4WDTA

17beta-hsd5 in complex with 2-nitro-5-(phenylsulfonyl)phenol
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdtA00
2PFHA 1ZSXA 4YVXA 2PDNA 2F38A 5LIKX 2PDGA 4YU1A 1XF0A 2WZTA 2IQ0A 2PEVA 4GIEA 3UYIA 1QRQA 2DUXA 1EXBA 4LBRA 3R43A 2VDGA 4LAZA 5HNTA 2ACUA 4JTAA 4DBUA 2PDJA 2QXWA 1HW6A 3UWEA 2I16A 1EF3A 2F2KA 5LIYX 1LWIA 2I17A 4XZNX 1T41A 4JIRA 3B3DA 4WDUA 3FX4A 3P2VA 2FZ8A 5AZ1A 1LQAA 4DZ5A 3CAVA 4JQ2A 4XZMX 1YE4A 4H8NA 1S1PA 3UZXA 4JIHA 3RX2A 2ISFA 2PDXA 3CASA 1PZ0A 1RY8A 4JTQA 3LN3A 4HMNA 2IKJA 4Q7BA 3O0KA 3UP8A 3CV6A 3MC5A 3R6IA 3QKZA 2P5NA 4LBSA 4L1WA 4QBXA 1Z8AA 3M64A 3UGRA 4JQAA 3V0SA 2IPFA 2J8TA 2IKIA 3V35A 4QR6A 2PDMA 2A79A 3GHTA 3Q67A 5JH2A 4PMJA 3V0UA 2PDHA 5LIXX 3KRBA 4XO6A 4XO7A 2PDPA 1AH4A 3CMFA 2NVCA 2IPJA 1PZ1A 1VP5A 2PDCA 4R9OA 1IEIA 4NKCA 1MZRA 4FAMA 3H7UA 4LB3A 2C91A 2HVNA 2FZBA 3UZWA 2WZMA 2HVOA 2ACRA 4WRHA 3BURA 4HBKA 3CAQA 2PDKA 1IHIA 2IQDA 3GHRA 2BGQA 2HEJA 2ACQA 3F7JA 1US0A 3UFYA 4JQ4A 4RPQA 4IJCA 1AFSA 2AGTA 4PRTA 4GACA 1K8CA 5HA7A 4L1XA 1VBJA 3EB3A 4FA3A 4LB4A 3WG6A 2ALRA 1Q5MA 3Q65A 1MRQA 4IGSA 2DUZA 2FZ9A 2HV5A 2PDLA 4LAUA 4G5DA 2ACSA 1S2CA 3BCJA 2PDQA 1Z89A 5M2FX 1EL3A 5KETA 1ADSA 4YS1A 2FZDA 1AH3A 1UR3M 4EXAA 3GHSA 4PUUA 3R7MA 3EAUA 3LBOA 1AZ1A 1QWKA 1Z9AA 3V36A 3O3RA 4WDWA 1HQTA 1XJBA 1X98A 4ASTA 4AUBA 1XGDA 4FALA 3GUGA 2INZA 3ERPA 2PDBA 3COTA 2FGBA 2INEA 1YNPA 3G1RA 3LENA 4XZIA 3DOPA 2IPWA 3V0TA 1A80A 1OG6A 3LZ5A 2PDIA 4XK2A 3LD5A 2PD5A 3EB4A 3WCZA 4DBWA 4JTCA 5C7HA 1ZUAX 1S2AA 3FJNA 3H4GA 3WBYA 2PDWA 1AZ2A 3LQLA 1YE6A 4XVDA 4GCAA 4DBSA 1M9HA 3U2CA 4JTDA 1Z3NA 2BP1A 1X97A 3H7RA 1ZQ5A 2PD9A 3ONBA 3MB9A 3N2TA 1PWLA 4JQ3A 2PDFA 5LIUX 4JIIX 2IPGA 2DV0A 3BUVA 1AH0A 3WBWA 1MI3A 2IKGA 3LZ3A 4PR4A 1SM9A 4GABA 1C9WA 2PF8A 3N6QA 3DN5A 4Q3MA 4GQ0A 4PRRA 3NTYA 4WGHA 3GHUA 1R38A 4WDXA 4XZHA 1JEZA 4H7CA 5AZ0A 3RX3A 2PDYA 3UZZA 2R24A 4QX4A 3M4HA 4ICCX 4FZIA 4YVVA 5JH1A 5HNUA 2IKHA 3D3FA 4JQ1A 1FRBA 3LUTA 3R58A 1GVEA 3ONCA 2R9RA 1PYFA 1S1RA 3WBXA 1YNQA 4XZLX 3R8HA 3VXGA 4IJRA 4GA8A 2BGSA 4XVEA 1Q13A 4WEVX 3G5EA 1T40A 3M0IA 1RALA 2HE5A 4XAPA 3LEPA 2PDUA 1X96A 3RX4A 2FVLA 3C3UA 3LNMA 3UZYA 2HE8A 4MHBA 2IS7A 4WDTA 4ZFCA 1PWMA 2HDJA 4PUWA 1EKOA 4GQGA 4I5XA 2NVDA 4F40A 3R94A 1J96A 1RY0A 3UG8A 5DANA 4EXBA 3R8GA 3LQGA 2PZNA 1ZGDA 4JTRA 2CLPA 4YVPA 4OTKA 3CV7A 4QXIA 5LIWX 3S3GA 3T42A 3BV7A
chains in the Genus database with same CATH superfamily
2PA6A 3SY5A 5LNVA 3AHZA 4EAYA 3FNDA 1XSIA 3H6OA 4AX6A 2F61A 1TE1A 5FF3A 4O0QA 4B5VA 2OKTA 2PEVA 4GIEA 4JOMA 3U2EA 4OQVA 4HHPA 1EP1A 2WCSA 1DXIA 5I00A 1WE5A 1XICA 4JTLA 1FH8A 1OYCA 2BVTA 2X09A 1ZJBA 2VFFA 1XISA 3M46A 3E3HA 1AW2A 4H7ZA 4C6PA 2QXWA 3LGGA 1RVGA 3UWEA 4JD4A 3NEHA 5IRPA 1ONRA 5LIYX 4GYKA 4KGJA 4CD5A 3MV11 5IM51 3TYCA 4I7WA 2PWEA 1YKWA 3VNDA 3SM0A 3SURA 4BF7A 2QUVA 3P2VA 5EGRA 1BVNP 3AC0A 4HZ8A 3RXZA 3KRZA 2FZ8A 3NA8A 4KW2A 4EF9A 2VOMA 4RDZA 3UZXA 2W79A 4OFCA 4BI7A 1M1BA 3EPOA 2ISFA 4IMGA 3CASA 1HGWA 1H62A 1PKNA 3EX4A 9XIAA 1VFUA 5L6UA 3LCLA 1XRFA 2V3EA 3W3OA 4DZHA 1GCYA 1H5VA 4IIGA 4C6KA 3IGXA 1YQ2A 4R33A 3WF1A 4MJZA 3CB3A 1Q63A 1R86A 4J27A 3N19B 2JKAA 3BO9A 2CZEA 1WPCA 3V35A 5I79A 1WKEA 3LV5A 2DZSA 1T0OA 3Q67A 5DT5A 4JKLA 1QI4A 3V0UA 5C9WA 4GKLA 3UCCA 2JFEX 2WNWA 1IR2A 5RUBA 1OCBA 1VIWA 3LSCA 3KE0A 3UWYA 3E02A 4WD0A 1PX3A 8TIMA 4IL0A 2WZMA 1RPXA 3CPRA 2QCGA 2YBTA 1V3IA 2ACRA 1WQ5A 4PN2A 1DWIM 3G1FA 5C5YA 1FWNA 4D9PA 4E38A 4L6HA 1NOUA 4IUOA 2CKRA 3DG7A 1DIEA 2FIQA 1LL4A 3LTSA 1K77A 3LYEA 5DEZA 2OOGA 2OU4A 2AGTA 2W62A 3O6CA 4GWEA 3I4EA 4JNYA 4QSFA 2VX5A 4GACA 4UTTC 3GR4A 4AX7A 4V1YA 3LI1A 4AWEA 2ZXQA 3S2LA 2CWXA 4QTGA 5HDRA 1H3GA 1MRQA 2XPKA 3L0KA 1KFJA 3NL2A 1JYXA 1QNRA 3LPOA 4MAVA 1XW8A 3VAVA 1JPDX 4IUGA 4E8DA 2FVKA 3B03A 3CZJA 5BXSA 3HZ3A 4KWVA 4XBSA 3T55A 2DORA 3Q45A 1CPUA 4UMAA 4QQ3A 1ONEA 3WQDA 3K30A 3AMKA 2WC3A 3S6DA 3U4FA 4UNIA 3RRXA 4AZGA 1BG4A 3GNPA 3LBOA 3P67A 3PJUA 3S2JA 1SGJA 4ROPA 4XWUA 4QIUA 5A6BA 1XLMA 1XDLA 3QH2A 1NFBA 4R27A 1MW3A 3BTNA 3UVIA 1W91A 4FR1A 4D8ZA 3F2CA 3NXLA 5A8PA 7ODCA 1GJUA 4WXZA 3WIJA 2H8XA 3H26A 4F3HA 3WCZA 4DBWA 3VGBA 3GQYA 1UBSA 4NYUA 1VEMA 4QDPA 2XZ9A 1V5XA 5I09A 1KA9F 2WHMA 4HVXA 4I5UA 1GG0A 2NLIA 3V4BA 4NSBA 3EZ4A 2CETA 4NP7A 4AEEA 3GXMA 3E96A 3G3MA 2A3EA 4Y9OA 2TODA 5HUOA 3URNA 6REQB 4IMCA 3TN4A 5CAHA 1GYNA 3W1TA 1I2QA 4JTUA 2GJLA 3NIYA 1NEYA 3CMGA 4U10A 1IV8A 4CD4A 1XSKA 2G3NA 5F2MA 4NXKA 1A5LC 4JN7A 3PHAA 1C9WA 3VOCA 4DAIA 3NVDA 3SUVA 1WKDA 4GQ0A 4OE7A 3W01A 1DIOA 4WDXA 3SUSA 3FGCB 4RDWA 1H7RA 4ZXOA 5BZAA 3WK0A 4ZQCA 1EOMA 2VFEA 5H8MA 3FYYA 2QULA 1DXFA 1E6NA 4YVVA 4LV9A 2D20A 2PGWA 3GG7A 2ZE3A 3I7QA 1TE6A 3UXAA 1TVLA 2GGEA 3HGOA 3SGZA 1E9ZB 2FFIA 1Y0EA 4O28A 3R8HA 4B5WA 4IJRA 1H0GA 1PHWA 2BASA 3G1XA 5D9MA 3AIQA 3WD4A 1Y5XA 3GU2A 1CGXA 1HX0A 4ZODA 3VKDA 3MHGA 1M7XA 4O1EA 2QF8A 1IT7A 2XTKA 1UUQA 4IMDA 3PG9A 1Z41A 4W7WA 2IS7A 3L4TA 3BLPX 5D02A 4C65A 1N7KA 1V6UA 2ZXAA 3BAYA 3RILA 1PWMA 4PUWA 3N2MA 4BQ4A 3KBNA 3KTXA 3H22A 4GQGA 2DJLA 2EQDA 3IV3A 4K36A 3W1NA 3TMLA 4I8YA 1HKJA 