4Q7IA

Crystal structure of engineered thermostable d-tagatose 3-epimerase pcdte-var8
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
298
structure length
298
Chain Sequence
b'MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRYEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 118
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4q7iA00
1OADA 3UXIA 1BXCA 3KCJA 4GJJA 1BXBA 7XIMA 1XLJA 2HK0A 4QEEA 4HHLA 3KBNA 3KBWA 4YTQA 5H6HA 6XIMA 4YTTA 4Q7IA 3LMZA 1XIHA 2QUMA 3ITVA 1XLAA 3P14A 2G4JA 3UVAA 4XKMA 3M0XA 1XYLA 2HCVA 4PGLA 3IUHA 3P6LA 4GJIA 3VYLA 1XLMA 1XLFA 1I60A 1XLCA 3BDKA 3CWHA 4QE4A 5I7GA 8XIMA 5TNVA 3KCLA 3CQHA 4ZB2A 3UA3A 4QE5A 1A0CA 4W4QA 3UA4A 1QTWA 1XLIA 3C0LA 3XINA 3VNMA 4EACA 4QDPA 1CLKA 3ITTA 3VNKA 2I57A 4ZB0A 1MNZA 1XIFA 3AALA 3XIMA 3QC0A 2NQJA 4ZB5A 1YX1A 4XIMA 4OVXA 4XIAA 3M0LA 2XIMA 5AVNA 1K77A 2GVEA 2NQHA 4X60A 5XIAA 4KW2A 2GYIA 4A8RA 2XINA 1XINA 1O1HA 3CQKA 4LNCA 1XYCA 3UU0A 4QE1A 3KBJA 1MUWA 1XIEA 3ITOA 4QDWA 3L23A 3U0HA 1A0DA 2HK1A 4ZBCA 1DIEA 2ZDSA 3BWWA 4G56A 3M0VA 5XIMA 1DIDA 2QW5A 5AVHA 3DBNA 4X61A 4XISA 2QUNA 5B7YA 2G0WA 3KBSA 4EAYA 4QEHA 1QT1A 3BZGA 3ITXA 1XLHA 8XIAA 3KCOA 3CQJA 4XSMA 4K1GA 5J8LA 3XISA 3C0QA 1XLBA 3VNIA 3IUDA 2OU4A 3AYVA 1I6NA 4HNOA 3WQOA 1XLLA 1XIBA 3M0HA 4HHMA 4GLEA 2J6VA 3KBVA 5EMLA 5EMMA 4YTRA 3QYSA 1S5MA 4PFHA 4YTUA 3TC3A 2QULA 3AYTA 3JU2A 1XYBA 5B80A 1XLKA 4US6A 2Q02A 3NGFA 2XISA 5EMKA 2X7WA 1GW9A 3ITYA 3N4AA 2X7VA 1XIJA 5C9ZA 4J4KA 5EMJA 4DVOA 2GUBA 1XIMA 3C0SA 3M0MA 5B7ZA 4K3ZA 1XICA 1XISA 1DXIA 3ITLA 4YTSA 3VNLA 1XIGA 1XP3A 2I56A 1XIIA 3TVAA 5H1WA 9XIAA 1XYMA 3BANA 4XSLA 1XLGA 4A8NA 2ZVRA 1S5NA 3QZAA 6XIAA 3DX5A 3KTCA 4E3VA 3AAMA 3CQIA 1A0EA 3M0YA 4HGXA 5FA5A 3BZJA 5XINA 3OBEA 3U3HA 1QUMA 3VNJA 3IUIA 4DUOA 2NQ9A 1XIDA 1DE6A 1D8WA 1DE5A 3KBMA 4GQBA 3GNXA 4A8LA 3KWSA 3QXBA 9XIMA 1XLEA 1XLDA 3CNYA 1XYAA 1TZ9A 3FVMA 4X63A 4A8IA 2GLKA
chains in the Genus database with same CATH superfamily
3UXIA 1MRQA 1A5AA 4WJEA 4HNVA 4NNBA 3IJDA 4ZXLA 3BLEA 4E8CA 4L64A 4XKMA 1A5SA 2HCVA 4MKVA 4P7RA 4GXPA 3WFZA 4GYKA 2WPBA 4WF7A 3FS2A 1XH0A 4WSHA 1IEVA 2HRWA 1U5HA 1V51A 4EPDC 4ERAA 3QQ1A 2V5DA 1G94A 1R3WA 1MO0A 4PULA 4UQAA 4PEEA 4KWWA 1M7PA 1Y8BA 1M41A 3RLVA 2C18A 1AD1A 4WVXA 1M1BA 4NVTA 3WUGA 1W9BM 4U3AA 2BHZA 3WQ4A 4Y9MA 4HBKA 1Y5WA 1TJ1A 1CB7B 1JCJA 1H2JA 2ZTJA 3N6QA 4DNHA 1OFPA 2A3HA 3VAVA 3EDFA 4QTGA 3CPGA 4HNOA 1P6CA 3RCYA 4ADSA 1LOLA 3M0JA 1WAWA 4TTUA 4MFEA 2D2OA 3W2NA 3GZ3A 3RITA 2DH2A 2PF0A 3W1QA 3QRHA 1LWHA 3EWBX 4XAYA 4P8XA 3ZM8A 2E6AA 4O8RA 3R5EA 3M43A 4C7DA 3GSMA 2OQHA 5HPOA 3AMKA 1A5MC 1XF0A 3VM5A 4IXHA 4PB3A 2CLIA 4RXGA 3FVMA 1TZ9A 1PBGA 1R3TA 4NX5A 3IWPA 1MFUA 2XWDA 4OV4A 3QN3A 1J5TA 3THAA 3UD6A 1F8MA 4B90A 2QUUA 1YLVA 2WLYA 4UTKA 1A5KC 1FWNA 3LCGA 3WQPA 6PTDA 1EYWA 2XGZA 1FX6A 3CT7A 1YADA 4IMGA 3WQEA 2PGFA 4UCFA 2A4AA 5BU9A 3L5LA 3DZ1A 3VC5A 5HR7A 3EAUA 3C2EA 4IG2A 3PB0A 3FYPA 1ODZA 2AGTA 3KHDA 2VZVA 1E4IA 4JZ5A 3SQLA 1JPKA 1HVQA 3NQ2A 3P8JA 2R1KA 3UGVA 4US5D 2FIQA 3PNUA 1IGSA 4HNLA 1E70M 3TXZA 2PURA 5REQA 3W7GA 4O1CA 3C2FA 2E1DA 2YZ5A 3GVVA 5DXXA 1ISWA 2FLIA 2Q8LA 1WXYA 4DZIA 1XCFA 3RX4A 1JVNA 2A5HA 2P10A 4DO7A 3ATYA 1DXIA 1I0DA 4MAZA 1TZ7A 2A0NA 3RILA 1F07A 1TJ0A 4DJDD 2FJUB 3GYEA 2XIIA 5AC5A 1DJQA 1OZMA 3G0XA 1XFCA 5FAGA 3CEUA 3CNYA 3HM7A 3KVJA 5B7ZA 2WSQA 4NI3A 4JKMA 1IEQA 5K4ZA 1ZALA 4UOJA 2ZZ1A 1XCWA 3G6LA 4FX8A 3E0VA 2SFPA 3FXGA 2P8BA 2HE5A 4NAFB 3SQSA 5LGZA 1PWLA 1SW7A 5I06A 2D2HA 1KM0A 4QX4A 3NQBA 3VIOA 3P7YA 4QHRA 4ML9A 3ALGA 1KCZA 4JXCA 3J7HA 2DP3A 1UZDA 1DVJA 1QNRA 2VEPA 3W71A 3WL0A 4MB4A 3E2VA 3O8AA 4IPIA 3PAJA 1AQMA 1Q66A 2ZDRA 2ZX6A 2A3LA 1ZZMA 3STFA 4HYWA 3LENA 4HHHA 2MANA 3SI9A 3TMQA 5C8BB 2BX7A 1R86A 2VEFA 1ONWA 4ZSTA 4W86A 3UR8A 3TW9A 5D2YA 1DJZA 1J6PA 2Y62A 3ARTA 1MQQA 3QTGA 3RIKA 4LUTA 2YL6A 3QTPA 1KBKA 3QKZA 4GG9A 1EDGA 1GOXA 3QYSA 5D30A 1TG7A 1UJPA 2P53A 4BI6A 5A5WA 2XISA 1VFMA 4PCNA 2DEPA 3I4KA 3K8KA 2D23A 3M47A 2VI0A 3NNTA 3R0KA 4FA3A 4K7VA 3CGTA 4O4WA 4M19A 3FX4A 1Q6RA 3WQDA 4G2DA 1HP4A 1D8WA 3OA5A 4PC8A 4AF0A 3MMWA 3LN3A 5LKYA 1H41A 4Z2HA 1ME9A 4HOWA 5C2CA 3K8MA 1SMDA 1Q4NX 3W7PA 1Y65A 2NV9A 1KR1A 3M0XA 1IE7C 1JJKA 2BP1A 3R25A 1IHIA 4XO6A 2DZXA 1EF2A 1W5QA 4D6CA 2DZTA 1AFSA 1UKTA 4ZB0A 1UQYA 1LBLA 3BQ5A 2DSZA 3D0CA 4ZB5A 4MPKA 1E0VA 5G4WA 1M7OA 3L9CA 4OIFA 4TQTA 1UWRA 3E74A 1Q6DA 3DYMA 3M0ZA 3B40A 4IP7A 1JZ2A 1K03A 3T0AA 4IOTA 3P0XA 1H7RA 1Y7VA 3JZUA 4WXZA 3E9AA 4K1GA 3BTNA 2VC6A 1Q6FA 1BPLB 1UUOA 3FW6A 1PKMA 3A4XA 1IGWA 3EEGA 4FNRA 5FL0A 3PBMA 4WKFA 4HPJA 3N12A 4D72A 1R2TA 5FJUA 4L5ZA 3RPTA 3KDOA 3W1XA 3BLFA 2GL5A 3UG3A 3GVWA 3RMJA 2Z26A 2D73A 4GZEA 1VZWA 3P74A 4QS6A 3R58A 1FKWA 1KXHA 3RN6A 2YR1A 2I7GA 1FFQA 2CZ5A 2VRJA 8CGTA 4KGLA 3AZTA 2Z6IA 1JPDX 4DJED 2IXUA 1OEPA 2YFOA 3MHFA 4GWEA 1QNOA 4GVGA 1QI5A 4F0KA 4NJHA 3ZLFA 3P14A 2A7PA 4O18A 4JN7A 4H00A 4S2CA 5G2WA 3NQVA 3FSTA 4QDPA 1GVIA 2OX1A 5I00A 1F6KA 1JUKA 4NT0A 2CXGA 3VTRA 3PUGA 3W6MA 2JKPA 2Y7GA 3Q58A 1S39A 2BG5A 3CV2A 2VL4A 2GPTA 3KDNA 1XGDA 4NNCA 4K2SA 4H41A 