3APYA

Properties and crystal structure of methylenetetrahydrofolate reductase from thermus thermophilus hb8
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
291
structure length
291
Chain Sequence
b'MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylenetetrahydrofolate reductase
publication title Properties and Crystal Structure of Methylenetetrahydrofolate Reductase from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 104
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3apyA00
2FZNA 1ZP3A 3E2SA 3E2QA 3APTA 1TJ0A 2FMOA 3FSTA 3APYA 4JNYA 4JNZA 3FSUA 1ZP4A 1B5TA 1TJ1A 3E2RA 1ZPTA 1ZRQA 2FMNA 1TJ2A 1V93A 3IJDA 1TIWA 2FZMA 4O8AA 3ITGA
chains in the Genus database with same CATH superfamily
1LOLA 2C3ZA 2HS8A 1CI1A 3P81A 2ZA2A 5KZ6A 3WLMA 1Z32X 1TJ1A 1EJVC 1PKLA 4UMCA 5CAKA 2TPSA 4M8UA 3IIZA 2RDUA 2E8ZA 3T07A 2ZZ6A 4D6EA 1UPMB 3T8LA 4DUOA 5DN1A 1PEZA 2F38A 2FDMA 4F66A 1AJ2A 4ZO6A 2ACUA 1GVIA 1BQCA 5J04A 5DCBA 1G4TA 4LCSA 1J4EA 3KW3A 3Q4DA 3VNJA 3UG4A 1HIZA 4XKYA 5M2FX 1PYFA 3PSWA 1A5AA 3LMZA 3ZYZA 1US2A 1EHAA 1Q6QA 3M9YA 3EWDA 3PZ9A 1F3XA 1PE1A 4A6GA 2W4XA 5KTLA 1SZNA 4PUMA 4GY7A 3NPUA 3AHTA 3OA3A 3V5OA 2X8RA 1LBFA 4NU7A 3ECQA 1XDJA 1MEIA 3JRKA 2OQLA 1YDOA 2OPJA 1GKPA 4IT1A 4N02A 4FMVA 4TX9A 1C93A 5CJNA 2R1MA 4H9UA 3GQYA 4HSHA 3CBWA 5LNSA 3Q58A 2NQ9A 1JD9A 1NFPA 2ZUVA 5CLWA 2FJUB 2OU4A 4AWSA 1UASA 1LQAA 4L6HA 4ACYA 4CNSA 3WDQA 2DZTA 3UJRA 2I9UA 4QQUA 2GOKA 4D6IA 4HU8A 4YPJA 7TAAA 2EPKX 4WSJA 2ACSA 1EA9C 2OZ8A 1TRDA 4HJFA 2CWXA 1FY6A 4S23A 1XP3A 2Y1HA 1E0WA 3GVGA 1E0TA 2VGIA 2YLAA 1X8CA 2AKZA 4KEZA 5BOEA 1A4LA 4D6GA 3GW0A 4BWLA 4K6AA 2CKRA 1GORA 4M29A 4NG3A 4ADUA 3VGBA 1XCWA 4WJ8A 1KRCC 2HV5A 1QHPA 1CLXA 3K46A 3SR7A 1I9CB 2DVTA 3MA8A 4AVFA 2J9XA 3GC5A 2NX9A 1LBLA 4XWUA 3VDHA 2D2OA 1FKWA 3GHTA 3RLGA 3VIKA 3IJ6A 5FIPA 3V1PA 4UFKA 1V08A 3U48A 1HO1A 4OBTA 2QJGA 3S5SA 4A35A 1J8VA 2W63A 1X6UA 2CNCA 1A80A 3S1VA 2CLFA 1JI1A 3E6EA 3BW2A 4HZMA 2C1IA 2X42A 1JZ8A 3PBYA 1V6YA 4MNLA 2W9MA 1S2VA 2BHZA 3GWQA 1ZCOA 1RV8A 2Y85A 1BF6A 3QSTA 4NJKA 3I4EA 3VI2A 3RCYA 1E4NA 3B0YA 2YL9A 3W6LA 2NQZA 3VKJA 5M3WA 4D6CA 3N14A 2OZTA 4AYSA 4US5D 1O12A 1ZBWA 1NOUA 3B03A 4BQ5A 2D0HA 3LERA 4WDXA 2NVDA 1EP1A 2QCFA 3WEZA 3VIHA 5DANA 4LQ1A 3SQSA 4WKHA 3OLDA 4XZLX 6XIMA 1TIMA 3TK7A 5C8BB 3AOFA 3ARYA 5HQMA 5E0CA 1XYLA 9XIAA 4K7YA 5D2YA 1TJPA 3CNYA 5DQPA 5DO8A 3ITXA 1CW2A 5I07A 4P5UA 1H09A 4CQ8A 3LOTA 4KWSA 2PDLA 1P1XA 3GG0A 3EA2A 1KTBA 7PTDA 4YCPA 1Q2RA 5EMJA 4XBSA 3ANUA 3DYMA 2DJLA 4S3FA 2WC3A 2ISFA 4Q6XA 4JGDA 5AC7A 4Z1BA 5HQEA 4DM1A 1UD2A 3N2CA 1VFOA 2HK1A 3CHEA 3EZ4A 1IV8A 1J01A 1YQ2A 2QCDB 3ARUA 4A8LA 5XINA 4ROPA 3BG3A 3GXTA 3KFTA 4JNYA 4TTUA 3B40A 2OKOA 3GNRA 3M0YA 1P7TB 2X30A 5BU6A 4HNCA 4GUHA 4DM2A 4GXWA 1I2NA 4JTJA 1XISA 6ALDA 3SJNA 4MY9A 3G1XA 4HYRA 5JIPA 3NEHA 4LS0A 5F2IA 1ZENA 5IBXA 4RUBA 4JIIX 1JUKA 1LCOA 1EGZA 1UR2A 1XKJA 2VEPA 3UQNA 5C9XA 1UJPA 1AQFA 4JTDA 2XHYA 3UJFA 4JFWA 3DUGA 3FEMA 3NZGA 4IIEA 3DHDA 3SFWA 1T96A 1AA1B 2PDJA 5JBDA 2WSRA 4ECLA 1CEOA 2PTDA 2XFFA 1WDWA 1WDDA 3URAA 1FQ0A 4W5ZA 7ODCA 3TN6A 1RK6A 1EO5A 4KGJA 4Z17A 4UTTA 1NQKA 1R9XA 4QG9A 1LL4A 4QLLA 1VRDA 2AL1A 4WY0B 1FBAA 1TCMA 5HMFA 2QCCA 3WQVA 1D3CA 1M6JA 4FXFA 4K8GA 4LT9A 4C5YA 4Q8OA 1QFEA 3FAWA 2C8NA 2QCDA 3N9SA 4JL1A 3WD1A 4HNTA 1P7TA 2VYOA 2LLEA 2V63A 5LKYA 1BG9A 3CO8A 1LG2A 3VFLA 1KQZA 3UESA 3L65A 2RJGA 3H4WA 3UD6A 1X98A 3KHJA 4EK7A 1KKOA 3WFZA 4S3AA 1VFUA 3VGGA 3NR0A 4O4WA 3KVLA 5I3DA 3FHAA 1RD6A 3GTHA 1VPQA 3I10A 4LAUA 3M5VA 4XZNX 4P7LA 4B2DD 5I77A 1ADDA 3NAVA 1NH6A 1CIUA 4MLRA 4L9XA 3M0ZA 4LAKA 3LENA 3M46A 3W26A 4DWSB 1KRAC 4YCOA 3W1UA 4OV9A 3RM8A 3N6QA 1CB7B 2D69A 3W2UA 1NAL1 3QY8A 3G1VA 1VFFA 2BXVA 4KCVA 3VNDA 4WY0A 5GQBA 1H7WA 4NSBA 2PU0A 1V0MA 4CQCA 1MRAA 4GVHA 2QQ6A 3IVSA 5CBIA 1XXXA 3C8FA 2DORA 4ZOAA 3AIWA 2FKPA 1LWHA 1R2TA 4IMEA 4LV9A 4AY1A 1NSJA 3PNUA 4WK9A 3STFA 3CPGA 3TTOA 4NUWA 3W53A 1GTHA 4BQ2A 1IWPA 4JYEA 2QCMA 3AFBA 4LEQA 2IXVA 4DO4A 1F74A 3IGSA 4FR1A 1IEQA 2WBKA 1K9TA 3ARQA 4IMAA 4GJIA 4Z2LA 4UTHA 3R10A 3S6OA 4L80A 1CGXA 1E1EA 3V36A 3M64A 1W0MA 3S2NA 3W7QA 1WKEA 1IXQA 3QHOA 2E7FA 4Q22A 1L9WA 4LWWA 3G5EA 5FF7A 2E6DA 3AO0A 3N2BA 3BOXA 4DWSA 3PTKA 2XINA 3WNMA 4KQNA 1EQCA 2G3IA 2O9RA 4LNYA 1CGWA 4E4UA 4ERAA 1OC5A 3MU7A 4PUJA 3I6RA 4PCFA 3VNZA 2GGIA 3PAJA 2BASA 3DG3A 3LUTA 4YTTA 3SCVA 3QY7A 5IHRA 1VP5A 2Z0IA 2A21A 1C9DA 1SZEA 3WH7A 3GTIA 2PTYA 3OIHA 2YL6A 1XIGA 5A8OA 4GQQA 3OVQA 4D2JA 3F5LA 4PTDA 1EP3A 1QU4A 4IP7A 1CX9A 2ZUNA 3F4NA 1XQKA 3EEGA 3W81A 3UA3A 4TR9A 4OQVA 5HNRA 4I6KA 4HB7A 2GOUA 2PDCA 1F4HA 2QIIA 4MJ2A 2OO0A 4B5NA 5BOFA 3A21A 2BV9A 3MCOA 1H5VA 4N6EA 1S3TC 4QTGA 3I7QA 2HCVA 5AFDA 3P74A 1VFHA 2J75A 1WKYA 2C79A 1JFXA 1R47A 2JGYA 3NQFA 1F6PA 3UY8A 3IIOA 2OWWA 2W27A 1JDEA 1ZAJA 1SO4A 2OCZA 2ZYFA 3EPMA 4N9CA 4C91A 3D47A 1G01A 3M47A 4GKTA 2CZDA 3UBPC 4WXZA 4GCXA 3SDOA 2C91A 5T91A 4EWJA 3EMCA 3WLLA 2O9OA 3MI3A 1UA3A 1YW1A 3CQKA 5HWMA 1A5NC 4UQBA 1RJQA 1Q6LA 1TPDA 2PD5A 4H9VA 4M0XA 3DKJA 5BXSA 3VAVA 4INFA 4A3HA 1NDWA 3GNNA 3OQ8A 4BI7A 2GJNA 