1B3OA

Ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
489
structure length
304
Chain Sequence
TSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dehydrogenase
molecule keywords PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
publication title Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 304
sequence length 489
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b3oA00
2A6LA 2DZSA 1F05A 1UUOA 2DZVA 1WBHA 2C0AA 3NQDA 4ADUA 1FX6A 4PC8A 4M19A 1QOQA 4O50A 3FJ6A 1H51A 1DQWA 2NX1A 1HFBA 4KFNA 4WY0F 1IXQA 4XKYB 2H90A 3E49A 1H5YA 2FPTA 3T44A 4QSHA 1TQJA 3C0JA 4FNRA 4DO6A 2ZZ2A 3QRHA 1LBLA 4AHOA 2RDUA 1OFPA 1WDWA 4UTTC 4UCGA 1GWJA 3LB0A 3CIXA 3EWXA 3W1PA 4OV4A 2RDWA 1LBMA 4NNAA 2DZXA 2TMDA 4DBDA 3WJZA 3G0SA 3WJSA 3MI3A 1VHNA 1K8YA 4JEQA 3DFPA 4Z08A 3EKLA 4HN4A 2WSQA 3DKLA 3W1AA 1IXNA 3LX9A 1ZY9A 1W5MA 3HQ1A 5D04C 1OYAA 4N4PA 1O4UA 4XBKA 3TSMA 4MYXA 3L21A 1KM1A 3U6WA 3IV3A 4R53A 3RK8A 1IXOA 1W31A 2ZZ6A 1Z44A 5AYZA 3LRLA 5KTLA 3W85A 2C3ZA 1Q6RA 4TR9A 4X22A 1VJIA 1G6CA 3T40A 4IUOA 5I3GA 2FTPA 4RZ5A 5DCBA 3W71A 4PL2A 4XBSA 3ZWSA 1O5KA 5EY5A 3HO8A 4AWTA 1PE1A 2E77A 1ME7A 1W8SA 2J88A 3S42A 1TTIA 1WAUA 5IBXA 1EB3A 1M7PA 1H7OA 3F1QA 3CHVA 1K7FA 1ADOA 1ZALA 2CLMA 3JS3A 5G2IA 1AW2A 4HPJA 3HIJA 4JTGA 1JJKA 2WV8A 3ABQA 3T78A 3LM7A 3G24A 4KFOA 1TYGA 1JRCA 1OF8A 5J5DA 3IVSA 1MZHA 4NJGA 4BI6A 1QMLA 1AK5A 5HUOA 3MUXA 3FYOA 2ZBTA 2J9ZA 3W87A 3HMJG 4JTKA 4QJ1A 4BK9A 2Z0IA 3R89A 1WA3A 4HKPA 4K39A 4QQ3A 5EPDA 3FA5A 3QMRA 4IMGA 3O1NA 1JQXA 5LHFA 1R47A 3DI1A 1U5JA 2VFEA 5CZ0A 3A21A 1FQ0A 3CEUA 3G1YA 2QAFA 2Y85A 3T55A 5FF3A 1RR2A 2NWSA 3F03K 1T99A 1H60A 4WOQA 3TJLA 4EVZA 1JQVA 2R14A 4IPIA 4WY0A 4LS0A 2WPBA 1VCVA 3LI0A 3GXTA 3P60A 3PY2A 1TRDA 1H7XA 1KFCA 3UNDA 1ZENA 3NDOA 5LHEA 5F2MA 3E0IA 4UNLA 1NVMA 4N6FA 1OF6A 3P8IA 5D32A 3G1HA 3DXIA 3UQNA 4N6EA 3STGA 3QEZA 1JUKA 5I3KA 4WJEA 5CZJA 1X1ZA 4RZ4A 3FEMA 3FJLA 1FY6A 4RK8A 3M7WA 3QFEA 2ISWA 1JUEA 3NM3A 5AFDA 4FIQA 4WY0B 3GZ3A 1J5TA 3NG3A 4IX2A 1K02A 4AF0B 3W7KA 1OABA 1FCVA 4DO5A 4GC4A 3N34A 5K7JA 2C14A 1PVNA 3W72A 3MJYA 5AHFA 3GAYA 5LSMA 2BX7A 5EL1A 1FDYA 1QAPA 2WQPA 5FEXA 3UXAA 3GDRA 2QDHA 1TCDA 1WX0A 2BTMA 3GR8A 3T4CA 1XM3A 1RZMA 3EWBX 3S1UA 3W2UA 3OIXA 4DEFA 1ZAIA 2TRSA 1RPXA 3ZS4A 3VE7A 3E12A 3EEGA 2PRHA 3HPSA 3SGUA 1SPQA 5D2TA 1KM2A 2JBMA 4DF0A 3W88A 2W6RA 3G1VA 3KHJA 2EKCA 4MLRA 1O5XA 3N2XA 4AHQA 5U7SA 3V75A 4Z1CA 1YTEA 3IVTA 1GJPA 3TQKA 2O7QA 1Q45A 1M7OA 1LOSA 2Y7EA 1KTCA 2B7PA 2GJLA 3HPXA 3DHDA 4N9EA 1NSJA 1W56A 3W70A 1XUZA 1Z48A 3GDKA 4N2YA 3MI2A 4NZJA 3R5EA 3C2FA 3G3DA 1W3NA 4MVAA 3HG5A 4JTIA 1OG0A 2NWRA 3FLUA 5E0KA 4AVFA 5DELA 2FFCA 1VLIA 3GXNA 4YL2A 3DHFA 4IWWA 5FEWA 5D05A 1V7YA 4FF7A 3L2IA 3CM4A 3W73A 4NJHA 2GJNA 3B05A 3QQ1A 1B3OA 2C1HA 3G0UA 2G5WA 3K30A 4HT3A 2GVGA 2ZA3A 3UWYA 2V81A 2Z6IA 3AJXA 3MYPA 1KFEA 3A24A 4QNWA 5I3JA 1ME9A 3W07A 1W3TA 3PM6A 2A0NA 1VC4A 1XL9A 1GEQA 1JR1A 4PH6A 3BGGA 1SU5A 2R8WA 4GUJA 1DV7A 1XBVA 3G1SA 3LHZA 4UFKA 4O28A 2RDTA 5HWMA 5D33A 5HR7A 1SW3A 5C6MA 3BLFA 3RLVA 4LU0A 1LROA 3DENA 1IF2A 4R34A 3W75A 3UXDA 5C5YA 2V9DA 2D73A 4QM1A 1JCYA 2ABBA 3NPUA 3C2VA 3LRMA 4Q33A 3W7PA 5GVJA 3USBA 3TK7A 4KWWA 3C2EA 5SWUA 3MI6A 5EMUA 4LVAA 1GVSA 2GVLA 3N3MA 3LHYA 3TIMA 2ZRUA 4LNYA 2NXGA 1SFLA 1EEPA 4CNPA 3BW4A 3HGOA 3E96A 2YGYA 1EWEA 3CWNA 2JGYA 1SR9A 2E6YA 1TV8A 1KLZA 2CU0A 2NZLA 5LZLA 3EWYA 1KLYA 1NAL1 4TU1A 1LOLA 2CW6A 1TPVA 4MZ1A 4NXKA 4O17A 5LNRA 4N9BA 4KKXA 3TCEA 1T8XA 3L0KA 5F1VA 5KSWA 4OT7A 3Q94A 1MO0A 3Q2DA 1YLVA 5I3HA 3TC7A 1TO3A 2CLLA 3EX1A 3W7HA 3O6CA 4O53A 2H6RA 3DKJA 4A3UA 3PUEA 1UBSA 4H3DA 4WD0A 3RF9A 3S5NA 3HJZA 4IMCA 1YXYA 2A2IA 3P82A 4IX0A 2AAMA 3EX6A 1OX4B 1XDMA 2OX1A 4O1BA 1P4CA 4S2CA 3CT7A 1ZNNA 3TFXA 3P74A 4AEOA 4JTEA 4O52A 1V5XA 2F84A 1GVQA 1C9DA 4TMCA 4Y90A 5AC7A 5AHLA 2QJHA 1WOAA 1VR6A 3W2NA 5MHBA 4IOTA 4ZMGA 1KTBA 1DKWA 2ZRVA 3TW7A 4TX9A 3MHGA 4NUWA 4DF2A 5EA9A 5AYYA 5KZDA 4ZQRA 1H7WA 4GUGA 5CG7A 3R8RA 3EWUA 5G4EA 2V30A 4PA8A 3PG9A 3BG5A 1DBTA 4JD4A 4LVDA 2DZWA 5FF2A 1OFBA 5HWNA 4OE7A 4FX7A 3HB9A 3PSVA 3FOKA 3EWZA 3PSWA 3QMSA 5IBXC 2CZDA 1UB3A 2V5LA 4YCOA 3C61A 2FB3A 1Q6OA 1YXCA 3D0CA 1XKYA 3C8FA 3BLEA 3PB2A 1Q6LA 4U4MA 4K37A 3C6CA 2ISSA 1OYCA 2E1DA 3R13A 4UR8A 1W5QA 1ALDA 3PVFA 4K8HA 4Q32A 3QSTA 3MWAA 2W79A 2CWNA 2GUUA 1GYNA 2ZZ3A 4OWGA 5CPNA 1A5BA 3KXQA 4X2RA 1VGAA 2YFOA 4A2RA 2ZDRA 1B57A 1XUUA 3WK0A 1JCJA 4CNOA 3EXRA 2KZHA 4UTWA 4LUIA 2I14A 4D2JA 2A85A 4UTLA 5KZEA 1ZFJA 1LZOA 4LRSA 3ZFHA 5LNSA 3EX4A 2A4AA 2CLFA 2EHHA 2YR1A 2J9YA 4MFEA 3QH2A 1LOQA 2F7FA 4UTJA 1H61A 5HWJA 2AQWA 4BWLC 2R94A 1W37A 3CPRA 2BWGA 3G22A 1GTHA 3LCXA 3C4UA 4UTUA 1XBZA 4NXSA 1X7FA 2EAWA 1LDCA 3IIPA 4ZVJA 1FWRA 3IEBA 3NL3A 4WOZA 4ZQOA 2V0TA 4POCA 2VEPA 1IXPA 4JXCA 4E2DA 1OX6A 4GBUA 5G4WA 6TIMA 4UMBA 4N9DA 4EIVA 1EIXA 4NNBA 4L4MA 5HULA 1MEIA 2CZEA 1TPB1 2HTMA 5D2XA 2P10A 4O15A 3TMLA 4FXSA 3W7MA 3LERA 1PCKA 3PAJA 5DN1A 3LCFA 1WV2A 3QQ0A 4IXHA 3QPZA 2J27A 1SW7A 4N02A 4MY9A 3SFKA 1YPFA 4X9SA 3A5FA 4LW7A 2QAPA 3LLDA 2CLHA 1DVJA 4O1AA 1ZAHA 2JKEA 2YDAA 