4WDTA

17beta-hsd5 in complex with 2-nitro-5-(phenylsulfonyl)phenol
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdtA00
3EB4A 1XJBA 1K8CA 3B3DA 1PYFA 3UZXA 4YVXA 3DOPA 4FALA 5LIWX 3N2TA 3RX2A 3WBWA 2DUZA 1S1PA 1MI3A 4FA3A 4XAPA 3R7MA 4QR6A 4LB4A 4ASTA 4YS1A 3WBYA 4QX4A 4LAUA 4YU1A 2I17A 4LBRA 2F2KA 1XF0A 3R94A 4PMJA 3LEPA 1Z3NA 1RY0A 5HNTA 2FZ8A 1IHIA 4GCAA 2ALRA 2PDFA 4ZFCA 2BP1A 2IS7A 2F38A 4JIHA 4LBSA 1ADSA 2HVNA 5DANA 4LB3A 1ZGDA 1PZ0A 4WDXA 2PD9A 3R8GA 1SM9A 4FZIA 4Q7BA 4XZHA 1C9WA 3R8HA 1IEIA 4JQ3A 3G5EA 3CV7A 1YNQA 2IQDA 4XZIA 2FZBA 2HV5A 2PDCA 3BV7A 3RX4A 3GHUA 2J8TA 2ACQA 1QWKA 5LIYX 4GABA 4WDUA 1AZ1A 3LQGA 1ZUAX 2R9RA 5LIUX 5LIXX 4PUWA 3V35A 4PR4A 4WDWA 5C7HA 2PDJA 3ONBA 3VXGA 2IPFA 2IPWA 3R58A 4XZNX 1Z9AA 2IKGA 1S1RA 2FGBA 2PDXA 4H7CA 3DN5A 2NVDA 2PDGA 1Q5MA 3Q67A 3LN3A 5HNUA 4OTKA 2PD5A 3UZZA 2ACSA 4IJRA 3WG6A 4JTQA 3V0TA 2PDPA 4JTRA 4JQAA 2INZA 3MC5A 3ONCA 1AH3A 3FX4A 1Q13A 2BGQA 2PDBA 1ZQ5A 3P2VA 2I16A 2BGSA 3CAQA 2PDUA 3LNMA 2FVLA 4Q3MA 2PDKA 2HVOA 5M2FX 2PDIA 1EKOA 2IKJA 4XZMX 3G1RA 1Z8AA 2HE5A 1QRQA 1YE4A 4YVVA 4NKCA 1US0A 1MRQA 2FZ9A 4G5DA 2PDHA 5LIKX 5HA7A 5KETA 1PWMA 1UR3M 1PWLA 3M0IA 4WRHA 3T42A 2ACUA 4PRRA 3V0UA 3COTA 2PDNA 3CMFA 3M4HA 4H8NA 4GA8A 2PDYA 1A80A 1RALA 3CASA 1AH4A 3UP8A 4ICCX 4WEVX 2PDMA 3V0SA 4XVDA 4DBWA 3LBOA 3Q65A 3CAVA 3S3GA 4EXBA 4HBKA 3H7RA 3BURA 1MZRA 2DUXA 4WGHA 3BCJA 4XO7A 1VP5A 4GQGA 3H7UA 2NVCA 1Z89A 4F40A 2HE8A 3WBXA 2VDGA 2PDQA 3BUVA 3WCZA 3LENA 2A79A 4LAZA 1X98A 3N6QA 4JQ4A 4DBUA 2ACRA 2PDWA 4JTDA 3R43A 1LWIA 2IPGA 4XO6A 4PUUA 1AH0A 2IPJA 1XGDA 3O0KA 3QKZA 3KRBA 1S2CA 3U2CA 3UZYA 1AZ2A 2PZNA 4GQ0A 5JH2A 4JQ2A 3LZ5A 1R38A 2HDJA 3O3RA 1M9HA 4XVEA 2P5NA 3H4GA 4JIIX 2DV0A 4GIEA 4JIRA 1AFSA 3GHRA 2INEA 1X97A 4L1WA 2PFHA 3CV6A 4QBXA 5JH1A 4HMNA 1HW6A 1RY8A 1ZSXA 2PDLA 4XZLX 3UG8A 3FJNA 1HQTA 4AUBA 4DZ5A 2IKHA 2PEVA 4XK2A 1GVEA 1FRBA 1VBJA 3LD5A 1PZ1A 1T40A 2PF8A 3D3FA 2AGTA 3V36A 4IGSA 1JEZA 1S2AA 3GHTA 1EXBA 3GUGA 3LUTA 2IKIA 2CLPA 4WDTA 4QXIA 3R6IA 3ERPA 1X96A 4RPQA 3GHSA 2HEJA 5AZ0A 5AZ1A 3LQLA 1LQAA 1YNPA 4I5XA 4GACA 3UYIA 4JTAA 1T41A 3F7JA 3UZWA 4YVPA 3NTYA 2WZTA 2FZDA 4MHBA 3LZ3A 3MB9A 3UWEA 2C91A 3RX3A 4JTCA 4R9OA 2QXWA 2IQ0A 2ISFA 1YE6A 4IJCA 3EAUA 3UGRA 4JQ1A 3UFYA 3M64A 1EF3A 4L1XA 1EL3A 4FAMA 3C3UA 3EB3A 1J96A 2R24A 4PRTA 4EXAA 4DBSA 1OG6A 2WZMA
chains in the Genus database with same CATH superfamily
3CB8A 3PZ9A 1BVZA 1K9TA 3A3WA 2WAGA 5JMUA 3NVTA 2AAAA 4HOZA 2B31A 3N2BA 3U5YA 1XLDA 4M1BA 2YA0A 3KP0A 4ORIA 1E55A 3JZUA 2UY5A 5REQA 5BW6A 1PHWA 1DIDA 4F9DA 3W7CA 2WPBA 2GGEA 2E6AA 1H7OA 1WV2A 1ME9A 3UJ2A 4HGXA 5A6LA 1WA3A 5A69A 1EPXA 3A9IA 1YTEA 2ZWYA 1V0LA 3GKFA 4Y7EA 1B9BA 5AYIA 4E3VA 3G8EA 1NFPA 2OWXA 5I6SA 2WCGA 5DY2A 1ZGDA 4RE2A 8XIMA 4ROQA 2VCBA 3H8AA 1C9WA 2NXHA 1E6RA 3VKBA 2E5DA 5HOSA 3W2NA 3EDKA 3GD6A 1TCMA 2YPIA 1A5LC 3BV7A 2VEGA 4XTIA 4QCFA 1V3KA 3G18A 4UTHA 3VINA 2YA2A 3QSTA 4Y2WA 4OGZA 4FF7A 6XIMA 4CU8A 1VH7A 2IW0A 2CLOA 5D09A 2OEJA 5IDIA 2HROA 1E6ZA 3URQA 2V2CA 3E49A 3HQ1A 2R6OA 1EDGA 4EAYA 2DZPA 4WD0A 4BQ4A 2WHMA 1AUSL 1H49A 4J40A 5AYZA 5HWNA 4I90A 2GSJA 1EA0A 3P80A 3LN3A 5HNUA 4HD5A 5CLTA 1FBAA 1UPPA 1SPQA 4GC3A 3WD1A 4O14A 1RUSA 2CBJA 3KVLA 5FL1A 2W66A 2ZUNA 1V51A 1R3VA 1FTXA 3M5XA 2OPJA 4PUEA 3WH6A 2PDUA 1KM2A 3K13A 2WLZA 2RGLA 2O56A 3E0VA 5BOOA 3LXAA 5AKQA 2G41A 4E4FA 4Y90A 1V03A 1NARA 3PBMA 1LQ2A 3M0VA 1E51A 3SQMA 3CV1A 4B15A 3N29A 3RAOA 4GISA 4H9UA 1FH8A 4URIA 1NWTA 3LBMA 4DRSA 4C6NA 3EOUA 1MXSA 4JBRA 1KFBA 1N82A 3HQPA 3QC0A 4FLSA 3KVMA 2WJZA 2OEMA 4GD0A 1SJDA 1MXDA 1XG3A 4KIRA 3C52A 4DO4A 2QCLA 4GVFA 1PX4A 1MWOA 2NQ5A 2PWDA 4HNCA 4MZYA 3DGBA 1YYAA 2G3FA 3T2PA 3M0LA 4I5RA 1B3OA 1E56A 3QV6A 5FEXA 1OFOA 2E6DA 4C6PA 3LLXA 1TO3A 4QJ5B 3ZYZA 1Z48A 3R25A 2C8NA 1O95A 1ADOA 3PZIA 4XO7A 4NVTA 4J3XA 3PWGA 3W22A 2V5CA 3PNZA 4CQDA 4C6EA 2Z24A 1A53A 3N19B 4UTMA 1I2NA 1MW2A 3RRAA 4XBKA 4IMAA 2ZZ2A 3OG2A 5I00A 3ARYA 3ATZA 1TPDA 2YR1A 1BSLA 5KZDA 1GJWA 1SSGA 1FWTA 1L6YA 4JQ4A 3UG3A 3B9AA 2OX4A 3IJ9A 2WC4A 4ZMGA 4NUWA 4XD6A 1DJWA 2Z2UA 1LF1A 3KL3A 3W01A 3TYBA 4PMZA 4PSPA 3ABQA 5KMYA 3EPMA 3RXZA 5CZTA 2CERA 2D0GA 2TAAA 2X09A 3CM4A 4BKNA 4GX9A 1J0HA 4WOQA 3C2FA 3VNZA 3H24A 4LYRA 3FY1A 3VIHA 1L0PA 1VEOA 1P1XA 1KBBA 5LKYA 1REQA 4A3UA 2QPSA 5A3HA 1OM0A 3UG8A 2BVYA 1Q2RA 2D2JA 2PURA 3WD0A 3H2FA 3GRIA 1AVAA 4UBPC 2Y8KA 1PTAA 2V63A 1GJPA 2DIEA 5I2UA 1FY6A 1A4MA 4HA3A 4AG0A 5REQB 3T55A 3QGVA 3VIKA 2ICSA 3EOSA 5CJ5A 5FEPA 2WB5A 1M5WA 1YW1A 1PS9A 2V2DA 2HBXA 1PYMA 3PS7A 5FI8A 4Q4QA 4FHAA 3SCWA 4FOKA 3W37A 4GI8A 1JUEA 1MUCA 3WFLA 3S2MA 1SZNA 4ACZA 3IGHX 1UMLA 1RR2A 3UGVA 3LCHA 1UQYA 3ZJKA 2R94A 1EGVA 3OBAA 1OG0A 5A6SA 2VVSA 4XAYA 4KS0A 3EMQA 1QHPA 4CVWA 2X42A 5FJOA 4P8VA 1HNYA 3DHDA 2XH2A 4KCUA 5HWMA 2PF0A 2CCRA 3K8KA 4ZB2A 1ZCOA 3RLGA 3WJSA 1WZKA 1AODA 3MB9A 3RJXA 1IZKA 3IJ7A 1ML1A 3C56A 4GK8A 3ZFHA 2DH2A 4CU7A 1EIXA 4S3FA 2X1IA 3H4XA 3SCRA 1R0MA 3EX3A 1O1HA 3KXQA 5A8MA 2VX5A 4UMAA 5FESA 1ALDA 1E6QM 1ZY9A 2QCGA 2VQTA 1E9YB 2BMBA 