3CB8A

4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
244
structure length
244
Chain Sequence
VIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyruvate formate-lyase 1-activating enzyme
publication title Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 82
structure length 244
sequence length 244
ec nomenclature ec 1.97.1.4: [Formate-C-acetyltransferase]-activating enzyme.
pdb deposition date 2008-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF13353 Fer4_12 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3cb8A00
2YR1A 2GUUA 4JY9A 4ZQPA 1K8XA 3VE7A 1VZWA 1SFJA 1WBHA 1Q6QA 3NQ6A 4NXKA 3EWWA 2ZRWA 3NOEA 3W7EA 4UIOA 4LY8A 1SO5A 2DZVA 1LZOA 4EWND 1QPOA 1JULA 2ZZ3A 2H6RA 2VKZG 2E1DA 1L2UA 5E93A 2RDWA 3DXIA 4LVDA 3P80A 3TAOA 1KTCA 1G7VA 2ZZ6A 1EUNA 1TJRA 3KVJA 2EPHA 5FESA 3CLMA 2ZRZA 2VENA 4JTJA 2XFWA 2A2IA 4IUOA 3TSBA 2NUYA 2PC4A 1BTMA 4XBKA 3THAA 5AFDA 4JD4A 4HNTA 2W0UA 3TQ0A 2ZQ0A 4RXGA 1LORA 1THFD 3CIWA 4Z0JA 1H1ZA 4N6EA 4BI5A 1XC4A 3GX9A 4IMFA 3EX6A 4JTSA 3CU2A 3W9ZA 1JRCA 1YDOA 4UR8A 1W5QA 1YADA 3P5YA 1KM3A 3HGSA 2TMDA 4X22A 3P81A 3F03K 5EA9A 1OX4B 1FWRA 4PEKA 4UMBA 1SW0A 4N02A 1VLWA 2HMCA 3UZJA 3LCLA 1KFEA 2OMAA 5HUOA 1W5MA 4IQLA 3TK7A 4ZQNA 4ML9A 2VC6A 2QUUA 4M19A 1TPUA 4LVBA 1GOXA 4H4IA 3S5ZA 4A2RA 3TSMA 4Q32A 3TE9A 3MP4A 3QPZA 5BNKA 3ZS4A 5KTLA 2C14A 1TPB1 3SGUA 1JCMP 5DBUA 1MEIA 3V1PA 2QCMA 5F1UA 1VRDA 4A2SA 2ZBTA 1TPEA 5K4XA 3NNTA 1F2JA 1OFAA 4RZ5A 1X6UA 1H7RA 2YX0A 3EX3A 4XKYA 1I2OA 4ORIA 4TU1A 4FNPA 4DBDA 3I7RA 1KV5A 3AO0A 1FCUA 1JUBA 3UYCA 2EAWA 4LOCA 3FIGA 4HPJA 3QPYA 4DF2A 3A23A 3IGUA 3NQ8A 5KMYA 3H55A 4LS2A 4JTEA 4NJJA 4IGHA 2XN0A 2VEMA 2Y88A 3TQVA 1XUUA 2A0NA 4LVGA 5HULA 1ZALA 5DLCA 3T44A 1VGAA 4QNEA 2FB3A 1B3OA 4HHPA 3M16A 2I1OA 1AG1O 2YSWA 1AMKA 3TCEA 3GAKA 4Q4KA 2DORA 1QOPA 3NAVA 2ATMA 1R2RA 2P0OA 1WOBA 3W2LA 1FQ0A 2E77A 4XTIA 4W9TA 3WK2A 3UQNA 5KINA 4BK9A 5CSRA 1D3GA 1ME8A 2QKFA 3DHDA 4CCDA 4LV4A 3TNOA 1JR1A 3S1VA 3EKLA 5MHBA 1H63A 4FHAA 3W6YA 4OQVA 3UY8A 3MMTA 4WY0F 4YWIA 3HBLA 1JQXA 2WSYA 1R30A 4JTUA 3W75A 2C15A 1AL7A 2NLIA 2CLFA 5HQEA 3HPSA 5D02A 3C52A 2EF9A 4A29A 4LRSA 2VFIA 2QDHA 3LCIA 3NL3A 2GVGA 3DU0A 2V2HA 2ISVA 1WYIA 4O4VA 5C2XA 1KBJA 4K7VA 1A50A 4GRSA 4XZ9A 1QDSA 3LLDA 1OHLA 2E6DA 4KKXA 3PG9A 3G8RA 5AC7A 1R2TA 3ABRA 3UWYA 3G0SA 3GLCA 1VCFA 3NA8A 3CHVA 1KM0A 1ML1A 5CPNA 3TIMA 2CW6A 4DEFA 3BG5A 2CLIA 3BG3A 4UFIA 1R46A 1F76A 1M6JA 2DZTA 3D0CA 2JK2A 1H62A 5I3KA 4ADSA 3B0UX 3N2XA 4TIMA 3KRUA 1TB3A 5BMXA 1QCWA 3GNDA 5DY3A 3GB6A 4IX0A 4AWTA 4JYFA 3CB8A 5G1TA 2V82A 3FKRA 1S5WA 3STGA 4HSOA 3TR2A 1VJIA 1JCLA 1X1ZA 5F4SA 1MZHA 1IXNA 1QAPA 3G3MA 2ZZ7A 4JDBA 1K7XA 5EYWA 3B0VC 1GTEA 1FDYA 1TYGA 3TMLA 2V5LA 3MI3A 4PA8A 1QMLA 1AW2A 4FNUA 4MLJA 3TFCA 1TV7A 3W7DA 3E02A 1YDNA 3SSJA 1A5CA 2J9XA 1DHPA 5EMUA 5AHLA 2H3BA 3TJXA 3S5NA 3PVFA 4GNJA 1R2SA 5J5DA 1ZJIA 3W7OA 4XKYB 5F2GA 5D2VA 1K02A 1VYRA 3QEZA 4O1DA 3GKFA 3KFTA 3TROA 3HPXA 1TQJA 3O6DA 3UWWA 3UY7A 1H50A 3I65A 4FX8A 2VFGA 1A5AA 2NXGA 5CZTA 5HWMA 4NJHA 3LM7A 3HF3A 3PY2A 1SW3A 5HR6A 4IPJA 1F6PA 3F4NA 3WK1A 4GBUA 3NYZA 3WK0A 1I2RA 3LRMA 1OX6A 4UUIA 2VXNA 4RV8A 3PAJA 3DFSA 4JYEA 3EXSA 4UTTC 3FYOA 2V0TA 3R5EA 3MYPA 4AF0A 5DXXA 4NX0A 2WV8A 3CQ0A 3PB0A 4M7SA 2FIQA 3C61A 4MYAA 4LVFA 1Z44A 2W79A 1G4EA 1GZGA 1N55A 4HT3A 2NWRA 1OFBA 3TUUA 1HTIA 1SPQA 4H3DA 3W72A 5G1YA 1LLWA 3G1XA 3W1QA 2HSAA 2PRMA 2V2DA 3EEGA 4AMAA 4CNOA 4NZFA 3S5YA 1WX0A 3QC3A 3ZR4A 2NX1A 4O0KA 1SSDA 2OT0A 4MY1A 2AAMA 1RVGA 3C3NA 3LDVA 2ZRYA 4E38A 3NEVA 3NQEA 4LT9A 3U8GA 3NQDA 4DELA 1JCJA 1NF0A 1YXDA 5T26A 1X7FA 3UWZA 2C18A 3L9CA 5L6UA 1BEUA 4KWWA 1UJPA 5FEWA 3VE9A 7TIMA 1QPQA 2FB2A 4MZYA 3DENA 2QCGA 4Z1AA 2ISSA 2A7RA 3KRSA 4R33A 2VOMA 4CCCA 2AQWA 4I9AA 3OVRA 5D33A 2FJKA 4ZQOA 3E12A 3W22A 1WAUA 1JCXA 3GZ3A 4HSNA 1O60A 4PTNA 2BLEA 4QISA 4CNPA 4FEZA 3RFAA 1QNVA 2Y6ZA 3P61A 4NVTA 5DCBA 3N73A 1JUKA 1BKSA 1KA9F 4RZ6A 1GVFA 4JY8A 3T78A 3TMQA 3NQAA 3BG9A 5HJLA 3FYPA 2G97A 1W3NA 2QAPA 1OX4A 3FKKA 2QCFA 1G69A 3DFQA 3GYEA 3BW2A 3W74A 4DF1A 4FF7A 5E1QA 4RXFA 2VFDA 4UFHA 3LCFA 3G1AA 1YXCA 2CZFA 1LBLA 1TREA 1DL3A 5F1VA 2BX7A 1NSJA 1I2QA 4RX0A 4PL2A 4QNWA 4UTUA 1LOLA 3CEUA 1PCWA 2H90A 3TX9A 5DBTA 3NGJA 3BLFA 2HS8A 3EWYA 5H2ZA 3HG3A 2CLEA 4E0CA 1LP6A 2XN1A 2A21A 4I7UA 1TTPA 2JBMA 2QUTA 4BFAA 1SR9A 3SECA 2YYTA 3LLFA 1XBVA 3BLEA 3GIYA 3B04A 3QW3A 2QUVA 1H1YA 3C2OA 3IGSA 1VC4A 4FX7A 1TQXA 3NPVA 2O7SA 5D32A 1U5JA 1JVNA 3L5MA 4OU1A 3ANYA 1NFBA 1VLIA 2G96A 3R13A 1KFBA 1YLVA 4WD0A 1XKYA 2X1RA 4CQ9A 3MJYA 4LU0A 1M7OA 3P8JA 3GXTA 1H7XA 4LVAA 1HG3A 5C5YA 5K9DA 3A24A 1P0KA 4JTGA 5C55A 3QH2A 1TPDA 2V2CA 2JGQA 4AF0B 1O4UA 1PS9A 1SO4A 3CIXA 1EIXA 1OF6A 3MWAA 1F05A 1KM5A 4O50A 1CW2A 5FF4A 1SSGA 3WJZA 5HWJA 2QCCA 4L4MA 5EY5A 4DO6A 3P62A 2DZSA 1W56A 1H7NA 2FPYA 2JGYA 4QQ3A 2RDUA 2QJGA 1EWDA 1PE1A 3TKFA 3MI2A 4N4QA 3PUOA 1XL9A 5DY2A 1ZAIA 5AN7A 4WQ6A 3IRDA 3OIXA 1RD5A 2DJXA 3HIJA 2JKAA 5AC8A 3M5XA 1VYPX 1VPXA 1FBAA 3C0JA 3P5ZA 3KHJA 2F7FA 3QMTA 5GVJA 4ICNA 2RKXA 4BF9A 2EKCA 3IIOA 1YXYA 3LHZA 4GWEA 2X16A 2NZLA 3QW4B 