4Q7IA

Crystal structure of engineered thermostable d-tagatose 3-epimerase pcdte-var8
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRYEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Escherichia coli
total genus 118
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4q7iA00
2Q02A 4YTTA 3VNMA 1BXCA 4J4KA 4XKMA 2X7VA 4US6A 2XINA 3AYTA 1QT1A 5XIMA 3UA3A 5H1WA 2ZDSA 8XIMA 5EMLA 3QXBA 5XINA 1XLAA 3DX5A 3P14A 7XIMA 1XYCA 4X61A 5TNVA 3AYVA 4Q7IA 4A8LA 4GLEA 1OADA 1CLKA 1S5NA 1A0DA 3GNXA 4PGLA 3U0HA 1GW9A 3XINA 1XLLA 3VNJA 1XIDA 3KBJA 3KBMA 1XLBA 2G0WA 4ZB0A 5H6HA 1A0EA 3ITXA 3M0VA 1XIMA 4GQBA 2GUBA 1XISA 3LMZA 1XLCA 5EMJA 2GVEA 4HGXA 5FA5A 4YTUA 3U3HA 6XIMA 3KBSA 4HNOA 4OVXA 3CQJA 3DBNA 3VNIA 4QEEA 1QTWA 2NQ9A 5AVHA 1O1HA 3BZJA 4KW2A 1XIBA 3CQKA 3KBNA 5B7YA 8XIAA 3ITTA 5B7ZA 3P6LA 4QE1A 3AALA 4DVOA 3BZGA 1XLEA 1TZ9A 1XYAA 3UVAA 4E3VA 1QUMA 3VNLA 1BXBA 3FVMA 2GYIA 3CNYA 1XYBA 2I57A 3C0QA 3KCJA 2QULA 9XIMA 3BDKA 3UA4A 1S5MA 1XIEA 1DIDA 3N4AA 2HCVA 3AAMA 2HK1A 3C0LA 6XIAA 5J8LA 2NQJA 3WQOA 5C9ZA 4XIMA 5AVNA 4W4QA 1XLKA 3M0YA 3IUHA 1XLFA 1XLJA 3JU2A 3QYSA 4XISA 1XP3A 2OU4A 2X7WA 4X60A 3BWWA 4XIAA 3UXIA 3XIMA 4EAYA 3L23A 1DIEA 3ITLA 3ITVA 4ZBCA 3CQIA 3TC3A 4HHLA 4LNCA 1XYMA 1YX1A 4A8IA 4K3ZA 4K1GA 4PFHA 5B80A 4G56A 2NQHA 2ZVRA 5XIAA 1I60A 1MUWA 3M0MA 3VYLA 4XSLA 1K77A 3ITYA 1XLGA 1I6NA 4QEHA 2GLKA 4A8RA 3KCLA 1MNZA 1XLHA 3UU0A 4QE5A 3C0SA 2HK0A 4YTQA 3OBEA 1DXIA 2XIMA 4A8NA 4YTSA 1XIIA 4DUOA 3M0LA 3KBVA 3IUIA 2QW5A 4QE4A 1XYLA 1XLIA 3M0XA 3BANA 1D8WA 3IUDA 2I56A 4X63A 4ZB5A 1XIFA 1XIHA 2J6VA 1DE6A 3VNKA 3CQHA 3CWHA 3NGFA 1XLMA 3QZAA 2QUNA 3KBWA 4YTRA 1XICA 1XLDA 1XIJA 2XISA 3KWSA 1A0CA 3XISA 9XIAA 4GJJA 2G4JA 5EMMA 3ITOA 4GJIA 4ZB2A 2QUMA 3KCOA 5I7GA 1DE5A 1XINA 3QC0A 4QDWA 5EMKA 4XSMA 4HHMA 3TVAA 4QDPA 3M0HA 3KTCA 4EACA 1XIGA
chains in the Genus database with same CATH superfamily
3ARVA 2EXOA 1NFBA 4E0CA 1BYAA 3LS9A 1XSJA 1KXQA 4NUWA 4CCZA 4OUEA 2Y8UA 3RU6A 4C6PA 3ITGA 2PTXA 4TX9A 3SRDA 4I8DA 4QTGA 4H9ZA 1LOSA 4F40A 1VFMA 1NDYA 4S3DA 2EPMX 3CHDA 3KBNA 4MB4A 1I0DA 2FPVA 4AIUA 3NDYA 3C0QA 5EA9A 1KWKA 1FWEC 3AZTA 4LS0A 1EC7A 2DSKA 3WJYA 3G1RA 4NXSA 2QJJA 3GG7A 3VPLA 3S47A 1YIXA 1XP3A 3UZYA 1A5BA 3IEBA 3TZFA 4ZFCA 5BWAA 1DQXA 3S42A 3LMYA 4DO6A 1JCNA 3W84A 4HNTA 1S3TC 4GUGA 5GJPA 4PMXA 3LPOA 3UWYA 3U4AA 2ABAA 5D2WA 3PJUA 4YTRA 2OQLA 3VKJA 2F7FA 1TA3A 2C15A 2PDJA 1HL9A 4UR8A 5EFDA 2HS8A 3PZIA 2WJFA 4Y9NA 3GTFA 2DT0A 4HZ8A 1R46A 9RUBA 3WBYA 4K39A 3TTEA 5A95A 4GKTA 2DQWA 3PG8A 3UWVA 1WOBA 3LLDA 2G95A 3WQGA 2NUWA 4AZ6A 4XUGA 5CZKA 3PBGA 3GM8A 2CKSA 1VYPX 4HTYA 5D9NA 3IRSA 1TE1A 1TPVA 4I8YA 3NDZA 3NVTA 1QHOA 3GNRA 4CQAA 3EEZA 5DQPA 3PK7A 4QJ3B 3W37A 2VWTA 2V8ZA 4LY8A 4W85A 5C9XA 2BY3A 1TIMA 3M46A 3CZGA 1JFXA 1NIUA 1TVNA 2ANUA 4HVXA 3VD5A 4RZ6A 3KOXA 2CLFA 2J7GA 2YPIA 5AZ0A 2Q8ZA 2HJPA 3OG3A 3KS5A 2B7NA 3PPHA 4WJ8A 2GJLA 1TPB1 1VIWA 1LG1A 4DLFA 3GXTA 2F8QA 4H8VA 5TD4A 5U4NA 3WDHA 4C91A 2ZUWA 2PPGA 3LV5A 1GWJA 3WLHA 2XFWA 2QW5A 3DGRA 4V33A 5AYZA 4TXEA 5LA1A 2BOFX 1DWGM 5F2GA 4LAMA 4HNVA 2FDMA 3AMGA 3T09A 3ITOA 3ZO9A 1KV5A 4HN4A 4Z2IA 3G8EA 3GXDA 1ISVA 3LNMA 4JEJA 4RW5A 3TFCA 4E6MA 1KGUA 2HE8A 2W91A 3GG1A 2VCCA 1PWLA 4G5DA 1XI3A 2DSZA 4ATLA 4ZO6A 2WHMA 3B06A 4ZO7A 3VM7A 3EB4A 2DORA 2HROA 4H9YA 3WMLA 3U2ZA 2CLPA 1X1OA 3DG6A 2VX7A 4LUIA 3ZS4A 4FLRA 1E3ZA 4JIHA 4GVGA 3G3DA 1BYBA 3SR7A 2I5QA 3R8GA 3R25A 3VIFA 4KW2A 4WOZA 1RUSA 2VR4A 1L2UA 1FWJC 2DH3A 5A6LA 3SGZA 1FH7A 2A3EA 3BURA 2YFOA 3BDKA 3KOZA 3B3DA 5BMWA 3O06A 4CN6A 2J47A 1E4IA 1EUNA 4DUXA 3UFYA 3CUZA 2PS2A 1QO5A 4O13A 4PL1A 3WL0A 4XD6A 5GNXA 3UR2A 2GQ8A 4QM1A 1H1YA 2Y85A 3DIPA 1K77A 4LAZA 3RN6A 3THDA 1W91A 4TVUA 3V5FA 1HG3A 4QR6A 3FXGA 1V8EA 4MWAD 4PTVA 3S2MA 1EYWA 1XG3A 3MV01 4YVVA 5DCDA 2GWNA 2PMQA 5CC5A 3CQHA 1Z69A 4WZHA 1LRNA 2QPXA 5EB8A 3VIGA 4JFUA 4HYVA 3NVDA 1V79A 3RAOA 3ALGA 2PCEA 4IFRA 4JOMA 4DF2A 5CLWA 4UR7A 3TVAA 4GXWA 1B3WA 3GVWA 1KLZA 5MHBA 2QT3A 3W7PA 1MDLA 4LAOA 5LIKX 3LLXA 4A3UA 3MCNA 4IFKA 4P7NA 3F4CA 1T96A 2BXYA 1XGEA 4E4UA 1TCMA 4GZJA 4ZB0A 3VOIA 3AU6A 1DJZA 2XWEA 4OGZA 1RK5A 1UD4A 4RXGA 1XLCA 3SI9A 2QVHA 2V2CA 3DHDA 3P2VA 4QFUA 3K1GA 4AY8A 2NQ9A 4I9MA 3VDGA 5B7ZA 3AALA 4CNOA 3VCNA 4BCEA 4ADUA 4IT1A 3RUBL 4HT3A 4ZEPA 3G0XA 1G67A 3IPWA 1ICPA 3HQPA 1WZMA 1Y5WA 3VUSA 3KL5A 3FN9A 1XD1A 4BF5A 4JD4A 1EP2A 3SN4A 1HTIA 5F4SA 4XG1A 3REQB 1RP8A 4DJDD 2XG9A 5DY2A 3NOYA 3BV7A 5GVJA 2QEZA 2CU0A 4GH1A 2FGLA 1DOSA 1UUQA 1NM9A 3E38A 2CEQA 2I7GA 4UOZA 3HPAA 1B1YA 5A2CA 3N29A 4BKNA 3WLLA 1FWNA 3S83A 4LW7A 4A3QA 1SGJA 5BNKA 3UG3A 1K7FA 3MPGA 3HURA 1RJRA 1XR2A 2EG8A 2G41A 3QMSA 4LTSA 4DNMA 2ZA2A 1Q7MA 3W86A 3H2EA 4W87A 1LOQA 1YW1A 4K8EA 2WLZA 2D0GA 3N6HA 1ZAIA 2Q71A 3AQUA 2WMIA 3UXAA 3WK1A 1QOQA 1SYTA 4XZBA 4NJGA 3N18A 4I5UA 1YYAA 1XKYA 2O56A 3K4WA 3NL2A 4HA1A 1CECA 2Q8XA 5IM51 3GNDA 2GGEA 1TV2A 1NFGA 2HK1A 4PB5A 5J8LA 2DUZA 5REQB 1GUVA 3W25A 1C8QA 1R3SA 3QEZA 4QIUA 1Q5MA 4RXFA 1C7SA 1JDDA 2W6RA 3BWWA 2E6DA 4K38A 3FFSA 5ENLA 1FHDA 4GJ1A 4DIAA 3T1GA 4BJHA 