1B3OA

Ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
489
structure length
304
Chain Sequence
b'TSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
publication title Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dehydrogenase
total genus 83
structure length 304
sequence length 489
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b3oA00
1QWGA 5D2XA 3TXZA 5LSMA 1GPWA 4UFHA 4W9TA 4FO4A 5D2TA 5D32A 1KFLA 4OBTA 2ZZ3A 2ZZ4A 5G4EA 1MEHA 2C6QA 3K30A 3PG8A 3GVGA 2G97A 4HPJA 3CWOX 3G1YA 5F2GA 3OG3A 2WOQA 1GYNA 4XTIA 5BW6A 4NZJA 3THQA 3B0UX 4K39A 3W7KA 4AEOA 5BMWA 5HJLA 4GNJA 3VNDA 1FWSA 5BNKA 4NNCA 1K8XA 4IMFA 3G1HA 4AWTA 3I65A 2RDWA 1TJPA 4WY0F 3W73A 5G2WA 4XKYB 5DXYA 1FCUA 3QH2A 2QCDA 2Z2UA 1MEWA 4TIMA 4M6QA 1KV5A 1G7UA 2DZTA 3P84A 2R94A 4IXXA 4JXCA 4UTWA 2NV1A 1ZALA 5K4XA 3TAOA 3HG2A 4Q32A 5F1VA 1WXJA 1SSDA 5A8GA 3P74A 2ZTKA 5CGQA 5EKYA 3TK7A 4AVFA 4WJEA 3EWUA 4K8HA 5K9XA 4AXKA 1DKWA 1AMKA 1KTBA 5F2LA 2WSQA 2UV8G 3LERA 4O0KA 1OYAA 3NQGA 4JYFA 1EWDA 3WFAA 4IXHA 2VFGA 3NYZA 3R8RA 1TPFA 3W22A 2HTMA 4DQWA 4NZFA 3C2RA 2YZRA 2ZTJA 2A6NA 2VFHA 5D2YA 5H2ZA 3LOTA 4GJ1A 1C8VA 5C54A 3GKAA 3C56A 4NJHA 4LTSA 2OT1A 4PTNA 3L21A 4AHPA 5U7SA 3W7EA 2BX7A 1XBXA 4HIBA 4HN4A 4JICA 3ABOA 3EX1A 1WAUA 3G8RA 3QF0A 1B4EA 3W23A 5TBOA 3FJ6A 1F5ZA 1A5SA 4LUJA 1YXDA 4WY0A 1VHNA 1WYIA 2G95A 1W3NA 3QJAA 2VELA 4O57A 1XC4A 1KM6A 2VFFA 1KFEA 3G1FA 3QQ0A 3M43A 1S3HA 1O5KA 4JIQA 3KVKA 3O6YX 2Q8LA 3E02A 3MYOA 3LTPA 3HBLA 4N6FA 3I6RA 2ZA3A 1SFJA 4O19A 4UMBA 3P82A 4JX6A 1PE1A 5HWJA 1LROA 4JTLA 3HPXA 3PBUA 2ZRWA 5LHEA 3TU9A 3DI1A 5SWUA 3BW3A 1H62A 2OZ0A 2NXIA 1G4PA 1SU5A 4RJEA 4O16A 5HMSA 4OWGA 3W2KA 5DLCA 4A29A 1SO6A 4O4VA 4UFLA 3GZ3A 2VOMA 3NQCA 3GX9A 3C2OA 4I7UA 1HO1A 4BF9A 4JEQA 1ICSA 2WNQA 4EF9A 4JYDA 1AW1A 2FB3A 5K4ZA 3W2MA 3TSBA 2PCQA 3DU0A 4O13A 3BG3A 4N02A 3W76A 1XUZA 4Q33A 1ML1A 4UTTC 1D9EA 4TX9A 1VRDA 2YFNA 3PBYA 3UQNA 3MP3A 1QPOA 4CCDA 3FS2A 1Q6OA 3FKKA 5DBTA 4ADUA 5LZLA 3DFOA 1LLZA 5F2MA 4UC5A 3STGA 3BV4A 3AJXA 2OCZA 1W1ZA 3BGJA 1DOSA 5J5RA 3T44A 2RHGA 1GVQA 2W6RA 3S9YA 3WJYA 4DF2A 4I7WA 4J9JA 1V7YA 3NQ2A 4U4MA 4NNBA 3T7VA 2NXHA 5EPDA 3CC1A 3TMLA 1R46A 5CZ0A 4DEFA 1L6YA 5D33A 1TSIA 2J88A 2V82A 1OFAA 3EX3A 3SGUA 1FXQA 5HWMA 4OU1A 3NL3A 4OV9A 4DELA 1YLVA 2TPSA 4LUIA 3V1PA 2DZUA 3LV5A 4AWSA 3B03A 4IMDA 3QW3A 4YMZA 1PVNA 5AHLA 2QUTA 3P5YA 1KW1A 1EP2A 4EOUA 4XBSA 3EX2A 3NPVA 5KSWA 1C29A 3CTLA 4ZQNA 3LXCA 1YPIA 3W83A 1D3HA 3TQKA 5KZEA 4N9CA 3UPWA 4PEKA 1RQHA 1KFJA 1G4SA 5DN1A 1NVMA 3SJ3A 2HS6A 5F4SA 3N2MA 4X9SA 2ALDA 4K37A 1W37A 1TPWA 1OVDA 5ABTA 1TRIA 3LHUA 2C14A 2G5WA 1NAL1 4ZZ9A 4ZQMA 4FNRA 4AF0A 3IEBA 4OT7A 1SZGA 1A50A 2CLOA 1ZY9A 1H7NA 1Q6RA 1THFD 3GXTA 4TMBA 3OVPA 4RXFA 1BEUA 4QAIA 4K7YA 1AK5A 2Y85A 2ISWA 3HGRA 2Z6JA 1OFEA 3TKFA 4AB4A 1FWTA 5LNVA 3JR2A 3R89A 3G22A 1TV5A 1TIMA 1QDSA 3W7PA 3EXTA 3EKZA 3NO5A 1ZFJA 3MYPA 5AHNA 1QMLA 3S5OA 2GQ8A 2QKFA 4PA8A 3TSDA 4JDYA 5FESA 2NUYA 4FXSA 1P0NA 4JY8A 4R33A 4JTTA 5C2XA 3LV6A 1L2UA 4LVGA 1MO0A 1PS9A 3M1ZA 1P4CA 1K8ZA 1YPFA 3L5LA 5E0KA 4A21A 2TMDA 4KKXA 4NX5A 3MMTA 3EEGA 3T4CA 1N8FA 3CQ0A 3P62A 1QO2A 1YDNA 1KA9F 2EPHA 3KVJA 4LC6A 4TO8A 1WV2A 5DCBA 3FA5A 3S1XA 5K7JA 1ZCOA 3T40A 3NL5A 3FYPA 4FNTA 2BXVA 2CWNA 2VEIA 3SZ8A 1VPXA 2JBMA 5L9FA 3T78A 4JX5A 3ATYA 3HQ1A 1F7BA 4O12A 5LNWA 1LBFA 4A2RA 1ZNNA 3NM1A 1VJIA 1OF8A 3L5MA 3JRKA 4S2CA 1OX4B 1UUMA 4O14A 4WUIA 3TC6A 4QM1A 4LVBA 3P67A 2Y7EA 2H8XA 1WQ5A 4JTGA 4ALDA 2WO5A 3S1UA 3PBWA 3TA6A 5I3GA 3GB6A 5EMUA 4CQ8A 1L9WA 3M5VA 4WD0A 1QFEA 5CSRA 1Y0EA 3F03K 3WJSA 2ZRUA 4CNNA 2ZZ1A 4IMGA 1Z44A 3MP5A 2E6FA 2CLMA 3V75A 3ABQA 4HNVA 3UWZA 2FLIA 1M7PA 2WSRA 3G0UA 3HGSA 1UASA 4K38A 4MYXA 5FF7A 2ISSA 4BFAA 2NX1A 3CEPA 4NJIA 2C15A 5CG7A 2WNNA 1LTDA 2A2IA 2V5LA 3M7WA 1QAPA 3PB2A 2VC6A 3SR7A 3O63A 3P81A 1E51A 4RCXA 4JN6A 1TREA 5EA9A 2J6XA 3TUUA 1TTIA 1JULA 2VKZG 3FLUA 1JCJA 4BI6A 4NT0A 3NQFA 3QQ1A 2OX1A 5D05A 4IMCA 2V9DA 1LRQA 2DZXA 3B06A 4O18A 1PCWA 2DJLA 5K2ZA 4LW7A 1I4NA 1PIIA 3HG5A 3BGGA 2QJGA 3OHIA 4O15A 3IIVA 1U5JA 2RFGA 4RR4A 4OHQA 1LDCA 2PE4A 3HF3A 4KWWA 4KFNA 2A7NA 1W5PA 1DORA 1IXNA 1VCGA 3A9IA 4O28A 3I7RA 5F2IA 1NF0A 1OX4A 2E5DA 5CZSA 3VE9A 1O5XA 1IXQA 2Y70A 3FYOA 3KOFA 4K6AA 1I8JA 3W71A 2H3BA 5U4NA 3TROA 3S5ZA 3PUOA 3PC0A 4CQ9A 2QJHA 3L66A 3BW4A 4UTJA 4MVAA 4AHQA 1FX6A 5LKYA 3GDTA 5G2HA 4AMAA 3BW2A 4N2YA 1VHCA 3W9ZA 3C0JA 1M5WA 4O1AA 3EX6A 1YXCA 4PCFA 2KZHA 4M6VA 4Z0JA 4HHPA 1H61A 4FF7A 1FCVA 1UCWA 2QCFA 1PV8A 1LM1A 1WOBA 2B7OA 3W2LA 1J5TA 3MBDA 1OG0A 3E12A 4RV8A 5J5DA 2QJIA 2I9EA 4Z1CA 1X8FA 1TPEA 1LYXA 1TJRA 3W3OA 1KM3A 3N19B 3ABRA 1F6KA 3A5FA 2JKPA 1VC4A 4OV4A 3P8IA 3L0GA 2Q8ZA 1LZOA 3QRHA 3H54A 3GAKA 1M6JA 2FJKA 3QMTA 3DI0A 3UD6A 1RR2A 1WDWA 4ORMA 5FF4A 1ICPA 4JTHA 3FFSA 3LDVA 4DPPA 3N14A 1IF2A 5EBUA 1DQXA 2C1HA 3LTYA 4UTUA 1PHWA 3M5XA 3IRDA 5EYWA 3KHJA 4I9AA 1G4TA 4LC8A 1TPB1 4WY0B 1Z48A 4N4QA 3TFCA 1FDZA 2CZFA 1K7XA 1AW5A 3LCWA 4GFSA 2E1DA 4ZQRA 4UNKA 3L5AA 5LGZA 4TMCA 1O60A 2EKCA 2O7QA 3LCLA 4O4WA 3ANYA 5I3KA 1FY6A 3W7OA 1SO5A 4UTKA 