1C3FA

Endo-beta-n-acetylglucosaminidase h, d130n mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c3fA00
1BPLB 2OYLA 5AYBA 3AYSA 4TX8A 2Y4SA 3ZJ6A 2XGBA 4Z2LA 4MNKA 4AISA 3W25A 2DT1A 4N0RA 5EB8A 1V0MA 3A4XA 3VGGA 2V5DA 1BLIA 1GOKA 2GFTA 2GUYA 5I6SA 1W3JA 2IXUA 2G4FA 1US3A 1BVZA 2J25A 3AHYA 2TAAA 3NSXA 3CUFA 1CECA 2CBIA 2O9RA 2DSUA 3EDEA 4KGLA 1EDTA 5DO8A 5M17A 4QCFA 2VRKA 4GI9A 3WH5A 2ZX8A 1QI0A 5DT5A 5A2CA 3VPLA 2UY2A 5IFPA 2X0HA 4Z2HA 3AS3A 2JALA 3QHNA 1TVNA 3WF2A 1XCWA 4BCEA 3AJ7A 4KRTA 3RPMA 2J7DA 1MW1A 2BFGA 3KWXA 3WUFA 1GVYA 2CKSA 1VFUA 3CO4A 4ZE4A 2XHYA 1R86A 5A8PA 1JGIA 1HP5A 2XYLA 4WLCA 2CCRA 4JCLA 3TTOA 4LQ1A 3SCUA 4AIUA 3AMCA 2BXZA 4R5EA 1MW3A 2BHYA 4W8AA 2XVLA 1B30A 1XRVA 4W8BA 3LPPA 3GNRA 3KEHA 1K9TA 3SCQA 5A94A 1WZAA 1BSIA 1H49A 2BVYA 4UFHA 3WFLA 1WO2A 4YPJA 1NOWA 3EBVA 2DT3A 2BVTA 1V3IA 3SCWA 7A3HA 4EAMA 2O9OA 1NQ6A 2QMKA 3PHAA 1E6PA 2G41A 5CQ1A 2E3ZA 2GJPA 3VKKA 4C7DA 4AWEA 1JXKA 1PJ9A 3WDHA 2ZIDA 1CGYA 2HVMA 4M81A 5I77A 3ALGA 1HNYA 4UQDA 1I1WA 3HMCA 3VDCA 2ZXQA 4DM1A 2ZWYA 1XH1A 4RE4A 3VGFA 1UKSA 3BCFA 1JYWA 1E71M 2WLZA 5FD0A 1DWIM 3WH7A 3AIVA 4AZBA 1V0KA 4QCEA 2J78A 1JL8A 2CHNA 5E9AA 1OSEA 2PC8A 3OB8A 1R7AA 5C8BB 4P7OA 3JUGA 3BLKA 5CG0A 3UCQA 1OT1A 2ZOXA 1NM9A 2GDVA 4YHEA 1JDCA 2UWFA 1K9FA 4NRRA 3T0DA 1GOMA 4RE2A 1OT2A 1E72M 5DMYA 1PZ3A 2J4GA 1MFUA 1GOIA 4CD4A 4AEEA 1CIUA 1Q6FA 5KZ6A 2EPKX 2XSAA 1C8YA 2XWEA 1VEOA 3GYCA 3TTYA 3OLEA 3NDYA 4N42A 1KXVA 3O6AA 1EIBA 2YJQA 5DT7A 1V08A 2VJXA 1CGXA 2V3EA 5JIWA 3BH4A 2ZXDA 1JNEA 1J0KA 4PTXA 3ZM8A 1RPKA 2D23A 2WZEA 5I24A 2YA1A 1U2YA 3SUTA 3AXIA 2Y5EA 2G8ZA 1E3ZA 2J77A 1ZBKA 5JIPA 3THDA 4J7RA 3RJXA 4B9ZA 4DM2A 3CMJA 4FLRA 3UETA 1GVIA 3GXDA 1OGSA 5A69A 4GXPA 3ZR5A 1A3HA 5IDIA 1M01A 2ZX6A 4OBSA 4U33A 2XTKA 1PX3A 2J62A 3VGHA 3FAXA 3PZQA 4PMUA 2W5FA 4BQ3A 5C70A 5C71A 3T0BA 5E0FA 3B9AA 5JBFA 1UQYA 4QLKA 3VX0A 3AMLA 2PBGA 4PMOA 5CZKA 4V28A 1RD6A 2CBUA 2PF0A 3PTMA 3WD2A 1V02E 3T2QA 1NWUA 1HJXA 2XIIA 4UQ9A 2VI0A 4HOWA 3LMYA 3VM7A 1PZ2A 1N82A 1UR1A 1ESWA 1KBKA 1RP9A 3VU2A 1HXJA 1TUXA 1EDGA 4M24A 4Z2IA 1G0CA 2GSJA 1ITXA 2WWCA 3WQ4A 5CLWA 2CBVA 3VMNA 3VM5A 5A8MA 2B31A 4WF7A 2WBGA 4P7NA 4ZE5A 3MO4A 2J7GA 4XZBA 2E8YA 4GO9A 3VDAA 3VDHA 3ZJ7A 3CZEA 4PMRA 3ARZA 2WKGA 3WD0A 5A8OA 4UFIA 4UZSA 1E5NA 3ARRA 3WH8A 1B2YA 4QP0A 1V3KA 3W4RA 4U3AA 2V5CA 4PUDA 3FNDA 2ZICA 3HJEA 1UYQA 1JDDA 2A3CA 2OWXA 1OGGA 2EO7A 5D9NA 3GH5A 1CXFA 1J10A 1CWYA 1GORA 4MADA 1H2JA 2YL9A 3CTTA 1GOOA 4XX6A 4MNJA 2E9MA 1H0IA 1EOKA 1LG2A 4HZ6A 2X0YA 1JZ3A 1OWQA 2CEQA 3NDZA 4M80A 1M53A 4FK9A 5I2UA 1G5AA 3EYPA 4RL3A 1XSIA 8CGTA 1J0HA 2E4TA 2YLLA 1FHDA 1DWGM 1E6NA 2EJ1A 4S3JA 3TA9A 1OD0A 5A6MA 1W2PA 3VD7A 4UQBA 2J47A 2XVPA 4URIA 1LWHA 3ALFA 1HKIA 1E4NA 3VIIA 3WQ6A 1XYFA 3AIRA 4HA3A 3AHZA 4HU0A 5BXSA 4CUCA 1MW0A 3AS1A 3B8SA 1HF6A 1M7XA 1UKOA 2FGZA 4EANA 1LWJA 3AMKA 3AZRA 4UNIA 4H8HA 3BCDA 2DSVA 2WMFA 1E0WA 2FH6A 2CESA 5IXEA 4H8UA 2OYMA 5HOSA 1F4AA 4X0NA 4R27A 2D1ZA 3ZJ8A 3ARUA 3N15A 4CU8A 2XIBA 1MYRA 1PBGA 3WD1A 5CLTA 3WN6A 1PX4A 1B3ZA 4AYSA 4HPHA 3FHAA 2RGMA 4OZOA 4UQCA 2BXYA 3KE0A 2PB1A 5A95A 3MANA 3OGVA 1V3JA 5FOOA 1VRXA 1UKPA 8A3HA 5ABGA 3UR7A 1W1TA 3ZT7A 2WCGA 4PMNA 2JFEX 2OWCA 4UQAA 5A6SA 2FH8A 3VIJA 3WF3A 1CTNA 1RP8A 4Q7NA 4GIAA 1J0ZA 4PMZA 2WXDM 2ESCA 4HP5A 2XFFA 4Z2GA 4ML4A 2RGLA 2ZUMA 4AY1A 1UZ1A 1W9PA 2OSWA 1C7SA 5A3HA 3ZSTA 1L8NA 4P7RA 3DYOA 3AFBA 4CCDA 2VURA 3OIHA 5BRPA 2Y2WA 1JYVA 3WKZA 3WF4A 5CPQA 5LA2A 4PSPA 1VBUA 1DTUA 2PWHA 3W82A 3WH6A 3QOKA 2CBJA 1H09A 1RH9A 1QNSA 3BAYA 3EMQA 1IT0A 2DSZA 1EHAA 3SUVA 2WM0A 5LYRA 3IJ8A 2E0PA 1JI1A 1C93A 1C8QA 1WPCA 3MUAA 1KXHA 1NOFA 3K4AA 3T08A 1CZ1A 2W67A 3QHOA 4C7GA 1HKMA 4ATLA 4PN2A 1E6SM 1W91A 5CPTA 4CU6A 1PIFA 5IHRA 4MB3A 3RM9A 1QI4A 1SMAA 1ZU8A 1D7FA 2PI6A 4P8VA 2VZUA 4OJYA 1B90A 1V6XA 1ZBVA 1UD2A 1ZJAA 1ISZA 3VIPA 4GINA 3WNNA 1ZB5A 3MV11 2AAAA 4HMEA 1E1EA 2A3EA 4UOZA 1KCKA 1OIFA 1LF1A 4FLQA 4ZFMA 3UG3A 3ZSSA 1J9YA 1ODUA 4WKFA 1UKQA 3D3AA 4HMCA 3CUGA 1G1YA 2DIEA 3MUZ1 3CZGA 4GQQA 1OB0A 3A3HA 2YDSA 1V03A 1ZBCA 3ARYA 1A47A 1XH0A 4GZIA 3WL1A 4U31A 3CBWA 4ATWA 2VR5A 1FHLA 3L2MA 5ABEA 2VX6A 4AW7A 4E2OA 3BMVA 3MUIA 4W89A 2XVKA 3ZMRA 1MQQA 5AY7A 3KL0A 1IZKA 1JD7A 1QVBA 4D71A 3PZVA 3UERA 2C7FA 1KXTA 1TE1A 1BQCA 1E43A 3SUWA 2PWEA 2HISA 1K6AA 4M1RA 3VOCA 4P7LA 1UOKA 4AZCA 3ARSA 3WDJA 2C8NA 4PMYA 3SUSA 5CGMA 4W7UA 1HVXA 2VZVA 2Y8VA 1JZ4A 2X2YA 1J11A 1FH8A 1JZ8A 1UR8A 3MKKA 4A3YA 2CKRA 3PZMA 5A8QA 1W9DM 1AVAA 3AI0A 3MSDA 1CLXA 1E4IA 3ARWA 1ISYA 2WCSA 4GPNA 1EO5A 1GJWA 3WMCA 4PCSA 2Y24A 1JG9A 1FP8A 5BCAA 2D3NA 3ZOAA 1QW9A 2J8GA 2A3AA 2EXOA 2WHKA 2WVUA 5I79A 4MTVA 3N1AA 1P6WA 4JL1A 3TTSA 3ZO9A 2PWGA 3N11A 4H2CA 2CPUA 4FMVA 4H41A 1E0XA 3BAKA 3CHEA 5A6AA 1ZJBA 1DWHM 5E70A 3U5YA 3OZOA 1XSJA 4MB1A 4BQ4A 4GKLA 2AMGA 4PBGA 3VDBA 3DHUA 2WMGA 1UH2A 3AHVA 4PUEA 1HJUA 3DYPA 3AISA 1JF6A 5A2BA 4W7VA 4CU7A 1J12A 3MUY1 3FHQA 1LLOA 5D9OA 2WLYA 1AQMA 4CKQA 3WQ5A 4EK7A 3NCOA 1W9VA 2W62A 1DP0A 2OLHA 1JZ7A 3WDRA 2QPSA 5EMYA 2DQXA 2CNCA 4AZCB 2JE8A 