4JL1A 2XIOA 2ZIDA 3WJZA 3UZ5A 2XM2A 2QDHA 4UZSA 4AD3A 4DM1A 3W74A 2J7CA 1NOFA 2CNCA 3QHMA 2QNEA 3L68A 2X05A 3VINA 2O55A 3NL3A 5C9WA 3UEQA 3K2GA 1CGYA 1JDAA 4LNYA 4TTUA 2REQA 3NO5A 1T8QA 3U4FA 3TN4A 3W70A 1ADSA 5MKGB 1XDMA 1EZWA 2NSXA 2QJMA 4OQVA 1DWAM 2IW0A 3MU7A 2F6UA 3H8AA 3AYVA 3WLJA 3FLUA 1R3RA 2G50A 5BYWA 3TTSA 4DO5A 5FEWA 2FFIA 1FWDC 3ZLFA 2W62A 1ZUAX 4DLMA 3TV8A 2B7OA 3L2LA 2XDFA 1BWKA 3TXZA 4AEFA 3MW7A 3GR7A 3QGKC 3TNBA 4KEUA 3BLPX 2NV2A 1Q13A 1BXBA 1AQFA 5HINA 3WMSA 1V5XA 4IM4A 1U1JA 2V3FA 6XIAA 4GO9A 4QGCA 3ME3A 4XZHA 1NTHA 3T9PA 5I3DA 3O2LA 1UUMA 1VJSA 1TTPA 4GQQA 4PULA 4XIAA 4JKKA 2CLOA 4XAGA 2ALRA 4D6GA 4JFVA 4JFSA 3LBCA 1CXEA 3BG9A 2A2IA 1YBQA 4JTAA 3DN5A 3GXIA 5LA0A 3WUGA 1ZCOA 4HYRA 1PX8A 3R5EA 1EQCA 1YXDA 4HNNA 2FDSA 2PDIA 4Q8MA 2QUMA 1JIBA 1D9EA 2HZGA 2WHKA 1O94A 4YHEA 3FJ6A 5CZSA 2V81A 4GNJA 1P6BA 4MYXA 2PP1A 1W9UA 4QCEA 1W5NA 3QC3A 1NDWA 2WPGA 2YLLA 2GSHA 1JCJA 4FX8A 2WMJA 1R2TA 4QLJA 4DWSB 4NG3A 1BG9A 4UTKA 3ABZA 1S5WA 4IQDA 1EJ7L 2BNJA 3W07A 4IMAA 3CNYA 1B2YA 2AL2A 4RX0A 1OC7A 2P1FA 1E1FA 4HA0A 1JD9A 3GTNA 2FLIA 4X60A 2CETA 5E93A 3TJIA 4I7VA 2D3NA 1LDCA 2P76A 1I2PA 2YZRA 8TIMA 5JUVA 5B80A 3CQ0A 1KV8A 3TP4A 4JTFA 1O1ZA 4NU7A 1IT8A 1UMLA 1POKA 4L4MA 1E4NA 4EP8C 4IIHA 1GJUA 3BGAA 4CNSA 1J01A 3BANA 5LNWA 2D69A 4ZXLA 1KM5A 3RFAA 3LOTA 5EBUA 1ZHAA 3INPA 4M7TA 2YCKX 2ZWYA 1SW7A 3QKEA 4QS5A 5LNVA 3CB8A 3E0LA 2OFJA 1E6PA 4B5VA 1E40A 3W75A 4HMCA 3T0CA 3VIJA 2FTWA 4ZO8A 3MV11 3VD9A 4QQUA 2WJZA 1B57A 3W7NA 1RQBA 3OG2A 3VMNA 4FR6A 2WM0A 3GXMA 2WBGA 2VZTA 2W66A 3PZTA 1CLKA 3F4NA 5I02A 4UTMA 1YPIA 4L6DA 1LLOA 1JQXA 1H4PA 3GXFA 4L61A 3BMWA 3W1QA 4XK2A 1UH3A 4F66A 4L65A 3WNLA 1UOKA 3CT2A 3STCA 3ARPA 2CBIA 1L0PA 3PWIA 5CLTA 3VA8A 4H8NA 2Y24A 3TCSA 3CASA 5AVNA 3P5YA 3WDPP 4O17A 1EL3A 5EYWA 4Z2GA 1F4AA 1FWSA 4UFHA 2XUCA 4LBSA 2HBXA 1JI1A 2GQ3A 3FCPA 4IQJA 1IIGA 2NVDA 4ML4A 3SAZA 3UZJA 1XL9A 4UTUA 3G8RA 3AIBA 4AY7A 3N9RA 2IPWA 3RLUA 1XJBA 2A3CA 2ZVIA 4YCOA 4HPGA 3K5XA 4IPJA 4U3AA 1M7OA 4CNTA 2FMNA 3R2GA 1CWYA 3ZSSA 4GJIA 3NNTA 4DXXA 1HW6A 2YBTA 3F2BA 2PLJA 4Q8WA 4XSMA 3EXRA 4TV5A 3S2JA 4RPPA 2WNNA 1E0TA 2X1IA 3HN3A 4Q8UA 2INFA 3E96A 1KTBA 4QNWA 4DUWA 3QGVA 7REQB 2Z2AA 1QCWA 2VDIA 3P14A 2EO7A 4I3GA 2XVNA 2PAJA 3O0KA 1CXKA 4YTUA 2OELA 4KCTA 5A6SA 4C6QA 3PB0A 4M56A 2ISFA 3EBVA 3NUKA 5IBXC 3WEMA 3ITTA 3LSCA 1JXJA 1EGVA 3UVAA 3O6AA 4UMAA 1WKEA 1PDZA 2XZ7A 3L5MA 5K9CA 3VCRA 1ZPTA 3AXHA 2F2KA 3T2OA 1PIIA 1VRDA 2OB3A 3BOFA 3NZPA 3QYSA 4Q8QA 2RDXA 2QCEA 1SFSA 1QMLA 1XSIA 3GE7A 1MUCA 2PEVA 3E0WA 3NQMA 1KRAC 5LIXX 4EXQA 1EEPA 4L9XA 2ATSA 1YEYA 2ZZ1A 5D32A 2WVVB 1PTGA 3ANVA 5I3KA 1UKTA 1WX0A 1KFBA 2YA0A 3B0PA 1LBMA 2NWRA 3G6LA 3W7RA 3CMGA 5BROA 1XFBA 2E5DA 3RRAA 5AYIA 4YS1A 2G3NA 4MJ4A 1T5AA 2Z7GA 4LANA 2Y2WA 3F4DA 3W1RA 4AZ5A 1F74A 3RLGA 2V69A 3S5YA 3NL6A 3C0JA 2JKPA 1JZ5A 2V68A 2V38A 5GNZA 3VIKA 1XRVA 1JXKA 1ZJIA 3VX0A 2R91A 1W32A 4MHBA 4AZCB 3BGJA 2ZDRA 2CZVA 5E1QA 4Q8NA 1UJPA 3EA2A 3VNLA 4TVCA 2E67A 1DPMA 2PD5A 1G1YA 3UWUA 1S5MA 3C2YA 2YIHA 4WOQA 3KL3A 1HNYA 1XLKA 3S46A 4DPQA 3NEHA 4NX5A 3FOKA 2X7WA 4XUYA 4WRHA 5CC7A 5DN1A 4Q6XA 4ZBCA 2PDGA 3ATZA 4A8IA 1F6KA 3NTYA 1A50A 1V7YA 1BRLA 3IIZA 2CW6A 3NQDA 2J78A 4GY7A 2XIQA 4HCHA 4WKFA 4NAFB 4QSHA 4C6CA 1UC4A 4B5NA 1JCXA 2V3EA 2ODOA 1C93A 3AICA 1MQPA 5CGQA 3EWYA 1W1TA 4H4IA 3CT7A 4EPKA 2XISA 4S1FA 2ZYFA 3TTYA 5LIYX 3TYDA 1H7PA 4ALDA 3WDQA 1GPFA 1W56A 1C91A 3MVIA 5AC4A 1V6TA 3H6OA 3W38A 1PO9A 3GIPA 3OGRA 5JU6A 1RY8A 1L9WA 3AYTA 2Q6ZA 3GVRA 4AAJA 4XAYA 3N9KA 4JAWA 2BVWA 3BLKA 2JGYA 5EGRA 5HNUA 5C2XA 1HGYA 3ITXA 2IXUA 1OM0A 4JN7A 1X1ZA 5CH9A 2O7QA 1DIKA 1TREA 2VZVA 3SEPA 1E6ZA 3MWAA 1QATA 1X8CA 4QG6A 3NA8A 2DZXA 1JGMA 2Y6ZA 3TAOA 3H54A 1WZLA 3CZKA 3WQOA 1O5RA 1W8SA 4O19A 1XPYA 4OFCA 1VP5A 1GORA 1M03A 3SFWA 2C14A 1O5QA 2PWVA 3LCHA 3VD7A 3HGOA 1BKHA 4WF7A 4X0NA 3ARRA 4JN8A 2C1HA 2PGRA 3K8MA 4DAFA 1E71M 3LM7A 2JEQA 1V3MA 2X1RA 1XYLA 4CNPA 3VILA 3R6IA 2GJXA 5HAOA 2X8RA 3KE0A 4J3TA 5I78A 3LPPA 2EPKX 1FWFC 5J5RA 2ZRWA 1HL2A 1VYRA 3CHFA 1QPNA 5FD0A 3T40A 1NWUA 3P5ZA 1CXHA 4O18A 3WO8A 1LT8A 3GDKA 1W5MA 1YHTA 3WK2A 4B5XA 4N4PA 1QW9A 3DYOA 3MUAA 2PDMA 2VZOA 3BSGA 3PZNA 5BRQA 1BHGA 5DO8A 1HKJA 4Z1DA 3ONBA 4CEXC 4ZOCA 2HPMA 2H90A 2J9XA 2OKOA 2HV5A 3SUWA 5CJNA 3HJZA 3VGEA 3OHMB 1FCVA 3H7UA 4DPPA 4M6UA 2GWGA 3M64A 4AD0A 4DHGA 2GVGA 1UD2A 3MCOA 4HB7A 2QVNA 2VKZG 1VF8A 4GX9A 4V1YA 3HQ1A 1E1CA 4WY0F 4RL3A 4V2XA 2R1PA 3LXBA 1ME7A 1Q6GA 3G1XA 4A3YA 3LD5A 1FDJA 3DXIA 3B04A 3O05A 4W9TA 3II1A 1U2YA 4H41A 4M0XA 4ZA0A 3QZAA 1M68A 4AIOA 1A0CA 4G9PA 2WC4A 4AD2A 1V3IA 4W89A 1ADDA 5AHFA 2YA2A 1XHGA 1FKXA 3CTLA 2FHBA 3GK0A 1J0ZA 1ZP4A 4S3JA 4G1KA 3HOJA 1EWDA 1HP4A 3GY1A 1A0DA 1JAEA 3E2VA 4LUJA 4ZENA 1UQYA 2VQUA 1KCZA 1J8VA 4WCJA 4HHHA 3W2MA 2OWWA 1S5TA 2UV8G 2GQAA 3BAXA 1K70A 4NZCA 5ABFB 1OF8A 4MY9A 4O54A 2FZNA 2HISA 3CH0A 2BWGA 4BQ5A 3QPZA 3WQDA 3FYOA 3TC3A 5IOBA 3WYZA 1VFHA 3KVLA 2CLIA 1HFBA 3KVMA 3AXMA 1ZAHA 2JALA 2H3DA 2J4GA 3SUTA 1B31A 4AEEA 1GJPA 3UPMA 4RR4A 2RUSA 3GH4A 3UU0A 9CGTA 4KT2A 