4Q7IA

Crystal structure of engineered thermostable d-tagatose 3-epimerase pcdte-var8
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRYEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 118
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4q7iA00
3M0MA 1XIFA 2GUBA 3BANA 4OVXA 4HHMA 3IUDA 2X7VA 1DE6A 2ZVRA 1XYMA 3IUHA 5TNVA 5FA5A 2Q02A 5B80A 1XIGA 4US6A 1YX1A 1XLEA 3BWWA 4YTTA 4ZBCA 1XYLA 4Q7IA 3C0QA 1XIBA 1XP3A 1CLKA 3QC0A 3JU2A 2QW5A 4XIAA 4HHLA 5EMMA 3QXBA 2X7WA 3VNLA 4YTQA 3UA4A 3U0HA 3BZJA 1DIEA 1TZ9A 1XLKA 3VNJA 1XLGA 3FVMA 1XIJA 3KBVA 1XLJA 4LNCA 1XLCA 3VNIA 4G56A 1XIDA 4X61A 3AYVA 1XYCA 3ITOA 4ZB0A 3AALA 4XKMA 1I60A 3M0LA 2XINA 3UU0A 1XLLA 4KW2A 4EAYA 3TC3A 1I6NA 3L23A 9XIAA 3KBJA 1XINA 3CQJA 3ITTA 1QTWA 2QUMA 3DX5A 3P14A 3TVAA 1A0DA 1XICA 3CQKA 3KBSA 2NQJA 1BXCA 2GYIA 1XLIA 3P6LA 3GNXA 1XISA 4A8NA 8XIMA 1DE5A 1XYAA 3M0YA 6XIAA 3M0XA 1MNZA 1XLHA 3KCLA 3QZAA 4HGXA 4QDWA 4ZB5A 2GLKA 1MUWA 3IUIA 4A8RA 4QE1A 3VYLA 3C0SA 3OBEA 4QEHA 1XYBA 3DBNA 2J6VA 1A0CA 3XIMA 3C0LA 5XINA 2NQHA 4YTSA 3VNMA 3M0VA 4QE5A 3CQIA 4E3VA 2QULA 3ITXA 5B7ZA 3XINA 4DVOA 9XIMA 4XIMA 4J4KA 2HCVA 1GW9A 4PFHA 3BDKA 4W4QA 4GLEA 3ITYA 8XIAA 2HK0A 4EACA 3KCJA 1XLDA 4QDPA 3CNYA 4K3ZA 3QYSA 6XIMA 1D8WA 2GVEA 3UVAA 3LMZA 1O1HA 1XLAA 1XIEA 3KWSA 2NQ9A 4XISA 3KCOA 5AVHA 3ITLA 3WQOA 4XSMA 1S5NA 2G0WA 4X60A 3VNKA 4DUOA 1XLBA 1DXIA 5XIMA 5AVNA 5B7YA 1XIHA 3ITVA 5EMKA 5J8LA 5EMLA 3BZGA 1BXBA 4ZB2A 4X63A 1XIMA 3N4AA 5XIAA 2G4JA 1DIDA 4PGLA 3M0HA 3UXIA 2HK1A 3NGFA 2ZDSA 3AAMA 5H6HA 4YTRA 4HNOA 1K77A 1S5MA 3CWHA 3U3HA 7XIMA 5I7GA 3XISA 1A0EA 1QUMA 5EMJA 4QEEA 1XIIA 4A8LA 4A8IA 2I57A 2QUNA 2I56A 4GJJA 4YTUA 1XLFA 3AYTA 2OU4A 2XIMA 1QT1A 3KBWA 3KTCA 4XSLA 3KBMA 4GJIA 4QE4A 2XISA 5C9ZA 3KBNA 5H1WA 1XLMA 4K1GA 4GQBA 3UA3A 1OADA 3CQHA
chains in the Genus database with same CATH superfamily
4H04A 4XAZA 3N6QA 3RRAA 1QRQA 2FVMA 3LUTA 4E4FA 5I3IA 2J7GA 1PJ9A 4JTQA 1NOUA 3T2QA 5F4WA 4AEFA 3NSXA 3MZNA 2CESA 1UR0A 2AQVA 4LVDA 3GXMA 4JDBA 5BYWA 2WO5A 3CGTA 4GXWA 1ECEA 1FWNA 2NUXA 4AIEA 1ME7A 1WKYA 4QISA 2RKXA 1OCJA 3VABA 1W31A 3L7RA 2D2HA 1WDSA 4NYYA 3SY8A 4WHBA 1L2QA 5T8GA 5JBFA 4KCWA 3VIKA 4JNZA 3WLKX 2E09A 4QRNA 3M43A 5EFDA 1IT8A 4D6JA 3FX4A 3OZMA 4MWAC 1H1NA 1JPDX 3B40A 4IX0A 2E6DA 3QHMA 4DO7A 2GWGA 1CGUA 1T5AA 2C19A 3G0SA 5AC8A 4Y9AA 3WY1A 3THAA 1DTNA 3NO5A 3QR0A 4ICMA 2BY0A 4UR9A 1RK5A 1TB3A 1TX2A 2GGIA 3WN6A 1S2WA 1FRBA 3LTYA 2BX7A 4OV4A 2WMIB 3CPGA 2CXEA 1TO3A 3ARXA 4EP8C 1SW7A 3AXMA 3KE0A 3O6YX 4AYGA 1JCYA 2BTMA 3PNZA 4LVGA 4YCPA 4AHOA 4QM1A 4EOUA 1CGTA 2I14A 2PGWA 5KZDA 1J0ZA 3VC5A 4PRTA 1POJA 4QLKA 2AL2A 4US6A 1R3TA 2R6OA 4JN7A 3VKAA 1EC8A 1DVJA 1XX1A 3UA4A 1YDNA 3V0SA 2PP1A 5LZLA 3KX6A 1GG1A 1R8LA 4S3JA 3DFSA 4U28A 3P7YA 5CGMA 1K6WA 1R2RA 4UCFA 3OLGA 1LF1A 2YCIX 1WUEA 1V02E 1YDVA 5HPCA 5A2CA 3A21A 2YPIA 3R94A 8TIMA 3DIPA 4ZQPA 2AMGA 3MI3A 3TLLA 4PMDA 4EXBA 2JKEA 5XINA 2W63A 3VKDA 1UR9A 5A2BA 1OT2A 4PTWA 3PC0A 4PFHA 4Q8NA 4JTAA 5AOUA 3ABRA 4U33A 3RFAA 1UHVA 2JBMA 2ZXAA 5C9RA 1NDYA 2PTYA 4YN5A 1LWHA 3LMZA 2QAFA 4ZTYA 5D2TA 3HFTA 2B81A 4P61A 1XYZA 2DZUA 3LQLA 3V16A 2NV9A 3RLVA 3S5ZA 4ERGA 3DHUA 4ZQNA 3UEQA 4PGLA 3RK8A 1KFBA 2FPYA 2PDCA 4YTRA 1K77A 4IXHA 3WDHA 3GE7A 4PUKA 3VK5A 2YA1A 1N7KA 2P53A 1XLFA 4H8UA 2PB1A 4AVOA 1OADA 3N6JA 1UA3A 4IFRA 4HHMA 1EBGA 4GY7A 1OCQA 3TOYA 3LHZA 4R5EA 1O5RA 1MFVA 1M5WA 3TH6A 2D2OA 3QHNA 4H9XA 4MAVA 4CCZA 1QI4A 3ID7A 2QPSA 3SY1A 3GFZA 1D3GA 4RZBA 5ABHA 2RAGA 2PC4A 4OUIA 3BXWA 4L1XA 3ITGA 3NL3A 3THCA 1XV8A 3LCGA 3NQEA 4R9OA 1EX1A 5HMEA 1NOFA 4RXGA 4DX3A 3BVJA 2C0HA 1EIBA 4L64A 1XL9A 1QOPA 2RDXA 4YMZA 4GVFA 4P8XA 3WQPA 4NJGA 2A2IA 9XIMA 4UQ9A 3WF4A 4QJ5B 1DWAM 2DT1A 4JFTA 2C91A 2QS8A 5A6SA 4XZMX 3ZYZA 5AKQA 3WQGA 3C56A 1E6PA 2ZZ6A 4TU1A 3V0TA 4DF0A 3D3AA 5K9CA 3IJQA 3MPGA 3V5OA 2PDLA 2CFFA 1TSIA 4BJHA 3L67A 2BWGA 3UY7A 3WQ8A 6PTDA 1I2NA 2PDIA 1SW3A 3CQ0A 2FJKA 1SR9A 1DJZA 1GJUA 1UZ1A 3EPMA 1J10A 3LBOA 1US2A 2NSXA 1OGBA 2DZXA 3UGVA 3C52A 1SO3A 3O9NA 4Y2WA 4AZBA 2EPKX 4O1AA 1C9WA 4MPKA 4N02A 3DYPA 2VEGA 4WCJA 3U0HA 1B3ZA 5E9XA 2Y89A 1ITCA 4I6VA 1CCWB 1H50A 1XLJA 2DSKA 2QLYA 3WQWA 2DQXA 2ESCA 4W89A 3RCYA 2ZVIA 4GIYA 3W7MA 5BNKA 2PDJA 1MXSA 1BWVA 1HFBA 3AIEA 1FWAC 2ZA3A 1G67A 3S5OA 1P48A 2WV8A 5AC5A 4IPPA 4UQCA 3H53A 4IL2A 4PSRA 4QSFA 4QE1A 4C6PA 3HGRA 2VGGA 3GNOA 3TJXA 4H41A 3FOKA 3ZVHA 5LYRA 1LZOA 1B30A 3N04A 4S39A 3OVRA 4HHPA 1ZU8A 3PBVA 1S2VA 5HA7A 5K7JA 2BGQA 3HGSA 4GUJA 1V51A 4O18A 1Q7QA 4RDZA 3H23A 1NWTA 3H6OA 4UMAA 3FY1A 1R3YA 3S4TA 5CSRA 3ITLA 1W5MA 1MRAA 4HU3A 3C61A 3TAOA 2DH3A 3K8MA 1VBHA 1HX0A 3R2GA 2X1SA 3QR3A 1XYFA 4GXMA 1XFBA 4CKQA 3G1VA 2WHMA 3FYOA 4R88A 4NX0A 4BS0A 3ME3A 1EGVA 3SFKA 1RVKA 3R8HA 3L4YA 3FGCA 4BY3A 3GHRA 3HV9A 2V69A 2PWFA 2J62A 3WLMA 3LXAA 1ZP4A 1J01A 1J96A 3RGTA 5A69A 4RW3A 1E51A 1UQZA 1EPVA 2INEA 5AFDA 2PFHA 5CZJA 1VYSX 3LXBA 4GZ7A 3BJSA 5DN1A 5EB8A 3PTQA 2QDEA 2QMKA 4I7VA 1KV5A 3UGRA 5TBOA 3EB3A 3S5SA 4GYJA 2QUUA 4U2YA 2XM2A 4ZB5A 4MY9A 1V0LA 5K2ZA 2PGFA 4LS0A 5M2FX 