1C3FA

Endo-beta-n-acetylglucosaminidase h, d130n mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
b'KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c3fA00
7CGTA 1BPLB 1FH9A 4J3WA 1CGWA 5M17A 2VRQA 2WVTA 2YA0A 2A3EA 1RD6A 3BLKA 3VM5A 3BXWA 2J79A 3ZT6A 2WSPA 1CGVA 1X1NA 3ARTA 3ZMRA 1NQ6A 1W9BM 2XHYA 1G94A 1JYVA 4MAZA 1UWTA 3WY1A 3OGSA 4CCCA 3WMBA 6CGTA 3QOMA 3BAWA 2BVDA 1XSJA 5FL0A 4PSRA 2Y4SA 2VURA 2D24A 1M01A 1WDSA 5I23A 1E3XA 1W9PA 2MANA 2VMFA 1UD8A 1JAKA 5CPQA 1HX0A 3PTQA 1XH1A 2XIBA 4ZXOA 1GORA 1JGIA 3KL3A 3WH5A 5HPCA 2XUCA 5IDIA 4UFHA 4LX4A 1WZLA 2WPGA 3CZEA 3RM4A 1LF1A 4UTFA 2V3FA 2GDVA 5AC5A 5I78A 3SUVA 1W3LA 1UHVA 4JHOA 2VR5A 3HMCA 3OGVA 2VRJA 1E6XM 3D5HA 4YHGA 3FW6A 2DSKA 4ZE5A 3WUGA 3HU7A 3L2LA 2PC8A 3SCSA 1ZU8A 5A8QA 1HJWA 4KGJA 3VX0A 3I3BA 3VIPA 1TFVA 4AIUA 4H2CA 3VIMA 2WSKA 2WMFA 1HKIA 4AD1A 1EO5A 3ZJKA 1V02E 4TTUA 1E40A 2A3HA 4UQDA 5A1AA 4PRWA 4P8VA 2JF7A 3FXYA 4F9DA 3VM7A 1FP9A 3AISA 4PMRA 4XV0A 1UD4A 1HL8A 1V08A 4JZ5A 5CSYA 1YHTA 1MW0A 4D6EA 3GDBA 1W1YA 1FH7A 1ITXA 1W9UA 3POCA 2FDMA 3PZNA 1G5AA 1UOKA 2WKLA 1ITCA 3MMUA 3AS3A 4MB5A 1V6WA 4J3TA 1MQQA 3WELA 2DIEA 1FFRA 5HBFA 3AIWA 3PHAA 4XX6A 4MJ2A 2J7DA 3CBWA 2CPUA 4OOUA 1QOXA 5EMYA 3UG3A 1H41A 4CU7A 5I5RA 3VTRA 5BXSA 1QNSA 1NWUA 1E6SM 3MUY1 3K1DA 2ZUTA 1XD1A 5BCAA 4OBRA 4TUFA 4MNKA 3AHTA 4HU8A 1PZ3A 3UEQA 2D2OA 3QHNA 2XWEA 4AWEA 4PSPA 1TA3B 3ZM8A 3WQ5A 3VGDA 3ARWA 3CUHA 3RDKA 1MW3A 1OGBA 1C8QA 4WKHA 2BXZA 3FAXA 1CGTA 3WL0A 4F79A 4CVWA 3ZSSA 5HNNA 3VIFA 3WQ8A 4ACZB 4EK7A 2WVVA 1U30A 3CIVA 4JL2A 1XRVA 3WBEA 3GH5A 2QPSA 4AZIA 1JZ7A 2G3IA 3WUBA 1H4PA 5E09A 4CUCA 1OCQA 1E0XA 1GVYA 3VILA 3WD0A 1CXHA 4IPNB 5A6KA 4AZ6A 3FHQA 3CH9A 2XGBA 2DSVA 1ECEA 1NP2A 2Q8XA 3WH7A 1XCWA 5A69A 1U2YA 1KWGA 2RGMA 3N04A 2BY0A 4NRRA 4AD3A 2G4FA 2G3MA 1NH6A 1HKJA 1CLVA 1JI2A 3OLIA 4W85A 1E6RA 2XGIA 5A6LA 2CCRA 3FY1A 3NDYA 1LQ0A 1B9ZA 1CNVA 3ARRA 2HVMA 1SR0A 3F5JA 1WP6A 4JL1A 3KEHA 5A2BA 1I1WA 1Z32X 5GPRA 2EEXA 3G6LA 5JBEA 4GZIA 4D6CA 4LYQA 5HOSA 2EJ1A 3WF0A 1V3LA 3VKKA 2V5DA 3FHAA 1UZ4A 1GOWA 4J3VA 4IUGA 3CPUA 4FMVA 4Q22A 4WJXA 3L4XA 1NOWA 4P7OA 2VTFA 2CKRA 5A8NA 1A47A 4QLJA 3U5YA 3AHZA 3VGBA 1UH2A 1QW9A 4CD7A 4D1IA 1GHRA 2PF0A 1WE5A 2DDXA 3J7HA 3EMZA 3MKKA 1L8NA 2OYMA 2CHOA 2GK1A 2ZX7A 1KWKA 4LYPA 1OD8A 3CMGA 1J12A 3WF1A 1BQCA 3SUSA 3W53A 3HJEA 2OWWA 3GNRA 1E6NA 4AZ5A 1TZ7A 2FHBA 1WNOA 1WZMA 3F5KA 3M7SA 4UFLA 4M29A 4CD8A 2OSXA 2DT2A 4NRSA 2VJXA 3AROA 2VT0A 3OLDA 4HU0A 5CLWA 4FLSA 2X8RA 5ABHA 3EYPA 1CWYA 2YDQA 4PCSA 5E6ZA 2W62A 3GXMA 1BYCA 1W1PA 1X6NA 1KR1A 5FOOA 1EQCA 1JNEA 1V6VA 4Z2IA 2XG9A 2J7FA 4JIEA 4OOZA 4MAVA 3W27A 4PTVA 5DMYA 1EDQA 2WC3A 2ZWZA 4UQAA 3SCOA 2JIEA 4W5ZA 3T08A 2Y5EA 1XCXA 1BVZA 4PN2A 2J7HA 3I3EA 1DWJM 2NW0A 3WNOA 2Y2WA 3CUJA 4UFKA 4U31A 1NP0A 1J18A 5D9MA 3WBAA 2VX7A 2Z1KA 1OGSA 4AD4A 1LL7A 3EMQA 1ZS2A 2WB5A 1EDGA 3AZSA 2J74A 1PJ9A 4AD0A 3OA5A 1H0GA 4M8UA 3OLGA 2QMJA 5CGMA 2UY3A 3A4WA 3EDDA 3MSDA 4UR9A 3APGA 4IM4A 5AYIA 2YL9A 2C8NA 4M81A 3RJXA 3F5LA 1B30A 4J3UA 1UZ1A 1V0NA 4J7RA 2WCAA 2UY2A 5A8OA 4MNMA 2YLAA 4IISA 1W3HA 1JDAA 3EDEA 1QNRA 4TOQA 3ZT5A 3O2LA 1ISXA 4HA4A 1WZKA 4GINA 3PZVA 1FFQA 2XTKA 2WC4A 2NT1A 3MO4A 4P7LA 3SCPA 4GI9A 2ZUNA 4X9YA 4BA0A 2DSWA 5JIWA 2VC9A 3EDKA 2XWDA 1CXIA 3EDFA 2VX6A 2X2YA 4FF5A 5LYRA 2AMGA 4MB1A 1HVQA 1LG1A 3DECA 1KXQA 1QBAA 3BGAA 4HOWA 1EOMA 3VUPA 1WDPA 4QP0A 4DWSB 4JKLA 1ZJAA 1C91A 2W66A 4NI3A 4B9YA 2W61A 2EPKX 2WLZA 4CU6A 2O9PA 4N42A 3WL1A 3WD1A 2J75A 2J7CA 1UG6A 4IPLA 4EAMA 2PWFA 1TR1A 3I3DA 1UH4A 1AVAA 5IFPA 4AD5A 5BXRA 1EDTA 2CETA 2CXGA 4U2ZA 1CGXA 1DTUA 2D3LA 1OT2A 5I2UA 1H2JA 2ESCA 2XFYA 5BRQA 1UR9A 1J0JA 3B9EA 3W6LA 1RH9A 1V3HA 1KXTA 2PB1A 4D1JA 1VRXA 8CGTA 3KZSA 1GVIA 4HA1A 1E6PA 2D3NA 1RPKA 3RO8A 4CN6A 1V03A 3WDQA 4QAWA 4AZGA 5CSUA 1TA3A 4CKQA 1E0VA 3GNOA 3O9NA 2D0GA 4XB3A 3QHOA 1JXJA 1QI5A 3UCQA 4E4PA 1E4NA 4J28A 1NWTA 4ACZA 2PWEA 3CUGA 1A3HA 3N11A 1JDDA 3VD7A 1C7SA 2G3NA 1KBBA 1KBKA 1OM0A 3WH6A 2ZUSA 4CD6A 1E15A 3LMYA 2GK1B 4CN4A 2ZWYA 3CUFA 5M03A 1Q6GA 3PZTA 1E4MM 3GZAA 3THCA 4W89A 2J8GA 1DHKA 4AW7A 2ZUMA 2VI0A 3GTNA 2GJRA 4HA3A 1DWAM 2YL5A 4C7FA 3IJ7A 2WW5A 5EFFA 4DWSC 4PMOA 4D6HA 1JYXA 1YQ2A 2WCSA 1UD3A 2G8ZA 3DHUA 3DHPA 3KL0A 3IAQA 3UR8A 3AZTA 4JKMA 2BV9A 2PWGA 1AQHA 1QI4A 3M46A 1ISWA 1JIBA 4B16A 4RE2A 3WNNA 4PCTA 4AEEA 4U5IA 4MJ4A 3W6MA 4W86A 2O92A 5CXPA 3RM8A 4GI6A 2J8FA 2O9TA 4P7QA 2XVGA 3GXFA 2CBUA 5AC4A 1EGZA 2WANA 1GW1A 4E8CA 2OWCA 1TVPA 1V02A 1V3KA 3AMCA 5EBAA 2ZUVA 2G41A 2XYLA 3GH4A 3WF2A 4W93A 1XYZA 1G1YA 2ZE0A 3ARSA 3DC0A 3VIIA 3SCNA 1G01A 1LL6A 1TVNA 3G6MA 3PZIA 1JZ3A 1BF2A 4MTVA 2FHFA 1W1VA 1UWSA 1IT0A 1GQJA 2IUZA 2TAAA 1CENA 4V2XA 2WZEA 4XUYA 4HPHA 1K6AA 2BY1A 2VCAA 1LWJA 3UERA 4P7NA 4PEEA 2QMKA 1ODUA 3AHXA 4EE9A 2BS9A 2EXOA 4FK9A 2XVNA 1C7TA 3GM8A 3RM9A 1QNPA 4PMQA 4LPCA 3CZJA 4S3JA 3SCUA 5I6SA 4OIFA 2EBNA 1E55A 2GFTA 4GZJA 4P8WA 4UZUA 5FD0A 1W9VA 4GI8A 1QHZA 2A3AA 2WWDA 2BHUA 2JIWA 2VZVA 4LGXA 3K4DA 3FNDA 3ARPA 3RPMA 3BAYA 3AYRA 3W38A 5FKYA 4BS0A 1G0CA 