1XXXA 5BRBA 4RKAA 3HBLA 3DI0A 1O95A 5FEPA 3OA3A 4IMDA 1VYSX 3N19B 2IQTA 3W3OA 3FS2A 3W2KA 1OFDA 3STEA 2ABAA 1VYRA 5E1QA 4FHAA 3TSBA 1KM3A 4QNEA 2QCMA 2TPSA 3LXBA 1RV8A 1SSDA 2Y62A 3G0XA 4ALDA 2NLIA 3TKFA 3B0PA 4PCFA 2QF7A 2Y6ZA 5AOUA 3I7RA 5BNKA 1JUBA 3QPYA 2C13A 2VFFA 1WXJA 2ZZ4A 1NEYA 1TPUA 4A2SA 2E5BA 4MIMA 4S1FA 3HG3A 4O0ZA 1LYXA 4AXKA 3WK3A 3SIZA 1ZJIA 1H62A 3ATYA 4R33A 3S1VA 4IMFA 3LCWA 3EB2A 3IIZA 1JVNA 4LT9A 1VZWA 1YDOA 3FYPA 1DL3A 3ZR4A 3PUOA 1LBFA 3DAQA 4M7SA 1F7BA 2PE4A 4FB7A 4A29A 4LUJA 4XWUA 1M6JA 1GPWA 2A7RA 3LHWA 1TV7A 1AW1A 1TPWA 1SZGA 1EUNA 2LLEA 4FNTA 4FEZA 1LTDA 4ZQMA 5HQEA 5D30A 2YSWA 5G2HA 3WJWA 1BEUA 4I9AA 3PS7A 4RLIA 3EXTA 4ZZ9A 3OEXA 3A5VA 4PFMA 1KBIA 4PTNA 3MBFA 5HR6A 1EP1A 4CNNA 1WOBA 3N9RA 1QPRA 2QR6A 3VCRA 4JGDA 4KFPA 1A50A 2XN2A 2BZNA 1KM0A 3QW3A 2B4GA 7TIMA 1W1ZA 4PL1A 5EBUA 3C2RA 4AF0A 3W86A 3S5ZA 3IGSA 1GOXA 1L6YA 2C16A 3VKJA 1LRQA 1TPDA 1U83A 3LXAA 1VH7A 5AHMA 2AGKA 1SZNA 1A5CA 5E93A 2E09A 1HG3A 3P84A 1PHQA 1SQ7A 3GB6A 2DORA 4HNUA 3GVGA 3BO9A 2G95A 2HS6A 5U4NA 5L6UA 1R46A 4Q4KA 2Y88A 3QJAA 1F74A 4AAJA 4DPPA 5D09A 2H8ZA 4RR4A 5EYWA 3BV4A 1PS9A 4M6VA 3TAOA 3L67A 2V82A 1OHLA 2Q3OA 3L0GA 4GNJA 1KM5A 3STCA 4WX2A 3T7VA 5LNWA 4O16A 1GG1A 3M5ZA 2VFIA 5DY3A 4O10A 1HO4A 3EXSA 3UWZA 3RMJA 4MKNA 1PV8A 1S3HA 3IGUA 4FNPA 2GQAA 4NT0A 3ELFA 4UTTA 2A7PA 2Q8ZA 3LCGA 1JCNA 4G1KA 4I7VA 4J9JA 1LRNA 2ZCGA 3W76A 4BF9A 3SW6A 5EKYA 3NQGA 2Y7FA 1F76A 1QO5A 2QCGA 2HMCA 1R2SA 1EPXA 5BW6A 3GK0A 3NQMA 1QPQA 2DJLA 5F2IA 1OFQA 4YMZA 1ZHAA 5D38A 3UZJA 3NQ6A 4RCXA 2DU2A 3NL2A 3TUUA 2VFHA 4M6QA 2E5CA 2VOMA 3P80A 5K3VA 2EPHA 4CQ9A 1MXSA 2JGQA 4DBEA 5KZMA 1K7XA 1SO6A 2Y63A 3JRKA 3NEVA 4RJEA 1EP2A 2NXHA 1SZEA 1ME8A 3S5OA 2FPYA 3BW3A 4NVTA 4E2BA 2WSYA 2RKXA 3CB8A 3W1TA 1I2QA 3LHUA 1G4TA 3LBMA 1FCQA 1TPFA 4LVBA 5H91A 2H3DA 2DZTA 1VLWA 4LC8A 3KFTA 4O1DA 3W7CA 3TXZA 3G8RA 4RXFA 2YW4A 3L9CA 3MHFA 1NF0A 3B06A 2X2GA 3HGSA 2V2HA 1YDVA 3OVPA 1SO4A 1JCMP 1C29A 3W2LA 1T0OA 1D3HA 3N73A 3FIGA 3IVUA 3GLCA 3EX2A 2PRLA 2B7OA 3KRSA 3WJYA 3CIWA 3NQAA 5FI8A 3PB0A 3MYOA 4MJMA 3YPIA 4AHPA 4DPQA 3PBVA 4LRTA 5G1TA 3CC1A 4JYDA 2RH9A 3M47A 3WK1A 1W3IA 1D9EA 4HPXA 3IIVA 1AMKA 4AWSA 3NPWA 3QYQA 3KRZA 3S6DA 2ZZ1A 1B9BA 4O14A 1QPOA 3NQVA 2QCDB 4ZL1A 2YPIA 4I7UA 2QCCA 3W84A 3MO7A 3NL6A 1X1OA 2H3BA 4L4LA 4JTUA 1OFRA 3PC0A 3G3MA 2YZRA 1QOPA 1GVOA 3H55A 4UNKA 2ZYFA 4O18A 3W83A 2YYTA 1OVDA 1N8FA 1OX4A 3MP4A 5DLCA 3I6RA 3CEPA 3GDLA 2QJGA 4LOCA 2ZTJA 2YFNA 2VC6A 3TA6A 1L2UA 4CQ8A 2ZRXA 1LORA 4JTHA 4NU7A 3LCLA 1SW0A 3IGXA 4EOUA 1S5VA 1ICSA 3NR0A 2QJIA 1W5PA 3NZRA 4EF9A 1I2PA 5AHIA 1J4EA 5TIMA 3PULA 4K8EA 2J6XA 3G1XA 3HG4A 1O60A 3HG2A 3W9ZA 4Y9AA 3FFSA 4O4VA 3M1ZA 1RD5A 1A5SA 2W0UA 1PL9A 3TFCA 5DXYA 4JX5A 2OCZA 4NJIA 1BKSA 1OK4A 2QCNA 5BOOA 1QPNA 1CI1A 2ZRYA 4Y6GA 3P7YA 5I3IA 3UWVA 3V1PA 1YTDA 3G1AA 2B7NA 5FF4A 3STFA 2G96A 2JK2A 4X3ZA 3DU0A 1SO3A 3O07A 3ABSA 1YDNA 5CZSA 3L5AA 4YXGA 1H1YA 1PHWA 2X1UA 3TDFA 3WFAA 1O94A 1HL2A 3NQFA 3PUDA 2OT1A 3GDTA 1TMHA 4LWWA 4UMCA 2YX0A 1KBJA 1PIIA 1DJNA 4ORMA 4AB4A 3C3NA 3LOTA 2NV2A 3N9SA 5ABTA 2X1RA 3UY8A 3P62A 1EWDA 4GUIA 4YCPA 3Q37A 4HNTA 2C6QA 1DHPA 3W1QA 1A5AA 2VKZG 3W7RA 1JRBA 3CQ0A 1UCWA 1IIHA 3KVJA 5HMSA 3GNNA 1CW2A 1H1ZA 1XDLA 3NO5A 2V5BA 1KFJA 5AHNA 1N7KA 2A6NA 3BW2A 4P61A 2X30A 5C2XA 4IGHA 4U28A 1G4SA 2DP3A 3W7OA 4UFLA 1K7EA 5DBUA 5A5WA 1I8JA 2NX3A 2NX9A 1TB3A 4UUIA 3ZWTA 2B7QA 1TJRA 3F4WA 4NX0A 4AMAA 3RFAA 4NNCA 1QNVA 1HUVA 4Y8FA 3A22A 3TQ0A 4CCDA 1H7PA 4LTSA 1SFJA 4PEKA 4JIQA 4UFJA 2CZFA 3NVTA 5F4SA 3W1NA 5H2ZA 1H50A 2VEKA 4NQ1A 4KWVA 1L6WA 3TAKA 3E02A 3SR7A 4Z1BA 3B03A 4GUHA 1SUXA 4JTJA 5FESA 4OBTA 2G97A 4I7WA 3GIYA 3O16A 4JYEA 3BPWA 1Z42A 3UWWA 4B5NA 5AN7A 1G7VA 5F4XA 3KOFA 2XFWA 4WXYA 1M5WA 3M43A 2V2CA 3N14A 4FNSA 4GE8A 4MY1A 4O54A 3CU2A 3W1LA 3HOJA 3RLUA 2RHGA 4JYFA 4M5PA 4R7JA 1MSSA 3R2GA 1UUMA 3W1RA 4LV4A 3TW6A 3KVKA 3NQCA 4P2VA 3CTLA 3LTYA 4H6KA 4O8RA 3NXFA 1VPXA 1KFBA 3NQ7A 4LS1A 3G18A 5D02A 4K7YA 4JTFA 4ADSA 4ZQNA 5HJLA 3MHUA 3BG3A 3B8DA 3B0VC 3M44A 4UR7A 4DXVA 1TPEA 5AC8A 1OYBA 5DBTA 4LY8A 4IQLA 4LV9A 4C1KA 2CFFA 2P0OA 2GPTA 3G8EA 3LDVA 1TRIA 3DH7A 4IMEA 4YLWA 2Q3RA 4M6PA 3P5ZA 3GX9A 4O1CA 4O19A 1EA0A 4CQAA 4UMAA 1JULA 3S1XA 1LLZA 4ZQCA 2XN1A 1QDSA 2QCLA 4FNQA 2GOUA 3L68A 5D2VA 3HGJA 1IIGA 1VS1A 1B4EA 2QCEA 4E38A 4FX6M 1JCLA 3QSRA 3UD6A 1TSIA 3SGZA 3BLIA 4GJ1A 2R91A 3VNDA 1P0NA 1WQ5A 1K03A 1XC4A 3I7SA 2NUWA 1LP6A 1FDZA 1QFEA 1S5TA 2NUYA 3B0UX 1VYPX 1B4KA 3M5VA 4OV9A 2TSYA 3G1FA 2NV1A 2ZZ5A 5IM51 2YYUA 1GT8A 3TQVA 2CLIA 5BMXA 1FCUA 3C56A 4E0CA 5HNRA 3O06A 3NZ1A 1AW5A 2E6FA 3W2JA 3OBKA 5LNVA 1G4EA 4MJZA 5CZTA 4WQ6A 3LBCA 1QR7A 3U8GA 2HSAA 4MZ8A 5K9XA 1Z41A 3W7DA 2JKPA 4GFSA 1OFAA 1KFKA 1BWLA 3GAKA 3M6YA 3MP5A 3W7LA 3TV8A 1T96A 4JIPA 1QWGA 3TSDA 4WZHA 5G1YA 4FIRA 1SO5A 2ZA1A 5A8GA 2QUUA 4CCEA 4JS3A 4HIBA 3TMQA 1WYIA 3W1XA 3GKFA 3W7NA 5DY2A 2FQIA 1FXQA 3DGRA 3B04A 2B0MA 1OK6A 3GYEA 3OHIA 3SECA 1I2NA 3PBYA 3WJXA 3CLMA 1SZFA 3QC3A 3OVRA 3NAVA 3VE9A 3C2OA 3UPBA 4LVFA 4BR1A 4K7VA 4IPJA 3BARA 2WOQA 