4WDTA

17beta-hsd5 in complex with 2-nitro-5-(phenylsulfonyl)phenol
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdtA00
2PDXA 1EF3A 4GABA 2I17A 2IPJA 2WZTA 3ONBA 3N6QA 4Q3MA 1GVEA 3R7MA 4JQ1A 1XJBA 4YVPA 4WEVX 2R9RA 4NKCA 3MB9A 3UYIA 5C7HA 1UR3M 3R94A 1VBJA 3H7RA 4PRTA 1K8CA 1Z8AA 3R8HA 3UZXA 4XZLX 3LD5A 2HVOA 2PDPA 3R43A 4JTAA 5HA7A 2BGSA 2PDWA 3COTA 3M4HA 4Q7BA 4AUBA 4PMJA 3O3RA 2IPFA 3P2VA 1PWLA 3V0SA 3LBOA 1XGDA 4YVXA 2IKJA 1XF0A 5DANA 4PUUA 3LUTA 4WDTA 4IGSA 4DBSA 4I5XA 3H4GA 2HV5A 3M0IA 4PR4A 2PF8A 2PDGA 5LIKX 3KRBA 4JQ2A 2IKHA 5AZ1A 1X97A 2HVNA 3GHTA 1YE4A 1C9WA 1HQTA 4DBUA 3UWEA 1SM9A 1AH0A 3QKZA 1YE6A 1AH3A 2PEVA 4LAUA 4XVDA 2PDLA 2FZ8A 1AH4A 4LAZA 1US0A 2ACQA 1IEIA 3GHRA 2P5NA 3ERPA 2PFHA 3G5EA 3MC5A 4JIIX 1ZSXA 1R38A 2VDGA 2NVDA 2PDNA 1Z9AA 2IKGA 4ICCX 2PDKA 3O0KA 3CV6A 3RX4A 1S2AA 3NTYA 3DOPA 3RX3A 2INZA 3CMFA 2PDCA 4WRHA 5LIYX 3BCJA 3WCZA 5M2FX 2ACUA 3LN3A 1M9HA 2PDFA 2C91A 4G5DA 1ZQ5A 3FX4A 3WBXA 4FAMA 4QX4A 4WDWA 3V0TA 4XVEA 3N2TA 2PDHA 3DN5A 4LB4A 4MHBA 4GQ0A 3GHSA 1YNQA 1J96A 3EB4A 3LENA 1S1RA 2HE8A 3CV7A 3V36A 2DUXA 2R24A 2HEJA 5LIXX 4DZ5A 4JQ3A 4WGHA 1RALA 4JTCA 1PWMA 3R8GA 2FVLA 2IPWA 3Q65A 4JTRA 3BV7A 2PDUA 1QRQA 3R6IA 3B3DA 2CLPA 3FJNA 1Z3NA 3WBYA 3VXGA 4XZNX 1S2CA 2FZ9A 1HW6A 4XZHA 1T41A 4QBXA 2HE5A 1ZGDA 4XK2A 2IS7A 1MI3A 1Q13A 4JTDA 3S3GA 2PDYA 4LB3A 4GCAA 1IHIA 2DUZA 3UFYA 2AGTA 2ISFA 1EXBA 3Q67A 3G1RA 4GIEA 4QXIA 3EAUA 4XZMX 1QWKA 4XZIA 1ADSA 2PDBA 4JQ4A 1AZ2A 1Z89A 2FGBA 3M64A 2ACSA 4HMNA 4L1XA 5KETA 3ONCA 4FALA 1LQAA 2F38A 3U2CA 2IPGA 4QR6A 4FZIA 3EB3A 2BGQA 1PZ1A 4OTKA 2ALRA 2I16A 2PDQA 4H8NA 4ZFCA 2PZNA 3LNMA 4YU1A 4DBWA 3UZYA 4LBSA 2IKIA 1AFSA 2IQ0A 5HNTA 1MRQA 2J8TA 5HNUA 4L1WA 3F7JA 2BP1A 4XO7A 1MZRA 4RPQA 3T42A 3BUVA 4R9OA 1RY0A 3LQGA 2FZDA 3R58A 3CAVA 1YNPA 3UGRA 1FRBA 2PDIA 3UZWA 2FZBA 4GACA 1RY8A 2DV0A 1OG6A 4EXBA 4PRRA 3D3FA 4IJRA 3GUGA 4JIHA 4YS1A 2IQDA 3GHUA 3V0UA 1EL3A 2PD5A 4LBRA 2HDJA 1JEZA 1ZUAX 4HBKA 4FA3A 2ACRA 3RX2A 2PD9A 3CASA 4JTQA 3UG8A 3H7UA 3CAQA 3WBWA 4YVVA 3WG6A 5JH2A 1A80A 2PDMA 5LIUX 5JH1A 1AZ1A 1T40A 1S1PA 4F40A 5AZ0A 2WZMA 4JIRA 1PYFA 3LZ5A 3LEPA 3LQLA 2NVCA 1VP5A 4WDXA 1X96A 2A79A 4WDUA 4PUWA 1EKOA 1X98A 1LWIA 1PZ0A 3UZZA 3BURA 4XAPA 4EXAA 4ASTA 3C3UA 4XO6A 4GA8A 4IJCA 2PDJA 1Q5MA 3V35A 2F2KA 5LIWX 3UP8A 4JQAA 4GQGA 3LZ3A 2QXWA 2INEA 4H7CA
chains in the Genus database with same CATH superfamily
1E3XA 1W3IA 1SZEA 1LLZA 3W84A 4AWUA 2WZTA 1LG1A 2GL5A 3EDJA 3TN4A 5K4XA 1ZBKA 3NZRA 4DYEA 1GVYA 1UWSA 4CU8A 1DIKA 1TR9A 1C8VA 1OD0A 2DSKA 2O7QA 2RDUA 5E93A 3UXLA 3U6WA 2WZIA 4TIMA 2WC7A 1T6MA 1EIXA 3ZWSA 2FGLA 5TIMA 1B30A 2ZVIA 2DPEA 4IF2A 3HJZA 4Y8EA 3T8QA 1RP8A 2OZTA 1WXJA 3ABQA 2NX3A 3R43A 4C6KA 2HNEA 5AKQA 3QV6A 3E2QA 1O1HA 1KCLA 1JDAA 3W72A 4AUBA 1IZJA 2J66A 4NXKA 3PZ9A 4DI8A 2IPFA 2W63A 3ZZ1A 1I2RA 4ZE4A 1K4HA 3ARXA 4P7RA 4O1DA 1LBLA 1GYLA 2BXYA 2ZOXA 5FF4A 1LBFA 3W74A 2X7WA 3GZAA 1A5AA 2F61A 3IVTA 1OJXA 4X2PA 4ZTYA 4MY9A 3TTSA 4P61A 1FQ0A 3KRSA 3OYXA 1G69A 4XKMA 4Y6GA 4UMCA 2R82A 3UD6A 4E2DA 2IKHA 3FYOA 2DORA 3TA6A 1SR9A 1TMLA 4MADA 4MAZA 1I8JA 1X6UA 4O52A 5TAOA 1JZ6A 4ONVA 5ABTA 3GDTA 2WJZA 2E67A 1TWSA 3N1AA 5D04C 4I3GA 3UA3A 1Q6LA 4F48A 2ACQA 2YZ5A 1KCKA 1XLIA 1RK6A 4N6EA 2PFHA 4H1ZA 4H9VA 4AZGA 2QHAA 3ITYA 3N73A 5F1UA 4JFUA 1ZLPA 3K8KA 2DVUA 5A2AA 2JF7A 3TV8A 2CZEA 3WDPP 4CD5A 2YX0A 4O1AA 4BF5A 1JPHA 1XINA 1VBGA 4M1RA 2QUTA 3K8LA 2WPBA 2PC4A 1GTHA 2D23A 1IEXA 2J6VA 3PBGA 3EDDA 1BQGA 5CJMA 4PMRA 2DQWA 4L4LA 4J3TA 1K77A 1QNPA 3EB4A 4RV8A 1CXLA 4AFYA 2UY5A 4DX3A 2O92A 4FEZA 1JZ7A 4HU4A 1QPNA 2ISDA 2H8XA 3WH5A 4JTCA 3IEBA 1K7XA 1S5MA 3A3WA 2FVLA 4V1YA 4JYDA 3PUGA 1LT8A 1C3FA 3R6IA 1SZFA 3CQKA 3C2OA 2GZXA 3TCSA 5JBEA 5LKYA 4XZNX 1S2CA 2C79A 5KEZA 1LORA 4HZ6A 1F4HA 1K02A 1XLFA 4Z1YA 4C5YA 4LALA 1WXYA 4QAIA 1Q6EA 2FZNA 4IQJA 3UXDA 4LNCA 1ISVA 1ZENA 2YKKA 3VX1A 1JAKA 2WHMA 1E0XA 1BF6A 1W2PA 4ZCWA 1OFEA 3AIWA 2FDSA 1UH3A 4FLRA 3GDLA 4PMYA 8A3HA 1PYMA 4ADSA 3WENA 2PLKA 4FALA 1R6WA 3HZ3A 3CC1A 3AJXA 3WQPA 3EEZA 4CKQA 3F1QA 3MJYA 3GUWA 4K6AA 4TX6A 2ALRA 2OO6A 2NZLA 1XG4A 3PAOA 5KSWA 1V3KA 3NO3A 4AZ6A 3CIWA 3TTOA 3WKZA 5EL1A 1ZAJA 3WNPA 4XO7A 2L5HA 4EAMA 4QG6A 1HJVA 3E2SA 1Q2SA 3WEOA 4PC8A 5FL1A 3LQGA 4RPPA 3A64A 5BRPA 2GQ8A 2VRJA 3QHNA 4I9TA 3PNZA 4W85A 3IWPA 2CWNA 2E5CA 2BY2A 2CKSA 1XISA 4RL3A 1E9IA 1DJGA 4XBKA 4IJRA 3P5YA 3UR5A 1FWSA 2GOKA 3EX2A 1SPQA 2EKCA 2D73A 2CZFA 3NL2A 3PVFA 1HGWA 4ZOCA 1EL3A 3O07A 1WQ5A 1H63A 3OQEA 4XD4A 4ZEPA 1T7LA 3GKFA 2B31A 1P0BA 5T9BG 1JL8A 1BHGA 4BFAA 1GQNA 1M7OA 4QLKA 3TJXA 4CNOA 1VRXA 4XIAA 3NQ7A 2E6DA 1OX4A 4MVAA 2YCIX 2GGJA 4NILA 3WNNA 2Z7KA 3H7UA 3GB6A 3ZLHA 1QWGA 1YNYA 5LYRA 1NU5A 2DIEA 4KEZA 4IIGA 4S3CA 3IGHX 4HA3A 2CEQA 3N13A 4LUIA 2R6OA 1DORA 1TPUA 3G0SA 4L7ZA 3BJFA 3RMEA 5HPOA 3DESA 4X60A 3L2IA 1AW2A 1WA3A 1NH6A 3MSDA 1S39A 3WFAA 3BGJA 4XUGA 1GHRA 3E02A 1RAKA 2CW6A 3SUWA 1SGJA 1QMLA 1XLHA 5F2LA 4X9YA 4IGMA 3C2RA 5REQA 4MGGA 1SJDA 1SSDA 4RE3A 2R1KA 4M5PA 4FNUA 2Z27A 4C7FA 4LWWA 1J0IA 