4Q7IA

Crystal structure of engineered thermostable d-tagatose 3-epimerase pcdte-var8
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRYEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 118
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4q7iA00
4XIAA 4ZB0A 4XISA 2I56A 4HNOA 3CQIA 5B80A 3ITYA 3IUDA 4J4KA 3VYLA 1I6NA 3KTCA 3U3HA 4QE5A 4PFHA 1CLKA 2Q02A 4XIMA 1O1HA 1D8WA 1GW9A 1XLLA 3QC0A 1XIFA 5B7YA 1XIIA 4DUOA 4A8RA 3M0MA 3VNJA 5AVNA 1XLMA 1A0EA 4A8LA 4GLEA 1XLKA 3KBSA 5AVHA 1DIEA 1A0DA 3P14A 2ZDSA 1XLDA 3KBWA 4YTSA 4E3VA 3AYVA 3BWWA 1XLAA 2QULA 3LMZA 3KCLA 3NGFA 5XINA 3KCJA 1QT1A 4YTTA 8XIMA 5C9ZA 1XICA 1XLJA 3KBMA 4HGXA 3FVMA 3IUIA 4HHMA 6XIAA 1XIGA 4K1GA 4X60A 1MUWA 5H6HA 2HCVA 5J8LA 3L23A 1XYBA 2OU4A 1BXCA 1XISA 2QUNA 2HK0A 3ITLA 4HHLA 1OADA 1S5MA 1XLFA 4KW2A 3XINA 4Q7IA 4W4QA 2XISA 3M0LA 1XYAA 4QDPA 4QE4A 5EMKA 3UU0A 3VNKA 8XIAA 2GVEA 4GQBA 1XIMA 3UXIA 3U0HA 2J6VA 1XIJA 6XIMA 3DBNA 3QZAA 3CNYA 1XINA 2G4JA 2QUMA 9XIAA 4G56A 3C0SA 3CQKA 5I7GA 4US6A 1K77A 1XLHA 1QUMA 3C0LA 4QEEA 7XIMA 3UA4A 4X63A 1DE5A 1XYLA 4GJJA 5FA5A 5XIMA 2NQJA 3BZGA 5EMMA 2NQHA 3ITTA 4ZB2A 1XIHA 1YX1A 4XKMA 2GUBA 3M0HA 2NQ9A 3KBNA 4A8IA 1XLEA 4EACA 1XLCA 3BZJA 4OVXA 3WQOA 1XYCA 3XIMA 2GYIA 2XIMA 3P6LA 5EMLA 1XLGA 4XSMA 4GJIA 3ITXA 3XISA 1DE6A 4PGLA 3TVAA 1I60A 1XIDA 4QEHA 4DVOA 2X7VA 3AALA 1DXIA 3AYTA 1XP3A 2GLKA 4YTUA 9XIMA 3N4AA 4QDWA 1MNZA 3C0QA 3AAMA 3ITOA 2ZVRA 2X7WA 3GNXA 3CQJA 3BANA 3BDKA 4X61A 3KCOA 4A8NA 4YTRA 4ZBCA 5B7ZA 3VNMA 3KWSA 2QW5A 3QYSA 3VNIA 1A0CA 2XINA 5TNVA 1DIDA 1XIEA 1BXBA 1XIBA 3CQHA 3TC3A 1S5NA 3CWHA 3JU2A 3M0YA 4YTQA 4ZB5A 3IUHA 3UVAA 3M0VA 5H1WA 4K3ZA 3KBJA 4QE1A 4XSLA 3QXBA 1XLIA 1XYMA 3KBVA 3M0XA 3UA3A 1TZ9A 1QTWA 2HK1A 3DX5A 3VNLA 3OBEA 2G0WA 4LNCA 4EAYA 5XIAA 1XLBA 3ITVA 2I57A 5EMJA
chains in the Genus database with same CATH superfamily
4M6VA 2X30A 1Y5XA 4LVFA 1ELSA 1FX6A 4GO8A 4HSHA 3C2EA 2WLYA 1H1ZA 3CLMA 3MUAA 3UD6A 3AS0A 1G67A 3QQ0A 3P0WA 2VEGA 3O6AA 2QYGA 3GM8A 2ZDSA 3G1AA 5ENLA 1ZP3A 1WDSA 1H2JA 1SR9A 1UH3A 3KLKA 2ZUMA 1PUDA 4HNCA 1KO0A 5I3HA 4DWDA 3CL8A 3V0TA 1UD6A 2ZX5A 1G9HA 5TD4A 2QAFA 2VI0A 4H6RA 3W24A 4HN4A 4J28A 1XPYA 2DIEA 3V1PA 4U28A 4DO7A 1PAMA 3RNDA 2IQ0A 4HZ7A 3WD2A 4DAIA 2QJNA 4HB7A 4PUJA 2YDRA 4HYWA 3TA6A 2PDBA 3SUWA 1E6SM 4IMDA 3W7QA 1V6WA 4AF0B 3LM7A 1P1XA 1T8XA 3XISA 5MHBA 1R30A 1FCQA 3NR0A 3CM4A 4Q8QA 1XP3A 4I7UA 3SRHA 4CQ8A 2WV8A 3CPUA 2Z6JA 3W7KA 3TSDA 5CBBA 3B0VC 2VEIA 4LXFA 1O4UA 2ZRVA 4S3AA 3THQA 3GZ3A 3KL3A 1XIBA 1FWEC 1RSCA 1VQTA 4S3BA 4HYVA 1C90A 4ACYA 1JF5A 4A05A 3MO4A 4J9JA 4I3GA 3SECA 4QHRA 4C5YA 3OLIA 1TJRA 3HG4A 3LEPA 1PTGA 2WO5A 3RAOA 1O95A 5B7YA 3ZMRA 3WK0A 4Q8WA 1XLMA 3RCNA 3I3DA 1S5TA 2ON3A 1L2QA 1BF2A 3BUVA 1UD8A 2RDTA 2WSRA 1GQJA 1UQZA 4JFWA 1BXCA 1XISA 1W1VA 2OSXA 4H9XA 1SO4A 4PC8A 4ZSUA 1XYAA 3I6RA 1OCQA 1EYEA 4JTKA 4A3HA 4R5EA 2O9TA 4MLRA 4F0SA 3ANVA 3MV01 1BAGA 3KP0A 2HBVA 4R7JA 2R82A 5GNXA 2FZMA 2GVGA 1KCKA 5JBFA 4XAGA 4GZ7A 1OGSA 4NI8A 4CEXC 3F4VA 2J7DA 3PZVA 2YCIX 3Q37A 4Z2KA 3PUGA 1LUCB 1T0OA 4Z42C 4P8WA 1TCMA 3BGAA 3S3GA 2XM2A 2HS8A 3B05A 3GXIA 3W70A 2FDSA 2OCZA 3M0JA 4HA1A 1CLVA 4Z1CA 4XZWA 3OZOA 1BXBA 2X09A 2VVNA 2EPHA 4K3ZA 3D47A 2OWXA 1AJZA 3IGXA 4KGLA 3IAQA 2EGZA 3M6YA 1GORA 3WNNA 1JPMA 1CGTA 1FHVA 4HPNA 3HMJG 4ILSA 4ZMGA 1X98A 3PNZA 4I5XA 4C6FA 4IIHA 4WY0A 1QOPA 3RJYA 1Q2RA 6XIAA 4H9ZA 2WSPA 4JN8A 2ZE3A 3NXFA 3UY8A 2ZRYA 4YPJA 1T99A 1QHOA 2FVKA 4DYJA 1O5RA 5D9NA 3LM3A 1H41A 3S6DA 1HVQA 4R33A 4PZVA 3VD9A 3R8HA 4C6DA 3S6TA 5DMYA 3HQ1A 1PPIA 1SW7A 1VB9A 4XZIA 3W2LA 3GU9A 5CZ0A 3MO7A 2DSKA 4MJZA 2PDXA 4N9DA 3HPZA 3TXZA 3BOXA 2Z1SA 3RYSA 1JUEA 4WCJA 1W17A 2PZNA 3M0KA 3MI2A 2X16A 3CMGA 5DX7A 4L9ZA 1RA0A 1S1RA 2V81A 1AH4A 3UWYA 2C15A 3AIVA 1JD7A 4NAEB 3WQ6A 4L6OA 1XBZA 2B7QA 3MJYA 1VJIA 1EEXA 4M1BA 1H7PA 3VXGA 3GIQA 3QSTA 4TX6A 4NRRA 2ISVA 4DM2A 1Z9AA 2OODA 2XFFA 2Z2BA 3QY7A 3IUDA 5DLCA 2OYKA 1F07A 2Z1KA 3D46A 7TAAA 4IXXA 3M46A 5CPNA 2DFAA 1H4PA 1R46A 2A7RA 1OFBA 1TRIA 2PU1A 1R38A 4A4AA 4HHHA 4S39A 5AN7A 2VX4A 3URAA 1ME8A 3LDVA 4GIEA 2I7GA 1OADA 1JCXA 5JU6A 3BJSA 4N9BA 4GXPA 3ARSA 1CNVA 3OHIA 4O0KA 2Z7GA 1U5VA 3VM5A 2IPJA 1NOWA 2VGFA 3SW6A 4A29A 4WJ8A 1YADA 4EVZA 1YX1A 2J78A 3AFBA 1FBAA 5EBUA 3VGHA 1EFZA 2J6XA 3MP3A 4A3UA 4AZ5A 3FV9A 1JG9A 1FUYA 4CD7A 3TYCA 3W2MA 1J96A 2X0YA 1QAPA 3IJ7A 4KCVA 3BLKA 1IIHA 4ZZ9A 1OCNA 1E70M 2XDFA 2NUYA 1OG6A 3L68A 4YYCA 4DBWA 3R8RA 1EOKA 2H90A 4KH2A 1QASA 2MUCA 1EDQA 3DX5A 3RLUA 1YXCA 1PKMA 3ITVA 4AC1X 1E73M 5F1UA 2Y0FA 4ZB0A 3BLOA 1IGWA 4IQDA 1ADOA 1HN1A 1DJNA 1MEIA 2QZRA 4PN2A 2CBJA 1ISZA 4H6QA 3PWIA 1J5TA 1PVNA 2D0GA 1E6XM 2WZIA 3T81A 4U31A 1V6UA 1X1NA 1AD1A 1GOIA 3MMDA 2R8WA 3VCCA 4W87A 3BAIA 4B90A 5BXPA 1JUKA 2HPIA 3RLVA 4AEOA 2I9UA 3LLXA 1OX4A 3GH5A 3QQ1A 3WFLA 4JEQA 4ERAA 2OXNA 1QW8A 3EDEA 2QR6A 2VHLA 1QI4A 2OX4A 2EKGA 1CLXA 2HV5A 4Y96A 2CBIA 2XN2A 1AA1B 2HNEA 3PANA 4H6EA 3QGAC 3NUKA 4DBEA 1NWRA 1OFRA 4IGHA 3KS5A 4B3ZA 5DBUA 2CFFA 5MF5A 4Q33A 4S3GA 2CZEA 2ZADA 4QDMA 3WZ0E 5HJYA 4DF0A 