3CB8A

4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
244
structure length
244
Chain Sequence
b'VIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyruvate formate-lyase 1-activating enzyme
publication title Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 82
structure length 244
sequence length 244
ec nomenclature ec 1.97.1.4: [Formate-C-acetyltransferase]-activating enzyme.
pdb deposition date 2008-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF13353 Fer4_12 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3cb8A00
3LXBA 1OABA 3IEBA 1FXQA 4U4MA 3E96A 4E0CA 3PSVA 1GEQA 1YLVA 3IGXA 4CNPA 2Y63A 3MI3A 4FNTA 2BZNA 1DHPA 3CQ0A 4JDBA 4FX8A 2GOUA 4IQLA 4O52A 1S5TA 2ZDRA 3QQ1A 1Q3NA 4ZZ9A 5G4WA 2EAWA 3PUEA 2FB3A 1R2RA 1YPIA 3F4WA 2TMDA 3TR2A 1CW2A 4RV8A 1OFDA 4JTJA 2QCNA 3A23A 1H7OA 3W76A 1OFQA 3O15A 1XM3A 4UTLA 3NA8A 3CIXA 3TA6A 3S5ZA 3NQ7A 2C18A 3G1FA 3SFKA 1QPRA 3GXNA 1OFAA 4O18A 1GYLA 2WNQA 2NLIA 4UTTC 2V2DA 4GRSA 4Y8FA 2H8ZA 1AL7A 2AQWA 2VEKA 1ZCOA 2G97A 4ADUA 1TPWA 4UFKA 4PTNA 3W7OA 1S5VA 3C52A 3IVSA 2QCDB 5E93A 2R94A 4CQ8A 1TTPA 4A29A 4IMFA 1VLIA 3HG3A 4HT3A 3N2XA 3O1NA 3TFXA 3PBUA 3ELFA 5DXXA 3W7HA 5AC8A 3T55A 4DF0A 2GVGA 4A2RA 4N4PA 1LRNA 2C19A 3SIZA 1K02A 2Y7GA 4XZ9A 3NXFA 1TTQA 1UCWA 3HGSA 4JYDA 2YW4A 3CU2A 3LTSA 1LRQA 1WX0A 3T40A 3MHUA 1BTMA 4FIQA 5H2ZA 3G3DA 3S5YA 3UPWA 5DY3A 3B0PA 4Y96A 3PWAA 1G4TA 5CPLA 3G8RA 1ADOA 3HG2A 1KTBA 3KRZA 3GVGA 3W07A 4DO6A 1TTIA 3NQ2A 1O60A 1M7OA 3W1UA 1VZWA 2ZRXA 4X3ZA 3W1RA 4K7YA 5F1UA 5LSMA 3PB2A 4WY0B 5D30A 5HMSA 3P5YA 2FQIA 3Q37A 3ZR4A 4HIBA 3U6WA 5HWJA 3NQCA 1J5TA 2GJLA 2WO5A 4NJGA 3LLFA 2CW6A 1BWLA 1GWJA 1OF8A 2E68A 1IXQA 3C3NA 1E51A 1H7WA 1S3HA 3N9RA 1JCXA 4NJHA 1QOPA 5L6UA 3LCXA 3W1XA 5D33A 4B5NA 4IMCA 3GKFA 1JUBA 4O12A 3HJZA 3TV8A 1RZMA 3UD6A 2A1YA 5MHBA 5FF4A 3MP4A 3V1PA 1FCVA 1Y0EA 3IRDA 5AHIA 3PR2A 1I2RA 1QDSA 2Y88A 2ZZ5A 3K30A 4MYXA 1K7FA 3SGZA 1FY6A 4ADSA 2CFFA 2A6LA 3GXPA 4L4MA 4LOCA 1VYPX 1X8FA 3O6CA 1PS9A 1JUEA 2ZRVA 4TU1A 1P1XA 4HNTA 3G1XA 1I2QA 3H54A 1ZHAA 2FPYA 2QCDA 4LC8A 1GTHA 1JVNA 3A24A 2OX1A 4FIRA 4AB4A 1ONRA 3PBVA 1L6SA 4UTWC 1QO5A 3NDOA 3NQAA 5CSRA 3THQA 1W0MA 3WK2A 3TNOA 4JTKA 3W2KA 4PL2A 1WXJA 1TPFA 5ABTA 1FCUA 1F5ZA 3FYOA 2H3BA 5DCBA 3TQ0A 3W22A 4K38A 3G1AA 3STCA 3NO5A 4Z0SA 1ZAJA 3HGOA 4JTEA 4MFDA 2I9EA 2H8XA 1OX6A 4NZJA 5D05A 1V7YA 4FB7A 1O4UA 3QYQA 4JEQA 4M5PA 3C0JA 3DFSA 1LOQA 4UTJA 3TAOA 1SZNA 1KFCA 2J6XA 4JX4A 3BARA 5HUPA 1CI1A 3C6CA 3OIXA 2OZ0A 4WY0A 3W7JA 3UPBA 4KKXA 1WQ5A 4JIPA 3EXTA 3UWUA 3L5AA 4POCA 4EIVA 1VCVA 5EYWA 2F84A 1G7UA 1SO3A 2ZRUA 3P5ZA 1SUXA 3M6YA 3TCEA 3PS7A 3ZS4A 3MJYA 5K9DA 3KVKA 2VKZG 3O6DA 4KWWA 5HINA 3GXTA 3CB8A 2YPIA 4LS2A 4AF0B 4UMBA 2P1FA 1GVFA 3HG5A 4R34A 4KFPA 3F03K 1JRCA 4WX2A 4EF9A 1RD5A 1B9BA 3HBLA 3R5EA 3TH6A 5K4ZA 5HR6A 1WAUA 1FXPA 4JYFA 4RCXA 4TIMA 1DQWA 1W37A 4O19A 1QNVA 4LT9A 3VKJA 2V2CA 3ATYA 2YGYA 1KM2A 3TSDA 2Z1BA 3I7RA 4NX5A 1W56A 3S6DA 1NAL1 2A7RA 4UCGA 1R46A 2LLEA 1K7EA 5BOOA 3NL2A 4Z1CA 2A85A 3TUUA 3JS3A 3LBMA 4CQ9A 2JGYA 1SZFA 2VEPA 2ISSA 3M5VA 3G0UA 1DKWA 1HO4A 1MEWA 4HPJA 3DHFA 3ZWTA 3OEXA 4RKAA 2C0AA 5DY2A 4LVBA 1I2NA 3VE7A 1FUYA 3PB0A 1A5BA 1QAPA 2GQ9A 4FEZA 1BWKA 1P0KA 4ZQMA 1VHCA 3W23A 1UJPA 3GYEA 4UFIA 4NT0A 1KM5A 4MZYA 3STFA 3W7DA 2CZFA 1MSSA 3FLUA 5C6MA 1G4EA 1OYBA 1LDCA 1DV7A 1OFBA 4WJEA 1S5WA 3PG8A 1TYGA 1JR1A 4BFAA 3EXRA 3UY7A 3EX1A 2E5BA 1HTIA 3C2OA 3B03A 3PUOA 4UNLA 3N9SA 1SZEA 1K7XA 4HN4A 4MOZA 5EKYA 1G67A 3NVTA 2GVLA 3CLMA 3CHVA 1LBLA 4O13A 4O4WA 2JBMA 3TKFA 3DFPA 3I7QA 4N02A 4K6AA 3EWWA 5J5RA 1LCOA 4O0ZA 3M16A 3QQ0A 5CPOA 1D9EA 4NXKA 4AF0A 4I7WA 4TX9A 3MO7A 5TBOA 1X1ZA 3DI1A 2X2GA 5IBXA 4UTHA 2ABAA 3FA5A 3DZ1A 4LTSA 3FJ6A 6TIMA 1OF6A 4JD4A 3LCWA 3OBKA 4QJ1A 5BMXA 1SZGA 1H62A 1B4EA 1DJQA 3BLIA 5FF7A 2Z2UA 2YSWA 5DXYA 2GUUA 3HPXA 3M5ZA 1JCMP 4GUFA 1TPDA 3LV6A 5D38A 1F05A 1AW5A 1WBHA 3L0NA 3TC7A 4LWWA 1H7PA 4UMCA 5K9CA 4D2JA 4E38A 2WSRA 3W7NA 3QM3A 4WOQA 4DEFA 3LXAA 5E0KA 1HFBA 4BWLA 5KZDA 2PURA 2XFWA 3GK0A 2CLEA 4MY1A 4N9BA 1WBJA 5F4SA 2PE4A 3Q2DA 3MWAA 2DZVA 1HO1A 3SSJA 4NUWA 3WJXA 1W5MA 3QEZA 2H3DA 5BW6A 4KFOA 4NJJA 2QKFA 4WXYA 3F1QA 1YXDA 3W74A 2NXHA 5HWNA 1MZHA 2AGKA 2A21A 4DELA 1PHQA 5CZTA 5CGQA 3GZ3A 2H6RA 2V82A 4EWND 3IIXA 2C15A 3T7VA 3W1AA 4IGHA 4JICA 1JULA 2CLKA 6ALDA 3FEMA 1K8XA 3B06A 3IIPA 3BPWA 4LY8A 5D2XA 5AB3A 4IOTA 3TW7A 4L4LA 2EPHA 2FPTA 4Z1AA 3EWXA 3GKAA 1H1ZA 4WD0A 3W1QA 3UY8A 5F2GA 3WFAA 2X16A 3QF0A 4MJZA 5DN1A 3BG9A 1HL2A 4C1LA 1KBJA 1C8VA 1EP3A 3VNDA 1C9DA 2X1RA 4LS0A 3EXSA 4NXSA 1W5OA 2HS6A 4YMZA 3E0IA 3THAA 3FOKA 3TIMA 1M7PA 2EHHA 4Y90A 3DGRA 2Y70A 2RDTA 4E2DA 2G5WA 3EB2A 1PL9A 2DP3A 4FNSA 3PG9A 3W9ZA 3WK1A 4HNVA 4QQ3A 2B7NA 2VENA 3CT7A 3C61A 1SQ7A 2NX3A 1XCFA 3SJ3A 4ZQRA 3MP3A 3WK0A 3N34A 2ISWA 2V0TA 2HS8A 4DO4A 3R2GA 3ABSA 4HKPA 4AEOA 1ZJIA 3BGJA 5LNSA 4LNYA 1Q6LA 4GFSA 1X1OA 2J27A 3TK7A 4YXGA 5C2XA 3W2MA 3GDTA 4LW7A 1FWNA 5FEPA 4RK8A 3HGRA 4H4IA 4GUHA 7TIMA 3NR0A 4QIUA 2FJKA 3TSMA 3Q58A 5KTLA 3HO8A 3RNDA 2WSYA 3G8EA 3C2VA 2Y62A 3FS2A 1LM1A 3L9CA 