3A4WA 1PIGA 3UR8A 1V3LA 1H4PA 3J7HA 1US2A 3AOFA 2VVNA 4JHOA 4OUEA 5AYIA 4W86A 1VEPA 1HIZA 2J7BA 3K8MA 2GJRA 2IUZA 4D6CA 2W61A 1J0YA 4P8WA 3EMCA 1G94A 3A4AA 1K9DA 3KZSA 4XUYA 1KXQA 1EOMA 1SFSA 5A8NA 2VT0A 2VL4A 3VGEA 1CGUA 1QI5A 3IAPA 3SCRA 1HN1A 4U2YA 4HTYA 1TR1A 5ABFB 1UA7A 3WEMA 1QNPA 4UFLA 3N13A 1CENA 1GCYA 1L0PA 3M07A 2WVVA 4B15A 1BAGA 3VIMA 3PZUA 3I3BA 5EBAA 1BYBA 5ECUA 4W88A 1NH6A 3EDDA 2CETA 4PMVA 2WVTA 3NIYA 3DECA 3VNZA 4F9JA 1DHKA 2VRJA 1B3VA 4W5UA 4HZ8A 4CCEA 4XB3A 1HL8A 3MV01 1PAMA 1KWKA 2NW0A 1R8LA 3K46A 3D5HA 1UWIA 4H7VA 3RILA 4JFTA 3FXYA 1I75A 1TZ7A 3OLDA 4CN4A 1LQ0A 3PZIA 1H3GA 4HA1A 1GJUA 1JXJA 3W0KA 1BYDA 1UD3A 2AOSA 3WD3A 2QMJA 1U33A 1VF8A 2VZTA 4JCMA 4S3KA 1V0NA 4CD6A 1OD8A 3G6MA 4WSKA 2JF7A 4WK9A 1XCXA 1FH9A 2VO5A 1DWFM 2WZHA 2UY5A 1QI3A 5GNZA 1C92A 3N9KA 2WSKA 3CH9A 3SCNA 4TVUA 1WZMA 1HT6A 1YQ2A 4WKHA 4IPNB 1LL6A 4J3WA 2WWDA 3ZT6A 1V6VA 1X6NA 4LGXA 1HJSA 1PEZA 4BS0A 2DIJA 1IZJA 2GK1A 2WVVB 3W28A 2OSYA 4KGJA 4AD4A 2Z1KA 1F4HA 2WYSA 3IANA 4M56A 1W9BM 3VMPA 1JZ5A 4PTMA 4Y7EA 3PN8A 1GHSA 2J7HA 4TOQA 3WMSA 4IM4A 5GQBA 3TONA 2WZIA 1CXIA 1XD1A 4QLLA 3SUUA 1QNRA 3SURA 3DHPA 5EFDA 4JKKA 1KGXA 1WB0A 2BVDA 2YKKA 3W81A 1QNQA 1E4MM 4D6HA 1XC6A 1J18A 4LYPA 4ZEPA 4IISA 3ZR6A 4J28A 4E8CA 1XYZA 6A3HA 5D9PA 4CD7A 5CPSA 3CHFA 1UR2A 1V3MA 1WDPA 2V3GA 3W24A 3BAXA 4P8UA 4E8DA 1BHGA 3GBDA 4W87A 4W84A 4FLSA 3UG5A 5A1AA 5HBFA 1K9EA 3VIKA 3AHXA 1V6YA 4W85A 4CVWA 2MANA 1GNXA 2XWDA 4PCTA 4LYRA 3GNOA 5CGTA 4MJ4A 1B1YA 3WNMA 3EDKA 4TVDA 2VNCA 2PBOA 4X9YA 1UQZA 2YOCA 2ZE0A 1DWJM 3CMGA 4UQEA 5DF0A 2FGLA 2F8QA 4MJ2A 1AQHA 1WZKA 4K68A 3N17A 5FL0A 2XSBA 4RE3A 4JFWA 4UZUA 4D1JA 3AMDA 4WKAA 1IV8A 1SYTA 2Z1SA 2GK1B 3WIJA 1MW2A 2VCBA 1EXPA 4B16A 1WNOA 2CXGA 3ZJKA 3WF1A 1MWOA 1VFOA 4J3SA 3B9EA 2GDUA 2ZX9A 1Q6EA 1BFNA 3ARXA 1J0JA 3EDFA 4AC1X 5BYWA 3VUPA 4WSJA 2F61A 4DUWA 2YBUA 1UUQA 1EQPA 4L4PA 3SIMA 1GQKA 2WNWA 5JBEA 3BXWA 1UWQA 5M3WA 2JEQA 3A47A 4LXFA 1TG7A 4PSRA 1JD9A 6TAAA 3PZTA 4W8LA 5BRQA 1HL9A 3VVGA 1VEMA 1V6UA 2WW5A 3POCA 5AC5A 4DWSD 2YIHA 5BXTA 2WMHA 4D6GA 1ODZA 4PMQA 4OKDA 5F7UA 3VD9A 2WVSA 1EH9A 3M6DA 3HN3A 3L4WA 3WDPP 5BXPA 2XVNA 1NP0A 2WSPA 5KEZA 3AHTA 2JIWA 2W92A 4W7WA 1KQZA 2WHJA 4B3KA 3RMEA 5FL1A 1ECEA 5D8WA 1WAWA 4BA0A 1LL4A 1HP4A 2WMJA 4EE9A 2NT0A 3BAJA 1QW8A 4FF5A 2D0HA 4ATDA 2V38A 1KR1A 3UEQA 2EEXA 1UD4A 3WUEA 4BQ2A 1FOBA 1JYNA 2CHOA 3VO0A 2C0HA 1GZJA 1MVYA 4ZENA 3BGAA 1FH7A 4KMQA 1GUVA 3G6LA 1QHPA 1E9LA 4JHZA 1M03A 1OBAA 2VX4A 2BV9A 3CZLA 1ZBWA 5CXPA 3L2LA 3CLWA 3WMBA 4J3VA 1E4LA 2VX7A 1YHTA 4TUFA 1UR4A 2X05A 1BYCA 2XUCA 3VD3A 1TA3A 1JF5A 4AD1A 3OBAA 4V2XA 2J7FA 1Y7VA 3T2PA 4DWSB 1GOWA 5LA0A 3CUHA 2YL6A 3THCA 3WSUA 1ZS2A 2CYGA 1UR0A 4ACZA 3OZPA 1B3YA 1KB3A 3MU7A 5FKYA 1NOUA 4HOXA 4NRSA 1NWRA 3WUBA 1NWTA 4FLOA 1LJYA 1XHGA 2VX5A 1J01A 1H0GA 3CUJA 4PMDA 4OOUA 1Q6DA 1C3FA 1C90A 3SCPA 3VINA 1BG4A 1VIWA 3WBAA 3OLGA 3O9NA 1HX0A 3ZT5A 2GVYA 3AXXA 3AROA 5JUVA 4TXEA 2WPGA 1HJQA 5A6BA 3T0AA 1OIMA 3AS0A 3W38A 5A6BD 4GI6A 3BLPX 5A6JA 2XJ7A 3T09A 3GZAA 2D3LA 4MAVA 1W9XA 4AZ7A 4CCCA 2YDRA 3W27A 2CIPA 1LG1A 5ABHA 1UHVA 4A4AA 3AXHA 1W1PA 2WCAA 3K1DA 1Q6GA 1UWUA 1CYGA 1XGZA 2W63A 1DWAM 3ARVA 3NSNA 1O7AA 4XZWA 2J79A 3U57A 4AD0A 2EPOA 2G3JA 4IPLA 1V3HA 3B9DA 1JAKA 1VFFA 5FCZA 1I1XA 4JKLA 1W2VA 3CZJA 3M46A 5CSYA 3ECQA 3BSGA 3AZTA 2DGAA 1Q6CA 2J74A 4J3UA 1C8XA 1MFVA 1TA3B 3UESA 2ZWZA 2ZUWA 3PZNA 3RO8A 4MPKA 1OM0A 4AIOA 4MDOA 4U5IA 4AZHA 2DSKA 1M04A 4ACZB 3OA5A 4UTFA 5IFTA 2XGIA 3QGVA 3W6LA 5E6ZA 1E6ZA 2E9LA 1JDAA 4AD5A 5E6YA 4ZXOA 1WDSA 4MB4A 1GONA 5JBDA 5A2AA 3RIKA 3N12A 5HPCA 5BWFA 3BSHA 4PMXA 1WP6A 1U30A 4AIEA 4WIWA 2J7EA 2ZUVA 3L4VA 3RDKA 4W93A 3WL0A 3VD4A 3VX1A 3RM8A 2QF8A 3NSMA 2X1IA 4HMDA 4UOQA 4BF7A 4HPGA 5GNXA 2VTFA 4GO8A 4MNMA 1Q4NX 1UWTA 1BYAA 2YLAA 4UOJA 5D8ZA 4QDMA 1UWSA 2QPUA 4PEEA 4GZEA 1KGWA 1W9UA 2VOTA 2WC4A 1HJVA 1E55A 2DH2A 3AIWA 3FN9A 4HZ7A 3KL5A 4UFKA 4YN5A 2FHFA 3IJ7A 1CBGA 1QHOA 1H41A 5EFFA 5ABFA 5LA1A 1WDRA 1EDQA 2O92A 1E6QM 4AEFA 1W1YA 1FP9A 1PPIA 2JIEA 3QHMA 3KL3A 3AICA 3VILA 1VENA 4KWUA 5IHSA 1MQRA 1TMQA 3GNPA 2PWFA 1E6RA 4JIEA 4J27A 1KQYA 5GNYA 1B9ZA 3W26A 3MS8A 4UCFA 2A3BA 3TP4A 5A6LA 5FIPA 3F5LA 1G9HA 4H8VA 7CGTA 2XVGA 5AC4A 1QNOA 2G3MA 3K8LA 3WFZA 3CHCA 1Z32X 4LX4A 2XFRA 5A6KA 3GXMA 4BZYA 3DYMA 4PTWA 3VGDA 5I3DA 1CPUA 3WENA 2WHLA 2QV4A 3VIFA 4D6EA 2EPNA 1QPKA 3TTQA 2UY3A 2JEPA 1KGUA 2G3NA 3BAIA 2XG9A 4P8XA 3WEOA 1NWSA 2BY1A 3PTQA 1PX8A 1E5JA 1ZL1A 1ISXA 4U2ZA 4C7FA 3U7VA 4LYQA 4D1IA 1R87A 3QR3A 2E40A 4JKMA 2O9TA 3WELA 3MMUA 3AQUA 1VJZA 2ZUTA 1WZLA 4D6DA 1D2KA 2BY3A 2XFYA 1X6LA 3II1A 3U5UA 3TOPA 3GXIA 3K8KA 1CGVA 2V3DA 3WBEA 2BY2A 3SCOA 3BC9A 1C7TA 4YHGA 1UZ4A 1CXEA 1WCGA 3BAWA 4CGTA 1OGBA 3WNLA 2UY4A 4P7QA 5HDRA 4X0VA 1VFMA 3EMZA 3FW6A 2DEPA 1DEDA 1AQ0A 3OGRA 5TD4A 3F5KA 3GH7A 3GDBA 2GJXA 4AZ6A 5HPOA 4HOZA 1ITCA 2EQDA 4F79A 1QI2A 3SCSA 2VUYA 1GPFA 2PWDA 3AYRA 5BXRA 3AIUA 3S6TA 1UG6A 2J7CA 4IUGA 2OYKA 1BVNP 3L4ZA 4L4OA 4U5KA 5M03A 3DC0A 1LL7A 4CN6A 3IAQA 3WQWA 4E4PA 