3LUTA

A structural model for the full-length shaker potassium channel kv1.2
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
326
Chain Sequence
b'LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 120
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lutA00
3UZWA 4XVDA 3WCZA 4QXIA 2PF8A 2PDJA 1Z9AA 3UZYA 1ZQ5A 3R43A 4GACA 2R9RA 1PZ1A 4FZIA 2AGTA 4R9OA 5DANA 3ERPA 5M2FX 3NTYA 4HBKA 3UZZA 2HVNA 2HDJA 1US0A 1AH4A 1Q5MA 3U2CA 4GABA 4JQ2A 3CV6A 1S1PA 1K8CA 4AUBA 3O3RA 1YE6A 5JH2A 4F40A 4NKCA 4JIIX 3UZXA 3EB4A 2PEVA 3RX2A 3CV7A 2WZMA 3LBOA 2ACRA 4ZFCA 4LBRA 1S2AA 2C91A 3LEPA 2PDGA 1X96A 4L1XA 4YU1A 2NVDA 2PDCA 3BUVA 1GVEA 4XK2A 3B3DA 3CASA 2IPFA 3DOPA 3G1RA 2PDMA 2PDQA 1Z3NA 5KETA 2J8TA 3F7JA 2BP1A 1RY0A 2PD9A 1RALA 2F2KA 4IJRA 2HEJA 4FALA 2CLPA 3RX4A 3BCJA 1RY8A 1J96A 2NVCA 4Q3MA 3N2TA 5JH1A 3KRBA 5HA7A 4FA3A 3UGRA 3FJNA 4YVPA 1M9HA 2IQDA 3H7UA 4GQGA 3LD5A 3T42A 4LB4A 5LIWX 1XJBA 4LBSA 3LNMA 3WG6A 4PR4A 2I16A 3LZ5A 1PWLA 4JTQA 3H7RA 3N6QA 2IKJA 4DZ5A 2PDXA 4YVXA 4LAUA 3Q65A 1JEZA 3R8HA 3LENA 2FZDA 3WBYA 1EKOA 4OTKA 2PDHA 1C9WA 3UG8A 4IJCA 1XF0A 3R94A 4XZHA 4WDXA 4PRTA 4PUUA 1AH0A 2PDWA 4JQAA 1PZ0A 3R6IA 1IHIA 3BURA 3P2VA 3MB9A 1LWIA 1X98A 4EXBA 3M0IA 2INZA 2PDUA 4WDTA 1PWMA 4GA8A 2HVOA 1T40A 1VBJA 4WRHA 4PUWA 5HNUA 2F38A 4JTDA 3EB3A 3R8GA 1MRQA 2IPWA 3S3GA 2FGBA 4XZMX 2PDBA 3LN3A 3GUGA 4H7CA 1LQAA 2PDYA 3WBXA 1Q13A 2HE8A 1FRBA 3CMFA 4JTRA 3ONBA 4LAZA 4GCAA 1YE4A 4PMJA 1X97A 1EXBA 4EXAA 1SM9A 3Q67A 2DV0A 5LIYX 3G5EA 3DN5A 4JIRA 3M4HA 1YNQA 3UYIA 1AFSA 4JIHA 1S2CA 3LQGA 4JQ3A 1A80A 3R58A 3O0KA 1IEIA 1ZUAX 4LB3A 2IPGA 4YS1A 1QWKA 3FX4A 4FAMA 2ALRA 3LUTA 3MC5A 4WDUA 5AZ0A 2PD5A 3V36A 2PDIA 4L1WA 3GHUA 2FZBA 3UP8A 1AH3A 2HE5A 1AZ2A 2IQ0A 2IS7A 5C7HA 4JQ1A 5AZ1A 4G5DA 3D3FA 1EL3A 1PYFA 2I17A 4GIEA 4WDWA 3GHTA 3LZ3A 2PDNA 4WEVX 3WBWA 3VXGA 3V0SA 1S1RA 5LIUX 5LIKX 2FVLA 3H4GA 3R7MA 2DUXA 2PZNA 2HV5A 4XZIA 4HMNA 4QR6A 4XAPA 1Z89A 1XGDA 2WZTA 1OG6A 2IPJA 4JQ4A 3UWEA 2PDKA 3V35A 1T41A 1YNPA 2FZ8A 1HW6A 1ZSXA 4QX4A 1EF3A 2FZ9A 1VP5A 2PDPA 3GHRA 4DBUA 2ACQA 2BGSA 3RX3A 4JTAA 1R38A 4I5XA 4Q7BA 2R24A 1MI3A 3BV7A 4ASTA 2IKHA 3COTA 2INEA 4GQ0A 4DBSA 4JTCA 2P5NA 2DUZA 3V0UA 2IKIA 2PFHA 1Z8AA 2VDGA 4XZLX 4IGSA 2PDFA 4XO7A 4XO6A 3GHSA 3C3UA 2ISFA 2ACUA 3V0TA 2ACSA 2PDLA 4WGHA 4ICCX 2BGQA 4RPQA 3ONCA 1HQTA 4XVEA 1ADSA 4XZNX 2QXWA 1AZ1A 3QKZA 1MZRA 1ZGDA 2A79A 3EAUA 4DBWA 2IKGA 5HNTA 3UFYA 1UR3M 3LQLA 4MHBA 4PRRA 4QBXA 5LIXX 4H8NA 3CAQA 1QRQA 3CAVA 3M64A 4YVVA
chains in the Genus database with same CATH superfamily
3MS8A 4MGGA 1YXDA 5D38A 4UNKA 5I3IA 1FWSA 4PEEA 1I9CB 5CPQA 2YYUA 3TLQA 1QXLA 3EX1A 1H2JA 2J9XA 2EO7A 4MWAE 1FDJA 1BYBA 1QW8A 3A3XA 3ITGA 3A4AA 4PBFA 3A21A 1JJKA 2I5QA 1XDMA 2ZRXA 5BROA 3W3OA 3NDZA 4QHRA 1UASA 1AW5A 3TC6A 3EX6A 1L8NA 1R47A 2WZMA 2ZIDA 1SO4A 1TQXA 3LLXA 1QFEA 1DWAM 4L4OA 2PGRA 5ENLA 4E4UA 4IQEA 4L6DA 4RK8A 1D3CA 3CIWA 2OZ3A 4DZIA 4P8VA 4CD8A 1JF5A 3WDHA 3FYOA 3O6YX 2X1IA 3T1GA 1DJWA 5FJOA 2E6DA 1RBAA 4F3HA 3TFCA 2DH2A 3VIGA 5HANA 2WMJA 1GYMA 4ZQOA 3I7RA 2NXGA 2RUSA 1TKKA 4MNKA 3EOEA 3WQCA 2DVUA 2Y61A 5JH1A 5HOSA 1GGOA 1UR4A 4H4IA 2XHYA 4OBTA 3KCLA 1HJWA 4HCHA 2EPNA 2IQDA 3I3BA 4L4PA 2EKGA 4DX3A 1RK5A 3AS0A 1C9DA 3GVGA 3GVWA 3VOHA 4NUWA 5KZMA 1Y7VA 2E1DA 4U10A 3E1F1 3WLOA 2O92A 4W86A 3NSNA 3TMQA 1RD6A 4QEEA 2ABAA 2G4JA 2G96A 2VCBA 5ABGA 3UR8A 4KIEA 4OJYA 3VKCA 3HQPA 4QE4A 1GPWA 4PMOA 1UH2A 2NSXA 1M65A 3VMOA 1FWAC 1DJIA 3DIPA 3QFEA 3IJ7A 1W1PA 1MUWA 2WJDA 1AH0A 1XLCA 3GFXA 1KW1A 2QDHA 2VWSA 3T09A 2WK2A 4JTTA 1R3RA 2GGJA 2C6QA 3UPBA 5AECA 3KW3A 4TX9A 3W7KA 2V5JA 4OECA 1SUXA 1KR1A 4GO9A 2YJQA 2C8NA 1XFCA 1GWJA 1VEPA 4HPGA 2PDUA 4KWVA 1MEIA 5LNUA 3NQCA 2CBIA 1XBYA 4LQ1A 3E38A 2XN0A 3AIVA 1OX5A 2DJLA 2ZZ5A 5CC3A 3F4NA 3L4ZA 3C86A 1ZAHA 4FPSA 1ISYA 4DJEA 1V7YA 1Z32X 4XZMX 3S42A 4GUIA 3WBXA 5L9FA 4ZQNA 1VRDA 3S5OA 5CC5A 4S39A 4R7WA 3OHIA 3MYOA 3P5ZA 5C9XA 2FMNA 2OGJA 3PJTA 5LIYX 2PGFA 3M4HA 3LPOA 1RBLA 2GGHA 1CECA 1E72M 3R79A 2ZXAA 3CL7A 1N55A 1D9EA 3QPYA 4JL1A 4FX6M 3MHUA 5AN7A 3GVRA 5K9CA 5KZDA 4JQ3A 3RNDA 3QGAC 1M01A 1AMYA 1LDCA 1CLKA 3W7MA 1R30A 3LXCA 4GE8A 1KM0A 2R8WA 3HO8A 1F4HA 1M6JA 5F2LA 3LHVA 3TQPA 3M0MA 1HXJA 2B7NA 3EMQA 4GC3A 4O53A 1FKXA 1XPYA 3BZGA 2G4FA 4HSNA 4F4RA 4LPCA 5EMKA 1QPOA 1OYBA 4HIBA 3OOQA 1XRTA 1XYBA 3VA8A 1S39A 3D3FA 4LJ3A 2V2HA 2XH0A 3VX0A 5HWNA 1PYFA 3WL0A 3RR4A 3MCNA 2Z2BA 1DJGA 2PDNA 4WUIA 4DJFD 1PZ2A 1V6WA 1YTDA 4ATWA 1DWHM 3IACA 3SGUA 3CO8A 2OTDA 2UWFA 2ZXBA 1HUVA 2W92A 5CC6A 3UVAA 3W23A 5CBJA 1GOQA 3QZEA 1EJSC 2FTWA 3KBVA 1ZLPA 2B7PA 2JGQA 1JI1A 3SCNA 1DVJA 4JQ4A 3WNPA 2W67A 4JHZA 2BHYA 1AL8A 1B1YA 3DFHA 3P6LA 3SADA 2V0TA 1A5BA 4MWAB 2ZUMA 2PLCA 4RZ4A 1US2A 3L5AA 3BJTA 2YDSA 1HJXA 3G1SA 3O05A 2G3MA 4UTFA 1B54A 3QF0A 1K7XA 5AYXA 3W83A 2ZOXA 4K7VA 3OVGA 1OK6A 3TV8A 1FXPA 3QGVA 2FZNA 2DUZA 2NUYA 3QLDA 4CNOA 1GG1A 5AKQA 3TA9A 3LA4A 1VKFA 1IEWA 3AIBA 3Q2DA 1R2SA 5CGQA 3D6NA 4A8LA 5I02A 3BAIA 3SCRA 3VPLA 4AC1X 3C8FA 3E49A 2AGKA 4H9VA 4BQ5A 4DXVA 1R8LA 2YA2A 1PIIA 