3CB8A

4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
244
structure length
244
Chain Sequence
VIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pyruvate formate-lyase 1-activating enzyme
publication title Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
pubmed doi rcsb
source organism Escherichia coli
total genus 82
structure length 244
sequence length 244
ec nomenclature ec 1.97.1.4: [Formate-C-acetyltransferase]-activating enzyme.
pdb deposition date 2008-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF13353 Fer4_12 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3cb8A00
3BW3A 1TTIA 2RH9A 1B3OA 3EX6A 4NJJA 4QISA 2CZFA 1H50A 1R2SA 2BWGA 2WPBA 1T8XA 1OFOA 1WV2A 2TPSA 5L9FA 1P5BA 3KOFA 3LRMA 4Q32A 3CM4A 2J9ZA 3UWWA 5C54A 2VEKA 3TKFA 1KM5A 4O14A 1ZFJA 2DZUA 2G95A 3BARA 2GPTA 3LX9A 1MXSA 3EWZA 1AW1A 4AHQA 1OFRA 2P10A 5HMSA 2RFGA 2PRMA 3DKLA 2H8XA 4AVFA 3MHFA 4XBKA 1TTJA 1ADOA 3M7WA 5AHFA 4MZ8A 4QM1A 1IXOA 1G7UA 3IGSA 5F2LA 2GOUA 1L6YA 1K8ZA 4MKNA 4O11A 4BI5A 2W0UA 1S5TA 3QPZA 2CWNA 2A21A 2YGYA 1KFLA 3C2VA 3PAJA 4CLMA 3B0VC 3BG9A 1YADA 3GXTA 3DFPA 4LY8A 1B9BA 3MHGA 1LRTA 3CC1A 1FWSA 1PCWA 2WSQA 2WO5A 1THFD 4KFOA 1TPVA 4OBTA 2HTMA 1TCDA 2GQ8A 2GJNA 4LVFA 3LDVA 2DZWA 8TIMA 4WUIA 5K9DA 4LRSA 3TV8A 3CEUA 3LCHA 5EBUA 4R34A 4FX7A 1H5YA 3C6CA 1JR1A 5J5RA 3K30A 4PODA 2NV2A 3B03A 2BZNA 5LGXA 4IMGA 3G1SA 1FDYA 1YTEA 4FXRA 3LTPA 4UTJA 4LUJA 3G1VA 4Z1BA 1W3IA 1T0OA 3PM6A 4TR9A 4RKAA 3TX9A 1KLYA 2J88A 5D32A 1RD5A 5TQLA 2DZXA 1G4PA 3OIXA 2TRSA 2TMDA 3W75A 2Y88A 3SGZA 4UFKA 2V82A 3T40A 3GB6A 5E93A 3GXPA 3NAVA 3W1MA 2DJXA 1YDNA 4EOUA 3QYQA 3FJ6A 2E6FA 2Y70A 3C0JA 4O15A 5CPOA 2YXGA 6ALDA 2EHHA 3VI2A 1TPUA 1TPDA 4AWUA 5LNSA 1W5QA 3RMJA 1I2OA 2R94A 1TJPA 1VH7A 3G1YA 4OU1A 3GDMA 5BMWA 1J5TA 3S0CA 2FPVA 2E6AA 5KZEA 3LHYA 3BLIA 4E2BA 4MFDA 4UFHA 5AHNA 1IGSA 4JTLA 2HMCA 1PE1A 3WK1A 2C0AA 5CZ0A 1LZOA 2ZZ5A 2VENA 4K8EA 4PH6A 1SQ7A 5ABTA 4O50A 1F5ZA 3V75A 1VJIA 3W7EA 2EKCA 4FIRA 4GUGA 1AMKA 4UTLA 3C2FA 4JN6A 3W7PA 1HO4A 1GVRA 3P84A 3QSTA 3TQ0A 3LRKA 4UTUA 1MEWA 5AYYA 3PY2A 4K8HA 2I9EA 4TU1A 1B4EA 3ABQA 4X9SA 3KFTA 3PBVA 1LOLA 4G1KA 2VEIA 3W85A 3LCGA 3W71A 1BWLA 2VELA 4PTNA 3LERA 3I7QA 1OFPA 1YXYA 4LC6A 4ALDA 1DORA 1BWKA 3FIGA 4UTIA 3GAYA 3IGXA 4IX0A 1RZMA 2YSWA 2E6DA 3W7DA 3S42A 1W3TA 2BLEA 5T26A 3LM7A 2QJGA 3HPSA 2HS8A 4Y6GA 4OT7A 3N9SA 4LS1A 5HWJA 4XUGA 5D2VA 1OFQA 3M1ZA 3W83A 3GDRA 1VCGA 2VEPA 3UWQA 3I65A 1GWJA 4MVAA 3M5YA 3IIPA 3L5LA 2X1SA 3LHTA 1TRDA 1GVOA 2ZRXA 2YYTA 3TW7A 4UTKA 3NXFA 1TREA 1XDMA 4PL1A 3G0UA 4YL2A 3TA6A 2J6XA 1LM1A 2QCFA 4LS0A 1QCWA 3FS2A 5FEPA 2B0MA 1GVQA 1TV8A 3SECA 1KM6A 1RVGA 4K39A 2FB3A 2ZYFA 1JCNA 4JYFA 2ZRVA 3JS3A 1GTEA 1SFLA 1UASA 3TNOA 4O1CA 4A2SA 3KVMA 2QCLA 3MWAA 4N2YA 4O1BA 3IV3A 3W2KA 3NDOA 2RDTA 1F73A 1OVDA 4MJMA 1DL3A 4Q4KA 1W8SA 4CCEA 3L68A 4NZJA 1GPWA 2YZRA 4P61A 4UNKA 3DHDA 2X2GA 3ZWTA 4H4IA 1W31A 1EP3A 1PV8A 1IIHA 3DFQA 3NQ8A 1RR2A 2PE4A 1FWTA 2G97A 4DF0A 3P62A 1JCMP 3ZR4A 2H6RA 4ADTA 1S5WA 1XUZA 5DY3A 1QMLA 3G18A 5DXXA 2A7NA 1RQBA 4NXSA 4JYEA 3GYEA 1H61A 3SR7A 3USBA 5EY5A 3TR2A 1PS9A 3L9CA 2E6YA 1LROA 4FXSA 4ZQRA 1H60A 2NUYA 1V7YA 2DZTA 4WD0A 4ADUA 4KWWA 2Y7DA 1H63A 3W7QA 1ICPA 2Y85A 3UWUA 1RQEA 2ZRZA 2JGYA 4Z08A 1QO5A 3W73A 4ZVJA 3E12A 1W5MA 4YMZA 3IIOA 2ZA3A 3G0XA 3U8GA 3RK8A 5K3VA 3CEPA 3LGEA 1LCOA 1F6KA 3BW4A 4N4PA 3G1HA 5DY2A 5F4WA 4AF0A 4Y96A 4OQVA 5I3IA 4UMBA 1GG0A 4UR7A 5HUOA 4UTMA 3QPYA 5D04C 4WX2A 3PB0A 1JQXA 3PBUA 2OJPA 4EF9A 1YPFA 5D33A 2Q8LA 4UUIA 3QC3A 4TIMA 2ZBTA 3P5ZA 4RXFA 3OG3A 3S1VA 3W6YA 1T96A 4UR8A 4O53A 4QIUA 3BK0A 5D37A 3KVJA 3MBFA 5F4SA 1OHLA 1R30A 3G1XA 3P61A 2E5CA 1RV8A 4KWVA 2OZ0A 1EP2A 3LRLA 3OHIA 3INPA 2QCCA 2QF7A 1YTDA 5F2MA 3BO9A 3UXAA 3E02A 3W2JA 3GAKA 3KXQA 2I14A 2ZDRA 3NZRA 1UBSA 5EL1A 3W70A 2VFIA 4JEQA 3TH6A 4IPIA 4JGDA 2CLFA 3HG3A 4AH7A 3DBPA 2J24A 3LXAA 5MHBA 1VR6A 3RLVA 4UMAA 2X16A 3HGOA 1S5VA 3GDKA 3G8RA 3W7HA 4RR4A 3NL2A 4IMFA 5K4ZA 2VFFA 2VFGA 4K7VA 1TIMA 2ZZ4A 4X2RA 1P0NA 2B7NA 3WK3A 1G4SA 2Z0IA 1SU5A 4RZ6A 3TMLA 3TFCA 1GTHA 3KVLA 1VLWA 1XFBA 2YPIA 1DQWA 3DXIA 1FWNA 1TQJA 4HNUA 1KFCA 3T7VA 4AAJA 5LZLA 3QRHA 1P1XA 4ORIA 1M7PA 2CLEA 5I3JA 1QFEA 5LGZA 4IUOA 4BFAA 3PB2A 4DO5A 5LHEA 5I3KA 1CI1A 5HJLA 3R8RA 1HFBA 3DGRA 3NQ7A 3S5NA 3MP4A 3MUXA 1UCWA 3NA8A 1TQXA 1XBVA 2A6NA 1ICSA 1OF6A 3GXNA 2PRLA 3LBMA 4JIPA 2C1HA 2H90A 4XKYB 4LNYA 1B57A 3S1XA 3O6YX 3SGUA 1JJKA 4X22A 4MZYA 1SZFA 1SZNA 3MP5A 3W1UA 2RDUA 5EKYA 5EMUA 4R7JA 1MO0A 1JUBA 2C16A 3MHUA 4WJEA 5FF2A 4NJGA 2E5BA 1F74A 3EWBX 4BR1A 2J27A 3KX6A 1IIGA 1PVNA 1F05A 2WNZA 5KINA 1W0MA 1H51A 4FNPA 4JDBA 4I7UA 1EA0A 3MI3A 2A6LA 2V2HA 4BF9A 1W56A 1TPC1 3EWUA 1ZALA 2AAMA 3WK2A 2LLEA 4MYAA 1ZY9A 4HHPA 2XN0A 3UPWA 1NFBA 1SW7A 2DORA 4IXHA 2CZEA 7TIMA 1OK4A 1WQ5A 1TSIA 5G1YA 1TPEA 1JULA 3PBYA 1QPOA 3NPXA 5EPDA 2YCEA 1Q6QA 2QKFA 2GVJA 2TYSA 3QMTA 1A50A 1HTIA 1KV8A 4O0KA 4BWLC 1TPB1 4TMCA 2QCDB 2XN1A 2B7OA 1VCVA 4Z1DA 1SW3A 1TTPA 4GRSA 5CPNA 2JKAA 2QCHA 3S5YA 2J9XA 2AGKA 1S3HA 5BRBA 2H8ZA 2ISSA 1KM3A 4Z1AA 4S1FA 1WOBA 3OVPA 