3APYA

Properties and crystal structure of methylenetetrahydrofolate reductase from thermus thermophilus hb8
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
291
structure length
291
Chain Sequence
MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylenetetrahydrofolate reductase
publication title Properties and Crystal Structure of Methylenetetrahydrofolate Reductase from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 104
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3apyA00
3FSUA 3ITGA 4JNZA 3IJDA 3E2QA 3FSTA 3APYA 4O8AA 4JNYA 1ZP3A 1V93A 1TIWA 2FZNA 3E2SA 1TJ1A 3APTA 1TJ0A 2FMOA 1ZP4A 2FMNA 2FZMA 3E2RA 1B5TA 1TJ2A 1ZRQA 1ZPTA
chains in the Genus database with same CATH superfamily
5MKGA 3LCLA 4XZBA 3NSNA 3P81A 5HJYA 1EJSC 3QFWA 4E4FA 3GBDA 4IMDA 4M5PA 1QK2A 3LBOA 1EOMA 4BQ4A 3M0JA 1JEZA 4LY4A 2BB0A 5FCZA 1RLCL 3W7HA 3U6WA 2QKFA 3MUAA 1UZDA 1TZ9A 3FS2A 3PBWA 1DVJA 2DVXA 3N25A 1Q8JA 1K9TA 1GW9A 3WEMA 3AWOA 1XIBA 4HPJA 1CGWA 2PWUA 3OHMB 4DJFD 1CI1A 1G4EA 1EUNA 3FNDA 4W85A 3EB3A 2PAJA 4GY7A 1E6ZA 4HD5A 5A6KA 1Z6KA 1PIIA 3ARQA 2XIJA 5J5RA 2O7QA 4EWND 1JD9A 4AX7A 3SB0A 4CKQA 4MY1A 4YTQA 1XQKA 4Y9NA 3VNLA 1Y5WA 1I6NA 2A5HA 2HXTA 3WYZA 3UESA 2UY3A 2HEJA 1AW5A 1EFZA 1QT1A 2V3EA 4JOMA 4L80A 6XIAA 2HDJA 4XTIA 2WXDM 1OT2A 4JYDA 4MYAA 4X63A 3KBNA 2W61A 1Q6FA 4H6RA 2NX3A 1WXJA 2RDXA 3U2OA 5A8GA 2HS8A 3R13A 3VCRA 1CW2A 3PBMA 2HISA 4DJFA 4EACA 2FGLA 2I14A 1TPB1 2CLMA 4XVEA 2WKLA 3NUKA 4Y9PA 2V8ZA 2J13A 3ARWA 5GPRA 4JQAA 3CHFA 1UHVA 4LVDA 3VGGA 3BQ6A 5EMJA 4IFOA 1E73M 3W73A 1B3ZA 1A4LA 1W3KA 4TVUA 1NJJA 1NM9A 4A2RA 1XSIA 4WY0A 4JQ1A 4N9BA 3D3FA 2L5HA 5I2UA 1J93A 1CYGA 5K4ZA 1QOQA 2VEMA 1Q2SA 5HMSA 4KRUA 3BICA 1SZGA 3NZ1A 4AD5A 2X1IA 5TAOA 2E9MA 4O28A 5CGQA 3CL7A 4Q8QA 4M51A 4JTEA 1UP3A 4XIAA 4LV4A 4MAVA 3KTXA 1W8SA 2X40A 1XW8A 1EWDA 2W9MA 3IIOA 3QN3A 3CUGA 2PWDA 5BMXA 4IXHA 1AA1B 3WK2A 1Q6CA 3VNMA 5EMKA 1KFCA 1EJVC 3L65A 3MO7A 4IFKB 3CV1A 3W1PA 5HR7A 4DNHA 3OIHA 4QROA 4W87A 2PZNA 3NA8A 4XBKA 1KRAC 5E9XA 5LIUX 4P5UA 1GQJA 4DWDA 1W8GA 4JQ2A 4PGLA 1QJWA 3GUWA 4O1DA 1ZSXA 4N02A 3PPFA 3DYMA 5HANA 2FZBA 3HGJA 1WZAA 3CV7A 3PBVA 3LLFA 1LOQA 4PEKA 3VOGA 1KGWA 1I1WA 1Q6RA 2Y8UA 2ESCA 3FHAA 3S9IA 4NAEB 5CSRA 1REQB 3KOFA 1BG9A 1EUAA 3H21A 4JTFA 3PF3A 2PTDA 4YTSA 5GJNA 4RW3A 2JF7A 1FWWA 3CHVA 4FMVA 4DHGA 4GUIA 3IJ8A 3AZRA 1P0KA 2FVKA 3NL3A 3BE7A 5L9FA 1K9EA 2J77A 1E9YB 3FEQA 4DIAA 3VNZA 1R7AA 3MDUA 4RW5A 1JDCA 4DELA 4F0MA 1ZBWA 2P88A 4KWWA 3HMJG 3VILA 3EPMA 1YPIA 3HQ1A 4HOXA 4DXXA 4L6OA 3LHWA 3BLIA 5FSDC 2JEPA 4IMCA 4A3RA 4IPIA 3F2DA 5ECUA 5D2WA 4YWSA 5AHFA 3MZNA 2O9PA 4D9PA 4AMAA 3PS7A 1LG1A 4JHZA 4O4VA 3N6QA 1B3YA 4YYFA 3CHEA 1OM0A 4ASTA 4MJ2A 3WUBA 3PY2A 1H51A 3BJFA 6ENLA 3IGXA 1KV5A 2R9RA 2W92A 1GVYA 1NU5A 3PM6A 1XGDA 1A4MA 5IBXA 1VAHA 3P14A 3GHRA 4A22A 1UWAA 1P43A 2J8GA 1I2RA 2QR6A 4YHGA 4HK6A 3HOJA 2C18A 5BW6A 4F0LA 3TW7A 1OBAA 2GZXA 5HJLA 4AYGA 3ARPA 1IT0A 1IWPA 1MMFA 2YKKA 2VZTA 2G41A 4NRSA 1OFQA 3ZVHA 1GZGA 3Q4DA 1OYBA 3F4DA 2VGGA 2GGJA 1LZOA 4O8AA 1K6AA 5U4NA 3UNTA 1DORA 2JIEA 2XINA 2YCLB 3RFAA 3KS6A 4QP0A 1DJQA 4OHQA 1I2OA 3EA2A 1QBAA 2CLHA 1XCWA 3ANVA 3SGZA 4WJXA 5AC5A 3PHAA 4AY1A 3C3UA 4HYRA 4UNLA 1OGGA 5DELA 2QF7A 3ABQA 1RCOB 5H1WA 3NQFA 1F7BA 3GU9A 3V5CA 3GX9A 1F9CA 3GG1A 5A6TC 1R38A 4GC3A 2YJQA 4J7RA 2HXUA 4KWUA 3PNZA 1WDDA 3T44A 3CQKA 3SRHA 2V2DA 4GFIA 4XAZA 4OIFA 3V16A 3F03K 3VTRA 1XIDA 2NXGA 4V15A 2PTZA 2FH8A 4BWLA 1NP2A 3ID7A 2BXZA 5CZKA 3D6NA 1K70A 2NVDA 4NI8A 5I3FA 2Y7DA 4GZJA 1ME8A 2CFFA 2PCQA 3GC5A 3T05A 1MDRA 3TDFA 1PL9A 5E6ZA 3AI0A 2IQTA 1A5NC 2D2GA 3VOIA 4BA0A 1YXYA 3TYCA 1L9WA 5HQMA 1EXBA 1HP5A 2Z2UA 2WSRA 3ABRA 2W91A 3LZ5A 1EEPA 3M0XA 3TXVA 4UFLA 3SR7A 2VFEA 3BZJA 3E0VA 2G8ZA 5FF3A 1G0CA 2HV5A 4HMEA 5I3IA 2CZVA 4RZ5A 2Z2AA 1OFEA 3CJPA 1V4YA 4W86A 1L0PA 4CQCA 1TPH1 3YPIA 3LN3A 1EGVA 1WUEA 2WZHA 5CG7A 3B0VC 4DJDC 3W7OA 3PZMA 2YW4A 2ZWYA 4IIGA 4MNKA 1P0NA 3ZFHA 1W9DM 3NM3A 1L2UA 3P5YA 2UWFA 1YPFA 2WJEA 2OOFA 3SUTA 1KM5A 3ZT5A 3M46A 1SJDA 4DI9A 2PDBA 1FWNA 1SU5A 1G94A 2C3ZA 2WSPA 1HVXA 4ZO9A 3NJ3A 2PLCA 3RCYA 4E4PA 4B5SA 2ZICA 1U83A 4FF5A 5EMMA 3V1PA 3ZJ7A 1ICQA 2CZEA 1QNPA 5FJPA 2ZADA 1JI1A 3MA8A 3T40A 3TH6A 3WBYA 1V6XA 3FHQA 1DBTA 1W6TA 2YXGA 1V93A 3SY8A 1T0OA 3NQVA 2AQOA 2PRLA 4LQ1A 1UBSA 5KZ6A 2G96A 3VOHA 4WLCA 4O4WA 1UH3A 2FJUB 2OU4A 3IK4A 2YW3A 1WP6A 3PN8A 1ZFJA 2JFEX 3CHCA 4C6FA 3DFHA 4JX6A 1CGUA 2DT0A 3QTGA 1J0ZA 3AIBA 1ELSA 1YDYA 3W1RA 5C71A 3UZYA 4AY8A 2ONEA 4JL1A 1JUEA 3BZGA 3HPZA 4XUGA 3GU1A 4QJ1A 2XUCA 3C2RA 1H1YA 4F48A 4Q8OA 1B90A 3URAA 3BW2A 4FZIA 1UR4A 4ZA0A 2BY1A 3WDHA 3GZ3A 4HZ6A 3CWOX 3GWQA 1L6YA 4E8DA 4MUZA 1DJWA 4U5IA 2OPJA 3H24A 3SIZA 3QPYA 4UWMA 2B7NA 2QF8A 4K1GA 3HF3A 4HU3A 1KD0A 1RBOB 2OO6A 2WVVA 3JUGA 1VH7A 5FEZA 4PUDA 1KBBA 1ZQ5A 1GOXA 2XG9A 1TPFA 1CXLA 1GVRA 1G01A 3WUFA 3H2FA 3UQNA 2REQB 2E9LA 2C19A 1KFJA 5DMYA 4MKVA 2TRSA 4B5TA 2OFJA 1BXBA 2QVHA 2BFGA 4MLRA 1DWFM 1ZL1A 1RSCA 2BY0A 1B3XA 4UQDA 2FGZA 1MEWA 2V3FA 2X1SA 3UG5A 5HULA 1VJSA 4WRHA 3IJLA 1NFGA 2C16A 1XR2A 3KRUA 5F2LA 