2A7RA

Crystal structure of human guanosine monophosphate reductase 2 (gmpr2)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP reductase 2
publication title Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a7rA00
4J9JA 2OCZA 1I45A 4NNBA 4JTHA 1VS1A 1FBAA 2YW3A 4GRSA 3LV6A 1SFJA 2BXVA 5CPNA 3W7KA 3B4UA 2ISVA 2B7OA 3C4UA 1VGAA 2HTMA 4NZJA 1F05A 2JKEA 3BG3A 3G8RA 4MPQA 3L2IA 2R91A 3IIPA 5D32A 1L6SA 3TQ0A 4K8HA 3CT7A 1OX4A 1KV5A 3VKJA 4RK8A 3GLCA 1XBXA 4RZ6A 5D2TA 3MHGA 1AW1A 4ORMA 3W1NA 5BNKA 3C0JA 4FX7A 1K3UA 4UFMA 2QCEA 3BW3A 1SSDA 3A24A 3IGXA 3M41A 1TRIA 2P1FA 1OX5A 1G4PA 3HG4A 3M5YA 2JGQA 3PVFA 4OQVA 2QDHA 2HSAA 2FDSA 2VFIA 5HQEA 3P8JA 1NAL1 2E09A 3LI0A 3G22A 4O1DA 3NQ6A 4IX0A 1W8SA 4O4WA 3NZ1A 1OJXA 3WJYA 4IMFA 1QWGA 3C2VA 3W86A 2CLIA 3LXBA 3PY2A 3TUUA 2CZEA 4FX8A 4O14A 4TMCA 1K8YA 3HQ1A 3TSBA 2VOMA 3M1ZA 1VH7A 1QPRA 2DP3A 3ZWSA 1GVFA 1QO2A 3T7VA 4XKYA 3IRDA 4P2VA 1O5KA 3LCIA 2R94A 3MI6A 3P60A 3DGRA 4NUWA 2E6YA 4UMBA 5FESA 1EWDA 3LCHA 5KTLA 1O5XA 1LM1A 3STCA 3P82A 2WNNA 4DEFA 3GKFA 2W6RA 1FCVA 3DENA 3A22A 3DHDA 4CQ9A 4OGZA 3PWAA 7TIMA 4K37A 4UTKA 2H3BA 3G3MA 3JR2A 5G2WA 4NU7A 3IVTA 2A5HA 1GTHA 3TK7A 1O60A 4AB4A 4ZQRA 2QCMA 4JIPA 1K7FA 1RR2A 3MBDA 1DBTA 2ZCGA 3KAOA 4FEZA 1SFLA 1VCFA 4RZ4A 3OVQA 4ADTA 1C8VA 3VE7A 4UR7A 4TIMA 1MXSA 2A21A 4DBDA 4IMGA 3I7SA 4N4PA 4AF0A 3UWWA 5LZLA 2ZRXA 3A21A 3CEUA 3TE9A 4WY0A 3C56A 1TPVA 2H8XA 3TA6A 1W0MA 4NZFA 2Y7EA 2QCGA 2WSQA 2YGYA 4E2DA 1WV2A 1VHCA 2ZZ3A 3UPBA 4DO6A 1EA0A 1YXYA 3D0CA 4FXSA 5AHIA 1TPUA 4G1KA 3W85A 1JQXA 1JUKA 3O16A 3OEXA 1KW1A 4ZQNA 4HSOA 5KZEA 2OZ0A 1WOBA 3W07A 2QF7A 2VC6A 2QR6A 4IXHA 3TDFA 4Y6GA 5T26A 2FTPA 1SZFA 3W6YA 1OF8A 1H50A 3CIWA 3EX3A 1DVJA 1LTDA 4I7WA 2YFNA 4WUIA 2X16A 2FJKA 3ABOA 4JNMA 3G0UA 4FNRA 1Q6QA 4MLJA 3G3DA 3ABQA 3O1NA 2WNZA 5HR7A 4NJGA 3C52A 3IIVA 1FWNA 1XBYA 1SZGA 1Q45A 3OA3A 1R2RA 1Z42A 3ANYA 1YXCA 4O1AA 1AW5A 1LCOA 1ME9A 5I3HA 3CQ0A 3R13A 4DXVA 1G6CA 1F6PA 3GDKA 5D03A 2CLOA 4QAIA 3PUOA 3GNDA 2E1DA 4UXDA 1LDCA 2V0TA 1I2OA 5DBUA 3W2UA 1ICPA 4ZQOA 4O11A 2VFEA 3IGUA 4FO4A 1FCBA 3FA5A 4AEOA 1BWKA 4KFPA 1H7RA 4OE7A 3W73A 2ATMA 3SFKA 1F5ZA 3LCLA 4CQAA 1F76A 4I7UA 2QAFA 4QNWA 4LS0A 2QAPA 1M5WA 3F4NA 2BZNA 3TW7A 4TU1A 1GG1A 3W7GA 2AQWA 3LRMA 1W5PA 1JULA 4RX0A 1JRCA 3N14A 4AHQA 2YX0A 5EA9A 2ISWA 5LNRA 1OG0A 2NZLA 3STFA 4EOUA 2KZHA 3ZS4A 1RVGA 5KMYA 4JDYA 2AAMA 2E77A 1P0NA 3W1LA 4DO4A 3GZ3A 2NXGA 4DF0A 5L6UA 2J9YA 2WSRA 3O06A 5BW6A 4PH6A 3S0CA 4KWWA 1W5NA 3PBYA 3QEZA 3M47A 5AFDA 4LY8A 3S1VA 3RF9A 1X1OA 3EKLA 2ZA3A 4UCGA 2DZVA 3RU6A 4BI7A 5FEWA 4FF7A 3FYOA 3M16A 2CLKA 2A4AA 2NX3A 2CZDA 4PA8A 2G96A 3DAQA 4N9EA 4O0ZA 1KTNA 5KZDA 5KITA 2WPBA 2LLEA 1YPIA 4ICNA 4JTUA 3W2KA 2J27A 1XM3A 3NGJA 3QPYA 1TQXA 1L9WA 3G1VA 1ZNNA 1YLVA 4MY8A 3E9AA 3BG5A 3R12A 4M5PA 4BI5A 2O7QA 1O95A 4QJ1A 4UR8A 5EBUA 5AB3A 5LNSA 2XN0A 3O6DA 3BV4A 3SGZA 2HS6A 4MYXA 4AAJA 4JYFA 1XUZA 3PG9A 2C18A 3PR2A 3TSDA 1WBHA 5LNWA 2Z0IA 1T8XA 1OK6A 3IV3A 4ONVA 3CM4A 3O07A 3HG2A 1QPNA 1OFOA 3FKRA 3N3MA 1VRDA 3E0IA 1VPXA 4MUZA 2CLEA 5FF7A 5G4WA 4DO5A 1LP6A 3NO5A 2Z6IA 5TQLA 4IGHA 4NXKA 3W7QA 2NX1A 2ZZ7A 5J5RA 1KV8A 3DFPA 3BARA 3A5VA 4BF9A 2VFDA 3L21A 4YCPA 3H53A 4JDBA 1LBMA 5AOUA 1B57A 1Z41A 3UWUA 2GQ8A 4TO8A 4XQ6A 5U7SA 4JTKA 4IOTA 5CG7A 1J5TA 3HGJA 1TPB1 4ALDA 1JCJA 3FEMA 1FXQA 5AYXA 1A5BA 1QO5A 1FCUA 3NM3A 4LVGA 1EB3A 2X1SA 2QUVA 3WJSA 1EPXA 2ZRUA 4XZ9A 3R8RA 3QM3A 1CI1A 3W1RA 5IBXC 3WJZA 3YPIA 3GDLA 1SW0A 1JQVA 1UCWA 2AGKA 1EUAA 4O50A 3NM1A 4JY8A 4ZQCA 5IBXA 1P1XA 1TTQA 4LU0A 1JR1A 2Y61A 3TMQA 5C54A 3VI2A 3BPWA 5AC8A 3PUDA 4A2RA 4NNAA 4O8RA 2A7RA 2NV1A 3G1YA 1H60A 2YZRA 1LOLA 2YCEA 1C29A 5L9FA 3L0GA 3LERA 2W0UA 5I3GA 2EKCA 4CNOA 1GYLA 4LVFA 3PSWA 1WOAA 2QCLA 3M44A 4CCDA 2Y89A 2ISSA 5LGZA 1B4EA 5FEPA 4UFLA 3UXAA 1GWJA 2XN2A 1ADOA 4Z1DA 1XBVA 1RV8A 1U5JA 4U4MA 1I2RA 1XDLA 4YWIA 4ZQMA 4HNUA 5D33A 3LRLA 1VLIA 4P61A 1TCDA 3GKAA 3GNNA 3QH2A 3TW6A 3N19B 1ME8A 4GC4A 3SR7A 4CNNA 3LLDA 3PSVA 2ZRZA 4IPIA 2CFFA 3P5ZA 3W1PA 4JR5A 1H1YA 5FEZA 3IIOA 4O18A 5G2HA 4Z1AA 1FUYA 1DQXA 4HSNA 5HJLA 2TMDA 4GUGA 4JYDA 1OK4A 4MJMA 1TPH1 3GDMA 1OFPA 1ZY9A 3HBLA 3PB2A 2CW6A 1LROA 1VC4A 3NXFA 1LBLA 2YYTA 2Y62A 3M43A 1YTKA 1R47A 4O1CA 3I65A 1CW2A 5I3KA 4X3ZA 5BRBA 4N6EA 3M0ZA 1RQHA 3EXSA 1XUUA 2E6DA 5HWJA 4POCA 1QDSA 1J4EA 5K2ZA 4PODA 4OV4A 4FB7A 1SO3A 3UWYA 3Q94A 4NT0A 2I14A 2VENA 3BO9A 4FIQA 1W54A 1GTEA 4H6KA 4MY1A 3W22A 4QSHA 2C0AA 3NA8A 3F4WA 2ZDRA 3WK2A 4BWLC 5EY5A 4MFDA 1OX4B 1I2PA 3CTLA 1KM4A 4RLIA 4BWLA 2OJPA 3W87A 1TO3A 1IIGA 3TC7A 3OHIA 2QUUA 4FNPA 1BWLA 3JS3A 4IPJA 3NVTA 2WSYA 3W7EA 5KZMA 3H54A 2Y70A 5LHEA 4NJJA 4XBSA 3CIXA 3USBA 1GEQA 2X1RA 4K6AA 4IWWA 3HG5A 5FF2A 4KKXA 1FY6A 3R5EA 2ZZ5A 4JICA 4CLMA 1JJKA 2QCHA 4JTFA 2QUTA 2PURA 2JKAA 1F73A 3MMTA 1OF6A 4DPQA 2ZZ2A 3ZFHA 3I68A 5KSWA 3EWWA 5DN1A 3C2RA 1WXJA 4W9TA 3P81A 4D2JA 3S5OA 3LRKA 3L68A 4XKYB 2Q8ZA 5HNRA 1FWTA 2E6FA 4PCFA 4UUIA 3WJXA 2B4GA 4NJIA 4ZL1A 3LHVA 3E02A 4GXMA 3EX6A 4MFEA 3TJXA 2C1HA 5DCEA 1H5YA 3LBCA 3PF3A 5CSSA 