3LUTA

A structural model for the full-length shaker potassium channel kv1.2
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel subunit beta-2
total genus 120
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lutA00
2IPWA 4GQGA 1EXBA 4FZIA 5LIWX 3V36A 4L1WA 3LQGA 4YVVA 3UFYA 4WDWA 4JIIX 3GHUA 1PZ0A 4XZMX 2F38A 3B3DA 2R24A 4XO7A 3V0TA 1X97A 3LENA 4ZFCA 1Z9AA 4QXIA 2HEJA 3UGRA 4QBXA 2INZA 3EB4A 1LQAA 1MI3A 2WZTA 3R58A 1MZRA 3KRBA 2PDIA 3ERPA 4GA8A 3UYIA 5JH1A 2A79A 4XZHA 5DANA 2HVOA 2P5NA 3R7MA 4IGSA 3ONBA 3RX4A 2IKGA 3VXGA 2PDNA 3RX2A 4H7CA 4XO6A 2HE5A 4MHBA 2I17A 1ADSA 4PMJA 3M4HA 2HVNA 3DN5A 2PDYA 4XK2A 3T42A 2ACRA 2PEVA 3R43A 2IKJA 5JH2A 2FZDA 1AH4A 3UZWA 3CAQA 4PRRA 4WDUA 2FZBA 1RY0A 4JTCA 3Q67A 4PRTA 3G5EA 2HV5A 4LBSA 3WCZA 4PR4A 3D3FA 4QX4A 2PDMA 3UG8A 4JTDA 2PDFA 4AUBA 2PDGA 3MB9A 3O3RA 3BCJA 2BGQA 3CAVA 4GQ0A 4JQ3A 1YNPA 2PDPA 2I16A 1ZQ5A 1HW6A 2IPGA 1YE4A 3FX4A 4FA3A 3GHRA 4DBSA 3ONCA 3N2TA 3P2VA 3GUGA 2C91A 2PDBA 4JQ2A 4EXBA 4G5DA 3F7JA 4QR6A 4I5XA 3R94A 2CLPA 1S1RA 1Q13A 5AZ0A 2PDQA 4GACA 3BURA 2ACUA 1LWIA 1OG6A 4JTAA 3LNMA 1X96A 2PD5A 4IJRA 2IQDA 1HQTA 4ICCX 2FZ9A 3WG6A 2NVDA 3GHTA 3H7RA 1RALA 3UWEA 3H4GA 1Q5MA 1M9HA 3MC5A 2BGSA 3M0IA 2PDCA 3V0SA 4RPQA 4ASTA 4JQAA 4FAMA 4GCAA 1AH3A 1XF0A 3WBWA 5AZ1A 1IEIA 3C3UA 4IJCA 4GIEA 1K8CA 3GHSA 2PDKA 3V0UA 1R38A 2ACSA 5M2FX 3CMFA 4HBKA 1AH0A 3S3GA 5LIXX 2DUXA 4L1XA 5LIKX 2IQ0A 1IHIA 1X98A 2PZNA 2HDJA 2PD9A 2VDGA 4R9OA 1AZ1A 1US0A 4JQ4A 2PDLA 1J96A 3LUTA 4GABA 4F40A 4Q3MA 3WBYA 5LIYX 1A80A 4WDXA 4PUWA 4JIRA 1PZ1A 4WDTA 2QXWA 4YVXA 2PF8A 1RY8A 5HNTA 4LB4A 2IPJA 1ZUAX 1GVEA 1JEZA 3CV7A 1VP5A 3G1RA 1EL3A 1PWMA 3O0KA 4OTKA 5HA7A 2PDWA 2FVLA 3R8HA 1Z8AA 2J8TA 2BP1A 1QWKA 1VBJA 4FALA 1YNQA 4XVEA 3UP8A 4H8NA 3RX3A 4HMNA 4Q7BA 3R8GA 3LZ5A 4XZIA 2R9RA 3LN3A 2PDHA 1PYFA 1ZGDA 3N6QA 3NTYA 3U2CA 3Q65A 1T41A 3H7UA 3LZ3A 3LBOA 2DV0A 4JTRA 1XGDA 4YU1A 1XJBA 3WBXA 3UZYA 4JIHA 1QRQA 2IKIA 2FZ8A 2HE8A 3COTA 1C9WA 1T40A 3M64A 1PWLA 3LEPA 4LBRA 3QKZA 4YS1A 1S2CA 2DUZA 4JTQA 4LAUA 1S1PA 1Z89A 1AFSA 2IKHA 2ISFA 1AZ2A 2NVCA 4DBWA 4LAZA 2FGBA 2WZMA 4EXAA 3LD5A 4DZ5A 2PDJA 4XVDA 4XAPA 4JQ1A 4XZLX 1EKOA 3R6IA 3UZZA 1MRQA 2ALRA 3CV6A 3EAUA 1S2AA 3V35A 2PDXA 1UR3M 1ZSXA 4NKCA 4WGHA 2PFHA 1SM9A 3BUVA 3BV7A 4LB3A 2IPFA 5KETA 4PUUA 3LQLA 2IS7A 1Z3NA 3FJNA 4WRHA 1FRBA 4WEVX 1YE6A 4XZNX 1EF3A 4DBUA 3CASA 5C7HA 2ACQA 3UZXA 5LIUX 2AGTA 4YVPA 2INEA 5HNUA 3EB3A 3DOPA 2F2KA 2PDUA
chains in the Genus database with same CATH superfamily
3GTIA 1IF2A 4UZSA 3FOKA 4TTUA 1TELA 2ATSA 3OQEA 1ZTVA 1FTXA 3GX9A 1G69A 2F38A 4LFYA 4HJFA 3UWWA 5D38A 2Z4GA 4LVBA 3N4AA 4QXIA 1OB0A 1TJPA 3NO1A 1SR9A 4QBXA 3D6NA 1PKNA 4DZAA 1E1EA 4ES4A 3WY1A 4Z2GA 1R85A 2ZUTA 3RHGA 1RHCA 2PGFA 2TYSA 2KX9A 3PZOA 1E5JA 4IH3A 2WM1A 3O07A 2VMFA 3UJSA 1OGGA 4MY9A 3E38A 2OVLA 4MFEA 4NJGA 1WV2A 3U4AA 5HNNA 1A5CA 3LGGA 4O8AA 2IKGA 4TU1A 3KOFA 1MXDA 5KTLA 3CUHA 4J40A 2AQOA 1KGXA 4KESA 1P6WA 4LJ3A 4AZ7A 1N2VA 1VFSA 1B4EA 3UY8A 1W3TA 5G1YA 5FI8A 7PTDA 1W5PA 2DW7A 4YN5A 5C6MA 4IMCA 2PEVA 3IUDA 3I3DA 1WDPA 2OG9A 3K8MA 4M6QA 4GYJA 1XSKA 2VD8A 3PAJA 4KCVA 3AUOA 4B5WA 3HG3A 4O53A 2HV5A 5HMFA 1IXNA 1IZKA 1SFLA 2QVNA 4MIMA 3OYZA 4HTBA 1OCQA 4FX6M 1UD2A 1P43A 3UWUA 3TUUA 4ZB5A 2V2DA 1RR2A 1T8QA 3CLWA 4KCWA 1H1ZA 1UA7A 3P61A 3RUBL 4QTGA 5CSYA 5C9XA 4JQ3A 3MV11 3AXKA 3PFMA 4ZQRA 3O6DA 5AN7A 3PJXA 4OT7A 4J7RA 4RLIA 3OGRA 4IIHA 4RW3A 1J8VA 4LV4A 3EX2A 6CGTA 1OT2A 4CKQA 1NY1A 4Z1YA 3VNLA 4RX0A 5MF5A 1U5JA 1LUCB 3LMZA 2EAWA 3QBUA 3C2FA 3H2NA 3PM6A 3WMSA 1A5NC 5CGQA 2DSUA 1K4HA 3KW3A 3TJIA 4ICCX 3WG6A 1DJYA 3EKZA 5HJXA 3HFYA 3TAKA 3KRUA 1HIZA 4OIFA 2C8NA 3CO8A 3IAPA 2AQVA 4GH3A 1O6IA 3AJ7A 4NI3A 3WELA 4FMVA 2AL2B 2FZNA 5G1TA 2NUXA 1GUVA 2EPNA 4GCAA 1QVBA 1O68A 4YTQA 3LMYA 4DPQA 3OLIA 5EMMA 4H9UA 1EO5A 1GCYA 3UXKA 3R10A 4FSAA 3HMCA 3L4UA 4ERGA 2PRMA 2BVTA 5DFAA 2V68A 4B91A 1E6XM 4L1XA 5I2UA 4BWLC 4E0CA 4AZCB 4PMDA 3G0SA 4FXSA 2WSRA 1Z7AA 4RNIA 3RGTA 8XIMA 1R47A 1US0A 1O94A 4FF7A 4BI6A 5HXMA 3GS6A 3T09A 3W1NA 7TIMA 4O0KA 3S0CA 2QKFA 4EANA 2Y1HA 3KL5A 3G1HA 2FQIA 3BDKA 3MBDA 1UZDA 1XIJA 3K4AA 4HNCA 4J1OA 1J01A 2QXWA 2QDGA 3BG9A 1CLVA 3IVTA 5DRCA 2ONEA 2VFFA 3AHVA 1VD6A 1UPPA 3A6OA 4X63A 3MV01 1Z44A 1ZBKA 3TLQA 1AJ2A 1IWPA 2ZRYA 4UR7A 3GDTA 4P8UA 1KV5A 3R0KA 3M6YA 6XIMA 1H7XA 4C1KA 3K2GA 1I0DA 2FFCA 3S2LA 5BXPA 4DJED 4FALA 4Q32A 2W79A 2ZFAA 1PIFA 1H7OA 3LCGA 3R13A 4GVHA 2Y4SA 4HMCA 3W7DA 2V9DA 4MF4A 1ONRA 4UFHA 2ZIDA 1TA3B 1FWBC 1WAWA 1X7IA 5FCZA 1EP2A 4G6CA 5TIMA 3WUFA 5M17A 3CQIA 3E2SA 5GJNA 1HKWA 4GVGA 1LL4A 4MJMA 1FKWA 1H5VA 4EX4A 5HPOA 3ZT6A 4WIWA 4OV9A 1XICA 3G1AA 3W2NA 2PWDA 4JFUA 2BVWA 1S3HA 3WLTA 4A8LA 3BV4A 5EGRA 2EPOA 3IV3A 3SN4A 2W3ZA 1XGEA 1JG9A 3GNDA 3ZMRA 2HXTA 1CZ1A 1EJUC 1BVWA 1NAL1 3WDJA 2OX4A 3BAYA 2Z25A 3CQ0A 2DVUA 1UKSA 4UCGA 5TF0A 4KBXA 1QO5A 2ISFA 1J4EA 3MUXA 2WNNA 5I24A 3RG6A 1JVNA 4NAEB 2CW6A 1K7FA 4O1CA 3R6IA 1C7TA 3PTMA 1IXPA 3DDMA 3DZ1A 2CKSA 4H19A 1NOFA 2ZA1A 3W7PA 3CUZA 1C92A 2CHOA 3V16A 3W7CA 1RPXA 3MMWA 