2A7RA

Crystal structure of human guanosine monophosphate reductase 2 (gmpr2)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP reductase 2
publication title Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a7rA00
1VLWA 4NZFA 1DHPA 4LVDA 4IMFA 4ZL1A 3ATZA 3FFSA 4CCCA 1HL2A 2ZZ5A 2VOMA 3GDLA 3W1AA 5G1YA 1TTQA 2NZLA 3LTPA 2ZCGA 4UMCA 5MHBA 3LCHA 2B7NA 3UY8A 2H3DA 1MEWA 4WJEA 2NX3A 1FCQA 3W7JA 4IPJA 1WAUA 3LRLA 4QJ1A 1TJRA 4OV9A 3L0KA 1TPB1 2NX1A 4TMBA 1MO0A 5TIMA 5F2GA 3UWYA 1JCNA 3CC1A 1AK5A 7TIMA 1N55A 3FYOA 1O5XA 2TSYA 1W56A 1UCWA 1AL7A 3W88A 4X3ZA 5G5IA 2ZA2A 3WK2A 1H7RA 1KM0A 3H54A 5LHEA 3EB2A 1OYCA 1RQEA 5EL1A 1F2JA 2EF9A 4Z08A 3THQA 4NJHA 1AG1O 3NNTA 4ADSA 3NL5A 3G0SA 3PF3A 1UJPA 3L68A 3NDOA 3UWWA 3NO5A 1YADA 4E0CA 5C55A 1RQBA 1A5CA 5KITA 2EHHA 5F2LA 1HG3A 1U83A 4DF1A 3QPZA 4H3DA 3LCGA 4JTTA 1FXPA 1LORA 2J6XA 4AEOA 1OFPA 3HF3A 5ABTA 4N9CA 5AYZA 4O1AA 5L6UA 1I2NA 4Y96A 3CM4A 4O28A 3TV8A 4O14A 1TV8A 3CT7A 2PURA 3C2OA 4JTJA 4YWIA 1ZFJA 3BARA 4XZ9A 1GVSA 1YPFA 1XFBA 4AWUA 1A53A 3NL6A 3ATYA 4FNPA 3LXBA 4AAJA 2CFFA 3W7RA 3IGXA 3S5ZA 3DENA 2YYTA 5LHFA 1TPEA 2YX0A 3L67A 4EVZA 4EIVA 1FDJA 1G7UA 3GKFA 5I3IA 1KTCA 2HS6A 1ZENA 1DQXA 4D2JA 2H8ZA 5BMWA 1FWWA 1R46A 4Y8FA 2HS8A 1ZHAA 1VH7A 2YFOA 4IMDA 2Z6IA 3UY7A 3S1XA 1DV7A 1FCVA 3ZWTA 1ICQA 1OK6A 2DP3A 1TTPA 1ZAHA 3DU0A 4KWVA 4O8RA 2RDUA 2P10A 2CLEA 3LHVA 3P62A 3TFXA 1TREA 4RJEA 5D38A 4PCFA 1D3HA 2JKAA 3L5AA 1KFEA 5LNRA 1I2RA 3F1QA 3CB8A 4YCPA 1H7OA 3W7GA 1F5ZA 3W1MA 4DPPA 1M7OA 4MFEA 5FF3A 1KW1A 4TO8A 4AHOA 1C29A 1K7XA 3S1WA 5DXXA 5AHLA 1QWGA 1H7NA 1UBSA 3M6YA 1PV8A 3WJSA 1MEIA 4FXRA 2VEKA 2HTMA 1VJIA 4MIMA 1B4KA 3LGEA 4E38A 2B7PA 3MHFA 1H7PA 4JNMA 4BK9A 1SZGA 1WOBA 2AGKA 3U2OA 5D2TA 1X7FA 3TR2A 2E5DA 4YCOA 1H5YA 2Y7GA 2ZZ1A 5H2ZA 1LRTA 1KFKA 4AMAA 2OX1A 1TV5A 1W3TA 3HBLA 4PL2A 3Q58A 1KM4A 3R8RA 4O1BA 4NX5A 2ZA1A 4MPQA 1H7XA 3NR0A 4FIRA 1BKSA 4I9AA 3O6DA 4IMEA 4TX9A 1I4NA 4M6VA 4NX0A 1KFBA 3NQGA 1JR1A 4OHQA 5D32A 3N3MA 3TX9A 3B8DA 3BLFA 2JK2A 2A6NA 4BWLC 5E1QA 2A7PA 3R13A 1SZNA 4JIPA 2JGYA 3GYEA 4NJIA 1Q6QA 5CZTA 4MY9A 5EPDA 5U4NA 2NXGA 3MWAA 4X22A 4LV4A 4ZQNA 4QNEA 4A21A 1LDCA 4GFSA 2YCEA 1GVFA 2E09A 4O13A 4ORMA 2CLOA 4FNTA 1PVNA 2I14A 3TDFA 3PC0A 3QMRA 2VC6A 4FEZA 4N4PA 4OE7A 2C15A 3LTYA 3GKAA 3W7MA 1P4CA 2QCFA 8TIMA 3KRSA 1JUKA 1ME7A 1YTDA 4EF9A 1GQNA 3LTSA 1HFBA 5F1VA 3KVKA 4Z1CA 5K9DA 4QSHA 3QRHA 4JTKA 4BF9A 1XM3A 4Y6GA 3W71A 1B3OA 4Z1AA 3OBKA 1GOXA 1J2WA 1BEUA 3M5ZA 2QCCA 3JR2A 5D2XA 1EEPA 3LB0A 2B7OA 3NGJA 1XDLA 3UQNA 3GXNA 3Q2DA 3PY2A 3W7DA 3PB2A 2G96A 3A21A 3HG4A 3GXTA 3DAQA 3C56A 3ABRA 5HR7A 3NPWA 2VKZG 1MZHA 1U5JA 3G1FA 4XTIA 4JY9A 4DF2A 2NXIA 1YLVA 2X16A 1JCJA 1WV2A 4AH7A 4MLRA 5AN7A 5EA9A 2J9ZA 4U28A 1W8SA 2FJKA 2YYUA 3SFKA 3QQ0A 4L4MA 1G6CA 4QNWA 5D2YA 1QFEA 3LV5A 2NWSA 3W7KA 3G1YA 2C16A 4NU7A 4LUIA 4RK8A 2W79A 1FWTA 2X30A 1KM6A 3RK8A 2WOQA 4P61A 3B05A 1H62A 5LSMA 1TJPA 3P8JA 4QM1A 4AHPA 4XBKA 3CHVA 1T99A 3QM3A 1KFCA 5EBUA 3DZ1A 3PSVA 4AHQA 5K3VA 4UFMA 1VQTA 3QMSA 1VYSX 3PSWA 4KKXA 3H53A 1NF0A 5IBXC 3C4UA 1AW1A 2Y7DA 1OF8A 2CLFA 5J5DA 1EUAA 1W5QA 1NFBA 5C54A 4O0KA 4MY8A 5HQEA 2ISSA 3DI1A 3N19B 3UYCA 3DKLA 4MLJA 2DJXA 2PE4A 1VRDA 1F73A 3M16A 4FXSA 3M5XA 4O15A 4DPQA 3SZ8A 2J27A 3ZS4A 3W7EA 1LBMA 1G69A 1XXXA 1S5VA 1EP2A 1ZJIA 2CZDA 3HPZA 3VCRA 3EXSA 2KZHA 3G1AA 1P0KA 2TRSA 2YR1A 3MMTA 4GUIA 4WY0A 1H51A 1HO4A 2BX7A 3G8EA 5LNUA 3RLUA 2A1YA 3BV4A 1TB3A 3FS2A 1ME8A 5KTLA 4KFOA 3DGRA 2RFGA 3L0NA 4MJMA 4HT3A 3W1TA 5G4WA 2ZTKA 3BW3A 1MSSA 3GDRA 3TW6A 4AF0B 1K02A 2QCEA 1I45A 1GG0A 1TPC1 3IIXA 4Q32A 1SW3A 4O4WA 3WJYA 1PCWA 1RV8A 5KZDA 4GUHA 5LNWA 2XN2A 4N9EA 3L66A 5BRBA 3HGOA 4HPXA 3IIOA 1IXOA 2PC4A 5SWUA 2E6YA 1OFBA 4QISA 2NWRA 3GAYA 3W7HA 2VEMA 1TPH1 5AC6A 2CU0A 3BGGA 1YDOA 3ELFA 2C14A 2FLIA 1XCFA 4JTGA 3L5MA 3N9RA 3UD6A 2G97A 3P82A 4AWSA 2VFIA 2A0NA 5BNKA 4LVBA 1CX9A 3STCA 1N8FA 4UTMA 2QUVA 1LRQA 2E77A 1AMKA 4MZ8A 3NQMA 3QFEA 3WJWA 1KLZA 1C8VA 4JTSA 2VEPA 4ZQMA 3NL2A 4ZQOA 2QDGA 4CQAA 2E5CA 5K7JA 4FX7A 1YDVA 2VENA 1UUOA 3QMTA 4OWGA 5AHMA 3B0VC 5FEZA 3MI3A 3MW7A 4JTLA 3STEA 4LS0A 4U4MA 2QUUA 1OYBA 3LCFA 1DOSA 4UTHA 3W72A 1WDWA 4Q33A 4LRSA 1ZAIA 1R2SA 4C1LA 4IQLA 4EF8A 2ZZ4A 4Y9AA 1QPNA 2GPTA 2YDAA 3W84A 4X2RA 3W1NA 1OF6A 1ALDA 1FY6A 3VE9A 3GDKA 2ABBA 2CLLA 4XBSA 3TA6A 1DORA 2V8ZA 2QUTA 4O17A 3UZJA 2PCQA 4RCXA 4ZQPA 1XI3A 4ZZ9A 4NJGA 1LP6A 3IGSA 4FX6M 3RF9A 3CTLA 2Q8LA 3I68A 4A2RA 2WJZA 3MHUA 1KA9F 2QJIA 1XUUA 2DJLA 3O15A 2Q3RA 4UMAA 1OX4B 2H8XA 4QQ3A 3A23A 1G4PA 1FX6A 4IJBA 1WX0A 2GQ8A 2QJGA 2CZ5A 1M6JA 4CCEA 1SZFA 3SW6A 3LI0A 1L6WA 1JVNA 1NSJA 2P1FA 1NVMA 3T7VA 4DBDA 5CPNA 3W1PA 3QYQA 5FF2A 3ZFHA 4O16A 1SZEA 4WOQA 1GYLA 1FCUA 3M1ZA 3IIPA 4PFMA 3LCLA 3A9IA 3I65A 3O63A 3TSDA 2FB3A 3G22A 5E0KA 3W7NA 3LXAA 1W3IA 4UTWA 3NPVA 1H1ZA 2Y62A 2A4AA 1X6UA 2WNZA 3W2JA 2EPHA 2DZWA 2V2DA 5FEWA 5HUPA 1L9WA 1GTEA 3HJZA 4IX0A 4HNNA 3W1QA 3W23A 2ATSA 4OU1A 5AC7A 2XN1A 2J88A 2XFWA 3P74A 3TKFA 1JCXA 4LOCA 1ME9A 1KM3A 4E2DA 4A22A 3ANYA 3EEGA 4LU0A 4LTSA 