3PZIA 4GHRA 3TTYA 4E3VA 4QS5A 4PUUA 4AZ5A 2Y4SA 3GZ3A 2PWVA 5A6BA 1RQEA 3COTA 3NXFA 5FACA 4AB4A 4CD5A 2KZHA 3NZQA 4J35A 2WJDA 3S2NA 3PVFA 3INPA 1R46A 1KD0A 3E1F1 1VFFA 1XRFA 3AYRA 4AISA 3LK6A 3W75A 2ZXBA 5EMJA 3QSTA 1H7WA 2J4GA 3CIXA 1ZNNA 3PWIA 4ECLA 3TTSA 5LNSA 3CUZA 1QVBA 3IJIA 4DWSB 5FI8A 3AJXA 3IUDA 2XH0A 2J7EA 3F4CA 1XQLA 3MS8A 4DJED 4JTEA 3W01A 3CASA 5JU6A 1UR8A 3CPRA 1S2AA 3FK4A 3JW7A 3V3WA 1DIEA 4OOZA 3ARPA 3KEHA 4WJ8A 3U5UA 3GRIA 4YL2A 3ZWTA 4MWAA 4XKMA 4IL0A 3WG6A 2OWCA 2ACSA 3OVGA 1B3OA 2NX1A 1PAMA 1YNPA 3NZ1A 3G3DA 4UZUA 2W4XA 1QJWA 8XIMA 4K2SA 3M0YA 4BI7A 3TYUA 1UOKA 3W7CA 3MKKA 3S9ZA 3AHYA 3LNMA 1P1XA 3SRFA 3SZ8A 2JIWA 1F3WA 3CK5A 3DXIA 5JMUA 4J4KA 4PB3A 4FIQA 3A4AA 2XSAA 4EACA 1OIFA 4UMCA 3W7HA 4Z1AA 2JGQA 2E5CA 3KVMA 3W1NA 5HOSA 3R6IA 3AO0A 4F0KA 4Q8TA 1CGWA 3W02A 5IFTA 3F5JA 1PKYA 1MEWA 3IJ6A 4F0HA 3CWOX 4IIGA 1TPDA 3N4FA 4HZ8A 2PRLA 2QCEA 4LCSA 2DJXA 1S5VA 1W3HA 3C2VA 4FIRA 1IT0A 1POKA 3AQUA 4Q6JA 1LOLA 4KFPA 3S2LA 1W8GA 3BCJA 4LXFA 4BEQA 3M1ZA 4C1LA 4AZCA 2JF6A 3GW0A 3CO8A 4YYFA 2OJPA 3OGVA 3GLCA 4K7YA 3AUOA 2ZTKA 3I4EA 2V5CA 2YBTA 2IMRA 3KRUA 1C3FA 3AS2A 4B4HA 4EX4A 4P8WA 6XIAA 2IPGA 4IP4A 3BPWA 1G7UA 2J66A 2PCEA 1BQGA 4OKDA 1LDCA 4GNJA 3GK0A 2J6VA 2ZZ4A 1TFVA 1VQTA 4MNJA 1Q45A 5CPQA 4GLEA 3HV8A 3BL3A 4GY0A 1ZJBA 2V9DA 3S6TA 2QEZA 1CXKA 6XIMA 1SZFA 1GORA 1ZB5A 5IRPA 4PUMA 4K38A 4LYRA 4DI9A 2ZZ5A 1TUFA 3AMKA 1XH2A 3BO9A 3FVDA 1WZKA 3DFPA 1TVLA 3G1XA 2OMAA 1F4HA 1A0EA 4G7EA 2VI0A 3HZ3A 4ENLA 5A6BD 2AGTA 1RP8A 2QCCA 1CB2A 2OSWA 3BAWA 4IGHA 2ABBA 1VH7A 2FZMA 1DE6A 4HD5A 2YCJA 4M3PA 3KZPA 3TW6A 2VFFA 2JK2A 3UJEA 4F0RA 1XBZA 2R24A 4PMRA 3UWZA 2E67A 2DV0A 5G5IA 1KM1A 3IVTA 4RZ4A 3KBVA 1NDWA 3GW3A 3OGSA 4O12A 1E0TA 4IGMA 1GW1A 1H11A 3TONA 1O60A 3ZOAA 1GONA 3CUIA 3S9YA 3KBJA 2JEQA 3CUJA 3B0XA 3WF2A 3P61A 3RPMA 2YIHA 2QVNA 3B4UA 4JNMA 2X0HA 3C0SA 3P93A 4E38A 2MUCA 4BF7A 1A4LA 3SUTA 1ONWA 2QCMA 2ZC8A 1HF6A 3BDKA 3HO8A 3WNPA 4ZCWA 3HG2A 3MWCA 1EQPA 1NY1A 4EAMA 4KEUA 4OTKA 3W86A 1Q8JA 3KS5A 4XISA 1MZRA 3F2DA 1DHPA 2WCAA 2DUAA 4HPXA 5J8LA 1FWJC 5AC7A 3K8LA 3T6CA 4ACZA 1T40A 3MP5A 4DWSC 1F6PA 4B9ZA 2O92A 1UR2A 3K46A 1BVWA 1R3WA 3LEPA 4CCEA 1P0NA 3EXSA 1LQAA 2ALRA 1BGAA 1BXNA 4P7RA 1FUYA 3TXVA 4DJFC 1U1UA 1ICPA 3QGKC 6REQA 1DWIM 1ICSA 5RUBA 2E6FA 2ZKMX 4ZZ9A 2DZTA 3WO8A 2VELA 3WD4A 1TKKA 3JS3A 5D02A 3H70A 3QQ1A 4TV5A 8A3HA 2Z00A 3CH0A 3PPFA 4GIAA 4N9EA 4AZIA 2V6AA 1WDPA 2XIJA 1FWEC 2BS9A 2WMIA 1GVOA 1GZ1A 1MUWA 3VYLA 4C6FA 3GVRA 1SO4A 4UNKA 1PCKA 1UWQA 3MJYA 2QCFA 1G4EA 1TVPA 4DBDA 3PK7A 5F2MA 2QMJA 1A5OC 1Q6CA 5HNTA 3OPSA 1ME9A 3L4VA 3NGJA 3URNA 4O15A 1BSIA 2VC7A 5XIMA 5BWAA 3R5EA 3WDJA 2F6XA 1VFOA 3H4GA 3SEPA 5A5WA 4FNUA 3E5BA 1W37A 1K8XA 3CWNA 3W26A 4LANA 4A3UA 3M5VA 2V3GA 1XF0A 1OJXA 3E96A 3CUXA 3VKCA 5E0KA 2I16A 1CI1A 4HNLA 3P74A 3O7UA 1D9EA 1FOBA 1UWTA 1U1HA 3STGA 3UJRA 1AL7A 5BOFA 1B3XA 2HZGA 4XKYB 3DFOA 4WSKA 2PWGA 1TMQA 4YCOA 4RNHA 1XWYA 1FHUA 4HNCA 5BOOA 4O1DA 5HQEA 3NL6A 1JULA 3EDJA 1E5JA 3VFLA 3NR0A 3LM3A 5DCBA 3SFWA 1TRDA 3IIXA 4HU4A 1V7AA 4DF2A 4LRTA 2PEVA 1GYMA 5A6TC 2PLKA 2RGLA 3S5NA 4MZYA 1YLVA 2PMQA 5KMYA 3GKFA 3GM8A 4E4UA 5HWNA 4IH3A 4DYEA 3G1HA 3ITXA 3PB0A 4TTUA 2HXTA 5CZKA 2QCHA 1QNQA 1PVNA 4JL2A 3CAKA 4Q4RA 2C7FA 5HQLA 3L66A 2ACRA 1RY8A 4LVFA 1XG3A 4OV9A 4IIDA 2VNCA 3GG1A 3KM8A 4PZVA 2HXUA 5I79A 3N14A 3GAKA 3LZ3A 2PU0A 4S3GA 4HNUA 2YR1A 3PBYA 3W7DA 3WSUA 3PBUA 4NAFB 3EX2A 2BZNA 3KXQA 1VJSA 1UWAA 4QEEA 3W1PA 3PAJA 2H9AB 1JCMP 2PDBA 4HNNA 2A7NA 2PI6A 4NAEA 4QBXA 4WSHA 4BHYA 3T0DA 1UR3M 3VTRA 1IF2A 2WK2A 2DW7A 5BRQA 3N9SA 3ATYA 3FV9A 2EJAA 2VUYA 6A3HA 1V3MA 3C3NA 4OWGA 3K5XA 2R1MA 3QXBA 3NAVA 1EF2A 2VEIA 3OHMB 4WKHA 4LNCA 3FKKA 1T6MA 4XX6A 3CIWA 2PTXA 1YADA 4QTGA 5ABFB 3P2VA 1FHLA 3WMCA 3SR7A 3P14A 1ENUA 1IEVA 3UWYA 2X8RA 5BZAA 1R86A 1EP2A 3FHAA 4GZEA 3GXDA 4JN8A 4ICNA 1QDSA 2W92A 5A8QA 2VDIA 1MUCA 1NEYA 4X3ZA 4GH3A 4XTDA 1XPGA 3EWUA 5EA9A 4MZ8A 3BV7A 2BB0A 5HATA 2AGKA 2X2GA 1GCYA 1PPIA 4UIOA 4S3CA 5I6SA 3W74A 1XM3A 1CECA 1TQXA 1D7KA 3UP8A 2VZOA 1NU5A 4I8DA 5JBEA 1OQFA 2TYSA 4OGZA 4E8DA 2Z6IA 1MI3A 3LERA 1B5TA 1HO4A 2A7RA 3CIVA 2QUVA 2DFAA 2Z2AA 1JNDA 1MRQA 2A5HA 1W9XA 4ZXLA 4F9JA 1GYLA 2QF7A 3W7NA 1Q6QA 5LIUX 1Z8AA 3R13A 1LT8A 1L8NA 2V82A 4HPJA 1GEQA 3BMVA 2FQIA 4PBEA 1CLKA 2NXHA 2YZ5A 3W23A 3LM7A 4WDTA 5SWUA 1V6TA 2HS8A 1XLCA 3HIJA 1TE6A 3UWQA 1YNQA 4G1KA 1Y8BA 3VAVA 5D2YA 3TYZA 4PL2A 3KW3A 3PG8A 1IIGA 4O11A 5HQMA 3SSJA 1REQA 1H7OA 4Q8WA 4KEVA 1OIMA 3W37A 3KCLA 3M07A 3HG5A 3FCPA 3A23A 2BY1A 1RH9A 3DZ1A 3TN5A 2NWRA 2WLYA 4RNJA 3N18A 4XUYA 1CWYA 1FP9A 1J93A 1GW9A 1M3UA 1B3YA 1RALA 4LBUA 1RD6A 5G2HA 3WD1A 3B04A 2F2KA 1O1HA 2W3ZA 3B9AA 5DY2A 2XWEA 2G41A 2O9OA 2X16A 3GYEA 1FDYA 2VOTA 1S39A 5M5DA 4EPEC 1BYDA 3P8JA 1GJWA 3L12A 3FKRA 4NIRA 7XIMA 3W1QA 3T8QA 2EKCA 3GBEA 1ZAHA 4AWSA 2HS6A 3QPZA 4AHPA 3W84A 2J47A 1H09A 2DU2A 1WZAA 4UTIA 3UW6A 1ZJIA 5A6MA 1Y7VA 4WDXA 3B8IA 3G18A 3G1DA 1HJSA 4L4OA 3SBFA 5FL0A 2V3FA 3AXIA 2FTYA 3M0KA 3DGBA 4QG9A 4UTFA 3BWWA 5FF7A 1WXZA 2FZDA 2EF9A 