3APYA

Properties and crystal structure of methylenetetrahydrofolate reductase from thermus thermophilus hb8
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
291
structure length
291
Chain Sequence
MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylenetetrahydrofolate reductase
publication title Properties and Crystal Structure of Methylenetetrahydrofolate Reductase from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 104
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3apyA00
3E2SA 2FZMA 4JNYA 2FZNA 1TJ0A 3ITGA 4JNZA 1TIWA 2FMNA 3FSUA 1ZP3A 1TJ2A 3E2RA 3IJDA 1ZP4A 3APYA 1ZRQA 3APTA 1ZPTA 1V93A 1TJ1A 2FMOA 3E2QA 1B5TA 4O8AA 3FSTA
chains in the Genus database with same CATH superfamily
2DH2A 1HN1A 1MMFA 2XM2A 4JTQA 2XVGA 3G22A 4NP7A 3VIOA 1VFTA 2VWSA 3PUOA 4B91A 4LUJA 4BWLA 3W7NA 4KEMA 1EF2A 2ZE0A 1P0NA 1EGVA 4RNHA 4JHMA 3APYA 3C2FA 3W2KA 2VZVA 1QI4A 3M0JA 1PE1A 3KFTA 3HG3A 4MHBA 1VBJA 4UBPC 1JL8A 4KCTA 1M7OA 3N34A 1V7AA 1ZHAA 4G6CA 2VVNA 1Q7ZA 2XYLA 4YCPA 1F76A 4TTUA 2RGLA 3AC0A 2GYIA 3LRMA 1XD0A 3VCRA 3SM0A 2AMXA 2V3GA 1D7FA 4ZB2A 1VCVA 4FNPA 4S3DA 4AIEA 1W1PA 3SEPA 5TIMA 2FTWA 1U22A 3VIGA 3LV6A 4F79A 1H0GA 3V3WA 2GQ8A 4U33A 4ZZ9A 3GUGA 3DZ1A 3LY0A 3PUEA 3ERPA 3OZOA 4IPPA 4ZE5A 1TV3A 4A6GA 4AU0A 4NU7A 2XISA 3MVTA 1XXXA 2B0MA 2YCKX 2F2KA 1JF5A 4EF8A 5F2LA 1CWYA 2GPTA 4IIHA 3UJRA 3BSMA 4ICNA 4G9PA 1YHTA 1ML1A 3M0MA 2YA1A 3NQVA 3CZ8A 1SGJA 4XK2A 4CD8A 4GIAA 3IS4A 1KQZA 5FF4A 1GQIA 8CGTA 1RK6A 2KZHA 3M5XA 3RLGA 1TPB1 3KL5A 1V0NA 4OTKA 1JXJA 4XTIA 3G3DA 1OB0A 2YR1A 5K9DA 3ARQA 3OHMB 4CLMA 1K9DA 2FZ8A 4OGZA 3W6YA 1U5JA 4ZEPA 4ZOCA 1WPCA 3CL8A 4AYSA 4C6BA 1M7XA 1R9ZA 4D6HA 3WJWA 4NAFA 1W1VA 3W1NA 2Q8LA 1M6JA 4E8GA 4LBSA 2CLMA 3WBXA 2VX4A 1EHAA 1V3IA 1PV8A 3KOWA 2YCJA 2HXUA 4WRHA 3V5OA 2OT0A 1MEHA 3TIMA 5CPOA 1C90A 5A1AA 1F61A 1K4GA 4AZCB 2R1LA 4WVXA 3NO3A 3PFRA 2ISDA 1EEPA 2NV2A 4DAIA 4LYKA 3WF1A 4D6IA 4TVDA 4NVTA 2Y70A 1Q45A 5CAKA 1M53A 5A8MA 4QJ5B 3NEHA 3RFAA 2WBKA 3S5OA 2C6QA 4JTKA 2X8RA 4HGXA 3OPSA 5D2XA 3B0UX 2C15A 3U7BA 1L0PA 3KBMA 3AQUA 4H6QA 1XLCA 1W0MA 1ZTVA 1AD1A 1F3XA 3S42A 4CQDA 1DIEA 2QIWA 3UYIA 3UZXA 1L6GA 2GUUA 3S2CA 2QPSA 4OHQA 1QHPA 2DSKA 4P5UA 1XRFA 4HHLA 1HJSA 1O95A 1US0A 1K3UA 4QS6A 2G37A 5E1QA 4LYRA 1FKXA 3ZLHA 2V68A 1ODZA 3HQ1A 5DCEA 3NDZA 5D09A 3ZO9A 4F0SA 3DC0A 3L4UA 1H7OA 1SJDA 1UKSA 5LSMA 4PYSA 3QSRA 4JDBA 5PTDA 4DJDD 3R7MA 4WJ8A 1QWGA 3LXCA 1LL4A 1W3JA 3N4EA 4OOUA 4NJGA 4M3PA 1XLFA 3SO7A 1JQXA 4K6AA 4JX4A 4Z1YA 1UH4A 1H49A 3QR1A 5HJXA 3WBWA 3UWQA 3OG3A 3P6LA 1SO3A 2Y89A 4IMCA 3L4WA 4FXSA 2CLOA 3VDHA 3E74A 1ICQA 5AYBA 1YTDA 2WNQA 4BJHA 2DQWA 2PLMA 3EKLA 4L1GA 4HNLA 1JGIA 1P0DA 2GDUA 3WZ0E 4I7UA 3THQA 1EQCA 3MSGA 1D8WA 2R82A 3EWDA 1W8GA 3BUVA 2E09A 5FSEC 3H7UA 1UR2A 1E4IA 3C6CA 2TSYA 4AD2A 3DBNA 2OB3A 2Y5SA 1I0BA 5LNUA 2OSXA 2ISVA 1UD2A 3APGA 1S2WA 3OLDA 3F7JA 1G0CA 3BLKA 1GK8A 1K70A 3TX9A 1A3HA 3V35A 5CJNA 4FLSA 4W85A 4R7OA 2HRWA 3KZSA 1QNQA 4FMVA 3SUVA 5D4YA 1JRCA 1DJXA 4JTAA 1WDDA 3DIPA 2JK2A 3LNPA 2WMIB 1F8IA 4GQQA 2J77A 1ZAHA 4Z42C 3QMTA 1VR6A 4DF2A 2B7PA 9XIMA 3NM1A 2YA0A 3UWEA 2CNCA 4PTXA 4Y9AA 3RK8A 1ME7A 2QAFA 2P8CA 3B05A 1CW2A 4JTSA 3JW7A 3HIJA 3NCOA 1UUOA 4ZENA 2W62A 4TO8A 1TZZA 1F2JA 1UA3A 4DM2A 3U5UA 4AZCA 3B4YA 1XIFA 2ISFA 1FWGC 3NQ7A 4P8VA 1XQLA 2VR5A 2B7OA 1B5TA 5BCAA 3G1AA 4HZMA 4YTTA 2DVUA 3IACA 2D1ZA 1YRRA 5REQB 3STEA 4D72A 3PZGA 3BJSA 3AHXA 4GZJA 4WEVX 4Q4MA 1KCZA 3EWWA 2VGFA 2V30A 3TYDA 4M6QA 2HCVA 1LWJA 1D3CA 3OVRA 4NZ1A 1KC7A 3BARA 1FH7A 2P1FA 3AMCA 1IT8A 2C79A 3W38A 1WKDA 4FS9A 4LVAA 5HPOA 1KBBA 2OYLA 1NOFA 3N9KA 1G01A 4UTMA 4NIRA 1EUAA 1GVRA 3WLPA 1IEIA 3EWUA 2A7NA 3GTFA 4P7QA 2WO5A 1ZY9A 1I45A 1GKPA 1DTUA 1Q3NA 1LRNA 3ALGA 1S3HA 1XLKA 2P0OA 3I3EA 3UG3A 3WLOA 3GTNA 4MWAD 4B4HA 1SO4A 4GMEA 5ABTA 5I24A 3BOLA 1JEZA 4MWAE 1HKMA 4DUOA 4MJ4A 1YXCA 3CQ0A 1UQYA 2BGQA 3PF3A 1HFBA 1Y65A 3TLQA 1OCBA 3EXSA 2VD9A 4NILA 3TYZA 4ATWA 3CPUA 4O54A 3T7VA 1FP8A 2XM1A 2ZZ6A 4RXFA 2O55A 2PDHA 4QXIA 4LAZA 1TPDA 2J6XA 1L6SA 1R2RA 1V6YA 4GNJA 3E0FA 3ZVHB 5H91A 1QPRA 5HWNA 2WANA 1FFRA 5FF2A 3W07A 3WLQA 2PD9A 5BXTA 3T44A 4TX9A 3DGRA 2D24A 1GCYA 2J66A 3W2JA 2CFFA 4AIBA 3WY1A 2Y85A 5J5DA 3TKFA 1ZB5A 3LQLA 1MXSA 5M2FX 3VC6A 3P62A 2G5WA 3CNYA 2HVMA 3KVJA 4Y9MA 4A8IA 1E6SM 4XZWA 5AC6A 3M9YA 1UWSA 2JEPA 4MB1A 2XVKA 3NSNA 2VYOA 2PDKA 4FSAA 4Q4KA 3A64A 1J6OA 2WC4A 3MA8A 4IFOA 4W8BA 2E9MA 2ZTJA 3Q94A 4KCVA 2DUXA 3GXMA 2AGKA 4O16A 5D02A 3CS2A 4D6DA 3ITGA 3QHNA 3RO8A 2BBFA 4D8LA 4H8UA 1W1ZA 2QGYA 1O1ZA 3KOXA 1AG1O 3PPCA 3KHJA 3GQYA 3AMGA 4NZ4A 4BEQA 4H83A 4J3TA 1X6UA 4A4AA 2WMIA 1W17A 3I10A 3L67A 3BAWA 5I00A 1W9VA 1TCMA 3N73A 2QUTA 1AK5A 1KV8A 4M7SA 1DXIA 4ZOAA 4FALA 4X22A 4EOUA 5G4EA 1FX6A 1UWIA 1EWDA 1XGZA 2VRJA 2WSQA 3O1NA 1NIUA 4Z17A 3W6LA 2ZX9A 5T9CE 1H7PA 3UGVA 4PMUA 3KUMA 4MPQA 1NWUA 3HG2A 2FZBA 3VM5A 3RGTA 1GVQA 3WBEA 1E9IA 3JRKA 3HMJG 1OVDA 1JPMA 3R6IA 4RDVA 5REQA 5CGTA 3MS8A 1UMYA 2NZLA 4BEUA 1G4PA 1Z7AA 4LWWA 3E2SA 3E38A 4QJ4B 4JN7A 5K9XA 3R79A 5HOSA 2EGZA 1TPEA 3VDGA 3M1ZA 1QPKA 2WHLA 