1EWDA 3H53A 3LLDA 3HGJA 1K7EA 3KRSA 3L67A 1TJRA 3W72A 1H1YA 5D38A 5AB3A 3PWAA 1A5SA 3DZ1A 3M9YA 3THQA 3W1NA 3CQ0A 3DHFA 1FY6A 2C6QA 3T44A 1YLVA 3HGSA 3HO8A 3W7OA 2R14A 2GJLA 3A23A 4MY8A 3P67A 3S9YA 3B8DA 1M5WA 3W84A 2B7QA 1ZAJA 1ZJIA 1I45A 3GDLA 1AL7A 1VLIA 3E9AA 4QQ3A 3TXZA 3TXVA 1OK6A 4RLIA 4DXVA 3NQDA 2FPYA 4JY9A 3F03K 3CPRA 2OT0A 4BI6A 5D2XA 3ANYA 4ZMGA 1BTMA 2E77A 1Q3NA 5KITA 4IX2A 3STCA 1LTDA 2ZQ0A 4OV4A 3S5ZA 4L4LA 3VNDA 4GWEA 3W7GA 3Q2DA 3NM3A 1GOXA 3G1DA 1JRCA 4MZ1A 2G5WA 4DO6A 2D73A 3BG3A 5AOUA 3PG9A 1FCBA 3UYCA 1L6WA 4Y8FA 2H3DA 4IXXA 1SO6A 1OFBA 5D09A 3C52A 1WDWA 5FI8A 3FJLA 1QWGA 3L65A 2HSAA 4JTIA 3S1WA 3CTLA 3HBLA 4OGZA 4MJZA 2YW3A 3LI1A 1D3GA 3E96A 5TBOA 1LDCA 1U5JA 1FDZA 3VKJA 1UB3A 2G96A 2GQAA 1H1ZA 5AC7A 1K03A 2EPHA 1K3UA 1ME8A 3QMRA 4U28A 4DELA 2Q8ZA 1A53A 3PVFA 1JQVA 4HPJA 3L0GA 1KW1A 1W5PA 1PHQA 2DZPA 3HMJG 5FEWA 5AHEA 2YFNA 4O54A 1W5NA 4JY8A 5CPMA 2RHGA 3SJ3A 1Q6RA 5A5WA 4D2JA 1KFEA 3N3MA 3LLFA 4PCFA 1KV5A 5F1VA 4CQ8A 5BW6A 1DQXA 4JTEA 3W1TA 1F7BA 3HPZA 3AO0A 4JYDA 4LTSA 3W88A 1X1OA 4M7TA 4HIBA 2QCNA 4AHOA 3L2IA 1SO3A 1XDLA 3NL5A 4RX0A 3O63A 1PHWA 2JBMA 5FEXA 1ALDA 2NXGA 3KHJA 2C15A 2A7RA 1WYIA 4X3ZA 4N9BA 2YW4A 4ZZ9A 4JX4A 4M19A 1QO2A 5HULA 2EGZA 3W1LA 1LBLA 4XTDA 4MYXA 1GVFA 5CG7A 4AMAA 1OABA 2NX9A 5E1QA 1C8VA 1L9WA 4NJIA 4XBSA 1XL9A 4M6VA 3V1PA 2Y6ZA 1GYNA 2A4AA 2GUUA 2A2IA 4HN4A 3CHVA 3IIXA 2ZTKA 1KLZA 5H91A 3HG5A 3LCLA 3W23A 3PSVA 3BVJA 1PL9A 1FUYA 1LYXA 3A24A 4RJEA 3LHUA 4CCDA 5AYXA 2FPTA 3EB2A 1MEHA 1T99A 2OMAA 3G8EA 3NQCA 1AL8A 2F7FA 5D30A 3W7JA 1A5BA 1JCLA 5FESA 1I2NA 1NVMA 1QDSA 1UJPA 1NF7A 4QAIA 5LNWA 2R8WA 3M0ZA 3EX1A 3LCFA 4RZ5A 3UPBA 4K38A 4TO8A 5D03A 4O1AA 1Q45A 3RU6A 3UWVA 5HR6A 4WY0A 1CX9A 5C55A 1G69A 1YPIA 1KA9F 1ZAIA 4BK9A 4UMCA 4MY1A 5HQEA 3S1UA 2BSLA 3UWYA 1JVNA 1K8YA 3W2NA 1I2QA 4JD4A 4Q33A 1XCFA 3HIJA 3ABRA 1GJPA 2QDGA 2WQPA 3C2OA 3W7MA 3RF9A 4R33A 3A21A 1ICQA 1TB3A 2ZZ7A 4UTWA 3GNDA 4FEZA 4O17A 4NJKA 4ZQCA 4N6FA 2B4GA 4LU0A 1TRIA 1WXJA 4POCA 3UZ5A 1LORA 3B0UX 4GXMA 1EIXA 5HNRA 3W2LA 1VPXA 4MLJA 2JK2A 4HNTA 3STFA 2OX1A 2CW6A 1XI3A 3ATYA 4FO4A 3DFOA 4LV4A 3CWOX 1JCYA 2PURA 3EX3A 3PC0A 5DBUA 1F6PA 1AK5A 2VKZG 4M7SA 2VC6A 1FX6A 1ML1A 2O7SA 4H3DA 4O52A 3B04A 3QW3A 4JTFA 2DP3A 3PSWA 4Y9AA 1VHCA 1R2RA 5EYWA 3W74A 1OG0A 4LT9A 1YXDA 3W9ZA 4QNEA 2Z2UA 1LOQA 3P8JA 4IMEA 4K36A 3NQMA 5LSMA 2VFEA 4N9EA 4CCCA 3M16A 3U2OA 1M7OA 1V5XA 3TSDA 3G24A 3LBCA 3LXBA 4FNRA 4HSNA 3FKKA 1KM2A 3CU2A 3I7SA 3UZJA 1YDVA 3NQEA 4O4WA 4J9JA 1KTNA 4YLWA 5G1TA 3ABOA 1GG1A 3HQ1A 2UV8G 4YCOA 4PFMA 4S2CA 5CKSA 1SO5A 4O13A 1IXQA 2V5LA 3T4CA 1KFKA 3N34A 1CW2A 1VQTA 4CQ9A 1OX6A 3TSBA 2ZCGA 3BGJA 3KVKA 3W1RA 1VRDA 3HOJA 3TMQA 1K7XA 2CZDA 4EWND 3TJLA 2Q3OA 3UQNA 3LCIA 5LNRA 3DAQA 3HG4A 3TSMA 3M5XA 4A29A 3MO7A 3L0KA 2QCMA 2X30A 3O06A 3NQ2A 4JS3A 3EWXA 6TIMA 3PUDA 1G67A 2NX3A 1O4UA 3PS7A 4N6EA 3IIZA 3W76A 2DZVA 4UTTC 3P81A 3AJXA 3H55A 2B7PA 1O5KA 4AF0B 3M43A 5G5IA 1OFAA 3UD6A 2WSYA 2O7QA 2Z1BA 5KTLA 2NLIA 1KTCA 4WY0F 2WNNA 3C56A 4N9CA 4IJBA 4XWUA 4AHPA 3C2EA 1Z41A 4UNLA 1MSSA 4GUHA 5KSWA 1ZAHA 3NPUA 4WOZA 1VS1A 3HF3A 3W2MA 1FCVA 1VYPX 3JRKA 2E09A 3G1FA 1Y0EA 2HS6A 5HINA 3HB9A 4FNQA 3U6WA 3PUOA 4LW7A 5F1UA 4EF8A 1LLWA 3ELFA 3D0CA 2CLLA 5F4XA 4JTKA 3WJXA 3W1AA 1Z42A 1KFJA 1P0KA 1D9EA 3S6DA 1LBMA 3S8HA 3SFKA 4RZ4A 1H7XA 5DCEA 3LB0A 3M41A 5AFDA 1N8FA 3EXTA 4M5PA 4FF7A 4ONVA 1JUEA 3T78A 3LCWA 5K9XA 5GVJA 2I1OA 4OWGA 2Y7FA 2FJKA 4RK8A 5C6MA 1W54A 2Q3RA 3QZEA 4GJ1A 3B0PA 2ISWA 1MEIA 3MI6A 4N9DA 4N02A 1W3NA 2NWSA 3WJZA 3UY7A 3P7YA 5D2WA 1KM0A 3NEVA 3N19B 4IQLA 1VCFA 2PRHA 5KMYA 5D2YA 1P4CA 3ABSA 2VFHA 5DN1A 1SW0A 3NYZA 1O95A 3W7KA 3TE9A 4LRTA 4ADSA 5J5DA 3BPWA 5AHIA 2ZZ1A 4GUIA 4KFPA 3EKLA 2P0OA 1H7NA 3L5MA 5AN7A 3W7LA 3M5ZA 1VYSX 2W6RA 3KRZA 5G2IA 2NWRA 3R13A 1OX4A 1SZEA 1BEUA 5BOOA 1SSDA 4HSOA 2FFCA 1OYAA 3MBDA 5I3GA 1JRBA 1RQHA 4LS2A 1FWRA 3BGGA 5AHMA 3VE9A 3A5VA 4IPJA 2WKJA 3SSJA 2WNQA 5G2HA 3SI9A 2QAPA 4NXKA 1XUUA 1QOQA 1TYGA 3LV6A 3CLMA 2ZRWA 4RV8A 3STEA 3SZ8A 3NO5A 3W1XA 2VOMA 1FWWA 2X1RA 3UY8A 3B06A 3RLUA 3MJYA 4K37A 2A85A 2C13A 4NX0A 3BG5A 4WQ6A 3WK0A 5L6UA 1JCJA 4ML9A 4FB7A 4JNMA 4NQ1A 3RFAA 4ORMA 3F4NA 1H7PA 3PUEA 1TMHA 1EX5A 1BKSA 5CZTA 3B05A 1L6SA 1RPXA 1AW5A 4DPPA 3FYOA 3NQAA 3P60A 5FF7A 1OFEA 4DBEA 4N4QA 3I6RA 4E38A 2V0TA 2A1YA 3N9RA 4JR5A 1EUNA 5HUPA 5C2XA 3QF0A 4JXCA 1ONRA 3MP3A 1YYAA 5D2TA 1J4EA 1WBJA 1SPQA 2Y89A 2CFFA 3IEBA 4PA8A 1O60A 2ZA2A 2XFWA 1GT8A 4ZQNA 1ZENA 5D02A 1DBTA 3QJAA 3QQ0A 3EEGA 2VEMA 3F1QA 2JGQA 3TQKA 1NEYA 3M6YA 3LCXA 4LVGA 4AEOA 2FIQA 1I8JA 4LVBA 1X1ZA 3PULA 3TIMA 4M6QA 3DI1A 3IVUA 5DLCA 5CPLA 5LHFA 4IMDA 3IGUA 3DENA 4XQ6A 3WJYA 3O6DA 3MMTA 3N14A 4FX6M 3CB8A 4CNOA 5D05A 4E0CA 2DZSA 2CU0A 2WOQA 5KZMA 4AWTA 3FYPA 2JKPA 3EX2A 2A0NA 3QM3A 1TO3A 1SO4A 3ATZA 3TU9A 3TUUA 3WJSA 1KM1A 3DFNA 1JUKA 2YDAA 3EKZA 1F2JA 1B4KA 3G1AA 3I68A 4O0ZA 1XXXA 5K2ZA 1YXCA 2NX1A 3O05A 3O1NA 3G0SA 4LVDA 3P5YA 4QITA 4YWIA 2NUXA 4MIMA 5TIMA 3QSRA 3FLUA 1KTBA 3TQVA 3MW7A 1LRQA 3TC6A 4JICA 4ZL1A 3LHWA 3IRDA 4UTTA 3NR0A 4JTUA 4M6PA 1H7RA 