3LUTA

A structural model for the full-length shaker potassium channel kv1.2
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 120
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lutA00
1YNPA 4HBKA 4QX4A 3U2CA 2BGQA 2PDUA 4HMNA 4XZNX 3V0SA 3F7JA 4YVPA 5M2FX 1MZRA 3EAUA 3G5EA 3RX3A 2ALRA 2IPGA 4F40A 3GHTA 2NVCA 3LZ3A 4QBXA 2A79A 2IS7A 2PD5A 3V36A 3G1RA 1X97A 3KRBA 5AZ1A 3ONBA 2ACQA 3B3DA 2FZBA 1LQAA 3MB9A 1AFSA 3R94A 4YS1A 5LIUX 4GABA 2HV5A 2PDNA 4XZLX 1EL3A 4JTRA 4JTQA 1AH4A 2PZNA 1PWMA 4DBWA 3NTYA 1Q13A 2J8TA 1SM9A 3MC5A 1VP5A 2ISFA 4XO6A 4ASTA 2FGBA 1PZ0A 4IJCA 1Z9AA 5JH2A 4XK2A 5LIXX 3Q67A 3UP8A 4GCAA 2PDKA 3WG6A 3DN5A 3GHUA 2INZA 4IGSA 2AGTA 4ZFCA 2C91A 1JEZA 3WBWA 2VDGA 1S1RA 4XVEA 4JQAA 2QXWA 3M64A 5DANA 3LENA 3RX2A 2PEVA 4LAZA 1ZGDA 3BUVA 1MI3A 3UG8A 3ERPA 4PUWA 2HDJA 1QRQA 3WBYA 4FAMA 3GUGA 4WDWA 4XZIA 2PF8A 3Q65A 2PD9A 2PDMA 4LBRA 2INEA 2PDGA 2HVNA 4DBUA 2IQ0A 1XF0A 1HQTA 1R38A 2P5NA 1S1PA 1AZ2A 3H7RA 1YNQA 2WZMA 4GQGA 4FZIA 1Z8AA 1AZ1A 5HNTA 4XZMX 2I16A 2IKGA 3CV7A 2DV0A 3UFYA 4H8NA 2HVOA 1RY0A 1EF3A 1QWKA 1GVEA 4QXIA 1C9WA 1RALA 5JH1A 2IKJA 3ONCA 3GHRA 5LIYX 3M4HA 4I5XA 3GHSA 4NKCA 1OG6A 3R43A 4MHBA 3COTA 3M0IA 4PMJA 4YVVA 1RY8A 4WDUA 2IQDA 3DOPA 3CASA 1A80A 3R58A 1AH0A 1J96A 1IEIA 5HNUA 3UWEA 4FA3A 4GA8A 2PFHA 3UZXA 5LIKX 2BGSA 2R9RA 3R6IA 4GIEA 2FZDA 4IJRA 3LQLA 4PRRA 1PZ1A 3VXGA 4RPQA 4DZ5A 3EB3A 1PYFA 2PDYA 2PDIA 2PDBA 4JTAA 1ADSA 4WDXA 2IPJA 1EXBA 2PDJA 2BP1A 4WGHA 4WRHA 4LB3A 3LQGA 2IKHA 1AH3A 3LN3A 2ACSA 2PDWA 3O0KA 4FALA 2F2KA 3LEPA 4XAPA 3BURA 4Q3MA 1ZQ5A 4JTCA 2R24A 4Q7BA 4R9OA 1K8CA 2PDFA 4GACA 3N2TA 3CV6A 5C7HA 3S3GA 3V35A 3CAQA 4JQ4A 4AUBA 1T40A 3UYIA 4QR6A 2ACUA 3UGRA 2CLPA 3LZ5A 2PDLA 1LWIA 1YE6A 3UZWA 1X96A 2IPWA 2FVLA 3UZZA 1EKOA 2PDQA 4ICCX 4L1WA 3LD5A 2F38A 2HE5A 3V0UA 1Z3NA 2I17A 3V0TA 2NVDA 4XVDA 3CAVA 4JIHA 2FZ8A 1S2CA 4WDTA 1Q5MA 4PR4A 2PDPA 4PUUA 4YVXA 3N6QA 1UR3M 5AZ0A 3WCZA 5LIWX 1ZUAX 1HW6A 1XGDA 4H7CA 1Z89A 1M9HA 3QKZA 4YU1A 4JQ1A 1MRQA 2HE8A 1YE4A 4G5DA 4JIIX 4GQ0A 4LBSA 3FJNA 1US0A 1FRBA 3LBOA 2WZTA 2PDHA 3UZYA 3D3FA 4PRTA 2DUZA 4JIRA 1T41A 1X98A 4LAUA 3FX4A 4JTDA 2DUXA 4XO7A 3BCJA 1IHIA 4DBSA 1VBJA 4JQ3A 3R7MA 1ZSXA 2IKIA 3R8HA 3T42A 4JQ2A 4EXAA 4XZHA 1PWLA 2HEJA 3P2VA 5HA7A 3LUTA 3H7UA 3BV7A 4LB4A 1S2AA 2FZ9A 3WBXA 3LNMA 5KETA 4WEVX 3EB4A 3CMFA 2PDCA 3RX4A 2ACRA 2IPFA 4L1XA 3R8GA 3H4GA 1XJBA 4EXBA 2PDXA 4OTKA 3C3UA 3O3RA
chains in the Genus database with same CATH superfamily
3MQTA 1TJ2A 3S6OA 3GXFA 4L56A 3B8UA 3WQEA 4J9JA 4GVGA 4Q8OA 4DNHA 1UUMA 4I9JA 3KL3A 2JALA 1KNWA 3TEVA 3TP4A 5A69A 4JDYA 1Q85A 2PD5A 5GPRA 4KCUA 3VOJA 1NOFA 1HG3A 3WJYA 1GOOA 4RDYA 3INPA 3PZVA 1LQAA 2W0UA 4GIYA 1AFSA 2E0PA 1XBYA 1GVOA 1GW1A 2X1IA 4XZLX 5HANA 4Z0JA 3C8FA 4Q4RA 2X42A 1U5JA 3SCSA 1NU5A 2G0WA 3DFSA 3II1A 4PB5A 3W2MA 2Y8KA 1JCMP 1C90A 4KGJA 1NFPA 5TAOA 3F4VA 3TUUA 1DXIA 4GKTA 3WH5A 3UA3A 4BF5A 4UFHA 4WOQA 2Z26A 3AMKA 4XKYB 4WKHA 4W8AA 1K4GA 5I3HA 1M7XA 3IIVA 4QJ3B 4O57A 4XZWA 2X09A 3T9PA 3LBCA 1EO5A 2NV1A 1REQB 6XIMA 3BMXA 2VR2A 1QNOA 1WA3A 3UWVA 3LENA 3F4NA 4R5EA 1UP3A 4KWOA 1US2A 1MI3A 3ERPA 1DYSA 4Q8QA 3GUGA 2Y0FA 3DECA 4WDWA 3W7GA 2JKAA 2D2OA 3QTGA 4RW3A 2X7VA 2Y8VA 5FF3A 3CUFA 1SZEA 2PD9A 3AFBA 3UBPC 4PBGA 4H7VA 2PGFA 3HGJA 4HOWA 5I7GA 2FZNA 3G0XA 2VOMA 1VF8A 3S6DA 3C8NA 2P5NA 4QQ3A 4GI6A 1EBGA 5DX7A 4U3AA 2YDAA 3LTSA 2OPJA 1AQ0A 1ONRA 4Q8WA 4GFSA 2A6NA 3CLMA 2I16A 2IKGA 2VVSA 4MIMA 3M9YA 4HU8A 4H8NA 4V15A 5D03A 2E4TA 4Q8TA 1OG6A 3LLFA 1TPEA 2H6RA 3LERA 3ZYZA 4DYEA 5FJPA 5FEXA 2PURA 1HGYA 1RY8A 1SW0A 4GPNA 4QLKA 3S1UA 2FPYA 2RGMA 1O66A 4GY1A 5CBJA 4TXEA 2BSLA 5CGMA 1AMYA 3LCGA 3ATZA 3KRUA 1CPUA 2XVGA 1M01A 3GFXA 2HTMA 3VE7A 2RDTA 3N2BA 1UZ1A 4DM2A 1XIDA 2WHLA 2FPTA 3E0FA 1XFCA 5I03A 2FMOA 2QYGA 1LZOA 3SR7A 1H61A 1T99A 1KWKA 3ITTA 5D8ZA 4FNPA 3WD4A 3R11A 4JHOA 1V6XA 2ALDA 5FL1A 4CD5A 3GU1A 2A2IA 4WKAA 2PGEA 1BTCA 1QW7A 2PDWA 4L64A 2WNQA 4GI4A 2VC9A 3BSGA 1BF6A 4OOUA 1DJWA 1BHGA 1K8CA 4O1CA 1E6PA 4K6AA 3SRDA 3L5AA 3M5VA 3GG7A 4BA0A 2VHLA 4M80A 3SO7A 1G9HA 1Z6KA 1UOZA 3ES7A 4JQ4A 1F8MA 3M0MA 2Q8ZA 4M51A 4XZ9A 1GVQA 1O5RA 3DHPA 4M7TA 3JU2A 2ZVIA 4ADSA 3C0QA 3A22A 2HK0A 1FP8A 3N2CA 3QSTA 3NQ7A 3VMNA 4DRSA 1A5OC 5C71A 4N42A 3MVIA 4NJHA 1KM5A 1NOWA 1OC5A 3AHYA 4B16A 3H2AA 3N25A 3FLUA 1PKNA 3TNOA 3BG5A 2V5KA 4YPJA 1HL2A 3PAJA 3BCDA 1ZTVA 1JRBA 3UZ5A 2OZ0A 3W76A 3VNLA 5HR7A 3SIZA 4NJJA 4RW5A 2UY4A 1JPMA 1ZBCA 2OX1A 1AJ0A 1XWYA 4HA4A 2Y63A 1JGMA 2BLEA 2V3FA 4WY0B 1VFFA 3W0KA 4ZR8A 5F2MA 4Y8FA 1W2PA 2PSNA 5C0QA 3BOLA 3GC4A 2O56A 3RPDA 2XDFA 3PPHA 2TPSA 1MDRA 5CJ5A 1TMQA 4GXPA 5RUBA 3S2NA 3LCWA 2GGIA 1TWWA 2WM1A 1RBOB 1KR0A 4MKVA 2WMIB 1ISXA 4IFKB 4QLJA 4B4HA 3UW6A 2V8ZA 3TYZA 5AVNA 3RNDA 3QFEA 3TROA 2EBNA 4PUDA 1QNQA 3VK5A 3V1PA 2OTDA 2QGYA 3HGOA 2VZOA 1EGMA 5C6MA 2W9MA 3H7UA 1WCGA 2NSOA 4L61A 5JBFA 2WCSA 1NDWA 3TVAA 1DJNA 3NPXA 5F2IA 3TN4A 1H49A 2I5QA 3QHMA 4HHLA 2XWDA 1XJBA 2E9LA 2AQOA 1F6YA 3T1GA 3WNLA 4H41A 4BZYA 1ME9A 1MMFA 4WF7A 2YL9A 1J0YA 5IBXC 2BMBA 