1Z69A

Crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
327
Chain Sequence
MKFGIEFVPSDPALKIAYYAKLSEQQGFDHVWITDHYNNRDVYSTLTVLALNTNSIKIGPGVTNSYTRNPAITASSIASIAEISGGRAVLGLGPGDKATFDAMGIAWKKPLATTKEAIQAIRDFISGKKVSMDGEMIKFAGAKLAFKAGNIPIYMGAQGPKMLELAGEIADGVLINASHPKDFEVAVEQIKKGAEKAGRDPSEVDVTAYACFSIDKDPVKAVNAAKVVVAFIVAGSPDLVLERHGIPVEAKSQIGAAIAKGDFGALMGGLVTPQMIEAFSICGTPDDCMKRIKDLEAIGVTQIVAGSPIGPAKEKAIKLIGKEIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethan
publication title Crystal structure of methylenetetrahydromethanopterin reductase (Mer) in complex with coenzyme F420: Architecture of the F420/FMN binding site of enzymes within the nonprolyl cis-peptide containing bacterial luciferase family
pubmed doi rcsb
total genus 119
structure length 327
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1z69A00
1YW1A 3SDOA 1FVPA 1RHCA 2B81A 1Z69A 1BRLA 3B9OA 3FGCA 5DQPA 3RAOA 4US5D 1M41A 1TVLA 1NQKA 1LUCA 1BRLB 4UWMA 1XKJA 5LXEA 1NFPA 1F07A 3B9NA 1EZWA 3FGCB 4J2PA 3C8NA 3B4YA 4US5A 2I7GA 1LUCB 1BSLA 5AECA
chains in the Genus database with same CATH superfamily
1YNPA 4JX4A 1ME8A 1KFKA 3WQPA 3N9SA 3QSRA 4RW3A 3O7UA 1DQXA 3CU2A 1UHVA 3TLLA 5CEWA 1EJXC 2OT1A 4Q4QA 1A4MA 4XAPA 4MWAA 1E4IA 3TWAA 2QCLA 3BSHA 2UV8G 5E93A 3NZRA 2GPTA 2JE8A 4YHGA 1OFOA 4N9BA 3DBPA 2HBXA 2Q09A 4PEEA 2GGGA 3QH2A 4C7DA 2VI0A 2VL4A 3KUMA 3EAUA 1HX0A 2XM1A 3L2MA 5EMLA 3ARRA 4GJIA 3VCRA 4QISA 3PZQA 4WSKA 3UP8A 4WKFA 1XXXA 3E2QA 4IPNB 1RBOB 4N2YA 2Z26A 3AXHA 4MF4A 3C2YA 3NGFA 4IQEA 2D0HA 3A5FA 4FK9A 2EF9A 1XIEA 1CDGA 4J3VA 1JGMA 3WD2A 1E15A 3MWCA 4UNIA 3SY1A 4L5ZA 2OPJA 3LD5A 1U5HA 4MY8A 1K3UA 1TA3B 2BTMA 3UW6A 4PULA 3QTPA 4RV3A 2OSXA 1A80A 4AZHA 3STGA 1ISXA 1JXKA 1QNOA 3G1FA 1EH9A 2CWNA 2X8RA 4D9PA 3ABSA 3SDOA 3LM3A 1DTUA 1E1CA 1IT7A 3WJZA 4FX7A 2NT0A 3NDYA 2IS7A 4RPPA 4H83A 1G4EA 2G3IA 1GOKA 2H3DA 1GKRA 3GSMA 2VRKA 2QULA 2CZFA 1GVSA 5FOOA 3H2EA 1UR8A 3OG3A 2EQDA 2VT0A 2Y85A 4F2UA 1SMAA 2I9EA 2V5BA 3QZAA 1PZ2A 3ANYA 1B54A 2DVXA 4ZQRA 1MDRA 3BURA 4AH7A 2GJLA 3B8TA 6ENLA 3N11A 4YU1A 4UOJA 4C1NB 1GOOA 3OQ8A 1EDGA 4RKAA 1K9EA 4ILSA 3CPGA 3MMUA 3W85A 3I7SA 2FGBA 1FWSA 3OHMB 1UH4A 4AEFA 5CZJA 3FYOA 3FJLA 1GZGA 4PMRA 1VAHA 1V08A 1VJIA 3H22A 1VPYA 1PDYA 3TW6A 4H8VA 1W8SA 5KSWA 3RLHA 5G5IA 1OGBA 2EO7A 4NZFA 1WA3A 2ZVIA 2I14A 3NO5A 1BF6A 3L2IA 1JFXA 2YL5A 4EANA 2YSWA 4XX6A 3WH7A 1A5KC 4F0HA 4OBRA 1Q6DA 1K9FA 2GJXA 3UWVA 5EMYA 1JQXA 2EKCA 2P50A 1HTIA 3D3AA 1BVWA 2R24A 2G37A 4OWGA 4LS1A 2PDHA 3W00A 4FLSA 3E3HA 2QEZA 1J9YA 4IIBA 1V51A 2QDEA 2XVGA 4HOXA 3G1DA 1AVAA 4Z1BA 4L6HA 1TREA 3RCMA 4XKYA 1W9XA 4FMVA 4MNLA 3PZGA 2HXTA 3FSUA 2QW5A 3RJYA 3H26A 3AMKA 3QVQA 4H6QA 2ZC1A 4NRRA 1JFHA 2A3CA 3FJNA 1B0IA 4JFWA 4EPKA 4HMNA 3G77A 4GK8A 1Y8BA 5FEXA 1W5NA 3IJIA 3NVTA 4RZBA 1RALA 1XLJA 2BXVA 2ZZ3A 2OG9A 3RLUA 1G67A 1JDEA 4S2CA 4A4AA 1O7AA 4Q32A 3NVDA 2AMGA 2OQLA 3QLDA 4J40A 1VLWA 1NIUA 2C6QA 3WNLA 3H2OA 4PR4A 1H5VA 3WH8A 1KGUA 1NOUA 3UA4A 3NXFA 3MCNA 2QJIA 3S9ZA 3EWCA 3LRMA 1SO3A 4DF0A 2XTKA 3EKLA 3B9NA 3WMSA 3S2CA 2DZXA 3PZNA 4M82A 2A3LA 4Z1CA 3AJXA 1OCJA 3GBDA 1MXDA 1KBBA 2D2HA 4W8LA 4PUMA 4AWUA 4CVUA 3MVTA 2VURA 4PMOA 2Q8ZA 3V75A 1TWSA 2ICSA 2EXOA 2ZXAA 1QW9A 2BG5A 1KXTA 4NF7A 1B4EA 1V8EA 3FXGA 4H9TA 2ZA2A 3N2BA 3E12A 1LUCB 2V2DA 3RNDA 3LENA 1GQLA 2G97A 2PDFA 4LS0A 3S8HA 3VI2A 2R1LA 2C1GA 4YWSA 2HS6A 1RQEA 3F5JA 3I3BA 1HKIA 1UA7A 4YNGA 3TNOA 3DZ1A 4ERAA 1ZP3A 4WIWA 4U28A 1G5AA 4EPEC 2GQAA 3O1NA 3TZFA 3W87A 1XLAA 4G9PA 1XYBA 1OT1A 4MKSA 2GWGA 1JGIA 5TBOA 3UZXA 2FZDA 1EJTC 1D3HA 1U2YA 2XYLA 3RX4A 1DJGA 4AHOA 5HMFA 2E09A 4CU8A 3W7JA 3RO8A 4Q7NA 2Y2WA 1A50A 1IYXA 3IJ8A 3KRUA 4KEVA 4XZ9A 3W1RA 1WDDA 1KTCA 5A6BD 3LLXA 1Q8AA 2PDCA 3HG2A 3ZZ1A 1YDNA 2I1OA 3QXBA 1P43A 4NP7A 3MT1A 4HP5A 1F6PA 5A2AA 4A22A 3QRHA 4MY9A 4NXKA 2FPTA 3WLJA 4HU3A 1XPYA 3PF3A 1Q6CA 3CZKA 5FJRA 3H2CA 4E8DA 4QJ5B 2CLOA 3G1VA 1R8LA 4I5RA 1CIUA 4KW2A 2OYKA 1TCDA 2OX4A 3LK6A 3VIJA 1N7KA 1YXCA 1OGGA 3H2FA 3TJLA 4B9YA 4YTSA 4QS6A 1BQCA 1LRNA 3S6TA 1GT8A 7ODCA 2F6XA 3BWWA 3FXYA 4AG0A 2G50A 2OKOA 3M64A 3OBKA 4JTAA 3NL6A 1R9ZA 3T07A 4IHCA 4NL1A 1J93A 4N6FA 4L9YA 4ECLA 2W5FA 5GNXA 3W82A 5L9FA 1M01A 2HNEA 4K68A 4ES4A 4R85A 4F0SA 2QUVA 3QFEA 4W7UA 4ML4A 4H9YA 4ZR8A 4AZBA 2FGLA 1KLZA 4ACZA 3LOTA 3NO3A 2D1ZA 4UNKA 5FL0A 3O3RA 3E96A 1ENUA 2WC7A 2WLZA 3B9OA 1XCXA 3W28A 2O9OA 1XCWA 3V1PA 3GO2A 4K38A 3AS2A 2MANA 3A9IA 2OKTA 4P8UA 1W1YA 4LOCA 2ZXBA 3KBVA 1OG6A 4TX8A 1FWNA 1KV5A 2G3MA 5E6ZA 2DT2A 4ZSTA 5I3GA 2OO0A 3DFPA 4BFAA 4MB4A 3NQMA 1RLCL 4K37A 2KX9A 3VGDA 3VAVA 2E5CA 1BHGA 1JXJA 1YE4A 1CGTA 1H61A 1QK2A 1DJZA 2VDGA 4AAJA 2OCZA 3VNMA 3B0PA 2Z2AA 4OBTA 1GUVA 3IACA 1HVXA 1W9DM 2WZEA 3AMCA 1TWWA 2QS8A 1KFJA 4R34A 1TQXA 3VIHA 1J79A 1YBQA 4WK9A 4KEUA 3G3MA 4IUGA 3O06A 3SY8A 1KB3A 3IWPA 1H7XA 1QI3A 4FNQA 4I7UA 4X22A 2PPGA 4Y9OA 4UXDA 1DQWA 4HZ6A 1XIDA 2BXZA 4L1GA 2E8ZA 2FIQA 4HOZA 1JZ2A 1ME9A 1XYMA 3PVFA 4FZIA 3I3EA 5HMDA 1N8WA 1JCMP 5FA5A 2QIIA 2XM2A 4LNYA 4L65A 4DPPA 3FKKA 2X09A 3B8WA 3AZTA 3SUWA 1CECA 1T0OA 2J25A 3DENA 3ID7A 3I4EA 1Z7AA 1PWLA 3QY8A 3KRZA 1GK8A 1RCQA 