4Q7IA

Crystal structure of engineered thermostable d-tagatose 3-epimerase pcdte-var8
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRYEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
total genus 118
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4q7iA00
5EMJA 3U0HA 4ZB2A 4ZB5A 1I60A 2I56A 3AALA 3DX5A 3QC0A 2QW5A 3KTCA 5EMKA 1A0EA 5C9ZA 4J4KA 1DIDA 1XLJA 5TNVA 3VNKA 3BANA 3M0XA 4PGLA 2G4JA 4QEHA 2QUNA 1A0CA 2OU4A 4W4QA 1XYLA 1QT1A 1XIHA 2NQHA 4QEEA 3KWSA 4QE1A 4GJIA 4X63A 1XLGA 1OADA 2HK1A 2QULA 3AAMA 3M0VA 2X7WA 1MNZA 2XIMA 4HNOA 1XYMA 3WQOA 4KW2A 2QUMA 1XLCA 4GLEA 3ITLA 4HHLA 4A8IA 4GJJA 9XIAA 1QTWA 4HHMA 4ZB0A 5AVNA 4EAYA 3P6LA 1XLLA 3XISA 1XP3A 3UVAA 1XIMA 4YTQA 3VNJA 1A0DA 3KCJA 3VNMA 2ZDSA 5I7GA 3TVAA 3VNIA 1XLEA 1BXCA 3P14A 4OVXA 4ZBCA 4HGXA 2GLKA 3QYSA 3TC3A 1XLBA 3GNXA 3KBNA 5J8LA 3VNLA 3IUIA 4YTTA 4K3ZA 1CLKA 4A8LA 2HK0A 3DBNA 4XSLA 1XLAA 3KBSA 2X7VA 4QDPA 3XINA 3BZJA 3M0MA 2GVEA 4XSMA 1XLDA 1DE6A 1DE5A 2G0WA 3CWHA 2I57A 6XIAA 1YX1A 3CQIA 4DVOA 3C0QA 3BDKA 2XINA 5H6HA 4XIMA 3UU0A 3QZAA 3UXIA 4YTSA 4YTRA 5B80A 3ITXA 4A8RA 8XIAA 1XIGA 3NGFA 4YTUA 1I6NA 5XIMA 2Q02A 5B7YA 1XYBA 1S5NA 1XISA 1DXIA 1XINA 1GW9A 3ITOA 1XLKA 3FVMA 3U3HA 4XKMA 1XIDA 3L23A 3UA3A 4DUOA 3KCLA 3KBJA 1XLHA 1XIEA 2HCVA 3BWWA 5H1WA 3CQJA 4PFHA 1DIEA 4Q7IA 1XYCA 1K77A 3IUHA 3KBWA 5AVHA 1XIBA 9XIMA 3ITTA 3N4AA 3BZGA 4XISA 4XIAA 2NQJA 4G56A 3KBMA 4X60A 1XYAA 7XIMA 3ITYA 4A8NA 5B7ZA 3M0HA 3LMZA 5FA5A 5XIAA 4K1GA 4US6A 1XIFA 2GUBA 1TZ9A 4QE5A 3UA4A 1BXBA 2GYIA 6XIMA 3AYTA 4GQBA 1O1HA 3M0LA 4X61A 3C0SA 3OBEA 4QE4A 3JU2A 3VYLA 3XIMA 1XIJA 8XIMA 3AYVA 1XLMA 1XLFA 1XLIA 5EMMA 2NQ9A 1XIIA 3IUDA 4QDWA 3KCOA 1S5MA 3QXBA 3C0LA 2J6VA 3CQKA 1D8WA 3KBVA 3CNYA 5XINA 3M0YA 2ZVRA 5EMLA 4LNCA 4EACA 1XICA 1QUMA 2XISA 1MUWA 4E3VA 3ITVA 3CQHA
chains in the Genus database with same CATH superfamily
4JTEA 1WUEA 2WC7A 3ONBA 3AZSA 2EG8A 2DUXA 1KTBA 5D05A 3VINA 1WKFA 3A5FA 3Q58A 3SO7A 2V81A 1C3FA 3DHUA 4MIMA 1GNXA 3GU2A 4MJ4A 4R7WA 4GJJA 3WJSA 4BCEA 1ZS2A 3AXHA 2BVTA 2WZIA 3AU2A 3SCUA 4CD8A 3WBYA 1ISXA 2J4GA 5I07A 2V3FA 1WBJA 5JMUA 1A3XA 3KLLA 4IQLA 3C86A 1ITUA 4GMEA 1MQQA 2WBKA 3FYYA 4MF4A 3WQDA 2PC4A 4QR6A 3AFBA 4RZBA 1C7SA 2XJ7A 3NSXA 3CMFA 3K5XA 1EUNA 3HJEA 4B5XA 3T6CA 4TOQA 3EB2A 3UXLA 5ABTA 1B57A 5JBEA 2PZ0A 1R2TA 3UJ2A 4ECLA 5C9UA 4PTVA 4Q32A 3F1QA 3WQ5A 5HPOA 5TIMA 1UR3M 4MFDA 1IEWA 4R88A 3H2CA 4A05A 3SUSA 2GWNA 4FR6A 2WKJA 1UC5A 2C1HA 2PBGA 2ZUMA 2GUBA 1M1BA 1HGWA 1EA0A 4A3HA 4CNSA 3L4ZA 1NFGA 3AIUA 4LVGA 4TIMA 3VKBA 4MWAD 1EH9A 4RNIA 5E70A 4QJ1A 3W70A 5EMUA 1UD3A 3D46A 1PYFA 1VBHA 5IDZA 1YPFA 1D3CA 3IVSA 3O0FA 3PZMA 4J4KA 1J8VA 5TNVA 3WH5A 3LU2A 2G4JA 1YDVA 4M81A 5HJLA 2GJLA 1RJQA 5BRBA 2UY3A 5LGZA 4O4WA 5F4XA 1Z9AA 3KOWA 5CC7A 3HQPA 4Y7EA 3VIIA 3GHUA 2FB2A 4OV9A 3LSBA 1V6UA 2NV1A 2Y7FA 3VNJA 2Q3RA 1E4MM 1SZRA 1DOSA 1OFEA 4O1FA 1K70A 2Q6ZA 4Z1DA 4Z2GA 1FRBA 3MP5A 1XLBA 3AMGA 1CENA 3WLSA 1CLVA 3RYSA 4Q8NA 3B06A 1U33A 1C7TA 1KRCC 2DW7A 3I68A 2ALDA 4ERAA 1BYDA 3MWAA 3WIJA 2ATSA 4FXJA 2TRSA 5DRCA 3G1XA 4BHYA 2OLAA 4NNAA 3ATYA 1XLHA 5C9XA 5KITA 2D0GA 2ZC1A 4DB7A 5AC4A 3S9ZA 2ZRUA 4MWAB 1YNQA 4AQLA 2QJIA 1AD4A 4H7CA 3P67A 3ARSA 2ZIDA 4AIBA 2V30A 3BMWA 4LS1A 4GQGA 1E1CA 3C2OA 3L0GA 3G18A 3FAXA 3GK0A 3IGXA 1OZQA 4AZCB 1TWWA 3PG8A 1M68A 5KSWA 1V77A 1LM1A 1CXFA 4BF7A 2ZZ2A 2EPMX 2WCAA 1DIDA 1S2UA 1YTEA 2HWGA 3WLJA 4PE8A 3BSHA 7CGTA 1SPQA 1JDDA 3JR2A 2RUSA 3M6DA 1YBQB 4UTUA 3LLDA 1EC9A 1VRDA 5F1VA 1XYMA 3T08A 4ZSUA 2WHMA 3ATZA 4WJXA 2VCBA 4Q8QA 3NL5A 4QG8A 4DY1A 4NIRA 1T6MA 2HMCA 3KBNA 3A12A 4G7EB 4KCUA 2FFIA 3VDHA 3N9RA 3I6TA 3NZGA 4CN6A 5DMLA 3BAKA 3GVRA 3W2LA 2G0WA 4NX5A 4B2DA 1MXSA 3T2PA 4L4PA 5CZJA 2ZUNA 2CXGA 5DBTA 5DLCA 1NY1A 3W26A 4YJ5A 2GUYA 1HKMA 2POZA 1CPUA 1ISYA 3TW6A 1XG3A 1JCLA 2VEFA 1B2YA 3S1WA 1MWOA 2VQTA 4NJJA 3GFYA 4S38A 4XZNX 3L4WA 5E6ZA 1C9DA 4NRSA 3MSDA 4GI6A 2YOCA 1WX0A 1OT2A 2OEJA 2YGYA 3H7RA 3UA4A 1YMYA 5IDIA 4RV3A 3U6WA 4Z0SA 2OWXA 3N2XA 5I2UA 2W66A 1E73M 2JKPA 1R3QA 3TTOA 5A6BD 3C61A 3FW6A 1JFXA 3W2NA 2E5BA 4XVDA 5DCDA 4W4QA 1T8QA 3K8MA 1E15A 1I9CB 4LGXA 1QI0A 2PFHA 3AMDA 1QWKA 3CEUA 2J7CA 3M0IA 1EQCA 1C8YA 2A3AA 3SCWA 5I3JA 4LRTA 7REQA 2FKPA 1KRMA 3U7VA 1UZ4A 3IIXA 1Q63A 2YBTA 3PBYA 4O19A 4K8GA 3VD4A 1S1PA 4XSMA 4DNMA 1QBBA 4QGCA 4C91A 4RV8A 3NOYA 2VP8A 1OK6A 3URAA 3L68A 3AZTA 1ZPTA 4OU1A 4HNNA 3ME3A 4HNVA 3N25A 3GNNA 1NDZA 1NJJA 1V6YA 2ZUUA 1W5QA 2XGIA 2D24A 3LD5A 2OKTA 1MFVA 4TX9A 5GNYA 4C6EA 2CHRA 3M43A 4DZ5A 3ZJ6A 3B4YA 2FLIA 3T0AA 3M44A 5A5WA 1IE7C 1B3ZA 1XD0A 2PC8A 1JI1A 1FWIC 2NQ9A 1JXJA 4H9VA 4CQBA 2C79A 2REQB 1Z3NA 3ZQ9A 1TV4A 4XZ9A 1Z48A 2VELA 3GDTA 3V5FA 2PLKA 1VFOA 2PBOA 3RITA 4ZR8A 3CUIA 2J8TA 2DJLA 4F0LA 1MVYA 3O0KA 3W28A 3OVPA 3GAKA 1LCOA 4ADTA 1OHLA 1W3NA 4AIEA 2OZ8A 4QXIA 1KWKA 1XRFA 1D3HA 3CZEA 3NZQA 1H0GA 3S5SA 4Y9NA 1FP8A 2BVYA 3T44A 1F8IA 3C0JA 3ONCA 4QBXA 2NWRA 5CBBA 1JD9A 5G4EA 5IFTA 1TWIA 3MO7A 4BKNA 2C14A 3S8HA 1KFJA 3S5ZA 1VYPX 4ZTYA 3MBDA 4ZL1A 4X2PA 1F4HA 1GJUA 1G01A 1KRBC 