4WDTA

17beta-hsd5 in complex with 2-nitro-5-(phenylsulfonyl)phenol
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdtA00
1AZ2A 4LB3A 2FZDA 4ASTA 2BP1A 1XJBA 2R24A 3U2CA 1T41A 3LZ3A 4Q7BA 2IQDA 4YVXA 1YE6A 2PD9A 2PDPA 3H7UA 1S2CA 2FZ8A 4FAMA 4HMNA 4JQ1A 2P5NA 4F40A 4JQ4A 1X97A 3UFYA 4FA3A 2PDIA 1ZUAX 4R9OA 5LIWX 3C3UA 3M64A 2A79A 1YNPA 1PWLA 3UZZA 1UR3M 4GQ0A 2PDKA 1QRQA 4XZNX 2C91A 1VBJA 2HEJA 4ICCX 5M2FX 4YU1A 3ONCA 4LAZA 3LZ5A 1ZGDA 4JTCA 3CAQA 1EL3A 4AUBA 5DANA 3UP8A 3V0TA 4XZHA 4QX4A 2CLPA 2NVCA 3N6QA 3LBOA 4LBSA 5JH1A 2PDUA 3LQGA 3UGRA 2PDQA 3S3GA 4NKCA 2PDMA 1AH3A 3BURA 3UZXA 2ACQA 3UYIA 1Z9AA 4DBSA 2IPWA 2R9RA 4YVPA 1T40A 2PEVA 1YNQA 4QR6A 2BGSA 3R8HA 4Q3MA 4PRRA 2PDLA 3FX4A 2PF8A 4YVVA 1EF3A 3GHTA 3RX4A 1FRBA 2PDCA 4GABA 1AH4A 2INZA 5JH2A 1YE4A 3V0UA 3LD5A 2IKJA 3QKZA 1SM9A 3RX2A 4XZLX 4JIIX 4JTQA 1VP5A 3R7MA 4JQ3A 3WBXA 3O3RA 2IKIA 5LIXX 1X98A 1GVEA 3NTYA 3M0IA 3DOPA 3CV7A 1C9WA 2F2KA 3ERPA 4WRHA 2PDFA 1ADSA 4JQAA 3Q65A 1PWMA 1RY8A 4I5XA 3V35A 3CMFA 4LAUA 2IPGA 4WDXA 1S2AA 3RX3A 4WEVX 3KRBA 4H8NA 2PDGA 3EB3A 1HW6A 1IEIA 3ONBA 4WGHA 4EXAA 2DUXA 2IQ0A 4GCAA 3R58A 2IPJA 4L1WA 1LQAA 4WDTA 3GHSA 4JTAA 4DBWA 2HE8A 5LIYX 5KETA 4PUWA 3R94A 4PMJA 3UZYA 2HV5A 3H7RA 3O0KA 1RALA 3LN3A 3R8GA 3LNMA 3G1RA 4ZFCA 4GACA 4PR4A 1ZSXA 3CAVA 3COTA 3R6IA 5AZ0A 4XVEA 2PDYA 5HNTA 5HNUA 4GA8A 4G5DA 3MB9A 2AGTA 2HDJA 2IKHA 2PD5A 1HQTA 4JIHA 4WDWA 3D3FA 1MRQA 3BV7A 4XAPA 3R43A 1LWIA 1XGDA 4XZMX 2PFHA 3H4GA 3EB4A 5LIKX 1AZ1A 1R38A 3Q67A 4JQ2A 1OG6A 4XVDA 4DBUA 4XK2A 5HA7A 4IGSA 4PRTA 4YS1A 2FZ9A 2ALRA 3LUTA 1IHIA 3M4HA 3GHUA 3UWEA 1MZRA 1K8CA 3V36A 1ZQ5A 3LENA 2ACRA 1Z89A 1QWKA 2DV0A 3B3DA 3F7JA 4XZIA 3DN5A 1S1PA 1M9HA 2WZTA 4GIEA 4PUUA 1JEZA 2ACUA 3BUVA 1A80A 2PDJA 2FGBA 1RY0A 4HBKA 3EAUA 4XO7A 2BGQA 2PDHA 3BCJA 2PDXA 3WBWA 2PDNA 3N2TA 1PZ1A 4XO6A 2HVNA 1Q5MA 2IKGA 3WBYA 4DZ5A 1S1RA 4FALA 1MI3A 5AZ1A 1XF0A 2IS7A 2FVLA 2J8TA 1Z3NA 3CASA 3G5EA 2IPFA 1EXBA 1Q13A 1PZ0A 2PZNA 4EXBA 4LBRA 4MHBA 4RPQA 5LIUX 3UG8A 3WCZA 3V0SA 3GUGA 4FZIA 3FJNA 3UZWA 1AH0A 4L1XA 2ISFA 2HE5A 1AFSA 4QBXA 1EKOA 2PDBA 3LEPA 2F38A 4JIRA 3WG6A 4LB4A 4IJRA 2DUZA 1PYFA 2I17A 2HVOA 2VDGA 2WZMA 4WDUA 2INEA 4OTKA 2NVDA 4QXIA 4JTRA 3T42A 4IJCA 2PDWA 3P2VA 1J96A 4H7CA 3VXGA 3GHRA 4GQGA 1US0A 1Z8AA 2QXWA 1X96A 4JTDA 5C7HA 2FZBA 2I16A 3CV6A 3LQLA 2ACSA 3MC5A
chains in the Genus database with same CATH superfamily
4PE8A 1MO0A 4NVTA 1XLMA 3HPSA 4UZSA 2CZFA 2OZ8A 4HPHA 2BV9A 1BXCA 1T41A 4CD7A 5JBEA 1DJXA 3CWOX 3CZLA 4XAYA 2C14A 5HJXA 3UJ2A 3G3MA 2HZGA 1GPWA 3DHFA 1VPYA 1YE6A 4JEQA 4RNIA 4UFKA 5AYIA 3L9CA 4GVIA 5D04C 4DUWA 1HIZA 3TLLA 2G95A 2P5NA 2WZHA 3KOXA 4S1FA 1S39A 2GQAA 1MSSA 2R91A 4TMCA 2ZVIA 3RG6A 4X9YA 2VZSA 2X2GA 3GDTA 2J9ZA 4NNCA 3WLNA 2A79A 2OLAA 3RUBL 3VIIA 3G1AA 5G1MA 4O50A 2WSRA 2ZA1A 1ZZMA 2A7NA 5I3FA 3IANA 4E8DA 1PO9A 1EOKA 3EPOA 4D6EA 3C2VA 4HHPA 2XVLA 1OFRA 3LZ5A 4PODA 1J12A 1W31A 1WYIA 1IR2A 4LOCA 1CCWB 4P5UA 1K7XA 3AMKA 1IXOA 4EANA 2BVWA 3N6QA 3KFTA 3NVTA 3EWYA 4B2DA 2W9MA 1HGWA 2HXUA 3THDA 4S38A 3RPDA 5GNXA 3WK3A 1UWUA 3R10A 4GJ1A 4FXSA 3I3EA 3UG5A 4LS0A 4O1BA 1QVBA 1J8VA 3KM8A 3E12A 4EKJA 3DKLA 2PF8A 4YVVA 1HL8A 3SY8A 3INPA 4GX9A 3RX4A 1M03A 1Q7ZA 1GZJA 4ADSA 4IHCA 4QISA 2BBFA 1XD0A 2FMOA 3MDUA 4HMEA 1JCYA 2HK1A 3SCNA 4BCEA 2OKTA 3WJSA 3W00A 4JTQA 4GCXA 5T8GA 3LSCA 2QCDA 3TYBA 4D6CA 2NSOA 3B8IA 3M43A 5AECA 2WMIB 4ZOEA 4AF0B 5DCEA 2VEGA 3CV7A 3PWGA 4NX0A 4ZOAA 1BVZA 4UOJA 1FWFC 1V03A 3BH4A 2J8GA 3ERPA 4PB4A 2GSEA 5DX7A 3I65A 3VKJA 4OT7A 4YHEA 5AYXA 3RCMA 4F66A 1K03A 2I14A 2J79A 3H6OA 4JBRA 3GDRA 3GH4A 3GG1A 4Q22A 1IEIA 3PB0A 4O4WA 2XGIA 1Z69A 2O4MA 1MW1A 1BYCA 2QUTA 4MJ4A 1LT7A 4ATWA 2GGIA 4D8ZA 2P8CA 3AS2A 4GZ7A 4GIRA 1R85A 1HKIA 3NEHA 1FWWA 3ZJ8A 3PZGA 5DT7A 5AVNA 1LLWA 3MJMA 3DXIA 5AYZA 2HPIA 1JI2A 4B5XA 3UPMA 1TKKA 2BVYA 4QS5A 2W5FA 4TXEA 3SRFA 5AHIA 5HDRA 3LNMA 2H8ZA 3ES7A 1EBGA 4J1OA 4EPDC 3T07A 3C2FA 2NUWA 3URAA 4AZHA 4PH6A 2A0NA 4MTVA 1GVIA 3EEGA 2D73A 2ZX7A 5C9RA 3TQPA 2JALA 1V7AA 2WM0A 4IG2A 5C9WA 3EA2A 3AIEA 3KS5A 3VKDA 1OX5A 3L21A 3E02A 3AIUA 3I7QA 3VOHA 1E6SM 3GVVA 5I3HA 2Q8XA 3M16A 3SECA 4M5PA 4AISA 1W1A1 1YPIA 3EMZA 2J7EA 3ZJ7A 1ME7A 3PFRA 3S83A 4ERAA 5KZMA 4XZMX 3KOYA 4M6UA 2VWTA 2ZRZA 3WELA 4UIOA 4AZGA 3DX5A 1EEXA 3ITYA 2HCVA 4DO4A 3NDOA 4O14A 3Q2DA 4GH3A 2GJXA 4LANA 2YPIA 4R85A 4C7GA 1WUFA 1IHIA 3WKZA 4MOZA 1K8CA 1PUDA 2WMHA 3C2YA 2GVYA 1A3HA 3TEVA 3E49A 4ZQRA 1KFLA 4D71A 2BFGA 3M0ZA 1A53A 1L6WA 4LX4A 4BZYA 4LUSB 3K1GA 2G3MA 2VC9A 5DXYA 5FEPA 1WE5A 3VTRA 3WQ5A 3PZTA 2DT2A 3ENLA 3TTYA 1ZB5A 4QQUA 5G4HC 1DJGA 3MHFA 2OMAA 3V4BA 5D2WA 3GRIA 1RY0A 1X7FA 5C9ZA 1IZCA 1WAUA 4E0CA 2VEMA 1UWSA 3DEQA 1XIFA 3CJPA 3MCNA 5A8OA 1OABA 3P67A 4M80A 3WD0A 3NIYA 2XZ9A 4A22A 1UJPA 1ZTVA 5I24A 2OO6A 3UWUA 5E1QA 1UQYA 2EBNA 3HQOA 1S3HA 5BRPA 2IPFA 4GYKA 1TJPA 1IR1A 1XRFA 4Q8VA 3HO8A 2PBOA 1C8VA 4OBRA 3S1UA 3NAVA 3TTOA 3TFXA 3L4XA 2WVVA 3S2CA 4C1NA 3W70A 1G4EA 4HU8A 3S2NA 5D37A 3CPRA 1H7XA 4ZTXA 1RAKA 4RZ5A 3RU6A 1FDJA 