3CB8A

4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
244
structure length
244
Chain Sequence
VIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyruvate formate-lyase 1-activating enzyme
publication title Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 82
structure length 244
sequence length 244
ec nomenclature ec 1.97.1.4: [Formate-C-acetyltransferase]-activating enzyme.
pdb deposition date 2008-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF13353 Fer4_12 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3cb8A00
4R53A 1SFJA 2CLOA 3UZ5A 2X1RA 4LS0A 1XKYA 3QZEA 2Y61A 2CWNA 3O05A 1O95A 1OYAA 2NXGA 4KFNA 5D32A 2QR6A 3F4WA 4LUIA 3Q94A 5FEPA 3KXQA 4HNNA 5AYXA 3VE9A 1K02A 4UTTC 4BWLA 1QPNA 2Y7GA 5AHIA 4O19A 5AC7A 3B05A 4POCA 2YYTA 3C56A 3ZS4A 5DCBA 1ICQA 3I68A 3SI9A 4ORIA 5CSRA 4MPQA 2FLIA 4IPIA 2GVLA 4G1KA 3WJYA 3EKLA 3SZ8A 3KHJA 3QMRA 1T99A 1OYCA 2C1HA 3TUUA 1FUYA 4Q4KA 4RJEA 3FYOA 5DCDA 3DFOA 2BZNA 1VYPX 4O1CA 4WJEA 3E0IA 4AH7A 1LOLA 4N9BA 1YTDA 3OVRA 1KFJA 1QR7A 3UWZA 1YPIA 3LHZA 3GR8A 1W0MA 5FF2A 1DHPA 1PS9A 1VS1A 3C6CA 4JN6A 4WXYA 2J27A 3OIXA 1RZMA 3UNDA 3N9SA 1BWLA 1H7PA 3GDLA 2BSLA 3G1HA 1KFLA 4R34A 1FWWA 1RR2A 5D2TA 4CQAA 4ADTA 5BRBA 8TIMA 1C8VA 2VFHA 1GVRA 3NL3A 1SW3A 5KTLA 4WOZA 4D2JA 3H55A 4UTWC 1QOQA 4MIMA 1S5TA 4CQ9A 4RR4A 2VEKA 3CU2A 3NR0A 1JJKA 4EF8A 4XWUA 1GQNA 1I4NA 4MLJA 1EIXA 3HB9A 2YPIA 1VYSX 4O50A 4JYEA 1N7KA 3S1UA 4H4IA 3NM1A 1OX6A 3W6YA 3BW3A 3HG2A 1Q6OA 3M43A 4NXKA 3GDRA 3JS3A 2OJPA 2EPHA 4NJHA 4JEQA 4YCOA 4AMAA 4HIBA 3W1PA 1M7OA 3L65A 4E2DA 5K2ZA 3SSJA 2R91A 3CPRA 1Z48A 1GTEA 5FEWA 1DORA 2CFFA 4PL2A 4QJ1A 3O1NA 1G67A 3LOTA 5E0KA 1RPXA 1GYLA 2LLEA 1OVDA 1SZEA 2PC4A 5I3JA 1GWJA 1XFBA 3ABQA 3G1VA 4ORMA 1YXDA 4Z1BA 4O0KA 3OVQA 5T26A 3GIYA 4OHQA 3L5AA 3W23A 3CEUA 1XC4A 1Z41A 3QEZA 3L21A 4A2RA 5K9XA 1TQXA 4I7UA 6TIMA 2XN0A 1A5SA 4BFAA 4HNVA 1MEWA 5AHNA 2V9DA 2RFGA 4MKNA 2HMCA 3UYCA 5FI8A 1WOAA 2E6YA 4R7JA 3W1XA 1VPXA 3QH2A 3JRKA 1FWNA 1F5ZA 3EX3A 3FS2A 2VEPA 4IX2A 3C3NA 2O7QA 5L6UA 4O28A 4LUJA 3EB2A 4KFPA 3PVFA 4UFJA 1UBSA 4CQ8A 3W7RA 2ZZ4A 1R2TA 2CLLA 2ATSA 1KM4A 2C16A 3NQCA 4HT3A 3QQ1A 1P1XA 1OF8A 3GK0A 3MYPA 2FFCA 4LNYA 2NV1A 3UWVA 2QDGA 5CSSA 4RZ4A 3W71A 4JTGA 2WJZA 4RXGA 1DJNA 3WK3A 4UTUA 3TAKA 3HGOA 4JDBA 3PAJA 4O11A 3YPIA 2AAMA 1WYIA 3KRZA 1B4KA 4FO4A 4ZQCA 1SQ7A 4RKAA 4JICA 2DZVA 3LBCA 1QPRA 3ELFA 4YLWA 1YYAA 3A21A 3C52A 4M7TA 4XTDA 2W6RA 4NNBA 1J5TA 3K30A 4QISA 2EHHA 1X7FA 2JBMA 3LXCA 3P81A 3N14A 3T4CA 3TMLA 4DPQA 2Y62A 1TRIA 3R12A 4NZJA 1LBFA 3NQEA 4I7VA 4JTTA 4GXMA 5SWUA 4IWWA 5C55A 4FIRA 5LNSA 2C3ZA 1G6CA 2YFOA 4N9DA 1VHCA 3W83A 1D9EA 3QSRA 1IXNA 4IPJA 1JCJA 3SGUA 5EY5A 1KV8A 3LHVA 3W70A 3IIPA 3SFKA 2TMDA 2BTMA 2ZRZA 2B7NA 3TQVA 1UCWA 2DJXA 4K6AA 5EKYA 3ATYA 4OE7A 5CPMA 1XBYA 3PB0A 3QF0A 3RF9A 2YW4A 3S1WA 4K36A 3WK0A 5FEZA 4JD4A 1G4PA 2Y88A 1I2QA 1K7XA 1TPVA 3T7VA 5G4EA 2YSWA 1I2PA 2ZZ5A 4GRSA 2ZZ6A 3R13A 3Q2DA 3WK2A 3IEBA 3HO8A 2WNZA 5AHLA 5IBXC 3P80A 4ML9A 4HSOA 1O5XA 4IMEA 3O15A 4UR8A 5I3GA 5CPLA 2VFEA 3OVPA 3CM4A 4L4LA 1LOSA 4E38A 1JRCA 1W56A 4OV9A 5J5RA 4RZ5A 3PBWA 1W37A 2VENA 5EL1A 5F4XA 1QAPA 3P7YA 3FEMA 2E1DA 5F2MA 4ZMGA 2QCFA 1OFBA 3R89A 3W7MA 2GPTA 3QSTA 1P0KA 3BV4A 5F2IA 1FWRA 4MUZA 2CZDA 1B57A 5KZMA 1ZAIA 4Z08A 2WSQA 1ZJIA 2Q3RA 2H8ZA 4A22A 1L6WA 1X1OA 1XDMA 4RLIA 5K7JA 3L2IA 2WPBA 4PFMA 5U7SA 4JYFA 4MYXA 1KTNA 3HPXA 3W7PA 3CHVA 1KTBA 2C6QA 3PF3A 5D37A 3LTYA 1Q45A 3G0XA 1DBTA 1PHWA 1IXQA 1TPDA 3EWYA 1VLWA 3I65A 2NZLA 4DXVA 2C14A 4TMCA 5FF7A 2CW6A 2C15A 3TCEA 3ZWTA 1LRQA 1LRNA 3T55A 3W1UA 1FXPA 1XUZA 2V81A 1XDLA 2DZXA 1W31A 3LGEA 1YADA 2C13A 4XZ9A 4UTIA 4OV4A 3CWNA 3NG3A 3W74A 2CLIA 1SUXA 4NJIA 1EUAA 1LP6A 3AJXA 3O6YX 2DORA 1EP3A 5D04C 4N9CA 1OFPA 2ABAA 4TU1A 4CCCA 1OJXA 3W7LA 1CI1A 3C0JA 3D0CA 3ZWSA 5CPNA 4FXSA 4TIMA 2ISSA 2HS8A 2ZZ3A 3G18A 4S2CA 1TPEA 3LERA 5DXXA 3EWBX 2YR1A 2QCMA 1FCBA 4X3ZA 4GC4A 2A85A 1M6JA 1TO3A 4O18A 3WJWA 4H3DA 4GUIA 1ZAHA 3NNTA 5E93A 3KVLA 3LM7A 2AQWA 3M6YA 2C18A 1R2RA 2RH9A 1H61A 3TU9A 1EP1A 3L66A 1SO6A 4E0CA 1TTPA 4HN4A 3LCXA 3S1VA 3W7JA 1KM0A 4DELA 3TE9A 1AL8A 4UFIA 4YL2A 3BLEA 4LS2A 3FA5A 2E68A 4GUHA 3LCGA 4B5NA 3FKRA 4DO5A 5G2IA 5F1UA 3BLIA 3W7KA 5HUPA 2V5LA 2E6AA 4RK8A 1EUNA 4Y90A 3CIWA 5BOOA 2FB3A 2WNNA 3IIVA 1W3IA 2G5WA 2WOQA 1PVNA 4NJGA 3M44A 3DU0A 2F7FA 1Q3NA 4JYDA 3GR7A 3BG3A 1LYXA 3NPWA 2A6LA 1TB3A 4UC5A 4QSHA 3UD6A 4R33A 3W72A 1NAL1 5H91A 3LTSA 1KLYA 2DP3A 5AHMA 3U8GA 5F4SA 1T96A 4JXCA 5D03A 1G4SA 1S5VA 1BTMA 2KZHA 3L0NA 4U4MA 1L6YA 4UFHA 4O1DA 3HGSA 1DQXA 1X1ZA 1YTEA 4HNTA 3BO9A 4IUOA 4OQVA 1GTHA 3INPA 3RFAA 2QCHA 3UPBA 4LC8A 4WD0A 1K7FA 1MEIA 4QAIA 3Q37A 4O16A 3S5OA 1M5WA 5DY2A 2DZUA 3W2MA 2V5BA 3TX9A 4RX0A 3N73A 4IXHA 5EYWA 2QCGA 3A23A 1UUMA 3MP3A 3EXTA 4YWIA 5CPOA 4O4VA 3STFA 3PC0A 5DBTA 2X1SA 2F84A 4NQ1A 4UIOA 3BK0A 3DZ1A 5HNRA 3P67A 1QO2A 1I2NA 5HWNA 1TTJA 3TQKA 4ALDA 5ABTA 1KM1A 2DJLA 1TV5A 1R30A 1VRDA 2G95A 1T0OA 3N9RA 1XL9A 2YZRA 3EWZA 3S5ZA 2A21A 3L9CA 3USBA 4XBSA 3P62A 3TA6A 5FF0A 4CCEA 3FJ6A 2ISWA 4O8RA 4N6FA 4JTUA 