4WDTA

17beta-hsd5 in complex with 2-nitro-5-(phenylsulfonyl)phenol
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdtA00
3UZZA 1RY0A 4ASTA 3UG8A 5KETA 4H8NA 1ZQ5A 4Q7BA 3UP8A 3BCJA 3DN5A 2ACUA 3LZ3A 5HNUA 5HNTA 2PDKA 2BGSA 3WG6A 4HBKA 4I5XA 3UZYA 4JQ4A 1T40A 1MRQA 2FGBA 2IPGA 2PDBA 1AZ2A 4JQAA 4YVPA 3Q67A 4PMJA 1S2AA 5LIXX 5C7HA 3FJNA 3WBYA 3NTYA 3V36A 3EB3A 3LQLA 3DOPA 5AZ1A 2HVOA 4QBXA 4GACA 4PRRA 3LN3A 4PR4A 1X97A 3M0IA 3LNMA 3CMFA 4ZFCA 3UGRA 2PDWA 3RX4A 1SM9A 4L1XA 1ZGDA 4DBSA 2J8TA 1IHIA 1Z9AA 2I16A 4WDUA 2PD5A 2BGQA 2HE8A 2A79A 1RALA 4NKCA 2WZTA 4GQGA 3BURA 2NVCA 4WDTA 5DANA 4EXBA 3LBOA 3GHSA 1XF0A 3R43A 4PRTA 3V0UA 4YVXA 3UYIA 2ACRA 3N6QA 1LQAA 1YE4A 4MHBA 2ACQA 1Z89A 3U2CA 4FAMA 2PEVA 1QRQA 1ZUAX 4YVVA 2PF8A 2IKGA 1VBJA 4OTKA 3R58A 1VP5A 1YE6A 1HQTA 3H7RA 5JH1A 2IPFA 2PDNA 3CV6A 3VXGA 4XZIA 4PUWA 4H7CA 4WGHA 3S3GA 3BV7A 1Q13A 3F7JA 3WBWA 2ACSA 4G5DA 3G1RA 4FZIA 3CAVA 3D3FA 4Q3MA 4JIIX 1AH3A 3CAQA 2C91A 3LEPA 1YNQA 4R9OA 3GUGA 1FRBA 1MZRA 1S1PA 2FZ8A 2PDLA 2FZDA 5LIWX 3KRBA 2R9RA 2ISFA 4XZLX 3H7UA 5LIUX 1LWIA 1M9HA 3O0KA 2FVLA 2PDXA 2PFHA 4L1WA 4LAUA 2PDYA 4JIHA 1XJBA 4JTCA 4LBRA 2INZA 4XO7A 4WEVX 3LUTA 4GIEA 1K8CA 4DBWA 1ADSA 3GHRA 1JEZA 2HV5A 4FALA 1RY8A 3WBXA 3UZXA 1EXBA 1Q5MA 2PDPA 2PZNA 4XAPA 2PDCA 2HE5A 4DBUA 3MC5A 2WZMA 3R7MA 2R24A 2VDGA 2P5NA 1R38A 4ICCX 3FX4A 1HW6A 2INEA 4XK2A 1MI3A 3R6IA 3G5EA 2F2KA 1X98A 2PDMA 1S1RA 4IGSA 4F40A 1PZ0A 3R94A 1YNPA 4XZHA 2IKIA 3LENA 4JQ2A 3Q65A 3LQGA 2IKJA 1X96A 3QKZA 4GA8A 2DV0A 4QX4A 3V0TA 4WRHA 2FZ9A 4JQ3A 2ALRA 5M2FX 3N2TA 5HA7A 2DUXA 2HEJA 2QXWA 1Z8AA 1C9WA 2HDJA 3T42A 3RX2A 1T41A 1EKOA 4GABA 4DZ5A 1PWLA 2AGTA 1AFSA 1QWKA 3ERPA 3LD5A 1Z3NA 3EB4A 3WCZA 2IQ0A 1AH0A 4HMNA 2PDQA 5JH2A 3R8GA 5AZ0A 2F38A 4QXIA 2IKHA 3V0SA 4IJCA 2IPWA 4JIRA 4YU1A 3UWEA 4XVEA 1A80A 3P2VA 3MB9A 1ZSXA 3ONCA 2IS7A 2NVDA 1J96A 2PD9A 4GQ0A 4JTQA 1UR3M 3H4GA 2IQDA 3M4HA 4XZNX 4LAZA 2PDHA 1OG6A 3M64A 2PDIA 4XVDA 3LZ5A 3ONBA 3UZWA 2PDFA 3V35A 4RPQA 1PWMA 1EF3A 3GHTA 4XO6A 4QR6A 4LBSA 4EXAA 1US0A 4JTDA 3CV7A 1S2CA 4XZMX 2PDUA 2FZBA 5LIYX 2I17A 2BP1A 3CASA 4AUBA 4JQ1A 1EL3A 1IEIA 3BUVA 4PUUA 2PDJA 4FA3A 3EAUA 1PYFA 3C3UA 4LB3A 3RX3A 1AZ1A 1GVEA 1PZ1A 2CLPA 3GHUA 4JTAA 4IJRA 4WDWA 2PDGA 3R8HA 1AH4A 3UFYA 4YS1A 2HVNA 4GCAA 2DUZA 2IPJA 5LIKX 3B3DA 4WDXA 4JTRA 4LB4A 3O3RA 3COTA 1XGDA
chains in the Genus database with same CATH superfamily
4CN6A 2PSNA 4KIRA 5FF7A 1GCYA 1TPC1 3A4JA 3GM8A 2VYOA 3H2MA 2QQ6A 4H8VA 3H55A 1O60A 3O7UA 4CD4A 1TVPA 4F79A 1R8LA 2XH0A 2JKPA 4Q8NA 1AW1A 1UUQA 3WD2A 3GS6A 4K8HA 2Z4GA 1RZMA 2KX9A 1LLZA 4W89A 3BMWA 5GNZA 3DKLA 1RVKA 4BKNA 3NZRA 5BRQA 1S2AA 3HG5A 1E6XM 4YPJA 4IICA 4KRTA 1JNDA 4PTNA 3EB3A 3DOPA 3NR0A 4IQEA 4QG8A 2PWEA 4PR4A 1GOOA 1X97A 3SAZA 4UOQA 3GK0A 3T1GA 3ZSTA 4DVOA 3AI0A 1UWRA 4J3XA 1PCKA 3PNZA 1W5PA 1FA2A 2Y7FA 4M3PA 5F7UA 2Z1SA 1VPYA 1JZ6A 4HN8A 4AH7A 1GK8A 2O9PA 5E93A 1B0IA 1U5VA 1Q8JA 5HNNA 3AIEA 4O14A 2E9BA 5M1TA 1P6CA 1YW1A 5JIWA 4H41A 4H9ZA 4PYSA 2YBUA 3UG3A 1ML1A 3WELA 1O5QA 1MWOA 5HPCA 1XH2A 1EYEA 3W7PA 3R79A 2JKAA 4JAWA 2P10A 2PU0A 1K1DA 1VP5A 1OC5A 4M81A 3RPMA 1QAPA 2CPUA 1XM3A 3UJSA 3NQ7A 5CZKA 1XDMA 4PL2A 4UQAA 2W62A 2PF0A 1OFBA 1Q6QA 3D6NA 3TZFA 3ZLFA 2DVTA 1Q13A 1U2YA 4NJKA 1TZZA 2ACSA 1WXJA 4KW2A 3LX9A 3ANUA 2NQHA 2PPGA 1W3KA 3LEPA 3PP7A 4PGLA 3TTOA 4J40A 4GRSA 2V67A 4PMYA 2BZNA 3T2QA 1SQ7A 3EZ4A 4RKAA 1UUMA 3M7WA 2Y7GA 1J6PA 3ABRA 3KRBA 4QCEA 3C0SA 4ZOBA 4D6EA 2PCEA 4RZ4A 1LBMA 3NQGA 1JNEA 3SN1A 2NV9A 2V38A 1I6NA 4IXXA 2PI6A 5U7SA 3S5OA 3NOYA 2H90A 1JYVA 2WLYA 1NU5A 4N02A 1TKKA 4AU0A 1DWGM 4L6OA 4TX9A 1K9FA 2ISSA 4LCRA 1TSIA 4CD8A 4KBXA 2QHAA 1ADSA 1Q7MA 1QO2A 3C2VA 2FJUB 1CLVA 2OGYA 3RILA 2PDCA 3T0BA 1V0LA 4W86A 2X05A 1FY6A 2XWEA 4OGZA 3O9NA 3HJEA 4GO8A 1E0UA 2DT0A 2X09A 2Y89A 3KS5A 1XBXA 3EX3A 4WVXA 3Q4DA 1P0DA 3G5EA 4A3RA 1QI4A 3LOTA 1XI3A 4WKFA 1PZ0A 3MI3A 4IMAA 2QCLA 1AJZA 4CD6A 1B3XA 5A69A 5EBUA 4GA8A 3U6WA 2OKOA 4QITA 4Q22A 2EKGA 4Z1YA 4GXPA 4WY0A 4WRHA 4J7RA 3S9IA 1MNZA 1WDDA 3D47A 3DYOA 4GCXA 3L4XA 3URQA 4WOZA 1JPHA 1PE1A 4JHMA 1LZOA 3UA3A 3SRDA 1IGWA 2QDHA 2QUVA 2VC7A 4INFA 3T42A 4K7YA 2ABBA 3MMUA 1AFSA 1QWKA 3GC2A 3SUUA 1I75A 2IQ0A 4RV8A 3AIQA 2GWNA 3E49A 2OMAA 4DM2A 2G4JA 1XLFA 1KRAC 2TPSA 3P80A 2ALDA 4Q8TA 3GG8A 3PPFA 1UWQA 3AZSA 3P14A 4AYGA 3L4VA 4ATDA 1FWEC 1KTCA 2ZUTA 7ENLA 3A5VA 3KL0A 2VTFA 1J96A 4I5UA 2Z27A 3FAXA 3NAVA 1TPUA 1AMYA 1UCWA 2OSXA 4C6LA 2A3CA 5ABFA 2H3BA 4UQCA 2HXUA 2PDIA 3THAA 1KGUA 3J7HA 3ZJ8A 2WC3A 1TPEA 3AMDA 1P1XA 1W2PA 2BOEX 2Z1KA 1EX5A 2V5DA 3QZ6A 3S5SA 2QULA 4XIAA 1I2OA 3B04A 1EF3A 3XISA 4NAFB 4ICNA 5BXTA 2WW5A 3KWXA 4LUTA 4O1AA 3M46A 3VNJA 2VFFA 1DORA 4PE8A 1FX6A 1LP6A 2PDUA 3N4AA 1RR2A 4PUDA 3ZWTA 1SFJA 2C1GA 3DGBA 4Q32A 4EPEC 5I24A 1F76A 2D3NA 4FX6M 8RUCA 2OJPA 5F2IA 3BMVA 3P0XA 3OGRA 2YBTA 1GVEA 1PXGA 1JAEA 1EP1A 1OVDA 3P81A 3GHUA 3T44A 4HTYA 4H8UA 4ZENA 4ZBCA 4CEXC 3DFPA 4WSJA 5CCZA 2V2CA 1HF6A 3CUJA 4HHHA 4MM1A 1G7VA 3EXRA 1KKRA 3GR4A 3M0MA 3POCA 1WDSA 5A6TC 