISWA 1SJAA 3AYSA 3EWDA 3RX3A 1UG6A 4HSOA 4UC5A 4BKNA 2DUAA 3QBUA 1EYEA 1AVAA 2ZFAA 5DMYA 3O06A 3AIBA 1OJXA 1IXPA 4H8NA 3CEPA 3AXIA 4GNKB 4MY9A 5C5YA 3G8EA 3CZ8A 1V0NA 1W3HA 3WLOA 3P7YA 2VCBA 4RDYA 4UTWC 2YGYA 4DBDA 3MB9A 3AS3A 1TPEA 5D38A 2Z28A 3KLLA 1TKKA 3WQPA 4W7WA 3TXZA 3G1SA 3BLIA 3CYJA 3WQCA 1NH6A 1N55A 1QI3A 2V5KA 4XK2A 3KVKA 2ZUSA 4AAJA 4HN4A 2EO7A 4JHZA 3L12A 3HIJA 2XZ9A 3FDKA 3OEXA 1XISA 3E12A 3T2OA 3B8IA 1TWSA 4WJ8A 4JQ4A 4IIHA 3ONBA 2DZXA 3QRHA 3WNNA 2FMOA 1NP2A 3WLJA 2W6RA 1F6PA 1K8CA 2PC4A 2OEKA 4UQ9A 5CBIA 1LRTA 1NOWA 2NVDA 3W53A 3FFSA 5A6BD 3PN8A 2CKRA 4GY7A 2EQDA 1L2UA 3CAVA 5J5DA 3BVJA 4H9XA 5LNRA 2VR2A 4QITA 2WKJA 5EJ1B 2X0YA 3KOWA 1F9CA 3VA8A 3GX9A 3LU2A 5REQA 4LEQA 4P00B 3RMJA 2W63A 2Z27A 4FSAA 2F38A 3QFWA 4JTGA 1DWHM 3GHRA 1EDGA 3LCWA 5JIPA 3AIEA 1ZRQA 3GVVA 3AROA 3LSCA 3JZUA 1R30A 1HG3A 3EWCA 4WDXA 1Q6OA 4PTMA 3TJLA 1NDVA 3M44A 2CNCA 3B0VC 1TFVA 5C9ZA 2C79A 2BNJA 2WVTA 3KBWA 3P8JA 4TX8A 1RR2A 3NQGA 3BV7A 3RLGA 2G3JA 3LI0A 1TJPA 3IV3A 3FVDA 3WCZA 1E6ZA 1M7XA 3GTHA 1S3HA 1XLAA 1ZALA 5FF4A 3BG5A 4DVOA 2XH2A 1UD4A 5I2UA 1S2AA 2W62A 4CUCA 1I2QA 5KINA 4ICCX 5LNUA 3RPDA 4QE4A 2OYKA 2PS2A 1W9BM 4CQ9A 4KWVA 5DANA 1VBHA 1HVQA 3WEMA 1OEPA 3F4NA 3ZR5A 3LG3A 3R6IA 4INFA 4ACYA 4F2UA 3R25A 1US2A 3HFYA 3APYA 4GKLA 3RLHA 3UWQA 3WELA 2XVGA 3DAQA 3T1GA 1YPIA 2YIHA 2Z24A 1BG4A 1EOMA 4UQDA 1KTNA 3HQPA 1JPKA 4FS9A 4F0MA 4F0KA 3CZJA 2HJPA 4GUJA 1R7OA 2YPIA 3BAYA 3LHVA 4DO5A 4PRTA 1GJWA 4JTSA 1OFOA 4DY1A 3DBNA 5K4XA 1L6WA 4JFTA 1VBUA 2VD9A 2NQJA 5D2TA 3RITA 1NJJA 2UY3A 2FMNA 3LQGA 2IPFA 5G2WA 2FGBA 1W9PA 2QCDA 3O3RA 4IHCA 4EACA 2WWDA 4DLMA 3VC6A 4HBKA 3WNPA 4HPXA 5F2LA 3E74A 4QX4A 3VGHA 4U2ZA 3RCMA 4MKNA 4UTLA 3GD6A 2A6NA 4PCNA 1XRVA 1BKHA 1YTDA 4AVFA 1W3TA 1GQIA 4HNVA 3DFSA 4HU4A 3QFEA 1ODZA 4M7TA 3IJ9A 3NDYA 4J35A 3QR0A 2PU0A 3L66A 4NAEB 2CLPA 3R7MA 2CBVA 2I5QA 5LA2A 4C91A 3CL6A 3RX4A 1KRBC 1O5RA 2WJZA 4IG2B 1RA5A 2Y5EA 4D6HA 1WDPA 1OCNA 2ZA3A 4C6IA 3KL5A 5AC5A 3R10A 2FVMA 1PBGA 3EKZA 3FY1A 5FF0A 3GG8A 4AF0A 1S1PA 1O12A 5I0DA 4U3CA 1AK5A 1S1RA 1TTIA 3AAMA 3GXNA 1IXNA 3TYEA 2Y7EA 5A69A 1SZNA 1J12A 1XIHA 5DXYA 5CG0A 4WJEA 1EYWA 1THFD 2YCLA 4UTIA 3HBLA 3WFZA 3C2RA 5HUPA 4WDUA 5DFAA 5JVLA 4IISA 4LAOA 5E5CA 5CCZA 3EPNA 1UZ4A 1DVJA 1KCKA 3VMNA 3L2LA 3LHTA 4LQ1A 1W3KA 2ZUUA 3CLWA 3L0NA 4C6EA 4Q3MA 2BHYA 2QCEA 1XBYA 3PFRA 1QU4A 5CZTA 5CPNA 5AFDA 3NDZA 4LAMA 1L6FA 2C1GA 4Q6XA 4NZFA 3HV8A 1E43A 4H9ZA 3VCCA 3P0XA 2CZDA 2Y61A 4L4OA 2ZRZA 3W82A 3NURA 3NOEA 2RJHA 5AC6A 1VBGA 5ABGA 3UETA 4TVDA 4PB3A 1X6LA 1JGIA 3NZ1A 3PZUA 4LVGA 5AYBA 4D6CA 4AZGA 3DGBA 4ECLA 1D3GA 2RDWA 3PBMA 3ZT7A 3ZYZA 1S2WA 2QPSA 1LYXA 1POKA 4MM1A 4LV9A 5GPRA 1O66A 3BAIA 1C9WA 1K77A 1Q2RA 1PHQA 2YXXA 1EIBA 1VIZA 4IF2A 5F2MA 4D9PA 1ADOA 1AFSA 2PWVA 4PMXA 1JDCA 3LY0A 3LA4A 2W67A 3IS4A 3N1AA 3RUBL 3B9AA 2FYMA 3WLSA 1NOUA 1H61A 4RX0A 5GJPA 1UR8A 1KA9F 5U7SA 5E0FA 2I56A 2CXGA 3VKKA 1SZRA 1B3WA 4MKSA 1XYAA 4CU7A 4FNSA 4CCEA 3W75A 2C14A 1EA0A 1UP3A 4ADSA 3T0CA 1Q7MA 3AICA 2VZVA 3CBWA 2BMBA 5I02A 3S5ZA 1R2TA 1YX1A 1OX4A 2PDFA 1E6SM 5AHNA 1MQRA 2X1IA 1L6YA 3VIKA 3VU2A 2NZLA 3URBA 3EDFA 2HPIA 2H9AA 3C0LA 2CHNA 1JD9A 2J7BA 2G41A 3O07A 1LP6A 1X1ZA 1W1A1 2G4FA 