4QISA 2QUVA 4ZQPA 3NPVA 2CLEA 1XBYA 1AL7A 2WNZA 3LRKA 2VXNA 4JTTA 1KV8A 2VFDA 3W22A 3G1DA 2QUTA 4LVGA 4MZYA 3B4UA 4O12A 3MP3A 1EP3A 1I2OA 2O7SA 4BFAA 4UFIA 3LV5A 1FBAA 2FPVA 5AYXA 3QZEA 1FXPA 1F6PA 4JDBA 1UJPA 1MEWA 4UIOA 1VHCA 3LV6A 4LC6A 4UC5A 1XI3A 5F1UA 1ONRA 2Z1BA 3LLFA 4ADTA 3TU9A 3OG3A 5J5RA 3PWAA 4MLJA 1VCGA 3M5XA 2DJXA 2NXIA 4RZ6A 4TIMA 1AG1O 4PODA 4XUGA 3TC6A 3NOEA 4Z0JA 3N2MA 1I4NA 2EF9A 3L66A 1K8XA 1F73A 3NQEA 4JX4A 4RXGA 1N55A 3WK2A 3PBWA 1P0KA 3ANYA 1XFBA 4BWLA 2ZZ7A 6ALDA 1BTMA 5CGQA 1K8ZA 1VQTA 2NUXA 3SI9A 2EGZA 1TPH1 4IJBA 1H7RA 2VEIA 5DCDA 4UTMA 4O57A 1DOSA 3TX9A 4M7TA 1LLWA 3BVJA 5KMYA 3BGJA 3SY5A 3P5YA 2WO5A 1GG0A 3TH6A 1DORA 4BI7A 3R12A 1ZCOA 4FX8A 2Y7GA 3W1UA 4JX6A 3LCIA 5TBOA 3P61A 4CLMA 3KVMA 1DQXA 4JY9A 1K3UA 2WKJA 3MMTA 5K9DA 2FLIA 1I2RA 3EX3A 4S2BA 3DFSA 3UWQA 1OFEA 5LNUA 3RU6A 3M41A 3THAA 3M5YA 3VI2A 3E9AA 3ABRA 8TIMA 3TJXA 3KAOA 1P1XA 2ZFAA 1TPC1 5CPOA 3U2OA 2ZRWA 1FDJA 3TE9A 2PCQA 5D2WA 3KRUA 2E6AA 3NNTA 3SJ3A 4JN6A 1D3GA 4UTIA 2QCHA 4K6AA 4EF8A 1EX5A 5G2WA 3SSJA 3S1WA 1YXDA 4XTIA 5CPMA 1TTJA 1Y0EA 5AHEA 3KVLA 4ICNA 4HHPA 3W7EA 2ALDA 2YXGA 4ML9A 4NZFA 4HNVA 1W5NA 3BK0A 3W6YA 3ATZA 3MW7A 5C54A 5CSRA 3W74A 3LI1A 2Y70A 1R30A 4JICA 3HGRA 5D03A 1E51A 5DXXA 3PG8A 2ZRZA 1W5OA 1A53A 1KM4A 3LGEA 4A22A 2BLEA 1LCOA 2CZ5A 2UV8G 2FDSA 3THQA 3VFLA 4ORIA 2ATSA 4Y96A 2FB2A 3UY7A 2QCDA 2QDGA 4ONVA 3H54A 3PBUA 3W1MA 4UFMA 3NL5A 1SSGA 1W0MA 3OVQA 4DO4A 3UZ5A 3GKAA 5F4WA 4CCCA 1F2JA 3P8JA 5C55A 5F2GA 4OU1A 1TTQA 4QIUA 3AO0A 2RFGA 3IRDA 4H4IA 4GXMA 2WSRA 2WNQA 1ZAJA 2ISVA 1F5ZA 2E68A 5D2YA 1FWTA 1GYLA 1QO2A 2H8XA 4WXZA 3S0CA 1YTKA 1QCWA 2TYSA 4MFDA 4XTDA 4UTWC 2J9XA 4O4WA 4FXRA 3I68A 1J2WA 2Z2UA 2X1TA 5DCEA 5BMWA 3CWOX 2Y89A 5K9CA 3S8HA 4UXDA 3S9YA 5LGXA 2ZQ0A 5AB3A 3NQ8A 1KV5A 1LM1A 2PURA 3NA8A 2A21A 3L65A 4O0KA 3NQ2A 4OGZA 2WJZA 2QCFA 4GWEA 4N9CA 4Z1DA 4AH7A 4K38A 2A7NA 3P67A 1GTEA 2OMAA 2DZUA 3HPZA 1Q6QA 3M9YA 1X6UA 5K2ZA 2CLOA 1UASA 3A23A 3QW4B 2ZTKA 1ML1A 3NYZA 1RVGA 4YWIA 1RQEA 3O8AA 2V2DA 2VFGA 1NFBA 3FKRA 3W7GA 3FKKA 1G67A 2HS8A 3HF3A 4JNMA 1ICPA 1WBJA 2Q8LA 2ZA2A 1BWKA 4RV8A 1HTIA 3GNDA 1FUYA 1MEHA 3EWWA 3I65A 1X8FA 2GQ8A 3LTPA 3BG9A 3DFNA 1KW1A 4UFHA 1FCBA 3O6DA 3S5YA 3W7QA 1OX5A 4Z0SA 4JR5A 1HO1A 2VENA 1KA9F 3TR2A 3UPWA 2YW3A 2E5DA 1TQXA 5FF0A 3O05A 2E6DA 2C15A 2ATMA 3GR7A 3DFQA 1TV5A 4TO8A 3P81A 5CSSA 1R2RA 1XBXA 3TNOA 2XN0A 4DELA 4JY8A 3I7QA 1F6KA 3GXPA 4XZ9A 3Q58A 1KFLA 1RQBA 4OHQA 5T26A 4HSNA 1TTPA 1CX9A 1W54A 4LS2A 4AWUA 2YCEA 2I9EA 2JKAA 3L0NA 2C18A 3LXCA 4MY8A 3W7JA 5L9FA 1FWSA 3INPA 4O11A 2Z6JA 4A21A 4IXXA 1AL8A 5FF7A 3ABOA 4K36A 1GZGA 3W2MA 3QMTA 3KX6A 2BSLA 3L5LA 5LKYA 1THFD 4NX5A 2WNNA 1OJXA 4UTKA 1R2TA 2V8ZA 1KM6A 1FWNA 4NJKA 1C8VA 3PR2A 2FIQA 2X16A 3W23A 1S5WA 3UWUA 4Z1AA 3QF0A 5KINA 3C52A 3JR2A 2CLKA 1G7UA 1H7NA 1G69A 2OJPA 1TIMA 3DZ1A 3LHVA 4MYAA 1L6SA 1VCFA 4FNUA 1YPIA 1GVRA 5FEZA 4GRSA 1ICQA 3PF3A 3LCHA 5LGZA 4RX0A 3H53A 5CPLA 1TREA 2I1OA 1LRTA 3IIOA 4MOZA 2BXVA 4MUZA 3UYCA 2Y7DA 4JTSA 5HINA 1OFOA 1P5BA 4QAIA 5TQLA 4HSOA 3A9IA 2J24A 2PRMA 3DBPA 4EWND 2FJKA 3SZ8A 3O63A 3IIXA 4FO4A 5CKSA 2P1FA 3O15A 1DJQA 1IGSA 1H63A 4OQVA 3L5MA 1PCWA 1TJPA 1FWWA 3DFTA 5K4ZA 5AC6A 1I45A 1L9WA 3LHTA 4W9TA 2OZ0A 3NPXA 2QEZA 4O13A 1G4PA 4XQ6A 3F4NA 4NJJA 5HUPA 1NF7A 3MBDA 3LTSA 5F2LA 4JDYA 4DF1A 2X1SA 5G5IA 2QKFA 1XCFA 4BI5A 4TMBA 1EUAA 2GVJA 1GVFA 3NGJA 1GQNA 2GQ9A 4HNNA 1RQHA 2VELA 2OT0A 1YADA 4C1LA 4XKYA 3EKZA 5KITA 4QITA 1VRDA 2A5HA 4WUIA 5K4XA 3RNDA 3TROA 5I3FA 2VEMA 2A1YA 5D37A 1KTNA 3GDMA 3QM3A 4UTHA 3M16A 4DQWA 2PC4A 4JTLA 4MPQA 3DFOA 4N4QA 3NM1A 3M0ZA 2DZPA 3W7IA 2C19A 1JCXA 1YYAA 3TXVA 3O6YX 1Q3NA 2Y61A 4GUFA
chains in the Genus database with same CATH superfamily
2DZSA 2DZVA 3RPMA 3M4HA 4MUPA 1S1RA 4ADUA 5C2GA 4M19A 1D8WA 1H41A 1OY0A 1QOQA 1E1FA 4XSLA 1DQWA 1XIBA 2W66A 3DX5A 1LQAA 1MQQA 3T9PA 4XSMA 2VR4A 3I4KA 4A8RA 1UH4A 5GNYA 4UTTC 1N8IA 5HDRA 4E6MA 3CIXA 3EWXA 3W1PA 4PUWA 2RDWA 1LBMA 1MI3A 1XFCA 2TMDA 3WJZA 3HTWA 3G0SA 1EQPA 3WJSA 1VHNA 2XWDA 3ERPA 2VZVA 4PMVA 2GWNA 4EXQA 2AMXA 4HN4A 2B31A 3QLDA 2D2JA 2FTWA 5D04C 4XISA 4DYJA 4XBKA 4MYXA 1F4AA 2XZ9A 3IV3A 4R53A 2DT2A 4GO9A 3OZPA 1DJXA 3NSXA 4TR9A 3KZSA 1VJIA 4IUOA 5DCBA 3DEQA 3AUJA 4YIWA 2G37A 3M07A 1O5KA 2WCAA 1AH0A 3PTDA 1DE5A 1TVPA 2YCIX 5EY5A 2PWHA 2EPLX 2E77A 3QTGA 5EMLA 3LA4A 3VC6A 3S42A 1V08A 3WLLA 4R7OA 4H01A 1JAKA 1RH9A 1O68A 3JS3A 2CLMA 3BMWA 5HMDA 2PWGA 5A95A 4ZXLA 4R9OA 2XTKA 4J28A 1ZGDA 2WV8A 1MW1A 2Z7KA 1JRCA 3L2MA 5J5DA 4ZTYA 2DY3A 4AY1A 4NJGA 4J3ZA 1LF1A 4F79A 2PFHA 3CPGA 4H6QA 1IEXA 4XZMX 4KGLA 1B5TA 5HUOA 3VVGA 4DWSC 4L6OA 2Z0IA 1JZ5A 1WA3A 4NRRA 4JKMA 2BXZA 4LBSA 1V3MA 1IT8A 4X2PA 3RJXA 2OWXA 3A21A 4DLMA 2FH8A 2Y85A 5FF3A 1S2VA 1H60A 3BUVA 1XIEA 1XPGA 2XIOA 2PTXA 2ZUWA 2CWXA 4IIHA 2WPBA 4AZ6A 3CAQA 1XIGA 1KFCA 5DMMA 4D6FA 3NDOA 3A13A 3E0IA 1KRMA 3CHEA 3GVQA 4N6FA 4PMJA 2BVYA 3P8IA 4JCLA 3FY1A 2HISA 2BHUA 2CESA 2WYSA 3DXIA 3FN9A 1PX3A 4RZ4A 3FJLA 5A6KA 1XD0A 3K1GA 4KRZA 4FIQA 5ABFA 4CQCA 3NG3A 1CECA 4IX2A 3M7SA 