3G77A 3GM8A 4H9XA 3CIWA 2ATMA 1MO0A 4KPLA 4GJIA 4A05A 1CXFA 1FHLA 1XX1A 4P7QA 4FR6A 2CITA 3FSTA 4OJYA 1FCQA 4ZZ9A 1A5SA 2Y2WA 3QMSA 2VCAA 3BJFA 3ARPA 1HL8A 1LWJA 1OD0A 3IK4A 4US5D 3AU6A 2BHUA 1V93A 4L1WA 1BVZA 4NASA 2DH3A 2QDDA 2DPEA 3QF0A 2XFRA 3MMTA 4L7ZA 4P5UA 1F3TA 1G0CA 1TPB1 4ZVJA 2E3ZA 2WBGA 3N6JA 1LQAA 4HZ8A 3E0VA 1IZJA 1ZENA 2WNQA 4MG4A 3CUXA 3IWPA 5T8GA 4O19A 4UBPC 1SO4A 3BLLA 1QR7A 4DYJA 4A3QA 3UNTA 5KZEA 3M0LA 3IRDA 4KWSA 4IGSA 1MDRA 1MRAA 3U5YA 2KAUC 4AD2A 1QPRA 4V33A 3KAOA 3MT1A 4NAFB 4DWSA 5CC3A 3AMGA 4BK9A 2YB4A 4GLEA 3ITLA 3Q4DA 4BF9A 3NPUA 4ZO8A 1SO5A 4K8GA 1W5MA 1C90A 5JH2A 1PKMA 4TX6A 1W37A 4KETA 1MYRA 1ZCOA 5K7JA 5EMUA 4EP8C 9CGTA 1LORA 4L6HA 3I3EA 5LXEA 5IBXC 3TN6A 4HPNA 1A3WA 1DYSA 1P6BA 4ORIA 3MP4A 2XDFA 4AEEA 4JEJA 3CT2A 2GJPA 1F61A 2X40A 3OHIA 1TWZA 3GBDA 4R53A 4HOWA 3MJMA 3IJQA 4DJEA 1M7JA 3HQNA 3IUHA 1KBLA 4UTHA 1B54A 3GVGA 3QFEA 3SI9A 4AMAA 1TPFA 5IDIA 4LYPA 2EGZA 3CTTA 3L4ZA 4KWOA 2PDBA 1TX0A 4XTDA 1ME7A 4JD4A 3UBPC 1A50A 4HU0A 1G67A 1GOXA 5JQ9A 1E6ZA 3TIMA 4A8IA 4GJJA 3LHWA 5CZSA 3HTWA 4D6CA 1GQNA 3W7KA 4I8YA 4WVXA 5E9XA 5G4WA 1J5SA 3NSXA 1NQ6A 3L21A 3LERA 4JN6A 4K6AA 4JKKA 5AHLA 1LJYA 3VK5A 1JGMA 3GKFA 4W7VA 3NA8A 3LCXA 1FDJA 2BB0A 2R1MA 4HKPA 2VDIA 1P5BA 1TJ1A 1R3VA 4RPPA 2YKKA 2DZUA 2QUVA 3PBVA 3VKDA 1TCDA 3RPDA 1IEIA 1FXQA 1YDOA 2NWRA 2C18A 4XWUA 4A4AA 1K8CA 1EHAA 2CU0A 4AVOA 3PK7A 2PC8A 1E4NA 4TVCA 3NVTA 3TVAA 4FOUA 4L61A 3SSJA 4F2TA 3IUIA 3EX3A 5GVJA 5BRPA 4EAYA 1AL8A 3CZEA 2GSHA 4UQBA 3S6OA 1Q4NX 1DJXA 3IVSA 1TO3A 4YTRA 2CBIA 3L23A 2YA0A 4GC4A 2D22A 3TJLA 4GABA 4B5TA 3RCYA 1DE5A 5LXXA 4Q6XA 2DIKA 2HK1A 5AYXA 1Q6OA 3P5ZA 1XSJA 2O9OA 3OTRA 3GD6A 3WEOA 5JU6A 1KQYA 1XG4A 1OGSA 2YW3A 3PF3A 4AD4A 1W8SA 2Z00A 3WNLA 1NF0A 3LHVA 4GE8A 1ME9A 3LM3A 5LSMA 1HKVA 3DHFA 1UWRA 2I5QA 4UTTC 1QW8A 3S5NA 4LYRA 2CEQA 4IQDA 1ISWA 2QMKA 1O60A 1ONXA 1HX0A 4H9TA 4ATDA 4DUOA 1UKPA 4S3DA 1XUUA 1YNQA 3HF3A 3PB0A 4XVEA 1XH1A 2XVLA 1GWJA 3K13A 3GY1A 3W7MA 4N0RA 5I6SA 1VPYA 5LNSA 4AF0B 2D69A 4IG2A 1TZ7A 3BICA 2O7QA 1Y0EA 2OLHA 1J0JA 5EPDA 2O55A 2RJHA 3U2CA 1W1VA 1RJQA 3WD4A 1UZ4A 3PPHA 4IOTA 2WJDA 2DQXA 2V30A 2VUNA 1B90A 1XGDA 3BGJA 2ZE0A 2QCHA 4C5YA 3QSTA 2OX1A 3F2CA 4P7OA 4RE3A 4I5UA 4O18A 1CGXA 5MHBA 1FWCC 5TAOA 1JPKA 1JIBA 4U10A 2EXOA 1CYGA 1E72M 3WL0A 1LL6A 2OELA 1BQCA 2POZA 2VR2A 3NJ3A 3PS7A 3LPOA 4CNTA 4DBDA 1EQCA 3VE7A 4RZ6A 2VFIA 3PZIA 1D3CA 1MUCA 1YXDA 3W74A 3VOCA 4E6MA 2CLHA 1HNYA 4MAZA 1S1PA 4MKNA 4LCQA 1AZ2A 2OSXA 3C52A 3QXBA 3TQ0A 1V03A 5CBBA 5J5DA 1QOQA 5LHFA 3P84A 2V3FA 2BASA 3QN3A 1PEZA 3RLGA 3PBMA 2JF7A 4K2SA 1ZZMA 4ZCWA 4I5RA 3CEUA 3WLIA 4KEMA 2XWEA 1TKKA 3IGUA 4QNWA 1XLLA 3AHYA 3OBEA 1KCLA 5D9MA 4C6NA 4M6PA 4HCHA 4QNEA 4ADSA 1O1ZA 3TW6A 4MNKA 3CO4A 1EFZA 4IPPA 2WSQA 3W1XA 2V6AA 4LAMA 3ZVIA 1CLKA 3TNBA 2IMRA 1OX4A 2CERA 1E6QM 1GVSA 4JY8A 4YL2A 4MWAD 4F66A 3NQCA 1A5AA 1SSGA 2F2KA 3QPEA 1PV8A 2VFHA 5BOFA 3V1HA 3ZFHA 4NZ3A 5F7UA 1V0NA 1YLVA 3QOKA 2JF6A 3GXPA 3B3DA 2WWDA 1VJZA 3VFLA 5D04C 3TSDA 4NJKA 3H21A 2VX5A 3V0TA 2QPUA 4J28A 4XG1A 1Z9AA 4G1KA 3UVAA 2G0WA 2E6YA 1FWGC 3S6TA 3RCNA 1QUMA 3AHTA 1NTHA 1WKDA 3OVQA 3V5OA 4I90A 3C6CA 3FYYA 4ZQNA 4M6VA 3TYDA 2BFGA 5HATA 1XIIA 1S2WA 1R0MA 4Z2KA 1EYEA 4IMGA 1GEQA 5A8MA 2Z1SA 1P6CA 3TYUA 2V3GA 2CBJA 4GNJA 4PTNA 5LNVA 1BWVA 3VZXA 1A3XA 3GK0A 2HE5A 2WAGA 1REQB 3EWDA 1OYCA 2YZ5A 4PTXA 1UH4A 3II1A 3CM4A 3K1GA 4PMXA 1JNEA 2YYTA 1F5ZA 1KNWA 3WK3A 3OA3A 5A1AA 1W9PA 2QJMA 4S38A 4IPJA 3C0QA 3B0YA 1KD0A 1TV7A 2OQHA 3FJLA 2H9AB 2QULA 5D2TA 5HANA 1EYWA 3GNPA 3GW0A 3QR0A 2AOSA 5H91A 1AJ0A 4P61A 5AYBA 5CSUA 1NOUA 3TV8A 4QX4A 1U5HA 3DFPA 3TWBA 3V5FA 4NZFA 3I65A 4CU8A 5I02A 4PTWA 4XX6A 2OQYA 3AXXA 3QHNA 3UWYA 2PDFA 2F2HA 3T0DA 1P1MA 4PH6A 1XLDA 2PB1A 3R8RA 3LCHA 4LS1A 3QV7A 3O63A 1ZJBA 5DT7A 4WY0A 2XTKA 2WMIB 4AG0A 3I7RA 3KTSA 4D8ZA 3ONCA 3W85A 3P2VA 3MWCA 3SUVA 1B3WA 3A64A 1CGVA 2ESCA 3QJAA 1PKLA 3B40A 2OSYA 4LPCA 3VMPA 4BF7A 3F7JA 2XSBA 4NYYA 4I5XA 3DG6A 3CUGA 1RCXB 3ZR4A 1KTBA 5AZ0A 1NSJA 7CGTA 4HSHA 1HKMA 3AS1A 3F03K 1JF6A 1EQPA 1OADA 1HQTA 4PMZA 3SO7A 4H6QA 3W2LA 3GHTA 2V38A 3OU8A 5EB8A 3ITOA 2J74A 3GDBA 4OZOA 3MUY1 1P0EA 4ASTA 2XVPA 4M51A 5REQB 4MADA 1ICQA 1AH3A 4IQEA 1PX4A 2B7PA 2YZRA 4ICMA 2Q09A 2CBUA 1NWUA 2BBFA 2QJJA 4MUZA 3DHUA 1UZ1A 1TTQA 2GYIA 1F6PA 2X16A 3FV9A 4EPDC 1AQ0A 3S3GA 4BR1A 1UCWA 4KCUA 4GK8A 2QV5A 2ZVRA 3KHJA 1MQQA 4WJEA 1QNQA 1X98A 3NZGA 2HDJA 3TZNA 1LBMA 2PD9A 4HOZA 1IEXA 4PCFA 3JZEA 3HA1A 3ZLHA 1OX6A 1EGMA 3TTOA 3WQ5A 3LHUA 1IXOA 1E0VA 5AC4A 1SU5A 1TWIA 3T6CA 4Q3MA 3EA1A 4A8NA 2H90A 4WDXA 5H8MA 3I7SA 1E51A 4XAFA 1XLJA 1FY6A 1SW7A 3MO7A 2PUZA 1TWWA 1ESWA 1H2JA 2JE8A 2Q01A 1V8EA 4LAKA 4LEFA 4PUJA 5DXXA 2B7QA 2QGYA 1JQVA 1EJWC 3C8NA 3AXMA 3W28A 2PTWA 1B5TA 5M3WA 5TNVA 3SQSA 3PJUA 1J0YA 2Z29A 4KWUA 1K70A 1KGWA 4C5ZA 1BFNA 4GIRA 4HPGA 4L6OA 5EBAA 4H8NA 2Y0FA 3NL5A 3GFZA 1LBLA 3JUGA 3RXZA 4LVFA 2QCCA 2Y7GA 1BGAA 4DF1A 3M0XA 4UUIA 2IW0A 4A3RA 3KLKA 1BTCA 3B8WA 4PMOA 2QF7A 2Q8LA 2ZKMX 1EUAA 2WMJA 2MUCA 4B2DD 3LI1A 1EDTA 