2INZA 3VVGA 3ICJA 3P61A 1B4EA 5CGTA 3S2NA 2XSBA 1GVYA 3PUEA 4GVFA 3GXTA 5A6LA 2QPSA 4UTTA 2HXUA 1KCXA 3FS2A 4IL0A 1RALA 4IQEA 4H83A 1EBHA 3L4TA 2O7SA 2RGLA 3DEQA 4B4FA 2OKTA 4F2TA 1R7AA 1TFVA 2WC3A 4MUZA 3TUUA 3PK7A 1BKHA 3NPWA 4PFMA 1NP2A 1V02E 4S3CA 3A23A 4L5ZA 3WY1A 4JTAA 3AI0A 3FW6A 3VU2A 3EB2A 3B0PA 1YNYA 1FTXA 2PURA 4FNSA 3MA8A 1UMLA 1SFTA 1N8IA 1PIIA 3FY1A 4KEUA 1A5KC 3BG9A 2FZBA 3KAOA 1BD0A 3H7RA 4IMCA 2G97A 3VOJA 4C6KA 1GT8A 4X2PA 3I3BA 2PGFA 2VGBA 1POJA 3A21A 1K3UA 1FY6A 3VKBA 4M6PA 4O0QA 2WVTA 2A79A 4FI4A 1CW2A 1LZOA 2FLIA 4UQBA 5AYXA 1XH0A 4B3LA 4GE8A 3KBNA 4TU1A 1MVYA 2ZXBA 1FH7A 1OJXA 4LVAA 2C1GA 3TROA 5EMLA 1KA9F 2V68A 1BHGA 1J2BA 2GQAA 1NDZA 3E0IA 3LGDA 4B2DA 4NXSA 3QN3A 4HMCA 2GWNA 3TNBA 4P7LA 2DQXA 1RXOB 3PBYA 2DDXA 4DEFA 3N6JA 4GH3A 1X1OA 3MUIA 3TWBA 1KFCA 1KWKA 4LW7A 3I7RA 2R24A 3PF3A 1KKOA 1H7WA 4MIMA 4O14A 3AS1A 5B80A 5DMMA 4B5VA 3N04A 1YE4A 1BYCA 4PFHA 3L66A 3V75A 4DJEA 4F0HA 5K7JA 2ZXAA 3PJTA 4JTDA 1N7KA 2ADAA 3E2RA 1VJZA 2AKZA 4EE9A 5C70A 1XUUA 4ZEPA 3U2ZA 2BGNE 3VM7A 1QNQA 1VP5A 3KCJA 5FAGA 2FQIA 2QIIA 1F6YA 2UZ9A 3CHCA 4OWGA 3TSMA 3DU0A 1WQ5A 3GU1A 2REQA 3CWNA 1OX5A 1BXNA 4QQUA 1UD3A 4B4HA 1W3JA 2E6DA 1K8ZA 4A6GA 5C0QA 4CN6A 1KNWA 3GRIA 4PB3A 3T4CA 1QHZA 3W29A 1ZRQA 1A5BA 2GUUA 2VMFA 3AWNA 1QPKA 3TYEA 1F4HA 3WLLA 1FA2A 5CBIA 5FF0A 1FKXA 3IJ8A 2WVVA 4AHPA 1R47A 4KIRA 3BMXA 3HG2A 1M3UA 4LRTA 1OEPA 4H8UA 2RKXA 4LVDA 5I3FA 1B30A 3CC1A 5F2LA 3CL7A 4IMAA 2O4MA 3S4TA 4LANA 3AHYA 1GOQA 1ODUA 5F2IA 3QHOA 1AODA 1EQCA 5DANA 4EWJA 1O6IA 3STGA 4FLSA 5I07A 3PULA 3VC6A 3V7PA 4S3JA 2F61A 1UR3M 1IQ8A 2WKLA 3F5LA 1V79A 3KTCA 1VBHA 3Q58A 3LTPA 5GPRA 4LAUA 1EHNA 1A0EA 3TTYA 4QR6A 2OLAA 4G1KA 3OYXA 1RCQA 3AQUA 3WG6A 3HO8A 3AUJA 4RW3A 3KOYA 2DZXA 2E3ZA 3KWXA 3IV3A 3IUIA 1CGUA 1IWAA 1QCWA 7PTDA 1G0CA 5GNYA 2PS2A 2JEPA 4H00A 3LD5A 3TQ0A 2BY0A 4HPXA 3K8MA 3R25A 1BRLB 2YL5A 2HE8A 3SURA 2BFGA 4H01A 4GGBA 1W1PA 1X1ZA 3EPNA 2WB5A 4H9VA 1J6PA 4ORMA 4GJIA 2VOMA 2PRHA 2QGHA 2DT3A 2PDJA 2GL5A 3WX7A 1BYBA 1RCOB 5AYBA 3VE7A 2TAAA 4Q4SA 3IJDA 3ARPA 3RMJA 1ICPA 2E40A 3KL0A 3URBA 3TR9A 4L6HA 1DQWA 3VDGA 1XYFA 4QJ4B 4DJDC 4CQBA 3RRAA 1FWRA 1BVZA 4V33A 2C1HA 2WWCA 3W2KA 3NVTA 4RXGA 5LXXA 4LV4A 4Q8VA 1A3WA 1L6SA 1WUEA 4BWLA 1UWTA 2VQUA 2NQLA 1XICA 2WVUA 1DWJM 4WDXA 4Q8TA 2VX7A 5AHFA 1VZWA 4FXJA 4FR6A 1F2JA 5DQPA 1W5PA 3MS8A 4PMVA 4PUDA 2FGBA 2WNNA 5BYWA 1EC7A 1U33A 3AIBA 1A5OC 2PDMA 2AKMA 4LUJA 2GVJA 4HA3A 3U7VA 1HL9A 1PXGA 1XLHA 3L0GA 3ZYZA 1SZFA 4GJJA 4FF7A 4IJCA 3W74A 4QAIA 2D20A 5LYRA 4WD0A 3HBLA 4CNPA 3UETA 1TA3A 1K9EA 3CUZA 3BL3A 2BY1A 1PHQA 1CXKA 3ME3A 3SCVA 1SM9A 3E5PA 2TMDA 3U6WA 5I2UA 3ARVA 3M5VA 3AYTA 4BEUA 1UP0A 4PMYA 1Z69A 4DWSD 2J79A 1BVWA 2X1IA 3RLHA 5HOSA 2J9ZA 4AD5A 4C65A 2J4GA 2YGYA 3S2CA 3BOLA 3F03K 3ABRA 1YPXA 1YIXA 2FTYA 3B0YA 5HWJA 3F2DA 2YBUA 3DFHA 4IPLA 1X6UA 1V08A 1JZ2A 1QK0A 3NZRA 3WNMA 2IPWA 1W6TA 1E40A 1ZJBA 3VOIA 4GLEA 1KFWA 4R9OA 2VFHA 3PZQA 4J7RA 4EXAA 3P5YA 3F2CA 3KCLA 3NGFA 1J01A 3NTYA 3QOKA 4DWSB 4UFMA 1JULA 4MFEA 3VA8A 2E6AA 3I4KA 1B3XA 4IOTA 1EGMA 1BSIA 3PY2A 2CLKA 2Q8ZA 1HJVA 5A94A 3T55A 5TBOA 1G01A 3W1QA 1XYZA 2BY3A 1D8CA 3GXNA 2VD9A 3DYPA 5IHRA 3L4ZA 1NDVA 2PUZA 1C9WA 3UG3A 2H3DA 3WBEA 1DXEA 5AFDA 1HGWA 5A2AA 1DORA 2YXGA 5EMUA 5I23A 3TEVA 4OIFA 4ADSA 3ECQA 1SSDA 3WLPA 3S1GA 2ZA1A 3GE7A 4LAKA 2X41A 3GU2A 1JI1A 1YEYA 4C7FA 2VWTA 1E4IA 2CZDA 2W79A 3WNOA 1ZY9A 4M5PA 3R94A 3A4WA 3IIXA 3K2GA 3R58A 1R86A 4GA8A 2RHGA 1FDYA 4B9YA 4CU7A 3P7YA 4TVCA 4WY0B 2C19A 2IW0A 2A7NA 3SFKA 1OGGA 5AVNA 1JDAA 4E3VA 1NM9A 3FSUA 3TNOA 3CWOX 4M19A 5BZAA 3UWEA 2NV2A 4QLKA 3VIIA 4W86A 5FAJA 1EF2A 1US3A 4OUEA 4GYPC 4OBSA 1YYAA 1MXGA 3DG3A 3U7BA 1VLIA 4YXGA 3RGTA 4NRSA 3K8KA 4DPQA 1YNPA 1OY0A 3F5JA 4RV8A 1OD0A 4S3FA 2AMGA 3VDHA 4LUYA 2G5WA 4AZBA 4HOXA 1LWJA 4H8VA 3MTWA 3NNTA 1W5QA 3B0UX 3W1XA 4X2RA 4CCDA 1M03A 5LSMA 3POCA 4GO9A 3QR0A 2JFEX 2GSJA 4H7CA 2G95A 4LT9A 2ISDA 1W3KA 3GNXA 2GJLA 1RP8A 1YKWA 3EPMA 4ZOAA 3AIUA 4KESA 3WKZA 4NQ1A 1DHKA 1XH2A 4R7WA 2WJEA 4B5UA 2QHAA 3K1DA 5DY3A 3EXRA 1E3ZA 5LIXX 4C6BA 3KE0A 2JKAA 5G2WA 4C6LA 3BURA 5I6SA 4MPKA 1JZ7A 3CHEA 3RXZA 3T7VA 3HG3A 3DBPA 3AUOA 1DWIM 1FWBC 2V5DA 3NDOA 1TZ7A 3USBA 3F5KA 2GGJA 4YMZA 4WKAA 3ELFA 1JD9A 3BGJA 3UG5A 2JIEA 4Q8MA 2HPMA 2X0HA 3AXIA 4HGXA 2V5BA 2ISSA 5A8NA 5F2GA 4O50A 4GWEA 1E55A 1JCNA 1E0TA 4YLWA 2PE4A 3VINA 2XISA 3UXIA 3GLCA 1EJVC 4LH8A 2NVAA 2P3ZA 2X1RA 4GXMA 4OOUA 4XBKA 3LBCA 4FX6M 3CL6A 4LALA 3BMVA 2O92A 2OKOA 1VFUA 2A21A 4PRRA 2WM0A 3W87A 3SM0A 4BHYA 4DXVA 3LENA 5F1VA 4H8HA 5BRBA 4KPLA 3GDKA 1U30A 3B4UA 2F2KA 1PZ2A 1TMLA 1MZHA 4CCCA 3HB9A 3W1TA 2X7VA 3IS4A 4UMAA 3V16A 2DVUA 1JGMA 1RD6A 3URQA 5KSWA 4JHZA 1W1IE 1OYCA 1VBRA 4IIFA 2QDHA 4KBXA 3M0YA 1QDSA 1XF0A 4S3DA 3AZSA 3KBVA 2EPKX 2HK1A 4UZUA 1AFSA 1YBQA 4MWAA 2OZ3A 3QTGA 5LNVA 1TE1A 4HOZA 1MXDA 4YWIA 3S83A 1K70A 4E2BA 2AQVA 3TDFA 5D4YA 3QR1A 4MYXA 4XD3A 1OX4B 3H2CA 1BG4A 8RUCA 3CLWA 5EFFA 2X2GA 1LL6A 4ADUA 1KXTA 4X0VA 1GQNA 1TX0A 1XLAA 3ENLA 1P6WA 2BGSA 1RLCL 2CZVA 3WLSA 5H8UA 