4WDTA

17beta-hsd5 in complex with 2-nitro-5-(phenylsulfonyl)phenol
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdtA00
4DBSA 1Z3NA 3Q65A 4QBXA 3FJNA 3LQGA 4XO7A 2FGBA 4L1XA 3V35A 3S3GA 3LD5A 4WDUA 2PF8A 4F40A 3CV6A 3ONCA 1XJBA 4ASTA 2FZBA 2HDJA 2QXWA 3LZ5A 1X98A 3UZXA 1XGDA 1RY8A 2PDLA 4H8NA 3COTA 2ISFA 4XVEA 3T42A 4JTRA 3NTYA 2C91A 4JQ3A 2WZMA 3C3UA 4OTKA 2PDGA 2WZTA 2IPGA 1Z8AA 2IKHA 2PDUA 3LNMA 5LIYX 1AZ1A 1Q13A 4RPQA 3V0SA 3UYIA 2IQDA 4WDWA 3RX2A 4DZ5A 2BGSA 3FX4A 3BV7A 1X97A 2PFHA 4XK2A 1ZGDA 4QX4A 3MC5A 1MRQA 1A80A 4EXAA 1J96A 3M0IA 2IPJA 3EAUA 4IJCA 2IPFA 2CLPA 4JTQA 4WGHA 2HE8A 4YS1A 1PWMA 1M9HA 3N6QA 1R38A 4GA8A 1OG6A 4AUBA 4PUWA 2ALRA 1K8CA 4JIIX 5JH1A 3LZ3A 4MHBA 3LEPA 4GQ0A 1XF0A 3KRBA 3O0KA 2PD9A 1ADSA 3V36A 1QRQA 3LENA 3ERPA 5C7HA 1Z9AA 3CASA 1PZ1A 5KETA 5LIWX 2FVLA 2DUXA 3CAVA 2FZ9A 3BUVA 1LQAA 4WDTA 1QWKA 4QR6A 4H7CA 2PEVA 1EXBA 4WRHA 3VXGA 4GQGA 1S1PA 2HVOA 3R43A 2FZ8A 4FALA 2IQ0A 1HQTA 3M4HA 3M64A 3P2VA 3UG8A 4XZHA 2PDFA 4ZFCA 3EB4A 5HA7A 2PZNA 4Q3MA 4NKCA 3BCJA 1EF3A 3R94A 1PYFA 2PDBA 3WBWA 1PWLA 1Z89A 3H7RA 2ACUA 5DANA 4L1WA 4PUUA 1LWIA 3DN5A 2PDJA 3EB3A 4XO6A 4PRTA 3CAQA 3UGRA 3RX3A 4WEVX 2PDYA 1UR3M 4IGSA 2F38A 3LBOA 2IKIA 5JH2A 4JQAA 4JQ2A 1US0A 1ZSXA 2R9RA 1VP5A 1GVEA 5HNUA 3H7UA 1RALA 1FRBA 2I17A 3MB9A 1AZ2A 2BGQA 2DV0A 1ZQ5A 1RY0A 1PZ0A 4HMNA 3LQLA 4PR4A 3WBYA 4GIEA 3GHTA 3RX4A 1EL3A 4FZIA 2F2KA 4JTCA 4DBUA 2VDGA 4GABA 2HE5A 1SM9A 3UFYA 4PMJA 3R8HA 4LBRA 4FAMA 2A79A 3U2CA 2AGTA 3CMFA 4XZNX 4R9OA 4YU1A 2R24A 1AH4A 1YE6A 1JEZA 4XZIA 2P5NA 2ACQA 4JTAA 4JQ4A 1AH3A 2PDIA 4XZMX 1T40A 3GHRA 3R6IA 5LIKX 3UZWA 4XZLX 5AZ1A 3UWEA 2FZDA 5LIXX 3R8GA 3D3FA 3WG6A 3G1RA 2HV5A 4GACA 4YVPA 3CV7A 1YE4A 2BP1A 4YVVA 4EXBA 3Q67A 1EKOA 2NVCA 3O3RA 1ZUAX 2PDPA 4JTDA 4LAUA 4GCAA 5HNTA 4LAZA 1YNQA 2HVNA 4LB3A 1HW6A 2ACRA 3F7JA 1S2CA 5M2FX 4WDXA 4XVDA 2IPWA 2INEA 2IS7A 1MZRA 5AZ0A 2INZA 4IJRA 4LBSA 2PD5A 1IEIA 3GUGA 2ACSA 4XAPA 4I5XA 3G5EA 1YNPA 3R58A 3WCZA 4HBKA 3R7MA 2DUZA 4G5DA 2PDHA 3UP8A 2PDWA 1Q5MA 2IKGA 4Q7BA 2I16A 1S1RA 3BURA 2PDMA 3LN3A 1MI3A 4JQ1A 2PDQA 3QKZA 1S2AA 3V0UA 3UZYA 2PDXA 3LUTA 1C9WA 1X96A 2J8TA 4PRRA 4JIHA 2NVDA 5LIUX 2PDKA 2PDCA 3H4GA 1IHIA 3WBXA 4QXIA 4LB4A 2IKJA 1T41A 4DBWA 3GHUA 4JIRA 3N2TA 1VBJA 4ICCX 1AFSA 4YVXA 3GHSA 3V0TA 3ONBA 3UZZA 1AH0A 3B3DA 3DOPA 2PDNA 2HEJA 4FA3A
chains in the Genus database with same CATH superfamily
1I0BA 3PS7A 3CB3A 4EWND 1KM1A 3RJYA 3BLOA 4PBFA 3C3NA 1EGVA 2PCEA 1EO5A 2BHUA 7ODCA 1H09A 4ASTA 3REQB 5MF5A 2O9RA 1SMAA 2FZBA 1SZRA 4LT9A 5D2WA 1TZZA 2EGZA 2Y1HA 1P7TB 2HNEA 3TIMA 3EZ4A 1XGDA 3H21A 2DJXA 3F4DA 4UMAA 4MDOA 5AY7A 4HD5A 3COTA 8TIMA 3BICA 1XIDA 2C79A 2J88A 1J12A 5A6LA 3XINA 1H7OA 3OVQA 3SCPA 1XH0A 1A0EA 4NU7A 4AB4A 1DVJA 1MNZA 3EDJA 4UOJA 4GVHA 3S2NA 3W84A 1Z8AA 4K7YA 2WPGA 1TREA 1KC7A 7XIMA 5I6SA 1F07A 3SADA 1JDEA 3I6RA 3G3DA 1MFVA 3OB8A 1WZAA 1U5VA 4G6CA 5D8WA 2Y63A 4L4PA 4NZ5A 3JVAA 3I3DA 1J96A 1XL9A 4P7OA 3TQKA 3G1AA 1XLHA 2FH6A 1OADA 3DGRA 2Y5SA 3IANA 3GG8A 1FOBA 4KWWA 3NZRA 3W72A 5AVNA 4GA8A 1OG6A 4U3CA 1X8CA 4MUPA 4F9JA 4JIIX 3V75A 4ZQRA 3W29A 4KEUA 1YKWA 2VC6A 1J0ZA 4J28A 3BW2A 3NQEA 2Y7DA 1FCQA 1RPKA 1DJXA 1H1NA 4X9YA 3VGBA 4AZGA 2OOGA 3MTWA 1G0CA 2C13A 1OM0A 2P3ZA 4B2DD 3ABOA 4GD0A 1OCQA 3TOPA 3VOCA 4CLMA 4X2RA 2P88A 3URAA 4A21A 3OGSA 4K39A 3VXGA 5CEWA 3GU1A 2ZUMA 3WFLA 2O7QA 3FJLA 3E12A 3UJ2A 1Y5XA 2H9AA 1KR1A 3VDCA 2FZ8A 5D2TA 1VLWA 1G7VA 1KCXA 4GISA 4NG3A 1Z6KA 4K37A 1L6WA 1YADA 4FF5A 5HQEA 1EEXA 4ERGA 2PC8A 1Q66A 3VDAA 1GG0A 3MQTA 2WO5A 1EF3A 1HJVA 3GZ3A 3WBWA 3H7RA 3CHVA 1VBRA 3NSMA 3WDRA 3GTHA 4XSLA 1GQIA 4GY7A 3WBEA 2YJQA 4ATDA 3MDUA 4HMEA 1AJZA 2V3DA 1QMLA 5AOUA 1V6XA 5I24A 3GH4A 1XDJA 3RLHA 5A95A 1ME7A 4B5XA 2I9UA 4Y2WA 1HKJA 1MW0A 4RDZA 2QJIA 4AD5A 3BGJA 4H3DA 4GIRA 3H7UA 3V16A 1RALA 4A3RA 1TPVA 4FMVA 4H04A 4A6GA 1LQ0A 1TX0A 3EOUA 3PWAA 2B7NA 3PZUA 2GDVA 3IGHX 1MFUA 5KMYA 4JTCA 4D1IA 1W1B1 4C6BA 4P8XA 3HPAA 4Z08A 5A69A 2DVTA 1QHOA 4DLFA 2AKZA 4RV8A 2ZADA 3BAIA 3W6YA 3JU2A 5FF7A 3TC6A 5KSWA 2GUYA 1MXGA 3UJFA 2XH7A 3SEPA 1ITQA 3IUDA 5JBEA 1D3GA 1WAUA 3V5CA 1U1HA 4TMCA 1UD2A 4FNPA 5AYYA 3B0YA 2GL5A 4V2XA 3C2FA 4B91A 3PPGA 2C3ZA 3UT0A 3S4TA 1R85A 3ARPA 3N73A 1F7BA 4Q8NA 5REQB 1AW2A 3HU7A 2DH3A 1XBXA 3O6AA 4JTFA 4YTUA 3CTTA 2V2HA 3N18A 7REQA 5D2VA 2BG5A 5D9NA 2OGYA 2DZTA 3VNDA 4OVXA 1LDCA 3U2EA 3SN0A 3FSUA 3T44A 4EXBA 4HK7A 4C65A 3VUSA 1JCLA 4AWEA 3WJXA 4NP7A 4WUIA 2Z2AA 2ISWA 1W2VA 2Y5EA 3RLVA 4DJEC 2RDUA 4DWSA 4HPGA 1ZBVA 3N4AA 5FD0A 3W73A 1EZ2A 1SFSA 5CC7A 1JCMP 1D3HA 3CZJA 4LB3A 1E9IA 1QVBA 1I2QA 5FA5A 5HINA 3B4UA 3SCNA 1WXJA 1LWJA 4S3BA 2Z1SA 1I1XA 4YWIA 1GT8A 1JDFA 5BMWA 3QSRA 5CPNA 4XVDA 1VYRA 2IPWA 3ZSSA 4NZJA 2BDQA 1JULA 5HOSA 1H63A 3BC9A 1I2PA 2JKEA 2FTWA 4JN7A 2E28A 2Y62A 3AC0A 3C52A 3ANVA 4FLSA 1ZBCA 1MQPA 4UTHA 4NNCA 2BGNE 4UTWA 1WUFA 4IMCA 4XZ9A 4B9YA 4L56A 3PUEA 5LNSA 1P6CA 3R7MA 3N2MA 4OJYA 1A5CA 1LOSA 1RZMA 2XN2A 2OMAA 2R82A 2X05A 1J0JA 1QAPA 3KBWA 4EAMA 4PMOA 4MWAB 3F5JA 1Q4NX 