1B3OA

Ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
489
structure length
304
Chain Sequence
b'TSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
molecule tags Dehydrogenase
source organism Homo sapiens
publication title Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.
pubmed doi rcsb
total genus 83
structure length 304
sequence length 489
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b3oA00
1PCWA 3EXTA 3UY7A 1IF2A 4MZ8A 3NDOA 4O14A 1JR1A 3TXZA 1ML1A 2E6FA 2ZA1A 4JY8A 1FCBA 4DPQA 4MJZA 4PCFA 4IJBA 1A50A 3W2KA 1BKSA 1KM0A 1GYLA 2GJNA 1XBYA 2JGQA 3W1TA 2AAMA 2WOQA 3GDTA 5D2XA 2VOMA 1P5BA 1DJNA 3HGRA 4O10A 2Q8ZA 5EA9A 1W1ZA 1VZWA 3IVTA 1RR2A 4IMFA 3GVGA 2H8XA 3W2JA 3K30A 3TXVA 4O1CA 4O50A 1FCUA 5FEZA 1FBAA 4MZYA 4NX0A 3SW6A 3TSDA 4RR4A 1M7PA 1XBXA 3NPWA 2F7FA 4RZ6A 2YZRA 5HULA 3NA8A 3BW3A 1S5TA 3B06A 2ATMA 4BI7A 1W5OA 1GG1A 1OK6A 1S5WA 4YXGA 2DJLA 3W7OA 3C4UA 3FJLA 3MO7A 2NX9A 1QR7A 3M16A 3PUDA 2C19A 2ZZ2A 1TPH1 1QPNA 2Y70A 3LI0A 3C56A 1VGAA 3T40A 3HOJA 2QUVA 5GVJA 3MI2A 3G1YA 1H51A 3IIOA 1FWTA 1TTQA 1JQXA 3WJXA 1LBFA 5C54A 3B0VC 4AEOA 4ZVJA 4X2RA 4X22A 4I7VA 3P60A 1SZFA 3TSBA 3MHFA 2OT1A 1YXDA 3KXQA 4JD4A 3GXPA 4R34A 3GIYA 4RJEA 4BI5A 3CEPA 3LHWA 4LV9A 4QNWA 4UTLA 1IGSA 1TQXA 3L0KA 4NXSA 1Q6RA 5KTLA 5FF4A 1X7FA 1JJKA 5DXYA 3STGA 1GT8A 3IIXA 3G0UA 4N4PA 3W7MA 3TUUA 1F05A 3M1ZA 3EX3A 3W75A 3Q2DA 3TW6A 4N6FA 4TIMA 3QW3A 3W7DA 4HNUA 3C61A 1LYXA 4XZ9A 4HN4A 4CQ8A 1G4TA 1TPC1 3L66A 2RDUA 3LCIA 4H3DA 4WY0A 2ZBTA 4HPXA 5AYYA 1H1ZA 1TPDA 2KZHA 4GXMA 5CSRA 5EBUA 1KFKA 3LBCA 1JUEA 4LS1A 2I9EA 4M7SA 2HTMA 4X3ZA 4ZQMA 1JVNA 3UNDA 4GUHA 1KW1A 5FI8A 4I9AA 3DFSA 3LTSA 3S1UA 3NQCA 2YX0A 3LCWA 3W1LA 2X1SA 1HO1A 4GUFA 1OX4A 1TB3A 1TREA 1VRDA 4NVTA 2Y7FA 5G2WA 4O8RA 3GYEA 1FCVA 4Y9AA 3W83A 1OX5A 3UPBA 1IXNA 3FFSA 3F4NA 3FEMA 2ZA3A 4AWSA 3NGJA 4FNRA 1UASA 2X16A 3MYPA 