4TMCA 3THQA 4EIVA 3S1WA 1OF8A 2X2GA 1I2NA 3GR7A 3PBWA 1BWKA 4O17A 3W7MA 3G1SA 4N2YA 4AAJA 3IGXA 5BW6A 1B57A 3FJLA 2Y7EA 5LGXA 5AYXA 5D2YA 3TSDA 3NQVA 3M5YA 1Q6RA 1PCKA 1YPIA 4CCEA 5DXYA 3LHYA 4C1KA 4GUHA 2P10A 1FX6A 4NNBA 1G4PA 4R7JA 4NUWA 3C2FA 3OBKA 3DFOA 3GXPA 3P8IA 2DU2A 1DQWA 1TO3A 5DCDA 1A5SA 4JTKA 1G6CA 3HPZA 3O16A 5K9CA 2BZNA 2WNNA 1SO3A 2J9YA 2ZRVA 3G8EA 5K9XA 3BARA 4EF8A 5AHEA 5FEXA 3N34A 1B4EA 3HGJA 3W7HA 2FLIA 1L6YA 5G4EA 4NU7A 1FCVA 4NJKA 4QAIA 1GJPA 4M6QA 4AXKA 5CZ0A 1ALDA 4IOTA 1PHQA 4ALDA 4CLMA 1U83A 3HGOA 2HS6A 2R14A 3MBDA 1KLZA 3FA5A 3W1NA 1UB3A 3MHGA 3R2GA 4JTTA 2DP3A 4K7YA 4O1BA 4POCA 2EHHA 5A8GA 2NX3A 4QJ1A 3W7KA 4DPQA 3PC0A 1W31A 1EA0A 3LTPA 1ICPA 2TSYA 2Z0IA 1H51A 3KAOA 4DO4A 3PG8A 4XWUA 4JR5A 1JUEA 3LOTA 4GUFA 1FXPA 4YL2A 3PF3A 1RQEA 3U6WA 1IIHA 2C1HA 1UCWA 2FFCA 4ZL1A 3L2IA 2NUWA 2NV1A 2QJHA 4O13A 1TTQA 2QAFA 3O6YX 5AC6A 1UUMA 3E9AA 3S9YA 6TIMA 4ADTA 2FDSA 1IF2A 4AVFA 1H7WA 3MP5A 4LW7A 4G1KA 2YXGA 4RK8A 2Z1BA 3P60A 1TJPA 2X1TA 3LHWA 1LDCA 1A53A 1VR6A 1O95A 1YTEA 1DJQA 1VYSX 2WKJA 1OG0A 3P67A 1YPFA 4LRTA 2NUXA 1EP2A 3KRZA 2WPBA 1GWJA 3RMJA 3BW3A 5AYYA 3DI0A 2B7NA 3R89A 1GYNA 4IX2A 4C1LA 2QJIA 3HJZA 3WJXA 3EX1A 1YTKA 2ZA3A 1HUVA 4N9BA 1LM1A 4UFJA 4H6KA 1W8SA 1RR2A 3TAKA 1TMHA 1FDJA 5LHEA 3W83A 4A3UA 2ZZ1A 2WNZA 1RV8A 5D38A 2FQIA 3Q37A 6ALDA 3LERA 5F2MA 4I7WA 2QDGA 3PM6A 4Y96A 2ZZ2A 3B05A 5AHMA 5LNUA 5K3VA 2JKPA 4HIBA 1K3UA 1RQHA 5I3JA 2ZRXA 1KTBA 1FWTA 3JR2A 3UWUA 1W1ZA 4MPQA 2YW3A 2YFOA 2YPIA 3GVGA 1G7UA 3OA3A 1L9WA 3QQ0A 3PBUA 4JTIA 4XBSA 5CGQA 2ZTJA 4OV4A 2QCNA 4LS0A 3MP3A 3MO7A 4O10A 2W6RA 1OFOA 3B8DA 4Y6GA 4LUIA 5EL1A 1H5YA 3W1MA 3G1DA 2Q8LA 1T8XA 4OV9A 3WJYA 3IIPA 5AHFA 1DBTA 1EEPA 1DORA 4JGDA 1X1OA 4UFKA 3DAQA 4WXYA 3RNDA 1W5OA 3W88A 2GJLA 3W2JA 3W7JA 3OVPA 3TJLA 3OEXA 3GDLA 1NVMA 3GDMA 1KFKA 3W7PA 2VFEA 4D2JA 4ZZ9A 1F7BA 1OFDA 3W1LA 2V30A 1S5VA 4S2CA 2B7OA 2GQAA 3QYQA 3HGRA 1TV5A 4RJEA 1XDMA 3KVLA 2TPSA 2WSQA 1KLYA 2DJLA 3G24A 3W1PA 3T40A 3TFXA 4LV9A 1JCYA 5SWUA 1DKWA 1FWWA 3B0PA 3W7IA 3FOKA 1B9BA 5LNSA 3BGJA 4AHPA 1GPWA 1OYBA 3E96A 3KVMA 3LTSA 3T7VA 1D9EA 3QSRA 1LROA 2Z6IA 2Z2UA 3QZEA 4FNSA 2A4AA 4P2VA 3I7QA 1EWEA 4N4PA 4IXHA 1LOSA 1A5BA 4GFSA 3O1NA 1QWGA 4TO8A 1N8FA 4UTHA 5AYZA 2Y70A 3IVUA 1Q45A 2ABAA 1TCDA 1X8FA 1VCVA 3HG5A 1H60A 2B4GA 5LHFA 3M6YA 3TA6A 1JJKA 2YGYA 4GC4A 4PFMA 4FNRA 4IMEA 3L21A 1LBMA 5I3HA 4N9EA 3FEMA 1LTDA 5HUPA 3WJSA 1ONRA 2BWGA 4PC8A 2GOUA 3C2EA 1KV8A 3TV8A 1LBFA 2G5WA 2OT1A 1Z42A 3Q94A 5KZMA 3EX4A 3MUXA 4Q33A 4MZ8A 4O12A 3R12A 4WOZA 3L0GA 1Q6LA 4NXSA 2Y61A 4UMAA 4LC6A 1Z48A 3HOJA 4O15A 4Z1CA 2FPTA 2G95A 1DVJA 2QR6A 5J5RA 5HMSA 1DQXA 1TPH1 3UNDA 3F4WA 5CPMA 4FO4A 4JEQA 5AB3A 4IXXA 3G1YA 3NPUA 3PB2A 3W71A 2WOQA 1AK5A 4FX6M 4DO5A 1T96A 3LBCA 1K7FA 4HNNA 4X9SA 1FWNA 3AJXA 5I3FA 3B06A 1T0OA 4WOQA 1GYLA 1QPRA 2I14A 3L5LA 1LRQA 3PSWA 4WX2A 3FFSA 3L65A 3GDTA 5EBUA 4KWVA 2OJPA 3EKZA 3LXBA 3EWUA 2V5BA 1R47A 2QF7A 4AB4A 1D3HA 1CX9A 3NPXA 5CG7A 2NXIA 3YPIA 4O19A 5BOOA 4QM1A 2J27A 2VEPA 1KFJA 3USBA 1MO0A 1OABA 3LHVA 1O5KA 1IXPA 2B0MA 2YW4A 4WUIA 1IIGA 4O4WA 1I45A 1W3IA 5G5IA 4UTWA 3IVSA 4M6VA 4O54A 5LNRA 1GTHA 4FIQA 3WJWA 4JX6A 2ZCGA 3HMJG 2Y7DA 3A5VA 2ZRUA 3HB9A 1SO6A 2DZXA 2ISWA 2YFNA 1UUOA 1XBXA 2WO5A 3CM4A 1K03A 3L68A 3KOFA 1C29A 3QFEA 2FTPA 3GDKA 3M5VA 2E5CA 2R8WA 3NL2A 4R53A 4NNCA 4BI6A 1FWSA 3UPBA 3LB0A 2TYSA 4LUJA 4M5PA 3W23A 3IIXA 3SW6A 4EF9A 3NQFA 5FF0A 3RLUA 2ZFAA 3MBFA 3SI9A 3NM1A 4IMDA 1DOSA 4UTIA 3EWXA 2OX1A 4O14A 3TXZA 1H7OA 3SFKA 3O8AA 1RQBA 1JQVA 4PH6A 3NR0A 2E5DA 1DJNA 2PE4A 4S2BA 1WQ5A 2X1SA 3GAYA 4JX5A 5F4WA 1V5XA 1UASA 5HNRA 2QCLA 2VFFA 3CC1A 1W54A 4JDYA 4HPXA 3W86A 1AL8A 5CSSA 1ME9A 4E2BA 4TR9A 3NZ1A 4UNLA 3S42A 2E6FA 3INPA 1GVRA 3LV5A 4YCPA 4AEOA 4NQ1A 1GVQA 1KM1A 1XXXA 1J4EA 3P82A 3QQ1A 1FCBA 3IIVA 1TRIA 4JXCA 1P0NA 2QCDB 1TPFA 3C2RA 2YYUA 2GQ8A 3EWZA 5KZDA 4BWLA 2H8ZA 1LOQA 4QIUA 4UC5A 4O0ZA 2ZTKA 2X1UA 4HN4A 1EX5A 4AWSA 3UXAA 2X30A 1NAL1 1F6KA 3ZFHA 2A6LA 4MYXA 3CWNA 1OK6A 1O94A 5F4XA 2E6YA 4IJBA 3LHUA 2CWNA 3RLVA 3GR8A 4QITA 1XBZA 1ZCOA 4U4MA 3A5FA 4LNYA 2CLKA 4Y9AA 2VELA 3TQKA 3CPRA 4GXMA 3UD6A 2GQ9A 3ABQA 4MFDA 5LNWA 3DBPA 3B4UA 3QMSA 3N3MA 1TPWA 1Z41A 3LCGA 3G1FA 1SZGA 1B4KA 2OCZA 3L0KA 4O52A 2IQTA 4O18A 1H7PA 4S1FA 4PCFA 2HTMA 1Q6OA 1OFQA 2Y7FA 1XDLA 1SW7A 5CZSA 3V75A 3RU6A 3VKJA 2J88A 4AH7A 2ZDRA 4FXRA 3PR2A 4FNQA 4Y90A 4JN6A 4OT7A 1FY6A 1WA3A 4O1CA 3L0NA 1XUZA 1G4SA 5U7SA 4MKNA 4K6AA 1QR7A 4WY0B 2RFGA 1HFBA 4O16A 1TRDA 4TMBA 1KM6A 1G4TA 3PBVA 5K4ZA 4UFLA 4RLIA 2I9EA 3FS2A 2ZA2A 1JCNA 5F2LA 1T99A 1H61A 5K2ZA 1EB3A 1OJXA 1P5BA 2WJZA 2Y85A 2LLEA 3G1VA 4JIPA 3TC6A 1WDWA 1AW1A 3EWBX 4OGZA 3STCA 3N19B 1NEYA 5IBXC 3W84A 3PUEA 1EUAA 3TXVA 3GKAA 3O6CA 1DV7A 2NV2A 1VCGA 5LGZA 4GUGA 1ZFJA 4JICA 3TDFA 1XFBA 3BW4A 3ZWSA 1VHCA 4KFOA 2E09A 2A5HA 3W07A 4I7VA 3DFNA 3N9RA 3W2NA 3DFTA 4K8EA 3UXDA 4XQ6A 4OWGA 3QF0A 5FF2A 4DBEA 3NQ7A 4O11A 4CNNA 3L66A 5CPLA 2VEKA 1MXSA 4MVAA 1OFPA 3M7WA 4EOUA 3SJ3A 3LI0A 3BO9A 1ICQA 2C19A 2QEZA 3DGRA 1LYXA 2C3ZA 1ME7A 4Z08A 4NX5A 3O06A 5A5WA 