4L4LA 3V0UA 3AS2A 3B8SA 2V2DA 3QV6A 1ITXA 1KFJA 2HRWA 3OBEA 5J5RA 4WJXA 3LXAA 2PDCA 1W3NA 4RNIA 4H9ZA 4QXIA 3OVGA 2DZAA 3KEHA 3CQ0A 1R6WA 3GU2A 4IISA 3QPEA 3V0TA 3UZZA 2CETA 3GM8A 3N12A 4H19A 1KBKA 2XG9A 4WHBA 1XGEA 2OKOA 3WQEA 2WJEA 3WH9A 4RE0A 3STCA 2DUAA 2QCMA 5LHEA 2ZBTA 2P1FA 3VAVA 4K7VA 1FCVA 3CV6A 1Y7VA 5A8GA 1AODA 3PJUA 3WELA 3LMYA 1DPMA 1ICQA 5LNRA 3PPCA 3EMCA 4TV6A 2WSRA 5CH9A 5CPLA 2QPSA 5BW6A 1UOZA 1E43A 4GI8A 1YDOA 3KCLA 1KV8A 1IT8A 1B5TA 1YLVA 3NAVA 4FS9A 3VIIA 3C2YA 4P8UA 3MSYA 3TW6A 1EGMA 2VZSA 2XHYA 1JZ4A 3AYRA 3OZPA 4HB7A 5HMFA 2D20A 2X1UA 3CUXA 3NDYA 4JTHA 2PDUA 2BOGX 3L12A 1L0PA 3M6YA 1J10A 3A9BA 3E0WA 4O4WA 2DH2A 3FCPA 1VKFA 1N55A 4XK2A 4B3LA 4PYSA 1R2TA 3LMZA 1W3KA 2X16A 1GVSA 4O15A 3AMLA 3EAUA 1IWPA 3S1WA 1EP1A 4QSHA 3CUJA 2VI0A 3AMGA 4FHAA 3I7QA 1RXOB 3AUOA 2V5JA 4GQ0A 2QCFA 3POCA 3OVRA 2DP3A 1DWFM 2PGFA 2QIWA 3W1NA 3HGRA 1W5NA 1S2TA 3BOFA 1JFHA 2DZVA 1TE6A 1LQAA 3WH8A 1T8XA 3ABQA 4WRHA 4WSJA 1R3RA 1RBAA 4S39A 1KM0A 3ATYA 2FLIA 3DHFA 4XD5A 3KW3A 4B5WA 3GVWA 3W7LA 4MMWA 3TTSA 5CPQA 2ZZ1A 3IPWA 1XI3A 4ENLA 3LA4A 1XP3A 1FH8A 1Q63A 3CL6A 1HN1A 4HIBA 4FR6A 3VM7A 3KL3A 5GNXA 3EB4A 2XN1A 4YJ5A 1W32A 3B40A 4B90A 3R94A 1QNPA 1CDGA 4UFHA 5LA1A 1R3TA 1PKMA 4MYXA 3SDOA 3SZ8A 5E70A 3U8GA 5ABHA 1DQWA 3BPWA 1QPOA 5AHNA 1J6PA 1YPIA 4W85A 4FNUA 3L5MA 1PXGA 3L67A 3A13A 3KLKA 4IGSA 4ZQMA 5JIWA 2WMFA 2Z29A 3APYA 3EDDA 1ISYA 4C6LA 4DJED 3BMWA 1J0IA 3H8AA 4IQLA 4KH2A 2FFIA 2CCRA 1CXEA 1LL6A 1ZQ5A 3G1VA 4HMNA 3C0QA 1S2UA 3MU7A 3N9RA 4IPIA 5HK4A 3WLSA 2V5DA 3SCTA 3A3WA 3BAWA 4FZIA 1SGJA 4LUSA 4RDYA 1HNYA 4DBUA 3C86A 1MEHA 4E2OA 1NP2A 3N2XA 1OB0A 3NQ2A 4W8AA 3M7WA 5JU6A 4FAMA 2VQUA 3ITOA 3WD2A 3FSTA 3H4XA 2A7PA 3A64A 4WIWA 1JCYA 4K36A 2ZX7A 2CXEA 3H24A 5DXXA 4HHPA 1YE6A 2XVKA 4XZIA 1DWJM 3QQ1A 4FOJA 3IV8A 2Z24A 1E40A 4LCRA 3N29A 3DYPA 4LH8A 3BV4A 1WV2A 1SJCA 2X2YA 4Q32A 3DERA 5KEZA 3I3EA 1H61A 1GJWA 2YYUA 3MBDA 4BCEA 3H2OA 4U5KA 2PU1A 4LV4A 2C16A 3LGDA 5BZAA 4KMQA 3DYMA 4NZFA 4J27A 2WKGA 5C2GA 4F4RA 1GKRA 1R3SA 3N17A 4JFSA 3UY7A 4FNTA 4DF2A 2GQAA 3PZTA 1FCBA 1VH7A 2QJJA 2YA2A 3ZLHA 2YSWA 1QOQA 4XWUA 3DKLA 3O3RA 2G3FA 1GOWA 3IRDA 2DT3A 3MVTA 1Q7MA 3H53A 2GDUA 1JDAA 1R0MA 4J1OA 5F4WA 1UWTA 4PCTA 3F7JA 2FZMA 5D33A 1LYXA 2CZVA 3BQ5A 3PTKA 5E93A 4PB3A 2HPMA 2VEKA 1IEWA 4XB3A 5CGMA 4MF4A 1TR9A 3QBUA 2DFAA 2O9PA 3EBVA 5I5RA 4ZB0A 1FQ0A 4D6EA 4IM4A 4NJJA 3QY6A 4G7EB 1Q45A 2DGAA 5EL1A 1XPGA 4P7QA 4Q6JA 5T91A 2I16A 5XIMA 1CLXA 3IJLA 1OINA 3KDOA 1AA1B 2PDMA 2X0YA 3EWZA 4JS3A 1L8NA 4JCLA 2X09A 1JVNA 1BF2A 2C18A 3APGA 2RH9A 2HISA 3BG5A 3D5HA 1QXLA 1GW1A 2NVDA 5LIUX 2YGYA 2XUCA 3N6JA 1VHNA 2VWSA 4GOAA 2NUYA 2JE8A 2VJXA 3GH5A 4LB4A 4FLOA 3Q37A 2R1LA 4IPLA 1EJVC 2QPXA 1UB3A 1GZGA 4FIRA 1F6KA 2HEJA 1OY0A 2GGEA 3KRZA 1Q6FA 1O4UA 4QBXA 4W4QA 2GSEA 3EMZA 4IP4A 1K9EA 4MKNA 3S3GA 1KBJA 3IUHA 5CZTA 3KTXA 5A6JA 4NNAA 1DJGA 5D02A 4HQVA 1X7FA 2DIKA 2X42A 2CLFA 4Z2KA 4LRTA 3L66A 3AHYA 3W82A 2WZIA 2NLIA 1EJRC 4FXSA 2WWCA 1V0NA 1MQQA 1FY6A 3AQUA 4O57A 1NOFA 2BY0A 4NX5A 4C91A 3P74A 2RDXA 3M5ZA 3QMRA 2Z7KA 1JXJA 3TYCA 2PTDA 5GQBA 3VOIA 3H2CA 1OCBA 4QAWA 3RLGA 3R13A 5D30A 3H7VA 4XZWA 5AHIA 2PGEA 2ZX9A 3G8EA 3F5LA 4DM1A 5HWJA 4FLQA 4DZ5A 4OU1A 3CWOX 3N3TA 4YXGA 4INFA 1H3GA 4AZIA 3AIQA 2C0HA 3ARRA 3MW7A 1V02A 4KCTA 5CSYA 2PBOA 1R9XA 1IZCA 1KQZA 2JKPA 3M5VA 5BCAA 1TPEA 3AU6A 5BYWA 1XSJA 2ZKMX 3AYTA 3GAKA 3NG3A 3TA6A 4WOZA 4BS0A 1Q7QA 1KXVA 5F1UA 4BQ5A 3GFYA 5LKYA 4MWAD 2QAPA 1EHNA 1JZ6A 4GC3A 1XF0A 3O0KA 2PD9A 3W00A 3NEVA 4N42A 1E6QM 3NVDA 2I56A 1U5HA 1Q6OA 4A4AA 2J8GA 3GRIA 4WDTA 3QZEA 2VRQA 4MNMA 3E74A 3ZM8A 7CGTA 4HYVA 5LA2A 5C5YA 4CNNA 4PTXA 1ALDA 4X0NA 2VOTA 4TIMA 1QTWA 1J2WA 2VCAA 3L4YA 1ZY9A 4M7SA 1VFUA 1E71M 1OZQA 4ZVJA 1R86A 4ZXLA 4ZE5A 4QG9A 4XZHA 3GKFA 3LCXA 1XR2A 2Z1KA 3MKKA 2PWDA 5HR7A 1FWWA 1EC8A 2G0WA 3UA3A 2Y89A 4D6IA 4CU8A 3MMTA 4Y9MA 2VEIA 4TTUA 2WCAA 3VKCA 1EJXC 1FX6A 4C60A 1DBTA 1XIHA 4JEQA 3M44A 5CXPA 1ECQA 3L2LA 1CGUA 1V3HA 2IMRA 4LEQA 4PB5A 2HXUA 2OSWA 4EE9A 3OODA 2QVNA 3FDGA 4KS0A 3HGJA 1HP5A 2YL9A 2A0NA 2ZWZA 4TX8A 4WKFA 5HDRA 3LG3A 4WSKA 4JQ2A 1G01A 3SUVA 3UF9A 2TODA 5F4XA 5HNUA 1QCWA 3GWQA 1RP8A 1AD1A 4LOCA 2XISA 2Y4SA 2DV0A 1MEWA 2J7CA 2YW3A 2VKZG 1RY0A 1BVNP 4P61A 4AZBA 3ZFHA 4L4OA 5BOOA 3WH5A 4HOXA 4RPPA 3OEXA 1FWRA 4PMDA 4KGJA 4HTYA 3ALFA 2ODOA 1QNSA 4IMGA 3FVDA 1SQ7A 2V9DA 2E4TA 3EWCA 3BH4A 1JYXA 4J2MA 1UA7A 1GVFA 2VRJA 1M1BA 1B1YA 2HJPA 4JFUA 2C71A 4JPGA 1ZP4A 5G1YA 2R24A 3E2VA 1M3UA 1RLCL 2F6XA 3ARZA 3CM4A 4M6PA 2GVJA 3BW4A 4JQ4A 3HURA 1E0UA 3WD4A 1UWIA 1GPFA 4E8DA 1TUFA 3N13A 3AZSA 2J7FA 4AIEA 3ITTA 5EGRA 1VPQA 3RN6A 2VR2A 4FX8A 1GWJA 4UZUA 1O5RA 4O54A 1S46A 1B0IA 1EO7A 5BRBA 3WMLA 1TCDA 3CV7A 2ATMA 1GYMA 1MQRA 5D8ZA 2YDQA 1Q6GA 1D7KA 3Q67A 3WQ6A 2VX7A 1W1IE 1V6YA 1HL2A 1UPPA 3SCUA 4K2SA 3W7GA 3LYEA 5BRQA 3V18A 4H2HA 4N9EA 3S47A 3DX5A 2J6VA 2EG8A 2P8BA 1VBUA 1R3WA 2XIMA 1PX8A 3N2OA 3V1HA 3MPGA 3TJ4A 4L9XA 3PAOA 4AISA 1FWSA 3WEZA 1UKTA 1G67A 3EWDA 4AWSA 3F03K 2E9BA 3QZ6A 2OQLA 