1Z69A

Crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
327
Chain Sequence
MKFGIEFVPSDPALKIAYYAKLSEQQGFDHVWITDHYNNRDVYSTLTVLALNTNSIKIGPGVTNSYTRNPAITASSIASIAEISGGRAVLGLGPGDKATFDAMGIAWKKPLATTKEAIQAIRDFISGKKVSMDGEMIKFAGAKLAFKAGNIPIYMGAQGPKMLELAGEIADGVLINASHPKDFEVAVEQIKKGAEKAGRDPSEVDVTAYACFSIDKDPVKAVNAAKVVVAFIVAGSPDLVLERHGIPVEAKSQIGAAIAKGDFGALMGGLVTPQMIEAFSICGTPDDCMKRIKDLEAIGVTQIVAGSPIGPAKEKAIKLIGKEIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methylenetetrahydromethanopterin reductase (Mer) in complex with coenzyme F420: Architecture of the F420/FMN binding site of enzymes within the nonprolyl cis-peptide containing bacterial luciferase family
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethan
total genus 119
structure length 327
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1z69A00
2I7GA 3SDOA 3B9OA 4J2PA 4UWMA 1BSLA 3B4YA 1F07A 1Z69A 1NQKA 1LUCA 3C8NA 1EZWA 1M41A 1NFPA 1BRLB 1FVPA 1RHCA 2B81A 3RAOA 1YW1A 4US5D 1BRLA 5DQPA 5LXEA 1LUCB 5AECA 3FGCA 1TVLA 4US5A 1XKJA 3FGCB 3B9NA
chains in the Genus database with same CATH superfamily
1FA2A 4MGGA 1DJHA 4MWAB 1E6SM 3CJPA 4C6PA 4JZ5A 2J79A 3TAKA 3TKFA 2DZBA 4YTTA 1EGMA 3SI9A 3CB3A 3CL6A 4MDOA 1W9XA 1A5KC 1OK4A 2GVEA 3DGBA 4QLKA 3W23A 3QN3A 2AL2A 4MZYA 2IMRA 4MAVA 2FVKA 5BRBA 1PDYA 1FH8A 1OG6A 1QWKA 3GZAA 2PDWA 3MPGA 1KBBA 3ANVA 3IJQA 4DXXA 4U10A 1EX5A 2XFWA 1CLKA 2PWVA 5I3HA 4MJZA 1XF0A 3UJEA 2E4TA 1WCGA 2Z1XA 3ARTA 3W27A 3W22A 1UZHA 3M7SA 3MKVA 2P88A 2CHOA 2FH6A 3DBPA 4JFVA 4XIMA 1UKPA 5EA9A 2NXGA 4I9AA 1ZJIA 4DWSC 1A0EA 4LEQA 2GLKA 2IPFA 5CZJA 3KDOA 5H2ZA 4I6KA 2QCNA 3BJTA 2VGIA 2VUYA 4LAMA 3TSMA 4H04A 7REQA 1E4IA 1XKJA 3DN5A 4PTVA 2O92A 4DX3A 3ZVHA 3ATYA 2BZNA 2NQHA 3W2KA 3A12A 4S23A 1QPQA 2GVJA 3R4IA 5CPTA 2PWEA 2XDFA 3SCPA 3VTRA 2JKAA 4FF5A 2J66A 3BQ6A 4AD2A 4LYRA 4J9JA 5TAOA 2EF9A 1S5MA 1MUWA 2Z1KA 4OT7A 2VEIA 1AMKA 3IIPA 5U7SA 1P1XA 3BH4A 4JTTA 1RV8A 4C5YA 1DEDA 4HNTA 1R3WA 1E73M 2GZXA 3P2VA 4QE5A 3DH7A 3GG7A 4PB5A 4H7ZA 2PMQA 2OXNA 5C9RA 1JXJA 1IR2A 4M8UA 3FCPA 2C3ZA 3GVVA 3BGAA 4OIFA 3QXBA 5D38A 2OT0A 3ARVA 1TIMA 1CB2A 3SRKA 3QY7A 4C1LA 4GY7A 1T5AA 3ZJKA 7PTDA 2TRSA 4TO8A 5LNRA 4WJ8A 5DRIA 3EWUA 3PZGA 2JF7A 3PPHA 4WKFA 1HT6A 1WA3A 2PE4A 3GXDA 3VPLA 2V38A 4GQBA 1HJWA 3PC0A 4RNHA 2YZ5A 4YLWA 2NZLA 4ZQCA 4IFKA 3R0DA 1LBLA 2GSEA 2Y8UA 4FXRA 1F5ZA 1RBAA 3GE7A 1HVXA 4N4QA 3GHSA 4V15A 1QXLA 2W9MA 4FNUA 3DFTA 3OIHA 1RR2A 1PB0A 3AMKA 3LERA 3LZ5A 3IPWA 4N6EA 2BVYA 4H1ZA 1HP4A 1E6PA 3LN3A 3S1XA 3UJSA 3IJ9A 1I9CB 3W2UA 1JGIA 2C79A 4WKAA 3B4UA 2YDQA 3E2RA 1A0DA 5HDRA 3VNDA 4NVTA 2PDMA 4KFOA 3SN1A 3QV7A 4DZIA 2ZXAA 4FI4A 1GHSA 4FSAA 1R38A 1ZGDA 2Q01A 1Q6EA 1KFCA 2WHMA 4UB9A 5FL1A 1Z3NA 2PF0A 1BWVA 3TYZA 4FR6A 2V5CA 2ZXDA 3VOJA 2WJDA 4S3GA 3GG1A 3G8EA 4TV5A 3WNLA 4H9YA 3NQAA 1B5TA 3T8QA 4KEMA 1UROA 2BX7A 1XISA 1HJSA 3MMUA 3SZ8A 3WQ8A 1UWUA 4ZXLA 1XIGA 3LI1A 1VKFA 1C8QA 3VGHA 3K2GA 1R2SA 1TWZA 1VBJA 5XINA 3DG3A 4DRSA 3HG2A 3GXIA 4D6FA 2CZFA 2XSAA 2BB0A 4Y7EA 1HG3A 1I8JA 3KOYA 4KWOA 3ZLFA 4XKMA 1UBSA 3ABZA 2AQWA 3B8DA 5A94A 3URNA 3LQLA 4GABA 3OZMA 2ACUA 3QKEA 2TAAA 2OZ3A 2DIEA 4F0HA 4FOKA 3OBEA 1XIHA 3KWSA 5CGTA 3I68A 3ANYA 5CZ0A 5HPOA 3DI1A 1SW7A 3CS2A 4Y90A 4DXKA 1SYTA 3LBOA 3ABOA 3USZA 1EJSC 1GORA 3CQIA 3TC3A 3N15A 4HZMA 6ALDA 2YL5A 1HKVA 4GRSA 4INFA 1RLCL 5LHEA 4M6PA 4R7OA 3AHVA 5CEWA 3IJDA 4RW5A 3THCA 2OQHA 2CZVA 3RGTA 4QLJA 1F61A 3KTCA 3FAXA 1LLWA 5D9OA 3S2LA 4LEFA 1OCQA 3B9NA 4CCDA 1MUCA 4PMXA 4GGBA 4J3WA 2C16A 4RE2A 1E0VA 2OEMA 5D4YA 4QM1A 5I77A 3GDTA 5E93A 4HT3A 4UTIA 3VKKA 1F2JA 1V6VA 5JIPA 1L6YA 2O9OA 4ZL1A 1B3XA 3LNPA 5J5RA 1W2PA 3LSBA 4CQCA 3BW4A 4GC3A 4P5UA 4NZ4A 2C6QA 5BXSA 2D22A 2VGBA 3RFAA 4AC1X 1UH3A 2R1KA 4QGCA 3CQKA 1JPDX 4OECA 4PN2A 4O50A 2DT1A 1MUMA 3NSMA 4JHMA 3UG4A 1RHCA 4HB7A 3W28A 1U1JA 3EX4A 3W84A 4IGNA 4TXEA 4L64A 1PE1A 1XC6A 4AD3A 3AIWA 2V69A 2PPGA 3FKKA 4AF0B 1RUSA 3ZS4A 3KBVA 1BRLA 1V5XA 1DBTA 1VRXA 3M1ZA 2E6YA 1SO3A 1G0CA 2GQAA 2WC7A 1EQCA 1QPKA 3GAKA 1K7EA 3IJ6A 1TRDA 1Q45A 2OODA 5FSDC 1BHGA 5D9MA 5I6SA 3TW9A 4RKAA 4D8ZA 3C61A 1XR2A 1DJWA 5IXEA 1JFHA 3QW4B 1G6CA 4R34A 1V02E 4W86A 5C7VA 4IIDA 2WVVB 4IICA 4C5ZA 2YLAA 3FLUA 4N2YA 2DUZA 1JGMA 2OWWA 3N3MA 1GK8A 1A5UA 3LM7A 1W9UA 1ODUA 4R53A 5CG7A 1TZ9A 1KBIA 1Y7VA 4WXZA 3I4KA 4NASA 4WXYA 4HNCA 2A79A 4JX6A 1JJKA 3UWVA 5EY5A 2HMCA 2NSOA 1W1B1 1GVOA 1IGSA 3CZGA 1LCOA 1MNZA 4AVNA 3I7QA 3U57A 1JCLA 3HGSA 1W9VA 3G2GA 3V75A 5D2TA 2PDFA 4JKLA 1QTWA 1KW1A 4P8XA 3B9DA 4S38A 1A3WA 3TLQA 3W2JA 2BV9A 1OFAA 1PIFA 2VFHA 1F76A 3W1RA 4Q3MA 3SDOA 2XVNA 1WKFA 1X97A 3CK5A 2VOMA 5EMJA 2Z1BA 3MP4A 4LAOA 1YLVA 3R0UA 4HPHA 3VZZA 2AGTA 3T1GA 3TXZA 2X09A 2DZUA 5G1MA 5I3GA 1LF1A 1KR0A 3ALGA 5G4EA 2PGFA 4TUFA 3E38A 4WEVX 1OK6A 2OKTA 3KBMA 3KP0A 2YCEA 2JGYA 1A5OC 2EPMX 1DVJA 3W25A 1J4EA 4PMRA 4QHRA 1V4YA 4DJDD 4NAEB 4DJDC 2G4FA 4HIBA 1PIGA 1L2QA 5FJTA 2RGMA 4ES4A 3HPXA 3PAJA 3OOQA 3OJGA 3RPMA 1R3YA 1O66A 2J9XA 1IIHA 2E3ZA 9RUBA 4ECLA 3LHZA 1UUOA 1TTPA 5GJMA 2VFIA 3K30A 4F9DA 5I24A 3HQNA 3PZNA 1J0HA 3FFSA 3TEVA 4QNWA 1K9FA 2Y88A 4GXWA 3TE9A 3O07A 