1GYNA 4NG3A 3W3OA 1XJBA 3JS3A 4AAJA 3DFTA 3P82A 1TJRA 4X9SA 2VCBA 2PGWA 3TTQA 2W61A 2B31A 4LF2A 2P1FA 1BXCA 4XB3A 4ZENA 1GOWA 4C7FA 1T40A 2ZC8A 3LTSA 4GD0A 3OBAA 1UR0A 1AD4A 2BDQA 4WXYA 1T96A 1PWLA 3PPGA 3HM7A 1S2CA 3OA5A 4AHOA 1A0CA 2IQTA 1DIDA 1GOKA 2VFGA 3GU9A 3RNDA 4H41A 3RU6A 3AICA 2FHBA 4O14A 4GIYA 3NO3A 1K8ZA 2J9ZA 1SMDA 4KKXA 3U5UA 1ZAHA 4XAZA 2CZ5A 3PULA 4X60A 3NQBA 4MB1A 4PB4A 4NP7A 4JY9A 3VD9A 3THUA 3OVGA 1B3XA 1UR3M 1UP0A 3XISA 5EMKA 3PN8A 4RZ5A 2J7EA 3TXZA 3EX1A 4NZ1A 3W1LA 1C29A 4HA4A 1V7YA 4JX6A 1A5KC 2QDEA 3CL6A 3SW6A 5A94A 1V3MA 3APYA 3LQLA 3ZZ1A 4RDWA 4QAWA 3F2BA 3LOTA 4LCSA 1E71M 3CWNA 3WLJA 2PODA 1ITUA 2A5HA 1BSIA 1UQYA 3N9KA 3AMKA 3GSMA 5C7HA 3E6EA 4PE8A 1GJPA 4AC7C 1KXTA 4PODA 3ANVA 3BGAA 5AC5A 4FXRA 4A21A 1Q8AA 2PDUA 4ILSA 5HMEA 4IHCA 4A29A 4OE7A 3KDOA 2ZUVA 1AMKA 3F4CA 5CPLA 3DYMA 2V5JA 1VH7A 3O1NA 4IFKA 4Z2LA 3I6RA 4P8VA 3BZJA 5IM51 1TWSA 3LENA 3SRHA 2INZA 2G41A 1S5WA 3EB4A 4CVUA 2I5GA 3W7OA 5TD4A 1R3TA 2C16A 3EXTA 1RP8A 5AHMA 4AISA 4C6FA 3C0LA 3MMUA 4JTJA 2A4AA 3GTFA 2QZRA 3GG0A 1JZ8A 2ZICA 1AL7A 3V5CA 4HN4A 2C19A 3HPAA 2D2GA 2E7FA 5FF7A 3VTRA 3N25A 5D2WA 3LX9A 3GNRA 1BD0A 1QHZA 4O1DA 1WAUA 3EA2A 1JCNA 2PZ0A 3LGDA 1EP3A 2FTYA 4XK2A 4UWMA 4PCTA 2YCJA 1FP9A 3RK8A 5T91A 3KWSA 1DWJM 1PS9A 3L5MA 4K7VA 3PUOA 3NQDA 3SUSA 3GAYA 3REQA 1JI2A 3U9IA 2PAJA 2DT3A 3VYLA 3AC0A 2OGYA 1H0GA 1R9XA 3NXFA 3U2EA 1FA2A 3RRAA 2HSAA 4QFUA 4EPEC 3APTA 5HWMA 3SEPA 5CJ5A 3CHCA 3B03A 4H9VA 2CXGA 4JNYA 5BROA 2G3IA 3FX4A 3PWIA 3PB2A 4BQ2A 1DL3A 3GUGA 3N15A 1W3LA 4NHVA 4YHGA 1WYIA 1E0UA 1FWEC 5IDZA 5G1MA 4DWSC 4RXFA 3ITCA 1OZQA 3PAOA 1NF7A 3IIOA 2WK2A 2OEMA 3M16A 1SW0A 4GQQA 4Y9MA 3TN4A 1C8QA 1HJUA 1P7TB 3CYJA 4V2XA 1W5NA 2YA1A 1DJGA 3CUFA 3T4WA 3SCSA 2Z1BA 3VNKA 2X2YA 2JEPA 3RCMA 3VDCA 4K1GA 2A3LA 4C65A 3TWAA 3M0IA 3SCPA 4M56A 3TCEA 3N12A 2XIMA 4GYPC 1UP3A 3P6LA 5ECUA 4I3GA 2TSYA 3DCPA 3IACA 1UBSA 4L9ZA 4RV3A 5A2BA 4YWSA 4LCRA 3I6TA 5GPRA 4DM2A 3N13A 4H9MA 3B0XA 3SDOA 2X09A 1NARA 2PZNA 4C60A 5D8ZA 3FGCA 3DENA 2XN1A 4E4PA 4JQ4A 2PDLA 2EPMX 1YNYA 3LLXA 3KZSA 2DSZA 3E0LA 1QI3A 3C8FA 3DIPA 4G7EA 2ZRZA 2YCEA 1MDLA 2PBGA 1SYTA 1XIEA 5BWFA 5HQEA 3WD3A 3MYOA 3AQUA 1HJVA 4G56A 1H41A 4M29A 5CSSA 2C1IA 2BGNE 1IGSA 2I5IA 3WQEA 3ECQA 3ALGA 2G96A 1WOAA 2Q8ZA 2EG6A 3GB6A 3LYEA 3WENA 1C91A 2WMHA 4PUNA 3SCNA 5CPTA 4C1NB 3AYRA 5KINA 3N11A 3G6LA 4GZJA 3EA3A 2VEPA 2Y5EA 5F4WA 3AAMA 1V77A 5AHNA 2XFWA 1XYZA 2V82A 2P0OA 2VEIA 3N29A 1F6KA 3WJYA 4CN4A 4PSRA 2YOCA 3RX3A 5A95A 4P8XA 3VD7A 4LT9A 3W87A 3GXMA 3WNKA 3OG2A 2PTYA 5D2VA 1R87A 1QHPA 1LTDA 2AMXA 3UJEA 3W1TA 5H1WA 3H7UA 1C8VA 1HKIA 2WMFA 3UCQA 1DWIM 5A8QA 4YU1A 1AQFA 1BRLA 1OF8A 1XYMA 3W0KA 3OB8A 4FLOA 4E2DA 4IXXA 1A5BA 3OO2A 3VCRA 4AQLA 2O7SA 1SVDA 1LL7A 1PHQA 1E6SM 1XLHA 1BWKA 3ARWA 4LBRA 3KCJA 4CNNA 4ZQCA 1M5WA 4HPJA 2WVUA 1XQKA 4JHMA 1VCGA 4G8TA 4DLFA 1TRDA 2HBVA 2W0UA 2HS8A 5AKQA 1TUXA 3MKKA 1FH9A 4JTKA 1W91A 3GNOA 1N55A 3ARZA 4RE2A 2YDSA 2BHZA 2E5DA 2R91A 3BSMA 3I3BA 1EB3A 3PZQA 4Q4MA 3EBVA 4HNOA 2GGHA 3DERA 4ROQA 2VEMA 2XWDA 1GVRA 2W63A 1KM2A 3K1DA 2ZYFA 3P5YA 5E0CA 2J13A 3GIYA 3B4UA 2J27A 1IT7A 3ITYA 3B4YA 4GKLA 4J27A 3KVMA 3L5AA 3BC9A 4X9YA 5G4HC 4QP0A 3VI2A 2ISVA 3C5QA 4PEEA 4H7VA 4QS6A 3PG8A 3SUUA 1XCWA 2IS7A 1FWFC 1ZBVA 4KEVA 1X6NA 1F8MA 4WEVX 4IWWA 4JKLA 3PTQA 1HTIA 4DBUA 2QAFA 2H8ZA 1BYBA 2DSVA 4U2ZA 2YXOA 3EWYA 9RUBA 2JGQA 1W17A 2YX0A 1OWQA 2P8CA 3KWXA 4E38A 3QPYA 4E4FA 3NCOA 3THCA 2VELA 1JCMP 2Z0IA 2E77A 1EA0A 4XUGA 2GOKA 3V18A 1LT7A 4WDWA 3P81A 4JIIX 1JCYA 3C2YA 2Q8XA 2O56A 1E6PA 3TAOA 4EVZA 3OVRA 5CPMA 1TPUA 3IANA 3MA8A 3VILA 4HPHA 3Q94A 3A4XA 3GE7A 4RL3A 1XBXA 1KM1A 4OQVA 1Q6RA 1DEDA 3TQVA 5FF4A 3R79A 3HMJG 4B3KA 2BG5A 2VUYA 1R46A 3AMLA 2OKTA 1CXLA 2ZQ0A 1DKWA 1FH7A 2J7FA 1P48A 3CK5A 3XIMA 5JXQA 3GAKA 5BCAA 4U31A 4RDVA 1D3GA 3OVPA 4GUGA 3RX2A 3DAQA 3UEQA 5U4NA 3M07A 1BWLA 1GPFA 4BY3A 4EF8A 2ZXDA 2XU2A 1AW1A 4MZYA 3XINA 2XHYA 3DN5A 3QLLA 3W84A 3WDHA 5L9FA 3NM3A 1BF6A 3H12A 5EA9A 3WJXA 1QPOA 3BGGA 1A0DA 1O4UA 4UC5A 4V27A 1ZBWA 3A13A 4PRTA 3GTXA 1TX2A 3L12A 4JS3A 3KM8A 4EAMA 1Z41A 2V8ZA 1POKA 1DORA 3D3FA 1Q6FA 3MMDA 4A6GA 4N02A 2VZTA 1P0NA 1GVOA 4FX7A 3TQKA 2V5DA 1E70M 2WHJA 4WY0F 1XYAA 1CGTA 5E0KA 3VNYA 4Z42C 3CAVA 4LF1A 1YNPA 3FHAA 2H3DA 2PDPA 3GR4A 1Y5VA 2QMJA 2QUMA 1POJA 2YXXA 2A3HA 4US6A 3GRIA 1QBAA 3EDKA 4L9XA 4MLRA 1FWNA 3SECA 3BMXA 3H23A 4QLKA 4AIUA 2Z7KA 3M7SA 2DZXA 3IJ7A 1M01A 2PDQA 3U0HA 4AZHA 2GL5A 1I9CB 1Z42A 1GYMA 1V0MA 2BOEX 2C15A 3GC5A 2B7NA 1VFLA 4RE4A 1FHDA 3S1GA 3NQVA 4DLMA 5FA5A 1YIXA 3VZYA 1FWDC 1HO4A 5E70A 4ZO7A 1QNOA 1ZJAA 4LS2A 4I9JA 4F2UA 4JTEA 4RNHA 3CHVA 2QPSA 5EMYA 4GIEA 4KW2A 2PDKA 1U83A 3AYSA 1AQHA 2NLYA 4B9ZA 2RJGA 1WKFA 1TJ2A 3KBJA 1HG3A 2YBUA 4I6VA 5XIAA 1OYBA 3UWQA 4HCLA 1JYWA 3UR8A 2VDGA 4GGBA 1DIEA 3E2QA 4WK9A 3VD3A 4J9JA 2VX4A 3WF1A 1M7PA 3QR3A 2J88A 3BH4A 3A5FA 4YTSA 3TXVA 1UR1A 3CMJA 1FWWA 2BX7A 2ISDA 2C1HA 1BYCA 3USZA 1PTDA 3G22A 3N6HA 2V63A 4YCOA 4LB4A 2C1GA 1EIBA 2D23A 4FLQA 1ODZA 4MM1A 3F4VA 2WZHA 4M1RA 3SCVA 