1Z69A

Crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
327
Chain Sequence
MKFGIEFVPSDPALKIAYYAKLSEQQGFDHVWITDHYNNRDVYSTLTVLALNTNSIKIGPGVTNSYTRNPAITASSIASIAEISGGRAVLGLGPGDKATFDAMGIAWKKPLATTKEAIQAIRDFISGKKVSMDGEMIKFAGAKLAFKAGNIPIYMGAQGPKMLELAGEIADGVLINASHPKDFEVAVEQIKKGAEKAGRDPSEVDVTAYACFSIDKDPVKAVNAAKVVVAFIVAGSPDLVLERHGIPVEAKSQIGAAIAKGDFGALMGGLVTPQMIEAFSICGTPDDCMKRIKDLEAIGVTQIVAGSPIGPAKEKAIKLIGKEIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethan
publication title Crystal structure of methylenetetrahydromethanopterin reductase (Mer) in complex with coenzyme F420: Architecture of the F420/FMN binding site of enzymes within the nonprolyl cis-peptide containing bacterial luciferase family
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 119
structure length 327
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1z69A00
1BSLA 3B9OA 1M41A 1F07A 3SDOA 3B4YA 3C8NA 1TVLA 1BRLB 1LUCB 1Z69A 2B81A 1YW1A 4US5D 1FVPA 4UWMA 1EZWA 5AECA 4US5A 3FGCB 1BRLA 5LXEA 1LUCA 1NFPA 4J2PA 3RAOA 3B9NA 1XKJA 1RHCA 5DQPA 3FGCA 1NQKA 2I7GA
chains in the Genus database with same CATH superfamily
1ZNNA 2YCEA 5I7GA 4E2BA 1DXEA 2ASHA 4FX7A 2QPXA 3BMWA 2NUWA 3O3RA 3GIPA 3AHVA 1UKPA 1X6NA 2J9ZA 5JH2A 5EBAA 2ESCA 2Y63A 3Q58A 4N4QA 3QMSA 4FOKA 1LF1A 1OYCA 1PKNA 3T55A 4UUIA 4B5WA 3AYRA 4H8HA 3G0XA 1KCZA 3GTIA 4LAMA 1O94A 1J01A 4F8XA 3MY9A 3VCCA 3HPXA 4GGBA 4RNJA 2O92A 4EK7A 1WUFA 5AHLA 4QISA 3N2MA 4S39A 1JNEA 6XIAA 2GGJA 2X42A 3PSWA 2O7SA 4YTSA 1ISVA 1N8IA 2FJUB 1W1B1 3KCLA 4US6A 1PO9A 2YDAA 1P7TB 3KRSA 4K38A 2ZVIA 1Q63A 1PIFA 1YNYA 1GTHA 4DEFA 3AHZA 1K77A 4MUZA 1KB3A 2CKRA 5H1WA 4UQCA 2EPHA 4GBDA 2VCCA 4JTEA 5A6AA 3NZQA 3GHUA 3FCPA 3TYBA 2YZ5A 5F1UA 1WKEA 1XLLA 1RP9A 4BF9A 3E96A 1PDZA 2P76A 4HYRA 1YYAA 5AZ1A 1F7BA 4JTFA 4B5UA 3B9EA 2YL9A 1TA3A 3WQ8A 1EXPA 3U5UA 3VX1A 1V3HA 2AL2B 3C0QA 2IKGA 3W74A 1VRDA 1KLZA 4JIPA 4C7GA 4CNOA 3N19B 4KFOA 4UZUA 4EWJA 4WSKA 3E49A 3UG5A 2CNCA 3HV8A 1B3OA 4GBUA 4URIA 1PZ0A 2BOGX 4LF1A 2PWHA 4LC8A 3GDKA 3CQHA 3ZVHA 1AQ0A 1EX5A 4W86A 4XKYB 1IE7C 2GJXB 2EJAA 4RNIA 3GDBA 2DUZA 4L1XA 4PH6A 4DN1A 1O6IA 4K8HA 3VOFA 3W82A 1EH9A 5CC5A 4DRSA 4QP0A 5I03A 4R85A 1XDJA 3GNOA 5CPTA 5FD0A 1R9ZA 4RE3A 1L2QA 2NSOA 3LCXA 1SO6A 2ACSA 3L21A 2PC4A 3EDDA 3T42A 2WLYA 3BUVA 4HBKA 2PU1A 2ACRA 3LSBA 3RPDA 1JAEA 2EG7A 3H53A 4JKMA 4H6RA 4Q7IA 5KMYA 2B4GA 4NKCA 1ME9A 1KBJA 3WH7A 4EXBA 3KOXA 4Q4RA 4Y2WA 1PZ3A 4AF0A 3PZGA 1A5OC 3OYZA 2X1SA 2Y8KA 3HQ1A 5FF4A 1PS9A 2FGZA 3ITTA 4H9ZA 1K8ZA 4UTMA 4DZ5A 5HK4A 5JIPA 1V6WA 5ABGA 4ZR8A 2J4GA 1MW1A 4QDWA 1J93A 2X7WA 2WJZA 1MO0A 2Y0FA 3TOPA 3N6QA 3RLUA 1RLCL 1K4HA 3CYJA 1DXFA 2X0YA 3WF1A 1B1YA 1NWRA 3BCFA 4O4VA 3B9DA 1TPUA 3N2TA 3NL5A 1J5SA 3TQKA 3LM7A 5HPOA 4KS0A 2ZRYA 3IK2A 2CLOA 4O17A 1F07A 3UR8A 1GVFA 5AYZA 2F61A 3C56A 2J7BA 3PZMA 2CWXA 4WKHA 1RBLA 1KGWA 1GCYA 1VLWA 1TPB1 3PZUA 1V0LA 4PL2A 3MZNA 4AZIA 2C91A 1JPHA 3NQ7A 3NGJA 4AHOA 4ORMA 3FDGA 3OLEA 1UD2A 3VIJA 1DQWA 3TN3A 4M24A 2O9RA 1Z89A 3NDOA 4U3CA 3W87A 3KBNA 1Z48A 2A3CA 2PBOA 4MY9A 2VMFA 3QVQA 1FWTA 3V0TA 3FA4A 3WLQA 2R94A 4QGCA 5T9CE 1ISWA 1L6WA 3AHYA 3TE9A 4H83A 1GOIA 1W3NA 4CLMA 1BXBA 2OQYA 1FKWA 2PZ0A 3UNTA 1ZCOA 1CI1A 5KINA 3ES8A 5CAHA 2YDRA 5LIKX 1O12A 3QFEA 3UR7A 3WLJA 1EJ7L 3I3DA 3QV7A 2DVUA 2WVVA 3UXLA 3OG3A 1BAGA 4NNAA 1Q6FA 4PYSA 2QNEA 4IQJA 4XVEA 1SFSA 4Z2KA 3CEUA 4HSOA 1TPDA 2FH6A 1RD5A 5TNVA 4DO7A 1EB3A 1B31A 2R1NA 1RR2A 4M0XA 4DI9A 3U7BA 2YOCA 1DTNA 4B2DA 1DJNA 2A4AA 1G9HA 2FZMA 4IG2B 2WHKA 2ZX7A 1SYTA 5C7HA 3JZEA 4YCOA 4YL2A 1HTIA 1R46A 3W02A 4L4LA 2ZZ2A 1TWDA 1KQYA 3RLVA 5D02A 4A8NA 3VKBA 1YTDA 4PULA 2HRWA 3FXYA 2PRLA 2NQJA 3RCYA 5C9WA 1QHPA 2NX1A 3LQLA 5LGZA 3WDRA 3AXMA 1ZB5A 3KVKA 1OZQA 3V3WA 5E0CA 4UCGA 3QPEA 2WB5A 4QR6A 3C3NA 3QGVA 1JYWA 2WKGA 1AFSA 3SRFA 5I6SA 4A3QA 4RUBA 4ZSTA 3TJXA 2G3FA 3REQB 3FNDA 1CXFA 1W1VA 1D9EA 3LBCA 3G1HA 3STFA 3I10A 2C1HA 1R86A 1QVBA 4P5UA 4BQ4A 4HA1A 3BSMA 3BLOA 3WNPA 1ZJIA 2DVXA 3RO8A 2J78A 1CYGA 1V3LA 4NRSA 1ELSA 3PBUA 3UJ2A 2WNWA 3WY1A 2VGBA 3ITCA 2VZTA 1JI1A 1WQ5A 4WRHA 3ZR6A 5DXXA 1HGWA 5A8GA 3PPFA 2TAAA 3LCIA 2AKZA 2AL2A 2BY2A 5D2WA 1GPFA 3BMVA 2F8QA 1BXNA 3IIPA 4LCQA 4ADTA 5FF3A 5CGTA 1MFUA 3BOLA 4N9CA 1JUBA 3PN8A 1V0NA 5GJPA 1D7KA 2V5JA 4O19A 3KP0A 3KZPA 1XLBA 3WD2A 4XKYA 1AD4A 2EBNA 4MNKA 3P67A 2TODA 5HUOA 4C1NA 2GJXA 4C6CA 1KKOA 3ZO9A 3LSCA 3CAWA 3WDJA 1WXYA 3SUWA 1I2QA 2V5CA 1E43A 3OBKA 2D69A 1GQJA 3N6JA 1Z8AA 4DF1A 3MKKA 2OOGA 4NJIA 4Q4QA 3UR2A 1V6TA 4HVXA 2A2IA 4IUOA 1WV2A 4A3YA 4MLJA 3CJPA 1R9XA 4EKJA 2XFYA 1W31A 3GIQA 3L2IA 1IF2A 1KGXA 1DJQA 1WAUA 4PMOA 2DJXA 1WPCA 1XIEA 4IZGA 1Q4NX 2ZUWA 3GDLA 4NASA 4GISA 5D38A 3TA6A 4EF9A 2QJGA 1H61A 4YHGA 3W85A 4K2SA 4R9OA 2J6XA 3IUIA 1P0EA 4ZO7A 3P14A 4EOUA 3I6RA 4UOZA 1VRXA 1U30A 3PPHA 3E2QA 4O4WA 2F6XA 3IIZA 3C2EA 1NWSA 3G8RA 4I6KA 3KLKA 1UP3A 3H4XA 5DELA 2FMNA 2NXHA 1X1NA 1AJ2A 5BWAA 1CBGA 5K2ZA 1GT8A 3BG9A 1Q6RA 2REQB 1LRTA 1B3VA 5FEPA 2CWNA 2DSZA 3B4UA 3MCMA 1C8QA 3W7LA 4HTYA 4J3WA 2E6FA 3SCPA 4IQEA 3TN5A 4HU8A 2D0HA 3N3TA 3HZ3A 4R33A 1OGGA 2GK1A 3UXKA 5CG7A 4LVAA 1C8XA 1KO0A 