5TQLA 1OYAA 4JYFA 3HQ1A 3IVTA 5D04C 4UFLA 4NT0A 3WK1A 2YPIA 3FA5A 1A5BA 1SPQA 3W1RA 3TK7A 3O6CA 3C0JA 1P5BA 1TO3A 2PRMA 4MYXA 1OFRA 3F03K 2VFHA 3W7CA 2VEIA 3W2NA 2GQ9A 3A22A 3GAKA 1OX5A 5HULA 4O12A 1KM2A 1SSDA 3LHUA 1FXQA 2V9DA 1QCWA 3P84A 3I6RA 4LUJA 3WJZA 5I3GA 1SO6A 3GX9A 1QOPA 2DZXA 1GT8A 4RZ5A 4KFPA 4M7SA 4FB7A 1VZWA 1GWJA 3P61A 3M43A 1K8YA 2QCNA 3PBUA 3MBDA 1O4UA 3M41A 3UZ5A 1XDMA 1X1ZA 3C61A 3R2GA 3NZRA 3CQ0A 4HKPA 3E96A 3M7WA 1S5TA 4MY1A 5CKSA 2Y7FA 1YXDA 3DFSA 5DBUA 3W7OA 3KRUA 4M6QA 1K8ZA 3M5YA 4OBTA 4E2BA 5D2VA 5I3JA 2YSWA 3TU9A 4M7TA 2RDWA 1I2QA 5GVJA 3BW2A 4DO5A 1TIMA 5DXYA 3MI6A 2GVGA 1LOLA 3PG8A 3INPA 3GNDA 4C1KA 4ICNA 1LYXA 5T26A 2V30A 3NQ7A 4JGDA 3QC3A 3SIZA 2WNQA 5FEXA 3TW7A 3BG5A 3QSTA 3NQFA 1XUZA 1KFLA 1M7PA 3N9SA 1ML1A 3O05A 4JYEA 4JICA 4HSNA 5CPOA 4UUIA 4I7WA 5CZ0A 1GZGA 1H61A 1EP3A 2HMCA 3PWAA 4N6FA 2EAWA 1LBFA 1K03A 4BI7A 1DJNA 4A2SA 2V5LA 1XBYA 5HWJA 1TMHA 4M6PA 3TMQA 3T55A 4CLMA 2FDSA 2BWGA 3Q37A 3G1XA 3CEPA 3LDVA 2QF7A 3PBYA 1QO5A 4IMCA 2OMAA 2I1OA 4PL1A 5AHEA 1W0MA 1ZAJA 5EY5A 5J5RA 1I2PA 5DELA 3QW3A 3GNNA 2HSAA 1RQHA 4PTNA 3VI2A 4BI6A 4IX2A 4RV8A 4DO6A 4WXYA 3TE9A 2UV8G 4K8HA 1SO5A 2FQIA 1VYPX 2JKPA 3ABSA 3K30A 4OV4A 1QDSA 2V5BA 4OT7A 5D02A 2QAFA 1BTMA 5A5WA 3BG9A 2DU2A 3EWBX 4UTUA 3ABOA 1SSGA 1Q45A 3KVMA 4N4QA 1KTNA 2ZZ7A 4M5PA 4S2CA 3W7IA 3C52A 3LBCA 1OG0A 2NXHA 1AW2A 3TNOA 4UMBA 1W5NA 2FTPA 1LTDA 3IV3A 3P81A 2EGZA 4O11A 1HUVA 3PR2A 3THAA 4FNRA 4HNTA 3O06A 4JDYA 2DZUA 1TSIA 3NA8A 4AVFA 3T40A 4AWTA 1H60A 3RNDA 4P2VA 2QCGA 1VR6A 1Q6LA 4R34A 3QH2A 3M5VA 1SQ7A 3TROA 2QCDB 2QDHA 2C1HA 3W87A 1B57A 4UTTC 4N02A 3NM3A 4UTJA 3EKZA 3PBWA 3USBA 1EPXA 2A7NA 4B5NA 1SR9A 4N6EA 3GXPA 4RXGA 5BOOA 3DFNA 3LHTA 5AYYA 3W86A 3C2VA 1DQWA 4IGHA 4BWLA 3VFLA 2Q3OA 2Z0IA 4AXKA 3L0GA 1WQ5A 3HOJA 1JQVA 3QQ1A 3P7YA 3EWUA 4XQ6A 4UTKA 4LRTA 1I2OA 3EWZA 4A3UA 3OIXA 2E5BA 1D3GA 1GEQA 2NUWA 4DXVA 3A5FA 3NQ6A 4WY0F 2G95A 2BZNA 2CLKA 2QR6A 2C18A 3W70A 3QZEA 1IGSA 4JTFA 2F7FA 3N14A 2QJHA 4ZVJA 3CWNA 3W2MA 3UWZA 3P5ZA 5K4ZA 2Z1BA 3E12A 1TPUA 1ZALA 4JX5A 1TRDA 3C2EA 3W22A 2X2GA 2ZRZA 1JRCA 5HJLA 4MFDA 2XN0A 1KV8A 3KHJA 5G4EA 1H1YA 2V81A 2Y63A 3SJ3A 2NLIA 3TQ0A 5DN1A 4O18A 5KSWA 4FNSA 2ZZ3A 2A2IA 5C6MA 4A29A 3BLIA 2W0UA 3CU2A 5FESA 4MZ1A 4TIMA 3HO8A 2RH9A 1HTIA 3IVSA 3GVGA 1QPQA 1TPDA 3BVJA 1QPOA 5DLCA 1FWSA 4UNLA 4LVGA 1K7EA 2WSYA 2P0OA 1DL3A 5F2MA 2QEZA 4AF0A 2CLIA 2C19A 3AJXA 2DZSA 5I3FA 4M19A 3TAKA 4W9TA 1IXPA 1KV5A 4UFJA 2Z2UA 3HIJA 4IXHA 2C6QA 3UXAA 5D37A 2V82A 3D0CA 4K37A 3C6CA 4HHPA 4UCGA 3GK0A 4N9DA 3S1UA 3STGA 4XWUA 2WV8A 3LXCA 4GBUA 4GUJA 3TMLA 5LNVA 1JCYA 2IQTA 3WK3A 4H4IA 2TPSA 1PCKA 3JRKA 3TJXA 3O16A 3RMJA 5D03A 3SR7A 3UXDA 5K9CA 4JX4A 3E9AA 3UWQA 5CGQA 1VPXA 5IBXA 2Y70A 3LRKA 2BTMA 2E1DA 5EKYA 5L9FA 1W31A 3HG3A 1RD5A 2ZFAA 3CEUA 4GXMA 1XBZA 3LCWA 2A21A 1PIIA 2OT0A 3CIXA 5D33A 2J9XA 1KBIA 1IXQA 4NNCA 3OA3A 3OHIA 2ALDA 3EX1A 1OFDA 3N34A 3PS7A 1M5WA 1SU5A 3PAJA 5G2WA 4PH6A 3W83A 3STFA 1YXYA 1DKWA 1KM5A 3LRMA 3S0CA 3IVUA 1TTJA 2OJPA 1ZCOA 3CPRA 1VCGA 1LBLA 3OG3A 2FPYA 4H6KA 1Z48A 4QIUA 3GB6A 1Y0EA 3CIWA 3VE7A 2VFFA 3TQKA 2Y88A 4NQ1A 4Z1DA 4XKYA 3EWWA 1B9BA 1F76A 2CZFA 3FIGA 5G2IA 2A7RA 3O8AA 4JR5A 4RR4A 1WBHA 4KFNA 1JJKA 3EXTA 3SGZA 1W5OA 3KXQA 4LS1A 4YL2A 3NXFA 4ZQRA 4R53A 3MP5A 4ADTA 5A8GA 4WXZA 4TU1A 1Q3NA 2ZTJA 3LBMA 3RFAA 1I8JA 3NQ2A 5HR6A 3QF0A 1OX4A 1NEYA 3L65A 4K7YA 4LWWA 4WUIA 5E93A 4EOUA 5FI8A 4JIQA 4WD0A 1EIXA 1GG1A 1QPRA 4ZMGA 3NM1A 4X9SA 5KZEA 3LHYA 4WY0B 4GJ1A 3FYPA 4DEFA 3CWOX 3MP4A 4RX0A 3EKLA 3T4CA 3W7PA 4O4VA 3G0XA 2ISVA 1QOQA 3P8IA 3GZ3A 4PEKA 3TQVA 3G8RA 5LKYA 5BMXA 4FNUA 5KZMA 2YW3A 4Q4KA 5HUOA 2JKEA 3WK0A 1FWNA 4ZQCA 5AHNA 2R8WA 1W5MA 1QO2A 1WYIA 4FF7A 3SY5A 2R14A 3FKKA 2B4GA 1EA0A 1EX5A 1XBVA 3LCXA 1E51A 3SGUA 1UUMA 3B4UA 3P80A 4DF0A 4O57A 4BFAA 2D73A 3W7QA 1FWRA 3AO0A 3DXIA 1F7BA 2R94A 5HNRA 3UPWA 4JDBA 1Z42A 4HSOA 1TQXA 4RZ4A 1F74A 3PVFA 2H6RA 2VFGA 1FDYA 2GJNA 5C2XA 4DELA 4MVAA 1XC4A 1P0NA 2F84A 3PB0A 1G4SA 4IPIA 1B4EA 1NF7A 2ZQ0A 3M44A 4K38A 4LT9A 4N2YA 2NUYA 2X1TA 4BI5A 3E0IA 4GUGA 1VYRA 4PC8A 2EKCA 2ZRYA 3H55A 2GQAA 3MP3A 3GDMA 3BLEA 3O1NA 1S3HA 4FX8A 1FDZA 1L6SA 3JS3A 5AOUA 3PG9A 3I7QA 3VNDA 3V75A 4R7JA 2AAMA 3I7SA 2WKJA 2V2CA 2BXVA 4UIOA 1OABA 1LOSA 1RPXA 1PL9A 3TSBA 4NXKA 1MEHA 2YXGA 2B0MA 3B0UX 3S1VA 4N9BA 1WXJA 1K7FA 2NV2A 4OGZA 3TIMA 1J4EA 1X1OA 2RHGA 5AB3A 1EWDA 2E6DA 4DQWA 2GVJA 1W54A 3HGRA 5FEPA 3W2LA 1TYGA 1N7KA 5LGXA 4WOZA 2VELA 1NAL1 4R33A 3S42A 4LVAA 2ISWA 3GLCA 1R2RA 4S2BA 5K4XA 3W74A 2OCZA 4DBEA 4RXFA 3NPXA 1SO3A 2AQWA 3HG5A 4NJJA 2ZRUA 3MHGA 1BWKA 4FIQA 5DCBA 1KFJA 1L6YA 4NNBA 1SW0A 3N2XA 4JTIA 3MUXA 5EMUA 5CZJA 4UFIA 1EWEA 3EX4A 2CLMA 3PULA 4RKAA 1PHWA 1KBJA 3O07A 4HIBA 4S1FA 2QCLA 4DO4A 2WPBA 3OVRA 1JULA 3LERA 4JTHA 5CG7A 1FBAA 4RZ6A 4Y90A 4GNJA 5CSSA 3G3MA 2J24A 4UFKA 3NQAA 1L2UA 3FOKA 4FO4A 4HPJA 3S5OA 2CZEA 1PHQA 2E68A 3ABQA 1DVJA 1DJQA 3B0PA 4NUWA 1XBXA 3TFCA 4JYDA 4TR9A 4LW7A 3VKJA 3PBVA 4LS2A 3S8HA 3EWXA 2E6AA 3NAVA 3BGJA 3RLVA 1T8XA 