1XBYA 1JUBA 3ORWA 4U28A 1LUCA 3P7YA 2ZQ0A 4C6CA 3TJXA 4HP5A 4ZQRA 2P0IA 3WMSA 4Q6JA 2A3AA 1TQJA 2VC5A 1ITXA 2H9AB 3PUDA 3S6TA 1OHLA 2DUZA 5CZSA 3TROA 3AIRA 3WLSA 4AC1X 4O0QA 2WOQA 3SCNA 4FMVA 4RV3A 3CS2A 4LB4A 1JYVA 1E0VA 2BY2A 3VOIA 5JBEA 3KVJA 1QNPA 2TSYA 1KWKA 3M07A 2JGYA 2A2IA 4YU1A 2I17A 2ZUMA 4OV9A 2BOFX 4CKQA 2HVMA 1UR9A 3HN3A 1Z3NA 1HVXA 3APTA 1RP8A 4UIOA 1VFHA 1O7AA 1XYBA 3MUY1 1IF2A 2ZDRA 1F76A 2D2OA 3O63A 3L66A 2XVPA 3CZ8A 1WDPA 2QV4A 3ZM8A 1P7TA 3H26A 4ZO9A 4PN2A 2BVTA 1KD0A 3CB3A 4F79A 4N4QA 1CGWA 4W85A 3M6YA 5F4WA 4QTGA 4CCCA 3DZ1A 3G5EA 3OPSA 4NXKA 3QC3A 4GI4A 3C3NA 3LCFA 3WDRA 2RGMA 4HT3A 2O9OA 3VZXA 4R5EA 1O68A 2ZX5A 4EPKA 1IEQA 1K7EA 4BY3A 3I3DA 5I3JA 2E9LA 5LIYX 5BRQA 3AWNA 5CCZA 4ZZ9A 1YTKA 1ZUAX 2XIMA 5G4HC 3NOYA 3GXDA 4OQVA 1TZ9A 1N55A 1O5RA 3V35A 3P5ZA 4IIDA 4MGGA 5HBFA 3AYVA 1SJCA 3KM8A 4J3ZA 2XJ7A 4LBUA 1FFRA 1EJVC 1ZL1A 1OFPA 3LBCA 3SRFA 1EJRC 2CWXA 1FH7A 3DFYA 3MANA 4TTGA 1QOPA 4TIMA 1IXOA 1VFSA 1ODZA 5CZJA 4U5IA 4TX6A 4C6KA 4J3TA 1ZZMA 4EACA 3WD4A 3UG4A 2XDFA 3VIIA 2VEMA 3EDJA 1MDRA 3L0KA 3RF9A 3NGFA 3W29A 4O54A 5H6HA 4MUZA 1GEHA 1UKSA 2ZRVA 5AHNA 4L4MA 1ZP3A 5CSRA 4TOQA 5TBOA 3BAKA 2XFYA 1GVIA 2PDIA 3GFZA 1ITQA 2E7FA 4LS0A 1UASA 1YQ2A 5JBFA 2ZBTA 4GQQA 3FV9A 2WMIA 2ZX8A 1W3TA 3KBNA 2E6YA 2GGIA 3E2QA 2GSEA 4ZL1A 4AY1A 5KETA 1PWLA 1PIIA 2XG9A 3REQA 4AF0A 1SYTA 3MV01 3HG3A 2WYSA 4HPXA 2QHAA 3SCQA 5FKYA 1MRAA 3V3WA 1ZBKA 3L2IA 3ARUA 4N7QA 4MZ1A 5DRCA 3ZR4A 4UFHA 4AYGA 3CH9A 3VUSA 3IIPA 2BVWA 2V3GA 4Y9NA 2OMAA 2YXXA 5B80A 4Q4RA 3Q94A 2XSBA 5IRPA 1BRLB 1QNQA 2PDMA 1B30A 1ZB5A 2BWGA 4IQJA 2BG5A 4CQAA 9CGTA 3WLJA 3VGBA 3S1XA 1G7VA 2BXVA 2DZXA 1Q6CA 2UY2A 3CAVA 2YOCA 4MPQA 1OT2A 4UMCA 3UR7A 3CYVA 4N02A 4DXKA 1VPYA 2HTMA 3E96A 1ONXA 2JKPA 5CH9A 3VNKA 5BRBA 1XFBA 3PUOA 5HJLA 2ZXAA 3NEVA 3NZRA 1XXXA 2JBMA 3SEPA 4F4RA 4M7TA 2CEQA 3MS8A 3WFZA 3ZJ8A 1XLAA 3EPOA 3SECA 1Q6LA 1UC5A 3POHA 4V2XA 2D0HA 1MFVA 4O15A 2DZVA 3VIOA 4GQRA 4Z0SA 5IBXC 4DQWA 1XLKA 1PKMA 3C61A 4W8BA 3ARPA 4AXNA 2WSQA 1OGSA 2Q01A 4U33A 1ITUA 2VGGA 5DY3A 1GHRA 4WY0B 2MUCA 1Q65A 2E8ZA 2BVDA 2XFRA 3W87A 1DWAM 3VDHA 2EAWA 3N15A 1XD1A 4RZ5A 4CD8A 2V0TA 5LA0A 2VEFA 4ZE4A 2V5LA 1JZ5A 2INEA 1IEXA 3AWOA 1ME7A 2DGAA 4L1WA 4M6VA 2A7PA 5LSMA 3NL5A 4YCPA 4OIFA 3QPEA 4EIVA 4XIMA 1HW6A 4HNUA 1M3UA 2E28A 3W7OA 3D6NA 3G6LA 2V3DA 1JNEA 3G1FA 3U9IA 4AD5A 4GINA 2EQDA 5DBUA 5AHMA 3TVAA 1C8QA 2Y8VA 3AU2A 4QAWA 3LCXA 5I07A 2P76A 4PTWA 4IUOA 3NQDA 4ZQNA 1HUVA 4P7NA 3IV8A 3KVKA 4UTJA 1D8WA 1EXBA 2Q6ZA 4O1CA 4PE8A 2VM8A 1JPDX 2A0NA 2C0HA 2E1WA 4ZQMA 1CEOA 3FHQA 2IKIA 3BL3A 3CUZA 5J5DA 5ECUA 1QI3A 5E6YA 1YHTA 1XIFA 1HP5A 2DORA 4IHCA 1EC9A 4MB5A 2HNEA 4ZXLA 3OLIA 3W84A 3BZJA 3UYIA 3VVGA 1S5NA 4PTDA 3OU8A 1OFBA 5T26A 1ICSA 1XUUA 1B57A 4MVAA 5JQ9A 3NO3A 1XGEA 3TNBA 5A95A 1KFCA 1L9WA 4FNRA 3MW7A 3CZKA 1TV5A 3NFUA 4YLWA 7ODCA 3AJXA 4KH2A 3GS6A 1O1ZA 1UKQA 4PB4A 1Y65A 2DH3A 1P43A 3WY1A 1HO1A 4XTDA 2NSXA 4KWSA 3AYTA 2D0FA 1JDFA 1A49A 3K8LA 3LMZA 5D03A 3N18A 2FFCA 6CGTA 3B3DA 1ODUA 2Z7GA 1VHNA 2J9XA 2PLKA 5B7YA 4ZBCA 4ACYA 4F2BA 1MI3A 4Q4SA 1KTCA 1Y8BA 3PPCA 1WOAA 5I06A 1OINA 3CLWA 1FX6A 2B4GA 2EHHA 2FVKA 4QX4A 1O5KA 3R0DA 3GXTA 2YCLB 4NRRA 1JYXA 5TNVA 5EU9A 4ZSTA 3XINA 4Q8UA 5CC7A 1QVBA 3LEPA 1OCQA 1CECA 2PDFA 3EXSA 2WM1A 5FOOA 3TR9A 5LZLA 5CG7A 1FWJC 6REQA 2F38A 1U1UA 1WCGA 1O66A 5SWUA 3EMZA 1POJA 4IPLA 2OXNA 4DXXA 3GBDA 1G7UA 1GQJA 5FF2A 3R8GA 1SM9A 3FKKA 1J0YA 2CXEA 1P0DA 2VC7A 4LAMA 1CBGA 2WJEA 3CPGA 1WX0A 4DWSC 3DERA 3ABRA 1FA2A 4BR1A 2FZBA 1HJSA 2Y0FA 5BROA 4HB7A 1N8WA 4H1ZA 3M0MA 3ZJ6A 3L67A 4HMEA 1FCQA 3OZMA 2A3CA 1AZ1A 5BXSA 2X16A 4CU6A 1EWEA 5D2XA 3D5HA 2JKAA 2WV8A 4Z2JA 4L56A 2XZ9A 3MJMA 2YB4A 3AOFA 2X7VA 4PSRA 4WDWA 4J2PA 3T4CA 1SSDA 3GC5A 2VR2A 5ABTA 4PMYA 3MUXA 4QITA 2CLFA 3ZOAA 5C7VA 3ISIX 3AS1A 3CWHA 5U4NA 4NZFA 3GUWA 4ZVJA 5E0KA 2DVTA 4RXFA 1YXDA 3E2VA 1W1A1 3P2VA 2I16A 1AD1A 1B3ZA 3W6YA 5CPOA 1CIUA 2BDQA 3LHVA 1DTUA 3QYQA 4Q32A 3STFA 4F0SA 1R86A 2HVOA 4IPPA 4J9JA 3AMCA 3ES8A 3G1RA 4KRTA 1BKSA 3TMLA 4LUTA 2R1PA 3WK2A 1I8JA 5HA7A 3HF3A 4TMCA 3TUUA 3FYYA 1OCBA 3MKKA 3W7LA 4H01A 1VAHA 4LUSB 1B90A 3I7RA 1W8GA 2XIOA 1CB2A 3FDGA 1VS1A 2G0WA 3S9YA 4JICA 1VHCA 2PLJA 1KQZA 5HMSA 3OYZA 3SRDA 3J7HA 3GTNA 4QJ3B 4JKLA 3WQ8A 2BASA 2QUUA 3H70A 3AS3A 3BAIA 1QHOA 1TVPA 3MBFA 1TREA 3LBOA 1L2UA 4C65A 3ARXA 1MUMA 5DFAA 4K6AA 4DJFA 4AVNA 4Q7IA 2FPTA 4HA1A 4IPJA 3BURA 5ABFA 5LNWA 2CPUA 4I5UA 3MU7A 2FZMA 2QYGA 3T81A 2J62A 3L68A 5FF7A 3H7UA 5CAHA 3N6JA 1TMQA 1OFRA 1GG1A 3VILA 3IJ6A 3E0IA 3VKCA 2BBFA 4PZVA 1J5SA 2QVNA 2WVSA 3M41A 3TYDA 4QSHA 2WXDM 1A5NC 2CZFA 4QP0A 3DX5A 4XAFA 3FA5A 2A79A 1WOBA 4EWND 1W1TA 3URNA 3RHGA 1EJWC 4HCHA 2CZDA 3AISA 2ACRA 4F9JA 4U4MA 3R43A 5BNKA 1K7XA 2QS8A 4GKTA 1C90A 2ZZ6A 3SB0A 1W37A 3DFSA 4PEKA 3PG9A 1UOZA 3FAXA 3WH9A 2OZ0A 3UZYA 2OLHA 2VURA 3CJPA 4UTTC 4PCTA 5JH2A 4TQTA 5HR7A 1Q7MA 1TTJA 1P0NA 5AFDA 3GC4A 1JR1A 4LJ3A 1I60A 3SN4A 3W7GA 4FK9A 3LHZA 2G3JA 4LVGA 1RJQA 3EBVA 4QS6A 4KEUA 4C6OA 5JH1A 4HMNA 3R89A 