1V79A 2VT0A 1XUZA 4L6DA 3DCPA 3TWAA 3W1XA 3W75A 3ABXA 3LU2A 3T08A 3OOQA 4B5TA 3PB0A 2GSEA 3AHTA 5G2WA 2FYMA 3OBAA 1UD5A 3HQPA 4GK8A 4PCFA 3MUY1 3UT0A 3FHQA 2R14A 3LPOA 4LBRA 1KRBC 3M5YA 1QUMA 1FCUA 4C7DA 1PYMA 4B2DD 3DECA 5CSUA 5E0FA 2QCMA 3RIKA 4YPJA 1AQFA 4OGZA 1HZYA 2P8CA 1PB0A 4D72A 3R2GA 4B4HA 5K9DA 1T8XA 3R4IA 4WKFA 2C79A 2E40A 3WYZA 2NLIA 2V82A 4CU7A 2DT0A 4I8YA 2VRQA 2I56A 2ZZ4A 1IYXA 3UWWA 3UWQA 4PTWA 4N7QA 2QUMA 3NM1A 2QDDA 1OWQA 1T41A 3BV7A 3GVRA 2FZDA 5D8ZA 1IEQA 5JVLA 1ZUAX 2FDSA 1ECQA 4ZBCA 1BKHA 3MMTA 4HHMA 5IRPA 8CGTA 2JALA 3SCUA 3M0JA 4QCEA 1KM6A 3TFXA 3E0FA 1PPIA 4CD8A 1K9TA 1UOZA 3LI1A 4PTXA 3BGJA 3NPXA 2QCLA 3RGTA 4UTLA 4L7ZA 3LTPA 5CBJA 3L4UA 1WXZA 5GNZA 3NQAA 3GO2A 2CXEA 1QXLA 3M0IA 1F2JA 2FTWA 4EPDC 2BFGA 3XISA 4UTHA 3VA8A 1VYRA 1N2VA 3OODA 2V6AA 3VIKA 2HISA 2PD5A 2VC9A 5J5DA 2OQHA 2OKOA 4JTGA 2ZICA 2X1IA 5DCEA 3BOFA 4IMGA 3HURA 5JXQA 1W9DM 4JTSA 3SR7A 4D1IA 4MIMA 3PUOA 2EO7A 1TE1A 4GYFA 2CPUA 5DT5A 1JD9A 4GQQA 3I7QA 2BGQA 5A8OA 3G3DA 2VP8A 1YDNA 4C6IA 4GIYA 2YFOA 2E0PA 5HQLA 3SGGA 3HJEA 3TU9A 3ZT5A 4JTDA 1XBYA 3EGJA 4TO8A 2B7QA 2DSKA 3CL7A 1N82A 2OYMA 4AWUA 4CQ9A 2WWDA 3H7UA 3R58A 4Z2IA 1HJVA 3CHDA 4RXFA 3B03A 4DLFA 3LHTA 1NDZA 5AY7A 4ZQPA 3SN4A 4QG6A 4KWVA 3TKFA 4DUVA 2V67A 2WQPA 3GC4A 4M51A 3T0TA 4R7WA 1PCKA 3UWYA 2ZBTA 3P6LA 2E8ZA 4FA3A 3QLLA 3EA2A 1ZGDA 1VJZA 3SGUA 4OTKA 4TMBA 3CHVA 5HA7A 1UJQA 2WC4A 1QDSA 3QHMA 4C6KA 1ZBVA 5I3IA 2Y61A 1V02A 2AOSA 4F2BA 3OA5A 3CAKA 4MNLA 4AYSA 3EWBX 3WX7A 1D8WA 1R8LA 3S2MA 4HCLA 1KM4A 4LBSA 2OYKA 4BKNA 3NO1A 2VQTA 3I65A 3K30A 1E5JA 2NQLA 3SSZA 3MVIA 4JQ1A 4MNMA 4DUXA 1H11A 3J7HA 2IPFA 1EF3A 3V5FA 1RXOB 1XLMA 1TZ7A 3ZWTA 2Z2AA 3EWXA 2YPIA 3CWNA 2VURA 3TONA 4Q8VA 1W3HA 2QIWA 1DORA 4L9XA 3T4WA 4HPGA 3NQBA 3GS6A 4WDUA 3ZT6A 3QYSA 1QR7A 4ZFCA 1AODA 2W62A 2NXGA 5LSMA 2NV9A 4JQ3A 2R1KA 3DI1A 1VENA 1GKRA 4N9DA 3MYOA 3FIGA 4C6QA 4K3ZA 3CO4A 2FLIA 4I8DA 2REQA 4Q8UA 4O57A 1XSIA 3PBWA 1W5OA 3N3MA 3TZFA 2OSXA 2FB2A 3UF9A 3ES7A 3S6TA 3QPYA 2E9MA 1S2UA 4QEEA 2EEXA 3H2NA 4IM4A 3TAKA 1N55A 4M82A 3LXBA 4AWTA 2H8ZA 2Y70A 3TNOA 3PZOA 3TUUA 4HHLA 1J9YA 1U5HA 2GGHA 2OZ3A 1V0MA 4JIEA 1SZNA 3G5EA 4ML4A 4CQ8A 3E9AA 1EO5A 3B97A 3WG6A 2WYSA 3SFKA 3M64A 1BRLA 4BF7A 3ANUA 4HK6A 5K9XA 3I7RA 4K37A 3QHOA 1F05A 1GJPA 3VMPA 3G1VA 4A05A 1I2NA 3IVTA 1KQZA 2J62A 3FXGA 1B3XA 1HKIA 4NAEA 4DO5A 3WL1A 4LALA 1XRSA 2OJPA 4PCSA 1ZLPA 2WHMA 4WDWA 4GI6A 1NAL1 1W5MA 1UASA 5D9MA 1W3JA 3HOJA 4CU8A 4FS9A 3RRAA 5FF0A 5A6SA 1A5KC 4KIRA 4IUGA 5EA9A 1I0BA 4DUWA 3Q65A 4KFPA 1SGJA 1VYPX 2Y88A 1JCTA 3F7JA 1PCWA 1W91A 1ZAIA 2RAGA 2FFCA 3WQ6A 2PDJA 4AY7A 1KNWA 1KXHA 3PAOA 4G1KA 1KA9F 1MUMA 2JF6A 3W00A 5A6BA 4JS3A 3QV6A 4UMBA 3E0WA 3A4AA 1F3TA 3GXNA 4NX0A 1VKFA 4CCEA 4YVPA 3WD1A 3LRLA 1MW0A 5HINA 3NDZA 1BSIA 4B4FA 1HKWA 5HWNA 4CD7A 3A5VA 1LUCB 1CX9A 1UG6A 4WOZA 2FTPA 2PI6A 3EZ4A 2QJHA 2VTFA 1A47A 1R3WA 4WXYA 5M17A 2VYOA 2E5DA 1R5YA 1TQJA 4UR9A 3RPTA 4N4PA 3QRHA 4GGHA 1HL2A 1XIHA 1E70M 1JF5A 3AIQA 1XLFA 2G3JA 4E38A 1UWUA 5FI8A 4WJ8A 1LBLA 2RGLA 5AOUA 3W4RA 1J0YA 5LKYA 1BYBA 3T6CA 4GJIA 1OFRA 1Q3NA 1P5BA 4Q8QA 4DWSD 3TWBA 3R89A 1EFZA 4GE8A 1XIDA 4HOWA 3TLLA 3LQGA 2ZIDA 2E09A 4C6MA 4O1DA 1F3WA 1Q6LA 3BGGA 2BHZA 4ZL1A 3ATYA 4EVZA 3QFWA 3UXDA 1DHKA 4PC8A 2Q3RA 1XKYA 2XVNA 1C93A 4L4OA 2PAJA 1TTQA 1X7FA 3VE7A 1UUMA 1FXPA 1AH4A 2OWCA 2F84A 3A21A 2Y5JA 2XU2A 2DZAA 1L6YA 6A3HA 2ZRVA 3OB8A 3QC3A 3BWWA 1LROA 4D6JA 3WLTA 2EG6A 1X1ZA 2CETA 3U4AA 1MQRA 1WZAA 4MF4A 2OEKA 3ORWA 1RA5A 3AALA 3ARUA 2XZ7A 2Y5SA 3TR2A 2O56A 2V69A 4AD3A 4L1GA 4C6BA 1EHAA 3EKGA 3UA3A 2ZX8A 2DU2A 3LGGA 2VRJA 4DAFA 3VI2A 2HK0A 5IDIA 6CGTA 3FAXA 1U1UA 3WL0A 2B7NA 2AKMA 3GM8A 4Z2GA 3A12A 5JBEA 2PDFA 1JDFA 3GH4A 2Q3OA 4WJEA 1F8IA 1F74A 3P8IA 1O5KA 4WY0F 5DEZA 3G1RA 5T91A 3WF3A 3I4EA 4NP7A 1UCWA 1XR2A 2PD9A 1Y0EA 3HFYA 3LNMA 3R1ZA 4GY7A 2VFFA 1HJWA 1JGMA 2NT1A 4H41A 1LG2A 4AH7A 1AK5A 4FXFA 2ZUTA 2UY4A 3C0LA 3KZSA 4XVDA 5FEZA 1ZCCA 4GQRA 4ATDA 4IPNB 4ACZB 4JHMA 5HULA 3S1VA 5D09A 4I90A 4M81A 4XD4A 5C6MA 1SZFA 3VM7A 5HNNA 5A2BA 4QS5A 1JDEA 4JHOA 1PTDA 1S2VA 1UPPA 4IMEA 2V2DA 1WUEA 1C91A 4LANA 3ZR4A 4GQGA 5G4EA 5I3DA 2W66A 2VOMA 3VK5A 3IJIA 1US0A 3DKJA 1TMHA 2C71A 5CH9A 4AFYA 4MMWA 2ZDRA 3FAWA 4HZ8A 3CWHA 1K8CA 4A3HA 4JTHA 1RLDA 3LTYA 4LQ1A 4OV4A 5TD4A 1LL4A 4Q8PA 1GJWA 4V28A 1KKRA 5KETA 3DFTA 4BR1A 2QCEA 3A3XA 3CHEA 1W3TA 2ZUVA 2W0UA 3LLDA 3ZSTA 4ICCX 3KVLA 3AROA 4M80A 3P80A 1KTNA 5AFDA 5LNVA 3BAJA 3UGRA 5DMMA 1SMAA 3GRIA 1J18A 1WOAA 2NV2A 1ONEA 2VWSA 3WF2A 1O68A 4NZ3A 2EG8A 1DJHA 4CN6A 3A47A 1UWAA 1AMKA 2F6KA 1VP5A 1GEQA 7A3HA 1FWRA 3QLDA 5D4YA 3GAKA 2A1YA 4GZJA 1J79A 4L56A 4OT7A 4LPCA 5E09A 3UVIA 3NZ1A 3W01A 3KCJA 3R6IA 4ZOAA 3PHAA 5AN7A 2QEZA 3ZJKA 1R2RA 5A6LA 1MDRA 2XDFA 2QT3A 1WAWA 2RUSA 5HQMA 3UWUA 3T2QA 4UFIA 5I09A 4C5ZA 1Q6GA 5C0QA 5A6BD 4NF7A 2VDGA 3F03K 4GNJA 1XLCA 4CQCA 1X38A 1US2A 3IUDA 3AUJA 1SZGA 4AXKA 3SCRA 5CJ5A 4FI4A 4LAUA 3B9OA 4UFJA 3OA3A 1S3TC 4MUPA 1KM0A 1LWJA 4Q22A 4YJ5A 5BXTA 4H1ZA 4FSAA 2PFHA 4Z2HA 3VINA 4OOZA 5AC5A 3MBFA 4UBPC 1E6SM 1NVMA 4WKAA 4MAZA 4DJED 4ADUA 1Q8JA 1ZRQA 2CLIA 4AW7A 2WMKA 