1O6IA 2QPUA 4GIAA 1QNOA 1W2VA 2XIIA 1JYNA 4UQEA 1J11A 2BVYA 3VGEA 1EHAA 3TTSA 1VJZA 1KFWA 4M1RA 1X6LA 2WCGA 4JKKA 1UKQA 4Z2HA 5D9PA 1BYBA 1GJUA 5E0CA 3WKZA 4C7DA 4AC1X 4OJYA 5BXPA 4W84A 1E3ZA 1BYDA 1UWUA 3PTKA 3A3HA 4JFUA 4Z2KA 7TAAA 5A6MA 2UWFA 3W26A 4GO9A 2BHZA 4U3CA 1JAEA 3ECQA 2G3JA 1UD6A 2V38A 5DFAA 4E8DA 3BCDA 1JD9A 4QCFA 3WEZA 5I79A 4PYSA 5AY7A 1HJQA 4TX6A 3CZLA 3UESA 4Z2GA 1JZ8A 3WF3A 1UKOA 1UKSA 2NT0A 5JIPA 1HKMA 2VCBA 2YLLA 3N12A 4AZ7A 3L4UA 4B9ZA 2WZHA 5E6YA 3PZGA 2UY4A 4AY1A 1W2PA 1XSKA 1QHPA 4BF7A 3FAWA 5IHSA 4WIWA 3VIJA 2WHJA 1JZ2A 3WNPA 2DQXA 3NSXA 2VZSA 2CITA 3KL5A 1XV8A 5I24A 2QF8A 3WNMA 3POHA 3MV01 1XD0A 1NWRA 1LLOA 1HJUA 2W4XA 4MDPA 3NYDA 3WF4A 2PBGA 1E0WA 1EHNA 4DWSA 5LA1A 4P8UA 1PEZA 4K68A 1J0KA 4XZWA 5DT7A 3TTYA 3AHYA 1AQMA 4PMXA 3K8LA 3ZT7A 1W3JA 1AQ0A 4OBSA 1F4HA 2GVYA 1CXKA 5HDRA 2XFRA 5HPOA 1JYWA 1ISZA 1E5JA 3K4AA 4ZE4A 1VF8A 3VINA 1UQYA 1ISYA 4KWUA 1K9DA 1MVYA 3CHDA 3VGFA 1DEDA 2VZUA 3N13A 5CJ5A 1FHLA 1UR0A 3QR3A 2V3EA 3WNKA 4WLCA 2A3BA 1V6UA 2CBJA 3SCRA 1JG9A 4HOZA 2XM2A 2RGLA 1Q6CA 2IXVA 1VFUA 1W1TA 1KQZA 2JFEX 1VAHA 4AIEA 1BGGA 2D23A 3UR7A 1E43A 3W4RA 4DWSD 4ACYA 1OD0A 2GDUA 1M53A 1JL8A 4B15A 1TMQA 4W5UA 1VJSA 1D3CA 2W67A 3WD4A 3ZR5A 4U33A 1KQYA 3AMKA 2E8YA 5I77A 3PZOA 3ARXA 2ZX5A 3IJ9A 1B0IA 2DSZA 2DT0A 3NDZA 1B3ZA 2W63A 4FLRA 3ZIZA 2IXUA 3CZKA 1OGGA 3AS1A 1QVBA 1WDQA 1EA9C 4D6JA 3GBDA 2VVSA 3AXIA 4UQ9A 5I0DA 1K9FA 1NOUA 4GZEA 1MQRA 1KXHA 3L4YA 3VIKA 2CHNA 1CXLA 4F9JA 3MMWA 2J62A 2ZUUA 2W5FA 3PZMA 1TUXA 1ZBVA 3AMDA 4URIA 4QFUA 4JAWA 2CYGA 1P6WA 2Y24A 1B90A 5KEZA 4ZFMA 3SURA 4A3YA 2VQUA 3T09A 5BROA 2WVSA 2WVUA 3AIQA 1QI0A 4H41A 5FL1A 3TTOA 4GKLA 1LJYA 4H8HA 4QLLA 5I3DA 1E4LA 3WQ4A 4OKDA 3WDRA 3THDA 1XH2A 1HNYA 1V3IA 3VGGA 3EDJA 4QCEA 1Q4NX 3IJ8A 5GQBA 3SIMA 1BLIA 3ALFA 3L4VA 5C70A 3NSMA 1UD2A 1PBGA 2ZX6A 4CN1A 1EOKA 1B2YA 1F4AA 5IFTA 1MWOA 9CGTA 3CTTA 1CBGA 2VZOA 4BQ5A 1MYRA 5BXTA 1JDCA 4ZEPA 4AMCA 1E70M 5CG0A 4MB3A 3AICA 3GXDA 4M82A 1R8LA 8A3HA 4MDOA 1Q6DA 3CO4A 2DH3A 3NUKA 4HZ7A 4B3KA 3DYMA 3BH4A 5A94A 4KRUA 4PMZA 1ZBCA 1SMAA 2JEPA 1VEMA 3W81A 5IXEA 3BCFA 1NOFA 2VRKA 1VEPA 1R7AA 2J7BA 5C71A 2WMIB 3MSGA 3II1A 1BYAA 4MADA 1XC6A 2WM0A 2BY3A 1HJVA 3MU7A 3ARVA 3AQUA 2NSXA 3T2OA 1NM9A 3VDHA 4YN5A 2V3DA 3S2CA 3CGTA 3VIHA 4TTGA 1MFVA 1UR1A 1HF6A 1UUQA 1UKPA 2XVLA 3AFBA 3ARYA 1U33A 1Q6EA 1E72M 1XHGA 1QI2A 2GJXB 4UQBA 3ZOAA 2WAGA 3ALGA 2YIHA 3VO0A 1V3MA 3CUIA 3BAJA 1VIWA 1AMYA 1V0KA 3OB8A 3VPLA 2X0YA 1JI1A 1QBBA 1SMDA 3VDAA 4UCFA 4HZ6A 1HL9A 1WKYA 5A2CA 4BQ3A 2WLYA 1MXGA 4PMVA 2PBOA 3MANA 2CERA 2B31A 4AYSA 4KRTA 2BXYA 2J7GA 1DWFM 4R5EA 1O7AA 5ABFB 1CEOA 1WAWA 4ZENA 1BAGA 1MQPA 2YKKA 2CKSA 1C90A 1XGZA 4BZYA 4WF7A 5ABGA 1UD5A 4QLKA 3OZPA 2W92A 4TVDA 1VBRA 1E73M 3WDJA 3N17A 5JBFA 1B31A 1FHDA 4H7VA 1FH8A 3L4TA 2D0FA 2DSUA 1QW8A 1EO7A 4MNLA 3K46A 3QHMA 2C0HA 2YA2A 5KZ6A 2D1ZA 2ZOXA 1CZ1A 5C8BB 1HXJA 4H8UA 4N0RA 5A3HA 1JZ4A 1WPCA 3AYSA 4JHZA 4J27A 1R87A 4ATWA 1GOMA 1OBAA 2DT1A 1VB9A 5CZKA 2YDRA 2DGAA 4H04A 2J25A 4J3SA 1JFXA 4KGLA 4AZCB 2E3ZA 1UQZA 4GQRA 2PI6A 3VX1A 2PWHA 2WMGA 3L2MA 4PTWA 3A6OA 1H3GA 5EB8A 6TAAA 4DUXA 4PMDA 1UWRA 2WMKA 1UH3A 3ZR6A 1J0YA 2YOCA 2J77A 2YL6A 4HMEA 2OWXA 3ZJ6A 1KCKA 3PZUA 3WQVA 3WDPP 1KXVA 4ATDA 1EH9A 2OYKA 1FA2A 4W8LA 2WXDM 1E4IA 3M07A 2WK2A 5EFDA 3U7VA 5A6AA 1OWQA 5D4YA 4P8XA 5CPTA 3UG5A 3U7BA 1VEOA 3LPGA 3PZ9A 4HP5A 4NSBA 1LL4A 1VFOA 3VDCA 3VMNA 1J01A 1KB3A 2YDSA 3AIVA 3BAXA 1J0IA 3W25A 4QDMA 3AIEA 4WKFA 2FGLA 2ZXAA 1C92A 2W91A 1GJWA 1C8XA 1GPFA 2J4GA 5BYWA 2XVKA 3WDIA 3PN8A 3SUUA 3N1AA 4FLOA 1ESWA 4AEFA 3RJYA 2J78A 1D2KA 1DWIM 1UR8A 3QGVA 4JFWA 2JE8A 3DYOA 4JCLA 3MUAA 4ML4A 2GJPA 4KMQA 5BRPA 1H5VA 3LPFA 5DT5A 4PUEA 2F61A 4X0NA 3BAIA 1BHGA 2WHKA 4UZSA 3T2QA 5D9OA 1W9DM 2GSJA 2VZTA 2WC7A 3N15A 3B8SA 4P7RA 1BTCA 1BG4A 4LXFA 1JD7A 1EXPA 4HPGA 2OSYA 2X05A 1ODZA 4JCMA 2C7FA 4F8XA 4W8AA 1UYQA 4PTMA 3WENA 2CBIA 5JUVA 4PUDA 1ZJBA 1K9TA 3NCOA 4TVUA 4WK9A 3JUGA 1CYGA 1ISVA 3W82A 4W7UA 3ARZA 1H09A 1B3VA 3WMSA 1VFFA 4DM2A 1VENA 4UFIA 1UWIA 1PX3A 1B3XA 4OUEA 1KR0A 1LG2A 4TXEA 1RP9A 4WSKA 1G9HA 2EPMX 5E0FA 2ZX9A 4WSJA 3WEOA 4V28A 1GOKA 2WMJA 1C8YA 3BLPX 1DP0A 3UETA 4RE4A 1E56A 1H1NA 5CGTA 1H49A 3VD5A 3RMEA 4CD5A 2Y8VA 3WUEA 3ARQA 2DIJA 2WZIA 1DWHM 2XFFA 3BSHA 5JBDA 7A3HA 1XH0A 2XSBA 1WDRA 3BSGA 1HVXA 5CQ1A 3L4ZA 1ZL1A 2V5CA 3CHFA 3TONA 1CXFA 4LQ1A 1HP4A 3ZSTA 4E2OA 2J47A 3F4VA 2YA1A 1MW2A 1J10A 1FP8A 1WZAA 3WMCA 2BY2A 3D3AA 1CPUA 4V27A 4Z2JA 2BFGA 3N9KA 1B3YA 1OINA 1HIZA 2F8QA 2WHMA 3B9DA 5D9NA 1QPKA 3BAKA 3KWXA 4CVUA 2WNWA 5AYBA 3U5UA 2ZXQA 5A8MA 4OZOA 1E5NA 3T0DA 1H11A 2WMIA 2QHAA 4CU8A 1GQKA 1GQIA 2CEQA 3WD3A 2DEPA 3CLWA 2FHCA 3AMLA 2O9OA 2CIPA 1VBUA 3T0AA 3TA9A 1PAMA 1MXDA 2XM1A 1KGUA 4HTYA 3NJ3A 1SFSA 1D7FA 2GJXA 3VNZA 1WCGA 5LA0A 4H8VA 3MUZ1 4F66A 1R86A 4XZBA 3A4XA 5HXMA 1OSEA 1KGXA 2WBKA 1E6QM 3K8MA 1J0HA 3IANA 1B3WA 1M04A 1FOBA 1M7XA 4KH2A 1UKTA 4W7VA 2WKGA 4HMCA 3WSUA 4TX8A 2CBVA 3IAPA 4MNJA 3VIOA 5ABFA 3QOKA 1KGWA 1V0MA 2ZX8A 4LYRA 1GOQA 3ZO9A 