3GXNA 1T96A 3CLWA 3F2CA 2YL8A 1JNEA 4QJ4B 5IFTA 4PH6A 1B57A 3WEMA 4DF0A 2CZFA 2ASHA 1O4UA 1CENA 3BGAA 2CEQA 4PUKA 4W86A 4UTHA 4GIAA 1YPFA 4O12A 1V3HA 3L2LA 4MWAB 3V4BA 1JCXA 3PPFA 3ONBA 3OB8A 3HGRA 1G6CA 1IEXA 4ZO9A 1Y5XA 4LCSA 1ITXA 1TIMA 1VH7A 4QE1A 3NOEA 4MB3A 4WSHA 3W85A 4LALA 1GPFA 1SFJA 3WNKA 2ABBA 4G1KA 2QNEA 3GVWA 4FOUA 2VUYA 3H4XA 2J7DA 4LVFA 2X8RA 1XQKA 1IXPA 1OD8A 4IL2A 5A1AA 1VP5A 3TW6A 4A05A 3E38A 4JKLA 2YL5A 2I1OA 3NQAA 3LX9A 3JRKA 1H0GA 1WV2A 2Z1XA 4QSFA 2PP3A 2HVMA 1LL6A 1CXEA 1SZRA 1OD0A 3ZMRA 1XLKA 2WSYA 3FFSA 3TDFA 3BW3A 3L9CA 4D6FA 2X1TA 1DE5A 3D6NA 3VMPA 1U1JA 2QJIA 3QQ1A 1IXNA 4NRSA 1E15A 1JEZA 4GOAA 3T8LA 4JTGA 3VC5A 3QXBA 4K36A 5HWMA 3KLLA 4MFDA 3I65A 3N12A 4E4PA 5KINA 5CZSA 4E2BA 2W27A 1UKPA 4WKFA 4B5TA 2H8ZA 3F03K 1IZJA 4GX8A 5G2IA 3ARPA 4GUJA 1E56A 4TX9A 3MW7A 4OWGA 2PC4A 2FDMA 3JW7A 3W1MA 5GJNA 3W6YA 2XWEA 2RDUA 3PUEA 4DJFC 6ALDA 2PCQA 2XSXA 1HNYA 1GG0A 4J5NA 4IM4A 1SR9A 4A8RA 2Y5SA 4EP8C 3RJYA 1W3HA 1Y7VA 1OCJA 1UG6A 3AIBA 4D1IA 2RDXA 3NG3A 5AYZA 1V03A 3I10A 4FNRA 2GJLA 1SO4A 2C0HA 1I1WA 4HZ7A 3CIWA 5CPNA 2WMJA 1POKA 2R82A 4NKCA 5K9DA 1BYDA 1EHAA 2QHAA 5A2AA 3ABXA 1KV8A 4K2SA 4ZTYA 3K46A 3CYJA 5KZ6A 3B8IA 4AQLA 3U2EA 1JG9A 4E8GA 3PB0A 1TMLA 4H9VA 4N2YA 1BGAA 2HWGA 3N2MA 2PFHA 1ADDA 3QV6A 2P76A 4AZHA 4I7VA 2VXNA 2J24A 1PYFA 4U4MA 1XLGA 1PYMA 1VFHA 2WC3A 4GXMA 4EPDC 3W37A 1UWRA 2EPNA 1PPIA 5U4NA 1WXZA 2PDJA 3VD4A 3FJ6A 4C1KA 2GJPA 3LQGA 3JVAA 5CAKA 4NAFB 3LN3A 2NQZA 1O68A 1WP6A 1I75A 2ATMA 4UIOA 3VKAA 1GZ1A 3GS6A 1CCWB 4L9XA 3G6MA 3EDDA 5JMUA 5XINA 2WQPA 1VFTA 2QS8A 3CZLA 2VO5A 3B0PA 4GVHA 3NFUA 2Z27A 1QW9A 2FB3A 3PTQA 5AHMA 4WJ8A 3SY5A 3H2CA 5AN7A 4IXHA 1BVWA 5EPDA 1T40A 2CLMA 3P80A 1OINA 4R7OA 1QAPA 1IWBA 3HPFA 4AG0A 4TVCA 4FOJA 5LGXA 4TTGA 2GZXA 2NQ5A 1E0VA 4NZ3A 2PRLA 2YGYA 4J28A 3FYOA 2CC0A 4B91A 3V1HA 1KBBA 2WJZA 2Y89A 3NQ8A 3UZZA 1HUVA 1YEYA 1IZKA 4JNZA 1V3LA 4UC5A 3LD5A 2PGWA 2ZA2A 1QNRA 2R14A 3DFOA 3GW0A 1J0ZA 3VIGA 3BANA 3QY7A 2GSJA 3QGKC 1D3GA 4S3FA 3GWQA 3HPAA 1S2CA 2OYLA 4UR8A 3PS7A 1TG7A 1J0JA 1UH3A 4D8LA 3LOTA 1ZS2A 1U30A 3ARYA 3S2JA 1TUFA 3UVIA 4WK9A 2Z00A 2PB1A 3LV6A 3GIPA 1B9BA 2GGGA 3AUJA 2YFNA 2QZRA 4FP1A 1V0NA 4BKNA 1EUAA 4H8VA 2EJ1A 2XYLA 4AHQA 2FHFA 4M0XA 4MG4A 4ZA0A 2GOUA 2E8YA 2OYMA 1UP2A 1ISWA 2E9MA 2UV8G 5AHEA 1J79A 1RSCA 2DT2A 1F4AA 1IHIA 1A5SA 3RLUA 5DT5A 4LCQA 3FK4A 4CKQA 3TU9A 4FS9A 3P60A 3NQBA 3CBWA 3MSDA 1NP2A 4LT9A 4C6OA 1BLIA 3NUKA 4TU1A 5I79A 4BHYA 3W7OA 3FA4A 5A6SA 2BHUA 2ZDSA 4WZHA 5KETA 3KVMA 1FXPA 2HPIA 3GG1A 2IXVA 4BJHA 3VAVA 1LT8A 2X2GA 1PDYA 1I2QA 1S2WA 1ZAIA 5DMNA 3W1PA 1XDMA 3UXAA 3ABZA 3KP0A 1F3TA 3TE9A 3OO2A 1XCXA 3W74A 2NUWA 4DO5A 4AZCA 3GDLA 2RAGA 4ICNA 2MUCA 2CXGA 3PZQA 3F7JA 5CAHA 3ZJ7A 3IGUA 3B8TA 3KW3A 2IPGA 4JX6A 1Y65A 1KTCA 3G1YA 1X97A 3RJXA 3KRBA 5HQMA 3FV9A 3NSXA 3AWNA 4I3GA 3OVRA 3FGCB 4LUTA 4AZ5A 3K5XA 1A4LA 4GK8A 2BV9A 3VX1A 4AW7A 4UFLA 4KKXA 1S2TA 2GJRA 3CUZA 3DESA 1ZB5A 2DEPA 3N15A 4LOCA 2BTMA 4XIAA 5A6BA 3SCRA 3CU2A 3NL6A 1TQJA 5ABEA 1CGXA 1SFLA 1BWLA 4KT2A 1EL3A 2HBVA 1WZKA 1W5NA 2A3HA 1GQLA 2I7GA 3N3TA 4UR9A 3W75A 1W5MA 1Q13A 4HYWA 1HZYA 4O16A 5J8LA 1BQCA 2O9TA 2VENA 3VABA 1UPPA 4L6DA 2CCRA 2X1UA 5DF0A 2XINA 2GSEA 3GAYA 4IIFA 4ZB0A 2PLJA 1FHDA 1XGEA 4IJCA 3BQ5A 4LEQA 2A21A 4HCLA 4LU0A 4WUIA 4GUGA 8A3HA 1K7EA 2V5CA 3W83A 5FD0A 2Q3RA 3SCPA 4UZUA 1VPXA 3WLJA 1XSJA 4GUIA 1MQQA 4AMCA 5I3FA 1CXIA 1F5ZA 2GDUA 4GJJA 1KXVA 1BYAA 2G95A 2ZZ3A 3CWNA 2CNCA 3W1NA 4D6GA 2OKTA 1GOQA 3CEUA 1QT1A 1UR0A 3ABRA 3HG2A 1UKQA 2BASA 4IFOA 5HQEA 1KBLA 4O50A 2BXZA 3VOCA 1UQZA 3HU7A 3RX2A 3REQA 2OQLA 3PY2A 3P84A 4GIRA 3LU2A 4J3ZA 3S2LA 3WO8A 4ACYA 1CECA 1PX8A 1XG4A 2ZZ5A 4EIVA 3U3HA 2VEIA 1XINA 1VEPA 4NQ1A 4PCTA 3GVVA 3ZVHB 1TPDA 1QK0A 5KSWA 2VCAA 1MW0A 3MS8A 4LYPA 2Z6JA 1GVYA 1N82A 1A5MC 1KGUA 5GJMA 3BAXA 3CMGA 4DWSA 1AD4A 1MEWA 4WD0A 4WX2A 4KS0A 4J27A 2BY1A 4GX9A 5CKSA 1EJUC 2D23A 4FNSA 4QP0A 3CV7A 6PTDA 5FCZA 4CU7A 1KXQA 4MY8A 1TJ1A 1BXNA 2HBXA 1L6FA 4YTQA 3KOFA 2Y6ZA 5TF0A 3AYVA 1TO3A 3FJLA 3M0IA 2A3LA 3BJFA 4GGHA 4HOXA 2VGIA 1GJWA 3QQ0A 4NAEA 1F61A 3ZJ6A 3T81A 2POZA 1M6JA 3FA3A 4ZSTA 4AF0A 3E74A 3NGJA 4K8GA 2BB0A 1FCBA 5HNUA 2O4QA 4V33A 2GPTA 1EP1A 4L7ZA 2TYSA 4O18A 4IMFA 2W67A 4E6MA 4QCFA 2GWNA 1QNSA 2DZBA 4AXNA 2FJKA 1RCOB 2GQ3A 2PDBA 1SPQA 4CUCA 2VC6A 2E8ZA 4DJFD 2NX9A 5DMYA 2HS6A 1AH3A 4QRNA 4AEEA 5A6TC 5K4ZA 3W38A 3B9EA 4O8AA 2ISDA 4TO8A 3M6YA 3MI6A 4AIBA 2Q8XA 5CSYA 2R24A 3WQPA 3W1AA 3WEOA 3N6JA 3KLKA 4IMCA 4IF2A 1UWSA 2J9YA 2Z1BA 4HHMA 4ZOEA 3BOXA 4CNNA 2Z6IA 3LHUA 2YPIA 4A8IA 3STPA 1QW8A 1THFD 2ACUA 4EF8A 4YHEA 1EJWC 4PRWA 1UC4A 4RXGA 4AEFA 3H70A 4C65A 4U31A 1X96A 4MB5A 2YA1A 1P0KA 1YX1A 4K7YA 2OT1A 2XSAA 2IQTA 3AHZA 4AFYA 2GVGA 4IJBA 1XISA 2WJEA 2ZXQA 2VFIA 4G56A 3AS1A 1XIFA 4E0CA 4G8TA 2HCVA 5CXPA 3M16A 1YTEA 1UA3A 5G2HA 4UZSA 4JIHA 3EMQA 3FDKA 4NYUA 2ZX5A 3QN3A 2E28A 3HV8A 3DBNA 3AHXA 3G1FA 4C6FA 3SURA 2ZXDA 4NZ5A 1KCXA 5AHLA 4TVUA 3ZM8A 4OECA 4P7QA 4IGMA 2YXXA 3C2VA 2HE8A 2OSYA 3PFMA 5C70A 4GNVA 4XX6A 3EWUA 