3LK6A 3MB9A 4O50A 4IWWA 1IIHA 4KH2A 3ARPA 5AHMA 4OU1A 4F0HA 1YE6A 1XLEA 3SUUA 3B4YA 4AMCA 4RW3A 4NI8A 3NJ3A 2HEJA 1REQB 3S2NA 2VEKA 2V38A 2Y85A 1EUAA 3GVGA 4JTLA 2BBFA 3FKKA 4A29A 1XLHA 1N7KA 3WLSA 4JYDA 7XIMA 3IIOA 4EANA 3GLCA 4EAYA 3TW6A 4MDPA 3WK2A 1NDWA 3B9AA 4P7OA 1FH9A 2CCRA 4V27A 1LRQA 1JUKA 1OC7A 1MI3A 2XN0A 4E8GA 3F5KA 3DKLA 2ZWZA 1R3RA 3EOEA 4D6GA 3MZ2A 3UJSA 4YIWA 3H24A 4Z42C 3RPMA 4DY1A 4JL2A 2X1TA 2Z25A 4Z2JA 5MHBA 4IIHA 3VD7A 4RR4A 3GXIA 2CU0A 3BOXA 4OBTA 2Z1WA 2P3EA 1DVJA 3MPGA 1W3LA 4KPLA 3STCA 3RM4A 2POTA 1CTNA 1G94A 3GNRA 3TQ0A 1C90A 2BOFX 2ZXBA 4J4KA 3WQWA 1IT8A 1FWJC 4P8UA 1UZ4A 3USZA 3HMJG 3APTA 3GHSA 1QW8A 3VYLA 3QZ6A 2E6AA 2PUZA 1FH8A 4HA0A 1CGUA 2XYLA 4Z1CA 2Y62A 2XG9A 5CQ1A 2JIEA 4CVUA 5EFDA 5CC6A 3GBDA 1LORA 3H8AA 1UR9A 4HK5A 3WNKA 2HTMA 1MYRA 4MY1A 4NRRA 2PWDA 3UJEA 4J40A 3MCOA 1BWKA 2Z27A 4KMQA 3KAOA 3RJYA 2ZRZA 3RX4A 3ELFA 3M41A 3W7PA 4H6KA 5HR7A 3RU8X 4Y9PA 2ISFA 3BZJA 5EMJA 3CT7A 5DBUA 4Q32A 5TF0A 1RAKA 2QDGA 3NQ6A 5I77A 2YW4A 5G1MA 3D3AA 1UR3M 2Y6ZA 3UXIA 1RHCA 3EX1A 4PGLA 3WH6A 4HPNA 3KRUA 5CSRA 3GR8A 4GNKB 4JZ5A 4WSJA 2PWGA 5K3VA 2ZX9A 4MB5A 2QAPA 1KBKA 2Y24A 2YXGA 2PA6A 4NZJA 3G1YA 6ALDA 1E55A 2DSWA 3PBVA 3JRKA 4KT2A 3UCCA 2B31A 3E2SA 2C1IA 4OJYA 1EXBA 2HE8A 2PGRA 1VZWA 3L5AA 3FS2A 3OVRA 2C7FA 2WZTA 1T99A 4WZHA 4ACZA 4XZIA 3T0AA 1XLAA 1FA2A 3TR9A 1Z44A 3MKVA 3NAVA 4S3GA 4Z0JA 3S4TA 2X2YA 3PANA 1KC7A 4S1FA 4HJFA 5EPDA 4AD2A 4JDBA 3FDKA 1QPKA 1P6BA 3ICJA 2ADAA 1DJYA 4GO9A 2R8WA 3VM5A 1YTKA 4IX2A 4BY3A 2DUAA 1XF0A 4OBRA 4CNNA 2DQXA 1JAKA 1L8NA 4BS0A 4MZ1A 5ABTA 3KOFA 5D04C 4W7UA 5LGXA 5A8MA 3VIOA 3IGUA 3TYZA 2QHAA 4HJWA 4MKVA 1UC4A 4ZZ9A 1OF6A 3ARYA 2W5FA 4DI8A 4EE9A 1XSKA 2W6RA 3STGA 3WMBA 1V3KA 4FF7A 4LNCA 1NIUA 4AZGA 3RN6A 3DHDA 1XKJA 3N12A 1R6WA 2W27A 4H7VA 2GOUA 1DE5A 3QC0A 4DYJA 2BGNE 2OXNA 2PDPA 3M5VA 4IP7A 4GQBA 4XZLX 3KM8A 2FVKA 3TEVA 3U2CA 3GH5A 2FHBA 1GUVA 2ZQ0A 4ADSA 1GOOA 4RKAA 2QCGA 5CBIA 3LTSA 1DPMA 3RX3A 4Y90A 3CNYA 4BEQA 1JZ2A 2EPKX 3LG3A 3O7UA 4W4QA 3W0KA 3ZM8A 4MADA 1J0KA 3U2EA 3M0LA 1TZ9A 4K8GA 2VC7A 3FSTA 3KXQA 2O4MA 2PDKA 2ODOA 4IFRA 1QI5A 3W7NA 2XUCA 1YXYA 4YXGA 5FEXA 4HCHA 4GD0A 1I6NA 1CXKA 3V1PA 3ABQA 5AHFA 4GMEA 4C6OA 1IEWA 3C2RA 1VS1A 4FXSA 4DO6A 2WZIA 3EKZA 2XGIA 4DWDA 5LIYX 4I5RA 3CZGA 3U6WA 3F1QA 1RY8A 3IAQA 4IIDA 4MJZA 1X8CA 3VKKA 1TJ1A 3ZIZA 4J7RA 2X05A 5HBFA 2Y1HA 2XVLA 1EIXA 4AHPA 3WLIA 5F4WA 3DH7A 2YX0A 4FMVA 1U5JA 4H7CA 1Q6OA 3UBPC 1OJXA 4P7RA 4X9SA 4JFUA 2FZ9A 1V51A 4ROPA 4LUSB 3UWVA 4LB4A 3ZLGA 2QCNA 2XSAA 3VDGA 1A50A 2QQ6A 2VD9A 4E4FA 4H9MA 3ANVA 4FX6M 4Y8FA 2NVDA 4PCPA 4FNSA 4D6HA 4FXJA 3SDOA 1TPEA 1RJQA 3LHVA 2YR1A 5HNRA 5DO8A 4A8LA 1QBAA 3QQ0A 3W23A 4PUEA 3UJRA 2PF8A 2G3MA 4AD1A 1I2RA 5M2FX 3MMWA 3QZAA 2FQIA 4DBSA 4A3RA 1E6ZA 8XIAA 4PTVA 4WSHA 4QSHA 4QDMA 1WA3A 1FKXA 1NJJA 3U48A 2WSPA 3QOKA 4LUTB 5FF2A 3BARA 4CD5A 4FX8A 3QTGA 3NZPA 4UMAA 2CC0A 5HQEA 2RDUA 3VXGA 3BDKA 2BMBA 3SQMA 3CQKA 3QH2A 4EPBC 2DEPA 3KBVA 4FNPA 1XLKA 1KFKA 1M5WA 4AZCA 4MAVA 2XM2A 3MBDA 4PA8A 1IGWA 3GXFA 1KFEA 2GDVA 1BF6A 1XJBA 2J74A 3DFPA 1DIDA 3NCOA 3PNZA 3GE7A 1C7TA 3NZGA 2V8ZA 2WLZA 1DJXA 2ZFAA 2VWTA 3SY8A 4XTDA 4A4AA 5FCZA 1DWJM 2CW6A 3LHUA 1VCFA 1C92A 1FWHC 3FGCB 3D5HA 4UQDA 4AWEA 1E51A 1FWGC 2HE5A 2V5KA 2OZ0A 3WF4A 3V16A 1Q6EA 4AVFA 4QTGA 3MANA 4G6CA 3NQCA 2J8TA 4WIWA 4GI9A 3T44A 4KBXA 1F5ZA 3BICA 3WCZA 3D0CA 1ICPA 5BCAA 2XIOA 4XO6A 1AJZA 1FP8A 1O60A 4C60A 2PDYA 3S9ZA 4EP8C 3P60A 2WKLA 3DAQA 1YBQA 9XIAA 1Y5VA 4UR7A 2VFIA 3EDEA 3RX2A 1Q6DA 4GI4A 4G9PA 4I6VA 3EWZA 5J04A 3WDQA 2EJ1A 2FMOA 5CC3A 3PUEA 4DF2A 3NEVA 1JCYA 1TTJA 4AIBA 3KDNA 2PP3A 3ZZ1A 1BHGA 3K8LA 1AMYA 4XIAA 1TRIA 2QCDA 4AU0A 2VR4A 5LNUA 1OFDA 5EMYA 2OX1A 4WGXA 1S2CA 2QUVA 3TN6A 1ITXA 1JQVA 2DJLA 4TX9A 4HNUA 3UZXA 4OVXA 4D6DA 3VZXA 4DX3A 3A64A 1ZAHA 3BCDA 8RUCA 3AWOA 5L6UA 5LYRA 1XL9A 3SUSA 3MUIA 3OIXA 2WXDM 4UTKA 1X8FA 3N29A 4RK8A 5EMMA 3WBEA 3TVAA 1TV2A 4BFAA 4XG1A 2PODA 3RCMA 2HVMA 3M5XA 4NIRA 4J2PA 3PNUA 2HVOA 1DIEA 1K4GA 4JTJA 2I9EA 2UZ9A 3UA4A 2GSJA 3F4WA 3S2LA 4L6HA 3H26A 4FF5A 4MWAE 1SUXA 1UWTA 3C6CA 3OIHA 3FKRA 1MEIA 1RJPA 1SM9A 5XINA 2FTYA 1WDWA 4U10A 4PMUA 2RJGA 3FYOA 3W83A 1QASA 2CZFA 2ABAA 1CGVA 4B3ZA 3ALGA 1CIUA 1JFHA 4XAZA 2IS7A 1P6WA 4G7EB 3GXPA 2H3BA 4L5ZA 2O9OA 3PPGA 3M6DA 3V75A 1RJRA 5CSSA 2HXTA 5PTDA 2WKJA 5K7JA 1C29A 3PZ9A 3CO8A 4PTMA 4PMQA 1WKYA 1ADOA 1BKSA 3GH7A 4Y7EA 3IUHA 1J12A 1MUWA 3L4YA 4S3AA 4MGGA 4IFOA 1EUNA 3TQVA 1UP0A 1J8VA 2FPYA 4M6PA 4C6DA 2YIHA 1EGVA 4D2JA 3IVSA 2OG9A 5BROA 1TSIA 3HF3A 4MJMA 1OGBA 3RNDA 3HG3A 3PWGA 3G8EA 4R9XA 3VD9A 3GUGA 4JIRA 3JW7A 2QR6A 1FP9A 4MB1A 3NPWA 1ISZA 2UBPC 4W8LA 5HMDA 7PTDA 3W7IA 3BANA 3VKCA 4OUIA 1UQZA 3W7QA 3AIUA 4OWGA 3GW0A 1QATA 1H1NA 2YKKA 4JFWA 5I79A 3LDVA 2FVMA 2O55A 1MW2A 3H2FA 3JUGA 3CASA 2VX7A 2OGJA 1H09A 3EDKA 2J7CA 4IJCA 3H6OA 4JN8A 4DBEA 3K8MA 4GVHA 2Z4GA 4PSPA 1E0VA 2QMKA 4UQBA 3PPCA 2C16A 3H4GA 3G77A 1UA3A 3WH9A 3AZTA 3ARWA 3N73A 1XIIA 3VGFA 4UCFA 1WYIA 2V2CA 3VMOA 1QPQA 2X2GA 2YW3A 4K6AA 2CLMA 3IJQA 4FR6A 1XRVA 1FDJA 2WNZA 5LZLA 1GVQA 1UUQA 1TPWA 2R91A 4DZHA 3G1AA 4XB3A 4DBWA 