3GIYA 3W2JA 4HKPA 1TMHA 3L67A 5F1VA 1SW3A 3B03A 3CWNA 1P4CA 3WK0A 3G1DA 3UYCA 3PC0A 3P62A 3W3OA 3WK3A 1TYGA 4DPPA 3LHTA 3CHVA 4LRSA 3STEA 2ZZ6A 4L4MA 2B7NA 4Q4KA 1O94A 1TPEA 2ZRVA 4K36A 3OVPA 4AF0B 2Q3RA 1JVNA 4UTTC 1PL9A 4U28A 3NNTA 4WY0B 5D05A 1G4EA 1SU5A 1X6UA 4N4QA 5AHEA 4UTTA 1I2QA 1FX6A 2VELA 3C2FA 4FNSA 4A22A 1UJPA 2CZFA 1A53A 3B0VC 3MYPA 1WDWA 1G7VA 1JCXA 1RZMA 5AYYA 2EAWA 2V30A 4C1LA 4DF2A 1H7WA 3L5LA 3W84A 3T40A 4ZVJA 4QQ3A 1LOQA 1X1ZA 3HO8A 1DORA 3TC6A 4E38A 2RDUA 3C2EA 3MHUA 1JCMP 3M9YA 3NPXA 3S8HA 1TPDA 5F2IA 5HWNA 3KVLA 3QFEA 4NX0A 1H61A 5D37A 4GFSA 3UQNA 4PC8A 4JTEA 3FKKA 2NV2A 1EWEA 1A50A 4GBUA 1LORA 1B9BA 2H6RA 2A6NA 4NJKA 3EB2A 3W1UA 2QCCA 2JKPA 2W79A 3NQ8A 5AC6A 1YTDA 3S5YA 3A9IA 1SO5A 3T78A 1G7UA 1GVSA 4M7TA 3TIMA 3LCXA 4Q32A 2YSWA 1FWWA 1DOSA 2ZYFA 1ICQA 1NFBA 2PRLA 2DZSA 5IM51 1T0OA 4FX6M 1K7EA 2V2CA 3FIGA 3MP3A 2WV8A 1GZGA 4LV9A 3UWZA 2YR1A 2C13A 4PFMA 2QDGA 2CLFA 3L66A 5K4XA 3ZR4A 1MO0A 3C6CA 2VEKA 1ICSA 4O12A 3PBVA 1TRDA 1W37A 3E49A 3HPXA 5F2MA 1KM3A 3OIXA 3GDRA 3UPWA 3O63A 1SO4A 3S1WA 2C15A 4N6FA 1ONRA 3GB6A 3IIXA 1G69A 2NUXA 1KFKA 5E1QA 1FWSA 3NAVA 4YXGA 1Q6LA 1U83A 1WQ5A 3FJLA 1HO1A 4LNYA 4QITA 3KOFA 1KFBA 2G97A 3FFSA 3STGA 3UWQA 3NQGA 3TQVA 5K9XA 1ZENA 1DHPA 2RKXA 4ZMGA 3EWYA 1YADA 3B0PA 1AG1O 1GT8A 2YYUA 3KRUA 4Z1BA 3SJ3A 2PC4A 4BFAA 2VFHA 1XXXA 4EWND 4UTHA 4K7YA 3CWOX 5DCDA 1PVNA 1KLZA 3I6RA 3P8IA 5EKYA 5K4ZA 5U4NA 4JTGA 4E0CA 1PV8A 1V7YA 1LYXA 5CZ0A 3KRZA 1M7OA 2VFFA 4N9CA 4WJEA 1X7FA 4JGDA 5C5YA 3SGUA 3EX1A 3PB0A 4M7SA 4JS3A 1F2JA 4ADUA 4X22A 3NQ2A 1F74A 1S5WA 3QC3A 4O13A 1C9DA 1ZHAA 1P5BA 1TV5A 2TPSA 1BEUA 1TV7A 5D2XA 2E5BA 1ME7A 2Z2UA 1DJNA 3G0XA 1XL9A 3GR7A 3KRSA 3ABRA 1JCYA 1JRBA 1K7XA 2X1UA 3I7RA 3B06A 4LTSA 4E2BA 3A23A 4LW7A 1NF7A 2V82A 4UTLA 4MOZA 3MHFA 4JTJA 2ZQ0A 3ABSA 3MI3A 4IXXA 3G1AA 3S6DA 3CC1A 3HGOA 1SPQA 2DZXA 3KX6A 5TBOA 3W7LA 2O7SA 1VQTA 4JX5A 3PUEA 3DFSA 5HUOA 4ADSA 4H3DA 2FLIA 4O54A 1IXNA 3MI2A 3TFCA 2B7QA 3LHUA 4WZHA 3DHFA 4MYAA 3GVGA 1ZJIA 5AHNA 4BI6A 4NVTA 2A1YA 3NQFA 4PL2A 2Y6ZA 2NLIA 3DKJA 3QW4B 1P0KA 4TR9A 3TKFA 1VZWA 1I4NA 2XFWA 3MJYA 2ZRYA 3UZ5A 3B04A 2GVGA 2DZTA 3P74A 1W3NA 2H3DA 4L4LA 4Y96A 4O1BA 2G95A 3DBPA 5G4EA 2DZUA 2FB2A 4A2SA 3L5MA 3MBFA 3LTSA 3TCEA 5MHBA 4RXFA 4WY0F 3M7WA 5LNUA 3W7PA 2VEIA 3LLFA 5HWMA 3DXIA 3Q58A 1EP2A 4UC5A 5C55A 1XI3A 4JYEA 2Y7GA 4NJHA 3HMJG 5DCBA 3SECA 1FQ0A 1ZFJA 4IQLA 3UY8A 4GUHA 4JD4A 3PULA 3NR0A 4O17A 4AVFA 2QCDA 3RLUA 3BGJA 4OHQA 1K02A 3INPA 4H4IA 2P10A 3UY7A 4K38A 3LX9A 2IQTA 2OMAA 1R46A 2PE4A 3U6WA 3NQAA 4M6QA 1XKYA 4OT7A 1QPQA 4R7JA 5LKYA 1WA3A 1XFBA 3QPZA 3SW6A 3CEPA 1F7BA 4UTMA 3PS7A 4B5NA 3EXTA 3W70A 4UTJA 4JX6A 2RDTA 4LWWA 1TTPA 4WX2A 1OYBA 2X2GA 4FXRA 2A85A 3B05A 2E6AA 3EXRA 1R30A 5G1YA 2OX1A 3S1UA 5AHMA 3IVUA 1ZCOA 4JN6A 1JCNA 3OVRA 3EEGA 3V1PA 3W7HA 3WJWA 1EEPA 3WK1A 3M5VA 4JTTA 5LHFA 4UIOA 5D02A 4M19A 5CZJA 1GJPA 2DZWA 2BTMA 1UUMA 3MW7A 3W7IA 3W2NA 1N8FA 2RHGA 4HNNA 4LS2A 1H51A 1WX0A 1TQJA 1OFDA 3UD6A 1THFD 3HOJA 1LLZA 4UNKA 1MEHA 3KHJA 3W1TA 3TAOA 1TJPA 4HNTA 2CLMA 4RJEA 5LNVA 2E5DA 4RCXA 4YL2A 2EHHA 5I3JA 1XBZA 3N73A 2J88A 1TPC1 5HUPA 3RMJA 1R2SA 4XTIA 5TIMA 4OWGA 1CX9A 3QJAA 3N9SA 2G5WA 4UFJA 4RV8A 4N02A 3TNOA 3QW3A 3LCGA 3W2LA 1QMLA 3SIZA 1Q3NA 2GPTA 1UB3A 4UMCA 4LVBA 1T99A 3W7OA 4IMCA 3C8FA 1QNVA 4K8EA 5G5IA 4LC6A 5BMXA 3DI0A 1DQWA 4FNTA 4ZQPA 5A8GA 3IEBA 2DORA 2BLEA 3GXNA 1YPFA 5FEXA 4WXZA 1HUVA 2Y85A 4TX9A 4CCEA 4LRTA 3CLMA 3EX2A 2GJNA 1QOPA 1YTEA 3FJ6A 3I7QA 3TXVA 3HPZA 3DU0A 3NG3A 1W1ZA 2D73A 2GJLA 2C14A 5AC7A 4XWUA 5H2ZA 3PM6A 1VHNA 5HR6A 1G67A 1W5QA 2GUUA 2BX7A 4JTLA 4WOQA 1JUBA 1TJRA 3G18A 3L65A 1AW2A 3NL2A 1OHLA 5D09A 3PBUA 8TIMA 2HMCA 1W3TA 2GOUA 3NQCA 1YXDA 1LRNA 1PE1A 2Q8LA 1EP1A 5A5WA 5EYWA 2RFGA 1OFBA 4JEQA 4HN4A 3QQ0A 4LUJA 3JRKA 1IXPA 3VFLA 2I9EA 4O15A 4HIBA 1FDZA 4C1KA 2ZTKA 1KFCA 3HGSA 3NZRA 1K8ZA 1D3HA 2NXIA 4NQ1A 3TROA 3RK8A 1DKWA 1L2UA 3BVJA 1W3IA 3QMSA 5LGXA 2A0NA 1JCLA 4UFKA 1ZAHA 3NQ7A 1S5VA 4ML9A 1D3GA 3G1XA 2ZFAA 2GVLA 3LXCA 1HFBA 3S5NA 1SQ7A 1RD5A 3W23A 1WBJA 2WJZA 3B8DA 3SI9A 2EGZA 3MWAA 4NXSA 4GJ1A 2P0OA 1NVMA 1GPWA 3TR2A 1VJIA 1MEIA 3S5ZA 1KTCA 1KFJA 3P61A 4O16A 1OVDA 3MUXA 3C61A 3IVSA 5CPLA 3TX9A 4X2RA 3KVMA 4AWTA 3CB8A 1EUNA 1GVOA 1G4TA 1TIMA 1R2TA 4FIRA 2Q3OA 5BMWA 1AMKA 3P80A 1GYNA 3LBMA 3G8EA 3HIJA 2YXGA 3EWZA 5F4WA 3THQA 2B7PA 3W88A 1YDNA 1IGSA 1I2NA 2R8WA 3T44A 3HPSA 1PIIA 2CZ5A 3M6YA 3W9ZA 2QCNA 4PTNA 3K30A 2V5BA 1SZNA 4R34A 1KBIA 1F6KA 3MP4A 5EL1A 1H63A 1NF0A 1VYSX 2YFOA 4NX5A 2YPIA 1ALDA 4GUJA 4XBKA 3O8AA 3W74A 3LM7A 4N2YA 4N9DA 1QOQA 3G1FA 3P5YA 4EF9A 3AO0A 4ORIA 4I9AA 4HPJA 5AHFA 4JXCA 4MLRA 1IIHA 3KVKA 2CWNA 4GE8A 1W5OA 3NDOA 5EPDA 4MKNA 5CZTA 5I3IA 2V2HA 1MSSA 3VCRA 1TREA 3SY5A 4KFNA 2EF9A 1TTJA 4IUOA 5F2LA 5HULA 2YW4A 4GUFA 4O28A 1YDOA 2ZA2A 1SO6A 2RDWA 4I7VA 1VR6A 5G2IA 3OG3A 3QF0A 4R33A 5DBTA 2NUYA 3ATYA 3QMRA 2I1OA 2X30A 5D38A 3LHYA 4IMEA 5CKSA 3W71A 5AHLA 1TTIA 1WYIA 3NL5A 3QZEA 2GQ9A 3TXZA 3UXDA 3G24A 1KM6A 4GUIA 1FDYA 3ELFA 3QYQA 