3A5VA 3S1VA 1G4SA 1SU5A 4RZ4A 3M47A 1SW7A 3UQNA 5D37A 5KINA 1A53A 2PC4A 1ZALA 1ZENA 2ZRYA 3QC3A 4X22A 4PA8A 4JTFA 1SPQA 3GDRA 2NUWA 2TSYA 5I3JA 3L0KA 1Z41A 4O1CA 3BW2A 3W7IA 4MIMA 3O63A 3DKJA 5AN7A 3A5FA 4UTKA 5LZLA 1EIXA 3HMJG 3L2IA 2YFNA 2Y7FA 2H90A 3I65A 4M7SA 2ZBTA 1SFJA 3R89A 1IXOA 1RQHA 4R53A 5J5DA 3KVLA 2C6QA 5CG7A 1VH7A 3LHWA 1WYIA 1GOXA 4OE7A 3QFEA 3GDLA 4DXVA 2Q3OA 2X1TA 4O17A 3SECA 1ME8A 3EX2A 3NOEA 4M6VA 3LHUA 3LTYA 1G7VA 1W54A 1LBMA 4AHQA 2NX9A 4LV4A 2A0NA 1G4PA 3UZ5A 2A5HA 3E9AA 4TO8A 2CLFA 1ZAIA 1VCFA 2HTMA 1GVSA 1UASA 2CLMA 5FEZA 4HNNA 5BNKA 4HHPA 3WJWA 3S42A 3MI6A 4JTGA 5HQEA 1OFRA 5AC7A 2RDWA 4O11A 1OX5A 2NV2A 4S2CA 2VFIA 1GVOA 1YDOA 2YX0A 3F4NA 1PVNA 3BGGA 3NZ1A 4PL1A 4I7VA 3IVUA 5F4XA 1OX4A 3QSRA 4GNJA 5KMYA 2WNNA 1QPQA 1TMHA 4NZFA 1D3GA 1VGAA 4NX0A 5H91A 1XL9A 4NNBA 4DPQA 3A9IA 3M44A 3R13A 5D2TA 5D2WA 4UR7A 3G18A 3GR8A 4N9EA 5FF0A 4LVDA 5HWMA 4JTHA 3NL3A 4WZHA 3NPWA 2C14A 4TMCA 2XN0A 3DU0A 3VI2A 3W88A 3EWBX 5G2WA 3NAVA 1RV8A 4O28A 3HB9A 3BO9A 3SR7A 3STGA 2C16A 2VFGA 2ZZ7A 4UXDA 5I3GA 1DL3A 1YYAA 4RZ5A 1IIGA 3KOFA 2BXVA 1LORA 1JQVA 3M9YA 1KM4A 1KTCA 2QUUA 3DFNA 4MUZA 3NQEA 2A4AA 3NL5A 4NQ1A 2RKXA 4I9AA 3TJXA 3NL6A 4UMAA 4A22A 3LCHA 3MMTA 3GNDA 3FIGA 5K3VA 4YCOA 3L68A 2RH9A 2E5CA 2CLOA 2QJGA 2E09A 3PVFA 3I6RA 5D2YA 3G22A 1H5YA 1V5XA 3ABRA 3TAKA 4N4QA 4ORMA 4UFMA 3TC6A 4UUIA 2YFOA 4GE8A 4JGDA 3S1WA 4X9SA 4O57A 3GAKA 4UTTA 1MO0A 4DPPA 2GQAA 1Z48A 5G1YA 1PCKA 1I2OA 1EPXA 1M6JA 4OQVA 3RF9A 1OG0A 3P81A 3HIJA 3ATZA 1QPNA 2QCHA 3W7LA 1Q6QA 1PCWA 4FO4A 5FESA 3KFTA 1OK4A 3NPXA 1ZNNA 2DZSA 2NXGA 3LHZA 3W2NA 5CPMA 2CZDA 1ICPA 3QH2A 1SSDA 4UTUA 4O0KA 5K4XA 2NWRA 3M43A 1PIIA 4IMGA 1L2UA 2R91A 1WOBA 3P7YA 3FJLA 4XTIA 4NNAA 5DCEA 1UB3A 4UFLA 2DZTA 2I14A 3FKKA 1OYCA 2BTMA 4JYEA 4CCDA 1YTDA 3DXIA 1KM6A 4FHAA 1R47A 3NQDA 1L9WA 2AAMA 3IIZA 1I4NA 3LOTA 2Y7DA 5K7JA 2V30A 2D73A 2QCLA 3UZJA 3DFTA 1O95A 3QW3A 4XKYB 5HR7A 1EUNA 3UWQA 3BW3A 1XUZA 3W85A 3H55A 1K8ZA 2QCMA 3EWUA 2QJHA 2YXGA 1AW1A 3QZEA 3QMTA 1VC4A 2Z6IA 4RXGA 4XWUA 2B4GA 4O14A 3W2UA 2DU2A 4Z08A 4JTIA 2WNZA 4Q32A 4O54A 3W7QA 4AXKA 3G1DA 4IPIA 1OVDA 3CEUA 1W3TA 2ZTJA 3PAJA 1RVGA 2EGZA 4AWTA 2X1SA 1IGSA 3LHVA 3LCFA 3A22A 1W5PA 3GX9A 3IV3A 5IBXC 4JY9A 1GG0A 3UWVA 4QNEA 1YTKA 3VCRA 5FI8A 4Q33A 2YYTA 4OGZA 3PUDA 1T0OA 5I3HA 3W84A 1VYSX 4UFHA 1WDWA 3LCGA 2WOQA 1VR6A 5I3IA 4MLRA 2FIQA 5C55A 4WXZA 1OHLA 4UNKA 3IIVA 1QCWA 1XUUA 1UUMA 3PC0A 3M5XA 4G1KA 4NJIA 1PV8A 2A7PA 3C4UA 2V9DA 2FFCA 1ZY9A 3W7KA 3CWOX 4Z1BA 1W3NA 5LKYA 3L21A 3W1LA 1FBAA 2ZQ0A 4JNMA 1FWWA 4UTIA 2E6YA 1TPVA 3QPYA 1L6WA 3CC1A 1TPB1 3W6YA 1VHNA 2YW3A 3S9YA 3W87A 3STEA 3OG3A 1TPH1 2G96A 2XN1A 2OJPA 3DKLA 3NGJA 4XKYA 3QSTA 3ZFHA 4OWGA 2VXNA 3GDKA 2QJIA 3NQ6A 5K2ZA 1QO2A 3P61A 1RR2A 3C2RA 4LU0A 2EKCA 2NUXA 2R14A 2BLEA 3G1HA 3EX4A 1SW3A 2DZUA 5C54A 3HG4A 3W7MA 1LYXA 1GZGA 4FXSA 3GNNA 4A2SA 3E49A 4OHQA 4Y9AA 4PCFA 4O4VA 2JKEA 3DH7A 2QCGA 3M0ZA 1FQ0A 4QAIA 3CTLA 4WOZA 2B7PA 1I45A 3P60A 2ABBA 4HPXA 4OU1A 3W7PA 4EVZA 3MI2A 3W73A 1NF7A 5LHEA 3SW6A 1K03A 3AJXA 5AYXA 4O1DA 5EY5A 1OFOA 3NQVA 3O07A 5AFDA 1QR7A 1Q6OA 3EWZA 4AAJA 2Y61A 1ME9A 2QF7A 1OFEA 2OCZA 1EB3A 4RX0A 2C1HA 3IGSA 2CZEA 1TV5A 4N6EA 1CX9A 2ZZ2A 1LLWA 4UIOA 1TJRA 3TDFA 2Y85A 4RR4A 1D3HA 5KZMA 3QRHA 5IM51 3NYZA 2E77A 5E1QA 3RLVA 4IPJA 1ME7A 4H3DA 4BF9A 3LM7A 1NFBA 4TMBA 3O8AA 4MZ8A 1UBSA 5AHLA 4LVAA 3R12A 3WJZA 2JKPA 3MHFA 4FNPA 5FF2A 5AYZA 1OJXA 3UXAA 2W0UA 1QPOA 2CLIA 4XUGA 3I7SA 3TQVA 4LVGA 3PM6A 3LTPA 5T26A 5FF3A 4JTLA 1EX5A 4H6KA 3BLFA 1F2JA 4ZL1A 2YYUA 2JKAA 2ISVA 3LB0A 2DZXA 3B4UA 3LI1A 3USBA 3IGUA 4QSHA 4GXMA 5AHMA 1ALDA 2A6NA 4FNQA 4FNRA 4O1AA 3NQ8A 2KZHA 1TRIA 3NNTA 5HULA 1N8FA 2FB2A 3NZRA 3W1NA 4AHOA 5HJLA 1VPXA 5G2IA 4E2BA 5BRBA 2GVJA 4YL2A 1WA3A 2VFDA 3TSBA 3M5YA 4AHPA 3I68A 1SO5A 1Q6RA 4TR9A 4NU7A 1J4EA 3OVPA 1THFD 4M19A 5EPDA 1TIMA 4K7VA 4QITA 3NQGA 4PFMA 3S0CA 4IX2A 5AHNA 1H50A 4JXCA 2Y6ZA 3KVMA 1TCDA 3MBDA 3FKRA 4FF7A 1Q45A 1UUOA 3DFQA 4X2RA 4Z0JA 1TPC1 1X6UA 3BG3A 4PC8A 1IXNA 5A8GA 3LCLA 4O16A 3D0CA 4MVAA 1EWDA 4O50A 2ZZ1A 5AOUA 1Z42A 2YR1A 2A2IA 5BMWA 2QCEA 4JX6A 4DQWA 3C2FA 2V81A 5SWUA 2PCQA 5D03A 1M5WA 2CU0A 2GJNA 2DJXA 2JGQA 1F6KA 3T78A 1Z44A 2Q8LA 4A21A 1OFPA 1JCJA 3PY2A 1OX4B 3MHGA 3TMLA 3WK3A 2Z0IA 3BV4A 4LRSA 1FCBA 3TX9A 3LCIA 4HNUA 3TXZA 3C56A 3P82A 4CCEA 4HSNA 3FYPA 3QMRA 1VS1A 1DVJA 3G1YA 1O5KA 1PHWA 1GG1A 1TB3A 1AG1O 4UFJA 1DJNA 5A5WA 3EWYA 3O06A 3S1XA 2BWGA 4QM1A 5DCDA 3TQKA 2ATSA 3M7WA 1NEYA 5EMUA 4RJEA 1SW0A 1DOSA 3PBYA 3LXCA 1KM1A 1R2TA 4J9JA 2QCFA 5G1TA 2J88A 1FDJA 5AHEA 4AWSA 3FFSA 1BKSA 5CZJA 2RFGA 3EEGA 5F2IA 1F73A 5F4WA 3PBWA 2CLHA 4XBSA 5D04C 1RQEA 1SSGA 1XC4A 2W79A 1TRDA 3NEVA 4O10A 1KFJA 2Q3RA 1RPXA 2GQ8A 4ML9A 2ZRZA 2NX1A 3CPRA 4K37A 3GB6A 3N19B 4N9DA 3N14A 5LGZA 1KTNA 1LOSA 1I8JA 4NNCA 1A5AA 3UWZA 1B57A 1ICQA 3T44A 2VEMA 2QCCA 3NQMA 3OA3A 3TJLA 3LLDA 4KFNA 1XBZA 3LGEA 2OMAA 2NZLA 1VLWA 1TPEA 1LLZA 2ZRWA 3BW4A 2YZRA 5LGXA 3S8HA 4YCPA 3HF3A 4K36A 4S2BA 4WUIA 3RLUA 2WJZA 1I2PA 1FCQA 2V5LA 3QMSA 3GDMA 2QUVA 4IUOA 3W1MA 5AC6A 