1C3FA

Endo-beta-n-acetylglucosaminidase h, d130n mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
b'KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
molecule tags Hydrolase
source organism Streptomyces plicatus
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c3fA00
3IJ8A 5EBAA 2NT0A 1B0IA 4IISA 2VCCA 5FD0A 4DM1A 5BXRA 2VQTA 2Y24A 3SCVA 1C92A 2EBNA 1QBAA 1JDDA 2CKSA 3DYMA 4D6HA 4UOZA 1UA3A 2WC4A 5IXEA 1B3VA 1QHOA 2XYLA 3D5HA 2DEPA 3J7HA 1UYQA 2VNCA 4AC1X 2WWDA 5A8OA 1QI4A 4EE9A 3BGAA 3DC0A 1E0XA 2VCAA 5I6SA 2DSUA 2WC3A 1HP5A 4W7VA 2ZX7A 2YDSA 5FL0A 1UH4A 3D3AA 4W5UA 4UZSA 2WVTA 4BQ2A 2DT2A 2W63A 1UWSA 1UOKA 1Q4NX 2W92A 5M03A 4KRTA 3WIJA 1JNDA 2WWCA 3OGVA 4MTVA 3VGEA 2NT1A 3WSUA 5DMYA 2PB1A 3UG5A 1VFFA 4CCCA 5I5RA 3VOCA 2UWFA 1JIBA 3BAWA 1TVNA 2QMKA 3CUGA 1CGWA 3WY1A 1DWHM 3B9EA 4Q7NA 4MB4A 1NWSA 2VR5A 1UWQA 3QR3A 2YA1A 2JEPA 3MMUA 4W5ZA 1DTUA 4UOJA 3TTYA 3GZAA 2OSXA 4HU0A 1GJWA 5D9PA 3PTKA 1GW1A 3GNOA 4ATWA 4QLLA 1XHGA 2W66A 1SFSA 4PTMA 1WKYA 1LJYA 1E56A 3WNKA 4NF7A 1B3WA 3N18A 1HKIA 5CZKA 1N82A 5AC4A 3WMCA 1XYFA 2DH2A 2AMGA 4U5IA 3VIKA 1R8LA 2E8YA 3ZT7A 2XJ7A 1UD6A 2CBIA 3W25A 3VGHA 4D1IA 3TTOA 3VM5A 4P7QA 1E0WA 5M3WA 1NARA 1BYCA 1IZKA 2CETA 1LF1A 1MW1A 3TTQA 4TTGA 2CYGA 1EHNA 4HA1A 2HVMA 1VEOA 3SUVA 2VURA 2XVGA 4AIEA 1UQZA 3WQ5A 1JF6A 4NRRA 1EOMA 3ZO9A 1BGAA 4DWSB 1UR9A 5E6YA 4IM4A 1Q6DA 1D3CA 3UERA 1DWAM 1Q6EA 1O7AA 1W9PA 1UR2A 4MAZA 3SCSA 1GORA 3E1F1 2VRJA 4CCEA 4L4OA 1OGBA 2J7EA 1ESWA 3TTSA 4PMYA 3WD4A 4J28A 3WD1A 4LXFA 1OBAA 3WFLA 3F5KA 2BY3A 2CPUA 3DECA 5D8WA 5E6ZA 3AZTA 3B8SA 1GOQA 3WQWA 3EMCA 4JFSA 3A3HA 2Q8XA 1E3XA 4CN1A 2WLYA 5JIPA 4XUYA 1JZ4A 2ZXDA 4FLQA 1CLVA 1UWUA 4LPCA 2WB5A 1Z32X 2XWDA 4Z2IA 3IAQA 4K68A 2V3FA 2VMFA 2FHBA 1VRXA 2BY0A 1DWFM 7A3HA 1JG9A 3VDHA 1KR0A 4V27A 1QW8A 4J7RA 2YKKA 3L4TA 1E6SM 3AMCA 2EPKX 1HJWA 3CZKA 4BQ3A 4CUCA 1CXLA 3EBVA 4JAWA 4LQ1A 1BYAA 1O6IA 2X8RA 4MNLA 1E1EA 1OD0A 3SUWA 3T0BA 4FLSA 1UKQA 1EA9C 3WNMA 3FN9A 3GTNA 3ARRA 4PMZA 3WDPP 4W93A 2CITA 4DWSD 2OYLA 5I78A 1J0JA 1KXHA 3HN3A 4NRSA 2JFEX 4W89A 3CUFA 3FHQA 1XSKA 1P6WA 3VD7A 2GK1B 3MUAA 4MADA 3WN6A 2YBTA 4P7RA 5HDRA 2XVNA 3POHA 4HMEA 4UFLA 1XYZA 2VVSA 3ZM8A 3DHUA 1ODUA 1FH8A 2EJ1A 2W62A 4W86A 2OYKA 2TAAA 3A4XA 1WP6A 1ISXA 1GQLA 3BAJA 5FIPA 3WMSA 3QHOA 1HP4A 1LLOA 5ECUA 5M17A 1E6NA 4AY1A 1KR1A 3LPOA 3VM7A 4KGJA 1W1VA 2D0FA 3WNPA 5CPQA 4JFWA 3N11A 4GO9A 4URIA 5I23A 2J77A 5CGMA 2CNCA 1E40A 1GONA 3OZOA 3WD3A 3L4XA 3GH7A 1XD1A 4UOQA 2G4FA 2EQDA 3AS0A 5I3DA 3WF0A 1GJUA 1W9VA 4QAWA 2VX6A 3WNNA 1ZJAA 2WVSA 3RJXA 3LMYA 3WUGA 1V6UA 3MKKA 4GZEA 5EFFA 4PUEA 2WNWA 1CNVA 2NSXA 5CQ1A 4P7NA 1EGZA 1WNOA 4CKQA 3I3BA 1JI1A 3A47A 2GJRA 3WUBA 3S6TA 1W3JA 4W8BA 3UEQA 3VDBA 4HOWA 5E0CA 1WZAA 3EDFA 3HJEA 4TX6A 3FXYA 1V0LA 4EAMA 4U2ZA 3ARUA 5A3HA 3PZVA 2DH3A 2XTKA 4ACZA 2FH6A 1Q6GA 1BG9A 3CBWA 5A69A 4PMXA 2HISA 1WB0A 2J7FA 2NW0A 4W84A 5A6LA 2D1ZA 3W4RA 4YN5A 1ITCA 5A8NA 1BGGA 1HIZA 2DSWA 1TR1A 4HZ6A 4N42A 1J12A 2WMGA 4J3UA 3MMDA 2XG9A 3K8KA 2BXZA 1UR8A 2PBGA 3AYSA 3VIIA 1IV8A 1E6ZA 1QNRA 3PBGA 2RGLA 3CZEA 3PN8A 4LX4A 4DUWA 3RILA 3CLWA 1J01A 1E9LA 1W32A 3AYRA 3MS8A 1VEMA 2JALA 2ZUTA 1HX0A 4AD1A 3VU2A 1CYGA 4H2CA 1V3JA 3EDDA 4QP0A 5IFTA 3SEPA 3WELA 1RD6A 3AROA 4CN6A 1MW2A 3AMDA 3WL0A 3W37A 4H8HA 1KWGA 1H49A 4AZHA 4W8LA 4ATDA 4YHGA 3QOMA 1W9XA 4PTXA 2XSBA 1GHSA 3EDEA 2EXOA 3CZJA 1XSJA 3NUKA 3HU7A 4UQAA 1AVAA 2Y4SA 1U33A 1PBGA 4EKJA 2YA0A 3W0KA 1FHLA 4OBSA 1CXEA 2WMFA 4M81A 4PYSA 4PCSA 3VDAA 5HPCA 1LWJA 1UD3A 4D6GA 4AW7A 5GQBA 4HA4A 4PSPA 3WF2A 1K9DA 1JAEA 1VIWA 2J74A 3M46A 4AD3A 2WAGA 4HP5A 2XFRA 4UNIA 1M04A 1JDCA 2EPMX 1PZ2A 4OZOA 5ABGA 4TOQA 2W5FA 5C71A 3AS2A 3VD5A 2RGMA 2CHOA 2WK2A 2J78A 3AICA 4L4PA 1M03A 2JE8A 3APGA 4IPLA 1GOIA 3RM8A 5A94A 2D2OA 2YL8A 1VFMA 3VD4A 3GXDA 3JUGA 2E0PA 5GNYA 4Z2JA 3GXFA 1PEZA 2E3ZA 1UHVA 3TONA 3OA5A 3ARXA 4RE3A 1JZ5A 4W8AA 2OSWA 3GBDA 3AHYA 8CGTA 1F4HA 4QCEA 2WW5A 1CWYA 4WSKA 2GFTA 4PMQA 3VX0A 3ZJ8A 1DP0A 2V5CA 4RL3A 4ZE4A 1E4LA 1JD7A 1A47A 1CLXA 4OUEA 3CGTA 3PZ9A 1CGUA 2WHLA 1KXQA 4MDPA 2XWEA 4F79A 1KWKA 2WHMA 3ARYA 1XH0A 3O9NA 1FFRA 4MDOA 3DHPA 4F9DA 3VTRA 5A95A 4GI9A 1EOKA 4ZFMA 2JF7A 5GPRA 1BAGA 3SCUA 1KB3A 4WKHA 1WAWA 3SUUA 2DT3A 4LYQA 1HN1A 5GNXA 1K9FA 1Q6CA 4PTWA 1WDRA 2JIWA 4UQCA 4LYRA 4R5EA 2XVPA 2ZX6A 1SR0A 3WBEA 3W28A 3RCNA 4HMCA 2ZWYA 1UG6A 1LG2A 5I2UA 1UWIA 1MXDA 3WF4A 5HOSA 3WH6A 1GQJA 2MANA 3AS1A 3BCFA 2WPGA 1NOWA 3NIYA 3IAPA 3VIMA 2O9OA 4JKLA 2XFYA 1ISYA 3ZSSA 4Y7EA 2WMIB 4U33A 1R86A 3CUHA 1R7OA 4TXEA 4U5KA 1E4MM 3T0AA 2BS9A 4ACZB 4J3WA 3CPUA 5D9OA 5D9MA 3T0DA 5I77A 5FL1A 1W1TA 1ISWA 3F5JA 1JAKA 3T09A 2WCGA 1E72M 3CUIA 3M6DA 4GPNA 4ZXLA 1ZBWA 1UKSA 2DSKA 1XC6A 3NSMA 1LL7A 3MUIA 1FFQA 1XD0A 1CGTA 1YQ2A 4GIAA 5I79A 3A6OA 1V02A 3WUFA 2J8FA 4ZXOA 4D6CA 2XFFA 4F9JA 3SCPA 2BVYA 3W81A 1E6QM 2XM2A 1UD2A 1PAMA 1JZ6A 1MWOA 1OB0A 1UR0A 3B9AA 4H41A 4M29A 7TAAA 3AXHA 3CZ8A 3A4WA 1HVQA 5KZ6A 3SCWA 1US2A 2C0HA 3IANA 3F4VA 4QFUA 2FH8A 5FKYA 1W2PA 1E6PA 1B2YA 1XV8A 1CXHA 1WO2A 4H8UA 