5KITA 2V5BA 1TTIA 2E68A 4WXZA 3TR2A 1JRBA 3S5YA 1ADOA 4MFEA 4MOZA 5CPOA 3P81A 3QZEA 5LKYA 1VQTA 2CLHA 2HS6A 1DJQA 2J9YA 4FO4A 1KM1A 5HJLA 5EYWA 3T4CA 3QC3A 3MI3A 1PL9A 3DHFA 2FPVA 1LOSA 3L5MA 4N4QA 3S9YA 4PL2A 2A85A 3BO9A 1LDCA 3M5YA 3NL3A 3SIZA 4UTUA 3NM3A 2ZFAA 1SPQA 4MIMA 4JEQA 3THAA 1M5WA 2CLEA 1HO4A 1GTHA 2RH9A 3CWNA 1KM3A 1Q45A 3PAJA 3N9SA 1EUNA 2B4GA 4O16A 1PHWA 4IMCA 5AYZA 4XWUA 1IIGA 3UZ5A 3UWUA 3W71A 3LCGA 4MLRA 4CNPA 1R2TA 3HPZA 4K38A 3RLVA 2YW3A 3NO5A 3M6YA 1B57A 4BWLC 3CC1A 5ABTA 4FNSA 2Q8LA 2DZUA 1YADA 5F2GA 2E6DA 2NXIA 4BFAA 2Y89A 3W1QA 2QDHA 3DKJA 1SW0A 4UTJA 3KOFA 3TMLA 2Y6ZA 3T44A 3SGZA 1WBHA 2ISSA 1DQXA 5DBTA 1IXPA 3QW4B 3L5LA 2YYTA 3VI2A 3GDLA 5H2ZA 2VEIA 4N2YA 4FX6M 1D3HA 1X8FA 2ZYFA 3NAVA 1MEHA 2FLIA 3GKFA 5D33A 3W1XA 2QCHA 3O6CA 3MMTA 4JTHA 4UFKA 1ZFJA 2Q3OA 1W5QA 1GVOA 3G1VA 1VH7A 4LVAA 3ABQA 2ZTKA 4RCXA 1K7EA 1XBZA 3CEUA 5I3FA 1W5MA 5DY3A 1S5VA 4JXCA 5G5IA 5CPNA 4GJ1A 2A6NA 3TH6A 3F4WA 3VNDA 4X9SA 5E0KA 1GZGA 1IXOA 3N9RA 3GB6A 4O18A 4UCGA 3AJXA 3M5XA 5F2IA 4MJMA 5EY5A 2VKZG 4I7WA 4ZQOA 3P67A 1VYPX 3C8FA 1SSGA 2R8WA 4BR1A 2W6RA 3TDFA 4PC8A 3O1NA 1OVDA 2EHHA 3C0JA 3Q37A 1UCWA 3P5YA 1OYBA 2A21A 1SW7A 2CLOA 2JKAA 2NV1A 3GK0A 1RV8A 3OA3A 3UPWA 1KFCA 3EWYA 5FF0A 5KZDA 3A21A 1LZOA 3WK3A 3RK8A 3QMTA 4O1BA 1T0OA 1JCLA 2Y62A 5EMUA 3W2UA 1TPFA 1P0NA 3IIZA 4YL2A 4HSNA 4WD0A 2GQ9A 4MPQA 1O4UA 3NPXA 4RKAA 4PEKA 1LBMA 3N14A 3GNDA 4OE7A 1W31A 4TO8A 4UR8A 3ZFHA 3LCFA 3G18A 4O1DA 1NAL1 1SQ7A 1WV2A 3BLIA 2UV8G 3ANYA 3BW4A 3QMSA 2YDAA 1DQWA 3TX9A 4S2BA 1NVMA 1MXSA 2GQ8A 4CCCA 5KZMA 3ABOA 3TKFA 1UB3A 4LWWA 1ICSA 4O13A 2VFEA 2GVGA 1FY6A 4O4VA 4LUIA 3A24A 3HG5A 5C6MA 1W3IA 3W3OA 2GVLA 3TSMA 2ZRZA 2Z1BA 3G1AA 5CPMA 3M41A 1FCQA 3W7IA 5DXXA 4KFOA 2A6LA 5BW6A 4KFPA 1JCNA 3EB2A 1I2NA 3BG9A 2QJHA 1AW5A 1RQBA 3N34A 1YXYA 1S3HA 5U7SA 1EA0A 1G67A 2C1HA 3HMJG 3BVJA 2H90A 4IX2A 