2OYKA 4BI6A 4H7ZA 1QJWA 1YXYA 3N4FA 4IMCA 1LL4A 5CC3A 4S2BA 3USBA 4S3AA 1Q4WA 5G5IA 2HS6A 4LYQA 4CD4A 3N15A 4AC7C 4LB4A 1X1NA 1XGZA 2HVOA 3UXDA 3MT1A 2INEA 2ABBA 7TIMA 8XIAA 1NARA 4PYSA 1SR9A 2VI0A 1HKWA 4UFMA 4D72A 1VFSA 3M5YA 2CBVA 1SJDA 2J7BA 1Y7VA 1H1NA 1XC4A 1VENA 5AC6A 4DWSC 3S9ZA 1YRRA 1JYNA 4M1BA 4M29A 3WF2A 2E68A 2GGEA 3DHPA 2YCLB 2I5GA 3HIJA 1AJ0A 2QV4A 4QE5A 3QR0A 4N2YA 3AWNA 3F2DA 3BSGA 2QVNA 2IQDA 3NL6A 2X2YA 5FA5A 1K8YA 3VNJA 4FNTA 1EC9A 2ZX8A 4IPJA 4E3VA 1KTNA 4Z1CA 2FHBA 1GT8A 3L4UA 2V5BA 2YLAA 3PBWA 1TPFA 5K3VA 1QO5A 3TFCA 3SN4A 2ZUUA 3IJIA 2XWEA 1TG7A 3FIGA 3MA8A 3OLIA 3EXSA 3CC1A 5GJMA 4QG6A 2NLIA 1O66A 2QPXA 2B7NA 3F2CA 4NAFA 3T05A 3H53A 4L7ZA 3WQGA 2J75A 4D6FA 9XIAA 1AH3A 2EO7A 3DG7A 8CGTA 3RPMA 1OZQA 1YTDA 2A7RA 3D47A 3AS0A 3WZ0E 1HP5A 1I0BA 2OQYA 2Z1SA 4UTWC 1JZ8A 4QJ5B 3L23A 1UHVA 3W7CA 2ZZ5A 2O56A 3S5OA 4JTUA 1T99A 3PPGA 4CNSA 2QJJA 3SRKA 3AIQA 2CKRA 1VYRA 3SCPA 1FXQA 4UUIA 1TV2A 1B5TA 1QPQA 3PZOA 1PAMA 2BASA 1VFOA 4EWJA 3TZNA 2INZA 1JL8A 1QW8A 5AYBA 2WBKA 2NX1A 1UWTA 4W7VA 2OSXA 2QCGA 4NYYA 3VI2A 3VZYA 3UESA 3BTNA 1WV2A 4AFYA 3LRLA 3DECA 4CD6A 1OYBA 2GK1B 1HJWA 2QEZA 4O1AA 4NJHA 4CGTA 2BGNE 2E3ZA 1G4TA 7ODCA 2E5CA 1J9YA 1XSKA 3IARA 3TNBA 1KV5A 4I5XA 3NO3A 2CBJA 1UB3A 1HJSA 2YIHA 1JGMA 4A05A 3QHMA 4I7VA 3SUSA 1B54A 4AZCB 1LBMA 4HIBA 3OQEA 3WLPA 3CUIA 3UCDA 2DZAA 4B4FA 1J11A 1DBTA 2DIJA 4LYPA 4JFWA 4XIMA 2YYTA 1HNYA 4ZCWA 4JEJA 1NWTA 1BTMA 4A4AA 2Z7GA 6PTDA 2R1MA 4PMJA 1W6TA 4OV4A 2BSLA 1K9DA 2PRHA 1L2UA 9RUBA 1ESWA 3SUWA 2ZA2A 1OK6A 4KGLA 3WJXA 1DWAM 1VFFA 5A2BA 4H6QA 3MZ2A 4D8AA 4YTUA 3LNPA 2JIWA 3CHDA 5HOSA 1H11A 4FNQA 2NLYA 2NUYA 4E2DA 2QPUA 4JS3A 4PBEA 4H9UA 4CQAA 3VD7A 4PTNA 4DWDA 3LHTA 5IXEA 3FHQA 1AD4A 4DWSD 3PJWA 4F9DA 1SO6A 4JX6A 4C90A 1XGDA 3DYOA 1EJTC 2WANA 3VM7A 1R7AA 1PZ2A 3MI6A 1WDDA 1U5JA 2G0WA 4CN1A 1GQNA 3AC0A 2WBGA 3OHIA 5FKYA 2KAUC 3SCSA 3WQCA 1R38A 1TO3A 5HWJA 3BG3A 1LG1A 1J5TA 4WKHA 4K38A 5D9MA 1XSIA 3M0HA 2ALRA 1XLHA 2XIOA 1LWJA 3HMCA 1A5OC 3JVAA 3TYDA 3KL3A 3K30A 2PTXA 4B5UA 5CG0A 2YXXA 4B5WA 5LSMA 1H7WA 2QCMA 4C6KA 4FIRA 4PMOA 1O5XA 1AQMA 3LB0A 4DJFC 1TCDA 1D8WA 3M0YA 1Z89A 3E96A 3B3DA 1WX0A 5I03A 2EGZA 2EPKX 3A6OA 3GDMA 3PJTA 5CC5A 2WPGA 5KITA 4WXZA 3UCQA 4QP0A 2WZTA 1XLIA 3OLEA 4GHRA 2O9PA 2JEPA 1DWJM 4RZBA 3NG3A 2MUCA 1EYWA 3UWZA 5AHEA 3WUGA 1F6KA 4Y8EA 3XINA 5H8PA 5M17A 4HA1A 1MMFA 3EWUA 3EX1A 3NSNA 2V3GA 1PZ1A 4M0XA 1E73M 3W25A 3T0AA 3PBGA 4W4QA 2WV8A 1SJCA 4PZVA 4GGHA 5ECUA 1MQQA 3A9IA 1R2SA 1OGSA 1YYAA 3LPGA 5LYRA 3G5EA 3CUHA 4Q7NA 1DIKA 1DORA 4P7RA 3L0GA 3BJSA 3N3TA 1W9DM 2AMXA 5LIUX 1M01A 1TUFA 1SO3A 4IGNA 4QIUA 2UY4A 1YDNA 2EPMX 3QM3A 5EMJA 2JGYA 3WK2A 2ZZ4A 5GJNA 1UZ1A 1V6WA 4L80A 5LNVA 5I00A 3SFKA 2XYLA 4CD8A 3KBNA 1MXSA 3FJNA 1WUEA 2VJXA 3EX6A 1E6ZA 2DW6A 1KWGA 4MFEA 1O5QA 4HU4A 1PCWA 3CYVA 1EPXA 1US3A 3H7VA 2ZDRA 1V3JA 4JTJA 4R7OA 4BI7A 5A6KA 1J18A 2ZUSA 5LA0A 2AKMA 1BXBA 4R53A 2DIKA 4PMVA 3GG7A 2FHFA 5BZAA 4L6DA 3E0FA 1US0A 5C7HA 5B7ZA 3CZ8A 2I16A 1AA1B 4M8UA 2ACSA 3B0PA 4GO9A 3QEZA 1GOWA 1S5MA 1MUCA 3DI1A 2FZDA 3M41A 4P8UA 1US2A 3XIMA 3HGRA 1MZHA 3VIHA 1QOXA 2WMFA 4GUIA 4DJFA 4ENLA 4DYKA 3EWXA 1W5MA 1DJZA 1KLYA 1UR2A 3TOPA 4NF7A 1ZJAA 1SFSA 2PSNA 1V02E 1RUSA 1GUVA 4FR1A 2WNNA 4LUJA 1D9EA 3AIVA 3D3AA 1W2PA 3ARVA 3GY1A 1KV8A 3QMTA 1ZJIA 4KF1A 1KM6A 2PRLA 2O9RA 2BODX 1LRTA 2G3FA 3I6RA 5A6JA 1JRCA 5JU6A 5A6MA 4Y9OA 2QKFA 4JTKA 4KEUA 3BVJA 3D6NA 3GX9A 1B9ZA 4O15A 2WJFA 1KFCA 2GVGA 4Z17A 1GKPA 1LOQA 3W81A 1QNOA 4TO8A 3RXZA 5BW6A 4Q8MA 3NQGA 5KMYA 3AXHA 3W2MA 3VO0A 3GDKA 1GGOA 4IMGA 1T8QA 4UMAA 5EMMA 1K1DA 4AVOA 3MANA 1OVDA 3NQ2A 4LBSA 3A3HA 1EC7A 2C18A 4KFOA 5CAHA 4O52A 4Q4PA 2YBUA 3FEMA 2PRMA 4OHQA 2PWHA 4EWND 2EPOA 3LM7A 4HNNA 2D0FA 1VKFA 1YKWA 2Z2AA 1H51A 2QULA 4U10A 2JK2A 4PRRA 2X42A 4NG3A 4DZHA 2MANA 1DEDA 1EF3A 2ZE3A 4WJ8A 1LP6A 5I02A 4MVAA 3AALA 4QSFA 3VDCA 4CCDA 2GYIA 3TN6A 4UQDA 2V38A 3AHYA 5K7JA 5JH2A 4N42A 1SSGA 4OZOA 1IT8A 4P2VA 3GNNA 3LI0A 1VP5A 3OU8A 3V5FA 3OODA 3S5ZA 3H23A 2QPSA 3VIKA 4GE8A 3FVDA 1ITXA 2QR6A 2FPYA 1TV8A 2HBXA 3BCFA 1XIBA 1XH0A 4DI9A 2DH2A 2V5JA 3ZLHA 3UWVA 4Q7IA 3LYEA 2YSWA 3AHZA 4G8TA 3RMEA 4WEVX 4FOJA 4Q4QA 2JBMA 3VU2A 1JZ2A 4NXSA 1HW6A 1PPIA 3FSUA 4YTTA 4WGHA 2IQ0A 3R58A 4ZE5A 3ABQA 4RDWA 2PCEA 2C6QA 4FMVA 4J3SA 4DBWA 1VFHA 2RGLA 1OQFA 1GTEA 3TYAA 4RKAA 4BHYA 2ABAA 4A2SA 3MV01 1U83A 3NVDA 3E0IA 3UPBA 1TIWA 1D7KA 3NYDA 1OIMA 3FCPA 3FAWA 2Q3OA 5BNKA 2SFPA 1PCKA 1ITQA 3L0NA 1TPUA 3KLKA 4G56A 1LL7A 1WKYA 4PTMA 3AMCA 3FA3A 4Q4RA 4HYWA 4WDWA 1ZY9A 4MADA 4H04A 1O95A 4C6OA 3RCNA 1NELA 3AXKA 1J2BA 3AIRA 1R5YA 2P53A 2QAFA 1DP0A 1OCBA 1OSEA 4MYXA 1JYXA 3HG4A 1HF6A 5KEZA 4LF1A 2OYLA 4Q4KA 5AHMA 3OBKA 1WKDA 4KGJA 4P8VA 4ZQOA 2PE4A 1YMYA 4KEMA 4I8YA 3TR2A 3D5HA 1R6WA 3PWAA 2H90A 3R1ZA 2F2HA 3IIOA 3EMQA 4N9CA 2DH3A 3CTTA 3UVIA 1MYRA 2EQDA 3WK1A 2ACRA 9CGTA 2YL6A 1CXIA 5F1UA 3BOXA 3C0JA 1DJIA 4MJZA 1WQ5A 2ZYFA 3MBDA 4KMQA 3ZWSA 1SYTA 3MJYA 4BF9A 4JN6A 1DVJA 1JRBA 1FKWA 5AKQA 4QDMA 4KT2A 4WOQA 5HQEA 