1MVYA 2HBVA 1BWLA 1W9PA 6TAAA 2VVNA 2YB4A 1W3LA 2BZNA 1LLZA 4UR8A 4LVDA 1XLCA 3NZGA 5A6SA 1W17A 3KP1A 1OCBA 1JZ7A 3W2KA 3LGEA 3M0ZA 4R7OA 4AWSA 1XRTA 1W9VA 1TJ1A 1TQJA 4ZXLA 4A3QA 2J8GA 4KFPA 2IPJA 4XIMA 2CKSA 3QHMA 1F3XA 3USZA 4AIUA 4L64A 4OUEA 1PKMA 1ZSXA 3WQVA 1FCVA 5DCEA 2PDMA 4R33A 1BEUA 4QAWA 4BJHA 3G18A 3G1SA 5I3IA 2CLEA 2FB2A 4DIAA 1RK6A 3ZVHA 4E4UA 2YX0A 2ABAA 1QFEA 4ZE5A 3RK8A 3W71A 1N55A 2X1IA 1F3TA 2WANA 1GKPA 3EX6A 3UYIA 4PN2A 3QY6A 1O5RA 1OFEA 1VH7A 1QXLA 3QC0A 1SM9A 3EOOA 4XUGA 2A6LA 4AF0B 4DNMA 2O56A 2G8ZA 2WJZA 2YL9A 1W0MA 2PRMA 3GTFA 2X7WA 2ZA1A 1XRVA 3RGTA 3RU6A 3SURA 3HV9A 4FX8A 1Z89A 3L4VA 3LCFA 3TSMA 2C71A 5AC5A 1XRSA 2W9MA 3NPUA 3LHTA 3IJ9A 1AW5A 1CGUA 1WXJA 4OOUA 1POKA 5DT7A 4HSNA 5AZ0A 1W5QA 5AC6A 4NQ1A 1QRQA 3VD4A 5C9UA 2DEPA 1SSGA 3P8JA 4E3VA 3LNPA 3BLPX 4JXCA 3UCDA 3LHWA 1QPOA 1UUOA 3V0TA 4V2XA 4UTMA 1AL7A 1OC6A 2CETA 1WYIA 3WUEA 2CLHA 1A47A 3U4AA 1UZHA 2ZWZA 2QJHA 3AHTA 2FMOA 3BO9A 4ADTA 3T81A 2VD9A 4QDWA 1NJJA 3N3MA 1B3ZA 2VC5A 3C2OA 3GTHA 3L0KA 3BCDA 4LU0A 4G1KA 4NAEB 4PUUA 4Z1AA 2F9RA 1X8FA 2E4TA 3VNJA 2JFEX 4WGHA 3NSNA 4Z2LA 4QQUA 1IEXA 4H7CA 2A5HA 4Q3MA 3T42A 5DMLA 1RLDA 3R4IA 2FPYA 3JW7A 1R47A 3N4EA 4KIRA 3LQGA 1RD6A 4TV6A 3RXZA 2YCEA 1Q85A 2WHJA 4IT1A 1A5MC 3ZLGA 1K03A 3UR5A 2EEXA 3ANVA 4LW7A 1JL8A 1AQ0A 3WLPA 3HBLA 2JIEA 4IIGA 3G8RA 3S1WA 3MWAA 4UZUA 4L4OA 1CCWB 4CN1A 5CXPA 1XQKA 2GK1B 2YIHA 3A9BA 4H7ZA 4RLIA 2DJXA 3N2TA 2X7VA 3LCXA 4O0QA 1GZ1A 1EIXA 2G95A 3HGSA 2Y61A 3VE7A 3FVMA 4AZCB 2OZ3A 4UTTC 3GXIA 2OR2A 1JNDA 4HB7A 4DBSA 3OGRA 3EB4A 3SR7A 4DZIA 3RRAA 5A8PA 5LA0A 4HPHA 3L9CA 4DJEA 1RQBA 3EX1A 4J9JA 4GNVA 3XISA 5HATA 2QAFA 3C61A 3TCEA 1K9DA 3TFCA 2UY2A 3S47A 2ISFA 2O4QA 5D8ZA 4NNCA 1EX5A 2YKKA 4GLEA 4M6QA 3P61A 4S39A 1UD3A 1EX1A 2YGYA 3EDDA 3CQKA 3MANA 3O2LA 4IXHA 1UCWA 3ABXA 3OODA 1UKQA 1EXBA 2HMCA 4B5UA 3XIMA 4WR3A 4YTQA 4V15A 1V02A 2WOQA 2VJXA 5TD4A 5A1AA 1DJHA 3ARSA 1DJYA 4F2BA 1F7BA 4MLJA 3N73A 4RXFA 4XZIA 1K8ZA 3M41A 1JI1A 3U6WA 4I3GA 4IX2A 3PSWA 1LROA 3N1AA 5BROA 3TONA 4GZIA 2V8ZA 1US2A 1XYZA 4O8AA 2O7SA 4R27A 3L4TA 2OZTA 4HU8A 3QR3A 1TSIA 1X8CA 4JIHA 1F8IA 4MPKA 3CV2A 3OIXA 2W62A 2EAWA 2QCCA 4ICNA 3EWXA 4EF9A 4GQQA 4HYWA 3LM7A 1M3UA 3AYRA 3K8KA 5KZ6A 2A3EA 2VDIA 4JFUA 3VMPA 3WELA 4N42A 1V4YA 1LL4A 3W1QA 2WMIB 4HKPA 3WF3A 5FJIA 1R3SA 4C91A 2WSYA 3B8IA 5AZ1A 4E2OA 1QHOA 3GYCA 4B90A 4E0CA 1EYEA 3CV6A 2ZZ4A 5FACA 4MJ2A 5LA2A 3BZJA 5IOBA 2GUYA 4U31A 1T7LA 1E6ZA 1GZJA 4B16A 1Q3NA 3KL3A 4J28A 1E6XM 2FZNA 3BOLA 2PLCA 3BLDA 4HMDA 3SCVA 1PKLA 3CMJA 3LCWA 1UJQA 2PBOA 3ENLA 3MMDA 1HN1A 4I6KA 3LERA 1QCWA 4PTNA 5MKGB 2CHRA 3LPGA 3TLQA 1CEOA 2JK2A 2QCHA 1THFD 1XKJA 3SIMA 5HQEA 1DWIM 4GI9A 1GTEA 1ZALA 1IEIA 3KLKA 3ARXA 3AC0A 2ZUNA 1GHRA 4F2TA 5BRPA 3FJ4A 5JH1A 3CUGA 1N2VA 4J3TA 1Z8AA 1J0JA 1KTBA 5G2HA 3PBVA 5LIKX 3THQA 1D3GA 4B9ZA 4D6IA 2V63A 2G5WA 2C13A 4N4PA 3NIYA 3U2EA 4K1WA 1CW2A 1ICQA 1VCVA 3GWQA 2HE5A 3CC1A 3CBWA 2PWVA 4AD4A 4S38A 2NUWA 2J13A 4JPGA 1F4AA 1LQ0A 2WWDA 1HQTA 1EF2A 4ZODA 4IMAA 1GQNA 1DVJA 5KZEA 1ISWA 2HDJA 4JY8A 1VGAA 5AB3A 3EXSA 3EEZA 2B7OA 3KE0A 3HGJA 3FYYA 3GTNA 4L61A 4UTIA 2BGQA 1V3IA 1KM2A 2HTMA 4HPNA 5CPTA 1ITUA 1W5MA 3V0UA 3PANA 4LAOA 4WKHA 4CCZA 3B04A 3MCMA 5F2LA 1Q2SA 3LPPA 2G4FA 2PUZA 5EFDA 4ZO6A 3DEQA 4Y2WA 3EA2A 4HYVA 4LCSA 3N2XA 2VFFA 2POZA 5G2IA 3OZPA 2PBGA 5D04C 2NT1A 5T9CE 1ADSA 4ZO8A 1HO4A 4C6KA 4TVDA 3BG5A 4JTRA 4CEXC 3NQ2A 2E28A 3RX2A 3W02A 3OLGA 1W3NA 1IHIA 1FDJA 3T0DA 1AZ1A 2BP1A 4GXWA 3AJ7A 1RPXA 3Q65A 4JKMA 4XAYA 4B5NA 1H09A 3L5MA 4O10A 3U2ZA 4JFVA 3GC5A 5A69A 1CX9A 2ISDA 2Q6ZA 4ASTA 1QW7A 4L80A 2XFYA 4WDTA 4KGJA 5I5RA 3WFLA 1GKQA 3CUXA 3WK1A 1J01A 1RY8A 3D46A 5EMMA 4GY0A 4AD0A 3UXIA 1O4UA 3GIQA 3IJ6A 1SW3A 5M3WA 3UWZA 3EWWA 3RM9A 1OX4B 1I60A 2YZ5A 2I5IA 5ECUA 5AHMA 2DZPA 3D6NA 3C56A 4JN7A 3C0LA 2PDBA 3GTXA 2CPUA 5I3KA 3CAVA 4OVXA 2TODA 3VDBA 4BEUA 1FCUA 1QPKA 1H41A 3AHXA 1LUCA 2IW0A 3IIOA 8RUCA 4AISA 3AS1A 4S3CA 1ITCA 3EPMA 4P8WA 5A94A 1PIGA 5DANA 5LHEA 1HZYA 1QO2A 3CV1A 3WQCA 1FWDC 4G6CA 4REQA 3W2MA 2X0HA 3TJ4A 2OB3A 4LWWA 4S3DA 2BHUA 4IQLA 3CAKA 2RGLA 3E2VA 4AYGA 4ZFCA 1B57A 4KF1A 1UBPC 4V27A 2J7DA 4AD5A 3IVTA 4N0RA 2V0TA 3CYVA 4LALA 3KL0A 2H3BA 2DSUA 3H8AA 3MSRA 2PF8A 4F0RA 1DOSA 1I0BA 1IIGA 3RCYA 5I03A 3ES7A 2VTFA 4UTKA 1XH2A 1P6WA 5CC5A 3M6YA 3R2GA 4WRHA 3VX0A 2XFFA 2AKMA 1PX3A 3M7SA 4JTLA 5DBTA 2QMKA 1IT8A 4N9EA 5LIYX 5AHFA 2ZWYA 3W7RA 4YIWA 4IL0A 4YCOA 2HROA 3FEMA 2HXUA 3MPGA 3BGJA 3UF9A 2PLJA 4BZYA 2WC4A 2I5QA 2VGBA 3GBEA 4QNWA 1IZCA 4RK8A 2WHLA 1SYTA 3UNTA 4WXZA 1K7XA 2QGYA 4HHHA 4W8BA 4UR9A 1BYBA 4IGHA 1Q4WA 3VDCA 3MJMA 4G8TA 3A4WA 3T4WA 1HKKA 3W7NA 4CD5A 2BVWA 3C2VA 4MZ8A 4OE7A 4FNUA 3ITOA 4A8IA 4JHZA 3LY0A 3KP0A 5D9NA 2RDXA 3BMVA 5AYXA 3APYA 3MB9A 4XVDA 2BOGX 4DZHA 1FWRA 4Y9MA 1DP0A 3S6OA 2E9BA 4H6RA 1GVYA 4LC6A 2WB5A 4B4FA 4NYUA 3NPWA 2Q3OA 2Z1SA 3L4WA 2XVNA 2ZOXA 3MMTA 3KOXA 2Y7FA 3A22A 3K4AA 2WXDM 2BVYA 3TKFA 1KRAC 1A3WA 1Q13A 3GNXA 1GG1A 4OQVA 1XDLA 4JTQA 2C1IA 4CNOA 4FIRA 5A8OA 3NQFA 3TH6A 3UY8A 4CD7A 4UMAA 3WIJA 4FA3A 3LTSA 4MSSA 4PMYA 4ZGYA 3SCQA 2E1WA 3QV7A 1AQMA 4P2VA 