1AZ1A 3G22A 3EWCA 3MDUA 5H8UA 3VNLA 2Z2AA 3NG3A 3NQDA 4XBJA 3VILA 4LUJA 1F8MA 4BS0A 1GJPA 2J25A 2XIJA 4F0HA 3W07A 1HJSA 1M7JA 4YVVA 4IX2A 4KEZA 4ZODA 2AMGA 2Y8KA 4QAIA 5BXTA 1PB0A 4AC7C 1EJUC 1Z48A 3EDKA 1CZ1A 2FHCA 5HNNA 3TAOA 1L9WA 2Y1HA 3SN1A 2WQDA 1DIOA 2W61A 4X61A 1EEXA 3I65A 4WXYA 4Y7EA 4JY8A 1DTUA 3AIEA 1I8JA 2O55A 1KC7A 1VJZA 4JCMA 4R34A 1GUVA 4XTIA 4O0KA 3QOMA 3T0CA 4NKCA 4QISA 4GY7A 3V5OA 2CU0A 2PEVA 2GVEA 3RX2A 3NQ7A 1ZAJA 3T2PA 3CIVA 3VCRA 3WNOA 2ACRA 1YHTA 3S9IA 1S2AA 3DKLA 4GH1A 2OFJA 4QCEA 5KTLA 2CBJA 1FXQA 4H3DA 1H1YA 3T07A 1JUBA 3Q4DA 1OX4A 1VFMA 7CGTA 4KGJA 5GJMA 3QQWA 3QVQA 1EPVA 2NSOA 3SCQA 4PUNA 1H5YA 2PD9A 1W56A 4C7FA 4FO4A 1RH9A 2Y24A 3NZ1A 2CLPA 3QTGA 3NEVA 5EL1A 1HL8A 4Q3MA 4IMGA 2WMIA 3RPDA 3PTMA 3HG4A 3PR2A 3ARXA 1AUSL 4FK9A 4DWSC 4YVPA 3A24A 2GVGA 5G1YA 1Q6CA 3WNMA 2E1WA 3N29A 1PIFA 3CS2A 1UG6A 3H7UA 2YB4A 3KZPA 4LB4A 2YZRA 4K36A 3ANYA 3N34A 3LV5A 5CC7A 4ACZB 1TV3A 1WXYA 3LZ5A 4A3HA 1Q6LA 1GZ1A 1V8EA 1XCXA 4LALA 3NL6A 5C0QA 4O1EA 1EJWC 1OF8A 3WH7A 5AC4A 1QCWA 3Q65A 4JGDA 1E6NA 3ZR4A 1GKQA 1CB7B 1XLBA 1C9WA 3VO0A 3OYZA 3B03A 1XSJA 1H7OA 2PP3A 2PODA 4NY2A 4GBDA 3WLRA 3FVMA 3N4EA 1QJWA 1J9YA 4MF4A 1GQNA 4HU8A 4LY4A 3FJ4A 4LV4A 4YYFA 1QBAA 2O56A 1C7SA 2X41A 2YL5A 2NW0A 1YEYA 2HISA 3EPOA 3JR2A 3S5NA 1OFAA 3INPA 5EYWA 1UPMB 4ZL1A 3SCPA 1YQ2A 3R8GA 2E40A 4S2BA 2XIQA 1OD0A 1JZ6A 3L2LA 3B9NA 3U2OA 4BY3A 2V5KA 1J11A 1UKOA 3WK0A 1E9ZB 4MWAD 5EMJA 2C16A 4TU1A 2JBMA 1ECEA 1H3GA 1JZ2A 3UGVA 4IMEA 2X40A 1J0ZA 2GZXA 5IDIA 1SM9A 2P10A 1Q8JA 2D22A 4CN6A 1R6WA 3TXVA 1WDDA 3ID7A 4I8DA 3I4EA 1SR9A 3M5YA 3H12A 1A5NC 4MB1A 3WQDA 1A80A 3FYYA 4WHBA 4C1NA 5J04A 3H2NA 2PCEA 4HA0A 2OVLA 3LU2A 1ICPA 4EOUA 4PN2A 3TQ0A 1SSDA 4TVUA 2XJ7A 1VZWA 3S2JA 3TWBA 3UR7A 1J0IA 2Z6IA 4GXWA 4A2SA 1D8WA 2EG6A 1E4NA 1BYAA 4GQBA 3UP8A 4Y6GA 1UR1A 1KGWA 1XLFA 2AQVA 2ZFAA 3GFYA 2DSWA 1Q8AA 1H11A 3G1YA 3BLDA 3POCA 2CZEA 2BY2A 2DZXA 2BWGA 1EL3A 2FZMA 2V6AA 4L80A 4XUGA 1XIEA 3G1AA 4Q8NA 4RCXA 3DG7A 2E9BA 4UTWC 3OTRA 4AEEA 4C5ZA 1A5KC 3PY2A 4REQA 4NVTA 3A13A 4WJ8A 3WD1A 1DP0A 2WHMA 3R25A 2CHRA 3NXLA 3N2BA 1OSEA 3KL0A 2D0HA 4HMNA 1J0KA 2YW4A 1XGDA 5GJNA 1AQMA 4LH8A 5G5IA 4QDPA 3H2FA 4XKYA 4F8XA 4AH7A 3RFAA 1U2YA 2ZWYA 2WQPA 2DQWA 3R5EA 3HIJA 5FEXA 3MKVA 3CAKA 1VPXA 5H2ZA 3O9NA 1XRFA 4L7ZA 2ZDRA 4HK7A 4IQJA 4MLRA 1ZRQA 2W6RA 2YA1A 4TUFA 5I2UA 4JTEA 2YXXA 3WJYA 2Q09A 1KD0A 4M1BA 1A53A 4IFKA 1IXNA 5I78A 2IKIA 1CGTA 2CHNA 4Y9MA 4IP7A 3OQEA 4UMAA 5C9RA 4HYRA 2ACUA 2GJLA 3M07A 2BOFX 1GVFA 5SWUA 1E5JA 4RPQA 3L4XA 1ADDA 4DI9A 2Y6ZA 3ARRA 1UWQA 2P0OA 4PBEA 3GK0A 3RU6A 2FPTA 2J7GA 5BRPA 1I2QA 1TWZA 2D3LA 3NEHA 2GPTA 4PMZA 1T8XA 3AXHA 4QBXA 2XFRA 1V0NA 5D2WA 2BVDA 5REQB 3CWHA 4FR1A 1CLXA 3NCOA 1UYQA 1R3WA 3VOJA 1RA0A 3BLOA 4AD2A 4XD3A 1DXIA 4P61A 3AZSA 3TNBA 4XSMA 4IQDA 3RJYA 2CLOA 5JUVA 2ZTJA 1W2VA 2Z1BA 1POKA 3MW7A 3DI0A 6ALDA 1KFKA 1PZ1A 5I0DA 5EB8A 4ALDA 4P2VA 2HVNA 3GU2A 3AUJA 1YNYA 2V30A 2LLEA 1EYWA 1RLDA 3NVDA 1TUFA 3GAKA 1DIEA 3NQBA 2E5BA 4C6OA 3MUY1 1DJNA 1XIFA 3HA1A 3RLGA 3B04A 1FHVA 3FFSA 1AODA 2X2YA 3SSZA 2WSQA 3LB0A 1WXJA 1B3VA 2AQOA 2E9MA 4GVHA 3E5BA 2AKMA 3PWAA 2Y85A 4DJDA 3TUUA 3QFWA 1F74A 3M16A 2YBUA 3AJXA 3QMRA 3VIOA 2WWDA 3T55A 3ARWA 3C2OA 3L0GA 3SUUA 2RDUA 4M82A 3GX9A 2A3EA 2XVLA 5K4ZA 1R3VA 5AC8A 3IANA 1V3IA 2PDMA 1SFSA 4QITA 3LLFA 3NXFA 5A3HA 2VZOA 1DHKA 4BI5A 2NVCA 1OGSA 2J9YA 4Z1YA 4WSHA 1VS1A 4H9UA 1S3TC 3ITTA 3NO1A 3WL1A 2YBVA 1M9HA 3ABZA 5B80A 4HD5A 4HA4A 3UR2A 3AXKA 1YDVA 4LW7A 3VKAA 3DDMA 3LD5A 4HOXA 3LSBA 1J4EA 2FDSA 1XGEA 5E6ZA 2AL2B 5CBBA 1EFZA 4O14A 4JTQA 5A8OA 1Y65A 3SGZA 1V77A 3S1UA 3BGAA 2CLKA 4YVXA 4LAUA 4IGMA 4ZSUA 1XIBA 5EMUA 5A95A 4UTKA 1EA0A 1P7TA 4R88A 1OZMA 2O9OA 2UBPC 3H4WA 4QSFA 1QNQA 2W91A 2WM0A 1US3A 4HB7A 1DQWA 2J24A 2PDWA 4DJFA 4N02A 1HP4A 1RBOB 3RCYA 3QHOA 3W1XA 5CSRA 1UUOA 3GXPA 3L12A 4OGZA 1HT6A 2G3IA 3CUJA 1WCGA 5HQLA 5BOOA 3EWDA 3WLKX 3UESA 4CGTA 1SW7A 1SO6A 2INZA 2ZUUA 2ZRYA 3FA4A 3FLUA 1TJ1A 1XIHA 2C7FA 1ZNNA 1B3ZA 3SM0A 1T6MA 4WY0F 1A4MA 4JIPA 2J7EA 2Q71A 3IAPA 5BCAA 1UR8A 4LOCA 4AYSA 1FWEC 4IMFA 4Q4RA 5CSSA 4HA3A 1RVGA 4UZSA 1UR2A 2X8RA 3ES7A 3MI2A 1OX6A 3MZNA 1PUDA 4LC6A 3LI0A 1TZ9A 1B3OA 1VPQA 2VM8A 1Q13A 3CHFA 3W1LA 3MSGA 3ABXA 3CMFA 4MDOA 3M0LA 3VDGA 3WLNA 4Y9AA 1I45A 4MB4A 3IPWA 3W01A 4E3TA 1TO3A 4XISA 2PURA 3AHYA 3PZVA 4JIQA 3Q67A 5D2VA 1J79A 5AC6A 3P74A 4HCLA 4PC8A 3T2OA 3OZMA 1ZCOA 4QEHA 4CNSA 3F4VA 5E09A 4B3LA 5HMFA 1UJQA 2RHGA 4IISA 2VMFA 1H51A 4W7WA 3BSGA 4B16A 2UZ9A 3O0KA 3WJWA 4HPHA 2Q3RA 3OO2A 1S2UA 4CU8A 2GYIA 1KFCA 1PYMA 1XH0A 2BVYA 1QWKA 3QV7A 3KS6A 3LHYA 3F2BA 1CX9A 1KRBC 3DAQA 3ZT7A 4DM1A 3W53A 4KFPA 1JXKA 3OW1A 1OC5A 5AHMA 5F4SA 2HE5A 3DH7A 1FHLA 1EP2A 2IXVA 4J3XA 3WLHA 3B9AA 5LNSA 4DAFA 5KSWA 3RM8A 1HIZA 1Q6OA 3L0NA 3W75A 3WQFA 1FWIC 2WJEA 3J7HA 3EWXA 3O6AA 5EMLA 1OD8A 2R91A 1UOZA 3DFYA 3V0SA 2E6FA 4S3BA 4UR8A 3RO6A 3N2OA 3H7VA 3BLEA 2GFTA 1A50A 4GMEA 3GQYA 1VJSA 3R7MA 2DUXA 1LT7A 1MXDA 1QHPA 4H7VA 4Z1AA 3FXYA 3GAYA 3W9ZA 2VP8A 1JULA 4O57A 1YTKA 4I9MA 3V35A 