4ZZ9A 3UZ5A 4OUEA 3RMEA 4JTQA 4FIQA 3WMBA 1W32A 1W56A 3CEPA 3CYJA 3WBXA 4H9VA 4FXRA 1V0LA 2GOKA 3D47A 4HB7A 2JKEA 1X6LA 1A49A 5CAKA 4GUGA 3POHA 1EX1A 3T08A 2TRSA 3M9YA 4LW7A 4NRRA 4Z0JA 2OQLA 3IGHX 2VOMA 2I17A 4KETA 2RDXA 3HFYA 3I3DA 2WZIA 3W75A 5KINA 3DUGA 1OC5A 1W5MA 4AHOA 1Q2SA 4JYFA 2FJKA 1OG0A 8RUCA 3CL8A 3IJ8A 3SO7A 5AZ1A 4Y7EA 5FEWA 1KLYA 3KE0A 2Z2UA 1X1OA 4LYQA 3ARUA 3S6TA 2R1MA 5AC4A 1ZAJA 2DZUA 1FQ0A 3BJFA 4WY0A 1XDMA 3TZFA 2BVDA 1B4EA 3P6LA 4GJ1A 5K9CA 4GD0A 2V5CA 3E49A 5JH1A 5AB3A 3OVGA 3DFOA 1J11A 3TC6A 2GJXB 4XTDA 3AMCA 5DCEA 3T8QA 2ZX7A 3HFTA 2CZFA 1S38A 3BLOA 3NPXA 4HQVA 3K46A 2HZGA 1KD0A 4WX2A 2Z25A 3NO3A 2E09A 4L1GA 2C7FA 2ZWZA 4JR5A 1YPFA 4NHVA 4N9EA 3ZXWA 4MNMA 2YL9A 2Z1SA 4QM1A 9RUBA 4WJXA 4MWAA 2FDMA 3QJAA 2PDIA 5G4HC 1MDRA 1R7AA 1XV8A 3K5XA 3WK0A 2FPYA 1CXKA 4YNGA 4GNKB 1P7TB 1JDEA 3DKLA 3G3DA 5FJPA 2VRQA 1U22A 3O6AA 3V7PA 2EPHA 5C7HA 1CGYA 3V16A 5LA2A 1PIIA 1FY6A 3GXFA 4WXYA 4JIPA 3NSMA 3JR2A 2DZWA 2XHYA 1LORA 2OKOA 4YL2A 1UZHA 1OK6A 4V1YA 3EOOA 3ZSSA 2PGRA 2ZZ7A 1XYAA 3SIMA 3L65A 2WHKA 1OT2A 2VQUA 2DZBA 1BG9A 3C3NA 1KWGA 4RXFA 1OF8A 2ISFA 4WCJA 1NVMA 4WKAA 5I09A 4MTVA 1DJYA 5C71A 2I5GA 2TSYA 4ZQCA 5LNWA 3VNMA 3KRBA 3PJUA 1JXKA 3GHTA 1UOZA 4R7JA 4NAEB 4LRTA 4RKAA 3TYBA 2AAAA 3DU0A 4H04A 4IPPA 4S3AA 3OO2A 4OJYA 1MUWA 3DH7A 3WQ8A 2OJPA 4DB7A 5A69A 3W27A 4A4AA 4XO7A 2ZUWA 4O15A 1UD3A 1W3HA 3BZGA 3G3MA 4F79A 2EKGA 8XIAA 4ADTA 4H01A 4GXMA 1XLBA 2ACRA 2BY0A 3ARQA 3PZVA 1XYZA 2A1YA 3E0LA 5J5DA 1U33A 3OBAA 2FFIA 4K1WA 1W0MA 1H5YA 4A8NA 3LCHA 3L4VA 3IJ6A 1G7VA 2XSBA 3E3HA 5BOOA 3ZFHA 4Q4PA 3W37A 3BAWA 2WZTA 3KLKA 4H9MA 5EMUA 3R79A 1NFBA 3LD5A 3O3RA 3EYPA 3HB9A 4E4PA 4JN8A 3NQ8A 1VC4A 2WZMA 2CCRA 3HTWA 3RM4A 3G0SA 3NQFA 1VENA 5JXQA 1K9FA 4R5EA 4AD3A 3W01A 4O19A 4L4OA 2JBMA 2D0HA 4DM1A 1N8IA 2RUSA 1TQJA 3H54A 1WKFA 1JDCA 1E6XM 4UZUA 2RAGA 3UCCA 1R3RA 3KOWA 4IUGA 3UW6A 1DQWA 2QVNA 3TEVA 3R94A 3OZOA 4ZO6A 3TFXA 2E6YA 3EBVA 4AEFA 3VX1A 4HA1A 3WDIA 3NQGA 2CLPA 2WHJA 1TWIA 2Z1VA 2XH7A 1R9XA 1V0NA 7CGTA 4W7UA 3MCNA 2BVWA 1EF3A 3IS4A 1ZUAX 4NF7A 1E56A 2P1FA 4GUJA 4QJ4B 5HNRA 4QDMA 2EKCA 4I7UA 4LUSA 3W9ZA 1ECEA 3EGJA 2PU1A 2V81A 4JEQA 4IZGA 3KX6A 5SWUA 3EOSA 4LBSA 1YW1A 3VOJA 1A80A 3LRLA 3AWNA 2KAUC 3CL7A 2X40A 3FEQA 1E5NA 3WNMA 4FX6M 1ADDA 2CLLA 3W7JA 2UWFA 3AQUA 3BAYA 4TR9A 1PKYA 2Z0IA 1C7SA 4A6GA 2JQXA 3MKCA 1QI4A 2DJLA 2VHLA 4KFPA 4KWOA 2XFFA 1UP2A 3PJTA 4DM2A 1HT6A 5JMUA 4BF5A 3F2CA 1KM5A 3I6RA 3QV9A 5AYBA 1XLMA 1ISZA 4DBUA 4C6DA 3RU8X 3WD1A 1I2RA 4AD4A 5D32A 1WDRA 3MTWA 4W8BA 3PUEA 1TMHA 3K30A 4YN5A 4Y8FA 3VGFA 1IZKA 3UU0A 3G24A 4HNUA 4RE3A 4YCOA 2C14A 3APGA 2UV8G 1AA1B 2V6AA 1PSCA 1ZP4A 4H2HA 3S9IA 5CKSA 3QBUA 4C6EA 2G5WA 3KCOA 3NPUA 3ZT7A 2GQAA 3EX2A 3W25A 1TVLA 1LQ0A 3PBYA 3N2BA 4PB5A 4Q4QA 2XPKA 1OIFA 3WCZA 1OC6A 3GVGA 4IM4A 3LHTA 3U6WA 5CAHA 2X7VA 1LOSA 4M24A 1VKFA 1KV8A 3TYZA 1G7UA 3OB8A 3UQNA 4YTSA 3E2RA 2NW0A 4CLMA 1XBZA 5DX7A 5ECUA 1Q45A 4DWSC 1CX9A 1A0EA 4E2OA 1CW2A 2P0OA 4QBXA 4CU6A 1EX5A 4Q4MA 5I02A 1LG2A 1AK5A 2QAFA 4MAVA 2ZZ5A 4YTTA 4QAWA 1WBJA 3SUTA 2V3DA 2J7HA 3ZJ6A 3AMLA 3IUHA 5FJOA 3TU9A 4GPNA 2NT0A 2NXGA 5AC8A 1UC5A 3WLNA 1I2OA 1KBBA 3FJ6A 4PR4A 1TQXA 3VZXA 4PBFA 3I4EA 4GMEA 4AIOA 3VD7A 3FDGA 2XZ9A 3A22A 3WLMA 1XWYA 4QITA 4B92A 4GI9A 2HISA 1EEXA 1F3XA 3OYZA 2A3CA 5ABTA 4LX4A 1P0KA 1UHVA 3NCOA 2ZRXA 2CHOA 3FY1A 3GG8A 4GIRA 3TLLA 1XYFA 5KZMA 3S5NA 4AZ6A 3CM4A 2J7FA 3SCSA 3QFWA 2X0SA 2GGIA 1OWQA 1VRXA 1GQIA 3ELFA 2HPMA 3IK4A 4Z17A 4ZR8A 4RE0A 3D3AA 4XAZA 3CUGA 4ZOBA 3W7LA 3BE7A 1XLDA 1EUAA 1GKRA 3VD9A 2G3MA 4LV9A 4JIEA 4ICMA 2X1TA 2NSXA 4NNAA 3S5OA 5H8UA 3Q94A 4ZEPA 1IEXA 5K7JA 1LWIA 4UZSA 4XBKA 5EBUA 1DV7A 1OFDA 3LA4A 1EH9A 4AZIA 4BEUA 3GTFA 3HPFA 1XD1A 4AC7C 2XJ7A 3USZA 1GONA 3W3OA 4XZLX 3R89A 2ISSA 1XPYA 4M6QA 2AKMA 3NXFA 3FKRA 3N04A 4FIRA 1DTNA 1WPCA 2DZSA 4TU1A 1FWSA 3C8FA 4G7EB 4G5DA 1EJRC 1YMYA 2B7PA 1UPMB 2FZ9A 3VIPA 3SGGA 4QG6A 2C16A 5DF0A 3TQPA 3XISA 3ZZ1A 1OFAA 4TVCA 4O28A 4HZMA 1IXOA 1P43A 1B3YA 2DY3A 3VDBA 1VCGA 4LUYA 3BW2A 3MJYA 3UZYA 3AYSA 1PX4A 2ANUA 4C6NA 4C1NA 3LTYA 3WDQA 2E25A 3TN6A 3FGCB 1CGWA 2WNWA 4Q8TA 1Q5MA 4CNTA 4LFYA 1PYMA 1MRAA 4KKXA 2F6UA 2DZAA 4CD7A 5I07A 1L6YA 4B2DA 3KVMA 4A8LA 3H4XA 1AW5A 2Z4GA 4GGBA 4CCDA 3HPSA 5FJIA 4PRTA 3UWVA 1H4PA 3DHFA 3EA2A 2QUMA 1RR2A 1CNVA 3DERA 1F7BA 2RDTA 3BG3A 2A21A 2QDEA 2V30A 2C0HA 1ZAIA 3FIGA 1TCDA 3EA3A 1XRVA 4O11A 1IIGA 2BDQA 4UR8A 4U2ZA 5A6MA 5AYIA 2HS6A 5BWAA 1B90A 3GFZA 3TYUA 4DQWA 4E0CA 4GIYA 3W7DA 2QPXA 1VBRA 1BQCA 1XD0A 4H9ZA 3GFYA 3WH5A 3LV6A 3U57A 4B5SA 3BMVA 2RHGA 3A21A 3MA8A 3MO4A 3R0DA 5I3IA 5CXPA 3IANA 3B4UA 3T7VA 4NXKA 4A3UA 1DWFM 3AHXA 4AY1A 2EPOA 4GY7A 1RJPA 3T78A 5C9XA 3GNNA 4KERA 4BWLC 3R0UA 4WSJA 4JX5A 5B80A 5D9MA 2JF6A 2FMNA 2VVSA 2XH0A 1EUNA 4WOZA 3UJ2A 1BYCA 2ZRUA 3T0DA 1MW3A 1EGVA 3L0KA 1XYMA 3H23A 4NXSA 2ZVRA 3GHSA 2FZNA 1ICSA 2TODA 4P7NA 3NAVA 1W1VA 5I3HA 2DT2A 4HCHA 3UZWA 1ZTVA 1ZLPA 3BGGA 4GABA 1QU4A 2HBXA 2OKTA 2OB3A 1OYBA 4OKDA 2BWGA 3VPLA 4JTCA 4TX8A 1I60A 1A4MA 1TVNA 2E5BA 5DBUA 2PTZA 