1TMLA 1GONA 4HA1A 4QIUA 4CLMA 2P76A 2NW0A 1PIGA 1PWMA 2WCAA 5FEWA 3EOLA 5CPOA 2TMDA 3DX5A 1J18A 3QRHA 1QNVA 1QWKA 1XBYA 4LC6A 3CMGA 2E1DA 4GQBA 3R8GA 4PUMA 3R1ZA 3W75A 1X6UA 2NXIA 5A6AA 2NX3A 4DI8A 1XPGA 3WJWA 4KEUA 1CBGA 4KH2A 3NZRA 1YBQA 5D37A 2NQJA 4W89A 1XISA 1A0EA 1JQXA 2CWNA 3SGGA 4XZWA 4PCNA 1MUMA 2WHMA 3VIMA 2PGRA 6PTDA 4R27A 4DY1A 3GH5A 3Q45A 1JZ5A 2E6FA 1TREA 2HS6A 2WVSA 3RM9A 2Z24A 1W32A 4HYWA 2W66A 3VGGA 4AY1A 5FAGA 2GUUA 3PTKA 1HF6A 3P7YA 1RD5A 4N9BA 2PWVA 1UH3A 4IF2A 1JZ6A 3VKBA 3UG3A 4X3ZA 2P50A 3AJXA 3DFYA 3NIYA 1IR2A 4LUSA 3S4TA 3G0XA 2GUBA 5A6SA 1XLBA 1FQ0A 4C6BA 5E0FA 3P93A 2VFEA 3VGBA 2EPLX 4EXQA 4MJZA 3ANYA 3DGRA 3OJGA 2PDJA 3EWCA 1TR1A 2AGKA 3N04A 4UTIA 4IT1A 3WMCA 2XIJA 1Q66A 3E5PA 5FEXA 3ZJKA 5CC7A 3KVJA 1TPH1 3EMZA 4K37A 4LVGA 1KXVA 3LV6A 4IIBA 3V35A 1W3IA 4LH8A 3BPWA 1RP9A 2PDXA 3VOGA 5G2IA 4G1NA 2HWGA 3W2MA 2A85A 1H49A 3OZMA 4US5A 3W4RA 3HJZA 4K39A 5DF0A 3E0IA 4FLRA 2HISA 1FUYA 3AS0A 3BW4A 1K9DA 1U1JA 1E15A 4MKSA 4S1FA 2BVDA 2JKAA 3LA4A 1R2TA 1ZJHA 5BXSA 1QO2A 4EWJA 1J5TA 1GG0A 3CWOX 3NQAA 3HJEA 4U5IA 3G1XA 1F07A 3N4EA 3DFOA 2YPIA 4U33A 3TYBA 3LU2A 1PZ2A 4NXSA 1SZFA 1WXZA 3DHPA 2PP1A 1WDWA 4Q4SA 1W31A 5DO8A 3KL3A 4M7TA 1R3QA 1FWIC 3WJZA 1IT0A 1Y7VA 4W93A 3UR2A 4KCTA 3LCLA 5HQLA 2PRLA 1J6OA 5DEZA 4CCCA 4S39A 5DMNA 2GVLA 3L2MA 1N8IA 4UFMA 2GDVA 3ID7A 3DI0A 5CZKA 4BJHA 4LX4A 4HHPA 1JUKA 1NEYA 1EWDA 4HHLA 4EK7A 3AZRA 3AFBA 2GZXA 4ERIA 4E4UA 2EKGA 2QJNA 3SAZA 1VKFA 3CBWA 2F6XA 2GDUA 3WQVA 1MVYA 2A6LA 3E9AA 3USBA 1MZRA 1CWYA 4Y90A 4FF5A 4GA8A 3BTNA 3W7QA 2YDQA 4XD3A 2PWEA 2WV8A 4WOZA 4J4KA 2D2JA 3I68A 3PBYA 4HN8A 1VJIA 2CLMA 3PWGA 3U3HA 2CLKA 3RX4A 1Q2SA 1VBHA 2PS2A 3VXGA 1XRTA 1MNSA 3L4WA 3LRKA 4H7CA 1WB0A 4Q4PA 3PNZA 2WQDA 4NI8A 2X1UA 3ARUA 4I7VA 4NZ4A 3WEMA 1H63A 4XV0A 1BTMA 1UWSA 2V2CA 3LBCA 3PP7A 4ZR8A 1PB0A 1IYXA 1CI1A 3CAQA 2V81A 3TROA 3NQ7A 2XIOA 3D5HA 3HBLA 1KW1A 4NUWA 1P7TA 3T78A 1K6AA 1LT8A 1WUFA 1XLIA 1PX8A 5ABTA 4IMEA 4PFMA 5K9DA 4AY7A 1EZWA 2X7VA 4CQ8A 2RDXA 1H50A 3T4CA 3WL1A 4IICA 3CZKA 1CIUA 2PDMA 3NQ2A 2J6VA 4BQ3A 3UG8A 3U7VA 5HNRA 1C93A 4DJFD 4JDYA 4AZIA 1HXJA 3VNDA 2AL2A 1KM4A 3M5YA 4CN1A 3D0CA 2CWXA 2HPMA 1OCBA 1HW6A 1YE4A 4FA3A 2FZMA 1NOWA 2PBOA 4HYVA 4IL2A 4FS9A 5E1QA 3GIQA 3UXIA 4AZBA 1I4NA 1O5KA 3GG8A 5ABFA 1XFBA 4KFOA 4LGXA 1E4MM 2XZ7A 3KOZA 5GNZA 1S1RA 2OYMA 2A7NA 1NFPA 1DOSA 3LNMA 2QCGA 4Z1CA 3VINA 5JBDA 2XZ9A 1Q45A 4IMFA 4PUDA 5LHEA 3KTCA 4PL2A 3NSMA 4X0NA 3V0SA 3GDMA 4C6DA 1TJ0A 4ATLA 1BGGA 3THAA 2CIPA 3C3UA 3VOHA 3RITA 2RDWA 4U28A 2ADAA 4UQEA 3BLKA 3NQEA 4HBKA 4KIEA 1OZMA 3BJSA 3A3XA 3WMBA 4UMAA 4LC8A 4L1GA 1SZNA 4MB4A 3RR1A 3WQOA 4RKAA 4RXGA 4D6DA 3LCFA 4IISA 3TYEA 3LUTA 4W8LA 4GZEA 1U5VA 4F40A 4C6JA 5B80A 3UW6A 2ALDA 3HN3A 4J3WA 4YVXA 5AOUA 2DUAA 3AMCA 4GBDA 1VRDA 1LDCA 6A3HA 5CZ0A 3C0SA 3GTHA 3KUMA 4V15A 3NZPA 4V1XA 5I3GA 1EL3A 2NVAA 1XDJA 4Z2HA 3FA3A 1U2YA 1TUFA 2D24A 1W9UA 1ZHAA 3ZSSA 2J47A 3UP8A 3WDRA 5G4EA 3VIIA 1WZMA 3GC2A 2G97A 4GG9A 4QE4A 1W0MA 4W7UA 9XIMA 4KRZA 3DFNA 3VX0A 1IR1A 4NL1A 1HL2A 3S5OA 3A3HA 2NZLA 1TR9A 4H8VA 3RMEA 4IL0A 3WQWA 3GVVA 3LZ3A 5C54A 4GJ1A 1EX5A 3T0TA 2DVTA 3L0GA 3HG2A 3ZWTA 3NPWA 1ADOA 3OYXA 3W27A 3WN6A 2YR1A 1XFCA 4MFDA 3OQ8A 1YADA 3WF0A 3HO8A 3TR9A 2VEFA 4DO6A 4I8DA 2Q3OA 1G1YA 4S3FA 3UZYA 2WBKA 3COTA 4Z2JA 3LRMA 3KHDA 3ORWA 5HAOA 4BF5A 1JPDX 1RK6A 2E9LA 2ZUSA 3QKZA 1GYLA 3CL7A 4QGCA 3LCIA 1R3SA 1TPC1 2OWCA 3FK4A 3WQ8A 2Q6ZA 3WLKX 4D6EA 4WKHA 3PHAA 1WX0A 2VTFA 1UROA 1CGWA 2DZTA 5IFPA 2G4FA 2UZ9A 1SFSA 1W5QA 4GRSA 3CHFA 1NP0A 3KCLA 1KB3A 1SFJA 1XLFA 3R0UA 1MW1A 3PSVA 1S39A 2EHHA 3EDJA 1SM9A 5LYRA 2WLZA 2O4MA 2OFJA 1H60A 4Q4RA 1JCLA 3MANA 4QM1A 1E9YB 1UH2A 3AYVA 3DGBA 2G3NA 1I2NA 1FOBA 5CG7A 4HQVA 4ONVA 1HP4A 3UG4A 3A5VA 4O57A 2F8QA 1K4GA 3HGSA 2GFTA 3DOPA 2VCCA 3T40A 1ZB5A 2SFPA 3F5LA 4CCZA 3WQPA 3LQGA 3ABSA 2AL1A 3N2BA 3BAWA 4W9TA 3IIXA 1KBIA 1TCMA 1Z6KA 1TIWA 1JYVA 1QASA 3MTWA 1X1NA 2VT0A 3BQ6A 3NURA 3H8AA 1FWAC 2X1IA 2I9EA 4AWEA 3TMLA 2VEKA 4EPBC 1GKQA 4Z17A 1RH9A 4UB9A 4ZO9A 3VDHA 3R58A 3W38A 1IGWA 4UR9A 1OYAA 4O13A 3CAKA 1G7VA 7A3HA 2ZVIA 4Q8MA 1M68A 1UYQA 3W07A 1A4MA 4X2PA 2YXGA 2Y8UA 1WP6A 3L5LA 4MVAA 5HUPA 4J3VA 1EO7A 4YYFA 3SBFA 2JK2A 3VNJA 4AWTA 2FGZA 3VGFA 4JTTA 3KBNA 1SW3A 3L66A 1ELSA 3NPVA 4AIBA 5SWUA 3UZWA 3QHMA 2FIQA 4DN1A 3SCRA 1E6RA 2WSPA 3MVIA 1JUEA 2JKPA 4HHHA 1W2PA 4CVWA 2QCEA 3TCSA 4K68A 3WCZA 2V69A 2XPKA 1QMLA 4TV6A 4ACZB 4L9YA 1I60A 3UVIA 1X8FA 3LDVA 4JTDA 2YGYA 3MB9A 4OFCA 1VB9A 4YPJA 1AD1A 2F6KA 4O52A 4OKDA 3HQPA 3NGFA 3H6OA 2ZC1A 3BAIA 3C56A 5F1VA 1OX4B 5DMMA 3BSHA 4O10A 4C6KA 1EEPA 4GYKA 4D71A 3HOJA 4XBJA 3W2UA 4NSBA 3R94A 4DAIA 2DZBA 4JGDA 1K7EA 3HQ1A 4NAEA 1RUSA 2BZNA 5BOEA 1E55A 1YDYA 2F6UA 1ECQA 2R6OA 2TODA 2G4JA 8XIAA 2OZ0A 3WF3A 1V02A 4HTYA 4Z08A 2YSWA 4NYUA 3U4FA 4YMZA 1DJNA 4C90A 3UWEA 4ZBCA 3I6EA 2EF9A 3TW7A 1V6VA 3ABQA 1JYNA 3VD5A 3PC0A 3RDKA 4P7LA 5JBFA 2FDMA 1WZAA 2ZX6A 3WBWA 3QEZA 5AZ1A 4D6GA 2W4XA 3M0KA 4NXKA 2YDAA 1L9WA 4JTLA 3C2OA 2FPYA 4EKJA 3BLFA 1EJTC 2PLKA 3E3HA 