1FY6A 5AHLA 2IQTA 1RQHA 4QX4A 3VZXA 3JZEA 3S1UA 2DJLA 1QFEA 1CB7B 5JUVA 1E56A 1UR8A 3THDA 4D8LA 3MV11 1V3LA 8CGTA 4DM2A 3FKRA 1X7IA 4U5KA 3CMFA 3NDOA 4P7QA 4IPJA 4H2HA 1HJXA 3AISA 3DC0A 3CT2A 4QDWA 4PCFA 3NPVA 1YADA 3G24A 1PKYA 3EWXA 2ATSA 2E0PA 4EKJA 3K4AA 2Y7EA 1MQRA 3M0ZA 4WJEA 3HGRA 3PZOA 8XIMA 1PZ1A 2FDSA 4Z2GA 2HPMA 1NWUA 1RK6A 4LCRA 4N9DA 4DO5A 1QNPA 1KQZA 2WQDA 2Z29A 3EWWA 3W83A 1E72M 4GYPC 4A3HA 5DBUA 2VEKA 3GBDA 4Q32A 3BG9A 5AYIA 3CV6A 4C6OA 3C8NA 6TIMA 1QK0A 3UVAA 3L65A 4W5UA 5AHEA 5I3FA 1XYAA 4QCEA 4KF1A 2BLEA 3FJ4A 1ZLPA 5AVHA 3BE7A 4LH8A 4JIRA 4O15A 1XIEA 4C6KA 3AS1A 1XRSA 1WBJA 2F2KA 2WCSA 4JN6A 4WLCA 1FWHC 2XH0A 2X2GA 3V5CA 2DIKA 2X8RA 1YNYA 1W3LA 2RDUA 5FJPA 3OB8A 5AYBA 4JN7A 1F3WA 4AUBA 1ODZA 2ZRUA 2ISFA 4E38A 1LM1A 3I6RA 3BO9A 4LPCA 1J5SA 3PZIA 2AKMA 2WSQA 4KW2A 1XSIA 1EJRC 5F4XA 4KRZA 3ZT5A 3RLVA 3KZSA 3CUXA 2R91A 3R43A 3OYXA 4MFEA 4CNUA 4DNHA 1E51A 1O5KA 4ORMA 3N18A 1A49A 1TV4A 5I79A 7ODCA 3H2FA 4RL3A 1MEWA 5A8GA 3HQ1A 1W9PA 3MP5A 3GM8A 3I7RA 5EU9A 1JDFA 5M03A 1FWGC 1XDJA 2YW3A 1I1XA 4GXPA 4E5TA 2PWDA 3UXIA 4NI8A 4Z1YA 3S6OA 1X98A 4JTCA 3ARXA 3PTDA 2VURA 1BGGA 1V0MA 1TELA 3EX6A 3MA8A 2VD9A 4S3DA 2OKOA 3NDZA 3BURA 3POCA 3DFQA 2VR2A 3NQFA 1XRFA 8TIMA 2FZ9A 1O4UA 4ZGYA 4CQDA 3P60A 1GZJA 5K9XA 2NQLA 4OJYA 1F3XA 4PCSA 5FACA 3CBWA 3CPUA 3LCHA 1J11A 5EFDA 3MT1A 4LWWA 1F73A 2OZTA 3VIPA 1VGAA 3C6CA 3D47A 3KDNA 1IR1A 4JEJA 4AEOA 5DY2A 3LGGA 1PTGA 5FESA 1MXSA 3MO4A 3WD3A 4LS0A 2HS8A 4G1NA 3W26A 1TPC1 1XGDA 1XG3A 4IPPA 1BYAA 1XGEA 4QLLA 5HBFA 1TTIA 2FZ8A 4AB4A 3WLJA 2BY3A 1N7KA 4NZFA 4UTLA 5F1UA 3OLDA 1RSCA 2PWGA 1LLOA 1VFMA 3ITTA 4GXMA 2WC3A 1RQEA 1WDWA 3OA3A 3M0HA 2V2DA 3AS0A 2BY2A 2ODOA 2BODX 2G3IA 3ZSTA 4C6BA 4QP0A 2ZA3A 4FP1A 3L0KA 4H6QA 1IZCA 3ZJ8A 3VIOA 1BWLA 1VYPX 4IX2A 3AICA 2CFFA 1UKQA 4QJ3B 1CGXA 5KZDA 2VMFA 2YXXA 1ISVA 3RO8A 3LOTA 3WNNA 4OFCA 4UFIA 3VGFA 2WOQA 5AYZA 3MYPA 4MZ8A 1M3UA 1JYVA 3UNDA 3Q67A 3WDJA 4DUOA 4BQ2A 2YBTA 1UHVA 5AHNA 2O7SA 4FPSA 3COTA 2DUAA 4K8GA 1TA3B 2QCDB 4MPKA 3EWYA 4GVIA 3DHFA 3VGDA 1WPCA 2XISA 4BWLC 3DFOA 3ARQA 4FX6M 1SZFA 4DI9A 2ONEA 1OT2A 7XIMA 5EMUA 4CQBA 3NEVA 3T2OA 2G3JA 1AUSL 3CASA 3R79A 4XZBA 3NVDA 3UP8A 4BQ3A 1D3GA 1NAL1 3V0SA 2VZSA 1R47A 3EPMA 3C3UA 3MUAA 4AYSA 1TV8A 3HJZA 2VUNA 2Q09A 1X39A 3W02A 4PUJA 3RO6A 2QGYA 1ITUA 1QW8A 4E4PA 3W1UA 4EVZA 3FYYA 1AVAA 1FTXA 3VILA 1UWAA 2QCFA 4BS0A 1Z7AA 4LOCA 2PTZA 5SWUA 3OVPA 1UYQA 3RMJA 1K70A 4NKCA 1DQWA 1E6RA 3A3WA 4E6MA 1XYMA 3GIPA 3OVQA 2BFGA 1CXKA 5DMYA 1E0XA 3N2XA 1KRAC 1RCOB 1OINA 5CCZA 1DL3A 1ZJAA 1YXDA 1PXGA 3IUDA 3WH8A 3GUWA 3CWOX 5F4WA 4HA4A 3RR1A 1KV8A 2NWSA 3EXSA 4JPGA 4AWSA 3FGCB 4IJCA 3VE7A 3HA1A 1MVYA 4QJ1A 4AZ5A 5AC5A 4D6GA 4M7TA 4LVFA 2VOTA 2Y0FA 1NELA 1FCQA 2X30A 2WLZA 1BYBA 4LCSA 3KHDA 4LYQA 2W27A 2E25A 3DKJA 3NQEA 4ERGA 3VDCA 2GSJA 1LWHA 4EPBC 3HQOA 3L9CA 1R5YA 2BXZA 4CCEA 5BU6A 3KL5A 1P43A 1YXYA 1PYMA 3WH5A 1GGOA 3RLGA 3WLSA 2BHYA 2G97A 2VKZG 4RV8A 2IKJA 4JIQA 1XLLA 3NZRA 2DUXA 1XIMA 1Q8AA 2GWNA 3PJTA 3SCSA 3IIOA 3IARA 1CCWB 4XTIA 4PMNA 1V08A 3AXXA 1IWPA 4DUWA 4S3FA 3G77A 1CEOA 3EKLA 4AU0A 4EIVA 1N8FA 4DF2A 1OJXA 5CGQA 4HSNA 3WLKX 4V33A 1TB3A 3VXGA 1YTDA 1UUQA 4M56A 4JCMA 1YBQB 3K1GA 1SM9A 4K6AA 2CBIA 3UQNA 3BK0A 4XK2A 3MMDA 3NZPA 4POCA 1YYAA 2A3LA 4QJ5B 3WQVA 4HMDA 3R6IA 4ZCWA 1QOXA 3FDKA 1M53A 2CXGA 4F0LA 3VE9A 1BTMA 1DV7A 3SM0A 3C3NA 2OPJA 3MSGA 3GVRA 3U4AA 3RIKA 1FWFC 1JF5A 4AD4A 5BOOA 5DX7A 3VOCA 3E1F1 4LFYA 4MZ1A 4Q8QA 1I2RA 4ORIA 3NFUA 4UR8A 3CZKA 3LXBA 3S2JA 4D6DA 1KM5A 1W8SA 1UOKA 3KRUA 1YE6A 3WK0A 3O05A 1UA7A 2HROA 3AWOA 2Y5JA 3T0CA 1B2YA 3LRKA 1XICA 1PL9A 4F2TA 1UKOA 3HURA 3UZWA 2RJGA 3L67A 2GQ9A 1XYZA 4HMEA 2WSKA 3N2TA 3L0NA 4X3ZA 3UWWA 4GX9A 3E2VA 1GEQA 2ZX6A 1FHVA 2QYGA 3EPNA 3V4BA 4HMNA 1XX1A 3S1VA 1KXTA 4N4PA 4LGXA 1W5NA 3VCRA 4Q8WA 1WX0A 4GBDA 2W62A 3QGKC 3S47A 3MUZ1 1UZ1A 4X9YA 3CLMA 1FFQA 1Z42A 2B7NA 3OYZA 1GJPA 3GXMA 4MB3A 3TN4A 1MXDA 1W1PA 2EO7A 5KTLA 3W2MA 4R5EA 1QO2A 2YL6A 5E0KA 5HWNA 2YA0A 4B5SA 1K8CA 2H8XA 1XCWA 1M04A 3ABRA 2BOGX 2DZTA 2FZDA 1UZDA 1V77A 3W7QA 4J3ZA 2VI0A 5DCDA 2YDRA 1Z69A 4PMOA 5HANA 1QNQA 2TSYA 3K4DA 2JBMA 1DIKA 1HJQA 3C8FA 1GG0A 2QCMA 3SY8A 4PUEA 3O16A 3UWUA 2INEA 1DWJM 1JCXA 4DHGA 1VH7A 3SSZA 1VLIA 4ZENA 3QQ0A 4B4HA 3M07A 4LSBA 4HYRA 2P10A 5AN7A 2R24A 4UC5A 3QYQA 3KTXA 5M17A 5JVLA 1FXPA 4PODA 4F2UA 3G3DA 3W6MA 1YBQA 4DLMA 1UC4A 1EUNA 1GONA 2G41A 2UZ9A 3FXGA 1ZQ5A 4R3UA 1MWOA 2QJGA 4QDMA 4PZVA 2ZTJA 1L9WA 5G2HA 3OLEA 4IUOA 4KQNA 2X7WA 2DQXA 3A13A 2CWNA 3TONA 1UR3M 2POZA 3WK3A 3AYTA 1KM0A 5ABGA 1HKWA 1WZKA 3VOIA 1E1EA 1HJUA 3WJXA 1XLMA 4IL0A 1ZCOA 5HJYA 3HMJG 2J7GA 2R14A 2EXOA 2UY3A 4UXDA 4R27A 1YDOA 3W6YA 1E0WA 3GIYA 1ZHAA 3W0KA 4Q8OA 4CNTA 1ONRA 4XD5A 1DP0A 3AU6A 4XWUA 3BLFA 3CYVA 1IXNA 1PCWA 2W92A 3WLRA 1CX9A 4MMWA 4A35A 4HQVA 2WPBA 3MI2A 1UQZA 1CXFA 3IS4A 4V1XA 4NF7A 5IHRA 1EP3A 4EANA 5DY3A 1W1TA 1F6KA 1CGUA 4M7SA 1SZNA 1UBPC 4N42A 3GFXA 3AIVA 3PTKA 2CLHA 2QCLA 4XAFA 1XBZA 4F0MA 4JFTA 1NDVA 4CEXC 4ASTA 4Q4SA 4JFWA 5D09A 1US2A 1CBGA 2EEXA 2RHGA 4I9MA 5KZ6A 4IXHA 2DU2A 3LY0A 1RK5A 5LYRA 3NQ6A 3UCCA 4W89A 