1KGWA 1P0NA 4QIUA 3GBDA 3BL3A 1KBIA 1B3OA 1F6PA 3QVQA 1O12A 1ML1A 1V0KA 4H6QA 3W85A 3IRDA 3LG3A 3QGAC 1LJYA 2GJRA 1KXQA 4N0RA 1OFQA 2G0WA 5JBEA 1FWGC 1PCWA 3UVIA 3E2QA 6REQB 2ZC8A 3BH4A 5CC7A 2QCDB 3DHUA 2Y88A 4M51A 3GG1A 4G6CA 1GW1A 5CBIA 1L6FA 5J04A 3GH5A 2AL1A 5ABEA 3URAA 2XUCA 4IJCA 4NX0A 1DJGA 3C3UA 1MXSA 3SCUA 5H91A 3B03A 5TIMA 1S3TC 1OB0A 1AQFA 3CTTA 4GHRA 3LGDA 2QJNA 4Y90A 1TELA 3H7UA 4Z2KA 1MW2A 1TV5A 4XZWA 1V3MA 1J0KA 1J9YA 3AIQA 3T0TA 2YL8A 4HTYA 3R10A 1G01A 1P1XA 2GJXA 4K37A 1V08A 2WC4A 1W1ZA 1UZ4A 1L8PA 4IISA 4JHMA 1VEOA 2PWDA 1KNWA 3R13A 4K39A 1JL8A 2V5KA 2CNCA 1AMYA 5BOFA 3HOJA 1TX2A 5CZKA 4DLFA 5DQPA 5BXTA 2DZVA 2XSXA 3IJIA 1R30A 4KIEA 1HW6A 1XHGA 4HKPA 4CCEA 4U2YA 5AVNA 2OVLA 4MFDA 4HU3A 4E8DA 3CBWA 1VFLA 2R1NA 1TCMA 4MY1A 4EPBC 1XG3A 2OEMA 3M5YA 3ITOA 2Z2AA 1AW1A 2OTDA 2ATSA 5HDRA 3W87A 3UF9A 2O55A 4JNZA 4Q8WA 2YXGA 3TH6A 3SN1A 1VFOA 1TR1A 5FESA 4GFIA 4OV9A 4WD0A 1FWTA 4JOMA 1A47A 4IFRA 2PTWA 5LIXX 4WSKA 3ITYA 1FVPA 4O16A 2Y7EA 1PL9A 2W61A 2WQDA 1XBYA 1XIGA 2RDUA 4LTSA 3OLDA 4S3GA 4LUJA 5C55A 3RR1A 1L0PA 3OLGA 1UP0A 1SVDA 4YWIA 3VE7A 3WF1A 1KGXA 1ZU8A 1KW1A 4NILA 1S2VA 5T8GA 2OO6A 1EWEA 3HA1A 1KM1A 3BAKA 1OADA 2Z7GA 2PODA 3P3BA 3WY1A 1X1ZA 4CVUA 1MQRA 4NAEA 4PGLA 3RYSA 3PPHA 2DT1A 1N8WA 1UD4A 1SJAA 2QPSA 3G1DA 4UMBA 3QQ0A 4AD5A 3PWGA 4YWSA 3PWAA 1F73A 3PM6A 2NSOA 1OCQA 1F8IA 1HXJA 4YVPA 3S2MA 2J8GA 1LM1A 2VURA 3A6OA 4W9TA 2YGYA 3QGVA 4M29A 4ZTYA 1QASA 3NQAA 3KLLA 4P2VA 1K3UA 4Q4RA 2XN0A 5CBJA 3S4TA 3PFRA 1QRQA 4AW7A 5DCDA 7TAAA 1LL4A 3VDGA 5K9DA 1TSIA 1BTCA 5GJMA 2YKKA 3GKAA 4P8UA 4TV5A 4MIMA 3A3WA 1ENUA 5AHMA 2PRHA 3ICJA 5AYXA 5HOSA 4MDPA 4GQQA 1CIUA 1TV4A 4XKYB 3BZJA 5L6UA 1ONEA 4DPQA 1EIBA 3Q67A 4KESA 4Z0SA 3KWSA 5A1AA 4DJFA 4RR4A 4CNUA 1NFGA 1KRAC 1PVNA 3ABQA 3M64A 4AB4A 4HA0A 4H8VA 3VX0A 3CIWA 1HKIA 3MV01 4D8LA 3AZSA 1PZ1A 2VYOA 1Q7QA 3B4YA 3SECA 1MZHA 3E5BA 1GOKA 1EWDA 1B57A 4LC6A 2NWRA 2WM1A 5FJTA 3GG0A 1UZ1A 3UWEA 2PCEA 2LLEA 4H83A 3V0SA 1FRBA 1PIFA 3CLMA 2XN2A 3VKDA 3CAVA 3RRXA 2QEZA 5CZSA 3GG7A 4PH6A 2J47A 3RRAA 4RDZA 2O7SA 1CYGA 3WD4A 4AISA 3UY8A 3B9AA 3N34A 3WLTA 2NX1A 6TIMA 4C91A 4REQB 3QPEA 3MUAA 5A95A 1I6NA 1QOXA 4YTRA 3WJWA 1J4EA 2D2JA 3AYTA 3UZXA 5JBDA 4US6A 4LXFA 5JVLA 4ZQRA 3BVJA 1BYAA 3M6DA 1HL8A 2Q3RA 1F3WA 2V38A 1Y5XA 1KFEA 1L2UA 3STPA 4H19A 1NDZA 3H4GA 3GO2A 1V3IA 3HV8A 2ZICA 4FMVA 4HOXA 5C2GA 1FOBA 3ARPA 4LJ3A 3OG3A 3TSMA 1B3VA 3NQEA 1T8QA 1BXBA 3ARYA 1XGZA 3T2OA 1ITQA 4DIAA 1DJHA 2F2HA 2OO0A 1QK2A 3MCMA 4GIEA 5BOEA 4I8DA 3WNNA 1UB3A 4O12A 3GIQA 2HSAA 5GQBA 4F3HA 3NR0A 1Q7MA 1VQTA 3IRSA 1JI1A 2PRLA 4FLSA 3KS6A 4ZOEA 4CNPA 1KCLA 4YHEA 2VFFA 3AYRA 3T1GA 3SQMA 5MF5A 2QAPA 2PU0A 3MSGA 2B31A 1SZGA 3HPZA 4IP5A 3G1RA 1EJSC 1VP5A 1RBLA 2YX0A 1ZRQA 1MUCA 2H6RA 2ZXBA 2OSWA 1GCYA 5CBBA 3KS5A 3E12A 4AX7A 4J1OA 1P6WA 2VD9A 3TFCA 1P6BA 1OJXA 1Q8JA 2DSVA 3N3TA 3S8HA 4UWMA 3OGSA 5DFAA 2D22A 2BODX 1EJXC 2DU2A 2CU0A 3TAKA 2MUCA 4I6KA 1OGSA 2XGBA 3BCFA 3WENA 4B4HA 2DORA 4XX6A 1YQ2A 1ADSA 1W17A 3FOKA 5AY7A 1X7FA 1QFEA 1W2VA 2Y85A 3KVLA 3H2EA 2JF7A 3WLIA 4CD5A 5JQ9A 4YPJA 3G5EA 2BXVA 4GI8A 3OYXA 3N17A 3VD3A 3JVAA 2WW5A 3P5YA 3DFHA 4K6AA 4YMZA 5EBAA 4MY8A 4LGXA 3TR9A 1R3YA 3H22A 4H9TA 3BC9A 3MWCA 4NJGA 4OECA 3GR8A 3MBFA 1R9ZA 4QE4A 4E2VA 2PI6A 5C0QA 2BVTA 4AZGA 3WLHA 2OX4A 3B8IA 3OPSA 1HN1A 3GXTA 4GK8A 2PDKA 1EBHA 1R3SA 5ENLA 3S1GA 1TJPA 3AALA 3BG5A 3OZPA 3AZRA 3TSDA 2YCIX 2CKSA 1WDSA 4Q4SA 4H1ZA 1XJBA 4W89A 2HQAA 3U0HA 1A0DA 3UWWA 4ZOCA 5M17A 4JIQA 3ATZA 4UFKA 3CQJA 2FZ8A 1RXOB 6ALDA 1B0IA 2WLZA 1ISYA 3LM7A 5CJNA 4RE4A 3BAJA 4RV8A 2VMFA 3N4FA 3KOZA 4PFHA 2TMDA 4ZO7A 4ZO9A 1XYBA 3UXAA 3G2GA 2W9MA 1TPUA 4LF1A 1OFRA 3QF0A 1PAMA 1TREA 1YEYA 5I2UA 3ABRA 3NTYA 1V77A 3MJMA 3PBWA 1KTNA 3E0WA 4OHQA 1YKWA 1ZFJA 4A2RA 2XH2A 2POTA 4LOCA 1SFLA 5M3WA 4PODA 1H7NA 1TRDA 1NFPA 4WQ6A 1PPIA 6CGTA 5D2TA 3EWUA 4MZ1A 7PTDA 1EXPA 4GZ7A 4HP5A 2NX3A 5JU6A 4DELA 3HQOA 3F4DA 3B8WA 3TQKA 3PTKA 1J0HA 1TYGA 3UFYA 3WLQA 1G4PA 3FV9A 1J2BA 4HOZA 3U4AA 3IIXA 4G7EA 1TMQA 2VEMA 5A6BD 4OVXA 3UPWA 5JH2A 3ES8A 2WM0A 2WC7A 3FEMA 4Q8MA 3TZNA 1B2YA 3ARWA 4ACZA 2WB5A 2Z00A 3N1AA 1M68A 3KWXA 1KV5A 1AZ2A 3S1UA 3HGRA 4GYPA 2QCCA 2RKXA 3GDLA 3RFAA 3TR2A 3OBKA 3NSXA 4IICA 4HHPA 3FGCA 3CAQA 1PX3A 4B5WA 5EMYA 3ZVHB 2KX9A 1M04A 4DVOA 1KRMA 2GUBA 4W85A 3PG8A 1E6QM 4UTLA 2CZEA 3CAWA 4QLJA 2XIBA 2CERA 4HYRA 4DYEA 4YVXA 3CUIA 5LXXA 4JEJA 4WGHA 1S2AA 4Z2GA 3H70A 4FB7A 3VKKA 3JS3A 3UYCA 2V63A 5GNYA 3B0XA 4PB4A 2YJQA 4UC5A 4MWAE 4PCPA 3R4IA 4HPNA 2FB2A 4LH8A 3NWRA 3KL0A 2XM1A 5DEZA 1NOFA 1L6SA 3S2NA 5IBXC 4JQ1A 1QDSA 3UA4A 5C6MA 3NOYA 1EQCA 4Z1BA 1SZNA 1JCXA 1MNZA 4TXEA 3W7KA 1C9WA 2POZA 4EXBA 3FA4A 2NWSA 1C90A 4FNTA 1GG0A 4GX8A 1AJZA 3W2MA 4KF1A 3W1UA 2EG8A 1DWGM 1QWKA 2VEGA 3EMZA 3LERA 1H1ZA 3TP4A 1LDCA 1W1B1 1FUYA 1J93A 3PZNA 4KEZA 2YB4A 4EPKA 1V02A 4YVVA 1M5WA 1PZ0A 2GK1B 1T0OA 3N2TA 1QMLA 3E1F1 1VFSA 5A8OA 3R11A 1MZRA 3NGFA 5EYWA 1OK4A 5HBFA 5D33A 1PHWA 2QCNA 3LTPA 1R47A 1UWUA 3LLFA 3D46A 2ATMA 4YXGA 3W2LA 1UD2A 4ZFCA 1JZ6A 2PC4A 3URQA 