4NJKA 4CU6A 3OTRA 2QYGA 4EXQA 4WVXA 3O07A 3WFZA 1HJSA 2NUXA 3L4UA 4Y96A 1UJQA 1V6TA 3S42A 4GIAA 3S2MA 1Z6KA 5G2WA 3L5MA 2EPOA 3ITVA 4FNQA 5T26A 3VDCA 3G22A 3NDYA 3LSBA 2X30A 6ENLA 2VD8A 4MUZA 3BV7A 2J7FA 3QQWA 4YVXA 3GK0A 1RHCA 3H55A 3HA1A 5CZ0A 1HJVA 2ZVRA 4AU0A 3B9DA 5D2VA 1I75A 1QJWA 2OWXA 4FNRA 2ACUA 2PDJA 3GXFA 2I16A 1TUFA 4O1CA 2Y8VA 3K8KA 1TPH1 4Q8OA 2WMJA 2OSXA 3INPA 3AXXA 4MY9A 2OVLA 5CPSA 1TPVA 1EBGA 4JIRA 3GX9A 1F6KA 3N1AA 1KXVA 3EYPA 1UP0A 2PBGA 3QQ1A 4D6CA 4LF1A 4PTVA 4DUOA 1JXKA 2J6XA 4P7LA 2TPSA 3RX2A 1WZAA 1SUXA 1EJWC 3T8QA 2WNQA 4RKAA 3G24A 5F4SA 4CCZA 1H7XA 1YTDA 3EKGA 4C6EA 3CUFA 1Z8AA 3TV8A 3AROA 5IOBA 2BMBA 4ZO6A 3QYSA 1CXHA 4ZO7A 3UWUA 2Q8ZA 1A3WA 2PDHA 1NARA 1TV3A 4X22A 4F0RA 4NZ4A 1AH4A 1W6TA 4P8UA 5K7JA 3MW7A 3CUGA 4ACYA 3F4WA 2I7GA 1IEIA 2NX1A 1MZRA 2VM8A 2I56A 3NPXA 1AD4A 4J3SA 5EKYA 3A23A 4RZ6A 1A5CA 4GC3A 3G1YA 3E0LA 3HFYA 3BMWA 4XQ6A 2RUSA 4H19A 3ITTA 4DRSA 3VD3A 1VEPA 3WBAA 5FF0A 4HBKA 1DTUA 5BU9A 4HNUA 2PDKA 3WYZA 3KOXA 2OODA 1IZKA 1ML1A 2Z0IA 3F5LA 3W88A 1W5PA 1JCMP 1KR1A 2YLAA 3MTWA 1FWFC 5AN7A 1JUKA 4ZSTA 2C1HA 3W7IA 5HUPA 2HBVA 4HMCA 3G8RA 2FTWA 4OHQA 1AMKA 1K6WA 4LB4A 4B4HA 3PBVA 1HO1A 2DIKA 3OVRA 5M1TA 3HPFA 4JDBA 1J0ZA 1PDYA 1MQQA 4YN5A 3WY1A 1B4KA 3GXPA 4B3KA 2LLEA 2UWFA 3SQLA 3FW6A 2GQAA 1CTNA 4JIPA 2POTA 1EGVA 2D0GA 1V03A 4HP5A 1UR3M 4GQBA 3I3BA 3UWVA 5A2BA 3W26A 4PUUA 4HYWA 3I10A 5HBFA 3R79A 1BQCA 2OCZA 4DO4A 4O1AA 5F7UA 1IGSA 2INFA 1JJKA 2FKPA 2XM1A 3VPLA 4URIA 2BVYA 4B91A 4NAEB 4E8CA 2NV2A 3TC6A 3LTPA 2X1SA 1P7TA 5TF0A 3NQFA 4FB7A 3RLHA 1HT6A 1KLYA 4N02A 3S9IA 4A3RA 4AYSA 1O1HA 1SZNA 5E9AA 2WM1A 5CSRA 5I3DA 1R3SA 4LY8A 5A8NA 3N04A 4FI4A 2P3ZA 5ENLA 2WVSA 5HULA 4H8UA 3WBYA 5D8ZA 4Z0SA 3QR3A 1TV2A 3AU2A 4GCAA 4EKJA 4UQ9A 5E09A 3U9IA 1VPYA 2NQJA 1XCFA 2XVLA 4O4VA 5FD0A 1QO5A 3ABQA 2QMKA 4NZCA 3DZ1A 1OHLA 1ZHAA 3G6MA 8CGTA 3TW7A 3SO7A 2ANUA 1EQCA 2E7FA 3P8IA 3MJYA 1A3HA 2O56A 4QG6A 3O6YX 3W23A 5MHBA 2OR2A 3UG3A 3RN6A 4CEUC 4S38A 2OLHA 1ADOA 2GUYA 1SMAA 4IGMA 3TOPA 1KCLA 1Q45A 4NF7A 5EMLA 1E9LA 3GG1A 4XBKA 3U2OA 4R85A 1NF0A 5FJOA 3ZJ8A 3GYCA 3VOGA 1KB3A 4C6JA 1E43A 4KRTA 2EPNA 4PCNA 1C8VA 3S5ZA 1J5TA 2XG9A 2QR6A 1VYSX 1PTGA 5EYWA 4LC6A 1DE5A 1WP6A 1MEWA 4TU1A 3UXKA 4LYKA 1XG4A 2WMKA 1P7TB 1RLCL 5AFDA 1GHRA 3WJSA 1ZP3A 4G56A 1RALA 3OQ8A 4MGGA 1W9BM 4F0KA 3WNLA 2ZBTA 3OB8A 5JIWA 3T08A 4P5UA 1H60A 2ZDSA 1XLHA 3PNUA 4X9YA 5DELA 3LM7A 2HE8A 1OF8A 1B3ZA 3EX2A 1FHVA 3VIOA 1L8NA 1V3JA 2EPMX 5A6MA 4JTFA 2WXDM 3U57A 1QU4A 3R94A 3DCPA 4B5NA 4DJFC 1J96A 3MBFA 4GX9A 1ENUA 1W1B1 2HQAA 1X7IA 3FGCA 4FR6A 4IQLA 1R3TA 2VFDA 2WBGA 4PUKA 4DQWA 3NQVA 5DN1A 4OBRA 3GVVA 4YVPA 3E12A 1JCJA 1J9YA 1Q8JA 2JQXA 2H90A 2ESCA 3JZEA 1TPEA 2J7EA 4N7QA 2WMIB 4PTMA 2WK2A 3TNBA 4EE9A 4J5NA 4LVBA 1EWDA 2RFGA 2ZCGA 1OADA 3EX1A 4DYJA 1KCKA 1YTKA 1RP8A 1TG7A 4IPLA 4FIQA 4M81A 1EXBA 2YCIX 1IXOA 3WQFA 1GEQA 1R3YA 3S8HA 2HROA 4XIAA 3N2XA 2BLEA 3OU8A 4BJHA 2E6DA 3SCWA 1KRMA 5FCZA 5HQMA 5CCZA 3WK3A 1XGZA 2G3MA 4FK9A 4U5KA 2I17A 5A6SA 4HK6A 2G3FA 3GVRA 1AD1A 1AJ0A 1DEDA 1PIIA 1R9XA 4RLIA 1DJXA 2W91A 2BWGA 4IX2A 1UR4A 2TRSA 2Y1HA 5AZ1A 4ENLA 1UA3A 2BY3A 3RUBL 1I2PA 4E2OA 1RAKA 4H8NA 2WSRA 3QMRA 4RXFA 4R3UA 1KFLA 4Q8PA 4GLEA 2QQ6A 1SJBA 2PDXA 2F6KA 4JTQA 3LN3A 1VRXA 3CO8A 2O7QA 4UQDA 3NL6A 4ZB0A 3KOYA 4P7OA 4RV8A 2XISA 4JCMA 2J25A 1S5NA 4ZO9A 3CGTA 4L1WA 4AZ5A 4OBTA 3QZAA 3TTOA 5EL1A 3VGDA 4LVDA 4Q4OA 1E1CA 1X8FA 4LU0A 4JZ5A 4I8DA 2PDMA 4CLMA 1EHNA 2A79A 2BODX 3ZVHA 5I3IA 1G4PA 2NV1A 2HRWA 4TMCA 4LJ3A 1E4NA 1XIJA 3B05A 4R9OA 2BVDA 1R46A 3BCFA 3BJFA 4GXMA 4M29A 2C91A 1XINA 3CNYA 1U83A 3MMTA 2EG6A 2FZBA 4BKNA 3HQPA 3DI1A 2HMCA 2P10A 1F3WA 1XD1A 2O9TA 2ZC1A 2V82A 3BURA 3SIMA 2VJXA 3ZQ9A 3CAQA 1XWYA 5EBAA 1KTCA 1RUSA 3CZKA 3U6WA 1UR2A 2RH9A 3QR0A 3CUJA 3CUHA 2CERA 2W61A 1US0A 5A6LA 5K9XA 3NQCA 2OB3A 4UFKA 2WC7A 1N8IA 1A49A 4P8VA 3ITCA 2GDVA 4HU4A 2XH2A 1K8CA 1KQZA 2QGYA 5C2XA 1XH1A 5K4ZA 3ZVIA 1R2RA 1NY1A 4MZ8A 3HU7A 5CZKA 1DBTA 4UZSA 3WUGA 4TO8A 5M2FX 3WQCA 3IJ6A 1H0IA 7XIMA 4KIRA 4HT3A 1JYVA 3FHQA 3ES7A 4AXNA 1MEIA 4PCTA 2DSZA 3REQA 3DX5A 3VOFA 3A13A 3KRUA 3EA3A 3A3HA 1H7PA 2OZTA 3SCRA 1MDLA 1HQTA 1PDZA 4B9ZA 3LLFA 3MWCA 1TTPA 1GTEA 2GDQA 2OGYA 2QDGA 1XJBA 4AUBA 1HP4A 1PKLA 2FB3A 4ADSA 4O13A 3COTA 4KWSA 5KZDA 4LRSA 5FAJA 4A8RA 3O1NA 4QFUA 5ECUA 1FA2A 5AYYA 4PMZA 3VM5A 3S1VA 3RR1A 3M6YA 4DNHA 1QPQA 3EXTA 5H91A 1XSJA 2DZWA 1BEUA 5D9NA 2O7SA 4UZUA 3VMOA 1F07A 3PSWA 2YW3A 1WXZA 1QPOA 1FVPA 1OYAA 1EJRC 2OLSA 1FCUA 1OZQA 4K3ZA 4UTIA 5FF7A 3M7WA 1NDZA 1GZGA 3G0SA 3REQB 5E6YA 3P5ZA 3WMCA 1R6WA 3HJZA 4NVTA 1ALDA 1UKQA 2BP1A 2YDAA 2XVPA 4GY7A 4RE4A 5H8UA 4YCPA 5K4XA 3H2NA 1GVSA 3B9OA 4XD5A 1W1IE 3NZRA 3P5YA 4JQ3A 4RNHA 1JL8A 2I1OA 5XIAA 3G6LA 3W1MA 3VYLA 2V81A 3UPWA 4JFUA 1WA3A 3VU2A 3VE7A 2WJEA 4GY1A 1LBLA 1MNSA 4GZIA 2I9EA 3TZFA 1W1VA 4C6QA 5JQ9A 3UJFA 3OO2A 3RG6A 1KGUA 3QFWA 1DJQA 2CYGA 2GVEA 2QJGA 3RAOA 3FYPA 1M65A 3KP0A 3AIBA 5TNVA 3CL7A 2E25A 4LEQA 3MYOA 3C2RA 3GNDA 2VP8A 3DHUA 3EWBX 3WLPA 