1DV7A 1JCYA 3UXDA 4LRTA 3GKFA 4Y90A 3TH6A 3U6WA 1DL3A 3MHGA 1W5NA 3FKRA 4AH7A 4FEZA 3C61A 4ZQOA 4O52A 2V2DA 3S1WA 1HO4A 3Q37A 3LCIA 5HINA 4K8EA 3UZ5A 2R8WA 1VS1A 4RKAA 3EXSA 4FX6M 3LM7A 2ZZ2A 3TX9A 4M7TA 3C52A 4MYAA 4YL2A 3RLUA 3HG3A 3A24A 3LI1A 2FPTA 3CB8A 1IXOA 1GTEA 2YPIA 3O15A 1KFBA 4ZQPA 3DXIA 1EB3A 4PFMA 1H51A 1YTEA 1KTCA 3PS7A 3PVFA 2P10A 4MFEA 3OEXA 1I2RA 4MPQA 3ABSA 3UPBA 4R53A 3W1TA 5K9DA 4ML9A 1ME7A 1VCVA 1SR9A 3DHFA 4D2JA 3TCEA 1KLYA 3GXNA 2V5BA 4IWWA 4HNTA 5G1TA 1AL7A 3W1MA 1YYAA 4QITA 2YXGA 2R14A 3PB0A 4JD4A 1I45A 1JCMP 3SI9A 3U8GA 1F2JA 3W7CA 2V81A 3LLFA 1H5YA 4E2BA 5FF3A 5AYXA 3NEVA 3BLIA 3CU2A 1BTMA 3HB9A 1W3TA 4UFKA 2WNZA 3HGJA 4JR5A 1CX9A 3KRSA 4MZ8A 1DBTA 2FFCA 2FQIA 4PH6A 2ZQ0A 3BARA 1EP3A 3B0PA 1VGAA 2ZCGA 3TV8A 3CLMA 3MJYA 1KM0A 2A85A 4BR1A 4DF1A 1QNVA 5BMXA 2GJLA 1T8XA 1L6SA 2NV2A 4Y8FA 1VQTA 1ZJIA 4XBKA 4JTUA 7TIMA 5IM51 3USBA 1LOLA 5MHBA 3S8HA 2CLFA 1OJXA 2QCNA 3B05A 2E6DA 1R30A 2XN1A 3BG5A 3C2VA 3INPA 4ADTA 3ZS4A 2AGKA 1T96A 1FXPA 4JTKA 5KTLA 3NOEA 5I3JA 4FNQA 3S5YA 4O10A 3QSRA 1NF7A 4UTLA 5DY3A 1L6WA 4NX0A 4BI5A 2Y89A 5GVJA 3SSJA 2V8ZA 1JVNA 3NDOA 2NX3A 1Q6LA 1R2TA 2EHHA 3IIPA 4O54A 3G3MA 4LS0A 1SW3A 3NZRA 1OFQA 1EUAA 5CPNA 4AF0B 1GVRA 4UFIA 3W7JA 2ZDRA 3SECA 3PY2A 1W5OA 2D73A 3IVSA 2BSLA 1H1ZA 5BOOA 2BZNA 4CLMA 4MKNA 1OFBA 1QOQA 1XFBA 3RNDA 3I68A 3MHUA 2ZA1A 4DO4A 3UNDA 1X1ZA 2ZZ5A 4L4LA 2YFOA 3E49A 5AYYA 3WK3A 3CHVA 4LVDA 1AW2A 3LRKA 3QW4B 1HG3A 1ZAIA 1LRTA 3L67A 3TDFA 3P8JA 3SY5A 4LV9A 3WJWA 3W07A 1A5AA 2QCCA 4KFPA 3W7LA 1SQ7A 3W7GA 3B8DA 1GQNA 2EGZA 2GVGA 4JDBA 3NQ6A 3LXAA 3NG3A 3TC7A 2WQPA 5AOUA 1KM4A 4RZ6A 1LOSA 1UUOA 4IX0A 1KBIA 4X22A 1UBSA 3L0KA 4C1KA 1FUYA 3LLDA 2NWSA 2X30A 3WK1A 3A23A 3A22A 4PC8A 1G6CA 1P1XA 1IGSA 3L0NA 4M7SA 1B4KA 3G3DA 1ADOA 5HR6A 2DZVA 3L9CA 3MI6A 1KBJA 1RPXA 3I7QA 4FNSA 1TYGA 3GLCA 5G1YA 1JJKA 1YTKA 1KFKA 1Z42A 2NXGA 5HQEA 2RH9A 5FI8A 1N7KA 3LXBA 3UWWA 2LLEA 5DCDA 3LHVA 5TQLA 3FJLA 4N6EA 4LVAA 2GVJA 5FEZA 3LRMA 4IX2A 3VFLA 5C6MA 2HS8A 4YCOA 5KZDA 4UTWC 2Y7FA 3N9SA 4FIQA 1RZMA 3UXAA 3TMQA 2ZZ6A 3DKJA 3SW6A 2B4GA 3A5VA 5CPLA 3NQ8A 1W5QA 1WOAA 1W54A 1MSSA 1VYPX 3I7SA 4MLRA 3S6DA 4K7VA 3U2OA 3FEMA 3S1VA 2OMAA 1SZEA 4FHAA 3NM3A 3W1NA 3MW7A 3W7MA 1A53A 3CPRA 3W7QA 1XUUA 5AHIA 3KX6A 4K36A 3LX9A 1JRBA 4LY8A 2ZA2A 2HSAA 2QDHA 4QSHA 5HUPA 5BRBA 3NPXA 4UNLA 2NUWA 4DXVA 6ALDA 3W85A 2P1FA 1ALDA 2PURA 1Q6QA 4BWLC 4CNOA 3W7DA 3EKLA 3OIXA 1H1YA 1OK6A 4Z1BA 4XZ9A 4NUWA 2A1YA 3TJXA 2VENA 2JGQA 3EWXA 3TW6A 2CU0A 2ZBTA 1F73A 4XWUA 3Q58A 1W0MA 2QCEA 2Y63A 2X1RA 3LGEA 4POCA 5FEXA 1VH7A 5AHFA 4MUZA 2Z6IA 1H63A 1TPC1 4MZYA 3TIMA 3F1QA 3DKLA 3UZJA 4DBDA 4UFJA 3KFTA 3LB0A 3KVMA 2YSWA 5K9CA 1FCBA 2YDAA 2YYUA 3RFAA 2J9ZA 3TAKA 1TMHA 3VI2A 3MHFA 2Z1BA 4S2BA 1SZNA 5AC7A 1S5WA 1AG1O 3PSVA 3CIXA 3LCGA 1K7FA 1JCNA 3KAOA 1AL8A 3TSMA 4EF8A 3S0CA 1TO3A 5AHEA 3PG9A 1S5VA 1QR7A 5EY5A 4Z1AA 4WOZA 3RLVA 5CSSA 1ICQA 4LNYA 3NAVA 4O53A 3M6YA 3P61A 3NXFA 1SFLA 1KM2A 1OK4A 2W0UA 4DO6A 3LCHA 3FOKA 4JGDA 4HKPA 3L65A 3TNOA 4OE7A 4MFDA 3W7NA 1KV8A 4WXYA 1X1OA 1TPDA 4GBUA 3W75A 3W84A 3W7RA 3NQMA 2C16A 2W79A 4GUJA 1QPNA 4JTJA 2BTMA 2VEKA 5C5YA 4N9BA 4M5PA 3LTSA 5AB3A 1TRDA 5AHMA 4AHOA 1BWKA 1H60A 5FEPA 5D2WA 3M47A 4NXSA 2E6AA 1XKYA 2XN0A 2WSYA 2OJPA 2E6YA 2Q3RA 3LCXA 4ZQCA 2A0NA 1K03A 2CLLA 3QM3A 1DVJA 2CLKA 1OX5A 4I7VA 2C18A 3LHWA 3M9YA 3P80A 3NQ7A 2TRSA 3BLEA 3DHDA 3WJZA 2EF9A 3P60A 2GUUA 5G5IA 3G1VA 4WOQA 4MJZA 3RMJA 3W1QA 3OVQA 1OFDA 1HUVA 1RVGA 4M19A 1LP6A 2A7PA 3PSWA 3M5ZA 3ATZA 2HMCA 5F4WA 5D37A 1M7OA 1GVFA 1KTNA 3R13A 3M5YA 3KXQA 2YCEA 3W1RA 4JX4A 2JKEA 1WA3A 4QISA 3GR8A 1B3OA 1IIGA 1DJNA 4FX8A 1LLWA 2CW6A 3W2UA 2EAWA 1QPRA 2GPTA 2XFWA 1GYLA 3DFTA 3LRLA 1XXXA 3DH7A 1MEIA 2A5HA 5I3FA 3G1DA 3MI2A 4UR8A 2V30A 3ZFHA 1TPUA 1C9DA 4UTTA 1FWRA 1SPQA 1GG0A 1FCQA 1KLZA 3DAQA 4TU1A 5AC6A 3M44A 3G0XA 1WBJA 4R7JA 3TR2A 3MUXA 1NSJA 3O8AA 3IIXA 4NJJA 3VCRA 4FIRA 3NQVA 4S1FA 1LBMA 4RLIA 1GZGA 1X7FA 4JTEA 1EIXA 1OFPA 1F05A 3E0IA 4UTMA 3W1LA 2A4AA 4GUIA 3S5NA 4ONVA 1G4EA 3C4UA 4UXDA 2C13A 2QF7A 3A21A 1XDLA 1OFOA 4A22A 1R47A 3O07A 2PRMA 2VEPA 4MZ1A 4MJMA 1CI1A 2E68A 2VFEA 1GTHA 4LT9A 1DHPA 2QCHA 3STEA 3C2FA 3THAA 1I2OA 4HNNA 2PC4A 2ATMA 3EWWA 1GJPA 2BLEA 4H3DA 3JS3A 4LWWA 2F7FA 1VCFA 2DJXA 1HTIA 4UMAA 4H4IA 3C8FA 1W8SA 3IIOA 3MI3A 3G24A 3IVUA 3UWVA 3PWAA 2AAMA 2WKJA 2ZRZA 4FNUA 3NPUA 3QSTA 3G1XA 4WX2A 2C0AA 1GG1A 3EWBX 1OX6A 5D03A 1MZHA 3G8EA 4QJ1A 3M41A 1XL9A 1EPXA 4JTSA 3IVTA 3GDRA 5TIMA 3CEUA 3GDKA 1G67A 2ZRVA 5CPMA 1SO4A 3UY7A 1LORA 3AO0A 3GAYA 4MY9A 3BPWA 1O94A 2Y7DA 3UWQA 2X2GA 3NPWA 3B4UA 4LOCA 2CZDA 2NLIA 3CM4A 4JY9A 4H6KA 3VKJA 3W1XA 3OVRA 1JR1A 5I3IA 4A2SA 3SGZA 1W5MA 3CIWA 4MY1A 2CZEA 2Z0IA 5DELA 4AWUA 2QUVA 3SFKA 1A5CA 4YLWA 3WK0A 1LBLA 1ME8A 2IQTA 3STFA 3W1AA 3QZEA 5DY2A 3BG9A 2CLHA 3EX4A 1JUEA 2GQAA 5AN7A 1KM1A 4RZ4A 2GJNA 3KVLA 4BI7A 5HWNA 1RQBA 4MLJA 4UTHA 4UFMA 4QNEA 2YW4A 3DFPA 1YDVA 4Q4KA 4IOTA 1ZAHA 2OT0A 3BO9A 3QFEA 4QIUA 4BWLA 5KITA 1FWNA 1JUKA 4PL1A 3TXVA 4DO5A 1PCKA 4HNUA 2X1UA 