1ICPA 4TX9A 5DLCA 3B04A 4EF9A 2VFDA 3P84A 4ORMA 3W22A 3RNDA 3LRLA 2FJKA 3THQA 1SO5A 1YDNA 4GC4A 5D37A 4LTSA 1G4PA 2VFFA 1P0KA 4UFIA 2E77A 3UXDA 4UTWC 3PR2A 1O95A 4PL1A 4LS0A 3S5ZA 3W1AA 2PE4A 2NUYA 2QKFA 3O05A 1QPQA 3S1WA 1SR9A 1XM3A 3P8JA 4H6KA 3A22A 1KV5A 1KA9F 4ADUA 4K8HA 3QM3A 3C2FA 3TQKA 3W76A 1W56A 2WSYA 3PULA 5AC6A 1OFEA 3B4UA 3M47A 3IGXA 1XXXA 3IGUA 3JRKA 1OFPA 3LCHA 4LU0A 3TCEA 4ZL1A 3FLUA 1T8XA 3TC6A 1SZGA 2HSAA 4HHPA 1JCYA 2EGZA 2DZXA 3CTLA 3RFAA 5D09A 2DJXA 1XL9A 3TFXA 1VS1A 1W3NA 4M6PA 4UTTA 5D2YA 2QCFA 4PFMA 1GG0A 1V5XA 4PH6A 5I3IA 2C13A 3WJSA 4CCEA 1KBIA 2BSLA 3UY8A 1AW2A 1E51A 4QIUA 4TMCA 5D04C 2X1TA 3W7EA 3E12A 4GNJA 2QDGA 5HNRA 5DY2A 3HG2A 5H91A 5HR6A 1LROA 3SY5A 1FQ0A 5A5WA 1WBJA 3W7NA 3G1DA 1MO0A 3QPYA 2NX1A 5LSMA 5D2WA 1NF7A 2X1RA 2YR1A 3CU2A 5EKYA 2C16A 4MLJA 4UTHA 3PUEA 4XBSA 4HPJA 4EF8A 2PRMA 3PF3A 4W9TA 4JR5A 4FNQA 1J4EA 2V2HA 4DXVA 3LHTA 3O15A 1QDSA 1O5XA 4O57A 2XN1A 4AF0B 3LHVA 1HL2A 3WJYA 3G1SA 3WK2A 5T26A 3W1PA 1TV5A 3NEVA 3R13A 2ZCGA 4GFSA 3LCXA 2OMAA 4Y8FA 2V82A 2VFIA 5CKSA 1GOXA 3N19B 1YPFA 1PV8A 4GUGA 2WNZA 1K02A 1TRIA 3VCRA 2CFFA 3L2IA 1T99A 1TQJA 4UIOA 4HKPA 2LLEA 3L68A 4AB4A 1FWSA 1ALDA 5G2IA 2DZWA 4NJHA 3HGSA 3G24A 4NU7A 4O15A 4JIQA 1FDZA 1LBLA 5FESA 3KX6A 3EX4A 3EKLA 1KBJA 3W9ZA 4S2CA 3P8IA 2JK2A 2H8ZA 3W6YA 1TO3A 3LCLA 1M7OA 3CM4A 4DF1A 5FEXA 5C55A 4KWWA 1OYAA 4OQVA 3GXTA 3PG8A 3G1FA 3ZWTA 3DAQA 4UFMA 1KM6A 3NL2A 4OV9A 4O0ZA 3P7YA 4LC8A 3B8DA 3P80A 4NJJA 5HWMA 3DZ1A 5IBXC 4LVFA 2DZPA 2C6QA 5CZ0A 1K8YA 4XBKA 2VEKA 2WSQA 3N2XA 4ALDA 3TNOA 3DFTA 5KZEA 4E0CA 3NYZA 1EWDA 1N8FA 1BTMA 1PS9A 4TMBA 2V0TA 3W2MA 1FUYA 3RU6A 3IIPA 3NQVA 4UTIA 2Y61A 5DCBA 3QH2A 5D2VA 2Z2UA 3W7JA 3SJ3A 3INPA 4JTUA 3STFA 3QSRA 2RFGA 1W0MA 2P0OA 5KINA 5CZSA 4LVGA 1I2PA 4EVZA 1EPXA 2NX3A 2PRLA 3A5FA 3L67A 3EXRA 2QUTA 4R53A 2ZDRA 4RXGA 4LOCA 3P61A 4UMAA 3WK0A 3SGUA 