3T4CA 3M0YA 5FA5A 4HU0A 3RG6A 1R0MA 3BUVA 1PTGA 2HNHA 3R2GA 2VTFA 1EB3A 3QY8A 3LEPA 2W92A 1T41A 1R85A 3BLKA 1M7XA 1X97A 1C9DA 1KFBA 1EA9C 2QZRA 3WNLA 1CGXA 4ATWA 3HPXA 4O1DA 2FZDA 2V8ZA 1MDLA 3BXWA 1C29A 4JN6A 2NX9A 3RCNA 5I3DA 1ZJHA 4I7WA 3EOLA 4GBUA 3H2MA 6REQA 5MKGB 4V2XA 1LQAA 1ITUA 2CLEA 1QI2A 2PDCA 1ME8A 2KZHA 2ALRA 2RJHA 2UY4A 1DJWA 4AMCA 1V3LA 4NZJA 1I1XA 4EKJA 3EMCA 3BW4A 1L9WA 1Q6GA 3LTSA 3QPZA 3OQEA 4KEUA 1HX0A 4D8AA 3GUWA 3WH9A 3VCNA 3VKJA 1JQVA 4D71A 4JTLA 1I1WA 4S3CA 3F2BA 5LNSA 4PMJA 4XZBA 1UWTA 2Z6JA 3SRKA 1OABA 1HJXA 3T09A 1OD8A 2H3DA 2VEKA 4HZ8A 1WZMA 1O5RA 3T9PA 2PDNA 4PFMA 1L6WA 3ME3A 1ZBKA 5CC6A 2PC8A 3CQIA 1G6CA 1PEZA 3OBEA 4ILSA 3RLHA 4Q22A 2GLKA 2V2CA 4DO5A 1G69A 2FTPA 3EX1A 4CQCA 4EAMA 3ITVA 1H51A 2NXHA 1KB3A 1XBXA 4BR1A 4PSPA 4F9DA 2VM8A 5AC6A 1QTWA 1XLIA 4C6PA 1A53A 1UD6A 5DO8A 5H8PA 2ZZ3A 5IDZA 3C2OA 4B9ZA 4N02A 4YCPA 1Q6CA 4QRNA 1CZ1A 3LUTA 3OG2A 2HWGA 4AIBA 3TSBA 1JCNA 1OFBA 5D05A 4B5VA 3RU6A 2D0GA 1H1NA 2RJGA 1E55A 3OVQA 2QW5A 3DBNA 3KOYA 4QG8A 3AWOA 4HZ7A 3W07A 1GGOA 2PLMA 1Q4WA 3RM8A 4JQAA 3ONCA 4PMVA 3RX3A 3I6EA 3JRKA 4P61A 1Z3NA 3JW7A 4JFUA 3MVTA 4UNLA 1UR4A 4M8UA 4FALA 1JXJA 3WH7A 5DY2A 1QBBA 2WJZA 2GGGA 3ORWA 3CU2A 3REQB 1CXEA 3NGJA 1X8FA 2ZRWA 1UMYA 3C2VA 4GC3A 3U3HA 4B5NA 1AH0A 3PPCA 1ONXA 4CU7A 5G5IA 1NAL1 2HVMA 2E8ZA 3NDZA 5CPLA 4BF7A 3ZS4A 1X38A 1LLZA 2VCBA 4HNCA 4EF8A 4UTWA 5A8PA 1NWSA 1ADOA 4DJDC 2Q3OA 4RCXA 1WA3A 1QPRA 1SR0A 1JYWA 5CJMA 2RGMA 3GK0A 3FHQA 3LCLA 3MMDA 1JUBA 3WF0A 3NIYA 2VGIA 1BKHA 3U2OA 3TE9A 4NZ5A 1X39A 1V3KA 5BMXA 4Y9OA 3VXGA 2FGZA 4X61A 1Q85A 4PMUA 4V27A 4O53A 4D6GA 2VO5A 1SO5A 4KWUA 3PZGA 5HATA 3PSVA 1KCXA 2QULA 1YNQA 3A9IA 4CEUC 3HU7A 4XKYA 3VINA 5CG7A 3CAKA 4J4KA 4RX0A 3MUXA 3FK4A 2GWNA 2WAGA 1ELSA 2A6LA 3QLDA 3QEZA 3ALFA 3TTQA 2EXOA 1UJQA 2YBUA 2PUZA 5HQMA 1QXLA 2BY1A 1VPQA 1EA0A 5GNXA 3F03K 5KSWA 2E6FA 3CO8A 4ERGA 2G3IA 4KPLA 5F7UA 5I3FA 1K6AA 3CZEA 4EANA 2QIWA 1FWHC 2WPGA 2E28A 3LV5A 5I7GA 2ZUVA 1YXCA 3VMNA 4W4QA 2C3ZA 2IQTA 5ABGA 1K8YA 1FCUA 4C6FA 4QJ1A 1GYLA 1K77A 1TTJA 4WK9A 4TTGA 2GVEA 5I6SA 5XIAA 3C52A 3GH7A 1LLWA 4REQA 1YBQB 4ZQOA 1OX4B 2GZXA 3PJXA 3VOHA 3VOCA 1W37A 4MVAA 3GY1A 1RCOB 1ZP3A 4I7VA 1RVKA 1GZGA 2PGWA 3O6DA 3QOKA 1E3ZA 4H9UA 4C7GA 3VNIA 3DFNA 4DWSB 1LQ2A 3I3EA 3QR1A 4C6BA 1AZ1A 5FIPA 4X9SA 1UR2A 5T9CE 4FOKA 4RE2A 2H9AA 1A3XA 2VWTA 3APYA 3TA9A 4CQAA 2PZNA 4QJ3B 4AD0A 4M7SA 3M5ZA 3KRZA 4LY8A 1R87A 4LYPA 3K4WA 4GI4A 4A2SA 2OPJA 1JCMP 1OINA 3W4RA 2RH9A 3F4VA 6XIAA 4W5ZA 5CSRA 1V8EA 2YW3A 4M3PA 1E5JA 1UW9A 4RNIA 1NWRA 4LV4A 3WUFA 3EDDA 3QZEA 3II1A 1RCQA 4OUIA 1IWAA 1B5TA 1KKRA 2AOSA 3GW0A 4A05A 5A6JA 2WNNA 3SRHA 1W31A 4YJ5A 2ODOA 1NY1A 3IGXA 3EX3A 4J35A 1AL7A 4DBWA 1UWAA 3VIJA 3S47A 3WQWA 1P5BA 4W7WA 1ITXA 4KMQA 1O1ZA 3LCXA 1A5CA 1UBSA 1JDAA 4DJEC 2J88A 3GDTA 1Y5VA 2X0HA 3WEZA 5G1TA 4M7TA 4JICA 4S3JA 4AHPA 2OYMA 3WQVA 4PRWA 2MNRA 4V1XA 3BWWA 5ABFB 5LGXA 1W9DM 3S83A 1VYPX 5BMWA 5FKYA 3URBA 3DAQA 4H7CA 3VD4A 3UJFA 3DFYA 3CZLA 2IKHA 4N4QA 2AMGA 4EWJA 1VJZA 3VOFA 3KBVA 4V33A 4GC4A 5HA7A 2BXZA 2QVHA 2WSRA 5FAJA 1MWOA 5HJXA 1EJ7L 3T44A 1BVNP 3C0SA 2PDQA 4JCMA 3QHMA 2IPWA 3MSYA 3VVGA 2A3AA 4M1RA 3TJXA 1VIWA 5KETA 3AIEA 2R8WA 3SCPA 1TWDA 1CI1A 4J3TA 4A8IA 4Q4KA 2DUZA 3KOXA 1BYBA 2V3FA 5D2VA 3SUVA 2VRKA 1IT7A 2VFDA 1UWQA 3RAOA 4F48A 1ZENA 3LMZA 4WDWA 4W88A 2BNJA 3R6IA 3TTOA 2BGNE 2EG7A 4AZ5A 2P3EA 4MJMA 4ATLA 4AXNA 1YRRA 1JR1A 1K8XA 4RNFA 3W73A 3GVQA 3WNOA 3PN8A 4MB5A 4TV6A 3W24A 3W70A 3DENA 3VGEA 4J3WA 4FAMA 4AZCB 2GSEA 5AN7A 3L0NA 3PTMA 4JDYA 5BW6A 4JIRA 2ZDSA 2FHFA 1ZJBA 4KRUA 3WLSA 1QNVA 1JEZA 3OIXA 1JPHA 1WDWA 5HNUA 1ICPA 3NL5A 5T26A 4O57A 3WNKA 4DY1A 2PWUA 2WKLA 3PWIA 1EJVC 3WMLA 4H6EA 1EP2A 1EC8A 2WO5A 3CB3A 1IXNA 2AQOA 2ZX8A 1N82A 4LALA 4HK6A 1TB3A 3RDKA 4UTTC 1MQPA 3CZGA 1WZKA 1IR2A 1CXHA 4AY8A 1YE4A 2GQ9A 4C7FA 1VFTA 5AOUA 2YA2A 3PF3A 1EGMA 4Q8PA 2ADAA 2CXEA 4BQ2A 1EHAA 1XIDA 2Q01A 3QMSA 2BXYA 4PMQA 3WQ5A 3WK3A 5BYWA 3M44A 2OZ3A 3U4FA 3H24A 4Y8EA 3PUOA 1Z89A 3QGKC 1GWJA 3A5FA 3NL3A 1N2VA 1SZEA 2O9PA 2G97A 1YNYA 1X6NA 1FWIC 3EB2A 3ZWSA 2D3LA 2QYGA 2VR2A 1QJWA 1GTHA 4HN8A 3ZJ8A 3BW3A 3L67A 2XVLA 3XINA 1V3JA 1TUFA 2CLKA 3RO6A 1EJUC 3M5XA 3O63A 1GJPA 3VOGA 4WOQA 2OT1A 1CPUA 1U1HA 1IYXA 4UCGA 3AS0A 4LY4A 2G41A 5U7SA 2ISDA 3WF2A 4PUUA 1JULA 4LS1A 2VQTA 3ZVHA 2UY5A 4EAYA 3DOPA 1MFVA 4CCZA 1A4LA 4X9YA 3C0QA 1GTEA 4DXKA 1QO2A 3RF9A 4R9OA 3ANYA 2Q8ZA 1XG4A 2DZPA 2DVUA 2Q02A 4QSHA 2C0AA 5HWMA 4BEQA 1ECQA 3SDOA 1I2QA 2R1LA 4A22A 1C91A 4PBEA 2WMJA 4MWAD 4S1FA 1ICQA 1G9HA 4Q6XA 1UIPA 2FVMA 1F5ZA 1W1IE 1GVEA 1RK5A 2DIEA 1L2QA 3KHJA 3NFUA 1MMFA 3I7SA 3LU2A 2PDMA 4PUKA 3W7RA 1SW0A 4CQBA 4D1IA 4EXQA 1XLJA 2ZVIA 3MV11 2VD8A 2Y1HA 1BAGA 3VNYA 5F2GA 2YA0A 5E0FA 1S46A 1GQKA 5C9WA 1F61A 3HURA 4FNPA 4LAZA 1OGGA 1LRTA 1VBJA 3LSCA 5BWFA 3M4HA 2Y5JA 1YPIA 4O54A 1VEPA 3N19B 5CPSA 1LOQA 4FXSA 4LWWA 5FJJA 1HUVA 1S3HA 4WR3A 4EPEC 1HKVA 3DI0A 4R85A 2YCLB 1HTIA 4JD4A 2D3NA 2ZOXA 2UBPC 4KH2A 3MBDA 1I45A 3W1NA 2V67A 4G56A 1V5XA 5B7YA 5DRCA 1FDYA 2CZVA 1NDYA 