1I2RA 4AHQA 3QYQA 4KWWA 2YL5A 2WSKA 1OX6A 3ARUA 4WSHA 4HMDA 5BRBA 4S2BA 5C8BB 1TG7A 4R7OA 2V67A 3UGVA 3WSUA 4NAEA 3TU9A 5C54A 3EXTA 1EF2A 3W6YA 3PANA 4XAFA 2D2JA 3SGUA 4NJJA 2E6FA 1IWPA 1WDRA 4EACA 4HCLA 3DI0A 2Q02A 2Y7DA 3I3EA 3OQ8A 5JIPA 4PC8A 2A4AA 1GYMA 1K6AA 2CC0A 3BH4A 2BS9A 3OGSA 3DX5A 4DQWA 2H8XA 3MI6A 3ZVHA 2Z27A 1AW2A 3WQ5A 1XIDA 2GFTA 3BJFA 3OHIA 4B2DD 4CD7A 3SW6A 3H22A 2FJUB 3B8VA 1M53A 2YSWA 4ZR8A 1JCLA 3VNIA 1NEYA 4A29A 1H5YA 1TTQA 4RPQA 4PSRA 1WDWA 4JXCA 1Q45A 2VCAA 3MUZ1 3QPYA 5CAHA 1RJPA 3BC9A 4DJFC 2W3ZA 4Z2HA 4PUMA 1TZ7A 4M7SA 2Z6IA 2I1OA 3RF9A 1W3NA 1XBXA 1FCQA 2E77A 2KZHA 3EDKA 4J9JA 3FYPA 1QI4A 1Z9AA 2EJAA 1Y8BA 1R38A 2PLMA 1JL8A 1MNZA 3DESA 3N2CA 4AWTA 1ITUA 5FF2A 2WC7A 5K4XA 1LLWA 2ZX7A 4Q8VA 1R87A 3N2OA 1XLMA 3KWSA 4YHGA 5D2TA 1J6PA 6PTDA 1JZ7A 2AQOA 3KZSA 4UUIA 4WDWA 2G97A 2WMKA 3VKBA 3O8AA 4GNVA 2J62A 3F4VA 2YL8A 1C9WA 3W7CA 2Y8VA 1FWWA 1HXJA 1SR0A 5FAJA 3GU2A 1KGWA 5HATA 3W85A 1NP0A 2OT1A 5REQA 5KITA 3GFZA 1W9XA 2V30A 1ECEA 4FPSA 4W7UA 2BGNE 3WL1A 1HVQA 3PBMA 4C6JA 1AQHA 3N2TA 3THAA 1QNVA 1GVEA 1NSJA 1EDGA 1AL7A 2QGYA 4FA3A 1CGUA 4RDZA 1OWQA 4EOUA 1M5WA 5HNRA 1VRXA 3O6DA 4LXFA 4AWEA 4UC5A 1ZP3A 4MB5A 6A3HA 3RM4A 2V6AA 1EXPA 2Y7GA 5K9XA 1MRQA 3PSWA 1SO3A 4RE2A 5K2ZA 1D3HA 1WQ5A 3POCA 2PTZA 5I3GA 2R1NA 3IJLA 1R6WA 5D04C 3STEA 2VFIA 2IQTA 4AYSA 3IGSA 1ZJBA 3D46A 3EXSA 2V5LA 1SW0A 1VGAA 1IEVA 2J7BA 4UR9A 1UQZA 1QHZA 3CHCA 5T26A 2Y4SA 4IQLA 3WEZA 1FHVA 4GBDA 1UWAA 3S0CA 5TQLA 4ZTXA 1D8WA 2Z1KA 1XIFA 3TA6A 7PTDA 5DBTA 4QQ3A 2WCGA 1I4NA 4UFLA 3QBUA 1LQ2A 5CZ0A 4IIGA 1TRIA 1OEPA 4KWOA 4FNSA 3LLFA 1J2BA 5LNUA 2NUYA 3DFHA 2ZDSA 3LUTA 3UXKA 4X2RA 2F2HA 3VGHA 3HMJG 1OFRA 4LYQA 1IXNA 1ME8A 4FX6M 1UZDA 3QVQA 2PFHA 1KGXA 3M7SA 3MSDA 2QCNA 3MS8A 4DF0A 4XZIA 1LM1A 4PRWA 4C7DA 2XVLA 4JTLA 3CQKA 2DZUA 2BHYA 2YFNA 5I2UA 3NPXA 2YCLA 1J0JA 1TELA 4Z1YA 1UD3A 3TDFA 1CZ1A 1NFPA 4L4LA 1N2VA 3N1AA 3DG7A 3AIQA 2DIKA 2Y8KA 2QGHA 3WLSA 4CD5A 4DBEA 3MBFA 3JZUA 4IPPA 1BFNA 1RA0A 1EH9A 4EAYA 3IIPA 4YVPA 4MVAA 1YX1A 1R2SA 2HPIA 2BODX 1M7JA 5C0QA 4F4RA 4GUFA 3QPEA 4HTBA 5CAKA 3RPMA 1A80A 1OHLA 3G1FA 2G96A 2ISWA 2ZRZA 3NO3A 4LT9A 1MNSA 3A47A 2CZFA 3PG9A 1LJYA 3CAQA 3PZQA 3KTCA 3IK2A 2X30A 3SBFA 5C9UA 1KBJA 4AIBA 2ZUNA 4XAZA 4LUYA 5CC3A 4UQCA 2GK1A 4FIQA 3VTRA 5LIWX 3LEPA 5KTLA 1H63A 1BGGA 3USZA 3BLLA 3DECA 4HU0A 1PX4A 2ACRA 1KXTA 1A3XA 2OZ0A 2E7FA 2AKZA 1K1DA 5H8UA 3DFYA 4LAUA 3SQSA 3ZR5A 3P6LA 1JPHA 4E3VA 4IP5A 3TW6A 4ZQNA 4RK8A 1FOBA 1S2VA 1EIBA 4KFOA 4DYEA 2FH6A 3KZPA 3T7VA 4I5XA 2ON3A 2CHNA 4A05A 5BWFA 1A5UA 1NOUA 2DUAA 3HB9A 4NIRA 1DQWA 2J7DA 5D8ZA 4HHPA 1QPQA 1B3OA 3LDVA 3M0MA 1R3WA 3TOYA 4GXMA 3VIIA 4R9XA 1US2A 1K6WA 5K7JA 1JULA 4WR3A 5ABEA 2VVNA 1ICSA 1EB3A 1A5KC 2ZC1A 4J5NA 2C8NA 3MYOA 1Q6LA 3OODA 2X1SA 3AHXA 3VKKA 2ESCA 1TUXA 3UVIA 1J9YA 2VEMA 4C1NB 2ZRVA 4UCGA 4J28A 2QPUA 3C61A 5XINA 3FJLA 4MZYA 3CUGA 3K13A 2OWCA 2CXEA 1X96A 4BI5A 4BQ4A 1GW9A 1D7FA 3KBMA 1RD5A 2WMFA 2AKMA 4EXBA 4P7OA 2ZRUA 3LMZA 3MP5A 4O0QA 5FA5A 4HYWA 1F3WA 1AZ2A 2VOTA 1TWDA 1C9DA 3C8NA 4PMYA 3Q94A 3IAQA 1E15A 3KL0A 1I75A 1MUMA 1S39A 4OZOA 1XIEA 2HEJA 4P8WA 1DJYA 3N2XA 4W8AA 1OG6A 3RX4A 3M5YA 1ITXA 3LQLA 3NQVA 2OOGA 4J3WA 4S23A 1LLZA 4B2DA 3AU2A 3LV6A 2AMGA 4EIVA 4IG2B 3OVQA 4JTHA 1QNQA 4Y2WA 1GONA 1A4MA 2VUYA 4R33A 3OTRA 3KP1A 7REQA 3S1WA 3WFLA 4ORMA 2TMDA 3HFTA 5GQBA 3TYBA 2EG7A 3WZ0E 3JZEA 2VRJA 3PZOA 3UZWA 1PDYA 4D2JA 4E2DA 1KM4A 3WNMA 4K36A 2QUNA 3P74A 3D3FA 2G4JA 2PZ0A 1J96A 4E2VA 3NSXA 2YXGA 4KRUA 1J0IA 4X3ZA 3V1PA 3C3UA 3SECA 4GINA 2YYUA 3E2QA 3U48A 1F6PA 2WVTA 3CV7A 1GVIA 3ITCA 1GOQA 2YW3A 2WKJA 3AYRA 3P8JA 3K8KA 2OTDA 2XVGA 2CLEA 4P61A 4GG9A 4XD3A 2WSQA 1JZ4A 1YE4A 2AGKA 4TMBA 3WBEA 3A12A 1CXFA 3WD0A 4RCXA 4NI3A 2J24A 4Q7NA 4W86A 3CO4A 4GGBA 2Y5EA 3NQGA 1DJIA 2PGWA 4OJYA 3GXPA 1FWIC 4OTKA 3MUXA 3NZRA 1JG9A 1TMLA 1H0GA 2Q3OA 3PF3A 3WELA 4GX8A 3DFNA 3CUHA 3W53A 1AD4A 2OPJA 5IHSA 4ZGYA 2X2YA 5K3VA 4UTTA 2J6XA 4GI8A 4H8UA 3LCGA 3MA8A 4XD5A 4B9YA 1XGZA 3DERA 3HV9A 2ZUSA 4D6HA 4PB4A 1X6LA 4HZ6A 3P3BA 4R7JA 3CIWA 4QISA 2OEKA 4TR9A 3UJEA 3ZR4A 1C3FA 2OLAA 2ZICA 2GLKA 1DVJA 3D47A 1CENA 2Z00A 5A2BA 3UNTA 2GUYA 4TV6A 1W1B1 3VKDA 4K8HA 3E49A 4A22A 4NT0A 2EHHA 4KBXA 5G4EA 3RU8X 2FB3A 1TPEA 1KWGA 2W67A 1ODZA 4L5ZA 2ADAA 2X40A 4JIIX 3C52A 3HMCA 3TXVA 3DGBA 4CQ9A 2XIBA 3PZMA 2XSBA 1QFEA 1A47A 1RP9A 2EKCA 1GKQA 4XAPA 3P84A 1XRSA 5CBJA 2QJIA 4JQ4A 3SUVA 2XN2A 3GUGA 4J35A 3CL6A 2OX4A 2X1TA 3PBWA 4A2RA 2WZIA 3BAWA 1ME9A 3G24A 4WJEA 4DVOA 1J11A 1G6CA 3VOFA 3RCYA 3C4UA 1W6TA 3E3HA 5C9RA 1JUEA 2NT0A 1YKWA 3WJSA 2OKTA 3VABA 3OLIA 1SUXA 4YMZA 5HULA 5F2IA 5I03A 2NXGA 5GPRA 4DBWA 3WF1A 3LGGA 4K1GA 2QQ6A 2VO5A 1POJA 2GOUA 1G4EA 3MT1A 4US5A 4QEHA 4KIRA 4Y7EA 4WVXA 3S2NA 5C6MA 3OBEA 3DFOA 4D1JA 3CZLA 2P0IA 3QV9A 1JD7A 5D33A 4JIPA 5DMMA 3WMCA 3I7SA 2VEKA 4M19A 2I9UA 3OJGA 3H2NA 1WBJA 4U2YA 4MPKA 2Z1SA 1REQA 2VTFA 1Q6QA 4X9YA 3F03K 5BXPA 3CBWA 2POZA 3TK7A 3W7OA 3I6RA 3IVSA 3VKAA 3BAYA 2W79A 2GVYA 3BJTA 3QHOA 4UXDA 4ORIA 4OUIA 4UTIA 1YDNA 3QSTA 