2A7RA

Crystal structure of human guanosine monophosphate reductase 2 (gmpr2)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
338
Chain Sequence
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GMP reductase 2
publication title Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a7rA00
3OG3A 3RK8A 1G4EA 4JGDA 4BR1A 4HNNA 1CW2A 4JTFA 3PSVA 3W7CA 3UPWA 3K30A 1QPNA 4IOTA 3S5OA 1QOQA 1ICPA 3NQFA 2V2CA 3FEMA 3QF0A 5G2WA 2H3DA 2ZRXA 1F5ZA 4JYFA 4QNWA 3M41A 1CI1A 3BVJA 3UWZA 3RU6A 3BLIA 1W37A 4Z08A 3EWUA 4XTIA 5LGZA 1RQBA 3G3DA 3HGRA 1G4PA 2ABBA 2Y6ZA 1GVQA 4FX8A 3GAYA 3LTPA 2DP3A 3HOJA 4CQ8A 1R47A 4JTJA 4JDBA 5AC6A 1FWTA 5G5IA 4H4IA 3S6DA 5FEPA 3WJSA 1IIGA 1UUMA 2A1YA 4IMFA 1HFBA 3BV4A 4ZQPA 4DELA 2QCHA 2P1FA 3NO5A 4E2DA 1JCNA 3SI9A 3S8HA 3HG3A 3UZJA 3NQMA 1SFJA 2TMDA 1N7KA 3ZFHA 4BWLC 3NM1A 2H90A 3W2NA 2BTMA 1WAUA 3W1NA 3HIJA 2GJLA 3JRKA 2A21A 4HPJA 2CWNA 4EF9A 1TV5A 3JR2A 3ZWTA 3HB9A 4YL2A 2Q8ZA 3P62A 4O14A 4M6QA 4IPIA 2JGYA 2FB2A 1PIIA 3LHVA 2VC6A 1AL7A 2OX1A 3ELFA 4Q4KA 3GLCA 5DELA 2ZRZA 4KFPA 2GQAA 3IIOA 4MYXA 3LXCA 2BX7A 4MFEA 4MY8A 4UFIA 4CCDA 5C2XA 4PCFA 3QM3A 1Q3NA 4BK9A 3QW4B 1OFPA 2FPYA 1T99A 2O7SA 4WXYA 3OIXA 4Y9AA 3MP5A 1JUBA 3TX9A 5E1QA 4RKAA 3WK3A 1J5TA 5FF4A 2YW4A 2J27A 2B7OA 1JR1A 1Z42A 1LDCA 1TV7A 3GDMA 2ISWA 4JTEA 3EWXA 1FXQA 5DY2A 5AHIA 5D2WA 2ZTKA 3BARA 3TQVA 1PHQA 4HSOA 1WV2A 3P74A 3QSRA 5LNUA 1C8VA 3M43A 2B0MA 3GYEA 2VEMA 2ZRYA 1LORA 1LTDA 4FNRA 4UMCA 3W1QA 4M6PA 3TROA 3P81A 3WK1A 2ABAA 4FO4A 2EHHA 3M9YA 4O19A 3ABQA 4O4WA 1WQ5A 2BSLA 1L9WA 3BGJA 4WD0A 3UNDA 5C6MA 4HN4A 1AW2A 4JTIA 4RCXA 3WJZA 4IXHA 1FXPA 5D33A 1NF0A 3BLFA 2VXNA 1QO5A 3BLEA 5L6UA 1FCBA 1XBZA 3SR7A 4O1AA 3DFPA 2Y89A 2YYUA 1KA9F 4MIMA 3W71A 1T96A 3ANYA 1LCOA 4PL2A 3T55A 3SECA 3W1MA 2ZCGA 1A5CA 4BI7A 2CLHA 4GUJA 4MKNA 3G8RA 3OVQA 3STEA 1F6KA 3KAOA 3IGUA 4NXKA 2A4AA 1YDOA 3GKFA 3NPXA 2QDGA 1FY6A 3MI2A 4YCPA 1M6JA 1ZHAA 1GOXA 3LCFA 3RF9A 3KVJA 1JRCA 1XBYA 4Q32A 3F1QA 2V8ZA 4JX6A 4UIOA 1FWSA 4ONVA 2WSYA 3W07A 4QJ1A 1SO6A 3PB2A 1VCFA 2CZDA 4QSHA 3SGUA 5HR7A 3GDRA 1AK5A 4JTGA 5DBUA 1H50A 4Z0JA 2E09A 3EWZA 1JUKA 1JCJA 3O6DA 3N14A 2X1RA 3DGRA 3NQCA 5ABTA 2NUWA 1ZCOA 4NX5A 3W9ZA 1GT8A 1K7FA 1F74A 1W3NA 1LLZA 3NZ1A 4O53A 3I7QA 5C54A 1OX4A 1G4TA 1KM2A 5KITA 1OK6A 3C61A 1KBIA 1F6PA 4I9AA 1VYSX 3W7GA 3W7JA 3S1XA 4CCCA 1PVNA 1KFBA 2Y63A 5F1VA 4NVTA 3DH7A 1P4CA 2VFDA 3NR0A 1SZEA 3N9SA 3VCRA 1XCFA 1IXQA 2V2HA 6TIMA 1ME9A 1WBJA 2PC4A 2V30A 4TR9A 3TW6A 1I2PA 4X3ZA 4IMGA 2ISSA 2VFFA 1H60A 5I3IA 4O10A 5MHBA 3W84A 3C2EA 1GEQA 2GJNA 4EWND 2G95A 2JKPA 4Z1AA 3STGA 3A22A 4QAIA 3W7OA 1LRTA 4FXSA 3TV8A 2QJIA 3LHZA 5FI8A 2VFGA 1XDLA 5BNKA 4IX0A 1OABA 5FF7A 2ALDA 3ATYA 4QISA 5AHMA 1J4EA 2NV2A 1TSIA 4S1FA 4C1LA 2NXGA 2V5BA 2FB3A 3M16A 4DO6A 4GUFA 1R2TA 1Z48A 1YTEA 3TMLA 3M47A 3NQ8A 1H62A 4O4VA 1GWJA 5AYXA 1VZWA 1O5KA 2QUTA 3N9RA 1XBXA 3SZ8A 1B4EA 1GVOA 3V1PA 5K9DA 1LOQA 1DV7A 3DKLA 4WJEA 2P0OA 3LTYA 3H54A 1FWWA 2DZVA 3EWBX 1YLVA 3UPBA 3E02A 1OX6A 4WQ6A 4AWUA 1KV8A 4OV4A 1ADOA 1OVDA 4GC4A 3CC1A 3WJXA 4LVDA 5DN1A 4NX0A 1LRQA 3UQNA 3ABOA 3UWQA 1ZFJA 2J9YA 1JCMP 1OFAA 1VQTA 5CSSA 2VENA 1ICSA 5DCDA 3TSBA 1B4KA 2RH9A 4WX2A 3TC7A 3TUUA 1W8SA 1HG3A 1EWEA 3PBWA 1W0MA 4JYEA 2J24A 1R2SA 4YWIA 5LSMA 4ZL1A 3MW7A 4FF7A 1QO2A 3W1PA 1L6WA 4CNOA 3P8JA 5BRBA 5D30A 1X1OA 2Z0IA 1NF7A 1OJXA 4O8RA 3T44A 2A85A 4UTKA 1ALDA 3P8IA 3V75A 5H2ZA 4J9JA 1A5SA 4MZYA 2VEKA 1FUYA 3MBFA 2PRHA 1SZGA 1GYLA 1FWNA 4KFOA 5D05A 3LCHA 3M7WA 3QRHA 3A23A 3TSDA 4K8HA 4FNSA 1XUZA 2RKXA 1W5QA 2NX9A 3P5ZA 2BLEA 4O18A 2VEIA 1DQXA 1S5WA 3RLVA 3UWWA 3CU2A 1D3GA 1LYXA 2DZXA 3I7RA 1GJPA 5DY3A 3DFNA 1K8ZA 2HMCA 3UZ5A 2QCDA 3S1VA 3STCA 2FPTA 4ZMGA 1KLZA 1THFD 1V7YA 1BEUA 3FS2A 1R46A 4K37A 4MVAA 3LHYA 4P2VA 3PC0A 3GIYA 3UYCA 4ADTA 4N2YA 3WFAA 4OGZA 1O95A 3T4CA 3LTSA 1NAL1 3MUXA 5AN7A 5I3FA 4LVFA 2TSYA 1FDJA 4UTJA 3FKRA 1P5BA 2CZFA 1TTQA 3IGSA 3QC3A 5DLCA 2ZTJA 5G4WA 5BOOA 3HMJG 1WYIA 4HKPA 1KFCA 1IF2A 2VFHA 3EKZA 4IXXA 3G1FA 2Y62A 3O6YX 1W1ZA 2FJKA 3RMJA 2NXHA 2DZWA 2GVGA 3SIZA 1QR7A 4MZ1A 3OA3A 1G6CA 2V9DA 4NZJA 5LNWA 2XN0A 3Q37A 1TQXA 2NZLA 3L5LA 4MOZA 4DBEA 1QOPA 4JXCA 5D38A 2E6FA 5A8GA 3IGXA 4BI6A 3BW2A 3PG8A 4JX5A 2FQIA 3T40A 4XWUA 3LBCA 1TRIA 1XL9A 1S3HA 4PFMA 3E12A 4AWSA 4X2RA 3IIPA 3P84A 3BK0A 2YPIA 3L0GA 2WPBA 3NPUA 1T8XA 1V5XA 3MHFA 1W3IA 4LC6A 4UTLA 3EWYA 4HPXA 1OYBA 1L2UA 3W7NA 2C6QA 5G1YA 2RHGA 1W56A 4FNUA 2ZZ6A 3B0UX 4UFMA 4HT3A 1I2NA 1G7UA 5I3JA 1OF6A 3CLMA 4JEQA 1NFBA 3KVMA 3FYPA 3AO0A 3R8RA 1TREA 5EL1A 5FF3A 4NZFA 1VYRA 4MY9A 1RQHA 1W31A 1K7EA 5CKSA 4A2RA 1F7BA 3A21A 3LRMA 1O4UA 3C3NA 3C2FA 3R12A 3RFAA 1H7PA 3C0JA 5A5WA 3C2VA 5DCEA 1K03A 3GXPA 2G96A 1WBHA 5EMUA 3CT7A 4ZQOA 1WOAA 2HS6A 2HSAA 1GYNA 4MFDA 3TK7A 3R89A 4UFHA 3FOKA 3W7DA 3NEVA 1SW0A 3R5EA 4IJBA 1QFEA 2C0AA 4LW7A 4RZ4A 5LZLA 1OX4B 3GDKA 1WDWA 1OYCA 2JKAA 4EOUA 3NG3A 3DZ1A 2DZSA 2WJZA 2A7RA 2YX0A 5CSRA 1NVMA 4CLMA 4A2SA 2XN1A 1UJPA 5KZEA 4AVFA 4NJJA 2QJGA 3CHVA 3DFSA 3NL3A 5HNRA 5DXYA 1DJNA 3PUDA 3VNDA 3S5YA 1KM5A 