1E73M 4BEQA 4QCEA 2IQ0A 5HPCA 3L4YA 1JDFA 4ZB0A 1XI3A 1CW2A 4R9XA 2EG7A 2VURA 2VL4A 3CYVA 3LXCA 5C9RA 3OLDA 2XH0A 1XLEA 2AKZA 3UZJA 1V3LA 2PLCA 1UWUA 3C0JA 4YWIA 3EX4A 1A80A 1DV7A 3STGA 2EG8A 4BS0A 3I7QA 6TIMA 5HNTA 2GVJA 1DXFA 3N1AA 2IPJA 2A2IA 2Y63A 4ZA0A 4AZCA 1GK8A 2R1NA 5AB3A 2YCLA 4GVFA 2I1OA 4OBRA 4PN2A 3INPA 4Y9NA 2WMKA 3R0DA 1VP5A 2OLSA 4IG2B 2CXEA 2Z27A 3KOYA 4ML4A 4OTKA 3THQA 3OW1A 1EC9A 4CD7A 4L6DA 4KMQA 1KTNA 4HYRA 4TMCA 2R9RA 1PYMA 5D33A 4H8HA 1GZJA 1UD8A 1O7AA 1ZGDA 5U7SA 4C7GA 2XG9A 3GR7A 4IFKB 1S3TC 3FLUA 4FNQA 1EUNA 4XTIA 1ZBCA 2AKMA 3HPXA 1UIPA 4Q8QA 1RCQA 1P0DA 1W8GA 4FX8A 5FJUA 3QQWA 4A2SA 3H4WA 4JIHA 3WH6A 1J11A 1OFQA 4DQWA 1G5AA 3KL0A 1EPVA 1LG1A 3UWVA 3LEPA 3MP3A 4O0ZA 1G4EA 1EHNA 4DXVA 2VDHA 1OK4A 2DUZA 4FK9A 4JKMA 3TFCA 2B81A 4YIWA 4LEQA 2IKHA 2VD9A 1ME8A 4H3DA 1VR6A 3LD5A 1OC5A 2WWCA 2YFNA 1H4PA 2ZZ4A 4XZLX 4HK7A 2PRHA 5DT5A 2G37A 2I9UA 3W26A 1P4CA 5BRQA 2E09A 4RK8A 1G94A 3M9YA 4UQCA 2DGAA 3CL8A 5I06A 3S1UA 3NZQA 3SUTA 1PDYA 4DAFA 2BS9A 3PWAA 3WQDA 4JN7A 4DJDC 3FNDA 2GGGA 3UETA 2V5CA 2GK1A 1UOKA 2QJGA 4GCXA 2GJXA 1C9DA 4C1LA 2V67A 3DG7A 2QUTA 4W88A 4WOQA 2J7GA 3TH6A 1UMYA 2RDUA 5GNYA 3VX1A 4C6EA 4I7WA 2V0TA 1RJRA 3ABOA 2J7CA 1XRSA 1YPXA 2CESA 1THFD 4NRRA 4HNTA 4QJ1A 4L4LA 3CJPA 1LRNA 4LNYA 2CZDA 2OKOA 2A3CA 3ZVHB 3QV9A 2NQHA 1MFVA 4B5VA 1LYXA 2R24A 3QY7A 4YHEA 3CC1A 2QV4A 3ITGA 3VKAA 3TTYA 3W7GA 1L2UA 4MKVA 2D20A 3NDYA 4UR8A 4AFYA 4ZOAA 3PFRA 1XKJA 4JHOA 3N73A 5H8PA 4HNLA 2AMGA 4WF7A 3DFQA 2ASHA 2BWGA 4GOAA 2PDIA 4KERA 4CEUC 1ALDA 4GY1A 3V1PA 1WQ5A 5DRIA 2J6XA 5FACA 4IFRA 3IK2A 1PE1A 2JFEX 2PDNA 4O1BA 2NUYA 3G3DA 3UR7A 1W2VA 4IX0A 5ABFB 1VPQA 4F0RA 2WMIA 4NX0A 2OODA 4JFVA 3PZ9A 3T42A 5C71A 5DELA 3CQHA 1W5OA 2IKJA 4HA3A 2ZRUA 3A22A 2OO0A 3M0YA 4FNTA 1AW2A 1RY0A 1XIBA 3EB2A 1RA5A 4O8RA 3NYZA 1WDQA 1D9EA 2PP0A 3DUGA 4O17A 4PR4A 3SQLA 1Q6CA 4GNKB 2OYKA 5FL1A 3WDPP 3V3WA 4D1JA 1F76A 8TIMA 3QY6A 1UR9A 3TYCA 5I07A 4BQ4A 3BCJA 4RDZA 3EPMA 5C2XA 3W6YA 2FGLA 4Y9PA 3E2RA 3AXIA 2ZBTA 3B9NA 2VI0A 4PSPA 4JHZA 3WBAA 3BLIA 1TRIA 3IJIA 1AODA 3LB0A 4WCJA 3UPBA 2XVNA 2VRJA 1E3ZA 3ES7A 2ACUA 4DRSA 1LWIA 1OG6A 3KXQA 2YIHA 3MDUA 3NNTA 3N3MA 4IJRA 4YTUA 4HK5A 3QV6A 3WUEA 4I9TA 2PLJA 4D9PA 5DY2A 2NX1A 4A2RA 1KFCA 1LM1A 3H4GA 2CC0A 2P8BA 1EBHA 1G9HA 2A1YA 3QFWA 4RPQA 1A4LA 3FY1A 1KGUA 3W00A 2BV9A 1L6SA 2RH9A 4ZE4A 4PL1A 4PTDA 3T07A 1R38A 5CQ1A 5D09A 3IIZA 3BANA 2XN2A 3BOFA 1J79A 2DEPA 3WD0A 5GQBA 5BRBA 1Z69A 3MSDA 3F4DA 3EMCA 3GG1A 1IHIA 1EDQA 3R11A 1FWTA 8CGTA 2XM2A 4NJJA 2RGLA 2DJXA 1XLAA 4HSOA 2V3DA 4CU7A 4FP1A 4OOZA 3GZ3A 4IIEA 3WBYA 5FJTA 1E56A 4MTVA 3S47A 1K8XA 1V3JA 1FWHC 1F4HA 2FH6A 3SUWA 4UTJA 4EOUA 7ENLA 1SJAA 3WIJA 4DPPA 8A3HA 2J4GA 3LLDA 5DMYA 1FHVA 2GWNA 3IPWA 1CXEA 2Y7DA 3Q2DA 4M80A 1I1WA 3Q58A 3FEQA 5EU9A 2E4TA 4L80A 3WQ4A 2XINA 4RW5A 4QG9A 3N9RA 1K02A 2Y8KA 4H8UA 1JUBA 2BY0A 3APGA 1WOBA 2FFIA 4JTGA 4LYQA 4HK6A 4HMNA 5HUOA 1CGYA 2FHFA 1RXOB 3M44A 2BNJA 5BZAA 3AZTA 3PNUA 3GU1A 5FKYA 5C9UA 3W6LA 2X2GA 1Q85A 4AHPA 2ZWZA 5LKYA 2E8ZA 4D6FA 3ZVHA 1RA0A 2DZPA 3NEVA 3SGUA 3SN1A 1YXCA 3MW7A 1DIOA 5FF3A 2ZUNA 4TVUA 2ZRXA 4PMNA 2QCDA 2RGMA 3VIKA 4UTUA 2PE4A 1W3NA 2CLIA 3NOYA 2Y7FA 5A69A 4JICA 4JOMA 3C4UA 2FZ8A 2HE8A 2PC4A 4WD0A 3W53A 4LANA 3W1AA 3O06A 1F6YA 4FXFA 4DJFA 1JGIA 3SY8A 4DX3A 4IP7A 4Z0SA 6XIAA 2PCQA 4NJHA 1L8NA 1T6MA 1T99A 3N18A 1F8IA 1WXJA 4PGLA 2WZMA 4LSBA 4DO5A 2B4GA 3VPLA 1TV4A 5JUVA 5K4ZA 5LGZA 1ISYA 4LS0A 1VFMA 1J6PA 4IGHA 1VYPX 3QHOA 1OFOA 3SFKA 3VGHA 5D4YA 4C1NA 5AYYA 4QSFA 4E3TA 1QOXA 3C2EA 5AYZA 3VCCA 3MCMA 4IGNA 3B05A 4AXNA 1J0HA 4JR5A 1G7UA 3T08A 1ITXA 1NWRA 3RYSA 3PR2A 2ODOA 2FMNA 3T0AA 4ERAA 3RAOA 4UTWC 5KZMA 4DYEA 5JVLA 5FESA 3GXDA 3CLMA 2W92A 3VM5A 5DCBA 1V0LA 4WKAA 1W9VA 3LXBA 3EGJA 3U2OA 3TQPA 1XIGA 5HNUA 1T5AA 3GH7A 4TX8A 3G1FA 4H6EA 1XLKA 1YTDA 4UQDA 1DJIA 4N6FA 1EXBA 1XS2A 4XBKA 3WLNA 4NNBA 5BMWA 2CHNA 1I2PA 5A8GA 5FF2A 3NQ8A 4XKYA 3S1XA 1KM0A 2E25A 3VOIA 2ANUA 1SZRA 3RRXA 3HPZA 3RIKA 4XZ9A 2HEJA 4IZGA 3QC0A 1MMFA 1SGJA 1FBAA 5FOOA 2HROA 1QPKA 3REQB 5CLWA 1UD5A 3STPA 3LGEA 1IIHA 1G4TA 4PMQA 4Z1AA 4FLSA 4XZHA 1BG9A 1VCVA 4JIQA 1VRXA 2HVOA 2AAMA 1ECEA 2IXUA 1EP1A 1OBAA 4AX6A 2YA2A 4ROPA 3T0BA 4XO6A 4YTTA 1K9EA 1VIZA 4ENLA 3HGOA 4W86A 5IOBA 5HBFA 5RUBA 3R43A 3UWZA 1X1OA 1OY0A 5LNWA 1H51A 5D9OA 3WLMA 3BVJA 4MY1A 2E28A 2W6RA 5E6ZA 4CQAA 3TMQA 4F48A 4OECA 3B0PA 1PZ3A 4Y9OA 4FIRA 2OWWA 1Q6DA 1I8JA 5ENLA 3N2OA 2PDGA 4QLLA 1RBAA 3T55A 3FFSA 4JYFA 4J5NA 2J79A 2G3MA 3PZTA 2X30A 3WLRA 3SIZA 2ZZ5A 1OC7A 4TMBA 1KCXA 4BI5A 4GHRA 1CXIA 3SZ8A 3AIWA 4DBSA 2OGJA 1I6NA 4IIDA 3OZOA 1ZCCA 1MQRA 1IEQA 1J2WA 1VF8A 1OF6A 2OEJA 4LUYA 4KWWA 1CX9A 1UJPA 5D30A 5FJPA 1P0KA 1GKPA 1K9TA 2GVEA 3P8IA 3B9DA 4UTWA 3WX7A 1J93A 1FKXA 3OIXA 1QBBA 3EDEA 3W7LA 3NR0A 3ZOAA 4MWAC 4Q4KA 1BYDA 5F4XA 3FXYA 4HNUA 4NX5A 4XSLA 1GQIA 3VC5A 3CT7A 3M46A 4TTGA 3AOFA 5BW6A 3SJ3A 4HHMA 3KBWA 2DSWA 2QVHA 5I00A 2ZXBA 1KBJA 4MPQA 3MO4A 3YPIA 3WFAA 1UW9A 3N17A 2VRKA 1OG0A 3VGDA 1LWHA 5C7VA 3GHSA 1VFOA 3ITTA 