3NURA 5DRIA 4HNUA 3CZEA 1QBAA 1AQ0A 3R1ZA 3A22A 2OXNA 3WQVA 3UGRA 4B15A 1CDGA 3U3HA 1OFBA 2XTKA 5DT5A 2WANA 4PBFA 4CD4A 1RJQA 1YTKA 1OFAA 2VMFA 3RPDA 3MZNA 3RYSA 3CTTA 3T0DA 1GJWA 4JHMA 1FH8A 1G94A 5ECUA 2FVKA 3S5SA 3OA3A 1PZ3A 1A5OC 4LUSA 1DQUA 3TKFA 3EX2A 3NQAA 1SM9A 4ZODA 4AU0A 4H9UA 1KR1A 5HJYA 3JU2A 3GSMA 2C16A 3CAWA 5C71A 4QHRA 3A23A 4EPEC 1DHKA 2NW0A 4JIEA 1AJ0A 4MLRA 3UR8A 4N6EA 2D0HA 1S5VA 4AWUA 3VFCA 1EHAA 5A94A 5A8MA 3EDJA 4DB7A 2Z6JA 3OP2A 3WIJA 3G18A 1ZLPA 4PZVA 3PULA 4AQLA 3V16A 4BF7A 1LYXA 1PKNA 4PEEA 3U2OA 4DF1A 4YNGA 4IPNB 4H01A 1ENUA 2PURA 1KO0A 1MFVA 1XM3A 3HO8A 3C2FA 1F3XA 2HSAA 4JNYA 4JEQA 1T41A 3RK8A 4K37A 3SDOA 1BXCA 5AYXA 3N9SA 3EMZA 3N25A 3TJ4A 5HJXA 3TSMA 2Z2UA 3CUIA 4LVGA 3WLRA 1X7IA 1H62A 2E9LA 3ARYA 4PYSA 4OV4A 4L1XA 1B3VA 2GDQA 3F4WA 1SZNA 4X22A 3ARQA 3GNOA 1UR9A 4J2MA 1E9IA 4FOJA 4ZZ9A 2WSYA 1ZU8A 4M8UA 3M0ZA 3PSVA 1W1A1 3V5OA 1RPKA 2ZXBA 4KH2A 3PUEA 4RNJA 3V0UA 5I09A 1SFJA 2PSNA 3EEGA 5FSEC 1M3UA 3FK4A 3R4IA 3BL3A 3C0LA 2Y61A 3UWQA 4CU6A 2P3ZA 4XBKA 2AOSA 5H2ZA 2BGQA 5LNRA 3P60A 1HJQA 3ALFA 3N2BA 3AJXA 1Q6RA 1VCVA 3EOUA 1T8XA 4GUJA 4E38A 5EPDA 1MUWA 4ML9A 3GNNA 1R5YA 1L6SA 2E8YA 1UP0A 1TZZA 4YTQA 2Y1HA 1XSKA 4AF0A 3M0XA 1EA9C 3FY1A 1NARA 1TWSA 2DZTA 4PMNA 1TWIA 2VFFA 4C1KA 3M1ZA 1D3GA 1TV8A 1XBZA 2BV9A 4CGTA 1GVFA 4GNKB 4J3UA 4UTWA 3WJWA 2TODA 3OA5A 5F1VA 4F0LA 5ABFA 1KM0A 5BOOA 3TNOA 1HJUA 2VEGA 4DEFA 1JF6A 4LYRA 4QLKA 4R5EA 3LBOA 3M5XA 2TAAA 4FB7A 5G1TA 4JHZA 1VKFA 3TR2A 1MDRA 6ALDA 2G8ZA 3BGGA 1AQMA 5LKYA 5KZDA 1KNWA 1GTHA 3E5PA 3DG3A 1K03A 1HUVA 4Q4SA 3NQFA 3UCDA 3BQ5A 4RDYA 2WXDM 4FP1A 4AD1A 4UOJA 3N73A 1Q7QA 5AHMA 4O12A 4RNFA 3FEMA 2YGYA 3VDBA 1SVDA 4HU3A 2YDQA 3VZYA 3I7RA 1N55A 2W61A 1LQAA 2F9RA 2WBKA 1SO5A 4IZGA 3DC8A 4OECA 3TQ0A 1AZ1A 4CLMA 1WO2A 3QV7A 3RX3A 4L6OA 1UZ1A 3PWAA 4B90A 4KGLA 1OX4A 3NQEA 2VC5A 4XVDA 5M5DA 4MDOA 1SZEA 4DZ5A 3CU2A 2B7QA 5TIMA 1UG6A 1UR1A 3MI2A 2GUUA 1A3HA 1DKWA 4HQVA 2HMCA 4ZSTA 3HPSA 2RGMA 2EAWA 1Z7AA 3W0KA 5FEZA 4GD0A 4C1LA 5AHLA 4C6BA 2NLIA 1W5OA 3HJEA 1BXNA 2OSXA 4H6RA 4P5UA 3U9IA 1DWFM 4E5TA 1P4CA 3DDMA 1BAGA 1EPVA 3GQYA 5G2WA 3S6DA 4KCVA 5LGZA 3G1DA 3WLKX 2BHUA 4AMCA 1PXGA 3MBDA 3M0VA 4IIEA 5IFTA 3GUWA 2J75A 3QZ6A 4GZEA 3PS7A 2I14A 4J2PA 3W7GA 4UMBA 3S4TA 4P7QA 3BZGA 1XYAA 3H70A 3IRDA 1P48A 4ROPA 4NJIA 3NZQA 3OZOA 3A3WA 2E0PA 4PMDA 1FWAC 3SADA 1UP2A 2A7NA 3UNDA 4UFJA 3SSZA 3VFLA 4S3GA 1M01A 3F1QA 2FZDA 2OEJA 1EJWC 1ISZA 1Q6DA 2EG6A 3MKKA 1U1UA 1OIMA 3NYDA 1XF0A 4PUJA 1ZBVA 1KM6A 3LERA 1XIIA 2OMAA 2GJNA 1BEUA 3CZ8A 4O53A 1B90A 3FS2A 3BCJA 1K9DA 4E2BA 3H53A 3WBWA 5DXXA 3WQ4A 4LVDA 4MJMA 3SZ8A 3ARZA 5U7SA 2DFAA 4U31A 5CG7A 4QDWA 1FDZA 3RMEA 1E3XA 4L7ZA 2ICSA 1JZ6A 4LJ3A 2QJHA 3TE9A 1IT0A 1VCFA 4DBUA 3NG3A 4XKMA 4ZOEA 4JHOA 4CD6A 1WXZA 1H7RA 1MRAA 3EGJA 1FH9A 4QLLA 2GVLA 2YL9A 2XVKA 4F48A 4P8UA 3QLLA 4HCDA 4LV9A 1QI5A 2A3AA 4H9TA 1XLLA 3DFTA 2X0SA 4U4MA 4WXZA 1W0MA 4LBRA 1XIMA 4DZIA 4JIQA 3UW6A 4REQB 2BY0A 1J0HA 4PCFA 4Z0JA 2W63A 4KIEA 3QLDA 2VFDA 3W02A 2ZRYA 4YWIA 3KCJA 4CQBA 3UWWA 1Z42A 3MSGA 3L4ZA 3BMXA 1V08A 3EYPA 3TZNA 4JGDA 1BKSA 1XLFA 4LCQA 2G5WA 1XCXA 4Z2LA 1VLIA 2DJLA 3HG5A 3CQIA 2C0HA 1CX9A 4PFHA 4JTCA 3UWEA 4MJ2A 4AW7A 3CPUA 1WDPA 3GHRA 3S9ZA 4QE5A 1UD6A 5A6JA 3DYPA 3WLNA 4MTVA 1PKLA 4IP4A 3WK0A 5CGTA 3AXKA 3S2LA 1Y5VA 3U5YA 3VNKA 5HQMA 3WY1A 1W3LA 1F3TA 2A7RA 2AAAA 5DELA 1GG1A 4PEKA 3GTHA 1RBLA 2BY1A 3N34A 4R7WA 3V3WA 1R30A 4TUFA 1FWCC 1XQKA 3OYZA 4HZ7A 3GBDA 3HZ3A 3NZGA 1KKOA 1ELSA 3D6NA 4GKLA 4US6A 3R43A 1THFD 7XIMA 5HPOA 3GO2A 1WNOA 4OV9A 4M5PA 1H7XA 1B54A 2VOMA 1XRFA 2QZRA 3JS3A 4KGJA 4FNQA 1XC6A 1E4MM 3AIEA 4XKYB 3QJAA 2TPSA 1TX2A 1V0LA 4M51A 3MWCA 2VZUA 4IPLA 1XLEA 3MSRA 3HU7A 3L2MA 3VD3A 4JKLA 3T44A 1G4TA 3QFEA 3HQNA 2ZOXA 3EMCA 5AHNA 2PDNA 4CVWA 3A3HA 3W7MA 4B3ZA 5PTDA 3T4WA 1P43A 4UFIA 4H9XA 4GIEA 3A64A 2EGZA 1KM3A 3CM4A 5I6SA 2VX4A 5C2CA 3MSYA 1E51A 3ISIX 5IDZA 4AHPA 3JUGA 3VIHA 2GSEA 3G6MA 2WZTA 3UP8A 4MFDA 4IQEA 1MXGA 3TIMA 5M1TA 4GVIA 4XTIA 1GPWA 2VC7A 4YIWA 3RNDA 2W92A 1VLWA 3P82A 4AD4A 4F79A 4NZ4A 3E0IA 2WPBA 5M3WA 4TVDA 3IJ6A 3KRZA 4GZ7A 2ZUMA 4IGHA 1EGZA 1MFUA 1RCXB 2WV8A 4IH3A 5IXEA 2V3GA 2DGAA 2H9AA 1UB3A 4PN2A 5DBUA 3WQWA 3EPOA 1W1VA 4PTMA 3QXBA 5FOOA 3AROA 3FGCB 3NAVA 3R8RA 2AL1A 4KF1A 3TMQA 2TSYA 4O11A 2ABBA 3U0HA 1EXBA 1O12A 1C92A 3T78A 1B9BA 1UBPC 4H6EA 4EF9A 3VOJA 3BK0A 2CYGA 1NAL1 3PFMA 3LA4A 5G4WA 5A8PA 1E0UA 3H4GA 2I57A 3RM9A 3C8FA 2QIIA 1Q8JA 4JYFA 1DL3A 5J5DA 1DJGA 3GHUA 1PIFA 2GGHA 3PHAA 2WQDA 4CCCA 3GR4A 4KRTA 5DRCA 1R7AA 1RXOB 4IJBA 3RGTA 5KZMA 3Q67A 3ZZ1A 1W31A 3PJWA 3ITYA 4DO4A 1WDQA 2MANA 2BHZA 2YYTA 4M3PA 2GZXA 1LCOA 2WVUA 5KZ6A 3ORWA 4QJ5B 4CKQA 3MVTA 2BASA 3G1VA 3F5LA 1S2TA 4LUTB 3M0IA 1CBGA 5I3HA 5HMSA 1YTEA 2C19A 4BQ3A 5JH2A 1XWYA 1TYGA 2G3FA 2Z1WA 3TC7A 3HG2A 4XWUA 4H7CA 3DKJA 4IIDA 1GZJA 3P67A 1XH1A 2WNWA 2QUTA 2VI0A 4FLQA 3HM7A 4BA0A 3EKGA 5HANA 2VENA 2FKPA 3SO7A 2QDGA 5FEXA 3CAKA 3ZR6A 4GFSA 4WXYA 2OJPA 2JIWA 4W8BA 1UA3A 1KFLA 5F2LA 4BWLC 2XN0A 2BMBA 4IUGA 4IG2A 1IT7A 4GZIA 