3EXRA 3IIZA 1W37A 5CKSA 1GQNA 1UBSA 4JYDA 3G1HA 1G67A 4O53A 3W1RA 2CLHA 4XUGA 3NVTA 2WNQA 3UPWA 3DZ1A 4JIQA 3HO8A 1GT8A 3O63A 2C13A 8TIMA 3LHTA 2Z6JA 3IVTA 3DHFA 1MEHA 3MI6A 4OBTA 2Q8ZA 1GVOA 1OYCA 1ZAJA 3TW7A 2E6AA 3I6RA 1I4NA 4M7TA 1OK4A 3W2UA 2CU0A 4DQWA 1LLZA 3UWVA 2B7QA 4OE7A 2E5BA 2Q3RA 2BTMA 3LCHA 1YDVA 3BVJA 3NPWA 4IMGA 4JTFA 4UNKA 3NG3A 1WOAA 3NQGA 3C6CA 1S3HA 3P84A 3W85A 5I3GA 3EXTA 1W3TA 5BRBA 3SY5A 5FF3A 4K37A 3OHIA 4UTLA 5IBXA 3VI2A 3LBMA 4YLWA 3W87A 3B03A 1PVNA 1P4CA 3DFPA 3TH6A 5D30A 3C4UA 1W0MA 1FDZA 3G0XA 3W7LA 4O8RA 1HO4A 3UWQA 5HWNA 4N9CA 4ONVA 3CEPA 3LI1A 5LZLA 2QCHA 2ALDA 2Y62A 3CT7A 1KFCA 3U2OA 3E49A 5D2WA 1GEQA 2R91A 2J9ZA 2OZ0A 3M41A 1QPNA 1SU5A 3ELFA 2Y7GA 3NDOA 4GUIA 3LV6A 4K8HA 3LGEA 3W1AA 3LX9A 4MIMA 2H3DA 1ZNNA 3P74A 3G3DA 3PULA 3L67A 4FXSA 5HINA 2BXVA 3N2MA 2PURA 4JS3A 3FJ6A 1XM3A 2A85A 1YTDA 5E0KA 5AOUA 3STFA 2A7NA 4MY9A 1ZAHA 2DZPA 2GJNA 1I8JA 1IXQA 1F74A 2P1FA 5DCEA 3NQ2A 1L6SA 3ZWTA 5I3IA 4JTLA 3N9SA 4UXDA 4IPIA 1E51A 3DH7A 3BGGA 3W7RA 1OX5A 1PIIA 3Q58A 4M6PA 1BWLA 2F84A 3NL6A 3EB2A 4PODA 4UFMA 4AHOA 1YYAA 2O7QA 4X2RA 1VQTA 4L4LA 1RZMA 5FI8A 2VFHA 4RKAA 3QM3A 1J2WA 4A22A 2V9DA 1NF7A 3OVQA 1I2PA 3LCWA 4YXGA 3W1TA 3M47A 4GE8A 4CQAA 1WXJA 2C0AA 4LS1A 1F73A 3JS3A 2CFFA 1FXQA 5D2TA 1KTNA 5D09A 3LXCA 2AGKA 3M1ZA 4E2DA 3IV3A 3JRKA 4GJ1A 3KX6A 1HO1A 2CZEA 1K7EA 1J5TA 1QO2A 4K38A 2DZUA 4JX4A 1QOQA 5FEPA 4N6FA 4NNAA 3QRHA 4RR4A 4KFPA 1O5XA 4N9DA 5C6MA 4UTMA 2UV8G 4ZVJA 1ZHAA 4HKPA 1TIMA 3I68A 1KM4A 5CZJA 3BV4A 1L6WA 3KXQA 5AHIA 5D03A 4R34A 3OG3A 1LRNA 5EKYA 5LKYA 1XCFA 2C16A 4J9JA 1VS1A 4UR7A 3O15A 3A21A 5AHNA 4UTWC 3ATYA 3NXFA 3W73A 3M5ZA 2YDAA 4NT0A 1XBYA 4LTSA 3PBYA 4P61A 1EP1A 4UTKA 3ABSA 4DXVA 1ICSA 2D73A 2GVJA 2R94A 3C2VA 1OVDA 2ZZ4A 1M5WA 3M43A 2QCDA 3K30A 4WXZA 3ATZA 3S6DA 3NM3A 2V8ZA 2PCQA 4O1AA 4YCOA 1FCQA 1VHNA 3EX2A 3L5AA 1K8ZA 2Y89A 4BR1A 1TTIA 1PV8A 3BPWA 5CPOA 3SIZA 1EP3A 2CLOA 1VH7A 1TV8A 1TSIA 5U4NA 1N7KA 2VEIA 4EVZA 4JNMA 5D2XA 4FNTA 4RZ4A 3UZ5A 2A7PA 2WQPA 3PUDA 2RHGA 4ZMGA 4WJEA 4DPPA 5L9FA 3LRKA 1HL2A 4UMCA 3DI1A 2GPTA 5TBOA 3BK0A 3W7QA 4MOZA 1LCOA 4UTJA 2A1YA 1OFEA 1C9DA 3NO5A 2Q3OA 3W2KA 2C6QA 3I7SA 3CTLA 3LRLA 4MJZA 1S5TA 1Y0EA 4JTHA 5DN1A 4U28A 1PHWA 4NJGA 3LXAA 3CWOX 2GVLA 1QO5A 4RCXA 4K39A 5F2IA 1MSSA 3NL5A 3PWAA 3QJAA 3QSTA 2NX9A 5LSMA 4WZHA 2NXHA 4XTDA 1SQ7A 4Z1DA 4LWWA 3FLUA 2QCEA 3S1XA 3VFLA 3W76A 1GG1A 5G4WA 5BMWA 1FUYA 3H54A 4GUJA 5KSWA 4Y8FA 3M9YA 1K8YA 4NJIA 2WSRA 1GVSA 1GG0A 1JRBA 4O28A 4ZQRA 3W1UA 4BWLC 4WY0A 5DELA 2ATSA 4LC8A 1KM2A 4HNUA 3GXNA 1ZENA 4MJMA 4MUZA 3GK0A 4PL1A 4YMZA 3S1UA 3C56A 3PSVA 5C54A 3W3OA 2ZYFA 2A6NA 3MHFA 3T55A 4BI7A 1MEWA 2BSLA 1LRTA 3W7GA 4KFNA 5FEZA 5H91A 3W2MA 2CZDA 1CI1A 1SZNA 3TW6A 3S8HA 3P7YA 4B5NA 3W70A 1RPXA 1OYAA 3KVKA 2EGZA 3TC7A 2B7PA 5D37A 5KZEA 1C8VA 1TTJA 4MY8A 3VCRA 2Y63A 3S0CA 3NQCA 1OFRA 4IMCA 4UTTA 3DKLA 3VNDA 5D05A 3W1XA 3GNNA 1P1XA 5K7JA 4ZQMA 2RDTA 1F5ZA 1XI3A 1W5NA 3RK8A 3HQ1A 1AW5A 1EPXA 4IWWA 1W5PA 3O05A 4UCGA 4AHQA 4OHQA 2NWSA 1SZFA 1QFEA 5G2WA 1KFLA 3NQMA 3LTYA 3H53A 5KITA 4NZJA 3GDRA 5FF7A 4AWUA 2PRHA 1Q3NA 2E68A 2FPVA 1PL9A 3PS7A 5IM51 2CLMA 3A22A 3WFAA 4Z0SA 4QSHA 4MLRA 3G18A 2JKEA 3NZRA 5TQLA 3C8FA 4TX9A 2J6XA 1KW1A 1M7PA 1TPC1 1IXOA 4K36A 3IEBA 3DKJA 4FIRA 2CLLA 4X3ZA 3W7NA 2DZWA 1KBIA 2ZZ5A 3A9IA 1V7YA 3M0ZA 1TPVA 5LNVA 4CQ8A 4ORMA 3ABOA 3M44A 1ADOA 3MYOA 3Q2DA 3W7CA 4DF0A 5D04C 3G0UA 2ZA1A 2V81A 3SGZA 3RF9A 3O07A 3MW7A 4ZQCA 2YCEA 3SZ8A 3HG4A 2ABBA 3QMRA 5G2IA 3E0IA 3SR7A 3HG2A 3T4CA 4Z1BA 4HNVA 3F1QA 4O57A 1SZEA 3TU9A 2CZ5A 2TRSA 4ADUA 1SFLA 2H8XA 3S5OA 3STEA 3N14A 5TIMA 3G22A 3MHUA 3R8RA 5HR7A 1ZY9A 4FB7A 1WBJA 1IGSA 2J24A 3BLIA 3LCXA 2KZHA 4MFEA 5EPDA 5G2HA 3WK3A 2XN2A 2YZRA 5ABTA 1WV2A 4MZ1A 2PRLA 2RH9A 1SUXA 4A21A
chains in the Genus database with same CATH superfamily
4U2ZA 4ZQPA 3NWRA 1Q6QA 3NQ6A 4IIBA 1UOZA 3EWWA 2ZRWA 2ACSA 2XVLA 3W7EA 4U3AA 3MWCA 4WLCA 2DW6A 2OB3A 4F0RA 3CPUA 2VX7A 4O8AA 2VKZG 1ZB5A 2E1DA 2NT0A 4GYFA 3VMNA 2ZZ6A 1XIIA 3CLMA 2ZRZA 2VENA 2A2IA 4LEFA 2NUYA 3THAA 4HJWA 5AFDA 2W0UA 1KR1A 1PYFA 3OO2A 2QJJA 5ABEA 4GO9A 4JTSA 1JRCA 1T7LA 4CQBA 4UQBA 1YADA 3DYOA 4AG0A 2D23A 1XPYA 1KM3A 2WC4A 4ACZA 5EA9A 4B5SA 4UMBA 4UCFA 1UJQA 3WLKX 2Z7GA 4N02A 2TAAA 1KCXA 4QG9A 3UZJA 3LCLA 5HUOA 3QZAA 4IQLA 2L5HA 1TPUA 1GOXA 4PCNA 1XCWA 1NARA 1R6WA 2KX9A 4EKJA 1SJDA 4DIAA 4UQCA 3OYXA 1D7FA 3SBFA 1UUQA 3U7BA 4NAEA 3VGFA 4DI9A 1JAKA 2XIJA 1XG4A 1TPB1 3H4GA 1IWBA 2VL4A 3U4FA 1XC6A 1JPDX 1XYMA 5E9AA 4EPDC 1AUSL 4M56A 3HPFA 3VA8A 4YHEA 1VRDA 4L6DA 2BB0A 4H7VA 3NNTA 1A5KC 4UQDA 1X6UA 4JKMA 2PGEA 3K13A 1E5NA 3A64A 4ORIA 4CU8A 3V16A 1FCUA 2W66A 1ZTVA 4XUYA 3WLJA 1VBRA 5KMYA 3H55A 3R7MA 2VEMA 2Y88A 2VDHA 4LVGA 4DX3A 1ZALA 4OOUA 3T44A 3PWIA 4QNEA 2FB3A 1B3OA 1ZQ5A 1ISWA 2YSWA 4JHOA 1AMKA 4AYSA 3GAKA 3LM3A 1TX0A 1W3KA 1WZLA 2ATMA 2CKSA 3MVTA 1ZL1A 4UOZA 3UG8A 4XTIA 4W9TA 3UQNA 2V3EA 5KINA 4BK9A 2XFRA 3DHDA 2HXUA 3EDJA 3EKLA 1H63A 1XLBA 4ZA0A 3MMTA 3AMDA 4D6EA 4DO7A 3HBLA 1A4LA 3ITYA 3W75A 2DFAA 4IUGA 3LNPA 3KL3A 1PWMA 