2I56A 5AHNA 4PL1A 3WMLA 1EA0A 1B3ZA 1L6GA 3F4VA 4KESA 4OIFA 3IGXA 5HQLA 2POTA 1Y5WA 1EPVA 1FWDC 2P50A 3ARSA 1YIXA 5M1TA 4JIQA 4YJ5A 3ZMRA 4HSNA 1EXPA 1XYZA 4WHBA 3GS6A 8A3HA 4BI5A 1D3GA 2ZXAA 3KVJA 1E71M 3G0SA 4U4MA 3VCRA 3JS3A 3O05A 1CDGA 3PPHA 5A6SA 5A8NA 3O2LA 4O0KA 4A3RA 3ZLGA 1OFPA 4S3FA 4B5VA 2YXOA 3U57A 1TELA 3VMNA 1A5MC 1N2VA 4JYDA 3SUUA 1XI3A 3OQ8A 1ONXA 2WZMA 1KO0A 3BAIA 2V2CA 3K4DA 4RW5A 3CK5A 4IJCA 1F7BA 4H7CA 2OGYA 3GHRA 2ZX5A 5AC4A 1TMLA 3AYSA 4GUJA 2QXWA 4CEUC 2XVGA 4DJDC 2WZIA 3VD3A 3ZT6A 1MNZA 2G3NA 2XGZA 3U2CA 2I5QA 1PX3A 3FA4A 3GM8A 3SY5A 3NL3A 3ARWA 3S42A 4IPIA 1REQA 2OEJA 1H63A 1Q4NX 3MWCA 1FCQA 3U4FA 1E1CB 4Y96A 3W1XA 4REQB 3VOCA 4TV6A 2J7DA 1UD6A 4IQLA 4IWWA 2DVTA 2D22A 2J6VA 4HZ8A 1BWKA 1XICA 4O1CA 3UWYA 3BE7A 1NOFA 1QI4A 3P0WA 2ZADA 3NQAA 3SB0A 4HZMA 5I3JA 5D38A 1THFD 1HJVA 2XSAA 3FVMA 1UBSA 3RR1A 3UZZA 1E5JA 2PDKA 1KW1A 2POZA 2W63A 4QFUA 2PAJA 1N8FA 3WY1A 3CUFA 3VOFA 1NIUA 1S5VA 2OLSA 5HK4A 4JKMA 5FJPA 3NL2A 3V0TA 3WD4A 4MY9A 4QX4A 2CLPA 2R6OA 3LQGA 4K8EA 4L9YA 3IGUA 2YL5A 4XD5A 5DLCA 2IPWA 1JD9A 2VC6A 3OG2A 4ADUA 2E8YA 3AIWA 3APTA 3IK4A 4GFIA 3BZJA 3R0DA 4QLKA 1IZJA 1EDQA 4M24A 3VOIA 3S46A 4JXCA 1VLIA 3M6YA 2R1LA 4QROA 5I0DA 1IT0A 2FIQA 1BGAA 4XD3A 4K7YA 4HCDA 1GHSA 4LS1A 4F9JA 2WVSA 3HFYA 1MDLA 1PHQA 1P0BA 2PP3A 3CZKA 4KPLA 4ZQPA 2W79A 4LU0A 5DY3A 3IV8A 3K8KA 1EJVC 1K77A 2XSXA 2D1ZA 4GYPA 2ZKMX 2FPVA 1DV7A 1PB0A 2E0PA 3A4JA 1ZENA 1R3QA 4PGLA 3BGGA 3PTKA 3AOFA 5TF0A 4W84A 2MNRA 4C6CA 3ZR5A 4NASA 1MFUA 3AHXA 4TTUA 1TWWA 2A6NA 1M41A 2C13A 1V3IA 1QNQA 5CZJA 4AVFA 3UXKA 3V35A 3R0UA 1XPGA 2CZ5A 2IPGA 4PBFA 1JZ6A 4GKLA 3NZRA 1FX6A 3CUZA 4MKVA 2X1IA 4H8NA 1W9VA 3SBFA 2QJIA 3O0FA 1GZGA 3ID7A 1T6MA 3LY0A 4UQBA 4L4LA 4FX8A 1VHNA 2I9UA 1SVDA 3GVGA 2DU2A 3CH0A 3NFUA 1CXFA 1P4CA 4WD0A 1ZU8A 2NWSA 1Q2SA 3N25A 4LAMA 4MWAA 5HJLA 3T4CA 2Q8LA 4LWWA 1L6SA 4R7JA 1RA0A 2YJQA 3EXTA 1R3TA 1B4KA 1EOMA 4AWEA 1UR4A 2Q6ZA 4DO5A 1ME8A 2E40A 1UMYA 2FB3A 4ZO8A 4M19A 3BPWA 5AZ0A 1TPDA 1DYSA 4PEKA 4OV9A 4OUEA 1IE7C 2NX9A 1A4MA 2DZUA 2YCKX 1XLEA 3GC5A 3OP2A 4Y9NA 1HJQA 5TIMA 4DJDD 2IKHA 4Y7EA 4AZBA 4LAOA 3W1QA 5A8QA 2YW4A 2A3AA 3BMVA 4Z1AA 1W3JA 5BXRA 2VO5A 5ECVA 1VIWA 4PN2A 3KZSA 1YDVA 1B90A 3G6LA 4GQBA 4IIHA 3PG8A 1KCKA 3WQOA 2OWCA 1JZ5A 3I3BA 4FNRA 1S5WA 3V5OA 1DWIM 4UTUA 2BOFX 1UD8A 4GXMA 4QJ1A 5SWUA 3REQB 1P5BA 2D69A 3GBEA 3GHUA 4AAJA 4YTQA 3VK5A 1EP3A 4GIAA 4DNHA 1S2WA 5CBIA 2O7SA 4JNZA 3LHWA 3VKKA 5A69A 3W23A 4QJ4B 2OPJA 4PSPA 2PCQA 1QAPA 1R3WA 1C92A 2G3IA 4KCUA 3NL5A 4ZOBA 1VC4A 1F5ZA 3C3NA 4HPGA 3TYCA 2WNWA 5M03A 4DRSA 1UH2A 4W7UA 3W1LA 4IP4A 3SUVA 3ORWA 1WOAA 1EZWA 2QCEA 1AK5A 2QVHA 1XH2A 1YW1A 2WSPA 2W27A 4Z2LA 1OFBA 2PDNA 1AJZA 1TQXA 4PUDA 4R3UA 5AZ1A 3THAA 2WW5A 4MIMA 2HROA 2OFJA 4WQ6A 3VNKA 1P0KA 2W6RA 3T40A 3HURA 1GVRA 1RJPA 3DGRA 3NM1A 1FCVA 4KCTA 2GDQA 3T0CA 4TX9A 3CB3A 3GDLA 1NFBA 4ZO7A 1RQBA 2DPEA 2ISSA 4D6IA 1FOBA 3WN6A 2E4TA 4Z2JA 3THQA 4B90A 1AH0A 4QS6A 1XD1A 4L6OA 4B9YA 1TRDA 3VZXA 5C5YA 4PMZA 2EG6A 4LY4A 1XCFA 1IEWA 3W2KA 1SZEA 4NRSA 5CQ1A 4BF7A 4DF2A 4AD5A 4HNCA 3P84A 1TV3A 4PB3A 2XIJA 2FZBA 1C8XA 1M53A 4N9DA 3PZQA 4Y9AA 3PF3A 4C6LA 1AZ2A 5FF3A 3C2RA 2PA6A 3DFNA 2R24A 4FLQA 3IUHA 1ICPA 3B9EA 4A3QA 4HOWA 3FW6A 1QPNA 2NX3A 4Q7BA 5M5DA 4H9VA 4PCFA 3O6AA 4CU6A 1A5KC 2TRSA 4BEUA 3CL7A 4RXGA 3NQ6A 4JQ1A 2P0IA 1ZAIA 4L4MA 2QCFA 1PEZA 3BC9A 3RHGA 3GO2A 5LIWX 3L0KA 3O16A 1Q2RA 3F1QA 4OJYA 4LPCA 5EBUA 3B97A 2Y5JA 4ZQNA 4JFTA 3WFLA 3LERA 4JYEA 4XZNX 4M6PA 3FJLA 3GWQA 2GVJA 5DBTA 3RM4A 1XLKA 3GXDA 1XLAA 3ONCA 3QSTA 1P6BA 1VBGA 3DBNA 2E5BA 2DZVA 1B3VA 3BICA 4Q8NA 4GJIA 4J3ZA 1T96A 3WLRA 1RBOB 5IOBA 4XBJA 4MG4A 3GU9A 1VEPA 1Z44A 4JTSA 1IXPA 5CGQA 3EDJA 1JAEA 1FUYA 3O1NA 1QW7A 4LEFA 2F6KA 1QTWA 3BAYA 2E1DA 3N14A 4RZ4A 2QLYA 1DQUA 1XX1A 4L56A 5AYYA 3OW1A 2FJKA 5BRBA 4C7FA 4HOZA 2WLYA 2YLLA 2ZXDA 2F61A 2VRQA 2OVLA 3UR8A 2GDVA 2FQIA 4H01A 1L8PA 3A47A 3DFTA 4FX6M 5IM51 5LHFA 3BOLA 3ABXA 3KL0A 3Q45A 3PZIA 4RLIA 1A0CA 3TN3A 1FBAA 4AHQA 2A85A 4XTIA 5T91A 1KM2A 4QSHA 2ZDSA 4Z2KA 3RN6A 1LUCB 4O57A 2E5DA 1P7TB 2YFOA 1R9ZA 4AEFA 1H1ZA 4JNYA 3UY8A 1C8YA 3HV9A 4F2UA 1IF2A 3I6TA 3M0VA 2PURA 1HUVA 4QNWA 1EB3A 4O13A 3A4AA 2FGLA 1OB0A 2O55A 1VJSA 1W3HA 4KFNA 4IIGA 2UWFA 3QPYA 5DEZA 1T0OA 4FX7A 4MMWA 5BWFA 3QQ1A 3GG0A 2PGEA 2VFEA 4MNJA 4CUCA 2YZRA 3TDFA 1F2JA 3U5YA 2EPHA 3OBAA 4L1WA 2OXNA 4W88A 3UA4A 3PZMA 4J3UA 5LNWA 2Y85A 4UOQA 5A6AA 4G9PA 4H9XA 1ZS2A 1LLZA 4H2HA 4LCSA 4EPBC 3T8LA 5IFPA 4NUWA 1V51A 3KCJA 3RR4A 3VUPA 3CAVA 4QQ3A 4GY0A 5GPRA 2V3DA 1TIMA 1TTPA 1L9WA 4S3KA 4Z42C 1HO1A 5FEWA 1JIBA 1R9XA 4XSMA 3ARPA 4CVUA 2ZICA 1M7OA 3WLMA 3SO7A 4DM1A 4ZSTA 4MPKA 2EPNA 3H54A 1BWVA 4O1FA 3KE0A 3W85A 1QNSA 4WJEA 2HWGA 3PNZA 5K4XA 5CC6A 1MQPA 3IJ7A 3IPWA 4K39A 4XKYB 1RA5A 1SW3A 2VD8A 1FQ0A 1LQ0A 4WVXA 1XDMA 3VE9A 1ONRA 1IV8A 1TR1A 2ZOXA 2BLEA 2J66A 1YBQB 2XJ7A 1ZALA 3EX4A 4F0SA 5JUVA 4US5D 1V3MA 2QT3A 3WJWA 1PBGA 2PU1A 1XIMA 2ZE0A 1Y5VA 5BOOA 2E6DA 2CLFA 1I2RA 4NY2A 1UZHA 2W4XA 1MZRA 2PTDA 2YB4A 