1EA0A 1NFBA 1PHQA 1HL2A 1WBHA 3HO8A 1XDMA 4Z0SA 3H53A 4RK8A 1J2WA 3OBKA 1EP1A 4EVZA 1DJQA 3HIJA 4IPJA 3BVJA 3DZ1A 3NR0A 2ISVA 4FNPA 4WQ6A 5FEWA 1TTJA 1B9BA 3HPSA 3IIZA 3DFQA 1XBYA 1VLWA 1FWWA 3KRZA 5F4XA 4GC4A 3PBVA 4MY8A 6TIMA 5E1QA 1ZAJA 2VFIA 4UCGA 4UIOA 2I1OA 1GVOA 3IV3A 4O0ZA 4XKYA 2QCMA 1TTQA 1H50A 3PR2A 2QCGA 1A5BA 4O1CA 1OABA 3RF9A 3F4WA 3TFXA 1BWLA 1F74A 2E5CA 4GUGA 3E96A 1I2NA 1FQ0A 3O06A 1LCOA 3STCA 5D02A 3GR7A 4NU7A 1TQXA 1H7XA 3GXPA 1B57A 1SO3A 3W1UA 4DF0A 2VFDA 4E0CA 5CZJA 4YWIA 1XM3A 4HT3A 3SIZA 1H7OA 1SUXA 4CCCA 2B7PA 1MXSA 3T55A 1QO5A 3L68A 3HMJG 4WXZA 2WPBA 4UMCA 4GUHA 4OGZA 5DXXA 1JCXA 3GDLA 2VEMA 1W56A 1R2RA 4E2DA 3W1PA 2A6LA 3H55A 2GVLA 4O1DA 3W86A 3HGOA 3LI0A 3BLFA 2J9YA 2NZLA 2DU2A 3O6CA 1IXPA 3PAJA 1RQEA 3S42A 3GNDA 4GRSA 5IBXC 4FB7A 5D30A 4U28A 1WX0A 4JTIA 3W70A 2GOUA 3EB2A 3GNNA 2DZPA 1OYBA 1U83A 2PRHA 2AQWA 3ZWTA 3W88A 3M16A 3ZWSA 2I14A 1TV8A 5CPOA 2FDSA 3EXRA 3M0ZA 1H7RA 4O1BA 2VXNA 2JK2A 4N4PA 1T99A 1ONRA 4PL2A 1EEPA 3DBPA 3NL2A 4OQVA 2FTPA 1YTDA 2J24A 2Y7GA 3R5EA 3CT7A 3LHTA 4NXKA 1TPVA 3W2NA 3N2XA 3R2GA 1DQWA 2ZZ7A 1YXYA 3W7HA 3NQAA 2CLEA 1EWEA 2B0MA 4AAJA 2R91A 4QNWA 1GVSA 4EWND 3NZ1A 2ZFAA 4ZMGA 4CNPA 3MP4A 2H6RA 3QMRA 1PL9A 3C3NA 4PODA 5EL1A 3GIYA 1VYRA 2CFFA 3PM6A 4QQ3A 1GEQA 1XCFA 2QUUA 5CZTA 3HPZA 1VR6A 3PUDA 4CCEA 4JYEA 2H3DA 3C6CA 4M6PA 2RDUA 3NQDA 3G0SA 2JKAA 2YYTA 2J9XA 1JQVA 1VZWA 2QDGA 1TB3A 3MO7A 2WV8A 3NA8A 4JTFA 4Z08A 4Y6GA 5H91A 3GK0A 2XN2A 2QCLA 4UR7A 4IGHA 1R2SA 4LS2A 1D3GA 5AYZA 2A21A 4KFOA 2E09A 1UB3A 3BK0A 3G18A 5K3VA 4LRSA 5LNRA 2Y88A 4HSNA 2P0OA 4ADSA 1OYCA 1XBZA 5L6UA 2ZYFA 3HOJA 5FF2A 3D0CA 4C1LA 4JNMA 3EWZA 3TJLA 2ABAA 1H7WA 1TPH1 2DZWA 2E5BA 2X1SA 4MOZA 4TR9A 1N55A 3NL6A 3WK2A 5I3HA 1W31A 2B7QA 3O05A 5F1UA 1CW2A 1K8YA 3DGRA 4NQ1A 2X16A 2Q3OA 4MIMA 4BK9A 1ZHAA 1JQXA 4O8RA 3O1NA 1Q3NA 3OA3A 3HG4A 3DFNA 3NQEA 1I2QA 2DP3A 2RKXA 3E9AA 1FBAA 4IPIA 3IGUA 5A5WA 1YDOA 3ELFA 5KZMA 1OF6A 5KMYA 4RX0A 1BKSA 3W72A 2CZ5A 5HULA 2V2CA 3QEZA 3TW7A 5AC8A 3P5ZA 5G2IA 1TV7A 1SW0A 4NJKA 5HR7A 3TQ0A 4NNAA 3B04A 3DFSA 4IQLA 2FPVA 4DPQA 3NVTA 8TIMA 4WZHA 5DBUA 1TTPA 3W7IA 4ORIA 2JGYA 1K02A 1XI3A 5G4WA 3O16A 2ABBA 2QEZA 2NUXA 4R34A 4LVFA 3B0VC 3EWYA 2PRLA 1OFRA 3TE9A 4CQAA 2FIQA 4FX7A 5KINA 3UYCA 1H7PA 2F84A 3HJZA 4G1KA 2Y61A 1IIHA 3O6DA 4L4MA 1SW7A 2WJZA 3N9RA 4P61A 2O7SA 1Z41A 5D09A 3W74A 3Q2DA 1QOPA 1FDJA 3LBCA 2V2HA 5D2VA 2A7RA 1FDYA 3QPYA 4NJGA 1ME9A 1SZFA 3MBFA 4RXGA 1GT8A 3C2EA 2V0TA 3NGJA 3PULA 2C3ZA 1SSGA 3TQVA 4IUOA 1K7EA 2B7NA 3R12A 5E93A 3P7YA 3RU6A 2CLIA 2YR1A 4XTDA 2G96A 3N34A 3NNTA 3F4NA 3L2IA 3QPZA 4ZVJA 4Z1DA 2BWGA 1G7VA 3LHZA 4ICNA 5T26A 1KFCA 4LS1A 1VLIA 2H8ZA 5LNUA 1EX5A 4GE8A 3DENA 4LV4A 1V5XA 1K3UA 4GXMA 3UWUA 4HPXA 4B5NA 4N9DA 3W2JA 5C55A 4IMEA 4DBEA 4A3UA 2QAFA 4KWVA 1HFBA 1ZENA 3IGXA 1O4UA 2ATSA 5CKSA 2C19A 2YX0A 4XUGA 5LGXA 4UTIA 4Y9AA 4XQ6A 5HUOA 3YPIA 2FPYA 1Q45A 2H90A 3ZR4A 2Y62A 2TYSA 4O17A 4O11A 2YW3A 4UUIA 1LOQA 2ZRYA 3QYQA 1EUNA 2TSYA 4X2RA 2FB2A 3QMSA 5LHFA 2ZRXA 4X3ZA 3UY8A 4YCPA 2QR6A 1VYSX 3W87A 4LU0A 1TQJA 1P0KA 2QAPA 3G1AA 1UJPA 4E38A 5HNRA 1NEYA 4O50A 2E77A 1KM5A 3FIGA 1P5BA 2DZSA 4YXGA 1F6PA 1T0OA 1XBVA 5LNSA 2Y6ZA 2NWRA 3G1SA 1J4EA 3PF3A 3VE7A 4GWEA 1LRNA 3GYEA 3Q94A 3RK8A 4HSOA 2QCDB 1RD5A 1X6UA 1QPQA 2X1TA 3LCFA 4ZL1A 3N3MA 5AFDA 1OHLA 1RV8A 3WJXA 1O95A 1GOXA 3W6YA 2J27A 4FXRA 3GDMA 4EIVA 3UWYA 2DORA 1GWJA 3N73A 3CWNA 4NVTA 4N9EA 4IJBA 2RDTA 1YADA 4RZ5A 4JIPA 4JS3A 3IGSA 3LHYA 5IBXA 3PUEA 3QC3A 2NX9A 1G69A 3MWAA 4Y96A 3LBMA 2YGYA 5DCEA 4P2VA 1QCWA 5FF0A 5D38A 1JCLA 1F76A 4GUFA 1S5TA 1JRCA 1JUBA 1I2PA 1TCDA 5D04C 1W3IA 2GQ9A 3KRUA
chains in the Genus database with same CATH superfamily
4MF4A 1V3IA 2ZUVA 2R1NA 2YDSA 4FO4A 3BJTA 5HQMA 1KFLA 1BSLA 1JGMA 2ZZ4A 5G4EA 3ARSA 1OCJA 4JL2A 1BAGA 3K30A 3GVGA 3CWOX 3G1YA 3DESA 5BW6A 3JW7A 3B0UX 4GACA 2OGJA 1QI4A 2GQ3A 2PZ0A 1K8XA 2OQYA 4IMFA 3I3BA 3I65A 3WLOA 5BOEA 3R43A 3TEVA 3EKGA 1BGAA 5T8GA 1T8QA 3ZJ6A 1R3QA 1AH0A 3QH2A 2INFA 3RPDA 2Z2UA 4TIMA 2HEJA 1ZPTA 1GQLA 2HISA 5GQBA 4KCVA 1KRAC 1LL4A 3HG2A 2PLMA 2G4JA 5JIWA 4GKTA 3ITLA 4HD5A 4CD5A 2ZTKA 1XLFA 5CGQA 3TK7A 4RNIA 4W8LA 3VA8A 3EWUA 4K8HA 3QGVA 4QE1A 5AECA 3H70A 1DKWA 3WBYA 2V5KA 3WBXA 3N18A 9XIMA 3LERA 1OYAA 2D2JA 4PMOA 1EWDA 2ZWYA 4HTYA 3WFAA 3AQUA 4EK7A 4JTQA 2ZVIA 3DYOA 3R8RA 2E9LA 3GXIA 4LUSB 2YZRA 4PTXA 4QG8A 2ZTJA 1OY0A 4W5ZA 3LOTA 4GJ1A 4OFCA 3GKAA 4XZBA 1M68A 4LTSA 2OT1A 1B3XA 3R7MA 3L21A 3ECQA 2RAGA 4HIBA 4JICA 4Q6JA 1KWGA 3V35A 3V18A 1S2TA 2VZOA 4WSHA 5BROA 1UP0A 1VHNA 1WYIA 1HF6A 3T8LA 2G95A 2W5FA 4XAPA 4K68A 2PTXA 2OO6A 1U1UA 4DXKA 1O5KA 3WLPA 3KVKA 4F4RA 2PGFA 2Q8LA 3MYOA 3LTPA 2Z29A 5A95A 4A8IA 4CQDA 3ALFA 3UJSA 2YXXA 4HA1A 3SB0A 1SJCA 3BW3A 2BHUA 1SU5A 8XIAA 4O16A 3TYUA 4OWGA 3UCCA 3W2KA 3RO6A 5FSDC 5DLCA 2HNEA 1JXKA 4O4VA 3ITYA 1EF3A 5CSUA 4P7RA 2EG7A 3GX9A 4XAZA 4I7UA 1ICSA 4W7WA 1DJYA 4LEFA 2J7DA 1Q6FA 2PCQA 2HXTA 1CXKA 1XUZA 1S2WA 1D9EA 1GNXA 3UWEA 3EOOA 5F2MA 1I6NA 3BGJA 5J5RA 2RHGA 2AL1A 3A4XA 3S9YA 4DF2A 3CIVA 