4YHGA 1H41A 4NNBA 3WLIA 1FWJC 4AHOA 2H3DA 1XIEA 3GXTA 4ILSA 1VBUA 2DEPA 4NXKA 1VPXA 4PL1A 3LCLA 3WH9A 5B7ZA 3RCYA 5CH9A 3VOFA 3GBEA 1HNYA 3EWUA 4RW3A 4DIAA 5KINA 2J47A 1QW8A 3VPLA 3KCOA 4AXNA 3NXFA 1BG4A 5E93A 4LNCA 3QSRA 5FAJA 2WMGA 1YLVA 4LSBA 1V5XA 2OYKA 3VA8A 4BF5A 1W1PA 3IJQA 4F3HA 3GWQA 2FZNA 2V5BA 3THDA 1JPIA 2VHLA 1WZKA 1CBGA 1JZ7A 3HJZA 4R9XA 2WCGA 3CAQA 1VRXA 3CL7A 3GC2A 3D6NA 4L56A 2E67A 1EGZA 2DUAA 4UC5A 2YR1A 3VKCA 2C0HA 3RMJA 4UFKA 2ATMA 3H70A 4JCLA 2ISDA 4GUHA 1GORA 3A9BA 1A5CA 2FJUB 5FSEC 4GH3A 1UR1A 2EJAA 5C8BB 4UR7A 3H2NA 1VKFA 1KGXA 4UMBA 2PDBA 3NQCA 3W7DA 1W1ZA 5CJMA 5A1AA 2EF9A 3R43A 3SCVA 3P5YA 4PUEA 3K4WA 3TSMA 2Y61A 4Q8OA 3VDBA 5LIUX 5D2WA 4EX4A 3Q37A 4C6OA 3MSYA 1QHOA 4WY0B 1V7AA 3CTLA 1UW9A 2V2CA 2E6DA 3WDQA 2QS8A 5FJIA 3WQ8A 4PL2A 3CHFA 1PV8A 3WLNA 4Q8WA 4C1NA 1QK2A 5C9ZA 2Z24A 1MDLA 4WDTA 1EKOA 1U1JA 4OHQA 4JL2A 5C5YA 4NJGA 3AUOA 4LJ3A 3W9ZA 2P10A 7ODCA 1NWSA 4NILA 3EX2A 3VD9A 4UFIA 1VEOA 1M3UA 5ABFB 2JKEA 1A5BA 3VNIA 4AEEA 4TMBA 1EB3A 4PCNA 5AYZA 3BICA 3RM4A 4M3PA 1NWRA 3WK0A 3TP4A 1CXKA 4XKYA 2P1FA 1KM0A 4DUWA 4PMYA 1QOQA 4ERGA 1V6WA 5FEZA 1PUDA 1V79A 3V1HA 4U28A 5K9XA 3W0KA 4GY7A 2VX5A 5SWUA 3G0SA 3GUWA 2QPXA 4ICCX 3W6LA 1PKLA 3KBWA 3PJUA 3G0UA 2QNEA 4FK9A 1TWDA 1W9UA 3BE7A 4AZGA 3KRUA 4A4AA 2HDJA 5I6SA 3HV9A 3W38A 2Z00A 1PBGA 3GG1A 3PTMA 1ZGDA 2Z6IA 1P1XA 1RQBA 1R7AA 2WSPA 1KD0A 2O9TA 3SRKA 5CCZA 3T0DA 5EMMA 2YFOA 3SQMA 2DORA 4IT1A 5KETA 3SIZA 1CGTA 3GNDA 4M19A 4C7GA 3NSMA 1W9PA 3P62A 5ABHA 2R14A 3OW1A 4Z1CA 2WKGA 3N19B 4L1GA 3ITCA 2IW0A 5HNUA 2OX4A 4M6QA 4PUNA 3H54A 1BTCA 4L4LA 3T0BA 5KEZA 1TA3B 2DT1A 5I03A 3GKAA 1JPDX 2R91A 3M16A 4DO7A 4LX4A 3VVGA 3VNMA 4LFYA 1UR2A 3WJXA 1I2PA 3A23A 1TMQA 3A24A 1GOMA 2QUVA 4OKDA 4IXHA 4R7OA 3B0YA 1FXQA 4EWND 3OA3A 1XG4A 1R85A 1L6FA 1UG6A 3O16A 3HFTA 2IMRA 5CXPA 1DBTA 2QJMA 3W22A 5FD0A 3TCSA 2XZ7A 4ORMA 2BHUA 2QDGA 1IHIA 3SSJA 4I9TA 1XLKA 3A4WA 5AHNA 4DUOA 2XYLA 1EUAA 2PDCA 5DANA 1NAL1 4JEQA 3ZLHA 3HB9A 3P7YA 4FA3A 3KOXA 2F9RA 4IISA 2FMOA 2YX0A 4ZFCA 1E6PA 4LEFA 4LPCA 3KOFA 1DYSA 2NV2A 4V27A 3QW3A 3FX4A 2J66A 2JFEX 3GVGA 5H8PA 3DKJA 4W84A 2Q8LA 4UTJA 4XZMX 5F1UA 2CLFA 1M04A 3E3HA 1Q5MA 3GM8A 1AL7A 1LG1A 1W0MA 2V0TA 3WEOA 1H2JA 3N29A 3DN5A 2PDWA 2RJHA 3LA4A 3P81A 4MM1A 4W7WA 4C60A 3BLLA 1Q6GA 1TB3A 3DHPA 3UY8A 3KOZA 3HQ1A 3OZPA 3GZAA 1SW7A 1T7LA 2R1NA 2VT0A 3FOKA 1FWRA 4ERIA 1OX4B 4R33A 1BRLB 1Q6EA 2WSKA 3TVAA 1RQEA 1JZ8A 4HGXA 1TJ0A 4XVEA 1UUOA 4AF0B 5BMXA 3K13A 3WBEA 2HVOA 3G22A 3TN6A 4YVXA 1WNOA 2X42A 1W5MA 1JQVA 3M6YA 4AEFA 1O6IA 2QCEA 4B5SA 4GIAA 4WJEA 4PZVA 3RNDA 3SADA 3MSGA 4XZIA 5ENLA 2WHLA 1TPB1 3S1UA 3TR2A 3FJNA 1KTCA 3CHVA 1LWIA 3C2VA 2IKGA 3ZS4A 3PB2A 2FHFA 3G3DA 3QTGA 4ICMA 1ZHAA 1OBAA 1OVDA 3SRHA 1O7AA 3EOLA 3LS9A 1DJYA 2VGIA 5A95A 3WLMA 2DQWA 3QHNA 5CSRA 1QI2A 1T8XA 4OUEA 3W7LA 4JN8A 2Q8XA 3GHTA 2VRKA 3WH6A 1J0KA 3O3RA 2H9AA 2AOSA 4E38A 1N8WA 1WAWA 4HSNA 2HE5A 3L7RA 3WEMA 2FDMA 2OTDA 4JN6A 4J3SA 1QHPA 3ANUA 3CBWA 4JDYA 1SM9A 2DPEA 2P0IA 4C90A 2OZ0A 1OT1A 4G8TA 2HRWA 4HHLA 3SRDA 4J2MA 1GZ1A 4NI8A 4U10A 1WDDA 3L2LA 4JKMA 2VR4A 3CGTA 4H00A 2PGEA 1K02A 2VX6A 5FJUA 1KXHA 4IIDA 2FB3A 1TTJA 4Z0JA 2V67A 2XIOA 2BY0A 1E6NA 2PDXA 4JX4A 1DWFM 2E09A 3SI9A 1F05A 1MRQA 1G4TA 3B8DA 3VTRA 2GK1A 2POTA 3GXIA 2ZZ3A 3T2QA 1K8ZA 3PK7A 2O92A 4Z1YA 2WJZA 1B3XA 1MXDA 1W3LA 1MEWA 4HPJA 2RAGA 2CESA 4GQRA 4GY0A 2IPWA 3ARYA 3WLKX 5A8OA 2CZ5A 3Q4DA 3CYVA 4I5UA 3LQGA 3MVTA 2Q3OA 3JU2A 5D04C 3O15A 4EE9A 1MW1A 2XN2A 2Z6JA 1FXPA 1XIIA 1VC4A 4MKNA 3L21A 5M03A 1NEYA 2XFWA 5CZSA 1G69A 1NWUA 2HXTA 4NKCA 1WDSA 1DPMA 1PDYA 2G41A 1W9VA 3RJXA 3TV8A 3POCA 4G2DA 1UKSA 1JCJA 4NL1A 4HPGA 4WVXA 2H9AB 2BOFX 5D03A 1OIMA 4BI7A 3BAWA 1V6XA 1ZY9A 5G2WA 3UETA 1BVZA 3F5LA 4OZOA 2VVNA 3M1ZA 2VEKA 1FTXA 3PZOA 4XUGA 1LUCB 3WH8A 4H8VA 1F9CA 2C91A 3WDJA 4LUYA 1YYAA 1QATA 4OE7A 3UWWA 3H7UA 3WUFA 1A80A 1XDLA 3EKZA 5CPMA 2WM1A 1P7TB 1KFWA 5EMYA 1XLEA 2FFCA 1OD0A 1JPKA 1FWAC 1ZBCA 1EGMA 1ODZA 3M41A 5BWFA 4C6KA 4RPPA 4TTUA 2YCLB 1E1CB 4KFNA 2WCSA 4IJBA 3CWHA 4M24A 4Z2HA 3GTHA 4XUYA 5A3HA 3MZ2A 2EPKX 4AWTA 2WSRA 3U57A 4Z2IA 1J0JA 3F4VA 3T81A 1V0MA 4B4HA 1FDYA 2C18A 4UWMA 3W87A 3KXQA 4M7SA 3KVJA 5KMYA 2ZXDA 1OC6A 3VKJA 1V3IA 4ZE5A 3SJNA 1TVLA 4ZQNA 3W81A 5EKYA 3FCPA 1JAKA 2VURA 3BAIA 2D2GA 2OZ3A 1ML1A 1TREA 2E4TA 1T5AA 1OFQA 1X6NA 4J3VA 4O1AA 3R0UA 2QCLA 3E6EA 4IQDA 1QNPA 2J25A 1EHNA 3CV6A 1TTPA 3AXMA 2PD5A 5E1QA 4MNLA 3WK3A 2NUYA 1XYZA 5AHFA 3ES8A 2IPGA 4PR4A 3A21A 3RLHA 3PN8A 3DBPA 4KH2A 2OPJA 4IL0A 2A4AA 4BI6A 3II1A 4PEKA 5HPCA 2V5CA 4DXXA 3NO5A 4PTXA 1HXJA 2NQZA 1PZ1A 4GYJA 5I23A 1DIOA 3A4JA 4IPNB 4WDUA 2DZXA 2AMXA 3TU9A 1GVOA 3T78A 2IS7A 3CMGA 2HS6A 2TAAA 5CPOA 2BFGA 3PUGA 4Y9MA 3QQWA 2XIIA 1OD8A 2ZICA 1TPDA 1X6UA 5CGQA 3UT0A 5FIPA 3RFAA 3O6DA 3EBVA 1UA7A 4XIMA 4UOQA 1J6OA 5GVJA 3BW2A 3EDEA 3TA9A 2ZRWA 3WF3A 1N8IA 3UF9A 2Z4GA 4PMUA 2ZX9A 4LEQA 4LYQA 1LORA 1RP9A 1XYCA 3L5AA 4ORIA 2PTWA 3NR0A 4KCVA 3SURA 3SGGA 7TAAA 5AHIA 4Z2KA 2PU1A 3TWAA 5CJNA 4FX8A 4WIWA 5DT5A 5BNKA 3BLDA 1R47A 