4MLRA 3NPWA 3G3MA 1LLZA 2NZLA 4I7WA 3MYPA 3UXDA 3N2MA 1HO1A 2QJIA 2QEZA 1EP1A 3M47A 1DKWA 1TV5A 3VCRA 3TJXA 2ABAA 1G7VA 1XC4A 2RKXA 1I2RA 4MPQA 2NXHA 4C1LA 4I7VA 4Z0JA 3W7IA 3KRUA 3R5EA 4KFNA 2J9YA 5EA9A 5AYZA 2AQWA 3GX9A 3OEXA 1XBZA 1GEQA 3NNTA 2WSRA 3Q58A 1EEPA 3W22A 4EIVA 3LTSA 3OVQA 4JTSA 4LOCA 4O8RA 3IVTA 3FFSA 5DBTA 1Q6LA 1Z48A 1OFDA 2Z6JA 3EWYA 4JTTA 2OCZA 1L2UA 4KKXA 3VE7A 4BI7A 1QR7A 3N73A 3M44A 4GE8A 4AXKA 3HJZA 4U4MA 1AW2A 5BMXA 1QPRA 2Y61A 4O1DA 3P80A 3GZ3A 2BX7A 2ZZ2A 2YR1A 2CLHA 3W1QA 4DEFA 4MY9A 1YDOA 1VYRA 4JX6A 4MUZA 2YYUA 1R47A 4GBUA 2PC4A 3DFSA 5I3HA 3EXRA 1K7FA 3SIZA 4HPXA 3NL6A 3F4WA 3NM1A 1DVJA 3NPVA 1K02A 2VXNA 1QPNA 1WOAA 4Z0SA 3PF3A 3EWWA 3ZS4A 4OHQA 1UUOA 2ZZ3A 5CSRA 1OYBA 3SW6A 4AB4A 1X6UA 2W79A 5FF4A 1ME7A 2QAFA 3GVGA 3ZFHA 4L4MA 3P74A 4GUJA 3L66A 2QUVA 4NNAA 3O15A 4FNTA 1W5OA 1EB3A 4JX5A 4CNPA 1C29A 1GQNA 2ALDA 3G22A 5FF3A 1N55A 1N7KA 3ZWSA 1KBJA 2V9DA 2V81A 5HWMA 4IWWA 1TPH1 2FTPA 4LC8A 3W3OA 5DELA 4O57A 4XZ9A 2RDWA 2Z6IA 3NQ6A 1NF0A 2F84A 3R12A 1KM4A 4JDYA 3MYOA 4WY0B 4UFIA 3QW4B 3W07A 2Y7GA 2CLIA 2V8ZA 1SZGA 5G2WA 1GYLA 5I3FA 1QOPA 1LRNA 1O5XA 2DJLA 4GFSA 2V2DA 4OE7A 4QJ1A 2A7PA 3HGRA 5FF0A 4HNVA 3GKFA 1FBAA 1ME9A 3TDFA 1MZHA 4LVAA 4DF1A 4E2DA 5IBXC 4NNBA 1FDJA 3DH7A 2BTMA 5LKYA 3GR7A 5IM51 3S5OA 1G4TA 3TK7A 5AC6A 3A5FA 4ICNA 4NT0A 3NVTA 3NGJA 4NZFA 4MOZA 5AC8A 1LP6A 3NQGA 2QR6A 4H6KA 3W7NA 1PIIA 2QCGA 2BXVA 3GNNA 5C5YA 4UC5A 1LOSA 1DJNA 4LUIA 5G4EA 3LXCA 4ZQMA 2ZRYA 4IGHA 3THAA 5DXYA 3C2RA 1OJXA 1O94A 2DU2A 1R2TA 3BW2A 3GK0A 1QNVA 4BWLA 1ZHAA 4IMCA 1H7OA 1IF2A 5CZSA 3O07A 1A5CA 5AHLA 3JR2A 2C3ZA 1WX0A 3Q94A 2E68A 3EX4A 4WZHA 4O18A 2V5BA 3W7RA 1IXPA 2CLOA 3T55A 1E51A 3FKRA 2ZA1A 4QSHA 1G6CA 4JTJA 1WA3A 2C14A 1SUXA 2VFDA 3W87A 4UFLA 4LV9A 3TAKA 3QH2A 1HUVA 1I4NA 2E5DA 4JTGA 5DCDA 3W7CA 4UXDA 3NG3A 2FLIA 3R89A 1ZCOA 2EAWA 1F76A 2FB2A 4FIQA 5CZJA 3OA3A 1DHPA 3DKJA 3QEZA 1FQ0A 4UIOA 1W37A 2GVGA 4RCXA 3CIWA 1OF8A 1GZGA 2Y7EA 3B4UA 5FEZA 5LNVA 3LTYA 4W9TA 3TROA 3YPIA 3E0IA 2Y63A 1XKYA 3LOTA 3IIVA 3HG2A 1XBYA 2EF9A 3CIXA 4DQWA 3M5VA 3TW6A 2H3BA 3KAOA 3LHVA 3LHZA 3E49A 4JIQA 1NAL1 3GDTA 4UFMA 2V2CA 2ATMA 5U7SA 3W86A 1FXPA 3NQVA 4EVZA 5HWNA 2XN2A 4NJHA 1H7WA 2QUUA 3QFEA 4FX8A 1Q6OA 3L0NA 3NZ1A 4OV9A 1DV7A 3BLFA 1A5AA 4YXGA 3LV5A 4UFJA 1Z44A 5SWUA 4WXYA 3DI0A 2Y62A 3L21A 5E0KA 3MI2A 4QNWA 1R46A 3TFXA 5CSSA 4WXZA 1FCQA 3PBWA 4S2BA 3SY5A 1HG3A 2NUWA 1D3HA 4FNUA 2YX0A 4O12A 3A9IA 3C4UA 4NX5A 2CZ5A 4DO4A 2ZRUA 3N2XA 4GC4A 3Q37A 4DF2A 4TX9A 4XTIA 1VZWA 4O16A 3O8AA 4TMBA 2X1TA 3RNDA 5F2GA 4UTHA 1AG1O 3TC7A 4CNNA 5KZDA 1WBHA 1DJQA 1VHNA 2NXIA 2CLMA 4UCGA 5K7JA 4LWWA 1X8FA 4YCPA 1VGAA 1G4EA 3DFTA 3GKAA 4DBDA 4NU7A 2ATSA 2CLKA 1W1ZA 5HR7A 2WV8A 1WAUA 5LNUA 3NL3A 3NQFA 4PL2A 5DCBA 1K8XA 4O4VA 3H54A 4HKPA 3BV4A 2QJHA 3W2UA 1TPWA 4Z1CA 3QMSA 3WJWA 3GR8A 4B5NA 1XM3A 1EUAA 3PR2A 1KBIA 1TPFA 4MFEA 1SFJA 3OBKA 1VC4A 4I9AA 3UWZA 1XBXA 4R53A 1H62A 4A21A 1YTKA 5K4XA 3QQ1A 4GNJA 1GVSA 1SSGA 4P2VA 2ISVA 4NNCA 1PCKA 4FNSA 5F2IA 4PC8A 1NSJA 2QDHA 4A22A 4O28A 2GVLA 4PEKA 2ZZ6A 3P82A 4O19A 5CGQA 3O6CA 3GLCA 1OX4B 2WJZA 2QCEA 1EPXA 2YFOA 4JTHA 3UNDA 1OX5A 5U4NA 3C3NA 2ZFAA 2KZHA 3FOKA 4XKYA 3W1PA 4O10A 3OVRA 3CT7A 5BNKA 4HT3A 4RXGA 3L5AA 2ABBA 3C8FA 2P1FA 4IOTA 1I2PA 5K9CA 3I7RA 5A8GA 1J2WA 1LBFA 3CWNA 3VFLA 2FQIA 4FHAA 3GIYA 5IBXA 1FCUA 3A22A 4C1KA 4CQAA 1UUMA 2NV1A 1SR9A 1TV7A 2C18A 1QPQA 3HPXA 4HNNA 4WOQA 3PG8A 1DOSA 2OT1A 5H2ZA 4UTWC 1X7FA 3TCEA 1QAPA 3IVSA 4K6AA 1ZNNA 2TSYA 3DU0A 3FA5A 4ZQPA 4NUWA 2A5HA 4Y90A 3WFAA 5G4WA 2FDSA 1EWEA 3NOEA 1FXQA 2QUTA 1M6JA 4DPQA 3C61A 1C9DA 3G3DA 3O16A 1KFBA 1IXNA 1JCXA 2IQTA 1OYCA 3P8IA 2JKEA 3BLEA 4AWSA 2ZTJA 4A3UA 4K7YA 2V30A 2X1UA 3STGA 2PCQA 2E1DA 2R91A 2GQ9A 1HL2A 3EXSA 3LI0A 2QCDA 4GUFA 4ZQOA 3FEMA 4A2RA 2C19A 3R2GA 3TAOA 1U83A 4NVTA 1TTQA
chains in the Genus database with same CATH superfamily
1OADA 1B3OA 3EX6A 4QISA 3SY8A 4ZXLA 5DRCA 3OB8A 1V3JA 1H50A 2XJ7A 1LQ2A 4YNGA 1QHPA 4PCNA 1MRAA 5CGMA 3NO1A 3K46A 2BWGA 1LT8A 1XCWA 4Q32A 3UWWA 2VO5A 6REQA 5I03A 1Z32X 4JL1A 2EG8A 4L5ZA 1ZTVA 1MXSA 3VIJA 4X0VA 4LNCA 4N0RA 3RJXA 4AHQA 1D8CA 4IIBA 3NZGA 4Y7EA 3MHFA 4A8IA 5XIAA 1TTJA 4X0NA 3GO2A 4QG6A 1IXOA 1JDDA 1L6YA 3KE0A 1ZU8A 4GOAA 3QPZA 2CWNA 4J3WA 4Q22A 1NFGA 6ENLA 2OG9A 1Q65A 3PAJA 2V69A 2VEGA 1JGIA 3BG9A 1A5MC 4R9OA 4B5TA 2Z00A 2VDGA 2QT3A 2WO5A 3PNZA 3UZYA 4LVFA 5BCAA 5K9DA 5HBFA 4DJEC 4R34A 1JR1A 2REQA 1V6UA 3G1SA 1FDYA 3LTPA 2RDXA 3T09A 4D8LA 5ABGA 4MADA 1W3IA 3ECQA 4TR9A 3APYA 7CGTA 4CD5A 5D32A 1RD5A 1KBBA 5TQLA 3AS3A 1VFHA 2BBFA 4L4PA 1G4PA 2TMDA 4P5UA 3PZVA 3GB6A 5E93A 2WBGA 3S3GA 2YBVA 1PWMA 2I5GA 1K77A 3GG7A 5DMNA 4H6EA 1P1MA 4O15A 3AZRA 1G01A 4LANA 3IJLA 4X61A 1WDPA 4AWUA 1W5QA 2R94A 3AIWA 4PYSA 4D9PA 3DFHA 3VIGA 3L4UA 5BMWA 1BXBA 1JI1A 4FXFA 3V18A 3PTMA 2FPVA 5KZEA 3BLIA 4D6JA 2A3BA 4UFHA 1DIOA 1IGSA 4JTLA 2HMCA 4PMVA 3W53A 2C0AA 2PP1A 5ABTA 3C3UA 1O68A 1WZMA 1RA0A 1F5ZA 2ZC1A 3SBFA 3W7EA 2PU1A 4JN6A 3IGHX 3P84A 4O8AA 4UOJA 3TYDA 5C0QA 3TQ0A 3KDNA 4K8HA 1GQIA 2I9EA 3W00A 3CLWA 3MMWA 4AFYA 