3GR7A 2JGQA 3P67A 1H63A 4RLIA 3IRDA 3W2KA 2ZBTA 5CPLA 1TCDA 4QITA 3LI1A 3R5EA 1F6PA 1TPFA 1FUYA 4EWND 4UR8A 3WJXA 4O19A 1LRNA 2X1RA 2A5HA 3EXRA 4ORIA 4UC5A 3LLFA 2PRLA 2JBMA 4JN6A 4UTIA 1P1XA 2QAPA 1LLZA 1G4EA 4K36A 1RVGA 3LHWA 3TJLA 2O7SA 3LHZA 1XL9A 1OFOA 2DZTA 4MYAA 5HINA 4UTLA 1AW5A 3W9ZA 1G4TA 5FF4A 5AFDA 2ZRVA 4CNNA 2C3ZA 3SI9A 5IM51 1W5PA 2RDTA 1WA3A 3MI2A 4XUGA 2WQPA 5DY3A 3NOEA 3LM7A 2I9EA 3OEXA 3DHFA 2V0TA 4ML9A 3G18A 1SFJA 1O60A 4G1KA 2QCDA 5EYWA 3FJLA 1IF2A 4GC4A 3W6YA 3HGSA 3S5NA 3KFTA 1ZY9A 1LOQA 5CZSA 3KRZA 5KINA 1LM1A 4L4LA 3O6YX 3WFAA 2GUUA 3ZWSA 4JEQA 4O50A 2OZ0A 4O1CA 1V5XA 3S9YA 1T0OA 2VFDA 2DORA 2NUXA 3DFOA 5HMSA 3G1HA 1GVRA 1W1ZA 3W75A 4MUZA 1LROA 1EUNA 4NZJA 2TMDA 2Y85A 1O94A 3W1XA 3EX3A 4BR1A 4WQ6A 4NXSA 4YLWA 4GE8A 1VLIA 3LCIA 4XTDA 1MXSA 1QNVA 1PE1A 2E6FA 4I7UA 4ALDA 5G1TA 4K8EA 1AL8A 4LNYA 1WBJA 2DZVA 4IXXA 3M0ZA 1THFD 4IWWA 1WOAA 3NQVA 2YGYA 3G0UA 1Z44A 2RKXA 1YPIA 1R47A 1RR2A 3IEBA 1LZOA 1PS9A 3DKJA 2A85A 4Z1BA 3W07A 4YMZA 1XKYA 3CLMA 2C13A 3C8FA 3Q94A 3N2MA 3B04A 4UXDA 5CSRA 4K7VA 3BPWA 1Q6OA 2Y6ZA 5F1UA 3P5YA 4OQVA 1H50A 1A50A 3BG3A 3EX2A 1JRBA 1UASA 3SSJA 3QJAA 1R30A 1SFLA 5CPMA 1OJXA 3W1LA 4KWWA 3DHDA 4O52A 3BW4A 1Q6RA 2ZZ2A 3G3DA 4JX6A 4LC8A 4MKNA 3UWUA 2VXNA 1LCOA 6ALDA 2C0AA 2WSQA 1JUEA 4UR7A 1JCMP 3DFPA 4IUOA 3OVPA 3HG2A 1TQJA 3MBFA 3R89A 5K2ZA 5AHFA 3C2FA 5DY2A 1ICSA 3UPBA 3W1UA 3DFTA 5DCEA 1JQXA 1ZNNA 3NL3A 1C9DA 4UFHA 4O53A 5HWMA 1BWLA 1GVOA 4UTTA 5FF7A 4CCDA 4MZYA 1W37A 3KOFA 1JCLA 1YYAA 3G24A 2YFNA 2X1SA 2QCHA 4HN4A 3LOTA 3T78A 3NPUA 3V1PA 3LV6A 4NNAA 2QKFA 3W76A 3W3OA 3LLDA 5D09A 2VFEA 4JTUA 3MYOA 3F4NA 3RU6A 1FQ0A 1OFEA 3QEZA 1FCBA 3E02A 4LY8A 4CNPA 1GJPA 5F4WA 1HO1A 1YDNA 1OFQA 1OFAA 1A5SA 3NQEA 3M9YA 5LZLA 3C3NA 5HWNA 2CW6A 1K8XA 1TRIA 1J5TA 3BK0A 4FHAA 4GRSA 3G1VA 3PUOA 2BSLA 4O10A 3BO9A 2GOUA 2FIQA 2W6RA 1CI1A 3L21A 4HNUA 5G2HA 1ICPA 3UNDA 3TSMA 1GTHA 1VHNA 3HPSA 3TUUA 3FLUA 1YTKA 2X1UA 3U8GA 2V2HA 3S6DA 2ZRWA 4K39A 4WZHA 3QW4B 3S5YA 2H3BA 3FKRA 1YTEA 3NQ8A 3YPIA 1JUBA 1S5WA 4JTEA 4LV9A 1OX6A 2O7QA 1DBTA 3W2UA 2ZA3A 2DZPA 3B03A 5I3HA 1VGAA 3W73A 4CNOA 4GUFA 3DH7A 3IGUA 5LGZA 1VC4A 3QSRA 3MJYA 4GWEA 4PODA 4AB4A 3EX6A 1K3UA 1IXNA 1UB3A 3OVQA 3LX9A 2NV1A 1GPWA 4IMGA 1W3NA 3MO7A 2ZRXA 4O54A 4YXGA 3DBPA 3R12A 3NZ1A 3ZR4A 3I7RA 2CLHA 2GJLA 1TPVA 2NX9A 1D9EA 1GVQA 3MYPA 1G7VA 4JS3A 3KX6A 1X8FA 5LNSA 1VCFA 4JXCA 3UWVA 4I7VA 5D30A 4QAIA 4UNKA 3FJ6A 2CWNA 4CQ9A 1OK4A 4MOZA 5K9XA 1ONRA 3W7LA 3F4WA 2ZYFA 3HPXA 5AC8A 3N73A 2GVLA 3G1SA 3TCEA 3P60A 1SUXA 4ADUA 3L2IA 1EB3A 1QAPA 3KVJA 4TMCA 2FB2A 1RZMA 2BLEA 3TAOA 3GIYA 3A5VA 2WO5A 1SO4A 5F4SA 3TC6A 3TH6A 1VHCA 3PUDA 3FEMA 5KMYA 1ADOA 1V7YA 3M47A 5AYXA 2PRHA 1A5AA 1KTBA 4PA8A 2B7QA 5D05A 3NEVA 5H91A 1SW7A 4MJZA 4O1DA 5I3KA 4POCA 2ABAA 2FPTA 2Z6JA 5DBTA 5TBOA 3TXZA 1CW2A 1VCVA 2R91A 3NVTA 2ZZ6A 4LVFA 1O5KA 2YZRA 1QMLA 2WNNA 4K6AA 3NYZA 1R2TA 3HGJA 3KAOA 3IIVA 3TC7A 1QR7A 4JD4A 2H90A 5F2IA 3EWYA 3NQCA 4CQ8A 5D2WA 5C5YA 2TYSA 1O95A 2ZDRA 3QPYA 2OT1A 2YW4A 1OVDA 2Q8ZA 2ATMA 4LC6A 2FFCA 1H7WA 3L5LA 6TIMA 4O0ZA 5AHIA 1GYNA 5DCDA 4IOTA 1KLYA 3GDTA 3NQDA 3T44A 2J9YA 4NVTA 1TPWA 1G67A 3U6WA 1IIHA 1TTIA 1Z41A 4Z0JA 2FPVA 2LLEA 2WSRA 3E49A 4WX2A 5BW6A 5FF0A 1IIGA 4XKYB 1LLWA 1F6KA 3HB9A 3PUEA 3DFQA 5U7SA 3PM6A 2Y89A 4Z0SA 4HNVA 3W85A 2Y61A 2G5WA 4JY8A 3KVLA 3L9CA 3A24A 5F4XA 2Y7EA 3TXVA 4ONVA 4UTWC 3C2RA 2A6LA 1TV7A 3NG3A 1EP1A 1T96A 3G1DA 4FNQA 4J9JA 3GR8A 1F05A 3HMJG 1YXCA 3SECA 3DI0A 1OHLA 1KM1A 1VS1A 3IIZA 2QCMA 3B06A 4NJKA
chains in the Genus database with same CATH superfamily
1DXIA 4FOUA 5I23A 1EC7A 4IMFA 5D8ZA 4ZL1A 4CCCA 1I60A 2VOMA 3W1AA 1TTQA 1BSLA 1R0MA 1CB7B 3SCSA 1MW0A 2H3DA 2VD8A 3W7JA 1HKVA 1GNXA 4IPJA 3ZMRA 4O8AA 1WAUA 1TJRA 1WDPA 4J27A 1MO0A 3I6TA 5C7HA 1XG3A 4BQ5A 3DCPA 4B16A 1N55A 1O5XA 1UCWA 4LUYA 2ZVRA 4X3ZA 5G5IA 1H7RA 2P5NA 1RY8A 4NILA 1RQEA 2DSKA 2EF9A 4Z08A 4CEUC 4DRSA 2TODA 3S4TA 5C55A 3TYBA 4H83A 3UR7A 1A5CA 5KITA 4AY8A 1A0CA 1XIIA 3VO0A 1XGEA 5M2FX 3MZ2A 2JALA 1A5KC 4LCQA 4J35A 1ZSXA 3LCGA 1LORA 4LPCA 3DC0A 5I24A 3HF3A 2Z1XA 5E6ZA 1A5OC 2G37A 1UWAA 1A3XA 5AYZA 2YBTA 2EQDA 1KNWA 4O14A 2Z29A 2PURA 4WDTA 3UG3A 4XZ9A 2QMKA 1GVSA 1XFBA 5FSDC 3WNLA 3O0KA 4AIEA 7REQB 3A12A 3ZLFA 3S5ZA 2YYTA 3M0HA 5I2UA 1FDJA 5A69A 3CO4A 5I3IA 3SJNA 4AD4A 2EKGA 1S46A 5BMWA 1M65A 3UWEA 3VAVA 1QTWA 3NSXA 1ZHAA 1VH7A 4LBRA 2J62A 3FHAA 4KT2A 3S1XA 1DV7A 2WAGA 2OZ8A 5TAOA 4GVGA 4O8RA 3LHVA 1M41A 3GC5A 1PTAA 1O5QA 3N25A 1LWJA 5CZKA 2B81A 2JKAA 1KFEA 1IYXA 4I90A 1W8GA 3W7GA 3PNZA 1OT2A 4HZ6A 2YB1A 3WQVA 2X0HA 3HPFA 4QEEA 3SM0A 5BU6A 4QLLA 5A6LA 5JXQA 1VJIA 1E0TA 1YQ2A 5JMUA 1ZL1A 2B7PA 3U2ZA 3BLKA 4ASTA 3VIKA 1WOBA 2L5HA 2YL8A 4TX6A 3U2OA 2ACQA 3AUOA 2YZ5A 3E5BA 1H5YA 2DT0A 2ZZ1A 5H2ZA 1LRTA 1RH9A 4AMAA 1EJVC 3WH8A 1W3TA 4NX5A 1CIUA 3K5XA 4ES4A 1DTNA 3ARZA 1OIFA 3NR0A 4FIRA 3EOEA 1BKSA 4IMEA 3ALGA 2XH2A 4LEQA 1Q4WA 4M6VA 3JZUA 4OTKA 4C6KA 2G4FA 5AY7A 4Z1YA 5D32A 4GXPA 1EC8A 1PTDA 3KBSA 5I6SA 2ZE0A 3U5YA 1EF2A 1V3HA 