1GKRA 1P5BA 2XFWA 3LS9A 3PZNA 1EX1A 4JTRA 3URNA 2YBVA 1XBZA 2CBIA 3VNLA 2CKSA 3DKLA 4ILSA 3LX9A 5H6HA 3H2CA 4K3ZA 2R24A 4OTKA 3MW7A 2GPTA 1Q6FA 3ALGA 1Q66A 2QUMA 2GVGA 5A1AA 2WO5A 3A24A 4CU6A 3NXFA 1IXNA 3M1ZA 3DENA 3WK1A 4BK9A 1JGIA 4F79A 3VABA 1E6ZA 5DCDA 1DHKA 3WX7A 3VX0A 4HQVA 4BI6A 3S9IA 1DYSA 3FSTA 2OWCA 4KFOA 4ZFCA 2HXUA 4UWMA 2R1LA 3KVMA 1R9YA 2KZHA 1GCYA 3LSCA 2ZZ7A 2EXOA 2QAFA 5DY2A 2DUXA 3CXOA 1AL7A 5IRPA 1IT7A 3GDTA 2HPMA 3OGVA 1J12A 2QGYA 1XYZA 4L9YA 3PP7A 1BHGA 2D2GA 3S5OA 2YR1A 3DC0A 3W01A 1CTNA 4IM4A 5FF3A 2PRHA 1DTUA 3GYEA 3W70A 4CD8A 3T0AA 2Y62A 3DFQA 2HMCA 1P1MA 3E0FA 4GABA 1OF8A 1X7IA 3HZ3A 3D5HA 4GQGA 3CQ0A 4UZUA 4UFJA 4H83A 1M7XA 3THQA 4GI9A 3DX5A 4KFPA 3VKKA 4HVXA 2FFCA 1SQ7A 3V0TA 3R7MA 2GSJA 2DZAA 3CUHA 3LRMA 2O4MA 1XGZA 4UR9A 3LHUA 4HK6A 3MTWA 4R53A 1XINA 3CHDA 4ATLA 4B4FA 3VGHA 6ENLA 2E67A 1Y5XA 2OR2A 2VX6A 5C9UA 2HNEA 2KAUC 4V28A 3N4EA 1X97A 2J7CA 4MKNA 1MVYA 4BEQA 1PWLA 5AHFA 3UZJA 3GVVA 4E4PA 1L8NA 4XUGA 4C6FA 3RXZA 2VFDA 5K4XA 1X6LA 2BOEX 2R91A 3WENA 1GVYA 2FMNA 3CMGA 4GG9A 1Q6DA 3P0XA 1ZBKA 1KFBA 1FTXA 4H8HA 4J3XA 1L6GA 3I3EA 3O6DA 4LVFA 3MSYA 3E38A 3BAJA 3ZJ8A 3KVJA 2YX0A 2XGZA 3N9RA 1RR2A 4X0VA 3MBFA 4JTKA 3N4FA 3OW1A 3IJQA 2XN2A 2C15A 5EPDA 3DEQA 4UTWA 3VDAA 3NZPA 4BR1A 4K68A 5CBJA 1G5AA 4PMVA 2BHUA 3QV6A 2BSLA 5AECA 3AMGA 3GNPA 1XYFA 4O18A 4AVNA 3LLFA 2OEKA 4IUOA 3EXRA 2QZRA 1OT2A 5DCEA 2XIOA 1KM4A 1VJIA 1BXCA 3QYQA 3SW6A 3PB0A 3N11A 1R3VA 4H7VA 1XGDA 1PHQA 1A0EA 1QCWA 1GJUA 1UUOA 3QYSA 1HKVA 4AWEA 4PB3A 1AH3A 5I7GA 3PUDA 3B9NA 4UQDA 5KETA 4Q4KA 4JY8A 3B04A 3WD3A 3P2VA 5D32A 2Z29A 2F7FA 1RXOB 3ARPA 3VU2A 4E8DA 3QR0A 2KX9A 4K8EA 4OZOA 4LSBA 2ONEA 4DO6A 1QI3A 1DJYA 5LZLA 1OB0A 4OOUA 3GIPA 4GUIA 3LPGA 1XR2A 2Q8LA 3HJZA 2OYMA 4AZCB 3S1XA 3OODA 3FAXA 3VC6A 4ROQA 5D09A 2Z26A 4DAIA 2ISWA 4RW3A 3L0GA 3H4GA 1GWJA 1AD1A 4O13A 2QUNA 4HHPA 2Y24A 1DXEA 4ZGYA 1UBSA 1F5ZA 2FGBA 3TZFA 1FCUA 2P8BA 4DJFC 3W6MA 5L6UA 1V8EA 4QIUA 4NZFA 5LA0A 3LLXA 5CG7A 3PANA 1WUFA 3TYDA 2WMIB 3HQOA 2RDXA 4W8AA 3C5QA 3OVGA 3C2VA 3GXMA 1O1HA 3ITVA 1OABA 3ME3A 3ITGA 4GVIA 2A3HA 3ARXA 3BQ5A 3V0SA 1V3KA 1KFEA 2BNJA 3BH4A 4Y7EA 3W07A 2I16A 1A47A 3LMYA 5ABTA 3TR2A 1OQFA 4LTSA 3FY1A 2HROA 3GTXA 4ZTYA 3HMCA 1RQEA 4S3JA 3ONCA 4J9JA 5E93A 1RAKA 3UWQA 4ZQMA 4MZ8A 1O60A 4AZCA 1GOXA 5AHIA 1KTCA 2DVUA 2HTMA 4AMCA 4WHBA 5ABGA 2NV2A 4V1XA 3MVIA 2DZSA 4NAFB 3NCOA 4MAVA 3P5YA 1UH4A 4N2YA 4GYPC 3CO4A 2QJJA 4IFOA 1LWIA 3TMLA 5D9PA 3UFYA 4MHBA 3VIMA 2X1SA 1N55A 9XIMA 3SRDA 4NX5A 4JQ2A 1OFPA 3ABQA 2HK0A 4LVAA 2A3CA 1KFWA 1EX5A 2QXWA 4I7VA 2X1IA 4DUVA 2WMIA 2VEGA 3MHFA 4DZHA 3N2XA 3REQB 2G97A 5BRPA 1EFZA 1TE1A 4S1FA 3ITLA 3AISA 5AKQA 2DEPA 4GUJA 1EL3A 1XLEA 4C7DA 4D6FA 3ZM8A 2ISSA 3OZYA 3OYXA 1I2OA 2C13A 4AZ6A 1HUVA 3AIUA 4JX5A 2BX7A 1PTDA 3L21A 4CQBA 2INZA 2V30A 1JCNA 4LC6A 1E51A 2PURA 1V79A 2YDAA 3VYLA 3U2ZA 1ZRQA 4F0SA 4NL1A 3WBAA 2RFGA 4OUEA 2P8CA 4TXEA 3PTQA 3B0VC 1NDYA 3R94A 4A8RA 2VZOA 4NAFA 4IX0A 1VC4A 4PUNA 1WUEA 4WDUA 1RZMA 2H6RA 1W54A 2DW6A 4XZHA 4S2CA 1LLZA 5XIAA 1HP5A 3AHYA 3G0SA 3BE7A 3A6OA 1XHGA 5JBFA 2G37A 1JUBA 1A3XA 5I24A 3EX2A 4GISA 1R7AA 4YLWA 3WDJA 4WOZA 3REQA 3FXGA 4L4PA 1J0KA 1MYRA 1VYRA 4O12A 1RH9A 3KP1A 3C0SA 2HSAA 1OINA 4E5TA 4I3GA 1DKWA 2E3ZA 4UFIA 2BY0A 1RPKA 1R30A 3M4HA 2NZLA 3TAKA 5C9ZA 3GVWA 1K02A 2VFFA 3LTYA 4UIOA 5LNWA 1H7OA 1VBJA 3F2CA 4H9MA 2GFTA 1UW9A 5EA9A 2YDRA 1GQJA 2NT0A 3H55A 2GUYA 4RZBA 1YYAA 3NDYA 2OZ0A 3L68A 2Y63A 3W1AA 3PHAA 1YADA 2PA6A 3MDUA 4XISA 3UR5A 2FLIA 1TV3A 3IUDA 2PD9A 3RCNA 4JEJA 3SGUA 3NPXA 1RLCL 1TPEA 3P6LA 1W2VA 4B9ZA 3NQEA 4XD3A 2YCKX 3WQGA 2X7WA 1G69A 2AMGA 5D03A 1BYAA 4UTFA 4JR5A 3B4YA 3AXMA 2PZ0A 3S5NA 1HVQA 1VAHA 1TE6A 4IPLA 2B81A 3M0JA 1E43A 3BARA 2DPEA 1V6WA 1XLGA 5D4YA 3W71A 1W1YA 4WOQA 2ZZ3A 5A6BA 1BD0A 4FX7A 4TMCA 1K8ZA 1I6NA 1UBPC 5CXPA 1ZHAA 3U2CA 5CH9A 4PH6A 4LVDA 3A3HA 3PUOA 5A6MA 4MY8A 3S2CA 3SN4A 1BSLA 3WFLA 1PTAA 3S5ZA 2WANA 3AHXA 4YTUA 3WIJA 4BFAA 2DQXA 1EJSC 3RHGA 1DJQA 1VEMA 1JI2A 2Z7GA 1E6QM 4N0RA 4A8NA 3NWRA 4D9PA 2BGSA 2H9AB 4L4OA 5A8NA 4HCDA 2EKCA 4J3SA 4Z0SA 4HPHA 4U10A 3AIVA 3E0LA 3K8LA 4G1NA 1EB3A 3VDGA 1BYBA 3S1WA 3IUIA 2V5DA 1OG0A 4POCA 3G3MA 1DXFA 3V18A 2XZ7A 1PCWA 1EIXA 4JTQA 3W87A 3NQGA 4KIEA 3GFZA 2YXXA 1MUCA 2QJNA 3WQOA 3IJLA 2VCCA 1M65A 5G2IA 3NL5A 3V0UA 3G18A 3G6LA 2ACQA 4HOWA 4X63A 4NHVA 5G4EA 1WP6A 2BBFA 4M56A 2V5LA 1G67A 4IG2B 4MPQA 4RDZA 3N18A 2QR6A 2DSUA 4CUCA 4M81A 3W2LA 3HPAA 2VZSA 3GUWA 1DQXA 1Q8AA 2BY1A 1QOPA 2XTKA 8TIMA 3MCMA 1MW1A 1ECEA 4CNUA 3BLDA 1OK4A 3POCA 1LQ0A 2PGWA 2H9AA 4DUXA 3S2MA 5TBOA 4C1NB 4U2ZA 2JKAA 4MNMA 1Q6GA 3TX9A 2WW5A 2FZBA 4N42A 3FSUA 4QNEA 1V3JA 1ML1A 4NZJA 4Y96A 3K4AA 3ZR4A 2J7HA 1DTNA 4P8WA 1GVFA 5EFFA 3QZAA 4XZ9A 1SYTA 2I5GA 4PRWA 1HW6A 1EOKA 4I9AA 5DMMA 4Y9MA 3S5YA 4ML4A 2F6UA 2PGRA 5C5YA 1MNSA 4EOUA 1DL3A 3VILA 2A6NA 3LB0A 1WV2A 3TJXA 4NI3A 3R13A 2VMFA 3VNYA 5DRIA 1JCMP 3RPTA 3VOFA 2CHNA 5HNUA 4DXKA 1V77A 1R3YA 5GVJA 1IWAA 1IQ8A 2QCGA 4IIHA 1QT1A 3URQA 1ZCCA 4IG2A 1V0NA 1YXYA 4B4HA 3OOQA 1F8MA 2Q01A 1MXSA 4HK5A 5K3VA 