4B92A 4XAYA 4DO4A 3SFKA 4O8RA 3VILA 1UHVA 4LOCA 4HNUA 3BH4A 3INPA 1EA9C 1I45A 1QNVA 3AYVA 4GZIA 1QNRA 1HJSA 1XV8A 2C19A 1GOQA 3N6QA 2WNWA 4C90A 1YDYA 5FEWA 2YCEA 1GORA 3T1GA 4HSOA 1BPLB 2OYMA 3HF3A 1SR0A 2JGYA 4NQ1A 1KBLA 2EQDA 1DIOA 4AIUA 4LW7A 3W1MA 3EX6A 3ANYA 3WK1A 3ABRA 3OEXA 3I6EA 3KAOA 5G1MA 1XD0A 5MHBA 1PV8A 1EZWA 5HA7A 4R7OA 5A6SA 4LH8A 3M4HA 4MB4A 1FDZA 1KV8A 3NQFA 3M0KA 3R11A 5AHEA 2FB3A 2V5JA 2JK2A 4HNNA 1XWYA 4A3YA 2PGFA 3MPGA 2Y1HA 4PBGA 5HUPA 1AD1A 1ODUA 3UT0A 1UD4A 3S1WA 1TV7A 3MJMA 5A6MA 3HQOA 2AMXA 3QGKC 2HK1A 4EOUA 4FXFA 3M6YA 1LM1A 3OGVA 3ITXA 5IM51 1P0EA 5XIAA 2ZBTA 4C6BA 4LRTA 5EYWA 2Y8KA 2IUZA 1JDCA 3NQAA 5MF5A 4S3JA 4MNLA 3UWEA 3AAMA 1PTGA 3KBSA 4UTFA 1NP2A 4D71A 4ZO6A 5E0FA 3UZ5A 3UEQA 3VNZA 1U1JA 3H4WA 1U5VA 3S1GA 3ANUA 3T9PA 1VB9A 4IZGA 4JIIX 1X38A 4Q22A 5CPOA 1K1DA 2RKXA 3QR3A 2NVDA 2OR2A 4ICCX 3FVMA 2PB1A 3MKVA 4HSHA 3VD4A 5CSSA 1GJWA 2D2JA 3RAOA 4S3AA 2V8ZA 1WE5A 2GGEA 3WUEA 3ZWTA 2WBKA 2CBJA 4GG9A 1J93A 1X7FA 5D05A 4S3FA 1G4EA 7ENLA 2PDFA 1S5VA 2E8ZA 1VFHA 4KIEA 4U2YA 4WVXA 5C0QA 3QF0A 4TVDA 1FWBC 1VIZA 5D37A 3V4BA 1TV2A 1G01A 3BSHA 2DEPA 4QX4A 3EDEA 1CW2A 1UASA 1W9DM 2GPTA 3ARSA 2PDHA 3JRKA 3EOUA 3GHSA 3EOEA 3T2PA 1NF0A 2G95A 2HE8A 3S6TA 5A5WA 1C8QA 2J13A 2NQLA 4UFMA 3OBAA 1LP6A 5TNVA 1L6SA 1E73M 2VOMA 2EPLX 5CPSA 4AU0A 5JMUA 5EU9A 4IUOA 4XAZA 1B57A 4O1FA 2Z24A 4I5UA 3EXSA 3W3OA 2WC4A 1VEOA 2PDUA 4JKKA 1L6WA 3KBVA 5DXXA 3NURA 1BRLB 2YDSA 1RCQA 2C13A 2H9AB 3VNYA 2OX4A 1A5MC 1TYGA 3UR7A 4XTIA 1EC7A 1SZRA 2OQYA 2WNNA 1N7KA 1XIMA 1N8IA 4QJ5B 1Q13A 5CC5A 4OV9A 2PDYA 4AD4A 2NW0A 3G1RA 1IQ8A 4E2VA 3P0XA 5F1VA 2BGNE 3WF2A 4MTVA 3GO2A 4C7DA 7CGTA 1KCZA 2X0HA 2WANA 2XZ7A 2ZDRA 1Z89A 1OFOA 3QZEA 1XYAA 3BGGA 6PTDA 3BLKA 3AYRA 2AGKA 1U2YA 3PZVA 3UJSA 4KRTA 4FNSA 3UY8A 1Q2RA 4HYVA 3VDCA 2BGQA 3CUGA 4QE1A 4AISA 5AYXA 2VR2A 2GWGA 1B3VA 3LGGA 1SYTA 3UZYA 4LS0A 1H51A 4REQB 4GGBA 1GYNA 5BOOA 4NF7A 1VFFA 4U5IA 3WH8A 4ERAA 4Q33A 4EK7A 2WJDA 3LCXA 3VDGA 3QHMA 4J2PA 1NWRA 2F2HA 3MA8A 3PS7A 4P8WA 1UIOA 1FWJC 2WOQA 3VO0A 1R2TA 1TPC1 3SB0A 2ANUA 4H6RA 1RY8A 1KCXA 1XLCA 4AAJA 3DBNA 3KDOA 1I2NA 3PPHA 1BTCA 2CLEA 4PUMA 2HDJA 1ISXA 1JUKA 3SUSA 2DZWA 3CB3A 4ES4A 1CT5A 4M6PA 2ZYFA 3OP2A 5CPQA 1WNOA 4BWLA 1KC7A 1TIMA 1GJPA 1OC7A 4PE8A 1XP3A 3W7EA 4HMEA 1F3XA 3VMOA 4F79A 3U4FA 1KXQA 3BO9A 2VURA 2DSWA 1C91A 5KTLA 1K7FA 4K39A 4CN4A 1ADDA 4LCRA 1FWAC 3GAYA 2CITA 3NXFA 4MDOA 2CHRA 3UNTA 3LQLA 4MKNA 3R0UA 3CUFA 3T8LA 1SSGA 4PUWA 3R5EA 4AZCA 4YHEA 2DZBA 4OWGA 1Q85A 4JXCA 3LB0A 4JN7A 4F66A 4HVXA 1UD8A 1K7EA 4J5NA 2OSXA 2UY2A 4IIHA 3BE7A 4Y8FA 4HA1A 3PG9A 1YDVA 1G6CA 3CV1A 3LMYA 4X2RA 3W27A 2BY1A 4H9XA 2Q71A 2W3ZA 4KBXA 2WBGA 1FHLA 2BVTA 1OY0A 4JHZA 2ICSA 2PS2A 2PDXA 3TYAA 2XPKA 3WELA 3ONBA 4IICA 1A5SA 1V6YA 5BXPA 1CGVA 3R7MA 1L6FA 1UMLA 3M43A 4PB5A 4W8AA 4IMFA 3BLIA 1XPGA 1N82A 2PPGA 1JCYA 3GBDA 1GQLA 3MP5A 3RMJA 1FVPA 3TC6A 3THUA 5BXTA 4FNTA 1VBJA 2REQB 1IXQA 1RLDA 3R8HA 3NZGA 3S2JA 2OOFA 1BSIA 2GSJA 3IJ8A 5CPMA 1H49A 3M0MA 3NPVA 1XHGA 1KM6A 3CWOX 3T05A 3S1VA 4POCA 3ATZA 4K1WA 1WO2A 1PVNA 4PN2A 1TPEA 3F4CA 3W2LA 3UXAA 1LZOA 3BARA 2DZPA 3GU2A 3VOFA 1SW7A 5BWFA 2ZCGA 1XC4A 4HTBA 1CLXA 1AJ2A 3NYZA 2ZA1A 4RXFA 3EB2A 2QJIA 4LV4A 3S5SA 3S2LA 5CZSA 1RLCL 1JF6A 4PR4A 2WNZA 4X9SA 1OT2A 1OX5A 3THAA 4PL2A 3SO7A 3S2CA 2R1PA 3RF9A 1EDGA 5G1TA 5I09A 1JRBA 4GY0A 1P0DA 3G1HA 4F3HA 4MMWA 3IS4A 4HYRA 1DTNA 2WK2A 1TJRA 5AHFA 1TVLA 3C0LA 3VD7A 1UW9A 1ONXA 3JVAA 2NLIA 3CEUA 1DHPA 5CC7A 1TJ1A 4IJBA 4D9PA 4BCEA 1RXOB 5G2HA 3A23A 4XD3A 1KXHA 1GEHA 5EBUA 1S5NA 1WYIA 3I6TA 5FEZA 2XSAA 2DDXA 1YQ2A 3A3XA 3W07A 2PDNA 1D8CA 1UKQA 1FHDA 3AIQA 5L6UA 3VD5A 3N25A 5IFPA 1XLAA 3F4VA 3K30A 3QXBA 1A0EA 3SCWA 1PKYA 3V16A 4WUIA 1W9BM 2XIMA 4P8UA 3G1VA 1SJAA 2VJXA 5AYYA 3CYVA 3BCJA 3KOYA 1M41A 4PUNA 4TU1A 1XRSA 3PPCA 4AEFA 1NSJA 4KT2A 5C54A 1M9HA 4PMQA 3LV6A 1I1XA 1Y5VA 1J10A 2GJLA 1XM3A 1J0JA 1W1VA 1QBBA 4J7RA 1R3RA 1IF2A 1DJWA 3NVDA 1DL3A 3SADA 4FXRA 2Y7EA 5DT5A 5HANA 3QR1A 3IGXA 1V0LA 3BANA 3CEPA 1J96A 1X1OA 2JF6A 4HN8A 3L5MA 2PZ0A 2A7NA 3BAWA 4JQ3A 2PWEA 3LCGA 2HBXA 3S5YA 4R53A 3ITVA 3NCOA 1V02A 3QC3A 3Q65A 3NQEA 4OBSA 1EFZA 3OZPA 1FX6A 1FWRA 4Q4OA 3ISIX 3LBCA 3IJLA 3I7QA 1X8CA 1E5NA 5AY7A 1F3EA 1UH2A 4QITA 2XU2A 1TVPA 4NZ1A 4X3ZA 1FDJA 4UTTA 2NWRA 2X05A 5H8UA 2BOFX 5HJLA 5K4ZA 4C5ZA 4Q8QA 3UJRA 2R1NA 2GQ3A 4XX6A 4TTGA 2TYSA 2ISFA 4M6QA 3HG2A 2W27A 4D6JA 1H1ZA 4H7VA 2WMFA 1UZ4A 1ADSA 4ADUA 3IJ6A 5I3JA 2YCLB 1QNOA 3RIKA 4F0KA 1GW1A 2FTWA 3LCIA 4AIEA 5IHSA 3NL6A 3WNKA 4JTGA 1S5TA 1NQKA 3OGSA 5ENLA 4DM2A 3N9KA 3WQVA 1QTWA 2EG7A 2DSUA 3AYTA 3GC4A 3IACA 1PCWA 3BTNA 1W5QA 3ARQA 3PZIA 4KWUA 1LL7A 1PBGA 5F4SA 5AVHA 3K2GA 3B05A 5E0KA 3HU7A 5HATA 3GIYA 3BUVA 1LROA 1X6NA 3GVVA 2PC8A 2A7PA 2R91A 4RX0A 2WCAA 2UWFA 1CGWA 2PA6A 3KL0A 3B0XA 4JTUA 2DV0A 3EDFA 2VC5A 1KFJA 3TXVA 3DERA 3WDHA 1J11A 1R30A 3NR0A 5BU9A 2IQDA 1YMYA 3TONA 4KCUA 1THFD 6TIMA 4CNSA 1J0KA 3ITTA 3DC0A 3LNPA 3I6RA 2FMNA 3URAA 1VF8A 3UVAA 4MB5A 1TB3A 1L9WA 2WM0A 3RX2A 