4D8LA 1VFFA 4P7OA 3SGGA 1CBGA 4QSHA 5REQA 1Y0EA 1ITXA 3Q4DA 4RLIA 2OB3A 5I77A 4BY3A 4M80A 2OYLA 3E2QA 2XZ7A 1QUMA 4K7VA 5CGMA 4JQAA 1T40A 2E28A 1XRSA 2CIPA 1OINA 3PBVA 1AQ0A 3NL5A 1W1A1 4GCAA 4GH1A 1FP9A 1ME9A 4PTNA 3NQ2A 2ZRUA 5C2GA 4LAZA 4UR9A 5HR6A 3P5ZA 2EKCA 4Y90A 3N25A 2PBGA 1HNYA 4R27A 5H8MA 3S46A 1DXIA 1TV4A 4D8AA 2J74A 2Z6IA 3VILA 2ZFAA 4RNJA 4XBJA 5G2HA 1HO4A 2GJNA 3CHVA 1QBAA 3GAYA 3GK0A 1MO0A 4RW5A 3S6OA 4PUKA 2UY3A 4YVVA 2V2DA 4LF1A 2YBVA 3N3TA 4TOQA 4UXDA 4V27A 1NDYA 3W81A 1J4EA 5HUPA 2PTYA 1JRCA 1E72M 1LQ2A 2OR2A 4DUOA 4IJRA 1WDRA 4JR5A 3QHNA 1JIBA 3KLLA 4O1BA 1GJPA 1FFRA 4ERGA 3BSMA 4DPPA 3W7IA 1KBKA 1AZ2A 5BU6A 1FWSA 1TX2A 3KBMA 2HSAA 1IXQA 3DYOA 3VIJA 1BWKA 1UKOA 4FX7A 1HKVA 4JNYA 4F3HA 2YSWA 1W91A 3UU0A 2FZDA 4MDOA 1WDDA 2FH6A 3K8LA 4ZSTA 4JICA 2BOFX 2VX6A 2QQ6A 5CPOA 2G4JA 4AWEA 4U3AA 4DJED 3SSZA 4DO6A 5HBFA 2O4QA 4KWVA 1WKEA 3G8RA 2HBXA 1GHSA 3MCNA 2GDUA 3W88A 3WQOA 4XZBA 4A2RA 3WNKA 1V4YA 2VC5A 3GIYA 1Z3NA 2NV9A 2O7QA 1DEDA 1EOMA 2PDPA 4DY1A 1MI3A 3UW6A 3POHA 4RZ4A 3L4UA 7CGTA 3KRZA 1LF1A 3FX4A 1H11A 2P5NA 4US5A 3TC7A 4M82A 1PJ9A 2PA6A 1A3HA 4JTTA 3PPCA 4DF1A 4JCLA 4EAYA 1WXZA 4MB5A 4ZXOA 1UR9A 3ES8A 4C90A 1ECQA 1E9LA 2XFYA 3LU2A 1SJCA 1CLKA 2YLAA 1WAWA 3DZ1A 4RV3A 2YL6A 2E25A 1GOMA 1SFJA 1OT1A 1UWAA 1QI0A 1EJTC 1Q7MA 3MDWA 3T0AA 3ZS4A 8A3HA 2REQB 4QJ3B 3B40A 1BGGA 3LHVA 2VCCA 3B9OA 4C91A 1UQYA 2HK0A 3EBVA 1F73A 3WD4A 5HXMA 1LTDA 2WZHA 1UR8A 3PM6A 1SPQA 3FN9A 2Z24A 2FZ8A 4M7SA 3M6DA 4HN8A 1AW5A 3N29A 1LOSA 1KD0A 4O57A 1XCWA 4J3VA 3WF2A 3AHXA 3FCPA 1RJRA 2WYSA 2YLLA 4QEEA 3RN6A 3W7DA 2WVVB 1DE5A 4OGZA 1DVJA 1VCVA 1YTKA 3SSJA 3GNRA 1X8FA 4OVXA 4JQ1A 1DJXA 3MUZ1 1AK5A 4KRUA 4DB7A 3UJFA 3C6CA 3APGA 4QG9A 3U2OA 5A8GA 3L5AA 2P10A 3NL3A 3UCCA 5IDZA 4GYKA 3VGGA 3OTRA 2DJLA 1V0LA 3H53A 5HQLA 3B97A 1JR1A 1B57A 4B5TA 3CUHA 3JW7A 3AJXA 5XIAA 1TSIA 4UWMA 3DC0A 1OGBA 2ZXQA 5KMYA 3ZR4A 1RBAA 3VYLA 1QPRA 2DEPA 3B8UA 4XIMA 4LAMA 4UTWC 5D8WA 1CGXA 1BYDA 3T2OA 2D0HA 3UEQA 2Y6ZA 1QMLA 1DP0A 4BF7A 2XGIA 3BLEA 5J8LA 4K8GA 1AW2A 3DESA 1DJGA 2EPOA 1TPEA 1XIJA 4D6JA 3M4HA 4NL1A 3WN6A 4E4PA 4Y8EA 1V6XA 2BHZA 2HVMA 4JTFA 4BJHA 3TTSA 3ABXA 3UJ2A 2GUYA 4JTCA 1G4SA 1V77A 3NSMA 1LJYA 3B9EA 3M0HA 5DFAA 1LT8A 4WSHA 1HIZA 3HGSA 4LU0A 4JHOA 2XTKA 4KERA 3PTDA 4ACZA 9XIMA 1IXNA 4LBUA 5DRCA 1G4PA 1KBBA 2ZX9A 4G9PA 3SFWA 1TJPA 3DG7A 1UKPA 3W00A 1GVRA 3WQEA 3KOZA 5SWUA 4MUPA 4JIRA 3ITCA 3GNNA 3W7HA 5JBEA 4L80A 4F2UA 3PC0A 3CAKA 4AEEA 3VD4A 1SZNA 4U10A 3LCIA 4O8RA 5LGZA 1SMDA 3GS6A 4J27A 3WBYA 3SY5A 1XIFA 4IIDA 1RQHA 2O9OA 1QO5A 2NLIA 3H55A 1A0DA 3DECA 4MGGA 5HA7A 4Q4QA 3NPUA 3MT1A 1UASA 4WJEA 2AL1A 3SADA 1JYXA 2BWGA 4Q4RA 4R9XA 4ZOEA 2LLEA 4W4QA 3WQDA 3IANA 2D69A 4X9YA 2YX0A 4I6VA 5TF0A 1TA3B 2ZZ2A 3LX9A 3C0SA 3EA2A 1Q65A 1VPYA 5LNUA 3VK5A 5JIPA 3DGRA 3QHMA 4F9DA 4XKMA 2DZUA 4UTHA 3RU8X 1TPDA 2ZE0A 1VH7A 3O6YX 2CU0A 5E1QA 2BNJA 4KFOA 4KEVA 1FDZA 3UJRA 3CAQA 3LV6A 3N2XA 4LX4A 1QI2A 3LY0A 5RUBA 2AQOA 4NZ1A 3MYPA 1RJQA 3LCFA 2DW6A 1NWTA 4OV4A 2R1KA 4PUMA 4DQWA 5AHIA 3TC3A 2AQWA 3GZAA 4JTSA 1A5MC 4IX0A 3GDBA 4DLFA 4D6CA 3QC3A 3OG2A 4C1KA 2IXUA 4Q8PA 3AIRA 1W1B1 4ZVJA 1QRQA 4RCXA 2XIJA 2FHCA 4AUBA 3MVIA 4GMEA 3AISA 4MWAE 2GJXA 2YPIA 3BTNA 3ARRA 1VD6A 1ODZA 5FJPA 4OBTA 3EX4A 4S23A 1JI2A 2PLCA 4DJFD 4JEJA 1VR6A 1OVDA 3T1GA 2XIQA 5LHEA 2JKPA 2VC7A 4QITA 1QATA 1WDPA 1TPFA 3ITLA 3EOSA 5U4NA 3C2FA 3M0LA 1EJRC 3CQ0A 4Q8NA 3TONA 3MBDA 4PTVA 4PUNA 1M1BA 4R88A 3O15A 4US6A 1I2QA 4E4UA 2HEJA 5JXQA 1XYLA 1RVGA 1JUBA 4ZODA 3KTXA 3UFYA 3V36A 1H63A 3ARWA 2Y62A 3CYJA 3IJIA 1IF2A 2QGYA 4PL2A 4U2ZA 4Z2HA 1K1DA 1LBFA 1GVEA 1FCVA 3JVAA 3G6LA 1JEZA 4C1NA 1M65A 1FHUA 2PRLA 4O8AA 4IH3A 4WX2A 4IWWA 3ZOAA 3NQVA 3NQCA 1Z48A 1FKWA 1M6JA 2DSWA 2YR1A 3DH7A 3W1RA 1HJXA 1XLBA 1Q66A 3WDPP 4IQLA 3DENA 2PWFA 3W9ZA 3QMSA 2I16A 1RP9A 3W1NA 3KP1A 3PSVA 3FYOA 3CO4A 3FA3A 3G3MA 5G1TA 1OFDA 5EKYA 1MW3A 3VD3A 2GQ3A 2ZC1A 1UOKA 3AHTA 3S0CA 4YTSA 4MJMA 3OBAA 5IBXC 4YCOA 3FA5A 3NEHA 3MJMA 3KVLA 4RDYA 3GIPA 2E77A 3HFYA 3IIVA 1O5XA 2CITA 2QMKA 4HU4A 2J24A 3MQTA 1VFMA 4P5UA 1WB0A 1Q85A 3IVTA 3TTQA 4L6DA 3NSNA 3O07A 3QZAA 4HA4A 1IT8A 2DSVA 3ARQA 1ITCA 3M07A 2NWSA 4AHOA 4ZO6A 1KBLA 5J04A 2BVDA 3ZJ8A 4IX2A 4C6EA 1VHNA 1W9XA 3DXIA 3A3WA 4S2BA 2POZA 4Y9OA 3MYOA 1IE7C 3KRUA 2WMHA 1XDMA 4Z1YA 3NQBA 4L7ZA 4ZFCA 3TN3A 3GNPA 3SUTA 3UF9A 3VD7A 5M17A 5D9MA 3GHUA 1JCLA 1PX8A 1TMHA 3LN3A 2D23A 5G4HC 4HMNA 2GFTA 1XD0A 3MB9A 3OIHA 3RX4A 3VNIA 1AH0A 1LRTA 2OT1A 3WBWA 3I3EA 1S5NA 2PF0A 4NZCA 2OZ0A 2O0TA 2D73A 4FA3A 3R0DA 3W7EA 2WNZA 3B04A 2OYMA 4WIWA 1M7JA 2FZ9A 3TTEA 4UR8A 3BAYA 4XZNX 1R5YA 2OG9A 3MV11 3WLHA 1F7BA 3V0SA 5M2FX 4AD1A 1YXDA 3RPDA 1BYAA 1MW1A 1RD5A 3G22A 2VR4A 4HPJA 5EFDA 5T26A 1MMFA 3TYDA 3BGGA 4MZ8A 1POKA 1BG9A 2YA2A 1C7SA 1W32A 4QE4A 2R1NA 8XIAA 3WLOA 2WW5A 4PMZA 4GOAA 3HF3A 2Y61A 1MDLA 1RPKA 2YBTA 5FESA 4DUVA 1FXQA 3EDDA 1UP2A 4X0NA 2BVWA 3V5OA 4XAYA 2GUBA 2Y8KA 4F48A 3TYBA 1R3YA 3V5CA 3MY9A 4AVOA 3CZGA 1R3QA 2X05A 1XIDA 4Q4PA 1VKFA 3W7MA 2ALRA 3W84A 1US2A 4REQA 