2OSXA 2Y6ZA 3HG5A 5M5DA 3KTXA 3WQVA 2BNJA 2J6VA 4LCQA 2A7PA 1P4CA 4HOXA 5HDRA 3B0VC 1ZJBA 4NJIA 3GD6A 1KR0A 1JYNA 1U1UA 1DJXA 2ON3A 1CGWA 4MUZA 4EKJA 2ACQA 1W3TA 3IS4A 5LXXA 5HNRA 5BYWA 4DUVA 1X8FA 2Y8KA 3LLXA 3IACA 1O4UA 1IT0A 2GVGA 1XQLA 4B3LA 1OF6A 8TIMA 1A5NC 4ONVA 3AIRA 4MLRA 4B91A 3PR2A 3MUCA 1NTHA 1GHRA 2OO6A 2P8BA 5HULA 1TE6A 3FSTA 1W1TA 4J5NA 4WXZA 3TJXA 4HCHA 2JGQA 2QIWA 1KFEA 3N4EA 4N42A 4F0RA 3W1MA 1PHWA 2A0NA 4DXKA 4UTFA 4YTUA 4IG2A 1A5AA 1DXIA 2ZCGA 3QH2A 4E8DA 2CWXA 2OR2A 3VC6A 3H2EA 2BWGA 3TXVA 3IANA 4QG9A 4HYVA 1I0DA 2AKZA 3BARA 3DERA 1UD4A 3SCTA 1JYWA 3C2FA 3W1LA 2CLPA 4QE4A 3AI0A 3QFWA 2XTKA 1MW3A 3SGUA 2WWCA 4QP0A 3W24A 1W2PA 1JVNA 3GTIA 3QOKA 4BA0A 3CQHA 1EC7A 3N3MA 2DSZA 1ISZA 3V5CA 4UTWA 2VWSA 3W2KA 3E49A 1GHSA 2WB5A 4HSHA 3KWSA 2QCCA 4QIUA 2PP3A 3P2VA 2Z27A 2ISFA 4M7TA 3RXZA 1M53A 1OCNA 4JNYA 2D2JA 3GXNA 3OJGA 2Z1WA 2XSBA 2BY1A 4JTUA 2QGHA 4QG6A 1J6PA 4LV9A 3IVTA 2NQLA 1DORA 1R6WA 3EWXA 3BW3A 3DGBA 3W6YA 4D72A 1R30A 3P8IA 4HB7A 2PI6A 3CQIA 3W7HA 4BQ5A 4JHOA 2SFPA 3OODA 3MHGA 4F8XA 1CEOA 4UB9A 2P50A 1TWZA 3P60A 1Q65A 3BWWA 5H1WA 3W25A 1VF8A 3VGFA 1EBHA 1XR2A 3BCDA 2VJXA 3WF0A 3MMTA 1C92A 1GPFA 2EGZA 4JIRA 1VZWA 5I78A 4WUIA 2HZGA 3PPFA 4NAFA 3QV9A 4IP5A 4QSHA 4JFVA 3MP3A 3R5EA 4G7FA 2OZTA 2GOUA 4M6VA 2A5HA 3GTNA 3HGOA 4AZIA 1KNWA 1ZALA 2V3EA 1W6TA 4GQ0A 2BY2A 4KWUA 2G3FA 3OEXA 4N7QA 1JZ6A 4HMDA 1EP1A 1I2NA 4TO8A 2B4GA 3I4KA 2B31A 1EJWC 2YDQA 1KKRA 2G3MA 6TIMA 4TX8A 1VCGA 1TJRA 1R5YA 3F7JA 2F2HA 3BURA 3UEQA 3G1YA 4MWAE 5FAGA 5BU9A 3LPGA 3AHYA 5LYRA 1W3IA 4O0ZA 3VD7A 1XSIA 4NG3A 4UUIA 3NPXA 3VGBA 4NAFB 1VJIA 1RY0A 2PDKA 3GC5A 3FXGA 1JG9A 4PMZA 4H2HA 1PWLA 4JEJA 1VFLA 3LCFA 3TX9A 1RA5A 1E56A 1ZBWA 4FF7A 2E40A 4DZIA 1EOMA 3HQNA 3W53A 2NW0A 2J7HA 4UR8A 4JX5A 2VFEA 2YFNA 1JJKA 4JX6A 2C8NA 2WPBA 1YXYA 2V6AA 3EWDA 1F6YA 4AZ6A 1LZOA 4PUKA 4CQ9A 3SUUA 1DJQA 2CLIA 2VDGA 1JL8A 5D8ZA 1J0IA 3APYA 1HG3A 3VNYA 1OX4A 4NZ1A 3VIKA 1YNYA 2ALRA 4AD0A 3DYOA 2WZEA 3QTPA 5FOOA 3T2OA 4KS0A 3EB3A 4QM1A 3MA8A 2R1LA 1HKJA 5C7VA 2GQ3A 3WD0A 3F03K 3UZJA 2BXVA 4MDPA 5EMKA 4L4OA 2R1MA 5BW6A 2VOMA 1UASA 4KESA 3BOXA 2PPGA 3MMUA 1FCQA 3HA1A 1E6XM 4Z2JA 1W5NA 3WX7A 2XDFA 1KV5A 5HR7A 6REQB 1ADSA 4N9EA 1C93A 4Q7NA 4DI9A 3KZPA 1M7XA 5HWNA 4H41A 1LOSA 2D3NA 4AD4A 1WXYA 3EEGA 1Q2SA 2CITA 4MZ8A 3HV8A 2PWHA 4QNEA 1QDSA 3SM0A 4JFWA 1A5UA 3L0NA 2E6FA 3DUGA 2ZUVA 4HPNA 3T4WA 3VE7A 1GVFA 1E70M 3ORWA 1OCBA 2HCVA 2WWDA 2DU2A 4E3TA 2A6LA 1OWQA 2NX3A 4UQCA 4RE4A 4JFUA 3EX3A 4MNKA 1XYAA 1L6WA 1WE5A 2FTYA 3WF4A 4QS5A 2PP1A 4NVTA 1SR9A 2PLJA 1XIFA 3M47A 1C8QA 1Y7VA 4DF0A 2ISVA 3C0SA 1EZ2A 1OY0A 1TMLA 1KQYA 3WFAA 4GINA 3R6IA 1OGGA 4Q4KA 1ZB5A 3PF3A 4CD7A 1GZGA 1E72M 3N04A 3BG5A 4PMQA 4JDBA 4DEFA 1VCFA 2HVMA 1EXPA 1VPQA 4K36A 3SCNA 4L9YA 4WR3A 1XYLA 1BAGA 4W87A 1K6AA 3SN4A 1CW2A 1HJXA 4D6IA 1C8XA 5LA1A 5I00A 1R46A 1R2SA 4EXAA 1CLXA 4UMCA 4PCSA 5HR6A 4Y8EA 2DFAA 1O94A 3FYPA 5D8WA 3VGEA 2G3JA 5AHEA 5D32A 5HINA 1OFRA 3HMJG 2XSXA 3VMNA 1U5JA 5JIPA 4WDXA 3ZJ7A 6CGTA 3PTDA 3L5MA 4NYYA 1UHVA 2VFFA 4PUDA 4IMGA 2A85A 1Q13A 3UYCA 3A9IA 1OYAA 1MI3A 3LEPA 3M7SA 3UZZA 3W7MA 1X7IA 3HU7A 1DIEA 1BG9A 3LXAA 3N9SA 3BLKA 4B5TA 5EFDA 1JXKA 3KVLA 4WQ6A 4CU8A 5FL1A 4JTCA 1HQTA 4YLWA 4QJ3B 4GIYA 1UPPA 1EHAA 4E4UA 2V8ZA 3RMEA 3S42A 2PUZA 4O54A 4JGDA 1EIXA 2VEMA 4NZCA 3IRDA 4JTAA 1WP6A 3IIOA 3TE9A 1EPVA 2P53A 1DHKA 3OGSA 3E2QA 3GH4A 2PWEA 4AZ5A 3HG2A 3WD1A 4AY1A 2VX7A 2FH6A 1I2QA 3E9AA 1EX5A 4NZ5A 1B3WA 3CAKA 9RUBA 1AUSL 3DX5A 1IF2A 2G37A 3HQOA 3LHUA 2VTFA 4OV4A 3LHYA 2ZQ0A 1GVQA 3TJIA 1GWJA 1BF2A 2DDXA 1QR7A 3WQWA 1FWNA 3SQSA 1TPEA 4V33A 3UZXA 1S2WA 3WQOA 3AS3A 1LQ0A 4O53A 2F6KA 4UZUA 3URNA 4B16A 4WY0A 3PZGA 4LANA 3MANA 1B30A 5CC6A 1PCWA 2VZSA 2W67A 1Q6CA 1DWHM 1BSIA 1DWGM 2YCLA 3MCNA 3UZYA 3ZR6A 2R94A 1SZGA 3KBSA 4S3BA 3CV1A 5AOUA 1J12A 2Z7KA 1H7WA 1W8SA 2XVPA 3UWVA 2QMKA 4IGSA 4Q4PA 3D47A 4IX0A 4MNMA 4F4RA 1H51A 2RFGA 2VOTA 3PBMA 3PTQA 3IEBA 3R25A 2Y7GA 4RNHA 5LIYX 2INZA 3O1NA 5M2FX 3EGJA 1ICQA 3GS6A 4IMDA 5ABEA 4FOJA 5LXEA 1PZ0A 1ZU8A 5AB3A 5D9NA 5BWAA 1TV5A 1RJRA 2V5JA 3O05A 3N2BA 3QKEA 1XC4A 4HA0A 5IHRA 3XIMA 1H7OA 1WZLA 4GC3A 1VFUA 3ZT5A 3QQ1A 2OG9A 2TSYA 3TQPA 5A2AA 3LY0A 2VI0A 3RU6A 4DX3A 4QDMA 5E0CA 3BMXA 3LNPA 4NJHA 3UPMA 2G8ZA 4UNLA 2PB1A 4UR9A 4XTDA 3GW0A 2OT1A 1KM4A 4KFPA 1FBAA 1OADA 3DECA 2DZWA 3RF9A 4PUJA 1XFBA 1F3TA 3I3EA 4IP7A 4B3ZA 3FVDA 1MSSA 1V03A 1EDQA 3UFYA 5A6MA 3P80A 2X1TA 3WD2A 4IFKB 4FB7A 1TYGA 1T99A 4I8YA 4ML9A 3PFRA 3IJ7A 3T40A 1H50A 4JIIX 3GDRA 4EOUA 1OX5A 1K8CA 4QISA 1UZDA 3A22A 3U3HA 4HSOA 1C90A 1J0YA 4LB4A 4HU8A 3YPIA 4DLMA 4Q4QA 4Q7IA 3T7VA 1JRCA 3OGVA 2PGFA 2PLMA 1KBJA 4ZQRA 4A8NA 4JTJA 1ENUA 3BV7A 2TYSA 1ONEA 1YRRA 4FXSA 3CPGA 2QJHA 2G3IA 3DESA 4UTKA 2A3CA 1R3RA 1WOBA 4FX7A 4IUGA 3RRXA 1ME7A 1CNVA 4C1NB 1QI5A 3R13A 3VX1A 3TMQA 4AYGA 1JQXA 4DI8A 3B9NA 2G3NA 4HCLA 3LX9A 2J7EA 1S39A 3DFPA 1H0IA 2PWGA 5M3WA 3CLMA 2VC5A 1JUEA 1FWCC 4ZB0A 4KERA 3H7VA 5CLWA 2XVKA 3T55A 1BGGA 2TMDA 2GLKA 5BU6A 3UG4A 4S3GA 2HSAA 4JY9A 4XBJA 