1WX0A 4IMGA 1AW1A 3EKZA 2W79A 2PRLA 2CLMA 3UWYA 4K39A 3WJXA 4O12A 3O8AA 3WJZA 3A9IA 1GYNA 3W75A 3HGJA 4BF9A 1A5BA 2VFGA 1P4CA 1P5BA 2JKAA 3GKFA 3G3DA 4RXFA 1FDJA 3TW7A 3TH6A 4FX8A 4HNUA 1JCYA 3QC3A 3TK7A 2H3BA 3MI2A 4ZZ9A 2ZA1A 2TYSA 4NZFA 1NSJA 3DGRA 3MBDA 1WBJA 1QPQA 3CEPA 3PUDA 4OBTA 3W2LA 3CWOX 4MOZA 1EEPA 3UZJA 1W3TA 3CT7A 3IIZA 3S8HA 5CZTA 1B9BA 4KKXA 1OX5A 1DKWA 2QJGA 4ICNA 3KVJA 3KRUA 1QOPA 1NFBA 2NX3A 2X2GA 3L5MA 5KZDA 3TC7A 2VELA 2NUWA 2B4GA 3IIXA 1EWDA 3BGJA 3TV8A 2PE4A 5EMUA 4DPPA 1XM3A 5I3IA 3NA8A 3S6DA 1I8JA 4LU0A 2E5DA 4UMAA 1PL9A 2J9ZA 3BPWA 4FIQA 4IMCA 2P0OA 2YCEA 3GYEA 4LY8A 2C19A 5AC6A 3QRHA 3EXRA 3RK8A 2DZSA 3KAOA 1LZOA 3M5ZA 3W1AA 4Y9AA 3A24A 4JS3A 1I45A 3DFSA 1EB3A 3O16A 1H51A 3W7GA 2ZDRA 1GVQA 2J9YA 2Y6ZA 1W5QA 1F74A 4AXKA 4PL1A 2QCNA 1P0NA 4O52A 3G0UA 3IV3A 3R2GA 5G1YA 1WBHA 1AW2A 2QCEA 5DELA 2X1TA 1HL2A 1GG0A 1KFCA 2FB2A 4K7VA 3PS7A 4WUIA 3TAOA 3W7EA 1OK6A 4HPJA 1G7VA 4N2YA 2BXVA 3S5NA 4K37A 3EWWA 3W85A 3G1AA 3W2JA 2ZYFA 2V8ZA 4RCXA 5LNVA 4MY8A 1K7EA 2E5CA 2GJLA 1SO4A 2BLEA 1RQHA 2ZZ1A 3IGSA 2WV8A 1ME7A 1GZGA 3PM6A 2CZEA 3Q58A 4NX0A 3LHWA 3TFXA 5BW6A 4W9TA 2A7PA 4LW7A 1F05A 2Q8LA 3STCA 3PULA 4AF0A 4WZHA 1H1ZA 4PH6A 5I3KA 3O06A 3FIGA 1VR6A 2R14A 4Z0JA 1YDOA 3KX6A 3ABOA 2ZA2A 1J2WA 3LI0A 3BG5A 4ZQMA 5G1TA 3ZFHA 2CLFA 3BVJA 3NQGA 3EWXA 2WSYA 3OEXA 4Z1CA 4TO8A 1KFBA 5G2HA 1WA3A 2V2HA 1W5OA 4IXXA 1TSIA 2I1OA 4AF0B 1S5WA 2QEZA 3VI2A 4O15A 2NLIA 3DFNA 1EX5A 3DI1A 2FIQA 3LHYA 1O4UA 4UUIA 3ANYA 5AOUA 3B8DA 2ZFAA 2WO5A 1FBAA 3GKAA 1A53A 3LCFA 3QQ0A 3W7IA 4MLRA 4ADUA 1F7BA 2ZBTA 4GE8A 5U4NA 3M1ZA 2RDTA 3W87A 1K3UA 2RHGA 5C6MA 3GXTA 4JTFA 1YDVA 2E09A 2EGZA 3DFPA 2ZTKA 4H6KA 1EA0A 3O6CA 3W7HA 3WJSA 5D2VA 5CKSA 4LV9A 3PY2A 3LLFA 3C2EA 3B0UX 3NZ1A 3W2NA 3PUOA 2GQ9A 1H60A 5EBUA 1VCFA 3IGXA 4LWWA 1W5PA 3DENA 1HTIA 5AYZA 4FX6M 1SO5A 4MFEA 4GUFA 4ADSA 2A4AA 1IIHA 2E5BA 5HWMA 4LS1A 4NU7A 5C2XA 4YXGA 2JKPA 1M7PA 3U6WA 2CZFA 1LRTA 4BK9A 1FCQA 1LTDA 4K8HA 1GVFA 2B7QA 4DO4A 2YXGA 5HULA 3MJYA 1DQWA 3DFQA 4QNEA 3G1YA 4I7WA 2Z6IA 1GT8A 3C8FA 3NOEA 2WKJA 2GUUA 4Z1DA 3HQ1A 5GVJA 3QPZA 3W1QA 3QPYA 2E6DA 2HSAA 3IVUA 3NPVA 4JX5A 2Q8ZA 2Z0IA 2PURA 1QFEA 1KBIA 3HGRA 4IQLA 3DAQA 4A2SA 4O13A 3LB0A 5A8GA 1LLWA 3HOJA 3C2OA 4Z1AA 1XBXA 1H5YA 3DI0A 3W73A 3LXBA 1W3NA 4FNTA 4WQ6A 3LCWA 1MSSA 2NXIA 1GOXA 3NGJA 3CQ0A 3A5FA 1DVJA 1A5AA 2B0MA 3SGZA 2EAWA 3F03K 2VC6A 2J88A 1HO4A 3MI6A 1JUEA 4MZ1A 5A5WA 4QITA 3TNOA 3IGUA 3TJLA 2EF9A 1QO5A 2VEIA 1W8SA 1SSGA 4LVAA 1U5JA 5IM51 5AC8A 4OU1A 1EP2A 5J5DA 1WQ5A 5D2YA 3NQDA 5TQLA 2B7PA 3QFEA 2GVJA 3QJAA 3T40A 3P5YA 2WSRA 4NJJA 3C4UA 4PEKA 4Y6GA 3E12A 4MJMA 1VHNA 1PCKA 4RZ6A 3TKFA 3MI3A 1JQXA 4NNCA 3NL6A 4IMFA 1YXCA 1I2OA 3BW4A 2Z2UA 1L6SA 1G69A 3HJZA 3P8IA 4GBUA 4DQWA 1KBJA 2QF7A 4JX4A 5CZJA 5DBUA 4O14A 4N4QA 5D33A 3TSBA 5K4ZA 4NVTA 1GG1A 2ALDA 1NF0A 4N02A 1ADOA 1W1ZA 4N6EA 1SR9A 3MYOA 1O5KA 4A21A 5K4XA 1GEQA 4K7YA 5C5YA 4NUWA 1ICSA 3PBUA 3CC1A 2GJNA 1JULA 4X22A 3LBMA 3EX2A 5LKYA 3PWAA 2Z6JA 1H1YA 2G96A 2J6XA 3H54A 2QJIA 3O6DA 1SW0A 1CX9A 4GNJA 2Y7FA 3WFAA 4MFDA 3NQFA 4NNAA 2QCCA 5DN1A 1VCGA 3EWUA 5KMYA 3TXVA 3C2RA 4CCDA 4AWUA 3GDMA 1Q6LA 4PODA 4BI7A 2WNQA 4J9JA 3MHFA 4S1FA 1K8XA 1JCXA 1TPH1 1THFD 1ZAJA 1UASA 2QAPA 3ATZA 3AO0A 3HPZA 4OT7A 1FY6A 1YLVA 1N55A 2A5HA 2FPYA 3DHFA 3IVTA 1SSDA 4JTIA 4IX0A 1GJPA 4O1BA 1TMHA 1OFEA 2YDAA 1LM1A 5HMSA 1U83A 3BARA 3G1XA 3GXNA 2VOMA 4UMCA 1K8ZA 4UTKA 1ICPA 5LNWA 2VEMA 4XQ6A 1PV8A 2A2IA 2CLKA 3GDKA 3HBLA 1VLIA 1XCFA 4HSNA 5K9DA 1ONRA 1QCWA 2J9XA 3VCRA 3G0SA 3L0KA 2QAFA 1FCVA 4N4PA 3A5VA 3W22A 3DFTA 3E9AA 4ZQPA 2FPTA 5FF3A 1TIMA 3VKJA 4IJBA 2H8XA 1FDYA 1J4EA 3LTPA 1DV7A 3SY5A 2H90A 4BWLC 2VFFA 4UNKA 3T78A 5BMXA 3P84A 1UB3A 2Q3OA 2YGYA 2Y70A 1RVGA 3FLUA 3MUXA 4QIUA 1W54A 1LBLA 2V2CA 3N34A 4CNPA 1G4TA 4WXZA 2ZRYA 1FDZA 1O60A 3B04A 3NQMA 4AHPA 3T44A 3B0PA 4JTLA 3KRSA 4UCGA 4CNOA 1CW2A 3M5VA 4GJ1A 2FTPA 3NQ7A 1N8FA 2Y89A 3GZ3A 5F2GA 4MY9A 1S3HA 1W5NA 1F6KA 3N3MA 1D3HA 4E2BA 1KW1A 3LV6A 5K9CA 2ISVA 1ME9A 5CZ0A 2P10A 4DBEA 3M0ZA 2FQIA 2ZRUA 5LZLA 4N9EA 4HKPA 2Y85A 3HPSA 2DZWA 2NUYA 1YPFA 2R8WA 5AHFA 5LNRA 3LHTA 1IIGA 3UXAA 3C61A 4BI6A 3LRMA 1OK4A 5LHEA 3M47A 1JCLA 2VXNA 3EX6A 1JUBA 2UV8G 2QCLA 3QYQA 2CLHA 2J24A 3IRDA 2ZCGA 2NV2A 1XBVA 1IXPA 2ZRXA 4QNWA 3NQ2A 3NL5A 3QM3A 4WY0A 2E6FA 5BNKA 5F2LA 3W7NA 2FJKA 3L67A 2PCQA 1MXSA 3E49A 2WQPA 1KLZA 4WOQA 2QJHA 3TFCA 1G7UA 3L68A 5DY3A 4O1AA 4MZYA 1B4EA 3THQA 1VCVA 4JTSA 3CTLA 2QCDA 3S9YA 4WY0B 5D05A 1KFKA 3B03A 3PSVA 3MBFA 3MW7A 1L9WA 1V7YA 4FEZA 3W7DA 3W88A 1KM3A 5LHFA 5L9FA 1F6PA 1JUKA 3G1SA 4XKYB 1SZNA 2JGYA 1OFAA 1RQEA 2X30A 4EVZA 3HIJA 2QCDB 2TPSA 4M6QA 1TPB1 1SZGA 3UXDA 3P74A 4ZQNA 4WY0F 3GDTA 4KFOA 4FF7A 4X2RA 3W1TA 2ABBA 3NM3A 3M41A 4NX5A 2Y7DA 2H3DA 3NQ8A 2HS6A 1Z44A 3RU6A 1TTIA 2C0AA 1JQVA 4IOTA 3GX9A 2CZ5A 1A5CA 3C2VA 4O4WA 1TREA 2FDSA 3LV5A 3ZR4A 1QWGA 5LNUA 4EWND 3LI1A 5DCEA 3O63A 4IGHA 2GQAA 1H7WA 2A7NA 4TX9A 4C1KA 4I9AA 3NPXA 1BWKA 2VFIA 2TSYA 3WK1A 1C9DA 3NVTA 5I3HA 2PRMA 2A0NA 2OX1A 4UFKA 4JTJA 1ZALA 3PSWA 3NO5A 5KSWA 1A50A 