3RU8X 3SCOA 1US0A 4BF5A 1TZ9A 2ZICA 3T4CA 3RJXA 1XIJA 3GVWA 4N42A 3JZEA 3M41A 4KWWA 1R0MA 1XLLA 4E4PA 5C8BB 2CIPA 3TC3A 4GI6A 4IIFA 1IZKA 3WH9A 4KRTA 3C0JA 2XIQA 1SPQA 1BTMA 2BNJA 3CAVA 2PE4A 4UTTC 3GVQA 3GTNA 1OABA 2YCLA 2B4GA 2DUZA 2VEMA 9RUBA 3VOGA 3WQFA 1QWGA 3FEMA 3SUVA 4DWSA 1GJPA 4LYPA 2INFA 4P7LA 2V81A 4GVGA 5HNUA 3FYYA 4KKXA 4GFSA 3M9YA 3EMCA 1BRLA 3UXLA 1BWLA 4GQQA 4IPLA 2JE8A 2Z6JA 3QTGA 1YTEA 2G0WA 5FJIA 3NPWA 4DJFA 2IKIA 5L9FA 3TN4A 2VEFA 3APGA 1K02A 5T91A 3VX1A 2HV5A 2YA2A 1KBIA 1W17A 3LX9A 2AKMA 1XSKA 3E2SA 3HPFA 1WA3A 2XYLA 5CGTA 5DEZA 2VEPA 2Y6ZA 2GVYA 3C0QA 4KMQA 2QW5A 4XIAA 3TMQA 4D6CA 2VQUA 3MHGA 1A5SA 4K8EA 1KFLA 2GGJA 3I7SA 4C65A 2MNRA 4A2RA 4EVZA 4Z42C 5T9CE 3MB9A 3QFWA 2V5KA 1QASA 4M82A 5D9OA 3AIBA 2R1LA 1RJQA 2I9UA 2REQB 1BXCA 5CSUA 4LF2A 4UBPC 1ZPTA 5AZ0A 1I45A 1ONXA 6CGTA 4UTWC 4K37A 5M17A 1TWSA 5HMSA 2R94A 3ONCA 3PZOA 3RJYA 1EGZA 3R4IA 3ZT6A 1SO6A 3SAZA 4GI4A 2D1ZA 4I7WA 4KF1A 3MUXA 1R87A 2D3LA 1S5NA 1XGEA 3BE7A 4IUGA 3GS6A 1KFCA 3QV7A 3H2NA 1XJBA 4FNPA 4F79A 5GNXA 3T07A 1A5AA 4AD2A 4KCVA 2D69A 1R3RA 3EWXA 3HMCA 3WMBA 5C7HA 3GG0A 5HDRA 4DAFA 2TRSA 5CLWA 3URQA 4H6KA 5KZMA 3VMPA 2VVNA 5BWFA 3FHQA 2O9PA 1JZ2A 4WJEA 3KFTA 3BQ6A 1XIBA 1KW1A 3BMXA 1I4NA 3UWVA 4UFJA 4HYRA 1CPUA 4MJZA 1W5PA 4OECA 3MMUA 3FIGA 2BP1A 3LLFA 1J6PA 1E0UA 1I6NA 4KBXA 1HL2A 7ENLA 2X09A 1E4LA 3A24A 1H2JA 3VIGA 3W22A 2BOFX 1CGYA 2IKJA 3B97A 3PPGA 3BLKA 3OIHA 2Q8LA 2J9YA 4REQB 4MYXA 4A8RA 4D8AA 4V1YA 4IQEA 1GUVA 3SW6A 2CZFA 2WMFA 1K8ZA 3WELA 1AUSL 3PUOA 1QBAA 1UPPA 3R0KA 4MMWA 1BEUA 4WSJA 3B9NA 3OIXA 5C2GA 4FPSA 4HQVA 3PFRA 6TAAA 3UR8A 5AHNA 1OINA 3WLNA 2A3EA 3PTDA 2VR5A 3VNYA 5C5YA 1EOKA 3LSCA 5C6MA 3TYAA 4RDVA 3EDEA 2UY4A 3WCZA 2VKZG 4U5IA 2FHCA 4AX7A 3MUAA 4C6LA 4IWWA 5IOBA 1V7YA 1VB9A 4O52A 1ZLPA 4KIRA 2VVSA 2OLSA 4L65A 1QUMA 3C86A 2O7QA 3PM6A 3CL6A 3MI2A 3S47A 5I77A 2DY3A 1HKIA 2QQ6A 2ZX8A 3IV3A 4LBSA 1NP0A 3BANA 2X1TA 3U48A 1M7PA 4DJFD 3OLDA 4W5ZA 5BRPA 2JKPA 2OZTA 1XYLA 3WDPP 3OBAA 5TD4A 2DZBA 4UOZA 4F2UA 4ZB0A 1PTAA 3A9IA 4DPQA 1E4IA 2P5NA 1OC6A 4Y8EA 1M01A 4J3UA 3LXCA 3M47A 3TQVA 4B2DA 1KBBA 2EPLX 3RM9A 4JY8A 4FS9A 3QRHA 3NURA 2QGHA 4AWUA 1FWBC 1XC4A 3Q67A 4MWAE 2UZ9A 5KINA 3OQ8A 5I3KA 5E0FA 3L68A 2A4AA 1KRBC 2UY3A 4OE7A 1KBKA 3V4BA 3KVKA 1IHIA 1I1WA 3TYEA 1M53A 1UZDA 3VCRA 2GVJA 3RHGA 1HJUA 1EH9A 3MUIA 4F9DA 2YX0A 3C2FA 3EMQA 2XDFA 4J2PA 1EJTC 2CERA 2D20A 3MDUA 1IQ8A 1AD1A 2OT1A 1UUMA 4NY2A 3U3HA 1PX4A 3IJ8A 3QMRA 3GXFA 3W2KA 1IEWA 1LG2A 3O6AA 5BRBA 4ROQA 1R7AA 3SQSA 4YYCA 4QNWA 4CEXC 2VX4A 1FWDC 3BSHA 5A3HA 3LGDA 4G8TA 4B5NA 5LNRA 1W3IA 4LS2A 3VM5A 5HANA 3AICA 5EMMA 3M0IA 4OHQA 1JF5A 3VZYA 3TR9A 3RR1A 1R9ZA 1XIDA 3CT7A 1GOWA 1KCZA 2YL5A 4DO5A 4GINA 4LCRA 3H26A 4HPGA 2ZWZA 2B7NA 4IFKA 2XN1A 3G1FA 5ABTA 4WJXA 4NP7A 7TAAA 1E73M 4ICCX 1VEPA 2J74A 4CUCA 3NQAA 2OZ8A 3MYOA 1HN1A 1L0PA 3DH7A 3OO2A 1X96A 3EOLA 2ZUSA 5IXEA 1J8VA 4LAUA 4AD1A 3OJGA 4GY1A 2OEJA 3CMJA 4W4QA 1YMYA 4LFYA 4A3HA 2J88A 4XO6A 2FJUB 1F5ZA 7REQA 3GNRA 3C8NA 3G1AA 2D73A 2NVDA 4JTJA 4QAWA 4O28A 1WXJA 2XIOA 1QPKA 1SMDA 1B0IA 1SO5A 3S1UA 4I9TA 1NF0A 4W7UA 4IX2A 3AMDA 3MANA 4NJHA 1A5CA 2QCGA 2VGFA 2BOGX 3UR5A 1GNXA 4QQUA 4A8LA 3NO3A 5DMNA 4E8CA 3B8SA 1X8CA 1HP4A 4GZIA 5FF2A 1EWEA 4N4PA 2FMNA 3S9IA 1KRCC 3M0MA 1ZS2A 3PZGA 2JQXA 1S1PA 1F05A 1E1FA 1NWUA 4YPJA 1JDAA 1JPIA 4PA8A 1PKMA 4KETA 4JFVA 3HPSA 3MI6A 2I1OA 3CL8A 5CPMA 4DF1A 3WLRA 1K03A 4WKFA 3PWAA 4E6MA 4C6DA 3W24A 5EYWA 1NDVA 1JAKA 2QVHA 4IQDA 2PF0A 2Q71A 5LXXA 4NT0A 1WDWA 3TJIA 3BG5A 1TR1A 1O4UA 1XFCA 2P8BA 4B90A 1S46A 2WMHA 4QCEA 1XYAA 3QZAA 1J0HA 3CT2A 3POHA 1E1CA 3ARVA 1KKOA 3WX7A 6ALDA 3WENA 4INFA 1U33A 4YVXA 3W7IA 1VZWA 4ZQMA 3TQ0A 1DIKA 3DOPA 3E74A 4I8YA 3ZM8A 1O1ZA 2C14A 3VIOA 2VEKA 2O55A 3BAKA 3MKVA 3GDRA 3PAOA 2BBFA 3WEZA 4CVUA 5A6KA 4G7FA 4LY8A 2X41A 3E49A 1V77A 3EMZA 4XSMA 3KRBA 3TLQA 4B2DD 3VNKA 5U4NA 3RM8A 2V38A 5AY7A 4AD4A 3NWRA 3CB8A 1GTHA 4F0SA 4CQDA 2HK1A 1ITQA 4O4WA 3M6YA 2E77A 2AL1A 3GIYA 2ZX9A 5CPLA 2TSYA 4A8IA 3FJ6A 2EKGA 3GH5A 2C15A 3NJ3A 1UD5A 2DVXA 4YTSA 2GUUA 4IGSA 1JPKA 3W28A 5GPRA 1OWQA 3CTTA 3SQLA 3OA5A 1GQNA 2X7WA 3VNJA 1J11A 1WDQA 2Y70A 1ZUAX 2IPWA 2ISSA 1FWGC 3EX6A 4W88A 2Q8ZA 4O54A 2YYTA 3WNNA 3MUY1 1T96A 9XIAA 1S3TC 2Y5EA 1P6BA 3DX5A 2YYUA 1CXLA 3CQKA 4MB3A 3OYXA 4RXFA 1ADOA 4LPCA 4GCAA 3W7QA 4GGBA 1I75A 3NQBA 3OP2A 1YKWA 4KRUA 1R7OA 4FALA 7A3HA 1WAWA 2JKAA 3K30A 3S6OA 4HHHA 3VI2A 2OQHA 2TODA 1D2KA 4NZ5A 4AEOA 4L6HA 3I3BA 4V15A 1ELSA 1XR2A 5FSEC 4AAJA 4M6PA 3RAOA 5HR6A 2FDSA 3LPGA 2PC8A 4AX6A 4A3RA 3MZ2A 4X60A 3VDAA 3UCQA 3UF9A 2DZWA 1XRTA 5A8NA 4LUJA 3R12A 3WFZA 4A3QA 4GD0A 3T05A 1ISXA 5CPTA 5G1TA 1EC9A 1R2TA 1J0IA 3WLOA 2VP8A 3QF0A 4QJ1A 1JFHA 1P7TB 1DBTA 1RXOB 5I7GA 4Z17A 1PX8A 1XIIA 4LVBA 3MSRA 2RDUA 2ZXDA 1W9DM 5D2XA 1ISYA 4RDYA 1K7EA 4NILA 3GIPA 3RCNA 3N13A 4L4MA 4AY7A 5LHFA 2POZA 3R8GA 2VENA 3O15A 2QXWA 4NZ4A 1X1OA 1WX0A 2QJGA 1UR1A 3LCHA 4D6FA 3VNIA 2HBXA 2ZZ1A 4C5YA 1B2YA 3KHJA 5I07A 2VMFA 1N8WA 2YJQA 3AJ7A 4C60A 1X6LA 3EBVA 5CBJA 1Q6LA 