3L4XA 4WGXA 1RY8A 1YBQB 2XN1A 3PN8A 3TDFA 3DECA 3VIJA 1AMKA 4XBSA 3N12A 4G7EB 1A4LA 3BG9A 2DSWA 3L4TA 2YDAA 1MYRA 1KGUA 3STGA 3SSJA 4KERA 1AJ2A 4XSLA 3AALA 4Q4OA 1LORA 1W31A 1IT8A 1H7PA 3ZWSA 4CQCA 4BHYA 4IG2B 2UV8G 3ZO9A 1W3NA 2D20A 1XINA 4KCWA 4S3BA 3GBEA 3WYZA 2VR5A 1WAUA 3O6DA 3AXXA 3W85A 3AIEA 3ZXWA 1BD0A 1KGWA 1EIBA 5LHEA 2E09A 1S2VA 2ZZ3A 1QUMA 4X0VA 4LUSA 1E4NA 4JHOA 4PL2A 4GFSA 4NL1A 4W5ZA 3SCPA 2PRHA 2IXVA 2Y62A 3KWSA 1RBAA 1IT0A 1QOXA 2VFGA 3WQWA 3TX9A 3AHXA 2WSPA 3W72A 4NT0A 3AUJA 3MT1A 1FHVA 2TRSA 3MUCA 2D3NA 4Z2HA 5A6BD 2Z2AA 5M17A 5EGRA 2JE8A 4JTIA 4MG4A 3K46A 4H04A 1W6TA 1SFJA 4PRTA 1T7LA 3S46A 4CCDA 2CESA 2OQLA 3R0UA 3KZSA 4BEQA 4YTSA 3KDNA 5A6JA 4IP5A 2CBVA 1NOWA 3DOPA 4C91A 1NH6A 4KEMA 3DI0A 4RNFA 4I8DA 5I77A 1WUFA 3NDZA 1UD3A 3NQGA 1CGVA 3OLEA 3TW7A 2H9AA 3CIWA 2PI6A 1KCZA 2Y61A 3UXIA 3ZT6A 1Y7VA 3WBYA 4MAVA 3WKZA 3G6MA 5C9ZA 3MTWA 2L5HA 3W1AA 3C0JA 4PCNA 4GRSA 4K37A 1KM4A 4W93A 3LYEA 4MFEA 5C2CA 4JX6A 4MWAC 5GNYA 1ZP4A 1IHIA 4DPPA 8TIMA 3BE7A 1OIFA 4LF2A 1KRAC 3W74A 3PF3A 1XX1A 4BQ5A 1G01A 1E1CA 4XQ6A 3UZJA 4B91A 3BARA 4JFWA 5A2AA 5D2VA 7A3HA 2HBVA 4QQ3A 4H7ZA 2WBKA 1MW3A 1UZ4A 2B81A 2D23A 2W91A 2HMCA 1XP3A 3UWQA 2BTMA 4FOJA 4Q33A 4JHMA 4FXJA 2VFHA 3W73A 3KHDA 1KFKA 3LI0A 4GXMA 3EOLA 1E5NA 1HL9A 3TTSA 3E74A 1AW2A 2ACQA 4D71A 1GK8A 3W7QA 2ABAA 3KX6A 3OZYA 1TZ7A 4KWUA 4IIBA 4IG2A 4J2MA 4N9CA 4IJBA 4UC5A 5XINA 4DZAA 2O9RA 2OEKA 4JTGA 2GDVA 3B0YA 4LV9A 3TTYA 2P1FA 1Z9AA 2IKGA 4X22A 3WSUA 1US2A 4W7WA 3CL6A 3DN5A 1YPIA 1EHAA 2Z4GA 3HGJA 1F74A 2PD5A 2J9ZA 4JTQA 4RZ4A 4JQAA 3T05A 4DO5A 3ONCA 1ZJHA 2P50A 5LHFA 4A6GA 3ARRA 2ADAA 4UCGA 1Z69A 2YJQA 3EXTA 4NAEA 2A3HA 3CO8A 3MMDA 3VIFA 3NUKA 3CT2A 4AH7A 3BAXA 2FVLA 1KBLA 1JRCA 1BF6A 2D24A 3HJZA 4HPGA 1VF8A 4PEEA 2PDKA 5AC8A 4ZXOA 1EKOA 3U2OA 3VKAA 3SIMA 2HE5A 6ENLA 1XLBA 4HSOA 1US0A 4IMEA 1UCWA 2PDHA 4IOTA 1VR6A 5HINA 5HPOA 1JGMA 3SADA 3N04A 4JNZA 3ZLGA 3UU0A 3QTGA 6TAAA 3KLKA 1I2OA 2VWSA 3DH7A 4UMBA 4JFUA 3OEXA 3KEHA 2CWNA 2W9MA 4GFIA 3REQB 2QUTA 3W7JA 3UJEA 1RH9A 1XM3A 1BQCA 4ICCX 2DIJA 5CZKA 4KFPA 3L4ZA 4G2DA 4GXPA 4IL0A 1EPVA 4UZUA 5BXRA 1TTPA 1M68A 1ZBWA 3HV8A 4HTBA 1M41A 1VRXA 1BRLA 4DO7A 3M1ZA 4MY8A 1R2RA 1TWDA 4JZ5A 4IH3A 2JQXA 3H7RA 1G4TA 1GTHA 3ALGA 2VZUA 1A3XA 2V8ZA 4YIWA 3C0SA 4DBDA 2NVCA 1BLIA 3VX1A 3WBXA 4I6VA 1QAPA 4JIEA 3PTQA 3P8JA 3LTYA 2ZXDA 3OLDA 3QOMA 3TC3A 4R53A 2ZIDA 4N9EA 1JPHA 1OT1A 5AVNA 1Z7AA 5M03A 2X0HA 1PKYA 3UY7A 4DUVA 3WLPA 1XGDA 1K3UA 3KFTA 2ZA2A 2OKOA 2W79A 4HPNA 4IF2A 1GKPA 1KCKA 1W17A 3VD5A 3P61A 1GG0A 4S3GA 3LY0A 1QI0A 1DWGM 4XVEA 4WY0A 2EKGA 4OECA 3IJIA 1A5OC 2ZDSA 2PFHA 4ZQPA 5LGXA 1W1YA 4H8UA 3PHAA 2ZE3A 2HSAA 1TJ2A 1D3GA 1E6XM 1C8XA 1V3LA 3MUIA 3QXBA 1DWFM 3BJTA 2QKFA 3GH5A 3GNDA 2W62A 2OGYA 1JRBA 2VCAA 5AY7A 3PSVA 3NOEA 4C6DA 1U2YA 2PGFA 1S5WA 2PRLA 2CU0A 2PEVA 4UTIA 1H7XA 3FAWA 3QYSA 2WKLA 2QR6A 2F9RA 1Q2SA 3AMKA 4IIEA 2PSNA 1QBAA 4C7FA 2X40A 4J27A 3USBA 2QNEA 3CHVA 1JF5A 1QT1A 2VD9A 4ZA0A 2PF8A 4P61A 3D3FA 2GJRA 3CUFA 5DCBA 2OLAA 4BQ2A 2POTA 4OU1A 1XIDA 4HU4A 4R85A 1O60A 4NZ4A 1G94A 4JTSA 1ZLPA 2F6KA 3QY7A 1ZALA 3T9PA 2GVGA 3E5BA 4LYKA 3IGSA 3NGJA 1CXLA 5CLWA 2EO7A 1QPKA 4MB1A 1EZWA 4H41A 3RO6A 1F4AA 3QKEA 4J1OA 5FJRA 3RU8X 2ZTJA 4MDPA 3BW3A 2QQ6A 1WUEA 1OC7A 4HCLA 3QQ0A 5L9FA 4YVPA 2A3BA 3TYEA 3AXMA 1PTGA 2QVHA 1KWGA 2E5BA 4LNCA 4N6FA 1MEWA 4OUEA 4AIEA 3T8QA 3TC6A 5H1WA 2QXWA 1CXFA 4FX6M 2P8BA 3UXAA 2WVUA 1S2UA 2G8ZA 4NG3A 3TXZA 2GVJA 1RLDA 3BJSA 2RDXA 2VFEA 1EL3A 3VD7A 5BZAA 1V6TA 4Z1AA 2VX4A 3VDGA 4FIRA 3SUVA 5BCAA 4AEOA 2B7PA 3U7BA 1UIPA 3FHAA 2EKCA 3QQ1A 3G0XA 3POCA 3WBEA 2AOSA 1JCTA 1V3IA 4AZBA 3G2GA 4UFJA 4XKMA 1R3TA 4YTQA 3VNDA 2YDQA 4C7DA 3FDKA 5D05A 3S1UA 1BSIA 2Z1WA 2P88A 2QDDA 1B3XA 4DJED 3GE7A 3Q45A 4GXWA 1R85A 3VGDA 2F2KA 1P6CA 1UHVA 3GDRA 3DFPA 1QO5A 1V4YA 2AKMA 4WUIA 1TWIA 4JEQA 4PB3A 2VX6A 2VGBA 3CUIA 1FHLA 2J47A 2PTZA 5CPLA 3LOTA 5FJJA 5KITA 4JTKA 1FCBA 4PMVA 3ZT7A 3TFXA 1FDYA 5C55A 1ISXA 4J5NA 1HT6A 3LHTA 4C90A 5DELA 5AYYA 2GUBA 4BZYA 4JQ3A 4FXFA 4S3KA 3V1HA 4NZJA 5AHIA 3CK5A 1W9PA 1IQ8A 2TYSA 3SY5A 1J8VA 4UTTA 2BSLA 3C2YA 4X9SA 5A6KA 4P7QA 2UY3A 3RR1A 3CUJA 4B3KA 1FWIC 1K70A 2Y8UA 1TMLA 1AA1B 5A8GA 5TQLA 5ENLA 3ABZA 2V3EA 4QM1A 1G0CA 3AHTA 3BOFA 2UBPC 1RVGA 1DPMA 1QOQA 4E2OA 2WANA 3C0QA 1V08A 2H8ZA 3AHZA 1BQGA 3GX9A 3GC2A 3Q67A 1KW1A 3QW4B 3PTKA 4X61A 4ROPA 2V9DA 4FR6A 2INZA 3AXHA 2HK1A 1R8LA 4I9MA 1ME8A 4AZ6A 1XDJA 3WMBA 2DT0A 4CN6A 3GTHA 3LPOA 4KMQA 4A3YA 1U5JA 3TXVA 3WQPA 2NV9A 3NDOA 1SQ7A 1LJYA 2WHJA 3TLLA 3MSDA 4XX6A 3CH0A 2GJPA 3N4EA 3C4UA 4M6QA 3KBWA 3MSRA 4NKCA 1AL8A 1T96A 3E38A 1ISWA 1A5AA 3QR1A 4JKKA 3EPNA 4JPGA 4AIBA 4AHPA 3BSMA 1KXHA 4F3HA 4Z1BA 1SZEA 1A0DA 1YMYA 4ZQCA 3BTNA 4LX4A 4QRNA 2P0OA 1GPFA 2HCVA 3F4DA 2OODA 5D2YA 3TWBA 3CUGA 3W7EA 4D8ZA 2YCEA 1MQPA 3LV6A 4R33A 2Y4SA 2OYLA 4KBXA 4WSJA 5CJNA 3GQYA 1EA9C 3KRUA 5H8UA 4EXBA 4JTFA 1XBXA 1CGYA 2DUXA 1HJUA 1ZAIA 1BWVA 2I9UA 4JEJA 3N25A 2Y85A 2W5FA 1UD5A 1Z89A 3TA6A 3S2LA 1KV8A 2C14A 2G95A 4EANA 