1K7EA 4WDTA 4CD5A 3G8EA 3W2KA 4XSLA 1ZJAA 2UY4A 3STGA 4QDWA 1NWRA 1OC7A 4M6QA 2H3BA 3UVAA 4MWAB 2XN0A 1XH1A 3UXAA 3EBVA 3Q2DA 1GOOA 3SCQA 1H0GA 4HZ7A 3ZLGA 4C1NA 2QPSA 4NYUA 3SIZA 1UR0A 1RCOB 1NFBA 4GQ0A 2ZC8A 2XG9A 3MUAA 3WUGA 4DBSA 2GZXA 2A4AA 1GYNA 3VD4A 3QSRA 5FF4A 1JXKA 1ZBVA 5D9NA 1KCKA 4AD2A 3AIRA 2NW0A 1DBTA 4RE3A 4AIOA 1TPC1 3KZPA 1KQYA 4O54A 1YTDA 3CWOX 2GQ8A 4R34A 2YFOA 3FVDA 2QCNA 3EB3A 2BS9A 3CJPA 1FXQA 4KWUA 1RVKA 2J8TA 1R3QA 2BMBA 4Q8PA 1XYAA 3QBUA 1NTHA 3GH7A 3IGXA 3HFTA 4FALA 2D0GA 4TVUA 3C2OA 1R9ZA 1VHCA 3W7OA 1GHRA 4O15A 2YZ5A 1A5OC 1QO2A 4A2RA 4BHYA 1UMLA 4DPQA 2YBUA 1UOKA 4ATWA 3KL3A 4MWAA 4RK8A 5CPTA 2PTZA 3OHIA 3LLDA 3MHUA 2WVUA 3TROA 4HA0A 1AVAA 1XL9A 4HU0A 3ZJ6A 2D1ZA 3PZOA 1JPHA 1XSKA 5D2VA 4JQ4A 2D3LA 1XFCA 4ZR8A 3UF9A 4LC8A 4GINA 4KETA 4IP4A 1GEHA 2Q8ZA 4AX6A 2VM8A 4DJDD 2GLKA 2PWEA 3N17A 1MXDA 2XSXA 4UFHA 1ELSA 3RO8A 4J5NA 5C2CA 3KDNA 3AI0A 2J7DA 4EF9A 1VKFA 1VBHA 1ADOA 3V5FA 1I0DA 3C2RA 1KR0A 3D6NA 1HJQA 1QPOA 1XDMA 1VZWA 3KL0A 1XLDA 4X9YA 1QDSA 3UCCA 3F7JA 3WK3A 2PDUA 4HNNA 1H51A 3EMZA 2XFRA 2AKMA 3JU2A 1ODUA 1MW0A 2ASHA 3H21A 2P1FA 1ZPTA 1AQMA 3EGJA 3GX9A 4Z2GA 1F61A 1O5QA 3HO8A 1MO0A 1N7KA 5FEPA 4D1JA 4KEUA 1M04A 3CM4A 3VMNA 1NOFA 2BTMA 4V15A 3HU7A 4MDOA 1DJXA 1H60A 2P3ZA 2E1WA 5I5RA 1JCLA 2XN1A 7A3HA 5E9XA 1B1YA 4MFDA 4QQ3A 1K8YA 2YA0A 4A29A 1HKMA 1CBGA 5FJTA 4E2OA 4IQEA 5AN7A 4GFIA 1A5UA 1EPVA 2ZOXA 4Q7NA 1DWGM 1J0YA 3SCNA 3R0UA 2DZBA 3SZ8A 3APGA 3WLNA 2VX5A 3TYAA 3CWHA 4S2BA 5IBXC 2VHLA 4L1GA 5HR7A 4WJXA 3MUY1 1LP6A 2AMXA 3WL0A 4HPGA 3UJEA 3OYZA 3L5MA 2DZVA 1SW7A 2UBPC 4S38A 1HJVA 3S8HA 1XRSA 4GZ7A 4EACA 4AVOA 3PNZA 4JN7A 3TYZA 5CPMA 1QO5A 4HJWA 1P0DA 3DDMA 3OGSA 1UQZA 3U2EA 4JTAA 2IQ0A 4NJJA 2O55A 5DT5A 2OX4A 4B15A 1T8XA 4MWAD 2WQDA 3W7LA 3I6TA 1WCGA 3N15A 5KEZA 2OLHA 1BYCA 1JEZA 5CQ1A 2DH2A 2XWEA 4JL2A 3XIMA 4PBGA 3NYZA 3T9PA 3WLJA 1B2YA 4JTCA 4HT3A 2ADAA 1O5RA 2V2HA 3ATZA 3AYRA 2ZX8A 3LYEA 3OA5A 3DFHA 3G1HA 2VWSA 1Q13A 4JKLA 4KFNA 5TAOA 3MT1A 4PMZA 2OOGA 2V3EA 3PG9A 4JKKA 3U4FA 3WQCA 5A8PA 2Q3RA 3AMCA 1F8IA 4R7WA 4ICNA 3LV6A 3SUWA 4PMXA 2V5KA 3ARVA 2Y4SA 4ACZB 4UCFA 1FWBC 3NURA 2WV8A 2ZZ4A 5HMEA 1X7FA 1XIEA 4MY1A 2I7GA 4PSPA 2WSQA 3G8RA 1R3SA 1UP2A 1B57A 3EDJA 4PGLA 2J4GA 3DHUA 1W3JA 3II1A 1E9YB 3MZ2A 3QXBA 3DAQA 4MB5A 1QUMA 1SSDA 2QVHA 3G1FA 2BB0A 2IKIA 1KB3A 2CLOA 3QQ0A 4RNIA 3TTSA 2QDEA 2CZVA 3R0DA 3AS3A 3CMJA 2WMHA 5CJ5A 4NZ4A 2G41A 3QMSA 3MSGA 2A1YA 4GY0A 1TTJA 3KOWA 3TNBA 8RUCA 2PODA 3LTPA 1XG3A 3U3HA 3GW3A 5EYWA 2FB2A 1I2PA 4U3AA 5I00A 2J7BA 2JGQA 3LCHA 1IIHA 3IV3A 4U5IA 3U9IA 3W22A 2QHAA 4ACZA 4H9XA 3WJSA 3U6WA 4GO8A 4FF7A 1ONRA 5I0DA 1THFD 4XAPA 4ZENA 4YNGA 4CD6A 4IZGA 4CNTA 1EF2A 4OECA 4DWSC 1DVJA 1E3XA 3FX4A 4NX0A 3UYCA 1JXJA 1XC4A 1XLJA 3FA4A 5DF0A 1US3A 2DH3A 1QW7A 4HA3A 4IX2A 3QM3A 3SGGA 3AYVA 1K8CA 4AEOA 1I60A 2OKTA 1D8WA 1PWMA 2ZX6A 4K1GA 1WDSA 3KXQA 4K36A 4KW2A 4AHOA 3G0XA 3TMQA 4EPEC 3E0VA 1D3GA 1E3ZA 4PBFA 1LDCA 3TVAA 4C6CA 4AHPA 3MJMA 1ZQ5A 1F76A 3RM9A 3E96A 4RZ6A 3PPGA 5C2GA 1SMAA 3TLQA 1B3WA 1VRXA 3BTNA 3B9OA 1NWUA 1K4GA 2J6XA 2A0NA 1VBGA 4FK9A 3T2OA 3MC5A 1ZP3A 2JEPA 4PE8A 3ZWSA 1PS9A 1ZFJA 4AU0A 1H7RA 4NYYA 3BOFA 2YW3A 2JF6A 3WY1A 3TIMA 2OT0A 3H7RA 3MKKA 1XFBA 4HZ8A 4YTRA 2D3NA 4OU1A 3O2LA 3BMWA 2D2HA 4Y8FA 2PAJA 2VCAA 3BLIA 3KP0A 3DH7A 1W3KA 1EBHA 1TV4A 4V1YA 3U5UA 1ISYA 3UCDA 3P0WA 3R1ZA 4DO7A 2GVLA 3BGGA 3N1AA 3Q65A 3A5VA 3LHTA 3MMTA 5CC7A 4GBDA 1VYSX 2O7SA 3DFSA 1E9LA 1HKKA 3FFSA 4R27A 1LOSA 5F7UA 1SM9A 3A3WA 4GHRA 4FA3A 2HPIA 2C1GA 5DMLA 1ICPA 4US6A 3ZR6A 2FH8A 2YFNA 1FWEC 4QCEA 2HNHA 3RJYA 4D6JA 3ZVIA 4KERA 4PUDA 1DJNA 1UCWA 1W9DM 1UOZA 4AZ7A 5CZSA 3AUJA 4DJED 4OWGA 4HU3A 9CGTA 4Y9PA 1ZLPA 3ZSTA 5LXXA 4I9JA 3VD7A 3PK7A 1EJXC 1J11A 1L8PA 3K1DA 4JQAA 3M41A 3QZEA 3G1RA 4RCXA 2PWDA 1V02A 1NARA 1GJWA 1VF8A 1C7TA 4HNUA 3SEPA 3CPRA 3GTFA 2V3GA 3N4AA 3TQVA 2PP0A 1F05A 3KTSA 3STCA 3EDDA 3OVPA 3BUVA 5C54A 1EYEA 1A0CA 2V8ZA 1F07A 3UZZA 5LNUA 4KH2A 3QPYA 1UZ1A 2I57A 1WQ5A 4EVZA 1HT6A 2VZUA 2J9YA 3EX1A 4IL2A 3PM6A 5T9BG 3RGTA 5DBUA 2IKHA 4CCZA 3NDZA 5G1YA 1RD5A 2WHLA 4BS0A 3D3AA 1FHDA 4K39A 4OIFA 3LBCA 4AIBA 2A79A 1QJWA 4CGTA 5D04C 1YPFA 3G22A 2J7FA 4UOZA 2OGYA 4J28A 4D8LA 4O28A 1J9YA 3VPLA 4Z08A 2Z7KA 5L9FA 3BICA 3C52A 3GE7A 2YLLA 2Z1SA 2VVSA 3WBWA 3E02A 3PJUA 2X0YA 1QNQA 1LOQA 1XUUA 1H41A 2GGEA 4IF2A 1M7JA 3UT0A 5E0KA 1UR4A 1KW1A 3S6TA 4XIMA 1OCBA 5G4HC 4F9JA 2BOGX 2DP3A 3R58A 3V16A 1KBIA 1V3IA 3NQBA 4JTLA 1QATA 1JG9A 4HNLA 3PZGA 1LZOA 1ZAHA 4DF2A 3CLWA 4GA8A 1GVSA 4HTBA 4NJIA 1QHOA 3AAMA 3QQ1A 2J74A 1UPPA 4FIQA 5EMMA 3DU0A 1UIPA 1KGWA 1KCZA 3MDWA 5ABHA 2VP8A 2GJPA 4R85A 4XZMX 3W7NA 1CDGA 2H90A 1G9HA 1PKMA 2CZEA 1EC9A 2BGQA 3ES8A 2DSWA 2NT1A 3RX3A 1AQ0A 3IS4A 3RR1A 3VM7A 4KT2A 1ZTVA 1EC8A 3EOOA 2X09A 1PHWA 2MUCA 3T40A 3W7MA 4O11A 4HNOA 3A13A 3SBFA 1WAWA 3FLUA 3M16A 3RYSA 1SO3A 1OG6A 2ANUA 1M1BA 5A6TC 2VWTA 1WBJA 2RJHA 1J10A 3BLOA 4LVBA 3UR7A 3FV9A 4FX6M 2R94A 2NVCA 1AW5A 3E2SA 4QXIA 4I7UA 1MQPA 1NM9A 3ZWTA 2PC4A 1SMDA 3VKCA 2Z25A 3NQ2A 1EXPA 4IJBA 3EDFA 1JF6A 3PB2A 