1UPMB 3ABXA 1IXPA 4LEFA 1LUCB 2BXVA 3AS2A 3UG5A 1ZJBA 1V6XA 2P88A 3TCSA 1A5LC 1BKHA 4H9XA 4H04A 2GGHA 1S5VA 4C6KA 4O28A 2BGSA 1G7UA 1PZ0A 3CO8A 4Y96A 3W88A 1XLIA 3QFEA 1QR7A 3C0JA 5JH2A 2POZA 3II1A 2HBVA 2WZEA 1UOKA 1W1A1 4RW3A 3UWUA 3G1SA 1GZJA 5I2UA 3C3UA 3NWRA 1H09A 4M24A 4JFUA 1GVSA 1O5RA 4ALDA 3IIVA 2V5LA 3W85A 4KKXA 2BHYA 5A8QA 5HINA 2FJKA 1A50A 4U5IA 3S1XA 2OPJA 3N17A 4TMCA 4GACA 2VC9A 3ARXA 3M5YA 1PX3A 2VEMA 5FA5A 4QDPA 1E51A 5I06A 2IMRA 1K8ZA 1PX4A 1CECA 1EA0A 2XIOA 3WLIA 5CBBA 3BAYA 3T4CA 4WY0A 3VUSA 1KFEA 2ZWYA 1GUVA 4YNGA 2YL6A 5CZ0A 2WHKA 4NI3A 3B8IA 2YBUA 3N19B 1GOIA 2V67A 4JIIX 2Y4SA 1RALA 3GG0A 5FJOA 4QLKA 3XISA 3NQGA 1S46A 4M6UA 3RRAA 4E4PA 3FAWA 4UTFA 3MI2A 5BYWA 3QKEA 4QR6A 3MDUA 1CLKA 3Q4DA 1EXPA 4OWGA 4GH1A 9CGTA 4GRSA 5DT7A 4J2MA 2IKGA 3C86A 5A6AA 1W32A 3UFYA 1FWDC 4S1FA 2O9RA 5L6UA 3P5YA 3AFBA 3CZEA 4BWLC 4B92A 5EYWA 4GKTA 4LANA 3TMQA 3CYJA 4DO6A 1TWDA 4CNSA 1AQ0A 4Z2LA 1FWHC 1QNPA 1DPMA 1B2YA 1F4HA 2OEMA 5D2VA 3V5CA 1O5KA 4XO6A 1DBTA 5DT5A 1J11A 4O17A 2D0GA 1KM0A 1W9UA 3VUPA 2XDFA 4HKPA 1WA3A 5CKSA 2RKXA 5C7VA 4MSSA 3SCWA 3W22A 5I3HA 4ML4A 4XAFA 3K13A 1KLYA 3QW4B 3QOMA 3WK2A 1SZEA 5CZSA 3EPMA 2NUWA 1OD8A 5A2AA 4S39A 2CC0A 3NOYA 4TMBA 3STCA 3WH6A 2PDMA 1G6CA 2FH6A 4JTRA 4XD3A 4DRSA 1FH9A 3VNZA 3N2MA 1R7AA 5I0DA 1BVZA 2WLYA 3FJ4A 1PKMA 1AMKA 4ZQPA 1O68A 3VOHA 3MUCA 3BL3A 1MWOA 2INZA 1OFDA 4L4OA 3O63A 4HA3A 3RM9A 1LUCA 1TWIA 1DWFM 4JYFA 1L9WA 1JPIA 3EGJA 1RBOB 1ICPA 3FKRA 3S5ZA 2WYSA 2GQ9A 4IF2A 3M5VA 3U6WA 3CPRA 3P84A 1YTKA 2PLJA 1Z41A 1CLXA 4I9JA 4R9OA 1JCJA 1JYVA 1JZ5A 1FH8A 1HG3A 1UR4A 3LX9A 4RE2A 1LP6A 4PTMA 3LLXA 3R12A 3O07A 3G6LA 3LGGA 1WP6A 4AG0A 4IIDA 2D0FA 4DO5A 5L9FA 2GL5A 4A8LA 7CGTA 7TIMA 4E5TA 4O13A 5DMMA 1TRDA 1UQZA 1VEOA 4JR5A 1VIWA 3BK0A 1M03A 3OIHA 1KRCC 1NELA 3C2RA 3CIVA 2ZRYA 4F48A 3THDA 1BEUA 3KTXA 2QGHA 1LQ0A 3U48A 1DTNA 1Q5MA 1UB3A 3EX4A 2F8QA 3M7SA 1LLZA 3RX4A 4DBSA 3IVUA 1AJZA 2DIEA 4IX0A 2F38A 2W6RA 1KRAC 2NQ9A 4NT0A 2DIJA 4IX2A 4RCXA 1KBJA 4CEUC 1QHZA 1FFQA 3B9OA 2XFFA 1ZAJA 1EWEA 5CC7A 4KWWA 2XGIA 2HTMA 3T05A 3QW3A 3TN3A 3O2LA 1E5JA 3D3AA 1Q8AA 4GISA 3I7QA 4GNVA 4GO9A 2ISSA 3SADA 3GDKA 4HYRA 4DF0A 2ZKMX 3PBUA 2GUBA 3MKCA 4ZA0A 3KOZA 1KW1A 4IOTA 3AYTA 4RJEA 2IXVA 4TVUA 2Z27A 1MQRA 1XC4A 2A79A 2CHNA 4JHOA 1RA5A 1YBQB 3QZ6A 4PUDA 3WK0A 3NQBA 1D9EA 3AWNA 1PDZA 5C54A 3KTCA 3WLNA 3F4WA 3NQAA 2IKHA 3U7VA 2EG6A 3GE7A 3T8LA 3E2VA 1VAHA 2FFIA 1B3ZA 3KCOA 3SB0A 3EOOA 1FWAC 2WNZA 4ADTA 1S5MA 5IBXC 1IIGA 1TSIA 3O3RA 3C4UA 2PRHA 4PUUA 5XIMA 3GXFA 4Z08A 1EB3A 1XSKA 4JKMA 1NFGA 1X98A 1LOQA 4HPXA 1F7BA 4Q22A 4GFIA 3VNLA 3ARSA 3WQDA 3EXRA 1HO1A 4EP8C 2ZXBA 3SUUA 3EWBX 1W2VA 4I90A 3U4AA 5AC7A 3WMSA 4EX4A 3MY9A 3ITCA 3LSCA 4GFSA 4G56A 3WNMA 2CHOA 3APTA 3LGDA 3BJTA 1NARA 3P5ZA 1FDYA 3ZJ8A 1MW1A 1O6IA 2GGJA 5TBOA 3K5XA 3QPZA 3N11A 5LZLA 4NL1A 4UTTC 1N55A 1XRVA 2QIIA 2F6XA 5FAGA 1WYIA 4EAMA 3T0CA 3W37A 2FGBA 4QE1A 5I3KA 4PB3A 1UWTA 1V6VA 3T2QA 3NUKA 1DJGA 4ECLA 2CZFA 3TU9A 1VB9A 1BRLB 2VXNA 2V69A 5HANA 5ABHA 3FJ6A 4DZAA 2QS8A 2VWTA 3TTSA 3WF4A 4R88A 3QC0A 4MKVA 4KS0A 3U5YA 4OJYA 2CW6A 4RNIA 5CPSA 4ORMA 1CXIA 2PFHA 5HDRA 3DI1A 4DXKA 4CNNA 1R46A 5FJJA 4MUPA 1AJ2A 4NXSA 1EJ7L 1MRQA 4L64A 3LOTA 4Q4QA 3UT0A 3ARVA 1XYMA 4HSOA 8TIMA 3BG9A 1R5YA 3PVFA 5A6MA 3T9PA 3W7RA 1G7VA 3WDRA 1SR0A 1OEPA 3SCQA 3FHQA 4KH2A 5AHEA 3W29A 1LL7A 4B5WA 2E4TA 1T99A 3BDKA 1PZ1A 1QW7A 5E0KA 4XO7A 3WF3A 3W2NA 2CPUA 2TYSA 4A3UA 1HP4A 3A21A 4GGBA 4DJFA 2EPKX 3B4UA 4ZO7A 2CLKA 4UXDA 1IWBA 3D6NA 3M0LA 1OG0A 3R13A 4BS0A 1IR1A 3UCQA 1WKYA 2H9AA 1F6PA 3UR7A 4UQBA 4JKLA 5D9PA 2OO0A 1J6PA 3UCCA 2PEVA 4A35A 3D46A 3INPA 1FVPA 4S23A 1GVOA 3W7EA 2XZ7A 3WH7A 2PWGA 4FZIA 2Z2UA 4FXRA 1KM3A 3EPNA 1K7FA 3HV8A 3RPDA 1RP8A 1DJWA 3L65A 1YBQA 3WQEA 4AWTA 3PY2A 4DM1A 4PBGA 4PCPA 1B3YA 4QM1A 3LDVA 4OBTA 4WUIA 2I5IA 3WLHA 3W7JA 2NV1A 4RDZA 4UFLA 3NXLA 2Z1WA 2Y63A 1ITUA 3ZWSA 1E6XM 2DZUA 4FB7A 3EKZA 5H6HA 2XIQA 2WVTA 4C6JA 1ZU8A 3VPLA 4GINA 1H60A 1VRXA 2BOGX 2ESCA 4A22A 2OX4A 1HJXA 3CEPA 2QZRA 2I17A 3V75A 3I6EA 4CNOA 4CD6A 4O0ZA 1XRSA 4LTSA 4GY1A 1W5MA 3S2JA 1OWQA 2OTDA 1BWLA 1GEHA 4WKAA 3ZR6A 3PWAA 1TPH1 3THCA 2J75A 4GBUA 4HPHA 4RX0A 3VOGA 4L5ZA 3S4TA 2PDUA 3MV11 3W73A 3GHSA 2XSBA 4CKQA 2GSEA 3FOKA 3UJEA 1XH0A 3CH0A 3COTA 5BMWA 3MTWA 2V0TA 2C1HA 2Q3RA 3G8RA 4US5A 3M64A 1NOUA 1QK2A 4EKJA 2ZUUA 3TYEA 3E49A 1JZ4A 5XIAA 3PN8A 2V5JA 2J47A 4D6EA 2W4XA 4ROQA 3QXBA 1ESWA 1OF8A 2JIEA 1J12A 4RZBA 2MNRA 1C92A 3MV01 2CLPA 1XP3A 3B8SA 2QDDA 1OIFA 4RL3A 4Y90A 5JH1A 4O57A 3F2CA 2DSWA 1OC7A 4S3BA 4AEEA 3FXYA 2FJUB 4XTDA 2RFGA 1WO2A 3PJXA 4MFDA 4LT9A 2WZTA 1AH0A 4OE7A 2VFGA 3EAUA 5F1VA 3CQKA 1JUEA 4O0KA 3W86A 1H41A 3W7CA 3A5VA 2PWFA 4LS1A 1G67A 4KIEA 1KFBA 3HGRA 2V3FA 5KEZA 4AUBA 1B9ZA 1M68A 2A1YA 4BF7A 3QJAA 3NFUA 4K8GA 2ZICA 2ZUVA 1H7WA 1A0DA 2PGEA 1XKYA 4LYQA 1J18A 2ON3A 5CZTA 3O7UA 2VGIA 3WQWA 4P7RA 2DZWA 5IOBA 1ZBCA 2OU4A 3CQJA 3RLUA 4CQAA 3HTWA 3LQGA 3E5PA 5CPMA 3B8VA 1JCYA 4A3YA 1GONA 1F4AA 1HL8A 1GWJA 4MAVA 2YFOA 5D04C 3VD4A 4K38A 4GIRA 2BMBA 1CDGA 4IMGA 