1T41A 1LL7A 1MNZA 3B8WA 4QJ1A 1XRVA 2CYGA 1CXHA 2XFYA 3VC5A 4XD4A 3AIRA 4K2SA 3GHRA 4A8RA 5G4EA 4HTBA 3F4DA 2YBTA 1UJPA 1W54A 5FEPA 4AEOA 3F03K 3C2EA 3W7GA 4ATLA 3A5VA 1CCWB 3QXBA 2FVMA 1CXLA 2ZZ1A 3TH6A 4B5WA 4GYKA 1RVKA 3IJ8A 4CNUA 4K39A 3T9PA 2ANUA 4CKQA 1A0CA 7REQB 3W6LA 1A49A 4GQ0A 4DBSA 4GG9A 1ZBWA 5DBTA 4JTCA 1WP6A 2B7QA 1E6ZA 4G1NA 3ICJA 3T0TA 1Q6GA 4ICNA 5CBIA 4BEQA 1EGMA 1GVRA 4HN8A 1O68A 3VD7A 4EAMA 1GOXA 3BMVA 4Y2WA 1P0NA 3M0ZA 2Y7GA 5JBFA 4QTGA 3H2AA 2VQTA 1W9BM 4HCDA 1GK8A 1ADSA 4DQWA 1KXVA 3M7WA 1FWFC 5DRCA 5F7UA 2VX6A 3TA6A 2H9AA 2OSWA 1A5AA 1BXNA 3VFLA 2L5HA 1NDZA 5EPDA 3BAWA 3HTWA 2NV9A 4GI4A 2WSRA 3I68A 3BMXA 1UQZA 2VEMA 3S0CA 1ZHAA 4DXKA 3UZWA 3GYEA 5LNVA 3NJ3A 2G37A 4Z1BA 4QXIA 2PDJA 1Z9AA 4XAFA 3AXIA 1QPKA 2RKXA 4XKMA 2Z24A 2NUXA 4OZOA 1DJXA 2DGAA 5E9AA 1LBLA 5HPCA 4L64A 2XG9A 4E8GA 4M8UA 2OCZA 1ISXA 2HMCA 4DUOA 4HYWA 1QPNA 3CV6A 4HNLA 1V5XA 4FXJA 1GHSA 4RR4A 3N17A 1OJXA 5BZAA 4EF8A 1FDYA 4TTUA 3EX3A 1W5MA 2CERA 3E02A 3QN3A 3G24A 1JPDX 4KRUA 5A6AA 2Z25A 3ZJKA 1ONEA 1M5WA 4W8LA 3IIOA 4BF7A 1Q66A 3KZSA 4P7OA 5DMLA 3GIQA 3W7LA 1RP8A 2CZ5A 1LWHA 2QCNA 1C7TA 4GX9A 3PM6A 1TJ0A 1KBLA 5FJRA 1NEYA 2H8ZA 3ALFA 1VR6A 3L23A 1XFBA 2Z6JA 1Z3NA 3VGFA 1JG9A 3RDKA 1KFJA 2F6KA 4HPNA 4H7ZA 3N13A 2VVNA 4J4KA 1V03A 1YRRA 1MXGA 4M3PA 4US6A 3GTIA 3NO5A 4MY9A 3V3WA 5AHEA 3QEZA 2TYSA 1F05A 5D9MA 1UC5A 1JRCA 4UNIA 1GOOA 2WVUA 1KKOA 1JCMP 2OYMA 7TIMA 3T42A 3FY1A 3GNDA 5C2XA 5DF0A 4PTWA 1Y5XA 1VEOA 3EZ4A 3G1HA 1SJCA 4PR4A 2C1GA 3IARA 3K4WA 4KESA 1W9VA 3EX4A 2Y7DA 1QOQA 1DWIM 2WMHA 3W88A 1E0VA 1ITXA 2WM1A 3BL3A 2JFEX 3U2ZA 3TN4A 4WKAA 4J3VA 4YWSA 3OA3A 4GOAA 1OFRA 1DJZA 3RM4A 3A22A 3CZ8A 4IOTA 1TSIA 1KXQA 1JCNA 1FH8A 1H7NA 1TA3B 1W3KA 1LUCB 3TJIA 1XSIA 2YXGA 3B4YA 4N7QA 4NJKA 4HNNA 3RCMA 3WQ8A 2ZX7A 3WLMA 2NVAA 3SCTA 5DELA 1JYWA 3DECA 3GBDA 2PS2A 2ZVIA 1T40A 4MKVA 3TW9A 4LCSA 4BK9A 3RILA 4YTRA 1U5HA 3LI1A 3VNZA 4JDBA 3B9EA 4FHAA 2ZA1A 1VPYA 3PWGA 4ROQA 1O5QA 3RHGA 4ERIA 2ZA2A 1TWDA 3PNZA 3U2EA 4GH3A 4E0CA 1CXFA 3KL5A 4EE9A 1YE4A 1EXBA 3MP3A 2Y70A 2HBXA 1BWLA 5A6BA 3T78A 2E8YA 2WANA 1SJDA 2VHLA 3G3MA 4G7EB 4HP5A 3WQGA 1SVDA 3ATZA 2EKCA 3O15A 4IPIA 1SFJA 1RR2A 2JEPA 2ALRA 4MY8A 5CZJA 4LAKA 4H6KA 2OWWA 1CW2A 1R3YA 5E5CA 1PHQA 4F79A 3T0AA 1FBAA 2J9ZA 1R3TA 4GNVA 3CAWA 4UQ9A 5EU9A 2OT0A 4L6HA 2DORA 4N6FA 5I06A 1XLLA 4G5DA 3G77A 2F6XA 4PCFA 1CI1A 4ZENA 1XM3A 3DYOA 4JTLA 3SCUA 3EOOA 5IXEA 4YCPA 3CPUA 1Y8BA 4O11A 4NF7A 3ARVA 3VNYA 3RIKA 3WH5A 5DBUA 2ZUVA 2VOMA 2ZZ6A 2BDQA 4K3ZA 1JNDA 2VVSA 4QR6A 4MFDA 1C93A 1NOUA 2WZTA 1CEOA 1XP3A 1XHGA 3OLGA 2OELA 5HK4A 3K4AA 3E96A 4D71A 4XD6A 2PDPA 5JBEA 1S2TA 3QR0A 1NDWA 3KTXA 4F2BA 4EXQA 3KFTA 2VR5A 4LX4A 1JGIA 1ZAIA 3ANVA 1S3HA 3UXLA 2OOFA 4F0SA 4A21A 2VWTA 1KM2A 1OFQA 3H24A 3RF9A 3B40A 2V3EA 1S5TA 3N04A 1DE6A 1N8FA 4QQ3A 3LLDA 2QR6A 3TONA 3W00A 2R14A 4CU6A 2D24A 4BHYA 1UCWA 4ADSA 3ITLA 3DI1A 1K9EA 4B15A 2X0HA 1A5CA 2FGLA 2CNCA 4IHCA 4LRTA 4YYCA 3BTNA 2PUZA 1GQIA 3POHA 3SR7A 2VX7A 3W7OA 4ML4A 4HQVA 4O52A 3VIKA 4Y90A 4DBWA 4IM4A 4B91A 5HNTA 5D8WA 2C19A 1UR3M 1G01A 3BSMA 4C91A 2MNRA 1I6NA 3FHAA 2X0YA 2VO5A 1PCWA 1SMAA 2J62A 2CLFA 3A47A 4UFLA 3ZVHA 3DFTA 3VGBA 4J9JA 3CAVA 2Q02A 1E40A 4IIFA 3CLWA 3GXIA 4TVDA 4NI3A 3MHGA 3MP5A 1D3HA 1K9TA 3IGHX 1X6LA 2G3FA 5FIPA 4ZTXA 5D33A 2X1SA 4OUIA 4AZCB 4EKJA 1U1UA 1J01A 4PFMA 2AMXA 2WPGA 4D72A 4LUTB 3LERA 2CWXA 1AQFA 5IHRA 1TR9A 3GSMA 3UZZA 2ADAA 1US0A 1TIWA 2Y7FA 3VD9A 1EA9C 3UCCA 4OKDA 4WY0A 4JQ2A 1E3XA 3W76A 1HG3A 3BLIA 1VYRA 3OPSA 5CZSA 4ORIA 4F9JA 5M1TA 2OQLA 4F40A 1XLIA 2PRHA 1P0DA 4RUBA 1E6SM 4MWAC 1ISVA 3KOFA 4JTHA 3VKJA 2ZXDA 1GHRA 4O0QA 3VGDA 1H63A 2CW6A 3TZNA 2PDCA 1OG0A 4B90A 5IFPA 1I0DA 2IPFA 1A0EA 3DENA 5CLTA 2ZBTA 3DOPA 4AD5A 3RXZA 4Q4OA 2YCKX 1NDYA 1J5TA 2VR4A 1EJTC 4ATDA 4C1LA 1NIUA 3C56A 2FH6A 4UFIA 2CZVA 3P8JA 4HA1A 2OZ0A 1KCXA 3GRIA 4WJEA 4FA3A 4K8HA 4HN4A 4KMQA 3IRSA 4X9YA 2QYGA 3M7SA 4X60A 2QT3A 3CQ0A 5C2CA 2Z1XA 3ES8A 3M0VA 3UWZA 4BA0A 1GTHA 4LV9A 3N9SA 3H7RA 3CBWA 3Q37A 2BSLA 1B9BA 4MPKA 1VBGA 5BXPA 1E1FA 3AHXA 1Q4NX 2P53A 4M7TA 4S3EA 4GVFA 4Z2IA 3LHTA 1HVXA 3VTRA 2NQZA 3R94A 4YN5A 3KVJA 4I7WA 4WDXA 3DU0A 4JNMA 1EGVA 4AD1A 3BARA 2CETA 4OIFA 3EWYA 5FAJA 2I56A 2VC7A 3M0HA 4RX0A 3W82A 2XPKA 3TYDA 1KO0A 1JDDA 2WW5A 3IUHA 1PTGA 4INFA 4O1DA 5HNUA 5K9XA 2P0IA 3PTKA 2REQA 3OGVA 5A69A 3EB3A 4GUGA 2WLZA 1PHWA 1H1ZA 1SZGA 2A2IA 3OZYA 1Z6KA 3ZVIA 2E68A 4H7CA 2YDQA 4RDZA 3QV8A 4ZQRA 3SUVA 2ZE3A 3LCWA 2D20A 4DM2A 1F73A 1ZJBA 4PCPA 2WAGA 5E0CA 2DV0A 1MDRA 3WMSA 8RUCA 4J1OA 3CZLA 3H21A 1F07A 1YBQB 1IF2A 4HNCA 3SIZA 4JIHA 1MUMA 4MJZA 3ZOAA 4J35A 3BCDA 3U7VA 1W5PA 1FFQA 3PVFA 3C2VA 2TAAA 5D2TA 1XBZA 4YHGA 1KQYA 2IPGA 5ABFB 2QCFA 4R7OA 4GIRA 2QUUA 3KX6A 3UNTA 3G1DA 3AJ7A 5D2XA 2J7CA 2UY3A 4C6KA 1ZZMA 3MPGA 4PMNA 3VZYA 2XU2A 2C14A 1AZ2A 1NFGA 4WQ6A 1PX4A 4K68A 3AS3A 4DYEA 4RXFA 4GXMA 5FL0A 1MWOA 3HG2A 1V3LA 3WQ5A 4GWEA 3SI9A 1OT2A 2WHJA 4WEVX 3WX7A 2QF8A 2FH8A 1TMQA 1E1CB 1F3EA 3C52A 4TXEA 3PF3A 1R7OA 2CESA 1LG2A 4XAZA 5E70A 1FCBA 