4AZ7A 4D72A 1GOMA 2QV4A 3THCA 1RP9A 2Y8KA 3BH4A 3VMPA 3OZPA 4UFIA 2X0HA 1G0CA 1S46A 5BXTA 3ZT5A 5A6BD 3FW6A 5FCZA 1EXPA 1U30A 1HKJA 4D6DA 1K9TA 2G3IA 3QHNA 2J47A 4MB1A 4WIWA 2W91A 3W82A 5IFPA 2O9PA 3RMEA 1BQCA 4DUVA 1R7AA 4YHEA 4MNKA 2WKLA 1J0YA 2BHYA 2WCSA 5CPTA 4PMUA 4OKDA 3AHTA 3KZSA 2X09A 5A6JA 5E09A 4BQ4A 1WCGA 5BROA 2ESCA 1V6YA 1TCMA 4IPNB 2QF8A 1ZBCA 4J3XA 3WQVA 4AZCA 1WZKA 1BPLB 1WZMA 3FHAA 2OWCA 2J79A 3CHCA 3FAWA 1ITXA 2XGBA 3FY1A 1FP8A 5E70A 1UA7A 4JCMA 2D0GA 3U5YA 1ZU8A 1CEOA 1ZL1A 4JL2A 4HOZA 3W29A 3EDJA 2WLZA 1DHKA 1EHAA 4Z2LA 1FP9A 3N1AA 1DWIM 3MO4A 3ARZA 1CGYA 1C7TA 1QNOA 5JBFA 1W1YA 2QPUA 1VEPA 2WZHA 1EH9A 1WDSA 3I3DA 3OBAA 3WNOA 1E5NA 1Y7VA 1VENA 2ZUVA 2XM1A 1CBGA 3MSDA 5A2CA 4PMRA 2A3BA 3ARWA 3N13A 3OLGA 3VMOA 4UTFA 1UD5A 3NSXA 5C8BB 2GK1A 1PPIA 1KBBA 2O9RA 1D2KA 1HJUA 5I0DA 3SCTA 3A4AA 2UY2A 4CD5A 2V38A 1JDAA 3W27A 4C7DA 1LQ0A 4N0RA 1HL8A 4AZBA 2YDQA 4GI6A 5AC5A 3U7BA 1QBBA 4TVCA 1HJVA 2XUCA 2J4GA 3UG3A 3VGGA 3MUZ1 1GOOA 3CH9A 3O6AA 3CMJA 3MU7A 3AS3A 2EO7A 1W3KA 2J7HA 1GVYA 3B9DA 2WMHA 4D1JA 1UR1A 2VQUA 1BVNP 4X9YA 1G5AA 4P8WA 4W7WA 4CU8A 3VNZA 2ZUSA 4ZEPA 3WUEA 4BA0A 4D6IA 2JF6A 1C93A 4TVDA 3OGSA 2C8NA 3NDYA 1H41A 2VOTA 1F4AA 1I1XA 5E9AA 5A8QA 3T2PA 4D6JA 4UQEA 5LA1A 1OCQA 1QVBA 2BHZA 4QLKA 3T08A 2UY4A 1ZS2A 1CPUA 1UD4A 4KGLA 1ISZA 1NP2A 3ZJ7A 4E2OA 3ZT6A 3RO8A 1V6WA 3OLEA 2WMIA 3ZQ9A 5BYWA 3PZQA 3ZJKA 4V28A 4MNJA 4TX8A 3VIOA 4D71A 1QI3A 2IXUA 2EPLX 3SIMA 5DO8A 4ML4A 4D6FA 1MW0A 2PBOA 4JHZA 1JFXA 5JIWA 3WKZA 4GQQA 4AZ6A 3CO4A 4M82A 4AEFA 2O92A 1OM0A 1V3IA 2PWHA 3PZIA 4GXPA 2OLHA 4GZIA 4TVUA 4P8UA 4DM2A 3W38A 2IXVA 3WFZA 3TA9A 3N9KA 4C7GA 1EQCA 2A3AA 3GXMA 5A6AA 2YIHA 2D3NA 5IHSA 4E8DA 2E8ZA 2OYMA 4P7LA 3EYPA 4HTYA 4CCDA 2XIBA 4NZCA 1B31A 2VO5A 4W87A 1VB9A 2DIJA 1WZLA 1GQIA 2CCRA 3CIVA 1UZ4A 2V5DA 3MV01 4M24A 1UWTA 2AAAA 2VX4A 1GCYA 2ZUUA 3ARSA 4OOUA 1E0VA 4LGXA 1E70M 4H7VA 4CD6A 5BCAA 4W85A 4YPJA 2WMJA 1GZJA 4RE4A 4P8VA 5A2BA 5ABFB 5DFAA 4E8CA 2WSPA 5BXPA 3RJYA 1VJZA 1BLIA 4CD4A 5CLWA 3VIFA 4R27A 3L4WA 3BC9A 1XRVA 3KL5A 3POCA 3UESA 4BF7A 3VINA 3VD3A 1C3FA 4AIOA 5D4YA 5DF0A 1BYDA 3BSGA 1AQMA 3K46A 1PX4A 3ZR5A 1CTNA 2VUYA 2YBUA 3KWXA 1PX3A 5EMYA 2CHNA 1ECEA 4PMNA 1AQ0A 1OSEA 2ZICA 5AYIA 4P8XA 5A6KA 2XGIA 3WEOA 2JIEA 1JXKA 5AYBA 2FDMA 2WHJA 1NWRA 1C8YA 5HBFA 2G3JA 4AYSA 1H1NA 1E4IA 1HJSA 1WDPA 5IHRA 3W6MA 2YL6A 5CXPA 3BAYA 1EO7A 2V3DA 1FHDA 1UH3A 2GJXA 4JHOA 5IDIA 3WH5A 1KXVA 4M80A 3BMVA 5A6SA 1KGXA 3K8MA 3OGRA 2VT0A 2J7DA 1B1YA 3AHVA 4GKLA 3L4UA 2VJXA 2JEQA 1JYNA 4U3AA 4B16A 2WC7A 1GHRA 1HL9A 2E9LA 5JBEA 2YL9A 3LPPA 1J0KA 3CMGA 2VZUA 2WANA 1MFVA 2QLYA 1KCKA 2CIPA 1QNQA 2YOCA 4QDMA 1TZ7A 3RPMA 1H3GA 2VX5A 2DSZA 3VDCA 3OLDA 1VFOA 1L8NA 1GQKA 4PN2A 1E5JA 1J0ZA 1OT2A 1TMQA 3F5LA 3NSNA 4DUXA 1E6RA 1UD8A 2YDRA 4FF5A 4UQDA 1XH1A 1YHTA 3ALFA 4RE2A 4PRWA 4D6EA 3AQUA 3ARTA 4BQ5A 4Z2GA 2VRQA 2VZSA 2EPNA 2XIIA 1SMDA 1JD9A 3IK2A 1NH6A 2WVUA 1B90A 1E3ZA 4EK7A 5E0FA 1FOBA 3T2QA 1XCXA 1UH2A 3II1A 4J3TA 2BNJA 2GJXB 1J10A 3KL0A 1W3LA 1UR4A 3ZMRA 1UUQA 5M5DA 1J18A 2J7CA 5HPOA 5LA0A 4XZBA 3UR8A 3ARVA 4FLRA 4CD8A 4AD4A 4E4PA 3CHDA 1DWGM 2WHKA 4ZE5A 1V3LA 5EB8A 1W91A 1BHGA 4HOXA 4NSBA 2G3NA 3ARQA 1E6XM 1TUXA 4EANA 1B9ZA 3BCDA 2W67A 1QHPA 4X0VA 1GNXA 2V3EA 2XSAA 2CEQA 1JZ8A 4F66A 1V08A 7CGTA 1ODZA 1TA3A 1CXKA 3N12A 1PX8A 1QOXA 4MAVA 1KBKA 4B3LA 1B3YA 3AOFA 2ZWZA 4TUFA 3SCOA 4B15A 3W24A 4WSJA 5DT5A 4F8XA 2J7GA 3AIBA 2ZXQA 4J3VA 5JUVA 1X1NA 1UZ1A 1V0KA 2A3CA 2UY5A 5CSYA 4HA3A 1HJXA 2W4XA 3WH8A 3VUPA 2A3EA 3VKKA 2WBGA 3TOPA 3LPGA 1FH9A 3BLPX 5I24A 2CBVA 3L2LA 1BVZA 2WXDM 2J25A 3K4AA 4MJ2A 1QI2A 3GNRA 2ZE0A 2A3HA 1MQPA 5GNZA 3IJ9A 1GPFA 5A6BA 3AHZA 1HVXA 3KEHA 2CKRA 5ABEA 1BSIA 3BMWA 2ZUNA 1BYBA 1BG4A 1V6XA 3WQ8A 1IZJA 1L0PA 4GI8A 3GNPA 3U57A 1Q6FA 3UETA 1AMYA 3ARPA 3RDKA 1CDGA 1W9BM 2DGAA 4Z2HA 4B3KA 1JGIA 4J3SA 1E55A 4JCLA 4A3HA 4CU7A 3AZRA 4KRUA 1TFVA 4H04A 1QNSA 4JKMA 1TA3B 4OBRA 4PEEA 4PMVA 3SURA 5JBDA 4MB5A 2YLAA 4PUDA 3VVGA 1VF8A 1J0IA 1I1WA 3VNYA 4JKKA 1RH9A 1CZ1A 1UKTA 4PBGA 3U5UA 1E73M 1X6LA 1NM9A 4UZUA 5A1AA 4B9YA 1H5VA 3MUY1 4AZIA 2E4TA 3WDJA 4AD5A 1JFHA 1C90A 2ZOXA 5A8PA 4XZWA 1SMAA 1M01A 3GM8A 1KFWA 3PZTA 4Q22A 5FOOA 4PSRA 3W53A 5CJ5A 1D7FA 3TP4A 3AMGA 2CESA 4WLCA 1PIFA 4AIUA 5BWFA 3MV11 1KGWA 5CG0A 3ZOAA 4A4AA 1MQRA 1ZBKA 3KE0A 4TTUA 2WBKA 4WKAA 3U7VA 4V2XA 2Z1KA 4JL1A 2DIEA 1EDGA 2DDXA 2J75A 2BHUA 4MPKA 3THDA 2F61A 1H4PA 1V0MA 3WDIA 1H11A 1JZ7A 3RM9A 2WYSA 6A3HA 4AD2A 3WF1A 4CGTA 3AHXA 1JZ3A 1MVYA 3L4YA 3AMLA 3L4ZA 3AIQA 2AOSA 3DYOA 2WMKA 2ZX5A 2FGZA 1V6VA 3MSGA 2D23A 2DT1A 1BTCA 3L4VA 1W1PA 3OIHA 2OWXA 1JYWA 2ZIDA 1CENA 1CXIA 5A6MA 1NOUA 2GJPA 5CPSA 2D24A 5DT7A 3VGDA 2XVLA 1E15A 4PTVA 3O2LA 2F8QA 3WDRA 8A3HA 2WCAA 3BAIA 4H8VA 2GSJA 2WZEA 4CU6A 3GXIA 1E4NA 3AIUA 4OIFA 4BS0A 1NQ6A 5AY7A 1PJ9A 3WNLA 2OWWA 2EPOA 2DT0A 4HMDA 2G3MA 3RM4A 4ATLA 3L2MA 1ISVA 3GBEA 2VC9A 3K8LA 1EO5A 1J9YA 3EMZA 4U31A 2G41A 1M7XA 1XGZA 3NYDA 1E43A 4W88A 2CBUA 3W6LA 3VIPA 3EMQA 1W9UA 1VFUA 1QNPA 1V3MA 4GINA 4XV0A 1JYVA 