3K4AA 2J9YA 4PZVA 1E6NA 4LAMA 2X7WA 1IGSA 3I68A 4Y6GA 1TE1A 1UH2A 4DX3A 5CC5A 5JU6A 3U2CA 4IM4A 2GLKA 2DT2A 4JBRA 3EWZA 3BGJA 3RCYA 2Q6ZA 3CO4A 3H23A 4MLJA 5CCZA 3A12A 3G18A 1XLBA 4PUEA 5C7HA 1XM3A 2VC6A 3QEZA 4FF7A 4UZSA 4O1FA 4RW5A 4QP0A 1IR2A 4Z1DA 1OF6A 1PO9A 3HGJA 3GU9A 3UXKA 3EDDA 2QVHA 3W6MA 2X0YA 1XLGA 2OZTA 3A23A 5M03A 3VDCA 1EHNA 2OG9A 3MBDA 1I2OA 4AZHA 4ZVJA 2ZZ3A 4KGLA 4O18A 1EOMA 5KETA 1SU5A 3EWYA 2ZDRA 3MO7A 2R9RA 1F6KA 4ZGYA 1TPVA 3IIOA 4PN2A 3WG6A 2VMFA 1NY1A 2PTDA 2WZMA 3HBLA 4Z1AA 3IJ8A 1TCDA 1E9ZB 3DECA 3K46A 4QEHA 1PX8A 3UZJA 2OLSA 2WMKA 5KSWA 1KGUA 4LCQA 5K7JA 4I8YA 3ITTA 4S3CA 1U1HA 2POTA 4ASTA 4KWOA 2E67A 1SYTA 4GXPA 2AQOA 1QBBA 4L6HA 3UETA 1DV7A 3VNYA 3U0HA 2XGBA 2PTZA 3T08A 1TYGA 3B0VC 4JIPA 4PGLA 5IDZA 1AA1B 1WUFA 4C65A 1PTDA 1HGWA 5JXQA 5U7SA 1BYAA 4F0RA 4C6MA 4QAIA 1XPGA 3WDIA 1W5OA 2PWDA 2VI0A 5DCBA 3GK0A 4YN5A 1ZSXA 1ZBKA 3ALFA 1EJSC 4YHEA 3A4XA 3R8HA 3TTEA 3CUZA 1FDJA 3ITVA 4FIRA 3ARTA 4MWAB 4BFAA 1L6WA 5DO8A 3ABSA 1BSIA 6CGTA 2J7FA 5A6BD 4Q33A 2XIIA 3SQSA 2CZVA 2AKMA 3WDJA 4JTUA 3AWOA 1OCQA 3WK3A 4HYWA 1RA0A 3EWCA 3OU8A 2J4GA 4MNJA 2WXDM 1ZL1A 1UC5A 1AH4A 2VDIA 3BICA 3WD1A 1OIMA 1M7JA 4Q4RA 3VNKA 2NX3A 3BMXA 1US3A 1OCJA 5GVJA 4AC1X 4UTUA 1UOZA 3K8LA 1UHVA 1OFEA 2HDJA 2ALRA 1TV7A 4XUGA 1XYLA 3K30A 2WWDA 1T41A 5I6SA 3Q67A 3H2CA 2VT0A 4XZ9A 2JEQA 1UKQA 1F74A 1XLAA 3H2NA 1BPLB 3AS3A 3AIVA 1TJPA 4U28A 4J2PA 3GXDA 2OGYA 2QDGA 3ITLA 3VOCA 3UWWA 2GFTA 4UR8A 4PUJA 2IKJA 1GQNA 2ZCGA 2IS7A 3WUGA 1KGXA 4JNMA 1KTNA 4L56A 3T55A 1FXQA 5K4XA 4C6CA 1A0EA 1M41A 1GJWA 3FHAA 1Q4NX 3VFCA 4BA0A 3H2AA 4GY7A 2REQB 3AYSA 1PWMA 3NQFA 4ZL1A 3HM7A 3DESA 3L9CA 4S3EA 3DH7A 1HF6A 2EEXA 2X1UA 3BG5A 5E9XA 2YKKA 4HCLA 1BHGA 4GK8A 2PUZA 4PA8A 1FUYA 4LRTA 3MBFA 1OX5A 4KFNA 4UMAA 3TSDA 3CLWA 1WV2A 1KQYA 3OVPA 1QK0A 5C9WA 4MG4A 4JCLA 2G3NA 1GYMA 3L21A 3AI0A 2OZ8A 3HA1A 5ECUA 4V1XA 4F9JA 3WQCA 3BJFA 1BD0A 5BXRA 1ZCCA 5BU9A 4JTDA 1C3FA 3MCMA 4F66A 3CLMA 4MM1A 5DANA 1P6CA 1J79A 4AWUA 1P1MA 4M0XA 3UXAA 5G1YA 1J96A 2CKSA 4LV9A 1K1DA 2VGGA 2DSUA 3IJ7A 4Q7NA 3W26A 1TTQA 4ATLA 5A6JA 4YTUA 4LH8A 5FL1A 3GKFA 4OZOA 1HL2A 6XIMA 2DT1A 5A6SA 3WFZA 4JX6A 1V02E 4HN8A 2HXTA 1G5AA 1V93A 1KB3A 1Q6CA 3TN4A 1F73A 3HZ3A 3LYEA 1WX0A 4Q8MA 4H8VA 1X38A 4H6RA 4MWAA 4QE4A 1THFD 3AS1A 1XX1A 3IAPA 1K6AA 2P8BA 1HJVA 2Z28A 2GJXB 3NL3A 3U57A 1NTHA 2XSAA 3AMDA 3T0DA 1Z69A 3R2GA 1FHLA 3N6JA 4R7JA 3AXKA 1C8VA 2ZUTA 3TTQA 1E71M 4HZ7A 1CENA 3H12A 3OLIA 5BRBA 5CLTA 3S46A 3TH6A 2FTYA 3WQ8A 1MW2A 4ML9A 4F0LA 2UWFA 1KM4A 2ZXAA 3IV3A 7A3HA 1XIJA 1R87A 2W92A 1A47A 5J5RA 3TAOA 4Z2GA 5E9AA 3FJNA 1M7PA 2ADAA 3VOJA 3UR2A 3ITOA 4X0VA 1IXNA 1KV5A 1NFBA 3L66A 4FOKA 3N6QA 2CZEA 3VZYA 1YPIA 4CD4A 2ATMA 4UR7A 3R1ZA 5KZ6A 2XH4A 5I02A 1O1HA 4UFIA 4WXYA 1KXHA 2W63A 4L4PA 4GC3A 2PDIA 2QCHA 3LRKA 4LNCA 3TJLA 3GIQA 1JI2A 5G1TA 4LB4A 2REQA 1LJYA 1QNRA 1BLIA 4RXGA 9RUBA 1JNEA 5HNNA 2GQAA 3ZYZA 1PYMA 2VP8A 1JCLA 5KTLA 1GW9A 2JQXA 1R38A 3P8IA 3LLDA 4J3ZA 2GUYA 1Q6GA 4QDMA 1EC8A 1JZ3A 3A24A 5EGRA 3LPPA 3V5FA 2IPWA 1LM1A 1UR0A 2AL2A 3ARZA 4DBEA 2WHJA 4MOZA 3E6EA 4XISA 4GUIA 1MVYA 3CH9A 2PCQA 3I7SA 3TROA 3F5LA 3PG8A 4XZBA 3GNNA 4ACYA 5B7ZA 3NVDA 4WR3A 3F2DA 3LUTA 2YJQA 3GXIA 1GZGA 2W91A 1YIXA 2D3LA 2PCEA 3SSJA 1I4NA 4I5XA 4MB4A 3VIJA 5DX7A 3ZWTA 3M0IA 3W9ZA 1UD4A 3GNRA 3KWXA 5HNTA 3VC5A 3W3OA 3CUJA 5TF0A 4HPNA 2A6LA 5CG0A 4S2BA 1XIDA 4V27A 1P43A 1XDLA 4M82A 1QXLA 2ZBTA 4G7EB 4IMEA 2P3EA 3B0XA 4F40A 3QY8A 1OK6A 1XCXA 1N82A 3DHUA 1QOPA 2WQPA 2J7GA 1WOBA 4XWUA 5GJPA 3FNDA 4JTTA 4FX7A 3V0UA 1LROA 1VJSA 4O1EA 4N9CA 2I5QA 2PZNA 1QI3A 1BG4A 5XINA 1NF7A 1HIZA 5LNSA 2BY3A 1OT1A 1V79A 3PAJA 3VMOA 2GJXA 3UY7A 2V6AA 1OK4A 1N8FA 1JNDA 4CUCA 3LB0A 1KD0A 4Z2KA 3TJ4A 3KRSA 1XPYA 1OGSA 1FQ0A 3MO4A 3TQPA 2G3JA 4IFKB 3HMCA 2TMDA 3NZQA 1Y7VA 5CH9A 4UWMA 3UXIA 4XIAA 5F2MA 5LYRA 1J0YA 3KS5A 1MZHA 3VO0A 4ZFCA 1CB2A 4C7GA 1REQB 4C1NB 3ZJ6A 1RP9A 4HNUA 4KGJA 2PDJA 3QH2A 1EF3A 3D47A 4NKCA 2QAPA 3W7QA 3UD6A 1F07A 4HPJA 4M6PA 3MDWA 4AF0A 2UY5A 4JDYA 2J7EA 1F9CA 1MDRA 4UTHA 3TW7A 4HIBA 4GLEA 2P10A 4NXKA 3FX4A 3I6RA 4B5XA 4Z2JA 4QFUA 3SR7A 4TX8A 4MKNA 4S2CA 5KINA 2E5DA 1R3QA 2PGFA 3W2MA 4AD5A 4E8DA 2VRQA 1C8XA 2JKAA 2QVNA 4EANA 3LHWA 4L9ZA 1MNSA 2TPSA 3A4AA 3AHVA 4DPPA 3LMYA 2Y24A 1WDSA 3AZTA 3M0HA 3BAXA 3RM4A 5H2ZA 4MZ1A 4IISA 1HKWA 2HNHA 1QW9A 2PDQA 2ABAA 3OA5A 3LBCA 2PF0A 2V9DA 1EIXA 1W3LA 2XIBA 3TNBA 3AUOA 1E3ZA 4US6A 4A3HA 4P7OA 1TJRA 3L4TA 1RD6A 4Q7BA 1RVKA 1DWIM 1X1ZA 1YNYA 2BY2A 1SFJA 3WUBA 4UQEA 4X0NA 4ZOEA 3EX1A 2V82A 2X1TA 3G1HA 4QIUA 4O1BA 4AHPA 1W1YA 4REQB 2EHHA 4WSHA 3MHGA 3UU0A 4JFWA 1Q6QA 4J35A 1A3XA 4JICA 4W5ZA 1Q6RA 4DN1A 1S1PA 3FW6A 1QI5A 1BQGA 1JDEA 1JPDX 1PZ3A 4WOQA 2DZBA 3A5FA 1KLZA 5HPCA 3CHFA 1T5AA 2C0HA 1UWRA 1NDVA 1XR2A 1J0KA 4HQVA 3CU2A 4DWDA 3IJLA 3S9ZA 1LRQA 5G2IA 3GDBA 2OODA 5G1MA 2CWXA 5I79A 3ENLA 1JDCA 2OEJA 2XWDA 4LVDA 5D9OA 1HKKA 1FWSA 1UR9A 4G7EA 3CQIA 3VABA 3GVVA 1K9EA 2PU1A 4DZ5A 1R30A 2RUSA 3G8EA 3FLUA 4MZYA 2G50A 1ZP4A 4GQGA 3XIMA 4C91A 4O8RA 4MTVA 2WHMA 3EX2A 3PTMA 3VGHA 3ZR5A 1T6MA 