1PHWA 4UTIA 4O0KA 1J2WA 3ZWTA 4CQ8A 1NSJA 2ZRWA 1W56A 3VE9A 1MZHA 1KM5A 5D30A 3FS2A 1BTMA 4RKAA 1IF2A 5DXXA 3W1AA 1TB3A 2FFCA 3T55A 1VLWA 5LSMA 4O52A 3L5AA 4JX4A 2H8ZA 2Y7DA 3TSMA 1D9EA 2F84A 1KA9F 4Z1CA 1UUOA 1WAUA 2RH9A 5F4SA 3TV8A 3NEVA 2PRMA 1PHQA 1YYAA 2EPHA 5FF3A 3O05A 5F2GA 3TMLA 4CCCA 1A5SA 3NQMA 4LC8A 3U2OA 5G1TA 5EMUA 3FLUA 1AL7A 1OFRA 2J6XA 2NXHA 4M6PA 1SW7A 4CNPA 3NQEA 1QPOA 2HS8A 2Y7FA 2CLHA 2YDAA 3GXTA 3AJXA 4R53A 3FOKA 4UFIA 4AWUA 4N9BA 1OFAA 2H90A 4JIQA 1EIXA 3LXAA 4EVZA 2C3ZA 2OT0A 1HL2A 3EX4A 2QKFA 5CGQA 5CPOA 1PS9A 4OBTA 1OYCA 1VCVA 3GDTA 3HB9A 3LTPA 5CZSA 3S9YA 4YCOA 3T4CA 3DFTA 2J24A 2B0MA 2TRSA 2GVJA 4Z0JA 3W1MA 3LGEA 1SZEA 1Q6RA 3GYEA 3LCWA 3P7YA 4A29A 2ABAA 3NQVA 3VNDA 2F7FA 4HT3A 3TH6A 5E93A 3W83A 2WOQA 1VCGA 3KFTA 5CPMA 4Z0SA 2QJGA 2DJXA 4K7VA 2ZZ1A 2PCQA 3E96A 1ZAJA 4UMAA 1GG0A 3F1QA 4LVAA 4O53A 1H62A 5J5DA 3TU9A 3EWXA 1LZOA 3ATZA 1LRTA 1KM1A 3G1HA 3S42A 1A5CA 5DY3A 3SSJA 3L9CA 3LHZA 4ZZ9A 1SUXA 3V75A 3BW4A 5KINA 2ZTJA 3NOEA 2UV8G 1NEYA 2QJIA 3NPWA 3C3NA 4Y8FA 5K7JA 1M7PA 2C19A 3W1XA 3W7RA 4AH7A 3FYPA 3QRHA 5C2XA 3F03K 3BLIA 3QSTA 2A7PA 3W2MA 2FB3A 2Y63A 1OFEA 1B4KA 2FIQA 4DF1A 2FQIA 3BLFA 4QNEA 2V81A 2WQPA 4FNUA 2QCDB 2QCFA 2Y88A 5DXYA 1LOSA 4MIMA 2TYSA 3L0KA 4Y9AA 5F4XA 2V2DA 2V8ZA 5CSRA 1RQBA 1PCWA 4MZYA 3BG9A 3EWBX 3HG3A 4OU1A 2C6QA 2WNQA 5D2WA 1W31A 1SSGA 3B0UX 3LOTA 1KFEA 2NX9A 3NL6A 4RXGA 1OFQA 4WQ6A 3MP5A 3L0NA 3LB0A 2BWGA 1IXQA 4IX2A 3Q37A 2A7NA 3W7NA 2JK2A 4K39A 4MZ1A 1N55A 1W5MA 5HINA 3W76A 3N2MA 5D2YA 1ZAIA 4AHOA 3TJLA 3W7DA 4QM1A 5DELA 3DFOA 5D2VA 2ZA1A 3A5FA 1HO4A 1A5AA 4O57A 1MEWA 5SWUA 3NPVA 3PBWA 1T96A 3LHWA 5BOOA 1KBJA 1B3OA 5FF4A 3E12A 4OV9A 1KM0A 3NYZA 3HJZA 3G0SA 2A6LA 4S2BA 5E0KA 3BGGA 1TSIA 1TPFA 3BK0A 4FNQA 3DH7A 4AMAA 3GK0A 1GOXA 5K3VA 1L6YA 1VYPX 1IXOA 3W7CA 2J9XA 1FCQA 4YMZA 1GQNA 2DU2A 4YLWA 1H7PA 4NNCA 4RR4A 2A2IA 2X1TA 3GAKA 1BKSA 3LCFA 2JGYA 3LTYA 3QQ1A 2XN1A 3THAA 1LBFA 1Z44A 5FI8A 3M5ZA 4FHAA 1S5TA 1FDJA 4HHPA 1KLYA 1K8XA 5AYZA 1TPWA 1XCFA 3NL3A 4LV4A 2Z1BA 1YDVA 1UASA 2ATSA 4IMDA 5DLCA 1KFLA 1GVRA 2NWSA 2V5LA 3R2GA 6ALDA 2Z6JA 1S3HA 4MZ8A 1M6JA 1OABA 5ABTA 3EKZA 4O4VA 4BR1A 4O10A 1XDMA 1N7KA 4Q33A 1RPXA 5C6MA 2VEPA 5DY2A 3HF3A 3PG8A 1H7OA 3TFXA 3BLEA 3N2XA 3LDVA 4LS1A 1VYRA 3QMTA 2DJLA 1FXPA 3LI1A 5GVJA 4KFOA 1AK5A 1ML1A 1XC4A 1H7NA 1Q6OA 1Y0EA 4JTIA 3QSRA 1HG3A 3UNDA 3G1SA 2BSLA 1O4UA 2VKZG 4HPXA 1I8JA 3PAJA 4RZ5A 4X9SA 4PEKA 3MO7A 4XUGA 4M6VA 2CU0A 3LV5A 1E51A 3KVJA 4BK9A 3DFQA 4UTWC 4A21A 1EP3A 3P84A 4AWSA 4DBEA 3W72A 4QISA 4UFHA 4LUIA 5AN7A 3HGRA 2C16A 4EIVA 1LLWA 4UTWA 2FPVA 4WOZA 4Z08A 4QIUA 4WD0A 4DQWA 4GWEA 1X8FA 3DKLA 3RNDA 4AHPA 3EWUA 1EX5A 3OBKA 1L6WA 3UWVA 1KTBA 4UNLA 3O15A 4PL1A 2ZBTA 3H55A 1K03A 4Y90A 1FWRA 1QAPA 2E68A 4A3UA 1QR7A 1QCWA 3UZJA 3NQDA 3C2OA 5HMSA 1Z48A 3W7MA 3WFAA 3RFAA 2E5CA 4JTSA 2VEMA 1G4SA 2CLLA 4LVDA 3W1QA 2TSYA 5F1UA 2QJHA 2V9DA 3MYOA 3DI1A 2NUWA 1QFEA 3KXQA 3SZ8A 1DL3A 3TQKA 4AXKA 1HTIA 1ZALA 3W75A 4KWVA 3N9RA 3M5XA 1H7XA 1KM2A 4MVAA 3P67A 1H1ZA 2NWRA 2FPTA 4UTUA 2WO5A 2FPYA 1DV7A 3N34A 3GX9A 3R89A 2WKJA 1UBSA 3O6CA 1SR9A 3W7JA 3DFNA 1RQEA 2PRHA 4MJZA 4S2CA 3S1XA 5I3FA 5K9DA 5H91A 4HNVA 4EF8A 4O19A 2ALDA 4WXYA 6TIMA 3IIZA 3NPUA 2JBMA 3BW2A 4DELA 4IJBA 2ZZ4A 3DZ1A 1GVQA 4TMBA 4XTDA 3GAYA 5D04C 1AL8A 3TAKA 3IGSA 2QEZA 2GQAA 4JY9A 1OYAA 4GNJA 3GXPA 2OT1A 2DZPA 4MY9A 1V5XA 1PCKA 2VXNA 1LRQA 3GR8A 3O6YX 4LOCA 3CPRA 4S1FA 1DJQA 2J9ZA 3RLVA 1JUEA 5K9CA 2ABBA 2R14A 5FF0A 1TV8A 2VFGA 1OX6A 3CU2A 4LT9A 3U8GA 3Q2DA
chains in the Genus database with same CATH superfamily
3U7BA 3NQBA 1I45A 4NNBA 4GIYA 3WBXA 3ONCA 1FBAA 3QC0A 4HZ8A 3WBAA 3WBYA 3U5YA 4I5UA 3LV6A 3QVQA 4UCFA 1PX4A 2BXVA 3ZJKA 5CPNA 1QNPA 3B4UA 2ISVA 2B7OA 4PEEA 3UXKA 3EDJA 2R91A 2PDYA 1R3WA 1R7OA 3TQ0A 4K8HA 1KV5A 1KXHA 4K68A 1RCQA 3RYSA 4YVPA 4NZCA 1IHIA 3QR0A 6TAAA 1KO0A 2VFIA 4QLKA 4YPJA 5HQEA 4O1DA 3IJLA 5EMMA 1PPIA 1OJXA 2ZXAA 3W86A 2VC9A 4LH8A 2J8FA 2IXUA 3QZ6A 3L7RA 1VH7A 3AC0A 3OGVA 4LYQA 1QO2A 3T7VA 4XKYA 1JZ3A 3VC6A 3IRDA 4P2VA 1O5KA 3LCIA 3EOUA 2FZDA 4JQ1A 2R94A 3P60A 5BU9A 1PKLA 2E6YA 4GI9A 4C60A 2V6AA 3VIPA 1EWDA 3P82A 2WNNA 4Y8EA 4DEFA 3GKFA 2W6RA 1J0KA 3A22A 3DHDA 4OGZA 7TIMA 4K37A 1AQ0A 2A5HA 3TK7A 9XIMA 2QCMA 1S1PA 4JIPA 1RR2A 1LG1A 1W9XA 3WD1A 2BG5A 1JPIA 1UH2A 3V7PA 4UR7A 2CEQA 1MXSA 1SJAA 3KL5A 4AF0A 4LJ3A 1XFCA 3A21A 5AC5A 4WY0A 2UZ9A 1R9ZA 2H8XA 3TN3A 3CYJA 3EGJA 1W0MA 2Y7EA 3MMWA 1BSLA 1WV2A 1OBAA 4CQBA 1KQYA 1UA7A 5HMFA 3MANA 4G1KA 1JQXA 3O16A 3SEPA 5CH9A 1KW1A 7REQB 3AYSA 5HPOA 6XIMA 3S6OA 1R9YA 1GHRA 4J3VA 2QF7A 2VC6A 3BZJA 4IXHA 3WIJA 4FR1A 1M9HA 3FY1A 1QRQA 4AEEA 5IDZA 1SZFA 3W6YA 1DWFM 3EX3A 1DVJA 1OC7A 2XM1A 2VDGA 2FJKA 1XRSA 2AL2B 4JNMA 1Q6QA 1QOXA 4NG3A 2V63A 1BSIA 2WNZA 2VP8A 3VNLA 3UT0A 1XBYA 3OA3A 1C7SA 3WSUA 1XYZA 1LCOA 5I00A 2D20A 3GDKA 5D03A 4XZBA 1IEWA 1PIGA 4KEVA 5CQ1A 4QAIA 2AQOA 4PCSA 2C91A 4FI4A 1LDCA 4Q4MA 1I2OA 3FA5A 4F9DA 1I6NA 4KFPA 1H7RA 4OE7A 1UZ1A 3QLDA 3WLHA 3W73A 2ATMA 1CT5A 3SFKA 1F5ZA 