3GTFA 4CQ8A 4GK8A 1QK0A 3PFRA 1ZZMA 1CGWA 4Y6GA 3GTNA 3JS3A 4HCLA 2HNEA 1NFGA 3N6HA 5HATA 3L0NA 1QPRA 2FLIA 4GA8A 3CL6A 3HF3A 5BMWA 2DZXA 1KNWA 3UA4A 3GU9A 4UOQA 4GYPA 1BLIA 3SY1A 1LOSA 2J7HA 4FXSA 3I4KA 3LEPA 4NXSA 3R0UA 3PF3A 1KC7A 3FDGA 3K1GA 5GPRA 2ZRWA 4LOCA 3TWBA 2W92A 3QR1A 4LC8A 4GBUA 4A8LA 1HXJA 2A6LA 4UTUA 4R88A 3R8RA 1QW7A 1JI1A 4HQVA 2HDJA 3BC9A 1UBPC 3H70A 3SSZA 4R5EA 2QLYA 4R53A 1XYFA 3LM3A 4Z08A 3C56A 4KCVA 4DF1A 4AXKA 3SSJA 5LGZA 1WUFA 3GDMA 5D2TA 1OX6A 1T5AA 1W8GA 1AMYA 1XBVA 3N25A 1VFFA 3VOJA 5CQ1A 1FCVA 3ABRA 3CV7A 1HJWA 2Z2BA 4HOZA 3OPSA 1XIIA 1SZGA 2TMDA 4D71A 5ABFB 3VX0A 4Z1DA 1VIZA 2PWVA 2VCAA 1B9BA 4V27A 2Y70A 4O8AA 1V7AA 4Z17A 3THCA 1TPB1 1M01A 4J3WA 2WWCA 4JTHA 4X2RA 4CD7A 3GLCA 1G4SA 4HPNA 4AYGA 5HWNA 1DJHA 4BFAA 1EF3A 1YNYA 4GBDA 3C2OA 1LWIA 2IXVA 4L4MA 4GH3A 2GVYA 5LNRA 2VC7A 1XPGA 3TE9A 1ZJIA 4ZE5A 3AYRA 2W66A 4JY8A 1SJCA 5A8MA 6XIMA 1RK5A 3W73A 2E67A 4L7ZA 1S1PA 1EQPA 2FPVA 4ZO8A 3AU6A 4RZBA 1PZ3A 3F4DA 1JRBA 4MB1A 3S46A 2G5WA 3HG3A 1TRDA 2CBVA 5E0KA 3AZTA 2YDQA 2Z27A 3CIWA 2IPFA 4M0XA 2J8TA 5EPDA 3DGBA 1MXDA 2PZ0A 5LXXA 4ZENA 1WAUA 2XJ7A 3P14A 1MQPA 1EEPA 1Q6RA 3T0AA 4CU7A 4XTDA 4X61A 4X3ZA 4DB7A 4GJ1A 4XZ9A 2JKPA 4XISA 3TAKA 4W7VA 3STCA 4BWLC 4XKYA 4FAMA 4Z42C 4NNAA 3GVQA 3OVPA 4RE3A 3E1F1 1ZTVA 2NXHA 4WRHA 3RDKA 5ECVA 1GOXA 1WV2A 2QUTA 3FA3A 1YLVA 1J0HA 4ZOCA 2XIBA 1LORA 3DI0A 5F1VA 1NAL1 4HN4A 4ICMA 3WMSA 3APYA 1ZAIA 3B9EA 2EG8A 3GNOA 1JNEA 3PPGA 5K9CA 3TJLA 2GGHA 3IRSA 2P3EA 2OQHA 1WZMA 4K7YA 1IYXA 2DUZA 1VH7A 1XS2A 4LBUA 4L5ZA 3CO4A 1P48A 1PE1A 4H3DA 3B0PA 1DJNA 4M51A 3DFSA 4A8IA 3SI9A 3O7UA 2BOEX 4HMEA 4CKQA 3W7NA 4PFHA 2QCFA 1PUDA 1KBKA 4QGCA 3NO5A 1E5NA 1CGYA 1VD6A 4K2SA 2HVMA 8A3HA 3M47A 2V63A 4GYPC 3OZOA 1UWIA 3LCFA 4IWWA 1CGUA 2X0HA 1VFTA 3BH4A 4HZ6A 4LV4A 4MJMA 5F4WA 1DHPA 1JGMA 4P8XA 5G1YA 2AKMA 4TV6A 1LQ0A 1XPYA 4L4LA 1QI0A 1EP3A 3GUGA 3ZR4A 4MJ4A 2FGBA 4A3QA 5HQEA 5D33A 4LTSA 5A95A 2ZA2A 3MUZ1 4K6AA 1GVQA 4PEKA 1OG6A 1OC7A 1TZ7A 1K8YA 3BQ6A 1YRRA 1KCZA 2J75A 3DFTA 1V0KA 3VA8A 2PGEA 3MS8A 1VFMA 4Y2WA 3OJGA 3DBNA 1SFSA 1ME9A 1S2AA 2ALDA 2CLHA 1H63A 3PZQA 3WMLA 6XIAA 1AQFA 4RUBA 3BG9A 4PMDA 2ZRUA 4W84A 1V6XA 4BK9A 1A53A 5AC8A 5I0DA 3WLIA 3KS6A 1M9HA 3UNTA 4ORIA 3VIMA 2OKOA 3L21A 1OQFA 3SDOA 1IR1A 1B90A 1KM5A 3H7RA 2YFOA 4S3KA 5I2UA 1U1JA 3ONBA 1A0CA 1CBGA 1BSIA 1EGMA 3P0XA 4IICA 4UFJA 1E73M 3FOKA 1HO4A 1SSGA 3EX6A 2OQLA 3MCMA 2IQTA 3H53A 4QE5A 1TWZA 3ARVA 4QAIA 3E0VA 1FWTA 1T8QA 2QCHA 1KV8A 3SAZA 2VKZG 1TB3A 2HK0A 2UY2A 4MPQA 3DN5A 2R91A 3NZ1A 4EPKA 1FFRA 1FWAC 4M1BA 1HKIA 4PFMA 1UMLA 4DJEC 1NH6A 3ZLGA 3UG4A 4AC7C 3GAKA 2OSWA 2OFJA 3R13A 4DLFA 3VKAA 4W87A 1WZLA 1KM1A 3W82A 4FZIA 4ZFMA 1EC8A 5HXMA 1GVEA 3APTA 1LLWA 2J13A 5HMFA 4WJ8A 2GSHA 3PZVA 4HYVA 5CJNA 1XBZA 1E51A 3FLUA 4QDWA 3DXIA 5IHRA 5C2GA 1CXLA 1O68A 4IQDA 3GU1A 4XAPA 4AWUA 2FVLA 3VIJA 3WDQA 2NX3A 4M6UA 4Q8UA 3LNMA 1QPNA 2A7RA 2VDHA 2YXGA 2NQLA 3O06A 2WHJA 1VHCA 3V3WA 5C8BB 1BRLB 1DWHM 1ZFJA 5XINA 5G4HC 4J4KA 3W07A 1OX5A 4HIBA 2B7NA 1DIDA 4MVAA 1N2VA 1JZ3A 1UKPA 1RY0A 3CUZA 2YDRA 4M82A 4O16A 4XTIA 3GNNA 5FJIA 3KZPA 2C8NA 4HK5A 2CLIA 4O52A 3T2PA 5I03A 2FH6A 2BHZA 3W72A 3RLVA 7PTDA 2FPTA 3TUUA 4MFEA 1TJ1A 3IGHX 5L9FA 2DH2A 4JX5A 5FJTA 1NQ6A 1PB0A 1V0NA 2GQ3A 4HTYA 4JAWA 1YMYA 2HXTA 2QAFA 4Q8NA 4IIFA 3KHJA 4CNUA 1ZB5A 4Q8WA 3DEQA 2V5JA 1ME8A 2EPHA 3M07A 1VBHA 5EA9A 1YDVA 5GVJA 1CNVA 1BXBA 1K9FA 3GXDA 3TLLA 3R12A 1L6SA 3N2OA 4FP1A 3K13A 1R9ZA 3KWSA 2XWEA 5F4XA 4B2DA 1PVNA 4RJEA 3NCOA 2BY0A 5AOUA 1HW6A 4FMVA 3QF0A 3NL5A 3VCCA 1RCOB 1QWGA 1MUCA 3WK1A 1EEXA 2OLAA 4IJBA 5BRQA 3PSVA 4HSNA 4CNOA 1YX1A 3RO6A 2A3HA 3TCEA 3ZJ7A 4W88A 4BF9A 3IUHA 4E6MA 4JHMA 3HQOA 5T8GA 2VL4A 5JBEA 2DT0A 1N55A 1J2WA 4QNEA 1KFEA 5AHEA 3UW6A 4GI8A 2CESA 3URBA 1YPFA 1UWQA 1OFAA 3AXHA 3G8EA 2DIJA 1UIOA 2H8ZA 3BSHA 4LBSA 2JEQA 1BHGA 5ABFA 2ABAA 1JFXA 3E6EA 3JZUA 5C0QA 1UR0A 2QVHA 1X6UA 4DBEA 4E4FA 4O1DA 3WQEA 3RCMA 1UKOA 1VPQA 4QR6A 3UESA 3N2BA 2AQWA 1XD0A 1TUXA 4JIEA 4K38A 1ISYA 2BV9A 3U2ZA 2Y6ZA 4UTKA 4TR9A 1XCWA 2E0PA 1I0BA 2XFWA 3WLHA 1XIEA 5AYXA 2WSQA 1PX4A 1SW7A 5CC6A 3W0KA 1RPKA 2HVNA 4X60A 1XLCA 2OWCA 1O6IA 3IJLA 4ICNA 3VO0A 4DI8A 3OVGA 2D24A 1Q6FA 4GVGA 2J7CA 1YADA 3EA2A 3WD2A 4LNYA 3BV4A 3UETA 3W83A 3QPYA 1PKYA 2J47A 3W7EA 4O14A 4J35A 1AFSA 2ZUSA 5EMMA 3LERA 2VCCA 1AVAA 3T0BA 3WMBA 3B8SA 1HKKA 2QDEA 5HA7A 3VIHA 1ZY9A 4OV9A 2ISDA 3K4WA 3EB3A 4FA3A 1K8XA 3CPGA 1R9YA 4GQQA 2JIWA 3VNZA 2YLLA 2H6RA 4H00A 2CHRA 4QG8A 2RDWA 3M43A 4DAFA 3SUWA 4DYKA 4EWJA 5DCEA 3PBYA 5KETA 2QEZA 1W9UA 1ADSA 3EOEA 1NQKA 4HPGA 4NNCA 4JCLA 1RQHA 2E09A 1LL6A 1A47A 1C3FA 1NSJA 2JIEA 3AHVA 1ZENA 5GNZA 4NILA 2J74A 2ZRXA 2ICSA 2O9RA 5TD4A 3B0VC 2QIWA 3KUMA 1IZCA 2BTMA 2QJNA 2INZA 4Q7NA 4JBRA 1W3IA 2INEA 2WMHA 4MB4A 1LQ2A 4S39A 3VKCA 2REQA 3V0TA 2W5FA 4O53A 5D09A 1GUVA 4YNGA 5C9XA 3EKZA 4MZ1A 1KRBC 1KD0A 4GRSA 4MOZA 1GOKA 2GWGA 4H9VA 1GVRA 4OUEA 8XIAA 2J66A 3LBCA 3FJNA 3O6DA 3PR2A 1OIMA 3NPUA 1PPIA 3Q2DA 3UWWA 2Y7GA 4XVDA 3H24A 4GG9A 