2Y70A 4XZ9A 4KFNA 5E0KA 1RVGA 5AOUA 3EB2A 1OFDA 2ZZ2A 2ZZ1A 1AMKA 2R91A 4DPQA 3W7EA 3PBVA 4RX0A 4IMCA 4ZQNA 3GB6A 2XFWA 2ZA1A 4MYAA 1X1ZA 4UC5A 3TJLA 3G0SA 4RZ6A 2C19A 4K6AA 3NAVA 3LV5A 1N55A 4Z1BA 4JS3A 1IXPA 2JGQA 4HSNA 3F4NA 3L66A 5EY5A 4XBKA 3USBA 3GNDA 2BWGA 2WNNA 3E9AA 4O12A 3GXTA 1RPXA 2QCLA 4O54A 3N73A 2A7PA 5I3HA 3UXDA 3B0VC 1BWKA 2DU2A 1B9BA 3HPXA 4IX2A 2NUXA 2C18A 4R53A 1XKYA 3GNNA 5LKYA 4U28A 4DBDA 3W7MA 4GXMA 5K9CA 4CQ9A 4XQ6A 1ZJIA 3DENA 3TSMA 2TYSA 4LUIA 3W1AA 3DFTA 4N9CA 1QWGA 5CZJA 4A21A 1XUUA 1A50A 3IRDA 2QUVA 2QKFA 1TTPA 2WO5A 3QW3A 3OHIA 4UFKA 5AYZA 1P1XA 4FNTA 2ZFAA 5LNVA 5KZMA 2YZRA 4JIQA 2R8WA 1JQVA 4WY0F 3QQ0A 1VR6A 2J6XA 3W1TA 3W88A 1M5WA 1TPB1 3W1UA 5HWJA 3LLFA 1H7RA 4OWGA 5DXXA 2RDWA 1Q6OA 4O11A 5LHEA 4LT9A 4Y90A 3SY5A 2PRLA 4K38A 3FYOA 4FX6M 4LV9A 3FKKA 3A5VA 4LTSA 4WOZA 3PSWA 2P10A 3ZWSA 4FB7A 1F76A 4O57A 2NV1A 2H3BA 5AC7A 1WA3A 2G5WA 5KMYA 5D03A 3SJ3A 3LB0A 2X30A 5H91A 1RQEA 2C3ZA 2YR1A 1HTIA 3H55A 3W87A 1WX0A 3G1AA 3PY2A 4RJEA 3W2LA 3NA8A 2YFNA 4GUIA 2ATMA 3LGEA 4LS2A 4ORMA 1W5OA 1IXNA 3W2JA 5FF2A 4X22A 3LXAA 2DORA 4RK8A 2HS8A 3DBPA 4FXRA 1RZMA 3LBMA 4ADUA 1LBMA 4XBSA 2W79A 1JCYA 3PBUA 3ZR4A 3B8DA 4WOQA 4LU0A 2QCDB 4KWWA 5D2TA 2WSRA 4IMDA 1BKSA 2QCGA 1QPRA 1UUOA 3MBDA 2BXVA 4LOCA 1ML1A 3KVLA 3CIXA 4ADSA 1KFEA 3B05A 4LC8A 1P0KA 3BW4A 2RDUA 5FF0A 1UCWA 2Z6JA 1GVSA 3LRLA 3S5NA 3W6YA 4EVZA 1GVRA 1RD5A 4O52A 3AJXA 3M5YA 3FA5A 1D3HA 1B57A 1SW7A 2A7NA 3LERA 4I7WA 4UFJA 3P80A 2C13A 5CPLA 3W23A 1W5NA 3W2MA 3TW7A 2WNZA 4FIRA 4M19A 1VRDA 4OE7A 2J88A 1LOSA 5F2IA 4LRTA 4Z0SA 2NX1A 4IPJA 4YLWA 1LZOA 4DF1A 1EIXA 1K8XA 3EX1A 1JQXA 3QH2A 4UNLA 2H8ZA 4TMBA 3IIVA 3DFOA 5F2MA 5F4XA 3DU0A 1NEYA 1UASA 3CM4A 4QNEA 3QSTA 3A9IA 1PV8A 1QAPA 3E49A 5GVJA 4JICA 3UWVA 3CWNA 1GQNA 1TB3A 4WUIA 1A5BA 1KFJA 2X2GA 1G7VA 1NSJA 2ZRUA 3W72A 4PA8A 5TBOA 4E38A 1VJIA 3TCEA 3QZEA 4NQ1A 1C9DA 3GVGA 4R33A 4O28A 4LNYA 1K02A 3UWYA 3TU9A 2J9XA 5CPMA 4AF0A 3ZS4A 1LROA 2QJHA 1EEPA 4Z1DA 3BPWA 4Y8FA 1EPXA 5F1UA 5CZSA 3G1HA 1FX6A 3G1YA 2DJXA 5K9XA 2VFIA 3SSJA 3MI6A 4HNTA 4UUIA 4JY8A 2GQ8A 3QMSA 1S5VA 3THQA 3NDOA 2NUYA 1AW1A 5HJLA 4OV9A 2H8XA 3TAKA 4M6VA 5J5RA 4LS0A 2V81A 4DXVA 1H7XA 1DBTA 2D73A 3L5AA 1TV8A 1EB3A 2G97A 4AMAA 3MP4A 3MI3A 2Z1BA 3W85A 5IBXA 4NXSA 3TNOA 5DBTA 2VOMA 2FTPA 1SZFA 2YCEA 3RNDA 2FFCA 4AXKA 3FIGA 4JR5A 1KTCA 1ZAIA 4UMAA 3QJAA 4OQVA 1EP2A 4QITA 4N02A 3KOFA 1ZAJA 5EA9A 1ONRA 2YXGA 5T26A 4AB4A 1KTNA 3TR2A 3BG5A 2QCMA 3CB8A 3MHGA 1H51A 2ATSA 3MWAA 5K2ZA 2QAPA 1GPWA 1GTEA 2LLEA 4JD4A 3VI2A 1AL8A 2ZZ3A 3ABSA 3GDLA 3RLUA 4N4PA 2W6RA 1H7OA 3F4WA 2E5BA 3WJYA 1W5PA 4GUHA 3OBKA 4NJHA 3HQ1A 2XN2A 1PCKA 3TXVA 2Y61A 1MSSA 3PR2A 3LHWA 5LNRA 2Y85A 2YW3A 1VYPX 2WOQA 2CLFA 4HHPA 4YCOA 2A0NA 2J9ZA 1UB3A 3OEXA 5G4EA 3W75A 4UTIA 3KRZA 4NUWA 4JTSA 3NPWA 3HG4A 4DPPA 5HR6A 4CCEA 1R2RA 1MEHA 5AHNA 2CLKA 1VLIA 3G1VA 3NQ6A 2ZZ5A 2PE4A 1U5JA 1MZHA 2EPHA 3CEPA 1ZALA 3NL5A 2DZPA 4CNNA 3T78A 2QUUA 1JULA 4AHQA 3PS7A 2FIQA 4O0ZA 4MZ8A 4N6FA 4PH6A 2WSQA 4PEKA 5L9FA 5F2GA 1YTDA 1TTJA 5HUOA 1ZAHA 4CNPA 3TDFA 3NPVA 4GE8A 3G18A 4JTUA 4OBTA 5CG7A 1PL9A 3UY7A 2ZZ7A 4DO4A 3IVSA 3D0CA 3NZRA 2EF9A 4I7VA 3QPYA 1SO4A 1MXSA 4IUOA 4O0KA 1KTBA 3P60A 4RXGA 1ZNNA 5BMWA 1LLWA 2W0UA 3EKLA 4JTLA 4QIUA 3MP3A 2QF7A 5FESA 1TMHA 4N9DA 3B03A 2NLIA 2E6DA 1M7PA 3S1UA 3QMRA 4ZQRA 3E0IA 3T7VA 4GNJA 3W70A 4MJZA 3EEGA 2EKCA 5AHEA 3TFXA 1M7OA 2Y7GA 3TIMA 1AW5A 2I9EA 1OX5A 5K3VA 1VLWA 2B4GA 5D04C 3UWUA 4UCGA 1ZY9A 1YYAA 3EXSA 2CZ5A 5TQLA 3KXQA 4IGHA 1IIHA 3THAA 3NOEA 1TRDA 5G2IA 2WQPA 1O5XA 3P5YA 4GFSA 3B4UA 1I45A 1KV5A 3EX4A 1KW1A 1SPQA 4LRSA 2E6YA 1TPC1 3BW3A 3W7PA 5F4WA 1SFLA 3LI0A 3MHUA 3A24A 1VS1A 4JY9A 2VFEA 3LLDA 1SR9A 3F03K 1Q6RA 4DO5A 1VH7A 1XFBA 2Z6IA 4K39A 4ZQMA 2YGYA 5U7SA 3O6CA 4XKYA 1RV8A 3W74A 1G67A 3MJYA 4NJKA 5D2VA 5IM51 1I2RA 4JYDA 3PG9A 1EUNA 3L65A 4UTTA 1SO5A 2Z2UA 3EX6A 3VKJA 4IWWA 5G2HA 1J2WA 2QCEA 3UY8A 1KFLA 3QPZA 3L9CA 2EAWA 3IEBA 5LHFA 5SWUA 1OF8A 1DVJA 5HQEA 3W73A 3A5FA 3WK2A 4AHPA 1LOLA 5LGXA 2C15A 4MJMA 1YPIA 3KVKA 2DJLA 3TA6A 2H6RA 3TFCA 5C5YA 2QR6A 1S5TA 3NNTA 5HINA 1FCQA 4N6EA 1QDSA 1MO0A 2IQTA 2FLIA 2JK2A 2V0TA 3O06A 3KFTA 2CLEA 3G1DA 2AAMA 3UD6A 1L6SA 1MEIA 3NQAA 4LVAA 3LCLA 1HL2A 1VGAA 4OHQA 4K8EA 3EXTA 2GVLA 2JBMA 4WY0B 3VE7A 4XTDA 5D2XA 1X6UA 1VPXA 1H7NA 4OT7A 1LBLA 3KX6A 4ZZ9A 3PULA 3LDVA 1ZENA 1Y0EA 3DHDA 3C2OA 4GJ1A 4LWWA 4FNQA 1A53A 1C29A 3L68A 4TMCA 1TJRA 4O16A 3NQ2A 3BO9A 1ME8A 1I2QA 2DZUA 4XUGA 2ZRVA 3R2GA 1XI3A 3TE9A 2CLIA 3PBYA 4BF9A 1G69A 5U4NA 3BG3A 2X1SA 1YXDA 4MUZA 3GK0A 1TCDA 3G0XA 1DJQA 3DI1A 1VHNA 2NX3A 3TXZA 3TQKA 2E5CA 3L5MA 1TPFA 1SO3A 6ALDA 1XDMA 4AF0B 3O63A 1EP1A 2QDHA 5D37A 2TPSA 3M5VA 4NT0A 4MY1A 4TU1A 3MO7A 3O07A 4BWLA 3L0NA 3SGZA 3KRSA 3I6RA 1VCGA 3LXBA 2GVJA 3NL2A 4JTKA 4M7TA 3Q94A 2FPVA 3NXFA 3DKJA 2UV8G 3B06A 5AYYA 1YTKA 5D2YA 1WXJA 1H7WA 1OFEA 2OT0A 3B0PA 2NWSA 1R30A 1FCUA 4Y6GA 1BWLA 1OG0A 4GBUA 2OCZA 4FIQA 3IVTA 1VHCA 1OFBA 2YSWA 3W7IA 2B7PA 3R13A 2I14A 1D9EA 1QPOA 5CPNA 3HJZA 2ZZ4A 4U4MA 3W7HA 