1T40A 3VM7A 3R8HA 3KAOA 2J7GA 4AMAA 3VE9A 3TQPA 4NVTA 3GG1A 3EDJA 1QNRA 1SW0A 2FZMA 5HJYA 2DW6A 3DI1A 2WCGA 4LB3A 1X1ZA 1YEYA 1HL2A 4RZ4A 1XSJA 1R9YA 4BF9A 3TXZA 1TMLA 4H3DA 5G1TA 3NDOA 1R9XA 1C29A 2WMJA 2C79A 3PPGA 1OY0A 1OC7A 2DIEA 4CU6A 1UIOA 4TTUA 1YNYA 4RX0A 4DJDA 1KFEA 4KRZA 2Y88A 2IKJA 2PWDA 4QHRA 3WEMA 4XSMA 5CBBA 1JI2A 2ESCA 3FDGA 3CO4A 5EYWA 1F73A 3FS2A 1QR7A 1YNQA 4HBKA 2R82A 4FS9A 3CZLA 4GY7A 2CU0A 4FLQA 1HJVA 2DH2A 3TQVA 2V3DA 1V3JA 4JTJA 2HK1A 6TIMA 2CBJA 3BE7A 4E4FA 4DI9A 5CKSA 2DUAA 3LRKA 4O14A 4LSBA 4S3BA 4FXFA 4UFIA 2AQVA 4O1BA 3QZ6A 4POCA 2HJPA 2YCLB 2NQ9A 1AUSL 3EYPA 3PR2A 3H21A 4P61A 4UTWC 1S2UA 4BI7A 1CGWA 3GW0A 4P7OA 3O6DA 3WJWA 1AD4A 4M1BA 5C9RA 4O12A 4OV4A 1V79A 3P7YA 2PFHA 2WZHA 3P3BA 1B3OA 1SJDA 5FF2A 5CCZA 4HPJA 4KCTA 1GPFA 5LNWA 3B8VA 1PL9A 2DZBA 4OBSA 4WXYA 2NXGA 3UJSA 1E1FA 3W2LA 5I09A 4L4MA 3TWBA 2G3JA 2OU4A 2ISSA 2CKRA 4HNVA 2WJEA 3TW7A 3USBA 2W6RA 3NCOA 1XLBA 3C2EA 1H11A 1AQFA 2CLIA 3TC6A 1F3WA 5K7JA 1A3XA 3UGRA 3ITXA 2W91A 4QR6A 2YDQA 2QXWA 1VYSX 1S38A 2Y1HA 2GFTA 4HN4A 4D71A 3CH9A 1P7TB 1A0CA 1EFZA 1TRIA 2VQTA 3KTXA 1TTIA 4O1AA 2QPXA 2QDGA 5AOUA 5CH9A 2XZ7A 3T44A 1SFJA 4CNNA 1ZJBA 3VZXA 1IWPA 3DG7A 2NWSA 3OP2A 1FXQA 4JAWA 3RM4A 4QE4A 5J04A 2Y63A 1XIBA 1QOPA 4XAFA 4AX6A 1RJRA 3H7RA 4LYQA 2VM8A 3CUZA 4YXGA 1GONA 1ESWA 3VZZA 4EVZA 4JTHA 3IK4A 2OJPA 3HG5A 3WQEA 4GQ0A 2A2IA 3NTYA 3F4NA 1TE6A 1H0IA 1ZGDA 3EOSA 1TPFA 2BY1A 4EKJA 2EBNA 4YTRA 3O6YX 1PJ9A 3CTTA 4J2PA 4A3YA 3QHOA 3KTCA 3I10A 3M0IA 4XK2A 3UG8A 3O15A 2CXGA 3EB3A 2FZ8A 1BKHA 3C2RA 1WDRA 2XGIA 4PTXA 2WO5A 4JKLA 3W73A 1U22A 3BAKA 3AXIA 3G5EA 3N29A 2ZZ1A 4I7WA 2E5DA 3R10A 4Z2IA 5L6UA 1WNOA 1QWKA 4DO7A 4X9SA 4K6AA 3GAYA 3C3UA 5BRBA 2F2HA 4IP4A 3ITCA 3STFA 3C3NA 2PEVA 3NQCA 1FA2A 5DELA 2VKZG 1KFCA 4WJEA 5ECVA 3W2NA 2OWXA 3INPA 3VUSA 3TC7A 1ODZA 2QCEA 2F61A 1EA9C 5CG7A 2GQ9A 3VUPA 4PCPA 4CN6A 2J7BA 3RPDA 3UY7A 4DBWA 3VOJA 1R2TA 3SCRA 3U3HA 4C6JA 4AUBA 1MUMA 3OLEA 2V9DA 3M4HA 2X1TA 2O55A 1GEHA 1ALDA 3WBXA 4Q7BA 4W5ZA 2W4XA 2CZVA 5CPLA 3L67A 1Z42A 1LOSA 3T7VA 4Q7IA 1S5VA 4IMCA 3R1ZA 3QSTA 4CD8A 1GEQA 3KOWA 3UEQA 4OGZA 3D47A 3MHFA 1PYMA 3SADA 1JZ6A 6PTDA 2WZTA 3BAWA 5LIWX 3E02A 4M80A 4DVOA 2V5JA 3QR1A 1VR6A 3LI0A 4I9JA 2A1YA 2RKXA 1L6WA 1H60A 2GK1A 4ZMGA 4ZVJA 1TVNA 2NW0A 2VELA 2GVLA 3BCJA 4ZOAA 3TNBA 3TFXA 2JKEA 1MMFA 3IIVA 1LBFA 4AZCA 3PP7A 4DXKA 5FSEC 5K4ZA 3BSGA 1LWIA 3CS2A 3CQIA 3AUOA 3GVRA 2EG7A 3LN3A 2WK2A 3F4VA 4C6NA 1ZY9A 1Y65A 3GZAA 3IV8A 1RXOB 1LCOA 2D2OA 1VBHA 4Z08A 3EKGA 3N04A 4DWSB 3WF0A 3LGDA 1TV8A 4H8NA 1XLIA 1G7VA 8A3HA 4N02A 3S2NA 4IISA 1X1OA 3SUUA 3ZR6A 5KITA 4TO8A 5BW6A 5D38A 4E3TA 2PDPA 2GJRA 4IICA 3GAKA 4FLRA 1BRLA 4KESA 1M1BA 1XKYA 2E77A 4HVXA 4DJFD 5DY3A 4MB3A 4EXBA 3VKDA 4M8UA 1IGWA 4AIBA 3NQ8A 1NWRA 4IUOA 4KBXA 4DM2A 4GD0A 5KEZA 2C3ZA 2GVEA 1W54A 3N9KA 1T99A 3WUBA 3SO7A 4HK6A 3PTQA 2QCDB 3RRXA 1E5JA 2W92A 3QPYA 3WLLA 2VFGA 2A79A 3ES8A 1EQPA 3M9YA 2WCAA 4H04A 3H23A 3MQTA 1UZDA 1KFLA 1G7UA 1AL8A 2HS8A 2QUUA 5I3DA 3GIYA 2V30A 1V77A 3H70A 5DY2A 1F3EA 3SRHA 3U2CA 3RUBL 1V6XA 2Y5JA 4HMEA 1P48A 3JR2A 4JGDA 2P0IA 2QCGA 3W27A 2PDXA 2NWRA 5HK4A 2VX7A 3W1XA 1DWHM 2ISWA 2DJLA 2ZICA 3ITLA 4DZAA 1TMQA 4RNIA 3VTRA 3GFZA 1VRXA 5I77A 3JUGA 5BWAA 3CZJA 3WMBA 5CZ0A 4W85A 3AHVA 3B0YA 1J2WA 2Y7EA 3R12A 3BG3A 3O16A 2PP3A 1FWAC 3IARA 1HJXA 4O16A 4K8GA 3JRKA 3GUGA 4D1IA 4XAGA 1XHGA 4JTDA 4CCCA 2GDUA 4XZHA 2GDQA 2DV0A 2PD5A 3NG3A 1UR3M 1HF6A 3MUAA 3WMCA 4RUBA 9CGTA 1REQA 4AHQA 1GOWA 3B4YA 1DORA 4O1EA 3COTA 1ZQ5A 1VFUA 3LNMA 3GXNA 1XYCA 2D20A 4GVFA 4MJMA 3V4BA 1O1ZA 2ZZ2A 1CENA 4L4PA 3ABOA 3GH4A 3UPMA 1UR0A 1N8IA 3PN8A 1VB9A 3HV8A 2A0NA 4CQ8A 4LBSA 3R8RA 3GY1A 1DIOA 2W67A 3RMJA 1XSIA 3BARA 1CZ1A 3VZYA 3DYMA 2UY5A 1P0NA 2BBFA 1W9UA 2VEGA 3H4XA 4LY8A 4Z0SA 3URBA 2DFAA 3A4XA 4N9CA 3NL2A 1MRQA 3W9ZA 4TTGA 3PFRA 2X41A 3IIPA 1OIFA 2GJXB 3D0CA 3MSGA 2ACQA 5AYZA 5H8MA 3UXAA 1T6MA 2FHCA 1E0VA 1SGJA 4DUWA 1E73M 1TUFA 4C6IA 4JHMA 2QAPA 1JAKA 3REQB 1WOAA 2QJGA 2J88A 3E0VA 5FF3A 4C6MA 4XKYB 1EO5A 4GIEA 2C8NA 3FCPA 4Z42C 1Q6GA 1P0BA 4GABA 1CXIA 2OQHA 3UA3A 1D7KA 1UMYA 1Z9AA 2DT0A 3N13A 3WNOA 4N4QA 1VHNA 4M56A 4O53A 2OFJA 4ZEPA 2WWCA 3KZSA 4JOMA 2BODX 1AJZA 3QOMA 1I8JA 4XB3A 5BXPA 3DI0A 2RDTA 4LUTA 4LC8A 5PTDA 3GR8A 5E0CA 1NOWA 4R3UA 3IRDA 3M7WA 3WENA 4ZB5A 3SN4A 3SN0A 1MW3A 3EWUA 2TSYA 1R46A 1WAUA 4W93A 4GXMA 4PGLA 5ABEA 3HFYA 4GQBA 3ZWSA 2CZEA 3W53A 3P0XA 3WY1A 3BLKA 1B30A 1NWUA 2VZSA 3STEA 2BSLA 3T8LA 3WO8A 3GU9A 4QE1A 5FKYA 1OX4A 5CZKA 4MKVA 4GYPC 2Z4GA 3CZGA 3UETA 1TKKA 4D6DA 1RPKA 4GJJA 3HFTA 2ACRA 3DXIA 3PAJA 4CVWA 1VFTA 1RK5A 3MKCA 2E6AA 2CCRA 4DF1A 4C65A 1VCGA 4X0NA 4O4WA 4JTEA 1XFBA 3P67A 1Q7QA 4LAMA 3CK5A 2FTPA 3AHZA 1KCLA 4AZGA 1WZAA 3W2UA 1OYCA 4MWAD 2VQUA 4MTVA 4H9MA 2QPUA 3KDNA 1WZLA 4F79A 3UJEA 1GVRA 4PMDA 2VCBA 4MADA 2H9AA 4J2MA 4D6JA 3UXLA 1QTWA 4CNPA 4PL2A 1BSIA 3QOKA 3EXTA 1CXEA 3CB3A 1XGEA 3XINA 4AXNA 3P62A 3MMWA 1BD0A 1VFOA 5D30A 1GOMA 4WGXA 4MJ4A 1WKEA 2E1DA 3UZWA 1ZFJA 3QYQA 1NF0A 2CBUA 3UPWA 2XU2A 2Q8XA 4UFJA 4ZA0A 2J47A 1QU4A 1EJVC 3UFYA 3FA5A 2BGSA 3ELFA 1W3KA 1VKFA 