3ARPA 5D02A 3U4AA 3S2LA 2VOTA 1TWWA 3DFHA 2VFIA 4ICCX 2GVGA 2Z4GA 4RNJA 1XLFA 2IXVA 5C2XA 5FL1A 3EA2A 4PFHA 3EDEA 4K7VA 4PN2A 5I77A 3PG9A 3G8RA 1HF6A 1CYGA 1CECA 3G0SA 4A3RA 3WBEA 3P0XA 1VCFA 1UKPA 3NA8A 3CHVA 2Q71A 3FJ4A 5CPNA 4DUXA 1ISZA 4DEFA 3BG5A 1VBHA 1E4IA 1F76A 2VURA 4HK6A 1YNPA 1S5NA 4UWMA 1OINA 3N2XA 3K4AA 4TIMA 1QJWA 4IP7A 3L2MA 5GJMA 3AZSA 4GCXA 2HNHA 3GB6A 4GQ0A 4UTFA 3WH8A 4C7DA 1CXLA 4JYFA 2GVEA 3R10A 3STGA 1F3TA 1RBLA 1VJIA 1X1ZA 3OIHA 1IXNA 5I07A 1QAPA 3G3MA 4JDBA 1K7XA 2WCAA 3OQEA 3B0VC 3VX1A 1FDYA 1F8IA 3MI3A 4PA8A 4H83A 3TJIA 3W7DA 3F2DA 5EMUA 5AHLA 3TJXA 4JTAA 4US5A 4GNJA 4HYVA 1R2SA 1W1PA 3K8MA 3ARWA 4RDWA 2FGBA 1NFPA 1IEXA 5D2VA 1K02A 3QEZA 4GH1A 1GW1A 2ZX8A 3UWWA 1WP6A 2P76A 4FX8A 4S3EA 1V3HA 2IQDA 4NASA 3JZUA 3TN4A 1A5UA 3E6EA 5HR6A 3A3HA 1F6PA 3TN5A 1DJYA 3NYZA 3UBPC 3WK0A 2HK0A 4HA0A 3M64A 3UR2A 4E8CA 3PAJA 4JYEA 2ZXDA 4UTTC 2HDJA 1W1A1 1Q8AA 3R5EA 3SRHA 5DXXA 2W63A 2DH2A 2JFEX 3G5EA 3RHGA 3CQ0A 3PB0A 4HZ7A 4M7SA 2FIQA 4E2OA 3MSYA 3BC9A 1G4EA 5HMEA 3ZO9A 2NWRA 1OFBA 2VHLA 1HTIA 3EBVA 2XTKA 3W72A 1IEIA 2V2DA 3L4TA 3RX3A 1P48A 1VIWA 3CTTA 3QC3A 3AUJA 2AAMA 3DG6A 3LDVA 3VGEA 2ZRYA 4PMZA 2PDUA 3SFWA 1YE4A 3NQDA 4DELA 3SGGA 2YIHA 1YXDA 4H00A 5T26A 2E4TA 1JZ5A 3L9CA 5L6UA 1UJPA 3POHA 4LYQA 3NO3A 1ZBCA 1VKFA 4HJFA 4ATWA 3DENA 2A7RA 4R33A 4KWUA 2Y5SA 2AQWA 4I9AA 3BLOA 2WZMA 3W22A 1WAUA 3QR1A 3WF2A 3IAQA 5KZ6A 3MTWA 4C7GA 4HSNA 2J75A 1E55A 2GJXB 4NVTA 5DCBA 4M8UA 3N73A 4DZAA 2HVNA 2UY5A 2PD9A 1FWHC 3AOFA 4TQTA 3LLXA 4YVXA 3FYPA 1E56A 3VD5A 1D3CA 1G69A 5JUVA 2GOKA 4DF1A 4XO7A 4FF7A 5E1QA 4UFHA 2V63A 1YXCA 3PZQA 4CNTA 2CZFA 1PDYA 1QXLA 3FSTA 1QHZA 1J0KA 1NSJA 3QHMA 1I2QA 4ZO7A 4DWSD 4PL2A 4B5WA 4W4QA 1YHTA 3NGJA 3EWYA 4S3GA 1FWIC 5H2ZA 1A0CA 4C60A 3M6DA 1VFSA 2XN1A 2A21A 4MF4A 4I7UA 2VVSA 1TTPA 2NW0A 1SR9A 3BXWA 3BLEA 4QR6A 3RCYA 1XIMA 4C6FA 3IGSA 3MKKA 1VP5A 4FX7A 2O7SA 4QGCA 1XIHA 1A3XA 1IR1A 2PTWA 1NFBA 4LBSA 1JDEA 1KFBA 1C3FA 2X1RA 2Y5JA 3MJYA 4LU0A 3VOIA 1M7OA 1TA3B 3QVQA 1H7XA 5K9DA 4J1OA 1S38A 1KKOA 4QLLA 3BOXA 5E0CA 5C55A 1YW1A 5A6JA 3K46A 2OO0A 9CGTA 1JZ6A 1G01A 2V69A 1EIXA 1OF6A 4MAVA 4NY2A 2VRJA 1UG6A 5FF4A 1PWLA 3WJZA 4H9VA 4AZ7A 4KGLA 3VVGA 3SUTA 4OECA 3A4AA 2DZSA 1H7NA 1QHPA 2JGYA 4L80A 1CT5A 3CL8A 4BEQA 2HROA 1NOUA 1PE1A 1B3YA 5CG0A 4E4FA 4JN8A 1TV3A 4K1GA 2ADAA 2NQJA 1NDZA 2D0GA 3M5XA 1CWYA 2DEPA 3P5ZA 5FCZA 3ZT6A 5GVJA 4GWEA 5IHRA 2X16A 4BF7A 4TMCA 1XH2A 2VUYA 3THQA 4EIVA 5ECVA 3S1WA 1UC5A 3DUGA 2YL5A 2QVHA 3G1SA 4AAJA 3A4XA 5BW6A 2GDVA 2TODA 3IWPA 5FA5A 2C1IA 5LGXA 5D2YA 6REQB 3ARUA 3WNKA 2P10A 4NNBA 8XIAA 4JPGA 3TWAA 2DU2A 3KWSA 2BZNA 2ZRVA 1KBLA 3UZXA 2PBOA 4IMAA 5AHEA 3WBAA 2CITA 5FEXA 3ZXWA 3Q67A 4J4KA 1B4EA 2D0HA 2FLIA 1US0A 1LL4A 3WEOA 1JZ4A 4GMEA 1ZBKA 5HOSA 4AXKA 4BKNA 2DZAA 1E9IA 1YE6A 4IP5A 4AFYA 1V8EA 2HS6A 1IZCA 3MBDA 1KLZA 4KW2A 4XK2A 3R2GA 4JTTA 2DP3A 2PDHA 4B5XA 2WWCA 5A8GA 3W7KA 1W31A 3GXIA 4ZEPA 1UD4A 3KAOA 4DO4A 4XWUA 1CBGA 1JUEA 3NCOA 1AJZA 3VGDA 4IIDA 4WGHA 1IIHA 2FFCA 5FSEC 1GVYA 3L2IA 1V0KA 2NV1A 3AIEA 3MMDA 1TTQA 4O13A 2OGJA 3AALA 3PZMA 4A4AA 3MUCA 2FDSA 1WAWA 2GDQA 3V0UA 1J93A 2UY3A 4RK8A 4Y2WA 2X1TA 3LY0A 4QAWA 3AHYA 3H22A 5FAJA 3OHMB 1HIZA 1O95A 3FK4A 4C5YA 1BXCA 4NHVA 1WKEA 1IEVA 1X96A 3SUUA 3P67A 1TZ9A 3GVQA 4LRTA 2NUXA 4L6OA 3CUJA 3BW3A 2XVNA 3VOFA 5AYYA 1GYNA 2BS9A 1UKOA 2EQDA 3EX1A 4UFJA 5TAOA 1PPIA 3NZGA 3TAKA 2B81A 5FL0A 4PCTA 2ZZ1A 1RV8A 3VIHA 2PLCA 3VOJA 3VUPA 3RCNA 4EAYA 4PUNA 1VRXA 2WBKA 1PYMA 3ZJKA 3UYIA 5I3JA 1AH0A 1KTBA 3O7UA 4XZMX 3MY9A 3GHRA 4F48A 1L9WA 2FTYA 3PBUA 4J28A 4JQAA 3CH0A 3MO7A 4A3HA 1E0XA 1E70M 3WQWA 1QBAA 4AEFA 4AY7A 4HOWA 5EL1A 3KDOA 1E9LA 3IIPA 1EEPA 2PBGA 3O0FA 4IP4A 4YU1A 2D3NA 1C92A 3DAQA 4WXYA 1T41A 1FRBA 3W88A 2BVTA 3FDKA 1NP0A 1KD0A 5A6BD 4ZB5A 3GDMA 1KFKA 2VD9A 3W7PA 1F7BA 3QYQA 4PBGA 1KO0A 1SM9A 1XDMA 3KVLA 2QPUA 4GO8A 3GIPA 3AHXA 3L2LA 4LV9A 4Z2IA 3JZEA 1NDWA 2YB1A 1OGSA 3WNOA 1E15A 1EDGA 1KFWA 3LTSA 3T7VA 1HW6A 3RM8A 3SQMA 3AIRA 3F5LA 3V5CA 5AECA 3SCUA 3I7QA 1OBAA 4IQEA 3TYAA 1GOQA 2CBIA 4WSJA 3EWDA 1N8FA 4LCRA 1B3WA 4C6IA 2QXWA 4YTRA 3HG5A 2IPWA 1BRLB 5BOFA 4PFMA 5A6SA 3N13A 1VBGA 5H8UA 4FNRA 4IMEA 3CYJA 5T91A 2GFTA 3FEMA 5HUPA 1G1YA 1GUVA 4PC8A 3KE0A 1KV8A 2XHYA 1TA3A 1XH1A 4D8AA 2WCGA 4FXJA 2OT1A 3GG1A 3Q94A 4Q33A 4A3QA 2BVYA 4J3XA 5EMKA 3RLGA 4D6HA 2VO5A 4L4PA 2OKOA 4UMAA 2ZVIA 2PWFA 1AD1A 3GC5A 4YS1A 4HK7A 3EB3A 1UMYA 3POCA 1IHIA 2OX4A 4IXXA 4MADA 3G1YA 3NPUA 3SCVA 3SRDA 2WMKA 1AK5A 3KW3A 3WDHA 1K7FA 4HNNA 4X9SA 1MWOA 5I3FA 1T0OA 1GYLA 1QPRA 2I14A 2Z27A 3TP4A 1EQCA 3GDTA 2OJPA 3EKZA 3LXBA 2VEFA 4ZTXA 2DUXA 4DB7A 1XIEA 5HA7A 2QF7A 1VBUA 1PEZA 3TTQA 5CG7A 1E43A 4KH2A 5IDIA 4ECLA 1OD0A 2VEPA 4QJ3B 3TN3A 2NQ9A 1KFJA 3UFYA 1QOXA 4MNLA 3WQPA 2YW4A 5DMLA 4JQ3A 3S1GA 4TVDA 4O54A 3CS2A 4FIQA 3WJWA 4JX6A 4K1WA 3QZ6A 4PE8A 6REQA 2Y7DA 3HMJG 2QGHA 3A5VA 1SO6A 3S9ZA 4H8HA 1LQ2A 3OZPA 1UUOA 3KTXA 1EBGA 4PBFA 4IIGA 1X7IA 1KQZA 2R8WA 4R53A 2ZIDA 4BI6A 2P88A 2R1MA 3HZ3A 1FWSA 3UVAA 4EF9A 3SI9A 1EGVA 1V0MA 1EQPA 3VD4A 1E72M 4BQ5A 5CC7A 3ITTA 