2GSHA 1BYCA 4UTMA 3B8TA 1E1CB 1O5QA 2A3AA 2JEQA 3ME3A 1XP3A 2FTPA 4XIMA 3E0LA 1S5WA 4QAIA 5D9MA 4NNAA 5DRIA 4GVFA 3WO8A 4JTQA 1E5NA 5E0KA 3W25A 9XIAA 1QOXA 2BVYA 1UROA 3EDJA 4QJ3B 1VFMA 4C60A 4JX5A 4QG6A 4M5PA 5D37A 5CPTA 1LLWA 1H5VA 2YFNA 4PSRA 5AC7A 1O60A 1MDLA 5F4XA 5E9AA 4OECA 2JIEA 1ZBCA 1UJPA 4XZBA 2PUZA 3GO2A 3VOFA 3W38A 1EUAA 1X6NA 4FXSA 4RJEA 4UTHA 5MKGA 5A8NA 2J8FA 4JPGA 3V1HA 3QV8A 1JCTA 1X96A 3SM0A 1GVFA 4Q8QA 3ITLA 1X38A 4RL3A 3R5EA 2ICSA 2VRJA 5A8QA 3SIZA 4IP7A 4FZIA 4FK9A 3W85A 5G4EA 4HU3A 3AXXA 3DFQA 1EZ2A 1F3TA 5DT7A 1UQZA 2A3CA 4GZ7A 4EAYA 3GVWA 4QS6A 2R1KA 2OX4A 1MEWA 1E6XM 2WPGA 5I3KA 1WKYA 3ES7A 2AL1A 1A0DA 1OSEA 1FWGC 5BXRA 1LBMA 1AW2A 3BQ6A 3OZYA 1AJ0A 3W02A 4NZJA 2RAGA 4RE3A 2YKKA 1WZMA 4IFKB 2OXNA 3HJZA 3VC5A 2A21A 2BBFA 2OQHA 1XBXA 4O12A 5I09A 4POCA 1B90A 3WMCA 1DWIM 3UJSA 4YYCA 1YXDA 1TZZA 2X1UA 1HJQA 2PE4A 4GXMA 1TMQA 3GNRA 3AYTA 2DP3A 1IV8A 1PJ9A 3EX6A 1Q4WA 3TDFA 4YHEA 1XDMA 2G37A 3TQVA 1RCXB 1PKMA 4XZLX 3W1TA 3B97A 3NZPA 3ITVA 1F4HA 3E38A 4W7UA 3U3HA 5F4WA 1XLGA 4JFUA 1UBSA 1RQHA 4AY7A 5KMYA 3S46A 5A2BA 1XG4A 3Q37A 4KEZA 2E5CA 1XH1A 1SMDA 4A3QA 4US5A 3HZ3A 1TV5A 5I3JA 5AOUA 4Q8VA 3QN3A 4LF2A 4W9TA 4NZ4A 1PZ2A 1V79A 2JF7A 1S5MA 2PURA 1G9HA 1OY0A 4GD0A 5KZMA 4WIWA 2R91A 1M7PA 3TOYA 4K68A 4J2PA 2NQLA 3LPGA 1G94A 4ML9A 3HQNA 1YNYA 2A3BA 4YVXA 1PSCA 4DX3A 2FZDA 3GXDA 1D7KA 2H3BA 3SI9A 2WSYA 4PN2A 4CN6A 1XWYA 3DHDA 3ABXA 3PBVA 1MSSA 4A21A 3FYYA 1TA3B 2HVOA 2F8QA 5CPLA 3FKRA 4B3LA 4KWWA 4MNKA 2YW4A 1I75A 4AZCA 3NL3A 4U3AA 3G1XA 4O4VA 2E25A 1YNPA 4KF1A 4FX6M 1ICSA 2FHFA 3IJ6A 1PTDA 3P67A 1ADDA 3N9RA 3ZIZA 4M8UA 5LHFA 4B91A 1OFQA 2EJAA 2ZZ7A 4ZTXA 3TOPA 1Q5MA 2QCNA 4U31A 3FV9A 3MUY1 4YWSA 3A21A 4PUWA 2QIWA 1VEPA 6ENLA 1XV8A 3ZJ7A 3DXIA 3E2SA 4A22A 1E5JA 3URAA 5D30A 2E4TA 4WOQA 3LMYA 4BQ3A 2INEA 2ZTJA 3CK5A 5CC7A 1VRDA 3MZNA 4LWWA 3KW3A 3CUXA 3CZGA 4YIWA 4Q4PA 4DF1A 1EWEA 3L67A 4Q4SA 4KGJA 3GW3A 4M0XA 3TONA 2WHLA 4JNMA 1OQFA 1EJ7L 3FA5A 3H2CA 5M17A 3V3WA 1V6TA 3KUMA 3EPMA 4UTTA 1LOQA 2DH2A 5A8MA 3UJEA 3B0UX 1NWSA 1PX3A 3NZRA 4LCRA 3GM8A 3EOUA 1I2NA 4GQRA 1LL7A 5HJXA 4TTUA 4HSHA 3WQ6A 3PANA 4ZE4A 3GG0A 3NWRA 1FOBA 5FJJA 1JF5A 1V02A 3ZR6A 1GOWA 4PMVA 4F2BA 3VZYA 3UJ2A 4AB4A 4DWSB 2E3ZA 3LV5A 3S2JA 4Y90A 4S3BA 4UUIA 1GK8A 3M47A 1RQEA 4F0SA 1XC4A 5D02A 1LRNA 3AFBA 1Q6DA 4G9PA 4MNJA 3T8LA 2ZXDA 1OCJA 3BGJA 3S3GA 4UNLA 5CAKA 1KRAC 4HGXA 2OSXA 5D4YA 3TV8A 3I4KA 4NSBA 4AG0A 2Y7GA 1XSIA 4YTSA 2IXUA 4MWAA 1UKSA 1OT2A 3U9IA 1RY8A 1B3YA 4J40A 4AUBA 4HJWA 1HW6A 3N6JA 3T0DA 2PGFA 4NZCA 3L7RA 4GQ0A 1AODA 3B0XA 3LPPA 3LQLA 1UR0A 3N19B 4UFJA 3IUDA 4ZTYA 3VNLA 2NWSA 2OG9A 2ZA1A 5C8BB 1TV8A 1AG1O 4IOTA 1W8SA 4H8UA 4KS0A 1MRQA 1ZNNA 4HA0A 3CZKA 1B31A 4X63A 1A3WA 2MANA 4XUYA 1T99A 2Y8VA 1E0VA 1PZ0A 1BYDA 3LZ3A 2VEKA 1MQQA 4MAZA 1Z48A 1M04A 1VPXA 3C56A 1J0YA 2ZE3A 1LUCA 1W91A 3W7KA 1TQXA 4KQNA 2PI6A 2XIJA 2OT0A 2POZA 1D9EA 4XZMX 1GG1A 3MT1A 1XLDA 4DJDC 2ANUA 1E73M 2FGZA 5EA9A 1RVGA 2NUYA 3IACA 4GCAA 4N9CA 1OINA 5JBEA 3QY7A 1MUCA 4WOZA 1QVBA 4E3VA 2ZZ5A 4IT1A 3OIHA 1FXQA 2C15A 4A05A 4AHOA 3NZGA 1JEZA 2P0OA 2VVNA 3ID7A 3WUBA 5FSEC 1HT6A 3CYVA 4DB7A 1BQCA 4CLMA 1CB2A 4BWLA 4OUEA 3NPXA 3RPTA 4CD5A 3O05A 1ZENA 