2H9AB 3OOQA 2FVMA 3BE7A 2QAFA 4UQDA 2QAPA 4NYUA 1A3WA 2HVNA 3E2RA 2BZNA 2DSZA 4L65A 3TW7A 4TU1A 3GR4A 4OIFA 1JPKA 1QBAA 1W5PA 1W2PA 1BF6A 4HOZA 4AHQA 1E9YB 5EA9A 3KDOA 2ISWA 3BMWA 1OG0A 1J0JA 3FSTA 4A4AA 4J3SA 4EOUA 2KZHA 4LUTA 1ECEA 4DNHA 2G41A 4JDYA 2AAMA 3W1LA 4DO4A 4FP1A 3B8IA 2NXGA 5L6UA 2J9YA 3R7MA 4Q8NA 3GNOA 2P8BA 3PBYA 4TTGA 4LY8A 3RF9A 4H19A 3SUSA 4MNMA 2ZA3A 5FEWA 4FF7A 3V5OA 3VIKA 4Q8TA 2NX3A 2RGLA 2J7FA 4MDOA 4I3GA 5JIPA 4N9EA 1TELA 1V0KA 5C2GA 3N12A 3UW6A 1V3JA 4L61A 4NP7A 2PDGA 4ICNA 2J27A 3NGJA 3GFZA 1L9WA 3G1VA 4AD0A 4DZIA 3U4FA 4JCLA 2Z2AA 4RV3A 1O95A 4QJ1A 4HJFA 4DVOA 1UWUA 2INEA 2PWVA 5C9ZA 1KGXA 2V3EA 2C8NA 1DQUA 4E8DA 2D3LA 1E43A 2Z0IA 4ONVA 3O07A 4X2PA 4NL1A 1QPNA 3QTPA 1OFOA 3GZAA 4A8NA 4H04A 4MUZA 2CLEA 2XHYA 3IPWA 1EO5A 2Z6IA 4NXKA 4A3HA 2ZZ7A 1CXIA 1DXIA 1KV8A 2R1LA 2ZUUA 3K4AA 3A5VA 2VZTA 3SGGA 4JDBA 3UWUA 2GQ8A 3TZFA 5BXSA 1XISA 4IOTA 5CG7A 3IAQA 4PB5A 2HXUA 4JBRA 1JCJA 4GVGA 1TVLA 2GDQA 4AIEA 1NDVA 1EB3A 4JFSA 5HJYA 1EPXA 6ENLA 2BGSA 3R8RA 3UJEA 5G1MA 5IBXC 3WJZA 3YPIA 4Q7IA 1SW0A 3JU2A 2AGKA 1S46A 2E4TA 1HXJA 3NM1A 3SUTA 4ZQCA 2ZKMX 1P1XA 2D23A 1TTQA 4LU0A 1F61A 2QV5A 4H2CA 1QT1A 3VI2A 1PZ0A 5I3DA 1FHVA 2CBJA 2F2HA 4A2RA 4V33A 2WC7A 4DZHA 3GVVA 3MVIA 1C29A 5L9FA 3L0GA 2WVVB 4TV5A 2EKCA 1TWIA 4LVFA 1GW1A 3AIVA 4CN1A 1AQMA 1BXCA 3A3WA 1NM9A 2AAAA 2Z27A 2AMXA 4UFLA 4QFUA 4IP4A 3USZA 1KR1A 1CGWA 2ZXQA 4H00A 1UD8A 2PP0A 3GHSA 3T0AA 4J2PA 5IXEA 1VLIA 3AZTA 1DYSA 3WKZA 1UWIA 3GKAA 4GC4A 1PB0A 4J5NA 4ICCX 1DWJM 5JH1A 3P5ZA 1H1YA 4NRSA 5A8MA 4F9JA 4PTVA 3BGAA 3KOZA 5FIPA 3VMNA 4K2SA 4E4UA 1Z8AA 2DQWA 2TMDA 5AKQA 1MDRA 1UJQA 1XLEA 4HZ6A 1TPH1 2GJXA 2HE8A 4Q8PA 5DANA 2CW6A 1LROA 4H9VA 2YYTA 2Y62A 5I0DA 4H7CA 1YTKA 2BVWA 4A05A 3QV7A 1CW2A 3F4CA 3WO8A 3PWGA 1IEVA 3APYA 1ZRQA 4I5RA 1QDSA 2PDHA 1A47A 1YNQA 1FHUA 3C0SA 4YVXA 4UQEA 5FKYA 1B3XA 1SO3A 3UWYA 2WYSA 5FACA 4NZ1A 2ADAA 2I14A 4QGCA 4WGHA 1EJVC 3O0KA 4FIQA 1W54A 5FCZA 5A6JA 2C0AA 4C6MA 3MCNA 4GYKA 1SYTA 3N15A 4NYYA 3T8QA 1BQGA 2P50A 2VJXA 1IIGA 4FNPA 3SB0A 3THDA 4HCHA 3DG6A 2OSXA 1E1FA 3DUGA 3URNA 5LHEA 3CUFA 3RU8X 3VOJA 3CQHA 4K6AA 1CXKA 3HG5A 1R3RA 4R9OA 5FF2A 1FY6A 4JICA 3VGGA 1JJKA 4JTFA 2UBPC 2WVSA 5TD4A 4KETA 3OA5A 4HK6A 2ZZ2A 3I68A 1QXLA 1H0IA 4DYJA 5DN1A 1B1YA 1LJYA 3C2RA 4HMNA 2VDHA 1V3HA 4UOQA 4WKHA 3K5XA 2Z00A 4UUIA 4CNUA 2B4GA 1PTAA 5BU6A 1IEXA 4M82A 4MF4A 1MXDA 2C1HA 5DCEA 3LQLA 3WQ8A 3WF2A 4C6IA 3PF3A 5CSSA 1FP9A 5F1VA 1SW3A 3CWNA 4BHYA 3G1DA 5E6YA 2VC7A 5FAGA 1OZQA 1E40A 2WMIB 4MKSA 3LHTA 4LRSA 2ZZ6A 7TAAA 4BQ3A 4Q4KA 3VOIA 1EOKA 2YDQA 4K36A 2Q3RA 1JVNA 4ZBCA 5D05A 1G4EA 1XLHA 2V69A 2ZWYA 1I2QA 3SQSA 1WPCA 1K77A 1WB0A 3PZOA 2CZFA 3CZGA 4KWOA 1RZMA 1NH6A 2V30A 4C1LA 3VU2A 4BZYA 1YEYA 3WELA 1LOQA 1K9EA 3T42A 5CBJA 1DORA 1KXQA 4E38A 3C2EA 4M6UA 1JCMP 3M9YA 3NPXA 1TPDA 1VENA 3EDDA 2QXWA 4U5KA 1CLKA 3QFEA 4NX0A 4H7VA 5D37A 3A64A 3OLGA 3UQNA 3T08A 4B5SA 5LIWX 3GXDA 2GUYA 4AX6A 3W1UA 4QSFA 2PD9A 1DIDA 1S2WA 3NQ8A 5AC6A 3ZM8A 3ZT6A 4WJ8A 1GVSA 3TIMA 4FPSA 1XYFA 1XIIA 2ZYFA 1NFBA 2DZSA 4WSJA 4FX6M 3VIIA 2WV8A 3UWZA 1W1IE 2PDCA 3L66A 3LGGA 4EKJA 1Q4NX 1ISYA 3CMJA 1E6XM 2BGQA 3PBVA 1Q2SA 1W37A 2WZTA 4QLJA 3HPXA 4H01A 3OIXA 3SO7A 1V02A 1XF0A 1DJGA 1FWSA 1Q6LA 1U83A 1WQ5A 2GJPA 4QRNA 3S2LA 1POKA 1KFBA 3STGA 4J28A 4TVDA 1ZENA 3BAKA 3TC3A 4LFYA 3EWYA 5LA1A 3R10A 3K8KA 3IS4A 3PJWA 1UD2A 2YYUA 2V67A 1E3XA 4O1EA 2O55A 3KRUA 2PC4A 2R24A 3GXFA 3GG1A 1RA5A 1XXXA 2VFHA 4BFAA 3H2OA 4KH2A 1O5QA 3VFCA 1E4MM 3CUXA 1Y5VA 1UC4A 3GBEA 4K7YA 4B5XA 1JNEA 3QXBA 1KLZA 5U4NA 2DGAA 4XIMA 3EWDA 1AODA 4WJEA 3LG3A 3OYZA 4TVCA 1OT1A 3URAA 5C5YA 3PB0A 4M7SA 3LLXA 1VFUA 1NOFA 1F2JA 2QW5A 4ADUA 3F5LA 4Q8MA 1C9DA 4AY7A 4J1OA 1GCYA 5D2XA 2E5BA 2Z2UA 3S4TA 3UZYA 3GR7A 3VKAA 2X1UA 4E2BA 4M56A 3A23A 2DIJA 4WSHA 4UTLA 3F4DA 1ZBVA 3MHFA 3H2AA 3G1AA 1RY0A 1JFHA 4IFRA 3CC1A 4ZSUA 2DZXA 1RJRA 1VQTA 2Y0FA 4ADSA 5A94A 1K9FA 2FLIA 4E3VA 2OODA 4R9XA 3HURA 3DHFA 4IL2A 3AMGA 4NVTA 1CXFA 2A1YA 3FAXA 2Y6ZA 2J7EA 2NLIA 1D2KA 1NDZA 3II1A 4J3XA 1BXNA 4GQBA 2DZTA 4H6EA 2OLAA 2G95A 3QY8A 2DZUA 2ZC1A 2VZVA 3F7JA 3L5MA 3BAIA 1GNXA 3W53A 3LTSA 3BANA 1AD4A 1DWAM 3SQLA 1QUMA 1UWRA 5LNUA 3W7PA 2VEIA 5HWMA 2BY0A 1EP2A 5HMEA 3N2TA 3HMJG 4PUMA 3THCA 4PR4A 3UJRA 3CL7A 5A8OA 3NR0A 3ZMRA 3SRHA 4H4IA 2ZADA 4E6MA 2OMAA 2D1ZA 1ADSA 3OP2A 1R46A 1TE6A 3CT2A 2UWFA 2PE4A 1XKYA 2J25A 4W4QA 4OT7A 3CEPA 3JW7A 3AIUA 2PDIA 4UTMA 4L80A 1RP9A 3BWWA 4AD4A 4JX6A 4JHZA 4KPLA 1RP8A 1VIZA 4GZEA 1MW3A 1OYBA 3WL1A 3B97A 3KS5A 1OIMA 3EEZA 3BV7A 1XWYA 4REQA 5G1YA 3S1UA 3L2MA 3AXIA 4W84A 4ES4A 1BPLB 3IVUA 4JN6A 4AVNA 3BCDA 4UZUA 1JCNA 5HMDA 3EEGA 3W7HA 3WK1A 4JTTA 3APGA 1RSCA 4V28A 1XLMA 1O66A 2PBOA 4H6RA 2PDQA 1NQ6A 3T8LA 1NWUA 1F3WA 3MW7A 4LUSA 1DJWA 3W2NA 3BOXA 1PYMA 5C0QA 3M07A 1OFDA 1TQJA 1JNDA 2E9MA 1GJWA 3KHJA 1TJPA 2XIQA 2QPSA 4RJEA 4GH1A 4RCXA 2CERA 1TX2A 3NTYA 3W82A 5HK4A 4DUOA 3EOLA 4J40A 3U5UA 3KCJA 4TXEA 3N9SA 5I24A 2E9LA 2BOFX 4RV8A 2ISDA 3LCGA 2PPGA 3SIZA 3HTWA 3QTGA 4ERAA 1NTHA 1J8VA 