1K02A 4AF0B 1UBPC 4WK9A 3N34A 4D9PA 4F66A 5K7JA 3WELA 3GVWA 3GAYA 4R85A 3EWCA 3BCJA 2C7FA 4IIFA 3RCMA 4DUWA 3M0MA 1RZMA 1UKOA 3WF4A 1PX8A 3KBJA 1EBGA 4G5DA 3OIHA 3W2UA 4PUKA 4LALA 4S3BA 2YL8A 4ZOCA 3FJ4A 3E12A 3HPSA 3SGUA 1X38A 1KM2A 2JBMA 2W6RA 4HA1A 3KHJA 4BEQA 4R9XA 1Q65A 1O5XA 3WLIA 4GQBA 4Z1CA 1YPXA 1PXGA 1W1IE 3IS4A 3IVTA 1GJPA 1MDLA 3KL3A 1J8VA 4S3GA 2Y7EA 1KNWA 3F7JA 1D7FA 1Z48A 3GDKA 4N2YA 4IL2A 3MI2A 3C2FA 1W3NA 1H3GA 1W8GA 3GSMA 1OG0A 1V3LA 3FLUA 1BGGA 1PZ0A 4AVFA 1E40A 1CXKA 1GOKA 3RHGA 3AIVA 3L2IA 3CM4A 2GJNA 1MXDA 3K30A 4P5UA 3SUSA 2GVGA 1YX1A 3QV9A 3UWYA 5CG0A 4X9YA 1E5JA 3WLNA 4DJFC 4DNMA 3W07A 1ITXA 4M8UA 1XCWA 1W3TA 3PM6A 3JVAA 3RM4A 2X2YA 1JR1A 4PH6A 3NVDA 3OB8A 3V0SA 1GKRA 2XVLA 1DV7A 1NDWA 1XBVA 3LHZA 4XIAA 1UR4A 3OQ8A 3PZ9A 3WD3A 5HR7A 1XLCA 5C6MA 4LU0A 3STPA 4R34A 1XJBA 4QM1A 1RJQA 3C2VA 1SFSA 3W4RA 3LRMA 3S2LA 1DWJM 1SYTA 1F3XA 1UD5A 4KWWA 3PZQA 3C2EA 5SWUA 1J0YA 3N3MA 2BP1A 3RPDA 3LHYA 3TIMA 2BMBA 3K8MA 4JL2A 1HKMA 4CNPA 3BW4A 3FNDA 1U1UA 1P0EA 1SR9A 2E6YA 1TV8A 2CU0A 2NZLA 1Q4WA 5CC6A 2WMJA 2CW6A 4MZ1A 1BRLA 3P0XA 4O17A 1KQYA 5LNRA 2Z1SA 3AIQA 1T8XA 5KSWA 4MPKA 1JDFA 1YLVA 2VR5A 3U3HA 4GIRA 3W7HA 2H6RA 4MM1A 9CGTA 3GM8A 4A3UA 2PLJA 3PUEA 1UBSA 2NSXA 2C91A 2OX1A 4O1BA 4EAMA 4O52A 2F84A 1XSJA 1GVQA 3KLLA 2IKGA 4PUNA 1WOAA 4US5A 3T2QA 4I8YA 3MZNA 3W2NA 4ZMGA 1XLIA 5IXEA 4O8AA 3THCA 3MMWA 1UP0A 4KWOA 3TW7A 3MHGA 1S1PA 2HRWA 4ZQRA 4GUGA 5CG7A 3R8RA 4F0SA 3EWUA 3R4IA 1E71M 1FHUA 1PDZA 4IIBA 3PG9A 3BG5A 5ENLA 4ZCWA 1BVZA 2WK2A 2W63A 3RX4A 4FX7A 3UERA 2E1WA 3EWZA 1UB3A 2V63A 3BSGA 1REQB 4NZ4A 2GUYA 3CT2A 3C8FA 4KH2A 2CITA 3PB2A 1Q6LA 4I9TA 4K37A 4U4MA 3C6CA 4DRSA 2ISSA 1OYCA 4MWAD 1W5QA 2FZNA 4K8HA 4JQ2A 3QSTA 4XD6A 1E0VA 8RUCA 8CGTA 5CPNA 2Z1WA 1E6XM 3OGSA 2WMGA 4M82A 1R3VA 2HK0A 3IPWA 2YFOA 3AHXA 1XUUA 3WK0A 1ONWA 2DT1A 1JCJA 1J9YA 1JXKA 4LUIA 5CC3A 1HGWA 3CAWA 4Q8OA 5LNSA 3EX4A 3SY1A 3EBVA 2J9YA 2WLZA 4MFEA 2OQHA 3AAMA 1W1PA 1Z32X 4IM4A 4Q3MA 4RW5A 2VVSA 1TCMA 3CPRA 1TMQA 2W67A 4GJIA 4Y2WA 1GQKA 3NL3A 4WOZA 4ZQOA 4POCA 2XH4A 1IXPA 4DIAA 3C86A 3AZTA 3CUFA 2X0YA 1F8MA 4N9DA 1QW8A 1KXTA 5HULA 2CZEA 1TPB1 2AQOA 4FXSA 1PCKA 5DN1A 4WRHA 3ES8A 3K4DA 2CHRA 5ABEA 2D24A 4H2HA 5GJNA 2PDLA 3PUGA 3SSZA 1BVNP 1XDJA 1WDDA 2J27A 4MY9A 4W8LA 1X6NA 3BC9A 3AIEA 4IQJA 3LLDA 4U2YA 1XXXA 3I6EA 3K46A 1T7LA 4LB3A 5FEPA 1XIFA 3OA3A 4LY4A 4BQ2A 1C92A 2ABAA 1FTXA 5E1QA 3VNKA 2A3EA 3GTFA 4UBPC 3TSBA 1K8CA 1KM3A 4WDUA 3N2TA 5MF5A 2TPSA 5FL1A 3NCOA 3LXBA 2XPKA 5BXPA 2NLIA 2DH3A 2JIEA 3U48A 3WBWA 3B0PA 4W5UA 4PCFA 1I75A 4AISA 3H4XA 2J47A 3QPYA 2ZZ4A 2RJGA 2PDWA 4UZSA 2CKRA 1UR8A 4QG8A 2Z00A 3SIZA 1H62A 2PLKA 3LCWA 3PJTA 1GORA 2FGBA 3IIZA 4LT9A 1J0ZA 1VZWA 1A5MC 4PGLA 1RA0A 2C1IA 2PE4A 4H8HA 4RDVA 4FB7A 4XWUA 1M6JA 3KTCA 1BYCA 1JXJA 1JPDX 4JTQA 3WD4A 2LLEA 4FNTA 4I9AA 1ESWA 5CLWA 1ZJBA 3WD2A 3MBFA 2E8YA 1QPRA 4GG9A 1VBJA 3WO8A 1A50A 2XN2A 4RNHA 2QMKA 3QW3A 4CD6A 2Z1VA 1W1ZA 4PL1A 2DIEA 5EBUA 4AF0A 2Z29A 5JUVA 4QAWA 5A8PA 4DWDA 1FH9A 1ZBWA 3SURA 3KWXA 3VKJA 5A6SA 3VGDA 1LRQA 1FFRA 1U83A 2OZ3A 1R3TA 1VFSA 3WQ4A 3KW3A 4W87A 1VH7A 1A5CA 3EDFA 4AC7C 1NOWA 2E09A 4HNUA 3BO9A 3UU0A 2HS6A 5L6UA 4HOZA 3PZMA 1XRVA 3F4DA 2XH0A 1Q6FA 2ZVIA 4I3GA 1QHZA 4PCNA 3ZT5A 2EXOA 3TTYA 3STCA 1G0CA 3C3UA 4MWAB 5DY3A 4O10A 3EXSA 1S3HA 3KBVA 4FNPA 4HZ6A 3ZR5A 2EQDA 4GIYA 3OZMA 1RVKA 3KZPA 3EPNA 3LSCA 4J9JA 1LRNA 2ZCGA 4YJ5A 2V3GA 4BF9A 2IKJA 3SW6A 4H9YA 3URAA 3DG3A 1QO5A 1E43A 2DH2A 2VRJA 4GY7A 4LAZA 4JTRA 2JF6A 5F2IA 1EO7A 4W84A 4RCXA 2NQZA 5C9RA 2YA0A 2EPHA 1I0BA 3VDHA 2VO5A 3VOCA 3SUTA 5KZMA 1K7XA 3FDGA 2Y63A 3KP0A 4GI6A 3FGCA 5GJMA 1SZEA 2FPYA 2O0TA 4NVTA 4E2BA 3MKKA 1I2QA 1UIPA 5CXPA 1JIBA 4LVBA 1CGYA 1V6WA 3FCPA 4O1DA 4LC8A 3CASA 4G1NA 3TXZA 2WVTA 4RXFA 3WNLA 3DYMA 3B06A 2X2GA 3BMVA 3AXXA 4WDXA 1YDVA 3WQ8A 5D9NA 3PNZA 1TWWA 1T0OA 3PPHA 4CU6A 1PWMA 1OM0A 3EKGA 3E3HA 4IP7A 3VGBA 3NQAA 5FI8A 4AHPA 3LM3A 4TXEA 4F9JA 4JCMA 3M47A 1K70A 1NWTA 1W3IA 3NDZA 4HPXA 5I3DA 3KRZA 3ZT6A 1B3XA 2PP0A 1M65A 2YPIA 3W84A 4CVWA 4HHMA 1EJSC 3AFBA 3PC0A 5BZAA 3U2EA 4LGXA 1GVOA 4O18A 2WHJA 1N8FA 3ARRA 4YS1A 2XGZA 3I6RA 4NI3A 2G0WA 1MUCA 2VX4A 4NU7A 4RDYA 4C7FA 2YXXA 3HG4A 3G1XA 2QW5A 1UOZA 4DZIA 4Y9AA 1P43A 3GH4A 5C2CA 3TFCA 3MANA 5AYIA 5FD0A 1QPNA 1CI1A 4H83A 4MB1A 1A5KC 1PO9A 2B7NA 3CNYA 3DU0A 5PTDA 4AD2A 3TDFA 2GYIA 1O94A 3WDRA 4LWWA 1ZCCA 4UMCA 1ZL1A 2C79A 4MNJA 2VQUA 3C3NA 3KBMA 5ABTA 3UY8A 1DHPA 2VKZG 3MV01 1REQA 3W7RA 4EACA 3GW0A 3QGAC 2EPKX 3CQ0A 1UMLA 1GQIA 1QT1A 5HMSA 1JYWA 1XDLA 3NO5A 4S3EA 3BW2A 2VX6A 4IGHA 4U28A 2GK1B 4QE5A 1JAEA 3BJTA 3WQEA 5A5WA 3CQIA 3SCPA 1Q13A 1XHGA 2NX3A 3GH7A 2QJMA 2W61A 2NX9A 3ZWTA 4H41A 2B7QA 4NX0A 4NAEA 3RFAA 3V36A 4G7FA 3CJPA 1QNVA 2F6XA 1E3ZA 4E2VA 4PEKA 5F4SA 3VD4A 4RE3A 1H50A 1F3EA 2VEKA 4F0HA 3R94A 2PD5A 1L6WA 3TAKA 4Z1BA 1TVNA 4JTJA 1SUXA 4ZODA 1FH7A 1ENUA 1HT6A 4HNOA 4I7WA 5HANA 3R10A 2ALRA 3BPWA 4B5NA 1QNSA 3GIPA 4JHMA 4A8LA 4ATLA 4WXYA 4KRUA 1VIWA 4ZFMA 2FZ9A 4FNSA 4WSHA 2VHLA 4GE8A 4ACYA 3W1LA 3HOJA 1W1A1 1Z89A 3S2MA 