1H62A 1FDJA 2FIQA 3TJXA 2H6RA 2ABBA 5LNVA 1B9BA 3PWAA 3GAYA 3W7LA 4JYFA 3W7QA 4BK9A 4GBUA 2OCZA 4JTEA 3FS2A 1VLWA 1LCOA 2G96A 5J5DA 1J2WA 1QOPA 5HINA 1VYSX 4E38A 3OHIA 1JCJA 2YYUA 5LGZA 5D30A 3PM6A 6TIMA 1YLVA 1F2JA 2FQIA 1H50A 2NV2A 5CSSA 1LOQA 3ABSA 2GOUA 2WKJA 1ZNNA 4UXDA 4IQLA 3CQ0A 2A5HA 1Q6LA 2VXNA 3EWZA 3G3MA 3L65A 3R89A 2NXGA 5D2TA 4AHPA 1SO3A 1F76A 3ATZA 2ZRVA 2QEZA 5CPLA 3IVSA 2W79A 3LM7A 1ZAHA 2ZZ6A 3G8EA 2QCEA 5IBXA 4WJEA 4FEZA 1Z42A 3IEBA 3W72A 3O16A 3LI1A 4ZQPA 3PC0A 3A5VA 4JN6A 2V2DA 4JX4A 3U2OA 1MEWA 2PURA 2G5WA 3VKJA 1R47A 3NQEA 4JYDA 3S0CA 3W23A 1TPEA 1YDVA 3R8RA 4FIQA 1G6CA 3NQFA 3G8RA 4JTGA 3NL5A 4JTKA 3ZR4A 4IMGA 4ADSA 1IXQA 2EPHA 2EF9A 2RDTA 4UTTC 4UNLA 4LW7A 2Y7EA 1OFAA 3HG4A 4UFLA 2WQPA 3DU0A 1IIHA 4RK8A 1YTDA 4ZQCA 2BXVA 4Z0SA 2E6AA 1DBTA 4WY0B 2C15A 1F5ZA 1K7XA 2GVJA 3UWWA 1JRCA 5F2LA 4OU1A 3PG9A 4UMCA 2IQTA 3MHUA 3EX1A 1R2RA 3G22A 3NQMA 4LNYA 2ZQ0A 4ML9A 5HMSA 4NJGA 4UTMA 1B4KA 4NNBA 2XN0A 4L4LA 3LB0A 4XUGA 2FPTA 1TYGA 1WX0A 1I2RA 4R7JA 2Z0IA 1EUAA 1VC4A 3EWUA 1L2UA 5DBUA 3MI6A 4LRSA 3R12A 3Q58A 1LORA 3S1XA 1K8ZA 1TMHA 2CWNA 4JY9A 3P62A 3U6WA 4B5NA 4IMEA 1W3TA 3QQ0A 1VLIA 4FX7A 2CZ5A 4M19A 4IWWA 4O17A 3B05A 4GE8A 3PB2A 2RHGA 3OVPA 1QWGA 2ALDA 1TCDA 4QQ3A 3USBA 5G4EA 3W7PA 1AL8A 2NUWA 2JKPA 3C3NA 4O53A 2R91A 5HWNA 3L5AA 3GLCA 6ALDA 2V81A 2J6XA 5AHFA 4TR9A 4PA8A 1YDOA 2QAFA 3M5VA 2WNNA 5DELA 1QO5A 1L6YA 1FDYA 1TSIA 4M7TA 3BLEA 3H53A 1H7OA 1TPB1 2J24A 1H60A 1JUBA 3SECA 3M44A 2GPTA 1J5TA 1H63A 3LXBA 4E2BA 3O6YX 3BW2A 4QISA 1SO6A 1GVQA 4NZFA 5EL1A 2Y7DA 3FYPA 5DCDA 4YWIA 5K4XA 2V8ZA 4Q32A 1KFEA 2QUUA 4N9BA 1GPWA 1P1XA 1OFBA 3E02A 4RV8A 3TQ0A 5C5YA 1KM2A 1YYAA 2ZZ3A 3FKRA 3W7CA 5AHLA 1F7BA 3KVMA 5HUOA 1T96A 2F84A 1KLZA 1VYRA 4O52A 1QNVA 2TYSA 2YPIA 2E5CA 3TAOA 3UWVA 5TIMA 5LNRA 2H3DA 5AHMA 1VHNA 2JBMA 2ZZ1A 4O1AA 2X1UA 3NNTA 5E93A 5D02A 3T7VA 4LVDA 