1Z69A

Crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
327
Chain Sequence
MKFGIEFVPSDPALKIAYYAKLSEQQGFDHVWITDHYNNRDVYSTLTVLALNTNSIKIGPGVTNSYTRNPAITASSIASIAEISGGRAVLGLGPGDKATFDAMGIAWKKPLATTKEAIQAIRDFISGKKVSMDGEMIKFAGAKLAFKAGNIPIYMGAQGPKMLELAGEIADGVLINASHPKDFEVAVEQIKKGAEKAGRDPSEVDVTAYACFSIDKDPVKAVNAAKVVVAFIVAGSPDLVLERHGIPVEAKSQIGAAIAKGDFGALMGGLVTPQMIEAFSICGTPDDCMKRIKDLEAIGVTQIVAGSPIGPAKEKAIKLIGKEIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethan
publication title Crystal structure of methylenetetrahydromethanopterin reductase (Mer) in complex with coenzyme F420: Architecture of the F420/FMN binding site of enzymes within the nonprolyl cis-peptide containing bacterial luciferase family
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 119
structure length 327
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1z69A00
3B4YA 4J2PA 4US5D 1BRLB 3FGCB 1BSLA 1LUCB 2B81A 1RHCA 5DQPA 3FGCA 1BRLA 3B9NA 1LUCA 3SDOA 2I7GA 1F07A 1NQKA 4US5A 1M41A 1XKJA 1YW1A 1Z69A 1TVLA 1NFPA 3RAOA 1FVPA 3C8NA 4UWMA 5AECA 1EZWA 5LXEA 3B9OA
chains in the Genus database with same CATH superfamily
4O19A 4FZIA 1RR2A 1L0PA 4K38A 3AHVA 1C91A 3DFTA 3GD6A 2QDGA 1A5SA 4LVDA 1XYCA 4O16A 2IUZA 1J0KA 3MBDA 3VXGA 2PEVA 3WMCA 3KOYA 2PA6A 4Q4KA 2EF9A 2WJZA 1R8LA 1K9DA 4ZSUA 2O7QA 3F2DA 1RQEA 4Q4RA 4FOUA 2FYMA 1XIFA 4Y7EA 3HQNA 1E56A 1TV4A 4UTLA 2OT0A 4ZFCA 4DBUA 3K8KA 1OT1A 1SW0A 3R4IA 1UWRA 3OOQA 4P7RA 3VNYA 1HVQA 3TYCA 3D0CA 3LSCA 3V0SA 3M0KA 5DCEA 3C0SA 3H2MA 5FIPA 3EDJA 3O06A 1G7UA 4NZJA 2REQA 3NGFA 3RMJA 1FHDA 2Z29A 4E8DA 6XIMA 4YCPA 2OX4A 2XH4A 2E40A 2VENA 2EEXA 5H91A 1EL3A 5HK4A 1H41A 4OU1A 4Q8TA 4JTJA 2XSXA 1HXJA 2D2GA 5CKSA 1TUXA 3IJLA 3P8IA 3VIOA 3W71A 2WPBA 4ERAA 5AHMA 4LF2A 3GXNA 4AY8A 1ONEA 2PTDA 1QNVA 3EMCA 2XGIA 4JTAA 5EL1A 4KERA 1ZP3A 3NJ3A 3NR0A 3W7EA 1HZYA 5K3VA 1GW1A 4NAFB 1SU5A 2FMOA 1P0EA 1GKPA 2B7QA 1HNYA 2WVUA 3GYEA 2V38A 2PCEA 3BLEA 3LG3A 2PU0A 1OVDA 3CUJA 4V2XA 5I3HA 1IIGA 3GYCA 3U9IA 4HMDA 4LYQA 3UXIA 3LPOA 2CLHA 4D8AA 4AVFA 4X9YA 2PU1A 3M5ZA 2DT0A 3WBXA 3LLXA 1R7OA 2HXUA 3EOUA 3UW6A 7CGTA 2W67A 2Z2AA 1OZMA 1HJSA 1FWDC 4A8LA 4ZB5A 3BICA 3IARA 2J6VA 1T96A 1RPKA 1UZ4A 4FA3A 4Q8PA 1GK8A 2WC7A 4J7RA 1BWVA 3MWAA 2WYSA 3SSJA 5F1UA 1QNSA 1LUCB 4MUPA 4GVIA 4XSMA 3K4WA 1V7YA 1UKPA 4JIEA 3DGBA 4LANA 1XRSA 1GVIA 1VFHA 1VFOA 5MF5A 2DV0A 3QQ1A 3DFNA 4JFSA 2VDGA 3MUY1 4F3HA 2C15A 4PE8A 1DHPA 4DUVA 3W7PA 4ZE4A 1PZ1A 3T78A 1MW0A 1VJIA 4JN7A 1D3GA 2PBOA 4G1KA 3HM7A 3ERPA 2OSYA 3BC9A 3W70A 4GO9A 1D3CA 2QV5A 1DE5A 4WDXA 3BAWA 3UZWA 2ZCGA 3KVLA 3W7CA 4KCUA 6CGTA 3U2CA 2CNCA 3ME3A 4ZO8A 2PDIA 2Y7GA 1A3WA 1XJBA 5DFAA 4S38A 4DPPA 5T8GA 3VPLA 3F5JA 2R94A 3NPUA 3TQVA 1TFVA 2IPJA 3LCHA 4GMEA 2PWGA 4PEKA 4H7ZA 2VNCA 3KL5A 1PL9A 2YXGA 4WKHA 2W9MA 1GKRA 2JIWA 1X6UA 1FTXA 3A13A 2F7FA 3H7UA 3RLGA 3U8GA 4PRWA 5JBFA 3KL3A 1OG6A 4G1NA 5KZDA 4QQ3A 4OOZA 2G0WA 1KFEA 3GY1A 4IUGA 4YTUA 1UH3A 1L9WA 4BCEA 3THCA 3MP5A 2OVLA 4A05A 2Z1XA 3DYPA 5A8OA 3ELFA 2RHGA 2DDXA 3UFYA 3Q2DA 3R12A 4M6PA 2WPGA 1DV7A 1QRQA 1NVMA 3VZXA 1E40A 2ALRA 1JUBA 2X09A 2CW6A 4XX6A 2G4JA 2VQTA 2MUCA 2VX5A 4LX4A 3LCLA 4MNLA 2YFNA 5D03A 5A6AA 3VE7A 4V15A 1KGXA 3WK3A 3T9PA 4PB5A 1KBBA 1V3LA 2CKSA 1ZZMA 4S2CA 2WAGA 4XZWA 3T09A 1BEUA 4GQ0A 4O8RA 1E1EA 1JXKA 3M7SA 1J8VA 1EXPA 3LPPA 4JTEA 1OC7A 1THFD 4B5NA 3WDQA 1O6IA 3WJWA 3HV8A 2WMIB 1XD0A 4PBGA 4H00A 3N04A 2C18A 4UTKA 2Y7EA 4GI4A 2HRWA 2PWVA 2Q6ZA 1U1JA 3TMQA 3CZKA 5DQPA 1I4NA 3M07A 5EBAA 2QAFA 2C71A 1CLXA 4ML4A 1QNPA 1DKWA 3GVRA 4D6DA 1VIZA 1NIUA 1E6XM 1P48A 1FVPA 4N9EA 5FJPA 1YPXA 3E2RA 2QJJA 1DL3A 2OELA 4INFA 1GZ1A 5BOFA 2CC0A 2J25A 1EJTC 1Q6LA 4IGNA 3PZIA 3EXSA 1RCXB 4EXBA 1PKNA 4ZQOA 4UTTC 1KWKA 5A2CA 2ZX6A 1WKFA 4CNTA 3HFYA 3HPXA 4H9MA 5J8LA 4HMCA 3R8RA 3WQPA 2B7OA 2VM8A 4KEUA 4Z1AA 2OGYA 5FJJA 4H9YA 2VCAA 1V77A 3TN4A 2VP8A 3KUMA 3H22A 1WB0A 3DXIA 3O16A 2W4XA 3OHMB 1Q45A 4NZ1A 2NXGA 3FA5A 4JNZA 3HO8A 1PDYA 3FVMA 1BQCA 2DUAA 2X0HA 4ZBCA 4XD6A 2C14A 3VCCA 1G69A 2QUMA 4UFLA 4HA0A 4XBKA 3VTRA 1E0UA 2A3AA 4GC3A 1JI1A 1C90A 3FIGA 4NAEA 1P1MA 4PRTA 3RLVA 5E0KA 4Y8EA 3GR4A 1OC5A 3LGDA 5REQA 2CLFA 1JXJA 4KGJA 1QU4A 1LWIA 1IGWA 1UOKA 4WXYA 2E7FA 1VP5A 1O5RA 4M1RA 4JYFA 1D3HA 4GGBA 2FZMA 1GJPA 1YXYA 3H4GA 3NNTA 3ZJ6A 2V30A 1CI1A 3VDHA 2YZRA 1XSJA 4AXNA 4RZ5A 2GK1A 4RPPA 1R86A 4PCFA 1SJAA 1K02A 4PMNA 3ZT6A 4IWWA 5FEZA 3SUWA 4MTVA 1IZKA 2O4QA 5DN1A 1O5XA 2WQPA 1JZ6A 2Z4GA 2XYLA 1OEPA 2ZYFA 3LHUA 4HCHA 3G1XA 4OOUA 3PUOA 3LS9A 1AL7A 4AF0B 5CZSA 3GDTA 4C6OA 1V0MA 1H11A 3MO7A 3WQEA 4C90A 2IQ0A 2H3BA 2IPWA 3B0UX 4HNCA 2H9AA 4Q8UA 2EBNA 4GRSA 3EWYA 3R8HA 3TQKA 4GI6A 4DWSA 1I45A 2OZ3A 5A1AA 5CGQA 3MS8A 6REQA 4MWAA 1G7VA 1DJGA 3S3GA 1JPIA 4NU7A 3V7PA 4GY1A 1O60A 4Z17A 4L6HA 1S46A 1DP0A 2J75A 4D6GA 4W8BA 2A3BA 1M9HA 1QPQA 4YNGA 3UERA 4JTQA 3JZUA 5AC5A 1AJ0A 1CBGA 3DDMA 1EYWA 2KZHA 3TJIA 3IJQA 3CH9A 4H7VA 1Q13A 1TIMA 2DT3A 4U31A 5LYRA 2QJMA 2XIMA 2I5GA 3CH0A 3GR7A 3GK0A 4PGLA 1EIXA 3LXAA 1YDNA 2UY3A 4E38A 1X6LA 2QPSA 5FSEC 4R27A 3W7QA 2XGBA 3SY5A 1XWYA 3WG6A 2V6AA 1GOXA 3PVFA 2I17A 2QF8A 3IEBA 3WDPP 