1HX0A 1PZ0A 2X1RA 3KCJA 4LAMA 4JTSA 1YDYA 1VCFA 1T5AA 4CNNA 4NRSA 4QEHA 3SUVA 3W3OA 4J3UA 5M5DA 1ESWA 1BSIA 2QJHA 3LCIA 3CV6A 1E9IA 3PFRA 1S2CA 1RBAA 1QXLA 2QIWA 3BGJA 3UYIA 1TZZA 3VA8A 2D73A 3UVIA 3WCZA 2CCRA 2G0WA 4MUZA 2DJXA 3TSBA 1D8CA 3RILA 3RF9A 1TX0A 1Q4WA 3ZSSA 5G2HA 1C8QA 4GNVA 1B3OA 5LHEA 4ZQPA 3QMTA 1PO9A 1XCFA 5EL1A 4F0KA 1YE6A 1K6AA 1M7OA 3QEZA 4S3DA 4HYWA 2DT2A 3EKLA 3SIMA 3CYVA 1UWUA 4IHCA 2V81A 1OYAA 3R11A 2G95A 1B5TA 2E9MA 5J5DA 1V0KA 3CAWA 4UR7A 1Q8JA 3VD9A 3E2VA 3P3BA 4JTFA 2VI0A 4JCMA 2R1PA 4RKAA 2VR5A 4KWOA 1ZSXA 4PEEA 4R5EA 4Y9AA 4QDMA 3F2BA 1V7YA 1EUAA 3H24A 1ZAIA 3ITCA 1F3WA 2J88A 2D22A 5CZ0A 1OIFA 2QDGA 2ESCA 2R6OA 2OLSA 1W5NA 2NWRA 1KGUA 2NWSA 2WCSA 1J0ZA 1QPRA 5A95A 1KFCA 1WKFA 3W4RA 4ORMA 2PI6A 2GWNA 3OZPA 3W7GA 4NXSA 3BLLA 2FTPA 3B9EA 1XIDA 3IGHX 4PODA 4X61A 1Q63A 1ICQA 5H2ZA 2EF9A 3VGDA 5LNRA 4HHLA 2PWGA 4DYJA 3O07A 3WBXA 1J0JA 4JDBA 1HZYA 3FN9A 1O6IA 4AZ5A 1X1NA 5JMUA 4Z42C 5D02A 3SY1A 4EWND 5CZJA 1O68A 1UG6A 3GHUA 2A3EA 3UEQA 3ARWA 1XYBA 3BGAA 4R9OA 1XIMA 2R14A 1HFBA 5EY5A 5HJYA 1TMLA 1RQHA 4Q6JA 2RH9A 1UD8A 3GU2A 4A3YA 4E3TA 3E2RA 1UR1A 3AZSA 5T8GA 4YWSA 4Q7BA 2ZX5A 5FSEC 5JH1A 4JYFA 1FFQA 3BLKA 1WE5A 2V3DA 4ZVJA 4H8VA 2FVMA 4Y6GA 1TTPA 4O17A 5T9CE 3GDRA 1C92A 3WNPA 4DRSA 1CNVA 3UZYA 3UA4A 4XUYA 2J7GA 4DXXA 3TJIA 3RMEA 4AWUA 3PTMA 3WQFA 4FPSA 3BL3A 4F0LA 2GSHA 3ZXWA 5A3HA 1JCXA 3PF3A 2W62A 2YCLB 3FOKA 2CLMA 3CIWA 1EYWA 3WNKA 3ABSA 3VZYA 4FOUA 4DBDA 4GYJA 5F2GA 1A3HA 1OGBA 3O63A 5C0QA 4XD4A 3E2QA 4BF7A 3HG5A 1YRRA 1ITUA 5FACA 1WPCA 3R12A 1FWJC 4XO6A 1DWHM 5I3IA 2WVTA 3H22A 1KGXA 3MP3A 5BMWA 3O6AA 3C8NA 3W0KA 3EX4A 5IXEA 4GZJA 2IUZA 3IIXA 3SGZA 4CQAA 3I3BA 1DJZA 4KCTA 1JNEA 3W1NA 3MI6A 3L4XA 2ZXBA 3VD5A 1FWRA 3LI1A 1UD4A 3LG3A 3RFAA 5E5CA 3C6CA 3GZAA 1KFKA 2QKFA 3F2DA 1DJGA 1EBGA 1ZZMA 1UMYA 3HQNA 2OEMA 3TP4A 2JK2A 2EPMX 3B4UA 3VFCA 4QEEA 1R87A 2AOSA 3WD2A 2VZVA 4L6OA 2A7PA 1GVQA 1LYXA 4EAYA 1OX5A 2DZWA 3RAOA 2YCLA 2ISDA 3CQHA 1J96A 3LEPA 2WAGA 2WMFA 3QLDA 4RE2A 2ZCGA 1XLHA 3W85A 2EEXA 3IJ9A 3IIVA 3WLOA 2ALRA 5CGMA 1LG1A 4XVDA 3GXPA 4DVOA 2V5JA 4DF1A 1KM1A 2R1NA 4AC7C 3KUMA 4GH3A 2P5NA 2JFEX 5B80A 3MS8A 1TKKA 1XV8A 1WA3A 4O0QA 2QF8A 1B4EA 4MYAA 3ENLA 3CB3A 1G6CA 4RLIA 2J79A 4Q8TA 3PSVA 5SWUA 4J35A 5K9DA 4MNJA 2CBJA 1W1VA 1GVEA 1YTEA 3ZLFA 5E6YA 4UMBA 1PIGA 4MYXA 1M01A 1HGYA 1T0OA 1U1UA 2Q3OA 3VMOA 2RUSA 4PMDA 1D2KA 1GW1A 3UPWA 1XW8A 3WLTA 4JQ3A 2DDXA 2WHJA 1O66A 2PP3A 1HJSA 1VENA 4K7VA 5EKYA 3GVRA 5CPLA 3RCMA 2QPUA 5I3KA 4FAMA 2WMGA 3WMLA 1OJXA 3B0PA 4GZIA 3QC3A 4LS2A 1GZ1A 2WYSA 4ERIA 1VEPA 4H3DA 2WLZA 2OQHA 3CIVA 4FF5A 1P0BA 3IARA 3WJWA 2OTDA 4IQJA 3VMPA 1ZJHA 1DXIA 2YL5A 2WVSA 4DF0A 4XZWA 1XIJA 1TPWA 4HCHA 3SRHA 1CXLA 1DHPA 3T1GA 1M7PA 4XZIA 4OJYA 3UZXA 4TU1A 3LBMA 5K2ZA 1M41A 4QDPA 4GXMA 1FH9A 4CLMA 3KWSA 1XRVA 4M51A 4UOJA 1BGAA 3UWEA 5BXRA 1CB2A 4AX7A 4XAZA 3NSNA 4AXKA 1G4SA 3SADA 2J62A 4FS9A 2WWCA 2ZKMX 5HJXA 3RO6A 2GDQA 3S0CA 1B31A 1EEPA 3LDVA 2GGGA 2DY3A 2J78A 3C2YA 4DZ5A 3KS6A 3P82A 4HHHA 1TREA 4OE7A 3NQDA 4L1XA 4R88A 5T26A 1V6UA 1H62A 2SFPA 3U7BA 3RU8X 4TX8A 4ALDA 2E9BA 4YTQA 3OZMA 2EG8A 1B9BA 4QM1A 2GJLA 4CCCA 2PDYA 2Y7DA 1TZ7A 3S1UA 2FJKA 3VM5A 1W1IE 1V6TA 2IQDA 4US5A 4RNHA 5ENLA 1EJTC 1TVLA 1GW9A 2PTXA 2D0FA 2Z1XA 4JNMA 5LXEA 3BZGA 1U30A 1ZP4A 4LUIA 5FF0A 2NX1A 3W73A 3TQPA 4I8DA 5DRCA 1C7SA 3NQ7A 4NP7A 3B9AA 1QOQA 1F9CA 2ZE0A 3NOEA 4YWIA 1HTIA 5ECVA 1R5YA 1XLBA 1JR1A 3SM0A 1YDVA 2AGKA 1OSEA 1MFUA 3NPWA 4W88A 1KFLA 3GXNA 5EB8A 3VO0A 2GSEA 3TONA 4H1ZA 1OFDA 2Q09A 1FWTA 1OADA 2YA2A 3PJXA 2FZNA 2VEFA 3P84A 2DZUA 4GJJA 4QAWA 4UQAA 3W83A 3ITYA 2D20A 3T08A 1S5NA 3K8KA 4JTGA 2V5CA 3UP8A 4I5UA 3B8SA 4LBSA 3RUBL 1G4PA 3M0HA 1YEYA 3SRKA 2VL4A 4MVAA 3LD5A 4IGNA 4BCEA 1WZLA 2QUUA 1V51A 1VJZA 3CT7A 4NJHA 2OZ3A 3QGVA 3M7SA 4FLSA 1NJJA 1RLDA 1KA9F 3N29A 3GKFA 5CZKA 1W5OA 1RP9A 5HNTA 1WDQA 2W67A 5CC6A 4E3VA 4O53A 3MKCA 1TJ0A 3LQGA 4B92A 3T4CA 1UHVA 3UWVA 2NLYA 1PKYA 3ELFA 3EPOA 3CTLA 5A8GA 4J7RA 1BKSA 2DSVA 1OCNA 2HBXA 1RSCA 3ITOA 3RRAA 1Q85A 3L2MA 3SY8A 2XVNA 1KRMA 3L2LA 4JQ1A 3WH6A 1B3ZA 1GQKA 4GUGA 4ZZ9A 1KM3A 1KM6A 1FP9A 4Z1YA 4C6OA 4GQBA 4MB4A 4RDWA 1G1YA 3FS2A 4W84A 5CJMA 2X2GA 1TPUA 1DJWA 3NDOA 2QS8A 3LCXA 1KXVA 3QLLA 2XH2A 4UQCA 4RV8A 2MNRA 1B0IA 4RE4A 3L5LA 4F0MA 2WC7A 2Z6JA 3FIGA 4JAWA 5DELA 3AYSA 4JIRA 3DI0A 3R4IA 4IIGA 4EANA 5FJPA 3TTQA 3JVAA 2EQDA 5G2WA 4GE8A 3NFUA 3EAUA 1GQLA 3P8IA 2OLAA 4MWAC 4IIFA 1JQVA 1PDYA 3N6JA 5HR6A 4B2DA 3TC6A 3QTPA 3W28A 1JDDA 1XF0A 3VDCA 7XIMA 3BW4A 3GRIA 3NYDA 4PRTA 6TAAA 4CEUC 4JIHA 1SFJA 2FYMA 5CAHA 3CL7A 4JEQA 2W6RA 5H1WA 2PDXA 3POHA 5C9RA 1XUZA 5AYIA 3DI1A 3WUFA 1V4YA 2VOMA 3VKAA 1OFBA 4JICA 1QI2A 1VPXA 4H9TA 3UJSA 2VO5A 3TUUA 2I1OA 1R38A 1Q7MA 3CPUA 2PUZA 4HBKA 4C7FA 3RIKA 4A3QA 2HEJA 2NX3A 3F5JA 3KE0A 3OIXA 3URBA 4PTXA 1VLIA 4WR3A 4MADA 3UR8A 2WJEA 3NTYA 4QJ5B 3PR2A 5CGTA 3M5ZA 4GYKA 4CU7A 4QX4A 3CLMA 1JQXA 2JEQA 4HMNA 1LLOA 5EU9A 4ZSTA 5TIMA 2E1DA 3BC9A 1YE4A 4Z2KA 3CL6A 3LNMA 1S3HA 3C56A 2DZXA 3QF0A 3BLFA 4DZIA 4ZCWA 5HMSA 3Q37A 3EA3A 3P5ZA 3SCPA 