3HV8A 3KFTA 1QNSA 1LOLA 1LWIA 2G4FA 3LCGA 3W71A 2VELA 3LERA 1OFPA 4LC6A 4HNOA 1VPYA 2HVOA 2VGBA 3IGXA 2QF8A 4EXAA 1UQYA 3QGVA 2E6DA 3S42A 3WYZA 2EG6A 5KZ6A 1R86A 4GZJA 3KRBA 4KEVA 2PDMA 4CCZA 5D2VA 1XINA 3M1ZA 3MY9A 1WE5A 1BXNA 5FAJA 5C9UA 3AYSA 3U48A 1ZGDA 3OGVA 2CBJA 1I6NA 2NQ5A 1GVOA 2HROA 3ZM8A 4CU6A 3LGGA 1TREA 4PL1A 3CQHA 4QLJA 4IMAA 1X1NA 2GJPA 1B9ZA 3V5FA 2F38A 1Z8AA 3A4AA 1QCWA 4CD7A 2ZKMX 3CZLA 3PWIA 1KM6A 2FB3A 1JCNA 3TYBA 4E8DA 1F3XA 1TG7A 3KVMA 4DAFA 4N2YA 3NZPA 4Q4KA 1W8SA 2D20A 3IJ7A 4L9XA 1EP3A 1PV8A 3N04A 3GVQA 3DFQA 1RR2A 2G97A 1H2JA 3BL3A 3R10A 4ADTA 1S5WA 1GZ1A 1XUZA 2OXNA 1QMLA 2G3MA 1WKFA 5DXXA 3N12A 4G6CA 4OOZA 1H61A 2BHZA 3TR2A 3L9CA 3IANA 1LROA 5FJUA 3HTWA 3IUIA 4ADUA 3MWCA 4GCAA 1H63A 4W7WA 2JGYA 4H9ZA 4LBUA 3W73A 3BQ6A 4XO7A 4Q4OA 2NVDA 5K3VA 3MCNA 4NRSA 5FA5A 3BW4A 4GQ0A 5DY2A 5F4WA 3VIKA 2W4XA 1Y5WA 4HU0A 3VDBA 3GVVA 1AQHA 1MW3A 2ZIDA 2Z1WA 4PMUA 1S2UA 1VEPA 3PBUA 3TR9A 4J35A 3L23A 4HK6A 4EF9A 4DJEA 4C1NA 1U1UA 3U4AA 1JDFA 2ZBTA 4X63A 3S1VA 3VD3A 4C6NA 1HKVA 3V36A 1PBGA 3HFYA 3BK0A 5D37A 3PJWA 1V0NA 4EACA 3G1XA 1UR3M 5GJNA 3CJPA 3SQSA 2QCCA 2QF7A 3B8TA 4GABA 3BO9A 3M4HA 2I14A 1UP0A 1TX2A 4IPIA 2E1WA 3HG3A 4GNVA 2PWGA 3ES8A 3V5OA 4Q3MA 4OECA 3E5BA 3LXAA 1R38A 2XFFA 2P5NA 3W7HA 3WUEA 1F9CA 2ZXAA 2VVSA 2VFGA 4C6BA 4E3VA 4K7VA 1FWJC 3VIFA 1VIZA 5C8BB 2FHFA 1PAMA 3WK3A 1FOBA 3TMLA 2PTYA 3NYDA 1VLWA 2FHCA 1XFBA 4MWAC 5TF0A 2YPIA 4A8LA 1MDRA 3FA3A 3WCZA 4CU7A 3MUCA 2F9RA 2E40A 1KFCA 3T7VA 3VM7A 1FKWA 5MKGB 3UESA 4ORIA 2D2HA 1QFEA 2DT3A 2IPFA 4QQUA 3RX2A 5I3KA 4UQDA 1QI3A 3DGRA 3S5NA 1UD3A 1Q6FA 1YE6A 1T8QA 4S3GA 3GXNA 1OF6A 2PRLA 2CZVA 3BANA 3VX1A 4B3ZA 5HQMA 3O6YX 4GH3A 3EZ4A 2E8ZA 4Q7IA 1JJKA 2G3JA 1SZFA 4AZBA 4CGTA 3W1UA 2RDUA 4JNYA 1CLXA 1XLDA 2PDXA 1XR2A 4K2SA 4WJEA 3SCWA 4HZ8A 1WDRA 2J27A 3AIEA 1W0MA 4FNPA 4LQ1A 3CQIA 3RM9A 3UW6A 4I7UA 3MI3A 2BVYA 4A6GA 1TPC1 2AAMA 5XINA 1M1BA 3LPFA 4GHRA 3LLXA 4LX4A 1E4NA 4Q8QA 3UPWA 2GQ3A 3ZJ6A 2CZEA 3S4TA 1OK4A 3C0SA 1T41A 2EPNA 3IAQA 5A6SA 2B31A 1JULA 3PBYA 1UP2A 1A50A 4H6RA 1KV8A 4O0KA 3UZZA 4S3FA 5F7UA 1NIUA 2XN1A 1JPIA 3VIIA 1VCVA 4Z1DA 4I6VA 5A95A 2DIJA 3S5YA 1V6YA 1UPMB 1XPGA 2W27A 1P43A 4XO6A 1KM3A 3T6CA 4S1FA 4Z1AA 4PMOA 1EWDA 4S3EA 3KBMA 5I77A 3LLDA 4PMYA 3HGJA 4KIEA 3KRSA 3L67A 1H1YA 2HE5A 5DF0A 4NL1A 4HPNA 6REQB 3PPHA 3M9YA 2DVTA 4C7DA 3THQA 5LA0A 2XH4A 3DHFA 1FY6A 1X97A 1HGYA 3RCMA 2FFIA 1ADSA 3B8DA 3IAPA 1ZAJA 1ZJIA 3E0FA 3TA9A 4DXVA 2ODOA 1M53A 5A2AA 2V67A 2OT0A 4BI6A 3W6MA 1UMLA 2E77A 1Q3NA 5KITA 3STCA 1LTDA 3UR8A 4L4LA 1ZZMA 4GWEA 3NM3A 4LBSA 2Z7GA 4OBSA 2OYMA 1XD0A 5DT7A 4DO6A 4PUUA 2J7FA 3LS9A 3NQBA 5AOUA 2G0WA 1VBJA 3VNKA 1F4HA 2WMJA 4Y8FA 1ADDA 2DY3A 4HZ7A 1OFBA 3FJLA 5H8PA 2YA2A 1WKEA 2JEPA 3D47A 3CTLA 3S5SA 2YW3A 4AUBA 1XLJA 4AIBA 1E6NA 1U5JA 2Z24A 3WMCA 5A2CA 5E0CA 1FDZA 4A3QA 3ANVA 1UB3A 2REQB 1EO7A 2VD8A 1K03A 1OC5A 1S5MA 2EPHA 4U28A 1ME8A 2Q8ZA 4AZCA 1JQVA 4KCVA 2PDJA 1PHQA 3HMJG 4NG3A 5CPMA 3BAIA 3A12A 3K8MA 4A3RA 3CH0A 5F1VA 1F7BA 6TAAA 3ITLA 4JYDA 4LTSA 4AHOA 2IMRA 3NL5A 4RX0A 5D8WA 1PHWA 4IQJA 1QI0A 2NXGA 1PB0A 4WRHA 4AQLA 4F0HA 1V03A 4MHBA 2ONEA 3WQEA 1C7TA 4ZZ9A 4YIWA 3GTHA 2Y5JA 3ABXA 5HULA 3W82A 4GLEA 1LBLA 4F0LA 3RCYA 3IUDA 1ITQA 2OZ8A 3GS6A 4HMCA 2DW6A 2WVSA 3GM8A 3GUWA 5E1QA 1FFRA 3KZPA 4MWAA 2HK0A 3CV6A 4CNSA 1GYNA 2GUUA 3WDRA 3P2VA 1U1HA 1M68A 1NU5A 2ZTKA 1KLZA 3HG5A 5C9RA 3LCLA 2ISDA 3BVJA 3CHEA 5CGTA 5HA7A 1FUYA 4IP4A 4KPLA 4HCDA 2BVTA 3B40A 3W27A 4M8UA 3A4JA 4DWDA 1U5VA 4MM1A 1MEHA 1T99A 3G8EA 3NQCA 4ZE4A 1EDQA 1GQKA 1A5BA 2GUYA 1QDSA 1UJPA 3LNPA 5LNWA 3ARRA 3EX1A 1TE6A 3UPBA 1MUCA 3A3XA 4PTMA 5D03A 2Y8UA 2ZX5A 3R4IA 1G69A 1KA9F 4P7OA 1BG9A 4MPKA 4B4HA 2NLYA 4Z2LA 3GVRA 3OHMB 3PZ9A 2ZX8A 1JPDX 1XCFA 4US6A 3W7MA 3GR4A 2C79A 2WZIA 1VD6A 1FFQA 2ZZ7A 2J8TA 1GGOA 1DPMA 4NJKA 2XFRA 4ZQCA 4X2PA 3CUZA 4LYRA 4LU0A 3UZ5A 2C71A 5CC5A 2P3EA 1GORA 3FVMA 5B80A 3MSGA 5FOOA 3QLDA 1LL7A 4O1FA 3CQKA 3W2LA 4BA0A 1VPXA 4GO9A 2PTZA 2G37A 2OX1A 4GZ7A 3EA2A 5FJRA 2ZUVA 4FO4A 2XGZA 4PCPA 4D71A 2V5DA 1P0DA 3GFXA 2BNJA 3P93A 4YHGA 3BJTA 3UCDA 3CL8A 4M7SA 1FX6A 2XVGA 1J18A 2VL4A 1TWZA 5ECUA 2CCRA 4KCWA 3KW3A 1R2RA 4LT9A 3PJTA 4W4QA 4QNEA 3P8JA 4K36A 4XD3A 3NQMA 3RILA 2D0HA 4N9EA 4XZHA 1PKLA 3AU6A 4FF5A 4OOUA 1M7OA 3KTXA 2XIBA 3AHVA 1XIMA 4O4WA 2PS2A 3ABOA 4L56A 4PN2A 4O13A 4GKTA 3UCQA 1VBGA 4F0RA 4CQ9A 3TSBA 2QVNA 1CYGA 3W1RA 3FAWA 3HOJA 4MMWA 4QG8A 3AZSA 2YL5A 2OGJA 2OLSA 3VUPA 4QXIA 1K7XA 3EA1A 4WIWA 4EWND 3TJLA 4XD5A 5E0FA 4XIAA 4GI6A 5LNRA 2YCKX 4AXNA 3BAWA 3EB3A 3MO7A 4A29A 4AEEA 2X30A 3EWXA 1JF5A 3EEZA 3AYVA 1UD4A 3AJXA 3H55A 4JHMA 2AOSA 4MJ4A 4DUWA 4NASA 1QRQA 3AYRA 5G5IA 1OFAA 4Q4QA 4PMJA 2WNNA 1PZ2A 3VGEA 3S6TA 1MQQA 4AHPA 1C93A 3C2EA 2VJXA 4IJRA 1MSSA 4C1NB 4HMNA 4WOZA 3HF3A 4WKAA 3T8LA 1Y0EA 2HS6A 3U6WA 5F1UA 4EF8A 3MMDA 1UKOA 4D1JA 2Z1SA 1CIUA 2PZNA 2ZVRA 1ZQ5A 1RJRA 3VYLA 3PFRA 4RZ4A 1H7XA 2PDBA 2IPWA 3VIMA 2Z7KA 4DYEA 1C7SA 2PAJA 3M41A 3E2VA 1N8FA 3MKCA 4M5PA 4GH1A 3T78A 3LCWA 3HMCA 1AUSL 4OWGA 1IEWA 3PAOA 1W54A 1RJPA 2BHYA 3B0PA 2EJAA 3SADA 