2HVMA 3EMQA 4HNCA 4V28A 3SFKA 3ZR6A 1XKJA 1DIEA 1ODUA 4S2BA 4LBRA 5D4YA 3TLQA 4YTTA 5F4WA 4DUOA 3CB3A 3OG2A 3WD3A 4L1GA 5E9XA 3CC1A 3RUBL 1OZQA 3K8LA 1AL8A 5A1AA 1ME9A 4E2BA 4CD5A 1G9HA 4LAKA 3INPA 3BTNA 2WHJA 3UG4A 3QQ1A 3IIVA 4JFWA 2O55A 2JALA 4QRNA 3C2RA 1EL3A 1E6NA 3USZA 3VIJA 3QYSA 4H41A 4WCJA 1MW0A 4O0ZA 2ZTKA 1UWRA 4FS9A 4P8VA 3SJNA 5I03A 1PX3A 3VZZA 3N6HA 4MYXA 3CWNA 3AC0A 1UYQA 1O94A 5DMNA 3M0MA 3GR8A 3LU2A 1XBZA 3A5FA 5HMDA 3ITLA 4LNYA 4F0MA 4F0SA 3F4CA 2CLKA 4L1WA 3TTEA 1QWKA 3TQKA 4GXMA 3UD6A 4IICA 1NQ6A 4HMEA 1Q7ZA 1XG3A 1GHSA 3DBPA 3VKDA 3N3MA 4B9YA 3G1FA 3EOLA 2IQTA 4J5NA 2HTMA 2YA2A 2Y7FA 9XIMA 3W26A 1A4MA 3VKJA 2J88A 3APTA 5CZKA 3VIKA 4IT1A 2R9RA 2XVPA 3UU0A 1WA3A 2YLLA 1XR2A 2J13A 5U7SA 3A3XA 3BCFA 2RFGA 1HFBA 1TRDA 4TMBA 1KM6A 1G4TA 5K4ZA 4UFLA 3GBDA 2ZA2A 3IANA 3PZOA 4M80A 4GI6A 1UP2A 3U5UA 2LLEA 4M1RA 3TC6A 1W91A 1EJWC 1GZJA 4DJFC 3FVMA 3TXVA 3O6CA 1ZFJA 3TDFA 1PKMA 3BW4A 1VHCA 1GJUA 1BD0A 4I7VA 2NSXA 3V35A 3W2NA 3DFTA 3UXDA 3ANUA 2WWDA 3QF0A 3NQ7A 2P53A 1FWJC 3WSUA 2PU0A 5CPLA 2VEKA 2F38A 2YXXA 3FNDA 4AC7C 1GHRA 2WVUA 2IKJA 3PP7A 4EOUA 1RJQA 4P8XA 3SQSA 4MTVA 4R7OA 2C19A 4ZOAA 4H8VA 4KPLA 1O66A 4J3TA 1CXFA 3ZR5A 2ZUNA 4Y8EA 3PAOA 2X42A 3IIZA 5CKSA 1GQNA 3UPWA 4IL0A 2DUZA 3AUOA 3O63A 3SCNA 1BRLA 3S2CA 3TC3A 3F5JA 2NQ5A 4TTUA 1I4NA 2E5BA 4TX8A 4Q8UA 3BVJA 3WLHA 3NPWA 4XZWA 2IPFA 5CH9A 1UKQA 3NDZA 3LD5A 2EPNA 3W85A 3RILA 5I3GA 1HGYA 4K37A 3OHIA 3GD6A 3B03A 3SY8A 3N12A 4GINA 1UP3A 5BXSA 1K9TA 2FYMA 5CPTA 4ZOEA 3WLTA 3MKCA 1W0MA 3G0XA 3EYPA 4N9CA 3CEPA 4LB4A 3SB0A 1EPVA 5EFFA 3VGHA 5FJPA 3U2OA 1U22A 1AZ1A 1H11A 3E49A 3WD2A 2NT1A 2OZ0A 3M41A 2GVYA 3PK7A 4BHYA 2Y7GA 4JFTA 4K8HA 2PF8A 3LGEA 3M0VA 3WCZA 4MIMA 4M0XA 4HGXA 4Q8WA 2G3NA 3G3DA 5BXTA 3N6QA 3E2SA 3VINA 3FJ6A 1MNSA 5E0KA 5AOUA 3STFA 3GRIA 1QNOA 2C79A 1DIKA 1MRAA 1KCZA 1V77A 1IXQA 5DCEA 3IJQA 1BYAA 1XD1A 4AD3A 1EZWA 3T4WA 6XIMA 4KEMA 1DXFA 4QE1A 2XU2A 1B30A 3W7RA 3Q58A 4GQQA 3VABA 1UZHA 5I0DA 3IJ9A 1XIFA 1IT0A 2WM0A 3IUIA 1MQPA 5LYRA 3GFYA 2JE8A 2F6XA 3N3TA 4B5UA 4A22A 2V9DA 4J3WA 1TWDA 4GIYA 3B8UA 4YYCA 4Z2GA 4GE8A 1WXJA 2C0AA 2VEGA 2Z28A 2XSXA 1X6NA 2Y8UA 3B8WA 2AGKA 4E2DA 3M4HA 3WH6A 3ITVA 1XLGA 4GJ1A 1BFNA 2CZEA 2DVXA 4K38A 3ICJA 3M0IA 1TZZA 4A8NA 2BOEX 3I68A 3MUY1 4LPCA 5CZJA 1LWHA 1PXGA 3OZYA 3K5XA 4IM4A 2HPIA 3GVRA 4J9JA 2NQHA 3UJRA 1VS1A 3AMKA 3ATYA 3NXFA 5KEZA 3NIYA 3IJ7A 2BFGA 2VUNA 2HE5A 1OY0A 5FJOA 1KWGA 1ICSA 2GVJA 3C2VA 2MNRA 3M43A 3BMVA 3RRAA 1HGWA 1E4LA 1S2CA 2PDCA 4WXZA 2NVDA 4JTCA 3R4IA 2V8ZA 4YCOA 5AVHA 2Y89A 2WXDM 3CHEA 1L6FA 3C0SA 4C6NA 1TTIA 5LA1A 2HRWA 4RUBA 4AX6A 3CZKA 5U4NA 1N7KA 2VEIA 5FSDC 3PBGA 3SRFA 3A9BA 1IGWA 4CVUA 2Z25A 5CGTA 4FNTA 4RZ4A 3C5QA 5L9FA 3CAQA 2Z1KA 2GPTA 3BK0A 1Q8JA 4TOQA 5FACA 1FH8A 4MOZA 8XIMA 2X8RA 1S46A 3CTLA 4MJZA 1XIJA 1N2VA 4NJGA 3VC6A 1JDAA 3CWOX 3QHNA 2GVLA 4IIHA 1CB2A 2PWUA 4AMCA 1TVLA 3NL5A 3QSTA 4GXPA 2GZXA 4MKVA 4C6PA 4QHRA 2XWDA 3UA3A 3WLQA 4PTMA 1PZ1A 2JIEA 4XTDA 1SQ7A 3AS1A 2V5DA 3FLUA 4MUPA 3VFLA 3COTA 1QK0A 4K2SA 1J96A 2J7HA 4NJIA 1JF5A 2GUYA 3OB8A 3XINA 2DIEA 3OJGA 1W9VA 4BWLC 1N82A 4B5TA 3WMBA 3ES7A 1KM2A 3M0KA 4P5UA 1RJPA 4MUZA 2HWGA 4K3ZA 3C56A 2ZYFA 2A6NA 1GONA 4BI7A 2FMOA 4PUKA 3FEQA 2XZ7A 2XFYA 4GIEA 5KETA 2CZDA 4E4PA 1CI1A 1W9XA 1CEOA 1S2TA 3W70A 5LXXA 3KVKA 5C9UA 2PTYA 3WQ8A 1Z8AA 3AIQA 1GVIA 2HNEA 5D37A 5KZEA 4GQRA 3TLLA 3TYEA 3WDIA 3WD1A 3NSMA 3NQCA 3VIIA 3DG3A 3VNDA 1QK2A 5D05A 4EXAA 2NVCA 4ZQMA 1XI3A 2BHUA 4H6QA 2I17A 3HQ1A 4XVEA 4IWWA 3O05A 4BQ4A 1XYCA 2NWSA 4Q3MA 1EKOA 1RCQA 1TG7A 2VX5A 5KITA 1R85A 5FF7A 1LWJA 2BG5A 3GH4A 1PL9A 1UD3A 5IM51 2CLMA 3R25A 1JG9A 4PMQA 4Z0SA 3G18A 1J11A 2JKEA 2G4JA 4TX9A 1QU4A 8RUCA 1U5HA 3W81A 3BZJA 2OGYA 5CC5A 4LAZA 4D1JA 4GYKA 4M51A 1Y5WA 4I90A 2O9RA 4CQ8A 2J25A 3ABOA 1M1BA 5D04C 4ACYA 4C7FA 2ZA1A 3RF9A 3O07A 4ZQCA 2YCEA 1RAKA 4KCTA 3SZ8A 5G2IA 5M5DA 2H9AB 3SR7A 3HG2A 1J2BA 1UR8A 4DVOA 4O57A 3RN6A 3KEHA 3CV6A 1Q5MA 7PTDA 2TRSA 2VWSA 2G3FA 2H8XA 2E28A 3S5OA 4GKLA 2QV5A 4XZHA 3STEA 3IK2A 4NYYA 5CQ1A 1DE6A 3MQTA 4FB7A 4IHCA 1WBJA 2Y0FA 4HCHA 3VD3A 1AD4A 1OCQA 4IPLA 5ABTA 1WV2A 3HFTA 1NP2A 3MDWA 1KBKA 4JEJA 2RH9A 5FJIA 4DWSA 4FPSA 2OO6A 1K8XA 2XIBA 1SFJA 3BCDA 1WBHA 4NXKA 5G1MA 3E0WA 3NOEA 1WB0A 1SFSA 4UIOA 3G77A 4LY8A 2E9LA 1SO5A 1LZOA 4M29A 1JULA 2ZZ3A 3EGJA 3BWWA 3BJTA 5E93A 3DXIA 3B9AA 1KTCA 1G7VA 4PRRA 3LG3A 1EUNA 1TJRA 3ID7A 3KVJA 3BE7A 1HJXA 3CZLA 1W9PA 4Q4RA 2OEKA 2PC4A 4G7EB 1E4NA 1GKPA 3EMZA 3GTNA 4JD4A 4U5KA 3WUEA 1BSIA 4RXGA 3UA4A 3LA4A 1H1ZA 4MKSA 2R1PA 1XC4A 2HXTA 1W5QA 2OOFA 5HNNA 3HGSA 3WUFA 3P81A 3N04A 3ME3A 1VLWA 2GGJA 2JQXA 2HMCA 1W5MA 4JQ2A 4ZQNA 1LT7A 2QUUA 4LVBA 2XISA 3KBNA 3RU8X 3GFXA 4ZODA 1FH9A 2YB4A 2PDFA 2CHNA 4Q32A 3MP4A 1TR9A 3A3WA 2EG6A 3PTQA 4LAMA 3GQYA 1YBQB 4JIIX 3ZS4A 2GGHA 3SGUA 5HJYA 2WKLA 1HP4A 5DMMA 4GGHA 2QCMA 3B9DA 5F1UA 1W6TA 4DNHA 3FAXA 4A05A 2ZBTA 1PZ3A 2P8CA 1H7RA 2YX0A 4MSSA 4DXKA 3MV11 3STPA 2PAJA 4HCDA 2QW5A 2OWWA 4DBDA 4Q7IA 3DEQA 3UYCA 2EAWA 1X39A 3BAKA 3QPYA 2BY1A 3A23A 4LS2A 1GOMA 2WKGA 4JTEA 1PIGA 3OZMA 