3S5SA 2Z1WA 1US3A 1I1XA 4GJJA 1K02A 3V5OA 3KDNA 4ZTXA 4EACA 1RVKA 5AC5A 1U5VA 3EWZA 1Z3NA 4ORMA 3TZNA 1TJ2A 1BAGA 1W1YA 3L12A 1K03A 3HG2A 3PBGA 1NDYA 3RIKA 1JZ7A 3N2TA 2V38A 3Q94A 4LFYA 2BGNE 3TW9A 2HWGA 2J9XA 1S2WA 2VI0A 4GUFA 5FJUA 2ZZ6A 3LZ3A 3CBWA 3K4AA 3I3EA 4QRNA 4DXKA 4A05A 1UYQA 3OLDA 1WB0A 1Q6DA 3POCA 1ZJHA 5BWAA 5AVNA 1YXDA 5CLWA 1ZNNA 1JNDA 1QXLA 2B4GA 3W1UA 5E1QA 1ELSA 1P6CA 2YXOA 1DWJM 1R38A 1Q6GA 4HNCA 3CL8A 1KWGA 2OG9A 5D4YA 1TWWA 3PUGA 2I5QA 1O94A 3RPMA 2E9MA 3M4HA 3KAOA 1QNQA 4CQDA 3MV01 3HM7A 3W29A 3J7HA 1EOKA 3LUTA 3B4UA 1Q4NX 1LTDA 4N2YA 4H9MA 4JNMA 4HNNA 3WO8A 5FJRA 1L0PA 3T6CA 1VCVA 3BOFA 1D8CA 4S3GA 2FTYA 2AAAA 3LPGA 2FVMA 3M0IA 1Q7MA 2V67A 4DY1A 4GVIA 3QTPA 3ABOA 1J01A 3PNZA 3LX9A 3VMNA 4WJEA 3GDTA 2NUYA 3U3HA 3W2LA 4H6EA 1VYRA 3H7VA 1HF6A 4JTSA 1E9IA 3ITXA 2PC8A 4HSOA 1TX2A 1MZHA 1TCMA 3KBSA 4ONVA 1V0MA 3IVTA 3T81A 5E5CA 3WUEA 2OT0A 5FEZA 3MP5A 3LY0A 3B97A 3B8DA 3MPGA 3ID7A 3LHZA 2WQDA 3IJ8A 3UERA 4C7DA 4OTKA 1M6JA 4LF2A 1CECA 1X1ZA 3FKRA 1Q6OA 3FS2A 3FY1A 4F0HA 1TR1A 3T42A 4O8RA 2O9PA 4HNLA 5AYZA 3BAXA 4AD2A 3NQEA 1DIKA 2PLJA 3R2GA 4MDOA 2YZRA 2GL5A 7A3HA 2PUZA 5DX7A 1BG9A 2Q3RA 1K8ZA 3NJ3A 2WMFA 1R7OA 4JN8A 3V1HA 4LBRA 1S3TC 3W7GA 4DJFD 4ACZA 1B5TA 3C0SA 2F2KA 3LPFA 3CEPA 3PG8A 1I6NA 5E9XA 1DTNA 3WNPA 3ZWTA 1T41A 1D7KA 4QLKA 4G6CA 2YFNA 4UQBA 3FK4A 3I7RA 2ZXDA 1RR2A 2G3IA 3FEQA 1Z7AA 3KZSA 4K8GA 2YYUA 3B8WA 3IVSA 2BXYA 4O0KA 5AB3A 3H2MA 2CZVA 2CC0A 2CCRA 2Y62A 1VJIA 3MCNA 5G1MA 1RBLA 1LYXA 3RNDA 2OELA 2CLFA 4QHRA 2VXNA 3XIMA 2QPSA 1XDJA 2Z6IA 3CWNA 3GTHA 4U2ZA 4A22A 4UMCA 3NG3A 3PTDA 1V79A 1VGAA 3MMUA 1BYCA 3V0SA 2KX9A 1MYRA 2IKIA 4UTMA 3BLEA 2ZRYA 1U5HA 3UZ5A 1VFOA 4AHPA 1WDPA 1ZL1A 4L6OA 1GJPA 1OFDA 2CFFA 1QHPA 2R1MA 4JL2A 2PDCA 4I9AA 2ODOA 4H41A 2WW5A 3G18A 1RCQA 2EPLX 4AY8A 4LB3A 1QNSA 1HGYA 2YYTA 1EWEA 4PMVA 3AWNA 5I02A 2XHYA 5AHLA 1TA3B 2PWUA 4H9YA 1XLLA 3POHA 2L5HA 3EOLA 4CU8A 2AKZA 1EX1A 1W1ZA 1KM0A 1IHIA 3KVJA 4F0SA 3EWDA 4AD3A 3VNMA 3YPIA 3LRKA 1ZCCA 4MB5A 4H8HA 1TMHA 2ZZ7A 3O0FA 3CQJA 3SQMA 1QK2A 1YIXA 2W63A 3ITYA 3MSGA 2Y5EA 4MMWA 4HCHA 1NM9A 1F3XA 1CB2A 4EPBC 4OV4A 5CPOA 3TA9A 1XLEA 5FSDC 1QR7A 1RD5A 3R10A 4AF0A 4N9CA 1KGWA 5LKYA 3FAXA 3FJ4A 1OD0A 4X2PA 2ACSA 3DYOA 2O4QA 2R6OA 2GJRA 4NIRA 1R2TA 3IEBA 4MUPA 3P61A 4D8LA 3OLIA 3AIVA 1YEYA 3GHSA 3R0DA 4JGDA 2GQ8A 1J0IA 1QWKA 4GXPA 1QAPA 1TR9A 3P60A 1WKYA 1B9ZA 3VIKA 4LPCA 1J5SA 1XGDA 4DUXA 3W86A 4LS2A 3VGGA 5EU9A 3QQ0A 3BDKA 3T0DA 3OZYA 3DOPA 1P43A 1VENA 3CC1A 4HZ7A 2R82A 2NXIA 1B54A 3B9NA 4KFOA 1XQLA 2MUCA 3O15A 4U4MA 3A3XA 4BEUA 3LGDA 4L56A 3EDDA 4UOZA 1FWBC 2ZWYA 5DMLA 5CBIA 5CC3A 3UJRA 1QDSA 2J88A 2ZFAA 4V1XA 4XG1A 3SUTA 2EPKX 3KRSA 1KR0A 4B3ZA 4BZYA 4S3AA 4YWIA 4JTDA 2VEKA 1E0XA 2Z6JA 3NSMA 4OIFA 4DNMA 1X97A 1IXPA 3HIJA 1NWRA 4W5UA 4GPNA 3TQKA 5C2CA 3TR2A 1RJQA 4FXFA 3D0CA 3XINA 1FWDC 2IPGA 5F1UA 1P5BA 3R0KA 3AZRA 3CTTA 1A5AA 2Y85A 2XVNA 1TREA 4JKKA 4Q8MA 4INFA 3W1AA 5BMXA 1DHKA 1KQYA 2WLZA 2XIJA 3A6OA 5REQA 1TV5A 2ZWZA 3MO4A 3DUGA 1QI3A 1S5WA 1ZBKA 4GD0A 4DI9A 3PJXA 4QEEA 1Z32X 3MWAA 4B15A 5KSWA 2C0HA 1QT1A 2R24A 3ME3A 3ALFA 3H23A 1G7VA 2EBNA 1BSLA 3QXBA 3V1PA 3CQHA 1GYMA 4GE8A 4GZEA 3OA3A 2GFTA 4H6QA 1YDOA 3KVKA 2J79A 1Y5VA 2CU0A 2XIQA 1V7YA 1TIMA 3S2CA 2FHFA 1RSCA 4C6NA 3C61A 3NQ8A 4MYAA 1WUEA 1EJ7L 3C3UA 2EJ1A 3CWHA 3RITA 4QDMA 4WY0F 4IQEA 1IEVA 1L6WA 1EKOA 3ICJA 3S5OA 3GWQA 1AW1A 2YZ5A 3QPEA 4ZR8A 4HA3A 3CM4A 4LCSA 1BXNA 4PRWA 2XIOA 1E6QM 4YJ5A 4F0LA 1K7FA 3TQVA 1EPVA 1LWHA 1HL8A 3LQGA 3EMZA 3GC2A 3MYPA 4UNLA 1VFHA 1W17A 5GJNA 3DGRA 3R5EA 1O4UA 1WAWA 3D3AA 1F3EA 1E1EA 1JDEA 1OM0A 1ZU8A 4D1IA 4KWWA 4O1FA 4H9ZA 4TIMA 2W67A 3VDBA 2ZUWA 3P0WA 1OFOA 3TU9A 1DKWA 3WNMA 4N6FA 3FXGA 1JAEA 2VGIA 3G1DA 1QRQA 1FOBA 4CN6A 5CBBA 3N15A 4BS0A 2Z24A 1RXOB 4ZMGA 1NWTA 5D03A 2EAWA 1LOQA 1O5RA 1V6WA 1HP5A 3DKJA 1JPKA 3N3MA 4JFTA 4JN6A 2XDFA 3QSTA 5REQB 6TAAA 3L4YA 4CNSA 1S38A 2YA2A 4GXWA 4D6GA 2V3GA 4CEXC 4AD1A 2RJGA 1W9XA 3IV8A 1LQAA 1XGEA 2Q8XA 2PSNA 3AHXA 3UCQA 4W93A 3NYZA 3QC0A 3W6YA 3HBLA 5DBTA 2I9UA 4XX6A 3UPBA 1AODA 2Y7FA 1RY8A 2Y61A 2PRLA 1OINA 3NO3A 3RO8A 3UXLA 1GONA 2ZX8A 4DF2A 1P0EA 2WAGA 5CXPA 4HHHA 1J6OA 1QW9A 4REQB 3NQ7A 2A3LA 3SGGA 2UZ9A 4GUHA 4ZOBA 3UGRA 2ZC8A 3OA5A 3KP1A 1HJUA 4D6EA 1UZ1A 3GXIA 4LVFA 2ABBA 2Q3OA 2Y24A 3GHTA 4ROQA 2DSVA 5LIXX 3L0GA 3SECA 3F4CA 2OT1A 3IS4A 5DXYA 4J3ZA 3QVQA 3O2LA 3L4WA 1D3CA 1TV4A 2QDDA 1H61A 2CLEA 1TPFA 4FXJA 1SYTA 2OO0A 1YPIA 3IVUA 3OLGA 2J77A 3MANA 5GJPA 4WZHA 2Y2WA 4ZVJA 1Q3NA 1XCXA 4H2CA 5BWFA 1TJRA 3W85A 5PTDA 4PB4A 1R87A 1VAHA 4XZWA 1KBJA 4UIOA 3W9ZA 4PTXA 3B8IA 3UG5A 2VEGA 2VUNA 1A4MA 3RRAA 4FEZA 3MUY1 3A5VA 5BRPA 3SIZA 2C79A 1E0VA 1S2TA 3GG0A 2PTXA 3AS3A 4PRTA 3V16A 4IIDA 1MFUA 5HNRA 1UR1A 4H4IA 3VNIA 3W1RA 1ECEA 1DPMA 2PCQA 3MKCA 4IPNB 1DYSA 1B57A 1Q66A 2PDLA 2V5CA 2DT3A 3FN9A 4S2BA 2IW0A 5CPMA 1MRAA 4NAFA 1F74A 2JBMA 2CEQA 1PV8A 3BCJA 3UY8A 4ZCWA 1PS9A 3KBJA 3L4VA 3TW6A 2QF7A 3AXMA 5BOFA 4N9BA 1EHAA 4QCFA 3WQ5A 1AH3A 4L9ZA 2G37A 3ZFHA 2P88A 3R7MA 