4H6KA 4AHOA 2EJAA 3AZRA 4O17A 4F8XA 4IG2A 3UR2A 1GZ1A 4DXKA 2D0FA 3NCOA 3S42A 4DEFA 3AIEA 4RNHA 3M0ZA 3CL8A 2VUNA 4Y9OA 3A4JA 3R58A 3L21A 3CZLA 3DBPA 4KW2A 5LGZA 3GVQA 3EGJA 1JPDX 3I10A 4RXFA 4ZXOA 4G5DA 2CITA 4R5EA 3QMSA 2IKGA 4A3UA 3UWQA 2WVVA 5E6YA 2JK2A 3FIGA 4XV0A 4CNSA 3QKZA 3TE9A 2UY3A 3KHDA 2J8TA 3LRKA 3BAYA 4JHZA 4IFKB 1H51A 2FTYA 4MTVA 3DECA 1MNSA 4MYAA 3GHSA 1D8WA 3VKDA 1HKIA 1EUNA 3WQGA 3W7NA 4YYCA 3Q65A 4CKQA 3FYOA 1E6XM 4J4KA 3CYJA 4I7WA 1XC4A 3B9OA 3CC1A 3DFQA 4Z1YA 1YIXA 3GH7A 3LERA 3LI0A 4FOKA 5A6AA 4PUDA 4H7VA 1XRVA 2GVYA 3Q58A 3LZ5A 4HNVA 3MP5A 2EPOA 1EWDA 1M7PA 1M41A 4O1DA 3GTIA 4A29A 1GVYA 3QPZA 4E3TA 1K6WA 2NZLA 4GVIA 1WA3A 3E1F1 3OYXA 3SECA 3TX9A 5E0KA 4QS5A 1W1A1 1KRAC 3TP4A 3AHZA 4C1LA 2E3ZA 2QQ6A 3O9NA 3T1GA 4M51A 4PMVA 1GGOA 3HG2A 4HTBA 1W1TA 2A3LA 4OWGA 4I3GA 3VNKA 4DJEA 1KFWA 1PS9A 1UA3A 1XCFA 4HCLA 1JF6A 1IYXA 1JPKA 3AYVA 3BV7A 1PBGA 1HGWA 4C1KA 4WY0B 4J35A 1V3KA 3MA8A 5H8PA 4NRSA 2IXUA 5J04A 5J8LA 5IDIA 2C1HA 3NQ6A 4UCFA 1F4AA 1F9CA 2CLPA 4PBGA 4XKYB 3FDKA 5D4YA 1G7UA 3VOJA 1JD7A 1TRDA 1WZMA 3GVGA 3M07A 3R79A 5KZDA 3LOTA 4UTIA 2YDSA 3TKFA 3B0PA 7TAAA 3HFYA 3OLDA 2Z00A 1NTHA 1OYAA 3TYBA 3IJIA 3W2NA 1SO5A 1BSIA 1QFEA 3V36A 1KFBA 3TCSA 2PAJA 2FVLA 4JNYA 2YBUA 5K7JA 1B57A 2XWEA 3NNTA 1YMYA 1FDYA 3AISA 3HO8A 5D03A 3EWWA 4DIAA 2FKPA 5CGQA 3GG0A 4ZENA 2QCDB 4OUEA 3L4WA 4E4PA 1WUEA 3C2OA 2R1MA 3L4UA 1UUMA 3MUZ1 1K70A 1UWQA 3R43A 1FP8A 3VKKA 3NQGA 3WLMA 1ESWA 1WOAA 1ME9A 3TTQA 1T7LA 3WNLA 4B92A 1TV5A 4R85A 3ZOAA 1O1ZA 3THDA 4ORIA 3L4ZA 2X8RA 2PS2A 3BCDA 2Z1XA 3W22A 5ABFA 3O6CA 1QNOA 2C6QA 4UFIA 3USZA 1W3IA 1KD0A 1B3ZA 2WC7A 3P82A 3Q4DA 4R53A 2W62A 5BU9A 1UR0A 1EDTA 3P5ZA 4TXEA 2FPYA 4H4IA 2VZOA 1O66A 3SGZA 3W53A 1ZL1A 3TYUA 3EDKA 3NO1A 4AF0B 4IIEA 1JCTA 3WH7A 4LS1A 5BOFA 4ROPA 1B3OA 3K4DA 1K8ZA 4YTRA 4Z2GA 3WLKX 1XC6A 1V79A 2HS8A 3LPOA 4M8UA 3SY1A 3KS5A 3CIVA 4JTGA 4CQAA 3VKJA 4Q4KA 2WZEA 2HE5A 3WDPP 3MUAA 4PMQA 2PP0A 1HJWA 1IT7A 2OELA 1KFKA 4ML4A 2X1IA 2AGKA 3QW3A 5TIMA 1PHQA 3LM7A 4D6CA 1HKWA 4CU7A 2QGYA 4M19A 1O95A 3E49A 1LG2A 1XLBA 3G1SA 2JKAA 1AH4A 3APTA 2J9YA 2YDAA 3VYLA 4CCEA 1JEZA 3MYOA 5ABTA 3PZMA 4NXSA 4C7FA 3VI2A 4BF5A 2WQDA 4ZO7A 5CCZA 3GLCA 2X0HA 4XIAA 3IK4A 2PI6A 4JFTA 5H1WA 1K8XA 4GNJA 1SVDA 4JIEA 4AAJA 5C9UA 2O9OA 4B9ZA 5LIXX 1QNQA 1LTDA 3U2OA 4NILA 4XG1A 4L4MA 4UUIA 4DYEA 5IHSA 2CWNA 4TR9A 3W23A 5I2UA 4FX7A 2FPTA 3B8VA 4GFSA 5DMNA 1HXJA 4WJEA 3GXIA 2VGGA 2L5HA 4NVTA 1ZUAX 1H7WA 4RJEA 1KCLA 4ALDA 2WLYA 4DZIA 4DXXA 1H0IA 3AMDA 1Z41A 2R8WA 1L2UA 1HW6A 3ZZ1A 1SR0A 1B30A 5U7SA 2ACRA 3TQVA 2ZE3A 3AAMA 3PPHA 1CX9A 2YB4A 3DBNA 3VILA 4FIQA 1DIEA 3GXMA 2NT1A 1PCWA 2WJFA 4GY0A 1P48A 3NGFA 3U9IA 1GYNA 3MO7A 1WAWA 1LL4A 1EP2A 4MAVA 2ACSA 4RZBA 3B9EA 2Z7GA 7ENLA 1SZGA 1OX4B 2KX9A 4QE4A 6XIAA 1XD0A 4Z1AA 3WNPA 3E2RA 1DXIA 1LRQA 3MSDA 1TPUA 1XLIA 4J5NA 1JUBA 3S5SA 1JPIA 3WYZA 3S9ZA 1IQ8A 2BASA 3SY5A 3PBVA 3EEGA 5TBOA 4RV3A 3NO3A 1AD4A 2Z1BA 4OOZA 3VIHA 4GXMA 4B3ZA 2V5CA 1C92A 4P7NA 1TYGA 4DZHA 2ISDA 3LPGA 1LBLA 5CBJA 3VM5A 1KM4A 3W83A 1QNRA 4GBUA 1LP6A 3AWNA 1EXPA 5CZJA 3B9NA 3W1LA 1F6YA 5G1TA 2QUTA 3VX1A 1X98A 4J3SA 2C1GA 1NIUA 1RY8A 1OT1A 2PDLA 2CZ5A 2V3GA 4Z1DA 2V8ZA 3AMKA 2NSXA 2QNEA 4LUIA 2Z26A 4WX2A 3T0BA 2NSOA 2XH0A 3WNKA 4QG6A 2EEXA 3MHFA 4GGBA 4DO4A 1EUAA 4LS0A 1OK6A 3AIUA 1XGZA 2OO6A 3GE7A 3K4WA 1J2BA 1M53A 1S2VA 3E2QA 1PVNA 2VQTA 2EBNA 4B3KA 3PF3A 1L8PA 3PFMA 4Y96A 5D38A 4GUHA 2CIPA 3MZ2A 1CGTA 2BY3A 3FW6A 4Q4SA 4JX4A 4OIFA 5K9DA 2IPJA 3I68A 3TN3A 3WQWA 4IJCA 3TOYA 3OHIA 2X1SA 1BYBA 4IPPA 1WNOA 3VZXA 2CHNA 4YS1A 3TK7A 3LZ3A 4CD8A 3WMCA 1E6ZA 1C8XA 4JIQA 4O11A 3T78A 1PDYA 5KITA 4IMFA 1P0DA 1V03A 5G4WA 1K6AA 3U57A 4RNJA 4D72A 4JTKA 2VUYA 3NFUA 2DIJA 3L4XA 4J2PA 3K46A 3B9DA 3HA1A 5JBDA 1RQBA 2DZPA 2PEVA 1EXBA 5EMKA 2E9LA 3GR4A 4QGCA 5DN1A 3V5OA 2OODA 4YMZA 2X40A 2VR4A 4N2YA 2TPSA 2JFEX 3EX6A 3AJ7A 2B7QA 3BGAA 3TLQA 4XSMA 1TX2A 3BLIA 2ZE0A 4PULA 4HU3A 5FAGA 4WK9A 3IVTA 5JMUA 1J8VA 1E0TA 4J3UA 4O53A 4HA4A 3TSDA 1R7AA 2QCLA 3B8IA 3GG1A 4LYKA 3PZNA 2G37A 3CUZA 2PDJA 4CNOA 2DW7A 4Q8WA 3BAXA 3CPUA 1FXPA 1OGGA 4ICNA 1GONA 4CVWA 4O19A 3MKCA 2WHMA 3CZKA 3NJ3A 1U30A 4JQAA 3WD0A 4G2DA 5K9CA 1FWNA 1VQTA 3NUKA 4REQB 2PU0A 2FGLA 1K9DA 1V02E 3SFKA 2UY4A 1EWEA 1QBBA 2VR5A 4GIEA 2INFA 5HMEA 3URQA 5DY3A 4RZ6A 2O4QA 4R27A 4BR1A 4QE5A 3SQSA 1NFGA 1SM9A 4MLJA 4LANA 3UFYA 4IXHA 4KGLA 2QMKA 1T6MA 5DCEA 3KOXA 3P5YA 4J3WA 4GJ1A 4MKSA 2B81A 2Y8VA 2HBVA 4R9OA 1GOMA 4YU1A 4CU6A 3BSHA 4ZB2A 3CIWA 3ARTA 3LI1A 2REQA 1D7FA 4QJ3B 1DQXA 2NUWA 1DOSA 1E70M 3QV7A 3W87A 4I9MA 1QATA 3ITCA 2QVHA 1Z44A 3GHRA 1WQ5A 4ICMA 5LIKX 3M7SA 1JAKA 2V5KA 3LCGA 2I1OA 5E0CA 3W7OA 1UKQA 5ABEA 3K13A 4HSHA 3T8QA 1PV8A 1PAMA 1RSCA 4UMCA 1UBSA 3L0NA 3CL7A 3O15A 5E0FA 3PAJA 1ZAJA 2BOEX 4IUOA 3UCDA 3KOZA 4PUEA 3UZJA 3W2JA 3PBYA 1MWOA 4DPQA 1NAL1 3W75A 2BZNA 1TB3A 3N34A 1ITUA 3PBGA 1A5AA 4AIBA 1LZOA 2QCGA 2YCEA 3GR7A 4LAUA 3EOLA 3PNZA 3NIYA 3CQKA 4DLMA 4LAZA 1WYIA 2HVNA 3W2KA 2RDTA 2ZRVA 1DJHA 3ZVHA 3OQ8A 