1RY0A 2XGBA 1ISYA 4P7NA 3AHXA 4IGHA 2Z6IA 4UFMA 4FXFA 1VBHA 3IRDA 3UNTA 3S6TA 1W1IE 1NFPA 3C86A 1G7UA 3LU2A 4JTUA 1B3YA 2AOSA 3CWNA 1IHIA 2D2HA 4GBUA 3M41A 1JR1A 1MI3A 3E6EA 3GW0A 5LKYA 1ML1A 3DAQA 5HULA 1FP9A 3TR9A 2RH9A 2INZA 5L6UA 4WDUA 2VCCA 3ITXA 3AI0A 5LNSA 4NL1A 3TC7A 2XUCA 5FAJA 4H3DA 4C6LA 1D9EA 3FJ6A 2PF8A 1LOQA 1H1NA 3W3OA 3LSCA 2QUTA 3ECQA 3MZ2A 1E1FA 1QOQA 3PBMA 3TMLA 4FNQA 4O53A 1UMYA 2GDUA 1W1YA 3IJLA 2IKIA 3BUVA 2HPIA 4B3KA 4A8RA 2ZUNA 3DXIA 3NVTA 5CJNA 4DJFC 4ADUA 3MDUA 1B9BA 2QJIA 3UF9A 3G1XA 1OBAA 4L80A 3V16A 2I1OA 3N9KA 2AMXA 4AWEA 4PSPA 3BLPX 3K46A 3LMZA 1M68A 3T8LA 2B31A 1TPFA 2D23A 2P8BA 2J8GA 3M0MA 3UWQA 1ISZA 5K4ZA 1TUFA 5C54A 1FWCC 2YJQA 1JDCA 1K9DA 2WXDM 1MW3A 1TPVA 2ZQ0A 1OFEA 5DCEA 2CBUA 2ESCA 1Q6QA 1AH3A 3PF3A 4F0SA 4O28A 2OJPA 3SECA 2TMDA 3LK6A 3WN6A 3QR0A 4PTNA 5I3DA 1J96A 1ZCCA 4H8UA 3UU0A 4MVAA 3STFA 2I17A 1NU5A 2W3ZA 2ZUSA 4D1IA 6REQA 3BSGA 1G5AA 1TV3A 3SN4A 3OZOA 3R11A 1REQB 3GRIA 2QVHA 3CAQA 3GH7A 2A5HA 2P0OA 3LX9A 1PCKA 7ENLA 2E5BA 1AODA 3FA3A 4HK7A 1RZMA 3VVGA 1UKTA 4PRTA 3WFLA 3RX3A 1QU4A 2FHBA 5G2IA 1RA5A 3UR2A 2EG8A 3ZOAA 2YR1A 3JRKA 3KVJA 4QE4A 3EOUA 4MNKA 1GQIA 4OTKA 1MZRA 4XBJA 3VABA 1KFBA 2HJPA 1FKWA 4IP7A 3UCQA 2FMNA 3ATZA 4HOZA 3TJIA 1E4NA 1EDGA 3CZ8A 3LENA 2V0TA 2DGAA 3GC4A 2DV0A 1ZALA 4AEEA 3TC6A 1ZU8A 4GNJA 1PX8A 1I75A 2Q3RA 3CO4A 5DXXA 4DUVA 3P82A 2OLAA 2BGNE 1ZP3A 4GZEA 4IH3A 1FDJA 1A80A 4JGDA 1MW2A 1XUZA 4E3TA 2PDLA 1BVZA 3BOXA 5FAGA 4GWEA 4GX8A 2ZZ4A 3ZLGA 2MUCA 3SGZA 3DU0A 2AAAA 4HHHA 3M0YA 1MMFA 1O6IA 2DH2A 3ONBA 1QT1A 1IT0A 3U5YA 1E55A 3TUUA 4XB3A 5TD4A 4P7RA 4RDVA 3WMBA 2OWCA 4YHGA 1AL7A 2GQ8A 1VPXA 2R94A 4A29A 4TV6A 1ALDA 5E9AA 3AYVA 4HCLA 3TN3A 4L4OA 4M1BA 3DFNA 1WDRA 2VX6A 1U5JA 4DM1A 3CAKA 2QDHA 4HD5A 4PUKA 1O94A 2PCQA 3WF1A 1W3KA 4JCLA 2JF6A 1XQKA 1W2VA 2YCJA 1KGXA 1GW1A 5HR7A 2YFNA 1BQGA 3JU2A 4QXIA 2QCGA 1Y5XA 6XIAA 1VS1A 3IEBA 3SUTA 3G3MA 3LXAA 3STCA 4IWWA 3UR5A 1OZMA 5D04C 4MNLA 3NSNA 1EBGA 3VNJA 2JKPA 4IIHA 4XIAA 5DT5A 3UGVA 1AH4A 1CLVA 1OFRA 1WKDA 1E9LA 4GYKA 5IM51 3EMCA 1R7OA 2XVKA 3WQCA 1KM4A 1IWAA 4NJIA 2OB3A 3GY1A 4KIEA 5IFPA 2WM1A 3LCFA 3HN3A 3N12A 4IISA 2DZSA 2WANA 1GJUA 3SQSA 4JTGA 5A6LA 3NURA 3M4HA 1TPWA 1XLFA 2BY0A 1TX2A 3PPFA 3VOHA 1TPEA 5FJRA 3Q45A 4JNMA 3KOWA 4ZQPA 3CEUA 3BQ5A 3GG0A 3USBA 1TJ1A 4HYVA 3WK1A 2X1RA 1J10A 2NLIA 1J0JA 3PBVA 3CV1A 3F4CA 2F6UA 1I45A 3S0CA 3GH5A 3WBYA 3UYIA 4PULA 2YZRA 4E3VA 3T44A 1T8QA 1KCZA 1HIZA 4JTDA 4IPLA 4QRNA 4UNKA 4CGTA 1HKKA 1YE4A 4F0RA 4IFOA 3V7PA 3M0VA 1Y5WA 2P5NA 2PSNA 5F7UA 3RU6A 3FS2A 3R13A 1LROA 3TIMA 5MKGB 3GDLA 4JX5A 6PTDA 2XN1A 3OGSA 1IXQA 2XFYA 3W7NA 1RXOB 2D0FA 3KHJA 3PK7A 4HZ7A 2X1UA 4GK8A 4CUCA 1JPIA 4CD8A 3XINA 1LORA 5C2XA 1IEIA 3UG3A 4GY0A 1TJPA 2WK2A 1KGUA 4QSHA 1E71M 2I5GA 3LM3A 2WZIA 4REQB 4WHBA 1ECQA 4KKXA 1VFSA 4NYYA 2NV1A 1TVLA 4MNMA 4F8XA 4MIMA 3WDIA 2E5DA 2OT1A 3IV3A 3KX6A 3O0KA 1SPQA 3PBGA 2CLEA 5IBXA 3GU1A 5FF7A 2YLLA 2ON3A 3MTWA 4GI4A 2QUMA 2IXUA 2LLEA 4EP8C 4AF0A 1JQVA 3CHFA 3TMQA 3T2PA 1TTQA 2CHRA 1SQ7A 1HL9A 5C6MA 3E49A 2VFEA 1QPNA 4HSOA 4JNZA 3DG6A 3VD5A 2VC7A 3UT0A 4NU7A 1PKLA 3W29A 5KITA 1VBRA 5TQLA 4JQ4A 1W37A 2R82A 4HZ8A 4IHCA 3GSMA 3HB9A 3G0UA 4R7JA 3K13A 2XYLA 4U31A 6ENLA 5K7JA 5IDZA 4ZO7A 5T91A 4S3KA 3REQA 2Q02A 2VEPA 1L0PA 3LDVA 2QUNA 1G94A 1W32A 2HNEA 2POTA 4KEUA 2WJEA 1XIDA 3H4GA 1I1WA 3A4AA 5IBXC 2D73A 1RJQA 4N9EA 1P5BA 5F1VA 5D2WA 3QQ1A 3NL5A 3G8RA 1BSLA 2PURA 3BARA 1XJBA 3ZWTA 2HVOA 5AC4A 1QUMA 5BWFA 3H22A 1S1PA 3G1DA 3PTMA 5AHFA 1PTAA 4N9CA 2ZZ6A 2FHFA 3P5YA 2ZRWA 3N4FA 2OYLA 3NEHA 4DO6A 3I3EA 3HO8A 5TBOA 2E28A 3GR4A 7TIMA 2Z7KA 4IQEA 1PYFA 4E2DA 1C9WA 1JDEA 4O14A 3OA5A 4MPQA 3CLWA 3N4EA 3MO7A 4DWSB 2QMKA 3HPAA 3W1NA 3WF0A 1HTIA 1NF0A 2I57A 4QFUA 1ITQA 2OGYA 3FXYA 1JCJA 3MUXA 1EC9A 2GFTA 1S1RA 3W2NA 4PYSA 3QMSA 2PRLA 3TR2A 1OHLA 5CGMA 2YL9A 4CNSA 4EPDC 3T05A 1UP0A 4FALA 4B9YA 3GVQA 3H54A 3GAYA 1H1YA 2PP3A 3DYMA 4RZ4A 5IFTA 3T0TA 2R6OA 2NVDA 1BVWA 2YFOA 1LRTA 4XV0A 1VEMA 3CEPA 2A3EA 3RJYA 4QAWA 2J75A 3UJFA 1QI3A 4ICCX 4QQUA 3SIZA 4E4UA 4Q4OA 4AZHA 1OC6A 3SGGA 4Z0SA 3GU2A 1O7AA 2ZUVA 1V3IA 1XDLA 1K9TA 3VNIA 1NOFA 1IF2A 4KESA 3LCWA 4FOJA 3HBLA 4ILSA 3EB4A 3FV9A 4WGXA 5M5DA 5XIMA 3R5EA 1MYRA 2Y24A 1GOOA 3A23A 4PSRA 3R25A 3ZMRA 1VFHA 4L9YA 1SJCA 4GO8A 5BNKA 3PUDA 3UXAA 4LB3A 1V6YA 1YDYA 2JEPA 2V68A 3TTEA 2HBXA 3DECA 2VGFA 4FA3A 1UD4A 2XH7A 1ZB5A 1GVEA 4K68A 4YL2A 7CGTA 1T41A 1AQMA 1R87A 3LV6A 1WYIA 3VINA 3OODA 2ISSA 5A95A 1G4TA 3T40A 3LEPA 5AC7A 3WKZA 1QJWA 4IG2A 4MJ4A 3VNLA 3IRSA 3QMTA 1X7FA 5BXTA 3THUA 2D3LA 2WJZA 3PULA 3TZNA 3W7EA 3L4VA 7TAAA 1J0IA 1S39A 1BKHA 4C7DA 1O12A 4GJJA 4Y9MA 4QDPA 4J7RA 3UG8A 4Y96A 1Y5VA 3VOGA 3BCFA 2PODA 5HOSA 5I07A 5KETA 4CNPA 1WDDA 4KWUA 1B4EA 2G4JA 3U7BA 1LRNA 4RZBA 4YIWA 1XH1A 5AZ0A 1W3IA 3FJNA 2AKZA 4OZOA 3H24A 4UMCA 3GU9A 3O06A 2HWGA 3HFYA 1DWHM 3R94A 5K9CA 5DELA 3URAA 5JMUA 4ZE4A 5EL1A 3I3BA 2C7FA 2PRMA 3WLOA 3AIEA 1VZWA 4Y9PA 1M9HA 1UWRA 2WCGA 1AA1B 4WDWA 2E09A 2OEJA 2EKCA 4JBRA 1LG1A 4KS0A 4EK7A 4GJ1A 4WOQA 3WD2A 2WMGA 1V02A 4DF1A 3ABQA 3SIMA 1XSKA 3VUSA 2XSXA 1GEHA 1IXPA 