1C3FA

Endo-beta-n-acetylglucosaminidase h, d130n mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H
publication title Mutations of endo-beta-N-acetylglucosaminidase H active site residues Asp130 and Glu132: activities and conformations.
pubmed rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase
total genus 90
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1c3fA00
3ARRA 3ARPA 2EPNA 4U3AA 5CSUA 4AY1A 1JZ3A 1H0GA 5I3DA 2BFGA 1WE5A 1NOWA 2PWDA 5HPCA 3OGVA 3N12A 1FH7A 1KXVA 1W91A 1G1YA 1KCLA 1JZ2A 2D23A 5GPRA 2MANA 3VDHA 4PMNA 1ZJAA 3AOFA 1PJ9A 5M5DA 4E2OA 4ML4A 2WBKA 2WCSA 2J7BA 3MO4A 5BXSA 1EGZA 3SCRA 2DT0A 1UQZA 1CXKA 4PRWA 4KH2A 4HP5A 3OLGA 3GM8A 1I1XA 3EYPA 2BHZA 1OINA 4D6IA 4LPCA 1PX8A 3VD7A 5A8NA 1XCWA 1JXKA 3QOKA 2VUYA 3W29A 4WK9A 5FL0A 3T08A 2YA2A 1V0KA 1VFMA 2AOSA 4WIWA 3WF4A 3VMNA 3CMJA 3ECQA 1C3FA 1C8YA 3LPFA 1H4PA 4J27A 5AC5A 3L4VA 1M01A 4B9YA 3L4ZA 2QV4A 3CUIA 3KWXA 3VGHA 3VUPA 4QLLA 2QPSA 3ZT5A 2YL9A 1U33A 4MADA 4TX6A 5EMYA 4AW7A 2WHJA 3DHPA 1CENA 1KR0A 4LQ1A 4UNIA 3AMGA 1NOUA 2W67A 4F8XA 1FOBA 4C7FA 3WEMA 2EJ1A 2XSAA 1GOKA 2CYGA 1US2A 1JZ8A 1V6YA 3GDBA 3AIBA 3A4WA 4BA0A 2D1ZA 4PMZA 4ACZA 3CZ8A 4U2YA 1BYAA 1ESWA 4ZE4A 5LYRA 5FL1A 4DM1A 3CZKA 4OOZA 4F9JA 3WMCA 1OSEA 3RMEA 3SUUA 1RP9A 2DSWA 5DFAA 1E4NA 3NSMA 4HOXA 1TR1A 2RGLA 1EOMA 2OWWA 1U30A 5A6AA 1EO7A 4CCCA 3AHVA 1VFOA 1HF6A 4H8HA 3M46A 1JXJA 3CLWA 2JEQA 1UZ4A 3T09A 2XM1A 1KCKA 1RP8A 3WDJA 2A3AA 4BQ5A 2AAAA 2X2YA 1KGWA 3L4TA 4GQQA 2EO7A 5FD0A 1UKTA 4H8VA 2WZIA 3WBEA 4L4PA 2JF7A 3JUGA 2VC9A 1G9HA 2CBIA 4AEFA 1V02E 1UKPA 4JFTA 4CD6A 4W8BA 1HL8A 1EH9A 2CKRA 2X05A 1KQZA 2Y8KA 3EMZA 2WC7A 5BRQA 4H2CA 1D7FA 3LPGA 1CGUA 1CXHA 4GINA 4P7QA 4AD0A 1B3YA 1AQMA 2WMIB 4MNMA 4M29A 3OLIA 2CETA 2NT1A 1JZ5A 1EO5A 4R27A 4PTXA 2BHUA 5KEZA 4PMYA 4E4PA 3E1F1 1W1YA 2C7FA 3NJ3A 2VTFA 1R8LA 1U2YA 3CZJA 3QGVA 5D4YA 3VGGA 4W5ZA 1B3WA 1XSKA 3PN8A 1K9DA 3CGTA 2QMJA 1PX4A 3L4UA 1J0ZA 4Z2HA 2WMJA 3K46A 5A69A 1JDCA 1V6VA 3A4AA 2XPKA 2ZUUA 2GFTA 5DT5A 3RPMA 4WLCA 2ZUTA 1ISXA 3BMWA 4NRSA 4GO9A 3WF0A 1BFNA 5CLWA 2D20A 1UD3A 1AMYA 3NYDA 3VM7A 2VZOA 1EQPA 2W61A 3RM9A 1ZS2A 3T2PA 4HOZA 2V5CA 3VMOA 4U2ZA 1HP5A 1J0IA 1GQLA 2YA0A 4N0RA 3NDYA 1NWUA 5BXPA 1OGSA 1XGZA 4MDOA 4AZCA 1LL6A 2YL6A 2ZWYA 3MU7A 4NI3A 4K68A 2VX6A 3ARWA 4W88A 2G3IA 1VB9A 2CKSA 4M24A 4PTWA 4W8LA 1LLOA 1K9EA 3BSGA 2PWFA 1VEPA 3AS1A 3W6MA 2WBGA 1EDQA 3VIIA 3DYPA 3UCQA 4AIUA 2WHMA 1XH1A 1V3MA 4W8AA 3EBVA 3KL0A 1C7TA 4R5EA 3NCOA 2YLAA 1JF5A 3OIHA 4MNJA 1B30A 1E4LA 1H3GA 4AISA 3WF3A 1ISWA 2YOCA 2DSKA 1OT1A 2Y5EA 2F61A 2O9RA 3UG3A 3TTOA 2VCAA 2Y24A 3PTQA 2F2HA 1JI2A 4HMDA 3CZGA 3DHUA 3O2LA 1JZ4A 5BRPA 4U31A 3GXIA 5JIPA 3CUHA 1E43A 4KRTA 2ZX7A 4TVUA 3M07A 2O9OA 5A8PA 5HBFA 2VRJA 1M7XA 4ACYA 3WQWA 1GOOA 5BROA 4MPKA 2GJRA 2VJXA 1VJZA 4JFVA 3L4XA 3B9AA 4P8VA 5LA0A 2J25A 2WMHA 4YPJA 1W2VA 4N42A 3B8SA 3FHQA 4WKHA 4TUFA 4WKFA 1UWTA 4PMOA 4UCFA 2ZE0A 4Z2KA 2FH8A 3AIUA 1JZ6A 1S46A 4PUDA 4UFLA 2VL4A 3BLPX 5ABHA 1GQJA 4UQAA 2WB5A 4AZBA 3WEOA 1JNEA 1MXGA 4B3LA 4MNLA 1C90A 3RILA 4W5UA 4CKQA 1NARA 2E9LA 1VAHA 1V3JA 3ALGA 1PPIA 4Q22A 1J12A 1UKQA 3WEZA 3ZR6A 4AMCA 1DEDA 1OCQA 3EMCA 3SUVA 3VIPA 1OM0A 2C8NA 3VNYA 2IXVA 6CGTA 3WL0A 1J01A 4MJ4A 1J11A 2A3HA 3VDAA 4J3XA 3B9DA 1J9YA 1KBBA 3TOPA 2VZTA 5I0DA 1Q6EA 4BQ4A 4UFKA 1QHPA 1HL9A 2DT3A 2DT2A 3IJ9A 2W5FA 4WJXA 3ZT6A 1B3ZA 3GXMA 1JIBA 4KRUA 4NF7A 4OKDA 1BF2A 1IV8A 1ZL1A 2XWDA 4FLRA 1X1NA 2FHBA 4JFUA 1Q4NX 3VOCA 1ISYA 3K4AA 1GOIA 3F5LA 1QI5A 2BV9A 2UY3A 2VQTA 4PBGA 3IAQA 5D9NA 3WF2A 1UH4A 5IHRA 4E8CA 2VZVA 1Q6FA 1LWHA 1DWIM 4CGTA 2JIWA 4H04A 3MUAA 4UQCA 3CHDA 1BVNP 1ZBCA 4FMVA 1V02A 2XFRA 4AC1X 3VVGA 2E40A 3VU2A 1CLXA 1E3ZA 4IPNB 1CYGA 2J8FA 4QAWA 2NSXA 2WPGA 2PC8A 2G3JA 2G4FA 3W53A 5FCZA 2ZX6A 4DWSA 3MMUA 6A3HA 1WZKA 1V08A 3SCUA 3DECA 4AZIA 2WC3A 5IXEA 3W24A 3VM5A 1J0KA 3NUKA 2X0YA 2Y4SA 4MB4A 2ZUNA 4EE9A 3AIVA 1UOKA 1GORA 1QVBA 5JBDA 2VVNA 5LA1A 1V0LA 2D0FA 3AMCA 4ZXOA 3ZO9A 3WL1A 4GIAA 4HPHA 1XSIA 1JAEA 2VOTA 1CXLA 1PX3A 2YLLA 3MUY1 1OWQA 3VD9A 4PEEA 2XVNA 3SCWA 5IFTA 2WWCA 3T0DA 2YA1A 1HN1A 2OWXA 3PZQA 1FHLA 1GOMA 4D6FA 4AIOA 5AYIA 3F4VA 2CERA 5I6SA 1CDGA 3WFZA 3TP4A 4U5IA 2E4TA 4B9ZA 1PIFA 3MKKA 2GJXB 4CD5A 3AFBA 1JNDA 1J10A 3U57A 4GZJA 1EQCA 5CZKA 1JYVA 2XHYA 1HX0A 3FHAA 3W38A 3I3DA 3FNDA 3VD5A 4YN5A 1MXDA 3S6TA 1E56A 4JHZA 2ZXQA 3VD4A 1DWJM 1L8NA 2QMKA 4JL1A 1CIUA 2VX7A 3IK2A 4UZUA 2XGBA 2RGMA 4JCMA 4CU7A 4NSBA 4MAVA 4QCFA 1QI4A 2DIEA 3OZPA 1QBAA 2WNWA 2X09A 1NWTA 3BC9A 1ITCA 3WN6A 3EDFA 1OGBA 4IPLA 2XSBA 4D6DA 4C7GA 4KMQA 2J7EA 2V3GA 1KXQA 3LMYA 3RJYA 4GXPA 1TA3B 4BCEA 1QNPA 5D9OA 2VCCA 4DWSD 5ABFA 4IUGA 4AD2A 1F4AA 3BCDA 1BG9A 3VGBA 1GZJA 3N18A 4TVCA 5AYBA 2QF8A 5I79A 2XG9A 3NSNA 1UUQA 1E4MM 1WAWA 1FFRA 1E3XA 4D71A 1HJSA 3WUEA 1BGAA 5CPSA 4W85A 4JFSA 1JF6A 2GSJA 2FHCA 2CESA 4PMXA 1CGWA 3DYMA 4XZWA 2EPMX 3OGSA 2A3BA 1ODZA 4GO8A 2ZOXA 4UQDA 4JKMA 4B3KA 4CN1A 3TTQA 1JYNA 2GK1B 3WH8A 2PBGA 5E6YA 2NW0A 1K9TA 3FXYA 1UKSA 3HJEA 1D3CA 5I2UA 5A8OA 2D3NA 1HJQA 2XIIA 4UFIA 1B3VA 