4I7UA 1XI3A 3W1PA 3DAQA 4FNUA 4N9CA 2DJLA 4Q4KA 3U2OA 1HG3A 3E02A 1IF2A 2P0OA 3C8FA 4ICNA 5I3KA 1F7BA 2Y89A 3PF3A 4DF2A 4UTMA 2E6AA 5L9FA 1LOLA 4BI6A 1LBFA 3UNDA 4XBKA 4JIQA 4PH6A 4MY8A 5DBTA 2ZA1A 4MYAA 3GAYA 2ALDA 4MFEA 1GYNA 1EA0A 4BI7A 2V5BA 3HGJA 5DELA 1SO4A 3KAOA 1XDLA 3LDVA 3P67A 5LNUA 2P10A 2CLLA 3PSWA 4IXXA 1YADA 4O15A 1H60A 1EP1A 1FWTA 3P8JA 1XBYA 1P5BA 3HPZA 2ZCGA 3B05A 4PEKA 4JS3A 1KFKA 3LRKA 2Y7EA 1U5JA 3W7CA 1YPFA 1GQNA 3RU6A 4IWWA 3DFOA 1SR9A 2QEZA 4ALDA 1O5XA 3NPVA 1N7KA 3TE9A 3N3MA 1G69A 8TIMA 4GWEA 4UR8A 3RMJA 2R8WA 3CIWA 1T8XA 4WY0F 4O1BA 5G5IA 2QR6A 3KRSA 5F2MA 1AW2A 1A5CA 1FDYA 2YCEA 3ABOA 1TREA 3L65A 3P74A 3IIOA 3EKLA 2IQTA 1MXSA 1H1YA 2RDUA 2J9XA 3JR2A 1GVRA 1AL8A 4AH7A 1U83A 1KBIA 1KFEA 3LI0A 3NPUA 4LV9A 4ONVA 3QJAA 1MEIA 1WV2A 1X7FA 1OK6A 5TQLA 4JR5A 3BVJA 3RFAA 1FDZA 1W3IA 3CEPA 3L66A 4MY9A 4BI5A 5TIMA 5LNVA 5U7SA 5KSWA 5EBUA 4DF1A 2OT0A 3VFLA 2E5DA 4LUJA 1TPUA 4JX5A 1JCNA 1B3OA 1EEPA 5D09A 5K9XA 5AYYA 2VOMA 1ICSA 4CNNA 1VRDA 4ZQPA 3W2JA 1JCLA 4MZ1A 1TV7A 3W71A 4BK9A 1KLYA 4CQAA 1XKYA 3TMQA 1K3UA 1O94A 4RZ6A 4YLWA 5KZEA 1EP2A 4JTUA 4CNOA 1T99A 2WPBA 3T4CA 4O8RA 1A5SA 1JCYA 1TSIA 1YTEA 1KV5A 1OYAA 2CZ5A 2WSQA 1W5QA 3TFCA 4OT7A 3BG5A 3VE9A 1LP6A 2J9YA 2ZZ3A 3LRMA 4S1FA 5CSSA 1EUAA 4MPQA 4FX7A 4M6QA 1YDNA 4OV4A 1TO3A 2QAFA 2DZWA 2ZZ4A 2ZA2A 2FTPA 3HQ1A 4C1KA 1LZOA 4KWVA 3UYCA 4K8HA 1J2WA 1B4KA 4K39A 1QOQA 2RHGA 1G6CA 2QAPA 2VELA 2G95A 3WJSA 1TQXA 4IJBA 4MLJA 4AVFA 2ZZ6A 1BEUA 3W72A 1KLZA 3S1UA 4O53A 4PODA 4OBTA 4DBDA 2Z6JA 4ZMGA 3QW4B 1GJPA 2X1UA 2BSLA 3E12A 5EA9A 5LNRA 1H7XA 4W9TA 5HNRA 1GPWA 2FPVA 1DORA 4CCCA 4NVTA 1DBTA 4MJMA 1FWSA 1KV8A 1GVQA 3ANYA 3QPZA 1ZFJA 3L0GA 3B0VC 1ZAHA 1LTDA 2FDSA 4UTWA 3TU9A 2VFEA 4FX6M 3ZWSA 4JN6A 1JRBA 1XBVA 1JUKA 3SY5A 4OV9A 3S5NA 2GPTA 4AWUA 2O7QA 3NQFA 4BR1A 2YDAA 3BK0A 3OVRA 1DQXA 3LBCA 2ZYFA 4U28A 1W5NA 2A7NA 4DO5A 4BWLC 2HSAA 4LUIA 3W86A 1VYRA 3W7RA 1ML1A 4ORIA 1TTJA 3NM1A 2TYSA 1GTEA 2VFFA 3G0SA 3NG3A 4QISA 2ATMA 3L5LA 1TJPA 2NV1A 2E6FA 3MYOA 2E1DA 3HOJA 4GC4A 3R8RA 1T96A 1JQXA 1K8YA 2Q8ZA 1EWEA 2WKJA 1TV8A 5U4NA 4ADTA 1KFLA 2NXIA 3GR7A 4RXFA 1VQTA 1P4CA 1QFEA 1FWRA 2O7SA 5LNWA 1NSJA 3MP5A 3B8DA 5F1VA 2OT1A 5D32A 5KITA 3RK8A 3G1SA 2ZTKA 3EX3A 3TXVA 4JTSA 2B0MA 3W1TA 3W7EA 4P61A 3NM3A 3GIYA 3LHTA 2NUYA 3C2EA 3Q94A 1SO6A 1H61A 2HMCA 3W70A 2TRSA 2TPSA 3KRUA 3JRKA 5CPNA 3W83A 1H63A 1TQJA 1A50A 4WQ6A 4JTTA 1F6PA 1NVMA 4CLMA 5I3FA 2B7OA 3HPSA 3M41A 2E6DA 1L6YA 3KVJA 3PULA 4EOUA 2I1OA 3P84A 2VC6A 4RLIA 2ZA3A 2VFHA 5CKSA 4M7TA 3MYPA 3G1VA 3N73A 3P8IA 2FLIA 3V75A 2VEIA 1XDMA 2QDHA 4LC6A 4ZVJA 4ZQNA 3MBFA 3G24A 4GUIA 4LS1A 1WOAA 3O05A 1QMLA 4M6PA 2V8ZA 3TROA 3B04A 3CM4A 2B7QA 3P80A 3G3MA 3LV5A 2EF9A 3BLEA 4GUGA 3W7GA 1MEHA 1P0NA 1GT8A 3KHJA 4GUJA 3TW6A 3DHDA 3GLCA 3LHYA 1R30A 4ZQCA 4NJKA 5GVJA 5EL1A 5G2HA 1XBXA 1YXCA 1R2SA 2QUTA 2J24A 5C5YA 2PRHA 3OHIA 4IMDA 3WJYA 3EX6A 2C3ZA 2NWSA 4XTDA 5F2LA 1IIHA 1AK5A 4JY8A 4XQ6A 5G4EA 4K8EA 3IVTA 1F76A 3DBPA 1NF0A 4GJ1A 3H53A 4DBEA 1KFBA 1IXPA 1PE1A 2CWNA 2DORA 5HUOA 1C29A 2XN2A 2WQPA 4FXRA 3O16A 2F7FA 3UWWA 3W3OA 4R7JA 3EKZA 4YWIA 3M1ZA 4JDYA 4IXHA 4A3UA 3CWNA 3SGUA 3W2LA 1KM3A 2PRMA 3UWYA 2PRLA 3SI9A 1H7NA 3LRLA 3UXDA 1LROA 2W6RA 1RQBA 1YDVA 1KW1A 3LX9A 1XFBA 2QDGA 1LRTA 3DI0A 3SZ8A 4GBUA 3W75A 1QWGA 5FEWA 3A21A 4EF8A 3G0XA 4N2YA 1N55A 5CZ0A 1W8SA 4P2VA 2X30A 2UV8G 2V2HA 3MUXA 1H51A 3U8GA 1AMKA 4UC5A 3N2MA 1YXYA 1FX6A 4HSOA 3B0UX 3INPA 4LRTA 5D02A 1H7RA 3MW7A 2ZFAA 3L5MA 5D2VA 1JJKA 1VJIA 4MKNA 3L67A 4IX0A 4IMEA 1KA9F 4LVFA 4ZQOA 1KM0A 1HUVA 2BX7A 1F74A 2J9ZA 2DZPA 3AO0A 1VCGA 4AMAA 3ABQA 3DENA 3O6YX 5AHFA 5FEXA 5CZSA 3KX6A 3KXQA 4R33A 3S5OA 5DBUA 2C13A 3YPIA 2WV8A 4Z1DA 2JK2A 5LHFA 4Y6GA 1SFLA 3LERA 4N6FA 3OVQA 4QNWA 3P62A 1W1ZA 1W31A 1XXXA 5DLCA
chains in the Genus database with same CATH superfamily
2GWNA 1OABA 4U4MA 4E0CA 2DDXA 3IGXA 1LF1A 2Y63A 4B15A 3MUZ1 4JDBA 3VOHA 3QQ1A 3CTTA 1EO5A 5ECUA 3VDGA 3PUEA 1R2RA 1YPIA 4JNZA 4I6VA 2TMDA 4IMAA 2ZC1A 3H4WA 4F3HA 3NSNA 4OBRA 3PPGA 1XM3A 3NA8A 3CIXA 3S5ZA 3NQ7A 2WHJA 5DMNA 4KRZA 5IXEA 4N42A 1XIJA 4O18A 2WNQA 3QKEA 3SCRA 2D2HA 4Y8FA 2H8ZA 2AQWA 2VEKA 1ZCOA 4C6PA 2UY2A 3NCOA 3IVSA 2R94A 4A29A 1VLIA 3OZOA 4HT3A 5CZKA 4LGXA 3PWIA 4AZCB 3QBUA 1WXZA 4GJJA 2PCEA 2YBVA 4FS9A 4RZBA 2XYLA 4XZ9A 2HJPA 2PLMA 2QULA 4Z2KA 1TTQA 1UCWA 3KBVA 3BJSA 3GW0A 3WH8A 3WLMA 1BYCA 3T40A 3MHUA 3WQVA 1O12A 1BTMA 4NRSA 1XH2A 3UPMA 3U2EA 1BVWA 1P43A 2W5FA 3PWAA 4G7EB 4BF7A 5EMJA 4DO6A 1JZ8A 3BMWA 5A2CA 3T6CA 4CQDA 1Q8JA 2FQIA 5AC4A 5I09A 2BGNE 2YKKA 3BICA 5HWJA 3VPLA 3W29A 2GJLA 1UOZA 4NJGA 1UUQA 4W87A 2VRQA 1BWLA 5DEZA 4NAEA 1Q6FA 1CCWB 3CMGA 3C3NA 1H7WA 4MWAC 3PZIA 2R1KA 3LCXA 3GO2A 3H21A 1U22A 3TZNA 3TV8A 3UD6A 3MWCA 1Y0EA 1M68A 5AHIA 2VZUA 4MYXA 1E0VA 1XLEA 1H41A 1V0MA 2JEPA 3APGA 2A6LA 4L4MA 2OFJA 1ELSA 4MPKA 3O6CA 1JUEA 2ZRVA 1P1XA 4HNTA 3T2QA 3G1XA 3H54A 2HK1A 1V51A 2FPYA 1VP5A 3BAYA 2XFYA 3MO4A 4AB4A 3M4HA 4UTWC 4WJ8A 3NDOA 5CSRA 1QI4A 4HB7A 3TNOA 1XH0A 1TPFA 5ABTA 5DQPA 1GJWA 3EZ4A 1WZAA 3DYPA 4K38A 5A2BA 3STCA 