1W32A 2QLYA 4GI8A 2YL5A 5GPRA 2G3IA 3VIHA 1HKJA 3MMDA 3A6OA 1SR0A 7TAAA 1CLVA 3K4DA 2EBNA 1CNVA 2VZOA 4HA4A 3CUIA 4NF7A 1CGWA 2D2OA 9CGTA 2YBTA 1C91A 3L4UA 3NJ3A 2XM1A 5I5RA 1E0VA 1GW1A 1VBRA 3L4YA 4UR9A 1CXKA 1JIBA 1EGZA 3WD4A 2DH3A 5CJ5A 4GQRA 2ZUNA 4PTVA 3F5JA 4QAWA 1V6WA 1XSKA 4NZCA 2XM2A 1E73M 1EHNA 3M7SA 1JZ6A 2VCCA 1EQCA 1E1FA 1GOQA 3CIVA 3PZOA 4Z2JA 2OWWA 3VGBA 2X8RA 2BY0A 3BMWA 3AIEA 3WUGA 1BGAA 1QBAA 1UWRA 5D4YA 1EA9C 2ZUSA 3FY1A 4D6JA 1AMYA 3WNKA 2CITA 2GJXB 1KWGA 1W1VA 3SCTA 1X1NA 3CHDA 3IK2A 4CN1A 1QHZA 2YL8A 4AZ5A 4PYSA 1R85A 4ACYA 1D3CA 3VMOA 4DUVA 2BNJA 1GQJA 3WF0A 2ZX7A 2WMKA 3LPFA 4TTUA 3OGSA 4JZ5A 1B31A 1XD0A 2D0GA 3L4XA 1HJWA 3L4TA 1JI2A 1E15A 1GHRA 4KH2A 3AIQA 3AIBA 3APGA 3RJYA 2D24A 3WNOA 4UFJA 1UA3A 4PRWA 1ISWA 5M5DA 3ZQ9A 5BROA 3CZKA 3U7BA 4DWSC 1CGTA 2FDMA 4QFUA 3MMWA 4JFVA 2VQUA 3RM4A 3I3EA 1V02A 1KR0A 1JNDA 3O2LA 2BHUA 3GXFA 1JFXA 1KBBA 2ZXAA 4EKJA 2V3FA 3WH9A 4NSBA 4Q22A 1H1NA 1WE5A 6CGTA 1UR9A 2FHCA 4LPCA 2ZXBA 4MNLA 1NP2A 3WDQA 3WEZA 3CGTA 1H11A 1BG9A 2BHZA 1BTCA 2Q8XA 2DPEA 1UKTA 5CSUA 4A3HA 2VC9A 4TVCA 3ARQA 3PZGA 2XPKA 3GTNA 3ARPA 3EDJA 1UD6A 4D6FA 4DWSA 2F2HA 3N18A 4F9DA 4KRUA 1FFQA 1QBBA 3AZSA 2WBKA 2QHAA 1VAHA 4J3XA 1B3XA 3SCVA 3UG4A 3NYDA 3GH4A 4M82A 1JYXA 2VRQA 1BF2A 4AD3A 4XV0A 1WKYA 4F66A 1UD5A 4CD8A 3AMGA 2DT2A 2IXVA 3F4VA 3RCNA 1QOXA 3W37A 1CXHA 2WC3A 1UH4A 1JFHA 2WANA 2ZUUA 4AD2A 3PZ9A 2VCAA 3WQ8A 1E40A 2OSXA 2YA0A 2NT1A 3QOMA 5DFAA 1WDQA 4JL2A 4CVUA 2W91A 2E8ZA 3I3DA 2WK2A 4BQ5A 2VQTA 4Z2KA 2JF6A 1E56A 3PTKA 4TX6A 3FAWA 2O9PA 1BGGA 1ISVA 2X09A 3GM8A 2J75A 3SEPA 1GQLA 5I78A 1UD8A 3HU7A 4H04A 1E3XA 1TFVA 2EPLX 1FFRA 2FHBA 3ARTA 2E9BA 1VJSA 3LPOA 2D0FA 2VVSA 1V0LA 4MAZA 3E1F1 1MQPA 2J8FA 1UH3A 5E0CA 1E70M 3NUKA 4OIFA 4NI3A 1R7OA 3ZIZA 2DT0A 4QLJA 4GZJA 1HKKA 4CD5A 2YA2A 2WB5A 3VD5A 4AZGA 1FA2A 1G01A 1CDGA 1XV8A 3OG2A 4J3TA 2YDQA 1E6XM 5DEZA 3N04A 1TCMA 1XH2A 2Y8KA 2VMFA 3WY1A 2WMIA 2WHMA 1OCQA 5D9MA 4HU8A 3VIGA 1VB9A 2DSWA 4V27A 4AXNA 4D72A 4OOZA 3VIOA 1W3HA 2D22A 2ZX5A 2CERA 2W66A 4F8XA 2WAGA 4AMCA 3S2CA 1W3KA 4UFMA 3W29A 2DDXA 1KFWA 3PBGA 2WC7A 1B0IA 3AS2A 2WKLA 4JAWA 3T2OA 4TTGA 1NARA 5HXMA 1MXGA 3W6MA 4MB5A 2W4XA 4JFSA 3GBEA 3VNYA 4D6IA 4ZXLA 1JZ2A 4OBRA 4DUXA 2EPMX 1SMDA 3CPUA 1KCLA 4WJXA 2BS9A 1EO7A 2VR4A 3CZ8A 3WQVA 4M29A 4W5ZA 5E09A 2VZSA 2D20A 1H5VA 4U3CA 1J0IA 3POHA 3WNPA 3WDIA 3MSGA 4MDPA 4M8UA 1MXDA 1CXLA 1S46A 1TVPA 5HNNA 1GQIA 3W53A 1B3WA 1W3LA 1OINA 5I23A 3IJ9A 3VTRA 4AZIA 3OLIA 2NSXA 4B9YA 2A3HA 1CEOA 4JFUA 5I0DA 1JAEA 4B3LA 1O6IA 3LPGA 1HVQA 2WMIB
chains in the Genus database with same CATH superfamily
1PTDA 3B04A 4PB3A 2B7NA 5AYBA 3MSRA 2Y0FA 1A5BA 2Y4SA 1ADOA 4CNUA 5FJTA 2A85A 5AHMA 4MNKA 2G37A 2DT1A 5EB8A 3A4XA 2V5DA 1AL7A 1J96A 2IKGA 1BLIA 5F2GA 1XLFA 3O05A 2GLKA 3LYEA 3NPWA 4MZ1A 4B5XA 2IXUA 2PDBA 3HQPA 1S2WA 2J25A 2ZKMX 3AHYA 3CQKA 1BQGA 1MEWA 4MVAA 2CBIA 2QS8A 4XTIA 1XIJA 1O5KA 5DO8A 3TLQA 2ZVRA 5K7JA 1MNSA 2IKJA 3GDTA 1I60A 1RD5A 3VPLA 3GD6A 2UY2A 5IFPA 1ZRQA 3VZXA 3QHNA 5EMKA 2CWNA 2CC0A 3RPMA 2J7DA 1MW1A 4Q6XA 3P62A 2CKSA 4ZE4A 2XHYA 3AUJA 1KFBA 5DY3A 3NQMA 1JGIA 4F2TA 3MBDA 4DBWA 4JCLA 1LOLA 3SQLA 3SCUA 1PKMA 2BXZA 4R5EA 1MW3A 4W8AA 1TPUA 1SW7A 1BWKA 4NYUA 3TUUA 1LYXA 1KFEA 2ISVA 2Y62A 1K9TA 3TLLA 3TC6A 4IWWA 5GJMA 1PHWA 1WO2A 1A3XA 3KCJA 4B5VA 2ZRVA 2OX4A 2V67A 2DT3A 3ONCA 1JPIA 1VHNA 1V3IA 4N02A 5F2MA 4DXVA 2BOFX 2QMKA 1E6PA 3MCNA 4AWEA 1JXKA 3WDHA 4K1GA 1S1PA 1TKKA 4M81A 4JYDA 1I1WA 4R88A 3HMCA 2DY3A 1HUVA 1UP2A 4G1NA 2OKTA 2PUZA 4LEFA 4PBFA 1JYWA 1E71M 1X6UA 4FXFA 1EB3A 1V0KA 1JCYA 4L4LA 1MXSA 1VCFA 3B3DA 4B90A 1XBVA 4MMWA 3MDUA 3EKZA 2B0MA 1X8FA 3HF3A 2CLFA 1WBJA 3P60A 4HNNA 3BLKA 2I5QA 4XD6A 1XC4A 3T0DA 3RCMA 3GDKA 1GOMA 3KTCA 3OTRA 3WBYA 2OX1A 4RE2A 3H6OA 1OT2A 3M41A 1PZ3A 2OG9A 3T9PA 3G3MA 3UCDA 4AEEA 1CIUA 1OC6A 4Q8TA 5IBXC 5KZ6A 1KTCA 1ZALA 2XWEA 4MG4A 2HEJA 1J2BA 2GVLA 1KXVA 3CL7A 1V08A 4GOAA 4ERGA 4IIDA 1M6JA 3HFYA 2ZXDA 3MVTA 1J0KA 2WZEA 1CW2A 1XXXA 2WSYA 1VQTA 3DZ1A 3IGSA 1WOBA 2HROA 1MUMA 4YYCA 2Y5EA 3UWQA 1E3ZA 4FF7A 4LU0A 4LUIA 2OGYA 4AUBA 4J7RA 4RV8A 2QF7A 4HPXA 3CMJA 4FLRA 4QG6A 4HMNA 5LIKX 5A69A 4GXPA 4Y9NA 5IDIA 1M01A 5BZAA 4U33A 1TV2A 2XTKA 2G4JA 5FACA 3VGHA 3O6YX 1E9ZB 2FTPA 1XINA 3AMLA 1E1CA 1RD6A 2CBUA 3IK4A 4O19A 4KEMA 4GY1A 4J1OA 3WD2A 3T2QA 3W3OA 1HJXA 1M3UA 4Q7BA 5BOEA 2I9UA 4QISA 1UR1A 1RP9A 1JR1A 4IT1A 3TYUA 4Y8FA 4M24A 2NQ5A 4FIQA 4Z2IA 3ANUA 4M7SA 3WQ4A 2CBVA 3SADA 1EX5A 3VM5A 2B31A 4WF7A 3WLRA 3GXTA 2PDPA 2ZZ6A 4AY7A 2QPXA 3ZJ7A 3CZEA 2VUNA 2Q71A 3AXMA 2PTZA 1T5AA 3ARRA 3LXBA 1B2YA 3FA3A 4QP0A 3W4RA 5I06A 4U3AA 2ASHA 3OVPA 4FR1A 3HJEA 5BU9A 1QUMA 4US6A 5C54A 4XZHA 3AWOA 2E9MA 1H0IA 4RX0A 4FXJA 1OC5A 3S46A 1LG2A 1OWQA 5C55A 2FDSA 3NDZA 1TJRA 5C6MA 1E1CB 1S3HA 5I2UA 3DERA 1DXIA 4I8YA 2G50A 2E4TA 4YLWA 1DWGM 4FHAA 3RUBL 3TA9A 4H7ZA 2ZVIA 3LCWA 3W1QA 2PP3A 2WJEA 3ALFA 4GY7A 3KOFA 5CKSA 3MP5A 2ATSA 1VBJA 3AALA 5JMUA 3AHZA 5CZJA 4U10A 3QTGA 3KXQA 3BGJA 3QLLA 5FJPA 4N6EA 4PCPA 4EXQA 