3M6DA 2D0HA 1BG9A 3SEPA 3KE0A 1XSIA 2WYSA 1JXKA 2PWDA 5A6JA 4CCDA 5A6BA 5IHRA 1I1XA 4CCEA 3CMJA 3OLEA 3OGRA 4J3XA 4AD2A 3BC9A 1ZBWA 2J7EA 2UY5A 5ECUA 1HJXA 2GUYA 2YBUA 4D71A 3MV11 3GNPA 3AIRA 2BNJA 2EPNA 2YBTA 4TVCA 3NSNA 3SCQA 2DPEA 1PIGA 3CHEA 4YPJA 4BCEA 1E1FA 4BQ4A 1QI3A 1V3JA 4RL3A 1GQLA 3WQWA 1NARA 2QLYA 5A2AA 3SUWA 1VFMA 2EQDA 4D72A 2V3GA 1EIBA 3W0KA 1L0PA 2E0PA 1PX4A 2DT3A 1BFNA 2E9LA 4AZCA 2XJ7A 3WFZA 2JALA 1NWSA 5E70A 3TTQA 3SUTA 5FCZA 2FH8A 1E1EA 3CZ8A 4C7GA 5DF0A 3CHCA 5A6BD 1M03A 3EMCA 5A6SA 1IV8A 1W9XA 1SYTA 4AXNA 2CESA 3OIHA 2E9BA 2XVPA 2VUYA 2YL8A 3AXHA 3OG2A 2AAAA 5D8ZA 3RILA 2OYLA 3L4WA 2FGZA 2WBGA 1PPIA 3AOFA 1GZJA 1UWQA 3VOCA 1W32A 3VD3A 4JFSA 3ZQ9A 1V0LA 3T2PA 1ZB5A 3LPPA 3BMWA 5CLTA 2ZIDA 5LA2A 3AS0A 4EKJA 2EPLX 4GPNA 4Z2LA 2FH6A 3TP4A 4U5KA 3TOPA 1HN1A 3WQ6A 4UOQA 4D6FA 3AXXA 2E40A 2VOTA 3ARUA 4M24A 1OB0A 2CNCA 4Y7EA 2VQTA 2VX4A 1HT6A 2VL4A 5DEZA 2X0HA 1W91A 1TG7A 4CGTA 3PBGA 4W87A 3CZGA 3BMVA 3IK2A 3W24A 4GXPA 1MFUA 1Y7VA 1C93A 3WD2A 4A4AA 3RCNA 2WHLA 3W28A 2BVTA 1JZ5A 3WIJA 4PMUA 1GOIA 4M56A 3VNYA 1CECA 1V6YA 5A95A 3S6TA 3A47A 3WUFA 1E71M 3T0BA 4D6IA 2ZXDA 2A3CA 1GUVA 1C3FA 1OIMA 2E8ZA 2X1IA 3N18A 1Q6FA 4NF7A 4D6DA 1R85A 3VIGA 4JFVA 5GNZA 1JNDA 3AIUA 2O9RA 5M5DA 5M3WA 4Q7NA 4U2YA 3AJ7A 1PIFA 2ZXBA 1PZ2A 4JFTA 2Z1SA 4DUVA 3VU2A 3VDBA 1J0ZA 4HZ8A 1UA3A 3GXIA 2YJQA 3AZRA 3RIKA 2DH2A 2VVNA 1BGAA 1GOOA 2ZUWA 2D20A 4FLQA 4MB4A 1W3KA 3A4AA 4L4OA 1DWGM 3AHVA 1IZKA 4D6GA 5DO8A 4AZHA 2WVVB 5TD4A 1JZ6A 3OZOA 3WH9A 2VR4A 1CIUA 2ZICA 4EANA 6A3HA 4UOJA 1OT1A 4W88A 1UA7A 4X0VA 2E9MA 3UG4A 3VGHA 2VCCA 4PBGA 3K8KA 3VD4A 3HN3A 1HKKA 3NIYA 1WO2A 4GO8A 4PMYA 1GONA 5BWFA 3VD9A 2HISA 3DYPA 4ZXLA 1RP8A 1MW1A 3AMGA 3W37A 4W7WA 1K9EA 3PTMA 4R27A 2JEQA 2EPOA 2JF6A 4YHEA 3AI0A 3AS2A 5GNYA 1JF5A 1HJSA 4PTXA 2D22A 3U57A 3EBVA 2OSWA 2VNCA 1V6XA 1CGYA 1WB0A 3MUIA 3MMDA 1OIFA 3SCTA 4DUWA 1R7OA 4DM1A 1IZJA 3SCWA 1CGUA 3VVGA 1QNQA 3AIBA 2VX5A 3GH7A 4ATLA 1S46A 4UNIA 1TCMA 1H0IA 1UR2A 2VO5A 3WEMA 1I75A 4A3HA 3O6AA 4GQQA 3VMOA 4BQ2A 1CXEA 3WDHA 4AISA 4UFMA 2WMHA 4AZBA 4CD4A 4S3KA 4HMDA 1JF6A 1KCLA 1CDGA 1US3A 1BVNP 1ZBKA 2OLHA 4B3LA 5A8PA 2Y8KA 3OBAA 1LWHA 4W8BA 1TE1A 1CTNA 1JFHA 5FIPA 1US2A 3ZJ7A 1GHSA 3PZQA 5CPSA 1J9YA 3FN9A 1BSIA 4AIOA 4NZCA 5E9AA 5ABEA 3WH8A 4UQCA 2E4TA 3VMPA 1EQPA 3WFLA 4UOZA 4UFJA 3SCVA 2QV4A 3B9AA 2XSAA 3W29A 4HOXA 3WN6A 3LPOA 1QHOA 1GNXA 1B1YA 2XPKA 2BHYA 1N82A 3GBEA 2WWCA 1XYFA 3GYCA 3MS8A 2EO7A 1UR4A 4RE3A 4L4PA 5F7UA 1PX8A 5D8WA 1HP5A 4M80A 1CLXA 4MPKA 2X09A 4WKAA 4U3AA 3E1F1 5GNXA 2AOSA 4PMNA 1GCYA 1E9LA 2F2HA 1E6ZA 3ZJ8A 3WNLA
chains in the Genus database with same CATH superfamily
2HK1A 1BPLB 1F6PA 4J3WA 1CGWA 3TYEA 5M17A 1OX4A 2YA0A 4DX3A 2GGEA 1RD6A 1XX1A 3VM5A 5ABTA 3ZT6A 1X1NA 3NOYA 5AVNA 1NQ6A 2XHYA 4WQ6A 1G94A 2QS8A 4K2SA 4ZCWA 3VAVA 2DVTA 3T9PA 4HCLA 3BAWA 1XSJA 1VYPX 2D24A 2GL5A 1A0CA 1WDSA 5I23A 2G3FA 2MANA 1P0KA 2VMFA 1O5RA 4DJEA 1UD8A 1JAKA 4IJCA 3VABA 3PTQA 1Z89A 4ZXOA 2XIBA 5MKGB 3G1VA 4C6QA 3UZXA 3KL3A 4PA8A 3WH5A 5IDIA 4CCZA 3Q65A 1SW0A 3RM4A 4NQ1A 2HS8A 5I78A 3SUVA 4OFCA 1MUMA 3CM4A 4AX7A 4GK8A 1S5MA 3HGSA 1CT5A 2JBMA 5EMUA 2VRJA 3M0HA 4Q33A 3SSZA 4YHGA 1MZHA 1W1A1 5CPLA 4ZE5A 3HU7A 3S2NA 3SGUA 2Z28A 5A8QA 4CNSA 3F7JA 2DZAA 2XH2A 2WSKA 2WMFA 4AD1A 2Z2BA 1V02E 4I9AA 3NXLA 1XJBA 1UD4A 1JCMP 3TDFA 4JZ5A 4D6EA 1VZWA 2Q8LA 1FH7A 4O17A 3ATZA 2DZBA 1W9UA 2YCIX 3POCA 2FDMA 1VHNA 3GNNA 5CGQA 2H3BA 1FCUA 3GO2A 4MB5A 1ALDA 3CL8A 1GYLA 3W85A 1JPHA 4YWSA 3KVKA 1XIEA 4HCDA 3NDOA 1P6BA 3CBWA 5H2ZA 1E6SM 1FWWA 3OIXA 4XK2A 3NTYA 4XWUA 3IRSA 3WK3A 3NQBA 4MNKA 3UEQA 3O07A 5ENLA 3QHNA 4UMCA 1OFEA 2PU1A 1QOQA 1F6YA 3WQ5A 4A05A 2O4MA 2Z25A 1PHWA 4F79A 4DQWA 3O8AA 4XKYB 5HNNA 3VIFA 4EK7A 1XRVA 1JDEA 1ADOA 2JGYA 4GCAA 2ZVIA 4AZIA 4NL1A 3O3RA 1H4PA 5E09A 1RZMA 4ZA0A 1JQVA 4QNEA 5A6KA 4X2PA 2POZA 3C5QA 1UBSA 3CH9A 2DSVA 2GGHA 1QNVA 3ZWSA 3I65A 2RGMA 3FYOA 4NRRA 3E38A 1ZJIA 4LCSA 2O0TA 4HU4A 1SUXA 1ONRA 1GVEA 1HKJA 3H2MA 3KBVA 4W85A 2ZQ0A 3FY1A 3MUXA 3TAKA 1FWJC 1CNVA 1YTEA 3F5JA 2OZ8A 1WBHA 3MUCA 1LP6A 2A79A 3DFQA 3SADA 3GRIA 1I1WA 3G6LA 4GZIA 4D6CA 4JTEA 4PUJA 3FJLA 3WLTA 2R94A 2CHRA 2IQDA 4LEFA 4J3VA 3GNXA 4FMVA 1Q8JA 4WJXA 2O7QA 4R88A 1NOWA 2Y62A 4J1OA 2CKRA 1AJ2A 4QQ3A 3VGBA 1QK2A 5HR7A 3G2GA 3J7HA 2YXGA 4ZR8A 2W0UA 3W7OA 1XW8A 3I6EA 1KWKA 1XDMA 4A3QA 3LGEA 3CMGA 2ABAA 1BQCA 4C91A 3V1HA 3MTWA 2OCZA 3O06A 3ITXA 2OSXA 2DT2A 3S3GA 3XISA 2MUCA 2VT0A 3UP8A 2PGEA 1WOAA 3CK5A 4L9XA 3RXZA 3IGHX 1XQKA 1XIHA 3P62A 1RJPA 2G5WA 3UJFA 1A3XA 5JH1A 1BYCA 3RX4A 1W1PA 3PB2A 1X6NA 1KR1A 3GHRA 3NR0A 1JNEA 1GG0A 4R53A 4C6CA 4MWAC 5CC5A 4I6VA 4OOZA 3LLDA 1CB7B 3R79A 2QJMA 1XPYA 3SCOA 5J04A 1VIZA 3PPFA 4W5ZA 5I09A 1XCXA 4S3FA 2YZ5A 4Q32A 1Z48A 4PN2A 2J7HA 4QSFA 4RR4A 2ZZ6A 1J18A 1D9EA 3WBAA 1OGSA 1JUBA 3TX9A 7ODCA 4X3ZA 1VD6A 3N6QA 4O54A 4Y9OA 1H0GA 1YPXA 4JYFA 4U28A 4AG0A 5CGMA 3EDDA 2ZA3A 3LMZA 4BWLC 3APGA 4IM4A 4JBRA 3H2NA 1HTIA 2IKGA 4DVOA 4UTHA 3NM3A 3RJXA 4N4PA 2PDXA 2V82A 4DJFA 3WMLA 