1PE1A 1YXYA 1TYGA 3YPIA 3L2IA 4UMBA 2VEPA 3IIXA 3PM6A 4LUJA 4MPQA 1QCWA 2PRMA 3W7RA 4H3DA 2WV8A 2QEZA 1FCVA 1FDZA 1TPVA 4WXZA 2VELA 4KKXA 1B3OA 1W54A 3QQ1A 2CLLA 5EKYA 4POCA 1EA0A 2OZ0A 1VCVA 3NGJA 4Q33A 3O8AA 5C55A 3M5ZA 3C6CA 5EBUA 3IVUA 3M44A 3NYZA 1W5MA 3CEUA 3S5ZA 1GG0A 1OFRA 4NJGA 3W7KA 4O50A 4LV4A 4AHOA 3SFKA 1U83A 4W9TA 4JN6A 1O60A 4UNKA 4N9BA 1TPWA 4UTWA 5D32A 4R34A 3MYOA 4LVBA 1EWDA 3HO8A 1XC4A 2A5HA 4RV8A 3LHUA 1DKWA 1I2OA 3GX9A 3DAQA 4OU1A 4EIVA 4H6KA 1KM1A 1PHWA 3M6YA 1SZNA 1JJKA 3C4UA 3G3MA 5FEWA 4C1KA 3O16A 2Q3OA 3G1SA 2ZBTA 3O05A 1BTMA 3HBLA 3GR8A 4UTWC 4HNUA 1O94A 3CTLA 3NM3A 1TTIA 3E96A 3I68A 3NVTA 1HUVA 5TIMA 3LOTA 4O13A 4YMZA 1TPDA 5FEZA 3NL6A 3DHFA 1GG1A 2GPTA 3HGOA 1OYAA 4UXDA 3LV6A 4RZ5A 4NU7A 3P82A 1GVFA 2I1OA 5K4XA 5DCBA 1DHPA 2CLOA 2ZDRA 4PL1A 1ME7A 3N34A 4UR7A 3C8FA 5E93A 4ZQCA 3TC6A 4QM1A 1X8FA 3M1ZA 4DF0A 2PURA 2CLMA 4ZVJA 1KM4A 4JTHA 2CU0A 2GOUA 3LX9A 3W2UA 1X7FA 1G4SA 3W1RA 4LY8A 5I3GA 4P61A 3O15A 1Q6LA 2ZYFA 4AEOA 5KZDA 1FDYA 3S42A 4UFLA 3W1LA 2X1TA 5F2LA 2X16A 3NQ7A 3W7QA 3OVRA 2PCQA 3P67A 3LCXA 4WY0A 2WKJA 3FJ6A 7TIMA 4JNMA 3Q58A 2ZA2A 3U2OA 3CQ0A 2E68A 4FHAA 3GAKA 2JKEA 4O17A 4FNPA 1H5YA 2YYTA 4XKYB 4RLIA 3B04A 3TAOA 3TMQA 3STFA 3G8EA 3FLUA 3LCIA 2YDAA 4A3UA 1WOBA 3PWAA 1F05A 1FBAA 4K7VA 4A22A 3C56A 2VKZG 4JDYA 4EF8A 3Q2DA 3U6WA 2OJPA 3HGSA 3P61A 3CWOX 1DL3A 4UTHA 2Y7FA 1JCLA 2ZA3A 1K8YA 5LNSA 2F7FA 3VE9A 1KM0A 3SW6A 3IV3A 4LVGA 4GUGA 1H1YA 2ZQ0A 3QEZA 4WZHA 3N3MA 5KINA 4PODA 3HG5A 1UBSA 1LM1A 1TJPA 2C1HA 2Q3RA 4ICNA 3HPSA 5J5DA 3TQ0A 1E51A 3PF3A 1FQ0A 1HO1A 3EX2A 3WJWA 4MLRA 2DZTA 2Y7EA 3PUEA 1TPUA 1OK4A 1Z41A 3EXRA 4FEZA 3U8GA 3I7SA 3I65A 4NNAA 3LCWA 4DQWA 4M7SA 2HTMA 1TO3A 2RFGA 3DFQA 3MMTA 3S9YA 5G1TA 2R94A 5KTLA 5HWNA 2GUUA 1CX9A 2R14A 1OFOA 1Q45A 3O1NA 4I7UA 4Z1CA 5KSWA 5AHLA 5D09A 3HG2A 5EYWA 1JUEA 1VC4A 2CFFA 4K7YA 1TQJA 4UTUA 2OT1A 5IBXC 2A2IA 4JIPA 1K3UA 1MEWA 4ORIA 1FWRA 1EUAA 3NQGA 3P7YA 2FDSA 4B5NA 3VFLA 1XBVA 2E77A 3CIWA 1KM3A 5D02A 3HF3A 4DF2A 3G0UA 1Q6QA 4BFAA 2E5DA 3NQVA 5K4ZA 1QNVA 3LRKA 1H63A 3W83A 4UTMA 4D2JA 1JCXA 2NWRA 4O15A 3S1WA 1Z44A 2CW6A 4AAJA 1DQWA 3FFSA 4PTNA 1L6YA 1QMLA 1TPH1 3N2XA 2C14A 2BZNA 3GKAA 5EPDA 3W7LA 4DEFA 3EWWA 2NXIA 4O1DA 2AGKA 4JX4A 4BI5A 3DI0A 3KHJA 8TIMA 1IXOA 3QFEA 1PS9A 3PAJA 2A6NA 3QMTA 3HGJA 2E1DA 2KZHA 5CPOA 2QCCA 5HMSA 3GZ3A 1IGSA 2Y88A 1SUXA 4UR8A 4MLJA 4S2BA 5CGQA 2Q8LA 1SQ7A 3ATZA 4IQLA 1F2JA 4PC8A 4X9SA 3KRUA 3TJXA 3N2MA 5HUPA 1LRNA 1YPFA 1SU5A 2F84A 2B7NA 4LS1A 1YDVA 4E2BA 1PCWA 1JVNA 5CZ0A 2ISVA 4N9EA 3W3OA 4HNVA 3W22A 1LBFA 1AG1O 1EX5A 5CZTA 2C16A 3LM7A 2V5LA 1KM6A 3OVPA 4L4LA 2X1UA 1K7XA 1YADA 3LI1A 4S2CA 1SSDA 3NQDA 2AQWA 3PVFA 3GDTA 3EX3A 3CPRA 4L4MA 5AHFA 3JS3A 2GQ9A 4ML9A 1H61A 3M5XA 3PB0A 1DORA 3L67A 1XXXA 1RR2A 3WK0A 2QAFA 3W1XA 3LHTA 4TO8A 3LCGA 3GXNA 3HPZA 1OFQA 4G1KA 1GZGA 4Y96A 2TRSA 2V2DA 4RXFA 3W76A 3C2RA 3NQEA 5AFDA 1LP6A 1OHLA 3BGGA 3G1XA 5HWMA 1KLYA 2O7QA 4AWTA 1SW3A 3QYQA 4N4QA 4O1BA 1XM3A 1N8FA 4FX7A 2CZEA 2YFOA 3TH6A 1A5AA 1DOSA 3UXAA 2RDTA 4M5PA 1TIMA 3G22A 3S0CA 4RR4A 1TPEA 3DXIA 2ZRWA 1W3TA 5BMXA 3N19B 5I3KA 1HO4A 5K7JA 4NJIA 4AH7A 2QCFA 3H53A 3TKFA 2OMAA 4IMEA 4TX9A 3C52A 1QPQA 3GR7A 1YXCA 1JRBA 1SSGA 3L0KA 4YXGA 2E6AA 5AB3A 1EP3A 3FJLA 4R7JA 3BG9A 2A6LA 3M0ZA 1T0OA 1P0NA 3MYPA 4JTTA 4QQ3A 1KBJA 4E0CA 5AC8A 2EGZA 1I8JA 4NNCA 2QCNA 3L21A 1F73A 1H1ZA 4UTTC 4K36A 4GWEA 3G24A 2B7QA 4O1CA 3IIZA 3INPA 1YDNA 1I4NA 3W2KA 3PUOA 1GTHA 4NNBA 2Y7DA 4CQAA 4GRSA 4ALDA 1KFKA 4KWVA 4HIBA 1ICQA 2WNQA 5BW6A 5HULA 5FEXA 4A29A 3W86A 3ABRA 5F4SA 2V82A 4TIMA
chains in the Genus database with same CATH superfamily
4GCAA 6XIMA 1G4EA 2ZXAA 3FJ4A 3IAQA 4JGDA 4LYQA 3W7CA 3UPWA 3R25A 3VPLA 1QPNA 3PPHA 2WZMA 3VIIA 1EPVA 3DG3A 2V2CA 1P0BA 5G2WA 4YPJA 4JTAA 2GUBA 2WWDA 3BVJA 4IH3A 1FWDC 1PX4A 5CCZA 5A8MA 3KOXA 4Z08A 3VMOA 4MB1A 2YCJA 4AMCA 3EA2A 3Q67A 4LPCA 1G4PA 2ABBA 2PD9A 4FX8A 3GS6A 3ID7A 5A69A 2DP3A 4CQ8A 2PDGA 2EPKX 1CEOA 4FPSA 3WH5A 1Z9AA 1IIGA 4B5VA 1HFBA 3BV4A 1EH9A 3A3HA 3OODA 1R3WA 3ARXA 4D6DA 3C8NA 3SI9A 3TTQA 3S8HA 3UZJA 3OVGA 1SFJA 4OECA 1OCNA 1K1DA 3IS4A 4GKLA 3HIJA 2A21A 4HPJA 1CGYA 4EF9A 1KRMA 4YL2A 4E5TA 1XSJA 3P62A 4O14A 4D9PA 3T0CA 3CK5A 1AL7A 1NIUA 5EMLA 4LB3A 2WXDM 5I09A 4MYXA 4JOMA 4E6MA 3ITXA 4H9MA 4MY8A 1PDYA 5HQMA 5C2XA 3QM3A 3QW4B 2FPYA 1T99A 2O7SA 3OIXA 4Y9AA 3MP5A 1KRAC 1MYRA 4RKAA 5FF4A 2J27A 3GDMA 1B1YA 1JZ3A 2ISWA 3V5FA 3EWXA 4HSOA 1WV2A 2BODX 4L65A 3MUIA 3FN9A 4KIRA 3TOPA 1XLBA 3A9BA 2WM0A 2ZRYA 8XIAA 2BGNE 3T2OA 2V5KA 4DXXA 1LTDA 3DCPA 4FNRA 3TROA 1XR2A 1RAKA 5XIAA 4KF1A 1PTGA 3VIJA 1MFVA 1QBBA 3A4WA 3LD5A 1XYFA 3UNDA 3PZOA 2R9RA 5C6MA 4HN4A 3IJQA 4JTIA 4GH1A 4LSBA 2CBJA 1NF0A 2VXNA 2XVPA 4O0QA 1FCBA 4W5ZA 2WMIA 1T96A 3CGTA 2OU4A 1BRLB 1RXOB 4AVNA 2ZCGA 4HYVA 3UG5A 3WQDA 3ITGA 1J96A 1MW0A 3VTRA 5FJTA 4A35A 2ISDA 1V3HA 4NF7A 1O6IA 1HKJA 2QDGA 3H8AA 3URBA 2OZ3A 4US5A 2GOKA 3RF9A 3QV9A 3THUA 1JRCA 4PBGA 2E25A 3CZKA 1DWHM 2V8ZA 4DHGA 4ONVA 1ZB5A 1LQ0A 4PN2A 3ZLHA 3PZNA 3G2GA 4YN5A 