2PLKA 1HKJA 5BZAA 3IUIA 4IHCA 4OOZA 4DLMA 3BH4A 3R13A 4MY9A 2NXGA 3GBEA 4A21A 4PZVA 2YA0A 4WEVX 1LDCA 3BE7A 4GFSA 2YCEA 4DYJA 7XIMA 3BOFA 7PTDA 1KCXA 1PVNA 3VABA 2I14A 2BNJA 2OWWA 2D24A 3QMRA 1L2QA 4FEZA 4N4PA 3W7MA 1O1HA 1OGSA 2J7FA 1ME7A 3PTQA 4L6DA 1GQNA 1EDGA 3LTSA 4LF2A 5A2BA 3CH9A 1HFBA 3GG8A 3PUGA 5K9DA 3QRHA 4Y6GA 3BMXA 3W71A 3G6LA 3WLMA 2BGSA 1LLOA 2ICSA 5BRQA 3VKCA 4H7VA 4XSLA 3LB0A 1PWLA 2B7OA 3U57A 1GKRA 3GXNA 3Q2DA 3W7DA 3MT1A 1OCJA 3N2BA 3A21A 3PP7A 5CCZA 3ABRA 3NPWA 2VKZG 2WMJA 4PCNA 5LA1A 5FKYA 2NXIA 2XFFA 3AHZA 4BZYA 2X16A 4KS0A 1LL4A 5EA9A 4IZGA 1EXBA 2FFIA 1W8SA 4PMUA 3H4WA 3SFKA 1HQTA 1T6MA 3QQ0A 3A4AA 5D2YA 4CVUA 3ONBA 3BTNA 4GGHA 2ON3A 3G1YA 3R7MA 2W79A 4H6QA 2X30A 1KM6A 3CHFA 6REQB 2PLCA 4XBKA 1DE5A 2FZDA 3QM3A 4Q4SA 1BXCA 3FGCA 3JVAA 4Q4RA 3DZ1A 2Z28A 1RP9A 4EXQA 3DUGA 1SMDA 3QY8A 4KKXA 3WQDA 1NF0A 1Q13A 1FWCC 3C4UA 4PTMA 1AW1A 3N6JA 3GH7A 1VPYA 5A8OA 3WEOA 4GLEA 3BAWA 4GFIA 3CTTA 4H7CA 2VL4A 2UY5A 2ISSA 3DI1A 4BA0A 9XIMA 3BSMA 3UYCA 4MLJA 2DT3A 3R0DA 1F73A 2DIJA 3PZOA 3AROA 3WLNA 2QW5A 1EJ7L 2OWCA 3KBMA 3DG7A 4UQDA 3W6LA 1ZJIA 3EXSA 5CG0A 4BCEA 3RM9A 3MMTA 3QHNA 4L5ZA 2WJFA 5IXEA 3D5HA 4C6EA 2Q02A 3RLUA 4PFHA 1ZPTA 5FOOA 3QV9A 4IFRA 1CLXA 3ZR5A 3L0NA 1WKDA 2KX9A 4PBGA 4HT3A 3WLSA 5E9AA 1IT7A 2VVNA 3HU7A 2RDXA 4J28A 5M3WA 3BW3A 1MSSA 3FDKA 5I77A 1MFVA 1JI2A 4AD1A 2QCEA 3WH6A 3K1DA 1I45A 1TPC1 4Q32A 1E1CA 4PUKA 2I5QA 2D0HA 2VX4A 3SO7A 2VCBA 4ZENA 2PTXA 3VVGA 5C9RA 4QCEA 1IEWA 4J40A 3L66A 5BRBA 3HZ3A 3HGOA 3CZGA 4DUWA 1IXOA 5SWUA 3OLIA 3BXWA 2E6YA 2NLYA 1OFBA 3GAYA 4GJIA 4W84A 3UW6A 1XCFA 4FK9A 1DXEA 1ITCA 3UD6A 5EU9A 2A0NA 1CX9A 3STCA 3MJMA 2QUVA 1Q63A 1AMKA 4EPDC 2J47A 1V02A 4X0NA 1NU5A 4MZ8A 3QFEA 1ZJAA 3WJWA 4ICMA 1E6SM 3GHTA 2VEPA 4IJRA 4ZQOA 2QDGA 1I6NA 4CQAA 1US0A 3WDIA 3CWHA 1YDVA 1OB0A 1UUOA 4OWGA 1ZBWA 3MI3A 3STEA 3P6LA 2W61A 1M04A 1QI4A 1OT1A 3WUFA 4LRSA 1ZAIA 4IPNB 5A8PA 3FEQA 4MDOA 4C1LA 4GG9A 3O9NA 1GOQA 2GPTA 1DIKA 3GUGA 1G5AA 3PZMA 3DN5A 4OBRA 1OF6A 1FY6A 3VE9A 1GONA 4UCFA 4IF2A 1K9DA 4IQEA 4EPBC 3FA4A 3VGHA 3W53A 3HURA 2EEXA 3TOYA 2QUTA 4KGLA 3CMGA 1PYMA 3ZJ8A 4A8IA 2PCQA 4ZZ9A 1GQLA 4NJGA 5HMFA 3IGSA 4FX6M 2BG5A 2RAGA 3R11A 3MHUA 1FHUA 5F7UA 4UMAA 3UJ2A 4QQ3A 1FX6A 1GHSA 4IJBA 1J0YA 4XAGA 4XAFA 1V79A 4CCEA 3LI0A 3TP4A 4IPLA 2UY2A 1LT7A 1WZAA 1M7JA 1CEOA 2BGNE 5CPNA 1BG9A 1TZ7A 1TV3A 4O16A 3IIPA 2J66A 1ECQA 1UH3A 1JDFA 3RLHA 5KEZA 4UTWA 2ESCA 3FW6A 3KTXA 5CBBA 1PXGA 5HANA 1L9WA 2GGEA 4IX0A 1ESWA 3AHVA 4AZGA 3W23A 4BQ4A 3N2OA 4WDUA 5AC7A 3WMLA 1JCXA 3T4WA 1I0DA 4E2DA 3ANYA 3TZFA 1UP2A 4NT0A 4IIHA 4M1RA 1DJZA 1SPQA 2NQHA 3BLPX 1A5MC 3GO2A 5EFFA 1C8XA 1IZCA 2WBGA 3A22A 2BY2A 4O12A 1RK6A 1SSDA 3SQLA 4ERAA 4WJXA 2V9DA 1QCWA 2IPJA 3P84A 3WJZA 3QZAA 3A47A 2DZXA 1GT8A 4WCJA 5JQ9A 2VJXA 3KS6A 3LENA 4KFPA 3VIPA 1VZWA 4KW2A 4KWSA 3NOYA 1T5AA 4R88A 4P8XA 9XIAA 3PBUA 3F2DA 1O4UA 2GDUA 1O1ZA 3TTQA 4I8YA 4LYRA 4JFSA 4HKPA 5E9XA 5DT5A 4MY1A 1FP9A 3KL0A 4B5WA 3KCOA 3QGAC 4Z2HA 3W7OA 4GQBA 2OO0A 1NFGA 4M6QA 3AISA 5I3JA 2YSWA 4M7TA 3PJWA 2RDWA 1I2QA 5GVJA 1UZHA 1H1NA 3PPFA 5HJYA 4ICNA 1LYXA 5GPRA 2WHLA 4B15A 1ONXA 1M7XA 3QC3A 2WNQA 4INFA 5FEXA 1WKEA 3QSTA 2XJ7A 1XUZA 2DSZA 1CDGA 4OUEA 1VAHA 4I7WA 5CZ0A 1GZGA 1GOIA 2EAWA 2PDMA 4ZFMA 4BI7A 4QQUA 1TMHA 3IJ6A 4L9YA 3B8WA 3BCJA 2BWGA 3B8SA 4WKHA 3FCPA 1NM9A 3PBYA 4IMCA 4PL1A 5AHEA 3KOXA 4IMAA 1ZAJA 2VGIA 3GSMA 5EY5A 5J5RA 1I2PA 5DELA 3QW3A 1RY0A 4L65A 1RQHA 4PTNA 1ODZA 4FLOA 3AIVA 4IX2A 3GVWA 4DO6A 5HQMA 1EJTC 2KAUC 2QS8A 1VYPX 2E67A 4OT7A 5D02A 4Q4PA 3EWBX 1YX1A 2PTZA 2WHMA 4UTUA 4QEHA 1K6WA 2HNEA 3D6NA 1FWIC 4AISA 4S2CA 1Y5VA 3K46A 1B3XA 3TNOA 4UMBA 6TAAA 1Q7ZA 1H11A 3P81A 4O11A 5CC6A 4IQDA 2YDQA 5CXPA 3PR2A 2O9TA 1VJSA 4AVFA 1FKXA 4P2VA 4GIRA 4R34A 3TYAA 1FWEC 3BL3A 4XZBA 4ZOBA 1DQUA 2XVPA 2QJMA 1SQ7A 3TROA 1P48A 3WO8A 2QCDB 3GU2A 2C1HA 1B57A 2EO7A 3NM3A 4LYPA 3PBWA 4B5NA 4XD5A 3GXPA 4M1BA 3LHTA 1C7SA 1DQWA 1WXYA 1XYBA 3VFLA 2Z0IA 2CHRA 3L0GA 1WQ5A 5CPQA 3QQ1A 5A6JA 3EWZA 4A3UA 2VX5A 4Y7EA 4JKKA 2E5BA 1D3GA 3VOGA 1E71M 3NQ6A 2PUZA 1OCBA 2G95A 1E0UA 1IGSA 1PSCA 1HW6A 4H9XA 3EPMA 2QJHA 3MSDA 3CWNA 3W2MA 1WZLA 1V0NA 1TPUA 3FX4A 3GFXA 1DTUA 4CCZA 1WDDA 1TRDA 2ZRZA 5HJLA 5G4EA 1KV8A 1XLGA 3AIQA 4QLJA 5TNVA 1UBPC 3H26A 3HJEA 3CT2A 1DJIA 4GZJA 4FOJA 3SJ3A 5DN1A 4O18A 1UA7A 4A29A 3CU2A 3IWPA 4CUCA 5LXEA 4TIMA 3HO8A 1DIEA 5A6TC 1OD8A 1HTIA 1EOMA 2W92A 1QPOA 2ANUA 3MV11 5DLCA 4EP8C 4UNLA 2NVDA 4W8BA 4IP7A 5G1MA 4HPHA 1NARA 4AF0A 2C19A 2DZSA 4M19A 3UYIA 2UWFA 1Q66A 4W85A 2JQXA 5FAGA 4UFJA 1FOBA 3R6IA 4IXHA 2VUNA 4QSFA 3TVAA 2ZX8A 4HHPA 1TMQA 3STGA 4XWUA 1OBAA 4H4IA 2VZTA 1NWTA 2NVCA 1MUMA 3CJPA 1PCKA 3O16A 4PTDA 1X8CA 4EK7A 1E6QM 3UWQA 1VPXA 1UQZA 1KRAC 1W31A 2VR4A 2ZFAA 4GXMA 1XBZA 1S3TC 4F2BA 3CIXA 3UZXA 1KBIA 5BOEA 3ORWA 4CD8A 4AYSA 3WQ4A 3PZUA 1OFDA 3DGBA 4ZB5A 4L6OA 2ZVIA 4B5TA 1KRBC 3N34A 1TX2A 4ROPA 1UYQA 2VX6A 1KM5A 4G2DA 2PWUA 3LQLA 3MO4A 3WLIA 1Y0EA 3CIWA 3TQKA 4AG0A 1Z3NA 3FIGA 5G2IA 3VTRA 4X60A 1PAMA 4IIGA 4GD0A 4K2SA 