3EWWA 4XZIA 3QR3A 4D1IA 1BTCA 3UG3A 3THDA 2HPMA 1NU5A 1Z89A 2YCLA 1RQBA 3GW0A 1EH9A 2DIJA 3MSYA 4LT9A 3IVTA 3S8HA 2WBGA 1Q45A 4FI4A 4RZBA 3SSJA 2ZVRA 4R9XA 5ECVA 5BRQA 1GOKA 3AU2A 2WVSA 4I5UA 3LHWA 4H8HA 3TX9A 1VCFA 1QDSA 1YDOA 2QQ6A 2VEIA 4WSJA 3WUEA 2P76A 4IXXA 4UTTA 3P0XA 1FTXA 1XICA 2QPSA 4PUKA 4HZMA 1PTAA 4XBSA 1WDPA 2A7RA 1FHUA 1J2WA 1JCXA 3W0KA 2F9RA 1UWUA 2GSJA 3S2NA 2DZUA 2WHKA 4XO6A 2A7NA 4AZGA 9CGTA 1OQFA 1GPFA 3CPRA 3JZEA 3W37A 1JZ4A 4ICCX 4LXFA 1DQUA 2BGQA 3KAOA 1UKTA 3CV2A 2PGWA 4IMAA 4X63A 2X30A 4QRNA 2XH2A 1VCGA 5M17A 5I7GA 1VFSA 4GZJA 3UFYA 2XZ9A 3CQHA 3K13A 3EA2A 3ITVA 4IUOA 1M1BA 1JCLA 4BF5A 3WQPA 1X6NA 5LIXX 1HGYA 1QOXA 4J3UA 1OYCA 2G41A 1E51A 4JYEA 3GM8A 2F6UA 1WDRA 1R9XA 3LGGA 4XIMA 3NPUA 4GO8A 3AQUA 1O12A 1N8IA 2QIIA 3I7QA 1FWCC 1G67A 2Y8VA 5M2FX 1K70A 3VNDA 3RCNA 4UR7A 4B3ZA 3O2LA 4QLJA 3UVIA 1ONXA 2POZA 3PFRA 3WF3A 4QDWA 2VEKA 2NQ9A 3O3RA 3LBMA 4K6AA 3LCXA 1J6OA 3WJSA 5JH2A 2Y4SA 2DZPA 4O1CA 2WLYA 5LYRA 3NQVA 3CV7A 1R9YA 4IX0A 5A5WA 5C6MA 2XUCA 2Y8UA 3KL3A 1MEWA 1TCMA 1XX1A 3EOUA 3LBOA 4LS1A 3T0BA 4ZFCA 3PJXA 4RE0A 5IBXC 2Q8ZA 5EMYA 2ZZ7A 4QE1A 4OE7A 3W29A 5H91A 1WQ5A 3WD4A 5A6KA 5K3VA 4WSKA 2FVKA 4IFOA 3HOJA 5DMYA 4MJ4A 5F2MA 3ZIZA 3DFSA 2W9MA 3SY8A 3H26A 1HKJA 4UQDA 4IQLA 3F7JA 1KR0A 4RNFA 4G8TA 2ZC8A 4EWND 7ENLA 1ZJAA 2X1TA 2PMQA 1MZHA 4WZHA 3F4CA 3GTNA 2X09A 1ZBCA 1K6WA 3MDWA 2A3CA 3MO4A 3N9RA 1KM4A 5C7VA 1SPQA 5FJPA 5BOFA 1TYGA 4CD4A 1M41A 4GCXA 3VOFA 4IL2A 3VZZA 1GZGA 1ZU8A 4FXFA 5JIWA 2CLHA 1EF2A 5GNYA 4HMCA 4H9ZA 2BFGA 2YXOA 3HM7A 3KXQA 1W5OA 4B9YA 5IDZA 3WBYA 3VUSA 5I3GA 5E6YA 3AMGA 3TROA 4Y9OA 3UG8A 4P8WA 2W62A 1J10A 1MEHA 4UWMA 1TPC1 2PRLA 2OEJA 2QVNA 1JF6A 4GI9A 3TE9A 2Y7EA 4GINA 2B7OA 4JYFA 3L21A 4UFHA 2ALDA 1VLIA 3P2VA 1LWIA 3N2XA 5I00A 3UQNA 3MWAA 4QSHA 2C71A 4ZGYA 2QJGA 3ITOA 3PP7A 1QNPA 1D7KA 3GTHA 4IPLA 3GXDA 2VCCA 3LPFA 4PMUA 2XM2A 1BGAA 2YIHA 3H23A 5G2HA 4B5NA 3S3GA 3EBVA 2Z7KA 5EBAA 1YDNA 1AVAA 2A1YA 2FGBA 4AWSA 4LYPA 5AYIA 4AXKA 1WDQA 1LQAA 1KGXA 3GNRA 5CJMA 2Q01A 1N82A 4DUWA 4JX6A 1FWTA 4JTUA 1TPFA 4Q8VA 1E9IA 7PTDA 1G94A 2VFEA 4GI6A 1ODUA 1G6CA 1NWSA 1BYDA 1PX8A 3K1GA 3WKZA 4QG6A 3LXAA 2WWCA 1XW8A 3QSRA 2VOTA 3OZOA 1XS2A 1RZMA 4C6MA 2DIKA 5A2CA 3MI6A 2HXUA 2A4AA 4PTDA 2QV4A 4ERAA 1QMLA 3GUWA 3PJUA 2PTYA 3W7QA 2YDAA 2OYLA 4AZ5A 4DF1A 3CZGA 3LV6A 5I3JA 3VABA 1TTPA 4WVXA 1UZ4A 1NARA 4HNTA 1JPIA 1K8YA 4X0VA 4NRRA 4QJ5B 1FP8A 3KRZA 1EOMA 5LGXA 6ENLA 2ZQ0A 3KBSA 3CHEA 1SJBA 1J0JA 4DO7A 3CHDA 3TN3A 4A22A 4BF9A 1U5VA 4FNQA 3PZIA 4AG0A 4HMDA 2MUCA 3EXRA 4LY8A 2R94A 3TZFA 3FDGA 2GUYA 4L4MA 1QU4A 2X16A 3FDKA 3KS5A 3SQSA 2XN1A 1TA3A 3W7PA 1OG6A 3SUWA 1LUCA 5CGMA 1F5ZA 2PWEA 2V82A 2WYSA 4TQTA 3PPHA 4W89A 3ZMRA 3W7CA 2NX3A 3N73A 4V15A 2Z1VA 1NWUA 3IVSA 3S2MA 1LOLA 1L6GA 2XZ7A 1RV8A 4JY9A 4S2CA 3WO8A 3UWVA 3W72A 3ANUA 2EEXA 4QNEA 3DFQA 4K1WA 2VD9A 1JDAA 2DEPA 5H1WA 2ZRZA 2FPVA 5FOOA 2R1KA 5T8GA 1JZ7A 1TPVA 4XZBA 3ZR6A 3THCA 4O17A 3BOXA 4RXGA 1W1YA 4XO7A 4DUVA 2R82A 3VOGA 2XTKA 2O7SA 4D8LA 3GDLA 5IHSA 4UQBA 3ZZ1A 3ONCA 2GGEA 4G7EA 1NQKA 2C1HA 1VJIA 4JNYA 2J8GA 1DQXA 6XIMA 1HN1A 1H7WA 3PK7A 1SO3A 5KITA 3PZNA 1LROA 3BW2A 3GNPA 4KFNA 1DHPA 3G3DA 3MUAA 4WXZA 2I5IA 4RNIA 2QUMA 3CMGA 4GC4A 3QZ6A 3UJSA 5BW6A 2YW3A 1TX0A 1ZALA 1A47A 1VHCA 2O9RA 4DWDA 1NOWA 1XIIA 2JIWA 2VDHA 5A6SA 5DQPA 3OLIA 4O1AA 4FLQA 6CGTA 3FKRA 1WZKA 3NTYA 2C13A 2W63A 2QCDA 1F6YA 3IGSA 1EIBA 4CNNA 2ZUWA 3JS3A 5F1VA 1YPIA 1KM5A 1SZNA 2UY5A 5I3KA 1K9DA 4YPJA 3DXIA 2Y0FA 3KHDA 5HAOA 3ZSTA 1G0CA 1X1NA 2EPHA 4C7DA 4Q4QA 1VYSX 3B05A 3QPZA 3KBWA 3EKLA 3RG6A 3ARPA 3P80A 4ML9A 2OT1A 4BFAA 4NZ1A 3RM9A 1MVYA 4IXHA 2P3ZA 2WVVA 2Z1WA 5FF4A 3R11A 3W7JA 2SFPA 8XIMA 2GVLA 3F2CA 1E0XA 3WENA 2Z0IA 1QVBA 3TU9A 3B3DA 3UT0A 1QBBA 3W02A 6REQB 4C6IA 4MSSA 3NZQA 1ME9A 1EWEA 3G1RA 5D9PA 3UR5A 4TTGA 1EGZA 3TYZA 3MUCA 5G2IA 3KBJA 5HMEA 4XBKA 3U5UA 3AWNA 4IJRA 3TTQA 4FALA 5LNWA 4MTVA 3BCJA 3ALGA 4IGHA 2WB5A 4O4VA 3BCFA 4QG8A 2EGZA 3VD5A 3QY7A 4L9XA 4N0RA 3SB0A 4CEUC 5A6MA 3AYSA 5FCZA 4V33A 4QIUA 4I6KA 4PUJA 3VCNA 4GJJA 3GXFA 1WKDA 3AMCA 3GU9A 2NQJA 2DT2A 3UYCA 4TV6A 5LZLA 4AIOA 1W5NA 2VC6A 2VI0A 3AZRA 3WG6A 3EX2A 3FSUA 4U31A 4NAEA 3P93A 4ZO6A 3K8MA 2XDFA 2ZCGA 4W84A 1V3KA 3UJEA 3NOYA 3GC2A 1GKPA 1FCQA 2DY3A 3IIPA 3W2MA 3RU8X 3MMDA 1VEMA 4EPBC 3E0FA 3HF3A 1UA3A 2FFIA 3DFPA 3PBMA 4Z2LA 1BSLA 5HNRA 5BWFA 5DCEA 2A3AA 2XFFA 3UF9A 2Z29A 4JN6A 1MW1A 4AZCA 1HGWA 3NO3A 5MHBA 4MJ2A 3EEGA 4AW7A 2OQHA 4Y9PA 2Z7GA 3M0IA 1BVNP 4GQQA 3G1VA 4GA8A 3TOYA 4XG1A 5JXQA 4AIEA 2GK1A 3BW4A 2F38A 1OGGA 3ZFHA 2HCVA 2PCQA 1K3UA 2IPWA 3S2LA 1KFLA 1SZRA 1YYAA 5CQ1A 1TG7A 1JD7A 2PDBA 2I9UA 4JFUA 4H1ZA 1R9ZA 4IIDA 2V68A 2KZHA 3A3HA 2FB2A 3CC1A 2D2OA 3PPFA 2ZRVA 5I6SA 3AHTA 5HMDA 1KTBA 5K9DA 2QGHA 4H01A 1M04A 2JF7A 4GCAA 2V3FA 4PMJA 3GD6A 4ZQMA 3DC8A 1WYIA 1QHZA 3SGGA 2PA6A 2PE4A 5CKSA 2NT1A 3UYIA 1JQXA 3ARUA 3PB2A 1CIUA 3PHAA 1WXZA 1V79A 3W1RA 1ZENA 4AZ7A 2G50A 4I3GA 3AXXA 3VIPA 3QMSA 3M0YA 1B9ZA 4F2UA 3GZAA 4IIEA 1D7FA 4C6QA 3CEPA 5HJYA 3BV4A 4KS0A 4LAOA 2HROA 