5HR7A 3DG6A 4PUNA 1BQGA 1KKRA 5DBUA 2ODOA 4Z0JA 1HJXA 1JCJA 1RBAA 3DGRA 2PWUA 2VR4A 1DPMA 3WIJA 4NX5A 1GT8A 4L56A 2FYMA 4H7ZA 4GI8A 1W2PA 2YLLA 1XG3A 2BVYA 3W7GA 1J0ZA 2WMFA 2Y63A 3LENA 4XZBA 4WCJA 2OWCA 2WVSA 1OD8A 3DH7A 4K1WA 1OC6A 3NR0A 1RUSA 4F9JA 3T2PA 3VCRA 1XCFA 1IXQA 4TR9A 1DXEA 3T8LA 4X3ZA 8RUCA 3QV7A 3EMZA 1H60A 5I3IA 4O10A 4M3PA 1GEQA 4HK5A 3GUGA 2JKPA 3N9KA 4KRZA 3W7OA 2QJIA 3LK6A 4PUWA 1OABA 2NVAA 1PTDA 4QISA 1E72M 2H9AB 3B8IA 1J4EA 3TYUA 1EQPA 3PFRA 3CO4A 3UZZA 2NXGA 2V5BA 4LUSB 4PMYA 4CCZA 4CU8A 3M0LA 4AD3A 1ISYA 1VZWA 2ZVIA 3SZ8A 4C6MA 5E5CA 4CD4A 4XD6A 3V1PA 3N04A 3K2GA 3WKZA 4WJEA 1TFVA 2OYLA 1R7OA 3II1A 4BS0A 3UPBA 1KV8A 4OV4A 1OVDA 3OG2A 1TV4A 4GVHA 3UQNA 3ABOA 1OFAA 5CSSA 2VENA 1ICSA 3TSBA 2RH9A 5IXEA 1CECA 4GG9A 2R1KA 4MHBA 3IACA 4G6CA 2J24A 1R2SA 1UKTA 1CGUA 4C7GA 1P6WA 3W1PA 4TXEA 4CVWA 1UZHA 5D30A 1A49A 5HQLA 4NAEB 3ITLA 2A85A 1QHPA 4HMEA 3V18A 4P7LA 3CB3A 3V75A 4J9JA 7A3HA 2WW5A 1Q6GA 4LAOA 2PRHA 5A8OA 1ISZA 5HMEA 4H9YA 4JQ3A 4L6DA 4K8HA 4C5YA 3WF0A 1XSKA 3N6HA 3P5ZA 4PR4A 2XUCA 2VEIA 3I3DA 4TUFA 1V0LA 2WMHA 1V6WA 2DSZA 1W91A 3LGGA 3LPFA 3ZJKA 4HMDA 1D3GA 4I6KA 4A4AA 5FCZA 1AJ0A 1XIDA 4HGXA 5AZ1A 2R1PA 1QBAA 2FPTA 2VZVA 4HOZA 4ZMGA 1THFD 1XYZA 2FMNA 4MWAC 5BXSA 4CNUA 1R46A 3EOLA 3W26A 3LHYA 4Q8UA 3VKCA 4M80A 1UR3M 3CHEA 1E3ZA 3LYEA 2AQOA 3VGFA 1O95A 3T4CA 3LTSA 1BSIA 4LVFA 2TSYA 4UTJA 3BMXA 1P5BA 2CZFA 2ZTJA 2RJHA 5G4WA 5BOOA 1WYIA 3EKZA 4EAYA 3G1FA 3O6YX 1JIBA 4M51A 3OA3A 2YB4A 4QGCA 4UQ9A 1W9UA 3HFTA 4WGXA 3VIMA 2GGGA 2NZLA 4DBEA 2IUZA 4GNVA 4JXCA 4KWUA 5A8GA 2VZTA 3IJDA 4BI6A 1Q2RA 4XWUA 1TRIA 1S3HA 4GYPC 2REQA 1FA2A 2QVHA 3BK0A 2WMIB 1XPYA 1T8XA 4YU1A 3IRSA 3MHFA 2XTKA 4UQAA 1W3IA 2OB3A 4UTLA 2PTWA 1L2UA 1E3XA 3M0IA 5HJYA 2RHGA 1EX1A 4UFMA 1AFSA 1I2NA 1M9HA 1G7UA 3CLMA 5I77A 3GH4A 4G2DA 3R0KA 3TYDA 1EGVA 2INEA 4BZYA 2D2GA 1WKFA 4MY9A 4JFUA 3LN3A 4ZO8A 1E43A 3DDMA 1JG9A 3TN5A 4RV3A 1RCXB 1E5NA 2Z2AA 1RA5A 4YHGA 3RFAA 3R12A 3ARRA 1H7PA 3C0JA 4GH3A 1QNOA 3C2VA 1V4YA 1K03A 2E3ZA 1WOAA 4BHYA 2HEJA 2HS6A 1GYNA 3EDFA 3VOJA 1EHNA 4LW7A 4D6EA 4RZ4A 3MUY1 2DT3A 4HU4A 4EWJA 1Q6CA 3DZ1A 1M3UA 2WLZA 2WJZA 2FGLA 4PMZA 4ZOEA 5CSRA 3IJ9A 4DBSA 1Q4NX 1GVYA 2P53A 3N4EA 4A2SA 3TP4A 1UJPA 4XIMA 2ZX7A 3SN4A 2QJGA 5HNRA 1UR0A 1H0IA 5E09A 3VIFA 1DJNA 4J3SA 2O4QA 3RXZA 4E2OA 5E0KA 1RVGA 3EB2A 4QE4A 2XGIA 2ZZ2A 5I2UA 2R91A 2PDIA 4H9ZA 4DPQA 3W7EA 3OJGA 3ZYZA 3UJRA 3KBWA 3NFUA 4UC5A 4F2BA 2GVYA 4RZ6A 3H12A 3LV5A 1N55A 4O8AA 4HSNA 1KCKA 3F4NA 3L66A 2OX4A 3R7MA 2QCLA 1F61A 4X9YA 3THCA 2A7PA 2Z7GA 3PZTA 2DU2A 1B9BA 1NWSA 3CAKA 3HPXA 4ZGYA 4S3GA 5TAOA 2QMKA 4AX7A 4F0LA 3POHA 4KIEA 1ZJIA 3DENA 5T91A 2TYSA 4GACA 3DFTA 4N9CA 3B4YA 4C6DA 3TR9A 1A50A 3IRDA 1AQ0A 5H8MA 2WO5A 4PB4A 3AZRA 4JBRA 3QQWA 3OHIA 3EDJA 3R43A 4FNTA 2ZFAA 3WDHA 4JIQA 2R8WA 4C6KA 3QQ0A 3W1TA 3QPEA 1M5WA 1TPB1 5HWJA 2W5FA 4OWGA 4G9PA 1D7KA 4O11A 2J75A 3Q65A 3UCQA 1HF6A 3FYOA 4FX6M 4LV9A 5C70A 3PSWA 2A3AA 3CAVA 1BD0A 2QGHA 4EPBC 4RNIA 4NG3A 3VNIA 1EF3A 1HN1A 1GOWA 1WXZA 3SJ3A 3LB0A 2WQDA 3WQOA 1SGJA 3G5EA 3G1AA 2NVDA 1S2VA 2YFNA 4QSFA 2ATMA 3LGEA 3S2NA 3GO2A 4LX4A 1IXNA 5DT7A 4HZMA 1PEZA 3LXAA 4U2ZA 2V69A 2QYGA 3U48A 3WBWA 4XBSA 3PBUA 4Q8TA 3ZR4A 3B8DA 1QNPA 1ZUAX 2OWWA 4DWSD 4KWWA 5B7ZA 5MKGB 2Y2WA 2QCGA 1F8MA 1U1JA 3CXOA 1ML1A 5J8LA 3KVLA 1B0IA 4ADSA 1W32A 2PTZA 2INZA 4B3LA 4QE1A 3B05A 1TVNA 5DMNA 3WEOA 2OFJA 3FYYA 3S5NA 3W6YA 1GVRA 3M5YA 1TJ0A 1OGSA 1GNXA 4IFRA 2A7NA 3WQ8A 2ACQA 1L6GA 4UFJA 1CCWB 3W00A 3RR1A 3KL3A 2D23A 2WNZA 1ADSA 3AYVA 2Q02A 4U3CA 1NARA 2NX1A 1KXTA 2Q6ZA 5CC5A 1IEXA 2XPKA 1K8XA 1RD6A 4DJDD 3QH2A 4L6HA 1SFTA 2QGYA 4TMBA 3BJSA 3DFOA 3LA4A 1JYXA 3E2QA 1NEYA 5DMMA 3CM4A 4IQJA 3FSUA 1ZJBA 1QHOA 1PX3A 3A9IA 4JICA 4S3BA 2EG6A 2X2GA 1QRQA 1G7VA 2PF0A 2CZVA 5TBOA 2YDRA 1XLKA 1ZBWA 4NQ1A 4AY8A 4TTGA 1ENUA 2VR5A 2WBKA 1VFUA 4LNYA 1K02A 1A5OC 1N8IA 4AF0A 1OT2A 1LROA 3XIMA 3UVIA 4Y8FA 2AQVA 5F1UA 1LWJA 4IPLA 4XISA 3KBVA 3R0UA 4S3AA 5FIPA 2HQAA 3MCNA 4IL2A 3WD3A 1Z7AA 3MI6A 4UUIA 5E9AA 1PB0A 4JY8A 2GYIA 6ENLA 4JQ2A 3THQA 2VUNA 2NUYA 3ZT5A 5HJLA 1TX2A 3EWDA 1P6CA 4F2UA 1DBTA 4JEJA 2G97A 2Z1BA 3B0YA 2W61A 2VOMA 3B9NA 3NCOA 3UESA 3SUSA 4JFVA 1JNEA 3VVGA 3CYJA 4JR5A 3QJAA 5I7GA 4QITA 4N02A 4J2PA 2HPMA 3KOFA 1WXYA 5EA9A 1ONRA 2RDXA 2YXGA 3UJSA 4CQBA 3QVQA 1NOUA 1V03A 2BOGX 1GORA 4DZAA 2D0HA 1UUQA 3ZVHB 1Q8JA 5IOBA 3G1RA 4AVOA 4AD0A 1XISA 4W8BA 3ABSA 4D8ZA 3RLUA 1UD5A 4N4PA 1H0GA 3F4WA 2E5BA 4GUHA 2J79A 2Y61A 4ICCX 4MKVA 2BB0A 5LNRA 5BOFA 1MW1A 4DJEA 3GNPA 5HNUA 4YCOA 2BVWA 3OEXA 3KRZA 2DVUA 3A47A 3TONA 3HPAA 1ITUA 1Q13A 1R2RA 1E0WA 4MKSA 1VLIA 2VOTA 2ZZ5A 1I75A 1EJWC 1R3SA 3MV11 4GQRA 4YWSA 3T78A 4EPDC 4QEHA 1ECQA 2QUUA 4JKMA 2QULA 4B5TA 4PULA 4NIRA 5HUOA 4FSAA 3G18A 4GQBA 4JTUA 4OBTA 2HBXA 3UY7A 1OGBA 1FWCC 2WYSA 3O7UA 4HJWA 4O0KA 5BZAA 3EKLA 4JHOA 4LYPA 2QF7A 2YCLB 2PDHA 2OVLA 3QMRA 4ZQRA 1EDTA 2GK1A 4KH2A 2PLCA 5AHEA 1PUDA 3TFXA 4JTRA 2Y7GA 2I9EA 4GKTA 4JCMA 4I6VA 1OX5A 5K3VA 4TVUA 2PDLA 1AZ2A 1PBGA 2XM1A 4PBEA 5TQLA 2VJXA 