3S1GA 1B30A 3CV1A 3KCOA 5DCDA 4J7RA 2WCAA 4MNMA 4AY8A 2YLAA 3A3WA 3W23A 1W3HA 1JDAA 3RMJA 3EDEA 1QNRA 5KZMA 4X22A 4TOQA 3ZT5A 1X39A 2XZ7A 4HA4A 2OQLA 3I68A 1BKSA 1I9CB 3MO4A 5C2GA 2CZVA 2YXOA 3SCPA 1Z42A 4IL2A 1NELA 2YXXA 4X9YA 3P6LA 1SJBA 2NWSA 2V81A 1A49A 3IJQA 3LBOA 3FSUA 1A0EA 2XWDA 1CXIA 1XLMA 4FF5A 1MEHA 5K7JA 3M0YA 1H62A 2AMGA 3G22A 4O15A 4XD5A 1KXQA 3ITYA 3TLLA 3E9AA 1O5QA 3VUPA 1ZZMA 4ICMA 4DWSB 2HE8A 3ITTA 2W61A 2WLZA 2FZ8A 3SN4A 4FI4A 4Q8OA 5G1TA 2OKTA 4DBWA 3R10A 2D2HA 4IPLA 2G97A 1TR1A 1UH4A 1EDTA 2PRMA 1CGXA 5I2UA 4IG2B 5BNKA 2ESCA 4RDVA 3B9EA 1KV5A 5E93A 4D1JA 2P3EA 2RDXA 1X7IA 1XR2A 2AKMA 4O0QA 4ILSA 4AZGA 3R7MA 2ZYFA 2YDAA 3E5BA 3GNOA 2D0GA 3H4GA 5LSMA 4O16A 1OCNA 2PTZA 3OEXA 4Z17A 3VA8A 4ACZA 4JPGA 3V16A 1FBAA 4EPKA 3CUGA 2OQHA 3N11A 3NO5A 3VD7A 1OM0A 3JRKA 3WH6A 3VZXA 3KOZA 1E15A 1E9IA 1YPIA 2ISWA 2QJNA 5I3HA 1EC9A 4WOQA 4AW7A 1IEXA 1KFJA 1DWAM 1UP3A 3S5ZA 1TREA 3BLOA 3IJ7A 1W54A 3MBFA 3E6EA 4LAOA 4KEZA 2WCSA 1A53A 2G8ZA 4NU7A 1BWKA 2HZGA 4JIIX 1TWSA 1IQ8A 3AZTA 3O6DA 4IL0A 4JKMA 1ZALA 1F61A 3SBFA 3B97A 3UY8A 1MDLA 5F2GA 5AC8A 3RF9A 4PCTA 3CV7A 4FOUA 4K7VA 3W6MA 4Q8UA 3RM8A 2O9TA 2EAWA 4LRSA 3E2VA 5AC4A 2WANA 4E8CA 4QJ4B 4LVFA 5AOUA 3AMCA 2QJIA 3GH4A 3E74A 4LYKA 1RQHA 1GGOA 1NU5A 1NSJA 4Q6XA 4QAIA 3ARSA 1JGMA 3WG6A 2ZRZA 1DXIA 3SCNA 2PDCA 3W1QA 3GFXA 1TVNA 3G6MA 2QCDA 1XIFA 4FOKA 4JXCA 1W1VA 4H7ZA 5AYXA 3ZZ1A 1IT0A 2PTYA 5BMWA 1K6AA 3LG3A 2BY1A 3G24A 4GJIA 1L6FA 3STPA 3KOFA 4EE9A 3WLJA 2CLMA 2QDHA 2XVNA 3KCJA 4MWAE 3QSTA 3S6OA 2AQVA 3OBEA 3L5MA 2GFTA 4P8WA 1HO4A 1K70A 4PRTA 3VOGA 3K4DA 1PE1A 1OC7A 4JQ4A 3RPMA 1SZEA 3AYRA 4N7QA 2WQDA 5HAOA 1O6IA 4LBRA 3KS6A 2ALRA 1W2VA 4AHPA 4JNYA 4GFIA 1FWBC 1JYNA 1RHCA 2PMQA 4LV9A 4GZ7A 4HA0A 3TTSA 1SO5A 4M1RA 3GHSA 4OBTA 1KBLA 4Z2HA 5D9PA 1BYBA 1GJUA 1YE4A 4C7DA 3DH7A 3JZEA 1E3ZA 3TQPA 3WLSA 2KAUC 3DDMA 4HHPA 1QMLA 3W26A 1UROA 4GO9A 2BHZA 4U3CA 1UD6A 4S1FA 1Q2RA 5I79A 5H8UA 4PYSA 3OVGA 3GS6A 1VYRA 3ELFA 4PL1A 3IJ6A 3WF3A 5JIPA 2XINA 1HKMA 1Y5WA 3EA2A 2PA6A 3L4UA 5TAOA 2OXNA 4MY1A 1XLEA 4B9ZA 2WZHA 2AL2B 1XSKA 1YXYA 2NX1A 1QHPA 4BF7A 3GXTA 4JIQA 4DLFA 2WHJA 1OYAA 1QPOA 2DQXA 4ZZ9A 1EJSC 1P6CA 3KL5A 1PTAA 3ITLA 1FVPA 3MV01 1OJXA 3T4CA 3ME3A 3SI9A 3UJ2A 1HKWA 1LLOA 4AUBA 1Y8BA 4GYJA 3NYDA 2VUNA 2F84A 4IP7A 4C6PA 1J0KA 4XZWA 4YJ5A 3MCNA 1EX1A 4NJIA 4N9CA 3NWRA 5E1QA 5HPOA 4ZE4A 1UQYA 4UTJA 3FJ6A 4HYRA 4GH3A 1FHLA 3W1XA 4UXDA 1PKMA 3PNUA 2HK0A 1JG9A 4LVAA 2BZNA 2RGLA 4WUIA 1W1TA 1NDYA 1KQZA 4O1DA 1L2UA 2PP1A 2Q71A 2WM1A 3MB9A 1BGGA 1XBXA 1GG1A 1XM3A 1QO5A 1E43A 1DIKA 4DWSD 3GWQA 4XVEA 1OD0A 3N3TA 3QV7A 1UMYA 2J6VA 4NZFA 3HG4A 5LIYX 1WUFA 2GPTA 3ZR5A 4U33A 2PAJA 1W0MA 4DI8A 4RZ5A 2QCDB 3KBNA 2OVLA 3QR1A 2C1HA 2DSZA 2DT0A 4RXGA 3BJSA 1TQJA 4S3EA 3ZIZA 1QR7A 3HPFA 1DJQA 1KLZA 1OGGA 2ZC8A 1RCXB 1QVBA 1EA9C 4D6JA 1BEUA 3GBDA 4IZGA 1J2BA 3AXIA 3B9NA 2UBPC 3NXFA 1K9FA 1V7AA 2VWSA 3ANYA 1DE5A 2VGFA 2ZUUA 4QE4A 3PZMA 1TUXA 2VKZG 4JAWA 2CYGA 3R8GA 2Y24A 5M2FX 1B90A 5KEZA 3PBYA 2HXUA 4E2VA 5BROA 2WVSA 4G6CA 3AIQA 1QI0A 3BGGA 4H41A 3CAKA 3TTOA 3PWIA 1LJYA 4H8HA 5HWNA 1OC6A 5I3DA 1YADA 1PHQA 3DESA 1J6PA 4OKDA 4PE8A 3K13A 3RHGA 1VBJA 4FHAA 3W7MA 2PGFA 2W3ZA 4NNBA 3KP1A 2A7NA 3WLPA 1WXJA 3B0PA 3MP3A 5C70A 4GNJA 2ZRYA 3QN3A 4CN1A 1NQKA 4HSNA 1F2JA 4MJMA 3MJYA 4I7UA 3TYBA 4JTCA 2PLJA 4PRRA 2VZOA 3PSWA 4XAZA 4BQ5A 1MYRA 1TPB1 2W79A 4F2UA 5HMSA 4ZEPA 4CEUC 5CG0A 2ODOA 1XUUA 4B5XA 3PUGA 3GXDA 1I60A 1Q6DA 2OO6A 4ADUA 3E3HA 3NUKA 3K2GA 4G7EB 3EXSA 1SO4A 1OFDA 1VEMA 2CLFA 4FNPA 3BCFA 1P7TA 3PAOA 3I7RA 1XL9A 4C1NA 1OZMA 3DFOA 3IARA 1A4MA 1AL8A 4MADA 3V18A 3IPWA 3DX5A 4DZ5A 2PLKA 3UZZA 1XYMA 3T2OA 3M0VA 3VDHA 2D73A 2VEIA 4YN5A 2OMAA 3VIHA 1P0EA 2OGYA 4R7JA 1UKPA 3R0UA 4LALA 5XINA 5EMLA 2O4QA 3AFBA 3RG6A 1U33A 3GLCA 4D8ZA 1QI2A 1US0A 2WZMA 4DJDC 2ACRA 3KM8A 3ZOAA 2WAGA 1KRBC 3QV6A 1WYIA 3OU8A 5TQLA 3BAJA 1RBAA 4LS2A 2PP0A 2NQ9A 1V0KA 3D3FA 4Q8VA 3PJXA 4US5D 3UXIA 3IIPA 3PUEA 3T55A 3RYSA 3VDAA 3FSTA 4UCFA 1EJRC 4NUWA 1HL9A 1H1YA 2WSRA 5A2CA 2CERA 1O7AA 2V30A 1CEOA 1WAWA 1QATA 4HPJA 3CV2A 3UWZA 1XLLA 1T0OA 1C90A 1XGZA 4UR8A 4WF7A 4QLKA 3PANA 3TVAA 2W92A 4WGXA 4TVDA 1VBRA 4H3DA 1FHDA 1R0MA 1Z3NA 1QW8A 2D0FA 5E0KA 3GNDA 5C2CA 4C6LA 1XIBA 4IP5A 4N0RA 2F6XA 1JZ4A 4NZ4A 5HQEA 3A22A 3Q4DA 1SO3A 2DT1A 4JTGA 4GUFA 3LXBA 1JFXA 3E2RA 1ECQA 3NGFA 3L68A 1GEQA 2DY3A 3C52A 4PTWA 3FA5A 6TAAA 3W1LA 1VYSX 1G4TA 3C8NA 1F5ZA 3QV8A 1J0YA 2W9MA 2DIKA 2J77A 3MYOA 1R9ZA 4HMEA 1XIJA 4MZ8A 4KIRA 3WQFA 5AHLA 4AMAA 2PDKA 4MY9A 3ES8A 1A5LC 4JNMA 4XO6A 3GVWA 2WXDM 2DORA 4K8GA 4ERAA 3WQDA 3HMJG 3U7VA 2WK2A 3PJUA 4NSBA 4HP5A 2FQIA 3T6CA 3VMNA 4H9UA 3APTA 3STFA 2R6OA 5XIAA 4QDMA 2Z2UA 5AHNA 4PB5A 3K5XA 1QDSA 2J88A 2ZXAA 1C92A 2Z2AA 3NQ7A 5BYWA 3VCCA 4XSMA 3NQEA 2QYGA 2XVKA 1EYEA 4IICA 3SUUA 1KM1A 4FLOA 4JY8A 1ESWA 4C6JA 2J78A 1D2KA 2NV2A 3NQFA 1UR8A 5D2YA 1H5VA 4PUEA 4GNKB 5E5CA 1BHGA 2WHKA 1W9DM 2GSJA 4FALA 1TJPA 4QS5A 4FEZA 2OSYA 1KKRA 1ODZA 2C14A 3K30A 1UYQA 2GJLA 3TJIA 3LCLA 3DCPA 4PTMA 