1VBUA 2QMJA 1EQPA 4MJ4A 6TAAA 1QI0A 5BXSA 1CGXA 2WKGA 3AXXA 3VGBA 3VPLA 3SCQA 1R87A 2D20A 3ALGA 2ZUWA 3SUTA 1G94A 4UQBA 2X05A 3FNDA 1V03A 1H0GA 1TVPA 2Y5EA 2DSVA 1JF5A 2BV9A 2WVVB 3GH5A 4FMVA 3WENA 4X0NA 4CD7A 4FLOA 1HJQA 2BFGA 4FK9A 1NWTA 2OSYA 3BAKA 1KXTA 3AXIA 1DEDA 2ZXAA 1HNYA 2X0YA 3WD2A 4HU8A 2G8ZA 1V3HA 4XX6A 1KQYA 2VTFA 3AIEA 1QW9A 5TD4A 3M7SA 4Z2KA 4AWEA 1AQHA 2VL4A 4ZENA 4KMQA 2X1IA 3VILA 3W26A 3GDBA 1OD8A 4HPHA 2PI6A 4M8UA 2GDUA 1I75A 5EFDA 4PCTA 3PZNA 5CGTA 3ZSTA 4BCEA 4S3JA 1OGGA 1VAHA 2J62A 3NDZA 3VMNA 2GVYA 2EEXA 3WQ4A 2E40A 3MMWA 4U3CA 1EIBA 5BRQA 3S2CA 4UR9A 2IUZA 1HKMA 1ZJBA 3QHMA 4AZ5A 2O9TA 1V02E 3GH4A 3WQ6A 2BVTA 2VRKA 2ZX8A 2XPKA 1OIMA 1UKPA 2VI0A 1HT6A 4J27A 3OB8A 4HPGA 4JFVA 3CHEA 3PZOA 1VBRA 5LYRA 1B3ZA 2CBJA 2QPSA 4UFMA 3BSHA 1TE1A 2PF0A 5C70A 2CXGA 1W2VA 3CZLA 1JZ2A 1PIGA 2WVVA 3MANA 5HNNA 1C8QA 3IJ7A 1QI5A 1CIUA 3SUSA 1X6NA 2D22A 1GOKA 3NJ3A 2PWDA 1OGSA 2F2HA 2Y2WA 1V3KA 2J8GA 4M1RA 2VZOA 4GQRA 4A3YA 4XB3A 1NWUA 2QHAA 3CTTA 1H09A 1R85A 3VIHA 1MFUA 1ZB5A 1J0HA 4AMCA 4CN4A 1QHZA 1G1YA 3BLKA 1FH7A 4UFHA 3AJ7A 2VCBA 3OG2A 2WM0A 3QOKA 4M56A 5D8ZA 2WZIA 1UQYA 4S3KA 1UWRA 3VIGA 3WEZA 1CXFA 3WEMA 2C7FA 1A3HA 4UFJA 1NP0A 4WKFA 3N04A 5ABHA 4AZCB 1IT0A 3UG4A 4LYPA 1K9EA 3ZJ6A 2FHFA 4DWSA 3WL1A 5KEZA 2UY3A 4NI3A 3RIKA 5D9NA 1G9HA 1ZBVA 1VJSA 1DWJM 3EDKA 4JFUA 4HZ8A 4WK9A 1C8XA 4QCFA 9CGTA 4MB3A 1OWQA 2VR4A 3WBAA 4CVWA 4IUGA 3T2OA 1JXJA 1XSIA 1SYTA 2FHCA 4BZYA 1HXJA 4DWSC 5F7UA 3AI0A 2PC8A 3VGFA 1V0NA 1B30A 4AEEA 3BAXA 3ECQA 2DQXA 1E1FA 5HXMA 2BVDA 2BY1A 1MQQA 2XVKA 1G01A 5A8MA 1LWHA 2VX7A 3WDHA 3N17A 1WPCA 3WF3A 2YL5A 2E9BA 1JNEA 3AIWA 1E71M 4UCFA 3HMCA 3SCRA 4KWUA 3G6LA 6CGTA 2GDVA 2BY2A 2YLLA 3KL3A 1H0IA 3AFBA 3ZIZA 3DYPA 4GZJA 2V3GA 2YJQA 1C91A 1OIFA 4B9ZA 4P7OA 2BXYA 1QPKA 2D3LA 2VZTA 3K1DA 2Z1SA 4CVUA 4KH2A 1UKOA 4JZ5A 4AD0A 3PTQA 2X2YA 2YA2A 1XCWA 3BXWA 1JYXA 3PTMA 2B31A 2WSKA 4UFKA 2D0HA 3AIVA 1NOFA 4JFTA 3VIJA 1KGUA 1BF2A 3PZGA 1WDQA 3QGVA 2J7BA 1FA2A 5CSUA 3CZGA 3OLIA 4AXNA 2FGLA 3PZUA 4AISA 2CERA 2VZVA 4PMOA 1U2YA 4QLJA 4WJXA 3ZR6A 3PHAA 1HF6A 1PZ3A 3LPFA 1EDQA 3AZSA 4HZ7A 3M07A 2ZUMA 3CUJA 4GO8A 3WH7A 1MXGA 1MYRA 4JIEA 1RPKA 1GVIA 1US3A 2GUYA 3WDQA 4C7FA 2W61A 5BRPA 4AZGA 4W7UA 3VX1A 1XH2A 4WF7A 1JI2A 1C7SA 2PWFA 1GOWA 2XHYA 3GYCA 2DPEA 3N15A 4UQ9A 3WH9A 1TG7A 1W3HA 4OJYA 3VO0A 5LA2A 3K4DA 1EDTA 1CGVA 1MW3A 2E9MA 1KQZA 1JL8A 1KCLA 1RP8A 3FAXA 1HKKA 1LG1A 3AISA 1K6AA 3AIRA 3CHFA 1OT1A 1CECA 1BFNA 3UR7A 1GUVA 3WD0A 4MNMA 2PWGA 1WE5A 5CLTA 1J11A 2PWEA 1H2JA 3UCQA 3NCOA 1LL6A 4PMDA 3SCNA 4ACYA 2ZX9A 5DEZA 3WMBA 4OOZA 2VVNA 3AMKA 1B3XA 2ZXBA 3PZMA 5ABFA 1M53A 4U2YA 1LL4A 1OINA 3G6MA 1W9DM 3I3EA 2Y8VA 5A2AA 3VD9A
chains in the Genus database with same CATH superfamily
5EBAA 2VP8A 5FAGA 3UXDA 3UNTA 4JYDA 4XQ6A 3FEQA 5FD0A 4DM1A 2VQTA 2Y24A 3SCVA 3TLLA 1C92A 4XD3A 1QBAA 1YPXA 1ADDA 5EMUA 3G1YA 5F1UA 1LRQA 3J7HA 4HA0A 4E0CA 3PNUA 1OABA 5A8OA 4MMWA 1VGAA 2RDUA 5LNUA 5XINA 3HQPA 3GO2A 3P6LA 3NURA 5DMMA 4O54A 2DT2A 3LRKA 2W63A 1HW6A 1NSJA 1IQ8A 1Q3NA 2PTWA 4XZIA 2G0WA 3WSUA 5DMYA 4PZVA 3UG5A 3R12A 2RDXA 4AWUA 4FA3A 5I5RA 3C2EA 3RAOA 1JIBA 1ZP3A 3CUXA 1OY0A 1TVNA 4Q7NA 4LUTA 4MB4A 3QR3A 3LI1A 2JEPA 1XS2A 3W73A 4UOJA 2OSXA 1V5XA 3GNOA 1O5KA 1SFSA 4HK5A 1WKYA 2ABBA 4HJWA 4B3ZA 4JTHA 4F3HA 4HN8A 3WNKA 3M0ZA 4DJFA 5AC4A 2C13A 4GD0A 1XYFA 2AMGA 4ZO9A 3PG9A 2XJ7A 3W25A 4D1IA 2R9RA 5M3WA 3TYCA 3MJYA 3S1GA 1LF1A 4YCOA 4H01A 3CB8A 4LW7A 1L6SA 3ABSA 3QGAC 2HVMA 3S2JA 3UR5A 2GQAA 4JTFA 4AIEA 3C3NA 4PRTA 4DF2A 3G0SA 2EKGA 2AQOA 2CHRA 1JF6A 4PEKA 3E6EA 3C2OA 4NRRA 4GK8A 5E6YA 1D3CA 3HIJA 4DYEA 1UR2A 4ZVJA 4GG9A 3CXOA 2A7NA 2VRJA 5C9ZA 2J7EA 2Y1HA 2BGNE 1ESWA 1AK5A 2C14A 3UNDA 5FAJA 5E6ZA 4B2DA 4LT9A 3PSWA 4BI6A 1DORA 3EMCA 4XTDA 1TPB1 3A3HA 4JIRA 3RF9A 5JIPA 1JZ4A 4FLQA 2YCIX 1FXPA 2WB5A 3XIMA 4Z2IA 3IAQA 4K68A 4C6PA 4EWJA 2BY0A 3L9CA 3LBOA 4KCUA 1QW8A 3IIZA 3GW3A 3GZ3A 2YKKA 3BOFA 3W01A 4QE1A 3UY7A 2V69A 4MF4A 1E6SM 5RUBA 1WKFA 2VHLA 3NZQA 3CZKA 4BQ3A 4JAWA 1D9EA 4FXSA 4LQ1A 3CAQA 1O6IA 4MNLA 2H9AA 3SRHA 2D2JA 4OGZA 3HG2A 1FWDC 1VJIA 2ZDRA 4O16A 1O66A 3WDPP 3WLHA 3FDGA 3PUDA 5I78A 5LNVA 2E6YA 3CU2A 2CZFA 3HN3A 2JFEX 3CK5A 4MFEA 4J9JA 2BMBA 3MUAA 1ZY9A 2GWNA 2OOFA 3O3RA 5HDRA 2XVNA 3ATZA 2FZBA 3ZM8A 1FH8A 3B8TA 4W86A 2OYKA 3A4XA 4YJ5A 4UR8A 3WMSA 2PDNA 4H9VA 1KFEA 5U7SA 3S1UA 2YGYA 5BWAA 3W7IA 4I7VA 3W2KA 2D0FA 4O19A 3C0LA 3GXPA 3N11A 4URIA 2J77A 1N2VA 4DLMA 3G3MA 1XBZA 1W5OA 4QX4A 1QATA 3GH7A 3H55A 2G4FA 2EQDA 4DI9A 3MT1A 1IWBA 2YZ5A 4H3DA 4JTLA 5I3DA 3WF0A 1XPYA 4AUBA 2PDFA 1PHQA 3AYVA 1MDRA 2WVSA 3RJXA 2FYMA 3LS9A 3IEBA 1DTNA 1V6UA 2YCKX 2HPIA 3EXTA 5A6TC 3SI9A 4I6KA 1WNOA 3KP1A 3WUBA 1NDZA 4W8BA 1OG6A 4EIVA 5E0CA 1IEWA 1P1XA 1PSCA 1OX4A 4TX6A 1BKHA 3MVTA 1V0LA 2CLLA 4EAMA 1ITQA 3S2MA 2NV9A 1Q6GA 1WXJA 4M7SA 3UA3A 1ZZMA 3IGXA 4B90A 3EB4A 2QDDA 5A6LA 2D1ZA 1IXPA 3TFXA 4HK7A 7REQA 4DQWA 3MP4A 1H7OA 1H1ZA 1DJIA 1K02A 1VKFA 2YXOA 5LIKX 2BXZA 1GVOA 4HCLA 4QS6A 1E9LA 5EA9A 3MS8A 1QU4A 4YCPA 3VU2A 1SO6A 