4J3UA 2J62A 1W32A 1E40A 4HA1A 4OBRA 1AVAA 3AHYA 4JKLA 2DSZA 1UR9A 2VCBA 3VX1A 1NM9A 2BY3A 5AC4A 3PBGA 1EOKA 2G3MA 5IHSA 3G6MA 2J77A 4JFWA 3N15A 2A3EA 2WVTA 1VIWA 3N13A 3UR8A 1W9XA 1LF1A 1K6AA 4FF5A 3U7BA 1XRVA 4HPGA 5A6MA 1MQQA 1UWQA 4HZ7A 3F5KA 3U5UA 1HJWA 1K9FA 1W3JA 1OGGA 1B3XA 1KBKA 1GPFA 1UR0A 1BGGA 1M53A 1H5VA 3VMPA 3VNZA 4UOJA 4YHGA 3CHFA 1TG7A 3WENA 5HPOA 1PZ2A 3OLEA 1E1FA 5C8BB 4EKJA 4HMCA 2BY0A 2DH2A 1VF8A 2VT0A 3GNOA 1V0MA 3EDJA 3VGFA 2ZWZA 2YL5A 4A4AA 1PEZA 2ZUSA 1UA7A 1R87A 2BVYA 3UESA 1G94A 1W1TA 1Y7VA 1KGUA 4CCEA 1UYQA 4ACZB 1J18A 1JAKA 2DPEA 4MNKA 3AYSA 2D0GA 3WFLA 1XYFA 2WKLA 3D3AA 1J0HA 1VEMA 5AY7A 3SURA 2V3DA 4M80A 4KWUA 4ZEPA 3FN9A 1N82A 1Q6DA 3AI0A 4AEEA 1BVZA 2GVYA 2WMIA 2CXGA 2OYKA 1OD8A 3WIJA 1QI0A 1H41A 1GONA 1AQ0A 1DWGM 1GHSA 2W4XA 2WLZA 5D9MA 4W93A 2XFYA 1OB0A 1RD6A 4BQ2A 3QHNA 4J3SA 2VRQA 2BVDA 1UR8A 3WNOA 3AZRA 3VD3A 3L2MA 3DC0A 3THCA 2PWEA 1E5NA 2C0HA 3SUTA 3W0KA 5DO8A 2UWFA 4DUXA 1PBGA 1JGIA 2EEXA 3A47A 2VURA 3IJ7A 3QHOA 5BXTA 3POCA 5A6LA 1UD5A 3WUBA 4QCEA 3SCVA 3RIKA 1OIMA 5I5RA 1BTCA 3APGA 3K8LA 3BXWA 1UA3A 3UERA 5BCAA 1TVNA 2XWEA 3VIOA 1H2JA 4EAMA 1X6LA 4X0NA 3PZMA 5DT7A 1V3HA 4QLJA 1HKIA 2GUYA 3WD1A 1BYBA 2XM2A 3T2OA 3CHCA 4PMVA 1YHTA 4U33A 2WYSA 5EFDA 1B0IA 1XC6A 1M04A 1XSJA 3W28A 1HIZA 1D2KA 2JF6A 1HVXA 3ZJ7A 3QR3A 3N9KA 4MB3A 2OYLA 1FFQA 4HA3A 4J3VA 2TAAA 1HXJA 3IJ8A 2BHYA 1V6UA 4CVWA 4LX4A 2PBOA 3BCFA 1BG4A 4UQBA 4KGLA 3ARUA 1OD0A 1EDGA 4XV0A 4PMQA 4B16A 2GJPA 3NSXA 1J0YA 1LWJA 2X8RA 3LPPA 3WNKA 2E9BA 3AYRA 1QNRA 3FAXA 1ZB5A 5JIWA 3AHXA 3KZSA 2O9TA 3BH4A 2YIHA 1BSIA 2VX4A 4PMRA 1W2PA 1NWRA 4FK9A 4WKAA 1C8QA 5CSYA 1JDDA 4XX6A 3BAJA 3UG4A 3PZVA 3AZTA 1MYRA 3L2LA 4W84A 4IM4A 2G8ZA 1F4HA 4P8WA 5A6BA 3ARQA 4JL2A 2G3NA 1VBRA 2IUZA 1TCMA 1E5JA 1QHOA 4D6JA 1NH6A 1E6ZA 1XH0A 3BLKA 4P8XA 2J7DA 2CBUA 3ARVA 4LYPA 4AZHA 5E09A 3OG2A 4M56A 1LG2A 1BQCA 4CD4A 1GW1A 3AJ7A 3ZIZA 4ZENA 2FGLA 4OIFA 2X0HA 4QDMA 4ATDA 4UQ9A 2CBJA 2FDMA 3A4XA 3AHTA 1QNQA 4CN4A 4H41A 4BQ3A 8A3HA 1CZ1A 4RE3A 2DQXA 4PCSA 3ZJKA 3AICA 3WQ4A 3VIKA 3CIVA 4OOUA 2FH6A 4P8UA 3AIQA 3ARYA 4MJ2A 1E55A 4F66A 4OBSA 4OJYA 2ESCA 3K8KA 4EANA 2HVMA 1B90A 4NRRA 3G6LA 1G01A 3WH7A 4PCTA 4RE4A 4JCLA 1MQPA 4A3HA 2WZEA 5LA2A 2W63A 5D9PA 4QLKA 1CWYA 3VIGA 4CN6A 1C93A 3BAYA 1UD2A 2D24A 4M8UA 4UR9A 4PYSA 4GI6A 4CVUA 4GQRA 1WZLA 3WD4A 1XCXA 1JFHA 3GXFA 1DWAM 1HKJA 3UEQA 1TVPA 1EXPA 2XVGA 4AZ5A 4BZYA 1MW2A 4U5KA 4C7DA 2DIJA 2Y8VA 2J75A 1W9VA 4GI8A 2JALA 4HZ8A 1UKOA 2D0HA 4AWEA 1SR0A 3WD0A 2WMGA 1LL7A 1MVYA 1CECA 5A6BD 3AIRA 4DUVA 4X9YA 4FLOA 3AMDA 3BAXA 1MQRA 1OBAA 1UD6A 5EB8A 1GUVA 9CGTA 1VJSA 3CUJA 1SMDA 3WNPA 1R7AA 4TXEA 2A3CA 1UH2A 1QNSA 4AZGA 3WQ6A 2YBUA 2YL8A 5A2AA 3HU7A 4LYRA 3ZR5A 2O92A 1MW0A 1EHNA 2D3LA 1Q6GA 2XVKA 5ABGA 3VDCA 1FHDA 4UZSA 1EHAA 1W3KA 4UFHA 4PUEA 3HN3A 5JBFA 3SCOA 3WH6A 1JD9A 2JFEX 3WQVA 3VPLA 3MV01 3PZGA 3AS3A 3ZMRA 1LJYA 2YJQA 3SIMA 4D72A 4HMEA 1E15A 1QW8A 2DDXA 2WHKA 3FAWA 4V27A 1JYXA 1OT2A 2E8YA 1VBUA 3VIFA 4W7WA 2OWCA 2BS9A 2JEPA 4WSKA 5C70A 3RO8A 1E0VA 3QOMA 4HTYA 2FHFA 3WQ8A 3WUFA 5E9AA 1KWGA 1E73M 2ZICA 3VIHA 1TMQA 3K8MA 3AS2A 3CO4A 1E6RA 3KL5A 1P6WA 1UWUA 1PIGA 2XYLA 5D8WA 1QHZA 3M6DA 2WVSA 4S3KA 1XD0A 1VFUA 3BAKA 3RDKA 3PTKA 1UR4A 5IFPA 2NT0A 5IDIA 4AD5A 1VFFA 2W66A 3MMWA 1DTUA 2UY4A 1IT0A 2XFFA 3RM4A 3CZEA 5A95A 2PF0A 3BSHA 3NDZA 7TAAA 4UOQA 1UZ1A 1QPKA 3SCSA 1QI2A 4JKKA 3LPOA 1SYTA 4HOWA 1JI1A 4WSJA 1WDSA 2QPUA 1KGXA 4M81A 4W89A 3PZUA 5CPTA 1BYDA 2VNCA 3II1A 2WLYA 1DWHM 3KE0A 3ZJ8A 1V3IA 2CBVA 3L4WA 4LXFA 5EBAA 2OYMA 4D6HA 3THDA 3ZOAA 2VR4A 1E72M 3I3BA 1YQ2A 2XUCA 3T0AA 2WVVB 4EK7A 3PZ9A 1JZ7A 2E3ZA 3W37A 4LYQA 3AIWA 4JZ5A 1WB0A 3OZOA 3WQ5A 1C92A 3WD3A 3GTNA 5CG0A 1ZBVA 2QHAA 1R7OA 4J7RA 2F8QA 2OSWA 2EPKX 4J28A 5EFFA 2J74A 2ZX9A 3PZOA 5M3WA 1WP6A 2PB1A 1NOFA 4V28A 3POHA 2GK1A 3K4DA 1WCGA 5M03A 5F7UA 3WDQA 3I3EA 3UR7A 5I77A 4HU0A 4RE2A 1W9BM 3SUWA 3RCNA 4D6EA 4PSPA 1EIBA 3TTSA 2J78A 5ABFB 5A2CA 1V3KA 1LL4A 2B31A 4U3CA 3GH5A 4D6GA 2HISA 2WWDA 1EA9C 3PHAA 1QI3A 3GZAA 1E70M 1XHGA 3VIMA 1MFVA 3BGAA 3U7VA 4UTFA 4MTVA 3WDHA 3RM8A 3F5JA 4E8DA 4H8UA 2BVTA 1NP0A 2WW5A 3AMLA 1PZ3A 2XIBA 3N04A 1KFWA 5FIPA 1C7SA 2WK2A 4J3WA 5HDRA 1DHKA 3CZLA 2YBTA 3IAPA 1ITXA 1JL8A 2J7HA 4PTVA 3W82A 2WMFA 1W3LA 3AISA 2Y2WA 1MW3A 2XVLA 3OGRA 2ZXBA 3VDBA 4GKLA 2WSPA 2J79A 1CGXA 3BAWA 1CGYA 2WAGA 2WC4A 1B2YA 3WH5A 5I78A 1HKMA 3K1DA 1HNYA 3SUSA 3VILA 1H49A 5CGTA 2ZUMA 2ZX8A 3B9EA 3T0BA 3GBDA 1E6SM 1GJWA 4FLSA 2ZUVA 3DYOA 4NZCA 4UFJA 3VO0A 2ZX5A 1I1WA 4MB5A 1C91A 3MSDA 2W92A 3AXXA 1VRXA 3UETA 1BHGA 5A6KA 1I75A 1R85A 2D2OA 2FGZA 3W25A 3W26A 4TTUA 2CHOA 4W7UA 4AZ6A 4UQEA 2DSUA 4M82A 4P7OA 5M17A 1H11A 5CPQA 3WMBA 1CBGA 3CTTA 4BS0A 2EQDA 1OIFA 4JAWA 4X0VA 4ZE5A 1CNVA 3AMKA 2G41A 1W9UA 1QBBA 2WSKA 5JBEA 1UG6A 3WNMA 7A3HA 1CGVA 1FP8A 2CNCA 1E0XA 3PZNA 1QOXA 2QLYA 1VEOA 3O9NA 4PN2A 1R86A 4QP0A 3AHZA 3AS0A 2XGIA 2Z1KA 4V2XA 2GDVA 4D1JA 1QW9A 3O6AA 2Z1SA 4ZFMA 3ZM8A 3WDIA 4JHOA 4H7VA 4TOQA 3KEHA 1JDAA 4CUCA 1WZAA 3MUZ1 1V6WA 1HP4A 2VI0A 4AD3A 2VZUA 