3WEOA 4C6FA 3ZT6A 3UBPC 1YTEA 1B3WA 4AD1A 3UETA 2OT0A 1AUSL 4M0XA 3CMGA 1GORA 1H61A 3TN3A 3GVVA 4MADA 1ITCA 1CENA 1W32A 1QNRA 1I1XA 5BXSA 4PUNA 3PR2A 1DWJM 2QCGA 1GKQA 4LF1A 2DSUA 4HT3A 3BICA 1BYAA 2YJQA 1V5XA 4F2TA 2GDQA 4L6DA 2A3AA 3WQDA 4D6HA 3TWBA 1W9DM 4IT1A 3QQWA 3Q67A 5FF4A 1MNSA 3MSRA 1OCJA 4OKDA 4JX4A 1Y5WA 3ARZA 3ARYA 4ZOAA 3OA5A 3ZLHA 5AZ1A 4ES4A 4LYQA 1LT8A 1W5QA 2TMDA 3H4XA 2ATMA 2F6UA 2Z0IA 4O0KA 2RAGA 1TV3A 4GLEA 1PB0A 4C6BA 5AHFA 1JZ3A 1MQPA 3AIUA 3W74A 1JQVA 3VMNA 1SFSA 2DT1A 2BWGA 5DCDA 3G18A 4UTWA 1KA9F 2VZTA 2CFFA 4UQBA 2HWGA 2CZFA 3EWZA 4AG0A 1J0KA 2QZRA 3DBNA 2YL9A 3UGVA 3QTGA 3T4WA 1W1PA 4S3DA 3TZNA 3WX7A 4AC1X 1XF0A 3DU0A 1F4HA 3LA4A 4OBSA 3M0ZA 2PLJA 3FJ4A 4TU1A 1LG2A 1Z32X 5F4SA 1HJQA 1I2PA 2V5KA 4MHBA 3SCNA 1JRBA 2D73A 3CWHA 1R3RA 3VGFA 4IQDA 5A2BA 2FKPA 3P61A 1OCBA 2RHGA 2FHBA 2REQB 1TZ9A 3SN0A 1OGSA 3PBWA 3R58A 4NVTA 3AQUA 1H1YA 4L9XA 2PDNA 3S1WA 3T0TA 2BDQA 2C0AA 4BEQA 2CIPA 1VFUA 1ZP3A 3PPGA 1FP9A 3CPUA 3GG1A 2JEPA 2XVKA 1N8FA 5FJJA 4EE9A 2PA6A 2DW6A 1E6NA 2C6QA 5AY7A 4KWWA 4M6QA 3VGGA 3W1PA 4FNUA 3P8IA 1ITQA 1KCKA 3QLLA 1S1PA 1YDOA 4M80A 3R11A 2XN0A 3USZA 3BG5A 3DFTA 3TYBA 4B92A 3CPRA 2OEMA 1UIPA 4O28A 9RUBA 4D6CA 4JDYA 4LYKA 5LA1A 1UHVA 3N18A 8XIMA 3P82A 4JHZA 4CCZA 1VYPX 2ZUWA 4L1WA 3LLDA 2IUZA 4JN7A 3RF9A 2UY2A 1TMQA 2Z00A 1BYDA 3HG4A 1OFRA 3JR2A 2PMQA 5IRPA 2PGWA 2ZZ2A 3QZAA 4LYRA 3UZXA 2FTPA 3IJQA 4UOZA 1Q2SA 2EPKX 3S2LA 5FSEC 2ZUNA 2DPEA 2P76A 4NZ1A 2XH2A 2QVNA 1V3MA 2X42A 1FCBA 2KAUC 5CKSA 1D3CA 5A2AA 1JI2A 3CHEA 5G2WA 1UQYA 3G1AA 3AJ7A 8XIAA 3W07A 1ISZA 1K7EA 2J78A 2XPKA 1OINA 1X98A 4TQTA 4D8ZA 2D2HA 1JZ2A 2HJPA 3DHFA 2Y6ZA 2VEFA 5EMUA 3AIVA 3O15A 2A7NA 2VFDA 2HXTA 1KC7A 3FFSA 2IXVA 5AYXA 5BMXA 3V0TA 3CXOA 4FXRA 3I68A 5LGZA 1U30A 1M5WA 4DXVA 1BKSA 1TJPA 3QPZA 1HKKA 1C92A 2OWWA 3N4FA 2J47A 2EPHA 5FKYA 2NX1A 3W1LA 2HS6A 2DQXA 1YKWA 3A6OA 1TR9A 3VZYA 2WZIA 3WH8A 3UWVA 4D1IA 5C9WA 1X7IA 3CT7A 3EEZA 1XYBA 2Y8KA 1BEUA 2I7GA 1V6WA 2JKEA 1QHPA 4M19A 4P7NA 3TFCA 4MB4A 1J0YA 3IJ6A 2F61A 2E0PA 4P8XA 2DJLA 5T9BG 1AQMA 1SMDA 2DUAA 5IDIA 4DEFA 1HJUA 1M41A 1UWTA 1DJYA 3GYCA 3C6CA 3AXIA 4QJ5B 3L5MA 1NY1A 2YDSA 3EA1A 3GZ3A 4WHBA 1T99A 2ADAA 2YDAA 1WP6A 4OECA 3OJGA 4UFHA 1P5BA 1ICSA 4H83A 3RU8X 1E1CA 3IIPA 3KFTA 1NDWA 4RDZA 1GEQA 2EPLX 3WLNA 4DF1A 2YA0A 1KCXA 2X7WA 4MTVA 1G4TA 2B81A 2WYSA 2BTMA 2GVGA 1DWFM 4PUEA 3TR2A 1VFFA 1KNWA 2WO5A 4XO6A 4QR6A 4K6AA 1C29A 3ITXA 3VINA 3S9ZA 1JCYA 1LTDA 3PPCA 3UR8A 1J10A 5JBFA 2W27A 5LXXA 3KP1A 3G1SA 3WL1A 4C6PA 3W2KA 1PL9A 1MXDA 1P7TB 3CHDA 5XIAA 4EP8C 4YWIA 3V1HA 5I3HA 5EMMA 3VOFA 4NAFA 4NILA 2OZ8A 3RPTA 1V08A 1E0XA 3VM5A 3KZSA 4HYVA 3TLLA 2BY3A 1DJNA 2FHFA 3L4ZA 4AD4A 1B90A 1OCNA 4LS1A 1TUXA 4NZ5A 1E70M 3UFYA 3GY1A 3W24A 2D2GA 4QAIA 4MNKA 4YS1A 2W9MA 7TIMA 3D46A 2PWFA 3VK5A 1R3YA 1TA3B 3AUJA 2Q6ZA 3TSBA 4MIMA 3HQNA 4X0NA 2XYLA 3N9RA 1E3ZA 2BGNE 4A8IA 2JEQA 2J66A 4TXEA 3UR2A 1WZMA 1IIHA 3B9AA 4BF9A 3C5QA 3VYLA 4KESA 4KWVA 3PTQA 1WXYA 4UZSA 2VFGA 1JCJA 1TVLA 5HNUA 5CGTA 5T26A 3PK7A 1EOMA 1A5KC 1WQ5A 3THUA 3EXTA 5BU6A 5K9XA 1B3ZA 1PDYA 3NGJA 1NP2A 1F3WA 1E9IA 2X1RA 5C7HA 1JGMA 3PSVA 1EHNA 2H9AB 3QR1A 3TTQA 7REQB 4H9UA 2DSZA 2QDGA 3AXMA 4NYUA 3P60A 4PMXA 5EMJA 3F2DA 3S47A 5D38A 3RX4A 3BQ6A 3N2OA 1JPIA 2YB4A 1FWBC 3NXFA 3IVSA 3ECQA 1DTUA 3GG0A 4DF0A 3W1RA 4LANA 3QMSA 3KBMA 3NZQA 1M3UA 3ZLGA 5CGMA 3TCSA 3E2RA 1XD0A 3PZVA 2YPIA 4PMRA 3PWGA 3EDJA 2QDEA 3GH7A 2CLLA 2E9MA 2ZZ3A 3GHSA 4ACZB 1E9YB 1K4GA 1PZ3A 1CGTA 3R43A 1DJQA 3FEMA 4F0HA 3UYIA 3N6QA 3W2JA 3UG5A 1W3IA 5G2HA 2ZZ6A 3L2MA 4ACYA 5CBJA 2POZA 1BSIA 4WF7A 4FAMA 3CWNA 1AD4A 2F9RA 2P8CA 1GOIA 4HCLA 4NZJA 3PPHA 3R25A 1W1YA 3OBKA 3ZWSA 3NL6A 3TMQA 3CBWA 4GYFA 1G4SA 2ZDRA 1H5VA 3KCOA 7A3HA 3WNLA 3S3GA 3NDZA 3U48A 4KRZA 1THFD 3N04A 1UWAA 3E0FA 4KIEA 5EA9A 3BAWA 1JQXA 3NUKA 4JIIX 2OO6A 2E6FA 1BXCA 3VM7A 3MANA 1UUOA 2WSPA 1VFLA 4GC3A 1BF2A 1UD4A 1HNYA 4Z2IA 3RR4A 4Q4KA 4ONVA 5FIPA 4F2UA 2PDLA 3W7HA 5LIWX 4XZWA 4S23A 2WMJA 3PAOA 3NQ8A 4O53A 4FOJA 2OEKA 4HYWA 1UR2A 4GI9A 4XBSA 1LWIA 4A6GA 3F2CA 5G1TA 1G4PA 4B3KA 1A4LA 4QNEA 3N25A 3L4TA 3ITYA 4AD2A 1RQHA 4PB5A 1OCQA 3E74A 1LWHA 3FA5A 4HPHA 3M0YA 5I3GA 2XDFA 1BHGA 1UZ4A 2XIOA 4GIEA 4CNSA 3NPWA 1FWJC 1EXBA 3VABA 3G6MA 3GIYA 1HP4A 4I8DA 1B54A 1KFLA 4MJ2A 4PSRA 4AEEA 1F74A 4F48A 1DKWA 2BHZA 4IF2A 4PB3A 1LJYA 1EWDA 4ICCX 2GVJA 2DSWA 3CHFA 1J9YA 2C8NA 3G3MA 1N55A 3DENA 3ZJKA 1U1UA 2R1KA 3LENA 3W29A 4JQ2A 4I90A 2Z28A 2DV0A 1H7WA 3BO9A 2QJIA 1X6UA 3UVIA 3WQPA 3ITVA 3BZGA 5I77A 2YKKA 3KRZA 3B0YA 3ABZA 3FJ6A 3QN3A 2WJEA 1V6XA 5FSDC 3M6DA 4AD0A 4NJJA 3RX2A 4UFKA 4BCEA 2OSYA 1AW5A 4WCJA 3OEXA 4JKKA 4B16A 1BQGA 9XIAA 2C79A 5FF3A 2UBPC 2WBGA 3L4UA 3OVRA 4W8LA 4EXQA 4XG1A 2Z25A 1TPDA 4U2YA 1F3TA 1V77A 2NUXA 2TRSA 3AS1A 4YU1A 3CQJA 3OGSA 3RJXA 1NJJA 4XVEA 3VOGA 3RAOA 3CO8A 5FJPA 2DW7A 5LZLA 3MMTA 2CWXA 4FI4A 3MCNA 1JGIA 2HVMA 3BAJA 3GR7A 2A21A 3IIVA 2NXHA 5CC5A 1TYGA 1XIJA 1E43A 3W38A 3O8AA 4GHRA 2PDFA 1X38A 4Q7IA 3V35A 2GQ8A 1NP0A 1UKQA 3W1QA 