3B8SA 4UTKA 3BJTA 4EANA 3AZRA 2MUCA 4H8HA 5F1VA 2WJDA 4GE8A 4P2VA 1E0WA 1RBLA 4CQAA 5IXEA 1ONXA 5HOSA 3AXKA 3IARA 1O4UA 2XIBA 1TRDA 1MYRA 3WD1A 4F0SA 3GIYA 4UQCA 1R3YA 1LT8A 1XIHA 4L1XA 2TPSA 4XK2A 2FFCA 5A95A 3OGVA 1V3JA 4LWWA 5FOOA 4G6CA 1UKPA 4XBKA 1FWRA 3PBYA 3NQGA 5JU6A 2JFEX 1XBYA 3VIJA 4FX7A 1R2TA 1YE4A 1T8QA 1J0ZA 2R9RA 3FK4A 2BWGA 3PB2A 1K8YA 2I1OA 4Z2GA 2PP1A 3I4EA 4AY1A 1WX0A 3R94A 3C2EA 1SO6A 4P7RA 3DYOA 1BD0A 3OIHA 3I4KA 2ISSA 2Y2WA 5LA2A 1VBUA 3COTA 2QJGA 4QROA 2PWHA 3K5XA 4K39A 4KIRA 3QOKA 2CBJA 1U5JA 2ZCGA 1XICA 2WSRA 4Q33A 3B05A 2QAFA 5K9CA 1EHAA 4IL0A 1C9WA 3N2MA 3GVQA 4YWSA 3MC5A 2C16A 4F0KA 1P0BA 4Q4RA 1XIFA 3MUAA 3S0CA 4TX9A 4ZTXA 1OEPA 2GZXA 1CZ1A 4UIOA 4W9TA 1OF8A 4GUIA 4JX4A 4WUIA 4TMCA 4KEZA 4JIPA 4CU6A 5CPTA 1PIFA 5IHRA 3RM9A 1A0DA 3PJTA 4GG9A 1D7FA 4P8VA 2UV8G 3NZPA 1UZHA 1B90A 1VLWA 1AJ0A 1ZBVA 1DQXA 1FKXA 1ISZA 4O18A 7REQA 2EG8A 1EFZA 2QJHA 1OHLA 1E1EA 2A3EA 3QM3A 4IZGA 4FLQA 3UJEA 2X41A 4NZ3A 3ZSSA 4X60A 1J9YA 4WKFA 1XLJA 3CO8A 4KKXA 1O94A 3UZYA 1IZCA 2R1PA 2VWSA 4MY9A 3IIPA 4XVDA 3MUZ1 1MNZA 3GVGA 4O1BA 1A47A 4K7YA 2OOGA 4B5UA 4GYJA 4H9XA 3DKJA 3G1HA 3WQFA 3OYXA 3CBWA 1WUFA 1TPWA 1ONEA 4Z08A 1FHLA 5ABEA 1PIIA 1Q66A 3HA1A 3WO8A 2HJPA 3GNXA 3HIJA 5CC7A 5AY7A 4UTUA 3VOJA 3PUEA 5LGXA 4RPPA 1IZKA 1JD7A 2P76A 1LRNA 4LF1A 1RY8A 3GRIA 1XJBA 2HISA 2NWSA 2NQHA 2Q8LA 4B5TA 3TXVA 1RBOB 1RLDA 2NVCA 1GWJA 2PF8A 1HVXA 1QW7A 3FVDA 6ENLA 1JZ4A 2ON3A 2X2YA 1MI3A 4AX6A 1FH8A 1F6KA 1UR8A 2OMAA 3L23A 3PZMA 2J88A 7REQB 3C3NA 2QDHA 3ATYA 1PTAA 1W9DM 5CZ0A 3MSDA 3TAOA 4Q8UA 2C1HA 3ARWA 8RUCA 4C1LA 4CQCA 4PGLA 1SO4A 2GDQA 2E5BA 3QRHA 1QW9A 2A3AA 1P6WA 5D04C 2PWGA 3N11A 4A22A 5HQEA 4GNJA 4LC8A 4H41A 1N8FA 3P93A 2NUXA 5CC5A 1ZJBA 4RXFA 3W7MA 2AMGA 4PBGA 4LNYA 1M68A 2Y7DA 3ABXA 1Q8AA 3DHUA 3AHVA 4PUEA 3N2CA 3QMRA 1JF6A 5A2BA 1WQ5A 3E5BA 3MUY1 4GIYA 2G3FA 4QSFA 3WQ5A 2WV8A 1DP0A 3WDRA 3ZFHA 5FSDC 5I3IA 2DQXA 1PIGA 4JTGA 2VVNA 5AYIA 1J8VA 1XDJA 1DQUA 1MEHA 1VEPA 4QQ3A 1FWEC 3V7PA 2W61A 3E3HA 1VPQA 2BBFA 3U48A 3A4AA 3H2OA 3GS6A 2FJKA 4E4FA 1GG0A 3LNMA 1KFLA 4MWAC 2PD5A 4JQ4A 1RALA 1HN1A 3G0SA 3S1WA 4MWAE 1TR1A 5ABFB 5E5CA 3WEMA 2QYGA 2IQTA 3E0VA 2C19A 3M0LA 1GCYA 1LOQA 3TWBA 3VC6A 4LT9A 1DVJA 5IDZA 3D0CA 5EBAA 2AGKA 5D33A 4NZ4A 1KLZA 4PB4A 4W88A 1R3VA 1NH6A 2I5GA 4L1WA 2VGBA 2WVTA 1EF3A 4F9JA 3E9AA 3SECA 5D2YA 1PVNA 3GE7A 3MDWA 1PAMA 4QJ4B 3U3HA 3HQOA 1R8LA 1SFJA 4WGXA 4L64A 2A6LA 3GFYA 4JFTA 2PRMA 1TZ7A 4RKAA 4QE4A 1ECQA 4CN4A 1LQ0A 2GSEA 3KVMA 7ENLA 4GVGA 3W0KA 2PD9A 1JPDX 1OD8A 3G1AA 4WSKA 4F0RA 3W7DA 4HHHA 2W6RA 1FH9A 2WZHA 1P0DA 4J2PA 5BOOA 2E5CA 4IQJA 2UY5A 1C92A 3P67A 2HNEA 4D8ZA 1TWDA 2I9EA 1WZMA 5CJNA 3HURA 1U1JA 4R7OA 4AEOA 2R14A 1FWTA 4QNEA 1E9IA 3BTNA 4WKHA 1ICQA 4J3WA 1EBGA 3CL8A 1V6VA 4ZQMA 4O8AA 3H2NA 2BDQA 1PEZA 4BS0A 1IZJA 2TODA 2GK1A 3W28A 3VCNA 3CEUA 4HK6A 2OSYA 4AD4A 2WYSA 3DGRA 1TTQA 2XGZA 4ZGYA 5M2FX 1GHSA 2RJGA 4A8IA 4ZFCA 5GQBA 1YBQA 4HBKA 3R10A 1N2VA 4L65A 1EPXA 2PTXA 3W81A 1QNQA 1E4MM 2Y5JA 3JU2A 4IISA 3M6YA 3ZR6A 3KM8A 6A3HA 5CAKA 2Q01A 1S39A 4PUMA 4ROPA 1YPFA 3GHSA 9RUBA 3LSBA 4Q8VA 2PDFA 3MZ2A 4P8UA 5H91A 1XS2A 3M5YA 4W87A 4EXAA 4FLSA 1W1ZA 3UG5A 3EOUA 5HBFA 2FVLA 3VIKA 4W85A 2MANA 1GNXA 2XWDA 4PCTA 4BI7A 1YE6A 1H1ZA 3WNMA 3EPMA 7TIMA 3DBPA 1C8VA 4X9YA 4UC5A 2VC6A 3N73A 2PE4A 1DWJM 3UP8A 4PMJA 4YTRA 1Q3NA 4MJ2A 1AQHA 5FL0A 5F2LA 2C13A 4X9SA 5H8PA 2AL2A 3KFTA 4J9JA 1VC4A 5HNTA 4GJJA 1IV8A 1SYTA 2GK1B 3UWUA 3WIJA 1MW2A 2VCBA 1P4CA 4B16A 1WNOA 1DKWA 3WF1A 1MWOA 4MKNA 4NJKA 2GDUA 3BURA 2CLMA 2FQIA 3SIZA 3MPGA 4AC1X 3K1GA 5BYWA 4R9XA 2PAJA 2F61A 1YBQB 2E6FA 3IJIA 3WLOA 1GQKA 3GFZA 2WNWA 1QO2A 3A47A 4IMEA 4LXFA 1EYEA 1VEMA 2ZRYA 3PG9A 1OZQA 5DN1A 3NQ7A 3TJ4A 4FAMA 4PMQA 1AJ2A 4OKDA 6ALDA 2WVSA 1EH9A 3NXFA 3TTEA 4FNRA 3E0FA 1G67A 3STCA 1J5SA 4TV5A 3N4AA 3QZEA 3EWYA 5TIMA 3LA4A 1ECEA 5D8WA 1OCBA 3LG3A 5LXEA 3BAJA 1K4GA 4FF5A 2D0HA 3NQCA 2Z28A 3H2CA 2QNEA 2EEXA 5A6TC 1JYNA 2AL2B 2CHOA 3BSMA 3PP7A 2C0HA 3I7RA 3PSVA 2P0OA 1IGSA 4WGHA 1FH7A 2O55A 4KMQA 1GUVA 2X0SA 4JHZA 1E9LA 3HGSA 3EB2A 3V3WA 4K8GA 5MF5A 1YLVA 1ZBWA 3CL6A 3QR1A 4O17A 1Q8JA 4H6KA 2PLKA 2GPTA 4J3VA 4O50A 3MY9A 1V51A 4ICNA 1D3HA 1YHTA 4TUFA 3VD3A 1JF5A 4V2XA 5C2GA 4GGHA 3HB9A 3EX1A 3LBMA 3QZ6A 2OT0A 4WD0A 5LNWA 3CUHA 4DLFA 3PNUA 4LY8A 3JR2A 5CAHA 3UWZA 3HQNA 1DJGA 4B4HA 3JW7A 3OZPA 1CB2A 3MU7A 1NOUA 4QJ1A 1NWTA 3SB0A 1G4SA 1H0GA 3M0XA 1R30A 4QX4A 4HN4A 1VIWA 3B4YA 3OLGA 4LS0A 1HX0A 1TMLA 3ZT5A 3LV5A 1X1OA 3N25A 4GQ0A 1S38A 5SWUA 1M7JA 3PJWA 3GU1A 1EIXA 1XYBA 2XJ7A 3DOPA 2D3LA 4MAVA 1KNWA 1ZP4A 3NZRA 1J5TA 3H23A 3IGHX 1LG1A 1NEYA 1TE6A 5F1UA 3RLVA 3SQSA 1Q6GA 4G7FA 3U57A 3ARVA 4QHRA 1O7AA 1YYAA 1P5BA 3UU0A 3W87A 3B9DA 3M0KA 1JAKA 3URQA 3VZYA 3ME3A 1SFLA 4NI8A 3M46A 1OCJA 3LHUA 1Q6CA 2J74A 4ZZ9A 1TV7A 1QMLA 1MFVA 3OJGA 4RDYA 3T8QA 2WNQA 3W7EA 1OM0A 3CK5A 4ENLA 4HA0A 1Q7QA 1R9XA 1AA1B 3PY2A 3QQ1A 4C6PA 2E9LA 1JDAA 5E6YA 4ZXOA 1WDSA 3F4WA 3E12A 3TEVA 1QT1A 5A2AA 4PMXA 4BWLC 4GUGA 4EAYA 1A5KC 4Q8OA 