3OQEA 2IQTA 3CWNA 5E0FA 1JZ6A 4LUYA 3CUFA 1E72M 3HIJA 3DHPA 4ZQNA 2OB3A 3CZKA 2PS2A 1V3HA 1E73M 3EXTA 4XBJA 3B97A 3CC1A 5LIWX 4PA8A 1EHNA 4GRSA 3GTNA 3ZS4A 3TN3A 3K13A 3OP2A 5FI8A 3AS1A 3D3FA 1QPQA 3OEXA 3VDBA 1B4KA 3HA1A 2G96A 1AL8A 1XLMA 1OGSA 3LSBA 4XB3A 3LPPA 1UKPA 5HOSA 1J18A 5A94A 2PZNA 3A5FA 4LGXA 3K4WA 1NU5A 2PDGA 3CHVA 1JUEA 4ENLA 2OXNA 4DN1A 3HGJA 3DFYA 3IRDA 2INFA 3AMLA 1XJBA 3LRLA 3UXLA 4UQ9A 1XICA 3CEUA 1K1DA 3FXYA 4UQEA 3PBWA 3E74A 4GC3A 3H26A 4C90A 3W7RA 2OWXA 2UY2A 3KBMA 3UG5A 3VIOA 1XM3A 1K03A 3ARRA 4IPJA 5CSRA 4JXCA 3A9IA 2E5BA 3O9NA 2XIQA 1UC5A 1Z42A 4C6NA 2EAWA 3TCEA 4Q4PA 4PMQA 2O4QA 3HOJA 3GH4A 3L0NA 1W5PA 1P6BA 2IMRA 1O1ZA 1QI5A 1V5XA 2OSWA 4LVGA 3L7RA 3PAOA 1X6NA 2BGNE 4O57A 4GLEA 3HGOA 5GNZA 5F1VA 1DPMA 4GFSA 1UZ4A 4GYFA 1QBAA 3LGGA 2INEA 3M0LA 1K6WA 4JTEA 5C7VA 3B8TA 1KCLA 5AC5A 2ZXDA 3PJTA 1AW1A 4G1KA 1CXIA 4WRHA 2YL8A 1TELA 4M6VA 4AYGA 5A6LA 4X3ZA 2OEJA 3B8IA 2E6FA 3DOPA 4KS0A 4U33A 3A22A 4AF0B 2RAGA 4H01A 4M7TA 2H8XA 1UKQA 3VVGA 1T6MA 1B90A 3WELA 2B0MA 1KBKA 3MSRA 2CZFA 2EO7A 2WNZA 3MB9A 3TJ4A 4DY1A 2PGFA 2TSYA 5HAOA 3IWPA 3CH9A 1P0KA 2EJAA 1M53A 2ZICA 1Z9AA 1UWTA 1LORA 3C0JA 3UPBA 1U5JA 3FYPA 4HOZA 1JZ7A 2JQXA 2YYUA 3V4BA 3PWIA 4G7EB 1EZ2A 2FQIA 3H2MA 2Z2BA 1UD5A 3C61A 2Y5SA 1REQB 2V5BA 4QCFA 2VRJA 3K30A 2NQHA 4QS6A 2B7PA 5IDIA 5IOBA 3CU2A 1EC7A 1UP3A 4E38A 5C6MA 4LU0A 2UY3A 3OLEA 4ZQRA 4LYKA 4D1IA 1KO0A 3COTA 5I3FA 1L2UA 1JCYA 4FOKA 4QAIA 3RITA 3ZR5A 1GOWA 4CQ9A 4W86A 3AU2A 4AF0A 3TAOA 1M9HA 1UR9A 3T0CA 3WQDA 3LCLA 3MO4A 3GH5A 1OFOA 1MI3A 1IGWA 1XPYA 3CMFA 3NIYA 3ID7A 4RW5A 2QPXA 2VQUA 1KXTA 4G5DA 5K9CA 4JHZA 4QGCA 3ANVA 5DFAA 2JKEA 1LRTA 1WOBA 1MW2A 4HSNA 2GUUA 1HL8A 1Z8AA 2NQLA 2CLHA 3WQ6A 3SY5A 2WLYA 2E4TA 1OWQA 5CC3A 2WXDM 3PUEA 3R2GA 1JZ4A 4A3UA 3R0KA 5HUPA 4BZYA 4HN4A 3W1PA 4YYFA 4G7EA 5LIXX 2V2DA 3MMUA 5LGZA 1DIKA 4A05A 4DXVA 4M1BA 5LA2A 1REQA 2HQAA 4KEVA 3W25A 3E49A 3IJDA 2VR2A 3VD3A 1WBHA 1GVOA 4DNHA 4BA0A 4DEFA 1GGOA 1UD3A 1Y0EA 2WC4A 1QMLA 5FKYA 2NUWA 4Q4RA 3S3GA 1POKA 3BCJA 1YPIA 1UWQA 5F4WA 3M6YA 3XISA 4UUIA 1H49A 4MJMA 1HP4A 2DQWA 4IMFA 1UROA 1EWDA 3L2IA 3THCA 1QK2A 3B0XA 3A4AA 4E4FA 1ISVA 2Z2AA 4PMUA 2QULA 2WWDA 1DWFM 1FVPA 1GG0A 3QQWA 4LF1A 3PBGA 1RQBA 3N25A 1E55A 2OSXA 4Q3MA 4IMDA 5CEWA 4IIDA 5KZEA 1LRQA 2JALA 1IXPA 3RU6A 2E0PA 3EWXA 2XSAA 1E1CB 1K77A 1K7FA 2OELA 3UXDA 1LTDA 4MM1A 5GJNA 1G4EA 5DXYA 5A8QA 4E8GA 2NXGA 4K2SA 2VX7A 2JIWA 1TB3A 4GI8A 3DG7A 1G0CA 3VE7A 3LXAA 2WBGA 4BJHA 4J1OA 4ZOCA 3P61A 2I5QA 3BJTA 3PZQA 2O92A 3R79A 2NLIA 4IGSA 1JAEA 3G1SA 5AYBA 1J6PA 1UH3A 5CPQA 1H4PA 3WH5A 2WJZA 3OLGA 3P60A 4MB1A 2J8FA 3EWZA 1NEYA 2JKPA 2QCLA 2CLIA 4KMQA 1S46A 3H70A 5A6JA 3KOZA 5FEZA 3WO8A 2IPFA 4PCTA 5G4WA 4IQDA 2A3AA 4PZVA 4MNKA 5F2LA 4CEXC 3NG3A 2VC6A 1KM0A 3T8QA 2Y7GA 1HL9A 4L61A 1C8YA 1PB0A 4KRZA 4FNPA 3KEHA 1I2RA 3DXIA 3EOUA 1HN1A 3RNDA 3H6OA 1KV5A 3MP4A 4L4MA 3WF4A 1QNSA 2HRWA 1KBJA 4C6QA 4YXGA 1SFSA 4GIEA 4TMBA 4LW7A 2ZWZA 1E1CA 2YXOA 5AYXA 4PTNA 3RPDA 3WF0A 1SFLA 3W1MA 4XZBA 3AIEA 3ABRA 5AVHA 1EDQA 2DIJA 3AJXA 3B05A 4ZE4A 3BSHA 4YTSA 2QCEA 1CXKA 3AWNA 9RUBA 5D8WA 2WK2A 4XBKA 3BSMA 2VEIA 5B7YA 1VBRA 3T44A 2AAMA 2BHYA 1ITCA 3T6CA 1V93A 4DYKA 3CV2A 1UWSA 4PCPA 3WG6A 1BG4A 2DSKA 1ONWA 4WVXA 1HJWA 3KM8A 3W23A 4FB7A 2XFYA 3I6EA 1S38A 2BOFX 3ZT7A 1MEHA 1WXJA 1YHTA 3UZ5A 4KBXA 3KBJA 1BTCA 3CASA 3W2MA 5G5IA 4W87A 5I06A 1IT0A 4J3TA 1CXFA 4O1EA 5MHBA 3MVTA 2X16A 4HK7A 1A5SA 5DMNA 4GGBA 3W1RA 3MWAA 2PRMA 4W5UA 4X2RA 4AUBA 1MZRA 3EX3A 3T42A 5E09A 1A4MA 4HKPA 2O9TA 4HMEA 4HPJA 3TYUA 2F6XA 3WMBA 3CV1A 2A2IA 2FZDA 3M6DA 4JYDA 3TJLA 2IKGA 1QOXA 1W91A 4WY0F 1Q4NX 3E0IA 3KLLA 3BCDA 3P7YA 4CCEA 2GGHA 2Y7EA 2A3BA 3GYCA 2BDQA 2O9PA 2Q71A 2ALDA 4Z2JA 1A5MC 4LBRA 1EJRC 3RMJA 1H7PA 1HKIA 4G9PA 3PZIA 1HG3A 1E6XM 3LHVA 5CPSA 4GZEA 5FJUA 2OMAA 3N9KA 1A5BA 5ECUA 3SRFA 4ICCX 2AGTA 1E0UA 4J27A 3LM7A 1GNXA 2BVDA 1XX1A 3FW6A 3QFEA 1G94A 4JPGA 2EPOA 1GPWA 3QKEA 2RDTA 1I75A 4UR8A 3W27A 1TMHA 3LU2A 2XYLA 2B7QA 1KLZA 2VD9A 3THDA 3HJEA 3CAQA 3CHCA 4TV6A 2Z1VA 1UKTA 3NL2A 3PJWA 4UNIA 1ISXA 2E09A 2XIIA 4GMEA 3QW3A 2CIPA 3WF1A 5E9AA 2EPHA 2ZX9A 1CGVA 1RVGA 2JE8A 2OT1A 2C1HA 4C6MA 3CB8A 4LYPA 2RGLA 4V33A 2V68A 5AYZA 1LBMA 1EDTA 1S5VA 2VFIA 2ZUMA 4YHEA 1W6TA 2WOQA 1M03A 2VRKA 3ALFA 4LANA 1IF2A 1CXHA 3BSGA 1LQ2A 2PDPA 1ZU8A 1A53A 5K4ZA 1IEVA 3L4ZA 3W82A 1ITXA 3O6YX 4FHAA 4C6BA 3WH9A 3UGVA 1JZ5A 3QW4B 2ZE3A 4LH8A 3WD0A 3NEVA 3G1AA 4YN5A 4ASTA 5B7ZA 3HPZA 3N13A 4Q8WA 3SQLA 3TNOA 2FTWA 1F6KA 1GOIA 1NP0A 1YXDA 4J2MA 3IK2A 1TUFA 1TTIA 1F2JA 2FVLA 5I23A 2W91A 1IEIA 3K8MA 1B3VA 1H61A 1DEDA 3R6IA 4W89A 2F61A 3I7RA 3RJXA 5DBTA 4CNPA 1S2AA 1U5VA 1U22A 2P50A 1XDLA 3A23A 1NP2A 3NPVA 2G3FA 4RX0A 4R7OA 4U4MA 4E2DA 1CCWB 4OVXA 4G8TA 3CEPA 4S3CA 3NZRA 2GGJA 3LN3A 2IKJA 1XLFA 3RK8A 4ZE5A 4YHGA 2X0HA 4PULA 1F4AA 2PBOA 3L4UA 1JAKA 2Y2WA 5HXMA 4FXJA 2P3EA 4QJ4B 5M03A 4H6RA 3HBLA 1W1ZA 3MSDA 4W9TA 4GC4A 2NVAA 1OFAA 4UC5A 4C6KA 4CVUA 4AZGA 7TIMA 1QAPA 1ZS2A 3TFXA 1JPMA 3C4UA 5AB3A 5HJLA 2NUYA 3HV9A 3NSMA 1G7UA 2PRLA 5J5RA 3QKZA 3FDGA 