2W5FA 2GYIA 3G2GA 3AOFA 4E0CA 2FFCA 5FSEC 3GU2A 1Y5VA 3TFCA 1FCBA 4FOJA 1PS9A 1ADOA 3N73A 3N3TA 4DWSC 2QAFA 2QEZA 3PBGA 3L0NA 4C6OA 1IIGA 3F5KA 3QHNA 4JIEA 3ALGA 4OOUA 3HN3A 3VU2A 2QJGA 5IOBA 4L1GA 3QOKA 2QS8A 2ZIDA 4ML4A 4H8NA 4IT1A 1RHCA 2ODOA 3CUJA 1TX2A 3MB9A 4JEQA 5AYBA 2RGMA 1V02A 4AZIA 4O1AA 2ZE3A 3A9BA 4I5XA 2WHJA 3ICJA 8XIMA 1IEVA 3VIGA 3H7RA 4AZ5A 2TPSA 3VXGA 1GZ1A 4O18A 1OWQA 1V0KA 2VENA 2FHCA 3C6CA 3CTTA 2J88A 1LOSA 3GIYA 1EC8A 4D6CA 3DFPA 4AMCA 1ZALA 2H3BA 2DPEA 1KKOA 2VFDA 1FX6A 3TC3A 1CIUA 2QLYA 3KLLA 4C6MA 4CD8A 4YNGA 2TAAA 4J3UA 1RP9A 2E8ZA 1N8WA 2YBUA 3IJ6A 6TAAA 3AXKA 1L6GA 5TF0A 5ABFB 1M41A 1S1PA 1E0UA 1IT8A 3GM8A 3IJIA 3CC1A 1XF0A 1V0MA 3WLQA 3TR9A 1H09A 1VB9A 2PDFA 4KT2A 1J5TA 4XAFA 1GVQA 1ISWA 4M6QA 2YDSA 1FRBA 2GJLA 3AHVA 1J2BA 1UD8A 4Q32A 2VCCA 5CKSA 3GDMA 4M82A 3KLKA 1AQMA 1VRDA 1AQ0A 2Y2WA 4FXSA 5I6SA 1RLDA 4JTIA 4NJGA 2WCAA 1ITXA 2H9AB 2ZXQA 1QI2A 3PUGA 4CQBA 1FUYA 5C9WA 3WNOA 4CN6A 1JJKA 3P7YA 3T42A 5CBJA 1PSCA 3FJ6A 4PULA 2TYSA 3MHGA 4E8GA 1YTKA 1S3HA 3GE7A 1HL8A 2CKSA 3GTHA 3FDKA 3BSMA 2WO5A 4GNVA 3GVWA 4UTTC 3W1MA 2WCSA 2WVSA 3PZGA 2Z29A 4GPNA 5C9RA 3CXOA 3W9ZA 1J79A 1EL3A 5K9CA 2Q71A 3CT7A 4GABA 4P7NA 4YVVA 1SZEA 4ACZA 4RDVA 1JCTA 1E0WA 4H7CA 4QG6A 1C8QA 4K7VA 2EG7A 3S1GA 2A21A 1JRCA 1K8CA 3L5LA 3QSTA 1E4MM 2D3LA 3GG7A 3SBFA 5HXMA 1QPKA 1LBFA 2RFGA 4TQTA 2XSXA 5XINA 3SCQA 1EPXA 4IPNB 4CQAA 2PFHA 4BF9A 1CECA 3TVAA 3AUOA 1RUSA 3RMJA 1J11A 2A3LA 2HZGA 2QCDA 1EDGA 2ATMA 5EY5A 3PAJA 3LGEA 5PTDA 4QE5A 1EEXA 1EA0A 2DGAA 2WKJA 1WKYA 3QZEA 3G0SA 3NZGA 1PWMA 3QMSA 3BMWA 1JGMA 4W4QA 2VZOA 3DCPA 5F2MA 1KCXA 5G1YA 3G1XA 3QSRA 4R7WA 2DH2A 1GK8A 3FW6A 2BX7A 2J47A 4YWIA 4XZNX 3G0XA 3ONBA 4AZCB 4LYRA 4AW7A 3H4WA 2YFNA 1UD4A 4MADA 3STGA 3WJYA 1A53A 3R4IA 5I23A 3KL0A 3RCNA 3TYBA 3ZLFA 1ZZMA 2PDGA 3WBWA 3BLPX 1ZLPA 3R0KA 2X05A 2DIJA 4LBRA 4OZOA 4UMCA 4ZXOA 1UIPA 4WF7A 3VMPA 2ZZ3A 1X1NA 4J3XA 4CN1A 4U3AA 3VNJA 1UMLA 3LYEA 3WH8A 2GJRA 2P10A 3KBJA 1S2UA 3ARYA 3U5YA 1J9YA 1HJXA 3GTIA 5HMDA 4A3YA 5AB3A 4QLJA 3W7MA 1R6WA 2E5DA 3GC2A 2PGFA 2DUAA 3KRSA 4JQ4A 4KEVA 3FCPA 3GXIA 4DM1A 1VLWA 3R79A 3IVSA 1DJZA 1AQHA 3ZO9A 2OWXA 5BRQA 1KM6A 3NL2A 1CB2A 3OVRA 1H0GA 5FEWA 4K7YA 3DDMA 4Q4SA 3W0KA 4LEFA 1DIOA 5EPDA 1E1CB 4EANA 3C52A 4PMVA 3MWCA 2YIHA 3A3WA 3SUUA 4YMZA 4PL2A 3PBUA 4UXDA 4NZJA 3WDIA 4YIWA 3W27A 4H9UA 3GTXA 4WX2A 5LXXA 1PDYA 2V5DA 4IOTA 4R9XA 4O57A 3FKRA 5H8UA 3W85A 1UKQA 1TPC1 4LUTA 1Q85A 3E3HA 1EBGA 3R1ZA 3NPWA 4O19A 2DJLA 2P0IA 4RXFA 5A6JA 4TTGA 3P82A 2E09A 4AXKA 1RVGA 2QDEA 1JAEA 1MQQA 5DBUA 3VKDA 3W87A 1VEPA 4BQ2A 4JICA 5JIWA 4NJJA 4PTMA 3OG2A 3FXGA 4KEMA 3CAWA 4ZOCA 2JE8A 2VEGA 4XG1A 3T2QA 2OQLA 3MP4A 1D2KA 1M3UA 5I09A 4GVGA 1LDCA 5I3KA 4C5ZA 3TA9A 1HF6A 4EXAA 2A3HA 2DT1A 3S5NA 4ZO8A 3LU2A 3TYDA 4AU0A 4HBKA 5HQLA 1Z7AA 1YTEA 3UZWA 1H60A 1IIHA 1XYLA 4JTRA 1QDSA 4C7DA 4GJ1A 2CLFA 1SW0A 4MNMA 1QPNA 2GQAA 4HCHA 4HA0A 3WH7A 4MLJA 1EKOA 3EWDA 5I7GA 5CZ0A 5DY3A 3UR5A 3M5YA 2PP0A 1ZY9A 1XC6A 5A8PA 3BTNA 4FLOA 3OLIA 2INEA 3APGA 1J01A 4UZSA 5FF4A 2EPMX 1HKMA 1W5NA 5CGTA 1EC9A 4HSOA 3WK0A 1P7TA 4XQ6A 1C90A 1JZ4A 1LOLA 2AAMA 4Q22A 4RZ4A 2QIWA 1E4IA 2VEIA 1R46A 3R8RA 1L8PA 3KS5A 2X1RA 4H00A 3HV8A 4OBRA 3ZLGA 2VEKA 4XSMA 4UZUA 1WKEA 2BWGA 1R9YA 4YCOA 4N6EA 5C0QA 1GYLA 1TMQA 5FJTA 3MC5A 3I6TA 4D6JA 2W62A 4CNPA 2J9YA 5LHEA 1KM2A 4ES4A 2TMDA 1EJUC 2E1DA 1EQCA 2V38A 3VFLA 4GBDA 2OSYA 5A6AA 2GQ8A 3KDNA 3L4XA 3AMKA 3ORWA 4YXGA 1S1RA 2Y5EA 3KP1A 1FCVA 4R5EA 2A3CA 4UQEA 2ZC8A 2WPGA 3KCLA 2VC9A 5D37A 2NUWA 3AMDA 3LHYA 3TC6A 2CCRA 3VI2A 5K2ZA 2ZUNA 3ABOA 3GVGA 1LLZA 4H6EA 3WDQA 2Z1VA 3H23A 4FXFA 1RV8A 4CGTA 2PDWA 4AF0B 1QWGA 3IJDA 1W1ZA 4PA8A 4PC8A 4P7QA 1R86A 4Z17A 2WW5A 3DERA 3IUDA 4NZ4A 3KBMA 2OT1A 1L8NA 4ORMA 7XIMA 4FB7A 3CUXA 4GYFA 5LA1A 2GSEA 2ZUTA 5IFTA 3GHUA 4ATWA 3S5SA 1CGYA 3DI1A 5G1TA 3LXCA 3STEA 2ISFA 1TPVA 3LEPA 1P0EA 3WQ5A 1TJ2A 3VZXA 4DVOA 5H6HA 4YCPA 4PSPA 4AUBA 3A4AA 3NPVA 1QI4A 5DMNA 5AVNA 3PB2A 3VDHA 3OP2A 1I2PA 3DFNA 4W5UA 4Q8WA 1EYEA 3RM8A 2NUYA 4EWJA 2Q8XA 1POKA 4RNIA 1QPOA 1VBUA 4DBUA 3BLKA 3VDBA 4WSHA 3PWAA 2D24A 3QBUA 3G3DA 3W7IA 5CCZA 1C7SA 1UP0A 2CLOA 4L9ZA 3OOQA 4UQCA 4DO5A 3IRSA 4URIA 1HKJA 3WMSA 1VFSA 4P7RA 3THDA 1OIMA 1E6QM 2HVNA 2TODA 1LQ0A 2XH4A 3ZSTA 5AC6A 1R7OA 4RX0A 3TTYA 1ECQA 3WLTA 2A6LA 5BXRA 2EKCA 3TJ4A 1IEIA 2FTWA 1P6WA 1VYPX 1AJZA 2OLAA 3HU7A 2YB4A 1LORA 3M0LA 4ILSA 1BYAA 1FWDC 2WSKA 5JVLA 3OPSA 3UXIA 3SCWA 1NARA 4XAGA 3QFEA 3CASA 4HZ8A 4NKCA 1GVSA 2AAAA 4LW7A 1P6CA 4XD5A 4CU8A 3L9CA 4PMYA 1M6JA 3H2NA 1O5KA 4DEFA 2CPUA 1KQYA 4L6HA 1U33A 4L6DA 4FXJA 3CPRA 1FTXA 3AUJA 1ZGDA 5BCAA 4LOCA 1KXTA 3FAXA 1UA7A 1B0IA 1EYWA 4QS6A 2EAWA 4YU1A 5LIYX 8RUCA 1QUMA 2JBMA 2C8NA 1J96A 3NQ6A 2NSXA 4D72A 1MFVA 2O0TA 4S1FA 4ECLA 3B97A 2JQXA 3S3GA 3S42A 2VFIA 3U57A 3CB3A 2PDPA 3UNDA 3UA4A 3AHXA 1ZJAA 3E0WA 3QF0A 3VGDA 3IUIA 2VUYA 3AYTA 5D03A 5F2GA 4BI6A 1RPXA 1R5YA 4ZGYA 3UWZA 3RUBL 4FALA 2QIIA 5AC8A 2CNCA 1YEYA 1HGWA 4NRRA 2YDAA 3HPAA 2NT0A 4LAKA 3MKKA 3C56A 3M44A 4DF1A 4ZB0A 1JDAA 1QHPA 1XLJA 4V2XA 3OVQA 