2GJLA 2JGYA 4PUKA 3QFEA 1QPRA 3PBMA 1X39A 3MDWA 1HUVA 1H0GA 2GSJA 3LCFA 3C2EA 1HO4A 3VGEA 1G4SA 3STGA 3W26A 3BGGA 2PGRA 2BWGA 1SSGA 2QUMA 5BXSA 3IIZA 1I0DA 4Q7NA 1W31A 1GEHA 1RBOB 3FLUA 3G5EA 4N4QA 4QDPA 1FH9A 1Z48A 4LVBA 2BHYA 7PTDA 1LJYA 3CPGA 5H8UA 3K8LA 3RPMA 4GKTA 2PMQA 1PCKA 1Q5MA 4Q8VA 3W71A 1W2PA 3G2GA 3UEQA 4KRUA 2ZXQA 2PLJA 3SBFA 1BWLA 1KWGA 4X60A 1JCJA 3IV3A 2OWWA 2ZVRA 4PCNA 3DFNA 3T07A 1IEVA 3QC0A 4HYRA 3HF3A 4JIHA 4KWVA 1LUCB 2IKJA 3N19B 3UG5A 4PTNA 4QAIA 3CB8A 1ZJAA 1Z69A 2FIQA 1DHKA 4LJ3A 5FEPA 3QGKC 4IFOA 3VNMA 3UCQA 3WUGA 2FJUB 4AZHA 1CGWA 4QCEA 3SQMA 3G24A 4Z17A 2POZA 2R94A 2C15A 3MJYA 1J01A 1Z42A 3V3WA 2FGBA 3L4TA 1N7KA 4D6HA 1M5WA 2QIIA 3CBWA 4DO6A 4RE4A 2G50A 3S2CA 3VABA 2WMKA 1FCUA 3TTOA 3M46A 3T2QA 1TFVA 1FP9A 2QXWA 1EX1A 3K1GA 5BMXA 4HP5A 1B54A 3V4BA 4BF9A 1W1VA 3FAXA 4YL2A 3ITLA 4ZSUA 4NAEB 1MXDA 2J78A 1VPXA 4Z0JA 3UWZA 2C91A 2CLLA 1RQEA 4ACZB 2E6DA 4BI5A 3S5YA 2WZTA 4HVXA 1PDZA 1CXHA 3BK0A 1J4EA 2D69A 1BG4A 3EXTA 4OFCA 1TWDA 3LM3A 2V67A 4JYDA 4B5UA 4WDWA 3F2CA 4QS6A 4WVXA 2GJRA 1E6SM 3ABZA 3CH0A 3KL5A 4NHVA 4ZO9A 1FWCC 2XU2A 3DH7A 2Z27A 5FEZA 3ZWSA 4JKLA 4ZQCA 3LDVA 1XISA 1W1YA 2G3IA 4HU0A 3TVAA 1CW2A 3S1VA 3QN3A 2HE8A 4A22A 1P4CA 1VD6A 2XDFA 1K8CA 3EEZA 3QEZA 1QUMA 2DSVA 2CZFA 3TZNA 1QPNA 1OQFA 4D1JA 1YTEA 4CD7A 4H8VA 1UUQA 1GVIA 2PP3A 4IQDA 3K2GA 3OLGA 3S9IA 1FWIC 3KBMA 1X7IA 4MJ2A 4ZSTA 5G2IA 3GB6A 1TWSA 4PE8A 2V68A 1RVKA 4HMCA 3OZOA 1K3UA 1W37A 1FFRA 1FWHC 2TRSA 2IQ0A 1XCXA 5LHFA 3VU2A 5BXPA 5IFPA 3NA8A 1DXEA 2PDFA 4C90A 3WENA 4NZ1A 3PR2A 3GVVA 4CN6A 5IRPA 3UXIA 2VNCA 2DZUA 4L6DA 1BTMA 1HP4A 3BCJA 1ONWA 1UC5A 4LTSA 1ICSA 2DEPA 3KVJA 3MSRA 1EYWA 2ZDRA 4L1WA 1RQHA 4PUUA 3P3BA 4IP7A 5DO8A 1FWBC 4G9PA 3MCNA 3TWAA 2B7PA 2E40A 4H01A 1KWKA 2XGZA 3ZS4A 2CBIA 4DHGA 5MKGB 4MADA 4W7VA 2NQZA 3NWRA 2XFRA 3OG2A 1US0A 2Q8LA 3TQ0A 1TTIA 4A2SA 2XFYA 1MVYA 1R2RA 1FRBA 1IEXA 5I7GA 4FB7A 4DXVA 4M6UA 3KAOA 3TJIA 3ABXA 5A8MA 2YXXA 2AAAA 1WKFA 2QT3A 5EMLA 3EMQA 2OPJA 3CYVA 3FK4A 1WDQA 4IIFA 2F2KA 2RFGA 3WO8A 2PODA 4W8LA 2JEQA 3GNNA 3G6MA 1NOWA 2HK1A 4I7VA 1KGUA 3NQCA 2FFCA 5A6BD 3D6NA 4LBRA 4O13A 1H49A 3CMFA 4TO8A 2CW6A 3SSJA 3CV2A 2C19A 3P8IA 4PL2A 2WLZA 3E5BA 3VCRA 2WW5A 3GBDA 6CGTA 1THFD 2YLAA 3GX9A 5HQMA 5KZ6A 1ZBKA 4TX6A 1YDVA 1ZENA 4ORMA 1G94A 1UPMB 2VEMA 5K4XA 1EH9A 1CZ1A 1OFEA 1G4EA 1GTEA 2YL5A 4F48A 2A3AA 3QGVA 4MZYA 1JZ5A 1JGMA 3M5YA 4BWLA 1CTNA 2P10A 1HVXA 1TPH1 2GVEA 1FUYA 2J6XA 3G1RA 4W9TA 3WF0A 4Q8MA 3LV6A 3RF9A 4OBSA 1A47A 3AHVA 4S3EA 4YVVA 2FHBA 5HUOA 1RCQA 2J79A 2BBFA 2G4FA 1JRCA 3B8TA 5HJLA 1DJNA 3CWNA 2F6UA 3SW6A 1OSEA 1PX3A 3NQAA 2R6OA 1TRIA 1E0XA 1HG3A 3WLPA 2PWUA 3HQNA 3W86A 5T9CE 3RMEA 4UIOA 3EOOA 3EOEA 4O0KA 2QMJA 2WNQA 3GO2A 3UWWA 2GWGA 3RRXA 2CXGA 5D9OA 2OJPA 2JF7A 3P60A 3PNUA 1UR8A 2WJDA 3PTMA 1QW9A 1UWSA 3ECQA 2X7WA 3TYDA 1UG6A 1MZRA 4QJ1A 5A8PA 3R4IA 1OFDA 3VO0A 4IJRA 3WDJA 1VRDA 3L2IA 1ELSA 1AQHA 2YCLB 3F2BA 4G7FA 3AIBA 1XYCA 5E09A 4AFYA 1OF6A 5AFDA 1PIFA 3EX1A 4KF1A 3W27A 1N8WA 4UFKA 4AX6A 3WQPA 1OBAA 2X7VA 1KBLA 4CCCA 2DU2A 2BXVA 3S5OA 3B8WA 2BTMA 3PJTA 4UC5A 3VIKA 2ALDA 2PDQA 5D05A 2GJPA 3GR8A 5FF4A 1S2AA 1YBQA 4POCA 1ADOA 3SRDA 1C9WA 3CZ8A 3S46A 3W74A 5A6SA 3KP0A 3I7RA 3F4WA 6REQA 1C93A 3GNOA 1C91A 1RJPA 2YXOA 2YFNA 3W70A 4C1NA 1VFFA 3ORWA 3GDMA 4BQ3A 1AH0A 3KP1A 4CNUA 2WBGA 1ZJBA 5A8NA 1BSLA 2WNNA 2NX1A 1V3LA 4R7JA 4X3ZA 1SU5A 3STEA 5FJTA 1BKSA 1JZ3A 1JZ7A 3G1DA 3PWGA 3QHMA 4E2BA 3R11A 3T4CA 4JZ5A 2BXYA 3ONCA 1K4GA 4O1EA 3VIJA 1CXLA 3OZMA 2H8ZA 1BGAA 1BRLB 2ZUVA 2E68A 2FHFA 1DJZA 1OWQA 4Q33A 4MNKA 2PA6A 3UA4A 2I7GA 1KM3A 3F2DA 1XS2A 3GDBA 2ZDSA 5H6HA 3W7IA 2D1ZA 2YCKX 5B80A 1VCVA 4Y8FA 1J0YA 1ZJIA 4CNTA 1LT7A 3IGUA 1F8MA 3CT7A 3PM6A 5MHBA 1CIUA 3UNDA 3IS4A 1Y5VA 2H8XA 2WAGA 3BJSA 5LIYX 2P53A 4IQEA 3PZQA 1A5BA 4O0ZA 2C0AA 1QI0A 2J24A 4AW7A 3FX4A 1NWRA 2OQHA 2D73A 2QJMA 1V3JA 1M65A 5HULA 3TTEA 2VFIA 4P8WA 4JIPA 3W7PA 3R0KA 1U1UA 1TTQA 2P76A 2G3MA 3VTRA 1QI3A 1LQ2A 1EC7A 1KXQA 2GJXA 4R7OA 1GKQA 4F0RA 3SFWA 1FTXA 1R38A 3HN3A 4PUWA 1KGWA 2OR2A 2Q3OA 3BW3A 5TAOA 1OT2A 2XVGA 1ADSA 4Z2HA 1PZ1A 3WLIA 5LIWX 5C2XA 3FGCA 3HZ3A 1DYSA 2GGGA 2OCZA 3CAVA 2FZ9A 9XIAA 1BXBA 2XIJA 3SR7A 1YXCA 4UFMA 4M6QA 3VNLA 1HX0A 2G96A 4HA0A 3GDKA 5HMDA 2V69A 5KINA 3DU0A 1P6WA 3POHA 2YCIX 3N6HA 4GIAA 4PN2A 4GQGA 2J62A 3FKKA 5AYBA 5AC7A 1I1WA 2ZVIA 3CHCA 2HVOA 2KAUC 4GUGA 1J9YA 3MSGA 2OU4A 4BQ4A 1EHAA 3P2VA 2WSKA 1JYWA 4I6KA 1EF2A 3ZJ8A 3BG9A 2XVLA 4ZOCA 3HJZA 1E0VA 1ONRA 1R3YA 3ARVA 2TYSA 1U1JA 5HA7A 3FA4A 4PTMA 3LLDA 1AQFA 2WXDM 3I65A 2PDBA 3M6DA 2E8YA 3WQDA 3M0JA 3BAJA 3EYPA 1YQ2A 4N6FA 5JXQA 3ZR6A 4Z2LA 4U10A 1C8VA 1TELA 1IXPA 1XLFA 2IKIA 3J7HA 2NQJA 4HPNA 1PPIA 1SFLA 1E51A 3G18A 1TG7A 4OV4A 4DBEA 3Q2DA 4CNPA 1UWUA 4QLKA 1LM1A 3ISIX 1AW1A 1HL9A 2AL1A 3K8MA 1IE7C 4BHYA 1S5MA 1UD6A 3M0HA 1YPFA 1Q6LA 2DPEA 2XINA 1PL9A 1TJRA 3GDTA 4PR4A 4TQTA 1XIFA 3TR2A 5EKYA 3DXIA 5XINA 3NQMA 1DJQA 2QUUA 3MJMA 1BVWA 4X61A 3WNOA 3W02A 1UZDA 3DFPA 1E73M 3ANUA 1XH1A 2CBVA 5FF0A 1TWZA 4PSRA 