3S4TA 3N2OA 5A2BA 3ARZA 5ABHA 5DQPA 4WK9A 3N73A 3T8LA 1Q7QA 2XSXA 4E2DA 4LWWA 3F1QA 2AGKA 4UFLA 3MY9A 1S2WA 4Z42C 1D9EA 3WQ4A 5CPSA 3GO2A 1GOOA 5F2LA 3QPYA 2GWGA 2DQWA 3WNOA 3AROA 4R7JA 3EOOA 2NSOA 1AZ2A 4O18A 4GQ0A 1DXFA 5G2WA 1MDLA 4BF5A 3WUGA 4NYYA 2NLIA 3F5JA 4N0RA 3R11A 2ZVIA 1XRTA 1CTNA 3M0ZA 4BEUA 3FXYA 1G9HA 4MYXA 5D2WA 3LCGA 5C8BB 3ARQA 3WMLA 1GVYA 3JRKA 3OW1A 3B8DA 2I14A 3H12A 3PP7A 3VC5A 1HQTA 1KLZA 1ZCCA 4O50A 2E0PA 4H8HA 4O1EA 1KFJA 1X1ZA 1ZJBA 3B05A 2OO6A 4IFRA 2O4MA 4Z0JA 2HPIA 4HYRA 1GVEA 1NQKA 2BHYA 1OFDA 2Z2BA 4ERIA 2QF7A 4KCVA 3QPZA 2EPOA 1QI4A 1UH3A 7PTDA 4JY9A 1VFMA 3OOQA 3ZSSA 4IIGA 3VI2A 5A8QA 3II1A 2YKKA 4Q8WA 5CGQA 4JL2A 3TH6A 3GVVA 4WDTA 1KR1A 1SO6A 3MI2A 3MP4A 5FEWA 3ERPA 3GHSA 1FHUA 3VD9A 2Y5SA 3WF2A 4GZJA 4GUJA 5AZ1A 3HPSA 1EJXC 4KFOA 4RDYA 2E25A 1DXIA 5MKGA 4L4LA 4XKYB 2R1NA 3SGGA 4O10A 3HZ3A 2JEPA 2KZHA 1XYMA 3K2GA 2ZTKA 1NFGA 3S5OA 4D8AA 2WZTA 4UTWA 5E0CA 4KIEA 3SBFA 1I6NA 4M0XA 1KKRA 4DX3A 3M5YA 3BZGA 1GOIA 5BWFA 3TN3A 5JXQA 1RPKA 3IIOA 1TUFA 4HYWA 3VMOA 4IXXA 1JPKA 3GYEA 1J0KA 4DJEA 4JQ1A 1Y5VA 2DZSA 4L1XA 1VFFA 1H5YA 1H63A 3UERA 1IV8A 4EXAA 1OG6A 4PB5A 1BTCA 1E71M 3LHUA 3AO0A 5EFFA 4QJ1A 1YPXA 3MA8A 3QZAA 6REQB 1EJTC 5HXMA 4F0LA 2YFOA 3GY1A 2XUCA 3R10A 4D72A 2YGYA 5I3GA 2PWHA 2PPGA 3KUMA 3GXFA 4WVXA 5D9NA 3BAWA 4GYKA 1JPMA 2J7HA 1UWTA 2CYGA 3WQGA 4Q8TA 1BGAA 4C6IA 3L0NA 5HQEA 2DU2A 1FKXA 4MOZA 4OBTA 4QG9A 1NDWA 4YCOA 2R1MA 2ZUSA 4QLJA 2X41A 3CEUA 2O55A 2VUYA 1XLEA 1R6WA 4GCAA 3VZZA 3RLUA 2DP3A 5LA1A 3VU2A 4DB7A 1VZWA 2XH0A 4RNJA 3ZVIA 3RDKA 1F73A 1JDEA 2HS6A 4FXSA 4DJFD 4IT1A 3AS2A 3GXPA 3R1ZA 3VUPA 5AVHA 3O05A 2FHCA 4EK7A 3B8VA 3WF3A 5AYBA 3V5FA 1JNDA 1C9DA 4HU3A 3VM7A 1NDZA 3R8HA 2VTFA 3CHCA 1FXPA 3MV11 4PUDA 1K02A 1LDCA 4OT7A 1BKHA 3RIKA 3HB9A 4PRWA 4LF1A 4MYAA 4K68A 2J8TA 4BFAA 4PCSA 1QWKA 5CPTA 3NIYA 1F6PA 1VYSX 3WNLA 1DTNA 4KGJA 2HRWA 3CNYA 1DJYA 4GO8A 4LY8A 5DN1A 2FPYA 2X30A 1OD0A 1XH0A 3BLLA 2PAJA 2X1RA 3VMNA 1P48A 4N9BA 2Y7EA 2OYKA 4LVFA 4EPEC 2QEZA 4GI9A 2NQHA 4NZ1A 3PBYA 1WDQA 3ARVA 4UR9A 3I3BA 1OYCA 4YL2A 1PSCA 2PS2A 4CQ8A 2EBNA 4M6UA 1J4EA 4NZCA 1Q5MA 4RX0A 8A3HA 1F3EA 1HGWA 4IJRA 1EWDA 4B3LA 2XN2A 4Z08A 1IGSA 3OA5A 2AL2A 5E6ZA 5C0QA 4ZR8A 3PJTA 3WF1A 4X0NA 3WLTA 4BI6A 3NQCA 2PDBA 4PGLA 1E3ZA 2Q8LA 3GM8A 4ATLA 4AZIA 4IXHA 3U5UA 3I4KA 3G22A 3OZPA 1L6SA 5GJMA 1OF8A 4D6IA 3S5SA 2V5KA 4DZIA 2YL5A 4O8AA 3T2OA 1ISZA 1I2RA 2J9YA 2BODX 2OO0A 1PCWA 3SJNA 2NQ9A 1SU5A 5LIKX 3EA3A 1XGZA 3QV9A 3IAPA 3THDA 3VTRA 4IICA 1QHZA 3E0FA 5J5RA 3DEQA 2O4QA 1VYRA 3SRHA 1XYLA 1TWZA 1OABA 5GNZA 1LUCB 3N3TA 4U5KA 3RN6A 4L64A 1HIZA 3UWVA 1AH4A 1YX1A 5DMLA 1BWKA 4Z2LA 2WHKA 1KB3A 5KSWA 1M7XA 4HNVA 1WDRA 3FNDA 1H7RA 3OP2A 5DT5A 3RPDA 3H2MA 3TTEA 4A35A 4BWLA 5KZ6A 4F48A 2VZOA 1R30A 1G5AA 3LXCA 1UQZA 4WGHA 3BLIA 1N8IA 1XQKA 3NYZA 1B4EA 2OCZA 4NRSA 3B8WA 3FIGA 3WLKX 3MKCA 5TIMA 1JYWA 3CO4A 2PP3A 3ELFA 3O07A 4NAFB 1K4GA 4ILSA 4LUTB 1WDSA 5A6MA 1TTQA 1G67A 4I7VA 4GJJA 3UNTA 3B0VC 4LYQA 4HTYA 4G7EA 2DIKA 2ZCGA 3FVMA 1BXCA 4XD5A 2FB3A 4KW2A 2WVTA 3OZOA 2VOTA 3MJYA 4IP7A 5T91A 2ZRXA 4MWAB 4F8XA 5F7UA 1GVSA 4PTVA 3TONA 3Q2DA 1W5OA 3TLQA 4MNMA 3BLPX 1RCOB 2WLYA 2G3MA 3W1XA 1W9VA 5FACA 4LS2A 3MCMA 3FS2A 2WKGA 2FKPA 2XN0A 2FPVA 5LXXA 5D04C 1ZSXA 2CLKA 5EYWA 3PTMA 1ONEA 4D6CA 8XIAA 1WP6A 1UWIA 3W7KA 4M29A 1G1YA 3W2UA 4W9TA 1VIWA 1W8SA 5CSUA 1F4HA 2NX9A 3W26A 1QATA 5CSYA 1TR9A 3T0BA 3HV9A 3AMLA 1TSIA 2NT1A 1L2QA 3PUEA 3RMJA 2WMFA 5AZ0A 1YRRA 3BGGA 4Q8QA 3W7NA 3O06A 5IFTA 1UOKA 1CT5A 4NJIA 4E0CA 3KS5A 4JTAA 1BYCA 2EPMX 3LU2A 3QFWA 4Q7NA 1Y5XA 1O12A 1OD8A 5GJPA 5HATA 2VX7A 1BHGA 4S3EA 5E09A 2GGJA 1VKFA 3LDVA 2FTYA 5AHEA 4D6DA 3RX3A 3WEOA 3B0PA 1YXCA 1XR2A 4CGTA 1Q8JA 1JD9A 1PKLA 1TELA 2X7WA 3HIJA 4H4IA 1AG1O 1XYFA 2UY4A 1LLWA 1L8NA 4CEUC 3S1VA 1K8CA 4DPQA 4L9XA 1M7PA 7REQA 3AFBA 3TYZA 1NY1A 4MKSA 4YHEA 1FWNA 1R3QA 4DZHA 5LIWX 2RDTA 4AZGA 2OYMA 2PWVA 3M7SA 4AWTA 3QTPA 2PMQA 4QROA 2J77A 7XIMA 3DENA 1TUXA 2Z27A 5D02A 4LU0A 1RPXA 2J8GA 2Z0IA 3F2DA 4PBGA 1E6PA 1NDVA 1I0DA 3L4UA 1P1MA 2BGNE 2NWRA 2ZUVA 4H9XA 1CXIA 2QUNA 3E3HA 4HNNA 2DZUA 4FXRA 2FZ8A 3VD3A 3B9DA 4XG1A 5IFPA 1OYAA 1VEPA 2HZGA 4LQ1A 1EUAA 1LBMA 3CIVA 2WW5A 2XVGA 2KAUC 1M65A 4LBSA 3IAQA 4GH3A 2HVNA 3W27A 4TU1A 2OG9A 3M47A 4PFHA 3AIVA 3QLLA 3PWAA 3H2EA 5C9WA 3BV4A 3VKDA 3BMWA 1TV3A 4IGNA 3U2ZA 3TV8A 4JN7A 4C5YA 3WIJA 3A4XA 1AL7A 2WCAA 1EZ2A 4E8DA 1EYEA 3BANA 3RUBL 2VRQA 3SGUA 3PPGA 1R87A 3H2OA 3KRZA 3PZUA 5DO8A 4RE4A 3C2OA 3NO5A 3PFRA 4NHVA 4CVUA 4GVGA 1KRCC 2C19A 2GK1B 5F2MA 2IPFA 1AJ0A 4GVHA 4H19A 2D69A 3RCYA 3C8FA 1EJUC 3M6DA 3LLDA 1Q8AA 1R7AA 4OTKA 4FX7A 3R5EA 4NX0A 4ZEPA 1FWAC 3K4DA 4B92A 3WJXA 3Q58A 4AMCA 1UR8A 1IWAA 4RDWA 1Q13A 1TX0A 1GOKA 3CPUA 1C92A 3U4FA 2BGSA 4QEEA 3N11A 2NX1A 4QDPA 1XRSA 2DSKA 1BTMA 2B7QA 3KE0A 1ECEA 2BY1A 3LM3A 4ZO6A 3QF0A 1I1WA 5HQLA 2B0MA 1W3IA 2INFA 1F05A 1AQMA 1HGYA 4TVUA 5JIPA 2WHLA 4K7YA 1F8IA 3G8RA 2ZUUA 3CHFA 1BVWA 2A6LA 2D73A 4WJEA 2A5HA 4O4WA 2J27A 1K8XA 4GBUA 1EP3A 3CQJA 2GGHA 3SJ3A 