3ARZA 5FJPA 2OEJA 1IIGA 4XBKA 1OX6A 1QPRA 2HBVA 2WMHA 3E74A 1VCVA 4I9JA 3TC7A 1GVEA 4RV8A 4DXKA 5AVNA 1E9IA 4GKLA 3L7RA 1E6NA 5D30A 1H1YA 2YBUA 1OYAA 5TBOA 2O0TA 1ZHAA 1ZBKA 4PMYA 4AIUA 1A4LA 4OOUA 1BYDA 3GVVA 1Y5WA 3O6DA 4DVOA 1TVNA 1EL3A 4DZIA 2WOQA 3FGCA 3Q37A 3GG7A 2F2KA 4O1FA 1V93A 1XLDA 3B8IA 3BLKA 1E9YB 3QMRA 3S5NA 3UZYA 3ZYZA 3RO6A 1KBBA 4IIEA 2YCLB 1UH3A 4FLQA 1XRFA 3VGBA 3NVTA 4JKKA 4ATLA 1X6LA 4I5UA 2I17A 3BAWA 3MSDA 3UESA 5FJUA 1QO2A 1V03A 3N9RA 3U7VA 4LY8A 3U3HA 4HN8A 2ZA1A 2HSAA 4US5A 4ZE5A 3BH4A 3EEZA 1W1ZA 3RJXA 1NM9A 1QHOA 3VE9A 4UR8A 1X6UA 5B7ZA 4UTTA 1U1JA 4DNHA 2I5QA 2RDXA 2C19A 4PUUA 4N42A 4EXQA 5A2AA 1L6SA 4ZB2A 5BXRA 4AY8A 1XLIA 2OMAA 4KCVA 3EWUA 3TLQA 3W76A 1K03A 4BQ3A 1NP2A 3R7MA 4H2CA 1XCFA 1ICSA 1DKWA 4IMFA 5I3KA 3W2LA 2VX5A 5EB8A 1TZZA 1GORA 4B5XA 1IT7A 3RMJA 3C0SA 1GVIA 4ICMA 3EYPA 3VPLA 4BCEA 2DH3A 1AW2A 3F5JA 2E9LA 3FW6A 3N25A 1NFGA 4FNTA 2RDWA 4ML9A 1HVXA 3FYYA 2XIMA 3B8TA 3HJZA 3WBAA 4I9TA 1TKKA 2I16A 4IT1A 1OB0A 4ZEPA 1QPOA 3Q67A 1LWIA 2HWGA 3WF0A 1B9BA 1EEXA 5I3FA 2J79A 4R27A 3OHMB 1FTXA 3W88A 3B8VA 5IDZA 4Q8WA 2D2HA 4XWUA 3BSHA 1LLWA 2X41A 3DFSA 1A0DA 1XHGA 1QNSA 2YDSA 4OV9A 3LPPA 4NVTA 2E4TA 5L9FA 3V0UA 3N18A 1YMYA 5LNSA 3F4VA 3RM8A 1OX5A 1K7FA 1A0EA 3W24A 3W53A 3EDJA 3SCVA 2Q8ZA 2J7HA 1S2TA 2PLKA 5E5CA 3QW4B 5D9OA 3GG0A 1EBHA 1H4PA 3CS2A 3AS2A 4H04A 2XH7A 4ZB0A 2Q71A 2WC3A 1HT6A 1OM0A 1DWIM 3AFBA 3UR5A 2ZWYA 1OK6A 3GU1A 1EP2A 5EMKA 3WENA 4G7EA 1F8MA 2GUYA 4CU6A 4NZ5A 1F3EA 3VNLA 4MWAC 4O52A 2OCZA 2ANUA 5CGMA 1OYBA 5BRBA 3R11A 2CIPA 3GXDA 5EMUA 1GJUA 5HDRA 1BVZA 1XICA 1PSCA 5H6HA 3W2KA 4H2HA 2CBVA 3RF9A 3C0JA 5MKGA 2NXIA 1G4SA 3SJNA 4GACA 4MZ8A 1FWIC 1I8JA 1SZRA 5CSYA 4WX2A 2XVPA 5FL1A 1R9YA 3TNBA 1UMLA 4JD4A 5A6KA 5B7YA 1F73A 1OBAA 3B3DA 3WN6A 4INFA 4DPQA 3WJZA 4JIIX 4QFUA 4XSMA 2OLHA 4UIOA 1PAMA 3MHFA 3APYA 4JTUA 1JRBA 4JFTA 3GVQA 4OKDA 1NARA 2NLYA 2RJHA 5E1QA 1L0PA 1GHSA 2OU4A 4NX5A 4W7VA 3CGTA 4TXEA 4C1KA 3KWXA 4DPPA 4AQLA 4QLJA 5DCDA 2BGSA 2Z6JA 4JEQA 3W6YA 4JY9A 7ODCA 4ES4A 2AGKA 4NJKA 4N9BA 4HB7A 1AL7A 1QNRA 3EWYA 3SO7A 1TO3A 2YCJA 2XH2A 3B40A 4QCFA 1E4MM 1H49A 5J5RA 1SJAA 4E8DA 3ARRA 5ECUA 1YE4A 3TYAA 2ZA2A 2WJDA 3FJ4A 4XUYA 1JZ4A 4HYVA 1UR8A 3LMYA 1SJBA 3WEZA 1CXEA 1TA3B 4W88A 3FSUA 1XRTA 2W91A 2WVTA 2ZTKA 1EJUC 3MSRA 3NVDA 2C8NA 4KCWA 3OG2A 4KKXA 4LAOA 2PLCA 5D33A 1M7PA 2BVYA 3QV8A 1W5PA 3NXFA 4OZOA 4XZNX 1V6VA 2UY2A 1K7XA 3QF0A 1V6UA 3MP3A 1YXCA 4LBUA 4HGXA 2VCBA 3A24A 3AS3A 3CB8A 4GJJA 2WMFA 2DDXA 4I3GA 4UB9A 3M4HA 1Q2SA 1JZ5A 3VZZA 3SCWA 1A80A 1T96A 3KS5A 4AMAA 3DC8A 5CXPA 2CBIA 2QJIA 4ZXLA 2HS6A 4CNPA 1HIZA 2V3EA 2DY3A 3MP4A 1TVLA 4MDOA 2GDQA 2WMGA 3AMDA 1Q45A 3CM4A 3CUZA 3UZZA 4ZO9A 4US5D 1A3XA 3N34A 1XX1A 2OVLA 4QE1A 4X0VA 4IPPA 5CC7A 2Y5EA 2PURA 5CPLA 3VIHA 2YCLA 3B9NA 4HNTA 1TV4A 3F5LA 2QMJA 1ECEA 4C6EA 4O53A 4X60A 3DZ1A 4IMCA 1GOWA 1X7IA 4HHPA 4DELA 3TOYA 3HV9A 3E1F1 2WSRA 4EIVA 3LPGA 4UFKA 4AIEA 3GX9A 2OGYA 3LPFA 3BO9A 3AAMA 4G2DA 1G5AA 1U33A 2JGYA 3PG8A 2G96A 3VIFA 4XAGA 3V35A 4OQVA 3SCOA 4QROA 2Q6ZA 2NQ5A 3WUBA 1P48A 1TJ2A 1AJ0A 3R8RA 4MJ4A 3MO7A 3B0YA 1X39A 3PVFA 3TC6A 3UPMA 3CQ0A 3TH6A 1RK5A 4ZTXA 1CENA 3W7HA 1C7SA 4I7VA 1QWKA 3LS9A 4LJ3A 2BASA 5I3GA 1JYVA 2ZKMX 1Z7AA 4HMNA 4QXIA 4K36A 1QT1A 4G56A 4QEHA 3RU6A 1DJIA 3KL5A 4ZQRA 4LB3A 1FBAA 2J8GA 3SBFA 2P0OA 1Z6KA 1WDPA 4O0KA 6XIMA 1EDGA 1LCOA 4L6OA 4KWWA 5CPOA 4NUWA 1Y5XA 3BCJA 4GYJA 3AU6A 2IQ0A 4KCUA 3UG4A 1I1WA 2OTDA 4RXGA 1V7AA 3VU2A 1BFNA 1D8CA 3MJYA 2DIKA 3WMSA 1I9CB 1VF8A 2J8FA 1LRNA 1RSCA 2Z00A 1OEPA 4WXZA 3I4KA 5KTLA 1G0CA 4HZMA 5F1VA 4Z1DA 3SRHA 1GYNA 1XIFA 4HD5A 4ZENA 3CUXA 1QNOA 4RV3A 1XFBA 3FOKA 3WDIA 2AGTA 2VGGA 3N04A 5FACA 5SWUA 3BJTA 5HXMA 4U5KA 4FOJA 2G50A 2QV4A 1ITQA 1IEVA 3TP4A 3LCLA 3GG8A 2BOEX 3NQVA 4MWAB 1JPKA 3AUOA 5JBDA 3LZ5A 1JYXA 3NL2A 3T0CA 2ZZ3A 3PJUA 1JCMP 1LP6A 3LENA 3S2JA 1M53A 1AZ2A 1R3VA 2TMDA 3URAA 2OPJA 4LYKA 4PCTA 3CBWA 1NY1A 4FLRA 2BDQA 1KRAC 4K7YA 5REQB 3WIJA 3VUSA 5A5WA 4GUGA 5BNKA 4BK9A 3KWSA 2P8BA 1DTUA 3FY1A 3ZJ7A 1ADSA 3C8FA 2EF9A 3KBSA 2GOKA 2FIQA 4C90A 1OIFA 4S3KA 4LVFA 3IWPA 2XGZA 2CHRA 1UKOA 5G1TA 1S5VA 4U2ZA 1VFLA 2DGAA 3PG9A 1HQTA 2QJNA 2YCIX 4HNLA 1OINA 3B0VC 1CECA 4F0SA 1I1XA 4LTSA 2R24A 4V1XA 8XIMA 1SFJA 3M0YA 3M1ZA 5D9NA 3PZIA 3KRBA 1VBRA 3VMNA 1XBVA 3GU2A 3TZNA 1XYMA 1KCXA 3KBWA 2ZUSA 4PB3A 1V3MA 2G4FA 5G2HA 3E3HA 3QV9A 4JX6A 3EPNA 2PTZA 4ZODA 3G1SA 3SJ3A 2WM0A 4IIFA 1RALA 1EZ2A 5HJYA 4QAWA 4O13A 2YB1A 1LQ0A 3IGHX 3K8KA 4XD5A 1EQCA 1DXIA 4TVCA 3KW3A 5CAKA 3N13A 3QY7A 4RDZA 4J3TA 4MVAA 2ON3A 3TYUA 4KRZA 1WZLA 3WQVA 1DIOA 2J7GA 3NPVA 3M0KA 1SPQA 2G0WA 3E0IA 3EB4A 1KFWA 3WMLA 1NQKA 1UIPA 5HWMA 1XIMA 2Z2BA 3TXVA 2P50A 5DF0A 3U2ZA 4PFMA 4RDVA 3WNLA 1V08A 2C14A 3UY8A 3MYPA 1AH3A 3H2CA 4AEFA 1V5XA 2CHOA 4MPKA 3VD4A 1GOQA 3RXZA 4C1NB 4YYFA 1OG0A 1XIBA 3WLMA 2VDIA 4HPJA 2X16A 4EACA 5DN1A 4IPJA 3W7EA 3URQA 5C71A 1X97A 2ZA3A 3AMKA 4DWSC 4DB7A 1EOMA 3OZYA 1H3GA 1G69A 3ITOA 5HJLA 3NQFA 5H8UA 2DV0A 2E6YA 2BODX 3IJLA 5U7SA 3M0XA 2X1UA 2A7PA 2D2GA 4PB4A 1Q5MA 1M01A 1OSEA 3GHTA 2VRKA 2WNNA 3BLIA 4JFSA 3L0NA 3HG2A 4P8WA 