4GXWA 4QP0A 2ADAA 1RD6A 3AROA 3AMDA 3S1XA 1HUVA 5CPMA 3HGJA 3WL0A 1EJTC 3TCSA 1AA1B 5REQB 4CNOA 3GNDA 3W37A 3BGJA 3KHJA 4IUOA 4AZHA 4W8LA 4ATDA 4YHGA 4N4QA 3QOMA 1W9XA 3PFMA 3VK5A 5H8UA 3NNTA 3HU7A 4HN4A 5A8GA 2Y4SA 4NJJA 2TMDA 4PH6A 1MEWA 3EKGA 4OBSA 4QG9A 2OT1A 1F6YA 3O6YX 1G6CA 3UWQA 5HPCA 4MJZA 1LWJA 4BEQA 4D6GA 4O50A 1P0EA 2OLSA 2GGIA 2QPXA 3B0YA 4GRSA 4LUJA 2P3ZA 1R9XA 2J74A 4U4MA 3W1LA 1ZAJA 2E5DA 3HQNA 3S47A 4GNVA 3WCZA 9XIMA 4GBUA 3ZWTA 2YFNA 3VD5A 5D2YA 2WK2A 2J78A 4JTKA 1M03A 1VFSA 2JE8A 3TYUA 3APGA 1GOIA 3L7RA 2OEJA 3FJ6A 2YL8A 1S2UA 1VFMA 3PAOA 4ZCWA 5KINA 3JUGA 2E0PA 3EOSA 3GG1A 2FGBA 2BVWA 2E3ZA 4S23A 3SFWA 3WLIA 5TQLA 2L5HA 2AKZA 4IQLA 4K38A 1JZ5A 4Z1DA 3AHYA 8CGTA 2BLEA 4WSKA 3NL3A 1RVKA 2GFTA 4PMQA 3ZJ8A 2E5BA 2QNEA 1CLXA 1RCQA 4F79A 5J5RA 1XH0A 3O9NA 3A9BA 2OODA 1FFRA 4RDWA 4HSOA 3KCJA 1A5BA 4R7OA 5LGXA 3VTRA 4GI9A 2JF7A 5GPRA 1BAGA 1Y8BA 1ADSA 3C5QA 3T7VA 5DCBA 2DVTA 1TPDA 1IWAA 1ICSA 3N19B 1HN1A 1VQTA 1Q6CA 3OP2A 4H9YA 1SZNA 2OVLA 1WDRA 2Q8LA 2JIWA 4UQCA 4R5EA 2FIQA 3V4BA 4JEJA 3RX2A 3KZPA 3RCNA 3QQWA 5AHFA 1S3TC 1UG6A 1LG2A 3MWAA 2A85A 2HROA 3UCDA 1MXDA 5HOSA 3E0VA 6XIAA 3OBEA 2H90A 3SN0A 1VBHA 3BCFA 1YXCA 2ACSA 1NOWA 3LZ3A 4JKLA 1ISYA 1WXYA 4Y7EA 3ZSSA 2HE8A 3AXMA 1R7OA 2DZVA 1E4MM 4O13A 5FACA 4ACZB 3CPUA 3KS5A 5D9OA 1TWSA 2ON3A 3S6DA 3WLPA 3QM3A 3T0DA 2NQJA 3F5JA 1NDYA 1E72M 4CQ8A 3M6DA 4TU1A 4WCJA 3W7OA 4OV9A 1XC6A 4KCWA 1Z6KA 1LL7A 3MUIA 1XD0A 1SFTA 1YQ2A 4GIAA 3A6OA 1V02A 3WUFA 3TLQA 3RCYA 3AUOA 4LY4A 3SCPA 1E6QM 2XM2A 4XK2A 1G7VA 1UOZA 3W72A 3VKDA 2R24A 3LNPA 2FFIA 4M29A 5DMLA 5BMWA 1XL9A 2NVAA 2QKFA 5KZ6A 2PRHA 1HGWA 1O94A 3IANA 4QFUA 3HFTA 5FKYA 5LIXX 1W2PA 4N7QA 1WUEA 4AZ7A 4D72A 2NV2A 1RP9A 5C2GA 2Y8KA 1V8EA 3OZPA 4UFIA 1G0CA 5A6BD 3FW6A 3ANYA 5DN1A 1YX1A 1EXPA 4GOAA 1HKJA 3GFXA 2GUUA 1K1DA 2J47A 4WIWA 2W91A 3W82A 1TV3A 2HXUA 3NPVA 1TPVA 1EKOA 4V1YA 1XX1A 3HFYA 4OBTA 5C7VA 1GZGA 2P0OA 4I90A 2BHYA 1BXCA 4PMUA 1PKNA 4K7VA 4MIMA 3AHTA 2X09A 3NR0A 5KSWA 3VZXA 5E09A 5BROA 2QF8A 3M0IA 1ZBCA 2QUMA 3WQVA 4AZCA 1WZKA 4J5NA 3RNDA 1VLIA 3FHAA 2XDFA 4GVIA 3FAWA 1ITXA 4JCMA 3CS2A 1EJXC 1CEOA 1S2CA 1ZL1A 2PTZA 1U83A 2V5KA 4JL2A 1EHAA 3EZ4A 3N1AA 4O12A 1DWIM 1C7TA 3PB2A 4HHPA 5JBFA 1EH9A 1WDSA 3NZPA 1DKWA 3CB3A 1E5NA 1Y7VA 1YRRA 2XM1A 4UWMA 3MSDA 5A2CA 4PMRA 1A5NC 2ZVRA 3TQVA 4UTFA 3NSXA 3FIGA 3KHDA 2Z2AA 2QCDA 3VE9A 2HE5A 1PPIA 4UMAA 3ZVHB 3UXIA 2UY2A 3T0TA 4H6RA 1LQ0A 5AC5A 2QUUA 2DZWA 4C6KA 3G3DA 3VGGA 3NQMA 3MUZ1 4GC3A 3B4YA 3DOPA 3STPA 2WPBA 2WMHA 4NY2A 4DJEA 1ENUA 1BVNP 1G5AA 3R1ZA 1JPIA 2V63A 1TO3A 4CQBA 2ZYFA 3GDTA 1XLBA 3FGCA 2NX3A 3A9IA 4D6IA 2ZZ6A 4WSHA 1QJWA 3OGSA 3OW1A 3NDYA 1DV7A 3REQB 3TROA 5BW6A 5E9AA 1R9ZA 4PB4A 1F6KA 5M2FX 2VGFA 1G67A 1KM3A 4AHOA 4MGGA 1QVBA 4QLKA 3QLDA 5BU9A 1Q6RA 4OE7A 3P3BA 1CPUA 3VNIA 1R5YA 1F3XA 1NP2A 2TRSA 4E2OA 1P6CA 4IIEA 3RO8A 1V6WA 3IVUA 1DJGA 2FVLA 3MDUA 2A21A 2P88A 3PZQA 2I17A 4KKXA 4V28A 4MNJA 2FMNA 3FOKA 1QI3A 2Q02A 3B8IA 4BR1A 3VNLA 2CFFA 3M5ZA 2EJAA 4OVXA 4GQ0A 4ML4A 2ICSA 4D6FA 1MW0A 5FA5A 3WKZA 2NX1A 1A5OC 1PZ1A 3TC3A 1XRSA 1DJQA 2PWHA 3DFOA 1IEVA 1Z9AA 1I60A 4O53A 2PD5A 2IXVA 1Q6LA 3F7JA 3I6EA 4L9YA 3FA3A 1GOXA 3N9KA 3LENA 1LOLA 2GGHA 4PUWA 2D3NA 2E8ZA 5CZTA 1TE6A 4YYFA 4CCDA 1R2SA 5T91A 1VB9A 5CBJA 4WY0B 1ME8A 2V5DA 3NA8A 4QIUA 3KBWA 1NIUA 4M24A 1UWTA 4PRRA 3MVIA 4YMZA 2ZRXA 3SY5A 4CD6A 2IMRA 4W85A 2HSAA 2WMJA 3NM1A 1A5MC 3TSBA 5ABFB 4E8CA 3PF3A 4HYRA 2YDAA 3W2MA 3E0FA 2OOGA 4UTUA 3WBWA 4CNSA 4EVZA 5EMJA 3EWDA 5C54A 2G37A 5DF0A 1LCOA 4MSSA 4WGXA 1NFPA 2ZRYA 4QE4A 3T05A 4M0XA 3W1PA 2Y70A 4JICA 3KWXA 4O1BA 1PX3A 5EMYA 2ATMA 1H51A 1AQ0A 1Q6OA 5I02A 3DGBA 3VZYA 3CQ0A 1R3SA 4L6HA 1XLLA 1TQJA 2ONEA 1A0DA 4QITA 1QOPA 3WH5A 3GSMA 3DGRA 4UTIA 1TRDA 4LUYA 4M80A 3ME3A 4EACA 3I10A 1PHWA 4LAZA 2I5GA 3TDFA 2JEQA 2PCEA 4B16A 1GHRA 3C2VA 5BOEA 4YLWA 3FVDA 4JDYA 2YL9A 3LPPA 3ORWA 3VE7A 2TPSA 3QBUA 1KCKA 3DG3A 1A53A 4WRHA 4EXAA 2V5JA 4NILA 3TAKA 4QDMA 5CPLA 1H3GA 1MZHA 4PN2A 1J0ZA 3F5LA 2I5QA 1UD8A 3PPCA 2HS6A 2YDRA 4UQDA 1YHTA 3GRIA 4DRSA 3W3OA 3EKZA 2VRQA 2XIIA 3KBMA 4UTTC 1JCYA 2IKGA 1JD9A 3SBFA 1NH6A 4C6NA 3ERPA 2WNNA 4K39A 3IV8A 1PV8A 3MMTA 3TYEA 2AAMA 2BNJA 3KL0A 2QAPA 3ZMRA 5HPOA 3KTSA 3QKEA 3UR8A 4WDTA 2PDHA 3CHDA 1DWGM 4FS9A 2A1YA 1V3LA 5EB8A 1W91A 1BHGA 4NSBA 3B0VC 2XIQA 3ARQA 3GWQA 4XAYA 1TUXA 3GU9A 1B9ZA 2W67A 4LCQA 4K8GA 4WY0A 1VS1A 2ZRWA 1IXOA 4S38A 4XUGA 5H2ZA 3QTGA 4JQ3A 1XYLA 3H7RA 1PX8A 4Z08A 4FX8A 5CJNA 3HMJG 1B3YA 2ZWZA 4TUFA 4E4FA 1H61A 3GFZA 4RPPA 3UPMA 5EGRA 1HJXA 2W4XA 1AUSL 3EEZA 4AFYA 4OV4A 3VKKA 1S1PA 8TIMA 3EWUA 3WLLA 3TN4A 5AN7A 5C2CA 3BLPX 5I24A 1BVZA 3KS6A 2I5IA 4HZMA 2ACUA 2W9MA 4XKYB 3CTLA 4MJ2A 3KRUA 3GNRA 4XO6A 5GNZA 3IJ9A 4R7JA 1NDWA 3KWSA 2QGHA 4GE8A 3WLRA 4ZBCA 2CKRA 3HV9A 3IJQA 1BSIA 3BMWA 1BG4A 4CQCA 1QK2A 3U57A 1KBLA 5TBOA 4XAFA 2WZMA 4ZSUA 3JR2A 3R58A 4Z2HA 2CLFA 4J3SA 1E55A 1LLZA 3CM4A 4RXGA 1S39A 4MB5A 1XG4A 5G4HC 3U0HA 3VVGA 1B3OA 1EJVC 3TSDA 4ILSA 1RH9A 1CZ1A 4O1DA 1UKTA 4RW3A 1E73M 3V18A 3LRLA 1X6LA 