3MANA 3FY1A 1GJUA 2V3FA 3AQUA 4HZ6A 4MAZA 1B9ZA 2CCRA 2CEQA 3MUIA 1KB3A 3WSUA 4AIEA 5A8MA 1CXEA 1E71M 3GXDA 4DWSC 5A94A 1H1NA 3SCNA 2ZIDA 2PWGA 3WBAA 5A2BA 2OSYA 3PTMA 3WY1A 3M7SA 1SMAA 1WDRA 1O6IA 8CGTA 3CUFA 5CGMA 1XYZA 4UFMA 1GNXA 3WDRA 4LGXA 2WXDM 1ZBWA 2CITA 1CXFA 2ZUWA 3KL3A 1WPCA 3VKKA 2UY5A 4JIEA 4P7RA 1DWFM 4TVDA 1NQ6A 1E6XM 4DM2A 1GHRA 4IISA 3WELA 3VIJA 4Y7EA 3BAIA 2WVUA 5DF0A 1CTNA 1V3LA 2W91A 3N11A 2XJ7A 1CXIA 2WM0A 4WF7A 1CGTA 3W81A 5E70A 1FP9A 1JYWA 1G0CA 2D22A 2VZSA 1E6NA 5I23A 4MDPA 5HXMA 3OB8A 4GZEA 3VTRA 3U5YA 2J7GA 1LG1A 1TZ7A 4P7NA 4CU6A 3NIYA 3ARSA 1H0IA 4OZOA 4AZCB 2DEPA 3EMQA 2VVSA 3SCPA 4OUEA 1KXHA 2JE8A 3A6OA 2ZXDA 1G5AA 2WANA 4PMUA 3SEPA 4ATWA 3VX0A 2EPLX 1BYCA 2UY2A 2W62A 4XUYA 1UWSA 2BY2A 3FW6A 5HNNA 3QHMA 1HJUA 2E8ZA 4D1IA 3OA5A 3TA9A 1SFSA 1HJXA 3PZIA 1HT6A 2X1IA 4J3TA 1GVIA 2YDSA 2WZHA 4Z2IA 1HVQA 5JUVA 3ZQ9A 3VINA 1US3A 3RJXA 2VR5A 3W27A 1GCYA 1M03A 3T2QA 7CGTA 4KGJA 5KZ6A 3L4YA 2J7FA 3VGEA 1MW1A 1TFVA 1UQYA 4Z2LA 3UG5A 1BAGA 2BXYA 1B31A 3GNPA 1W9PA 1KWKA 4RL3A 1IZKA 1HKKA 2CPUA 3ZT7A 1ISVA 3TONA 2AMGA 5FOOA 4DUWA 4W86A 5A6SA 1EDTA 3IANA 1C8XA 3WUGA 4TX8A 2O9PA 3D5HA 2WKGA 3AXIA 1V03A 2WCAA 1FH9A 4QFUA 4PTMA 3OLDA 3ARXA 3AROA 1J0JA 1E4IA 1GOWA 2V3EA 1UWIA 4GPNA 4MB1A 4CCDA 3HMCA 4F79A 3ARTA 2EPOA 4W7VA 4HU8A 3TTYA 1UH3A 1A3HA 2EXOA 3EDEA 1NWSA 5CLTA 4P7LA 3ZJ6A 1HJVA 1CLVA 3ARZA 3AXHA 5BYWA 1WDQA 4CU8A 1W1PA 1DP0A 3CHEA 1KXTA 1W1VA 5ECUA 1JG9A 3ZSSA 2CHNA 2DSVA 4L4OA 2BXZA 4URIA 3WF1A 5TD4A 5A3HA 2BNJA 1L0PA 5BWFA 1PAMA 1ZBKA 2DGAA 3CPUA 3W4RA 3WKZA 3GNRA 4CD8A 3WNLA 4AZ7A 5A6JA 3GYCA 2YDRA 4CD7A 1ECEA 1CPUA 4PMDA 1MFUA 3GBEA 3A3HA 5GNXA 1GQKA 3MV11 1KR1A 4BF7A 1BLIA 1B1YA 1WO2A 1XD1A 1RPKA 2WHLA 1WKYA 2BY1A 5ABEA 3VGDA 1W3HA 4A3YA 3J7HA 4Z2JA 3GH7A 1NP2A 1XH2A 5GNZA 1QNOA 5GNYA 5HOSA 4GZIA 4Q7NA 3WMSA 2J47A 4AYSA 3EDKA 1FA2A 1A47A 1LQ0A 1Q6CA 1ODUA 5A8QA 1E6PA 4GI9A 2ZXAA 5D8ZA 2J8GA 5BXRA 2J7CA 1WNOA 4ZXLA 3MS8A 2JIEA 2E0PA 4XB3A 2YKKA 4FLQA 3BMVA 4B15A 3N17A 4S3JA 1KQYA 4UOZA 1WZMA 2VX5A 3MMDA 1JD7A 3PZTA 3SCTA 3WNNA 5I24A 3CUGA 4PSRA 3WDPP 1E0WA 2VO5A 2XVPA 1E9LA 2Q8XA 3SCQA 1JFXA 2WCGA 3ALFA 3CBWA 2VMFA 5E6ZA 1AQHA 1IZJA 2DH3A 1GQIA 4M1RA 1H09A 3S2CA 4Z2GA 5DMYA 3WH9A 4AXNA 5CQ1A 1X6NA 3GH4A 2PI6A 1UD4A 2OLHA 3WD2A 4D6CA 5E0FA 4AD4A 3ZSTA 1TE1A 4DWSB 2V38A 4YHEA 1V6XA 4W87A 1MWOA 2E9MA 3OBAA 2CIPA 1UWRA 2GJXA 1W9DM 3N1AA 1ZJBA 3AZSA 1GOQA 1CEOA 1UR1A 1O7AA 5GQBA 2VRKA 1XV8A 5CJ5A 1E1EA 1FH8A 1GVYA 2IXUA 2J4GA 1ISZA 4F9DA 4ATLA 1UR2A 4TTGA 1V0NA 2YDQA 3MSGA 2XTKA 5FKYA 2OSXA 1RH9A 2V5DA 1E6QM 5C71A 1UD8A 2EBNA 1TUXA 2GDUA 3CMGA 5DEZA 4XZBA 5E0CA 3AIEA 4AD1A 3EDDA 5CXPA 6TAAA 1TA3A 2WVVA 1ZU8A 2PWHA 3CH9A 3W6LA 1WDPA 1VENA 5A1AA 2DT1A 2VQUA 1UHVA 4HA4A 2WMKA 1Z32X 1BPLB
chains in the Genus database with same CATH superfamily
3ARRA 3ARPA 2EPNA 5CSUA 4C65A 2JKPA 4AY1A 1KM2A 4E3TA 1FVPA 4F48A 5I3DA 1JZ3A 2BFGA 3WJWA 1VFHA 2PWDA 4M5PA 5C7VA 1KCLA 5HJXA 2D23A 4XK2A 3VDHA 3RYSA 3QJAA 4IFRA 4XO7A 1F6YA 3GDKA 1REQB 3EB3A 4Y90A 2WBKA 3HPXA 4CEXC 2HROA 3W00A 3M1ZA 4S3DA 1TRIA 4FO4A 5BXSA 1EGZA 1NQKA 3BQ6A 5DMLA 3SCRA 4EXQA 4ONVA 3I10A 3E38A 3JVAA 3EYPA 4RZ6A 2BHZA 1OINA 5XINA 4DZAA 4K3ZA 2ALRA 1W5NA 3MQTA 3ZWTA 2W3ZA 3G22A 2VUYA 3W29A 1FKXA 2AOSA 2P76A 2JGYA 3C8NA 3WF4A 3NZGA 1K6WA 2FTPA 3LPFA 5AC5A 1I8JA 2FPTA 3U48A 4BY3A 4A3QA 1OF6A 3FA4A 2PP3A 4ZA0A 4FNPA 4IIFA 4ZO8A 3ZT5A 1XI3A 1LORA 1U33A 5EMYA 1NY1A 3B0YA 4K38A 5F4SA 1KR0A 1QTWA 3NDOA 3NL6A 5FAGA 3EA3A 3KHJA 3ID7A 3IUIA 4C7FA 1H7OA 4DF2A 2CYGA 1JZ8A 1ZCOA 3GUGA 2FB3A 3GDBA 3AIBA 3GFYA 1JPMA 1NELA 4HSOA 3IARA 1LRNA 3HGRA 4ACZA 3S2NA 1BYAA 2GUUA 3BJSA 4JBRA 2FZDA 3RMEA 3SUUA 1TR1A 2OWWA 2PUZA 2H3BA 1EO7A 3L5MA 1VFOA 4O12A 4HNOA 5F4XA 3UNTA 4QR6A 2XM1A 4XAFA 2E7FA 3S1WA 3NQEA 4IHCA 2ISFA 3GYEA 2A3AA 5BU6A 3W7GA 1GVSA 3LGGA 4BQ5A 2DZSA 3HURA 3L4TA 2EO7A 4Q8PA 4C1NB 2ISVA 3WLHA 3PSVA 3WBEA 4DXXA 4L4PA 2QQ6A 2DIKA 4M6VA 1G9HA 4O4WA 1UASA 4XBJA 4NZJA 1UKPA 3D0CA 1I6NA 1Y5WA 4Q4SA 1WBHA 2CKRA 2X05A 4C6MA 1KQZA 3EMZA 4H2CA 1D7FA 1GT8A 3MWAA 1CGUA 2RDWA 4P7QA 4AD0A 4C6BA 4REQA 1YADA 2Y1HA 4R85A 3STCA 4M29A 3TJIA 5C7HA 1PZ1A 2NT1A 2FQIA 1EZ2A 1XUUA 1EO5A 4R27A 4PTXA 1A5CA 3RX4A 4QBXA 3M0LA 2VTFA 1U2YA 3H26A 4W5ZA 1B3WA 1R3SA 3PN8A 2DV0A 4Z2HA 3C0SA 1V6VA 2XPKA 4ZO9A 4DB7A 2OKOA 4KF1A 4RKAA 1XDMA 5DT5A 4L65A 1ISXA 3BMWA 2POZA 4H9UA 4LUJA 2YR1A 1LLWA 4GO9A 2D20A 2B0MA 3UWEA 3GX9A 3NQMA 2OKTA 3VM7A 4K36A 3RM9A 5HATA 1FWBC 3S8HA 1VCGA 2V5CA 1NIUA 1HP5A 1GQLA 1NWUA 4C6JA 2VWTA 4DBUA 3VUSA 4S2CA 2P5NA 1K77A 4CNNA 1JQVA 4NI3A 4K68A 2RFGA 2VX6A 2YZRA 1AH0A 4JDYA 4PTWA 1XLCA 4W8LA 3RMJA 1K9EA 5TF0A 3LCXA 3HPAA 4MIMA 3R25A 5I3HA 3QV6A 3EKGA 1XH1A 4W8AA 1HTIA 1G67A 4R5EA 5CGQA 3XISA 3V0UA 4GX9A 1B30A 2A21A 4AISA 4UTWC 4J5NA 3LEPA 3PVFA 2OU4A 1LQ2A 3QZAA 2VCAA 1JCYA 3H54A 5F2GA 1JI2A 4HMDA 1JZ4A 5BRPA 4U31A 1Q6LA 2BODX 4LAOA 1IEVA 1LBFA 3QLDA 4TVUA 3WBXA 3FIGA 4P61A 2VRJA 3QMSA 3OO2A 4JEJA 2Z1WA 3TW6A 4ACYA 1PCWA 2VJXA 4C91A 1XLMA 3L4XA 1IXPA 4P8VA 