4HNTA 4HNNA 1OF6A 1ICQA 4DF2A 4CNOA 4RX0A 1V7YA 3HO8A 4H4IA 1HFBA 1N7KA 4JICA 1C29A 3NQ6A 4Y96A 2FTPA 3OVRA 3IGSA 3TU9A 1LRQA 2A7PA 1G4SA 1W54A 5FEPA 2FFCA 2NWRA 3TA6A 4Z08A 2B7PA 1DOSA 1KFLA 1OG0A 4L4MA 3BLFA 1OX4B 1PCKA 3NM1A 5F1UA 3W1NA 2VC6A 2QCCA 4RXFA 3N2MA 3ELFA 1Y0EA 3UYCA 3MWAA 4FX8A 3UWYA 1GVFA 3EWBX 3PY2A 3NQAA 4O11A 3HF3A 1UUMA 1I8JA 3EWXA 4U4MA 4K39A 4O4WA 1LRNA 1SZEA 3GR8A 3NG3A 3NR0A 3NZRA 4YMZA 1TPVA 2J88A 1XC4A 3PUOA 1WOAA 3NXFA 3H55A 1G4EA 1XDMA 3OEXA 4LT9A 4NX5A 2QCNA 4MY8A 1G69A 3T78A 4N9CA 5I3JA 3MP5A 3BPWA 3F1QA 3UWQA 4CQAA 3FKKA 4RZ4A 1RPXA 3MJYA 3HB9A 5BNKA 4IMDA 4MFDA 1XI3A 4K7YA 2ZTJA 3KAOA 1LTDA 3TROA 2QAPA 3IIVA 3L21A 5TBOA 7TIMA 5K2ZA 2GQAA 4G1KA 3TAKA 2B7NA 2R14A 4JIPA 2E1DA 4JX6A 4JYEA 1HG3A 2AQWA 5HWJA 4EOUA 1TTJA 4MZ1A 3GKAA 4LVBA 2VFGA 1WYIA 4RLIA 1OK4A 3M5ZA 5C2XA 1AL7A 2NZLA 2OT0A 1X1ZA 3L0GA 3M0ZA 4Q33A 2NWSA 4JNMA 3RMJA 1EP2A 3EWWA 1DORA 2OX1A 4KFNA 3MUXA 3G0SA 3GNNA 4P61A 5SWUA 2DU2A 3S42A 5KMYA 1K03A 1YTKA 3L9CA 1ZAJA 3OVQA 1EP1A 3S5OA 4WOZA 2E09A 4JTIA 4FNTA 1Z48A 4CNNA 1L6WA 3HJZA 5LHEA 1QMLA 1SO4A 3HPSA 2ZRXA 5HUPA 1O60A 1TPUA 3NQGA 1A5SA 1MZHA 2WO5A 5AHIA 2QJIA 3LHYA 2XN2A 5E1QA 2CU0A 4WXYA 1HTIA 1WDWA 3NPUA 3A23A 3C2VA 1KTCA 4LS2A 3QRHA 4UFHA 4BF9A 1EEPA 1D9EA 4M6QA 2RKXA 3LBMA 2DP3A 4JTSA 1H1YA 1FXPA 1EIXA 3DFPA 3NQDA 3S6DA 3W87A 5EPDA 4DO4A 1AW1A 1TJRA 1FXQA 1EWEA 4IPIA 2VELA 3GR7A 1JULA 1TIMA 5K9CA 1GTEA 3LLFA 2A0NA 2RDWA 2VENA 3DFOA 3DXIA 4MVAA 2QJGA 1CI1A 3TFCA 2A1YA 3EEGA 3UWZA 4AH7A 3O8AA 1VJIA 5BMXA 3YPIA 1CX9A 5L9FA 3R2GA 3BV4A 3CB8A 4IPJA 3I6RA 4TU1A 2HMCA 3HQ1A 4Z1DA 4EIVA 4DO6A 3LRMA 1ME9A 3TW7A 1H5YA 1K3UA 5F4SA 2H3BA 1O5KA 1RZMA 5AC8A 5LNSA 2O7QA 2CLFA 4ONVA 3UZJA 4AHQA 4FIRA 3O6DA 3OIXA 4RZ5A 4HIBA 4HT3A 3FIGA 3KRUA 4XKYA 3KFTA 1XCFA 5AFDA 3NQ7A 3TC7A 4NNCA 1QO2A 4FHAA 4KWVA 1OABA 2J27A 3LXAA 3MBDA 2BTMA 1KM4A 