4EK7A 3AALA 4PMJA 3AO0A 1O5XA 1XSIA 3FAWA 3DUGA 4AHPA 2ONEA 3HBLA 4ADSA 1S5TA 5CJMA 3IVUA 2EF9A 3E0IA 3LCHA 3FN9A 4KWOA 3GAYA 4O0QA 1JGIA 1PZ3A 2CLEA 4GQRA 2DJLA 2Y85A 5D04C 3LGEA 1TV8A 2ACQA 4IFRA 4GK8A 1U83A 1TA3B 4QLJA 4NZ3A 3W7HA 4QM1A 5C9WA 3TYAA 4Y9PA 1O60A 2NVAA 4NASA 2UV8G 4GO9A 5CGTA 3IUIA 1E1CA 4ZMGA 2PE4A 1Y5WA 4E6MA 1VS1A 1BTCA 2G3NA 2H9AB 1GTHA 1FKXA 2O0TA 4C6KA 9RUBA 3IAPA 2OSXA 2XGBA 1HJUA 2DVUA 2VC5A 3WF1A 4JCMA 4UMBA 2Y8KA 2JEPA 1UHVA 4CQBA 1FDZA 3EDEA 1V8EA 4Q8UA 1EKOA 2PLKA 2Z4GA 1F8IA 2F9RA 1D8CA 5FOOA 1B4KA 1XLLA 1VBGA 4K3ZA 1EDQA 1ODUA 2CU0A 4B5TA 3RRAA 1YNQA 1H11A 4H6EA 4S2CA 3P0XA 3P93A 1ISXA 3ARYA 3PULA 2GK1B 4C6CA 1AMKA 3D46A 4DUOA 3GIYA 4XAYA 1JJKA 1LLOA 2OLAA 1O1HA 3QR1A 2FDMA 4TVDA 1P0KA 1TIWA 4IPJA 3AI0A 3B9AA 3B03A 2INZA 3WD1A 3TZFA 1OX4A 3R2GA 1UIOA 2MNRA 2WMIA 3O63A 3CV1A 4CQ8A 3VOHA 5CSSA 4LC8A 3TSMA 3SIZA 1QHPA 3II1A 3GNDA 3TNOA 3BVJA 4QTGA 1GORA 4YHGA 2VRKA 3M41A 3USBA 3W01A 1MZHA 3ITYA 5FEXA 1R87A 4ZA0A 1OYBA 1XW8A 2VXNA 3UZYA 3DC0A 3SJNA 1JCXA 1Q6CA 3WL1A 3SO7A 5CPTA 1TJ2A 4B5NA 3KFTA 3H4GA 3RXZA 1JZ8A 2E5BA 2WCGA 2WSQA 4M1BA 3SSZA 3EPNA 1AFSA 3TFXA 4JHOA 1OCNA 4NY2A 3VE9A 1VBHA 2Y7FA 5I79A 1UD8A 1IIHA 4R33A 3F4CA 1XFBA 1YPXA 2EJ1A 1NF0A 4LS2A 1BG9A 5I09A 1WX0A 4LUTA 4F0MA 2ZRWA 3FJ4A 4AMCA 2ZUNA 7REQB 4IIHA 1JG9A 1DJYA 3O1NA 4GIYA 2CZDA 2ZRZA 3D3AA 3TN4A 3K5XA 1YXDA 2BS9A 3ME3A 3KLLA 1B3VA 4J40A 5F7UA 4P8VA 4ZCWA 1N8IA 4YHEA 2YZRA 3WQ8A 3VDBA 4ONVA 1I75A 2FMNA 3DYOA 2ISFA 1DE5A 2PSNA 4AEEA 3QRHA 2WKLA 3KRUA 3A47A 4DWSB 3N1AA 4XUYA 1NP0A 1KTCA 1LL7A 2YDRA 4JQ3A 1OFQA 1GUVA 5C9ZA 1AL7A 4DX3A 3A3XA 5HPOA 2HZGA 2IKHA 4KQNA 1TQXA 1POJA 5D32A 1XG4A 4LYPA 3UYIA 4F2UA 2IQDA 3DG6A 3UNTA 5LZLA 1V6VA 1PJ9A 3MMUA 4HN8A 1ZU8A 4JTJA 3ZJKA 1VIWA 2EHHA 1UUOA 4V28A 4JYEA 3B4YA 5BWAA 4PMZA 3UXAA 3MC5A 2CBUA 5C8BB 2YL6A 3GG7A 2F84A 4UR8A 1VJZA 3TW7A 3QOKA 4C5YA 2JBMA 3NM3A 4EACA 3N6QA 2W66A 3WLNA 3T2OA 4PTDA 4MZ1A 4R9XA 3TN5A 3QFWA 2E7FA 4P5UA 3FYPA 4ZR8A 2FPVA 3SURA 1FDJA 1E4NA 1XYLA 3NZGA 1VJIA 1X38A 2JGQA 3NM1A 3T0DA 1DL3A 3DZ1A 4ILSA 3BUVA 1EIXA 3RG6A 1A3XA 2ISSA 3WLJA 1E5NA 1RP9A 2TMDA 3ATZA 1YW1A 3QF0A 4GH1A 4HJWA 4IIDA 2J75A 1LROA 1OYCA 4I90A 8A3HA 3RILA 1UR9A 3WFZA 1EIBA 3OIHA 4E38A 2VWTA 1RCOB 4HPXA 1I9CB 4AC1X 1S1PA 4S3DA 5K2ZA 3ARQA 3IAQA 4PC8A 2WWDA 1KCZA 3UG8A 1OZMA 1VFHA 1P0BA 3WQVA 5FL1A 4GLEA 4Q4QA 2BFGA 1MXSA 3IGSA 1KRCC 4AH7A 1WXYA 1XUZA 3VIMA 4TOQA 1MW2A 3IIPA 4HN4A 2QS8A 1GYLA 1JAEA 1RHCA 1TV4A 3MP4A 1KM6A 4IUGA 4YTQA 5DRIA 4FEZA 3E0LA 3G0SA 3ZIZA 3A4AA 4JKKA 1J93A 1W3TA 5C6MA 1A5KC 3B0XA 3FV9A 1TUXA 5CJ5A 1EJ7L 1LOLA 4GZJA 1KQYA 4JX6A 4PCPA 4NRRA 1DEDA 1XHGA 2W3ZA 3G0UA 5BRPA 2Z0IA 3N9SA 3BSGA 4XX6A 1C7SA 1O7AA 1EOKA 3FXGA 1W9UA 3GXNA 1W3HA 5H8MA 5TF0A 1VAHA 2BODX 1VFTA 4JTLA 4NAFA 1MO0A 1V3MA 2EAWA 1QK0A 2GYIA 4WR3A 1E1FA 2AQVA 2YR1A 1E55A 3CWHA 3R0UA 3UGVA 1US2A 5CG0A 3TCEA 3CQHA 3IRSA 1HJQA 1BXNA 4A05A 4UNKA 1K02A 3S1GA 1EPVA 3VOGA 1R9ZA 2Q6ZA 1ZS2A 4JEJA 1P1XA 4HT3A 1UW9A 1J5TA 3WQFA 3AFBA 3JW7A 3VGGA 3GXPA 1KKOA 1W56A 1EDGA 1OD0A 1KR0A 5K3VA 1H5VA 4S23A 2QJHA 4JNMA 2I5QA 3VKBA 4W89A 3B0UX 3MBFA 1FWAC 1NFPA 4Y8EA 2VFGA 3SQLA 5BU6A 2V6AA 3CU2A 3KBVA 3AXXA 4U3AA 2GVGA 5IBXA 3W7DA 2OKTA 2OG9A 1O6IA 2D2GA 2ON3A 4OV9A 4DWSC 2GQ3A 3NDOA 1S3TC 4AWUA 2XJ7A 3D3FA 3DFTA 4WOQA 1F2JA 2VENA 3GYEA 2WMHA 5AVHA 2VVSA 1N82A 2XVPA 3AROA 2X1RA 2QHAA 1CECA 4JICA 1HFBA 3B8UA 1REQA 1F5ZA 4XAGA 3C61A 1F73A 5AECA 1QPKA 1UBPC 3FA3A 1TJ1A 3PG8A 2E6YA 4LEFA 4NT0A 4G8TA 3M1ZA 1GJUA 3THQA 2H6RA 5DCDA 3M0MA 2HS6A 4NNBA 3F4VA 5HNTA 2B7OA 2QR6A 2F6KA 4IZGA 4JNZA 1H7NA 2ZRXA 1M01A 2G95A 2OOFA 3UXLA 1XH2A 2QUVA 1QI5A 3OYZA 1TQJA 3IWPA 3ARUA 1DJWA 2D2JA 2YA0A 3MMWA 4HU4A 4DYKA 3QC3A 4EPEC 3CO4A 1MUCA 1B90A 2I57A 3WQ5A 2NQLA 1PSCA 1TR1A 1RH9A 4AG0A 1XM3A 4LU0A 5HMSA 1IEIA 4AXNA 2W67A 1BYDA 2J13A 3KBSA 3IJ8A 3PBUA 4OQVA 3SJ3A 3TJLA 3WCZA 5EBUA 4LUSB 1W9BM 1QW7A 2OX1A 1UZ1A 2DUZA 1UZHA 4QEEA 3MCMA 1M04A 1OHLA 5C71A 5A2AA 4NIRA 2ZX5A 1XKJA 1J79A 5HPCA 4ZFMA 2BVWA 2Q01A 2I14A 3TW9A 4JBRA 1TKKA 4RUBA 4LCQA 2PDXA 1W54A 4MUZA 2GUBA 3NQ8A 4PRRA 4N9BA 3RMJA 1VGAA 4QP0A 2EKGA 1ZBWA 5CLTA 3W7CA 4E3VA 5F2GA 4XBKA 2JIEA 4HNTA 1TE1A 3GKAA 2ZUSA 3SCSA 3F1QA 4QLLA 2JALA 1CB7B 2EPHA 4KFPA 3SUTA 1W9VA 4GG9A 1R46A 4DM2A 3CAWA 3DAQA 1GCYA 1RA5A 1E9ZB 3KXQA 3TC3A 4CN1A 1VFLA 3NQDA 1A5LC 2YXGA 1R3QA 2R14A 3N14A 3AMCA 5H2ZA 3HQ1A 2D3NA 1WPCA 3I4EA 3NQBA 1D3CA 2DQXA 3LCIA 3A9IA 1KM5A 3OBKA 4W8BA 4S38A 1NDYA 4ZEPA 3RPDA 3GS6A 1DP0A 3W6LA 5G5IA 4JX5A 4C6DA 3E02A 1XIBA 1ZNNA 3R25A 3H70A 5EMYA 2DIEA 3GNPA 1RK6A 4WLCA 1FWFC 2W0UA 1SZNA 3W7EA 3UERA 4PMXA 4A3QA 3AIWA 4ZQNA 3HQPA 4AD0A 1AZ1A 1Q13A 3IJ6A 4RPQA 5I02A 3H2NA 3UBPC 4S1FA 6ENLA 2WHLA 3QOMA 2OSYA 3GW0A 4F0LA 3KTCA 1OIFA 5EU9A 4UFJA 4OGZA 2BB0A 4Q7IA 4MWAC 2PLCA 2CWXA 1JDDA 3KBNA 1A80A 3VVGA 3NPVA 3FVMA 1E6PA 3FFSA 2FB2A 4AUBA 2ALRA 1WXZA 3WF3A 5JH1A 1HTIA 4DVOA 4ZBCA 1KCKA 4RL3A 3ES7A 2B0MA 4IMEA 4K1GA 3MT1A 3QLLA 1JYVA 3AS0A 3CASA 4I5UA 