1FCQA 5KTLA 3AQUA 4E2BA 1I0BA 4M8UA 2VDHA 1XICA 1VBHA 1ISZA 1KCZA 1PCKA 3QR3A 4J5NA 1FQ0A 3QC0A 2PU1A 5JXQA 4AZBA 1FHLA 4GX9A 1VS1A 1W1PA 3WF3A 3R5EA 1SUXA 1WCGA 4PUNA 4H9MA 4H8VA 1BYCA 1DXIA 2PGEA 3MUIA 5FF2A 4H9YA 1K8XA 3WLLA 5CZSA 3U2EA 1W3HA 4UOQA 4I5RA 1A49A 3KDOA 1OK4A 4FLQA 3GY1A 4I90A 4QISA 4UFJA 4HNUA 1NFBA 1VYSX 3U8GA 3VM7A 3H70A 4FX7A 2WC4A 1XQLA 4GUFA 3ELFA 4TV6A 4A8NA 4W9TA 3TEVA 3AFBA 1PAMA 2D2HA 3ZM8A 5KMYA 1PZ2A 2J9XA 2R1PA 3NZRA 1TPWA 2X8RA 5BXPA 1OJXA 3CGTA 1HGYA 4KFNA 1TQJA 3GIQA 1NDWA 2X2GA 3SY5A 4MWAB 5DXXA 4CU6A 1TELA 1L2QA 2DZAA 4XAPA 3LCHA 2CBIA 2PP1A 1UH4A 2P8CA 3W7PA 4G1KA 1F5ZA 3AS2A 4HB7A 1NF7A 4X2PA 2CYGA 3ARRA 4WKHA 4H2HA 2EKGA 1PZ1A 1GGOA 4DB7A 2WLZA 4UBPC 2G50A 3VOCA 1XLAA 5AHIA 6PTDA 4LWWA 1SSDA 2ZRZA 3LTSA 1E4NA 3G1SA 1V6VA 1VPYA 1OADA 2AL2A 2ABAA 1E6NA 1ZBCA 5I77A 4IQJA 1KRMA 2DORA 4XKMA 3NFUA 4Z2KA 3LA4A 4Z2IA 3AC0A 2RGLA 3UJRA 3LHTA 1K9FA 1VCVA 4GJIA 4CNSA 4XWUA 4BJHA 1LRTA 4AX6A 2VC7A 3P84A 3NGFA 5U7SA 3RLVA 2DUXA 1QI0A 3AYVA 1SZFA 1KXVA 3B0PA 1WO2A 4PCNA 3DX5A 2JKAA 1YBQA 3IS4A 3NURA 1BWKA 1PIGA 4MY8A 3SCUA 1NP0A 3FFSA 3CQ0A 2DP3A 4QTGA 3GAYA 1SW7A 4KIRA 1WA3A 3VGHA 1HKKA 4PODA 3EWXA 5CBBA 1E9IA 1YYAA 2XVGA 4S3FA 4JTQA 3RHGA 3EA1A 3SCTA 4NUWA 3UWQA 4U5KA 1LM1A 1VRXA 3CV6A 3PJWA 4IIEA 3DYOA 1A3HA 5I5RA 3N9SA 3CWNA 2OYMA 1GJPA 4HTBA 5DMLA 5C2XA 4AWUA 2QPXA 5CAKA 3EX4A 1K1DA 1BRLA 5DF0A 4HNTA 3R2GA 2WMGA 3KOWA 4JXCA 3LXAA 1O5RA 5JIPA 1SYTA 4EF8A 4KCTA 4QHRA 4KWSA 3AIUA 3WKZA 2V67A 1G4TA 3O1NA 1QHZA 3W4RA 2OEMA 4JDYA 4OECA 4EAYA 4KPLA 4PFMA 2EPHA 2OWCA 4X61A 1BLIA 1KFLA 3MYPA 2QXWA 2R14A 3NQ8A 4HMDA 3DKJA 1PYFA 3WD2A 4B5WA 2WMJA 3GBEA 3U48A 4ZO6A 4KS0A 4RCXA 1XPYA 3LSCA 2IPJA 3M6YA 2E28A 4LTSA 5G4EA 2NQ5A 3NL5A 2J7BA 4B91A 1E4LA 4B5NA 4S3KA 1E0XA 4AWSA 1GORA 1ENUA 1TV5A 2PEVA 3LCIA 2PRMA 4JEJA 3BO9A 5G2IA 1KTNA 3INPA 2HRWA 1FBAA 3D46A 2Y8KA 4NZ1A 1KRBC 1XL9A 2A7PA 1VBRA 2BLEA 3CLMA 3ANUA 1IWAA 2HVOA 3WSUA 1VKFA 4UTWC 3EWZA 1LJYA 3L4VA 3R8GA 2V0TA 4FS9A 2VX4A 4LNYA 4C60A 4GYKA 1O5QA 1K77A 1ONRA 3EPOA 1FH9A 3DAQA 3ENLA 3W2MA 2H8ZA 3EX6A 2HNHA 3TFXA 1HX0A 2NSOA 4Z1BA 4PUWA 5GNYA 1JRBA 5F4SA 3T9PA 5HWNA 4JKMA 4H04A 2WYSA 4POCA 2XH7A 1PTGA 2I7GA 2OSXA 3K2GA 2VTFA 2Q3OA 1BGGA 2ZZ6A 5FAJA 3G1DA 4QFUA 2HROA 1CLVA 1TWIA 1S2VA 4NZFA 3USBA 3QMTA 3OVGA 2D2JA 3MMDA 3PUOA 1PKLA 6XIMA 3LI0A 2CLLA 3MZ2A 3MCMA 4U31A 1CENA 3B8WA 2VX7A 4AY7A 4IL2A 5FEXA 4HKPA 1NY1A 2CESA 2NV9A 3LTPA 2OZTA 3LERA 3W3OA 4A4AA 3UJFA 1FKXA 3B0UX 4C6JA 1B2YA 1SO3A 4EAMA 2PUZA 3G1AA 4FP1A 4JDBA 2VWSA 2W0UA 4B5XA 3SCOA 5CGMA 2H90A 1XFCA 1X1OA 3BMVA 3N29A 3VDGA 3A22A 5BOOA 4YVPA 3NDZA 1G69A 3VINA 1RJPA 1T7LA 5BWFA 3W7DA 2FVMA 4TVDA 3I7QA 4FPSA 4HA4A 4JY8A 2Z1BA 2WZEA 4PTDA 3UWUA 4HYWA 4K38A 4NP7A 4WR3A 4Z2LA 1ISVA 4G7EA 4ZQOA 5EMLA 2DH3A 2CHOA 4PB5A 4ZOBA 2HTMA 2GWGA 1E5JA 2DDXA 1XD0A 1XSKA 2WOQA 1AZ2A 8TIMA 4X3ZA 1US3A 4XBJA 3TZFA 1JZ2A 4CNUA 2PU0A 1H7XA 1E3ZA 1P0DA 2PZ0A 2NW0A 1A5BA 5LZLA 1SFLA 2F6KA 4JFSA 4DBDA 3UZZA 2OKTA 1P5BA 5REQA 1ADDA 1Q6EA 2QMKA 1F4AA 2ZA2A 3TONA 4LSBA 1MW1A 1N7KA 1IEXA 4ADUA 1AD4A 4LYPA 2ZE0A 1XLCA 1WPCA 3F5LA 4H19A 1OHLA 2X30A 4UNKA 3VDAA 2NLYA 3NQCA 4JIIX 3PVFA 1OVDA 3CH0A 1QO5A 3BAXA 1DIDA 1N2VA 4HP5A 1NEYA 1LL6A 1ZB5A 3QKZA 2XISA 3QY8A 1DJGA 4WDWA 3AHYA 2CETA 1JG9A 3LSBA 1KM4A 1PHWA 1ITCA 1F3TA 4I6KA 4M6UA 1QCWA 4US5D 5A6BA 3ARTA 1H50A 5BXTA 4DBSA 1V3KA 2RDUA 1WNOA 2E6DA 4EKJA 3THUA 4FXRA 1Q5MA 3VKAA 5CC3A 3I3EA 5TIMA 3WQ4A 3QV7A 2PLKA 3WIJA 1UWIA 4XIMA 1A3WA 1XM3A 4FA3A 4A2SA 4EP8C 4N9DA 1PHQA 4A35A 7CGTA 3MJYA 3IIPA 1QR7A 3EXRA 3P0XA 3W2LA 1GOKA 1OC5A 3DOPA 1FWCC 1KKRA 5I3DA 3JZUA 4ERGA 2PDQA 4MWAE 3MHFA 2PGRA 1PZ0A 3UY7A 3M43A 5DMMA 3MYOA 2IKIA 4HMNA 1SGJA 3UPWA 2ZRWA 3LX9A 2PDIA 2WMFA 1GEHA 2PURA 1QHOA 2QCGA 3MKVA 2FPTA 3W84A 3RLHA 3WQOA 4CQDA 4US5A 3JS3A 4BFAA 1HW6A 4S3AA 1S2WA 4B15A 1ZBVA 2RHGA 1V0NA 4Y9MA 2VFHA 1ZPTA 3LS9A 1EC7A 3S2MA 3IGSA 1CTNA 3KM8A 5DCEA 4L7ZA 1FWBC 2XZ9A 4ZQPA 4RUBA 2V63A 1YE4A 4JTCA 1H4PA 4Z08A 3THCA 2CITA 3PSWA 4C6LA 3REQA 2OEJA 5HNUA 5A6LA 3BVJA 2XFRA 4DWSD 1OSEA 3UG3A 2WQPA 4KH2A 5AYZA 2XIQA 5FD0A 4LU0A 1J12A 1D3HA 4M3PA 1B30A 3PZVA 4ZR8A 3NGJA 2Z27A 4PZVA 4PMZA 4AZGA 3W1QA 4FF7A 4LS1A 3AROA 2MNRA 4OFCA 4UTJA 2DVTA 2EPNA 4WXZA 4AWEA 3K30A 5AOUA 3G1HA 4IMFA 2CIPA 3EX1A 3LG3A 2GJXA 1OC7A 1XS2A 1TV7A 3T2OA 3BLOA 3QVQA 4REQB 4D6IA 2E5BA 2ZX8A 4KETA 1UWTA 4MZ1A 2OJPA 2WSQA 1W37A 3GDLA 4LRSA 3OGVA 5DRCA 3APTA 1PJ9A 3QZ6A 2W27A 3IPWA 1DOSA 5C6MA 4GYJA 1R3YA 3VIMA 1OABA 1QBBA 3VD4A 1KFKA 3O16A 6REQA 2LLEA 4G5DA 2EPLX 1QASA 3T7VA 3CO4A 3GVVA 1E72M 3TE9A 1R9ZA 3I6RA 4E38A 1RA5A 4ROQA 1SSGA 1YNPA 1VCGA 2UV8G 3HV9A 4GVHA 4J3SA 2O56A 3MUZ1 1XRSA 2INFA 1F2JA 1UZ1A 2Q09A 3K1DA 4WUIA 1UOKA 3POHA 4N42A 3N3MA 1X96A 5CAHA 2IKGA 3EMQA 4R34A 2YX0A 4Z0SA 3UJEA 3UWYA 3K4AA 2BG5A 2GUBA 1VENA 2XFWA 3MSRA 4DYKA 3L2IA 4PE8A 2DVUA 1DKWA 1WQ5A 2Y61A 2J6XA 4LF2A 5CH9A 1OCJA 3DFOA 2BOEX 2PWGA 1O7AA 3R6IA 3E38A 4AVOA 1DV7A 2PLJA 5IFPA 4W8BA 1LBMA 2EJAA 1UUQA 2C6QA 4QAWA 2WK2A 4TUFA 1I0DA 2FZNA 3E12A 