4MSSA 2O92A 4PMVA 3IANA 1SGJA 3SEPA 4A8LA 2GDVA 4IQEA 2G37A 5G1YA 4X9YA 5CPTA 2XIIA 3HA1A 1S5MA 2WLZA 1E0TA 3QTPA 3ITCA 5C2GA 2VELA 2DUXA 4XO7A 3R5EA 1VHNA 1KR1A 3OW1A 1H3GA 3MDWA 2FDSA 4HHPA 4CEUC 1EOKA 1UIPA 4W5UA 3I7SA 1UKSA 1NTHA 1XLEA 2D3NA 2PBGA 2PLCA 4KF1A 4JTUA 5DQPA 2P88A 2G97A 5IDZA 1XRVA 4Z2GA 2YJQA 4IUGA 3BW4A 3WBXA 3DH7A 4C6JA 4EWND 2PDCA 5J04A 2NZLA 3WQ4A 1QCWA 3KDOA 1PVNA 3RIKA 3E0WA 3VZZA 2ZTJA 2CBJA 3G3MA 3LPPA 3LBMA 3CGTA 1FOBA 4GZ7A 2RUSA 3N1AA 1Q6LA 1QUMA 1VYPX 1HJXA 4KERA 1N7KA 3L0NA 4TUFA 1NP0A 2PTYA 1UD8A 3PJTA 1BG9A 3B9NA 3RX3A 2XVPA 2D2HA 1RH9A 2DIEA 3O6AA 4LV4A 1TREA 4ZOBA 1Q6CA 3T0AA 3BLLA 3UA4A 3MJYA 2ZRUA 1TWZA 3ZIZA 3EWCA 2XZ7A 4MWAC 2DZWA 1QJWA 3G8RA 5A6JA 1KM2A 4JGDA 3OA3A 3F4WA 3BAIA 2H3DA 3GXIA 1B3WA 4JDBA 3W70A 3A12A 1AW1A 1FWAC 1K3UA 4DX3A 1PB0A 4AWSA 2GJNA 1SZNA 1SM9A 1Q7ZA 3PB2A 3MHFA 3CHCA 3HF3A 4MY1A 5FAGA 1UR4A 1OJXA 5I0DA 2ZFAA 2CYGA 4O4WA 4LRTA 2XIMA 2PC8A 2YCLA 2CLOA 3T0TA 4HNTA 4CCZA 3TR2A 3U5UA 1CEOA 3MKKA 1XHGA 3VGBA 1W37A 2PDKA 1TZZA 2WB5A 1RJRA 5EU9A 3PJWA 3CIVA 1BKSA 1BG4A 3TSDA 1S5WA 5T9CE 3CL7A 1H60A 3FEMA 2Y8UA 3G6LA 2BS9A 1LLOA 4LTSA 1OF8A 3IAQA 1DTUA 2PEVA 4H7ZA 1KFBA 1H7OA 3BUVA 1EB3A 3UWZA 3W7EA 3L5MA 1KRCC 3E96A 1OABA 5HAOA 1E1EA 1ZJIA 1BSLA 3S2CA 3DYOA 4OIFA 1M7JA 4HU3A 4EE9A 4Y9NA 3B8VA 5EMMA 1AZ2A 3CEPA 2QIIA 3CV1A 1ZY9A 1NIUA 1GEQA 1P6BA 4KRZA 1JCYA 1RQBA 3NL2A 3CPGA 4GZJA 1IR1A 4JXCA 3VOIA 2X30A 1TCDA 3LSCA 4TIMA 6XIAA 1X39A 3WDJA 1O95A 3A4JA 2OXNA 4J1OA 2VM8A 3CIXA 4EPEC 1H5VA 4HNOA 4I90A 3U4FA 3P6LA 1UOKA 1IWPA 4YCOA 2PU1A 4MHBA 1X7FA 4PMJA 3MCMA 4BEUA 5AYBA 3M0XA 4HA3A 1IEIA 3CJPA 1AA1B 3FCPA 5H8PA 3QGVA 4FA3A 2VDIA 1GOXA 3SRFA 3EB2A 4JTKA 5I23A 3G8EA 4Q4QA 2QCDA 1QOPA 1TVPA 4I7UA 2BXVA 4UR7A 2F8QA 3GNNA 4PRRA 2Y4SA 4C7DA 1PTAA 3MU7A 3B8WA 3VXGA 5H8MA 3UXIA 1J0HA 4H8UA 4L5ZA 3BAKA 1QO2A 1L6YA 2IPJA 3S4TA 5HJXA 4LVAA 5AC6A 3AZRA 1IR2A 1R85A 1XUZA 3GSMA 2JGYA 4LB3A 4LNCA 2A6LA 1TV3A 4LVBA 1I2NA 3SQLA 1MRAA 1W5QA 3LTPA 2ACSA 2UY2A 4B4FA 3O0KA 3FA5A 3ARWA 1K8ZA 5HNRA 4HMEA 2ZUVA 1ZQ5A 3Q4DA 3W7JA 2QV4A 2WC7A 4QGCA 1TFVA 3R10A 3UQNA 1PUDA 3FN9A 1X1NA 4O1DA 3R79A 2A3AA 1TPUA 2PPGA 3L4WA 2WSRA 3O63A 3W1XA 1OFOA 9CGTA 2FQIA 4FNQA 2OGJA 3OGRA 4L4MA 4NYYA 4O4VA 4M6PA 2VOTA 3CV2A 4A8NA 3HQPA 1MQRA 2FVLA 2DQXA 3W7IA 3ARVA 4PTVA 1GKPA 4H01A 1H2JA 4ZGYA 4Q7IA 4Q33A 3PNUA 4JNYA 3WQDA 2VEPA 2J7GA 3P81A 3H2OA 4WDTA 2D0GA 2WWCA 4TVDA 3SIMA 4N02A 1E72M 3BSMA 1J18A 4IMAA 2GGHA 3WCZA 5LIWX 3WNMA 4BS0A 2QR6A 4WR3A 4H8HA 2V2HA 3W1LA 3B0YA 3RMJA 1HKKA 1LTDA 3VOHA 2QCFA 2QAFA 3VI2A 3APTA 1IT0A 4PMNA 5A95A 4ES4A 2DT3A 1NSJA 5T91A 1PHWA 2AL1A 4LBSA 4M81A 3WQWA 3WMBA 3CZKA 1FWDC 3FJNA 2QCHA 3NQ6A 3NM3A 3UJFA 1US0A 4BF9A 1UMLA 1Q66A 4DIAA 4TQTA 3UZYA 4ZO8A 3VDGA 2J7FA 2Z7KA 1YTKA 1Q7MA 1VGAA 1KFJA 4MUZA 4WVXA 1W3JA 4IIDA 2V5DA 1XIBA 1VBJA 4FX6M 3TQKA 1WDQA 3T78A 2FFIA 1EJTC 4ZODA 3PF3A 1TV2A 1VQTA 4DEFA 4ZFMA 5AHIA 3BV7A 1S2AA 5EGRA 1SO5A 3UJEA 2OB3A 4HPHA 1ZNNA 4HYRA 1ICSA 1BYBA 1DJZA 1KQYA 1H62A 2J47A 1BSIA 2E5DA 3A47A 2WSKA 1ML1A 2GLKA 3WN6A 4LEFA 5E0CA 3GY1A 3WUEA 3WFAA 4JL2A 6ENLA 5A2BA 3AJ7A 1EPXA 3P82A 1JYWA 2BGQA 5BRBA 3MZNA 4LUSA 4Z1AA 2CXEA 2CLHA 1FWHC 3URBA 2EKCA 5D8WA 4N6FA 4XWUA 1RP8A 2DFAA 3UETA 2DZTA 1H51A 3CPRA 3SJ3A 2PF0A 4O0ZA 5E09A 3BVJA 1RAKA 4N9DA 2A79A 4H2HA 3WK3A 2ZE3A 3TV8A 4K1GA 2DT0A 1V6TA 4FXFA 3GDBA 4IP5A 4LC8A 1TTJA 1SJCA 2HROA 4U2YA 3R13A 4WIWA 1TELA 3IK4A 1SSGA 3O2LA 4YCPA 3EOOA 1JYXA 3MKCA 1PWMA 4PL2A 1ZPTA 4PFHA 4KIEA 4QNEA 4V1YA 3K4DA 2C18A 4H6RA 1J6OA 1J2WA 5F4XA 1SZGA 4GZEA 4WLCA 2BBFA 3PZ9A 2ZX7A 4JL1A 2E67A 3H12A 4XAGA 4XK2A 4NL1A 3OLGA 4GCAA 5REQA 2WVVA 3NQEA 4FI4A 3ZWTA 3EOEA 1Y5WA 1IT8A 4DY1A 3QV9A 2RJHA 2ZKMX 1JVNA 3CO4A 4PTXA 3MA8A 2UY5A 4IMEA 4ZXLA 4G7FA 4PMZA 4REQA 3KL0A 3SCNA 2QUUA 1P6CA 3FAWA 3WNPA 1MUMA 1PAMA 1R9XA 3B9OA 4MNMA 4E8CA 4UOQA 3SGGA 4F4RA 4XUYA 2A5HA 4B2DA 4GGBA 1UW9A 4HK7A 4M19A 5F4SA 2ATSA 3UXLA 4MWAD 2G8ZA 5M03A 3BAWA 4DXXA 4AISA 2OG9A 4FK9A 3GTNA 2ZTKA 5I07A 1EA9C 5H8UA 4DBUA 4GVIA 4JHZA 3FXGA 3BO9A 4E2VA 3A4XA 2VGGA 4EACA 1YNQA 2WZMA 1CW2A 5H1WA 2Z1VA 3WFZA 3WYZA 1VKFA 3I3BA 3UYCA 5FESA 1HKVA 3VIPA 1EHNA 3RM9A 1DJHA 1VBHA 3N4FA 4HU0A 3ITOA 1GOIA 1XYMA 1PL9A 2PU0A 3H53A 1CNVA 3P5ZA 2JFEX 1QWKA 1UA7A 1AQFA 1OYAA 3M07A 2CWXA 3ONCA 4DVOA 5LIYX 3AI0A 3M4HA 4GY0A 3CMJA 1SJAA 4YVVA 2DSUA 1WXYA 2IQDA 1LQ2A 1ZAJA 2R6OA 4DI8A 1ODZA 1HL8A 2BGNE 2PE4A 3AALA 5C7VA 4QROA 2E77A 1VENA 3TCEA 2ADAA 2J9XA 4GJIA 4RZBA 4ZSUA 2WKLA 4HA0A 1BTMA 2O4MA 1G67A 1PZ1A 2BHZA 4S38A 1FP9A 2VI0A 1YPXA 2QIWA 1ZALA 1JCLA 4CCCA 1LBFA 1TJRA 3M5ZA 3KBSA 1L6SA 1QU4A 2IKHA 2JIEA 1JCNA 2ZADA 3PSWA 1KTNA 1H7XA 4NZ4A 1ZJBA 5TIMA 4QLLA 3P67A 2AQVA 2GK1A 2EG6A 4B2DD 3F2BA 4JTCA 3SDOA 3AYTA 4XTIA 1MXGA 5F2LA 3BLFA 1PKMA 1RV8A 4Y90A 1PZ2A 2A4AA 4MMWA 1KRBC 5DLCA 2G4JA 1ZAHA 2J4GA 4JEQA 4AZGA 2DUAA 2HISA 3C4UA 2GOKA 1AL8A 1U83A 5D2WA 4X2PA 2ZICA 3WD0A 1IV8A 4EF9A 5FKYA 4X60A 2QJNA 3W1TA 1WKDA 5B7ZA 3CHFA 1NARA 3DFNA 4PBEA 4I8YA 3TH6A 