4QRNA 1ZGDA 2F2HA 1Z9AA 3HF3A 4GABA 1CPUA 4BY3A 4O1DA 3UWVA 3S5NA 2WPGA 3C2VA 1KFJA 1S5WA 4S3FA 1QO2A 1EP1A 3SY5A 5B80A 6TAAA 2Z2BA 3GDTA 2PDNA 1C7SA 4K68A 4H6EA 2WNWA 3WQPA 4E4FA 4IFKA 4H9ZA 1WKFA 3UNDA 4D2JA 2FMOA 3EKGA 5T26A 2ZX8A 4ATDA 3Q65A 5D33A 3D5HA 1TFVA 1JIBA 1REQA 2C16A 4UFKA 4C1NA 2OFJA 4BK9A 3SUSA 3HJZA 2E40A 3AJ7A 5BOFA 2FPVA 2PRLA 4LC8A 2XHYA 5AYZA 3AISA 2DH3A 1UC4A 3U9IA 2VEGA 3L0GA 2PBGA 3TA9A 2X42A 2YCEA 3AXHA 3BLEA 4CCDA 1RQBA 4UFJA 4Q8VA 3MHUA 4IUOA 4FHAA 3EX6A 5IRPA 2H8XA 5AKQA 1H61A 1RZMA 2ZX5A 4NNCA 4AD1A 1QCWA 3CPGA 1IE7C 2D69A 5E5CA 4ZQOA 2ZZ4A 1HO4A 3SIMA 4WDTA 2QCEA 4HBKA 3VZXA 1JCXA 1QW8A 3A22A 3OG2A 4H2CA 2G3IA 2NSOA 1DIKA 2VM8A 4BHYA 4O4VA 5CGMA 1S2UA 1IZKA 4GNKB 3QGVA 2CBIA 1OFOA 1P1XA 2A3BA 3CHDA 2YZ5A 3UW6A 1NP0A 4B2DA 2XTKA 5D30A 2BP1A 5CZKA 1S5NA 3W23A 4REQA 4H9UA 3B0PA 3B8WA 4KIRA 3TOPA 3BVJA 4BCEA 3SN1A 3WQ6A 3MKVA 4RK8A 4UZUA 3FFSA 4OQVA 4TTGA 1EL3A 3F5JA 1UUQA 3TWBA 3CIWA 1KCLA 4LAKA 2A3HA 1ADOA 3WQ5A 1XLMA 3KBSA 1V3LA 1H63A 5CQ1A 3T4WA 2GQ3A 4KEUA 1IXOA 1CX9A 2XSXA 5ABEA 2QPUA 3A9IA 4AD0A 1OJXA 1NM9A 4AZGA 1OX4B 3P93A 2D2HA 1U2YA 3M7WA 4CEXC 2PBOA 3C3NA 4LY8A 5DMLA 3REQB 3NA8A 2J7HA 3WF2A 4UNIA 1JG9A 5CG7A 3FA3A 3WLRA 2C0AA 3TN5A 2ZYFA 2EXOA 1PIIA 3RMJA 3WYZA 4IHCA 5FL0A 4HTBA 1OZQA 4R53A 3TC7A 3AO0A 3MCNA 3ES7A 2J7CA 3C2OA 3CUHA 1WDRA 2D73A 2A2IA 3QMRA 4PC8A 2X2YA 4JTLA 4YPJA 2J8TA 1YDYA 1AL7A 3CL6A 4PFMA 3VOFA 3TZNA 3LCWA 4YJ5A 2R6OA 1MYRA 2BXYA 3T2PA 3V16A 3LTYA 5A6LA 5C8BB 3GR7A 4AEFA 5A2BA 2G0WA 4UNKA 1D8CA 1RVGA 3W2UA 5T9BG 4I6KA 2V2DA 4ENLA 3K1GA 4N6EA 2VEIA 3DKLA 3CAKA 1XS2A 1RCXB 4HB7A 1IEVA 4YYFA 2C3ZA 4LEQA 5FKYA 3AS0A 4LC6A 3VU2A 1I1XA 1A53A 3ZZ1A 3QZEA 5I7GA 5E6ZA 1XFCA 1SZFA 4RKAA 3HQNA 3L5LA 4PUNA 3SCPA 1WNOA 2ZUMA 4UTKA 3MI6A 4O19A 4CQBA 1BQCA 1JQVA 1JPKA 1OC5A 4AWEA 4U3AA 4F2BA 1XGDA 4X63A 2X05A 1V3MA 3MHFA 3GC2A 4GC4A 2OELA 2QCCA 5DMNA 3LGEA 3GYCA 4RV3A 3MANA 1GOXA 4J1OA 3RCNA 4KETA 1HKJA 2AKZA 4A05A 4B5NA 4W84A 5A6KA 3SQMA 5M5DA 4E2DA 5LIWX 3UGRA 3F4CA 2R91A 2ACRA 3FA4A 1LQ2A 4IJBA 5BROA 4JY8A 3WELA 1FP9A 2JGQA 4FNSA 1EGZA 1NSJA 4MWAC 2DZPA 2QEZA 1PZ2A 3IRSA 3EOLA 3T78A 4E38A 1P7TB 1OGBA 1FOBA 2PP3A 3L5MA 2VX5A 4JIEA 3LI0A 4B4FA 4UFMA 3OTRA 3GVWA 3PM6A 4AD3A 4CCZA 1UROA 3WJSA 4JQ1A 2DVXA 4QQ3A 3GAKA 2EAWA 3A13A 4H7CA 1O60A 2C14A 4OV9A 1WQ5A 2VD8A 4ZFMA 2EKGA 2CZDA 1YX1A 3G1YA 4JTIA 2HE5A 2IUZA 1A5UA 1JULA 2QF7A 4I5UA 4H19A 3AUJA 3RX3A 2NT0A 4X2RA 1OX4A 4HMDA 5HMDA 3QQ1A 1XLEA 4TIMA 2QUVA 3REQA 1RJQA 3LD5A 1CXLA 4Q8NA 4GYFA 3PPFA 4HSNA 1NF0A 4AZIA 3RG6A 2GWNA 3R8GA 4PH6A 3VKBA 4DUXA 5DXYA 3D3FA 4B5UA 4LVFA 3IUIA 3L0NA 1NWRA 1FWBC 1NEYA 1ZQ5A 1LBFA 2JFEX 2F6KA 1MW3A 1TMLA 1IHIA 1XFBA 3ZM8A 1MQPA 4KW2A 3W1QA 1JCMP 3H4WA 2GK1B 4XZHA 4MF4A 4ZO9A 3ES8A 4ZO6A 3SECA 3UZWA 3WD0A 1LWIA 1S39A 2PF8A 4IG2A 4K37A 3NZRA 1EJTC 1G69A 1R8LA 2PGRA 4N6FA 3QTPA 1N8WA 1XKJA 3BCFA 3GS6A 4DXXA 2YA2A 4HA1A 2Y8KA 4GZ7A 3RX2A 2VC7A 1KM2A 3MKKA 4ORIA 4JN8A 5HJYA 1W9DM 4YCOA 4UC5A 2B31A 3QYQA 4GUJA 3KHDA 2NUYA 4XD4A 4IQDA 5AECA 3NQEA 3WDHA 4PTNA 3CM4A 2FKPA 3C0LA 4D71A 1GEQA 3O05A 4S38A 2E68A 3VCNA 4LB3A 2CXEA 4N0RA 2PD5A 4FAMA 4KESA 4J27A 1OD0A 3RU8X 2HQAA 4OV4A 2FZDA 3NQ2A 3AU2A 2ZX7A 3CWOX 4IPLA 2OVLA 1RCQA 3S2LA 3I4EA 3CB8A 3STGA 1JYWA 3GXTA 3G1XA 3GNDA 3ZMRA 3PJTA 4LALA 1Q13A 2G3MA 2V81A 2A7PA 4IJCA 4ONVA 1T8XA 1J01A 1V5XA 3VGBA 2UV8G 1VLWA 3NQDA 2C71A 3P14A 3ATZA 4UTJA 1HP5A 1NWSA 5FJPA 2PB1A 5FAJA 3T0BA 3UQNA 3VK5A 3DAQA 2EG8A 3LPFA 1FWFC 1G4SA 3ANVA 4R85A 4YL2A 5I3JA 5MKGA 2DY3A 1P6WA 4NZCA 3N9RA 5A95A 1JDAA 2OQYA 1TWSA 4N4QA 3VIMA 5FJIA 3WLSA 1SW7A 4O10A 5D2WA 2PTYA 3CZGA 1E1CB 1GPFA 1VFLA 1WUEA 1UZ1A 3FYYA 4WJXA 3BLFA 4NYYA 2E6DA 4UTWC 1EZWA 5A69A 3UA3A 2XN1A 1KCKA 3HG5A 1JYXA 1XI3A 1W6TA 4Q8QA 3BH4A 1KFKA 3W1RA 3G1RA 4GCAA 2BB0A 2Z6JA 3A47A 4FIQA 3CTLA 4I3GA 2WMGA 4Z2IA 3URNA 4KRUA 3GO2A 1ZJHA 5I3DA 2YLAA 2QT3A 1IIHA 4D8ZA 4UOZA 1AD4A 3HPSA 1E70M 4R7WA 1H62A 2ACUA 4M1BA 1XSIA 5TNVA 3BCDA 3CZJA 3OW1A 1K8YA 3B8UA 4U31A 3TVAA 3RUBL 3IV8A 3QV6A 4IP7A 4MUZA 2WWCA 4WZHA 3R25A 1T96A 4YXGA 1WE5A 1EC9A 1E6RA 1QNVA 2OMAA 3L0KA 2GK1A 4KERA 3BGAA 4CD7A 4JN6A 5A6BA 1V0KA 3PB0A 4H8HA 1K7EA 3ATYA 5JQ9A 3W7MA 3KP1A 2CHRA 1XBVA 2A3CA 5HMSA 3GIYA 4XBKA 3URBA 3BAJA 3QM3A 3MJMA 2NX9A 2CLFA 4RLIA 2ZVIA 5HNUA 1MO0A 3C8FA 5AC5A 1KGWA 1SSDA 4UTLA 3LPOA 3UJFA 1DVJA 3KCLA 4Y8FA 3NYZA 3O9NA 3OZMA 1RXOB 3AXMA 4JQAA 4IXXA 1I60A 1XQKA 2PAJA 3M6DA 3WJXA 5E0FA 3CV1A 1KR1A 1Q4WA 4XBJA 5CPQA 1XIBA 3TTYA 1SJAA 3R58A 2Y7DA 2IXUA 4BR1A 4BKNA 1QASA 1UJQA 1FCQA 4QNWA 3OP2A 4S3AA 3G1VA 3MJYA 1EKOA 5AY7A 3NL5A 4DNHA 3FSTA 2HISA 1VQTA 1S2CA 2CLEA 3NGFA 3EB4A 4OFCA 5AVHA 3WIJA 2PDLA 4V1YA 3G0UA 4Q3MA 2PLCA 3G6MA 3OEXA 1GYNA 4GI4A 2GJNA 2Z7KA 4S3GA 1TUXA 2YCLB 4G7FA 2CBVA 3P61A 2EO7A 2WPBA 3IGSA 3CHCA 3NPUA 3AROA 4W7UA 1DEDA 5HMEA 4WOZA 3GY1A 4UQCA 5IBXA 2QCNA 4PBEA 2DP3A 1DYSA 3LHTA 2PS2A 2ODOA 3DHDA 4MY1A 1H5VA 4DI8A 3E3HA 3L4VA 2BVYA 5BNKA 1JZ8A 4X9SA 1GKRA 3CUXA 4IL2A 1TIMA 1K7XA 2C1GA 4V28A 2ZFAA 1ITXA 1HKIA 3ZSSA 5I5RA 