2X2GA 4Z1CA 4XQ6A 1SZNA 3N3MA 4POCA 4JTJA 4DELA 4QITA 1ZALA 3QF0A 4GUJA 3LGEA 1U5JA 1GEQA 2J9ZA 4AXKA 3UXAA 1F6KA 3VE7A 3ATYA 1QPRA 2WV8A 2Y7GA 4C1LA 5FEWA 3O07A 1TRDA 2V9DA 3LERA 4MUZA 3E9AA 4OGZA 3W84A 1F74A 1ZENA 4OBTA 5K7JA 1R2SA 4IX0A 2QCDA 3PBWA 1RVGA 4JTTA 4MY9A 5F1VA 4GRSA 4I7UA 4A29A 5LGXA 1LRTA 2VEPA 2CLLA 2QR6A 1PHQA 3CPRA 5LNWA 3WJWA 1WOBA 2C18A 5D03A 3KVLA 1FWNA 4UR7A 2ABAA 1KV8A 3PBYA 4A21A 3MP3A 2ZZ4A 4N9EA 4ZQNA 3LTPA 1UBSA 3I65A 3E96A 1CW2A 3S8HA 1ZHAA 8TIMA 1F6PA 4AWUA 2E5DA 1AMKA 3LV6A 2JGYA 4MYXA 4JDYA 2NUXA 1U83A 4QJ1A 3LHUA 5AHEA 1ONRA 1X1OA 2PCQA 1RQEA 1VCVA 3V1PA 1LP6A 1G7VA 3EKZA 3PBVA 2TRSA 1GYNA 4OT7A 3BG5A 3E49A 2A2IA 1K8XA 4J9JA 5F4XA 4O0KA 1X6UA 4WUIA 5BRBA 2EKCA 3C2OA 1DKWA 4UMBA 5DCEA 1JQVA 3Q94A 4DF0A 3DI1A 5LZLA 3HGJA 2BZNA 4KKXA 2DZTA 5J5RA 4AAJA 2AGKA 3DENA 3PVFA 1LOLA 3TMQA 4AVFA 4IXHA 2TSYA 3V75A 2QCGA 3MHGA 1GVSA 3NL6A 3FYOA 3SZ8A 1QCWA 3HIJA 5BMWA 2YXGA 5L6UA 1YXCA 1Z44A 3H54A 4OWGA 1A5BA 2C0AA 2JKEA 2R94A 3QYQA 4XTIA 5A8GA 3F03K 3W85A 2B7QA 3VFLA 3TK7A 3KVKA 1KTNA 2QF7A 4S1FA 3G1XA 1A5AA 2Z6IA 2W0UA 4GUIA 1I4NA 4XTDA 2TPSA 1OFQA 3W7GA 2Q3RA 3S1VA 2WPBA 4CLMA 4UTKA 3QEZA 4Z1AA 3R5EA 3O06A 4AWTA 3QMRA 4JTLA 3JS3A 1XKYA 2ZZ5A 1O94A 4K7VA 1XBVA 1H7NA 3I7RA 3W07A 1W5PA 1H7WA 3NOEA 3PS7A 4K36A 3GX9A 3KRZA 1KTBA 3SSJA 2ISWA 5D32A 3T55A 4NJIA 1EP3A 4WQ6A 1Q6QA 3A9IA 3VE9A 4O54A 4FNPA 3I7SA 1FX6A 2E6YA 1YPIA 1NEYA 2Z6JA 2DORA 3FOKA 4UFJA 3WFAA 3QSTA 3C52A 3CIXA 3HG3A 4NT0A 1OFOA 4ZQRA 5AB3A 1P4CA 3M43A 1OHLA 4IXXA 2CLKA 2YSWA 1WAUA 3B0PA 4NQ1A 3G0XA 4FNUA 1SW3A 1I2QA 4Y90A 1QOQA 5AHNA 2B0MA 1GVRA 4FXSA 5HQEA 4Z0JA 1XDLA 2CW6A 3W7RA 1ME7A 4IUOA 1HUVA 1THFD 1JCMP 1PVNA 2BWGA 4GWEA 1BWKA 5AOUA 4AF0A 4NXKA 4NJKA 3AO0A 4FB7A 5U4NA 3SFKA 5I3GA 4A22A 4HNVA 1LM1A 4YCOA 3OG3A 3MP4A 4D2JA 3C2EA 2B7OA 1SSDA 5K9DA 1TV7A 1NFBA 4WZHA 5CZTA 1C9DA 4C1KA 