2WC4A 4JR5A 1BSIA 1VKFA 3EXTA 4LS1A 3PWGA 4EXAA 2IKIA 4YHEA 3CMJA 4JL2A 3H4XA 2ZTJA 2C71A 3LBMA 1X6NA 1I8JA 3MUZ1 3RRXA 1ISVA 4F3HA 4IPPA 1K70A 4EOUA 1E0VA 5FI8A 4JIQA 1CPUA 2ISFA 2DH3A 2OSYA 4ZMGA 4CKQA 4S3KA 3ITOA 4GJ1A 1RD6A 5I00A 4HK5A 1GQKA 1ISYA 4W87A 1OCNA 5C70A 1UKTA 3G0XA 2ISVA 3H2AA 1XLCA 4LNCA 3BLOA 4E2OA 1E9ZB 3GZ3A 2R6OA 3G8RA 3UXKA 4FNUA 3NSNA 4Q4KA 5HUOA 1RPKA 2YBUA 1QWKA 5AECA 4ZQCA 1JGIA 3ENLA 3TLQA 3L4XA 3GHUA 1E9LA 5GJNA 3U7BA 2B4GA 3UA3A 3B4UA 1J2BA 1AJ2A 1PKYA 2D73A 4RW3A 2XIQA 3UJRA 1E4NA 3VD7A 1Z42A 2OLAA 4HSOA 4GO9A 4F2TA 3JZEA 3WKZA 3SY8A 5C7VA 3I10A 1PBGA 2Y5SA 1RJPA 4GVIA 4DELA 2EPMX 3KOYA 3VNLA 1P0NA 2OEMA 2FVMA 4K1GA 3EGJA 3PAOA 3PB0A 3WL1A 1E6XM 4IPIA 3M44A 4K38A 2X2YA 3B9AA 2WYSA 1AUSL 4PC8A 4ZR8A 3H55A 3V35A 5GJPA 3O1NA 1L6SA 1X6LA 3PG9A 3I7QA 3POHA 5JH1A 2Z26A 2AAMA 3W0KA 2WKJA 5XIMA 2Z1WA 4HTYA 5CC7A 1PL9A 2OG9A 3AS2A 3KDOA 1B54A 4N9BA 1WXJA 4WKAA 2WJEA 4FOKA 4MNLA 1XR2A 1T8QA 2PTDA 2E6DA 4DQWA 2E9MA 2GVJA 3HGRA 5JBEA 4MADA 4V2XA 1S2AA 5A2AA 4S39A 4WOZA 4GH1A 1XD1A 2ISWA 1QU4A 2HJPA 2W62A 2AQOA 2Y8VA 2IKHA 2DH2A 2PLMA 2ZRUA 1UJQA 4FIQA 5DCBA 1EGZA 4FXFA 1PDZA 3EDKA 3N2XA 8CGTA 4AZCA 4U3AA 4C6JA 5C9ZA 3IS4A 4UFIA 3PULA 2VM8A 1K8CA 3AMGA 5AZ1A 4EANA 5CC3A 4RV3A 1XH2A 2QCLA 4DO4A 1V0LA 4JQAA 1UH2A 2W66A 5FD0A 4C6IA 5DEZA 4Y90A 3H6OA 1DWGM 4LY4A 4US6A 4IL2A 1RHCA 1L2UA 4HPJA 2XWDA 2DW7A 3EMQA 1PHQA 2E68A 3WLHA 3ABQA 3U9IA 1ISWA 4AD5A 2XM1A 4E3VA 3VKJA 1LT8A 1NDYA 3S8HA 4MTVA 3EWXA 3NAVA 3RLVA 1H63A 4RLIA 4H9TA 3LI1A 2QULA 3OZOA 1TPFA 3VIGA 3ANVA 2ZC1A 2X1RA 2PRLA 2JBMA 4HMDA 4UTIA 1LLZA 4K36A 3CQKA 4R9OA 1NWUA 4EWJA 2X1IA 1KCLA 4HNOA 3I3BA 2Y2WA 4XO6A 3RRAA 5HINA 4ZXLA 4KCTA 2V67A 3W9ZA 1OINA 3QKZA 3ZJKA 2DW6A 1ZGDA 2WQPA 2EJAA 4ML9A 3G18A 1Q6DA 1SFJA 4LANA 1O60A 4G1KA 1TE6A 5A3HA 3HGSA 3U2EA 3KRZA 1UD8A 4L4LA 2UZ9A 3LUTA 4JEQA 4O50A 3SAZA 2OZ0A 4FR1A 4O1CA 2XGIA 3S9YA 4MUPA 2VFDA 3MSRA 5HMSA 3DFOA 3CXOA 1O66A 3G1HA 3U5UA 1W1ZA 4KEZA 3AMKA 1LROA 1PZ2A 4MM1A 2VT0A 3EX3A 4J2PA 4BR1A 3VU2A 3FA3A 4WQ6A 4NXSA 4ICCX 1CNVA 3W26A 4YLWA 2E6FA 2DZVA 4Z2GA 4RL3A 1THFD 3DFYA 4CN6A 1PYFA 1Z44A 1R47A 2BODX 3IEBA 4GKTA 1XKYA 3CLMA 3C8FA 4ZEPA 3N2MA 1U2YA 5CSRA 2DV0A 3BPWA 2XIIA 3BG3A 1JRBA 1N2VA 1TJ0A 1SFLA 4QJ3B 2OGJA 1EPVA 3CV2A 2BVWA 1E5NA 4JX6A 4LC8A 2PF0A 4M80A 4A3RA 4MKNA 1XPGA 3UWUA 4QJ4B 2C0AA 3VM5A 1U5HA 3DFPA 4ZSTA 2YCLA 2I9UA 2VOTA 3ALFA 1TQJA 3R89A 4ZTYA 4J3XA 1W3KA 1KB3A 3W1UA 4DHGA 1JQXA 3VNZA 4XZIA 1R3QA 3FVDA 4UFHA 4O53A 1U22A 4UTTA 3WBEA 1W37A 3KM8A 3KOFA 3V1HA 3G24A 3K8KA 2QCHA 5A1AA 2J6VA 3T78A 5A6MA 3LV6A 4NNAA 3W76A 1CGVA 3U4AA 3DYPA 3UZYA 4HMCA 2ONEA 1BVNP 1KBBA 1XH0A 5D4YA 1V3KA 2WM1A 4MNKA 1UG6A 4XAPA 3KDNA 1BD0A 1FQ0A 2VQTA 1LF1A 1TVNA 4D1IA 1YDNA 3WQWA 4HA4A 1QVBA 4YHGA 3FYYA 4AQLA 3M9YA 3L4UA 1EJRC 1H2JA 3UJFA 5HXMA 5JUVA 1J5TA 1UOKA 3B40A 3G1VA 4JHOA 5FCZA 1QNPA 3H23A 5D9MA 1XYAA 3TNBA 3HPSA 2V38A 2X1UA 2V2HA 1FH8A 4LUTB 2J7CA 1E40A 3WZ0E 3GYCA 3YPIA 1XWYA 5LIXX 3JW7A 2PD5A 4LBUA 1OX6A 2VI0A 2I17A 2R1MA 2V3FA 1CGTA 2Y24A 3WLLA 5DT7A 3SUVA 4AB4A 2GJXA 2WLYA 1B5TA 2NV1A 4TUFA 3OLDA 3B9NA 1EBHA 1AFSA 3WX7A 1B3YA 2VDGA 1MDRA 3MO7A 1S39A 4O54A 3NZ1A 2CLHA 1PJ9A 1V6VA 1V6WA 4ZO6A 5I09A 4RUBA 3BAXA 1D9EA 3V36A 4JFWA 1GVQA 3EZ4A 3MYPA 3L4VA 3SQSA 4JS3A 3WH9A 1X8FA 3ZXWA 1P0DA 3UWVA 5D30A 4OZOA 4FLQA 2GZXA 1OK4A 4MOZA 1A4MA 2C91A 3VMPA 3N73A 2GVLA 2PP0A 2OLSA 4KPLA 3BMWA 1K6AA 4DZHA 4TMCA 1WAWA 3TH6A 1BQCA 3FEMA 3NTYA 1ADOA 1V7YA 3M47A 5AYXA 1EH9A 2B7QA 2INEA 3VINA 3NEVA 4MJZA 1XLJA 3P0WA 3S6OA 4L1WA 4POCA 2R1KA 3GG1A 1VCVA 1WZKA 2Y5JA 2E1WA 2YZRA 3VA8A 4M3PA 2BMBA 2VQUA 3NYZA 1BWVA 5ABEA 1MWOA 4TVDA 1QR7A 4HZ7A 3WBWA 3NQCA 5HMDA 1IWPA 3CUGA 3CBWA 4JQ2A 3QPYA 1US2A 4E8DA 2Q8ZA 2PA6A 2ATMA 4HNLA 2J77A 4LC6A 2FFCA 4DYKA 1H7WA 1GYNA 3GW3A 3EB3A 2HBXA 3SBFA 4AWEA 4CEXC 1KLYA 3TN4A 4KMQA 4Q4OA 1BGGA 1ONEA 4D72A 3E2VA 1IIHA 1Y5WA 1LLWA 2J7BA 4PB4A 3VIJA 2QQ6A 2ZXAA 3KVLA 3B8TA 5LXXA 4EX4A 4UTWC 3C2RA 2OO6A 1J01A 3HMJG 1F05A 3TOPA 3IJ9A 4LXFA 4RW5A 3DI0A 3WF0A 3WEZA 3V0UA 2CC0A 4NJKA 2C8NA 1VLWA 1F8MA 4LVDA 3RXZA 3FFSA 4HPGA 1HL2A 1EEXA 3GDLA 4RPQA 2NZLA 3LTPA 3KP1A 4RNFA 4WVXA 2ZCGA 4UMCA 5MHBA 1S2WA 3E0WA 3LCHA 2B7NA 1MEWA 3UP8A 2BASA 4DNHA 4ENLA 4QJ1A 4OV9A 3L0KA 1AD4A 1CT5A 1UR3M 1CXHA 5F2GA 3NVDA 7TIMA 2YL5A 1FWAC 2PDFA 4NG3A 3PANA 3M0IA 2D2GA 2TSYA 1W56A 3W88A 3MA8A 4S3FA 4Z2IA 5EL1A 4E8CA 3VIIA 4UBPC 4I6KA 4IIFA 3THQA 4NJHA 3NNTA 1WDQA 2WB5A 2WPGA 1XQKA 1UJPA 3DECA 3UWWA 2D2JA 3CLWA 4R3UA 1HG3A 2Z24A 4C1NA 1HNYA 1WUEA 4DF1A 4H3DA 4AEOA 1HJXA 3EMCA 1OFPA 5HPOA 3VOFA 3FVMA 1UH4A 3G1RA 2V3EA 3WELA 1RK5A 4Y96A 2WMGA 3CM4A 1RLDA 3TV8A 2JF6A 4Y9OA 4BQ3A 1HKMA 1RJQA 1VFTA 4YWIA 1ZFJA 1HL9A 1JPDX 1YPFA 4ACYA 1B30A 1JYWA 4AWUA 3ATYA 3LXBA 4ZSUA 4NL1A 3K4WA 1W32A 2YL6A 4H9MA 3UVIA 1AMYA 3W7RA 3MMWA 4JIEA 5LHFA 2PI6A 2YX0A 3K4DA 1G7UA 1Q7MA 3GKFA 3BJSA 2BY1A 3GNOA 2H8ZA 2E4TA 2NQZA 1FWWA 3ZVHA 1VPQA 3VD5A 2OB3A 4Y8FA 1YRRA 1QXLA 3WDJA 3CGTA 2YFOA 3B9DA 4IMDA 2Z6IA 