1GJPA 4RZ4A 3KCJA 4PFHA 3RF9A 4AFYA 3PNUA 1KFWA 2WVSA 1NQ6A 3HQOA 4GIYA 4FA3A 5I77A 3H7VA 1VD6A 2BNJA 3TEVA 4IPNB 5FF7A 3SJ3A 4CVWA 3NQ6A 3CQHA 4UTTA 3PUGA 1W3IA 2OQLA 3S47A 3NGJA 2W5FA 4AW7A 1KM1A 1E0WA 1H7XA 3ZSTA 2ALDA 5C2GA 5C55A 2XH7A 4ZSUA 3NTYA 2DQXA 1UASA 3WH8A 1OT2A 4RV8A 3V0TA 1W5NA 4LUSB 3KDOA 3TR9A 1V02A 4CN1A 1UP2A 1ALDA 1JDFA 4O50A 3BURA 4LU0A 1D7KA 5AHFA 3CIXA 5M17A 3DFTA 3ZR4A 1ZALA 2X09A 2V5DA 4NHVA 3DFQA 5H8UA 1EDGA 2NVAA 4BI6A 1AL8A 4LNYA 3QR3A 3ZXWA 2WW5A 3FN9A 3L68A 2NQJA 1CEOA 5EMLA 3FJLA 1BSLA 3IJDA 2LLEA 2VEFA 3H70A 4I6VA 5DRCA 1LLOA 2PZ0A 5I3GA 2XFWA 3OZYA 1GG0A 1TVNA 3IUDA 4O11A 2PWEA 4CU8A 2DUAA 3ZS4A 2J9XA 4QCFA 5GNXA 5FJRA 1ADDA 3QLDA 3ZIZA 5IM51 2GOUA 2PRMA 4X61A 2OWXA 1EIBA 2YGYA 1QMLA 3F2BA 1GVIA 1IT7A 1EJXC 1A5NC 4GWEA 3W7OA 1XBXA 1I6NA 4QBXA 3LCIA 4UMBA 4R33A 3LHYA 4PEEA 3TCEA 3SCRA 4F0KA 2C1IA 2QQ6A 1WXYA 2O0TA 4Y9OA 2X0HA 4MIMA 4R27A 1TTPA 5TQLA 3A6OA 2QJHA 3ITYA 1E73M 1G4EA 1MUMA 1MI3A 4MDOA 3Q45A 5RUBA 4EPKA 4MPKA 4CQCA 4FR1A 1XG3A 4GD0A 3SW6A 3PZQA 4RE0A 2FB2A 2D20A 1QPOA 1ZJIA 1IQ8A 4AC7C 3NO5A 3AIQA 3OLGA 3NVTA 1YADA 3MUXA 5JBDA 1Z89A 2CLIA 3W72A 3PR2A 1BTCA 1VFOA 1F3TA 3K1DA 3S1GA 4NNBA 4YS1A 2YCLA 4N42A 2XFYA 3TA6A 3VD5A 4FLRA 3E02A 4KEZA 4HHHA 5LHFA 1LLWA 5BOOA 5C9UA 2F61A 4GVFA 3TN6A 2A7RA 2D22A 4C5YA 5EMMA 2EPNA 1FTXA 1POKA 4DUVA 3DYOA 3H24A 4IP4A 4AX7A 3F5KA 5D8ZA 3GHUA 4R3UA 2FZMA 1EJWC 2FZNA 3TSMA 1TPFA 3CMJA 1ITQA 1TIWA 2Y7FA 1A49A 4UR9A 4L1XA 3UBPC 4JOMA 1C8QA 1O94A 3AXIA 2I56A 4EVZA 4IICA 3BLLA 5JUVA 4MVAA 3VX0A 5F7UA 3ANUA 1ITCA 1E43A 1KCXA 1T8QA 2ZXDA 3ARPA 3VI2A 1K77A 2QULA 3G0XA 4MB5A 1LT8A 3IIPA 2GDVA 4YMZA 3YPIA 4YVPA 3PB2A 3W7DA 1YNQA 2VO5A 1KXQA 3W1LA 1TKKA 2VKZG 4M7TA 4WDXA 1WCGA 5H8MA 1KR0A 2FB3A 2VFEA 4TUFA 3SRFA 1E0VA 1E0XA 3VIPA 4AYGA 3CUGA 3H53A 1UWQA 4ZCWA 2R1PA 4XZMX 2CWNA 3M41A 4CNPA 1SMAA 1BXNA 4H00A 1GVYA 1MEIA 5A2CA 1OFQA 1U30A 3DCPA 1SM9A 2HSAA 2BG5A 4LUSA 4OUIA 2Q8XA 1YTEA 2PE4A 4NX0A 3MYPA 4FF5A 1V6UA 2D3NA 5LIXX 4CQ9A 3MI3A 1A5SA 3NNTA 3M0ZA 3ISIX 2HROA 3PZTA 5ABFB 1YE4A 3VNIA 5F4SA 3W1AA 4R34A 3TC6A 2D2OA 1MDLA 3PUDA 3CV6A 5AZ0A 2JKPA 4XAZA 1B30A 3BWWA 1V4YA 4O15A 1Q63A 2FLIA 2PPGA 4EAYA 2RAGA 3WDPP 5EMYA 2DORA 2OSWA 2NWRA 4QE5A 3E0WA 2ZRWA 5LIUX 1S2AA 2IPJA 4A3RA 3M43A 3AIRA 4AHOA 1M1BA 3FIGA 1HL9A 1TQJA 2WCGA 2NX1A 2EJAA 3C5QA 2ZDSA 3TJIA 2J78A 4W7VA 1KKRA 3VX1A 3IJ6A 1JI1A 5JBFA 3BLDA 4B3KA 1NWTA 2A3LA 2YXGA 3H26A 1U83A 2P76A 3G77A 2E3ZA 3PZOA 4EPBC 2NT1A 3RILA 2VFIA 3VGEA 2I16A 5CEWA 4J3VA 1O4UA 3P60A 4EPEC 1B1YA 3W0KA 4F4RA 3W25A 2ZE3A 3KLLA 1PWLA 3UCDA 1K8CA 3UWYA 2FHBA 3TYUA 2ZZ2A 4JD4A 1TZ9A 3EMZA 1B4EA 4XKYB 4G5DA 3GTXA 3FSUA 4K7VA 4WDWA 1MEWA 1ISXA 4J4KA 2Y88A 1IEQA 2Z2AA 5C71A 4LOCA 1Q6DA 1DQUA 3OQEA 3XINA 3LRLA 1I1WA 4EWJA 1TPC1 1YXDA 1YE6A 1CGYA 4HA0A 4U5KA 4AZ7A 4QJ1A 2Z26A 4D1IA 2G97A 1EFZA 2QCLA 3EB3A 3FEQA 3WD4A 3LI1A 3NDOA 1R7OA 2QHAA 4AISA 1ADSA 1XH2A 2HNEA 3IJQA 2V3DA 4ZQRA 4NSBA 3TK7A 4HOZA 2NVCA 3SCOA 1R47A 3U3HA 4GE8A 3SCSA 1QTWA 2X2GA 2R24A 1A5BA 3ZVHA 2WOQA 2ISWA 1DORA 3W02A 4AY1A 1X7FA 2VURA 2YLLA 4KF1A 4Q8UA 2BX7A 4HJWA 3TYCA 5MF5A 1DKWA 2ZC8A 2Z6IA 2UBPC 1JGMA 1E15A 4GYKA 3TQKA 2F6UA 5GJMA 3UA4A 4CCEA 3C52A 4ZQNA 4XKMA 3M16A 1RLDA 2GOKA 4DEFA 3UYCA 5CSSA 3G1FA 3TUUA 1IF2A 2NLYA 5EKYA 2ZWZA 3UG8A 4QAWA 1HX0A 3CL7A 5BRPA 2JF6A 3VZZA 1LG2A 2AMGA 3WMLA 1B3WA 2W79A 4DUWA 1BYBA 3W53A 1HJUA 4ACZB 3WLJA 1RHCA 3MUAA 2X1IA 1W2PA 3SI9A 3OIXA 3DHFA 5ABFA 1XBYA 3PBVA 3WJZA 2HE8A 2WMHA 4KQNA 4JTHA 4HOWA 5GPRA 2NLIA 8XIAA 3DFHA 4HN4A 2XIJA 1ONEA 1UUMA 3BV7A 1MUCA 1VCFA 3P74A 3TONA 1PTGA 4O1AA 2OWCA 4IIBA 5AHNA 1EX5A 3K2GA 2CBJA 3W28A 4L9XA 5HUOA 4NASA 4W88A 1LT7A 1P0KA 9XIAA 2AAMA 2A4AA 5CXPA 3IJ9A 1DIOA 4ZXLA 3M46A 3L4ZA 4KFOA 1KKOA 4FNRA 3NDYA 1KM6A 4Q7IA 2ZUNA 2W67A 2RJHA 1C93A 1OY0A 1B57A 5D8WA 7ODCA 1TJ1A 1UPPA 3WX7A 3VILA 4HNCA 5KITA 1GT8A 2R1NA 2WK2A 2Y5JA 1YEYA 2RDTA 3LBOA 1WAWA 3ZVIA 2CLHA 3AICA 3NZPA 5DCDA 3THUA 3A3HA 2WQDA 2HVOA 2WZHA 4H9VA 4GG9A 1XIGA 1YDOA 3QPEA 2Y8VA 3BOXA 3MW7A 3FXGA 4XKYA 5AYXA 2H3BA 1VP5A 1V3JA 2DIKA 2EG7A 3VKKA 4K7YA 3AYRA 5FESA 4AD4A 1GOMA 3PZIA 1Y5XA 2UY3A 3QN3A 1H50A 4Y2WA 1ZRQA 2F7FA 3W1XA 5FD0A 2ZRUA 3GAYA 1SPQA 3W1MA 1AW1A 4GY0A 3WFAA 4LCSA 3L2IA 4MJMA 4ERGA 4Q8TA 4I9TA 1PCKA 2PC8A 3L7RA 3JU2A 3R4IA 1XV8A 3S0CA 4IH3A 2Y7EA 2YL8A 4LUYA 4GZEA 2J6VA 3HOJA 1KO0A 4YTRA 5LIYX 5JIPA 1YQ2A 3BXWA 1VEMA 3GU1A 1XD1A 1SZNA 1E72M 3IEBA 1ME8A 4XSMA 2VENA 5CBIA 2VZOA 4WSKA 2V5CA 4DJFD 1XG4A 1I9CB 4NJIA 1DWAM 3DXIA 1TZ7A 1BF2A 2NQLA 4Y7EA 1K6WA 4FI4A 3P7YA 4H01A 3EDEA 1OM0A 1H2JA 4Q32A 2DZAA 3L2LA 1UD6A 3U2OA 1E4LA 2YDRA 2OR2A 5FEPA 1VF8A 3TXZA 3W83A 3UWZA 3WMBA 4HU4A 4LAUA 5BRQA 4E4UA 3DOPA 1PCWA 2O9PA 3VIKA 1XRTA 3MUY1 4C6QA 4IP5A 1BWVA 1WKEA 3WDQA 5DXXA 5ABGA 1F3WA 3UERA 3VNDA 3PWIA 3WD2A 4HMNA 1TVLA 5D9MA 4ACZA 1VJZA 3QV9A 4NJJA 3NZ1A 3PPGA 3SFKA 1XDJA 2HV5A 1KWGA 2VNCA 1XYAA 4GUFA 3HB9A 1K8XA 1VC4A 1S3TC 4DWSD 1JCTA 4FP1A 2E6FA 1JPHA 1PIGA 3VA8A 3PTQA 1UA7A 3Q2DA 3K4WA 3MSRA 3L5AA 1G4TA 4RR4A 4A3QA 4IIFA 