3B0PA 2HISA 4GX9A 4NHVA 3B8SA 4XD4A 1OHLA 4QDMA 1FWFC 1F6KA 5CGQA 3KTXA 3POHA 4FEZA 3DI1A 2VZUA 3S6OA 4WQ6A 3QSTA 1VRXA 3CV7A 3ORWA 1LUCA 4S39A 1H1NA 1KFWA 3N1AA 1GQIA 1HKVA 1QHOA 2OKTA 2I17A 1UD3A 1YPFA 3MP4A 1UBSA 3H21A 3FKRA 3TH6A 2PDJA 3NQ2A 3HMCA 4FS9A 1AA1B 3ANYA 3LXCA 3NSXA 2HPIA 4GNVA 3LSCA 3BLIA 1K8YA 4RDWA 1HO1A 1E1EA 1XRTA 4AZCB 4WKHA 1FDZA 3QOKA 5F4XA 3AMCA 1V6VA 1YTKA 1NDZA 3BZJA 4LJ3A 1CXEA 1EC7A 5IBXC 1Q6CA 1W5OA 2OQYA 3T8LA 1ZBCA 2PODA 4HIBA 3M47A 1XG4A 3CZLA 2Q09A 3BC9A 4H04A 1FP8A 2EJ1A 4YYFA 3V75A 2V2HA 1RY0A 1DIDA 1RJRA 4D1JA 1UMYA 4H8NA 4GFIA 4AFYA 3RFAA 2H8ZA 3BCJA 1UR9A 5A1AA 1CW2A 2VC9A 2XFYA 3NJ3A 2VWTA 3LLXA 4ROPA 3EYPA 1UWIA 2WOQA 2PDKA 4HBKA 3TC3A 3TN6A 3OPSA 1SSDA 3GDMA 2JALA 4HTBA 4WJ8A 1IT7A 1K03A 3WKZA 4AX6A 1QJWA 3OU8A 3MCOA 1L9WA 2YX0A 4PTWA 3DEQA 4RZ5A 2NV1A 1MW2A 7XIMA 2HROA 3DFOA 5A6LA 3GC4A 3LQLA 3L4YA 2WNNA 5GPRA 5EMKA 4JCLA 2VX6A 2NSOA 3LY0A 1KGXA 2A7RA 4HYRA 2HK1A 2PDWA 3LCLA 2XH7A 2WSQA 2D0FA 4QE4A 3GNPA 1ZGDA 3IANA 3S1XA 3NPVA 3FGCA 2RDTA 3UCCA 2DVXA 1Y0EA 2WSYA 4P8UA 2CYGA 3IUDA 2GVLA 4HMCA 4NKCA 2NT0A 4LS0A 5BU9A 4Q8VA 1D9EA 2O9TA 1QFEA 2VZSA 5TAOA 3W81A 2GL5A 1JUBA 3N6HA 5CZ0A 3N3TA 3Q94A 2B4GA 4AVFA 3KLLA 2HCVA 5C2GA 2J27A 1W2VA 1V7YA 3HA1A 5J04A 1P6BA 4DJEC 4IPJA 4UNKA 4NZ4A 1GQKA 4XIMA 1F61A 3TC6A 2ZXBA 1C7TA 2PRMA 3C2YA 4NI3A 1ZP4A 1KBJA 2VFIA 4U5IA 4L4PA 1XR2A 4IIGA 4HA4A 2A6NA 4EANA 2FYMA 3F7JA 2XM2A 3MZ2A 1XLEA 1KFKA 5TNVA 4TVCA 1ESWA 3D3FA 4J2MA 2CLFA 1W1TA 3S5ZA 2X0HA 5T9CE 3ME3A 1UR4A 1NH6A 4G8TA 4R9OA 1JDCA 3NZ1A 1W9BM 4O1CA 2XSBA 3AHXA 2DZPA 3C8NA 1FWGC 1EJ7L 3E2QA 5AOUA 1W17A 4DI9A 3WENA 4LAKA 5GQBA 3LDVA 5CJ5A 1A5MC 4LF2A 1LDCA 3WYZA 2OWXA 4BR1A 1PHQA 2P88A 3QEZA 2X2YA 1KFCA 4KGLA 4O10A 4LVGA 4L7ZA 2ESCA 3VIPA 7ODCA 4V2XA 5LNVA 4FNRA 1XIDA 5DX7A 2WMGA 4MB5A 4YHGA 3GHRA 1RXOB 1UOKA 2R14A 5FOOA 3N34A 4O17A 2WMIB 3BL3A 3LV5A 1LBFA 1LROA 4FR1A 2ZICA 1O7AA 4O18A 2Z6IA 1X1NA 3EKGA 1POKA 3E5PA 1XRFA 1Z41A 4JNMA 4HU8A 4HSOA 2J88A 1QPKA 4LVBA 2PWVA 5BZAA 2B7QA 3MI6A 4GOAA 4LRSA 1MI3A 4Z1AA 3WNNA 1DXEA 3ANVA 1Q63A 5A6MA 4DHGA 5C7VA 5HQMA 1LCOA 1LOSA 2CXGA 4GJJA 4LNYA 4K8GA 3TQPA 2A4AA 4LCSA 4ZTYA 1IXNA 3TQ0A 5BWFA 2G3IA 3KOFA 1ZRQA 4Q8PA 3BAYA 3BARA 1TRIA 1E0TA 3PY2A 1FXQA 3EX1A 4XSMA 2BHUA 3RLUA 3SCSA 3T78A 3BW3A 3URNA 2OFJA 1R9ZA 1RUSA 4RE4A 4KT2A 2V5BA 1DOSA 1EKOA 3QY7A 2ZRUA 3AS3A 3TIMA 2MUCA 3MP3A 2VM8A 3G8EA 3N9SA 4UOJA 4OJYA 5XINA 5AC7A 3PN8A 3MSYA 4CNNA 2EF9A 1EA0A 4IJCA 3R4IA 3W87A 3VUSA 9CGTA 3P2VA 3UNTA 1ADOA 2DJXA 3PBUA 7TAAA 4BY3A 1V79A 4BZYA 1R2SA 2O56A 1J0IA 3H4GA 5HINA 1KRBC 4DJDD 3KBSA 5C5YA 1TWSA 3S5YA 4FLQA 4ZB5A 2BXVA 3SCOA 3LHWA 3WLJA 4KFPA 3OG3A 4LFYA 1V03A 1B1YA 1JYXA 3GKAA 2YW4A 2FDMA 3VO0A 3H23A 5JVLA 5A8PA 1TMLA 2Y70A 1PX3A 1PUDA 4JTSA 3ZVHB 3DI0A 3KWSA 3VGHA 2QCEA 1US0A 3EGJA 3I7RA 3UJFA 3XIMA 3UPBA 3I6RA 2QAPA 1L6FA 1DQXA 2XSAA 4UNIA 5AVHA 1DJIA 1YEYA 4R53A 1OYBA 1QW9A 3APTA 4A3QA 4IMEA 2W4XA 3CNYA 4L56A 2QJGA 4C7GA 4FA3A 1YYAA 4UR7A 1A5AA 2B0MA 1GVIA 5CPQA 1AZ1A 1JF6A 3PTDA 2CLPA 2GVEA 3WEZA 3PNUA 4JN8A 4C6QA 1HO4A 2XHYA 1DP0A 3UXIA 3EPOA 1DJGA 3GXMA 2WC4A 1OABA 3THQA 2GPTA 3U3HA 3MUY1 1NTHA 3IIXA 3NCOA 2DUZA 4QJ3B 3S1VA 3DHDA 1O5RA 3BVJA 2ZZ4A 1TWZA 4GUGA 4JYEA 3U4FA 1MXSA 1NM9A 3AZTA 4JTRA 4ERAA 4LUJA 2WKGA 5MKGA 1XYCA 4Y7EA 1LBLA 4LEFA 4A35A 3RNDA 4TUFA 2Q8LA 1TX2A 5I7GA 3QV7A 3UWQA 1ZQ5A 3GXTA 4H01A 4RZBA 3VX0A 4PODA 1E6SM 3GFZA 1PKYA 3AROA 4KETA 1H09A 4RW5A 1TV8A 3STPA 4BQ4A 4XBJA 3LPFA 1GQJA 1OC6A 5ENLA 1R3SA 1SGJA 5ABGA 4MG4A 4I9TA 2ZUSA 4S3CA 5A6AA 3HPZA 1T8QA 4M8UA 4QBXA 3A9BA 3WQEA 3VNDA 1REQB 1NAL1 4GXWA 4IMFA 2QF7A 2C1HA 4JYFA 1C93A 2VFEA 2WV8A 2SFPA 2NQ9A 4A8RA 2J8GA 2WHKA 3ZS4A 4GUHA 2WJZA 2A79A 5IOBA 5D2YA 4GX8A 2WZTA 5GNXA 1E1FA 1VBHA 1OJXA 4RDYA 1FWDC 1XISA 4YCPA 4HU4A 4S1FA 3OLGA 1C3FA 1K3UA 4B5NA 1V3KA 3I6EA 1TIMA 3CUIA 3HJZA 2RGMA 1TE6A 1CTNA 4KWUA 5EMLA 4DAIA 3EOSA 4ZZ9A 4LVAA 1AJ2A 3GO2A 4HP5A 1UJPA 3BLFA 3U2CA 5JIPA 3HPAA 3SCVA 4QLKA 3AYRA 3A4AA 4QRNA 2PWHA 3NQMA 4DJFC 4DPPA 1NFGA 3W00A 3VFCA 1HUVA 1Q65A 4U3CA 2Q3OA 1CWYA 4HSNA 3L7RA 2XWDA 3U2ZA 4O57A 4E4PA 5A8QA 1M7XA 3FSTA 3T6CA 1W3TA 1KBIA 4YTSA 5HWMA 1J5TA 1JJKA 3EKLA 1XIHA 3FA4A 4MWAA 3E1F1 1DV7A 2DEPA 1MUMA 2Y24A 3G0SA 4ZODA 5C2XA 5HATA 4DRSA 3GYEA 3BCFA 2A3LA 3NM3A 1H63A 2ISFA 1EPXA 3DH7A 4UMBA 2VXNA 2X0YA 1M9HA 5DRCA 1YTDA 1QPNA 1MFUA 4G7FA 1ALDA 4ENLA 4HHPA 1C8YA 4DO4A 1IXQA 3LGDA 4CCDA 4MJZA 3R10A 1XJBA 3FJLA 3V5FA 2J13A 4QSHA 3SQMA 3EEGA 3MO7A 4UFMA 4IUOA 2CKSA 4WEVX 3WLSA 1EJUC 1OX5A 1SZEA 5I0DA 1QPQA 3ALGA 4IMDA 1W54A 1S39A 4XD3A 1VS1A 2UWFA 3CPGA 4F0MA 4RZ6A 4CD7A 4LUSA 4ZSTA 1XYAA 4AB4A 4B4HA 3W22A 2RFGA 4QG6A 2D2OA 2INEA 2INFA 3H24A 5C8BB 5CPOA 3GIQA 4R7JA 2VD9A 5AN7A 3UZ5A 3IV3A 1TWWA 2ZC1A 3GTNA 1GQLA 1Q6RA 3W1UA 2IKJA 3DBPA 4GIRA 3B4UA 3QYQA 1HJWA 3CU2A 4NP7A 3TNOA 3DHPA 4Q4SA 8TIMA 2IMRA 1KXQA 5FJIA 3SQSA 5MF5A 1D7FA 4GYJA 4EF8A 1E56A 5CPSA 4B5XA 3SDOA 2R1NA 1O12A 3RO6A 3C2OA 4BQ2A 4UMAA 2OWCA 1M7OA 3CB3A 