4UMCA 1KXVA 2VURA 1WXYA 2D0HA 1ISVA 3K1DA 1YNYA 4B5WA 1QNVA 1NOWA 4QS5A 5G5IA 1MZRA 2DORA 1BGAA 1YPFA 3S47A 4PMUA 1HUVA 1LT8A 1E70M 2Y85A 4Q4PA 4ERGA 3H7RA 5GQBA 4LRTA 3EX2A 3GC5A 1QOPA 1VJZA 2J7BA 3I7QA 3TXVA 2DVUA 3NG3A 2OWWA 2C14A 3UR8A 1VHNA 1QNQA 4JTLA 5ABFA 5E0FA 3G18A 1TWWA 3L65A 2XH2A 2BOEX 1RBAA 3PBUA 3WD3A 4LBUA 1Z3NA 2HMCA 1W1VA 1W3TA 1AMYA 3CV7A 4HYVA 1YXDA 4W8AA 4W8BA 3G6MA 3FNDA 3LEPA 1EJTC 2NQZA 3VNIA 3VIMA 1ZJBA 3SCVA 4I5XA 5JBDA 2I9EA 1E5NA 4HIBA 1FDZA 4LBSA 4LEFA 4D6DA 1K8ZA 4WGXA 3B9NA 1DIOA 1W3IA 3VOCA 2CIPA 5LGXA 1HJWA 4LAKA 3SY1A 1S5VA 4ML9A 4C6JA 4D8AA 1MQPA 4OBRA 1IR1A 3WMBA 4FAMA 1Q6DA 1HFBA 5D9PA 4GZ7A 3W23A 3MWAA 1A5MC 1HGWA 1NVMA 3MU7A 3TR2A 4TQTA 4CD8A 2R82A 1RPKA 2NQLA 4CNTA 4ZTYA 4O16A 1KFJA 3P61A 1OVDA 1UZ4A 5FAJA 1CGVA 2OZ3A 4UTFA 5CPLA 4P8VA 4XAFA 5TNVA 4E8CA 4ILSA 2QHAA 1GVOA 4IPPA 2GK1A 4HK5A 1XLGA 3QR3A 3H7VA 2HDJA 3IUHA 2ZVRA 3DECA 3HIJA 3BJSA 4GCXA 4PUKA 4F8XA 3T44A 3ARPA 4PRTA 4B92A 3AMLA 4MSSA 3W9ZA 1J10A 4HHHA 3K30A 2OTDA 1WZKA 2X0SA 4DAIA 1KBIA 1E1CA 3GIQA 4AZCA 3MP4A 2W27A 4DUVA 1NF0A 2YFOA 4NX5A 1W1YA 3SIMA 1W3LA 2V3DA 1W9DM 4ZR8A 4N2YA 4N9DA 4RW3A 4I9AA 1W5OA 4K8GA 3AHVA 4MKNA 3GTNA 3R94A 1B30A 4RDZA 4G56A 3M0IA 3IUDA 3VCRA 2C71A 3SY5A 3XISA 1XRVA 2YW4A 2FMOA 4R7OA 3T81A 3PNUA 4L6OA 3QF0A 4PGLA 4AIUA 2QPUA 5CKSA 1S5MA 1CIUA 5IHRA 2HWGA 3E6EA 3NL5A 3AHTA 3UXDA 3AYRA 3ELFA 5I6SA 4I6KA 1E6PA 4O0KA 2QMJA 1SJDA 4HJWA 1VFTA 3GH7A 3RR1A 3VA8A 1KM5A 2OSWA 3FS2A 4FR6A 5HDRA 2FFCA 3L5AA 1EJSC 1GUVA 1KKRA 2H8ZA 2F84A 1W2VA 4L1XA 5F4SA 5DQPA 2PRMA 2VX4A 2EPHA 3O05A 3TMLA 3SRDA 2O4QA 1Q5MA 5G1TA 1AL7A 2NXHA 3TLQA 2CBUA 1QPOA 2HS8A 2XIMA 2DEPA 2YDSA 4Q8QA 2YDAA 4FS9A 3EWCA 3GXTA 3LSCA 1B90A 1HKJA 1HJUA 2YXXA 4US6A 4CD4A 3LQGA 2QKFA 5CPOA 4JL2A 4OBTA 1OYCA 4UB9A 2Y8VA 5CAKA 2EJ1A 3UPMA 1RA0A 3ARVA 3B0XA 3AAMA 1UR0A 1J79A 4UWMA 3ZOAA 3GYEA 4YWSA 3P7YA 4BA0A 2NQ5A 2ZICA 2F7FA 3W83A 4GINA 2F8QA 3GD6A 1ZJAA 2WOQA 4HD5A 3T2QA 3WBWA 4WR3A 2QJGA 1FA2A 1JI1A 4D71A 3FV9A 2PCQA 3E96A 1XLBA 3F1QA 4O53A 4M1BA 5E5CA 4QE5A 3EWXA 2BHUA 4MG4A 5DX7A 4CEUC 4H7ZA 3G1HA 5EMYA 3BAJA 2XFYA 5F7UA 4CCZA 3L9CA 1E6QM 3UGRA 4ZZ9A 1SUXA 2YCIX 3BW4A 5KINA 4HTBA 2ZTJA 4JEJA 1XW8A 1NEYA 4B3LA 1VFSA 4IFOA 4GKTA 4Y8FA 3GUGA 4WDTA 4AH7A 3NURA 3HU7A 2FTWA 2A7PA 3LPGA 3N17A 3BMVA 4DWSD 1OFEA 5LIUX 1OGSA 4DJFA 3MO4A 4DJDC 2CLPA 2QCFA 1NY1A 3L0KA 4Y9AA 1NELA 3VX0A 3T05A 2G3JA 2V8ZA 2A3LA 3EZ4A 4H41A 1RQBA 5CSRA 5D9OA 4Q22A 1DWIM 4TV6A 2WNQA 3ZVIA 1S2CA 1W31A 1SSGA 3B0UX 4H8NA 1QK2A 4WQ6A 4C7GA 8XIAA 4X0VA 4PE8A 2BWGA 4HA4A 1NDYA 3FAWA 3RCYA 3TW9A 4L4OA 1DTUA 4XISA 2ZX5A 4KWUA 1N55A 1CGYA 3WN6A 1W1TA 3E0WA 3TJLA 3NDZA 4EXAA 2CKSA 2WJFA 1WAWA 3NPVA 3PBWA 4F79A 1KBJA 1YQ2A 1YBQA 2YL8A 3MY9A 1C91A 1TSIA 3ZYZA 3DH7A 1E6SM 4OOZA 1MUWA 4G8TA 4ROPA 4L56A 3EMCA 1NP2A 6REQB 2F61A 3I4EA 3WQFA 4E5TA 1QW9A 4XSLA 2PFHA 2QULA 5BOEA 1Y7VA 2X1TA 1BKSA 3LCFA 1LBFA 1T40A 4HA0A 1WP6A 1K70A 1KLYA 3MTWA 3W28A 1TPWA 1XCFA 4L64A 3VVGA 1KNWA 2J79A 1JD9A 4PB4A 2NWSA 1S3HA 2XH4A 3AUOA 2DSUA 3AALA 4O4VA 2VM8A 5LA2A 1KKOA 1NWRA 5C6MA 1UWTA 2J62A 5DY2A 5A8NA 1YE6A 3N2XA 2I17A 4KCWA 4GIRA 1VYRA 4PBEA 4PB3A 4RE4A 4WDXA 2DJLA 1FXPA 4JFWA 4DJEA 4IHCA 4H9ZA 3AS0A 4GQQA 1HG3A 1TV4A 4B9ZA 1XHGA 4GH3A 3MDUA 4ZB5A 4YVVA 1F07A 4IQJA 4S39A 1P0DA 1KBKA 2BS9A 3PZIA 1J9YA 1UKSA 2G50A 4L6DA 1UR2A 3DFQA 4GGHA 2IUZA 1TVPA 2TAAA 4AWSA 3W72A 2GGEA 3H8AA 3GHRA 4QR6A 2C16A 1LLWA 4UTWA 4Z08A 4WD0A 4AHPA 2C0HA 5M1TA 3WQCA 1CWYA 2ZBTA 3IARA 3H55A 4GJJA 1N8IA 1UH3A 3DC8A 1Q6CA 1ODUA 3C2OA 4HCDA 4G7EA 4AD2A 4F2BA 3VIFA 2VEMA 1XRTA 3WQGA 1FKWA 2CLLA 4LVDA 1D7FA 2ZUMA 5I79A 3DI1A 2NUWA 4HMCA 3ITVA 1HTIA 1JAKA 6CGTA 3QV6A 3R79A 3W75A 4Z2GA 2QGHA 3SRFA 2J8TA 3P67A 2NT1A 5JIWA 1H1ZA 2CETA 2FPTA 3NYDA 2WO5A 3B0YA 3U2ZA 1DV7A 3N9KA 1EF3A 3LM3A 4GXPA 1BGGA 3DFNA 2JEQA 1Q6FA 1PBGA 1O6IA 4S2CA 3S1XA 2E3ZA 4J3UA 4IG2B 3Q45A 4QP0A 5H8UA 2JALA 4FLRA 3RCNA 4IJBA 4EWJA 1GONA 3VINA 3CZJA 1R85A 3KBVA 2QT3A 1TA3B 3AYTA 4F48A 3GXPA 2OT1A 3IAPA 4H6QA 1PCKA 3S2MA 3PJTA 3HQPA 3O6YX 3N2BA 3CPRA 1XC6A 3I10A 2YZ5A 2EEXA 5A6MA 1KCKA 5C8BB 3XIMA 2D0FA 3U8GA 4J9JA 2OCZA 3WLQA 4AYGA 2YW3A 3RX2A 3K4WA 3DC0A 2YB4A 8A3HA 4FA3A 4IH3A 4RE2A 2WHLA 3V0UA 4QEEA 3L2IA 5FJPA 4HA3A 1LL7A 2J7HA 1OX4A 1TMQA 2DZAA 4RZ6A 5D2TA 1AW1A 1WNOA 2ZUSA 1JL8A 3C0JA 1K3UA 4UFMA 2J4GA 1H09A 5CJMA 2WLZA 8XIMA 2HCVA 3UEQA 4JKMA 3W01A 1OX5A 1G4PA 4Y9OA 1I0DA 1WDSA 2QDHA 1O7AA 2HSAA 2QVHA 2FDSA 4CQDA 1KCZA 2XSAA 1ELSA 3NQ6A 4UR9A 3CZ8A 1W1B1 1C3FA 3GTXA 1AJ0A 3WQWA 3C2VA 3TUUA 1YMYA 1FVPA 2FGBA 3QOKA 1V0NA 3BJTA 1K8YA 3TSBA 4AZHA 1UWQA 5B80A 5JU6A 2VD8A 1QPRA 4UOJA 1D8WA 1GVFA 4DAFA 3E38A 4IGNA 1S2UA 1Q7QA 3EKGA 3U2CA 3DGRA 4UMBA 5FESA 3LCHA 5KTLA 4EPDC 3STCA 1HF6A 3G5EA 3APTA 1FCVA 3SCTA 3PWAA 1YHTA 4S3DA 2OELA 1PDYA 3KE0A 4WRHA 1UH4A 1UWSA 1YPXA 2XG9A 4AB4A 2OEJA 1K7FA 3MBDA 1DBTA 2ZCGA 3V5CA 1M53A 3MWCA 3OVQA 4ADTA 1JXJA 3VE7A 2D2OA 3CEUA 3TE9A 1JF6A 3C56A 4PSRA 3WZ0E 2A3CA 1X8CA 3TA6A 4NAEA 4GOAA 3BQ6A 