5C9WA 1W9BM 1H51A 3GXTA 3OA3A 3ALFA 1B2YA 3HOJA 2OEJA 2HVMA 2GLKA 4K39A 1W1IE 3GRIA 4P7RA 2CZDA 5H6HA 2PC8A 2Y62A 1Q2RA 2J7CA 1KCZA 5G2WA 2WMKA 1LLWA 4HPXA 4JCLA 5TQLA 4Q8NA 5E5CA 2J9XA 3MI2A 2YB1A 4XZLX 2Z6JA 1ONRA 4K3ZA 1OFRA 1WDPA 2BX7A 4B3ZA 1YKWA 3VFLA 1R7AA 1ADDA 4X2PA 3VM5A 1ZAIA 4ZFMA 4MNKA 1EUNA 5D32A 1UH2A 1TX0A 2IPWA 4GO9A 4E8GA 3T2QA 3U0HA 1MUWA 1OG0A 3C2FA 1JPIA 2P8CA 4HOWA 3V16A 2PTZA 5E09A 3QMTA 4DN1A 3W7GA 3WF4A 4QLKA 4HA3A 4H6KA 1TJPA 3M0MA 4J27A 2PD9A 1MW0A 3ABQA 2FGZA 3ITVA 1M04A 1HL9A 4BS0A 1BWKA 2OGYA 3P2VA 4IM4A 4DX3A 5K3VA 1F6KA 3TN4A 2WKGA 3PBMA 2F6UA 3KWXA 1UPPA 2GUUA 1XLDA 1KKOA 3W72A 1OBAA 5CPSA 3BLFA 1TTQA 1IV8A 1NDZA 2GVJA 4ACZB 4FNTA 3EMCA 1E0WA 8TIMA 4NY2A 2OX1A 1G6CA 3U48A 2XIBA 1NFPA 5C6MA 2OO6A 5G1YA 2PWUA 1NFBA 2FFIA 4DRSA 2PGWA 1X6LA 2HPMA 1W1VA 4LCQA 1E0TA 4EACA 1X7FA 3H2AA 2DZSA 9XIAA 4M0XA 2XUCA 1KBJA 5I06A 3ZSSA 3TUUA 3RR4A 1HP4A 5RUBA 3MBDA 1MXGA 3B06A 1KRBC 1AA1B 4I5XA 1TELA 2QUTA 1JNEA 2Z24A 2QGHA 4IFKA 3QM3A 4JR5A 4GFIA 4IQJA 4MIMA 3WNPA 3NNTA 2Z00A 3B9EA 4BQ5A 5E9AA 1DE5A 1YXDA 4IMDA 2E5BA 3PUDA 1XFCA 5HMEA 3CIXA 4Z1YA 1BYAA 1DYSA 2BV9A 4K7VA 1QI5A 5DO8A 3F5LA 3S46A 5BMXA 1C7SA 3WL1A 4RCXA 5BOEA 1VENA 4TVCA 2REQA 3CEPA 5C55A 3PBWA 3TXVA 5EL1A 3GD6A 3M5YA 3QN3A 4FLOA 3BAIA 3VO0A 4RDWA 2VC9A 2GYIA 4JD4A 1OX5A 4KIEA 4LUYA 3ARYA 3G0XA 5BRQA 2CESA 1OFDA 3I4KA 4NX0A 1E72M 5AHLA 1WCGA 5FF0A 3MI3A 5FJTA 1OHLA 1ZPTA 3VKKA 3Q67A 5LGXA 2ZA3A 4DEFA 4LX4A 1Q6LA 1H1YA 1DHKA 2ALRA 3MSYA 2OEKA 3WYZA 5G4EA 3KCOA 1KA9F 4JTTA 2Z1WA 4W7WA 3WLMA 5I3HA 3OQEA 1I2NA 5JIPA 1WXYA 3EB2A 1PCKA 5A6MA 3CIWA 1ZZMA 3QW4B 4HU4A 3QZEA 2XG9A 4O1DA 3AMDA 3BQ5A 3R25A 3UPBA 6XIAA 1QATA 4M1RA 3WLOA 1KXVA 1VBUA 1VBGA 1OJXA 3BLOA 2AKZA 3NEVA 3G24A 2E9LA 4E2VA 1B90A 4M7TA 3QF0A 1QJWA 1NWTA 2XGZA 1IXPA 1XL9A 1VIZA 2GJNA 5KINA 3S5OA 1FVPA 4WSHA 3W83A 1OK6A 1R3QA 3PBGA 3OU8A 1UD4A 1PKYA 4FF5A 2ZTJA 5AYIA 2WQPA 4RPQA 1TIWA 1XBYA 4Y9AA 1W91A 2R1NA 3WUGA 3S83A 1Q6EA 2ZC8A 4QGCA 4AVNA 4BK9A 1TVPA 4XO7A 2P3ZA 1VBRA 3IVUA 1MUCA 1S39A 2XDFA 1AZ2A 2WYSA 1YQ2A 2OODA 2POTA 3ZVHB 2CLLA 4CN4A 4LVBA 4KH2A 1A5NC 4P8XA 2YW3A 1DQUA 1CBGA 3RITA 3UZJA 3HMCA 2R94A 2VZOA 3E5PA 1SFTA 4GH3A 3RF9A 2Q71A 3PG9A 1JD7A 4MOZA 3SAZA 1AD1A 1JDDA 1ZP4A 2DZAA 3AFBA 3LCHA 1Q8JA 5LZLA 4CNTA 1DEDA 5K9XA 4GY1A 5A6AA 3S1XA 5T8GA 1JCJA 1PTGA 1C8XA 4LGXA 3RX3A 3T55A 3BGGA 2O92A 3GE7A 3GC2A 1I45A 2ZUSA 2D0FA 3NJ3A 2OEMA 4C90A 4GX8A 3WD0A 1GG0A 3PJXA 3OG2A 5I2UA 4ZOCA 4DBDA 3P93A 4LS2A 4G7EA 2WVVA 2C0AA 4UQEA 4CLMA 1L0PA 5LA1A 4MB5A 2TMDA 2V5DA 4JTSA 2V2CA 1W2VA 3CHEA 2XFWA 3N4FA 4ZB2A 1TV3A 1EGMA 4F48A 1OABA 3BSMA 3PZOA 4ZO7A 5A8GA 4NZCA 1I1WA 3PWIA 4MWAE 1YRRA 1U5JA 1FCQA 5DQPA 1JDCA 5IDZA 2NVCA 4KWWA 1R0MA 5J8LA 2WMFA 3E0IA 3NOEA 1FX6A 3NR0A 4OFCA 4S3FA 1OFBA 1K6WA 3GH5A 3P81A 5AYYA 3V18A 1J2BA 4NJKA 2AMXA 1W31A 1YTKA 1V03A 5HQLA 1O5KA 2PDYA 3KL5A 3SCTA 4D8LA 3ITYA 4PA8A 3ZMRA 3QLLA 5IBXA 1PHWA 1DKWA 1EHNA 2I57A 3GR4A 4JQ4A 2Y7GA 1FHLA 4MMWA 2QPSA 2FH6A 3UQNA 4QIUA 4QX4A 1C92A 1SZNA 2RDUA 4PTVA 3URNA 4EAYA 1E6SM 3VD3A 4DHGA 2WNNA 2V38A 3VVGA 1HIZA 4PUDA 5A6JA 1RSCA 1UKPA 4JFTA 1WKFA 1L8NA 4MLRA 4WJXA 3W7HA 1NP2A 2E40A 1BSLA 4C60A 1QVBA 1ZRQA 4JEJA 3G0UA 1KXQA 3MDUA 3ZQ9A 2PGEA 3S1UA 3RHGA 5CPOA 1C7TA 1M68A 4DYJA 1WBHA 2HWGA 1IF2A 3LTPA 3OPSA 3W07A 3RCNA 4DWSA 2BGNE 5D9OA 3A6OA 2NX9A 3MUCA 3H24A 4MUZA 3PZUA 4PRRA 3AI0A 3BZGA 3MV01 5A6TC 4JZ5A 2ZDRA 4BWLC 4HSHA 2C19A 4PL1A 4FX6M 4KT2A 2D3NA 5E6YA 3SCOA 1VLIA 3NL3A 3PK7A 4QRNA 4O15A 1S1RA 1TWZA 1O12A 1SZRA 4QSFA 3SGGA 4ZBCA 3WH9A 2PDUA 2VR2A 1UPMB 5HA7A 4DUVA 2FLIA 1C8YA 5CPMA 1QBAA 3OVRA 3MC5A 4UCFA 1GVIA 3CO8A 1SUXA 4G56A 3AMGA 4HJFA 1E3ZA 3H7VA 4S3KA 1A4LA 3KBMA 3CQJA 2QCDA 1E56A 4JBRA 1V6TA 3N4AA 1VCFA 2XSXA 2XIIA 3BAYA 3A4JA 3GW3A 5ABFA 1QW8A 1RBAA 7REQA 1BTMA 1OD8A 4XG1A 5EMUA 4U3CA 1GNXA 2GUBA 2IQ0A 4QJ3B 4QXIA 4R88A 3MHGA 4DXXA 2J79A 4KMQA 2OWCA 5AN7A 4NYYA 1WUFA 5A5WA 1V3LA 3N6QA 1XBZA 1BVZA 2J75A 1SJCA 1N82A 4GZ7A 2XFRA 1W5PA 3MSDA 4D6EA 4FIQA 1TWIA 3VFCA 3OGSA 1JUKA 3T0BA 1ML1A 2G3NA 3CUHA 4IPLA 4XZNX 4IPJA 4JIIX 4LVGA 1FWBC 2FYMA 3B0UX 1YPIA 3NZ1A 4D8AA 1ONWA 2WQDA 1L9WA 1P6BA 4GCXA 2ZRUA 3CT2A 4J3XA 3UZZA 5KZMA 3WH6A 2D0GA 5I00A 4JHOA 2J27A 2X1UA 4KCWA 3ITTA 2PB1A 3FW6A 5DMYA 2CITA 1R5YA 3A64A 2DUZA 4KCUA 1EC7A 4F0LA 2FPVA 4OT7A 4ZQPA 3N15A 3PNZA 3S0CA 5CSSA 4GUIA 1GJUA 4JQAA 1KGXA 3GYEA 4TOQA 1XG4A 1Z48A 5HAOA 3SY5A 3F4DA 2RDWA 1BKSA 1B9BA 1KD0A 2EG8A 2Y89A 4GC4A 3MI6A 4O13A 3ONCA 3ZJ8A 4R9XA 2X40A 3W1LA 3C8NA 5T26A 3SIZA 4ADSA 1CPUA 2DUXA 3OEXA 3RG6A 5G4HC 4KETA 3U8GA 2V5CA 4J3UA 3SQLA 3AU2A 3LRLA 7A3HA 4X0VA 1IR1A 3M0YA 3H4GA 1J5TA 3A23A 4IGMA 2A7PA 4CUCA 3TYBA 3PBYA 5AC4A 3CZEA 1DIEA 5GPRA 4AD2A 4H9VA 3A3WA 3DG3A 3W24A 3DGRA 2EPMX 3MP5A 4R5EA 1FCBA 5FSDC 3KW3A 4U10A 4YVPA 1J18A 2FDMA 4FSAA 2ZX9A 1QHZA 3LLFA 2ASHA 2BASA 5EMKA 5FD0A 1MW1A 4TR9A 2PU1A 5DCDA 2BHZA 2G3FA 2ZDSA 5FEZA 4HHLA 3KHDA 1RA0A 1GVEA 1E6QM 3WQ6A 1WKYA 3GNRA 4XKMA 1FFRA 1K8YA 4I6VA 1NVMA 1SO4A 3W7KA 4AEEA 5AC7A 1B5TA 1ZJAA 2GZXA 3VNIA 3REQA 1Q7MA 3WN6A 4C6FA 2XH0A 1XIMA 