5G2HA 4MSSA 3P81A 4LUSA 3NYDA 3TX9A 1N82A 1H1YA 3BMVA 3V36A 2QJHA 4JNZA 3K5XA 4XV0A 1KFKA 1JCYA 2GDUA 1OYBA 4ASTA 4ZBCA 3WF3A 4JL1A 2ZUMA 3HO8A 4Y9PA 2FZMA 5C55A 2HBXA 3KOZA 3CTLA 4U3AA 1NOFA 1A80A 3GG8A 4TX6A 3CHDA 3FSTA 2BB0A 2PDIA 4FNPA 1R7AA 3EOOA 4I9JA 3W7QA 1FWRA 1I2NA 3CU2A 4W86A 3I7SA 3W76A 4TV5A 5CG0A 3QMSA 3P82A 4B4FA 5C7HA 3H4GA 1WOBA 1EIXA 1R3QA 2JALA 3ZR6A 2TAAA 2WCAA 3Q58A 4GGHA 3T7VA 4P2VA 3TTSA 3EKLA 3CHCA 1LRQA 3VE9A 3GRIA 2OJPA 5AY7A 3N13A 3B0UX 2QDHA 5E0CA 1C92A 1B3WA 2PDFA 3PZOA 1VKFA 4PTWA 3VD7A 3RM4A 3UU0A 1W3JA 2E6AA 3EWYA 1UH3A 4F66A 6REQA 2WV8A 4KCWA 4ZE4A 2D0HA 4GABA 3CK5A 3APGA 3DFPA 4C6BA 4PC8A 4JX6A 1JPIA 4N9EA 2ISSA 3GNXA 5CPTA 1EUAA 3KCJA 3L2LA 3A9BA 4CUCA 3KS5A 1NP2A 1JYWA 1XQKA 3M6DA 4PULA 1UHVA 3M1ZA 2QMJA 1EDTA 3K8MA 3H12A 3ARPA 4DWSC 4AWSA 2TSYA 1F6YA 2NQZA 3R58A 4RW5A 3OQEA 2VGBA 1E40A 1GOWA 3QFEA 3W7MA 1V3MA 3W6MA 2C1IA 3BLLA 2WMGA 3PVFA 3TC3A 3E49A 1EP2A 3W28A 1HG3A 3VXGA 4PMOA 2BZNA 5AHIA 1FHLA 2KAUC 5AECA 3M0YA 3MUCA 5LA0A 3DENA 1PBGA 1TWDA 4GCXA 4H9XA 2VR2A 3RCYA 4IL2A 5IDZA 4RX0A 3RX4A 2FZNA 1VHNA 4JTKA 2WKGA 1CEOA 1LROA 2O55A 3ECQA 3W7DA 5HJXA 4LYQA 3QM3A 1TQJA 3PTKA 4PUMA 3CMJA 3KBMA 2C6QA 2PWDA 4L61A 1O95A 1UQYA 4MLJA 4X0VA 1OGSA 3WLLA 4V33A 4Q4MA 5I77A 3AYVA 1ZBWA 3GXNA 1G4EA 3W37A 1XG3A 3HJEA 3UBPC 4H6RA 2BOGX 5LYRA 3DU0A 3TJ4A 2PP0A 1C90A 4LRTA 1RBAA 3T8LA 4O18A 5IDIA 2V3FA 1ZS2A 4GUJA 4GMEA 1XRSA 3GDBA 3HPZA 4Q7IA 4C7FA 1OT2A 4YU1A 4E4PA 3UR8A 1XF0A 4ZOAA 1D7FA 3UYIA 1VYPX 2DUXA 2ZYFA 1REQB 3O05A 3B0XA 5J8LA 3AYSA 1GQLA 1XYZA 4KIEA 1NVMA 4JTAA 4DBUA 2J62A 1JUBA 3UR5A 4P7RA 5XIMA 3A9IA 4GUGA 3MA8A 1KBBA 3WELA 1GQJA 1UWUA 2X1IA 3P7YA 4LVGA 4RPPA 5CC7A 1TELA 1U30A 2DZTA 1JZ2A 3M5XA 1TTQA 3LCXA 3ENLA 3PBUA 4UBPC 1EXPA 4JQ2A 3GC5A 4G7FA 4XZMX 1YE4A 3ABZA 3OYXA 4JIHA 3CIVA 3PZNA 3BLDA 2Y8UA 3EX3A 4EOUA 2SFPA 1DQWA 1DE6A 2WKJA 4RNJA 4D6JA 2DDXA 4NY2A 4LVAA 4UR9A 1R2SA 1ZRQA 4HGXA 4B92A 3R6IA 3TONA 3KTSA 4JDYA 3N6JA 4QBXA 4PUJA 4UB9A 4KPLA 3C6CA 3SCPA 5B80A 3TQPA 2XSBA 5BRBA 3BOLA 2A6NA 4PSRA 4PMJA 1GOQA 4KBXA 3CHFA 3DG6A 3RYSA 3UPMA 5AKQA 4AIBA 2P1FA 5DCDA 2YSWA 4GI9A 1HVXA 3ANVA 3KCLA 3DFOA 1A5MC 1OX4B 1TV8A 2CXEA 3HB9A 1E0TA 1V4YA 3A22A 4DWSA 3M41A 2HVOA 2QIIA 1UWRA 2OEJA 4Q32A 2BXVA 3WUFA 4WX2A 1ZAHA 3WLSA 1CENA 4DJED 1ZP4A 2HEJA 3GS6A 2HPMA 1BPLB 1HTIA 4QG9A 3W7CA 3QTGA 4IJCA 4Q4KA 2R1PA 1VBGA 5KEZA 3TQ0A 4HSHA 3ARQA 3W24A 3TSBA 4RZ5A 4KFNA 1S5MA 4L1XA 2DGAA 1UC4A 3EXSA 3S2NA 3WH6A 5D8WA 2PE4A 3FHAA 1JF5A 3C2FA 4FNTA 3G1VA 3MSDA 3AIRA 1KKOA 1PIGA 3UJEA 4ZTYA 2ZRZA 2VQUA 4NAFB 1QW8A 2R14A 5MKGB 3LHYA 4E0CA 2A3AA 1XIBA 3BICA 2G8ZA 5T9BG 4CQCA 1PZ2A 1BRLA 4P7QA 5HNNA 1QI5A 2MNRA 1ZLPA 4DWSD 4XBJA 1CCWB 3GKAA 3VD4A 3ZT5A 3QV8A 3NPVA 4WDWA 3PPCA 5IXEA 2VC9A 3S6TA 2NVAA 2ISVA 2WO5A 1ISVA 1WXYA 4AZ7A 4DXXA 2V2CA 1YNPA 3T9PA 3P80A 3NZQA 4F0MA 4AHOA 2ZZ2A 3PJTA 1DP0A 4B5SA 2CZDA 1OFBA 2PF0A 3EB4A 1MMFA 1WBJA 2H9AB 3LGEA 1OBAA 4LW7A 3F5JA 3I6TA 2JF7A 5TBOA 3QV7A 1KFWA 2C13A 2P53A 3WF0A 4IPJA 1MW2A 1TPC1 2XU2A 4YYFA 5AYBA 1K70A 2AOSA 2V9DA 4G9PA 1JZ6A 3QGKC 1X1NA 2BOFX 4M6VA 3LHTA 4PBEA 2QNEA 1DWFM 1KWKA 2PD9A 1W3HA 2WANA 3ZZ1A 4B5XA 3LDVA 4PH6A 5FJJA 3QV6A 3SBFA 1R30A 2OZ3A 4FHAA 2YB4A 2A5HA 4E3TA 4V15A 4DO7A 2E3ZA 4C6MA 4OT7A 1EJXC 4M6QA 3HPAA 2PF8A 4J9JA 4JXCA 3S1XA 3WK2A 1FCBA 1CWYA 2ZA1A 4PMYA 4U5IA 3C2EA 3VGHA 3CUXA 1UD2A 3NQAA 5A6KA 3QSRA 5A6BD 1Z69A 2AMXA 3RX3A 1LG2A 2V0TA 3TOYA 3VC6A 3W22A 2ZX6A 1Z42A 5JH1A 1F4HA 1EO5A 2IKHA 3GH4A 3M0HA 2B7PA 3TFXA 4KKXA 1FQ0A 2QPUA 2V30A 2VYOA 4W8BA 4NG3A 1CLVA 1IQ8A 1GVYA 1XRTA 3THAA 3WEZA 3WBXA 3BVJA 2P8BA 3EDEA 4IPIA 1UP3A 1LT8A 3TCSA 4C6FA 4P7NA 2HE5A 1EDGA 4YCOA 2PDUA 2P8CA 4MNKA 4HMDA 1V8EA 3B0YA 4KETA 5M03A 3KM8A 4OVXA 4ADUA 1HIZA 2O9OA 1UKTA 4O1BA 4Y7EA 1EDQA 5KZ6A 1UZ4A 4WDTA 4PSPA 3BZGA 2RDUA 4HHLA 1RP9A 1V02A 5LA2A 3NSXA 1B1YA 4MJ2A 2XH4A 4FSAA 1J6PA 4IMEA 1RA5A 3PZIA 4EXBA 2A21A 3TYZA 3R1ZA 4UTHA 2WC4A 4PB5A 4AFYA 3OOQA 3G1SA 2VEPA 4LCQA 4DWDA 4MWAD 4GO8A 3EPNA 5D2XA 1GZ1A 2YA1A 2HS8A 1ZSXA 5IBXC 4AZCB 4XAFA 2Z1SA 3AAMA 2GSJA 4F2BA 4PMUA 3MCOA 1GG1A 1UQZA 4QQUA 1JZ5A 3EOUA 3KOWA 3UJSA 4O10A 5HNTA 2XVKA 5A6TC 3K1DA 4HU8A 2QPXA 3BAIA 4NJJA 3OLEA 1P1XA 1W5OA 2G50A 2VVSA 2VDIA 3WEOA 1FWJC 4O12A 4UCGA 3A4JA 1SZRA 3AOFA 4IIEA 1OFPA 2VURA 4NASA 1BGGA 2YW4A 2VOTA 2WJFA 4QLJA 1KM4A 2OZ8A 4HPHA 1DL3A 1S46A 2V5KA 2WLYA 3NGJA 1ZCOA 3WQPA 4CVWA 2EHHA 5A8QA 2E1DA 2PLKA 4UTJA 1TIWA 1HN1A 4D6DA 5JVLA 4HU3A 1GQIA 3KLLA 1TWSA 4V2XA 3ITLA 3HMJG 1A5NC 4RE2A 4R34A 3LI0A 3TDFA 2PRHA 3MP3A 4UFLA 3F2BA 3SGUA 3LHVA 5DF0A 2ZVIA 4WJXA 4ZL1A 1DV7A 3C0JA 1LUCA 4H83A 1A50A 2RHGA 1KXQA 2C18A 5FAGA 3PUEA 5D04C 4A3YA 3N29A 4IF2A 5JH2A 3IUDA 4KS0A 5KITA 2WJDA 1XP3A 4QEHA 3MI2A 4EP8C 2Z1BA 9RUBA 3W7KA 2IPJA 3CQIA 1K1DA 3T78A 3SN1A 4I9TA 4I6KA 2ZDRA 2PMQA 5E93A 5JXQA 3QKEA 3EGJA 3VD9A 1QBBA 2TYSA 4RE0A 1EA0A 2DW6A 2WWDA 1L6FA 2Z1XA 2HK1A 2V5LA 3I65A 4JFVA 4S3CA 4NYYA 5HMSA 4MYXA 1PX8A 5KTLA 4ATLA 4C6OA 4B3LA 5H8PA 3TROA 