2VKZG 3MU7A 3EYPA 1UA3A 1UR8A 1GQKA 4GI8A 3W7NA 5XIMA 3ABRA 4NRSA 1JZ3A 4JDBA 1BXNA 1DQXA 4ZO6A 3FDKA 4F8XA 1U22A 1H7RA 1Q63A 3DBNA 2NV2A 2PI6A 2H8XA 1E1FA 3E49A 3FXGA 3IARA 2NX9A 2RDTA 2O9PA 3VDBA 3GNXA 4X61A 1QI4A 3KVKA 1E9LA 3H2OA 1B0IA 3MHFA 1JI1A 2CFFA 1UPMB 5I78A 4MZ8A 4N9DA 2D0FA 4XZBA 3G1SA 4OWGA 3A4WA 3W82A 2NQZA 1HZYA 2FB2A 3GLCA 4ZMGA 3GTNA 5A6JA 4D6JA 3NWRA 1YYAA 1DWHM 2VVNA 3NDOA 1UOZA 3W76A 2GSJA 1NU5A 2CETA 2WCGA 3GO2A 3FIGA 3PZGA 1YPFA 1M1BA 3N2MA 3VUSA 2I7GA 1ZFJA 2GQ9A 2PLMA 4W4QA 1VFTA 4AEFA 1Y5XA 3MP5A 1OFDA 3W23A 4INFA 3U57A 4A8RA 2BMBA 1QI0A 1Q7QA 2P3ZA 3WBXA 1MNZA 3WKZA 4ADTA 3ITVA 2PF0A 2A21A 1UWAA 1Q7ZA 1V6UA 3LM7A 2QCLA 1VBGA 1MWOA 1XHGA 1EEXA 3JZUA 4QQUA 4LW7A 1UUMA 2YL9A 2RAGA 2XSAA 4JTQA 1CEOA 3AS3A 6ENLA 1Z32X 1X8CA 3W9ZA 3ZLFA 4FXJA 2O4QA 3ARXA 1M53A 4MB3A 2CHRA 2OZ3A 2P53A 2NVCA 3WZ0E 3TJ4A 1G01A 3E74A 3MSRA 3O7UA 4GFIA 3K4WA 4XVDA 1YDNA 4M0XA 3QH2A 4RNJA 1RJPA 4B3ZA 5LNRA 4CQDA 1GOMA 1MRQA 4LQ1A 4UFJA 1P1XA 2NWSA 4D72A 4UNIA 3PZNA 5J5RA 1HT6A 3B9AA 1X1ZA 4F3HA 1NIUA 3A24A 1VFFA 2FJUB 2DT1A 3IJLA 3P62A 1M04A 3MUAA 1BYAA 3M0HA 2Y7EA 4AH7A 3VA8A 3TA6A 4QG6A 3O05A 4ZODA 1H09A 3LV5A 2PMQA 3EKLA 3OP2A 3LNPA 1ZNNA 3TLLA 4ZSTA 1GPWA 3HG5A 1QPQA 4D1IA 2WOQA 1D7KA 3BLDA 1NWSA 4XZNX 4A3HA 4F4RA 4B5XA 3URQA 1E0XA 4DNHA 5I3KA 1YBQB 2E9BA 4WJXA 2Y62A 1V0KA 1RLCL 2INEA 2OQLA 3ARRA 5HQMA 2GGEA 2I57A 4C6QA 3W1PA 1P0BA 1Y8BA 3W7JA 4XUYA 2V2HA 2VZOA 3NFUA 5XINA 3VNZA 1XWYA 1H3GA 4QQ3A 5LIWX 4IJBA 3NG3A 1CB7B 1U1UA 3AWNA 1AUSL 2F84A 5A6KA 1YRRA 5A6MA 3SY5A 1H7WA 4XO7A 2VGIA 4UNLA 3B0VC 4P7NA 3RILA 2FYMA 1OFAA 3BG5A 3RO8A 4JFSA 2YCLB 1EJSC 1BAGA 4L4PA 4TUFA 1KO0A 3RFAA 3QMTA 3PUDA 5T9CE 2XVKA 1FCVA 1VCFA 1F3WA 2INFA 2QS8A 2WHKA 3MQTA 2GUYA 1S2UA 2G5WA 3OLGA 2O92A 1M65A 2VZUA 2OJPA 3CZJA 3ONBA 5CZTA 3PJWA 2RKXA 3HV8A 1GVIA 5AC8A 1QOPA 3TSMA 5BMXA 5A5WA 2GGIA 5FIPA 5TQLA 2HVNA 1I45A 2ACRA 5I7GA 1NM9A 1SJDA 5CXPA 2I56A 1W3KA 3H2AA 1H7PA 1KA9F 3MZNA 3NQFA 4AWUA 3PJTA 4PMRA 2XIBA 4R7WA 3EWZA 1GHSA 2HNHA 4D6IA 4E8CA 1KFBA 2Z26A 4KIRA 1UJQA 1XLCA 2AAAA 3P3BA 3VKJA 3TTEA 3F4NA 9XIAA 3BLOA 4CCEA 3MSGA 3C2RA 3ATZA 1JDAA 3WSUA 4AVFA 2J7DA 3B8TA 2OSWA 2QUNA 1FH8A 1PUDA 4B4FA 4HNVA 5JIPA 1JULA 1JD7A 2ZA3A 3GHRA 3FS2A 4LUIA 4OUIA 4H6RA 5ECVA 3N2TA 5CH9A 4R33A 2VP8A 2FPTA 4HZMA 2Y8VA 4QR6A 2C79A 1BKSA 4LBUA 3BLEA 4NU7A 2ZWYA 3QSRA 4L4OA 4IUGA 4ZFMA 4W87A 1AQMA 1UKOA 4LRTA 4C91A 4H7ZA 3WQFA 1XLMA 4FNRA 1Q5MA 3T05A 2BGSA 4GINA 3WH8A 4GI9A 4ZB2A 4PFHA 4ZE5A 4UFKA 3TA9A 1KR1A 3W02A 3CWHA 5JBEA 3V0UA 4P7RA 1ZPTA 2XGZA 2QNEA 4XAYA 4Y8FA 1K8YA 2DIEA 2DUXA 1ZAIA 4MJ4A 3H54A 1NH6A 2VGFA 4C6MA 3VU2A 2P0IA 2D0GA 1V4YA 3ZQ9A 1KXHA 3UG5A 4PMYA 1D7FA 3T2OA 2PU0A 3CB3A 2VX7A 4YYCA 5E93A 2VR5A 1PVNA 2D1ZA 4H83A 4WDTA 4U4MA 1EX1A 2VENA 3S9ZA 1R6WA 4UTKA 2ZE3A 4M1BA 3N19B 2V5LA 4UNKA 3FSUA 4MMWA 3NDZA 1A49A 1WDDA 3OZPA 3EOEA 4IIGA 2WC7A 3S9YA 1ISZA 3WD1A 5I79A 2TAAA 2PTZA 4AZ5A 1MUWA 2Y70A 2DZSA 4N6EA 3O0KA 3ENLA 4IQLA 2QGHA 1F3XA 2FVLA 1XCFA 5CPSA 2J8TA 2BP1A 1VBJA 3DC8A 1JCXA 1EBGA 2OWXA 3QY8A 4W84A 1Q6EA 4FNPA 3IRSA 5CBIA 7REQA 2GOUA 2DJLA 4XZIA 3MZ2A 4LTSA 5K2ZA 2PCEA 3HV9A 2PDHA 5AC7A 2C0AA 4O4VA 1LCOA 1SFTA 3G2GA 4DM1A 3OZYA 2X8RA 4DNMA 2ZX7A 2R94A 3UPWA 4GUJA 2WSYA 2ZUWA 3GNNA 2VYOA 5I3JA 5LNUA 1Y65A 1H61A 1ZJIA 4ZOBA 2ICSA 1TQXA 3AIEA 3ME3A 2VOTA 4DWSD 1VQTA 4HZ7A 1KFWA 4BZYA 3WH7A 5A8PA 2W9MA 5K9CA 3VKCA 4OBTA 1C9WA 4HVXA 3SRDA 1XKYA 4W85A 1X39A 3G3MA 2G95A 3FAWA 1M41A 4KWVA 1W9DM 1UD3A 2WYSA 4YLWA 1M6JA 5F1UA 3KFTA 4MOZA 4N4PA 3KE0A 4LAUA 4PA8A 2BY1A 1W56A 2XM1A 4AXKA 4I9MA 3S2CA 1TFVA 4CQCA 4IIFA 3SIMA 3QYQA 2BOGX 4BWLA 4F0LA 1IIGA 2FDSA 3QPZA 2DZAA 2OEKA 1XH0A 4FNUA 3IJ8A 6ALDA 4CGTA 4ZQMA 4ADUA 1J0KA 1LLWA 5B7ZA 3R25A 1N8WA 2PU1A 3TYAA 4FO4A 3VMOA 4ACZA 5CBJA 3FA4A 1ZSXA 4EPKA 3UU0A 3O2LA 1W1PA 3BAKA 3N14A 4QEEA 4UTFA 3STCA 2VC6A 1EJ7L 3CXOA 2VC9A 4Q8PA 1KC7A 2VC7A 3QTGA 1LF1A 4HPXA 4GZ7A 1O12A 3FKKA 3SN0A 4GI4A 1XIFA 3KOWA 3WNOA 3FJNA 1GW9A 4K1WA 1B1YA 4WRHA 4HSNA 4EF9A 3GVQA 1VFUA 1OQFA 1JXKA 3GR8A 4O1FA 3SCUA 4FPSA 4JFTA 2E5CA 1NVMA 1KXQA 5LIUX 1IT8A 3LPFA 3ARSA 1XIDA 2R1PA 1VEMA 3CIXA 3LPPA 3VDAA 3MKCA 4S3JA 3E02A 3V75A 4B5NA 2O9TA 1O1HA 2XIIA 1ZRQA 1OC6A 2VC5A 1J0IA 5GJMA 3BW3A 4UMBA 3UFYA 1B4KA 5A2CA 1KKRA 1PZ0A 2OZ8A 2WLYA 3ZJ8A 3MSYA 4DWDA 3QQ0A 1L2QA 1I2OA 1GHRA 2DT0A 3FN9A 5F2MA 3H26A 3O6AA 4EE9A 4UOJA 2OXNA 3UGRA 6TAAA 3EDDA 3P14A 2BXZA 2A7RA 3G18A 5DXYA 3EOSA 5KZ6A 1XDMA 4GQRA 1MEIA 4DEFA 1TVLA 2FB3A 4HB7A 3GFYA 4GXPA 3L7RA 1RZMA 4O11A 1SSDA 1XYFA 1E40A 1PTAA 1RBOB 2E6DA 4DJDA 4O15A 4NJIA 1CXKA 1WBHA 4NZJA 5HWJA 3A21A 1PJ9A 3H22A 3MKVA 4QJ5B 1CDGA 1ADSA 3M4HA 3W6MA 2CKRA 1T8XA 3EX6A 2WPGA 2GGJA 1S5VA 3BO9A 1KTCA 4ZTYA 1UUOA 3AXHA 4WSHA 1QK2A 1PO9A 1DXEA 3ZT7A 2E40A 5D8WA 4HMEA 1M7XA 4IP4A 2C3ZA 4PUEA 1E9ZB 2WVVA 3M6DA 2YB1A 4QAIA 1DHKA 1XUZA 5DLCA 4RZ4A 2QCMA 1B2YA 1OEPA 1GJUA 3TC7A 3PZVA 3EKGA 5C9WA 1GTEA 3VAVA 4AUBA 3KZPA 2XGBA 3ARQA 2ZZ1A 4DB7A 3MI2A 1TPEA 5CCZA 3K8KA 2IPGA 1B9BA 2PTXA 