1TJ2A 1EH9A 4LH8A 3MI6A 1ZLPA 3PUGA 4N9DA 3WH5A 2NWSA 3N3TA 4RUBA 3P7YA 5CSUA 4IQLA 1QATA 2PRHA 4FPSA 4Z2JA 3QPEA 2VGGA 3C8NA 5BRPA 1X98A 4CNTA 3OOQA 3F2DA 1UOKA 3AS1A 1PX3A 2VFHA 4LAMA 3B9AA 1XHGA 4OFCA 2ZICA 1IE7C 3RR1A 4Q8OA 3N4EA 1SW0A 3TLQA 1UHVA 4IGMA 2GUBA 1EQCA 5HATA 3TE9A 3KCLA 2ZWZA 5AHIA 4GUIA 1ENUA 2PF8A 2P0OA 5LYRA 5JUVA 3MUZ1 5A6MA 2PI6A 5IDIA 1VYSX 3OLDA 1L6FA 3WLJA 4KGJA 1J8VA 3I6TA 4HSOA 4R9XA 2FFCA 3Q67A 1JZ6A 1C91A 2ZWYA 5I3GA 4LS2A 3VE9A 4I5XA 1F4AA 2WKJA 3ZQ9A 3L4TA 5G2HA 1XH1A 2QAPA 3ZR5A 2ON3A 1XUUA 3VA8A 1TYGA 3STEA 3ERPA 3UY8A 3B06A 3AALA 2A85A 4K37A 3U4FA 3BG5A 4WQ6A 5DQPA 3S47A 4NQ1A 4ORMA 4YTSA 1H7PA 1IWAA 1OCJA 1BKSA 3BV7A 1RPXA 4TVUA 1UZDA 2WHLA 5AYIA 3FYOA 2Q6ZA 1UYQA 4NHVA 3AISA 3NQAA 3P60A 5FF7A 1OFEA 3VD4A 3GH4A 4N4QA 3I6RA 1AZ1A 5E6ZA 4CVWA 3SCSA 1Q8AA 1E73M 3ZJKA 4YU1A 1HJQA 3MP3A 3MO4A 5BXRA 3KP0A 1O60A 4QP0A 3O0KA 2HPMA 1WZKA 3BMVA 4ZQNA 4D6FA 5HK4A 3QJAA 3QQ0A 2XTKA 2JGQA 3AIUA 4DJDC 4LVGA 4AEOA 2FIQA 3EYPA 3TIMA 5JBFA 5CH9A 4PB5A 1NJJA 3AS2A 3IJ9A 4LCSA 3QY7A 3T2PA 3V3WA 4IMDA 3T4WA 3DENA 3JU2A 3CAWA 3QLLA 4NYUA 4NZCA 4ZFMA 2YCLA 3PP7A 1BXCA 2CU0A 3WQVA 1ZBCA 4AZ7A 5KZMA 4DBWA 4XZMX 3OZPA 2A0NA 2G8ZA 1Q13A 2GVYA 2FH6A 1SO4A 3TCSA 4F79A 3TU9A 3TUUA 8CGTA 1XCXA 4LALA 3OP2A 1N2VA 2VZSA 1OZMA 4HA1A 3UYIA 3O1NA 3P5YA 1W9BM 2PLKA 5TIMA 1K8CA 3VC6A 4PSPA 1KTBA 2YCJA 3MW7A 4EKJA 4JKMA 2I56A 1I75A 3VM5A 4BJHA 4C60A 3IRDA 4CQCA 3HA1A 4D6GA 4W93A 4JTUA 1QPKA 2QLYA 4JQ1A 3ZSSA 1EGVA 3W4RA 1EJ7L 1XIHA 2QJIA 2QEZA 3WZ0E 4AW7A 3M47A 3S2CA 1DKWA 1DXEA 2QXWA 1OBAA 3TJXA 1G7VA 1YHTA 1Q7QA 3B3DA 4C1LA 1KQZA 3KRUA 3SUTA 2AQWA 3S2NA 3OEXA 1GEQA 4AZCB 4EIVA 2XU2A 3WLHA 4O8RA 3IVTA 3FFSA 5DBTA 3VDAA 2FTYA 2P0IA 1OFDA 2Z6JA 2OCZA 1DTNA 3WQ8A 1QR7A 4C5ZA 4AXKA 3HJZA 4GD0A 1QPRA 2Y61A 2ZZ2A 4W8LA 2CLHA 4GIRA 2CHNA 2YL9A 3MS8A 1YDOA 1VYRA 3CV7A 3CV2A 1E0WA 8XIMA 1TZ7A 3L2LA 1OGSA 2ZUMA 3DFSA 1Y5VA 5I3HA 1K7FA 1ZP3A 3NL6A 2YA1A 4DWSC 1VFFA 1KCKA 3WQ5A 4G5DA 5HANA 2MANA 2O9OA 1UR4A 2PB1A 1J2BA 2ZUUA 4MWAB 5FF4A 4GQBA 2BMBA 2QAFA 5BROA 4NNAA 4ICCX 1FWEC 3MSRA 5D8ZA 5E6YA 4CNPA 1EJWC 3LBOA 1PDYA 1Q7MA 3NSNA 2ALDA 3RMEA 4XIMA 2J62A 5FF3A 3ZWSA 2V81A 4PMDA 1EGZA 4LC8A 2IKGA 4V1XA 3UG4A 5IRPA 2XDFA 4R27A 1YNYA 1S46A 1UG6A 3HV9A 2EKGA 4H7CA 4DUOA 1R6WA 3WLKX 5LIYX 3NQ6A 1NF0A 3PTKA 1V6XA 4YS1A 1LUCA 1W1YA 4PMZA 2ZUNA 3BLPX 2OZ3A 1LT7A 5I3FA 2FZMA 4GFSA 4QJ1A 3ES7A 1FBAA 1ME9A 3GKFA 3TDFA 1MZHA 4PCTA 5IBXC 1FDJA 3GR7A 1S39A 3B8UA 2FJUB 1R3WA 4JIRA 4UBPC 1BYCA 3BAXA 4NYYA 4NZFA 4R85A 2PBOA 3NQGA 1PIIA 4PCSA 3UP8A 4UC5A 1T6MA 4L1WA 3N17A 2ZRYA 3M0VA 1OJXA 4B16A 3KBSA 1O94A 1R2TA 2ZE3A 1REQA 2WSKA 4BWLA 3O3RA 2BB0A 3GWQA 1QNPA 5CZSA 1A5CA 1RP9A 5M1TA 1B5TA 5FSEC 4WZHA 2QJMA 1OSEA 4DLFA 3SN1A 1V3KA 4C5YA 4B92A 1XP3A 3ISIX 5I0DA 3T55A 4QSHA 1Z9AA 1V02A 4JTJA 3GIPA 3W87A 4DJDA 1AH4A 4LV9A 2DUXA 3SDOA 4RZBA 3N29A 5DCDA 3BAJA 2FLIA 5C9ZA 2WPGA 2EAWA 5CZJA 1F76A 2VX6A 3BUVA 3K8LA 1HL9A 1UKTA 2QV4A 4YTUA 3S83A 3SCOA 5FACA 1F6YA 4UIOA 2Y7EA 3YPIA 1BYDA 1CXHA 2VX5A 3GBDA 2H3BA 3KAOA 3LHVA 4J1OA 4EAMA 3FSUA 3V0SA 1NAL1 4GFIA 5FL1A 2ATMA 3GFYA 4DM1A 2CKRA 3K1GA 2ZXDA 3NQVA 5HWNA 5JMUA 1WKDA 1Q6OA 2GDQA 3MSDA 4BEQA 1A5AA 2J25A 3SRFA 5IFTA 1JFXA 3H22A 3QR0A 4H7ZA 3H4XA 3WH7A 3DI0A 5E0KA 2INFA 2EPOA 3TFXA 3PBWA 2NUWA 4FNUA 2YX0A 1XC6A 1EC8A 3KOZA 1MI3A 3C4UA 5HPCA 3N2XA 3ALFA 4TX9A 2QZRA 4XTIA 3TP4A 3CWHA 4MNLA 2PDHA 1QU4A 4TMBA 3ARQA 4BS0A 3RNDA 1JD7A 3CB3A 2C8NA 3TC7A 4XSLA 3AFBA 2YCIX 3JZUA 1DJQA 4W88A 2E9MA 3ZZ1A 3QHOA 3TN5A 5K7JA 3VXGA 1YEYA 3CHFA 4IM4A 1O5QA 2ATSA 1W1ZA 2D3NA 3RN6A 6PTDA 3NL3A 4H8UA 3NQFA 1EOMA 3B8IA 4NZ1A 3FV9A 4W7VA 5HOSA 1OZQA 3E2SA 3QMSA 4ZE5A 1XM3A 3PR2A 1TPFA 2PWUA 1EDTA 2WZMA 1A5KC 1VAHA 4DWSA 5IHRA 1VC4A 1E6PA 3LPPA 3OODA 1YTKA 5EMLA 3OBEA 3FNDA 4DM2A 1KKOA 2ZVIA 2DQXA 1PCKA 3GXIA 3H12A 1AH0A 2OSYA 2FHBA 4DJFC 1EZWA 3QR1A 2BG5A 4A22A 2PEVA 4BF5A 1Z3NA 3MDUA 2V6AA 1BGGA 4DZAA 2A3CA 4AZHA 3SCQA 2E9LA 4JTHA 3R8GA 2GZXA 3UNDA 5CC7A 2HBXA 3T1GA 1GOOA 2KZHA 1K9FA 1OQFA 7REQA 4RXGA 1L0PA 2ABBA 3C8FA 4EPEC 5K9CA 3N18A 3V35A 3F5LA 3L7RA 3GYCA 1LBFA 5H8MA 4FHAA 5IBXA 4C1KA 4CQAA 2FVMA 2BODX 3R8HA 4UWMA 3EKGA 4HNNA 9XIAA 3PG8A 1US3A 3DYOA 1SFSA 3IVSA 6XIAA 2TSYA 3WFAA 4IIFA 5G4WA 1EWEA 3NOEA 3BLKA 1FXQA 2QUTA 4GINA 4DPQA 3P3BA 3G3DA 2ZUSA 1TE1A 2J74A 1VFUA 2IQTA 2JKEA 3BLEA 3CUJA 2ZTJA 4A3UA 1GJUA 3GHUA 2PCQA 1QVBA 2R91A 3LI0A 3TAOA 1TTQA 3APGA 3VGDA 2RH9A 2GSJA 4W8BA 2CZFA 3AMCA 5M2FX 1XLAA 5D9PA 1NOFA 2A79A 3WBAA 5CPSA 2BXZA 3QOMA 2F2KA 1DJIA 3KOFA 2J9ZA 2XGBA 1VFTA 4HU3A 1V51A 2VEKA 1A3HA 5KEZA 3TKFA 2R1LA 1KM5A 4O14A 3VIHA 4AD5A 2I57A 2NQ9A 2GPTA 4XAPA 2YCLB 4WSKA 2BVWA 1OFRA 3B4YA 5EFDA 2P10A 2RFGA 4LUYA 1E9ZB 2H8XA 4WJ8A 1D7KA 3VPLA 1C8QA 1H49A 3E0LA 2OYLA 1ADOA 4MZ8A 2XWEA 3IGSA 4YTTA 1J0YA 4BI5A 1UH3A 1ZUAX 2WWDA 2BXYA 2YXOA 2YGYA 2FZBA 3C2VA 3SAZA 4ATLA 4LY8A 1B9BA 5T8GA 2EPKX 2V3DA 1PCWA 1SJAA 4B2DA 1THFD 3SQLA 3WF2A 2FTWA 3C86A 2CYGA 2HTMA 1TCDA 1CT5A 5ABFA 2DZWA 8TIMA 3FEQA 5EBUA 1B3VA 1W3KA 3KOWA 4FX7A 3C6CA 5J5RA 