3TQVA 2A0NA 1O5RA 3ARRA 1VGAA 3MSDA 1OQFA 4HHPA 3MZNA 2I1OA 3T8LA 4LUSB 1R3WA 1QOPA 3C8NA 1OEPA 3GTIA 4LCQA 1WOBA 4MGGA 1DP0A 2E77A 4TVCA 3H2EA 3KL0A 1TMQA 1D3GA 1ME8A 3WH7A 2QKFA 4CCDA 3GH5A 4LV4A 3S1VA 2DVUA 5MHBA 3B0XA 2EXOA 2ZC8A 5I7GA 4P7OA 5FKYA 3WMCA 1JQXA 4S3DA 2NLIA 5HQEA 2AQOA 5REQB 3T81A 4GH3A 3QY8A 3O2LA 4US5D 4LRSA 3LCIA 3MU7A 3NL3A 2YL9A 2V2HA 1WYIA 3S6TA 1BAGA 3UR8A 5FAGA 1QDSA 3LLDA 1OHLA 3O6AA 3AISA 4C65A 3RO6A 3SCPA 1KGUA 4X63A 5I23A 3UWYA 2RGMA 5CJMA 4P7QA 3WKZA 3EPMA 2I5IA 3CUHA 1KM0A 3W01A 3M7SA 3ZT5A 2CW6A 3VKCA 2VX6A 4YTSA 1R46A 1XD0A 1BQCA 1M6JA 3D0CA 1HN1A 4HYRA 1Q7MA 1EZ2A 5XINA 1F4HA 3B0UX 4Q7NA 3II1A 3KRUA 1CNVA 4YVPA 4IX0A 2GK1B 4NIRA 5CC6A 3CB8A 2V82A 1S5WA 2VRKA 3TR2A 2QQ6A 2XSAA 1JCLA 4I3GA 2ZZ7A 2VCAA 3TR9A 1GTEA 1TYGA 5BZAA 2OEMA 3ZQ9A 1QMLA 3ARTA 1Q2SA 4MLJA 1M03A 1TV7A 4G5DA 3SSJA 1A5CA 2J9XA 4NP7A 3S2NA 4JTQA 2IKHA 3LMZA 4XKYB 1KGWA 1ISXA 3KFTA 2BOGX 3HPXA 3HN3A 2ZC1A 1H50A 3I65A 5CZTA 1A5AA 1ZCCA 4GX8A 3V36A 3ITXA 1J9YA 3CGTA 3PY2A 1SW3A 4QTGA 4IPJA 3F4NA 3U7VA 4GBUA 1Z7AA 2A3EA 4TX6A 3OP2A 2HISA 1I2RA 5A8QA 4NZ3A 3DFSA 4J3VA 5A6BA 1A5OC 2H9AA 2PWGA 4AZ5A 1I0BA 4G1NA 4NX0A 3QTPA 2CNCA 4UQEA 2OQHA 4LVFA 4XB3A 1DJGA 3OOQA 2W79A 1EIBA 1M7XA 4D8LA 4FOJA 1AFSA 1DJIA 1GZGA 3VNZA 1N55A 1QVBA 1WDDA 1LLWA 1R3SA 1XRSA 4AMAA 1I6NA 1W32A 2Z29A 3CV7A 4KQNA 1AQ0A 4MY1A 1RVGA 4HU3A 3L4UA 3GY1A 3KZSA 3NEVA 3NQEA 4LT9A 1MXGA 4HA1A 3KBVA 2R6OA 1QT1A 1NF0A 1A49A 2DSZA 3WZ0E 2C18A 5CBBA 4DM2A 4OTKA 7TIMA 4L1XA 1K6WA 1L0PA 4MZYA 4DWDA 3R58A 1HKKA 2YDSA 3KRSA 4CCCA 4BS0A 3KOYA 4G9PA 5D33A 3QHOA 3E12A 1DE5A 3URQA 1UP0A 1JCXA 4LYKA 1UIOA 4GQGA 1M04A 4G7EA 3BOLA 4CNPA 5CGMA 2XGZA 3RFAA 2J74A 4B16A 4KCVA 1W8GA 2HZGA 4EPBC 2CESA 1OC6A 1W3LA 4LCSA 1XP3A 1CLVA 1WPCA 3OLIA 1O5QA 2Y8VA 2G97A 3FKKA 3UWEA 2QCFA 3GYEA 3BW2A 2BOFX 4RXFA 4H9TA 1OCBA 4NILA 4KETA 2WCSA 4WF7A 2VC7A 3KM8A 4H6EA 1TREA 2WMHA 3VOCA 3ZM8A 1LOLA 1Z69A 3CEUA 1PCWA 2H90A 3VPLA 1GK8A 3EA1A 3AIBA 2CLEA 1YBQA 5I79A 3ZT7A 3THUA 3WQ6A 4HZ6A 1V0LA 3RAOA 2JBMA 4S39A 3EOOA 2YYTA 1XBVA 4GZ7A 3QW3A 4LANA 4C6QA 4Q4PA 3EOUA 3AAMA 4LQ1A 3GU1A 3L5MA 4OU1A 1VFFA 3ANYA 3U2ZA 4V27A 5H8PA 2G96A 4FOUA 3CQHA 3KHDA 4ML4A 4GABA 4F4RA 1W1TA 3ZYZA 1HG3A 4MDPA 3A24A 2ZX5A 4JTGA 2JF6A 4AF0B 3EWCA 4ZE5A 5C7HA 5A8MA 5BRQA 3MWAA 4LUSA 4XAYA 1BGAA 5CAKA 2PEVA 5HWJA 4JNYA 4HPHA 4GVGA 3TN6A 5EY5A 1J5SA 2ISDA 3UPMA 2WVVA 3GNRA 1EDTA 3QC0A 4QQ3A 4RW5A 2WW5A 3WQGA 2J7DA 3T9PA 4Q4MA 2R1LA 5BCAA 4ZB0A 3TTSA 1W1B1 3GH7A 4WQ6A 1PDZA 1RD5A 2DJXA 2X0YA 1FBAA 1UMLA 5REQA 1UWQA 4XO6A 4CCZA 1W17A 3EOSA 1YXYA 3WLSA 2CKRA 3LHZA 3MUAA 3APYA 1WNOA 1A80A 1HJQA 2VCBA 3SSZA 3FV9A 5BXPA 1OF8A 3GR7A 1BWKA 4DXXA 1ZP4A 4N2YA 2INFA 3T1GA 4KBXA 3FJLA 1H0GA 4LEQA 1EJVC 3TSDA 3NQVA 3M5YA 1E5JA 4CCEA 4G56A 4PEEA 2B31A 3BQ6A 1G4PA 4B4FA 3WLLA 3V7PA 3VD9A 5DCDA 1A5SA 4JTKA 1MI3A 3WDJA 3EB4A 2PGRA 4D8ZA 3CWHA 2IUZA 1QBBA 3N34A 3HGJA 1L6YA 4Z2HA 4NU7A 1T40A 4QAIA 6PTDA 5A6LA 4M6QA 3CUIA 1RA5A 2Z1WA 1ALDA 1PHQA 4G2DA 4ALDA 1U83A 3HGOA 5LIUX 1GOWA 3S4TA 4XZIA 4POCA 4H2HA 1XLDA 1U1UA 2EHHA 2OVLA 2WZIA 2NX3A 4DPQA 3HTWA 1EA0A 1ICPA 5CLWA 3PJWA 1H51A 3CH9A 4JR5A 1ZPTA 3LOTA 4GUFA 3RITA 1PSCA 4I8DA 3PF3A 1XHGA 4EXBA 3NSNA 1RY0A 2EBNA 2C1HA 1UCWA 3GM8A 1WE5A 3LPPA 2QJHA 5BWAA 4YPJA 2WNWA 1Q4NX 3SCWA 3VIFA 3BLKA 1UW9A 3GUWA 3VOGA 6TIMA 3FJNA 4ADTA 2OEJA 2JF7A 4FSAA 3MP5A 4I6VA 2Z1BA 3P60A 4ZB2A 4QROA 1A53A 3GHSA 3SN0A 1YTEA 3TTYA 1GEHA 3GTFA 1VYSX 1YPFA 3GBEA 3KRZA 1EP2A 5IFPA 1BG9A 2B7NA 3R89A 2FJUB 1K4GA 2VZUA 3C0QA 5H6HA 1HKVA 3HJZA 3ARXA 1PBGA 1HUVA 4N9BA 1LM1A 4H6KA 1JPIA 1W8SA 4RZBA 3B8TA 3GXMA 1FDJA 2GGEA 3R79A 3W83A 4A3UA 2PB1A 2DQWA 1YPXA 3FXYA 3Q37A 6ALDA 5RUBA 3CAWA 2WK2A 4WSHA 2J7EA 1XRVA 4I7WA 1DWAM 3PM6A 3VM5A 3O0KA 5AHMA 5LNUA 1PUDA 1RK6A 2YW3A 1G7UA 3QQ0A 3SADA 4JTIA 1JNDA 4ENLA 4Q8TA 2ZTJA 1SR0A 1XH0A 4LS0A 3MA8A 2DIJA 1F3WA 3RJYA 2PDIA 3W1MA 2Q8LA 5HATA 3WYZA 3AMCA 1J10A 5T9BG 1YRRA 1XISA 2JIWA 3AU2A 4J3ZA 4UFKA 3DFYA 3RNDA 4TV5A 4DLFA 2HQAA 1K1DA 4X9YA 2VFEA 4ZZ9A 1OFDA 3W1LA 3LPOA 1QPKA 4IFOA 1S5VA 1QI0A 5ECUA 2B7OA 4XD4A 1TV5A 2VI0A 5D9OA 1EXBA 3GXDA 5A69A 2DJLA 3TFXA 1A5NC 5DEZA 3B0PA 4BEUA 1WUFA 4AHPA 1KRAC 3PPGA 1RLCL 1LROA 3LGDA 2Z6IA 4CU6A 3BAJA 1SYTA 2Z2UA 3QZEA 2A4AA 4P2VA 4L7ZA 1EWEA 3R8HA 3RG6A 4IXHA 1LOSA 2ZUTA 5AYZA 1Q45A 1EGMA 2B4GA 4CU7A 3JW7A 3PJUA 3W27A 1C8XA 2E9MA 2J7BA 1FWBC 4Z17A 1JPMA 5I3HA 2WJDA 3AI0A 1MMFA 3BMXA 2BWGA 1ITXA 2YCKX 4F66A 1LBFA 1Z42A 1REQB 4MZ8A 2YCJA 4Q6XA 2OLHA 3NXLA 2IS7A 1Q6LA 4NXSA 2DT3A 3UXKA 4E8DA 1G5AA 1TV2A 4O15A 1UWSA 2QR6A 1BHGA 4GA8A 1DQXA 3UNDA 3F4WA 2VM8A 3VOHA 3IJLA 3NZQA 4FO4A 5HMFA 4W85A 3WNPA 2DPEA 3W71A 2J6VA 2PDBA 2WOQA 2Y2WA 4DO5A 3SCSA 1T96A 2QMJA 4FF5A 4ERIA 3OLDA 3B06A 4WOQA 4QG8A 4WX2A 1IT7A 4PUMA 1BTCA 1Z89A 3PANA 3UEQA 5CSYA 1J0JA 3HV9A 4AB4A 3KZPA 1D3HA 2PWHA 4R7WA 1CX9A 3AZRA 4H6RA 2NXIA 4IF2A 1YDYA 2J27A 3E0LA 1E6PA 3WDPP 3DX5A 3PFRA 5AZ1A 3USBA 1MO0A 3R0KA 2F61A 1IXPA 1UA7A 3DESA 3H2NA 2QMKA 4ZGYA 4YWSA 5FJTA 4PTDA 3EDKA 4G8TA 2J8TA 