2WVUA 2ZZ6A 4PC8A 4D1JA 3GX9A 1W9BM 3B0XA 2ZRZA 4D1IA 3DHFA 4FX6M 4UCGA 3KRZA 4EIVA 2F8QA 3HGSA 1KFCA 3V16A 2ZX8A 3RO8A 1EJUC 3DFOA 4WSKA 1G4SA 3OYZA 4UTLA 5MKGA 5LNUA 4PUWA 1RZMA 1WDQA 4ENLA 2HROA 3W23A 6TAAA 2XH0A 3S6DA 3WBAA 2P5NA 5DFAA 3SCPA 4TX6A 2WHKA 3LHWA 4PB5A 3IJ9A 3VDAA 1V3KA 1FDJA 1Q4NX 1VAHA 3OTRA 3IPWA 4AEOA 2TODA 3MVIA 3IVUA 1AK5A 1PTGA 1OYBA 4BZYA 1IEQA 3W1XA 1SU5A 4IZGA 5T91A 1F07A 3GFZA 3JVAA 2C15A 4GBDA 4GXPA 4J35A 5AC5A 3W1AA 3WQFA 3LYEA 4PMXA 3QLLA 1W9XA 4J3UA 4H8UA 1LJYA 1UJQA 1MNZA 3PUDA 3DDMA 6PTDA 1BHGA 4Q8PA 4XD5A 2NLIA 4EXQA 3VKKA 4O16A 3WNKA 3QYQA 3WF2A 5AC7A 3B0UX 2AGKA 4MSSA 4AIOA 3CHCA 3VD3A 5EYWA 1EPXA 3NL2A 2OLHA 1N8FA 3APTA 4XAZA 4A6GA 1XS2A 3M5ZA 3LN3A 1W37A 4GX8A 1XFCA 2RKXA 4IX2A 2WMFA 4H9YA 4O12A 3M5VA 5B80A 3RR4A 5BRPA 1VS1A 2BSLA 3VK5A 3R2GA 2QCFA 1U2YA 5C0QA 2V63A 3GG0A 3EAUA 4AB4A 4NAEA 2FZ9A 2VC9A 4QLLA 4JFTA 3PM6A 1SYTA 4LTSA 1JCXA 5A8NA 3W7JA 4OUIA 4OIFA 4RJEA 1V0NA 1AA1B 4BR1A 5MKGB 4US6A 3IRSA 3S6OA 4B9YA 3MP4A 3UERA 5BOFA 4XKYB 4FSAA 5JXQA 4GNJA 1BQGA 2VRQA 3ANYA 1NDWA 1FCVA 1E6SM 1YDYA 1X98A 4O8AA 1BPLB 1D8WA 1CXLA 4DQWA 2O9RA 4S23A 3B0PA 2Y7DA 3EPMA 1DP0A 5EMJA 4ZB2A 2O4QA 4LC8A 2I5GA 5HBFA 5AFDA 1BWVA 2RDTA 2ADAA 4HTYA 4PGLA 4GFIA 1QT1A 3WLOA 2FTPA 3P0XA 2WMIA 2XIMA 4XO6A 1PZ2A 1IIGA 1BQCA 2RDXA 4C6IA 3GNOA 3RUBL 4QQ3A 4ML4A 1THFD 1R87A 4TTGA 5FJJA 3PZUA 2BBFA 3ZWTA 4HZ6A 4BY3A 1VP5A 4XAYA 3NNTA 3DBNA 4CQ8A 2G4FA 4U2YA 3ITGA 4KFOA 5T26A 3STFA 1N7KA 3W1TA 5CBJA 2I57A 1YTKA 2OJPA 1L6YA 1VIWA 2YCIX 2HXUA 5G1MA 4AVOA 1Q6DA 4RDVA 2OVLA 1SJCA 3TFXA 1E4IA 2WHJA 4H9UA 3GBDA 1NM9A 4OFCA 4CEXC 1JF6A 1UH4A 3E1F1 4ZOCA 4EF9A 1ZCOA 4PN2A 3PZNA 1B9BA 4RLIA 4UQBA 3F2BA 1E0WA 2ACUA 2VZTA 2OXNA 4LQ1A 1B9ZA 3CS2A 1PIGA 2WKLA 9CGTA 4X61A 3KDNA 2QJGA 4JNZA 1K6WA 3UGVA 1W91A 2XG9A 3SQLA 4KEVA 3WZ0E 4GBUA 1ZJHA 1K7FA 3ISIX 1Q66A 1ME8A 1IT8A 2CZFA 3WLQA 2J78A 1DKWA 4JICA 4PBGA 3TKFA 2EJ1A 4MLJA 1KM2A 5DMNA 1Q6QA 1XIHA 1QPKA 4UFHA 4N4PA 5M1TA 2BS9A 2UBPC 4O1CA 2CBJA 4POCA 3VOCA 4LUSB 5E0KA 3PC0A 1R38A 7REQB 3TYUA 1QOXA 3MWCA 3TTQA 4QTGA 4AUBA 3TNBA 2RGLA 4C65A 2G5WA 3OHIA 2QAPA 3RILA 4A2SA 1RCXB 3M7WA 1UR8A 4QCEA 1XRVA 3W4RA 4GXMA 4DJFD 3KP0A 4IFOA 1UD2A 3MHFA 4JIHA 3UG8A 2PE4A 4XK2A 1UOKA 3DI0A 3WNLA 4K6AA 1UKQA 3VCRA 4AX6A 4P7QA 3ABQA 3CIXA 3SCQA 3VCCA 2JF6A 1KXTA 3CM4A 3TZNA 4Y96A 5KZDA 3U8GA 2CHNA 3V0UA 5U4NA 1RPKA 5CEWA 1FQ0A 1JULA 1E5JA 3GH5A 1M9HA 1DEDA 4NYUA 1VJZA 3B9EA 3NZRA 2HNHA 3UCQA 4MDOA 3NQBA 2R1KA 1S5MA 1J2BA 2OQHA 1E0VA 1G0CA 2W63A 1XGZA 2YZ5A 3CUFA 1GVYA 2EPNA 1NARA 4GG9A 3PP7A 2ICSA 2WZTA 1KCKA 3HPSA 3QPYA 3W7KA 2VEIA 4MB4A 4OOUA 4PB4A 2NUWA 1RLCL 2WMKA 3DAQA 4RZ4A 1IXOA 4LVFA 2OFJA 3I6RA 2DT2A 2O9OA 1UR4A 3NQFA 4UNIA 5AN7A 2NQ5A 3CL8A 1BFNA 1QOPA 4CD4A 4L7ZA 4HMNA 4GYKA 3AQUA 2XIQA 4I6KA 4CN4A 4E4PA 4MJZA 1MO0A 4LUJA 1S2CA 4BWLA 3I65A 4ACYA 1CCWB 1REQA 3WSUA 4ZODA 4H8NA 4PRWA 1E0UA 2BTMA 3L12A 1P0BA 3VUSA 3W1QA 1HX0A 5FF2A 3O7UA 4HHHA 3NYZA 1JZ2A 1F2JA 3G6MA 4ADSA 4ZQCA 4Q6JA 5FEXA 3QV6A 1MZRA 3RLUA 3G0XA 1JDAA 4Q4OA 4F0KA 4GUGA 3ELFA 1GZJA 3TTYA 2CZEA 1S46A 5LA2A 1AJZA 3ZJ8A 1LBFA 3C8NA 3NEHA 4LU0A 2V9DA 4GC4A 2FPVA 2HBVA 2OLSA 4KRUA 4Z1AA 1V3LA 5LZLA 1UC4A 3UY7A 3TYDA 3LBOA 4YYFA 2PF0A 1F4AA 3QN3A 4PMJA 1NDYA 3VFCA 2XIJA 3GDLA 1GVSA 1L8PA 4IPPA 3C8FA 1XICA 4PMNA 5E9AA 1Z41A 2WLYA 4GYPA 2A2IA 1A0EA 4DF2A 3B03A 1W54A 5CQ1A 4FOKA 5IM51 1E6QM 3B9OA 4Q33A 1EA9C 1P6BA 4CNNA 1ZP3A 4JQ1A 4S3JA 2WJFA 1W9DM 3BLFA 3INPA 1GTEA 5DCBA 4UMAA 2O7QA 4IMFA 2VVSA 4J9JA 2X7VA 3W73A 1P5BA 4RE2A 2XINA 3TN4A 2B81A 3W01A 4GNVA 5B7YA 1XC6A 4ZVJA 4GGBA 3KZSA 3LRLA 3NVTA 3NQGA 1YDOA 2JIEA 4O8RA 1HFBA 1JR1A 1TA3A 2HJPA 3U2CA 1LLWA 2WO5A 3MDUA 2GPTA 2X0SA 1M5WA 1MMFA 1O60A 3A13A 1IXPA 3QR3A 7ENLA 2WJEA 4KRZA 3C0LA 2Y24A 4IFRA 3UJFA 1HW6A 3ZXWA 3LGGA 3BOLA 3JZUA 2Y5EA 1AMKA 4DZHA 3F4DA 3MMWA 1G5AA 1A5MC 1QHZA 3CO4A 1RPXA 3BANA 2PCEA 1FHLA 1ZFJA 3N4FA 4IPLA 2GVYA 1QRQA 2CBVA 4H7VA 4PTDA 3Q67A 4XX6A 3KVMA 1LT8A 3H4GA 1MEHA 1FHVA 5CZ0A 3KCJA 2HISA 1FFRA 4CEUC 4K1WA 4LY4A 4WKHA 5DY2A 1A53A 3SDOA 2VZOA 4TVUA 3AWOA 5KZEA 3V0TA 3UJRA 3S2MA 3A5VA 5IOBA 4ZMGA 1JUBA 1CXIA 3VU2A 1W1B1 2FGBA 3MMDA 3QMSA 4JTKA 3N3TA 3CQ0A 3G1DA 1FKXA 4XBSA 4AIUA 3TR9A 1KWGA 2XWEA 1W3JA 4PFHA 3N9KA 2E8YA 4TV6A 2UV8G 1UUQA 1JGIA 1W1YA 1A3HA 5A6LA 4AWEA 1F73A 4IOTA 4KWOA 2WW5A 3KHJA 1ZL1A 1SQ7A 1QPQA 4Q8VA 1AW5A 3CV2A 4N6FA 1VFFA 4NU7A 4PODA 3ARRA 1NF7A 3LOTA 4TQTA 4KWVA 3BJFA 5FCZA 3CH0A 4LVDA 3L4YA 1WKDA 4JL1A 3LCIA 3U0HA 1TRDA 1VFSA 2DZPA 3CUGA 3SGZA 1M65A 1Q6LA 2D0FA 1NFBA 2F38A 1HTIA 4D8AA 3TN5A 3BTNA 1J93A 2PTDA 1YBQA 1ZNNA 4HNOA 3QM3A 1V4YA 3GLCA 6ALDA 4NAEB 3N11A 4GO8A 3RRAA 1E6ZA 1LQ2A 1E4LA 1XLLA 3H4XA 3VZYA 1XP3A 3VD5A 2WSYA 1J0HA 1JIBA 1BXCA 4IQEA 5TBOA 1TZ7A 4PEEA 5HMSA 1K9EA 3FXYA 3QGKC 2AQWA 1BYAA 3ABSA 2O7SA 3MYPA 4HQVA 5AYYA 5DCEA 3WMLA 4MWAC 3CZJA 2I14A 5LHFA 1TV8A 3P61A 4TUFA 1LP6A 2CYGA 5A8MA 1HJUA 2Y8VA 1IYXA 1OGBA 5HUOA 3UCCA 3MV01 3W1RA 5IHSA 1Q8JA 2O0TA 1LL6A 2CLHA 1ZCCA 2DSWA 3UNTA 