1DIDA 3ARPA 4PZVA 2WQPA 1O5XA 3P5YA 3RR4A 2HV5A 3B4UA 1KV5A 4Q8QA 2RUSA 1TWWA 3EX4A 1KW1A 1SPQA 2E6YA 2Q71A 3UA4A 4S38A 3W7PA 4M56A 1S2AA 1OQFA 4IM4A 1MXDA 1XP3A 3T2QA 3B8VA 4ZODA 1SR9A 3SRDA 3TOYA 5CAKA 1VH7A 4B15A 1XLCA 4FI4A 3T0DA 4ZQMA 4ZOBA 3O6CA 1GHSA 4NJKA 2Q8XA 5FJPA 4JYDA 5E0FA 3PG9A 1EUNA 3MZNA 1SO5A 3EX6A 3VKJA 3FGCA 1J2WA 4E8GA 2D1ZA 1PKMA 3QPZA 4RW3A 3PUGA 3AWNA 2C15A 3A3XA 3KVKA 2HK1A 3VKDA 2H6RA 3TFCA 4K8GA 2QR6A 2D20A 1QK2A 3PJWA 5LIKX 2IQTA 2FLIA 2V0TA 2YB1A 4I9TA 4W4QA 3AS3A 3UD6A 1L6SA 1S38A 4LVAA 3S5SA 2GVLA 1X6UA 2VRKA 1H7NA 3VINA 4K1GA 4JL1A 3KX6A 1Y0EA 1JEZA 1ZP4A 1A53A 1HIZA 1TJRA 4O16A 3WD2A 3NQ2A 3BO9A 1I2QA 4XUGA 1XFCA 1XI3A 2IPGA 4MB5A 5U4NA 4LQ1A 4MUZA 1VEMA 3ONBA 4DY1A 1VHNA 5HATA 1XRTA 1BHGA 4NZ5A 1SO3A 1E4MM 3RGTA 6ALDA 4AF0B 3MSGA 4IL0A 1EP1A 2QDHA 4NT0A 4MY1A 1OC5A 1GKQA 3KRSA 3BWWA 3I6RA 3VOHA 1VCGA 2GVJA 3NL2A 4M7TA 3RX3A 1BTCA 2UV8G 3B06A 1YTKA 5D2YA 1PWMA 1OFEA 1XRFA 3B0PA 3SAZA 1R30A 4AZ5A 1Z6KA 3E3HA 4KEMA 3TJ4A 2OCZA 2YSWA 3W7IA 1LL4A 3AOFA 2WK2A 5JBDA 4Q4QA 3PK7A 1I0DA 3F2CA 1QPOA 2ZZ4A 4IGNA 3W7HA 1PE1A 4F66A 2J78A 4ZA0A 3YPIA 3AC0A 3PM6A 3K13A 4QLLA 4HTBA 1ISXA 2EQDA 1Z69A 4WXZA 4XSMA 3B9EA 4ZSUA 1B3OA 3QQ1A 1G5AA 2QT3A 4ZOCA 5EKYA 5FSDC 1VCVA 1UD4A 3QYSA 3VGHA 3EOOA 3EA3A 1W5MA 3CEUA 3S5ZA 2FVLA 1JPDX 1OFRA 4NJGA 3DBNA 4PMVA 2OLSA 2YL6A 3GIQA 1B30A 1YW1A 2J7GA 2VD8A 2VGBA 4GLEA 3C0SA 4UNKA 2VEGA 4N9BA 4UTWA 2V5DA 4LVBA 3GUWA 1DKWA 5HBFA 1I2OA 3MUCA 1UR9A 1QTWA 1J0JA 3DAQA 4OU1A 3E2VA 3SIMA 4EIVA 1J6PA 5CC6A 2DY3A 1KM1A 2J7DA 3OYZA 3M6YA 1SZNA 3C4UA 3VOGA 1Y7VA 3G1SA 4E4UA 2ZBTA 3APGA 3O05A 3HBLA 1O94A 3I68A 3NVTA 3W82A 1HUVA 1RBLA 4YMZA 1GOKA 2Z1SA 3MB9A 1TE1A 1XGDA 4XB3A 4KCWA 4R3UA 2GPTA 3HGOA 2VQUA 3LV6A 1GQIA 2DQXA 4RZ5A 2QV5A 4L9XA 5ENLA 2ZDRA 4PL1A 1ME7A 4UR7A 4U5KA 4GJIA 4GD0A 5E6YA 3TC6A 4HPHA 4P8XA 3CHFA 4DF0A 2QHAA 2PURA 2CLMA 5AECA 4R5EA 2VX5A 3MMUA 1XWYA 3H2AA 1A3HA 2GOUA 1V3JA 1IEIA 1NWTA 3AYRA 3W1RA 4P61A 3O15A 1MW3A 1Q5MA 4MNMA 1CXIA 3VD5A 3U57A 1X6LA 3W1LA 8CGTA 1XX1A 5F2LA 1S2TA 3NQ7A 3W7QA 3DESA 3KCOA 3OVRA 4XVDA 1X38A 4DXKA 3P67A 4C7DA 4WSKA 3LCXA 1PKLA 2WKJA 3FJ6A 2FH8A 4JNMA 1A47A 3Q58A 5XIMA 2ZA2A 5HPOA 3GHTA 2CXEA 3U2OA 3CQ0A 2E68A 4FHAA 4NI3A 3GAKA 1JPKA 1AMYA 2C91A 5XINA 3G8EA 3FLUA 3KE0A 3LCIA 1GZ1A 4EXQA 3RCMA 1SMDA 4FXJA 4E4PA 3PWAA 1FBAA 1Q7ZA 4R88A 4X0NA 1G1YA 4JDYA 3FGCB 3Q2DA 4E2VA 3P61A 4WIWA 1K8YA 1W8GA 3EWCA 5EMMA 5LNSA 4IP5A 3E0FA 1KQZA 4BJHA 4U33A 3VE9A 3SW6A 4HTYA 2VUYA 4B9ZA 3LSCA 1Y8BA 2ZQ0A 4CNSA 3N3MA 3OO2A 5KINA 1R9ZA 2E9BA 2MNRA 3MUZ1 3PF3A 3URAA 1HO1A 3EX2A 2NSOA 1XQKA 3NJ3A 4FEZA 1TUFA 3PTMA 3I7SA 3I65A 1X98A 4NNAA 3KTXA 3W38A 4DM2A 4M7SA 2E9LA 2A79A 3H7RA 5G1TA 1TJ1A 5KTLA 1CX9A 5I06A 2W9MA 4PTWA 3PPCA 5A8PA 1ONWA 2PC8A 1XC6A 3BSGA 2CFFA 4OOZA 1W3JA 4UTUA 2A2IA 1VFSA 3SUVA 5T9CE 4GGBA 1OM0A 1RJPA 1IYXA 3FXGA 4LANA 3VFLA 3GQYA 4RNJA 4ZSTA 3CIWA 4I5XA 4AZHA 4J5NA 3IJLA 1XLLA 4LH8A 4IIBA 1N8WA 4KCUA 2NWRA 1ODUA 3VUPA 4O15A 2PCEA 2AMXA 5I0DA 3FFSA 3F4VA 4PTNA 3VK5A 1TPH1 4NSBA 3AIUA 5BXPA 2NXIA 3EZ4A 2AGKA 1P48A 1UD2A 1E1FA 3R79A 3WLIA 4FLQA 3PAJA 3URNA 3QMTA 5HNNA 3T0TA 1FOBA 4EX4A 3AISA 4IIDA 5HXMA 3N18A 2Y88A 4UR8A 1QW9A 5CGQA 4REQA 3ATZA 4MWAA 4IQLA 4X9SA 2ZUVA 5HUPA 1XLIA 1M41A 3UNTA 2B7NA 2OEKA 3WUBA 3EOEA 4E2BA 3AHYA 3W3OA 4XAYA 3W22A 2Z26A 4OTKA 1F9CA 3OP2A 1KM6A 4L4LA 2X1UA 2GQ3A 3NQDA 2AQWA 4PMOA 3EX3A 3KP0A 3JUGA 1WUFA 1MQRA 1NQKA 1DORA 1UIOA 5E9XA 3WK0A 2QAFA 3GU2A 3LHTA 3NGFA 3U3HA 4TQTA 2TRSA 5CGMA 1B3VA 4GFIA 1XIMA 3BGGA 3CS2A 3SJNA 2V38A 4H04A 2O7QA 3RYSA 4AWTA 1TWZA 4N4QA 1JZ2A 1N8FA 1BLIA 3OLEA 2G8ZA 4GYPA 3JZUA 2XG9A 2RDTA 5TF0A 1VBRA 3F7JA 3GXMA 1TPEA 3DXIA 5RUBA 1E4LA 4WKAA 5BMXA 1C92A 4ERGA 2CYGA 1PYFA 4D1IA 5K7JA 3THDA 1J10A 3N2BA 3N3TA 2PDXA 3TKFA 2OMAA 4US5D 4GISA 2JALA 3WO8A 1K9DA 4KRTA 3T6CA 2FVKA 2DVTA 5TD4A 1GQJA 3R94A 3DEQA 5AB3A 4R7JA 1FHLA 3T4WA 2J8FA 3NYDA 1JYWA 3RITA 2WC4A 3DHPA 2PFHA 3EMQA 1J93A 3UG3A 4O1CA 5CPQA 3PUOA 3LZ5A 3H2OA 4DBWA 4GRSA 4ALDA 1KNWA 4EANA 4KWVA 3PTKA 2ZE3A 4AYSA 4W87A 4AC1X 1FH9A 2BY1A 1WDDA 4RPQA 4TIMA 3AHVA 4CD6A 3OG3A 3RK8A 1QOXA 3VCCA 2P8BA 2HNEA 1CW2A 4JTFA 3CV1A 3PNZA 3S5OA 3U4AA 3AS1A 2JFEX 3NQFA 3FEMA 3QF0A 3SQMA 3M64A 3G77A 3PTDA 3WUGA 4JYFA 4QNWA 3GU9A 3UWZA 3ARTA 2GDVA 4K2SA 2FDMA 5DMLA 3EWUA 5JBEA 3ARSA 4BCEA 5LGZA 3MMWA 3G3DA 1UKOA 3GAYA 5ECUA 3FCPA 4DYEA 1R47A 2E0PA 4JDBA 5AC6A 3GTXA 3TCSA 1FWTA 4H4IA 5DT5A 3W37A 4ZQPA 2QCHA 1MUMA 3NO5A 1JCNA 3WG6A 1OEPA 4NYUA 5BRQA 2TMDA 3TA9A 5CG0A 3WEZA 3BANA 4BWLC 3NM1A 3GR4A 2UWFA 2H90A 1WAUA 1C90A 2BASA 3LU2A 1TWSA 1TV5A 2I16A 3JR2A 3K1GA 3HB9A 2Q8ZA 3QZ6A 1BAGA 3CMJA 4M6QA 4IPIA 2JGYA 2FB2A 4C6NA 3LHVA 1DWFM 2ADAA 2UY2A 3RILA 5MF5A 3GLCA 4KFPA 1A4MA 2DUZA 3QGKC 3LXCA 3DERA 2BX7A 3MCOA 4HOWA 4MFEA 4YVVA 1W3HA 4PCFA 1Q3NA 5GPRA 1JUBA 5E1QA 3WK3A 3BZGA 2PMQA 1JR1A 1UR1A 4W8LA 1KO0A 1OWQA 4NZCA 2PZNA 1AZ1A 3S9IA 4J28A 3QV6A 5DY2A 5AHIA 4H2HA 3UR8A 2W92A 3BARA 3TQVA 3KP1A 5LNUA 2VEMA 5A8NA 4OJYA 1LORA 3W1QA 