1VYRA 1YBQB 2X2GA 1UOZA 1TCDA 1P1MA 4AC7C 4DYKA 1ZU8A 4GZEA 3LBMA 4ZGYA 1GYNA 2QVHA 4H9TA 2PURA 2V5LA 1QI0A 1K4HA 1FWTA 3VOIA 2I1OA 3WIJA 4A29A 5MKGB 1ZSXA 4MDOA 1ZCOA 1F2JA 4FLOA 2WKJA 3WQ5A 3XINA 1QNQA 2DT3A 2JIEA 4LSBA 3T40A 1EDTA 1U1HA 2GJNA 4DZIA 1R47A 1KW1A 1WCGA 3KP0A 4KWSA 1CI1A 3OB8A 2V9DA 3R0KA 1TJ1A 2NQLA 2GQ3A 3BAIA 2BNJA 1GVYA 2YCIX 4GQBA 4X9SA 3RUBL 2DFAA 2RJGA 1LWJA 2R82A 1W6TA 3V7PA 3L12A 3CLWA 2ZFAA 4O52A 1JCNA 4F0KA 4S2BA 4HZ6A 4XZMX 1BKHA 3IPWA 3WDQA 2YYTA 3SFKA 1W3JA 2OT1A 4PULA 4AX7A 4CQAA 4I7VA 6TAAA 1PCWA 1WBHA 4DO6A 2AQOA 3GUWA 1RQBA 3W73A 3DFQA 3I4EA 3R89A 2VCAA 4Z08A 4NIRA 3ZJ6A 3SR7A 4QSFA 2Y0FA 3W75A 2E5BA 4YYCA 4WDWA 2ZRVA 4H00A 4RPPA 5I2UA 2BXZA 4H2CA 1WDPA 3W85A 3QPEA 2IPJA 3K2GA 2CHNA 4C5YA 2YL6A 3OHMB 2Z2UA 3F4WA 3L9CA 3IS4A 3FA3A 3TJ4A 4MPKA 3TYUA 4TV5A 1QMLA 1SZFA 4ZA0A 3SUVA 1TV7A 1VZWA 4US5A 3DN5A 2ACUA 2E28A 1Q3NA 1VGAA 3EMCA 1I0DA 4L61A 3TEVA 3RN6A 4LCQA 3P93A 5CZTA 1VYSX 1VD6A 2ZA2A 3A4XA 4O1BA 2ZXQA 1I60A 4DJED 4RNJA 2Y5JA 3P5ZA 4MUZA 2ZUUA 3EWYA 5JBDA 1TB3A 5DT5A 3CYJA 3ARVA 1IZKA 1D8WA 3PZNA 3WF1A 3MA8A 5D03A 4ZE5A 3CTTA 1VRDA 3I10A 3LHZA 3UGRA 1OB0A 4GY0A 4GYKA 5K7JA 1BFNA 1WOBA 4OQVA 1TIWA 4MYXA 4DAFA 1V7AA 3BSMA 1Q7QA 2ZX7A 1Z9AA 3PG8A 4FP1A 1RA0A 1KTNA 4LPCA 2E3ZA 1CLXA 3PB2A 4JL1A 1CZ1A 1MW3A 1KRMA 2F7FA 3OVPA 3PJUA 4U4MA 4QHRA 4DJFD 1NF7A 3SGZA 5LNUA 4GJIA 3WLHA 4TVUA 4O16A 2ZTJA 3B8VA 1PKNA 3BLOA 3V0UA 2CLIA 4CU7A 2RGLA 3GVGA 5IDZA 1YE4A 4REQB 2Y1HA 3QBUA 1Q2RA 4K7VA 1QOXA 1P0KA 4QS6A 3V5OA 2E40A 2R8WA 2X7VA 2XVGA 3N13A 1NWRA 5CBBA 3IRDA 3OZYA 4W88A 1QDSA 3SY8A 4BWLC 2YA1A 3GDKA 4LVDA 4PTDA 5D4YA 4OV9A 3EWBX 2DDXA 1XIGA 1ENUA 2Q02A 5HUPA 3WNPA 1E4IA 3G24A 4HOZA 1XCXA 1T7LA 1FCQA 1RD6A 3LLFA 1K9TA 3WDRA 1R3QA 4PUMA 4REQA 4V28A 4LW7A 3H4WA 4JKLA 4L4MA 1YNQA 4IP7A 1QI5A 4P7RA 1V6YA 3WQCA 3VCCA 1QWGA 1NDYA 4FXSA 1HKIA 4QNWA 3MDUA 5DN1A 4IFKB 5FL1A 4AEOA 1XX1A 3M9YA 5AKQA 3KZPA 3ITOA 3JU2A 3BGGA 5EMYA 3W2MA 2ZA1A 3WLTA 2E68A 2OCZA 1IWBA 1OZQA 3STFA 4LAUA 1XLCA 1L8PA 2Q8ZA 3LGGA 5I5RA 3MS8A 3W23A 5A6JA 4C6MA 3S2CA 2YCLA 2BX7A 4Y2WA 2G41A 1V6TA 1HJSA 2DZXA 2FPVA 1NWUA 3AZRA 4PSPA 4Q6JA 1XQLA 3KVKA 4XB3A 5LHEA 4U2ZA 2FZMA 1E6PA 2R6OA 4MUPA 3QGAC 1TELA 2R24A 1ZCCA 4JX6A 3SFWA 3QRHA 4LY4A 1FWSA 3EOOA 4KMQA 3USBA 3DFHA 4QE1A 3I7SA 4L64A 1H11A 4HNOA 1CBGA 3ZXWA 2ZWYA 5HAOA 3LI1A 1U22A 2GZXA 4XZHA 3L4WA 4PUKA 1CECA 1LM1A 3NZPA 1JFXA 4EX4A 1IEVA 2NLYA 3RR1A 4M29A 4DWSD 4L9YA 1G9HA 3TW6A 4O12A 3GB6A 3GU9A 3QFWA 1C9WA 3PC0A 1T41A 4IZGA 1VBRA 4Q8QA 3FY1A 2EHHA 3K5XA 5IFTA 3OIHA 3TTSA 3UU0A 1TTIA 2NXGA 3W3OA 1IF2A 3V0SA 1ONXA 1S2WA 4GZJA 3ZT5A 1US3A 2DZTA 5FF2A 5TBOA 4JTLA 3NO1A 1A80A 4HNNA 4O1DA 1C8VA 4CUCA 4O4WA 4LUYA 4YCOA 4MYAA 1PAMA 5EY5A 1WDWA 3P67A 2VUNA 1XKYA 2VHLA 3KBWA 3UERA 3KEHA 2PDHA 2BASA 3CZKA 4DQWA 3D0CA 4Z42C 1F7BA 1BYBA 4OHQA 3VC5A 5BWAA 2Z7GA 3AS0A 4Q6XA 4ZQPA 2FB3A 1QCWA 4TTGA 1YXDA 2BY1A 3ITTA 4IFRA 3T7VA 3RK8A 1US2A 3WMBA 4GYPA 3IGUA 3BSGA 4G7EA 4CNOA 1TREA 2PLCA 3T8QA 4FLSA 3MMDA 1KV8A 1E0WA 3NDYA 2JE8A 5A94A 1E1CB 3B9DA 1UC4A 4DN1A 1JYWA 2OO0A 3W2NA 3HMJG 4ZQMA 3WL0A 1K6WA 5TQLA 5EFFA 3CMJA 2BS9A 1AL8A 4DF2A 2DZBA 2OLHA 1W9XA 4PUJA 2QUMA 1KTBA 2GDVA 3FYOA 3QHMA 4ADTA 4MZ8A 3BJTA 1O1HA 2BODX 2CHRA 2YA2A 5B7YA 3HTWA 4NYYA 4UWMA 1FWRA 3UT0A 5G4EA 2HVNA 5I3IA 1B3OA 4BHYA 1A4MA 2TAAA 1MRAA 5I3JA 2D22A 2FZNA 5BOFA 2B7OA 1QNVA 4J35A 2YBVA 1BWKA 1F73A 2E25A 1CXKA 4MPQA 2J7HA 4E8CA 2V3DA 3RLVA 3VDHA 1A3WA 4HZ7A 4QTGA 4DIAA 1QASA 3ZJ7A 3B8TA 3ABOA 2BGSA 3KVLA 4Y6GA 3QQ0A 1RHCA 5D04C 3STGA 4ZOCA 3VU2A 2CWNA 2IPGA 4KEMA 4JTEA 1MUWA 2YZ5A 2XIQA 1S38A 4XKMA 4D71A 1B30A 8A3HA 2HQAA 1L6WA 3OP2A 4E0CA 2PU1A 2A7PA 3KW3A 3MO4A 3MV11 1GZGA 3WNKA 1V4YA 1CGUA 2QCHA 3FAWA 3REQB 2OPJA 1N8WA 1K9EA 3CMFA 1WOAA 1PIIA 2V8ZA 3QXBA 3M5XA 2HS8A 2P53A 1JUEA 2P0IA 3WMCA 4RW3A 5FJTA 4DBSA 5LNRA 5HQLA 4QG9A 5ECUA 1MMFA 3L21A 3TKFA 1KV5A 5E6ZA 2FVMA 4Z1CA 3A5FA 4AZ5A 3BG3A 3BLLA 3PBGA 4WDTA 1PYMA 3TSDA 1TRDA 1A5NC 1SU5A 3CGTA 1WKEA 3I6TA 1EGZA 3MVTA 1X6LA 3WBAA 3PUOA 1VBGA 2QUTA 3UR7A 2PTDA 5F1VA 5H8PA 1W56A 1LQAA 1UR8A 4F66A 1T96A 1SJCA 4MGGA 1N8IA 3IEBA 1I1WA 1Z89A 1XFCA 3W7QA 5C54A 4KCVA 3VNMA 4C6IA 4YTQA 2WZEA 4M6VA 3RM8A 3C0JA 4W85A 4IP5A 2VC5A 2G4FA 4KERA 1UH2A 4MKVA 1UP3A 2WMFA 3LG3A 3VXGA 1E4NA 5C55A 4PUWA 4AIOA 1H49A 3ZR4A 1VJIA 2FB2A 4HMEA 4BK9A 3GR8A 3AICA 4MY9A 4LAOA 3AMLA 2D1ZA 4DI8A 2CC0A 1AJ0A 2ASHA 3EOEA 3CAVA 2P1FA 3ARUA 2O55A 5LSMA 4IPIA 3UY7A 1G0CA 1VFSA 1WKDA 2POTA 1ME9A 2A3HA 1V0NA 3VDCA 2GQAA 4C5ZA 1FDJA 5KITA 3PJWA 1CGVA 4GFSA 3WD0A 4NZ3A 4ZTXA 1KD0A 3APGA 4FXJA 2Y7DA 6CGTA 4Q8WA 1TG7A 1ISVA 3BV4A 3STEA 1G5AA 3WO8A 1UD8A 3LTYA 3W01A 2J62A 1K7XA 2H3DA 2YR1A 2I5GA 3GSMA 3TYAA 4HPGA 1S2UA 3O6CA 1XRVA 3TFXA 2NQ5A 3LUTA 1W0MA 1VIWA 1L2UA 4HCHA 5FEWA 1JDDA 1KXTA 1DWHM 3PJXA 4H2HA 4S2CA 1XGEA 4A2SA 1PTGA 3WBXA 5CJNA 5FA5A 1J79A 5H8MA 3AHZA 4NT0A 4W93A 2HE5A 2Z6JA 1A0CA 1GEHA 2Y62A 3G77A 1FWCC 2O7QA 3B97A 4HK6A 4J28A 1XC6A 2XG9A 1R38A 1WAUA 4WOQA 