2QCLA 4N2YA 1YBQB 4MWAB 1FWJC 4MY1A 2PODA 3RCMA 1ONWA 1EX5A 1EIBA 2OJPA 1SSGA 2P53A 4V2XA 4GG9A 1ALDA 3TR2A 5LIWX 2OEMA 2IS7A 3UPWA 5H1WA 2I5GA 1D7FA 2H9AA 4QG8A 2WSYA 2PWVA 5AY7A 1A53A 1O94A 5A3HA 4GUFA 1LRNA 3QQWA 3UCDA 2PF8A 2G3JA 3SCOA 1UW9A 1U1UA 3V35A 5REQB 2XGBA 4DO4A 2EF9A 2OGYA 2J75A 3HZ3A 4L9YA 3BK0A 4XZ9A 4PMUA 2A2IA 3H4XA 2QNEA 2ZUUA 1T5AA 2F84A 2W92A 2ZRZA 4B15A 1KXVA 3HJEA 3AU6A 5D04C 4YS1A 3OA5A 1ICQA 4ZXLA 3BJFA 3DBNA 1AW1A 3CNYA 5CPLA 1KTNA 3WL0A 4D2JA 7XIMA 2IPFA 4LEFA 4UMCA 4DI9A 3I10A 2PAJA 1XIHA 4I8YA 4AWSA 4A8IA 1XLEA 1W9PA 3R89A 2WHJA 1TPH1 2P0IA 1K6WA 1OYBA 2Q8XA 1OFQA 5AYIA 1K02A 4FNPA 4Q8UA 3H2AA 1OX6A 5CQ1A 4POCA 2R91A 5FOOA 3VNMA 1W2VA 3QEZA 1XBYA 5JUVA 4H6KA 1GVFA 3K5XA 3CQHA 3EWDA 3LG3A 2WC7A 3GKFA 2ZZ4A 4MAZA 1GYNA 4D6EA 6PTDA 2Y88A 4XIAA 1JXJA 3HMCA 4GABA 4CN4A 3IGSA 3GW0A 4ICMA 2WBKA 3PPFA 1JDEA 1LLWA 2VOTA 4FXFA 3S5NA 4CQ9A 2X1UA 4D6FA 5FF2A 2WQPA 4TXEA 1UR4A 2HZGA 2NW0A 4JTQA 1P43A 4X60A 1KRCC 4AY1A 3N13A 2NLYA 3EDJA 1C93A 4F0KA 3UXKA 4B91A 3FYPA 3GY1A 4UOQA 2Z2UA 3L4YA 2SFPA 4HMDA 3NYDA 3TZFA 1P1MA 1YRRA 1H7OA 3I6TA 3ZXWA 2Q01A 2G3NA 3VCRA 1KR0A 4W5ZA 6TIMA 1AJ2A 2ZZ7A 3UWQA 2PPGA 4PR4A 5D05A 2D3LA 1FWGC 4CD6A 3NQ7A 3B9AA 1O5QA 4XWUA 4Y9MA 1CGWA 3LRKA 3QGKC 1JCYA 1J0KA 3DHUA 3VNYA 4JFVA 2Y7GA 1IV8A 1Z6KA 1LL4A 4RKAA 4ZGYA 3EA3A 3RITA 5LNRA 2V2HA 1GG1A 4Y9NA 4YTQA 4UNLA 3IUHA 2RDXA 2VD8A 3T6CA 2VZOA 4XBSA 2EPNA 1G5AA 1YXYA 2ZCGA 4CCEA 2WCSA 5HWNA 2FKPA 5KZMA 3N3MA 4WGXA 4Y2WA 4JIHA 3AXXA 3CGTA 2WANA 4LYKA 2ZRXA 5G2IA 3FDGA 1IGSA 5D32A 5M5DA 3N6QA 5AHMA 3LMZA 1X97A 3PZMA 3A9BA 4TMCA 3RDKA 5G4EA 3S5YA 2C16A 1SQ7A 1I4NA 4DX3A 4A3QA 4MNLA 2A3EA 1V6YA 2XN0A 3GVWA 3WEOA 4HNLA 3HOJA 3B8VA 2BHUA 3SAZA 1XINA 3AMLA 4XAZA 1J12A 1OK6A 1HKMA 2BLEA 3I6EA 2CCRA 3AICA 2YKKA 4LTSA 4GY0A 4OOZA 3VD5A 4UQCA 1TR1A 2P76A 3W6LA 2ZA2A 1L6FA 2B31A 1TVLA 1TR9A 3BZJA 4WF7A 1RA5A 2J66A 2J8GA 4AIBA 4R53A 1X6NA 2ONEA 1ZB5A 3GAKA 1ZAJA 2CXEA 5DELA 2F6KA 3CMFA 3GC5A 1O1ZA 2J27A 3W1MA 3NIYA 4KCUA 1B3VA 3CAVA 4KFPA 2XSAA 1XGZA 1W56A 1J6OA 2G0WA 3QY6A 5BW6A 2V63A 1T7LA 3RU6A 4MB1A 5A6BD 5E9XA 2GDVA 2OZ8A 4WJXA 2FMNA 5JBDA 1SFSA 3A64A 3QC0A 1UD2A 1DKWA 3GNDA 4MZYA 3A47A 1TQJA 3VIPA 1OABA 3W22A 1Q6CA 2XFRA 3ALGA 1E1EA 4UTTC 3AIEA 4QQ3A 1GJUA 3OHMB 3H8AA 3E0LA 2HCVA 1N82A 2OSWA 3SCWA 3S9ZA 3H12A 3APYA 3G1SA 4O28A 3KZPA 2PDLA 3QH2A 1YTDA 3PAJA 9XIAA 2JGYA 4GI8A 5I3JA 2V5JA 1E4MM 5CSUA 1H7XA 1NF7A 5DRIA 4L65A 1GVSA 4F0RA 4ACZB 4MLJA 1C9DA 3BXWA 3P81A 3G77A 3VX1A 3MI3A 1HGYA 1SW0A 4HK6A 1P0NA 3EX6A 4BQ4A 5HDRA 3I4EA 4HNVA 1H51A 4YHEA 4QDWA 3AAMA 1VRDA 1MXSA 2Z00A 3DKLA 3NPXA 2CWXA 4IUOA 4KWOA 2DGAA 5C5YA 3PFMA 3DOPA 3F4WA 2RDWA 3W6YA 3P6LA 3L2MA 3BSHA 2NT0A 2UBPC 1A47A 2MNRA 5KETA 3ITYA 2ICSA 1XRTA 4DYKA 3AO0A 4YHGA 1JCTA 2DORA 2QV5A 2V6AA 1UKTA 3LZ5A 4KGJA 1M7OA 2EG6A 5HNRA 3FIGA 4RE3A 3T40A 3P14A 3QMRA 4D8ZA 1WZLA 1DJWA 5LA0A 1JPHA 4AZCA 3ORWA 5GJPA 4HPGA 1MUWA 1PWLA 4B16A 4AD0A 1DWHM 3A4AA 3VDBA 5D37A 1PL9A 1N2VA 4CNUA 1ZJAA 1SJAA 1H61A 3WBXA 3NZGA 1S3TC 3W25A 4C60A 5A95A 2B81A 1JNDA 3TE9A 5FSEC 1G94A 3THCA 3NM3A 2WPGA 4RUBA 1SO5A 3OZMA 5IXEA 1XSKA 1QNVA 3O3RA 4Z08A 1GKRA 4IISA 4S38A 1TELA 1W8SA 1NH6A 3IV8A 1UG6A 3CS2A 4JTEA 4TUFA 1AZ1A 1DQUA 4YTRA 2Y8VA 4KKXA 4JCMA 2QW5A 4RX0A 1VENA 3FDKA 1JJKA 4ADTA 2DVTA 2RGMA 1T96A 3EOEA 4YVXA 1S2VA 1Z7AA 2GJXB 3KL5A 2GZXA 3TLQA 3BICA 1Q7QA 2VDHA 2ZZ5A 1KFLA 1IEXA 4DUXA 4ATDA 3F4CA 4GNKB 5HNUA 3ARZA 1O60A 3PZ9A 3WQ8A 4JBRA 2V69A 3MHFA 4JX4A 1BWVA 3VGEA 3NCOA 3GYCA 2OO0A 1TVNA 1RY0A 2ALDA 1XDLA 2IKHA 8CGTA 4OE7A 3QV8A 4AISA 3W27A 1EQPA 4HNUA 1C3FA 2BHYA 2V2CA 2PD9A 3WQ5A 2G96A 3UGVA 4OHQA 4R85A 3WQPA 5IOBA 3ZJ6A 3OU8A 4YYFA 3NZ1A 4YU1A 1QNOA 2PDCA 4N6EA 1UIOA 5I78A 1THFD 3NO5A 4C1NB 4LC6A 1DTUA 1UA7A 1B9BA 4LYPA 1F61A 2FPTA 4R3UA 3GTIA 4GIAA 4HP5A 5EMYA 3W85A 1B5TA 6ENLA 3VIMA 4YTUA 3H21A 4IFOA 4U2YA 4GGHA 3VOHA 4E3TA 3EOOA 4M51A 4UOZA 3TW9A 4WKHA 4DXXA 4GQ0A 4LSBA 1LBLA 4QJ1A 4J35A 2QDDA 3UVAA 1S5WA 3PG9A 1SW3A 1EIXA 2W62A 4J3ZA 3AZRA 4HHPA 4WLCA 4ZOCA 1VPQA 2VUYA 3QV9A 3QF0A 1US0A 1R0MA 3FK4A 2YCLA 1CIUA 5D38A 3ZWSA 3G8EA 3LK6A 1H09A 2YCKX 3AZTA 1B3OA 1Q63A 2VFGA 3EYPA 3K13A 3PTQA 3SCRA 4BI6A 3CJPA 4AIEA 2XGZA 1XC6A 5U7SA 3W01A 2Z1XA 3I7SA 4J5NA 3LMYA 3WD0A 2OU4A 4HHLA 3DG6A 1NF0A 1PZ0A 3G1FA 3LTSA 3PBMA 4AC7C 3GG8A 4H9UA 1UYQA 1W1TA 2YYUA 5HWMA 4E6MA 2E6FA 1OWQA 4AG0A 3CZKA 4GZJA 3GG7A 1E6QM 1FCBA 1TPC1 4PMQA 2BASA 3BMWA 3MUY1 1DIKA 4D72A 1X7FA 4D1IA 5CC3A 1GW1A 3HPSA 1GTEA 2QT3A 1IR2A 1RK5A 2Y85A 2HS6A 3E38A 3VGBA 1OCJA 3E2VA 3OVPA 2BG5A 3KWSA 2F2HA 1W3LA 4Z0SA 3O6DA 3ZT5A 2VKZG 1EZWA 4EP8C 4DZIA 4CKQA 1JPDX 4DRSA 2OT0A 3NQAA 3HFTA 5AC7A 1SFLA 5I3KA 3N9KA 5KZDA 1SZRA 2WNWA 3LV5A 3S47A 1QW9A 3OODA 2EG8A 4C5ZA 9RUBA 5CJNA 2DSZA 1WAUA 3DYMA 1LRQA 4BCEA 1OFEA 1NQKA 2DH2A 4CNTA 4O19A 5AYYA 2ZVIA 2GK1A 4NAFA 1PIGA 1UA3A 3A5FA 4XKYA 1CDGA 4GISA 5AZ0A 4XVEA 3QKEA 4AVNA 4HHMA 3DI1A 3UWZA 1UBSA 4JYEA 3VZYA 4DAFA 2OOGA 3IGHX 4TO8A 3VMNA 2IKIA 4P7QA 4DIAA 3GVGA 2FFCA 