2J7FA 3MTWA 1HG3A 3KP1A 1P4CA 1OD8A 3P5ZA 2UWFA 1E6RA 1XBXA 4PULA 3W38A 2EPNA 3MCOA 4ACZA 3NO1A 2G97A 3UWWA 4ZODA 3AIWA 1WUEA 3H54A 3H4WA 5HJYA 3TLQA 2P88A 2FDMA 9XIMA 1U22A 4MUZA 3KX6A 1JDEA 3MUZ1 3CHCA 3O0FA 3S2NA 4KFPA 1MW2A 1EZWA 3WIJA 1YX1A 1YLVA 3NFUA 3PTMA 2HPMA 1QW7A 4JTTA 1BWLA 1K6WA 1GVYA 3TN5A 5I3GA 2J88A 2V5JA 3GW3A 4DXVA 2JK2A 1XUUA 3LRLA 2BGSA 3BCDA 2BTMA 1T5AA 1XLBA 4DBSA 3CGTA 1OFPA 1JD7A 1LDCA 4W7VA 3HPZA 5XIMA 4ZZ9A 1GCYA 2WHMA 2QCCA 5CXPA 4ZQCA 1WQ5A 5FSDC 5E09A 3IIPA 1RHCA 4HNUA 2J24A 1VYSX 3OQEA 3WLSA 1W91A 5CCZA 4H3DA 4HHPA 5GPRA 4UNKA 3KRBA 4HK7A 4F0MA 3W7KA 4TV5A 3TX9A 1B54A 3KCLA 4O1BA 1W1A1 2P50A 3G5EA 3M0JA 3PZTA 4H8UA 4PEEA 2X8RA 2FKPA 4GYJA 3BMXA 2VC5A 2XVGA 2GDVA 3EGJA 4XKMA 4ICCX 3IIVA 3NQFA 2AAMA 2VRQA 3FV9A 3WF1A 3H2OA 4C6NA 3KLLA 3IJ8A 1E51A 3LHTA 4XO7A 3UPMA 3N1AA 1JYVA 1K3UA 3ZJKA 1W8SA 3E6EA 3QHOA 4R53A 5C9WA 5AYXA 3XISA 4Q8MA 3LXCA 3VDCA 1CW2A 5F2LA 4LUYA 2JKAA 4Q8WA 1G4TA 1FY6A 3GKFA 5E6ZA 1P6CA 5CPLA 3MSYA 3YPIA 3NQGA 4IJRA 4UQCA 1VHCA 4I8YA 1ZTVA 4W87A 2WMKA 5D30A 3OVRA 3TTYA 1FWNA 3UCDA 4QAIA 5BXRA 3W7IA 2ZVIA 4ZTYA 1P7TB 1KB3A 3CZEA 3I65A 3Q67A 8XIAA 3WKZA 1TMHA 1UWQA 4YLWA 3NQBA 2GYIA 3PG8A 3EMQA 1C9WA 3H2FA 2V5LA 5JU6A 1JZ8A 4I6VA 4GYPC 3KCOA 3OG2A 5CSSA 2PFHA 3VVGA 4AIEA 1K8XA 4W86A 4WSJA 1EJSC 1PSCA 4RV8A 1KLYA 4L64A 2VVSA 3G8RA 1DJHA 4PUDA 1ZHAA 3E3HA 1JZ2A 1R3VA 1QCWA 4CVUA 5AHLA 4RNHA 1K9FA 1DTNA 1K77A 2A7RA 5HXMA 1RAKA 1RVGA 1VCVA 3KDOA 4ZEPA 3N9SA 4H2HA 4D6EA 3CL8A 4K8HA 3ZLFA 1IEVA 1KFKA 4LNCA 1S2TA 3VD5A 2QULA 3RYSA 4NRSA 4H19A 3BMWA 3CB3A 3CPGA 3RHGA 2PP3A 3OZMA 3SCVA 4OECA 4ZQMA 1VPQA 2R1PA 4C6DA 4H9UA 5ABTA 1XICA 2ZOXA 5CGTA 5CC7A 4IQEA 4S3EA 3ECQA 2ZC1A 3E74A 1HKKA 3C0JA 4NILA 5AFDA 3LTSA 4QSHA 1HKMA 1LLWA 2VL4A 2CHRA 1WXYA 5M3WA 1RLDA 2WLYA 2AKMA 1JRBA 2ZX9A 3AXKA 1DIDA 3P67A 3ATYA 5CZJA 1DXIA 5I3DA 3UETA 1R9XA 1XIMA 3BLOA 3L12A 2WMFA 4BQ3A 4C6LA 3RO8A 1JEZA 3H23A 3T05A 2QNEA 3UWEA 4N9DA 3GXFA 3JVAA 1ZAJA 1EP2A 3T2PA 3GFXA 1TV7A 2W6RA 1GOOA 3VDAA 4UNLA 3H8AA 2NSOA 2GFTA 3O05A 1YNPA 1FWWA 3N2TA 1QPNA 4UMCA 1WKDA 3GG0A 1PCKA 1SO6A 4MVAA 1XLKA 2F61A 1JGMA 4FB7A 1JUEA 4CCZA 4AQLA 5FEXA 3VGHA 3OU8A 2VFIA 2QDEA 1BVNP 2VFFA 3VUPA 4NZ5A 2Y5SA 4DPQA 6A3HA 1VBGA 6ALDA 1CWYA 3WQ8A 4D6IA 3R6IA 5HR6A 3LLFA 4R7JA 4CU6A 5LXEA 5HJLA 2WNNA 2W0UA 1Q6OA 5KETA 3OVQA 1BQGA 2ZE3A 3II1A 4HJWA 4QCFA 2C13A 4AYSA 2JGYA 1TWIA 1AUSL 3CAVA 2WMJA 3XINA 1TTPA 4IG2A 1XH2A 4A3YA 4LEFA 1E6QM 5D02A 2Q8ZA 4MAZA 3MZNA 3TSDA 1UP3A 2J4GA 4OUEA 3MT1A 1XM3A 2FTPA 1XX1A 1KQYA 1VFSA 4JTDA 3CEPA 1TPEA 1UIOA 5EB8A 1PB0A 1KV8A 2WHLA 2ZWZA 4US5D 2D20A 1AQFA 4H4IA 2F9RA 3RCMA 2C3ZA 3GH4A 2RJGA 1ESWA 4CU8A 4TTUA 3RRAA 1VZWA 1X7IA 3FKKA 2HJPA 3ZSTA 4ZENA 1DWFM 3BOFA 3KTCA 2WM1A 3GHUA 2QCDA 1U5HA 4XAPA 3NIYA 5M17A 4JTCA 2ZRUA 3UVAA 3ZZ1A 2XISA 1KR1A 4AZHA 4LCSA 1J96A 3RLHA 5M5DA 3PTQA 3OTRA 1QI5A 4ZQRA 3Q37A 4CD7A 3AZRA 4LUTA 1G5AA 3NAVA 5AYYA 1BXCA 4E8CA 1YXDA 4PTXA 1L2QA 4AX6A 1AW5A 1H5YA 5BXTA 1JZ5A 1UD8A 3NZPA 4RDZA 3EWZA 4GXPA 4V28A 4OZOA 1CCWB 1S5TA 4RJEA 5LKYA 1V5XA 1OADA 1UR3M 1OX4B 1FWFC 1ZJBA 1TA3B 1UP0A 1XIJA 3V75A 4MADA 2DT2A 1A80A 2F8QA 1J79A 2P0IA 3IJ7A 1UCWA 2WSRA 4I9TA 5G2HA 4LB3A 4P61A 1ISZA 3MSDA 1ODZA 5LHFA 1TCMA 5IRPA 3PUDA 4JQAA 4UOJA 2I7GA 4BWLA 1LRQA 2DZXA 5DY2A 3AUJA 1SZNA 4Q4SA 2BXVA 3UG3A 2VEMA 4UFIA 1XBYA 2OODA 3W7HA 3AMKA 2Z25A 2A5HA 3VK5A 1AL8A 2PDFA 3BDKA 2ZRVA 2ZA2A 4FLRA 1SR0A 4NI3A 4LPCA 4YTRA 1W3NA 2O55A 3TXVA 4M80A 1KCLA 4UR8A 2IW0A 2IPFA 5FF7A 4S1FA 1V3IA 4B5VA 5A3HA 5PTDA 3ARZA 4PUWA 2TSYA 1K4HA 3G2GA 5I6SA 2BFGA 4KCWA 1X38A 4RPQA 1RLCL 2DVXA 3HIJA 3W27A 1O1HA 1TTJA 3K46A 3SIMA 2VX6A 3ID7A 1GOIA 3BARA 1MMFA 2A6NA 4Z2HA 4M82A 4DJFD 3UWUA 3WD3A 3PAOA 1I6NA 1POKA 4NF7A 4K8GA 4I8DA 5E5CA 2PGFA 4HU4A 1RSCA 4C6QA 4XBSA 1QASA 4GGHA 1XIDA 3MMWA 1L6SA 3LERA 1V0KA 5HMDA 4U2ZA 3W88A 4ZOEA 3OLEA 3CPRA 1Q65A 5H8MA 3PM6A 2BLEA 2VWSA 2VFHA 1XLGA 2GQ9A 3EX3A 1JCLA 2CPUA 2I16A 3THUA 3VX1A 4JY8A 4O57A 1AFSA 2X2YA 1ZBKA 1JNEA 3TYAA 3VA8A 3FGCA 4IFKB 2PLCA 3GDKA 2X1SA 2NV2A 1J93A 2F38A 3T81A 1GT8A 1DVJA 1OIMA 4B91A 3WD2A 3IJ9A 1HL8A 3NXLA 1UWUA 1S1PA 1C8QA 1FWTA 2AL1A 3RO6A 1CENA 4UFJA 3KLKA 1EC9A 3MYPA 5E9XA 4X22A 4B2DD 1UD5A 3VOHA 1Y5VA 4M6UA 4L80A 3IUDA 3IIOA 3CU2A 1JPDX 1UIPA 3LQLA 3NL5A 5EMYA 3AIRA 3LK6A 2SFPA 3I7SA 2D69A 1N7KA 1Z32X 2GOUA 3S2LA 3URQA 1HQTA 1UPMB 4ADUA 2FGBA 1OFRA 4B5UA 4C60A 1MXDA 4X63A 1FFRA 2DSWA 3MY9A 2YBVA 1OB0A 3SJ3A 4R33A 5KMYA 3T42A 3BE7A 3SQLA 2V5BA 3E2SA 1F6PA 3GIPA 4UTWA 4EF9A 2PDCA 3GO2A 3WLJA 3QY7A 3DKJA 3LBMA 3SECA 1F73A 1H7NA 4R7OA 4YVVA 1HJVA 2YFOA 2A3HA 3B8TA 4J28A 3QGVA 1VRDA 5A2AA 3USZA 1WYIA 3E49A 5CJMA 2XSBA 4Z0SA 2FPTA 4HTBA 1L6YA 1XYMA 1MWOA 3LI0A 2BNJA 1EHAA 2VX4A 1U30A 1MZRA 3OIHA 3RNDA 3P0WA 1JYWA 2DZPA 1W0MA 4XAFA 5C8BB 4HGXA 2C7FA 3CJPA 5JBEA 3VD9A 1ITUA 3UZYA 4QLJA 3PWGA 5C7VA 3W1NA 4M6QA 3W7OA 4EWND 2XVNA 1PYFA 3NWRA 3NDOA 1O1ZA 2Y8KA 2G4FA 3GNRA 3ICJA 3NZQA 4F2UA 2RKXA 4MFEA 1AQMA 5KZMA 1EA9C 3SZ8A 1VPYA 4R85A 3W02A 1US0A 2EAWA 1T8QA 5TD4A 4E4FA 1FH8A 2A1YA 2E9LA 4Z2JA 3H12A 4J3WA 1E43A 1AZ1A 