3V5CA 4J9JA 4U4MA 3R10A 3SFWA 1RALA 3BANA 3BGAA 3TZNA 1R46A 3ZYZA 1L6YA 4YVVA 3FVMA 3I4EA 1TSIA 2YLLA 2V82A 1FWEC 3G6MA 4O1EA 5HWMA 1ZJHA 3UF9A 1YLVA 1WKYA 3V1PA 2GL5A 3UPMA 1GCYA 4AWSA 1RHCA 3B03A 1H09A 5C71A 2C0HA 2ASHA 3QW3A 1W3KA 4LCRA 1PVNA 1TUXA 5AHLA 3W4RA 3KBMA 3EX2A 3NPVA 5KSWA 1E4IA 1C29A 1XG4A 2O9PA 5FL0A 3S4TA 1RQHA 4JQ3A 4NYYA 5HAOA 3SJ3A 2HS6A 5JH1A 5F4SA 4FAMA 2WBGA 1W37A 3UZXA 4Z42C 4NZ3A 3LHUA 2JALA 2G5WA 4ZQMA 3OODA 3E74A 1A50A 1RCXB 2IQDA 3TN4A 3EOUA 2CLOA 1K9DA 4Y9MA 2OG9A 1Q6RA 3VKCA 2OQHA 2OOGA 4RXFA 1BEUA 2D1ZA 4QAIA 4JHZA 2ISWA 3XINA 3EDEA 4HK6A 3LQGA 1XGEA 2Z6JA 4ICMA 3TKFA 4AB4A 3G22A 3TN6A 1KB3A 4Y9NA 1AMYA 1TIMA 2WAGA 4RDYA 1Q4WA 4X0NA 3F5LA 5BWAA 1UR4A 1JDCA 2GQ8A 3QKZA 4U31A 3TSDA 4JY8A 4B4FA 4EAYA 1GW1A 2ZE0A 3L5LA 1WDPA 4J3UA 2FTWA 5E0KA 5A8PA 1UR3M 1FHLA 4KKXA 4QAWA 2J8TA 3OZMA 2GJXB 4DYJA 4I5UA 1N8FA 1GYMA 4GJIA 1YDNA 5CG0A 1KA9F 4G7EA 3CZEA 3SCVA 3TNBA 4C1NA 1UH2A 3LNMA 5C7VA 1ZGDA 4HB7A 3NL5A 2ZC8A 3IAQA 1GONA 3T08A 3CO8A 3BV7A 1UR9A 2PGWA 4O12A 5PTDA 1ZNNA 2DFAA 3L5MA 3JRKA 4CVWA 3E0FA 4O14A 4WUIA 3QR3A 3S1UA 6XIMA 4EPDC 3KCJA 3BQ5A 4GI6A 4CQ8A 1L9WA 2J79A 5CSRA 2ZZ1A 1Z44A 2P8BA 4AY7A 3F4DA 5E0CA 2CLMA 3V75A 1CXFA 3FSTA 2WSRA 3KWSA 4K38A 2WZEA 3ARVA 5FF7A 1RCOB 1JDEA 3COTA 3CEPA 2AKZA 3ARZA 3BZJA 4MNLA 3VDAA 1LWHA 4KEMA 4Q3MA 3IK4A 3IK2A 1E0XA 2E4TA 3N17A 4ZB2A 4DX3A 1ZRQA 1NQ6A 2VKZG 3VUSA 2W67A 5FCZA 2VZSA 3NQFA 1JYVA 4MDOA 3RCNA 3SSZA 4NZCA 3EMQA 4DWSA 1D7KA 5AC4A 4HNOA 1CBGA 2G41A 2JF7A 4WGXA 3L4UA 5K2ZA 1DQUA 3CQKA 3HG5A 3BGGA 1EPVA 1AZ1A 1RA0A 4N0RA 4O15A 4MNKA 1BTCA 1LDCA 3UGVA 2V3DA 4KFNA 2A7NA 2QIWA 2VX4A 1E6ZA 4W4QA 3SQSA 1A5LC 4EACA 3B8WA 2E5DA 3S46A 1GQIA 1MUCA 1O5XA 1IXQA 3KOFA 3G1RA 4K6AA 1I8JA 1E55A 1QNSA 3W71A 3WUEA 3KTCA 3S5ZA 3VM5A 3PC0A 1J0IA 2QJHA 1R7OA 1QVBA 5G2HA 3BW2A 4H6QA 2XG9A 1ECQA 1M5WA 4FA3A 3IACA 4AD3A 2F2HA 2KZHA 4XIAA 4Z0JA 2HVNA 4HHPA 1GOOA 4FF7A 4JTAA 1FCVA 1VFFA 1LM1A 2B7OA 3W2LA 4HPHA 4Q8MA 1OG0A 5J5DA 4AUBA 4M24A 4LH8A 3HFYA 1OIFA 1TPEA 1KM3A 3N19B 2JKPA 3PZGA 5JH2A 4PRTA 1VC4A 1AJZA 2Q8ZA 3H54A 3GAKA 3VDHA 4OBSA 1P6WA 1C8YA 5A3HA 4GFIA 1B3VA 3LTYA 4UTUA 5FACA 3IRDA 1VFLA 5EYWA 2FMOA 4I9AA 4HHHA 1A3HA 1K7XA 1MFUA 3ZT6A 5C8BB 2E0PA 3KE0A 3O3RA 3LCWA 4OOZA 3LGDA 2CLPA 2E1DA 3KBWA 5LGZA 2YKKA 1JZ8A 1HKWA 4IIHA 5D4YA 2VC5A 4LRTA 3GKFA 1VFMA 3VZYA 1DL3A 3MHGA 4B5XA 1H0GA 3FKRA 1DWIM 4FEZA 4MAZA 5TD4A 4ZQOA 2XFFA 2V2DA 2DPEA 3QN3A 3S1WA 1VD6A 4XD6A 3OBAA 1QTWA 3T42A 4ICCX 3EXSA 3LM7A 4M7TA 4AMCA 3URNA 4IHCA 3IARA 4MKVA 1RAKA 2PWDA 2YPIA 3SQLA 4PFMA 1CDGA 3PVFA 3AIVA 4MPQA 1RJQA 4JQ1A 3ABSA 3LMZA 3AZRA 4JFWA 4L9YA 4ML9A 2WMKA 1ME7A 1HIZA 3SQMA 3TCEA 5LIUX 4DZ5A 4IWWA 4AQLA 5DT7A 1JDFA 4L80A 2I5GA 4JD4A 2YL9A 1I45A 2PSNA 2WMIA 1O1ZA 1H41A 1LQ0A 3W7CA 1RD6A 1JPIA 4WEVX 3N9KA 4ZE4A 4UFKA 2WNZA 1O5QA 3E2VA 3REQA 4R9OA 1QXLA 1VGAA 3CZJA 3TV8A 3MJYA 3WMLA 1QNVA 5BMXA 2GJLA 2PB1A 2PPGA 4C60A 3OZOA 2NV2A 1VBRA 4ZA0A 1XYBA 3AIBA 7TIMA 4Q7BA 1LOLA 3USBA 2OLSA 4U10A 4ZFCA 1M41A 4JZ5A 3GQYA 2FGZA 1E73M 5FKYA 3B05A 4YTSA 2E6DA 2I17A 3C2VA 2AGKA 1EZ2A 3NOEA 5I3JA 1R3TA 3KS5A 4O10A 3S5YA 3QSRA 4C6DA 4FLQA 4UTLA 2D2OA 1Q2SA 1L6WA 4BI5A 1QK2A 3SSJA 1JVNA 3NDOA 4HTBA 1X96A 3V3WA 2NX3A 1JCTA 5DF0A 4ZSTA 3QLDA 1EUAA 4ZE5A 3W7JA 2DW7A 3SECA 1R0MA 4PUKA 2VX7A 2PTYA 1RY0A 1H1ZA 4PRRA 4MKNA 1OFBA 1VPQA 1QOQA 4DO4A 2VT0A 1P6BA 4S3BA 3VNMA 3IJ7A 3BLOA 3TDFA 2DSUA 2EPNA 1A5AA 5T9BG 3CMGA 1OWQA 3VGGA 1P7TA 3R8HA 4AEEA 3W7LA 1SQ7A 1VEOA 4WK9A 3EEZA 1VFUA 3NQ6A 1GVIA 3LXAA 3RO8A 2O4MA 2WANA 5BYWA 5AOUA 3HQOA 1UUOA 4S3JA 3L0KA 1DWGM 3MA8A 4KMQA 1A80A 1HQTA 1E4MM 2X30A 3A22A 4FZIA 1G6CA 4M7SA 1J6OA 3G3DA 4IM4A 2ISFA 4Y2WA 2ISDA 4G7EB 1ADOA 1OC5A 1FH7A 4C1NB 1ZCCA 6TAAA 1AD4A 1KBJA 5AYIA 1JZ5A 2AMXA 3AS0A 3LZ5A 4C6IA 5CJNA 1Z42A 1P0BA 5HQEA 2GGGA 1PTGA 2PDXA 5FI8A 1UKQA 4S3CA 4V2XA 1KGUA 2ZUNA 3IJ8A 3V0SA 4UOZA 1H0IA 4F9DA 5LYRA 1EYWA 2GVJA 1Z32X 3VFLA 1N2VA 2Y7FA 4HYRA 3N9SA 1RZMA 3VNLA 4HK5A 1R3VA 1DWFM 4C90A 3TLLA 3DKJA 3V5OA 5CPLA 4ZTXA 1NY1A 1WOAA 4HCHA 4D6CA 1MSSA 6REQA 2V3FA 2OMAA 2EPOA 4Q4QA 4J4KA 4FLOA 1A53A 5AKQA 3CPRA 1F3EA 3W7QA 2HVMA 3VIMA 1J0KA 5A8NA 1ODZA 3M0KA 4F2BA 1VFOA 2XZ9A 1EJVC 2C8NA 4W84A 3L7RA 4YIWA 1RH9A 3CTTA 2BHZA 1Q6QA 3P0XA 1HW6A 3TWAA 4DJFD 1LL7A 3GZAA 3OIXA 1HKIA 1OK6A 3IS4A 4GVFA 1Z69A 4QRNA 3H21A 2JGQA 4XWUA 1NWTA 2Y63A 5FD0A 2X1RA 4POCA 5FEXA 2P3ZA 3S2MA 4MUZA 4TQTA 4YJ5A 1TVLA 1H63A 3F1QA 3WDRA 1GZ1A 4QS6A 2YSWA 5K9CA 3RFAA 1E9ZB 1TMHA 4F0SA 2OYMA 3OPSA 1XLJA 1AG1O 3WEZA 3PSVA 4F40A 2ONEA 1U1JA 1C92A 3T0TA 5AHEA 1I9CB 3PG9A 1S5VA 3RAOA 1UD4A 4Z1AA 4YWSA 1V0KA 5CSSA 3BMVA 1ICQA 4I6KA 4S3DA 5JUVA 1SFLA 4LUTA 1F6YA 4PMDA 3LCHA 3FOKA 1XPYA 4JGDA 3GR4A 3WDIA 2GUYA 2JE8A 4OE7A 2FFIA 5BOFA 4GBUA 3W75A 3A9BA 1IZCA 1XLAA 2P53A 3VNZA 1GQJA 2QQ6A 2VEKA 4N9BA 1AH4A 4M5PA 1O68A 1W1IE 3GVRA 3MKCA 3CAVA 1WO2A 3SCTA 1TMQA 2HV5A 4RZBA 5D2WA 1VKFA 4NXSA 5TNVA 4RE0A 2XHYA 1Q66A 2GWNA 5G1MA 3QV9A 3IJDA 3URBA 2E6YA 2WC3A 3LCXA 1DVJA 4S39A 3S2JA 2C18A 3M9YA 