3NO5A 1ZAJA 1AA1B 1XGDA 4JTEA 2CKRA 3WYZA 2H8XA 3FW6A 3MSGA 3SGGA 4JEQA 2F2HA 1V3JA 4H04A 2WKLA 4GGBA 4UTJA 3TAOA 1SZNA 1KFCA 2J6XA 4JX4A 3BARA 2ZX5A 3CIVA 3OIXA 4WY0A 5G4HC 1WQ5A 4I8YA 3EXTA 3OP2A 3PZNA 4KEUA 3S9IA 1UP0A 2FZMA 3BTNA 1XYAA 4R85A 2Q01A 1B30A 1SO3A 2ZRUA 2WZIA 1AJ0A 1RK6A 4GI8A 4IFOA 3PS7A 3B8SA 3ZS4A 5K9DA 3MY9A 1FWCC 4UMBA 1KBKA 1TR1A 2P1FA 1SFTA 1TG7A 4ZCWA 4KFPA 4AZ5A 4OUEA 4WX2A 1RD5A 5K4ZA 4LUYA 2D1ZA 1QASA 2Z7KA 1QNVA 2V69A 4B9ZA 3ATYA 1AVAA 2XG9A 4HNOA 4HU4A 5TD4A 4J40A 3E2SA 3CL6A 2D3LA 1NAL1 1GOQA 4UCGA 4Z1CA 1KR1A 2QW5A 2YA2A 3VDBA 4UOJA 4RKAA 5DY2A 4LVBA 1I2NA 1YNPA 3VE7A 4NASA 2GQ9A 3UG3A 1KBLA 3N2CA 1XD0A 3QV7A 3OYXA 1UJPA 4UFIA 4NT0A 2ZX8A 4Q8TA 3GXDA 1PYFA 3EMQA 3W7DA 2CZFA 5ABGA 3DERA 4BS0A 3FGCA 3FLUA 2PTXA 3AZSA 1P1MA 4L6HA 4A3RA 1TYGA 4DJFA 5HDRA 3C2OA 4EPKA 4V1XA 3U4FA 3N9SA 1FWAC 1NFPA 1SZEA 3KTCA 2EKGA 1NARA 3QV9A 2GSHA 4PE8A 4UNIA 5E6ZA 2ACSA 1A80A 5DF0A 3E2VA 3NZQA 4E2OA 1LBLA 4O13A 4Q8NA 3PJTA 2DQXA 1OY0A 4D6JA 2WC3A 4JQ3A 4K6AA 3EWWA 5KZ6A 3RX4A 3JVAA 4AZHA 3ANVA 4TX9A 4B5SA 3PUGA 5EMLA 4A8LA 1JZ2A 4K2SA 4MB5A 2X2GA 4UTHA 4ZTYA 1C8YA 4LTSA 1OB0A 1XDJA 2BS9A 3LCWA 4QJ1A 4GCXA 3ZT7A 3K5XA 3BLIA 1RVKA 5FF7A 1R7AA 2YSWA 2E8ZA 1AODA 1WZLA 4FAMA 3PNZA 2DUZA 1TPDA 5D8WA 1AW5A 3L0NA 2AQOA 3APYA 4UMCA 3T81A 2VD8A 3PPCA 2XVKA 2PDKA 3DBNA 4WOQA 4M24A 3MVTA 3IUDA 4JHMA 1HNYA 4BWLA 1WZKA 3QGAC 3V7PA 1EO7A 2BOEX 2YL9A 3COTA 4DYJA 3M7SA 1ZGDA 4N9BA 3LA4A 2PE4A 5CPSA 2WCSA 1ZBKA 3WEZA 1V77A 1W5MA 1J18A 2H3DA 1G1YA 3F1QA 2PI6A 1MZHA 3UJRA 4KW2A 1NM9A 5CGQA 3GZ3A 2H6RA 2GFTA 4F8XA 1DIOA 2X7WA 3T7VA 3QQWA 4KRTA 3B8WA 4L65A 2WLZA 3QKZA 3UXIA 3FEMA 4RL3A 3HQOA 4NZCA 1EH9A 4GIYA 1BKHA 5AB3A 3EYPA 4L4LA 2EPHA 3VNKA 1H1ZA 4MKSA 3OQEA 6XIAA 1E72M 5F2GA 3TC3A 3WFAA 1R38A 5I06A 3BG9A 1C8VA 4AU0A 1ZL1A 3TNBA 2HS6A 4CEXC 5DRCA 2Y70A 4ZOEA 2G5WA 3TTYA 2HNEA 3IAPA 3E0WA 3OZPA 2Z1XA 3B97A 4FOJA 4M1RA 2PZNA 4HKPA 4JQ2A 5LNSA 1G9HA 4GFSA 3H6OA 2UY5A 4DUOA 4C65A 2ONEA 3WMBA 4YXGA 5C2XA 5FEPA 2BXZA 3K46A 3GH7A 4RK8A 4GUHA 2NVCA 3WUEA 3AIBA 3TSMA 3UYIA 3WD3A 4UB9A 3RNDA 1CLXA 3C2VA 5H8PA 3S2MA 1GORA 1MYRA 4E2VA 2J77A 1G4SA 1SU5A 3M47A 1TE6A 3UQNA 5KINA 4LANA 6REQB 1ZENA 3QC3A 4X22A 2DZAA 2I17A 1Z41A 3ZJ7A 4GX9A 4C6KA 1PTAA 4M7SA 1SFJA 5A6AA 4XK2A 1RQHA 2I57A 5J5DA 2QVNA 1H5VA 5FSDC 3LHWA 1GOXA 4DXVA 3GDLA 4O17A 5D8ZA 4LALA 3AXMA 1Z7AA 4J3WA 3F4CA 3UG8A 1PKNA 1VFFA 5HJXA 5PTDA 3UZ5A 4QDWA 2VO5A 2CLFA 4B92A 1GVSA 2CLMA 4HNNA 4HHPA 4TVUA 2EEXA 2DY3A 3CYJA 4FLRA 5CLWA 5M17A 4JTGA 1XFCA 5CJ5A 1OX5A 4S2CA 1WDPA 3PJWA 1YDOA 4NAFA 4HK6A 4ZO7A 4PL1A 2BOGX 1M9HA 3R25A 5F4XA 1DJHA 4I5XA 4GNJA 3ZO9A 1FFRA 1SGJA 5I2UA 5KMYA 3KBNA 5JUVA 1QPQA 4M51A 2ZXDA 1EHAA 5D2WA 3GR8A 4LVDA 2OKTA 4GACA 4IIDA 2C14A 1JZ4A 3NO3A 4ZB5A 1AJZA 5CG0A 2F61A 3AUJA 2VWSA 4AZGA 4PFHA 3B8UA 1DL3A 4C6QA 4HZMA 3KOFA 2BXVA 2F6KA 1JQVA 2Y5JA 4OECA 1M41A 4MUZA 1KM4A 3WLJA 3GXIA 3O0KA 3NL5A 4NQ1A 3XINA 2R9RA 3GH5A 4XSLA 4UMAA 3LCHA 3MMTA 2G37A 4LSBA 1OC5A 1CWYA 2E5CA 2QJGA 2J8FA 5D2YA 3GU9A 3DG6A 3TAKA 4N4QA 3TC6A 5AVHA 5TF0A 1S46A 2QMKA 4JGDA 4Y9NA 4LCRA 4LYKA 4M29A 1Z48A 5G1YA 1PCKA 1I2OA 1TELA 1EPXA 1M6JA 2KX9A 3ENLA 4QEHA 3RF9A 1OG0A 3P81A 1MQQA 3L23A 2VGFA 3PZ9A 3FDGA 2QV5A 1ZNNA 4E8GA 2DZSA 5CPMA 3IV8A 3QH2A 1SSDA 1J12A 1EZWA 5ECVA 2J6VA 3SUWA 1P0BA 1WOBA 4S3AA 4P8VA 4KRUA 1TIWA 1UB3A 1POJA 1K4HA 3F4DA 3VOJA 2BY1A 3EA1A 1ZPTA 2ZKMX 1KM6A 1R47A 3VD3A 4IJRA 3NQDA 3K8LA 4H7ZA 1L9WA 5BXRA 2WJDA 2WM0A 4LEFA 2Y7DA 3NTYA 5K7JA 1D2KA 3ZSSA 3DFTA 3T8LA 2X09A 4WIWA 2WSPA 1KD0A 2DT0A 1O5RA 4WRHA 2PLJA 5A6KA 1AW1A 5IDIA 3QMTA 2VR2A 4AD5A 3VMPA 3T0DA 4O14A 1UQYA 3HZ3A 1TKKA 4XISA 5JH1A 4Q32A 4O54A 5REQA 1SZRA 2FTYA 4O1FA 1A5UA 2X05A 1OVDA 1JI1A 3A3WA 3VD9A 3PAJA 1ADDA 2O56A 2EGZA 4DI8A 2SFPA 3CPUA 2OYMA 2WB5A 2G8ZA 4FPSA 4H01A 2QGYA 2C7FA 1W1IE 1TWWA 2YYTA 4D6FA 5A8NA 1RCOB 3PUDA 3W84A 1LUCA 4Q6JA 1WDWA 3LCGA 2WOQA 1VR6A 4CNUA 4MLRA 1OM0A 3HV8A 4UNKA 1XUUA 3PC0A 3M5XA 3SUTA 2A7PA 2CEQA 3ONCA 3QR0A 4B5XA 2IMRA 4EKJA 5H8MA 1W3NA 4CU7A 3R10A 4JNMA 1FWWA 4UTIA 4OOUA 4M81A 4D1IA 1L6WA 3CC1A 3T8QA 1EOMA 4TX8A 4US5A 2PWVA 2FGLA 4LF1A 1HQTA 3ARVA 4XKYA 1H1NA 3ZFHA 3F7JA 4OWGA 1TE1A 3ZLGA 2C91A 1J10A 1O1ZA 1WXYA 2QJNA 4HZ6A 1Y5VA 3WQ8A 2F6UA 2R14A 1ZJAA 3VGDA 4GZIA 3HG4A 3QV8A 2HRWA 1LYXA 5AKQA 3W6LA 5FIPA 4O4VA 3DH7A 3M0ZA 1FQ0A 4FALA 3KUMA 4FLOA 4DM1A 1NF7A 3M6DA 4LQ1A 5I5RA 1K03A 1BF2A 3GG0A 4J2PA 4X63A 3H4XA 4IQJA 1Q6OA 3PTDA 3BANA 2W61A 1ME9A 3IGSA 1V6XA 1TV5A 1LLWA 4IFRA 4LEQA 1UMLA 3TDFA 1A5OC 3RPTA 3LS9A 1J79A 4HQVA 4KGLA 1PKMA 4AD3A 3E74A 4HVXA 1KGXA 2GDUA 4HD5A 3TOYA 1V6YA 4IPJA 4H3DA 2VDHA 4TMBA 3W6MA 4KF1A 2WVUA 4CN6A 3R12A 1ZRQA 4Q8PA 3VIKA 1TV3A 1XYFA 2ZXQA 1OJXA 2R1NA 4H8UA 3UXAA 3WF2A 2CLIA 4ATDA 3R43A 3TQVA 2REQA 1CXIA 4JTLA 1JPIA 2XIMA 4KCVA 4CU6A 1IV8A 3U2ZA 4PUWA 2DZXA 2GZXA 3RUBL 4QSHA 1K77A 4O1AA 4WGXA 3PTKA 4YTRA 4KETA 4W8AA 1HZYA 3FYYA 4AHOA 4UQBA 1D8CA 3H2EA 5G2IA 4E2BA 4JTDA 3BE7A 1M7JA 2VFDA 4AHPA 1G5AA 2GUYA 2Y2WA 1J4EA 1U1UA 2OG9A 2PU0A 3HN3A 1LG2A 3E0FA 