3GVRA 3CTTA 1JCLA 3BOXA 2E6YA 1YDVA 3RNDA 5G1TA 2A79A 1TPH1 1W17A 1UKQA 2BGNE 3UCQA 4XTDA 1TCDA 1PVNA 1UC5A 3YPIA 1EC7A 1EZWA 2WC7A 1VEMA 3VAVA 1UASA 2IXVA 2XIBA 3OQEA 3THUA 1GOQA 1W0MA 5CC5A 1J96A 2DSKA 4XD6A 2PDXA 3IJQA 5C2GA 3DI1A 5D33A 4OBSA 3UZ5A 1E0XA 2V2HA 4MVAA 2NUWA 2ZX5A 4D6GA 1JQXA 1OD0A 5K2ZA 4NKCA 4Y8EA 3IAQA 1J93A 2PA6A 5EU9A 4F79A 7ENLA 3Q58A 2NW0A 1HO4A 1UWUA 4I9MA 4LB4A 2VENA 1H7OA 5PTDA 5AYYA 4XKMA 2BOGX 1KR1A 2G50A 1C90A 5AZ0A 5I00A 1W1YA 3OBAA 3MVIA 2E7FA 3SB0A 3E02A 2PRLA 2RDUA 1SFSA 2OODA 2GGEA 3MYOA 2ZX8A 3UXAA 3W73A 3QMRA 2Y89A 2QAPA 8A3HA 3GKFA 4IGHA 2NXGA 1FP8A 4HNUA 1CT5A 1IE7C 3UEQA 3TNBA 4GRSA 4UMBA 1OX5A 1I6NA 3P8IA 2KX9A 3L2IA 4FOKA 4PTVA 3VGFA 4TVCA 2PDQA 1TJ0A 2XWEA 1HJUA 4NIRA 3WQ4A 2CWNA 3QC3A 6REQA 3KVJA 2VX4A 5K7JA 4ZBCA 2XH4A 3WLMA 4PR4A 1U1UA 4DUVA 3LHWA 9CGTA 1R3SA 4E2OA 1QJWA 4NG3A 4WLCA 2WMGA 4RDZA 5A8OA 4AZ5A 1TE1A 2ABAA 3R8RA 3PWIA 3KBMA 3PP7A 3JZEA 5LZLA 3TMQA 2GJXA 1H0IA 3KCOA 4ZR8A 3TEVA 3Q65A 3DN5A 4RPQA 2QYGA 2L5HA 1Y7VA 1H3GA 3SW6A 3ATZA 3NQBA 3W7JA 3TYDA 4BF9A 4GBDA 3TKFA 4Z1DA 4QIUA 4JICA 4K8GA 2ZXAA 3KP0A 2B0MA 2GUBA 4A8IA 4DO7A 1RV8A 1A5NC 5ABFB 3MWAA 4E0CA 2WNQA 2AL2B 2P76A 3BURA 4Q8PA 2WZEA 5DRCA 1BXNA 3QOMA 2YB4A 4URIA 1CXFA 2DSUA 2OO0A 1YE4A 3MJMA 3TTSA 1ISYA 3W23A 3UPWA 1O7AA 4B4HA 1LORA 1NARA 2YR1A 4L56A 3KBNA 4I7WA 5AHLA 5I3DA 2UY2A 2WNWA 3CAKA 4RKAA 5H6HA 4F48A 2VEMA 2VX7A 3WH5A 5JU6A 1EP1A 5FF7A 1OIFA 3VDCA 4W85A 3C0SA 1AQ0A 4D2JA 2OEJA 1JYXA 5FJRA 1MXGA 5FJPA 2QUVA 1P0BA 4KETA 3CMFA 4FO4A 4JQAA 1UD6A 1CTNA 3STFA 1L8PA 3WF2A 4ERGA 3R1ZA 1MNZA 1A0CA 1H60A 1ZTVA 3QSTA 5J04A 3SY8A 3P60A 2GWNA 4DLFA 2Y7FA 1SMAA 2WLYA 3CAWA 4LRSA 4LVFA 1CGYA 4GH3A 4KCUA 1Q66A 2Z2BA 4WF7A 1JPMA 2X7WA 5CC6A 3TYUA 5FL0A 1WKEA 3T0TA 1C8QA 1TG7A 4QM1A 3MSRA 3B4UA 3W1XA 1R46A 1RLCL 4HYVA 3P62A 1GQKA 3IGXA 3ABQA 3HMJG 4R7JA 4O14A 1F76A 1GPWA 3TQPA 3TNOA 4LAUA 2GJNA 2DDXA 3N3TA 3BLEA 1A3HA 3R0DA 4ZOBA 1IQ8A 2V2CA 2E8YA 1JNDA 1SYTA 2VEIA 4IXXA 1HKKA 3WLRA 3LEPA 2R6OA 5DN1A 3WDJA 1FHLA 4UFIA 3T08A 4LOCA 3GBDA 3BJSA 4MZ8A 2VWSA 3AZTA 2J88A 3URNA 4UFLA 1GW1A 2VJXA 2Z1WA 3CGTA 3N13A 4PODA 2DORA 4NAFB 5TNVA 3E5PA 2PWFA 3BAWA 1JAKA 3MHFA 2VYOA 4Q4OA 3DYOA 2QCFA 1AUSL 4QEHA 1AQHA 5AVHA 3VNIA 1EQPA 2Q8XA 5I78A 3TA6A 4E6MA 4FXFA 1DORA 3PB0A 2RGMA 4DF2A 4EF8A 1F61A 1RQBA 4F40A 6TAAA 4K8HA 3IIOA 3IPWA 4QQ3A 1BLIA 1A5OC 1XQKA 2JKPA 3QY8A 4S23A 3VDGA 4J5NA 4Z0JA 3MS8A 1W37A 3LZ5A 4IMCA 1UD2A 3DIPA 2VFGA 3B0PA 3BZJA 4MG4A 1F7BA 4U2YA 3USBA 1R0MA 4JFVA 5BROA 5MHBA 1GT8A 1PYMA 1FWDC 2Y88A 1E9LA 3PPCA 2FPYA 2P10A 4REQB 3NYZA 3AJXA 4LALA 4CQBA 2ISVA 1P6BA 3S9ZA 4OZOA 5EMUA 1FH8A 4Q6JA 3UWUA 1BFNA 5HXMA 2VCCA 2VFHA 5JMUA 4GKTA 2VQUA 5F7UA 3P3BA 3SSJA 5A8GA 4BK9A 4MB5A 3RRXA 3CEUA 4IMDA 2SFPA 1CZ1A 5B7ZA 3OLEA 4QP0A 2FJUB 4KIRA 1W3JA 3I65A 3PG8A 1LROA 3TJ4A 1GVRA 4JEQA 2WNZA 2GDUA 1XLKA 1UKOA 2FZBA 4GXPA 5FD0A 3V5OA 2TYSA 4PEKA 4DO6A 2FFIA 7ODCA 1K7FA 3FK4A 1NSJA 3NVDA 1IEIA 2VOMA 4W8BA 4L4PA 4DO4A 3MC5A 2E9BA 2EG7A 3RU8X 5C55A 3UZXA 2H8XA 1IWAA 1CW2A 4GC3A 4FIRA 4ILSA 4NYYA 3VZZA 3UXLA 3KOZA 4LXFA 4E2DA 2GGGA 1TREA 2XFWA 3EKGA 2PDMA 1GUVA 3EB2A 3WH7A 1KQZA 1WBJA 1TVPA 1HL8A 1CLXA 4RDVA 