3NQ7A 1G9HA 2EF9A 5HBFA 5G5IA 4WOQA 3ZZ1A 5DO8A 4AD4A 1OFDA 1Q6DA 2OODA 2A7PA 5D9PA 2HMCA 1JGIA 4DJEC 3M5YA 4I9MA 4DNHA 3KXQA 1A3XA 1IZKA 4GZJA 3FVDA 1B3OA 3M0XA 3P0WA 4NYUA 1PZ1A 1EJXC 4DI8A 5C0QA 1KGWA 1QPRA 5E09A 4MHBA 1O12A 3DH7A 1XIEA 2VURA 1MEIA 5AC5A 3G1DA 4IPLA 4E8CA 2PP3A 4XAYA 2PMQA 4IL0A 2VVNA 4X60A 1MI3A 3F4CA 3B97A 3TR2A 1RJPA 1NSJA 1IR2A 2F8QA 1GZGA 2CBUA 1EIXA 3POHA 1R3SA 3N04A 1A5KC 3GO2A 3CV2A 4E3VA 4MUPA 3VD9A 2HZGA 3C4UA 4UXDA 3VOHA 2D22A 2C13A 1JZ7A 3OP2A 3BICA 3HTWA 3R58A 3NFUA 1D8CA 3AMDA 3GTHA 3A4JA 1GTHA 4P8WA 1OZMA 3HQNA 3WNPA 3NJ3A 2BODX 2WMIB 4MB5A 2PC4A 3MMDA 1PIFA 3SIMA 2WMJA 2PDCA 3REQB 2WKJA 3NPUA 3EB3A 4F66A 2Z24A 3ENLA 2DSZA 4WX2A 2PC8A 3WO8A 2C0AA 3EWBX 3CUHA 1FH8A 1Q13A 2PWFA 3GDKA 4GC3A 3UVIA 2ZRVA 4L1WA 1LORA 3AO0A 3GAYA 3O6AA 4S3EA 3BPWA 3W01A 2XM2A 3UWQA 4LOCA 3NPWA 1E71M 5ABGA 1UROA 3W1XA 2I5IA 3P2VA 1JR1A 5I3IA 3CIWA 1XIIA 2CEQA 3S2LA 2JEPA 2QUVA 3SFKA 1PKLA 1A5CA 4Q22A 4MJ2A 1ME8A 2IQTA 2VDGA 1NH6A 5DY2A 3MSDA 2CLHA 1GJUA 3EX4A 5ABEA 3ZVIA 4FPSA 2Z4GA 2GJNA 2XM1A 3KVLA 5HWNA 3ARWA 3AHYA 1AQFA 3RCYA 3KBJA 3VAVA 4QNEA 4AC7C 1YDVA 4Q4KA 1P48A 2OT0A 4US5D 4C5YA 3BO9A 3KWXA 2X0YA 3POCA 4GO9A 1EA0A 2PEVA 4DO5A 4ERIA 3KP0A 1XDMA 1L8PA 4R9XA 4RK8A 2Z1KA 3RM8A 3AHXA 1EP1A 3BVJA 3DZ1A 3NR0A 4FNPA 4WQ6A 2O9TA 2PS2A 3T05A 3HPSA 3MUCA 1XBYA 3VX1A 3WMBA 4WKHA 3KRZA 2R1MA 3WLQA 2HPIA 2VCCA 4WGHA 2V3GA 2VFIA 4CQCA 4O0ZA 4GXWA 4O1CA 5DX7A 3RF9A 1VJZA 1E6SM 2EPLX 4M8UA 2CHOA 2J7HA 4RUBA 4JCMA 1I2NA 4G2DA 3STCA 1H7XA 4DWSD 1B57A 1E40A 1TR9A 1MXDA 2QXWA 4KBXA 2F38A 4FS9A 2AAAA 1ITCA 5CZJA 1JDDA 4HU3A 5CXPA 3H2FA 4QCFA 2TAAA 2BOEX 1M3UA 4CCCA 3RU8X 1KBBA 4MNJA 1UKTA 5XIMA 2PDWA 3L68A 4GVGA 4WXZA 3WMSA 3V0TA 4EXQA 4UMCA 1FFRA 1KXQA 1W56A 1R2RA 3GIQA 3DYPA 5IHSA 4H2HA 1QI0A 1RA5A 2IS7A 3BLFA 1RQEA 3GNDA 3QXBA 4GRSA 6REQB 5IBXC 4FB7A 3I3DA 4U28A 3AXHA 1OGGA 3B9DA 3EB2A 1JEZA 1XLIA 3GNNA 3OYZA 1OYBA 2PRHA 3LA4A 3EB4A 3ZWSA 1CGYA 3N6QA 4UQBA 1XRTA 3AAMA 3O9NA 1FKXA 4PEEA 4JOMA 1ONRA 3T6CA 3S6TA 3NO1A 3OHMB 4PL2A 1FVPA 2PBOA 3NL2A 2UY4A 4PUMA 4FMVA 1CIUA 5HNUA 2UY3A 3N2XA 3R2GA 3QV7A 5E0FA 3W7HA 2J47A 3NQAA 4AAJA 4AYSA 2QMJA 2Z1SA 3T1GA 1GVSA 1MDLA 1WZMA 3L4TA 3MP4A 4CGTA 5CC5A 2H6RA 3BURA 1KGXA 3W6LA 1WKDA 5EL1A 2YBVA 4H8UA 3RITA 4H8NA 1W17A 2AQVA 4F0MA 3HPZA 3A13A 1EQCA 4PMXA 4C6PA 4QJ3B 4FI4A 1E9YB 2XVKA 3R11A 2CERA 3G0SA 2YYTA 3CH9A 5FOOA 2QDGA 1RBOB 3MO7A 4HZ7A 3BE7A 4Y6GA 4DHGA 1WKFA 3GK0A 2XN2A 2QCLA 4UR7A 1HKKA 4IGHA 2GLKA 1D3GA 1IWAA 1PYMA 1QRQA 1UB3A 2VX5A 4DWDA 3BK0A 4LUTB 1PZ3A 4V33A 1R9YA 1YBQA 3DHUA 4HSNA 3QGAC 4QHRA 3B8UA 4C1LA 3EWZA 3WLIA 1Y65A 4EAMA 2OR2A 3GHTA 2ABAA 3KDNA 4LF1A 4JEJA 5H8MA 1YMYA 3L4YA 4DJDC 1KBLA 1N55A 1M7JA 4LGXA 3VYLA 2ZIDA 1W2VA 1K8YA 2X16A 1SVDA 5CPQA 4KF1A 4IGNA 4AX6A 4DAFA 2DSWA 1BYCA 3EOLA 3DFNA 3VNKA 2RKXA 3E9AA 5AVNA 3GXFA 3IGUA 1C91A 3E1F1 1YDOA 3ELFA 5A5WA 5KZMA 3K2GA 5A6LA 1OF6A 1Q6CA 4RX0A 1BKSA 2J7FA 3NGFA 3AFBA 1SW0A 3GU9A 4NJKA 5HR7A 2E67A 3DFSA 3VIOA 2FPVA 2BGNE 2CKRA 3NVTA 2OPJA 2VRJA 8TIMA 4WZHA 3MUIA 1ECEA 4ZFMA 1J0YA 3RDKA 1UR2A 5G4WA 3O16A 1EX1A 1I1XA 1BD0A 2QEZA 4LVFA 3EWYA 1A5OC 4Y9OA 1OFRA 3TE9A 3SRHA 2FIQA 3UYCA 2UY2A 1H7PA 1W3HA 3O6DA 1KWKA 4L4MA 3GH5A 3VX0A 4FR1A 2VP8A 3QHOA 3FK4A 4IPPA 3LBCA 8CGTA 4S3FA 4UOJA 2V2HA 2OWXA 1FDYA 3VOCA 1ME9A 2GDUA 3LPGA 4TVCA 7CGTA 1WPCA 4F2UA 3KS6A 3NGJA 3PULA 2HE8A 5HPOA 3TQVA 4H7ZA 3RU6A 2YR1A 4KH2A 2G96A 5C9WA 4Z1DA 5T26A 1KFCA 4LS1A 4F0LA 4OIFA 2DVTA 3CUXA 2J77A 4KCTA 2PDMA 4LV4A 1DE5A 4Z2KA 1PDZA 4C6FA 6A3HA 3NO3A 4GXMA 3W2JA 4DBEA 4J3SA 2QAFA 3ISIX 4C6LA 1A5NC 1DE6A 3RLGA 4J7RA 5CKSA 4R27A 5HA7A 2IMRA 4XUGA 1K77A 4UTIA 2FGBA 2P76A 2FPYA 4CN4A 2H90A 3ZR4A 3GTXA 3SAZA 4UUIA 4REQA 3GNPA 1YE4A 3P3BA 1WNOA 2VL4A 3W87A 5T9CE 1TQJA 1P0KA 1EJWC 2Z26A 1NEYA 1NQKA 2J7BA 1KM5A 3FIGA 2XFRA 3WG6A 3AMGA 1PX8A 4YXGA 2BMBA 4OECA 3PF3A 5KZ6A 2WZHA 4GWEA 4C6BA 4GQGA 2QCDB 1RD5A 3EOEA 5DRIA 4I5XA 3SCRA 3B9OA 3FEQA 1GOXA 3W6YA 2J27A 3TN5A 2QUNA 4ZSUA 3N73A 4P7NA 4NVTA 4N9EA 1BSIA 1YADA 2BVYA 3IGSA 5IBXA 2E8YA 3HV8A 2VZTA 2ZDSA 3QC3A 4B9YA 1NDWA 4BJHA 3DYMA 2BY0A 3E0WA 4XO7A 5FF0A 3M64A 1JCLA 2WK2A 2QULA 1JRCA 1I2PA 3MZ2A 5FSEC 1TCDA 3FYYA 3KDOA 1TVPA 2GQ9A 1UHVA 1QWGA 2PP1A 3CHCA 1GPWA 1CXLA 4FLSA 5D2TA 3C0LA 4QSFA 2CZVA 1WE5A 2ZX5A 2ZZ3A 4ML4A 4DN1A 1DIOA 1MEHA 2JIWA 1FOBA 2W61A 5F2GA 2WOQA 4XTIA 3THQA 1EEXA 3W7KA 1T6MA 3BOFA 1FWSA 4A3RA 4M1RA 4M1BA 3UP8A 2RDWA 1Y5XA 1V02E 4QE5A 1Y7VA 1HGWA 1BPLB 1MEWA 1KV5A 4U5IA 3CHEA 4D1JA 2DZAA 1J0ZA 2WHMA 1IEVA 3G5EA 1SSDA 5A8GA 4H1ZA 3MUY1 3IJIA 4HCLA 3WBWA 2V68A 3BJFA 4MWAD 3UCDA 5K9XA 1RLDA 1IHIA 3A3XA 2CIPA 1YNPA 1AMKA 3T2OA 1BXBA 2UV8G 4GGBA 3LQLA 3UVAA 3TCSA 2IQ0A 2VFGA 1TPFA 4RL3A 4GIYA 3GG8A 3C2RA 4XVEA 4C6EA 2A6NA 5D2YA 1CB2A 3R0DA 2BY3A 3CV1A 3H7RA 3CV7A 3AUJA 4IICA 4AHPA 5C2GA 2BX7A 2VRKA 3G8RA 3QF0A 2D3NA 3BAXA 4H8HA 3FJ6A 1F5ZA 1C9WA 3SCNA 1A5SA 5EBAA 3K4AA 3IANA 5IHRA 2VELA 3XISA 3QV8A 1GQKA 2IPJA 3G1FA 4WCJA 3QQ0A 4JIQA 4D6JA 3VD3A 1T41A 3E02A 4Q7NA 