1UP0A 3CASA 5FJJA 5HNNA 3MMUA 3UG8A 4DB7A 2HWGA 4TXEA 5CC6A 2HISA 3FV9A 4IPIA 1UBPC 1PKNA 1CXFA 3CT2A 4KCTA 5AZ0A 1WCGA 4JIRA 1I1WA 2VC6A 1XBYA 4Y9PA 1W1IE 3SUVA 3E0IA 2WVTA 3L5AA 4CEXC 1X98A 1C9DA 1Y0EA 4GYFA 2VZSA 3WD3A 3PB2A 1QR7A 3VDBA 3O6DA 4AY8A 1W5OA 3SSJA 2F2KA 2JKEA 2E1WA 2WW5A 2ZICA 3KP1A 3W00A 4IP5A 3M0JA 3USBA 3H2OA 3L4WA 4H7CA 3IAQA 4DIAA 2GK1B 3MT1A 4A8NA 2EHHA 4ZENA 2VYOA 3WFZA 4UWMA 1KR0A 4K3ZA 5JBDA 3L2MA 4BR1A 5A8NA 3M16A 1XH1A 1E40A 1CWYA 3EPNA 4BWLC 1KBIA 5MKGB 3W73A 5CAHA 2CLKA 3RCNA 2F6KA 5A3HA 1G4SA 1AODA 4M1BA 5C9WA 2QKFA 5FI8A 4GNKB 1M65A 1P6BA 4W87A 3RK8A 1H7XA 3LRLA 4K68A 3DC8A 2NSOA 4PUKA 1IV8A 1H2JA 2YLAA 1BXCA 4HK5A 2BY0A 3WEMA 1Y8BA 4IX2A 3CZEA 4ZO8A 5AN7A 3II1A 4O4VA 1XX1A 2VEFA 4DF0A 1RPXA 3O3RA 3QJAA 1QVBA 1SO6A 3PTQA 2DY3A 4JHOA 5D30A 3B4UA 2IKJA 2X42A 3W1NA 1A0DA 4FLQA 2WAGA 2OU4A 3LHVA 2X1RA 1FFQA 3AHVA 2V30A 3VD9A 1OZMA 2OZ8A 2HV5A 4TMCA 3DENA 4LTSA 4X61A 4W86A 2GVYA 4JHMA 3KRBA 2VVSA 4UTKA 3P81A 3WLPA 3CAKA 1CGYA 3N15A 2Y24A 5BMWA 4F0HA 5G4EA 3HURA 1K3UA 1EZ2A 3QTPA 4LUTA 4HYWA 3RLHA 3QYQA 4JL1A 3EWUA 1TV8A 2YYTA 4JIQA 1IZKA 1A5LC 4U31A 1ICSA 1PX3A 4XVDA 1EUNA 1EJXC 2P76A 2PDLA 3SY5A 2V38A 4EPBC 2ZZ7A 2MUCA 1G9HA 2WNQA 3G6LA 3G5EA 4ROQA 4AD5A 3U7BA 3KRUA 3UYCA 1M7JA 2CESA 2W67A 2YBTA 2FJUB 5I3IA 3UETA 3AHTA 4HMDA 4IGHA 3GFYA 4MM1A 3H7VA 5I77A 1TVNA 3VIKA 3R13A 2JEPA 4L56A 3W26A 4X0VA 2YDAA 3GK0A 1TPWA 3RX4A 4NAFA 4MPQA 1JF5A 2FVKA 1T8QA 3WNOA 4PMDA 4LQ1A 3SCRA 3EX4A 4Z0JA 2DIKA 1BVNP 4RJEA 2Y4SA 2B7NA 4K38A 1EWDA 4MZ1A 1FH9A 3ME3A 4HPHA 2G37A 3LN3A 3PPFA 1H62A 4J35A 2QPXA 3KZPA 1EJ7L 3SBFA 1TTPA 4K8HA 4GC4A 4TUFA 3WBXA 1DOSA 2CNCA 4YNGA 3TYEA 1PPIA 3M07A 2XSXA 3K1DA 4LB4A 3T2OA 3VNLA 1XFCA 3L4XA 1F9CA 3W7MA 2Y6ZA 4C65A 3RYSA 3W4RA 1FHUA 1XIDA 2OFJA 1BYDA 1WKEA 4ZVJA 2AQOA 2I5IA 1QU4A 1UJPA 1KKRA 1OZQA 3W6YA 3OBKA 3SUUA 2ZX8A 1EYEA 1GZ1A 3R8GA 3HMJG 3KCOA 2WMIB 3FEMA 3P93A 4HKPA 3VA8A 8XIMA 2WWCA 4GBDA 2QDHA 3F2DA 3EMCA 2CLPA 1KQYA 1V4YA 1V93A 3S46A 2XM1A 5A8GA 4C1NA 2VZOA 4RDZA 3FCPA 3B9OA 2OEJA 1TPB1 2D3NA 3QMRA 3W1TA 1OYAA 4HP5A 1P48A 3VIHA 3G18A 3QM3A 4GZJA 1I6NA 2AGTA 3MMDA 2FMOA 2QPUA 3THDA 1OX6A 2W62A 3BG9A 1HG3A 4G2DA 1FP8A 3WD1A 3FA5A 1QI0A 2ZKMX 4ZTXA 3P3BA 2QW5A 1BWKA 3VM7A 1EGVA 1TELA 3G22A 3FJLA 1W8SA 4FIRA 4B3KA 5DMYA 2DT2A 3GDMA 4GZEA 4RK8A 1VJSA 3UR2A 1IT8A 2IPGA 3VIJA 4QR6A 3BJTA 3NNTA 1CXEA 4LVAA 3DEQA 5FJOA 2FFIA 4JN6A 5CZ0A 1AFSA 3UJFA 3TN6A 2VFHA 1YEYA 2PGRA 4DBDA 1U1UA 4Q8PA 3HGSA 1LBMA 1MZRA 1UWTA 1RJPA 4MNJA 1GTEA 2JFEX 1VC4A 3NG3A 2BZNA 1C29A 3ZSTA 1BVWA 1J6PA 4EAYA 1O5XA 4ECLA 1BXBA 3HGJA 4UTTC 4LCQA 4L6HA 2PGWA 2QUMA 2SFPA 2RGLA 4PRRA 3KS6A 3P14A 4UC5A 4I5RA 3GUGA 3ZT7A 4OECA 1A53A 4LBRA 3W0KA 2BSLA 3STEA 2A0NA 5AB3A 2DU2A 2PBOA 1VAHA 4CGTA 1NF7A 2PD9A 4HJWA 3O6YX 5DT7A 4O50A 3SURA 5DMMA 1VR6A 3KWXA 4NI8A 4TTUA 3MVTA 4Y9OA 3OZOA 4B5TA 3IUDA 2PDMA 1H7PA 1AZ1A 3GD6A 1JCXA 1YIXA 3EBVA 3U8GA 1F05A 3GNPA 3A4WA 5F2IA 4C6FA 4HNLA 2OELA 3KDNA 3S6DA 4DO6A 3PHAA 4LVGA 3UZZA 3APYA 4LUSA 1W1PA 1RSCA 3OIHA 1PDZA 3YPIA 1MEIA 4O17A 4EXAA 2J77A 1PE1A 2NV1A 5JBFA 1AJ0A 1LQ0A 2IQTA 4JX6A 1PSCA 1W1A1 4S3EA 4KESA 3GH5A 4ZO9A 2Y8VA 1EF3A 1VJIA 3PBVA 4PMNA 1KXTA 2DSVA 4AVNA 5CH9A 1OQFA 3VDHA 4GVGA 2D0HA 2J7BA 2C0HA 1KTCA 1XUUA 2XN1A 3PFRA 3NVTA 4HJFA 3THQA 3CM4A 3XINA 1E56A 1KFKA 4DNHA 4LVFA 2FYMA 1ZU8A 1JCTA 1W0MA 1N2VA 2E0PA 4KRUA 4RNFA 3BAIA 4DAFA 3AIRA 3GYCA 4AG0A 4PH6A 3IV8A 1O94A 3TC7A 2Y63A 4A35A 2BLEA 4MY1A 3UPBA 1A5BA 3OOQA 1OGBA 4PMJA 4HIBA 5BCAA 3BZGA 1TO3A 2EG8A 1XLJA 5KZDA 1BXNA 3OPSA 4I7UA 2XISA 1W1TA 3OA5A 4S23A 3NQ6A 4GZ7A 4F2BA 2CU0A 4GVHA 4S39A 3NSMA 4WDTA 5AVNA 2V5KA 4DNMA 4GFIA 3L0KA 3ID7A 4GWEA 2CXEA 1RQHA 3ZJKA 3I3EA 3A12A 1EOKA 3REQA 3T55A 3W1AA 4WHBA 1X97A 3WF1A 3BAYA 3JZUA 2CIPA 3LK6A 4XBSA 5BRBA 5GNYA 3F2BA 3STPA 4D8LA 3R25A 1Q6CA 2H8ZA 1Z7AA 2AQVA 2WKJA 1IEQA 3G1YA 1KD0A 1HJUA 4J1OA 4RDWA 4PTNA 3DCPA 3EGJA 3OYZA 1H4PA 3QSTA 1QAPA 1V02E 4RKAA 2C0AA 5HOSA 5DBUA 1B3OA 3BW3A 1XIHA 2IKGA 3WLLA 1GONA 2NV2A 3W2NA 2OWCA 4EXQA 4H7ZA 3P7YA 3PBUA 2A3EA 1GPFA 1MW1A 4KCVA 3PSVA 1CXHA 1Q6GA 2V0TA 3NSXA 1G4PA 3O6AA 5HJYA 2PDCA 4QLLA 3NXLA 1F61A 3T07A 1QK2A 5D32A 3GR8A 1N55A 4Z2HA 2J7FA 3DHFA 3GC5A 4WY0A 2GQ9A 4PCPA 1ELSA 1O5QA 4FLSA 5HMSA 4KRZA 4UQAA 3EEGA 3LXBA 5D03A 1B0IA 3NO1A 1FA2A 5CPLA 1EO5A 2OWXA 3AUOA 1H3GA 2PUZA 5E6ZA 4PTVA 5CBIA 4XUYA 5EFFA 4DWSA 3T81A 2PI6A 3LA4A 4W7WA 3R2GA 3BSGA 3EOOA 1WZAA 3VE7A 5FA5A 1JDEA 1WV2A 1CB7B 4WX2A 2LLEA 4EACA 1PXGA 3WK3A 1BD0A 3TTEA 1A5CA 4FK9A 1Q6RA 2FZ9A 1FXPA 4XZHA 1S2VA 3OVQA 2DW6A 3MZ2A 2I14A 2XH4A 1XG3A 1NDVA 1K8YA 1ZNNA 2VEMA 5I23A 2PTDA 1UOKA 1IXPA 2OG9A 3D3AA 4R5EA 1XBVA 4UOQA 2NXHA 1EGMA 2DUZA 4AD2A 2D1ZA 2A7RA 4CNPA 4HCHA 1QWKA 2B0MA 2ISVA 3VGDA 2QVNA 3LHZA 3A5FA 3SCSA 4HMCA 3VGFA 4B16A 5HPCA 1Z44A 1S5WA 4JYFA 4B5VA 3R8RA 1YTDA 2JBMA 4HHMA 4E5TA 1MO0A 4I6KA 1M5WA 3TE9A 1LOSA 2XDFA 2I16A 3THCA 1SO4A 4GFSA 4CQCA 1B5TA 4LEFA 1FWEC 1QBAA 3ALGA 3GG8A 3L68A 1F3WA 3T42A 4PUDA 