3K30A 2NV2A 3B03A 2BZNA 4IMGA 2YKKA 1NP2A 1YTEA 3N4AA 1UR1A 5LXXA 4UQAA 4XUYA 1XS2A 3G1VA 3UG3A 4I8DA 4Z1BA 1T0OA 4QJ3B 2J88A 1XGZA 1WUFA 4TQTA 4CKQA 2TRSA 5I02A 2Y88A 3LQLA 1QNOA 1NM9A 1WDSA 4B91A 1PYFA 1TR1A 3GXPA 4F48A 3UU0A 2HXTA 3IJIA 4UB9A 5CPOA 2YXGA 4GACA 1JZ8A 4P8VA 5GJPA 1EHAA 2BFGA 1TJPA 1IT7A 1ITCA 4HNLA 3PPFA 4W86A 3WBXA 5AC5A 1MW0A 3AIVA 3NDYA 1ZBVA 2DFAA 1J5TA 1E6SM 4LPCA 3QY8A 4U10A 2E6AA 3LHYA 1I60A 4XAGA 1BD0A 4MFDA 5AHNA 1PE1A 2IXVA 1O5RA 1TR9A 4K8EA 4A05A 4KW2A 4G1NA 1OWQA 1HL8A 1JAEA 4JZ5A 3UR2A 1NWTA 1VJIA 4FIRA 1EL3A 2Z4GA 4GUGA 1AMKA 4RNHA 3W0KA 3LRKA 1YKWA 3ARSA 2Q09A 4JKLA 3PY2A 3WMBA 4TU1A 1B4EA 2FGZA 1Y65A 4X9SA 4NF7A 1LUCB 3XISA 2VEIA 1EBHA 3W85A 3I7QA 4JAWA 1IEVA 1E43A 4IX0A 1XG4A 4XISA 2BLEA 1O7AA 1DHKA 1T40A 3NEHA 3HPSA 1F8IA 4OT7A 1J96A 2Y5SA 4UNIA 3VKAA 4LYPA 3W83A 3SN4A 3AU2A 3F5KA 5FKYA 5GQBA 3UWQA 4CVUA 4MVAA 5CBIA 1D7FA 3TW7A 3NXFA 1IT8A 2BV9A 3G0UA 4PMXA 3Q65A 4YL2A 3TA6A 1REQB 3T2OA 1UR0A 5FEPA 2B0MA 3N1AA 4IF2A 4I9MA 2CHRA 3SFWA 2WZTA 1GVQA 3LSCA 1JL8A 1XLCA 1RVGA 4K39A 2ZYFA 3ARXA 1F61A 5C9WA 3ZJ7A 3IJ6A 4OUIA 5FSDC 4OZOA 4QX4A 2VZUA 3TNOA 4A2SA 3GHTA 2QCLA 3W2KA 2XUCA 3IV3A 3NDOA 1UR8A 2D3LA 5I24A 4MJMA 3IS4A 1ISVA 4FA3A 4CCEA 4L6OA 3W38A 1XPYA 4NZJA 4PE8A 1GPWA 2YZRA 4P61A 4UNKA 4UOZA 3DHDA 3TC3A 4TV5A 3OQ8A 1E3XA 4H4IA 1KNWA 4XZNX 1FWTA 3GVWA 3TN3A 5DY3A 3G18A 2PGEA 2A7NA 4JYEA 5LIWX 1R87A 1EEXA 3EOEA 5DO8A 3USBA 1TELA 4XB3A 5EY5A 1PS9A 4IPLA 4KT2A 1MNZA 2E6YA 3T08A 1TWDA 4KH2A 1QBAA 3W7QA 4QRNA 1PSCA 2ZRZA 2ACUA 1E4IA 3TLLA 4MB4A 3IIOA 3G0XA 3ZR6A 6A3HA 1NELA 3GD6A 3CMGA 3LGEA 1E1FA 1WNOA 4N4PA 3M0KA 4CUCA 1W9VA 4Y96A 1EBGA 1J0KA 1GG0A 4UTMA 3AXIA 3MANA 5D04C 2VNCA 1JQXA 3CUGA 2XISA 3RRXA 3WH6A 1XV8A 3BQ5A 3BAYA 4XKMA 4IIHA 3DCPA 3K13A 4C6MA 4U3CA 4L9ZA 3WLTA 3P5ZA 4GGHA 3W6YA 4W5UA 4UR8A 1Y5XA 1O1ZA 1FH7A 3MBFA 5F4SA 1RV8A 4RE3A 1MXDA 4S3DA 3INPA 1RK6A 3CPUA 1I1WA 3KBWA 1D8WA 4PUMA 1HZYA 3UXAA 3E02A 2WJDA 3W2JA 3KXQA 2ZDRA 1GHSA 2QHAA 3TH6A 1B54A 1RBAA 4AH7A 3N2CA 4XAZA 1E55A 1F07A 2X16A 3HGOA 4DRSA 4JQ3A 1J12A 1QW8A 4E4PA 3WO8A 4A8NA 1JFHA 6XIMA 4HPGA 1P0NA 4RZ6A 4ROPA 4DWSB 2MNRA 3V5CA 1TZZA 3OPSA 4ZOEA 1E6XM 4FAMA 2W9MA 2O9PA 1DQWA 4S3JA 1CGWA 4URIA 4V33A 1TQJA 3CAKA 3T0TA 3BSHA 3FDGA 3WH8A 1HKIA 3QRHA 4HBKA 4KMQA 3WNMA 4L6DA 5LGZA 4IUOA 4BFAA 1I1XA 3PJUA 4XZIA 2RAGA 3NURA 1B30A 3NA8A 4GI9A 1FWBC 3FCPA 3P14A 1B57A 4IIGA 3SGUA 3BCDA 7REQB 5IXEA 4MZYA 2VC9A 1E15A 3MP5A 3ABZA 4IGSA 3R43A 4GVHA 2C16A 3E5PA 4GQQA 5EBAA 4NJGA 4UR9A 1V6VA 2DVXA 1H09A 1F74A 4BR1A 2E4TA 3OLIA 1PVNA 4ZEPA 2AMGA 2AKMA 2V5CA 4HVXA 4JDBA 1EA0A 3R58A 3RLGA 2VRKA 3LD5A 3EWUA 1ZALA 3WK2A 3AWNA 4MYAA 2WSPA 2XN0A 3BAKA 4K1GA 1WQ5A 1TSIA 4B3KA 5G1YA 1EYWA 1UWQA 3LN3A 3RGTA 4AZIA 2JE8A 2QULA 2XH0A 2DUAA 1TPB1 4TMCA 2UBPC 2BY0A 2POTA 3UZWA 2IXUA 4JTQA 3WDHA 1TTPA 2DVUA 3VNZA 3MTWA 2JKAA 2J9XA 3GTNA 2AGKA 3SCRA 4U5IA 2Y24A 4ZOAA 1Q63A 1UA3A 1K7EA 4M24A 1NDZA 1TJRA 3W29A 2PGRA 3WL0A 5AB3A 3AXKA 2R1PA 4HB7A 4MY8A 1IHIA 4JOMA 3W84A 2B7QA 4CU8A 1AL7A 4QAWA 1VLIA 4PRRA 3QV7A 3TXVA 1OK6A 3BJFA 4RLIA 2FPYA 3M64A 3M0HA 5D2XA 4UQ9A 1BYAA 1W32A 4IX2A 2ZQ0A 3AS0A 3O2LA 2OQLA 4DUXA 4MZ1A 2G5WA 4C6IA 1ITXA 3OYZA 4GNKB 5CJMA 1FCBA 1RSCA 5A8MA 1DJWA 1UKQA 4H2HA 4IXXA 3C52A 3QBUA 5ABFB 1KRBC 3CNYA 3S1WA 1IT0A 3HBLA 4OGZA 2A3HA 3OO2A 1D3GA 3VKJA 2G96A 1H1ZA 4NZ4A 3QMRA 3U0HA 3WBEA 3DUGA 1A53A 2DSKA 2Q02A 3AOFA 3PVFA 1KW1A 1CTNA 1W5PA 2PGFA 4H19A 1QI2A 1RLCL 2NW0A 1EXPA 3BXWA 5AHEA 2YFNA 3LU2A 4O54A 4TVDA 5CJ5A 3F2CA 2VM8A 4ZR8A 1IGWA 4JFVA 2CC0A 4GMEA 1H3GA 3ZYZA 4D2JA 1KFEA 1OCQA 3VKCA 5BW6A 1DQXA 3HPZA 1BGAA 3AO0A 2QCNA 4PUNA 1SO3A 1C8XA 4JKKA 4XSMA 2JBMA 2RGLA 2D1ZA 5FJJA 1HVXA 4I8YA 1QNRA 1VBUA 3V4BA 4BF7A 4IPPA 4N9BA 3TVAA 2BGNE 4M19A 1K1DA 1FHUA 4XK2A 4XTDA 5JU6A 1GVFA 1OABA 2NX9A 1BPLB 1C8VA 3LMYA 4JCLA 4NJIA 4M6VA 2Y6ZA 2A4AA 2PP0A 2A2IA 2A3EA 3CHVA 1XYMA 3W23A 3DHUA 4RE2A 1PL9A 1AODA 3RHGA 2PDNA 1LYXA 3AICA 4QR6A 4CCDA 5AYXA 1AL8A 5D30A 3W7JA 1LLOA 2VC5A 1NVMA 4QE1A 1DXFA 4XZWA 1OIFA 1R9XA 1C9WA 4ZB5A 2QJJA 3LCFA 4RZ5A 4RNJA 3RJYA 4K38A 4L7ZA 1PTDA 5CAHA 4O1AA 2CBVA 1EHNA 1EPVA 3UWVA 2AL1A 4WY0A 2FYMA 4DJED 1UP3A 1A5UA 4KCTA 1UIOA 3CASA 5DMLA 4BK9A 4UMCA 5HQEA 3W2NA 1K8YA 4L9YA 1I2QA 2QDGA 2WQPA 3PWGA 2PTXA 3W28A 4O17A 4FEZA 4J7RA 3THDA 3VIPA 2B4GA 1WXJA 3ONBA 1LORA 3TQPA 3CO4A 3B0UX 3TYZA 1E0VA 4EK7A 1XIIA 1VJSA 2PSNA 3V16A 4M0XA 4HNTA 3STFA 2VVNA 3KCJA 1XI3A 1PUDA 1V3MA 4LV4A 3WH9A 3CWOX 1JCYA 4UZUA 2PURA 1QWKA 1XLKA 1TVNA 5DBUA 3CGTA 3K4WA 5I09A 1YMYA 4AZGA 2VKZG 1SFTA 2VC6A 1RCQA 4H3DA 3B04A 3QW3A 2PF0A 4XBJA 4ML4A 3PSWA 2CEQA 1IYXA 3ARYA 3OG2A 3L4VA 3CMFA 1DJHA 4MKVA 3VCNA 3O0FA 4AVOA 2J47A 3LBCA 4HSNA 3TTQA 1KM2A 3I7SA 3MZNA 4REQA 3SRKA 3VILA 1UZHA 1XYCA 4YCOA 2CITA 3ITYA 5CKSA 1IXQA 1R3TA 1V0LA 1VQTA 4LB4A 2X7VA 3TMQA 3R0DA 3UQNA 2Q3OA 2X05A 5EMMA 3WQWA 3WDPP 3A13A 3FXYA 3BWWA 3NQ2A 5DEZA 3FHAA 1G67A 1O4UA 3IIZA 4LYQA 1N8WA 2WW5A 1M65A 1JPHA 4UTTC 3WSUA 3P81A 2X7WA 3H7VA 1TMQA 3M43A 1XF0A 3UD6A 2Z1BA 4J40A 1GNXA 3WD2A 1CGTA 