2V30A 4LYKA 3RILA 1Z9AA 1WB0A 3W7CA 1M7XA 4RZ5A 2ACSA 3WQ6A 3UZJA 3SUSA 4UMAA 3IJIA 1UP2A 3G1AA 3NTYA 2XHYA 1F05A 2PDQA 1N55A 2A7PA 4EAYA 1XIBA 3QEZA 3A3HA 4JYDA 2VJXA 5GNZA 1OB0A 1EZ2A 2DT3A 3A4JA 2C1IA 1ZAJA 3O6YX 5CSYA 3NQ2A 2H3DA 5IDIA 2ZYFA 2DSKA 2IKGA 3WELA 1QHZA 4Z2HA 1QI5A 4REQA 1B4KA 3UWZA 1YTKA 1YPXA 4IP5A 2INFA 3VD4A 1DXEA 1VIWA 3NPUA 5I0DA 4EAMA 2PLCA 1D7FA 1P6BA 2JK2A 1RY8A 5EYWA 4UFLA 1OFOA 3KWXA 3SCNA 1TX0A 3LPOA 1VR6A 1KBLA 4C7GA 1FP8A 1NWRA 2J47A 3EDJA 2GDQA 2PFHA 3IIXA 3W73A 1VHCA 4ZVJA 2VEMA 1MQPA 4ALDA 3LLDA 1EEPA 4Z1BA 4JX4A 5AYYA 1Q6OA 3DGRA 3M0LA 2E9MA 2EGZA 1SUXA 3ZVHB 3B05A 1DQXA 3EDKA 4YTQA 4ZXOA 4HGXA 1UWSA 1C91A 3CMJA 3KEHA 1I2NA 3WF2A 4GISA 4V1YA 2PDCA 3U2ZA 2ZA1A 4OUEA 3SBFA 3AXIA 3EKGA 3T2QA 5C9WA 3KRZA 1SZRA 5CC6A 3GG8A 1WE5A 1JULA 1Q7QA 2J7EA 2WHKA 3MCNA 4DJFA 4NG3A 1UP3A 3M5YA 4JTHA 5CSSA 3LD5A 5CJMA 2R8WA 3ITCA 2WB5A 3V0UA 5JH2A 3UESA 5CG0A 4CEUC 2ZOXA 3BMVA 1QWGA 3CL7A 3RM8A 3NQMA 2W91A 4B15A 3VCCA 1EJVC 4PL1A 1PX3A 2HNHA 2Y7GA 3VKAA 3AC0A 3PS7A 2CXEA 1OFQA 5EFFA 2DSVA 4ZODA 3CH0A 3RRAA 3BMXA 1ONEA 1KM2A 3PWAA 3H6OA 2NXHA 1HKMA 1KXHA 4RXFA 5A8NA 3I3DA 3WDHA 1P7TA 1EYEA 3TVAA 2X0HA 4YYFA 1BGAA 3A4XA 3BVJA 1JF6A 4FLOA 3TAOA 1YDVA 3UZXA 4DJFD 2PD5A 2QPSA 1R9ZA 2TPSA 4UTJA 1I6NA 5CPLA 4MWAC 2Y61A 3NGJA 1ZENA 1JUEA 4XZHA 1YX1A 2W5FA 3G1VA 5A2CA 1GYLA 3ZM8A 3H53A 4HPGA 3WH9A 1AG1O 3FYOA 4UFKA 1JUBA 3QOMA 4F2BA 2O9TA 1DE6A 3UR7A 2WKJA 4AIEA 3T78A 3CIXA 1KTNA 3D3AA 3WZ0E 1NDZA 1PHWA 1R9XA 3PNUA 2I5IA 4JKKA 4AHQA 4FNPA 2O9RA 2QJNA 4JQ3A 4M81A 3TROA 4ZOBA 1CPUA 3NL2A 4EACA 3PUEA 3NGFA 3MDWA 1DWGM 3E0WA 3AMLA 4YWIA 5H8MA 4IGSA 1Q6DA 2UY2A 4NT0A 5GPRA 3U6WA 1IIGA 4G1KA 3STEA 4D6IA 3GK0A 2XM1A 4PBFA 2GJXA 3R10A 4O52A 4AD1A 4OU1A 5CC5A 1JQXA 3AU2A 2AL1A 3L5MA 2CLMA 1E3ZA 2XIMA 5C2GA 3FN9A 4LUSB 2R9RA 1R46A 1DKWA 3IV8A 4N7QA 1FOBA 3NDYA 4KWSA 4B5NA 2QULA 3AIBA 4PMQA 3BG5A 5K4XA 4UQAA 2G5WA 1Q4NX 2OCZA 4TMCA 1G01A 4CQ9A 3SFWA 3FHAA 3PR2A 3N73A 4HOXA 1JZ6A 1EDQA 1H0GA 4WF7A 2FFCA 1LP6A 2EPKX 1WKYA 2WZEA 4B9ZA 2VELA 2ZZ7A 1WNOA 4UFHA 3NNTA 2F61A 3EX1A 1F8MA 4PMVA 1BF6A 3DHDA 4IX0A 4HA0A 1D3CA 3GNXA 3AJXA 1KCXA 2E9LA 3T0BA 2CKSA 4XD4A 3QR3A 3WLLA 4XSMA 3LB0A 3HPZA 5H91A 4PA8A 4GCXA 4L1WA 2IQDA 2AL2B 3IGXA 5HJXA 3PSWA 4FK9A 2VQUA 1FX6A 1P4CA 2XTKA 1BVNP 2QXWA 4CKQA 2ZE3A 3TA9A 4JTAA 3C5QA 3MMTA 3U7VA 1Y8BA 3VO0A 4G2DA 3PPGA 3GWQA 4IP4A 1Q6LA 4CQAA 4JDBA 3SO7A 2FGBA 5BW6A 2Z25A 5F4SA 3F4WA 3VCNA 3PUGA 4M0XA 5M1TA 3N19B 1HZYA 3LQGA 5IRPA 1Y0EA 1T96A 1VP5A 4AQLA 3B06A 1OY0A 4I8DA 3C2OA 4I3GA 3QBUA 4ERAA 1MEHA 4ZO6A 2ABBA 4NXSA 1A3HA 1CXHA 4PEEA 3ZZ1A 3GHRA 3I4EA 4MM1A 1H7PA 2HVNA 1F74A 1NWTA 4ENLA 2WC4A 1KXQA 1DXFA 5BCAA 2PBGA 3WENA 2OWXA 2VRJA 4X2RA 2RGLA 5FKYA 4BR1A 1H2JA 1U1UA 4HJWA 4JHZA 3B8TA 1LDCA 1ZP4A 3UBPC 1V0KA 2OR2A 1OEPA 4L1XA 3B0UX 4DZAA 1SGJA 4ZFCA 2FTPA 2FIQA 2BXYA 3CPGA 1D8WA 1J9YA 3C4UA 4ZSTA 4QR6A 2C1GA 1J6PA 4QEEA 3TFCA 2B7QA 3VIKA 1QI0A 3BPWA 2EBNA 3R58A 1P0EA 1VCVA 4S39A 3TCSA 1LRQA 4IQLA 5AHMA 3M6YA 3VIFA 4LAKA 1IEXA 1EBHA 2J8TA 2HVMA 5D02A 4WJXA 3WMCA 2VFFA 4LV4A 4XZMX 2Y5SA 1KRMA 1JUKA 5A69A 3S83A 4AY8A 4LALA 3LBCA 4IPIA 3CZLA 4KWVA 3R7MA 4UTFA 1X6UA 3ZQ9A 3VU2A 2HTMA 3UA3A 1UQYA 1NARA 1NOUA 4K8EA 3S1GA 2G0WA 5A2AA 2OVLA 3O6AA 1NF7A 3V1HA 3BMWA 3OG2A 3ABSA 1OX5A 2PP1A 2OOFA 1UPPA 1OGBA 3HG3A 3NPWA 2I14A 4KBXA 2HEJA 2XZ7A 1B0IA 2C71A 1CW2A 1H51A 3T4CA 1D3HA 3ZFHA 5A1AA 1KFEA 4LT9A 1H5YA 3FEQA 4Q4MA 1IGWA 1HL8A 2Q3OA 2C0AA 1GVFA 4X0NA 5HAOA 1XGZA 4KFNA 4LTSA 3VKCA 4K36A 5MHBA 2PZ0A 2ISVA 2O55A 4OOUA 3UCDA 4DIAA 4AIBA 1EGVA 1FVPA 2WLYA 4LW7A 1B1YA 1S2TA 1K7FA 3SFKA 3VMNA 1X38A 2D24A 5I02A 3QR1A 3WQGA 4JR5A 6A3HA 1XDMA 4ROPA 2CETA 4BEUA 1P7TB 3IJ8A 4ZTXA 5CBIA 2QNEA 2VHLA 4F40A 2H90A 1QRQA 2Y63A 1RCXB 1JPKA 4NX5A 1NOWA 1AQ0A 1VBGA 3KS6A 5G1TA 4C6IA 3RMEA 2CZ5A 3A21A 3QPEA 3DEQA 3N2OA 1JYXA 4L6DA 4UWMA 2PLMA 1E1CA 2PU0A 3NPXA 3JR2A 1ME9A 1YNPA 2J74A 1CGVA 4FAMA 1M5WA 3H26A 1OIMA 4O54A 2WMHA 1XYCA 3T42A 2ZRXA 4GKTA 1VEOA 3VC5A 3M43A 3QZEA 2QMJA 9XIAA 4LYPA 5BWAA 4MWAA 3LCGA 2OZ8A 4W84A 1R3RA 3BSMA 3G1SA 1NWSA 2NQZA 1R3SA 3U2OA 1XBVA 3TYAA 4AEFA 1N2VA 4MWAD 2WMKA 1DTUA 1M01A 4HNOA 3RUBL 5T26A 3RLUA 4GH3A 3MP3A 4QBXA 1A4MA 3MVTA 4D8AA 4B91A 2W79A 3AS3A 3F5JA 1VFTA 4LBUA 1R8LA 4AY7A 3IK4A 1D2KA 3UXLA 3WG6A 5HPCA 1EA9C 3LBMA 4G7FA 3THQA 4UQ9A 1TPB1 1G4SA 3FDGA 3NJ3A 4JQ1A 2D1ZA 1GOWA 3LLFA 4LBSA 1F7BA 4KPLA 4CLMA 4EF8A 5HNRA 1XH2A 1LT8A 3RF9A 2IW0A 2ACQA 5HNTA 4QS6A 1XM3A 3RDKA 5E9XA 3NAVA 1E6NA 1P1MA 3AJ7A 4FNSA 4EXQA 3WQPA 3WF3A 1KBJA 3VMPA 1EL3A 4H7CA 3W1TA 1DORA 1OCNA 1G7VA 4IMCA 3G6MA 3GBEA 5A8MA 1WP6A 4PRRA 1EFZA 4O1DA 3OBAA 3WEZA 1Q6RA 5FF2A 5CLTA 4LNCA 3GNRA 4ZFMA 4H9UA 4ML4A 3V1PA 3LHTA 4UTHA 5REQB 4GH1A 1XV8A 3M0IA 2A3AA 2X1SA 3T09A 3L12A 4OV9A 4CQ8A 3VFLA 4K8HA 1XPYA 3T0AA 3E5PA 3O1NA 2ASHA 3GTHA 1LLZA 4XAGA 4BI7A 1IZKA 1H61A 4HMCA 4UTTA 4S3BA 5BU9A 1XLCA 1NFGA 1JYNA 1FHUA 1KO0A 4CU6A 1QHOA 4FB7A 1TIWA 5FL0A 1J18A 2VT0A 4Z1DA 5CKSA 1R30A 2FJKA 1POJA 1PHQA 4G7EA 4NP7A 2J9ZA 3U3HA 4YXGA 3GZ3A 1FWDC 3B04A 2O0TA 2BVTA 3QY6A 