3OW1A 1FH9A 3ZSTA 3WH5A 4E2DA 4DO6A 2UY3A 3KLLA 1XYLA 1YXYA 3WENA 1PUDA 1XPYA 4FXSA 3W85A 3MKKA 4F4RA 3OEXA 2BXZA 1UROA 5KZEA 2GDUA 4IPNB 1RD6A 3AHXA 3AQUA 2X42A 3TDFA 3HV9A 1AUSL 4RUBA 3QGAC 2DH2A 1BYAA 4DWSB 3KL0A 3D47A 3KTXA 4BEUA 3WCZA 1DJHA 3DEQA 3C52A 2FFIA 2XUCA 3MKVA 1FWNA 3TYCA 3RMEA 3VZXA 1SZGA 1Z42A 4JAWA 4W85A 3UCDA 4W5UA 1ME9A 3MS8A 3CQ0A 3R13A 7REQA 1G6CA 4B5VA 4KWSA 4C6EA 2CLOA 3MUAA 3PUOA 4UXDA 2E1WA 1GOMA 2OGJA 3W2UA 1BYBA 4O11A 2VFEA 2OYKA 2E0PA 3BOFA 2DT0A 1ITQA 4AEOA 2NQJA 2Q02A 1C7TA 1QASA 2Q01A 3T2PA 3LCLA 4CQAA 4QNWA 1M5WA 3FXGA 3JZEA 3NSMA 2VCAA 3RRAA 5A6TC 1EXBA 5CJ5A 2R1PA 2YX0A 5LNRA 4AZ6A 2NZLA 2BGNE 4NI3A 1MUMA 2P3EA 1DJZA 3DOPA 1OGBA 1AQFA 3DBNA 1P0NA 2PF8A 4Y2WA 4MWAA 2IMRA 2WSRA 5BW6A 3CZEA 4PH6A 3S0CA 2ACSA 4KWWA 3TYBA 3M47A 2WZHA 2ZX7A 3ABZA 5C70A 1M1BA 3OTRA 3S1VA 3TTYA 2GZXA 2Y8UA 4D8LA 4MB3A 4UCGA 1DJIA 2H9AA 3QBUA 2P8CA 3FYOA 2A4AA 1I9CB 1SJCA 4KEUA 1GQJA 2AMGA 1A80A 1KTNA 2GUBA 5KZDA 1EYEA 4AIBA 5DMMA 1YPIA 3QPYA 3RPTA 1TQXA 4MNLA 3UXLA 1EGMA 3R12A 4M5PA 2VWSA 4UR8A 1G94A 2XN0A 2JQXA 1JZ6A 3TYEA 2HS6A 5BCAA 4AAJA 4HN8A 2WCSA 4JYFA 3ZR6A 1XUZA 2C18A 1YE4A 3TSDA 1UKQA 1WBHA 3PZTA 1T8XA 3IV3A 4G7FA 3ARZA 3VK5A 3QV8A 3REQA 1B54A 3N3MA 2PGEA 5HJXA 1P1MA 5FF7A 4DO5A 1LP6A 1UQZA 1NP0A 5A8PA 5TQLA 3VMOA 4IGHA 1IZJA 2NX1A 3DFPA 3GNXA 4AD5A 2VFDA 3M0MA 4AWEA 2XISA 3NDYA 5AOUA 1Z41A 1Z6KA 3UYIA 3WNKA 4A35A 4GK8A 4XQ6A 3DIPA 3DX5A 4DB7A 5GPRA 3WDIA 3WD0A 1J12A 1JCTA 2WCAA 4ALDA 5AYXA 4AC1X 4JNYA 4LVGA 3VD3A 2QUVA 2ZRUA 2BOGX 1PJ9A 3W1RA 4XAYA 3WLPA 1R38A 1PYFA 4DI8A 3GDLA 3QY7A 4ACZA 1BFNA 1POJA 2R1NA 3C0QA 4XAGA 4QDMA 3V4BA 2EXOA 2XJ7A 2EPKX 4IUGA 4UQCA 1CCWB 2X0YA 3TMQA 3WLNA 4XVEA 4AC7C 5HANA 1QHPA 3PUDA 4U33A 3WD2A 1ODZA 5IDIA 4O8RA 3MDWA 3GSMA 4IISA 2YZRA 1A5NC 3C3UA 3BTNA 3ID7A 3R11A 4H9YA 3ERPA 1GPFA 3ITTA 1LUCB 1R3SA 1WOAA 3GWQA 1ONXA 4QG9A 3CXOA 3M44A 3LMYA 1V3KA 2Y89A 1G9HA 2ISSA 1B4EA 4PSPA 5FEPA 1E3ZA 1GWJA 1XLCA 1ADOA 1RV8A 1NQKA 4U4MA 2HE5A 3DN5A 1EQCA 1I2RA 1XDLA 4YWIA 1EBHA 4ZQMA 3LRLA 3SBFA 3TW6A 3AROA 1WKDA 3SR7A 3OQ8A 3PSVA 3EMQA 3GRIA 1GORA 2ZX6A 3OZOA 4Z1AA 4WK9A 5DFAA 3ARUA 2WC3A 3NWRA 1A5UA 4A8IA 4JYDA 7CGTA 1CXLA 3HBLA 4WKAA 1XD0A 1J11A 3NXFA 1JAEA 3I65A 4MB5A 5I3KA 4N6EA 2WKLA 1RQHA 3EXSA 2HQAA 3H4WA 1H49A 1UQYA 5HWJA 1A5KC 5K2ZA 2SFPA 3RX3A 4OV4A 3SCUA 3CPUA 4JIHA 3PN8A 3N4EA 3UR5A 3HQOA 4NT0A 2BHYA 3BO9A 4H6KA 3VILA 1LL4A 4EXQA 3F4WA 3WK2A 2B81A 3TYUA 4MFDA 3CAWA 3CTLA 1KM4A 2OJPA 1A0DA 1E71M 3FA3A 3TN6A 1V6YA 3JS3A 3IJ7A 4GXWA 2OKTA 2WSYA 1CPUA 5KZMA 3ZVHB 3H54A 1Q4WA 3EA2A 4GNKB 4KEZA 2OYLA 4GA8A 4MPKA 1HJSA 3LZ5A 3UERA 4NJJA 4XBSA 4I90A 3USBA 5M17A 2W9MA 4KKXA 2ZZ5A 2QCHA 2QUTA 2ISFA 4FF5A 1DWHM 4AVOA 2YXOA 3VDBA 2WMJA 1WXJA 4KESA 3LRKA 2CBVA 4XKYB 2FZBA 2Q8ZA 4W93A 1FWTA 5ECVA 3H4GA 3WJXA 2O9RA 4ZL1A 4U10A 3E02A 4GXMA 3EX6A 2FVKA 3LBCA 5FSDC 2X7WA 1E0UA 3E1F1 4LALA 4RNJA 3B03A 3WK0A 2FYMA 2I57A 3GXIA 3UXIA 2PTWA 4RNHA 2PLCA 2HISA 4QCEA 5JQ9A 1TR1A 3CTTA 2B7NA 4JPGA 1GJUA 3FK4A 2ZRVA 4AF0B 1KBBA 4JFVA 4XO7A 4U28A 3F2DA 1JGMA 4WY0B 1J01A 1Z7AA 3DCPA 5AHEA 3WL0A 1UW9A 4EXBA 1P0BA 4NZ5A 2VELA 1K6WA 5FJTA 4Y7EA 1A53A 2VR2A 2V5KA 1WDWA 1RBLA 5AYYA 1H7WA 3ALGA 4S23A 3T40A 3VABA 4E2VA 5LIXX 5FJRA 3HO8A 1B3YA 4DHGA 2MANA 1TJ0A 3MHUA 1E0VA 2WK2A 4G9PA 3S8HA 3I6TA 4A8RA 1J2BA 4P7RA 3EPOA 1MFUA 5AVHA 1EFZA 2PDMA 4JTEA 1A50A 4GBUA 5A6BD 1ISXA 1B9BA 4DY1A 7ENLA 4NJKA 3LSBA 3EB2A 2QCCA 3W27A 2W79A 5I06A 1XQKA 4LNCA 1SO5A 2QF8A 3T78A 1G7UA 1BRLA 2J13A 4M7TA 3QKEA 1RUSA 1CDGA 4H8HA 3UA4A 1FWWA 4GY1A 5IM51 3NOYA 3SN0A 1PZ1A 3VKDA 4IIDA 3MP3A 1SMDA 1F3TA 3MSGA 2YR1A 2C13A 1R3TA 2QDGA 5K4XA 1BF2A 1K6AA 4XO6A 2VEKA 3SY8A 4QTGA 4F0MA 1KM3A 3GDRA 3UPWA 3S1WA 1SO4A 1ONRA 3GB6A 3IIXA 5DT5A 2NUXA 3KTSA 1KFKA 5E1QA 3NAVA 3FFSA 3NQGA 4F2UA 3TQVA 3K2GA 5K9XA 1QK0A 2RKXA 1G0CA 1IT7A 3MUZ1 4EPBC 4Z2IA 2G4JA 4QLLA 3EA1A 4LAMA 2XIJA 4W7UA 4LUTB 4F40A 3SJ3A 4ATLA 4A3YA 1DXFA 4EWND 3GNPA 3WLJA 3UP8A 5DCDA 3P8IA 5EKYA 5K4ZA 1DJXA 4JTGA 4E0CA 1IT0A 3UG3A 5CZ0A 4IIGA 3KRZA 1X7FA 2HEJA 1CZ1A 2O9PA 3SGUA 3VAVA 1XLAA 2D2HA 2FVLA 4MWAE 3GU9A 3VGHA 3W6MA 4GISA 2HROA 3NQ2A 5AYBA 2PGRA 3QHNA 1SJBA 4G5DA 1TV5A 1TV7A 4H8VA 1ME7A 1XL9A 4HMDA 1XLFA 3B06A 4W88A 2V82A 2CBIA 4MOZA 4JTJA 3A3XA 3OU8A 1OC5A 3RN6A 4PMDA 1CYGA 4AIOA 4IXXA 4KCUA 2ONEA 2BDQA 1SPQA 4JX5A 4J27A 4HVXA 2YA0A 3ARXA 4BF7A 2DT2A 2PDJA 3ZZ1A 4O54A 3TFCA 3LHUA 3SADA 3NQFA 3SFWA 3UJSA 1P0KA 5BRQA 1I4NA 2XFWA 2ZRYA 3CZKA 2GVGA 2H3DA 3LK6A 3RCMA 5LXEA 2R1KA 4O1BA 1XSJA 5G4EA 2FB2A 2VQTA 4L9XA 4DLMA 3TCEA 5I7GA 1ISZA 3GVQA 3FCPA 2GVEA 3EMZA 3DXIA 1OSEA 1GEHA 2Z1WA 4NJHA 4S3EA 1ZFJA 2VEFA 3B3DA 3PZNA 3R1ZA 2BY1A 4GUHA 1IZKA 2QCDA 1K02A 4MB1A 3DYOA 2P10A 3UY7A 3M46A 4K38A 2IQTA 1E9IA 6PTDA 1XIFA 1W6TA 3U6WA 2VGFA 3NQAA 3PWIA 4R7JA 3D6NA 5LKYA 1XFBA 1TWSA 3QPZA 3SW6A 3DFYA 3PS7A 1WDPA 3EXTA 3D3AA 4TUFA 4OOUA 3SJNA 2RDTA 4LWWA 3UA3A 3WD4A 2FGZA 2X2GA 1NFPA 3EAUA 1ITXA 2E6AA 3EXRA 3NCOA 2OOFA 1R6WA 4IP5A 4TOQA 4BQ2A 4J3ZA 