1EBGA 1EYWA 3DHPA 3GR4A 1ICQA 1TTPA 1ZAHA 4C6FA 5I79A 3UXIA 5D38A 1D3HA 1ECEA 5LNRA 1I2RA 4AEEA 3F1QA 1XLLA 1H7OA 1F5ZA 3QFWA 2DQWA 1T7LA 1GHRA 1KW1A 1JEZA 1C29A 5DXXA 3THCA 4W7VA 4OKDA 1B0IA 4ERIA 4DJFD 4FXRA 2VEKA 2HTMA 4MIMA 1B4KA 3LGEA 3B8IA 1H7PA 4BK9A 1W1B1 3R94A 2Z27A 2XIBA 5DFAA 4IFKB 3IRSA 4C7FA 2P3EA 3COTA 3RILA 3ID7A 1LG1A 1BXNA 1EJWC 4NP7A 3WLJA 3HA1A 3NYDA 4B3KA 2DUXA 4NY2A 1TV5A 2VRQA 2ZWZA 3R8RA 1KM4A 1UUQA 4O1BA 1A5UA 2WNWA 4MPQA 4UNIA 1UWSA 5ECUA 3M6DA 3XINA 4W5UA 4NX0A 4OHQA 2PDNA 2F2HA 1TUXA 2Z4GA 3RCNA 3N3MA 2QPSA 3BLFA 3KS5A 2DSUA 2A6NA 1SZNA 2JGYA 4NJIA 5U4NA 3MWAA 1CXFA 1G9HA 1Z6KA 4KGJA 4ORMA 2VC6A 4OE7A 3PPCA 1P4CA 2F38A 3TTEA 2QCFA 2NQ9A 1UROA 1JUKA 3R43A 4KQNA 4EF9A 3LYEA 5M17A 3LMYA 3RGTA 4PMJA 1JYXA 4FALA 4Z1AA 3OBKA 1BEUA 4XB3A 3BOXA 3JR2A 4ILSA 3R10A 5D2XA 3VDBA 2ISDA 3PY2A 1AQHA 2G96A 4J3WA 3EPNA 3GXTA 4HYRA 3DAQA 5CJMA 4HZ8A 1HGYA 3LA4A 3UU0A 3RDKA 3UPMA 1MZHA 5CPTA 3WNOA 1VIWA 2J7DA 2ZUNA 3G1FA 4DF2A 2GJRA 1YLVA 1JCJA 3LGDA 1WV2A 4AH7A 2HRWA 4JFVA 3AJ7A 4B5UA 3C3UA 3W24A 4L4MA 4GKLA 4HK7A 1K9FA 3EDFA 1WP6A 3LV5A 4IIDA 3A64A 3VOHA 3GIPA 3WYZA 1XLMA 1FWTA 3D3FA 4DJDD 4P61A 4S3DA 1H62A 3E6EA 4JCLA 3P8JA 4QM1A 1R3WA 3ERPA 4I8DA 5K3VA 3CYJA 4HD5A 4AHQA 3SADA 3E2QA 4L9ZA 3AIRA 2J78A 5REQA 4BF7A 3GNXA 1VQTA 4JIIX 3NURA 3QMSA 1JL8A 3ARRA 5JBDA 4IIBA 1A49A 1NDWA 2Y7DA 4EXBA 1GZ1A 1KR0A 2GYIA 1EUAA 1NFBA 2FZ8A 1EX1A 1HJQA 4M56A 3N19B 3S2CA 4PUJA 1OZQA 3DG6A 4GC3A 4K3ZA 2DJXA 1KQZA 1R3TA 4B5VA 4FXSA 4DPQA 4PSPA 4PCPA 2J27A 3EOLA 4JHZA 3WBAA 1XXXA 4M8UA 3VNJA 3QY7A 2A3EA 4LYQA 2CZDA 1WB0A 1EO5A 4LUSA 1QK2A 2KZHA 1C7TA 1W1VA 4WDWA 1ZU8A 5KETA 2TRSA 2WCAA 1KR1A 3UR2A 1M03A 4S3CA 1HO4A 2PDQA 3WSUA 3G8EA 1EKOA 2AKZA 3BV4A 2YBVA 4TV5A 1VBHA 1HVQA 1ME8A 4XZNX 3AU2A 4KFOA 3DGRA 2AQVA 2RFGA 2CPUA 2Z2AA 4MJMA 1V08A 4GINA 2BGQA 1OGBA 4DNMA 2ZTKA 3KL5A 1D7KA 1UR1A 4UOZA 3QN3A 5CAKA 4PUEA 5GNZA 5M1TA 4GA8A 3IIXA 3F7JA 3WJYA 1PCWA 1ZP4A 4GUHA 2XN2A 4N9EA 2XM2A 1XRVA 5D9PA 4QDPA 1GYMA 3IIOA 1UWUA 3MMDA 2YCKX 4D6CA 4AU0A 3NCOA 2VEMA 4ZODA 2O56A 5AC6A 3BGGA 2C14A 5M5DA 5FJOA 3BDKA 4P7LA 3L5MA 1MMFA 3VOCA 4HMEA 4DZAA 4AWSA 2MUCA 3N15A 5BNKA 5CGTA 1M1BA 4UTMA 2E77A 4P7OA 3OYXA 4YS1A 3SRDA 3F5JA 1KLZA 3SURA 2GJXB 4JTSA 4HOXA 1XLFA 1PB0A 5K7JA 2CESA 2JFEX 2PDYA 3LEPA 3W72A 1WDWA 1W17A 4NZ3A 1R2SA 3CL6A 1QPNA 2Y5EA 1UMYA 1TELA 2G3NA 1ALDA 3GDKA 4GI4A 4H04A 2GVYA 3UZJA 1UD4A 2E40A 4NF7A 3RYSA 1HIZA 1I1XA 4XKMA 5CLWA 1O12A 1YDYA 3S2NA 2D1ZA 3RF9A 2QMJA 3CTLA 3GFYA 4AZ6A 2QJIA 4LCRA 3ZYZA 1XUUA 3C86A 3O15A 1QI2A 4W4QA 1LL6A 3RPTA 3ZQ9A 2WQDA 3AWOA 3W37A 3RR1A 1OX4B 2XDFA 1G4PA 9RUBA 5HBFA 2GQ8A 3M0XA 2CZ5A 2O92A 4ERGA 2QUNA 3CUZA 3WQGA 1JVNA 1NSJA 3GHRA 1PPIA 2GSEA 5DRCA 4JBRA 3ITCA 1UQYA 4DJFA 3SFWA 3W1PA 4CQDA 3NDZA 1UR0A 1FVPA 3QYQA 3OQ8A 3ZFHA 1SZEA 1C8QA 2PEVA 1FCUA 1FH7A 3UF9A 3TSDA 2FB3A 3G22A 5E0KA 1Z89A 1W3IA 3CNYA 2Y62A 1TV4A 3W2JA 8XIAA 2V2DA 4AZ7A 4Q8WA 3AXIA 1A0EA 2W3ZA 5KZ6A 3BURA 4OU1A 5EMKA 4EAYA 2XN1A 3TKFA 3P74A 1OSEA 4LOCA 1TIWA 6XIAA 1REQA 1KM3A 4ZO7A 3WQ6A 1OYAA 1YIXA 4IICA 4JYFA 1J79A 4UFLA 3V16A 2YPIA 4WGHA 1A5BA 3W1RA 3S2JA 3CPGA 3S46A 2WVTA 4MYXA 2QJJA 3CMFA 2VFHA 1X97A 2VEIA 2WMFA 2GQ9A 3ZM8A 1OX5A 2WZIA 3HN3A 2ZC8A 4LUJA 5I3GA 1QOPA 4XD3A 4XZWA 4LCSA 3T0TA 1OC6A 1WCGA 1Q8AA 1Q2RA 3M43A 5EB8A 3GZAA 3ME3A 2GSJA 1GVEA 3H24A 4G9PA 4NZCA 4OECA 2VRJA 5CKSA 3TW9A 3UGVA 1WPCA 3ITXA 3DFSA 1ZQ5A 1B3VA 1G1YA 4JTDA 4D8LA 6PTDA 3GG7A 5D2VA 4BKNA 3DESA 4ZE4A 3QXBA 4IJCA 2Z00A 1WXZA 3RHGA 3INPA 2V30A 3NQ7A 4JGDA 3SIZA 4TX8A 4AC7C 1R3RA 3L4TA 3C2YA 4C1NB 1KFLA 1ML1A 2DEPA 4JYEA 3H7VA 1H61A 2HMCA 5IDZA 4HK6A 4Q8UA 3CL7A 4M6PA 2BVTA 4CVWA 3GVQA 3TMQA 4J3SA 2MANA 4DJDA 4PTXA 4B4HA 2CXGA 2Q09A 3LDVA 2QF7A 1TWSA 1QO5A 3AYVA 2I1OA 5AVHA 5ENLA 2EPLX 2BHUA 3ITVA 3GNNA 5I0DA 2HSAA 1RSCA 2HISA 1JD7A 3M4HA 1D2KA 5CQ1A 2CNCA 4RV8A 3TE9A 1SO5A 4HZMA 3H2FA 3T42A 2OKOA 3STPA 3B4YA 1BTMA 3AIEA 4HYWA 3BG9A 4NIRA 3ZVHB 2O9PA 2W4XA 1KTNA 2VC9A 2ZZ7A 5CEWA 3VIMA 4W86A 2NSOA 3W7IA 3ZIZA 3LBCA 4RNHA 2NXHA 3L12A 1AW2A 2FTPA 1LTDA 2DUZA 3SSZA 2EGZA 3W27A 3QR0A 3NO1A 1E6PA 3SUUA 3NA8A 4AWTA 2WJDA 1H60A 1Q6LA 3GU1A 3M5VA 3T09A 3C0QA 3T1GA 2YIHA 4UTTC 4N02A 4AEFA 3KHDA 4UTJA 3OP2A 3WD3A 3B97A 3SB0A 1UIPA 3QKEA 2HXUA 1SR9A 5BOOA 3W86A 2X42A 5GNYA 4L1GA 4BWLA 1JQVA 3P7YA 1IV8A 5HOSA 2HNHA 4UTKA 1I2OA 3PJUA 3WD4A 5BYWA 2QT3A 4X0VA 4DXVA 3O6AA 1W1PA 1P7TA 3F4CA 4WY0F 3ZO9A 2BZNA 3VX0A 1EQCA 4QG8A 3W70A 3QZEA 4JTFA 1EGVA 1VF8A 4D8ZA 2POZA 3UWZA 1XINA 3E12A 2XFYA 2XH0A 4PE8A 1X38A 4MB5A 3NO3A 3W22A 2X2GA 3MANA 4HHLA 1P6CA 1QI0A 1J96A 4UR9A 4CU6A 4JFUA 4DY1A 1GGOA 3TQ0A 4FNSA 4NAEA 4V15A 3A3HA 3BLIA 2W0UA 4MZ1A 2YA2A 1GCYA 3AZSA 2XSXA 1JNDA 1UIOA 2RH9A 4GCAA 2VEFA 1ONWA 3FN9A 3GVGA 1TPDA 8RUCA 2VUYA 1H0GA 1FWSA 3OTRA 1K7EA 3GFZA 2WSYA 2IS7A 2P0OA 2FHBA 5F2MA 2PF8A 3LNPA 2XSAA 3VNIA 2CLIA 3VDAA 3H8AA 2YLLA 1IXPA 3LPPA 4MNMA 1KV5A 3KBNA 3UESA 2PDKA 3HIJA 4MMWA 1F6YA 1BPLB 5D37A 5BWAA 4K37A 4AMCA 2QDEA 2XGZA 1RLCL 