1ZFJA 3LXAA 2IQTA 1Z42A 4ONVA 4DBDA 2V82A 1LBMA 4HPXA 5D38A 2QUUA 4KWVA 3OBKA 3P8JA 1MO0A 3LX9A 2NX1A 4U28A 3G22A 4XTIA 2QDHA 4M19A 1IF2A 4NXSA 2RDWA 2PRHA 4DF2A 3B0VC 1RQBA 2X16A 1GPWA 1TPC1 1ZY9A 3TSDA 5FEXA 4MJZA 3W1RA 3DHDA 3HG3A 3V1PA 3W7QA 1MEHA 4S2BA 3P5ZA 4AVFA 3ABSA 4M6VA 3GAYA 1R2SA 4M5PA 5TIMA 4UTHA 6ALDA 1JR1A 1F2JA 2NWSA 3N19B 4AEOA 3GAKA 3H53A 1PE1A 3HF3A 3NYZA 2OCZA 1OF6A 2V2DA 2ZQ0A 1DL3A 1ZENA 3MO7A 1H7NA 5HQEA 4ZL1A 1YDNA 2A7RA 1ZHAA 1PCWA 1F73A 5AYYA 3S0CA 4FXRA 1HG3A 5CG7A 4FX7A 3M16A 5KZEA 2XN1A 3R5EA 3DKLA 2D73A 4BR1A 4MYAA 4FNUA 2XN2A 4ZQOA 1BKSA 4GUGA 1AG1O 1OX4A 3BG9A 4JGDA 7TIMA 1IGSA 3LRLA 2EKCA 5D30A 3CB8A 4ZVJA 3NQAA 4LVFA 1VYRA 4UTTA 1H7XA 1SZFA 4DEFA 1VH7A 4FHAA 3QW4B 3TC6A 3CIXA 3MP5A 4OWGA 3LDVA 3GXPA 3RMJA 4JTEA 4LV4A 2NWRA 1TPUA 1OX4B 3IVSA 1TJPA 3W1NA 5KINA 1NEYA 3PBVA 4HHPA 5HWJA 1OABA 3E02A 3PR2A 3SIZA 3W86A 3GB6A 4IMDA 4M6PA 3L5LA 4RV8A 1TJRA 1R46A 3KOFA 1FWSA 2Y7EA 1OYBA 1RV8A 3MHUA 4UNLA 3FFSA 1I2RA 3TIMA 5HR7A 1EWEA 1VJIA 2YFNA 1H7OA 1MZHA 1DJQA 1UJPA 2ZTJA 2VKZG 4EIVA 1JRBA 1WXJA 4UTLA 1HO1A 3W2UA 1FQ0A 3LCIA 4DF0A 1TV8A 4UTJA 4X9SA 4UTWA 1QNVA 1XXXA 3LCHA 1AMKA 3LCLA 1Q6QA 1LOQA 3TR2A 1LROA 3EXSA 4UMBA 3NQ6A 3FOKA 3UY7A 2W0UA 3W3OA 3DKJA 3U2OA 1JCMP 4FNPA 3W1LA 4AWSA 1KA9F 4WX2A 1H63A 4Q32A 2E77A 5F4WA 1TRDA 3TW6A 3W07A 4UFMA 1C29A 1GVOA 3SR7A 2OT0A 4O57A 3RLVA 1SFLA 3P61A 2QUTA 4A29A 2I14A 4LC6A 3N2MA 4QM1A 1LDCA 2JKEA 1SPQA 3NEVA 5MHBA 3W84A 4LRSA 4MZ8A 5AN7A 4LOCA 1Q6RA 1HUVA 4AWTA 1TV7A 4MVAA 2NX9A 5HUOA 4O53A 4JX6A 5K3VA 1FWTA 1FXQA 4JIPA 1HFBA 4LVGA 4JIQA 1QPOA 3FYPA 4PCFA 3OHIA 3F4NA 4EF9A 3QMSA 4EOUA 3IIOA 4FNRA 3SECA 3I7SA 3PG8A 3VFLA 2VFDA 3UWQA 3UWWA 5C54A 1KV5A 3FJLA 3TXZA 1TPWA 3DH7A 3NZRA 2ATMA 2BX7A 5I3FA 3UQNA 2DZPA 1TTQA 4TMBA 1VQTA 3KVMA 3M5XA 3GNNA 4AHOA 4UXDA 2B7OA 5EPDA 4TR9A 2Y63A 3S1XA 1KFEA 3G8EA 3HG5A 3TJXA 1H62A 2V30A 3HG4A 3RNDA 3MP4A 1R47A 3THAA 5G2WA 1GVSA 4O17A 5LGXA 3NPUA 1XI3A 4XBKA 3VE7A 1RD5A 2ZRVA 2CU0A 1F76A 4O10A 2A1YA 3P82A 2Z1BA 1PHQA 3C2FA 2I9EA 3QMTA 4YMZA 3JR2A 3EX4A 1ZCOA 5HR6A 3KFTA 1AL7A 1BEUA 5G5IA 2OMAA 1W5MA 4LRTA 4OGZA 3NDOA 1KM2A 1QMLA 1VC4A 3I7QA 3HMJG 2X1UA 4PC8A 1X8FA 1TYGA 1Y0EA 4JR5A 3EX1A 3B06A 5AFDA 5LSMA 2H6RA 4K8EA 1AW5A 1K8YA 3P60A 5CGQA 5DXYA 2TRSA 1ME8A 2ZZ7A 4ZQRA 2QKFA 4UFLA 3OG3A 4GUJA 4JY9A 1KTCA 1VZWA 1JCNA 3W1MA 2YYUA 2GVGA 5AB3A 1ZNNA 3SW6A 3TDFA 3LLDA 5AHEA 3W2KA 3MWAA 1B3OA 3LHUA 1O94A 4M7SA 3BLFA 3FKKA 1OG0A 3S42A 1WOBA 3GVGA 2HTMA 3ABRA 3M9YA 4PTNA 1SO3A 4FNQA 1IXOA 4GWEA 3N2XA 1OFRA 4Q33A 4AAJA 1WV2A 3NQVA 1LLZA 4XUGA 3STGA 3MHGA 4JNMA 2AGKA 3OA3A 1ALDA 5HJLA 2A6NA 1KM6A 1K03A 1G4EA 1SU5A 3I7RA 3NL2A 2YW3A 2V0TA 4MY1A 1AK5A 4A3UA 1LORA 1H7RA 3TSMA 5FF4A 3PG9A 1H50A 3TROA 1XBZA 5IBXA 5LGZA 2JGQA 2P1FA 3BGGA 2GOUA 4P61A 1V5XA 1XUUA 5D09A 3QW3A 1KM5A 4DO6A 2JK2A 3L0GA 2NUXA 5E1QA 3UPWA 4NJKA 1UUOA 5EA9A 3E96A 5DLCA 2BWGA 5CZSA 3G1FA 1YTKA 3G1DA 3GLCA 3I6RA 3S5YA 3M5YA 5FESA 2YX0A 3SJ3A 2CLEA 3LRKA 4UTMA 3TQ0A 3B4UA 4Y96A 1ML1A 3PBYA 4P2VA 4CNNA 1NVMA 4UR7A 3G24A 5H2ZA 4O54A 1QDSA 1E51A 4LVDA 4YCPA 1DOSA 4LT9A 1JVNA 4QQ3A 2OT1A 1OFDA 1EPXA 3NAVA 1D3GA 1VGAA 5D2WA 4GFSA 4K38A 1OFOA 4LVBA 4DF1A 2O7SA 3W9ZA 3MMTA 3NXFA 5F1VA 3R8RA 5G4WA 3VNDA 3PB2A 5KITA 4JTKA 2RKXA 3O07A 1OHLA 3A22A 2ZZ2A 3STEA 2QUVA 3KVKA 2OZ0A 3GNDA 4AHQA 3G8RA 5HINA 3EEGA 3W7CA 5TBOA 2ZA3A 5BMWA 3M7WA 1OFQA 4CLMA 4NT0A 4BI5A 1FX6A 2RDUA 3V75A 3RLUA 3BW2A 1FCUA 1PIIA 1T8XA 4PA8A 4JY8A 3DXIA 3W7OA 3UWUA 2DZTA 4JDYA 5D2XA 4KWWA 4XKYA 2G97A 3CLMA 3W76A 1NF7A 4C1LA 1TCDA 4FB7A 4JTHA 4AB4A 2R94A 4LTSA 3UY8A 2DU2A 3F1QA 3TMQA 2XFWA 4O0ZA 1SW7A 4Z0SA 2GQ8A 1YXYA 3G3MA 2ZRWA 1WDWA 3PUEA 4Y8FA 1L2UA 2FPVA 2NXHA 4L4MA 3DBPA 1TPFA 1WAUA 4FNSA 1X6UA 1LCOA 5D02A 1TQJA
chains in the Genus database with same CATH superfamily
1SFJA 2CLOA 4W8LA 1O7AA 9CGTA 2Y61A 4G7EA 4KFNA 4GVGA 1XLLA 5D9MA 4HNNA 3ZT5A 1EA9C 4IP4A 3FYYA 1QPNA 3GBEA 4QXIA 4H9YA 1WPCA 4PUKA 3ZS4A 1E40A 3MV01 3I68A 1KRAC 4MPQA 2FLIA 4IPIA 1B3WA 3WJYA 4U10A 2IXUA 3KHJA 1OYCA 2C1HA 4CU6A 1FUYA 5CJ5A 1LT8A 3VO0A 3A3WA 3K4DA 1FKXA 3E0IA 1DJWA 1GOQA 1YHTA 1LOLA 1YTDA 3OVRA 3UWZA 3WNOA 4IQEA 4IF2A 1W0MA 5G1MA 1M7JA 2J27A 1BYDA 3RDKA 1H7PA 4MUPA 3GDLA 1A0EA 5D2TA 3ZJ8A 4CQAA 2EG6A 4WOZA 4D6IA 3H55A 3O9NA 3TN5A 5M2FX 1S5TA 4CQ9A 1TV4A 2Q8XA 1NWRA 4EF8A 3EOSA 4XWUA 1GQNA 1I4NA 2GVEA 3AYRA 2H9AB 3BURA 2XVPA 1VYSX 1BAGA 3NWRA 4ZFMA 4QLKA 3A64A 1N7KA 1W3LA 4PN2A 1H4PA 2X8RA 2YCKX 2NQHA 3VKCA 3HG2A 4IJCA 3RX3A 3M43A 4IISA 3GDRA 3JS3A 4QDMA 2EPHA 1UWAA 1MFUA 2IQ0A 4AMAA 4B5TA 5AVHA 5K2ZA 4D8AA 4D6DA 4P5UA 1PZ0A 3O1NA 2E40A 1EF2A 1G67A 5E0KA 5ENLA 3UXLA 1GYLA 1OVDA 4WDXA 1SZEA 1FOBA 4BQ3A 5EMYA 2WM1A 3WQ8A 1Z9AA 1MRQA 3GIYA 4OHQA 1V6YA 3L5AA 3N11A 2GUYA 4DZAA 2C79A 3AISA 3MA8A 1XC4A 1IR2A 2F61A 3QEZA 4A2RA 5MKGA 4PSRA 1A5SA 3KEHA 4Y2WA 4GD0A 5AHNA 3GW3A 5D8ZA 4EPDC 2RFGA 2HMCA 3UYCA 1B3YA 3ISIX 2NT1A 3JRKA 3LBOA 1FWNA 1E4NA 1JDCA 5HANA 1V3HA 4UFJA 1UBSA 2P3ZA 1Q5MA 3TN4A 2SFPA 4HT3A 5C9WA 3NSXA 1QU4A 3MYPA 4LNYA 