4Y96A 3OZMA 4PEKA 1P7TB 3V35A 4ZQRA 3RITA 1XRFA 3HO8A 3DKJA 3ARZA 1H09A 4MYAA 3GDTA 1VFFA 4DM2A 5HNTA 4LW7A 3UWYA 3W01A 1SJDA 1SO6A 4QJ1A 1KR0A 5T8GA 5HANA 5E0FA 2ZX9A 2PDHA 3WEOA 1PKYA 1JDFA 1WBJA 4V28A 2ATSA 4RE4A 1E56A 1H1NA 4YLWA 1H49A 2NLIA 3KCLA 1GT8A 3RMEA 4CD5A 1FY6A 1N2VA 1R30A 2YCLB 2GSHA 2XN1A 2E09A 1OF6A 2RHGA 3UPBA 4M51A 3L5AA 4WR3A 1B57A 4UTWA 3L4ZA 2V5CA 3CWOX 1XGDA 1S2VA 1CXFA 3S1WA 1JQXA 5FJOA 3F4VA 1WKEA 3FA3A 4LAMA 2Y1HA 5G1MA 2X1SA 2BY2A 4V27A 1ENUA 2BFGA 3R58A 3G3DA 2FZ9A 1HIZA 2OLSA 3KVLA 1RJQA 1PDYA 1G4EA 3E0WA 3RPDA 3G0SA 3VE9A 4EP8C 4LU0A 3WZ0E 4CU8A 1K7FA 4O18A 4I8DA 4QIUA 1JUEA 2P0IA 5K2ZA 3CLWA 2FHCA 1GVRA 3T0AA 3TA9A 1MXDA 4JTIA 3W7LA 1KGUA 3NJ3A 2GVGA 1P48A 5G5IA 4F4RA 4F66A 5AYZA 5C5YA 3T42A 4XZBA 1YTKA 3A4XA 1OSEA 3K8MA 4WRHA 3M5YA 3UG8A 5REQA 4KF1A 2I57A 3CQJA 2FB3A 5C9RA 3UWUA 1UKTA 2X16A 3F1QA 4Q4SA 3WSUA 1W5MA 3HV8A 5I3IA 2RDUA 1M1BA 1RPXA 2QCHA 1KGWA 1R2RA 2ZX8A 1XLJA 4LYRA 2VFGA 4M6QA 5D37A 4LBUA 5T91A 4XIAA 2D0HA 4DUOA 4HNUA 4EACA 2WYSA 2FDSA 4N9DA 1IZCA 4DHGA 4CCDA 3VXGA 3TJXA 3A64A 4C1KA 3EKGA 4AD2A 3AYVA 4KS0A 1ZBWA 2UY5A 4KEUA 5ECUA 3TW9A 1H5YA 1FWIC 2WJDA 4D71A 1YNPA 1WQ5A 4ECLA 1I0DA 4WDXA 3ABSA 3NSNA 1PIGA 5CAKA 1E1FA 3U9IA 1I0BA 2OG9A 3DAQA 3TZFA 2QLYA 1N8WA 5A2AA 2DZSA 3W0KA 2C1GA 1L0PA 2Y7EA 2X42A 4AZCA 2CC0A 1YPFA 4JR5A 1E9YB 3TTQA 3BUVA 2FH8A 3U4AA 3DUGA 2PCQA 1ME8A 4FXJA 1E1EA 3CZ8A 1KM3A 2PDMA 5K4XA 3CHCA 3OTRA 4FXSA 1R3RA 3EMCA 5A6SA 1W9XA 3OIHA 2BTMA 4C6MA 5LKYA 2QCLA 3ORWA 1PPIA 1W1IE 1GZJA 1FCVA 1TPC1 1V0LA 3USZA 3SGZA 3UR2A 5CLTA 3TA6A 3T8QA 1PTGA 3AXKA 2GGJA 4EKJA 4GPNA 2AMXA 3AU6A 1A5NC 1IWBA 3SRHA 4U5KA 3H7UA 1W8GA 3TOPA 4WJEA 4WD0A 3H70A 4D6FA 2VDHA 4I5XA 3HZ3A 2VOTA 3BOLA 4M24A 5H6HA 4EVZA 3LBMA 4JQ3A 3GVRA 1W8SA 4LUIA 1AFSA 4CGTA 3GXNA 2FVMA 2IQTA 2BBFA 3W24A 1NFGA 4GXPA 1PTDA 2BVTA 4PMUA 1GOIA 3C86A 3B3DA 5A95A 1WUEA 9XIMA 4D6IA 1JRBA 1OIMA 4NF7A 4D6DA 3W1NA 3QZEA 3AIUA 3CO8A 5M3WA 2FKPA 3F4NA 1FDJA 2EG6A 2VEKA 1Z6KA 1PZ2A 4JFTA 2Z1SA 2DZWA 2GGGA 3LHVA 2VELA 3LU2A 2NXGA 2NQLA 4HZ8A 1UA3A 2PD5A 3GXIA 2OPJA 2DH2A 2VVNA 4DNMA 2D20A 4WDWA 4DLMA 2BGQA 5KINA 1W3KA 3A4AA 3W2MA 3M9YA 1IZKA 5DO8A 3G18A 4AZHA 1L6SA 1JZ6A 2Z1VA 2ZICA 1TJ2A 4I3GA 4UOJA 1OT1A 3B40A 4X0VA 4HPNA 4FX8A 1S2WA 4IMEA 4BFAA 2ZFAA 3IIZA 4PBGA 3K8KA 2NX3A 3HN3A 4I9TA 5L6UA 2CLHA 2HISA 3DYPA 1TYGA 2ISDA 1O12A 3PTMA 3IVUA 1PIIA 3RAOA 1WXZA 5J5RA 3BANA 3R2GA 4O1FA 3AS2A 3W1PA 4LH8A 2D22A 4JTUA 1HZYA 1LBLA 1Q6LA 1OIFA 4JS3A 4IMAA 1KTBA 1D8WA 3VVGA 4ICCX 2VGIA 3AIBA 4FNTA 1H0IA 1UR2A 2VO5A 3S5OA 1I75A 4OU1A 3LQLA 1WAUA 1CLKA 4AISA 4YYCA 4AZBA 2FPTA 3U2ZA 1US3A 1ZBKA 4EPBC 2OLHA 3BLEA 1EJXC 1IEIA 4YVPA 2DU2A 1LWHA 1FWAC 4KFOA 4DXKA 3AWNA 4RJEA 1JFHA 5FIPA 1KFBA 4FNUA 1KV8A 1BSIA 3LXCA 3LUTA 5E9AA 5ABEA 3WH8A 1TV3A 3SCVA 1XLHA 3B9AA 4N02A 3LPOA 2VDGA 1FWHC 4XO7A 4O1BA 2XPKA 3CYVA 4GUIA 3LXAA 1W5PA 2YCKX 3NL5A 1YDVA 4Q8WA 3TKFA 3GYCA 4G2DA 2EO7A 3W7JA 4OUIA 4LUSA 4L4PA 4WY0A 1UZDA 5D8WA 1CLXA 3N14A 4MPKA 1UW9A 4ORMA 1TJRA 4GY7A 3S2LA 3P5YA 3C3NA 4AYGA 3B06A 1E6ZA 3M0IA 2HNHA 3WNLA 7CGTA 2NVCA 2YW3A 4NAFA 2WVTA 2A3EA 1DQUA 1I2OA 2WSPA 5F2IA 5DRCA 1XP3A 3ARTA 2PUZA 4MAZA 3SM0A 1UWTA 2MNRA 2V5LA 2P76A 3K4WA 5EPDA 2OEMA 3OGSA 4CCCA 1HG3A 6CGTA 3QOMA 5FL0A 3GZ3A 3FKKA 2Y4SA 2VURA 3CWNA 4Q4RA 1E3XA 1I45A 3TROA 2OODA 2PTXA 4K39A 1XH1A 1GORA 3BW3A 3LLFA 4JTFA 1JGIA 3NNTA 2FMOA 3N34A 2ZDRA 4IUOA 3SECA 4AVNA 1LF1A 2D2GA 4UTFA 1E1CA 2V3FA 2Y85A 1JCNA 3LZ5A 4XD6A 2YYUA 3TQ0A 5JVLA 5TIMA 4E8GA 1OADA 2WJFA 1E51A 1GWJA 2Y5JA 2DSKA 3WUGA 3JR2A 3F2BA 3ICJA 3I3BA 2R1KA 1TFVA 4H2CA 4GQGA 3ZJKA 4TTUA 1E40A 1Z7AA 4HPXA 4UQDA 3A24A 4Q8NA 2IPWA 4WOZA 4EX4A 1FP9A 3AISA 1HL8A 3KW3A 2R9RA 3HG2A 1MW0A 4XIMA 3C8FA 3WLRA 5PTDA 4H6RA 1UOKA 4GHRA 1S5VA 1LRQA 1OYBA 1FFRA 3AIWA 3PHAA 2PDQA 3QMTA 3EXTA 3IS4A 2NVDA 4MJ2A 1SZFA 4PC8A 4OOUA 1R3TA 3UG3A 1H41A 2WO5A 3M6YA 5BXSA 1NWUA 4KCVA 2ZUTA 1XD1A 4MSSA 5BCAA 1TQXA 3QMSA 4LB4A 4H1ZA 1ZLPA 5LXEA 1LLWA 5CH9A 2D2OA 3CXOA 3KLLA 2XWEA 1KFCA 5H1WA 3ZM8A 3VGDA 3RDKA 1LORA 1OGBA 1C8QA 2XIJA 1GJPA 3ZSSA 3WQ8A 2WVVA 1U30A 3LDVA 3UJRA 5AC7A 4RXFA 1O94A 2G3IA 3WUBA 5DY3A 1OCQA 1E0XA 1RQEA 4XAFA 3WD0A 4C6DA 3GG0A 5G1YA 4ADTA 2RFGA 4AZ6A 3FHQA 2YCEA 3RFAA 2XGBA 3LV6A 1ECEA 3H4XA 3TYZA 5A69A 2CLOA 2AGTA 1OC5A 3N04A 3P67A 2BY0A 1RUSA 2G4FA 1JVNA 1PV8A 4GY0A 1I4NA 2FJUB 2YFOA 3A13A 1UR3M 1JI2A 2QCNA 3WLQA 1ZNNA 2QQ6A 1M7JA 1B9ZA 2HVMA 1E0TA 4JL1A 1BTMA 3KEHA 1MNSA 4WZHA 5DXYA 3N19B 3EX3A 5A2BA 1LBMA 1EP1A 4LYQA 5BW6A 2EJ1A 1ZAIA 1EC7A 3N4EA 4Q4QA 2V5DA 2YR1A 5I7GA 3BCJA 2ZZ5A 3BPWA 4P7OA 4IQDA 5A8NA 1PZ1A 3U5YA 3AHZA 4LY4A 4A29A 1BXNA 1GHRA 2PF0A 4S23A 4N9BA 2VOMA 5FAGA 4ZB2A 3EMZA 1XBYA 2ZX7A 2BGNE 1WXYA 4LYPA 1KD0A 3W7CA 4DIAA 5DCEA 3SUSA 2QJGA 3GNRA 1A5MC 1AH3A 5F4WA 1WNOA 2H9AA 2VFFA 3PUDA 4M29A 1SZRA 4GISA 4CD8A 4DELA 2PWVA 5CLWA 4FLSA 2YB1A 3EYPA 2YDQA 4PCSA 2P5NA 1GKRA 1TWZA 3U48A 4HSHA 5CEWA 3STGA 1G4PA 5FOOA 3LNMA 2DZTA 2XG9A 4PTVA 3IIOA 2E67A 1EDQA 2WC3A 2ZWZA 