3AXXA 4CQDA 1GQKA 4QE4A 3WD0A 3BAKA 5AYIA 3B8SA 1C8YA 2UY3A 3LM3A 3WYZA 4EWJA 5G2IA 3PANA 1U5JA 2Y5JA 5CSYA 3TMLA 3C8FA 5K9DA 3E12A 1PS9A 2RFGA 2ABBA 2E77A 1EP3A 3IGSA 3W1PA 1EQPA 2Y85A 3VX0A 1E72M 2E6AA 3VKBA 2P8BA 3N11A 5FF2A 2BBFA 1A3XA 4H6QA 3R12A 1VBUA 1KRMA 3DX5A 2V68A 2ZA2A 3QLDA 4YXGA 4IH3A 3AIEA 4DZAA 1E1FA 1AJZA 4P7QA 1XYMA 1A80A 3HFTA 1POKA 3F03K 4XZ9A 2BOEX 1PYFA 1KLYA 4AZIA 3LEPA 5C9ZA 2VOTA 1X96A 1EEXA 2OKTA 3TJLA 1DWJM 4N42A 1EKOA 3PULA 4JDBA 4MIMA 1FKWA 1OFDA 1DXFA 1XLBA 3PY2A 2A21A 2GVGA 1XCXA 4D8AA 4Z17A 4GA8A 1NFBA 4CQ8A 2DGAA 4O53A 1Q7QA 1MUWA 4QLJA 3SJ3A 2VZTA 4JQAA 2QEZA 3DFTA 2QDGA 1CLVA 2GDVA 4B4HA 1WDPA 5A2CA 3IRSA 1DWIM 1OADA 3B0YA 1R3WA 2OO0A 2G4FA 2HXTA 3UWYA 4YVPA 4B9ZA 1BGGA 3LYEA 3EXTA 5C8BB 3PUDA 1NIUA 1L6GA 5ABEA 5EMKA 4CD6A 1HT6A 2J7HA 1CENA 5GJMA 1ZL1A 4C6IA 4PCFA 5DY2A 1GVSA 2VL4A 4M51A 3ALFA 3E2RA 5FD0A 4N0RA 3CNYA 4PFHA 3CJPA 3NDOA 1JYNA 3DHUA 4QEHA 1Z48A 3S0CA 5H6HA 2Z0IA 5T91A 1X1ZA 2GGIA 1VHNA 4NG3A 1EHAA 4XG1A 4N7QA 1RA0A 2ZZ5A 2PWUA 3GNXA 1ENUA 3AZSA 1A3HA 4O18A 1KWGA 3HPXA 2VX7A 3ZVIA 3NPUA 3WLTA 4KF1A 2HK0A 4L9ZA 4KWWA 3LPPA 5DRIA 4YVXA 3RILA 4C6EA 4AYGA 1TIWA 1DV7A 1RUSA 3CQJA 3AU2A 3GXNA 2GSHA 5DANA 1KGUA 3MUY1 3T40A 3HV9A 1ISWA 4HPNA 3RPMA 1J6OA 1M01A 1WOAA 4JNMA 1GKQA 2NT1A 4H19A 2PDGA 3TKFA 3F4NA 1HKMA 2UV8G 3SGGA 1WKFA 2GK1A 4JQ2A 3SSZA 1HJWA 1ZTVA 1GVIA 1EJUC 3PZMA 1JPKA 2QCFA 5AHNA 3GC2A 3P6LA 2QAPA 1K4GA 3AMKA 3LRMA 3UWVA 1QW7A 2Y7GA 4GC3A 2GVEA 4GH3A 3AIVA 1YE6A 5MKGA 3KWSA 2I5GA 4C6QA 1JFXA 4WOQA 3GR7A 2GOUA 1NWUA 1WZLA 7TAAA 2R1LA 3EX3A 5D2TA 3FVDA 2VKZG 1MRAA 1GHSA 2VUYA 2OEKA 3C3NA 2E09A 3SQSA 3O6CA 5HR6A 1F6PA 3BW2A 1TZZA 1LTDA 2PDKA 1VJZA 3AHZA 3Q94A 4AZBA 5LZLA 1UIPA 3S5NA 4GE8A 4P8XA 1Q6FA 3BC9A 4EX4A 1IYXA 4G6CA 3WK0A 1HVXA 3PTDA 2ZXBA 5HJXA 3SGUA 1QHPA 3GG7A 2V5DA 4IISA 4BZYA 4G56A 1DEDA 1AMYA 3HIJA 1XYFA 2C18A 5REQB 1RQBA 3MCNA 4C6DA 3Q37A 3AO0A 3MSGA 3C86A 1JR1A 1XIGA 2P0OA 1VKFA 1GZJA 5E09A 3N2MA 3RPDA 3W7IA 3RJXA 2BS9A 1V8EA 1S38A 5BZAA 5EA9A 4XKYA 3VZZA 3GXDA 1RV8A 2QDDA 3GNOA 4UQCA 1WDDA 2Q09A 3E5PA 5C5YA 5IDZA 1R85A 2HSAA 5K7JA 5I0DA 3HQ1A 1S3HA 1UOZA 1B1YA 2VEGA 3IARA 4UBPC 4NX5A 3G24A 1HW6A 1T41A 1PIGA 4NJHA 3BW4A 3E49A 1FH7A 1YPXA 4GNVA 1MVYA 1MI3A 4IUGA 1A5UA 2YB1A 2G5WA 4L61A 4DPQA 3PZOA 1LL6A 4XZMX 1GKPA 4DUOA 4FIQA 2VTFA 1XFBA 2Y62A 1GOMA 3ZOAA 5I6SA 2YXXA 4BQ2A 3M5ZA 1KFLA 3E9AA 4M24A 2QIIA 4L4MA 1LLWA 1XLGA 3AXKA 2MANA 2JALA 2FVMA 3ONCA 5A8QA 1GG1A 7PTDA 4G7EA 1Y5WA 4GH1A 4Q8WA 3E5BA 4GBUA 2WWDA 4GIRA 4XD6A 4NX0A 3AOFA 3UXIA 6TAAA 5FEPA 1ZRQA 2QJHA 1MRQA 1XQKA 1W31A 1HL9A 3W1UA 1DJHA 2YDRA 2POZA 2Q3RA 4FP1A 4DXKA 3PZUA 1WDQA 3M5YA 3VOJA 1IR1A 3AZTA 3GDBA 1P0NA 2ZX6A 3WQDA 2FZBA 1XLKA 3ANVA 1X7IA 2MNRA 2Y0FA 2HMCA 3LGEA 1HKWA 4PYSA 2Q6ZA 1JYXA 1OGSA 3V0UA 3QZAA 2XM2A 1HGYA 4H2HA 2P50A 2FJKA 1T0OA 1J12A 3DFNA 3G1SA 4W89A 1TMHA 3KXQA 4JS3A 3CZKA 1QI3A 4LY4A 2W92A 4E8DA 4A8RA 4KW2A 4ZQRA 3ARYA 2E1DA 4GUIA 1IXNA 4MKSA 1JULA 4ML9A 1UR1A 3VAVA 1DJZA 4PB3A 5EFDA 1HO1A 1W37A 3WJXA 2ZRYA 1XICA 4EWND 2O7SA 3QV7A 3DYPA 3BOLA 2J7EA 3LTSA 4AC1X 1QXLA 4LPCA 3ABOA 3HBLA 1IR2A 4HU8A 3UR8A 3MCMA 1GEQA 1ZCOA 5HBFA 4IL0A 1QHOA 2NQZA 4FPSA 3WUGA 3KCLA 4DLMA 3GW0A 1B4EA 2INEA 1QI4A 2YFOA 4XD5A 4KEUA 3LCLA 3LX9A 3WLKX 1QFEA 3TAOA 2IMRA 3NQCA 4AZ7A 4R3UA 2G3JA 4K2SA 4GQQA 2YL6A 3GS6A 2ADAA 1G7VA 2WB5A 4M7TA 3T0DA 4H83A 2RGMA 3MUAA 1XQLA 4C6OA 3NZQA 2QAFA 5CLTA 3UCCA 2VZVA 3NQ2A 4GIAA 1EP1A 3NEHA 3GDRA 3QV8A 1KGXA 4OIFA 4XZLX 2VGGA 1LF1A 3T2QA 4EKJA 4I9JA 2PDWA 2AKMA 1TTQA 3P62A 6CGTA 1J9YA 2Q01A 2JIWA 8RUCA 2QJMA 5CBJA 1H7RA 2VMFA 1M3UA 2QMKA 1MW0A 5DEZA 4D6EA 3FGCB 3CK5A 4E3VA 5CZKA 3FOKA 3AMCA 3KBWA 3WUFA 3ES7A 4I5XA 4YTQA 5HAOA 3BQ5A 3WDRA 3N17A 4O12A 3UZJA 4KMQA 2ZZ1A 4DELA 2XJ7A 4PSPA 3PBMA 2P0IA 2DIJA 3H2CA 3KVLA 5A6BA 4L80A 2O4QA 3CZGA 1NWTA 1P43A 2H6RA 3FAXA 4B3LA 1MQRA 5AC7A 3QW4B 3FDGA 1RD5A 1LCOA 1PAMA 4BQ5A 3HFYA 4TVCA 1AH3A 1MUMA 2F84A 3P8IA 2VGBA 4JR5A 1RH9A 2W9MA 3NOEA 2YB4A 3IIXA 1L0PA 3H22A 1R38A 1KR1A 2VDGA 5EMLA 1VHCA 3HQPA 1XW8A 1UR0A 4LBUA 4MB1A 1G1YA 5DX7A 3TC3A 5AC8A 3O0KA 5GNZA 4NJJA 1XGEA 4LVDA 5HQLA 4GJJA 4IFKA 3OO2A 3NTYA 1J18A 3GIPA 4CVUA 3RX3A 2INZA 4QSFA 3RR4A 4Q8UA 3XIMA 1OFRA 4O19A 4UR7A 3N04A 4D6CA 4AZCB 3ZLFA 4F9DA 3URQA 2J7DA 3J7HA 4GJ1A 4DZIA 1A49A 2GVLA 2V2CA 3MMTA 3BLOA 3APTA 2DVXA 1KTBA 5EMMA 1QNSA 2G41A 1YXYA 2GQAA 3VK5A 1W3JA 3P67A 4N6FA 3UJ2A 1RQEA 2YFNA 1B2YA 1S46A 4LF1A 2OB3A 5I3HA 2XGZA 4WGHA 1NTHA 3SCNA 3W86A 3CL8A 1BQCA 1GVOA 2OEMA 1HIZA 2IPWA 4BI5A 4YCPA 3EWBX 3DH7A 4IQEA 1QRQA 4ZOAA 5PTDA 4AMCA 1TX2A 3VC6A 1FOBA 3EWXA 4IWWA 3FNDA 4US5D 5DLCA 1F2JA 4UQDA 2ZWZA 4N9BA 2YXOA 1RBOB 2HE5A 2ZUWA 4QSHA 4B91A 5M03A 1V03A 3SUTA 4NNCA 3TSMA 1J8VA 2Y8UA 3L66A 4GCAA 1H7OA 3UY7A 3WJYA 3TP4A 1WX0A 4Y9NA 6ENLA 4LAOA 4F0SA 1TV5A 5CZTA 3TMQA 3UFYA 1FUYA 1PIIA 3S9ZA 4XZIA 2OZ3A 1W32A 1FWNA 1NP0A 4N02A 4MOZA 3FW6A 1DJXA 1TPVA 1HL2A 1ODZA 3QOKA 3LLFA 3QZ6A 1LOLA 4GUFA 1Q66A 5C9UA 1POJA 1VBRA 3VNKA 