1GOQA 1KXQA 1KFKA 1NOWA 3NQGA 2Q3OA 3P67A 3VNDA 4AD0A 2VZTA 3LY0A 2F8QA 2Z1WA 2XGZA 2PD5A 4JDYA 3T42A 3N4EA 2VGBA 1GWJA 2OWXA 4QDMA 4D6HA 1UWIA 2Q01A 2OSYA 7TIMA 3AUJA 1IR2A 3SJNA 1XIEA 3IACA 1RD5A 2CYGA 4S1FA 5AECA 3RDKA 2F61A 4FP1A 1GYNA 1FBAA 3ABXA 4JEJA 3G8RA 1DQWA 3WFLA 3AMGA 3PB2A 1IZCA 1TJ2A 1Y5XA 5KITA 4HPNA 1FFQA 2Z24A 1W3TA 4A35A 3PHAA 3XISA 3HQPA 2ADAA 1UMYA 1H49A 4DWDA 1PIIA 1QNPA 3DKJA 4HCHA 3KBWA 4IG2A 5H8UA 1WQ5A 1TPH1 1JCTA 5DRCA 1AVAA 5HJLA 1HKWA 4NSBA 4XVDA 4M7TA 5HUPA 2YXOA 1EO5A 1FWWA 4O0QA 4GI8A 4L4LA 5ECUA 1DHKA 2OWWA 1K9EA 3LPPA 3U7VA 5IDZA 3M64A 4B5WA 3W0KA 4V33A 3QC3A 1FVPA 2AL2B 3QM3A 1KFEA 2WJZA 2XVNA 1Z7AA 4HYVA 1KM3A 1V8EA 2WSRA 5I00A 2QV4A 1B90A 3CXOA 4FF5A 2PDFA 2GUYA 3N2MA 4F0LA 3QPYA 3OVPA 1O66A 3RX4A 1TV7A 4NI8A 3OYZA 1ISVA 1UP3A 1OBAA 4A8NA 4F3HA 3TWAA 1H5VA 3PBMA 2Y2WA 3LHWA 3QPEA 4GWEA 1TQJA 2Y7DA 1XDJA 3AZTA 1G01A 4IP7A 3V5CA 2OPJA 1OC5A 3DYOA 3KOWA 2Z1KA 3WQ5A 4Z1CA 4NNBA 2KAUC 3KCOA 1H61A 4JX6A 1AMKA 1RQHA 5DX7A 3ZJ7A 3VVGA 1H1ZA 1FWRA 1H0GA 1JCXA 2IQ0A 3EOEA 3AHXA 3M7WA 4HNOA 2WZMA 2E25A 4ALDA 3LRLA 3GTFA 4EPKA 2REQA 3M5YA 4LEQA 1UP2A 4QP0A 5BXTA 5CQ1A 2WQPA 1N8FA 1DJGA 3NQDA 2GQ3A 2EQDA 1DXFA 1CLVA 4X0NA 4RJEA 4J5NA 2DVUA 1XH1A 3QSRA 3GU9A 1BVZA 3O06A 3VNZA 3GXIA 3W7LA 4TIMA 2CITA 1IXQA 4LC6A 1UKSA 3TQPA 5AYBA 1MUMA 2GSEA 1QAPA 4JX4A 4XBKA 4J3ZA 3OQEA 1U1JA 5F2IA 3SM0A 4LSBA 2ZXQA 3NVDA 1H7XA 3GX9A 1WV2A 1CLXA 1XRSA 4RE3A 5FOOA 3HU7A 2DSUA 3LNPA 1QXLA 1R3SA 3UXAA 3DERA 1E40A 1N55A 3QMSA 4PR4A 4R53A 5I78A 4LU0A 2I9EA 3OBEA 2PURA 2ZDRA 3CEUA 1XDLA 2C1HA 4W8BA 3RLHA 3MVIA 4M5PA 2EO7A 4J3TA 3MMDA 5BW6A 5A94A 3SI9A 8RUCA 1WCGA 1HVQA 3CHFA 4DM1A 4L6OA 3DEQA 3P82A 1K6AA 1P0EA 3QFEA 3IJDA 4DBWA 3MYPA 5LIWX 5MHBA 1YBQB 3FJNA 1QPNA 2HNHA 4IOTA 2Y7EA 3WDQA 3N9RA 1QI5A 1S5MA 1IEQA 2CLPA 2CZVA 2CHNA 4NKCA 1E6ZA 1F2JA 3F4DA 4REQA 3L21A 1BVNP 1KM5A 3RG6A 1XLMA 4JQ4A 2OZ0A 1XXXA 2VZUA 1KXTA 2YCEA 4MVAA 3LTPA 2ALDA 5B80A 1WKEA 4URIA 1TMHA 2DP3A 2O56A 4B15A 1E9ZB 3GDMA 3QEZA 3W1UA 3IIVA 2WNZA 4H01A 3KLLA 3R10A 3ZZ1A 4BZYA 3PZMA 3T0TA 2GQAA 3B9DA 2VD9A 5AYIA 1EUAA 3V36A 5C70A 3LENA 1TPB1 3VPLA 2GYIA 2WZIA 3P80A 1ZSXA 4O8RA 5J5DA 4CQ9A 1IWAA 1XRVA 2PPGA 2GDUA 1DWHM 2GJPA 2VFDA 3LMYA 3NOEA 3PSVA 2ZRZA 1W9PA 1TTQA 2BHUA 4GIRA 2A79A 3H24A 3CYJA 1LP6A 3TNBA 3UR7A 1JYNA 3GAYA 1VJZA 4EWJA 2P0OA 4ZOBA 1XSJA 5I3GA 1O7AA 5AVHA 4U31A 4M6UA 2O9RA 2AQWA 1FXQA 5DO8A 3TA9A 1J0JA 4OBSA 5I0DA 1J18A 3AXHA 3MSGA 3HF3A 4DN1A 1UH4A 3T1GA 1RHCA 3PANA 3G24A 2I56A 4GJJA 4CCCA 1XCFA 3IANA 2XVLA 4K1GA 2X1UA 5BU6A 3UZZA 3P0XA 1E9LA 3VD5A 4R85A 1W9UA 4ZOCA 1IWBA 4PEEA 1VBUA 1XCXA 3SUSA 5C9WA 1E9IA 1P0KA 3O0KA 3WUGA 2J25A 3AIQA 3FGCB 2VYOA 4R9XA 3VZZA 4CQAA 3SQMA 1RSCA 3OBKA 2PCQA 1UD2A 2OOFA 1EUNA 1CXIA 1OZQA 3GR4A 4LV9A 4AW7A 5BXRA 4CN6A 1DJQA 2FPTA 1UOZA 1FWIC 3AISA 3G0XA 4KS0A 4GO9A 1W5QA 4IJBA 1ZAIA 4OUEA 3DAQA 2RHGA 2E6YA 1RPXA 1G6CA 2EPNA 5CJ5A 4EPDC 4JEQA 4DZAA 3G2GA 4JICA 2HCVA 4PMJA 1E72M 1K1DA 4DIAA 3IGXA 4ZO6A 2HK0A 2GSJA 3EWCA 4KWUA 4QDPA 1SVDA 2HWGA 3KZSA 3NOYA 4HSNA 1W8SA 5DXYA 3IJ9A 1KQYA 4XAGA 2VC6A 2IPFA 4JQAA 1C91A 4WLCA 5HMFA 1UW9A 2J7FA 2WSQA 3TMLA 3BLPX 1WOBA 4RV3A 3ZR5A 3W7EA 1F76A 4ZA0A 2PWEA 2UWFA 4D6GA 1HT6A 3SGUA 3BLDA 3CHDA 1L6GA 4CNSA 3T2PA 2YOCA 2WB5A 3CMFA 4A2SA 4HOWA 1RQBA 4RW5A 2PZNA 4J3VA 3U6WA 3T78A 3HFYA 1Q65A 2E40A 3KOYA 1OZMA 1PYMA 4AD5A 1LBMA 1OCNA 4ZEPA 4C6CA 1B4KA 3QKZA 1MMFA 1JZ3A 4AIOA 3W71A 3V35A 3KDOA 3K4AA 3N17A 5CBBA 4BQ5A 3G1YA 5I3FA 2NQJA 3KRSA 5FEPA 2ZUVA 3MSDA 3CZEA 2OR2A 3W1TA 5A6LA 1AZ2A 1PB0A 4WF7A 3A3HA 2PP3A 1XPYA 2C0AA 3LGEA 1I2PA 3NDZA 4J28A 5H8PA 2OO6A 5IBXC 3HPAA 4DJEC 4L5ZA 4Z1YA 5HJYA 1LTDA 5LA2A 3EX1A 1OYBA 2FGLA 4LRSA 3V5FA 2W27A 1W1PA 4O0KA 4YXGA 3AIVA 1JGMA 1GKPA 5CZTA 2CZEA 3T40A 2VC5A 1Q13A 1U22A 2Z26A 4H9ZA 1EXBA 4GI9A 4Y9PA 5I2UA 3CZKA 1W3NA 5K9DA 2ZRYA 2FTWA 1A3HA 2QCDA 4P7NA 3TK7A 4IGNA 3DC0A 4CU6A 2VR4A 4MG4A 4B92A 3W83A 3VO0A 4HNTA 5CAHA 2QCNA 4B5VA 5IFPA 4KERA 4Q4QA 4RKAA 2PDHA 1JZ5A 1NAL1 4QXIA 1TV4A 3UU0A 1TPFA 2BVTA 1BGGA 3G22A 4GCXA 3GHSA 5D9PA 1ITXA 3CV7A 1FFRA 4G2DA 4B5UA 4OBRA 1SZEA 4MADA 4QQ3A 3CAWA 3GDBA 5FF3A 4BA0A 1PL9A 2R82A 3LDVA 4JD4A 1H1YA 3MO7A 1B9BA 1B3WA 2XFWA 1CXFA 1TTJA 2XJ7A 2PD9A 4IMFA 1SM9A 4AQLA 3SY5A 4X22A 3GC2A 4WY0B 2OTDA 4U10A 5GQBA 2HVOA 5A1AA 1T8QA 4MPQA 3AXKA 3URAA 5CPNA 2VZSA 3ERPA 1CW2A 4M6QA 4JL1A 2OSXA 3A22A 2ZDSA 2Y24A 1C29A 2FVLA 3UG3A 4C1NA 4XSLA 2B0MA 2QJJA 4QROA 5D8ZA 5CC5A 3STCA 2YFNA 4LGXA 1A5MC 4DNMA 4FLSA 2IQDA 1TIMA 4NG3A 1V93A 3SDOA 3MSYA 5D30A 1P1MA 3APYA 3P3BA 3PJTA 4H9TA 1VP5A 3MUCA 4QG8A 3GVGA 3PZVA 1NVMA 4JNYA 3NSMA 2PDYA 4DUXA 1Q6OA 3OEXA 5FIPA 3LS9A 1TYGA 1EA9C 4P7OA 4KGLA 5C2XA 2GJRA 2E8YA 1B9ZA 5A2AA 3VD3A 1VKFA 3K4WA 1EZ2A 1F3TA 1JL8A 4UFHA 1VS1A 3DFTA 1DV7A 1OFQA 4DVOA 3W7OA 4LJ3A 1Q3NA 2QHAA 8XIAA 2P1FA 1CB7B 1UBPC 2BVYA 3UY8A 1EC7A 2WNNA 3U2EA 1EIXA 3QW4B 3QYSA 4K3ZA 3TFXA 1XLAA 3ZSSA 3HGOA 4ORMA 1QU4A 5DBTA 4ADSA 2V3EA 3ZLHA 3RU6A 4ZQRA 4GYKA 2A85A 4L9YA 4Y9NA 2Z7KA 