3F5JA 1B31A 4PFMA 3S0CA 5AHNA 1QI2A 1R3YA 2WNWA 4PMDA 1YW1A 1BYAA 2PP3A 5FAGA 4X2RA 1JAEA 3L4XA 1TPC1 3S2LA 5I24A 1H4PA 4JBRA 1X8CA 4XG1A 4O50A 3UESA 1I75A 2ZZ1A 1SR0A 3HPAA 4JX6A 2DVXA 4D6EA 5GJPA 4QHRA 5FKYA 1E6SM 5D03A 1NP2A 2C71A 4DXXA 1MI3A 4FMVA 1P0DA 1ECQA 1LQ0A 1E5JA 2DPEA 2DT3A 3WIJA 3WQ6A 1JF5A 1QRQA 3A4AA 3FSTA 2JGQA 3OGSA 1W6TA 3T78A 3ITGA 4NAFB 2WAGA 3MKCA 3PY2A 3EB4A 3I4KA 4Y9MA 2Z0IA 3BV4A 1QI5A 3LCIA 5A8PA 1RJRA 4GQBA 1GG1A 4UFJA 3VKCA 1DJNA 1PO9A 3S1XA 1TWZA 1WCGA 2BWGA 4QM1A 1NEYA 1SMDA 3TP4A 4RJEA 2CHNA 1UBPC 4F40A 1JI2A 2J88A 1FDJA 2VGGA 4AWSA 3BQ6A 1CNVA 4D6GA 3FFSA 1BKSA 3GE7A 3EEGA 3PBWA 3QV6A 3MB9A 3LM3A 2AL2B 1YNYA 5AYIA 3QLDA 3CUHA 1KB3A 1PKYA 1FFQA 1E3XA 3J7HA 2GYIA 1R3RA 2Q3RA 3TW9A 2BHUA 3VD5A 3UR7A 3GHTA 1RPXA 1LQ2A 1WZMA 2IKJA 3LD5A 1M03A 1OCQA 5I0DA 2NX1A 1Q8AA 3GB6A 2FYMA 4DWSC 3UWZA 2OSYA 1R3SA 1A4MA 1C8XA 3OA3A 1HGWA 1DQUA 4LBUA 1AZ1A 2OWCA 2NZLA 2FZDA 2ZRWA 4WKAA 4TXEA 1RA5A 2YZRA 1OD8A 3HQNA 3ITYA 3UNTA 1KCLA 2FVMA 1UKTA 3SRDA 5JXQA 3KZSA 3POCA 3BXWA 1E6ZA 2RJHA 4UBPC 3D47A 3IACA 3QZ6A 4IUOA 2FVKA 2WQDA 1JG9A 2D0FA 3WLPA 2BP1A 2FH6A 2DIJA 4J27A 5DFAA 4Q7BA 3T07A 1F7BA 3QTPA 4GI4A 1NJJA 1VBJA 1LOLA 2XH4A 5HMFA 4D6IA 1DTUA 3FX4A 4GYPA 4PH6A 5DBTA 2RGMA 4CQBA 1NOUA 3H4GA 4MFEA 1GYNA 1W3KA 4BI7A 4GZ7A 2V5BA 4NI3A 3HGJA 1JL8A 2UBPC 5LNUA 3WEOA 2CLLA 1KKOA 1F3TA 4YYCA 4ZOCA 1ITUA 2VM8A 4GABA 1FWTA 4WDXA 1Y65A 4JS3A 3TN3A 3LRKA 3GVWA 1M01A 3DFOA 4F0RA 5REQB 1LG1A 1SR9A 1E40A 3TYDA 1G69A 1KGWA 3RMJA 2R8WA 4UCFA 4YTTA 1MVYA 3S5SA 1IEIA 2P76A 4GZJA 1Y8BA 2ZE0A 3WF1A 3BSHA 3FVMA 5JVLA 1LT8A 2OLHA 4J3ZA 2QVHA 1KBIA 1J0ZA 4P8UA 4NRRA 4ONVA 1I1XA 1MEIA 1WV2A 4X0NA 1DWHM 1X7FA 1OK6A 4M80A 3R8GA 1LUCB 3W27A 3RFAA 1FDZA 4AD2A 1VFLA 4H8VA 3WFLA 2Q8XA 3BMVA 2D22A 3VFLA 3R0UA 3ITCA 1TPUA 4JX5A 3GXFA 3THCA 2QHAA 1C7TA 2YCLB 3E1F1 1GW1A 3URAA 4AIBA 4CNNA 4DN1A 5IOBA 4NP7A 4XIAA 1XYBA 2X42A 3A9BA 2XIIA 2GL5A 1B5TA 1MW1A 1O94A 4WKHA 2PDWA 2E67A 1EP2A 2XM1A 5FOOA 1YTEA 4WCJA 1RBAA 3AU2A 1E6PA 2RAGA 4MNJA 2HWGA 3T9PA 5GNXA 5CAHA 3K1DA 2J9YA 2ZZ3A 3LRMA 1EUAA 4ZSUA 4M6QA 3CHEA 1FVPA 2Z26A 3HU7A 1RLDA 3T0AA 4KWVA 4J2MA 1O7AA 4K8HA 1GKQA 4ZB0A 1B4KA 3CO4A 2VX5A 1QOQA 4PMNA 4M6UA 2C1GA 1HL8A 3AIRA 1QNSA 3VK5A 3ZT5A 3WJSA 4MLJA 2ZZ6A 1BEUA 1KLZA 3GNRA 1EEXA 4O53A 4OBTA 3TONA 4QDMA 7ODCA 1NQ6A 1YHTA 5LNRA 3V0TA 2YDSA 2WMIB 3VDHA 4W9TA 2ALRA 2J7EA 5EMMA 2FPVA 1XKJA 3QPZA 1ZFJA 1W8GA 3L0GA 3EOLA 1QATA 2VFEA 1JUKA 2W27A 3CZGA 1W17A 4YN5A 4B5WA 3BOLA 4ZEPA 4KWUA 3NQFA 4BR1A 5H1WA 4U28A 1W5NA 3PTMA 5CC6A 4DO5A 2OEJA 2HSAA 4LUIA 3W86A 3PHAA 1VYRA 4XB3A 4LX4A 4GY0A 3NM1A 3R6IA 4YTQA 2TYSA 1TJPA 1UWRA 1XWYA 4H9TA 4W89A 1M1BA 3VD4A 2G41A 2E1DA 3NYDA 2NVAA 1VEMA 4R7OA 5IRPA 1JQXA 5E09A 2Q8ZA 4C6IA 4LUSA 1TJ1A 1EWEA 1WKFA 4FA3A 2WKJA 1MMFA 1TV8A 3AS0A 1DHKA 3GR7A 4GO8A 3MCOA 1P4CA 5DMMA 2X7VA 4HOZA 2O7SA 3MP5A 2ISFA 3NQBA 5F1VA 2OT1A 5D32A 1E6NA 3CZEA 2PBGA 5EFFA 3EOSA 1XLCA 1CGXA 1NQKA 3KP0A 5ENLA 4ZE4A 1SO6A 1H61A 3W70A 3KTXA 3PK7A 2CKSA 4PRWA 3VZYA 1E15A 1A50A 2DGAA 3EDDA 1ITQA 1NVMA 5I3FA 2B7OA 4QBXA 5E9AA 1R87A 3P14A 2OZTA 2ON3A 3KL0A 4Q6XA 2VFHA 2QV4A 5CKSA 4M7TA 1N2VA 3BL3A 3F2CA 4ATWA 1Z9AA 2FLIA 1B3ZA 4KPLA 2VEIA 3NDYA 3U7BA 2WPGA 4ZVJA 4ZQNA 3MBFA 1WDDA 3E38A 2NT0A 1QMLA 2VCAA 2O55A 3B04A 3KL3A 3DDMA 1UH2A 3G3MA 3SCTA 4C6NA 1E1FA 3TW6A 1GT8A 3KHJA 3LHYA 1R30A 1GYMA 3SEPA 1EC8A 3A13A 2IXUA 1UR3M 1UHVA 2J24A 5C5YA 5FJJA 3UWEA 2PRHA 4IMDA 2WYSA 3EX6A 2NWSA 3WNLA 3WX7A 3WLLA 3IANA 1LL4A 3IVTA 1W2VA 3DBPA 3CL8A 3H53A 1TR9A 4AYGA 4XD4A 2CWNA 3M0IA 2F7FA 3W3OA 3GG1A 1E0WA 2CETA 3ISIX 4JDYA 4IXHA 4Q4SA 3CWNA 4Z42C 3SGUA 4IP5A 4MWAE 1I0BA 1E3ZA 5I00A 2PRLA 3AROA 3SI9A 2DQWA 2WBKA 3UXDA 1KFWA 3LSCA 4ZXLA 1XFBA 2QDGA 1E73M 3WBXA 4DHGA 2Z00A 3DI0A 1UH4A 1FWGC 3TTOA 1AQMA 1N55A 5E9XA 4DLMA 4G5DA 3WDRA 1EJTC 2UV8G 1E56A 2Z1KA 5CSYA 1S2UA 2W66A 4CU8A 1TVNA 4P7QA 2F9RA 2Y8UA 3HFYA 1VRXA 4GNKB 3N2MA 1FX6A 2BXYA 3INPA 1H7RA 3MW7A 4WSJA 1EXPA 1R9ZA 3DG3A 3H24A 1BQGA 1PDZA 5HBFA 3UW6A 3QC0A 4DNHA 3TTEA 4RE4A 1KM0A 3WNOA 2J9ZA 1AZ2A 5JBFA 1ODZA 3DENA 5FEXA 1AH4A 3QVQA 2HNHA 3WDIA 3KXQA 4HSHA 5ABHA 1XRTA 2GSJA 3YPIA 2WV8A 4Z1DA 4WEVX 4GYPC 2INFA 1SFLA 3F4VA 3LNPA 4YTSA 4N6FA 4QNWA 3P62A 3S1GA 1W31A 5U7SA 3AISA 2J13A 1BPLB 3GSMA 2OZ3A 4A8NA 2H9AB 1RA0A 1HKWA 1GEQA 1YLVA 4QS5A 1DJWA 4BQ4A 1N82A 2BZNA 3CQ0A 3TJ4A 2GOUA 3UEQA 1S5TA 2ZDRA 3LG3A 3WG6A 3VC6A 4ECLA 1XCXA 5DO8A 3F4WA 2C0HA 3TR2A 1VKFA 1OFDA 1QU4A 3GC4A 4HHMA 1FOBA 4D6DA 2YJQA 4UTLA 3PZMA 2OO6A 3TA6A 3R79A 3WLQA 4XZIA 2C18A 3ORWA 1UIOA 4GY7A 4K3ZA 3GXNA 2W67A 1OFAA 1GYLA 2NLIA 3T09A 4UTTC 1EHNA 1IWAA 3N13A 3VM5A 3B8IA 4LYRA 4ASTA 2OPJA 3ZJKA 3AU6A 5C7VA 4UFKA 1WUFA 2QCDB 5E93A 2GGEA 2EG6A 3O1NA 3E5BA 3PBUA 1UROA 3REQA 4FLQA 5AC8A 3T55A 3GFZA 4A2RA 2FZ8A 2C19A 5CQ1A 3T42A 1Z32X 2ZE3A 2C8NA 2PDYA 4L80A 4UQDA 1GUVA 4P8WA 4D6HA 5LXEA 2V5DA 4M56A 3S5YA 4XV0A 3NJ3A 2PBOA 2PTYA 4Y96A 1GZ1A 1BYDA 3KRZA 3GVGA 3W07A 1TTIA 5I7GA 1VZWA 4X3ZA 5LSMA 1RALA 3ZR4A 4HIBA 1UKPA 2Q71A 4QRNA 2J7DA 2ZUUA 