3AXIA 4QG8A 4H8HA 3THAA 1ZJHA 3QVQA 3T0TA 2W5FA 4NJHA 5L6UA 1QWKA 4JFVA 5I3GA 4Y90A 2RDWA 2HMCA 2VVNA 4GC4A 4IX2A 1NWTA 4L64A 4X63A 4J7RA 1HO1A 3HM7A 1XBYA 2CKSA 2XTKA 3RIKA 3DI0A 1F76A 1TV7A 4LWWA 4EANA 1KFCA 3IEBA 3U3HA 4LGXA 2OO0A 4HA3A 2VFFA 1WOBA 4PA8A 3L9CA 3C6CA 4KIRA 4I8DA 3VNZA 4DQWA 4Q3MA 4LY8A 3LTPA 2OT0A 2V82A 3R12A 2KZHA 4DWSD 1NH6A 5DANA 2FTPA 1GOQA 3DN5A 5AC6A 3DGBA 3ID7A 1UJQA 3UGRA 4E0CA 5A94A 5RUBA 4DB7A 4N9DA 2QCEA 4RW3A 2IXVA 2DORA 4HZ6A 5CQ1A 4JTEA 1K03A 5EY5A 4O28A 3BLPX 3BQ6A 3VUPA 1MW3A 3PN8A 3EA1A 3C4UA 5FJRA 2GSHA 2YKKA 1KTNA 2CLKA 3IK2A 1PZ0A 3WLOA 4F0SA 5AC5A 3QV8A 3QTPA 1XLJA 2AKMA 2E09A 3RK8A 5DY2A 3TMLA 1DWIM 1RLDA 1CXFA 2PWFA 4DUVA 3UQNA 3DI1A 4XTDA 4BEUA 1GKPA 3LK6A 1UQYA 4GZIA 1G5AA 4O1AA 3ICJA 1KO0A 3OGRA 3EX2A 2V5LA 3BLDA 4HHHA 3MO4A 3U2ZA 4TMBA 2WC4A 1UP0A 4L1GA 4KCWA 4MNJA 4A8LA 5DT5A 4IQJA 3WEMA 4QIUA 1BQCA 3GW3A 4B2DA 2QAFA 1UD5A 4DAIA 4D2JA 5LA0A 1W3LA 4UCGA 2NQHA 1IIGA 3T0AA 2ZC1A 3OBAA 1RR2A 4FNQA 2HROA 3ZLFA 4GY1A 1OJXA 4HA1A 2PWGA 1IGWA 3NPUA 3M0KA 3L0KA 4P2VA 4CD5A 4MFDA 3PB0A 3C0LA 4QJ5B 4AD3A 3RDKA 3CT2A 2X2GA 3UJEA 1R2SA 1W5OA 1XQKA 5GPRA 3GIPA 3BO9A 4JDYA 1UR2A 2XIBA 4V15A 1TTJA 4PRWA 4UTTC 4B5SA 5FSEC 4HZ7A 2DDXA 3U5YA 2OZ0A 5HXMA 1OX6A 1I45A 4N7QA 5A2CA 2GGIA 3JR2A 4IX0A 3S1XA 1X6UA 3C0JA 5HWMA 4US5D 5CZSA 4PUJA 4D6GA 3UCCA 4KRTA 2BHZA 4MB3A 2BY1A 4OBRA 5M2FX 2ZUTA 3E5PA 1TWIA 3RNDA 2FJKA 1EB3A 2HVMA 2Z6IA 1V0KA 4GE8A 5T8GA 3B97A 3A5FA 3L5LA 3QW4B 4XKMA 5AHFA 1GK8A 3VD9A 2P0IA 2PD5A 3VIFA 4LV9A 4OUIA 3NO5A 4UFLA 1GOOA 2WOQA 4HGXA 3A5VA 2OTDA 2GJNA 1VEMA 1K77A 1YNPA 3N11A 2J74A 4CN4A 2D22A 1VFSA 5XIAA 4L65A 5JIPA 4K1WA 2WVSA 1SR9A 3UP8A 3NL2A 4MJ4A 3BOXA 1DIKA 1Q3NA 7TIMA 1JNEA 3GNRA 4QDWA 4E5TA 1ISWA 3W76A 2V3EA 1P5BA 4J3TA 2FMOA 4MY8A 2GWNA 3EWBX 3NZQA 4AD2A 1MSSA 2WYSA 3PZIA 5E9AA 4H9XA 4Z42C 4GRSA 1XLKA 2HPIA 4KEVA 1CEOA 4Y9AA 4AVFA 3HV8A 2R1KA 4FA3A 1C90A 1HZYA 2VP8A 1VFMA 3MY9A 1H7RA 4AY8A 1S5VA 4ZE4A 3DG7A 3G6LA 4TVCA 4QNWA 3WK0A 3LXBA 3OGVA 4F40A 4PMUA 4TUFA 4DI9A 1GOKA 3KE0A 4E4FA 2QEZA 3KOWA 4GUIA 1H4PA 5EFFA 3WK3A 3XIMA 2CKRA 3W7KA 3P80A 1TV2A 4PEEA 5I00A 1EZWA 1FWDC 4K38A 3U7VA 5I77A 4JTUA 3EKZA 4GFIA 2C7FA 4GVGA 2ZA3A 5B7YA 4PH6A 3IIXA 3R1ZA 3E2SA 1KM2A 3G1FA 3PY2A 1V0LA 2PRMA 1YDYA 3T2PA 5G2HA 2XZ7A 2Y2WA 3RX2A 1Q85A 1W5QA 4DNMA 3B0VC 1X97A 1IEQA 3M47A 2D23A 5KZEA 3W1XA 2CBJA 4QX4A 1HL8A 4IG2B 4D8ZA 3UYCA 4EXAA 5C0QA 2OLSA 2ZRYA 4LCSA 3ENLA 4BQ2A 1AG1O 3EKLA 3LHYA 1Q6EA 3NYZA 4AMAA 4WXZA 2CLHA 2WVVB 1F74A 3FEQA 3A24A 3ERPA 1R9YA 1CGVA 3QPYA 4JOMA 1JI2A 2VZUA 3I6EA 2FDSA 4B15A 1BWKA 4LVFA 1KXHA 4NI3A 3WF4A 1I8JA 4UWMA 4IPNB 3TXZA 2PUZA 1R8LA 3L0GA 2EPLX 3URNA 4AEOA 1L6FA 2Q02A 2A3HA 2V30A 2XH2A 1DKWA 1HQTA 1ZALA 1GZJA 2GLKA 1K9TA 4JN6A 3LHTA 2EG6A 1RV8A 1W8GA 4EAYA 2XIQA 1KGXA 3QKEA 4AZCA 3PWIA 4A2RA 1CLKA 1PWLA 2PC4A 1ZB5A 1GHSA 3NR0A 3HPSA 3GU9A 1VEOA 3L4VA 3RR1A 1KRBC 1TPC1 5DQPA 3IARA 3CAQA 4PTWA 2V63A 1FWTA 3SM0A 1CBGA 4M81A 1UH4A 5D9PA 1UR3M 1E72M 3W38A 3LTSA 5AC4A 1ADDA 4K68A 5JH2A 1V77A 5FSDC 2R9RA 5FESA 3P14A 2A6NA 1ZRQA 3BL3A 3U7BA 4F2BA 3TUUA 1P0EA 1XLAA 2J47A 3OW1A 5IOBA 1DV7A 3PTDA 1OFBA 4Q6XA 3LLFA 2A7NA 4BKNA 4TX9A 1POKA 2HWGA 4GI9A 2QV5A 3BZGA 3OA3A 3DFHA 4FNSA 4EF9A 2P50A 3U2CA 3RFAA 2AGTA 2NWRA 3HIJA 3DEQA 2C14A 4CD6A 1GQJA 4D8LA 1ZTVA 2VX6A 2PURA 3A21A 1TA3A 2YYTA 1TPFA 3ZT6A 4OECA 2F61A 4MJMA 4BK9A 4XUGA 3ARWA 4I6VA 3DHUA 3GXTA 3GTXA 3Q94A 2QV4A 2G3JA 3H2FA 4FXFA 1OX5A 4I8YA 4KWSA 1EJUC 1SYTA 1A0CA 3HG5A 3F4NA 1PIIA 4OE7A 1FHLA 4MNLA 5JBFA 3MUIA 4QJ4B 3PUDA 3REQA 3S2JA 2NUXA 2W4XA 1P7TA 4NF7A 3M5XA 3N3MA 1JIBA 4CVUA 1PX4A 3IGXA 4UOZA 4HKPA 4UQAA 3WNNA 4W7WA 2PP1A 1ECEA 1F3TA 3QGAC 5ABFB 1GEQA 2O4MA 1EQCA 2GK1A 2J7GA 3G8RA 1B3WA 2O55A 3JUGA 4MGGA 2Z1VA 2V3FA 2A6LA 1EQPA 1FKWA 1NSJA 4W7UA 2WMGA 1UZ4A 2BVTA 4LAKA 4RCXA 1LF1A 3BAKA 1FA2A 4MAZA 5LXEA 1X6LA 5LNUA 4OOUA 1DTNA 1MEIA 4XQ6A 1NFBA 5CBIA 1WE5A 4GYPC 3KCJA 1XRTA 4UQEA 4RNFA 4IL0A 1IR1A 1FFQA 5GNYA 4UTUA 2WBKA 3KOYA 4XBSA 3CMGA 3PP7A 3P8JA 4Z2IA 4RR4A 4IICA 4W84A 1MDLA 4LAMA 4F9DA 1DWGM 5A6TC 1J18A 4PEKA 3K4AA 3ZR5A 3R5EA 3LUTA 4CEUC 1VZWA 4RKAA 1P6BA 5FJJA 2J7HA 4PBEA 4LYQA 1MMFA 2D24A 2PDKA 1T41A 3N2TA 1VBJA 2DT0A 2HSAA 2AQOA 3UJSA 4Q4MA 3UG4A 4NJKA 2Y8UA 5HJYA 5CZ0A 5DELA 2PCQA 3IIVA 1V5XA 2QF7A 3NSXA 1BEUA 2ZZ7A 3CTLA 4LSBA 2BSLA 1A49A 4H1ZA 2O92A 4M5PA 2POTA 2ZTKA 1MUMA 1GJPA 4LFYA 3WF2A 1YTDA 1UWRA 1QNVA 1UR1A 1UASA 5AYXA 3L5AA 1Q4WA 5GJNA 3W7MA 4XVEA 3MI3A 1R47A 3AXKA 2FH8A 3UVIA 4H41A 4JTRA 1DWHM 4TU1A 2E0PA 1EBGA 3UZ5A 3W1QA 3C3UA 4OTKA 2PDGA 1TZ7A 3OOQA 4HNUA 1TV3A 3CQIA 2NXGA 1JXKA 4W93A 1J6OA 2Q71A 2DSWA 4RE2A 3UPBA 1VC4A 2I5GA 4XBJA 4IHCA 4D6DA 4GZ7A 2QF8A 4DY1A 4GO8A 2PFHA 6PTDA 4U31A 3G1HA 1YNYA 4NUWA 4IMDA 2AQWA 4HCHA 4QQ3A 3M0IA 3G1YA 3B8DA 3DHPA 3OG3A 3HG4A 4YIWA 3NZPA 3O05A 2ZZ5A 3KM8A 3LBMA 4CCDA 1PWMA 3OA5A 1XFCA 1EX5A 5K4ZA 2V38A 3WQOA 2OB3A 3SAZA 2C8NA 3LEPA 5T26A 3LCWA 1SZFA 4LPCA 5GJMA 1LORA 4H00A 4MDPA 3ABRA 1XUUA 