3MHFA 5AZ0A 3LHZA 1M68A 1HJQA 1K7FA 1GJUA 2J6VA 1S5WA 3EA1A 3KTSA 1K1DA 3PZQA 2FHFA 2GQ3A 4UC5A 1TRIA 2D1ZA 4JQ1A 3HURA 4M5PA 2ISVA 4ZBCA 4W5ZA 3NM3A 3UPWA 3R0DA 2NLIA 2I17A 4DELA 4NI8A 1PL9A 3FA3A 1X8CA 3VUPA 3VNJA 4M7SA 4UMBA 2PC8A 3ORWA 2PWDA 1R3QA 4S3AA 4CEXC 3W27A 4GGBA 4G2DA 4XAPA 1MSSA 3A9IA 2GWGA 4Q4MA 1DL3A 3TYEA 4GJIA 3S5ZA 4NP7A 2PDKA 2P1FA 2ZKMX 3OP2A 2QKFA 4JX5A 3QTPA 4JBRA 3WIJA 1BKHA 1VP5A 4GGHA 3LM7A 5I79A 2OX4A 3O8AA 3LNPA 2BGSA 5I09A 2DDXA 5I07A 2BODX 2I14A 3NQ8A 4TVCA 4GYPC 5AVNA 3WK1A 3HPAA 3PPGA 4ILSA 1PCKA 1W37A 3R2GA 3HJZA 3EB2A 2HWGA 3M0KA 2IKHA 1FCUA 1CWYA 1UMLA 1TV7A 5F2IA 4X0NA 4L9ZA 1QO2A 1VAHA 6TAAA 4XAGA 3OU8A 3EDJA 2PLMA 4GYFA 4JTIA 2GUBA 4GQRA 3CT7A 4S3JA 2VFHA 2QJIA 1IT8A 3WNLA 2ISFA 2PTXA 3GTXA 2PRMA 4M24A 1YBQA 3SZ8A 3EKZA 3CUXA 1EP3A 2B4GA 2GQ8A 5A6LA 3AS2A 1NAL1 3N12A 1S2WA 1C8VA 1N7KA 1W1ZA 4DB7A 5GQBA 2V67A 3GR7A 4QDMA 4MUZA 4BQ2A 4MHBA 3B8IA 3KWXA 3H70A 5FD0A 4YMZA 4CQCA 1T0OA 3A9BA 2HK0A 3A23A 1AD1A 8A3HA 4DWSA 3CB3A 1KKRA 3NL2A 4PUDA 3ZO9A 4E2VA 3KOWA 3IJDA 3CWNA 4ZOCA 1I4NA 4Q6JA 1PKLA 5TIMA 3D47A 3R43A 5DY2A 1ESWA 4MM1A 3WBEA 3LTSA 2OO6A 3MI3A 1EDQA 4P7NA 2VT0A 5CH9A 3WUFA 3GW3A 3L4VA 2NWSA 3N19B 3B0YA 1AH4A 3WQOA 3U2CA 1BVZA 3S6TA 4UZUA 1Q7QA 3STGA 4YCOA 3EDFA 1G4EA 4YNGA 4L1GA 1W8SA 4H41A 2I57A 1QI3A 3OG3A 4J28A 3SCOA 1R46A 1QASA 3EB4A 3CQKA 2ONEA 4PUMA 1M53A 1TPDA 4PULA 4XUYA 3T6CA 4AIUA 4KCWA 3STEA 1X96A 4RZ6A 2J75A 3LYEA 5CG7A 2BV9A 3UY8A 4J5NA 3BUVA 3IV8A 4KKXA 3VIFA 1W3HA 3G1FA 5FJTA 3K1DA 1NSJA 1W1A1 2BY1A 4O16A 3SN0A 5BXSA 4TV5A 3LG3A 1KCLA 1L6FA 1HNYA 3U3HA 2J8TA 4FXSA 2BP1A 1RY0A 3SY5A 3RRAA 3W6YA 2J88A 4G7FA 3ZSSA 1EXPA 3CO4A 5M03A 3FYPA 3DEQA 2PWVA 3OLDA 3R8RA 3TQVA 3ZXWA 3GC5A 1DWJM 1XYLA 2NX9A 3TJXA 4K8GA 4IG2B 3AHZA 3UBPC 1IE7C 3FJNA 4HJWA 1EPXA 2CCRA 4P7RA 4UXDA 1XYMA 1LOQA 2D2JA 4A3YA 2JIEA 1XJBA 4LBSA 1FHDA 2V81A 2NZLA 4NJHA 3VKKA 1E73M 4QG9A 1ZPTA 3B4UA 4NNAA 2DSVA 2VGBA 1W17A 3GDMA 2OSXA 4IT1A 1X7IA 2EHHA 3F5JA 1UIOA 4H04A 3APTA 1EEPA 4F0LA 3R8HA 2VTFA 4UTMA 1ZJIA 4HZ7A 5DY3A 4U3AA 1VFUA 2PU0A 1E0WA 5A8PA 1VD6A 4ZO8A 2QHAA 4H00A 1K8XA 2QJMA 1CLVA 1V02A 4A3RA 5JMUA 3A6OA 3CK5A 1ITQA 3P0WA 1VF8A 1DOSA 2FYMA 5EFDA 4LBUA 2JF6A 4FIRA 5TNVA 5LGZA 1ECQA 1TQJA 3E0VA 4UTWA 2BLEA 4JTDA 4UOJA 3VOCA 4OWGA 3L65A 4HU0A 3BOFA 2VC9A 1LQ2A 1OFPA 4AEFA 1UD8A 3EOLA 3HQ1A 4CQ8A 3FW6A 3E12A 4DZAA 1UHVA 3IGUA 3MQTA 1F61A 4O18A 5J8LA 4LAZA 3AS1A 1LT8A 3NSMA 4AD0A 1BG4A 4E2BA 1VFFA 3LY0A 3WLJA 3JU2A 1PVNA 4PMXA 1OK4A 1ZCCA 3JW7A 3EPNA 4LUSA 3GG8A 4GY1A 1KCKA 2V63A 1S5NA 5D04C 2QIWA 1PIGA 4D8AA 4YL2A 1E6RA 3MP4A 4BI7A 2O0TA 4EPEC 2YR1A 3VE9A 3LQGA 2VFIA 1H7XA 1JPMA 5KMYA 2BHZA 4FLSA 1WZAA 3MO7A 3OVRA 4MVAA 1UUQA 3W7EA 4GFIA 4R53A 1CENA 2CKSA 5D05A 2ZA3A 2PD5A 2WSPA 3BG3A 3CHVA 4LUYA 5AY7A 3W1TA 4W8AA 5DRIA 2WKLA 3ZJ8A 2F2HA 5J5DA 2BZNA 1JVNA 3EOSA 4Q6XA 5I77A 1JYXA 4RV8A 3GY1A 3MY9A 2HRWA 3TC7A 3TW7A 4AD3A 3WZ0E 3W1MA 1A5OC 3GHTA 3IV3A 1JYNA 2PSNA 3WH6A 1S5VA 4QQUA 1XUUA 4MZ1A 3GTFA 2GJXB 3KVMA 3WNKA 2QAPA 2YX0A 4JTSA 1ONRA 3WQVA 2YL6A 4HU3A 5IOBA 1MFUA 1M7OA 4W88A 1P0BA 5CEWA 3RK8A 3JZUA 1WUEA 4AHOA 4FX7A 3UXDA 5C71A 1NELA 2BY3A 1E0TA 3TVAA 2JALA 2VGFA 4LEFA 4PFHA 2BBFA 4DBUA 1EUAA 4DO4A 3WLIA 2BS9A 3QC3A 4HHPA 1EBHA 4MLJA 3PNUA 2DSKA 1AJ0A 1BRLA 3UETA 3WY1A 4GNJA 4DF0A 3SFWA 4EK7A 4HNUA 4DI8A 4V1XA 1GVOA 1FUYA 3GC4A 4O1FA 3SW6A 4ZE5A 4HMEA 4A35A 1IQ8A 1NFBA 5C54A 1Z8AA 1G4SA 5DX7A 2OLSA 4J40A 3F5KA 4HYVA 2VDIA 1BQCA 4C6NA 3L9CA 4R3UA 1W9UA 1ME7A 2ACSA 2NV1A 2XFWA 4GHRA 4YTTA 2NXHA 4IJBA 3UWUA 1UA7A 4YTUA 3OBAA 4E8CA 3ITXA 1UW9A 5A6JA 5FI8A 1W32A 1M03A 2BVTA 1I2NA 3CZKA 3UWWA 4UCGA 1IGSA 3PTQA 2J77A 4JIEA 3S4TA 4KCUA 5AC5A 1MUCA 3E6EA 5LA0A 2IMRA 3MMUA 1KTCA 1WDSA 2E77A 4KEUA 3JUGA 4HK5A 4W9TA 1YPXA 4S3GA 4H8NA 2RDTA 3CAQA 3P61A 1RSCA 4ZVJA 1KBKA 2OQYA 2YFNA 3RMEA 4XVDA 1LRTA 4DBDA 2BOEX 2AGTA 3P3BA 1PJ9A 2WCGA 3AOFA 1UZDA 2X7VA 4XV0A 1H41A 1DBTA 3MVTA 4C6CA 3QY8A 4NILA 4E4PA 3PSVA 5D37A 5K4XA 2VRJA 5AOUA 3LM3A 2ZC1A 3PSWA 1OT1A 2C15A 2F84A 3PWIA 4DJED 1BD0A 3FVDA 3NAVA 1DXEA 1RXOB 3AZTA 4GUJA 1GNXA 1OX4B 3L68A 2DUAA 5LXXA 3DYMA 4D6CA 2GQAA 3IWPA 4PSPA 1BEUA 4AZIA 4AIBA 1ODZA 1UD4A 1FFRA 4XTDA 3PC0A 3M0JA 4O10A 5HATA 2WMIB 3NGFA 2QPXA 3HPZA 1QUMA 2PDQA 4B5SA 2KX9A 2VJXA 3DKJA 2QW5A 3ZS4A 3GFZA 4OQVA 3U57A 3HJEA 2CLEA 3CEUA 3NSXA 5DT5A 3GIYA 4L4LA 5TQLA 1XDJA 1JPKA 1I2PA 3ABRA 3KWSA 2GQ9A 2OO0A 1PKMA 2DT3A 3CQJA 4BZYA 1HKKA 4C1KA 2BG5A 1KBBA 2ZADA 3E2RA 5D4YA 3HPXA 2GJRA 3TC3A 4MAVA 1JZ5A 4DRSA 4FLOA 1S46A 4W7UA 3GYCA 4URIA 3VC6A 1W3LA 2ISSA 3G1XA 2YFOA 1JYVA 4J3SA 5D8ZA 1SZEA 2GDQA 2WSKA 2ON3A 3WF2A 3M44A 4ZOBA 2ATMA 1J5SA 1I0BA 3MSRA 4RZ5A 5T9CE 4GK8A 4JKLA 1UWRA 1VFLA 2FJKA 2DFAA 3CH0A 4XZHA 2A3HA 2CXGA 5BU6A 4CCDA 5A8NA 4ZZ9A 1ZL1A 1PZ0A 2V5CA 2PTWA 5CAHA 7A3HA 3B8SA 4ZTYA 1OIFA 3TWAA 1B5TA 4UFJA 3MU7A 2EPOA 1TFVA 1IR1A 1U5JA 2G95A 4US5D 1R2RA 1LG1A 4M29A 2QAFA 1K6AA 2GWNA 4WRHA 1BHGA 4NAFB 4PUWA 1R87A 5ECUA 3ZLFA 3KEHA 3P8IA 1MRQA 3AMDA 1A5LC 4A8NA 