1PBGA 2ABBA 2ACUA 3GH5A 1OYAA 3I7RA 1VBGA 1JYVA 1EDTA 2CERA 3KUMA 4GACA 1HTIA 3HGOA 4FR1A 1M03A 3N18A 5TQLA 3WLKX 4Q4RA 4QBXA 2B81A 4G56A 3HURA 3K5XA 3LNPA 3SY1A 2R1LA 3C8FA 2ZZ5A 1B5TA 4IP7A 1BQCA 1Q65A 1Q7MA 4BHYA 3TYZA 1XX1A 3BJTA 2BY2A 4GINA 3O2LA 1LUCA 4M80A 3THQA 1KFBA 3CL6A 4JTGA 1H1ZA 3MI2A 1I4NA 2Y88A 1IQ8A 1UIOA 5A8MA 4LUIA 3DGBA 3BG3A 3CQIA 4QDWA 1IF2A 1JZ3A 1XYZA 2V81A 1AH3A 3SN1A 2WMIA 2A7NA 5D2TA 3Q45A 3KHJA 3PG8A 5A2CA 4J9JA 3SZ8A 3O05A 1LQ2A 1DQWA 3LBMA 3FOKA 3DIPA 3KBSA 5AYXA 3H26A 2OQYA 2ANUA 2EG6A 2FDSA 2CEQA 3MSYA 3NOEA 2HVMA 3UR7A 4V28A 4GD0A 3AMCA 3W74A 4EXQA 2C1HA 4C6IA 4FNQA 5AECA 4DNMA 3QGAC 3V0SA 1XINA 1JUKA 4ATLA 5AHNA 2X7WA 2AMXA 1VC4A 4GO9A 2CBVA 2GVEA 4NAFB 4ZTYA 3W88A 3GUGA 1CDGA 4DF2A 3XIMA 3M16A 3EOSA 3ANYA 5AZ0A 3W7KA 2I57A 2VUNA 3QC3A 2A0NA 4AISA 4U4MA 3VZZA 1DTUA 1WDRA 4GBUA 1FHUA 3B9OA 4GQRA 1Q2RA 1N82A 1KTCA 1FVPA 4NY2A 2ZFAA 1RCXB 3AZTA 4LVFA 5E0CA 3VIFA 4OBSA 5GNZA 2OTDA 2QUVA 3ZLHA 3T2PA 5HK4A 1YRRA 2ZUSA 3VD3A 3G8RA 4O17A 4JFUA 3H2OA 3XISA 4NX5A 3T0BA 4QQ3A 3WLMA 4ZMGA 5KZEA 3MSGA 1EZ2A 2UY4A 4DZHA 5CJMA 1A5UA 3R11A 5GQBA 1KFWA 3M0VA 3HBLA 1JZ5A 2P1FA 1LWJA 5JQ9A 3ITLA 2YXXA 3NQMA 2VR5A 2D3NA 4BQ3A 4L56A 1QFEA 4LS0A 3FX4A 3ITCA 1OX4A 4Z1AA 4LEQA 4GZEA 3CHDA 4NNCA 4DZAA 3BCDA 4G7FA 5KZMA 4JNYA 4F8XA 4XD6A 2Z25A 4C91A 4MJZA 4HZ7A 2QQ6A 4RNHA 4V1YA 4R33A 1J0KA 4KRTA 4GQBA 1M65A 4WDTA 3K1GA 2XIMA 1XLKA 1XH1A 3E02A 3VNDA 1JULA 5KETA 3OQ8A 4JN8A 5A5WA 1XDLA 1TB3A 2EPKX 2CBUA 5AZ1A 3ZWTA 1VFFA 3LM3A 3OW1A 1TA3A 3SSJA 2F6XA 5HNNA 4B3ZA 2J8TA 3BCFA 2JGYA 3JRKA 4WDXA 2W6RA 3FYOA 1EF2A 3KVLA 3EMCA 2ALDA 1EH9A 4AD4A 1O95A 4W84A 4C6BA 1KNWA 3VNKA 3VM5A 4NF7A 1IXPA 2A2IA 3ZOAA 2BY3A 4K36A 2ZDRA 4M24A 4PRRA 3PG9A 3II1A 2X42A 5LNVA 4UFMA 1XWYA 4JN7A 4HVXA 4CEUC 2FHFA 1DJXA 4Q4KA 3FGCA 4B9ZA 3VIIA 3R7MA 1GUVA 4D8AA 1DWGM 2VVNA 1FWSA 3VDCA 3WLRA 3VPLA 3PK7A 2IPWA 1F05A 4FX6M 3MV01 1MDLA 3O3RA 1W9XA 4GK8A 2Q02A 3CEPA 2KZHA 3NTYA 1C8XA 3GAKA 3M1ZA 3NYZA 4RLIA 4JYEA 2E9BA 4H3DA 3RX4A 3E0IA 3R0DA 2O4QA 1GQKA 5HR6A 3AO0A 2E6AA 4J3ZA 2BASA 2J27A 3WH9A 3IUHA 1UG6A 1UOZA 7A3HA 5BXSA 2P3EA 3DN5A 4ZB5A 3J7HA 3E2RA 3CZJA 2F7FA 2YGYA 4GISA 4JIPA 1YE6A 4QSFA 2PDCA 5F7UA 4JQ3A 3GFZA 4HZMA 5I07A 3ZR6A 4Z1DA 1TV3A 1R2SA 4G1NA 1SMAA 1V3IA 3LNMA 5LGZA 1IXNA 5EGRA 3G1YA 1O68A 1E6XM 1WUFA 2PWVA 2XN2A 3CO8A 3VMOA 4K3ZA 3LD5A 1YTDA 1KRCC 5DLCA 1E1FA 2QUTA 2B7PA 4XSLA 4Y7EA 4DQWA 2ZBTA 1MW0A 2V82A 1HNYA 1KV8A 2E5CA 1YADA 2W3ZA 1G7VA 1PKMA 2WQDA 2GLKA 4AVNA 3WJXA 3IEBA 1TWZA 2J7HA 4PBEA 3KWXA 5E1QA 4ZBCA 2R8WA 1C93A 2E3ZA 2G3NA 4G8TA 4PUKA 3W53A 2F84A 3T07A 1VFMA 4I7WA 2PWHA 1XSJA 5LGXA 1NQ6A 4US6A 4HNCA 5D9MA 2WC7A 1UPMB 4Q8TA 1RH9A 4CCZA 1O66A 5GVJA 3NXLA 2ZXDA 5C55A 1VP5A 1PX3A 2OEKA 7TAAA 5C9XA 5HBFA 4JNZA 1WAUA 1A5CA 4PCPA 3RAOA 3VO0A 1ZJHA 1NAL1 4MWAC 7REQB 1NF0A 4JL2A 2NT1A 4Z2GA 1JDDA 4NNBA 3C4UA 2C13A 2VCBA 1GEQA 3H12A 4UR8A 2NXIA 1UQYA 1THFD 3AHZA 4OUEA 4D6GA 3GW3A 3H2MA 1XGZA 2GSJA 1B4EA 2E6YA 4IJBA 4M1RA 1UASA 1QWKA 3D47A 3BAYA 3TMLA 4P7OA 3H53A 1NH6A 1LL7A 2PGWA 1JR1A 2E0PA 3BURA 3N2CA 3GNOA 1XH2A 1CXEA 3S6OA 3BDKA 3E96A 3W25A 2C79A 3SCRA 4PCTA 3TLLA 3NIYA 3DENA 3DFYA 4CQ8A 3MWAA 2PBGA 4H6QA 3V75A 3PPGA 1IR1A 3KWSA 2FZ8A 4HCDA 5E9AA 5KZDA 3EOLA 3H2CA 2ASHA 2QW5A 3WF2A 4AYSA 1UKTA 1XBXA 3UZXA 3TTOA 4C1NA 2QZRA 2AL2B 3AIVA 2VFGA 3TSDA 1HKWA 2QJIA 1KGUA 4O10A 2R82A 2ZRYA 3A9IA 3NSMA 1A5AA 4ZB2A 3EBVA 4ORIA 3NZPA 2NQ9A 1XIHA 3AALA 4MFEA 4DO6A 3POCA 3H2EA 1BYDA 3C2EA 5D9NA 4AZ7A 1XYBA 4JN6A 3GH7A 4GIEA 2CLEA 3EWUA 3QV8A 1GYNA 5ABEA 1OFAA 2XDFA 3FV9A 3ZJ8A 2XFFA 3KCJA 3TNOA 1E3XA 2IMRA 1VFLA 1HG3A 1V6YA 3MCOA 3QY6A 4DLMA 2A3EA 1GOQA 2VO5A 1LWIA 3BAJA 3WLIA 3L4WA 2X0HA 1CWYA 1J0IA 2B7QA 4AHPA 2ZX6A 2FMOA 2WANA 3DEQA 3AU2A 2HBXA 3BAWA 1P1MA 1AJ2A 3LPGA 3AWNA 1F6PA 1ZBKA 2P5NA 1J10A 1EJWC 1HL2A 3WJZA 1YXDA 1TR9A 3SCVA 4AIEA 1F73A 1M9HA 3MBFA 2YR1A 4QE4A 3I68A 3GG8A 1Z41A 3FK4A 1BWLA 3C0SA 4H2CA 2VZVA 4XZWA 5C70A 4UCGA 1XH0A 1QW8A 4TO8A 3DBPA 3WQPA 4QCEA 4NAEA 1PWLA 1Z48A 4R9OA 1ESWA 5G5IA 1REQA 2WNZA 3IGHX 4LCQA 2F2HA 1UR3M 1RCQA 2Z00A 2NV2A 4MAZA 4Q6JA 4MB4A 3GZAA 3GFXA 2YA1A 2RUSA 3EXTA 4W89A 5B7YA 1VBJA 3WQEA 2C15A 4LC8A 4ZENA 4D6FA 2J79A 1SFSA 3HZ3A 2BVWA 3TNBA 5MHBA 1CNVA 2V5BA 1K4GA 3H22A 2B0MA 4LV9A 4ZEPA 2ZA3A 4HPHA 4H7VA 1T41A 2ZA1A 2BHYA 5CPOA 2YDQA 4QNEA 4PMDA 3WNNA 4Z2HA 2B4GA 3EKZA 2HE5A 2SFPA 1XG3A 3VMNA 2VL4A 2R6OA 4L4OA 4I9JA 2AOSA 3IAQA 4MDPA 4I6VA 5F4XA 1QW7A 3E6EA 3N04A 3TN5A 2AKMA 1KBJA 3ES7A 4W7UA 4R85A 3T0AA 4ZQCA 2ZXAA 1EO5A 1FXQA 3WMLA 3COTA 1B3OA 4Z2JA 5HDRA 1JQXA 3H4XA 3QTPA 4GXWA 1ITQA 3ITXA 4DYJA 3IJ9A 3UVAA 3V3WA 1P0BA 3ERPA 4E8CA 5LNWA 4HPNA 4PMOA 3UGRA 2VX6A 4CN4A 3OLDA 3NQ7A 3OHIA 2DSVA 3W02A 1DXEA 4AIUA 4BY3A 3W72A 2I5QA 5LXEA 1JPIA 4QAIA 2PE4A 3ZJKA 4HU8A 1VFHA 4OQVA 1Q63A 2JEQA 2GJNA 3VUSA 3PB0A 4D6DA 3U5UA 1H5VA 4AWTA 4DBEA 3CMGA 3DC8A 2X16A 3PZ9A 3M0MA 2JALA 5ABGA 5I03A 2MANA 4J27A 2V3DA 2YCLA 2VC6A 4C7GA 3CYVA 4NZ3A 2GSHA 1O6IA 3W2UA 4L9YA 3CZLA 4Z0JA 4HOWA 3UP8A 4PCFA 2PD5A 3IAPA 