2NV1A 2QDGA 3WQGA 3AHZA 1GCYA 5CSSA 2XGIA 1UA3A 1W9DM 3VOIA 3GTNA 1DJNA 4UTUA 3TAKA 5CGMA 3ONCA 1IYXA 2V63A 4FO4A 4ZQCA 1SQ7A 4RKAA 4JICA 1XWYA 3ZR5A 1UKQA 3DG7A 3HMCA 1QPRA 4YLWA 1YYAA 1XINA 3C52A 4NNBA 2YA2A 1B3ZA 1X7FA 2EHHA 1HNYA 2JBMA 3LXCA 3T4CA 3TMLA 3RCYA 1I0DA 1TRIA 4GYPC 5JBDA 3HTWA 2PDGA 3GU9A 4IWWA 2PF0A 1Q63A 1CBGA 4G2DA 5LNSA 1G6CA 2Z1SA 1IT0A 3W83A 5C8BB 1NDWA 3TTYA 4EACA 5EY5A 1KV8A 2PGEA 3A47A 3LHVA 3W70A 4CNSA 3T0BA 1XLEA 3SFKA 2TMDA 1I75A 2B7NA 4K6AA 1VAHA 5CPMA 3PB0A 4G8TA 3QF0A 2P88A 1B0IA 3AJ7A 4K36A 3WK0A 1G4PA 1LF1A 3C5QA 1P0DA 3KP0A 3EOUA 2ZZ5A 1VFTA 3IEBA 2A3LA 5IBXC 3FXGA 3P80A 4HSOA 4ML9A 3CHDA 5I3GA 5CPLA 3R8GA 2VFEA 4DB7A 1QNQA 1R3RA 3IGHX 4RZ5A 4HA4A 5F4XA 3W53A 5E6ZA 1PTGA 3OQ8A 1E73M 5F2MA 2E1DA 3T2QA 3CUFA 2GPTA 1LL6A 3QSTA 1P0KA 4J40A 4MUZA 1M68A 4KW2A 1M01A 3G6MA 4HOWA 4W7WA 1CTNA 1X98A 1XDMA 3V0UA 1RPKA 4RLIA 2BASA 5U7SA 2O56A 4MYXA 3HPXA 1QW9A 3KTCA 4RNFA 3CHVA 4GO9A 2Y8KA 2C6QA 3K4WA 3LTYA 4P7QA 5HPCA 2I9UA 1PIFA 1TPDA 1IXQA 3KE0A 3I65A 3HFYA 1XISA 2CW6A 1ZBCA 3VM5A 2C15A 1XSJA 3U3HA 1LRNA 3COTA 3AHVA 3NCOA 1FXPA 1S2AA 3W1UA 1IR1A 3VIHA 2DZXA 1EGZA 4ES4A 1R87A 3LM3A 4UTIA 3CWNA 4G7FA 2WMIB 1R3QA 3H8AA 2WC3A 2FZ8A 5D04C 4N9CA 2ABAA 3JW7A 2WCAA 3C0JA 3ZWSA 4TIMA 4LF1A 2CCRA 3VIPA 5A94A 1KGWA 5I23A 3EWBX 5IDIA 2ANUA 5CLWA 4X3ZA 1LWIA 4GC4A 1UZ1A 5D9NA 3WJWA 4H3DA 4GUIA 3AQUA 1ZAHA 1UD5A 3DEQA 1OCQA 1M53A 1J0IA 3LM7A 2AQWA 3M6YA 2IW0A 4WLCA 1R2RA 3ARRA 4AZ7A 2TODA 2GZXA 3L66A 3AIEA 1XLBA 2YCLB 1K9TA 1DXFA 3QLLA 1KM0A 3R0DA 4GZ7A 3G2GA 1DWHM 1GZJA 4AIOA 2BY0A 2HXUA 4B5NA 3UEQA 1HL8A 1KR0A 1PTAA 5H6HA 4J7RA 3W81A 4B2DA 2V5LA 2OKTA 2WWDA 2WW5A 3U57A 1EUNA 5BOOA 2FB3A 1X8CA 3UERA 3IIVA 1A5UA 2WOQA 4HA0A 1PVNA 3WF0A 4NJGA 2FTWA 4D1IA 1Q3NA 2GGGA 3GR7A 2I5QA 3BG3A 1LYXA 3CS2A 1V0NA 3OIHA 4CVWA 1GHSA 1TB3A 5FJPA 5C9RA 1NAL1 3LTSA 1OGGA 5AZ0A 3TOYA 4IPLA 3IJDA 1Q4WA 5D03A 3H6OA 1BTMA 2XJ7A 1AUSL 4UFHA 3IJQA 1ISVA 3F2CA 1O5RA 2FVLA 2VD9A 3ITXA 4OQVA 4WJ8A 3AIBA 2QCHA 4P8VA 5I79A 4PUEA 4K2SA 3WZ0E 4JQ2A 3WNPA 2C0HA 4GQRA 2O92A 1EHNA 1PWLA 4J3WA 4R5EA 4B9ZA 5CPOA 4O4VA 3STFA 3PC0A 2VHLA 4UIOA 4NQ1A 1CGTA 4DBUA 1IT8A 5HWNA 1TTJA 1KM1A 4LUSA 4PMNA 1TV5A 1T0OA 1XL9A 4Y9NA 3S5ZA 2A21A 3NZGA 3BAXA 2ISWA 4YTSA 1AW1A 2CLMA 2YA0A 3UWYA 4B16A 3CZGA 3WQCA 1CNVA 3A9IA 3RLGA 4L9ZA 1P5BA 3QZ6A 4Q6JA 3G3DA 1FDJA 1XIEA 1JCYA 3QC3A 2H3BA 2ZA1A 1UP0A 4NZFA 1WBJA 2XIIA 2DSWA 3ITYA 2Z29A 3W2LA 4XSMA 3CWOX 3WBXA 1IWBA 1EEPA 3OHMB 1QNRA 1W3TA 6TAAA 3ABZA 3CT7A 4ROQA 1JGMA 4HU3A 1A3WA 3KBNA 2C1GA 3KVJA 4W88A 1NFBA 3L5MA 1TA3B 1AJ2A 1EWDA 4C7DA 4DPPA 1XM3A 1OZQA 1J11A 3NA8A 1I8JA 1ISWA 2PBGA 4LU0A 1PBGA 1AZ1A 4QE5A 2E5DA 4UMAA 3UR7A 2J9ZA 3VZZA 4UQAA 4AX6A 2YCEA 1SR0A 5LA0A 3GFZA 3RK8A 5HMDA 2DZSA 3GXMA 4PTWA 5HMEA 3IV8A 4A8RA 2J9YA 2Z7GA 2BHUA 1XH1A 3GC2A 1P0NA 1F9CA 3G0UA 2ZXDA 1JNDA 2QCEA 5DELA 4M80A 4K7VA 3PS7A 1PSCA 4HPJA 4N2YA 1T5AA 5DRCA 3W85A 3G1AA 2V8ZA 2ZWZA 4LYKA 4MY8A 2E5CA 3OU8A 1SO4A 2BLEA 3CUHA 5CSYA 3CYVA 3ITGA 3IGSA 3GW0A 3N2CA 1ME7A 1GZGA 3PM6A 4L9YA 1TJ2A 1TVLA 4C91A 5CXPA 1GQKA 3TFXA 5BW6A 2A7PA 3STCA 2P3EA 2G4JA 1LWJA 1Y5VA 3FIGA 3KX6A 1WKEA 1GQIA 5LIXX 1Q13A 1UR1A 1JGIA 1KCXA 3BG5A 4ZQMA 3ZFHA 2WSYA 6XIAA 3OEXA 1DE6A 4S3CA 5EB8A 1W5OA 4JIIX 4AF0B 3BMVA 4O15A 1JXJA 4Z2IA 2NLIA 1EX5A 1UR3M 4KGLA 2ZC1A 4OKDA 1EIBA 2Q71A 4JL1A 4W4QA 2V3EA 4YN5A 3KBMA 2EG7A 3POCA 4MKSA 1ECQA 1FBAA 3GKAA 5CBIA 1A53A 3LCFA 3W7IA 1WDPA 2X42A 2OEJA 1UH2A 5U4NA 4WK9A 2RDTA 4DYKA 3GIQA 2RHGA 2PTWA 1KB3A 4DN1A 4FLQA 2ZTKA 3WEOA 1KFWA 4H6KA 3BXWA 1SGJA 4X2PA 1QT1A 5GQBA 3NZ1A 3S83A 1H60A 3R43A 3UCDA 1VCFA 2WMKA 2GGJA 4LWWA 3ARVA 1J01A 2QVNA 3GZAA 2CZVA 4IP5A 4GYFA 4ADSA 4AX7A 2A4AA 2BBFA 4H41A 5CAKA 2D20A 4XD5A 2ZE3A 1XFCA 1XD1A 3U6WA 2VJXA 2BP1A 1US3A 5T9BG 1WXZA 2ZE0A 1RHCA 2YXGA 3DHPA 3MJYA 4IFRA 3G1YA 2Z6IA 4ML4A 2BY1A 3WBEA 3NOEA 4Z1YA 3NUKA 1PYMA 2FZNA 4Z1DA 1D7FA 4R9XA 3W1QA 2Q8ZA 3BSMA 3AWNA 1VRXA 1QFEA 1KBIA 2GOKA 5T9CE 1D8CA 1P48A 2WZTA 1BLIA 1LUCA 4WSKA 3UG3A 3DI0A 1QI0A 3URAA 4GK8A 1GOXA 3C0SA 1V3JA 3NGJA 3GNPA 4MNMA 3EBVA 2B0MA 2PDFA 1FHDA 1JUEA 4MZ1A 1RH9A 1C8QA 1G01A 1UWRA 4QITA 3QYSA 4LVAA 2F2HA 7REQA 5IM51 4LQ1A 2QLYA 4PMJA 2GVJA 3A3HA 3ICJA 5AYBA 2W9MA 2Y8VA 1E1CB 7TAAA 4HHHA 3BMXA 1VHNA 2PD9A 3L2MA 4RZ6A 3BAYA 1JIBA 3TKFA 3KDNA 3VIFA 3GUGA 2NV9A 1JZ4A 3UNTA 3CNYA 3NL6A 1ZJBA 3AYTA 3TLQA 4YPJA 1I2OA 2R1NA 4IGNA 4JCLA 1L6SA 3GG0A 1NOFA 2QF7A 3R1ZA 4IIGA 4N4QA 3TSBA 4S3EA 1GG1A 3JZUA 1T7LA 3PZNA 3TR9A 1ADOA 3WDPP 1UC4A 1K77A 4CD6A 1GEQA 1OINA 3PBUA 4XZMX 5EU9A 3A9BA 2GJNA 1SJCA 3GC4A 1OY0A 2PDKA 9XIAA 1JPKA 4GABA 2GJXB 5IHRA 3VOHA 1K8CA 3VGGA 2JE8A 4AW7A 1SW0A 2XSBA 1CX9A 3SBFA 2QPSA 1BRLA 4PTVA 2KX9A 3KOZA 1VCGA 4F9DA 4NAFB 3VD9A 2F6UA 2RDXA 2PP1A 5KMYA 3ABXA 4AVNA 1Q6LA 3BMWA 2WNQA 1DJYA 4X61A 2FFIA 3OZMA 1JCXA 4GHRA 1MFVA 4URIA 3VGDA 2YBUA 1BXNA 1OGBA 3HPZA 1ZGDA 4C6CA 3C2YA 4QLLA 3NSNA 4O1BA 1TMHA 4GZJA 1Q6CA 4W7UA 4L64A 4H8NA 4EAMA 1LM1A 3B40A 4MNJA 3ENLA 2GYIA 2ZX5A 3VD4A 2DGAA 2VOMA 4UMCA 1K8ZA 4Y9OA 1HGWA 2RJGA 