2OSYA 1J2BA 3MKCA 3GFXA 1NY1A 2VGFA 3SRHA 1UMYA 3WK1A 1T7LA 3CV7A 2IKJA 3E6EA 1CGWA 3M9YA 1JDAA 3BSMA 4Q7BA 3TN3A 1DP0A 4QRNA 1WQ5A 4WD0A 3B40A 3FHAA 3S9ZA 3CQIA 3EAUA 2PSNA 4HJFA 3V0SA 1AW2A 4QAWA 6XIAA 4V33A 3WJZA 4REQB 1FXPA 4MWAB 3AXHA 1QO5A 3BLEA 5L6UA 1XBZA 5EBAA 3SR7A 2VHLA 4HZ6A 3DFPA 4MDPA 4PRTA 1KA9F 3ANYA 3LZ3A 1C8XA 3SECA 5C8BB 3AXKA 1RK6A 2CLHA 3MDUA 4MKNA 1XSIA 3ZIZA 3KAOA 3IGUA 4CU6A 4FP1A 1WCGA 2DH2A 2WHMA 4GINA 1M6JA 2XIMA 1K6AA 2PBOA 4Q6JA 1XBYA 4Q32A 4AZCA 4JX6A 1FWSA 3W07A 4C6OA 1Q66A 2ZC8A 2PDQA 1VCFA 3VA8A 1KRBC 4XD4A 3EWZA 1LG2A 3TTSA 3O9NA 4WSJA 1NP2A 3NQCA 5LXEA 1WUEA 5FOOA 4ACYA 2HK0A 1OX4A 3BAKA 1J0YA 1KM2A 2ZXQA 1OK6A 3C61A 3CUJA 3LUTA 2NQ9A 5HPCA 2YA2A 1PVNA 4ZFCA 2C1IA 2XH4A 3MJMA 3KS5A 1R3TA 4S23A 5F1VA 4NVTA 1P4CA 1PDZA 4JHMA 3T08A 2VFDA 4UQEA 1PKNA 1BVWA 1ME9A 4AYGA 2PC4A 2YDSA 3ISIX 4MB3A 1ZSXA 2W66A 2ISSA 5MHBA 3W84A 1BF2A 3APYA 3STGA 3A22A 1VJZA 2QVNA 1RA0A 4G1NA 4PB5A 3SB0A 3TV8A 2VFGA 3PANA 4JFWA 1XDLA 4AEFA 4IX0A 3ATYA 5AHMA 2NV2A 3RCNA 2D2OA 4PSRA 4C1LA 2FB3A 1VFFA 3LPGA 4AD4A 1HKMA 7TAAA 3VNMA 5AYXA 1O5KA 3N9RA 3ENLA 2PDBA 1B4EA 4Y9NA 4Y8EA 1DV7A 2P0OA 3D47A 4LXFA 5REQA 4U5IA 1FWWA 1UR2A 2F8QA 3E02A 5A6KA 3VD7A 1EBGA 1WKDA 3CASA 4GCXA 3WLMA 4NX0A 1LRQA 1BF6A 5GNZA 1ZFJA 4TV5A 3UJFA 1JCMP 3WNNA 1VQTA 5GJNA 5D9NA 5JH2A 4WX2A 1W8SA 2PD5A 1HG3A 2GSEA 5I5RA 3EOUA 4JYEA 1TZ9A 2QDEA 5LSMA 4DYJA 1Q7MA 4HMCA 4ZENA 3B3DA 1QO2A 3R0DA 1E9ZB 2PP1A 5DFAA 5CC3A 4PYSA 2VNCA 1HJQA 3T44A 1XF0A 4UTKA 3WL0A 2WPGA 1ALDA 4XD3A 4J4KA 3ICJA 3VDBA 4XK2A 2VEKA 4C6FA 1SZGA 3NWRA 3WBEA 3A3WA 1R3RA 4EXBA 3LCHA 4LFYA 1U30A 4C6BA 2RKXA 1W5QA 1XS2A 6REQA 3L4ZA 3K8MA 3RLVA 2GLKA 3UWWA 1XPGA 1HKWA 1LYXA 2DZXA 1B5TA 1OY0A 1C3FA 3DFNA 1K8ZA 2HMCA 1QVBA 1X7IA 4PRRA 4JTDA 3STCA 1XLEA 3BAWA 5DF0A 5BOEA 2BMBA 4K37A 1S2CA 4MVAA 4WR3A 4YIWA 3UYCA 3WFAA 2QZRA 3WF3A 1ZBKA 4OGZA 2BOFX 2Z7KA 1W1A1 1VFLA 3Q4DA 4ILSA 5FAJA 5I3FA 4GI9A 3GRIA 1TTQA 2PZ0A 3BTNA 4J7RA 4QJ3B 4IGMA 4IXXA 1L8PA 3SCWA 4C90A 3SIZA 1IR1A 3WLRA 1W9DM 1YPXA 1TQXA 3E1F1 2P0IA 4MOZA 1EJ7L 3D46A 2POTA 3IGXA 2FQIA 3T40A 2BG5A 3WLPA 1CXHA 4AWSA 5ABHA 4F0RA 2YPIA 3L0GA 3NPUA 1V5XA 1B3YA 5C2CA 3EWYA 1OYBA 3CV6A 2BXYA 3WLKX 4GC3A 3CZJA 3WMCA 4XZNX 5G1YA 4W93A 2ZZ6A 4RUBA 4C5ZA 2WHLA 5I3JA 1OF6A 3T09A 1NFBA 3KVMA 5CZKA 2GGEA 3FYPA 1ZBCA 3R8RA 4A8RA 1M1BA 3DGBA 2E7FA 1CLXA 4NZFA 2P3EA 3K8LA 3PPGA 1O66A 3ME3A 2GWNA 4QR6A 4AZCB 3PZQA 5CEWA 1F7BA 9XIAA 1KC7A 3CUHA 3FXYA 1Z3NA 1KGUA 2EPLX 1ZL1A 3U7VA 2G96A 1CENA 1WBHA 2DIJA 3MSRA 5JXQA 3WLLA 3CT7A 1E0UA 2J8TA 2F9RA 2HSAA 3TK7A 3NEVA 4XZWA 5LZLA 1OX4B 3UEQA 2JKAA 1K6WA 4EOUA 3SCVA 3RPTA 3M0KA 2A7RA 2YX0A 2CEQA 3AWOA 1IEVA 5HOSA 4CLMA 4MNJA 3CHVA 3BAYA 3CUXA 1EO5A 1KM5A 5AOUA 1RY8A 1OFDA 1CLVA 1AMKA 2C79A 3QY7A 4ZQNA 3SO7A 1DWAM 4LCSA 3TZNA 4AU0A 4DZHA 2ZUTA 1XJBA 5AY7A 3RPDA 3WD4A 3KL5A 4JS3A 4E4FA 3UZXA 3E5BA 4LEQA 4CGTA 3USBA 2HVOA 3GNDA 4GYJA 3E9AA 2WNNA 4O12A 4H8VA 4PTDA 1XLJA 3UWEA 4B16A 2EKGA 2VL4A 5I3HA 1QNSA 3OYXA 5HA7A 4IX2A 4J40A 2C18A 2BVDA 5REQB 4R53A 3LEPA 1R0MA 3GNNA 5LKYA 4BY3A 3BOFA 3MY9A 1R87A 5FACA 1UKPA 4LUIA 2OLAA 1UWRA 4MTVA 4PTMA 4DJED 4EPEC 5CZJA 4OFCA 1TTPA 4PUDA 2ZXDA 3QW3A 3QKEA 5EMKA 1YBQA 4S3CA 5KZMA 4XAZA 2YZRA 3RCYA 1J8VA 4G7EA 3UW6A 1VR6A 2J6XA 4GX8A 3W88A 3AZSA 1Q6OA 2J7FA 4Y90A 2XVKA 2PRLA 3DX5A 3PZIA 3ZOAA 1JGMA 1ESWA 3RG6A 3ZT7A 3AHTA 4FB7A 3TWBA 1GVIA 2NV1A 2H3BA 1AJ2A 5D03A 4YTQA 2A3BA 1RQEA 3EB3A 2Z1VA 2C3ZA 2YCKX 3W2LA 1UPPA 5KZ6A 3HQNA 1GQKA 1ZCCA 4MAZA 4A3QA 6REQB 3W2JA 3E0LA 4BEQA 3FJNA 2HS8A 3DBPA 1W9BM 2Z27A 2CWXA 5C9WA 1RZMA 3N12A 3AMGA 1W1B1 1LBMA 4F0KA 2OPJA 1I6NA 3P2VA 2IKGA 1YMYA 3ZVIA 1BKSA 3OLDA 3J7HA 2BXVA 4H41A 3ZZ1A 4IIHA 1HVXA 4LC8A 3LM3A 3M7SA 1UCWA 1H1NA 1SJBA 4Q22A 2OGYA 3LRLA 3NOYA 1B9ZA 3I6EA 1RD5A 4O52A 1L6FA 3FA5A 1D3HA 1B57A 3KOZA 5FJOA 1SW7A 2IQDA 4DWSB 2QDDA 1P1MA 3QR3A 3TJIA 2WBGA 4GI6A 1U5VA 3TQPA 4M19A 3DFHA 1QNQA 1F3WA 4YLWA 1TZZA 2YA0A 4DF1A 3FA4A 4CNTA 2B81A 1BPLB 2CKSA 3KZSA 3R10A 3S46A 2D3LA 4PBFA 1UASA 1K70A 3KCLA 5EB8A 1KRCC 3QSTA 3EDDA 3E49A 1I9CB 1TJ2A 1KFJA 2F2KA 1NSJA 4IPPA 3W72A 3WQ5A 2W62A 1VJIA 3QZEA 3UZYA 1C9DA 1M65A 4GYFA 4Q8PA 4DUXA 5HAOA 5DX7A 3ZS4A 3QR1A 3C5QA 2YL9A 1Y5WA 1F3XA 3PWGA 1LT8A 5HK4A 4M1BA 3ABXA 1X39A 3G1HA 2J4GA 4ZO7A 2DJXA 4LJ3A 2GQ8A 3TC3A 3VD3A 3IJIA 3UJEA 4IQDA 5KEZA 1AW1A 1BGGA 4OV9A 3TAKA 5J5RA 2V81A 4DXVA 1H7XA 2D73A 1EC9A 1EB3A 1TV8A 1UPMB 1FH7A 3QLDA 1EYWA 3VMNA 2FFCA 3FIGA 2OQLA 1EDQA 1ZAIA 1DJXA 4YJ5A 2OKOA 1ZLPA 4KETA 2JEQA 1X8CA 3VZXA 1PIFA 1K9FA 1KTNA 3L4UA 2J13A 3QOMA 3BG5A 2V68A 3CB8A 3MHGA 1NELA 2ATSA 5K2ZA 3VI2A 1AL8A 3QGAC 1LJYA 1VPQA 1XG4A 3GDLA 2W6RA 2ZVRA 3EB4A 3AFBA 2FTYA 2WHKA 2Y24A 3TXVA 4P7OA 1FTXA 4ROQA 3MQTA 1T8QA 5HJXA 5CSUA 3AIBA 4DI9A 2CLFA 2J9ZA 2FZNA 3NIYA 5G4EA 5IHRA 2BOEX 2DT0A 1DJYA 1Y5XA 3GTIA 3NPWA 1GOQA 2G41A 1TV3A 3KUMA 1MEHA 4URIA 5M03A 4QLKA 1QWKA 3G1VA 1U5JA 1MUWA 4RNHA 3TTYA 4CNNA 1C8QA 5T9BG 4AHQA 1UKQA 5AC4A 2FIQA 4HBKA 4PH6A 4N6FA 2WSQA 5L9FA 1YTDA 