3RILA 3N11A 2R1MA 1Q6OA 3UF9A 2CBVA 4O28A 3BZJA 1Q63A 3WG6A 3B03A 2CZEA 4N9EA 3MMTA 1HT6A 4Q4QA 4IP7A 1BF6A 3S9IA 4XBSA 5C7HA 4ACYA 1AH3A 4ZTYA 2ACQA 5HWMA 4MB1A 3UJ2A 3VM5A 4MJZA 1XPGA 2DIJA 3BJSA 1DJHA 2R6OA 3WNNA 1J12A 3APYA 1AMKA 4JQ2A 3I3DA 3WF3A 4PTXA 3HBLA 3IJIA 3MHGA 2JIEA 2IKGA 1V93A 5BOEA 4UNLA 1FCUA 1H5VA 1U5HA 4DO7A 2HVMA 3LHYA 1EJXC 1SMDA 3VNYA 5M2FX 4IMFA 1JCMP 2HDJA 3EZ4A 3QC0A 1MI3A 4KFNA 3ARSA 3EX6A 2ZUVA 4MIMA 2YDRA 1KLYA 4KRZA 3WD3A 3S5OA 2WZHA 2QCCA 3TYZA 2X7VA 2BVDA 2XINA 1W3JA 4GO8A 4L9YA 4FNPA 3VCCA 2PDBA 1FXPA 1X7FA 4G2DA 1NF7A 4J3VA 3TQKA 2V5BA 5I3FA 5C5YA 2FZMA 2YR1A 3ONCA 2HXUA 4ZQOA 4NYUA 2OEMA 3LNPA 1A5CA 2PTWA 4C60A 4DXVA 5I3JA 3AISA 1V0MA 1X38A 5JIWA 4RDVA 1C8YA 2DP3A 1GVRA 2A6LA 1EA0A 3N4AA 4GHRA 3TH6A 1H7NA 3UBPC 2HCVA 2NX1A 2Y63A 1ZY9A 3AMKA 5M17A 4D8ZA 2Y89A 3L21A 2VFHA 1LT7A 4FNUA 3FJ4A 1TA3B 5E9XA 3W28A 3RXZA 3A4WA 3LRKA 4Z1AA 5I5RA 4CUCA 1LL6A 5C70A 1TPFA 2PDFA 1I9CB 3H4WA 1WYIA 2ACSA 2PF0A 3N3MA 2C7FA 1XG4A 1W5PA 2O9OA 2XFRA 1MXSA 1BWLA 2V9DA 3DAQA 3B9NA 3GH5A 3A9IA 4CQDA 1K9FA 3WLMA 4UFMA 3PB2A 2GJRA 1MW3A 1C8XA 3O0FA 4LYKA 1PIGA 2VRKA 2JK2A 3CB3A 2UY3A 3L5AA 1R3VA 2JGQA 4MNMA 4HA3A 4S3CA 4WEVX 1XS2A 4K1WA 2WZMA 4MZ8A 4KEMA 3FKRA 3W1LA 2HNHA 2E6AA 4AC1X 5DFAA 3E12A 2NX3A 4Q7BA 4UMCA 2YKKA 1ZALA 1R85A 2BB0A 3A6OA 1O1HA 3UYCA 1CGXA 2Z1XA 5HA7A 3FSTA 1EQPA 1XRTA 2PWGA 4W93A 1VBRA 3MUIA 3AAMA 1XDLA 1EBGA 2CPUA 2OQHA 1WBHA 2YA1A 1YLVA 3AYSA 3VMPA 3FX4A 1B30A 3GLCA 1AW5A 4NXKA 4FAMA 1YDYA 2BDQA 2P10A 4OT7A 4GY0A 2PU0A 4Z08A 3P81A 1W54A 1I2QA 1S2AA 1HVXA 1ODUA 3H4XA 5CC6A 2WO5A 3T2PA 1T6MA 2INEA 5A6MA 3B8IA 3T6CA 2F38A 3W7KA 5A8NA 2C91A 1XLDA 4IGNA 1PTAA 4CNUA 3NQCA 4FR1A 4JL2A 2P5NA 3SCQA 1E6RA 1S3HA 4ZQRA 2EBNA 5LGXA 1LZOA 3GWQA 2ZBTA 1A4LA 4B9ZA 1TMHA 4IPIA 1J6OA 4HMEA 4HPHA 2X0HA 3IV8A 1VAHA 4AXKA 5CGMA 1L8PA 1GQKA 2D0FA 3GC5A 2G0WA 3O16A 3BTNA 1VIZA 1TJ1A 2DPEA 3GX9A 4FK9A 1K4HA 3HGJA 2BY2A 2R14A 5E6ZA 3EWDA 3AIVA 1EOKA 1HJWA 3W72A 3LPGA 4FOKA 4S3AA 1M1BA 3URBA 1HF6A 3CYJA 1X6UA 2E3ZA 3H26A 2J77A 1EO7A 3NDOA 1Y0EA 4MY8A 3FYYA 3S2CA 5FJUA 1EIXA 2D2HA 1F5ZA 3CIXA 4ZXOA 4LFYA 1M6JA 4YCPA 4O1AA 4HSNA 3G3MA 4Y96A 1XXXA 4WGHA 1G01A 1QHPA 4IFKB 1BLIA 3W00A 3WCZA 3HPZA 4H7ZA 3LTSA 1IEQA 1EO5A 1VR6A 4OOZA 4PBGA 2PWFA 4K68A 4N02A 4UFKA 4LAKA 3GS6A 2PUZA 4EANA 1IV8A 4W84A 3SCPA 1LRTA 4Z42C 2E6YA 3BICA 4H1ZA 4BHYA 1BYDA 1L8NA 3WX7A 3IJQA 5I77A 3UG5A 3VVGA 2V0TA 1B3YA 1KRCC 3I7QA 1P0DA 3HTWA 2VM8A 3A5FA 4OIFA 3W27A 5HQEA 1ZQ5A 1K4GA 1S2WA 1GZGA 1U1HA 4N9DA 1V0KA 2ZUTA 1YPFA 1HO1A 3UJFA 4DN1A 4IXXA 5SWUA 1E4LA 2GQ9A 2WWCA 3DBNA 4BK9A 4NZ3A 1BVZA 4MFEA 1VPXA 1J79A 4GBUA 1LTDA 4CD8A 2J9YA 2XU2A 5AC7A 3ICJA 3F7JA 3QF0A 1E9YB 4AIEA 3TSDA 1JYVA 3RG6A 1GOXA 4I6VA 8CGTA 4PB3A 1QPOA 4HPJA 3IARA 3ITVA 1V6WA 4K7VA 5AC6A 3I68A 3CEUA 4H2HA 5BMXA 5RUBA 1VQTA 1EC9A 2ZXDA 3W9ZA 1UR8A 2XIMA 5AC8A 3W24A 4DRSA 3VE7A 4R88A 1TE6A 2NWSA 4ASTA 2PI6A 1YADA 3GKFA 1XICA 3TCEA 1JJKA 4TTGA 3TROA 4GJJA 1L6FA 5AB3A 3PPGA 4GC4A 5T9CE 5FEPA 4XZNX 4JIRA 3BMVA 1LWHA 3LZ5A 4FHAA 3N3TA 3W1NA 3A24A 5G1YA 1LBFA 2VEIA 2WJDA 4I9AA 2Q8LA 3SY8A 3F2CA 3RPTA 1KCLA 2VCBA 4NJHA 2ZZ7A 2B4GA 4O57A 2O0TA 1F9CA 1RBAA 2QUUA 3A4JA 4C6EA 1XUUA 1QWGA 1VPQA 3CUFA 4GCAA 4OVXA 3H55A 4LBUA 1CIUA 3ARTA 4GIAA 4ICNA 1AA1B 1OSEA 2C6QA 2PCQA 4H2CA 4GA8A 3UY8A 2QULA 3M0JA 3BOXA 3LXAA 4HOWA 5HWJA 3G1AA 4DWSC 2GOKA 3DUGA 3OVPA 3M0KA 4UOQA 3EOLA 1LBLA 1B4KA 1OFPA 3SRKA 3NXFA 1XDJA 3PTKA 4J7RA 2GVJA 4GI6A 4L6HA 3C3NA 1JYNA 1RZMA 4QCFA 1HKMA 4YTSA 1Q6EA 2VR2A 5FESA 1HIZA 4Q8PA 3G1SA 2YXXA 1XC4A 1OGBA 4JTJA 3WQPA 3KS6A 5EKYA 2DZVA 1IEXA 3W76A 4PCTA 1BSIA 1E5JA 2BFGA 3M0HA 2DZWA 2J13A 3LI1A 1EZ2A 5FAGA 3LRMA 4AVNA 5D2XA 4D6IA 5ABHA 4N0RA 2PGFA 4A35A 1GOKA 4URIA 4S38A 4NZJA 3W4RA 5A6BA 3MI3A 4K2SA 4HOZA 4HSOA 3CV1A 1DWJM 1TWZA 1CTNA 5FJPA 3WH5A 5E6YA 3ARXA 1O5XA 3GG8A 1A53A 4OOUA 1IWAA 5HUOA 1Z44A 3ABQA 3BLEA 1KRMA 5LXEA 2H3BA 4AFYA 1LORA 1RAKA 1WZAA 4WUIA 4AWSA 3PTQA 1H11A 1MVYA 4ZOAA 1OX5A 3U2EA 3G77A 3IVUA 3ZM8A 4EVZA 3RM8A 4LC8A 1S1RA 4UNKA 4B4HA 3UD6A 3QR0A 4MNLA 3A4XA 2ISSA 1HL8A 1A49A 1DWHM 5E9AA 3DU0A 5D2YA 1XH2A 1R2RA 2P50A 2PBGA 4GUHA 4XQ6A 3VKCA 4REQA 3W1MA 3KBWA 2JKEA 2DZPA 1QASA 3IGHX 1PAMA 3N04A 5H91A 4XO7A 1EX5A 3V75A 2VDGA 2QYGA 4ZQCA 4QRNA 4ATDA 4ZVJA 1OADA 1ZBWA 2OVLA 1ZBKA 3OU8A 1XW8A 3LI0A 3UZXA 3CS2A 2P8CA 4GK8A 1QPKA 2ZXAA 3Q45A 3QMTA 3CQJA 3AIUA 3FAWA 2PZNA 2V3DA 2IQDA 2ZWZA 4HA4A 5E5CA 5E0CA 4CU7A 3IWPA 4PCNA 3L7RA 5HPCA 4D6CA 5CEWA 5DT7A 3MMWA 2MUCA 4ERGA 4IF2A 4F0SA 3BLDA 3WF0A 3A4AA 3T08A 1X39A 4OBSA 3H12A 2DSUA 2G4FA 4ONVA 3URAA 4XZMX 3CAVA 1H7WA 1GHSA 3BW2A 3EOSA 2WNZA 3WLPA 4O15A 4NF7A 4O4WA 1UH4A 1VPYA 1GEHA 4IX0A 3SCUA 1EJTC 1TQXA 4MWAB 4PR4A 4GVHA 2OODA 4RUBA 3PNZA 1VYSX 1DE6A 4JNZA 2LLEA 3N6JA 3LBMA 1GYLA 1UR0A 1JYXA 3C6CA 3W88A 1CLVA 4EPDC 3D5HA 3V18A 4AX6A 4HHMA 4QDPA 2UY5A 2QCMA 2OR2A 4QAWA 1TFVA 1EWEA 1NVMA 1R9XA 2CLHA 1PB0A 1Q85A 5I06A 3BUVA 4LU0A 4UTTC 2PDQA 4MKSA 1FDYA 3XINA 3FNDA 3MDUA 3KBJA 3ARWA 