1Q45A 3LSBA 3MS8A 3DC8A 3WLSA 1R7OA 3TE9A 4C6NA 4HHHA 3KOZA 1R3YA 1XIHA 1KBIA 4UTTC 3ZXWA 1IWBA 2TPSA 1X38A 3FXYA 1QWKA 4LVBA 3AROA 1FA2A 3ICJA 4MUPA 2C1HA 1AJ2A 4ZSUA 2XSBA 4UNKA 1XDJA 4M51A 3WLLA 3MU7A 1OD8A 1SMAA 3NWRA 2ZFAA 6REQB 1BSIA 3MMDA 2ZRXA 4WIWA 3T09A 9XIMA 3T08A 1ZPTA 2F84A 3SCTA 4EF9A 4JFSA 1J6PA 2WJEA 2YL8A 1CENA 2UY3A 3EBVA 4ZXLA 3W7GA 4GOAA 4XO6A 3BCDA 2YOCA 4HA4A 2IKGA 2Q02A 3V3WA 4EPEC 5I7GA 3WNLA 3QV8A 1KGXA 3IWPA 1KKRA 3GB6A 1Z3NA 1S46A 1DQXA 1FH9A 3ARYA 3UW6A 1KA9F 1EXBA 3N2MA 2X40A 1VBUA 1YLVA 4RUBA 3SADA 1QCWA 1KXQA 4WZHA 3PZUA 4R34A 3E1F1 7REQA 1Q6QA 1H0GA 4FZIA 1AODA 2GUBA 1CLKA 4BQ4A 5G4WA 2BVDA 3LMZA 3UZWA 2ZZ7A 4ACYA 4JFVA 2PP0A 2OOFA 4PFMA 3STCA 3WMSA 1VIZA 3TIMA 3RYSA 3TCSA 5CPLA 2O4QA 3EGJA 1QI3A 3QH2A 2QUUA 4K2SA 3T42A 5I3IA 1Z7AA 3CZGA 5G1TA 1J96A 4PMYA 3WLIA 1E1FA 5CZKA 2TYSA 5XIMA 5I79A 2BY3A 1TB3A 3W75A 1P43A 3NNTA 1EIXA 2Y63A 5E09A 2HNHA 1XISA 4W9TA 3EWWA 5FOOA 1BEUA 4Q4OA 4E4PA 3TVAA 4K68A 1EEPA 2XVKA 5A8MA 3LRMA 5I2UA 1H50A 5ABTA 2FZ8A 3PAOA 1FH7A 4JQ4A 1VBHA 4PTDA 4GVHA 1YQ2A 2D0HA 4ICNA 2Q8ZA 1X7IA 2Z7KA 4IIEA 3RFAA 3W9ZA 3EDKA 1HVXA 2GVLA 1YNPA 3ZR4A 4HNUA 2WYSA 1GVFA 4A8LA 5JBDA 3WH9A 4K37A 1EUAA 2WHLA 3TJXA 2C91A 1VBJA 3WF3A 4HPNA 1H61A 4UOZA 1TUXA 4AUBA 5C2GA 4L4OA 2VC5A 1I9CB 1A5BA 4M6VA 4XZHA 4Z0JA 3HG3A 1KFWA 4QAWA 4W8LA 3W73A 3HFTA 2WVUA 3E2RA 3BURA 5K9CA 3BARA 3E0VA 1KTCA 1FH8A 4PUNA 4YNGA 1HKKA 3C2OA 5E9AA 4C60A 3CS2A 3CHVA 5KZDA 2E6FA 3OA5A 5EMUA 2CXGA 2EHHA 3FHAA 3VIJA 1JI1A 4DQWA 2B7OA 3V75A 3O9NA 2ASHA 5EFFA 2GGHA 4IQJA 2W91A 4W86A 2VX5A 1OT2A 3OZYA 1XUZA 1XKJA 3PSVA 1HO4A 3CL6A 2BVTA 4I9JA 3I7SA 2NV9A 3W07A 5CSUA 2FH8A 3KZPA 4WOZA 3IIPA 1A5AA 1O1ZA 2WC3A 4JQ3A 5D02A 2G3JA 2DZXA 5T9CE 4POCA 4W87A 3LXAA 4UR8A 2BXYA 1H41A 3CIVA 3MHUA 4W89A 1SFLA 2J78A 5C2CA 1A3XA 3PPCA 1UZDA 2CNCA 4I5UA 3SSJA 5BOEA 3N4AA 4QE4A 3W7QA 1OCJA 2V2DA 2HNEA 2OX4A 3NGJA 2PZ0A 4E6MA 3GXFA 4DBDA 4XZBA 3ARXA 3B05A 1GNXA 2ISDA 1UR9A 3UA3A 3GU1A 3T2QA 1ICQA 2XG9A 3CPGA 4JYFA 4OFCA 3STGA 1QASA 3GNRA 4RJEA 3B0YA 4IPNB 4YWSA 4PUWA 4K6AA 4B5NA 8RUCA 3FJ4A 2EXOA 3OOQA 4HZ6A 3CEPA 3UZYA 4Q8WA 5I06A 1AQHA 4LYKA 3N04A 3BOFA 3AXXA 2OYMA 4LRSA 3C4UA 2ATSA 2QCHA 4F0HA 5REQB 3AWOA 4AYSA 2YKKA 5HNTA 1FXPA 2ZZ6A 5EMLA 2BDQA 3PG9A 2G5WA 1OFAA 2WB5A 3OB8A 1POKA 4DPPA 3W2LA 2ISVA 1RZMA 2ZBTA 1ECEA 4J9JA 4QCFA 3LU2A 3GFZA 3MCOA 3MP4A 3BQ6A 2PODA 1JCMP 4PFHA 3R43A 3ITOA 5GJPA 4JPGA 4O19A 3S1WA 1UWQA 4AH7A 1BF6A 4EIVA 4H7VA 2NQHA 3CXOA 3VD9A 4UTFA 3B4YA 3WQEA 1M7PA 2GFTA 1EJXC 5LIKX 4IGSA 1YX1A 2X16A 4CQDA 1UH3A 1C93A 1H7RA 3VKBA 2V3FA 3UT0A 1EFZA 3B8SA 3WK0A 3WEOA 4IFKB 3MSYA 3FKKA 2NW0A 2F8QA 1KXHA 3VDAA 1M7JA 3IAPA 1GVOA 1SFTA 3VFLA 3AO0A 1UPMB 3EEZA 3B06A 4JFUA 3KWSA 2C16A 2BOEX 3W1RA 3FLUA 4ERIA 5EA9A 1BHGA 3TC3A 1WZAA 4G2DA 4JTTA 3SIZA 1BGGA 5B80A 5MKGB 1YDYA 2AL2A 4HMDA 3NR0A 2KX9A 5J04A 2XIMA 5AC5A 4Q8PA 2X0HA 3TV8A 2AGKA 3W83A 4UFLA 1EF2A 2GSJA 1ME9A 2E9BA 2QZRA 3NQBA 3AISA 3BCJA 5FIPA 2PDXA 1GVQA 3GFXA 5CLWA 1XG3A 1H5YA 5D33A 4GUGA 2FDSA 3LS9A 3FK4A 1GQKA 1HTIA 2YBVA 3WEZA 3UGVA 2X7VA 3OG3A 1ODZA 1CWYA 3PK7A 1K4HA 3P62A 3L5AA 4GRSA 3IGSA 3V16A 3ZOAA 3EWCA 1UBPC 2CXEA 1MXDA 2FFIA 5J5DA 1EJUC 3WJZA 4WSKA 3KW3A 3CMGA 2ZWZA 1EYEA 3MUXA 2FTPA 3RITA 4UB9A 1QNPA 3WF4A 2CYGA 4MKNA 3GIPA 2REQA 1UASA 5HMSA 1JQXA 3W1UA 4L1XA 3NPXA 1KTBA 4JR5A 3ABZA 1E6QM 1UD2A 2VR5A 1HFBA 1QI5A 5AN7A 3U7BA 4S3EA 2Y5EA 4Y8FA 3C52A 2EKCA 3TUUA 1PS9A 4G1KA 3ZT7A 5HATA 4O53A 2JQXA 1GKRA 3LQLA 3KHJA 4KEZA 1BXNA 4HQVA 1K9FA 2YCIX 2CZVA 4KFPA 1WNOA 1UUMA 4R33A 3DFSA 4MLRA 4KEVA 1B2YA 3AS3A 3QN3A 5D30A 1FWIC 1E0TA 4WKFA 4NSBA 2BHZA 2DFAA 2QS8A 4GY1A 2WPBA 2WJZA 1GYMA 4JY8A 3NQDA 2Z25A 3ITGA 3MKCA 3T8QA 4G7EB 5ABFA 1NU5A 2Q09A 1W1TA 3FEQA 3VGFA 1ZBKA 2ESCA 3U2EA 3H12A 3W53A 3C3UA 4FSAA 1QUMA 3MSRA 3B8DA 3TN4A 3WSUA 2FTYA 5HNNA 1I8JA 1BWLA 2NSXA 4AVNA 1UJQA 3GR8A 4WUIA 2WQDA 3LDVA 2GVEA 4IUGA 4I7UA 2BY2A 3PAJA 3ARZA 3I7RA 3LCGA 3N3MA 3IUDA 3PUOA 1J01A 5I77A 3E74A 1FWJC 5F7UA 3UGRA 2AQVA 3S3GA 1K8ZA 4NNBA 1UCWA 4XISA 3UYIA 2F7FA 1LTDA 3HV8A 1YNQA 2J7CA 3S47A 1ISVA 4YTSA 3HM7A 3R2GA 1XH1A 5FCZA 2JGQA 3U5UA 3HQNA 5D8WA 1KM1A 4Z0SA 4PMQA 3MP3A 2WHJA 4Q4SA 3IVUA 1NTHA 1TA3A 3LCHA 3LHZA 4FHAA 2WLZA 4XIAA 4NJKA 4Q8OA 2PDCA 1YNYA 2PLJA 1XYMA 3DC0A 3LPOA 3MI2A 2EG7A 3BWWA 1CTNA 4JIIX 1NP0A 2VFIA 3C6CA 2DGAA 1WDSA 2QCDB 4ATDA 3LPFA 1CGTA 2R8WA 5L6UA 3VCCA 4GMEA 2ZUTA 3UWQA 4UFIA 3DOPA 2X7WA 3GTFA 1R3RA 5BCAA 1PV8A 2CITA 3PJXA 2OWWA 4NZFA 1HX0A 2DT1A 1GG1A 4DX3A 4WXYA 4ZGYA 3GFYA 2D0GA 2J27A 1ZHAA 1EQPA 3RAOA 3W29A 2VFDA 1OG0A 3ARQA 3ARUA 2IW0A 1VYSX 3QYSA 1U22A 2Z28A 3W7NA 4WK9A 3RNDA 2ISWA 5D9NA 3GHSA 2DORA 3PM6A 4W93A 2HE8A 1ZL1A 5KETA 2PWEA 5GQBA 3WDJA 2X8RA 2A4AA 3A21A 1DJYA 4OGZA 2DVUA 1ZBCA 3F5LA 3WMBA 3OGSA 1JCNA 4XKMA 3M47A 3QV7A 3VX0A 3AFBA 3SGGA 3ANUA 8TIMA 4Z1YA 3THCA 4JN8A 4YTRA 2XN0A 4AEEA 4M82A 3CEUA 4IG2B 5KTLA 3BXWA 1N55A 1SO5A 2JF6A 1GOMA 3K8LA 3P60A 1POJA 4UTHA 3TW6A 3S9IA 2DZSA 3STFA 4AIBA 