1ZAHA 4CNPA 3TDFA 5JVLA 2PDCA 1P7TB 4D6GA 4OUEA 1T40A 2ZZ7A 1MNSA 2QNEA 3VMPA 3D0CA 4U3AA 2ZC1A 4I7VA 1SO4A 1IT0A 1F07A 3LPOA 4WRHA 3O0FA 1ZNNA 5BMWA 2W0UA 2DQWA 3QHOA 4J3ZA 3MP3A 5FESA 4N9DA 1GW1A 5FJJA 2NLIA 4GQ0A 4BQ5A 3AU6A 1GOMA 1M7PA 3T7VA 2NQLA 1TA3A 4GNJA 1WNOA 3H2MA 4MJZA 4CU7A 4G7EB 2EKCA 3HM7A 2IPJA 3EGJA 4CN1A 2B4GA 1QI0A 5A6MA 3UWUA 1O1ZA 4UCGA 1QK0A 3SM0A 1JZ7A 1TRDA 4GFSA 1ADDA 2BHYA 4AD2A 4PUMA 2OZ8A 3GH7A 1TPC1 4Q8OA 5F4WA 3ZR5A 3N25A 4QROA 1BKHA 2VZUA 1PZ0A 1DXIA 1D7FA 3VU2A 3A24A 4RDVA 1AQHA 4WGHA 3RLHA 4JY9A 3SN1A 2VFEA 2BGQA 1XFBA 4K39A 5G4HC 4KWOA 1G67A 1QXLA 1HKVA 3VILA 3S6OA 4B5WA 5IM51 2Z2UA 4RDZA 5G2HA 2PDPA 3WLOA 5FL1A 1UWSA 4Q4OA 4ZXLA 3LQLA 2QCEA 1N82A 1Q6DA 2E40A 3GHUA 1OF8A 1DVJA 3A5FA 1LOLA 3BAXA 1YPIA 3UR2A 2C1GA 3TA6A 4QG8A 5C5YA 3NNTA 2ZX5A 1FCQA 1RH9A 4CD8A 3CQKA 1J0IA 2JK2A 5CGTA 2DSVA 3O06A 2CLEA 3WZ0E 2QUMA 5FJRA 3LCLA 1VGAA 1JPMA 1YNQA 4WY0B 5D2XA 2QS8A 3NEHA 4YTSA 4D6CA 4HK6A 1QASA 1IWAA 3DHDA 3C2OA 3OQEA 1C29A 3S2JA 3L68A 4A05A 2J25A 2F6XA 1IEWA 2DZUA 4AISA 1FRBA 1QI2A 4DLFA 1RHCA 3PBYA 1YXDA 2VWSA 3GK0A 1TCDA 3G0XA 3MUAA 1DJQA 1XYCA 2NX3A 3R8HA 1UZ1A 3TQKA 4RNFA 1XLGA 3L5MA 1TPFA 4IZGA 2FZBA 1RCQA 2VD9A 1AD4A 3O63A 1R6WA 4PUJA 3N4AA 3CH9A 4BWLA 3L0NA 4R7OA 2VDIA 3SGZA 2E28A 3VAVA 4LBUA 2FPVA 1WZKA 1J79A 3C2YA 1E1CA 1MVYA 5H6HA 1WXJA 1H7WA 1S39A 3NO3A 2OT0A 3FAXA 4BQ3A 1AQMA 2EJ1A 2YZ5A 3AI0A 4RE0A 4Y6GA 1VFOA 3GWQA 2R1MA 1BWLA 4X60A 4DNHA 4H2CA 1LUCA 4IMAA 1O5QA 1D2KA 1PYMA 3APTA 2D3NA 3OZOA 4LUTA 1CYGA 1IQ8A 2CERA 4L9YA 1AH3A 1D9EA 1FWJC 1WDSA 5CPNA 3DIPA 4J35A 4MM1A 2WC7A 2TODA 3UETA 1YXYA 3L2IA 4R7WA 4UMBA 3WFLA 8A3HA 4LUJA 1UWTA 3RLGA 2YDQA 3WLSA 1RLCL 1P0EA 3W7RA 1Z8AA 2QEZA 4HCHA 4C6IA 1FDZA 1PTAA 1TPVA 1E15A 2DEPA 3AU2A 1WDRA 3DG7A 4POCA 3WLNA 2P3ZA 3HN3A 3NGJA 3O8AA 2GGJA 3M5ZA 3VUSA 4WVXA 3IVUA 5CLTA 3M0XA 3NYZA 3OOQA 3GVRA 4C60A 4XAPA 2ZWZA 3KLKA 1OT1A 4LV4A 4AFYA 4W9TA 1WZMA 1FHUA 1KXQA 4V27A 4JN6A 3VX1A 5GQBA 4GNKB 4MWAD 4R34A 3M0HA 1EWDA 4B4FA 4Y9MA 2A5HA 5FJUA 3AS0A 1ITXA 3GX9A 1JGIA 2X7WA 2A3CA 1OCQA 1OZQA 5I03A 3TVAA 3ZJ8A 5H1WA 1W1PA 4ERAA 1JJKA 3G3MA 1E6RA 5FEWA 4HZ8A 3TYCA 1BTMA 4UTWC 3NM3A 3CTLA 1TTIA 3E96A 4FLOA 3MC5A 4PUEA 4W7UA 3WLHA 3BOLA 2VP8A 1GPFA 1GG1A 3KTCA 4UXDA 1YNPA 2VC7A 4NU7A 2XSAA 1GVFA 4C6CA 1W1VA 3HJEA 1DHPA 2CLOA 2VVSA 3N34A 1E56A 1K4HA 2Z4GA 2XVLA 4ZQCA 1OIMA 1E0XA 3M1ZA 3WN6A 1RBOB 3PBGA 2DH3A 4ZB2A 4PMNA 2WMJA 5EFFA 1GKPA 3PZ9A 4YYCA 2E67A 3W2UA 4PUKA 2BS9A 4GZIA 1Q6LA 2ZYFA 2XH2A 4DBUA 4UFLA 1W1IE 1E73M 2HXUA 3UA3A 3EYPA 2WVVA 3E74A 3M0VA 3PPFA 1C7SA 3DYPA 2DT2A 7TIMA 3K46A 1YHTA 4G5DA 3OGRA 3H4WA 4JFTA 1RVKA 4H8HA 3UJ2A 3AQUA 3FHQA 3FEQA 3VNZA 2YYTA 2UY4A 1MWOA 1JCTA 3TAOA 1YEYA 3STFA 1DWJM 4U2YA 3WBAA 2YDAA 4HHHA 3OGSA 3R8GA 1MDLA 4WJ8A 1UBPC 3RM8A 4A22A 1E40A 2PLJA 4DJFA 2VKZG 4H8UA 1R5YA 2NSXA 3EDKA 3HGSA 4ZTXA 3FSTA 3WDJA 3DECA 1YNYA 3CWOX 1POKA 4A8LA 4NZ1A 3RHGA 3CQHA 1KM0A 3IV3A 4LVGA 4GUGA 1H1YA 4WZHA 3QEZA 1GW9A 2VWTA 2PDKA 1DJIA 2OEMA 1TX0A 3HG5A 2OODA 2I56A 1LWHA 2C1HA 2Q3RA 4LBSA 2QIWA 4ICNA 1BYAA 1E51A 1TVPA 1UQZA 4GYKA 1XINA 3WJWA 2DV0A 1XLMA 1NU5A 1TPUA 1XDJA 1EJTC 1Z41A 1MI3A 5KETA 2O56A 3LMYA 2E4TA 4GHRA 5IFTA 3BLOA 4N42A 3LCWA 4AD5A 5CAHA 3H7VA 2R14A 1J0KA 1OFOA 3O1NA 2PI6A 1XIFA 3HG2A 5EYWA 3D3AA 4PFHA 4K7YA 3U9IA 1TQJA 3UR5A 2OT1A 4ZB0A 5IBXC 2O4MA 1DTNA 4ZR8A 1EUAA 1DHKA 3HZ3A 1EGZA 2FDSA 4AZGA 1EGMA 2WKGA 1E6PA 4J3XA 3LNMA 1A0EA 3NQVA 1VF8A 5K4ZA 3LRKA 3USZA 2I57A 4UTMA 2FJUB 1JCXA 2HISA 4ZOAA 1BQCA 4QE5A 3S1WA 2J77A 1A5LC 1DQWA 3E0WA 3UXLA 1QMLA 1LG1A 4Y9PA 3OZPA 2BZNA 2VRQA 2W63A 1R85A 5EPDA 1WPCA 3W7LA 4AZ7A 4DEFA 4O1DA 4JX4A 2PWEA 2IQ0A 8TIMA 2AAAA 1IXOA 1PS9A 1LUCB 4ZXOA 3HGJA 2E1DA 4F40A 4GIEA 4LUTB 2KZHA 3S83A 2QCCA 2WM1A 1DJWA 1E0TA 4ZB5A 3DUGA 4S2BA 1V3IA 4IHCA 1IWBA 1VJSA 3RM9A 3KRUA 3P14A 1LRNA 1K4GA 2YXXA 1YPFA 3TYEA 3AUOA 2NV9A 2VMFA 2WVTA 1YDVA 1JVNA 5CZ0A 4N9EA 2YKKA 4LEFA 4ZBCA 4HNVA 1R3YA 5CZTA 2DVXA 2DSKA 2C16A 3LM7A 2V5LA 4WF7A 1YADA 3LI1A 9CGTA 4GO8A 3CPRA 1WP6A 3PB0A 1XGEA 4B3KA 5JU6A 1XXXA 2D24A 3GXNA 3HPZA 1OFQA 1UH4A 2V2DA 5C9RA 3GE7A 4L7ZA 4RXFA 4H8NA 2VCAA 4L1GA 2ZUMA 3G1XA 2PWDA 5HWMA 4G56A 1SW3A 5AC5A 4O1BA 1XM3A 2IPWA 2CZEA 4ZFMA 3TH6A 2EO7A 4UZUA 3WH6A 4M5PA 3G22A 3S0CA 3BURA 2ZRWA 1FFRA 3N19B 1K8CA 2J7EA 1HO4A 4NJIA 2ZKMX 3H53A 1G94A 3XINA 2Z29A 3CBWA 4TX9A 3C52A 1QPQA 3GR7A 1OADA 4PSPA 2QPSA 3WELA 1VBUA 3I3BA 1EP3A 3UERA 3UXIA 1QUMA 2A6LA 4DUVA 1XYMA 4NL1A 1P0NA 4V1YA 4ES4A 1I8JA 1UIPA 2X2YA 1GUVA 3MU7A 3L21A 4GPNA 1FWIC 2PPGA 4LBRA 4YHEA 2B7QA 3OTRA 3IIZA 3INPA 5AYBA 3FK4A 1I4NA 1GGOA 3W2KA 4WK9A 1J12A 4LAZA 1TWDA 4NNBA 1KFKA 1ONEA 2WNQA 3KOWA 1OCJA 2WVVB 1XLDA 3AXXA 2NT1A 3N29A 2YBTA 4YTUA 3SQLA 3W28A 4DZIA 2V82A 3IJ7A 1YE4A 4AG0A 4H7VA 4A8NA 1E6QM 4IISA 4BR1A 1EHAA 2YXOA 4B5XA 2P5NA 2VVNA 2FTWA 3K30A 1QOQA 1YKWA 3ECQA 1ICPA 4LY4A 4H00A 3VX0A 1P6BA 5C9UA 2ZRXA 1F5ZA 3AJ7A 3CZGA 3ZLGA 1CI1A 1IV8A 1F3TA 2FGZA 3RU6A 3BLIA 1DWIM 5D9MA 1MXGA 3GHSA 4XTIA 4PTXA 