3R0UA 3S1UA 1GZJA 3TMLA 2IKJA 3PFRA 3L2LA 4I5XA 2Z25A 1CECA 2PWGA 1ADSA 3UXDA 1DJGA 2ZICA 4JX4A 5K9CA 2O9OA 3GBDA 2BTMA 2XHYA 2XG9A 1P6BA 1TZ9A 4F4RA 1POJA 1PIIA 2OQYA 3ITYA 2OT0A 1P1MA 4GYFA 3RJXA 4NYUA 3VZYA 4NNCA 2D2OA 4CN4A 3EX1A 3K1GA 1H09A 4ZO9A 3PS7A 1SU5A 1HL8A 3PAJA 5G2WA 3LPOA 4PH6A 3VD4A 1U1UA 3STFA 1MNSA 1DKWA 2DVXA 1TTJA 2OJPA 3VC6A 3OG3A 1JF5A 2J79A 3CH0A 4H6KA 2BOFX 4QIUA 3VK5A 3PZVA 3GB6A 3VE7A 2VFFA 5REQB 3EWWA 3N11A 4KCUA 2CZFA 4LAMA 2A7RA 4LAKA 3HQPA 4F79A 2A79A 3QBUA 7A3HA 3KLLA 3GXMA 2W9MA 2DT2A 4MNJA 4GX8A 2QXWA 3B0XA 5HA7A 4YL2A 1VFFA 3NXFA 4ZQRA 3CUFA 4R53A 4LB3A 3EB4A 5A8GA 1BTCA 4WXZA 1JDEA 2FHCA 2OEJA 2BY3A 3QF0A 4K1WA 4GIEA 3L65A 4LWWA 4RE4A 3KWXA 1YNPA 1NDVA 2W63A 1GG1A 5KZEA 3LHYA 4DUXA 4DEFA 3RMEA 3CZEA 5CJNA 3SRHA 4RX0A 3EKLA 3N04A 3GXIA 3GE7A 3T4CA 4XISA 3P8IA 1XIBA 5DO8A 1UR8A 5BMXA 3D47A 2YW3A 4PMXA 1F61A 4LQ1A 5AHNA 2SFPA 1W5MA 1QO2A 1WYIA 3IJIA 2WZMA 2PCEA 3VC5A 2R14A 3FKKA 1EA0A 3LCXA 1S38A 3BJFA 2GWNA 1VFMA 4DF0A 4BFAA 3W7QA 1FWRA 3DXIA 3P2VA 1F7BA 3M7SA 1EOKA 2VYOA 4JDBA 1F74A 2VFGA 4A35A 1QUMA 3BV7A 5C2XA 1XLBA 5J8LA 4RE2A 1KRCC 2IMRA 2FVKA 2HPMA 2A3CA 4GACA 1BYCA 4N2YA 4I5UA 5FA5A 3FNDA 3E0IA 2RGLA 4D6IA 2EKCA 3MP3A 2FZBA 3BLEA 4FX8A 3JS3A 5AOUA 4Q3MA 3V75A 4R7JA 3WMSA 3S9IA 4PMRA 2V2CA 2BXVA 1HGWA 3FK4A 1OABA 1LOSA 1DXFA 3TSBA 2O4QA 3T8QA 4NXKA 2YXGA 4ACZA 2B0MA 1NTHA 3BZGA 3S1GA 5HNTA 3GHSA 4JOMA 3KBVA 2NV2A 1X1OA 2RHGA 5TF0A 4UQBA 4IIEA 3W2LA 1JYVA 2CHOA 1TYGA 5C9UA 1XHGA 2FGLA 2VELA 2ZOXA 4CD5A 4BEUA 1EZWA 2J7HA 3S42A 4LVAA 3GLCA 1R2RA 4WSJA 3H4GA 2OCZA 4HYVA 4NYYA 3LG3A 3HG5A 5E6YA 4NJJA 1V7AA 4W7UA 1KFJA 4PTVA 4B9ZA 1QNQA 4H2CA 3MUXA 4XZHA 5EMUA 4JQ4A 1HKKA 1E6ZA 4PUWA 3IARA 2PLJA 2WANA 2J13A 2PWVA 4QDMA 3O07A 1NY1A 3F5KA 4HIBA 1DHKA 4A8NA 3IPWA 4Z17A 2BP1A 5AC4A 1J5SA 3LPFA 4FAMA 4RZ6A 2OSWA 5T9CE 4CNTA 2J24A 3BZJA 3WNMA 2BOEX 3USZA 1W1A1 2Y8UA 3G6MA 3PWIA 2VTFA 2PDBA 4NUWA 3B0PA 5JVLA 2QYGA 1BYDA 1EFZA 4TR9A 3CZKA 6CGTA 2G3MA 3GXFA 1U33A 3BGJA 2PDJA 1CLKA 5BXPA 3EOSA 4BQ2A 2CBVA 3WJXA 3WBYA 3AIBA 3EXRA 4ORIA 3MVTA 4UC5A 1REQB 3N2TA 3WMCA 4JN6A 1G4EA 2VRKA 4GQQA 3IJ7A 2O7SA 3LHZA 2WMKA 2FMOA 1OFOA 4EAMA 4MYAA 4UTLA 4Y9NA 1AW5A 3AYTA 3GUWA 5FF4A 5IM51 3QR3A 1NP2A 1IT8A 3NOEA 3OEXA 3TEVA 3CO8A 1CZ1A 2PODA 3B8UA 3EMZA 2V63A 4H00A 2QCDA 4MB1A 4DZ5A 3W4RA 1YW1A 5T9BG 1LOQA 4KRTA 1DWIM 3WFAA 2D0GA 2BDQA 4MSSA 2J8FA 7ENLA 1XC6A 4S3AA 4YTSA 1G94A 4PB3A 3VPLA 2HXTA 1WUFA 1A5NC 1SMAA 1R5YA 4MUZA 1KKOA 1EIBA 3N13A 4NZJA 1KQYA 2TMDA 4REQA 5H8PA 1RA0A 4AVNA 4J2MA 3WDQA 1K77A 1VLIA 3LCIA 1PE1A 4I7UA 4JTRA 4LNYA 1PX4A 3PZ9A 4U2ZA 3NQVA 3G0UA 5G4HC 2RKXA 3B0YA 1RR2A 3DKJA 2OX4A 1VFSA 4YMZA 3BOLA 5GJMA 2BV9A 4Q8MA 3B04A 5HQLA 4MKVA 4UTFA 3TA9A 2DGAA 1R9YA 4ZO8A 3I3EA 1KXVA 2PDUA 2Z7GA 4J3TA 5A6SA 3UERA 4KWWA 3DHDA 4O52A 1NP0A 2DQXA 1Q6FA 3D3AA 3EA2A 1Z9AA 1LCOA 5C2CA 3SCOA 4QE4A 2XIOA 1L8NA 4LJ3A 4D6HA 4I5RA 3OVPA 3QV7A 1LWHA 5AC5A 4QX4A 5DY2A 2ZUTA 3UPBA 3DFTA 3QGVA 1ZNNA 3NL3A 1AVAA 3WLRA 3T0CA 4Y9MA 2HCVA 3HMCA 4YPJA 1QT1A 2J7EA 2OELA 4HA1A 4B4FA 4H8VA 1JCLA 3PN8A 2YFNA 5D9OA 4HN4A 2XINA 3NPUA 5CSYA 1E0WA 3PZTA 3UEQA 5D09A 2WCGA 3VCCA 4V1YA 4HNCA 1KCZA 3MYOA 1ZBCA 4GOAA 3WQFA 4DWSD 1SR0A 2H9AA 5C2GA 5FACA 4IGNA 4H8UA 1JFXA 4GYPC 4LY8A 4CNPA 5F4WA 1HO1A 3I4EA 3PJXA 3R0KA 3WUEA 3WFZA 5EMYA 3BCDA 1S1RA 5HWNA 3CUJA 1UWQA 1QHZA 4J3ZA 3BK0A 2BSLA 3WF4A 1FRBA 4ZB0A 6XIMA 2GOUA 4G1NA 2W6RA 1CI1A 2Z1SA 1KCKA 2PDXA 5G2HA 3UNDA 3F4VA 3TUUA 1YTKA 3PPGA 3V5FA 1QBBA 2VZOA 4WZHA 4PMNA 4YVPA 4XIAA 3S5YA 5ABHA 2H3BA 4JIRA 3FKRA 1XIDA 4QE1A 2DFAA 3GG0A 1XIGA 3ZT7A 1P7TB 4GZEA 4H7ZA 1XIEA 3W2UA 1LQ0A 3M0YA 2ZA3A 4P7RA 2DIKA 3W73A 3IGUA 3WG6A 3ZT5A 4CNUA 4Z2LA 4JKLA 2GJPA 5BXSA 3RX4A 3TLLA 1IXNA 1DYSA 3LX9A 2FZMA 4G56A 4X2PA 4TTGA 1QPKA 1GPWA 1XDJA 4GQ0A 4IMGA 3W38A 3S6TA 2PGRA 4E3TA 1W3NA 3N4AA 3Q67A 4KESA 3OODA 4WJ8A 4GXWA 1QOXA 4NAEB 1EYEA 4X9YA 1W1TA 1DPMA 3WD0A 1J0KA 3KX6A 1OEPA 1V3JA 2DVUA 1VCFA 1CENA 1R3YA 4QAIA 4UNKA 4LBSA 3WQCA 4NZ4A 2OWXA 4DBUA 2AMGA 3W7LA 2RUSA 1MI3A 2HV5A 2V68A 5GQBA 1DJWA 4PN2A 5JU6A 1L6GA 4ADUA 3FHQA 3L2IA 4Q7IA 2X7WA 2EG6A 1EB3A 1QAPA 3WLPA 1RZMA 4IGSA 3TQPA 3NUKA 4C6QA 5F4SA 3TC6A 1VHCA 5KMYA 3GWQA 2PRHA 3AHYA 4PA8A 5D05A 1Z32X 5I3KA 4QG9A 3MUAA 2PGFA 3MKVA 2Z6JA 1UA3A 3TXZA 1O7AA 5JIWA 1K4GA 3NFUA 3WD1A 5D9NA 2ZZ6A 4LVFA 1VIZA 1QMLA 5DMYA 3LMZA 1PIFA 3SCQA 3TC7A 2VGFA 3CZ8A 3BJTA 3L23A 3EWYA 1BLIA 5D2WA 1EJSC 3MUCA 1FWJC 5C5YA 1VFOA 3NJ3A 2YW4A 1OVDA 1Z69A 4LB4A 2PTYA 4OVXA 1MXGA 5C0QA 4YTUA 4DLFA 3KEHA 3L5LA 3QHOA 5AHIA 3T9PA 1H0IA 5IRPA 2VHLA 1IEVA 2J9YA 4GMEA 3WQOA 1G67A 3U6WA 1Z41A 1VFUA 4Z0JA 2FPVA 2WSRA 5BW6A 1F6KA 3HB9A 3NWRA 4DJFC 5A6KA 3DFQA 1F8IA 5U7SA 3QOMA 3IV8A 3VILA 3PM6A 3S3GA 3A24A 4K68A 1U30A 2W27A 3TXVA 4ONVA 3UZZA 1PUDA 1T96A 3G1DA 3GR8A 1YXCA 2ZUSA 3KE0A 5HDRA 3MPGA 4F40A 3PHAA 2A3AA 4MWAB 3ATZA 1H49A 1M68A 3AXXA 1ZRQA 3EAUA 1QI5A 2ZZ5A 1LL7A 3THUA 1GW1A 3GW0A 5FIPA 4E4FA 1ZS2A 1WO2A 2NX3A 3L4YA 2WMIA 2ACUA 3LRLA 2VD9A 