3B04A 4UR9A 1TTPA 3O07A 1B3YA 3BARA 4UR7A 1QO5A 4MG4A 3BCFA 2VCBA 3LHUA 2VGFA 5HJXA 3QYQA 4AYSA 5IM51 1C29A 5KTLA 2WANA 2HNHA 3VGHA 3TDFA 3EWXA 3T9PA 1XRFA 5REQA 1AW5A 3SRHA 1OC5A 3VDGA 2YOCA 3FKRA 3LU2A 3N04A 2CFFA 3CGTA 4FALA 3WDIA 2H3DA 7A3HA 1QW8A 3TTYA 3CHFA 4GINA 4IJBA 2ZX6A 2ZZ6A 5E9XA 5FF3A 3PJWA 1E6RA 4S3FA 1H5YA 1MDRA 1SO4A 4YTTA 3DC8A 3URBA 2A5HA 4GKLA 3UESA 3JRKA 2ACUA 1GVOA 1SUXA 5TNVA 1LWIA 5AB3A 1XYFA 5ABGA 4AY1A 4LVAA 3CUGA 1E1EA 4ECLA 3VGFA 4US5A 3OIXA 1ZPTA 3RX3A 2Y0FA 1QI4A 2A7RA 1UJPA 3JZUA 4HCDA 2PTZA 5I06A 4NX0A 1B3XA 3DHDA 4R7WA 1UOKA 4F79A 4I9AA 2LLEA 3OP2A 1WBJA 4GPNA 3O2LA 3DFSA 2GQ8A 2A2IA 5CLWA 4HHMA 5F4SA 3T05A 3O6DA 1O94A 2QCNA 4PZVA 4PB4A 3WBYA 1E4LA 3RM9A 3GHTA 4YNGA 3RX4A 3FJ6A 4CQDA 4Q4PA 3P81A 4ATLA 5BXRA 3H23A 1SSDA 2VDGA 1FXQA 1WZLA 2O7SA 2GQ9A 5G1MA 1H7XA 3QJAA 2DT2A 1JQXA 4PCFA 1WDWA 3SI9A 1J5SA 1P1MA 4WD0A 4KFOA 3EDFA 4MWAA 3SIMA 2YL8A 2VD9A 1YDNA 4M6VA 4TV5A 2V0TA 5J5DA 3TU9A 3MV11 1HT6A 3DCPA 2CERA 1NDZA 1XIEA 4S2BA 1BFNA 4RDWA 1UH2A 2BMBA 4NQ1A 3S6TA 1V6TA 1AH3A 3P61A 3H54A 2PB1A 2ABBA 3T40A 1EOMA 1NWUA 4Y7EA 3NQ7A 3K1DA 5GJPA 1Q6DA 3N15A 4JTTA 2WHJA 3CIXA 3AWOA 4BEQA 2V81A 8RUCA 3NL6A 5DEZA 4HYWA 1XWYA 4HK6A 3FNDA 1S38A 4C6NA 3OHMB 4S3CA 1BWVA 1OGBA 2FB3A 1SO3A 1RJQA 4ERAA 1U5JA 3VOFA 4BY3A 4AWTA 4V33A 3MMDA 3KS6A 3VNIA 4U2ZA 5C9XA 3D0CA 4BI6A 5IXEA 3RU6A 1CENA 1XIIA 2Y70A 2PDPA 4NYYA 4ZO8A 2DZSA 4JTSA 1MRAA 3LSBA 4YPJA 1A53A 1JR1A 5CC5A 1C8YA 5C2CA 4RLIA 1XIGA 3HPZA 3VMPA 1VCGA 1EBHA 1B9ZA 2Q8XA 5JVLA 4H9MA 1N2VA 1KA9F 3WL0A 4AU0A 4RXGA 1YTKA 3KHJA 4WDXA 4HNCA 1K7EA 3I6TA 4WCJA 3CQJA 2CLOA 4Q22A 1GHRA 1UIPA 4EKJA 2Q09A 4XAPA 1XINA 1W9DM 2UBPC 3LRLA 3QTGA 5IDZA 1EFZA 2ZUWA 3H26A 3P6LA 4CQCA 4W86A 4H9YA 1DXFA 4MVAA 1XCWA 1Q6QA 2VT0A 1WBHA 3OTRA 1E9LA 1NEYA 1AUSL 2QCHA 4DUWA 1PHWA 1VIZA 1V4YA 3NXLA 4Z1BA 1PTGA 3T8LA 1XBZA 3P67A 3P62A 3UG3A 4I7UA 1IHIA 3BLKA 1RJRA 2REQB 1JNDA 1A50A 1Q6RA 5G4HC 1NARA 4LUJA 1V08A 2O56A 4XIMA 3TONA 4P7LA 5EMUA 4EPKA 2E25A 4CUCA 3S83A 4AQLA 2XM1A 1R30A 2DY3A 3LQGA 1B31A 4U28A 3RJXA 5CPOA 3NPWA 4L1XA 4JY9A 4O8AA 3THUA 3WJSA 4MB1A 4MPQA 5M1TA 3V5FA 4ES4A 2G8ZA 1CYGA 3KRSA 3V7PA 4K8HA 1E6NA 3GNXA 3I4KA 3VIPA 2ZXAA 1HJSA 1VPYA 3T6CA 4H8NA 4HPHA 3WD3A 3UJRA 5HBFA 3SCWA 4KWUA 3HMJG 3NTYA 2ZA2A 2BOFX 1BXCA 1ENUA 1RVGA 3VFCA 3GZAA 3L23A 3LX9A 1TWWA 2ZX8A 3UPWA 3ZVHB 1YYAA 4IXXA 2GGHA 4UTTA 4UQCA 4YCOA 2UY5A 4EX4A 3GD6A 3V0SA 1VHCA 1D2KA 2V2CA 4S3JA 8XIMA 1SW7A 3EXSA 4FP1A 1BYCA 1X1ZA 1AQMA 3AU2A 3L2MA 2XIIA 1K1DA 3WBAA 3AS3A 4X22A 1IWBA 5BOEA 1HIZA 1CGYA 1QI2A 3NURA 3R10A 4R88A 4Q8TA 1H50A 3CZEA 5I07A 2H3BA 4DJDC 1C3FA 1WB0A 2ZICA 2Y61A 1SJAA 3P7YA 3GVRA 6ALDA 3H6OA 1NVMA 4R3UA 4AIOA 5LGXA 2XGIA 1M7OA 3JS3A 3KRBA 4A8IA 1L9WA 1UR4A 3PG9A 3H55A 1ICPA 2DUXA 3NQFA 1DJIA 4ZL1A 2WNWA 3MP3A 2D3LA 2QJGA 3UWYA 2IW0A 1JDCA 2AOSA 3VMOA 3VMNA 1TJ0A 2VEGA 2A4AA 5CG7A 1PO9A 3IJQA 3E9AA 2WQPA 4FX6M 2YIHA 3OLEA 1LLWA 3ZMRA 4GBDA 3HGOA 1TMQA 4NI8A 2YA1A 2QUNA 3VNJA 1PTAA 1VR6A 3W9ZA 2OWCA 5FJIA 1XLDA 3MV01 4NKCA 4JHMA 3RCYA 3BMXA 3L65A 1QPQA 1PYFA 4F0HA 1A0DA 1Z89A 4PCSA 3E0VA 2YB1A 3B06A 3TSBA 4W5ZA 5DRCA 3EB3A 4YYFA 4KESA 1IZKA 4L9ZA 1ZP3A 4JKMA 3WJYA 3LLXA 2ZZ3A 4S3AA 1GOXA 2F38A 3LBOA 2OEJA 3AS1A 3TAOA 5AYZA 3WJWA 4GZEA 4RZ4A 1WP6A 2VOMA 2WHKA 1PYMA 3BANA 1GVEA 3KCOA 3VZZA 3NSNA 1V7AA 3UR8A 2DSZA 2YLLA 1US3A 2J27A 5DMLA 1ZHAA 2MUCA 3WZ0E 1T99A 2OWXA 3LQLA 3W7RA 3RU8X 1EA0A 3BLFA 3CO8A 1UKOA 4GUFA 2NXHA 4GWEA 1EL3A 4KEMA 1L2QA 3QHNA 4U33A 3C2RA 5I3JA 3D47A 4G7EA 4FK9A 2EQDA 4GH3A 1JL8A 4RK8A 1SFTA 3VD3A 4KEZA 2NQ9A 2F8QA 1OF8A 3R8HA 1TPWA 2NT0A 1CB2A 3WLTA 1L6GA 4M29A 3GFXA 3IJ9A 3AUJA 3AIVA 3P84A 4Z2JA 4UBPC 3UR7A 3OQEA 3M0VA 2NV2A 3KX6A 4JTAA 2TAAA 1IWAA 3ARXA 3GQYA 1H2JA 2VMFA 3DESA 2DVXA 1PIGA 3DKJA 3QY7A 4GQQA 2WM1A 2NQ5A 1BHGA 4AZ6A 1BF6A 1F61A 3K8KA 3ZO9A 3R8GA 2VCCA 2WSYA 3PSWA 5K9XA 1QOXA 2OX4A 4FNRA 3LGGA 1EJSC 2BP1A 4DELA 4GNKB 2J4GA 1W6TA 3M0LA 3WMBA 1S5WA 3QM3A 2QDDA 4K6AA 2VM8A 4F66A 1V93A 3S0CA 3W1PA 2BY2A 3CHDA 3PZOA 4JTDA 4N9CA 1NY1A 4LRSA 4DUXA 3CJPA 2D2OA 2OEKA 4IOTA 2OYKA 5TD4A 1QK2A 3MZNA 2J25A 4ZODA 4OT7A 4L61A 3LSCA 1S2CA 1JF5A 3RITA 4S3KA 2Z25A 3LHWA 1I6NA 1LT8A 5AZ0A 1DIDA 3HG3A 4AIUA 3CZGA 1CLVA 4DPPA 4CD4A 2VURA 3SGUA 1SZEA 3M43A 4PUNA 2WCSA 4AY7A 3W2LA 2VO5A 5CAHA 6XIMA 3AXHA 2PBGA 3G77A 2QPUA 5JUVA 5F2IA 4ZGYA 4J3ZA 2UY2A 4FR1A 3ITGA 4Q7BA 2GUUA 4N6EA 3KVKA 1MI3A 5C7VA 3TH6A 1WCGA 3WUEA 4O12A 2HK0A 4F2TA 4AEFA 4DJDD 3WKZA 3LB0A 2WB5A 3KL0A 3CH9A 1H62A 4C6QA 3T55A 3YPIA 2P0OA 3UU0A 3VIOA 3VPLA 3DOPA 1M7JA 2QDHA 1Q65A 4Q4OA 4US6A 4M0XA 1VCFA 1LBFA 5GVJA 1G69A 4NZ4A 4MJZA 4N4PA 1TVLA 5B7ZA 3V35A 4WDUA 1QWGA 4OKDA 4ZQPA 3U0HA 1C8QA 1ZAIA 2XM2A 1AMYA 3ZWTA 1RAKA 4DAFA 4B5VA 1OC7A 2ZTJA 2ATSA 3UD6A 1WO2A 3N2BA 2VFHA 3MI6A 1BQGA 3LHZA 3O8AA 4I9TA 4LAOA 3U4FA 2GOKA 1V0MA 2GZXA 3H2EA 4PODA 3EPOA 2QZRA 1KBIA 4J3VA 2WSPA 3TQPA 3H2MA 4BJHA 2HTMA 3HTWA 3T42A 3NZ1A 2ZXDA 1J11A 2A1YA 5IHRA 2VTFA 3G3MA 1M68A 1Y65A 1NQ6A 