3EWWA 5DLCA 1TZZA 1KM2A 5CGQA 4FR6A 4N9CA 2YA1A 2EAWA 1TFVA 4MMWA 4M6UA 1QPKA 5HK4A 5FOOA 4FX7A 4UTMA 5HMFA 4JQ3A 4DUVA 2INFA 4ADUA 1O5KA 3P84A 3DGRA 4Q7NA 4UTIA 2Q71A 5FI8A 2GDUA 3LBOA 1S2WA 4ASTA 2ALDA 3DN5A 5HULA 4J3SA 1QUMA 2CLMA 3MT1A 5A6AA 5CCZA 4XVEA 2IXVA 5H1WA 4ZGYA 4OQVA 3MQTA 4ONVA 2JGQA 1WOAA 1E9ZB 2CBIA 2ZXQA 4GINA 1VB9A 2QXWA 2BY3A 1YIXA 5CGMA 2ZZ2A 5LA1A 1KWKA 4Z2IA 1OX6A 3L2LA 3ARRA 3WDJA 2VKZG 3MC5A 1IQ8A 1KM3A 1XLFA 1HJQA 3UETA 4IPLA 2G96A 3JZEA 3VUPA 4XB3A 4KEMA 3MDUA 5I24A 4CGTA 3FKKA 1KTBA 4R9XA 4UB9A 1TJRA 2GYIA 3GLCA 4MJ4A 1T96A 4JDBA 3QV7A 3A4AA 4XTIA 1B1YA 1XL9A 3CL6A 1VRDA 1UR8A 2FH8A 5K4XA 1GYNA 1XC6A 4MUZA 1PIGA 4A3QA 3IVTA 3GC5A 3VIKA 2XFRA 1Z42A 2OU4A 2PDWA 4HU4A 3W53A 5AYZA 5A8GA 4C65A 2F84A 4TOQA 2XVNA 1AH3A 2OWCA 2FVKA 2NV1A 1KFJA 2ZXDA 4LVFA 1Z6KA 1OX5A 2E77A 3P93A 4PMZA 3UJSA 3M6YA 1UBPC 1LF1A 1BQGA 4Q6JA 1KFWA 2IPFA 4E2BA 1H62A 1RA5A 3OZYA 2J8TA 1GG1A 2WHMA 3PZOA 5IDIA 4X2PA 3LX9A 3AS1A 4IMEA 1P0BA 3IJLA 4K8EA 2QCGA 2PDBA 1E6RA 4JQ4A 4R33A 3H6OA 1JYNA 3F5JA 3RXZA 2VUNA 4MPQA 4YIWA 2NQJA 1KKOA 3SUSA 1Q6EA 4XIAA 3R8HA 4FXFA 4LVGA 3B8SA 1E43A 1KXTA 1E1EA 1LBFA 2B81A 4PBGA 5HWNA 3TTSA 4QLKA 3QFEA 3IV8A 2VFHA 4GKTA 1E15A 2FQIA 3TC7A 1E6SM 2GFTA 1G4TA 5C7VA 1V6TA 5EU9A 4FZIA 3O9NA 1ESWA 3L0GA 1XRTA 4Y9PA 4BI5A 3REQA 2WXDM 4L1XA 3GTNA 5LNUA 3RM9A 1U5VA 2CW6A 4IIGA 3R12A 3QMTA 3NUKA 3N2CA 1V79A 3QR0A 3EXTA 3ITLA 1DOSA 1HL2A 4YYFA 4GNJA 4LU0A 4WUIA 2CHNA 4ZE4A 3VKCA 3CWNA 4HGXA 1D8CA 1U5JA 4UQDA 1DQXA 3H4WA 4DHGA 3SUWA 4LCRA 3VI2A 4NASA 4HN4A 3DHDA 3HQ1A 5AKQA 3EKZA 1PCKA 1UP3A 4H9YA 4IHCA 1J8VA 4ZOAA 4C6KA 1EZWA 3NZ1A 1I2PA 3NPWA 4AIEA 1MEHA 1QK0A 4LYKA 4J7RA 5GJNA 1ODUA 3O7UA 4ATDA 3UR7A 3R8RA 4OU1A 1VHNA 3IVSA 2ZYFA 2CLOA 2TYSA 4HMNA 3UXKA 4ZL1A 1FA2A 3NEVA 4O52A 4KT2A 1TV2A 2EPMX 4MYAA 1XGEA 1UKSA 1KFLA 2CETA 2J79A 2HK1A 1W8SA 1Q65A 2CWNA 3ZMRA 1SO6A 3CZ8A 3GHRA 3GS6A 5AHIA 3T6CA 1DJNA 2YDQA 3O07A 2ISWA 4M56A 2PDPA 4PUJA 3QLLA 1E1FA 1AUSL 4F0SA 3SW6A 3Q45A 5F4WA 3B9EA 4DWDA 5IOBA 1PWMA 4N4PA 1GOOA 4XG1A 4C5ZA 1OZQA 4RZBA 3CH9A 2X09A 3EEZA 2E0PA 3S9ZA 2JEQA 3VNLA 3VM7A 2I9UA 3ID7A 4RZ5A 3VZYA 2OOGA 3KTCA 2Y2WA 4UTUA 3QH2A 4W84A 2OLSA 2PFHA 3LI0A 3P60A 4AX6A 4GQBA 3C2YA 4AWUA 1HFBA 4NY2A 1BVZA 1JGMA 2C19A 4IPNB 2NUWA 3VKBA 1NSJA 3W7HA 4C1LA 1QWGA 3VYLA 4AU0A 2YDRA 5TNVA 3CQHA 2ZA2A 3AXHA 3S0CA 1FWFC 3USBA 1PYFA 4GNVA 1HZYA 4AQLA 2GQ8A 3QSTA 1GEHA 1GJWA 3WJSA 4J3XA 4LAMA 4XUGA 3CQKA 3LB0A 1O60A 3OEXA 4IH3A 4DWSA 3UWYA 2WCAA 4GIAA 3M5VA 4IMAA 5G2HA 4GOAA 3LQLA 3DEQA 2XFWA 4I6VA 2ZRVA 5F2MA 1GVFA 1XI3A 1NF7A 1FWCC 2C15A 3PZQA 4DAIA 4XSMA 6A3HA 4QG9A 5C2XA 4J2PA 2JK2A 1B31A 4GLEA 2YB1A 2PEVA 5KITA 3L12A 3VE9A 1KQZA 4GA8A 1B3XA 1C93A 3HGSA 4ECLA 1DHKA 4U5IA 1GVOA 2BOEX 4QCFA 1SFSA 4C6QA 4EP8C 4A3HA 5A8MA 2OEKA 3LY0A 2OEJA 2P3ZA 3N9SA 1W5OA 1R38A 2IQ0A 1EEPA 1UR3M 2VGBA 3WLLA 1ALDA 5TBOA 4IIDA 2DW7A 3PHAA 2ZFAA 2HTMA 3CT2A 1RPXA 4X63A 4IMDA 1TPH1 3KBNA 4U5KA 2V5LA 5H2ZA 2O9RA 4E4FA 4DI8A 3OVPA 1BLIA 3R43A 3CUFA 4B2DD 1A0CA 3W0KA 2NT1A 2GJPA 4DYKA 4DBSA 4JHZA 2OELA 5I5RA 3BAXA 1JZ7A 4NQ1A 5A8NA 4KW2A 1A5OC 4MG4A 1TIMA 4J3VA 5LSMA 5HJYA 2JIEA 4UXDA 3ZLHA 1VIZA 3H8AA 3TTEA 2PWEA 3MDWA 3L23A 2WSPA 1OFOA 3U5YA 4V15A 4AF0B 1J10A 4O1FA 3HJZA 3N14A 4PCSA 3WD0A 3V0UA 1I75A 3PK7A 1O5XA 2WVTA 3OW1A 3TA6A 4CUCA 4GGHA 1K70A 1GHRA 4J2MA 4O4VA 4PTXA 1EBGA 2O4QA 4FOUA 3W6YA 3WYZA 1JGIA 2FYMA 3BQ6A 4ACYA 2G3NA 1PX8A 3L4UA 3LQGA 2NUXA 1GQJA 1DWIM 3WEOA 2WYSA 3ZJKA 4B5TA 1IV8A 3HF3A 1XISA 4WY0F 4GZIA 3I6TA 4Y9NA 1W2PA 3ITGA 4L4LA 4E8GA 3O1NA 1NJJA 2PSNA 1W3TA 4UFJA 5DRIA 1SO3A 3LPOA 3DBPA 5F4SA 1RHCA 1GKPA 1UD5A 3B06A 4W5UA 3W84A 3K13A 1UH4A 1QNQA 5E09A 3TWAA 2QDHA 1O95A 3DGBA 5D9NA 4Q8NA 5A8QA 6ENLA 1S5VA 4H6RA 4ICCX 1IXPA 3KOFA 3BPWA 1HJWA 1XRFA 2EJ1A 2QF8A 3HN3A 2INZA 2OYKA 2X0YA 2ACUA 3VNKA 2WKJA 3HQPA 1J6OA 4FOJA 1AH4A 2NXIA 1O7AA 4GUIA 2PP3A 3FJ4A 1LCOA 1SJCA 3SSZA 1GVRA 1SO4A 4DNMA 1OYCA 1XINA 4FSAA 2YBVA 2DFAA 2D69A 5LNRA 5IHRA 1XUZA 3AS3A 4AZBA 4I3GA 4QJ5B 3FJNA 2QGHA 3Q2DA 4Q7BA 3WN6A 1WDQA 1J0ZA 4O1AA 1VEMA 5DMMA 3AYVA 3P2VA 2ZX9A 4HHMA 3FSUA 5A2AA 2FKPA 4XD6A 4DUWA 1E3XA 1R3QA 1TE1A 5F1VA 1E40A 2OLHA 1I9CB 4L4MA 4TMCA 1TWSA 1JZ5A 1LRNA 3B8UA 2Y5SA 3DG6A 1XP3A 1US3A 3MHUA 4GVIA 1P48A 4M6PA 2OYLA 3W1TA 2X1RA 4FEZA 3AHYA 1BSIA 1Z48A 3QHNA 5FACA 1RJQA 3DIPA 3KBWA 3N15A 2WVVB 1XSKA 4D6EA 5E5CA 3B8TA 4I5UA 1GVSA 1MI3A 4OT7A 1NOWA 4BWLA 5CSYA 2W91A 3ZLGA 1K9EA 5AZ0A 1KC7A 1SPQA 4FLOA 4PE8A 3LHUA 2WCGA 4PL2A 5KZDA 3UR5A 4KEVA 2JKAA 1S1PA 3VCRA 1V7AA 3POCA 4FR1A 3WELA 2XTKA 3G1VA 3TK7A 3S2CA 1UH2A 1E4LA 1XQLA 1WO2A 2ZX5A 4HK7A 2PDJA 3WJZA 2ZE3A 4AZHA 4TVUA 3NVDA 4WY0B 4ZA0A 3V0TA 2J7BA 4XZMX 2J27A 1KRBC 1U83A 1C8YA 4PTDA 4POCA 1HIZA 1EL3A 3AMGA 2VWSA 2VCAA 1D2KA 1T7LA 1PZ2A 3TONA 3KEHA 1NDVA 1EKOA 2INEA 2I14A 9XIAA 2YBTA 4F4RA 3F2DA 3W1RA 3O06A 3EWYA 3A5VA 3VZZA 2NV2A 3I68A 1H11A 2Y7FA 4M81A 3GAKA 1K9TA 3GUGA 2AKZA 4R27A 2Y6ZA 4MWAB 5CGTA 1FHVA 2BHYA 2YSWA 1I8JA 2IPGA 1Z8AA 4QROA 3GU9A 3N13A 1VYRA 