1KC7A 1JXKA 4TTGA 1AMYA 4ZSUA 1CLXA 2DZXA 4LF1A 2YFNA 1XBXA 2P5NA 3L68A 4XG1A 2CXGA 3V3WA 1C29A 1PX4A 1XYBA 2ACUA 4LB3A 4CGTA 4S3JA 4ASTA 3UERA 1HKJA 3K1DA 4NNCA 3ITGA 3QY6A 4LUJA 4M5PA 4HOZA 2ESCA 1B9ZA 2E67A 2UWFA 3FW6A 3MBFA 1GZ1A 2RGLA 2FGZA 5AC5A 3WX7A 3V4BA 3EWXA 1H7OA 1GVEA 1EJUC 4I9MA 4HB7A 3O8AA 1HJWA 2FZDA 4PH6A 1CXIA 2X1SA 3W38A 5EFDA 3CMGA 1B31A 2WLZA 1DJHA 1J8VA 4XBJA 5HNRA 3ITCA 4AC1X 1W54A 4ZXOA 3W86A 3DC0A 1CZ1A 5CSSA 1Z9AA 4TR9A 2QYGA 4UNLA 4C6OA 3LV5A 4YCPA 3AXXA 2Y8KA 1MQRA 4LBUA 4E3VA 5EB8A 1XXXA 4HMDA 1J4EA 3P82A 2A3LA 1LT8A 1VD6A 4RE0A 2XM2A 2FH8A 4HN4A 4AWSA 1NAL1 4DJDC 1F6KA 3ZFHA 1KR0A 1OK6A 1U1HA 4AD2A 1ZCOA 4GYPC 1Q6CA 5E6ZA 4Y9AA 3UZYA 1UD5A 1GKQA 4HNOA 3GNOA 4GY0A 5LXEA 3ABQA 4MFDA 3DCPA 4INFA 1XLLA 3LCGA 1SZGA 3L23A 2PU1A 1GKRA 4I5XA 3FCPA 2XVKA 5MF5A 3OGRA 3GE7A 4S1FA 1FWAC 1Q6OA 1XDLA 1SW7A 3GG7A 5FD0A 4EE9A 5HDRA 1W2VA 2O0TA 2F2KA 4Y90A 4HU8A 1TE6A 2DSWA 1FY6A 2DT0A 4GI9A 3HURA 1XUZA 3R1ZA 1ZRQA 1UWUA 3KCLA 1EJSC 4WDXA 3GR4A 4MDOA 4HNLA 5F2LA 4H01A 3AU6A 1EB3A 1H5VA 2CWXA 4JIPA 5G4HC 3SIMA 3VYLA 3N19B 4J2PA 3SUWA 3PUEA 2QZRA 2AMGA 2OSYA 1Q6DA 2NV2A 1VCGA 5LGZA 7ENLA 4GUGA 2NV9A 3VX0A 4JICA 4CQDA 4DJFD 3S46A 1MZRA 3N2TA 4DJDA 3KWXA 1R7OA 4KFOA 1TUFA 1FTXA 2A5HA 2BP1A 3MVIA 1FVPA 3DFNA 4J27A 2WMIB 4DBEA 2PP3A 2YDRA 2ZICA 4CNNA 3WFZA 4WRHA 2V68A 3L66A 1JAEA 1MXSA 1F61A 4L64A 3VKKA 4E2VA 1ECEA 4LXFA 4YIWA 2FH6A 4IIEA 1ME7A 5I6SA 3O06A 2BMBA 4XIAA 4C1NB 3G1HA 3URBA 3PZ9A 1G67A 1NH6A 2DSKA 3WQVA 2CLHA 4W86A 4AU0A 3UJ2A 3DZ1A 3HO8A 2XGBA 2BXZA 1DTNA 2Z6JA 1MEHA 1JYWA 3P3BA 4HMCA 4UB9A 3I6RA 1JNEA 3CQIA 3W2UA 1QI5A 3URNA 4ZSTA 4GLEA 1LLZA 1GQLA 1X6LA 3ZVHB 2Q3RA 2PDLA 1F9CA 1X8CA 1NM9A 1REQA 3NQGA 1WOAA 3L4ZA 1FHVA 5BRBA 1ITUA 5FF3A 2BBFA 4UTLA 3VI2A 5CC3A 5J04A 2W27A 4MHBA 2V38A 3D6NA 1BSLA 1P4CA 3H7RA 1HO4A 3SURA 1DJXA 4ONVA 3LI1A 5A2BA 1MVYA 2Z7KA 3GTXA 2ALDA 2Y62A 3PZVA 3T8QA 3N9KA 1UH4A 2UBPC 3BV7A 3KOWA 1JCTA 1QPNA 1SU5A 3AYTA 4HMNA 4PMOA 3LV6A 2FVKA 3B9EA 3BLLA 3N17A 4H7CA 1V0NA 3RXZA 2YLAA 1S2VA 1Q6EA 3PULA 2PWDA 3N2MA 5CXPA 1XM3A 1YTDA 3OU8A 2A7NA 1WO2A 4F79A 3EDDA 2P1FA 1ZUAX 4KS0A 2OYMA 4A8IA 3NQ2A 4ZR8A 2VZVA 3FVDA 3HQOA 3ZWTA 4C91A 4JTLA 1R5YA 5GJNA 2MANA 1M53A 3DH7A 4NRSA 1W9BM 1E6RA 3L7RA 1PIIA 4M6PA 5TD4A 4UZSA 1FH7A 4KEUA 4DYEA 3WEZA 1UH3A 2REQB 4PODA 4AHOA 1XFCA 2PTXA 5JBDA 3KP0A 3DG7A 3PTKA 1UQYA 5FIPA 1RVKA 5FI8A 3FX4A 3QM3A 3WF3A 1J2WA 2VGBA 1I2PA 4YXGA 3T07A 5A8OA 2PLJA 4KCUA 4JAWA 4CUCA 2EPLX 4LS1A 1ODZA 4Q8MA 3JS3A 1NELA 2CFFA 1FXQA 1KTNA 3E2VA 1TZ7A 3IV3A 3I6EA 1ECQA 5DRIA 4KRTA 1J5TA 1EF2A 3ALGA 5PTDA 2DZUA 4JHMA 4JX4A 1QOQA 3IGHX 1NWUA 4GY1A 4UBPC 2POZA 4QJ5B 4US6A 2C7FA 3NUKA 1KM4A 3BV4A 3EKGA 1UKTA 3KXQA 4R34A 1CIUA 5LKYA 3LMYA 1HVQA 4U31A 2CHRA 4UR7A 5AHNA 1PJ9A 3A21A 4UTWC 4LTSA 4HA3A 4XSLA 3ABSA 4CD8A 4HOXA 4G6CA 2X0SA 3MS8A 4K68A 5M17A 2A3BA 3DHPA 3NM3A 1RUSA 1FCQA 4XAGA 1ZGDA 3R6IA 3L5AA 1ZS2A 4BR1A 2XIOA 4ATDA 5CPOA 3SIZA 2CLOA 4URIA 4RE3A 1UQZA 2YCIX 1TV8A 2UY4A 4E5TA 1TSIA 2ZE0A 5DT7A 4B5VA 4EVZA 1T6MA 8CGTA 2YL8A 1QI3A 3UZ5A 2A7PA 2INZA 1FHLA 1FWEC 1VFUA 4Y7EA 3BSGA 1I0DA 5C9ZA 1OFEA 3MMWA 4HHLA 1C9DA 3EPOA 2D20A 2C6QA 3I7SA 5ABHA 5DN1A 2EO7A 2X0HA 3TYZA 1JZ3A 4RCXA 3CLWA 3N15A 4K39A 5F2IA 2RJGA 3QJAA 2NX9A 2NLYA 5LSMA 4X0NA 2NXHA 1BF2A 1H3GA 5CPQA 4LWWA 1E6ZA 3CJPA 2WHLA 5BMWA 1US3A 1B3XA 4HHMA 3VNMA 3WBXA 3CL6A 1XSKA 1LJYA 2WSRA 3W1UA 4PB3A 1RH9A 3P0WA 1ZU8A 3OPSA 3W4RA 1WKYA 3PZNA 4LC8A 1F07A 3FA4A 3RIKA 5GNZA 3GXNA 3U48A 1ZENA 4PL1A 3VGGA 3PSVA 3CUGA 3W3OA 3T55A 2V5CA 4XZNX 4J35A 1BWVA 2BSLA 1LRTA 1U5VA 2FZ9A 3W7GA 3W2MA 5FEZA 1QNSA 5H1WA 2Y5EA 3CUXA 3VTRA 1SZNA 5HJXA 3TW6A 3DECA 4B5NA 4DYKA 4DUWA 4FXFA 3CZ8A 2GSJA 1EHNA 4BQ2A 5HNUA 2OZTA 2WAGA 3GFZA 2Z24A 1A3HA 2WMIA 4MB3A 1B1YA 1O68A 4IJCA 1OFRA 4RV3A 3GU2A 2VJXA 4UTTA 4PRWA 2Z1SA 3WD4A 3LPFA 1EO5A 1F5ZA 4UCGA 1HQTA 1W5PA 4NF7A 4OHQA 4UQ9A 5G2WA 3LTYA 3H53A 4NZJA 3RGTA 4QEHA 4D9PA 4C1NA 1J0ZA 4CD7A 4FP1A 2PRHA 1Q3NA 3H2OA 1V51A 3E1F1 4B4HA 5HXMA 1DXEA 3A22A 3M0JA 4AIUA 1PZ0A 2F9RA 4QG6A 4QSHA 4MLRA 4A35A 5DANA 2VQTA 3E0VA 5TQLA 3KRBA 1I9CB 1ONWA 1KW1A 1XSIA 1R9XA 4IZGA 4K36A 4M1BA 5A2AA 2CLLA 3UESA 3ZVHA 3W7NA 3A9IA 3QOKA 3FDGA 3M0ZA 1TPVA 5HPCA 3M44A 4JTRA 3RPTA 3BAXA 4HZ8A 1ADOA 1CENA 3G0UA 1D8WA 1XLIA 3H4XA 3MW7A 2XIMA 4TXEA 2PF0A 3QMRA 2QNEA 3E0IA 5AYBA 3I10A 5I09A 4Z1BA 2O56A 4AY1A 3F1QA 2ASHA 3T2PA 2QGYA 1RXOB 3F4VA 1TX2A 2W67A 4ADUA 1SFLA 2VC5A 1VIZA 1UWAA 2FZMA 3FXGA 3G22A 3MHUA 4H04A 2CEQA 2J24A 3B8VA 3BLIA 2KZHA 3PTDA 2XN2A 2PRLA 1DXIA 5D38A 2YR1A 4UOQA 2GUUA 4JY9A 5C2CA 3VE7A 1VZWA 3IK4A 4LAOA 4F9JA 5ENLA 4EXQA 2P8BA 3VNJA 4OBRA 2DZVA 4EWND 5AVNA 1QPOA 3ZLHA 1ITQA 2RDWA 4LVDA 3P80A 4W7UA 3TAOA 4IFKB 1XLJA 2R82A 2J7GA 2REQA 5FESA 3VU2A 2XFWA 3SN1A 3VMPA 1V6XA 3TSBA 4PUWA 5GNXA 2VR4A 3PJXA 5C70A 1ZLPA 4RDVA 4ZENA 4HNTA 3TQ0A 2Y24A 2ZQ0A 3CIWA 4D6IA 1NJJA 4N6EA 3K2GA 3EAUA 4IMFA 1V3MA 3W9ZA 1YDOA 4W8LA 5CJ5A 4UR8A 2PI6A 5EBAA 2PD5A 3P5YA 4GYJA 2G8ZA 2GQ3A 4R27A 3UT0A 4ERGA 2VCCA 4PEKA 1SW0A 4NZ5A 4N42A 