3LNMA 3B05A 1V6WA 4S3GA 1QOPA 2ZRUA 1CPUA 2BGSA 2CYGA 4O1FA 1ZCCA 2B4GA 2BX7A 1IZJA 4M24A 3AHTA 5I03A 1OG0A 1XDMA 3RM8A 5JQ9A 3KWXA 3WH6A 5I23A 1OFOA 2QJNA 2RJGA 1SMDA 4PUMA 4JTQA 4XD4A 3F5KA 1S3HA 2GGJA 2VFEA 2VYOA 2RHGA 3MHGA 1G9HA 2PTYA 5DFAA 1A3HA 2I9EA 4I9JA 2J9XA 3BE7A 4JY8A 4GYPA 4D8AA 1YBQB 4G1NA 1QRQA 3LENA 3ABSA 4QRNA 4EP8C 1GQNA 1MW1A 2DT1A 1QR7A 1OFRA 2Y88A 6REQB 1QASA 1FWGC 1G4TA 3M0XA 4C1NB 3FS2A 1HKKA 5CC3A 4AVOA 2R91A 4RX0A 2EPNA 1UYQA 4HHLA 2A3BA 1JUEA 1LCOA 8CGTA 4JYFA 1UMLA 3UWUA 4GYFA 5DCBA 3RO8A 1VLIA 1UROA 1WZKA 2UZ9A 3SCVA 3WSUA 5AHMA 2A21A 4DWDA 2W92A 2PZNA 2AL2B 2J7EA 2NX9A 2G97A 3AXMA 3QQ0A 2OGJA 3DFYA 2J77A 4PFMA 4KRZA 4JD4A 1VFOA 4GMEA 1BAGA 4HOWA 3NL5A 2JQXA 1UQZA 2ZFAA 1H7PA 4H7ZA 4M56A 4Y6GA 3S6OA 3RAOA 4KIEA 4WEVX 1GVQA 2Z28A 3N9KA 2D0HA 3RO6A 4JL1A 3C56A 1RD6A 3MHUA 1LRNA 1DE6A 1P0NA 1AJ0A 1CWYA 4DYJA 5CC6A 1ZSXA 2VELA 1KFLA 5C70A 3GDLA 2WVUA 4QISA 4NSBA 5AC8A 3E0FA 4AD1A 3NOYA 3T4WA 5EA9A 1WDDA 1AZ2A 3GTNA 3A22A 3QXBA 2G4JA 4HNLA 4DJFC 4F0KA 2VEPA 1U22A 4PMNA 2Y24A 3PUGA 4YN5A 3LPFA 3M0YA 5DLCA 2GJXB 4R34A 3QY8A 2PWHA 4EF8A 3LY0A 1LBMA 2EO7A 3VC5A 4DBDA 3VIGA 1OFPA 1VRXA 1WDRA 4C6IA 5AN7A 3PZ9A 3O06A 4BWLC 2RUSA 3WLRA 2VGBA 4DRSA 3DIPA 4IFKA 2P5NA 1U33A 3FGCB 1PKNA 4WXYA 2J9ZA 3H12A 1LWHA 5M3WA 1G6CA 4XZMX 2EPMX 2ICSA 1SO6A 2W63A 4Z1CA 4WQ6A 3U6WA 1T40A 2NWSA 1XQLA 2NX3A 3STPA 3R6IA 4F3HA 4XZLX 3AHXA 1CCWB 4J9JA 3UVAA 2FZDA 2YW4A 1TMLA 2EXOA 2E9MA 4Q4RA 5T9BG 3A4XA 3UXDA 4YCPA 3CAKA 4QQUA 3WY1A 3LCLA 1W17A 1KKRA 3XISA 3QLDA 4N0RA 5EMJA 1TSIA 4AD4A 3SRFA 2P3EA 2EPKX 4Q8PA 3KZPA 2WM0A 2BV9A 2XYLA 4H9UA 3NXFA 1RK5A 5D37A 2NV1A 1KW1A 4D71A 4LX4A 4LVGA 4GCAA 3W7QA 3HFTA 3U4AA 5G2WA 5DMMA 4QEHA 3EKGA 1NELA 1KBBA 3DFOA 1XXXA 2XWDA 2CC0A 4U2YA 1RCXB 2PRLA 4FOUA 4ZOEA 3WMSA 1I2RA 1IV8A 2OYLA 4IGMA 2VDIA 4H83A 3AOFA 2INEA 4HJFA 3H22A 1UCWA 5FEWA 2YBVA 5F2MA 4WY0A 3W6MA 1TMHA 4LW7A 1X1NA 3EWYA 3VFLA 2X41A 2ZOXA 2OZ8A 3ANYA 3LHVA 2AMXA 3WN6A 4HNNA 1E9YB 3N4EA 3N25A 2OXNA 3ALGA 4ZOBA 3H4WA 1FWEC 5KZMA 3BDKA 4XKYA 1NU5A 1UH3A 5LXXA 1AL8A 1VB9A 1XSKA 1JRBA 2Z6JA 2QDGA 4FO4A 4MWAE 3BURA 1IR2A 3PFRA 1Q8AA 1BYAA 3TC7A 4JAWA 1I60A 1XLMA 1IXQA 1E5JA 3W88A 1BVZA 4MY9A 4UB9A 1HVQA 1I2OA 3N4FA 5ECVA 1RD5A 1T5AA 3GHUA 1TPDA 4JIRA 1EC9A 4YVXA 5EBAA 2QCDA 3RUBL 3BOLA 2HQAA 4CEXC 1TIMA 2E1DA 3U5UA 3ITXA 5FKYA 3W7JA 4KCVA 5FI8A 5M5DA 5SWUA 4H9TA 1ONXA 4Y9NA 1E1CB 3LTYA 1F3XA 2DQWA 4GXWA 1F3EA 4LUYA 2GVLA 4KKXA 4V1YA 5HR6A 1LLZA 4XTIA 3TAKA 3HQOA 5FF2A 2RAGA 1H60A 3ZSTA 1TPB1 2OZTA 1XRSA 4XISA 2Y7GA 1AVAA 2HDJA 3KTSA 3GYCA 2FHCA 4O8RA 5EB8A 3CMJA 4DN1A 1UMYA 3NDZA 1SJDA 3TFCA 1UKPA 1G1YA 1Z7AA 3H2AA 1W9PA 4NZCA 3UPMA 2XN0A 1K7XA 3KDNA 2GDQA 3UW6A 4V27A 3TNBA 1ZLPA 2D0GA 3W1RA 1XICA 1FHDA 3OJGA 5FJUA 1TZ9A 3GC2A 1XDLA 3EB2A 1TVPA 1W5PA 2QW5A 1XLGA 4AF0A 1SPQA 4H6QA 4QITA 3CEPA 4AYGA 4QE1A 3VZYA 4LBUA 2PZ0A 4H6RA 1JPHA 5BROA 4JDBA 2F2HA 3CNYA 1VJSA 1XD1A 2NXIA 5D2YA 3RHGA 1E56A 2DZXA 4C6FA 3OPSA 2WMIB 3BJTA 1MRQA 3NPXA 1DWAM 3BSMA 1QT1A 1V6UA 4GHRA 2ADAA 5DF0A 2CEQA 3GXDA 3E3HA 3ZT5A 2FZNA 4O50A 3BLEA 4DJFD 1NQKA 3CXOA 1QJWA 5FCZA 1M03A 1F4HA 5C7HA 1Z9AA 3INPA 4X9SA 3MWCA 3P0WA 1Q2SA 2OYMA 3C2VA 4L80A 3MKVA 1O5QA 1KNWA 1DORA 3PTQA 2ZQ0A 3CLMA 1GNXA 2HXTA 3VNYA 1A5OC 1E3XA 1B4EA 2A85A 3PHAA 3LXCA 3WFAA 4DZAA 4A35A 5LNWA 3G22A 1VYPX 3UXKA 5HWNA 3T7VA 4WKAA 3SN1A 3BTNA 3MWAA 1CGXA 1DHPA 3A23A 3M4HA 1IF2A 1XYMA 3QR3A 4LUTB 1YX1A 1NDVA 1P43A 4ZO6A 5FJOA 1WDSA 3WLLA 5EMMA 5HANA 1U2YA 3PB2A 3TWBA 2WPBA 5D2XA 2CNCA 4ATWA 1OFAA 4ZTYA 4E8GA 4UNLA 4L7ZA 1YXYA 5IFTA 1XG3A 2QKFA 5FAJA 1KV5A 2E67A 4U5IA 2BNJA 4PMRA 1E15A 2WKJA 3FHQA 4TTGA 1FHVA 3NOEA 3PC0A 1BPLB 4JGDA 1A5SA 3TXVA 3BXWA 3WIJA 3MUCA 1J0HA 4BI7A 2Y5JA 3QYSA 2X1TA 4MKVA 3SGGA 2YX0A 1E4IA 1QBAA 4YTSA 1OCJA 1L6SA 3WDQA 4GGHA 3T08A 4C6EA 4PGLA 2QGHA 2I5IA 4GJIA 2VC9A 2VX4A 1BGGA 3SB0A 3W07A 3CEUA 2E77A 3GTFA 4QNEA 5CAKA 2OFJA 3C8NA 3PZGA 1UP2A 2RGMA 1B9BA 3LRMA 1NF7A 4CGTA 3PJXA 1S5NA 4XZNX 4DJDA 5EFDA 1QO2A 4KBXA 5F1VA 4HPJA 1RA0A 2W91A 9CGTA 4X2PA 4DO7A 1JPMA 3O7UA 4KFNA 2VFDA 4TVUA 1OEPA 2PDIA 3BMVA 1WKYA 8XIAA 2PRHA 4HSNA 1W1ZA 2VC7A 5I3FA 1Q8JA 3RCNA 3RCMA 3UZWA 5AZ1A 3HOJA 5DXYA 4UZSA 1XPYA 1KRMA 5L9FA 4LNYA 1W1PA 4JXCA 3RGTA 3ITVA 4IH3A 3W1TA 1F3WA 1D9EA 4FSAA 4GACA 1XYBA 1HKMA 3VX0A 1OABA 2WV8A 3IJDA 1FHUA 5A8OA 2DZWA 2NW0A 2QYGA 3PUOA 2G5WA 3VCNA 4NJGA 1BKHA 3VGDA 4UQBA 5CPSA 4B16A 3DG3A 3TROA 4L6HA 2E6AA 3QR0A 2E1WA 4O10A 5U4NA 2BXZA 5A3HA 1GQKA 4UOQA 4E2VA 3BJFA 2OZ3A 3UY8A 1SJBA 4MIMA 4CQ9A 1UKSA 2VZVA 3ELFA 4L9YA 1I4NA 3T0CA 2IS7A 1GOIA 4NAFB 4I5RA 3PVFA 3CUFA 3GUGA 3KOFA 3ZR4A 1PKYA 2E6FA 3TR9A 3PK7A 5HUPA 2BVYA 3NEHA 1K7FA 2J7BA 4C7DA 4EIVA 2PDWA 5M17A 5HAOA 4NJIA 3CHEA 1HGYA 4GX9A 4LY4A 4EOUA 4E4UA 4LALA 4JQ1A 4Q8OA 5A6BA 5C54A 1W8SA 1R7OA 4M3PA 1IGSA 1A5UA 1YHTA 2XFFA 5HNNA 3NQVA 3WBXA 2J8FA 3OU8A 2UWFA 4DO5A 1C9DA 4PL1A 1W3JA 4HMDA 4KETA 1NM9A 3B3DA 4URIA 1MYRA 5E6ZA 3WLQA 3ZJ6A 4DBSA 4MFEA 4ADTA 3O6YX 3LNPA