5C9WA 2WMJA 1UWUA 4JAWA 1OC7A 2WO5A 2QDDA 1PX8A 4NI8A 2CW6A 1V02E 1GWJA 2E68A 1IXQA 2DT2A 3ZSTA 4LYQA 1S3HA 8RUCA 4NJHA 3CWHA 2OSXA 3W1XA 1F3XA 4B5NA 3GKFA 1JUBA 2JF7A 4O12A 3UJEA 2VI0A 5I6SA 4B5VA 4BEUA 3MP4A 3AUOA 2NLYA 3PR2A 2XFFA 2ZZ5A 2Y88A 1EJSC 3WH6A 2WW5A 3RR1A 4RUBA 4YS1A 2XPKA 1A5LC 2VGIA 2BY0A 4LUTB 3FJ4A 4HHHA 3GVRA 4LY4A 1L6SA 1QO5A 3NQAA 3VNYA 1TA3A 3THQA 1W0MA 2E8YA 1A3WA 4QLJA 3VNMA 4GNVA 3GR4A 4PGLA 1E0TA 5T9BG 2Y5SA 3IWPA 1QJWA 2X0SA 5DCBA 3VIIA 2A3CA 3G1AA 3TYAA 3RO6A 4X9YA 5D05A 1E9IA 5C70A 4FB7A 3QYQA 2J7BA 1XYZA 5CEWA 1A0DA 4D8LA 3TWAA 4U2YA 2Z29A 5DX7A 4H7CA 5HUPA 2BV9A 1P48A 3UWUA 4XZWA 1I9CB 3T2PA 4H8HA 1VCVA 3CT2A 2F84A 3P5ZA 1SUXA 1XS2A 4Z17A 2YCIX 4W4QA 3KVKA 1QI3A 4KWWA 3CB8A 2YPIA 4LS2A 4ERIA 3RAOA 4MHBA 1OIFA 3FHAA 1JRCA 4JKKA 3RN6A 1B9BA 2NVDA 1FXPA 3AQUA 4TIMA 3FA3A 5IHRA 1OGGA 3V1HA 4ZGYA 4C6BA 4LT9A 2V2CA 3VZZA 4OTKA 2EPLX 2PWGA 4B3ZA 3TSDA 1KRCC 4MMWA 2WMKA 4UQEA 3QOKA 3L2LA 2BDQA 2E28A 2LLEA 1BRLA 1A4LA 3NL2A 4JIEA 4KWOA 4JL1A 3TUUA 2GOKA 2EBNA 4H9MA 4HYRA 1AFSA 3GWQA 3RMEA 3HV9A 5CPTA 4HPJA 3DHFA 3IUHA 1YE6A 3ZWTA 1FUYA 4NILA 1XLAA 3PB0A 1DJGA 4FEZA 1BWKA 1RK5A 1US3A 4ZQMA 1VHCA 4C6JA 1KXQA 5FCZA 1KQYA 1KM5A 5AZ1A 1GHSA 3K13A 3N9KA 3STFA 3UXLA 1J6PA 1OYBA 1KQZA 3RHGA 1S5WA 2J75A 4XUYA 4BFAA 1SJAA 3WDQA 1HTIA 2XWDA 1XIMA 3PUOA 2Z7GA 4UNLA 2A3HA 4DB7A 1K7XA 4W88A 4DBUA 1G67A 3NVTA 3KTSA 3WUGA 3QR3A 4MNMA 4HOWA 1TJ0A 4DWDA 1LCOA 2J7GA 3M16A 1D9EA 3VGFA 4AF0A 4I7WA 3U5YA 5TBOA 4NYYA 2PEVA 3D6NA 3DI1A 3BMXA 5IBXA 2ABAA 1XICA 2ZWZA 4B3KA 4JN7A 3DZ1A 6TIMA 4OOZA 1PUDA 2J74A 3OA5A 3L4TA 3OZYA 1K4GA 2PF0A 1SZGA 1B4EA 2Z2UA 3AS1A 4OIFA 3HPXA 3M5ZA 3LV6A 5D38A 2FFIA 3UXKA 1WBHA 3TC7A 4LWWA 4WVXA 1H7PA 3EAUA 3BCFA 2IQ0A 4AZIA 1UIPA 4W5UA 3PWGA 4D2JA 1XIBA 4HTBA 4DEFA 3RO8A 5E0KA 1LL6A 4HNCA 4J4KA 1CYGA 4F4RA 3QR1A 5KZDA 3AZTA 3SUVA 2PURA 4Z2JA 4XZMX 2V3FA 1WBJA 5F4SA 2BODX 3Q2DA 2XGIA 3C8NA 1XIDA 3SSJA 3OHMB 4RW5A 3WJXA 3ITOA 2BASA 3QEZA 4A8RA 2QKFA 5CPQA 3ZT6A 3W74A 1MUWA 2NXHA 3WKZA 2PGEA 3T08A 1EDQA 4XAYA 4W85A 1CLKA 2AGKA 1CXEA 3RX2A 1NELA 4PB4A 2XHYA 4D8AA 3ZR6A 2V82A 2C15A 1PDYA 3NSMA 1V3IA 3IIPA 4LY8A 4LH8A 5D2XA 4H00A 1R85A 3ZLHA 1XC6A 4RDYA 3PTQA 3QF0A 4MJZA 4ZBCA 3VILA 4EX4A 1HL2A 4C1LA 5HPOA 4WDWA 3WBAA 2V6AA 2AGTA 4HA1A 1C9DA 3M0KA 2X1RA 1RBLA 3TIMA 2EHHA 4Y90A 3P0XA 1SJBA 2FGZA 4R88A 2RDTA 4XKMA 3KHDA 4KESA 4GIRA 2DP3A 4FNSA 4IISA 5GJNA 1IQ8A 4FR6A 4HYWA 2QPSA 4BQ5A 1HVXA 3SQLA 4B5TA 4HNVA 4L1GA 1SQ7A 3MP3A 3N34A 5CGMA 4IJCA 4RNJA 4ACZA 3ABSA 4ROPA 4IQDA 4LNYA 1J93A 3M0XA 2POTA 4MB4A 2OLSA 4JQAA 4PUJA 3W2MA 3GDTA 4G8TA 1FWNA 3D46A 3HGRA 3NR0A 4QIUA 2FH8A 2PPGA 2Z24A 2ZVIA 3S6OA 1E1EA 2PTZA 3CB3A 2Y62A 3EA2A 4U3AA 1LM1A 2J8GA 4L1WA 3L9CA 3A5VA 1SW7A 4GQGA 1GQJA 1XR2A 1A53A 2PC4A 2PDLA 4V15A 2PDGA 4B90A 4A4AA 4PA8A 1SPQA 3GDRA 1WDRA 3U4AA 2DSWA 4P7LA 3L0KA 5I3JA 3BW2A 4MIMA 3O63A 1UWTA 3A5FA 1A3XA 4UTKA 3WLTA 4GYJA 1EIXA 4WLCA 2PMQA 2WZMA 5JQ9A 2PF8A 3GNOA 4TTGA 1NOWA 3I65A 1E0UA 3EGJA 3SN1A 3NWRA 3KVLA 4GVFA 2FDMA 3H8AA 5CG7A 4OE7A 2GJXA 2Q3OA 4JFUA 2HZGA 1UWQA 5LIUX 3NOEA 2XZ7A 3VGBA 2FHFA 3UBPC 1G7VA 1XV8A 3CQJA 4R27A 4RNFA 1CGUA 1J8VA 1T6MA 2A0NA 5F7UA 3SCQA 1U5VA 1DP0A 5DT7A 4O0QA 3OYZA 1UASA 2IUZA 3UCDA 3TJIA 4PULA 3WJWA 2VUNA 1FWJC 3BAJA 3S42A 2RDWA 3EDKA 2INZA 2GK1A 2OSWA 2NV2A 1GVOA 3AIEA 1PVNA 3BGGA 2CXEA 4PRTA 4I7VA 5I79A 3PPHA 4O1EA 1DXIA 3IVUA 3QSRA 1X39A 4R3UA 3JW7A 1E43A 1D3GA 1VFTA 1XL9A 3WNNA 3AXXA 3MUAA 3M44A 1CBGA 4KIEA 3G18A 2VZSA 4N9EA 3KCLA 3BAXA 3NL3A 2I16A 4Q4PA 1X38A 1MUMA 2POZA 2XN0A 1DWAM 2IPFA 3OLDA 2PA6A 4OJYA 3EWBX 3NAVA 1RV8A 4E4PA 1TUXA 1DXFA 3ARTA 1YIXA 2C16A 2ZZ7A 3QXBA 3ZVHA 2OKOA 5CBBA 3WLSA 3TEVA 1KTCA 3NQEA 1VFOA 2RKXA 3TJXA 2X40A 5K3VA 1W1YA 2P3ZA 2EO7A 1IWBA 1ZP3A 2RH9A 4H7VA 2E09A 3RILA 3PVFA 3I6RA 3G22A 1H5YA 3I3DA 3ABRA 3B0YA 1E55A 1K8CA 1CT5A 4M1BA 4UUIA 5HOSA 3FNDA 2YFOA 4GE8A 3T4WA 4EXAA 3GAKA 3H2NA 6PTDA 9RUBA 3HIJA 1Q6QA 3WD0A 4FO4A 3L4YA 2DUAA 3LHZA 2JEQA 4H9XA 1DYSA 4UTUA 5HAOA 3UJSA 2HXTA 2VGBA 3T0CA 3FJLA 4QAWA 3EMZA 4NNAA 1J96A 2P8BA 3N15A 2DZTA 1BLIA 5LIKX 1OYCA 4F2BA 3UA4A 2BTMA 4JYEA 3SURA 3FXGA 1JAKA 2FTWA 2ZICA 4IP7A 3M0YA 2XIOA 1D3CA 2CBVA 2V30A 2D73A 2QCLA 4L6OA 1HL9A 3G77A 1GVEA 3BW3A 1NDYA 3LENA 2OYKA 3EWUA 1QNPA 4AWEA 4GI6A 2GGJA 3QZEA 4C1NA 1L8NA 4FR1A 4DYEA 2B4GA 2P3EA 3W2UA 4JTIA 2E9BA 3N1AA 3BZJA 3KL5A 4DAFA 1FWFC 3VOCA 4ZFCA 2BBFA 4MWAA 1MW0A 1UMYA 3G1DA 1NOFA 1NDVA 2X2YA 2PDJA 5BXPA 3V4BA 6TAAA 4KH2A 2OX4A 3A22A 1Q5MA 3IJ9A 5IBXC 4JY9A 4AIEA 3VUSA 4QNEA 1YTKA 2I9UA 2TAAA 3VCRA 5FI8A 3H70A 4Q33A 2V67A 3WELA 4Q7NA 1E9YB 5I3HA 4UFHA 4RPQA 5BXTA 1GKRA 2FIQA 2J7CA 3VGEA 2PS2A 2JF6A 1QCWA 1UUMA 2XINA 3AFBA 2NV9A 3BV7A 3W7KA 5LKYA 3MTWA 4YWSA 2BY3A 2PDMA 1FBAA 5B80A 4BEQA 4KS0A 2RDXA 1TPVA 3QPYA 1BFNA 1B9ZA 4QP0A 1J2BA 1JEZA 3W6YA 1VHNA 2YW3A 3AICA 2XIJA 3OG3A 3STEA 1TPH1 2G96A 2IS7A 3A4XA 4OVXA 2VC5A 1KRAC 3VIPA 2WANA 3SFWA 5M2FX 5K2ZA 3U57A 4LU0A 2EKCA 2NUXA 3CH9A 4F0KA 1MQRA 1SW3A 2NQZA 3W7MA 9XIAA 3STPA 1A47A 3TVAA 4KEZA 3A47A 