5DY3A 2A5HA 3ITXA 4O16A 1KGUA 4REQA 1J5TA 2UWFA 3B8UA 4C7FA 1Z3NA 3B8DA 4FO4A 3G1DA 3PWAA 2QAFA 1BG4A 3CLWA 3NTYA 1KXVA 1LG1A 1GZJA 4AZBA 1QAPA 3INPA 4J5NA 3G0SA 2R82A 2QCHA 3O9NA 2NQ9A 5JBFA 3CQIA 3URBA 4HOXA 3I7SA 5CPNA 3CLMA 1DJZA 1IHIA 1HKKA 4MM1A 2PSNA 4LRSA 1RA0A 1EC8A 4QG8A 4S3BA 5AYIA 1BYAA 2BVWA 2J25A 1VIZA 1GKPA 1XIGA 3H12A 5F4SA 1XD1A 1LJYA 1KD0A 2JQXA 1JZ8A 4MYAA 4HMCA 4NI3A 3BJFA 6TAAA 2GJNA 1XC6A 3GG1A 3QQWA 3UVAA 2A79A 1FCBA 2GVLA 4XZHA 1BVNP 3P5YA 2I5GA 1WE5A 2Y89A 4PB5A 2GK1B 2F9RA 2GWNA 4M3PA 3OVQA 2IKJA 2GL5A 3R0KA 2EAWA 1JF6A 3W9ZA 2Q8LA 3NQMA 2XM1A 2EKCA 1Y7VA 3HPZA 3O6CA 3VDHA 2PGWA 2YSWA 1UMYA 1U5VA 1YQ2A 4EPEC 3GTHA 1A5LC 1UW9A 4S3JA 3VOCA 2O9PA 1GVYA 1TX0A 3TXZA 4JCLA 1A5BA 2I9UA 2DORA 4XX6A 4GZEA 4MWAA 4W89A 2G41A 3DU0A 3OP2A 2FZBA 3S1GA 5C2XA 4D9PA 1W0MA 4RPPA 1TIWA 3GKFA 3M43A 3A22A 2HVNA 1M3UA 2CLHA 2HK1A 4D71A 5REQA 4G8TA 1UD6A 2P5NA 2I7GA 3IRDA 4TTUA 2E67A 1M41A 2V81A 3IIVA 2DT3A 4V33A 3ZMRA 3G1FA 1RY0A 1DBTA 1JD7A 3Q94A 1I2OA 4GIEA 4PMJA 5CGQA 1IQ8A 3HGSA 4HYWA 5I3HA 4E3VA 2ISVA 5I23A 3NEHA 3DDMA 3OGVA 3EOUA 1T7LA 1GG1A 4MG4A 1TCDA 1OG6A 4K1GA 1GKQA 2J13A 2V5DA 4PTNA 3GD6A 2PDCA 5CZSA 2VFEA 4HA4A 3W70A 2YBVA 4I7WA 3UZWA 5G4WA 3CIVA 3UNDA 2PC8A 1JRCA 1K9FA 3DOPA 3OLGA 4M1RA 1IZCA 3VOJA 4Q33A 1UR1A 3RR4A 3VOIA 1VC4A 2F7FA 3DERA 1R7AA 1OABA 4A8IA 1FHDA 2NX9A 1YHTA 4NJGA 1O1HA 2QYGA 3BURA 2VENA 4JX4A 3L66A 3W1NA 4JQAA 1ODZA 1GW1A 4DJEC 3V18A 2DVTA 2XJ7A 4AXNA 1XW8A 3PSVA 3EBVA 2CITA 1BD0A 3ITGA 4M56A 2QCFA 1E4IA 1WKDA 3SUVA 3UYCA 4H6EA 5FJIA 4RLIA 5GJMA 3ME3A 4NNCA 4PEKA 1VBUA 4Z17A 1UZHA 2NUXA 1J11A 3GFZA 4O8RA 1HJXA 2OO6A 4LCRA 2VFHA 5HANA 4YLWA 1ICQA 1VEPA 1AQMA 4F9JA 3RMEA 3W7MA 4LS1A 2PRMA 2GFTA 3OZOA 1EJWC 4KWUA 4WK9A 4G7FA 2PRHA 3CPGA 3M16A 4GX8A 4YN5A 1H0IA 5XIMA 4AD5A 2DZWA 1WXJA 3SAZA 1VPYA 4IPLA 2SFPA 3DN5A 4CD6A 4UFMA 4GUIA 4DWSB 4H01A 4XD3A 1J4EA 1CWYA 4ZQCA 2RFGA 1IR1A 3L65A 3GNNA 4L9ZA 3WBWA 3EMQA 2FGBA 3KTCA 2WHLA 3W38A 1XYLA 1S5NA 1I60A 2GQ9A 5HR6A 1K8XA 1OC5A 1EPVA 4C6PA 4PL1A 4TUFA 3CHFA 1LOQA 1HGYA 3MVTA 2OOFA 3NG3A 4DO4A 3AIRA 3KL0A 4HT3A 3H4WA 2OO0A 5T8GA 3LHWA 1MSSA 1M04A 3R43A 2Z1VA 1VBGA 2ALDA 5C9ZA 3F4CA 3W29A 1AQHA 4NSBA 2WJEA 2VC6A 3SADA 2HPMA 2QF7A 3BLFA 3OQ8A 3RDKA 1VPXA 2PWFA 3L68A 4TIMA 3EOSA 3MQTA 5D2XA 1EIBA 1AD1A 1UYQA 2WBKA 1UR0A 5F4XA 2PP0A 3FJLA 3CXOA 1ZPTA 2QDHA 1MW3A 2CEQA 3QR3A 3HMCA 3W7KA 3T1GA 3TCSA 1KXTA 1KV8A 3MI2A 1H62A 3FHAA 3U0HA 2DIJA 5I0DA 3M6YA 2WHJA 4QDPA 1BG9A 2PPGA 5TQLA 3ABOA 3IJ8A 4KGJA 4QX4A 1JJKA 2WVUA 1ML1A 3CV6A 1U1HA 2YZRA 3ID7A 9XIMA 1AH0A 1XYCA 4Z08A 2PLJA 2D2OA 4C6NA 3KCOA 4GJ1A 1VCGA 4QNWA 1R2TA 3W1LA 4HNOA 3MMDA 5T9BG 1XCXA 1Z41A 4GLEA 4WR3A 3PTQA 4GIRA 3OTRA 5LIWX 5CLTA 2W67A 2VVSA 4GABA 1G4TA 3W2JA 1C8YA 2VCAA 1CNVA 2VI0A 4CVWA 1KW1A 5FKYA 1E1FA 2FFIA 1W3KA 1W9VA 3O06A 4GO8A 4MWAD 1M7OA 4KF1A 3RRXA 1A5UA 4W87A 3VFLA 1RD6A 1K70A 1BRLB 3O63A 5D8WA 2PDBA 4M6VA 3SY5A 3AXIA 1SZEA 5LIUX 3BVJA 1LDCA 4NAEB 4GZIA 1OQFA 1NU5A 1WP6A 5J8LA 4UZSA 4U2YA 2Q01A 5GQBA 2OLAA 2BY0A 2V3FA 4MY8A 5E9AA 1KCLA 4LYQA 4Z1YA 4H9YA 4ZOCA 3APGA 3QN3A 4GX9A 3EOLA 2VFGA 3LGEA 3NYDA 2BV9A 1WBHA 2CZ5A 3W7GA 1ZS2A 1HF6A 4D6IA 1YADA 1RV8A 2LLEA 5E6YA 3VNZA 1UR2A 5EYWA 1F61A 1BYCA 4MZYA 1DV7A 3GK0A 2JBMA 2GGEA 1V4YA 2G3IA 2VGFA 3LCHA 1SW7A 1W8GA 2CESA 3S47A 5IHRA 3TW7A 4AWSA 1S5MA 3S1WA 1W2PA 1YPFA 1LWHA 1B54A 3CU2A 5D37A 4F66A 2W4XA 4JQ4A 4B3LA 1PL9A 4K7VA 3S5OA 1XH1A 3CHCA 2Z1KA 3W1MA 4GHRA 4LV9A 5G1YA 2J9XA 5GJNA 1GHRA 1SMDA 1PKLA 4Q4PA 5E9XA 4P7NA 4ILSA 1W2VA 3FVMA 3NQGA 4GWEA 4K1WA 4AISA 1ZFJA 4NL1A 5AHNA 3TDFA 3EA1A 2CYGA 2WMJA 3BAIA 2TYSA 4Q8MA 4AD0A 4QJ5B 2VQUA 3DHPA 2VFDA 3OGRA 4S3CA 4KESA 1R3QA 1ZP3A 4H8UA 3UWZA 2J77A 1QBBA 4JTQA 4GFSA 1AG1O 2WZHA 1IR2A 3MW7A 1OX4B 3IIXA 1Q65A 1CXIA 4ZO8A 1FX6A 3SN0A 2ATMA 5CZTA 3L5LA 3KS6A 4DZAA 2D73A 2XFWA 3WLNA 2ZCGA 4PN2A 2X0HA 1OZMA 4POCA 2V3GA 3DGRA 1XBXA 2XN1A 3ATZA 3NSNA 4I7UA 1J2WA 2B7PA 4FALA 1DQXA 3ABRA 3JVAA 3BLLA 4IMDA 5FSEC 2IKIA 4EPKA 1W1IE 1XYBA 1J6OA 1ONWA 2E9BA 1UJPA 1VFHA 5C70A 4DWSA 1S38A 1PWMA 3O15A 1FUYA 3EAUA 4H3DA 3UCDA 4IXXA 2KAUC 1SVDA 1VGAA 3QKEA 3O05A 5JH1A 2PDWA 2H9AB 1EJTC 1A5CA 1IEXA 3KFTA 1FXQA 1EC9A 2O7QA 5G4HC 3PWIA 4CGTA 2VDHA 2G37A 3WJSA 3WSUA 1OT2A 3HPFA 4IQLA 1WDRA 3TIMA 4PE8A 1XLJA 3JR2A 4WCJA 2PMQA 1TQXA 3AI0A 2GDUA 3WUEA 4ERAA 4JX5A 4Q8OA 3F4DA 1TPVA 3BL3A 4PUJA 4B5VA 3H70A 1XQLA 7REQA 3DYOA 3LV5A 1E6XM 1R0MA 2CZDA 2KX9A 3QBUA 3QHNA 2DZTA 4DXVA 1I0DA 2PTXA 3VZYA 1B57A 3FN9A 2PDUA 3S1UA 1ZENA 3AIVA 4CEXC 1TWIA 1NOUA 2J27A 3HG4A 3L9CA 3H55A 1EGZA 1FWNA 1YW1A 4UQ9A 3TYEA 3IJ9A 1M7XA 3M7SA 3QMTA 2WSYA 2C3ZA 2PE4A 2Z6IA 4HSHA 1HKJA 4DUOA 3HQNA 3BJSA 3HTWA 1YPIA 2BX7A 3M47A 4O28A 3AXHA 4E2OA 4DJDC 2XIIA 2OODA 4DBUA 1BQGA 5KZEA 3ECQA 4JOMA 4UFLA 1ITCA 3A23A 1YTEA 2ICSA 4JIQA 4FPSA 2XZ9A 2J9YA 1EP3A 2UY3A 1JDDA 5AYYA 4LOCA 2HDJA 1QU4A 1TJRA 2H90A 5EL1A 4IOTA 3T2PA 5CG0A 1NELA 2PCEA 4UOQA 1V0KA 2QIIA 5ECVA 2QJMA 4O54A 3E0VA 3WJYA 4GG9A 4G5DA 4QG9A 1J0JA 3CUGA 3U57A 5AKQA 3C86A 4A21A 2YA0A 1IT0A 4W93A 4Y9NA 1D2KA 4GFIA 4LV4A 4DIAA 