5BW6A 3NJ3A 1HTIA 2PWVA 5KZMA 3EYPA 4PEEA 1W1ZA 2PDQA 2G5WA 1YLVA 1RZMA 2QJJA 3SSZA 2F38A 1NFBA 3BCFA 5EBUA 1QI5A 3BG9A 5FJJA 3GDTA 2BHYA 2QKFA 3SN4A 2BWGA 1LLWA 5FEPA 1QI3A 4K1WA 3N6QA 1HJSA 1UBSA 1R46A 4JFTA 3VGDA 1XC6A 3EMZA 4IQLA 4ZO7A 1G94A 5AYYA 4Y6GA 1Z89A 4KWVA 1K8XA 3ZO9A 4JIEA 4EX4A 1HKIA 3WJXA 3LM7A 1WB0A 5CPLA 1M7OA 1YE4A 4UTUA 3HJZA 1FKXA 2J8FA 3SUUA 4F2TA 1MXDA 1EDGA 4A3HA 1OGBA 1A5KC 3LCXA 4IXXA 1FWFC 1KFWA 1YYAA 4IZGA 2OLHA 3D3FA 3VTRA 1G5AA 1OFBA 2B81A 1JQVA 3FX4A 3W28A 2MANA 3B06A 3TW7A 2GYIA 3NA8A 4JN8A 1X8FA 4XAFA 2XH4A 1LG1A 3WL1A 3OP2A 4NZJA 2VKZG 3OYZA 3EKGA 1ZSXA 2IKIA 2VP8A 1W1TA 1PIFA 2Y2WA 3TONA 4G7EA 2GUYA 2D73A 1N55A 1QNVA 1H7PA 3M46A 2PI6A 4GH3A 4MDOA 1G7VA 1L8NA 5HPOA 1TUXA 3UJ2A 3AXHA 3A9BA 1K7XA 2E40A 1JDDA 3LY0A 4EXBA 1RJQA 1RQHA 3KVKA 5CSUA 4I7WA 2PDXA 3BLIA 1UYQA 2NQHA 4OTKA 4PUMA 1V79A 3W82A 4D6IA 3L12A 2PTXA 4EOUA 1J5TA 3K1DA 4V27A 3VD7A 1R3YA 4US5A 2QPXA 1Z69A 1VPQA 2GVJA 3ALGA 2JBMA 1YXCA 1MZRA 1FKWA 3BQ6A 3MDUA 1SUXA 2OCZA 4E5TA 3OA5A 1JF6A 4QNWA 4LPCA 1HXJA 3DZ1A 5C9ZA 4UTLA 1IZCA 2ZVRA 4PULA 5CZKA 3RR1A 2W4XA 4V1XA 5D2YA 1AQMA 4QDPA 3K4AA 1SU5A 1K8YA 4NZFA 1NWSA 1JZ4A 3EWBX 1HL9A 5BOFA 2PDNA 4LV9A 3ZSTA 3KFTA 1H50A 3O15A 3OBAA 3ICJA 3ZWSA 5BU6A 3OJGA 4Q6XA 3LS9A 1G69A 2P0IA 1MDLA 3E2SA 3W7LA 4N4QA 4XO6A 1P0EA 3LI1A 2WO5A 4JN6A 1OWQA 2JGQA 3MYOA 3APYA 1DJYA 3LSBA 4QG8A 2B0MA 4C6BA 2WNWA 3CQJA 3C52A 3CC1A 3VIKA 3DG6A 1TA3A 4NZCA 1S2UA 3TXVA 2ANUA 3ITVA 2C91A 4XVEA 3CL8A 4XD4A 3PZUA 3M64A 1MVYA 4JTFA 1PV8A 4NI3A 2C79A 3TTEA 4E4UA 2VWSA 1F3WA 3VD9A 5MKGA 4HSOA 3IIOA 5F7UA 1AK5A 3WBYA 3PWAA 5G4WA 2VTFA 3WNNA 3AHTA 2XZ9A 1JZ3A 1UUQA 3A23A 3NXFA 3VGGA 3IGXA 4US5D 4R9XA 4KPLA 3EDKA 3KZSA 2QQ6A 3CB3A 2XFYA 3NVDA 4GQGA 3MUXA 3W1QA 2J6VA 1Z8AA 2XJ7A 3TX9A 2VUNA 1V77A 1XSIA 3MI2A 4XZBA 5C9RA 4XV0A 3AU2A 1ZZMA 1R7OA 4QIUA 2VYOA 1TQXA 1ICPA 3O6DA 3KS6A 3NNTA 3L2MA 1OGGA 4CNSA 5FJUA 3N18A 3VNIA 4S3DA 4PTNA 4US6A 3COTA 3T05A 5TQLA 4UTFA 2FTPA 2O7QA 4YL2A 2QUVA 2WCAA 4WSKA 2XGBA 3TOPA 2QPUA 4PCSA 1XKYA 2H3BA 1AH0A 3S1WA 3UGVA 4HNLA 3QZEA 4U10A 3KTXA 4GA8A 3LPFA 1JFHA 3UZXA 5LIKX 1S46A 5LKYA 3NSMA 3AOFA 4D8ZA 5CLWA 1B90A 3WKZA 2O0TA 2DSVA 3QLLA 1ONWA 2EPMX 1CYGA 3CUGA 4QS5A 4B5VA 3HOJA 1JPKA 1KGXA 4DJEC 4BWLC 2PODA 3VNYA 4CNTA 2BP1A 4XBSA 4M3PA 2R1MA 1XLLA 4FXJA 3AMCA 1IEQA 4PTWA 4ZQPA 4FALA 1RJPA 2LLEA 4F0RA 4CQAA 2OZ8A 3DKJA 4Q7BA 2PDFA 1E4MM 3WELA 1XH1A 1OHLA 3QEZA 4S23A 6REQA 4JCLA 3N4EA 3GC5A 2QDDA 1BQGA 1M1BA 1DIKA 3E5PA 4AC1X 5CPMA 2OLSA 1OQFA 3GTHA 2F84A 2J13A 3AS2A 2OWWA 4INFA 3A5FA 1CIUA 1MQPA 3M0VA 3QC0A 2OSWA 1L6WA 1GORA 2EPOA 5D32A 2O9PA 3N13A 3AIRA 1FDZA 2CPUA 3QHOA 1EBHA 1FWRA 1VFUA 2P3EA 3T07A 3GG8A 3K4WA 2C6QA 4Z2HA 2IMRA 4GG9A 1E0WA 2INFA 1PIIA 4W9TA 3WLQA 4Q22A 2PTDA 2CZEA 1PDZA 4DXVA 3CXOA 1HJUA 4ONVA 2GGEA 1FWWA 1M04A 2R1PA 2DY3A 4GNJA 4DZAA 5DMMA 3HPZA 3WNOA 4PFMA 4R7WA 2QUMA 5AC7A 1UH2A 1WOAA 2CKSA 4GRSA 1WAWA 2VX4A 1B3OA 4JTJA 1IYXA 4ERAA 3SRHA 3A3XA 1IE7C 3UZJA 1PBGA 2TAAA 3UXKA 1NDZA 1L8PA 1W56A 1UR1A 3NEHA 2BZNA 4IT1A 1X6LA 3S9ZA 4AZCB 2C0AA 4IPLA 1CX9A 5HINA 3S1GA 4POCA 4GISA 4Q4PA 5I78A 1EA0A 5A6KA 1M65A 3KTSA 2WZHA 4KCTA 5BROA 1JQXA 4ZOCA 5L9FA 4M5PA 5KZEA 3WLKX 1W3NA 4NNAA 3VILA 1LOQA 3KDNA 4DF2A 5DT7A 5I6SA 1L6GA 2ZWZA 3NPWA 4F0LA 3QY6A 4LFYA 2XISA 2PCEA 1XLJA 1QDSA 4L4OA 2Y85A 5L6UA 4LUTB 5IXEA 2PWHA 4WXYA 3C56A 3S8HA 1DJGA 1W9UA 4X22A 3GH5A 3R7MA 5HMSA 3DHFA 4JQ2A 4UQCA 4P8VA 2C1GA 2BVWA 4LYRA 2HEJA 1WDPA 1VEMA 2AQWA 5AFDA 4JAWA 1P1XA 4H9MA 1M53A 5E93A 1JCJA 2DIKA 3ARTA 4J35A 1HF6A 2C14A 5HXMA 1U33A 3B0VC 1XCWA 3G24A 2YBVA 4FNUA 4AZIA 4ZBCA 4JX5A 4GNKB 4W89A 4DELA 4OE7A 3OG3A 5LXEA 3A5VA 3W9ZA 3RG6A 1KWGA 1YTDA 2Z1KA 3REQB 4NRRA 1C8YA 1WDDA 2JEPA 2ZRZA 5FAJA 4YWSA 1VFSA 2VD9A 1ZL1A 3PNZA 1VJIA 1PHQA 3BLDA 3HQ1A 4XD3A 2CKRA 1S5VA 4RXFA 1VBRA 4AYGA 5FF2A 5LNWA 3T55A 4MKNA 1B0IA 3B3DA 1LP6A 3MT1A 4DI9A 2VRQA 1VZWA 1FVPA 1G1YA 4JTSA 3VCCA 2YR1A 3NDZA 3WLPA 1LG2A 3ES8A 4N9CA 4DBWA 1K02A 1KFCA 1YADA 2BOEX 1EZ2A 2I5GA 5I3GA 3S1VA 3WH6A 3GC2A 4X0VA 5I00A 4PSRA 1J93A 3VM7A 1W3LA 1U2YA 1BYCA 4JFVA 3KL5A 3NL3A 3AMLA 1LRTA 1ODUA 4FR1A 3PAOA 2GUBA 2EF9A 2PTWA 4UTMA 1XBZA 1AUSL 2OYKA 4JN7A 5JUVA 1BWKA 3UP8A 1X8CA 3MP5A 3ZVIA 3KX6A 2JF7A 3C0SA 2F7FA 3H23A 3E12A 1MWOA 4NAEB 4IGSA 4JS3A 3WX7A 2AGTA 3EX3A 4HN8A 4AF0B 1IF2A 2P10A 1S1RA 4MM1A 1A5BA 4AD3A 1TWIA 2NWSA 2XVLA 4ERIA 5FI8A 1MO0A 2J27A 4Y9MA 5A8MA 3UG8A 3QPZA 4I5RA 3SCOA 3A4AA 3TIMA 1E5NA 5BOOA 3OODA 4ATWA 4D2JA 3QW3A 5K2ZA 1FDJA 1RBLA 3WK1A 4DO4A 1OG0A 2IQ0A 4QSHA 1HQTA 1AG1O 2D69A 3TJLA 4JHMA 3TLLA 3S46A 4TX8A 4FZIA 4EANA 1Q6RA 1OM0A 1V3KA 1XYZA 1S5TA 3QOMA 3W00A 5E70A 3WUBA 4HCHA 5LSMA 2DDXA 4L1GA 3UFYA 3D0CA 4P8XA 4NF7A 3OIXA 4KFPA 3U5YA 3L4VA 4ORIA 1QPKA 3ZLFA 3IIXA 3FSUA 1OCBA 2J77A 3WLOA 3GHRA 3LGGA 2WKGA 3GHSA 1UHVA 1VPYA 3OZPA 4DJEA 4BWLA 1VS1A 3VUPA 4F0KA 2UZ9A 1G01A 3JR2A 1KM1A 1EWDA 4S3BA 3MP4A 3BLOA 1PX3A 3R58A 4XKMA 3MUY1 4IISA 5DXYA 3RM4A 1HGWA 4IIBA 5IM51 1B54A 5I77A 4LX4A 