3B3DA 2VX4A 3VC5A 1KFEA 2OMAA 2W91A 4ML9A 3RRXA 4M19A 4TV6A 2F6UA 1EBHA 4H4IA 3S5ZA 3TSMA 4GX9A 1KNWA 5BU9A 3AXKA 2G4FA 3WN6A 2C0HA 1IV8A 3ONBA 4XZLX 5KTLA 5B7YA 5I78A 1JCMP 3NQBA 5DBUA 5GPRA 3L4YA 1L2QA 3WQ4A 3TYUA 3UVIA 1HKMA 4A2SA 2XDFA 2E9BA 3VNLA 5LIYX 1S39A 1U30A 1P1MA 5K4XA 4CN4A 1F2JA 2OLSA 3EX3A 1I2OA 4TU1A 2CZVA 4FNPA 3I7RA 4ILSA 3AO0A 1JUBA 3QY7A 4LOCA 1UPMB 1H0IA 4DF2A 3IGUA 3NQ8A 4NJJA 2PCEA 2YA1A 4IGHA 1Q85A 2XN0A 5DLCA 5EMJA 5A6MA 1PKYA 5BU6A 1EX1A 3PPHA 1ISVA 3MUIA 3CV2A 1S2AA 5BROA 2BDQA 1MUWA 3UJFA 3NAVA 3QGKC 1EXPA 1R2RA 1D7KA 5DT5A 3LGGA 2IPJA 3GZAA 5DF0A 4S3KA 3GSMA 3QOMA 5CJNA 3WK2A 3KBWA 1DQUA 5JU6A 2WM1A 4JKLA 3PZIA 1QW8A 3CO8A 4WY0F 2CYGA 1R30A 4JTUA 3PHAA 2ISFA 3C52A 4AIEA 3IJDA 2EF9A 4A29A 2QULA 4PBEA 2QPSA 3DU0A 3OLEA 4B15A 2G3MA 2ISVA 1KBJA 1M3UA 2HV5A 3RO8A 3T2QA 1FA2A 5AC7A 2OU4A 3GLCA 1ML1A 3T05A 3TIMA 4DHGA 1PKNA 2CLIA 3BG3A 2GJXA 2DZTA 3WBYA 2EKGA 4P7NA 3PPFA 5CEWA 1H62A 4ADSA 1TB3A 5A8NA 1QCWA 5BMXA 3QV7A 1UZ4A 3GNDA 4A8RA 4AWTA 2G37A 4PB4A 2J7FA 5G1TA 4L56A 3FKRA 2DGAA 1CPUA 1FHUA 3O3RA 4HSOA 5D8WA 4QE4A 5F4SA 5EYWA 2WMGA 2PODA 1C90A 1HNYA 5GQBA 2XFFA 3TMLA 2V5LA 4F9DA 1AW2A 1UR9A 2ALRA 2ICSA 4YTUA 5TNVA 3E02A 2YCLB 1DHPA 2Z26A 2H3BA 3S5NA 3I3DA 3W37A 4J2MA 5J5DA 3RMEA 3W7OA 5F2GA 4O1DA 3O6DA 4Q4QA 1L8NA 2A3CA 3UY7A 1W9UA 3CQKA 2VFGA 5HWMA 2NXGA 4NJHA 3LM7A 3LUTA 4AD5A 3HF3A 2PTZA 3R8GA 2HEJA 2OQLA 4IQJA 3MZ2A 3WLMA 3WK1A 2OR2A 2ZUWA 4C5ZA 4UUIA 2VXNA 1HT6A 4RV8A 1V79A 3EXSA 1VF8A 3FYOA 2V0TA 4HTBA 5DRCA 3MYPA 1RCOB 3VZYA 1H49A 1TCMA 4I8YA 3W6MA 2WV8A 1TWSA 4JZ5A 4C6KA 1D8CA 3HV8A 4MYAA 4WDTA 3JUGA 1MRQA 3DN5A 3B8SA 4AD1A 3TUUA 1XSJA 1SPQA 1FWDC 3BMWA 2BGQA 4WGXA 3W1QA 2PRMA 1B0IA 4NZFA 3S5YA 1WX0A 2AQVA 3O9NA 3ZR4A 3B4YA 3VCNA 4HN8A 5A95A 4OJYA 4QDPA 1F3EA 2WVTA 4NI8A 4XX6A 5LA2A 1JD9A 1W2PA 3EMCA 1KBBA 1X7FA 3HJEA 3UWZA 1RCXB 2GWNA 4AISA 1BEUA 2C91A 4H9ZA 3VE9A 5IXEA 3R43A 1QPQA 2FB2A 1EH9A 3GNPA 3H23A 3Q65A 3OVRA 1JI1A 2FJKA 4ZQOA 1P7TB 2W3ZA 4NZCA 1O60A 4QISA 3SQLA 2HCVA 1Y5VA 5BOEA 1QNVA 3BGAA 1EOKA 1BKSA 1RK5A 2VGGA 4Y9PA 4JIRA 1GVFA 1UC4A 1A5LC 4JY8A 4RW3A 1A0DA 3T78A 3OYZA 3TMQA 4JFVA 2WPGA 2YBTA 1BYCA 4HQVA 4GISA 3W24A 3DFQA 2CXEA 1DWJM 2EPOA 3N1AA 3W74A 4WVXA 2VFDA 4HK5A 2EJAA 2JEPA 3LCFA 1ZJAA 3M0HA 2Q09A 1DL3A 1V93A 5F1VA 3C0LA 2BX7A 2VZTA 4RX0A 4UTUA 1V3IA 3VIGA 3BLFA 4PUDA 3H2MA 5JBFA 3HG3A 2CBUA 3TONA 2F8QA 2PLKA 1AVAA 5A6AA 4BFAA 4JKKA 4F3HA 1R3RA 1J18A 4JQ1A 3B04A 1AH3A 4QLKA 3JVAA 2ZE3A 5JMUA 4PZVA 2VNCA 4B3ZA 1JVNA 1XINA 4W8AA 4M82A 3R13A 5CSUA 5FJUA 3VAVA 1XKYA 3KLLA 3GO2A 4HSHA 3P8JA 1S1PA 3GXTA 1F4AA 2HBVA 5C5YA 1EFZA 3GIQA 1V6YA 3TZFA 1P0KA 5M1TA 2GLKA 1TPDA 4ZBCA 1E0UA 2JGQA 1O4UA 1PS9A 1SO4A 2G41A 3CIXA 3KS6A 3VDBA 2QCCA 3TYBA 4L4MA 1JYNA 1J01A 4DO6A 4Z2JA 1C9WA 1WXYA 4ERAA 5FJJA 1O7AA 4JIHA 4H9YA 2RDUA 1OG6A 3G2GA 5HBFA 3QXBA 1EWDA 1KXHA 3MI2A 4FK9A 1LL7A 4KEVA 4KIEA 1R9YA 1QW9A 4AD4A 3KCOA 1BF6A 3K4DA 3HIJA 3VZXA 5AC8A 2PGFA 1E9ZB 1DJWA 1S1RA 3KHJA 2F7FA 3WLNA 4AY8A 4BF9A 4X61A 1SJBA 2EKCA 3IIOA 4KCWA 1B3ZA 3TVAA 2WB5A 2X2GA 1I2NA 3PBWA 2WJEA 3PWGA 3IGXA 4IG2B 1B57A 3FHQA 2Y7EA 5AYXA 1Q6RA 1PCKA 2V67A 3H6OA 4JNZA 5DXYA 3LHYA 3U9IA 1TJ1A 2R1NA 1FX6A 1V03A 3C2FA 3OBKA 3OGVA 3CASA 3GXPA 1DQWA 3HPZA 5K9CA 7TAAA 3MPGA 2FDMA 3G8EA 3BARA 2XZ9A 3W7HA 4Q7BA 5G4EA 1C91A 4NJKA 3QV9A 2DT2A 2DSVA 4Q4OA 2CIPA 2OKTA 3PNZA 4H8NA 1IQ8A 4AUBA 2A79A 4O1BA 2NSOA 1CTNA 3V5FA 2SFPA 3LTPA 3H2FA 3WQ5A 4JQ4A 1WXZA 3PG8A 3BURA 3ZJ8A 1FFRA 4F2BA 4YL2A 1RQEA 2YCLA 3OBEA 4C90A 2PP0A 4V2XA 4ZL1A 3CQJA 2NUWA 1TV4A 5HNTA 4D6DA 2BODX 5AC6A 1EC9A 3DYPA 1X38A 2C1GA 1XS2A 4KESA 4H7ZA 4B91A 1IF2A 1H7WA 4ZFMA 4O1FA 4LW7A 1TJPA 4L4OA 3ARYA 2IQ0A 4NSBA 1MUMA 1DJQA 1OG0A 3VCCA 3ZIZA 4DJFA 1GCYA 1GWJA 1CGUA 4ZO8A 1D2KA 3QLDA 3DI0A 1KKRA 3W28A 1YTKA 8A3HA 3R94A 3TA9A 2VR5A 1VEMA 3AHZA 1RR2A 1V3KA 4GZJA 2O9TA 1TMHA 4QJ4B 1C93A 3S83A 3TWBA 4K8GA 3MT1A 1XCXA 2XH2A 5F2MA 2OLAA 3IACA 4AZCB 2QDGA 1S2UA 2ZZ2A 4HYWA 2UZ9A 3IJ6A 5K3VA 2JKPA 4HIBA 5AYIA 1RQHA 1IZJA 4C6DA 1E6XM 2DVTA 3NFUA 1W1ZA 4MPQA 1JZ2A 4W7WA 2YPIA 3GVGA 4Q8PA 1CXHA 3FN9A 4OV4A 1ADDA 4LAUA 4O10A 1PIFA 2CPUA 1OFOA 4JOMA 4FI4A 4Y6GA 1P6BA 4MWAE 1T8XA 1L8PA 4AXNA 3WJYA 1IT8A 2PWVA 5AHFA 3WF1A 1E0WA 1DBTA 3PZGA 2YOCA 3G6MA 1DORA 4JGDA 4F0LA 1P7TA 6ENLA 1X1OA 4P8WA 4A3YA 1W5OA 3W2JA 4NRRA 3W7JA 3GDLA 1NVMA 3GU9A 1W1IE 5JH2A 1OWQA 1KWKA 3H24A 1EC7A 2NQZA 3JU2A 3GVWA 1WDRA 3HGRA 4RJEA 2WSQA 1KLYA 4QQUA 3CAKA 1R9ZA 3KCJA 1JCYA 2CCRA 3AIVA 3N11A 1FWWA 4KERA 3W7IA 3FOKA 1B9BA 5LNSA 1E1FA 4WK9A 1GPWA 1OYBA 3E96A 5DMYA 5ABGA 1A3WA 4W88A 4C6EA 5HQLA 1RY8A 3CYVA 4MWAB 4N4PA 3A4JA 3O1NA 1QWGA 3RM4A 1IZKA 4UTHA 4L9XA 2Y70A 3IVUA 5GJPA 1VFMA 2ABAA 4GKTA 4XAZA 4U3CA 1H60A 1OCNA 1TELA 5LHFA 3M6YA 1ONEA 1OT1A 3VDAA 1I1XA 4KRUA 3L21A 4BJHA 4KMQA 3TJ4A 3WJSA 2AL2B 4R5EA 1R3QA 3V5OA 2GOUA 3BSMA 4GVHA 1N8IA 2X41A 2G5WA 1F3XA 5KZMA 3EX4A 3MUXA 4O12A 3R11A 3R12A 4WOZA 3L0GA 3E5BA 2DQXA 3B40A 4ZTYA 2VRQA 2Y61A 4ATLA 1NFGA 2QVNA 4LC6A 3HOJA 1GYMA 4Z1CA 1E9YB 5J5RA 5HQMA 5HMSA