3QFEA 2XVKA 1RK6A 5G5IA 3TW9A 4F66A 4E8CA 2GZXA 4Z17A 5FF4A 4QDMA 2BFGA 2VFDA 1VPXA 2FZNA 3CXOA 2XPKA 3L7RA 3JR2A 4JY8A 4V28A 4WEVX 3PBWA 3W6MA 4NQ1A 4XVDA 2DZWA 3I7SA 2WC7A 4MNLA 1WQ5A 3TJLA 1H3GA 2Z6IA 4W84A 2DEPA 1GYNA 3ZR6A 3KOXA 5E0FA 2HE8A 3GB6A 6PTDA 2XU2A 4JOMA 2XIIA 2E5CA 4D9PA 3H22A 1UB3A 3YPIA 4HZ8A 1CW2A 2YCKX 3O0FA 2YYUA 3GVQA 3VNJA 3B9EA 1XLJA 1AH0A 4U2ZA 5FIPA 1NEYA 1J93A 4HJFA 4QLLA 1H50A 1TPWA 2EJAA 3FEQA 3PPFA 1UA7A 1H0GA 1ONRA 3GG7A 5FJUA 1TE1A 3AICA 3P67A 1P6WA 1VFTA 1E1CB 4L80A 5DMNA 3VA8A 1CGUA 1NFBA 4UNKA 1R3YA 3THQA 5I23A 3OBKA 1P5BA 4M6PA 1X38A 1FP9A 1Q6GA 1D2KA 2Z26A 3WQCA 3GTIA 1H4PA 2XISA 4DUXA 1QXLA 4OJYA 4BI7A 3NQMA 1GJUA 4JN6A 1GORA 4H9ZA 3W88A 3KOYA 4IWWA 4UXDA 2OTDA 2PA6A 3UXKA 3N4FA 1EDTA 2QLYA 2F2HA 3OLGA 1NOFA 4MWAA 3IS4A 5E70A 1XLFA 1FDJA 1B5TA 4LVDA 3V36A 1JEZA 1DOSA 3GHTA 1F2JA 2NW0A 3ITXA 4B90A 4QSFA 4CUCA 5C54A 2GQ3A 3R6IA 5D4YA 3I6EA 4FSAA 1V93A 1J10A 2F8QA 4D6FA 4F0RA 3H55A 3LX9A 4CN1A 5LA2A 3HPXA 4QJ4B 3SFKA 5HMEA 4GACA 1T41A 1VC4A 2G50A 4H6KA 3VFLA 4BI5A 1I2PA 4QNWA 3NSXA 2HK0A 5AYXA 2BY3A 4OWGA 4PUNA 3TQ0A 2QJGA 4DM2A 1M7OA 3W53A 4MADA 1RV8A 2D1ZA 1LOLA 4D6GA 5J04A 3CU2A 3DFQA 1OEPA 3UGRA 1YKWA 3BMVA 4QS5A 3TOYA 2ZA1A 3EB3A 3WLLA 2ASHA 1XLHA 1OGGA 3WLNA 1AQHA 1H61A 4DF2A 1XJBA 3NWRA 3FA4A 4GWEA 2BHUA 4V33A 4YVXA 4HSNA 3AZRA 1A0CA 5E9AA 1OYBA 3DIPA 2ZRUA 4K8EA 1FKWA 2CHOA 4P7LA 3APGA 2Y2WA 3HQNA 1XLIA 3GFYA 3R7MA 4YS1A 3SCTA 3F4WA 3QHNA 2YBTA 1CB7B 1OZMA 3S0CA 5G1TA 1LQ0A 4L61A 4LBRA 2WM0A 1XF0A 1OQFA 1RCQA 2FIQA 4LCSA 5HNTA 1K9DA 2ALRA 1FWEC 3ZIZA 2EPLX 1I9CB 4GH1A 4Y9AA 1S46A 1SFTA 2IS7A 3MYOA 4REQA 2MNRA 3WQDA 5D8ZA 2YL8A 1CXHA 1JULA 1KRMA 2ODOA 4HCDA 3GDTA 2PCEA 3CWNA 3W9ZA 1G4SA 2J7BA 4WDXA 1GVRA 3STEA 2OJPA 5EFDA 1T8QA 2A3EA 1X1OA 2XM2A 3ENLA 3CV7A 1VIZA 2TMDA 4B5SA 4HQVA 2GOKA 2IQDA 3EX2A 2H6RA 4E6MA 3TOPA 1W5NA 1YLVA 4RK8A 4UQDA 3JUGA 4GOAA 1YBQA 2C71A 1IZJA 4KETA 1XLCA 1TR1A 4IFKA 2O9PA 3MCOA 3BGAA 3PG8A 2I5QA 5C9XA 1VPQA 5C70A 1NM9A 3QN3A 4F0HA 3RGTA 3GVGA 4PUWA 1I0BA 1Q85A 3NQ8A 2ZADA 2YCIX 5C7HA 2QIIA 3VXGA 3G1AA 2GQ9A 2IPWA 4NP7A 4H7CA 3W76A 1JPIA 3KZPA 4KRUA 3E9AA 2P3ZA 4KWOA 2PDGA 1GCYA 3DGRA 4JIPA 4GI6A 3O6AA 4NXSA 3WFAA 3PZGA 1BG9A 2VDIA 3LCIA 4OBSA 3EWUA 3FX4A 3TN6A 2CZEA 2DY3A 3JW7A 1JXKA 1V8EA 2ESCA 1GEQA 4A8LA 3LPFA 3MDWA 4YNGA 1UZ1A 5HULA 2VNCA 1S3HA 1CYGA 4CCZA 4DNHA 1E43A 2O0TA 1U5VA 4Y9PA 2Y1HA 3LMYA 3BLDA 1QRQA 3GFXA 4J3WA 1VJSA 4G5DA 2CKRA 4W86A 4YTTA 4WSKA 4JX5A 4C1NB 1PWMA 4YPJA 3TEVA 4DELA 3IGUA 3M44A 1Q6FA 1P4CA 3XIMA 3W2LA 5HR6A 3LTSA 4Y6GA 1FCVA 2RKXA 1WAWA 4CD4A 3H21A 2PDYA 4DWDA 3M0KA 5RUBA 3N1AA 2DJXA 4MKNA 4K36A 3ZLHA 3QM3A 3W7MA 2RAGA 4K1GA 4XSMA 4UCFA 1J9YA 5C2XA 3SUTA 3AQUA 5A8NA 3NAVA 1JCJA 5FJTA 3GAYA 5XIMA 2ISSA 3T0CA 3RLVA 3W7RA 2WSYA 1Q66A 4HYVA 2G4JA 3IACA 1MZRA 1GHSA 8CGTA 1MFUA 3EX6A 2EXOA 3ABXA 5CQ1A 3WQ5A 2Y88A 1ZJIA 3R2GA 3LERA 2PDQA 3C2VA 5TAOA 4LEQA 1H11A 4WY0F 7ENLA 5IDZA 2HXUA 4MLJA 4JTJA 3W2MA 1GKRA 2PDWA 4AZ7A 1PX8A 4CLMA 4GE8A 4AVFA 3VX0A 3H2AA 2IPJA 1V3MA 3GIYA 3O0KA 1B31A 3RITA 3PNUA 1T99A 4DYKA 1XIEA 4R7OA 2OSWA 5C71A 2B7NA 3QMSA 5T8GA 2YL9A 3KTCA 4K3ZA 3ITCA 1LTDA 2DT3A 4GNVA 3NDYA 3FGCB 3P14A 2DV0A 4GIEA 1BEUA 1A5SA 3MSGA 4KFNA 4MZ8A 1UBPC 4EF9A 3VCNA 5HJXA 1XBVA 3STPA 1NTHA 2I9EA 4AX7A 4KF1A 4GO9A 3LGDA 4ERGA 4HOXA 3CZEA 1GKQA 1M7JA 1KFLA 4HMCA 3WL1A 4JR5A 3FYOA 1XS2A 4OFCA 3VOCA 3NL2A 1JCLA 1OX4B 3WQFA 3G24A 1CZ1A 1VBJA 1TV8A 4B4FA 4ZB5A 1LLOA 2WPGA 2A7RA 1E4IA 1VFOA 3WDIA 3SW6A 3CQ0A 3BGJA 1OFEA 1JFHA 1H2JA 2CIPA 1U1JA 3V5CA 3UZ5A 2HEJA 4CNNA 4I9AA 4NNBA 1UR2A 3I7QA 3OQ8A 4A05A 2VO5A 3P84A 3LRMA 3URAA 2VKZG 3R79A 2VRKA 1EGZA 3PWIA 3VM5A 2J88A 3UVIA 2E4TA 5HANA 3V5OA 5LGZA 2CETA 3THUA 3SIZA 4IM4A 1AMYA 3G3DA 1E70M 3AU6A 1IYXA 3A22A 3QW3A 1F7BA 3GR8A 1H7NA 4JFVA 1SMAA 3EGJA 4JNMA 4XISA 2IQ0A 4C6BA 2R82A 4DWSD 1XIGA 4QE4A 3NQFA 1EDQA 2ZX7A 3EAUA 2VD8A 4H9MA 3C3UA 1JF6A 5HJYA 4RNIA 1DQWA 2BNJA 2NQZA 3BAJA 3IK4A 3GXMA 4AQLA 5AC4A 3L5AA 4LCRA 2Q71A 3UZXA 3T0TA 3BLKA 2Z25A 1KFWA 3O7UA 1TPC1 4ZOAA 2HWGA 3DFNA 3OB8A 3WBWA 3EWZA 3OVRA 3W1MA 1E72M 4M8UA 1V7AA 4FA3A 4XAPA 3CUXA 4M56A 2VEPA 4DIAA 4ZGYA 5F2IA 4XUYA 4D2JA 4QISA 1C8VA 1W91A 1I4NA 1HVQA 3G0SA 3W07A 4QAIA 4L4OA 2MANA 4ALDA 3NG3A 4PMRA 1BAGA 1KM0A 1XW8A 3WH7A 4LRSA 1ICPA 4ZFCA 3L4VA 1GVFA 3F5KA 3ARSA 2QW5A 1HXJA 5K4XA 1FFQA 1UUMA 4AHOA 2RDUA 2XM1A 3OQEA 2AQOA 5I24A 2BY0A 1TVNA 3NQ7A 3WQ6A 4W4QA 1NSJA 3MKVA 1PZ0A 4JTUA 4EOUA 4JKMA 3GR7A 2XVLA 5CBJA 2DZBA 1ZJAA 4GY7A 5KZMA 2YSWA 2JK2A 1YNQA 3GU9A 4S39A 1Q6DA 2OR2A 5D30A 4GIYA 3UWYA 2C0AA 4AWEA 1WKDA 2ATSA 3WLRA 4ATWA 1POKA 1C29A 1EJSC 1FDZA 2JALA 4PC8A 2AL1A 3EKZA 5EBUA 4F2TA 3RRXA 2OELA 5FF0A 3W4RA 1HTIA 1S38A 1OFQA 5LIUX 3FJLA 1FWBC 2Q09A 2VL4A 2Q02A 4YHGA 1V0MA 4JIQA 5H8PA 1UBSA 3LRLA 3QOKA 4WZHA 2QT3A 3L23A 1GW9A 3MO7A 4YTRA 4JX4A 4IQDA 4GIRA 1UJPA 3ZJ7A 4J3VA 3SY1A 3INPA 5AC5A 1F6KA 5I79A 3OJGA 1BYAA 4P8XA 3SN0A 4ML9A 3GIPA 4KWWA 1E4LA 4PYSA 3EA2A 1ZS2A 4MDOA 1ECQA 