3BOFA 5EBAA 3VNZA 5EGRA 2OOGA 5M5DA 1CB2A 2HISA 3NWRA 2OLSA 3BV7A 1CNVA 3R43A 4PCTA 4HK5A 3UT0A 3HIJA 3CM4A 1FP9A 3FJ6A 2MUCA 2QCNA 4I7VA 2CLFA 5G1MA 1UWAA 4FOJA 1U1JA 4RW5A 3BAXA 3WDIA 2P0OA 1KCKA 3GDMA 3VKCA 3YPIA 3NSXA 1LT8A 5FAGA 1UZ1A 3NQGA 4UMCA 1ZLPA 4FF7A 4W89A 1YYAA 2DSWA 3L0GA 4OKDA 3CZ8A 5E0KA 3I7RA 4IOTA 3GXDA 4YTTA 2D2GA 5FEWA 5BMWA 4P7QA 3VPLA 3ZT5A 1E43A 8CGTA 3MJYA 1RY0A 4P7LA 4ROQA 3CWNA 3RILA 1WZKA 3CWOX 2J8TA 1CGXA 1UR4A 1W2PA 2GQ8A 3L66A 5HXMA 5DLCA 3UR2A 1E0XA 1UP2A 1W56A 4YL2A 3M47A 3LCIA 4Y6GA 4WEVX 5BWFA 3SJNA 3W29A 3I6TA 5TAOA 3E1F1 3PPCA 2QLYA 2WSRA 2NX1A 1GYNA 4LEQA 3QQ1A 1SFLA 1E71M 1TPB1 3W70A 1DJXA 5E0FA 3WL0A 1LOLA 4DAIA 4DBEA 5LGZA 4HNNA 1UKSA 1LBMA 1RJQA 2PTDA 1JULA 3FHQA 1B3YA 2WCSA 1MQQA 5IRPA 2Z27A 4YJ5A 1SMDA 3LQLA 5AYBA 3RPTA 3W7IA 4B91A 1GOIA 3LI1A 5CZSA 4REQB 4KWSA 1GVOA 5I23A 2VRJA 1YDYA 3NQDA 3BOXA 5HR7A 3DN5A 5AFDA 3IUDA 4FR6A 5AKQA 5GVJA 3HN3A 1E6PA 3AXMA 1K70A 1S1PA 3ABRA 3UD6A 4BF7A 1OX6A 5HANA 3QKEA 2Z1VA 4UQ9A 4GG9A 4QSHA 1O5XA 2ZX8A 3SGUA 1UWSA 3B8SA 1XSKA 1GYMA 4FP1A 1FRBA 2ZZ7A 3DHFA 4PUWA 2QF8A 3W01A 4DPQA 2IPGA 4XTDA 2GJPA 1C91A 2FMNA 1M41A 3PPHA 3V0SA 2DPEA 4WZHA 5LNRA 4CNSA 1HO1A 3I7QA 1JCYA 3JS3A 1XWYA 1CGVA 4Q4KA 1SPQA 3TV8A 5C8BB 3N25A 4INFA 2KZHA 1QBBA 4Y7EA 2GOUA 2WVTA 4C5YA 2XSAA 2Z0IA 3RR1A 1I1XA 3WMLA 4V28A 3DOPA 4XZWA 4Q8TA 3E5BA 1B3XA 2PWEA 3CUFA 2FVKA 3B8UA 2Y4SA 3F5KA 2F38A 3UG3A 3R79A 4DLFA 5AECA 1ICSA 5FI8A 3QV9A 2G96A 1UWIA 4D6HA 4JX6A 3ZS4A 4C5ZA 1WO2A 3UWUA 4GBUA 4H6EA 2XN2A 4IPPA 8XIAA 3GVWA 3L65A 4PFHA 3VOFA 3AIRA 1SU5A 3SRKA 3CQ0A 4X60A 3VIFA 4DF2A 2QJMA 1GYLA 5HWMA 4CQAA 4DLMA 1FQ0A 4O0KA 2PA6A 3ZVIA 2CC0A 3EPOA 1H0GA 3O6AA 4DQWA 4PTMA 2DZTA 3AS3A 3W26A 3BC9A 4MZ1A 1US3A 2CNCA 5BZAA 3T2OA 4EPBC 1Q6QA 4OUIA 2Q3RA 3PULA 1IXNA 2Y7DA 3PB2A 5A8NA 1XIGA 3BH4A 1XR2A 3T0TA 1O60A 4AY7A 1D2KA 3BJTA 3BTNA 3QY7A 2O9TA 2NSXA 3PZIA 5CJNA 4H19A 3THCA 2E6DA 1V3MA 3GK0A 3NUKA 4XBKA 2YLAA 1PPIA 3ATYA 1EBHA 2WMHA 4Z2HA 1QASA 3WNMA 1GJPA 1E5NA 3ABZA 6REQA 1R30A 2B31A 2D24A 3NZQA 5AC8A 4H1ZA 1YTEA 1NQKA 2FH8A 1WB0A 4GKTA 4FI4A 4QEEA 4LUSA 1JPDX 4ALDA 5AHIA 2BY3A 3TZNA 3M0VA 4MVAA 1XYLA 2AL2A 2Q02A 3ARWA 4JQ2A 5EU9A 4X9YA 2NXHA 4KFOA 3CJPA 3UZ5A 1TJ2A 1EOKA 3W75A 1T96A 2V5LA 2DT3A 1GW1A 3LCLA 3N14A 1YXYA 3APGA 3LLDA 4JS3A 4ZOBA 5CAHA 3K2GA 1JR1A 4BI5A 4JL2A 1J0ZA 1G4SA 2XIQA 3GNPA 1UWUA 1JAEA 4RDVA 5BU9A 1PO9A 4RE2A 1KBLA 3L12A 3TMLA 1VQTA 4TUFA 3UXDA 3SN1A 2GOKA 5IM51 5JBDA 1P6CA 3ZT7A 5I7GA 3TN6A 1K7EA 3VKBA 3S6DA 3NOYA 2DU2A 1YDVA 4YVXA 4JKKA 3W1TA 3VIPA 3PTKA 4GYKA 4QS5A 2VOMA 2ZCGA 2DSKA 1SJBA 1PZ1A 1NOFA 1E4LA 2F2KA 3M5VA 4J7RA 1TZ7A 4EXAA 1KFWA 5JVLA 2PWHA 4A6GA 1QO5A 2C91A 1H4PA 3K1GA 1A5CA 1KGWA 3DYOA 4DJFC 3GR7A 4DY1A 1XH0A 1BXNA 4OV9A 4GVIA 2PDIA 3DAQA 3L68A 4G7FA 5KZDA 4CNUA 1WZMA 3M0LA 4DI8A 3TEVA 3N12A 3PSVA 1Q7ZA 3UESA 1K8XA 1XLGA 2ACSA 1OGSA 1G4TA 2WJFA 3H2NA 1G4PA 1FWFC 3GHRA 3HTWA 2JGYA 3G3DA 4NJIA 3QYSA 2PAJA 1KM1A 3GNOA 3ALGA 3VIKA 4XWUA 4C6BA 4HSOA 3VCCA 3VK5A 3O8AA 3FAWA 3VGBA 4U4MA 3KOZA 2V68A 2WAGA 4DAFA 2UWFA 5LIXX 3EGJA 1J6OA 1TUXA 5IDIA 2ZQ0A 4RE3A 3LHZA 3WF2A 3GG8A 4ZOEA 4HZ7A 5DXXA 4K8HA 2Y8KA 3VINA 1TRDA 2X2GA 3L21A 2BDQA 2D22A 1EHAA 3L0NA 4XBSA 3VDGA 1ZL1A 2J66A 1WDSA 2Y6ZA 4JYEA 2BFGA 3OTRA 2YBVA 3DECA 1QPQA 5F4SA 3UJ2A 2RHGA 4H2CA 1PSCA 3PTMA 4YS1A 3LDVA 2Z28A 3NQVA 2Z1KA 4A35A 2QIWA 3BUVA 3KDOA 3SCNA 4IL2A 4B4HA 1DIKA 1MZHA 3RPMA 3RJXA 1UG6A 2IPFA 5HBFA 2DT1A 2B81A 2RUSA 5G4WA 4F40A 2DDXA 4MKNA 3T9PA 4BR1A 1R2SA 3PZ9A 4PEKA 2F84A 1VYRA 1EJSC 4G5DA 4Q8UA 1XIIA 1GOXA 2V6AA 2TPSA 1T41A 3LXAA 2I7GA 4GIRA 5E1QA 5AHNA 3GVGA 3WBAA 4K2SA 4NILA 1PYFA 4LRSA 2Z7KA 3MCOA 2PODA 3P6LA 3JZEA 3VC6A 1SR9A 4PTDA 2OSWA 1DIDA 2JKPA 4EWND 2WSPA 3CTLA 5FF7A 4QCEA 1MRAA 2XIOA 7ENLA 3BW3A 4OZOA 2QCMA 2PRHA 1QNPA 2JALA 4AU0A 5I3JA 4IJBA 1UD5A 3U4FA 1OYBA 5SWUA 2VCCA 4GKLA 1UUQA 4W88A 3WLRA 3ERPA 4P5UA 1JD9A 3G1YA 2CZ5A 3UYCA 1HNYA 4MG4A 3T8QA 2YXGA 3BLLA 2HVNA 4LAUA 2J7EA 4RZ6A 3WUFA 3TQ0A 1EP2A 4OJYA 4WDXA 3BG9A 1EP3A 2RGMA 2HV5A 1EWEA 3D3FA 3DGBA 4M3PA 1CXHA 2ADAA 3GVQA 3VGEA 2XN0A 3FN9A 5D2WA 2FQIA 1KO0A 2HK0A 3S42A 4RR4A 3P60A 3TSBA 4KWUA 5CPNA 1IR2A 3DKLA 5D33A 1V5XA 2VFHA 4GINA 1SFSA 4LPCA 1R85A 4H00A 1R86A 3ZWTA 1AG1O 4MDPA 4S2BA 1J10A 4JL1A 1MZRA 3EA1A 4G2DA 4QEHA 2PS2A 4XAZA 3TP4A 2QVHA 8XIMA 1EIBA 3L4UA 1BRLB 3ZOAA 3IVSA 3P8IA 2OOFA 4M5PA 1K02A 3VIOA 3F2BA 3BW4A 1IGSA 3BLEA 1OF8A 5LSMA 3KBNA 2WJDA 3UCQA 2OSYA 1OF6A 4IIHA 7TAAA 1LJYA 1J6PA 4ZO9A 4C1KA 4O18A 3CL7A 1W3IA 1EXPA 2YOCA 4PRWA 2XZ9A 2A21A 3TYDA 4H41A 3WQWA 1IXOA 3PS7A 1EPXA 3EWZA 4C6PA 4EXQA 4IPIA 2P53A 4HA4A 3M0JA 4LBRA 3QJAA 2HE8A 3VD7A 2A3HA 1A5BA 1OCNA 4B5VA 1KC7A 3AYVA 3L7RA 2AAMA 1SQ7A 4UTTA 1W1TA 2XVKA 2PC4A 5IXEA 4M6VA 3BVJA 2O0TA 4MWAC 2P5NA 1DWAM 1F9CA 3KBJA 3CPUA 1CXKA 1JCLA 4DO6A 3HJEA 4AC7C 5HDRA 3SZ8A 1Y5WA 4GI4A 1LWHA 3W38A 2WSKA 3AIUA 1XLKA 4PFMA 5CSRA 2WM1A 1RP9A 1XGDA 2FJKA 3K8LA 1K7FA 4C6EA 1GQJA 3OZOA 3CNYA 4C6CA 3IANA 1I4NA 2VNCA 5REQA 4GNKB 3TK7A 4BKNA 1REQB 2OGJA 2VZTA 5ABGA 3GDLA 1GHSA 2OQYA 5J5DA 3W2JA 