2EO7A 3DG7A 4JYFA 3NGFA 3H2CA 4M5PA 4R7JA 2HVOA 3TW6A 3FX4A 3MKVA 4O8RA 1RBLA 1Q85A 3L23A 4PMQA 1GYMA 3G18A 1V02A 1FA2A 2QF8A 4GYFA 4ZQNA 1SMAA 3VNMA 3WH8A 4GZJA 4DXVA 2WSKA 1N8WA 1UZ4A 5AC8A 4ROQA 1OYBA 4C1KA 4IQLA 2CFFA 2P0OA 5DQPA 1TRIA 4I5XA 1GQJA 2FZMA 4QFUA 3P5ZA 4O1CA 2OQYA 4FLOA 4O19A 1CXEA 4IP5A 3H21A 5EMMA 4ENLA 1FWEC 3L4WA 1WKFA 2ADAA 3RLHA 2R1PA 1SJCA 3W00A 2BNJA 5D2VA 1B4EA 3NYDA 4E38A 1G9HA 3UD6A 5AY7A 3VNDA 2NUWA 1WQ5A 4GGHA 5HQLA 4GO8A 1FDZA 3S6OA 3N4AA 3PTQA 2RGMA 1DXEA 1RUSA 4UR9A 1ZQ5A 2YYUA 3ONBA 3WBYA 3DFHA 2WMKA 5T9CE 1XD1A 1SJAA 3VINA 1FCUA 3AI0A 1XRTA 3WFZA 3WNMA 1OC7A 1E6PA 3RX2A 4BQ4A 3UG3A 2GL5A 1MNSA 2E6FA 5LNVA 4AD5A 2Q8XA 4WGXA 4E4FA 3U8GA 3H7UA 2DUZA 3WNPA 1EX1A 1RJPA 1OD8A 4GFSA 3VA8A 1R6WA 4AZCB 4C6CA 4GCAA 1WZKA 4IG2B 2WXDM 2CKSA 2P8BA 3M6YA 3MP5A 2VX7A 3W7LA 1T96A 1VBUA 5TD4A 1AUSL 3UWEA 1VBRA 5F7UA 1BYAA 2PDQA 2CETA 4CCEA 5D9OA 4JS3A 3GG7A 3SJNA 5DY2A 3TN4A 2B0MA 4RNFA 4Z2IA 1SZFA 3VE9A 3L4VA 3B40A 4JIRA 2OYMA 4BR1A 1GEHA 2AKZA 4H7VA 1E56A 1I1WA 1KR1A 1MW2A 2PBGA 2WNZA 2VFDA 3MVTA 4X63A 4LVGA 4Q6XA 3IARA 3M0JA 4AZHA 4O12A 4B2DD 1EP3A 2P8CA 4UFIA 3RLGA 4AIUA 1D3CA 1MEWA 4GI8A 4UC5A 5F1UA 1C91A 3VOHA 4MG4A 5J5RA 2IQDA 3K8LA 3WMSA 3O2LA 4MLJA 3PFMA 7ODCA 2J78A 5FA5A 1PIFA 2W9MA 4PODA 3RPTA 4XUGA 3F5KA 3ANVA 2EF9A 4F8XA 4W7UA 1S3TC 1QWKA 2YB4A 1IT7A 1EC9A 3PBWA 4MWAA 1XFBA 1VF8A 4BWLA 5CGQA 1Y8BA 2NUXA 2PDKA 2YL6A 1HKWA 4FK9A 1NH6A 4BEUA 2YA2A 4HA3A 1PYMA 3TX9A 1NTHA 5CAKA 1LLWA 4J35A 4GD0A 3F4CA 3OYZA 1DORA 1ZCOA 3OLGA 4NYYA 3FJNA 1QRQA 1Z8AA 2EJ1A 2V67A 3P61A 3CYVA 2HBXA 1CDGA 3TTQA 4JY9A 1S2UA 1K3UA 1YE4A 2WKJA 3MMTA 2FLIA 2D0FA 3EX3A 3UWQA 2HK1A 4KEMA 3GG0A 2EEXA 7PTDA 3M41A 5CJ5A 3THAA 4ES4A 3E9AA 8TIMA 3TJXA 1P1XA 2ZFAA 1UPPA 4QG9A 1V0KA 3KRUA 4GK8A 1XW8A 2I57A 3RO6A 2PSNA 3SCTA 1N82A 1C93A 3S1WA 5FOOA 4XTIA 1T40A 3KVLA 4E8GA 3SEPA 4OZOA 1M7JA 4PUMA 1ISVA 3W74A 1VFOA 1JDAA 4ASTA 1R30A 4IL0A 3HGRA 5DXXA 1W5OA 1KM4A 4A22A 5EFFA 2CZ5A 2UV8G 3PZNA 5FL0A 4ORIA 4QEEA 3AIBA 2OODA 5H1WA 1W1B1 2HBVA 1O5QA 1Q7ZA 3B0YA 1W0MA 4QHRA 3UZ5A 3GKAA 4CCCA 4Q8VA 1K9EA 5C55A 4TV5A 1BG4A 2RFGA 1QXLA 3WQPA 3B4YA 1RP9A 3WMLA 5LXXA 1ISXA 4E8DA 3OP2A 3IRSA 1A80A 1QO2A 5EU9A 3AZSA 2H8XA 3S0CA 2PWUA 3B9DA 3UCQA 3R8GA 2TYSA 4O4WA 2Z2UA 2X1TA 5BMWA 3CWOX 1V0MA 2BOGX 2MNRA 4V1YA 3VGFA 4UXDA 4AEEA 2I5QA 3LD5A 1OT1A 4LQ1A 1CYGA 4TTGA 2XM1A 3NA8A 2AL1A 3L65A 3LNPA 4NZ3A 3MJMA 2WJZA 2QCFA 4GWEA 3ECQA 4QJ3B 4LXFA 1F6YA 3ZJKA 1GOWA 5BOEA 3E2VA 3N4FA 3B8VA 3WD1A 1EZWA 3QR3A 3NYZA 1DQUA 4YWIA 3O8AA 1R9XA 2VFGA 3IWPA 2ZUNA 3FKRA 3W7GA 3FKKA 3MSGA 4JNMA 1ICPA 1BWKA 3UFYA 1FUYA 2FVLA 3LTPA 1XGDA 1QI0A 1C7TA 4UFHA 2HNEA 3O6DA 4HCHA 2J7BA 3FVMA 4LUTB 2X7WA 4JR5A 5CSUA 2CERA 3ARVA 3DIPA 3SCWA 4AEFA 3U0HA 2E6DA 3CMGA 3C0SA 2PGEA 2ATMA 4Q22A 4TO8A 1TV5A 2ONEA 3UG5A 2QHAA 3DESA 3VKCA 2XN0A 4D6IA 3I7QA 1F6KA 3GXPA 1HJUA 5DRIA 4XZ9A 1YNYA 3VKKA 1KFLA 5T26A 2NQJA 1WPCA 3LPGA 1CX9A 4XZIA 1W54A 4AWUA 1UA3A 2YCEA 1KO0A 4PB3A 4IIEA 4CCZA 2JKAA 2FTYA 2QIWA 1E70M 2VURA 1E9IA 3KTSA 3WUBA 5L9FA 1FWSA 3INPA 4XO7A 1K9FA 3TR9A 3ARTA 1AL8A 5FF7A 4KCVA 4W89A 1F61A 2YBTA 3JUGA 1OWQA 3KX6A 1XLKA 3LGGA 2WMIA 4AD0A 4XO6A 5LKYA 2VC5A 1R9YA 4D8ZA 3UETA 3AXMA 3OVGA 3WSUA 3LYEA 4LPCA 3KL5A 3W23A 5I03A 4IQEA 1JFXA 3I10A 1AA1B 4XX6A 2GWGA 3AS2A 4C6BA 2FZ8A 4KS0A 2F61A 1UH2A 1TMLA 2PTDA 3UP8A 1L6SA 4FNUA 1YPIA 5HQMA 2PODA 1SZRA 5LGZA 3H53A 3EA2A 4LJ3A 2YCJA 4D1JA 4JTSA 1C8QA 3C5QA 4QAIA 3MO4A 4HSOA 2PRMA 1H2JA 3DBPA 4F0MA 2CBVA 3AXIA 3SZ8A 1WKYA 3O63A 3EPMA 2O4QA 2WZEA 1GQLA 1UC4A 1IGSA 3POCA 1H63A 3QYSA 1EOKA 1SVDA 1FWWA 4GI4A 3N2CA 4EE9A 2VDIA 3TJIA 5HJYA 1F3WA 2QEZA 5AYBA 2ZC8A 5BRPA 1A5UA 2W5FA 4D6JA 1EJXC 3MBDA 4GVFA 5FJJA 4HHHA 1XCFA 3Q67A 4CQDA 3VIOA 5DMYA 2GZXA 1JF5A 3QBUA 1HIZA 4WKAA 3ZSSA 4MWAC 4C1LA 4HK6A 4XKYA 4J2PA 5HATA 1DWGM 5KITA 1FP8A 4U3AA 2VEMA 3QM3A 3GDMA 3PZIA 1EF3A 3DUGA 4UTHA 3M16A 4DQWA 1HJQA 5I07A 3KDOA 3DFOA 5EFDA 3NM1A 1PPIA 3M0ZA 4J2MA 3ARUA 4XUYA 1JL8A 1P0DA 2DIJA 3UZXA 2C0AA 1FX6A 3KL0A 4IG2A 5FJUA 3L7RA 1HFBA 4M80A 4KFNA 3SRKA 1WXYA 3WKZA 3AIWA 2H90A 2FPTA 3N04A 1ONXA 1TQJA 4DO6A 2ZZ2A 1LBLA 2OQLA 2RDUA 1JFHA 1LL4A 4UCGA 3N25A 2BFGA 3KOYA 1E0XA 4NNAA 4DBDA 3UR2A 4IHCA 2ZVRA 4Z08A 3EKLA 4ZR8A 3DKLA 1UZ1A 1IXNA 3FVDA 3LX9A 2ZX6A 2BASA 3XINA 2YJQA 4N4PA 1J0IA 2HVNA 3GFZA 3L21A 3T0AA 1W31A 4MB4A 4UOZA 1Z44A 5KTLA 3W85A 2C3ZA 4X22A 1JPMA 1A4MA 1UP2A 2FTPA 4KT2A 4RZ5A 3W71A 1A3HA 4C6QA 4XBSA 3ZWSA 5BU9A 4DBUA 1BF2A 4OJYA 3KEHA 3T4WA 3EOOA 4DAIA 1ME7A 1XLMA 1W1YA 2J88A 1JPKA 4I9JA 1EYEA 1ZALA 1TWZA 4TVDA 3HIJA 4JTGA 4NF7A 3WQGA 3RDKA 1WCGA 1S2WA 1MZHA 1VEOA 1U2YA 3REQA 3GNRA 1AK5A 3ZLGA 2J9ZA 3TYCA 4JTKA 3HMJG 1DWIM 2G3MA 3DHUA 1RY0A 3QV7A 4HKPA 5B7YA 4K39A 2IPWA 4QQ3A 4WSJA 2O9OA 1J18A 4KWUA 2DVUA 3QMRA 3ARSA 3KRBA 3T08A 4Z2KA 1R47A 2HVMA 3MTWA 3G1YA 3BAKA 3T55A 1S2AA 3ZJ7A 2BG5A 3F03K 1T99A 4WOQA 3TJLA 2Y5EA 2R14A 4XIMA 1UWQA 1EA9C 1VCVA 3P60A 4GHRA 2XM2A 5F2MA 3DDMA 4FALA 4ZSTA 1OF6A 3MSDA 3VUSA 5I78A 2OZTA 5HNUA 