3GZ3A 1H0IA 2VO5A 4QEEA 5TD4A 1GOWA 2WJFA 4B4FA 3CB8A 4K8EA 1YKWA 1OIMA 3H8AA 2X2GA 3LNMA 4DBWA 1HXJA 2XWDA 3H2FA 4LBSA 3K4WA 3FKKA 2I5QA 1C7SA 3T44A 5CZJA 4QNEA 2RHGA 4O1CA 2ZTKA 2ZUNA 9XIMA 2I7GA 3HJEA 4JIPA 4R9OA 2J9XA 1JZ2A 4GI6A 2VUNA 1KA9F 4RE2A 3MTWA 4GKLA 2XVGA 4ORMA 1JQVA 4H9ZA 1TTJA 4XTDA 3RGTA 3AUJA 2PDIA 3EA2A 1OG6A 3SRKA 2VDHA 2HJPA 3BOFA 1HJXA 3IJDA 2XTKA 3BLLA 3STGA 1QATA 5TQLA 2WMHA 1JEZA 1UPMB 3NOYA 3UWZA 3WH7A 4C60A 2R1MA 2XIJA 1TJ2A 3C2YA 5M3WA 2Z1BA 3W88A 1TE1A 4UFJA 4YCOA 1X1NA 3OBEA 3MI3A 4ZQMA 4B3ZA 3K8MA 2CCRA 4YVVA 2PCQA 1H1NA 3TSDA 1WAWA 3PJWA 4M29A 1NDWA 4GVFA 4D6DA 1S1PA 4W93A 4JTIA 2YPIA 1DQUA 4H9YA 2G0WA 3T0TA 3LZ5A 3OLEA 3OGRA 3VIPA 1H11A 1A47A 1I4NA 1V3JA 3O9NA 3R89A 4MY8A 4UTJA 4FLOA 1LUCA 1KRBC 3AHYA 4YMZA 2DZTA 3KUMA 1NJJA 3MKKA 1G0CA 2DH2A 4L1GA 4ATDA 1TREA 1X6LA 5I3FA 4IP7A 1M7PA 2QV4A 3WL1A 5A6BD 1PHQA 1P5BA 2DSZA 2GUBA 4C6LA 1SQ7A 3QGAC 3B0UX 2CBIA 1TWWA 4AXKA 1GWJA 2C71A 5FKYA 1UR2A 4NIRA 4PRWA 4UTUA 2CLHA 3F5LA 2XFWA 3RRAA 1JPMA 3QRHA 2DP3A 1QDSA 2R9RA 3TOPA 1DIEA 2FQIA 3BWWA 3K46A 3BMXA 2ZUTA 2RDXA 3C0JA 4GI4A 1KNWA 1ITXA 2OQHA 3TW9A 5IOBA 4IMEA 4QAWA 4KWSA 4JTAA 2BGSA 5FSEC 3VNJA 3HPZA 1H50A 3KBJA 5A8OA 3COTA 3W7GA 4GCXA 2CXGA 5HMEA 1QI2A 5C71A 5ABGA 4UNIA 4YN5A 3I3BA 5C9XA 3QFEA 1Y5XA 2CHNA 1EO7A 4JX5A 5FF7A 3GVRA 4OQVA 2P1FA 1Q45A 1AQ0A 3WY1A 1QI5A 4HOWA 2POTA 3M0IA 1YLVA 2NQHA 4QDPA 3W7OA 3G1AA 1WB0A 2OLHA 3W75A 2G96A 1QW8A 4CN1A 4UFHA 3GLCA 3ORWA 5AYZA 3IK4A 4YTTA 2Z7GA 4IFRA 3A4JA 4DJFA 3IJQA 1UA7A 3FYPA 3UNDA 4MWAD 2WKLA 4UR8A 3DU0A 3WMBA 1UP3A 4CQBA 2QCGA 1AH4A 3WLQA 4Q6XA 4NJGA 1IEIA 3CZJA 2P5NA 3MS8A 3CQ0A 3ZR6A 3U7VA 4IPLA 5BWAA 2YBUA 3L5LA 5CBBA 4ZR8A 4DAIA 4GINA 3EMZA 1Q6QA 3FLUA 5I02A 4QTGA 3JR2A 5J5RA 4O0KA 3SQLA 5AHIA 3I65A 4FHAA 2ZZ3A 5E70A 2QGYA 1W91A 4M56A 3E74A 3CUIA 2C14A 3MW7A 5B7YA 1NWSA 1Q3NA 2B7QA 2P10A 3H23A 1QASA 2D69A 3WCZA 2FGZA 3UPMA 1GQJA 3GG1A 2ACUA 3KOWA 4Z2KA 3WMSA 2DFAA 3PBWA 2YOCA 3WH9A 3QN3A 3TW7A 1BF2A 3TTQA 1ZQ5A 2CERA 4JTKA 2WMGA 1KM4A 3WQGA 2VP8A 3EWCA 3QKEA 1M04A 2BNJA 5HK4A 4AMAA 1TA3A 4TX9A 4GX9A 3VKAA 3CMJA 1E5JA 4MAVA 5FCZA 1JXKA 3E3HA 1ZALA 4PMXA 1K9DA 4DZ5A 5D9PA 2Z4GA 1A5OC 4S2BA 3ABSA 4LU0A 1JFHA 1PWMA 2QVHA 1RVKA 2RDTA 2WVVB 4B9YA 1TR1A 4UMBA 3E0VA 4HK6A 3VOHA 5JVLA 2KAUC 1WDWA 4XB3A 5DCEA 1FCUA 5ABFA 3DFQA 3NL5A 4QBXA 4QS6A 3KL3A 3WD4A 2FHBA 4R9XA 2ZADA 2VX5A 5TBOA 3MUCA 1IHIA 3MUXA 4Q7NA 1NDYA 1P6WA 2ZXQA 3TYDA 4NASA 3ZLGA 2ABAA 4Z1BA 4IMCA 1UD3A 2C1IA 3U2EA 3U57A 1IIHA 4UTLA 2EPOA 2FGBA 1T5AA 3UGVA 4Y96A 2GJXA 4IMGA 6A3HA 2XIIA 3T0CA 2AAAA 4DWDA 2VFFA 5F2GA 2ZRVA 4U2ZA 5C9RA 4EIVA 4Q8OA 4WY0F 4NZFA 1UKPA 3H54A 2I9EA 2QR6A 1Q63A 1FWTA 2FPTA 3MO7A 1F3TA 4GO9A 1GOIA 4MWAC 4LFYA 4LUTB 2IQ0A 3VVGA 1UC4A 4GYPA 3WBAA 4GVIA 1IWAA 3W7KA 5TF0A 3N19B 4ATLA 1P1MA 2J9ZA 4RXGA 1MQPA 5FJRA 1V0KA 4HNCA 1V7AA 1XRTA 1KV5A 1CXIA 3W1RA 5CSRA 2BG5A 4HPXA 1QHZA 4AWSA 2YLLA 3CAVA 3AMGA 2FHFA 2YCJA 3SGZA 3TLLA 1KM3A 3G8RA 4ZA0A 3C4UA 1TRIA 1I0DA 2PTXA 2V5LA 1PX4A 2WQDA 5FESA 1E0UA 3N4EA 2PD5A 4I9AA 3NGJA 3R0KA 3UPWA 1AW1A 2VM8A 3IGUA 1I2PA 4NAFB 4PMVA 3RCYA 4B5NA 4IPJA 2V67A 3ECQA 4O1BA 1V08A 2VXNA 3GTIA 3SEPA 3VGGA 3NEVA 4Q8NA 3A21A 5E0CA 3K4AA 2AL2B 2JKPA 4I7VA 1RJRA 2V82A 3UG4A 4JKLA 4NUWA 3N4FA 4OVXA 2GWNA 3B8WA 2PWHA 4HT3A 2YA2A 1Z32X 1VP5A 3QOMA 3GFZA 2WMJA 3HQNA 3FIGA 5I3GA 2Z29A 4PTXA 2NLYA 2FLIA 1K9FA 1Q4NX 5FJPA 3RO8A 3N2BA 4QRNA 3FK4A 4H41A 3QQ1A 2Z2BA 1MNSA 3C61A 3ZVHB 1R9ZA 5BU6A 1JUBA 2DVTA 2XH2A 2NT0A 2HS6A 1E4MM 1FKXA 1S2TA 2BB0A 4EF8A 4DJFD 4WJXA 1OSEA 2EF9A 4H9MA 1A4MA 1HKKA 1GYMA 3S1XA 5KINA 2Q3OA 4RZ5A 4FF5A 3CAWA 3GXMA 4IFOA 2YGYA 2ZRXA 1US2A 4C1NB 3RUBL 1JZ5A 4N2YA 4AVFA 4I6VA 3KVKA 1R2SA 3UYIA 3EWZA 3AZRA 3NZ1A 4B5SA 5LHFA 1IWBA 2YL5A 1GQIA 4CNNA 4WD0A 1EBHA 1W3LA 2PBGA 2XH7A 1C92A 1RP9A 2A6NA 1OYBA 1IEWA 1VRDA 4JX4A 1XLMA 2XINA 3G1DA 3USZA 1C93A 3KFTA 3EXRA 3PZTA 4J28A 4YYFA 2NWSA 4GISA 4BJHA 2CBUA 1UPPA 5HINA 5AHLA 4E2OA 1W3KA 5JIWA 2ZC8A 4CUCA 1XYLA 3EOSA 3KLLA 3SJNA 1W3TA 4IGSA 3MYPA 4QJ3B 2EGZA 1D9EA 1OCJA 4A29A 3N9SA 2OVLA 1Q6DA 3TJIA 4NNAA 3ZXWA 1V3HA 2TAAA 2XGIA 3CHVA 3WJSA 3TVAA 2V2HA 4QISA 4E2BA 2BVDA 1C9WA 2AQWA 1VFMA 1SM9A 3H12A 2J47A 5KZ6A 3L4TA 4AHPA 1UYQA 2ZX9A 3L23A 1F8IA 3CYJA 4LAUA 4A6GA 1MSSA 3CPGA 2OTDA 3AC0A 4BKNA 4IGNA 2FH8A 3ERPA 2PP1A 3KZSA 2EPHA 4HNTA 1ZSXA 3RG6A 3D0CA 2ZXAA 3HOJA 4J3SA 2QCNA 2TRSA 2FKPA 4FNRA 3HPFA 3H2NA 3PC0A 4JEJA 1WBHA 4KS0A 3BOXA 3FGCA 3N2OA 2AOSA 2Y61A 1WP6A 3BCFA 3VGHA 1E9LA 1AG1O 2Z2AA 1KBJA 2D2GA 5A2BA 3ARPA 4LUSB 3H53A 1L8PA 3S5OA 2H3BA 4I7WA 4JY8A 4U10A 4UNKA 4AY1A 1EA0A 1FFRA 4F9JA 4GX8A 4ZGYA 4H8UA 1EC8A 4DJFC 3DN5A 2WYSA 3ZM8A 4X22A 2BXZA 8XIAA 1DKWA 3FKRA 1UBSA 5IRPA 3KHJA 2VX4A 3QEZA 3HN3A 3TFCA 4M6VA 1RALA 2JQXA 1V51A 2VGFA 4DQWA 3OZYA 3C0SA 3N2CA 4MG4A 4N9CA 3NQGA 3HGRA 4NT0A 1F7BA 1AUSL 4ZB5A 4AHQA 2YW4A 5L9FA 3NQVA 1XIIA 4W5UA 3L0GA 4HPJA 4OV4A 3F4DA 1E1CA 1ZFJA 3MWAA 1Z3NA 3WBYA 1E0VA 5G5IA 2J74A 1SFSA 1UP2A 3UWQA 4FX8A 