2VQTA 3QW3A 4CCEA 5DBUA 4V15A 1TWIA 5F4XA 1VFUA 2JKEA 3WL1A 2CW6A 1XIDA 3PNUA 3LM3A 1PTGA 2ZZ3A 4WY0A 1OFEA 3ARTA 1U5VA 1AZ1A 2ZVRA 3PUGA 3GNPA 2GQ3A 3PJUA 3B40A 4JX4A 4WSHA 4YS1A 2GJXB 1RVGA 4O54A 1DXIA 4KRUA 3W1AA 4IMEA 4H41A 4TVUA 2VP8A 2V81A 1I45A 5EYWA 3ATZA 4E3TA 3ZFHA 2IXUA 1C3FA 3SW6A 3N73A 1IYXA 3DCPA 1NWUA 1CGXA 3GIQA 4GBDA 4A3UA 3MKKA 2A6LA 1NDVA 1YDOA 5HNRA 4ZB0A 1TQJA 3GZ3A 4HNOA 2PDJA 3T1GA 4WX2A 1AW1A 4B5TA 4PMDA 1ML1A 1PDYA 3VGDA 3WBWA 4MNLA 4ES4A 1FHVA 1KBJA 5CPSA 3WQDA 5F4SA 2PTZA 3M0KA 4DZ5A 3KUMA 4MLJA 4MNMA 3C0LA 3GNXA 1TTIA 2RDWA 2XH2A 2VDHA 3LCLA 3DHUA 2RKXA 2GJNA 2PP1A 4C6IA 4CNTA 4C5ZA 3SN1A 4BWLC 5EGRA 3GTHA 2VR4A 5HR7A 4FR6A 3BLDA 3TJIA 2WVVB 4C1NB 1XP3A 2XFFA 3TYEA 1QATA 1IT7A 1FWGC 4OUIA 1ICSA 1DJQA 2D24A 3ITTA 4PUJA 1FY6A 2R82A 3PULA 2BX7A 3EWBX 4GZJA 4ZENA 3S1VA 3QF0A 4A21A 2OJPA 3L4YA 3KOWA 1H09A 3WG6A 1MUMA 1OC7A 2VDGA 2CBIA 4UTKA 2WKGA 3QBUA 3H55A 1IGSA 1TV5A 1W9PA 3SCVA 5C0QA 3QRHA 5A8PA 4GQGA 5CJMA 3T0DA 3BLEA 2FKPA 3OLGA 3U2ZA 1JCTA 3BQ5A 5CZTA 4BEQA 1G9HA 2Y89A 2W0UA 4K36A 5CBBA 1RR2A 3GBDA 5FL0A 1KBKA 3STEA 1E4IA 4ZA0A 4UTMA 2OEMA 4YVXA 1W3LA 3BAKA 2XIQA 1RH9A 3R11A 3FAXA 4F40A 2GUUA 1E56A 3UFYA 4FA3A 1XYFA 1VS1A 1P0DA 4JKLA 1OK4A 4GVGA 2E9MA 2QDHA 3EWDA 4M7TA 4Y90A 3TC6A 3RLGA 2CIPA 2VENA 2VVNA 4KW2A 5KZ6A 2YDQA 3FN9A 4AHOA 4W7WA 5HXMA 4ALDA 4TQTA 4JTCA 4G6CA 2E67A 3NOYA 3WL0A 3CAQA 3ZSTA 1G5AA 3K4WA 5I23A 4NAFB 2Y6ZA 1DIOA 2DT0A 3RRXA 1E4MM 2C19A 1F8IA 3LGDA 4UTJA 3UZXA 4I9AA 5EMKA 3BLKA 1C7TA 3UXLA 4QR6A 4PTVA 3KDOA 3QV9A 2DQWA 4RZ6A 2X05A 4P61A 2C1IA 1J10A 1HL9A 2Z4GA 4ROQA 4DXKA 2QDDA 3ITCA 3IVTA 1DL3A 3CAKA 3N6JA 1EHNA 1QMLA 1TE6A 3H2CA 4DZIA 5CSYA 5MF5A 2DP3A 3VX1A 2Z1XA 1TVLA 2IXVA 1NF7A 1QPRA 3VMPA 1W2VA 1GK8A 2DZTA 4HOXA 4LVAA 5I5RA 4Z2IA 3KVKA 4F2BA 4IFRA 1X8FA 4RNJA 1TJ1A 3F5JA 2IKIA 4HCLA 3DUGA 5LGXA 3NTYA 3ALFA 3EOLA 2A3EA 2F2KA 5RUBA 4OBSA 3A12A 2J7HA 1J0YA 4MSSA 4LT9A 4ZE4A 4LVDA 1S2AA 1V3KA 5ABEA 5CKSA 2PLKA 3TP4A 4A8RA 3Q58A 1D3CA 3ONBA 4O28A 1XLBA 1NH6A 1KCZA 3UU0A 3R12A 3CO4A 4DXXA 1KNWA 3WDQA 2HISA 3ZM8A 1MEHA 1P6CA 1W5PA 1KQZA 2DDXA 4ZFMA 4AD3A 1KFJA 3W7MA 1KQYA 2QV5A 3PB2A 2GJRA 1VEMA 1S2TA 2C79A 1PSCA 3LN3A 1QHZA 3IAQA 5CLTA 3RDKA 4R7WA 2GOKA 4GACA 1I0DA 1LG2A 1OX4A 4AX7A 1V4YA 3FV9A 4DELA 2WXDM 3SURA 3W4RA 1NVMA 2AL1A 3TYZA 3VNIA 3C8FA 1L6YA 1W9UA 1X8CA 4NI8A 1UA3A 1IEQA 3MY9A 1J0HA 2XU2A 4UCFA 3EB2A 4IX0A 1RK6A 3CZJA 4HN4A 4NZ4A 2OT0A 2FZMA 1EO5A 3L5LA 3T78A 3GNOA 2Y7GA 1O7AA 1PKLA 6TAAA 2Z6JA 1YADA 1BYDA 3CUJA 2BB0A 1WKEA 3B8UA 3E0WA 2E9LA 3WQFA 3LGEA 5LA2A 1P7TA 1OBAA 4ZB5A 4DBUA 4JTLA 2XTKA 4RV8A 3MO4A 3FDKA 5E5CA 3F4WA 4RK8A 1EZ2A 1VD6A 1SQ7A 1XLGA 2NWRA 5AVHA 2JKAA 3UWEA 3MYOA 4GY7A 4UFHA 1UKPA 3B8WA 3UEQA 3ABRA 3QR3A 2VVSA 1BRLA 4C7DA 4WCJA 4PUKA 2DV0A 2G97A 4AWSA 1JF6A 5L9FA 3AI0A 3UJFA 1LBFA 3ABOA 4PTWA 3TC7A 3RK8A 3MZNA 4GO8A 5J5RA 4N9EA 4B91A 1WXZA 2ZC1A 1TWDA 4JAWA 1E55A 2OTDA 4XD4A 4IMFA 4WKAA 1FHUA 2WC7A 5E9XA 2VFFA 5FF0A 3E38A 5GNYA 4AZ5A 3UETA 4HPXA 4EXQA 4RW3A 1WBJA 1Q6LA 1VFMA 1Q5MA 3NYZA 5LA1A 3RM8A 3TROA 1MEIA 1MI3A 4O8RA 2IS7A 2ZUWA 1PHWA 4AD0A 1SO4A 4O0QA 3O63A 4H6RA 5CEWA 2ON3A 2XIIA 4HVXA 3BGAA 3HQPA 1GJUA 4MJMA 3CMJA 5BYWA 3B03A 5BXPA 1T5AA 4C6EA 2I1OA 4MHBA 3W37A 3WDPP 2PC4A 1JUEA 2R14A 4KERA 1CGUA 4TU1A 3L5MA 3TX9A 3M0MA 5AC7A 2Z1VA 4BY3A 5FI8A 2V63A 3NM3A 2HQAA 1XLDA 3LBCA 4QGCA 4QBXA 3BGJA 2VZTA 4XD6A 3WLKX 3SCRA 4QRNA 3NQEA 1V6TA 1CIUA 4FF7A 1V79A 3DFYA 4WDUA 4MDOA 1JPIA 1DJWA 5HWMA 3H2AA 3SN0A 3VXGA 1JUBA 2Z1KA 3CIWA 4L65A 2UBPC 1W1VA 4TVDA 1TWSA 3PZ9A 4QE1A 4ASTA 3BV4A 4GVFA 3VINA 2OGJA 4DWSA 1A0EA 4B9ZA 4ZL1A 3PR2A 4UNLA 3ZVHA 3APYA 2VGGA 1HGYA 3N34A 2NUXA 5F1VA 1CZ1A 4MY1A 1UWAA 1E0WA 1WO2A 1JDDA 3W72A 3VDGA 1E9YB 4OU1A 5BU9A 1KC7A 1LM1A 3WMCA 2G4FA 2OT1A 3LTSA 3W74A 3PVFA 5K2ZA 4N4QA 4F8XA 1TREA 3KTCA 1TJ2A 1Q8JA 1XIIA 3UY7A 2PLCA 3TA9A 3N9SA 3RJXA 3KRUA 1V08A 1JZ3A 1UR3M 3B04A 2BOGX 3W1PA 2E28A 2BXVA 4ACZA 1GOXA 2OOGA 5DMNA 3WQPA 4YU1A 3EPNA 2P1FA 4V2XA 2HBVA 4QDPA 1DTNA 3OEXA 3WQ8A 1M7XA 4MPQA 3NQFA 1GOQA 6XIMA 1W32A 2J7FA 4IQDA 3OVGA 4K8HA 4RDVA 2QUVA 2PDUA 3I3DA 4QJ3B 2PDQA 1QBBA 1QXLA 1E15A 1F6PA 4R9XA 1UW9A 1KCXA 1WOBA 1SZNA 2ZTJA 5CGMA 4AD1A 1OFDA 4A3YA 5IRPA 2CESA 4AZIA 2X1RA 4UTWA 1BSLA 1N8IA 3AHTA 1A5SA 3GXNA 3MUZ1 3W88A 3PS7A 4RNHA 3GHTA 4H8HA 4JTIA 4D6DA 3BLOA 3W6LA 3TZFA 1XW8A 4LVGA 3G0UA 1L6FA 4LNCA 5BWAA 1Y8BA 5BXTA 4NT0A 3R89A 2VQUA 3BMWA 3GYEA 3V0UA 3LD5A 3LI1A 3F2BA 2IKJA 3QOMA 1B3OA 3TSMA 1W1B1 4GZIA 3UQNA 5AHLA 2WSKA 4XAZA 1G69A 5HQMA 2H3DA 4S39A 4DJEC 4ZMGA 4UTLA 1Q65A 3NPUA 2QGYA 3VIFA 3GAKA 3N2CA 4UBPC 1ECQA 2XPKA 1VPQA 4FB7A 1UP0A 1XINA 3Q65A 2FDMA 3W27A 3WDIA 3GTXA 2PTWA 1SU5A 4U31A 3EZ4A 1I1WA 1VFLA 1YXDA 2YB1A 3JU2A 4W85A 3M44A 3IVSA 2ZXQA 1JZ4A 5HINA 2QYGA 1R2RA 2FFCA 3QJAA 3A4XA 4PC8A 4LEQA 4GYJA 4D8LA 3WD2A 2V5CA 4GCAA 2P8BA 2ATMA 4YXGA 3C8NA 4MB1A 3W1NA 2ICSA 1HP4A 4TOQA 1BG9A 3B9OA 3OIHA 4PB5A 1OEPA 1QU4A 2XVPA 3L7RA 3RF9A 4J3XA 3AHVA 1ZSXA 1GOIA 2UY5A 