3TP4A 5FJIA 3ZR6A 4DJDD 1UG6A 4J3XA 2C71A 1DJZA 2UY2A 1XIMA 1K9FA 4HNNA 1FCBA 4HMDA 1XP3A 3ZSTA 3AUJA 3CUJA 3B9OA 2VZVA 2QHAA 1E3XA 3DH7A 6REQB 1EDGA 4TX9A 2DP3A 3MUIA 2HVMA 3SRKA 4BI7A 1FVPA 1H1NA 1RALA 3TU9A 1E4IA 1IEVA 4HT3A 2PDCA 3U48A 2YBVA 1DQWA 1FDYA 3BXWA 2NLIA 2EQDA 1F4AA 2J7BA 2WKLA 4CN6A 3IJ9A 4AD5A 2BXVA 1YXYA 3CAWA 3C2VA 4AZ6A 3UPMA 1CECA 1M03A 3GQYA 5A8NA 1J2BA 2XVGA 2ACSA 1SO3A 1SQ7A 3KBMA 1UKTA 2YLAA 3UJRA 1XYLA 1QPNA 1VPXA 1KFEA 5HJLA 2JEQA 2YL5A 3L4TA 3MUZ1 3WFZA 4DUVA 3G1YA 2ZX8A 3G8RA 4QCFA 4EWND 5BYWA 4PUWA 4JIRA 1M7OA 4XD4A 3PUGA 1GVYA 2PF8A 2ZZ7A 3CQJA 1RY8A 3NM1A 3F4WA 2DH2A 2PGEA 3CV1A 2REQB 3LI0A 3ARYA 1TPWA 3MUCA 4B2DA 4GI6A 3HGRA 4DXXA 5FEZA 1VIWA 1I1XA 2X1TA 1UBPC 3W2JA 3PSWA 3R8HA 3UR5A 1KRCC 3FJ6A 4GIAA 1D2KA 1EZ2A 1V3IA 3D46A 3FAXA 4WSJA 1E1CA 1M3UA 4IM4A 2OR2A 4AIEA 3LZ5A 1IZCA 4CNUA 4UZUA 4N2YA 1O5XA 3QLDA 3UERA 1HKJA 3WDIA 3QV8A 4IP5A 1KWKA 4CU6A 1KWGA 1DHPA 4XISA 2WJFA 1QNPA 1HJWA 4LUTB 1OM0A 1OCNA 1QTWA 2WM0A 2OO6A 4JCLA 2X7WA 1QRQA 3BLPX 3W1MA 4M81A 4Q8VA 4TV5A 4WUIA 4AD3A 4ATWA 4J3SA 4FOKA 4W8AA 2BY2A 3W7HA 1LOQA 2UY4A 3BMVA 1MSSA 3BK0A 3M64A 5AYIA 2CNCA 4UFLA 2AQWA 2DU2A 1FCUA 4K38A 1VYSX 2ZZ6A 3W88A 3C3NA 1N8FA 1DWGM 4WR3A 3NL2A 3PUEA 1IEWA 4OV4A 2FGBA 4GBUA 1K77A 2A3BA 4XKMA 1SR0A 4XQ6A 4G2DA 4GC3A 3BJTA 3NVDA 1EJVC 3NXLA 5EMJA 2BVYA 4Q4QA 3GU2A 4E3VA 1EIXA 2A0NA 1TMQA 2VHLA 3O6CA 4BEUA 3LBMA 1GOIA 3K46A 1UWIA 4S3CA 1XD1A 3STFA 4NKCA 3H4XA 3AS2A 1QDSA 1R7AA 1YDVA 4FIQA 2YJQA 3OG3A 4JCMA 5L6UA 1S2VA 3ZIZA 1UHVA 4AWSA 1R9ZA 4LV9A 4E2VA 3SR7A 1Q6QA 3NQMA 5G5IA 4A3YA 2H3BA 4IXHA 3TN5A 3CASA 2ACQA 4AVNA 4LUSB 1JL8A 1JD9A 4Q8TA 3GVWA 4OHQA 1B3OA 4WQ6A 3KP0A 4ZQOA 4H2HA 5MKGA 4S2BA 1KRBC 3WNMA 1X6LA 1Z48A 4J2MA 3SCQA 3V36A 4AEOA 1VGAA 1EWEA 5AHEA 5HK4A 2UY3A 3MBFA 2O0TA 5I0DA 4D8LA 1XYCA 3QW4B 3JR2A 4QROA 5I23A 2OB3A 3P0WA 1YW1A 3IV8A 3VUPA 1CXHA 4F9JA 2EPHA 1WCGA 1E0TA 1ICSA 3PANA 1UD6A 3URNA 1CENA 1YPIA 2VZSA 3AIQA 5G2WA 2VWTA 3HG4A 3SJNA 4GH1A 1RLDA 1JCJA 1X7FA 1TE6A 5IFTA 4WKFA 4BQ5A 1CTNA 5DANA 3VVGA 2P5NA 2J7HA 3GFXA 5EBUA 1YTEA 3QR1A 4B5SA 4LYKA 4FEZA 4IQJA 1OIFA 4JN8A 2YCKX 4R85A 3VNMA 3ZS4A 4DXKA 4PEKA 3K8LA 3FA5A 3WQGA 2EO7A 4HU8A 2OMAA 2NV1A 1R2RA 3KS5A 3QZAA 3IJDA 1UASA 1AH4A 3RM4A 4JTUA 4GPNA 3K4DA 3LG3A 2W62A 1XD0A 1EJRC 2Z1KA 4IUOA 1VEPA 1JPMA 1LZOA 3W81A 5C0QA 1V6WA 3SADA 3VIFA 4IX2A 3A3WA 1XC6A 1B57A 4O4WA 3TNOA 4UTTA 4O28A 5PTDA 5DBUA 4WX2A 1V08A 1PHWA 3E1F1 2P88A 3O6YX 2R1LA 2ZDRA 4QDWA 3T44A 3O3RA 4PYSA 1H0IA 1J10A 1OABA 1VFHA 3WJSA 1ZP4A 3DFSA 7XIMA 3W72A 1XW8A 1YKWA 4NNCA 3ZWSA 3S1VA 5CGTA 3WLSA 2ZCGA 3S83A 5K9XA 1Q2RA 3CV2A 4JQ2A 3B9EA 2BODX 1DXIA 3T1GA 2VX6A 5I3FA 2Y24A 4LVDA 1AK5A 3F2DA 1KCKA 1PXGA 4B4HA 5JMUA 1WXYA 5BXTA 1Q13A 4G9PA 2PPGA 5HR7A 1GZGA 3M5ZA 4BFAA 2FVKA 3CHDA 1DBTA 1X96A 4GXMA 1A5MC 5CPQA 3N3TA 2QDHA 4GVIA 4MNMA 4KFNA 2JIWA 1EA9C 2E8YA 3FVMA 3S42A 2ZX9A 4I6KA 4QJ4B 2ZXQA 4DUWA 3HU7A 5CKSA 3UXLA 4GKTA 3DKLA 5AECA 1XPYA 3TE9A 3U8GA 4MWAB 3NL3A 2DY3A 4PCPA 4ZTXA 2Z1WA 4D2JA 4Q7NA 5EMLA 2OYLA 1KLZA 2J9XA 4MPKA 2J9YA 3ITXA 1PSCA 4P2VA 2CZFA 2FTWA 1GNXA 1L8PA 3NQGA 5LIKX 1E6NA 1GVFA 4BHYA 2BLEA 3KBSA 1QATA 5FEPA 2E67A 2GQ8A 1QK0A 4MY8A 1QFEA 2ZRWA 1HGYA 1XM3A 3ZJ6A 4DELA 4QG8A 4Q8UA 1J96A 3EOOA 3CPGA 2G3JA 2OT0A 2VVSA 4WJ8A 4Q6JA 4Q8OA 1OX5A 4JNZA 3BAJA 4MNLA 1DJQA 5BU6A 2ZTKA 1DJHA 1LBFA 3B97A 3W73A 1JFXA 1L6GA 4GX8A 3DYOA 5CC6A 5FL0A 4WSKA 4OU1A 2LLEA 5C9ZA 1PPIA 4I7UA 3T8QA 1OFRA 4R88A 1TVPA 1MXGA 2FH8A 4OGZA 1H1YA 3H2EA 1KV8A 3FYOA 4JEQA 4AC1X 2J8FA 4AZGA 3B8VA 2DW6A 1MEWA 1SMAA 3ATYA 1VZWA 2ZA2A 3BWWA 4DVOA 1IQ8A 4K3ZA 5CAHA 3B0UX 1GOQA 3GYEA 1A5UA 2HCVA 4Q7BA 4DHGA 3WNNA 1B3YA 1ONWA 4XIAA 3RO6A 2C14A 5FSDC 3LRLA 3W24A 2HJPA 4XKYB 1LQ0A 3FEMA 2Z1XA 1PYFA 3N2CA 4F0HA 4DJFC 4B15A 1PIIA 1T41A 1MW3A 1ADDA 3RLVA 3MCNA 3PBUA 4CQBA 1VC4A 1QXLA 2DV0A 1IWAA 1R2SA 5IHSA 1R3RA 4PZVA 4GNVA 3CGTA 5I09A 1QI5A 2DZVA 1F73A 4S23A 3TOYA 5KEZA 4M6UA 4QDMA 3R5EA 3TONA 4L56A 1K3UA 5A2AA 1ISXA 5EL1A 1FWJC 4AU0A 1ZY9A 5KZDA 3FW6A 4H00A 3WQCA 1TE1A 2GK1B 5HMSA 1TA3A 4JZ5A 2HRWA 3M0MA 4LOCA 3BMWA 3FKRA 3W83A 2OZTA 4DBWA 4UXDA 1ML1A 3AU2A 4QRNA 1GVQA 1JDDA 3H55A 1V6YA 3UT0A 2QQ6A 1VYRA 1K7XA 1Q6LA 3JRKA 3UZZA 3H7VA 2ALRA 3W25A 3ABXA 3GDLA 1PX3A 3CV6A 3URAA 3EAUA 1I2QA 1S2AA 3R2GA 4KF1A 5LA2A 4E2BA 2GJXB 4R34A 4KEZA 4PC8A 4Y9AA 3NUKA 5DY3A 3P67A 4BCEA 3LPGA 4K8EA 1QWGA 3CH9A 3MI3A 5CJMA 5BWAA 1GQLA 2JKEA 2Q71A 5F4SA 1TV2A 2VO5A 1NELA 2CZEA 1C3FA 2TRSA 2EJ1A 3VKKA 4H04A 3T0CA 1FRBA 4J35A 3P0XA 2Z2UA 5F2LA 4RJEA 3SRFA 5H8UA 2ZZ2A 1EF3A 4Q33A 4HA0A 1NQKA 3MI6A 3UZXA 4IMDA 2X1SA 4TVDA 4YVPA 3NOEA 3L0NA 3SCWA 3WBEA 1ZU8A 1GT8A 3GW3A 1OGBA 4ZXOA 1EGZA 3AZSA 5C2CA 1UD4A 4GUFA 1GW1A 3GYCA 3PPFA 3W1QA 4GUHA 1UKQA 3ARTA 3OEXA 5C2GA 2FHCA 4M7SA 4Y7EA 3HURA 1VBUA 1WPCA 3GDRA 1IE7C 3A12A 3IGHX 3CPUA 3UCCA 5C55A 3KRZA 3N34A 1YHTA 2DFAA 3ERPA 1J0ZA 3BW2A 2H9AA 2Q3RA 1O95A 2FJKA 4KT2A 1PKYA 1C8XA 4N9EA 4Q22A 2Y5SA 1Q3NA 3TR2A 1WUEA 3F5JA 1AMYA 1W9BM 4YJ5A 