3M0LA 1PKYA 1JFXA 4U31A 2AL1A 4GI6A 1IR2A 3DFHA 3M5VA 2JIWA 3ZJ6A 2XDFA 1E6ZA 4HNNA 3CHEA 5T9BG 4LS2A 1EOMA 1ITCA 3VD7A 1WXZA 3HOJA 5FL1A 1MEHA 3TAOA 2CLMA 4O8AA 5LNVA 2E5DA 5I3JA 1XBZA 3IJQA 5HUPA 1R2SA 4D1JA 4OWGA 1CX9A 3QJAA 4UFJA 1JZ2A 4N02A 4GX9A 3VZZA 1Q3NA 3L4XA 3WFZA 4U2ZA 1TZZA 4Q4OA 3BAXA 1EF2A 3GH5A 3AJ7A 2EKGA 5A6AA 2Z29A 1UP3A 4QX4A 2QJMA 4KERA 3T0BA 4K8EA 1JZ7A 4ZODA 4DXKA 4FNTA 2A3HA 1V7AA 3M0VA 2NSXA 3S2NA 2BLEA 3GG7A 3S5SA 2XGZA 2DUXA 4HTYA 2XPKA 2OWCA 4CCEA 5E9XA 3FJ6A 3FEQA 2PB1A 4XD3A 1IE7C 3HPZA 2GVYA 3DU0A 3JUGA 1W1ZA 4HU8A 5AZ1A 2GJLA 5AC7A 1N82A 4XWUA 5HR6A 3EYPA 2GUUA 4M24A 3IJ9A 2YB1A 2QS8A 5DF0A 3RIKA 1TJRA 3LENA 3WBEA 2YCJA 3NL2A 4FLQA 1K1DA 1YDYA 1KRAC 4GJIA 3NQCA 3GW0A 1PDZA 5FD0A 1VFOA 1LRNA 4D6IA 3BLOA 2Q8LA 1ZL1A 2OZ8A 5EYWA 2RFGA 3MZ2A 4EK7A 1XINA 4HN4A 3QQ0A 1UOKA 1W3JA 5B7YA 3JRKA 1RK6A 1SZRA 3DG3A 3RJYA 4C6OA 1FHDA 3L4UA 3QGKC 1W3KA 3TROA 1DKWA 5H6HA 2OQHA 3QMSA 1KBLA 2O9OA 1JCLA 1ISWA 1XIBA 3NQ7A 3T4WA 3BSGA 4WEVX 4NI8A 2OG9A 3WF1A 3L4WA 5JVLA 3PTQA 3B8DA 2WJZA 4NXSA 4GJ1A 2P0OA 1VEOA 1K4HA 5T91A 4IF2A 1NU5A 1CBGA 4C6DA 2VEGA 1LWIA 2HBVA 3S5ZA 2VX6A 3ENLA 3RM8A 4D6FA 3IVSA 2FHFA 3TWAA 2IQDA 1EUNA 2QIIA 4WIWA 1TIMA 4C7FA 3VOGA 2Q3OA 1JGIA 5D8ZA 3NZQA 3WQ5A 4ZB0A 3THQA 1E5JA 3H70A 2B7PA 2EBNA 1MWOA 4EE9A 4KF1A 4W87A 3W6LA 2CZ5A 3UCCA 3BC9A 1S2VA 1A49A 4PTNA 2V5BA 5C9UA 1P6WA 3WNNA 2YPIA 1ALDA 3O3RA 2MNRA 3O8AA 4GUJA 4XBKA 3W74A 3LM7A 4S3BA 1R8LA 1QOQA 4S3GA 2YA1A 4HPJA 1OWQA 4GE8A 1JYWA 2WQDA 1KRCC 3GFYA 2Y8KA 3GG8A 4HU0A 5C9XA 2OLHA 2V2HA 3CH9A 3VKKA 4KFNA 5IOBA 5BXPA 4MAZA 5F2LA 3QQWA 1H1NA 1YDOA 2ZA2A 3AU6A 4M80A 1TFVA 1S3TC 4AD1A 2NUYA 3PANA 5ENLA 2I9UA 2NVAA 3CAQA 3LHYA 2XH0A 4C6BA 2PA6A 2BVTA 3VDHA 2VTFA 3PZMA 5AHLA 2VYOA 2OO6A 3QZEA 1WYIA 4PMQA 1MRAA 5M2FX 3QYQA 1X7IA 1PHWA 3CYVA 4B91A 4UTIA 4Z1YA 1J2WA 2FZMA 3UNTA 4CQ8A 4PUWA 1UP0A 2HVMA 3WDRA 4Q4RA 3VE9A 1MZHA 1U22A 4LYPA 2VX5A 1R7AA 3V36A 4GO9A 4QBXA 4S3CA 1IF2A 3D5HA 1VEPA 2VNCA 3T55A 4ASTA 4JIIX 5LSMA 3IJ6A 2X0HA 2Y7DA 1Q7MA 3FGCB 3NEVA 2WCGA 5FF3A 2CC0A 1P48A 1TJ1A 3AIBA 5A3HA 2VL4A 2QJNA 3U2OA 4AY1A 3GYCA 1OCBA 4CNPA 4K1WA 3OPSA 2OU4A 1V8EA 4NRRA 3AJXA 3FOKA 4UFIA 4AWUA 4ZOEA 1XQLA 2PP3A 4ACYA 1QWKA 4D6EA 3LXAA 3GO2A 3FYYA 4W7VA 5CGQA 4D72A 3GDTA 1JYNA 3LTPA 3WDQA 3S9YA 4YCOA 3T4CA 1HJQA 3DFTA 4QJ4B 2J24A 3WH8A 2TRSA 4DNMA 1Q2RA 3UG4A 4H1ZA 3LGEA 4PUJA 4IT1A 4QQUA 2WB5A 1SZEA 1VBRA 2WHMA 2OWXA 2ABAA 4ROQA 1KRMA 4HT3A 4FLOA 1VCGA 2WWCA 2POZA 3SCNA 5CPMA 4Z0SA 4B15A 2A3BA 4HPNA 3R8HA 5FJUA 4K7VA 2ZZ1A 1FWCC 4UMAA 1RXOB 3TEVA 5J5DA 3W25A 1LZOA 3UESA 4XZIA 3S42A 1KXTA 4ZA0A 5CLTA 3A6OA 1BXBA 1V0MA 4JQAA 3C3NA 3BMXA 5K7JA 5EFFA 3FYPA 3BH4A 2FZNA 3Q65A 5C2XA 1EL3A 4MADA 4RPQA 4DJFC 3UZZA 2Y63A 1BWVA 3A4XA 2FIQA 3BLFA 3TVAA 2WQPA 4F2TA 4WVXA 3GHUA 4DO7A 1XYBA 4MIMA 1O68A 2V2DA 2AGTA 3EWBX 3HG3A 2C6QA 2Z26A 5D2WA 1V4YA 3F2BA 3CIVA 2OKOA 1MDLA 4OUIA 2GQ3A 3KW3A 3VM7A 3WH7A 4RXGA 3WQ4A 3MP5A 1RCXB 4ZOBA 3VM5A 2JK2A 4PUDA 4REQB 1GOQA 1M3UA 1S2AA 4ZO9A 3N2MA 1SM9A 1P7TB 1ZAIA 4H83A 1ZU8A 3CQJA 3AMDA 4I8YA 4QM1A 2DVTA 1HO4A 5M3WA 3NEHA 5SWUA 3KOXA 3ZR5A 3LHWA 4FK9A 3OJGA 4WLCA 1UKTA 4ATDA 3KBSA 3E12A 3ITXA 4DN1A 3NYZA 1KFWA 3OGSA 3G0SA 3P14A 2E67A 3BK0A 4FNQA 4PMJA 2BP1A 3WUBA 3LPOA 4AMAA 5EGRA 1XGZA 4KMQA 4GVFA 3ARTA 1RAKA 1TVNA 3QOMA 3W7CA 1FCQA 4NNCA 3VGDA 4CEXC 2YOCA 3RGTA 3T1GA 4D9PA 1Z44A 1V3LA 3M5ZA 4FHAA 1B0IA 4GO8A 1GVYA 4US5A 4GYFA 3BLPX 4LV4A 2Z1BA 2ATSA 5DLCA 1HKIA 5CGTA 3PZUA 2V5LA 3R2GA 6ALDA 2D2GA 3WEMA 1RVKA 2PDKA 2GGIA 5ABTA 3EKZA 1W1A1 4Q33A 1PZ2A 7XIMA 4PMYA 1EC8A 6REQA 3PG8A 1H7OA 4MB4A 4DJEC 1LL6A 3LDVA 4LS1A 3QMTA 4Q6JA 2HRWA 1Q6EA 5ABFB 1O1ZA 2IKIA 4KFOA 2NSOA 1H7NA 1Y0EA 4AW7A 4MM1A 4ZGYA 1U1UA 1ENUA 4JN7A 1NDWA 3OHMB 4DJED 1I8JA 1H2JA 4RZ5A 4MJ2A 4PEKA 4XUGA 3F5KA 2CU0A 2PMQA 2XTKA 4GNVA 4BK9A 4UTWC 2Q6ZA 1EP3A 3A4AA 2W62A 2W4XA 1AA1B 3WMSA 4P8UA 4QISA 4UFHA 4LUIA 1AJZA 1OQFA 5FJJA 4WOZA 3T6CA 5EB8A 3RNDA 3DKLA 1EX5A 3OBKA 1VIWA 3F5JA 4UNLA 1H11A 2DT1A 1EGVA 3E0FA 4Y90A 4G6CA 2E68A 4A3UA 1QR7A 3UZJA 3L4TA 1TWZA 2V38A 4D6CA 3NQDA 2PUZA 3W7MA 2XFFA 3V16A 3RFAA 1Q6GA 3KRBA 3W1QA 4HHLA 4AY8A 5F1UA 4PTMA 3TNBA 2RDXA 1QFEA 3KXQA 3TQKA 1DL3A 1GQKA 5HATA 2WBGA 3F4VA 1JEZA 3TONA 3ITLA 3HFTA 3QYSA 1KM2A 4MVAA 2OQLA 2NWRA 2FPYA 3WLOA 3N34A 1DIKA 1MNSA 3GX9A 3R89A 1BHGA 5CZKA 3PZVA 4MMWA 3W7JA 4Q8UA 4A3QA 4LB3A 5A95A 1RQEA 2PRHA 2CESA 5BYWA 5I3FA 5K9DA 1XCXA 2O92A 4C91A 4O19A 2ALDA 1OM0A 4WXYA 6TIMA 1RY8A 2P5NA 3E0VA 3MCOA 2D22A 4DELA 2ZZ4A 1GVQA 5B7ZA 3CV1A 3TAKA 4AZCB 3IGSA 2QEZA 4GNJA 1B5TA 4MY9A 3BSHA 2OXNA 3GTFA 4E4PA 1LRQA 2OEMA 3A12A 3TYAA 3AI0A 3HA1A 4MHBA 3RLVA 1LQ2A 4PBGA 2R14A 4XX6A 5FF0A 4NAFA 2F6UA 1KQZA 2VFGA 4GWEA 4KGLA 3B4YA 1E15A 3TP4A 2VCBA 4JTHA 1EXPA 1VBUA 2C79A 4F66A 4QE4A 1SFJA 2WVTA 5AC4A 3W7KA 3C4UA 2BVYA 2HTMA 4NZJA 1F05A 2GL5A 3G8RA 1JPDX 2UY4A 5D32A 3V18A 1E6RA 1F8IA 1TA3A 1UKOA 2DT3A 5GNYA 4RK8A 1BKHA 3GLCA 1XBXA 3WH6A 4ORMA 3W1NA 5BNKA 3VOFA 2PDXA 2QCEA 2AQVA 