3KVMA 3WCZA 1J12A 3LU2A 3V5FA 1JYXA 5EFFA 5CC6A 3DFYA 3Q58A 4PCFA 2QUNA 4QNEA 1C93A 4Q6JA 1O66A 2UY4A 4E2BA 1E70M 4EAMA 1NTHA 2VGIA 1W6TA 4GHRA 4UWMA 4D2JA 1S2AA 2NV9A 1EF3A 4IZGA 4C6QA 4JNMA 3WKZA 3AIBA 3UG5A 3WDQA 2EG6A 2A3BA 5U7SA 3KCLA 4MFDA 1T5AA 4GYFA 1XRFA 3S5SA 2X30A 2PGRA 5TF0A 2BB0A 1TE1A 3AS0A 1L6FA 2NQLA 3TYEA 1BGAA 3FA4A 1E3XA 3URAA 3W6YA 3LHUA 4TQTA 5C2XA 3GG0A 1XUZA 4HA0A 3SB0A 2X0YA 3QBUA 5HPOA 4H9XA 3AUJA 3N3TA 1P5BA 3ATZA 1NDVA 5BU6A 3QMRA 3OYZA 2TRSA 3C0SA 3SW6A 1V7YA 1S2VA 2WSQA 4ATLA 2PE4A 3VKJA 4NU7A 1W1ZA 1ZENA 3QPZA 1SZEA 2DGAA 3EEGA 1Z44A 2E7FA 1L8PA 2ZUVA 3DYPA 4Q4MA 4GBDA 3II1A 3A3HA 1M53A 1ICPA 1T8QA 2YYUA 3QHNA 4I5UA 2HEJA 3W86A 3UR7A 3NQBA 1IT0A 2DIKA 3V36A 5IFPA 4C7GA 4CQ9A 1H7NA 1FY6A 3A4AA 4FNRA 4NT0A 4F0MA 3U5YA 1PTDA 5CBJA 5I0DA 1VC4A 1RCXB 3GXFA 5JQ9A 1VD6A 2QUMA 4Q6XA 3ZXWA 2AQOA 2J7HA 1HKJA 2X1SA 4UBPC 4LUTB 5JIWA 1YE6A 3SBFA 3GUWA 1XBVA 4GI6A 2VX5A 1BQGA 2XH7A 4GWEA 2HCVA 4Y9NA 1A5UA 5HWJA 3PJUA 1UWTA 4DB7A 4O54A 1R3WA 3EX2A 2DY3A 2IXUA 4WY0F 1PE1A 5C0QA 4HYRA 1SVDA 1QHPA 3WLNA 4BQ3A 1JRBA 2P3EA 2VEPA 3DBNA 4J1OA 2YDSA 4NI8A 2FZBA 1QAPA 3MKKA 4PMZA 3HGOA 2DZWA 2Q01A 3C4UA 3AIVA 1XIHA 3QV6A 3SGZA 4M19A 2DW7A 2H8XA 2UZ9A 3CMFA 1S3TC 4JN8A 1T8XA 3EMQA 2A7NA 2V2HA 4GQRA 1D3CA 3R8GA 2DQWA 3M0XA 4IMEA 5HJLA 2PZNA 1B31A 1WE5A 1DWFM 2A3AA 4O28A 5EBUA 2A85A 2DIJA 5DF0A 5TIMA 3FY1A 1LYXA 4HHPA 1UQZA 4AZ7A 1NAL1 4F8XA 4CQCA 1VP5A 2XINA 3HG3A 2H9AB 4JCMA 1MSSA 5HJXA 3KBWA 5LIUX 4MYAA 1Z69A 3RYSA 4WF7A 4PE8A 2ZX5A 4C7FA 3W84A 4GOAA 2WNZA 4CGTA 1O6IA 1EC8A 2ACUA 3AIWA 4UMBA 1IEVA 3B0VC 4JICA 1R3RA 4W8AA 4AY8A 1AQHA 4ONVA 2P76A 4CQDA 2Z7GA 3ZJKA 4IP7A 2VEMA 4ERIA 2ZXDA 4FAMA 3T4CA 2YA1A 4Z0JA 3OLDA 3L4ZA 2L5HA 2R1KA 2ZUMA 4UOZA 3WEZA 1G69A 1KFBA 1I2QA 1QNQA 2CHOA 1F6YA 1AMYA 4Y8FA 1XLLA 3E0FA 1FDZA 4CCDA 4TX9A 5HUPA 2GGEA 5GJMA 1EB3A 3ONBA 4LFYA 2VRQA 3WJXA 1MNSA 3POCA 3UCCA 2TAAA 1HJWA 4M51A 1XCFA 1H63A 1YDOA 1C90A 1EC9A 3W7CA 3DU0A 5IHRA 1IIHA 4FALA 1TPEA 3T78A 2V3EA 1JUBA 4GNJA 2EHHA 5JBFA 5A3HA 1CTNA 1FKWA 2QKFA 1CWYA 5DEZA 2PTWA 2INEA 1AW2A 4YWIA 3IS4A 6ALDA 1ISVA 4HNTA 4HMCA 5EPDA 1J11A 3MV11 3DG6A 4J3ZA 1W1PA 1K1DA 2X0SA 4AC1X 4EF8A 2RJGA 2Y0FA 1F05A 1FBAA 4Z2JA 5HR6A 1P1MA 3SSJA 3WFAA 3N9RA 4ZCWA 3MP4A 3HM7A 3SECA 1E55A 4EWJA 2MNRA 5D37A 2W3ZA 3RMEA 2R9RA 1ZAHA 3EPNA 3OBAA 1IWBA 4MY1A 2WMGA 4NZ4A 4AZ5A 3WK0A 3KLLA 2PZ0A 2ODOA 4RV8A 1GOQA 1YTDA 4US5D 1EEXA 3CASA 5LHFA 1YADA 4GISA 3CXOA 3EWDA 1JUEA 2ZE3A 5FEPA 3ZR5A 3S2JA 4PZVA 3MA8A 2VR4A 1VBJA 3DFOA 3BANA 3MZNA 4IWWA 2NV2A 7TIMA 3ARTA 3KX6A 2O9RA 4U33A 4Q8QA 1ONXA 5LKYA 3UWEA 3LV6A 3TE9A 4H8UA 1DTNA 3W1UA 5CQ1A 3DUGA 4R53A 3LZ3A 3ARZA 3H6OA 4GJ1A 3O9NA 1A5LC 3W23A 3ZT6A 5C54A 1TFVA 1H5YA 3B4UA 2R1PA 1Z32X 1KCXA 4L6OA 3TQKA 4IF2A 4IFKB 4WUIA 1XISA 2ATSA 1W3JA 5EMJA 2LLEA 2DSVA 2UY3A 1C3FA 5GJPA 2YA0A 3MVIA 1UD2A 1FWCC 4XUYA 4CCEA 3VNKA 3UWQA 3NAVA 4O0ZA 4HNUA 1S5NA 3GU1A 1QPRA 1V0LA 1KRCC 5J5RA 1H7WA 5IHSA 4O52A 3LBOA 2JEPA 3WNKA 1OSEA 4ADUA 3EX3A 5K9DA 2J24A 5I07A 2REQB 3GDKA 1I2OA 3KEHA 2ZTKA 3N2OA 4XQ6A 5F4XA 4GVHA 3B05A 4NX5A 3TOYA 1Q5MA 4CD6A 1K77A 9RUBA 1WKDA 1AFSA 3W88A 4E6MA 1TIMA 3RFAA 5CAKA 2Z25A 1TPC1 5A8MA 3CHCA 1CLVA 3EDFA 1ZNNA 4LV9A 4YLWA 2VENA 1HG3A 4OHQA 1JCXA 2XISA 1OWQA 2PURA 3NO1A 1JDFA 4LV4A 1GQIA 3T1GA 1V3HA 3A21A 3B3DA 4JN6A 4O8RA 4XD3A 4Y90A 1L6SA 3WZ0E 2YFOA 4ZXOA 3EWBX 4CU7A 4GUHA 4A3UA 4IXXA 2VGFA 4L9XA 1DHPA 1E0UA 2V82A 2QYGA 3QGAC 4D8ZA 2FHBA 3N18A 4GMEA 3GNDA 3HQ1A 4ENLA 1HL8A 4NIRA 2ATMA 2H8ZA 1F2JA 3NM3A 1PHQA 3LG3A 4WX2A 4UTFA 2VC6A 1B1YA 3GFXA 4HZMA 3BW2A 4B2DD 3LMZA 4EX4A 4LF1A 2BWGA 3AXKA 1TR1A 3TX9A 1OT2A 5FF4A 4TMCA 3K5XA 2PP0A 5D8WA 1AMKA 2VEIA 1H49A 3R94A 3LXCA 5FJJA 1UA3A 3W7PA 1V0MA 2ANUA 4M6PA 3TJXA 4BQ4A 3GLCA 4ZTXA 4KRTA 5ENLA 4UTUA 1G0CA 4MJZA 1HJSA 1XLFA 5CGQA 2HVOA 1KKRA 1E9IA 3H4WA 4S3JA 4CD4A 3W74A 5A6KA 3NEHA 4UFHA 5HQMA 3URQA 1LRQA 3F2DA 4I8DA 2PLMA 2RJHA 2PF0A 3UBPC 3UERA 4HD5A 4NG3A 3OVQA 5C5YA 5B80A 3I6EA 3FVDA 2I17A 3FAXA 4W86A 3AIEA 3MYOA 2D73A 3IJDA 3VGHA 4YHEA 3THAA 2ISVA 2XJ7A 3FIGA 3TYUA 1TJ0A 1UIPA 3M07A 2OT0A 3N6JA 3O0FA 1UZ4A 4NJHA 1NDYA 1JZ5A 4UTWA 1VJZA 3DFTA 2IKHA 1DXFA 1LG1A 3LX9A 3EWYA 4H4IA 4PYSA 1ZBKA 3LXBA 3NPVA 3W1MA 2OELA 1Q4NX 1I9CB 4R7JA 2JGQA 1NARA 3S2MA 3ARQA 3W6LA 4GGBA 1ZS2A 1XW8A 4RDZA 2PGFA 1KBIA 2BVDA 2EPLX 1UD6A 5F4WA 4G7EB 2WVVB 5BXSA 4O1CA 3WBYA 2TYSA 3TYCA 4Z17A 1GWJA 1WUEA 3M6DA 1W37A 3T05A 1JCTA 5T91A 3T6CA 3PG8A 2BY0A 1JPKA 2WZIA 3TN5A 3VOIA 3IRSA 2RH9A 1Y0EA 3I65A 3PAOA 4OU1A 2JF6A 3N6HA 1SR0A 2NQHA 1OQFA 4H9UA 4U5IA 3CQHA 2VC7A 1XP3A 5TNVA 3AROA 1MYRA 2W79A 3VA8A 1FTXA 4MZYA 5IFTA 1LP6A 4QROA 3NYZA 2QR6A 4L1XA 4YYFA 1K9TA 3WD3A 4XTIA 4N9DA 3CT7A 5BXRA 4EOUA 1MQPA 4X63A 3GNNA 3LGGA 1H62A 4IP5A 3IGUA 3RDKA 1EWDA 2OVLA 3KVLA 4BF5A 3CWHA 1TPH1 3EKZA 4BQ2A 3HA1A 1F61A 2ZUWA 4AYSA 4WHBA 3UXKA 2PSNA 3TW9A 1O1HA 1TTJA 3O07A 3SI9A 2R8WA 4PB5A 1X38A 3OJGA 4GUGA 4QE5A 2E67A 4TXEA 5HMSA 3WLHA 4EK7A 1F74A 5C70A 3H53A 3NQ7A 1KM4A 2J77A 1LWJA 3M1ZA 4RXGA 4X3ZA 3OOQA 4GX9A 3TSDA 2V3FA 1IEWA 2ALDA 4Q4SA 5GNZA 