2WZMA 1XM3A 4AIOA 2X09A 1DIKA 1KXQA 4HIBA 5F2IA 4AG0A 3V36A 1W5NA 1CGWA 4C6FA 1TIMA 4B3KA 2IXVA 1HG3A 1A5SA 3A5FA 3CMJA 4D8LA 1PEZA 1LQAA 2FPTA 2YYTA 1K1DA 1GQKA 2HPIA 4DXXA 3VD5A 1NF7A 3H22A 3LLFA 2DIEA 2GUBA 2E3ZA 2FJKA 3VOGA 3ERPA 1JPIA 1KM3A 1S3HA 4GYKA 4QNEA 1X98A 3QGKC 3BXWA 3GFXA 3A4JA 1Q8AA 4YTRA 3P93A 9CGTA 1UD4A 3MT1A 3TC3A 2Q02A 2VD8A 3QTPA 4FEZA 3O8AA 4A2SA 1QNVA 3RG6A 1YX1A 1ME7A 1UWRA 4C5YA 1UP2A 3P82A 4PRWA 1H1ZA 3O2LA 4JTAA 4PCNA 2XIBA 4AEOA 1JXJA 3WBXA 1G7VA 3VFCA 4NJHA 4UWMA 3WLPA 5DANA 1PHWA 2BWGA 2G5WA 1E3ZA 4S2CA 2QUNA 3P5ZA 4GOAA 1LOLA 2MNRA 2DW6A 4N02A 1EP1A 3UG3A 4XZWA 2CERA 1KTCA 1XGZA 1CCWB 1Q85A 2WJFA 1OFBA 3EKLA 1RCOB 4WEVX 1L8PA 1TUFA 3I3BA 4RE0A 1MQQA 2ZTJA 3BC9A 4DJEA 5RUBA 4YS1A 1ONRA 4P8VA 4U28A 3K4AA 2VKZG 2GGIA 1H2JA 3P61A 2PDLA 2H6RA 1IXOA 1NSJA 5D03A 1VB9A 2Z7GA 4JNMA 3VIGA 5A94A 3NQ2A 1TJPA 3P0XA 5TIMA 1FHVA 1OX4A 3TCEA 3NUKA 3E6EA 2BZNA 1XC4A 1MQPA 4H00A 4B16A 1P4CA 2OELA 4UTWC 1SR9A 3EPMA 4LVGA 2ISDA 2C18A 2IPGA 1QI3A 1SFLA 4YWIA 1SQ7A 1H7RA 5CZ0A 3C52A 4OFCA 1POKA 2G4JA 3NOEA 2XIQA 3PY2A 3U8GA 3DG6A 4JY8A 4RE2A 1EBGA 3H23A 4GVFA 1PX8A 3OU8A 3BE7A 3EDFA 2F6UA 1AL8A 2INZA 3LCGA 1MNSA 1QK0A 1PYFA 1UH4A 2O4QA 1P43A 3RILA 5AECA 1ZBWA 3VGGA 2JGQA 1UROA 1UUOA 3DUGA 5A69A 2C0HA 1A5AA 4L4MA 2QDEA 4ZVJA 3THUA 4JFVA 3EA3A 2GYIA 2H9AA 4C65A 3NM3A 1A3WA 1CLKA 4UFHA 3S6OA 4RJEA 3UETA 4YHEA 1Q6QA 2J47A 4BEUA 1TB3A 1H7PA 1G6CA 1QW9A 1K9EA 3AHXA 4M7SA 3W73A 4KEUA 4GC3A 1TWWA 4IQDA 4DAIA 1ME8A 3WKZA 1MUCA 3IJ7A 4DJFD 1LM1A 1S2WA 3SW6A 1NWTA 1QI0A 2PWVA 4XIMA 2PDXA 3HU7A 3IPWA 1UWSA 4LYRA 1P6CA 3Q2DA 3PZQA 3RYSA 3F2BA 3GAYA 3HM7A 2QF8A 2XGBA 1YPXA 1GQLA 4CUCA 1H50A 2PDGA 1HP5A 3GY1A 4NNBA 3L4VA 2C6QA 1PE1A 3GDMA 4J3XA 4W5UA 4FXRA 4ZXOA 3PK7A 3QYQA 4XZ9A 1XLGA 2HNHA 3AYTA 1AVAA 1H7NA 3NNTA 1B3YA 2Y7GA 3CTTA 3EXSA 4WLCA 4A6GA 3PUGA 3B0UX 4UXDA 4AEEA 1THFD 4JEJA 3W2UA 3BK0A 3PJXA 1OD0A 4Q3MA 3THQA 5LA2A 3VO0A 1TE6A 1SSGA 3XINA 4W5ZA 1DQUA 4IX0A 5BOFA 5I24A 2EHHA 4PUKA 1VH7A 1QI2A 3TYCA 3K1GA 5KSWA 1JQXA 4E3TA 5AC6A 5LNWA 5C2GA 1JPMA 2TRSA 4QQUA 1EDTA 5DXYA 1VBHA 3ARQA 1O5RA 5CZKA 2BXZA 4LW7A 5HPCA 5LHFA 5M03A 4PFHA 1G1YA 2JKAA 4JXCA 2I14A 4AVOA 4O1EA 5IXEA 4KERA 3N2OA 1BGAA 4UNIA 3AZSA 3S5ZA 5C9XA 5AC7A 2JFEX 3GQYA 3SQSA 2ZRXA 3UP8A 3W86A 1TFVA 3F2CA 3RFAA 1DHPA 1B3ZA 4LEQA 4P61A 3T8LA 4KEZA 3FK4A 4KEMA 4GC4A 1UBSA 2VUYA 4Z1BA 3HO8A 5LXXA 4PR4A 2BVDA 3HN3A 5FAGA 4NY2A 3LA4A 1JCJA 3E02A 2A85A 2XIJA 2XSBA 4MKSA 2ONEA 3WK1A 1RVGA 4HQVA 1HL8A 5A95A 4A3UA 3NYZA 3GC5A 3BLPX 4JTKA 3LRMA 1TTIA 4PMXA 1J10A 3LXCA 4HOZA 4UQEA 1E15A 1KM1A 2BSLA 4B5NA 3WFAA 3WH8A 1D3CA 3R8HA 2C13A 1WDDA 5FESA 4EXAA 3IEBA 3P2VA 1VAHA 3EX6A 4J28A 2G95A 3ITLA 1S2AA 1JR1A 4U3AA 1E0WA 1B90A 4ZQOA 3T07A 2HCVA 1XH2A 3N2BA 5CZJA 1TR1A 1OFQA 1JYNA 1PX4A 1P1MA 4FB7A 3VKDA 3GNDA 4WVXA 3OLDA 1NFPA 2PTWA 3TN4A 4KWSA 2B7OA 2Y7FA 1BQCA 3IANA 4ROQA 1PIIA 1R3YA 3F2DA 3MKCA 4FLSA 3SFWA 3HBLA 2ZX6A 3BTNA 1KFCA 4E4PA 1YNPA 1CW2A 1SFTA 5HJXA 1XSJA 3PP7A 4CQAA 3GC2A 2CLFA 3SCTA 2D0GA 3ZSSA 2Z28A 5DQPA 1MEWA 4IJRA 2C15A 4XBJA 1E4NA 3EEGA 4I9AA 3VC6A 1HO4A 2VZSA 3KDOA 5ABEA 1MXGA 4BA0A 3VABA 1F3XA 3VNMA 2J88A 1RPXA 1BLIA 4NZCA 2V5LA 2YLLA 4LF2A 3CUHA 3PFMA 1XINA 4R7JA 2YDQA 4GNVA 1FY6A 1P7TA 1W1TA 4FR1A 3OYXA 3T81A 3WUGA 4C91A 4QQ3A 3GNXA 5I2UA 3UERA 4PMZA 3IGXA 2TPSA 3UPWA 3RHGA 3URNA 1WO2A 4Q8TA 4LH8A 4H8VA 1EKOA 1WBJA 5C5YA 1M03A 3MO4A 3I6EA 3A6OA 3BW3A 5BYWA 4AZCB 3S2CA 3DHUA 4WY0B 2HQAA 2OWWA 5KZ6A 3OJGA 3W22A 1PVNA 3NIYA 1LYXA 4KRTA 4D8AA 4L4PA 5FJJA 1SJDA 1V77A 3R25A 1GG0A 1GVSA 3POHA 1XGDA 4GKTA 3DC0A 5XIAA 3B0XA 3NL3A 4RX0A 4UTFA 1GGOA 1E1CB 1HNYA 4DLMA 4ECLA 2VNCA 1OIMA 4DYEA 3SCSA 3E5PA 1FFQA 1WZKA 1SO5A 1JCNA 4O0ZA 3ZJ6A 1E56A 2FHCA 3NA8A 4LCSA 2ATSA 2YL6A 3PAJA 2YB4A 3CV7A 3JU2A 3W84A 5A1AA 4TV5A 2WCAA 4MB4A 2DT2A 5B80A 4QRNA 2ALRA 2QUTA 1YBQB 4H19A 3T7VA 3MV01 1HX0A 4X2PA 1H7WA 8TIMA 1UD3A 3LV6A 4CCZA 1B5TA 4DJDA 3CPRA 4IL2A 3GBEA 4XTIA 1Q2RA 7TIMA 3W28A 3G0UA 4TVUA 1LOSA 5C7VA 1BWLA 2DW7A 2F2HA 3VNKA 2AQWA 2E1WA 1G4PA 4P2VA 2J7FA 2WW5A 4RDWA 1V3JA 1IZKA 3GXTA 2QCDB 2D3NA 3F4NA 4UTTC 1EJRC 3LM3A 3BLEA 4J3UA 3VNIA 1TWSA 3TAOA 3W2NA 1RUSA 1DJWA 4XO7A 2VXNA 4FNUA 3L4WA 4M1BA 1TG7A 4PRTA 3PF3A 4MB3A 4MNJA 3G2GA 1XXXA 4EWND 2JIWA 2AAMA 3NOYA 3AISA 4TVDA 4ZFMA 1TUXA 3PTMA 2PWEA 4F3HA 4NAFB 2B81A 2Q8XA 3RUBL 3U9IA 4TQTA 2DP3A 4OECA 3VILA 3OZMA 1XBZA 3G1XA 2VC5A 4QBXA 1TELA 1OFEA 3BAXA 1VHCA 3ZOAA 3W1UA 3MDWA 3BQ5A 1XIJA 3WQDA 4HCDA 1T5AA 3P3BA 3THCA 2NVAA 1S1RA 4HHHA 5HMFA 2A21A 1FHLA 4E2VA 4NXSA 5ABFB 2BNJA 4H8NA 1J6PA 4PUMA 2XVGA 1WKFA 1UKSA 4BI7A 4Y9MA 3LD5A 3C4UA 4MKNA 1R3TA 2ZZ1A 1HVQA 3CUIA 3GTFA 3W1QA 5M1TA 3TTQA 1OFOA 3I6TA 1TV5A 1GVRA 1ZALA 3VIIA 4O1AA 3CWOX 4JN7A 1Q7MA 3UZ5A 3S3GA 2A7NA 1E6RA 1KFBA 4QHRA 4PBGA 1LBMA 3LYEA 1GK8A 3VGEA 2XSXA 1K7EA 3O6YX 3RR1A 4AZHA 1V3IA 4GXPA 4F0RA 3KRZA 2BLEA 1OFAA 3WLKX 3GTNA 5CEWA 1DWGM 3CH9A 2PDHA 2ABBA 3T78A 4AY1A 5A8QA 2DZBA 1OC6A 4CN1A 4N6FA 3MWAA 3RITA 3HG5A 1E0TA 4JCMA 1VEOA 2X0SA 3W26A 4LVBA 5BXSA 1I2PA 2X30A 1H7XA 4XAFA 5C8BB 5LIXX 1UC5A 