5RUBA 1TPB1 3GM8A 1B3ZA 1Q5MA 3NZGA 4TMBA 5TIMA 3CC1A 3T81A 8A3HA 3MCNA 1AK5A 3H21A 4LF1A 5IDIA 3QLDA 3RUBL 1AL7A 1XSKA 5J04A 2ZA2A 3WK2A 3AC0A 5LHEA 3EB2A 1OYCA 4HU3A 4FSAA 4G7FA 1E4MM 1F2JA 4DZIA 3QOKA 1AG1O 4U3CA 4ADSA 3W81A 3G0SA 3PF3A 4B91A 1HT6A 3L68A 4GK8A 1UC4A 3FJNA 1DWHM 3NO5A 4P8UA 3WNKA 4RZBA 2HZGA 1XYFA 4LFYA 2CBUA 1C9WA 2WW5A 3CQIA 3QPZA 4E4UA 1TWZA 2J6XA 4B5XA 5I06A 5ABTA 5L6UA 1I2NA 4O28A 3E0VA 3V5CA 4H2HA 3C2OA 4JTJA 1YKWA 1PZ1A 4GJJA 4FNPA 4RNIA 1FHLA 3E2RA 1SVDA 4AAJA 1LG2A 3IGXA 1HXJA 2JIWA 4M29A 3DENA 1TPEA 4WGXA 1E15A 2ASHA 3L67A 4EVZA 4EIVA 2MNRA 4ACZB 1KTCA 3MDUA 1UW9A 2VC7A 4WHBA 1DQXA 4D2JA 4DI9A 4OIFA 3W02A 2WVVA 2ZADA 1R46A 4AYGA 3PPHA 2HS8A 1S1PA 3AUJA 1TVLA 3R1ZA 2OYLA 2IPWA 2DP3A 2G50A 3DU0A 4HBKA 1VD6A 2RDUA 2P10A 4JQ3A 4Q7NA 2PWDA 1YMYA 1TREA 3TFXA 4C6MA 3CQHA 1W9UA 2Q01A 1E9IA 3ARXA 1KD0A 1E72M 3T08A 2NSXA 3L7RA 4DWSA 4YCPA 1XCXA 3W1MA 1M7OA 4MFEA 3EWDA 3PK7A 1JZ7A 5FF3A 4TO8A 1Q2SA 4JAWA 4KIRA 2ZXBA 5AHLA 1QWGA 1UD5A 1UBSA 3M6YA 3WJSA 1MEIA 3PNUA 4JTQA 2VNCA 1W9DM 3MHFA 3A6OA 1SZGA 2J8TA 4L56A 3HQNA 2E5DA 3QTGA 4YCOA 1HF6A 3WLQA 2XYLA 4CN1A 2OX1A 2J4GA 3NZPA 3DOPA 4R7OA 4L7ZA 4PBFA 3VZXA 3HBLA 4PL2A 1JD9A 3Q58A 3A3XA 1H7XA 3REQB 3LS9A 4KCVA 4I9AA 3O6DA 3V5OA 4GBDA 3UXLA 2X40A 1SM9A 4RPPA 3NQGA 4DO7A 1FFRA 1VBRA 4BWLC 3GVRA 1OD0A 4ZBCA 4WIWA 4EE9A 4F0RA 2A7PA 4JIPA 4LALA 3ARWA 4GYKA 5EPDA 4X22A 4NAFA 3N12A 2Z7KA 1E55A 2WVSA 1XPYA 1GVFA 2E09A 2CLOA 4FNTA 2BHYA 3VX1A 3TDFA 3PC0A 3LTYA 3GKAA 1HP5A 4EPEC 3W25A 4W7WA 4P7NA 4C6BA 3KVKA 1XM3A 5CJ5A 1XLEA 4TQTA 5MKGA 3MSYA 1B3OA 3APYA 3ARTA 3N9KA 4LAZA 4D1JA 3K8MA 5ABFA 1GOXA 1UR4A 3M5ZA 2X7VA 4LUTA 2QCCA 4UZUA 4CQBA 3OO2A 4REQB 1R9ZA 1XDLA 3DG3A 3UQNA 4C90A 2GL5A 4ZE5A 1G0CA 3PB2A 2PC8A 5CLTA 3MZNA 1ZUAX 3C56A 5HR7A 4B2DD 3RPDA 4XTIA 4JY9A 5FJPA 4JPGA 2IPGA 4MLRA 5AN7A 1VENA 3LNMA 2R24A 2J9ZA 4U28A 1JCTA 3N29A 1UOZA 5JH2A 1G6CA 4QNWA 1QFEA 2NWSA 2UY3A 3W7KA 5HAOA 2QLYA 1IEQA 2OR2A 1EA9C 4NU7A 4AUBA 4RK8A 3RX3A 3RK8A 3I3DA 2FJUB 2WOQA 5A2CA 5CGMA 1TJPA 2PGWA 4AHPA 1E1FA 3AXMA 3ITTA 1OIMA 3VKKA 1FH9A 4XK2A 3H53A 4PULA 4H8HA 1OF8A 5J5DA 1Q6GA 1AQFA 4IM4A 3SIMA 1J0ZA 1W5QA 4B3LA 4O0KA 2GSHA 5HQEA 1U1JA 3H2MA 3TYEA 1TUFA 2PE4A 3N17A 2FYMA 3CUXA 4WDXA 1KXQA 4HTBA 3SZ8A 3T0BA 3W7EA 1HN1A 1G69A 1BHGA 1EP2A 1BF2A 1DWJM 1W1YA 4JEJA 1RUSA 3HPZA 1E3XA 3VZZA 4FXJA 4XD4A 4JHMA 1KBKA 2PBGA 1P0KA 2YR1A 2F8QA 1W3JA 4GUIA 4KETA 1H51A 3S47A 2BX7A 2H9AB 3HFYA 5LNUA 3SY1A 1TB3A 3FS2A 2GGHA 5KTLA 4NKCA 1EXPA 1EC9A 3E2SA 5G4WA 4Q8QA 3T0DA 4CD7A 3URNA 1TFVA 2D3LA 1MRAA 1S5MA 1XP3A 4WF7A 1DEDA 1K02A 4TV6A 3SCRA 2D23A 1SW3A 3WENA 2GDVA 1JZ6A 5KZDA 5LNWA 3KWSA 2E8YA 4AFYA 1R3SA 4ZB2A 5LYRA 4PB5A 2E9LA 4PCTA 2CCRA 3ZJ6A 4HCHA 4QLKA 5M03A 1GJUA 2NWRA 3W7HA 2UBPC 1YDOA 3TWBA 3JUGA 2FLIA 2CBIA 5EMJA 1KC7A 4JTGA 1UD2A 2YKKA 4V33A 3VNYA 2VFIA 5C8BB 2QGYA 1N8FA 1LRQA 1JPHA 4J1OA 1VFHA 3N18A 5I78A 1B3WA 3NQMA 3EDEA 1C8VA 4ZQMA 2E25A 1Q8JA 2E5CA 3L2MA 2YA1A 3CZJA 2VCCA 1Y5XA 5AHMA 3PTDA 5FEZA 3MW7A 4JTLA 4LS0A 2QUUA 1OYBA 3LCFA 1QK0A 1K9TA 3UG8A 4EF8A 2ZZ4A 1FHDA 2YDAA 2FVLA 4PCSA 4X2RA 4HU4A 3WQ5A 2ABBA 2CLLA 3TA6A 1DORA 2V8ZA 2PDCA 3RM4A 4O17A 1V93A 2D3NA 3CUHA 3DDMA 4ZQPA 3H22A 1XI3A 2AL2A 1ISZA 1PO9A 1A3WA 1A5LC 2Q8LA 2WJZA 2PAJA 1KKRA 4J3VA 1HJVA 4LH8A 1JI1A 1NH6A 1JDAA 1KGXA 4IP4A 1AJ0A 3ITLA 2H8XA 3VOJA 4F0MA 2XVLA 1XLKA 4PRWA 1M6JA 1MVYA 1SZFA 1SJCA 4W8AA 1VBGA 2P1FA 1IEIA 4D6FA 1ZJHA 3T7VA 4DBDA 2YB4A 3AQUA 3OW1A 1DJXA 2YCJA 3I65A 1RBLA 1OZMA 4I3GA 3W7NA 3LXAA 1H1ZA 2A4AA 1X6UA 2EPHA 4TXEA 2DZWA 1XYCA 3XISA 3RPMA 3WDRA 1GTEA 3EEZA 2NT1A 4HNNA 3W1QA 2JIEA 2ATSA 4H9UA 1Y8BA 2J88A 3RCMA 2XFWA 3DBNA 1VBJA 4LTSA 1TJ1A 3EEGA 4AVOA 3DIPA 1BVZA 1RALA 3HQ1A 3IVTA 5D04C 4XAZA 3VDGA 3TK7A 1GQJA 1P5BA 2PRMA 4ZOAA 1OFRA 2AOSA 3W7CA 3QC0A 3W2NA 4IP5A 4S23A 4C60A 3Q4DA 5XINA 4US5D 3E74A 1R8LA 2OTDA 3LHUA 1FXQA 3I6RA 3IACA 4Z2KA 3GX9A 1XSJA 4HOZA 1Z8AA 3MKKA 1T41A 2BVYA 1EL3A 4RZ5A 4WRHA 4XG1A 4FB7A 4FMVA 2DSWA 1K8YA 4YYCA 4MAZA 1ITUA 2RJGA 4JTAA 3WY1A 3MBDA 2V5CA 1AH3A 1ZTVA 1KGWA 3M41A 4IFKA 1XDMA 1X1ZA 3C61A 2WMIB 3R2GA 5BCAA 3ARVA 5H8MA 3GH4A 3OZPA 1KWGA 3CQ0A 3E0LA 3ARYA 4J5NA 1S5TA 3UJEA 2HBVA 1OQFA 2QF8A 5DMNA 1UD3A 1GOMA 5DBUA 2WKLA 1K8ZA 3KBJA 4OBTA 4MKSA 2PDPA 5HMEA 3BW2A 2QVHA 3CZLA 4DO5A 1TIMA 5DXYA 2GVGA 4B2DA 3PG8A 3OJGA 1BF6A 1IE7C 3BQ5A 5T26A 1QHPA 4WR3A 4Y9PA 4DJED 3SUTA 1M7PA 3AYRA 3O05A 1P6WA 5EMLA 4UUIA 1EP3A 1VEPA 3MCOA 4A2SA 1TMLA 2V5KA 3PJTA 3L4ZA 5H1WA 2FDMA 3T55A 3S9ZA 2FDSA 3CEPA 1WZMA 1NDZA 3ONCA 2OMAA 3T2OA 1J10A 1W0MA 4UQCA 1QNSA 3KZPA 2R9RA 3CAVA 3JU2A 3AXHA 1B9ZA 4BI6A 4GQGA 2V6AA 4WXYA 2UV8G 1QW8A 3IJLA 3WH5A 2JKPA 3ABSA 1E5JA 3K30A 4OV4A 1QDSA 1R86A 2QAFA 1A80A 1IHIA 1QBAA 2OSXA 3NIYA 2WVVB 1BYAA 4QS5A 3G2GA 3ABOA 3OZMA 3UETA 4M5PA 1ITXA 4M24A 3WLOA 1W5NA 1UKSA 2C1GA 1TCMA 4AXNA 3HM7A 3QZ6A 4GX9A 1XQLA 1JYNA 1XX1A 3THAA 1E6NA 4JDYA 2EJ1A 4YVXA 4DWSB 2DZUA 1TSIA 1YBQA 1JG9A 2PDLA 3T40A 3UR5A 4M81A 3RNDA 3B8VA 2ALRA 3CAWA