3O06A 3KHDA 1JF5A 3BZGA 5PTDA 3HMCA 3EMQA 4NQ1A 4HJWA 3TROA 3GG8A 4GI4A 1GJWA 3WMCA 3MJYA 4OTKA 1ITXA 1HT6A 2YA1A 2EG7A 1SFLA 3MV11 1GYNA 3IUDA 1VFMA 1HGYA 2OEKA 3S6TA 2FQIA 3UWEA 3LB0A 3AMCA 4WK9A 3DOPA 3GXPA 4H9MA 2DQXA 1QAPA 3E2SA 3R0DA 3GR4A 3UWZA 4E0CA 2GFTA 5T8GA 3LRKA 1IWAA 3GDKA 4RL3A 3NQDA 3WH7A 3S2LA 3ARQA 1RBAA 3A47A 4C1LA 3WLTA 1GQKA 1OK4A 4A8IA 1WV2A 2O56A 3QY6A 4DBUA 2CFFA 1OB0A 2QCMA 3PJWA 5A6JA 4JTLA 4KWWA 5CLTA 4D8ZA 1R86A 2LLEA 2GVJA 2W61A 2E77A 6XIAA 1EOKA 3R58A 4BF9A 4H01A 3TLLA 3AO0A 5H2ZA 1H49A 1R2RA 1XD1A 4IGMA 2A79A 4IMCA 2XN1A 1UB3A 1GW9A 1BYBA 2CLLA 3FHAA 1EF3A 1FCBA 3N12A 1HKVA 1TRIA 3FK4A 3UWYA 5C7HA 3I7QA 2WC4A 3PNZA 3S46A 5BXPA 3SY1A 3BL3A 3LLFA 4K39A 3WNNA 3AC0A 4AYSA 4WLCA 2E8ZA 1WDPA 3L5LA 1VJSA 3PWGA 1E55A 4QDWA 3AMLA 2RH9A 1ZZMA 2QLYA 5I5RA 4R5EA 3U7BA 2Z1BA 4PMVA 4B90A 4YU1A 1VLWA 3NO3A 4X22A 4MZ1A 5I24A 1ESWA 1HL8A 1HZYA 3FS2A 2PWFA 2QIIA 3BLPX 3MDWA 2QF7A 1ADOA 3LGEA 1NDVA 4S2BA 3LENA 3CPRA 3M0XA 3WN6A 4P8WA 2XM2A 1F6PA 4LV4A 1GCYA 1YADA 3S5YA 4DWSC 2Z7GA 3W86A 4FXRA 5D2TA 3V18A 3QSTA 3LTSA 3RX3A 1KBBA 2IPFA 4MY9A 1QTWA 2A3EA 1QVBA 1LRNA 2RGMA 3JW7A 1V3HA 1VBRA 4K8HA 3APGA 1GG1A 1G7UA 3CWNA 3GNXA 2AL2B 4ZGYA 2PTYA 4JYDA 2ZTJA 4HNTA 3XINA 4C6PA 3Q45A 4XZHA 1PWMA 1X38A 2FTWA 4O52A 1GOWA 1JD7A 2F61A 4NSBA 5MHBA 3LBCA 1ALDA 3BAYA 1ZSXA 4REQA 3UPWA 5JVLA 1YHTA 2OOGA 1WO2A 3MUZ1 1IR2A 3LMZA 5BXSA 4GZ7A 1HVXA 3RG6A 4Z42C 1F8MA 4IIGA 2FGZA 3THQA 1J5TA 4JTSA 3TSBA 3NTYA 2C16A 3GAYA 4I90A 1FP9A 2O9PA 4JTRA 4NASA 2XH2A 1YEYA 4K68A 2GDUA 2VFIA 3CUXA 4I9AA 1TE1A 4Q3MA 2YCKX 1Y5VA 4GACA 2YL6A 4ZO8A 1V7YA 2QUNA 1PX3A 3L2MA 5IXEA 3NQMA 1FOBA 4NX0A 4FR1A 1I2OA 1LDCA 4IWWA 1W1IE 2DSVA 3EXTA 2PDMA 3ITLA 2Z1SA 5DT7A 3MKCA 5AY7A 3LK6A 5K2ZA 3FA3A 1RCQA 3VIFA 1QNRA 4GUJA 1BRLA 2AAMA 2ZFAA 1Q45A 2NLYA 3QV8A 3WQPA 2HK0A 4QDPA 3WD4A 5C2GA 2FGLA 1ZENA 3TOPA 2PDJA 2GQAA 2GVLA 4PMDA 4OJYA 1LWHA 1SZEA 1OFBA 3W1PA 5I3HA 4XZLX 3IUHA 1L8NA 1NOUA 3ECQA 1WPCA 2MUCA 2Y7EA 3NDZA 3IIPA 4MVAA 4FF5A 4HU4A 2J8GA 4U2ZA 4F2BA 3HF3A 3MKKA 2XU2A 3CLWA 2OGYA 2IUZA 5A6TC 2B7OA 5LSMA 3THAA 2BOGX 2D0HA 3WJYA 2ZVRA 1UBSA 2YCEA 4FLOA 4WKAA 3EX6A 4I7WA 3T9PA 3VMOA 3VAVA 3E2VA 1UUMA 2VMFA 5K9CA 3WCZA 3THUA 2FH8A 1PAMA 2ZWZA 3LZ5A 3R12A 2QULA 3M0VA 1OC7A 5DXYA 4HP5A 4Q4SA 2X8RA 3KL5A 5J04A 2IKJA 2HS8A 1OM0A 4FI4A 1E3ZA 4FIQA 1O5KA 5D02A 4DJEC 1IT7A 2FZ8A 3K30A 1REQB 5CC5A 3EX1A 3IUIA 2A7RA 3LDVA 2QYGA 3ARZA 2GVEA 4H9TA 5F4WA 4X0NA 2B0MA 3AIEA 3QR0A 2E9MA 3LV6A 4E6MA 3G8RA 3CK5A 3EPOA 4DWSB 5IBXC 5HQEA 4DXVA 5I77A 3EA2A 2JGYA 4XAPA 2D3LA 1PSCA 4P2VA 1HUVA 1DJHA 1ADDA 1GG0A 3F5JA 1UKTA 1GEQA 2NWSA 1KBLA 4W8LA 1Z6KA 3OZYA 2CKRA 3V4BA 3T09A 3WY1A 3CJPA 5CAKA 4LOCA 2DZTA 4ASTA 1G4PA 1EWEA 3HZ3A 1KBIA 3LV5A 3H22A 2ISSA 4AVNA 3N34A 4HIBA 4ATLA 2GJNA 3GXMA 3R79A 3OVQA 2XUCA 2OGJA 4OECA 3L66A 1KM3A 2YDSA 3DC0A 1UWSA 3CZLA 3GE7A 1VENA 5HAOA 3AYRA 4R85A 4GI8A 3A3HA 3E74A 1J9YA 3MW7A 4LYPA 1GVIA 3DHDA 4L80A 5CZTA 7PTDA 5CSYA 1GT8A 4AD2A 2WQDA 3TONA 1ITQA 2ACRA 3DC8A 1A50A 4D6JA 4B3KA 4DJDD 2Q71A 4G5DA 1IV8A 4LALA 3RJYA 3LI0A 1R8LA 1ICSA 2R6OA 3VNDA 1PZ3A 2WPGA 4W8AA 4XWUA 4CNTA 1LWJA 4WGHA 4DPQA 3NZPA 1VCVA 4JPGA 5ECVA 4W88A 3S5NA 3UA3A 2AL1A 2GGEA 4K7VA 3K8LA 2FIQA 4H9XA 4JXCA 2YBUA 3PBVA 1TG7A 4W86A 3E0WA 5ABGA 3P3BA 2X1IA 4KKXA 1UJPA 2J77A 1XLIA 4GKTA 3NPUA 1HJVA 3C3UA 3FLUA 1QI4A 3LGDA 1TTIA 3NL6A 3OVGA 4I9MA 1FWDC 4DBWA 1EDGA 1S2TA 2BB0A 4D71A 1ODUA 4GCAA 2DV0A 1UD6A 5AZ0A 5D37A 1VBGA 3MBFA 3OOQA 4P8XA 1FX6A 2MNRA 3W84A 3VABA 2OMAA 2XFRA 2D1ZA 3BAXA 4IL2A 1UQYA 5FEPA 4US5A 2C3ZA 4ACZB 4CN1A 3QBUA 4GVIA 4S3DA 1OZMA 3BMVA 4HHMA 2X1UA 4O1BA 1FHUA 1SZNA 5GNXA 1EFZA 1SW3A 2DUZA 3GXFA 4ICNA 3ZIZA 3NPWA 2WQPA 2ZZ4A 3GH7A 2VZUA 5EL1A 2PDFA 3HFYA 4JQAA 5U7SA 2VFHA 1KBKA 3WNMA 2QHAA 3W76A 1RAKA 4GIRA 2PDUA 3NZ1A 4AMCA 4D6EA 1Q6FA 1BF6A 2VL4A 2ZBTA 1IGWA 1XBZA 3IJ6A 3KCLA 4RZ5A 3G24A 4J27A 4RK8A 3OGRA 3GB6A 2ESCA 1J2WA 1R3TA 2ZDRA 3KRBA 1XPYA 1ITCA 5HJYA 5K7JA 3SRFA 4EPKA 1SFSA 4KQNA 1XBXA 2HPIA 1DJNA 2VGBA 2VO5A 5AKQA 1FHDA 1P43A 3PJXA 4JD4A 3SUVA 4AVFA 3LTYA 4FNQA 1LBLA 4Y6GA 4IIHA 1K7XA 1K7EA 3MT1A 1KM1A 2G95A 4INFA 3R94A 2OYMA 4WOZA 1Q7ZA 4NZ3A 3B9DA 2WJDA 1TPH1 4KCWA 2NVDA 3AXXA 1KXVA 3DXIA 5REQA 4AC1X 1QI3A 3SFKA 1QNQA 1XLJA 4GO9A 3WKZA 1OC5A 4IHCA 4AWUA 1RK6A 3B97A 4PTNA 5EY5A 4P7RA 3TIMA 4L4MA 3R1ZA 1HKWA 4HK7A 1MQPA 5CPNA 4FPSA 3HBLA 4GI9A 4YN5A 3N2TA 4JQ2A 2W27A 1EGVA 2W5FA 2JKAA 3COTA 4ROQA 4B15A 3LM7A 4JOMA 1J10A 3TA6A 3MPGA 1QNOA 4AF0A 5CGTA 1SJBA 2WNWA 4YWSA 1KC7A 4XSLA 5HNTA 4QAWA 2OYLA 3AWNA 3M0MA 4OOZA 3VIGA 3EDDA 3UXAA 1NVMA 4A8RA 5DO8A 5CG0A 1IEIA 4CU7A 1KB3A 2QKFA 4TMCA 4UTTC 3ITOA 5T9CE 4AISA 3FVMA 2OSYA 1TVNA 2A7NA 5HNNA 2XGBA 4D6FA 4MAVA 4NZ4A 4AH7A 3B40A 2PMQA 4WRHA 3DCPA 2YL5A 3SUWA 2E0PA 1Q2RA 5FA5A 4FIRA 1XBYA 3IARA 5L6UA 4BQ3A 2P0OA 5A8QA 3FNDA 3VIOA 4X2RA 4DO6A 4F9DA 5AECA 1U1HA 3PJTA 4GGHA 4H6EA 3PZIA 1P6CA 1QUMA 1CXEA 4KPLA 3LPPA 4EAMA 1AMYA 5FJPA 1MUCA 2YDRA 4KETA 3BLIA 4AC7C 1B4KA 2AMGA 4J1OA 