3TNOA 1X97A 3WCZA 4L61A 2EF9A 3TFXA 1U5VA 1G94A 2VEKA 4NNAA 1O66A 3BLPX 3AHYA 3EOEA 4DB7A 1JAKA 3NEVA 5CSRA 3LG3A 3VNJA 3S2MA 1Q7QA 2RGMA 1FCBA 3VGDA 1EJRC 2VUYA 3EDFA 2WSRA 1YPFA 3POCA 4PUKA 4W7WA 2DZVA 1LG1A 4YTQA 1UBPC 1VLIA 3HJEA 2QYGA 3W27A 4US5D 3GDRA 2JGYA 2WJEA 1TO3A 1OYAA 3T07A 1U33A 1V0MA 3BC9A 4YYCA 1AJ0A 5I3IA 3GYEA 4HU3A 3UVAA 4AIUA 2BLEA 2OX1A 4B3LA 3UPBA 4KRZA 4PUMA 2Y5EA 3WUFA 2O9OA 1LWHA 1XYZA 3OBAA 4F8XA 5BWAA 2PP0A 3LENA 3S5SA 2GVLA 3PJUA 4TU1A 5D9NA 4QNEA 1JXKA 5K9CA 4JTCA 1CXHA 3LCHA 1UH3A 5FOOA 5CZJA 3BLIA 3C56A 2QUMA 4IIGA 4PMDA 1Q66A 4LF2A 2CU0A 2G41A 1F6YA 5I09A 5K3VA 3P82A 3G0SA 1WOAA 1XHGA 2XU2A 1KXVA 1R3TA 4OECA 2PU0A 1QOXA 4M1RA 5E93A 3ZOAA 4PCFA 5EMKA 4QG8A 2NXIA 1J2WA 3VYLA 1ZJAA 3EEGA 4JNZA 4UUIA 3P0XA 3DG7A 3AHZA 4JZ5A 3PC0A 2X16A 3BV4A 3UZZA 2Z7GA 1TRIA 4PMYA 4TVCA 2YZRA 3IVTA 5CC3A 2I5GA 5CGQA 5HK4A 1HTIA 3SUTA 1PXGA 4W89A 1JYNA 1EBHA 4Z1BA 4B3ZA 2BOFX 3LV5A 3BOFA 3B06A 1E0TA 1KRMA 3N2OA 1H4PA 4NY2A 1R85A 4IGHA 2P3ZA 2XZ9A 4RE3A 3B04A 4LVBA 3W70A 1RLCL 1CXKA 2XN0A 4AY7A 3ME3A 5LA2A 1IYXA 3H4GA 1W1IE 3SZ8A 4H7VA 3N2XA 3QV8A 4MYAA 5D37A 3KL0A 4G1NA 4IL0A 1A3WA 4I9MA 1JUKA 1TJ2A 4U3CA 5I3FA 3R0UA 3PPHA 3USBA 3EMQA 4F0HA 4WDUA 4GI9A 2BVTA 4HK6A 4FEZA 5LGZA 3SJNA 1QAPA 1V77A 1OGGA 3MZNA 4Q4SA 3TQ0A 3KVKA 1I2NA 1RQEA 4RPQA 3E2RA 4HPGA 1HKVA 3WBAA 1TR9A 2V3EA 3L2MA 1O7AA 4JPGA 4RPPA 4XAPA 1XYCA 1K03A 2P53A 1BVWA 3WL1A 1HNYA 5HJLA 1AUSL 1VCGA 2WSKA 3GUWA 3P67A 3AMLA 3LA4A 5LA1A 2DZSA 3KLKA 4PRTA 2Q8ZA 3MP5A 1TR1A 2NXHA 2ZQ0A 4EWND 3LHVA 3NZGA 1EYWA 5BXPA 4UTIA 5CJMA 2QJMA 5FCZA 4WKFA 1RY0A 3NQMA 2F84A 4OBSA 1CGTA 3QHMA 3WQ4A 3CT7A 2WCAA 2Y6ZA 3BLOA 1E56A 3T0AA 4YWSA 1NH6A 2OCZA 2FIQA 3BW2A 3GNOA 4H7ZA 1XISA 4GUGA 5BMXA 1PUDA 3OBEA 1QOQA 2WCSA 3D0CA 4BI7A 2ONEA 5AVNA 3SGZA 5U4NA 1WXZA 4B15A 3CTTA 1UKPA 1DP0A 4LFYA 3AXXA 1VYRA 2OKOA 1RJRA 3PSVA 4LW7A 1E4MM 1S5TA 2CBUA 3VIHA 1W54A 1X6NA 2C8NA 3KW3A 3EDJA 1ZZMA 3W81A 3PTDA 3B9EA 4JYDA 2QKFA 4H9MA 3HPAA 4JFVA 4C7DA 3GZAA 3O0FA 3Q58A 5D05A 4YTSA 4DIAA 8A3HA 3WNOA 1BRLA 1BVNP 1W1TA 3H55A 4GVIA 5DF0A 4HNNA 1PSCA 2Q71A 4UQDA 3N15A 2BWGA 5B7YA 3H2EA 4ZMGA 3QQ0A 1XIEA 4CGTA 1T0OA 3MMWA 3N12A 3GNPA 3RDKA 3U8GA 3G1DA 3PS7A 4HA4A 2GWGA 4E8CA 1OC6A 4CCCA 4OOZA 1QJWA 4DZIA 1V51A 4AIOA 5K4ZA 3N29A 4QLJA 4GJJA 3MQTA 3CXOA 2ANUA 3E0VA 2D23A 1VBHA 2V5BA 2VEPA 3ABRA 5DLCA 3AMKA 1R3YA 2O9TA 3G5EA 1BKSA 4LJ3A 4GZIA 6XIAA 2ACQA 4YVXA 3EA2A 2IQTA 4N4PA 4PRWA 4JXCA 1NDYA 3UPWA 5AOUA 5C9RA 1L8PA 3SBFA 4U2ZA 1WZLA 3E2QA 3OB8A 3RRXA 3N1AA 4MFEA 3NG3A 2VUNA 1L6FA 1BAGA 4HYVA 3I3BA 1U1UA 3QV7A 3RMEA 1EPXA 5EFDA 3TAKA 4WD0A 1ZPTA 1FXPA 1RK5A 3CUIA 1QFEA 4E2VA 3WEZA 3F1QA 3PBWA 4U2YA 2R14A 1LOLA 3QF0A 1EQPA 3DDMA 4W8AA 2Q02A 4G8TA 5A3HA 2P0IA 3ARRA 4UQ9A 2XG9A 1CBGA 4N7QA 2PI6A 3PZMA 3TZFA 3SCVA 1H0IA 2H3DA 1RD5A 3LERA 1EOKA 3ARYA 4EK7A 3GTHA 4V2XA 5JMUA 5CPTA 3MMDA 1TELA 1I75A 1JDDA 4C6IA 4GJIA 3LCFA 4F2UA 4HCDA 3GLCA 1DJZA 3O6CA 1YNPA 1W9XA 4GQRA 2BASA 2Q01A 3BAIA 4PEKA 2GVEA 1KTCA 3CMGA 2DJLA 2EBNA 3BW4A 1EDQA 3K4DA 4Z0JA 2CESA 1VGAA 2JIWA 4FNTA 2G95A 5JIWA 3OZPA 4LUTB 1Z42A 3RCMA 1Q7MA 4BF5A 4K3ZA 2OYMA 1ONWA 3BZJA 3AJXA 1UWAA 2ZIDA 3AIUA 4UB9A 4ERIA 2BVDA 4MYXA 3PZVA 3NO1A 4LXFA 4A2RA 3S8HA 3JUGA 3W7HA 3M4HA 3PP7A 5ECVA 1JUBA 3C2YA 5KZDA 4AVNA 3EA3A 1CZ1A 4A21A 2C91A 4LBUA 3CBWA 4W86A 3I7RA 1ZUAX 5EBAA 3CHEA 3M6YA 4ZODA 2ABBA 5CAHA 1E6ZA 2CCRA 4EACA 5HBFA 4F3HA 1FHDA 1V6TA 5EY5A 3SCNA 2HPMA 3GFXA 4GYPC 3P2VA 3VXGA 3ZFHA 1XC6A 5FSDC 2BV9A 1VIZA 1WZMA 4LSBA 2VGBA 1XLHA 4QQUA 3KP0A 2O7SA 3OHIA 4W9TA 5EMJA 4ZO8A 2O56A 5DRIA 3DYPA 2QW5A 1IEWA 1MSSA 4DYJA 1KBLA 2H6RA 4DBUA 4DJED 3UESA 1DJQA 4DJDA 1E9LA 1RV8A 2RH9A 2Y8UA 3FCPA 1OYBA 2ZZ7A 4B5VA 1OBAA 3ICJA 1FCVA 3EOUA 3LN3A 2WKJA 2ZRZA 4XD6A 3RO6A 4LX4A 1QT1A 4WY0B 2QJNA 5M3WA 2D0HA 5DY2A 1R3RA 7ENLA 4NZJA 3R10A 4IQJA 1YXYA 1L2QA 1DXEA 3NQ8A 4HSHA 3MPGA 5F4WA 4GJ1A 2YDAA 4BF9A 5HULA 4L1WA 3G24A 1P6BA 1NDZA 1MZRA 5HWMA 3V0SA 1B3XA 2A6NA 1O5XA 1C91A 3IGHX 1HW6A 2AL1A 1M04A 2Z1XA 3L4XA 4Y9NA 2V5KA 2GJPA 1QU4A 3GHRA 2XFRA 2W61A 3TP4A 5CC6A 3W71A 4ZTYA 1ZLPA 4DQWA 1HT6A 3NPXA 4QCEA 6TIMA 1V08A 1IZCA 2J27A 1Y5WA 3CB3A 1E9YB 4L65A 4FK9A 3QTGA 1K02A 4PMOA 1ISWA 3AIWA 1GNXA 2VFFA 3PBYA 4PL1A 2W9MA 8RUCA 2QCFA 1XCWA 4B5SA 4OVXA 3ABQA 2PDBA 4KEVA 1XLJA 1E3XA 1X8CA 3SN4A 1XIMA 4TXEA 1RCOB 3Q37A 4J5NA 1OZMA 2ZZ5A 1NU5A 3KBNA 4JTJA 2VCAA 2C18A 1W31A 3GR4A 3LCLA 4JS3A 3A3WA 3B9AA 3RN6A 3FDGA 4XG1A 5DELA 1TMQA 1IWAA 4DYEA 3LCGA 3LSBA 3QMSA 1V03A 4XVEA 4LUTA 4IPIA 5MHBA 2YFNA 4LBRA 2E77A 4ES4A 2DW6A 3VKDA 3HPXA 1E4NA 4LAOA 4PTWA 3MMTA 3W84A 2VFDA 4HMCA 1D3GA 4EF9A 4UIOA 4ZBCA 3V1HA 4CNTA 4R9XA 2HZGA 1M3UA 1UR1A 5M1TA 1A4MA 1SW3A 4IPJA 3KRUA 3B40A 4HOXA 1VH7A 2JALA 5AZ1A 4C6PA 3NOEA 1ZBWA 3VFLA 1R3SA 2VOMA 1WAUA 2KX9A 4UCGA 2VELA 1MFVA 2PTWA 3K8KA 2VCBA 3BMVA 4PMXA 3SURA 5G5IA 4LVGA 3M47A 3RPTA 4E6MA 3GH7A 1SFSA 4AVOA 4DELA 2FMNA 3GG8A 2WC7A 4H2HA 3TR2A 3W7KA 4ICMA 3GBDA 4P2VA 1GORA 1C8YA 2BZNA 1EPVA 3B9NA 1JAEA 1X6LA 3NXFA 3H7RA 1I2PA 4QHRA 