4W87A 1K4HA 4Y96A 1ESWA 1GVIA 3UY7A 3CQHA 5A8QA 3U9IA 5BRPA 2XIQA 2G3FA 3NQ2A 5HWNA 5LZLA 5DRIA 2RH9A 4N0RA 1NF0A 2DJXA 2VEGA 3KE0A 1R6WA 4RPQA 3O9NA 1UKOA 3L65A 1W0MA 4UTIA 3N14A 5AHFA 4W85A 1GCYA 5C2XA 3KHJA 4HSHA 3OG2A 5FF4A 2ZQ0A 4IMDA 3VDBA 3GYCA 1NDVA 2DVTA 4QITA 5A8OA 2Z28A 3W7PA 3OBKA 4MY9A 4UFIA 4IPNB 4EXQA 3IUHA 4K8HA 1XLFA 4ZZ9A 2OWCA 3R0KA 3PZOA 1KBKA 1UKTA 1JFXA 4P5UA 3OGSA 1L2UA 4Y9AA 3CAQA 3U2OA 3A64A 3GXDA 4H3DA 1LORA 4UFJA 1XGZA 1JJKA 3HB9A 3R89A 3DAQA 4PL1A 1TTIA 3L0GA 3UGRA 3IIPA 3WDIA 3BMWA 2DGAA 2EG8A 3SQSA 4OT7A 2Z2UA 3L4XA 1JPDX 3N73A 1FUYA 1DWGM 2FKPA 3LXCA 4HTYA 3RITA 3V0UA 3IVTA 4MZYA 2WWDA 2YDQA 3ANUA 4CN6A 3KP1A 4OGZA 2DSKA 2ZUSA 1IIGA 3CAVA 3EOSA 2NVAA 1NAL1 2FZ8A 1T7LA 4DBEA 4PR4A 3N6HA 4ZQMA 3GH4A 5I2UA 4Q8VA 3BZGA 1QMLA 1QHPA 1R7AA 2WJDA 2YB4A 1JI2A 3VVGA 3I3DA 3U7BA 5I3JA 1BXCA 2ZZ7A 5CLTA 5JIWA 1JAKA 2OZTA 4DUOA 4D1JA 4ZE4A 2PWFA 4HK6A 1H0IA 3HPXA 3VM5A 4P7LA 5DEZA 1HP5A 5C2CA 2F2HA 1LJYA 2P50A 1JAEA 2PDHA 1ICQA 3O07A 5T8GA 3ZT5A 2QEZA 5CZTA 1JDEA 4PRTA 4PB3A 4GYKA 1TPFA 2G50A 1JDCA 4CQ9A 3VKDA 3EXSA 1AW2A 3BCJA 3WH9A 2OLAA 3NYZA 5BWFA 3WF1A 3QYSA 1G7UA 1Q6EA 1Y0EA 4LQ1A 3WDRA 3P61A 1S3HA 4XZHA 2J75A 4C90A 2GQ8A 1A5AA 3G18A 3OLEA 5EFDA 3NDOA 3QMRA 3W88A 2YCLB 3TTSA 1GWJA 5KTLA 2QUTA 2Z7GA 1MW3A 4JICA 3W25A 5IRPA 1KCZA 4O1FA 4KEUA 4Z1YA 2WAGA 1XIEA 3C3UA 3WLMA 4D6HA 3WIJA 3P62A 1RA0A 3S5SA 1V6WA 1EQPA 2Y61A 3O06A 4F0MA 1TJPA 5M2FX 1TB3A 4DYKA 4HZMA 1JR1A 3I7RA 4F0HA 2IS7A 4QG6A 5JU6A 3AROA 3BMVA 1CBGA 3SAZA 1V7YA 1KA9F 2B7PA 1F8IA 2Y7DA 2ZZ4A 3BARA 4DAFA 3SSJA 3KBNA 2OEKA 4XBKA 3UD6A 4LH8A 4J3UA 1QI4A 3PUGA 2I9UA 1TZ9A 1YBQA 3WY1A 5KMYA 2HV5A 4PSPA 1OBAA 2PZNA 5A2CA 4I9MA 2JF6A 3CNYA 2DZPA 4UCGA 3QR1A 3PJXA 2QF7A 3AXKA 3WDPP 3I7QA 1BVZA 1FY6A 2WVTA 1GOMA 5DMLA 3XINA 3AMGA 4QFUA 3O16A 4QDWA 3NXLA 1VAHA 1HKMA 5JBEA 1W31A 1E70M 4LF1A 3TSBA 5ABFA 4ADTA 3TTYA 4GYFA 5LGZA 4D6DA 1DP0A 2Y7EA 2WVSA 5EMKA 1Q8JA 2XGZA 3TYUA 2NT0A 3E5BA 4AZ6A 3BE7A 3B9AA 4J3VA 3B8SA 2VFGA 2P0OA 2FHCA 3ITLA 4JQAA 3RU6A 3R0DA 4XIMA 3TWBA 2QCDB 3LCIA 1MFVA 1Q6DA 2GSHA 2XGIA 4PUWA 4Z2IA 4CQBA 3EWDA 3UWWA 4FAMA 1F6PA 1VLIA 4XQ6A 3SY1A 4AY7A 3RCNA 2PF8A 3NZPA 4O8RA 2DIJA 4KGLA 3UG3A 4CVWA 3Q94A 3EXTA 1TR9A 2HVNA 4MB1A 3BZJA 4L4PA 3OZOA 3PN8A 3GKFA 3RN6A 3BAYA 4L65A 3L67A 3UCQA 2PWEA 5HNTA 2V82A 3RU8X 1LOLA 2J79A 5E6YA 1E1CA 3UU0A 4AEOA 4HTBA 3M0YA 2YKKA 3TN6A 3GVQA 1GYLA 3W2UA 5HJYA 1XLDA 3PBYA 1GEHA 4I5XA 2V68A 1BPLB 1K03A 4JIQA 1FWSA 1KRMA 3V7PA 3S5OA 1J12A 5D9OA 3M0KA 4QQUA 1E6QM 3VDAA 1UD5A 2J78A 1DXEA 3TC3A 3PJUA 1DHPA 3W26A 1XYFA 3GDKA 3WLLA 3UWYA 1A3XA 1H4PA 2A1YA 2BG5A 1UR2A 4RNIA 2IXUA 3BDKA 1I0DA 2NQJA 5G2WA 3EMCA 4CNPA 3VO0A 2PDYA 4IG2A 1ADSA 1A3WA 2EXOA 1H1YA 5G1MA 4EAMA 1PEZA 4C5YA 2Q71A 4C6KA 3W2JA 4YNGA 1XV8A 3LHYA 1PKLA 5D05A 1EO7A 2F2KA 4KEMA 3C61A 1C7SA 4F3HA 2GQAA 4PA8A 4Q7NA 1Q8AA 3QRHA 1D8CA 2Z24A 3GVRA 3RLVA 1ADOA 3L2IA 1VCGA 1RQEA 1Z44A 1FCUA 3VINA 4IL0A 3VYLA 1OFAA 2J25A 9XIAA 4N4PA 4XAYA 5E5CA 3IJ9A 4M7SA 2JQXA 3N4AA 5AECA 4MZ8A 3UR7A 4GLEA 3IIZA 1N8FA 1W9DM 3S1XA 3EWZA 1B5TA 4J4KA 3NQCA 2XFRA 3UPBA 2OJPA 3HPSA 2B31A 2XG9A 6A3HA 3DC8A 3KOZA 3W01A 3LV5A 1W9VA 1ITUA 5LNSA 1M5WA 1GNXA 1FHLA 3SUSA 1H09A 1DPMA 2DVXA 4DXKA 2G4FA 4I9TA 2Q3OA 3MCNA 5U7SA 4B3KA 1V3JA 4GFIA 1HW6A 3GAKA 4JKMA 2JE8A 1TKKA 1XKJA 4LUSB 3N2OA 1MXSA 3USZA 5CC6A 1QOXA 4YWIA 5JXQA 3BJSA 1RP9A 3RO8A 4O13A 4QE4A 4JYDA 5IFPA 4UTWC 1TPC1 5HK4A 1HJVA 4RLIA 4NI8A 2WZTA 5HATA 3RK8A 3RR4A 1XRSA 4CN1A 9RUBA 1EJSC 3PR2A 4FXSA 1NOUA 1J4EA 4JIRA 3W7NA 3PG9A 1HO4A 2OQYA 3C6CA 4LAUA 3GB6A 4JTDA 3E02A 3RPMA 2QULA 2CHNA 3CH0A 3MBDA 4HZ8A 1DJXA 3VFCA 4MAZA 1N8WA 1JUBA 3KVJA 4M6VA 1YMYA 4GVFA 4KEZA 1IEVA 5G4EA 5AYIA 4U2ZA 2A7NA 3SQMA 4BI7A 1Q6OA 3A24A 4ZTXA 3IJ8A 1B1YA 3W2KA 5LHEA 3L23A 3FHQA 4JEJA 9XIMA 3WZ0E 1GK8A 2EPHA 2NLIA 4LB4A 4CEXC 3GNPA 1ZBVA 3NOYA 2QCCA 2QT3A 1QWGA 1GONA 1TSIA 2X16A 4ILSA 4JBRA 2JK2A 3AXIA 3W27A 2WBKA 4Z08A 1J6PA 3H4GA 3IGHX 5REQB 2WVVB 3W4RA 3KBVA 2BFGA 1QNPA 1BRLA 4XG1A 2G3JA 2OZ3A 4ZOAA 1RVKA 4REQB 3B03A 1FQ0A 3PPGA 3L21A 2CZVA 3ITYA 4AB4A 3WQ5A 1B4KA 4RUBA 2V38A 1MEHA 3Q45A 3GDMA 5CG0A 1AJZA 3PZNA 4D72A 3DX5A 2JIWA 4F40A 4JD4A 2AAAA 5FA5A 1XH0A 1OT2A 5FSDC 1K6AA 5AZ1A 3GTIA 5FOOA 4AH7A 2G41A 5AKQA 3N11A 3W84A 4LANA 2D2JA 4YLWA 5HMEA 4P61A 4N9EA 4P7RA 5F1VA 1B3ZA 3DYMA 1BF2A 3GR8A 3MUIA 3DU0A 4Y7EA 4QEEA 4DWSC 4MZ1A 1XLMA 3A3WA 4OUIA 1W1VA 1EXPA 2ISSA 3I6TA 2C71A 1VIWA 1VBGA 2PLKA 3S5YA 4PE8A 3CZGA 3GKAA 3QOKA 3IJLA 4AD1A 4RJEA 3RO6A 3RM8A 4UTKA 4LYKA 3BGJA 3TC7A 3VZXA 5TNVA 3WD3A 3ISIX 3AYRA 1WDWA 4PC8A 4IICA 1OY0A 1R2RA 4IWWA 5K4XA 3WJWA 3AUOA 2E7FA 4W93A 2QXWA 3ALFA 4HK5A 2YCJA 3TZFA 1CLKA 5I02A 1WX0A 4LAZA 2OOFA 3HV9A 3ZXWA 4FHAA 1EJXC 2EGZA 2HDJA 3VGEA 1O1HA 1V3IA 5A94A 2VWTA 3EX4A 1DV7A 3WUFA 3GH7A 4AZBA 1GW9A 3KXQA 1F9CA 1XUUA 2FYMA 2J7CA 3A9IA 3E0VA 4DN1A 1IT7A 2QGHA 4C7GA 3R4IA 1F3EA 2YDRA 2P3ZA 4IMGA 2F9RA 1RHCA 4W84A 2GK1B 4GZIA 4FLQA 3KWXA 3PUOA 5D9MA 4IPJA 1NH6A 4U3CA 2A3EA 