1WP6A 3PP7A 5I3JA 3RPMA 3STEA 3OU8A 2HVOA 1QW8A 1LUCB 2J9YA 4HNNA 3ZR5A 1V6UA 5AFDA 4XBJA 5DY3A 3U8GA 4RDVA 1G5AA 5M5DA 4PEKA 5A6TC 4R34A 1QNPA 1ZHAA 3TMLA 1OD0A 3FHAA 4ES4A 1ZJAA 2G37A 4QP0A 2J66A 4H8NA 4KCUA 1WQ5A 5FSEC 1DKWA 2YCKX 3H26A 1R3VA 2HPIA 1E1CB 3EWCA 2J4GA 4FNUA 3LPFA 4BZYA 3AICA 2YXXA 2ON3A 3WQGA 4NSBA 3GFXA 4KS0A 1PDZA 2OZ8A 1A5LC 4WLCA 3T4WA 1XICA 2CBUA 3B0VC 1RLCL 4WDUA 2PBGA 2XN1A 4HVXA 4MADA 3HG3A 3NSNA 1XKJA 3BANA 1YYAA 4LAUA 1Z7AA 2Y4SA 1EYEA 2DVXA 3UPBA 1FHLA 3L21A 3WEMA 1FWJC 1T99A 3H2AA 1VBGA 2NQ9A 4LVDA 1V6WA 4NKCA 4JY8A 4OGZA 1O94A 5IM51 4J3UA 4XZ9A 4JTRA 2G4JA 1KFKA 4JFWA 4EOUA 1XYLA 4O1EA 1B4KA 1W54A 3VA8A 3PZ9A 4NU7A 1U30A 2V3EA 1UKPA 3CXOA 3N25A 3TTYA 4HIBA 4DJFD 1ZBCA 3H55A 2J62A 2VT0A 1XRSA 1WKDA 5BXPA 4MJZA 5A6SA 4PMNA 3LPPA 4XIMA 2CEQA 3UNDA 3EWZA 4O0ZA 2PLJA 3VGGA 3BURA 1AQ0A 4QR6A 1PZ3A 3KP0A 4ORIA 3CTLA 4KIRA 3OZMA 3V1PA 4ZBCA 1DIEA 1VGAA 1O66A 2C8NA 3UJRA 3PJWA 1Q7ZA 3GWQA 4MF4A 2PRMA 3GM8A 3CWOX 4JTKA 4NAFA 1LT7A 4DX3A 3NYZA 3N4EA 4DO4A 1VAHA 1Q63A 4CQ9A 3BSHA 4ZQNA 5LA0A 1GW9A 4GCAA 2ZXAA 1RJRA 3TROA 4N6EA 3GIPA 1XQKA 3WBWA 1IZCA 2VR5A 1J96A 1ZY9A 3P81A 3UERA 2YIHA 4JX6A 1H09A 4Y9AA 3AAMA 4QNEA 3W6LA 3WFAA 4S3FA 2ZBTA 3QOMA 1W1TA 1BHGA 4GACA 1JFHA 1PUDA 2DW6A 1JAKA 4G1KA 3LDVA 1JZ8A 3W00A 1B9ZA 1MVYA 1XLAA 1OFEA 1H63A 4X2RA 3N11A 3G77A 2QF7A 3TLQA 3CUXA 3TOYA 4GO8A 3LZ5A 4AAJA 1DIOA 3PZMA 1PS9A 3CMGA 5I0DA 2CLHA 3THQA 3M16A 1O6IA 2W27A 3LXBA 1BEUA 2QJMA 3OGVA 3OGRA 2CFFA 1P0EA 3CC1A 3VABA 4AXKA 2WMKA 4H2CA 4HNTA 5I23A 1GT8A 1E0WA 3LBMA 1ZNNA 3MKVA 3FXYA 1UA3A 3SSJA 1EJWC 4NG3A 3HBLA 1SZFA 2Y61A 4WRHA 4O13A 5E9XA 1BWKA 1OF6A 4M1BA 4PZVA 5K9XA 3YPIA 3U5UA 4PMXA 1VBHA 2XSAA 2NLIA 3IV3A 4WDXA 1GZJA 4F9JA 4ROPA 4JNYA 2FFCA 2CYGA 1C7TA 2DQXA 4LBUA 4K8HA 4KBXA 1VJIA 2BB0A 2WHLA 3QR3A 1UR1A 2FGLA 3SCQA 3CO4A 3DG7A 1UH3A 1NWTA 3MUIA 3HG2A 3F4WA 1H49A 1GNXA 3GXDA 4HHLA 3PANA 5E0KA 5F2LA 4DUXA 5LHFA 1QO5A 1E4NA 2VC9A 4JGDA 5DT7A 3NZPA 2O92A 8XIMA 4R7WA 5FF2A 2PPGA 3NQ7A 5HMSA 3CASA 4P5UA 1I2NA 2EF9A 3O2LA 2DPEA 3EDKA 3H7VA 1W5NA 2XIMA 3DC8A 3N9RA 3NL2A 4UMCA 4ORMA 5D37A 4N2YA 3AHZA 5DBTA 3PPGA 2YDAA 5HMEA 4UQCA 1GJUA 2QMJA 1TUXA 3RPDA 1PTDA 1VF8A 1K6WA 2QQ6A 4X0NA 4A21A 3IIZA 5DANA 1D7KA 2VZTA 4IPJA 2WNQA 4C6LA 3IGSA 3AU6A 3K1DA 1E6ZA 1LRQA 2FPTA 4JHOA 3SB0A 1S1RA 4H7VA 2ZCGA 2R9RA 3LLDA 2ZUTA 4FPSA 1POJA 3F7JA 1BF6A 3VIGA 3SFWA 2DSUA 1R7OA 4XUYA 4RZ6A 2PWVA 3TVAA 2QGYA 3GNRA 5T91A 3C8NA 3ARXA 3I65A 4HJFA 2ESCA 1OVDA 1V6YA 4M0XA 2ISVA 1GUVA 4QGCA 2VDHA 2G3FA 4IGSA 3W1AA 4L1WA 4U31A 4U4MA 4JQ2A 1DP0A 4GH1A 3SGZA 3HGJA 4B3ZA 4IXXA 2FGBA 3SCOA 4CQDA 2QCHA 3FAXA 1FDJA 3W81A 1TA3B 5LIWX 4QNWA 5D2XA 3SCTA 3MUZ1 4W7VA 3GU1A 2IKIA 4A8RA 1DHPA 1WYIA 2R6OA 3W22A 1HO4A 1HGWA 4NJJA 4TX9A 1XIEA 4ZO8A 3WLOA 3W7MA 4FK9A 4FLRA 5DCBA 5ABHA 4DF0A 4PUEA 3WMSA 2R82A 4NL1A 3IARA 4WHBA 1YTKA 1KFCA 3TNOA 5U4NA 2J25A 3LCWA 2GSJA 3MHGA 3E2SA 1CWYA 1WAUA 4AWTA 2E1WA 2YXOA 3UR2A 5BZAA 3QPYA 3W28A 5A2CA 4IIBA 2AMXA 5AHLA 1QOPA 5T9BG 3WL1A 4DF1A 3A23A 4GQGA 3L66A 2J7GA 3S1VA 4D1JA 3PC0A 4DAFA 3NM1A 4E38A 4OOUA 4CN6A 3LHVA 2J6XA 2BOFX 4LNYA 2HV5A 4I8YA 3ZYZA 1VR6A 1B3ZA 1GYMA 2ZKMX 4C60A 4NRSA 3D5HA 1EDTA 1TPC1 4V28A 1ZSXA 5K2ZA 5KZ6A 3UT0A 1JF6A 2CITA 4OTKA 1HKKA 2ZRZA 3BLDA 3WD3A 3W7OA 4JAWA 3VU2A 4BJHA 3UP8A 4RK8A 2A7NA 4JCLA 4TO8A 2G4FA 4AYGA 3LPGA 2BHUA 5BRPA 3RCMA 1L6GA 4ZXOA 4L65A 1ZJIA 1P7TA 4GBDA 3WO8A 4N7QA 3T42A 4C1NB 2V2DA 4XZNX 2DSWA 3VDHA 3EDJA 1EGZA 1MSSA 4LNCA 1D3GA 4UR7A 1PV8A 2VXNA 4ZMGA 3CV6A 2E9LA 3SY1A 2VGGA 1QPNA 1KCKA 3UESA 4JTAA 2ZWYA 3MO7A 1MW1A 3WX7A 3HPAA 1JD7A 3GYCA 1EJTC 3STGA 4QEHA 2JFEX 2HXUA 4NZCA 1BWVA 1YHTA 1HKMA 4LB4A 1F2JA 3WJXA 2IS7A 1DEDA 1G1YA 4HMEA 3WLJA 4JTDA 3T0BA 4XQ6A 3HQNA 1WKEA 3H53A 2J8FA 1DWJM 2OGJA 3PZIA 3KTXA 4UFLA 2ABBA 1JYVA 2PWHA 2A6NA 1AL8A 1UOKA 5HUPA 2ZUUA 2W5FA 4LS2A 3PBGA 5IXEA 2F9RA 1ZL1A 4RW3A 3ANVA 7REQB 4GYFA 3P82A 1P4CA 4I5XA 2DIKA 4F2TA 5C9RA 4ZB2A 4WKHA 3BSMA 5CZTA 3SY5A 4GUFA 2Y63A 2EO7A 3IIPA 1RV8A 3S9YA 3D3FA 1REQB 1TV8A 1DJIA 2PTYA 1IR1A 4UFIA 3VDAA 2XM2A 2QUNA 5CPTA 2ZADA 5EPDA 4QLLA 5E9AA 1WZAA 4NZ1A 4DI9A 2Y70A 1XIBA 1EO5A 1E0TA 1F4AA 1ISVA 5IBXA 4LB3A 3C6CA 2R1PA 3AUOA 2PDUA 3RNDA 5IRPA 4UNKA 4DYJA 3DKJA 1B9BA 1CXLA 1IEWA 4DZ5A 3ECQA 3WDHA 5A6KA 4DXXA 2WVVA 4D2JA 4HMDA 3Q65A 3IACA 3MS8A 3AIBA 4HT3A 5PTDA 4CD4A 5GPRA 5C54A 2DUXA 4RLIA 3L2IA 4X22A 4IT1A 1Z9AA 1XR2A 2DVTA 1DL3A 2NVDA 1MW0A 3AIRA 3LHWA 1NH6A 3BICA 5LHEA 4CKQA 4GI6A 2IMRA 3PULA 4ML4A 3EOEA 3G1HA 2BLEA 1XCXA 1Y0EA 3C0LA 2PGEA 1LWJA 1MNSA 1CGVA 4L9XA 2I5IA 3WF3A 5J5RA 4Q32A 4F8XA 3MI3A 1UD8A 4D6DA 3GBEA 2QLYA 1E6PA 2ABAA 3S1XA 1KA9F 3GR4A 3INPA 4EX4A 4AVOA 3CZKA 2P76A 1OYAA 4RZ4A 3C2RA 2TPSA 1QT1A 3ITXA 2C1HA 1XLHA 3AROA 4XAPA 4H4IA 3HG5A 4KQNA 1X1NA 1CTNA 2J7DA 2QPUA 3HZ3A 3UXDA 3BMXA 1VFUA 5D8ZA 1K8CA 3LRMA 1XLLA 1IXQA 3U2ZA 2QJIA 3TC3A 2J24A 4IFKB 4TMBA 2C91A 2GVJA 2Z1KA 3TAOA 4EIVA 3EMQA 2PP0A 3VKAA 4C6OA 4S2BA 3WK1A 2OSYA 5M1TA 1J2WA 2QIIA 2Z28A 2PDFA 4WZHA 1XIIA 2BBFA 