4YPJA 4DPQA 3B8DA 1ITQA 3B8SA 3FHQA 4Q6JA 4B90A 4DNMA 4DJED 3N2XA 3ABRA 1JR1A 1XLJA 4LS0A 1F8IA 2FH8A 3B0VC 3LN3A 4TV6A 4EXBA 3H2FA 4Y9MA 2BP1A 4DO5A 3G0UA 4UFLA 3VKAA 3I7RA 1JNEA 3QKZA 3IVTA 1G4SA 2HK1A 2E9LA 3UZXA 4HB7A 4LUTA 1JRBA 4O28A 3IGSA 4Q8OA 2ZZ5A 3SO7A 1DEDA 2VOMA 1WXJA 3SUVA 4GH3A 1VZWA 1OM0A 2C8NA 1MDRA 5AHNA 3F4CA 3NQCA 3H7VA 4ZL1A 3ENLA 1TJ2A 4J3XA 3B9DA 2KZHA 3FYYA 2R1LA 3H2CA 5HMDA 3C3UA 3G1AA 3R2GA 1Q6EA 4BQ4A 2Q6ZA 2DT2A 2NVCA 3LK6A 4Z17A 3DHDA 3MKCA 1B3ZA 2OODA 1JIBA 4KRUA 2DZVA 3DKLA 4UTLA 4DZIA 1ZL1A 1O12A 2XWDA 5AYYA 2NXHA 3CB8A 3VOCA 4YTSA 1IEIA 1TQXA 3G0XA 4O1DA 3F5LA 5JU6A 2BV9A 3IAQA 4YLWA 3UZYA 4AX6A 4O1CA 2Y61A 3UR5A 1U5VA 3MUAA 1AJZA 4FNSA 1ONRA 1HQTA 3O0KA 3CHDA 2PDHA 1OX4A 4L61A 4AC1X 1Q63A 5FF2A 1CLXA 3TUUA 1E3ZA 2DY3A 1FCQA 2J8FA 1XYAA 4INFA 1GTEA 1BSLA 2G3JA 2G4FA 4O52A 4Y2WA 1DBTA 4DXKA 1RJQA 4UMBA 5FCZA 4AB4A 5G4WA 3MMUA 1ZPTA 1OG0A 8XIAA 1XS2A 2E67A 1G6CA 2HJPA 4AZIA 2WC3A 5IXEA 3ZXWA 3VM5A 5MHBA 2Y4SA 3BICA 2ZUNA 3I6TA 5JBDA 2VVNA 4H3DA 1V0LA 2D0FA 4KEZA 3ZO9A 3URBA 3R58A 1IF2A 3WL1A 4GIAA 3TE9A 1SQ7A 1WA3A 8RUCA 1JQXA 1CXLA 4E4FA 3B3DA 3PG8A 2YLLA 3TWBA 4I7WA 3VC6A 2ZTKA 2XVNA 2QUMA 1FHLA 1VS1A 1K1DA 2TRSA 2DZUA 3T0CA 2CERA 4XZHA 4AF0A 3H2EA 4DYEA 2E4TA 1V7AA 2HMCA 3CQIA 3O07A 2JGQA 1RA0A 2GJXB 4CD5A 5F2MA 1XDLA 2PGFA 1JNDA 3DENA 3K1GA 4GZJA 1J4EA 3P81A 1DIKA 1EQCA 1JYVA 1XKYA 4NAEA 3VNJA 3FHAA 3VD5A 1Q13A 3T4CA 4KWWA 2ZXQA 1LOLA 1DWJM 1H62A 4B91A 4DZHA 1K8XA 4CU7A 4NSBA 1F6PA 4MAVA 5H6HA 3TZFA 1QI4A 2J9XA 2DIEA 3LI0A 1QBAA 1P7TB 4RLIA 4E2DA 2WPBA 1TB3A 4DHGA 3WN6A 3M16A 3QZ6A 1SZRA 4IPLA 1OGBA 3DOPA 2PF8A 2XSBA 2B7NA 4JTHA 4D6DA 1KXQA 3TXZA 3UCDA 2ZVIA 1BXNA 1XFCA 2WQPA 4JN8A 4IUGA 3WG6A 4AD2A 1F4AA 3S83A 6XIMA 3VZYA 1YRRA 2IQ0A 2GVEA 3WJSA 4GI4A 3NSNA 1E4MM 1HJSA 4IGHA 5FF4A 4L7ZA 1EC8A 2ACQA 1W56A 4GC3A 1K8YA 2AKZA 4A22A 1FWRA 2BG5A 1JF6A 2X1SA 4MLRA 2R24A 1XQLA 2E28A 2CWXA 4YJ5A 5C9WA 3FSTA 2A3BA 4GO8A 2ZOXA 5JMUA 3A9IA 3N2BA 4CN1A 1JYNA 3KS5A 4QXIA 5HQEA 1S2CA 3M44A 3LY0A 1F3TA 3FXYA 1D3CA 1G4EA 5I2UA 2J66A 5A8OA 3PFMA 5CZSA 3G3MA 2Y7EA 3PBUA 4HA1A 3AHYA 1OQFA 2DSZA 4H1ZA 4F40A 2BY3A 4GGBA 1EOKA 4O1BA 4MWAD 3KCJA 2Q09A 1C8VA 4JFWA 2QJNA 3NXLA 1BD0A 1UUOA 1W9XA 4B2DA 1K6AA 1KCZA 3BLEA 4HPGA 5D33A 3F2DA 4ZFCA 1Z69A 1K9FA 1OGGA 2XN1A 4MJZA 1UR0A 4NL1A 3RU6A 3VNZA 4LRSA 3FSUA 4YHGA 3W7IA 1TG7A 3WENA 4C6OA 3MP5A 1XRFA 2OJPA 5RUBA 3RX2A 1QK2A 3SY1A 3IJDA 1W5OA 2ZWZA 2YL5A 4L6DA 2W6RA 4IPIA 2BVYA 1G94A 1W1TA 1Y7VA 4ZQCA 3OYXA 2HVNA 2C19A 2HNHA 3SRHA 4HNNA 1J18A 4RK8A 5G2HA 3P82A 4QS5A 4KFOA 5AY7A 3SURA 1OYCA 4XG1A 4KWUA 3OG3A 2OT1A 3LQGA 3C3NA 5FEPA 3ATZA 3RG6A 3TC6A 3NQFA 1MRQA 4IPPA 3W76A 2NQLA 3Q94A 1H41A 1GONA 1AQ0A 4XZLX 3KS6A 3NM1A 3E5BA 1GYNA 2QUTA 2BVDA 2NLIA 2VRQA 2FTWA 4MFEA 3WJYA 4XVEA 3E5PA 4RNJA 2PFHA 1XLFA 2TPSA 3DC0A 2ABBA 2E6DA 3SUTA 1X98A 4DUXA 1JGIA 2HCVA 3IJ7A 5A6LA 2HS6A 1OIMA 4K8EA 1UZDA 4JTJA 1Q66A 2A0NA 1XIBA 2DVUA 3MZ2A 3P8JA 1UA3A 3IJQA 3EX6A 3RO6A 1TVNA 4I6VA 3VIOA 1X6LA 1U5JA 2AQWA 4JIIX 4NJKA 5C2CA 4JPGA 3WD1A 4XD6A 4S3CA 3T2OA 4D2JA 1S5TA 1VIZA 3DU0A 4DWDA 1B0IA 3V1PA 1OX5A 1XC6A 1UIPA 4JTLA 3W28A 5D02A 3SRDA 2JF6A 1HVXA 4HK6A 1KM3A 3N9KA 4DI8A 1X96A 1HXJA 3IJ8A 3HG2A 1V6UA 4PRTA 4LX4A 1BF6A 3GFXA 1F07A 3H7RA 2BZNA 3B9NA 4OV4A 3PS7A 3P61A 4PMQA 4F0KA 3RRXA 3NSXA 2O0TA 2X8RA 3WNKA 2QIIA 2E9BA 2J88A 4RX0A 3ITLA 1JCLA 1QNRA 2CLLA 3FAXA 1ZB5A 4XUGA 2YIHA 1R38A 1BSIA 4GE8A 1W2PA 1NWRA 2QCNA 3GW3A 2CLIA 4JS3A 4WKAA 3AUJA 3N3MA 3BAJA 3BLIA 2DJLA 3L2LA 2G8ZA 3UBPC 4NY2A 4JL2A 2E5DA 4EXAA 1EP2A 2G3NA 4ROPA 1XR2A 3HJZA 2VWSA 3N3TA 2IPJA 4IOTA 5AFDA 4PB5A 1ZAJA 3S47A 4B5NA 2J7DA 3KDNA 3ARVA 5CG7A 5E09A 4M56A 1OC6A 3GHSA 3U2EA 1LG2A 1BQCA 2WSQA 4O1FA 3AJ7A 2ZADA 1PTAA 4HNUA 2Y88A 4ATDA 3L0NA 3QM3A 4ZB0A 1FWHC 1ZUAX 3P74A 4UQ9A 2CBJA 2FDMA 3W83A 4A35A 3APTA 4OE7A 3AHTA 4G7FA 2P3ZA 4A21A 3QQ0A 3L0GA 4QAIA 4BQ3A 4RE3A 1A3XA 3AICA 1RVGA 1A5OC 3ARYA 4MJ2A 1H51A 4F66A 1TV3A 3ANUA 1VYSX 4FI4A 5KITA 1G7VA 3UWWA 3W2LA 2JKEA 1G01A 1X39A 1MQPA 1F7BA 3MZNA 3R4IA 4A3HA 3TFCA 5LA2A 3LYEA 1BRLB 4QLKA 1CWYA 3VIGA 1AK5A 1C93A 1UD2A 4M8UA 4M3PA 2BOGX 1LOSA 2HE5A 5HNRA 4CVUA 4GQRA 1DWAM 1AZ2A 1AD4A 3W2UA 1MW2A 3H12A 4U5KA 1MDLA 4JQ1A 3G0SA 2JALA 4QGCA 4HZ8A 1AODA 1MVYA 3C52A 3NA8A 3C4UA 5HJLA 4GYPA 3W07A 1TQJA 1OBAA 2PTXA 4G56A 5IM51 4W4QA 3O6YX 5DXYA 5AC8A 4TXEA 4RV3A 1A4MA 1XLEA 4OQVA 3Q37A 1X8FA 3DG6A 2UV8G 5ABGA 4Z1YA 1FHDA 4UZSA 5LSMA 3R6IA 2YYUA 3SCOA 2A7NA 3EEGA 2ADAA 1KKRA 2ABAA 5E9XA 1C9WA 4QSHA 4YS1A 1FWNA 3PG9A 3ZMRA 5T26A 3SIMA 4D72A 4RJEA 4HN4A 2DDXA 1QW8A 3DGRA 3JZUA 4J40A 3FAWA 2ZRUA 3RK8A 1IXOA 4PODA 3MI3A 3W70A 3W85A 1S38A 3T05A 2OGJA 4HTYA 1UW9A 4YL2A 3VOHA 4H7CA 2XH0A 3DGBA 3VIHA 3R7MA 3GXTA 3HQOA 3AS2A 3HMJG 1XIFA 4RXFA 5D2VA 3CO4A 2IKHA 1TPB1 3G8RA 1UWUA 5D8WA 2WVSA 5EL1A 3W87A 4FNRA 4GQBA 1FKWA 2Y7DA 3RDKA 4HCLA 2PTYA 1UR4A 4MUZA 2NT0A 4AD5A 4GNVA 1VFFA 5K9DA 1BWKA 4I3GA 1VBGA 2XFFA 4PZVA 3M4HA 4XKYA 1WV2A 7TAAA 4YYCA 3BGJA 2HPMA 3SCSA 3NOEA 1C29A 2QAFA 