4I3GA 1AQ0A 1L2QA 2VT0A 2V30A 4IL2A 4PA8A 1UP3A 1YEYA 5A6LA 4I7WA 1E0VA 4P7NA 2VZVA 2D20A 4LUTA 4JIHA 1E40A 2VTFA 2CHRA 2AAMA 3B9NA 3VIMA 3E2QA 4LFYA 5CSRA 1SW0A 1I75A 1F9CA 2V67A 5A94A 3KOFA 2QIWA 1VJZA 3ZWTA 1B3XA 1YTEA 4NAEA 5FACA 3S6DA 1TPWA 1MFVA 1I2QA 3AQUA 3TQ0A 1JNEA 4HD5A 1F05A 4XVDA 2XISA 3W1MA 1NM9A 5HA7A 3ITVA 2UY2A 4FNSA 4PRTA 4Q6JA 2FZ9A 2O9TA 3F03K 3LUTA 4S3GA 2H6RA 3VGBA 4PRWA 4NYUA 2VC7A 4ROPA 1V93A 3WLHA 4MB3A 1F07A 4JCMA 3HJEA 3UXAA 4CNPA 2YFNA 4PMRA 3MSDA 4JY9A 5E0KA 3WH8A 2A3HA 4J35A 1UKOA 2XM1A 3NURA 4XZIA 3NO1A 3G1FA 3Q94A 1J0JA 3WDHA 2ODOA 3AMDA 4YL2A 4D1JA 1J0ZA 4MB4A 4L1GA 4R88A 1E3ZA 2NV1A 1EHAA 5LNUA 3KXQA 4CCZA 1W8SA 2A3CA 2WC4A 3PBMA 5FJRA 1K3UA 2ZQ0A 2QCLA 5DQPA 3WBAA 1FFQA 2RHGA 1TR9A 2Z1BA 1CGWA 2VM8A 3W2JA 1P0EA 4KIEA 1XF0A 3LCFA 3MVTA 1K7FA 3W7EA 2VUNA 1U1UA 3SJ3A 3M5ZA 3WENA 3WQ4A 4HNVA 5A6BA 1CXKA 1E43A 3TONA 1V0NA 2PPGA 4CKQA 4U33A 3SR7A 1XWYA 2DEPA 5D2VA 2YW3A 4X0VA 3IACA 3M1ZA 1HKMA 3HGJA 5G2HA 4GQRA 3QFWA 3KL5A 2HK0A 3DYMA 4PCPA 4DJED 2CLLA 2ONEA 1FWSA 3N17A 2PDBA 2TMDA 3TN5A 1GTHA 1UWRA 5DY2A 3RO8A 4IJRA 4M6QA 1UYQA 4A3HA 4CU7A 1WDRA 2PDWA 3TAOA 1XIEA 4FNUA 3Q4DA 4DAFA 4JTDA 2WM1A 2E1WA 1EWEA 1Z32X 1RD5A 2D3LA 2XN2A 3I10A 5LXXA 1TSIA 2A7PA 3VABA 5EB8A 2BP1A 5A3HA 4C6PA 1HG3A 2H3BA 5FJUA 1VLWA 1X1ZA 3BLLA 3VNYA 1EA9C 4FLSA 3HN3A 1SSDA 1IIGA 1REQB 3WBEA 2W67A 3TH6A 2O7QA 3L2LA 3PP7A 3IJ8A 2AQWA 1DWFM 4C6JA 3S5SA 5MKGA 2Y88A 4V1YA 4EE9A 3KP1A 3HB9A 2QMJA 3HJZA 3OZMA 4QCEA 4J3VA 3CZEA 3GG8A 3H2FA 3TAKA 4LRTA 4WJXA 1IEVA 1ITCA 3T7VA 5A8GA 4AMAA 3HGSA 2PU0A 2PWVA 3LLXA 4MYAA 1DXEA 4AYGA 1GJWA 1JNDA 3CYJA 1JCLA 4AD2A 1TPC1 5F2LA 7PTDA 1BYAA 4E8GA 4E5TA 2TODA 1TWZA 3LXCA 1VEOA 3UP8A 2PGRA 4QEHA 4CLMA 4IP7A 6A3HA 3IGHX 3LBOA 2B7QA 4NKCA 4S3CA 4ILSA 3MV11 2GOUA 3CV1A 1A47A 3LK6A 3K5XA 3T2OA 4A29A 5F4WA 3TR9A 4H2CA 4R5EA 1RQHA 1ADDA 2WNZA 2ZZ2A 4Q8QA 1IGWA 3S1XA 3R8HA 4Q3MA 4ZO6A 3W71A 4AEOA 3WQ6A 3K2GA 3EDEA 2QUMA 4DUOA 1SFJA 4JTGA 4U2ZA 4JTHA 1V5XA 5FSDC 3OA3A 1B9BA 3MMTA 4UFJA 3F4CA 3UNDA 1JPDX 2VHLA 1S3TC 4AHPA 3TKFA 4Y6GA 2YA0A 3EOSA 4GABA 2WQPA 3NDYA 4IPLA 5CC7A 3SDOA 1ITUA 1SM9A 3LG3A 3B0UX 3EOUA 4NZ5A 1ZAHA 2WMGA 3QZEA 2OU4A 4DNMA 5LNRA 1MXGA 4MKSA 1E6XM 1OF8A 3O3RA 1DIEA 3WFAA 1UC4A 1GVEA 1H3GA 4CU8A 1IWAA 1Q85A 2NQLA 1U1JA 2C15A 5H1WA 1RCXB 2BY0A 2QHAA 4JX5A 1TVNA 4G7EA 1F4AA 1GONA 3GXMA 1UR8A 3HG5A 4LAUA 3GLCA 5CPMA 1HKVA 4CEXC 4DI8A 4DF1A 1M1BA 4DXVA 1XKYA 4NQ1A 4P8XA 4XBKA 3VOGA 4JIEA 1ZLPA 1XLJA 2XVNA 4W8BA 2WCSA 3HF3A 1CGYA 1NY1A 1A5CA 7ENLA 5FEZA 1HJXA 4MWAB 4QNEA 4IIFA 3O7UA 3NQVA 2WKLA 2DJXA 3W1TA 1FWCC 5DN1A 3CV2A 4H6EA 2DVXA 3QVQA 2WAGA 1CI1A 2V3EA 1UKQA 2WSYA 1PL9A 5EL1A 2XM2A 1H62A 1GVSA 3CHCA 4FK9A 5E6ZA 4V27A 2CCRA 4HU0A 4O18A 3KRZA 1WPCA 4GI4A 3HOJA 4GI8A 3BK0A 5IHRA 4QM1A 4A6GA 1QK2A 3THUA 1KFEA 3S8HA 3ITLA 2H8XA 3PTQA 3QFEA 3QSRA 3OBEA 3I68A 1A5NC 4HA3A 5EBAA 1XRSA 2GWGA 3FGCA 3H21A 2A3BA 2ZIDA 3DH7A 4LAKA 2PGWA 1R47A 1O4UA 1PIGA 1JF5A 3WDRA 4JQ2A 3UD6A 4XK2A 4CQBA 4C6FA 4J4KA 3MUAA 3SRHA 4IIBA 4O10A 2O0TA 5K9DA 2ZCGA 1F74A 3E2VA 3VYLA 5HUPA 1NAL1 2C3ZA 2WCAA 2R1KA 1C7SA 1Z6KA 2J4GA 1VR6A 5GVJA 3BG5A 2INFA 1N7KA 2V82A 4AY7A 3MTWA 3WD1A 3CLMA 4PUUA 2ACUA 1XYCA 3BUVA 1GW1A 1V7YA 3A3XA 5JMUA 4B2DD 2VYOA 1TJ0A 1S38A 4LCQA 2AOSA 2X1SA 4IGMA 3ISIX 4PUEA 5CJNA 4OOUA 3MUY1 2RDXA 4NXKA 1R3VA 5FESA 4UNIA 1E1EA 2OZ3A 3C0SA 3B4UA 4ZOCA 1LWHA 1FFRA 3OYZA 3IJ9A 3D0CA 2FVLA 2OB3A 2B31A 1EGMA 4X9SA 5JBFA 1PZ0A 3BAWA 2CETA 2R1NA 5EFDA 3QY8A 1ALDA 4IOTA 3HBLA 3UG8A 4FIQA 2ZZ1A 3SCWA 1UOKA 3SUTA 3SEPA 1MVYA 2FTWA 3V0SA 1O94A 1M3UA 3NA8A 3E5BA 3OGRA 1IWPA 1QBAA 5K4ZA 4ML4A 4MB5A 5C70A 1V6YA 3JRKA 3WX7A 5XINA 2PI6A 2ISFA 1VF8A 2YXGA 1E6NA 4B15A 3CHFA 1JXKA 3NZGA 4ZODA 1RCQA 1PKYA 1CT5A 5F2IA 1PX8A 3QGVA 4LY8A 2EF9A 1TZZA 3N19B 2CBUA 1OZMA 3SY1A 3OPSA 1HL2A 2P76A 2V0TA 1S5NA 3HTWA 4M56A 5DRIA 4DJDA 3CV6A 1CXLA 4IL0A 4LB3A 5FF4A 1NSJA 1GQLA 4H6KA 3IRSA 5C54A 2FMNA 3EDDA 3LGGA 3V5CA 4PBGA 3DG6A 3GNDA 1ZCCA 3W24A 1PVNA 4PTXA 3W7LA 4FNPA 2PD9A 2PDPA 3H7UA 4L61A 3G1YA 3U2OA 3HZ3A 3G1HA 1A5UA 1UP2A 3T81A 2TSYA 4LNYA 5BU6A 1NEYA 4DIAA 3QHOA 3M64A 3NPWA 2JE8A 1C9DA 2DZPA 3GH5A 2A3LA 3C0QA 1TVPA 3QHNA 1WA3A 1J5SA 3LLDA 3FYPA 3F5KA 3DFOA 2P3ZA 3UWWA 3UJEA 1Q6DA 2YZ5A 1V6XA 4XWUA 3XISA 3G2GA 3QW4B 1EDTA 2O9OA 3TTQA 1TV4A 4A8IA 2XGBA 4N9BA 1ZGDA 5CXPA 2CLMA 2V5DA 3BG9A 3BAXA 1G94A 4KCVA 3GXIA 1W9XA 4DUXA 1PDZA 1DJNA 1QWGA 3C5QA 4XBSA 4J28A 1TJRA 3WNNA 3W01A 3WIJA 3E0LA 1I1XA 4WLCA 1T40A 3KBJA 2J9YA 1X1OA 4ICMA 1SJBA 4BR1A 1XYLA 3M0JA 4YCOA 4U3AA 4YLWA 2NZLA 4IXXA 2J88A 1FCUA 3WLJA 2J24A 3KDNA 4GBUA 2X1UA 4TX6A 5EPDA 3TLQA 4NJGA 4AY8A 4AIEA 2EAWA 2Y5SA 1Z42A 4F4RA 1AH4A 1KXTA 3CUGA 4KWSA 4IUOA 1B3WA 1XBZA 2CU0A 4U3CA 4G7FA 2WMIA 4AF0A 1F3EA 1M65A 4YWIA 3B9DA 2BG5A 3EDFA 3O15A 3HPXA 3W2UA 4LALA 2OX1A 3VNDA 3UZ5A 4NU7A 4Z08A 4GYFA 1RY8A 2D3NA 3GKFA 3FXGA 1ZRQA 4FS9A 3QQWA 3P74A 2JIEA 4ZBCA 2CHNA 3UZJA 3M6DA 5EMYA 1GG0A 1DQWA 2IPJA 1ISWA 1CGVA 4E4UA 2RDTA 