1ICPA 2AAMA 3WLMA 2ADAA 3SQSA 4AD0A 2GPTA 3O16A 4XAZA 1EF2A 1R47A 3S0CA 3OBEA 1X8CA 1WDRA 2VZSA 1N8FA 3C86A 3WG6A 2VENA 3VCNA 6PTDA 3A12A 1OGBA 1VJZA 3SEPA 1WDWA 3D47A 3GO2A 3M9YA 3WDJA 3P84A 4G8TA 4DJDA 5J5DA 3PTMA 5G5IA 3WH5A 3MT1A 2Q02A 5FIPA 4NZ3A 4MWAB 4AZHA 2NXGA 3GFZA 2RDXA 4O17A 4WR3A 1EBHA 1AQHA 5C54A 1QHZA 1JDCA 3URQA 2BBFA 2AL2A 1TMLA 2UBPC 1REQA 5MF5A 1A5UA 5JIPA 3ZT7A 3W70A 3V7PA 3RLUA 2RKXA 2VZTA 5K9DA 3N9RA 1OSEA 5G4EA 3E9AA 3G1RA 1JI2A 4EPDC 5C7VA 5GQBA 2NSOA 3DDMA 3KVMA 2IPWA 3OGSA 4A3UA 4UC5A 5A8GA 1KBLA 4NZ5A 4OU1A 4OWGA 2HTMA 2Z1VA 1WBHA 3VGFA 2W6RA 5AHNA 3BL3A 4KEUA 2VX4A 5E6ZA 2C19A 4WQ6A 9CGTA 3D46A 2VC5A 3FA5A 4B16A 1Y5WA 2XFYA 4F2UA 2D73A 1M5WA 4Q8TA 4GISA 1XLFA 3HGSA 1EZWA 4DBSA 4DELA 2ZX9A 1JDDA 3SZ8A 2FJKA 2X8RA 1OCJA 3NQBA 3TXVA 3ARXA 4BQ2A 3PAJA 2CZFA 4YLWA 3KEHA 3LLXA 1I60A 4G1NA 5E0FA 1QUMA 1UZDA 3WLJA 5FOOA 2BXZA 4I6VA 3F4VA 1PWLA 3VFLA 2XZ7A 4GGBA 4M5PA 4MADA 4QLLA 3WD3A 5D2WA 1UA7A 3NAVA 3L5LA 4QISA 1JD9A 2VVNA 2XH7A 3N9KA 3UD6A 4B90A 1QPKA 1XX1A 1U5JA 3EDFA 1IXQA 2QAPA 2WPBA 1UH4A 4Q3MA 4TXEA 3BQ5A 4ALDA 3NTYA 4GJIA 4R7WA 4N4PA 2O0TA 2BSLA 1W1TA 3PN8A 3MHUA 3IJ7A 1OGGA 5I6SA 4LUTB 2GK1B 4LS1A 3OG3A 5CKSA 3N14A 5DT7A 4XD3A 1PSCA 4KRUA 3AIUA 2IMRA 4HOWA 5BXPA 1UWSA 2ZKMX 4DO5A 1F76A 3B8TA 2F9RA 4OOZA 3VMPA 2DSUA 1F6PA 4Q4RA 2FHBA 3QY7A 4CD6A 3GM8A 4DYEA 1W5QA 2CW6A 1MEHA 1T40A 2F7FA 4JHOA 3C0QA 2VR5A 3QMTA 1M41A 3PM6A 4IP5A 3QLDA 2QJMA 3MZ2A 3BZJA 2QKFA 4CD8A 3F03K 4J3XA 4ZEPA 1TMQA 3GDRA 4ADTA 3UEQA 5CPQA 4I5XA 3W2JA 2DIEA 1GT8A 3T40A 4C6CA 3WL1A 1XBXA 1NDVA 3RFAA 2Z29A 3R8GA 5SWUA 3WQ8A 4MWAC 1XFBA 1ZGDA 3IJDA 2HS6A 4NHVA 1W3TA 3TXZA 2OX1A 4NJGA 3JUGA 2J27A 4AH7A 1F9CA 1I2RA 1FWEC 3G2GA 1B31A 2VEFA 5AC4A 4PBFA 3S3GA 1GWJA 3UJ2A 2Y7EA 4HU0A 5C9RA 4AD4A 1OK4A 3E0IA 2IQ0A 3GBEA 1DJZA 1MFVA 1HL9A 3MO7A 2H3BA 4JHZA 3IJIA 3I3DA 3V5CA 1QBAA 3NNTA 3ZMRA 1IT0A 4GZJA 4JTEA 4F4RA 3CAKA 2ZUNA 3BW2A 2P50A 1VS1A 1E6PA 4MPKA 3TC7A 1UMYA 1EJTC 4Y9NA 1P1MA 5B7YA 3R89A 3IWPA 4A6GA 2YKKA 3P6LA 1SFTA 1OABA 1XLJA 1O12A 3NSNA 3MI3A 3AMLA 3GW3A 2VWSA 3EDJA 4DZ5A 2V2DA 3HFTA 1JPMA 1P4CA 4Z1AA 2Y63A 3AISA 3UZJA 2PAJA 3T1GA 2IKJA 3CV6A 1FHDA 3AIEA 1YXCA 1GJWA 3BAJA 4EWND 4HJFA 5CGMA 3W74A 1T6MA 4S23A 3E0WA 3G1AA 3N73A 1IEQA 1NOWA 3ABSA 3PZMA 3CB8A 3BGAA 4IFRA 1OWQA 4I7VA 3TSMA 1G94A 1MQRA 1K4HA 5H1WA 2CBUA 4E3VA 4PMNA 2B31A 2XM2A 4NKCA 1GQNA 2D2GA 1SFLA 1J4EA 2REQB 2EJAA 4ILSA 2DY3A 2Y4SA 2VQTA 2P0OA 3HG5A 2QCLA 2GOKA 1H41A 1SU5A 3SCUA 1KKRA 1O5XA 1EJVC 4HNOA 1H2JA 1OC6A 2GUUA 3GHRA 4Z1YA 2YCJA 2D69A 3OIHA 1MVYA 1JFHA 2PP1A 3BLOA 5H2ZA 4RPQA 4DXVA 4PE8A 5JBDA 1HFBA 2E5DA 1GGOA 3SY8A 3WJZA 3PPHA 2CZ5A 1KRAC 3OODA 3S83A 2E4TA 4GVHA 5FACA 4KQNA 5C9ZA 1MWOA 4A3HA 3TTQA 1DJGA 2PTZA 3BPWA 4FOKA 2FGZA 5JMUA 5CEWA 1MUMA 1NP0A 1ONXA 1YW1A 3NO1A 2X2YA 1Z89A 1W2VA 2JKEA 2WBKA 1RCXB 3TK7A 4H8VA 2A4AA 2PLMA 3CEUA 1G67A 5HWJA 1ZAJA 3MHFA 4KEVA 2WPGA 3C52A 3E2SA 1F3TA 4NRRA 1E6XM 2Z28A 4A29A 3U8GA 3N4FA 4LY4A 3U7VA 1UOKA 4IP7A 3WZ0E 2G4JA 1XYBA 1POJA 1VFSA 1Q4WA 3VZYA 1IGWA 4PUNA 1FY6A 1XKYA 3N18A 3WLNA 4YXGA 2NUWA 4JTCA 1K9DA 1HKVA 4YHGA 2GJPA 1M3UA 3LHUA 1W5NA 1XYLA 2NSXA 1W32A 1P0NA 4IG2A 3N12A 4YTUA 2VWTA 2YL6A 4J2PA 3ZLFA 5AC7A 3S47A 1R0MA 3UXIA 4FF5A 4S1FA 3CHEA 1LRNA 1VB9A 2E5BA 3KFTA 4K1GA 4JYEA 1LOLA 3MVTA 4LX4A 4E2DA 1JCXA 2DZUA 5LA1A 1DXEA 1KM6A 2IXUA 4AAJA 1WDDA 1JF6A 2DZVA 4CNTA 4NU7A 2CKSA 3NURA 2V69A 4DJFA 1RJRA 1BD0A 5D2YA 3V5FA 1V3LA 3WKZA 2NQHA 3UF9A 3W2UA 1UCWA 4E5TA 3DC0A 5D38A 7REQB 2HZGA 4QJ4B 2I5IA 3C3NA 4EAMA 3G0UA 2UY3A 5TIMA 1K9EA 1ZALA 1WXJA 4XZHA 1XM3A 2KZHA 4NL1A 4DUWA 4H7CA 2GGJA 2PDYA 3OHMB 3VD5A 4Z2KA 1UUMA 5CGQA 2Y88A 3QPZA 1C7SA 2HJPA 1ESWA 3ZIZA 3QEZA 2PC4A 2R9RA 4ML4A 4U2YA 5IFTA 7ENLA 4LANA 1LJYA 3P8JA 2F6XA 1UWTA 3WH9A 3IIZA 2GWNA 3LCWA 1NWUA 1XIGA 2GJXA 3VI2A 2D2OA 4UTFA 3UZYA 5AHMA 1G01A 3VK5A 2DQXA 3TNOA 4AZBA 4BHYA 3BWWA 3HV9A 2WYSA 2F8QA 2Z4GA 4N0RA 3STEA 1IT8A 3KHDA 1LUCB 4QJ3B 3RLGA 3GW0A 3RM8A 4BY3A 3T0TA 3UG8A 4AG0A 3BGJA 2J7DA 2PP3A 4J3TA 1R3WA 2X2GA 3A64A 3MI6A 2RDTA 4H04A 1WZKA 4QROA 2RGMA 3T0CA 2VTFA 3CYVA 3M0ZA 2QV4A 1JDAA 5J5RA 3LCIA 3GY1A 2V5DA 3U48A 3RPDA 1HJXA 4DPPA 1FXQA 1TPDA 3ZSSA 2GVGA 4KWOA 3ATZA 2GVLA 4FX6M 1F4AA 2D2HA 4IH3A 3PPFA 1VBUA 2GUBA 1C7TA 1F8MA 1IWAA 3UR7A 3KL0A 1KM3A 5F2GA 1ITQA 3LMYA 4OJYA 2UY5A 4PL1A 1IEXA 4AMAA 3W4RA 1LLZA 4IOTA 4KEMA 2C3ZA 3TYAA 2ZTJA 3N3TA 3R43A 2XGZA 3GAYA 5DQPA 3SB0A 4UOJA 5JU6A 3GVGA 5A1AA 3W7PA 3NPWA 3PK7A 2DPEA 2RJHA 3IGUA 1PEZA 4G2DA 1B4EA 4AZIA 4MM1A 3NR0A 2NWRA 3RJYA 1F8IA 1AJ2A 2Y7DA 2QHAA 4PODA 1I9CB 3B8UA 4AC1X 3FX4A 1N8WA 1OFRA 2Y8KA 1XIHA 3EOSA 3SCNA 3CLMA 3W71A 3TAOA 4H9UA 2X7VA 2NT0A 4UTLA 3QN3A 4UR8A 3OGVA 3VTRA 2WVVA 4J3UA 4MDPA 3QOKA 1XBYA 4U33A 1XR2A 1X1OA 5G1TA 1D2KA 1F05A 1B30A 4IX0A 4OUIA 1UWAA 3M5YA 1WCGA 3FA4A 4MKSA 1QI2A 2I14A 1XLBA 3WDPP 3CV1A 1W5MA 5HMEA 3KWXA 4EPEC 3ALGA 5KINA 2X0YA 1PZ1A 1XC6A 1EUNA 4C6DA 4US5D 1TZZA 3B40A 4NZFA 1QOQA 1OY0A 4WK9A 4S3BA 3DERA 