1BTMA 3LPOA 1JI1A 4WSJA 1KGXA 2ATMA 4M81A 2HS8A 3PZUA 1V6TA 4B5VA 3PWIA 3QGAC 1PTGA 3II1A 2DUZA 3TYUA 3LOTA 1TKKA 4LXFA 1TTQA 4QJ1A 4R34A 2NUXA 3KRZA 4KRZA 1J6PA 4Q4KA 2IPFA 1OFBA 4KWVA 1TPH1 2FZNA 3BG5A 1WB0A 1LROA 3OZOA 3NPXA 4QE4A 1C92A 3TC7A 2QHAA 2OQLA 1ZSXA 4HHPA 2EPKX 3KOFA 4J28A 4ZTXA 4LW7A 5I3KA 2PB1A 1NOFA 3CM4A 3LA4A 5F4WA 3A9BA 3W1XA 1C9DA 4CQCA 3L67A 1QMLA 1BWLA 2OO0A 1W5MA 3LRMA 3H4WA 4WXYA 3SUWA 2CZFA 3H2AA 4D6EA 1VCVA 1EIBA 3DAQA 3QFEA 4L9XA 1LL4A 2B31A 3GTXA 4HGXA 4U3CA 4BJHA 4D6GA 3UA4A 3REQB 2WWDA 4KERA 5CPLA 3GZAA 1RD5A 4E8DA 4UTHA 4H8UA 1XIMA 1FDJA 3TQPA 1M5WA 2XIBA 3N04A 4Q4RA 2WK2A 2OLSA 5HDRA 2Y5JA 3QQ1A 2YBTA 3L12A 2J7HA 4GABA 4YWSA 4X63A 1W3LA 1MEHA 5EMJA 4HU3A 3UY7A 5H91A 2HQAA 3BLDA 4XAZA 2QJHA 2WSRA 1EEXA 3ELFA 1HNYA 3G24A 1GJWA 4CNUA 3IV3A 3W23A 4NZCA 3F4DA 1C91A 4RPQA 1IIGA 1CI1A 1S3HA 5LHEA 2OZTA 4Q8WA 3UY8A 3S9ZA 3MBDA 5A6KA 1R85A 2GVJA 1Y8BA 2BBFA 2CHOA 4NZ3A 2VGIA 3IACA 4M82A 2J13A 2PD5A 1VBJA 5M17A 5CKSA 3IIZA 4ORMA 4JAWA 1VLWA 1IEXA 1XCFA 2G41A 1QBBA 2W0UA 1Z44A 7A3HA 3SY8A 1WUFA 4R9OA 2CNCA 3MYPA 3S5OA 4QP0A 4PN2A 2YCEA 5CJNA 3AS0A 2CZ5A 2RHGA 2XGIA 2Z1KA 4XAPA 4R9XA 1W3TA 5AHIA 5DCDA 3TC3A 4AU0A 3O6AA 2I56A 4ZFMA 3R13A 1AG1O 4ADSA 3KEHA 4RDVA 1XIJA 4ZSTA 4LNYA 1V6WA 1W37A 4AD3A 2WJEA 1GJUA 4MAZA 1B9ZA 3MUIA 1VFTA 4GRSA 1CXEA 1E71M 3PWAA 4GWEA 4LUYA 4DWSC 3CL6A 3EX4A 2XINA 3MC5A 3OJGA 3SN0A 3URQA 4GYKA 1H1NA 2PWGA 3THAA 2OSYA 1LUCB 3PTMA 1G4TA 4GG9A 3SJ3A 1WDRA 3CUFA 3UZZA 1GNXA 1S2AA 3WDRA 3SGUA 2CITA 1EP3A 3QQWA 2C71A 2ZUWA 3M0HA 3Q4DA 1QPQA 4DN1A 4M7TA 4LUIA 1YDNA 1DWFM 3HQNA 1QO2A 1JCJA 1NQ6A 2GYIA 4RXGA 3PULA 3WELA 4MKNA 4WEVX 2V5KA 5F1UA 4ZMGA 3QR0A 2J9YA 3BAIA 2UBPC 4ZTYA 3N11A 3WCZA 2XJ7A 3P5YA 2WM0A 1X1OA 1P5BA 1CGTA 2G4JA 1FP9A 2VZSA 3W7RA 5HXMA 2VEKA 5G5IA 3VTRA 4R53A 3R5EA 2ISWA 4GMEA 3ARSA 1UR3M 3EMQA 1EP1A 3KCOA 3L5AA 2OO6A 3BDKA 3DXIA 3UJSA 1R47A 2WANA 3SEPA 4H8NA 2EPLX 2UY2A 2W62A 1UWSA 3O1NA 4PFHA 3GUWA 3QHMA 1YW1A 3TYDA 3TA9A 1SFSA 3PZIA 4ENLA 2DFAA 5H2ZA 1FXQA 1GVIA 4JNMA 2V9DA 1R5YA 3QV7A 1US3A 2VR5A 4ICMA 4LAMA 2QEZA 5FEXA 1F2JA 3VGEA 4JTEA 3PNZA 1MW1A 4Z2LA 3FKKA 1BAGA 3MW7A 4NNAA 1W9PA 3LGDA 1KWKA 1ISVA 3L65A 4IMGA 3TNOA 1ZY9A 2AMGA 3TONA 4DUWA 2BLEA 3LLDA 1EBGA 3ZZ1A 1C8XA 4TX8A 3U3HA 3GXPA 4O15A 3S42A 3AXIA 3QXBA 1BRLA 3SECA 2WCAA 1XINA 3A3WA 3AROA 2GGGA 4MB1A 4CCDA 1FWAC 5HA7A 3ARTA 4W7VA 4HU8A 1A3HA 1H7PA 1Q65A 3BTNA 5AN7A 3C86A 1CLVA 3ARZA 3UGVA 2OQHA 4QIUA 4LCRA 2VUNA 2C13A 4URIA 3WF1A 5TD4A 1L0PA 2VC6A 5AZ1A 3FXGA 2DGAA 1R2TA 1ZBKA 3E02A 3WKZA 1TMHA 3GYCA 1ECEA 1CPUA 4FXSA 3WK0A 1MFUA 3GBEA 5GNXA 1ZHAA 3LI1A 1KR1A 5DMNA 5CC7A 3IIOA 5CCZA 5EY5A 4QJ3B 2WHLA 1WKYA 4DJDD 1DTNA 2V63A 1RPXA 1BKSA 2FYMA 4JDBA 3EOLA 1I0DA 5GNZA 3TAOA 5GNYA 4Q7NA 4P5UA 4JTCA 3EDKA 3RCMA 2QUUA 1FA2A 1Q6CA 2XIMA 4WY0B 1CB7B 1ODUA 2OCZA 3N6QA 2QDGA 5HR7A 3SQLA 5BXRA 3E9AA 3EB4A 4O17A 2NQ9A 2C15A 4ZXLA 2EG8A 3LD5A 4DAIA 2JIEA 2E0PA 2QJMA 1IR2A 4LANA 1F9CA 3NZ1A 3N17A 2NWSA 2GGIA 4RZ4A 4LUSA 1FWCC 3N73A 1WZMA 2VDIA 3MMDA 2IS7A 2AL2B 3IIVA 3FKRA 1TV2A 2XVPA 1TPC1 4FX7A 3EOEA 3ALFA 3CAVA 4S38A 2VFDA 1GQIA 5I00A 3OOQA 2JBMA 2NXIA 3GH4A 2RDUA 2PI6A 1LRTA 1O94A 3S4TA 5LIXX 3FVDA 3WD2A 2ZRVA 3VCCA 2ACRA 4YHEA 1PKMA 4E0CA 4W87A 2E9MA 3O05A 1UWRA 1W9DM 4JIHA 1ZJBA 2OTDA 3TCSA 3G1XA 3AZSA 3A5VA 1CEOA 4G5DA 1O7AA 1LLZA 4PUMA 1PL9A 1XYMA 3NM3A 4LF2A 4LBSA 1UR2A 4WOZA 2G5WA 5HQLA 3C61A 3STPA 2YDQA 2XTKA 2V5DA 4PCNA 1OVDA 3R89A 5C71A 1UD8A 2EBNA 3CMGA 2BB0A 4DYKA 1DJIA 1Z42A 3TDFA 2INEA 3B40A 2O56A 2PWHA 3CH9A 2HBVA 2E1WA 3W6LA 4BFAA 5A1AA 3BSMA 1UHVA 1EB3A 3UT0A 3SIZA 4LRTA 2P53A 2Z7GA 1H0GA 1XXXA 1WE5A 2J24A 3GR7A 4L5ZA 1NOWA 2VP8A 1NDZA 1FH7A 1KXVA 3GHUA 3UGRA 4JQ2A 3GSMA 4IF2A 1FCVA 3CUXA 1ZJAA 3AOFA 1PJ9A 1SO4A 5CSRA 4IIEA 4ZSUA 7ENLA 4ML4A 3SFWA 3E2SA 2J7BA 3MO4A 3AUOA 1R30A 3VABA 1NU5A 2G0WA 3REQA 1IWAA 2ZVRA 3PPFA 3P14A 3KOZA 1I1XA 3LSBA 4MHBA 4JOMA 1OYBA 4D6IA 3VD7A 1Q7ZA 3CQ0A 3MUXA 7PTDA 2ZYFA 4WSHA 5A8NA 1XLLA 3QV8A 3ES8A 1R9XA 3TMQA 3OA3A 3T08A 1RUSA 3M0KA 3S6DA 3E49A 1T5AA 1S5WA 1XBYA 3S5NA 1KV8A 2P50A 3BV7A 1OC5A 2ZZ4A 5T9BG 4J27A 4MYAA 2PLMA 3L4VA 4IFKB 3L4ZA 1RBLA 4EPBC 4C6QA 3VUPA 3EWWA 3WK1A 2WNNA 3N14A 3O16A 3WLSA 2YL9A 4MADA 2GJLA 1OABA 2WHJA 1QFEA 5I06A 5D2TA 2O55A 3TK7A 4A8LA 4ES4A 4LQ1A 5CC3A 2W67A 1E1CA 2FZ8A 4AWUA 1UPPA 4IFOA 3W86A 3CB3A 2Q3OA 3WEMA 4ERIA 2EJ1A 3HTWA 1FCUA 3TW9A 5KZDA 3W72A 1GZGA 4BA0A 5REQA 2D1ZA 3M7WA 1XWYA 4OUIA 5LYRA 3CZKA 4F9JA 3WMCA 1DJNA 1H50A 1VYPX 1E4NA 4HOXA 1VPYA 3KP1A 4CLMA 4CCCA 1A0DA 2NV1A 1JXJA 4E38A 4IMCA 1UZ4A 1PV8A 1TR9A 1KCKA 3MSRA 3UCCA 4ERGA 2XZ7A 3TZNA 2AAAA 4H9TA 4YXGA 3ZR4A 4FF7A 4H8VA 3QBUA 1M7PA 3TTEA 1NFGA 5HJYA 1EYEA 2CBIA 2OX1A 3UFYA 1ELSA 2V30A 3VKBA 3U2ZA 2G97A 5EKYA 1JUEA 1FBAA 1LZOA 1NJJA 3VKCA 1AQMA 1DOSA 4JIQA 3OLIA 3GK0A 2HV5A 3W7JA 2BHUA 1HUVA 4E4PA 4Y96A 1W1YA 5D4YA 5J5DA 3SR7A 3QGVA 4WDWA 1T0OA 4JTAA 2J6VA 2OOFA 1I9CB 1IGSA 4XAYA 4K39A 3K46A 4K2SA 5A69A 1JDCA 4IP7A 3N2TA 1H7XA 3PBWA 1B4KA 4WLCA 4FNUA 4Q6XA 