3XIMA 4Y9AA 2VHLA 3FSUA 2QCGA 4EAYA 3CTLA 1G0CA 1OZQA 3DIPA 2ABBA 4HPXA 3W73A 1QNOA 8XIMA 4EWJA 3SW6A 3AJXA 5AYXA 4O1DA 3MS8A 1PZ0A 5BYWA 3UERA 3O07A 1V3MA 4AAJA 1EFZA 2Y61A 2WBGA 2XU2A 4X0VA 1KKRA 3BCDA 4V1YA 1TJRA 4RR4A 3ITXA 2XDFA 3MCNA 1UKQA 3FK4A 3VYLA 4ES4A 3NYZA 5CBJA 1H49A 2OGYA 4W84A 3RLVA 4U33A 3OODA 1N8WA 3LM7A 5AHLA 3M0HA 1SMAA 4D8ZA 2BG5A 1DIKA 4DJFD 4NZ4A 3MHFA 2OWWA 5AYZA 1F07A 1TWDA 3OO2A 5CXPA 1Y5XA 4YVPA 3UJFA 3I7SA 1JFXA 1C8QA 2PP0A 4H6KA 3BLFA 9CGTA 1F2JA 2JKAA 3ARYA 3BC9A 3N4FA 3FEQA 4J7RA 3IGUA 5HMEA 3P6LA 4HN8A 4JFTA 1AJ2A 3U7VA 2CBIA 3NNTA 5HULA 2FB2A 4IL2A 2YXOA 4YL2A 3TSBA 8CGTA 3AMGA 3I68A 3VCNA 1SO5A 3AMDA 4NU7A 4GH3A 3QHOA 3WD4A 2QIWA 4M19A 5EPDA 1TIMA 1AH3A 1H11A 4K7VA 3VIJA 1Q7ZA 1TCDA 4GIEA 1RBOB 1Q45A 3ITTA 3KEHA 3GTXA 4ERGA 3OGVA 4Z0JA 1X6UA 2BHYA 2I7GA 3LCLA 5A8GA 5EBAA 3DGBA 4O16A 1J5SA 3D0CA 1AD4A 3F2DA 5AOUA 1JYNA 2YR1A 4AMCA 2QCEA 4XIMA 1HJWA 3C2FA 2PCQA 2IPWA 2GJNA 4GLEA 2GK1B 2JIWA 2DJXA 3LPGA 2PDHA 1AMYA 2W92A 2F6XA 1SJDA 1F6KA 4PTWA 4REQB 2E9LA 2P0IA 1IEXA 3AS3A 3R7MA 3MHGA 3TMLA 3WK3A 2VP8A 2HDJA 3SO7A 2DV0A 1LT7A 3P82A 4CCEA 3TZFA 4EPDC 1TMLA 1ENUA 1L2QA 5A5WA 1REQB 4PB5A 3UGRA 1EJXC 2ATSA 3M7WA 3A4WA 5G1MA 1H0IA 2YA0A 2AL1A 2DZBA 4UQCA 6A3HA 5AHEA 4G9PA 1VIZA 5CZJA 5HQMA 2RFGA 5MF5A 2V3DA 5F4WA 1IZKA 1TVLA 4C90A 3DECA 4S3FA 1RQEA 1XC4A 5LA2A 4RDWA 1PXGA 4MF4A 1KFJA 1UYQA 4GG9A 1XH1A 2OO0A 4FOKA 1UZ1A 2ZRZA 2G3FA 4K37A 4PN2A 4B4HA 4D1JA 2AKZA 1BTCA 4N9DA 3N14A 1KTNA 4NNCA 1A5AA 1R9YA 2YDRA 2XVLA 2QCCA 1QTWA 3TJLA 3VU2A 4FP1A 2PC8A 1TPEA 1LLZA 3BW4A 3CAQA 2O9TA 3VFCA 3HF3A 4S2BA 5E5CA 4QE1A 3G6LA 3HA1A 1I2PA 3DHPA 3QMSA 3WLIA 2ACRA 3GDMA 1Q65A 1J0JA 2QUVA 3W1MA 3B9AA 5AC6A 3PANA 1DIEA 2BVTA 4FNUA 1CGTA 5HATA 3E02A 2R1LA 2E0PA 5FL1A 2Y89A 4QEEA 3MKVA 4AG0A 2DSZA 2IKHA 1LBFA 1LWJA 1RSCA 3WL0A 2E25A 2VQUA 4MYAA 1PZ3A 3GAYA 1W1B1 4MG4A 1EA0A 2WMHA 1M3UA 1SO4A 2B31A 1VEPA 4DO7A 1R8LA 4IXXA 1YADA 3A12A 2YL8A 1EP1A 5E6YA 4UOQA 4FZIA 1XBYA 1P5BA 2P53A 3JZUA 5JBEA 3B9NA 4PEKA 1KFKA 1OT2A 4DVOA 4DBWA 1U5JA 3H26A 3W7CA 3WQGA 2GSEA 1UJQA 3RU6A 7TAAA 5JH2A 1A3HA 4MWAB 2HVOA 1PZ1A 3K8MA 3NZGA 3QLLA 3MKKA 2VURA 1EF2A 4QSFA 1KXVA 3CQIA 1FHLA 3ABOA 1TREA 3L65A 3DESA 3P74A 2RDUA 1H1YA 1JCTA 1GVRA 4AH7A 1KFEA 1Z69A 4RE2A 4JTAA 3LI0A 3NPUA 3EBVA 3W28A 1K9EA 3NIYA 4D72A 1XIEA 3L66A 4MY9A 4BI5A 2VC7A 3R8HA 5C8BB 4MM1A 3WNKA 5AZ0A 2OT0A 2DUXA 3N29A 1B3OA 1CXHA 4GVGA 1GVYA 5D9NA 4B2DD 3LSBA 1DJZA 3ES8A 3W2JA 4MZ1A 4RDVA 1KLYA 3NOYA 1TVPA 4CQAA 1XLGA 3UGVA 1XKYA 4JFWA 5GQBA 1E1CA 4RZ6A 5KZEA 3LGDA 3T4CA 1PAMA 1GQLA 2XVNA 3II1A 2WZTA 4Q4RA 1KV5A 2WSQA 4B3LA 1FH7A 1MDRA 2XIQA 4OT7A 3BG5A 3ECQA 3VE9A 4DUVA 3MJMA 3DYOA 3WF4A 2VZTA 3GHUA 5CSSA 2XUCA 2YCJA 4FX7A 1XG4A 4OV4A 3E6EA 2QAFA 2ZZ4A 3H23A 1GVIA 3HQ1A 3SQSA 3OVGA 3UYCA 2UWFA 2EG8A 3I6EA 3VNJA 1J2WA 1LL7A 3M0JA 4K39A 4XX6A 2RHGA 1G6CA 2QAPA 4R7WA 1XPYA 2G95A 4JL2A 4DX3A 5A3HA 4IJBA 3WN6A 2ZUSA 3S1UA 1IHIA 1UPPA 3S2CA 4PMRA 1GJPA 4AY1A 4IGMA 5C9XA 5EA9A 4C7DA 1KCXA 1MRAA 3TN6A 5XIAA 1EC9A 1R7OA 1DORA 4CCCA 1BSLA 1DBTA 2BMBA 2PU1A 3ZYZA 1KV8A 3LBOA 4PMOA 4WKFA 4W5ZA 2FDSA 4MKVA 1NP0A 1ZUAX 1EBHA 1EJRC 2FMNA 4JN6A 1XLHA 3URNA 1JF6A 4JIHA 3KS6A 3UR8A 2GPTA 3F2BA 5M03A 4OKDA 2BVDA 1WKEA 4XZHA 3VNIA 2YDAA 2GGHA 3BK0A 3VGHA 4YU1A 2FKPA 1DQXA 4MNLA 3UVAA 1VJZA 1TZ9A 3ARZA 4GISA 3AYRA 1ML1A 1QW7A 4ORIA 1TTJA 3MZ2A 1GTEA 3CV2A 3SJNA 2EPOA 2VFFA 3NG3A 1X6LA 1GW9A 3MYOA 2QMJA 4GYKA 1B90A 1P6CA 1K8YA 5MKGA 1HJVA 2PDFA 1KWKA 1IGWA 3AC0A 3EDFA 4RXFA 3OBEA 1ISWA 4NKCA 2HBXA 1HJSA 3OGRA 5KITA 3GBDA 1ITCA 3W1TA 4P61A 4G1NA 3GIYA 1OGBA 3WD2A 4AEEA 3H12A 3VIFA 2J7FA 3ZXWA 2XSXA 3QN3A 2TPSA 4S39A 3JRKA 1NDZA 5CPNA 3W83A 3BJFA 3L4VA 3CXOA 4WQ6A 4OFCA 1F6PA 2DVTA 2OXNA 3MSYA 1UD2A 3O9NA 4F48A 2E6DA 3KVJA 2UY3A 2CWXA 1BAGA 4CUCA 2VC6A 3N12A 3HMCA 3MYPA 3PZTA 3AXKA 5IFPA 3P8IA 3FDKA 3V75A 3S6TA 1B3XA 1XDMA 4UTFA 2XISA 4IG2A 3UR5A 3AI0A 4CVWA 3VZXA 3G24A 4GUIA 3O05A 4JOMA 3HQPA 4LAZA 3TROA 4GK8A 1Z3NA 2P5NA 1KBBA 2A3BA 4E3TA 3BLEA 5FJIA 1MEHA 4E4FA 5GVJA 5EL1A 3GTIA 1XBXA 3CZKA 3UZXA 3C0QA 1I6NA 3CPGA 2I5IA 4XD6A 3WJYA 3OHIA 1GKPA 2AMGA 4ZR8A 1VFMA 2PLCA 1AK5A 2D0GA 4JY8A 4XQ6A 4K8EA 4GJ1A 1F76A 1NF0A 4DBEA 3ARWA 1KFBA 1QI0A 4L9YA 4Q4QA 2XN2A 2ADAA 2WQPA 4FXRA 4K68A 4NYUA 1XG3A 2VNCA 2Z1SA 4GC3A 4HTYA 1OCNA 4KBXA 3M1ZA 3NURA 2OTDA 4LAOA 2JALA 2XFRA 1K9FA 4ACYA 1X97A 3TYEA 2HPIA 2D20A 2PRMA 4Y7EA 3WDPP 3UWYA 3SCSA 1JPKA 1YQ2A 4AX6A 3BOFA 3UT0A 1QT1A 3LRLA 4IIHA 1LROA 4IICA 2W6RA 2PTWA 4DYKA 1V79A 5KETA 1RHCA 2V3GA 4AZBA 1LRTA 3KCOA 3AIWA 3SZ8A 1XGZA 4PMQA 1PX4A 1XQLA 3W75A 1QWGA 5FEWA 4AZ6A 3G0XA 5CZ0A 4P2VA 2X30A 2YLLA 3MUXA 5DANA 2XIBA 3P93A 4P8XA 4KT2A 3ARQA 2OQLA 3GXMA 2PGWA 3B0UX 4LRTA 4YJ5A 3Q45A 1TUFA 3VKBA 1DWGM 1P7TA 1JJKA 1VJIA 1FWIC 2L5HA 4IX0A 4HJWA 2Z2BA 3KRBA 4LVFA 4KERA 4JQ4A 4IIBA 1TX2A 1HUVA 4AXNA 1F74A 1W91A 2OLAA 1L6FA 1VCGA 1M53A 3AYSA 3UZZA 3BAWA 3S2NA 1TCMA 4GOAA 2CLPA 4I9TA 1P6BA 4AISA 4YNGA 1V6WA 1OGSA 3ABXA 1XXXA 3Q65A 3IEBA 1B3WA 3DEQA 1FXQA 3PSVA 4DAIA 4CNPA 