4PMNA 4FOKA 4DBWA 1J4EA 3LCWA 3L68A 1PV8A 4GKTA 3KE0A 3L5MA 2Y24A 4OV4A 4HU4A 4IICA 5K7JA 1KB3A 3AS1A 3VCCA 3KAOA 3ITTA 3EWWA 1IYXA 1TV2A 1JCLA 3PFRA 3FVDA 5HQEA 3OIXA 3Q94A 2QCMA 3KTSA 4NXKA 3HPFA 4Q4PA 2QUNA 2FJKA 1K03A 2XIOA 1R3TA 4MSSA 1T8XA 3ISIX 5DRIA 3GTFA 3QRHA 1MQPA 3EKLA 3WF1A 4P61A 4JS3A 3CAQA 3UPMA 2QPSA 1B31A 1CLKA 5DFAA 3PBYA 1YW1A 4TOQA 3L4ZA 2YA0A 2D73A 2NUXA 2WM1A 4EPKA 2OX1A 2PLMA 5CPNA 2PTXA 2ISSA 3W83A 3OZPA 3M47A 1UJQA 1N8IA 4ERIA 2QJHA 3OG3A 3O07A 2XJ7A 1U5HA 2CLPA 3VK5A 1RJRA 4FOUA 3ITVA 1TX0A 1KLYA 1C9DA 1R2TA 1TG7A 4H9XA 1FCUA 2YA2A 4CEXC 2FKPA 1CZ1A 4PBFA 4ADTA 3RN6A 5HUOA 5JUVA 3PUDA 1S3TC 3W1TA 2OWWA 2WNNA 2A7RA 2RDTA 1S2CA 1TJPA 4LNCA 3RK8A 2PS2A 3KFTA 1LLWA 3LBCA 1R3WA 4EE9A 3FA4A 2GK1B 4ATDA 3LGGA 1JL8A 1UD6A 1HZYA 3W2JA 1QATA 1ZRQA 4PYSA 1U1HA 4GLEA 4KEUA 1ICSA 5HWMA 5C7VA 3W1LA 1CGTA 1LT8A 1UD2A 5BNKA 3L7RA 4MY9A 1I45A 3B0YA 4ZQRA 3RRXA 5ENLA 1QPRA 3IJQA 2PTYA 6ALDA 3TLQA 3FSTA 4X2RA 5DXYA 4EXBA 1I60A 3PAOA 1XLIA 4HOZA 1J2WA 4YTTA 1BKHA 3A4XA 2I5GA 3WK3A 1MO0A 1AL7A 2A1YA 2WHLA 1RALA 1GKQA 2FB3A 2VCAA 3G6LA 3NEVA 3O6CA 3N9KA 3AAMA 1CT5A 4GIRA 1GVEA 3VGEA 3ARVA 1OB0A 2Y4SA 1OFOA 2YYTA 4QDMA 4DZIA 4H9VA 5DN1A 3VNIA 4IX0A 4UOJA 3IACA 1MUMA 1NDZA 2I17A 2XVPA 2H3DA 2WHMA 2CWNA 4UTWA 3T6CA 2DUZA 3SO7A 4DF0A 3EWCA 4M7TA 2P76A 2F2KA 5I3HA 3TQPA 4AH7A 4BCEA 1SJAA 5D05A 3RYSA 2Y85A 4GE8A 1VHCA 1JI2A 4UQBA 1TFVA 5CJNA 3RCMA 1VFTA 3CB8A 3EXSA 2ZZ1A 3WF4A 4JIHA 4U2ZA 1F3EA 4AZHA 1QI3A 2Z1KA 1XXXA 3DESA 3GO2A 1A0EA 1ISYA 4MUPA 1BGAA 3G22A 3ABSA 1WOBA 4F2UA 4YYCA 2FZMA 4JD4A 3OYXA 4AC1X 3O15A 4PUEA 4LBSA 4JTDA 1DP0A 2VVSA 2DW6A 1NWSA 2J74A 2C0AA 3GNRA 4M29A 4RJEA 4OBTA 4LAOA 3MMTA 3BAIA 4MPQA 4MZYA 3IIVA 3N4FA 5K4XA 3LOTA 3ZJ6A 5D8WA 4M0XA 3TQKA 2FTYA 1O5XA 4IWWA 1Y0EA 4Y9OA 3W37A 4IUGA 4K39A 4IG2B 1QNVA 2V2HA 4C6QA 1GOMA 1MW2A 3OZYA 5JH2A 2FH6A 1XLMA 3TKFA 2VURA 1W9PA 2YOCA 1GPFA 2D0FA 2HJPA 1E9LA 4LPCA 5AKQA 1JDFA 1V79A 1FDYA 2KAUC 4GG9A 1EIXA 3BC9A 3GDRA 4OUIA 1XISA 4KKXA 4H4IA 1JNDA 3EKGA 3UYCA 5T9BG 4QCFA 4OGZA 3FVMA 2GVLA 3N1AA 5M5DA 2G95A 1AJ0A 1VFUA 3R58A 5HNTA 1BG4A 5DX7A 1PKYA 4A05A 3G6MA 3WBEA 2YBTA 3GNXA 3GYEA 2Y0FA 1S5WA 4GCAA 4GOAA 3IV3A 3B4UA 4OU1A 4L64A 1XI3A 3L5AA 3RX3A 5ECVA 2J7CA 3G1FA 1FA2A 3O7UA 4KGLA 1O1ZA 1RZMA 3SN0A 1WDQA 1KBIA 5BOFA 5ABFA 3WFZA 1S5VA 4LAUA 2YCKX 4WGHA 3S1XA 2ALRA 1OFBA 3PUEA 3B8TA 3T78A 5AHEA 3IVTA 2ZKMX 3MBDA 3TWAA 5HA7A 1WB0A 4B2DD 1TCMA 4P8VA 4ZQMA 2DW7A 3OLEA 3CYJA 4C6PA 4JTSA 8XIAA 2BSLA 1SQ7A 1YX1A 3TQVA 1RR2A 1XPGA 5H2ZA 5FJIA 4C90A 2DJXA 1Q8AA 4N2YA 4B90A 4C6KA 1MXSA 1GHSA 1GOWA 2GGGA 3URBA 1VD6A 2H9AA 3CWHA 5A2AA 1EGZA 1OQFA 4PCSA 4CVWA 1QK0A 5CPQA 3WD4A 1V7YA 1UUOA 4XO6A 4B3KA 1QNRA 3WD0A 4GI8A 1UKOA 2YZRA 3FJLA 3VD9A 2O55A 2WSYA 4MJMA 1QAPA 3KZPA 3DFSA 2E67A 4MMWA 1V3JA 2W66A 4XZIA 2ZTKA 1CCWB 3IVUA 4LC6A 3B9DA 4M81A 5A95A 2Q8LA 2E77A 5KINA 3CUZA 2VT0A 2OGJA 4DM2A 4B2DA 3K46A 4HN8A 1F6KA 5LKYA 4JTTA 4IUOA 3N4EA 2WPBA 1TIWA 3UWWA 1HT6A 2GPTA 4QG8A 1PYMA 2V5CA 3ABZA 1VZWA 1H2JA 1A5SA 2ZUWA 2XYLA 2PF0A 5BU9A 2XIBA 1SFTA 1QNOA 3PZNA 1EIBA 1MZRA 4QEEA 3CZ8A 2C14A 3CIWA 2IKJA 2EQDA 1W0MA 1SO6A 1U5JA 5E70A 2QUUA 4RDZA 1AFSA 3A3HA 4AD3A 4J3VA 3P0WA 5GJPA 5D38A 4Q4OA 1B3WA 3WQGA 4AIBA 4GQQA 1A5OC 2XVKA 2IXUA 4NZ5A 4IH3A 4TX6A 4NG3A 4IXXA 3A64A 4MFDA 1PEZA 1AW2A 3AISA 4NYUA 3N13A 4AEOA 1WZLA 5G4WA 2WMKA 5F1UA 3AXIA 2ACQA 1MW3A 4D1JA 1OZQA 2NQZA 3WDJA 4QIUA 4YHEA 2CLIA 1Z32X 3W71A 2QCNA 4GRSA 4J35A 1B4KA 3QXBA 4S3GA 3EDJA 3WDRA 5DO8A 2E4TA 3CUIA 4IP4A 3I4EA 3CTLA 3LGDA 2H8XA 3GDTA 4NJKA 3I3BA 3WBXA 3B06A 4F9JA 1IGSA 1RPKA 1OC6A 3PC0A 4MTVA 2PWEA 2VFFA 2YXOA 1DIKA 2UY2A 5LIWX 1E5NA 2CZDA 1F6YA 1AW1A 3SN4A 3TYEA 2DZUA 1GW1A 2CW6A 1I2QA 3ZQ9A 1KR0A 2DT3A 2G37A 1YNYA 3TWBA 1GQIA 4YTUA 4YVXA 3KEHA 1N55A 4IZGA 5CSYA 3C0LA 2ZYFA 3AXHA 2VEFA 4J4KA 4WSKA 3WBAA 4JX4A 3L67A 3JR2A 3EDKA 3PTDA 2XGBA 1BF6A 2CHRA 2OZ3A 1XDJA 3MP3A 3O8AA 4YJ5A 1A5LC 3QLDA 1UWSA 1FWEC 2Z4GA 1TMHA 1SJBA 5A2BA 1S2AA 3W7CA 1E1CA 4KCUA 1SMDA 2FDMA 4WDUA 2QJJA 4QDPA 3OJGA 2F6UA 2UZ9A 2VELA 4HPGA 1PUDA 1ZAJA 3TSBA 3QYQA 4Q4QA 3O06A 4R7OA 1EHNA 5JU6A 3NO1A 2EHHA 2BNJA 1MYRA 4LALA 1UR9A 3F4CA 3EWYA 1IGWA 3DGRA 4IGHA 3UFYA 5FL1A 3SCSA 1EF3A 2Z28A 3WEOA 4AEFA 1NQKA 1JD7A 3NPUA 1ALDA 1M68A 3UXAA 3UYIA 4LBUA 4BQ5A 5CC7A 3NR0A 3WUEA 3WO8A 3BK0A 1HXJA 1Z9AA 4J2PA 2WJZA 3TJXA 2D20A 4C6NA 3S2LA 4W93A 4E4UA 1JFHA 1GONA 4FO4A 1H11A 2CU0A 5B80A 3LZ3A 4MVAA 1VYRA 8CGTA 4U10A 2F9RA 2VOMA 1AVAA 1WXYA 2OG9A 4C65A 4ML9A 2QUMA 1R30A 2VHLA 4H8UA 2PDMA 5D2XA 1UB3A 1W56A 4UMBA 3LI1A 2HMCA 4Q7NA 4IGMA 1DJIA 1HFBA 4XKYB 3GIPA 1PX8A 3TMQA 5EKYA 1SZNA 1KBLA 3TV8A 3G24A 2I5IA 3PTKA 1M5WA 3EPNA 3W7QA 5A69A 1H7NA 4H1ZA 4K8EA 4GY1A 3W24A 2E6FA 7ODCA 3QQ1A 4IQLA 7PTDA 1ZAHA 3VE7A 3TOPA 4GIAA 3FA3A 4UCFA 2R1KA 4Q8NA 3MMUA 4JHOA 5DY2A 3BLFA 2DZPA 4RV3A 1LTDA 5CPTA 3N4AA 2BOGX 5HUPA 4EX4A 3WH6A 3NSXA 1YIXA 1I2NA 4BF7A 1GHRA 3C86A 3STFA 1QW9A 4NYYA 3V36A 3DHPA 2YLLA 3GXMA 3WUGA 1TZ7A 4RNJA 3AMLA 5I24A 3M5VA 3I10A 4HPXA 4XVDA 1UROA 3NQGA 