1R0MA 3RRXA 4GXPA 2OGJA 4KMQA 3P93A 5LXXA 3IANA 1LWIA 4UCFA 1WP6A 3V1HA 1E56A 4LALA 2VR5A 3V7PA 2WSPA 4QNEA 1KXHA 3LHUA 4C6NA 2Q01A 4H9VA 2VFGA 1US0A 3NM3A 3SM0A 3TW9A 4E8GA 3EKLA 2QS8A 2CHRA 4GFIA 1PCWA 3W81A 1TR9A 4LPCA 2VC9A 4GPNA 3H7RA 1PV8A 1JPKA 4DWDA 4LEFA 3FGCA 2WW5A 1TVLA 1IQ8A 2DVUA 1CCWB 3L0NA 3NZ1A 1V02E 5CSSA 4JTSA 4LQ1A 2GL5A 3TR9A 5FF7A 1WUEA 5DCBA 5E09A 4ICMA 4HMNA 3COTA 4NI8A 4PFMA 4AMAA 4QX4A 5BXTA 3U6WA 3T81A 5ABGA 1PZ0A 3N17A 2ZUUA 3GTIA 1G4PA 4MAZA 4H04A 2QAFA 3EWCA 2QCDB 5TNVA 1UWRA 1QOPA 3OBKA 4C6DA 1V02A 5CG0A 3CIVA 3T2QA 1VFFA 5H6HA 1YDVA 1K02A 4PUDA 2YJQA 3SY5A 5HBFA 5TAOA 3NGJA 6XIMA 1UR3M 3BO9A 4NL1A 3AWOA 1ZNNA 4UQDA 2VD9A 6REQB 4QE1A 4TX6A 3TX9A 3BSHA 2PDKA 2C0AA 3CJPA 1AK5A 1UROA 4BY3A 3PWGA 3GZAA 1V03A 3WQCA 4LUTA 4ZQMA 5AHEA 3GB6A 3HG3A 4DUVA 4W4QA 3PP7A 3E9AA 3QOKA 1KW1A 3THCA 1H7OA 5FF0A 1LRQA 4GISA 5HOSA 1J4EA 1PWMA 3TAKA 3CHVA 4I9TA 1K8XA 5IDIA 1CEOA 1GOIA 4E4PA 3QN3A 5DMYA 1R8LA 3BW4A 5XIAA 3SIZA 1IZKA 5DXYA 2D22A 1QI0A 3GFYA 5CKSA 3G0SA 1RV8A 4HKPA 3C2EA 1XLIA 1V3KA 4JY8A 2QJNA 3OBAA 2YXOA 3TJXA 1UCWA 4CVUA 4B4FA 4GYPA 3EOOA 2WCSA 1LUCB 3GD6A 3GRIA 4KPLA 4W5UA 2ALDA 1YXYA 2VP8A 3O15A 2E68A 4J27A 3UJRA 3L65A 2YBUA 2C13A 1LWJA 1RALA 4DBDA 1SJDA 2DY3A 2B0MA 5EY5A 5CPOA 2W5FA 4CN4A 8XIMA 5D2VA 1EJRC 3Q2DA 4A8LA 3MO4A 5L6UA 3GXNA 2PDCA 2YLAA 4HP5A 5H8MA 1QWKA 1UD8A 3AFBA 2E40A 4C6OA 3GTXA 1OCBA 3CO8A 4B3LA 1ICQA 4BWLA 1OT1A 3LHTA 3IK4A 4UZUA 1BRLB 3QV6A 2DT1A 4O1CA 4Q4OA 1MYRA 2D2OA 2FGBA 1CI1A 3KOWA 4FXRA 4JTIA 1G7UA 3LG3A 3NPVA 2GGJA 3ZOAA 1NELA 4D6EA 4KFPA 4PUUA 1SJBA 2I9EA 3VIOA 3RX2A 2BSLA 1BPLB 2DT3A 4U3CA 1M04A 2DW7A 4FOUA 4PODA 4HD5A 4G56A 3L4VA 2OT0A 4DX3A 4W88A 3YPIA 4HJWA 1TQJA 3SN0A 1ONWA 2DVTA 3O7UA 2OZ3A 1EX1A 1W2PA 1SU5A 3OEXA 2VEPA 4WHBA 3VZZA 2HXTA 4O0ZA 4R9OA 4FIRA 1Z3NA 1YXCA 3VAVA 1D3CA 1LOLA 4KERA 1EC8A 1CYGA 3NJ3A 1IXQA 4IL2A 1A5SA 1SR9A 3QR1A 3RO8A 1P0KA 3H23A 4MSSA 1KXVA 3W2JA 3HIJA 3ANYA 4UWMA 2PC8A 2GDUA 3TYAA 1SPQA 1QPRA 2A7PA 3ECQA 3VC6A 3OQEA 3IIVA 3L4UA 4Q4PA 1GCYA 3VGFA 1YE6A 4DWSD 2WMHA 4PTDA 2QIWA 3VDHA 1UWTA 2C1GA 3CK5A 5FKYA 1EBHA 3M7WA 1QBBA 4WDUA 1MQQA 1L2QA 1XFCA 1SJCA 1E6NA 4S3KA 5AYBA 2WYSA 7TAAA 2GJXB 7TIMA 4NKCA 1BSLA 1SZRA 3KTSA 1SFTA 1QVBA 4UTWC 1PYFA 4ZL1A 3W6MA 2R94A 4UQEA 4LCSA 3EWZA 5HMFA 1TIWA 2VD8A 2BOEX 2DZSA 4XVEA 4WQ6A 1E70M 2Z29A 4JTTA 1CXLA 1UR2A 3AWNA 2RFGA 3KBVA 1JRCA 3DC0A 1E43A 3AS1A 4AB4A 1Z48A 3FA3A 2NVCA 1VC4A 4Q4MA 2J8FA 1XIJA 4Y9AA 4PTWA 3AIWA 3AS2A 4LWWA 2BXVA 1WV2A 3N15A 3KHJA 4QJ4B 4NZ5A 3VOHA 3GZ3A 3GAYA 2ZZ2A 2P0OA 1X6NA 4GUIA 4Y9OA 4C65A 3CMJA 5CPLA 4YN5A 2YDSA 3RJYA 2VGBA 3FV9A 1VHNA 1FUYA 2C79A 4MZ1A 4BEQA 1EUAA 3GW3A 1I2NA 1E1CB 4MUZA 4NRRA 5HMDA 2O7SA 3M47A 3V5CA 4MKVA 4D8LA 1FHLA 4K8GA 3BCDA 4WDTA 3W7JA 3I65A 3KLLA 4W7VA 3L4TA 1GVQA 3CLWA 2O9RA 2C18A 2QKFA 3WD2A 4PUWA 4A4AA 1QW8A 3MC5A 4WSJA 1RD6A 1JPIA 4GWEA 1J0YA 3E2SA 1Z89A 3MHUA 3GVGA 3L9CA 3HGRA 3UR7A 3GBEA 6CGTA 4FXFA 3WK3A 2YB4A 2NSOA 4FLOA 1VENA 1E72M 2AAMA 4HIBA 2BP1A 4EKJA 1EJUC 1OCQA 1UOZA 1GNXA 4A8NA 4FNRA 5DMLA 1JCYA 2UZ9A 3DFQA 2PDWA 4FS9A 5LIUX 5D30A 3APGA 1UD5A 3FSUA 2BVTA 1GEQA 3W73A 4EE9A 4JTDA 3IGUA 5EMMA 3GDMA 3E2RA 1F2JA 3REQA 4CQCA 4HU8A 3M6YA 2JKAA 2OSYA 1UPPA 2QR6A 4PA8A 4O50A 4GI4A 4KWVA 5H1WA 3KWXA 1IR1A 1P1XA 2VDHA 2WCAA 5A8GA 1H0IA 1O7AA 1V6VA 3GHSA 4M29A 4LV4A 2KAUC 3LXCA 3BQ6A 1W1IE 1N7KA 3QY7A 2GJPA 1AD1A 4K7YA 1GK8A 3M6DA 2Y5JA 1QK2A 1VFOA 5HWNA 3TFXA 1OC5A 3R89A 2PGEA 1EJSC 3G1YA 3E5BA 3HPXA 2QF8A 2Z25A 3R0KA 1J93A 1KQZA 2JEPA 2BG5A 2ZX5A 4AD5A 3M0YA 2ATMA 3KEHA 5DX7A 3EA1A 3UETA 4NAEB 1Q3NA 1E0WA 1PKYA 5FI8A 1ONEA 1H49A 3EWWA 2EKGA 4JFWA 3ZVHB 2R1LA 4DM2A 5T9BG 3T0TA 2VGIA 3LM3A 4O4VA 4ZB5A 2VGFA 1D8CA 2IUZA 3SQLA 2J6VA 3N12A 1BG4A 3ZVIA 5D09A 1PTDA 1IZCA 5FL1A 3TQVA 2WZEA 1AG1O 4O1BA 1GQNA 3TYCA 1UKPA 3TOPA 3SGGA 1ZCCA 3LHZA 2QAPA 3W3OA 2DZAA 2FVLA 1XLAA 3M07A 2V82A 4MGGA 3JRKA 5ABTA 1UR4A 3F5KA 4AHOA 2PBOA 4AVFA 1DXEA 3QQ0A 3PNUA 4A3HA 1R9ZA 3WUBA 5JXQA 4RJEA 1OQFA 3JR2A 2E4TA 4POCA 2XFFA 4NRSA 5D37A 3AXXA 2A21A 5MKGA 4IJRA 3HPFA 1WKFA 4LF2A 4TU1A 4I90A 3ZSTA 1AH4A 2Y0FA 2J7EA 3UG8A 2FH8A 5HNTA 2UWFA 2A6NA 3QW4B 3OVGA 3MZ2A 3TJLA 5CXPA 2E8ZA 3BARA 2YDAA 4DELA 4FALA 2OO0A 2WQPA 1RVKA 1JQVA 3PPFA 1I60A 1NP2A 2JF6A 4GABA 4KEZA 1B5TA 1UW9A 1DJQA 5HMEA 2X2GA 3WDJA 3P8IA 4C90A 4IMEA 2BLEA 4EK7A 3VU2A 2ZX6A 3ZT7A 2F61A 5I79A 4AVOA 1SW3A 1I45A 1GGOA 5G4HC 4AY1A 1VJIA 3TN6A 2QUVA 3EDEA 4KWSA 2D73A 2E5BA 1TPUA 3TMLA 3P61A 5JVLA 1UA7A 4US5D 5BZAA 1J0KA 1K8ZA 1YNYA 2DEPA 5IRPA 2NXHA 5A3HA 3DFSA 1QK0A 1UKSA 3GNXA 4PGLA 4MADA 2Z2BA 3V36A 2YW4A 2C71A 4PE8A 4N4QA 2VX6A 1PE1A 4O8AA 1E0VA 4AH7A 4JX5A 1IGSA 3NQ7A 3B8SA 4JFTA 4YU1A 4L9ZA 1F7BA 4EWND 1BTMA 3C86A 1CT5A 2VZSA 4NASA 3UG4A 5CBIA 4F0RA 4UTHA 2PWDA 1J18A 3XIMA 1GZ1A 3RJXA 4DWSA 4I7UA 5AFDA 1JI2A 1GG0A 4LY4A 5BU9A 3WH7A 3W7QA 1V77A 2E1DA 3WD4A 3H2OA 2CERA 3TWBA 1G7VA 3M43A 3IJ8A 3DYMA 4DUOA 4F9JA 4N7QA 1O68A 5D38A 1H3GA 4M80A 1TPH1 4JR5A 1RCQA 3N19B 3W22A 2V5KA 5FIPA 