3GTHA 4FNTA 3MI3A 1HN1A 4JKLA 3QY8A 4XAGA 3VTRA 4O52A 4ZZ9A 1CB2A 5G4WA 2EAWA 2HISA 4IIEA 3VIOA 2Y5EA 4NAEB 1XYMA 2FZ9A 1IT0A 4FXJA 1CXFA 1CW2A 3VIMA 4D9PA 1HKIA 1B54A 3PZUA 2F8QA 4RV8A 4JTJA 4A05A 2NSOA 2QCNA 3A23A 1H7OA 3CJPA 1EC7A 1MNSA 2ZUNA 2RGLA 1O68A 1V0KA 4JIRA 1C92A 3G1FA 3BSGA 1QPRA 2PZ0A 3TYBA 2WMFA 2FMOA 2EJAA 2V2DA 4GRSA 3AWOA 2EJ1A 3E5PA 1AL7A 2G97A 1TPWA 2VVNA 1S5VA 3C52A 3CUJA 3B3DA 3WY1A 4CQ8A 3UETA 3HG3A 3N2XA 7REQA 2HBVA 3K4DA 5DXXA 5A69A 2XH7A 1E4IA 3G2GA 1NIUA 2DH3A 2WM1A 4U31A 4N4PA 1UKSA 3SIZA 4J28A 3OOQA 3MV01 1E1CB 3NXFA 4JYDA 2VVSA 1LRQA 4MGGA 3EOUA 5KEZA 4FIQA 5H2ZA 1KCKA 3G3DA 3PPFA 3VAVA 6CGTA 3WQ5A 1IT8A 1MFVA 5DY3A 4FI4A 2ZADA 2VYOA 5CPLA 3G8RA 1V6TA 1ADOA 3W1UA 3W1RA 4E8CA 1PSCA 4WY0B 3Q37A 3THUA 5D4YA 5BWAA 3U6WA 2QUMA 2ZC8A 4I5UA 1EYEA 1AUSL 3LLFA 5T8GA 1FH8A 1OF8A 1HJQA 1Q6CA 4RE0A 4E3VA 3N9RA 5BRQA 3W02A 1QOPA 4QE4A 2FJUB 5D33A 4F0MA 3CUXA 4IQEA 4IMCA 3CZJA 4BHYA 1RZMA 5MHBA 1Q63A 2CERA 3GFYA 1FCVA 4DWSA 1VFHA 3IRDA 3LQLA 4PUNA 5AY7A 1I2RA 5C9ZA 3K30A 1FY6A 2CFFA 4LOCA 1VYPX 1X8FA 1IT7A 1PS9A 3WBEA 5D9PA 3CAKA 4RV3A 4J3VA 1KO0A 4PUEA 1CXKA 1JVNA 3PBVA 1CGVA 4AZCA 1JYXA 3WK2A 4JTKA 2OOGA 1TFVA 3VOIA 1H3GA 3AMKA 1F5ZA 3SCPA 4PSPA 5GNZA 3CHDA 2H3BA 3TQ0A 3W22A 3HFTA 5A8MA 3CQKA 3GW3A 4Z0SA 1OIMA 1HF6A 3HGOA 2ACQA 3VVGA 2I9EA 1OX6A 1A49A 3N6JA 4NZJA 1V7YA 3U48A 4Q8VA 1O4UA 4M5PA 3USZA 3FGCB 4UOZA 5MKGB 3C0JA 3DFSA 1OCBA 3CV1A 1Q7MA 1BXBA 1FP9A 4H19A 3V18A 4IGNA 3BJTA 3UPBA 4KKXA 1CDGA 3SQMA 5HPCA 1QNRA 5BXSA 1NWUA 2Q6ZA 3W01A 4EIVA 1XGEA 2OU4A 5CC5A 5EYWA 3V16A 4ENLA 4GQQA 5BRPA 3TCEA 2IPJA 2WLYA 2ICSA 5DMLA 1V03A 3SAZA 3WH5A 3ANUA 1S38A 4H2CA 4PZVA 5HINA 3GXTA 1VF8A 1QHZA 2XH2A 4R34A 4H6EA 1UZHA 4EF9A 3HBLA 5HR6A 4ZE5A 4RCXA 1XLKA 5J04A 1DQWA 1W37A 4O19A 4DBSA 1I60A 4XZLX 1KM2A 1JZ5A 3I7RA 5GPRA 3A3XA 1W56A 3S6DA 4I5RA 2HPMA 4IG2B 4J3SA 3MMWA 3GD6A 1K7EA 1MW2A 5BOOA 4DIAA 4F79A 3TWBA 1S2VA 3LMZA 4CQ9A 2JGYA 1SZFA 2VEPA 3M5VA 3G0UA 1DKWA 4F2UA 1HO4A 3RRAA 1UC4A 1ZU8A 1RXOB 3OEXA 2GDQA 1QAPA 2QDEA 5LIXX 2OODA 4H6RA 3KCJA 3WBWA 4F0LA 1P0KA 4H8NA 1ONWA 3GYEA 1VBUA 3BGAA 3SCWA 4W7WA 3VX1A 4XAFA 1OSEA 1MSSA 5AECA 1QWKA 3KOZA 1HKKA 1G4EA 1LDCA 4XVEA 4WJEA 4ICCX 1UP2A 1EL3A 3WUBA 3EXRA 3UY7A 3EX1A 4BY3A 2E5BA 1UD3A 4C6DA 1XLFA 2VR4A 4PUUA 4TQTA 4MOZA 2BVYA 4Q8QA 3UR2A 2GVLA 4JTRA 2JBMA 3TKFA 3UVIA 2QF8A 2HVMA 4IIFA 3U2CA 3G6MA 4YPJA 4N02A 1ISZA 4O0ZA 5CPOA 3QQ0A 4AQLA 3BCJA 3MO7A 2P50A 1VJSA 3NEHA 1FHUA 3EPMA 3G5EA 1MZRA 1JNEA 3FJ6A 3VC5A 2DFAA 1OF6A 3OBKA 1S5MA 1E6QM 1DJQA 3UA3A 3VNLA 2GUUA 4L9XA 4M3PA 4NL1A 2ESCA 2PD5A 3WSUA 4QG9A 1W9VA 4HZ7A 3EDJA 5K9CA 3GZAA 1FWDC 1DJIA 3W7NA 4CEUC 2W3ZA 1QOXA 3LXAA 5A6TC 2INEA 1HFBA 2YCKX 1K9DA 3ITLA 1JD7A 2XFWA 4LJ3A 3ZJ8A 4UR9A 3GK0A 2CLEA 3SCUA 3MC5A 3RGTA 2XVGA 4NUWA 3VKDA 3EEZA 4C6OA 4QLLA 4AC1X 5BW6A 5A8QA 4NJJA 2PDNA 3W4RA 3LMYA 5HWNA 3C0LA 2PDXA 5CZTA 3S9ZA 1LJYA 2PGRA 4YHGA 4U5IA 1S2WA 3UG5A 4EWND 1HW6A 3IIXA 4IGHA 4JICA 1UKOA 5I77A 1GOMA 2PWHA 6ALDA 3B06A 1W9UA 2WC7A 2NQ5A 4IOTA 3TW7A 3PNUA 2FPTA 4Z1AA 3AYTA 3GKAA 4Q4MA 2PTDA 3NO1A 1R86A 3B9OA 4X2PA 1KBJA 3RYSA 3LZ3A 3M46A 4GVHA 2G3NA 1X96A 4LS0A 1W5OA 4YMZA 3AXIA 3FOKA 3GG8A 1TMQA 3EB2A 1PL9A 2QT3A 4IL0A 3CUGA 3B40A 4PSRA 4EXBA 2EPKX 3E0VA 1B3YA 2WJEA 3WK1A 4HZ8A 3WQEA 2B7NA 3CT7A 1US2A 2V0TA 3R2GA 4LB3A 4GQ0A 4AEOA 1ZJIA 4E4UA 3BGJA 3OG2A 1CTNA 1X1OA 2J27A 1RCQA 2PWFA 2XWEA 4LW7A 3DUGA 3IARA 4HA4A 5A6BA 2FJKA 1NWSA 5KTLA 3B8VA 3WMCA 3WMSA 3OLIA 3RLGA 1JYVA 2DEPA 4MDPA 3S1VA 4K1WA 3F5KA 2ZRYA 3VMNA 2NUWA 2TSYA 3MPGA 3W7IA 1XPGA 4QCFA 5FJTA 1MW3A 4ZO6A 2RUSA 3L2IA 2DSUA 2YFNA 4LYPA 3MZNA 2VDIA 4GCAA 4B4FA 2C6QA 8XIAA 1J0YA 1WYIA 3QFEA 3SECA 1UQZA 3EX2A 4DWSB 4CD8A 3LTYA 3SRHA 1H09A 4YHEA 3AS2A 1LBMA 4AHQA 1RPKA 4YYFA 1RCXB 1B0IA 1EA9C 1G4PA 2A5HA 4TO8A 2AMXA 3N18A 1VCFA 2HTMA 1YDYA 1XLLA 3APTA 5FEZA 2ACUA 3MI6A 2Z4GA 1K1DA 7ENLA 1OFRA 5AC7A 4L1XA 2OZ8A 3PZVA 3N6QA 3WQPA 1GK8A 2VFIA 4QJ3B 4AVNA 2YX0A 3SUUA 3F4NA 1CGWA 1W1A1 2GVYA 1OX4A 2VCCA 1OC6A 4TUFA 3BOXA 4RDZA 1TMHA 4NZFA 4DLFA 4GMEA 5H91A 4DZIA 4NNBA 1Q2SA 3A9IA 3R13A 5D2TA 2CHRA 2IQDA 5HWMA 4JTHA 4WZHA 2QPXA 2CBUA 4BQ2A 6REQA 4TMCA 3SSZA 2BB0A 2VD9A 4PMJA 4MAZA 4NSBA 3OW1A 2D69A 2ISDA 2OVLA 3VNZA 3HB9A 3SR7A 3STGA 4TVDA 2VFGA 4UXDA 1J0HA 1BGAA 1LLOA 1YYAA 4CVUA 3TYCA 1MUCA 2BOFX 3DFNA 2A4AA 2P8CA 3FIGA 2WVVA 4ERAA 1GOWA 3MUIA 1U5HA 3WQFA 1V5XA 1GCYA 4ORMA 1X7IA 3DC0A 3GIPA 4I6KA 1XYLA 3K8KA 1V3HA 3ID7A 3ZVIA 4JNYA 4UTTA 1QHOA 1WPCA 1CENA 1MO0A 2VT0A 1MDLA 4DPPA 2GQAA 4UZSA 4WHBA 4JPGA 4OQVA 4KMQA 2J66A 4AD1A 1KC7A 3WUFA 3BWWA 2CESA 1UD8A 4XBJA 3W7LA 3N4EA 4ZOBA 3TLQA 5FESA 3KFTA 1OK4A 3NPXA 1HJXA 2CZDA 5K4XA 3M43A 3W25A 1PIIA 5EGRA 5HJYA 5E70A 2R91A 4B16A 5C9RA 3P7YA 4XTIA 5BWFA 4UFLA 4V28A 1F8MA 4CQCA 3FKKA 3AHZA 4BF5A 4YIWA 4CCDA 1YTDA 4FHAA 4TV5A 3ZOAA 2G3MA 3AIQA 4FK9A 5H6HA 1RD6A 3L4UA 3WLHA 3UZJA 4JTCA 4AIUA 4BQ3A 2YIHA 3LPOA 1O95A 3QW3A 4XKYB 5HR7A 1EUNA 1XUZA 3CUFA 3H55A 2FGBA 3OLGA 4C7GA 1R3TA 2QJHA 4U5KA 3H2MA 2Z6IA 3IRSA 4XWUA 1TWIA 4WDUA