4ML4A 4PZVA 1O4UA 1JUEA 1D7KA 2E3ZA 3EPOA 3SZ8A 4XK2A 5KZMA 1BGAA 2EKGA 1ECQA 2WCSA 2E9BA 5H1WA 4GY7A 2ZDSA 3MI2A 3S3GA 3CWNA 3H26A 1SW3A 2WKGA 4M6UA 2G3NA 1EXBA 1XH2A 1QPOA 3Q67A 3RLUA 1GPWA 2JKAA 1W56A 3LG3A 4QXIA 5BRQA 1F76A 1E4IA 3AI0A 1H09A 3AU6A 4MZ8A 2W4XA 1LWHA 1YDNA 3SAZA 4BQ4A 1AZ2A 3GYEA 1JD9A 5HWNA 4P7NA 4ZXOA 5H91A 2ACSA 1TTIA 2OWWA 4NP7A 3WSUA 4IQLA 1O66A 3U2CA 3TZFA 3REQB 1SMAA 2ZWYA 1WZMA 4XSLA 2QQ6A 3G8EA 5DY3A 3LMZA 3ZJ7A 3NSNA 1F6YA 3KLKA 1R0MA 4ZSTA 2AKZA 4E8GA 1E0TA 1MEWA 4RUBA 3BVJA 3RHGA 4AW7A 4TX8A 3DG7A 1XLEA 1KRAC 3BG3A 3TQKA 2DZVA 3KOXA 4QG8A 4AX7A 1EQCA 3IAPA 2J79A 4GACA 1PZ3A 1JDFA 1E6PA 5LNUA 3ITOA 1XBXA 3CZ8A 5AFDA 1KGWA 3M0HA 3MHFA 2YZRA 4FOKA 4U3AA 3TQ0A 2HRWA 2Y7DA 3B8IA 5G1YA 5J04A 3GXPA 4KWVA 4O54A 1LL4A 2C1GA 3OLGA 3AS0A 1MWOA 1S2WA 2HZGA 2VNCA 4WKAA 1KQZA 3A4XA 1TWIA 1G5AA 1A50A 2ATMA 1KO0A 4ZL1A 1UZDA 3WH6A 5XINA 4LX4A 3CUJA 2Z1WA 4WY0B 3OG2A 1CYGA 4H9TA 1I9CB 3VTRA 4JTLA 3FFSA 4GPNA 2Z25A 4LYQA 3W81A 1R7AA 2G8ZA 4FMVA 4GYPC 4D6FA 4UFLA 4YTSA 3CTTA 1LRQA 4RLIA 3IJ7A 3CLWA 3I10A 4DEFA 2ISWA 3SCVA 4XWUA 1YX1A 4KETA 2BODX 4C6PA 4DWSB 3RRXA 3V35A 4US6A 4NHVA 3UP8A 3UVIA 3V3WA 1H7NA 2D3LA 2HXUA 3MCOA 4DM1A 2AL1A 1ZAIA 3R10A 2WSYA 1MYRA 3LSCA 4GABA 7TIMA 1TPDA 1GKRA 5FJIA 2PSNA 4JICA 1YYAA 4WQ6A 3F5KA 1EX5A 5C7HA 3PSWA 3W71A 2A6LA 3W7JA 1NOWA 1MZHA 5IBXA 2V81A 3MHGA 2E68A 3W85A 2HBVA 2ESCA 1DXEA 4U5KA 3H4XA 2DJXA 4GLEA 1F07A 2J24A 4UQEA 1XIBA 4MFDA 3RDKA 4CD8A 2QCHA 3WMCA 4OT7A 4HGXA 5HQEA 3LERA 1UR8A 3VNMA 3CZLA 3TH6A 4Q7BA 4F8XA 1KFWA 3M0LA 3RU6A 1QPKA 3SW6A 3V0SA 1XIJA 3OQ8A 3V1HA 2VHLA 3WQFA 1TSIA 2ALDA 4V28A 5GVJA 2UBPC 4C91A 4AF0B 1XF0A 2VD8A 2TODA 1R5YA 2OT0A 1AW5A 3GTXA 3TNBA 2F7FA 4ZOEA 2QCDB 1NQ6A 4LYKA 3OHIA 2P8CA 3DIPA 4LGXA 1MNZA 3VIIA 4IOTA 1PKLA 2NV9A 1JPIA 1JNDA 1UWRA 3WLRA 1Z41A 2BVWA 4XZWA 3KOZA 2HVNA 1TX0A 4JFVA 2Y2WA 3CO8A 1B31A 2CBVA 1IXOA 2Z1XA 1VLWA 4RCXA 2ZX5A 3WQEA 1KXVA 3GTNA 4S1FA 1AH0A 1WUEA 4KFOA 3KBMA 1M03A 3DFOA 1PDYA 4ZO7A 3DECA 3HPAA 3N12A 3T7VA 3P61A 1DWGM 4W7UA 5A6AA 2X16A 4K1GA 1CXKA 1EEPA 3FXGA 1K6AA 5D8ZA 3RR1A 4ROPA 1T99A 4CLMA 1PHWA 3G1XA 5HDRA 1ONRA 3K13A 1HP4A 3V7PA 2DT3A 4L65A 4E38A 4W8LA 2YW3A 3WL0A 5H2ZA 4GD0A 4GY1A 1BG4A 3ZT6A 1E4NA 1X39A 3KOFA 4EPDC 2QZRA 1ZJAA 3RU8X 1FH8A 4ZXLA 1SFLA 1QOPA 5CPNA 9XIAA 4TOQA 2YL9A 5LIYX 2A3LA 5M2FX 4IPNB 4XQ6A 2XWEA 3UJEA 3A22A 4GK8A 3E0WA 1EUAA 2TSYA 2Z28A 1AA1B 2E5DA 3RN6A 2XIQA 5DCBA 2C15A 1EJRC 1P0KA 2E5BA 2Q02A 1VYPX 4HHHA 3U2OA 2DUAA 1LYXA 1H7WA 3VOGA 2G3IA 1P7TA 4PMOA 4LS1A 4UQ9A 4B5XA 4P2VA 3W7DA 3U3HA 3LXAA 2O9PA 2QF7A 4KKXA 3CV7A 1VBHA 2QNEA 3W6LA 3V5OA 3GQYA 4KGJA 4OJYA 1KM0A 1UD6A 3L9CA 1GOOA 5FEXA 2A3BA 3MU7A 3N14A 2PTZA 3M41A 3UG3A 3M7WA 3UU0A 4O57A 2WC3A 4F2UA 1HKVA 2PGEA 3QV9A 1M68A 2VX6A 4GXWA 4DYJA 3ARZA 1BYCA 2YXGA 4JGDA 5CAKA 4XAGA 1LG2A 1UH4A 4JBRA 3FJNA 1C7TA 4AEOA 3BDKA 2IW0A 1SUXA 3GW3A 1OCQA 3W1LA 2GJPA 1EJWC 1ZGDA 2PP0A 4XV0A 4JTDA 3EWDA 1REQA 4WSJA 3HB9A 3L12A 3P80A 1MEHA 3NQMA 2BVYA 2FH6A 3TLQA 3TEVA 4IIEA 1TCMA 4R85A 4PUEA 1IE7C 3CL6A 4J40A 3SN0A 1AK5A 2W66A 1XBZA 4QDWA 4B5WA 3POCA 1KRCC 5BXSA 1O60A 1SJCA 1PL9A 3M5VA 3M5XA 1HF6A 1A5NC 1KFBA 4ICNA 3ABZA 3PJTA 1YHTA 4FX6M 4BS0A 4JL2A 4NXSA 1H5VA 1W3NA 2Z00A 5DBTA 3CV2A 5EMJA 3ARRA 1GG0A 3S2NA 3F7JA 4G9PA 4C6JA 3CXOA 3GAKA 1ZCCA 2WVVA 1RY0A 3ARWA 1YPFA 3A3HA 2JGQA 3TYCA 4V27A 1LQ2A 9RUBA 1OCNA 3A4AA 3RNDA 1PIFA 5D9OA 4ILSA 3NZPA 5LSMA 4PMZA 4TMBA 4YS1A 4HSNA 4CCEA 2V69A 3IIZA 5LGXA 1VFSA 2O0TA 2EXOA 3CUZA 3NA8A 2QLYA 3R4IA 5LA2A 1XD1A 3KX6A 4MJZA 3BGAA 2X30A 3ITLA 3LV5A 2GDUA 3UWUA 3V18A 1DQWA 2AAMA 3CAQA 3VKKA 3WLJA 4RNIA 3K5XA 4UCGA 3VIGA 3M0ZA 4RNHA 3A47A 2YBVA 3EKZA 5EB8A 4FS9A 3VOCA 3FS2A 3H24A 4JDYA 3LI0A 1JJKA 3W83A 1CGUA 1BEUA 2WXDM 1ISZA 2W79A 4O16A 5BW6A 4UQBA 3CHCA 4WK9A 2Y7FA 4Z2IA 3SN1A 4EVZA 4YPJA 3DG3A 2CLMA 1U83A 3U5YA 4A05A 4H00A 2ZQ0A 4XKYB 3VIOA 2E9LA 4IJCA 2E8YA 2HPMA 2BASA 1IT7A 2HVMA 2V63A 3IV3A 1ZP4A 3BSMA 4LYPA 3G3DA 4HU0A 1HTIA 3WIJA 5LGZA 5LNVA 3GBEA 3CUHA 1ITCA 1UCWA 1OYCA 3PBYA 4IT1A 1W2VA 1OEPA 5E9AA 2VRQA 1ICQA 3E1F1 4S3DA 4WEVX 4XBJA 2G3MA 3CL7A 4NKCA 1W1YA 3GG0A 4UFKA 4GUHA 3GXTA 4DZHA 1L2UA 4AZHA 3BXWA 1XR2A 2AL2A 1XYZA 2NVAA 2DT1A 6XIAA 2E6FA 3O06A 2E7FA 4LUJA 3ICJA 1UUQA 3GWQA 1MQQA 5F4XA 3WQ8A 4IG2A 2VCBA 3VDAA 5HXMA 1TUXA 5T26A 3TQPA 4QQ3A 1OB0A 3CHFA 5BROA 4G7EB 4IIBA 2BX7A 2VT0A 2PWGA 1K6WA 4I90A 3VCRA 5U7SA 1B3ZA 3ZVHA 1OM0A 4AH7A 4DBSA 4Y2WA 1TCDA 4YWSA 5CEWA 1PUDA 2ATSA 4JTHA 3EA1A 2A3HA 4DVOA 4F2TA 2ON3A 1NFPA 3WLMA 3UCQA 2VZUA 4NVTA 1E6NA 3NGFA 1BYAA 1OFBA 3VM5A 4C6MA 3S8HA 4L9YA 4LS2A 4J3VA 4HOXA 4URIA 3URBA 1O1ZA 2X7VA 1OFPA 3LSBA 4YJ5A 1WBJA 5IBXC 2OGYA 2YYUA 4MUZA 3LCHA 2BWGA 1UWQA 3E2VA 4ZQOA 4HZ7A 4MFEA 1XXXA 5GJPA 2B7PA 3W38A 3PJUA 1O12A 3NQDA 4PL1A 3BAJA 5D2YA 1Q65A 4NU7A 2PRHA 4Z1AA 4EANA 3MC5A 1EPVA 3W7NA 4WR3A 3QHOA 2XIOA 2XFFA 1Z9AA 3S83A 4ALDA 3GU1A 3WO8A 3EWYA 3E0FA 2GLKA 3CV6A 4A3UA 4F0MA 3ELFA 2ZRZA 3DAQA 3QPZA 3N3TA 3B0PA 3Q4DA 