1BQGA 3BW3A 5HJLA 4ES4A 4HOZA 3UXAA 1KA9F 1TVPA 3ITYA 5D02A 2H90A 2QZRA 1HL9A 2VZVA 2DSZA 1I2RA 2OX1A 5D03A 3SIMA 2DZSA 3F1QA 4AWUA 3HFYA 4RPPA 5BOEA 1EYEA 1UD5A 4TR9A 3WLQA 1KCZA 4O19A 3N3TA 5I3DA 1YNQA 1T5AA 3VD4A 1AFSA 1V93A 4J27A 6REQA 4KPLA 1KM1A 1ZP3A 4JEQA 4RW3A 4S3DA 1TZZA 2YYTA 3NQ2A 2BXVA 1M7PA 4NZFA 4NXKA 1RA5A 4NX5A 1CGWA 3WF0A 5BMWA 1XISA 2WC3A 4WDUA 3KDOA 2UV8G 4EWJA 1IIGA 2VFFA 1UD3A 1XYCA 3M47A 1POJA 4L1WA 3L2IA 1AH3A 4LVGA 4I9AA 1B57A 2OOGA 1A0DA 5CSYA 4CQAA 3C2FA 4REQB 3BPWA 1E4MM 1WB0A 4FS9A 1ZS2A 4Z0SA 4AVFA 6PTDA 1Q65A 1LZOA 1Z42A 3L5MA 3WMLA 4CN4A 3CL6A 3PG8A 5FJIA 3K8KA 4KF1A 2OEKA 4B2DD 3H4GA 2OSYA 3S1XA 4AXNA 3E3HA 2IUZA 4JN8A 2A3LA 2ASHA 1WZLA 1ZY9A 3BZJA 3VKDA 2EG8A 3MMWA 3HQOA 2D23A 3VGHA 1VGAA 3NDYA 2VXNA 1OGBA 1CGVA 4F0KA 4HKPA 2PLJA 4JXCA 3O0FA 3O7UA 3KLLA 2FGZA 1XWYA 2V38A 2W27A 4E3VA 3D5HA 2ACQA 3QR1A 1ZP4A 4N9DA 3EXSA 3MUIA 4M19A 1NM9A 1TV8A 3VGGA 4QP0A 3C0LA 1MI3A 3XINA 3TKFA 1YMYA 1PKNA 1I1WA 1I1XA 1XV8A 2J7BA 3LGDA 4S3FA 4AISA 3F2DA 3MJYA 2INEA 4Z2JA 5A8QA 2V5BA 3KLKA 1WKFA 4BWLC 4D2JA 4LF2A 4AF0A 4JFWA 3EDDA 3NQEA 3HN3A 2DVXA 2AKZA 3C4UA 4DZHA 2VX5A 4B5XA 4QJ4B 5HQMA 2WVTA 2WZIA 4K1GA 1JD9A 4NJJA 3LRLA 4H9TA 4WGHA 3GBEA 2J27A 4FF5A 1XYAA 1NP2A 5TBOA 1HQTA 1IXPA 3NZGA 1QPQA 4XVEA 1TV2A 2QV5A 3S9ZA 1B3WA 3MCOA 3OVQA 4J7RA 1IZJA 4KWSA 3N2CA 4NZJA 2NT0A 1Z7AA 3ARTA 3HU7A 4BCEA 3CUFA 3GXTA 2WCAA 1L0PA 1V51A 4AAJA 3M64A 1L8PA 2J7FA 5LA1A 1UKSA 2YLLA 1KM3A 2WBKA 4LGXA 1QT1A 3FGCA 1PV8A 4MG4A 5DXXA 4I5RA 4TOQA 3A4WA 4H8UA 4FZIA 1U33A 3W7IA 2IQTA 4W85A 3U5YA 4V2XA 5HR6A 1UWAA 4H8VA 2PBGA 1AG1O 1WA3A 3MV01 3P84A 4R7JA 5HBFA 4ZO9A 1FX6A 1UP2A 4ZB5A 2WNZA 2WNQA 4GABA 5D09A 3DG6A 1VBUA 1O66A 1QI5A 4JOMA 3EWZA 2QUTA 2QMKA 1DJQA 2D2HA 4R33A 4AY8A 2W0UA 4H2CA 4LBRA 2P88A 3VIHA 2Z00A 5FSDC 1UWTA 3H2MA 3EWBX 4LVDA 4U4MA 4MNMA 1WOAA 1W6TA 3OIHA 1QNSA 3FCPA 2GOKA 5DFAA 3EXTA 4UQAA 3TYBA 3B8UA 3GVVA 2DW6A 1EP1A 3V16A 1UZ1A 3WK3A 4RL3A 2GSHA 3VU2A 5HUOA 1ALDA 4OOUA 1J96A 5GVJA 3LXBA 1WE5A 5HXMA 1SMDA 4PL1A 1BGGA 2GJNA 3EWUA 3CUZA 2J6XA 1XKYA 1F3XA 3WFZA 1H4PA 1K4GA 4A2RA 3E0LA 5DXYA 1CB2A 5F4XA 4C7GA 1XH2A 3BVJA 2EG7A 3RRXA 4TMBA 4U28A 3TTOA 4NYYA 1AK5A 1O5RA 5AHIA 5CAKA 1ONWA 1CGUA 5GPRA 2WC4A 3FIGA 1MXSA 2QJNA 4PB3A 1LRNA 1QOPA 4DZ5A 1QNOA 2YLAA 3MZ2A 4M51A 3W7DA 2V2DA 5GNXA 3U6WA 1H60A 3HGSA 4JCLA 1PAMA 4P8UA 2FZDA 1Q3NA 3T8LA 2PDHA 2QMJA 5FACA 1PXGA 4U3CA 1U1HA 3VDHA 4AB4A 1PTDA 4PA8A 3T44A 1H61A 3GLCA 3CJPA 4UFMA 1IT0A 2H8XA 1BF2A 2CZFA 3QC0A 4C6FA 4XIAA 4ZEPA 2E0PA 3G18A 3BURA 2V69A 2Y62A 4C90A 2W5FA 1JZ8A 1T8QA 3STFA 2G97A 3CTLA 4EXBA 1E1EA 1TJRA 4MUPA 4N9BA 4GVGA 4GD0A 1PWMA 2HVOA 2PWFA 1VBJA 1WZMA 3BXWA 3W1NA 4RNJA 2RAGA 1IZKA 3KRSA 2J7DA 1C8XA 4JFSA 4LUIA 3ISIX 2BGNE 2ODOA 4AHQA 4M56A 3SN4A 2ZE0A 1HO4A 3GUGA 3SUTA 1XYFA 3HBLA 1YXYA 5FEZA 1X39A 4ZB2A 3D3AA 3M6DA 4MDPA 1XRSA 3UZ5A 2J7HA 2GVJA 4JTRA 1DEDA 1CYGA 3FHQA 1UH4A 2PBOA 1P48A 2BNJA 3N1AA 1EDGA 2XM1A 3WLPA 1FOBA 3SURA 2D3NA 2JKEA 1DJHA 2DT0A 1LF1A 4XZ9A 1OEPA 4QE5A 4O13A 1F9CA 3KP1A 2XN2A 3BQ5A 3BLKA 3VNKA 4FOJA 1R5YA 3PFMA 3S1VA 4ZB0A 1HO1A 2EJAA 4IG2A 4D6EA 4O1BA 1P6WA 1IR2A 5E1QA 2FZBA 4M81A 3FAWA 3IUIA 2C18A 1VYPX 3B9DA 1CT5A 4C6DA 7TAAA 3WEZA 3N3MA 4OV9A 3FXGA 3N25A 1E43A 2JGYA 2G0WA 2I1OA 3NDOA 4KCTA 1OFEA 9XIAA 5AFDA 3WBWA 3VXGA 9XIMA 4HU4A 2FVLA 4JFTA 3GKFA 3QQ0A 4PEKA 2Q8LA 1TB3A 1LCOA 1OFOA 3I10A 2PZNA 3B0VC 2HV5A 1W9DM 1OY0A 3SRDA 1PPIA 1VFTA 3I6RA 4UOZA 4DJDD 1MW3A 1G9HA 2W3ZA 3PTDA 4L61A 3NOEA 4W93A 3ZT5A 1KBJA 2NLYA 4MADA 5U7SA 2DSUA 4KWOA 2XIBA 3TTSA 3Q58A 1MFVA 3MKKA 1RQHA 2PWUA 1BSIA 2ICSA 1GW9A 3DHPA 2ZUSA 3STCA 4RDWA 1T7LA 2NXIA 3AYVA 2DP3A 3CNYA 3BC9A 3QBUA 2DW7A 4MWAA 1K7EA 4MAZA 2FTYA 3URBA 4AFYA 3THAA 3AI0A 1X7FA 3IJLA 2YKKA 1SYTA 2VDGA 5FF0A 2DPEA 2PDFA 4BEUA 1GVYA 4KQNA 2VENA 3N2MA 2H9AB 5BYWA 1OADA 4JL2A 4XSLA 5I23A 5BXRA 5AHLA 2CC0A 3WN6A 3GZ3A 3LSCA 3CUHA 3W2KA 3TNOA 4DYKA 2V9DA 1FP9A 1O4UA 3PZTA 3V75A 4H6QA 4AY1A 3RITA 3AAMA 1PX3A 2OPJA 1BYCA 1QAPA 5RUBA 1H0GA 3BAYA 2BY0A 1EO7A 1B90A 2PWHA 2E3ZA 3UJ2A 2XVPA 3I4KA 3REQB 1KRAC 4MZ8A 3WCZA 1TPUA 1EWDA 1WBJA 2QCCA 3DBPA 5XINA 2BVWA 3MYPA 3K4DA 3KRUA 1UD6A 4GY0A 1NY1A 1EC9A 1IEVA 5DANA 4R85A 1HKWA 4ZQCA 1RCXB 2C79A 3M0XA 1B4KA 3VIIA 4AZHA 1Q5MA 1FWGC 1PSCA 2J47A 3WYZA 1X8FA 2GJXA 3TR9A 3TSMA 4MB3A 2W79A 1S1PA 1Q7ZA 4ACYA 2OLAA 1GEQA 2YSWA 3ABSA 3ZM8A 4JN7A 3QOKA 4JHOA 1HTIA 3ZQ9A 3GU1A 4US5A 1A4LA 2OGYA 3P81A 3QSTA 1RQEA 2X7WA 3H53A 3S6OA 2EQDA 3O07A 5HJXA 1JL8A 3QV9A 4HPXA 2XINA 3GIPA 3OJGA 5CPNA 1UP3A 1WO2A 5AHNA 4PODA 1GVEA 1G4TA 1BWKA 4LVFA 5C2GA 2WNNA 2WHLA 1JNEA 5EMMA 2WJFA 5KETA 2ISWA 4MFEA 4Z2GA 3USZA 3W25A 2BXZA 4WIWA 1RY8A 3GDTA 3RGTA 1TWWA 4I9TA 4ENLA 2EF9A 1OC7A 2E5DA 3BGGA 2XSBA 3UJFA 4EIVA 3QJAA 3N6JA 4QGCA 3I6TA 2HXTA 2VURA 4IIGA 5D9OA 3NL3A 3OZPA 3ZLHA 3THUA 1U22A 1PDYA 3PAOA 1V6TA 4PUEA 1RD5A 3IJ9A 4JPGA 4HNVA 1Q4WA 1QW9A 1KWKA 4J2MA 1J6PA 1H09A 1SSGA 1NF0A 5HDRA 5I03A 2R1MA 2D0GA 2ZZ4A 3E0IA 3ME3A 3GNNA 5KZ6A 2CFFA 2PTZA 4ZA0A 