3M1ZA 3WJWA 3EWBX 2ZWZA 1L6WA 1ZAIA 3EXTA 3TWAA 4K36A 4O16A 3L12A 3NO3A 1L6YA 7ENLA 3MZ2A 3OQ8A 3PJXA 1FQ0A 1H0GA 4REQB 1HG3A 3LZ3A 2NQZA 1DYSA 3EAUA 2WQDA 2XIMA 2XVKA 2HTMA 4IGNA 1SZEA 1MFVA 5HMEA 4E8CA 3ALFA 4JKMA 1M68A 3CZ8A 3P74A 1SJDA 1OHLA 2H9AB 2WKJA 3PTMA 3IIOA 2GVLA 2G4FA 3LXBA 3DGBA 1QFEA 4CD5A 4YJ5A 4HCDA 1CXIA 4ATLA 4HSOA 2D24A 4UQAA 1IZCA 2X8RA 1R3WA 2QS8A 2DIKA 3GBEA 3L9CA 3LBOA 3TJXA 4JTUA 1A5CA 2V9DA 4PUEA 2QJJA 1UWUA 1IHIA 3LA4A 1ZBVA 1I6NA 5A8QA 1K9DA 3W2UA 3N4FA 1GW9A 1XLLA 4IMGA 3IWPA 1LORA 2V3EA 4IIGA 3OP2A 2DSUA 1WUFA 1A5UA 3TXVA 5GJNA 4DWSA 1XLKA 3K4DA 1IXOA 1XLDA 1H0IA 4ZFMA 5K4XA 3ARUA 4MSSA 1I0BA 1LM1A 1SUXA 2G50A 4O1DA 3D3FA 1OBAA 3OLEA 1X39A 4J3SA 4OV9A 2VRJA 4LVBA 5EMKA 2O9RA 2P8CA 2IKJA 5A1AA 1OYAA 5CAHA 4PRTA 3UZXA 1XBXA 1RBOB 2J9YA 5JH2A 2CW6A 4UFHA 2R6OA 4IGSA 3INPA 3THDA 4MPQA 4Q4KA 4BQ3A 3VCNA 1PEZA 1TREA 3Q2DA 4PSRA 3ZLFA 2GYIA 1LDCA 3OBKA 3R7MA 3NXLA 4QEHA 5C9RA 2FJUB 4NZ3A 3S5OA 1GPWA 4CQCA 2QAPA 4IFKA 3BANA 4X61A 5HULA 2Z4GA 3VDCA 1FCUA 2E8ZA 4BZYA 1OFAA 5FEXA 3CEPA 4HU0A 5L6UA 3S1UA 5C55A 3C8NA 4IT1A 4K7YA 1PKYA 2ZIDA 3LTYA 1MFUA 1FP8A 1G7VA 2EO7A 2QUVA 3VFLA 5FJTA 1TIWA 3BQ6A 1UIPA 1P0BA 4L61A 3VZZA 2INEA 3N2OA 4HU8A 1M41A 3PWAA 3C3UA 1PS9A 3MC5A 3PP7A 1OB0A 1TTQA 3CB8A 1VRXA 3APTA 5AKQA 4QGCA 4GYPA 5CPMA 2ACQA 2HE5A 2V3DA 3IRDA 1XLJA 2F9RA 2CKSA 4JY8A 4PCFA 3I65A 3GC4A 4ZE4A 1IIGA 1XPGA 3PUOA 4PTWA 3TN4A 1W2PA 3NG3A 3ZLGA 3B0XA 3B9DA 5JIWA 4NJKA 1AQFA 1JPKA 4B5NA 3WJSA 4G56A 1Y7VA 5I7GA 3JZUA 1VHCA 3W82A 3WDRA 4RNIA 3O9NA 3TJ4A 2OQYA 4W89A 5A2BA 4DI8A 5TAOA 3LSBA 2CLHA 2J25A 3EDKA 3WFAA 1DE6A 1ME7A 2VZUA 4AHQA 3R79A 2B7NA 3R2GA 1VYSX 4I6KA 1SVDA 3VPLA 1XHGA 2CZFA 1DBTA 3WUBA 3SCPA 2Y8UA 1VC4A 2ASHA 4PEEA 3NPVA 3UT0A 4KWWA 4MKSA 1DIDA 1MWOA 3TW7A 3QXBA 4N6FA 4JTRA 1SGJA 4LBRA 3HU7A 4QCFA 4NZJA 2A3BA 2E68A 2DU2A 3PZUA 2JEQA 2OQHA 1HQTA 3NJ3A 3NQGA 1B0IA 1OT2A 5FACA 1R87A 3WO8A 2FDMA 2WAGA 3VIGA 3M0MA 3Q45A 1NIUA 2I5IA 1WBHA 3KRBA 2CLPA 1DWFM 2XU2A 3C5QA 3ZIZA 1AG1O 1NY1A 5CSSA 4M7TA 1QPNA 5E0KA 1ADDA 1TV7A 3R11A 5K2ZA 1Y65A 1GEHA 3CK5A 1JCMP 4TV6A 3MMTA 1J0ZA 1FWAC 3RHGA 3B03A 2CKRA 2J7HA 1R3TA 3EPOA 2X0SA 3PUDA 5FSDC 1ITQA 3MWAA 3JZEA 2ANUA 1JFHA 2W3ZA 4KIEA 3DHPA 1XRVA 4X9SA 3PJUA 2O9PA 1HKIA 3TV8A 3WH9A 2QJMA 3EA1A 5G5IA 1R9XA 1E9ZB 2XWDA 1NFBA 4H7ZA 2Y1HA 2CZ5A 3W0KA 3BE7A 4EAMA 3H22A 2X40A 3DFTA 3NDYA 1JQXA 2J9XA 4S3EA 4MG4A 1XFCA 3WQGA 2PB1A 2XH2A 3DI0A 3QVQA 3LGEA 4FS9A 1TTIA 1SO6A 5B7ZA 3LXCA 3LPPA 1TUFA 4F2BA 7TIMA 2HXTA 3WH5A 1TVPA 3CIWA 3WNLA 3B9NA 1VFLA 2R1LA 3WLRA 4OT7A 1J79A 3C2YA 3OZPA 3PB2A 4HNOA 1I75A 5DXYA 4MZ1A 4CVUA 3H23A 3TX9A 2NX9A 3GC2A 4JFTA 3U5UA 4GD0A 1GQIA 3CHDA 3N34A 3NL2A 5A2CA 2V3GA 5CEWA 1GG0A 2ATMA 4BS0A 5XINA 5ABFA 1EL3A 5EYWA 1UP3A 2Y7DA 4MNJA 4P8VA 2Z28A 4PB5A 3AS2A 2XVLA 1JFXA 2XN1A 4LNYA 1V3LA 1VF8A 2GOKA 4Q32A 3A3HA 5HAOA 1QNPA 1RCXB 1PV8A 3AWOA 5AZ1A 1U22A 2G41A 4L4PA 3SEPA 1GZJA 3H2MA 4XTIA 4C6QA 3PZTA 1KLYA 1XGDA 3R6IA 3MUCA 4F0MA 1UH2A 1RZMA 1FOBA 2VEFA 2C18A 4INFA 3C86A 4Z17A 5C6MA 1U1HA 3RUBL 4GJ1A 4U5IA 3R10A 3GHSA 1XLGA 3EX2A 2WNQA 3SQLA 1XQLA 4A22A 2VEKA 2XM1A 3FNDA 3E0FA 5HNTA 2AOSA 2CYGA 3MSDA 3A12A 3A6OA 6ALDA 3H7UA 3SIMA 1YLVA 4CNOA 3TU9A 2XIBA 2Z26A 2QVHA 2ZUNA 1B31A 4AZHA 5IFTA 4GCXA 5C2XA 2V5LA 5FJJA 3TOYA 2D2JA 1XLIA 2J7BA 2PWEA 3P67A 3WJXA 4O4WA 3AOFA 1KBJA 1E4LA 2ZZ3A 1D3HA 3B8IA 3BAXA 2C7FA 3FSTA 3BPWA 1IEIA 3P93A 2NXHA 1PDZA 2EJAA 1P0EA 4KT2A 1F8IA 4AZCB 1EDGA 3NA8A 1EGVA 4M6QA 4BA0A 2BZNA 1GCYA 1FWHC 1L8PA 1R2SA 3GDTA 1BEUA 2JE8A 2TSYA 4IF2A 3NOYA 4XVDA 3BO9A 4QXIA 1BFNA 1WOAA 3HGJA 4J1OA 3STFA 1NTHA 3EXSA 1KFKA 3W75A 1H50A 3GH4A 2J6VA 3WQVA 3G6MA 4JHMA 4W8LA 4EPBC 4HJFA 1R9ZA 3ABZA 1F9CA 2QUMA 5DCBA 3WF0A 1UOZA 3L5LA 3F4NA 3ZJKA 5GJMA 4PMXA 3TK7A 3RX3A 1LYXA 2NQHA 2KZHA 4QRNA 1KCZA 4X22A 4HBKA 3UZJA 1PKNA 2NQ9A 1JYNA 1EZ2A 1LBMA 1F3TA 1S2UA 4NY2A 3EWCA 3CUXA 4FO4A 1DJZA 1PYMA 2OWWA 5I3GA 1BLIA 1H62A 3LERA 4B5XA 2DP3A 4ZR8A 1UH4A 5BWAA 4I7WA 2XFWA 2PDIA 3BW4A 1YDYA 2J7FA 4GY7A 3ZZ1A 4RJEA 3A9IA 3QFWA 3OW1A 3BJTA 1L0PA 2BOEX 2VX5A 2E1DA 1QOQA 1DXFA 4WQ6A 2HVNA 5E6ZA 2O55A 4GHRA 4K38A 3WL1A 3KZSA 5CLTA 3UVIA 3G1DA 3FJNA 4A8RA 5J5RA 4RDZA 2OSYA 2BDQA 4XX6A 3R0KA 1UR1A 1TE6A 4UTFA 2D2HA 3EWZA 5HANA 4YTTA 1XQKA 3THUA 2IQDA 3FVMA 4UQ9A 3UXAA 3PSWA 1W5OA 1EJWC 4M0XA 5LIYX 3UBPC 3GX9A 4GINA 1EXPA 4ZA0A 5FJOA 2R1MA 3C56A 4D71A 5D33A 4JX6A 4RZBA 1UPPA 4I5RA 3DKJA 1JNEA 2V38A 4XD4A 5BCAA 5TIMA 3ABSA 1OCBA 3ZSTA 3C4UA 1VFOA 1IT7A 3AMGA 1W54A 1XRFA 3AYRA 3QLDA 1Q6OA 3S2LA 3GXDA 3G5EA 2XPKA 4W9TA 3LHZA 1MW2A 4GI6A 1M53A 2W27A 5FJIA 1E71M 4PBFA 5A6TC 4FLRA 2VGGA 4IPNB 2YCLB 5CSRA 3E49A 4DHGA 3HM7A 1GHRA 1E56A 1ZENA 1Q6FA 4LS2A 2Z7KA 4AU0A 1JZ4A 2AAMA 4IPPA 5KZEA 2YB4A 4K1WA 1R7OA 2P3EA 4C6OA 4GZIA 3EDFA 2A0NA 3FHQA 4I5UA 4A8LA 3ZVIA 1TPWA 1X96A 5E0FA 1HUVA 3E96A 3T0TA 1WKYA 3CT2A 4GVIA 4DJDD 4LY4A 5C2CA 4QSFA 3VMOA 4TX8A 1Q8JA 4U33A 5EGRA 4WXYA 2H8XA 4E5TA 2OEKA 2WJFA 4UZSA 5FEZA 2Z1WA 3LLDA 2OPJA 1YDOA 1DHPA 