1DIKA 4DPPA 3T0CA 2Z2BA 4M8UA 5F2LA 3TYCA 2NQHA 4M1BA 2QVHA 1E9ZB 1K9TA 4B5UA 2Y89A 1V6TA 1UWTA 3KEHA 3BSMA 1FWHC 4A2RA 2BGSA 3BCJA 2PRLA 3T8LA 1S2VA 3EB4A 5H8MA 4O15A 1I2RA 3HGRA 1Z42A 1XCFA 2EG6A 2P3EA 2VZVA 4H83A 2CWNA 1DVJA 3P14A 2PDGA 2ABAA 3H2FA 2I1OA 3STGA 4DO4A 4P8UA 4S1FA 1IQ8A 2VRJA 3DEQA 3QQ0A 3UZ5A 1XKYA 1F76A 1NIUA 1R3YA 4KEUA 4MNJA 1E0XA 1AQFA 3MI3A 2V5LA 1ICPA 3KVKA 4MB5A 5DX7A 4ALDA 3WFLA 1XV8A 4JYFA 3RGTA 4H3DA 1Y8BA 2FZDA 5DXXA 1PYMA 3M0ZA 3CMJA 1PKYA 4DBSA 2NT1A 1UR9A 1O1HA 3E0VA 2IPJA 3E0LA 3EWYA 4LW7A 4D2JA 2WMJA 2GJXB 4WDWA 2PGWA 3MCMA 2A1YA 1O12A 4E3VA 5C54A 3WLPA 4FNTA 3IGHX 4IMEA 4C6MA 2BMBA 3QGAC 1EO7A 2YW3A 4CCDA 1XM3A 4B5VA 1O5QA 1XLGA 3F2CA 3AS0A 2VD8A 5TAOA 4CD5A 2WNQA 3EOOA 5LGXA 4JIQA 3UR2A 1X8CA 3P6LA 4R9OA 3DKLA 3XISA 3GR8A 3UPBA 2OWCA 5J5RA 4BQ4A 4FNRA 4PCPA 1O1ZA 2BY3A 3WQGA 3GNPA 4AXKA 2W9MA 2YBVA 4YTTA 3CB8A 1D7KA 1PJ9A 2GUUA 4MJ2A 5H8UA 4N6EA 1QXLA 1US3A 2YZRA 4IQJA 1E9YB 1RD5A 3HPFA 3W7NA 1DWIM 1AJ2A 1FDZA 1MFUA 3D3AA 1R0MA 4PTWA 4REQB 4XBKA 2QF8A 3M64A 1FCUA 4Z17A 4LXFA 3M46A 4C7FA 5FJRA 3JRKA 3S1VA 1AQMA 4DWSD 3BK0A 1OGSA 1PB0A 4QLKA 1RLDA 1TPUA 3MKVA 3W7PA 5BOOA 3SCRA 3VIJA 5A6KA 3AZRA 1M01A 2XVNA 4IG2B 1GKPA 1HKIA 4GVGA 2CZDA 3RO6A 3UJSA 3KTCA 3BG3A 2CLMA 5D9PA 5AC8A 5EFFA 3CAWA 4BS0A 3EWZA 3VOIA 1PCKA 2E68A 5I3FA 2WVSA 1OINA 1B3VA 1YQ2A 4ATDA 4GYPC 4S3EA 3M07A 2VNCA 4LF1A 3DU0A 1V8EA 3A4XA 2ZDSA 4AZBA 3DFHA 1H1YA 1Q85A 1SSDA 3QYSA 3G3MA 2BX7A 3P82A 2YXXA 4AAJA 2DIEA 3AROA 2DZUA 4W85A 3AICA 3NQAA 1LRTA 2OWWA 1SR0A 1JI2A 2DT3A 2VQUA 4H6RA 3KRSA 2E6AA 3UNDA 4HOZA 4WEVX 3WJWA 1J79A 4GX9A 3QEZA 1FWEC 2J79A 1J0ZA 2ZUTA 1HN1A 2R1PA 2CIPA 3I7SA 4AWSA 1RVKA 2V5DA 3L4UA 4QE5A 3W71A 4GQBA 1OCJA 1FY6A 3LXCA 4F0HA 3WK2A 1G67A 1GYLA 1JFHA 1DXEA 4BWLC 2UY4A 1WDWA 2W6RA 4Q4RA 2PF8A 4FAMA 1JDCA 3L0KA 3OBAA 1US0A 3GW3A 3ZVIA 1IWPA 3TH6A 1HKKA 5DMYA 1UP2A 5G5IA 2ZE0A 3DFNA 5KZMA 3BW4A 1OEPA 4OGZA 2PP0A 2YPIA 4C6BA 4R53A 2PODA 3SEPA 4JIEA 5D2YA 2Y2WA 1NOFA 1SMDA 2C19A 1VYRA 3M0JA 2BASA 1KM5A 4YPJA 2OSWA 3RCNA 3MY9A 2TPSA 3LPOA 1GVEA 4EPBC 5DELA 3DIPA 1TVPA 4KMQA 2D69A 2YLAA 3N1AA 4S3FA 4B2DD 3KBJA 1U30A 3EKLA 4XD3A 4FZIA 4U4MA 5I02A 3SZ8A 2JEQA 2AQVA 2PTXA 1WB0A 4LBRA 3BAJA 3VDGA 4KIRA 4S2CA 1N2VA 1LLZA 2KX9A 4E2OA 5AYBA 3R8HA 3GTXA 3OQEA 1PPIA 4CU6A 1J18A 2WNNA 2OT0A 4PTMA 3C2RA 1WZMA 2NVCA 4OBSA 2VC6A 2BP1A 1VR6A 1E43A 4ZO7A 1QMLA 2QV4A 3BJSA 1VD6A 4MZYA 4W7VA 4K37A 1BLIA 2Y85A 2QDEA 1CECA 4B4FA 3TN3A 1GQLA 1PS9A 3EEZA 3ZSSA 3CT2A 4GJIA 2PDYA 1JZ5A 3BLEA 4NRRA 2H8XA 2EO7A 5FL0A 3HG4A 4WJ8A 4DM1A 5FACA 3C52A 4AZ7A 1P1MA 2PDIA 1CGUA 3LXBA 2Q8ZA 3OIHA 1XIMA 2QJNA 3ABXA 2BZNA 3FV9A 1QBAA 5T9BG 1H62A 1P48A 1TPC1 3C5QA 4UNKA 4D6HA 1WBHA 3SIMA 2DH2A 4WCJA 1EYEA 3J7HA 1UBPC 4DYJA 2PRHA 3AHVA 3AYSA 1TCMA 4HCDA 1L6GA 5I09A 3PAOA 3MUY1 5C71A 2H90A 1GOXA 1E1EA 4XISA 1F3EA 4FMVA 1HP4A 5K9DA 3F4CA 4DBEA 4XB3A 3AOFA 4YHEA 2VXNA 1GKRA 2DP3A 4JTIA 1H5YA 1MDRA 1IGSA 4DRSA 3LQLA 3SB0A 3NA8A 4TV5A 1F3WA 4RR4A 3CTTA 1MXGA 3PBUA 4ZCWA 3W2JA 1L9WA 4NZFA 4HT3A 3S3GA 3E12A 1BWKA 3N73A 1E3XA 2P8CA 3KM8A 3CB3A 2R24A 2GWGA 2VC7A 2DVXA 3L4VA 1L0PA 3HN3A 3WMSA 3KWXA 4W8BA 1XH0A 3B3DA 3GUGA 1GJPA 2D22A 1EEPA 3GG7A 3SBFA 3W27A 4KW2A 4A3UA 1WXZA 3UESA 4BEQA 3GIPA 3MQTA 4DM2A 5ABFA 4HBKA 4CD6A 3TNOA 2ZXBA 3FEQA 3PWAA 4O0KA 4QS6A 3G2GA 3W7OA 4G7EA 4MOZA 4GXWA 3VNLA 4ES4A 3EA1A 2O4MA 2QXWA 5G2IA 1EJVC 1F74A 1UMYA 3EPNA 3NOEA 3VXGA 5F7UA 3KS5A 4JCMA 2D23A 4PFMA 1ZAJA 3BVJA 2CXEA 1N55A 5REQB 3K8KA 3LUTA 2NV9A 4HNLA 4EANA 2NX9A 1G6CA 3E5PA 4G56A 3DENA 1BEUA 1B1YA 5D9MA 1V3JA 2VCCA 3AYTA 1SSGA 3CT7A 3CWOX 5G4HC 3NEVA 1RK5A 3GXDA 3UZWA 3DG3A 1V08A 3ANVA 2REQA 2CNCA 3T42A 2OODA 3CEPA 1LG2A 4GKLA 4CGTA 1ELSA 1CDGA 1TQXA 1RSCA 4M51A 1H7NA 4H7ZA 1A4LA 1RY8A 2Y0FA 5JUVA 3UYIA 4JS3A 1LTDA 1ZAIA 3C4UA 3G6LA 3NDOA 2XPKA 5IFPA 4UTWC 3HGJA 3VMPA 3C3NA 4HA3A 1GOQA 1UD5A 4YVVA 5JH2A 4GHRA 1Z7AA 4JYEA 4E8CA 3QOMA 4BJHA 4I9JA 1A4MA 5HUPA 2C1GA 3R7MA 3BO9A 5HANA 1LOQA 1OG6A 3ABZA 2JE8A 1Q6OA 3BJTA 2EKCA 3DYPA 3RPDA 1RJPA 4LBSA 4CQCA 4MYAA 2I9EA 3AIWA 1DE5A 4AX7A 4V15A 4MFEA 2X30A 3CHEA 2XZ9A 3UW6A 3AHXA 2QCGA 3ZMRA 2I17A 3NJ3A 4XD6A 2HEJA 1UMLA 2FVMA 4PBFA 2G96A 2IKHA 3LM3A 2GSHA 1EWDA 9XIMA 1AQHA 3ARPA 3LPFA 3K2GA 1UP0A 3H26A 4IICA 4G9PA 1EJRC 2EPHA 3P8JA 3WJZA 6XIMA 2H3BA 3QHOA 2WOQA 4LB3A 2QMJA 3IGUA 1M03A 1QPRA 3N18A 2QPUA 5FKYA 3O07A 3C6CA 3L4TA 3TTEA 2UZ9A 1VB9A 3MSRA 4HN4A 3NM3A 2V2HA 1QNVA 8A3HA 1JZ4A 4S3KA 1BXNA 3CASA 2PWVA 1QO5A 3VC5A 5BRQA 1XWYA 3OZMA 1EXBA 2HQAA 2X40A 4D6CA 1TR9A 4HJFA 3MI6A 1GONA 3FDGA 3KOYA 4UZSA 4JTFA 3UWQA 3IV8A 5DF0A 1A5LC 4AHPA 1VHNA 3UBPC 3WMBA 2J7DA 1TFVA 5A2CA 4WX2A 4RPQA 4PMOA 1E40A 5AYXA 4CVUA 3VO0A 4YCPA 3A3WA 4MY8A 4DBDA 1Z8AA 2GJPA 1A49A 4ZO9A 1XQKA 3QVQA 5D2XA 3PWIA 1GUVA 1AH3A 1XL9A 5KZ6A 1VEMA 2VWTA 3GU1A 2F6UA 1X7FA 3O9NA 1XI3A 1XPGA 2GGHA 1QCWA 4DN1A 2BGNE 4C7DA 1D2KA 2WM0A 1C8VA 5A6BA 5DY3A 4ACZA 3JUGA 1C9WA 4RKAA 3W00A 3WL1A 5H91A 4FO4A 3DZ1A 5A94A 1YE4A 2ZXAA 1DJWA 3ZWSA 