3WF0A 2R14A 3CWHA 1BFNA 1UPMB 5CLWA 1UD3A 5DLCA 1U1UA 1PYMA 1XF0A 1Q2SA 4HOZA 2CLKA 3QW3A 4H83A 3BL3A 4U2ZA 3BW3A 5D09A 3QW4B 4QJ5B 3KP0A 1QPNA 1EGMA 1OGSA 1XGZA 4LV9A 5AYZA 1KRMA 3R8HA 3C5QA 2IPWA 3P80A 2ALDA 5HMFA 1P43A 4NJIA 3UW6A 3QPZA 3LNMA 3C0LA 4W88A 2CKSA 3LERA 1LLOA 2J6XA 1O4UA 1R3QA 4HNLA 2OZ8A 1VEPA 2BOEX 2V81A 4H9YA 2DZXA 1EDQA 3QSRA 3UCQA 1SJCA 3B0UX 4C1LA 1DJWA 3TQ0A 4O50A 2YLAA 3W7CA 3WQGA 4IPJA 2VEIA 2HE8A 4AWTA 3HBLA 1ZGDA 3RLHA 2YOCA 3OVRA 1OT1A 2Y5EA 2VD9A 4MKSA 2F61A 3PTQA 2F2HA 1NAL1 2GQ9A 3MDUA 3GXIA 3CUHA 3MI2A 4KRTA 4WDXA 4LOCA 4IH3A 3MJYA 2O9OA 5HBFA 4GISA 5GVJA 4L80A 2HVOA 3WQWA 2XN0A 3WLPA 4JFVA 3E2QA 3K4WA 4OHQA 3B9AA 5I02A 4L64A 5LA0A 2R1PA 1W2VA 2D73A 1ADOA 2PTDA 5D05A 2POTA 2V2HA 1TUFA 4PMOA 4Z2KA 4C60A 2AAMA 1PVNA 3AIUA 1JZ6A 4AH7A 4UQAA 2WB5A 2H9AB 4AZBA 1KO0A 4MNLA 3Q2DA 1VAHA 4Q22A 3G1SA 1EJTC 2D69A 3V5FA 2ZRWA 1OCQA 4US5A 4O4VA 3WZ0E 3VNYA 3VOJA 2QCDA 6CGTA 4OTKA 3THQA 5AZ0A 1J01A 1R0MA 2EKGA 1J11A 3URAA 3DZ1A 1TX2A 4RE0A 1SJAA 3FEQA 5I0DA 3KOWA 4R33A 4AIBA 3QZEA 4LCSA 1UIOA 2DT3A 1KM5A 1R3TA 2DZTA 4ZR8A 4XD4A 5GJNA 4NF7A 1IV8A 1DXEA 3QRHA 4WY0A 4FLRA 1NEYA 4G9PA 3KHDA 2GQAA 3W7HA 3U2CA 4DAFA 5FJTA 3TSBA 1NVMA 3LBCA 1ISYA 1OX6A 4DUOA 2VELA 3W88A 1GOIA 2IPGA 3H7UA 3MHGA 1FWJC 2CC0A 5M1TA 3BWWA 3U4FA 2UY3A 5L9FA 3WF2A 1SUXA 4PUUA 1A5BA 3N34A 2VZVA 4GYFA 3APYA 5LXEA 1QUMA 1LWHA 5I3IA 4OWGA 4CQBA 8TIMA 4CGTA 2HSAA 6PTDA 3AU6A 2DUAA 1BVNP 1ZBCA 4FMVA 1V02A 2XFRA 3VC5A 4MZ8A 1CYGA 4QAWA 1GTHA 1PB0A 3N29A 4DBWA 3W53A 2ZX6A 4PUJA 1P48A 1IR1A 3H24A 1WZKA 1J5TA 1V08A 3SCUA 4L1GA 3LMZA 3CHVA 3DECA 1X8CA 3BV4A 3W24A 1TYGA 2PDIA 1J0KA 1LM1A 3NUKA 4HPXA 4EE9A 1FTXA 1QVBA 3V36A 4YYFA 1KTBA 2V8ZA 4LTSA 1VHNA 5LA1A 3CTLA 1HKVA 1KRAC 3CV7A 3HPFA 1L6SA 3MWCA 3QSTA 6REQA 1XSIA 3NFUA 1PIIA 2VOTA 3A64A 1DQXA 2ODOA 1PX3A 3T6CA 1EJ7L 4S23A 1XC4A 3EZ4A 4PEEA 1K8CA 5IFTA 2X2GA 4R7JA 3TLQA 3OU8A 2YA1A 3E96A 3RX3A 5CH9A 4JXCA 4GVGA 5D37A 1E0TA 4DJEC 3WFZA 4AQLA 2NX3A 1PIFA 1TE6A 3MKKA 1GJPA 4PL2A 1J10A 1FXPA 4D9PA 2QCGA 2R91A 1QAPA 1AH4A 2XHYA 3K2GA 3LB0A 4XWUA 3RLVA 3B4UA 3MY9A 4PA8A 2WO5A 3TYAA 5HWNA 2PSNA 3S6TA 3TEVA 1L8NA 1K7FA 3DN5A 3VKDA 4IICA 2XGBA 1UCWA 2EJAA 4Q8TA 4R3UA 3BUVA 1RHCA 4QCFA 2YXOA 3LQLA 4L1XA 3OZPA 4LYKA 1AZ1A 3BC9A 1ITCA 3TU9A 3KVJA 2V3GA 3WO8A 3LMYA 3RJYA 1EGVA 1TA3B 2YPIA 1QNPA 3EGJA 3VI2A 4DWSD 5ABFA 1D8CA 3KWSA 3BCDA 1BG9A 5DCBA 1UJQA 2BWGA 4HSNA 1GVFA 2Z2AA 2R1KA 2Y7FA 3NQVA 2WJZA 3S5YA 2B7PA 1TWDA 5CBBA 5I79A 1FFRA 1W1IE 1E3XA 3Q65A 3S6OA 2NVAA 1BGAA 5CPSA 4JFSA 4GJJA 2GSJA 4LSBA 2CESA 4PMXA 1CGWA 4IFKA 1UBPC 1F6KA 4XZWA 3T9PA 1P0BA 3EWCA 2EPMX 4BK9A 2C91A 1XIDA 4UQDA 4JKMA 3TTQA 2PLJA 3BJFA 1RJRA 2GK1B 3OW1A 4UTMA 2R1MA 1Z9AA 5XIMA 1MXSA 5E6YA 3NZQA 2G37A 2YB1A 4GY0A 1RZMA 3E74A 2D3NA 3KLKA 1KRBC 4JQ4A 3PBMA 2F6XA 4JKLA 1UR9A 2QR6A 4Y6GA 4K1GA 5AC4A 3O3RA 1IEQA 4M6QA 2E6AA 1XG3A 5IHSA 3G6MA 2CHRA 3N15A 1W5QA 1XFBA 1Q3NA 4I5XA 4OVXA 3CO8A 4JICA 1LF1A 4IMAA 4FF5A 3U7BA 5A6MA 4HZ7A 3F5KA 4X2RA 4QQ3A 4TIMA 4WHBA 4ZCWA 3V35A 1LP6A 4UOJA 4JQAA 3CHFA 5HPOA 5K4ZA 4G7EB 4EKJA 4RZBA 4JTQA 2VT0A 5LIWX 3PANA 4PMJA 1PEZA 1UA7A 1YTEA 3BZGA 4UR7A 1QOPA 3DFOA 3EWDA 4IJRA 2PDKA 3FYPA 3LLFA 1EYWA 4CCEA 3W2JA 1UYQA 2XZ9A 4ACZB 4V15A 4R7OA 1JAKA 2DPEA 2D0GA 3KVMA 4GY7A 1YMYA 4M80A 4ZEPA 3FN9A 1N82A 1EC9A 4G6CA 4AEEA 4MM1A 1BVZA 5JQ9A 2GVYA 4M1BA 3HGOA 4QM1A 5I07A 3WIJA 1QI0A 3MI6A 1UROA 3DFTA 4JY9A 3T40A 3W1LA 5J5RA 2NWRA 1DWGM 3L21A 5D9MA 1U83A 1OB0A 3EX3A 1DJQA 3GB6A 4EWND 4DXVA 1O5XA 4QDWA 3L2MA 3LRKA 1VHCA 4M0XA 4J1OA 4RUBA 3THCA 4RV8A 3DG7A 4MJMA 4IMFA 2C0HA 1IWBA 3IEBA 4IIGA 3QHOA 5BXTA 3POCA 1UD5A 4QCEA 3RIKA 1XLDA 3GE7A 4WY0F 1ONEA 4FOKA 3K8LA 3R11A 4ILSA 3UERA 5BCAA 4HCHA 3S2MA 5CPNA 3K5XA 3RN6A 4X0NA 1EWEA 3LCIA 1S5VA 3BURA 3UPWA 3CHCA 3V75A 1ML1A 2C1HA 1W3IA 5EFDA 1ME7A 1TSIA 4IJBA 4NJGA 1XSJA 2A7RA 1QNVA 3HPZA 1F61A 2E68A 2PDYA 4LVGA 3W7DA 4XSLA 3ZJ7A 3QR3A 2NUYA 4MB3A 2OYLA 4V1XA 9XIAA 4J3VA 5A8GA 2TAAA 3UYCA 2XISA 4CVWA 3BCFA 4PH6A 4FR6A 4FIRA 2Z27A 4M19A 4KGLA 1KD0A 3TSDA 4NZFA 4LY4A 3EWZA 1OD0A 1A5UA 2ZZ1A 4B16A 4HJWA 1L2UA 4UTTC 2QGYA 2GJPA 4HHHA 3IJIA 3V5OA 1XRTA 1XLGA 3LPPA 3UP8A 2A3LA 5DBTA 1XLKA 5AKQA 1KW1A 1EZWA 1JCTA 1J79A 4MWAC 3AHXA 3N6HA 2Y6ZA 2Z2BA 5C9RA 3BH4A 2VFHA 4LF1A 2VX4A 2PCQA 3LXCA 1W17A 3S9IA 4FK9A 2OX4A 1JDDA 3AZTA 4W84A 3UJFA 2F2KA 4XVDA 1UC4A 4P8WA 1XW8A 1TJ0A 4JQ3A 5LNRA 4QS6A 1QHOA 3AYTA 1FWSA 3BLKA 2YSWA 3E0LA 3GDRA 2OZ0A 3M0ZA 3VE9A 1V8EA 2H9AA 4LYPA 3LRLA 3O0FA 3G1VA 3S1XA 4CD4A 3ERPA 3SQMA 3UWZA 5I3GA 2FGLA 2H3DA 3A4XA 4NQ1A 2B81A 1FWIC 1ECQA 4C1KA 1QNQA 4GXMA 4ZBCA 2DQXA 3WQ4A 5EPDA 3KW3A 4OOUA 3AIQA 3DG3A 3MCOA 1E55A 4OBSA 2ESCA 3EPMA 3N6JA 3CLMA 4EANA 4IL0A 3BLFA 3NO3A 1W1ZA 4HIBA 4JCLA 5AHMA 5A5WA 2W63A 1HFBA 2V67A 3T78A 3LTSA 2GOUA 3BAYA 2D24A 3FS2A 1T96A 3RGTA 3N19B 3NPUA 2REQB 4LUTB 1XCXA 1TPUA 1HKJA 5ENLA 2GGHA 3UEQA 2XVGA 1M9HA 1XPGA 4GXWA 3NO1A 3C2VA 3W1RA 5ECVA 2J75A 1W9VA 3V0TA 1QXLA 4GI8A 2D0HA 5J8LA 1KTNA 3MTWA 5F2LA 3DIPA 5A6BD 3AIRA 