3O6DA 2G96A 1E9YB 4DXKA 4NHVA 1MYRA 4N6EA 2XIMA 4KPLA 1VCVA 4JYDA 2VQTA 4ACZB 3ARYA 3L4UA 2O0TA 2R1PA 1XKJA 2PDGA 4RDWA 2XVGA 3N1AA 3A3WA 1ML1A 3QOMA 1TELA 5TQLA 3JU2A 3DHDA 4Q4OA 1UCWA 1ISWA 2QCLA 1HJVA 4JGDA 1XLGA 1AJ2A 1PEZA 4AF0A 4DRSA 4US5A 1EGMA 2AKZA 3AIUA 2QF8A 3BC9A 6REQB 1K9DA 1W3JA 2CEQA 2Z27A 3ITTA 1NSJA 3WNLA 3SGGA 2FGBA 5D9NA 3U7BA 3L4WA 4FX8A 3KL3A 3M0XA 3LTSA 2PODA 2ISVA 7ODCA 4ROPA 5CPOA 1G5AA 3AHTA 1EEPA 5IHRA 4JTFA 3KLKA 4W87A 1FCBA 5BROA 1XS2A 3AZRA 2W79A 1OFOA 4FO4A 1PCWA 1PHWA 4H7VA 5D05A 5AN7A 1JXJA 2PLJA 4LS1A 1EWDA 4FX6M 3HG3A 4TMCA 4XWUA 4YHGA 1Z69A 2NV2A 1P0BA 2GJNA 3KOXA 2CWNA 1UBSA 2HVMA 2UBPC 3WK2A 2BASA 2QUNA 4PFMA 1EXPA 4AZHA 1C90A 4QE4A 1JI2A 3GHTA 1S5TA 4Y9OA 2DQWA 2TAAA 3ZS4A 4B5SA 1CIUA 3VIHA 2NXGA 1LBFA 4ZBCA 3GWQA 3THQA 1KV8A 4PB4A 1QNVA 1MQPA 3ORWA 2WMGA 2QIWA 3JR2A 2WBGA 2IQTA 3RMEA 3CL7A 3OZPA 3TTOA 1BLIA 4HK6A 2E9LA 1XDMA 1R85A 4UFMA 3D46A 3CAQA 2P0IA 3NQVA 3UZ5A 2XU2A 2BHZA 3EXRA 3SCUA 3TWBA 3WLTA 3AYSA 2GLKA 4M7SA 2WMKA 3VE9A 2NVAA 1U5HA 1OG6A 1HGYA 4XD4A 2PUZA 1G0CA 4HK5A 3PJUA 3VGEA 4I90A 1AK5A 1MXDA 1IR1A 1HUVA 1QI3A 4C6EA 4RZ5A 3CH9A 1ZBVA 5CH9A 2OOGA 4W7WA 2A1YA 4BQ2A 2PDMA 2VWSA 3ZMRA 1FP8A 1PYFA 4IP5A 1LLWA 3GNNA 4HA0A 3WLPA 4QJ3B 1L2UA 1UMLA 3QY7A 1RLCL 4KEMA 2GQ9A 3BV4A 3RX3A 4DJDA 1P4CA 1CGXA 3KBMA 1Q7MA 3WH5A 1PIFA 3PZ9A 4XZLX 3V18A 1ZZMA 3L5MA 3DHPA 4IMGA 1FY6A 1YX1A 1F3XA 3TXZA 1JAEA 4WQ6A 4KCTA 1DJHA 4UFIA 4I9MA 4NAEB 1BAGA 5HNNA 3UPMA 1HNYA 3AYVA 3EWWA 3SECA 1YBQA 1G4SA 1Q6FA 4DPPA 5BU9A 2XH4A 2F6UA 3CV6A 3NPUA 3TC7A 3OTRA 1DWJM 1ICQA 2OFJA 4V28A 4QIUA 3LCIA 1YTDA 1VFUA 4DBUA 1VRDA 2OX1A 2YBUA 4HCLA 4WGHA 4LNYA 3H7RA 5IBXA 1GOIA 3TX9A 2WHLA 3UZWA 2GOUA 4DJEA 3DFHA 3LG3A 2VM8A 5DCDA 3ZJKA 3IV8A 2WJEA 4MNKA 4US5D 4ERIA 4RNFA 3GUGA 2YDRA 1NWSA 2E1DA 3MO4A 2J79A 4QCFA 4ERAA 3RM4A 1RCOB 4PN2A 1SR0A 4CU7A 4UOJA 1PIGA 1VBRA 2QDGA 5EFFA 4HMEA 1RK6A 3FA3A 3KVLA 2QAPA 3D0CA 3WZ0E 4YWIA 3UWUA 3QTPA 1NELA 2EXOA 3R8RA 1M03A 2E5DA 5EY5A 2PS2A 1EHNA 1X7FA 3CZLA 5FAJA 1XG4A 4JTRA 5HWJA 5I3JA 3S1GA 3W27A 1ECQA 3FA5A 4LF1A 4R27A 1EBHA 4PTXA 3S8HA 1GK8A 3R7MA 1KNWA 1P43A 1H7RA 2NT1A 5BMXA 4JKLA 1DTUA 4TO8A 1GG0A 5D4YA 2CU0A 4M19A 4HZ6A 4H8NA 4TX6A 1VBGA 3KTXA 3FDKA 4L1WA 1XYBA 4YVVA 1F4AA 2HISA 1REQB 3HTWA 3UVIA 3CEPA 1GEHA 2C6QA 4BWLC 1UKQA 3ITYA 3VDCA 4PMOA 1FWTA 2DJLA 4KCUA 2A6NA 4A3YA 4D1IA 3E3HA 3AIWA 4IIBA 2FH8A 3CB3A 1IIHA 3KL0A 1QW7A 4ZGYA 4DZHA 4IFOA 2ZQ0A 2JIEA 3KDNA 4Y8FA 4JYEA 3WEMA 4AZ6A 2C16A 1GZJA 1WO2A 5A95A 1P6CA 4H3DA 5GJPA 5HNRA 3CZ8A 2G3MA 2V3DA 3UPWA 1SZRA 3AYTA 2ZZ2A 3KBNA 1TMLA 3NDYA 3QLDA 4HOXA 1S2UA 3GR7A 2XSXA 3W6LA 1ZP3A 5LNWA 4ILSA 3F5KA 3U2CA 1TPWA 1XHGA 4NZFA 2Y0FA 3LSBA 1G69A 5I3HA 3EPOA 4QLLA 1UD4A 1OM0A 1EX5A 3OG2A 4NASA 1Q4WA 4DJDD 4QHRA 2E0PA 3LQGA 3GO2A 3PPHA 3E12A 3FW6A 1OF6A 2VZVA 3W07A 1H63A 1E4MM 3NYDA 4O1BA 4NJKA 5CG0A 1NFGA 1LCOA 1W56A 3SGZA 1OK4A 2DH2A 5JIWA 4IQJA 5LIXX 3M7SA 1YE4A 3VILA 2V5JA 3TYDA 2VL4A 1QOQA 3DN5A 4QE5A 2WZTA 4MY1A 4D8ZA 1AJ0A 1QPOA 3VKJA 3QV6A 4GC3A 1TREA 1AH3A 3QW3A 3O16A 3KS6A 3LPOA 2YCLB 2OYLA 3QY6A 1X6UA 4Y7EA 5LNUA 4PCSA 3DG6A 2DSWA 5HULA 4JBRA 1CENA 1PWLA 4Q8MA 4XG1A 4ZFMA 1QATA 3WBEA 2VXNA 3WKZA 3AZSA 1KGUA 3Q4DA 5BOEA 2O4QA 1BRLB 4Y96A 4WXZA 4O1CA 5ENLA 2WWDA 1OFPA 1XKYA 3STPA 3WMSA 3W82A 3W38A 2PGEA 4ML9A 4IPJA 2DIJA 1KTBA 4FI4A 1GHSA 3U2ZA 4HJWA 3RCMA 4LAMA 1Z41A 1HTIA 2RH9A 1OY0A 1LUCA 4IMDA 2B7QA 4WXYA 3VNLA 3JRKA 4H9MA 3MV11 2V8ZA 1OC7A 4W7VA 3ARWA 3UWEA 2G50A 1C92A 3M5XA 2G3IA 4IXXA 3TTQA 5EKYA 3BGGA 3KTSA 4L61A 3VXGA 4A6GA 1X6NA 2IS7A 4GH1A 2C1IA 2X0SA 3W72A 4MNLA 1ZRQA 3MBDA 1ZL1A 5HBFA 4ZFCA 4AG0A 3FFSA 4S3EA 4JTKA 1K9TA 3W7GA 1PX3A 1J9YA 1QW9A 3H4XA 4S3FA 4PUJA 5TAOA 3W2UA 2Z0IA 4XIMA 2Y7FA 1Z44A 4J3WA 4PTVA 4LWWA 5LGXA 3TAKA 4UQDA 2CZ5A 3IIZA 1M7JA 2CKSA 2FFIA 5AC4A 1GGOA 1JVNA 4QX4A 1VFHA 5M3WA 1RAKA 4KGJA 3IAQA 4GQRA 1UWRA 4XBSA 2E6AA 1I0DA 2W61A 3ECQA 1UD6A 2OGJA 4MKSA 4JN6A 2WVSA 2BXYA 4B4FA 3ITCA 3CC1A 2G3FA 1KBJA 2DORA 1D3CA 2WAGA 3TYBA 4X2RA 3IVUA 1XYMA 3Q45A 3VD7A 2C3ZA 5TNVA 4PL1A 3EWYA 4YTTA 4FXFA 2HJPA 1ZJAA 4H9YA 3EDDA 4U2ZA 2YA0A 3ICJA 3USBA 5BXSA 2H3DA 4WY0A 1PXGA 4Z2IA 4UXDA 4X2PA 4JQ2A 4GZJA 3OHIA 4LYQA 3W1RA 3LU2A 4Z2JA 1VF8A 2CLMA 1W32A 5CGQA 5E70A 1MNZA 2P50A 1X8FA 3N15A 2YZRA 3WBAA 4KT2A 1ZBKA 3R0DA 4RPPA 4MOZA 1J79A 1PO9A 1UQYA 4HOZA 3HQ1A 4ML4A 1EB3A 5C54A 3N2CA 5FJJA 1VR6A 1Q6EA 1DQXA 3NZGA 4ZMGA 1LOQA 1XD0A 4FXSA 3U4FA 2ZUNA 1ZENA 2W62A 1EDQA 1QNSA 5GJNA 1FWFC 3WQ6A 3BZGA 1IE7C 2ZUTA 3SO7A 1K4HA 3WH8A 1E3ZA 3H2OA 4JIQA 1M68A 3VZXA 2DT3A 4JTUA 3U5YA 1H3GA 3DBPA 5H1WA 4LX4A 3TZNA 2XM1A 4LEFA 4GQGA 4JTTA 1RJPA 3TC6A 3AWNA 2Q02A 1YPXA 4GNKB 5DQPA 3OW1A 3N11A 4O1FA 4PSPA 4EPBC 3FN9A 1D3HA 5F1UA 4HIBA 1VD6A 3H7UA 1F6YA 3FVMA 1XI3A 1F07A 1MEHA 5CSYA 2A21A 1VHCA 4D9PA 1JI1A 3IK2A 4XD5A 4P8UA 3T0AA 2NQZA 3OG3A 4HU8A 3WFAA 2ZWYA 3R25A 4HA3A 2OX4A 1G4TA 3JVAA 4HU0A 3WUFA 1KXHA 1DEDA 1X7IA 1XISA 2JGYA 3UNDA 3GC5A 4KH2A 3N29A 1UC5A 3BLIA 4Z2HA 3IVSA 5D9MA 1JUEA 