4IP5A 3AYRA 3Q94A 4Q8QA 4ACZA 5C8BB 3RAOA 3BGJA 3JRKA 4UTJA 4GI8A 5XIAA 5AB3A 1E6XM 2HS6A 5CZ0A 1GZJA 1F6KA 1UC4A 3UG4A 4CUCA 4NX0A 1PS9A 1PO9A 4B2DA 1X98A 4Q8WA 4GZEA 3K46A 3CMJA 2C0AA 3TQKA 3PG9A 1B30A 1I60A 3ZYZA 8CGTA 2GL5A 3MKCA 1K77A 1LL4A 3KCOA 1ME8A 5CPOA 4PE8A 2HS8A 3T0DA 3BLPX 1G69A 2GGGA 4PCTA 4JTFA 4WD0A 2FMOA 4X2RA 1IEQA 1YDYA 3ENLA 1JDFA 1KTNA 1E4LA 4AZ6A 1B3XA 1YPFA 1HKMA 3KTCA 3T4CA 2YZ5A 4ROPA 3WMBA 1XC6A 4MYAA 1BPLB 1HFBA 4PGLA 4RDVA 1W1B1 1W1IE 3DN5A 4AX7A 4JIRA 2FIQA 5LHEA 3H22A 3LTPA 2XH4A 1XD0A 1XL9A 2OB3A 3ABOA 2VC5A 1E9YB 4Q8OA 4UR9A 2ZZ2A 3WSUA 4FNSA 4H6RA 4H9XA 4XD5A 5A2AA 4R27A 4GIAA 4L9YA 5KINA 5H8MA 1YLVA 5CG0A 3MC5A 2TODA 2Y89A 2ZX6A 5BMXA 3TJ4A 3AU6A 4C6LA 2C3ZA 3VM7A 1B2YA 3GHUA 3CTTA 1Y5WA 3KOYA 5BWAA 3NQAA 3ZLGA 2RGLA 3GVQA 4XX6A 2IS7A 3KBNA 3UCQA 3IK4A 1DTNA 4GXPA 2DZTA 1UKPA 4NJIA 3VINA 3WBAA 2E67A 2ZX8A 1HF6A 5HR7A 3NQMA 3FOKA 4YTSA 4LVBA 3NQ6A 4S1FA 1KV5A 1ZTVA 2C1IA 2H3BA 1FWBC 2V3GA 1EQCA 4DJEC 1DKWA 4RE4A 1TCDA 3CGTA 4UFKA 3SQMA 1AJZA 5HWJA 3R89A 2XH7A 4UB9A 1JQVA 3RMJA 3UWEA 4Z0JA 3I7SA 1HW6A 4UQCA 4RJEA 3WD3A 2J8FA 3FAXA 3DG3A 3SFKA 1W3JA 1UWIA 1UMYA 6TIMA 4GIYA 4NAFA 2OZ8A 4Y8FA 3TAKA 3WDPP 1XLEA 3LCGA 1P6BA 1Q2SA 4DN1A 2WO5A 1FDZA 2CLIA 3AYTA 4CQ9A 1QK2A 1CTNA 1XLKA 5JQ9A 2G5WA 4K37A 1AD4A 4XZWA 1XINA 4IWWA 4D8ZA 4NT0A 2P5NA 3I6EA 2XWDA 4C60A 1IXOA 3ZWTA 5IBXA 1KXHA 4JEJA 1Q7MA 3C3UA 5DMNA 2QDDA 1WKEA 3BWWA 4YXGA 3V0TA 2OODA 1QO5A 1S5MA 1AQ0A 4D9PA 2Q6ZA 3G6LA 5JVLA 1LBFA 3VNIA 2XIMA 1KB3A 2DIEA 2ZTKA 3NQGA 3ZVHB 2J4GA 4IF2A 4Q4KA 3C5QA 3QKZA 3TOPA 1ZJHA 1XCFA 4PMQA 2H3DA 3OGSA 3EEZA 4ZMGA 3UD6A 1F8IA 2EJ1A 3IJQA 4GISA 4IZGA 2OU4A 1EX1A 3BG5A 4X9SA 3PUDA 1PZ3A 1A3HA 3CUGA 4Z42C 3STPA 1GOWA 1LL6A 3L4UA 2JEQA 2PF8A 1BF6A 3UZYA 1FWWA 1ZQ5A 5EA9A 4B5TA 4WY0B 3QRHA 3BJFA 3MMTA 4DYJA 5REQA 3VIJA 1UBPC 2YCIX 2V3DA 1XG3A 4PYSA 1QPRA 1CXKA 1FWRA 2QCHA 4K38A 3IVUA 3QW3A 3A5FA 4F66A 5DMMA 4UUIA 5LSMA 1MQPA 4EF9A 2OXNA 4N9EA 3LX9A 1YE6A 2G3NA 4JKMA 2EPKX 1EX5A 1LORA 5DEZA 1GG0A 1NOFA 3WMCA 5G2WA 3VYLA 4GYJA 5IM51 4NSBA 1F7BA 4KWUA 3DESA 2OKOA 5IRPA 4I8YA 3H4XA 1TE6A 2QJJA 1KV8A 1XCWA 4L1XA 1CDGA 3OB8A 4E38A 1NJJA 3H6OA 2DT1A 4L56A 5HQEA 5A6BD 1JRBA 3H8AA 2E5CA 3O1NA 3PPCA 3VMNA 3R12A 1NWRA 1W91A 3EMCA 1XXXA 4HSOA 5CPMA 4AVOA 1W2PA 4FXRA 1A5MC 4Z17A 1J0YA 2J66A 1TV4A 2F2KA 3IUDA 3BAXA 4LSBA 1EDTA 2DZBA 2E6AA 3RPTA 4PTVA 5CCZA 2VRQA 5DCDA 4O15A 2D73A 2Q8XA 3B8TA 5F4WA 3V18A 1P1MA 4BKNA 8XIAA 2FDMA 4PMVA 3FEQA 3NYZA 1MW0A 3N6HA 5B7ZA 2EPMX 1M7XA 1J8VA 4KETA 4LU0A 3LNMA 3OGRA 2I16A 4KEVA 3E5PA 1PWLA 1SQ7A 4GVIA 3GR4A 3N6QA 3VKBA 1DYSA 2IKJA 1EUNA 2QPUA 4J3ZA 2PDXA 3D0CA 1UBSA 1HJVA 1CGYA 3S5YA 1JEZA 3CU2A 1JUKA 1EKOA 3WLSA 2AL2A 2ZYFA 3AICA 1GOMA 3VE7A 1QR7A 2HTMA 5CPTA 4PRTA 1HP5A 1D8CA 3G0UA 4ADTA 1X6UA 1ICSA 5JBDA 4Q8UA 1TMHA 2ZWZA 3R10A 2REQB 4W7VA 4DBEA 1SW0A 5LKYA 2WMGA 3SEPA 2VX4A 5DO8A 3UZJA 1DORA 5AC7A 3UG5A 1VIWA 1OCBA 3MVIA 4FNTA 4J2PA 5E93A 1IIHA 4PL2A 3LCLA 1V7AA 4H83A 7XIMA 1LBMA 2PWGA 3WD0A 2BASA 2XVKA 4NZ4A 1MMFA 1JUEA 3XIMA 1O60A 4FEZA 5T91A 4AY7A 2ESCA 1WBHA 3TDFA 4OU1A 1OIMA 1R3SA 1GVQA 3LN3A 3IIZA 5HINA 3LS9A 4E5TA 4CCCA 3TMLA 1C92A 4OBRA 3CH9A 2PDYA 3HB9A 4P8XA 1ISWA 2X2GA 4MPQA 1JDCA 1FH7A 4AD4A 5GNZA 2Z2UA 3URNA 3M5VA 1V0KA 3NA8A 1O95A 3AXMA 2GJPA 1Q6FA 1R7AA 1E55A 2WXDM 4A4AA 1OB0A 1WDWA 1IZCA 3QV6A 3VDCA 4X22A 4Q7IA 1MO0A 3AIUA 2Z26A 2VKZG 1J18A 4F9DA 4B5UA 5C9ZA 1VFOA 1JGMA 1E0UA 2HBVA 2FQIA 1GT8A 2ZICA 1F2JA 2Y5SA 2Y2WA 1EZ2A 3RLHA 2QUVA 1B0IA 4DPPA 1ADOA 5G1TA 2TMDA 4V1YA 5CSUA 1V3MA 2IQ0A 3LK6A 5C7HA 1U83A 3EKGA 4Z1CA 1C90A 3LBCA 1U1JA 5XIMA 4N42A 3DFOA 3NQFA 4GIEA 3TSDA 1W9XA 3RO8A 1TJPA 5D32A 1REQB 4FLRA 2DJXA 2G8ZA 2YCLB 3E2QA 1S1RA 1LTDA 3W22A 1O5XA 3G0XA 4W87A 5LIKX 3SCWA 3GO2A 3W7HA 3W81A 2ZZ3A 3GDBA 4MNLA 3R1ZA 4PSRA 2Y63A 4S3KA 1WPCA 3IGXA 3W1QA 1XI3A 3PBVA 4PMRA 3PN8A 1EQPA 2EBNA 1KRMA 1EF3A 2R1LA 2FZ9A 3L4YA 4O8RA 1SGJA 4JTAA 1V6YA 1QI2A 3QHMA 1JI2A 3QZAA 4Y96A 3NL5A 1JFHA 2VZUA 2X42A 1R2TA 1BFNA 2P8BA 1W0MA 2PI6A 2ZRUA 1XG4A 4FNPA 3BV7A 3IS4A 5FJJA 3VZXA 1GW1A 3UA3A 2CKRA 3L0KA 5TD4A 1O7AA 3P14A 2RGMA 3LPPA 3P7YA 3LGEA 4PBGA 3TN6A 3BH4A 2PFHA 2QCEA 4IH3A 4N4QA 2Z28A 7REQA 2VUYA 4RE3A 1EHNA 1C8QA 1R85A 5HMSA 1JR1A 1EZWA 3AMKA 4HPJA 3C2YA 1KFWA 4N4PA 1TV5A 3HGOA 3W74A 1LYXA 3W24A 4A05A 3FNDA 2XVGA 2HSAA 5DN1A 5M3WA 1MZRA 4WGXA 1FWNA 2PGEA 3EAUA 2E09A 3NZRA 3KBMA 1WX0A 2PF0A 2QEZA 1LLZA 1X38A 1BAGA 3BICA 3UERA 1SW3A 3T81A 3LCIA 1NWTA 1VENA 4IICA 5LXEA 4IIHA 4ZOEA 4NIRA 1XIGA 1BVWA 1EJXC 2HK1A 1V0MA 2FHBA 4HZ8A 2HPIA 3UCDA 4R9OA 2HVMA 3U4AA 2ZDSA 4ZO7A 3W2JA 3ERPA 5MKGB 3W1AA 2XSXA 3E0WA 4B9ZA 1UKQA 3KOZA 5A8GA 3HMCA 2A5HA 2FTPA 3W2UA 7ODCA 2RJHA 4B4HA 4A3QA 4BJHA 1THFD 5ABHA 3NURA 2BB0A 1FKWA 1UR0A 5HULA 4AVNA 3IRDA 5I3FA 3FKKA 1G7UA 1P6CA 2CITA 1L2QA 3GWQA 4GLEA 1TWSA 4POCA 4WX2A 6XIAA 3TP4A 5A6TC 5LHFA 1HJUA 5A94A 4IPNB 5F2GA 1IV8A 2NQLA 1XLAA 4HT3A 4NNCA 3FJLA 4CN1A 2NVDA 3PBWA 1Q6QA 5GJPA 1H49A 4XK2A 3S2CA 4HTYA 3QGKC 1XSKA 