3SAZA 1UD6A 1GUVA 9CGTA 2TMDA 2VYOA 3WNPA 2XIJA 5D04C 1K03A 1R7AA 3SQSA 3C2FA 1QNSA 4AZGA 3WQ6A 4DNHA 1R9YA 3FV9A 1TPEA 3ZR5A 3Q58A 1MW0A 1EHNA 3M5ZA 3LXBA 2XVKA 3E0VA 1EHAA 4KS0A 1A5NC 4UFHA 4PUEA 3HN3A 3QMTA 3STEA 1A5SA 3W84A 1XLHA 1JD9A 3TYEA 2JFEX 3WQVA 1JULA 3EWYA 3MV01 1B3OA 3AS3A 3LGEA 1FX6A 3W2MA 4DLMA 2NUWA 1OJXA 4XZMX 3A3XA 2I57A 5K3VA 4V27A 4AYGA 3H23A 1VBUA 1AQFA 3A24A 3RCYA 4F0RA 1V5XA 2BS9A 3STFA 2R6OA 1AMKA 5C70A 3RO8A 5E1QA 1E0VA 1A0CA 4DEFA 2D2GA 3WUFA 1KWGA 3N9SA 1TWZA 4FAMA 5AECA 5D03A 3K8MA 4AVNA 1I4NA 3PJXA 3KL5A 1PIGA 5C2XA 3O6DA 3O7UA 4R88A 3KBJA 2A79A 3PTKA 4QROA 4N7QA 5IDIA 4MY1A 2IW0A 3WQDA 3I7SA 3NDZA 4Y8FA 2ZZ2A 4UOQA 2VM8A 1VQTA 3TR9A 1QPKA 1RA5A 1N8IA 3P62A 5F1VA 3UJRA 3NXFA 2QPUA 4W89A 2X42A 3WBYA 1BYDA 4NYUA 4RPPA 1SZFA 3MBFA 1PHQA 3L68A 2FFCA 2XU2A 3M47A 2DZBA 1V3IA 3W6YA 1FWWA 2I9EA 2OYMA 4D6HA 3THDA 1UJPA 3ZOAA 2VR4A 3I3BA 2XUCA 1F3EA 4EK7A 2BASA 2E3ZA 4NAEB 5CSSA 2YXXA 4I5UA 1TIMA 5CG0A 5DN1A 2PDMA 2F8QA 3A4JA 1FY6A 3ABOA 4NI8A 2OSWA 2J74A 2ZX9A 3CT7A 5M3WA 3O06A 3ZVIA 2DU2A 4V28A 5FJPA 3POHA 2GK1A 3C2OA 1ADDA 4ADTA 3I3EA 5T9CE 5ABTA 5D2YA 2Z1XA 3BOFA 1VD6A 4DX3A 4PSPA 2F38A 4CEUC 3CUZA 5A2CA 3TYZA 3W1PA 1D9EA 3GH5A 3KRBA 4ZOBA 1QI3A 1E70M 1L8PA 1XHGA 3VIMA 5FESA 1KLZA 3RM8A 4RNIA 2PDUA 4GFIA 3N9RA 4FNQA 4QTGA 3KBNA 1PZ3A 1G4PA 4UCGA 2BSLA 4J3WA 5U4NA 5C9ZA 3UG8A 1ITXA 1TWWA 4J2MA 3BCJA 1UWAA 3W82A 4JD4A 2WMFA 3LHVA 3OGRA 2QJIA 2ZXBA 4GKLA 2J79A 1CGXA 1JPKA 1CGYA 2GQ3A 3BAWA 4O1EA 4IP4A 1A0EA 3NG3A 3SM0A 4G7EA 3WH5A 1UC5A 2E5BA 3K1DA 4GIRA 3SUSA 1H49A 5CGTA 2ZUMA 2CLPA 3T0BA 1ZRQA 4DO7A 1YTKA 2DW7A 3PP7A 4UFJA 5JVLA 4PE8A 3VO0A 2ZX5A 4XIAA 3MSDA 1QPOA 4GCXA 3WLOA 3MP3A 2Y7GA 3UETA 3MB9A 1I75A 2FGZA 3NQBA 3WLRA 3DBNA 4TTUA 4W7UA 2DSUA 4N9BA 1Q6OA 4P7OA 4WGXA 5CPQA 3C2YA 3CTTA 4BS0A 5LIUX 2YW3A 1JVNA 1W6TA 4YCOA 3CV1A 3HG4A 2DJXA 5D30A 4EACA 1RCQA 1CNVA 1RCXB 5JBEA 3VFLA 1UG6A 1A5AA 1CGVA 3CK5A 2E09A 2YCIX 2QLYA 1VEOA 4YVXA 4MY8A 3RFAA 1OFAA 3AHZA 3T81A 4V2XA 2X1RA 1SJBA 4D1JA 1DVJA 2Z1SA 4UTUA 3PM6A 3SSJA 4GK8A 4H7VA 5HMEA 4Q4PA 1MSSA 5H8MA 3ZLGA 3UXAA 5H8UA 3FY1A 2V3FA 2CCRA 2CEQA 1KB3A 3WSUA 4H6RA 4NVTA 4RDZA 5A8MA 4TO8A 3B8IA 3WBAA 4NXKA 4IZGA 4Q8MA 1Y5XA 4F0SA 3U9IA 3B06A 2WJFA 2OGYA 1I2QA 4UFMA 1G7UA 1TPDA 4HPJA 2WXDM 3C2EA 6TIMA 4WDTA 3W1NA 3KL3A 2WNQA 2UY5A 1A50A 4TVDA 4IG2A 4DM2A 2YBVA 3BARA 3VIJA 1FRBA 3B8VA 3ITCA 1V4YA 1GVQA 1XGEA 4CNOA 2QYGA 3IK4A 1TREA 3TQKA 2PDFA 3QTGA 2PDXA 1Q8AA 3M6YA 1JUKA 5E70A 3Q67A 3N2OA 2D22A 2H6RA 1E6NA 4O54A 2GOKA 1K02A 3C56A 1LOQA 3NGJA 1TZ7A 4L6OA 3T4WA 4JTSA 4YCPA 2DEPA 4OUEA 2PURA 1SR9A 4GNJA 3CQHA 3CNYA 4GUJA 4PMUA 4ATWA 2VFGA 1PO9A 3PPHA 1AW5A 1IXNA 3EA2A 2G3FA 2FLIA 4XUYA 2BY2A 1FCBA 3ATYA 3OA5A 4FPSA 3DHFA 1HT6A 4WD0A 3D6NA 4J3TA 3SN1A 2WZHA 3M41A 6ENLA 2R8WA 4ICNA 3PF3A 3RNDA 2R82A 4I6KA 3W1QA 5CZJA 3W27A 1GCYA 4NJJA 3KRUA 5KZ6A 3HM7A 2J7FA 1YPXA 1ME9A 5CAHA 2HEJA 3UG5A 2BXYA 1B31A 1XM3A 4XQ6A 1ZP3A 3WQFA 2CPUA 3RR1A 5M2FX 5FOOA 1MNZA 4BEQA 5MF5A 4FIQA 1DPMA 3IANA 3NURA 3FJ6A 3G5EA 1RJPA 4JTDA 4DJFA 3CU2A 4TMCA 1GK8A 4IT1A 1FH9A 1L6FA 4QFUA 1OK6A 4CNPA 7CGTA 1E4IA 2V3EA 3U2OA 3F4NA 3HMCA 3ITTA 2EPOA 1DJGA 1DIOA 1NTHA 2REQA 3QKEA 3TTYA 3UU0A 1NWSA 3QN3A 5BYWA 3ZYZA 4LAZA 3DERA 1W1PA 3ZSSA 5ECUA 1EJVC 2DSVA 1RLDA 2O7SA 5A3HA 5BWFA 1L2QA 4GH1A 2Z4GA 4PUKA 4CD8A 4AZ7A 2YDRA 4XKMA 2HNEA 2DW6A 3NEHA 2CFFA 5HANA 5K4XA 4BF7A 3N4FA 3FDGA 1XD1A 4XO6A 5IDZA 1ZALA 1UZHA 2BY1A 3NGFA 5ABEA 4A3YA 1W3HA 4LU0A 4HQVA 1NP2A 4ML9A 2QUVA 1CX9A 5HOSA 4GZIA 3WMSA 1F5ZA 4WUIA 3DFYA 2J47A 3IJ6A 4ERAA 1CW2A 2Z00A 1LQ0A 3CJPA 2NV2A 3KVKA 3T07A 1WNOA 5LIYX 4XZNX 2EG7A 4NNBA 4B15A 1KQYA 4IQJA 3RU8X 1YBQA 4UOZA 3PFRA 3PZTA 1JD7A 1VRDA 4G8TA 3W1UA 2ZQ0A 3WDPP 1XICA 1PTDA 2Q8XA 2WCGA 5E6ZA 3G1FA 7REQA 1ALDA 3S2CA 1LYXA 4XAGA 2OLHA 2QVNA 4AD4A 3ZSTA 1UUMA 4BWLA 2PWVA 3HV9A 4ECLA 1HKWA 4RNHA 3TAKA 5BRBA 5HQMA 1VFLA 3GVWA 3QTPA 1ADSA 4RR4A 1P0KA 4QNWA 2QT3A 5FJIA 2VRKA 3VZXA 1XV8A 1TX0A 4WJEA 2J4GA 5HNUA 1ISZA 4F9DA 4X60A 2WZTA 1V7YA 2Q8LA 1US0A 4JTRA 1HL2A 3MSGA 4GVIA 5FKYA 1LBMA 1E6QM 4HZMA 2ZA1A 2YFOA 4B5TA 4XZBA 4L1WA 3VZZA 3AIEA 4QE5A 3QH2A 2D2HA 1Z3NA 2GSHA 4LAUA 3WQCA 1M7OA 1VENA 2GL5A 1O66A 1BPLB 1GPWA 4U3AA 3G1DA 3G77A 3TX9A 1A5KC 4GIEA 4XKYB 1B9BA 4ZO7A 3OPSA 1W91A 2PPGA 4MWAB 1JZ2A 5GPRA 4PMNA 3IV8A 2RJGA 1G69A 3PTDA 4H9MA 2INZA 2V2CA 4MGGA 3O8AA 3E0FA 1KM0A 1UQZA 1CXKA 4PRWA 4KFNA 4KH2A 2OMAA 3W9ZA 4Y8EA 1QDSA 4K7YA 5CZTA 4KCUA 4CNSA 4LPCA 1PX8A 4DJDC 1LWIA 2D2JA 4A6GA 4KIEA 1MMFA 1JXKA 3QOKA 5LHFA 4WK9A 5FL0A 1V0KA 1VFMA 1RK5A 3PSWA 4YTUA 4WIWA 1E51A 3VMNA 2VGFA 3CMJA 3UPMA 1C3FA 4JEQA 4MLJA 3ZWSA 4GHRA 4QRNA 1KKOA 3KTXA 2I5QA 5HUOA 1M01A 4B9YA 4B5WA 3BZJA 4I9JA 4QLLA 2QPSA 2CZEA 4TX6A 1QPRA 4AW7A 2R1NA 4DIAA 5LNSA 3DHPA 1CENA 3B03A 3AMGA 2YGYA 4HNTA 4F8XA 4GX8A 3FA3A 4Q7IA 1GG1A 4MZYA 4Z0JA 1IT8A 3TQVA 2XSAA 3A13A 3SRFA 1US2A 3LU2A 4F0MA 4Q4QA 1VPQA 1Q2RA 3A4WA 4Y9PA 4PMZA 4C6FA 4ZO6A 1J6OA 4U2YA 3PY2A 2GPTA 4ZE4A 5FL1A 4FXRA 4YU1A 3SN4A 3NZPA 1RP9A 