1TCMA 3CQJA 5D4YA 3HBLA 1HJQA 2DW6A 3IJLA 3CJPA 3CAWA 2J9XA 2VTFA 1Q6FA 1WZLA 4JTAA 1Y65A 5CC3A 3DFTA 4GH1A 2WMJA 4L1WA 4ZQPA 1E6SM 4GCXA 2VRKA 5I0DA 4YTUA 1VBGA 4IGSA 1UR9A 2J7FA 2PDUA 3AS3A 1FDYA 1J4EA 4ATDA 1DV7A 2VFFA 1H1NA 4UNKA 1RY8A 3TWAA 4RDVA 2ZX8A 7CGTA 2XIBA 5M1TA 4XB3A 3FY1A 3T42A 4DJFC 1UB3A 2BGNE 5A1AA 2YGYA 2POTA 2Y70A 1RVGA 3MUXA 3VGEA 3FAXA 2D0HA 4QIUA 2BB0A 2YL8A 3VNZA 5FSEC 1XHGA 3VC6A 1G4TA 3Q65A 2ZRYA 3NQMA 3REQB 4AHPA 1JCTA 3KRSA 4NZCA 4CNOA 1JD7A 3M5VA 3SFWA 2FTPA 3NQ7A 1N8FA 5F2GA 1RUSA 2C1IA 5A3HA 5AC5A 4LYQA 4Z2LA 3O6AA 3S2LA 1F6KA 4F3HA 4DJFD 1S2CA 3B9OA 2P10A 3M0ZA 3VDAA 4IIFA 1JZ3A 3QV7A 4N9EA 1PKMA 2R8WA 2DZWA 2NUYA 2Y85A 1YPFA 3NZQA 2J47A 2V6AA 4JTDA 1AD4A 4AZGA 1IIGA 3CGTA 3C61A 4BI6A 4C6JA 3F4VA 1R38A 5LHEA 2YL5A 4FR1A 1RCXB 3ARYA 3AYVA 1XLAA 1NTHA 1JYXA 1JL8A 3H2EA 1JFXA 3DFHA 4EE9A 4C90A 2Z2AA 2ZRXA 2CNCA 3VDHA 2E6FA 2RUSA 2NW0A 1ISXA 3D3FA 3W7NA 2FJKA 3L67A 4FLSA 1CB7B 2J7GA 3TFCA 1G7UA 4J3SA 5DY3A 4O1AA 3K2GA 1QXLA 1B4EA 3AS1A 1QK0A 5D05A 3GSMA 4A6GA 3MW7A 3S46A 3IJ9A 4MADA 2DIEA 3W88A 1ITUA 5L9FA 4AZCB 3U4AA 4XKYB 3BLOA 1C8YA 1M9HA 1RQEA 1VKFA 3OZOA 1VFMA 2X30A 4EVZA 1FWJC 3HIJA 4DYJA 3I4EA 3DECA 5LYRA 1HIZA 1TPB1 1KWKA 2BVWA 3P74A 1J10A 1TJ1A 2FZMA 4FK9A 2X09A 3GDTA 4X2RA 1EC8A 3VCCA 5A6BD 3C86A 4BQ4A 3F2DA 4ZSUA 1TTIA 3UYIA 3WY1A 2O9OA 4KGJA 3VNYA 4KRUA 1YQ2A 2JALA 1QWGA 4HMNA 2OR2A 3CUXA 4D9PA 4IGHA 2GQAA 3WLMA 3ID7A 5CBJA 4BF5A 2FGZA 4L7ZA 4IM4A 4S3AA 3L2LA 3WK1A 1C9DA 2OEKA 5ABEA 1U30A 2ZADA 3BLLA 4LUYA 4JTJA 4UFKA 1C9WA 2C8NA 4JFVA 2NQ5A 4I6KA 2BNJA 5KSWA 4RUBA 5BZAA 1LBMA 1TMQA 4GX9A 3T0CA 1J5SA 3GTHA 1WUFA 3OBKA 4UWMA 2VX5A 2WBGA 3P8JA 3BCDA 4UQDA 4ZOBA 3UCCA 1X39A 2RDWA 1W9XA 1UR4A 1RQBA 4QHRA 1GPWA 1TPC1 3BSHA 3TSDA 3SQLA 4I9MA 3LY0A 5FEXA 1BFNA 1E0XA 2F9RA 4M6VA 3GAYA 1P0BA 6ALDA 1JR1A 1F2JA 1SYTA 1H0GA 1PDZA 3H53A 3T6CA 1PE1A 4I8YA 2OCZA 2AL2A 1ZENA 2YLAA 1HT6A 1YDNA 3BLDA 3MDWA 2V5JA 1F73A 2AKZA 4EANA 4KEMA 3KBWA 3PWGA 3VYLA 1TZ7A 1A49A 3M16A 3CV6A 1YBQA 3VMNA 3VIKA 4BR1A 4HBKA 1XDJA 3SCPA 3RU8X 4FNUA 2HISA 1KR1A 3QR1A 2G0WA 3APTA 2EKCA 4XZLX 2GFTA 3NQAA 4DUOA 6ENLA 2VVNA 4UTTA 4ZB5A 1K4HA 4A3YA 3QW4B 4OWGA 3RMJA 4LV4A 5CPTA 1OT2A 1OX4B 2BDQA 3W1NA 1VFOA 1CCWB 3PBVA 2XTKA 3PR2A 2HVMA 3W86A 3GB6A 4M6PA 3L5LA 3W82A 1R46A 2BGSA 3OBEA 1A5NC 1I2RA 3TIMA 2HV5A 3DOPA 4OJYA 1Q7QA 4C1NA 2XFFA 3UR2A 4Q8UA 3VIIA 1REQB 1Z3NA 4AZHA 3KL3A 4US5D 4UTLA 3VMOA 1HO1A 3W2UA 4LFYA 3WH5A 3PJXA 4UTJA 4GJJA 2OZ3A 4UTWA 5C9XA 1PZ2A 5JUVA 3E74A 4ZB2A 3A12A 3PP7A 3GDBA 4GZEA 4FNPA 4AWSA 1KA9F 4DZIA 3ZOAA 1H63A 4Q32A 1PB0A 5F4WA 1TRDA 3TW6A 4UFMA 3WBAA 3OA5A 5BXRA 1UD8A 4A05A 1W32A 2HBXA 4I9TA 5MHBA 2FHCA 2OTDA 2VGFA 2WLYA 4Q3MA 1RCOB 4MWAA 2YIHA 5LA1A 1RK6A 4O53A 2G8ZA 5XINA 2XIMA 4HNOA 2OKOA 1HFBA 5I2UA 2FZBA 4JIQA 1XLJA 3RHGA 4PTMA 3CZJA 4KIEA 4EOUA 3IIOA 4PMOA 5LIYX 2VFDA 2WNWA 3UW6A 3E0LA 3BCJA 1SZRA 3GBDA 1KV5A 4B5VA 2AQVA 3O0FA 3NZRA 3UQNA 3AMLA 3VINA 2REQA 3KVMA 1LWHA 2YL6A 4Y7EA 1GKQA 1B31A 3G8EA 2V30A 3HG4A 3MP4A 4FOJA 5G2WA 2P50A 5TAOA 2NQLA 3SCWA 3V5OA 3HN3A 4ZR8A 2ADAA 1RD5A 4IPPA 3UCQA 5I3DA 3GXDA 1PHQA 4IG2A 3GYCA 3JR2A 4XV0A 3AROA 1XH0A 5BRQA 1BEUA 4B3LA 1MXDA 1GJUA 1W5MA 4IUGA 2QQ6A 4HK7A 1YE4A 1KM2A 2Z1KA 3MUAA 1VC4A 2BV9A 1VPYA 3I7QA 2X1UA 1Q7MA 3SJNA 3E0FA 3UP8A 3ALFA 1TYGA 1Y0EA 3T2PA 4H9VA 3B06A 1E70M 1TWWA 5AFDA 5LSMA 1JNEA 5CGQA 3KP1A 1E9ZB 1VBJA 3VNKA 1IEIA 2Y1HA 2BVTA 1DQUA 3ZVHB 1V3IA 4JY9A 1NP0A 3MUCA 5AECA 1XLKA 3RRAA 4E8GA 2HVOA 5E6YA 2VZUA 1L6GA 5AHEA 3NTYA 1CXLA 3FKKA 1OG0A 3F7JA 3KW3A 1WOBA 2DUXA 4REQA 4M1BA 3M9YA 1SO3A 4FNQA 3EKGA 4HGXA 3KWXA 2BOEX 3N2XA 1OFRA 2XU2A 4UBPC 2BY2A 3UJFA 1WV2A 5DRIA 3NQVA 4KRZA 4MTVA 3SDOA 2QXWA 4GY0A 1KM6A 1K03A 2I57A 3NL2A 2QPUA 2XVNA 3AXHA 1GNXA 1AK5A 4A3UA 1O1ZA 4UOQA 3TSMA 5FF4A 3PG9A 3CWHA 1EBGA 3IUIA 3IK4A 1XBZA 5LGZA 1V5XA 1XUUA 3I6EA 2ZICA 4DO6A 5JU6A 5E1QA 3UPWA 4NJKA 5EA9A 3L4XA 5DLCA 3E38A 3GVRA 3G1DA 3GLCA 3S5YA 3M5YA 1QBAA 1UR8A 1QTWA 5TF0A 4GI8A 2Y24A 3GU1A 4ECLA 1F3TA 2IXVA 2YCIX 5BU9A 2FMOA 2EPLX 4QQ3A 2YXXA 1OFDA 1TR9A 4L1GA 3QN3A 1GEHA 3MMTA 5F1VA 1F61A 3GG1A 1ZL1A 3VNDA 1PIGA 1OHLA 3A22A 4J27A 1CXEA 3AAMA 1EGVA 4J3TA 1E9YB 3STEA 3DC8A 2CBJA 4QROA 1GVEA 4TVCA 4BQ5A 2Z7KA 3DG6A 3VU2A 1F6YA 5C7HA 3RLUA 3SY8A 4IP7A 1YIXA 1PIIA 1T8XA 4JY8A 4PMUA 1KCKA 3DXIA 5DEZA 1NY1A 3UWUA 5JVLA 2NQJA 3N6JA 4XKYA 3AFBA 3OZPA 3EMQA 1EXBA 1RVKA 4W93A 4FB7A 1UIOA 1W9UA 2GDUA 2R94A 4LTSA 1NDYA 4AUBA 1FH7A 1MW1A 3EEZA 4DZ5A 1TJ0A 4XAFA 4Z2JA 4MDPA 3VABA 1XIGA 4O0ZA 4Z0SA 4INFA 2GQ8A 1YXYA 3TONA 3G3MA 2PI6A 2ZRWA 2HROA 1Q65A 2FPVA 2NXHA 4MAVA 3PZMA 1CLKA 1TPFA 1WAUA 3S9IA 1W3JA 2F8QA 1X6UA 4DUXA 2ZXAA 1LCOA 1C91A 2EG8A 4ZO9A 1TQJA 1C90A 3AMKA 4R53A 3E5BA 3UZ5A 2V5KA 2X1RA 3H7RA 3V1HA 2E4TA 4GG9A 3CMGA 1JF6A 2WVVA 2DUZA 2WVUA 5LIWX 3FX4A 5D32A 3OJGA 3M0VA 3WF4A 5AYXA 3RAOA 4UR9A 5I09A 4UTTC 4BWLA 4DJDA 1V0MA 3B05A 4POCA 3UETA 2YYTA 2PDIA 3TOPA 2GSEA 2GL5A 1ICQA 3UZYA 4ORIA 4G1KA 4TX8A 3V4BA 3VC5A 3SZ8A 3QMRA 4PTXA 3TUUA 2WHJA 4RJEA 4F40A 1L6FA 3DFOA 