3G3DA 2CBUA 1EP3A 4GUJA 2AKMA 3MBFA 1S2TA 3W7MA 1CIUA 1ZHAA 1CPUA 1IZJA 1XRSA 3M0HA 3UWWA 1K6AA 5KSWA 1XLGA 4UCFA 1SPQA 2IKIA 3Q65A 2EO7A 6XIMA 3PTMA 1GGOA 3QKZA 4WZHA 2V0TA 1UD2A 2WHLA 3HOJA 2FZ9A 2VO5A 1MXGA 2AKZA 1EC9A 1TQJA 1XCFA 1QR7A 2HEJA 4K3ZA 4LH8A 1XXXA 4Y8EA 2C15A 1IR1A 3FOKA 2DSVA 3BOFA 2Y85A 2WK2A 4GNJA 3DKJA 1S46A 3NIYA 5FCZA 4Y9MA 3WK0A 3K8KA 4Q4OA 3F4DA 2VX5A 4H6KA 4Z0SA 3TROA 3RYSA 3A9IA 2EQDA 3W26A 1CXFA 2WVSA 1WKYA 4E6MA 1V93A 3TDFA 3BCDA 1LT7A 3Q2DA 3PVFA 1DEDA 1PS9A 3MQTA 4DJFA 1K70A 1EGMA 2IS7A 4JOMA 2NVDA 2PD9A 4IL2A 2VELA 4V33A 1HIZA 5RUBA 1TUFA 2IQDA 3RITA 1JIBA 1JCMP 1TA3A 3PS7A 4O1EA 3MUAA 4KEUA 5M3WA 1RQEA 4B91A 5LNSA 2Y8VA 4JKMA 3TN5A 4QQ3A 4UB9A 5G4HC 3CM4A 3LYEA 1YQ2A 3ARRA 1I9CB 5PTDA 4ZFMA 1J01A 4A8NA 3AO0A 4MZYA 4Y96A 1V3IA 3AHVA 1OYCA 1CXLA 2J7DA 3GNDA 4ECLA 3SECA 4AISA 4DNMA 1K7FA 2VC6A 4RNIA 2ON3A 2FJKA 2GJXA 4CQBA 2Q8XA 1PTAA 4ZCWA 4AVNA 3CT2A 4W9TA 1GG0A 5ABFB 5LIYX 2BP1A 2P8BA 4N9BA 4UTTA 5BROA 1LUCB 2V3EA 4JCMA 2KZHA 4M6UA 1IEIA 4RLIA 3HF3A 4C90A 4PUUA 3N14A 1RLDA 1XCWA 3GE7A 1IEXA 3WF4A 4E2BA 1SZGA 4B5UA 2PUZA 1KBLA 5DMNA 2YCEA 2O4MA 4RE0A 1PZ2A 2NLIA 3S1GA 5K2ZA 3RU6A 4OUIA 4B5SA 1O5XA 4NJGA 4US5D 4HA3A 4JTAA 3SB0A 3CL7A 4ML9A 1DYSA 2OVLA 4TTUA 3N2BA 5KZDA 3PZTA 1ZPTA 2PRHA 1LLOA 3F5KA 1M01A 4HOWA 3B06A 4H6QA 5HWJA 3QH2A 1GWJA 1FCVA 1JD9A 4G6CA 3RPDA 1ONRA 3DESA 4HPNA 4PBFA 4XV0A 3W7NA 3GDBA 1OEPA 4IISA 4ICMA 4PTVA 1FHUA 3DUGA 1NARA 3VIMA 3VGEA 3UG8A 1FH7A 2XIBA 1XSKA 2J74A 1MSSA 4CN4A 5EB8A 3W02A 1RCOB 1JZ7A 4GIYA 2G5WA 4YXGA 4XKYB 2YYUA 2O7SA 2D24A 1VEOA 3M44A 2E5DA 4GK8A 2V3FA 2PWUA 2J7BA 1O4UA 2PDBA 4NL1A 2J7EA 3SN4A 5CXPA 3KTSA 1BRLA 3K8LA 2OXNA 4UTHA 4CEUC 3VKAA 3BK0A 5TD4A 3A64A 4GACA 3TX9A 1TTQA 4KCWA 1CXIA 3GX9A 2WSRA 4YIWA 4J9JA 3DG7A 4TMBA 2PTZA 3EDEA 2J25A 4OV4A 5AYBA 3P3BA 5LA2A 4L1XA 3O07A 4IM4A 4NX5A 1AODA 3NA8A 4W7VA 4R9XA 3T2OA 3NXLA 3NQAA 3QPYA 3GVWA 3EPNA 5D2VA 1VHCA 4MNLA 3MUIA 4D72A 3EKZA 2HNEA 3CH0A 2CCRA 2XGZA 1VQTA 3FHQA 3VIHA 5EU9A 3RLGA 4PH6A 1XIMA 3KCLA 5DQPA 2VMFA 2DSKA 4CQCA 4GWEA 4N2YA 3BJFA 4E3TA 4C6OA 3C2FA 4OTKA 1VEMA 5EKYA 3EXSA 1F9CA 3BDKA 3H7RA 2W6RA 2IPFA 3RCMA 2J6XA 3AISA 2F6KA 4IG2A 5BMWA 3LHTA 4BWLA 3U7VA 3HQ1A 3IAPA 1XDLA 1GVOA 2GUBA 3DC0A 1G01A 2WMKA 2XIMA 5B7ZA 3W7LA 4NAEA 4N0RA 1OYAA 3W71A 4E2OA 3T0DA 3HGSA 1TVNA 2A6LA 3W6MA 4U10A 1DE5A 1W9PA 3SGGA 2L5HA 3IUHA 1I4NA 1MQRA 1IR2A 1ZAIA 4H19A 3O0FA 4NXSA 1PTDA 3UYCA 2R9RA 1UROA 2ZZ7A 3GNOA 2W63A 4N42A 1DHKA 3AMKA 2DZWA 3UNDA 3PWAA 1WBJA 1MZHA 4BJHA 4B5VA 3IJLA 3AIRA 1G67A 2EG8A 4JIHA 3UXAA 2JQXA 1ITXA 1QK2A 3B05A 1ZALA 1RSCA 3M1ZA 3G2GA 1JG9A 4LT9A 5JXQA 2VP8A 4FNSA 4C6DA 1EO5A 1RY8A 1GYLA 5LNWA 4JFUA 4UFJA 3BANA 3L2IA 4AY8A 2OEJA 2ZKMX 4U33A 4NZCA 1JPMA 4FF5A 4ZO9A 3EA3A 1PDZA 1QNPA 5REQB 4C6EA 2A1YA 1HW6A 4JR5A 1EDQA 1S1RA 2VEIA 4AZBA 1BGAA 3VD5A 5CPMA 1GONA 4K38A 4F0SA 1ZL1A 1VAHA 3KAOA 1SSGA 2ODOA 4AZ7A 4CKQA 1IYXA 2EPMX 3TXVA 1M7PA 3UA4A 3CLMA 2QUNA 1BF6A 4G2DA 3I7QA 5BXRA 2J9YA 3OTRA 3BAKA 3VIOA 3GNXA 1ZLPA 3UCDA 2CKRA 3CIVA 2G3NA 4E2VA 4HK7A 3W82A 1PKLA 3PAJA 3R8RA 2Z1VA 1HGWA 3CH9A 4ATLA 1PWLA 2GUUA 1TJ2A 1EJVC 4PA8A 3SCQA 3R0DA 1H41A 2DIEA 3EWWA 1KM4A 1LOQA 2ZRXA 2YLAA 4ADSA 2IKHA 4ORMA 4PBGA 2YFOA 4ZQCA 2IPWA 2IQTA 1SW7A 4M56A 2OR2A 4B90A 4U28A 1TX0A 2QEZA 1SR0A 4AHQA 3PBYA 3GXPA 5DBUA 3G0UA 3DECA 1E6ZA 1H3GA 3SUWA 5IHRA 3C4UA 4DYJA 3GTXA 1EXPA 1Z44A 3SCTA 1D3HA 3UZWA 1B9BA 3TW7A 5JU6A 1FFQA 1VCFA 1W37A 1J6OA 3HBLA 1HL8A 3B9OA 7PTDA 2R1LA 4JNZA 4DX3A 2G97A 5AHIA 1I2RA 2ZZ5A 3VMPA 2FPTA 1H62A 3IJIA 4LBSA 3GQYA 3BGAA 4S3AA 4C6NA 3DXIA 3I3DA 1EFZA 2FTYA 2DIKA 4AAJA 4J3TA 3CASA 4AUBA 3BLPX 1MW0A 2AAMA 5K4XA 1OX4B 5HMFA 3U7BA 5HDRA 3C86A 4J27A 1S3HA 3W7IA 3AC0A 1XH1A 1M65A 4CNTA 3RX3A 3JS3A 3W4RA 4AMAA 2AAAA 3PUEA 2QV5A 4J3ZA 1XSIA 2ZTKA 4GVHA 4WLCA 5I23A 2YLLA 4TV6A 1ODZA 5DBTA 4GXMA 2ZE3A 3UWUA 3QMTA 5AHEA 3G1YA 5HOSA 5E0KA 3F1QA 1YDNA 3QM3A 2WVUA 4C7DA 1W1B1 2QR6A 3F2BA 2VOTA 3QV9A 2QKFA 3MHGA 3TYEA 3PB0A 1H1ZA 3FYPA 4LB4A 5E5CA 3QY6A 5BOEA 5GJMA 1DL3A 5CH9A 4S3BA 3UXKA 4MAZA 3MKVA 3TUUA 4Q7BA 2P3EA 5F4WA 3RRXA 4JTKA 3MYOA 2A2IA 4Z1DA 1AW2A 2C14A 2XFWA 2G3MA 4X2RA 3VKKA 2J24A 4PMDA 3W1AA 1OSEA 1M7JA 4IFOA 4WUIA 3GVRA 3EDKA 5FESA 3D5HA 3A22A 1X1ZA 1LF1A 1E51A 1P0NA 4LWWA 1EIXA 4YVPA 1YDYA 2V81A 3T09A 5EGRA 3TTYA 5HR7A 2X8RA 1QI3A 1QT1A 3ATYA 3ITLA 1TV5A 4ML4A 3NL2A 1X1OA 1OIFA 2J79A 1Q6FA 5I6SA 4UR9A 1JDFA 3HO8A 3CL8A 3F4VA 5TIMA 4Z2KA 4L9ZA 3MP5A 4H1ZA 1XLJA 4ZR8A 2PD5A 1ZJHA 5AECA 1A50A 1RALA 2FMOA 3IRSA 3BURA 4JL2A 3WLPA 4U31A 2WZHA 1CNVA 4XAZA 2B7NA 5AHNA 2ISVA 1RV8A 2F8QA 3LRMA 3W70A 4H8HA 4YVXA 2XZ7A 5A3HA 2XN2A 1R6WA 2YZRA 1EOKA 2FGLA 1CGWA 3AIBA 3JW7A 4PMZA 1EYWA 2NZLA 4AHPA 4JTJA 1UR1A 4JY9A 1YE6A 4O0ZA 1B9ZA 1K77A 4HNVA 2VENA 1JD7A 4Q4MA 4IGNA 4QP0A 5D33A 5G5IA 4D6GA 3BV7A 1NDVA 2RDXA 2DIJA 1XW8A 1BAGA 2VQUA 3WQWA 3A47A 4Q3MA 4AIUA 3CAWA 1HL9A 1TTPA 3LRKA 2HBVA 4MKNA 4PMNA 1POJA 3SSJA 4UTWC 1FQ0A 2GJLA 4PFMA 4RK8A 1DQUA 3IVTA 