3SW6A 1H2JA 1XS2A 5CQ1A 4M3PA 3AIQA 1H1YA 3UNDA 2VRKA 1WKYA 3MUXA 3SI9A 2Z1WA 2CLIA 4CN6A 3CM4A 1K8CA 4CQCA 4DUXA 1TQXA 2TAAA 4XZNX 3CMFA 1HT6A 2R1LA 3TNOA 1TRDA 1FXQA 4CNUA 4Z1CA 1LF1A 4M5PA 1KM4A 1W37A 1I2OA 1UKQA 4IIEA 1ELSA 4IX2A 2HE8A 3L66A 1PYMA 4O1DA 1L8NA 3B03A 4UTJA 4X2PA 4ENLA 3M43A 1H7OA 5LIKX 3CQIA 3RK8A 3QV7A 5IDIA 2BDQA 5CPMA 1KKRA 2J7CA 1NH6A 4JFWA 4WDTA 1NJJA 1UR2A 3AXXA 3P80A 2HVMA 1FRBA 1JCNA 2HS8A 1BAGA 1OGSA 1KXVA 3F5KA 3HG4A 3TFCA 4JL2A 1OYAA 5D2TA 3A22A 1W5MA 4C5ZA 2ZUNA 3EWWA 1ZUAX 3QFWA 2NXIA 4GINA 1Q8AA 1XIHA 2VEKA 3NDZA 2Z2UA 3GXIA 4ICNA 4D1IA 4HN4A 4AWEA 3TCSA 1CT5A 2Z27A 3CIXA 1W54A 4N0RA 3PC0A 2XN1A 3CO4A 2I1OA 5AOUA 3ABZA 4FF5A 4NJGA 1EJ7L 2E67A 4ZFMA 1HKVA 3MPGA 2J9XA 1DEDA 4PMXA 3ZVHB 4J40A 4YVPA 3AU2A 1REQA 4E3VA 2WHJA 2YDAA 1GOMA 1OJXA 5LXXA 5DT5A 1XG4A 2D0GA 1LZOA 2VR5A 3CZJA 2PDJA 1R2RA 2XVPA 4C6EA 3GNNA 2Y61A 1S2WA 4G8TA 3TP4A 1GQLA 5U4NA 1GQIA 2GPTA 2R24A 3W1QA 3M41A 2VI0A 4K36A 2DZBA 3WH5A 1F3WA 2O4MA 1B3WA 3EX1A 4O8AA 1I2NA 2PLKA 3CL6A 3LM3A 2PLJA 1JZ4A 4IL2A 1KM1A 1LWHA 2ZUUA 3CEUA 3EPNA 5F2IA 1IWBA 1ME7A 3UR5A 2DGAA 3W29A 1ZS2A 4X9SA 1O95A 4ZB2A 1RJRA 3R13A 4EF8A 4HOXA 4DJDC 4NYUA 3AMLA 2YB4A 4TX9A 4EKJA 1A0DA 4OWGA 4IPJA 1EYEA 4PUNA 5K4XA 1H49A 1VBHA 3Q58A 2Q3OA 1PAMA 3OP2A 1O7AA 1IEXA 3TTEA 3PJTA 4K2SA 1DJXA 1UMLA 2WBGA 1AK5A 1HJUA 4NKCA 4UTUA 3BLLA 1Z89A 4ATWA 3BV7A 5BCAA 4F2TA 3I10A 2YA0A 1SGJA 4JQ3A 2QF7A 1BFNA 4N9CA 4QG9A 4U2YA 3K8MA 4JICA 3AHTA 5AZ1A 4HK5A 2OQYA 1OSEA 1IT7A 4PZVA 1A3XA 3C2VA 2X0SA 4XUGA 5ECVA 3I3BA 4TX6A 3GVQA 4GQRA 5EMJA 1WA3A 3MJYA 3DI1A 3SURA 1XIGA 3B9NA 3BGJA 1HJXA 1KV5A 4MY1A 4WZHA 2ASHA 3PANA 3MB9A 1AD4A 4W7WA 1EC7A 2XPKA 1C8XA 1DPMA 4L6DA 5DO8A 3TK7A 1H7WA 3IGXA 3GC4A 5FACA 2EPLX 1XI3A 1HVXA 1PE1A 2Y8UA 3SBFA 1EPXA 4GUIA 2G3IA 3MP3A 4KEZA 1PX4A 4P5UA 2E9BA 3KS5A 1W1B1 5FAJA 2HZGA 1A5KC 2YDQA 1AJZA 2ZUWA 4PCSA 4LRTA 2YW4A 2WJEA 1H09A 1S2VA 2EHHA 4AZCA 4FEZA 3QPZA 3HMJG 1XCXA 3UR7A 3U2OA 4OV9A 1ME9A 3A3XA 1CIUA 2WNQA 4FAMA 3E0IA 2R1MA 1WAWA 4L9XA 3BW4A 3CT2A 4AMAA 3QMRA 4BEQA 4ACYA 1RBOB 2DY3A 3T2OA 4Q4QA 2BODX 2IKIA 2WJDA 1RALA 3LDVA 5HANA 2C1HA 4CNPA 2IKGA 2VJXA 3S9YA 1NOFA 3NQ6A 1X8CA 3NUKA 1IXNA 1CTNA 4LVGA 4WY0A 3AHXA 3SQMA 2G5WA 3VGEA 3EWBX 3S8HA 4DYEA 5F1VA 2WVVA 2YBUA 4MF4A 3M5XA 2J79A 3S1UA 2E68A 2MNRA 3NL2A 4FS9A 3RIKA 4L9ZA 4L1WA 2XIIA 1PS9A 2GQAA 5I07A 1UJPA 2A2IA 4AWSA 4OFCA 3QC0A 4OQVA 1JUKA 3G8EA 2VDIA 1JQVA 4M7TA 1DXFA 1KCXA 3KVJA 3PULA 1JIBA 3PBVA 4CEUC 1V8EA 2Y88A 5GJNA 4Q8OA 1A47A 4UR9A 2AMGA 3WDJA 1J5SA 2PS2A 4GUGA 3LV6A 4XB3A 2PRMA 5KEZA 3AAMA 2QGHA 4J3ZA 1ZNNA 3RDKA 2HTMA 5HR7A 5HATA 2OO6A 1KKOA 1HP5A 2VC9A 3WMBA 2DVUA 2DSKA 1TSIA 4J9JA 1E5NA 3BTNA 5JBDA 4ECLA 2YB1A 5F4WA 4HCDA 1QBBA 4XTDA 3U48A 3U3HA 4XQ6A 3M6YA 4QLLA 1ZY9A 2AL2B 3WENA 1TE6A 3UNTA 3UWYA 1ALDA 4XG1A 3KEHA 3VC5A 4HA4A 1UR9A 4LOCA 4JQ1A 5EBUA 4JIRA 5CG0A 4Q6XA 4YU1A 3IIXA 1TJRA 3W22A 2XFRA 2HQAA 1CGWA 1JDAA 2G95A 1ZCOA 2IPGA 4GO8A 4UFHA 4X0NA 1WV2A 1AG1O 1BG9A 3GUWA 1L2UA 1ADSA 4NJHA 4FLQA 2EQDA 1MSSA 2NX9A 4JEJA 1PPIA 1UC4A 2WNZA 3LU2A 5C2XA 3CUHA 2LLEA 1E4LA 1ICSA 3R0KA 3B4UA 2JBMA 3PP7A 1OYCA 2ZUMA 1TYGA 3GVWA 3R0UA 2ZZ5A 1IR2A 3WH6A 3ZJ7A 2HBXA 4UUIA 2B4GA 3DI0A 3DKLA 2XN0A 3CS2A 1PJ9A 3ALGA 3APTA 3U57A 1R7AA 3O15A 4XBJA 3VKAA 1W9BM 3W37A 3W7JA 3LTYA 4UFKA 1FHUA 3C86A 3L2MA 3WMLA 3P14A 4DO6A 4Z08A 3NSNA 4I9JA 1IE7C 4Q4PA 1XH1A 2VR2A 1DE6A 3LHWA 1Z8AA 1B9BA 2J66A 2PDWA 4KRZA 1PKMA 2WC4A 4LUSB 4CQ8A 1HGYA 3B4YA 1XRTA 4V1XA 4O52A 1XYLA 1JVNA 3LYEA 5D05A 2A79A 8CGTA 1PHQA 4LYRA 2YA1A 4WEVX 1NOWA 3WH7A 1ONWA 2CKRA 3N25A 4GE8A 4Z2GA 3TDFA 2D23A 4NAFA 3PWAA 4LS2A 3WUBA 2ZQ0A 3CZ8A 3PZMA 1J01A 4AG0A 1H62A 3V35A 2AQOA 4XZHA 3VOFA 5CPTA 2WJFA 3N15A 4FI4A 4YMZA 4DM1A 4RNIA 5G5IA 1EX5A 3T07A 3VNZA 3GW0A 5FCZA 2ZTJA 1FWGC 1KRAC 3AHYA 1ICQA 4EPKA 2Q8XA 1ZQ5A 1OCNA 4S23A 1Z48A 4FHAA 2VRJA 1K9TA 2FB3A 5FF4A 4AVNA 1H7XA 4UTFA 4O4WA 5LHEA 4KWWA 1TE1A 1BTMA 2BY3A 1E15A 4O0ZA 5BMWA 2QAPA 4BQ4A 3LHVA 1S1RA 3BXWA 1WDRA 1ISWA 1M41A 1FCUA 4S3BA 3PB2A 5EMLA 1B4KA 2OWXA 2ACRA 4ILSA 1UA3A 3EDKA 2RDUA 4Z42C 3HQPA 2XG9A 4C7DA 2DZSA 1VH7A 1JGIA 3AS1A 2PDHA 2QXWA 1OHLA 1LUCA 1H60A 5E0CA 1QO5A 3QW3A 1TPC1 2XU2A 4WIWA 3LRMA 3U7BA 1SZEA 3V0UA 3R89A 5HJXA 4EOUA 3C2FA 3HG5A 5B7ZA 1CLVA 5DBTA 5FA5A 1KGUA 3DBNA 4BY3A 3ZLHA 2ZFAA 2VHLA 4NASA 3E1F1 3ISIX 1S39A 1XLLA 2OG9A 2NW0A 4CN1A 3LBCA 3D47A 3T0TA 3WLIA 4I90A 4UQ9A 3FNDA 1L8PA 5F7UA 5IHRA 3L21A 1CDGA 3S2CA 2BVDA 3VCRA 1UKTA 4ZOBA 1KWGA 4XD3A 1GYNA 1PZ0A 4M6VA 3WBWA 1B5TA 2XZ9A 2A7PA 3VZZA 2D73A 5BWAA 2WSQA 3BG3A 1MO0A 3ANUA 1AW1A 5IDZA 5AC4A 2QMKA 1VBJA 3N6QA 3N9KA 5HQEA 5HULA 1MFUA 2I9UA 3M0XA 3EOLA 5AVNA 2ACQA 1R3SA 1H51A 3OA3A 1XLDA 5I02A 3MJMA 3J7HA 3APGA 2GUYA 5CBBA 1ZRQA 3RCNA 3CV6A 2YL8A 5I06A 3IVUA 1XYFA 1E1FA 3VNKA 3CZGA 1A5OC 3T4CA 3PJXA 4DEFA 3ABQA 3BLPX 2NV1A 4DJEC 5MKGA 1I9CB 3KHJA 3QN3A 3MSGA 4Y2WA 1ML1A 1N8IA 4J5NA 3G18A 1J6OA 4L7ZA 1JCMP 3C0QA 1D7FA 2PGEA 1EGMA 1OZQA 1F6KA 3LSBA 1XW8A 4ZO9A 3GG8A 4F8XA 2A0NA 1LRTA 1IWAA 3L68A 2WKJA 4B9ZA 5JH1A 4JKKA 1DQXA 2FVLA 3AWOA 4KIRA 