3HFTA 3I6RA 1HL8A 1E9LA 4WDUA 1ZP3A 4O19A 1QATA 3P82A 1V0NA 1QHPA 2ZRWA 3H4GA 3GUWA 3TU9A 4W86A 4QGCA 4JHMA 4J3TA 1C7TA 5SWUA 3VINA 1ISXA 1R6WA 4QFUA 2HJPA 4DZAA 4I90A 3FHQA 4HU8A 3PFRA 4Q8WA 4L61A 3UZYA 1SO6A 2NQLA 3NQCA 3R8GA 4OOUA 2QLYA 3C2OA 1HO1A 4BF9A 1QBAA 4EF9A 1E5NA 2FB3A 1D2KA 3RUBL 3SO7A 3W2MA 1PO9A 2R6OA 3NEHA 4Q33A 1PTAA 1ML1A 1NJJA 3PBYA 2YFNA 4NL1A 1OCNA 1D3CA 4ADUA 1W9UA 3DFOA 4C6CA 1LLZA 3GC4A 1YBQB 3BV4A 4M3PA 3AJXA 2OCZA 1J6PA 1W1ZA 4AY1A 2ANUA 3GG7A 3QY8A 1R3YA 3T44A 1NFGA 2ZXDA 2XSBA 3TJ4A 4H9YA 5EPDA 2JQXA 3RILA 3TMLA 1QUMA 3AS3A 5HMEA 1SMDA 3UJFA 1FP9A 1BYBA 2O55A 2DUXA 3SGUA 4PB3A 2PD5A 1XIBA 3UXIA 3FJ4A 5BXPA 3H12A 1HP4A 5CLTA 4YMZA 3SY1A 3B8SA 4IL2A 4HOWA 2QUTA 1KW1A 4ZQNA 4B2DD 3TQKA 4XBJA 4N9CA 4GIRA 2ACSA 1WB0A 3MTWA 3ZQ9A 1KO0A 3F2BA 5JXQA 1QNPA 2WZTA 2GSEA 4ZOAA 1FWHC 1TPWA 5AVHA 3VKBA 2PAJA 2YZ5A 1TRIA 1NAL1 3GHUA 1MMFA 4FNRA 2OKOA 5ABHA 4OT7A 4V1XA 4G8TA 1FWDC 5AZ1A 1THFD 3GXTA 3ZOAA 1U5HA 3IRSA 5M17A 4E4UA 4K7YA 2HE5A 3EMZA 3HGRA 1FWTA 2WSKA 1XYFA 1W9XA 4JN7A 3EKZA 1EHAA 3JUGA 1ZFJA 1J0JA 3S5OA 3VIHA 2QNEA 2D3LA 2D0GA 3T0BA 4FXSA 3W29A 4AZ6A 2I5QA 1Y5WA 5C2XA 4LVGA 1JNEA 1MO0A 2ON3A 3GTNA 3LNPA 3M1ZA 4B5VA 3E2QA 3PTKA 3WKZA 4Y7EA 1E1CB 3WLKX 4IQDA 4NX5A 3V36A 3FAXA 3P62A 1QO2A 4LC6A 4TO8A 1XS2A 4JFVA 4Q8QA 3FA5A 4Q8TA 4F9JA 3K13A 2IUZA 4QX4A 3FYPA 1CT5A 1FFQA 4REQB 3LS9A 2VEIA 3SZ8A 1A0EA 1VPXA 2JBMA 3HQ1A 1XIJA 5FJUA 4NZ4A 4WLCA 3JU2A 3RM4A 1VJIA 2C79A 1QBBA 1PPIA 3BSMA 3ITCA 4QM1A 4QP0A 2H8XA 3EWCA 4ALDA 2WO5A 1LWJA 1QFEA 3F03K 3WJSA 4CNNA 4KETA 2REQA 4LYPA 3UXLA 2E6FA 1JXJA 2J8GA 3ABQA 4GCXA 2FLIA 1PZ0A 5HOSA 4MYXA 3IJ9A 1PKMA 2VZVA 1ODUA 1IEQA 4NJIA 3SCPA 2C15A 5CG7A 2WNNA 3DX5A 3XIMA 2V5LA 3M7WA 2VC6A 3O63A 3GFYA 2UBPC 3SDOA 1K6AA 5EA9A 4GYJA 2J6XA 3TUUA 1TTIA 3VGEA 1JULA 1ENUA 1FWJC 1ZBCA 3ARPA 1JCJA 4ZXLA 2BOGX 4AXNA 4BI6A 1KNWA 2FVLA 5A69A 4DLMA 2V9DA 1LRQA 2DZXA 3B06A 1TX0A 4O18A 1BFNA 3UZWA 2DJLA 1CLVA 2VRQA 3AZTA 3OHIA 3IIVA 1U5JA 2BXZA 4XZNX 2ALRA 1WDRA 3AMLA 1QW9A 1W5PA 1DORA 5IFPA 1K9TA 3OZYA 5CZKA 1D7FA 2PWHA 1OX4A 3VE9A 3PZIA 2Y70A 3FYOA 2F6KA 5A6TC 3BOLA 3I6TA 4L7ZA 4DUWA 5U4NA 1V6YA 3PUOA 1V51A 4DO7A 4CQ9A 1CXHA 1S2CA 4UTJA 1YEYA 4AHQA 1CCWB 3MKKA 5HANA 4XD3A 2Y2WA 4IQEA 3GHRA 1VHCA 3W9ZA 1EIBA 3M7SA 3FW6A 4LB4A 3EX6A 1XIDA 4F0HA 2DT0A 1QI5A 1IEIA 1H61A 1ZQ5A 4PFHA 2PD9A 4H9TA 1WOBA 4PBGA 3VNYA 4UBPC 3E12A 4B3LA 3CUZA 2QJIA 2PUZA 2IPWA 3VZZA 1X8FA 3KZPA 1OD0A 3PJUA 3A5FA 4OV4A 3P8IA 5EMLA 3SCQA 1TUFA 2FJKA 3VMOA 4ORMA 3AROA 1ICPA 4LNCA 2YL6A 4DPPA 2XGBA 1JZ4A 1R3WA 2BFGA 2C1HA 4IGSA 3T2PA 3M5XA 1QHOA 3WSUA 3KHJA 2OZ8A 3M0JA 3N29A 4LC8A 4B3ZA 3KOWA 2GSJA 1TPB1 3A4WA 3TYCA 1FDZA 1UP3A 1UYQA 2CXGA 1XYCA 2WBKA 3UG8A 1XLKA 1UWAA 4ZQRA 5M1TA 3UR8A 3L5AA 4TMCA 3HPAA 4O4WA 2Q09A 1FY6A 1MQRA 2VOTA 3S2NA 4HMCA 1DV7A 1UG6A 1SGJA 1X7IA 1W5NA 2DT3A 1O66A 1T5AA 3AIEA 4KCUA 1HO4A 1JD7A 4K8EA 4FX6M 1RUSA 2E8ZA 2ZZ2A 1JD9A 3AZSA 1UQYA 4MYAA 3A24A 3LI1A 2OB3A 3H6OA 3WLLA 1GTEA 1E3ZA 3PPCA 4Q4MA 1A4LA 3UU0A 1YTEA 5FJIA 2PU1A 5F7UA 4QEHA 5A6BD 2E40A 4MFEA 3OEXA 3TA9A 2IW0A 4LXFA 4DLFA 4ZR8A 4HJFA 2PDQA 3BOXA 1A5MC 4NASA 5G1TA 2R14A 3GC5A 5I03A 5AZ0A 3SI9A 3U8GA 1GOIA 3UJ2A 1F2JA 2ZWZA 3LLFA 1H5YA 5FF3A 3B3DA 5AYXA 1TG7A 1BTMA 3NDYA 4PTWA 2D2GA 3HB9A 1W3TA 4JBRA 4D6IA 3QOMA 2YDQA 4JR5A 2QGHA 4HP5A 5FA5A 1US0A 3WQ5A 4MZ8A 1J9YA 4PH6A 2YB1A 3BARA 3UFYA 4HHLA 4B15A 4TXEA 4BR1A 3UA4A 3H2CA 2W4XA 3K4DA 4JIIX 4Y8FA 4QR6A 4H01A 1ZJIA 4J1OA 4XBKA 4CU7A 5HATA 5MHBA 3S8HA 1EZWA 3I4KA 1IE7C 3QTGA 1XLEA 2ACQA 3G77A 2WYSA 3INPA 1DPMA 2W92A 1T96A 3GG1A 4B16A 1WUEA 4NX0A 3WH8A 3OW1A 4DAIA 3WDJA 3EZ4A 2ZE3A 2EHHA 4O54A 3G3MA 2FGLA 1TFVA 1VF8A 1W5OA 5AYBA 2D73A 4L5ZA 4D72A 1ISYA 1PZ2A 1EOMA 2BSLA 2XFYA 4XVDA 3WD4A 3I68A 4HU0A 1OT2A 2ZA1A 2W62A 3UNDA 2ZZ5A 1XX1A 2PTZA 3BTNA 5AYYA 1JYNA 3CHVA 3AI0A 1L6GA 2XH7A 1WZKA 1ZAIA 1LRTA 3L67A 2XVNA 1PEZA 3P8JA 3WJWA 1OCQA 7ODCA 3VIJA 3B8DA 3WLSA 2EGZA 2AMGA 4I3GA 2R1LA 5BXSA 2WQPA 5D9OA 4X22A 3N3TA 4ZO9A 4U2ZA 4C1KA 3CL6A 3H7VA 1EF2A 2QF8A 5JBEA 5A2AA 1V79A 2NWSA 3WK1A 4PC8A 3HPFA 2VI0A 3OG2A 3SUUA 2WM0A 5HR6A 2DZVA 3WNOA 3QLLA 4BZYA 4NY2A 1EYEA 1RPXA 2XGZA 3I7QA 4XKMA 1TYGA 3GLCA 1EDGA 3B4YA 3L23A 1YTKA 1JPDX 1JF5A 3H4XA 1N7KA 4NAFA 3UWWA 4LPCA 5DCDA 3LHVA 3FJLA 2FHCA 1V6TA 4LVAA 4RE4A 3EA1A 4ZO6A 5FEZA 1PWMA 4B92A 4MNMA 2GDVA 2HS8A 4GX9A 4YCOA 3WIJA 3WH6A 1DP0A 4NHVA 1AQ0A 3AYRA 3RHGA 3TMQA 2C71A 4DVOA 3LUTA 4P8UA 1BF6A 1OG6A 2QJNA 3PNUA 1W54A 3ANUA 5HNTA 3I7SA 4MLRA 1MW3A 2REQB 4F2TA 4FHAA 3W1NA 2VYOA 4HCDA 3W7MA 2WHJA 2PFHA 3BCDA 1Q65A 2A3BA 1PSCA 3B9NA 2HSAA 2Y8UA 5HUPA 1YX1A 4J28A 3NPXA 1LL6A 3MSYA 3GNXA 6ALDA 5EFFA 1ALDA 4KWUA 2NT1A 3ABZA 1E5JA 3EKLA 2YL5A 1H1YA 3MCMA 3ZT5A 1DWAM 3K4WA 2A1YA 2VENA 2NQ9A 3KBVA 2FZ8A 4FF5A 1MXGA 1W0MA 5H8PA 2ZX7A 4Y9PA 1V3KA 3QZAA 3A3WA 1VBHA 2Z6IA 4MZYA 3DKLA 3ZJKA 1M65A 4UFJA 3KFTA 3FAWA 4IP7A 3KVMA 1XJBA 2YDAA 2VEFA 4B9ZA 4XSLA 4BF7A 5BCAA 4XO6A 5CC7A 1HVXA 4QTGA 3GFXA 3CYJA 2XISA 4ZBCA 3UR5A 1KXHA 3KAOA 3JZEA 