2PWHA 5C9WA 2EQDA 1M5WA 1R3RA 3CV2A 2NQJA 1NP0A 2ZXDA 3V3WA 2PRMA 3YPIA 3HN3A 4WGHA 2YXXA 2BV9A 1GOOA 1EA0A 1C29A 1V0MA 1ZCCA 1WKDA 4JGDA 2NX1A 3SCQA 5D2VA 4GI9A 4BQ2A 3N12A 3BG5A 3R43A 1HT6A 4YN5A 1NDWA 4ZOBA 2WBGA 5D09A 4NSBA 2PDHA 1EHAA 5DBTA 4W8BA 1HJUA 4HMEA 4L4OA 5M3WA 2OVLA 3DFQA 4CQDA 3W4RA 1MNSA 3ZQ9A 2HRWA 4JYDA 3BG3A 4AAJA 5ABHA 2VEMA 3U3HA 1E0UA 2VZVA 3RX2A 1PE1A 3H2EA 3UWUA 4M6UA 1AVAA 1Q45A 1EJXC 2GK1B 1NAL1 4NAFB 1VGAA 4XKYB 3BVJA 5LXEA 1OZMA 4XO7A 4W8AA 1Q6LA 2PEVA 3G1VA 5E5CA 5E70A 4WZHA 2EXOA 3KVKA 3EEGA 2AL2A 3QKZA 3EB4A 3O2LA 1H60A 1RPXA 5BROA 5LA2A 4FAMA 2RJHA 3GQYA 4J3XA 2ZUVA 4IFRA 2VJXA 1OF6A 2QJGA 2BVTA 3EWWA 3PTKA 3RG6A 3KTSA 1F6KA 4EOUA 1PCWA 2NQ5A 4L64A 1A4LA 3RLGA 4V1XA 3FYYA 3WMLA 3FJ4A 1UWIA 2FTWA 4PL1A 1KTBA 5DXXA 5A6JA 1XKYA 3UR2A 3RO6A 3W07A 3M0VA 3OVRA 4OZOA 5F7UA 1GGOA 5M1TA 1ML1A 2CXGA 4CNNA 4IIBA 2V30A 4KEMA 1S5VA 1MEWA 1E1FA 2WMJA 1DPMA 1RQEA 1TTPA 4FLQA 3TAKA 2CHNA 2QULA 4XQ6A 4CD8A 3FKRA 5CCZA 3LHUA 4NILA 1V3JA 4PTMA 3RILA 3VNKA 4H9YA 1KM0A 2GPTA 1JL8A 1UUQA 4M81A 1OC6A 4ERIA 3EWXA 4ZTYA 3S2MA 4DJFA 3VIKA 1OF8A 2Y5SA 3LGGA 4Q3MA 1YDVA 3VIHA 1LP6A 4OECA 3T0CA 1PX3A 1G1YA 4IFKB 1NU5A 1J93A 4WUIA 2Z1BA 4D6IA 3FEQA 3WDIA 1I60A 2C8NA 4UMBA 4QISA 2VR2A 4LS0A 4E0CA 3PZOA 2PSNA 1MZRA 2XH4A 3QZ6A 3VOCA 2GQ8A 2GSEA 3RCYA 3GTNA 2PD5A 4AW7A 1UWSA 4QFUA 5I24A 2PLJA 3ONCA 4RR4A 1WNOA 3IPWA 2OTDA 1EPXA 2EEXA 1Y8BA 3DFNA 4BQ5A 2XSXA 4H8NA 4AX7A 4BF9A 1B90A 1I2PA 5EU9A 1EDTA 1E9YB 2V3FA 5D9PA 5IBXA 4PCTA 2FH8A 2F7FA 1XCXA 4RZ6A 4UCFA 1TWZA 1XS2A 2Z29A 5FKYA 1NELA 2I17A 2C0AA 3R4IA 4MAVA 2CHOA 2JF7A 3BW2A 3M9YA 2JF6A 1VAHA 4CEUC 6REQA 4JOMA 3WNPA 2VFDA 3RPTA 1TWWA 5KITA 1A4MA 3WCZA 4JTIA 3N1AA 1VCFA 4FX8A 2UY5A 4WOZA 1MQPA 2J13A 6A3HA 4OUIA 3WBAA 4O53A 1JZ5A 3VKJA 4WVXA 2JK2A 1UUOA 4M29A 3CEUA 4V28A 4K2SA 5A6AA 3KX6A 1QNSA 4DBDA 4NI3A 3T42A 4HU3A 5AHEA 1TV2A 2QPXA 4F4RA 2XVGA 1ZJHA 1MEHA 1YTEA 4ASTA 4NXKA 4IPIA 5AB3A 2VTFA 4RL3A 3W02A 1CGYA 3WQWA 2YDAA 2ESCA 4XSLA 5FI8A 2AMXA 2BODX 3HPAA 3G24A 2PWUA 3T2PA 1A5NC 1I0DA 3E0VA 3AIQA 3OG3A 4KCTA 2PDNA 1MYRA 4WHBA 1VCGA 1OFPA 2Q02A 3FVDA 1B54A 2FGLA 4XD5A 4DM1A 1HX0A 4C1LA 1ISYA 3UJSA 1XL9A 1Z44A 2ABBA 2NVDA 4Y8FA 3TMQA 1IWBA 5PTDA 4G2DA 3QMTA 1GVQA 5CJ5A 4IHCA 5DT5A 5CKSA 3L65A 4KW2A 1KM3A 4QDPA 4HPHA 3S1XA 4GVHA 1EYWA 2FPYA 1PBGA 1V0NA 1R2RA 2WK2A 2O56A 4J3TA 5E09A 3MANA 4Z0JA 1NFGA 3NFUA 1C8QA 1UR0A 5EMMA 4MY9A 3DFPA 5HMSA 4WDWA 3LBMA 2QV4A 1G7UA 1BWLA 5D30A 1UWQA 1UB3A 2VZSA 1QK2A 3AHZA 3TN5A 3W2JA 4NNBA 3DN5A 2PGWA 4ATWA 3S1WA 4M1RA 2DUXA 1C8VA 1E5JA 3J7HA 1VBUA 4IUGA 5I06A 4XUGA 2Y7EA 2RAGA 2DT0A 2A4AA 3B4YA 3LYEA 3QBUA 1EBGA 3EKLA 3H54A 4IMEA 4L56A 1PZ3A 3WH8A 4B3KA 3WF4A 5EMJA 4H9MA 2OGJA 4A3RA 3QR3A 1HL2A 4H7VA 3BLPX 5DEZA 4DLMA 3URNA 1D8WA 5ABFB 3GB6A 3M44A 1WXYA 3L4WA 1NARA 2W63A 3WMCA 2IPGA 5CLWA 2QEZA 1XC4A 3U8GA 4ZQRA 4H9TA 1S39A 4I90A 4CU8A 3BOFA 2C1IA 1VYPX 2VM8A 3VABA 3M41A 1SZGA 2GJPA 1R3SA 1KGUA 3MKVA 2WMIA 3QYQA 4HT3A 3RK8A 3EX1A 2BY2A 4UOJA 2Q3OA 4MNMA 4P8XA 3BC9A 2PDUA 2I9EA 3GG1A 1AD4A 4FSAA 1OFOA 1KBIA 3L4VA 1JDDA 2QMJA 4E2OA 3P80A 1RY8A 4IZGA 1GKPA 2CESA 3QV6A 3TSBA 4Q7NA 4EACA 4RZ5A 1TWDA 2VUNA 3MWCA 3BV4A 3CB3A 3SGUA 1JZ3A 1V3IA 5HR7A 1V6TA 1Q3NA 4C6IA 5BXSA 3ZM8A 2E5DA 4AWUA 4A8NA 4HTYA 2PBOA 1EH9A 5D2TA 7ODCA 1O12A 4PUWA 1VEOA 1E43A 1DJQA 1A80A 2J7GA 3ZT7A 3GTFA 4QAWA 4IG2A 1GOWA 2XH0A 3WDJA 2BBFA 4UFIA 3O06A 3BLDA 4MF4A 5K4ZA 1XCFA 3A5VA 4FOJA 4IMFA 2A1YA 1EJSC 3DUGA 4GI4A 1I2OA 4P2VA 1GKQA 1ZBWA 2VP8A 1UKQA 2DZSA 2FHFA 4AWTA 4RXFA 1KRMA 3HA1A 5CJMA 2CEQA 1REQB 4Y9AA 3AU2A 2INFA 3FLUA 1EXBA 2F38A 4OBRA 4LY8A 3XINA 2B7PA 5D2YA 1V5XA 3OLGA 1PWMA 1EPVA 4LEQA 4UFLA 3QV7A 3WK2A 3PPGA 1CYGA 4HNNA 2YXOA 1L9WA 1NOFA 4OQVA 3HQNA 3AC0A 2DV0A 3GTXA 1BQGA 3T8QA 1V03A 3TP4A 5CZSA 1QO2A 1UUMA 1HTIA 1W3TA 1U2YA 1JF6A 2WJZA 3QPEA 1TPVA 5HINA 3CH0A 4O18A 3ATYA 3DFSA 4JZ5A 1FVPA 2DUZA 1TPB1 5DN1A 4LRSA 3W3OA 1ENUA 1UR2A 3CV1A 1A0CA 4TX9A 3WEMA 2YL8A 4ZB5A 1BSLA 4TVDA 2H6RA 5F4XA 2DY3A 4LGXA 2XVPA 2QCHA 4IICA 2C0HA 5HK4A 1MQRA 3W7JA 4AXKA 3KBWA 3AYVA 1F05A 4QLLA 1HVXA 2TODA 2P50A 4D6HA 4XB3A 2XJ7A 2B7OA 2PP3A 1QXLA 2YDQA 3CZLA 2PP0A 2E67A 3TW6A 4AMAA 3KXQA 5HNNA 1J9YA 2E9MA 4OFCA 4HNTA 1CXEA 4GIYA 4Y6GA 3NDZA 4K68A 1V0KA 2PDWA 1BVNP 1PYFA 4PBGA 3ONBA 3M5ZA 3KUMA 4EPDC 2Z25A 1VS1A 2ODOA 2PC8A 1DJYA 1W31A 3UYIA 4G8TA 2WKGA 1FH9A 1E0XA 1JCJA 4UTKA 3OB8A 1GZ1A 3E2SA 1DTNA 3ITOA 3LPGA 2E1WA 4TIMA 4O54A 4I9MA 4JDBA 3TAOA 4PA8A 2FVLA 4YVPA 1EGZA 1A5AA 3EZ4A 3OGRA 4PB4A 3GG0A 2FZNA 4BK9A 3GFXA 2W0UA 3CASA 2W67A 3S8HA 5CG0A 4FR1A 3P8JA 2CWNA 2DZWA 3AJ7A 2VNCA 4KFNA 1A5SA 2HROA 4QE5A 1HJQA 4ES4A 2WOQA 3KOWA 1XSJA 2QPUA 3GXMA 4FEZA 5CG7A 2E9LA 3SRKA 1PX4A 2IUZA 1L2UA 3D5HA 1QBBA 5EB8A 3SRFA 2J7EA 1EC9A 3VOFA 1Q8AA 3P62A 4ZL1A 2FHBA 4HK5A 3SCTA 4O12A 5I03A 3VKAA 5H6HA 4GUHA 5EPDA 1S5MA 1W9VA 3ANYA 1HP5A 3SUVA 5A6BA 3NZQA 5BXRA 4PMRA 4F8XA 3QTPA 4GRSA 3SGZA 4W7VA 1CPUA 4GX9A 2NV1A 2VQTA 3SQSA 2ACRA 3SDOA 2NWRA 3B8SA 3UG4A 2WMKA 