4ZZ9A 4CN6A 1MRAA 2CBVA 2X41A 4LUTB 4GUIA 4MHBA 4NJGA 2DZAA 6TAAA 1GYMA 4R9XA 1JPMA 2DIJA 2ZVIA 1K4HA 1OG0A 1PZ3A 3S2CA 3W1XA 5ABFB 2JIEA 1TPH1 4AY1A 2XFRA 3OZYA 4U3AA 4GG9A 3G1RA 3PUOA 2E1DA 4A2RA 2UY4A 3TLLA 2WMIA 5JQ9A 3AUOA 1EXPA 4HTYA 4NNBA 2Z24A 1DHPA 4DN1A 3WLMA 1L6WA 1XLAA 3TSDA 3BZGA 1LYXA 2VDIA 4AISA 2XIIA 3N13A 5EMLA 2GJLA 3ZIZA 3R12A 3N9RA 5ABEA 5ENLA 1XIIA 1V8EA 4GYPA 2OSWA 3O0FA 1HX0A 2D0HA 3OGVA 2DFAA 2GPTA 1LUCB 1JFXA 1VCFA 3I10A 3P7YA 4YN5A 2GVLA 4R9OA 4J40A 3ZJ6A 2PWHA 5CZTA 1UASA 3GC2A 1WKEA 1DJNA 2I5QA 2QJMA 3WLNA 4H00A 4KGLA 1XLJA 4Z1AA 2UWFA 4O18A 4XG1A 5DLCA 4IMGA 2X0SA 4MY8A 1E6QM 2RJHA 4JTKA 4CN1A 1NP2A 4O4VA 3SEPA 3S3GA 1EO5A 4PMYA 4NRRA 2AQOA 1GPWA 1W5PA 1H50A 3WSUA 3TSBA 4DEFA 3PZMA 3RITA 2PLJA 1ISWA 3B4YA 1PWLA 1H0IA 4K38A 1D8CA 5T8GA 3EA2A 1KNWA 3S9YA 1V3KA 3DI0A 4ATDA 2V3DA 1TCMA 3QGVA 4LY8A 2Y2WA 1TV5A 2WHLA 5D37A 1FHLA 4YTUA 4RLIA 3BOLA 1Z8AA 3O3RA 3NCOA 3H7VA 3Q65A 4LXFA 1O1ZA 2FFIA 2OSYA 4US6A 1T8XA 4MUZA 4M3PA 2ZKMX 3HQPA 3CMGA 5JH1A 1W3NA 3R1ZA 1UKSA 1Q5MA 4V2XA 1B3WA 4RDYA 2BWGA 5CZSA 4ZBCA 4HOWA 1PVNA 5C70A 1W3TA 3ANUA 1GQJA 4C6EA 5BRPA 1L8NA 2BOFX 2GDVA 4L9XA 5DCBA 3D6NA 4O12A 3SURA 4OKDA 4NAFA 3GH4A 3WDQA 2HZGA 2PDKA 1H7NA 3QOKA 5HMDA 2PEVA 4AVOA 5T9CE 2FZBA 3W37A 2PDXA 3N9SA 3OZPA 3HGJA 4GD0A 1U33A 3BV4A 5HWJA 4YJ5A 5A6KA 3L66A 3CTLA 1HKIA 1XBYA 4X61A 1CDGA 2JQXA 2EQDA 3LUTA 2JFEX 4ZO8A 3GUGA 4PBEA 1S5VA 2EHHA 4BI5A 4DYEA 3VDHA 4ZR8A 1VPYA 4RCXA 2D2JA 3QZAA 1R3TA 1YPFA 4A8IA 2GVGA 1SFJA 1UG6A 3YPIA 2NVAA 1T6MA 4OOZA 3AYSA 2YBVA 2CPUA 4P61A 4H6KA 4D6HA 3O63A 3WUBA 4K37A 2QUVA 2I9EA 1A5NC 1RBLA 1PZ2A 5DFAA 1S2WA 3EKZA 3BLLA 1DYSA 4B3ZA 2ZXBA 1EJWC 2NQ5A 4KEZA 2BVWA 1CTNA 1Z6KA 3H2NA 2J7DA 2FQIA 1H7WA 4AX7A 4BQ4A 1FFRA 1EPXA 3VGGA 4Q4PA 4AAJA 3O6DA 1E4LA 2NV9A 5H6HA 2Q71A 3VD9A 1TJRA 3EYPA 4PCNA 4RZ6A 5HXMA 3T81A 2EG6A 2XIBA 3DKLA 4F48A 1ADSA 3QV9A 1NTHA 4IMFA 2OX4A 1Q6CA 2YPIA 3BW2A 5DQPA 4GNKB 1NQ6A 3W7PA 4C6JA 4ATLA 2QF8A 4LC6A 3S1WA 5KINA 4LS2A 4O57A 1FDYA 5HQMA 1PO9A 4AZGA 4DO7A 1EEXA 3B97A 4CVWA 4LVDA 5F2LA 2PDUA 4U28A 4GKLA 1AL8A 4JHOA 3S5SA 2FZNA 4OQVA 3RAOA 4Y9NA 4ZB5A 2VRQA 4D6CA 3MY9A 4JIEA 5CAHA 2FGZA 3H4XA 4PUDA 3PNZA 3TYBA 2RFGA 4BA0A 1QASA 4KFPA 3VGEA 2GVYA 3HG5A 3LCXA 3STGA 2GJRA 3EA1A 4XO6A 4Z42C 3F1QA 1XHGA 1A5MC 1TSIA 4NY2A 4AWTA 3LTPA 1ITCA 3ID7A 4YPJA 4MWAE 5C9UA 5JU6A 1NY1A 4ATWA 2Y4SA 2XGIA 4GQ0A 4L61A 1K8YA 3GVGA 2YYTA 3OP2A 3PPCA 4Z2IA 1OD8A 2WZHA 2J4GA 5MKGA 1OGSA 3K4WA 5CC3A 3THAA 4CVUA 1LQ0A 1M7PA 2GL5A 4UFJA 4Q8NA 3S5YA 3E0VA 1UB3A 2YCLB 3W86A 2XH4A 2VQTA 4N6FA 3KE0A 3TYUA 3L4WA 1RPXA 3IAQA 4EF9A 2F7FA 5LXEA 1AMYA 3QTGA 4UCFA 1L2UA 4H2CA 1C9DA 1JZ4A 2WAGA 1QNOA 1HO4A 2VWSA 3M0KA 3QFEA 1SO6A 3HG4A 2HK0A 3ZLHA 4IMAA 5C71A 4IXXA 1KM6A 3BLDA 1X8CA 1NP0A 4XKYA 1TMHA 2J9YA 5LHFA 3W6LA 1VRDA 4FLSA 4I90A 4J3VA 2TYSA 4LANA 2BVDA 1GVIA 1EF3A 3NQDA 1J2WA 1K4GA 1W5QA 1X1NA 4CN4A 1KFKA 1S2AA 2PGWA 5HR6A 3APTA 1PWMA 3ZYZA 1ZUAX 1JD9A 4NXKA 3RG6A 4MKVA 3N14A 2X2YA 3WJZA 3MSRA 4QSFA 2X42A 3A3XA 1TQXA 4WGHA 3G22A 1OCBA 2VGGA 3INPA 3PZUA 2DORA 2VO5A 4XZIA 2FLIA 4E8GA 3LCIA 3LHWA 3E12A 3QLLA 2GGGA 3KLKA 1KFJA 3POHA 1WBHA 2ISWA 4IM4A 4TQTA 3TOYA 1CI1A 4XKYB 3GDKA 5EBAA 4UTUA 5CPQA 1J12A 4S1FA 1KM1A 3VUPA 3WLHA 2VC5A 3R8RA 4WZHA 3QSTA 3DYPA 4LF2A 3S9ZA 1ITXA 4PMUA 2C0HA 4FNRA 3V0TA 1W9BM 2FHCA 4JFUA 3MV01 2V67A 5FIPA 4JNYA 3PWIA 2WMJA 4QTGA 2QDEA 2C15A 3M5ZA 3OG3A 4MUPA 3LG3A 2A3HA 2VRKA 5FJJA 5LIXX 4OE7A 3W72A 5HUPA 4BZYA 3NYZA 4B4FA 3B8WA 3AHTA 4W8AA 2ABAA 2HBVA 4NZ5A 1DIOA 2OMAA 5DBTA 1W54A 3STPA 1SJBA 1ESWA 1QW7A 2ZWZA 3A6OA 4PUNA 4TIMA 4H19A 2DEPA 1J79A 4BKNA 2QPXA 1M7JA 2WNWA 3EEGA 4M6QA 1S46A 1BD0A 3GS6A 1LBFA 1O68A 1NFBA 1ME7A 4JXCA 3K8KA 4YYCA 1TMQA 2BTMA 1T99A 3MHUA 4AZBA 3IVSA 4FXJA 4L4LA 1A3XA 3TA6A 4PE8A 2D2GA 1S3HA 5BMWA 4C6QA 3GFYA 4GUHA 4RNFA 3WO8A 5KZEA 1RBOB 2Z28A 4DVOA 3SCUA 4E0CA 1S2UA 3NZ1A 4PMZA 3KBJA 3EWDA 1MW1A 5HATA 4M24A 2ZX9A 2CLLA 4P8UA 4JTRA 4XAYA 5H1WA 3B0PA 4WSHA 1G4EA 1SU5A 1VENA 3A64A 1TRIA 3HIJA 3CHEA 5A3HA 5JBFA 3HMCA 3MMWA 3MKKA 1KTBA 1QNVA 3R2GA 3M64A 3RM4A 4AIUA 2FTWA 1K7XA 4CU7A 3O15A 3S5OA 5LGZA 3QKZA 3KVLA 4EOUA 3UVIA 3V5FA 1GVSA 3KCJA 2V63A 2DPEA 4QJ4B 2XIJA 2X0YA 1IQ8A 4M19A 4CCCA 2QDDA 1WDPA 1GWJA 3UR8A 3AMDA 1ZBCA 4DWSA 3W7HA 3MBFA 3W00A 1L6SA 3BAJA 1E9IA 3CIVA 3N6QA 3NQ7A 5E5CA 3NG3A 1CGTA 2J24A 4Q22A 3T55A 2VVSA 1H7OA 3SGUA 3W81A 5AY7A 4IT1A 3EXRA 1HN1A 4MB4A 3ORWA 4P7OA 4G8TA 2PDIA 3PFMA 2BMBA 4B2DA 3IGSA 3LHUA 3T4WA 2ZZ3A 1OYAA 3P3BA 5EPDA 2Y7DA 5XIAA 5I06A 1PDZA 3BSHA 3IVTA 4HCHA 1XINA 3JZUA 4MB5A 1RCQA 3ZJ7A 5I3IA 1JL8A 4NZ1A 1QOPA 4HU0A 2F2HA 1AQHA 3H2MA 3BLKA 1PV8A 1EPVA 4GNVA 3MI6A 4OGZA 3O2LA 2BNJA 1K6AA 2WVUA 3TFXA 1DJYA 1JRBA 1O5QA 3KZPA 4AHOA 5DRCA 1TMLA 2PWFA 1JAEA 4DO4A 2ZFAA 2GJXB 2QS8A 1SO4A 1AD4A 4H8HA 4J2PA 2RDXA 3BGJA 4AVFA 4FX8A 2WKLA 4Z0JA 4X9SA 4OVXA 5EKYA 4PTWA 3GTFA 1J8VA 5LA1A 3JS3A 3O6CA 4FHAA 1WZLA 5AC6A 5CJ5A 2H3BA 1E15A 1UC5A 4XBKA 1RALA 3DCPA 2ZC1A 2Z1WA 1W0MA 3OVGA 1UWQA 3H2OA 3RYSA 4WSJA 4AXKA 1JVNA 3RCYA 1R3QA 2QAFA 4DUXA 1TA3A 5FJOA 4L65A 