4BZYA 4ZOEA 3UG5A 3G1FA 1OZQA 1F3WA 4TU1A 2YA0A 1KRMA 3LTPA 4JX6A 4JTLA 1QNRA 4V27A 1V5XA 1DPMA 4H41A 5HOSA 3WLQA 3ARVA 4NHVA 1U5HA 3MJYA 2WMHA 3BARA 4AH7A 4PCPA 1AH0A 2TODA 1MO0A 3HJEA 3DHUA 1JCYA 3NM3A 4WY0A 4TXEA 3G5EA 1XPGA 2XZ7A 3GG1A 2I7GA 1G69A 1V3JA 4R27A 2QEZA 3TYZA 1HP5A 4RV8A 1KO0A 3RMEA 1WP6A 3N4FA 2XSXA 3HO8A 3F1QA 1QXLA 3UBPC 3RO6A 3UJRA 3B8VA 1F73A 3QHMA 1V6WA 2CCRA 3LX9A 1SO5A 1QBBA 1OWQA 5ECVA 3PTMA 3VE9A 2QCHA 3UP8A 1GCYA 5D2VA 1VLIA 2GQAA 3UD6A 3WZ0E 4LYRA 4I5XA 3B8WA 3SGZA 1GZJA 2RGLA 1FWRA 5BXPA 3SFWA 3IK2A 2PDKA 4NAEA 4N4QA 4V2XA 4FLRA 1JUKA 3HQ1A 5C9WA 2ZUWA 5G5IA 1Q4NX 1VFSA 4Q4QA 3WK0A 2OKTA 3RX2A 4PUDA 5I3HA 2DT1A 4GJIA 2PTZA 2DUZA 4X60A 1M03A 3WQVA 3N2XA 4QROA 3UVIA 3CO4A 3AHTA 3IV8A 3WDPP 5EJZB 3M0VA 1YMYA 5G4WA 2G8ZA 2XDFA 5H1WA 2P5NA 3W7EA 1HIZA 4MWAE 1X8CA 2J8GA 5CGMA 2QV5A 4Y6GA 2Z29A 3TC6A 1RJRA 4JTFA 5DCEA 2DZPA 2YYTA 2MNRA 4WQ6A 4DXXA 4CVUA 3JUGA 1UWSA 5HQMA 3CQHA 1LWHA 2VD8A 3ITOA 3RM9A 3VDAA 1XG3A 3SCRA 5JH1A 2PODA 1TTPA 4LH8A 2DJXA 3E5BA 1TIMA 3NIYA 3GAKA 1VFLA 2PDIA 3IVTA 1T8XA 5HNRA 3SRHA 1TPUA 2DU2A 5K9CA 3A12A 2XUCA 4C7FA 3AMKA 1XW8A 3W7QA 2FJKA 1CIUA 4HB7A 1AQFA 1POJA 1V3LA 4LNCA 4DXVA 5HJYA 1I1WA 2NV1A 1TX2A 3QHNA 1VJSA 3DC0A 3ZWTA 2PBOA 3QHOA 1GTHA 5FL1A 3W4RA 4F66A 3VGEA 4X2RA 1QPRA 2QVHA 4H83A 4O53A 4L1WA 3L5AA 4G8TA 1ZP4A 2W92A 2KZHA 1XLCA 5L6UA 3PAOA 2V3FA 1XCWA 3F5KA 3M7SA 2JE8A 3KDNA 4O8RA 1EPXA 4UBPC 5ENLA 3KWSA 1KW1A 3WD4A 4YCOA 4OJYA 3AOFA 2E6AA 3V0SA 4FNQA 1FH7A 4K38A 1FCUA 2BFGA 1L2QA 3UXKA 4XVEA 4GJ1A 1GVYA 3GLCA 3AUOA 1R3WA 3ARPA 4ZO8A 3EA2A 3T0AA 3UG4A 3N14A 2R1MA 2BY3A 5BZAA 3HV9A 3NQVA 2J7HA 3CH0A 1GOIA 2IPGA 4IX0A 4GISA 4Q7BA 4UFMA 4YU1A 4YVVA 3PG9A 5TQLA 2XHYA 1S5NA 3ONCA 3Q2DA 2EKGA 1H1ZA 4FB7A 1XYFA 4RXGA 2CEQA 2WJFA 1E1CA 3DI0A 3FW6A 2WSRA 2P0IA 4AXNA 8XIAA 2Y7DA 3MV11 2DZWA 5JH2A 5AHFA 4BS0A 3BUVA 4KFOA 1LF1A 2QXWA 1PV8A 1GQJA 4NX5A 4XV0A 1DYSA 1XRSA 2Z7KA 1FQ0A 4EF9A 2HK1A 4S3AA 4C5YA 1UPMB 2V6AA 3M0XA 4NJJA 5EMLA 3H55A 3WEZA 3VMPA 2J66A 5HDRA 4UCGA 3DKJA 2B7OA 3CH9A 2J7FA 3F4VA 4LUTB 3S6TA 2O0TA 1ML1A 1TUFA 1JDFA 4PE8A 2R82A 1XPYA 1B57A 4FX7A 2Z2UA 1A47A 3UWVA 5LHEA 5AHIA 3WG6A 3R8GA 3GFXA 2HBXA 2J9XA 3FAXA 4Y7EA 3H53A 1UH4A 4MHBA 1K70A 3LTYA 3P81A 1WZKA 1XH2A 4MAVA 3TC7A 2CXEA 2QPUA 3I3BA 2WCSA 3ARRA 5EIYB 1K9FA 4XSMA 4HPGA 2V8ZA 1NDWA 1OFPA 1ZHAA 3RXZA 1WUFA 3RLVA 3P2VA 2WZTA 3SN0A 3VKBA 2IUZA 1JZ5A 3C86A 1HJWA 4UTJA 3DU0A 2BV9A 1UD8A 2OMAA 3MUIA 1LM1A 1G1YA 2A3EA 3WBYA 4AWTA 1W5MA 3QKZA 4IFKA 1K03A 1ITUA 5DO8A 5FAGA 2IQDA 3M6DA 1H2JA 4XO7A 1TTJA 3FXYA 2YBTA 3POHA 1IHIA 2WANA 1C8YA 1ME8A 5J5RA 2ZBTA 4WGHA 1Y5XA 4PUEA 2V67A 1TPVA 1ZU8A 3M5ZA 3IJLA 1H7WA 5E9XA 4HNCA 1K7XA 3O0KA 2O7QA 3OHIA 3C2VA 3W2MA 7CGTA 1C7SA 1ZSXA 3GDLA 4M19A 2E9MA 1D2KA 4M82A 1K7EA 4UQEA 4AZ6A 3MSGA 4QJ4B 3F2DA 1H5YA 2PWUA 3UERA 3W1AA 1BWKA 2QUUA 3QSRA 5HBFA 5KSWA 1EJSC 5CGTA 1HVXA 1H09A 1B1YA 1WBHA 1E15A 1XUZA 1P7TB 4GY1A 2CZFA 1EF2A 4TV5A 5IOBA 5EFFA 2HRWA 3H24A 3UR5A 3DYPA 1GVOA 3UYCA 4I3GA 2YOCA 3EB4A 3M5XA 4HYRA 1TA3A 1J18A 3WLPA 1M7OA 4JTUA 3GNXA 1M65A 2FPVA 2I1OA 3K5XA 3UPBA 1JCNA 2W4XA 3VOJA 4HPHA 2X0HA 4XZIA 4N9BA 1E4MM 1MFVA 1IWPA 1E1EA 1XHGA 2HVNA 3A9BA 