1JFHA 2WMKA 1FCQA 4GGHA 2CC0A 3WQ4A 3NSXA 1SO5A 1RY0A 1TRIA 1UYQA 2QLYA 2ZBTA 4MJZA 4B5XA 3KS5A 4YIWA 3WUEA 4F48A 5MF5A 1L6WA 3N2MA 2YSWA 2DU2A 1OFEA 3V7PA 4H7ZA 4YYCA 1HL2A 5BRBA 1BKHA 1FDZA 3FNDA 3LTSA 4CKQA 5EMLA 1W1PA 3SCTA 1QI4A 4L5ZA 1PL9A 1H1YA 3T4WA 4MUPA 1A0DA 4IFKB 4J4KA 3TYCA 4MOZA 3SI9A 3I68A 2CLEA 3OJGA 3FJLA 2VQTA 3EDKA 1DJHA 3EOEA 3AUOA 3K2GA 1I0BA 2ZADA 2E28A 2J27A 2F8QA 3MHGA 2V82A 4X0NA 1C8VA 4ZMGA 4YU1A 2Z1KA 4MPKA 5AHEA 1WXZA 3VIIA 5PTDA 1EKOA 5A6SA 4HA4A 4LFYA 3QVQA 4GQRA 4IIBA 2PLCA 5M17A 4P7OA 2Y6ZA 4P61A 2XVPA 1UH2A 1OHLA 2ATSA 4TIMA 2ZZ2A 1EJUC 3MWCA 4AQLA 3AICA 5D2WA 3LNPA 2ZRZA 1TSIA 2B31A 3THUA 1W9BM 4JTHA 3P93A 4AZIA 2W66A 3H2AA 3SCSA 1U83A 3KTXA 3TU9A 4TO8A 3O8AA 3W84A 3VOGA 4AY8A 1WZKA 2Y8UA 4IFKA 1LT7A 6CGTA 3S4TA 4DLFA 3M0KA 4CVWA 3WL1A 4M19A 4IP5A 3UPMA 2QGHA 2J8GA 4ZB5A 5LA1A 1IIGA 2REQB 2ABBA 4PN2A 1OCQA 3BPWA 3N3MA 2PGEA 2XM1A 4XAYA 3BCFA 1AFSA 1R3RA 1SW3A 4IJCA 3AXKA 1ZUAX 3LGEA 1NVMA 1DWIM 1TWIA 3HFYA 2AAAA 5CSYA 1AODA 3HV8A 3GDBA 1SW0A 5LIUX 5AHLA 2IPJA 1SJAA 4I5RA 4QBXA 4LS1A 3WQPA 5I78A 2VCBA 3RPMA 4F0HA 5ABFB 4RXGA 2PU1A 2P10A 3MYPA 4EPDC 1GQNA 3L4WA 2D23A 1Y8BA 2OODA 3A47A 2HDJA 4IXXA 3HGRA 3S2LA 1IXOA 3EYPA 2C16A 4DHGA 4RXFA 1DE6A 3VGFA 2QJIA 3LRKA 4WD0A 4EX4A 3EWBX 5K9XA 1BRLB 3PG8A 4CCDA 5BCAA 5BOOA 2DV0A 3W1LA 3P8JA 1ZY9A 4F2UA 2R82A 1Z41A 4GX9A 4Y9NA 1NWSA 2REQA 4XD5A 3WEMA 3STPA 1MW3A 1Q6EA 2QVNA 3EEZA 1GG1A 1XIHA 3MY9A 4JFSA 2OQYA 4J3WA 3QHNA 1UA7A 3QN3A 2ON3A 1PX8A 3OVRA 3T0TA 3BLPX 2H3DA 3M0MA 2OG9A 1OBAA 4UTUA 2WNWA 5CC5A 2A7RA 5A6KA 2VR4A 3WUBA 5ABFA 4WEVX 1V7AA 3SCWA 3AS0A 4ZA0A 4LX4A 1WOAA 4AB4A 1YTKA 2OOFA 2EGZA 1UIOA 2A5HA 1TV5A 2IXUA 1FCBA 5G1MA 5EBUA 4KESA 2WNNA 2HVOA 1GUVA 5D2XA 1MFVA 5BU9A 4RJEA 1T7LA 3RLUA 3BXWA 1XYCA 4JN8A 3AQUA 5GPRA 1JNDA 5HNNA 3B8WA 4FP1A 3EDEA 2H8ZA 3GSMA 3TWBA 1QW8A 1VPYA 4PL1A 1BRLA 1KM2A 4LF2A 4UFLA 4WIWA 4H2CA 1P6CA 3WLPA 1JPIA 2XISA 3W24A 4HCLA 1S5TA 4NJGA 3OBAA 1JD7A 3QHMA 4IICA 1A49A 4W7VA 7REQB 4UXDA 4XX6A 3UNDA 5AZ1A 4PC8A 1OC6A 5BWFA 3I7SA 1QNOA 1KLYA 3W2NA 5FCZA 2IPWA 5CPNA 1O5XA 1TTQA 1A50A 4AG0A 1RY8A 3KBSA 2C6QA 2D24A 1OM0A 3O7UA 3GLCA 4DIAA 1BLIA 2ZRUA 3IACA 4M3PA 1BYDA 3CQIA 4DJDA 3WYZA 3OO2A 2FZ9A 2VURA 3G77A 1DV7A 1AD4A 3N19B 4EKJA 2CHRA 4RDYA 1S5MA 2WQPA 2FPTA 2R1KA 1ICSA 2V9DA 1D9EA 5JVLA 3ANYA 1W1B1 4U5KA 5HBFA 2C0AA 4NZ3A 2WM0A 4LCRA 1NIUA 4NKCA 3LY0A 3HPXA 2HS6A 5A8MA 2VC7A 3G24A 2XM2A 1L6SA 5LHFA 4GIAA 3MZNA 3CZGA 1UP0A 3WSUA 3ITTA 1N2VA 5BRQA 1XSIA 1JGMA 1JL8A 5AHNA 1XPGA 3MUZ1 4P8UA 1BVZA 3V1HA 1PIIA 3IK4A 2I5IA 4XAFA 1CGTA 3E5BA 2NXHA 4NZ1A 3OBEA 1MDLA 1N8WA 2DUAA 7REQA 2V2CA 4YVXA 3A3XA 3RRXA 3O6CA 2J13A 3QTGA 2OO6A 2XVKA 3L4VA 1TFVA 1SSGA 4JZ5A 1TPB1 1ZJIA 1TQJA 4W8BA 3ICJA 1FWSA 1F3TA 2PEVA 3BLEA 3N2TA 3VKBA 1BVWA 4B5UA 1FWFC 5MKGB 1ISWA 5D05A 5JBEA 1QHZA 1ONXA 4QLKA 2PB1A 1EH9A 4QJ1A 4MFEA 1JIBA 1GZJA 1K9EA 2A85A 4DQWA 3TKFA 3AALA 4S3KA 5KMYA 1TPFA 2XGBA 4ZL1A 2HBVA 3MUCA 4O4VA 1DOSA 3NO5A 4W8LA 4REQB 3DFOA 3STEA 4Z1AA 4LRSA 3NQ6A 2WZMA 4NIRA 1HGWA 3C0QA 1PJ9A 1WNOA 1WDPA 4UBPC 1U5HA 4AEFA 4LAOA 3ZT5A 1IR1A 2NQ5A 4U28A 3OZOA 4AHQA 2QV5A 1O95A 2VDHA 4NNAA 4IMGA 3DHFA 2V69A 3V3WA 4ADSA 5D30A 4PR4A 4Q32A 3Q45A 4DYEA 4TUFA 3DFTA 3ISIX 1TO3A 2AQWA 3BDKA 1P6WA 2CEQA 1VR6A 3CIXA 3A12A 1X8FA 1FWHC 1H7XA 5E1QA 4P8VA 1UUQA 2CXEA 4JTIA 3DFPA 2PBGA 3LXBA 3F4CA 3NVTA 1NFGA 5MKGA 4AIUA 3HTWA 1BXNA 3B9DA 2PF8A 4ZQOA 4BF5A 3D0CA 3L67A 1FKXA 4KRTA 2TYSA 1ADSA 3N34A 3N6HA 3BAWA 4R7JA 1QI0A 4K8HA 4WX2A 1S1PA 2XGIA 3H2NA 1CECA 4ATDA 5KINA 2UZ9A 1TG7A 4M5PA 4REQA 1FH8A 4C5ZA 1XH0A 2FB3A 1NF0A 3INPA 4FNUA 2Z6IA 4PFHA 4QNWA 4XSMA 5CG0A 1R3WA 3QGAC 1XIIA 3O0KA 1O94A 2PC8A 4GIRA 5LIKX 4JN6A 1GVRA 4UFMA 2OVLA 2F9RA 3W75A 2JIEA 1ISZA 3VC5A 3WDHA 2CFFA 3S46A 1UD6A 3NUKA 1VFLA 1W8SA 2VVNA 3IUHA 2WCGA 5A2BA 3O16A 3WLQA 1UZDA 1RPXA 4FNQA 4HU4A 4QSFA 3IVTA 1ME8A 3NO1A 3TCSA 3MMWA 4ZB0A 1W3IA 2XIBA 4EIVA 4FI4A 2BVTA 4H41A 1EJ7L 4XAGA 3BAYA 2QJMA 3ARZA 4RR4A 5D2TA 5GJPA 3TQ0A 3U57A 3PY2A 2VRQA 3QH2A 2QNEA 3TW9A 3NM1A 1UR8A 5FJOA 2XVGA 5XIMA 2QDHA 2PSNA 1UQYA 3LHYA 3VKDA 1DQWA 3VOJA 2L5HA 4ZFMA 2PMQA 1W37A 2PWFA 1DORA 2FIQA 3LPOA 4ZTXA 1YMYA 2DT1A 4PCNA 1QNPA 5AY7A 2X1TA 1C8XA 1HF6A 3LZ5A 3SSZA 3WK0A 3WFAA 3THAA 3W7PA 3VCRA 3IRSA 2UY5A 1CLKA 3GB6A 1US0A 4EXQA 1YX1A 3C2FA 4C65A 4C6LA 3H8AA 1KXQA 3I3DA 2VDGA 6PTDA 1XD0A 4H4IA 3LA4A 1TA3B 3A4XA 2ICSA 2XJ7A 2P0OA 1MSSA 1W3LA 4Q8UA 2ZUWA 1E5JA 1Q7QA 3MANA 3ABXA 2J25A 4KCWA 3LPFA 6REQB 3AC0A 3H4XA 3MP5A 4H6EA 4JIEA 3UJ2A 3FKRA 3RX2A 4AZHA 7ENLA 4PFMA 3CZEA 3BV7A 1LUCB 4DWSD 4RL3A 2PDMA 1SPQA 1A5KC 4AW7A 2P76A 1AG1O 3W37A 2E6YA 4H8UA 3WQ5A 3QC0A 1R0MA 2F84A 1XBYA 4DNMA 4QSHA 4B16A 3NVDA 1I8JA 4PUWA 2ZIDA 2YGYA 1AZ2A 2YIHA 3HG4A 4JHOA 4E8CA 4NT0A 1UZHA 4NY2A 3QV8A 3AYTA 2OYKA 3ZFHA 1C91A 4J3VA 1XS2A 3CZLA 4DBUA 5FESA 5H8PA 2GVJA 3S9YA 3EPNA 1KBBA 1Z3NA 1Z48A 5KITA 1XH2A 4UNLA 4NF7A 4KWVA 4W85A 3C86A 5LYRA 3WD4A 3LGDA 1FUYA 4GWEA 3GBEA 1TA3A 4RE0A 1I45A 2HJPA 4DPPA 1PZ2A 3BMVA 3GR4A 3TH6A 2C14A 