1FDYA 1TIMA 4A2RA 5CPOA 3GUGA 3QGKC 4IMDA 3I3EA 2Y2WA 3CUJA 4QQUA 5D33A 4LUJA 1Q6QA 1LL7A 3TTEA 4GNVA 1JPDX 2HBVA 5EMJA 3L21A 5CSSA 1HO1A 1PJ9A 3O6YX 3BO9A 3TV8A 3I10A 3W7DA 3HV9A 4JIPA 4M81A 1OZQA 3EPOA 5K3VA 1V0NA 4TIMA 3WLLA 3V7PA 4IX2A 4DI9A 1XRTA 2QR6A 4O13A 5I00A 3DI1A 3N25A 4Z0SA 1S3HA 3D6NA 1ZCOA 3PZVA 1FFQA 2HV5A 4S3AA 4PGLA 2WC4A 4LAZA 4P7LA 1DHPA 5MF5A 4GI9A 5D09A 2QIIA 1Q3NA 2IMRA 1ML1A 4BA0A 2DSWA 2DQWA 3H7RA 3EDFA 4MB1A 3VFLA 1EOMA 2HSAA 1U5JA 1G69A 4H9XA 1H7RA 4NI3A 5C7VA 3B03A 3B0VC 2J9ZA 5F4XA 3QRHA 1AODA 1OFOA 4J2PA 1XRSA 4N42A 4L9ZA 3WL1A 4A22A 1J5SA 3WD1A 5KTLA 2OZTA 4LEQA 4GE8A 4Q8TA 4Y8EA 3I3DA 3OZYA 5BXRA 2CETA 2CXGA 3HPXA 2WQPA 2D3LA 1OT2A 3ANUA 4MHBA 2E5CA 3R5EA 5H8MA 4WVXA 2XFYA 3VKJA 3W6LA 4HZMA 1JJKA 2GVLA 1VRXA 3KZSA 1GVIA 3M0ZA 1RPKA 1S1PA 1V03A 3L5LA 3WDQA 1I6NA 4E3TA 1TA3A 4QR6A 3GXPA 1H7OA 4NYYA 3QHOA 1JXJA 1QI5A 3BZGA 2QF7A 3LCXA 3NURA 4J28A 1NWTA 2PWEA 4NX5A 4XVDA 4NASA 2HE5A 1TJ1A 3G1RA 1LROA 2ZUSA 1TUFA 4CN4A 1HW6A 3CUFA 5M03A 3G1AA 3WCZA 3PZTA 3GZAA 4M6VA 3THCA 1V93A 5EA9A 3FEMA 5DMMA 1DHKA 4S39A 4M5PA 4HA3A 4PUKA 1TTQA 1PSCA 2PTDA 2YL5A 4KETA 3M5XA 5EFFA 2A7PA 4W9TA 1M7OA 4PMOA 1YQ2A 1SSGA 1OF8A 4Z1DA 1FWTA 3DHUA 3DHPA 3WK0A 2DP3A 4O14A 4QJ5B 3LBCA 2PWGA 1QI4A 4PZVA 1ISWA 2ALDA 3R8RA 3CB3A 4LCQA 4RE2A 4AEEA 3IACA 4MJ4A 5CXPA 3I4EA 1OHLA 4GI6A 4O52A 2JKPA 2J8FA 4P7QA 4JGDA 2XVGA 2CBUA 1B4EA 1EGZA 4FAMA 2OWCA 3MYPA 1TWIA 1V02A 2P0OA 2G41A 2TYSA 4FF7A 4FR1A 4W93A 1XYZA 4LC6A 5LNRA 4NZ5A 1WDDA 3W1UA 1FRBA 8XIMA 3DC0A 4O12A 3VIIA 4XD4A 1G01A 1FWCC 8XIAA 2FZMA 1JZ3A 4HHLA 4RLIA 4S3CA 3NQMA 5IOBA 1GQJA 2IUZA 5B7ZA 1REQA 4V2XA 2WZEA 3DERA 1LWJA 3UERA 1ZGDA 4PEEA 2QMKA 4X2RA 1ODUA 2B81A 2JQXA 1O5KA 2FPYA 2EXOA 4FK9A 3A5VA 5DMNA 3B8DA 1QNPA 3NPXA 5GVJA 3GQYA 4R7OA 1B4KA 5DCBA 1FWRA 1V77A 4L56A 1H7WA 3PF3A 2PU0A 3NAVA 4PTNA 5HK4A 2EBNA 3NQCA 4GZJA 4F40A 4GI8A 4GYPA 1W17A 1H1ZA 4QS6A 2VZVA 3UXKA 2ZCGA 3V4BA 5J5DA 5LNUA 1EUNA 3NGJA 4ZTXA 4OWGA 1AK5A 3W7KA 1I2RA 1H51A 3T78A 5MHBA 2QPUA 2FTPA 2X40A 4HN8A 3RR4A 2XIIA 1TTIA 1TTJA 3KLKA 4TMCA 4UQEA 1W56A 1J11A 1IEWA 1VJZA 1KFWA 4YTQA 4IMCA 2WCGA 1IGWA 3SB0A 4OT7A 3EWBX 3WK1A 2YSWA 5BXPA 1HGWA 5LHFA 4UTIA 1UWUA 2OT1A 4JFUA 4Z1AA 5A6MA 4GVFA 4MF4A 4YIWA 3V0UA 3RPTA 3L23A 3ECQA 1F8MA 4NAEB 4KW2A 4JDBA 4C6FA 5L9FA 3KP0A 4TX6A 3CZLA 2ACSA 3W83A 3W75A 3OG3A 4UTMA 2VCBA 3N12A 3URBA 1IWPA 5E6YA 3PZGA 2UY4A 3EOUA 1YDYA 3GU1A 2VD8A 2OX4A 4RV3A 4WIWA 2GOKA 2EKCA 3NSXA 1XV8A 2C3ZA 2QF8A 1XD0A 1T96A 1F9CA 1KM2A 4MMWA 4Z0JA 5CPMA 1QPQA 1KFLA 2PBGA 2ON3A 2VEMA 5LA1A 1Y65A 3TMQA 1DL3A 3TTYA 2Z6IA 3UVIA 3K8LA 1W3JA 4R34A 1AQ0A 4OBSA 1F4HA 5BOFA 1FHVA 1E5JA 3UVAA 4GYFA 1QTWA 3A3XA 4DZIA 1MVYA 1EJTC 3VGFA 2VZUA 4O57A 3N13A 4HHMA 5EY5A 3QR3A 4GVGA 3TWBA 2A3BA 4KEVA 4L4LA 3W22A 3SCRA 2XM2A 2OZ3A 2TODA 1R2TA 1VFUA 3HFTA 2QUMA 2OJPA 5AN7A 1VAHA 2NUWA 6ALDA 3G1FA 2XH0A 1DE6A 3UR7A 3W4RA 5DQPA 4WJ8A 3HGJA 3ATYA 2GDUA 2C16A 5T9CE 4NHVA 4XZNX 4PR4A 4B15A 1YXCA 4V15A 2OU4A 4LUTB 4N6FA 1RA0A 2E8YA 5JMUA 3RK8A 3QM3A 3PZOA 2RJGA 2WSQA 3IJ9A 3QPYA 3NDZA 3DG3A 1B3ZA 4JTDA 2W63A 4FLRA 3EOOA 3NG3A 5I3KA 1M6JA 3P74A 3AS1A 2XU2A 3LCFA 3REQB 2VVSA 3PK7A 5I0DA 4OECA 1NOUA 1MQRA 3VIKA 2CHNA 2REQA 4TV5A 3WJYA 3MMWA 1Z41A 2W5FA 3R13A 3AMDA 4ZO6A 4URIA 4QFUA 1P6WA 4MG4A 3WQEA 4DBSA 4KWOA 3MKVA 3CQHA 3GU9A 5FL1A 4JY9A 3NPVA 3VFCA 4GKLA 2VGGA 1OX5A 1DJYA 4H6EA 4JTLA 1F3XA 2QJHA 3S5SA 1XH2A 1UASA 2Z1BA 5U4NA 1V3IA 1UUOA 1RBOB 3UWEA 1Q4NX 3IJ8A 5GQBA 1F8IA 3DG6A 3N29A 2CWXA 4IGMA 2GZXA 3V5FA 3P93A 1FWNA 1PBGA 2V0TA 2ZX6A 3FYPA 1MWOA 9CGTA 2OEKA 3WLNA 3HG5A 3LGGA 2P1FA 4JQ1A 1LUCB 1AL7A 3RLHA 3N3MA 1K1DA 1A5UA 1CCWB 2F9RA 1Q7ZA 4WDTA 1R8LA 8A3HA 1J2WA 2QCGA 2J6XA 4MDOA 4IGSA 1MUWA 4GGBA 3CO4A 4HZ7A 5BOEA 5A94A 1SMAA 2ZE3A 1A5SA 4FSAA 5GJPA 3E49A 2G95A 3DENA 2G96A 1P1MA 2QVNA 3II1A 2WM0A 1SVDA 2FVLA 1NM9A 2V3DA 3N2MA 3P0WA 4TTGA 2B7OA 1MFVA 1UR1A 1UUQA 3B8WA 4RPQA 5EU9A 1BXBA 3ARYA 1E72M 1XHGA 3UPWA 4TQTA 4QM1A 3TSMA 2GQAA 1LM1A 3O16A 3P8JA 2V5JA 1VIWA 1VR6A 2E25A 5D2TA 3MMTA 1QPRA 3NQ6A 5FF7A 4U4MA 1LT8A 4IPJA 1RY0A 4AHOA 1WKYA 3FKRA 4BQ3A 4LS0A 1YBQA 4PMVA 2B31A 4OGZA 2X7VA 3QLLA 4QEEA 2J7GA 3QZ6A 5ABFB 2I7GA 4ZENA 1BAGA 1MQPA 2YKKA 2CKSA 1K7XA 3EKLA 5D2XA 4DF2A 2BVWA 5ABGA 4YXGA 1R3YA 4Q3MA 4UTWC 3OZPA 3WDJA 3N2BA 3NM1A 5JBFA 4IOTA 1ZP3A 1VGAA 1EO7A 4OHQA 1K4HA 3QHMA 4UWMA 3S1XA 2E6YA 4QROA 3KOWA 4IPIA 2RH9A 4IX0A 5C8BB 5F4SA 1ZP4A 3KOYA 3P8IA 1WPCA 1DBTA 2R1LA 4JHZA 4J27A 2W6RA 3ABRA 1L6WA 1R87A 2NWRA 1OBAA 3EXRA 1ZRQA 4LV4A 3LA4A 1IXQA 1Q13A 1VB9A 1GZ1A 3DEQA 3UWQA 1RXOB 2DGAA 2INZA 4J3SA 4O1AA 3E0LA 4GQRA 2PI6A 3MA8A 3VX1A 4HN4A 5EB8A 4DUXA 2GDQA 3HPSA 1TX2A 4H19A 2FZNA 1U1UA 1UH3A 3MP5A 3MJMA 3G1DA 3N6HA 2HQAA 1XLCA 1KCKA 3PZUA 1Q66A 1K8XA 4C60A 1Z69A 3WQVA 2XIOA 4MWAA 3CASA 1VFTA 1EH9A 1R47A 2Q02A 1E4IA 4MUZA 5A6AA 2EPHA 2I17A 2YZRA 2YPIA 3FXGA 5BMXA 4GFSA 4P8XA 3IV8A 5CPTA 1VEOA 4DXXA 4GIEA 3LPGA 1LL4A 1VFOA 1K4GA 4Y9AA 1KB3A 1S39A 1DPMA 3G8RA 3W86A 