3VNDA 4D72A 3RO6A 3K4DA 4LYRA 1R7OA 3PZMA 3TTSA 2YYTA 1P0EA 4OECA 2HNHA 3PUEA 2ZUTA 1BXBA 1LTDA 3WH5A 1XF0A 3FFSA 2BHYA 3V5OA 1POJA 3TJIA 1BAGA 1XYFA 3OHIA 1MEIA 4YCPA 1X98A 3HPZA 4ZSUA 1E4NA 2QCFA 3E2RA 3KRBA 4R7WA 4LF2A 1SZFA 4LUIA 5M17A 4DJEC 4G1NA 3EX4A 1CLXA 3ANUA 4IGSA 3WLTA 4WOQA 3DCPA 1GORA 1Q65A 4BA0A 2EPNA 2CLMA 2BVTA 4JQ3A 2BLEA 1VYPX 1VEPA 3HQNA 2IQTA 4N7QA 4NSBA 4D6FA 4XZBA 4RJEA 4URIA 3S5NA 4AHPA 3W25A 4AZ6A 3G8EA 2KAUC 5AVHA 3U9IA 4QJ4B 1XX1A 3GDRA 1FH8A 4NJGA 4H7VA 3TVAA 5ABFB 3DHPA 4QBXA 7REQB 2XWDA 4O17A 1CXFA 4DM1A 3VMNA 3SSZA 1X6NA 3ZO9A 1A0DA 4Z2KA 4PTWA 1FWHC 2QZRA 2AAAA 3LSCA 3EXRA 1F07A 1J8VA 4MAZA 3AWNA 1HXJA 3AZSA 1OFQA 1GVQA 1DJNA 4Q22A 4HTYA 2F8QA 3TR9A 1RAKA 3NDZA 2BNJA 5EKYA 3UWYA 1PX8A 4LANA 2NV1A 3P5ZA 1MDLA 1A0EA 4NI3A 1XQLA 3SRFA 4QG6A 3NQ6A 2X2YA 3VOCA 4V33A 1G01A 2JF7A 4NASA 1R3TA 3EZ4A 5H2ZA 1RBLA 3VIIA 1W1A1 1JZ3A 4RL3A 1E9LA 4LRTA 5C9XA 3F4WA 1DJQA 3H12A 5DMMA 4LAKA 3M5ZA 5EA9A 4K1GA 2B7QA 1WQ5A 3TROA 2XWEA 5FJUA 1XC4A 2OZ8A 1R2RA 2NZLA 3EOEA 3WFZA 1FWTA 2ZRWA 1ZCOA 4ZZ9A 3CMGA 1KRMA 2Z6IA 1LL6A 4GUFA 3DFNA 1MFUA 4V1XA 4KGLA 3AXXA 4B5XA 3CHDA 2CBVA 4XV0A 1TX2A 3ZYZA 3AU6A 3G6LA 2WV8A 1UBSA 4GH1A 3L4XA 1ITXA 1FWIC 1L6YA 2GGJA 2NVDA 2DP3A 2FJUB 4XIAA 4H8HA 3NFUA 1UWQA 4HPGA 4O57A 1R6WA 3T40A 2YZRA 1DXEA 2IXVA 3QQ0A 2HZGA 3BMWA 1FWWA 3IUIA 3CL8A 2CYGA 1PAMA 1TG7A 5XIMA 1IQ8A 4HN8A 7CGTA 1WPCA 1SZGA 3U7VA 3A5VA 3EOLA 4AEOA 3PUGA 1Z41A 4M29A 4AD1A 2ZE0A 4JTIA 4MDOA 4L56A 4HK7A 3NURA 1J0YA 4HCLA 2AQWA 5C7VA 3UVIA 3K13A 2E6YA 3KOYA 1A53A 1YPXA 1ZBWA 2DH3A 2FVMA 1QOQA 2E3ZA 5C71A 1B3VA 3MW7A 4TVUA 5F2MA 2YLLA 1UKTA 4YMZA 3EOUA 2GL5A 4HZ8A 4WVXA 4AMCA 3LMYA 1DL3A 3WBWA 4NUWA 4WQ6A 5I79A 5FL1A 3VNYA 5LYRA 5DFAA 3G1HA 3OBEA 1TA3A 3L5AA 1C8QA 2VEFA 4AIEA 5A6BA 4IMGA 3TN3A 2ZXQA 3FOKA 4GGHA 1RZMA 3FSTA 1VFFA 2PP1A 1ODUA 3THUA 2CIPA 1UP3A 4GUJA 1UC4A 2YR1A 3DFQA 4KRUA 3NM1A 4IQDA 5HNNA 1UKOA 1UB3A 3HZ3A 3IV3A 3WQ4A 5A2BA 3HGRA 1E6NA 1H1ZA 1AH4A 1S5MA 2VOTA 1EJ7L 4DWSD 5HUOA 1VEMA 2YBTA 1CI1A 1JJKA 1R38A 2W0UA 3Q37A 5CLTA 3WLIA 1M65A 4JDBA 3J7HA 1MEHA 3T0CA 2JQXA 4UTHA 3MUZ1 4ML9A 3T2PA 4A8RA 2I56A 4C1NA 3SCPA 1IZKA 3CHVA 3GDTA 4U2YA 3W7QA 4B5WA 1EA0A 1AJ2A 4IJCA 2F6KA 4PCNA 2V69A 4MHBA 4A2SA 1V3KA 1PVNA 4A8NA 4A3HA 1EGZA 3ICJA 2JBMA 3GH7A 2ZRYA 3IIZA 4Y8EA 4QJ1A 5DMNA 5DRCA 2EPHA 3SCWA 2EPOA 3WBEA 1M6JA 4XVEA 1Z3NA 1UYQA 4AY1A 3HQOA 3GX9A 1ECEA 2VO5A 2V81A 1XDMA 3BCFA 5JBEA 2ZZ5A 3OW1A 3DH7A 3TDFA 5FAJA 2NX3A 3TYZA 3MKVA 3E6EA 3V1HA 1KNWA 1MI3A 2VFIA 5KETA 3CGTA 3C5QA 3LBMA 4QG9A 2J7FA 1E4MM 2XGBA 4J5NA 4DUXA 3P0WA 2J4GA 2DVTA 3KXQA 2J78A 2NQ5A 1H50A 5XIAA 1UROA 1HT6A 4XO6A 3RN6A 5H8PA 3AMLA 1FWGC 1DV7A 2EKGA 1H7OA 2B4GA 4FR1A 3CH0A 4O11A 5D2VA 4J3WA 4OTKA 1W3HA 3R0KA 3G1XA 5KMYA 2VUNA 2D3LA 1GVFA 1NH6A 4LJ3A 3LTYA 2JEQA 4JX5A 1Q66A 5F1VA 1ISZA 5JH2A 3CPRA 4W84A 4GIAA 1XICA 2PU0A 3WQ8A 3S5ZA 4GYPA 3BDKA 3CEUA 1NF7A 1Z6KA 3LV5A 2GSJA 3TYAA 1XLMA 1W5OA 2O4MA 1HGWA 3KS5A 1GJWA 3VILA 3IGSA 4PUKA 5C7HA 1TPDA 4ZQNA 1RCOB 1VS1A 2G41A 2VUYA 5HNTA 1PX4A 4PODA 2OMAA 1OADA 2E68A 1PIFA 6XIMA 5F2IA 3WD4A 1RHCA 2OWWA 1EPVA 4GQGA 1UWRA 2YCJA 4IMFA 3VXGA 4UC5A 4O19A 1XDJA 1OIMA 1TR9A 3CL6A 1YPFA 1J96A 4JQ1A 2X1RA 4FXJA 5A2CA 2D2JA 3E0WA 2VWTA 1ISYA 3L5LA 4S3GA 2ZZ6A 4Q4RA 3P82A 4HQVA 3QGVA 3WX7A 1UR9A 1I2PA 2Y8UA 5K2ZA 1ZHAA 2OZ0A 3UGVA 2E25A 5FCZA 1DJIA 3WD1A 3BMXA 1KBKA 4QG8A 1TPVA 3GU2A 5BXTA 2NUYA 2PDKA 4GO8A 1OFAA 2FFCA 4AX7A 3GIPA 3IGXA 3VIMA 4L7ZA 1ZB5A 1DWGM 3K4WA 2W61A 3VGFA 1JG9A 3LPFA 3KM8A 4F4RA 4S3EA 4MNMA 2P10A 1CGYA 1U1HA 6REQB 1KQYA 1QI2A 1UJPA 1OD0A 3IK2A 3EA3A 5H1WA 3MP3A 4U5KA 3T0AA 3PUOA 1XG3A 4Y9PA 5MF5A 2I9UA 3PM6A 4LUSB 1GW9A 3WQGA 3W7OA 1QDSA 3OGVA 4XD6A 2AL2B 3SQMA 4JTFA 1EL3A 1ZBVA 5FIPA 1TV2A 2CERA 4GE8A 4JNZA 4FPSA 3Q4DA 3ZR4A 2YXXA 4CQBA 5FJOA 3OZYA 4W87A 1MNZA 2YCIX 4GI8A 4JTUA 3O0KA 1M7XA 3M0HA 5DCBA 1IE7C 4ZQOA 1FHDA 3OB8A 4RE4A 2E6FA 1BG9A 4PBGA 5D05A 1A5SA 1SSDA 2CLPA 3U7BA 4UFLA 4JIQA 2XVPA 3E49A 5CC3A 3SQSA 4NAFB 1U30A 2PRLA 3HQPA 3LUTA 4KPLA 4US6A 3V3WA 3TTQA 4KS0A 4LYKA 1CT5A 4RDYA 2NVAA 3CUJA 1UH3A 2EJ1A 3PJWA 2X16A 1EBGA 4DJDC 4IX0A 5CSYA 1M7OA 4NKCA 2NLIA 3DKJA 3TA6A 1HKWA 4LH8A 4NRSA 3B9DA 1K8CA 4MPQA 4GYJA 4F0KA 3AYSA 4QCFA 2D69A 4PB3A 3FGCB 4HNLA 4HU0A 3GQYA 3STPA 2WM0A 5CLWA 1N8FA 1FH9A 2VX4A 4M7SA 1PXGA 2QNEA 1B9ZA 2GVGA 2DZVA 4KKXA 1YHTA 4MB1A 4BY3A 1WV2A 2VZVA 1X39A 1SO6A 2GWNA 1JYVA 2V3GA 3I3DA 1BVNP 1MW2A 5DBUA 9XIMA 2E8YA 4FOKA 1RVGA 5D9PA 1QOXA 3WLKX 1NSJA 1LORA 4JTCA 3KWSA 1SJAA 1W8GA 4Q8VA 3VIGA 4HTBA 4AFYA 1UP0A 2UBPC 2ZYFA 4F9DA 3G2GA 1AW1A 1HUVA 2YXOA 1PBGA 3NQAA 2V5KA 3KHJA 4L9ZA 2CLKA 3W7LA 1I6NA 5BOOA 2FZ9A 1MXSA 2G4JA 3P5YA 4C6DA 4DYEA 3KVKA 1BTCA 2AGKA 2WBKA 3HPAA 3ME3A 1RA5A 3MBFA 4A2RA 1BGGA 2YDRA 4S3AA 4PH6A 3ZIZA 2PCEA 4P7NA 4Q8MA 2EPKX 2FKPA 1KQZA 2VFDA 2EGZA 3FYPA 4E4PA 1PUDA 1JPMA 2R6OA 1TV5A 4GA8A 3MUXA 2QJNA 2J6VA 3W76A 1ITQA 1JVNA 1YMYA 4BHYA 1NU5A 1JZ8A 3OO2A 4LEFA 4ZQCA 3HMJG 1US0A 1ZUAX 5M2FX 2IMRA 1X1NA 4JIPA 3WJYA 2PDGA 3F7JA 1QUMA 1EQCA 3AISA 1BYCA 2Q8LA 2VZUA 2OTDA 3JU2A 