4NJHA 1RJRA 3WL0A 3RM8A 4UTTC 4GD0A 1XIIA 3NSMA 2X1IA 3M43A 4Y9PA 1KM6A 3LCGA 2VTFA 3G1YA 4JY8A 5C5YA 2YLAA 3BOLA 3TXZA 1I6NA 2QPUA 4PEEA 3BVJA 1LRQA 4GZEA 1ZNNA 2WC4A 1HJVA 4HZ7A 4CLMA 3KL5A 2E6YA 2GGGA 3GUWA 3IJ7A 3PBMA 3L12A 1H41A 4BFAA 2GQ9A 3NPUA 3GKFA 1YADA 1PPIA 2DZVA 1VENA 2YZRA 1XYAA 3KP0A 1E6RA 2Z1XA 5J5DA 3SAZA 4HSOA 1EJUC 3QW4B 5CBJA 3VUSA 3QMSA 3TP4A 1DJYA 2VC5A 1I2RA 3NM3A 4IF2A 2WZMA 2PP0A 4KCVA 4I7VA 5A6KA 3GZ3A 4BZYA 3W88A 3VGDA 5I3DA 3KBMA 5G2WA 1XLEA 3BK0A 1QPKA 4A35A 3A5FA 1AZ1A 4GY0A 5D05A 2Z7KA 1P6BA 3WEOA 2BY1A 3HO8A 1E5JA 3RAOA 3TFXA 2YGYA 4NJGA 4G56A 1KBJA 2O9TA 3CU2A 2XZ9A 2XH4A 3MMUA 4EIVA 3URAA 2VM8A 5ENLA 2ZUTA 1WZLA 4JTUA 4DJFC 3LGGA 2BY3A 1X6LA 3C86A 3U5UA 4YCPA 2B7QA 4DO7A 4NZFA 3WBEA 4TQTA 1KM4A 3JRKA 4LAOA 1ZJHA 1ZPTA 3BC9A 1C7TA 3T78A 1CXEA 4XAGA 3R0UA 1FWJC 4P7QA 4LAKA 2OXNA 3WLTA 5TD4A 3BO9A 4Q4MA 3WJZA 1ITCA 5HPOA 4XVEA 3C52A 3GFXA 1W1B1 4RW3A 2EKCA 5BXRA 3AIUA 3FEMA 1BVNP 1TTPA 1GJPA 2A7NA 3IRDA 1ZTVA 1Z8AA 4L4OA 3DC0A 1LL7A 4IQLA 4E4PA 4GI8A 4E6MA 1H7OA 3A6OA 2HE5A 3K4DA 4DI9A 1MEIA 1QU4A 1XQLA 2Q3RA 4IG2A 2D2OA 1W1IE 2YBTA 2BB0A 3NJ3A 3UJSA 1P48A 4PR4A 4K6AA 1G7VA 3DN5A 3GDRA 5FI8A 1GEHA 1VLIA 3EOOA 5CJ5A 4GQRA 2ZUNA 3VNLA 4PTVA 4QAWA 1V6WA 2ZZ5A 3NQ8A 3TC7A 1ML1A 2A2IA 3EAUA 4UNKA 1QPOA 2Z00A 3TROA 1EQCA 4Q32A 1E1FA 3CIVA 3PZOA 3OEXA 1TPB1 2X8RA 1P0NA 3IPWA 3BMWA 3WK2A 2AGTA 1Z41A 2C0AA 1WKDA 3NEHA 3E49A 1X1NA 3QSTA 3GB6A 5AYZA 1P1XA 3R89A 4MFDA 1BEUA 1KLYA 5KMYA 1GQJA 3CMFA 4AB4A 1POJA 4JZ5A 4BY3A 1XD0A 3L4XA 3DIPA 1HJWA 3WBXA 2O56A 3L4TA 4PL1A 1GVOA 3S5NA 4IG2B 1EF2A 5FF3A 4UFJA 2P53A 4S2BA 3WCZA 4QM1A 3RO6A 1ISWA 5M5DA 3SJ3A 2OO0A 5D03A 1UW9A 4QFUA 1XLHA 4HN8A 1HO1A 1FWCC 3MMWA 1HG3A 4AIBA 4F2UA 3PFMA 1EWDA 4C5ZA 1RA0A 3VI2A 4GX8A 3GXFA 4AFYA 3HPXA 1A5CA 1KBBA 2P1FA 4NSBA 1DQWA 3BLIA 5LSMA 3LCFA 3R79A 1UR9A 4HNUA 2ZXBA 3RRAA 4FNPA 1A5SA 2CXEA 3REQB 1QOQA 5HMDA 2QDGA 1ITUA 3ITLA 3EA1A 2NUYA 2OEJA 2PDNA 2HXUA 4IJRA 1PO9A 3TR9A 6TIMA 2GOKA 3G3DA 2PODA 1UUMA 3ARQA 5DRIA 5KTLA 1AH3A 4D6FA 2R1LA 3C2RA 3N18A 3LX9A 4KRUA 1FFQA 1QBBA 4I6KA 1A50A 1PXGA 4YL2A 2Z6JA 1Y65A 3WQDA 1DJXA 4XD4A 4XV0A 3ZXWA 4F66A 1K03A 1UD5A 1R47A 3F4VA 5L9FA 2X1UA 1SQ7A 3UXIA 2A4AA 3N9RA 2VDHA 5LXXA 3PZ9A 1P0KA 4ROQA 3PPCA 4EWND 3MYOA 1VGAA 1Q6OA 2PWUA 1RVGA 4JNYA 4JL2A 3KBVA 3EGJA 2W91A 2W3ZA 2E8ZA 2HZGA 2WK2A 3P3BA 2ISWA 3UR2A 1BGGA 2ZRXA 2X09A 1BTMA 4DF1A 4F2BA 4S3EA 3S1VA 3SEPA 1KFJA 4DF0A 5I78A 4H04A 1E3XA 6REQA 1A49A 2FHBA 3ARTA 4H19A 3QMTA 4ZB2A 2VVSA 4ZQOA 1LQAA 1Q65A 2QDEA 3APTA 3HTWA 3E1F1 4IOTA 2CFFA 1MQPA 4JR5A 2J8FA 1E70M 1F3WA 1ONRA 4FNSA 3ZIZA 2DT0A 4RNIA 4S3GA 1HKKA 3FJLA 1FA2A 3FIGA 1G01A 1CDGA 4GABA 4ALDA 2Y7GA 1L6SA 1XH2A 1BF6A 2I57A 3DDMA 2WMIA 2C1IA 4HU8A 3VIGA 1VB9A 4OOZA 3VIOA 3GDLA 3CQHA 4S38A 3QEZA 2W66A 5G1MA 4AMCA 3V4BA 3LGEA 4TU1A 1AW1A 1B0IA 3O6CA 4KWWA 3RLUA 4QRNA 1NARA 5HXMA 1MXGA 4MYAA 4UWMA 4Q7IA 2Z2BA 4XTDA 3VNYA 2X7VA 2XSXA 2Z1VA 3C0JA 3RLHA 1KCLA 4PFMA 4ZO7A 3C2VA 1FXQA 1IWPA 3TIMA 2HTMA 2GWNA 3FSUA 6REQB 5I02A 1PTGA 3WQVA 1LT7A 2VZSA 1MRAA 4NZJA 1H5VA 4U3CA 3WNPA 1IXPA 2F7FA 5AB3A 3PWIA 1S2TA 5T8GA 2VD8A 3QC0A 1Q85A 5HNNA 1W54A 2WO5A 2DFAA 5HINA 4C6JA 4HGXA 3M0YA 1H63A 4JFUA 5I0DA 1O6IA 1JCLA 2WMIB 1B3OA 4TX8A 1SJCA 3ZJ6A 3VE9A 1XG4A 3N14A 4N0RA 1IR2A 3VGGA 4GBDA 3WX7A 1GYNA 4PZVA 3CB8A 3QKZA 3UWEA 2GFTA 2RDTA 4DXKA 4JICA 1W3JA 2F6UA 4BF9A 2P88A 2G4FA 3OU8A 3TYBA 1DXEA 1US3A 4MY8A 2B4GA 3MB9A 4KGLA 2Y7FA 1IXOA 4LUSA 4QCFA 5AECA 3PWGA 2QCDA 2VRKA 4EF8A 1QI0A 3IWPA 3WF2A 4BCEA 4KRTA 4B5NA 3FGCA 1W3NA 3CO4A 2OODA 1ZAIA 1R86A 3RFAA 2DJXA 4WLCA 2X30A 3PM6A 2REQA 5EKYA 1SZEA 4ORIA 5C7VA 4YIWA 3FFSA 2HDJA 1VS1A 1GVQA 4AIUA 3AMCA 3GDMA 1AJZA 3C3UA 4CEUC 1XRVA 4S1FA 3ITVA 3KEHA 1WZAA 4LS1A 3NQFA 4UFHA 5E93A 4GQBA 3N6JA 4NL1A 1NOWA 3EBVA 1GZGA 1RV8A 3G1RA 3LV6A 3TCSA 3E02A 3UR5A 2O7SA 3FS2A 3NZGA 7A3HA 4EAMA 1NQ6A 2BG5A 4CNNA 1YNYA 4YYFA 3T44A 4QTGA 4YVPA 3EX4A 5CQ1A 2GJPA 4C7DA 5CBBA 2Y6ZA 1CGYA 4JYFA 2OJPA 1NDZA 5AHNA 3ZLFA 3NGFA 3L66A 1I4NA 4NT0A 4RDWA 3LM3A 3UPWA 4LRTA 2ZWYA 4Q8MA 4LUSB 4RE4A 2DIKA 2PDIA 1OYCA 1UKSA 2QCDB 3BCFA 4JX5A 2JGYA 3WH7A 3WZ0E 3EA2A 3ITTA 3H22A 2RFGA 4FOJA 4R3UA 5CPLA 4XD5A 4DJDC 1EJXC 1ZCCA 3FGCB 3IVUA 1XLGA 1BKSA 1QASA 3VK5A 1TV4A 3KOXA 3A13A 3UZXA 1FWBC 3TJIA 2REQB 1OT1A 2ZOXA 3UWWA 4IXHA 4YHEA 1K70A 5T9CE 2PGRA 5DMYA 4EXBA 3BUVA 2J4GA 3BANA 4CD4A 2DU2A 1NFGA 4HIBA 1F3TA 5HNUA 1W3TA 2XSAA 3TN3A 4LV4A 3OLEA 3NDYA 1WXZA 4N42A 4LUYA 4BF5A 3O6AA 1EIBA 2YJQA 5AYYA 5EPDA 1A53A 4WY0F 3I65A 3G22A 2RKXA 3WFAA 3LZ3A 1KKOA 3ZM8A 1RPKA 4Q8NA 4GBUA 3DG6A 3GNNA 1OX6A 2ZRWA 2J6XA 3QYSA 4QE1A 1Q6LA 2TSYA 2PTYA 4IQDA 1QATA 2E28A 1J2WA 5JIPA 2R94A 2WNNA 2AQOA 4O54A 3IJDA 3M5XA 3UETA 1GVIA 1UB3A 3KRSA 3ZR5A 4K7VA 2F84A 4O10A 3GR8A 3W9ZA 3FJ6A 3W7OA 1VKFA 4ZBCA 1WXJA 5ECVA 3GVWA 2YFOA 1NDYA 4PMUA 3UF9A 2OZ8A 5CZSA 2Y85A 3B9AA 4IMGA 4GUFA 3O07A 4HJFA 2QUUA 4A3RA 2PF0A 1L2QA 3E96A 4PUWA 1NWUA 1SVDA 2VR2A 4O4VA 3TAKA 2W9MA 4DYEA 