4OGZA 3FDGA 1YPFA 3N4EA 3WD1A 3XISA 2HK0A 3PAJA 5F1UA 3VCRA 2ZRUA 3VFLA 4P7LA 3VCNA 2OOFA 3VD5A 4P7QA 2BXZA 1P5BA 3G1AA 1OC6A 1X7IA 5IBXA 3VO0A 4H4IA 5TF0A 4JL1A 3FYOA 1TMHA 1B54A 1OF8A 3VZXA 3UWEA 4XUGA 2DVTA 4H9TA 3QF0A 1KGUA 3SIMA 3L65A 4QDMA 1OFAA 4XX6A 3WQ5A 5DCDA 3C2EA 2HPMA 4XSLA 1KBBA 2QT3A 3IJIA 1LQ2A 4K36A 4C90A 4FEZA 3MVTA 2VC6A 1IR2A 3BLDA 4GGBA 1DJZA 3ISIX 2WMKA 1GOXA 3W7OA 1K9EA 1UWQA 4LPCA 2YCJA 4ZENA 1PHWA 3GHSA 2A0NA 2QUNA 4GNJA 1RP8A 1UJQA 3C3NA 1T5AA 3RIKA 3AIUA 2F6UA 5IXEA 3NM1A 4I8DA 2DZTA 3CNYA 3H2FA 3NQFA 3IRSA 4IMFA 1XI3A 4P61A 3UF9A 1MRAA 1I2RA 4D6DA 1DTUA 7TAAA 3LGDA 3H70A 1MEIA 5C0QA 1H4PA 3H4GA 3PZMA 3HOJA 2DZSA 3TR2A 2V0TA 4DWSA 4M3PA 4KBXA 4QE5A 3KL3A 3TJIA 2XGZA 4G5DA 2A7NA 1J5TA 4CCZA 1CDGA 2XH0A 3R4IA 1ZPTA 3F2BA 3IIZA 1SM9A 1PIIA 3DFPA 3T6CA 5JBDA 4CNOA 5D03A 5G2IA 4XAFA 3VKDA 4V1YA 1H7XA 3A13A 1T96A 3H6OA 5AB3A 4DBUA 2C8NA 1OYAA 1PDZA 2XGBA 4Z08A 2B7QA 2Y6ZA 2XVNA 1UH2A 4KFPA 3H2MA 3EXRA 1WAWA 4JDYA 1ICQA 1HGYA 3N2TA 3W1NA 4Y9OA 1TYGA 5HMEA 4DAFA 5A1AA 3GE7A 5FEXA 4DYJA 1PXGA 1KFCA 4EVZA 2V2DA 4IPNB 1EO5A 1D3HA 1A5BA 1UBPC 3FEMA 2XIMA 3EAUA 3W29A 3VIHA 1G7UA 1TPFA 5A6SA 2XIOA 1T6MA 4W8AA 5EL1A 3BXWA 2WMIB 1KBIA 3W22A 3TW9A 4LEFA 1JR1A 3UG8A 5FJTA 4DZAA 5HATA 1TRIA 1A3XA 2VL4A 2FFCA 2IQTA 3ABZA 3EKLA 4EPBC 1QPQA 1S3TC 5D32A 4UXDA 5LYRA 3U6WA 1XDJA 4D8ZA 1HKMA 4MZYA 1EEPA 3BSHA 1W9DM 3FA4A 1ME7A 2VVSA 1G7VA 4NASA 2ISSA 3A22A 1SW7A 3H2OA 4WVXA 1ME9A 3RRAA 3LYEA 3E2QA 5U4NA 1QNPA 4NNBA 2PWHA 2QS8A 2VEFA 3NQMA 1CNVA 2CYGA 4DJFA 1TUXA 2D3NA 1YDOA 4ALDA 1WDQA 1YRRA 4S3FA 2DGAA 4QBXA 1BQGA 2PD9A 4PCFA 4FALA 1Z69A 8RUCA 1FWAC 1E6RA 1QI0A 2WWCA 4AEEA 1J0KA 2VFFA 1JXKA 2AAMA 1ZS2A 4S1FA 4CNTA 2Q6ZA 3LGGA 3NSXA 3DYMA 4RZ6A 2WZHA 1SVDA 5HA7A 3N2OA 4GQQA 2FHCA 4MB4A 4IPLA 4HD5A 2OT1A 4W5UA 1TMLA 4ROQA 1NFPA 3CB3A 3PK7A 1SR0A 4V1XA 5LSMA 3AZRA 4GABA 5C7HA 5I24A 4GOAA 3NGJA 1NFGA 5CKSA 4ZQPA 4L7ZA 4MYXA 1RD6A 4R7OA 4FAMA 2ZDSA 3NL2A 3R0KA 1R9YA 5LNWA 4MSSA 2Z4GA 4OTKA 3HU7A 3S9IA 3AU2A 2WLZA 4Q7IA 3WMBA 4S3JA 1UOKA 1PL9A 3UT0A 2OSWA 4C65A 4IFRA 1IXQA 3AALA 4HTYA 3C61A 1DQUA 5F1VA 1XICA 4RNJA 2PRMA 1CX9A 1XCXA 4WGXA 2DIEA 4HCDA 3WDQA 1GQNA 1SFLA 1F3XA 1ZCCA 3AO0A 5LIWX 4Q4RA 1WO2A 1VJIA 3H2EA 4WHBA 4EPEC 2KAUC 3IGSA 1BVZA 5CJNA 4FOJA 1AJ2A 4M81A 1VYPX 2Y4SA 3NQCA 2X2GA 4IQLA 1QWKA 3UCCA 3DX5A 3W70A 1B9BA 3GWQA 4J27A 2C7FA 3S5SA 3GC4A 2EG6A 2E1WA 4GYPA 3TK7A 4B5XA 5I3FA 1LJYA 1W9XA 1I2PA 3H7RA 1A4MA 1XCFA 4UQBA 3OGSA 3QPEA 1GQLA 3WSUA 4DUWA 4HNLA 1TTQA 2Z1VA 4C5ZA 5M1TA 2VZUA 5LIYX 1Q45A 1A4LA 5HNUA 3HPZA 4FX8A 1N82A 3M4HA 3M9YA 5E0CA 1MW3A 3WLIA 4CVWA 2WSQA 3V36A 4AMAA 3N04A 1PAMA 2OPJA 1QHPA 4TR9A 3C8FA 1IXOA 4S2BA 1YXYA 1VR6A 1O94A 4C6QA 4GI8A 2ZX6A 4L6DA 2VP8A 3U7VA 2FGLA 3W6LA 1HZYA 4V33A 1C8XA 2RDTA 4MJ2A 3CUGA 3WUGA 3H7VA 2IQ0A 1XQLA 1Y8BA 2X30A 3C5QA 1B4EA 5ABFA 3DECA 2QV4A 4Z17A 4Z2HA 5HR7A 4UCFA 1ZP3A 2AL2A 4I9TA 3TZNA 3T05A 2AKMA 2PDPA 2GUUA 1Q6LA 3EMQA 4C7DA 1EGZA 2ZZ6A 4ZQMA 4O1FA 5FIPA 3E0IA 3PUGA 3TYAA 3DG3A 1U1HA 4QDWA 5I6SA 1A5KC 3GIYA 2YLLA 5LA0A 3WFAA 4L6OA 4G7FA 4EWND 3V18A 4W93A 2AOSA 1P0EA 7REQA 3PTKA 1HKIA 4PFMA 3T4CA 1AZ2A 3PUOA 2Y1HA 2YCEA 1XDLA 3TLLA 1UUOA 2WHJA 