4XZIA 4HMEA 2ZADA 1XH1A 1WZKA 3B8DA 1FWCC 1WB0A 3KE0A 3W4RA 2QMKA 4MKSA 1OYCA 1TVPA 1RY8A 4W4QA 8XIMA 1R86A 2HBXA 1B31A 1TMHA 4FLQA 3DG6A 4PULA 3RIKA 1V8EA 3E96A 3O6AA 3UF9A 3DN5A 4K1GA 1ISVA 2OKTA 1PKYA 4LQ1A 4TR9A 3S9IA 3I65A 2MUCA 4D6CA 1MW0A 4CN6A 4CVUA 3SIZA 1H51A 1UCWA 4JHZA 2FH8A 1T40A 6PTDA 1JR1A 2Z1BA 3ID7A 4H4IA 2QLYA 1CCWB 1Q2SA 2VHLA 3QQWA 1A4LA 3MC5A 4M19A 5IDIA 4O0QA 4TV5A 3LTPA 3P81A 4O53A 4D1JA 1FRBA 1V7YA 1DWJM 3JS3A 4A8RA 4Q6XA 2NVDA 4LV4A 2ICSA 4GIEA 1Q6EA 3PSWA 2WLZA 1UBSA 4E2BA 4QLLA 2E9BA 3R89A 1H7RA 3EZ4A 3NL6A 5CSUA 1E1EA 1XBZA 1AFSA 3L12A 4N02A 1XL9A 1RBLA 2TODA 5FEWA 3DFYA 4O14A 4MNKA 3T40A 3RAOA 4YLWA 2VDGA 1UD3A 1QI2A 1AVAA 2NXGA 2DV0A 1OCNA 3DERA 4I5RA 2UZ9A 1XYBA 4WKHA 4GQBA 2DW7A 3W1TA 1X39A 3USZA 3SUWA 4C6EA 3HV9A 4PSRA 2BTMA 2J7BA 5FJTA 2HJPA 3KS6A 1J10A 5DN1A 3CZKA 1FHVA 3UR8A 3GNXA 4YWIA 1Z6KA 4OIFA 2YB4A 4IGMA 1TWZA 4YU1A 3W75A 2W66A 5C5YA 4P8WA 3EDKA 1B9BA 1DQXA 3TWAA 3DKJA 2J7DA 1IGWA 1GQJA 5J8LA 4O8AA 4I8DA 5EBUA 3WENA 2FQIA 4PODA 5AYIA 2V8ZA 1A0CA 3PNZA 2I1OA 1BGAA 2EPOA 3RPMA 1Y8BA 4DXVA 3MSYA 5GQBA 3T8QA 5IHRA 2ZA1A 2RDXA 2CXGA 4GVHA 1F8MA 1WBJA 4PRRA 3WLKX 2IW0A 1P0EA 4XZLX 3NAVA 2GSHA 4AH7A 2Q09A 4LF1A 4JIHA 3V7PA 3CT2A 4DVOA 1GVEA 1VFHA 3V36A 3AZSA 3SAZA 2VJXA 4UTWA 2QV5A 4XV0A 4AB4A 3QY7A 5GJNA 1VS1A 3N4AA 2VL4A 3HG4A 1H1NA 3ONBA 3N3TA 1C9WA 2OLAA 3WN6A 1B4KA 1TPWA 2XGZA 1CGVA 2GVJA 1JZ6A 5IFTA 4NJKA 4M8UA 1LF1A 2FTPA 2H9AB 2G96A 4O12A 2OWWA 2NV9A 2G3FA 2NSXA 4QJ3B 2JE8A 1Y0EA 4MGGA 2RDUA 2CIPA 3T81A 3PANA 1J8VA 4LGXA 3GR8A 1BYCA 5HAOA 1DQWA 4X9YA 3R11A 4AMCA 5DBUA 3SN0A 2I14A 1X96A 1H3GA 4NYUA 2YW3A 6A3HA 3JR2A 1PKNA 5D32A 1EYEA 3N3MA 3N6HA 3VOIA 5BU6A 1XUUA 4DWSB 1AODA 3R0DA 5KZMA 1UW9A 2I57A 2QR6A 3W76A 1MXDA 4ZB5A 2HMCA 1YMYA 1JJKA 3LBMA 1R3VA 1TREA 2E25A 3IVSA 1A5MC 1NJJA 4B2DD 1W56A 1CTNA 1GVFA 1GGOA 2FGLA 5EB8A 2BVWA 2YSWA 4C1KA 1SO6A 2WVUA 1J9YA 4TQTA 3IUHA 1IWPA 1RPXA 1IT0A 1NQKA 7XIMA 3W7LA 3WEMA 5AC8A 3RYSA 2YW4A 4GHRA 2WM0A 4C7FA 3ZT5A 4Y9PA 2E5BA 3O6YX 2PSNA 3SDOA 4W5UA 4ZB0A 3E5BA 2XN2A 3DBPA 3GKAA 4C90A 1FWIC 2FYMA 2YPIA 1UP3A 1RAKA 1W5PA 3ARUA 4DF1A 3B9DA 4WGXA 2NW0A 4PMJA 4GI8A 3KWSA 4GYJA 3NIYA 3O8AA 5CBJA 3WL0A 1I8JA 1ZCOA 2ZX6A 4GCXA 1JF6A 2VQUA 2XPKA 1XWYA 2VX7A 1ZAIA 4JQ3A 5FEXA 1OFPA 2QNEA 1XINA 1GTHA 1NAL1 1VHCA 2BHUA 3CAWA 3ZT6A 1U5HA 4XSLA 2B7NA 2E1WA 5C2XA 4NZFA 1KRBC 1CYGA 3IIZA 4B9YA 3AYVA 3J7HA 3P0WA 4MNMA 3TSBA 2Z1VA 3DFNA 3GW3A 1H7NA 1MFUA 2VQTA 4M56A 1GHRA 3KBWA 1PS9A 5BZAA 3CAQA 3S1WA 1Z32X 2DVTA 3IJIA 2PWVA 1E0UA 5D38A 3TC3A 2IPFA 1UKOA 4L6DA 2E9LA 4KWUA 3CC1A 4MDPA 1WDWA 3GZ3A 3BMWA 1PB0A 3LCXA 3OYXA 3IANA 4MLRA 5A8GA 1RJPA 1TPUA 1SVDA 3N04A 1PYFA 3KAOA 2FPTA 3KOFA 3GC4A 3MB9A 3O15A 4W8LA 4JNYA 3QC3A 2QUUA 3IK2A 3RM8A 4P8UA 1XLDA 1EGMA 4I7WA 3KL3A 3WMCA 1UR8A 4JQ4A 3S6TA 4J28A 1RBAA 2FDSA 1OSEA 2RJGA 5A8OA 5T8GA 3BO9A 4RZ5A 4FNUA 3WNPA 1BFNA 1AZ1A 1LQAA 2AAAA 3FEMA 2J9ZA 3PZ9A 4HP5A 2JF7A 3DI0A 3QR0A 5AHLA 1H1YA 2XVNA 1DWHM 1VFSA 2WJZA 4MY8A 1ME9A 3W01A 1VBUA 1R3WA 4K8EA 4H9TA 1US2A 3LHUA 3LMZA 3S5YA 3DEQA 1Z3NA 1QWKA 3AOFA 3G3MA 4WJEA 5I23A 5LXXA 4X3ZA 4GPNA 1UP0A 4HHMA 1ECQA 2INFA 4INFA 3GD6A 2QF8A 1W9PA 4L7ZA 2PP1A 4DWSA 3BZGA 3NSMA 3GBEA 3NJ3A 3A3XA 2Z29A 1YDVA 3DFSA 1DOSA 4P7NA 2DPEA 4ILSA 1YLVA 5C2CA 4DYKA 3VINA 2Q3OA 1E6QM 4P61A 2OYKA 1VFMA 4LY4A 3VKAA 3FKKA 3S1UA 3GVQA 3S83A 3LEPA 1J5TA 2HEJA 4XIMA 1FWNA 3TXVA 2PDGA 4AAJA 3LZ5A 4AZ5A 3SRKA 1PTAA 2JKEA 2R1MA 3GH5A 1SFLA 5G2HA 1P5BA 4KCUA 2YCIX 1Z48A 3VGFA 3BTNA 4JX5A 4MMWA 3BSHA 3OJGA 2G4FA 1MNZA 3R43A 3FV9A 2YX0A 4WLCA 3EBVA 5BOEA 2G8ZA 2IKIA 5FF3A 2BOEX 4NF7A 2J62A 4FXFA 3RJXA 4B9ZA 1VENA 4DJDC 2QCMA 1DJHA 3PWGA 2G4JA 5GNYA 3LM3A 2WAGA 3VAVA 1ISYA 5DQPA 2VC5A 2B7QA 1V3KA 3G2GA 1S1RA 3GX9A 1CXFA 1F05A 4CQ8A 1C29A 4E2OA 3CK5A 1XF0A 3IGXA 2Z00A 4QGCA 2J8FA 4JEJA 4E3TA 3VMPA 4GOAA 4XAGA 2YBVA 3KZPA 3VDAA 3MCOA 1XIIA 3O06A 2EPHA 4XUYA 3BAKA 3AU6A 2W3ZA 1CGUA 1OADA 1KBIA 1IXQA 3O6DA 3W1PA 3E9AA 3E0LA 5DY3A 5HWJA 2J88A 1FCUA 1PBGA 2ZRXA 4I9AA 3B8TA 2NWSA 1GHSA 4RDYA 3IWPA 4IQLA 2XUCA 1OX6A 4PB5A 2X1SA 4Z1CA 4IQEA 3OGRA 3WF0A 1DHKA 5DMYA 3RU6A 1LCOA 1YKWA 5DEZA 1CLVA 1DJIA 1FKWA 2ZXQA 5I03A 2VVSA 3MP4A 1BGGA 3CASA 3DC8A 3HU7A 1QHOA 3EMCA 1MRAA 4IFRA 3MZ2A 1ONRA 1VPYA 2Z24A 4IMFA 2C7FA 3QBUA 4ZOBA 2YYUA 4DAFA 2HS8A 1UYQA 1VJIA 2WVVB 2GDQA 5HXMA 4QISA 3OYZA 3VGGA 2QCGA 2OZ3A 3DGBA 3VD3A 4NQ1A 4K2SA 1QNSA 3GXPA 1FWJC 3KVMA 4PE8A 3T42A 1GG1A 2VZTA 4IIEA 3ZQ9A 5E09A 3WNNA 2VR4A 3CGTA 1JZ2A 3LZ3A 2F9RA 4CD5A 2O7QA 1A5CA 4IJRA 1QPQA 3IIXA 3VKJA 3QHOA 3MUIA 1CI1A 2X40A 5F1UA 2QXWA 1HXJA 3TJXA 4AXKA 2DSVA 2FZ9A 4ZR8A 3FAXA 1E5NA 3GG1A 2X30A 4J7RA 4NG3A 2BSLA 3WUEA 1KFCA 1VRDA 1HJQA 5SWUA 4JL2A 2A3EA 1J0HA 2J8GA 3F4DA 5LXEA 2CZ5A 4RUBA 1IEXA 1J0JA 2I9EA 3UG4A 4ZQCA 3MU7A 4UOQA 3U2ZA 1AH3A 1FWRA 1ZFJA 5BXSA 4DBDA 3CZLA 1SZRA 1VBGA 1E1FA 3RNDA 1LBLA 2DFAA 4NJHA 2J24A 1YDNA 3R8RA 2HS6A 2EPMX 5LGXA 3EPOA 3CWNA 2XWEA 3R5EA 5LNVA 1P4CA 1X1NA 2H90A 2PWHA 3EOSA 3HGOA 1JFHA 4KPLA 2VOTA 4QEEA 5I78A 3SGGA 2FDMA 