3HPXA 3T05A 1C91A 1O60A 3T2QA 4CCDA 2GSEA 1H51A 5D9OA 5HMDA 1BKSA 4PGLA 1E0WA 4M8UA 1NFPA 4LUYA 4W8LA 1LZOA 3IAPA 2DT1A 2NZLA 1ZPTA 4TMBA 5JBFA 1XUZA 2W3ZA 2ZTKA 1V3HA 1GOMA 3STPA 1QVBA 4PUDA 4QNWA 2Z25A 3DHFA 2ACQA 3GR8A 4DJDD 3G3DA 4HJWA 3E5BA 1Y8BA 1A0EA 1P6BA 5KZMA 2QCEA 2CBIA 4AY1A 2CPUA 2JK2A 1Q6CA 2W4XA 5CC5A 2XFRA 4PEEA 5LZLA 1WNOA 1K9TA 1JQXA 2YIHA 1HUVA 3AIWA 1C29A 1KO0A 3WDHA 4H7VA 1TFVA 2EF9A 4XKMA 4IGSA 2DZAA 1QATA 4ATWA 3N4EA 4IZGA 3GVWA 4JTTA 1BF2A 1QASA 3H21A 4I9MA 1S2CA 2BS9A 1ICSA 2OYKA 3ATYA 4HA0A 1NF7A 4DN1A 1EL3A 2ZZ4A 5EMJA 1XFCA 1A0DA 4ZGYA 3FXYA 2FZDA 4UNKA 4EXAA 3ZS4A 2FDMA 3T4CA 5D05A 3N2CA 2QCDA 1JZ8A 4MB3A 3G77A 3GUWA 5F2IA 3KVLA 1GW9A 1RV8A 3S6OA 4MFDA 2PDBA 1BXCA 2QVNA 1VQTA 4O57A 2G41A 3VOHA 2NW0A 3M0VA 4ZQMA 3SCVA 4GO9A 2QS8A 4K37A 2XGBA 4XK2A 2YB1A 4OKDA 2FPYA 3S1GA 5DLCA 3WN6A 3W7JA 4C91A 4D1JA 2J6VA 1U2YA 2YR1A 3NVTA 4GY0A 3LQLA 1M04A 1RA0A 1POKA 2CLKA 3DHPA 5HR6A 1XV8A 2FFCA 4E2BA 2OTDA 3WF2A 4L1GA 4IGNA 2OO6A 1P0KA 1OK6A 2XIIA 4CGTA 3ZWSA 2B0MA 1C8YA 3MB9A 2PTDA 1Q2RA 1TO3A 5LIUX 1W0MA 1UD5A 3M0XA 1V6YA 2ATSA 2QCCA 1ICQA 1LM1A 2XIMA 2DJXA 3DAQA 5ABGA 4QJ5B 3AMCA 2FYMA 3WQWA 1KGXA 4HYRA 1C8QA 2BDQA 4BEQA 4MNMA 3H4WA 1WDSA 4GFIA 4WGHA 4WHBA 3C4UA 3R25A 1Q85A 5A6JA 1JCNA 4LUTA 4GIYA 1FFQA 1CX9A 3DIPA 3VUSA 4O0ZA 3ORWA 3ZLHA 5HNUA 1D3GA 1SW0A 1E5JA 3HURA 1T7LA 2GVJA 1TVPA 1S1RA 2VFIA 4CQAA 3GH7A 4XZLX 1AUSL 5LNUA 3A5FA 4XSLA 3G5EA 3IIPA 1DORA 1R5YA 4RL3A 1R8LA 1TPWA 4OECA 4D8AA 5CZTA 1X96A 3BLKA 1IXNA 1V6VA 2YCKX 3IACA 1JDFA 4ZFCA 3QBUA 5FEPA 4V28A 3JW7A 4E8GA 2VGGA 4FLQA 4R7JA 3CPUA 4F40A 4UFMA 2OPJA 4GQRA 1F73A 5I3KA 5DANA 2QJJA 3AFBA 2A7PA 2CLPA 2XN0A 3L9CA 1RZMA 1S5TA 4YWSA 3GXTA 3ITOA 3MBDA 2DZPA 3FDKA 4N9DA 5LIWX 4WUIA 5IFPA 3ARWA 1JYNA 2A7NA 2PFHA 4FOUA 9XIMA 3ITGA 4JEQA 1E9YB 4IFKA 3L2IA 3OHIA 4DF0A 3MMDA 4K7VA 1GQKA 2VCBA 4S3FA 4NT0A 4LSBA 4F79A 2VEMA 4YTQA 2QCDB 3GFXA 1I4NA 1PTDA 5HJLA 3UYCA 2OEMA 1KBIA 4JICA 4X9SA 2PLCA 5EMKA 5HPOA 2OZ0A 4Q4PA 4AEOA 4FX8A 1G9HA 3BOXA 3W7OA 2Z7KA 1O5KA 4XZNX 2F6UA 2XYLA 1Q7ZA 2OMAA 2XN2A 1H5YA 3WDRA 4I7UA 3AS1A 1H7NA 4B9YA 3BSGA 4Q6JA 1EH9A 1DWAM 5M17A 2PRMA 2CLOA 3NM1A 3N4AA 1QNVA 3SFWA 2Z1KA 1PCKA 3K2GA 5FF2A 3QKZA 5EY5A 3A3WA 3E2VA 3M64A 1XIMA 1GVFA 2BY1A 3LMZA 3MJMA 5I3GA 4IXXA 4H1ZA 3L2MA 4PZVA 3A24A 1GVIA 4XO6A 2VZOA 1TTIA 4DJEA 2PDPA 2UV8G 2NVCA 4MY8A 2ASHA 2J7GA 4Q8QA 1PCWA 3K4DA 2E40A 2CLLA 5LHFA 4FXRA 1FWHC 3TP4A 3LCGA 2AL1A 4M6PA 1TJPA 5BXTA 4AIOA 2R1KA 1RD6A 1CZ1A 4U3CA 2F84A 2IQDA 3RU6A 1R3RA 2BGQA 4POCA 3DHDA 4TTUA 4W5ZA 1SO3A 2VRQA 3ARRA 3PWIA 4JS3A 1KTBA 3IUIA 1YDYA 4EK7A 2GYIA 4A2SA 2OGJA 1UR9A 3PULA 3AYTA 3WLQA 2Y5JA 3UXDA 1X6NA 3MUAA 3QV9A 2FZ9A 4HA1A 1LLOA 3ELFA 3UY7A 4FLRA 4AIEA 5AHFA 1GORA 2Z2UA 3WUBA 5C71A 3BSMA 2PDQA 3THQA 2BX7A 3CAWA 1CI1A 1KXTA 4J3VA 2F2HA 2BY2A 1EPXA 2WM0A 3VDAA 2QZRA 3FCPA 1G1YA 2WOQA 4U31A 5CG7A 4KEZA 4H01A 1BFNA 5HK4A 3IGSA 4W9TA 2XUCA 1H1NA 2WNZA 4YTSA 1OJXA 2VFGA 1GYLA 1X98A 1KCXA 2E77A 4WSKA 2A1YA 2Z26A 4XZIA 3BLFA 4AY7A 5CGTA 1UROA 2OYLA 5EMUA 1ADDA 2VEIA 3TTEA 4J40A 2PTWA 2C15A 1A5KC 3BANA 4LNCA 1VJSA 4J1OA 3PB2A 3K8LA 2G0WA 3CT7A 2D22A 4LGXA 2YA0A 3AJXA 1GOIA 2VHLA 2PDWA 3KXQA 4OBSA 4EF8A 1S2UA 1YE6A 3QHOA 5U7SA 3THDA 4DPQA 2D3NA 4NJIA 3U5YA 4F9DA 3MUXA 4L6DA 5C6MA 3TR9A 3GE7A 4TVCA 4ERAA 4UFIA 1B3VA 3TYBA 1ONWA 3CUIA 4PTNA 3R11A 4HNTA 3ZT6A 2ZADA 4C1LA 1AA1B 1G7UA 3BUVA 2JF6A 2D0FA 3UGVA 1XH2A 3TYDA 5T9CE 3KW3A 4JY9A 5FF4A 4PA8A 5GJMA 5BNKA 1Q2SA 4NX0A 3VIGA 4PB3A 1Q7QA 5FA5A 1QOXA 4Z1BA 1SR0A 5BW6A 1S2VA 3IJQA 4US6A 2ZA3A 1EYEA 1FX6A 3AMDA 3WQVA 3OYZA 3TSDA 4Q22A 5A2CA 5IBXA 4HA4A 4JEJA 2Z00A 3NZGA 1R85A 3AHYA 4EX4A 1G5AA 3PY2A 3FKKA 4AMCA 1Z48A 4MZYA 4L4OA 3U7BA 4RR4A 5CZSA 3BG5A 4IP4A 1JAKA 1SR9A 4IXHA 1FWIC 3EMCA 2V6AA 4JQ1A 3W1XA 3CZ8A 2D2JA 4BA0A 2WSPA 1PYFA 3EPMA 4I90A 2ZXBA 3OGRA 1J10A 3EB2A 3MP4A 3IRDA 2WHKA 1GHSA 5IHSA 3B04A 3NEVA 4W4QA 4QS6A 1HJQA 4AIUA 4JTIA 4Q33A 3WLTA 2RGLA 3AXIA 2EGZA 1L6GA 3MMWA 3GB6A 5D37A 3HQNA 3DYMA 3VINA 2GQ9A 4AEFA 4KGLA 3KBWA 1BKHA 2WNNA 1QNOA 3CZLA 2J9YA 5LGXA 1W1PA 3BARA 4R7OA 1GKRA 4KWUA 1RLDA 2WVTA 2A0NA 3RPTA 1KFBA 4NI3A 3FFSA 2PZNA 2FGLA 4D72A 1DJWA 4MF4A 4MKVA 3OZPA 2JE8A 5CH9A 1F5ZA 4M56A 4NX5A 1WYIA 4KH2A 4Z2GA 3SCQA 2JGYA 1UW9A 3SN0A 5DMMA 1VC4A 3MQTA 3TVAA 2PDNA 4RV3A 1PYMA 1JRCA 3F2DA 1BF6A 1J0JA 3KCOA 1MXSA 3PTQA 1ECQA 3ANUA 2DQWA 3E5PA 5M5DA 4TUFA 3DFNA 2FMOA 2MANA 4TOQA 5BOEA 1JZ4A 4HK7A 1S39A 4IPPA 1MUWA 4Z2HA 2VDGA 1E55A 1V08A 2OX4A 3QY8A 4ML9A 1VPXA 2XH0A 2BNJA 1EIBA 4LCRA 2G4FA 1XYAA 4WIWA 2AGKA 1G4TA 5FEWA 1YPXA 1OCQA 2OSYA 1US2A 5BYWA 3LBMA 2VD9A 4PBGA 2YL5A 4PUEA 1MSSA 2R8WA 2VZUA 2WHLA 1M53A 3GIQA 1Z44A 1FXPA 4YYCA 2DP3A 4GOAA 4LXFA 3M7SA 2YCEA 2YXXA 1CT5A 1VR6A 1Y7VA 3LXAA 2GZXA 4GFSA 3CQ0A 3QZEA 2J7BA 2QUMA 3GDKA 7CGTA 1EC9A 2IUZA 3MSRA 4DUVA 1PTAA 5FSEC 1XIDA 1LF1A 3PZGA 2X05A 4K68A 4UQAA 1X6LA 2VO5A 1DOSA 1QTWA 3GBDA 4WY0A 2ZIDA 3NGFA 4Y9AA 2FTPA 2DEPA 4KF1A 1M7PA 4KRZA 1PXGA 5BROA 