4JCMA 2BZNA 1VYPX 3QV6A 4O1CA 4AH7A 2OVLA 2YOCA 1QR7A 3FK4A 4IIEA 3LHZA 2WANA 5FF2A 1DHPA 1JPIA 1US0A 3UNDA 3OIXA 1RZMA 1BWLA 3G1HA 4KMQA 4R34A 1FWWA 4L5ZA 2UY5A 2PSNA 4ADTA 5BRBA 1C8VA 1GVRA 5KTLA 4UTWC 1QOQA 3H4GA 4XO7A 4BS0A 4PEEA 1TV3A 3R79A 4GCAA 2G3JA 5A8OA 5DMNA 4MLJA 2G3FA 1A47A 1EIXA 3M07A 2XSXA 2WC4A 5FD0A 3WLKX 2EJ1A 5A6MA 5A6TC 3S1UA 4I3GA 2WBKA 1Q6OA 1QHPA 4NJHA 4JEQA 1MQPA 4MWAC 3SSJA 3CPRA 3UR8A 1V4YA 1DORA 3TJIA 3KCOA 2DH2A 2CFFA 3RO6A 3MKCA 1R0MA 3LOTA 1I1XA 4GKTA 2VCCA 4ZXLA 1RPXA 2PDCA 4EK7A 1E43A 5A6JA 3G1VA 4ORMA 1I60A 4O0KA 3WNKA 3CEUA 2WLZA 2X7VA 4MWAD 1BG9A 6TIMA 2XN0A 2WK2A 4J3UA 2PA6A 1IEWA 1MEWA 4P7LA 4FS9A 3QKEA 1GOMA 3WD4A 3CUZA 5M5DA 1ZPTA 4AD5A 5FI8A 1WOAA 2CBVA 4R7JA 3BDKA 4IX2A 1ISZA 2V69A 5I24A 1MDLA 4O28A 4H9MA 4CQ8A 2CLLA 1CXFA 2MUCA 4M82A 4ZCWA 2C16A 4ZOCA 4YTQA 2X05A 2E3ZA 3GK0A 5LIKX 2FFCA 3BH4A 3PTDA 1YKWA 5KETA 1DPMA 5HATA 3W71A 3VNJA 2OOGA 2WJZA 4RXGA 1KXTA 1TE6A 3WK3A 2VEGA 1XYBA 2P76A 4HJFA 4O1FA 3QY7A 2X7WA 3A21A 1E6NA 1J5TA 1R3WA 3N14A 4H7ZA 3WF1A 2CBUA 4NZJA 3SCSA 4RDZA 4PMQA 4FIRA 3WD3A 2XZ9A 2VT0A 3WLRA 1XRFA 2C3ZA 4H19A 1VHCA 4AQLA 3EAUA 3QSRA 1BHGA 1IXNA 4IPJA 2DT3A 3LK6A 4NL1A 1XYZA 4XZBA 3ZJ6A 2ZRZA 1OCNA 3TQVA 3NZPA 1YE6A 5KEZA 1XBYA 2A79A 1IZJA 4PMRA 1JI1A 2EPNA 3S1WA 2FDMA 2Y88A 4J3ZA 1V02E 4GXPA 2R1MA 4MSSA 3IK2A 5CBBA 1EJXC 1XKJA 5EFDA 3U0HA 3WK2A 2WNZA 5AHLA 3O15A 2WJDA 1OBAA 1E6XM 2HDJA 4S3KA 3UG4A 3CHEA 5FCZA 4OV9A 1R86A 5J5RA 4PMYA 1W37A 3PHAA 2AMXA 3DYOA 3PAOA 2QCFA 1OFBA 3CT2A 1YNPA 3LGDA 2PDNA 3EMZA 2FGBA 3M46A 4A8IA 1B57A 5KZMA 1ZAIA 2WSQA 3JZEA 4AYSA 1L6WA 3ARPA 4DWSB 2HEJA 2WPBA 4PFMA 1KTNA 3RPTA 3U5YA 1FKWA 3PF3A 3K8KA 2PZ0A 3GHUA 4LEFA 1TR1A 1E15A 4ACZB 2NZLA 3GTXA 2C14A 1B9ZA 4TMCA 5A95A 1TUXA 1LRQA 3T55A 3T81A 1XDLA 5GJPA 1W31A 2Y5SA 3FHAA 4MHBA 3LGEA 1YADA 1LL7A 4OV4A 5DQPA 4BQ2A 2CLIA 2GGHA 1SUXA 4F0SA 3AJXA 1LP6A 2DORA 1OFPA 2PGFA 3KWSA 1OJXA 1DIKA 3Q67A 1CI1A 2XG9A 1OCBA 1PTDA 2E9MA 3D0CA 1OC5A 2ISSA 4E5TA 2HS8A 2YZ5A 1KC7A 1ADSA 3LERA 2GK1B 1M6JA 2WMHA 2O0TA 4KQNA 4ZGYA 2W91A 3NGFA 1PX3A 4KEZA 5E93A 4XZNX 4ZXOA 1CLXA 1H61A 4HOZA 4E0CA 4LX4A 1TZZA 3LCXA 3S1VA 2XH2A 3WUFA 3AIWA 1NP2A 4LY4A 1EC9A 5HPOA 3HZ3A 4IQJA 3WQVA 4YS1A 3FKRA 1R85A 4DO5A 5G2IA 3BLIA 3W7KA 5F7UA 4RK8A 3CIWA 4Q7NA 4TTGA 1W3IA 4AIBA 1GONA 1BXBA 2QJNA 3M44A 1A3XA 5CZKA 3DU0A 3SN1A 1BD0A 2HNEA 4UC5A 2WJEA 4DZHA 4QSHA 3UD6A 3W72A 3N4AA 1JZ6A 3LNPA 1WXYA 1T96A 4XD6A 2G3NA 4UOZA 2L5HA 1G4SA 2KZHA 1XS2A 4OOZA 1T8QA 4PCNA 3CV7A 4XX6A 1X1ZA 5IOBA 4PZVA 2GGIA 1GQJA 5FL1A 1IHIA 1U22A 1XQKA 2R6OA 3RFAA 3BTNA 1A80A 3M0IA 3BUVA 4IFKA 4QAIA 5CAHA 1X6LA 3Q37A 1M5WA 3MWCA 3W2MA 2V5BA 2D2GA 3VVGA 5EYWA 3MP3A 3PZIA 1EHAA 5DBTA 4GPNA 3BK0A 2OWXA 3P67A 4FI4A 3V5FA 4OTKA 4ALDA 4C6NA 4AG0A 1VRDA 2G95A 4NSBA 2YZRA 5JQ9A 4C6OA 3UWEA 3USBA 4XBSA 4PBGA 3GE7A 1KD0A 4YHEA 1R9ZA 3FJ6A 4O8RA 2Z2BA 2W79A 2PRLA 2WB5A 3PK7A 3WJXA 2ISFA 4O12A 1DJIA 3WH6A 4YYFA 3BLKA 4DO7A 3W75A 1EJRC 3STPA 3HGJA 2VFGA 1P4CA 4Z2HA 1DWFM 4RXFA 1GOOA 3LA4A 1RBOB 3TK7A 4ZZ9A 2TYSA 1NSJA 2V67A 4PUMA 3AMCA 1QPQA 1Y7VA 4U31A 1O5QA 2DQWA 3OLIA 3QKZA 4KETA 3IUHA 5GJNA 1UD6A 3S8HA 1B9BA 4KKXA 1OX5A 2C71A 5FOOA 3O3RA 1K4GA 1JAEA 4PUUA 4L56A 1QOPA 3GXFA 3V36A 5KZDA 1JG9A 5GNZA 1FWBC 2VELA 4J5NA 2YB1A 5EMUA 2QVHA 4NILA 5I3IA 1O66A 4NZ3A 3ZJ7A 4ZA0A 2BMBA 1PL9A 3BPWA 3WQOA 4FIQA 4IMCA 4LY8A 2ZUVA 4QEEA 3AMDA 3EXRA 3H7VA 5TNVA 3N2OA 1Y5WA 1NWUA 4JS3A 5C0QA 2EPKX 3W7GA 3XISA 2ZDRA 1GVQA 6REQB 4XD3A 2G3IA 2J25A 4O52A 3IV3A 1XLIA 3R2GA 2XGBA 2X1TA 1UP3A 1GG0A 4MB5A 2BG5A 3OLGA 4QFUA 1OK6A 4S3DA 5HA7A 4ZBCA 3WH8A 2BXVA 3S5NA 4K37A 3EWWA 3W2JA 4HHMA 3GFYA 3IAQA 2ACSA 3CK5A 2GJLA 4KCWA 2XH4A 2ZZ1A 1HJVA 1FH8A 2CZEA 3Q58A 3S2JA 4K68A 4AC7C 4Q7BA 2A3EA 3PULA 4WZHA 4PH6A 5I3KA 4M3PA 1YDOA 1HJXA 1MZRA 1P7TA 1J2WA 2ZA2A 4V2XA 5G1TA 3EA3A 3BVJA 3NQGA 1QWKA 5CLTA 5G2HA 2V2HA 4LCSA 4IXXA 3FXYA 4C6MA 1NWTA 1TSIA 4C5ZA 1XPYA 1GHRA 1Q6GA 3TJ4A 3DFNA 2FIQA 3LHYA 1DJXA 3H4WA 4UUIA 4XG1A 4C6EA 2XVGA 1NM9A 3GXIA 2WXDM 4KCVA 2UY3A 3TYEA 4K1GA 4UZSA 2WO5A 4WSJA 3H24A 3N1AA 4JKMA 3WX7A 3F2BA 2WHKA 1K3UA 2YBVA 2QJJA 1UKSA 4JTFA 1Q7ZA 5BWAA 4EKJA 1BSIA 3HU7A 1EA0A 2XUCA 3TYAA 3ZLGA 2QV5A 3WJSA 2YDRA 5D2VA 3LLFA 4BKNA 4K1WA 5EBUA 2A3BA 3DENA 4PUDA 2PDLA 2PAJA 4FX6M 5D9PA 3UZWA 1YEYA 4NU7A 5C2XA 1WO2A 4GQ0A 2JKPA 3CQKA 1FCQA 1LTDA 2B7QA 4DO4A 5HULA 4NHVA 3GG7A 1DQWA 4CNTA 3SUTA 1POJA 4QNEA 3QFWA 4ICMA 2GUUA 3IACA 1VFLA 5CEWA 3HQ1A 3FEQA 3QPZA 3ZSTA 2E6DA 3IVUA 3EPNA 3E3HA 3E1F1 2Z0IA 2PURA 3HGRA 3D5HA 1SVDA 4L61A 3LB0A 4GI4A 5GNXA 1OWQA 4I9JA 3LXBA 4NF7A 3T0DA 4WQ6A 3LCWA 1V6WA 4W84A 2NXIA 1A0DA 2OLAA 5EBAA 1PAMA 1V0KA 4O1EA 2DEPA 4Q8MA 3ZMRA 4KEUA 4C5YA 2GVYA 1HO4A 3VMPA 1R9YA 2EF9A 1QO5A 1CENA 2VEIA 3FV9A 3MC5A 3LQLA 1POKA 3T8QA 1S2TA 2XZ7A 1SSGA 1CPUA 2EXOA 5PTDA 1WQ5A 2ZUMA 5D2YA 5TQLA 2B7PA 3QFEA 4F48A 3T40A 3VUSA 5GJMA 3P5YA 4G5DA 4Y6GA 5FJRA 5HNNA 2QUNA 2FHBA 1XW8A 2PCEA 4H04A 3VOFA 1MUWA 1EJTC 3BW4A 2Z2UA 4RE3A 1G69A 3P8IA 2JEPA 1EJVC 4JX4A 2QIIA 5DBUA 4O14A 3CAKA 