4G2DA 2O56A 4IMDA 4UXDA 4DLFA 3IUHA 4DAFA 2ZTJA 5FF4A 5ECVA 3N4EA 3PZTA 4Q22A 5FOOA 3RLGA 5AKQA 1YDNA 1IT7A 2PSNA 1QCWA 5F4SA 3CPGA 3DBNA 2OLAA 5BWFA 4A2SA 2J9XA 1KGWA 4LUIA 3AYTA 2DIEA 1EDGA 2DDXA 3MI6A 2J75A 2SFPA 1EXBA 3WDIA 1H11A 3L66A 4HNNA 3N34A 2WYSA 6A3HA 4CGTA 4C6IA 1S5NA 3LD5A 5XIAA 1YNYA 1BWVA 1WOAA 3AIQA 3DYOA 2WMKA 2ZX5A 1W5PA 1V6VA 3MSGA 1W5QA 1BTCA 3S9IA 4B4HA 4DXXA 1UC5A 3N4FA 4PTNA 2OEMA 2D24A 7PTDA 4HNOA 3CYVA 3H53A 2WCAA 5LGZA 3BAIA 4UTLA 1J6PA 4HNLA 1A5CA 4PA8A 1NQKA 4CU6A 3GXIA 1E0UA 4NAFB 4Z1YA 4E38A 4GYKA 5IM51 2OT0A 3RM4A 1IT8A 4KWWA 4AAJA 2NQ5A 3K8LA 1U5JA 1EB3A 4QHRA 1M7XA 4Z1AA 2XGZA 3NYDA 3W74A 4W88A 3VUSA 5HNRA 3NPXA 3EMQA 1OYCA 1Q66A 1VFUA 3G1FA 3ZLFA 1QDSA 3SGGA 3AJXA 4DJEC 4NNBA 1EQPA 2HBVA 2FZNA 1T7LA 3B05A 4LWWA 2CZ5A 2WKGA 2E68A 3VCNA 3IUIA 4IPJA 2VEKA 4UQBA 4KT2A 3FNDA 1V03A 3W84A 2Y5EA 1X98A 4ML9A 3Q58A 1H7NA 4QEEA 1Q6QA 5EBUA 1ONWA 4I9AA 3GH5A 3WENA 3C8FA 4WJEA 4X0NA 1DIOA 4GUJA 4FXJA 1HJQA 4Z17A 1EP1A 3LK6A 2OSYA 4A8LA 3BAKA 2DZSA 4FR6A 3AXIA 2ZXAA 1HNYA 2G8ZA 2HK0A 3I6TA 4M7TA 3LCLA 3AIEA 1QW9A 1J93A 1I0BA 1I2QA 4AWEA 2PZ0A 4KMQA 2X1IA 3U2OA 2E6FA 3EWYA 1FBAA 1DJHA 5CZJA 4GX9A 1XDMA 3BQ6A 5CGTA 4S3JA 1VAHA 1JUEA 5HMDA 2GVYA 3C3UA 3B8UA 4L56A 1KFKA 3STCA 3E0IA 5H8PA 3L5MA 4JTDA 3GH4A 1OIMA 4AVFA 3OB8A 4J27A 2QAFA 3CPRA 2Y5SA 3BSHA 4A29A 2Q3RA 1UB3A 2V8ZA 4JD4A 1VR6A 3CZLA 4DXKA 2RDWA 4Y2WA 2QVNA 2WVVA 2R8WA 1ELSA 3KRZA 1C8QA 4QS5A 5D2VA 4Q8UA 1X6NA 2V67A 5H6HA 4MM1A 2Y2WA 4HPJA 3T4CA 3MPGA 1TPEA 4ENLA 1NWUA 1GK8A 2VUNA 3TVAA 4HNUA 1R85A 3DZ1A 2PMQA 2FKPA 3FV9A 4I9JA 2GOUA 1UZDA 4F2BA 2BX7A 1WDDA 1GPWA 4IP4A 1GW9A 3KDNA 3QOKA 2ZC8A 1UWRA 1CXFA 3WEMA 1WOBA 3CV1A 4UFJA 1NP0A 3RU6A 3N73A 4C60A 2XIMA 2FHFA 5FJRA 3U2ZA 1FDYA 4E4UA 5KEZA 5HULA 2UY3A 4NI3A 2PWUA 3RIKA 1Z8AA 4QDWA 2ISFA 1DWJM 3HO8A 4DNHA 4JFUA 4HZ8A 1F3WA 4MY9A 5HJYA 3TR9A 3CASA 5IRPA 1TWIA 3VFCA 3UWUA 4N4PA 3STFA 2P8BA 1SYTA 1HXJA 3I4EA 5F7UA 3BJTA 3VGFA 4BWLC 5KZDA 4MFDA 4F2UA 4HBKA 4PL2A 2J6XA 1T0OA 4DXVA 4MPQA 2BVDA 2QUNA 3CV7A 1MQQA 3P5YA 3URBA 4F2TA 2R94A 1AJZA 3TCEA 4PL1A 2FLIA 1MEHA 1U1HA 3RMJA 3VOGA 2RFGA 3WDHA 4CQDA 1I2OA 2PPGA 1WPCA 2YL5A 3W7GA 1JNEA 3AIWA 1MO0A 3SCRA 4KWUA 6CGTA 4H19A 3KL3A 3DFTA 3ITGA 4KQNA 3R79A 3DYPA 4O15A 2V3GA 2Y6ZA 2ZZ5A 2I1OA 2BXYA 1W8GA 4JGDA 4KH2A 4RJEA 3PTQA 3EOUA 3A22A 1JPMA 2YA2A 3GDRA 1JYXA 2Y7DA 4O0QA 2B31A 3M6YA 1KGUA 1A0CA 3REQA 3C0SA 1R38A 4DWDA 4LUTB 3BLEA 3BV4A 5LIYX 5CSUA 3LQLA 2J13A 3CZGA 3OLIA 3MBDA 1TUFA 2P50A 2FGLA 3PZUA 3HGRA 1W0MA 2CERA 4MY8A 4US5A 4QLJA 4WJXA 1PZ3A 3LPFA 3WQPA 2PLJA 4HZ7A 3M07A 2BXVA 1W3NA 1R47A 2ZUMA 3NQFA 1TYGA 3WH7A 1MYRA 3IIXA 1SZGA 1RPKA 1GVIA 3WDQA 1SVDA 5FEWA 3RX3A 1AH0A 3FEMA 2J27A 4QE5A 3I7SA 1PB0A 1XH2A 5H1WA 4DAIA 3H8AA 3I4KA 3O63A 2DPEA 4UQ9A 3WH9A 1TG7A 1W3HA 3U2CA 4IG2B 4G7EB 3K4DA 1MW3A 3SW6A 3NO3A 1HKKA 2A6LA 4S3DA 3H4WA 1K6AA 2FTPA 1OT1A 2I56A 1V4YA 3RLVA 3TYBA 1CECA 4V33A 2JBMA 1NJJA 4GNKB 3PC0A 3STEA 4MNMA 1XFCA 3GIQA 3CWNA 1WE5A 1SU5A 4Y90A 1K8YA 4IMEA 4ACYA 3P2VA 1XBYA 3UP8A 2ZRUA 4F40A 3A64A 3TJXA 4MKSA 4ADTA 3BPWA 3P81A 2Y8VA 2IPGA 2VCCA 1JDFA 1AZ2A 2E7FA 3FJNA 1SO5A 3ABZA 3FFSA 3N6JA 3OQEA 1JDDA 1UA3A 1TJ2A 2WC4A 3N9RA 4R33A 1B3VA 1XYAA 3COTA 4MWAB 2XYLA 4EF8A 2DEPA 4J40A 1UYQA 3QEZA 2DQWA 1GKRA 2V2DA 4AC1X 2PDWA 3KW3A 1QI4A 2B81A 3BGAA 2P10A 4JYEA 4NZFA 1E0XA 5I6SA 1WKEA 3S9ZA 1K7EA 1HP5A 4W7VA 1JR1A 2YDSA 2NUWA 3SDOA 4GUIA 1VLWA 5I06A 2GDQA 3SIZA 4B91A 2FZDA 1TJRA 1JQXA 1UOKA 1Q4NX 3QC0A 5M03A 4KRTA 2W3ZA 1W1A1 4I3GA 3UWZA 3YPIA 3ABQA 4US5D 4EPBC 2PB1A 4WXYA 8XIMA 3OEXA 1LUCB 1VFFA 3U2EA 1HL2A 3FX4A 2UWFA 3BAWA 1O95A 2GOKA 3VKCA 3WY1A 4RDYA 4S2BA 1SM9A 1PUDA 3B9EA 3PULA 1UWQA 5JH2A 2YA1A 3VOFA 4M6VA 3KRBA 3AAMA 4W5ZA 5HUOA 3TTYA 1ML1A 3PTKA 3KBSA 4PTMA 1KV5A 1LJYA 3VKAA 4PUNA 3RX4A 1E56A 2R1LA 1WKDA 4NF7A 1B3WA 3EOOA 3N18A 2VOMA 1DE6A 3T8LA 2DUXA 3NGJA 1HKIA 4A6GA 3BLIA 3WX7A 3AO0A 3TTEA 1ZENA 3VIKA 3VXGA 1G7UA 1R8LA 2BOEX 3B03A 2E8YA 3AUJA 5LZLA 3VGHA 4JX5A 1E0WA 1IZKA 2CETA 5C6MA 5EMLA 3ITTA 1I4NA 1WQ5A 1EHNA 2JKAA 1PTDA 4MWAD 1VEOA 1Z41A 4A8NA 1LOQA 1UQZA 3MZNA 4S3GA 1GG0A 4LS2A 1EOMA 2ISWA 4QSHA 4DVOA 1ALDA 1DWAM 3SCSA 4Z42C 3E1F1 4Y8FA 1DXIA 3W2JA 1UBSA 4J28A 2QF7A 3QSRA 1OBAA 3WFLA 4IIBA 2CPUA 3C4UA 3LOTA 3B8SA 3LNMA 4H9UA 1FKWA 3G2GA 4ZMGA 3WQWA 1E3XA 3IPWA 1V51A 2ZXDA 1Z32X 4LNYA 2XWDA 3KOXA 2YB4A 2VMFA 3CQIA 1RAKA 4M1BA 4RX0A 1KFJA 3APTA 4IFRA 3WFAA 3NQBA 4XZ9A 4PGLA 1JG9A 1KR0A 3GFYA 3NQGA 4OHQA 4V27A 4LB3A 4NYUA 3XINA 1PKLA 3EEGA 3D47A 3KBNA 2Y7FA 1M1BA 2PCQA 3AMCA 1HJWA 3W1MA 3WBYA 4JTQA 4DX3A 1HZYA 2ZKMX 4Q8WA 3WJYA 1E1EA 1IGSA 3RGTA 3T0BA 4FLSA 4X61A 1UKQA 3TW7A 1OFQA 3WNMA 2ZA3A 2AQVA 1YNQA 2DW7A 3N29A 4PMZA 1FWBC 5G1MA 4A2RA 4HMNA 4H1ZA 1DQXA 3PWAA 4NZ4A 1Z3NA 3VCRA 5HNTA 3VD7A 2GK1B 4H6QA 4MADA 4IGMA 1ZAHA 4GVFA 3POHA 4UFLA 1XYZA 3W7PA 1FVPA 2OMAA 1ODUA 3LCGA 1WP6A 2NZLA 2ABAA 3ANUA 3ANVA 3SECA 3WQOA 4AY1A 3VNJA 3IUDA 1KR1A 3HG4A 3H2MA 3WNPA 5CPQA 2NQHA 4GO9A 3DKJA 1M7OA 3HPAA 5B80A 