5BOOA 1ZB5A 8A3HA 4BF7A 3CO8A 4C6KA 3DOPA 3SADA 4ROPA 3GTXA 3AJ7A 2QUVA 3ITTA 4N4PA 5CAKA 3RMEA 4HPNA 4HU0A 3WQCA 1TPWA 1TVPA 3KBJA 4X0VA 1E9YB 3MA8A 2OT1A 2PDBA 1EQPA 1VEMA 4O1AA 1I0BA 2UZ9A 4HNVA 2WMIA 2GSEA 4FALA 2CLEA 4DQWA 4HBKA 4MYAA 4PMJA 3T44A 1WPCA 4RZ4A 1Q63A 2WWCA 4J4KA 2OWCA 4G5DA 3AROA 3H53A 5CBJA 3VCNA 1R0MA 1XIIA 1TWZA 3IVTA 4EX4A 1RH9A 3OYZA 4IPLA 4GVFA 2NUXA 3M0YA 4AD1A 3DC8A 1DQUA 2J77A 4UMBA 3T4WA 3VE9A 4O1FA 3ENLA 1YBQB 1VGAA 4Y9MA 2ZRYA 2CXEA 4HVXA 1ADOA 1V02A 1F5ZA 3S5SA 3NQ7A 4MKSA 1GOKA 2XVKA 2VC6A 4HMNA 3QTPA 4REQB 5C55A 3VU2A 3S9ZA 2PWFA 1T99A 4PN2A 4LXFA 1W9VA 2P10A 4AHOA 2DH2A 4HQVA 1KFBA 2PSNA 1VFFA 1XLIA 2W5FA 3TXZA 1RP9A 3M46A 3GHRA 3O8AA 3HTWA 3B8WA 1RK6A 1VBRA 1HW6A 5LIYX 4FNTA 4A8RA 3URAA 1W56A 4M8UA 3NZ1A 3WLKX 8XIMA 3H26A 2YR1A 1UH2A 4XV0A 1XC4A 8TIMA 3C0LA 3KM8A 4N42A 3VNMA 4GI8A 4LC6A 2QCGA 3OGSA 1Y8BA 2C0AA 3LCXA 5HUPA 4KH2A 5AY7A 1XDJA 2HNHA 3L5MA 4UQDA 1B30A 1SO4A 4DZ5A 4D6JA 2AQWA 1M01A 1E70M 3GAKA 2DIKA 1TMQA 4BQ2A 3B05A 1FKWA 4TVDA 3O07A 4H6QA 4JCMA 4QROA 1OFEA 1CX9A 3QTGA 5D37A 1EZ2A 3MHUA 1IXOA 3PJUA 3LPFA 1W1IE 3SUTA 1VLWA 5BYWA 3TC7A 3OZPA 3VGDA 1HO4A 4H1ZA 4LVBA 2ZTKA 3Q4DA 1JG9A 1V6TA 4ZQNA 3LX9A 2CZEA 1QK0A 3VKKA 1KCKA 4F48A 2OCZA 3PBWA 3ZS4A 3S46A 4MM1A 5HMEA 5TIMA 3OO2A 3I7RA 1E0WA 4WVXA 1LL7A 1VKFA 4WK9A 1S5VA 3FY1A 4J2PA 4F9JA 1ITXA 1POJA 1W2PA 3FJLA 2RFGA 5HNTA 4NNCA 4F9DA 1J0JA 3RX3A 2E0PA 3V18A 5XINA 4PUJA 3THAA 1IHIA 3W2MA 3DX5A 3GC5A 3TW7A 1A50A 3IAQA 1MW1A 4PMDA 4WQ6A 3G22A 3D3FA 3W73A 1BGAA 3ITVA 4H8HA 4C5YA 5U7SA 4IHCA 3NCOA 4F66A 4RR4A 3FN9A 2D3NA 3BGGA 4P7QA 3N19B 1AJ2A 3WQDA 3V0TA 5CPNA 1SFSA 3KZPA 4CU7A 3I3DA 3QSTA 2VGGA 5F2GA 4GXMA 1XKJA 4DVOA 3NTYA 1E72M 3C8NA 4Z1DA 5D2VA 2VFEA 2E6AA 4JTRA 3TJLA 4C6PA 2B7NA 2B31A 4BJHA 1JRCA 2GVLA 3HZ3A 1CECA 1QOQA 3CLWA 2C6QA 3AIVA 2FZ9A 4HCLA 4Q7BA 2AQVA 4JFTA 1UR0A 3AO0A 4ATLA 4WJ8A 1YTEA 2Y5EA 2VR4A 3IUIA 3A64A 3WJSA 1R46A 2G3MA 5I77A 1RA5A 1A0CA 3UVIA 4UTHA 1EJVC 3ATZA 3WQ5A 3B04A 2PGRA 3OG3A 3S5ZA 5FOOA 2DVTA 3PUGA 3A5VA 3S1XA 3NVTA 3EKLA 4KRUA 5HPCA 4HT3A 4AD3A 2Q8LA 2XIBA 3TW9A 2PDKA 4Q8VA 1DJYA 3NQ8A 3PTDA 1O94A 3MANA 4K39A 1FWJC 2J7DA 5L9FA 4XZMX 4M81A 4IMEA 2X05A 5I00A 5CC5A 2VFDA 3EKZA 1RZMA 4ZA0A 1IZJA 3WF0A 2HDJA 5DX7A 4PMOA 2QDHA 1XISA 1MI3A 1TPFA 2I5QA 2Y1HA 1B9ZA 3SSZA 3PBMA 1GTHA 1FOBA 1TTIA 1V6YA 1VC4A 4B4HA 3N9RA 1R3RA 3CWHA 4P8VA 1M5WA 1YNQA 3VD7A 1FWCC 5REQB 2YPIA 5D9NA 3RGTA 3LQGA 2PDQA 4D1JA 3BQ5A 4DJED 3QQWA 2R9RA 2BG5A 3OYXA 3W7MA 8RUCA 3QY6A 1TO3A 2UBPC 2OPJA 3N3MA 3T8QA 4F40A 1C93A 5AHNA 5I2UA 4HYRA 3IK4A 4AIBA 2NZLA 3K2GA 1IXQA 4WHBA 1MW3A 2VGBA 2XJ7A 4IMGA 1QW9A 2HV5A 4HYVA 1SFJA 1D9EA 5K9CA 1OD0A 4DUOA 1QO2A 2J62A 3L4WA 4AZ6A 3S2MA 4C6MA 4RV3A 2INFA 2WCGA 2ZZ1A 3VAVA 3F4DA 5G2IA 2OLAA 1XKYA 5D4YA 2QUNA 4HHLA 3STEA 1W1VA 1YDVA 1DQWA 3BLIA 1ECEA 4ERGA 4YYCA 2PDGA 4IGSA 4JX4A 3HN3A 4LB4A 4WDUA 1UQZA 3QGKC 5D9MA 4UR7A 2PPGA 2H9AB 1ISVA 3RR1A 2DUXA 1P7TA 5G4HC 4CQAA 1SZRA 5DRIA 2RJHA 2ZDSA 2DZUA 1QJWA 4PMRA 1OFAA 3EOSA 4MWAD 2VURA 3ABSA 1VENA 2PURA 4S3FA 3S1VA 4MWAB 4IXXA 2Y7DA 2DQWA 1F4AA 4OBSA 4X61A 3WUGA 4CQDA 1SW3A 3GIYA 2CLKA 3I6TA 4H6EA 3VKCA 4MOZA 1F74A 4ZE5A 3R10A 1ZJAA 5JUVA 4HZ7A 1YHTA 3HG3A 3Q65A 3QHMA 2ABAA 1QK2A 3LGGA 4H8VA 4KEVA 2CBJA 3DH7A 3AIEA 3HURA 5TAOA 3I6RA 4GPNA 4DZHA 3DENA 2DIJA 4N6EA 2E6FA 4UTTA 5H8PA 4JN8A 4O4VA 3PBYA 4KPLA 3WF4A 2GSHA 2VCCA 4PMVA 2POZA 2TRSA 1QI4A 3OGRA 1K6AA 1JNDA 1YNYA 4O1CA 3ZMRA 4AZGA 1KGWA 4FNUA 4DX3A 3URNA 1PKLA 1B0IA 3QJAA 1G4PA 4JEQA 1E73M 3MKCA 4HZ8A 3GXDA 3A9IA 3W1LA 3S5YA 1VRXA 1LWJA 2YDRA 3T0AA 3IV3A 4W84A 4NI8A 4MZ8A 5DELA 4Z2KA 2Q3RA 3CQJA 2L5HA 5D9PA 1V3KA 3OPSA 3G1DA 4AIOA 4IF2A 3IACA 1W1TA 1DJIA 1SFTA 2AOSA 2AAAA 4WJXA 2YA2A 3VDBA 3QPYA 1F9CA 2E5DA 4HNNA 3HQ1A 3H55A 2DZVA 4ALDA 3ARWA 2VT0A 3T55A 1T7LA 2DSZA 1CXIA 4RW3A 3N18A 2Z00A 2Y63A 1Z44A 5T26A 4NJKA 2W27A 1IYXA 1F7BA 1RCQA 2FHBA 4GIEA 2R82A 5FF2A 2Y7FA 4MAVA 4AZ7A 5M2FX 1FWBC 2OZTA 5I79A 4FLSA 5I0DA 4WD0A 1KQZA 3HJZA 3HQOA 1Q7ZA 5LIWX 1XCFA 3M0MA 5CC3A 3HFTA 3RJYA 1KNWA 5BW6A 3QFEA 4B90A 4PODA 2NUWA 3SCWA 3H2EA 1LOSA 2WM0A 4I6KA 2Z2BA 1WZKA 5AHEA 3TKFA 4J3TA 3WDHA 4IQJA 4ZOAA 1G0CA 1IT8A 3WELA 6TAAA 3LNPA 1QI2A 3ARPA 2OKOA 5LIUX 1J2WA 2YCLB 4KWVA 5AN7A 2RDXA 5DF0A 2CERA 3UZ5A 5EMUA 3P6LA 1J0IA 3L67A 4DYKA 2Z0IA 2E1DA 1UB3A 1UD4A 3KOWA 4AEEA 1HL9A 3H2AA 1VCFA 5BXSA 4FNRA 2V69A 3E12A 4HK6A 4QITA 5JIWA 3MI2A 2YLAA 2WLZA 4C1LA 1H1NA 5F4XA 1OFQA 1B1YA 1BYDA 1GEQA 5K9DA 5LGZA 3E2VA 2QV4A 3KBWA 5TNVA 5A6TC 1SVDA 3P8JA 2C1IA 4NJJA 3WQ4A 1AZ2A 1RBAA 1IF2A 1NOUA 1XLCA 4EAYA 3SB0A 4US5A 3VUSA 2PBGA 1TPH1 1QPRA 2YJQA 2VKZG 1TR1A 1SQ7A 3D5HA 1LP6A 1O68A 2QCHA 2QCEA 4GWEA 4DB7A 4IX0A 3SCPA 1ICPA 5E70A 2CU0A 4ORIA 1C92A 1L6WA 3M6DA 4DNHA 4G9PA 1Q8JA 2WV8A 4EK7A 1R87A 1OBAA 3GZ3A 3TA6A 2OFJA 3A9BA 2Z1VA 5EKYA 4AHPA 4IMCA 3FHQA 3AALA 2NVAA 3VABA 3TMLA 4GNKB 3KE0A 3EPMA 1TCDA 1OX4A 2I9EA 1TA3A 3OW1A 5C54A 1C3FA 1KRBC 4WLCA 3M0ZA 1P43A 3LMYA 3KP0A 3KRZA 1RJPA 4Q7NA 3W83A 5JQ9A 3WH9A 3TQ0A 1SSGA 2WXDM 4BR1A 2DSVA 1AMYA 4KMQA 3ARXA 3GVVA 2DSUA 