5K4ZA 1LLOA 1NF0A 1JPDX 1HVQA 3LUTA 3ZT7A 3LNMA 4WDUA 1EFZA 2CKSA 1EQPA 3LBMA 3GQYA 3PWAA 3MUY1 2G96A 3O6DA 4DM1A 1G5AA 3AIUA 2Y7FA 4CD8A 2W66A 3AHYA 5HBFA 3NDZA 4GQGA 2QCCA 1OG6A 5DN1A 4H9TA 3EWUA 2RGMA 2UBPC 3TXVA 4AWUA 1UMLA 4ASTA 1ONXA 2HVNA 4J9JA 1L8NA 1TPH1 1VBUA 2AGTA 1KKRA 4G6CA 2Y5JA 1UASA 1XYFA 4FLOA 1VFHA 4OT7A 4GYPA 4AY1A 3CL7A 1VENA 1SSDA 4JTIA 4IX0A 3H12A 3UF9A 4QEHA 1MNSA 4A3QA 4LUTB 1ZU8A 2PDQA 1HKVA 2OQLA 3VD3A 3H22A 1U83A 3DHUA 1OC6A 1P6WA 3BARA 1N8WA 3GR4A 2VC9A 4UTKA 1ICPA 2E9LA 3GDKA 4YU1A 1XCFA 1HN1A 1QCWA 3VCRA 3LGGA 3G0SA 3L0KA 2QAFA 4JFTA 4N4PA 4RDWA 2PDBA 5EMMA 2PDMA 1OSEA 4AD4A 5I78A 3F5KA 1TIMA 3UJSA 3P14A 3KLKA 3R10A 3VKJA 4IJBA 3GWQA 5ABFA 3SY5A 2H90A 3OLEA 3E2RA 4JKKA 4JNYA 3T78A 5BMXA 1C93A 2Q3OA 4U3CA 4IICA 3SSZA 3VFCA 3MPGA 1LBLA 4LB3A 4ACYA 1MW3A 2DVTA 3MKVA 1O60A 2OXNA 1QW7A 3DUGA 1CW2A 1MI3A 3EGJA 1XICA 3U7VA 5I6SA 1IWAA 4MY9A 4S3JA 3MMWA 3WLIA 4DX3A 1SJBA 3N3MA 4CD7A 4A3RA 1VJSA 2XIQA 3KHDA 5K9CA 2ISVA 1ME9A 3BANA 5CZ0A 1UWSA 2FQIA 2PWGA 4HB7A 3L4UA 1X96A 2XISA 2XM2A 2OG9A 3UXAA 4PB3A 3DFYA 3RCMA 3M47A 2VXNA 1MRAA 3EX6A 4KWSA 4A8NA 3AWOA 3IRDA 2ZCGA 1WE5A 1DWIM 2WMFA 3MSRA 1IXPA 3NL5A 5IHSA 4WY0A 3EDDA 1HP5A 1V6TA 4Q4RA 2PODA 3WMLA 2XIJA 4WKHA 1QVBA 2EO7A 4MZYA 2PDXA 3M0MA 4HU0A 3THQA 2OO0A 1MNZA 5A2CA 4GJIA 1KFKA 3B03A 1O1HA 5D9OA 1L9WA 4GZIA 2VC7A 2E9BA 1XYAA 4L6DA 4XO6A 2JGYA 3EPMA 4M1RA 1OFAA 3BGAA 1TIWA 3MKKA 3PFRA 2FJUB 3NXLA 2QCDB 1XSKA 1MXGA 3LS9A 1RK5A 3S9ZA 5GPRA 2Y5EA 5FJJA 1UA7A 4KFOA 5H8UA 3W1TA 2XYLA 2YJQA 2NVCA 3B8WA 1XG4A 1Z69A 2Q09A 3NQ8A 5XIAA 2HS6A 3ZLFA 2C0AA 3GX9A 2CZ5A 4WVXA 3LZ3A 3ME3A 3LV5A 1VF8A 1H41A 2J7BA 3LI1A 1KRBC 2A7NA 4I9AA 2VFIA 3M7SA 5CJMA 4GYKA 2PRMA 1L0PA 4OOUA 4AZIA 4D8ZA 1T6MA 1Q6EA 4Q8QA 3WBYA 3L4WA 3NO5A 1E72M 3LQGA 4JPGA 3ES8A 4DBDA 2V82A 3AXXA 4HPXA 4CD5A 2QUUA 1WP6A 1WUEA 4KWVA 3RGTA 1R5YA 1D7KA 2CC0A 3T09A 2NX1A 4PFHA 3G22A 3N13A 4ZFCA 4E3TA 4GH3A 1IF2A 2VD8A 2XGZA 4JIHA 4C7FA 4EXBA 3B0VC 2X16A 2J62A 3CZ8A 1A0CA 3W7QA 1MEHA 1EXPA 3P5ZA 3CASA 5JXQA 1U5VA 2P8BA 3OB8A 3N19B 1MMFA 4AEOA 2XDFA 3KZSA 4MJ2A 3NYZA 4HMDA 2E8YA 4RDYA 1KBKA 2V2DA 1DL3A 3RLHA 1H7NA 1RLCL 2CXGA 1B1YA 4WGHA 3PBGA 4KIRA 4GI9A 4XZIA 1ZHAA 1PCWA 3VUPA 4YWSA 5CG7A 4FX7A 1EYWA 4F9JA 3R5EA 1FWGC 1JF5A 3QY6A 1UKTA 3OW1A 1PWMA 1BKSA 2PTZA 4GUGA 1BGGA 2GGEA 2PFHA 3BG9A 3BLPX 1IGSA 3LRLA 3W25A 5D30A 2WSPA 1FTXA 1CXIA 4NZ5A 4LVFA 4GVHA 4F79A 1VYRA 3TW9A 1H7XA 5A2AA 1F8MA 2OYMA 4FHAA 3CIXA 3MP5A 2NWRA 1B3VA 1TPUA 4DWSC 1DJHA 2GWGA 2ZVRA 1EJUC 3E02A 4PRRA 3FSUA 2QJMA 3F4DA 2Y7EA 4NI8A 3CO4A 1OYBA 5JH1A 5REQB 4UNLA 4QS5A 4PRWA 4KF1A 4Q4MA 3CMFA 1B3XA 2ZXBA 4A8LA 3UVAA 1N2VA 4MAZA 4DWSD 1FFRA 3LCIA 4DF0A 2X41A 2WJFA 3LCHA 1A5LC 4QBXA 1AMKA 3LCLA 2VGIA 4NZ1A 4XIAA 1LROA 3WMSA 3EXSA 2BHZA 3ANVA 1T41A 1KO0A 2W0UA 3W3OA 1XCWA 2IS7A 3W1LA 2CITA 4RPPA 4AXNA 4ZB0A 3R4IA 1Z7AA 3SCTA 2E77A 1HKKA 3ZLHA 4D6GA 1BQCA 4GGBA 2YDQA 1GVOA 1S2VA 3AZRA 3MDUA 4P8UA 3CB3A 1LDCA 2JKEA 1P0EA 3VAVA 1SPQA 4ZOAA 3T0TA 2HWGA 2WZHA 2J7HA 1XIBA 4LOCA 4AWTA 1TV7A 4MVAA 2NX9A 3DG3A 4JX6A 4KEVA 4R27A 4GX8A 4JIPA 3N17A 4IQDA 4LBRA 4Q6XA 5C71A 1FP9A 3OYZA 1QPOA 3PJWA 3MVTA 3F4NA 5RUBA 3VX1A 3SECA 1MDRA 3I7SA 3PG8A 4C6IA 3UWQA 5E0FA 4LCRA 3AIQA 3FJLA 4DXXA 3TXZA 1TPWA 4F2UA 2OSWA 3DH7A 4HD5A 1YX1A 2BX7A 4DJEA 2O4MA 3MMUA 4FLRA 3EZ4A 3M5XA 4R9OA 4UXDA 2OYKA 2BVDA 5EPDA 4TR9A 3S1XA 4PULA 1KFEA 2VR2A 3AU6A 1H62A 2O9RA 2QZRA 3RNDA 2IUZA 3GU2A 2G41A 3G6LA 3AXKA 1KWGA 3BJTA 4GIAA 1TZ9A 4LXFA 3VGBA 3NPUA 5LGXA 1XI3A 4XBKA 2R9RA 3VE7A 2CU0A 1XLMA 1V8EA 5A6LA 1BQGA 2Z1BA 1ZCOA 3KFTA 4HNCA 1AL7A 3I4KA 2FKPA 4ATLA 2EBNA 1LG2A 2TAAA 3NDOA 3VA8A 2V5DA 1WCGA 4DM2A 1S3TC 3RR4A 4ROPA 1X8FA 1HJSA 2H6RA 3UU0A 3P60A 4PBFA 3CUJA 2TRSA 1ME8A 4AD2A 1UROA 2J13A 5JH2A 4GQBA 1W91A 3M0LA 3WENA 4GUJA 1KGXA 1OM0A 3ZM8A 2YYUA 2GVGA 3ARWA 1MW0A 2WM0A 2V38A 3BL3A 3SW6A 3LLDA 4E2OA 3LD5A 1B3OA 3LHUA 1O94A 3ZO9A 5E0CA 3GVGA 2J7CA 1DIEA 4PTNA 4YVVA 4HTYA 2IPGA 4DI9A 4GWEA 1DIDA 1IE7C 3MSYA 2X0SA 3MMDA 4L9XA 4Q33A 5HQMA 1E6PA 4G9PA 1FHVA 3O7UA 2ZUNA 4JNMA 1ADDA 4RNHA 3OA3A 1S1RA 5HJLA 4LJ3A 3L7RA 2VX6A 2PMQA 5CC6A 4MY1A 4JQAA 1J96A 1VEOA 1H7RA 3KCLA 4GVIA 4WIWA 2FHFA 1H50A 3TROA 1WZKA 2VCBA 3ZQ9A 3FCPA 4UTFA 2GOUA 3FJNA 3T08A 5D09A 1E0WA 1MYRA 3N6QA 3QW3A 2JK2A 2Q6ZA 5BRPA 2OZ8A 2NUXA 1EX1A 2PWEA 1XD0A 1B90A 2BWGA 1PZ1A 1YTKA 3BAWA 5FESA 4AD3A 2CLEA 3LRKA 1D2KA 3GNOA 3KTSA 4J3XA 4LAUA 3TZNA 4W8BA 3B4UA 4WDTA 1ML1A 3PPCA 3OGVA 4UR7A 2VWSA 4O54A 1QDSA 1E51A 2OT1A 4ZOEA 1EPXA 5M03A 1D3GA 3WUEA 4Q22A 1BKHA 4LVBA 2O7SA 4DF1A 3NXFA 3SUWA 3OP2A 4D71A 3PB2A 5KITA 4Z2GA 3I3BA 4AIUA 2WPGA 2ZZ2A 3KVKA 3GVQA 2EPMX 4D6EA 4CN1A 3M7WA 1G94A 3R6IA 1CGXA 4Q8OA 1W1A1 4PA8A 3WMBA 3DIPA 2DZTA 2I7GA 1EYEA 3BE7A 3WIJA 4C6PA 2BFGA 4QP0A 4C1LA 4JKLA 4F0LA 4JTHA 3U9IA 4AB4A 1DJGA 3WEMA 4NASA 3B9EA 1RP9A 4NAEA 3TMQA 2XFWA 1ZUAX 2OO6A 4HYVA 1SW7A 4U2ZA 4M8UA 1GVIA 3NOYA 3QGAC 4OIFA 3GFXA 1L2UA 2G3MA 4HVXA 4L4MA 3DBPA 2C91A 1A4MA 2ZOXA 2DSUA 4D6JA 2W27A 4B4FA 5D02A 3S2CA 3NDYA 4B15A 3KDOA 