4DNHA 3C56A 4IJBA 4JN7A 3UNTA 3VGGA 1NWRA 1EJUC 1Z41A 1E9IA 1KCLA 4UNLA 1D3CA 4ASTA 1ZAHA 3NPUA 2F2HA 1DIEA 1IWBA 5FAGA 1PX8A 4G7FA 1UD5A 3JRKA 2E09A 4YN5A 3HB9A 3UETA 3PUOA 2HBVA 3ELFA 4ZB2A 3D0CA 2VGFA 4JTKA 3WJXA 1Z42A 3WD3A 4JIHA 3WD1A 1D9EA 3S6DA 1UR2A 1LBMA 3S8HA 4DBUA 2WHJA 3LB0A 2YIHA 2P53A 3GTIA 3TOPA 2PWEA 4ONVA 1JUEA 5K9XA 5GNYA 5LIKX 5BOFA 1EA9C 2HXUA 2FJKA 4RK8A 5C6MA 4HK5A 2Q3RA 4GJ1A 5CQ1A 2VR5A 4MSSA 2V63A 4Q6JA 5I5RA 4N02A 1PTGA 2BVDA 1W3NA 3WJZA 2Z29A 5D2WA 3RIKA 1VCFA 3OYXA 1KRMA 4AVNA 2V5KA 2Z1KA 3U3HA 5D2YA 4A3HA 3ABSA 1XKJA 5I3DA 3WF0A 3IV8A 4DBSA 1GOWA 3VD7A 2INEA 1O95A 3W7KA 1OCBA 4GXPA 3H24A 2NSXA 1RY0A 4ZO6A 4LRTA 4KWOA 1VFMA 2PZ0A 3GH7A 1LWHA 1JF6A 2Q01A 1JGMA 5AN7A 3W7LA 4W87A 1OX4A 4GX8A 2JIWA 2XWDA 3MBDA 2BDQA 1JRBA 1FWRA 3BGGA 3GTFA 3ITVA 7PTDA 1Q7ZA 2OEJA 4KRZA 1R3VA 4NXKA 1J01A 4M3PA 5HPOA 3O7UA 5BZAA 2ZRWA 2VUNA 3VMPA 3W1XA 2P50A 2VOMA 1FWWA 2G3FA 1V8EA 3MUY1 4DN1A 3E38A 1AZ2A 1GEHA 2CPUA 4DO7A 4KGLA 4C6JA 1T5AA 3MV11 1G5AA 3RFAA 4JFTA 3D5HA 3F4NA 1TMHA 3EA3A 3OW1A 4F9JA 4QS6A 3EWCA 1UH2A 2QIIA 2W91A 3C5QA 4AD1A 4AIUA 4AD2A 2QVHA 2V0TA 3N9RA 1UJQA 4JR5A 1EUNA 5HUPA 4WR3A 4B3LA 2HDJA 2WKLA 3H2AA 3R0UA 2BOGX 1HJVA 5FJPA 1E5JA 1FVPA 4GC3A 3IEBA 4HK7A 4MWAD 2HVNA 4E6MA 2YA0A 4ZO9A 4F0MA 3EEGA 3F1QA 3TQKA 5M5DA 4R5EA 3CXOA 3T07A 1I8JA 3SUUA 2YB4A 4XQ6A 2OZTA 3O6DA 4KS0A 3VNIA 4NZ3A 4FX6M 2WMIA 1HT6A 3TZFA 5FCZA 4E0CA 4YVPA 1WKYA 2DZSA 2WOQA 1JYNA 4AWTA 4JTDA 3FYPA 3SUVA 4EANA 3EX2A 4V15A 3EMZA 3F7JA 4DI9A 3A47A 2HJPA 3ATZA 2W61A 3CS2A 4L80A 1KM1A 1JUKA 2YDAA 3EKZA 1F2JA 5K2ZA 2VEFA 5JH2A 3G0SA 4QITA 1PKNA 1R9YA 3FY1A 1YRRA 4MIMA 3VOGA 3U57A 3QSRA 2OSWA 3TQVA 5EU9A 3STPA 5DMYA 1E71M 9RUBA 2HRWA 4UTTA 4YTQA 1R7OA 1R3SA 2GJXA 1H7RA 1DWFM 4HMDA 2PWDA 4MLRA 2V38A 3G3MA 2O56A 1LLZA 1SJCA 2NZLA 2X09A 3UXDA 1HO1A 4P7QA 3GBEA 2CBIA 3KEHA 2ZOXA 1LQ0A 2RKXA 1I2RA 1GOMA 2NXHA 2XINA 4GKLA 4Y9NA 1DP0A 4J27A 3W22A 3OVQA 4S23A 2D69A 4BCEA 4LOCA 1O6IA 3PANA 3N6JA 1DJGA 3EWYA 4TX6A 1L2UA 4WDTA 4U4MA 1AW2A 1E40A 3OA5A 3AUOA 3UBPC 5CAKA 3GZ3A 1TWSA 2XG9A 1JZ5A 1J5SA 1R3QA 3W1QA 1ECEA 5D4YA 4DEFA 4MY9A 1AD1A 4JX6A 3LYEA 2WYSA 1R47A 4GJIA 3GU9A 3A4WA 1XIGA 3JUGA 4ATDA 2OLHA 5C2GA 1W1PA 1CB7B 3EXRA 4HPXA 3KL3A 1K02A 2O9TA 1QPNA 1WUEA 1WOAA 1A0CA 3EWWA 1JAKA 3MCMA 2X8RA 2WMHA 2ZZ3A 5AECA 1OYBA 1UKSA 3KLKA 1RLDA 2W79A 4JFSA 4LAKA 5A69A 2Y4SA 3ZFHA 3P74A 1WXZA 4PTDA 3O15A 1W5OA 4TTUA 4YYFA 4RDYA 1N7KA 4AZ5A 2WZEA 1UD2A 1U2YA 5CPQA 4YHEA 3DC8A 2RDWA 4PUWA 3WUBA 3VDCA 3SUWA 2F84A 3R12A 3GHSA 1KM4A 4WY0B 3QW4B 3W07A 2PTWA 1SZGA 3OGRA 1OGBA 1XX1A 1QOPA 1LRNA 1O5XA 1BWVA 4J5NA 4W8AA 5FF0A 4E2DA 2EPMX 3DH7A 2BTMA 2D22A 5LKYA 3TTSA 1MUWA 3F4CA 3TK7A 3GSMA 3H2MA 4ZOCA 4AC7C 2P8BA 1UQZA 1ONXA 4NT0A 3NVTA 5GNZA 4QCFA 3NGJA 3LSBA 4MOZA 5AC8A 3H8AA 4HA4A 3UXIA 2BXVA 3GNNA 2QYGA 3VINA 1SGJA 1US0A 1DJNA 5G4EA 3LXCA 2VHLA 4M56A 4LAOA 4YVXA 1CECA 1PO9A 4IGHA 3M0MA 3THAA 5BXPA 5DANA 1FWFC 2C7FA 2L5HA 3C2RA 4FLQA 5B7YA 5A6TC 3FGCA 1VRXA 1E4LA 1ZHAA 4IMCA 1H7OA 1FHDA 3O07A 3JR2A 3Q94A 4W5ZA 2V5BA 1W1A1 2IS7A 1IXPA 1E51A 3FKRA 2ZA1A 2J7EA 1G6CA 1S2CA 1RBLA 4ACZB 3V0TA 4IG2A 2BGSA 2HVMA 4I6KA 4UFLA 1DWJM 3MJMA 4UZSA 3TAKA 1I4NA 2AMXA 5JIPA 1BSLA 1QK0A 3NG3A 4V1YA 4FIQA 4REQB 1CXFA 2IKJA 8XIAA 3DKJA 3QEZA 1W37A 3B4UA 1EJSC 4HGXA 1B1YA 1CZ1A 1K4GA 3TROA 1XLEA 1DWIM 1PIFA 1XBYA 5C7VA 3SJNA 3M5VA 3TW6A 3OGSA 1MXGA 3ARTA 3E49A 4E2VA 4ZBCA 3KCOA 2CIPA 1BRLA 1CXKA 1U30A 2NSOA 4LEQA 1CDGA 3W86A 4GVGA 2XN2A 4NJHA 3DOPA 1JPKA 3L0NA 8A3HA 4L64A 4YXGA 3C0LA 1PTAA 1W2VA 5CLWA 1Z44A 4ZENA 1JDCA 2PDYA 3B0YA 2EO7A 2FGBA 1XSIA 3MI2A 1R46A 2HWGA 4QCEA 2HPIA 5CSSA 2J6VA 4I3GA 3I3DA 2YLLA 1W1B1 3WL1A 4F2TA 5A94A 4E3TA 1FWAC 5FJIA 1XYLA 1J6OA 4DYJA 2ZC8A 3EBVA 3A9IA 4C6FA 4NX5A 2CZ5A 4RE4A 3WEZA 4DO4A 4ERAA 2ZRUA 4DF2A 1XLHA 1Y8BA 2XM1A 3UG5A 3O8AA 5CLTA 2X1TA 3C2YA 2EEXA 4UTHA 2KX9A 1NARA 2R1MA 4HOZA 4H8HA 4ECLA 1WBHA 3ZLHA 4WKHA 2DPEA 4UCFA 3OIHA 1S38A 4YCPA 3WLIA 1G4EA 3WKZA 4P8XA 3DFTA 3ZXWA 4NU7A 5I06A 2YDRA 1N82A 3APTA 3ZO9A 1AQ0A 2DSUA 4LAZA 1AVAA 1K8XA 4KETA 4O4VA 1B31A 3WNOA 1JCTA 2QJHA 3SQMA 3OLEA 5IHSA 4W84A 3GR8A 2WC4A 1V79A 4ICMA 1EUAA 3RO8A 2D2GA 1YDYA 3NJ3A 1VJZA 3SCTA 4XVDA 3UWZA 3GG1A 3DBNA 3E6EA 1FP9A 4LUTA 2I9UA 4YJ5A 1SSGA 4P2VA 2ISVA 2ZADA 2OEMA 3AQUA 5AVNA 5F2IA 1DJYA 2WWCA 3D46A 1JEZA 3VNJA 1GW1A 2GVLA 2ZZ6A 4O19A 3D3FA 1AMYA 7TAAA 5CGQA 1AFSA 4IL0A 3DECA 1OX4B 2XIIA 1EPXA 2YFOA 2Z28A 3AMLA 3SCPA 2WMFA 3EPNA 3W1PA 1OGGA 1Q6CA 1AJ0A 1AQMA 3CT7A 4QGCA 3RPDA 3EOOA 3L5AA 1QOXA 5C2CA 1QNQA 3I7RA 4XVEA 1MFUA 1WCGA 3S46A 4RPQA 5A8GA 4ES4A 2PODA 3VFLA 3DYMA 1MW1A 5TD4A 1FCUA 3A22A 4OTKA 4DY1A 4B15A 1RP8A 3ME3A 2CLPA 4WOQA 3VAVA 4A8RA 1DOSA 2OT1A 4WF7A 5E9AA 3T0BA 1QAPA 4Y90A 2A5HA 4TOQA 3GFZA 1P48A 1JNDA 2WXDM 4EX4A 3MKVA 4W7UA 4LF2A 3BCJA 1OYCA 3UA4A 2V30A 1EOKA 3WELA 4C65A 2E1DA 4ZA0A 1HL2A 3EXSA 2QCDA 4GUFA 3TN6A 1CLKA 4MAZA 3R2GA 3CAVA 1U83A 3BW3A 1TMLA 4Q7NA 4J3SA 1RK5A 5I78A 1R2SA 4RW5A 2ZDSA 1HW6A 5RUBA 1T8XA 1OFOA 3DDMA 1WV2A 5L9FA 1P5BA 1XLLA 3LRMA 