1JCXA 3E2SA 1E55A 2BXYA 4M5PA 3M07A 2IW0A 3SZ8A 4W84A 1O94A 4R85A 3MSDA 3TAOA 4HQVA 1R3VA 2F6XA 2R1PA 4GG9A 4EPKA 1U5HA 4WSHA 3FK4A 2PFHA 4NQ1A 1NSJA 4UQDA 1VBUA 2BSLA 5EL1A 3RIKA 3PFMA 4LXFA 5AC5A 4LBRA 1FHVA 2V5JA 4DJDC 5BRPA 2J4GA 3A3WA 3VKCA 3E0IA 4MJMA 4O19A 3NM1A 1GPWA 5A95A 2CBVA 2YL8A 4E4FA 4M7TA 3IGXA 1SYTA 4L4LA 1SO6A 5CLTA 2J75A 4LALA 3SCPA 4LU0A 3VZXA 4FO4A 2W66A 5CJMA 1GHRA 4GQRA 3K8MA 3EDDA 3SY5A 2QUUA 1TJ0A 1GOXA 2J8FA 3T81A 4E3VA 3QW4B 3LQGA 4Z1BA 4AW7A 4PRWA 2ZX9A 1E5NA 2HSAA 4C91A 2ALRA 6XIAA 3NGFA 5M2FX 2ZDSA 1XFBA 3U0HA 1KR1A 2DUXA 1EGVA 5B80A 4RDVA 1HJVA 2PGRA 3CUZA 3PM6A 1XC4A 5J5RA 2GWGA 4TO8A 1EJTC 4OZOA 1I0BA 4IHCA 3N17A 5F2LA 1Z3NA 4U3AA 4QQUA 2VNCA 2WVVB 5JH2A 2V30A 3WQFA 1Q6GA 2X41A 2CZEA 1H7PA 3CZ8A 2JF7A 4CN1A 3KOXA 1ICQA 3P0WA 3ZIZA 5F2GA 3GIPA 1RD5A 4MF4A 4GQ0A 1EX1A 2QNEA 3A13A 4Q8MA 1XYLA 1TQXA 3C56A 1YIXA 4Q7NA 2Z2AA 1A5BA 1M68A 1XLKA 6TIMA 4AHOA 1UZDA 1W91A 3H8AA 4WR3A 4F0RA 3DX5A 1AVAA 4O8RA 1FBAA 3T07A 4E8GA 4RPQA 4LC8A 2CETA 2OG9A 2OX1A 2OYMA 5HULA 5JBEA 3PFRA 5H8UA 1T6MA 3TSMA 1BLIA 3SSZA 5D09A 3GHTA 1ZY9A 5BRBA 1XICA 4HZ8A 2VGIA 4P7LA 4Y9AA 4JTFA 3DDMA 3SRKA 3QF0A 4ZSUA 1ZFJA 5I3KA 4KQNA 4A8LA 4OT7A 1GHSA 3OOQA 2AGKA 4L80A 2RH9A 4G7EB 1ODUA 4MWAE 1R30A 3IJ9A 4AIBA 4AF0B 2VR5A 2NVAA 5F2MA 2A85A 5A2CA 1Q6DA 5G4WA 4A05A 2EBNA 2FGZA 4TMCA 2XVNA 3WUBA 4Y90A 1BG9A 4KS0A 1BTCA 2EXOA 3AYVA 3W27A 1YXCA 4WX2A 5D05A 3L65A 3LV6A 3F4NA 4X63A 3UZZA 3JVAA 1L6SA 2PBGA 4KFNA 3NNTA 3VKBA 4UC5A 4MKSA 4B2DA 3GXFA 3FXGA 3MUZ1 4W8AA 4EAMA 1VENA 4IJBA 1T8XA 3CO4A 3VILA 3FKKA 2OZ3A 3CZEA 3WG6A 2QGYA 4Q33A 3CL6A 4DWDA 5D02A 5D2WA 1F8MA 4JQ4A 4KGJA 2G3JA 3CS2A 3VOCA 2QMKA 3ABXA 3GAKA 4I7WA 1PX4A 4Y8FA 3LPOA 4I9MA 1W31A 2RKXA 5DCEA 3HZ3A 4FOKA 1VB9A 3ARXA 4PL1A 1GJUA 2XVLA 4N9DA 3S46A 4XZ9A 1UIOA 3C8FA 1IGSA 4UTKA 3S2JA 1VJZA 1MDLA 4LAMA 1JULA 2Q3RA 2NQJA 2TYSA 5ABEA 3LCHA 3MSGA 3IIZA 5KZ6A 4Q4RA 1JL8A 1Y5XA 3RM4A 1HVQA 5AHLA 3G1VA 4PN2A 5D30A 1SM9A 1BXBA 1HP5A 3TMLA 3DFYA 5AYZA 5E6YA 5JMUA 1WZAA 1XLBA 2HPMA 2HBXA 1ME7A 4R88A 4HNTA 2V6AA 3PZGA 5I3FA 1W8SA 1WNOA 2WMIA 5D9NA 4EXBA 3WZ0E 5ABTA 4BFAA 3PZQA 4GMEA 5CLWA 2XINA 1UP0A 4EWJA 2ZX6A 1LRQA 2VR2A 2MNRA 4NAEB 3GRIA 1BVZA 1SW0A 2ZXAA 2I57A 3V18A 2D20A 5GJPA 1OFPA 3F03K 4RXFA 2PEVA 1ZUAX 3KE0A 2CLHA 3ARQA 3A3XA 3EA2A 4HSHA 2V3GA 3EB2A 4AMCA 3NO5A 2XGBA 4IX0A 5E1QA 1EEPA 2V82A 1BSLA 4C1LA 3WLKX 4PMVA 1J0JA 1VPQA 4CNUA 5FD0A 4C60A 2GGHA 1BPLB 3Q45A 1BVWA 3TWAA 4GBUA 5HWNA 1J0ZA 3H2EA 3LNPA 1FRBA 1J8VA 3UWYA 1KRCC 4I8YA 2NX9A 1KM2A 3PUGA 5C9XA 4IQLA 2UY4A 3HGJA 3QHOA 3VNKA 1ZS2A 3EMZA 3FYYA 3FW6A 3H7UA 1EF2A 4UTUA 1E9LA 3S8HA 3L5AA 4UIOA 5FEXA 2C71A 5T91A 4Z2HA 3CJPA 2QIIA 3H12A 4Q4QA 3WH5A 2PDYA 1V02A 1JUKA 4CLMA 2OOFA 4Y9OA 5C6MA 4XO7A 4HU3A 1A5OC 4DUXA 1K8CA 3S2NA 3WLQA 1YLVA 2OYKA 2GJRA 4URIA 3W1XA 3IJ7A 3IV8A 1PHWA 2W5FA 3ABQA 4X3ZA 4UTIA 4FIQA 5D37A 1UZ1A 2C19A 2VDGA 1JPKA 2CZDA 3HGRA 1BWVA 1ZJIA 4XUGA 5M17A 5CAKA 2DZAA 3W88A 1WDQA 4BQ3A 4KCTA 4B5TA 3LBCA 3LHYA 2WJFA 5F1UA 4O11A 4AZHA 3CTLA 2QJNA 3UEQA 1CT5A 4EIVA 3W7DA 3RM9A 1XYMA 4JBRA 5HA7A 3INPA 1LL6A 2GQ9A 4UQ9A 1CGYA 1XL9A 5BXPA 3VDBA 3AOFA 2E6AA 3FDKA 3VNZA 1D8CA 1VJSA 1A3XA 4AY7A 1ISXA 1HN1A 3VX1A 3W7CA 1NOWA 3PJTA 2FH6A 5AZ0A 3UPWA 1QPOA 2FFIA 1XP3A 4GVGA 1PV8A 1RCQA 1Q6EA 3FLUA 3I65A 1YRRA 2X1UA 4FHAA 2O0TA 1JVNA 2D23A 1BGGA 4X9YA 4TOQA 1B4KA 3AFBA 3MDWA 3VOHA 4LAZA 1G69A 3M0XA 4PMUA 3GDRA 1OG6A 1UA3A 3M64A 2QCMA 3QMRA 3W0KA 3F4CA 3RRAA 2VEMA 4XAGA 4HZMA 4AZCA 2R94A 1JZ8A 1E4LA 5HNRA 1NFBA 2EAWA 4AF0A 5CSRA 4ZXLA 1GYMA 4DUOA 1KM5A 1M04A 2IXUA 3MV01 4BA0A 5I3DA 1E6QM 4QS5A 4DBEA 1I8JA 3N2XA 1EJWC 3MTWA 2F2HA 2XFRA 3EOUA 1B2YA 1UH3A 3DFNA 4JEJA 4ZO8A 3TJLA 1RJPA 4G56A 1V8EA 4J1OA 1EBGA 1WX0A 1UW9A 4ZE4A 3NQBA 2RDUA 1EO7A 1HXJA 3NQDA 3T55A 4QM1A 1EJRC 1D7KA 3SIZA 4DB7A 4UTTC 1UPPA 3C2EA 4IPPA 3G1FA 4H3DA 4IPNB 1AQ0A 1H7NA 1OFDA 2Z24A 1OG0A 1PBGA 3FIGA 4DWSB 1GVFA 3L23A 4D6IA 1KQZA 3SY1A 5KTLA 4XSLA 1PSCA 4NUWA 4GGHA 4U5KA 5EYWA 3WK3A 4WDXA 2VD8A 1QNSA 1P0BA 4IOTA 1Q7ZA 4RR4A 1E15A 1RH9A 1DJHA 1GOQA 3IJDA 3COTA 1B31A 5L9FA 1JDAA 2XZ9A 2OZTA 4G1KA 3OA3A 5H91A 1B3YA 3NVDA 4JN6A 4NRSA 2VCCA 4Y9PA 1NIUA 4DUWA 4I5RA 5IM51 1X8FA 3LZ3A 3MUXA 1F4AA 4TIMA 3PWIA 4K68A 2XH4A 1DHPA 5CEWA 4XQ6A 4TVDA 5HQEA 1SJBA 4IP4A 3ZQ9A 3UY8A 3VA8A 1T40A 1LOLA 1IT0A 3NZGA 4IMGA 2WBKA 1G1YA 4FNTA 2XFFA 3SM0A 4G1NA 3ZMRA 3H2NA 1DWAM 3AWNA 2E5CA 1WYIA 1XLDA 2WM0A 3CIXA 3W7GA 3LS9A 2CLEA 3CUFA 3WSUA 1F6PA 5BCAA 4ORIA 3QC3A 1UBPC 3PBVA 4LV9A 1KWKA 3U2EA 4C6JA 3RCYA 3LNMA 4P8VA 2JGYA 4HA0A 4ZOEA 1JDEA 2J8TA 3TP4A 1HT6A 3M5YA 4IIFA 1Q6LA 4AD5A 3MMWA 5DMLA 1H7XA 3CEUA 4YN5A 1DBTA 4PBEA 4YWSA 5E0CA 3FNDA 4LRTA 3BOLA 1Q45A 5DANA 4GVIA 1X6NA 3UF9A 3W1TA 4ZEPA 1IXPA 3G0XA 3PSWA 2OU4A 3N2MA 2E9LA 3SADA 3NDOA 4FR6A 3I3BA 4AVOA 4A22A 1J18A 3FEQA 3K1GA 5D9PA 1TV4A 3GW0A 3W53A 4MSSA 2Y5EA 4QLLA 1VBJA 4QJ4B 4G9PA 4IFKA 3S1UA 4GI4A 3QHNA 3QR0A 4CNPA 3OODA 3KOZA 1VHNA 2ATSA 2R1MA 5A6SA 1XLIA 2WQPA 