2F6UA 1E5JA 2VC5A 1UJQA 4R27A 2GFTA 3VUSA 3W71A 1TV7A 2EHHA 4UTJA 4Z2KA 3LRLA 1E9ZB 5A8PA 1US3A 1XYLA 5BWAA 4K3ZA 4NX5A 3RMEA 1C9WA 2G3MA 2IKJA 3QR0A 3EA3A 4WDUA 1XQLA 4JY9A 4YN5A 1F6KA 1PTDA 3CUIA 3UCCA 1PTGA 4JTHA 3SGUA 3GLCA 2I9EA 3UJSA 1W2VA 2IW0A 3T4CA 3G0UA 3SN0A 2XHYA 1VEOA 3AICA 4DHGA 4PMXA 2XIJA 2E1WA 3ANVA 1ZFJA 2NX1A 3DG7A 2ZBTA 4HB7A 3EB3A 3WSUA 2WNNA 1E1FA 3DI1A 5BOEA 3AJXA 3IUIA 2CITA 1EXBA 1OFEA 1JZ8A 3U4AA 1T6MA 4AXKA 4PMDA 1F3XA 1LLZA 5BU9A 3IJIA 8XIAA 1GQIA 4RX0A 3NM1A 3GUWA 3KCJA 3LEPA 3VGHA 3W73A 3G1AA 4UTTC 2VQUA 3T7VA 1OZMA 3ATYA 4GACA 1OX4A 4YTRA 4QJ1A 3VIOA 2W91A 4XSLA 1UQYA 1DJIA 3RFAA 1HX0A 5PTDA 4S39A 4CD4A 5CSSA 4AUBA 4AIEA 2Q6ZA 3JS3A 2PWDA 3DENA 1M68A 3UYIA 2PLMA 1KB3A 5DBUA 1P48A 5XIMA 3FS2A 3ANYA 5KZDA 4P8WA 4JFWA 1VBUA 4GKLA 3DYPA 1T0OA 3PZIA 3DUGA 3T2QA 1AVAA 4GC3A 4B5UA 1YKWA 4F8XA 3MUCA 4PUJA 3KCLA 3FEQA 1XLCA 4H4IA 3D3AA 2Q09A 3N9RA 2I17A 5DFAA 1BGGA 3PWIA 4L6HA 4UTWA 3EEGA 3MMDA 5CH9A 1IXQA 4XVDA 2E25A 4Q4KA 3T4WA 5D9NA 1XX1A 1ZBWA 5FF7A 1W1IE 3ZR6A 4YVXA 2ICSA 1U1UA 4UFMA 4DPPA 3GBDA 3O1NA 4QCEA 3H55A 1R47A 4C6NA 4TOQA 6TAAA 3H8AA 1W9BM 1KRAC 1S38A 4LNYA 3FW6A 1EJ7L 1FWIC 1RVGA 2Z4GA 4DNMA 3T09A 1XW8A 2NV2A 4JQ1A 4G5DA 3NSNA 4JIIX 4FB7A 1XLAA 1I2PA 4QEHA 1QXLA 4R88A 3FKKA 1DIOA 2VZVA 2VR5A 3GE7A 1B9ZA 8TIMA 4DUVA 3IS4A 3W6MA 5I06A 3AZSA 1L0PA 1X98A 3KBJA 2A3BA 2DH2A 3EPNA 3H26A 2ZUTA 1SYTA 1QOQA 3HQNA 2B7OA 3VKKA 3AS0A 3KM8A 3RYSA 4NSBA 5BMWA 3OZMA 5CJMA 3CWOX 4DZIA 2Y88A 5CQ1A 3NZ1A 1UWQA 2V3EA 1UZDA 3KRSA 2O7SA 4YMZA 2PAJA 1Q65A 4ACZA 4CD7A 1Q4NX 2BX7A 3EX1A 2E6DA 1DQUA 3HQOA 1Y5VA 3C2FA 4NHVA 1O94A 1OSEA 1JXKA 4S3CA 2PGRA 1AQHA 5BZAA 8RUCA 1MW1A 4W88A 4WEVX 3W07A 4A3UA 3TFCA 1GT8A 2FHBA 1I0BA 1DEDA 2NXGA 5LNRA 2OEJA 1S3TC 4AVFA 2AGKA 3V5CA 3ECQA 1TA3B 2HQAA 2B7NA 4JY8A 1UD6A 3SCWA 3H2EA 2Q01A 1KBIA 3ABOA 2RJGA 1J8VA 2OX4A 4GQBA 2OGYA 1LCOA 1DJQA 2FGLA 3ZLGA 3HIJA 3Q58A 2NVCA 4JTEA 2D24A 3WBEA 5MKGB 4S3KA 2XFFA 1I2RA 4ATDA 3CPUA 3IUDA 1DIDA 5CSRA 4L80A 5A6BD 3MB9A 5A5WA 3ZFHA 4AY8A 3H4WA 3DC0A 4MDPA 2V5JA 1PKYA 3BLKA 2FLIA 1TTQA 2ZX6A 4QAWA 1J9YA 1LOSA 4KW2A 3TQ0A 2CLIA 3OHMB 1LQ0A 3AIVA 4TV6A 4GCXA 3G3DA 4QJ5B 2VEMA 4AHOA 2FGBA 1CXFA 3L4YA 2VNCA 2V9DA 4YJ5A 4MNKA 1XYBA 3UG4A 1R3SA 2P1FA 1FX6A 1I8JA 2FIQA 3IACA 1I4NA 3GZ3A 3TLQA 4WGXA 1OVDA 1AJ2A 1Q6GA 1A0CA 1C91A 4FO4A 3ARUA 3BC9A 4AYSA 2CESA 4MOZA 1ISYA 1GVFA 4ZQRA 2R1KA 5HBFA 1DOSA 1ME8A 4FX8A 3TYCA 4C5ZA 1ISZA 4UMCA 3AWOA 5A8GA 4KCVA 4D6CA 3IV3A 3EXRA 4U5IA 1V0MA 2BXYA 4LCRA 4C7FA 2EG7A 3PULA 1SR0A 2QCGA 1XF0A 3QLDA 2YA0A 1EYWA 4W8BA 5A6AA 3PZGA 1JNDA 4DWSD 4H6EA 4JZ5A 4JFSA 5ABTA 3CUXA 3SCQA 3N9SA 1ECEA 1GGOA 1X38A 3G77A 3KBWA 4XUGA 4GI9A 2V5LA 3TAOA 1DL3A 1IEWA 3J7HA 1NWRA 4HPXA 5LA0A 1V3MA 3TKFA 5H91A 2HNEA 3G1VA 6REQB 2BY3A 1Z42A 1UMYA 3PBGA 3VA8A 1TCMA 1PJ9A 2QCMA 1EF3A 2VRKA 1CLVA 4A3RA 4DWDA 1GVEA 1P7TA 1KXTA 4L9ZA 1OC6A 1WKYA 3BG3A 5EMYA 1K9DA 2QMJA 5BXTA 4GE8A 1GYMA 1VJZA 1NWTA 2A7RA 3ZT6A 5FACA 3STCA 1E43A 1U22A 4JCMA 3VNJA 3GZAA 4LWWA 1UZHA 4ZB2A 3N04A 4M1RA 3C2EA 3DBPA 5M1TA 3RGTA 4ZEPA 3TXZA 3QBUA 4UMAA 2Z0IA 4UTTA 3EWXA 4OBSA 3W81A 3OBEA 3H21A 2WMKA 3R6IA 3NQDA 5E9AA 2FZDA 3LQLA 2DU2A 3TA9A 2QVHA 3SGZA 5SWUA 1JYNA 1EJVC 3NIYA 1AL7A 2FZMA 2PRMA 4M8UA 5CBIA 2P53A 5E9XA 4JIPA 4QAIA 4D6EA 3WF0A 3MSRA 3IARA 3VKJA 1JI1A 4FLOA 3UG5A 4OKDA 2CHRA 2BY0A 3PM6A 3MWAA 1B3XA 2W79A 3WJSA 1XFBA 3PTDA 4ATLA 1EFZA 2D0HA 3W22A 4LVDA 4O0KA 1JPIA 1A0EA 1K9FA 2YA2A 4MJZA 3IPWA 3E2QA 2YB1A 5GJPA 3C3NA 3L4TA 2A85A 3FHAA 1TIWA 1UBPC 2ISVA 1DE6A 3LZ5A 3CZ8A 1VRDA 1ZJAA 5XIAA 3GK0A 4E2DA 1PSCA 3EDEA 3F5JA 2J6XA 3AIEA 3NO3A 3NO5A 3SN1A 4BQ2A 1FHVA 2HE5A 1FCQA 2WANA 2NXHA 3LGDA 5FEWA 1E6SM 3M1ZA 2R1NA 3OLDA 2TMDA 1OB0A 3AIWA 3P14A 1EX1A 1PZ3A 5CCZA 5GNYA 3QPYA 4JTIA 1XGDA 2ZYFA 3MHGA 1OX6A 1EDTA 3LCFA 4M24A 5DCEA 2QF8A 3CM4A 5HMDA 1HT6A 3TC6A 2PRHA 1MUCA 4KMQA 4PBFA 3KHDA 1FWBC 3WMCA 4A35A 1UC5A 2KAUC 1X6UA 1ZP4A 1QPNA 1FRBA 1KM0A 4LGXA 3LB0A 1OFDA 5BXRA 1BXBA 1J5SA 4ADUA 1I2OA 5E0KA 5H6HA 3DFPA 4V2XA 3L4ZA 3AXXA 1UD3A 1N2VA 3QFWA 3VC6A 4AIOA 5I3DA 1IIHA 3ZSSA 3RCMA 3KWSA 1R9YA 7REQA 4PN2A 4KQNA 3UY8A 3FIGA 2PP0A 5J5RA 3BSHA 2WQDA 2YW4A 3DCPA 1YPIA 1QI2A 1PWLA 4X2RA 5E1QA 4NVTA 3PVFA 4IQJA 4QTGA 2RKXA 2WHMA 1QBAA 4AC7C 5CPQA 4RE3A 3H6OA 3THAA 4MPKA 3ORWA 2CERA 5AHNA 1W3TA 3R8GA 3FVDA 2DH3A 1GUVA 1WDSA 1Q3NA 5I3KA 3A6OA 4WJXA 4O53A 4HBKA 3NO1A 1R5YA 2PTZA 5E6ZA 7ODCA 1VCVA 4GMEA 5FIPA 2VD8A 3V0SA 3Q2DA 3HGSA 4NP7A 1QATA 1RK6A 4YVPA 2V3GA 1OZQA 4LSBA 4W7UA 3POHA 5M5DA 1MUWA 2VGFA 1QR7A 3D5HA 4EAYA 1E9IA 5I24A 3G1RA 1EZWA 3UJRA 1FWNA 3G2GA 3EA2A 2CZ5A 1O7AA 1JULA 2FTWA 4UFKA 1YXDA 1WKFA 1ZCOA 5BXSA 4YS1A 1QI0A 1VD6A 2Z25A 4JTRA 1W3IA 3LRMA 4UB9A 3FAXA 4OQVA 3NTYA 4GO8A 3E3HA 2J8TA 3ZJKA 1M3UA 1EDQA 5EMUA 1H5YA 2H9AA 3B05A 2XVNA 4J3TA 4CNUA 4I6KA 1MW2A 4ASTA 1OFPA 4R34A 3AO0A 3V5FA 4W7WA 5AC4A 2CFFA 1HJQA 1KKOA 2ZX9A 4CU6A 3AISA 5DRCA 5LIXX 3ZZ1A 3NCOA 1E0XA 3WQGA 4H83A 4KRUA 4C6MA 3GXMA 3THCA 1WUFA 5CJNA 1OT1A 