5CGMA 3R13A 5HR6A 1E40A 3WD3A 2VC7A 3CH0A 4Z0JA 4OTKA 3L4XA 4FNSA 2XN1A 4UOQA 1S5WA 1J4EA 3LEPA 3K2GA 2ZTKA 1W9VA 3M5VA 3M43A 2POTA 1FWNA 5FF0A 3USZA 3WUGA 3MKKA 3VC5A 2WNWA 1EBHA 3I3BA 3BARA 3NFUA 3GE7A 2GQ8A 4NJKA 3A47A 2GJRA 2E77A 4IJBA 3VDBA 3KCOA 2VEPA 3AC0A 4GH1A 4Y9MA 1E0TA 5TF0A 3QZEA 2CLPA 4XKYA 4HHLA 5A3HA 1EZ2A 3TAOA 2DH3A 2XTKA 1F3EA 1RXOB 2QYGA 4DJFD 4JQ1A 4PMXA 1WB0A 3TWAA 3JVAA 1C29A 4YN5A 4Q33A 3HM7A 1LBMA 4GYFA 4FX7A 1B5TA 3WG6A 3GIYA 1HIZA 2DSWA 2R14A 4ZTXA 4GIYA 3N2CA 3MMDA 4CEUC 3GG7A 3LLFA 1UR8A 3AYSA 3VIIA 4QNEA 3O07A 3NQDA 4JTJA 1QPRA 3WQGA 1E6ZA 2E09A 3PBGA 3CZEA 3PN8A 4LX4A 1TELA 3RILA 3CLWA 1W32A 3B0PA 5D32A 3CUZA 1VEMA 1UBPC 1MMFA 3GHSA 4GUHA 1KTNA 1V3JA 4RLIA 4O18A 3EDDA 1Q7MA 3H2OA 2FPTA 4M6QA 4DF1A 4GZ7A 2QDEA 4GHRA 3UYIA 4H8HA 3EXSA 4PTXA 4WGHA 2AGTA 2RH9A 3EDEA 3UD6A 1XSJA 5F4XA 2PU0A 1U33A 2WJFA 1PBGA 4KIEA 3R89A 3NOYA 5GJPA 2AGKA 2O4QA 3EWBX 5D30A 1UW9A 4U10A 3VDAA 4N6FA 4IOTA 4IIGA 4Y8EA 1UD3A 4LJ3A 3M41A 4PSPA 2PE4A 2REQB 3LHTA 3H2CA 3M46A 4HP5A 2XFRA 1O5QA 4UNIA 1SQ7A 3SGZA 1JDCA 2EPMX 4NUWA 4OZOA 5ABGA 3TN3A 1HQTA 5DXXA 4AF0A 2C91A 1TWZA 3MYPA 3WLNA 1ZSXA 3HJZA 3NVDA 4WDUA 4GACA 4JIQA 3ES8A 2ZDSA 5BMXA 2DJXA 3RM8A 1OK4A 3AALA 2Y8UA 3R25A 3U3HA 3OO2A 3GXFA 4ROQA 4TMCA 3A5VA 3TX9A 1SW7A 2R82A 1SSDA 4W8AA 3GBDA 3GD6A 1CWYA 4Q7BA 3F2DA 4S3BA 2V5CA 4RL3A 5C2XA 4ZE4A 1E4LA 1A47A 2QCEA 4F4RA 6REQB 3GNXA 2WHLA 2XWEA 4CNNA 1TSIA 1JDEA 2XIOA 5A95A 4ZFMA 4HKPA 3GU1A 2Q09A 1MUCA 2DU2A 2Z26A 4WKHA 4LVFA 3L21A 5LHFA 3DENA 2ZZ4A 1TZZA 1K9FA 3QPEA 4PTWA 3M5YA 4HNTA 4H2HA 4WXZA 1DL3A 2HWGA 2XVPA 3V0TA 2DY3A 2ZX6A 1SR0A 3UG8A 3PS7A 4JNMA 1P0BA 3RPDA 2BSLA 3WLJA 3DFNA 1JQVA 3WF4A 4PUJA 5DCDA 5JH1A 5LNWA 4AYGA 2C71A 3QR0A 2WPGA 4MKVA 1GT8A 3NIYA 3IAPA 2FZMA 3CIWA 2GLKA 2VFEA 1R86A 3H7VA 3H21A 3BW4A 2DUZA 4LY8A 3NZ1A 7ENLA 1VC4A 5D9MA 3S42A 2FJUB 3V1HA 1W1TA 4UR7A 3T09A 3VC6A 2WCGA 2EGZA 3CUIA 4QJ3B 4UTWA 3VNKA 3A12A 1UKSA 1XLHA 1CLKA 4HNVA 2DSKA 3NAVA 1XIMA 4HCHA 3T9PA 3PM6A 3L23A 4ZO8A 1EF2A 3GX9A 1FFQA 5I79A 3IVTA 2J8FA 4NG3A 4S3AA 2V9DA 4D6CA 4F9JA 1G4PA 4GQBA 3CHVA 2CLMA 3W81A 1XLFA 2HRWA 1PAMA 1JZ6A 1OB0A 1UR0A 3BW2A 3Q45A 1POKA 3AXHA 4FALA 1HVQA 1QO5A 2OELA 2Q71A 1R6WA 1US2A 2FTYA 3B4UA 5XIMA 1DXFA 3W22A 3QSTA 2FH8A 3U9IA 3DG7A 1RK5A 3ZFHA 2PD9A 1GOMA 2QV4A 3DCPA 1EYWA 4QJ5B 4IQDA 2DZAA 3DKLA 1XP3A 4BI5A 4QBXA 2G96A 1T41A 4JS3A 2H3DA 1CX9A 4H9TA 2G3IA 3QHNA 1EJ7L 3W2NA 1GJPA 2Z29A 3K30A 5IFPA 2O9PA 1BQCA 4X3ZA 1GVQA 1PKYA 2WKLA 5T9BG 3BJSA 4OKDA 3KZSA 3EWXA 3T6CA 4XD6A 1O12A 2RJGA 3H4GA 3H7UA 4BQ4A 1Z69A 1V6YA 3UY8A 2XZ9A 3CC1A 4Y6GA 4LAKA 2OWCA 4A05A 4B5VA 3FY1A 5E70A 2XH4A 3TMLA 1ZU8A 3JRKA 4HOZA 2VYOA 1XC4A 2WLZA 4B5UA 4Z2LA 5FSDC 4MZ8A 4OT7A 4FO4A 1QNOA 1TTJA 2I9EA 2IPWA 2XU2A 5A5WA 2J66A 2QPUA 2WZHA 1Z48A 3I3DA 1PCKA 1WV2A 3OBAA 3I7QA 2VEMA 1VENA 3IV3A 3GS6A 1CBGA 2GYIA 1AODA 1FWJC 2A3BA 5SWUA 3N13A 3OLGA 4QRNA 1KM2A 1F2JA 2YXGA 3VI2A 2RHGA 4H7CA 1XYCA 1U1JA 1KBBA 3GUWA 3KDOA 5I0DA 3SCTA 1FY6A 1NELA 5HATA 1YTKA 3W27A 3UF9A 1HL8A 4AZBA 1T5AA 4TVCA 4NZ5A 1HJVA 1FWEC 1KRCC 3NEVA 2Z6IA 4O4VA 3G1VA 3S3GA 3CH9A 3TR2A 3CMJA 2X1TA 1P7TB 4KESA 4O1AA 3SN4A 2VELA 3H54A 1SJBA 3VNZA 2A4AA 3CEPA 2IS7A 2Z7KA 4BA0A 3M44A 1FCUA 4GKTA 3R6IA 2C8NA 4MJMA 1QAPA 1F4AA 1I1XA 2OXNA 4DBEA 4AH7A 3BMXA 4UQEA 4E2BA 2BHZA 1Y5XA 1P5BA 1A5KC 3A3XA 1UD4A 1ISZA 2A79A 1K8XA 3SJ3A 3GC2A 3ZT6A 3OLEA 4HJFA 3ZQ9A 5DY2A 4TX8A 4QSFA 4JTTA 3UXAA 2JGQA 5DO8A 1JGMA 1BD0A 5JIWA 4JHZA 1JFXA 1VBGA 4LBSA 3NL6A 1K77A 3P82A 4R9XA 5KTLA 2O92A 3E2RA 3P61A 3TQPA 4MKNA 1G4TA 4P8UA 3JW7A 1TZ9A 2OX4A 4ZO7A 4W4QA 4XTIA 2A3AA 3GXMA 1I2RA 4PULA 4E8DA 5IHSA 5KITA 3PTDA 4H83A 1U5VA 2XIBA 2Q01A 4O57A 1RD5A 3O0FA 1WZLA 5EU9A 3OIXA 3E2QA 4HU3A 4LC8A 3B3DA 2NXGA 3MV01 1B4EA 2ZUUA 4OOUA 4AG0A 1E0VA 1IIHA 2J9YA 1LLWA 2GSHA 3OVQA 1E1CB 1VJZA 1BLIA 1TMHA 4M6UA 4ZQNA 4CD4A 5CLWA 1UPPA 4R27A 4FP1A 1NY1A 1YTEA 3BK0A 3ZYZA 4F48A 3VKBA 3C2YA 1C3FA 2C6QA 5D4YA 3MHGA 4FOJA 1T8XA 4I5XA 1PX4A 3ZR5A 1Q65A 4LC6A 1CTNA 1IEIA 2C79A 2NLYA 4BHYA 2YBUA 4DO5A 2CHNA 3KFTA 4PMNA 3W00A 1OSEA 4P8XA 5I00A 4NI8A 3WEOA 1XJBA 1N8IA 2QCMA 2WV8A 3LLDA 2B0MA 3NM3A 5HBFA 1RJQA 2G3JA 3NDOA 4MVAA 4RCXA 2ASHA 1WDPA 3LM3A 4ECLA 3FJ4A 5IHRA 1XF0A 3W6MA 5FEPA 3DX5A 5CXPA 3BAYA 1EO7A 3EOEA 3P0WA 2V3DA 1FHDA 4FNQA 1KXVA 3GY1A 3BMVA 3UPWA 1KGXA 1OQFA 3G1AA 1KRMA 1VCGA 2QDGA 1RA0A 3VA8A 2Y85A 4U3AA 1O1ZA 4IXHA 1EC7A 1J0KA 4LBUA 2VZUA 2WANA 3IVSA 2QLYA 2CC0A 2WJEA 3EX6A 3W7NA 1GZ1A 3V75A 3RPMA 3OLDA 4RV3A 1E5JA 3HB9A 3N3MA 3RCMA 4Y9AA 3ALFA 4RE2A 3M0XA 2X40A 2CZDA 1TPUA 3ARTA 4FNRA 4Z2GA 4EWND 2HK1A 2X1SA 1B90A 4XZLX 3G1SA 5E0FA 1X6UA 5CZ0A 2MUCA 1SFJA 3II1A 1JCLA 3UWYA 4DI8A 1J10A 4U28A 3WZ0E 4ZL1A 4LS1A 4A3QA 3ENLA 1UR4A 5M5DA 1XKYA 1S5VA 2PURA 3TUUA 3QYQA 4FLRA 4XG1A 4CD8A 4M3PA 1JCNA 2R1KA 1T40A 1Y0EA 4KPLA 4FHAA 3MHFA 4ZE5A 2E5CA 4Z0SA 3CNYA 4QJ1A 4OECA 2G3NA 3L65A 5AVHA 1PCWA 5D05A 3LYEA 2JK2A 4EANA 1NDVA 3BCDA 4X63A 1GNXA 4G1KA 4DZHA 3NG3A 1GQNA 2PDCA 4F66A 2PEVA 4GA8A 