4RNJA 3AJ7A 3CH0A 2XYLA 4DLFA 4WJEA 1VPYA 1XYAA 4J5NA 1T5AA 2YCLB 2ISWA 3DECA 5AFDA 4WY0B 4MNKA 1BHGA 3W7KA 4GC4A 3WQFA 1Y7VA 3MJYA 5AHFA 5LSMA 2BX7A 1FDYA 1QAPA 2WQPA 2ZKMX 4JZ5A 5I09A 1GHSA 3UXAA 1KKOA 3GDRA 6REQB 4AQLA 3CL7A 1W1TA 3T4CA 4DO7A 3AALA 2BHZA 4OIFA 1EOMA 1W2PA 3PBGA 3S1UA 3MT1A 4DEFA 3VMPA 1BF6A 1W17A 4DF0A 5LIWX 2WWCA 5C9UA 1LUCA 1XIIA 3PN8A 5REQA 3E6EA 4DJFD 2A3LA 3V75A 3BL3A 1RCOB 4HCDA 1YTEA 1OC5A 3TQKA 5AC5A 3R0KA 1KTCA 4A05A 2INEA 1NSJA 1W56A 4Y9NA 3IJ6A 3VDBA 4NZJA 3R5EA 1U33A 4ECLA 2GSEA 4MVAA 2QDEA 4QLKA 3AHVA 2BXYA 3P0WA 5EBAA 3DHFA 5FEWA 3HQOA 4DYEA 5AZ1A 3B05A 1B3OA 3G0UA 2G5WA 3FSTA 4HT3A 1HF6A 4HTBA 5AZ0A 2V81A 2Z6IA 3AJXA 3T2OA 5A6BA 1KFEA 1VPQA 3A24A 3MV11 4QNWA 4CNSA 5I3JA 1ZBVA 2PDNA 3CGTA 4M51A 2ZE0A 3BGGA 3N6HA 2R8WA 4NRSA 2PC8A 5LIUX 4GUJA 3N9KA 1OIMA 2RDTA 5HWMA 2VZSA 3T07A 1FP9A 5D33A 1SW3A 4PMXA 3BLFA 4GYJA 3VMOA 1IF2A 3UXDA 2YLAA 3MUCA 1JCYA 3NPUA 4ZO7A 1ADDA 3USBA 4Q4QA 3S9IA 4PB4A 1FWFC 1AH4A 3MI6A 3PBMA 4LX4A 2OWWA 1GVSA 1V0NA 2GVLA 4AMCA 2XGIA 3KOXA 4LNYA 4DJED 4B2DA 3W27A 3HGOA 2YGYA 5A2CA 3CWNA 1KXHA 3EWYA 3MWCA 1NAL1 3T0CA 2EPMX 1LOLA 3TYDA 1TPVA 4NXKA 1ISWA 1UHVA 3L0KA 4QJ4B 2V5CA 4OT7A 2VMFA 1MO0A 4ATDA 3Q2DA 2FMNA 3OQEA 3TC7A 2BOEX 3NZGA 3O6CA 4O53A 2NQ9A 2YBUA 2PWVA 4U5KA 1CPUA 2A2IA 2XHYA 2AAMA 4W86A 2VT0A 4NP7A 4AEOA 4WCJA 3COTA 1C9DA 4TMCA 2QPXA 1YHTA 3RX3A 5AHLA 2VCBA 4Z2JA 3CTTA 1KBLA 4IOTA 1A5OC 3WUEA 4P7QA 4BCEA 1DKWA 3QY8A 4DF2A 5AYYA 5I06A 3LNMA 5KZDA 5A1AA 5I79A 3TTEA 5I77A 2BVWA 1Z7AA 3VX1A 5HPCA 5IHRA 1UWIA 4JD4A 4LVDA 1OFBA 3LY0A 4UTFA 3G1RA 3WMCA 2BODX 3PSVA 3HFYA 4GNVA 3PSWA 3QMSA 2J8TA 2V5LA 4PCTA 3MQTA 2O55A 4YCOA 5DMNA 3C61A 3CV1A 3N1AA 1RJRA 4UQBA 3AMKA 3VYLA 4LUSB 3FK4A 1ZZMA 3SCRA 3R13A 4UR8A 1ALDA 4Q32A 3PZOA 1JCTA 3VCNA 2W79A 2CWNA 1Q6EA 2GUUA 4JQAA 1CENA 3EYPA 1Q5MA 1W9DM 2VC7A 3QOMA 3LPOA 3KXQA 1QW7A 1KRAC 1JI1A 2ZDRA 2DW6A 1B57A 3WX7A 4HU4A 2XG9A 4AVOA 3UA4A 3EXRA 2KZHA 5D8ZA 2I14A 4D2JA 2I9UA 1W9VA 4D8AA 1M68A 3QN3A 1ZFJA 1LZOA 2XIQA 4LBUA 3V5OA 4HQVA 2A4AA 4IFKB 2EHHA 2YR1A 4D71A 2VUYA 1QUMA 1QI4A 1Q6GA 2R1LA 1CLXA 1IWPA 3QH2A 1LOQA 3N6QA 3AWNA 2PUZA 2F7FA 3CMFA 2AQWA 2R94A 4TVCA 1W37A 3LCXA 3WUGA 5ECUA 3U9IA 1CGTA 2Y8VA 1LDCA 4ZVJA 1FWRA 1MW3A 2VEPA 2J74A 3N13A 4JXCA 2E25A 2Y8KA 3IJIA 4MKVA 6TIMA 5DFAA 4FLSA 4EX4A 4NNBA 4L4MA 2HTMA 5I6SA 5D2XA 2VZOA 3U5UA 4O15A 1XH0A 3TMLA 3LERA 1XCXA 3PAJA 3B9AA 5MKGB 4BQ3A 1B3WA 3QPZA 3EZ4A 4JIIX 2ANUA 3SFKA 3A5FA 5JBDA 1TE6A 1F3TA 1TA3B 3F5LA 4X60A 4K68A 3C2YA 4O1AA 1ZAHA 2YDAA 2P0IA 3HBLA 3KE0A 4EK7A 4BZYA 4OOZA 1GNXA 5JVLA 4IMDA 3N19B 2FKPA 3FS2A 4UQ9A 2ZUSA 5FAGA 4PYSA 3RM9A 5HPOA 4QRNA 4QNEA 1GJWA 2QCMA 1SSDA 1UKPA 4ALDA 5DT5A 2PGWA 5FSDC 3PHAA 1OEPA 3TKFA 3TZFA 1C8YA 4IIDA 3VILA 5AOUA 2XSBA 3XIMA 3WMBA 1NJJA 2POZA 2QNEA 4HD5A 4LYQA 5IDZA 3ITOA 2VFFA 4YU1A 4B16A 1NEYA 3WBEA 1TPUA 1LQ2A 4D8LA 4MIMA 2Z28A 3KLKA 4O0ZA 2BV9A 1OC6A 4QX4A 4ERGA 1E4LA 3ATYA 1OGBA 3S1VA 4IMFA 1Z3NA 1DL3A 4AZBA 1HP5A 3SCNA 2A3CA 1ODZA 2VP8A 4MHBA 4ZGYA 2VDGA 3BOXA 2I17A 1IWBA 5HA7A 1AW1A 1EUNA 1U1JA 3WQ6A 1AZ2A 5G2HA 2YSWA 1P6CA 3PS7A 3VUPA 3A5VA 1I1XA 3F4VA 2AOSA 4R27A 5HR6A 1N2VA 1EJVC 3H2AA 1EP1A 3OODA 3SGGA 3N9RA 3GC4A 7TAAA 5H8PA 3VCRA 2NT0A 4JGDA 4QR6A 4QROA 2BZNA 2OU4A 4GX9A 2OSYA 1YIXA 2B4GA 1UYQA 3C2RA 1AODA 3S5ZA 3IGSA 2C16A 1US2A 4C6OA 1KWKA 1I0DA 1TPDA 4URIA 4NZCA 3EOEA 2F2HA 3UR5A 4KIEA 3SQSA 5E0CA 1Y5XA 4JNYA 4PBEA 2AGKA 1M41A 5E93A 4KQNA 3P84A 1PHQA 1SQ7A 4FXFA 2DORA 3GVGA 4J3UA 2G95A 3URNA 5LXEA 2Q09A 1K9DA 4M81A 3QJAA 2NVCA 3BAWA 4AAJA 4QLJA 5GJPA 1AD1A 2AMGA 4M56A 4M1BA 2V82A 3M0VA 2Q3OA 1VAHA 3FHAA 2PB1A 3CS2A 3L0GA 1DJHA 4GNJA 5BWFA 5LNWA 3M5ZA 4GIAA 4L1GA 3E0VA 4FPSA 5IFPA 2YXOA 3CO8A 1PV8A 2GQAA 2I5GA 1XRSA 3ELFA 3R6IA 1HNYA 2BDQA 4UTTA 2Q8ZA 4G1KA 2FH6A 1QI2A 3W76A 2NLYA 5EKYA 1ISYA 2Y7FA 1I60A 1XIMA 4KIRA 3SCSA 1QPQA 3VIJA 1CZ1A 4AW7A 3GU9A 4AIEA 4U5IA 1ZHAA 5TNVA 3UZJA 4DUVA 3TUUA 2VFHA 3P80A 3BQ5A 5K3VA 2F6KA 3U2ZA 2JGQA 4A3RA 1ADSA 1OZQA 3LUTA 3BGAA 5B80A 1EP2A 1YRRA 1EHAA 1BQGA 3J7HA 4CNTA 3CB8A 3W1TA 4GJJA 1JNDA 5G1MA 1HJXA 2H3DA 4JFVA 1VLWA 3VDAA 3L9CA 3QHOA 8A3HA 4Q8PA 3H2NA 1O6IA 2V2HA 3THUA 1JCMP 3W2LA 4JBRA 3FIGA 3IVUA 3GLCA 4HGXA 2B7OA 3WJYA 1M9HA 5AKQA 3SRFA 4MJMA 3YPIA 3PBVA 5G1TA 3CC1A 3PZUA 4FXJA 2OKOA 4PZVA 1RALA 4F3HA 3B8IA 4WF7A 1J2BA 3QYQA 1YNPA 2ZZ1A 4CN1A 5CGMA 4O14A 5RUBA 2QCDB 4I9MA 4JTAA 1X98A 3W38A 3AYRA 4H7CA 1LWIA 5CJNA 4JTUA 3PPCA 4CD7A 4HU8A 3G3MA 5I24A 3MCNA 3WD0A 4PMUA 2G41A 1OVDA 3H4WA 3UESA 4IPNB 2NQLA 2FYMA 3LGDA 3MP4A 3CEPA 2YFNA 2VC6A 2QJNA 4GMEA 3TW9A 3TYUA 3NSMA 4CQ8A 1CEOA 1LORA 3MA8A 2NSOA 5IDIA 1S5VA 4ZOAA 3NZRA 3AS1A 1I2PA 4K8EA 4J3WA 3HG2A 3FFSA 1HX0A 1RD5A 3M1ZA 5EMJA 5DXYA 1ZBCA 4JX5A 3M64A 4NJIA 1OK4A 3F2BA 2QCNA 4D6GA 4FMVA 4YYCA 3P7YA 1FKXA 3CZKA 3CUHA 1GVYA 2XSXA 2XVPA 2ZX8A 1SO3A 4X3ZA 1XLLA 3OLIA 5FJPA 1WZMA 1H1YA 1PHWA 2HEJA 5GQBA 1GW1A 4JHOA 3WQVA 3T81A 1X7IA 3VGHA 1B31A 1PIIA 1DJNA 5LA2A 3QVQA 4D72A 3V5CA 4ORMA 4AB4A 2NV2A 3N9SA 2X1RA 