4K36A 3NL3A 3P74A 3BL3A 4D8ZA 1ME8A 1H1YA 1LWJA 4J3XA 2ZZ6A 2DZXA 2OODA 2WHJA 3H2EA 5FAJA 1ZS2A 4O15A 5C7VA 3C56A 3VINA 3WQOA 4WKFA 3RCMA 3VCNA 2OSYA 4AEEA 2V5BA 3VUPA 1B54A 1CZ1A 4AQLA 5F2MA 1YADA 3BLFA 4FX7A 2QV5A 3R79A 2VEKA 4NL1A 5DMNA 1E71M 2VFDA 3EA3A 1G4TA 4NZ4A 1YNQA 3EZ4A 3EWWA 3S9IA 1TFVA 4ZBCA 3V36A 3N2XA 3KRZA 3OODA 3IIVA 1FBAA 2ZUUA 3PZGA 2YA1A 3LBMA 4GNJA 4M8UA 4JCMA 4ZZ9A 1IIGA 1TPH1 4PB4A 3W02A 2OLSA 1GK8A 1EGZA 4CNUA 2EPKX 2CLFA 2P88A 2PF0A 2QCCA 3KW3A 5ABHA 4A8LA 3MV11 1AQFA 3IK2A 1XKYA 5G2WA 3EPMA 1GVFA 4KCWA 1IGWA 4ERGA 3ARTA 1J5TA 2J6XA 5LXEA 2QPSA 2VQUA 1MDLA 3GXIA 1C90A 1NARA 2OLAA 5LNSA 4U28A 3OLDA 3AALA 3W7LA 4LB3A 1SFJA 3TCEA 5CKSA 1DIDA 1YBQA 1L6YA 2BV9A 4BHYA 1VYRA 3EAUA 3JU2A 2OQLA 2ZZ4A 2ZUSA 1VENA 4C7GA 1VPXA 1R46A 4PFMA 2GVJA 4AD0A 4R7JA 3VOIA 3TWAA 2NQ9A 3S2MA 4HMNA 4L1XA 1GT8A 3B03A 1NELA 1XIFA 2VQTA 1TZ7A 2F38A 1P4CA 3VFCA 4CU6A 4JY9A 3I7RA 3H2AA 4FZIA 1PZ1A 4YIWA 1W5PA 4ZFCA 3C8NA 3I4KA 1UD2A 1RHCA 3N6JA 3AYSA 4E4UA 4QG9A 2BOGX 4L1WA 5JIPA 4RPQA 5CGTA 3NQ8A 3PUOA 4JOMA 1K03A 1RA5A 2FZDA 5LNRA 2Z1KA 1B9BA 1OG0A 4LY8A 4NI3A 4HA0A 1FRBA 5XIMA 3UZWA 1IZCA 1OF6A 4EXBA 1CECA 2PMQA 5GQBA 4PBEA 3QC0A 4L4PA 2WLZA 3VKCA 3SR7A 4IX0A 4CU7A 4JTJA 3N6HA 3TSBA 4IFKB 3SCTA 1BSLA 3H21A 1OC6A 2XUCA 1VPQA 4YTUA 1XLDA 4YL2A 2C3ZA 1XIEA 3QR0A 3MQTA 3PNUA 2H90A 4JEQA 4TQTA 3TJ4A 1R47A 2TPSA 4OUEA 3AXHA 3WBWA 5H8MA 1GVQA 4MNMA 5JQ9A 3WG6A 3LLDA 5JH2A 3AIUA 3SDOA 3WBEA 2X2YA 2YR1A 2OCZA 1JGIA 1PZ2A 4MJ2A 3D5HA 2WVUA 4G8TA 3U9IA 3ARVA 3AS1A 4GKTA 1E4LA 1UG6A 4OHQA 4Q4RA 4E4PA 3BURA 4XAPA 1QO2A 2ZFAA 1DBTA 4JTFA 2VC9A 4LAMA 5G4HC 1DP0A 1TJPA 2DT0A 4EPKA 1QNQA 3QLLA 1ZJBA 4MWAB 4GI9A 2QXWA 3MY9A 4W8BA 4UUIA 4AY7A 1HVQA 1ZJHA 3HA1A 5FJTA 5HQMA 4HD5A 1GCYA 5BNKA 3VGBA 2F8QA 3TOYA 2I17A 1ZY9A 1V5XA 1NM9A 3B4YA 3PWAA 1M1BA 4UXDA 5AYBA 1Q6OA 3WLIA 3K4DA 3WZ0E 1C8XA 1JD7A 3FY1A 3HTWA 3P0WA 1CCWB 3HM7A 3R94A 3H7RA 4MJ4A 4PRTA 4M3PA 3VE9A 1NOFA 4S2CA 1W1B1 3PG8A 3BLPX 3LXCA 1V0NA 2PDPA 3BMVA 3CQHA 2PTWA 1XI3A 2W61A 2A5HA 3MBFA 1O5RA 2RAGA 1Z42A 1DVJA 5D02A 2VRKA 3R0DA 1WOBA 2Q8LA 3ZJ8A 2BHZA 1XRVA 1KWKA 1W3HA 2Y5EA 5B7ZA 4Y7EA 1E6ZA 1G7UA 2ZRWA 2ZUVA 3O0FA 1UUOA 1R3SA 3TN5A 1V6XA 4PUUA 3RLGA 3L0NA 3RFAA 3QSRA 3E38A 3H4GA 2DQXA 2QT3A 3OW1A 1XUZA 3LCWA 4C1LA 5DQPA 4UZUA 3V5CA 4A2RA 2G3FA 2OOGA 5ECUA 5AZ1A 3EKGA 1NAL1 3I7SA 3TR2A 3ZS4A 4OFCA 1A3WA 1WPCA 4L4OA 1UJQA 1P6CA 2VENA 2J8FA 1X8FA 1K8XA 4XSMA 1XDJA 3M9YA 5JXQA 3QKZA 3H55A 1DJNA 1F8MA 4MSSA 2EO7A 5A1AA 2PAJA 1E51A 4LXFA 1SZNA 1FCBA 2NX9A 3W28A 3ZJ6A 1V6TA 4H04A 3B9NA 4YHGA 1WDSA 4QP0A 1UQZA 4JNYA 3FSTA 4ACZA 1EJVC 1TV4A 1JGMA 4LRSA 3NPWA 1ZBCA 4HNOA 1QK0A 4A3RA 4I9MA 3UF9A 3C0QA 4HN4A 4Z2LA 6XIMA 4DJDA 2VD9A 2QS8A 3M7SA 2FPYA 4NRRA 4M82A 1DE5A 2QUUA 4AF0A 3CMFA 3F4WA 5AHMA 1I0BA 3W22A 3QQ0A 4WRHA 4NAEA 1TUFA 2VC7A 4O0ZA 2QCDA 1LUCB 1EOMA 5LXXA 2XVPA 4PBFA 4P8VA 1T96A 3OG3A 3HG5A 2QMJA 3B8DA 1U5HA 2C91A 4OBRA 3OIXA 3HMCA 3UCDA 4FAMA 4YYCA 4WDWA 3N2TA 3PM6A 3DYOA 2E4TA 1PEZA 3UESA 4MHBA 1EXPA 5EPDA 4DUXA 1MXSA 3KTCA 5A6KA 3L4ZA 1V3MA 1BKHA 1UKSA 2WVSA 1DE6A 1UR4A 4X0NA 1JRCA 1FWCC 2BY3A 2A3CA 1LRTA 3WJWA 1TQJA 3O05A 4LSBA 4P7OA 4Z2GA 4LJ3A 4J2MA 1EIBA 2NXIA 3MBDA 3W25A 5KZEA 4JCLA 4JFSA 1O5KA 4TR9A 3T4WA 4O13A 3L67A 3ES8A 3HPSA 3KE0A 4AD3A 4J27A 1VZWA 1FY6A 3IJ9A 1TKKA 2UZ9A 4CCDA 3CQIA 4L64A 4A21A 4AC7C 2Q8ZA 1TPFA 3R1ZA 2PLCA 3NPXA 4K7YA 4M81A 2C16A 1R3YA 5CGMA 2VCCA 3IVSA 1AVAA 1SFTA 4O10A 3TW6A 3S42A 1LT7A 3L4UA 2PDBA 7REQB 3TAKA 3QH2A 1A5KC 2J78A 3FSUA 3KL5A 1PO9A 3S9YA 4FNQA 4TO8A 3LS9A 2P53A 1VGAA 4ATWA 4M0XA 2J7CA 4S3GA 1H0GA 3VMNA 5CSUA 2VI0A 3LRKA 3FHQA 2NUYA 5D9MA 2E6YA 4YU1A 4OZOA 2IKIA 2PCEA 1EC9A 1JQXA 1VIWA 2YSWA 3WN6A 1JXJA 1RJQA 3MP4A 3CIXA 1OD8A 4UZSA 1I2OA 2O9OA 4W5ZA 1YNPA 1ZBWA 3DUGA 1R3QA 3SCOA 1US3A 3NUKA 3RM9A 3DBPA 3WLHA 3WQCA 3GRIA 3A9IA 2FB2A 3TWBA 2G97A 2GDQA 2ODOA 3F2CA 1VFUA 4KEVA 1DXIA 3QGVA 4GUGA 4K37A 3CWHA 5FL0A 3V75A 3S5ZA 2EG6A 4FA3A 1QPRA 3DI0A 1EF2A 5HUOA 2D0GA 1FHVA 2BHYA 5K3VA 3VFLA 2ZXDA 3B9DA 3BJSA 4CN6A 1XCFA 4PGLA 2QIWA 2PWFA 3FDKA 3WQWA 4CD7A 3EDKA 3WF3A 4O1EA 1CPUA 1I75A 2X1SA 4UTIA 4F40A 1M53A 2CETA 2WZMA 3GNNA 5AC4A 2FZMA 3WUBA 5A8PA 1KFCA 4LEQA 2A79A 4WDUA 4HCDA 1A0CA 1BWLA 1ESWA 4JNZA 3WQ4A 1TA3B 3PZNA 3ATYA 3UWWA 3WK2A 3WMLA 1ZBVA 4DXXA 4ASTA 4XO6A 5E6YA 4F0RA 4H6KA 4M19A 1V6WA 2Z6JA 5K9CA 3NDYA 4RV3A 2ONEA 3LZ3A 1HL8A 1UZ1A 1SU5A 4NZJA 3RJYA 3GVWA 4IL2A 2QUVA 4HTYA 4D72A 2OKOA 4HZ8A 2IPJA 3OLIA 5AOUA 1QW9A 4HPGA 1UD5A 4H6EA 2XG9A 4KEMA 7ODCA 3CBWA 5ABFB 1JZ3A 4IM4A 3CUXA 3MB9A 4Q4QA 3DDMA 3I4EA 1UROA 1SZGA 1UR3M 1K9TA 2J62A 4U4MA 1PJ9A 1XLLA 2OSWA 1WZKA 4J3UA 1M6JA 3LD5A 1HJQA 3OVRA 1J4EA 1UKOA 3VUSA 1R2RA 4DJDD 2RJHA 4KQNA 4H8HA 4F4RA 3RO6A 3S4TA 1FTXA 2IXVA 3AS3A 4GXMA 2GJXB 3IANA 3PR2A 3W9ZA 1XGDA 2C8NA 3GY1A 3BQ6A 5JU6A 2CC0A 2VGIA 1LOQA 4ZQNA 2CLLA 3LUTA 3VPLA 1B9ZA 2V3DA 3PTKA 1D3HA 2PODA 1E0WA 5LIKX 2OMAA 5I5RA 5D8WA 3KVMA 1W17A 4J3ZA 4BY3A 4GMEA 4DXVA 1TMQA 3A13A 5A6LA 