4HJFA 4G1KA 3RJYA 3VDBA 3H21A 4MADA 1WZAA 1HVQA 4HVXA 2VZUA 3ZJ7A 1NDWA 4C6NA 3GRIA 1D2KA 2GGGA 1LRTA 5DFAA 4FLOA 1JCNA 1PHWA 1VFFA 3C8NA 1S2VA 2E1DA 3GIPA 1M5WA 3W74A 1GOWA 4J3WA 7PTDA 1UWUA 3L4YA 3O0KA 3S6DA 1SJCA 3IARA 5HATA 2WM1A 1PAMA 2CITA 3EWXA 3WJYA 2AQVA 4AXNA 1TX0A 2C13A 2MANA 1W3TA 3N2CA 4F0MA 5D03A 1W3NA 4HZ6A 3KRBA 1DIDA 3FS2A 5FI8A 4EPDC 3VD7A 4XX6A 1D3HA 2DDXA 1ECEA 1W1B1 3WFLA 3OO2A 5FF0A 3PFMA 4DI9A 4JKKA 3LS9A 4DNMA 3GDMA 4LPCA 4AWSA 3DU0A 2XVLA 1EDTA 4JYEA 1SSGA 2IQDA 4Q4PA 4WSJA 2P5NA 4WF7A 1GKQA 3UY8A 1R9XA 3WH9A 1J4EA 3GVGA 2GJRA 3N2BA 5C9ZA 4S3JA 1SQ7A 1ZS2A 1H5YA 4C60A 3EYPA 2Z0IA 2ATSA 3WQVA 2WVVA 1AW5A 2OGJA 2XH0A 3RXZA 5A8NA 2L5HA 4HU8A 2FVKA 1PL9A 1PVNA 3ORWA 1GQLA 5JBEA 1HJWA 3LU2A 4HCHA 2Y61A 5ENLA 3UZ5A 2E6YA 3AIEA 3WNLA 3FY1A 1DXFA 1ZENA 1UG6A 1TUFA 5TAOA 4FO4A 3CWHA 3VTRA 4Q8WA 1AQHA 3F4VA 1VBRA 4ZSTA 1UJPA 4NUWA 4KCWA 3HN3A 3C0QA 1K9FA 4J3SA 1FBAA 5A5WA 3HO8A 6ENLA 3RLHA 3PG9A 1W3KA 3LNMA 2D2GA 1PHQA 2J25A 3CEUA 4EXQA 1L8NA 1EA9C 1UKTA 4A29A 3MYOA 2J74A 4K1WA 4H3DA 5G4WA 2EJ1A 4LYPA 1NVMA 4JFSA 3R94A 3WH5A 4RNJA 1XDMA 3WLMA 1P7TA 2AL2B 4MAZA 2UY4A 3A4WA 3RLVA 2BXZA 3RITA 1J0ZA 4ADSA 4EXBA 2R1KA 4MB3A 4A2SA 1HZYA 1YYAA 4Z0SA 3GW0A 4XD5A 3EB2A 4PMZA 3VD9A 5AYYA 5CPLA 4PCTA 1NFPA 2DZTA 2OOFA 1BXBA 3U2EA 3T2OA 3M44A 3FVDA 3TMLA 2KAUC 2WSYA 4KRTA 2YDSA 4D6GA 2E6AA 3VCCA 2Z1KA 4F9DA 2QCDB 3T6CA 3KXQA 1TV5A 1C7TA 3KBJA 3FK4A 5CJ5A 4CU7A 1OHLA 3KDNA 4LUIA 3W7GA 2FPYA 2BODX 4ZTXA 2OEKA 2B81A 2D2JA 2FFCA 4V33A 4O4WA 2PC4A 1RR2A 1B0IA 3PULA 5I07A 2HK1A 1PIFA 2CKRA 4WHBA 1M65A 2INEA 1CB7B 1H11A 1VPQA 3GB6A 3PZUA 3UJSA 1XYFA 1UZDA 4AY8A 4POCA 5EU9A 5GNZA 4OUEA 2E28A 3U4FA 1FHUA 5T91A 3QGKC 2DT3A 1UIOA 3VE9A 3BSGA 4FPSA 1K9TA 1NOWA 1EJUC 2YYTA 3W1UA 2PDFA 3GWQA 3H6OA 3UXDA 4E3VA 1P0BA 3OGVA 3GH4A 4HU0A 4IMDA 2QUNA 3TFCA 2E7FA 4DJEA 5CLWA 1RQHA 2ACSA 1RH9A 2OJPA 5IFPA 2Z4GA 3UPMA 2GZXA 2OO6A 2AGTA 4IT1A 3QSTA 4NZ5A 2DSZA 4AF0B 1F5ZA 4H1ZA 4JIQA 3C61A 1B90A 2PMQA 3PBGA 1R2TA 5KMYA 4N9EA 2NQZA 1FWTA 3BGGA 3H8AA 3E1F1 3GHTA 2XH2A 2FHCA 4E0CA 4NRSA 5IHSA 1B54A 3S6OA 1JD7A 4V15A 4H6KA 3ANYA 1W5QA 1L6YA 1HVXA 2QV4A 1OG6A 3F03K 2GJLA 3UNTA 4J3XA 1PKLA 4O1CA 4AX6A 4LS0A 3H22A 1PJ9A 4GUHA 1A5AA 1Q85A 2PODA 4W93A 4DY1A 4D8AA 2YB1A 2WNNA 2TAAA 6REQB 1EC7A 3M0XA 4GVGA 4DLMA 1C9DA 1DJNA 2PDCA 5HR7A 2PDXA 5CPNA 1W37A 3SSZA 2GGEA 3WO8A 5D2YA 1PDYA 2UY2A 3VM7A 4M29A 1GOQA 1M01A 4PUWA 1GTEA 1JD9A 4JIRA 1S2TA 2BS9A 4DHGA 2PGWA 4TX6A 4IMAA 3NYDA 1XIHA 3HQPA 1E1CA 5FIPA 2OSYA 1N7KA 1E40A 2WB5A 1TTJA 4LCRA 3WBYA 3OGSA 4UNLA 1KM5A 3N2TA 5FJUA 2FVLA 1ZNNA 1Q8JA 3H54A 2RHGA 1EP3A 1TV2A 2TRSA 3KVLA 4PCNA 2A5HA 4DJFC 1AQMA 1UD5A 4HHPA 1AZ2A 2WMJA 1EXBA 1VKFA 2QCDA 1Y5VA 2GGIA 2Y0FA 3WK1A 1UIPA 1QO5A 3OA3A 2BHZA 1FWEC 5HMFA 1EZ2A 4MY9A 3SFWA 1SW0A 4J40A 4JY9A 3BE7A 5K2ZA 1SJBA 1EEXA 1AW2A 3LXAA 3P80A 4Q8PA 1PEZA 3GC5A 3WKZA 5F2IA 1HQTA 1Q65A 3SCTA 2BDQA 2WC3A 4AEOA 3OOQA 3MWAA 2DJXA 2DU2A 2EQDA 1TB3A 4C6FA 3M5ZA 4QTGA 4DWSC 4TV6A 1TA3B 3EX3A 4C6OA 1KTBA 2PA6A 2ZOXA 5AN7A 3B03A 1KBKA 1OFRA 3BW3A 2QDEA 4ADUA 2DZXA 5F4XA 1POJA 5EMUA 2C19A 5LNRA 4BQ3A 1W3HA 1T7LA 4HZ8A 2W27A 1MXGA 4BQ5A 4PMQA 5A94A 1WXJA 3PK7A 3M07A 1KWKA 3FYPA 1BF6A 1M9HA 3QVQA 1G1YA 3GFZA 2ZVRA 3ZLGA 5BW6A 2X1RA 5HNRA 1RSCA 4K8HA 4GXWA 3GFYA 1EO7A 4S3KA 4GX9A 1O5QA 2JBMA 2J13A 3S3GA 4M5PA 2YXXA 3SCUA 2ZTKA 3LTSA 3H2MA 3VKCA 2O4MA 2VDHA 1QDSA 4CNUA 7REQB 4ZXOA 2NQHA 2A85A 2QMJA 2FVMA 3PHAA 2H8ZA 1CT5A 1YPXA 1VEPA 4GH3A 1EO5A 3GG7A 1QBAA 1U1JA 2WSPA 1W91A 1MUWA 3GSMA 1W8SA 4NRRA 4FX8A 1X7IA 2OQHA 3L23A 1O12A 2DGAA 2Y1HA 1F3EA 1R6WA 3VNMA 1FY6A 3STPA 1ZBVA 1SUXA 3UVIA 4JL1A 4GA8A 4GGHA 6REQA 1DJYA 5H8PA 3BQ5A 3FVMA 1WDPA 1J5SA 3WLLA 4GO8A 3QKZA 1PPIA 1VZWA 3AZRA 3FA5A 3GM8A 3IGUA 4YVVA 2DT0A 3ZJKA 3C0SA 1E55A 4KWVA 4KWSA 3GTIA 4OBRA 3CV7A 2V38A 4PR4A 3P8JA 3VE7A 3KTSA 1JZ7A 4OT7A 3W00A 1GOKA 1GW1A 4XBSA 1ELSA 3S9YA 2ZUWA 1VHNA 1XUZA 1TE6A 3AIBA 1X8FA 2WZIA 1S38A 2PWUA 4H9YA 2HVNA 4BI5A 3HURA 2XJ7A 3TQVA 3M0YA 3TLLA 4C6LA 4Q8OA 2V2CA 1V0LA 1R9YA 4NI8A 4MNLA 4RDWA 2WBGA 1SFTA 3TYBA 4WX2A 5C9XA 4R5EA 1UMLA 4MJZA 2BFGA 2V63A 3V4BA 3K8MA 2Y2WA 2ZA2A 3TW9A 4AZ6A 4H41A 4FOJA 4PCSA 3QOKA 3BG3A 3PTKA 3W2LA 3CV2A 2E5CA 2V2HA 3MUZ1 4JEQA 3M0VA 1G9HA 3DFPA 1FWWA 2Y7GA 3CHVA 1X1OA 2VR2A 2PTXA 3KRZA 1OABA 4IZGA 3RR1A 1I2RA 4K36A 1KFLA 4WCJA 3JZEA 3N4FA 3M0KA 4FOUA 2R8WA 1CNVA 1IZJA 3QGAC 3QYSA 3WNKA 1DWGM 5LIKX 1Q6OA 5LNWA 1YW1A 4B16A 1HGYA 1LYXA 2PDYA 3S1VA 3IAQA 4QX4A 3TOYA 3QY6A 2X0SA 4XZNX 3URAA 4YIWA 1V6WA 4HK7A 4X60A 1TA3A 3CMFA 4WGHA 2OZ0A 2WMFA 3TV8A 4B90A 3W7PA 3WD3A 1NP2A 4HNVA 1ICSA 3UEQA 4P7LA 3O16A 4JTFA 4DZHA 2O92A 2PURA 4P8XA 1N8IA 1QRQA 4DO7A 1Q2RA 1W9BM 3LHZA 3E0IA 3F4NA 3SRDA 3SY1A 7TAAA 4D9PA 1Z8AA 2OLHA 2ZRVA 3ECQA 4PB4A 4PTDA 4N2YA 4D6JA 2CLLA 1QATA 4QG6A 4WK9A 4GBDA 4MZ8A 1OQFA 1TV8A 4CU6A 3NPVA 3ONCA 4QG9A 4KFPA 4BQ2A 1XW8A 7REQA 1OFBA 5E6YA 1TJ0A 3GXNA 3EA1A 3NQCA 4FR6A 4GX8A 3HFTA 2YIHA 2GSJA 3POHA 1AQFA 2X41A 2YBTA 1BWKA 4AQLA 4XAYA 1TWWA 4H8NA 4C1LA 4DLFA