5D9OA 1BXBA 3GHSA 3PWGA 3KRUA 1O4UA 6REQA 2RDWA 1ZL1A 4RNFA 2ZQ0A 4QG8A 3W72A 3W02A 4LNCA 2Y8KA 1FDJA 4HMDA 3N04A 1LUCA 3F1QA 4M1RA 3YPIA 5A69A 3SN1A 2CLKA 3GC2A 2OGJA 5IDZA 4DAFA 4P7RA 1VEOA 1E6RA 1AH0A 2HE5A 5AC8A 3W7DA 4JX6A 4AXNA 2ZUUA 1LLWA 4DZAA 3DBNA 4GY1A 2BVYA 1XLKA 4YMZA 4DJEA 3KTCA 4B5TA 4LB3A 4EE9A 2ZDRA 4MSSA 3SFKA 1AW2A 1UKOA 3BG5A 4BQ3A 1QWKA 3VZZA 3CV7A 2ZUSA 3WF3A 1Y5WA 1J79A 1W17A 2DT3A 3CH0A 2WSKA 2ZZ5A 3R43A 3CUIA 3GU9A 1HJUA 1W9UA 2XH0A 3VX1A 1V0LA 1JYXA 5BWAA 2CLLA 2X05A 2WCAA 3LK6A 2VXNA 4KGLA 1L2QA 3ERPA 1T99A 5KSWA 2P88A 1TR1A 4P2VA 3NL6A 2GQ9A 4Q8QA 3E3HA 3L4TA 4HYVA 3T55A 1C29A 5EMKA 1OCJA 2GUBA 3W29A 2YPIA 3SUSA 1E15A 3M44A 1WAUA 1W2PA 3I65A 3QGKC 3HQ1A 3TWAA 1PXGA 3WH8A 5F1UA 3BAKA 3WDPP 4EPKA 3F4DA 1P48A 4A22A 4UOQA 2YCEA 1NY1A 2QDDA 4KKXA 3FYOA 1N82A 1QWGA 2Q6ZA 4UTKA 4RPQA 1SVDA 1GONA 1NF7A 3RR4A 1JCJA 3OU8A 1TYGA 4PSRA 5D38A 2VENA 1Z89A 2J77A 2VD8A 3WBEA 4EPBC 4NRRA 3VIFA 1KTNA 2WPGA 4BI5A 1SJCA 2VGBA 3LCGA 3SUTA 3U7VA 4GNJA 1KFJA 2CHOA 3SAZA 3TTEA 6A3HA 1TMQA 1TWDA 1XGEA 3M5YA 3BV4A 1BAGA 3L23A 2AL2B 4TV5A 1WB0A 2Y5JA 1EPXA 2Z27A 4GPNA 3ABOA 2POTA 1JPKA 4F0RA 3H2OA 1M68A 2B7NA 4R3UA 1ZNNA 5DXXA 1GKQA 1AMYA 3KOXA 3QR3A 1PUDA 3TSDA 2VGGA 4L65A 4L1WA 3PVFA 3W86A 2WHMA 1EXBA 2G4FA 2PWVA 2J47A 1OYCA 2QT3A 4NNCA 2BWGA 1JYWA 4OOZA 4LY4A 2DGAA 3TN4A 4EXAA 5IHSA 1FX6A 2WZHA 5CLTA 2P0IA 1K70A 5F4SA 5IM51 3QJAA 1PVNA 3L12A 1K9FA 3W7KA 1LRNA 5BMXA 1QNRA 3GXDA 1IZCA 4UMAA 2BVWA 1ZJBA 4ADTA 2Z4GA 5E6ZA 4MTVA 1E71M 4QITA 5F2MA 3P80A 4B90A 3PULA 3TA6A 1UR3M 3UWWA 4I7WA 3KBWA 4JBRA 3GNXA 4W93A 1LT8A 3NZQA 1XCXA 4TVDA 4YVVA 2E5DA 1XG4A 2GQ3A 3BWWA 4M7SA 5I09A 3W1QA 4JIPA 5JUVA 2XUCA 2PWUA 5IFPA 2OJPA 3CYJA 2AL2A 3EWWA 5FEWA 2XH4A 2C71A 4LYRA 4ZO8A 3UY7A 1PIFA 1JVNA 2I14A 2WB5A 1GOQA 1IGSA 3O3RA 1GJPA 4O19A 4J2PA 3E0WA 4NAEB 1IWBA 5DT7A 3SECA 1GOMA 2J7EA 2PDIA 3B8VA 2BXYA 2W5FA 1O7AA 2Y89A 2F6KA 1M3UA 1UUMA 3CTTA 4IXHA 2V67A 4EF8A 4IJRA 1GOKA 4NXKA 3MJYA 2WPBA 3W7EA 3APYA 4CN4A 1GTEA 1KC7A 3AIBA 2ZWYA 1IEXA 2VUNA 3DYPA 3MV01 4L7ZA 4J3ZA 4G7FA 3FK4A 3UR2A 4M6UA 4B5SA 2BLEA 3OG2A 4FEZA 5K7JA 1LL6A 3HMJG 5LGXA 2J6VA 2HISA 2B4GA 4TX6A 4XK2A 3ARSA 3IV8A 1XRFA 1B3YA 4NVTA 1PDZA 4LEFA 5FL0A 4O14A 3GZ3A 3W7IA 3SN0A 3G0UA 1JRCA 1FWIC 2PCEA 3E12A 1V03A 3OBKA 4E0CA 2Q8XA 3G3DA 3GXFA 2WJFA 1J6OA 2FHCA 2DUZA 2ZXQA 2QMJA 2XU2A 4HN8A 3NA8A 3CUZA 1TPVA 4XD6A 1NDVA 1QPKA 3H2FA 3W9ZA 4NAEA 3WLRA 1CGYA 4O16A 2PDHA 3E9AA 5CSUA 1VCGA 2CXGA 3UZWA 3F03K 1X1OA 3KRBA 2P53A 4JTUA 4N9BA 1VD6A 1EZWA 2X0SA 4F8XA 2FTYA 1CLVA 3ONBA 5A2AA 1XRTA 1PZ1A 3MBDA 5FOOA 1E4LA 5C71A 3BW3A 2R9RA 4A2SA 3CK5A 1HO4A 1ODZA 5D37A 1S5WA 2WKLA 2QV4A 3GDLA 4FNRA 1KWKA 2G3JA 3CZ8A 4GCAA 3BO9A 1AJZA 1E56A 4GH1A 4MAZA 4LCQA 1OEPA 1RA0A 3O1NA 4KEMA 4H6QA 2EG7A 2GL5A 3ABZA 4RZ5A 4P8XA 4C6PA 4E2VA 1GYLA 1XSJA 3DIPA 3VGEA 3PS7A 3SQMA 1NELA 3A4JA 2WHKA 3IVUA 3N2OA 1Z6KA 4I6VA 1A5CA 2ACRA 1QTWA 3TC3A 4WGHA 3U0HA 4AWTA 4C6JA 3WQ8A 4YL2A 4GBUA 3GC4A 3NZ1A 3N73A 3DESA 1VHNA 2IW0A 2X40A 1XIBA 2GQAA 3WJZA 1RALA 3UW6A 2DIEA 1Q6CA 1FDYA 2GJXB 3TEVA 1ZGDA 2FH6A 1PAMA 4AISA 3WNLA 3WLHA 3KL5A 4XV0A 3JS3A 4S3GA 3MKVA 2FHBA 3TN5A 3DERA 1X1ZA 2PCQA 3F4WA 5CKSA 1JYVA 4GOAA 1E9ZB 1OX6A 4DX3A 3GXIA 4QG6A 4AFYA 4IISA 4JTTA 4FOJA 2NV9A 1OFQA 4AIEA 4DO5A 2FGZA 1JPDX 4MMWA 1AUSL 2VOTA 2B7OA 5FEXA 4WCJA 3PPFA 4QE5A 5CZTA 4PTWA 5U7SA 3NQVA 1BQGA 3AZTA 1Y65A 1E0XA 2ZRXA 1U33A 3PN8A 4K38A 3IANA 3T2QA 3BAXA 2R8WA 1FWWA 4PUEA 4MGGA 3RX4A 3VINA 4ORIA 1RBOB 4IGMA 3AXIA 2VFGA 2EBNA 2ISVA 3L66A 4DBWA 1DIOA 2BG5A 3GFYA 3T7VA 1QASA 2FHFA 3IJ7A 4WKAA 4M80A 1OZMA 4Z1CA 2Y70A 3I4KA 2C0HA 3NJ3A 2GJXA 4P7NA 2QEZA 3QZ6A 2DIKA 1OT1A 1W1TA 1SGJA 2CWNA 4AD4A 3EXSA 1H11A 2Q02A 2VT0A 2X2YA 2CERA 4GVFA 3WNNA 3G2GA 3DN5A 3MUXA 2ATMA 5AVNA 1H7NA 3C3UA 3ES7A 4MIMA 2ZUTA 1H3GA 2YDSA 4C7GA 2ZA3A 1ECQA 3LZ3A 3RN6A 2HZGA 1W56A 1W9PA 3TQKA 5LNVA 4IH3A 3W74A 1M5WA 3VOIA 4F2TA 3WLIA 1EIBA 3KDOA 5EGRA 3IAPA 1R86A 4UCGA 1Z69A 5I3GA 1C9WA 2VELA 4D72A 3GHRA 3HQPA 4IPPA 5HUOA 3UNTA 5HK4A 4LB4A 3VIJA 4JKMA 4Z1DA 3FJNA 4KF1A 3RM4A 1W8GA 3GR8A 5D9MA 3RLVA 4ZEPA 4LUSB 4M82A 4JIQA 2ZC1A 3UG3A 1GT8A 3NXLA 2X1UA 1SR0A 5A2CA 1G7VA 4GNKB 3OB8A 3BK0A 1D3HA 2VDIA 4AH7A 3R8HA 1NOWA 3KWXA 1DWJM 2PPGA 2CPUA 5C55A 4LAZA 4GO9A 4AY7A 3TV8A 6TIMA 1ONEA 4PB4A 3CHFA 2PP1A 3PZMA 4RV3A 3WKZA 2BP1A 1Q6OA 1OYBA 2BODX 2W92A 2YB4A 3TOPA 1KD0A 1XD1A 4PMOA 1FWNA 5HULA 4QHRA 3IAQA 1H1NA 3G6MA 3EOSA 8CGTA 2G5WA 1SJDA 1I2QA 4FR6A 2VC9A 4QP0A 4HSOA 3BAIA 4KPLA 4H8NA 3W6YA 1PX3A 4ICMA 3PZUA 4B3ZA 1PYMA 3AXXA 3HPSA 4HP5A 5RUBA 3DBPA 4O1DA 4EP8C 4L6DA 5G1TA 3SUUA 3UXIA 1UB3A 2WSYA 3SCRA 1ITQA 3JZUA 2ZRYA 3MV11 1HNYA 1BFNA 4OBRA 1XC6A 2V3FA 2ZA1A 2CETA 2NSXA 1PZ3A 4YS1A 1JDAA 4H9ZA 1AMKA 4LUSA 4IUGA 1TUXA 2G3MA 3SCUA 5HMDA 1L6YA 3M0IA 4GKLA 3VK5A 1NQ6A 2IS7A 3UWYA 3PZVA 4U31A 1EO7A 1KNWA 4IOTA 5A6BD 1FHVA 2YW4A 3JR2A 2EPNA 1WKDA 4P7QA 4PMNA 1WO2A 2XSBA 2GK1B 1I1XA 3AHZA 4BKNA 5I3JA 1I4NA 1K3UA 4M24A 1SO6A 2BFGA 2VFEA 1HXJA 1WZMA 2BY3A 3IGUA 1CENA 3IEBA 4QE4A 