5I2UA 1U33A 3GHTA 3NWRA 3D47A 1HQTA 1JCLA 3GDKA 4LNYA 2XFRA 1WUFA 5C2CA 5A6TC 1VCFA 2PU1A 3W29A 3SRHA 5D09A 4GGHA 3GNDA 4AVOA 1CNVA 1AQMA 1V3LA 3I3DA 4YLWA 1ZP3A 4L5ZA 4QJ4B 3GE7A 2DZSA 3TZNA 1U22A 5CJ5A 5EMUA 1US0A 1EX1A 4O28A 3QFWA 3GM8A 2D22A 1AL8A 2WHLA 4FR1A 4GO8A 3MDUA 2XFYA 3DGBA 1B3WA 4UOZA 1MUCA 3VZXA 3XISA 3N3MA 1PCKA 3SI9A 4UOJA 3JS3A 3SQMA 4WF7A 2VFGA 2B4GA 3GKAA 3MYOA 1RR2A 2D2HA 4KPLA 3RM4A 5CLWA 4V2XA 1MXDA 3PAJA 1RBLA 1RCOB 3TFXA 3CHEA 1GVRA 5IXEA 4AIBA 3BLDA 2D20A 2I56A 4G5DA 1XL9A 3WQ5A 2GSEA 3URNA 3VZYA 2WSPA 1NVMA 2V2DA 3P8JA 3V0TA 3N9RA 4YTRA 1NY1A 5D9NA 5HULA 4M7SA 1R3TA 3GR4A 3NQBA 3C2EA 1U1HA 1FWFC 1S1RA 2J8GA 2O4MA 4Z0SA 2DUXA 5I00A 1DJQA 4UMAA 4WZHA 1ONEA 4ZB2A 3U5UA 2A2IA 5GPRA 4US5A 4GIYA 2X0YA 3NAVA 1OF8A 2W5FA 5E5CA 7XIMA 4XIMA 4A2SA 4JTRA 1OGGA 4JN8A 3FEQA 5HNRA 4PTDA 4S38A 3B3DA 1R3VA 1VCVA 3VXGA 1YPIA 4M80A 4DJDC 4Q8VA 2Y70A 3IJIA 4X63A 4DF2A 4OE7A 1PB0A 3OZMA 4WKHA 4LYRA 2QULA 4IXXA 3S47A 3LLXA 1KW1A 1ECEA 4DPPA 2G4JA 3L65A 1UUMA 2WSKA 2VELA 3EMQA 4D1JA 1ZAHA 1S2UA 3CH9A 5GNXA 3TA9A 1T8XA 4HOZA 1MXGA 3DKJA 3IPWA 3VD3A 3AIBA 3F5JA 1TE6A 3SIZA 3EB3A 1V0MA 2PDQA 2O9TA 3KHDA 4H8NA 4MPKA 3OTRA 2PZNA 3W23A 4Q7IA 3NO5A 2OXNA 4C6NA 1HKJA 2OX1A 4UB9A 1ME9A 1FWWA 4Q32A 4CQAA 3WF4A 2VR4A 1K70A 2BP1A 3O2LA 4PA8A 4WSKA 3BAXA 3A9BA 4L6OA 3WX7A 1QPQA 2X0SA 1O6IA 4KFNA 2XN0A 2I9UA 3UQNA 4IXHA 1SMDA 3NYDA 1AL7A 3LU2A 3T6CA 5EBAA 2D2OA 4O14A 5JUVA 5K2ZA 3PWGA 4IHCA 1NFGA 2C1HA 5I79A 4MNKA 1VYSX 2C7FA 4NY2A 4QDMA 1R8LA 3AICA 1ZUAX 5A69A 3PF3A 3PJXA 3W7CA 1MDRA 4BF9A 3LCFA 1FCVA 2WQPA 4EPEC 4JTQA 2EPNA 2BXVA 4H4IA 3PPGA 5I07A 1G67A 5IDIA 2PWVA 3G0UA 3S1UA 3SCPA 4E8CA 3BG5A 5LIUX 4W84A 3AFBA 2R94A 4Q8MA 4DUWA 3O1NA 2DZAA 3NM1A 4JFTA 3ARUA 1FDYA 4MF4A 1B90A 1FXQA 1XSJA 2VVNA 1TWZA 2J27A 1J0ZA 3MSYA 1J0HA 1DJIA 5DCDA 4D1IA 4KFPA 3T0AA 3GXFA 4O8AA 4QM1A 3GNRA 1ZZMA 2FDMA 4GXPA 2J88A 1SW0A 2WO5A 1CBGA 2NXGA 2FFCA 5AECA 3LHYA 5FF0A 4UTWA 4ORIA 4HQVA 1QJWA 5DELA 2HROA 4KWOA 1KLZA 3GX9A 3TQVA 2WLYA 3T78A 1E1CB 3RLVA 4H2CA 2FPVA 3PB0A 4Q3MA 1GVEA 1XJBA 4A3HA 4KH2A 4OOZA 2Z1SA 3DFHA 3IRDA 4QNWA 1U30A 4IMDA 2YL8A 3KP0A 2Q8XA 4LCSA 3QMSA 1BRLA 1K8CA 4ACYA 2H9AA 3A24A 2EJAA 1R9XA 2HVOA 1CIUA 3W2MA 4AXNA 1JYVA 1VH7A 3T0BA 1J2WA 2V6AA 3OVPA 3P82A 1WXZA 4P5UA 2A4AA 4V33A 4MUPA 4LV9A 2XN2A 2FTYA 2VFIA 4P7LA 5LA0A 4L9XA 3NM3A 1ADOA 4B15A 1LRNA 1ZPTA 4B90A 1H41A 2ZE3A 1V6VA 4HA4A 3HGOA 5LNWA 3SY1A 4XISA 1LJYA 3C2FA 2O9RA 4FSAA 1YXDA 3V5FA 4MWAA 1VPYA 3AXIA 5A6JA 3IUIA 3BCDA 5HMFA 2V3GA 3LTPA 5EGRA 3MMWA 1EB3A 5U4NA 4REQA 4FNPA 1VFLA 3VIMA 4MDPA 3AMLA 3PWIA 2CPUA 3W82A 1H60A 2CKRA 1DHKA 4GHRA 5RUBA 4LUYA 3JW7A 3ZT5A 2PEVA 1VFTA 2Y89A 1PTDA 2GGHA 4BQ3A 3QW3A 4JFWA 1VD6A 1W9UA 3VKDA 1UC5A 2GJNA 3GHRA 3W2JA 4S3KA 5CGQA 1EWEA 2VWSA 1SJBA 2D0FA 1FP9A 2X1UA 1CTNA 1DJYA 2OT1A 2PRLA 3ZIZA 5CC3A 5KMYA 4W7VA 2ISSA 1ZB5A 1LDCA 1TG7A 2BFGA 1UQYA 3HG3A 4CNTA 3C52A 3CIVA 3O8AA 6REQB 4MYAA 1IT0A 3OHMB 1OT1A 3QQWA 2W0UA 1B3YA 1W6TA 2YCKX 4LVBA 3TXZA 4DY1A 1EDTA 4BK9A 2VEIA 4INFA 2XSBA 3TYZA 3GVQA 2WCGA 2UY4A 1W54A 2RUSA 2HQAA 1N8FA 2Y88A 3GH4A 4HU3A 3FX4A 3VABA 2WM1A 2BDQA 4PCTA 3M1ZA 4AYSA 1R86A 4HB7A 4UCFA 5A8MA 4RZ4A 8TIMA 1BTMA 3Q2DA 4CD4A 4HHLA 1QT1A 4FXSA 4ZQCA 2HEJA 4RR4A 5CQ1A 3M44A 3MZNA 3WFLA 3T09A 4A22A 3KBNA 3QY7A 3TROA 2EAWA 1TJ0A 2DJLA 1YTKA 4FB7A 1D7FA 3TK7A 1JCMP 3A6OA 2V3EA 3B8VA 3QVQA 2TMDA 3M0XA 5FJUA 1XH0A 3N34A 3SN4A 3DKLA 5IHRA 1W9XA 4AD1A 2PLMA 1BYBA 4DYKA 2Z2UA 3AISA 2ZTJA 4W4QA 3W2KA 2RDWA 5J8LA 4C6CA 2REQA 1ML1A 3TNOA 4JD4A 1VEPA 5AC6A 4D6HA 1GOKA 1E3ZA 3U4AA 4QFUA 4D6GA 3W70A 4FR6A 2XVLA 2O56A 4LANA 4E3TA 4O11A 4L6DA 1HN1A 5I06A 2V5CA 2ZA3A 3EYPA 2CWXA 3M64A 4MKVA 1E15A 1VS1A 4JTSA 4GQRA 1O68A 1EPXA 5KETA 2DH3A 1GOXA 5HWJA 1KM5A 4HK7A 3W87A 4OTKA 5DMLA 3NFUA 4ZFMA 3UERA 1EHNA 1F73A 3DXIA 1E1EA 1Q4WA 5D2WA 2X40A 3AHXA 1DQXA 3L2LA 1HNYA 4CVWA 1XC6A 3OU8A 1L8NA 4E4FA 3DFPA 4IMAA 4PODA 3O7UA 4AWTA 2X8RA 3W6MA 4RDVA 2WZEA 3WLSA 2I1OA 3KTSA 3EX1A 3EKLA 1A4LA 4O4WA 1OINA 3N4AA 5DFAA 2JEQA 3AROA 1RZMA 4CQ9A 3UGRA 4H01A 3PZQA 1SVDA 3APGA 5HR7A 3W53A 2J7GA 2X41A 4TVUA 1JCNA 3ABXA 4RW5A 1OCBA 3GHUA 1Q7ZA 3VIFA 1OVDA 4U3CA 3DHDA 5CCZA 3L21A 3B8TA 3U0HA 3U48A 2B7OA 2BHUA 1V79A 2EJ1A 2OJPA 7REQA 1OABA 3GH7A 4RE0A 3M46A 1I2QA 4ADTA 2E40A 4RNJA 1YRRA 3UA4A 3W37A 1QOXA 4C1KA 5CPTA 1Z6KA 1BG9A 3B9AA 1OWQA 5GJNA 4Z1DA 3FJ6A 1XSKA 4RZ6A 4I8DA 4AHOA 4PUJA 1E9YB 2CZ5A 3LTYA 1JIBA 2CFFA 1JZ8A 4OUIA 1P7TB 3FN9A 4IP4A 4PTWA 4HHPA 4ZODA 3B40A 3VGEA 4Q6JA 1PTAA 1UR9A 1XCWA 1DPMA 3CPRA 4JKMA 2DZUA 1Q5MA 1GJUA 2XYLA 3UXKA 2KX9A 4QJ1A 4Q4PA 5J5DA 2CYGA 5A94A 4UIOA 4QCEA 4JZ5A 1XGZA 4WXZA 4JYEA 4UTHA 1JZ4A 2ZE0A 4UFIA 5CJNA 8CGTA 1KBKA 2YDQA 4WGXA 1L2QA 3D6NA 1B3XA 1XRFA 4JQ1A 2Z26A 4GYJA 2E9MA 3CU2A 1UMYA 4RZBA 3QY6A 3KTXA 5IFTA 5BOFA 4ENLA 2EEXA 1BKSA 3P84A 2BMBA 1UKTA 2OZ0A 3W01A 2E25A 2NQ5A 2EPMX 3WDJA 1REQB 1Z8AA 4GOAA 4BI6A 4JTTA 1JNEA 4JAWA 1GNXA 4WLCA 1ICPA 3AMDA 3PFMA 4OGZA 2ZC1A 3W24A 3QMTA