3C0QA 6PTDA 3BAIA 3CLWA 1RQBA 1NH6A 3W53A 2Y6ZA 1GVQA 3BGAA 3LTPA 3HOJA 2ZOXA 4S3JA 4JTJA 4A3YA 5BYWA 1V6TA 1MRQA 4ERIA 3BQ5A 3QHNA 3S6DA 3WJSA 1UUMA 2ZUWA 4PCPA 4HB7A 4DELA 3GY1A 2P1FA 4E2DA 3TYAA 3SUUA 1V8EA 5DRIA 3BSHA 3HG3A 2WB5A 3NQMA 3URQA 3BXWA 3PTQA 4V1XA 1N7KA 1F3EA 3W2NA 2BTMA 2OWXA 2WJFA 3W1NA 4U10A 2GJLA 3JRKA 4FOJA 2CWNA 3VABA 3ZWTA 1WDPA 2WCGA 4AIEA 5A6JA 2DUXA 1JYVA 3NDZA 4PMUA 5D9PA 1PIIA 3C86A 3PZVA 2OX1A 1YDYA 4Q4KA 1AUSL 1I1WA 5DELA 3ES8A 4NRRA 3N1AA 1PIGA 2I17A 2NVCA 3E0VA 1ZBVA 4CCDA 4GJJA 4S39A 3SADA 4AXNA 4UTFA 1E9LA 4WXYA 2NW0A 3TX9A 1J5TA 1BXNA 3BCJA 3DC8A 1Z42A 4HK7A 2J7CA 1TV7A 3GC2A 3PJXA 1EJRC 3H2EA 1CLKA 1YRRA 1M53A 1FXQA 3M07A 4B3ZA 4Q8NA 1DE6A 3VDCA 5JIPA 2D2HA 3VOFA 3EPNA 2HDJA 3P74A 3QSRA 2B0MA 4LB4A 3M0YA 2QJJA 3D6NA 1QPKA 4M6PA 4OBSA 2Z1WA 2ABAA 4FO4A 1NQ6A 4L1XA 3VIOA 2EHHA 2ZX8A 2FHBA 3CHCA 2O55A 1EO7A 1UHVA 4O19A 3ABQA 4O4WA 1GKRA 1JDFA 1L9WA 3BGJA 2OXNA 4RCXA 5D33A 1RCOB 1XIIA 4OIFA 3BLFA 1ZS2A 3BAJA 3S2MA 3VD4A 3MA8A 4O1AA 1M04A 3W71A 4MIMA 3COTA 4PL2A 1PPIA 1LCOA 3T55A 3UZWA 4LNCA 1X97A 2IKIA 1A5NC 1V3MA 3G8RA 3STEA 1F6KA 4NXKA 1FHDA 2A4AA 3C0LA 4U31A 1YDOA 3ITOA 3GKFA 2J74A 3MI2A 3CMFA 3B8SA 1ZHAA 1GOXA 1EOMA 3LCFA 3KVJA 3F1QA 2V5CA 3T9PA 4OUIA 2OO0A 1PWLA 1SO6A 3PBMA 4QJ1A 4CD5A 4JIEA 3PB2A 2X7VA 5ABGA 4QSHA 2VR2A 3SGUA 2ZE0A 5C9XA 1H50A 2E09A 3O6DA 2X1RA 1XKJA 5ABTA 3R1ZA 1ZCOA 4JFSA 2BGSA 3AHXA 3W9ZA 4PRWA 3KBMA 3GFYA 1K7FA 1F74A 1LLZA 3I7QA 1JZ8A 3IUHA 4XZMX 1KWGA 1F6PA 1VYSX 3GHRA 1NDVA 3HPFA 3U5UA 2REQB 3VFCA 3K1DA 3UU0A 3BC9A 3AYSA 1NP0A 3FA3A 2IS7A 1SZEA 3RAOA 3N9SA 5BU6A 3TN4A 2ZUUA 2QV4A 2V2HA 6TIMA 1CB2A 1WBJA 3TW6A 2PLKA 1B90A 5FAGA 3MANA 4B5UA 2J66A 2GJRA 4IMGA 4LCQA 1RY0A 2GJNA 2G95A 1VFTA 1US0A 2GGHA 3GXFA 3L4VA 3VGGA 4QAIA 3O2LA 1EJUC 3LHZA 5FI8A 3M46A 5JUVA 3RU8X 1GOOA 1V51A 3L12A 5FF7A 2ALDA 1W9VA 2X05A 3H23A 1XW8A 1U33A 3E2RA 4BQ4A 4H9UA 2PP0A 2FHFA 2PDWA 1TSIA 5C7HA 3D3FA 3FVDA 3M16A 4GUFA 1R2TA 3NURA 3WCZA 4PE8A 4WDXA 1W6TA 2QMJA 3TMLA 3M47A 1R7AA 1H62A 4O4VA 2XJ7A 4M82A 2QUTA 1HP5A 1XBXA 4MSSA 2Y5JA 1GVOA 1UYQA 2WSKA 3N2CA 5K9DA 1LOQA 3DKLA 3OPSA 3EWBX 3UCDA 2CHNA 4L6OA 1NM9A 2W67A 1UZ4A 4AWUA 1ADOA 2OQYA 4GC4A 3PNUA 4WDWA 2OYMA 1CXKA 3VGDA 2IKHA 1TVLA 3CC1A 4Q4RA 3OLIA 2FH6A 4AZBA 2YCIX 2J9YA 1US2A 5DCDA 3KTSA 1B4KA 1XIBA 4UQBA 3TC7A 4Z2IA 3TUUA 4XZLX 1EWEA 3PBWA 1W0MA 3KDNA 1L0PA 3H70A 1U2YA 3NUKA 4AQLA 2P76A 1DIKA 3MKVA 4HA1A 4YWIA 5CPSA 3MW7A 4ZO6A 4FF7A 2Z00A 1LWIA 4UQDA 2WSPA 1R9YA 1L6WA 1JDEA 5BRBA 3VKAA 4IPNB 4H01A 4B2DA 4O8RA 2HE5A 1RP8A 1B54A 2CBUA 3ALFA 1A5SA 4OZOA 4AIOA 4L61A 2PUZA 3W0KA 4ATWA 4IUGA 1ZU8A 3IPWA 1GYLA 4F0MA 1EL3A 1G0CA 3QRHA 3TYZA 3OQ8A 3SCPA 1XUZA 3QBUA 2NX9A 2BLEA 1VFHA 4WDUA 4O18A 1E9IA 2O9TA 4JTCA 4LGXA 3RJYA 1S5WA 2PWHA 4HP5A 1R8LA 1JD7A 1EZWA 3SUWA 4AZ6A 1HJVA 1Z32X 2FVMA 3UZ5A 3S1VA 3KOYA 2WCAA 1BEUA 2WHJA 3WLJA 3OW1A 3PC0A 2PODA 3IV8A 4DLMA 4NRSA 1T6MA 3I4EA 3MUXA 5AN7A 1X96A 3RRXA 1FWEC 3LQGA 4JN7A 1VIWA 5JMUA 3HMJG 1NDWA 2VFHA 4Z2GA 3WBYA 3RMJA 2FJKA 5A8QA 2NXHA 3BMWA 2DZWA 2JEPA 2GVGA 1G6CA 2V9DA 4NZJA 1LQ2A 3BICA 3GG0A 4H1ZA 3Q37A 4AWEA 1QOPA 2E6FA 3BW2A 1EC8A 4PFMA 3E12A 4CEUC 3DOPA 4H6QA 4X2RA 3P84A 4B4HA 1BG9A 3CL8A 3FY1A 4LC6A 4GOAA 4D6FA 2C6QA 2VM8A 1M01A 3K4AA 4IIEA 1JNDA 1W56A 1FH8A 2NQJA 1JFXA 1FVPA 3S3GA 4JEQA 1DJHA 3AO0A 1EDGA 1TREA 5EL1A 4GABA 1RSCA 1RQHA 1BVZA 5LA2A 1W31A 1K7EA 1IE7C 2HXTA 4XZHA 3BQ6A 3A21A 3LRMA 2H9AA 3AIEA 4P7RA 3C2FA 3S2CA 2DSUA 3T81A 2OZTA 3EPOA 5EMUA 2J7BA 4ZQOA 4W5UA 3VYLA 5GJPA 4MFDA 3R89A 2CCRA 3FOKA 3W7DA 1SW0A 4IJBA 1QFEA 2C0AA 3GDKA 3NTYA 2CITA 4KESA 1FWHC 4JQ1A 1OYCA 4PEEA 3KBSA 2DZSA 4OOUA 2BBFA 2VGGA 1NVMA 4IICA 1TCMA 2WVUA 4AIUA 4INFA 1VPYA 5AVHA 2GWGA 5CLWA 3GH5A 4CN4A 4NJJA 2YL8A 4YS1A 3ARQA 4GO9A 5DXYA 3OGVA 2AL1A 3VNDA 1Q63A 5LA0A 4KFNA 4GQQA 1H11A 1UR4A 1V08A 3OLGA 3REQA 3PBVA 4IMCA 3SRFA 3BDKA 3MT1A 2AOSA 4NAEA 1X1ZA 3TJLA 1OZMA 3G0SA 3NO1A 1OGGA 4K6AA 3NAVA 3ZJ6A 1IXPA 5A2AA 5JIWA 2J6VA 4XBKA 4K3ZA 3GXTA 1FFQA 1RPXA 4B91A 4O54A 2R1LA 3N73A 2V3EA 1E71M 1ZRQA 3T0BA 4IIGA 3VNLA 4Q4MA 4TX6A 1XCXA 4GXMA 5K9CA 3TSMA 5GNYA 3P6LA 3CO8A 4D1JA 4P7QA 1AD1A 4QLJA 2ZX6A 2O0TA 1J5SA 4F3HA 1QWGA 2E1WA 4KCTA 2QUVA 1B2YA 3PN8A 4FA3A 5ECVA 3DN5A 5AYZA 1UOKA 1P1XA 5LNVA 2EJAA 3AIQA 1EEXA 2F2HA 4KWSA 4PMQA 1JQVA 4WY0F 2D0GA 5LIXX 3W1UA 4F79A 3LLFA 3F2BA 4BF5A 2RDWA 3VXGA 2DZAA 4IIFA 4K38A 5FKYA 1JDDA 4RW5A 1UOZA 5G1MA 2P10A 3ZWSA 1SJDA 2WANA 4O57A 3TNBA 5AC7A 5BCAA 5KMYA 3VNYA 5H91A 4GBDA 4H9XA 1R3QA 4QG9A 3MV01 3NA8A 4GUIA 3W02A 4LS2A 4ORMA 1W5OA 3B8WA 2BHZA 5FF2A 4GQGA 1I60A 4CUCA 2DORA 3CUGA 4GIYA 4FXRA 3LBMA 1HW6A 2W79A 3WYZA 4WOQA 4LU0A 2GJXA 1QPRA 4X61A 1K9EA 4GY1A 3M6DA 3OZYA 3CIXA 5GJMA 1IHIA 2HVMA 5A6BD 7XIMA 5T8GA 1P0KA 5FF0A 2GK1B 3LPPA 5HMFA 1GVSA 4NASA 1DJZA 3BCDA 1D8CA 1SFSA 1LT7A 4I7WA 3B9DA 1UZDA 3W23A 3UGVA 1Q85A 1W5NA 3W2MA 3TW7A 4KCVA 1JXKA 4KS0A 2X0HA 4FIRA 1KBBA 3VIPA 1VRDA 4OE7A 2J88A 1LOSA 5F2IA 4Z0SA 4IPJA 3B8UA 1LZOA 1EYEA 1Y5VA 3ES7A 2F61A