4FNQA 2V5JA 3A4JA 1KBJA 2GOUA 4DZAA 4PTWA 3UYIA 3DHPA 3GTXA 4MJ2A 1RD5A 3PTQA 4Y6GA 1TTPA 1RLDA 2V3GA 3L2MA 1EZ2A 2PB1A 1PHQA 1NTHA 2PBOA 1AD4A 3WQCA 1LL7A 5F1UA 1LUCA 1VFHA 3S5YA 5CC5A 3S6DA 4HPXA 2HDJA 1W8GA 1NWUA 2VFIA 3W26A 2Y7DA 4P8WA 3ONBA 4D6JA 1W1YA 2E5DA 4BFAA 1T5AA 3PPFA 2VEIA 5FCZA 1WKYA 2NQHA 4X60A 4HSHA 2D1ZA 1M9HA 4UFHA 4IX2A 2V2HA 1E9IA 1E1CA 1XC4A 3A9BA 4XD5A 4FHAA 2YLAA 3B0UX 1ZBWA 2E4TA 3T05A 2A85A 5AVHA 2E5CA 2VC5A 2Z1BA 3CS2A 1FWEC 2WJEA 1AG1O 5AYYA 4IP4A 4G1NA 3O16A 1IF2A 3FAWA 3H21A 4LAOA 1QI0A 2OSXA 3JUGA 1OCBA 4O14A 1OM0A 2OFJA 4EVZA 2X7WA 4GISA 3N6HA 4TX6A 5TD4A 1EHNA 1QAPA 1ISXA 2OT0A 1HJSA 2EQDA 3N2MA 2E3ZA 2FH6A 2BZNA 1TMLA 2ZUSA 4E3VA 1IEIA 4XV0A 3W2KA 1ITCA 4FF5A 1H61A 3LXCA 3S2LA 3WH6A 2EPKX 4PUDA 1Z41A 5D38A 3ZSTA 3CUZA 3T2QA 3WNPA 1XSIA 1M53A 4GYJA 3O6CA 3PFMA 2ZRYA 4C1KA 4G8TA 2JGYA 1PDYA 4JTFA 5BXRA 5FEZA 4AEOA 4NJKA 1IIHA 4JTTA 3WMCA 4ZODA 1UA7A 1UMLA 3U7BA 3RJYA 2PCQA 4US5A 2QUTA 2BFGA 5TF0A 4AYSA 1UCWA 3DESA 1RK6A 2FTYA 1LTDA 4KRZA 3TN4A 3GDMA 2OXNA 1NQ6A 3N73A 4D6IA 5D4YA 3A24A 1CECA 4MDOA 2O9TA 1US0A 4H9XA 1WCGA 3QW3A 1EQPA 3CLWA 3VO0A 5J8LA 3A3HA 3TQ0A 3W38A 2P88A 3WZ0E 1K9DA 2QDGA 4AD1A 4DF2A 4QQ3A 1RCXB 3P67A 4YLWA 2DT0A 4MGGA 4UIOA 5E70A 4DJDA 3GE7A 4L6OA 3OJGA 1IT8A 1QPQA 3HJEA 1WUEA 2EPLX 2F7FA 3N4AA 3MU7A 6TAAA 3M41A 1HQTA 1RVGA 4MLRA 2P50A 4Z2LA 3ZT6A 4HPGA 5IFTA 4M6VA 1J0JA 1TPB1 5HAOA 3K1GA 3QZAA 1JPIA 1TRIA 1RA0A 3MUCA 1R46A 3SAZA 3GNXA 2Y8KA 3QXBA 3GW3A 1XLEA 4CD6A 5AHEA 2D24A 1JRBA 2F8QA 4JBRA 1DTUA 1BF2A 5F2IA 4HA4A 3DYOA 1CB2A 8TIMA 4BQ5A 1OHLA 4AIUA 1QPOA 4EF9A 1JAEA 3TKFA 5TQLA 2YLLA 3MSDA 3G1YA 4Q8VA 2XDFA 1JNEA 5LIYX 3MP3A 4A35A 3A3XA 4R88A 1XXXA 1DJXA 5C70A 4LUIA 1KQYA 3UPMA 3A64A 4QQUA 3NL6A 5H8MA 3DDMA 1ZS2A 1EFZA 3IEBA 1ZB5A 4LAKA 5EB8A 4RW5A 1E9YB 2CKRA 2PDGA 4ZQPA 3TW7A 5XIMA 1UIOA 1K7EA 3UGRA 1K8ZA 3G1AA 4MNLA 3KW3A 4UR9A 3C86A 3CYVA 4C6MA 4K36A 1H7OA 2Z7KA 4IFOA 2BTMA 4PA8A 3W7CA 4DBDA 4JX4A 3S42A 4XD4A 4J40A 2C13A 4C6IA 2YZRA 1OC7A 3B0YA 4O10A 3VMPA 3W29A 3UXLA 8A3HA 2Z29A 1LYXA 1BD0A 1TV3A 3M0MA 7A3HA 1S2UA 3GC4A 1V6XA 3HIJA 4KGJA 1KM6A 5BROA 2ACSA 3TN5A 1JCTA 1XLGA 3AHVA 3DX5A 4HZ6A 4Q3MA 5FL1A 4PTMA 1W3JA 1X98A 3DI1A 1G4SA 2VENA 1DE6A 3MYOA 1NEYA 2XVKA 3SURA 5C9UA 4X3ZA 9XIMA 3E5PA 1OG6A 4Q8QA 4PSRA 1C3FA 3GQYA 2VVNA 3VFCA 1FWAC 3W2UA 3CMJA 3LS9A 4IGNA 5CLWA 4LVBA 4RDWA 3SUUA 1H1YA 4AFYA 2DT3A 1PTAA 1JZ3A 1FDZA 3P80A 3QQWA 4URIA 4NZFA 3CPUA 5HQLA 2X41A 1IZJA 4K7YA 1CBGA 5LIKX 5CC3A 2X2GA 4GCXA 1A5UA 3ARSA 5HQEA 3M0LA 5CPMA 2WV8A 3W7EA 1PXGA 2Z27A 1B54A 4ZENA 1F74A 1UROA 3CK5A 3GC2A 4J5NA 1DQUA 1O5QA 3WSUA 1ZAHA 2WVSA 1WUFA 4R3UA 1NP2A 3CQ0A 3NPVA 2Q09A 1FFRA 1HL9A 2J9ZA 3M0HA 4EE9A 4XBSA 4CD8A 3STCA 1US2A 4BK9A 2NZLA 3DECA 4UQBA 3NYDA 4TUFA 3G22A 3EXRA 4OBTA 3L4YA 1FWDC 3AS2A 4DJEA 1W1PA 5IFPA 3NDOA 4LBRA 2NUYA 4OBRA 1SSDA 4FO4A 4RNJA 2NVCA 1W91A 1JQXA 1C92A 1CDGA 2W3ZA 5AHFA 4PYSA 3KBMA 3W1LA 3GNPA 1OBAA 2I16A 1RY8A 4BA0A 2VZSA 2XU2A 2CBJA 1TA3A 3C56A 2QCDA 4JYEA 3ZOAA 4MWAC 2OMAA 3FLUA 4JIHA 1SZRA 1BGAA 1XBVA 2PDXA 2D20A 2OQYA 2HS8A 2GQ3A 4NZ4A 2GGJA 5CJ5A 1O68A 1AW2A 3NQ6A 2DDXA 4LRSA 4RNHA 3B9NA 4BCEA 4NIRA 3NOEA 3NURA 1VYSX 1QHZA 2X8RA 3UWQA 1H5VA 3G18A 1M3UA 5M03A 1SFJA 5GJPA 1YDVA 4ROQA 1F6YA 4UMAA 4TIMA 1A3WA 1KLZA 2WMFA 3AI0A 1T8XA 1G4EA 2YDSA 1U1JA 2B0MA 3CMFA 1DBTA 5HNNA 1TVPA 3CUHA 3AMDA 4RDYA 2WQPA 4U33A 1E71M 3FA5A 1BSLA 2BASA 1QW7A 3BLIA 4IMCA 3RLUA 1EP1A 3CPRA 2ASHA 3TX9A 4MHBA 1F05A 4WGXA 2ZUMA 4ZVJA 1HKWA 4B3LA 1KM4A 4KFOA 5CH9A 2ZA3A 2I9EA 4FNSA 3GDBA 3B8VA 4ACZB 1RSCA 3H7RA 2QUVA 5D9OA 1FH7A 4IL2A 4UTFA 3LHYA 3W7IA 1S2TA 3UWZA 3F4CA 3V5CA 3WDRA 1NELA 4PN2A 3KAOA 4Q7IA 4AUBA 2J78A 4UOZA 3PZTA 5I77A 2HNEA 3WQ6A 3ISIX 3W76A 3SZ8A 5G1MA 1LL6A 1SW3A 2B7NA 2F6XA 4F66A 1W3KA 4IJBA 4EACA 1A5BA 5BRBA 1S5TA 2E67A 3CB8A 4C5YA 3E0IA 3AXKA 2VP8A 4UTTA 2XINA 2DH3A 1J0IA 2EEXA 1OY0A 3EKGA 1AVAA 4YU1A 4I9TA 2DGAA 3NO5A 1LBMA 4XISA 3MB9A 3VIHA 5BCAA 3EOUA 1PB0A 2QCFA 2X16A 3O6YX 3TYDA 1WBHA 1HVXA 1GOIA 3MZ2A 5D04C 4BY3A 3PAOA 3VDCA 3M07A 2WJDA 3VGDA 1QOQA 4EWND 2DQWA 1LLOA 5EMJA 1ZQ5A 5CG0A 2FPVA 3LSBA 1BWLA 2WMIB 3SRDA 7REQA 1W3LA 4AWSA 1OT1A 3C4UA 2XWEA 3FVDA 1EXBA 1TV7A 3WLPA 2WMGA 4AZ7A 3AUJA 2WVUA 3E6EA 2RDWA 4E2DA 1XW8A 3PB2A 2QDDA 2C71A 1JCYA 2GWGA 4LEFA 3UG8A 1RH9A 2VC7A 5LXEA 1THFD 1ONRA 3E02A 5H6HA 4GUHA 1HF6A 1UC4A 3UCQA 4MNJA 3FDKA 4NUWA 4LCSA 1REQA 5DMNA 3VOIA 1RD6A 3MYPA 4Y2WA 1GORA 1SYTA 3OOQA 1TPWA 4IWWA 4GH3A 4ZSUA 1V93A 2ZTKA 5FEPA 4Z2JA 3TJIA 2X42A 1UWIA 3QV6A 3DFSA 4H8HA 1RBAA 2HBVA 2X1UA 4JKLA 5GNZA 2QNEA 4LYRA 2ZE0A 1BFNA 3W02A 1Q6OA 4HJWA 4QCEA 5F4XA 4H6KA 4S3DA 4KFNA 3BGJA 4DN1A 4AY7A 4M5PA 3SCRA 1GOWA 1AJ2A 3ARZA 3O15A 4LC8A 4D9PA 1UASA 2GVLA 3MP5A 3RJXA 3F5KA 5FF7A 1W5PA 3AXMA 1VFFA 4A3YA 3V75A 3ABSA 3B9DA 5JUVA 1QW9A 5EMKA 1WDPA 3LBCA 1WZLA 3H2CA 2PE4A 3M0IA 4GZJA 1OQFA 4JTJA 3LM3A 1KXVA 4R7OA 3KZPA 3MZNA 2Z1WA 4GVFA 4XAFA 1RPKA 4I9AA 4CNSA 4MB1A 1EC9A 5LIUX 5XINA 3K4DA 2V0TA 3B3DA 4MKNA 2IKGA 4IQDA 1HO1A 