4LJ3A 1R9YA 3K5XA 1GONA 5FL1A 2ICSA 1NARA 2HBVA 3G24A 1QNRA 1W3HA 3L4XA 5CJNA 1FP9A 3W2LA 4TR9A 1GJUA 3T2QA 4UCFA 4L65A 3MHGA 2RGLA 3ZLGA 1W17A 1XIBA 4FSAA 3BOLA 3GVGA 4C6IA 1TPVA 2B7PA 2QDDA 4PL1A 3TW6A 2OWWA 2DFAA 3WQFA 2ZXDA 1BYCA 1V51A 4HPHA 1XG3A 2V2HA 1XLJA 4JN6A 1BVZA 3U7VA 2DPEA 1O12A 3OJGA 1V0NA 4PTVA 3PZ9A 5DXXA 3NQAA 3UR8A 1R3TA 1W3IA 4GUHA 4W7UA 2RDTA 2Y6ZA 1V93A 4PUMA 5EGRA 3TYUA 3VZYA 3LRKA 2P76A 1KRCC 2VFGA 3ZR6A 3C4UA 4I7WA 1VJSA 4WXZA 4ONVA 4W5ZA 2FDSA 3VMOA 3WK1A 4CD4A 1QI0A 2O0TA 4Y9OA 3VFCA 2YDSA 4FR6A 5C71A 1M3UA 4U5IA 2CLLA 4Y9PA 3QZEA 1CB7B 3OBEA 1JR1A 1UH4A 3AYVA 4PL2A 4Q32A 2ISVA 2WZMA 1E6ZA 4XVDA 1GORA 1H0IA 3F5LA 1N8FA 3E0VA 4GYPA 4AYGA 3WDRA 3KCJA 4Y96A 3C56A 3LN3A 4LTSA 1JZ3A 3UD6A 4E3TA 3NZGA 3T40A 2D2JA 1BPLB 1LROA 3T08A 3NO5A 4LYKA 4FIQA 3AMDA 3TH6A 4PB3A 1A5CA 4NP7A 2F6XA 5J5DA 1CGVA 1ZAHA 1SJDA 1EEPA 3KTSA 4HOWA 3WNKA 1V6XA 4B9YA 4LUIA 3UY7A 4CCDA 3TYEA 1TJ2A 4RUBA 4TQTA 2VDHA 2QHAA 3W1PA 2QCNA 3FCPA 4JTSA 3FLUA 4XUYA 3N2XA 2Z26A 3I3EA 3PFRA 1W5QA 7ENLA 1XPYA 1Q3NA 1E0XA 1YMYA 4B2DA 5KITA 1KD0A 1FH9A 4A8NA 2JGQA 1HTIA 2QS8A 1PIIA 1EEXA 3L0NA 3AZSA 2GJXB 1M1BA 2QUUA 1Q5MA 1E6NA 5I24A 3DHUA 2ZUVA 4GX9A 3I4KA 2C8NA 4XAGA 4LAKA 3MO4A 4QE5A 4PBEA 1NDVA 4LAUA 2D2OA 2VELA 2PC8A 3MYOA 3MV01 3DESA 4WOQA 5C5YA 2RDWA 2PRHA 3AXMA 3CL7A 1MEHA 2ZRXA 1R3WA 1WXJA 5D9OA 3A12A 1TPDA 1TZ9A 1J12A 4QJ4B 5ABEA 4GCXA 1EWDA 3G1VA 4GC4A 3VIHA 3MMTA 1BHGA 2DZTA 3FXGA 1HKWA 1PIGA 1LM1A 1JCYA 3E0WA 1K7FA 3K1GA 4QEHA 3SUUA 1XUZA 3MP4A 4FOJA 3TSMA 4YN5A 2D1ZA 3OB8A 2BGQA 2ISFA 4R88A 1EO7A 2PDPA 3ANYA 2FVMA 4E8GA 1FWSA 4M7SA 4AEFA 3A6OA 4GVGA 1P0NA 3KTXA 1DJQA 1RVKA 2A6LA 3GDLA 3L65A 5A2BA 2NLYA 2CBIA 3WYZA 3G1SA 4GY0A 1U5JA 2VOMA 3RXZA 3ARQA 3WZ0E 3LV5A 2QJGA 1EDTA 1NEYA 2V2DA 3LD5A 2PZ0A 5HQLA 3VIIA 5GJMA 4L1XA 1YKWA 2BVYA 3TJXA 2WCSA 1VB9A 1Z41A 4QG6A 2NT0A 4XVEA 3SDOA 2VEPA 3GNXA 2OGJA 5HINA 3F2CA 5LNWA 3QBUA 4KRTA 5IHSA 3NXFA 4GZIA 4QISA 4XKYA 1FWRA 2PF0A 4ZOCA 1EBHA 1V03A 3H21A 2HISA 4GZEA 2FJUB 4LH8A 2HK1A 4U10A 7TAAA 4YWSA 1UWIA 5F4SA 1I0DA 1KC7A 3UG8A 1V3HA 4EXQA 4LFYA 1S38A 3EOEA 3NO3A 4WR3A 4XAYA 4NL1A 1WDDA 4P8XA 3QV6A 4H41A 3W7GA 2NVDA 2OXNA 4JL1A 3LXBA 4I7UA 1ECQA 5C2CA 4AWUA 3LCWA 4G2DA 4RDVA 3WD0A 4H9TA 4RE0A 4AFYA 2C1GA 4LAOA 4H2CA 3S5NA 1E4IA 3ABXA 4UWMA 5CZTA 2ONEA 3TEVA 3GC2A 3MC5A 1EC8A 1WP6A 3FGCB 2E8ZA 5HNNA 1EUAA 5C70A 2YSWA 3WL1A 4NRRA 5IFTA 1W5NA 3ONBA 4CN4A 1PXGA 4JFUA 3CIVA 2JIEA 4AY7A 2QMJA 4JS3A 4C7FA 1XLEA 3DFQA 2DIEA 4JCLA 4GX8A 1UHVA 2XSAA 2VTFA 4GZ7A 3F03K 4JAWA 4O0KA 3M47A 2V2CA 1MUCA 4R9OA 3ZQ9A 5LIXX 4ADTA 5H2ZA 1FA2A 3WNNA 5C9ZA 4IGMA 5LNSA 3M9YA 4U33A 4E2BA 2EPKX 4DAIA 1T40A 1QMLA 1R6WA 5HWNA 3KVMA 3ARYA 3PJWA 2OMAA 4O18A 4NZ4A 3PPGA 1LL4A 4J3VA 2E25A 2OR2A 4DO4A 4JNYA 3IJIA 3CPUA 4LBUA 2ON3A 1W1YA 1Q7MA 3PPHA 4Q8NA 3FDKA 3P74A 4BKNA 1K9EA 3P60A 5C0QA 1X6NA 1PEZA 4GXWA 2EJAA 3PFMA 3UGRA 5DCBA 3VKDA 1KO0A 3BZJA 1H3GA 1MNSA 4B5SA 4MPKA 1E9ZB 2EG8A 3LNMA 3W1UA 6PTDA 3LUTA 3P84A 3U2EA 3F4VA 3K1DA 4CKQA 2GGJA 4O12A 4YJ5A 3WLTA 4C7GA 3G1FA 3B40A 2CZVA 2X1IA 2ZX7A 4MDOA 2PD9A 1C7TA 1EJRC 1NFGA 4RDYA 3MMDA 2BB0A 1V6UA 2QGYA 3C61A 4NQ1A 2XGZA 3P3BA 4B3ZA 3RM8A 1VF8A 3MQTA 2QYGA 4I7VA 2FZDA 1H50A 2VOTA 1YE4A 4PTDA 2D0FA 3TYZA 2PTXA 4B16A 4RLIA 4NZFA 3DFPA 1HFBA 3SIZA 3TTQA 1S5NA 2VYOA 4UQBA 5CSUA 2BY1A 3KWSA 4IH3A 4CUCA 1ITQA 3VI2A 1IQ8A 3SRKA 1E4NA 5A8GA 1WCGA 4TMBA 2J74A 3APYA 4MWAE 1UP2A 1YDYA 3V5CA 1GVSA 3VOCA 2ISWA 3WFLA 3N3TA 3VIGA 2XUCA 3VKBA 3LA4A 1VS1A 4JTFA 4TU1A 5D2YA 4H83A 4QAWA 4U4MA 3BK0A 5LA0A 3R25A 5D32A 5A8MA 2POTA 4KCVA 4O50A 4NUWA 1XGDA 1TV3A 3FKRA 1PCWA 2ZZ7A 1I1WA 5G1TA 3LMZA 4Y9NA 3G3MA 3U4FA 3W84A 3OQ8A 5HA7A 3NVDA 3MWCA 4IGHA 3SCSA 1TWWA 4MDPA 3H7VA 4PTNA 4L56A 2Y70A 3TA9A 2CLPA 3TIMA 2OB3A 4HSHA 4PMUA 2ATMA 5J04A 4KF1A 3JUGA 1RV8A 4RX0A 3GAYA 1W9XA 2YBTA 3DFHA 3MDWA 1XDMA 3WEOA 1VQTA 5BROA 3L4YA 1FDJA 2JKEA 3B9OA 4Q3MA 4UOZA 4JTLA 1CGTA 4XZBA 4FIRA 3ZVIA 2O9TA 1PUDA 2VZOA 5D2WA 5BU6A 3AXIA 3G1RA 3KZSA 4Z1YA 3G77A 1TB3A 3EOOA 3P82A 3QHNA 5I5RA 5CLWA 1IWPA 2W79A 5AC6A 5GQBA 1XRFA 1US2A 3L0GA 1JFHA 2EO7A 2HVNA 2ZZ6A 1QR7A 4D8LA 4DJFC 2W3ZA 1HIZA 3KBVA 5IBXA 2NUYA 5FJRA 2GQ8A 4Y8FA 2Z1BA 1B2YA 4LRSA 3W72A 2R6OA 3DG6A 3BWWA 4WGXA 5CPQA 4AH7A 5A69A 3FYOA 4C1NB 3FDGA 1A5AA 1DWJM 4Q22A 1XYBA 1RCOB 4H01A 4UQAA 1VEOA 3DGRA 1MQQA 2WSPA 4MNJA 2QPXA 1IGSA 2XFWA 1KXQA 1ZJIA 3W2UA 1QAPA 1T0OA 3H2CA 1LBMA 2AGKA 4KT2A 1KBIA 2VZVA 1M7XA 5E93A 4QE1A 5CSYA 1GVEA 2BSLA 3F4NA 3UU0A 3RILA 2GLKA 5GNZA 2PZNA 4Z2IA 2RH9A 1QTWA 4DXKA 4LVFA 4PYSA 3BJFA 1LL6A 3BAKA 3VIKA 2J7GA 3L5AA 4GBDA 2GSJA 3ZO9A 2TYSA 4PFMA 1KM2A 1HUVA 4GACA 3TJ4A 2PTWA 2P3EA 2JEPA 1D2KA 4MFDA 4HNLA 3B0YA 3GB6A 4UXDA 3CASA 3A4JA 3NG3A 4MB5A 1D8CA 2BOGX 1SR9A 4AHQA 3P93A 4HD5A 3HJEA 4Z0JA 3IPWA 2IXUA 3IIZA 3FA4A 2CZDA 3DU0A 1TG7A 4B5WA 2NQHA 5B7YA 3ITYA 4Y6GA 1KCZA 4HKPA 5A6SA 2Q02A 1OGGA 5DT7A 3WBEA 2C91A 1F07A 4JTUA 1A5UA 4DUWA 2DP3A 4QRNA 1LCOA 3RAOA 2VUNA 4IIDA 1Q7QA 3GNPA 3S2JA 1VBUA 3LPGA 5G1MA 2PF8A 1BD0A 1BRLB 4N2YA 3GFYA 4QCEA 3N34A 1QI3A 2PDXA 3SY8A 1SPQA 