1QO5A 4ZO6A 2ZZ5A 4UQAA 2ZVRA 4O18A 3KLLA 2BTMA 2AAAA 4UTWA 1K6WA 3PB2A 1FWEC 3BQ6A 4YYCA 3GSMA 4IG2A 1GNXA 4UC5A 4AYGA 2GQAA 1C9WA 3GFYA 3AXKA 1JG9A 4ZA0A 4LUYA 3LHYA 1GZGA 2D1ZA 2GVGA 4ERGA 2EKGA 1UZDA 2ZC8A 3EMCA 3FYPA 3GDTA 3NZRA 1QJWA 5AYXA 3T8QA 2ZZ7A 1BTMA 4TOQA 2GLKA 2YA2A 3KUMA 3LZ3A 4BI6A 3N9SA 2D22A 2OQLA 3U5YA 3WUFA 4TV6A 2WAGA 5DRIA 4DM2A 1F6KA 3AS0A 3AO0A 6TIMA 2O9TA 2VZUA 1TJ0A 4AZ5A 1I45A 4RDYA 2J24A 2ZXDA 3REQA 3K5XA 1YLVA 2W9MA 1DJGA 4PZVA 4WGHA 1BTCA 1P0NA 4Q6JA 1G67A 3VGHA 1EX1A 1FWSA 1HKMA 4JYEA 3K4WA 5BU6A 5F2GA 4RZ6A 4IJBA 1SO3A 3W7DA 4F2UA 3OPSA 3MU7A 3R12A 4WY0A 2POZA 3EOOA 2FVLA 3VC5A 3B05A 2E25A 1UKQA 3AZRA 5I78A 4QSFA 1ALDA 3L23A 2PDMA 3SZ8A 4UNKA 4YVXA 1UA7A 3QW3A 3CL8A 2HBXA 1EHNA 2J7DA 1VFSA 1K8YA 3TFCA 1E1CA 4P7LA 5JMUA 4DJDD 2BS9A 4EX4A 2NWRA 1DL3A 1R85A 4V15A 4BJHA 4XAPA 1GONA 5G2IA 4GVIA 3K4DA 2V2HA 3VDCA 5KZMA 3P0WA 3G3MA 2XHYA 2WANA 4JDYA 1XPGA 1OCBA 1UB3A 4PMRA 3UQNA 1E4LA 3TSBA 4M19A 1E3XA 4HP5A 3VOHA 3SN1A 5DMNA 3IAPA 3QSTA 3ZT7A 2ZYFA 3QZEA 2Z1BA 3EX4A 1UR4A 3P74A 1KRMA 3N15A 3LCFA 3IV3A 2HJPA 3DX5A 2XINA 2EGZA 1ESWA 5CCZA 2WMIB 1LLOA 2NQHA 2V0TA 2CZEA 3TW9A 4WDXA 1PV8A 3NURA 2GUUA 1MDLA 2PP1A 5FIPA 2J7EA 6REQB 2RHGA 2GJPA 3EB3A 1GOXA 1H63A 1QNQA 4X61A 2Z1XA 1PTGA 4XSLA 3VDAA 2IQDA 3B04A 1BSLA 4IL0A 4NILA 3GYCA 1V7YA 3MUCA 1HP4A 4OE7A 3A9BA 4Z2LA 2PDNA 4V1YA 4NAFA 4L9YA 2XFRA 4GH1A 3TJ4A 3FLUA 1M9HA 2PCQA 3WELA 1SO4A 4GZ7A 3R0UA 4XBSA 1R3SA 5FA5A 3BAKA 1P0DA 1N8FA 4HZ6A 1GOMA 5D2TA 3ISIX 4QIUA 1HUVA 4JIHA 1IEIA 1O7AA 3CIXA 3C2VA 4CEUC 3TX9A 4Y6GA 1F4HA 4R3UA 3V1HA 2BXVA 4UTIA 3TK7A 3K2GA 1N8WA 3LUTA 2IQTA 3PZTA 5ENLA 2OWXA 1W1A1 3PR2A 1NDYA 4JBRA 5ABFA 4KEVA 5FF7A 1O5XA 4TMCA 3SCNA 4UTJA 1US3A 1H51A 2XFFA 3QOMA 4X63A 3VAVA 5FJRA 1P1XA 1EJVC 2JKEA 2ZC1A 1KR0A 1J0IA 1XDLA 2CZVA 3ONBA 3QGAC 3LERA 2VM8A 2CKSA 1B4KA 4HSNA 2VGIA 3GHRA 2OT1A 4AHQA 1RBAA 1UPMB 1PIGA 3ZWSA 1OGSA 1YIXA 4BQ5A 3QSRA 5I3JA 3N17A 2AL1A 2AMXA 3RLGA 2FH8A 1JDCA 2NQZA 1V6XA 4O14A 4YTUA 3S83A 4XUGA 1J2BA 3W7RA 2CFFA 3B8SA 2R9RA 4AX6A 5MKGB 1YNQA 3N4FA 4RNHA 3KTSA 1MZHA 1TV7A 1Q13A 1J0HA 3O0KA 1ZL1A 3MWCA 3R0DA 2I5IA 2P1FA 3CZLA 2BP1A 4HU0A 4HA3A 1SR0A 4JTIA 4N6EA 3WK3A 2GPTA 1PJ9A 1W1YA 4JHZA 1FDZA 3N11A 1J0ZA 3TQPA 4FNQA 4B91A 1XYFA 5AYBA 2A3HA 3HPSA 3AIEA 1R2SA 2AQVA 4EAMA 2WPBA 4QJ4B 5GVJA 1Y8BA 5CPSA 2VZVA 2GJRA 2WCGA 1ZY9A 4CN4A 1FCVA 4X2RA 4B15A 4NG3A 3M5ZA 1RP8A 3P8JA 3MTWA 1F9CA 3CIWA 4AB4A 1W9UA 2V30A 2R1PA 2VVNA 2DFAA 4YTTA 5HNUA 1IXPA 2R1MA 4W9TA 3UD6A 5DCBA 4JTCA 3UCQA 3U2OA 5DBTA 4JICA 3CQJA 2D20A 4P8XA 4U33A 5C2CA 3T9PA 2GQ3A 2QPSA 1F76A 3NPUA 2GZXA 3C3UA 4Q4SA 1QMLA 3A4XA 5C9RA 2NWSA 4M7TA 3AOFA 3UZJA 3KOWA 3IARA 4H9UA 5K9CA 2WO5A 2GJLA 2QLYA 4WOQA 3VKAA 3WDHA 4KW2A 3AYVA 3S8HA 4HU3A 4UMCA 4YVVA 1AW5A 4J3SA 3WQFA 5F7UA 2PS2A 3LY0A 4F79A 1FHUA 1MFVA 3HFTA 3LLXA 4QE5A 4BWLC 1OCJA 1IXNA 4PTDA 3ALFA 1GYMA 4YTQA 1HXJA 3QEZA 1W9PA 1EA9C 2PDIA 1DYSA 2Z24A 2Y7DA 4RCXA 3I3EA 1F6PA 1W32A 5C9UA 2ZX5A 3B8WA 1P0BA 1B9ZA 1GEHA 4OBSA 1IWBA 1XG4A 2XVKA 3W1AA 4Z0SA 5C54A 1E6QM 2D24A 5D2VA 4ERIA 3A13A 3QY6A 1H5VA 4EF8A 1VPQA 4Q4MA 4PUWA 3WZ0E 3O6AA 3CUFA 5H8PA 3WNMA 2RDTA 3L2MA 4GY1A 4RZ5A 4C6JA 5A2CA 4J27A 4WF7A 2Y8UA 4ZMGA 3A3WA 1CT5A 4GUFA 3VD3A 1SW0A 1E9LA 3FEMA 3AQUA 3KHJA 2WQDA 3C2FA 4W85A 3MSGA 4PSRA 3SSJA 1ZZMA 1YXDA 4DQWA 4Q4KA 4KCTA 4AVNA 2WMIA 1FOBA 3S9YA 2IPWA 3DEQA 4IPIA 4IGMA 4NYYA 5KEZA 2JK2A 1RQEA 3TTOA 1VFUA 3D6NA 3N2CA 6REQA 2DZVA 3KOZA 5KZDA 3DFQA 2OYLA 2DPEA 3G18A 2VX6A 1UWQA 2WSKA 1R38A 5LHEA 4LY4A 4ENLA 2Q09A 4U5IA 4LU0A 2X8RA 4LS2A 3S5YA 1FCQA 4Y96A 3OHIA 1OD8A 1Z42A 2VOTA 1R30A 1V8EA 1JI2A 2CBJA 1UWIA 3PM6A 2DH2A 4A2RA 1CLXA 4CQBA 4WQ6A 1VFOA 2E5BA 1C9DA 4WD0A 3TMQA 2A3AA 1AW1A 3U4FA 3L4XA 1H0GA 3SRKA 2OLSA 2NW0A 2DUXA 4Q7BA 4GYPC 3G22A 1T40A 3MUXA 1O4UA 1MRAA 1X1OA 4ATWA 4R5EA 3IRSA 3LHZA 1MMFA 4QM1A 2GVJA 3FA3A 4IISA 2DZPA 4LUJA 5M5DA 3L12A 5IBXC 3GYEA 4LNYA 2CLEA 5ABHA 3WQOA 1T0OA 1L9WA 3LCWA 4HKPA 2WPGA 2W63A 3VCNA 3PBYA 3K1DA 1JZ7A 3HA1A 5DFAA 3W7CA 2PLMA 2E7FA 1E0XA 5I00A 1QNPA 5DLCA 1FFRA 3ANYA 3E5BA 1ODUA 3LBMA 4RW5A 2DT1A 1KM2A 4N0RA 1TPC1 5JU6A 2Z2UA 1QRQA 5BOEA 2ISSA 2HMCA 3NWRA 3D47A 4HNNA 4PEEA 4FOUA 2D23A 3UU0A 4PMVA 5EBUA 7TAAA 4F4RA 2W79A 1OADA 2BHUA 2YLAA 5BMWA 5D32A 3WK0A 2NZLA 3T05A 3GR4A 1S5WA 2UY5A 4ASTA 1XQKA 1ZP4A 3QR0A 3AJ7A 5U4NA 2WV8A 4N2YA 4NU7A 2BVTA 2QS8A 2P10A 2ACUA 3CZJA 3ZS4A 4LS0A 3CV1A 2DSVA 3WDPP 5BWFA 1GPWA 4MLRA 5GPRA 4E8CA 4L65A 1W54A 4LX4A 3MP5A 4XZMX 1JULA 1VLIA 5AHIA 4Q6XA 1K02A 3FFSA 3N4EA 1QI4A 4YCPA 3C61A 1FH7A 4E0CA 5BW6A 2XN2A 3HIJA 3P62A 1W9XA 2ACQA 2JKPA 4PUNA 2GVEA 1VYSX 3USBA 3H7VA 1JCXA 3ZLFA 1XI3A 4CCDA 4QLLA 3L5MA 4OIFA 2IMRA 3WFLA 1RZMA 3VX0A 2G3NA 2WWCA 5CJNA 3S46A 1YDOA 4FIQA 4S23A 2WCSA 2WBGA 1GYLA 4TTGA 4K68A 1NDVA 4A35A 1LUCA 3LEPA 2QGYA 3VCRA 4GY0A 3OVGA 2Y2WA 2FZ8A 3WLRA 3OQEA 1XYAA 1BGGA 1CXHA 3Q45A 1UIOA 4HNVA 4M29A 3WNNA 1XD0A 4B90A 2QVNA 3PJWA 3R79A 2D0FA 2Y8VA 4E4UA 1EA0A 3ARXA 3RCNA 3A9IA 3S1XA 2NUYA 3ITVA 3DFHA 3VGDA 4B5SA 1PZ1A 3CUJA 2PDQA 2X1RA 4BF5A 1EEPA 1UZ1A 5KITA 5G5IA 