4MUPA 4Q7NA 5LNVA 3G0UA 4JTDA 3F4NA 1TWZA 4W8AA 1UPMB 2OELA 3UVAA 4HB7A 4LUTB 5EPDA 1HL9A 3E0LA 5DT7A 4UTUA 1SZGA 4AFYA 3CHVA 1KBLA 1T41A 3APTA 1PKLA 3UQNA 2GGHA 2FZ9A 1W9BM 1WB0A 4H2CA 1NTHA 3TA6A 1NWRA 3H2MA 1BF2A 3N73A 2X05A 5FD0A 2ZX5A 1GPWA 4PCPA 1A4MA 3BAJA 4L80A 3F2CA 2Y88A 4GQBA 1VFTA 1M7OA 1TA3A 1TUXA 4WOZA 3UCDA 4AC7C 2YL9A 3BLEA 4C6BA 3JUGA 1WUFA 1TRIA 1JCJA 1H41A 1HKVA 1MW3A 4NYUA 1TR9A 4ZSUA 3IGHX 1XLKA 3P8IA 2YW4A 4UTHA 3TDFA 3LCXA 4HMNA 3A5FA 4FAMA 2BHYA 3W9ZA 4DYJA 4BWLA 1EJ7L 2J13A 3F5LA 4BQ4A 3B06A 1QTWA 3R11A 4GK8A 4H4IA 2Y61A 4F40A 1J0KA 1EO7A 2ZYFA 4OT7A 4QDWA 3GTXA 1CT5A 1JFXA 3H4WA 2AAMA 3U57A 1V6UA 1LQ2A 4IFKB 1IWPA 1RV8A 4P5UA 4Y90A 4QR6A 1LJYA 4ZE4A 4LOCA 1XLDA 4AUBA 1UD8A 3SUUA 4XZHA 5MKGA 4PEKA 1OVDA 3GXTA 4Q7BA 2XH7A 4XVEA 4H1ZA 4PUEA 3B8DA 2VDGA 2NT0A 1O12A 3A3XA 5CJNA 4LUSA 7REQB 1HL8A 1VFMA 1NIUA 4HZMA 5AYXA 4MSSA 4YJ5A 2J7HA 4RZ6A 1PKNA 1NH6A 3LI1A 4JQ3A 4CQCA 2PP0A 2V2CA 3IS4A 2PLCA 1RY0A 5FEWA 4DXVA 2ZRXA 2NQ5A 2VCCA 3BQ5A 4W86A 2NVCA 1GVRA 5LXEA 3GBDA 2TMDA 4XO7A 1K7FA 4FOUA 4V2XA 3FNDA 3FDGA 1OB0A 4MLJA 5HWMA 4XD3A 1TWIA 2CBJA 3PUGA 5CJMA 1TJPA 3NQMA 2IUZA 1OK6A 1MZHA 3A5VA 4R34A 3S6DA 5IDIA 1Y5VA 3DCPA 3QJAA 1W2VA 4B3ZA 2JALA 2HBVA 1DE5A 4E8GA 3W85A 3PUEA 1CXEA 5H8MA 1XBVA 1KR1A 1JQXA 2ZFAA 4HKPA 3BAYA 3VUPA 5A8OA 2E9MA 1R9XA 4WEVX 4ZXOA 2EEXA 4MY8A 1VJIA 3NVTA 3MBFA 2QJIA 3UFYA 1TX0A 1I2OA 1E1CB 1XSIA 4GQ0A 4JKMA 3CZJA 4AMCA 4HK7A 5M1TA 1VLWA 3BICA 2F7FA 2DT0A 1RCQA 5AVNA 1XIHA 4W85A 2NXIA 4GFIA 2J78A 1F73A 3W73A 3HOJA 4IJCA 1FWHC 2J75A 2ZE0A 4GVIA 1TV3A 5PTDA 2A3AA 1DWFM 3KTCA 3ZJ6A 3QQ0A 3E0WA 2XG9A 3ZLGA 2VWTA 4Z2GA 3L5AA 1ZBCA 2X7VA 2EGZA 2FB2A 3SJ3A 2ISFA 4NVTA 1OFDA 1RPKA 3C8FA 2ASHA 2J7BA 1E71M 4EXQA 3NUKA 3PR2A 3PSWA 4PCTA 2CBIA 4H9VA 2P88A 1TJ1A 3NPVA 3CUGA 2BMBA 3PJXA 1EJSC 4Q4KA 3ANYA 2OG9A 3KBSA 3PNUA 4TXEA 3UYCA 2WOQA 3LRMA 3TSMA 4DBEA 1Q2SA 1UJPA 3LV5A 3WLLA 4PMXA 3LHUA 5I09A 3MDWA 3POCA 2OGYA 2HQAA 2Y1HA 3ALFA 3WBYA 1VYRA 4F4RA 1BQCA 3LV6A 1I9CB 1F6KA 3W29A 3S1WA 2XH2A 3T55A 1V5XA 4FR1A 2WANA 5MF5A 2G95A 3GIQA 3A13A 4CQBA 4K6AA 2ZBTA 5DFAA 3PBWA 1VCGA 5HJXA 4JX5A 2XSBA 4FNQA 1JYWA 3H7VA 2ZZ3A 3N4AA 2YDAA 4JTLA 1MNSA 3AAMA 4OQVA 1E6SM 1SMAA 3ZR6A 3B0UX 4GO8A 3W7PA 4GE8A 3QHOA 2H8XA 3N2XA 1DORA 4E2DA 5F4XA 2CXGA 1VFLA 4AZGA 1N82A 2FFCA 3M5ZA 3M44A 2HE5A 4QJ4B 4NU7A 3BUVA 1HKJA 5FF4A 1K8YA 1GVYA 4TVCA 3I68A 3KHDA 1NP2A 3SCWA 1TTPA 3BK0A 4XAPA 3WBXA 2FZNA 3BLFA 1XP3A 1UZ4A 3ABOA 3O3RA 4RK8A 1JD9A 3TN6A 3PP7A 4AXKA 1O5KA 4JTHA 2OO0A 2R91A 4N0RA 3ARUA 3TEVA 3EEZA 4MJ4A 5EBUA 4AWTA 3TU9A 3QV9A 1GHRA 3STFA 1UASA 2V2HA 4M1RA 4WK9A 2V5BA 2I5QA 2A3CA 1ODZA 1FH9A 4GISA 4AHQA 3MU7A 3ARQA 5EL1A 1L8PA 3K2GA 4MB4A 4E5TA 4FB7A 3VIJA 4XUGA 2ZC1A 1TPUA 2WZHA 3V7PA 3LLDA 2Z1VA 5LIKX 3CV1A 3L5LA 1W5NA 4PUWA 3STEA 3QR1A 1VGAA 4N9BA 3DFQA 2A3LA 6TIMA 2UY5A 5LA1A 2C18A 4GUFA 2BXZA 4KFNA 3BCFA 2QDHA 1SJAA 1UA7A 5JVLA 1ZALA 3GDLA 1M41A 3P62A 3NPXA 2OKTA 1WP6A 3ZSTA 3WLJA 2B7PA 2GL5A 3HPXA 4PTNA 3ANVA 3ZO9A 2Z7GA 8CGTA 4HJFA 1V3HA 5DXXA 4BK9A 1X98A 3UZYA 2QZRA 1QOXA 1JZ7A 4GUHA 1PBGA 4BI6A 2A0NA 5E9AA 4AVFA 4IG2B 1J4EA 2POTA 2ZUMA 4MJ2A 5T9BG 1A5UA 2CLHA 3LOTA 3FSTA 3ABQA 1I2QA 4XZBA 3KAOA 5CLTA 4NX5A 3NZPA 2VO5A 2D0GA 4ATWA 2ACUA 1XICA 3GC4A 3WD3A 2VC9A 1BSLA 4GX8A 1K4GA 4Z1DA 2EBNA 2OODA 1DQUA 4B16A 3I6EA 4A22A 5FJUA 5JQ9A 2ACQA 3A12A 5D38A 4CCDA 4CNTA 1W54A 2RJGA 5HINA 3RR4A 3IWPA 2CLEA 4GXPA 3DI1A 1YPIA 1OCBA 1V3JA 3LRKA 1C8YA 5F2GA 4HSHA 5EMLA 4JIRA 3EOOA 3NG3A 3NNTA 1YEYA 1HW6A 2EAWA 3ARTA 4HBKA 4O17A 4FA3A 2HE8A 1OEPA 2EPOA 3SCRA 5CG7A 3UJ2A 1PWMA 3KP0A 4JTSA 4LB4A 2Q8XA 4AIUA 2EHHA 2G97A 3W4RA 2VT0A 3T0BA 5HPOA 3S3GA 1TJ0A 1JDDA 3BURA 1IXPA 4OVXA 1TG7A 2Y62A 1V03A 1W1A1 3AU2A 5FEZA 4NRRA 4XV0A 3F2BA 5DANA 1YDOA 3O0FA 4XB3A 1KWKA 3IARA 4H6RA 3LN3A 2G37A 2HMCA 3G1RA 3AU6A 1I60A 3IJ7A 2VCAA 2X30A 4UTMA 5CC3A 2D0HA 3SCNA 1WXYA 1PZ3A 3QV8A 3TSBA 3O8AA 3E0VA 4I9JA 1R30A 1JRCA 2O4MA 4S3KA 1T7LA 5G2WA 1UG6A 2Z2UA 3VOFA 2Z4GA 3T9PA 5JH1A 1SGJA 3CPUA 1UKPA 4UB9A 3I7QA 2X0YA 4S23A 1MFUA 3THDA 2J8FA 1A5BA 2OLAA 3PS7A 4F48A 4FK9A 4RE2A 1D8WA 3BG9A 1WDDA 4Q8OA 3SIMA 4JTGA 3TUUA 1W91A 2WSKA 4H9UA 2I5GA 4IUOA 1PDZA 3K1GA 2QPUA 4GMEA 3D6NA 1QO2A 2NX3A 5D04C 3RLGA 2D24A 3UXIA 3GG8A 2WVVA 3W7JA 2C71A 1MEIA 4PULA 5L6UA 5CPSA 2ZRWA 5A6AA 2Z1BA 4MIMA 4IMEA 2JF7A 5LA0A 2P10A 1LRNA 2UY2A 3EWBX 3LB0A 3MT1A 2E4TA 1M04A 3FYPA 4WOQA 2ATMA 5FJRA 1ONEA 4HHLA 1DJXA 4YTQA 1GZGA 2QJNA 3ZWSA 3C2RA 1ZQ5A 5JBDA 2NLIA 1FTXA 2XIIA 4TQTA 1TCDA 1WE5A 4KFOA 1LWJA 3VIIA 1L6WA 1OT1A 1OD0A 1LL4A 1GVQA 3E02A 3AROA 5DCEA 5LKYA 1FX6A 4QFUA 3PY2A 3MW7A 2ISWA 2E9BA 1EA0A 4NZ3A 2OQLA 3RO6A 5IHSA 4U3CA 3M16A 1JPHA 3DG3A 1AFSA 1LLZA 4MAZA 3L0NA 3XINA 2GGEA 1JZ8A 5D32A 1XGZA 2F2HA 3VU2A 2PWDA 4FNSA 2FMOA 1V3KA 4UTJA 3W2NA 3F03K 7CGTA 2FYMA 4UQEA 3N3MA 2A7PA 3B8WA 1J0YA 4XZNX 3WUEA 4TX8A 1J5TA 4XQ6A 4D1JA 4ZOEA 2XVPA 1JCLA 4JHOA 2CNCA 3UJSA 4LAOA 4PMQA 4IF2A 2DDXA 3PZTA 3UPBA 2ATSA 4AZ7A 3ABZA 3WQCA 2HRWA 5C55A 