5EL1A 1TYGA 4UQ9A 2VI0A 4HOWA 2JKPA 2DZUA 3B9OA 3LMYA 2VD9A 1PKNA 3NVTA 2EG7A 1WXYA 1N82A 1KBKA 5FJOA 3VU2A 1HXJA 1TUXA 4JEJA 5I3JA 2BMBA 4I90A 3MCOA 1A3WA 4AWTA 2NX1A 4IH3A 1XQKA 2WBGA 3NG3A 4LCRA 1DIDA 2J7GA 3VDHA 5H2ZA 4RR4A 3WD0A 1E5NA 3PJUA 3KBSA 4BEUA 3KOYA 1A5LC 2V5CA 3FNDA 2ZICA 3GQYA 3QJAA 1OGGA 3NXLA 1OK6A 1CWYA 1GORA 2H90A 5CSRA 4M6PA 1MO0A 4MNJA 4Q4OA 5CBIA 1YDVA 3NURA 3DG3A 3SRFA 4HZ6A 2X0YA 1MSSA 3BQ6A 4M80A 4A2RA 4FK9A 4CQ9A 3ZYZA 1QRQA 4A29A 4WDWA 3EYPA 4IGHA 4RL3A 8CGTA 4E38A 2YLLA 1FHDA 2V8ZA 3DKLA 3FOKA 1E6NA 1OD0A 4C6DA 5A6MA 1U83A 1LWIA 2OKOA 1E4NA 3EWBX 3VIIA 4HNOA 4EACA 3AIRA 4QGCA 3H7RA 1W5PA 3QFEA 4HU0A 3R2GA 5BXSA 3W7GA 3KS6A 1GZ1A 2DZSA 1H1YA 3AS1A 5U4NA 3LTPA 1Z69A 4S3FA 1Q13A 1VFLA 4N4PA 4UNIA 3KVLA 1K8CA 3BCDA 3CV1A 1PKYA 2WMFA 5FF4A 3EOLA 2TMDA 4R27A 3TSDA 2HNHA 3ZS4A 4CU8A 3HG5A 3BW4A 5CLTA 2HE8A 1J79A 2PZ0A 2HWGA 2V9DA 2BXYA 3KE0A 4QAIA 2X40A 3LSCA 3URNA 2OR2A 2GUUA 4ZTYA 2QAPA 3ZT7A 2PDUA 2OWCA 4UQAA 1UBSA 4RPQA 2FH8A 2PCQA 1KCXA 3M0VA 4Q7NA 2AKZA 3GU2A 4HP5A 4ML4A 2I17A 3W76A 3HG3A 2XH2A 2GGEA 3DFOA 1AUSL 5A3HA 3E38A 1L8NA 1R0MA 3H7VA 5BRPA 1JYVA 4FI4A 3WF4A 4LAZA 5CPQA 4PSPA 1DTUA 4F0HA 4O28A 3W82A 1H09A 1H7WA 3EMQA 3SRKA 3BLEA 4H9VA 3T0CA 5LNRA 4WJEA 4YTQA 3LTSA 2E0PA 1NAL1 1C93A 1C8QA 1WPCA 4AHPA 1BXCA 3T7VA 1KXHA 2AL1A 4UUIA 1NOFA 3K4AA 4P61A 3T08A 2FZ8A 3LERA 4ATLA 2BGSA 2QVNA 7XIMA 1W91A 5DCEA 3N2BA 1SMAA 1TSIA 5H8MA 3L0NA 1UMLA 3TYAA 4GJIA 1MDLA 3EX2A 2GGHA 3B97A 4KEUA 4GINA 4IMFA 1N7KA 2RH9A 2AAAA 1EX1A 3E6EA 1OIFA 3QV7A 4NJIA 3W83A 1TV5A 1ODUA 3W2UA 3D3AA 4GRSA 2G97A 4G2DA 4HMCA 2DIEA 5AKQA 3CZGA 2ZZ4A 1OB0A 2YDSA 1V03A 1ZBCA 3ARYA 1XH0A 2PDMA 1G69A 2H8XA 4Q4KA 4GZIA 4U31A 4UCGA 4UB9A 1ME9A 1RCXB 3WJYA 2VX6A 4E2OA 3UXKA 3CAQA 3GK0A 2B7OA 2VDIA 4Z1BA 4D71A 4DNHA 4I5RA 1BQCA 1SW3A 3V35A 2NQLA 5KZEA 1E43A 4LC6A 4Y9OA 2OFJA 4M1RA 3VOCA 3PPFA 3PC0A 4P7LA 3FCPA 1UIOA 4DBSA 3UY7A 2C8NA 3H2AA 3NFUA 3W2NA 1IXNA 4K3ZA 5CGMA 4W7UA 3V5OA 3PNZA 4KCUA 2XDFA 1RZMA 3G2GA 3W7LA 4INFA 4JYEA 3R1ZA 3FYPA 4XZIA 4QBXA 5A8QA 3G1XA 3H12A 4GIRA 1VYRA 3AI0A 3VNKA 3UNTA 3RPDA 3WLJA 1ISYA 2WCSA 3WMCA 1X97A 4AF0A 3LB0A 3V0UA 3KAOA 4HKPA 1GPWA 2WHKA 1SZRA 3BGGA 3N1AA 3TTSA 1OC7A 4H2CA 2CPUA 2ZC8A 3QLDA 1E0XA 2PCEA 4IGNA 4K8EA 3LDVA 1DWHM 4ZQCA 2PFHA 4QXIA 1KV8A 3FV9A 3VDBA 3H4WA 3M0HA 4OGZA 2WMGA 4LEQA 4AG0A 4W7VA 2C6QA 2QJIA 1J12A 3FHQA 3R8RA 3UZ5A 1LLOA 5D9OA 2WLYA 1SO5A 3IGXA 4OV9A 2W62A 3UW6A 2JE8A 4KPLA 3TVAA 2FPVA 1H4PA 3J7HA 1US2A 4QS6A 4OUEA 1EZ2A 2P0IA 1TPH1 1QR7A 2CLHA 3P14A 5TF0A 5G1TA 3K8MA 3LCIA 2IUZA 3FA5A 1JDFA 1J0YA 4P8WA 3LRMA 1KXQA 1EOMA 1OQFA 5A8NA 2VT0A 3R12A 4GCAA 1QI5A 2ADAA 2FPYA 4HPNA 4HTYA 1Z3NA 2YCIX 2ZFAA 4LVAA 1JPMA 3VOHA 2ZADA 4AF0B 4UFLA 3N13A 1YPIA 4WQ6A 4B15A 1BAGA 1ALDA 1OZMA 4A3UA 3CUZA 4UTWC 3EDDA 3KRZA 3I7SA 1UPMB 3C2OA 1DORA 4V1XA 2OEMA 3T42A 3E74A 4HZ8A 3QPZA 4NG3A 4CCZA 3MT1A 3FSTA 1KWKA 1J6PA 1AMKA 3HV8A 4IMDA 1PUDA 1VH7A 3D5HA 3GG7A 3RN6A 3A4JA 3RMJA 4S3CA 1YTEA 4NXKA 3TYZA 1T8XA 2VEPA 3UBPC 1H3GA 2AOSA 3P0XA 1U33A 1VF8A 2VZTA 2GJLA 3PPHA 2OELA 1FCBA 3G6MA 3OZYA 4ZQPA 3W2JA 2GJNA 3OP2A 3MBFA 3GHRA 1QCWA 1ADSA 4R7WA 4AWUA 3SCNA 2XU2A 2PDHA 3MHGA 3VE7A 1HT6A 1MZHA 1YQ2A 1W5MA 3YPIA 4XBSA 4IFKA 4LGXA 3W1NA 4N9EA 2CLOA 3EWCA 1XX1A 3CAKA 5CSSA 4KGJA 4WDXA 3LN3A 2J8TA 3IANA 4DJEC 3K30A 1JZ5A 4S3BA 4PTMA 1OFOA 1D9EA 2DW7A 3PN8A 4Y7EA 1BXNA 2X2GA 1VCGA 3HQ1A 4FNTA 3TONA 1W17A 2WZIA 2RDUA 1CXIA 3SUUA 4IP5A 4QLLA 1Z89A 3SURA 3S6OA 1KGXA 4NNBA 1WB0A 2YKKA 3DHDA 3DEQA 3UXAA 4LYPA 4G9PA 1RXOB 1XYZA 3VKCA 2HBXA 3W2LA 4CD7A 3CHFA 3CWNA 1K4HA 1RCQA 1WDPA 2YCKX 3ZZ1A 5H1WA 3LI0A 3NQ6A 5A1AA 4CVWA 4GCXA 1SR9A 4PRTA 1BVWA 4JS3A 5CGTA 3LI1A 1B1YA 2C14A 5B7YA 4H1ZA 2PBOA 4Y6GA 1W8SA 4PUJA 2FGLA 3IJLA 1JEZA 4IFKB 4QG8A 2XSBA 1I2NA 4Z1DA 3RU8X 5C9ZA 4JFWA 3AMDA 2NLIA 4WKAA 3CT7A 4WDTA 3CWOX 1QWKA 5I09A 1EXPA 2VEKA 3N4EA 1Q6EA 2Z27A 4N9BA 4S3DA 4WSJA 3VC5A 4UTIA 4XAZA 3NL5A 1UUQA 4DI8A 1EQPA 4L4PA 4O0ZA 1O66A 1RQBA 4DVOA 5M3WA 1UWQA 1FWHC 3QW3A 4PSRA 1RHCA 1JD9A 1L6GA 4K36A 3VVGA 2WW5A 3UZJA 4DWSD 3TE9A 5AVHA 5HANA 1JRCA 4GYPA 4YVVA 4N4QA 4GLEA 5BXPA 2XVNA 1J4EA 5XIMA 2WSPA 3EB4A 1W8GA 3AHTA 2JIWA 3RMEA 1MRQA 1RY0A 4GK8A 4AQLA 5K4XA 2YXOA 2WMJA 1WV2A 2DQWA 3GKAA 3OBKA 3P80A 3CXOA 4EE9A 1SU5A 4EWJA 1QW8A 3B9NA 1PZ1A 3UEQA 4Q4SA 3RF9A 2FMNA 4JTQA 1UD4A 3WUEA 4BQ2A 1FOBA 3VABA 1JRBA 1JULA 2CLIA 4ZENA 1EP2A 1QFEA 3SZ8A 1R2SA 3G6LA 1S2AA 2ABAA 2VX4A 5HR6A 2H9AA 3F1QA 3W00A 1NFPA 4XBJA 2VX7A 1ZJIA 3O8AA 1EJTC 2WNZA 1UR4A 1FDJA 1XG3A 1BYCA 3QC3A 4H00A 3OVGA 2HS6A 3CEPA 4DWSB 2X1SA 4KEVA 3TYDA 5LA0A 1O1ZA 3B8IA 1OADA 1W37A 4ZA0A 5HK4A 2YL6A 2E6AA 4YS1A 3THCA 3R11A 4OV4A 4GUHA 1TTIA 4C1NA 2PDWA 1UR0A 1S1RA 1B3YA 4N2YA 3IJ6A 3UJFA 1YEYA 3TK7A 3WUBA 2DORA 4J2MA 1KM5A 3GU9A 3CUJA 4WOZA 4WR3A 1Q6DA 3W7QA 2GUBA 1C3FA 1C90A 2RDWA 3VINA 3WBAA 4XWUA 2GVYA 4RLIA 2DVTA 3DAQA 3AROA 5AZ0A 4NVTA 2ICSA 5A6BA 3T0AA 1OIMA 3W38A 5A6BD 4GI6A 1S5NA 4JQ1A 5A6JA 3T09A 6PTDA 