2XSAA 1WOAA 4F3HA 3HQOA 1FBAA 1RR2A 4M6PA 1GQLA 4B5WA 1I1XA 2OO6A 3AMDA 2YCLB 3ZJ7A 4LF1A 3SCNA 4IWWA 2O9PA 1HJVA 3MY9A 4RNHA 2DIEA 2PD9A 3LGDA 8RUCA 1KQYA 2H6RA 1M41A 1R9YA 5D02A 2Z0IA 4HNCA 1C29A 3G2GA 1VS1A 3VNJA 2BVYA 3NR0A 4F2TA 3B4YA 4NNBA 2J27A 1UP3A 3KAOA 1BVNP 1MW2A 2FFCA 1H2JA 2W0UA 1PHQA 4F8XA 2CFFA 4A6GA 4C6LA 2QCFA 3SCRA 3E1F1 3CC1A 3LSBA 1YQ2A 4FF5A 5G5IA 1F6YA 4XO6A 2W27A 5EU9A 1IEWA 5M03A 1ZB5A 4FEZA 3T8LA 1PSCA 1RH9A 3KXQA 5EMUA 3FHQA 4HOXA 1P5BA 4N6FA 4E8CA 3KP0A 1JZ8A 4JKMA 4OKDA 3DENA 1IIHA 1U5JA 1S1PA 2ACUA 3QOMA 4GC3A 4XIMA 2A3BA 3CLMA 1JVNA 3WNOA 1QI2A 3KX6A 1WCGA 3TONA 1LL7A 3ENLA 5CQ1A 4FMVA 1A5MC 1P6WA 2GK1B 3VD4A 5A6KA 5HUPA 4CN1A 3BV4A 2NQZA 2DV0A 4BI6A 4LYPA 3FDKA 4IMGA 3WQFA 2R9RA 3S1VA 3PBUA 4F0MA 5TBOA 3UXDA 2FB2A 5LZLA 3KFTA 1XCFA 2X0YA 4A3RA 4MWAE 3AZSA 1QAPA 1IWBA 4YTTA 1B9ZA 1XX1A 1FKWA 3O6YX 4GQ0A 4K6AA 3F5JA 3BAJA 1U5VA 1J2WA 1QNSA 4JQAA 2RGLA 3K4DA 3TYEA 3U2CA 1CB2A 4IOTA 1IXOA 2HVNA 3KRSA 4UTFA 3UPWA 3GKAA 5DMNA 3LHVA 4PMUA 1GVYA 3NPWA 1VBGA 1VCGA 2YCIX 5EL1A 4AC7C 4M6QA 3B0UX 1XH0A 4MWAA 4G7EB 2PDHA 3WLTA 3ZXWA 4HBKA 2H8ZA 2PWEA 4PTNA 4ERIA 5D4YA 2HE5A 3CH9A 1UC5A 3RCNA 4Q3MA 1LF1A 4E8DA 1R7OA 1FHUA 3SSJA 1WUFA 3A13A 4LC6A 4WJXA 2FYMA 3LN3A 4H19A 4GH3A 4QXIA 1EP1A 3VMOA 3GDLA 4OE7A 4BR1A 3B9OA 1OFOA 3EX3A 1C7TA 3NFUA 1W5QA 5CPQA 5H8PA 1OY0A 2VURA 4UQAA 1W17A 4HPXA 2PP0A 5CCZA 1ZAJA 3KUMA 3GVQA 3ZFHA 4DZAA 1PYMA 2MNRA 2E25A 1HKVA 3IVTA 3H24A 2FZ8A 1RVGA 4F0KA 2WVVA 1GW1A 5DANA 1XLBA 2YCEA 1U83A 4DJDA 2EJ1A 1F76A 2XSXA 4GQBA 3UWZA 4LGXA 4HGXA 5FF3A 3KBSA 4IFOA 2EF9A 4O16A 2IPFA 1W9PA 3D3AA 4YYCA 3N4FA 2ISVA 1ZS2A 3NO1A 4G7FA 3WFAA 5B7YA 2Y7EA 3MMDA 2D24A 4P2VA 1AJ2A 5G1MA 3STPA 5A69A 5A6TC 1KR0A 5LYRA 3PZVA 1E6SM 1Q65A 2VX5A 4IIBA 2INZA 1JYWA 3SRHA 2GSJA 2IKJA 3LB0A 1RQHA 3FHAA 2PDPA 4OU1A 2ZVRA 4AZCA 3AHTA 2QCDA 1W1ZA 2CZ5A 3U57A 3AHZA 4Q6JA 4D8AA 3G0UA 3IJ7A 1F8MA 3TC6A 4JQ3A 3CUXA 3WUFA 1N8FA 5I23A 3STGA 3VI2A 3THQA 5CJMA 4C7GA 1RLCL 3URQA 2QDEA 1IGWA 2FJKA 1EFZA 1VBHA 1E5NA 1UWQA 1F05A 6REQA 1H51A 2DQXA 2WKLA 4MM1A 5AZ1A 4GYFA 2V5CA 3CYVA 2QV4A 3ES8A 1TPWA 3PZGA 3A5VA 1UWUA 4IICA 5F7UA 4GCXA 4YLWA 5EMLA 3QTPA 4NAFA 3T4CA 1DORA 3W1TA 3PZ9A 1CW2A 3W2NA 1S5NA 3QGAC 3WF4A 3BG3A 4GVFA 1ISYA 3CWNA 3ANUA 3WQ6A 4V15A 2ZZ4A 2HVOA 5JBDA 3ABXA 3BE7A 3NOEA 5AHIA 1FP8A 1PL9A 2GVEA 4INFA 1W3HA 2Y7FA 1W3IA 2R1KA 1VEPA 2PDLA 4S3EA 3S3GA 4UQBA 1RHCA 3UCCA 2DDXA 1OGGA 1NOWA 1X8FA 1V0NA 4AZIA 4KQNA 3S5ZA 3NPUA 4TOQA 2EPNA 4B5SA 1R3TA 5E0FA 1E73M 4B92A 1LUCA 1OC6A 4RV3A 4FXSA 4O52A 4HHLA 4QAIA 2HQAA 3AUJA 3AZRA 1F3EA 1US3A 3W7IA 5GNYA 3VYLA 1ZRQA 1XLGA 1I6NA 1QNOA 4KCWA 1B0IA 3RCMA 4AZHA 1RY0A 2OZ8A 4JTUA 1PPIA 3R10A 2XZ9A 5F2MA 3W1UA 2OOFA 3WBXA 4MG4A 3POHA 3UQNA 3LZ3A 5F4XA 2RKXA 4AG0A 1QU4A 4AZGA 3EX4A 4LX4A 3CV6A 4E2OA 3TWAA 3WF2A 4JBRA 1GOWA 4EF8A 1PUDA 3WUEA 3RO6A 2QCGA 1WAWA 1HO4A 3O07A 3UA3A 3NQ2A 5KZEA 3PY2A 4RZ5A 5AKQA 1GQIA 2POTA 4NYYA 3K8LA 3VDAA 4WY0B 2OYMA 2P88A 3W2LA 2YOCA 5D8WA 3DHUA 3OB8A 3Q65A 4LRTA 4J40A 4LCRA 1XISA 2D1ZA 4HNOA 4ZE4A 1KTCA 3LCIA 3WD1A 1JNDA 3ES7A 4Y8EA 1ZTVA 3T8QA 4D6JA 1OZQA 5A1AA 1QUMA 3DI1A 1P1MA 9XIMA 1HZYA 3H2FA 3ZT6A 2HWGA 2XIIA 4PRTA 2Z1VA 3TUUA 4IIFA 4JTGA 1RSCA 4TQTA 5BXRA 1V3HA 1FFQA 1XYFA 1W9VA 1REQB 3WNPA 5AN7A 1VZWA 1O5KA 1JDFA 3AS0A 4ADSA 5BOFA 2VXNA 3N14A 1PEZA 2G3IA 3P62A 4H8HA 4HK7A 2ZTJA 4C5YA 1L6WA 1W1YA 1JUBA 3P80A 4MB3A 4JS3A 4C6FA 1ZZMA 4JTQA 1B3ZA 1SSGA 2NV1A 4UTLA 4MY1A 2CITA 1EP3A 4JX4A 4ZB2A 4GI9A 2D2GA 3B8WA 2J8GA 1BWVA 1B3XA 5AYYA 4BEUA 3BAKA 1FTXA 3MDWA 1F07A 1CNVA 3AMLA 5FACA 3LTPA 3KVKA 1ONRA 5FJOA 4YWSA 1Z8AA 1ESWA 4NHVA 1V4YA 4X61A 2DZBA 4LUSB 1MQRA 4IXHA 4Q33A 2ZXQA 4JDYA 2WB5A 4RKAA 5CBBA 3S9YA 3MB9A 5T91A 2TRSA 3GW0A 2CLKA 1LL4A 4YL2A 3MMUA 3LPFA 1P7TB 3LK6A 1JR1A 4UIOA 1V3LA 3CPRA 4XBJA 3LY0A 3VX1A 3WN6A 3CUJA 1XYBA 3SCTA 1A5AA 3NWRA 3EPMA 4EWJA 1TO3A 4WSKA 3VXGA 3GIQA 5C9ZA 1ZFJA 1WZKA 3U7BA 2CLMA 1TV4A 2J7HA 5I3IA 4GOAA 2RDTA 2I5IA 2EPLX 3T0BA 4I5RA 3NQ6A 4JYDA 1Q4NX 1NDVA 4DBSA 3USBA 5A5WA 3NSNA 4P8VA 3C0SA 4NNAA 2E1WA 2V5JA 1DXIA 1JDCA 4BI7A 3VE9A 4CCEA 2P3EA 3AS3A 3JW7A 4UQ9A 4EX4A 4FO4A 2OGYA 2JF7A 2NUXA 4W5ZA 3KM8A 5CSRA 4E4FA 4NSBA 3ABRA 4LVFA 4DJEC 2JQXA 1XBYA 1WDSA 3T0AA 1TCDA 3KTXA 3O3RA 4WX2A 2PWHA 4E3TA 5FF4A 3W7DA 2X42A 2DJXA 3UR5A 1WAUA 4WGXA 4V28A 1QDSA 4DI8A 5F4WA 4GMEA 3P7YA 3RR1A 1OZMA 5A8OA 3LGEA 2DSVA 3OIXA 3CPGA 1R3QA 2HBVA 8A3HA 4NJKA 3QSRA 2C3ZA 3ZT5A 1FWTA 3SCVA 4NX0A 5AVHA 4IGMA 1TJPA 1QRQA 4R3UA 4N2YA 4JQ1A 5DCEA 3B4UA 4AF0B 3WJXA 2FPTA 1Q7ZA 1K7EA 4JTRA 3OYXA 3MKCA 3PM6A 1T40A 2Q09A 5TF0A 3BLOA 4D6FA 3QRHA 4U5IA 5DF0A 3ZJ6A 4MUPA 2XGZA 1CGVA 4OHQA 3EDDA 5GJNA 3VZXA 4FF7A 4O8RA 3K46A 1HJXA 3SFKA 1W1PA 2I56A 1FWGC 4QS6A 2UY4A 4RNIA 1MXDA 4IHCA 3IIXA 4RW3A 3V0TA 3N2MA 1H41A 1DTUA 2A3HA 1Q8AA 2FPYA 3MJYA 3FVDA 2R24A 1XINA 2QDDA 2FQIA 5BXSA 5HNNA 2PLKA 2OSWA 3W83A 2HRWA 3PUGA 3CMFA 4O14A 2VWSA 2ZZ5A 3B05A 2NLYA 2CLLA 3NQ8A 4GIRA 2XM1A 1BGAA 3NIYA 4PH6A 5HR7A 4TO8A 1GKRA 1OYAA 