3PFMA 2GUBA 3MMTA 3KWXA 3A4JA 1XIGA 4Q8UA 3M46A 3RLUA 4OOUA 3TROA 2GK1A 2J6XA 3BOFA 4ADUA 6ENLA 4B5TA 1R2SA 1Q63A 3MVTA 4G56A 4LUTA 4J3XA 4UTLA 3W2LA 1V4YA 4Z2LA 3QKEA 1L9WA 3F1QA 2CWXA 4EXAA 1F61A 2VFHA 1XINA 3CQJA 5K3VA 4ATLA 3KRZA 1UWSA 4ZL1A 3CLMA 5D2WA 3DFYA 3QH2A 3GKAA 4ACYA 4V27A 1KCLA 4LW7A 1UIOA 3SURA 3H2FA 4C6QA 2DPEA 3W3OA 2CHOA 1A80A 1M6JA 1QR7A 4LV4A 3ZR4A 3TSDA 4FX7A 4BKNA 2NQ9A 2PTZA 5LHEA 1SW0A 1GVIA 3S2CA 1FH7A 4M0XA 5E5CA 3HMJG 3SCQA 4X63A 1E6XM 2GPTA 4C6KA 4D72A 2GWNA 1V3IA 2VCBA 1QI2A 4GC4A 1GQJA 3WIJA 1VAHA 4KRZA 3NYZA 1TPC1 4GNVA 2CCRA 5I03A 3IUHA 5I23A 1CZ1A 5EMUA 3W6YA 1AQMA 4XZIA 2V63A 3EOSA 3RNDA 1TZZA 5GNZA 5C71A 3FAWA 4M29A 4GPNA 3F7JA 1BYBA 2VUNA 1FDZA 3AALA 1E70M 4D6EA 1DJNA 1IZJA 1Z48A 3M6DA 1WKDA 1EYWA 4LUIA 3O6CA 4O14A 1Q2RA 4Q8PA 4XAFA 3W88A 3WNOA 2WHKA 4X9SA 2R8WA 4TR9A 2ZA2A 3N19B 5FJTA 4P8VA 1XUZA 3EDKA 3W76A 2ZCGA 3QY8A 4O19A 1FH8A 1KKRA 5CSSA 4Z08A 1OYAA 2WPGA 5DMYA 3ARSA 5E93A 4X0VA 4B91A 4L9XA 3ZIZA 4C6NA 1Q6RA 1BYAA 3TW7A 4UZSA 4GA8A 3EEGA 1TV2A 1NJJA 1E0VA 2VFGA 4ZQCA 1CNVA 1IGSA 3R0UA 4L9ZA 1HKKA 1R5YA 1P6WA 2PTDA 4KESA 1LM1A 5G4EA 4LCQA 2G4JA 3WMLA 4DBSA 4ZENA 4DNHA 4BI5A 2G3NA 1FWSA 1HJWA 4L1GA 3M4HA 1A3XA 3NL5A 5CXPA 2Z29A 2B7OA 2CC0A 4YHEA 3ZT5A 4F2BA 4FXRA 5D33A 1YQ2A 1CX9A 1J6OA 3C3UA 5KEZA 3BSGA 1EPXA 3KOZA 3B0PA 5C0QA 5E6ZA 1O5QA 4DELA 3CJPA 5EBAA 1A5NC 2IKHA 4UUIA 2DIKA 1ZHAA 4YVPA 3BLLA 2XHYA 1HG3A 3WQVA 1BHGA 1SZNA 3DECA 3OA3A 1KO0A 3UT0A 4EK7A 2QCDB 1K70A 3MY9A 1G7VA 4JYFA 1CDGA 1U83A 1JXKA 4JPGA 3HJZA 3MP4A 2D3NA 4XD6A 4JOMA 5HAOA 1RJRA 3I6TA 4PUDA 5DT5A 3CS2A 3VDHA 4GBUA 1N2VA 3H22A 2WYSA 1SUXA 3VNMA 5B7ZA 3B4YA 1R47A 4HTBA 3VIFA 3GD6A 4BQ3A 1YNYA 4QITA 1WYIA 3Q94A 4PCFA 1UR4A 3NIYA 4K1WA 3CYVA 4A21A 1Z6KA 1FHDA 4ORIA 2VX7A 1IGWA 1O5XA 3EDFA 4Q3MA 3EKZA 4KEZA 3UG5A 4F8XA 4YNGA 3NQCA 5AC6A 2NQLA 1WBHA 4HPHA 3D47A 3VE7A 4MWAD 4G1NA 4MJMA 1GOKA 4EIVA 4I3GA 5AB3A 3B0VC 4E3TA 2IPJA 1W1B1 3CMGA 2Y63A 5C9ZA 3B9OA 1RZMA 4HMDA 2DZVA 4N2YA 4C6MA 1AODA 2RDWA 4TMBA 3UCCA 4ZOAA 3QC0A 1X97A 2VHLA 4C1NB 5I24A 2J8GA 3GYCA 4C7DA 1LQ0A 4MUZA 3E6EA 4D6IA 4JIPA 3GR8A 1GVEA 3RN6A 4JXCA 4ZO8A 2OEMA 1JYXA 1F8IA 2QUMA 1FA2A 4DZIA 2IXVA 2I5IA 4WRHA 2H3BA 3P6LA 2PU1A 1AQHA 3GH7A 3BLOA 4IM4A 2ONEA 3LYEA 5IM51 1QO5A 5KTLA 1A47A 3BGAA 2H6RA 3RYSA 2WCGA 3N3TA 1HO1A 3N9KA 4UWMA 2HEJA 4RLIA 1ESWA 2V67A 1EJXC 5I5RA 1OX4B 1R3QA 4WIWA 3WDRA 1YXDA 4IPNB 3SADA 2WNQA 1UUOA 2WW5A 1IEXA 2HNEA 3QYQA 1VPYA 3MV01 4W5UA 4DUOA 4PYSA 2W91A 1FHVA 4AY1A 3TR2A 3VOIA 3AS3A 1A50A 2XGBA 3WJZA 5DF0A 1QK2A 1DJWA 1LWIA 3UERA 2FLIA 3K8KA 2WC3A 1DJIA 4MM1A 2EPMX 1LROA 1A53A 4Q8QA 1GOMA 4FEZA 3UJFA 1PUDA 1LL6A 1E0WA 3EWDA 1QNOA 1ZY9A 1Z32X 1PZ1A 3I7RA 3EKGA 2QDDA 4IHCA 1EYEA 4KWOA 1OFEA 4HZ7A 3IIPA 3L2MA 4NI3A 3L2LA 3S1VA 3WF0A 3ZT7A 4UR7A 1AW2A 4NUWA 2R1KA 4ASTA 1OX6A 3FS2A 2PRHA 2AOSA 3A9BA 1TPVA 1GPFA 2YL6A 1T0OA 3OLEA 5E0CA 1JD7A 2YKKA 5F7UA 4AF0B 3S42A 2YB1A 4MF4A 1AH0A 1B4EA 2VRQA 2VD8A 3SIZA 1A3WA 1F7BA 2WVTA 3O05A 3W25A 4S3BA 4DI8A 4LAZA 2QT3A 1B1YA 3LCWA 4Z2KA 3N12A 3B05A 5CZSA 3VOCA 2OQYA 4AIBA 2V0TA 1W0MA 1PTDA 4BF9A 5K4ZA 1OYCA 3SCSA 1ZCCA 4Y6GA 2C13A 1J2BA 1TV5A 4FZIA 2ZE3A 2VURA 4HVXA 4D6DA 4MLRA 3VGHA 4FNRA 3PBGA 1CEOA 1ZTVA 1W6TA 1WBJA 4YTUA 2YBVA 3UXDA 2J24A 4GYPC 3N2OA 2BY3A 1KM0A 4O0ZA 3MHFA 3VA8A 3MCOA 4OFCA 3N2TA 4Q7IA 3HG4A 2WM0A 3S83A 2PA6A 4DXXA 3GDTA 2PDXA 2PDNA 4MNMA 1AD4A 3EOUA 2E3ZA 3ITOA 4AXNA 4UTKA 4EF9A 2D2JA 1V79A 4J2MA 1A0DA 1B31A 3WK3A 1QNRA 1V6VA 2PTWA 3DENA 4UNLA 5F1VA 4D8LA 1NQ6A 2NV1A 1YPFA 4ADTA 2MANA 3FAXA 2J7CA 1NDZA 4K68A 3VIPA 2V5DA 2YLLA 1KGXA 3B9EA 2X1RA 2FGZA 2VFEA 3A6OA 3SB0A 3VCCA 3W1AA 3P5YA 1JJKA 1FCVA 3CNYA 3PF3A 3R79A 1FKXA 4H6QA 3WLSA 5H91A 3S5YA 4LTSA 1KLZA 4R3UA 5BCAA 2IKGA 4NF7A 4Z1BA 1EF3A 4JIHA 2ZIDA 4B3LA 3P5ZA 4RNIA 4L7ZA 4K8GA 1WOAA 3CWHA 1Y65A 4IIEA 3DYMA 4FMVA 4IQLA 1MW2A 4K39A 4WY0F 4EWND 3ONBA 2J8TA 2ISDA 4HN4A 2HPIA 2NUWA 4BFAA 3CUHA 5KZEA 5G4HC 1AZ1A 2Z1SA 3RITA 2FTPA 1MW0A 4JIIX 2PBOA 2D0FA 2IW0A 5HK4A 3OGRA 3LHTA 3P84A 2DUXA 1C9DA 3HQNA 3WQ4A 3IGUA 4GGHA 3F4VA 3S1XA 3NDOA 4PMYA 2WXDM 3PTKA 3ANUA 3NM1A 3WH7A 4CNPA 3PULA 1AL8A 3LHYA 3SN4A 4XBJA 1JR1A 4IT1A 4Q32A 4HGXA 2YL8A 2YCKX 4I7UA 1EP3A 3CLWA 2FHBA 1L6YA 3VKBA 2YDSA 2RJHA 2PWUA 1E15A 2W6RA 3EZ4A 2YGYA 4GVHA 1HVXA 1K3UA 1F3EA 1MDRA 1PHQA 1UJQA 1UP0A 1PTGA 1V6XA 3AHZA 2CLLA 4MZ1A 3ELFA 1IV8A 1MWOA 1XIMA 5XIAA 1XUUA 3B0YA 3DC8A 2F38A 3M0HA 2X2YA 3BOLA 4GX9A 3EPNA 4FF7A 3WEOA 4HCDA 1S1RA 2Z1XA 4Q4SA 3AS1A 2GFTA 5TIMA 3FJLA 3VIMA 3I65A 1BKSA 3W6MA 1E6QM 2ZVRA 3K13A 1UROA 4NZ1A 5FA5A 5D03A 2DW6A 2ZA1A 2PDQA 3ZXWA 1XLEA 3VM7A 4GACA 3WK0A 4JFUA 1EJRC 3BAXA 4YLWA 1UH2A 3REQB 4EKJA 2EG7A 2E68A 2X40A 3SCTA 3PPCA 2PSNA 3LD5A 3MWAA 3GG7A 4Z0SA 2QV5A 5DLCA 1W1TA 3WYZA 3GFYA 4OJYA 1ZGDA 2XN0A 1XLHA 3NL2A 2A6LA 1S5WA 4LB3A 1G9HA 1QBBA 5AHFA 4JHZA 4DY1A 5M03A 4NQ1A 3OU8A 2A3HA 1EJWC 3C6CA 5FCZA 3MUZ1 2WVUA 4B9YA 4HNVA 1KR0A 1RCXB 5D2VA 5BMWA 1EHAA 5DBUA 1Y0EA 2Z2BA 3O1NA 3G8EA 2GJLA 1HJXA 