4YCPA 3WH5A 3TQPA 4HNTA 2Y5SA 1EQCA 1JPIA 3KOZA 5CJMA 1JRBA 1B2YA 4FOKA 2WCSA 3KVJA 4QG6A 1ZBKA 3GXDA 3GNNA 4M24A 1CW2A 1BPLB 1N7KA 1P48A 4P61A 2X30A 5C2XA 2Z1XA 4V2XA 2QXWA 4PTVA 3W7OA 4UFLA 3VTRA 1F4HA 1W9UA 3BLOA 1I8JA 3APGA 3E2QA 4HYWA 3RCNA 4UUIA 1UR1A 1X1NA 2Z2BA 2REQA 4C6DA 1L8PA 4XZWA 4DJDD 3IANA 1H7PA 4LTSA 4C90A 3LQLA 2OOGA 4JIQA 2XJ7A 4UFJA 4IFKA 3IUDA 1NWRA 1QU4A 3W1NA 2ZICA 2XFFA 3LMZA 2RUSA 3CYJA 3AMDA 1V93A 2WNWA 4ZO8A 2ZADA 4EPKA 1TR1A 4NQ1A 4GOAA 3SR7A 3B03A 4GUHA 3WDPP 4IFRA 1B3VA 1XYBA 2G97A 4D6CA 1QNQA 4YNGA 4HU3A 4TX8A 1XYMA 3V3WA 3A4JA 3TYAA 1G7VA 5F4XA 3VKDA 2XFWA 3LLXA 2PDGA 2YDQA 4OKDA 1E15A 1M5WA 4I5UA 4DJFA 4J3XA 2OYKA 5LIKX 2OWCA 2XVGA 4MY1A 1RK5A 2QYGA 3CU2A 3WBAA 1GGOA 3RLUA 3ZO9A 3L4XA 3SUVA 2WSPA 1UUMA 4FR1A 3AXHA 7XIMA 4LV4A 4BF5A 5IRPA 3KVKA 1PUDA 4P2VA 3CTLA 4L80A 3NXFA 1VPXA 3AMLA 1UR9A 3N18A 4LS1A 4K7YA 3BSMA 4JTFA 5HJLA 1IEQA 3B8DA 2OSXA 3B0VC 1P1MA 3M44A 2Q01A 4YPJA 2J75A 2DZAA 2V38A 3GHUA 1JGIA 2GPTA 3DH7A 4IMEA 4YLWA 3GX9A 1YNQA 4AVNA 4CVUA 3S1XA 1PAMA 4IICA 2XN1A 2PS2A 4U33A 1B3YA 3ITVA 1BTCA 1Q8JA 1TSIA 2WC3A 1EZ2A 2Y4SA 3I7SA 1K03A 1LP6A 2NUYA 3GW3A 1VYPX 4CEUC 4UOQA 3M5VA 5C9WA 1KGUA 4OV9A 4C6KA 4HVXA 4CD8A 2ODOA 4ILSA 3OW1A 1PTDA 2CLIA 4JHZA 5E5CA 2INZA 4DJEA 4YTSA 1IE7C 2J79A 5E09A 1AW5A 4XKMA 2WMHA 4WQ6A 4TTUA 3VXGA 3WEZA 1SGJA 2FVKA 5JH2A 1Z41A 1CCWB 3DHPA 3SCOA 4WJXA 2JKPA 4C1NB 4PR4A 1KFKA 3HFTA 3VKAA 1MQPA 3MB9A 4W8BA 1FWAC 1BXCA 4JIPA 4CQBA 2GOKA 1QWGA 1PJ9A 5G1YA 4AD3A 1SO5A 4E4PA 1K4GA 5A8GA 5JXQA 3D3AA 1VJZA 4TOQA 4HIBA 3U57A 5LIYX 3W7NA 2GDQA 1FXQA 3DGRA 3B04A 4WIWA 1EDTA 2J77A 4GYKA 4C6IA 1TX2A 4QP0A 3BURA 1DPMA 3QC3A 2O9PA 1RP8A 3NAVA 3C2OA 3UPBA 4B91A 1XBYA 1KCXA 2BY0A 1AL7A 4JTTA 2QUTA 1QBBA 4W8AA 1UW9A 3MP3A 4E3VA 4YHEA 1I2OA 2I7GA 3ITLA 3QZEA 1F6PA 4JDBA 4Y9PA 4DM1A 1LWHA 1IV8A 3AIRA 4UIOA 3QOKA 1VHCA 3LV6A 3ZVHB 3GBDA 3LLFA 4ADTA 3TU9A 3OG3A 4XV0A 4RZ6A 4TIMA 2OGYA 3CL6A 2FGZA 4HTYA 1B30A 3TWAA 1XYFA 4Z0JA 3S47A 4X0NA 1K8XA 3NQEA 3DC8A 1A0DA 3H2OA 1P0KA 2YDSA 6ALDA 3MUZ1 1BTMA 7REQB 3HA1A 1B54A 1VQTA 3SI9A 2EGZA 1TPH1 2HPMA 5IFTA 3KHDA 3QV8A 1H7RA 1GOQA 3UCDA 1E73M 3M0KA 1ONEA 2X09A 4ZA0A 4E8CA 4M7TA 1PKNA 3SY5A 3P5YA 2WO5A 1GG0A 5C70A 3MZ2A 2XDFA 1E1CB 3R12A 4FX8A 2E40A 3W1UA 1JZ8A 3D46A 3AU2A 3GY1A 1EBHA 3I4EA 1DQXA 2GSHA 5ABHA 4HMEA 2WHLA 2W3ZA 3R58A 1I2RA 3ALGA 3DFSA 4AIBA 3RU6A 1L6GA 3W25A 4GISA 2G3IA 3F2DA 1XGZA 1H0IA 1S2TA 4U31A 3U2OA 2ZRWA 2CYGA 3TE9A 2WANA 2OLSA 4H8NA 1LT7A 3SIMA 3NNTA 5JBEA 4NIRA 2ACRA 2QCHA 2Q6ZA 3IJLA 5DX7A 4EF8A 1E9ZB 1EX5A 4G7EA 5G2WA 3ISIX 3RU8X 3SSJA 1TTJA 4L65A 5AHEA 4GH3A 4NYUA 2ALDA 4C6JA 4R5EA 4CUCA 1B1YA 3OU8A 3ZZ1A 3BTNA 4JICA 1E51A 2HXUA 4QBXA 1LCOA 2HWGA 3W37A 2Z25A 4H04A 1CTNA 2FDSA 3VFLA 1US0A 2ATSA 1KR0A 3AUOA 2D0GA 2WB5A 1CNVA 2QCDA 2D3LA 2PWEA 4HN8A 5BXRA 3H54A 1IGWA 2I5IA 2E4TA 2RDXA 3PBUA 2P53A 1PSCA 1POJA 3OVQA 3WH6A 4DO4A 1P7TA 5F4WA 4OUEA 1JYXA 1F2JA 4J27A 4Q8QA 1TTQA 4QIUA 2NW0A 2CC0A 3OO2A 4H4IA 4ERAA 1NOUA 2AKMA 2FGLA 2WNQA 1ZAJA 4KGJA 2DIKA 3CMJA 1GYLA 3P14A 1TWIA 3WLMA 4UTWC 3GYCA 4FXRA 3I68A 1WB0A 5C0QA 1WKEA 1YBQB 2HDJA 3CIVA 4AXNA 4GZIA 3GVVA 1MRQA 4O0KA 3NQ2A 5E70A 4N9CA 4Z1DA 4AH7A 3P67A 2DZUA 3HPZA 3APYA 5K2ZA 2V5JA 3QLLA 1XLJA 1RA5A 3V5FA 1RVGA 4DY1A 5LIXX 1XLAA 2V2DA 2YL9A 1IZCA 4NL1A 3GXFA 4S3KA 2Q8LA 1FHVA 3IJDA 1MEHA 3EWWA 3XISA 2O9TA 2GQ8A 1TKKA 1KW1A 3V35A 5BYWA 4NHVA 1V03A 1SM9A 1TUXA 4Z0SA 4MF4A 3T09A 3PP7A 1XH2A 1HO1A 4MB5A 4XAYA 5E6YA 2YW3A 4HZ8A 2E5DA 3GQYA 3PJUA 2QS8A 1H4PA 3B3DA 3VD9A 3ALFA 3OBEA 4XZLX 1NDZA 5D9MA 1EKOA 3GR7A 3VIHA 3P81A 2OPJA 1I9CB 1XBXA 1X39A 4L61A 2ZE3A 4U10A 2ESCA 1TTPA 3QFWA 5M5DA 1Q8AA 3UJSA 4DJEC 3AWOA 1UROA 3WQOA 4MY8A 3W7JA 2GDVA 1E6NA 4O11A 4IXXA 2OELA 4DHGA 1V0LA 3ABOA 1L2QA 1GZGA 4ZENA 4XAPA 3L5LA 1THFD 1PEZA 3BZJA 2V8ZA 1KM6A 2IPJA 1PKMA 5BXTA 4LAOA 4NJKA 1C8VA 3LG3A 2FIQA 4A4AA 3CAVA 3CL8A 4Z1AA 9RUBA 2I16A 5I0DA 3ARXA 3C52A 5HJXA 1H7NA 2OJPA 4JTCA 1KC7A 3LHVA 1RSCA 2H9AB 5EGRA 1GVRA 1W6TA 1QNOA 1ICQA 3P2VA 4S3JA 3LCHA 3WQDA 3QPEA 5CPLA 3CQKA 4HSHA 1YDYA 4IP4A 4MOZA 2Y7DA 1OFOA 5DO8A 1A49A 1PZ2A 2J24A 4EWND 2FJKA 3IIXA 4FO4A 1LT8A 3O15A 3SN4A 4OQVA 3L5MA 4IJRA 3H23A 3DBNA 4O1EA 3UA3A 4UB9A 2AL2B 3GO2A 2GJXA 1RY8A 4MNLA 4MB3A 1L9WA 4XVDA 2OZ0A 3NPXA 4LUYA 1ZP3A 1G4PA 3L12A 5HUPA 4DF1A 3LTSA 5F2LA 2CPUA 2HROA 2IUZA 1XKJA 2QKFA 3HN3A 3NXLA 1EUAA 4C6LA 1GVFA 4AFYA 1GQNA 4HNNA 1RQHA 2VELA 2X0SA 1YADA 4MDPA 3U4FA 2BGQA 3EKZA 4Q8WA 2JALA 1VRDA 3TROA 3OTRA 1H5VA 3WDIA 1UR2A 2PC4A 1ITUA 4JTLA 3VD3A 4Q4OA 3B8SA 3GTNA 3RYSA 3SQMA 1JCXA 3TXVA 1W3JA 1V51A 1SJBA 2A6LA 1F05A 3ENLA 3SBFA 1CGWA 2RGLA 3NQDA 2C0HA 4PC8A 3CPUA 4O50A 3FJ6A 1DJGA 3WCZA 2NX1A 1TJ1A 3KS6A 4WY0F 1IXQA 5B7ZA 4LANA 3C0JA 3QRHA 1QOXA 1OFPA 1WDWA 4IGSA 1GWJA 4GI9A 3U4AA 2CCRA 4EXBA 3WY1A 3MI3A 1PDYA 3S2NA 1GOMA 2WM0A 3W1AA 1ZY9A 3HQ1A 3ID7A 2HV5A 4LFYA 3TSMA 3W6LA 4HA4A 4MADA 2CXEA 2WCGA 2WM1A 1Q6RA 4D1IA 4B5UA 1GUVA 1NOFA 3BOFA 5I3GA 2VJXA 3NEHA 3GVRA 2DPEA 4AWTA 4OBSA 3AOFA 2BBFA 3MY9A 