1GVEA 2QCGA 5AHIA 3W27A 4DX3A 2X16A 3HPSA 4O0KA 1A5OC 1XLAA 2HCVA 3TQKA 2WCAA 1UWUA 1DWAM 4AD0A 2EPOA 2G3JA 1E0TA 1V3HA 2H9AB 4EPBC 4EPDC 1VFFA 4GVFA 1HQTA 4UTMA 3NQEA 5C9XA 4K37A 5IOBA 1YPXA 4JKLA 2CZFA 3QY7A 5AHLA 1W2VA 4ML9A 3ECQA 3BSGA 2KZHA 1C8XA 2HV5A 2F6KA 3UESA 1JDEA 4LALA 4Q8WA 1Z44A 2ZUWA 5D02A 1V8EA 4MPKA 1GTHA 3K4WA 3NAVA 1DHPA 2I16A 3F2CA 3M0MA 3NL2A 4C1NB 4U5IA 5C9UA 4KF1A 3B8VA 3NQAA 2V68A 1JCNA 4FS9A 5IFTA 5LIUX 4BK9A 3PAOA 1E6ZA 5G1YA 1SPQA 2D73A 5T26A 2E67A 4BKNA 4MB4A 1GONA 3EOEA 2QQ6A 3GTIA 5JBDA 5HPCA 1ME7A 4WIWA 2J7EA 2ZUVA 1I45A 1QAPA 3VX1A 1YMYA 2IQ0A 1LBMA 4N9DA 2PGEA 3CUXA 4BF7A 4HPGA 5GNXA 3C61A 4UOJA 4X2PA 4MY1A 3UVIA 1UWSA 4HYVA 3DG7A 4JTRA 2VOTA 4O4WA 4ICCX 2DH2A 3MCMA 3FN9A 3TFCA 4UFKA 2FHFA 1CBGA 5T91A 3CH0A 3OW1A 1TPEA 3MP3A 4LB3A 5EFFA 5AFDA 3MKCA 3L68A 3DENA 1EDQA 5G4WA 2O92A 1W1YA 1FP9A 3PBUA 3AICA 5IHSA 3UNDA 3LEPA 1VCVA 3W2KA 3STFA 2GVEA 1KQYA 3W26A 5HMSA 1EL3A 4UCFA 1K3UA 5CPNA 5A6LA 3F5LA 3QH2A 4H8VA 2E1WA 4H9MA 1ICSA 4M6UA 3LMZA 5KETA 2Y61A 2CZ5A 1CPUA 3WENA 2QV4A 2EPNA 3KX6A 2UY3A 2PSNA 4E5TA 1KGUA 2A7RA 2WM1A 2V2HA 4H6EA 2NQ9A 4I5XA 4P8XA 1PX8A 2Z6IA 1N8IA 3BWWA 4PL2A 3WELA 5FF7A 2JKAA 1VJZA 1D2KA 3QPEA 4HNLA 4PULA 3OHIA 3DBNA 4R85A 1QK0A 3TOPA 5I07A 1AD4A 1OABA 1OX4A 3WLMA 4LANA 1FWNA 2HK0A 1IIHA 4KBXA 4Q8PA 4MJZA 4YHGA 3RCYA 1UZ4A 4DYJA 1XPYA 1A5UA 2W27A 1OGBA 3WNLA 4YTSA 2UY4A 4XG1A 4K8HA 1VFMA 3EWXA 3EMZA 1IEXA 1TPC1 3OGRA 1AQ0A 2V5JA 3F5KA 3LHZA 3HFTA 4C6BA 2EQDA 2A0NA 4GVHA 4F79A 1R2RA 3W86A 3T55A 1GPFA 2BZNA 2PWDA 3AYRA 3FKRA 3JZEA 1ZENA 1UG6A 3STEA 1FX6A 2OYKA 4M19A 2PLJA 3TA6A 3G1VA 4ZO6A 2YX0A 2QJMA 4U5KA 3ORWA 4ZQRA 2VHLA 4AAJA 2QLYA 1HKJA 7TAAA 3SGUA 5XINA 5L6UA 2EBNA 1X7IA 1I8JA 4I5UA 4NF7A 3IRSA 1F3EA 2X1RA 2NUWA 3LD5A 2YB1A 1UWAA 1ADDA 1G7UA 1K7FA 2WZTA 1E0VA 1GW1A 1VBRA 3LHYA 3BW3A 5HWJA 3H54A 3OYZA 4JQ3A 1TWWA 4WZHA 4GYFA 1OX4B 4XZ9A 3F5JA 4REQA 3W1XA 2XM2A 4AMAA 2CZEA 1DV7A 3H2EA 1KTBA 1GOQA 4JOMA 3VGBA 4HTBA 3I68A 3GW0A 1PDYA 1QBAA 3BQ5A 3UT0A 1AMYA 4H3DA 2E7FA 3MVIA 1KWGA 1W1VA 3ELFA 1VP5A 2NWRA 4IIBA 5C2XA 1RPXA 3EPOA 2BNJA 3T8LA 3RHGA 2ZX7A 1NY1A 2WMKA 3LPFA 2OLAA 3GC5A 2FZMA 4R53A 1B31A 2D0GA 2PDKA 1OYBA 1RQHA 2X42A 5REQA 3APGA 4LBRA 2PDCA 1UA3A 4PRWA 1L9WA 1W3IA 4DEFA 3ZQ9A 3CZKA 2CW6A 4IX0A 3W7JA 4DWSC 1IYXA 1CGTA 1NIUA 2FDMA 4JFVA 4XIAA 1W56A 3NZQA 4NKCA 1ITQA 1HTIA 4GYPC 3QPYA 4REQB 1TX2A 3O2LA 2BHUA 3H21A 1Y0EA 4HSHA 3NR0A 1F7BA 2VEMA 3N2OA 3PK7A 4EKJA 2V3FA 3WH9A 1GVSA 5TBOA 4Q22A 3CIWA 3HPZA 1TWIA 3WJWA 1LTDA 4MNLA 3WDQA 4YTUA 1H7NA 2BHZA 1BTCA 2IW0A 1JUEA 5DXYA 1A80A 4A3HA 1RUSA 1XIEA 3F2BA 3PZGA 5CC6A 2XPKA 3GTNA 3EDJA 1UD6A 3WQGA 1EP3A 4F9DA 3ABOA 3AZSA 3G0UA 2WBKA 5M1TA 2QHAA 1VAHA 2OCZA 1B3XA 3UG4A 2GQ8A 3MI2A 4QITA 5REQB 3LXCA 3CQ0A 3W70A 5CZTA 4CD8A 4QEHA 3H8AA 1QOXA 4RJEA 5TQLA 2ZUUA 4AD2A 1QK2A 2VCAA 4QIUA 3WQ8A 3Q4DA 2YA0A 3QOMA 2BASA 3GTXA 1XUZA 4LTSA 4KFNA 2HS8A 4BQ5A 4Z2KA 1E56A 3PTKA 4MKSA 5FF0A 1ISVA 4G5DA 2D2GA 3W73A 3TQPA 2J75A 4PH6A 4AU0A 6XIMA 3W2MA 4GYKA 3INPA 1XW8A 1K1DA 4CQBA 4DQWA 2EPLX 1LROA 1FFRA 1F8IA 3LPOA 2D0FA 4MAZA 3LZ5A 1UH3A 4OIFA 4ZOCA 3UXLA 4CQ8A 1Q45A 4GFIA 1FQ0A 5CGQA 3V18A 5KZDA 2TRSA 3EZ4A 2FZ9A 1XV8A 1TV3A 1E6XM 4QNWA 4GNVA 3N04A 3CLMA 1YNPA 3LS9A 7PTDA 4HHMA 1SSGA 2WHMA 5KZMA 5D9MA 4MLRA 1M7PA 1EBHA 3S42A 4NAEA 2EAWA 4F8XA 3S2CA 4I7WA 2HK1A 2P10A 3SM0A 3EX6A 3AS2A 2Y7EA 2NXIA 3W6MA 1M65A 4IPIA 3U2ZA 1AQFA 1NSJA 3LXAA 1I0BA 1H60A 1R9ZA 4PUUA 1WYIA 4ZXLA 1JZ2A 1F9CA 1V6TA 3ITGA 1GKPA 1SMDA 3CPUA 3URBA 2P5NA 1XRTA 3T07A 1Q2SA 2CLEA 3VOIA 2VR4A 1Q7ZA 2QUTA 4M29A 1JQVA 4DO6A 3Q45A 1PYMA 4FIRA 3MO7A 5LNSA 3S9YA 1OFDA 3SO7A 3VA8A 2PLMA 1R9YA 2FJUB 5C2CA 1MXDA 3G18A 3CASA 5HNRA 3CT2A 4LUTA 4L1GA 3QBUA 4DPPA 1GQIA 2AQWA 2C3ZA 3M16A 1B3WA 2BODX 1TQXA 1X7FA 3VTRA 3OLIA 1CEOA 2R6OA 4LCQA 3GAKA 3GC4A 4B3LA 3AC0A 2E5DA 1TPDA 1BPLB 2OYLA 3TN6A 4HCLA 4JN7A 1LBFA 3AYSA 2ACUA 3V0TA 4NAEB 2ALDA 4E2VA 2SFPA 4OT7A 4U28A 2EPHA 4JEQA 2NZLA 3N3MA 3L67A 2Y88A 4C6FA 1GOKA 1PL9A 1QNVA 3RNDA 1BVZA 2TAAA 3CUFA 3E2RA 3EDEA 2DSUA 1EDTA 3TW7A 3KBJA 2VEFA 3WH5A 2ZA3A 4B5SA 2ZX8A 5DT5A 5A2CA 1TJ2A 2X0HA 4Z2HA 3NOYA 1EGMA 5AC7A 3IIXA 3KWXA 3P2VA 1GVYA 4WJ8A 6XIAA 3OO2A 2R1MA 5BRBA 2XYLA 2CCRA 4LUTB 3EWUA 3TTOA 5C0QA 3VXGA 2BHYA 1NU5A 1B30A 2XVLA 3W7KA 4H6RA 3N19B 4W8BA 1YDOA 3GNRA 5A94A 3A3WA 1NJJA 1BSIA 1H49A 3WK3A 2BVYA 4L9ZA 1RR2A 2O7QA 1F73A 3WFLA 4S39A 4YPJA 4IICA 4DO4A 4V15A 3LLXA 5EBUA 3GVVA 4PUNA 2BXVA 4N9CA 3SCWA 1SW0A 1JPKA 3ANYA 3GY1A 2G41A 3TDFA 2E3ZA 3LM7A 2WQPA 2ZIDA 2HVMA 5I77A 1JCJA 1HNYA 3CV7A 4S3AA 3UG8A 4UQDA 1OFEA 3VDCA 1SSDA 1SZFA 1PS9A 2ZXQA 4LW7A 4NZ5A 4QDWA 1XH1A 2RUSA 2ATMA 4OU1A 3VGFA 3A9IA 3P82A 3B40A 2WLZA 1DWIM 4AZBA 4M5PA 2Q09A 1FWGC 3ZWTA 4QCEA 3D3FA 4C6CA 1R6WA 2CHNA 5HMFA 3OVRA 2FTWA 4DBEA 1AFSA 3PR2A 3B0VC 4L61A 3JUGA 3USBA 4HCDA 4M6VA 4FXSA 5CH9A 4FALA 1JDCA 2UWFA 1K9FA 4NRRA 2DUZA 1HKWA 4IGMA 3DGBA 1GOIA 3IUIA 4B5WA 4KQNA 3UVAA 3Q37A 4L56A 1Q6FA 1EZWA 2EPKX 1C8YA 1VEOA 