1TO3A 1A3WA 1UZ1A 5EY5A 4NI8A 1RY8A 3LBOA 4WDWA 4WOZA 3WQ4A 1TKKA 4GQRA 4F0KA 4LNYA 3UCQA 3NAVA 4O53A 3M6YA 1KM2A 5FJRA 4DO6A 1U5VA 1VEMA 3SUVA 2Z1VA 4HQVA 1AFSA 3U3HA 2D24A 3WELA 3F2CA 3ZVHA 2RJHA 4C65A 4QLKA 4JFTA 2W79A 3QOKA 1PTDA 1BVNP 2BTMA 1KFWA 4ZTYA 5C5YA 4NIRA 1GJWA 1QU4A 5AB3A 3UA3A 3HM7A 1ONXA 1R3RA 4AHOA 1BWKA 2QVNA 1H60A 5BRQA 1VBGA 2UY5A 4GNKB 2JFEX 2V3EA 4H8VA 5EMKA 1XICA 2FHFA 3PPGA 1Q7MA 3CB3A 4TVUA 2HNHA 4I7VA 3U5YA 3OOQA 1NDVA 3APYA 3AXXA 1QI2A 4JTDA 3P80A 3KL0A 1BRLA 3GUGA 1XISA 4L1GA 1LP6A 3M5ZA 3ATZA 1YE6A 4HPGA 5D37A 3UGRA 3H23A 4ES4A 3VOIA 4YTRA 4JX4A 2JKEA 4PUJA 4QISA 5HQLA 4NAEA 3CZGA 1WUFA 3H22A 4PRWA 3W2UA 4AZCB 4GZ7A 3OYXA 3U9IA 3L4WA 4Q8UA 2XFWA 1GYLA 3LRLA 2EG6A 1XXXA 3B40A 4Q6XA 3UR2A 5I3FA 3UBPC 5H1WA 1MYRA 1UBPC 1TPUA 4L4PA 4UTTA 3EMCA 3EAUA 1SPQA 1FWRA 1J5SA 3PTQA 1TWIA 3DAQA 3M44A 3PHAA 7TAAA 1Q6GA 3IAPA 4H9XA 3DFYA 4NJJA 2XIIA 3A4AA 5C9ZA 1LBMA 4RLIA 1A49A 3NQBA 3AYSA 3AXIA 1OFPA 1X8CA 2Q6ZA 3RXZA 3PPFA 1PIGA 3GVQA 4GUIA 3PWIA 1G4EA 1UPPA 2BNJA 2BHYA 4YTQA 4DXXA 1M53A 3AIUA 1R47A 3O07A 3U7BA 3O2LA 4MZ1A 1JF6A 4MMWA 4KEUA 2VFEA 3CUGA 4H19A 1DHPA 4GJJA 1CNVA 4CN1A 2PLCA 3AC0A 4F3HA 1GHRA 2PLJA 2CPUA 2ATMA 5CGMA 1GJPA 5FAJA 3OLDA 1Z89A 4H3DA 4LWWA 1VFSA 2F7FA 2DJXA 4P7LA 2WVVA 3B8IA 4JCLA 4BF5A 4R3UA 1EC8A 3WDPP 4B90A 3OGVA 3K8KA 4GVIA 1W8SA 3IIOA 3MI3A 2X2YA 3UWVA 4OUEA 2AAMA 1UZDA 2ZRZA 5D9NA 3G1XA 3OVGA 1V0MA 4KT2A 1TA3A 5D03A 3H2AA 4AIEA 1W1PA 2VC7A 1JG9A 1XL9A 4KEZA 1UZ4A 2FKPA 4PSPA 2DUAA 1RK5A 5CPMA 1SO4A 2V5DA 1O94A 3CLWA 2HK1A 3CM4A 4JY9A 2BBFA 1VBJA 4MKSA 3OVRA 7ENLA 3QKEA 5IOBA 3CQJA 1W5MA 4CD8A 5CPTA 1BG9A 2CZEA 1AUSL 4YLWA 4UZSA 1NDYA 3HQPA 3W1AA 1CGUA 4L6OA 3GYCA 3BG9A 1NP2A 2ESCA 4BEQA 1XIGA 4DJFA 4AZ5A 1ZSXA 1KM1A 4RZ4A 5CQ1A 1DIEA 4AISA 3AU2A 1W1TA 4UFMA 1JIBA 3APTA 3DFPA 4J3ZA 1LUCA 2J4GA 3CUFA 3QFEA 4HGXA 5KITA 1JUKA 2AL2A 2VUYA 1NFBA 1PHQA 1WBHA 3HO8A 1GVYA 2C91A 1UKSA 4CU8A 3DOPA 1CLKA 2NQZA 4OBRA 9CGTA 2GFTA 4RW3A 2NV9A 3HIJA 1TJ0A 4L9ZA 5FEWA 3C5QA 3SURA 3HU7A 3BL3A 2ICSA 3DFQA 3IIZA 5F4XA 3H26A 4GC4A 3PBVA 4MY8A 3LPFA 4DWSC 3SRKA 2I1OA 4AU0A 4XKYA 2QCMA 3GVVA 1H50A 3PR2A 2Z7GA 4CNTA 2X0HA 4I9JA 3VCNA 1F74A 2CC0A 3GC2A 3BLDA 4Q8NA 3PPHA 3O06A 5D02A 4NU7A 4PMJA 3MDUA 2I56A 3GXPA 4QJ5B 3EDKA 4MAVA 2BY1A 4E0CA 1VIWA 4YWIA 4DRSA 1FWCC 4HT3A 1H7OA 5DMLA 2B7PA 4PCNA 4NAFB 1MXSA 2WJDA 1U2YA 1XIFA 1PXGA 1HGYA 3T55A 4B5WA 1FWFC 4LAZA 1BVWA 1PWLA 1JCXA 1ADDA 3GNOA 1LLOA 2BY2A 2A6LA 2QV4A 3D3AA 3W1PA 4E2DA 3H24A 3U5UA 3W86A 3C2YA 1TWWA 3LI0A 2DU2A 3O6CA 1IXPA 3CQHA 4OVXA 3S42A 2OOFA 3M6DA 3SCOA 1S2VA 1E6NA 1NFPA 1WAWA 3PBMA 5D30A 1WX0A 1TVNA 2GOUA 1BXNA 4ATWA 3W88A 3M16A 2I14A 5MF5A 1I0DA 1TV8A 5CPOA 1ITQA 2FDSA 1VFHA 3GU2A 3M0ZA 3RPTA 1H7RA 3WEOA 5TAOA 3FDKA 2B31A 3DBPA 1XIMA 2Y7GA 1H5VA 3R5EA 2DZBA 4FXJA 4DUVA 4NXKA 3W2NA 2G37A 5DMYA 1UOZA 1DQWA 1EXBA 2FZBA 1YXYA 1EXPA 2CLEA 2WKLA 4QNWA 4EWND 2ZFAA 4PMRA 3HA1A 5I7GA 2EXOA 3MVIA 3QMRA 1PL9A 4R88A 5BU6A 3C3NA 1HX0A 4PODA 3GIYA 5I23A 3PM6A 4LAOA 1GEQA 2XIQA 2OX4A 2A3LA 4A05A 1WZLA 2JKAA 5G4HC 1JQVA 1VZWA 3U57A 2WV8A 3NA8A 1XDJA 2FZ9A 4JTFA 4Z08A 1K9FA 1U30A 2PF0A 3MSGA 4I8YA 4H7VA 5I24A 1UMYA 3APGA 4FOKA 1SMAA 1T40A 3G18A 5K3VA 2W3ZA 4LRSA 2CWXA 5LNRA 1R9XA 2Y88A 2XH0A 1K70A 4ADSA 3E0VA 5L6UA 4LEQA 3VDGA 3HOJA 2A3HA 3ZVHB 2VWSA 5I77A 3BUVA 4E6MA 5H8UA 2E5BA 1VIZA 3T4WA 2X1SA 4TR9A 4HU4A 3EPNA 1DXEA 2QV5A 1RLCL 2O0TA 4U5KA 3R1ZA 2PWVA 3DGRA 1E1FA 4NQ1A 6CGTA 3M0VA 5A2BA 3R79A 6PTDA 4LBUA 4Z1YA 4FALA 1JPKA 1I2QA 1AH3A 2DP3A 1FBAA 2C7FA 3RJXA 4H9MA 4WDXA 1PAMA 4MADA 2CZ5A 4UB9A 2V2CA 5AC8A 3P5ZA 3OTRA 1RSCA 3L4ZA 4LSBA 4FXFA 1EJUC 1XHGA 3QC0A 2Y8VA 2L5HA 4XZIA 3R94A 1F3TA 3W7IA 1GGOA 3L4VA 3CH0A 1XI3A 2ABBA 2OZ3A 1IT7A 2PWEA 2G3FA 4YS1A 4CQAA 4FX7A 4Z2GA 1UWSA 4W7VA 5KINA 4NAEB 2CYGA 3Q45A 3HJZA 4G1KA 2Y61A 1IIHA 3TOPA 2WJZA 3N9RA 5J04A 1IQ8A 5D09A 4KW2A 4H00A 1ZUAX 4JNZA 2WWDA 3E2SA 4US5A 4PMVA 1XSIA 4IPNB 3EDJA 4CKQA 1GOMA 3RPMA 2XSXA 4RXGA 3C2EA 4PSRA 3C8NA 2V0TA 1SSGA 4GQBA 1Q6EA 3JVAA 3R12A 5E93A 3GDBA 3P7YA 4LYRA 2PDBA 2CLIA 3L2IA 3SRDA 1V3JA 4ICNA 1VLIA 2H8ZA 2NW0A 3DENA 1EHNA 1K3UA 1W91A 2H9AB 3UWUA 5ENLA 3B9AA 4QG9A 4IMEA 2E9BA 2D23A 1HFBA 3WF4A 3IGXA 4AWEA 1BF2A 3SM0A 3T0DA 4C6OA 1MNSA 2YCJA 1CPUA 4Q4SA 1V7AA 4XQ6A 1V02A 2IXVA 3FGCA 2XWEA 1Q45A 4BA0A 4YYFA 2Y62A 2FH8A 4DI9A 1RP9A 2WVVB 1X98A 3GM8A 4ERAA 1TELA 3QMSA 5LHFA 2QS8A 5C9RA 1PBGA 3ZR5A 3ZIZA 1Z7AA 2GWGA 1B31A 5A6MA 4W8AA 4O50A 1TA3B 4G6CA 3WQPA 2NQ5A 1P5BA 2DZSA 3MS8A 1T0OA 1XBVA 5LNSA 2Y6ZA 2NWRA 3IUIA 3G1SA 4Z2JA 3EOSA 2CETA 4UQEA 4J5NA 3WH5A 3W24A 3V1HA 2A3CA 1RV8A 1W9VA 1O95A 3UWYA 4HYWA 1GWJA 1OBAA 4RZ5A 4JIPA 3LHYA 5FAGA 3BAYA 5GJNA 2NX9A 4JFSA 4QROA 1J2BA 4NRSA 4HK7A 5D38A 1QK0A 2X1IA 1F76A 4GUFA 1S5TA 4ASTA 3TXZA 2FZDA 4GZEA 2WWCA 4N7QA 3K8MA 5D32A 2OO0A 2QYGA 1FWBC 1LUCB 4IGMA 4BQ4A 3C0SA 1KXTA 4OBTA 3LU2A 3WNKA 5LA2A 2AL2B 3PG8A 3NIYA 4HPJA 1GKRA 3OG3A 1GYNA 1E6RA 4NZJA 1EGZA 4A4AA 3A64A 3CWHA 4K39A 4AEOA 3KW3A 5BMWA 2F2KA 4IP5A 