3S5NA 4DY1A 3OBEA 2X30A 3CAQA 3VDAA 2C91A 2QDDA 4NI8A 2OOGA 3FV9A 4HPXA 1OFQA 3VNIA 1N2VA 4AIEA 1XYZA 3HV8A 4B2DD 2ZE0A 1G94A 3DAQA 4FB7A 1W1ZA 3BTNA 2J9XA 2QT3A 3LPPA 5HUOA 3FGCB 1B5TA 4JYDA 3PBMA 3W7EA 2BB0A 1EUAA 4E5TA 4F9DA 3WLLA 2ZQ0A 3C61A 3W25A 1UMLA 1BD0A 1YX1A 3WK1A 3VAVA 1VCVA 1P43A 4LUIA 2F84A 4DZAA 1C8XA 5ABHA 3MC5A 4DO7A 4JX5A 3MUCA 3SCUA 1S5WA 1IWAA 2NSXA 3R7MA 2W3ZA 2YIHA 1BRLB 1OY0A 5A5WA 2X16A 3F5JA 3E3HA 2NX3A 3R12A 4QLJA 3P62A 3EWDA 2OLAA 1X7FA 2BV9A 1JI1A 1REQA 1Z6KA 1EQCA 1ZNNA 1J2WA 3P7YA 5IXEA 3S4TA 3MHFA 3B0XA 4Z2LA 3CQIA 4GUFA 4GZIA 4QX4A 1EIBA 1ZTVA 3APYA 3EMQA 3PZOA 1YPXA 3AU6A 4GH3A 4H4IA 2YSWA 2Z29A 4EF9A 1BYCA 1HZYA 1QBAA 3B0VC 1MFVA 1QOPA 1VLWA 2C3ZA 4ERGA 4Z2GA 1TV2A 1KXVA 4ZB2A 3VD7A 1MVYA 1JXKA 4JTTA 2BBFA 2FFCA 3ITCA 3VIIA 2P0OA 3W1MA 4NXKA 3GXIA 2O4QA 3WCZA 3O1NA 5LXEA 1WA3A 2AL2B 5D8ZA 3KRUA 4ZVJA 4L5ZA 4B9ZA 2Z26A 1GNXA 1GKPA 4RE3A 3VKJA 1VFMA 2CLKA 1SFTA 1E0VA 3ELFA 4H6EA 3EDFA 4UBPC 3MB9A 1KXHA 1KFBA 4MNJA 1YMYA 4RJEA 3FDGA 4AD3A 3ZR6A 3TLQA 1LRNA 3HV9A 3M43A 2DVUA 4X61A 2EKCA 1RPXA 4UCGA 3HU7A 2QPUA 3W7RA 3W6YA 1HL2A 3ONBA 1XHGA 4XTIA 1HTIA 3PZMA 1A0EA 2VDIA 3NEHA 2CBIA 2HRWA 2NQZA 3OIXA 2YXOA 1Y7VA 1J4EA 1LL7A 4CGTA 1UYQA 1XLHA 4AY1A 3HFYA 1P7TA 1S2CA 3U57A 4JTHA 3AAMA 3MT1A 1L0PA 2FZBA 3KVMA 2PC4A 1VFHA 1UZHA 3TONA 3TW9A 3WDHA 2ZX5A 4FK9A 3AS2A 5IHSA 3EX4A 2E7FA 2XISA 5FF0A 1FXPA 1V0KA 4LUTB 1GTHA 3EAUA 3A12A 3II1A 1FWHC 3W76A 1ZJAA 2BFGA 4QDWA 1ZAJA 1FUYA 3WDJA 3RLHA 1DPMA 2FDSA 3IJ8A 3CV1A 4P5UA 3KTCA 4HVXA 4HK5A 3AHTA 5LIKX 3WJWA 3B3DA 2WC7A 3ID7A 2FH8A 3O16A 4MLRA 4JGDA 3VIJA 4LNCA 5A8NA 3DCPA 3O3RA 1XGDA 3W86A 1OWQA 2V63A 5C71A 2CEQA 1IZCA 2R91A 1XG3A 1R9XA 1M1BA 2NXIA 1FWNA 3MI2A 3DG6A 3H53A 4DXXA 3MZNA 4RL3A 4ZQRA 3ITGA 1JZ5A 1H0GA 1FOBA 5DCBA 3KBJA 3CUGA 4BI5A 1CLKA 2WCAA 3SO7A 2ZXDA 4O0QA 3GXDA 4WIWA 3ARPA 4GH1A 4GINA 4K8EA 4JQAA 1H51A 4HJWA 3QTPA 4D2JA 3FJNA 3THCA 5MHBA 4AZ6A 3WNMA 2ZUMA 3OBAA 3IACA 1R86A 5FJUA 1I2QA 1BQCA 3A3HA 1KM0A 2VVNA 3EBVA 1MEHA 4PRRA 1ECQA 1CX9A 4UFIA 1TTJA 1KB3A 2O9OA 1OF8A 5I03A 4UNLA 2X1IA 5LA0A 4LEQA 1ITUA 1KR0A 4S3FA 3AWOA 3UCQA 3MCMA 4AQLA 2QLYA 4NG3A 1TPB1 4QE5A 2VL4A 4GC4A 3H54A 1QVBA 1W9VA 3VD4A 2NWSA 4W87A 1R7OA 5KMYA 1J12A 2ZADA 1NEYA 4M51A 1W9UA 2CW6A 4OBTA 2HE8A 1ZAHA 1B3VA 2VX7A 2WHJA 3TXZA 4TR9A 2ZA3A 4FLRA 3LBOA 3GTFA 2PP3A 3PZUA 3LCGA 4LC6A 3IUIA 1NWSA 1GOWA 3CIWA 4N9EA 3RGTA 4BI6A 2QCDB 1UB3A 4MFEA 1UH4A 1OADA 4ALDA 3W37A 2QIWA 5E09A 2A5HA 2V2DA 3M7SA 1NOFA 3QQ1A 3MY9A 1EP2A 4AZIA 3V1PA 4KEVA 3E0VA 2YW3A 3GNNA 3VMOA 4MJ4A 2HMCA 4GZ7A 3GBDA 3RMEA 4N6FA 2XGIA 4K36A 1RBLA 4WKAA 1ZENA 4H7CA 1Q6OA 1E3XA 4MWAB 4K37A 3ES7A 1UP2A 3KM8A 3WBWA 3TU9A 3LM7A 1QUMA 3WH7A 3URBA 4DPQA 2W67A 1V02E 3R5EA 2PGFA 3K4AA 1FKWA 5AB3A 1GT8A 6A3HA 2H6RA 3VFLA 4PEKA 3FHAA 5BNKA 3ZO9A 4NASA 3MWAA 3VE9A 4XZLX 4ZO7A 3KBNA 5DLCA 3VIFA 3EPMA 5LIUX 3SBFA 3AYSA 3H6OA 1TFVA 1GG1A 1A5CA 5CZSA 1C9DA 3OVQA 5H1WA 4P7OA 2VVSA 3CZGA 4WD0A 2C1IA 3QV8A 2E67A 2EG7A 2PP0A 1SZRA 2EPOA 3FCPA 1E71M 1MW1A 1KBKA 4LYPA 4H9VA 1XSJA 2PZNA 2ISWA 5HJYA 2VQTA 1NELA 4DBUA 4DBDA 3P6LA 2QS8A 2ZX8A 4FXFA 2HTMA 3ZOAA 2E1WA 1VLIA 1VIZA 3RHGA 4L1GA 3FSUA 4F2BA 4WGXA 2GUYA 4HA1A 3M5VA 4K39A 3N12A 5FJRA 1H7RA 1XBYA 1VR6A 1O5KA 3R94A 3BJSA 4F4RA 1OD8A 1EBHA 2BVDA 3IWPA 2E8ZA 3ENLA 3CQKA 1W1VA 4ZB0A 3TQVA 3GAYA 3WD1A 4L65A 2Y5SA 2GFTA 4FIRA 1YXYA 4M1RA 1R2TA 2DGAA 3WJXA 4ILSA 2ISDA 1T0OA 3N2TA 3E96A 2OGJA 4NX0A 5DELA 3NL3A 4MZ1A 3NOEA 2HDJA 4WXZA 2WNWA 3WLOA 3ARSA 4DZ5A 2AGTA 1SJAA 3CQ0A 3TCEA 5CZJA 4EOUA 5AFDA 1AH0A 3UXDA 1SUXA 4S3JA 3IGHX 3V4BA 1FVPA 2J9ZA 4HNUA 3R8GA 3IAQA 2F38A 4NU7A 4CU8A 3SRFA 1M03A 4TX6A 1V0MA 3ATZA 5LKYA 2X0SA 4JIRA 3S42A 4PTMA 1J11A 5DMMA 2GSJA 3W1NA 3R0UA 1G7UA 1R3WA 3EWCA 2CESA 2WCGA 4J2PA 4OUEA 4RNHA 4ZXOA 1UR3M 3VD3A 4XZNX 4JIPA 1Z42A 1EZWA 3L66A 1J0HA 2DY3A 4DWSA 4XVDA 4Z0JA 1WKFA 1TZ7A 2QCNA 3IIOA 3UJRA 3L2LA 2DQWA 1O68A 1YADA 1OGGA 2FQIA 3LCFA 1GPFA 3ARWA 1F3XA 2YCKX 3TA6A 5I00A 1FKXA 4NNBA 1XPYA 1MYRA 4M1BA 2HZGA 5FAJA 2DH3A 3LCWA 6REQB 2YFNA 3DZ1A 5CG0A 3GG7A 2GGJA 5C9ZA 2PC8A 4CQ9A 2PAJA 2OODA 1MO0A 1GW9A 2EG6A 3VNLA 4HPJA 3SUSA 1GOKA 1EL3A 3LCIA 3NVTA 3WD4A 4TX8A 1RBOB 3UR5A 4XUYA 1OD0A 2Z7KA 4MWAD 2VRQA 3LTPA 3LPGA 2A3BA 1QK0A 1W3HA 1A0DA 2VR4A 5LGXA 3N9KA 1AH4A 1TJRA 3K46A 2CITA 5DO8A 3UJ2A 2CNCA 3TJXA 4GCAA 2NWRA 3KBVA 1PX8A 1Z7AA 4PC8A 3W83A 5AC8A 5IFPA 4CVWA 2LLEA 4AYSA 4K2SA 3T0CA 3PANA 1QHZA 4D6DA 4Z17A 1EWEA 3H2OA 4YLWA 4OFCA 3VIGA 5G1MA 1HGYA 2HK0A 5CPNA 1I45A 1MEIA 2D69A 1IWPA 3N2CA 3UW6A 5E70A 1WDRA 3DC8A 4JPGA 3UP8A 3H26A 3RG6A 3RJYA 1YNYA 1E4MM 4ZQOA 4UQEA 4CD5A 1YPIA 5HNTA 3V3WA 1XH0A 4XWUA 4A21A 1SR9A 2WPGA 3KRSA 4P2VA 2WWDA 1GW1A 3B9EA 2NUWA 2FGBA 2H8XA 1Z69A 3DYPA 1UKOA 1H7OA 1AZ2A 3BSHA 4I7UA 4A4AA 2X1SA 4PMJA 2E09A 1TCMA 1R9YA 4F9JA 2GSHA 3WBYA 4F3HA 3NTYA 5HMSA 3N15A 4JNYA 3V36A 4F8XA 4BF7A 2VURA 3WLMA 2HVOA 4I6VA 2Y61A 3LN3A 3W7JA 1JF5A 4PCFA 1SO3A 4IH3A 4S38A 3W2LA 1EHAA 2W61A 5SWUA 4FNPA 4ZFCA 