3BW3A 1DIEA 3A24A 3IGXA 1JPHA 1W9PA 1Y8BA 1OIFA 3ABXA 2P1FA 2RUSA 1IYXA 1EJXC 2JGQA 1HKWA 1XJBA 3PTKA 1VFFA 3L4ZA 2E09A 3LI0A 3G22A 3VDGA 4JHMA 1W8SA 3NZ1A 3N6HA 1TR9A 2D0GA 4XAPA 2E28A 2CLIA 3O7UA 3PY2A 4FX8A 1G5AA 3SRKA 3HQ1A 3RO8A 2DP3A 3ZJ8A 3ZWSA 4XBJA 3ZSSA 3CHDA 1XIEA 3LZ3A 2J7CA 2GGHA 4M8UA 3S3GA 1IEIA 1AVAA 1UG6A 1ZSXA 3N18A 3QR1A 2J74A 4HZ7A 2FZ8A 2E8ZA 1RJPA 4U5IA 1M41A 3AIRA 2O4MA 4OZOA 2VR5A 5D9NA 1HZYA 1O5XA 2WMHA 1LM1A 3POCA 3DENA 4CQ9A 3G3MA 3JR2A 5G2WA 1O60A 2YLLA 1GZJA 4ZQRA 4L4PA 3KAOA 4U3AA 1QVBA 1Q63A 3B40A 1VCFA 4RZ4A 4TIMA 4IMGA 3I7SA 4N4PA 3UWWA 2B31A 4A6GA 2QCGA 3TLLA 2WSQA 1S38A 1Z9AA 1A5LC 1CLVA 4D8ZA 2ZZ3A 3UPBA 1WZLA 3KOYA 4QS6A 1EA0A 3ICJA 4ZSTA 1TV2A 3CO8A 3PP7A 2CCRA 4F0KA 5REQA 3M0HA 4ZQNA 4HSOA 3GDBA 3QGVA 3GS6A 1UD5A 5XIMA 4AZIA 2OZ0A 1IWPA 3W07A 2WM0A 4GMEA 2QR6A 2REQA 4CU6A 4RE3A 2OGYA 1H50A 2IPFA 3SAZA 1LTDA 4LGXA 4I7WA 2YFNA 3ZO9A 2X16A 1KRBC 3ABOA 4D6JA 4ZTXA 1FRBA 3G0UA 1TV3A 2KAUC 4MLJA 3G3DA 3ABQA 3WMCA 1LG2A 3O1NA 3VKBA 4NJGA 3IIVA 3RG6A 1GKPA 1R2RA 2QZRA 1BD0A 3AS2A 3ANYA 1YXCA 1R87A 1V79A 1UR1A 2VQUA 1F3EA 3GNDA 2E1DA 4PRRA 2CNCA 2V0TA 3BAYA 1BLIA 4FO4A 1FCBA 3NVDA 1BWKA 1OG6A 3BQ5A 1F76A 3AU2A 1WKEA 4FXJA 3UWEA 1EO7A 4DWSA 3GVRA 3PFRA 4NZ3A 2IXVA 5HPCA 5A1AA 4XD5A 3KLKA 1GG1A 4AUBA 2ACRA 1G1YA 3W7GA 3LRMA 1XYAA 1JULA 3FHAA 4FOKA 1JRCA 3STFA 2BODX 4PMVA 3CV2A 1RVGA 3WQDA 4MWAC 1AJ2A 2ZXBA 2XZ9A 2XINA 3ONBA 3GZ3A 3MVTA 3WFLA 3ZIZA 1YBQB 4MNKA 2E9BA 4B2DD 1W5NA 4RW5A 1UR3M 3CLWA 1EYWA 4MWAD 3SQMA 5HNNA 3EKLA 1GOKA 1T5AA 2DZVA 2WJEA 2AOSA 4BI7A 4BQ4A 1JDFA 3M16A 4Q4SA 1BAGA 3L4YA 4XSMA 1JYXA 4PA8A 2GSJA 3DAQA 2WMFA 3LS9A 3AS1A 1V93A 2WPBA 1ZS2A 2G37A 4KRUA 1XM3A 1ZNNA 1YLVA 4YJ5A 4BI5A 4PCPA 5AB3A 3O6DA 3BV4A 2HNEA 2HV5A 1MMFA 1EC9A 3QKZA 3SGZA 4MYXA 2PI6A 1SMAA 4PRWA 2PGWA 5LNWA 1OK6A 3CM4A 1K9DA 1ONEA 1FWIC 3FKRA 3WQ6A 1VRDA 4HPGA 3OGRA 1L8NA 1C9WA 3CPGA 3STPA 3NO5A 1ZCCA 2DFAA 3W4RA 1R5YA 5CEWA 4R7WA 4EX4A 1UZDA 1EH9A 2FZ9A 3UETA 4BF9A 3L21A 3H53A 1LBMA 1B57A 4TO8A 4JTKA 2Z2BA 3CQKA 4HNCA 3ARSA 3EOEA 3NGFA 1EGZA 3T07A 3MMDA 3FEMA 1FXQA 1QO5A 1FCUA 5CXPA 3WJSA 4XZ9A 1E56A 3CZLA 3CASA 2WSPA 4LB4A 2QPXA 1JQVA 1QI2A 1EUAA 3H7UA 2G4FA 2A3AA 3WNMA 2Y61A 4JKKA 4YNGA 1E9ZB 4B90A 3BPWA 3H22A 2Z1SA 3AISA 4G7EB 2NV1A 3G1YA 2Q71A 1H60A 1LOLA 1CNVA 1JIBA 3V0TA 3LERA 1W9UA 5J04A 5I3GA 1FWDC 1PKMA 3A13A 2BNJA 3VYLA 1J5SA 1E72M 2QCLA 3H6OA 1FWAC 5CG0A 4CCDA 1Q66A 3VOHA 1X98A 3UXAA 3V35A 1MI3A 4Z1DA 1VD6A 4ZENA 1U5JA 1US3A 2IS7A 5CPSA 5D33A 4P61A 4WHBA 3GM8A 5FOOA 3QHMA 4IL0A 3GNNA 3N19B 1RH9A 1ME8A 3HZ3A 3SUVA 3LLDA 5D8WA 4IPIA 2PZ0A 2W91A 2CFFA 3W1PA 5FEZA 3HV8A 3P93A 4YTUA 1DQXA 1XG3A 2BVDA 1T7LA 2QUMA 4DBSA 3RITA 2VX7A 3Q67A 1LUCA 4GUGA 3AFBA 1OK4A 1OFPA 1ZY9A 2JFEX 1LBLA 1KGWA 1ITUA 4XVDA 3MSDA 1XLIA 1BYCA 1XUUA 1V3MA 1FP8A 2E6DA 4W86A 4POCA 3H23A 4PODA 1UOZA 1X39A 1RHCA 9RUBA 2RGMA 4FB7A 4INFA 5GNXA 3PAOA 3Q94A 3NZGA 3W26A 1GTEA 3N6QA 4MY1A 1JD7A 2PEVA 1XSIA 3XINA 3NA8A 3WNPA 4YTQA 3NUKA 5HXMA 1OX4B 2VMFA 2HBXA 1GVEA 4RLIA 4BWLA 1RLCL 1J18A 3PFMA 1TO3A 4DZAA 3OHIA 3ZLGA 4LF1A 4YHGA 4DRSA 2VVNA 1B3WA 4JTQA 1MFVA 2D3NA 2P88A 5A8QA 2Y70A 5E0CA 3CIXA 1PTDA 1GEQA 1ZJHA 3WX7A 4IWWA 1DHKA 4JOMA 1F73A 3TQPA 3KBWA 1OF6A 4DPQA 3ZFHA 3VNKA 1C8QA 4CVUA 2QMKA 3L12A 1HJVA 4D2JA 7ODCA 4Y9MA 1G01A 5MF5A 1WDDA 3L68A 5HNRA 4I6VA 4YHEA 4U2YA 2E6FA 3FJ4A 4JTCA 2J75A 4D6GA 3LHVA 2DSKA 1VF8A 3TYZA 3TJXA 1KR0A 1VRXA 1H5YA 2XIBA 2PWDA 2DSVA 3W00A 1YX1A 3ZVHA 3GIYA 4JTAA 3L67A 2XM2A 1L6GA 1P4CA 3GY1A 1XIHA 1SVDA 3MJMA 1XX1A 4KIRA 3VDCA 3W3OA 1TYGA 2WANA 3RXZA 2A3EA 4L4MA 1O94A 1RBOB 3RM9A 1EEXA 1OGGA 1RK5A 3NNTA 1X38A 3RJXA 3WQEA 2CITA 1SU5A 4IGSA 4NAEB 4UTTA 1PAMA 1PKNA 4R3UA 4UOZA 4FNSA 1F4AA 1Y5WA 3L2LA 1VBJA 3B0VC 1J93A 1W1PA 1MQQA 1G7VA 1JCXA 3NO1A 4GACA 4ZVJA 4QQ3A 1X1ZA 1T41A 1UMLA 1OD0A 5JMUA 3OLEA 3S9ZA 1NARA 5F2IA 3AXXA 4R27A 2VCCA 1MUCA 4GIAA 5C9WA 3Q4DA 3E2SA 1XPGA 3DHUA 2R1MA 2NV2A 2PU1A 4XZWA 2HJPA 4S3FA 1LORA 1HW6A 2V3GA 4S3JA 1A5OC 2H6RA 2A6NA 3VGFA 5AECA 2J7GA 1C90A 2GGGA 2JKPA 3FA4A 3SCPA 2VHLA 1HJXA 1B3ZA 2WHJA 5BRPA 1V02E 4Q32A 1YIXA 5CC7A 1ICQA 4AEFA 4PZVA 3WF0A 3RR4A 1K7EA 2V2CA 5LYRA 2YJQA 4HMEA 4LV9A 2FH6A 4PUUA 4CD7A 2INZA 4QG8A 4PFMA 2CLFA 3CJPA 5ECUA 3ZR4A 4IMAA 3C6CA 3GQYA 1ICSA 1KC7A 3PPFA 4NF7A 4QDPA 3VNJA 4EANA 1CGTA 3E49A 5F2MA 1HT6A 2XH7A 2C15A 3LU2A 1G69A 4AU0A 1XLLA 4YXGA 2OSYA 3VIHA 3FJLA 4LNYA 4LX4A 3KOFA 3RHGA 3UWQA 1WUFA 2ZX8A 4IFKA 1EZWA 4ZMGA 3GC4A 3M7SA 6A3HA 1S2TA 3I3BA 1UKPA 3AIWA 1YADA 3B0PA 1GT8A 4HNLA 3MA8A 3SCWA 4HA1A 4Z1BA 4CVWA 4IP7A 2G3MA 4DBWA 4MWAB 4LEQA 1R3VA 3I6RA 1PV8A 1V7YA 4RL3A 1E73M 1M7OA 3KBNA 4Z2LA 4JGDA 4AD3A 5CC6A 5EMLA 2XVKA 1IEQA 3I4KA 2VRKA 4HPHA 4Y9PA 4O13A 2BV9A 1P5BA 4KCVA 2IKJA 3EPNA 1DJNA 3ABRA 1JCYA 1VEMA 4KW2A 1Z32X 4LW7A 4DX3A 2YL5A 2IPJA 3GIPA 1HQTA 3S83A 4H9TA 3UG8A 2ZQ0A 3CUIA 4AZ5A 1K9TA 1GOIA 2GJRA 1REQB 3KX6A 3W7LA 5HUOA 5CAHA 6XIAA 2Z1XA 4H3DA 2X1IA 4F0HA 3B8TA 1IXNA 3MI2A 1ZBWA 3MT1A 3H21A 4BY3A