1OJXA 1K4HA 2VUNA 2A21A 3ZSTA 4IX2A 4P7OA 4DEFA 1XI3A 1W5QA 2QULA 3MVTA 2OVLA 4UQ9A 3OTRA 2VGFA 3F03K 3R4IA 4ZOEA 1SGJA 1MRQA 1AW5A 5D8WA 3PFMA 3U6WA 2YW3A 3WJWA 1OVDA 1BGGA 4IZGA 2IMRA 2FLIA 1VBRA 3HGRA 1IGWA 3V0UA 1EC7A 2HPMA 4MM1A 4LANA 4S2BA 1A5KC 2FGZA 4XAGA 5FSDC 3S1WA 2X2GA 3GG0A 3QR3A 4DJDC 4DUOA 2YX0A 5I03A 3O8AA 5EMMA 2GSHA 2VT0A 2PWEA 4NNCA 4PBEA 2DUAA 1DE6A 2BZNA 1NDYA 3UCQA 3L2MA 1GWJA 1W2VA 3LM7A 3NL6A 3LPGA 1E3XA 4IUGA 2JFEX 2QJHA 4OVXA 3S3GA 5L6UA 3FCPA 4AD0A 5AC7A 2Y24A 3FN9A 5K9XA 1OC5A 9XIAA 4GQGA 1SW0A 1XV8A 5HK4A 3GNNA 1X6NA 2Z1BA 1QW8A 4H6QA 3QQWA 2NV2A 3E02A 1LL4A 2QJNA 4ZOCA 3T4WA 1QI5A 4P2VA 4HIBA 5A2CA 3PY2A 1KBKA 5C5YA 2YLLA 1QR7A 1P0EA 1TPH1 2NV1A 1RBOB 2FYMA 2WC3A 3N9RA 2GGGA 1JFXA 4AEEA 5E1QA 1DQXA 1J2BA 5BXTA 2DDXA 1IWBA 3NZGA 4C5ZA 3KRBA 1TJ1A 4JD4A 1VEMA 3LHYA 4D1IA 1LYXA 5D32A 3MQTA 4AZCB 4GZ7A 3LZ5A 1PX3A 2P5NA 2RHGA 3KOWA 2CLEA 5EMKA 3A4AA 2ZXQA 2ISWA 2WCSA 2ONEA 1KM5A 3FXGA 2X05A 4HZ7A 4EE9A 1JDAA 4LEFA 4QBXA 4E5TA 3G1XA 4BF9A 2XZ7A 3P74A 3UWWA 4CEXC 4AUBA 4WCJA 4IQEA 4MNJA 1X7IA 1A50A 3IRSA 3CAWA 4GUIA 1FRBA 1U30A 4LRTA 2QCHA 1QCWA 2PTYA 4IFOA 1OADA 3UPBA 4O11A 2V68A 1WXJA 3HFYA 3EDEA 2XYLA 3V18A 3NCOA 3K8MA 4FS9A 1RVKA 1J6PA 1AD4A 3SN1A 3QZEA 1PV8A 4X60A 3TE9A 2CLPA 2WNNA 1F07A 1JCMP 1UD6A 4QXIA 5IM51 1QK2A 1DP0A 1PO9A 4W89A 4MWAD 3W82A 1SMDA 2CNCA 1XD0A 3RPMA 1XLMA 1YTDA 1QNVA 4E8GA 4V1YA 3P60A 1DE5A 3N9KA 1Q4NX 1SZRA 4AIOA 2OSYA 1XC6A 3VE7A 3KTXA 1L6GA 1XLGA 1NAL1 3FJ4A 1L6FA 3OIXA 4DJDD 1QFEA 3EWXA 3T44A 1U1HA 3DXIA 1EF3A 4UNLA 5PTDA 5T9BG 3BSGA 3NZ1A 2E6FA 3EWYA 3DHPA 4H8VA 3ITVA 2J24A 2YDRA 3EYPA 3IGXA 5K7JA 3DBPA 3CMJA 1H0IA 2C1IA 1NWUA 3CYJA 4J35A 4FIQA 4PMNA 5J8LA 1I2QA 1X7FA 4J7RA 3RX2A 1QPNA 1UR1A 1BXNA 4L9ZA 3OO2A 2GVYA 4ZCWA 1RZMA 3GNPA 3SQLA 3GNOA 3CQHA 3TTQA 1QJWA 1FVPA 1CENA 2D3LA 3LSBA 3UETA 3T40A 4D6JA 3W7DA 3DI1A 5U7SA 3UEQA 4L6DA 4PMJA 3L0GA 1ESWA 1OGBA 4KT2A 1E1EA 5C9UA 4GNJA 1FWGC 4UFIA 3O6YX 4FO4A 2J7DA 2VMFA 5JIWA 4X2RA 1J79A 5G1MA 3N3MA 3W1RA 3PK7A 4C6MA 4HNLA 4O13A 5M3WA 3LTPA 4AXKA 1EOMA 4UTKA 3B4UA 2LLEA 1JIBA 4Y9MA 3T6CA 4DM1A 2FMOA 1JI1A 1RJPA 4I6KA 4P8WA 3AZTA 1TV2A 2V6AA 2VOMA 7REQB 3RFAA 2Q3OA 1K7FA 2CLHA 2BB0A 3AUOA 3ARTA 1KC7A 3UCDA 4WSHA 4PMUA 4O0KA 1CNVA 2BXYA 2I7GA 2FH8A 3W02A 3DFTA 5LIXX 3O1NA 1I1XA 3FVDA 5KINA 4F2UA 2I5GA 1UR4A 2PWUA 3ONBA 3B9OA 2DZAA 3CT7A 4XZNX 3FK4A 1EB3A 5EPDA 4Y96A 2JF7A 4LYPA 5C2GA 1W3HA 2C15A 4AY8A 3CHEA 3VGEA 4UB9A 3R8RA 2NXIA 5GPRA 2PDPA 3S47A 1DVJA 2XIBA 2C18A 1AH3A 4H9VA 1HJQA 3PAJA 5DF0A 3M46A 5DXYA 4GX8A 1E73M 3USZA 1E9ZB 3ITLA 3W2KA 1DJNA 2ZZ4A 1KXQA 3B8TA 1S2TA 3UVAA 1N7KA 3PZNA 5D2TA 3WNPA 1TIMA 2E77A 3NR0A 4L7ZA 1FWWA 1GYMA 3HPFA 2NQJA 3S6DA 5D33A 1NWSA 4DBEA 3PANA 1PUDA 5BU9A 1NU5A 3T78A 1UD4A 4K2SA 4PRRA 1AQFA 2GDUA 1J12A 3A9BA 3C8NA 1KO0A 2QDGA 1YDNA 2Z1XA 4O19A 4UOQA 1VFLA 2PU0A 3TKFA 1FWDC 1VLIA 4IMCA 3VE9A 3PZQA 4Q8PA 3UP8A 2QDEA 2EPKX 1UG6A 4AAJA 4QIUA 3FSUA 1A5BA 3ZLFA 2REQB 3W1LA 4AMAA 4O8RA 3KS6A 4E38A 3P5YA 2AAMA 1EO7A 1UYQA 4HBKA 1H51A 2PGWA 5DLCA 2HISA 3MWCA 3OODA 3EX4A 3KCOA 2DVXA 3T0DA 3IRDA 1GGOA 1KTBA 4ZTXA 3JS3A 3THCA 1VBGA 1JJKA 1EUNA 1KKOA 1B54A 2R14A 3UA4A 4CQ9A 1C93A 3L9CA 4QHRA 4B3ZA 1VJIA 1MVYA 3ATYA 1JDCA 3BWWA 4RDZA 4FB7A 1DHPA 4MPKA 3FYPA 1KCXA 3TQPA 5CC3A 2I56A 3N2XA 4YMZA 4JTHA 1RA5A 4NU7A 4FNQA 4QE5A 1KLYA 3A5VA 3HFTA 3ITOA 2HDJA 2X0SA 3TAOA 4O0ZA 4Q4MA 4KWVA 4BK9A 5A8OA 1D3CA 1RK5A 1XSKA 3HU7A 1A5MC 1BFNA 7CGTA 1HKKA 3WMCA 4UOZA 4GNKB 3FEMA 3GAKA 1W0MA 4ERAA 4KQNA 2Q8ZA 3WDQA 7TAAA 2X2YA 3N14A 5BU6A 1K6WA 2WSRA 3E0LA 4RV8A 2NXGA 2Z1SA 5CBIA 1FWHC 3XISA 4LSBA 2CZ5A 1J0ZA 1XDMA 3PB2A 1WZMA 3BCFA 3QZ6A 3ZVHB 1TPUA 4FNSA 3M43A 3NEHA 3PAOA 1T40A 4O4VA 2OQYA 3RM8A 3MHFA 3A21A 4ADTA 1ZFJA 4XWUA 3H2CA 3MI3A 1TG7A 5JU6A 4NJHA 3IJLA 4R34A 2ABBA 3PVFA 4C6LA 2W92A 3M16A 4JCLA 1AQ0A 3LQLA 3PR2A 3QHMA 2OT1A 1YNPA 4I5XA 4CNUA 3OBEA 3MDUA 3UF9A 3BXWA 3K5XA 2GVLA 1OCJA 3WD2A 1VB9A 4UQCA 1XIIA 4WR3A 1GQIA 1JI2A 1LM1A 4CNSA 4AW7A 4A8IA 5AN7A 3SUWA 1KXTA 3ALFA 1F5ZA 1GOQA 4ZQOA 3AXIA 4TMBA 4US5A 1P7TB 4FOUA 1H41A 2REQA 5EB8A 3B8IA 3UFYA 1EJ7L 5DEZA 2EPHA 3DG3A 4ZO7A 5ABEA 1PKNA 2HJPA 2QDHA 2JIWA 4LW7A 1G4PA 1PYFA 3UW6A 1NF7A 2OZ8A 1TV4A 1CDGA 4Z2GA 1ICQA 3N2TA 4MF4A 3WEZA 3P93A 4XIAA 3KBVA 1TX2A 2QV5A 4J3UA 1TJRA 1I45A 5HMFA 4F0KA 3GW0A 5I02A 1MQQA 2J7FA 4H00A 3W81A 1E0UA 5HMDA 4LAUA 4B9ZA 1X1NA 4FNPA 5ABFB 4GYPA 2Z7KA 4LCQA 3PBVA 1UUOA 2KX9A 3KHJA 3M0JA 3RO8A 2HS8A 5GJNA 2OWCA 1UWRA 3TK7A 1TB3A 4EPBC 2QAPA 3T09A 3ICJA 3CTTA 3W1PA 3V1PA 3KRSA 1TJPA 4FX8A 2ZYFA 3CUHA 2CLIA 1ADSA 5AECA 5HAOA 5JUVA 1W9BM 3OVQA 4ICMA 1Y0EA 3W86A 5DANA 4N42A 5A6BA 2PE4A 4V27A 3S83A 2F61A 3IVSA 3LK6A 2W27A 4LXFA 1J6OA 3VPLA 1YPFA 2Z6JA 3A4JA 4Q6XA 3TYCA 3A24A 5G1YA 2ZZ7A 2CC0A 1MZHA 2RJHA 3WK3A 3DFHA 4GABA 5DT7A 1VBUA 4WDUA 2EPNA 4C60A 1GYLA 3S2CA 4FP1A 4I3GA 2JIEA 3NQEA 3VKJA 2VXNA 4OZOA 2PC4A 4Y8EA 2DT1A 4RE0A 1CXKA 2PLMA 4ADSA 3ITTA 3AXKA 4HOWA 2FGBA 1OCNA 1W5PA 1BWLA 2DSVA 