3IIZA 3WENA 3VAVA 4YWSA 5I3IA 4JS3A 1AJ0A 1ONRA 3EB3A 2R9RA 3SO7A 3HURA 4AZ6A 3STEA 3IJLA 2W66A 3KW3A 5AHLA 4O0ZA 4KETA 2QIWA 3GDMA 4JTHA 4AXNA 4W88A 1HKKA 1BF6A 1ZNNA 4EK7A 3LCXA 3SZ8A 4S1FA 1XD1A 3PNUA 4IM4A 1GPFA 5FJRA 2WSQA 4ZE5A 3HTWA 3VOGA 5IDIA 1QW7A 1FWFC 4MY8A 5D8ZA 3SB0A 4K39A 3VNLA 5CXPA 3QGVA 4LB3A 2F6XA 3MP4A 4HYRA 1W3HA 5BRPA 1V7YA 1EP2A 1KTCA 3IVUA 3WUEA 3LHTA 3WDHA 1P5BA 4O15A 4AYSA 1KV8A 2NUXA 1TCDA 1CECA 4EPEC 3GHRA 5A8PA 3VNJA 4X3ZA 4E8GA 3VNDA 4PEKA 2AL2B 3TQKA 3W28A 1ZZMA 1Q6QA 3WEZA 3OGSA 1BKSA 2VDGA 3BLLA 2OFJA 3B8DA 4PODA 4KMQA 1O68A 3PBWA 2AGKA 4I8DA 2NX3A 3C3NA 1IWPA 4HIBA 4LVGA 3GH7A 4AYGA 2EJ1A 3ZLHA 2G3FA 3BCFA 4I7VA 1DL3A 3CQKA 1Y5VA 3SRDA 3OVGA 2PDYA 3EGJA 3VFCA 1SJBA 1EJUC 3CMJA 3IK2A 3CO8A 4JQ3A 4J40A 1PCKA 2QXWA 2DIJA 1N55A 2Y4SA 3UXDA 3TOPA 3MCMA 1NWSA 1HO1A 2W4XA 1U5JA 3EWYA 3H70A 3VKDA 3NWRA 4LYRA 1UMYA 2NZLA 1QJWA 2ZX7A 4FNRA 3FA4A 3GXFA 4HCHA 1YPFA 2VRQA 2D0FA 1C8YA 4N02A 5E0CA 4AD4A 2FIQA 3W7PA 3WLTA 2D3NA 5FEWA 1Z89A 5CZKA 1CXFA 2GGEA 4W7UA 1FWCC 5A8OA 4A35A 4NP7A 1AMYA 3LQLA 1O5KA 4ICCX 1F3EA 5CC7A 1XIGA 2A3AA 4HOWA 1XYBA 2L5HA 3WMBA 1QI5A 3P84A 2GVEA 4NUWA 3JRKA 5T9CE 3M0ZA 4WK9A 5G1MA 1ISXA 1K4HA 3HJZA 1E6NA 1DV7A 2Q71A 4YL2A 1LLOA 3E12A 4E38A 3W73A 3W53A 3HGRA 3VKKA 4JN6A 3CV7A 2DZVA 4RNHA 4QX4A 4ML4A 3W83A 4J3UA 7A3HA 3OOQA 4ZQMA 1K8XA 4DVOA 1P7TA 3M7SA 2CETA 1JQVA 1RVKA 1NFPA 2OZTA 3REQA 4ZO8A 3NQMA 3WLIA 3UP8A 5K9CA 1XYMA 1LLZA 4HZ8A 3CXOA 2FFIA 4A2SA 1BQCA 1X6LA 1ONXA 2PTDA 4JTLA 1VFHA 2GGIA 3OYZA 4BI5A 4E8DA 1XH1A 3RO8A 3C2VA 4CU6A 1HKJA 3MSGA 1OIFA 1OC7A 4MHBA 4JKLA 1EWDA 4QROA 5F4SA 5FJUA 1J0YA 3RR1A 1NOUA 3VTRA 6REQB 3SQMA 4E2DA 1UZ1A 5T9BG 1K7EA 1LQAA 3NQEA 3PAOA 4FIRA 4EF9A 2VCAA 3CPRA 2Y70A 3RPMA 4LCSA 1J10A 2OX1A 5JH1A 1HW6A 1VFTA 1KXHA 3WK1A 1I2NA 2PCQA 2J47A 4AFYA 1UC5A 2JQXA 3L0NA 4C7GA 1XLCA 3UYCA 4UTJA 2QKFA 3GR8A 4Q8OA 4LYQA 4AD3A 4Z2IA 1B9ZA 3JS3A 3PR2A 5CC5A 1XXXA 1J0JA 1MUCA 3QOMA 2X1TA 3CUFA 2A5HA 1F4AA 1Q13A 2FMOA 3STCA 2RJGA 1GOXA 1B3ZA 1Q6EA 4HD5A 1XIEA 5ABTA 2QCDA 3TH6A 5LKYA 4PYSA 3W7CA 2Z2AA 2GWGA 1V93A 1EUAA 2ZOXA 3T4WA 1V7AA 5ECUA 2CBUA 1TJ2A 4IIEA 3W1AA 3D3AA 2ZWYA 2C3ZA 3B8WA 5K9DA 1ZHAA 2EPMX 4LAOA 4L4MA 1S2CA 1CWYA 4GUIA 1WO2A 3O6CA 3GFZA 4PULA 4AMCA 4MJ4A 3N18A 1SMAA 3TQPA 1CB2A 8XIMA 2YCEA 3OEXA 3NGJA 4JY9A 2Y24A 4PMJA 2QUNA 2E6YA 3G0SA 4RNFA 1Q7ZA 2E4TA 2QLYA 3PBGA 1PIFA 4GYFA 3H2FA 4UTLA 3AXHA 3NQ8A 1R85A 3QY8A 4JX5A 3N9RA 7REQA 4PE8A 2V5CA 3M0IA 3OGVA 1IXPA 3VI2A 4UTUA 4E4FA 2EHHA 1WP6A 4DWSC 4JYFA 4UNKA 1E6PA 2QDEA 4Q4MA 4ECLA 3QM3A 4J2PA 2WLZA 2NSXA 2VCBA 1ZCOA 5LHFA 1UBPC 2VL4A 2QUUA 1EUNA 1I1WA 1K8YA 3TCEA 5AC8A 1KWGA 2UY2A 2PDKA 1P4CA 3SN1A 1TMQA 5TNVA 5DF0A 1ZLPA 4QS5A 3CWHA 3VDAA 2XIIA 4LUTA 3KOXA 1GK8A 5BU9A 2E0PA 3LSCA 1OG0A 2I57A 4XAFA 5KZ6A 1E4NA 1ONEA 3TFCA 3TJLA 1NVMA 3FKKA 2R14A 1TWSA 1QVBA 4URIA 3VO0A 5FIPA 3N6HA 1Q4NX 3SR7A 4QS6A 2WMIB 1DQXA 3KDOA 1HF6A 2Q6ZA 4KWSA 5I79A 4S3KA 3W37A 2XUCA 1B4KA 4F0LA 1TKKA 3CU2A 4A3YA 2WZEA 3CZEA 5CH9A 4GVGA 4XO6A 3KFTA 3VX0A 2PGRA 2XVNA 3T09A 4QP0A 1PSCA 2ATSA 3OVQA 4UTIA 2WHMA 1GONA 4FF5A 2H8ZA 5CSYA 4JTGA 4LCRA 5LGXA 1RAKA 5G4WA 1S46A 4XD6A 3MU7A 1QR7A 3T08A 4NZFA 3OIXA 1JZ8A 3G0XA 3H6OA 4ALDA 4P7RA 4J3WA 3VZXA 1QI3A 3P82A 4UNIA 1QHPA 3SN4A 1ZGDA 1DJIA 3P60A 1WZKA 1W3NA 1XR2A 4DN1A 1GTHA 1IEQA 4JL1A 4G1NA 1ZBKA 3OPSA 1EJ7L 3C61A 2ZKMX 4PRWA 4HKPA 3WD3A 1W8GA 4IG2B 3O0FA 2ZTKA 4J2MA 2KX9A 3WQFA 4P61A 4N9EA 4P8UA 4RDVA 3MKCA 1TV5A 3GDRA 1LOLA 1I45A 1Z32X 4TTUA 2V82A 1ZL1A 4CCZA 2D22A 5H2ZA 5ABEA 4KF1A 1K6AA 1UZHA 1ZUAX 4DO5A 5HMFA 3W26A 4H41A 3TLLA 1EKOA 4QBXA 3N2CA 3SUSA 1KM4A 3GBDA 2YCJA 3GNOA 1NQ6A 3LPOA 1M9HA 2NVCA 4IPJA 3V4BA 1XSIA 2YL9A 4K1GA 3W76A 2YIHA 2PLKA 2J7CA 1EC8A 4FMVA 4Y7EA 3V0UA 4AQLA 4G6CA 2HJPA 2VFFA 5D9OA 2QVNA 5C9UA 3L2LA 1D3CA 4MDPA 1K9TA 1PKLA 1RBLA 3G1XA 1CGVA 3P2VA 2RUSA 1ZTVA 2Y5EA 1GOKA 1OM0A 9CGTA 2B4GA 3PZIA 2BOGX 4XSMA 2V5KA 3GDLA 3N14A 4JFSA 1TV8A 3W7GA 1WPCA 1ITUA 1XKJA 1H7NA 1RH9A 5H8PA 3VUPA 1UKSA 1MUMA 2FB3A 3N4AA 3PPHA 1CENA 2TYSA 5FL0A 3RM8A 1C92A 4W7WA 1BGAA 2ZZ1A 1M7XA 4I9TA 1KFEA 1XBVA 2NXIA 4QE1A 2WJDA 2OLSA 1QTWA 1TUXA 4KRZA 1ZP4A 1FWIC 3CIXA 3LNPA 3VGDA 3PB0A 3OQEA 3Q65A 2JIWA 4LV9A 4JN7A 2PTWA 4C6PA 4XAPA 2WSKA 3S9YA 4C6MA 3CZJA 4HK7A 2EG7A 1KFJA 3FAXA 3ZWTA 2ZZ6A 1M04A 1UJQA 2V8ZA 1GYMA 3ANUA 2OELA 4GPNA 1Q6GA 1TPUA 5C71A 1XG4A 3K4WA 3FFSA 3A22A 4KEZA 4LOCA 5C9ZA 1KRBC 1TJ1A 1UCWA 4CQAA 1SU5A 4RE0A 4AIUA 3F2BA 3UG8A 2E7FA 4Q7IA 4WEVX 2J77A 2CLOA 3ERPA 3A3XA 1WX0A 3HQPA 3KDNA 1YHTA 4FNUA 2X42A 1JZ6A 2DQWA 1B1YA 2WHKA 3UZWA 3PZGA 3OZYA 4LCQA 2C6QA 1E3XA 3JUGA 3P3BA 4IXHA 2Y2WA 3QPZA 5BMWA 3UZZA 4XUYA 3ARTA 3VIFA 2YA1A 1DJHA 1LOQA 2XWEA 2VGIA 2CERA 4Y9PA 4BKNA 3H7VA 1XWYA 3N2MA 1E6ZA 3C52A 2WHLA 5TQLA 4PTXA 4KCWA 1H49A 1LWHA 4W5UA 3S1VA 1CT5A 1KM6A 5FCZA 3L5MA 3NOEA 1S2WA 3FJLA 3R8GA 3ABOA 2WZMA 5MKGA 1O66A 3M43A 3MI6A 2YB1A 3W71A 1WV2A 4EKJA 2C14A 3GW3A 4OTKA 2ZX6A 3CAWA 3LI0A 1TRDA 1YNQA 3AMDA 4NJGA 2A3HA 3ZJ7A 3AHVA 