2G4JA 2XWDA 4GJ1A 4LY8A 2Y8VA 2FDSA 1LJYA 3S1GA 4B91A 4NQ1A 3KCOA 3KOFA 1K9DA 1ME9A 3VTRA 2YB1A 4ZOBA 4OBSA 5TNVA 4O8RA 1PKNA 3V75A 1E6NA 4JFTA 4A4AA 2A3LA 4ZXOA 3H7VA 1Q7ZA 2Y7FA 3GAKA 3CUJA 1R3TA 1W5MA 3WDIA 2XVLA 3W7JA 1TJ2A 1KCXA 1N8FA 5FF2A 2WMJA 1GK8A 7CGTA 3SCOA 2YCJA 3T0DA 4AD0A 4HTYA 1MUWA 1GYMA 2W61A 1VBUA 1F73A 1FHLA 2VFHA 1IHIA 3B8UA 3GKAA 1EWEA 3OG3A 5I03A 1KKRA 3VNMA 3VZXA 3WNOA 3WMSA 1SZRA 3DG6A 4GD0A 4BWLC 4JS3A 1H63A 2VJXA 1EDGA 1XI3A 2GK1A 1JDFA 1BWVA 4AD5A 1I1WA 2YKKA 4DBEA 1J93A 1FFRA 2FFIA 4RDVA 4MF4A 4HGXA 3GBDA 3WK2A 3HG2A 4H9YA 2VTFA 3WJYA 5LIYX 1ENUA 3M5XA 3B0UX 1VQTA 4LYQA 2EJ1A 4RNJA 5F4XA 2EKGA 3DC8A 2Z1BA 3NQ8A 4B5WA 1UWRA 4CQDA 4BF9A 1YXCA 2Z28A 3AJ7A 1VIWA 3BVJA 4MG4A 2D2JA 4QS5A 2PDFA 4DUWA 1QRQA 1GPFA 2V6AA 4FXRA 3AWOA 2WM1A 3N12A 4K37A 4X9SA 3G1YA 1A5LC 2PDWA 4OKDA 4UB9A 1PCKA 4F4RA 3T09A 4PUUA 5BZAA 2E6AA 4YJ5A 2X7VA 5FSDC 3DFNA 4AAJA 4JFUA 4FX8A 1QNVA 2E40A 2VNCA 4I5XA 1DP0A 1WZAA 2AQVA 4JOMA 1JZ2A 4Q4SA 4Z2HA 2HE8A 4HPXA 4PMRA 4K1WA 3PFMA 1IZJA 4C6EA 1SR9A 5AZ0A 3E1F1 1KRBC 4IGHA 1E0VA 3W38A 3KAOA 2FPYA 3TSMA 3FDKA 1FXPA 3WF2A 2BY2A 4WJEA 2J24A 4G56A 5GNXA 4LUTB 3OGRA 4U3CA 3O0FA 4U2YA 3JUGA 1JF5A 3HGSA 5E70A 2I17A 3W2JA 5FJRA 4MWAE 1P43A 5DMYA 1F3EA 1X38A 4J40A 4JFVA 2Z00A 3VE9A 3M0VA 3S9ZA 2FVKA 5CBBA 3UXKA 1BVNP 4NASA 2Y5EA 3GG1A 2UV8G 4F2BA 5BNKA 3TXZA 3N3TA 4I9MA 3UWUA 3HURA 3HG3A 1ZALA 1JZ3A 4HMCA 3IJ8A 1S1RA 3PPHA 2BZNA 5AC6A 3S42A 3W7HA 1HVXA 5C70A 4FIRA 4R9XA 3VOCA 1C3FA 2DVXA 5I02A 3S83A 3TA9A 1AZ1A 1KXHA 8A3HA 5CGQA 3LXCA 4Y90A 2PTWA 5CPOA 1YBQB 3M0XA 1IE7C 3IPWA 4IPNB 2MANA 3TLLA 3CAVA 3H54A 1OK6A 1P0EA 1YKWA 3T78A 1VH7A 2CYGA 4BY3A 1J0HA 1GEQA 1RCXB 4XG1A 4E2BA 4CU8A 4QJ3B 3R8GA 1EQPA 3TYBA 1CGUA 4HA1A 4LUTA 3K4DA 3TC7A 4XIAA 4PTMA 4E6MA 3FKKA 3VIGA 2WNQA 3AXHA 3UERA 4D6HA 2G50A 1RUSA 1F6YA 5BXTA 4UTTC 5FA5A 3PBUA 4IMCA 2GDVA 3TW7A 1HKWA 4DJDC 4ZQCA 3PWAA 4GK8A 4WKFA 5DLCA 2RKXA 3OTRA 3LHZA 3O15A 2YJQA 4WGXA 3HF3A 2O56A 4N9DA 3EX6A 2WZTA 4W7UA 1S2WA 2CITA 5JXQA 3ZJ7A 1R85A 1IT8A 3GG8A 4AD1A 4TVCA 2VEMA 3EMQA 1CWYA 1GQIA 1MQRA 3PBVA 2DSZA 5HPCA 2DW7A 1W3HA 4JD4A 4Y9OA 5FL1A 1YBQA 4C1KA 3V5CA 5HA7A 4OFCA 1R2RA 4XQ6A 5TF0A 1W3NA 2F2KA 5H8MA 1P4CA 2QUTA 2Z1WA 3VUPA 4O1FA 1OF6A 4PB5A 3KLKA 3A64A 2E77A 3U8GA 1TWZA 2XH7A 1DWAM 2JBMA 1OZQA 4AC1X 1DE5A 2ZTKA 6XIAA 1Q65A 3MQTA 3DGBA 4Q4MA 2PDKA 3QRHA 3NOYA 4QLJA 4L64A 3VOHA 3CS2A 2XDFA 1UKSA 4A8IA 1KV8A 3D46A 1R7OA 4PTVA 2GWGA 3PTDA 5I3HA 2FPVA 1RHCA 2NSOA 3S6DA 1QBBA 2ZRWA 1H2JA 3DECA 1R6WA 1NWTA 3T81A 3FA5A 4IWWA 5FAGA 1XBVA 4MZYA 1WDRA 3PBMA 1CZ1A 1S2UA 1J5SA 1E6SM 5BXPA 2ZXAA 4Q33A 2WKJA 4AEEA 5JIWA 3NO3A 4OV4A 1SFTA 3MUIA 1CYGA 1D7KA 2NXIA 4QR6A 5FJIA 4B9YA 1S39A 5I79A 1V6VA 3AS2A 5AYYA 1FWCC 4AZBA 4O0KA 3F4VA 1HQTA 8XIMA 5DEZA 3APTA 4ERGA 3TFCA 1CT5A 3NGJA 1TVPA 3LQLA 4AMAA 5KZMA 3MI2A 5BW6A 4LPCA 4I8YA 4C6IA 4NI8A 3RLHA 3NQAA 1TV8A 1U1JA 3WLSA 1FP8A 3VIPA 3NL3A 4HZ6A 1H50A 1IYXA 3BJFA 1POJA 3GD6A 4X60A 4ES4A 1E70M 3UETA 1PX4A 3WEOA 1KR1A 1AQHA 1L6FA 1QK0A 3R25A 1E6PA 1Q6RA 2W0UA 4PYSA 2FZ8A 2ODOA 3T05A 3QV7A 4WXYA 1SUXA 1WXYA 4NZCA 3QPZA 1RBLA 5H8UA 1NDZA 5LSMA 3GK0A 3Q67A 3H2EA 4XTDA 3LM3A 1BWKA 4GXPA 4W7WA 4KWWA 1BPLB 4F9DA 1UC4A 1PPIA 1LWJA 4OHQA 4PMJA 2Y0FA 1PV8A 2PWHA 2ZRVA 3P67A 4ZSUA 3OHMB 1TPH1 4DWDA 3UCQA 3BMXA 2G8ZA 1SJBA 5C2XA 2HVNA 1XBXA 4GX8A 3NQMA 4JDYA 1ZBCA 1W1A1 1B30A 3WDRA 4D71A 2W79A 1V6XA 3P14A 4TTGA 3F5KA 3H7UA 3NGFA 4O10A 1VJSA 1VYPX 2CBUA 2YOCA 2TRSA 1LL7A 1W5QA 3QR1A 3ARTA 3L5AA 5EFDA 1J0IA 4LRTA 4CN1A 3ZMRA 1XLAA 3RDKA 3UU0A 1EJWC 3LV5A 4QRNA 4GACA 1BF2A 4WLCA 3ZT6A 2CLPA 4QFUA 3CL8A 3WZ0E 3SO7A 2RGMA 1VCVA 2ZVIA 1JYNA 4O52A 1MRQA 3NNTA 1FHUA 1R2SA 1UWAA 1E4IA 3R8RA 2NUXA 1XLIA 2PLKA 3TXVA 3MYOA 4CN6A 5JU6A 1YNQA 2VGFA 2XIJA 1YDNA 4LV4A 3BG9A 4GUFA 1YNYA 4UNKA 3K5XA 1VFTA 2CU0A 3LCFA 1E5NA 2VEKA 3MMDA 4H00A 3NM3A 3EB4A 2EHHA 4LXFA 2BXZA 3TTYA 3CZJA 4GI6A 1BGGA 2YCIX 4UTLA 3UG8A 1DIEA 5JQ9A 3FEQA 4A21A 3U4AA 3KOYA 1OD0A 5HPOA 4LOCA 2WZIA 3PZTA 2PF0A 4EXBA 2Z2UA 3RG6A 1EGMA 4D8AA 3VNKA 2ZX7A 5HANA 4LJ3A 1TX2A 1X39A 1YNPA 4I90A 4XVEA 3WQWA 4B5VA 2V0TA 3VCNA 4GI4A 3TR9A 4JNZA 3GR7A 3TOYA 3BOLA 2JF7A 1JDCA 1VIZA 1TV2A 4URIA 5H91A 3XINA 1LROA 3A4WA 5A5WA 3R89A 3HPFA 4H2HA 2WSPA 2PDBA 1RJRA 2POZA 3AIQA 4R33A 1RCQA 1VLWA 3FGCB 1IEWA 4WF7A 1TZ9A 2VX4A 1AH4A 5JH2A 3WMCA 3VXGA 1JCTA 2CW6A 2EG6A 3W00A 1Q45A 1V02E 3E5PA 4MB3A 1LF1A 4DELA 2PDQA 3BANA 4MKVA 1MMFA 4ZO9A 3QFWA 1Y5VA 3W88A 5HWNA 3GFXA 1OGGA 1DIDA 1RA5A 3L0KA 1DJIA 4KRUA 1H1ZA 2ZDSA 4RPPA 1XQLA 1MNZA 3DYOA 4WQ6A 5IFTA 2J9ZA 4FNTA 5HATA 3ORWA 4M6PA 4L4LA 1BWLA 1J5TA 4CD7A 5I2UA 3AZRA 2Y88A 3B8DA 4RZ4A 3AMKA 4D8ZA 2PFHA 3CQJA 4DJEC 1L0PA 2DT0A 2GVYA 5I6SA 3H23A 2WKGA 4IPIA 1TQXA 1O5KA 4ZOEA 2NV1A 3QV9A 3K1GA 1MXGA 4PEKA 3EB2A 1K8XA 1QW9A 1U1HA 3FGCA 1BTMA 3DZ1A 1OX4B 3WLKX 1MUMA 4B3LA 4MKSA 1EA0A 1XLLA 2YA1A 1SZGA 1EP2A 1Z7AA 4GVGA 4IQLA 4JY9A 4MLJA 3QOMA 3Q94A 2OFJA 3GAYA 1VFSA 1KBLA 5DY3A 1A3WA 3ZLHA 4X2PA 5TQLA 1EUNA 1ZB5A 3QMRA 3PC0A 5BYWA 3NQCA 3QOKA