4LS0A 3N9KA 2GJRA 1J6PA 4BJHA 3QZEA 4V27A 1JEZA 1WDRA 1OYAA 1XLGA 3UA4A 3L23A 5B80A 4LUIA 3Q94A 2PDHA 5MF5A 2Y7GA 5AC7A 2J66A 2PTDA 4A3HA 1V3MA 4B5WA 3C56A 4QDPA 2X0YA 4W7VA 5CSRA 4DJFA 2GVLA 3EKLA 3PPHA 2XFRA 4G7EB 5ECUA 1E0UA 3OO2A 2VRQA 2E28A 1O12A 3BAIA 5EFFA 1QW8A 1R8LA 3TWBA 5DCDA 4KRTA 2FZDA 4WJEA 4N9BA 4JHMA 1B30A 1ZBKA 3N29A 1YPIA 3GR8A 1G0CA 2VOTA 4JIRA 1W9PA 3C6CA 4JN6A 2OODA 3N04A 2BSLA 3WDRA 1AFSA 4N42A 2H9AA 8TIMA 2VFHA 4KPLA 3NL3A 1XPGA 4D2JA 1VEPA 2JQXA 4MIMA 1PKYA 5ABHA 1R3YA 2XH7A 4RR4A 3WLHA 4WR3A 1JJKA 2WKGA 4JN8A 3WLNA 4EPEC 2WQDA 3R8HA 1J0JA 4JYEA 5BWFA 4E6MA 3NM1A 1OX6A 4MPKA 3W6YA 3HJEA 3BW3A 1KRMA 3IAPA 4O8AA 1RLDA 2OJPA 4AMCA 3E0WA 4RE4A 3C0QA 4YCOA 1HXJA 4HIBA 3NVDA 3SRFA 2IKJA 2PF8A 2R91A 3VOJA 2V5CA 3GC5A 4MG4A 5DX7A 1CWYA 1GTEA 1QOXA 1US2A 4PL2A 4QJ1A 1FWAC 5A6BA 2OGJA 1DEDA 1Z32X 3A3XA 5I3JA 2WMGA 1GZ1A 3ITVA 5AYIA 1YXDA 3RX2A 3I3DA 1XH2A 3OVQA 4J28A 2DQXA 5T26A 2R1LA 3W23A 1H49A 2QULA 4HPHA 2OZTA 4DJEC 1TQXA 4I7UA 3R11A 3QHNA 3ORWA 1YDYA 3MTWA 3QTGA 2V9DA 2W4XA 3T8LA 4MKNA 5A2BA 2E6YA 1EBHA 1VPXA 3QH2A 4FF5A 3MY9A 1ODZA 3EX3A 4F0KA 2VEPA 2F38A 2O7QA 5MKGB 5L6UA 1TVNA 4LUJA 3EB2A 3PVFA 2PP0A 1O6IA 4B3KA 2DSVA 1SJAA 4DJED 4GOAA 4QG6A 1YRRA 5LIUX 1JDFA 4YVXA 5AKQA 3PFMA 4RZ4A 3EDJA 2I5IA 4IMAA 1WKFA 2EJAA 3ZJKA 1ZJHA 2HK1A 3HGOA 4JDBA 4ICCX 3PAJA 3PZQA 4O11A 3YPIA 2AAMA 3KL0A 3FA3A 3LBCA 2ESCA 4R3UA 2DZAA 1Q2SA 1PO9A 4LSBA 4M7TA 1LL4A 4B92A 3K30A 3P81A 5JIPA 3S5SA 4DPQA 2Y62A 2F2KA 1BF2A 1BYCA 4I7VA 4JTTA 5SWUA 1A5MC 3BWWA 5I03A 1WDDA 4NYUA 1W3HA 4N9DA 5CPSA 4TTUA 3SUVA 3SCOA 1JCJA 3SGUA 1T40A 4LNCA 4JFUA 2D69A 3THUA 2BTMA 3N4FA 3W28A 5EKYA 4MNLA 1EDQA 3ATYA 4OE7A 3VNLA 3RF9A 2NQ9A 2J7EA 3EDKA 4KCTA 3OTRA 1I2QA 1TPVA 3T7VA 1RA5A 1VFUA 5C2GA 9RUBA 1I2PA 2ONEA 4ZO6A 3B3DA 3HO8A 5I00A 1A3HA 4KS0A 2WHMA 3S1GA 4E4PA 4L4LA 5FJUA 1EC7A 1XCXA 3PBWA 2VENA 4NIRA 4B91A 5EL1A 2XVKA 4US5A 2DVXA 1E6ZA 4MKVA 1X38A 1R6WA 3GS6A 1VJZA 4R7OA 5F2IA 1FWRA 1GKRA 1JZ5A 2CZDA 2XSAA 3K8MA 4H8UA 2D0FA 3IUDA 2Q3RA 4Q8PA 3CHFA 4AU0A 4A22A 1IZKA 5HAOA 3PN8A 3LPGA 5T8GA 3L2IA 1L8PA 3SAZA 4L80A 3W7PA 1KTBA 1OCJA 3G0XA 2ZWYA 2HQAA 1VLWA 4DXVA 3WQ4A 1QI3A 2WMIA 5A6SA 4Y9PA 2GDVA 1F3WA 3TCEA 3AUJA 1J93A 3IJ7A 1XUZA 3UJEA 4JIEA 3I6TA 1K6WA 2B81A 2VUNA 3JVAA 5FIPA 3QOKA 3SQSA 3EB4A 4NJIA 3QV8A 4FR6A 1OT1A 3O6YX 1QPKA 1EP3A 2R1PA 4JQ3A 3W7LA 3CUGA 1VEMA 4XAGA 3SM0A 3WD1A 1HKMA 2XPKA 4FXSA 1C7SA 1W9VA 2ZZ3A 3GHRA 2Z27A 4S2CA 5DXXA 1QASA 3LENA 4F8XA 2YR1A 2QCMA 1FCBA 1HVXA 5M17A 4F66A 5A6KA 2A85A 2YCLA 1TO3A 1UWTA 4H2HA 8XIAA 5M3WA 3DGBA 1KXHA 7ODCA 3TU9A 3N3TA 1EP1A 2HE5A 3R94A 3KTXA 3DYPA 4GVFA 3B8IA 3AZTA 3TE9A 1AL8A 4CQBA 2WCGA 3WUBA 5HK4A 4UFIA 3BLEA 4LS2A 1M65A 2QPXA 2E68A 1V02A 3LCGA 4HU8A 2VMFA 4OBRA 2E6AA 1MQQA 2E0PA 2WNNA 3WEZA 2AAAA 3DX5A 2G5WA 3AU2A 2NSOA 1V3LA 1OZMA 8RUCA 3ARXA 3NO3A 1B5TA 5E9AA 4JYDA 1JAKA 1I6NA 3NPWA 2A6LA 1YW1A 3VOCA 5H91A 4NRSA 1AQFA 1VD6A 7A3HA 2DP3A 5AHMA 4DYEA 1PX8A 1TWSA 3NIYA 3M0KA 2Z26A 1JI2A 4TX6A 4U4MA 5CH9A 2ZIDA 4TV5A 1Y5XA 1DQXA 2ZUWA 2Q01A 4HNTA 3BO9A 3K8LA 2HNHA 4GYJA 4IIHA 3INPA 1F4AA 1W1TA 3WDQA 4LC8A 4WD0A 3H70A 1DIOA 3IJ8A 4XBJA 3RM4A 3MUZ1 1NJJA 5DY2A 3RCNA 5TD4A 1YNYA 3KCJA 4RX0A 3N73A 4IXHA 1FWHC 1DWGM 1UHVA 1UUMA 3A23A 3EXTA 4YWIA 3HV9A 2X1SA 3UJ2A 2F84A 5HNRA 1QO2A 2CERA 3TQKA 4CEXC 5ABTA 3OVGA 1EF3A 1R30A 4HYRA 3S4TA 3N9RA 4H8VA 3RJYA 5I02A 3QXBA 3EWZA 3L9CA 3P62A 4CCEA 4W85A 3RX4A 1TWZA 4JTUA 1K9EA 3EKZA 3DCPA 4K39A 2J78A 3WJZA 3W27A 5D8WA 1UQYA 1A5BA 1HJUA 4TVDA 1F3EA 3TW7A 1FWCC 3URBA 2BOGX 3W02A 3MI2A 4CN4A 3KM8A 4GISA 4PE8A 2VUYA 4FXJA 1AH3A 4QJ5B 1UWIA 3DGRA 3MBDA 3ARZA 1ZBVA 4OBTA 1TA3A 2HJPA 3OOQA 3B9NA 1NU5A 3W01A 1XG3A 2J6VA 2QJGA 4J2MA 3TYUA 5FSDC 2I5GA 2DW7A 2X2GA 3TC7A 4GBDA 1XIMA 2NUWA 3FJ4A 3IIXA 4S3GA 5BCAA 3U2CA 2VGBA 2VYOA 2PE4A 3TNBA 3CIVA 2ON3A 4Z2KA 4H1ZA 1OD0A 3S6DA 3ES7A 4HQVA 1ITCA 3RUBL 4FOKA 3GRIA 2C19A 1BVWA 5AC6A 3V35A 2ODOA 4IL2A 3KAOA 1LZOA 3W1AA 1TWIA 3OGSA 3KRBA 1BG4A 1I45A 3O16A 2C7FA 3WL0A 4BA0A 1F74A 4AXKA 4PL1A 2PUZA 1XYCA 2QCNA 3VIOA 2AMGA 2PP3A 1QNSA 5G1YA 3D46A 4F0RA 4PUJA 3V16A 1HL2A 3HFTA 2ZX6A 4W87A 5IXEA 3WH9A 4NYYA 4RCXA 5LNVA 3PTMA 1U1UA 1K7EA 3UG8A 2WV8A 4NX0A 3LHWA 4W9TA 3BV7A 1J0ZA 4AF0A 2XWEA 3MT1A 2E8ZA 3O06A 1HP4A 3EOLA 2R14A 4Z0JA 4U33A 3ABOA 4CD4A 3LI0A 4LPCA 4DBSA 1BF6A 1R3VA 4FZIA 1M1BA 1LQAA 2IQDA 1AA1B 1Z89A 4C6LA 1AQ0A 1W1VA 1S5WA 2QEZA 1VIZA 3BQ5A 3DI1A 3LU2A 1O4UA 4V1YA 4C65A 3ANYA 4WEVX 1XGDA 1KCLA 3OG2A 4WF7A 4OVXA 2DT2A 3GH4A 1CGYA 1JYNA 1TUFA 2ZFAA 4MB4A 1JDAA 3QQ0A 3M0XA 3QZAA 4MLRA 4DNMA 4ADUA 2ZBTA 2PLCA 4UNIA 4GE8A 3M1ZA 2R24A 2NVDA 3W87A 1ODUA 3A6OA 2FVMA 2EGZA 1BWVA 3DFPA 3G5EA 3O6CA 2XIOA 1XJBA 1KNWA 3GUWA 3W7HA 3ARUA 2VL4A 3VIGA 1S39A 5CKSA 4J2PA 3PY2A 3ZXWA 3C2EA 1TVPA 4HNLA 3B0UX 1W9BM 4S3BA 1W5PA 2PTYA 2UWFA 4MDOA 1HTIA 3POHA 3RILA 1R7AA 4MFEA 4X9YA 1IIHA 1H0IA 5HWMA 3PZTA 1TX0A 4NKCA 1M7PA 2CZFA 1LRTA 1RXOB 4BK9A 2IPJA 3WQWA 1SM9A 3S6TA 2W3ZA 3DFQA 4OUIA 4I7WA 1EZ2A 1V79A 1S2UA 3C8FA 5BU6A 1XQLA 1HZYA 1WZAA