1F5ZA 3THDA 1FWIC 1RLCL 2EGZA 1H60A 2BOFX 1V3JA 3PULA 2G8ZA 2QJHA 3ISIX 1QATA 4MWAC 2I16A 4CCCA 4AWSA 1JFHA 3S6TA 2OSWA 2VKZG 3VOJA 1Q8AA 3M6YA 4HU0A 1K02A 1WXZA 4E2DA 2G95A 2E77A 4MDPA 4EK7A 5I09A 1K8ZA 3U5YA 3SIMA 2O92A 1ME8A 2BHYA 3KCJA 1NQ6A 2V69A 3TJIA 3QW3A 3AUOA 2VX4A 3H2CA 1S5TA 2RJHA 5I78A 2ZRYA 3CC1A 3BWWA 1R2RA 2PF8A 4M82A 4KPLA 2ZOXA 1BXNA 1HKJA 1QTWA 3STCA 2E6DA 3SEPA 5M5DA 4R34A 1U1JA 1CB7B 5DEZA 4NF7A 2REQA 4JFTA 1BVNP 1KM3A 3PZIA 2DORA 4UTLA 4WK9A 3BLDA 1WO2A 4FZIA 1QO5A 1W5MA 2BVYA 5TF0A 3WN6A 4QJ1A 3AYTA 4N4QA 2FPYA 3KX6A 4GVFA 3U2OA 3GZAA 1WPCA 2VCBA 3WQGA 3VIKA 4IGMA 2FZDA 1OK6A 4PMQA 3DG3A 2GK1A 4BF5A 5KINA 1ISYA 4V15A 1UD5A 3VNYA 4ATWA 3O0KA 4QGCA 3WH6A 1Q4WA 3GBEA 5AYIA 5CAHA 4DYEA 1E40A 3ICJA 4JTCA 4RX0A 5A6BA 1XBZA 4LY8A 3LM3A 4RXGA 1PIGA 2W92A 4IMCA 3E12A 4GE8A 3UQNA 4DBWA 4DNHA 3QSRA 1SFLA 3HFTA 5A6KA 2PDPA 3DYMA 5CG7A 3IVUA 2WZMA 3UPMA 2VFHA 1FH9A 3RDKA 3WF3A 3HM7A 4GY1A 1ONEA 4JIQA 1W1A1 3S6DA 3QZEA 2ZWZA 1UASA 1FTXA 3NSMA 1KKOA 1EA9C 2Q01A 1TMHA 2V5CA 4F40A 2XSXA 4PCPA 4V27A 4XKYA 2ZUVA 3VCNA 3DGRA 2QV4A 7REQA 3U8GA 4DWSC 4EWND 1GVQA 3A23A 4GNKB 4NSBA 3MU7A 4V1XA 3TQKA 3T08A 2OTDA 1F8IA 4IGHA 4C1KA 1XIFA 7CGTA 2XVPA 3E0WA 2CLMA 1KFEA 2VI0A 3WFAA 2QAFA 4QFUA 1NOUA 3EX2A 2WCSA 1XUZA 4W5ZA 4R33A 5EFDA 3N73A 1G6CA 1OIMA 4O13A 4FX8A 3VI2A 4K1WA 4PCSA 5AC4A 1EJSC 3M0KA 3KS6A 1W3NA 2C18A 4E38A 1PIFA 2D0HA 4W7WA 1WUEA 1XD1A 4EACA 5I07A 1K9DA 3WY1A 4B5WA 2ANUA 5DY2A 3SCRA 3A21A 2VEPA 3ONCA 3C3NA 3S2MA 3B8WA 5DT7A 4MB1A 1OX4A 5HPOA 3GTIA 4GISA 3OLDA 4Q4PA 1KLYA 3WQ8A 4ZL1A 4GUIA 3WDPP 4EPBC 4GY7A 5IBXA 2XJ7A 4XZBA 5E9XA 1GJWA 1QOQA 4YHEA 1O1ZA 2WXDM 4FPSA 2GJXB 4UFLA 3WFZA 2G0WA 1IE7C 3WF2A 3RO8A 2EPNA 2TSYA 3LSBA 1L2QA 2OLSA 4MAVA 4Z2JA 1FDYA 4O1FA 5ECVA 1G4EA 5CSYA 4IQJA 2PRLA 3QY8A 4GKLA 5DFAA 3M16A 2OQLA 3CK5A 3IARA 4UXDA 1T5AA 2UY5A 1H4PA 4WXYA 3DFSA 1KCZA 4PFHA 1CYGA 1Q4NX 4RE2A 2DZUA 2XU2A 2BY0A 6REQA 1SO4A 5K3VA 3MBDA 3G1HA 4KFOA 5DY3A 4UMCA 2C7FA 3C2RA 4JDBA 5L6UA 3R8HA 2VRJA 4HHMA 2WKLA 3GNRA 4GI8A 4L4OA 1MDRA 1W3LA 4MFDA 3TYCA 4HOXA 1NWTA 5BOOA 3GDTA 3GKFA 1ISWA 1FCUA 2VGFA 2NT1A 4B3ZA 3BLKA 3CWOX 4HD5A 1EEXA 3B8UA 1UWUA 2YGYA 3B40A 5DRIA 1IXOA 2EJAA 3LU2A 1DIEA 1GTEA 4ASTA 4JHOA 2O9RA 5CQ1A 1JYNA 2GOUA 3CB8A 3HQPA 8CGTA 3U5UA 3SCWA 4HNLA 4CQDA 3WNOA 1EB3A 4MMWA 3UZYA 3WQVA 5D2XA 1KWGA 1CEOA 1TWIA 4QEEA 3AJXA 3ZR5A 1KQYA 1U33A 3NG3A 5REQA 2PCQA 3DHUA 1RP8A 4GGBA 2UZ9A 5LIXX 2XN1A 3UZJA 3H2AA 3O63A 1XINA 2PTYA 5C0QA 4BQ5A 3KL5A 1UA7A 1ELSA 2JFEX 3P84A 3QVQA 2BOGX 1AMKA 4PZVA 3SGUA 4DLFA 1ICPA 3WF0A 1CCWB 1D2KA 3MJYA 2B31A 2JF6A 5AHMA 4GI6A 4W4QA 5BW6A 2CBJA 2OYLA 1EDGA 4OE7A 2ICSA 1E72M 1VPXA 1SO5A 3C0LA 3TVAA 5CC7A 4MOZA 3LXBA 2UY3A 1AG1O 3CZJA 1IIGA 2YOCA 1DJZA 3PG9A 4JS3A 4P61A 3HPXA 3WFLA 2V68A 1B4EA 1XKJA 4S3KA 4QISA 2YCLB 3BGJA 3EX6A 4PRTA 2ACRA 4F0LA 1H5YA 2B7PA 3T9PA 5A8MA 3KLKA 3NPXA 1L8NA 2CXEA 1GUVA 4L6HA 3K30A 2WMHA 4WY0F 1Z48A 4B15A 1QRQA 1WZLA 2IKGA 3W28A 1DVJA 3M41A 5CPLA 3JUGA 4LOCA 1DJXA 1KBBA 3E5BA 4RUBA 4R3UA 1NFPA 5JH1A 2GK1B 1C90A 5C2CA 3CV6A 1A5LC 6ENLA 3CUHA 4WGHA 1SJDA 2WB5A 2VOMA 3KHDA 2PS2A 4KH2A 4ZMGA 2JK2A 4G5DA 3JZEA 2VZVA 6ALDA 3TN4A 1AH3A 1ZB5A 1GZ1A 3VD9A 3H2FA 1L6GA 2GOKA 1FHLA 4FOUA 3BE7A 3W6LA 3GVQA 3CHCA 1UKSA 1MZRA 2YDQA 2FZ8A 3VGBA 3VZZA 3CAKA 2CZVA 2GJPA 2VT0A 1GKRA 3NEVA 3Q37A 2AQVA 2UV8G 4FF7A 2GSEA 4AWEA 1M6JA 2PP1A 2FVLA 1MQQA 1S5VA 4HHLA 4W8BA 3NWRA 5EBAA 5G1YA 4I9AA 4DO5A 2FLIA 3N19B 3K4WA 3OHIA 2AOSA 2QCDA 1AQFA 5FJOA 1AK5A 4O15A 4W5UA 1DQWA 1JEZA 2HV5A 5E9AA 4YMZA 3WQ4A 2ZZ1A 4X22A 4IIEA 1I2NA 4E4UA 4N6EA 2E4TA 1Y8BA 3BG9A 3GDLA 1E9ZB 1OBAA 1DIOA 3TYZA 2G96A 1F6YA 1KM6A 2P3ZA 3OG2A 3H22A 2YDRA 3FX4A 1L6YA 4XK2A 1CXHA 1IEWA 3R6IA 3OZPA 2I5IA 4LBUA 1YNPA 3TAKA 3BPWA 4A3HA 2BLEA 1XLLA 4PCTA 2Y88A 5J5DA 2W0UA 1IEQA 5DXXA 1HJXA 5FEZA 1DWIM 3T05A 3CV2A 2ZVIA 4JQ3A 2Q71A 4PB4A 1OC7A 3A4WA 4HMDA 4JTGA 1C91A 3L0KA 1LG1A 1Z8AA 4DZHA 3L68A 5AC6A 1SVDA 4KRUA 3ERPA 3LD5A 4HMNA 4S3GA 2ZBTA 5GVJA 3TE9A 2QPXA 3LK6A 3WMLA 2CHOA 4J3UA 1GVSA 4I6KA 4B3LA 4MY1A 2QW5A 2XIIA 4IX2A 2PTXA 4IIDA 3VDGA 5H2ZA 1GOMA 5KZEA 4IWWA 1AQHA 4M7SA 1W5NA 2BMBA 1V3HA 3NFUA 4LGXA 1PEZA 3FVMA 1SMAA 1JZ4A 3O6DA 3URAA 3VUPA 1XPGA 1XS2A 4KKXA 3EWXA 1PKMA 1FH8A 3AALA 1P48A 1R7AA 2FHCA 4J3VA 2WSKA 4HB7A 1NVMA 4RNFA 1XLAA 2QJMA 2PGEA 3NQCA 5D9MA 3HG2A 2XTKA 1UJQA 5DXYA 3W84A 1U83A 1JR1A 2JBMA 1RCXB 3HIJA 4JQ1A 2W91A 1S5NA 3CUXA 3HPFA 3UESA 4XAYA 5D32A 1PYFA 3C3UA 2WNQA 3CHVA 4JEQA 4M6PA 2ZIDA 2VGGA 1PZ1A 3PTKA 4AEFA 2QYGA 4H6RA 4AXKA 3U4AA 1A47A 4N4PA 1WZKA 3GFXA 1RJQA 1XYFA 5CC6A 2ZRWA 1F05A 3EOLA 1S5MA 1HKMA 4WJXA 1O66A 3R1ZA 2QCCA 1W1IE 4YL2A 1DE6A 3W9ZA 4OVXA 3K13A 4UR8A 3WJYA 4IXHA 5U4NA 3NPUA 5KETA 2Y8UA 2A3EA 4H9MA 3VC6A 1HVXA 1BTMA 3R2GA 3C52A 3GU2A 1QPRA 3OQEA 3M0JA 4AXNA 1RBAA 3BQ5A 1EPVA 4I5XA 4C1NA 2YB1A 1RK5A 3HGOA 4MLJA 1MRQA 3ZZ1A 4QIUA 1LQ2A 5CSUA 1HX0A 1R46A 3MHUA 4N7QA 5JQ9A 3HQOA 4CU6A 1Y65A 2WJDA 1XLMA 3LCXA 1QI2A 5A8OA 4J3SA