1CXKA 2A3LA 1QOXA 2X16A 1PTGA 2ZZ1A 1X39A 1P4CA 1VZWA 1KBKA 2PLMA 4O1FA 6XIMA 3CAKA 4TV6A 4PB5A 4B3LA 1E1CA 3SCOA 2XFWA 1US0A 4WSJA 5DT5A 2J7GA 2XSXA 2ZXQA 4S2CA 1PIIA 2VEFA 3LXCA 2CU0A 5CSYA 3S5NA 4MWAA 1PWMA 1AH3A 4GXMA 3VUPA 2A3EA 3HF3A 1QNVA 3TOPA 1VD6A 3IJDA 5AECA 3M0VA 4LTSA 2ZE0A 2A3HA 1OF6A 3S5SA 1YE4A 1BXBA 3BLOA 4B5SA 1VP5A 2QCFA 1HVXA 4UTHA 1W1IE 5ABEA 1H7RA 2ZUNA 1V6XA 2IQ0A 3QTPA 1J79A 3GNPA 2O7QA 3ISIX 4PTDA 4FIQA 3ABOA 3UETA 3RDKA 3RU8X 1CDGA 1W9BM 4B3KA 1ECQA 1JGIA 1JUBA 4CU7A 1TFVA 2B7QA 5DCEA 4QTGA 3S8HA 1TA3B 3SURA 1J5SA 4TO8A 4PUDA 3MUCA 1REQA 5DX7A 3GVGA 3VNYA 1FUYA 1FWGC 3FJLA 3H23A 3ABXA 4I7UA 3VFLA 2I57A 1SR9A 5AVNA 3L0GA 4PCNA 4PBGA 3L0NA 2KX9A 3D46A 3U5UA 3EB3A 3RG6A 4NNAA 3BTNA 1UZHA 5DRCA 2HZGA 4JOMA 3E3HA 1DPMA 4RPQA 4XZWA 2PDIA 4DJED 3TH6A 1KFWA 2VC6A 2Z24A 4AY7A 2DZXA 1D7FA 3W7DA 5F2GA 1HO4A 1AL7A 4B2DD 2DORA 3QV6A 4WDWA 2R91A 3O16A 4PUKA 3MV11 4TQTA 4RZ5A 2PWVA 2WBKA 4WKAA 1MSSA 2Z1KA 1EPXA 4ICNA 3EWZA 2BHUA 1SJDA 2F61A 3THDA 1EYEA 1R3VA 3ITOA 5D03A 1H4PA 2QCCA 3RM9A 1S5MA 4C6DA 5J04A 5LKYA 1D8WA 4MWAC 5AYZA 3L4YA 3NQCA 1JPKA 4KEVA 3PBUA 2QQ6A 1B57A 2DT1A 2FFCA 2ISVA 1GWJA 1CXIA 1GVRA 5A6MA 4PR4A 1HFBA 1Q8AA 3NQVA 6TIMA 5AYYA 4WEVX 8A3HA 1UR3M 3UPBA 1XLMA 4H8VA 4Y96A 3RLUA 1LT8A 1TR9A 2Z4GA 1Q2SA 3KLKA 4Q7IA 4YTRA 1E4NA 2W0UA 4BS0A 2HVNA 5AY7A 4L7ZA 1SZFA 1N7KA 2P76A 1ISVA 1G4SA 3LCIA 1RCOB 4PFHA 2KZHA 2BGSA 2VFFA 3EMZA 4U31A 4YVVA 3W6LA 4NXKA 1TJ1A 3VIPA 3RK8A 2BDQA 1S2WA 1V3MA 1PZ0A 3DC8A 1JYVA 3KVMA 2VC5A 3LHZA 3W1RA 1X97A 1Q5MA 1QRQA 1Q85A 4DJDC 3VPLA 3LZ5A 4FEZA 2D20A 1G94A 1H0GA 1OHLA 1TVPA 9XIAA 2NQ9A 1LQ2A 2WVVB 4ADSA 2V30A 2HXTA 4PCPA 4JTAA 2YSWA 4ZOAA 3JZUA 2OTDA 1XLCA 2WO5A 1S1RA 3PY2A 4Q4RA 2OQLA 2X0YA 4IX2A 3WD2A 4Q8TA 5K9CA 4H9ZA 1B54A 4IICA 5TD4A 4DNMA 3M7SA 1OC7A 3CO8A 2A2IA 1V7YA 3GDMA 3GDBA 2QV5A 2PI6A 4M8UA 2GDUA 1I75A 2NXHA 1BEUA 1K70A 1QPOA 5HINA 3NDZA 4JTGA 5CAKA 5DELA 2FPYA 1YPFA 2P0IA 3NO1A 4NJIA 1UIOA 4U3CA 5D33A 2NWSA 1EIBA 3FA5A 3G24A 2IUZA 1ZJBA 3MTWA 3M0MA 2O9TA 1HO1A 1IIGA 3WQ6A 2BVTA 2VRKA 3A3WA 4Q8OA 2Q6ZA 4IXXA 1HT6A 4HPGA 4O8RA 3CHEA 1VBRA 1B3ZA 2CBJA 2QPSA 5B7YA 3IIPA 3S46A 2B4GA 1Q13A 2D2HA 3IACA 5C70A 4OWGA 4X22A 1R0MA 3PP7A 1PIGA 4C5YA 1WBHA 3A5FA 4M19A 3MANA 1ZHAA 3PBWA 4E3VA 2GL5A 5E0KA 3IJ7A 1OC5A 3M7WA 2HJPA 3SUSA 1J2WA 1OGSA 3BLDA 1V3KA 1SW0A 2VZOA 4GQRA 1XDJA 3SB0A 5AHLA 4XB3A 3R10A 3MY9A 1R2TA 1H09A 3A23A 1ZB5A 4HT3A 4CN4A 1QHZA 2DZBA 5AC8A 3BLKA 2VCBA 4CEXC 2NV1A 3TWBA 1EC9A 1RCXB 1LQAA 3SSJA 4ZO6A 3C56A 4S3KA 3WEZA 1FCVA 1HKVA 1O1HA 1CB2A 4RNIA 3SGUA 3OODA 3N04A 4O1CA 3GR8A 1IT0A 4LYPA 5KETA 2NLIA 1J8VA 5BRBA 4XBSA 3WL1A 1AJ2A 3P5ZA 3C8NA 5D9NA 5G4EA 3EDKA 1OG0A 4ZQPA 9CGTA 1OWQA 3KUMA 3HV8A 3WBAA 3U4FA 4CVWA 3GC5A 2EAWA 1RBLA 4IT1A 2FHCA 1QFEA 4IL0A 1OADA 1KFBA 2JQXA 1C9DA 1GYLA 1UASA 4NZJA 1Q2RA 3QJAA 2DQXA 1E1FA 2BY1A 2XVKA 5A8MA 1X8CA 4JQAA 3TXZA 1UROA 4RZ4A 2G97A 5CAHA 1UIPA 1E71M 1O60A 3HMCA 2OO0A 3ITYA 1H0IA 4B92A 2DW6A 4NZ3A 4GZJA 1JEZA 4MZYA 3FDKA 1EP2A 3GTIA 2D3LA 3LCXA 2PP3A 3K1DA 1LWIA 2Z1SA 4CVUA 5K9XA 3V5OA 2V68A 4AD0A 1SJAA 3BXWA 3PTMA 1UC4A 3HA1A 1NOFA 2F9RA 4JFTA 3ONBA 4ZTYA 3QZAA 1LORA 1DXEA 1EUNA 1XLEA 2TSYA 3QGKC 4S1FA 6ENLA 2VZVA 4XVDA 5C9UA 3PHAA 1HF6A 4O1EA 4V1XA 1H7WA 2HV5A 4NX5A 4ZB0A 5MKGA 3AZSA 4YWIA 3HG5A 3UA4A 4QG8A 4AMAA 3CUJA 4OU1A 2XH0A 3R43A 2DVXA 1US3A 3W7CA 2B7PA 2W61A 3G0XA 5BRPA 1TWWA 1QPNA 4AZGA 4LAUA 3VX1A 3CAVA 3W71A 5AYXA 1GOWA 2XHYA 3GYCA 2FMOA 3PK7A 4OJYA 4JDBA 3QZ6A 4H4IA 2GVJA 3V5FA 3EPNA 3AISA 3TJ4A 5JU6A 1GGOA 3C2RA 3TFCA 4LANA 2GVGA 1BFNA 3UR7A 4FNUA 2Z25A 5CLTA 4AX7A 4EXQA 4JIIX 3IRDA 4PMDA 3SCNA 3INPA 3IWPA 1F76A 5DEZA 3WMBA 4CNTA 2EG7A 2VVNA 3AMKA 1ZNNA 2ZXBA 4U2YA 5CC6A 3G6MA 1XGEA 3TNBA 4DPPA 1V79A 5J5DA 3VD9A 2Z27A 8RUCA 2NT0A 4F0HA 5PTDA 1B0IA 4IISA 1EGMA 1P43A 4KWOA 4FB7A 4XAPA 1Y65A 2H8ZA 2HCVA 1VYSX 1XUUA 2EBNA 4DB7A 2CKSA 4UOZA 1KKOA 4RZBA 1Q7ZA 1QOQA 3F4WA 4AWTA 4LAMA 1W8SA 3D5HA 1ZCOA 2OPJA 2J9ZA 4HB7A 3S0CA 4EE9A 3T1GA 3DC0A 2ZA2A 2VCAA 2WC3A 2ZX7A 5FL0A 1UH4A 3D3AA 3TV8A 4W5UA 1OK6A 1PYFA 4UTMA 2WVTA 2BOGX 3M1ZA 4BQ2A 4GIEA 5E5CA 1UWSA 3C86A 2W92A 3WIJA 1OCNA 1JNDA 3C2FA 4YTSA 2NT1A 3E96A 2OGJA 5FEZA 2QMKA 3FYYA 1F7BA 1DWHM 4R53A 3K5XA 1NWSA 2PDLA 5FI8A 1D3HA 3MMUA 1DTUA 1FWCC 3KTXA 3I65A 2QVHA 4C6OA 4DF0A 3TKFA 1GW1A 1ZJIA 3BZGA 1XHGA 2W66A 1QASA 3BZJA 1K4HA 3HQOA 3GAYA 1PTAA 1FCBA 3JS3A 4GX8A 3P74A 5E9XA 1N82A 3WLTA 2PGFA 3WMCA 2DH2A 4U5IA 1ZALA 1P0DA 3WK3A 3ZT7A 1UD6A 2QEZA 3TTOA 3VM5A 4LUSB 3R94A 1NARA 1BYCA 1W6TA 3DI1A 4ICMA 3E0LA 3O1NA 3RFAA 5D37A 5ENLA 4AB4A 3E5PA 2Y7EA 1QO2A 3W2UA 2ZC1A 1FWWA 4R3UA 3T0CA 1E9ZB 3WQ5A 3GVQA 4JTEA 1MI3A 3ZO9A 3HQ1A 3CQHA 4IM4A 1Q6EA 3THAA 1W9PA 1C9WA 4MAZA 2IQDA 1OX5A 4CCEA 1OGBA 1VYPX 3TTSA 4PMYA 2AL2B 4LXFA 3OHIA 3EA2A 3F5KA 2BY3A 3O06A 4REQB 2VFIA 4JIPA 1R9YA 3VOHA 5L6UA 4HD5A 1FWAC 3ATYA 3C0QA 2Q8XA 4O4WA 1ZCCA 4LF2A 1WX0A 1CLVA 3AXKA 1UWUA 4LPCA 4B5TA 4XVEA 1AD4A 2V3FA 1BWKA 4JBRA 2FHBA 1VRXA 4AVOA 1DWFM 1X8FA 7A3HA 