3BAXA 3V0SA 2R91A 1KCZA 6REQB 1XKJA 4RKAA 2FGLA 2PDIA 4LRTA 5I3GA 1YRRA 1C8XA 1GPFA 4PCFA 3PN8A 3N1AA 2BX7A 5JXQA 3FGCA 4ORIA 2A3LA 4KCUA 4JFWA 3T8LA 2WKJA 2J13A 2PFHA 5BRPA 4KMQA 5DT5A 3RX3A 1KRMA 3BAIA 1EP2A 3OHMB 2VZTA 4O50A 3N15A 3B8SA 3BMXA 3GK0A 1JD7A 1EXPA 1O66A 4B92A 4F8XA 4W8AA 1FWFC 4K36A 3P2VA 4PUDA 2OQYA 2IPJA 4ROQA 4WK9A 1ISVA 4DO5A 4H7CA 3GHTA 1QWGA 2XFWA 4UFIA 1UWIA 1PX3A 1P1XA 4OUEA 1VHCA 2EHHA 2ZTKA 2IKIA 2Y89A 1K3UA 1XLBA 1EEPA 3KDNA 3LGDA 2EPMX 5TBOA 5G4WA 4KWSA 1SGJA 3GB6A 5CZ0A 1L8PA 4HVXA 1FWEC 4Z1CA 2E7FA 5JBDA 4DPQA 2XSBA 1AW2A 4AF0A 1WDRA 2Z24A 4LS1A 2GYIA 1ZL1A 3KBJA 2VFHA 3W1RA 3TONA 4LQ1A 4O1EA 3ZSTA 3RRAA 3C56A 1KA9F 2GVEA 2QDDA 5FEWA 1X6UA 4DJDD 4H00A 1EB3A 3WMCA 1NFPA 2DZPA 3PAJA 1S5TA 3S9ZA 3N9KA 3MDWA 3QKEA 3B9DA 3KVJA 4POCA 4RNFA 2WNWA 4UTUA 3U5UA 2ZXQA 1WKDA 3W70A 7XIMA 3SO7A 5HQLA 4ZQMA 1E5NA 4M7SA 2WMIA 4JNZA 2QHAA 4NJHA 1PS9A 3E0FA 2CEQA 2ISSA 2DEPA 3SFWA 3GDMA 1T7LA 2H6RA 3AMLA 2O9OA 1N8IA 2CLKA 2XM1A 1ONXA 4B5NA 2CZFA 1ME9A 4EF9A 2GJXA 1U83A 3GR4A 2VFIA 3GW3A 3M41A 3A9BA 3QPEA 5CC7A 3PBVA 5RUBA 1KGXA 2WBKA 1E6QM 3I4KA 1J0HA 2ZC1A 9XIAA 1B3WA 1M7XA 1F07A 3NQGA 4TX8A 5HUOA 2CBVA 1TRDA 2PDLA 3PB0A 4MNJA 1AD1A 3QOKA 3TR2A 1UB3A 2FMNA 2DZXA 2GJNA 4IQEA 4A8LA 3MKCA 3VC5A 4PUUA 1H61A 3KE0A 2BOEX 5EBUA 4ZB5A 3W7PA 1JXKA 5A6BA 5IHRA 1I1XA 4JQAA 3CMJA 1RCQA 2Z1WA 3OGRA 4J3XA 1OYCA 3BC9A 2Q3OA 1HJXA 2C0AA 3GNPA 3GC4A 2Y61A 2BNJA 3G0XA 1X1ZA 2VXNA 1DVJA 1OX4B 3CHEA 4YPJA 3SCQA 4BCEA 3S9YA 3BWWA 4ZO8A 5B80A 1NARA 3OVRA 4D72A 1QXLA 2HTMA 1UMLA 2O55A 3CIWA 4DF0A 2DT3A 3R43A 3ID7A 3WFZA 4BEUA 3UA4A 1F76A 1X97A 3VUSA 1HUVA 2JGQA 1IV8A 3EX6A 1SYTA 2E9BA 3R0DA 2VUYA 3AXHA 3OG2A 2AAAA 2PTWA 3NA8A 5D8ZA 4DO6A 4IIFA 1EIXA 4HNNA 3L4WA 3AOFA 5FEXA 3PM6A 3UZJA 1UWQA 1FHUA 4GI4A 5KZEA 1W32A 3ZQ9A 4JFSA 3L66A 3VDGA 1RBLA 5AZ1A 3LPPA 4XAGA 4H8NA 1MRQA 2AAMA 3THQA 3CMFA 5LA2A 4D9PA 3MC5A 3AS0A 1KLYA 2EPLX 2JKAA 3OYXA 5FA5A 1TPVA 4UOQA 1VFHA 1TV5A 5DBTA 4GGHA 4AF0B 3S46A 3LEPA 1FWDC 2DJXA 1LBFA 4F48A 1YNYA 4ZB0A 2QULA 3SQSA 4MVAA 3N9SA 4Q8MA 1TR9A 3PBGA 4W87A 3CZGA 4L9YA 3YPIA 3RCNA 2WHLA 3W28A 3SAZA 4CEXC 1TMLA 4M56A 2VHLA 1CECA 3VNYA 3S6TA 3A47A 4Q4KA 3KRBA 1BRLA 3OA3A 1QT1A 4L7ZA 2A3CA 1L2QA 5G2WA 1Z9AA 1RVKA 1GUVA 1C3FA 4EWJA 4KIEA 3VIGA 4JFVA 3IGSA 4HJFA 5FSEC 3U2CA 2ICSA 1PIFA 3MBDA 3T40A 3BOXA 3WBXA 1G67A 1PB0A 1S5WA 5KZDA 3MDUA 2EKGA 4FS9A 5LIXX 1GOOA 3WJZA 1TPUA 3HIJA 4B91A 3W7RA 2NQHA 2ONEA 3OHIA 1VCGA 2VR4A 4R7WA 1CIUA 3O0KA 4BF9A 1XIIA 4F0SA 2O7SA 4W88A 1YMYA 3B4UA 2E9MA 3P0XA 4OTKA 1EGMA 2NXHA 4IXXA 1HKKA 3NIYA 2ISFA 2OLAA 3UCCA 4GO8A 3BARA 1RP8A 3BGJA 2Q3RA 4W7WA 2JEQA 1EWEA 2EPOA 2JF6A 2NQJA 5A5WA 3U57A 4A8RA 1GYNA 3ZYZA 3GDLA 3VCRA 4J40A 3AC0A 1CGYA 1FCQA 3MMDA 4ONVA 2YBVA 2FLIA 3RCMA 3EEZA 4NNCA 3SCTA 4DUWA 4DM1A 5M1TA 4L6HA 4AVFA 3SCWA 1CGUA 3W7NA 3LRKA 2NV9A 3QV9A 1XG3A 5DMLA 2VX5A 1NDVA 3GH7A 1KC7A 1S46A 3VMOA 1P43A 1IE7C 2WMHA 4CD4A 4S3KA 4HMDA 1KCLA 4Y2WA 1BVNP 3OW1A 2QNEA 4ERGA 2NUXA 2Y8KA 4H9MA 2FB2A 1CTNA 1ZJHA 4JOMA 5EGRA 2VEGA 1A5KC 3FN9A 4LVDA 3GKAA 2P88A 3SJ3A 4UQCA 1GKPA 5D05A 4M7TA 4UFJA 3RRXA 2XSAA 5FF0A 2NV1A 3W3OA 1F7BA 1QHOA 4S2BA 1OFAA 4AH7A 3EGJA 4MLRA 2WWCA 3WBWA 1XYFA 1U5VA 1V5XA 1UR4A 1HFBA 3THUA 1EWDA 4Q4MA 3L0GA 4DN1A 5F7UA 4P2VA 1EJVC 4AAJA 1Q7QA 3LNPA 2X09A 5GNXA 3FJ4A 1GCYA 2F2HA 3ZJ8A 3PWAA 1J93A 2QZRA 5FJUA 2J9YA 3C4UA 4FB7A 4G5DA 2Z26A 3AYTA 3ERPA 2ZRXA 3UGVA 3BLKA 1FWGC 3BXWA 2J79A 1CGVA 1DJIA 2C18A 2ACQA 3ITCA 2BXVA 1RK5A 3WY1A 1XLKA 3ABZA 1BSLA 2VR2A 4JIRA 3WMBA 4B2DD 2Z29A 1Q5MA 3JW7A 2BVDA 3T4WA 1GEHA 3KXQA 1UP2A 4XQ6A 1EC8A 2PLMA 4M6UA 4D8AA 1PWMA 3TC6A 1PL9A 2A6NA 1X96A 4AHQA 2AQWA 2RDTA 4DAFA 2P10A 3AAMA 3B8IA 3O05A 3CU2A 3A4JA 4PL2A 1ZCCA 3UZ5A 3DZ1A 1WZLA 2J8TA 3CS2A 1OABA 4LWWA 2GDVA 5CC3A 5AC5A 1W3LA 4YCPA 4JN7A 4ZOEA 4HK6A 4JHOA 2VR5A 3FCPA 3RUBL 3D5HA 4GJ1A 4K7YA 4P5UA 4GBDA 4CNPA 2PC8A 1ZU8A 1HJWA 4KGJA 4IGNA 3VIPA 3V5OA 5D38A 1HKIA 1EO5A 1R3QA 3V1PA 1V8EA 4DJED 5CJNA 3MHFA 3TN3A 4PRWA 4P8VA 1IXPA 2JF7A 3FXYA 4XV0A 4H9YA 3SR7A 3H2OA 5CSYA 3BLDA 3BOFA 3SY8A 1YHTA 3PTDA 1EL3A 1W1YA 3T1GA 3GR8A 1ITXA 1ZSXA 2F2KA 4IFOA 4EXBA 4YU1A 3PZNA 1DIOA 1A5CA 1KTCA 1TX0A 1ITCA 3MMUA 3S5NA 2NSOA 3LRLA 4IMGA 2WJZA 2BODX 4GUJA 4J3TA 1MQQA 2DIEA 5HBFA 3GE7A 1O68A 4HB7A 2VEFA 3HQNA 2Y8UA 2J7DA 2Y5SA 2CPUA 2PSNA 5F1VA 1RLDA 3B0UX 3MUY1 1QK0A 3K1DA 3UFYA 1UP0A 4HU8A 1MZRA 4G8TA 3GSMA 3A9IA 4PSPA 5LXXA 3KHJA 1MDRA 2C71A 3AUJA 2BXZA 3VYLA 1CGTA 3H54A 1XLGA 1W5QA 4J2MA 1AQFA 5J8LA 4CQ9A 3L0NA 4ACZB 3ENLA 4EOUA 3WBEA 2QPSA 4O28A 7REQA 3KTCA 3GVQA 4CUCA 1ZTVA 3XIMA 2YGYA 3VILA 3C2YA 3UJSA 4IPNB 4UMBA 3MT1A 1OQFA 2HPIA 3SQMA 4ES4A 4JTHA 3MI3A 2EG8A 5HA7A 4MPQA 1NP2A 2Q8XA 3WH7A 1MXSA 1XCWA 1U2YA 3F4WA 3VKDA 1ICSA 1VBHA 3JU2A 4AD3A 4S2CA 1MMFA 3QY8A 2XGZA 3LD5A 1I8JA 3OLIA 3QQ0A 3ZVHA 4L61A 2XGIA 5A6LA 2CCRA 3QLDA 4GX8A 3NDYA 1LQ0A 1CI1A 3MCMA 4LAKA 2QCMA 4JYDA 5F2LA 4KEMA 4GH1A 1WP6A 3QC0A 2D2JA 1OCBA 3QYQA 1Z32X 5GPRA 2EEXA 3URQA 3GU2A 