1FY6A 1AUSL 4PMVA 2VL4A 4S3FA 1PCKA 1ML1A 2VC6A 2VNCA 4BS0A 2XH0A 3FJNA 4PBEA 2A1YA 4D1IA 2YZ5A 3OPSA 3UJSA 1R3YA 2GYIA 1Q66A 1VH7A 1P6CA 3PR2A 4AISA 1W9BM 1OX4B 2ISDA 2FIQA 1ZGDA 5HQLA 3WMBA 2YCJA 3LENA 4M24A 3OOQA 1EGMA 5HR6A 2GDVA 1DIEA 1TJRA 1TJ0A 1DJNA 2F6XA 3BOLA 2HTMA 3L66A 2I17A 4Y6GA 3SCOA 1SO6A 1WPCA 4WDXA 3OZPA 3VGDA 4P8XA 3W1PA 3S1UA 4DI9A 3L0GA 5LNSA 3SUUA 4A8RA 3QR3A 2E5CA 2B31A 2V63A 4PUEA 3KLKA 1OIFA 3GYCA 3BVJA 5CZJA 4X63A 1FRBA 4ROQA 2PE4A 3IJ9A 3CWHA 2FTPA 2NQLA 4MDPA 5F1UA 1IXPA 6TAAA 2IXVA 3E02A 4LOCA 6ENLA 2Z28A 1GT8A 1KCXA 1JCTA 3VNZA 2A79A 4TIMA 4ERAA 1EHNA 3NXLA 4U33A 3MP4A 3VNDA 4R53A 1FP9A 4CEUC 3WBAA 3H2MA 3LYEA 1NWRA 1ZL1A 1JPDX 2CIPA 4DY1A 1MZHA 3SQMA 3OW1A 1JNEA 1E1EA 3LCXA 5BU6A 4H9MA 2F84A 3OIHA 3UPBA 1XGDA 3TW7A 4RV8A 5CPMA 2J79A 3Q4DA 1AJZA 2E9BA 4BFAA 4H7VA 4O1EA 3KW3A 3W82A 4LVAA 2EQDA 1GKPA 2J66A 1E55A 1MW0A 1NWSA 5KEZA 3BG5A 3TN5A 4M6VA 1MMFA 1H50A 4UTJA 4PUNA 3QHNA 2ONEA 3IUHA 3VGGA 2IMRA 3MUY1 4IJCA 1VB9A 3RR4A 1PS9A 1OJXA 3SCSA 4OWGA 1UPMB 4O1FA 2HNEA 1HX0A 1HJSA 4XZLX 3E6EA 1NU5A 3CHEA 3EB2A 3S6TA 2XJ7A 3G1HA 3AHYA 1OT2A 2QPSA 1XV8A 3R94A 3NGFA 3GHTA 4WKAA 4BF9A 4W8LA 4Q8OA 3QY6A 1Z6KA 1Z41A 5I7GA 5DLCA 3SCWA 1KKRA 3EB3A 1L6YA 1PZ2A 4ZO9A 1O4UA 3O6CA 2HS6A 4D71A 1GOMA 3UERA 1T99A 3GIYA 3MHFA 5XIMA 2B7PA 3RDKA 3EX1A 3P0XA 3GDTA 5LHFA 1N82A 4ACZB 2Q3RA 4PMRA 3CZJA 3CWOX 5LSMA 4MNJA 1DEDA 3AMCA 3TTQA 3RLHA 3GC2A 1DJXA 4X2PA 1CXIA 1O6IA 2Y88A 2PDUA 4YJ5A 2VQTA 3UY7A 2GGGA 1KFJA 3FAXA 4JICA 2XGBA 2FTYA 3ELFA 3MKVA 2QMJA 1QNRA 2FZBA 4Z17A 4YPJA 1QTWA 2XH4A 3KHDA 5DY3A 1ZENA 4CQ8A 2R82A 3Q58A 2SFPA 2IPJA 4RZBA 3H2CA 2XGIA 2QLYA 1JEZA 1OCNA 3APTA 1V7AA 2VGGA 1G0CA 3CXOA 3S8HA 4R34A 1YMYA 2C1IA 3CEPA 2EPHA 3FXYA 1MO0A 1C90A 1KFCA 2J9ZA 4K3ZA 1W37A 1ECQA 1OINA 4F0HA 3J7HA 4GYJA 5CPNA 3GU1A 2CXGA 4HZMA 3OGVA 4Y9PA 3W23A 1UKQA 1VEOA 3TYUA 3ATYA 3LCWA 3B9AA 2Y62A 1DJWA 1KC7A 3IUDA 1OYBA 4MOZA 4Q22A 4XZWA 2OCZA 4AYGA 1PKMA 4LEQA 3PAOA 4O1DA 1FXQA 4NZFA 4QG8A 1MW1A 2J25A 4DAIA 3W6LA 1Q6FA 1U22A 4Q4RA 2OYKA 1UWSA 3WH6A 2XH7A 4IISA 4QG9A 4LS2A 3EKZA 1KBLA 4IMDA 2CESA 3QY8A 2WNQA 5MF5A 2Z1BA 2VJXA 2JBMA 2ZKMX 3LHWA 4ADTA 1E6QM 3NEVA 3RIKA 4XV0A 2NXIA 1LQ0A 1XYCA 3DH7A 2FVMA 5AOUA 1JDEA 3OZMA 1HP5A 1V3JA 3B8TA 3WEOA 1M9HA 1O95A 4NP7A 4EAMA 2AGTA 1VFSA 3C2VA 1WB0A 2J7FA 4H6KA 1UZ4A 4HJFA 2JE8A 1O66A 4JNMA 4D72A 3MO7A 4LB3A 4C1NA 3KDNA 4IX2A 1N8WA 1AH0A 1OFEA 3IACA 4WLCA 3AO0A 1VFLA 4G1NA 1B4EA 4GYPC 5GJMA 3T42A 3W1XA 3P0WA 1HN1A 4KCUA 3IJDA 3H21A 4L1WA 3PPCA 2W9MA 4LNCA 5G2IA 2CHOA 3EMQA 4L56A 1MSSA 4NY2A 1TWWA 4JN6A 1S2CA 1XD0A 3MTWA 2H9AB 4Z1CA 4XB3A 2PLCA 4AXNA 2XH2A 3ZLHA 2PA6A 3F2DA 2JFEX 1DXFA 2EPOA 1UUOA 2ZADA 4U5KA 3FIGA 3DFPA 4ECLA 3EOEA 3GVVA 2CBUA 3IV3A 2PB1A 3MP3A 4TMCA 3ZWTA 3U7VA 1A5LC 2CZDA 2G37A 2D3LA 1IYXA 4LVBA 4D9PA 5J04A 3WLQA 1PHWA 3EA3A 4OBTA 4G7EA 3BPWA 4EXAA 2VHLA 1TRDA 2WSRA 3LX9A 5EBAA 3R8HA 1R86A 3HG4A 1WKDA 4JDBA 3LRLA 3HFYA 3RLVA 1J10A 1TV7A 1XYZA 1KFEA 4X9SA 3C5QA 2WM1A 1VHCA 2A85A 3WKZA 2AMXA 1XCWA 3VIMA 4M1BA 1SQ7A 2OX1A 2BBFA 4I6KA 5G2HA 4EPBC 2RDUA 2O92A 2DU2A 3OLDA 3QQ1A 5E0KA 1TKKA 3PBYA 3AJ7A 3HGSA 3L0KA 5CJ5A 1PZ1A 2IS7A 2XHYA 5AC5A 1KFKA 1P0NA 1XLJA 3HF3A 2XPKA 1QNPA 1Y7VA 2UBPC 1IZJA 1OFDA 3QH2A 1YPXA 3TQPA 3OZYA 4MYAA 2WJEA 4FSAA 1I1WA 4DJED 1OGSA 1I8JA 1EPXA 3GAKA 4PCPA 3LCLA 1JPMA 2HK0A 2QMKA 1GQJA 1TSIA 5C7VA 3L4YA 2J8TA 1K9TA 2WKGA 4J3XA 2VUNA 1UIPA 1YNQA 4JPGA 1W9DM 3GH7A 5K4ZA 3KVJA 3GU9A 3QW3A 5A2AA 1UWIA 3QQWA 3TA9A 3GC4A 1JF5A 3IGXA 3O9NA 4J4KA 4ZMGA 2BTMA 3NCOA 4V27A 3CGTA 2DW6A 1HKIA 1RK6A 1E9LA 2IPGA 3RMJA 2CKRA 3OLEA 5JBEA 1OBAA 1MWOA 1P0EA 1UJQA 2WMGA 2DSWA 3W2UA 4C7FA 4RE3A 1IF2A 2CBJA 3PBVA 1W3TA 4Y8FA 1Q4WA 5AECA 3KRUA 2RDWA 1OFQA 3V0SA 2D23A 3UA4A 2P8BA 1N8IA 2V5DA 3ZJKA 2XIJA 3S1XA 3G22A 3BAIA 1EDTA 3SN1A 4ILSA 1CPUA 3SIMA 5D05A 1UASA 2O4QA 1GVSA 3E0FA 5A6BD 3ITLA 1G5AA 4C5ZA 1IE7C 5FSDC 2WK2A 2VYOA 3R58A 3IAPA 4MF4A 4DZHA 4S39A 5IBXA 3FA4A 4HPNA 3I6TA 1IHIA 4ZOBA 3DHPA 4Z1BA 3M4HA 3FEQA 3A9BA 5JBFA 1QJWA 4PRRA 4Y90A 5FJIA 1DYSA 3QM3A 4JX6A 4MMWA 3K30A 3XISA 4AEOA 9XIAA 4F2BA 2Z7KA 1FFRA 3I4EA 3L5LA 4IUOA 1U30A 1J5SA 3GFXA 3PTDA 3VNMA 3M5ZA 1V51A 1QT1A 4C6IA 1VBUA 2OG9A 1G69A 4Y9MA 4FXJA 1EOMA 2NX9A 3BLFA 1LROA 5FJJA 1C8VA 4L4PA 1AW1A 4ZCWA 4GY1A 4Z0SA 3E0VA 3A21A 3QFWA 2NZLA 1UH2A 1ZJHA 3L67A 1FA2A 1G4SA 3GR8A 1XBVA 3W7LA 2ZC8A 2B81A 1GTEA 3K1DA 1Q6CA 1OB0A 4HSHA 2RH9A 3TTOA 4PL2A 1XUZA 2WHLA 1L6GA 4QITA 3FVMA 2VRQA 2WC3A 4ZE5A 3ZWSA 4WK9A 4S2CA 3LU2A 2AQVA 3C56A 1JAKA 4DJFD 1OK4A 3DBPA 2RJGA 1NQKA 3W1AA 4H00A 2PC4A 4DNHA 2PRMA 1Q2SA 1CGTA 4P7RA 3ZYZA 1Q2RA 4PMQA 3UXIA 1M7XA 1SSDA 1KBBA 1TV3A 1XYMA 3KRBA 2A0NA 4PMJA 3B0VC 2NT1A 3NYZA 3QTGA 4QDMA 3OVRA 1OABA 1UIOA 1EF3A 3KCLA 1XLHA 1DTNA 1VFTA 3B97A 1VJZA 3OLGA 4FX7A 4WY0A 5EFFA 2OLSA 2RHGA 5I24A 1PJ9A 4RE4A 4NILA 2Y5SA 3S6OA 2IQ0A 3AC0A 3DHFA 1KBKA 3AHVA 4IL0A 4HU4A 2RJHA 1DIOA 1UKOA 3LTYA 3PFRA 3ZMRA 1DE5A 3VC5A 5EMKA 3VDCA 1FWRA 3RHGA 4L4OA 2BXZA 1E0XA 3WENA 5HDRA