2OGJA 4H6RA 4CD4A 1G1YA 2L5HA 4HU4A 3P81A 1OABA 1HJVA 4P8VA 1GVQA 3GKAA 1Y65A 3WEOA 3T9PA 5BXRA 3E0LA 3UWYA 4QEHA 4U5IA 1BYDA 3NQCA 4UQEA 2PDJA 1NEYA 1WDQA 3E2SA 4X2PA 2GWGA 1NDWA 3C0SA 4DBWA 4ADSA 4FEZA 4PB4A 3G0SA 2V5KA 3WQ4A 1U2YA 3U8GA 3APYA 3CUZA 1C7TA 1OCJA 4DY1A 3L5LA 3ME3A 4U3CA 1F4AA 1RD6A 4IIGA 2PTYA 2E9BA 1M1BA 4ZB2A 2PZNA 4AG0A 1GYNA 1JYWA 5C9XA 2IQ0A 4M80A 3W9ZA 2X05A 4AZCB 2CLPA 3UYCA 3HGOA 4A3RA 1OZQA 3IAPA 1EC7A 3ES8A 3L0GA 4J27A 2VENA 1PBGA 3TTQA 3LPPA 2GQ3A 4DAFA 4JEQA 4FMVA 5G4HC 1W1VA 3TJ4A 2ZX7A 1VEPA 1GOKA 1MW0A 2Z27A 3APGA 4CD5A 4B16A 3VC6A 3PBYA 5E0FA 1TPDA 1SW3A 2HS6A 3IANA 1AJ0A 3RCMA 4NZCA 1FCBA 1GW9A 3BG3A 1JCYA 1B3OA 4AWUA 5D9PA 1QMLA 1VJZA 1EJ7L 3FNDA 3VZYA 4E2VA 1F8IA 2WO5A 1JRCA 1C8XA 3URBA 4MYAA 1DIEA 2VTFA 4F0KA 2Y5EA 5D8ZA 3H7UA 1FWBC 4IF2A 5E6ZA 4N9BA 2QVNA 2WNZA 2AQVA 3TDFA 4PTMA 1WQ5A 2DT0A 3L4UA 3E0IA 4DNMA 1GTEA 4D6EA 1MFUA 3PM6A 3F5LA 3GX9A 4JIPA 1NH6A 4PMDA 4J2MA 3EWCA 3IGHX 3BJFA 3NSXA 5PTDA 2ZWYA 3SCQA 1S38A 5F2MA 2BGSA 1W5OA 1W3JA 5E6YA 3VDAA 1RA0A 1KBKA 1XYBA 4LUTA 4OV4A 3QC3A 4IQDA 4IUGA 5CQ1A 3BGGA 3EPOA 3LCLA 8A3HA 1L6FA 2PB1A 2NWRA 4G9PA 1HVQA 3FYPA 2Y6ZA 4TMBA 5BRQA 4Z2LA 1LWJA 1LQ2A 1S2VA 1IYXA 2A3CA 3MSYA 5LNWA 1CYGA 4A4AA 3SRDA 1ICQA 1ZL1A 1XS2A 1FRBA 2C91A 2GGHA 3L4YA 2VC6A 1R86A 3G0XA 1UCWA 1N82A 1KWGA 4L56A 2W0UA 3WH6A 1RP8A 1P0BA 5EBUA 4CD6A 2WZMA 2I7GA 3DDMA 4O1AA 3S46A 3AAMA 2CESA 2WBKA 3PAOA 4ROQA 5A6BA 4HHMA 2J13A 3W74A 4JKMA 2OEKA 1W1ZA 3K5XA 3NZGA 2HK1A 1ZBVA 2QT3A 3LTSA 4GIAA 3MUIA 4DZ5A 1H60A 4NAEA 5JXQA 4HJFA 4AZCA 2A7NA 3LRMA 3UJRA 3WQEA 2V6AA 3WJYA 3KAOA 3W1AA 5A6AA 3BLIA 4WIWA 3MS8A 1QBAA 1VYSX 4Z1CA 3ITVA 4KETA 4DJED 4GIRA 3L23A 4GVFA 2JIWA 2ZICA 2VZUA 1AFSA 1IEQA 5HQEA 4ADTA 1GCYA 4GA8A 1BEUA 1TCDA 4ACZA 4MB1A 3BTNA 4DPQA 1QHPA 4L6HA 2XVLA 4N0RA 1MDLA 3VK5A 3W71A 3B40A 4JTJA 4W8LA 1K03A 2Z0IA 1XG4A 1XD0A 2GSHA 4A8LA 2YL8A 1VJIA 4TVDA 2PUZA 3GNDA 3GXNA 4GC4A 3MVIA 5BYWA 4GLEA 3LGDA 3MWCA 3S4TA 2FKPA 4LVGA 1EA0A 1UW9A 3EWBX 4Y6GA 4JTEA 3G6LA 2YBUA 1S5NA 2OSXA 2ZXQA 3WUGA 1TWDA 4GCAA 3SR7A 2NSXA 1KQYA 2V3FA 2WSPA 1OADA 3AUJA 3B9AA 4K7VA 5AB3A 3GIQA 3KTSA 3TTOA 3N1AA 5FEPA 1GZGA 4YHEA 2OX1A 4O11A 3S2NA 1OFDA 2YX0A 2E7FA 4E4FA 4U2ZA 4A3UA 4PGLA 1EHAA 2IXVA 2VFDA 1LJYA 5I00A 3CUHA 3CUIA 1V6UA 2VX5A 4ZQNA 3GNNA 4OUIA 2VM8A 1S3TC 2CW6A 1Q3NA 4QE1A 1IEWA 3L2MA 3QFWA 2B0MA 5CPSA 3A22A 1H7XA 3LPFA 1QI2A 4CU8A 1DOSA 3W01A 5JBDA 2IPGA 2KAUC 1MSSA 4A2SA 3U2EA 4FLRA 1ZJBA 3AWNA 4I6VA 1FWRA 4C1KA 2V5JA 2NVCA 1WZMA 3DIPA 2OYMA 4GQRA 4LUIA 5CZKA 4FNTA 4DWSD 4KCUA 4FS9A 1VF8A 3PG9A 3QZ6A 2XG9A 3CQHA 4FXSA 3W4RA 4KT2A 2VEFA 5HINA 2QIIA 1BAGA 3W38A 1XSJA 4OHQA 4DBEA 3EX3A 3UZZA 2WYSA 3XIMA 4E8DA 1CXLA 2B7PA 2OZ0A 2OOGA 4ACZB 1EH9A 2NUYA 3VIJA 3W87A 2WNNA 4Q7NA 4O1BA 1QVBA 5CAKA 1HW6A 2B81A 4UNIA 4GIYA 1YW1A 4Z17A 4UTWC 3H23A 3OU8A 3DOPA 1C3FA 1CZ1A 4H01A 1F3EA 3I7SA 3C2EA 3H2AA 1UJPA 4GI8A 1EX1A 3QHMA 2WNQA 4DJEC 3ALFA 3AZSA 1DWIM 4NI3A 5C9ZA 4PB3A 2J6XA 4YMZA 5CPOA 1OYCA 4K1WA 4JY9A 3SB0A 1US3A 4EWND 1MFVA 2W67A 3EA3A 2OO6A 3L21A 3MANA 2QCHA 1YMYA 5A2BA 5KMYA 4Q4QA 3M44A 1TE6A 2D3NA 2CU0A 1PPIA 5ABHA 1K02A 2FPYA 3TH6A 3B8IA 5D2VA 1V93A 4H8VA 3RJXA 5GQBA 4Y9OA 5G4WA 1XPGA 3MUY1 4GJIA 4DPPA 1E43A 4JICA 3AIQA 1GVRA 5D33A 4BF9A 4LQ1A 4JDYA 1SMAA 4JQAA 3FIGA 3RM9A 2I56A 3LPGA 3SW6A 3QTPA 2Y7FA 3W1LA 2KZHA 2X7VA 3KVKA 5E1QA 3QV6A 4Y8FA 2HRWA 2DVTA 3MHFA 4Q6JA 1POKA 1H3GA 1XYFA 1UZ4A 2A85A 4WSKA 1TVNA 5FEXA 1VIZA 5EB8A 3WBAA 4FO4A 5HMFA 2DZWA 1W8GA 1UWTA 4MYXA 1QNRA 1V6TA 4LRSA 3GDBA 4L6OA 2NX1A 1KKOA 4BF5A 4K1GA 2RKXA 3WQ5A 3EMZA 4O0QA 4Q7BA 1QI4A 3CUJA 2PI6A 4BJHA 3PJWA 1B90A 3KCLA 3VIHA 5LA0A 5DMLA 2VZVA 3CQJA 1DJZA 1RQBA 1AJ2A 3OPSA 3AO0A 2P1FA 1Q7ZA 1WV2A 4D1JA 1GHRA 3WCZA 4O19A 4B3LA 1E3XA 4PRWA 4RPPA 5A8QA 4HHPA 5MF5A 5A6MA 3GHUA 1UOZA 5E0CA 3DUGA 3ARSA 1PKNA 4Z2JA 1ZBKA 1KFLA 3UZYA 4RDZA 4WOZA 4L4PA 1UD3A 3PZVA 1BWKA 1Z44A 4HP5A 3UG5A 4DQWA 1U83A 2YDSA 1DQUA 2Q8LA 3Q2DA 3W75A 1X6LA 2GJPA 1NQKA 2PDHA 3W7LA 4YCOA 3QSRA 3MQTA 4LUYA 3CPRA 1F3TA 2EJAA 1DE5A 1R0MA 4GVGA 1DPMA 4C7FA 3MU7A 1I60A 1EOMA 2E77A 2NUXA 2J8FA 2PTWA 1KRBC 4C6MA 3UPMA 2RDWA 4O16A 4KH2A 5BOFA 5KEZA 3VDGA 1UD6A 4IFRA 4PMJA 2V5DA 3W76A 1GKQA 2F8QA 3NM1A 4G7EB 4AZ6A 3KBNA 3RX4A 2ALDA 3ZVIA 2DVXA 4ERIA 3QPYA 2VCBA 3W1PA 3B9OA 1NVMA 4YCPA 4PUWA 3KOFA 1EIXA 3N2CA 1XKYA 3PG8A 1S2CA 4HTBA 4JD4A 1J2BA 3L4TA 4FZIA 3CZJA 4H41A 1XFCA 4LX4A 4H4IA 2QF7A 1VFUA 5A8PA 1SFLA 4ICNA 2CKRA 3H12A 1BG9A 9XIMA 4WDXA 5REQA 3PY2A 1E6ZA 2VL4A 2O9PA 4UTMA 1EP1A 1ONXA 4JTLA 1VFLA 1WOAA 3RNDA 2XIQA 3OQ8A 1N8WA 2H6RA 4L4MA 4TR9A 3WFAA 3GTNA 4I9JA 2P3EA 2E6FA 2C14A 3ELFA 3MJYA 1TR9A 1VC4A 3U48A 3DFHA 3AFBA 1UH4A 3W85A 3WJSA 3HM7A 4P8WA 5FD0A 3CUGA 3W07A 4XUYA 3H2EA 4HHLA 4ML9A 1UR4A 3M16A 2B7OA 1Z32X 3FJLA 1ONWA 4GI9A 3CWHA 4QAIA 3T0DA 2EG7A 1BPLB 3EAUA 4RUBA 3BCJA 1ADDA 1IT8A 4C60A 5LNUA 2QR6A 2EPHA 3KCOA 2DW7A 3DFPA 4NRSA 1SJAA 2ZVRA 1IWBA 3WQFA 4X63A 3GC5A 5C5YA 4Q8VA 3RN6A 2VR5A 1WXZA 5AHIA 3ITYA 2YA1A 1XIFA 1ZAIA 1X1OA 3EBVA 1PS9A 3A4WA 1PKMA 1SR9A 1O5XA 3LRLA 4A8NA 4UR7A 