5D09A 2NQJA 3EX3A 5CQ1A 1OX6A 4YPJA 4GNJA 4QX4A 1P6BA 1EZWA 3GR8A 4CD7A 3APYA 5LSMA 3OYZA 5A1AA 3H7VA 4JCLA 3PZUA 4QXIA 1TREA 2V9DA 4AD2A 1W2PA 1HL9A 3B9EA 2P53A 4DAIA 2NVCA 3KL5A 3G18A 3L4UA 3NO3A 4IQDA 4ZE5A 1MRQA 2ZTJA 2YL5A 4D6EA 4W7VA 4XX6A 4C5YA 2DU2A 3UY8A 2ON3A 3MCNA 4GY0A 1FWIC 5EYWA 4KERA 3VA8A 1AL8A 1V08A 2YB1A 1XKYA 3O6AA 4MJ4A 2WV8A 1SJCA 1R2RA 3NYDA 1LF1A 1R9XA 2NXHA 4HTYA 3QR1A 1DL3A 2DSWA 2CZFA 2NLIA 1PX4A 2ZUMA 2AMGA 4ZZ9A 4LS2A 2P8BA 5D9OA 1OX5A 1RY8A 3JU2A 3MVTA 4ICNA 1K02A 4K68A 2OQHA 4JPGA 3EB4A 2WZTA 4ZL1A 3NVTA 1A5KC 4JY9A 4DUWA 1M1BA 3T0DA 2YPIA 3MI6A 2D69A 3LM7A 4F0SA 4S39A 2WJDA 3K4DA 4AF0A 3W07A 4KW2A 2CBJA 1NOUA 2D0HA 2X2YA 4L4LA 5CZTA 3B9AA 1J0HA 2PPGA 5I02A 3LCXA 3OBKA 2Y1HA 2DIEA 3PSVA 4DY1A 2WM0A 1CGVA 2QT3A 1MNZA 3ARXA 3ITYA 5K9DA 1RJQA 4LUSB 1T8QA 5ABTA 3RDKA 3CS2A 3BG9A 1TRIA 4WY0F 2J4GA 2QMJA 2OZ0A 3PPCA 3N6HA 5MKGB 4N9CA 3CZEA 3S5YA 2IKHA 2R1NA 3WF0A 4JX5A 1OIFA 4KWOA 5T26A 1TPUA 4BEQA 3UXLA 3VOFA 3S2CA 1BYBA 1FFRA 2JKPA 3F1QA 4GXPA 1VF8A 4Z1YA 2WWCA 1XG4A 4EIVA 2P50A 2QGHA 2OYLA 4MYXA 2BBFA 1J0YA 5EL1A 5HAOA 4C1NB 1WDSA 1XLFA 2V30A 1GQNA 4YL2A 1FWTA 2PCEA 3ARUA 2XGIA 1R3RA 1WDPA 4O0QA 5BYWA 1R8LA 4RZBA 3UU0A 4WK9A 4O8RA 3ZVIA 1H5YA 3HG2A 3MUXA 4E2VA 3NG3A 4L5ZA 2I9EA 1CXKA 1ZJIA 2X0SA 2BS9A 1Q13A 1P1XA 3GYCA 2OYKA 3W7EA 3VIKA 2Q6ZA 2J25A 1QNSA 3VVGA 2HS6A 1DPMA 5AC7A 1ZCCA 3OBEA 4RL3A 4XK2A 3CM4A 4IM4A 1NDVA 4AZ6A 5HMFA 5LNUA 3NVDA 3V5OA 1G67A 3DHFA 4IPPA 4HNVA 2ZCGA 1QU4A 3FDGA 1U1UA 1D8WA 5KEZA 3EDFA 3HJZA 4KGJA 2HCVA 5G4HC 2C91A 2FMNA 3HA1A 4AFYA 1YDVA 1IT7A 1YDOA 3NQBA 3QQ0A 4PL1A 4WKFA 1CX9A 5D02A 4FNTA 1PE1A 1POJA 3OEXA 1EP3A 1QPQA 2BVYA 4BZYA 2IS7A 1G7UA 4DPPA 4E6MA 5AN7A 2HK1A 3WENA 3MUY1 5G2WA 4I8YA 4V33A 4JBRA 4TVCA 1W3IA 1WKFA 3AIRA 1XDMA 5B7ZA 4OV9A 4QLLA 3LHUA 4FNRA 1L6WA 1Q7QA 1GWJA 4WY0B 1N8FA 3RNDA 5FAGA 1GT8A 5M2FX 2JKEA 4O14A 3E1F1 2ATSA 3HG5A 1EA9C 3ABXA 4HJWA 3WMBA 2GVYA 5AY7A 1X8FA 3TJIA 3V5FA 2O9OA 4UNIA 3QR0A 3H7UA 4LGXA 3KVKA 1PIFA 2OCZA 2GDVA 2J78A 4D2JA 5I06A 2QCCA 4CNTA 5D33A 2YCEA 3N2OA 3IARA 2VNCA 4NX0A 3FEMA 3GXFA 4GJJA 1TQXA 1ZNNA 4O1CA 1Q45A 1XP3A 3TN4A 3ZT6A 4P2VA 9CGTA 1I1XA 3W7JA 4QJ4B 4JTKA 3Q2DA 3NAVA 4EVZA 3A23A 4ZFCA 3MSDA 4MWAD 4CVUA 4K1WA 3A24A 5I0DA 4KIEA 1MXGA 1S5TA 2VKZG 5TD4A 3T4CA 3FY1A 3MT1A 1CXHA 1FWFC 3EEZA 3N6JA 1A80A 1HIZA 1UKSA 1UW9A 4WCJA 3WQVA 3SEPA 5HOSA 4CD6A 1W1TA 1Q3NA 2A79A 1R3SA 1FP8A 2AQVA 3T0TA 4MZ8A 4A3QA 5BZAA 1IZKA 4PTNA 3HPSA 5JMUA 1ADSA 3CMFA 3GKAA 1A0DA 4HU0A 4WOZA 4A21A 1HP4A 2WZIA 1JYNA 3UF9A 1G4SA 3KVJA 3PWIA 5LNSA 2BGSA 1K7XA 4LYKA 1JPKA 3HJEA 6A3HA 3A6OA 3BPWA 3NPXA 4RKAA 4UUIA 1BVWA 4A8RA 3BG5A 1JYXA 1G6CA 2XU2A 2ZWZA 3B05A 4JTHA 4ADSA 3RO6A 4LXFA 2PB1A 1GQLA 3BWWA 3EOOA 3DBNA 2NQLA 1TZZA 4RK8A 2OMAA 1Z42A 2VP8A 3M0IA 4LRTA 3MKCA 4AC7C 4GGBA 4AQLA 4MWAA 3NDYA 3BLLA 4OT7A 2WKGA 3IV8A 3GK0A 3SCNA 2AGTA 1HO4A 2E40A 4B16A 1T99A 4U3CA 1X38A 2QCHA 3Q67A 3WLHA 4KFPA 5I79A 1IEQA 3TN6A 2NV1A 1C8VA 2CZ5A 1JUBA 3H55A 3R12A 1XKJA 4AD0A 4GQGA 5KSWA 3K8MA 3WD1A 1EJTC 2XFYA 1KW1A 3RMEA 4C6EA 1JZ8A 2GOKA 4EOUA 3LQGA 1FOBA 2OOGA 3R0UA 1E9ZB 4W5ZA 1M04A 4AVFA 5M17A 3PULA 4LX4A 1Z8AA 1IZCA 1G1YA 3T8LA 2FHBA 1QOXA 3R10A 3DHUA 4O16A 4OVXA 1WZKA 3P62A 3SSZA 1FWHC 5J5DA 1EHAA 3QW3A 3P3BA 1JF6A 5XIAA 4K8HA 3W86A 4NJIA 5F4WA 4RPPA 3LB0A 1ECEA 3L2LA 2C7FA 2VGIA 3ZVHB 5A94A 3FYYA 5D32A 5HWJA 3R94A 1EJ7L 4GIYA 4PRTA 3T0CA 3QPEA 4LFYA 1XYMA 1JZ7A 1OT1A 2J6VA 1MNSA 4ICCX 4JIRA 1UD3A 1X39A 3AIQA 3ITOA 3SUSA 5FL0A 3W7NA 1ITUA 3HQPA 2EGZA 4PMXA 3B9NA 3TK7A 1QO2A 4O12A 5HNRA 4LVBA 1E43A 3URNA 4S3DA 3LCGA 4Q33A 4NASA 1TIMA 3PR2A 3B8UA 3M7WA 3RIKA 3A4WA 2VJXA 2E7FA 4XB3A 2NZLA 2WCGA 3MU7A 1B9ZA 4MB3A 1EWEA 3T81A 2G5WA 3QH2A 1D8CA 1XV8A 1TV4A 2XN0A 1GG0A 3ME3A 1E0VA 5T91A 1JAKA 1A3XA 3H2AA 3M07A 3SADA 1M7PA 2ZX7A 3TROA 4IIHA 2WMHA 3FYPA 3OO2A 2IQDA 1IXOA 1ZJBA 3BJSA 3W6LA 3ATZA 3U4FA 4AG0A 1E0TA 3SQMA 5HATA 3S6DA 2PBOA 1XC4A 3E49A 4B4FA 3AICA 3UW6A 3VAVA 1RA0A 4UQAA 4DJEC 3N17A 3OA5A 1W17A 3SUVA 3IIXA 3VIHA 4A6GA 4GZ7A 4GYPC 2J7GA 1UC4A 3ECQA 4LAZA 4LCRA 2WHKA 4IMEA 4XZHA 3XINA 3WLPA 2GGIA 1G5AA 1K7FA 3GFYA 8A3HA 1F07A 5IXEA 4I9MA 1QOPA 3B40A 3VKBA 1XBVA 2HBVA 1IE7C 2ZC1A 1X7FA 5BU6A 3ZXWA 2Y63A 2VDIA 1BVNP 2PDLA 1OY0A 2WVTA 3S2JA 1I9CB 1RP8A 4XD4A 3RM4A 3GH4A 4XAYA 3WFAA 2V3GA 3CU2A 1FDJA 2YYUA 3UD6A 2XWDA 3DU0A 3PANA 1CGXA 1UUMA 2Y7GA 4S2CA 1CLXA 1UR0A 3C0JA 3KRZA 3TCSA 4HQVA 3UXKA 1TVNA 3GS6A 3NEHA 4Q7IA 3B0XA 3EB2A 2BP1A 2VEPA 3UJ2A 3BUVA 2WBGA 3OVPA 2EJ1A 4CCDA 3ZWSA 3P2VA 5AYIA 5A3HA 1HKVA 1Y8BA 3PP7A 2MUCA 4F0HA 4GVIA 2XPKA 5FEPA 5TBOA 4F4RA 3EA3A 1XLDA 3I65A 3UZ5A 3GR7A 1EQPA 3VC5A 2I9UA 2Y89A 4JFVA 4QG9A 4HK7A 3ITGA 1OGSA 3A5FA 4IGSA 3O6YX 1LCOA 4INFA 3W6YA 4Y6GA 2BXVA 3ARSA 2UY5A 1DQXA 1TTJA 1R87A 1XCFA 4QQUA 2CWXA 4LVGA 1XUZA 1AMKA 2PWFA 3VGFA 2G3IA 4GWEA 1AH0A 3QQWA 4L61A 4WD0A 3M41A 3M5XA 9RUBA 3WDPP 3EZ4A 3ALFA 1XJBA 3BARA 3LDVA 1XIMA 4E2DA 1W5PA 1Q4WA 1VPXA 3GVRA 4R7JA 3VGBA 2HPIA 4UTHA 3NCOA 2WVVB 1PO9A 4MKSA 2A3BA 4EPEC 3UEQA 