4E4UA 1W1VA 2GK1B 3G77A 1VH7A 5A6MA 1GWJA 3TW7A 3DDMA 3BL3A 1R3TA 4IIGA 4TVUA 3L21A 4NZ1A 2BGQA 4F4RA 1UP0A 3VIIA 1VYSX 3WJSA 1US3A 3KS5A 5BCAA 1EJXC 2Y8KA 1SSGA 3EOEA 3KRBA 4G6CA 3ZLHA 1KCZA 4DBWA 4JTTA 1OYCA 1GTEA 1X1OA 3P5YA 2HWGA 4H3DA 2ZZ1A 2WKGA 1KM4A 3QGAC 3W1QA 3N2MA 3INPA 3CUFA 3PNUA 1J2BA 3P6LA 4WSJA 2VWTA 2RKXA 3W1PA 5XINA 3NAVA 5FACA 3N25A 4LC6A 4C1NB 3TMLA 2RFGA 2Y63A 3LOTA 3KVMA 2JIWA 2X1RA 3Q4DA 2O55A 1VAHA 3GNPA 2OO6A 3OVQA 1OD8A 3WQFA 3BH4A 1S46A 4IQDA 2J6VA 2ODOA 5AYZA 5E93A 3WJZA 4TV6A 3SCSA 3WBWA 3OLDA 1ZAJA 3CB8A 1JJKA 4UR7A 2QF7A 3E0WA 2FKPA 3VX1A 4YNGA 4NAFA 3N11A 4PCTA 4GA8A 1U30A 2BSLA 1XRFA 1V6XA 3W27A 4HKPA 3M16A 4K7YA 1SR9A 4IP5A 2PTDA 1XIIA 2X1SA 5FSDC 2OX1A 1MWOA 5BRPA 2QMJA 4QSHA 2PPGA 4PMRA 4Z1BA 4AHQA 2DZAA 3V75A 3SZ8A 4FHAA 2ZADA 4R7WA 1IZJA 3M64A 1K02A 1BSIA 4PBGA 3S5NA 2A7PA 1QNSA 3CWNA 4IMGA 4DI9A 1WPCA 3A3HA 4REQA 3B8DA 1RALA 4JYEA 2BZNA 4KGLA 5I7GA 2Y70A 3IIXA 5RUBA 1U2YA 2NV2A 3TYCA 1EWDA 4PMNA 3PUEA 2OKOA 4MADA 1E4IA 2Q09A 3A23A 3P82A 4KCWA 4DJED 1C93A 3U4FA 5LGZA 3U2ZA 5H2ZA 5DF0A 3TUUA 2BVWA 4Q22A 2CLFA 4HHPA 1N8IA 5FAJA 1GOKA 2GYIA 3AMCA 3HG2A 4Q7NA 1XSJA 2FB2A 1FBAA 5HMFA 1UR2A 1XC6A 3S9YA 1H51A 2QJNA 1DHKA 2BDQA 4IL2A 3CM4A 1VYRA 2HSAA 2WXDM 3DFTA 3PM6A 2OZ0A 1JDAA 1P4CA 1SJDA 4G7EB 2FZ9A 4PUUA 4ADUA 3GDMA 1LTDA 3IVUA 1VF8A 3ITTA 3O6AA 4ZO7A 3EBVA 1S5TA 1V7YA 2Q01A 4I90A 4PZVA 1AL8A 1HJXA 5BOOA 3VD9A 3VDHA 3BLLA 1UC4A 2E67A 4X61A 5IHSA 4ERAA 4JL2A 1I8JA 3PJXA 3EA3A 3MP4A 1UIPA 4LVDA 3QW3A 3S4TA 2EJ1A 2R24A 3HG5A 2DT0A 1ELSA 2NSOA 3CQKA 4YJ5A 1VBRA 2GFTA 2E40A 3MMUA 1UA3A 2Q3OA 2J8TA 3AHXA 3OVGA 3ANVA 3AXMA 1VFTA 2J74A 3ICJA 3TTEA 2YL6A 2PDUA 1VRXA 4R3UA 1GVIA 2E5DA 2G4JA 3QLLA 2OWWA 3MO4A 4IZGA 2AQWA 5H8MA 1ISXA 4XZHA 4B92A 2WV8A 3L0KA 2PEVA 3ZMRA 3RR1A 2CLIA 4NUWA 2PTYA 4FOUA 4AY1A 3TE9A 5A3HA 3EWZA 1BSLA 1YDYA 3PVFA 1ADSA 4QRNA 3UCDA 4AVOA 3B8UA 1EC8A 3ECQA 3ITXA 3TLQA 1XUUA 4UNKA 4B3ZA 1AMKA 1DBTA 3NFUA 3I4EA 5D9OA 1UD5A 2ZRYA 5HJLA 1KRCC 3M0JA 1R3QA 1MEHA 2CLMA 1QHZA 1FKXA 3C0QA 4JN6A 3VNJA 3DHPA 4MFDA 2V5LA 2INFA 2NUXA 4PB5A 3QTPA 3AHZA 3B9OA 3LUTA 5D2YA 2A3LA 3EDDA 1CBGA 3A4WA 3MCOA 1E0TA 3C6CA 4EXAA 1TQJA 3HGOA 2PLMA 2G0WA 3RFAA 2I9UA 3FN9A 3WQDA 3PBGA 3VMOA 4HNTA 1M41A 4NRSA 3GFZA 4JR5A 2W66A 1GONA 4PC8A 3I7RA 4FLSA 3IRDA 1MQPA 1BAGA 3W1RA 3BANA 3BCDA 2FVLA 1U5JA 5G1MA 3W6YA 3HGJA 1T8QA 2Z1SA 4QNEA 2UY5A 4CN1A 4Y9MA 5K9XA 1WXJA 4A29A 1EC9A 2GOKA 1EP3A 4M56A 3S1UA 3UWWA 4DYKA 3NXLA 2UZ9A 3MKKA 1VCFA 2E28A 4IP4A 3EMCA 1MUWA 4LX4A 5AYIA 3JVAA 4US6A 5A6JA 1W31A 4QXIA 4XD4A 4YPJA 4H7VA 1KFBA 3IWPA 1J0ZA 5D05A 1SFTA 2RUSA 1SO4A 4JY8A 3F2CA 4XKYB 2QW5A 3EXSA 5CZKA 2YCIX 1DE6A 1F2JA 2NWRA 1Q7ZA 3MWCA 4ML4A 3CMJA 4J3SA 1OFBA 4QG8A 2ESCA 3HPXA 1TVLA 3TQ0A 4DUXA 2QF8A 2J13A 1EA9C 3S1GA 3D3FA 1SW3A 4HK5A 3WDIA 2PBGA 2Y5SA 3WNOA 3TSBA 3RCNA 3Q67A 2OYLA 4Z2LA 2G95A 2OELA 1JFXA 4JGDA 3KFTA 3NEVA 2VR4A 4DPQA 4CKQA 1O5KA 4PB4A 4TO8A 4YMZA 4R33A 4NI8A 3AISA 4DRSA 1TZ9A 3C8NA 5GNZA 1RK6A 2HS8A 4A3UA 2C0AA 3VOCA 3QQ0A 2EPMX 3G1HA 2DJLA 3BMVA 3FX4A 1GOOA 4JHMA 2CW6A 2ZVRA 3R79A 3VDBA 1GZ1A 2WOQA 2CETA 1QWGA 2H9AB 5FF2A 2JK2A 4XQ6A 4RLIA 2R1NA 1ENUA 1FWBC 2NX9A 1LG2A 