4YIWA 4RDVA 3AIQA 3HMCA 3WEZA 1FFQA 2VFDA 2PS2A 2OEMA 2YSWA 4I6VA 4MAVA 4GC4A 4F2BA 3VMOA 1C92A 3WL0A 1I45A 4BI6A 3CB8A 4M56A 2ZXAA 3PWGA 1UCWA 2VEKA 3KVLA 4DQWA 2FTYA 4AX7A 2X0YA 5G5IA 5D04C 3NEVA 2JKPA 2OMAA 2QV5A 3QYQA 1YXYA 1JUEA 1VYRA 3Q65A 5D2XA 3MSGA 5JQ9A 1UJPA 3UR5A 2CLFA 2V5BA 4LBRA 4LS0A 3T0CA 5CZJA 5AB3A 3GD6A 1R38A 1S1PA 1UWUA 4F2UA 2J7EA 2J7HA 1RD5A 1GQKA 2I14A 1AZ1A 4AD0A 5D9PA 3STFA 4IHCA 1M7PA 4U28A 1OIFA 3AU6A 3L5LA 3O6YX 3TJIA 3T8QA 1KTBA 4UMBA 4YTTA 2YBUA 1OADA 3UWQA 4HPGA 4HQVA 3OU8A 4ZQCA 2E5CA 1QASA 2XH2A 3URAA 1XC4A 3AXMA 3D47A 4C1LA 3QMTA 5FSEC 4NUWA 1R9ZA 3RDKA 2D20A 3BOFA 2VFHA 1J96A 4UWMA 2I5IA 3LHZA 4DUWA 2O9RA 2WPBA 3THQA 1WE5A 3VOFA 2BGSA 5D2TA 1P1MA 4GIEA 4TR9A 4D8AA 3WQCA 3SM0A 3CUJA 1JUKA 3AYSA 4JTAA 4Z42C 3GTXA 2YYUA 4QG9A 1OFRA 3GYEA 3PSVA 3W7DA 2E68A 1SO3A 1CB7B 1XYCA 2XM1A 3I3EA 4E8DA 4CVUA 3HFTA 3P3BA 2OQHA 2WOQA 3ME3A 3H24A 3PBWA 1ZJHA 3NURA 2O55A 5FJOA 4AWTA 4OVXA 1FFRA 5C7HA 3S3GA 1QPOA 3WLHA 3LPGA 3IEBA 3MHUA 1TPH1 3QKEA 3S42A 4Q8NA 1OFQA 3ENLA 2X7WA 3KBMA 4Z1CA 3BTNA 3UVAA 4B15A 1NQKA 2WKJA 3PANA 1XD0A 4MPQA 2PDLA 1EP3A 1YE6A 4Y9PA 2QW5A 3AQUA 1V6UA 1OK4A 2VX6A 3CS2A 3LRKA 3A21A 4FNTA 2XN1A 3TSMA 1TWSA 3H2NA 1GQJA 3WF4A 2ZRWA 3OGVA 2Y5JA 4GUHA 4RK8A 3WFLA 2CU0A 3QJAA 1C8QA 4GINA 3B4YA 2WVUA 3MUZ1 1KM6A 3R12A 2BODX 5AZ0A 1FH8A 5CC7A 3VIMA 2AKZA 4H7CA 1YW1A 3WD1A 3BW2A 3E49A 3G1DA 3QKZA 4BF7A 2E9BA 1J0KA 1MRQA 1MFUA 1KKRA 1Q7QA 1W1PA 1ITCA 2ESCA 1TR1A 4X0NA 1CDGA 1K1DA 1HFBA 4YTSA 3OVGA 4RNJA 3IVUA 3WJZA 3W87A 2CHOA 3HBLA 1XP3A 4FIQA 2ZRXA 1YQ2A 3KRZA 2DUZA 4H9TA 3GXPA 1T41A 5D37A 5DELA 3FSTA 5DY3A 3HURA 4Y8EA 1V6YA 1C29A 2DP3A 3GVGA 1QVBA 1YBQB 5K7JA 1CXKA 1M03A 1B31A 1E55A 1WO2A 4Q4MA 2J7BA 4C6DA 1VC4A 3QMSA 2WW5A 1SQ7A 2OFJA 3N2XA 1LWJA 3SUWA 2FGZA 3WMSA 3YPIA 4MNJA 4AMAA 3TWAA 3LHVA 3LUTA 3S83A 2YCKX 4Q8MA 1PCWA 2GGJA 2GJXA 1OYBA 4S1FA 3EB4A 4AVOA 8CGTA 2E5BA 1TPB1 2YZRA 4UNKA 4L1XA 3KS5A 5LA2A 5ABFB 1CZ1A 1W6TA 1W32A 3DFYA 2W66A 1BVNP 1O5QA 1YNPA 3MANA 3AIUA 3MBFA 5EKYA 4QX4A 3VDHA 3U2CA 5CBBA 4EPBC 4Q6JA 2XSBA 1EC9A 1LT7A 2FH6A 2Y1HA 2Y70A 1YDVA 5D09A 2QJMA 1C3FA 1XPGA 3F5LA 4B3ZA 3UNDA 1R2SA 3U2ZA 3W7HA 1CTNA 3D46A 2WZEA 3OQ8A 2YL6A 4TMCA 1E4NA 2V0TA 3S9IA 4GQRA 2ACQA 1K7FA 4O28A 1NEYA 3GXTA 3KZPA 2E3ZA 3QZAA 2R91A 3W29A 2XU2A 5EB8A 1P0NA 3B40A 1F73A 4GY7A 5K3VA 3W1UA 3N3MA 3P8IA 3V5OA 1TE1A 4XTDA 3CZJA 2C1IA 3LCLA 3RF9A 5B7YA 4DUXA 5AC5A 3BV4A 2KZHA 1A3HA 1V6VA 5T9BG 1HVQA 1WPCA 1E1CB 4K68A 4PGLA 1D8WA 3IAPA 4RPPA 1XCFA 4A2RA 3GQYA 4TMBA 3ZOAA 7PTDA 1I1XA 1EC8A 1E4IA 3WF3A 2DJLA 2ZDRA 2D22A 4KFOA 3PTMA 1Z48A 2DZXA 4O19A 3GHUA 1T8QA 1O5KA 1WZMA 5IBXA 1F2JA 2PP1A 3AS3A 2FFCA 5AY7A 1UROA 3TAKA 1O1ZA 4FIRA 1E3ZA 2ZA1A 5AYXA 4IX2A 5LXXA 2F6KA 5C9WA 4P7OA 3BGGA 1R87A 3M7SA 4QE5A 1U5VA 3OOQA 4UBPC 4IQDA 4IG2B 1P5BA 4ZE5A 3PBUA 2DW6A 3F5KA 1PCKA 1A5NC 1V5XA 4PMOA 1WXJA 2PDGA 7CGTA 3WQ8A 3TNBA 2ISWA 2QCLA 4P8UA 4AY1A 2Z1SA 1JD9A 2DT1A 2OO6A 4H2CA 4MJMA 2EEXA 1GJUA 2ZC1A 4HNVA 2VZTA 1B3VA 3QGAC 4HHHA 2DV0A 2V81A 3NQGA 3WQVA 2HVOA 5K9CA 3CTTA 3P93A 5MF5A 4CQCA 4B3LA 3RRAA 1QTWA 2OSXA 3GDRA 3CK5A 2UBPC 3CWHA 3M7WA 3C0LA 1A5LC 2PA6A 3XIMA 4K38A 3SJNA 1EH9A 4B5NA 1KC7A 3IWPA 5IDIA 4BI5A 4AD2A 2V2CA 1W5OA 2ZIDA 1DORA 3QR3A 4O0QA 3ARRA 3K13A 3UWEA 3B4UA 3E6EA 5T26A 1ECQA 4UQDA 4O17A 4GYPC 3RRXA 1SFTA 1XICA 1XR2A 1GG1A 1KLYA 1WKEA 1ALDA 4IH3A 2WYSA 3NZQA 3G0SA 5EFFA 3SBFA 1XIIA 1E6RA 2W6RA 1I6NA 3ABSA 2EAWA 4ENLA 4J40A 1EIXA 1DTNA 2ZZ2A 4DJFA 4KEVA 3DHUA 2VX7A 4MVAA 4I8DA 3ELFA 3NPVA 2QDHA 2GDQA 3SI9A 1NDYA 4W8LA 4L9YA 2V2DA 1YDNA 3P5YA 4GQQA 2V30A 4NXKA 4HGXA 4R3UA 1A5CA 2YOCA 3GFYA 4HD5A 1UB3A 3CV6A 1Z41A 4UNLA 3M0LA 3MY9A 2JEQA 4GWEA 3EA1A 4MLRA 3VD5A 3SY8A 2AAMA 4MUPA 2REQA 2OODA 3GNDA 1H63A 3A13A 3WH7A 2VR4A 3IJ6A 4E4FA 1WDRA 4JOMA 1V02E 3H2MA 2HPMA 4UQBA 1MNZA 4O54A 4RKAA 3LYEA 3L0KA 3SW6A 3W72A 1L2QA 4LRSA 4ZB5A 3F4DA 2VCCA 4E2OA 5C54A 2DSWA 2IPWA 2NQ9A 4BFAA 3THDA 2DORA 3POCA 1G4TA 1LWHA 2VZUA 2XIBA 4RE0A 5EL1A 1DHKA 1JPHA 4ICCX 4NJIA 1RD6A 4HOZA 3MSYA 3KCOA 3N34A 4JR5A 3V0TA 4JYEA 4XSMA 3DGRA 4RCXA 3EX2A 3U6WA 2F6XA 3M0HA 1RLDA 1P6WA 2VC7A 4OV9A 3LHWA 1WZLA 3I4EA 3FNDA 4H19A 1A0DA 3GR7A 1NQ6A 4ZQNA 1RPXA 1V0LA 2QMKA 1BRLB 1DBTA 1ELSA 5KITA 1DIEA 4B5XA 3OVPA 1TV4A 1CXHA 1YNYA 4UNIA 1O6IA 1LBMA 1IXOA 4BCEA 3EPOA 1V0KA 1KXHA 3BJTA 1TV5A 3BH4A 1KFEA 4Y9OA 4B5WA 1EQCA 1XL9A 3SFWA 2VT0A 1Q2RA 3RHGA 1XG3A 1OYCA 3I4KA 4J3XA 2YIHA 3MO7A 3EKLA 3G22A 4HPJA 5HUOA 1ZCCA 1GVRA 5CPOA 4JQ3A 4AHPA 2J9ZA 4IPPA 4ERGA 2ODOA 2NW0A 4HKPA 4DLFA 4D6JA 3OHIA 1SZFA 1Q63A 2Z2BA 1BEUA 4DBDA 2G96A 4G6CA 6CGTA 3PHAA 4CD6A 4FF7A 4WQ6A 2IPFA 4F66A 3NPUA 1KD0A 1ONEA 1LRQA 3QC3A 1SMAA 1JCTA 5CEWA 1ISVA 3HFYA 1A5UA 4FEZA 4MWAE 4ZVJA 3LI0A 3TJXA 3O05A 4JTTA 3NDYA 4C1NA 2F61A 1GYNA 3FYYA 3G1HA 2QPSA 4TX6A 4E38A 1XLIA 2FB2A 3LLDA 3A4WA 4PUEA 4JNMA 3OQEA 2W63A 1LUCA 3H7VA 4H9ZA 1LM1A 3QM3A 4AWEA 1TTPA 3LA4A 3TOYA 2BDQA 4HIBA 2GWGA 3DEQA 5HOSA 3SCVA 4C6EA 2J62A 3KOWA 3U8GA 1J2BA 1YDYA 