1NFPA 1BHGA 3G1VA 3WELA 3W76A 1RD5A 4C1KA 1MFUA 4N7QA 3SW6A 5CPSA 5J8LA 3TN3A 5D9PA 4EPBC 3TOYA 3DG3A 2QNEA 1V7AA 3QLLA 1BPLB 3TSMA 1W3LA 4S23A 1Q66A 1OD8A 1JPMA 1X1ZA 3H54A 4ALDA 1Q6OA 3C61A 4H9TA 1PTAA 4G2DA 4UC5A 3LMYA 5EU9A 3UJSA 4HHMA 2BZNA 1ONEA 4RR4A 1PKNA 2O92A 3RLGA 3SM0A 2X41A 3C2OA 1HJUA 4FIRA 3STCA 6CGTA 4ZFMA 1DHPA 4G9PA 3RPMA 3GW0A 5LA0A 1XRTA 4W88A 5EMYA 1HUVA 2EBNA 1EXPA 5E6YA 5A6SA 1B1YA 3F2CA 2OXNA 2OLHA 4ONVA 1IEWA 2CC0A 3QOMA 3UERA 4RPQA 3DI0A 2VC5A 4UOZA 4WGXA 1DWJM 4RE0A 1IHIA 1IV8A 1XGEA 2D23A 4UIOA 1JXKA 4L1WA 1QI5A 1TJRA 1YLVA 3S83A 4PMUA 1KC7A 4X9SA 4DJDD 5DBTA 3LRLA 3GVQA 4N4QA 4UB9A 3P8JA 1W3TA 2XN1A 3MDWA 3PNUA 4FK9A 5A8NA 2ZZ4A 2J7FA 2VXNA 4OJYA 2PODA 1K9DA 2P3ZA 3Q37A 4B9YA 3UA3A 1WE5A 1ZTVA 3ZMRA 2D22A 2ZDSA 4O0ZA 1D7FA 2OODA 3GRIA 3B03A 4LAMA 2PDXA 2F61A 1ISXA 2YSWA 3UWEA 4AAJA 4LVAA 1UMYA 1H7WA 2VRQA 5EA9A 1O94A 2PF8A 2ZOXA 2G3FA 1LT7A 2Y5SA 4CD5A 1VEOA 3CIVA 3CUFA 1XLEA 1BD0A 1E70M 2BODX 4NILA 3N12A 4PMJA 3S5ZA 1D3GA 1O12A 3DG7A 4EPDC 5HINA 2XH0A 5AHMA 3AIEA 4B3LA 4DJDA 3HG3A 1ZS2A 4IMGA 3GR4A 1E51A 1DWAM 3OODA 2Z7GA 3F4VA 3TIMA 1QXLA 1DTNA 1JNEA 1R0MA 1LRQA 2PC4A 5FKYA 4Y90A 2ZX9A 4JHMA 3I6EA 4N9EA 2E1WA 3BOFA 4H6KA 3W82A 1OFDA 4C7FA 1XYAA 3LQLA 5CJ5A 2XSAA 5ABHA 1HJVA 1BF2A 2GQ9A 3DXIA 1O4UA 1S38A 4AEEA 4IIFA 1JCYA 3U3HA 1OG6A 1TR1A 5M03A 4IMAA 1OEPA 4W7WA 1QRQA 4S3JA 1UBPC 3U2CA 1SW3A 1RBLA 4QEHA 3L0GA 2V69A 3G1RA 4MHBA 1EP1A 2J7DA 1EO7A 1PXGA 3OTRA 1Y7VA 2CHNA 3VFCA 3EX2A 3I4KA 4O54A 3HFTA 1EPVA 3C0QA 1QVBA 1TJ1A 3AHTA 4KESA 1G4PA 2RJHA 1BWVA 1V8EA 4ACZB 3W7GA 1SFJA 4PMRA 5BRBA 3B3DA 2PDNA 1VJZA 1DIEA 3A4JA 3TQ0A 3RJXA 4R3UA 4DI8A 4REQA 1MUWA 5DCDA 4FLSA 3QGVA 4K2SA 2BGQA 4XBSA 3QGKC 2W4XA 4A29A 2Y7EA 1K8ZA 3SIMA 3GDBA 3AU6A 4HSHA 1H49A 2QCDB 5CBIA 3KP0A 4DPQA 3CIXA 5H8PA 1W54A 4EF9A 3GNDA 3LHZA 4KFOA 1FHVA 3L0KA 4HHLA 4D71A 2V68A 3G8EA 3L21A 1GG1A 3BV4A 4KF1A 3P8IA 3S9YA 3RGTA 4F3HA 3RR4A 1KCKA 4XD3A 5AFDA 3LLXA 1U1JA 1B54A 4H41A 1Q7ZA 3QJAA 4JNMA 4DZ5A 4Q4MA 4O50A 4IIBA 3VKCA 4E5TA 2BHZA 1EOKA 2W63A 3VIOA 3S47A 3FN9A 4Q3MA 4FIQA 2D1ZA 2Z2BA 4IX2A 3SFKA 2QVNA 5F2IA 2OSWA 1A0CA 1BSIA 3VIJA 2V6AA 3P67A 4TX9A 4PEEA 5HPOA 1BQGA 1KCLA 3ONCA 3UT0A 5DANA 1PVNA 3B8DA 2PI6A 2RH9A 1Y5XA 3KOZA 2GUUA 4UTUA 2GVJA 4MKNA 2C1GA 4YS1A 4QE1A 3PPHA 3C8NA 5HPCA 4DWSA 1D9EA 2JIWA 3FJ4A 2FLIA 1LP6A 2DSKA 1XIJA 2PRHA 5C5YA 2PC8A 2XSBA 3N2XA 2ZRVA 5HJXA 3BH4A 5BWAA 3AYSA 4J3WA 3QV6A 1F3WA 3LRMA 4TV5A 1F76A 3SGGA 3AJXA 4MF4A 4HIBA 4PUJA 5BROA 5DQPA 3BOXA 4WOQA 2YL8A 1L6SA 2VWTA 1H7PA 1I75A 5MF5A 4L1XA 1C3FA 1XIEA 4PBGA 4XO7A 3U7VA 3OQEA 4BF5A 1NELA 3LMZA 4ICMA 1LBLA 3GDKA 3VUPA 2H6RA 3N14A 5D30A 1XLHA 1IR2A 3W1AA 4A3UA 4LUTB 3WD3A 2PDUA 2DZVA 4PB4A 2VGFA 1JVNA 1T6MA 4XZ9A 5EBUA 1LROA 1H1NA 3WQ6A 5EFDA 3SI9A 1EX5A 4PTVA 1CPUA 1WBHA 3IRDA 4Y9AA 2Y62A 3S1VA 1Z3NA 3G0UA 1BTMA 3MO4A 3OZMA 5IHSA 3MTWA 2ZVIA 1MXDA 1Q6LA 2GOUA 3S4TA 1TTIA 1YDNA 1U22A 1CXIA 2CKRA 4DAFA 4QR6A 2ZZ7A 1BFNA 3DFQA 2I1OA 1J6OA 4OOZA 2R24A 1T5AA 3LCFA 4LB4A 4ZCWA 1US2A 4NNAA 3KTCA 5D8ZA 3UVIA 3V18A 3CT2A 1H7RA 1XD1A 2XZ7A 2VYOA 2Z7KA 2X0YA 4NAFA 3FA5A 1K8YA 1UZ4A 1UR8A 5XIMA 4GH3A 4OKDA 1YQ2A 1OFPA 1AG1O 1C91A 3DZ1A 1OZMA 3ZSSA 3F5JA 3SJ3A 4MOZA 1ONWA 4H83A 1VPQA 4YTRA 4BKNA 4ENLA 3Q65A 1ME7A 2DFAA 1RXOB 3STPA 4P7LA 3M0ZA 5I3GA 5I78A 3QEZA 1LWHA 1P7TB 1E40A 4PB3A 1JPDX 3H6OA 2QJMA 1BSLA 1US0A 3WQCA 5CPMA 3O9NA 4KMQA 5E09A 1BXCA 3ZIZA 4UTTA 3EEGA 1EGMA 3NZQA 4WXYA 3DUGA 1H3GA 3ZYZA 3WH5A 2WWDA 1S5MA 1WDWA 4D8LA 3U0HA 2GGHA 3UG4A 3AS3A 1JF5A 1AZ1A 4R27A 4JKKA 2QYGA 4H9ZA 1Q6GA 1VLIA 5IDIA 2O4MA 1PDZA 2XHYA 1ZCOA 1V02E 1FH7A 1ICPA 1TKKA 1GNXA 3QM3A 4HYVA 3AJ7A 3E5BA 1VIZA 3EGJA 4RV8A 4PH6A 1XHGA 3PZIA 1SM9A 3LHVA 1JCJA 4M6VA 1MI3A 1W1A1 4V1XA 4YN5A 1F4HA 3GXTA 4UFKA 1K7EA 1W3NA 4U28A 4GGHA 3CPUA 4DO4A 3U7BA 3ZZ1A 1KFEA 1AD1A 2X1TA 3NQ2A 2ZZ2A 2QV5A 1VFOA 3DKLA 3WLSA 3LPFA 1OGBA 2QDHA 1EBHA 3RU8X 3DYPA 3P6LA 2G0WA 2GUYA 1KM1A 4NI3A 5AYYA 4Q8UA 4KBXA 4IHCA 2GJPA 4PUUA 4BK9A 1ZHAA 3OB8A 3GB6A 3VNYA 1WAWA 4S38A 3W6MA 4RZ6A 4TIMA 4UFIA 4CLMA 4JTLA 3NXFA 1CBGA 5E0KA 4HSNA 3GXDA 3QKEA 5A8QA 5E5CA 2NVAA 1O60A 4CCEA 2EPOA 2X7VA 1SR9A 1V6UA 3THAA 3RM9A 1SR0A 4DJFC 4GMEA 1TO3A 5CLWA 3RPTA 1YKWA 2GVGA 2E25A 1B57A 4CQ9A 4F79A 3CEUA 3HB9A 1PZ3A 2NWRA 4PN2A 4TX8A 3K13A 2JK2A 3W7RA 5FJRA 2OX4A 4KEZA 5DT5A 5T9CE 2J24A 5RUBA 1IXQA 3DH7A 4E2OA 1OCQA 2I16A 4IP5A 3S5OA 1JZ6A 1V3HA 1TE1A 2FGBA 2Z1SA 1W9BM 2VQTA 4X0VA 1FHDA 2J62A 3D5HA 1WX0A 1CEOA 3K4WA 2WBKA 2D0GA 3GKFA 3WJSA 1KR1A 1D7KA 5CG0A 1L6FA 2PDJA 1FWAC 2DQWA 1H63A 1HN1A 1NIUA 4L65A 3E9AA 1SPQA 2Q01A 1TTPA 4R53A 1R85A 1PB0A 1FKWA 1TE6A 1GTEA 3EOEA 3F4NA 3QY7A 4HHPA 4UTLA 4Z42C 2HPMA 3SECA 3RX2A 3W38A 5HMEA 4X0NA 2VGBA 1H0IA 3JW7A 2I56A 4TXEA 2FZDA 1AH4A 3BANA 3Q58A 3PJTA 3DC0A 4KCWA 3TCEA 4JR5A 1TUXA 3BAKA 3B8SA 2OLSA 3DHDA 3IWPA 4JKLA 3KOXA 3TTEA 1YXCA 1XIIA 4QLKA 1W2VA 5TNVA 3HQOA 1GJUA 1VGAA 3CZKA 2VOTA 1GKRA 2VM8A 5IM51 2FFIA 4P8XA 5CZJA 1MEIA 3V4BA 4RNFA 1MVYA 3CL8A 2GGEA 2ADAA 4HA1A 4WIWA 2BVDA 2QHAA 