4U4MA 1PHWA 5I0DA 2A85A 2QCEA 3KOFA 3M47A 4U5KA 2Y5JA 1S2TA 3NVDA 5I02A 2UV8G 4GKLA 4ZQPA 1C91A 1WDWA 3B06A 3OJGA 4B2DD 2QCMA 4R7OA 4ENLA 1I1XA 3SUUA 4LUSA 5D03A 3L4XA 3A13A 4TTGA 4JKKA 5FA5A 3VNZA 4QTGA 1V3HA 1PZ1A 1EP1A 2GQ9A 3IJ9A 3LNMA 5DO8A 4AIOA 3SJ3A 4GIRA 3ES7A 3TYUA 1XG3A 4ZENA 4Z2GA 3GKAA 1FXPA 3AMKA 2X1SA 4NNAA 2C91A 1VLWA 3DFOA 3IACA 2TRSA 2OLHA 4XV0A 1JYWA 3GTHA 2YFOA 3NYZA 5E93A 3CYVA 2ZUWA 3GUWA 4MFDA 3W72A 4GZEA 4LNCA 2R1PA 2EBNA 2J88A 1HKWA 1R3VA 2WM1A 4XK2A 3DFYA 3W86A 1YW1A 1G4TA 3L67A 1EO7A 4R34A 4XZHA 2D2GA 2DVXA 3L2IA 3VUSA 3D0CA 5D2WA 1WA3A 3WH6A 3UWVA 3KEHA 3QLLA 5FEPA 4Z2LA 4JQ4A 4DJEC 4U3CA 3STPA 5LNWA 2D1ZA 2BVYA 4UQEA 3O0KA 3LQGA 3BW3A 3CHFA 3CH9A 3EKZA 2ZDRA 4PCNA 4GNVA 3UGRA 1F3WA 5I5RA 1XLFA 1H5YA 1L8NA 3PVFA 1S1PA 1XIMA 2FTPA 4NZ5A 5GNZA 5BOEA 3ZSSA 2G37A 5DY2A 1Z42A 2PC4A 5FF3A 4FIQA 3U48A 5BOFA 2UY4A 2CLLA 3TJIA 1Q6RA 3TYZA 1P0KA 1TTJA 3QZEA 2QF7A 1L6GA 1C8XA 1DOSA 1VIZA 4ZQCA 4Q7BA 1BTMA 1OIMA 3H4GA 3UZYA 1KR1A 4O17A 5AC5A 1IEWA 4GQQA 1CB7B 1TJ0A 3CQJA 3BDKA 5JQ9A 5D02A 3ATZA 2OQLA 2VEPA 2VVSA 8TIMA 3CTLA 3LOTA 1LWIA 3G1HA 3W1LA 3OBEA 1V3KA 4O10A 3H26A 3TC6A 3E1F1 4UR7A 3U5YA 4QG6A 5F4WA 4HSNA 4IP7A 4MB3A 4LQ1A 3FGCA 1KKRA 1KGWA 1O1HA 3C2OA 5G1YA 1ZALA 3AMCA 3PWGA 3QPYA 3WQ4A 4MADA 3S9IA 2QCNA 4RDWA 4DYEA 2P0OA 3MMWA 3BQ5A 1E0VA 2VC6A 4M3PA 1NEYA 1F8MA 2IKGA 4QLJA 1S38A 4IP4A 2Y63A 5A6SA 4WXZA 3UR7A 4O1AA 4GY1A 2CLMA 1UHVA 2DZAA 2W91A 3IK4A 3SBFA 6XIMA 3V18A 3ZO9A 4WDTA 4CVWA 1ESWA 3RRXA 4LUIA 2ZA3A 3FEMA 4GKTA 1F76A 4HA0A 3MKKA 3O63A 2I14A 2VC9A 3Q94A 1OD8A 3UA4A 3VIOA 3N19B 1JDFA 3P8IA 5E6YA 1M7PA 1J0HA 2DUAA 3QW4B 4JL2A 1P7TB 1GVIA 1W1YA 2KAUC 5DMLA 1D2KA 3O7UA 3RR4A 4G7EA 2PGEA 3WF1A 5A5WA 3HQOA 4PGLA 1JDCA 3REQB 3AXMA 1SR0A 3TZNA 5E9AA 2GLKA 4CN1A 3MPGA 1MNZA 3SY8A 3I7QA 3TN6A 3IVSA 2BP1A 1H1NA 3GR4A 4EIVA 3G3DA 2DH3A 3LXAA 1E15A 4P7NA 1ISVA 2CLEA 5IM51 3KBJA 3EOLA 1SYTA 5DMNA 2G8ZA 2A6LA 3FXYA 2PP1A 3WELA 2WCGA 2FYMA 3CQIA 3KVJA 3EWUA 3BAKA 4FHAA 4V15A 2J8TA 2QJHA 1HP4A 4EPKA 4MB4A 4WSJA 3MZNA 1P6BA 3PFRA 1NSJA 1X7IA 3JR2A 3EEZA 3THAA 2P88A 5A8MA 3PN8A 5LNSA 3K30A 3F7JA 4MOZA 1KC7A 4BWLC 1LT7A 4OU1A 3WLQA 5LA1A 3MMUA 1YPIA 2X2YA 2CHRA 3EKGA 3C8FA 5I09A 2JALA 1DWGM 3CBWA 1ZS2A 3IJ6A 3F4DA 4JAWA 1BTCA 3H2OA 5EY5A 1GUVA 1FHLA 2WWDA 3M16A 1KM2A 5XIMA 4FNQA 1ISWA 3TYAA 3WD1A 4ZB2A 3EMQA 4HVXA 2JGQA 4DJDA 3PZNA 3LCGA 1U1JA 1A3XA 2TPSA 4QJ5B 3W1PA 1EO5A 1Q4WA 4H2CA 2QCDB 2C13A 5A69A 1DWAM 4PH6A 3MW7A 4NX5A 2BS9A 3BSGA 3C0QA 3FAWA 3K46A 3BAWA 5BMXA 1TWIA 2V0TA 2X7WA 1BPLB 2A7PA 3TMLA 1J0IA 1V6VA 1SO3A 4BFAA 3SY1A 1ADSA 1J2WA 3M64A 4B5SA 4I9AA 2PWGA 1HZYA 1KCLA 4RE2A 4XISA 4TR9A 2W9MA 2WXDM 3GR7A 2YZRA 2PWDA 3UERA 3LCWA 5I3DA 1JGIA 1WCGA 2XG9A 3AXKA 3R13A 2ACUA 3E02A 3TIMA 1E1CA 4C7DA 4H4IA 4HCLA 4O1FA 2PTXA 3BWWA 2HQAA 4NYYA 3ISIX 1RJPA 5LIKX 1QT1A 4DZHA 3LB0A 1UWRA 3CIVA 1OK4A 7REQB 5C54A 2PLMA 1D7KA 4DF2A 1HJSA 1UD4A 1W9DM 2GVYA 3G18A 5A6KA 4N0RA 3B3DA 4WSKA 5T91A 4JPGA 4YNGA 3HIJA 5FD0A 3SIZA 4FB7A 4NKCA 4NJJA 5T8GA 4C6NA 3ITTA 1RHCA 2OWCA 1KB3A 4FOKA 2OEJA 4LC8A 1TZZA 3CUGA 1KQZA 2GDQA 3FXGA 4FXSA 5AYZA 1EB3A 1T8QA 1VIWA 1JAEA 4LUTB 4MVAA 2YA0A 3I68A 5HQEA 1H3GA 3HGOA 1GQKA 3GVVA 1P0DA 3ZVHA 1YE6A 2MANA 4ZBCA 3W38A 2VRKA 5IFPA 3WQCA 2VZTA 2XINA 3MUXA 4DJFC 3A24A 3N73A 3WLKX 3UA3A 1UZ4A 3FHAA 2VT0A 3TA9A 3IARA 4G7FA 4L1XA 3IEBA 4FALA 4HJWA 1XUZA 1WOBA 4O4VA 3BH4A 3RFAA 1CX9A 3GHTA 4W93A 3U2CA 5J5DA 4I9JA 5F2MA 4LJ3A 1W37A 3N2BA 3PS7A 4N4PA 3BARA 2C79A 5HJXA 3U2EA 3UNDA 1W9BM 1XM3A 4JFUA 1A49A 5H91A 2PU0A 4UFJA 2Z27A 2R94A 2FB2A 4O13A 1VEMA 3WUGA 4GQGA 1WXJA 4FXRA 4EXBA 3OLDA 1JPIA 1UC4A 3W23A 4JD4A 4RE4A 1UD5A 4BR1A 4Z2JA 1S3HA 4UQDA 5AC6A 4L1WA 2XZ9A 4FNTA 2BTMA 4YIWA 1JYVA 3SCUA 3KVMA 1MSSA 1VBGA 5EBAA 4GBDA 4Q6JA 3LS9A 4H19A 4E2VA 1KM5A 2HDJA 3XIMA 1PO9A 1FH8A 3N15A 2QDGA 3GVRA 3T07A 4JXCA 3TVAA 4PBEA 1T6MA 2DZBA 1GQLA 1VPXA 1TG7A 5AOUA 1WZAA 3N2TA 1TQXA 4XZLX 5GVJA 3O05A 1CXLA 4ZO9A 1XI3A 4A21A 4F66A 4ROPA 4DNMA 4HQVA 2F8QA 5DT7A 1RQBA 1TYGA 2ZBTA 3SJNA 3TKFA 2HWGA 5HPCA 1I9CB 2CLFA 1RR2A 1ZPTA 2QCFA 3P0XA 4NF7A 5EL1A 2NXGA 4JTJA 3GO2A 4GK8A 4DZAA 3SI9A 2PZ0A 2VENA 4N9CA 2H3BA 5C9XA 3PJWA 1KQYA 3WMSA 1P48A 2C71A 1QU4A 4JIEA 3WYZA 3GUGA 3M5XA 3GVQA 4G5DA 4CNSA 3NEVA 2BXZA 3COTA 1GZGA 3B8TA 4GUGA 3WJYA 3UNTA 4JNMA 3G1YA 3TTOA 3FOKA 2DW7A 3UCQA 4ONVA 4FZIA 4ROQA 4GACA 4CGTA 1LQ0A 3OA3A 4NYUA 1HL8A 2J8FA 4JNZA 4F40A 1UJPA 2HMCA 3BLFA 1XV8A 2ZTJA 4MNKA 4M8UA 3NURA 6TAAA 3R5EA 4OKDA 4ZQNA 2PDGA 4MWAD 4Z1BA 3O1NA 2Q3RA 1H7RA 1XYCA 1QOXA 2PTZA 4UCGA 4UBPC 2RH9A 3DCPA 2Q09A 4KWUA 2W6RA 5CPQA 5IRPA 2POTA 3M7WA 2QJIA 2XYLA 3HPXA 1ZJIA 4MYAA 1QWGA 3KRSA 4AF0A 1F5ZA 3U9IA 1PTAA 1KW1A 3MHUA 4XZMX 1C7TA 4NVTA 3WLMA 1X38A 3W2NA 2YOCA 1FHDA 3SN0A 1LG1A 3LRMA 1YMYA 4C6CA 1R6WA 4ZO7A 4MWAC 3KHJA 1KGXA 1Q6DA 3V5FA 3NM1A 4IGMA 4UIOA 1X8CA 1XFBA 2XH7A 3MVTA 3QSRA 4AZGA 1Y5WA 1I2RA 2WVSA 1B2YA 1EP3A 3DDMA 3TCSA 1Z8AA 4K6AA 4GUJA 1P6CA 2BMBA 1K7FA 2E8YA 2VURA 4NX0A 1CXHA 2ZX8A