4I90A 1T6MA 3T0CA 1TTIA 2XIJA 3W83A 1UR9A 4N6FA 4XZHA 1ZCOA 2A3BA 3KCLA 3A47A 2YFNA 1YNPA 2F6KA 1XPGA 4JTGA 3OTRA 3VMOA 2QV4A 3KRSA 4PUMA 4UOQA 3CIXA 1MXDA 3DFQA 1GPWA 1OGBA 4B9YA 2X1SA 4O0KA 3B04A 4PMRA 1F76A 1PKNA 3N2OA 4ZTXA 2OLAA 4QDWA 5BXSA 3L68A 3VNDA 4IFKA 2VFEA 2OGYA 3BSGA 3KVKA 1YTEA 3UEQA 3UJEA 1YPXA 4R53A 3TYCA 3OIHA 3IK2A 3WQOA 4D8ZA 2UY3A 5HINA 1S5MA 4ZFMA 1VBUA 2ICSA 3HV9A 2R94A 3NZRA 1E9LA 3ERPA 2GGHA 3AJ7A 3SJNA 2I5QA 2XVGA 1F3EA 5FF4A 3LOTA 1GQLA 4CNNA 1E51A 4F0MA 1H0GA 1GHSA 3OLIA 3H12A 1M6JA 2YCEA 3QKEA 1RQBA 4ENLA 3M0KA 2D0FA 2CBVA 4IF2A 4IX0A 1FCBA 3MWAA 4AD2A 3CHEA 4IJRA 1LP6A 5HJLA 1H7XA 2VX7A 2R14A 5I3GA 2E40A 4BKNA 4UUIA 1XIHA 7TIMA 3IAQA 4PTNA 1NQKA 3M7WA 3VGHA 4IGHA 1R5YA 3CHCA 4U10A 3U2CA 2G3JA 2D2GA 3A12A 4LVAA 3M7SA 1E72M 2OODA 1W9VA 1FHDA 3GVRA 3OODA 4OE7A 3IGUA 3B05A 2OWWA 5KEZA 4UTJA 1A50A 3U9IA 3PBVA 1CENA 3GKFA 4E4UA 5DELA 3I3BA 3CHFA 1UG6A 1DPMA 5JIWA 3U48A 4PCFA 2BV9A 1JNDA 1SFTA 2GJNA 2WBGA 3BARA 4ZQMA 1E6NA 1VLIA 3ZIZA 2FZMA 1JDDA 3CIVA 5D02A 3H2OA 1D9EA 3G6MA 3DG3A 1DWHM 3QY7A 4Z1AA 3FYOA 1BXNA 1H7WA 3WUEA 3SGUA 5CQ1A 3SBFA 2X05A 2XH4A 3N29A 2H3BA 5MHBA 2E8YA 3UCDA 1V3HA 5KMYA 4S39A 3B0PA 4K68A 4AC1X 2ZQ0A 2XVPA 3ZR4A 5I03A 3Q4DA 5HUOA 4KWVA 3P5ZA 1TO3A 3CV1A 1X7IA 5E0CA 1AQHA 4GVHA 2FHBA 4PUNA 5BRQA 3PUDA 3IJ9A 7XIMA 3KL5A 3WK2A 3TWBA 4W8AA 1IWBA 3L4WA 3R7MA 3VNZA 4CVWA 3R8GA 4B16A 3BLLA 1MUMA 2WJFA 4LQ1A 4NZ3A 4X0VA 1JCLA 3OLEA 1CLKA 4MM1A 4LCQA 5HWJA 3MUY1 4JTUA 4P8VA 5ECVA 2VZUA 5FJRA 1QATA 3IVUA 1SMAA 3W88A 4IQLA 3DXIA 1XSJA 1SQ7A 1I0BA 3LHZA 3LNMA 3BJTA 1Q6QA 3N2XA 3NQDA 4HSOA 3KZSA 3BAIA 4MLJA 4PMOA 2QCMA 1V4YA 1W6TA 3PZUA 5G1YA 3EX4A 3VGBA 2TAAA 4CN1A 2Q8XA 3GXNA 2AQWA 1NU5A 4DXVA 1N8FA 2Y24A 4DWSD 2X1IA 2XG9A 4XK2A 3K4AA 2H90A 3MPGA 4ZE5A 3PTDA 1U1UA 4LS0A 3TNBA 1YDNA 5HNTA 2P8CA 1QHPA 1TTQA 2VX5A 2R91A 2PD5A 2VUYA 3TYAA 2VDGA 5FF0A 1W3NA 1H7PA 2W62A 3GX9A 4BF9A 2VFGA 1WNOA 3PR2A 3WLKX 2E9MA 1ZBVA 3AOFA 3WH8A 4DUOA 3H2NA 1FTXA 1XUUA 1HNYA 2VELA 3NXLA 1XX1A 5K3VA 1TX0A 4KCWA 1XH2A 2CHRA 4A3RA 4DLMA 1UPPA 5A3HA 2W79A 3A13A 4LF2A 1M7JA 2O4MA 3BLPX 2NQ5A 2PS2A 2WBKA 2H9AB 3HMJG 1K02A 2UZ9A 2VNCA 1BYDA 2CC0A 1XIFA 4JPGA 4MSSA 4I9JA 1YX1A 3GZAA 4OOZA 5EKYA 5DMLA 4JS3A 1XDLA 4MKSA 1XYCA 1JYXA 1C8VA 4E6MA 1S5WA 3ZQ9A 1XDJA 3WQFA 4YS1A 1J79A 4QAIA 3BGAA 4IQJA 5L9FA 5CLTA 3LI1A 4Q4OA 1VJSA 4WIWA 3UBPC 2FVLA 1NF0A 2O56A 3QHOA 2C1IA 3S2JA 1DXFA 1CGTA 2DIJA 1RQEA 3IUDA 3UG4A 2GVGA 1TWZA 5D8WA 2IQDA 1QVBA 3MANA 4LEQA 3V5OA 4DPPA 3JU2A 1P1MA 3BO9A 3WBAA 2Y89A 1CCWB 1YDYA 1MYRA 5G4EA 2B4GA 1RP8A 1FXQA 4ERIA 3W86A 2WZHA 1K1DA 3LNPA 2Z2BA 3KXQA 3WF4A 3SJ3A 1GK8A 1J0YA 1V03A 3MI2A 4XWUA 3ZWTA 4KRTA 5E93A 2ONEA 4YTQA 1LZOA 3CHDA 1MEWA 2GK1A 4JIIX 1TPFA 2GUUA 1JFXA 3GB6A 4BHYA 2EJAA 2CZDA 2VX6A 3MW7A 3UZJA 3V36A 1Q8AA 2W6RA 4OBSA 2REQB 5HPCA 3L7RA 4AG0A 4GXWA 3BMWA 1DIKA 3T07A 3ITTA 4N42A 4IL0A 1RY0A 3U2EA 2HROA 3GXMA 2B7QA 4LT9A 1AJ0A 1BVWA 3P62A 3GXIA 1TPDA 2GVYA 3NVTA 3KBJA 1HG3A 3VILA 3UZZA 2ZIDA 2L5HA 4AH7A 1SGJA 2VJXA 1EOKA 3KP1A 4LPCA 3V3WA 3ZR6A 1HJUA 4GFSA 2BVYA 3AJXA 1EDQA 2UY2A 3T8LA 4NI8A 4E3TA 4ALDA 4G7FA 2XIQA 2NQZA 3GH4A 4HCDA 1YDOA 2J7EA 2PF8A 1C8QA 3LXAA 1AMKA 4XD3A 1CT5A 4AVNA 2OOFA 3AIWA 2NQLA 2PA6A 2EBNA 4ZCWA 3AHTA 2GSHA 2Z1XA 2W67A 5CSUA 3CZJA 2OZ0A 1VHCA 3PS7A 5MKGA 2X2YA 5AHNA 3BG9A 3FNDA 5E6YA 3OQ8A 2WNZA 4PMDA 3BOFA 1LG1A 1XM3A 2VOTA 4JTIA 4JTEA 2PZ0A 1FKXA 1QR7A 3BOLA 1HP5A 3NZQA 5KTLA 1PE1A 2HXTA 1XH1A 3S3GA 4YTUA 3WD2A 3ANUA 4IIFA 3P61A 4IQEA 1N7KA 3W7NA 1M01A 1FWRA 3LK6A 2OWXA 4GJIA 3BDKA 3CWHA 3NG3A 3GNDA 1NARA 1J18A 4JL1A 4D6FA 2AGKA 2XZ7A 3RGTA 3THUA 1EPXA 2FDSA 4NYUA 3TUUA 2YYUA 3C61A 3SEPA 2YCJA 4O0QA 2YPIA 1K7FA 3SCNA 3WJYA 3S46A 3TCEA 3HO8A 4DZHA 4L7ZA 3GD6A 1FBAA 3S5ZA 2Q6ZA 1YTDA 1OCNA 2NVAA 4WJ8A 1E73M 3WDPP 5IHSA 4JYDA 3SRFA 1Z32X 3U7VA 3ZO9A 3GIYA 3S1WA 5AECA 4AEEA 7ODCA 4LANA 1XKYA 3PSWA 2OG9A 5M2FX 4XSLA 1QBAA 4I9MA 2JEPA 2EGZA 2YW4A 3PY2A 1F3TA 3MI6A 2F38A 2JIWA 4HYVA 3V5FA 5EL1A 3P0WA 1BRLB 1PO9A 3F1QA 3GNOA 4IGMA 3GTIA 4Z1CA 2AL2B 4S3EA 4FF7A 2PMQA 1GEQA 4NYYA 5AC7A 1XLCA 3EB3A 5A2BA 4DO6A 3WIJA 2PTXA 5D03A 1SM9A 2GGEA 2ACQA 5D2WA 4B3KA 3AISA 1M03A 1HGYA 2IUZA 3ABZA 1RALA 3PBUA 3IIOA 3K8LA 4WDTA 1POKA 1FH8A 4HU8A 2IKJA 2P0IA 1A5NC 5CZJA 5LNVA 1WV2A 4J9JA 4BQ4A 1XFBA 2XGIA 1YE6A 2FB3A 4DJFC 1R2RA 1TE6A 4INFA 5DT5A 1ME7A 3GDKA 3KRUA 4CEXC 3A4WA 4L56A 4PCTA 2H8ZA 2WMIA 5DN1A 3NA8A 1KTCA 1U2YA 3V1HA 2WSKA 2QJJA 5FSDC 1A3HA 4FI4A 2JALA 3EX6A 3ABXA 2WKGA 2BGSA 5C9ZA 1OIMA 1VCFA 1UKQA 1W9XA 1W1A1 4HK5A 1SU5A 1D3CA 2YL5A 1X6UA 1VPXA 1FCQA 3QZ6A 4N9DA 4RJEA 4H7ZA 1WDDA 3E38A 4L80A 2BY2A 2PWFA 3DYPA 3IJ7A 5KZEA 3W72A 2HJPA 1FHUA 2A7RA 2JE8A 3MP4A 1HJVA 6XIMA 1H50A 3VFLA 4JFVA 3TOPA 1SSGA 2QV5A 3AFBA 3ZJ7A 3M1ZA 3UA3A 3W2JA 4JY9A 3V18A 4Z1YA 3SM0A 4HCLA 2BMBA 3BV7A 2Y8VA 5HANA 4TVDA 4HA3A 2V68A 1RBOB 4M80A 4N9BA 3SADA 1WB0A 3FN9A 4UFMA 3UG5A 4F0RA 4W8LA 1DIDA 5BNKA 4C6CA 1X8CA 4IG2B 3G8RA 4O8AA 2QCLA 1E0UA 2Z24A 3AXXA 3AXIA 4D6HA 3ZVIA 1SR9A