3RO6A 2VUYA 4E2OA 1RLDA 4QTGA 1WZKA 4H9YA 3II1A 4HTYA 1HXJA 3AMLA 1Q8AA 1RALA 1NOUA 1Z48A 1KGUA 3GW0A 2WSQA 4GG9A 3LCXA 3H26A 1CYGA 4YCPA 3CQ0A 5H8MA 2VCAA 4XVEA 2RJGA 2EJ1A 1KXVA 3MPGA 5GNZA 5HNUA 1JPMA 4H00A 4AY1A 2V8ZA 5D09A 1HVQA 3ZIZA 2HDJA 3KTXA 1J0IA 2Y8VA 4ADTA 2E6YA 1Q6RA 3G1XA 2PD5A 1HQTA 3VM5A 4E2BA 4GUHA 3LHYA 4QEEA 3L65A 5D9PA 4XAPA 2NVAA 3HA1A 2XINA 3MVIA 4F2TA 5E6YA 2BTMA 5BROA 4GNKB 4CQCA 3STPA 1KKOA 3UPWA 3WUEA 3ME3A 5DT5A 1ZNNA 2ANUA 1KRMA 4O0ZA 1GPFA 3VKCA 4GGBA 3E5PA 8XIMA 1X6LA 5T26A 3T44A 3M7SA 3N9KA 4L9ZA 2HS8A 5G1YA 1XRTA 2C0HA 2G96A 1JYWA 1F4HA 4MNKA 4DBEA 1X6NA 5H6HA 1IQ8A 4FLRA 1LQ2A 4MDPA 4LUSA 2BHUA 2A21A 2DQXA 3WEMA 4NZCA 1QK0A 1G4SA 3RU8X 1WZMA 3GTIA 3F7JA 3MWAA 3TU9A 1ELSA 2EPLX 4GJJA 2YBTA 3I4KA 2J62A 1ZJHA 3DGBA 3WNOA 3DYPA 2CC0A 1CBGA 3JZUA 4XZWA 1AQFA 4EAMA 1TMQA 3ZZ1A 1JFXA 2AMGA 1UR1A 2VEKA 1ONWA 3TJ4A 1Q6FA 2YGYA 4JKKA 1JXJA 3U3HA 2HVNA 1KFKA 2ZA3A 4HYVA 2ZWYA 1EP1A 2WNQA 3GVQA 5D8ZA 3FSTA 3IJ6A 4IMDA 1B1YA 5A1AA 4K7VA 5E70A 1VB9A 3IIXA 5U4NA 2ZX9A 1XRVA 3IJQA 4LH8A 4TMBA 3E9AA 3OTRA 4OOZA 3ABSA 3VCNA 2FPTA 4ZQMA 3VPLA 1XHGA 3SI9A 2WMKA 2DSUA 5FJTA 1F3WA 5FAJA 5JXQA 4UQCA 7REQB 2WCGA 2D23A 4RPPA 2Y7EA 1JD7A 4ONVA 1FKXA 4P7LA 3QZ6A 4HJWA 1AVAA 4JCLA 1M68A 1F3TA 4BQ5A 1SZRA 2I17A 4JOMA 4C5YA 5HMEA 2E09A 2NVDA 4M81A 1S2UA 1XM3A 4AX6A 3QC3A 3VVGA 1DJHA 4EX4A 2X0SA 1SUXA 3JZEA 1BYBA 6XIAA 4UTIA 1DTUA 2J9XA 3AZSA 2GGJA 3WH7A 3FJ6A 3EA1A 1KM4A 1W3IA 1QI2A 5CPOA 1BF2A 1XJBA 4XAFA 3P6LA 5C7VA 2FJUB 4TTGA 1K4GA 1VHCA 2YCLA 4GKTA 2OCZA 1E72M 5BMWA 3DFQA 1H5VA 1XDLA 3LZ3A 3O07A 4F0LA 2YCEA 1G1YA 1MRAA 4D6HA 3UJRA 4TVCA 1QI0A 1CXEA 3R13A 1RP8A 1S2CA 4UCGA 3HG2A 2ZRWA 1JQVA 1TPVA 2ZUNA 4ZXOA 4Q8UA 1CLVA 1W1PA 4O16A 2PDIA 1V0LA 4AD4A 4US5A 2YDRA 1OX6A 4RXFA 1ENUA 5FJOA 2J8FA 1Q6CA 1E9ZB 4AZ6A 3B9AA 1DWGM 2XH4A 5CGTA 4GQ0A 3HGOA 1YXCA 4HNTA 2O92A 2PUZA 1DHKA 3QGKC 3IV3A 1LCOA 2DJLA 3CPUA 1OYAA 1GOOA 3R0KA 3MBFA 5DANA 3K46A 1NFPA 4HSOA 1PZ3A 4CD5A 3G1DA 3H2MA 3P8IA 2PBGA 5BMXA 5JH1A 1XQKA 2R94A 3DFHA 5F2MA 4H8VA 1P6WA 3G8EA 3GKAA 5CZSA 5I6SA 3N2XA 4IPPA 4H8UA 4HCHA 1BD0A 2R9RA 4NILA 4D6GA 1Q63A 4H19A 4QDWA 1AUSL 3NSXA 3A22A 4ORMA 3SRDA 3FA5A 5CPTA 2GLKA 2XFYA 2D2GA 1QOPA 3R8RA 3EOOA 3N29A 3P5YA 3PUDA 4N02A 5DMMA 4E2VA 6ALDA 1UROA 2PDLA 1TV7A 4IZGA 4PCNA 2NT1A 4IISA 3ITXA 4RX0A 4XQ6A 4M3PA 1UIPA 2J77A 3L2IA 4U2YA 3KEHA 2VELA 2G41A 3HPFA 3QKZA 3MO7A 5C71A 1UA7A 2E77A 3N4EA 1TPH1 1E5NA 2GGGA 1UG6A 1KLZA 3VIOA 3IIVA 3C86A 3WBXA 1K02A 3TSBA 1FTXA 2GK1A 4I8DA 2X0YA 1SJAA 3W6YA 1QPOA 3M0IA 2GDUA 5DELA 3DDMA 1BFNA 4ZQCA 3G0XA 1QHOA 1L8NA 1XFCA 4WRHA 4KETA 2I9EA 1TFVA 1PWMA 1EJ7L 4PULA 3WQVA 1W54A 2Y7FA 1EQCA 3F4NA 3S2MA 3PWIA 1JULA 3VE7A 4AZCA 3IS4A 3T4WA 1QOQA 3QC0A 3W0KA 5BRQA 4Y9PA 3H2EA 1U2YA 2HJPA 3OHMB 2H9AB 1MDRA 3UERA 4JTAA 4UR7A 3JW7A 2XFRA 3EA3A 1QHPA 1JUKA 1RPKA 1WXJA 1RJQA 4I6VA 4NL1A 3QY7A 3PN8A 3LOTA 3W2NA 3H70A 3WFZA 2VL4A 1EH9A 3WNPA 4ZFCA 1VZWA 3S9YA 4U28A 4DVOA 2WKJA 2Z1WA 1H7NA 4XUGA 1UPPA 3QTPA 3U9IA 2PC8A 2IMRA 3H2NA 2HPMA 5JIPA 2YYUA 4QLLA 1A4LA 3CIXA 4MZ8A 1LT8A 3D3FA 3CQHA 1BPLB 4UWMA 7CGTA 3DBPA 3NQMA 2LLEA 4J2PA 1TPB1 4DJFD 3KWXA 2QMKA 3DERA 1S2VA 1W3KA 2OEKA 4I6KA 3ARRA 1UD4A 3S5NA 2XH0A 1R87A 4S3DA 3RRAA 4K8GA 5HANA 4LUIA 3S4TA 3KHDA 1RBLA 2HXTA 3W7RA 1IXNA 1F3XA 3M4HA 4U5IA 3R79A 1R46A 3L67A 4YN5A 1NQKA 1LF1A 5D2YA 2UZ9A 1PTAA 1NQ6A 5C55A 4C6QA 3H2OA 3I4EA 2C0AA 5HMFA 2Y8KA 2WOQA 3KAOA 4UTTA 3SCQA 4JGDA 4NI3A 5A6TC 3VILA 1P48A 1K9EA 4B92A 2VX7A 3QXBA 3JR2A 2AKZA 3G77A 3KS6A 3QPZA 2QW5A 3HPZA 3DN5A 1AG1O 1M9HA 2EJAA 1VYPX 3F4DA 5A6BD 2X41A 4WGXA 4PEEA 4DF0A 2AL2B 3EPMA 1UR0A 3AJXA 1D7FA 3P82A 3RGTA 1CXHA 3AYVA 1YPFA 1AL8A 2CERA 1ADOA 1V0KA 5FJJA 2VOTA 2VCCA 4BS0A 3MHGA 4L6HA 3TMQA 4OECA 1XLLA 1ODUA 1O68A 1DOSA 1ZAJA 3DG3A 3CO8A 3GDBA 1S1RA 4DY1A 4N6EA 1K9TA 4UXDA 1CW2A 1RCOB 1GYNA 4E4FA 4S23A 2DSVA 4ATLA 1R3SA 2J13A 1E51A 3A9BA 2DW7A 1O6IA 4HK6A 4GI9A 1EUNA 1GHRA 1J0KA 4BJHA 5TD4A 4EXBA 3CUXA 3WH6A 4RPQA 1SMDA 2QDEA 1FHDA 3RPTA 1H4PA 1K6WA 2QIIA 1V3HA 3GUGA 1FWEC 5CBJA 2VWSA 1KCLA 3W7HA 4GXPA 4HZ7A 3SM0A 4GQQA 4B5SA 3TTEA 3ZJKA 2OSYA 4LC8A 3N2OA 4JDYA 2REQB 2Z2BA 2QJHA 4HPJA 3BLPX 3TYUA 3B0XA 4GINA 1PYFA 1U1HA 5U7SA 2CLKA 1ZP3A 2CLIA 5E0CA 4QXIA 1J93A 4D1IA 5D32A 2VCBA 3RMJA 4YMZA 2QDGA 1GJPA 1FWBC 1OC6A 2WK2A 3VGHA 4BF5A 3CQJA 1NP2A 5I07A 4JTEA 3EKZA 3HMJG 4PUMA 1VPXA 3CHEA 4F0MA 4C65A 1PX4A 1A0DA 2PS2A 1SZGA 1W5QA 5ABFB 6TIMA 1ZUAX 2OKOA 3ZO9A 4R9OA 3AIBA 1YTKA 3GQYA 3M5XA 1HJUA 1TYGA 1JCJA 3NCOA 3UG4A 4AU0A 4IMAA 3NEVA 4FP1A 4HP5A 3B8VA 3GC2A 4Y9MA 1CB7B 5AOUA 4LV9A 1QFEA 3CH9A 4BQ3A 3G24A 3L4VA 1FDZA 3EKGA 1UC5A 1W3NA 2NT0A 4MJ2A 3KCLA 4AMCA 1GWJA 2CZDA 3GC4A 4LAZA 3A5VA 4X63A 1H0IA 1OFOA 3QMRA 4J40A 3RIKA 1OM0A 1RPXA 1LLOA 1R9YA 4E8CA 4QHRA 5AC8A 2QGHA 3BW4A 4HSHA 4KWUA 4Q33A 3FKRA 2CZEA 4GZEA 2VGIA 1Q6EA 3P3BA 2PEVA 2DUAA 3GK0A 1QR7A 3SQLA 3H22A 2PF0A 1PTDA 5D4YA 1NDWA 1WB0A 3AUJA 4IH3A 3GXTA 4MF4A 1FP9A 1E6PA 1LBLA 5HBFA 5HUOA 