1KXQA 3S47A 4O1EA 3C2EA 2B7NA 1Y0EA 4GH1A 4F48A 5CPLA 1JCNA 1MUWA 6ENLA 1AW1A 4YCOA 1F7BA 3P84A 4XTIA 3LTPA 3QMTA 2W92A 5K3VA 3VNKA 3WL0A 4GPNA 4DF1A 1QW7A 4DELA 4G1KA 5GJMA 4CVWA 4NNCA 1AVAA 4TXEA 4OWGA 1HJSA 4UQDA 3PTKA 4WXYA 3IAPA 4IF2A 1JEZA 4CNUA 5G1YA 3CL6A 4HMCA 4MUPA 5CKSA 1P0DA 5A69A 2GGIA 4GZJA 3CYJA 4ZA0A 4LT9A 1UQZA 1XLAA 2ZRYA 3FIGA 2J9YA 5AYIA 2ZWYA 1MEIA 1DWJM 3G1AA 3C56A 3MZNA 3V7PA 1TKKA 3H2OA 1PTAA 3S5OA 5AC6A 1NH6A 3ERPA 4C1KA 2R9RA 1ZJIA 5GPRA 2QJJA 4UFLA 1ME9A 3SCOA 1DL3A 2XWDA 4P7OA 3CH9A 3KE0A 4EVZA 5AVHA 2IQ0A 3LCXA 3PSWA 2EKGA 3UR5A 3WF1A 1TPWA 1TZ9A 3WUGA 2DJXA 3Q94A 3G8EA 3TZFA 1UCWA 4JR5A 3IGSA 1A5SA 3NAVA 3M5XA 4HU0A 1RR2A 3I3BA 1JNDA 1I4NA 3BLOA 2X09A 3WK1A 3H2MA 3PBGA 3UCDA 3LMYA 4IH3A 2OKOA 3GYEA 2QDDA 4A21A 1AH4A 1QU4A 2OU4A 4IIBA 2V38A 4C6QA 3V0SA 3B8VA 3ZSTA 3O6YX 4QE1A 2F84A 1U5VA 3JZEA 5LKYA 1BGAA 3AAMA 3RK8A 4PCFA 2VCAA 1US2A 2BHYA 2Y5SA 1H7XA 3ARWA 4I8DA 4H19A 1TZZA 4HN8A 2PZNA 5AVNA 4UTMA 1JPHA 3M0KA 1A0DA 3U2ZA 3FGCB 3UQNA 1UROA 3CZGA 4TU1A 5E6YA 5JQ9A 2ZTKA 2PAJA 2YB4A 4IIEA 1U22A 2QZRA 3W2UA 3OLEA 1JNEA 2CHOA 2PRMA 4CUCA 2Q02A 4UOJA 3A6OA 2QCDB 3KS6A 3OBKA 3QV7A 3H24A 4O57A 5FSDC 4M29A 1SVDA 3UGRA 3RIKA 4GISA 3WBXA 2L5HA 2FMNA 1QK0A 5LNWA 2R82A 3Q65A 4L1WA 4CQDA 4JHZA 5EPDA 1B0IA 3ZLGA 4L6OA 2ONEA 1UP3A 5GQBA 4A3QA 1I1WA 3K46A 4M5PA 1TUXA 1CGXA 4PH6A 2NXGA 4EACA 3WELA 2ZX6A 1QW9A 2BDQA 2IXVA 1JUKA 1Z32X 3TTSA 1DJZA 2Z0IA 3QC0A 1IXNA 3GIQA 2PDLA 1H4PA 4QEHA 2Z28A 2V2DA 3PFMA 1KFBA 3OLGA 3UG3A 3N2MA 1HO4A 2CLOA 1UH2A 3TQ0A 3W7CA 3GDMA 1HL9A 4PUMA 1NQ6A 4H4IA 4O18A 3SSZA 4I5XA 4O4VA 4E2BA 1CZ1A 4LVBA 3QZEA 2Z29A 1V6VA 3PULA 4DJEA 4XAFA 1S5TA 4K3ZA 3AXIA 2X05A 1P0KA 2ZUWA 2J62A 2VFDA 1O66A 2VEPA 2BXYA 1WDRA 1HJQA 1WKYA 3RLGA 2R8WA 3QY7A 2BODX 4XKMA 3F5KA 4MY1A 4WOQA 3N17A 3O6AA 4UTHA 5FF4A 1MRAA 3ZOAA 3QW4B 1PE1A 1NQKA 3HIJA 1PL9A 4ZQPA 1AW2A 3OU8A 1CGYA 1ZLPA 3L67A 2EAWA 1R7OA 3KL0A 4E8GA 3VYLA 4UXDA 1B90A 3OPSA 8XIMA 2QT3A 1XGEA 1PVNA 1DQWA 2DVUA 2P88A 2RDUA 1VIZA 4P5UA 2DGAA 1PXGA 3ITVA 3WENA 5I3IA 1IZKA 3GZ3A 2BHZA 3AALA 4CNPA 2QW5A 3BUVA 4IPJA 1PDZA 5EB8A 4LVAA 3O63A 1X1OA 3GU9A 3VM5A 5BCAA 1H61A 5AZ1A 3WDHA 4N9DA 1XRTA 1W1VA 2OCZA 5HMEA 4M0XA 1BD0A 1U5HA 3F4NA 1QNSA 2GDVA 1R9ZA 3LERA 5BOEA 4Z1BA 1PIFA 2YXOA 1E1FA 3REQA 4WD0A 4U31A 4YVPA 2W62A 7TIMA 1Y5WA 3B9AA 1EBGA 4JTTA 1RUSA 1KFLA 4JTGA 3OP2A 3BDKA 4YTSA 8XIAA 4RDYA 3ZO9A 3OQ8A 4KGJA 4YL2A 4LH8A 2Y4SA 3W83A 5DEZA 4O50A 5JBFA 2QEZA 4GE8A 8CGTA 5FESA 4PSPA 3NUKA 1RALA 1SO6A 1SO4A 1TPFA 4L9ZA 4JKKA 4P8VA 4RZ6A 3FGCA 3BG9A 3D5HA 4X3ZA 4Q4MA 2EPLX 5I3GA 5L9FA 1H1ZA 2GZXA 4WSJA 5HMDA 3IJDA 4AD5A 3VX0A 3CUZA 4G6CA 5E09A 2B7QA 3TDFA 3TC6A 4ZSTA 2FDSA 1W56A 3G5EA 1G94A 3AXKA 2E7FA 4NXSA 4ZTXA 3ENLA 1A0CA 3CIVA 2INEA 3GVVA 3L65A 1GQJA 4RXGA 1TIMA 1XJBA 2Z1XA 3TYEA 1B3OA 4GA8A 1BYCA 4I7VA 2QUMA 1OSEA 1G4EA 4R34A 2YA0A 1WKEA 1J96A 4QQUA 4RUBA 1H09A 3G1HA 1IZJA 1BSLA 3CXOA 1EF2A 3FSUA 4IMAA 2WXDM 1WA3A 3S4TA 4GOAA 4GY1A 3ZR5A 2PTZA 3WQCA 5FI8A 2J9XA 3P74A 4QHRA 1E4NA 4YIWA 3B8IA 1XGDA 1S5NA 2XIBA 3QFEA 1KKOA 4LYKA 2X0HA 2DZVA 3FJLA 2VEGA 4MKSA 2Z26A 4XZBA 3RX4A 2YJQA 2WSQA 1SJDA 4NP7A 4UQ9A 5AHMA 1D3GA 3M0LA 2I16A 3TSDA 1LROA 1EJ7L 4UBPC 3B8UA 1RVGA 1K3UA 4M56A 5HMFA 2CKSA 3RHGA 2XVLA 1AZ2A 2ZE3A 1VGAA 4S3CA 3GVWA 1AZ1A 1EIBA 3W6MA 4DZAA 2CLKA 3CAVA 3UJEA 5CAHA 3RR1A 3EA3A 1IEXA 1V02E 2ZVIA 1MQRA 3OVRA 3MHUA 2GK1B 4HPHA 2ZZ5A 3W2MA 5CPTA 4F0MA 1TR1A 2XVGA 3NQVA 2GQ8A 3QHMA 1GQNA 4WKFA 2EQDA 3NM1A 4MMWA 4M6UA 3W85A 4B5WA 2QDHA 4OVXA 2FVLA 3F4WA 4EP8C 2X16A 3DFSA 3QKZA 4F2TA 4A3YA 4P7LA 2Y70A 3QPZA 1WXJA 4C6DA 2W3ZA 1TJPA 1P6WA 3C0QA 3U4AA 3W29A 3DH7A 1NSJA 3ITXA 1RP8A 3OZOA 5GJNA 1CB7B 1YPXA 4UTTA 3EWBX 3BGGA 1JGMA 2HVNA 2H8ZA 1UOZA 5C9RA 2UY5A 4LUIA 3KBMA 7XIMA 4GVFA 1DQUA 2YDAA 3U48A 3EOEA 2DT0A 1T0OA 1XUZA 2X2YA 3H2AA 3MC5A 5HQMA 1M7JA 3OBEA 3SR7A 4GQQA 4H1ZA 3CNYA 4D6DA 5XINA 3N15A 5EMLA 2CETA 5A8PA 2E5CA 3CZ8A 3EOUA 1MW0A 4DLFA 4GABA 5I3KA 1KTNA 3EDFA 5EBUA 4IP4A 3W75A 3HPAA 3GVQA 3HOJA 2ZX5A 3R4IA 2E28A 3WLHA 2YL9A 5AHLA 4GD0A 2ABBA 3WG6A 1DXFA 3WLLA 1Q4WA 3NQ6A 4MPQA 5EGRA 3I4EA 4XG1A 2JEPA 1CX9A 2BOEX 4GUFA 1YXCA 4ZOAA 3H21A 4MYXA 4NY2A 2FZMA 4LCRA 3FA5A 4M82A 4MB1A 3HG3A 2ZZ7A 4NHVA 4LNYA 4UIOA 1CYGA 4JQ4A 5HOSA 1E71M 3W74A 1RQHA 3IK2A 2W79A 2WVVB 3W7IA 3UG5A 1S5WA 1OFAA 4OQVA 1OIFA 3TQVA 3STCA 4C5YA 2C7FA 4V2XA 1YW1A 4HMEA 1AJ0A 4Q8MA 4MADA 4M1RA 5DMMA 1VFHA 3SUTA 2B7PA 4QJ4B 3MUXA 3MCOA 2J74A 3QXBA 5LIKX 3VIMA 1ZRQA 3KBVA 4W9TA 4ZO6A 4C5ZA 1GW1A 3B4UA 4ZZ9A 4RXFA 4PULA 2PU0A 3KX6A 3QGVA 2ZA2A 4DJED 3NL3A 2A3BA 2W0UA 2ZC8A 4ROPA 3QF0A 2FHCA 1H3GA 1UIPA 3VZXA 3GSMA 1XF0A 5CG7A 5GNZA 1FWWA 1SFJA 2AGTA 4AU0A 4U33A 1TV7A 5JH1A 1HO1A 1S2AA 3LCWA 4W5ZA 3WQ6A 4NZJA 1Q6RA 1TJ2A 4EWJA 3TOYA 1OX6A 1H1NA 2CC0A 3G77A 2DVTA 3N14A 4Q8UA 1XDMA 1XW8A 1Q7QA 4L6DA 1M6JA 3L4XA 5FJOA 5LIXX 1A47A 1AQ0A 3GO2A 2J27A 1SUXA 4HYRA 3H53A 3OG3A 3L2IA 1MNSA 4NF7A 3H12A 1XYBA 1RBLA 4RNJA 3AS1A 3DGRA 3IJIA 3MTWA 4CCZA 2PS2A 5GJPA 4K38A 