3PUEA 3DIPA 1LLOA 3DN5A 1WBHA 5CBIA 2F2KA 2PD5A 3R2GA 1LOQA 5FD0A 2VUYA 2PP0A 4JIPA 3OODA 5DRCA 1ENUA 3NYDA 3ITCA 4QXIA 3R1ZA 5EYWA 5IFPA 3AHZA 4WKAA 3PZGA 3I6EA 5TBOA 3RCYA 3L9CA 3WUFA 4DF1A 1BF6A 4LUSA 1H7PA 4E5TA 3TE9A 4XSLA 3E96A 3U5YA 5LSMA 4JFVA 4ZO7A 5C2GA 1T8XA 2BVWA 1NAL1 4ZO6A 1EF3A 2X40A 1OC6A 3R0DA 3UA3A 1Z6KA 2WBKA 5A94A 5A95A 4Q7IA 4HTYA 3W24A 3L0KA 3PSVA 3HG2A 4NXSA 2ZX5A 4NVTA 4FNQA 2R91A 3IS4A 4I5UA 4UB9A 1V08A 3AOFA 4DLFA 1FWEC 2GGGA 2BY0A 3PZUA 3ZIZA 3STFA 1NU5A 3E5BA 1V79A 1OGBA 2BVTA 2CZFA 4M29A 5EY5A 1UZ1A 4KGLA 1FCQA 3V36A 3LCGA 3F4WA 3D6NA 5CLTA 1GG1A 3QSRA 1A49A 3G6MA 3GTFA 2YYUA 3DC0A 3LLDA 5I09A 2VO5A 1FQ0A 1WAUA 2RGMA 1MFVA 4HYWA 3GR8A 3HPFA 4HP5A 2J6XA 3ZXWA 3WJXA 3AU6A 1XQKA 2KAUC 3W6YA 1Q2RA 2J47A 3D46A 4MKNA 4DJDA 2YXOA 1FX6A 2W91A 4URIA 4E2VA 4GJJA 3NSMA 2GVEA 1GQNA 3TN6A 2ZXAA 2XDFA 5I78A 2DZAA 1BSLA 2NQJA 2I5IA 5GNXA 4C91A 1UYQA 4ZL1A 2WZIA 2HS6A 3G0UA 1ADDA 4QR6A 3L5LA 4QDWA 3V1PA 1V0LA 4PCNA 1XV8A 5ABGA 4W8AA 2QCLA 4LY4A 3W85A 3NDYA 1XCWA 4WRHA 4AD5A 3CV7A 4GUFA 2OKTA 5G4WA 4UZUA 4FXSA 1Q6FA 1JDDA 3TVAA 3N12A 4V33A 2OEMA 4JDYA 2XWEA 2Z6IA 2IXVA 3BOXA 1M7PA 1Q6DA 4MB1A 1LORA 4MY8A 1GHRA 2IS7A 3S0CA 4IXHA 4HPXA 3S4TA 2OSXA 4OT7A 4E4PA 3HBLA 2DU2A 3UXAA 3T1GA 4RXFA 4X2RA 1GJWA 3W2KA 1JD9A 7A3HA 3VX0A 5FJTA 4A35A 3SEPA 3FEQA 1QNOA 3N14A 3EZ4A 4HSOA 3LHZA 2O9PA 3FFSA 2F6UA 3W07A 1MUWA 3BL3A 4MNMA 3SGZA 3CV2A 1HL2A 1LYXA 3T8LA 1RQBA 2OZ0A 1QOPA 3A4XA 2G96A 3OHIA 1JULA 3ZWTA 1VJZA 3PTKA 1EQCA 4AC7C 2NWSA 3EXTA 3PB0A 2V63A 4O10A 4OIFA 1A5MC 2VVNA 1Y7VA 4WSKA 4YTSA 1Y65A 1JDCA 4UQEA 1NWTA 4L4OA 3FEMA 5HQMA 3SCOA 3ZFHA 4P2VA 5D04C 2VEIA 3KBSA 3L4TA 3CYJA 4A8IA 2O56A 1H61A 4IIFA 4DBDA 2ZADA 1FDZA 3TU9A 1QOXA 3REQB 5HDRA 2FFIA 3P61A 4M19A 3EA1A 4MHBA 3O6YX 4JGDA 1FXPA 4DWDA 3OLIA 3AS0A 1W5PA 1A0EA 4ATDA 4N7QA 1BYAA 4YCOA 3C2OA 4W4QA 1H63A 3GE7A 3C52A 2H3DA 1PHWA 3KS6A 4PMYA 2V68A 3VOGA 1IIHA 3PHAA 3W00A 1UBPC 3DERA 3JU2A 1R30A 1TX0A 3KFTA 3QVQA 6ENLA 3AXHA 2Y62A 4UNIA 1YBQA 2D22A 5FI8A 3QMSA 4A22A 1P5BA 4ADSA 2J78A 3VOIA 1B3VA 4NX0A 4A2SA 1XINA 2P8CA 4REQA 3EMZA 3VNLA 3LZ5A 3L2IA 1FP8A 1ME8A 2HK0A 1IV8A 4AU0A 3POHA 2V9DA 4J3UA 4PUUA 4CNNA 1XP3A 1IEQA 3CXOA 4RE2A 1B3YA 2GVYA 4A4AA 5EFDA 3ITLA 2ZVRA 1Y5WA 2OX1A 4B4FA 3DYOA 3VILA 2Y5JA 3WLPA 4IIHA 1TV8A 3W81A 4HMEA 5IBXC 4KEMA 1ONRA 3TZNA 4DHGA 1QATA 4HA3A 3GU1A 1FWAC 1NM9A 4N9BA 4YL2A 1YEYA 4TMCA 3WNPA 2XZ7A 2JKPA 4S3GA 2G3NA 1M68A 3HGOA 1TELA 2UV8G 1E9IA 4O13A 4ZCWA 1JCTA 1HKIA 4XK2A 4LBSA 3CQKA 3M0LA 3STPA 3BG9A 5T91A 1OCBA 1FUYA 2VQUA 4GFIA 2WSYA 1FCVA 4YIWA 1OFDA 4JPGA 1PWMA 3FSUA 2QR6A 3GDBA 4M24A 1G6CA 2JFEX 4EE9A 3EB4A 1D7KA 3QGAC 2XFYA 4S2BA 4XO6A 3GRIA 4DZAA 1YRRA 1K70A 5CPOA 1Z42A 4U28A 2ZICA 4Y90A 1UR4A 3WD4A 4F0HA 3TSBA 3P5YA 5G1YA 5MKGB 4H9XA 4NXKA 3MI3A 1LJYA 3QYSA 4JOMA 1JZ7A 2IQDA 1I2QA 3EWUA 3KOZA 3LY0A 3SUSA 1SSDA 4DXXA 1XL9A 2CYGA 1BKSA 1E3XA 4UCGA 1BXNA 2ZC8A 1GQJA 4DN1A 3PG9A 2YX0A 2Z1SA 4KIEA 4L4MA 3WLQA 4F0KA 3KBMA 1RY8A 3S47A 1UUMA 2NX3A 4CD5A 1UQYA 2GDQA 3N2OA 3DHFA 1RUSA 1UUQA 4J3XA 3G6LA 4RZBA 4KCTA 4MSSA 1P0BA 3JW7A 1NSJA 4TXEA 1PX3A 2P0OA 1RD6A 2W63A 1G1YA 1PIFA 3V1HA 2Y4SA 3ONCA 3RJXA 4ICMA 5LNRA 3HOJA 4DBEA 3O0KA 2GWGA 2YYTA 1GNXA 2QVNA 4FXRA 1J18A 3INPA 3M4HA 1VCGA 4K6AA 2W92A 4UC5A 1TV2A 1OABA 1B4EA 1F3TA 3O1NA 4PSRA 3TCEA 3AISA 2PWHA 4LNYA 1R38A 2H8XA 1F76A 1TZ7A 1W8GA 3MKKA 4M51A 1PZ3A 1J5TA 2Z28A 1MUMA 4GUJA 1X1ZA 4LY8A 1U33A 2Z7GA 2GUBA 4O54A 5A6BA 2A21A 1BLIA 4KKXA 1DHKA 3QH2A 2CITA 1G9HA 1SO5A 2CXGA 3LTPA 1WZMA 1JAEA 2C16A 2WZTA 3SGGA 1FWIC 4KFNA 1XF0A 4GJIA 2PTZA 4QTGA 4FOKA 1WZAA 3KOXA 1QFEA 4J35A 2ZZ3A 4MG4A 1LQ2A 1UUOA 3T7VA 3MMUA 2YCKX 7TIMA 1JPMA 4D2JA 5K9XA 1I60A 5I03A 1A53A 3TNBA 2C19A 5ABFB 1C8VA 4N4QA 2GQ3A 1A5NC 4OE7A 4B3LA 3NPXA 2E3ZA 1P6WA 2ZZ4A 1O66A 1DWGM 5ECUA 3C3NA 3UCQA 2V8ZA 3B06A 4GA8A 1P6BA 2XM2A 5LGXA 3CV1A 4WX2A 2UY4A 4AY1A 1R9ZA 1YIXA 4BQ5A 4U3CA 3RG6A 1XLAA 1W3KA 3BCJA 3N4AA 3BQ6A 2FPVA 1YADA 1CXEA 2VGFA 5A6LA 1WOBA 3GBEA 4DJEA 3ARTA 5AECA 2FMNA 4QS6A 4YTTA 2BXYA 3CUXA 4KFOA 5EMKA 3HGJA 2NX1A 5C9XA 3NOYA 1XPGA 3QZ6A 4JX6A 3RPTA 1PVNA 3IGSA 4JQ4A 3F4CA 3T6CA 2VMFA 1W32A 1ZENA 3AI0A 1BWKA 3ZR5A 3WL0A 4KESA 1RA0A 3BANA 3PNZA 1Z7AA 1ZL1A 3H24A 4ML9A 4K7VA 4GZJA 1LT8A 4IISA 2D2HA 5FJUA 3QPEA 3M0IA 2V3FA 1HJWA 2NVCA 4BHYA 1EJWC 4XZLX 4CD8A 3T0DA 3DFOA 4B5TA 1XRVA 2PC4A 1P1XA 4QNEA 4QLKA 2ZXBA 1TKKA 4QEEA 5IXEA 4RE3A 1ZLPA 3VIMA 3AUOA 1CXLA 1OM0A 1RJQA 4P7OA 1OY0A 3P7YA 4FK9A 2BGNE 1XHGA 3SCQA 3WY1A 1IXPA 3DHDA 2XHYA 2JF7A 1EP1A 5C9UA 2FHCA 3UWQA 2OLSA 4BZYA 5CEWA 1O5QA 4GD0A 3WNMA 3ZYZA 3R11A 2QQ6A 1M6JA 3MBFA 4US6A 4WGHA 4BI5A 3ARSA 1EKOA 3STCA 2FFCA 4YPJA 3W1TA 3AZTA 2HVOA 4LV4A 3B8SA 2BXZA 2QVHA 4PC8A 3NQVA 4FP1A 2H6RA 2OQLA 3QV9A 1MDRA 2G8ZA 1Q6QA 3WLHA 4Z1BA 2PWEA 4G6CA 2PRLA 3SUVA 3PF3A 3SM0A 1LLZA 5CSRA 4CNOA 5DBUA 5C7HA 1CXFA 4QJ1A 4DYJA 3W01A 3GG7A 3I7QA 2DJXA 3BLDA 3FYYA 3FK4A 3WF3A 5CG7A 1YXCA 1AQHA 2P3ZA 4FNPA 1SJCA 5GJPA 2UY5A 3VC6A 2NT1A 3NM3A 1Q66A 1F8IA 4K3ZA 2V67A 4QX4A 2XH7A 3W75A 1RK5A 2X7VA 4I5RA 2YW3A 5A6KA 1YTKA 