3CASA 1TUXA 4O28A 3OIXA 2NUWA 4CD5A 2E8ZA 2V5DA 3P60A 4W4QA 1VBHA 2VEGA 3P62A 3CYVA 3CB8A 1KRCC 3RX4A 4A8IA 4TMCA 3TR2A 2PAJA 2OR2A 2QLYA 3HG5A 3IJIA 3PBYA 1VBRA 2D0FA 5HA7A 3UGRA 3GG7A 3C3NA 4N9CA 2JK2A 3H2CA 3CZJA 3G8EA 5LIWX 4O4WA 1FH9A 2DVTA 2YGYA 3L67A 2VFDA 1FY6A 1QWGA 3QM3A 1FQ0A 2PC4A 1SZFA 3NM1A 3O16A 3WFAA 4IL0A 1JIBA 4YLWA 2NV2A 1F3TA 3UA4A 4EACA 4TX8A 4V28A 3LENA 4PTMA 1FWJC 1VHNA 3U7BA 4KIRA 2QDGA 1YW1A 3REQA 3FN9A 2CZDA 1G1YA 4UIOA 3VDBA 4PUUA 4MNJA 3TEVA 2XWEA 1BG9A 3R6IA 4DJDC 2XYLA 3PBGA 2YCJA 2A21A 2QS8A 3MB9A 3SY1A 3SRFA 1FWDC 3S1GA 4HVXA 1XIDA 5FJUA 2QNEA 3WH8A 3MCMA 2E4TA 4CCZA 1CBGA 1LQ0A 5G1MA 3W1PA 1IT7A 4ICMA 4KW2A 1BLIA 2ZXQA 3GNXA 2B31A 3R0UA 1EOKA 4HSHA 2OEMA 3RJXA 3U8GA 1L6WA 4W5UA 3T05A 4LS2A 2QJHA 3N14A 3WLTA 4GUHA 2QCGA 3KUMA 3G5EA 3OHMB 4CNPA 3WEOA 4LTSA 3NUKA 2PPGA 3C0JA 4GYPA 3LRKA 4NZCA 4PCSA 4C65A 3V5CA 1BXBA 1S2CA 4MOZA 4TO8A 4ZE4A 4MB5A 4W8BA 3KP0A 1IEIA 1ZUAX 2J79A 4HNOA 3B0PA 4YS1A 5LNRA 4M6UA 1E5NA 4P7LA 2CLLA 3V1HA 4F48A 1AW1A 3BSHA 4MY1A 3WDQA 4UOQA 2NQHA 1H0IA 4DXXA 2Y5EA 1J2BA 1UROA 3A4XA 1QW7A 4E2DA 4DJFC 3RUBL 3LMYA 3CIXA 2AQWA 2WKJA 4OUEA 4DLMA 4QLKA 3W38A 2Y5JA 3B8VA 4PH6A 4XB3A 1LLOA 3E74A 3ELFA 4JTGA 3GH4A 1AL7A 4WDWA 3S6DA 1C3FA 2BXYA 3TXZA 1XH1A 3OBKA 3NPWA 5LIUX 4MMWA 1S38A 1HL2A 3TIMA 3DCPA 1P0EA 1V3JA 3USBA 1OBAA 4LYQA 5K2ZA 1DE5A 3K2GA 4HJFA 3ZJ7A 3CPGA 1JPHA 2FPYA 1U30A 3BOLA 2VRKA 3FEMA 1YNPA 4F0RA 3V4BA 3L5LA 4FP1A 4OBSA 3N4FA 4K8EA 4Z08A 2OWCA 1UH3A 1T96A 3LRMA 4O8AA 1UB3A 2VL4A 2WCSA 3NWRA 2X0SA 1KNWA 4IPJA 1SJAA 2XGZA 2JKAA 3KM8A 4H6EA 1EHAA 3TCSA 2PP0A 4WOQA 4RV3A 2HNHA 5G4WA 4E8DA 3WF1A 2P8CA 1GJWA 2WKGA 3EPMA 2I7GA 1S2VA 3KHJA 3KE0A 2ZRWA 4JD4A 2CIPA 3TYUA 1IEXA 2F61A 4XZLX 5JIPA 4CCEA 3W1UA 4AMCA 4B3KA 3DC0A 3QY6A 4ADUA 1WUFA 2PDLA 3B0XA 1TR1A 2ZX5A 3FS2A 3QLLA 1QTWA 1A3XA 3NIYA 4AMAA 2QULA 5FAGA 1HKVA 4B92A 4QFUA 1DWFM 1RCOB 3M5ZA 2CBUA 1EIXA 3VOIA 2VYOA 2A79A 3E9AA 2XGBA 1C29A 1OC6A 4NQ1A 1GONA 3KDNA 4FIQA 3A64A 3OODA 4PRRA 3VFCA 1XD1A 1K03A 2YOCA 3L7RA 2J74A 4QLLA 3LDVA 1Q6DA 1WV2A 1P5BA 3TK7A 2QCDB 4Y9NA 1F4AA 2VQUA 3O6CA 5I5RA 5C55A 1Q85A 1XLHA 4GACA 4NJGA 1CGXA 1WAUA 3W71A 1W3NA 1NP0A 4FNRA 3SRHA 5K7JA 1QK0A 4PMDA 2XIIA 1JZ3A 4UNLA 4DO6A 3T8QA 3LOTA 3KVKA 1DWGM 3PZOA 4A3UA 2WVVB 3HPSA 4LUTA 4L6OA 4NZ3A 4KBXA 1XBXA 2Z27A 3IK2A 4JIIX 5A1AA 4AZBA 5ABTA 1XC4A 4GKTA 3DHUA 1RP9A 4JICA 1B4EA 3TW6A 2UY4A 1YTEA 3WDJA 2Z4GA 5AYZA 1X1ZA 2G3JA 3NNTA 3N18A 1YX1A 3W87A 1ZBVA 4JKKA 1ZFJA 3P67A 1JAEA 3PANA 3QKEA 3ECQA 3LMZA 2E9LA 3F4WA 1G7VA 2O9TA 1W8GA 3BAJA 3T40A 4LRSA 3WH9A 5DCBA 1JCTA 3QW4B 3C61A 3TTEA 1EC7A 1TELA 4LNCA 1J93A 3VMPA 3KRBA 2A0NA 2GSEA 3VIMA 3CXOA 4IGNA 3S1WA 4S38A 3W26A 4NAEB 1UUMA 3SUSA 1YXCA 4KRZA 4U33A 4GQGA 1KXTA 1UPPA 3OBEA 4Q7NA 1XDLA 2QUNA 4UMCA 1A5UA 4BR1A 2UY2A 1VIZA 3MWCA 1H1NA 1OYAA 2QCMA 3HGRA 3HFTA 3MA8A 1CXEA 1OCJA 3C8NA 3XISA 2R1PA 4BQ3A 3MANA 3MBDA 1TJ2A 4OTKA 2XGIA 1DIDA 4L5ZA 3B9OA 4Q22A 2YA0A 4C6EA 3LCHA 4PB5A 3AALA 3EYPA 3BE7A 4H2HA 3PUEA 3QYSA 4WR3A 3SAZA 2GK1B 1IHIA 1UZHA 3GXMA 3DBNA 4DUXA 2W4XA 1FVPA 5DT7A 1JXJA 3QQ1A 3R0KA 4DHGA 2QDEA 4D1JA 3WEMA 1IXQA 5KZEA 5FESA 3TFXA 4WDTA 1GEHA 1OCNA 2VZSA 3V1PA 2NX1A 1Y0EA 4LAMA 5LA2A 4LANA 3CLMA 4F0MA 4CVWA 1W5QA 3APYA 3WDRA 4FSAA 1V6XA 4CLMA 4WLCA 4ZCWA 3RLUA 3UJRA 2OKTA 1TTQA 3DGBA 4QJ3B 1RAKA 3AWOA 3ONBA 3U0HA 1L6YA 3K30A 1JDEA 2MANA 2WPBA 1TVNA 3VAVA 2OLHA 3TLLA 1RJRA 4LS0A 4YHEA 4JAWA 3WQWA 4LNYA 3G8RA 1HKIA 4ZXLA 3AROA 4J3TA 1GTEA 3FSTA 2ZX9A 5T9BG 5BRBA 3R58A 1V02E 2OMAA 4FF7A 3T7VA 4DEFA 3FX4A 4UTLA 3LUTA 5BU9A 1W9PA 1WAWA 2ISDA 5FKYA 3IAQA 1P0KA 3RR1A 4MIMA 3M5XA 1MQRA 5ABFA 2CPUA 4H9MA 3RPMA 3VCCA 1W1VA 4DO5A 1LJYA 2CHOA 3HMJG 3WQ6A 1XUZA 3NYDA 2H6RA 5CJNA 1UD2A 2J13A 1TZ7A 2OZTA 4CU7A 3GB6A 4O0ZA 2WJZA 4V27A 1SFLA 1XLJA 2Y88A 4NL1A 2HJPA 2ZUNA 3P82A 2RH9A 4GKLA 1KLZA 4H9YA 1XIMA 4M1RA 1RPKA 2GDVA 4OHQA 1TRDA 3LHUA 2QCLA 4EAYA 5H8PA 4LF1A 2VELA 1E1CA 3GH5A 4NYUA 3WUGA 3AFBA 1O94A 2YPIA 2FZ8A 1NVMA 1P4CA 2XVNA 3EMZA 2BHUA 3UU0A 2GLKA 4NRSA 3I3DA 1H50A 4RE2A 3S83A 3PJWA 1KBIA 3UPMA 1XLGA 2R6OA 2OWXA 1VLWA 3DUGA 3RYSA 1VC4A 5EBUA 2CEQA 3G6MA 3COTA 2WMKA 2GGIA 2ATSA 4ZOAA 4OV4A 3UEQA 2DZVA 2INFA 3HZ3A 3C2RA 3PZMA 1E9LA 3APGA 3V0UA 4YJ5A 1DJYA 3CQIA 3M9YA 4O50A 5B7YA 3MUZ1 4G56A 3GHSA 3M6YA 3L4TA 4C6BA 4KFOA 3M43A 1AMKA 4CNTA 2WC7A 3UWYA 2Z1KA 3S9YA 1TPEA 3MTWA 4DWSB 2QXWA 3S46A 3AUOA 4JTJA 3IEBA 1ZGDA 4UCFA 4X3ZA 4LC8A 4QS5A 3LQLA 4FR6A 3GS6A 4D6JA 1MNSA 1W3TA 4L65A 1GVSA 1V4YA 1VRXA 1QRQA 2VCAA 1DPMA 3KOXA 4LVAA 2GVYA 4LYKA 3MV11 5CZKA 4IFRA 4OOZA 4DF2A 5CXPA 3N11A 1Y5VA 2FLIA 1TMLA 4A29A 1YADA 4DY1A 2YL8A 5FL1A 1CXIA 1FA2A 1G5AA 4LFYA 1IWAA 1PBGA 1VH7A 1ELSA 2R9RA 1ICQA 4HHMA 5MF5A 2WMFA 3CYJA 4D6GA 1MYRA 4NNBA 1BXCA 3B06A 2BMBA 3OEXA 8TIMA 1REQA 3PZUA 3H2OA 4CD6A 4UTUA 1DXFA 1P43A 2E25A 4Q32A 1XKJA 4K7YA 2E6YA 1DIKA 1QATA 1RK6A 1XLDA 3BLFA 4E2OA 1TX2A 3SECA 3UZXA 1OF6A 3FV9A 4ORMA 1EJRC 2O9PA 3WJXA 1E3ZA 1B3YA 4JS3A 3BO9A 1I2OA 1E70M 1G4PA 3AO0A 2VEFA