3O8AA 1AD1A 2VRKA 4K1WA 1WZLA 1TA3B 1CPUA 3NZQA 4HJFA 2FGZA 3P0XA 5CCZA 3W3OA 2YL9A 4EP8C 1YE4A 4UZUA 3AZRA 1JAKA 2VX6A 3RX2A 4XZLX 2BWGA 1FP8A 4AXNA 4GYPC 2VZUA 3DENA 1V02A 1M6JA 2FVMA 3K13A 1JZ7A 2YX0A 2CLEA 1EDGA 2JEQA 4AIOA 1X98A 3SJNA 3SCOA 1NWSA 4Z2GA 1T8XA 1LZOA 3GIYA 1FWRA 1WXYA 1C9WA 1WP6A 1D3HA 3TWAA 4AB4A 3UR2A 4JQAA 4XZ9A 4D2JA 2Q3RA 1C8QA 2GZXA 2VZOA 2YR1A 1KWKA 3CLWA 3W26A 1UD5A 4IICA 5I3KA 1P1MA 2J25A 4OKDA 2QJMA 2PDGA 4X3ZA 1FWNA 2DUXA 2GL5A 5HJYA 3POHA 5FEXA 1MW2A 3VDBA 3W7DA 2Z6IA 3P14A 4OWGA 3ZVIA 1XXXA 1W56A 1WDWA 4MWAC 2NQZA 5D05A 2J47A 3MP5A 2B81A 1NOWA 3RLVA 7XIMA 2HV5A 4AW7A 3H7RA 2XIBA 1P0NA 1RV8A 1GKQA 3G3DA 3L4ZA 4O4VA 5DXXA 4IQEA 3A3WA 2XHYA 4PR4A 3DAQA 2VRJA 3GYCA 1BKSA 3G8RA 5FAGA 1Q3NA 5H91A 3AAMA 4GNJA 4PMUA 6CGTA 4LTSA 2Q01A 1XIGA 4AIUA 4G5DA 2AGTA 2FYMA 2W62A 4IJBA 5M3WA 4MGGA 2DZBA 3PTDA 3QMSA 2VEFA 5FD0A 4QLJA 1KR1A 4RE4A 3TCEA 3MW7A 4RE2A 3KVMA 1QNVA 4GIYA 5HULA 3BO9A 1RQEA 5C9XA 4H3DA 2A2IA 2PFHA 3H4GA 3LXBA 3RJYA 1VQTA 5BXSA 3VKAA 4C6DA 4KCWA 4FOUA 3U7VA 4WY0B 1JCXA 3LV5A 3PBYA 5DCBA 4NZJA 4S3BA 2VKZG 4PL2A 1TZ7A 2Z27A 3PANA 1V6UA 4HK7A 3EMCA 2A1YA 1PKNA 3TJLA 5PTDA 3BLFA 3P7YA 5JVLA 2CLHA 1O1HA 4NNAA 3VD4A 1UOZA 1ZQ5A 3LENA 4W5UA 4PMXA 3GVRA 4DN1A 1XSJA 2QF7A 3R5EA 4IGHA 1OGBA 4DM2A 1BAGA 2V69A 1GYLA 1EWDA 1JPKA 3NSMA 5D9OA 1O60A 1J2WA 3U48A 4HYRA 4B3KA 3T0TA 1UWIA 3M7WA 2BY1A 3VC5A 3TK7A 1JEZA 1EX1A 2FGBA 4GD0A 3VUSA 3E3HA 2VOMA 4TR9A 1XLFA 3DHDA 5A5WA 4F79A 1KBLA 1ISZA 2RFGA 1LOLA 4RE0A 2I5IA 3QGAC 4GC3A 4RDYA 2IUZA 1LRQA 2DY3A 3KBMA 3R25A 4H83A 3LPPA 4O1DA 3K1DA 3CQKA 4CQ9A 5I78A 1G4PA 4JD4A 5LXEA 1XS2A 4KWVA 4MAZA 3E6EA 4DAIA 4O17A 2PMQA 1RP9A 4GK8A 3CM4A 4WY0F 4LBRA 4C1KA 4UC5A 5C2XA 2BS9A 4CVWA 3BMXA 1JR1A 1MWOA 4F0RA 3ES8A 1I60A 1PYMA 4DB7A 2GWNA 3BJFA 5IBXC 4Y2WA 3WF1A 1O5KA 3NOEA 1EJRC 2YA1A 3DU0A 4INFA 2E7FA 4RNFA 2VEIA 1OINA 3L66A 4JIRA 1S5TA 4K1GA 4CNNA 3G1SA 4Q32A 4KRTA 3CL8A 3EOEA 2V5LA 3NZ1A 1AW5A 3ATYA 1AW2A 1KRBC 1PIIA 1AMKA 3SGZA 3GSMA 4O1EA 4Q8TA 4NJJA 1X96A 3WUFA 1DWHM 2OR2A 1PE1A 3U0HA 2OODA 4J2MA 4W8AA 3RCYA 4GX8A 5DRCA 3WNKA 5C8BB 1JDFA 4DPQA 3WYZA 1BTCA 1XPYA 4MFDA 5DCDA 3W86A 3VA8A 1MNSA 2G4JA 4BK9A 4FOKA 1H60A 1Q6OA 2GUYA 1E1CA 2VX4A 4MWAD 4REQA 2VGBA 2P0OA 1JG9A 4EVZA 3L12A 2YDAA 4S3JA 1V77A 2VMFA 3OJGA 4FAMA 1ONEA 4RR4A 2QJNA 1E4LA 1Y0EA 2Y61A 6ENLA 1J4EA 4MUZA 1TPEA 2D2JA 1OCQA 3W82A 4GXWA 4GH1A 4H4IA 5IDZA 1OC5A 1XFBA 2G8ZA 1GW9A 3WD3A 1W1ZA 1VAHA 2OELA 2D2OA 1Y5XA 1N8WA 1FWAC 3UF9A 5H8UA 2ALDA 1A50A 1A5LC 1PIFA 4YYFA 4GISA 2P10A 4JL2A 1XL9A 1OHLA 4HK5A 1BLIA 5KZEA 4WSJA 3SZ8A 1MEWA 5FJIA 2XH7A 1CEOA 4ORIA 1Z9AA 1G7UA 4DBSA 2PWGA 3WH5A 4YHGA 5IBXA 2FHCA 1OF6A 1EIBA 1F6YA 5T9BG 2RH9A 1GEHA 1RK5A 4IFOA 4N6FA 1VCGA 3VZZA 4P7QA 1W5OA 2Y0FA 1I2OA 1C91A 2HTMA 2ZUVA 3CTLA 2DIEA 3FX4A 3L4TA 4HKPA 1ISYA 3GW3A 5A95A 1RBAA 2Q71A 4IP5A 3VGGA 3P81A 4AC1X 1GQJA 2EKGA 5TBOA 3C2EA 1UUQA 1WCGA 4H1ZA 2Y62A 1K6AA 4M7SA 2CEQA 3LCWA 1GVYA 1H7OA 3PZNA 4BKNA 2PGFA 2XFWA 1EGVA 3S6TA 1R8LA 4W5ZA 2GJPA 1TX2A 1B0IA 1OADA 5I3DA 5AB3A 1E9IA 3CB8A 3VIGA 3YPIA 4FPSA 3A23A 5KINA 1YHTA 5JQ9A 4XB3A 3PFMA 5D2TA 2GQ9A 5XIAA 2WO5A 3TW9A 5FSEC 4WDXA 2ZX6A 4J27A 1W0MA 4ZTYA 3RX3A 4EK7A 1O5RA 1CLXA 3U8GA 1KRAC 3WQWA 2QCCA 3TQVA 3O06A 2WZEA 1XYAA 2X30A 1RSCA 4GNVA 2Y70A 4S2CA 4PSRA 1CX9A 3AMGA 4QITA 3GH7A 5CSSA 3LX9A 3ZLFA 4YYCA 1XQLA 4JNMA 1F76A 1GEQA 5LIYX 7TAAA 4B3LA 3N2BA 3NDZA 3CT2A 3KRSA 3W7OA 2GSHA 4N4PA 2X09A 2YDSA 4FLOA 2NQJA 4ERGA 3J7HA 2EEXA 1CECA 4N0RA 4UR9A 1JDAA 1OJXA 4ML9A 1DKWA 4M1RA 5J8LA 3G1RA 3M07A 3IK2A 4I5RA 3VD5A 2CKSA 1OX4B 3SAZA 4KWOA 3CU2A 3ANVA 2FH6A 1TTQA 1BVNP 4RV3A 1M04A 1W5NA 3EXRA 1UMLA 1QW9A 4LUYA 3TMLA 3A64A 3TXVA 1W9BM 4FXFA 3A13A 1FVPA 4URIA 1AMYA 5IFTA 3PBVA 1B57A 5LGZA 3S1GA 1PKMA 1JFHA 3H8AA 3HQ1A 2JKPA 3EB4A 2RGMA 3Q67A 2OQHA 1OIFA 1ZFJA 4RL3A 1WDPA 1XCWA 3BANA 3REQA 1UD3A 4GFSA 1DXFA 3JUGA 3ZQ9A 1K7EA 1P1XA 3P8JA 5FF7A 3VFCA 3EX3A 5CPNA 2TAAA 4GLEA 4HT3A 1XG4A 1UUOA 2VFGA 1KRCC 2CWNA 4PMNA 3QLLA 4O12A 1A49A 3BLIA 4B4HA 3DFPA 1BRLB 4Q4MA 1EJSC 2OSWA 2XN1A 3UBPC 1VBRA 5DO8A 2Z00A 5HWNA 2P3EA 3TW7A 4LVFA 2VGFA 3VDHA 4KKXA 1F61A 1XR2A 4GIEA 4I9TA 2QAPA 5H2ZA 3FNDA 4DYJA 1L0PA 2BMBA 1A80A 4LQ1A 1AL7A 5EU9A 4TUFA 3GR7A 4NJIA 2NQ9A 2WHMA 2PDHA 3EKLA 3M46A 1DHPA 2DSWA 4WF7A 4K3ZA 2DSZA 3NO5A 1EJWC 3FS2A 4MAVA 2WVTA 4FF5A 1H7PA 1BVWA 2W3ZA 4BQ2A 3VNMA 5F2GA 3HPAA 4ECLA 4FXJA 3OVRA 3VIPA 4UQAA 4J3WA 4A8NA 3SQMA 3AXMA 1EO7A 4DLMA 1Q13A 4EAYA 3AU6A 2OLHA 3TQKA 2Z26A 1PXGA 5AY7A 3HU7A 1JYVA 4BWLA 3AYTA 3WNMA 3WCZA 1DE5A 2Z0IA 2G37A 4CN4A 4G1NA 4DEFA 2FB2A 3GE7A 3BJTA 2Z2UA 3RM9A 3EWZA 3SGUA 1VRDA 1GQIA 1ZCOA 2VNCA 4JICA 3WLQA 3LEPA 4RDZA 3SQSA 4KQNA 5CAKA 3WF0A 2OQLA 1XUUA 3PZVA 3QOKA 4AQLA 4JTRA 3MMUA 3KTSA 3URNA 1I2NA 1W1YA 7A3HA 5E93A 2NXGA 3S5YA 1I4NA 5K9XA 1Z8AA 3FY1A 2G50A 4X61A 3G18A 1E9LA 4L9XA 4DO6A 3MC5A 3GVWA 1TCMA 1KR0A 2D2HA 3P61A 3OZOA 3CAWA 3CBWA 4HU3A 4DWSB 1XC6A 1KBBA 2Z29A 1F8MA 3W84A 5HPCA 3KBVA 5AHFA 3N