1GTHA 2X05A 4LY4A 4O12A 2EJAA 2PURA 2UV8G 1TIMA 4TO8A 3ZLGA 4GMEA 2I17A 3S5SA 2DT2A 5EYWA 4QE5A 1DJWA 3QZ6A 5M1TA 2PDYA 3KX6A 1D3HA 3L2IA 4CEXC 3CH0A 1H62A 1JZ7A 4UQ9A 4WDUA 1JZ2A 5AVNA 1OIMA 3M0ZA 2D3NA 3G5EA 4GUIA 3IIPA 1A3HA 5H6HA 2OT1A 4C6LA 2X0HA 5IBXA 4TQTA 2GJNA 3HZ3A 3UQNA 1RPKA 1HFBA 3A23A 2W5FA 4CD8A 1EC7A 1KFJA 3CUIA 4JTIA 4FR1A 5A6BD 2W91A 1JCTA 4Y2WA 3OBKA 2HTMA 2W27A 1L6YA 3BOLA 4AD1A 3WD2A 1KLYA 3LCWA 1LOSA 2J77A 2HBXA 3W01A 2WC3A 4AX7A 1JAEA 2NUWA 3NEHA 4GXWA 3WK0A 1JXJA 2FKPA 2C91A 4IFOA 1SJBA 3GXFA 4ZQPA 1WNOA 2QCNA 4LRSA 4NY2A 3RJYA 4U5KA 2YLLA 2VR4A 1GZ1A 1W3JA 2E9MA 1UP2A 4RCXA 2VGGA 3VIGA 2OPJA 3GXNA 5IXEA 2NXGA 2WJZA 5HOSA 3H7RA 4G7FA 1H11A 3W7IA 3K30A 1XLGA 1TZ9A 3UXAA 3MHGA 1TV3A 4DYKA 3F1QA 2DSKA 4JQAA 3B8IA 2ISWA 1EJXC 1XF0A 1UMLA 1UC4A 4UIOA 3VIPA 3ELFA 5FD0A 4ZXLA 2VOMA 4N9CA 4J3TA 3DFHA 4CNOA 4QISA 2QPXA 3BARA 5AY7A 1AH0A 2DVXA 5LIXX 3LSCA 3WUBA 4WLCA 5KSWA 2NSXA 2E68A 1OK6A 4OUEA 3MS8A 5E09A 1GJWA 4URIA 3ZXWA 2BTMA 2HMCA 1XRVA 1XR2A 4GO9A 4QLJA 2CZVA 4OOUA 1D8CA 4YNGA 2QUUA 3M41A 3WK1A 5J04A 3LSBA 3CB8A 4KRTA 4AMCA 3HB9A 4HGXA 3EXSA 4KGLA 3G24A 4GZIA 4MGGA 2W67A 1E1CB 4HOXA 4LUTA 3CZLA 5KITA 3NGJA 1SZEA 3A47A 1HGWA 1U33A 1ZLPA 1HVXA 4ZOCA 4X2RA 1W54A 2VNCA 3IGXA 3TKFA 4AIOA 3CV7A 4FB7A 2YBTA 2HQAA 4ICNA 5HA7A 2QJHA 2X0YA 2PWFA 3W86A 1EPXA 1VBRA 2BSLA 4F9DA 5D2XA 2FLIA 4RNFA 2WHLA 5HDRA 3FYPA 3MJYA 2HXUA 4GY7A 1B30A 4PTMA 3AI0A 1KFLA 1HJXA 3T9PA 3AISA 3B8DA 4BKNA 1TWDA 3ZT5A 4HU4A 2BY3A 4MDOA 2PSNA 3OIHA 5HJYA 1G4PA 1LG2A 3F5KA 3FCPA 4S3KA 4IGMA 4L64A 4JTRA 7REQB 2PTDA 1ICPA 4XIMA 3TC3A 3NAVA 4RR4A 3IGSA 4N7QA 4DUXA 4E8GA 1UC5A 1JNDA 1FP8A 1V3KA 4W8BA 3UF9A 2J24A 4MYXA 1S38A 3FHQA 2GQAA 3Q37A 4FNSA 2HZGA 3KBVA 1MW0A 3QYSA 5B7YA 2Z6IA 1F2JA 1J9YA 1PTGA 4E2OA 2V5KA 3CS2A 3QOMA 4CD4A 4EXAA 1QAPA 2C6QA 3S5YA 4XAGA 4B3LA 2J25A 2RHGA 2GWGA 1LRQA 4UOZA 1A5OC 4MLJA 2CLFA 1WKYA 4C6OA 4H2CA 3L0KA 2WO5A 3SCOA 4YCPA 2VM8A 1Y5WA 3LK6A 4N42A 1V3HA 1W6TA 4O54A 3BE7A 3KDNA 3WLQA 1B31A 1I75A 3WF2A 3POHA 1Q65A 2WKJA 1QI2A 1DQUA 2IPFA 4M8UA 4I9AA 2WC4A 3HPSA 4PB3A 4CNPA 5BXRA 2FVMA 2CLEA 4IPIA 3UD6A 3NPXA 1H7NA 1KM6A 1DVJA 1J12A 3M47A 4JBRA 1YE6A 3QW3A 4TXEA 2OCZA 3LTPA 1AW5A 1E5NA 4JIEA 3B06A 1TG7A 1MEHA 2CLOA 3FDGA 1R7OA 4J2PA 1ZALA 3GC4A 2Z6JA 1VS1A 2B7OA 1BQGA 5DMLA 3FJ4A 1NFGA 5D2YA 3NSNA 4GQGA 3TDFA 4RDYA 1TTIA 3HPFA 3JU2A 5FAJA 2JBMA 4CNSA 3BQ5A 1BHGA 2WSKA 1R8LA 2J75A 2D0HA 2ZZ3A 3G1DA 2WQPA 3VO0A 2KZHA 2XJ7A 1RQHA 5EKYA 3RM8A 5K4XA 3CU2A 3WEZA 2ABAA 3M0JA 1YQ2A 4NIRA 4H01A 1I2RA 1MI3A 3W7RA 5EY5A 5CC5A 3O0FA 4YXGA 3ABZA 3RR4A 4EACA 1HVQA 2JIEA 3JW7A 2Y6ZA 1VJSA 2A79A 4PTVA 4AD0A 2WMGA 3HFTA 3IVUA 1UQZA 5M03A 3R7MA 1RQBA 4F0KA 3L4VA 3MHUA 5C8BB 4QE1A 4N4QA 3CTLA 4OBSA 4MHBA 3LLFA 3KOXA 3S46A 1YX1A 3WMLA 1Q7MA 4NQ1A 3VIHA 2G50A 2GVGA 5DBTA 3W2KA 1NDWA 4NZCA 3POCA 1LROA 2ABBA 1LUCA 1S5TA 3GUWA 1ITQA 3B8SA 2GQ3A 3ZM8A 4QDPA 4DJEC 5LA1A 4LBSA 2BXYA 1B3VA 2WNZA 3W37A 4O0QA 3D47A 2EPKX 3WFLA 1E43A 3P8JA 1VHCA 4MSSA 5DN1A 1Q4WA 4POCA 4IPLA 3EEGA 4F79A 3PBWA 3WH9A 2WVVB 2ON3A 2XH4A 4KS0A 4FOJA 1TMHA 1S46A 3W71A 4M3PA 3O8AA 3KP1A 5I77A 4TOQA 2R1KA 2GSEA 3QGAC 2J62A 5A3HA 1QJWA 1BLIA 3N9SA 3TYZA 4EXBA 3DC0A 4A35A 2QEZA 4A22A 1KQZA 3L4XA 2D2OA 3GBEA 2CLPA 3G0UA 2VXNA 1R86A 3QKEA 1RSCA 1R3YA 5E5CA 1G4SA 3M5XA 2FZ9A 4JAWA 3W22A 3GWQA 4CD6A 2Z7GA 3G6MA 4Y6GA 3WUGA 1OHLA 2OLAA 2ISSA 2O9RA 3BAXA 4H9ZA 3MC5A 3L67A 4Q8NA 4GYPA 6REQA 2BHYA 4DF2A 1N82A 1FFQA 3WLOA 1KBKA 2XGIA 4PCSA 4H1ZA 4B16A 2VJXA 3L9CA 3T2PA 1SJCA 3CMFA 3GG7A 4REQB 3TX9A 3WLPA 1TVNA 1R30A 3VDGA 2NV9A 3EWXA 4PBFA 5I5RA 3BOXA 8RUCA 1AZ1A 2MNRA 4D8AA 2FPVA 5HWNA 3I4KA 1O5QA 3R12A 4AYSA 2YDRA 3PG9A 1JDEA 1RK5A 4UMCA 3VM7A 3RPMA 1MQPA 1PZ1A 1QW9A 1XSIA 4MUPA 1HJQA 3B8UA 1FXPA 4GYFA 2XYLA 3D3AA 3NZ1A 5GJPA 3IIVA 1QNRA 1ZUAX 1CB2A 1QHOA 3E0WA 5TBOA 2HNEA 1GVEA 4F0MA 2R8WA 1A47A 4O1EA 4ALDA 1TTPA 1TTJA 5CPNA 2WVTA 5EFDA 3EWUA 1NDYA 1GOOA 3DG3A 1DWAM 2D2HA 5A8OA 2QIWA 4PMUA 1GG1A 1WDRA 2Q02A 3VCNA 2ZTJA 5HINA 4XD6A 7ODCA 1OVDA 1CNVA 1PCWA 4PB5A 3RPTA 5ABEA 3GZAA 2XN0A 1ZAJA 2IXVA 5CGMA 1DE6A 4CCDA 3Q65A 3IAQA 7TAAA 3KLLA 4B9YA 3GXIA 2Y61A 4DO7A 3LBOA 3TOPA 1JRCA 1JRBA 4RV8A 3IS4A 4HJWA 1OSEA 4B92A 1IV8A 4U3CA 4DZIA 4UFIA 2ZUMA 4DO4A 4C6CA 2CPUA 4LALA 5FJOA 2IKIA 3NQ6A 3ICJA 2QR6A 2Z1VA 4DZHA 4UTLA 5M5DA 5F2IA 4YS1A 2WANA 3W1UA 1REQA 3G1VA 2PWUA 4S3AA 1U1HA 1AFSA 1OFBA 3DXIA 2WZIA 4H6KA 1KR0A 4DIAA 2WCSA 4Q7IA 3IEBA 2XH7A 1CT5A 5D9PA 1N7KA 4XAPA 2DIJA 3VD4A 2E0PA 4R5EA 3WF4A 1PL9A 1YMYA 4V1YA 3OODA 1KRAC 3DECA 3HIJA 3QC3A 3TW9A 1SUXA 1WE5A 1RVKA 4JYEA 3O9NA 1F74A 2Z2BA 4W7WA 4TIMA 2QCDB 4JIPA 3EDFA 5FSEC 4MB5A 1OJXA 2G8ZA 1GQJA 3BV7A 4DBEA 1V7AA 5AVHA 1A5LC 4Y8EA 5D05A 1HJSA 5AC6A 5AHIA 3SGZA 4UTMA 4IMAA 4CQ9A 4MWAA 2P3EA 3V7PA 4AF0A 1VLIA 3KEHA 3KCOA 3W29A 4QITA 2WW5A 4K7YA 3CZ8A 3S1WA 2AGTA 2QF8A 3VGEA 3AIBA 2F9RA 1EOMA 3EB3A 1KM5A 3TFXA 4JTSA 3EPNA 3CPRA 2YFOA 2IPWA 1CGUA 1QT1A 4FZIA 3MPGA 4NZ5A 4G7EB 1S5NA 4YVVA 3WH5A 4WY0B 3OLEA