5HR7A 3BMWA 3NCOA 4ZODA 3T8LA 2RUSA 4UR8A 4TTGA 3FLUA 3W53A 2PGRA 4IPIA 3NEHA 2F6KA 4RX0A 1QHPA 1UB3A 1YXYA 2INZA 1YRRA 4JCMA 1SSGA 4TV6A 1W3LA 4GIEA 3TNOA 2ON3A 3BH4A 1EP1A 4M56A 3W87A 2CHRA 4ES4A 1R6WA 3VGBA 1TPEA 3LBMA 1I2RA 4WZHA 3GH4A 1DPMA 1PV8A 2QKFA 4NRSA 3OODA 3W7RA 1P5BA 1FCUA 3HPZA 3WL1A 3R89A 5CCZA 1KLYA 4KQNA 2C8NA 1J12A 1SFSA 2ICSA 1QI0A 4CVWA 3I3DA 5AHEA 3O63A 2R14A 2NUYA 4YU1A 3W7KA 2VOMA 4PUNA 4MDOA 3R43A 1TZ7A 3THUA 2NZLA 2DEPA 3PWGA 1S38A 3EX4A 3PN8A 1DIOA 1YYAA 4JQ1A 4AY8A 2DZPA 2QJMA 4JTIA 2V68A 1OFBA 3U2OA 4Q33A 3NXLA 5JXQA 4WD0A 3QVQA 1WAUA 2ANUA 2CBUA 1YTKA 5C2CA 3DKLA 4J40A 1H5YA 2CKRA 4OIFA 2RGMA 5H6HA 1GKRA 2WKLA 1OGGA 2CZDA 2FZBA 1EKOA 1BYCA 3TV8A 4MTVA 1E43A 2BGSA 1C7SA 4DJDC 4WDUA 2H90A 3GFXA 4ZE5A 5JUVA 4TOQA 3B8TA 4YWSA 3OZOA 4E2VA 2AMXA 3NSNA 1KRMA 1RR2A 3WJYA 2FH6A 4RE0A 4QNEA 3GU2A 1BD0A 1QHOA 1SFTA 3UETA 3ZLFA 4NJJA 4HSOA 4RR4A 4JHMA 4DZ5A 4K8HA 4L6DA 1RVGA 4JFWA 3RF9A 2FIQA 4UC5A 3FSUA 3NQ6A 1LUCB 1WPCA 1ME8A 1M65A 1HQTA 2P8CA 2BSLA 2BVDA 4U4MA 4CNNA 3GHUA 3IUIA 1OGSA 3MMWA 1GQIA 1QFEA 2QYGA 4AEEA 3XIMA 4J27A 1BKHA 3HURA 2ZADA 3O2LA 1X1ZA 1PE1A 4FLQA 3NQ8A 2YB4A 1WZLA 2WMJA 4M24A 3GXNA 4FOKA 5LGZA 4HN8A 5ECVA 2F9RA 3LA4A 4AWEA 2Z28A 3FA4A 4GYPA 4YIWA 4JR5A 5EMKA 2ZUUA 4P2VA 2J7DA 2V2DA 3ZQ9A 3EX3A 1UD3A 1HIZA 1THFD 4NZJA 4M8UA 5EMYA 1A5LC 1AH4A 4C7FA 3WH6A 3VFCA 3VDBA 1JCNA 4BCEA 1TCMA 2OU4A 1H62A 2ZZ7A 1VBJA 4C7GA 3CQHA 1JQVA 2NW0A 2WBKA 1CXHA 4ZSTA 4CD8A 1RBAA 1MVYA 2VRJA 3QN3A 3WUBA 2C1GA 3MP3A 4DWSD 3E9AA 3EA1A 3T2OA 1V6WA 4I5RA 4WR3A 3B03A 1BG4A 2NWSA 3R58A 3VC6A 4TVDA 3K4DA 5A8MA 2WPBA 5T26A 3VINA 2WCSA 4WUIA 4AC1X 3GSMA 2D22A 3SCPA 3ARRA 1VEOA 3TN3A 3Q58A 2WKGA 4NXKA 3L4XA 4MFDA 4JAWA 2OB3A 3G6LA 3CM4A 2PDPA 1FDJA 4H8VA 4DUWA 2CW6A 3EXTA 3H2EA 3VOHA 4DO4A 1MXGA 4K36A 3GY1A 3AXXA 3EB2A 3BG3A 1QWKA 3KL5A 2NLYA 4QLJA 3FXYA 3T08A 3WF3A 1DL3A 3CHCA 5GJMA 4HTYA 3FXGA 1XLBA 5DMLA 4M80A 3ITVA 3VGGA 4I6KA 5ABEA 4PH6A 1GOXA 3CHEA 1TE1A 3ZVIA 2WSYA 3MCMA 2G8ZA 1U5VA 5H2ZA 5C9UA 3H8AA 1UH3A 1GTEA 2CBVA 1BPLB 4NNAA 4UQBA 5F4SA 2Q6ZA 2GVLA 1QT1A 3UNTA 1M9HA 2GJXB 5LSMA 3S46A 3QGAC 1XW8A 3P60A 1AA1B 2EJ1A 1VLIA 2P3EA 1OX4A 3H21A 4MYAA 3L4TA 2OEKA 1UIPA 2OYKA 3LPFA 4X61A 1XYCA 2YXGA 4DAIA 4GJ1A 1KFJA 4KWVA 2BG5A 3C2EA 1LLOA 4Q6XA 4HYWA 2O7SA 3WBWA 2ZUWA 1HJQA 1YE6A 2OXNA 1IT7A 3TTEA 2ZTJA 2OVLA 3A64A 1UKOA 1CTNA 3N34A 1OFAA 2E28A 2WLZA 1KM6A 2QJHA 5A8GA 3VD4A 3ES7A 3G77A 5AYYA 1NF7A 1Q5MA 4S3AA 1JRBA 5FEXA 3CZGA 5FAGA 3ZJ8A 4N9CA 3KWSA 5REQB 1Z3NA 4EANA 4RUBA 1XD1A 4CD7A 2ZRUA 3GNPA 2QGYA 1YIXA 2YDQA 1JUBA 4H8HA 1DIDA 3RO8A 5EGRA 2E5BA 4W84A 3VUSA 4LYKA 1TV8A 3LGGA 3GUWA 4JKKA 4NJIA 3RMJA 1W1IE 4XKYA 2ZRVA 2HROA 1MDLA 3I6RA 4CN4A 4QG6A 1E3XA 5EU9A 4LAKA 3BAIA 2I17A 1UC4A 5KZ6A 1C7TA 1VEMA 2PWHA 1W2PA 4PRRA 9CGTA 5D37A 3SN0A 1PDYA 3NTYA 3RILA 1O6IA 2PDWA 2AAAA 3G1SA 2P76A 2HSAA 3DFNA 1TA3B 1JF6A 5I06A 3JZUA 2Y8UA 3GTHA 1KQZA 2XGIA 1NARA 2GOKA 2XVKA 1SJDA 1Z89A 4TVUA 4C6IA 1JEZA 2P3ZA 3OVQA 4UTTA 4UMBA 1BFNA 4XTIA 1AQFA 5HUOA 4OU1A 3YPIA 1Z9AA 1LORA 1K9FA 3T81A 3E0FA 2TPSA 3DDMA 5CKSA 2G4FA 2XZ7A 3CQIA 1FKWA 2J27A 4FNTA 4S2BA 3QQWA 4DM2A 4DB7A 4A05A 3RPDA 3NO1A 2OCZA 3L4ZA 1YHTA 4NAFA 3WD0A 3AS0A 1EZWA 1TWDA 2WQDA 2H9AA 4DEFA 4R33A 3CTLA 2HTMA 4V1XA 1DXIA 2R9RA 1A5KC 3TE9A 1VFSA 3OZYA 4I5UA 4S3DA 1NFPA 1QPRA 2HPMA 1HXJA 5MKGB 5G1MA 3T4WA 4O50A 2XWDA 4NZCA 4B3KA 2WHJA 4TX9A 5K9XA 1SU5A 1GOOA 4GRSA 2J77A 3HQOA 1XIFA 4LUSB 3FJ4A 3GXPA 4IZGA 5ABFA 4FSAA 4E0CA 2FVKA 4Q22A 4JFSA 1V02A 4RCXA 1VENA 2W0UA 1C8QA 4POCA 1J2WA 3WL0A 3WLQA 5A6JA 2WNWA 1CBGA 4ATDA 2BFGA 2X1IA 5E6YA 4XK2A 4AU0A 3W81A 1W1VA 3EA2A 1XCWA 1VHNA 5FL1A 4R7JA 1UZHA 1KTCA 3EWZA 3IPWA 1DYSA 1Q6GA 3TYCA 4QS6A 3GNXA 3IIOA 2WJFA 4JY9A 4PMNA 1C8XA 4LT9A 1KFWA 5FKYA 2GDVA 1EL3A 4UTWA 2CLFA 1A0CA 1S3HA 1FCQA 2PZ0A 3QOKA 5DY3A 2XFFA 2HDJA 1KA9F 1ZAJA 1DP0A 4IMAA 2ZX6A 3QZ6A 5U7SA 3M0ZA 3GNDA 4OBTA 2KX9A 2DGAA 4MHBA 1D7FA 1J5SA 5DRIA 4NNCA 3ABSA 1VIWA 1Q7ZA 3BJTA 4O13A 3E0IA 2CLKA 3RRXA 3Q2DA 4GKLA 1IYXA 1W9VA 1F74A 1EQCA 3L0GA 3WDIA 5FF0A 2A3BA 3BGJA 3UG8A 3KVJA 4J3SA 4PODA 3CU2A 5HMDA 4N6FA 3KOFA 3N25A 2J9ZA 3KP1A 1U30A 1Q4NX 1SYTA 4AVNA 4G6CA 3H2CA 4PMVA 3TCEA 1H7PA 1Q85A 1OD8A 3ENLA 1BWKA 1UWUA 4G5DA 3USZA 4J7RA 4AYSA 1KCXA 4D2JA 4PC8A 1LL7A 3SCVA 3CO4A 1B3VA 4Y9MA 3AI0A 2X42A 4Q8VA 4LBRA 1B54A 1AMYA 4F0MA 5AHIA 2YFOA 3BSMA 3WLIA 4PBFA 3DBNA 3PG9A 4JZ5A 2GGGA 1OHLA 3IGSA 4DLFA 1RLDA 3RIKA 2EPHA 4O4VA 1I8JA 3MTWA 3DI0A 1W1ZA 2BLEA 3NZRA 3ALGA 3RX2A 3OOQA 4UFLA 3TQKA 4H6EA 5J5RA 4FXJA 3REQA 1O68A 2D23A 2IXUA 2CETA 1E5NA 5I02A 4M6VA 3UZJA 7PTDA 2OZ3A 3PZQA 1OFRA 3W2MA 4IICA 2W67A 1JPMA 1V08A 4GUGA 3W2JA 3W00A 4AD3A 3CUFA 3UD6A 2H8ZA 3PJWA 3UA3A 1SFJA 1ODUA 3T0CA 4FHAA 1V6YA 2BDQA 2B31A 1EDTA 4B5XA 3IEBA 4N4QA 4W93A 2VR2A 3QBUA 2JEPA 2GZXA 2W5FA 5C9XA 4BR1A 2BOEX 1JUKA 3R1ZA 4UOQA 1LT7A 1Q8AA 1DXEA 1Q6DA 2RDTA 3MQTA 3H55A 3G3MA 3II1A 4XZ9A 2GQ8A 1LG1A 4PCNA 2LLEA 3QLLA 2VX5A 4R7WA 3AMLA 3DU0A 1TIWA 3V1PA 2QPXA 1C93A