5LZLA 1EDQA 3WQWA 5AHIA 2OSWA 3KL0A 2CETA 4QSFA 3U6WA 4UTMA 5HMFA 2X16A 3V5FA 1F3XA 1ODUA 5BXPA 4LBRA 1NP0A 3QXBA 3CAKA 4DBWA 2EKGA 1QWGA 3MDUA 4IL0A 1OK6A 1K4GA 1DOSA 1R2SA 3W0KA 4Z2LA 4LWWA 1XSKA 3VO0A 4M1BA 3MV11 1MVYA 2BASA 2Z24A 1GPFA 3NL6A 4MJZA 3VYLA 2P53A 1C8YA 1AVAA 2PB1A 2OZ8A 2PE4A 1UWSA 1ZFJA 1WOAA 3EWXA 3POCA 4ZSTA 5HOSA 2J8GA 3W3OA 4Q8QA 2FTWA 3FYPA 2XN2A 2QZRA 1FWHC 1K1DA 4NT0A 4EPBC 1A3HA 1QHPA 4XTIA 3BSHA 4YYFA 5A6MA 2Y89A 2YCLA 3NEHA 3FVDA 2ADAA 2BV9A 5EU9A 1U1UA 4QP0A 3LGEA 4GVHA 3RN6A 4AX7A 2NSXA 2XM1A 3OA5A 3PWIA 2YCJA 2WCAA 3GQYA 1NF0A 5KZ6A 2ACSA 5IOBA 2XIQA 1W9UA 3M64A 3SAZA 5FEWA 3GUGA 1R5YA 2ISSA 1WDWA 3M16A 3QLDA 1I2RA 2GOKA 1XR2A 1SO3A 1XSIA 4PB4A 3QOMA 4W8LA 2F84A 2H90A 3RUBL 4ZMGA 3N6HA 1XLFA 2BS9A 1JL8A 4WY0F 2QW5A 4IMDA 4ZR8A 2YXXA 7REQB 1UC5A 1UASA 4N6FA 5IM51 4ZGYA 1S2AA 2EG7A 4WJEA 4WDWA 1EA0A 4XD5A 4OBRA 2NQ9A 2D3LA 4HHHA 1YW1A 3HF3A 5I3IA 1XYZA 4EACA 3EXRA 2ANUA 3B97A 3SFWA 3L4ZA 2GJPA 1S2UA 2VEGA 1C9DA 1E3ZA 1CPUA 2WB5A 4AD2A 5BRPA 4HSNA 1XC6A 3SY1A 2XFFA 4GKLA 3P0XA 4X60A 1XGZA 2ATSA 2O92A 1LBFA 2I14A 4B92A 3W7LA 1PV8A 1E1CB 2BHUA 1RPXA 1XXXA 2B81A 5AYIA 4UIOA 3FHAA 1S2CA 3AS2A 3KRUA 3NURA 3U2ZA 4G7EB 3NQDA 5JMUA 1YQ2A 3DBPA 2G3JA 1C7SA 4CQ9A 4FPSA 4GJ1A 4HPJA 4UTIA 4GHRA 1UWAA 1TPB1 1EB3A 4S39A 3G1AA 3W1RA 1RP8A 1U2YA 2YIHA 2ZIDA 3CUFA 2D0HA 3LENA 3IUHA 3E02A 4QBXA 4FMVA 2CFFA 4IQLA 5H8UA 4D72A 1M65A 3V4BA 3EX4A 1Y0EA 4JTIA 1JJKA 2P5NA 2V3GA 3OLDA 1J0ZA 1MDLA 3RM9A 1F6YA 1UD3A 5KTLA 1EGZA 4QFUA 1UZDA 4RXGA 4GQGA 4KBXA 2NQZA 1EP3A 5AYZA 2OTDA 4MB3A 3VGFA 3UJSA 1V3JA 4EIVA 4JBRA 3GWQA 3WO8A 3WH8A 4L1GA 4GQQA 4GIAA 3LHYA 5LNUA 2BMBA 2JQXA 4CLMA 1DIOA 2V82A 1KR0A 1IR1A 2D24A 3AFBA 3LCIA 4D8ZA 1E4MM 1J4EA 3VM5A 4GNJA 3UA4A 4IFOA 4DI8A 1QW8A 3LB0A 2ZUTA 2A3CA 3NQ2A 1L6GA 2Z1KA 4LS1A 2VEFA 4HHMA 3H2NA 4AEOA 2FH6A 4QQUA 1JYXA 3CHFA 2FH8A 3GM8A 1HJQA 1KFCA 2OLHA 3B8UA 4DELA 2X2GA 4QNWA 5T9BG 3RM4A 2X42A 3GU2A 2AKZA 2ODOA 3KOFA 1VLIA 1WXZA 4PCTA 3IRSA 1EJXC 3SJNA 3IWPA 3OZYA 3UT0A 1GVQA 4BFAA 4KS0A 3KXQA 3B9EA 1J9YA 3FXYA 3KWXA 4D9PA 3DCPA 4IUOA 1M53A 4L9YA 4AC1X 3TTSA 2REQB 1RXOB 1E71M 3NEVA 3H70A 3ZT7A 2CBVA 3GTIA 3ZSSA 1TUFA 3W7NA 1BTCA 3ZJ8A 3ZOAA 5E0FA 4E0CA 2YKKA 3SCUA 3EPOA 1F3EA 2C79A 2YL5A 3TONA 1EIBA 4A3HA 2GJXA 3DG7A 1WDQA 4ROQA 4A3QA 4GABA 4CD6A 3GDMA 4O0QA 1UR8A 4C6CA 1R2TA 5HBFA 2YLLA 3B0XA 3OIXA 5BZAA 3GTHA 3ZM8A 4GI9A 9CGTA 4E6MA 1DORA 2CWNA 2XH0A 2QJNA 1K7XA 3IANA 1JF5A 2F2HA 3TAKA 3WLLA 1NDWA 3SGUA 2EKCA 2Y2WA 4DWSC 4QS5A 1KBLA 1GW9A 3G1HA 1HP4A 3MUIA 5TQLA 4PMQA 4MWAC 2E77A 2EGZA 1UD2A 2GDUA 3GSMA 3QEZA 1OFBA 3G3DA 4XISA 1V7AA 3M5VA 1W3TA 2YGYA 2DQXA 1VFMA 4IPIA 1AA1B 4LS0A 1LBLA 2QT3A 1MYRA 3A21A 3MW7A 1JDFA 5HWMA 3C2EA 5I3FA 3EKGA 3S6OA 2P8BA 4K1WA 3PZOA 3EDDA 2GJLA 4QGCA 2JF6A 2BOEX 4A3UA 3TR9A 4DF0A 3WCZA 3VIJA 4K8EA 1EHNA 3W6LA 4FLOA 1EBGA 3WSUA 4QM1A 1JYNA 3GNDA 3CBWA 1VAHA 2FGLA 4PH6A 3AYRA 3E0FA 4TVCA 1K03A 2WK2A 3JRKA 2HXTA 5EA9A 1PZ2A 3EEGA 4LCQA 1OF8A 3HA1A 1OWQA 3KAOA 1GVFA 4F0LA 3O9NA 4FNSA 1UMYA 4QJ3B 1TWSA 4DY1A 1X98A 3P81A 1VFTA 1ITCA 3IK2A 3W25A 2P1FA 1US3A 2PGWA 1EF2A 3WEMA 4K7YA 3KHDA 4KW2A 3ARUA 2BWGA 4OBTA 4LQ1A 2OO0A 3HGSA 4RK8A 4RKAA 1C29A 4PA8A 2R14A 4F79A 3N6JA 1R47A 1LG1A 2CIPA 5HNUA 3NYZA 3L2LA 4I3GA 3CHVA 3UZXA 4OKDA 3RPDA 5BMXA 1NFBA 2ZRZA 3PR2A 1V02E 3GIQA 1AODA 3PBUA 2J8FA 3QYQA 4DNMA 3GTNA 3DECA 4LVAA 3B8IA 1UR1A 2EXOA 4TVUA 1MXGA 1KFLA 3VIFA 4YXGA 1SFLA 4JKMA 3W6MA 3UXKA 1HKJA 4NZCA 1X97A 4CNSA 1ZCCA 1OG0A 2CESA 2CBUA 4OGZA 5I3JA 2A3EA 4J3SA 2Y0FA 4JQ2A 3WJYA 1PX8A 4IIGA 2OJPA 9XIAA 3C2RA 1GKQA 3O2LA 1OK4A 2BHYA 4HPGA 4AF0A 3H4XA 2PWUA 5CH9A 1XD1A 4TIMA 3NPWA 4NG3A 2ZRWA 3DUGA 2V81A 5JXQA 3R7MA 2ZKMX 3IVSA 4RDWA 2QIWA 2E6DA 4UZSA 5FEPA 3CTLA 1VFLA 4GISA 3UZZA 1LG2A 1EJUC 4DAFA 1UW9A 3NQCA 4TX8A 5E1QA 4IM4A 4AVOA 3EDFA 6XIAA 5CJ5A 3KW3A 3PPCA 1UROA 3OVGA 4H6RA 1OQFA 4BI6A 3QQ0A 3QW4B 3RITA 1QDSA 4FF7A 2ESCA 3M0VA 2PTYA 3VKJA 1QT1A 3OEXA 1FKXA 5BU9A 4NIRA 1M7OA 3P2VA 3W76A 3WLOA 3GBDA 1WBJA 3WNLA 2PDUA 1TJ0A 1HN1A 1LOLA 1W3JA 1EX1A 3QF0A 4PRRA 1ONXA 2X41A 5CAHA 3QLLA 1EXBA 1Q6EA 4C6BA 4KQNA 5DMNA 1W31A 3HPAA 1UKOA 4LF1A 4NX5A 4IMAA 5M03A 4XZ9A 5KSWA 4O14A 4WSHA 1VEPA 3BURA 3WLMA 4TO8A 3CUGA 3FSTA 3USBA 1AD1A 4I5XA 4Y9AA 3GHSA 1JCJA 3EB2A 2PP1A 1PBGA 3HPSA 4EPEC 2PLMA 4FX6M 3E2QA 3KDNA 4AAJA 2NLIA 2CHNA 3JR2A 1GQKA 2O9OA 4XKYB 2EPMX 3W23A 4JD4A 4WUIA 1K8ZA 3RLUA 3MU7A 5B80A 5CZ0A 3OLGA 3URBA 3V16A 1BF2A 5HPOA 3UG4A 2NQ5A 3NSXA 3VINA 3ARVA 5HNRA 4NAEB 2WANA 2V0TA 1A5LC 3QC3A 2GGEA 1KRMA 3UJFA 2BP1A 3FJ6A 3AYSA 5BWFA 4H7CA 4DRSA 2J7EA 4ERIA 2I57A 4NSBA 1OINA 1LQAA 3UGVA 3R79A 3TLLA 2VGIA 4LCRA 4D6HA 4IP5A 1KFWA 4JTKA 3NQEA 4MKVA 2J27A 1ZJHA 3I68A 3R94A 3CB8A 2G41A 2GK1B 1XH0A 4JIIX 3ORWA 4IMFA 4S3DA 1DIKA 3BZGA 2WMGA 1GG0A 2J7BA 1NP2A 2FQIA 2VXNA 3WBAA 1DYSA 2E5CA 3TQPA 2E1WA 2JE8A 2W66A 4MZYA 2HMCA 3BSGA 5A5WA 2PODA 4S3KA 1M7JA 3PK7A 4PR4A 4FXFA 3SCNA 3LEPA 1Y5XA 1OX5A 5FF3A 2DH3A 3RRXA 3FAWA 3W53A 1QHOA 4A21A 1E6SM 4DWSD 2XWDA 5I7GA 4UFMA 4O17A 2WQDA 1NY1A 4DWSB 3E0LA 5D8WA 2WZEA 1ZBWA 3RFAA 