3CMFA 3A4AA 1DJIA 3IANA 3TYEA 1W3LA 2GJXB 3VCRA 2WVUA 1X38A 4C60A 1LP6A 4TX8A 3DESA 1PAMA 1GKQA 1CXFA 3TN3A 1OF6A 3PFMA 2Y89A 1OVDA 3AALA 3AHTA 2JGQA 3ZJ6A 3BJTA 1B3OA 4US5A 3AICA 2DU2A 1G0CA 3QW3A 4MNJA 3PBWA 4HKPA 4MTVA 1WO2A 1HNYA 4C1KA 4F48A 3W53A 5HQLA 3UFYA 3VKBA 5I24A 4ATDA 2WZEA 1I0DA 2AQVA 3E38A 3NQDA 3USBA 3AJ7A 3BMXA 3H2FA 5EBUA 4FS9A 2POZA 3W87A 5I5RA 1ITUA 1CGVA 1L8PA 2EXOA 4KCUA 3T2OA 5EMYA 1UJPA 1VFLA 4QITA 2ALRA 4H6KA 1CXIA 2HV5A 1JG9A 2YOCA 2OEKA 3DFHA 4ZQOA 4UXDA 1A5BA 3ZR5A 1K6AA 1E3ZA 4AQLA 3WLRA 1FWSA 2V5BA 1V0LA 3B4YA 3GSMA 4ERIA 4FIRA 3W25A 3KL5A 3WQ4A 2EG7A 3L23A 5CSSA 4RCXA 1H7OA 4IGHA 3EBVA 1O7AA 5CSYA 4C90A 2QV5A 3EAUA 5I23A 2VUYA 3RMJA 2YBUA 3ARZA 1SMDA 1LT7A 3LTYA 4IFOA 5DRIA 3WF4A 4P61A 6TIMA 4LEFA 3W1QA 3PB0A 4J28A 2ZRVA 3MKVA 4JX4A 2G95A 4YPJA 3SRFA 3RU8X 1MW0A 4HTBA 1TSIA 3W81A 1BYAA 1F61A 1SO6A 3XISA 4B5TA 4L4PA 3DBPA 3S1UA 2E68A 1CDGA 1T96A 3WBEA 2DSWA 3PWAA 2PD5A 4CCEA 4LALA 3W00A 2WMIA 1KTNA 4BF5A 4X0NA 1TV7A 1LG1A 4YMZA 3S1WA 3VIIA 2R1NA 3C2YA 1OB0A 2DT2A 3WH7A 3BJSA 2PBOA 2WVVB 1X7FA 1LCOA 2B7OA 1LRTA 4GYJA 1SJDA 4Z0JA 3DKLA 2OXNA 3H2EA 4WKFA 4LT9A 4E4UA 1QO2A 5EFDA 1UPPA 3FVMA 3VNKA 3MSYA 2DH3A 2PI6A 2V3DA 3Q37A 1S3HA 3T09A 5CPNA 3NZPA 2E1WA 1THFD 1ISZA 3GD6A 4DJDC 1ODUA 4A8NA 4XSMA 1XXXA 1OX4A 3O63A 1Q65A 1BVWA 2V8ZA 3UWQA 3FEMA 4NZJA 3WEMA 1XI3A 3F1QA 4K39A 1I45A 3P74A 2X41A 3NDZA 3TJXA 3VOIA 3DECA 4FNSA 3BW3A 1PJ9A 5A2AA 3WNOA 2CNCA 5CZJA 4LH8A 4HZMA 3DFYA 2YGYA 3KL3A 4BQ5A 1F2JA 3OVQA 4DO6A 2C7FA 3QHMA 2ZX5A 2A85A 2C0AA 2PU0A 7TAAA 1NTHA 4LAKA 1QCWA 3PS7A 2WSKA 3PANA 3W27A 1MO0A 1E3XA 4WEVX 4PL2A 2QCNA 4ZB2A 1XLKA 3V75A 4C1NA 5CJ5A 4GKTA 1W9DM 3TKFA 4NNBA 3AS2A 3H54A 2YDSA 4HPXA 1J12A 1CB7B 5EFFA 4UQEA 3VDGA 4IMFA 4J7RA 4ZQNA 2ISWA 3CZGA 4JFWA 1K4GA 1ZBCA 2XINA 3VNJA 4JTRA 5BXRA 2ON3A 3W6LA 4BI5A 3M44A 3W7RA 1PKMA 3WLOA 2PGFA 4GNJA 2VT0A 1T99A 6A3HA 1XH0A 4DM2A 4A21A 2ZUTA 4GUIA 4YIWA 1RBOB 4QE4A 3MKKA 4W85A 3L67A 5H6HA 4J2MA 1W56A 4B2DD 3HPSA 3KX6A 1U1HA 3IIXA 5LIKX 5CLTA 3QLLA 4AZCA 3PZTA 1EO7A 2WZTA 1E71M 4GNKB 1M7JA 5AVHA 1JD7A 4MG4A 3WDIA 3KOFA 2I57A 1MNZA 1D9EA 1UOZA 2W27A 3RF9A 3PWGA 1J0KA 3U5UA 1FKWA 3N9SA 3EMQA 1OIFA 2FMNA 4ECLA 1U1UA 1TYGA 3PP7A 5HAOA 3IPWA 1UASA 1LL7A 3WD1A 4AZ6A 4MWAA 2OQYA 4WOZA 3ZXWA 2OYMA 4QCEA 3ARYA 3EWUA 3HQ1A 3CQKA 4WDUA 1XYMA 3I68A 1QMLA 3LXCA 1KV5A 1QFEA 1FWCC 2PS2A 1CXKA 3P3BA 2AMGA 4OOUA 3CIXA 3LRMA 3QGVA 4ZXLA 3B9AA 4AHQA 1OC5A 1PZ0A 3FYOA 3CH9A 4Q7BA 3WFAA 1YBQB 1XIFA 3VFCA 2P5NA 4GX8A 3PBMA 2NQ9A 3CH0A 1HKMA 1ISXA 4PTDA 1W1A1 5A3HA 1TX0A 5DRCA 5KMYA 3IIOA 2YCLA 1H09A 4WXYA 1OD8A 2C1GA 3Q4DA 1YXYA 1BWLA 1E4IA 4NAEA 5GNYA 3U4AA 5C70A 1FDZA 1JR1A 4IIHA 2J8GA 4CN4A 1V3KA 3H7UA 7TIMA 5BCAA 1XLIA 5K2ZA 3C8NA 4KT2A 4XD4A 1J18A 5LHEA 3BGGA 2G96A 4REQA 1EJSC 1E4LA 1YYAA 4WGXA 1DQUA 2NQ5A 2NWSA 4UMBA 1M03A 4D2JA 1J79A 1AL8A 3FJLA 1FH7A 3SUUA 1XL9A 1C9DA 4LUJA 3HGJA 3F4NA 3LA4A 4RDYA 1FWWA 1XKJA 3EWXA 1W37A 1W2PA 4R9XA 4LYPA 3WJYA 5FEXA 3A4WA 1XLAA 4L9YA 1B3XA 4IISA 3MDUA 3CXOA 3GC4A 2GGIA 4L65A 3TIMA 1UP2A 1UD8A 1ITXA 4G1KA 1BTCA 3CLWA 2YBVA 3MZNA 2E6YA 3OIXA 4G5DA 4PMRA 5A5WA 2ATMA 4A2RA 1EX5A 4MIMA 2UY4A 2HNHA 1RJPA 1EYWA 1SJAA 2H9AA 1ZJAA 3PUDA 1AZ1A 1W3KA 3I6EA 4ERGA 3NQ6A 3NWRA 4DEFA 2CITA 4U28A 5D32A 4C6IA 1NELA 3S5YA 2X42A 3C8FA 3GH5A 3WLKX 3AUJA 3W84A 4C6LA 1TTJA 3EDKA 2NLYA 3IK4A 3E2QA 4S3EA 1FUYA 5T91A 3WQGA 3VIFA 1OCNA 4JR5A 4AWTA 1MW1A 3W75A 1VF8A 1E4MM 3VILA 2I5GA 2DVTA 1VRDA 3DYPA 4IT1A 3VNYA 1TKKA 4H2HA 1FP8A 1SFJA 1YBQA 3LHWA 4EIVA 1QNPA 4WCJA 4ZSUA 2CWNA 1VLIA 5DFAA 3ZSTA 1ZUAX 1GNXA 2QJIA 3KBVA 4TVDA 5BOOA 1AJZA 5DMNA 3GYEA 4CCCA 1BVZA 4DM1A 1KM2A 3O9NA 3VKKA 3BXWA 3U2CA 2ZZ1A 3RHGA 3W7HA 1FP9A 2ZUVA 3QGAC 5FL1A 3NL3A 3W2NA 4UCFA 3N17A 4M7SA 4O15A 3OZMA 3NDOA 2AL2B 1P6WA 4UTWC 1NWSA 5FJPA 1HVQA 3RM9A 1VCGA 4GIRA 2DV0A 2E5CA 4YTTA 4QSHA 6CGTA 3NUKA 1X39A 4AVFA 1SM9A 4TX9A 3LS9A 1L2UA 4MNLA 1Q8AA 3C0LA 3EXRA 1E6RA 3NFUA 4IMAA 2J8FA 4HPJA 2XSXA 1L2QA 4BCEA 2W9MA 4ZA0A 3F5KA 4TTGA 2XFFA 4C7GA 2G3JA 3SRHA 3I6RA 3UCDA 1SVDA 1TPUA 4WY0B 2B7QA 5ABHA 2E8ZA 1FKXA 1C93A 3L4XA 3MY9A 2QGHA 4DWSB 2WKLA 4FX7A 3D3FA 3URAA 3II1A 4FLOA 4YL2A 2WZIA 3RMEA 3KDOA 2VFHA 1NDWA 2Q01A 2EKCA 2ZQ0A 1MDRA 4CNNA 4LWWA 1J2BA 3GZ3A 1Q13A 3L4ZA 4XAYA 2WB5A 4RNFA 1EGZA 1LBMA 1VCFA 2GGGA 1CXEA 1SO5A 4MHBA 4IHCA 4AVOA 2HXUA 1L9WA 4D6FA 5DMYA 3LLDA 2R94A 3JR2A 3U0HA 1IF2A 2B81A 4DLMA 1OT1A 3M0LA 2ZZ5A 3NQGA 2D1ZA 4DBDA 2OWWA 3BCDA 5I07A 3SCSA 1UZHA 1UD3A 3TH6A 3VZZA 1IIHA 2PWGA 4AW7A 4CQ9A 3WENA 5FL0A 4L9XA 4HB7A 4XUYA 1W31A 3AWOA 1VLWA 2PCEA 3VX1A 3BE7A 4WF7A 4KMQA 3WL0A 3VC5A 2PODA 1V02E 2YL8A 4GYFA 2ZX7A 1TZ9A 1K7XA 3BK0A 3GIYA 4GNVA 1UD4A 2O92A 2PDGA 5AC6A 6ALDA 1B3YA 1IWBA 4W7UA 1H1ZA 4L64A 3BW4A 3TFCA 1I1WA 1JVNA 1E1FA 3EA1A 4HN8A 1OFQA 2Y5SA 4LAZA 1OZMA 3NOEA 3HV8A 3EWCA 2ONEA 1ODZA 5A69A 4BQ3A 4Y8EA 2WJZA 2PU1A 1M68A 5CAKA 4XKYB 3WNKA 5HR7A 2WSYA 3LPPA 4IIBA 3OP2A 1UIPA 2HISA 1FWGC 3V18A 1V51A 3AQUA 1FCQA 1SO4A 4ZZ9