3GDRA 1AW2A 3R8HA 3HFTA 2PBOA 4E8CA 1A50A 3KM8A 3WBXA 2A6LA 1M65A 3WEMA 3MI3A 3OLGA 5KSWA 4YVPA 1ICPA 1K8XA 4AZ7A 5G1YA 2XINA 3OHIA 3AALA 2E6AA 4IG2B 3TNOA 1EUAA 4GIEA 1WOBA 3MJMA 3E0FA 5CPMA 2CYGA 3N29A 3SUUA 3TJXA 3M5XA 1OSEA 4GACA 3S6DA 3VKDA 1CENA 2JGQA 3GFZA 2W66A 2WZTA 5JIWA 3QPZA 1PTDA 3HV9A 3TK7A 4MAZA 3OTRA 1JAKA 2D0GA 5F2IA 1ENUA 4HK6A 4KRUA 4MKSA 3U9IA 3UERA 1V3HA 3D0CA 3NOEA 3WD4A 1TR1A 3V18A 1YRRA 3CM4A 4DI8A 1HQTA 3FSUA 2EAWA 2YKKA 4RE3A 3WYZA 4YTRA 4JYEA 8RUCA 4RXGA 3D5HA 2V3GA 4W87A 1RPKA 3NYDA 1GG1A 3IGUA 3QC0A 1JDDA 1SJDA 1FUYA 1FWSA 4O0ZA 3G1YA 1J93A 1LQAA 2DW6A 2BS9A 4HZ6A 3UPBA 4M6UA 3PN8A 1UH2A 3GNOA 4LNYA 2WKGA 2YXGA 2O4QA 4JFSA 4GMEA 1HGWA 3NQGA 6REQB 1PX4A 4HK5A 1AZ2A 2J78A 3QF0A 4UMBA 5FEZA 4NAFB 3Q4DA 1H11A 2FVMA 1BFNA 2BXVA 1F4HA 4BY3A 1EJUC 3DC8A 4ZA0A 3IUIA 3MZNA 4L7ZA 1H4PA 3EX2A 1JI2A 2Y62A 2VR4A 2ATMA 2EJ1A 4IJRA 3W1QA 5BZAA 4FR1A 2CZDA 2G3FA 5T9BG 1A5BA 5K9DA 3I65A 1SMDA 4CNNA 4IIFA 3P80A 3F7JA 4AH7A 3BLEA 4ONVA 4YWSA 4Q8UA 5TIMA 4S3JA 3MBDA 2DT2A 1EZWA 5LIWX 1C29A 2ZRYA 1XC4A 2G8ZA 3ZT7A 4NX0A 2DZXA 2XVGA 1EO7A 2W63A 3CYJA 1EOKA 1E6XM 2JALA 3QY8A 1KD0A 3W7OA 5LGXA 2V3EA 3HOJA 4A6GA 2ZX5A 1S5TA 1SZEA 1Q13A 1JG9A 1GOIA 2ZCGA 1WXJA 1WUEA 1B31A 1CWYA 3TWAA 3DZ1A 4AMAA 4F3HA 4K39A 1W3HA 2PS2A 2P76A 2A0NA 5A8OA 4LC8A 3MUCA 1WDSA 1F9CA 3URQA 4C1NA 8XIAA 3E9AA 4S3AA 3WIJA 3FEMA 3TTSA 3B8UA 1OX4B 2V5BA 3UXDA 4F4RA 5D32A 2CBJA 1PIIA 4ZEPA 1OWQA 3QMRA 4NNCA 3WMSA 4JL2A 1GKRA 5AKQA 3DFYA 3UETA 3EDEA 3LGEA 1VLWA 2QHAA 1GQNA 3BXWA 2NX9A 1J0ZA 1BSIA 5JBEA 1RVKA 2J7CA 1GJWA 3II1A 4PTDA 3K1DA 1YDNA 2Y70A 4L5ZA 3VM5A 3IIVA 2WWDA 1GNXA 2B4GA 5DMMA 1T40A 3VMOA 2A7RA 1OFPA 4PBGA 1Z48A 1M03A 4W8BA 4IPNB 3BOFA 2O56A 3ABXA 1J0KA 3K8LA 3P5ZA 5LIYX 2QUUA 4WVXA 3W7KA 1BLIA 3PBUA 2YB1A 1E40A 1UD2A 2G37A 1Q65A 3ITOA 3H8AA 4Q8TA 1GQLA 2XSBA 2F6XA 2BHZA 5ABFA 5LA2A 2WMFA 4ZMGA 3ZSSA 4DZHA 1KCKA 3ARRA 2OO0A 3RU8X 4Q6XA 1YHTA 2VDHA 4I5XA 4JTFA 5D05A 4ZOEA 4GYJA 4QG6A 1CXEA 4RW3A 3RPTA 3C2VA 4BQ5A 1XLEA 1Q66A 4GFIA 4R88A 1KA9F 4AHPA 4UOJA 2VFGA 5FSEC 3CHDA 3MYOA 3S2MA 2C8NA 3QQWA 5A6TC 5KZMA 1JD7A 3RK8A 3VAVA 4DYJA 3OVRA 4MNJA 3B3DA 3B9EA 4FIQA 2PA6A 3OGRA 4KRTA 2P53A 3WD1A 2OELA 5IOBA 3T7VA 1SSDA 4I8YA 2JKEA 4L1GA 3G1FA 3OW1A 1V79A 3PHAA 1GOQA 2E68A 5AZ1A 3KW3A 4BI6A 3B0XA 3TOPA 2X16A 1KKRA 3VM7A 4I7VA 2GOUA 2MNRA 4KCTA 2BDQA 3WLTA 1BRLB 1EQPA 1UR1A 2ZZ1A 3TN5A 3N11A 1V03A 4J3TA 1HP5A 2BASA 3PJUA 4D71A 1XYLA 3HV8A 5D03A 4HNUA 4PH6A 4J5NA 5CLWA 2WBGA 4XAPA 1E4MM 3P62A 3WLIA 3KP1A 1W17A 4EE9A 2CLFA 5C7HA 1GZ1A 4XZNX 4R7WA 1W5MA 4MSSA 3GTIA 1P0KA 2E8ZA 4ZSUA 4IGMA 2C13A 1OYBA 4B5VA 1ZNNA 4GGHA 3KXQA 1EXBA 4NJHA 4Q33A 5HNUA 2Z2AA 1EIBA 3AMCA 3EDFA 1K6WA 1Z89A 3BLOA 3PWGA 1W6TA 3EB3A 3SJ3A 1VQTA 1XRTA 4S2CA 5IHSA 1MEIA 2ALRA 3C2FA 4AC7C 4H9XA 2F9RA 3M9YA 1UR9A 4E2OA 3EZ4A 3LXCA 4NNAA 1J0YA 2X1TA 1JDAA 4JYFA 3KL0A 1R2RA 5HQLA 2ZTKA 1BXBA 4H9VA 4WRHA 4JAWA 3CNYA 1RD5A 3KOXA 4HYWA 1JCMP 1D7KA 4LUJA 3AYRA 4GY1A 2DVUA 3A9IA 5AVNA 2XWDA 1XUUA 3NL6A 1QPRA 4UIOA 4A05A 3F4NA 1RJRA 4TTGA 5U4NA 4XQ6A 3PTQA 2QKFA 5EMKA 2NX3A 5DXYA 2ISDA 5A6BD 5FF3A 1BXNA 3QH2A 4FF7A 1JPHA 2QLYA 3IACA 2GGJA 2OQYA 4XZ9A 4FOUA 4GHRA 1W9DM 2J88A 4MFDA 2FB3A 4XZLX 1FWEC 1QAPA 3BC9A 2R1MA 1SZGA 2YCKX 4OBSA 1BQCA 3AHYA 1RAKA 1Q6GA 3M7WA 4NILA 4GZJA 1J01A 4HN4A 1NIUA 1P6WA 5K3VA 2CCRA 2Y1HA 3A9BA 1XCFA 3TYEA 1RJPA 5ECUA 3UD6A 3XISA 5I2UA 2V5LA 4GE8A 2DP3A 4XO7A 1S5WA 4DJEA 1GOXA 2XIOA 1SO5A 2GUYA 1GPFA 2VWTA 1XFBA 3GO2A 3BDKA 5A6SA 3DBNA 1OM0A 3EOSA 4TVUA 4Y2WA 4ZOCA 3T08A 3S9IA 5HK4A 5J8LA 3MSDA 1TREA 1R6WA 2AMGA 3L4ZA 2V2HA 4UCGA 4F66A 1G9HA 5C2CA 4JTSA 4AFYA 1HUVA 1A5LC 1TPUA 2XZ9A 4AMCA 1OF6A 2GK1B 5AFDA 3HPSA 3I6TA 5HJLA 2CWXA 2G96A 3UEQA 3SN0A 1QDSA 2Z1VA 3IJ7A 1VCGA 4GI6A 4LJ3A 1C8VA 1JEZA 3R0KA 2A3BA 2JE8A 3WD0A 4W93A 1GQKA 2G50A 2J6VA 2YDAA 3EWZA 4HCDA 1AH0A 2EPNA 4BFAA 4QITA 1XL9A 4EWJA 3DHPA 2F38A 1XRVA 4FX7A 3C2RA 2FVLA 1QR7A 2HQAA 1LZOA 1V3MA 1Q4WA 3E96A 4MF4A 2BSLA 3HTWA 1AW5A 2ZE0A 1LT7A 3W53A 4X22A 3TCEA 4JS3A 1EJXC 4KWWA 1MZHA 5LIKX 3WNOA 1LL4A 2GGEA 3DESA 2NT1A 3WL1A 3AOFA 3GKFA 3U0HA 1T7LA 2YCIX 2J62A 1P0DA 1EWEA 3AXHA 3P14A 5G2WA 3TJLA 3GTXA 3KBWA 1UR2A 1LTDA 4GFSA 1ZAHA 3OEXA 4MG4A 4I7UA 2SFPA 2HXUA 1CNVA 1FQ0A 2E40A 5C55A 4MJMA 4DYKA 3TX9A 3N6JA 2PWUA 3GXPA 4O8AA 2D2OA 1H7RA 3HU7A 1N8IA 1X6NA 4LAUA 2WHJA 2BG5A 3V5OA 5I3JA 2WPGA 3RHGA 9CGTA 5I3KA 3BZJA 3JW7A 5HMEA 3IK2A 2RAGA 4JTIA 5A5WA 1H1ZA 3EGJA 3MCOA 4O0KA 4Z08A 1WAWA 3TYCA 3N3TA 3B8SA 3PFRA 1R7AA 3P8IA 4U4MA 1PZ0A 1NDYA 4CCZA 4D72A 2XGZA 3FY1A 3QLDA 1JZ3A 3VX0A 5CBJA 4XZWA 1HL2A 2E1WA 3U4FA 4BF7A 4UOQA 2P3ZA 4Q4RA 4C65A 5BOEA 3RXZA 1EGZA 3TQVA 4H8NA 1H41A 3L5AA 2PD9A 3W7RA 3CC1A 3CIWA 1VPQA 3EDDA 3SCWA 3KOZA 1XP3A 1TKKA 2ACRA 3CAWA 3PZ9A 3MW7A 3SJNA 2DH3A 4OBRA 1TJ0A 2GK1A 4GQGA 5DO8A 2FGLA 2QW5A 1YNQA 4C6NA 2CHNA 5M3WA 4H9MA 2WWCA 4S2BA 1MNSA 1SR0A 4HSHA 1XBXA 1SW0A 2YGYA 1Q2RA 2A1YA 4LAZA 1ELSA 2IS7A 4GZ7A 1YQ2A 1C8YA 3ENLA 2GOKA 4G56A 1HGYA 4K7YA 1EC8A 3VNYA 4MTVA 3ICJA 5GNXA 3LV5A 2A6NA 4M51A 4DLFA 4I5RA 1F6PA 1JI1A 