4GCXA 4KWVA 2QDGA 3HGRA 2XH2A 3SRKA 4UQ9A 4CNOA 3GXNA 3MQTA 4FX8A 4GZIA 2R91A 2DZWA 3P93A 1XUUA 3HM7A 3E0FA 1V51A 3W1XA 1GJWA 1OCBA 5CC6A 3MMWA 2GFTA 4IF2A 4ZODA 3UR2A 4J2MA 4QNWA 1RAKA 4O15A 2BOFX 3M7SA 3F7JA 2W67A 3N11A 3W75A 7REQA 3VC6A 5JBEA 5AHLA 2VQUA 4Z1CA 3QV9A 2Z0IA 4P8UA 4NZCA 2V5LA 2OELA 5K3VA 1NVMA 1CB7B 3W26A 3LUTA 3I3DA 3WX7A 1MEHA 2DSZA 1TJ0A 4GA8A 3QW4B 3PZOA 4LT9A 4B5VA 2DV0A 3HTWA 3W23A 3CZGA 5JBFA 3RJYA 3CNYA 1TUFA 2CLKA 1MSSA 4H8HA 7TIMA 3W29A 4O1EA 4JYFA 4FHAA 5IBXC 2NX9A 4RDYA 5CSUA 1VCFA 1LYXA 3F4WA 3VKKA 2FZ9A 3IIZA 4WSJA 4DXKA 3S9ZA 2VDGA 2FQIA 2ZRUA 4LY8A 3M64A 4KRZA 3K8KA 3VX1A 1UJPA 2GQ3A 2AL1A 3MHUA 1UWRA 3WL1A 3VX0A 1KLZA 3DECA 4DXVA 3TXZA 3C2VA 1RD6A 4L4PA 4JGDA 3T09A 2JGQA 2XWEA 4RE3A 3MP5A 4MB1A 4QRNA 1Z89A 2ZRXA 3GNNA 1P4CA 3AMGA 5D04C 2J9ZA 1NSJA 3OLGA 3ARZA 4IL0A 4QM1A 1E15A 3L2MA 2OZ8A 4C6DA 4HT3A 3WY1A 1F3XA 2FVLA 4MNJA 1DYSA 1S46A 1RBAA 2ZUVA 3HFYA 1T96A 4FNSA 2G4JA 3AS0A 4I9AA 1QMLA 5I3JA 5E0FA 3N9RA 2IPGA 3D0CA 3RF9A 1FY6A 1DEDA 5C54A 2YCJA 3TTQA 3A13A 5H91A 5C9UA 3NNTA 2ACRA 1SVDA 1UH2A 4M7SA 4WQ6A 1UR1A 2HE8A 1KTBA 4MPKA 1G9HA 4BWLC 4Y8EA 3NOYA 2AQWA 3V35A 1W1YA 3AXMA 3B04A 4GVFA 1DJHA 1XCXA 3T1GA 4UFHA 1D3CA 1X7IA 3TU9A 3BCJA 3OGRA 3UR8A 4BR1A 3MY9A 4W8AA 1BEUA 2YZ5A 3L66A 4HA3A 2O7SA 3TYUA 1KWKA 3O63A 2X09A 3QPZA 4F9DA 2Z6IA 1GZJA 1AUSL 4MGGA 3USZA 2ZXBA 3NDOA 4AB4A 4QJ5B 5LHFA 5BOEA 5LIKX 2FIQA 3R8HA 3QYSA 3QHMA 2POTA 4N4PA 2VRJA 1F61A 3EOUA 1AMYA 1S2TA 4UMAA 2WC3A 2KX9A 5DEZA 2BHUA 2BTMA 4PTWA 3CQJA 4TR9A 5FF7A 3HPXA 5C2GA 1W5QA 4X9YA 4TMBA 3UG8A 1R3VA 4PUMA 5FI8A 4D8ZA 3KX6A 1YBQB 3HGSA 4O13A 2Z26A 1W5MA 4QSHA 1M7JA 3SRFA 2Y70A 3C3NA 3R25A 3OBAA 1EJXC 4QITA 4AHQA 3KRBA 3ZR4A 3BGAA 1MRAA 3AYRA 1IZJA 3E5PA 3VYLA 4U2YA 1Y65A 2IPFA 4IFKA 3KXQA 3RLUA 5EMUA 3FKKA 2OO0A 2HNEA 1DE6A 1QNQA 2VR4A 2BMBA 1E6SM 4IJRA 3BXWA 1EP2A 4ZOAA 1X6UA 4FEZA 3TA6A 3W7LA 2FPYA 2ZVRA 1F8IA 3S2NA 2RJGA 2ZX5A 3NQEA 4L4MA 1BRLB 4RXGA 1TVPA 2BVTA 4GUJA 1F8MA 4OTKA 1FP9A 3VOJA 4N0RA 4HJFA 4I3GA 3P80A 2YL9A 4UTIA 3IK2A 5LYRA 3VABA 1V6WA 3B8VA 1B9BA 4YLWA 1VR6A 4OE7A 3WQWA 2HSAA 1F74A 1NWTA 7ENLA 4GQ0A 3M0KA 1CXFA 4OWGA 4LCSA 4F66A 4NSBA 1O1HA 4Q8MA 1JGIA 1HKIA 4C1LA 1GKPA 1RQBA 4D6HA 4HMCA 2PD9A 1Q6QA 4HCLA 3W1NA 2HK0A 4TU1A 3CBWA 1TTQA 3PJXA 4B5UA 2E8YA 4ZE4A 2ZQ0A 2V5JA 1RQEA 1H62A 4J28A 5E93A 4ERAA 3TP4A 4TTUA 1LRNA 3SAZA 1DJNA 1HQTA 4HK5A 4ROPA 1TYGA 3BW3A 4JFWA 3RRAA 3GHSA 1M7OA 1S39A 5D2YA 2V5KA 2OKOA 1RVKA 2AGKA 1TV8A 3TR2A 1SO5A 2F8QA 1XIGA 4MM1A 3EDEA 4HNLA 3MPGA 3UCCA 1V3LA 4GKLA 4FAMA 1WBJA 4MG4A 3RR1A 3VZYA 2Z6JA 2RKXA 3PZQA 1OG0A 3BLEA 2FTPA 1VHNA 2ACSA 3TZNA 2QV4A 4X22A 4B4HA 3UCQA 4DUOA 4UR9A 1M53A 3W2NA 2UBPC 1V0LA 5FJOA 3VKJA 5FESA 2FPVA 4Q7BA 3OU8A 3ZS4A 1OCNA 1KXHA 1NWRA 2G97A 4IISA 4FLRA 4IGNA 1H61A 3H8AA 4QJ3B 1W1VA 4XV0A 4IIDA 2GDQA 2QCFA 1H41A 2Z1WA 4I7UA 1UPPA 3HQNA 5K9XA 3SUWA 4UTKA 1UQZA 3WNMA 3WG6A 3W01A 2QCLA 5A6BD 1GCYA 3HIJA 3A47A 4GXMA 2NX1A 2VRKA 1W32A 2GWNA 1GYMA 4DN1A 5AC4A 3G77A 5FF0A 5FIPA 3LY0A 3UWVA 3R43A 4XTDA 3JZEA 2XVNA 2WAGA 1DHKA 4DLFA 3WMCA 2DEPA 1PCWA 4JAWA 4C6CA 1GPWA 4X60A 5G2HA 3LENA 4NT0A 1TPEA 4GUGA 2XTKA 3OZOA 4FNPA 1W1IE 3LV6A 2RAGA 3CQHA 4GNKB 4S2BA 3OGSA 1JCNA 1PPIA 2Q3RA 2ZUUA 4DJED 1TMLA 1Q4NX 3SFWA 2O9TA 4KCVA 3E2QA 4M19A 1U5VA 2B7OA 2DZTA 4XISA 3MI3A 1ONXA 2X1UA 4G7EB 3C2YA 1KM3A 2G3MA 4LYQA 2GK1A 2DY3A 1ZAIA 1BXNA 4J40A 3ATYA 4ZOEA 1NTHA 2FYMA 2BXYA 3GXPA 3HG4A 4WJEA 1HO1A 2J8FA 4ZQNA 4MB5A 1J8VA 3CUHA 1LLOA 2ISVA 3AIWA 2INZA 1J0JA 3NL6A 5REQB 4JCMA 2C0HA 3MV11 3DFTA 4B92A 4LUJA 3O6DA 3U9IA 2EO7A 4DJEA 2VZSA 4XZMX 3I7SA 4E3TA 2D2OA 1UWUA 3KW3A 3BOLA 1JFXA 5D4YA 4JIQA 3CLWA 2PMQA 3V0TA 4GYPA 3LXBA 3VE9A 3MUCA 3KOYA 3L4TA 3RITA 2PDYA 2G4FA 3FIGA 1KGXA 3A21A 2PDHA 3M9YA 3P5ZA 4IPJA 2O9RA 5FJJA 3BW4A 4WKAA 3H4GA 1X97A 2CXGA 1RK5A 1E55A 2ISWA 4O52A 3KL3A 2BV9A 3DG6A 1FWGC 3SGUA 4AD1A 6TIMA 1UKPA 3GC4A 4ZSUA 5C7HA 4HNNA 5G1MA 3WEZA 3E2VA 2VD9A 3AZSA 4CD4A 1XYFA 3TYAA 4DX3A 1MZHA 3W2KA 2G3JA 3QZAA 4CUCA 4P8WA 5A8OA 4CU7A 1NOWA 1DWIM 4DYEA 2QDDA 3BL3A 1V77A 1DXFA 4FI4A 4LF1A 4PRWA 1FH8A 3RG6A 2B31A 2VI0A 4AIOA 3CAVA 3FAWA 1JDEA 1GVOA 4KQNA 1RK6A 3GLCA 3S1WA 3W28A 1XLGA 1WZMA 4NQ1A 3UBPC 4H7ZA 3A3XA 1UWQA 3UETA 3WZ0E 2EF9A 4JZ5A 4NU7A 4WVXA 4A3HA 1ODZA 3ZT7A 3SCPA 4NJHA 1E6PA 4BEUA 3M5ZA 4Q6XA 1P48A 1NOFA 1B3VA 3B8IA 3IGUA 3O0FA 4WHBA 5IHRA 3P61A 3VIPA 3N2TA 4F0RA 3WN6A 3M0YA 4IG2A 4DUXA 1K3UA 3UCDA 5A6MA 1OYCA 3LV5A 3FLUA 2AKZA 2WLYA 2XIIA 4D1IA 1W3JA 5IDZA 2PDKA 4I7VA 3L23A 1UP2A 4LH8A 4TMCA 1X6NA 3EMZA 3WFLA 3TAOA 4GC4A 4O0KA 4E3VA 2R94A 2OVLA 1HJWA 3REQB 4BS0A 2Z24A 4GFSA 3N2MA 3E2SA 1UYQA 4GX8A 2REQA 4FR6A 2HWGA 4K6AA 2DSUA 1TSIA 4UTMA 3CMJA 3KVMA 2IXVA 1TWDA 3QMRA 3BV7A 1OF8A 3WLJA 4S3CA 1W1B1 2XM1A 3RXZA 4GUHA 2EG8A 3R89A 4BI7A 3A5VA 3C5QA 3B4YA 5I00A 2Y8VA 4W8LA 3V7PA 3NO5A 4Q8VA 3HMCA 4MNLA 3NWRA 5EFFA 1XBYA 3BQ5A 4IQEA 3EDDA 5CPLA 4JFTA 3RU6A 1BKSA 1W9UA 5FOOA 3MS8A 1NDYA 1OD0A 2GJXB 5CEWA 2DQXA 1R3QA 3TUUA 3P60A 1VIWA 1W9VA 1VQTA 3WNPA 3T4WA 2NQHA