3OJGA 4YLWA 4AYGA 3E3HA 2DZVA 4V15A 3NA8A 5FJIA 3R2GA 4F2TA 1K8ZA 2J4GA 2QJGA 3R58A 2VGIA 3S1XA 4XAGA 1MMFA 4N6FA 5CBJA 4LTSA 2J7CA 3VIJA 2J47A 4WSHA 1F6YA 4GX8A 4LUJA 1PCWA 4A8NA 4UTUA 1N8FA 5CSSA 3I68A 3CIWA 3MBDA 4H00A 3MMTA 1BVNP 1F07A 4H6EA 3WLNA 4C1LA 5LXXA 3VUPA 5EBUA 1KB3A 1G0CA 1GEQA 3HM7A 2XGIA 3SGGA 3UR8A 1E9IA 1OZMA 1VCVA 3CIXA 3IIVA 4ORIA 1QPOA 4S38A 3NXFA 3PJUA 3VIPA 2C16A 4J3UA 3E49A 3CS2A 3NR0A 4X0VA 2WHKA 1EQCA 4WXYA 5IFTA 4LUTA 1KFKA 4K8EA 1VBJA 3UZZA 3MDUA 3MDWA 1CEOA 1C92A 1DQWA 1V0KA 1YHTA 3P14A 3B9DA 4ZZ9A 1QNVA 2VT0A 1BD0A 3B4YA 3W2NA 3REQB 3PBUA 3W84A 1JZ3A 4HSNA 4LSBA 5HNNA 4FF5A 3W83A 4L4LA 3TH6A 3LLDA 1NDZA 1DWFM 3DFYA 4IPIA 2G3FA 2QUMA 4Q4KA 3UY8A 1KWGA 1M5WA 2V63A 2Z00A 1H62A 1FWWA 4FLOA 4S3EA 5C9XA 3NTYA 2D24A 3XIMA 1VZWA 2ISWA 1CENA 1CGWA 1UMYA 1XR2A 2YXOA 1FWIC 1OYBA 4L65A 4PTDA 4B5WA 4H7CA 1BXBA 2CWXA 2BVTA 5BWFA 4LANA 4GYKA 1EDQA 2TMDA 3MUCA 3SUTA 4Z2IA 3EB3A 4IIBA 1V4YA 4M29A 3UA4A 2VUNA 2WZIA 3PWAA 1DWGM 3RO8A 3MCMA 5C2XA 1Q63A 1IYXA 2V3EA 5LXEA 2YDSA 1E51A 3SUUA 2IKHA 4DBSA 5I77A 3GDRA 3USZA 1JD7A 4A3RA 2WBKA 2QLYA 1FUYA 1HF6A 1CXHA 2ADAA 4LNYA 4HNOA 4S39A 4LJ3A 2C13A 1GEHA 1FWNA 1U83A 2HZGA 5A6KA 1FTXA 4IJCA 5A2AA 1QMLA 3NQ8A 4Z1CA 2VCAA 4Q8MA 4C6PA 4H6KA 3BJFA 1P7TA 3WQWA 3HG3A 3KX6A 1XIMA 4XISA 4C6MA 4MGGA 1Q3NA 1H49A 3OZPA 2YJQA 4HJFA 1TR9A 2YYUA 4AXKA 4M1BA 1ONXA 3DHFA 2XIQA 3ZOAA 4QGCA 4HK6A 3NPUA 4E8DA 1OG0A 3NEHA 1TV4A 4M6VA 4PSPA 1HXJA 1FHDA 4MOZA 4OBRA 1QI5A 2V82A 1W5QA 2YL8A 3ZLFA 4LBSA 1EOKA 3N15A 4RNFA 4BA0A 3QY6A 3L4UA 3MANA 2GQ3A 4W86A 1OHLA 2PAJA 2XN2A 1R3YA 2XN1A 1PO9A 3OG2A 3K8LA 5BW6A 2VFIA 5ABEA 1XM3A 4MY1A 2QCMA 3O16A 2EAWA 1GJUA 3N18A 5EMKA 4Z2GA 4N7QA 1LL4A 3NQDA 1OADA 1F4AA 1Z6KA 1KBKA 2GGJA 1EJVC 3DC8A 4U33A 3A5VA 2ZUNA 1Q8JA 4UTTC 3WL1A 2V38A 4O11A 1BG9A 5T9BG 4MTVA 1L9WA 2J78A 3N17A 4ZEPA 4J1OA 2P88A 2VX6A 4HT3A 3L5LA 4FR6A 1RJQA 5BYWA 4JNYA 4NJIA 3DUGA 3ARQA 1ITXA 3SUWA 3WJWA 3QQ1A 4O54A 2WNNA 4NRRA 4P8XA 4XAZA 1B3XA 4KCVA 5DT5A 2CU0A 2Z1BA 3FCPA 4Y8FA 4KPLA 3GAYA 1BTCA 3UESA 3LM7A 1TZ7A 4GQBA 1W1PA 1SZEA 5KZDA 3GH7A 4QS5A 5XIMA 2I9EA 4ZFMA 3V1PA 2A2IA 3ARTA 1C91A 2ZXQA 3S6DA 3UY7A 3F7JA 3EX2A 4Z0SA 4NILA 4JTEA 4MWAC 2V81A 1H7NA 4HYWA 2G97A 2BY2A 4JIPA 4GFIA 1TV3A 1ONEA 1UR1A 3BOFA 5DX7A 1BPLB 1TX0A 5DEZA 5I23A 4YTQA 1BEUA 4GH1A 5G4HC 3HGSA 4AD4A 5CPQA 4DHGA 5T91A 2QQ6A 1ESWA 2D20A 2PDBA 4OKDA 2A5HA 3R12A 3PSWA 2F2HA 3ABOA 3AIRA 4ACZB 1RCQA 1QPNA 2WM0A 2ZQ0A 2BASA 2EF9A 1JZ7A 1KBLA 3A4AA 1NF7A 2BG5A 2VRQA 1RZMA 4WDWA 1TPB1 3NPVA 5EMMA 3BZGA 3WBXA 1KM6A 1E71M 1KTBA 1W1B1 1TPWA 1LUCB 1XKJA 1QOQA 5CC3A 4PRWA 4BQ4A 3CV7A 4JTJA 1F8MA 3MP3A 3VILA 5HWNA 1SU5A 1CLVA 4LCSA 1KFWA 5CEWA 3SCWA 4C6OA 2Y85A 4NX0A 1W3NA 4JQ2A 1V3IA 2NXHA 2WMIA 3VGDA 2WHMA 1R8LA 2YSWA 3V5FA 3CL8A 4BQ5A 2OEMA 3WJYA 5BMXA 1XD1A 1Q8AA 5TIMA 1NELA 3N34A 4O13A 2VDIA 4BWLC 1GNXA 1J0HA 3TTYA 4BEQA 1FXPA 5AHEA 5C9UA 1YIXA 2X09A 3KTSA 1XFCA 5E70A 5CG7A 4HHMA 1UR3M 3OPSA 8TIMA 3ERPA 3LCIA 2W9MA 5FF3A 1QK2A 4DJFD 4TOQA 1ZBVA 3FVMA 1EGMA 1DP0A 2EPOA 3NO5A 3ARUA 3RLUA 4JTKA 1GJPA 3H7UA 1KNWA 3BLKA 3I6RA 1JULA 3K4DA 2GJLA 1HTIA 1MW1A 5IFPA 3FJNA 1WZLA 3QR1A 1BVWA 4IX2A 2WJEA 5I3IA 1LWIA 