3S5NA 2W6RA 4J3SA 1VFOA 4RE4A 3QVQA 3MCMA 2PDNA 3CQ0A 3VIGA 3DYOA 4ZB0A 3RLHA 1E9ZB 1P6CA 2MANA 3N04A 1TUXA 3WNPA 2OTDA 1I2OA 4LB4A 4D9PA 4AYGA 2QDGA 4M5PA 4AIOA 5CBBA 4Q8PA 4JN8A 4RDWA 1IV8A 2PP0A 4ZE5A 1QK2A 3PZTA 5DN1A 3ZXWA 4QNEA 2Q8ZA 2QIWA 4MLRA 4YNGA 2P50A 3F4VA 4DB7A 3SY5A 2XPKA 1GUVA 3CV2A 1R2TA 2NV2A 3U2CA 3AXMA 1VBUA 3IVUA 1ME8A 3W82A 5GJNA 3TN6A 2XM2A 2WMIB 4CNOA 5LSMA 2G3NA 1O5RA 5RUBA 4DBDA 2PDYA 2GJNA 4DBUA 2AGKA 3P0WA 2UY5A 3DERA 4H83A 1HNYA 3GYCA 4PTXA 5LIUX 1E1CB 2ZDSA 3RPDA 4RPQA 2TODA 4FIRA 1J6OA 1ZY9A 3PSVA 1H09A 3ARWA 4B5TA 3W7MA 3HPFA 5K2ZA 3BAKA 4S3CA 3EEZA 1UR0A 1KFWA 1KR1A 2XJ7A 3ERPA 2ZUMA 5B7YA 1XLHA 3C56A 1OD0A 5AECA 1I2QA 3NL3A 2DSZA 4GUFA 4IIBA 3G18A 4PEKA 3TTYA 4UZSA 3PANA 1LG2A 3FA5A 1IT7A 1KLZA 1MQQA 4H9ZA 1KTCA 4HKPA 1LWIA 2HE5A 3P61A 2QAPA 2I9UA 4RJEA 4Z2KA 4URIA 3BV7A 3NXFA 2C18A 1O1HA 4R85A 3QGAC 2J7HA 4GUGA 3GXFA 2Z7GA 4RK8A 2O4MA 4S3EA 4JY8A 3FVDA 3NO5A 3W2LA 1DTNA 1U5HA 3ES7A 3N17A 5CH9A 3MKCA 1U22A 3SSJA 3GD6A 5A6JA 5I09A 4WY0A 2R1PA 4W9TA 4XX6A 1R9YA 3E3HA 2OG9A 3EB2A 3P84A 2FPVA 5HMSA 2GUUA 4H9TA 4DAIA 1PUDA 4RE0A 5HNNA 4B5XA 3BJSA 3H2CA 2A2IA 1JCNA 2WM0A 4Q7IA 1GT8A 1OX4A 2VP8A 1XD1A 4RNIA 4X60A 5BMXA 2PC8A 1NJJA 2WCAA 1ADOA 1TJ2A 1XXXA 1JXKA 1TZ7A 5DF0A 3UY8A 1RVGA 3NQBA 4DF0A 2ZBTA 1GTHA 3V36A 2CITA 4O8RA 4HPNA 2DDXA 4UOZA 4V27A 1TTJA 2Q6ZA 4PR4A 4IFKB 4Y9AA 2Y89A 3F03K 6CGTA 1UUMA 2QCCA 3CTTA 3R89A 4UTKA 1LL6A 1US0A 4GINA 3ZT6A 5EMYA 2PTXA 4NQ1A 1QCWA 4ZQRA 1QW9A 5ECVA 4PUUA 1JZ7A 1LBMA 1GKPA 4HNNA 5AC8A 1KB3A 1A53A 4UR9A 5CPNA 2BY1A 4W4QA 3FHQA 4BHYA 7A3HA 1BF2A 3ISIX 4BCEA 5TF0A 1EF2A 2XWEA 4NUWA 4KGJA 2Z1SA 5BROA 3N25A 5EGRA 3BAWA 5FF4A 2VX7A 2PAJA 3W88A 1THFD 5BXPA 3O7UA 3ZR5A 1XCXA 2FTYA 3M46A 3WNMA 3BAYA 5EMMA 1P48A 4X0VA 5GJPA 1FDZA 3KFTA 4A3QA 3IUHA 1G67A 4WUIA 1KRCC 4B5UA 3WDPP 2DZPA 3QHNA 3V3WA 4JOMA 3VNZA 1ZS2A 3SRHA 4QIUA 5I23A 2E5CA 3Q37A 1B3VA 6XIMA 1QO5A 1REQA 3PB0A 2XH2A 4W7UA 3CUFA 2WV8A 4TOQA 2QV5A 4FLQA 2HCVA 3WK2A 5CXPA 3VNMA 3SRFA 4QROA 1FWTA 1U30A 4GUJA 2IPJA 4O4WA 1WO2A 4XVDA 3NIYA 4ZQOA 4TX6A 1EWDA 1KV5A 2DQWA 3QV8A 1V51A 2DSUA 3ARUA 1TWWA 1MDRA 2ZDRA 3T6CA 2OQLA 1U5VA 1AJZA 2Y8VA 4LBRA 4WK9A 3RRXA 1VAHA 5G5IA 4NZJA 3PJXA 1OIFA 2Y85A 4UNLA 1TV7A 2BOEX 4YVXA 3CHVA 4C6DA 5L9FA 1SFSA 2XN2A 3M0XA 3RR4A 4XBSA 3UFYA 4IQJA 3GW3A 1VD6A 5C8BB 5M2FX 3EOOA 4K3ZA 1LOLA 2JEQA 4AW7A 4NSBA 1CXIA 4MY9A 1OQFA 3GB6A 1VHNA 2ZADA 1WAUA 2YXOA 1CGYA 1KWKA 1TZZA 3UGRA 3F2BA 4RV3A 3BICA 4V28A 4DELA 2WJFA 4HNLA 2Z2UA 3K8MA 1TWSA 4A21A 3HJEA 3N34A 1U1HA 3VKBA 5AYXA 3LA4A 3WUFA 2CC0A 2PLKA 2ZC8A 1C93A 1A0CA 1K9EA 3L2LA 3D3FA 2FMOA 4DXVA 1TV2A 3BW3A 5I7GA 1Q7MA 3AZTA 3CV7A 2O7QA 4H6EA 1W31A 2ADAA 3KBSA 3GVWA 3TYDA 2W61A 1ZZMA 3WBEA 1GVYA 1H5VA 3UW6A 5CSUA 4WY0B 3AQUA 3ARYA 4WX2A 1KM3A 4QS5A 1L8PA 4NYUA 2P0IA 5E09A 4O17A 1VJSA 1KC7A 3NOYA 5HUOA 2PDBA 4J3XA 1B30A 1TFVA 2ZZ5A 5FEWA 3NM3A 1BXCA 1R85A 4J3UA 3CGTA 4J35A 4D6JA 5J5DA 3WMLA 3LNMA 3FVMA 1OT1A 4RX0A 4D2JA 2P8CA 4Q8MA 3AXKA 4ICMA 4ZOAA 3L2IA 4WY0F 1B9ZA 1FWJC 1DJQA 3CT7A 5FJUA 1A5AA 1UJQA 1C92A 2VD8A 1FH7A 1DWFM 1A5SA 3WLQA 1HXJA 2ZUUA 1FWIC 1DXIA 4AXNA 3WQWA 2OFJA 3OHMB 3H55A 2CIPA 4O1FA 1FCUA 2X1IA 4HN8A 3UZ5A 3ZR6A 4Y8EA 2Z2BA 4PC8A 1TVPA 3W1MA 4C91A 4LCQA 3QJAA 1E0UA 1OVDA 2YB4A 1V7YA 1E5NA 1FBAA 1C7SA 3LZ3A 2CERA 4PCTA 3DENA 3CB8A 2HE8A 5B7ZA 3L68A 2OYKA 1OC5A 5D2XA 2BP1A 2CNCA 3WF4A 1XLBA 2DJXA 4TX8A 1NSJA 3P0XA 1AQFA 2PGEA 2H9AB 3M47A 2YCLA 3C0LA 1SSGA 4B2DD 3AIUA 3TW7A 2PC4A 3EMQA 3QHOA 1X8FA 2HDJA 3PP7A 2QCEA 4O13A 1QNSA 4OWGA 1JIBA 2J27A 3WH7A 1W91A 3CHCA 3GXTA 3KRBA 4NJJA 1ZRQA 2VXNA 5GVJA 1JZ8A 2BBFA 2H8ZA 1XWYA 5DT7A 1VB9A 3A5FA 2IKHA 5D9NA 1XW8A 3OBKA 1PAMA 2Z26A 1Z41A 2PDPA 3OQEA 3AHZA 3W24A 4JTQA 4XAZA 4EX4A 3IIZA 4GO9A 4HVXA 1V7AA 1PEZA 3E5BA 1JZ5A 4LV9A 4LUSA 2CEQA 2WVVA 3ZR4A 3DHUA 3KS5A 1RP9A 5E70A 1BG4A 3NQVA 2NQ9A 4YS1A 3WJWA 1A47A 1A4LA 4XUGA 3W7GA 1K77A 2J7FA 1QATA 3KUMA 4ZQMA 3BL3A 3QRHA 4EXBA 3N4AA 2YSWA 1ZJHA 1B3ZA 3NUKA 2PCEA 1EDTA 3VIIA 3LLXA 2NQJA 4GZIA 4EXAA 4R33A 4HU3A 4KCVA 5ABTA 2GYIA 3W7IA 2VZTA 2E6DA 2R1NA 4XVEA 2FH8A 4ACYA 3SUVA 3H7RA 1R3VA 3F4DA 1P0NA 1M41A 3PBWA 2J7BA 4M1RA 3VA8A 2FB2A 4XISA 4E2BA 2ANUA 1XLKA 3KL3A 3REQB 2C1HA 4GVHA 5C0QA 1BTCA 2QCDA 3WUEA 2YIHA 4PFHA 2XVPA 3B03A 2ICSA 1E70M 1WUFA 4W5ZA 4MKNA 3S5ZA 2J25A 3Q58A 3A47A 4B5WA 5CC7A 3TQ0A 4B92A 1BYCA 4P2VA 1UMLA 4JIHA 4GQQA 5D8WA 3VI2A 1YXCA 5LZLA 4H7VA 4O10A 3S8HA 3JVAA 2ZRVA 1GOMA 1SVDA 4B90A 4JQ2A 4HA3A 1UD8A 3LS9A 1EYWA 3TNBA 2ZIDA 3TV8A 1XLGA 3VFCA 3WY1A 2CLOA 1VYRA 4IMEA 3C2YA 2UBPC 3NR0A 4KMQA 4M6VA 4IZGA 4UBPC 3ARPA 1AW1A 3SCVA 3SUWA 3FA4A 2Z4GA 2VVNA 3HZ3A 4XTDA 4UQCA 1A5CA 1I0DA 1MRQA 4TX9A 4EPKA 3TXVA 5D2YA 2QEZA 1WZAA 3PZQA 3F2DA 3QYSA 4M29A 2WQPA 3TWBA 4IIEA 1XLDA 3BANA 2W4XA 3WLPA 4GPNA 4WKHA 2HSAA 5GNYA 2A4AA 3SCTA 1B57A 3LYEA 2YW4A 4Q4KA 1YTEA 2BGQA 5FA5A 3SCRA 2CLIA 3WNKA 4MADA 3A24A 3DX5A 2V9DA 3FOKA 3D46A 1JCTA 3UXKA 1UA3A 1O60A 2C19A 4RR4A 1SFTA 2YOCA 3FX4A 3TQPA 5AOUA 3SQLA 2VEGA 1F07A 4I7WA 1FWAC 4KERA 3AS2A 3I6EA 3VOFA 2VC9A 1UPMB 1IXOA 2FPTA