3CM4A 4M81A 4J4KA 1EF2A 5M17A 1PZ0A 4CQBA 3OZMA 1ZFJA 3BARA 1U1JA 3LX9A 4US5A 3EWZA 1RCXB 1AW1A 2WMIB 5HMSA 2PRMA 1QW7A 2TODA 5A2BA 4CD6A 4B90A 3M7WA 2ACSA 4QM1A 3DERA 1P6CA 3AIBA 1G7UA 2DZAA 5EB8A 1JI2A 2E67A 3SSZA 2GOUA 9XIMA 3EMCA 4LF1A 4MKNA 4C6LA 4O11A 4KWUA 3WLLA 2W0UA 4BKNA 1S5TA 4GISA 1KFLA 3BLLA 4G2DA 4CLMA 3DFPA 1ZSXA 3MHGA 3CC1A 3W01A 3ARUA 1F3EA 1TA3A 1ISWA 2WSQA 2IPJA 1SMAA 2GJXB 4KFOA 3E2RA 3WN6A 3RM8A 3G1RA 2GJNA 4D6EA 4IJCA 4WUIA 3TV8A 3CEUA 3T42A 3LCHA 3FK4A 3ZLFA 1H5YA 3DHPA 3FVDA 4PODA 1ZP4A 5LGXA 5BWFA 4HZ6A 4H7VA 1UROA 4HYRA 4FXRA 3URBA 4D72A 4H9TA 2DV0A 3H4WA 2WCGA 3U2ZA 1KLYA 1H0GA 4KIRA 3OIXA 3IARA 3FHQA 4UFKA 2E25A 3T40A 4DJDD 2WM1A 2JF6A 4RPPA 3SRHA 3W1MA 4PMNA 1M03A 2DJXA 3KS6A 2C1IA 3QTGA 5IFPA 4EOUA 1TJ0A 2FVLA 2E6FA 2WMGA 2WM0A 2EHHA 2VTFA 2IKIA 3GNXA 4QS5A 3VI2A 1TPUA 3UFYA 1SYTA 4TV6A 1YBQA 3RMJA 4S3AA 5CCZA 1VH7A 4OU1A 2X1IA 4NKCA 4Q8TA 2P3ZA 4QE5A 3S0CA 5REQA 1ELSA 3TZNA 4XG1A 5BU6A 3RO6A 4EPKA 3I10A 3RM4A 1LZOA 3M0XA 2VENA 1W3LA 3WLOA 1JZ2A 4PH6A 1SQ7A 4O50A 2QGHA 5LXEA 3B8VA 3V75A 2EKCA 3MQTA 3AMDA 3AXMA 3W7PA 4UTLA 3QSTA 4R88A 1W91A 5GJMA 2WMKA 3UJRA 5AYYA 2QW5A 4NY2A 2NV9A 3WD0A 2X0SA 2NQHA 3PBVA 6CGTA 1BWLA 4GQGA 4PTNA 3UR5A 4CD4A 1YXYA 1DORA 4FLOA 2CXEA 4UTIA 3OJGA 4FR1A 3ZIZA 2YSWA 3W7DA 1W3TA 1UZ4A 3REQA 3OTRA 5T26A 2PUZA 4U2ZA 2Y0FA 2QJGA 2HS8A 2I7GA 3T0CA 2B81A 5AY7A 5AZ0A 3N9SA 4LS1A 1R7AA 5HWJA 1TVLA 4XUGA 2OO0A 3GDRA 3KTCA 2VEPA 3I65A 3M5YA 4HJWA 2VC7A 1IEXA 3IIPA 3L5LA 3UERA 4XX6A 4AD3A 1TRDA 2YYTA 1I0DA 4KF1A 1WPCA 3FGCB 2J6XA 1LM1A 3FS2A 4DWSD 1NWSA 1OC7A 1TV8A 4MF4A 4ZCWA 3AWOA 2OWWA 4JIEA 3VDGA 3JS3A 1GTEA 1SFLA 1PWLA 1UASA 3M07A 4O1CA 4AEFA 1OM0A 1GQJA 3FXGA 4IG2B 3S2JA 2XFYA 4QTGA 1F73A 1OVDA 5H1WA 1DL3A 4RE0A 3L68A 1X38A 1GVYA 1HX0A 2X2GA 2FVKA 2Z1XA 3ZWTA 1IIHA 3NQ8A 2PE4A 3VZYA 3DG3A 1JCMP 4KEMA 3B9EA 2H6RA 1ZB5A 4H9YA 1ZBKA 4NXSA 1RQBA 2CETA 3ORWA 1W1VA 4RW3A 4U31A 2WBKA 4B5VA 3EOSA 2PDUA 3WFZA 4FXSA 4BHYA 3E0WA 4Q8PA 1V7YA 3A64A 1JXJA 2AQVA 2DZTA 3WQGA 4WD0A 4KWWA 1BRLB 2Y7DA 3QXBA 1ICPA 1CXLA 1KKRA 5JH1A 4Z08A 3E12A 2PBGA 3E3HA 3U8GA 2NQJA 3RK8A 1LCOA 2GWGA 3G1HA 4QDMA 3DG6A 4AF0A 5I3IA 3PBMA 1Q6GA 3U5UA 4UR7A 5HUOA 4DLMA 3V1HA 3QPYA 4WX2A 1L2QA 3PB0A 4F66A 1UMYA 3FDKA 4Q8VA 4QLLA 1BQGA 4NZ5A 2OJPA 1JDAA 1GKQA 2BP1A 1YPFA 5D33A 3I3EA 4L6HA 2Q8LA 3QC3A 3UF9A 2UWFA 2DQWA 4FI4A 4RXFA 3OG3A 2PDLA 1IEQA 3KOXA 3I6EA 4P8UA 4O53A 3CTTA 4DZHA 1OHLA 1UIPA 3P61A 3THCA 2GGHA 3URQA 2OZ0A 4F4RA 4HU8A 1YTDA 2OQHA 4Z2IA 2OX4A 4H8VA 2F6KA 4JQ4A 1XLFA 1JZ3A 3GAKA 3NZRA 1UBSA 1KWGA 3W70A 4BQ3A 4JGDA 2CLFA 2J24A 3FJNA 3TTYA 4FS9A 4DNMA 3QV6A 4UMAA 3G8RA 1ODZA 4K1WA 2VFFA 3MSYA 1XG3A 4KQNA 4X2RA 2Z0IA 1JG9A 2XPKA 4LCRA 4YWSA 1DYSA 4C91A 4LUTB 3DXIA 1FWNA 1FHVA 4E8GA 1J9YA 4BEUA 1MRQA 2CBUA 2DDXA 1P1XA 1M7PA 2CLEA 4DO5A 3PB2A 3SN0A 3NIYA 1KQYA 5LHEA 1W3HA 4GPNA 3R8RA 3QFWA 1RD6A 1XBVA 1ICSA 1QI4A 1EO5A 1TWWA 1JYXA 2C1HA 2H90A 1SVDA 3GU1A 4LNYA 3S1XA 3M6DA 2OQYA 1OT1A 2V5JA 1EDGA 1SZNA 4DHGA 3GW3A 2IW0A 4HPHA 4IH3A 1JUBA 4Z2KA 5EGRA 5FF2A 4E4UA 2ACRA 3GG0A 4KCUA 2PCEA 2ANUA 2X0YA 3KX6A 1IIGA 4WLCA 2WNZA 5KINA 5FD0A 5DMMA 1W8GA 2G50A 2P76A 1KFWA 1GCYA 4BF9A 1W56A 2DZBA 2VDIA 4WDUA 2LLEA 4IFRA 4PUDA 1NFBA 4IXHA 9CGTA 4IICA 3WQDA 4XZBA 7TIMA 2E8YA 2Z26A 3SUSA 4GYPC 1XQLA 1MZRA 3HQOA 1VENA 1QPOA 3NPXA 2PD5A 2QKFA 3S1GA 3ZT6A 4D6IA 5CG0A 3QMTA 4TX8A 3HU7A 1HTIA 4BWLC 2QCDB 1L8NA 2VD9A 4H00A 4QJ5B 1ZRQA 1SW3A 4JNZA 3O6AA 3FA4A 3O9NA 2ISSA 5BWAA 3BDKA 4A4AA 2GGJA 3TTEA 4NAFA 1QHOA 2PMQA 2HCVA 5D38A 4DJFD 2V3EA 3DZ1A 4HCLA 3CQ0A 1YLVA 4MDOA 1UW9A 3TYAA 3A23A 1C90A 2QMKA 3S9YA 1I45A 3GDLA 4M80A 4W89A 3G2GA 4JTRA 3WQ6A 3GC5A 3QGKC 3TXZA 3PPCA 2PWHA 3NQDA 4JY9A 3F03K 1XGEA 1OEPA 3CPRA 1ZJAA 3FYYA 1UH4A 2VR2A 1HF6A 3ANYA 4ZMGA 4AYGA 1HKJA 4PBFA 4OV4A 3S5ZA 3VNDA 3PNUA 5D9MA 2VX7A 3Q2DA 1JZ4A 3WLQA 3WY1A 4AMCA 1GOXA 3G1DA 1JRCA 4IHCA 1B3YA 3A6OA 1EYEA 3RDKA 4V2XA 1TA3B 1A47A 3PG9A 3AMKA 1Y7VA 2O9RA 4HA3A 3UYCA 1L6WA 3VZZA 3RITA 2WVUA 3MPGA 2H3DA 5DX7A 3MVIA 4LSBA 1TV3A 1ZS2A 3GHRA 2XZ9A 4MTVA 2WJFA 1XRSA 4XAYA 1XH2A 4MJZA 2W67A 2QJNA 2E3ZA 3LI1A 2XVNA 3G77A 2WVVA 2GQAA 1NTHA 1HXJA 1K3UA 3A3WA 4DELA 3PK7A 3TYEA 2ESCA 2PP3A 4FR6A 2ZXQA 1OY0A 2HK1A 1UUQA 1CEOA 4HPJA 3L0GA 3RUBL 2DZPA 1JYVA 4OUEA 5FEWA 4PTVA 2FMOA 4AY7A 1W5NA 4K8GA 4QSFA 2PFHA 1W9PA 4IL2A 3SJ3A 1HVQA 1Q6RA 3DFYA 5A5WA 3W6LA 3N3MA 5GNXA 3CHDA 2X41A 3LLFA 4PCFA 1PKYA 4CQ8A 1VFSA 4EPBC 2XIMA 3UJSA 2OELA 2PDIA 1X1OA 4M7TA 2EXOA 1E9LA 1NP0A 3L2IA 2OWCA 1K6WA 3O63A 1UZ1A 5CEWA 1V6TA 4CN4A 1PZ3A 1KRAC 2C15A 4X3ZA 1WYIA 2YW4A 1BF2A 4JX4A 3UR7A 4Z2GA 1YBQB 1QO2A 3UJ2A 3EDDA 4I9JA 4EWJA 2EGZA 3W1LA 3W02A 2D0GA 1Q6DA 3GUGA 3NCOA 5CG7A 3J7HA 4KEZA 4PRTA 1L9WA 3VDHA 4DZIA 1XL9A 1DE5A 5REQB 3V1PA 4C6KA 2OEKA 1H1NA 1B3ZA 1S2VA 2JEQA 2DSZA 4RJEA 1FRBA 1HJXA 2FPTA 2OMAA 4RDVA 3CUFA 1TV4A 1I2NA 5EMKA 1NF7A 4MJ2A 3M0ZA 1J0HA 2QPUA 1YQ2A 4HD5A 3M7SA 4XD6A 4JFUA 1Q45A 4WCJA 4HNCA 5HR6A 2CKSA 4RNIA 5C55A 1V3HA 1HIZA 5HQLA 5HJXA 1ZAIA 4LAUA 3PN8A 4MY1A 3S1UA 3UWYA 2PLMA