4JHZA 3LNPA 1E9IA 1TZZA 1XL9A 2YLAA 3NPWA 5HDRA 4WKAA 3QV8A 3WG6A 1LLZA 3V0TA 4JTRA 3MZNA 3NQAA 1GPWA 3SUSA 3MUZ1 1ZQ5A 3SR7A 3FJ6A 1KA9F 4B9YA 1H60A 4DF0A 4LAKA 1RD6A 1Z6KA 4G9PA 2VDHA 3H4WA 2ZUTA 5M2FX 4EAMA 3S5YA 1IWPA 5G2HA 2JKEA 3RILA 4ORMA 4O1AA 4RW3A 1PCKA 3LV5A 3RM9A 3I68A 2E8YA 3E1F1 3TSDA 3IJQA 1OIMA 1NQ6A 3VIGA 1EQPA 3TMQA 3COTA 1FQ0A 1M53A 2QMKA 4A3QA 2X1TA 1UIOA 1HKMA 4H8NA 1GZJA 3HPAA 1NOUA 2AKZA 3MHGA 1S5VA 3UR2A 3IIXA 3WK0A 2NT0A 3AS0A 3F2CA 5I09A 1RA0A 1U5HA 1XIHA 5K2ZA 4OOUA 2V69A 3VOJA 2HXTA 4M80A 2WMGA 3A23A 4N6EA 4YXGA 4A3RA 1W56A 4DBWA 3SQSA 2ZX9A 2OFJA 3WO8A 3EWWA 3VCRA 1JD7A 2EG7A 1HFBA 3S2JA 3ITYA 1DEDA 3SGZA 1JQVA 1DWJM 1TCDA 4F0MA 4U31A 4PUMA 3SURA 1W3JA 3QH2A 3OA3A 1XFCA 3BW4A 2R91A 3KCLA 4ECLA 4A2RA 4B5XA 4MWAE 1E0TA 4RUBA 1UKOA 1J0IA 3SRKA 3UXDA 3BMXA 1V6VA 3WLMA 2PTWA 3ZQ9A 4JTDA 4FLQA 2IPGA 1DIOA 4LV4A 1XYAA 4Q8OA 3PULA 3QKZA 2WKJA 2GJLA 3HOJA 1D7KA 4H6RA 1HKWA 2ANUA 1XPGA 4CNTA 1KM1A 4K39A 4IL2A 1HJWA 3T08A 3A12A 4BQ3A 2EF9A 4JTLA 3H4GA 1EBHA 4JIRA 4S1FA 1AFSA 4AZCA 4IIFA 1MSSA 2R1KA 1UWSA 3CZJA 1K77A 1Q6EA 3WK1A 3N2CA 2ZRZA 3BQ5A 3CTLA 3H2NA 1DJHA 1GONA 4ICNA 2P8CA 3WDJA 3K30A 3S42A 4HHHA 3FJNA 3B04A 4PCPA 1YXYA 4LVBA 1IXPA 2YZ5A 8RUCA 1KFEA 5D37A 1SFSA 2TPSA 1H7WA 2PBOA 3MHUA 3VDAA 4ML4A 3WLOA 2H3BA 4N4PA 1S2AA 1R9XA 1VFUA 1EBGA 4CN4A 3NZQA 2F7FA 4XAZA 3W6LA 1XUZA 1JCNA 3NZPA 4ZO8A 1QBBA 4ACZB 4U3AA 4QGCA 2E68A 3A47A 5LYRA 4MJ4A 5E9XA 4E2VA 4YJ5A 1QNSA 1LQAA 4X2PA 1EP1A 4O16A 3IVUA 4NZ3A 1MEHA 4XZ9A 3F7JA 1UMYA 1K6AA 4TVCA 3BICA 3LXBA 1EYWA 1UD8A 3EDFA 3STCA 3TW6A 1ONWA 3W1UA 1DJIA 4MHBA 4W5UA 4POCA 3UWEA 2J74A 1ZRQA 1VCVA 1W2PA 1YE6A 1C7SA 2QCDB 2Z1KA 4GY0A 3THAA 3O16A 5EKYA 1V77A 5BXPA 3NURA 1OX4A 4TX9A 3WJZA 4ES4A 2Q3RA 3OHMB 2J78A 4UTWC 2GLKA 2WMJA 4M81A 9RUBA 3IANA 4IX0A 2B7OA 3WQOA 4FALA 4HA0A 4US6A 2VVNA 2CKSA 3VZYA 4N2YA 1S1PA 1BXBA 4DYEA 3FW6A 1A3WA 4M1RA 4OHQA 4Z1CA 3HURA 3QGKC 2D22A 3WNNA 4INFA 4GIAA 4K38A 4ASTA 1RQEA 1PDZA 3KOZA 2ISDA 4XD4A 1KGXA 1EEXA 2WMIB 1SJBA 4MLRA 1EX1A 3R94A 4DI9A 2UZ9A 2I1OA 4D6HA 2X0YA 4NJJA 3RNDA 3HTWA 3WD3A 1PZ2A 3ANVA 5DMYA 3W1QA 4QNEA 4JIHA 5KEZA 1B1YA 4DY1A 3W70A 1L8PA 3EB2A 2FQIA 4IPIA 1HKJA 1UP3A 2DJLA 4CD7A 4Q7BA 2Z1VA 1EF2A 3W3OA 4KGLA 1WXYA 3LRKA 4QDWA 4EWJA 1OC6A 3MCNA 3OYXA 2E40A 4GUFA 1GTEA 5HUOA 5TF0A 1XSJA 1E6SM 1DV7A 1R3SA 3GHUA 4P5UA 3G1HA 5FJIA 4K1WA 1MNZA 4NI8A 1OX6A 1ELSA 1LRQA 2Y63A 4L6HA 4OV4A 3WNMA 3HMCA 1H09A 2P3EA 2NUXA 3PUGA 3NQ2A 4C6FA 2YBUA 3MI6A 4QFUA 3MSYA 4UNIA 5E5CA 3S1GA 4BCEA 1PL9A 1S1RA 3W83A 1XSIA 1AK5A 4PBFA 4L65A 4FI4A 4GJ1A 3EWCA 1V02E 1V79A 1X39A 4LAOA 4ZODA 2FJKA 3BJFA 1J11A 1XH1A 1NF0A 2CITA 3U8GA 1LL7A 2CHNA 3VK5A 3MC5A 4RLIA 1BG4A 4Q4KA 1VYPX 4X63A 4HN4A 3LNMA 3BOXA 2JF6A 3KL0A 4KPLA 3GK0A 3GXNA 4AWSA 2ZRWA 3DU0A 4O1DA 2IKJA 3LPPA 4XZMX 3D47A 4GUHA 3TQKA 3WQVA 3CC1A 3CZGA 1XYCA 3E6EA 2FZ9A 4JL1A 4AISA 2NUYA 2PU1A 2VZSA 4XV0A 1UR3M 4UOJA 4A21A 3F5LA 1E0XA 2F6UA 2WWCA 2Y70A 3WDPP 3H7VA 3UNDA 4RZBA 4Z2IA 2IXUA 3QGAC 2Z28A 4I7WA 3UR5A 2Q8XA 1JZ2A 2AQVA 4QEHA 3CQKA 1CCWB 1B2YA 1IR2A 4NF7A 1QNOA 1YDYA 2HNHA 2CLLA 4AHQA 4GZEA 3AHYA 1VP5A 4D6EA 3PJXA 2FMNA 4IMFA 2YYTA 1HZYA 3CEPA 2QJIA 1FOBA 3QHOA 2VDGA 1BVNP 1O5QA 1V5XA 4LALA 3FGCA 4GUGA 1J0JA 2AMXA 5HWJA 1LG1A 2G4FA 1ZHAA 1F3WA 3R0KA 3LCLA 1ITCA 3QMTA 4TTUA 1D8CA 4GYFA 4PULA 1TPB1 3VGFA 1DL3A 3I4EA 1Q7ZA 1DXEA 3C86A 3WLHA 4IGHA 4O53A 3ID7A 4B5TA 4MIMA 3P81A 1WBJA 3UJFA 5ABGA 3CWOX 1VENA 5EA9A 4FNUA 2C1HA 5HNNA 4UTUA 4PCFA 4DI8A 1LWHA 1QWGA 3PTDA 4GVIA 2QGYA 3CBWA 4MJMA 5EL1A 1DJQA 1X97A 1SFLA 3HG2A 3U48A 3CV6A 1LZOA 4G7FA 3ZR5A 2D2GA 3U3HA 3UJSA 3EEGA 5M1TA 5I3DA 2GWNA 3U4AA 2IKHA 4QLKA 3SCOA 1C7TA 1NP0A 4Z1YA 1SZFA 2BOEX 2WVVA 3LD5A 2XIJA 3CZLA 4R9XA 1YADA 3M5ZA 2AGTA 3HGOA 1XLLA 2QCNA 2OZTA 3SY8A 2W3ZA 3DG7A 3SCSA 4UTLA 3N4AA 5BRPA 3MWAA 1CGXA 5K9DA 2V82A 4NZ5A 1PJ9A 1FH9A 1TQXA 3RG6A 5CSSA 1CLVA 3B40A 3PZOA 4XUGA 3VNIA 3GTFA 3EOEA 5CG0A 1H1NA 4MY9A 1F3TA 4NY2A 2WQDA 3KLLA 4BJHA 3IWPA 1BF2A 3AZSA 3Q4DA 3TN4A 3QY6A 2VEIA 5FJPA 4L9YA 3PBUA 4YTUA 1E15A 2O7SA 1JG9A 2G3IA 3D3AA 1JL8A 4OE7A 1KTNA 4S3JA 1TE6A 2ON3A 2J79A 3VC6A 2VENA 1KQYA 3LZ3A 4W7UA 3AHVA 3LHWA 1LL6A 4L6OA 2DZTA 3VOGA 1JQXA 3RMEA 3BQ6A 5JBDA 4FAMA 3D0CA 2G5WA 1B3YA 5FSEC 4JXCA 4DLFA 2WZMA 2O7QA 1T5AA 4M19A 1TPFA 4WXZA 2OKTA 3L5LA 4JCMA 4AYSA 1LRTA 1UWQA 2BXZA 4S3DA 3KW3A 4RZ6A 2J6XA 3WL0A 4W88A 1QPQA 3BLFA 1Q45A 3ABOA 4J3SA 2WO5A 4CQBA 1TV7A 2GJXA 4S23A 1V3JA 2VZTA 2DSUA 4OKDA 3SUUA 1M03A 1LROA 3L21A 3HGSA 4IMDA 4PFMA 5CPMA 3K1DA 2QIWA 4AD4A 3RYSA 3BLEA 1FWSA 3U0HA 2C6QA 1R3WA 1RY0A 3F4VA 1WDWA 1RD5A 2QZRA 2Y7DA 2V67A 1SO5A 3ABSA 3QRHA 3DG6A 4CCEA 3HPZA 2BP1A 2J13A 1YEYA 1V02A 3W7HA 3GH7A 3UA3A 4LB3A 2W6RA 1LRNA 4S2CA 1ISYA 1GVOA 1MW1A 3GKAA 3W23A 3NSMA 1DORA 3DBNA 3ME3A 3AMDA 4HU8A 4UR8A 5DXXA 3B97A 1GOWA 2WNQA 3LGGA 3RM4A 2PDCA 2WVVB 5TD4A 1CLKA 3B06A 5AB3A 2WZHA 3ARWA 3P0XA 2DW6A 5B7ZA 1SR0A 1GT8A 1XCXA 3W38A 2XTKA 4HHPA 4PL1A 3C2EA 3C2RA 1PAMA 4PR4A 4R27A 