5JBEA 4LANA 2GLKA 5HOSA 4LB3A 3HF3A 3CHVA 1V3LA 1M65A 1S2UA 2HNEA 1FQ0A 3UWVA 1FKXA 4GUGA 3VKKA 1OG6A 3TW7A 3FHAA 1NIUA 1GOWA 1TPH1 3DKLA 3CIXA 1Q45A 3M1ZA 4IUGA 3CPUA 1HGYA 3L4XA 5FJIA 2VTFA 3O15A 1A47A 2AGKA 3UU0A 1QW9A 4CD7A 4GG9A 5D03A 1PYFA 3EPNA 4HU3A 4IQJA 3MKKA 1L8NA 1UWAA 2GK1A 1D3HA 5FAJA 2QCEA 1KM5A 3M47A 3WF1A 4HBKA 1KCXA 1KW1A 3HJEA 2OWWA 1EPVA 3FVMA 4C6IA 1TZ7A 2C19A 4S3BA 4I6KA 3S4TA 3WQGA 4B4HA 4UFLA 1KBJA 4UTTA 4I9JA 2VJXA 3AROA 1D8CA 1LQ2A 4IP4A 3BG3A 4HU0A 5ABHA 4F3HA 3GXMA 5JH2A 4WCJA 4YYFA 1S2TA 3SDOA 3ZXWA 2KX9A 4FPSA 3G1SA 2E77A 1V6VA 1IEVA 4Z2IA 2J7FA 4MAVA 5CJMA 5DMYA 1HQTA 1WA3A 4UQAA 3KAOA 2JIEA 1X8FA 2Z0IA 3T08A 2Y5EA 1BVZA 3TFXA 2R82A 4Q4OA 3M0MA 1DWJM 3WNOA 1NP0A 4O11A 4IHCA 5D9MA 5KETA 3SRDA 1H50A 4KERA 1Q2SA 3NL2A 3AZSA 4B5VA 2J74A 3OA5A 4M8UA 3OLGA 4QRNA 2R1PA 2UY3A 4UMAA 3TMLA 3HQOA 1NTHA 3DFPA 3LV5A 4H6QA 4FNQA 4JTJA 2C8NA 1KO0A 1EP3A 1ICPA 4FIRA 3EWYA 5MKGA 4F0HA 4GABA 1UZ1A 3CJPA 2UY2A 2ZZ4A 2QUVA 5CPNA 4DXVA 4IISA 3I7QA 1H63A 2V2HA 3R6IA 1AW1A 3O2LA 5AECA 3QBUA 1ISXA 1WZKA 3C2RA 5EKYA 1YDOA 1VS1A 1PUDA 1A3WA 4HK7A 4GIRA 1IYXA 5U7SA 5JIWA 3EWXA 2VC9A 3E2SA 3BQ6A 2VX6A 2X2YA 5LYRA 4GWEA 4AWUA 4GYPC 3LERA 3DECA 1QBAA 3BGAA 1SW7A 4HOWA 4GVHA 4NVTA 4DJFD 4QXIA 2XIQA 4JKLA 3VZYA 2HBXA 4XBKA 1C91A 1EFZA 2GGIA 4B9YA 2EPKX 4UTKA 4CU6A 7ENLA 2O9PA 4HD5A 2PDWA 1XKYA 4Y8FA 1FTXA 2J75A 2TRSA 4K1WA 2VFDA 4EPDC 4NYUA 4EAMA 3AWOA 2PWFA 1VBGA 3I7SA 1TPFA 3F2CA 4AD5A 4L4MA 3MWCA 1H2JA 1LZOA 1V4YA 3DFHA 5G4HC 4Z08A 5BRQA 3SQLA 1XYCA 3DHDA 4ZO9A 1RH9A 2BOGX 2QCCA 1ZAJA 2PB1A 2Q6ZA 3MVTA 1F6KA 1E6PA 4QTGA 3OO2A 3RO8A 4QAWA 3AXMA 1E0VA 5IDZA 1LOQA 4XB3A 2B7PA 3W76A 2D69A 1V51A 4LNCA 4E4PA 1XWYA 3M7WA 4XKYA 3S6DA 4OVXA 1W3IA 4NXKA 1A3HA 1GZGA 1VCVA 5C6MA 2G3NA 1KBKA 2NQ5A 1CW2A 3P60A 1DJGA 3CT2A 4PFHA 4L1WA 3CPRA 2GK1B 1UJQA 2ZWYA 3VCNA 4XZLX 2PGWA 3L65A 1SU5A 2V2DA 1TCDA 1R6WA 4RNIA 3CQIA 2AKZA 4C7FA 4GC4A 2ZADA 1K8YA 4Y9PA 1XF0A 4D6HA 2QKFA 1UD3A 5FEZA 4ZO7A 3RNDA 4MKVA 2YYTA 3O1NA 3K1GA 5CSRA 1HKVA 3VOHA 1JCJA 3RLUA 3UNDA 1AQHA 2HDJA 2XN2A 1XICA 3WJXA 3VNMA 1KRCC 4B16A 3GTIA 3SY1A 4U5IA 2O92A 1EKOA 5I3FA 1GTEA 1ADSA 1GW1A 3UZYA 2DW6A 2CLPA 1KM0A 1TVPA 3VNIA 4D2JA 3TK7A 4JDYA 3PWGA 4XG1A 4DB7A 1G1YA 1YYAA 4X60A 2B7NA 3TC3A 1D7KA 4G9PA 3VNJA 1LL6A 3B4YA 3PZIA 4Y9MA 3M43A 3A21A 5K9XA 2FHFA 2Z00A 2TAAA 4O0KA 2NVAA 4HMNA 2RJHA 1H7XA 2VCAA 3R11A 3W7EA 3ABXA 3V75A 2IKHA 1Y0EA 2PLCA 4GLEA 3Q67A 4P7NA 3KS5A 3AHXA 3TSBA 1GYMA 1XFBA 3Q45A 3C0LA 3RM9A 1EA0A 2PDYA 4C1NB 3PJWA 4PMQA 3MSRA 4LPCA 4J5NA 3CZJA 4LT9A 4S3JA 5I6SA 3BG5A 4YTUA 3NOEA 4D8LA 4I90A 1E55A 2PZ0A 5FD0A 1W9VA 1QHZA 2A3AA 2WWDA 1LOLA 5A6TC 1UC5A 2JIWA 1OK6A 2Q8ZA 3FNDA 3W7HA 3W38A 1XINA 5FKYA 5AYYA 2WJEA 1TV2A 2PZNA 3MY9A 2X0SA 4XBSA 1QNOA 5AFDA 3LRMA 1JCXA 1IR1A 1TJ0A 2C6QA 2BVYA 3QQWA 3WLOA 4JKKA 3C0JA 4ZOBA 4KCWA 3LI0A 1T6MA 3MVIA 4A2SA 4BI6A 2RKXA 1BYDA 1IXNA 3PTKA 1J8VA 2UWFA 1JAEA 2G3JA 3LHZA 1RVGA 4RDYA 3GTFA 1XDJA 4C6NA 2ANUA 4E8DA 4QCFA 3WEZA 1O4UA 2NXIA 5AY7A 1HJQA 3UESA 2QDEA 1JZ8A 1THFD 2X1RA 3ABOA 1UKOA 3FEQA 2AQOA 1UKSA 2NT0A 3BG9A 2YLLA 3THAA 4JYEA 4FNSA 4AZ7A 3H12A 2FPVA 3D0CA 4RW3A 1LCOA 4AY1A 1W2PA 3S5YA 3KHDA 5LGZA 3FAWA 1K7EA 3VIJA 1JZ2A 1W31A 2VZSA 2VM8A 3A23A 2CITA 5I24A 3GG8A 3WNMA 1A0DA 1HL2A 1ZUAX 4PUNA 4CQCA 1HJUA 2W4XA 4MDPA 3PUOA 3TN4A 3CL7A 2QIWA 4UNLA 1E0WA 4PUMA 1EHNA 3NPUA 4DWSA 4P8UA 4FX7A 1W1ZA 1C8VA 1PYMA 5DT7A 2ISVA 3AHYA 5I3JA 1NF7A 2H90A 5LHEA 1O1HA 4XZMX 1M7PA 2A5HA 3E02A 2GVYA 3LY0A 3QC3A 1CXKA 4KWVA 5HDRA 4H9TA 1JYWA 1ISZA 4ALDA 4B4FA 3WLKX 3K4AA 1GTHA 3CHDA 4XSLA 4QG6A 4HHHA 2V3EA 3FJNA 2A2IA 5KITA 1TV8A 4ZFCA 3IJIA 1V6UA 4IG2A 4M6PA 2R1MA 3PBWA 2E68A 4WSHA 1Q6CA 3CAQA 4DEFA 4FXRA 4A8NA 1CB2A 3ZLHA 1OFPA 2JFEX 4V1YA 3CUZA 2V2CA 2WPBA 4EF8A 3W88A 4ZSTA 1JUKA 5LIUX 4GXMA 4ACYA 1UCWA 2ABBA 3IK4A 5D2WA 1M53A 1JL8A 4DO7A 1TMQA 1BWLA 3WD4A 3C61A 3E0IA 2Y7FA 1GW9A 4IXHA 1YLVA 3QXBA 2V9DA 1NDWA 3SSJA 4RDWA 4ZOAA 3ARXA 2ZX5A 5LIWX 1B0IA 1RA5A 1KNWA 1EX5A 4H6KA 3PNZA 2GQ3A 1K02A 3NVTA 3IIVA 1WDQA 4QE1A 4UQ9A 5AC6A 4GZEA 4X9SA 3S1UA 1XPGA 3LB0A 1E0UA 1CXLA 3B05A 1EGVA 1XFCA 2CW6A 3MHUA 1ZBVA 3O0FA 4AVOA 2BMBA 4AFYA 1B3OA 3SURA 2F6UA 4LOCA 2DZVA 1VKFA 2VQUA 3AALA 4C65A 1UOZA 3UNTA 1IF2A 1NAL1 3HQ1A 1RV8A 9RUBA 3RLVA 3LS9A 1E4LA 3WDRA 3S42A 3KRUA 3THDA 3QTGA 2OTDA 3EDJA 4MFEA 2QJJA 4QCEA 3RU6A 1AH0A 1BLIA 1T40A 2XN0A 3MCOA 3ALFA 3L4VA 2OO0A 1P0BA 1XI3A 1K03A 2PCEA 3QQ1A 4JTTA 3LCGA 1YW1A 1B2YA 1F4AA 3Q58A 2E28A 1A5OC 2HCVA 2CXEA 2QCFA 1CBGA 4GA8A 3BLIA 5JU6A 3M4HA 3VKAA 5BXTA 1GVSA 4C6EA 1PWLA 3W74A 4AMCA 2V63A 1E70M 3WLHA 3AICA 1Z44A 4F0MA 3N2XA 3D46A 3P14A 2OFJA 4US5A 4PUWA 3DYMA 3URNA 3W2UA 3BH4A 4PMZA 1SW3A 4A6GA 1PZ0A 2JEPA 3R25A 4ROPA 3W81A 1NOFA 3GW0A 1EZ2A 3KWSA 1VEPA 3N4FA 1R7AA 2BB0A 2HXTA 3PY2A 5C71A 1VPXA 1YKWA 4RNHA 1BYAA 1XC6A 2BY3A 3KOXA 3MU7A 3LI1A 3AQUA 1UZHA 4RDZA 3HG3A 4DJEC 3S2CA 1EUAA 4HNTA 4CNTA 1YE6A 2I5QA 4EXQA 3S47A 1Q6EA 5CBBA 2PE4A 3W7QA 3ALGA 1W5NA 3VO0A 3LZ3A