1RV8A 1XIBA 1NELA 2XM1A 3OLDA 4J28A 3OHMB 4AFYA 2ACSA 3UR8A 1XX1A 3ID7A 2PURA 3H6OA 1G1YA 2D2OA 1BKHA 1ZTVA 2E25A 3MI2A 1KCZA 1QJWA 4W89A 5JIWA 1CIUA 3FEMA 1W32A 3S2CA 2J13A 4WGXA 3V1PA 3V3WA 4F9JA 1B54A 3S1GA 1OFDA 1SO5A 4LAMA 1WCGA 4L6HA 1WYIA 3CUHA 2OO0A 2KAUC 3TMLA 1W31A 1KM6A 2GGJA 2CCRA 3E0IA 1S1RA 1EQPA 3DFYA 3PPHA 4AMAA 5CC3A 2DSKA 1JCYA 4S39A 3LBMA 2PGRA 4N02A 4Y9AA 5C70A 4OT7A 3HPXA 1PKNA 3RM9A 1G7VA 2E1DA 2WC3A 4LWWA 1O5RA 2FPYA 4EAYA 2BLEA 2A3HA 4LS2A 2V5KA 4FNUA 2QUTA 3STEA 4LAZA 4OBRA 3FN9A 3ES7A 4RNFA 1FH9A 3TQKA 3ARVA 4URIA 4ZE4A 2PDNA 1R9XA 1ISVA 3GHSA 1YX1A 1E9LA 5HQLA 4OBTA 3MUIA 1UWRA 2XH4A 4MTVA 2WMIB 2DZSA 5IBXA 1FH7A 1XSJA 5FJTA 2RDWA 4ZQOA 1GPWA 3ITTA 5LA0A 1XYFA 2J9ZA 4Z08A 3ITYA 2QAFA 4HK5A 1NFPA 1FVPA 5BZAA 4AY8A 4H6KA 4FP1A 4CNOA 3UVIA 3WDPP 4JHMA 1QASA 3GHRA 2ZKMX 1Q8AA 2AQOA 4AW7A 4HYWA 2DIJA 2BXZA 3I3DA 1HVQA 5BROA 3AISA 1HP5A 2YCJA 1BWLA 2PSNA 3S9YA 1GOIA 2WLZA 4J2PA 1W2VA 1I75A 1I1XA 4L1XA 1TTQA 4L5ZA 2GOKA 3TWBA 4UOZA 4R7JA 1W3HA 4WSHA 1R3SA 1IZCA 3OO2A 4GLEA 1DHPA 3GFXA 4U3CA 2WANA 1KFKA 4DHGA 2J7FA 3N2CA 4A29A 3BSGA 4QITA 1CT5A 1JDFA 1W5PA 3O2LA 2PD9A 1ISWA 3ZVHA 2JIWA 3G1RA 4KCTA 3CHDA 1BKSA 3USZA 3T05A 3RPMA 1J5SA 3HM7A 3MYOA 4I7UA 3USBA 1YXDA 1XIGA 5TD4A 3IAQA 3CUJA 5A6AA 5JU6A 4RX0A 4Y2WA 4V1XA 1X1NA 1Z89A 1HL2A 3FAWA 1JCTA 1CB2A 4GZIA 4FHAA 2X2GA 3NXLA 2WZHA 4BFAA 5C55A 3AUJA 2NVAA 3ZT6A 3TYZA 3Q2DA 2E1WA 1X1ZA 1SJAA 2YLLA 2WAGA 4WHBA 5CPSA 2NT0A 3POHA 3QY8A 4PCTA 3E02A 1B5TA 4Q6XA 4DJDA 1C91A 4FLSA 3LZ3A 1YE6A 3KW3A 1D9EA 3K1DA 4H8HA 2DZBA 3TXZA 1BTMA 2ASHA 4HZ8A 4L9XA 4QROA 2GL5A 3PANA 4FALA 4MB3A 2CBIA 2NX1A 3PS7A 2OQLA 4JTQA 4H04A 3FFSA 1H60A 5D9OA 2NZLA 3URBA 6REQA 3VGDA 1IXQA 3WEZA 2A6NA 2FJKA 4K8EA 3A64A 4BI5A 1GVRA 1XH2A 5J8LA 4ZQMA 1Z69A 2D20A 5EBAA 2Q01A 1ONWA 4J3WA 4O10A 4S3AA 2MANA 3GIYA 1FH8A 3NO1A 4CCCA 5HATA 4L65A 3TYAA 2EHHA 3AMKA 3TYBA 2PA6A 4Z2LA 4GZEA 3LRMA 2Y88A 1Q3NA 1LT7A 3MJMA 1WQ5A 4A35A 1DJIA 4P7NA 4XIAA 1KCLA 3TC7A 1POKA 4K1GA 2V3DA 3LHVA 4IIFA 4Q8TA 1SW0A 2V82A 1EL3A 4D9PA 4Y9OA 2QV5A 2BVDA 2EXOA 3W88A 1DQXA 3KTSA 3QRHA 1VLIA 2YA2A 2ZRVA 1GK8A 1UH3A 2X1RA 4DWDA 4LAOA 3IIZA 1EP3A 3EOSA 3NQEA 3BOFA 5IRPA 2VYOA 3R8RA 1SO3A 1PO9A 3GQYA 2ZA3A 1NP2A 4B9ZA 1F5ZA 3KUMA 3H55A 3W37A 2VD9A 3AJ7A 3K4AA 2OOFA 4YYCA 5D33A 4XV0A 5LNRA 1H63A 3NGJA 4HA4A 1PTDA 3S83A 2IXUA 2P3ZA 1TPVA 1R3WA 1AG1O 4NUWA 3TAKA 5TF0A 4JIPA 4NI3A 1EJTC 3W7QA 1VYSX 2PDHA 1VFTA 4GNKB 3C2YA 3A4AA 5EU9A 3VKDA 3NVDA 3LSCA 2A3LA 2C13A 1RH9A 3ARUA 2DW6A 1QPOA 1T96A 1DE6A 1X39A 1MZHA 1UWUA 1XDJA 1HF6A 1H7RA 3QZAA 3W7RA 3PHAA 3ZR4A 4W5UA 4AZHA 4R3UA 1AD1A 4HD5A 4Y9PA 4XO7A 2J7BA 3L9CA 3W02A 1S3HA 4EF8A 3AIQA 2V68A 2CW6A 4IPIA 2CU0A 4HHPA 3DYMA 1ZJAA 5FF7A 2VGFA 3FJ6A 1BXBA 3UP8A 3VZZA 4E2DA 3OA5A 1LLOA 5BXTA 3CQKA 4E4FA 3VCNA 1JCMP 2DSUA 1LOLA 3SN0A 4C6LA 2GSEA 1KW1A 3K1GA 4QAIA 1PIIA 4LY8A 2NXHA 1J01A 3FHQA 1M7PA 2NSOA 2F2KA 4KGLA 2XGZA 5FF0A 3LNMA 2HK1A 3H4WA 3CIWA 5F4SA 3AHTA 4MJMA 4O17A 3DI1A 5D30A 3SW6A 1ONRA 1KQZA 3B04A 3T0TA 2Z2AA 4DUXA 2J6XA 1EZWA 1XUUA 2F7FA 4BQ2A 4IUOA 2DY3A 4LS0A 1KV8A 4MAZA 3V5OA 2JQXA 3ZYZA 3R11A 2X1SA 5XIMA 5ECUA 1X96A 1T40A 4JAWA 4HA1A 3ZZ1A 2CZVA 4F79A 4KF1A 4HZ7A 1LRQA 5E9XA 1JDEA 3VNZA 1L2UA 5I79A 3T1GA 2CERA 4H6QA 1SFTA 3JS3A 3S2NA 1KR1A 2CBUA 2ZA1A 4FNPA 1JYXA 1XRSA 3LHTA 3UXKA 3S0CA 4CCEA 1YDNA 4DAFA 1OFPA 2J75A 3T4CA 2XN0A 3I7RA 2J8FA 4JY8A 2C6QA 1P7TA 4V28A 2VDIA 4DO5A 2HE8A 3OLIA 4US5D 4PB3A 2AL2A 3NQ7A 3IV3A 2Y62A 3W07A 3WUBA 2I56A 2E6YA 4F40A 2OB3A 3B05A 3FA4A 5LNSA 3VDCA 4ATWA 4QEEA 1IWBA 4X63A 1I45A 4UCFA 4LUSA 1XXXA 4B92A 4FXFA 1KRAC 1LL4A 2VENA 3DFQA 1UR0A 1XKJA 3PZ9A 4WF7A 1SMAA 3TJ4A 4YTQA 4XAGA 3WFZA 5I7GA 2GGGA 3ARTA 2OEMA 2VR2A 1W17A 2NUXA 5E5CA 1OF8A 1LQAA 3ZVHB 1F61A 3TJLA 2WVTA 1FKWA 2CPUA 1ZBKA 3VFLA 1QPNA 1XLDA 1V02A 3KL3A 3AIVA 1JZ3A 1XH1A 3TW7A 1RXOB 1YTDA 2Y8UA 5F2IA 2QGYA 5CBIA 5LHEA 2EEXA 3UXIA 4O14A 4QLJA 4DNHA 4HPXA 1XCWA 5CZKA 4FS9A 1Z44A 4I3GA 3VI2A 2W91A 2XHYA 1N82A 3EZ4A 3RAOA 5DN1A 2PWUA 5BMWA 3NYDA 3RLVA 2GYIA 3WQEA 1K1DA 2W4XA 2ZXQA 3TEVA 2C1IA 3AJXA 2YXGA 4FNSA 1LL7A 5C6MA 2GJXA 3VOGA 4ZOBA 1KGWA 4PRRA 3OIXA 1EEXA 3SFWA 1QO2A 4ZB5A 4HNCA 1UZHA 3G1FA 3T07A 1LYXA 3GRIA 3EWCA 3FYOA 2Y63A 3HURA 1R9YA 2HNEA 3PG9A 1TQJA 3GY1A 4W93A 4Y8FA 3S2JA 3OB8A 1POJA 4N9CA 3M9YA 4BK9A 2QCHA 3PPCA 3REQB 5DBUA 1P0EA 4JQ3A 6A3HA 3QPEA 4GRSA 4QRNA 3U9IA 1GEHA 3BC9A 3P93A 4QX4A 4AZCA 4L64A 3QJAA 4A8LA 1TJ1A 3N6HA 3EMZA 2OELA 4ZXLA 2JBMA 3R89A 1GTHA 3PVFA 3NURA 2IQDA 3DG6A 5H6HA 5K4XA 1VPYA 1B31A 1KLZA 2Z2UA 3BV4A 1EDTA 3VOHA 5D4YA 2OQYA 2JALA 1XISA 3EX4A 1FWFC 1XIDA 3HPZA 1JRBA 3DG7A 5D09A 1TX0A 4HOWA 3GC4A 4XQ6A 2V3GA 2HBXA 2PCQA 3LG3A 1K8YA 3KDOA 3NCOA 3ALFA 3URQA 5HA7A 1TCDA 4YMZA 1IIHA 4LYRA 1CXHA 4ZOEA 3LCHA 4TR9A 1NOWA 5FF3A 3PPGA 3FJ4A 3W82A 2WZMA 4JKLA 3N6JA 3PBWA 2BV9A 2CLEA 3VOJA 2HPMA 4KEMA 1YIXA 3MS8A 5CGMA 3GYCA 2ZADA 4A22A 3CU2A 4UQEA 3CO8A 5A6SA 5CJ5A 4P61A 3ARXA 1S38A 3EDJA 4LC6A 1GYMA 4FOUA 1I8JA 3O8AA 3ZFHA