4O1BA 2Y6ZA 1XHGA 4ENLA 1ISVA 5LNVA 1R46A 1LG2A 2OX1A 2P53A 4DXVA 2OLSA 2A6NA 3QJAA 4WQ6A 2PRMA 3CPRA 1NWRA 3SAZA 4B5VA 3IIZA 4UQEA 3UESA 1NIUA 2GUUA 1NVMA 1OF6A 1SZGA 2ACSA 3GH4A 4E4PA 3OG3A 5CJMA 2C16A 2G37A 2POZA 4HMDA 3EX1A 4L5ZA 4WXYA 2I5IA 4IGMA 3TU9A 3QEZA 1QTWA 4DUWA 1V7YA 4WIWA 1B9ZA 3GWQA 4GPNA 2QF8A 1K9FA 1BYBA 3HMJG 1XIBA 3KOFA 1GQLA 1LT7A 3W0KA 3AC0A 1YE4A 1SR9A 2CBIA 1DWHM 1GZGA 2FJUB 4HSHA 3BAYA 4XD3A 5LNSA 4GHRA 4GG9A 3M0IA 3TA9A 2VC9A 2ACUA 4EVZA 1U22A 3JZEA 5FA5A 2PDNA 3U7VA 2GJXB 5ECVA 1P0BA 2EEXA 3EXRA 3NPXA 4A2SA 3K4AA 2XVNA 3BVJA 3N6HA 2VWTA 1UWUA 4MNKA 3DCPA 1OB0A 4HHLA 4PH6A 1QMLA 2R8WA 3CASA 1D3HA 2QJMA 3DC8A 2IUZA 4R3UA 4HK6A 4AZHA 3FOKA 3TP4A 3HA1A 1PIFA 5FEZA 3WENA 5K3VA 1OWQA 2QGHA 4DYJA 4HKPA 2AL2B 3WLQA 1IE7C 2VHLA 3SO7A 2I57A 5I3KA 4NJGA 3B0XA 2BHZA 3KP1A 3WDHA 3BCJA 3NVDA 1OK6A 5F1UA 1OX5A 1WO2A 3BW2A 2Y5EA 2EJ1A 4JFTA 5DX7A 2GFTA 1WKYA 3LENA 4LAZA 1Z41A 2UWFA 4C1LA 1X98A 4IISA 5A6AA 3WNKA 1TKKA 3VKKA 2FHBA 3ZZ1A 1HKIA 2FDMA 5CGTA 4XO6A 1NJJA 2WJFA 1EEPA 2A85A 1WKEA 3M7WA 2NX3A 4KRZA 3HO8A 2V81A 2DFAA 1IXNA 1XCWA 2OOGA 1UPMB 4RW5A 2VR4A 3VAVA 4NNAA 4H83A 3NJ3A 1JXJA 3ANYA 5A6TC 1W3LA 4AF0B 4M5PA 2FB2A 4B2DA 5MF5A 2O9TA 3DAQA 3GTXA 2F6XA 3W28A 2YL6A 3G0UA 3UBPC 4HJWA 3QR0A 3MMWA 1EGMA 1J01A 2WNZA 2OU4A 1UH4A 1KR0A 5BMXA 5CBBA 1K1DA 1MXGA 2V5BA 1I75A 3G77A 4XZLX 3UWZA 4LGXA 2VFIA 5D38A 3LGEA 2ZZ1A 4O28A 3IUDA 4XK2A 2C13A 5MKGB 2CZVA 3S2NA 3I6RA 1E4MM 3ES7A 1A5CA 2BS9A 5EMLA 5KTLA 3KL5A 1E0WA 3FKRA 4GYPC 3VNMA 3LUTA 4PMQA 2RUSA 2QCFA 3MP3A 4HVXA 1X96A 1PIGA 3O15A 1B4KA 4JS3A 4BA0A 4GC4A 2J75A 3APYA 3A3HA 3W75A 3QBUA 1DQUA 1FWCC 4EKJA 2VELA 1EXPA 2FTWA 2J7GA 1WNOA 4NIRA 2ZA3A 1EHNA 4W8LA 4IFKB 3UZWA 3UG5A 1PVNA 2WMHA 3CLMA 3CGTA 3MBDA 3QVQA 4A4AA 1L6WA 3NQBA 4HA4A 5T9CE 1LBFA 1VBHA 1S3TC 3UR8A 1WPCA 4R9OA 1XBZA 5C6MA 3QY8A 1PB0A 2QCEA 4C6QA 3FSTA 3L4WA 4DBSA 4M7SA 5M5DA 1HX0A 1QW7A 4HK7A 4UWMA 2R1LA 3EWBX 1BYDA 5XIAA 2G97A 5AOUA 5CKSA 1XKYA 3UXLA 1VRDA 3G1SA 1GQKA 4P8UA 2V38A 1W9UA 3WQEA 3LLFA 1UH2A 1SO4A 1X6UA 2YCJA 5K4ZA 4Q8NA 2V5DA 4JDBA 2VP8A 2Y7GA 3V75A 1VJZA 4GGHA 1XC4A 1JUKA 4K8HA 4C1KA 1HN1A 3K4WA 2VQUA 3OIHA 3L5MA 2RJGA 4YWSA 1JCXA 4K8GA 4FLRA 3RR4A 2W63A 2VI0A 5A94A 2VGIA 3MVIA 3A3XA 1JVNA 5EY5A 3HBLA 4GY1A 4WJXA 3NQ6A 3TTOA 4FZIA 3I6TA 3PJUA 4S3CA 3TYUA 3VMPA 4W7VA 5I3HA 2XHYA 3E0WA 4NILA 2YXGA 1OBAA 2Y5JA 2PGRA 4PMDA 4ZSUA 1E1FA 3GVWA 3W71A 2OSXA 4FPSA 3NM1A 3RX4A 1FXQA 3GZAA 1FP8A 3I65A 1XRVA 1F6YA 4LY4A 5EMJA 2OT0A 4DAIA 1WE5A 2YDSA 3NO1A 4LFYA 1F9CA 1IR1A 2G96A 2GUYA 5BOEA 3E2SA 1OZQA 4U3CA 2QMJA 4E3TA 2X1SA 1CLXA 1E5JA 3GW3A 5CXPA 1R9YA 5CAKA 3WBAA 1UROA 1Z32X 2PDXA 3WH5A 1CWYA 3EWDA 2OWWA 3WZ0E 4JTTA 1EOKA 3L2LA 1ZENA 1PZ3A 3VGHA 5I78A 1PDYA 1SW3A 5LXEA 4BWLC 3ZVHA 3VO0A 3F2BA 2VRJA 2GJNA 2EGZA 5BOFA 1J18A 4EF8A 2YFNA 4Q3MA 4HPHA 5DMMA 2FVMA 1WZAA 3LG3A 2JGQA 1R5YA 4RR4A 3GR4A 2NVAA 4DVOA 2A1YA 1VLWA 3PZMA 1D7FA 3T2QA 5FCZA 2PTDA 1VCFA 1HJVA 3IK2A 4A22A 5CPNA 4AFYA 4GA8A 6TIMA 1TA3B 1A80A 1PHQA 4BS0A 2V30A 1RALA 2J7CA 4Q4PA 4FF5A 1KM3A 4OBRA 1RHCA 2QPXA 4MUPA 1OY0A 1UUQA 3BOLA 3N2MA 2HQAA 3T1GA 3TQVA 2G3NA 3P6LA 3V0SA 3JU2A 3NQVA 4AZ5A 4LS1A 1W9XA 1HF6A 1TFVA 3D46A 4H9TA 1FWFC 5G2IA 2XFFA 5I3FA 2WWDA 1O4UA 1PPIA 2WMKA 3MMTA 2QPUA 5HUPA 1LBLA 5IHRA 3KBMA 4WX2A 3NSNA 4Q22A 3DKLA 1JDDA 4DLMA 4O17A 3UT0A 1WB0A 1QU4A 2YCLA 2ZRYA 3BUVA 4E4UA 1UZDA 4XZWA 3TAKA 1THFD 4GZIA 4W87A 3GZ3A 1JYNA 3K1GA 2V3FA 3P3BA 2XINA 3N6QA 3RCMA 4HPJA 1KCLA 2GOUA 3V4BA 4UUIA 1BPLB 1F3XA 3GVRA 4PUUA 3NA8A 1HO4A 2O92A 4AIUA 4JYFA 1S2CA 3KBSA 3C5QA 1C3FA 4YN5A 1JZ6A 2PZNA 2A3LA 3AYSA 1DIEA 5I5RA 1J2WA 1W1PA 3IEBA 3RPTA 4YYCA 1M9HA 1EX5A 3LSCA 3SM0A 3GDBA 3AYRA 5BWAA 3CIXA 2W61A 1UC4A 4NAFA 2PC8A 4QQUA 2RFGA 3BK0A 3HG4A 3IJDA 1M04A 1MQRA 1T8XA 3M5VA 1JZ7A 2H3DA 3CL8A 4ZTYA 4LUIA 2OZ3A 4B4HA 3W25A 3CHDA 1GOXA 4L4PA 4WOZA 4X3ZA 1TPVA 3DYPA 1FHDA 4NSBA 5F4XA 3WELA 1U33A 4LNYA 4G56A 2ZFAA 4AD1A 4S38A 1B3VA 2JEQA 5IOBA 1QI2A 4H6EA 1GNXA 4DN1A 1JZ8A 5GNXA 1DJZA 1R3RA 3RCNA 1B0IA 1REQB 3B8SA 4LPCA 1CX9A 5GQBA 5BYWA 1M1BA 1H62A 4JTEA 1KBIA 1W32A 3WUEA 3N13A 1AW1A 4GYJA 1UA3A 3IVTA 1US3A 4B16A 3CQIA 4DAFA 5CGMA 4GMEA 1W3KA 1R2SA 3PC0A 2GPTA 5HPCA 1UKPA 4JYDA 2CXGA 1E9LA 1UKTA 3AMGA 5AC6A 2YBVA 4R88A 3GDLA 2YB1A 4JTCA 3W2JA 4FR1A 4MY1A 4AU0A 4XBJA 5DCEA 4IJCA 1UD2A 3M64A 1LOSA 2ATMA 4V15A 4LUJA 2QUVA 1JCYA 3FLUA 3M0HA 1IIHA 5EBAA 1IIGA 3NXFA 5BMWA 4LOCA 4TR9A 2PWGA 3QLDA 2BX7A 1RCXB 3EB4A 2J6VA 2RH9A 2WK2A 4Y9OA 3NL3A 2FTPA 3S9IA 1S5MA 2VYOA 1MO0A 3TIMA 2PP0A 1TMHA 1GVQA 2E67A 4PTMA 4BF7A 3OVPA 4WKFA 4CNOA 4ZB0A 2TODA 4QR6A 3UYCA 3W24A 3VIMA 1CI1A 1UZHA 3I3EA 3B4YA 1RSCA 3DUGA 2C1GA 2ZVRA 1MMFA 1K9EA 4K7VA 2YA1A 2ZICA 3UPMA 3GSMA 1W1B1 4RL3A 3BC9A 3SDOA 3GLCA 1Y5WA 3P62A 1LT8A 1ZPTA 2W67A 3FA3A 4LTSA 4KESA 2QUMA 3KAOA 1MW0A 4C6JA 4G6CA 4PMXA 4M24A 3TNOA 1ZAHA 3TZFA 3GXIA 1Z44A 2D2HA 2E3ZA 1T6MA 4XZHA 5F1VA 4ATDA 3HQOA 3RLHA 3PZVA 6XIAA 4A3HA 4PODA 1PEZA 4EX4A 3U2EA 4GKLA