1D3GA 1TPH1 1KBIA 1LRTA 3VDHA 1WA3A 2J8TA 3M0JA 3BCJA 4MY1A 1JCXA 4ZOEA 4BJHA 1VH7A 3NZGA 1CXLA 2C1GA 3EBVA 2Y7GA 4IPPA 2X8RA 2XH7A 1OD0A 3WQCA 4ZODA 3EPMA 4IF2A 1EA9C 3M16A 2A5HA 3NO5A 4ONVA 4DJFC 1NEYA 1ICPA 3ARRA 1B4KA 1I45A 4DWSD 4Q8PA 2OYLA 3GNNA 4HNCA 1NFBA 4NRSA 3LUTA 4W89A 3TN6A 1JCJA 2HVOA 3MP5A 3FHQA 4DO6A 1Y5VA 2QCDB 1DJZA 2QJNA 3OVPA 1W17A 3FYPA 3IJIA 4IHCA 5HR7A 1GVSA 2VVSA 3ZVIA 1A4MA 2W62A 2TAAA 3E12A 1A5SA 3BO9A 1ISXA 3QHOA 1HP4A 3M0HA 2YXXA 5M17A 4FPSA 3QY8A 2OU4A 3UJFA 4XO7A 3LPOA 3VM7A 3C61A 4KGJA 3VKJA 4QQUA 1W1VA 1WAUA 3AU6A 2PTXA 2VENA 1KC7A 5HMEA 3PB0A 2BOFX 1GONA 3OZOA 1ONXA 3B04A 1KV8A 1L8PA 3NEHA 1XD1A 3M4HA 2VXNA 4K37A 1K03A 5C55A 3AS0A 2I14A 2VX6A 4C6MA 1ZJAA 3OVGA 1XI3A 4GWEA 4ZQRA 3QN3A 4GZEA 3FVMA 4CQ9A 4IJRA 1KLZA 2QUTA 1CNVA 2NSXA 5LXEA 1EGZA 4LVGA 3W7KA 4CKQA 1U5HA 1ZAIA 1UJPA 1JI1A 1A3XA 3S6TA 2W79A 1UUOA 3WO8A 3L2IA 4HOWA 1E9IA 1WZAA 1XLJA 4JX4A 3EKLA 4DPQA 4YXGA 2OB3A 1QPQA 3LCHA 3PZVA 2DZPA 4JNZA 2Q3OA 1DJXA 3PR2A 3R0KA 1BG9A 4IFKB 1SSGA 2ZADA 3K13A 3G22A 4CLMA 1ZPTA 2J7FA 2NW0A 4W84A 3LXAA 1R3TA 2PGRA 5DY3A 1ITCA 4QM1A 2GGJA 2TYSA 4KEMA 1BGGA 1LT7A 4KFOA 1TR1A 4N42A 3MQTA 3NPUA 2WSRA 4J3UA 3K8KA 3MA8A 2PBGA 3Q67A 4LH8A 1IV8A 3QR1A 2J6VA 4DUWA 3O6CA 3IRSA 2JALA 2AMXA 1HX0A 3WJXA 4AD1A 1W3IA 4H2CA 3N9SA 5G2HA 5IFTA 1XIJA 3N2OA 3WYZA 1KWGA 3HG3A 1H49A 2ALDA 3NPWA 4A35A 2XSBA 3NUKA 3CEUA 1K7FA 1EWDA 2FTWA 2OZTA 1AVAA 4EKJA 4QR6A 2YA0A 4F0SA 4WZHA 2E1WA 3CL6A 1OFPA 3NQ2A 5HQMA 1H50A 2WMFA 2UZ9A 3GK0A 1RBOB 2B7NA 4C91A 3IK4A 1WBJA 3SFKA 4HA4A 1K9DA 1JAEA 4AD3A 2WAGA 3GXNA 5AZ1A 5B7ZA 1BWLA 1YKWA 3SADA 2PTDA 1M04A 1PZ2A 4FXFA 2GUBA 4KWVA 4TOQA 3UT0A 2W5FA 4Q8NA 5C71A 3AS2A 3ES7A 3AICA 1KTCA 4L4PA 4FAMA 3GHRA 3GXTA 4L61A 5A94A 5REQA 3USBA 4HQVA 5DRIA 4DBWA 3NXLA 4FF7A 3LV6A 3LG3A 1W3TA 1UHVA 4RV8A 3TONA 1X96A 3KVLA 3OA5A 4XIMA 3DEQA 3E49A 3ARXA 4RE3A 4NAFA 1F4HA 3W1QA 2WW5A 4BF9A 3KOYA 3QFWA 4NXSA 1TTIA 3H2FA 4DBDA 4BEUA 4C65A 1CGUA 1ZQ5A 2NUYA 4R9OA 1KWKA 1MUWA 2WHMA 3ARYA 1X1ZA 4PODA 3BWWA 2ANUA 4MDOA 4AX6A 3DHPA 4NZ1A 1FWRA 1EOKA 1KNWA 3W1NA 3PFRA 4L1XA 1M65A 1KB3A 1WAWA 1MUMA 1QK0A 3N6HA 3SUUA 4BFAA 3NTYA 4IG2A 5DLCA 4RXFA 4LVDA 2V5BA 3QXBA 2I16A 4AF0B 3KLLA 1ME9A 1YIXA 4I7WA 5C5YA 3WBEA 3W28A 4JYFA 2V2HA 1DOSA 4HMCA 2EF9A 3L12A 5I2UA 5MKGB 4E8GA 2V2CA 1GQJA 3VOIA 3AS1A 3ITVA 1QUMA 1MDLA 2OZ0A 2YCLA 2O9OA 3W76A 1FXQA 3PPGA 4U33A 3FSTA 3CUHA 4U5KA 3O0KA 3GW0A 3T0AA 2GVLA 3LX9A 3URQA 1EFZA 3TJIA 3V7PA 1BF6A 1EJSC 1IXQA 4C5ZA 5I77A 1ISWA 2KAUC 4B4FA 1BTMA 1JAKA 3IIOA 3LMZA 4GPNA 3A4JA 2QZRA 3QLLA 4IMCA 2Z1VA 2FB3A 1CGTA 3FCPA 3FA4A 3CMFA 4Q4OA 2OQYA 4L4LA 4Q6XA 3SR7A 4YTTA 5G2IA 1KM0A 3B9AA 1YLVA 4H41A 3FS2A 2WSQA 3HGOA 1FKXA 4MLRA 3CZ8A 3A4WA 3DESA 3SCWA 2AL1A 2C0HA 3F4VA 2DVUA 2INZA 1E6PA 3QV9A 3G1RA 2Y88A 3EA3A 4G7FA 1JRCA 3GTHA 1TMLA 4C6JA 3THCA 1NU5A 3P67A 3QFEA 3MC5A 4DELA 2X0HA 1S46A 5FCZA 4A8RA 1JVNA 1F05A 3LA4A 4D6DA 1K9TA 4B5XA 4MB1A 3BGGA 3RMEA 3LTYA 4DUVA 1EPVA 1R7AA 4C6CA 1A5LC 4QGCA 4YHEA 4MNKA 1PDYA 3WLKX 3V1PA 3ZWSA 3N14A 5K9DA 3EX3A 3D0CA 4GJIA 1XLGA 1FHUA 4WOQA 1TIMA 4LAOA 3NYZA 2ESCA 4X60A 4IPNB 3M0LA 2E25A 4P5UA 1LBLA 4J3XA 4C6BA 1BPLB 3LSCA 4WY0F 1RALA 3CHCA 3NQEA 1VFLA 2XGBA 1FP8A 2D0GA 2CLHA 3W29A 1L6FA 4H9XA 5L9FA 3MO4A 1CGYA 1POJA 3P0XA 5H91A 1X38A 1W1YA 1VEPA 3EX4A 4CNUA 3CT7A 4PMJA 3WNOA 2BG5A 2ZUVA 4JTUA 7TIMA 4TR9A 3PJWA 3RXZA 1V93A 1FWFC 4LV9A 3RO6A 5C8BB 2GK1A 4IQJA 1VYRA 2DUAA 5KMYA 1D2KA 5C9XA 2QJIA 4RDZA 3SRDA 3URNA 4L6DA 4N0RA 3BJFA 5E1QA 4LUSA 1RPXA 5FJUA 1OX6A 2J4GA 3QY6A 3MB9A 4NAEB 3BG5A 3O6AA 3DDMA 3AS3A 2J7HA 1GVYA 3HPFA 3Q4DA 1UR1A 4X9YA 2PFHA 4P8WA 5HMSA 4W7WA 2ZUSA 3FKRA 2JF6A 1C93A 4EPKA 2NWRA 3W7JA 3W9ZA 2VOTA 5K7JA 5A8QA 3R2GA 4OFCA 4GUFA 1RY0A 1DIDA 3S2NA 3T08A 4L1WA 2CZEA 1RBAA 1ZS2A 2HS8A 2A7RA 4KGLA 1OFEA 3QVQA 4ERAA 1H62A 2WMIA 1XPGA 5BYWA 4PC8A 3ZJKA 3VIOA 4D71A 3E9AA 2EPLX 5AHNA 3QH2A 3QW4B 3AWNA 3SIMA 2QJHA 3GC4A 3T78A 5HNUA 4EAYA 2NQLA 3TQ0A 3ONCA 3SN1A 4AZ6A 2DZTA 5HQEA 4UBPC 1OM0A 4RUBA 3PZIA 1XIIA 1YBQB 4XD4A 2OLHA 3HZ3A 2Z6JA 3KM8A 4Q8VA 3W38A 1AW1A 3PPFA 3B97A 2JKEA 1EQCA 4WUIA 1XLKA 4HYWA 2YIHA 1LP6A 2OYMA 2HNEA 2YYTA 4I6VA 4P7LA 4HTYA 4NQ1A 1B31A 4W87A 4GUGA 2CCRA 3PNZA 3CIVA 1A3WA 1SUXA 2PAJA 2ZBTA 2AAAA 1T8QA 1GCYA 4US6A 3ARSA 3CL8A 3KVJA 4LGXA 4O52A 1EX1A 1E70M 2OZ3A 1KFCA 5BCAA 4YPJA 2VGIA 1EJUC 1GZJA 4ZOCA 4RE4A 5AHIA 4P8VA 5K2ZA 5DFAA 1EIXA 3KVKA 2R1NA 3L4WA 1REQB 1M3UA 4N9CA 1EUAA 1YDVA 3POCA 3UESA 3V3WA 3VINA 2QS8A 3TXVA 3OOQA 4AIOA 5HWMA 3EA1A 1VHNA 4REQA 1AQMA 3F4DA 3M9YA 3RPTA 3JU2A 3PVFA 4Q4QA 2V82A 2VUYA 3SAZA 3T81A 4FSAA 2ZICA 5AYIA 5D2XA 4LCRA 3WK2A 4J2MA 4L1GA 1W54A 2WHJA 3GR7A 4X2RA 1C8YA 4AYSA 1H1NA 1E4IA 2ACRA 4H8NA 4X2PA 1JULA 1ONEA 2YL6A 3QPYA 4G8TA 2GJXA 1UH3A 1FWIC 4JHOA 4JQ2A 4RZ6A 1P0NA 4H9MA 1JCTA 4GFIA 2GJNA 4FXRA 4MWAE 1RQBA 5A6SA 4J3ZA 1S2VA 3TYAA 7XIMA 2J7DA 1B1YA 4GKLA 2PDGA 4QQ3A 3ZS4A 4UTWC 3P93A 2O55A 1XLIA 3BE7A 1P6BA 4KCVA 4HHHA 1MFVA 3P7YA 3QV7A 1KRAC 3UVAA 1QNQA 2YOCA