4AD4A 1JUEA 3NO5A 1H60A 3SECA 1J96A 4KQNA 2OB3A 3WFZA 3WD4A 1OF8A 2E77A 4CQDA 2V3DA 4IFKB 4YWSA 1L2UA 3OO2A 1S39A 1B2YA 4JR5A 2YL5A 3T2OA 4HMDA 1ENUA 1NFBA 2QZRA 5E0KA 3QR1A 1YDYA 5AC4A 3QY8A 4JTTA 1EZWA 2VX4A 3GXMA 1E73M 3S0CA 1A3HA 5HWJA 3TTEA 4REQB 1KTBA 4MTVA 4H9TA 3ABZA 2JEPA 5H91A 4H4IA 1V6YA 1HW6A 4W84A 2ZUNA 3BG5A 3H2MA 3WJWA 2Y4SA 2VEGA 2ZXQA 2D2JA 3VUPA 1FQ0A 2Z1SA 9RUBA 3M0ZA 2VELA 4LWWA 2P0IA 2E6DA 4HNCA 1LT7A 5BZAA 4BZYA 3FVDA 3P84A 1KR1A 2QPUA 4NZ1A 3W37A 1LT8A 4UOJA 4ACYA 3K46A 1OVDA 3ENLA 4XD6A 1C3FA 4XZBA 4CKQA 3VDBA 1EJXC 1VQTA 3BMXA 3IACA 1HKVA 2VEPA 1NWUA 3NL6A 1RVKA 4IICA 5EY5A 2BY1A 3QPZA 1POJA 4M8UA 3W1TA 3WQEA 2GWGA 3TJLA 2DSUA 2XWEA 3CTLA 1LTDA 1S5TA 4KWOA 4JNYA 3KOYA 4NHVA 4XAYA 1XCWA 3V5OA 1QOXA 2QVHA 3O0FA 4CNSA 4JNZA 2B0MA 3A3HA 3WLHA 1F6YA 4NZFA 4I5XA 2WZEA 5H8MA 1XS2A 4GXWA 4D1JA 3BGAA 1E5NA 3OGSA 2GQ8A 4LAKA 1NTHA 5BRPA 5AB3A 1U83A 2IW0A 3EB2A 1PHQA 4QS6A 5DT7A 3T09A 1EF2A 3SIMA 3SRDA 1ZJHA 1PDYA 4J9JA 1DWFM 3CT2A 3TA9A 4XKMA 3PUDA 3LBOA 1FWCC 1WDSA 5HAOA 3CB3A 1NOWA 4Z1AA 2OX4A 3AYSA 2EQDA 1PTAA 4YNGA 5I06A 3C2OA 4GUHA 5D2YA 2D3LA 1M6JA 2YA1A 5HMEA 2EPLX 1RK6A 1Z32X 3OVPA 2FDMA 2V9DA 1W56A 3M46A 1NH6A 3W6MA 8A3HA 4FP1A 5BU9A 3TMLA 4NT0A 1ZBCA 2VHLA 1BXCA 4R53A 3LNPA 2IUZA 4QAIA 2ZUUA 2PZNA 2INFA 1EO7A 4HK7A 4XQ6A 4TX8A 3N9KA 3DGBA 2QGHA 3W72A 2OSWA 1SJCA 2ZRWA 1GZ1A 4RPQA 4W8BA 3KVMA 5IHSA 3THDA 1VJSA 4LGXA 2VR5A 1WX0A 2GGGA 3SM0A 5IFPA 1RH9A 4YMZA 3MI3A 4P7QA 4ZQMA 3SQLA 2FKPA 3V0SA 3JS3A 1U2YA 3P7YA 5FEWA 3SIZA 4PMDA 5FOOA 2A3BA 4JAWA 5TAOA 1ZQ5A 3PS7A 3MDUA 3NO3A 3BLDA 4TX6A 2BB0A 4GVGA 2C1GA 3ARVA 2EXOA 4HTBA 2L5HA 1MEHA 1LBFA 1XFCA 2QJJA 2RKXA 1LL7A 3AXXA 1R7OA 1M7JA 3GTXA 5BXPA 1HL9A 4ZTYA 3EX2A 3PBMA 1GTEA 4IHCA 3QKZA 5CLWA 4K8EA 2YL8A 2WC7A 5A8NA 5EMLA 3UEQA 3Q4DA 1G7UA 2G97A 3TSMA 3LN3A 3GNPA 4B9YA 4K39A 5LA0A 1XP3A 2HS8A 1JEZA 1REQA 4PUDA 4GUJA 1FDYA 1FRBA 3O1NA 4O8AA 3O16A 5IFTA 2NV1A 2VZOA 4JL1A 3C8NA 4LFYA 1ZJAA 2PBGA 3KEHA 4S3EA 5FJOA 4HMEA 2BXYA 3H2AA 4MHBA 1HFBA 3FA5A 2PTDA 1ZTVA 1JVNA 1JFXA 4S2BA 3TTYA 4LYPA 4Y8EA 3PTDA 3MUAA 4XK2A 1KLYA 3RAOA 1OCQA 1G01A 3DYMA 2P3ZA 3CYVA 2JF7A 1HJSA 4BWLA 5I02A 4FHAA 3T40A 1A4MA 2OFJA 5CPQA 3W71A 3GU9A 2PEVA 2FPVA 3CL6A 1T8QA 1WCGA 4X9YA 3M0VA 1BWVA 5AZ0A 4IXHA 3PTKA 3WEMA 1RPKA 2A6LA 1KM5A 2QW5A 4GA8A 1M68A 2CLLA 3SCQA 4LUIA 5GNXA 5EGRA 1B3WA 4R7OA 3R10A 1TPFA 4WJXA 1QFEA 1WZMA 1WOBA 1JZ3A 4IP4A 4ICNA 4IFKA 2C0AA 1FWWA 4ZGYA 4ZOBA 2A3EA 3KE0A 1FWDC 3RM9A 1XV8A 5BOOA 3BZGA 4ZCWA 2X7VA 3KP1A 3VIMA 3AS1A 1YDVA 3NQDA 4AZ7A 3NXLA 4M5PA 4UNLA 3E0LA 3WQ5A 2CBUA 3AICA 3WD3A 1JNDA 4QLKA 1CGXA 1EOKA 4J2MA 1OT1A 3WQ4A 1Q66A 1UQYA 2V63A 1UH2A 5CKSA 4GIAA 2VJXA 4HPHA 3S42A 1VD6A 2OR2A 1VJIA 2JE8A 2PF0A 2HZGA 2XISA 3VNJA 2Y7EA 3LGDA 4O1CA 2FGLA 4B92A 5I07A 2RGMA 3WMCA 3CH0A 4QJ3B 4X22A 1KRCC 1OK4A 4NQ1A 3CMGA 4HU4A 4DJFC 4L61A 3VIPA 2EPNA 2NSXA 3EWCA 2P53A 4I9MA 3C5QA 1A5MC 4ZE4A 2NX3A 1M1BA 2GSHA 3KHDA 2PTYA 1TYGA 3E2VA 2YCKX 2W3ZA 4GYPA 3QM3A 3STPA 4AC1X 5E93A 3M0HA 4DYKA 1EYWA 4FZIA 2PGEA 1P0KA 3IJDA 1LLZA 2YYUA 1XPYA 4LT9A 1EWDA 5EKYA 2XWDA 3AMLA 5K4XA 5IBXA 5FJTA 4NJJA 3EWWA 1KFLA 1IZJA 3P81A 1CLVA 3T4CA 1SW3A 1TCMA 1KWGA 1QHZA 4PRRA 3AIWA 3W27A 4KFNA 1VFMA 3VTRA 2WSQA 2ZADA 1XUUA 2VEIA 1K6AA 5JIWA 3E2RA 3BW2A 4FNRA 5EU9A 3K13A 1QPNA 3OEXA 3W7OA 4XV0A 4O1BA 1TWZA 1JZ6A 1QCWA 3NQ8A 4DHGA 4ONVA 1U22A 3GVWA 1XG3A 3BG3A 2OSYA 3L0GA 1VFFA 3WD0A 4D6EA 1Q7ZA 3VNYA 1BF2A 2ZRUA 2VUNA 5C55A 1ZU8A 3EPOA 4JGDA 3TYDA 1JXKA 4J1OA 1WNOA 2PGFA 3UXAA 5K4ZA 3NSXA 2E28A 3WQPA 4LAZA 1IWAA 5D9PA 1HJUA 3UY7A 4AUBA 4R34A 1QOPA 3IVUA 2MUCA 3UG8A 1RCXB 4O0QA 3OLIA 4FIRA 5HMSA 1WDQA 4IP5A 3M07A 4M6UA 4NYUA 1SU5A 6ENLA 1OY0A 1XDMA 2YFNA 2A6NA 1OHLA 4LSBA 4UTUA 2IXUA 2VO5A 3H54A 3WH5A 1HN1A 4IIBA 3W6LA 3DI0A 2H3DA 1CGYA 2AQOA 4IGNA 4D8ZA 2A0NA 4MSSA 4E5TA 1RCQA 3GWQA 1A49A 1DOSA 5A8PA 3PFRA 1C8VA 1IV8A 5JQ9A 3ONCA 1S1PA 1NF0A 2J66A 5BRQA 1TV8A 3FJ6A 3W1PA 1WB0A 3L67A 4B9ZA 2DZSA 3V5CA 4PBFA 1KBIA 3UPBA 3W7JA 1KV5A 3C2YA 3NSMA 1CGTA 3GB6A 3HGJA 4RZBA 5HOSA 3I68A 1A5NC 2DZXA 3G24A 4WHBA 1XISA 1EPXA 1T6MA 1NOFA 5DX7A 4JPGA 2H8XA 1E0UA 4TU1A 3B06A 1CEOA 3IJ6A 1TR9A 3WQGA 1LL6A 1B30A 1VHNA 1VFTA 3ARTA 4RL3A 3M9YA 4LUSA 4LRTA 2AMGA 3POCA 2CXGA 1AA1B 1W37A 3CAQA 3SUTA 3IV8A 4CCCA 4CD4A 3BV4A 1GQNA 1ZAJA 3L4ZA 4F40A 1ZJBA 3D3FA 1PXGA 2VEFA 4X0NA 4M6QA 2E68A 3BW4A 1E40A 3WLOA 1JDAA 4GINA 3KTXA 1X96A 4Y9AA 1QOQA 4A8RA 3DFOA 2Z29A 3SB0A 1MXSA 1L6GA 2MANA 4ZSUA 1YRRA 3W2MA 5JUVA 3IS4A 2DZUA 1EC7A 3VKJA 2Z0IA 3HGOA 3WO8A 1W17A 2QKFA 3DESA 3CZEA 3V4BA 4LUTA 1ADDA 3CPUA 1LZOA 2W92A 1TPH1 3WLLA 2NVCA 1GVOA 1TREA 1AUSL 4L64A 1PBGA 1K9DA 1IXQA 4ZOEA 2WK2A 2YXXA 5I5RA 2BG5A 3JZUA 3FV9A 1UBPC 1OCNA 7REQB 4C1LA 3CMFA 2XTKA 1JL8A 3LX9A 1B0IA 3WEOA 4O12A 4H7ZA 1EWEA 3GKAA 1CB7B 2QUUA 2ZE3A 3AMCA 1Z9AA 5AHEA 4IGHA 5A6MA 3ZFHA 3N2XA 1DEDA 5BMXA 1TMQA 3MHUA 4GRSA 2F38A 3GZAA 2YBTA 3KBJA 1D3HA 1LQ2A 2OKTA 3GW3A 3LB0A 3DBPA 2YXOA 4JKLA 1UHVA 1YKWA 1VBJA 4FK9A 3LOTA 1IWPA 3MJMA 3THAA 3H2EA 1MZRA 2VL4A 4FLOA 1QK2A 3MI6A 1TTPA 5GNYA 2HV5A 1A0CA