3GYCA 1US0A 4B92A 1RCOB 3ONBA 4LS2A 4JTSA 4GISA 1QXLA 5DT7A 1HL2A 5K2ZA 1CB7B 1CGXA 2V3EA 2QV5A 4IJCA 3OQEA 3ZR4A 3BH4A 4IMAA 1IEWA 3M4HA 4J5NA 1JNEA 3UXDA 2G0WA 2D23A 5I24A 5AOUA 2WPBA 1U2YA 2CLPA 3SUTA 3AXIA 4NU7A 3E0WA 1SZNA 3KBWA 1XLIA 1EUNA 1AH4A 1DL3A 5G2IA 4IUOA 4FEZA 3P8JA 3RJXA 4B9ZA 2ODOA 2ZDRA 1OGSA 3W75A 4DIAA 4NZ1A 3PULA 4B91A 5JVLA 1W0MA 2ZX6A 1G4EA 4OBSA 1I2QA 1PX3A 3ITXA 2J62A 4QQUA 3FAXA 3PZQA 5C70A 2W5FA 3NYZA 3RU6A 5C71A 3T0BA 1NDVA 4DXXA 1CI1A 5E0FA 3GNDA 5JBFA 1GKRA 1UQYA 4QLKA 4O1DA 3VX0A 1ZFJA 3KTXA 1OF6A 2PBGA 4PMOA 2YDAA 2PDGA 2ZZ3A 1Q7MA 5CZKA 3UA3A 4V28A 3M64A 3PTMA 4LAMA 4ZODA 3OOQA 2XIIA 3GR4A 3O7UA 2ZA1A 2EF9A 1ESWA 4C90A 5CC3A 4NHVA 3SN0A 1FCVA 4WSHA 2OEKA 2OTDA 1G0CA 3L0GA 1ITXA 3NOEA 5CLWA 1W5NA 2F6XA 3LNPA 3MO4A 3W7CA 2BOGX 3RR4A 4NQ1A 1DTNA 2E8YA 1HFBA 4HU4A 3VDAA 5EU9A 2GQAA 4JN8A 4PMRA 2OQYA 2R24A 2OU4A 4UFIA 4UZSA 4WEVX 2ALRA 3RX2A 4O11A 3BMXA 5AYXA 3GTFA 3PPGA 4PUDA 1GTEA 1JDDA 2A3CA 4QG9A 4EOUA 5D9NA 9XIAA 3BOFA 3GH5A 1J10A 3GSMA 3ABRA 1AH0A 1H2JA 3E5PA 1XBXA 2YL9A 1GOOA 3HM7A 4XX6A 3U4FA 2VFGA 2CEQA 1XFBA 1M53A 1GGOA 3R8HA 4IFRA 1XSIA 5HR7A 3LCLA 4UQBA 2J47A 2XVPA 4URIA 2FYMA 1HKIA 3WQ6A 3Q58A 4F48A 3VKJA 4HA3A 1OCNA 4ZO8A 4I8DA 5LZLA 4I9TA 4XO6A 4XAFA 4CUCA 3NVDA 2JGQA 4DNMA 2FGZA 1LWJA 1SZGA 3AMKA 4G8TA 3IACA 4TMBA 2VEIA 1VZWA 2DSVA 1WDWA 4RDZA 2PGFA 2FH6A 2CESA 5D2VA 4H8UA 3KTSA 4YCOA 3UWVA 1F4AA 5EMUA 4X0NA 2DW6A 2D1ZA 3ARUA 3O6DA 3N15A 4IXXA 4RZ6A 1PBGA 4NNAA 3W7RA 1B3ZA 1A4MA 2V0TA 4AYSA 5AHEA 1OFBA 4HPHA 2PEVA 3TH6A 4JIIX 5CJMA 4NX0A 3V5FA 4FP1A 1KRAC 4LVFA 4EF9A 4ES4A 5GJNA 3MANA 4ORMA 1M41A 1VRXA 3A21A 5ABGA 1ZGDA 2H3DA 2G96A 4UTJA 4PMNA 5A6SA 4GC3A 2E6DA 1S5WA 5EGRA 1V79A 2POZA 1RP8A 4WVXA 1ZUAX 4PMZA 3CJPA 2WXDM 2ESCA 1GOXA 2FGBA 2RGLA 2ZUMA 1UZ1A 2QW5A 3VKDA 1C7SA 3WG6A 1F8MA 4CCDA 3FJ4A 1GYLA 1A5AA 4LB4A 2VURA 3G8RA 4AY8A 3KZPA 1Q5MA 4E3TA 3Q94A 2A5HA 2L5HA 3WH6A 4V33A 1FWSA 1IT0A 2PU0A 1SFTA 3SUVA 4HU3A 3XINA 1GVFA 5LYRA 1PYFA 2VOMA 1LORA 4PA8A 4GKTA 4TV6A 3PFRA 4H9ZA 1V7YA 2QUMA 3QHOA 1HKMA 3RX3A 3R6IA 2XH0A 5LHEA 4CNPA 4A2SA 4PN2A 1E6SM 3VFCA 3BJFA 4MB3A 3ES8A 4WDUA 1ZU8A 4C6EA 3DI0A 1LLZA 2Q3OA 2FZNA 3AUOA 4HVXA 3G5EA 1ZB5A 1O5RA 3TMQA 4HMEA 1BSLA 4JIHA 4AVOA 1LF1A 3VOFA 4HSNA 1S2CA 3UG3A 4LAUA 1UKQA 2VFEA 3CUGA 1MZRA 2J9YA 4JTAA 1DJHA 4GQQA 3TQ0A 2RHGA 3A3HA 2Z26A 4RZ5A 2YW3A 3WL1A 1O5QA 1NVMA 2V2CA 4ATWA 4PE8A 4L5ZA 2JBMA 4AW7A 3QZAA 3BMVA 3PBWA 3W1AA 1TELA 1N55A 1MQQA 3ICJA 3LOTA 1IT8A 1XGDA 1FWWA 1KBLA 1QVBA 3PZVA 2C7FA 1TE1A 5EY5A 2P8CA 2PWEA 5EMLA 2PS2A 2YCJA 1AL8A 3P84A 1UOKA 4XAYA 5D2XA 2ABBA 3NO1A 4PMYA 5BWAA 3LRLA 3EXRA 2YPIA 1VIZA 3TZNA 2VZVA 2Y8VA 1H7PA 5JH1A 3GIPA 9XIMA 1ZP3A 1JZ8A 3MKKA 2CKRA 2YYTA 3PWAA 3TOYA 3CYJA 3TN4A 4XZLX 1E9YB 4GPNA 3GXPA 1JG9A 1YXDA 2O0TA 1FP8A 5BCAA 2EXOA 2WVUA 1XUUA 1M1BA 3ABQA 4JL1A 4W4QA 1TJ0A 4ZR8A 3U6WA 4ZOAA 3R7MA 3BAKA 2BLEA 5D2WA 5A6AA 1EEXA 3H26A 5E70A 2FKPA 1FTXA 1XSJA 4BQ4A 4GKLA 2QT3A 4Q6JA 3KP1A 2QXWA 3G24A 2P3ZA 3CM4A 1UH2A 3S5OA 2YR1A 3AISA 2E1DA 4CU7A 3UD6A 3H2MA 5AC8A 4CKQA 4Q3MA 3KBNA 3VAVA 3U0HA 3NEVA 3NNTA 1DPMA 2OLHA 1JZ7A 2QPSA 1UP3A 2CNCA 4Z17A 4FO4A 3UR8A 2QCLA 1V3LA 3NWRA 3WK1A 1L2UA 2ZQ0A 1HIZA 2OLSA 4F0LA 4GJ1A 4EX4A 3LK6A 1G94A 4Y9MA 3KZSA 1SFSA 1G6CA 1NFBA 2ZZ2A 2VL4A 2B81A 1XLKA 3SCRA 4U2YA 1QNPA 3W1LA 1A4LA 1JVNA 4PEKA 2WVVA 3VIMA 1KD0A 3I3BA 2I5IA 1QPRA 2QCFA 4LVBA 4G7EA 2CETA 4PMVA 4LRSA 3MWCA 1DHKA 2VRJA 1B3VA 4W5UA 4CCEA 3MWAA 4XB3A 4HNTA 4AVNA 4PCNA 3FKKA 4H2HA 3RILA 1FWAC 2JQXA 4MWAA 3VNJA 1R3TA 3FXYA 1I75A 4MWAD 1G4TA 1K7XA 4GACA 3G1FA 5K3VA 3HPFA 3PZIA 4HA1A 1GJUA 1JXJA 3TCEA 1BYDA 5FEPA 2QMJA 3W7PA 4JCMA 4S3KA 1Y5VA 4CD6A 3W01A 2ZE3A 1YX1A 2VO5A 1DWFM 2Z0IA 2DZBA 1QI3A 5GNZA 2WSKA 4FNQA 4ONVA 1JUKA 4ZL1A 2JKEA 1EEPA 2FMOA 2Y63A 2PGWA 2VFHA 4IPNB 2P8BA 2PPGA 3TV8A 1IWBA 3T4CA 3I10A 1H7RA 2E77A 4MSSA 2C79A 1HJSA 1OG6A 3P61A 1KBIA 1WBHA 2OVLA 2WVVB 4RE0A 3S2JA 3ABZA 4E8GA 3M0JA 3LUTA 4JNZA 3SW6A 3DUGA 2DZAA 1W9BM 4IQEA 3SDOA 1H61A 3GWQA 3V1PA 3VMPA 3U2OA 4G7EB 4GHRA 1ME8A 4IPJA 3WMSA 4IP4A 3FEQA 2NX3A 4GFSA 1XD1A 1EWEA 3DHPA 5EFDA 4JTTA 4JKKA 3KDOA 1OFQA 3L5LA 3LRKA 2INZA 1XC6A 5AHFA 1J18A 3QY6A 4ZEPA 1LP6A 1AG1O 4E8CA 3TJXA 2IMRA 3JS3A 4XSLA 5D9PA 4JTEA 3H2FA 4MWAB 5CPSA 1UR2A 1F61A 1SJBA 2UZ9A 3W24A 4XISA 3LQLA 2EKGA 1W1A1 3AYVA 4B2DA 1GT8A 1IIGA 1BHGA 3GBDA 4B2DD 2R82A 4JTFA 4NP7A 1YXYA 1V6YA 3CNYA 1PCKA 4L6DA 3GNOA 4LYRA 1IF2A 4DELA 4MJ4A 1VBHA 4FB7A 3EDKA 4TVDA 4J4KA 1UQZA 2YOCA 3C0QA 1YIXA 1UOZA 3CMGA 4UQEA 5LIXX 3O06A 2F8QA 1WZKA 4K68A 3N17A 2PU1A 3TKFA 3QQWA 1L6YA 3WQPA 2NXGA 4RE3A 5HJXA 3B8WA 4D1JA 4RW5A 3HPAA 4JHMA 1DYSA 5F4SA 2WSQA 2CXGA 3ZJKA 3N9SA 4R34A 3B9EA 5LIYX 2ZX9A 3TW6A 1BFNA 5I00A 1YNQA 3ARXA 1J0JA 3FVMA 1HGWA 2DJLA 3W1PA 3W74A 2YBUA 2VFIA 5JBEA 5DCDA 3BE7A 4ZCWA 2JEQA 3SN4A 1TG7A 3CQJA 1Q6QA 3PZTA 5BRQA 4Y9AA 5HATA 3POCA 2YIHA 5BXTA 2WMHA 1V77A 5F7UA 3VD9A 1R38A 1A0EA 5JQ9A 3TN5A 3HN3A 3L4WA 3WDPP 3MUCA 1S2UA 5HQLA 4G1KA