4HCDA 3WQOA 5I78A 4A21A 5CJ5A 4JNYA 5C9ZA 3QQWA 3G22A 3VOGA 1C8VA 1AODA 3VX1A 1PIIA 1J0KA 4NXSA 3W0KA 3SJ3A 1XJBA 2AL1A 1XI3A 1OZQA 3HF3A 1XM3A 6A3HA 3SFKA 3BAJA 4LXFA 3JVAA 1K4GA 2YA2A 3TC3A 2NQZA 3DDMA 1WXZA 4DELA 1IEQA 4A29A 3E9AA 4C6OA 1JRCA 5D03A 4J35A 5K4XA 1PWMA 1J0IA 3TA9A 3CAWA 1XIFA 1EDTA 1PB0A 3EDEA 3W7EA 5DN1A 1PEZA 4RNJA 2PWFA 1FXPA 1J0HA 3APTA 2GGIA 3SEPA 1TPUA 4E8CA 3UJRA 3Q2DA 4J3SA 3FKRA 1KM0A 4DYKA 4FNPA 3OLIA 3QV8A 3SUSA 2O7QA 4PMVA 2PTXA 2DZUA 2IUZA 3NQEA 3S5YA 2YW4A 1QPNA 3U5UA 4JDYA 3UWWA 3S4TA 1O68A 2ZVRA 1L2UA 4GRSA 3C8FA 4QFUA 3IEBA 3L4YA 2CBIA 3NXLA 1SO5A 1IWAA 4S1FA 1TZZA 1EDQA 3OIHA 3ISIX 4Q8OA 5CSUA 2WC3A 1VFLA 2ZX6A 2WZMA 4S23A 4K36A 4PBFA 1QT1A 4AF0A 5GJNA 4L1WA 3H2MA 3MHUA 3W1PA 4YYCA 4IFRA 4PUEA 2R91A 3TR2A 4FXRA 3GKFA 1M9HA 5F2GA 5D09A 4ORIA 4IG2B 4B3LA 3P74A 4P8VA 5HNRA 3TMQA 5M03A 3OA5A 4A8LA 4UQBA 4H01A 3ZJ7A 3E38A 3B03A 4NZJA 3CLWA 3LYEA 4OIFA 3F03K 1HW6A 3VMOA 3UVAA 2NQJA 1PCWA 3AO0A 3E2SA 2J9YA 2VXNA 1U33A 4Y96A 4JTKA 4UB9A 3AOFA 1XLHA 4TU1A 3R58A 1NM9A 5HNUA 4B5TA 2FDSA 3DIPA 1U83A 2FTYA 2ZX7A 1L6GA 3C0JA 3MDWA 2OLAA 4NAEA 3K46A 1PKNA 5BYWA 2VWSA 1Y7VA 3R0UA 3TCSA 3WK3A 2V67A 3F1QA 2XSBA 2C14A 4WY0B 4GCAA 1RJPA 1OINA 5H91A 1PV8A 4QLLA 2YPIA 3QW3A 2J8FA 5C2GA 1JZ4A 3A12A 1RVKA 7PTDA 1ZAJA 3BK0A 3W1AA 3POHA 1R3VA 4MYXA 1NELA 4O50A 2OLHA 2WPBA 3WQDA 4A3RA 4MUPA 1TJRA 3HJZA 1X97A 2WNQA 3R5EA 1K6AA 3BJFA 1HVQA 4JY9A 3GDBA 3G1RA 2C1HA 2NXIA 3N19B 3PZTA 1TV4A 2A6NA 3EBVA 3FDKA 3KBSA 2WBGA 2B0MA 2YL6A 3HPXA 3FX4A 1LLOA 1YX1A 4PMUA 2QT3A 1MQRA 4W9TA 5HPCA 1FFQA 4BWLA 4LB4A 2J74A 3E74A 5GQBA 3QKZA 1ECQA 2Z2BA 2X05A 3M43A 4KCVA 1KLYA 5REQB 2F7FA 4V1YA 1UR1A 1KWKA 1MEWA 1QI4A 1ADOA 2WHMA 3LS9A 1LT7A 5AY7A 4BEQA 3VOHA 2ZRVA 1EZWA 5DRIA 1JYNA 3VNLA 4AWEA 2ZIDA 3T08A 3AIQA 3V5CA 1HJQA 5A95A 5I3FA 4ORMA 3D5HA 3Q45A 5D2XA 1VZWA 5F7UA 3W6MA 3PTDA 1DBTA 3GM8A 1AJ0A 3LB0A 4JIEA 1DXIA 1J4EA 3UG4A 2P8BA 4X61A 1EP1A 4I9MA 3IAQA 1FUYA 1K4HA 1HJUA 3PHAA 4W5UA 3W7MA 3U57A 4L6DA 1OVDA 2Z1BA 3DC0A 4D1JA 3ORWA 3RLVA 1TCMA 2WVUA 3THDA 4R9OA 4X2RA 4QITA 2QDDA 4KQNA 2BOEX 1P0KA 5K9CA 2VGGA 4YPJA 4NHVA 3E0LA 4B15A 5A6LA 2Y24A 3GVVA 1PDZA 4MWAB 1ONEA 2H90A 1UW9A 2Z2UA 4E5TA 1XD1A 3W7DA 4ICCX 2CEQA 2INZA 1KM6A 1V0NA 3MO7A 3RM8A 1V6UA 3S3GA 2R1MA 4W7VA 4IFOA 1XIJA 1E51A 3VCNA 2PMQA 1S3HA 4U2ZA 3GS6A 2Y70A 1F76A 3RLGA 1NFGA 1W1B1 1E6RA 1S5WA 1QI0A 3I6RA 4GPNA 4DBUA 3WLQA 3KCJA 4HNCA 7XIMA 6CGTA 2WMIA 5CC7A 4EP8C 5JU6A 5CBIA 2Y5EA 4AVOA 1YW1A 3M44A 3K1DA 3BV4A 4LYPA 4ATWA 1M5WA 4O4VA 4MAVA 1C9DA 3STCA 1QWGA 3R7MA 1FOBA 3DHUA 2C7FA 3MUIA 1GQKA 5E70A 3WLSA 2PLKA 1E40A 2FVLA 2G0WA 5BCAA 4IIEA 4LVAA 1ZJIA 4KWVA 1ZU8A 3R13A 1FHUA 5D9MA 3KRSA 1KV8A 1GCYA 5HINA 1E1CB 1RD5A 3A24A 3MZ2A 3TOPA 1JF6A 5FESA 5MKGA 4DJED 4DO5A 2CWXA 4XD4A 2B7PA 1JYWA 1BYDA 2XHYA 2QF7A 2B7NA 4QM1A 3KZPA 4Q4PA 1BLIA 4IIDA 2AGTA 1EZ2A 4D6GA 1EKOA 1FWEC 4UIOA 1OB0A 3VDAA 4FNSA 4I90A 4AD3A 3QGKC 4IJRA 1EJWC 3SFWA 2VEKA 4LUJA 2YFNA 2PDLA 4XBJA 3C52A 1ELSA 5F1UA 3PB0A 2Z1XA 1Y5XA 1UOZA 4C6LA 2PDNA 1GTHA 1OM0A 4US5A 4UTLA 3SM0A 4I8YA 1M7PA 3DFHA 1KTNA 1J5SA 3QR0A 1CYGA 2E0PA 2J9ZA 4ZENA 3M46A 3FK4A 1XYAA 5ABTA 3AWOA 1WAWA 1VPXA 3L23A 4QP0A 2PI6A 1TO3A 3IJQA 3TTYA 3W3OA 1OC5A 3CV7A 1YLVA 2R14A 1O5QA 1EEPA 1TZ9A 1WBJA 2IQDA 3MS8A 3CHFA 3BQ6A 3LSBA 4MFEA 4NJJA 3G1AA 4MM1A 4CKQA 2O9PA 2Z29A 3GB6A 4TX6A 4KEZA 3ARUA 3C86A 3ECQA 1TV7A 1LDCA 4AW7A 5FJPA 1Q6FA 3IPWA 5CZTA 1SW7A 4ACYA 1XD0A 1EUAA 3BJSA 2YL8A 4U3AA 3W1NA 1WDQA 1KR0A 1LG2A 4Q4OA 2DVUA 3QPEA 4H9ZA 2WHKA 2W27A 3TIMA 1L2QA 1IZJA 1EGVA 4I9TA 4WDUA 3WK2A 4F66A 5B7YA 1LRTA 1NY1A 3L2LA 3KFTA 2XIMA 2DORA 3FA3A 4AXKA 1S46A 3RAOA 2BXYA 1DE6A 1VIWA 2VR5A 4B3KA 4ICMA 4LY4A 2YJQA 1LQAA 4QDPA 1PS9A 2VCAA 4L4LA 4LVFA 1WOBA 1V6VA 2ZKMX 5LNSA 1B3WA 4AIOA 1H2JA 3UZYA 4AVFA 1QNVA 3G0SA 3CAQA 1EJUC 3WNNA 2GGHA 1VFSA 4QTGA 1V6WA 2RFGA 1DJWA 5CGMA 4F9JA 1E1EA 1VEOA 2C16A 4YTUA 2D23A 2J62A 1XS2A 4ATDA 3BXWA 4IH3A 4B92A 4NZ1A 1JF5A 1I75A 3QMSA 1HP5A 1JQVA 4PB4A 2OXNA 4ZTYA 2VYOA 3CUIA 2CFFA 3HURA 3GC4A 1JIBA 1P0DA 1D9EA 3GHTA 5DXYA 1F8MA 3QFWA 4GXPA 2NSOA 3TTEA 4PUNA 4B2DA 4UFMA 2QJJA 3WF1A 1H7RA 2HRWA 3HPSA 4E38A 3QC3A 4JFSA 3HG4A 1H7PA 1ZBCA 2QV4A 3PZVA 5DX7A 2IKGA 4XISA 4KEMA 1I2RA 2ZADA 4K7YA 1OCQA 3UR8A 4QAIA 3PC0A 1OFPA 3DX5A 3V7PA 3WDPP 1EO7A 1W3TA 1S2TA 4J4KA 1CXLA 3UU0A 1WX0A 3R11A 3PFMA 4WCJA 4WKAA 4TMBA 5D2YA 3WEOA 3PJTA 3BLIA 4EIVA 1FP8A 1HFBA 1FH7A 4BI6A 4M81A 3R6IA 3S2LA 2QHAA 3A47A 4GACA 1RV8A 3VU2A 1M03A 4LT9A 1A5OC 1LOQA 4AZIA 2VMFA 4LNCA 3S9YA 3KVJA 4WJ8A 3IAPA 5ABHA 5C2CA 1KM3A 2ZUUA 1D8WA 1PZ3A 4JIRA 2AOSA 2JKAA 2ON3A 2P88A 3LHYA 1JEZA 4UOQA 5HWNA 2HQAA 1GPWA 3N34A 4DO4A 1XLEA 3NYDA 4M6UA 4ZQMA 3AYTA 1RUSA 3OVPA 4NAFA 1NWSA 1E9YB 1YIXA 3T09A 4XSLA 4ROPA 2I5GA 3NZPA 2WNWA 2PDJA 1DWJM 3AALA 2QMJA 3TAKA 2ZFAA 3GKAA 1P4CA 4K8EA 2VP8A 3M16A 1KWGA 4UZSA 5KTLA 2VD8A 4Q33A 3MU7A 1QK0A 3NL5A 4PMXA 1XV8A 2ABBA 3PBUA 3NA8A 1KXHA 1BG4A 3S1VA 3RU8X 4MNJA 4GIYA 1A5AA 2PWGA 3FGCA 5XINA 1RP8A 1A49A 3FNDA 5A8QA 4Q8WA 2C0HA 4UNLA 3HB9A 3FV9A 3KOFA 4PMJA 1AH0A 5D4YA