3LHYA 1FVPA 3L4XA 4JN8A 3GUGA 4UZSA 3MKVA 3CZEA 4RE0A 2ZXBA 5C54A 3EWUA 2CLOA 5E09A 3BO9A 3FKKA 4M6UA 4NNCA 2OB3A 2OOGA 3IANA 1JPDX 3MY9A 3TJXA 3VTRA 3BCJA 2QDGA 1EDTA 1NWTA 1G5AA 3ZXWA 4KWUA 2V3DA 1VHCA 1VPQA 3SCOA 2GUYA 4R9XA 3FJLA 3ZT6A 2GVLA 3CHVA 1QR7A 3PSVA 1JCXA 1R47A 3OHMB 4KH2A 3GZAA 1V0LA 1UKTA 5EY5A 2ZC1A 5FI8A 1P48A 2ZE0A 1XRTA 1ZFJA 2OQYA 3LD5A 2Z6JA 4AC1X 1DWAM 1KKRA 2ASHA 3AYVA 4GVHA 2XN0A 3MUZ1 5D9NA 3B3DA 3UW6A 1HL9A 4H2CA 3RU6A 4P2VA 2O4QA 1W2VA 1ZGDA 4DNHA 1N7KA 4UR8A 1JZ8A 1WKFA 1PX8A 2CLKA 2GLKA 3PZNA 3TSMA 4AZHA 4TQTA 3LCGA 1FWCC 2VO5A 1BRLB 3HPAA 2X8RA 3NZQA 2CZ5A 3TN3A 3KEHA 4O19A 4H9MA 2NT1A 3W00A 3KRUA 5B7YA 2OYMA 3NYDA 3DGRA 1CXIA 5D09A 3DKLA 1TSIA 3FNDA 4IFOA 1L6GA 1RLDA 2VFDA 3KXQA 3WF3A 4P7RA 2YZRA 4DXKA 1E55A 3W87A 2Y2WA 3W1UA 4YXGA 5HUOA 2DFAA 3EX1A 4LUSB 4G2DA 2WO5A 3V16A 4IXHA 1JUEA 3BAKA 1OABA 1SFJA 3CUIA 4TUFA 3W9ZA 3WQGA 1YEYA 1PE1A 2V5JA 3LGEA 4PTWA 4JHOA 5D2XA 3VOGA 3S2NA 1XJBA 1AMYA 3W1LA 3KAOA 3PJTA 3SR7A 3GHTA 1R85A 2NQHA 3A3WA 3EMZA 3GC5A 4HA3A 4Z2KA 1T41A 2GVGA 1WX0A 2O9PA 2X1TA 4RZ5A 3TN5A 3LNMA 1K9DA 1EBHA 2YA1A 5E1QA 2DUXA 3HN3A 2EEXA 1Z89A 3M1ZA 1JI2A 4K2SA 4H9YA 4HQVA 1GG0A 2E68A 3S2CA 1IGWA 1HFBA 1GHRA 1SUXA 2ZCGA 2P1FA 3WMSA 2PD5A 4OE7A 1BXCA 2TSYA 3R11A 3VYLA 4R85A 2ZVIA 3S42A 3K30A 5IRPA 1TJ1A 3O9NA 2VRKA 2ZC8A 1HKJA 2V68A 4GACA 1CI1A 3SCVA 3WDRA 3VD4A 1RCOB 4EXBA 1TV7A 3S83A 3FS2A 4IIEA 3FIGA 4CD4A 3QW4B 1LT7A 4LBUA 1REQB 4D6EA 7A3HA 3PPFA 1LT8A 1E4NA 1OT1A 4NZ5A 3CQ0A 3PZTA 2HQAA 3EA1A 4AY8A 1O6IA 1L6SA 1YLVA 1C8VA 3H8AA 2FHBA 3ITCA 3SURA 3O8AA 2OCZA 3G6LA 4YVPA 3G8RA 3CUZA 4XZ9A 4B9ZA 4JTCA 4DZ5A 3H26A 4P8UA 3H4WA 4QLLA 1BYBA 1ISVA 3B04A 2YLAA 4PUJA 3COTA 4GVGA 2J75A 1X8FA 5EMJA 3T07A 4EKJA 5C2CA 2GK1A 4AW7A 3HGRA 4QQUA 3C2YA 2C19A 3OYZA 1US0A 4LS2A 4HPNA 3VABA 4I5UA 3TXVA 1TCMA 3VPLA 1MDRA 3HMCA 1EEXA 1FY6A 1FWEC 4GC4A 2D0GA 4U5KA 3L23A 4JS3A 1OC7A 1F74A 4GLEA 4UMAA 4HZ7A 4FA3A 2VKZG 3DG7A 3LS9A 4P7OA 1TE6A 3W3OA 2YXGA 2EKCA 3ZS4A 5CJ5A 4JTRA 4FR1A 5LGXA 3GR7A 5D2WA 3SRFA 1PWLA 3GS6A 4C1NA 2HEJA 3CU2A 1WB0A 1JG9A 2W3ZA 2YL5A 5H91A 1CGVA 3OA3A 2VR5A 4WDTA 4AZ7A 2OZ3A 4BI7A 3LRLA 4PMYA 2OLAA 1ZB5A 1KBJA 4Z2JA 2F84A 3FSUA 3S5YA 1JNEA 1JCMP 1BGAA 1CLKA 3WDHA 3STGA 3UR7A 4CCCA 4GWEA 4D6IA 2WYSA 4UFKA 1HL2A 1LDCA 3RHGA 3IUIA 4Q33A 5DELA 3UXDA 2DSVA 3K4AA 1AW5A 3WD0A 3LLFA 4IICA 1ZJBA 2V5DA 1H50A 3A9IA 3NPWA 5AYXA 1I0DA 4JOMA 2ACRA 2VZTA 1ZBKA 3GHUA 2WM1A 2VZOA 1E6NA 5CQ1A 1EH9A 2AGKA 3BLPX 4Q8TA 2CKSA 3THAA 2QAFA 1SO3A 4O17A 2PB1A 1B3VA 2VMFA 3IIPA 4DBEA 1K1DA 1PB0A 1BF2A 3LBCA 1O1ZA 1K8YA 2GVEA 2FZ8A 4HZ6A 4GJJA 1H7PA 2CIPA 1O95A 4H1ZA 4UOQA 5GNYA 2ZWZA 4O8AA 3M0HA 3S47A 2X7VA 4QAWA 4J7RA 1VIWA 3W72A 4WSKA 1DJHA 2OQLA 3K46A 5C9RA 2D73A 5GJMA 4DJEC 4GUIA 1V08A 4ATDA 1X6UA 3D5HA 2HS6A 3TR9A 1CCWB 3SUSA 2POTA 1VC4A 4XB3A 5F2IA 3AC0A 3ES8A 5KZEA 4WCJA 3U48A 4GI9A 3WN6A 3QV7A 1KV8A 4ZFCA 1D7FA 3ANUA 1EP2A 4NT0A 3VD3A 4WY0F 2DIKA 2WVVB 4M7SA 3VK5A 2WSKA 4Q4MA 4ICNA 4C6BA 3OODA 2GVYA 2VM8A 3GR4A 4PBFA 3BQ5A 2PDCA 5TAOA 4H9VA 1EO7A 4FNTA 1NTHA 4FXJA 1GYMA 2RDXA 1FWJC 1S5VA 3NQ2A 5I06A 2PGEA 1Y5VA 2P53A 2H3DA 4G7EA 1V6UA 4JIHA 5LKYA 3BK0A 5K9DA 4CCDA 4K37A 1SJBA