3S3GA 4GZIA 4GNJA 3VNDA 4W89A 3G1HA 4AWTA 2Z2AA 2E7FA 3WD2A 2J7CA 1TJPA 1Z6KA 3W73A 4EX4A 5G2WA 4XKYB 5DXYA 1J01A 1FCUA 4DBUA 4KIRA 3VO0A 4MWAC 1EDTA 4JL1A 4QS5A 3PUGA 3MWCA 4J3XA 3P84A 2R94A 4LFYA 4UTWA 4GYPA 3TAOA 4Q32A 3OU8A 5F1VA 1WXJA 4GIEA 3GTFA 4P7QA 1VBUA 3P74A 1UR0A 1SZRA 1GOQA 5EKYA 1CGVA 4K1WA 4M6UA 3MCOA 1O5RA 4J2PA 4DY1A 4P7OA 2VR4A 2VR2A 3L2MA 1C8QA 4O0KA 4JYFA 2DQXA 4IXHA 3PANA 1NU5A 4D8AA 4P5UA 2YDRA 4LY4A 4DQWA 2HTMA 4NZFA 3AALA 3V0UA 1O6IA 1W1B1 5H2ZA 3WF1A 3MY9A 2HWGA 1C8VA 2HVOA 3OBEA 3PWGA 3ZO9A 4NJHA 3MSRA 4LAMA 5U7SA 3W7EA 4HN4A 1YHTA 2V5CA 3EX1A 3BSHA 1B4EA 3ES8A 4QLJA 5TBOA 4WY0A 5D8ZA 3A3HA 3RJYA 4E4PA 3WDQA 3QJAA 1AVAA 4CNSA 5REQA 1KM6A 2VFFA 1KFEA 3P14A 1CZ1A 3SCSA 3M43A 8A3HA 2HCVA 3O6YX 4LANA 3NZPA 1E56A 4HN8A 1EGVA 4V15A 2YXOA 3UT0A 2ZA3A 1SFJA 1DJGA 1YW1A 4KGJA 3RM9A 2QW5A 1K4GA 3WNLA 2IPFA 5A8QA 2AOSA 1PE1A 5HWJA 4AY8A 2AKMA 4E2VA 3HPXA 1E70M 4LYQA 3DI1A 5IXEA 3H4WA 1UD5A 2OZ0A 2NXIA 1G4PA 1GVEA 2F6XA 2Q01A 5HMSA 1JPMA 2QDDA 1GORA 4W8BA 3GZ3A 2VOMA 1MW0A 5DRCA 3KEHA 3BAJA 2ZUSA 2WNQA 2X40A 3EPOA 5RUBA 3VGBA 2WVSA 1AW1A 1OC6A 3VD4A 4RV3A 5K4ZA 1IR1A 5I78A 2WPGA 3DU0A 1XLHA 3AWNA 3BG3A 3W76A 4AIOA 3WLNA 7PTDA 3WLRA 5JIPA 4D6EA 1XC6A 4OKDA 1UH3A 1VRDA 4PZVA 3UQNA 3MP3A 1QPOA 1P0DA 3W26A 1Q6OA 4J40A 4QE4A 3V7PA 3RMEA 1VAHA 4UC5A 2PTDA 1G1YA 1T7LA 4X9YA 2D0FA 1DOSA 4LYKA 1ZLPA 1HJSA 2W6RA 1F07A 4IH3A 4L6HA 2ZUWA 4NNBA 2DSVA 3T7VA 5D9MA 3TYEA 3CC1A 4DEFA 3FA4A 3PZOA 2YIHA 4LAKA 1OFAA 3EX3A 4PMYA 1FXQA 1UW9A 4OU1A 1DWHM 1QOXA 4OV9A 3ITTA 3TWBA 2ZKMX 1EJTC 4B5UA 1XP3A 2TPSA 3GTIA 4LUIA 2DZUA 2V38A 3LPOA 2R9RA 4IMDA 2Y5JA 4IG2A 1Q4NX 1EP2A 4EOUA 4AX7A 3KOZA 3CTLA 1YPIA 3PP7A 3OA5A 4I5RA 7A3HA 4PEKA 1MFVA 4MM1A 1G4SA 5DN1A 4E8DA 1NVMA 2VCBA 3N2MA 2VVSA 4X9SA 5CLWA 2JF6A 2VDIA 4MSSA 1OVDA 4TV5A 4ZZ9A 1XQLA 2ZOXA 5CPSA 1DJIA 3WFLA 3IEBA 1X38A 4GI8A 3SN4A 1H7NA 2P88A 1HJXA 1IEWA 2XTKA 3OVPA 1WDQA 4HMEA 4YYCA 1OFEA 4H04A 4WVXA 3JR2A 4A8LA 2EBNA 4ECLA 3KBNA 4B5SA 5XINA 1QDSA 3FNDA 1UD3A 3NO5A 2OSWA 3S2CA 2J62A 5AHNA 1XLDA 1WDDA 2XIOA 2QKFA 3WUFA 4JDYA 3QPEA 2VEGA 3TC3A 5FESA 2NUYA 1H2JA 1P0NA 2OELA 3AICA 4JTTA 4XZWA 4AYGA 1L2UA 1PS9A 3N2TA 4JHOA 3SUSA 1K8ZA 1YPFA 1BXCA 4A21A 4YVPA 1NWUA 3T0AA 3WQVA 1UA3A 2EO7A 4WKAA 3MMTA 3AWOA 3EA3A 3T4CA 2EPHA 3ITVA 4DWSB 3KVJA 1JZ3A 3WX7A 1O7AA 3FGCB 3HJEA 1HJQA 1ZCOA 1QASA 3T40A 3GU1A 3QGKC 4FNTA 4MWAA 3V4BA 3NSNA 4LB3A 1RXOB 5ABFA 4ZOBA 4CEUC 5DQPA 4W93A 3RCMA 4H6RA 3DFHA 1Q8AA 2X41A 1DIKA 3NM1A 1OF8A 5EMYA 1KRBC 1QW8A 1I75A 1XFCA 5E70A 1UUMA 2CCRA 3TC6A 2VR5A 3KOYA 3P67A 4LVBA 1V93A 2IPGA 2Y7EA 1WQ5A 4JTGA 5A6JA 3VDBA 3PBWA 2J75A 3N12A 1CENA 1W9DM 3BXWA 4PCPA 3CQIA 1RBLA 1Y0EA 4L56A 2ZRUA 4IMGA 4MGGA 3MP5A 4IIDA 3CUJA 4R7OA 3UWZA 1M7PA 4K1GA 4YTTA 1LJYA 1UASA 3S83A 2ISSA 1F8IA 1PX3A 2NX1A 1HJWA 4GMEA 3O0KA 4KRUA 4IT1A 1BQCA 1LTDA 5DFAA 1QAPA 2WHKA 3PB2A 3SR7A 4AZHA 1E51A 4RCXA 2CBVA 1R9ZA 1MWOA 3UNTA 4R7WA 2QMKA 2WCGA 1GZJA 2UWFA 1DJHA 2XH4A 3FLUA 3C3UA 3KRBA 1Q85A 3QQ1A 4GCAA 2O56A 4Q8PA 3AISA 2GGEA 1PCWA 4C6JA 1RK6A 4LW7A 1RPKA 1PIIA 1UR1A 3TLQA 3WFZA 3AIRA 4RR4A 1PX4A 4OHQA 3F5JA 3HF3A 4KWWA 1S39A 1ZL1A 4C6MA 1NOWA 3MC5A 3FA3A 3A9IA 1Z3NA 1Y8BA 4O28A 5F2IA 1NF0A 5CZSA 4H83A 3O7UA 1CXIA 4TV6A 2GVYA 2H3BA 3AXKA 4Q8OA 3L66A 3H8AA 3EYPA 3BW4A 4MVAA 3FHAA 3GHSA 2POZA 4AMAA 4KESA 3THUA 4DBSA 1GW9A 2ZXBA 3C0JA 1ELSA 4PCFA 4M0XA 4HNCA 1SM9A 1X1NA 3N11A 3B0XA 1UCWA 1PV8A 3I10A 1MQQA 4RV8A 1CTNA 3DC8A 3MMWA 2I9EA 4Z1CA 1LYXA 3B0YA 3ABRA 1KR1A 1EQPA 5CAHA 2W91A 1QJWA 3L0GA 3H2NA 1XLBA 3QRHA 4J27A 1JYWA 4JKKA 3DI0A 1WDSA 4JTHA 3PZTA 3FFSA 2W27A 3VKDA 2O4QA 5I09A 3N14A 5EBUA 4IIFA 3TYAA 3USZA 2EEXA 5A6KA 1PHWA 4B2DA 2Y0FA 2YCKX 4IIBA 4WY0B 3MV11 3TFCA 3QBUA 4H9ZA 3KP1A 4K8GA 4RDZA 5REQB 1AW5A 2DT1A 4Q4OA 2PGRA 3WD3A 3W82A 2BGQA 4GFSA 1XINA 1O60A 2EKCA 9XIAA 2O7QA 1BKHA 2E3ZA 3W7OA 4UTKA 5C7HA 4PTDA 4GG9A 3TH6A 1IYXA 4RNHA 3BLKA 3S6OA 2YLAA 3SN1A 1E6QM 4O52A 4RPPA 1R7AA 3Q37A 5HINA 3K8LA 1K1DA 2DGAA 1VB9A 4RKAA 3OZPA 1XGDA 3TX9A 1H49A 3RLUA 4WSJA 3DGBA 2FPTA 2Y4SA 1OGBA 3URAA 3NCOA 4ZQPA 1OIMA 2YA1A 1EB3A 1H51A 3PS7A 4CD7A 2GSHA 1EA9C 1Q2RA 3W1TA 4G9PA 1SR9A 3DHFA 4D2JA 2OLAA 1KLYA 3T8QA 3TN3A 3TOYA 2V5BA 4HNTA 4IFOA 1O1HA 4GIAA 3W1MA 4QITA 2YXGA 3NURA 3TTYA 2VJXA 3N6JA 3M4HA 1L6FA 1X39A 2V81A 3KOXA 1US2A 2ZX8A 3NEVA 4G5DA 4W7UA 3CU2A 2Q8XA 2WLZA 3KL5A 3ARRA 3HGJA 1CX9A 4XSMA 1P7TB 1DBTA 2FFCA 2FQIA 3ERPA 5I07A 2ZQ0A 2NVDA 1EP3A 3B0PA 1KM0A 4QG6A 5E9AA 1L6SA 2XIBA 1VQTA 2P0IA 4RE2A 3FXGA 1OJXA 4IG2B 3WENA 1R30A 4IIEA 1JAKA 1AA1B 3ZS4A 3ZR6A 5CSYA 2OYLA 1FXPA 4JTKA 3WF0A 5KTLA 5I0DA 4FNQA 3KLKA 1C93A 2OFJA 2Y89A 2V8ZA 3ICJA 5KETA 1Q6LA 4AD0A 1R2TA 3IIPA 2QUMA 3NZRA 1GVRA 4EXAA 1V6UA 4WHBA 1IGWA 5GNZA 3N13A 4AIBA 1HJVA 1J0HA 1KQZA 2YL8A 3DIPA 3M0IA 4CU6A 3RNDA 2RUSA 1X1ZA 1KQYA 4C6QA 2YFOA 3E49A 1AW2A 1KCZA 1UOKA 2NQJA 2XU2A 2VZUA 1M03A 3SY5A 4URIA 3IWPA 1H1NA 1NOUA 2QCCA 3W7GA 1WCGA 1UKOA 1GQNA 2GVGA 3QVQA 4OZOA 3TC7A 3CZLA 3LSBA 4IX0A 1KBIA 3ARXA 4JNYA 1UBSA