2DSWA 5DFAA 3KOXA 3NSMA 2RGLA 4UUIA 1XJBA 1QWKA 3CH0A 3KCLA 3AHVA 4I7VA 2NX9A 5A6TC 2XN2A 4H8HA 3M46A 3MO7A 1XBVA 3A21A 2ZE3A 4FX8A 2PU0A 3QVQA 1RP8A 1RY8A 4KEMA 1L6GA 2V5BA 3QYSA 1I2OA 1YDYA 4FOJA 4FZIA 3NQ2A 1KGWA 1UKTA 2C3ZA 3RPTA 4H7ZA 1YXCA 2WZIA 4GYPC 1H1YA 2JF7A 2VC9A 1DE5A 4Q8UA 2F9RA 2ZBTA 2VENA 3OIXA 4WDUA 4PC8A 4AEFA 1V02E 4W8BA 1S2VA 1EH9A 2WC7A 3NQ8A 4DYJA 4GY1A 3LPGA 5TBOA 3KBMA 1OG6A 4L6HA 1K7XA 1O1ZA 2CETA 2FFIA 1JZ5A 1RAKA 3ABXA 4PMYA 3NR0A 3DCPA 3LCLA 3NQDA 2C7FA 3NJ3A 1R8LA 4B5XA 2BDQA 3SGGA 3CAWA 4JX6A 1XSKA 3EXSA 3CGTA 1FQ0A 5LNVA 3LM3A 1K7EA 3IUHA 2WMJA 1KFEA 1XIHA 2ZUUA 2GFTA 3GY1A 2PS2A 2PODA 4DJEA 3S2JA 3VOIA 3EOUA 2VKZG 2VZOA 1EQPA 1IZCA 4JNYA 4AVOA 1I45A 1P6BA 1QOQA 1J0IA 3EPNA 2Q8ZA 2C16A 3NDYA 3GDMA 2V82A 4PEKA 5BXPA 2QXWA 2HDJA 1J2WA 2ICSA 3ICJA 4ORIA 3QY8A 9XIMA 4O0QA 4IQEA 2V6AA 5FJRA 4M51A 1H60A 2G3IA 4M24A 3Q45A 3OZMA 3BSGA 3AS1A 2WBGA 1BXCA 1V3MA 5FA5A 1BVWA 3IS4A 1JF5A 3OIHA 4QQUA 2B7OA 4MNJA 1TELA 5FEZA 1E4LA 3LCFA 3F7JA 3TN6A 1H3GA 2DSKA 5IBXC 1YPFA 3B04A 1W3NA 4NZ1A 1N8WA 1HO1A 1E43A 2ZZ3A 2ZX7A 4KFPA 5A8PA 5AC7A 4HD5A 1GOOA 4IL2A 5BROA 3TR2A 2GJRA 1VJZA 3VK5A 3HA1A 4WKHA 4Z1CA 1PE1A 4TUFA 4WKFA 2BGSA 3EWUA 4UCFA 1WBJA 3CIWA 3GQYA 4NIRA 1H7WA 3GS6A 1W8SA 1FHVA 2KAUC 5ABHA 1GQJA 2HWGA 2YZ5A 3WEOA 4D8ZA 5JXQA 1C90A 4W5UA 1UP0A 4CKQA 1SVDA 3PJTA 1EEPA 3ALGA 2PDNA 1J12A 1UKQA 2PMQA 2AKMA 4BR1A 1FDZA 3W7QA 4N4PA 2DVTA 1EBHA 2AMXA 2IXVA 3WL0A 2A3HA 3ZVHA 1KBBA 3W3OA 2OR2A 1O60A 3TOPA 1P0EA 2VZTA 1FWDC 1QK0A 3CL8A 1QHPA 1HL9A 3O6CA 4GBDA 1ONXA 3IGHX 3VOFA 5LGZA 4WJXA 3ZT6A 3MCMA 3V1HA 4O1AA 4R7WA 4OKDA 3QYQA 3GDLA 1X1NA 2FHBA 5CZ0A 1Q4NX 3H21A 2X16A 3DFPA 5K9CA 3K4AA 4TU1A 1GEQA 2P0IA 1I2NA 2VQTA 1B5TA 4FNTA 5D9NA 3M0XA 1UH4A 2Z24A 1Q6FA 4EWJA 1DWIM 3GVQA 4O16A 4H04A 4Q32A 4Q4MA 4UQCA 3WYZA 4WXZA 3VVGA 2E40A 3KLLA 4NZ4A 3VU2A 3NAVA 1W31A 4IPNB 4QEHA 1S3TC 3I4KA 2NSXA 4P2VA 2PC8A 1SO6A 1TZZA 2Y85A 3TW7A 3CV6A 6A3HA 4HCDA 2P3EA 2WV8A 1YXDA 4Q8QA 3PK7A 4Z1AA 3URNA 3BW4A 3W02A 3WLIA 2X0YA 3GKFA 4DQWA 4C6EA 3KUMA 3RAOA 3AIVA 1UOKA 1EXBA 1GORA 4KW2A 3R79A 3AMCA 4LUSB 3TWAA 1IE7C 4HPHA 1XBXA 2YW4A 1OZMA 2Y5SA 4UNKA 3WBWA 1EF2A 3U4AA 1OWQA 3ANYA 3GU2A 3RR4A 1TPVA 3VD9A 2Z28A 1JCNA 1RR2A 1WKDA 4J4KA 1HN1A 2OWXA 1GOMA 3BO9A 3KVLA 4D6FA 5XIAA 1BWVA 4JIPA 2HZGA 5AYIA 3F4VA 5I6SA 4DF1A 1CDGA 4U5IA 4K37A 4A2RA 3FJLA 4B9ZA 4UTTA 2WJDA 4S2BA 1D7KA 3C0QA 3U57A 3TCEA 4S39A 1P0NA 1HX0A 3CT2A 4FXJA 4MWAA 4GNKB 3I3DA 2PDWA 3FNDA 2YCLB 5EMUA 3GNDA 1MXDA 1E56A 4JHZA 3VD4A 5TAOA 1CIUA 3BPWA 2PTWA 4UZUA 4JCMA 4XD3A 5K7JA 3P0XA 3QY7A 2X09A 1NWTA 3EDFA 4HYWA 2A1YA 4KMQA 1Z48A 3SY5A 3ITXA 3ONCA 4GXPA 2CWNA 4LV4A 2QJGA 3NVDA 4M6UA 2PAJA 1Q7MA 3U0HA 3BG9A 4H2HA 3EA1A 3VGBA 2DZWA 1GZJA 4PL1A 4ZQOA 2HRWA 3EWBX 2QCMA 5AYBA 2CLMA 2XG9A 5HNTA 1WAWA 3WUEA 1QRQA 2RDTA 3H22A 2FHCA 4OV9A 4ZQNA 3DYMA 2P0OA 2W9MA 2AGTA 2VD8A 4DBSA 5I3FA 1I0BA 4B3ZA 3WH8A 1VH7A 2WSYA 1R46A 3LHZA 2NW0A 2YCJA 3F03K 3DFSA 3HJEA 5H8PA 2CLHA 3MP4A 3UA3A 1B3VA 4J3UA 2J62A 2QNEA 1E40A 1M7JA 4GQ0A 4O53A 4YTTA 4OBRA 3QLLA 3FJNA 3M5XA 1JGMA 3P93A 2PDPA 1KM4A 1ITUA 1NM9A 3PBGA 4HYRA 4FR1A 3ES7A 2ZA2A 3PJWA 3UYIA 4KCTA 4HBKA 1NF0A 3M0YA 1VIWA 4NHVA 4N9EA 3N13A 1OFEA 1M3UA 1XRVA 2F84A 1UWQA 3P2VA 3U5UA 3B05A 2AQVA 4X9SA 1T40A 5CPMA 1GPFA 3R43A 1BGGA 1M53A 1H5VA 2C6QA 4MFDA 3RPDA 1CCWB 3OLEA 5C8BB 2QCLA 7XIMA 4C6KA 1E1CB 2BY0A 1TTIA 3ITOA 3BVJA 3VGFA 4WZHA 1XUZA 2WOQA 4LAKA 5I7GA 3IUDA 1OFQA 3DEQA 3GG0A 1JPDX 1A80A 2VC5A 3PBYA 3LENA 3GC5A 5J04A 5REQB 4GCAA 5AHLA 5BZAA 3PAJA 2V5LA 3WFLA 3ABSA 3D3AA 1VEMA 2CLOA 5LZLA 2V3DA 4E3VA 1Q6DA 3AI0A 3QC3A 3L23A 3OODA 3RRAA 2Z7KA 1H7RA 5FAJA 1OD8A 4NNCA 4EOUA 1EJXC 1L6YA 4LFYA 2C0AA 2W4XA 3FOKA 2WLZA 3AALA 4DF0A 4W93A 1GW9A 3THUA 3QHNA 4O18A 1T8QA 3ABQA 3NEVA 1EX5A 4K8HA 3O15A 2FTYA 3AZRA 2I9UA 3UR2A 2PWEA 1OCJA 1PBGA 2PRLA 2VURA 4NILA 3EKLA 3HO8A 1XG4A 1V51A 3SCVA 3P60A 4E4UA 3B8TA 1PWLA 5EBUA 3APGA 5I5RA 3BXWA 3HZ3A 5C6MA 2XWEA 1ZFJA 4B2DD 5HK4A 4ZB5A 1H2JA 1PWMA 5DT7A 4QLJA 2X1TA 1HKIA 2GUYA 3W1TA 1BYBA 2R9RA 4PMVA 2DVXA 4U10A 4LB3A 1S2TA 2RJHA 4K8GA 1HIZA 1WX0A 1KBIA 2WZMA 3GIQA 4GJIA 4GUHA 1FFQA 4HA3A 1ENUA 2PD9A 4RW3A 3GIYA 2CLFA 4IJCA 4E6MA 2PBOA 3XINA 3CV2A 3ARUA 3OBEA 4IGSA 1Y5VA 2ANUA 1J0YA 1LWJA 3BMXA 5C9XA 4BI6A 2BXVA 2ZDRA 1U5HA 3HB9A 5JIWA 5T91A 3KZSA 3M5VA 2O9TA 1Q5MA 2UZ9A 2PGEA 5AHEA 5AC6A 1QU4A 4J3ZA 4NASA 5CSYA 1I2PA 2SFPA 4GC4A 3UG4A 1MYRA 1RLCL 2GJNA 3UWQA 4H9ZA 1EPXA 3ARQA 1OYAA 3N2CA 1VBRA 5EMLA 1TCMA 3WK2A 3VYLA 4AX7A 1SW3A 1E6ZA 4HHMA 3TJ4A 1KBJA 5LKYA 3F2CA 2QF7A 1ZAHA 1F74A 1OHLA 2CZDA 3EX1A 1HGYA 3ZIZA 2PZNA 1JUBA 4IXXA 4KEUA 1X7IA 2QCEA 3R8GA 1V93A 2V0TA 4OECA 4C6LA 5LGXA 3TXVA 2GSEA 1TWIA 4H41A 1CZ1A 4PCSA 3ZJKA 5DX7A 2FH6A 4P8UA 5I3JA 1FWTA 4OJYA 2HVMA 1LQAA 1DE6A 3DC8A 3G6LA 4C6DA 3WH7A 3TLLA 4RE4A 2EHHA 5HWMA 2WZEA 4KETA 4TQTA 3BANA 5D9PA 4GIYA 3MUCA 4PYSA 4LCQA 1GKRA 1L9WA 4GI6A 4HT3A 5KINA 3EKZA 4ADUA 1RK6A 1WXZA 4I8DA 4QEEA 2I7GA 1JFHA 3GXFA 3RHGA 1TVPA 3P6LA 4KESA 4AZ5A 4BZYA