4QIUA 2DW6A 3ITGA 4WKFA 3UXLA 3HV9A 2VD8A 6REQB 2Z6JA 3O6DA 3HB9A 1CGYA 3QR1A 4PSPA 4NZ3A 4C1NA 4RE4A 2X7WA 3BUVA 3TUUA 3MUCA 3U4AA 1GYLA 1GEHA 4JY9A 2QEZA 5DLCA 1B31A 4B15A 3VD4A 3IJDA 1NTHA 3CUIA 3FOKA 3S5OA 1QBAA 4FX8A 4UMAA 1EOKA 3EWDA 1CZ1A 1P0DA 1SUXA 4LAZA 1OCQA 2X0YA 1W9DM 3K8LA 1A4MA 3W2NA 5FL0A 1AH4A 4L4LA 3UXDA 1G4SA 3PY2A 1E0TA 1VR6A 3IRDA 5FJOA 2GVGA 3RU8X 1H4PA 2I56A 3PZVA 1Z3NA 1R3YA 1GWJA 3WFAA 2BZNA 1OFOA 1GVOA 4MGGA 3N4EA 5HUOA 5DMLA 3SQSA 3TC6A 1ISYA 4JTGA 3WMSA 3CIWA 1S5MA 4MJMA 1XFBA 4GIYA 5G2WA 4P7LA 3B0VC 3VGGA 2XVLA 4ACZB 4GLEA 5CPSA 3CAWA 3FJNA 1XYAA 2B0MA 1OT2A 1YPIA 4ZVJA 3MHFA 3W4RA 2X1RA 3UJEA 3BAJA 3UY8A 5C6MA 4BEUA 4GOAA 3SRFA 2Q01A 3M1ZA 3O63A 1FH7A 1ZSXA 1MZHA 2WVSA 3IJ6A 4TTGA 3CMGA 1W1ZA 1GHSA 2XH2A 1Q2SA 3AIUA 3WQ6A 3PZNA 2BY2A 7ODCA 2WHKA 3PAJA 3CHDA 5ABHA 4I9AA 2HE5A 1EGVA 1I1XA 4Q33A 3N73A 4HOZA 2G50A 4DIAA 1TREA 4MPQA 2E9MA 5EMMA 2ZZ2A 4BWLC 3EBVA 1TTQA 2R1KA 1GOWA 1LQ0A 4PCPA 1BRLA 1X1OA 2FTYA 3RR4A 1QHZA 3W28A 2OOGA 5I3KA 5LA1A 4ASTA 3PPFA 2A85A 5BRBA 4C1KA 3DFSA 4AXKA 4KWUA 3HMCA 5AKQA 4AD4A 1FBAA 4Q6JA 1KM0A 5D8ZA 2WO5A 5BOEA 2FZNA 3B0PA 3TOYA 3EDEA 4LGXA 4O15A 4L61A 1PTAA 1LTDA 3DHPA 4JKLA 2PDMA 4N02A 3IGUA 5DMMA 4LSBA 2OEKA 2HROA 2FJKA 4GYFA 1CLKA 2VC7A 1B57A 1MQRA 1XFCA 2NQLA 4F4RA 3W1AA 5E9AA 3A24A 3GZAA 1KTNA 3GS6A 3BW3A 1TIWA 4JTHA 1I2PA 5XIAA 2F6KA 3MI6A 4RNFA 1XDLA 3R5EA 1I75A 4MJ4A 1DIEA 3OZOA 2EG6A 2GL5A 3MUAA 5JVLA 2BX7A 2ABBA 3AJXA 4HZ6A 3BLKA 3CHEA 3A3HA 1R3QA 4LW7A 4EANA 1PDZA 5CZKA 2HCVA 4E2DA 4QHRA 1X96A 1KM3A 3RF9A 3EAUA 2FZBA 1OIFA 1FHLA 4G56A 2VZTA 3K30A 4QG8A 1VHNA 2VZSA 4CGTA 4GH3A 4QE4A 1NQKA 4NNAA 1EOMA 5AVHA 1HX0A 1V3MA 3SRDA 1N2VA 3VDGA 3KRSA 3W74A 4GY7A 3EYPA 1YDOA 3FAXA 4HN8A 4IZGA 3CUZA 1SYTA 4HU3A 3SRHA 3QMTA 3C8FA 2INEA 1QPKA 1S3TC 1WDSA 3GNOA 4BK9A 3UP8A 3Q45A 1XLHA 4IT1A 3C2YA 3RPMA 2DW7A 3W7RA 1H5VA 4DZIA 4EP8C 5D2XA 4D71A 4OV4A 4DLMA 3A4WA 2FPYA 3O6CA 4UTWC 1HF6A 3QRHA 3QV8A 4D6FA 4A2RA 4DF2A 4YHGA 1WUFA 4F2BA 1BG4A 2QPUA 1KTBA 4JIQA 3PZQA 1M04A 4W5UA 2E6YA 1GUVA 5HWJA 3MVIA 1ZAIA 1Q85A 4MB4A 4W93A 1W6TA 3BW2A 3BV4A 2PAJA 1W1PA 4OUIA 1K7EA 3JS3A 3HGRA 2TMDA 3UJRA 2ZA1A 3ABOA 2Y24A 3TR2A 2OYLA 3W87A 1Q4NX 2ACUA 4AD0A 1KW1A 1BGGA 1U1HA 1EFZA 3PN8A 2V5KA 1QXLA 3SO7A 3UZJA 4JNMA 2GZXA 2QUTA 5LA2A 4W85A 4MY9A 1CGUA 2FB2A 4K37A 2FGZA 2AGTA 4ZQPA 2Y85A 4F0RA 2PDLA 2YZ5A 4LUJA 1QPOA 3B9AA 2R1NA 4J27A 4QDMA 1EDGA 3M7WA 4RZ6A 4PTWA 5D33A 3WBYA 4O28A 4MIMA 2ISDA 4DJFA 1JPHA 2ZXQA 1G01A 1PKYA 3M44A 4IIBA 3R58A 2QCMA 3UF9A 2WC3A 1G94A 1TMLA 1WX0A 2WWDA 3NA8A 3GH5A 2BBFA 2VWTA 3O6AA 1ZGDA 4IG2B 1DWHM 1NDYA 1NWRA 3TZFA 3REQA 5TF0A 2E8YA 3UG5A 1ISXA 1QNQA 2NXHA 3H7RA 1L6FA 4JYEA 3RX2A 1F4HA 2XINA 3THQA 4AMCA 5SWUA 3D3AA 1PTDA 1W5OA 5DXYA 4HJFA 3GDRA 5BRQA 4RCXA 1TPUA 1JQXA 1UD6A 3WUEA 1DJZA 4IFKA 2H8ZA 3BAIA 3M0HA 1J6PA 3DZ1A 4H9ZA 3ALFA 1CGXA 4JR5A 1MEIA 3WD1A 3H6OA 5M1TA 4RL3A 4NHVA 5C9RA 3GLCA 5D09A 1NF7A 2QCDB 2DT1A 1JCXA 2FZ8A 2J9YA 2ZBTA 4CQBA 4J2MA 3LBOA 2HPIA 3ZT5A 2AMXA 3DG3A 3NM1A 4J1OA 2X30A 2INZA 3VIPA 1BSIA 4H6KA 4DJDD 3TN3A 1EPVA 1Q6RA 2XIJA 2V5CA 4LUTB 1N55A 4O11A 5DMYA 1BVWA 5AC7A 5DEZA 5CGMA 1EWEA 1RBLA 2PMQA 3NZRA 2E5BA 4QDPA 4E4UA 3UR2A 3W1XA 4POCA 1Q6CA 3ZWSA 4IQDA 2IKJA 4FO4A 4CEXC 1N82A 1VIWA 2W62A 2WVTA 1JFXA 2CCRA 1B3OA 4PTMA 4G7FA 1KFJA 1W3LA 2ZE0A 4XWUA 2J13A 5AB3A 4YVXA 4WOZA 4TOQA 2BOFX 3C3UA 5E6YA 3S42A 2ZDRA 4JZ5A 2Y8VA 3MVTA 5GNYA 4PUKA 1TJ1A 1ZALA 1X39A 4Q4OA 3VD3A 2QJIA 1SMAA 4GKTA 1E0VA 3HU7A 3GU9A 3W26A 1RY0A 3SN0A 3BCFA 4BI7A 2VX7A 3BAYA 2ZWYA 2W61A 1UBSA 5JIPA 3CT7A 3GKAA 3QOKA 1XGEA 2QJHA 1SZGA 4OVXA 1CXHA 4RW5A 4DO7A 3G0SA 3F1QA 5FJIA 2JEQA 4MJ2A 1UPPA 1XBZA 1XBVA 1UZHA 3UPBA 3QZAA 3VMNA 3K4DA 4JHOA 4UOQA 3P62A 3K13A 4X3ZA 3SR7A 1SMDA 4OHQA 4NNBA 1CB2A 4AZIA 3VNDA 1QWKA 2YCEA 1KBJA 1WDPA 2OYKA 4O53A 3WQGA 3S1WA 4FR1A 3N2CA 4GQBA 2OU4A 4EAMA 3CAQA 3TWBA 1AH0A 3KBNA 4R7WA 1GTEA 1EUNA 2DJLA 1FDYA 4JHZA 5JH2A 1J2BA 2ZUSA 4MZ1A 2CZ5A 1VYPX 3TFXA 3CNYA 3BMVA 3WDIA 1CEOA 2J7HA 1TR9A 2VCBA 1K8YA 1KXTA 3W2JA 3A5FA 1F61A 4AZBA 1E55A 3CQHA 2PWDA 1VPXA 3OGVA 1OF6A 1CNVA 3EB3A 4MLRA 1TVLA 2RAGA 3UWZA 1WNOA 1TJPA 1TWDA 3SCTA 5FKYA 3WNOA 3EWCA 3W9ZA 3QKZA 6TIMA 3ES8A 3ITXA 2KX9A 4KWSA 1J10A 1MXSA 1OCJA 1VFUA 4GH1A 4GNVA 1NFPA 3WF2A 3DYMA 4PUEA 1WKEA 1N8WA 2GUUA 2CLMA 1J11A 2GJRA 3IAPA 1X8FA 5J5RA 2A4AA 1JPKA 3DEQA 3F2BA 2IKHA 4WF7A 3SFKA 1WO2A 3K4AA 3S9IA 4JHMA 1F05A 3E9AA 3PSWA 4XZIA 3EEZA 4XAZA 2CLOA 3B8VA 1GOQA 5CC6A 1KTCA 1WE5A 1WZLA 2DUZA 3FW6A 4LV9A 1XLMA 3LI1A 4GK8A 2YL6A 5T9CE 3WQVA 4JX5A 1FHVA 3F7JA 1DJWA 5G4EA 4B5XA 3AS3A 3N17A 3QR0A 3MSRA 4MLJA 2VD9A 4LAMA 2WKGA 4EPDC 2QCFA 2GVJA 5HAOA 4R3UA 3SN4A 3DAQA 3THDA 3ZVHA 4BA0A 5RUBA 4E2OA 2O7SA 3W82A 3B9DA 5K2ZA 4JIHA 2HWGA 3VM7A 2E09A 1O5KA 3CWOX 1B3ZA 1P0KA 3A47A 4D6CA 4GIRA 4KETA 3VNIA 1O4UA 1W9PA 1DTUA 5FESA 4GYKA 4QJ5B 2GJNA 2XTKA 5I23A 5EPDA 5ABFA 2YOCA 3XIMA 1H1ZA 1J0YA 3FJ4A 1KBKA 3B3DA 3AIBA 2TODA 1V4YA 3KVKA 1TV5A 1UG6A 2QIIA 3PS7A 4TUFA 1YTDA 3QR3A 1CYGA 3BSMA 3CMJA 2UY2A 4ORMA 4MNKA 1YYAA 3MKVA 3UYIA 4IICA 2WZHA