3VOGA 2PBOA 3NTYA 5IBXA 1EB3A 2FMOA 4ZB0A 1XLBA 3AQUA 1H7OA 3B9NA 3F1QA 3GUWA 4GQQA 4IT1A 3GXIA 1W1VA 1JDCA 3ABQA 1JYVA 3LM7A 5G4HC 5H8UA 1OF8A 2E67A 4J3SA 4BI6A 1KB3A 1M04A 4HOWA 2P3EA 4DZHA 3FYOA 3I3DA 3W87A 3BDKA 3R89A 3TCSA 1EDGA 3GRIA 5CZKA 4LAUA 2PDJA 3FA5A 1E1CA 4IMGA 3II1A 3DI1A 3VOFA 2VFEA 1UKTA 2QIIA 1FQ0A 2PTZA 3CEUA 3LEPA 3V16A 2BGSA 1RD6A 1X8CA 2PWDA 1TR9A 4HNCA 1ITCA 3IV8A 3A4XA 2NWSA 2DZBA 4I90A 4EVZA 1XINA 1JQVA 2QV5A 4B92A 5A6TC 3GXTA 1J12A 1RBAA 2EPNA 1TRDA 1H7XA 3MS8A 5DF0A 3ZJ8A 1A5LC 2ZX9A 4US5D 2PLCA 2IXUA 3SCUA 1EJTC 3GC5A 3MVIA 4UNLA 4MSSA 3UGRA 2PEVA 1JDDA 5D32A 4MKSA 3CUZA 4M29A 2F8QA 3STGA 3QEZA 3WLJA 5I3KA 4Q4SA 1X1ZA 4YTQA 3GD6A 1OG6A 3RO8A 1AQMA 5BU6A 4Q7IA 5FIPA 3M7WA 4B4FA 3QFEA 3A4AA 3KP1A 3U7VA 4LCSA 1JUEA 4Q8NA 4AUBA 3LN3A 4F48A 2X40A 3GZ3A 3H24A 1OABA 1FCVA 4DO5A 2C14A 1PVNA 3W72A 1OINA 5EL1A 3RAOA 1FHDA 1BGAA 3IAPA 1PIGA 1WX0A 2BTMA 1XM3A 5JBFA 1M03A 3WNOA 3ARQA 5C71A 1NFPA 2OLAA 3GHTA 4EAYA 2ZIDA 2OR2A 2VWSA 3VE7A 2PRHA 1JZ4A 3TTOA 1HVQA 2XGBA 1TELA 5ABFB 2D1ZA 3W88A 4B5XA 2Y5JA 1MZRA 2EKCA 3V0TA 4YVXA 5KETA 1L6FA 1MW0A 3R43A 3NO1A 2OOFA 2ACUA 4XAFA 5BROA 3TYEA 3IAQA 4PEEA 5FSEC 1JD7A 2PF8A 3N12A 2DEPA 4HA0A 4PUDA 2V3EA 1M7OA 1LOSA 4GC3A 1E6QM 5D4YA 3NJ3A 2B7PA 2GJLA 2UWFA 3HPXA 2WBKA 3DHDA 4A8IA 2FHFA 3G3DA 3AISA 2NWRA 5E0KA 5DELA 2FFCA 2PDFA 4YL2A 1DHKA 3A4WA 3CHDA 4P8VA 4IWWA 5ABGA 3CB3A 3GG8A 5D05A 3UJ2A 3W73A 4NJHA 3QQ1A 2C1HA 3OJGA 4L64A 2GVYA 3ICJA 4B90A 4TUFA 3BOLA 3ZR6A 2ZUTA 2WC4A 3UGVA 4F0LA 2A0NA 1VC4A 1XL9A 3QY6A 2PU1A 3M0LA 4QE1A 3HU7A 5I23A 4D6EA 5CC5A 4UFKA 4O28A 5DANA 3PWGA 3BSHA 3E5PA 3RLVA 1LROA 3UJEA 3A6OA 3W75A 4WVXA 2V9DA 2D73A 4LEFA 4Q33A 4EP8C 4P7OA 5GVJA 1FWCC 3PANA 4XD3A 3UBPC 3B0XA 3H7RA 5D8WA 4F4RA 4LVAA 2VDHA 1U5HA 2NXGA 1SFLA 3E96A 2VOTA 2JGYA 5AECA 1UZDA 1KLZA 2GGGA 4TU1A 1XPYA 4XZHA 2A3AA 1PZ1A 3FA3A 4N9BA 4KKXA 3TCEA 2GGJA 5F1VA 4XAZA 3Q94A 2Z4GA 4G6CA 3KBWA 1TO3A 2CLLA 3CBWA 1M3UA 2JQXA 3CWHA 2J66A 2VL4A 4H3DA 3RF9A 2CIPA 4FZIA 4GLEA 3EA3A 3EX6A 1OX4B 1XDMA 4S2CA 1EF2A 1P4CA 3CT7A 1E4NA 1ZNNA 3TFXA 1TJ0A 4Y90A 5AC7A 4B9YA 3NZQA 2QJHA 3WH7A 1VR6A 4FI4A 1BRLB 2VVNA 5MHBA 2OB3A 2VEGA 4DVOA 4HJWA 2ZRVA 4NUWA 3T0DA 1T41A 4Q4RA 3VAVA 4EPDC 4S38A 3AYSA 1KWGA 4S3FA 3WFLA 5CGTA 1CXFA 3OPSA 3CLWA 4OECA 2AL2A 1TUFA 3K4WA 3W81A 5HWNA 4OE7A 1GONA 4GQRA 3VIFA 2IPGA 3KCLA 2CZDA 3MDWA 3TOYA 5IBXC 1AVAA 2A79A 2FB3A 3E0LA 1DTUA 1YXCA 4F0KA 2BGNE 3B8TA 4OUIA 2D20A 1GKQA 1UR3M 2D2OA 3PVFA 2GLKA 2FJUB 1C3FA 7A3HA 1VFTA 1M53A 3RRAA 3T0BA 3GTHA 4IISA 4OWGA 2GGEA 1A5BA 1GZJA 4X2RA 4C5YA 1VGAA 3AXKA 5HMFA 5A2BA 3RR1A 3MDUA 4CNOA 5HXMA 4UTLA 3SADA 2XVKA 4TX6A 5KZEA 2E9LA 4DJDC 3KTXA 1FHLA 1HXJA 5CH9A 2CLFA 2YCKX 4F9DA 1JI2A 3VABA 3QGKC 2BY2A 5HWJA 3AS0A 2BWGA 1GTHA 4WKHA 3O9NA 3VO0A 3L4YA 3RJYA 1NU5A 4AX7A 1X7FA 1EJUC 3T05A 3IIPA 1DJZA 1X97A 1MWOA 1UQYA 3DYOA 2JF7A 2DDXA 2Z27A 4GY1A 1OX6A 4GBUA 4W5ZA 4UMBA 4EIVA 1EIXA 3ZLFA 4DBSA 1WDQA 4NILA 4LF1A 3ARWA 2ZUUA 2CXGA 2P88A 1UH3A 3LCFA 1GW9A 3QQ0A 4IXHA 1JZ6A 4ZOEA 3BCDA 1ELSA 3H4GA 1E72M 1OT2A 1IEVA 1J01A 1DP0A 1SW7A 4N02A 3WQWA 4E2OA 1YPFA 1T8QA 2VQTA 4X9SA 4BHYA 5FAJA 1V8EA 2QAPA 4PCPA 4XD4A 2PD9A 3ZVIA 2CLHA 1DVJA 2BY1A 1CXHA 4NSBA 4EWJA 1OFDA 4HB7A 1VYRA 4FHAA 4GKLA 1RV8A 2OFJA 3G0XA 3SY8A 4IPLA 4BJHA 4HYRA 1XX1A 3W53A 1XC6A 3I7RA 2IQ0A 2EG8A 4PBGA 1JUBA 2W92A 3K5XA 1HJSA 2G3FA 3WIJA 3CZEA 2E5BA 3BLPX 1MRAA 4B15A 4S1FA 4AX6A 2VI0A 1LYXA 3TEVA 4AXKA 4L56A 3WK3A 1F9CA 4R33A 4S23A 1IYXA 1JVNA 1ZPTA 2PTWA 1YDOA 3ZR4A 2PF0A 4JTDA 3DAQA 4A29A 4LUJA 1GCYA 4H8VA 1GPWA 2A7RA 2DSUA 2XIBA 2HE8A 2OZ8A 1TV7A 4UQAA 1SZGA 4ML4A 3GTXA 4JQ1A 1LTDA 4PMZA 2Z1KA 4ZQMA 5HQEA 5D30A 1BEUA 2JEPA 3LS9A 4RLIA 2F6UA 5HK4A 3I3BA 3EXTA 1V6YA 3WLOA 4PFMA 1KBIA 4PTNA 3DGBA 4MAVA 3UEQA 2ZUVA 1XQLA 3N4EA 3V7PA 1DYSA 2XIMA 2VUNA 4UZUA 3JW7A 3ZOAA 4W4QA 5A6JA 7TIMA 1CIUA 5JQ9A 1GOXA 3MUY1 1L6YA 4RV3A 1AMYA 5CLTA 1XYLA 2QV4A 2B81A 1OQFA 1GOOA 2ISFA 1QNRA 3B9OA 1B0IA 3SUUA 3G6MA 4OFCA 3GB6A 2KAUC 5U4NA 1R3SA 1ZUAX 3NO3A 1R46A 3C0QA 4QCEA 4DXKA 2ZX7A 1O1HA 2H8ZA 5EYWA 2G3JA 3BV4A 1PS9A 4ZOBA 6CGTA 2UBPC 4M6VA 1XICA 3L67A 3A47A 4DZAA 2IS7A 4S3CA 3GTIA 4H8UA 4WX2A 2O4MA 2Y8UA 1AZ1A 3T7VA 4M0XA 3LZ3A 1AFSA 3RG6A 1BWVA 2VFIA 4FLQA 4HMCA 3CV7A 3T42A 1HO4A 5A69A 3RMJA 4NZ1A 4Z1YA 4PE8A 5A3HA 4Q7BA 2A7PA 4DXXA 3SFWA 2GUBA 4I7VA 3BAYA 4JEJA 2OG9A 3VPLA 4WHBA 3NQGA 2QCGA 5BOFA 3S1GA 1R2SA 1EPXA 3H12A 3GK0A 3NQMA 4IH3A 4HZMA 2DJLA 3F5JA 2PDCA 3MU7A 1XG4A 4LBRA 1OFQA 2OLHA 4YMZA 4HCLA 2V69A 1JZ3A 1R8LA 4KBXA 5D38A 3NQ6A 2DU2A 3NL2A 4M6QA 1IR1A 2E5CA 1BYBA 1MXSA 3RRXA 1PX4A 5FJTA 4BA0A 3D6NA 1SO6A 3O6AA 3UG4A 3NEVA 3VKBA 3T6CA 1C7SA 3S5OA 1ME8A 3BW3A 3UVAA 2WSYA 1VFFA 2RKXA 3QTPA 3PZVA 1OIFA 1G4TA 2W4XA 3E2SA 5JIWA 3TA9A 5H91A 1EC8A 3JZUA 4UQEA 3W7CA 2VM8A 3G8RA 2R6OA 1XLFA 1NF0A 1WKDA 2IKHA 1ZP4A 2HPIA 3IK2A 1SO4A 3RXZA 1Q2SA 3GH5A 4R88A 4US6A 1D3HA 3N73A 4N0RA 1DJIA 2VX5A 2PRLA 3CUXA 1DTNA 3GR4A 3S2CA 1FWIC 4ATWA 4DPQA 4LRTA 2DFAA 3FGCB 1GOIA 1U22A 2RH9A