4NXSA 2C3ZA 4GABA 3PP7A 3E0IA 4UQEA 4RZ6A 3W2LA 3KAOA 1AH4A 2VFEA 2D3LA 1H1ZA 2BOGX 1V51A 3CQKA 4O52A 3JUGA 1WBHA 1DWIM 1K9TA 1S2VA 5IHSA 3T44A 5HDRA 5J5DA 4R85A 1V4YA 4EPKA 5C55A 2BOFX 3UCDA 1KW1A 5CG7A 2NX3A 1EGZA 2D0FA 1Z9AA 5EY5A 3B97A 2RFGA 2AL2A 4CCDA 3N19B 2JKEA 4BR1A 4IP4A 2ZUWA 3F1QA 3FOKA 2INZA 3ZJ8A 1OIMA 1IQ8A 1TYGA 1U5HA 4MYXA 3BLPX 1A4MA 3KEHA 2VDHA 4ZQOA 1W1B1 1PXGA 3SUTA 5D38A 5AVHA 2DQWA 3K8LA 2TRSA 3LXAA 5DCDA 2SFPA 5E0FA 3DIPA 2OOGA 3W3OA 3R1ZA 3M47A 1BD0A 1RPKA 1JIBA 3A3HA 1QHZA 3EEZA 1W3KA 3S47A 4S3JA 3UEQA 3MJMA 3S6TA 4KBXA 3VFLA 3PK7A 3MP3A 1XS2A 1JF5A 3Q37A 3CAWA 4NT0A 2AKMA 1JZ2A 3B8DA 3WH8A 3LMYA 1NF7A 4R7JA 4XD6A 3K2GA 4Z2LA 4B9YA 1KQZA 5A6LA 1R3RA 4Z1DA 1CWYA 1H11A 1OX4B 2WXDM 3SFKA 3PC0A 4GYPA 4E3VA 1R3VA 1HP4A 1F74A 2D2GA 3K30A 3L66A 4QXIA 1FCVA 5BYWA 4XKYA 1RALA 1OK6A 1XI3A 5D33A 4B90A 4ML4A 1E0UA 3SB0A 4LS2A 4ORMA 4P7NA 2NSXA 1F05A 2OU4A 3IJQA 2OO0A 4D9PA 3CYVA 2CLLA 2FJUB 4IIEA 2CWNA 4EWJA 3LHTA 2XPKA 1PS9A 1REQA 1ZLPA 3UESA 2C19A 3NZGA 4W5ZA 4P2VA 4DF1A 4N7QA 3AC0A 1DKWA 4FLRA 1W8GA 2C1HA 3ZR4A 1D9EA 2V3DA 5HMFA 3GNOA 3HTWA 4N6EA 3T0DA 2R9RA 4HYVA 4Z1BA 1VIZA 3UPWA 4CQDA 4FR6A 4GUFA 1O5XA 2V69A 3CTLA 3TR9A 4ALDA 4WDXA 4O11A 3W7KA 3TQVA 5C8BB 4E3TA 1FWGC 5BXPA 1KCLA 4I9AA 2W62A 3CZEA 4W7VA 4XAPA 2VX5A 4Q3MA 1CGYA 1KGWA 4XD5A 4OBTA 5CGTA 1MZHA 1EP2A 1TRDA 2VL4A 2RHGA 3NGFA 2HJPA 4ZXOA 1WYIA 1TZ7A 4C6QA 4OV4A 4WCJA 1TRIA 1XLHA 5EBAA 4WSJA 3GO2A 3CHDA 2WHKA 4LUJA 4F9JA 4IUOA 4K7VA 4UQ9A 2J66A 2E6AA 1PO9A 1W1YA 2QUNA 3O7UA 1XPYA 2Q8LA 1L9WA 4ACZB 4EVZA 2ZC8A 3U57A 1FWCC 2A0NA 1AODA 3C2OA 1XDLA 4B92A 3QSRA 3BLEA 3E2VA 4FPSA 4L1WA 2ZUUA 3SZ8A 3NL5A 5GVJA 1FH9A 4Q8PA 4AWUA 5HJLA 4FF5A 3BWWA 4QM1A 4FOKA 4JFUA 5F2GA 3ITGA 1R0MA 2PDPA 3V75A 1F07A 3LGEA 5C9XA 2VZSA 1VLWA 1OF6A 2ZOXA 3WUGA 1LROA 3VNDA 4A6GA 2G3NA 3EKZA 4J2PA 2XFWA 3EWYA 1Z7AA 4DWSB 2XUCA 3H2FA 3LM3A 3NVTA 2DPEA 4WY0F 4ZENA 3FDGA 3VCNA 2WLYA 3VOGA 3KOXA 4HMDA 4KCWA 2PMQA 3URNA 3LBOA 3VIIA 4FLSA 1R2TA 2X41A 5MHBA 2G3IA 1O12A 3VE9A 1K77A 4RZ4A 1VHCA 4H04A 2DW7A 2IUZA 2YXOA 2XM2A 3KTCA 2HRWA 4M82A 1FWTA 4ML9A 1GKQA 3I6RA 3AMDA 5FJRA 1V93A 3PZTA 2C7FA 3HMJG 3MV01 4W4QA 1TPVA 2ZRYA 5FL0A 3PBMA 4K37A 1XIJA 1V02A 3E9AA 3T2OA 2FZ9A 1ITQA 3FKRA 4GI8A 3B0XA 3ZR5A 4GXWA 2GVEA 1XM3A 3UXDA 1KFLA 1W8SA 3O0FA 4RNHA 4H00A 3MTWA 3NZRA 3MMTA 1JZ5A 4HPNA 1HKWA 1RK5A 4PMYA 3DI0A 4GBUA 4WY0A 4X3ZA 3KOYA 2PDUA 2QCEA 3ZT7A 3TK7A 4XZNX 1RUSA 3WENA 3H22A 1SJDA 2WMFA 4LXFA 4DO7A 3W23A 1RBAA 4GBDA 4G1NA 4PMQA 4M6UA 2X0HA 7TIMA 4LAOA 1QPQA 1E9LA 3ITXA 3LZ3A 1W91A 4OJYA 3R0UA 1AMKA 1TX0A 4ZL1A 1DWFM 2C16A 2WSPA 3LXBA 1A53A 1CGWA 1SFSA 4NNCA 1RR2A 2WMIA 4IFKA 3N9KA 1NJJA 1TE6A 5LIUX 2CETA 3V16A 4F0SA 4JTQA 3VKBA 1R3QA 3L68A 4NJGA 1GZGA 1XD1A 3SCTA 4HNNA 1W1A1 3NYDA 1GTHA 1LL7A 3IJDA 3MC5A 3PPCA 2Y5EA 2HXUA 1DWJM 3UNTA 2D1ZA 4H9YA 1P7TB 4JKKA 4HSNA 3T0BA 3UPMA 1B3YA 1XXXA 3M5YA 2XH0A 3VU2A 1FH7A 2ZXBA 3ZLHA 4KIRA 3CHVA 3W53A 4XB3A 3V18A 2J88A 2Y7GA 4DAIA 4LJ3A 4ZFCA 1DXFA 3ARQA 3WBWA 5EYWA 5C5YA 4PCPA 1I60A 2ZUNA 4MGGA 3FJ4A 4OZOA 4N9BA 3ABQA 3SUVA 3BK0A 1HIZA 1RA5A 3LCHA 1UWTA 2PUZA 3DFHA 1X7IA 1QPRA 4MWAA 2I56A 1C8VA 4IIHA 3WQ6A 4S3GA 5BCAA 4U33A 3OZYA 3ZS4A 4XZIA 3TYAA 1KO0A 3GTFA 1Q4WA 2PDMA 4JX4A 1G0CA 3QH2A 5I3IA 1XYAA 3H7RA 4PCNA 5A3HA 3FY1A 7ENLA 2ONEA 3WLTA 4M6QA 4PEKA 2V63A 4MJ2A 4PYSA 5AC8A 1VB9A 1W17A 4BQ5A 3GR4A 1D3CA 1VJSA 1DVJA 2EO7A 1RY0A 3LK6A 3MMUA 4BK9A 3QF0A 1T8XA 4OU1A 4Q4OA 3WLNA 3IRDA 1BFNA 4DJED 1X6NA 1V7AA 2VEFA 1CGVA 1ZENA 3EX6A 4UCFA 5G1TA 1E73M 3CASA 1E6ZA 4OBRA 3N29A 1P0BA 4KETA 3EOLA 3K8KA 1ONXA 4PTDA 5JIPA 2GL5A 3UWUA 2Z1WA 2ZX8A 1E51A 2HS8A 3TA6A 1YIXA 3TZNA 1M41A 4HNCA 5ABGA 2WC4A 8XIMA 4GO9A 4LUYA 4CGTA 2FH8A 3E0LA 4DZ5A 2QDEA 1UR9A 4ROQA 4Z0SA 5D30A 1XBXA 1CGUA 3GIQA 3LTYA 4WRHA 4IFRA 1UH4A 3LNPA 4IX0A 2W92A 5LNUA 2Q02A 3MUAA 3EPMA 1EEXA 4ZMGA 3QVQA 3UR2A 2WV8A 2YFOA 5TBOA 5DN1A 1SO6A 4LY4A 1POJA 3UR8A 1QK2A 3VD3A 4C6CA 4WJEA 3N2TA 3WDHA 1PX4A 3F4CA 2OVLA 1UIOA 4KRTA 3QQWA 2YBTA 2Z2AA 3NR0A 2CBVA 2VRJA 4MF4A 2HK1A 1A49A 1J0IA 4A2SA 4GH1A 1D2KA 1EOMA 3VNMA 1RCXB 3KUMA 7REQB 4AAJA 1DQXA 2WMGA 1O60A 4LW7A 4A21A 2YLAA 1TWDA 2MNRA 1U1HA 1UPMB 3SCUA 3CQIA 1NELA 1FHUA 4QS6A 2B7QA 2C13A 5TD4A 4J3SA 1ENUA 5HULA 2AMXA 2KX9A 4PODA 3WDQA 5FJIA 3WD2A 5ABHA 2W5FA 2WBGA 3HG3A 1ZUAX 2CBUA 3MYPA 4ZCWA 5JVLA 5M17A 1EIBA 4NAFA 2YW3A 3NWRA 3STEA 1LYXA 1H7RA 1KLZA 3CH9A 2YCIX 3GU9A 4GQ0A 1VCFA 1EUNA 4HCDA 2X2YA 1IWAA 2GVLA 2ZWYA 4Q8UA 2YZ5A 3BAJA 1D7KA 2EPKX 1EX5A 2CBIA 3QV7A 4BEQA 4RZ5A 4NILA 5GNXA 3IV8A 3LLXA 3QPEA 1QBBA 3VPLA 2VURA 4IGHA 5LA1A 3VX0A 2R1LA 1GZJA 3SADA 5G4HC 4F9DA 1A47A 3K1GA 3VIFA 3DFQA 3P74A 3L4UA 2AOSA 4DBSA 2ZRVA 3S9YA 1GOWA 2ZCGA 4C60A 1ZP3A 5F1UA 1JZ6A 2H9AB 3W86A 1IGWA 4F48A 4EKJA 2H90A 3TYDA 3T40A 3B9DA 1B4EA 3N17A 1OC7A 3CMFA 5I09A 2XN0A 3RX4A 1R86A 2CZDA 3M41A 3L7RA 2ZZ6A 5CC5A 1Q45A 2RDWA 4XAZA 3QV8A 3GG0A 1FXQA 3CT2A 3O3RA 3URQA 4PZVA 3AZTA 2Z29A 3I6EA 1RLCL 2H8XA 4O1AA 2ZZ1A 3DFTA 1CI1A