1VR6A 1KM5A 3WK1A 4YCPA 1W8SA 1PE1A 1Z41A 3QPZA 2PC4A 1KFBA 4WOQA 1LLZA 2YFOA 3RLUA 4O12A 4QNEA 3JR2A 5G4WA 4Z1BA 3PB0A 1KLYA 1QAPA 3LV5A 3TQVA 1DV7A 2YW4A 5KSWA 3LX9A 2ZZ7A 3B0UX 1L9WA 5HR7A 4N6EA 2CLIA 3I7QA 2X30A 3GXNA 4NUWA 4BWLA 1ZCOA 4JX5A 3W70A 4UNKA 3NPVA 1W37A 2O7SA 2QCLA 4HSOA 1TTPA 3PSWA 3IV3A 2G95A 5FF2A 1XFBA 1AK5A 1OX6A 3G3DA 5G1TA 1UUOA 2CZDA 3LTYA 4DQWA 1GWJA 1M6JA 1VCFA 4OHQA 3W88A 4CQ9A 3HBLA 5DN1A 1FWWA 2Y88A 5AYXA 4M5PA 3I68A 4PODA 2A4AA 5AC7A 3W7HA 1ZJIA 1TPWA 3SI9A 3U8GA 3KHJA 1BWLA 1GJPA 2ZRYA 2I1OA 5BOOA 2PRHA 2GUUA 3CT7A 2BX7A 3TIMA 4R33A 3D0CA 3QFEA 1C8VA 1N55A 2P10A 4K8EA 3W74A 2J9XA 4LV4A 1Q3NA 2OZ0A 2C3ZA 3N73A 1OJXA 2GJLA 3GAKA 4OV4A 4E2DA 4A2RA 1OYCA 3DI0A 3DHDA 4LRTA 4EWND 2ISVA 1JCXA 1L6SA 3QQ1A 4ADTA 4MY1A 2V5LA 1RQHA 2VEMA 3M7WA 5FF3A 4O19A 4UC5A 5IM51 5I3KA 4DEFA 3NQ2A 3BK0A 3MYOA 2WSRA 3CLMA 2V2CA 4WX2A 1SU5A 1UJPA 1NSJA 1ZY9A 2ZRWA 2XFWA 2WNQA 4N02A 4DBEA 3W1UA 3MBFA 1KFJA 3P74A 3LDVA 1MSSA 4UTWA 2DZVA 3UD6A 1QFEA 4ZMGA 3PBUA 4WY0F 3CIWA 3NQ8A 3S5NA 3DKLA 1VHCA 3TV8A 1ME8A 5G1YA 1WA3A 1B4EA 3HGOA 1ZAIA 4Y6GA 2QCMA 2ZA2A 1YTEA 3GDMA 3IRDA 4YLWA 3KRSA 1OFRA 3GDKA 4ICNA 1D3GA 1WQ5A 3HPXA 5LNUA 2G97A 1I2OA 2ATSA 4AHOA 1EB3A 4NZJA 2CZFA 5K4ZA 4CCDA 3DFNA 2I14A 3STEA 3DGRA 2WJZA 3LHZA 4IGHA 4LY8A 3EX2A 4XKYB 4JDBA 2FPYA 3RF9A 2A7RA 1DHPA 3B03A 4ORIA 5MHBA 3PSVA 1SUXA 3DFQA 2A7NA 2CLMA 3FA5A 3FJ6A 4LC6A 3MW7A 1WXJA 2HS8A 3BG3A 2NLIA 1DVJA 3TE9A 3GZ3A 5CZJA 1NF0A 4QM1A 3LRKA 3ZWSA 1SFJA 2ZRUA 2D73A 5CG7A 5G2HA 2DZSA 1I45A 2E5BA 3UQNA 3NZ1A 1A5CA 1VPXA 3LOTA 4JTFA 1FWRA 1GQNA 4U28A 1R46A 2BLEA 3OBKA 5LHFA 1XUZA 4DO5A 1OFDA 2FDSA 3SR7A 3P82A 5I3HA 3O63A 2EAWA 3TJLA 5D38A 1AG1O 3NVTA 2YGYA 2FB3A 3ZS4A 1H7RA 2NXHA 1MEIA 1DL3A 2QCDB 3ABRA 2CZEA 3DBPA 3BARA 5F2MA 2OJPA 1RD5A 4MYAA 1OF8A 3G1HA 1K7FA 4FF7A 1JUKA 2YCEA 5FF7A 3W1MA 1BEUA 2P1FA 5F4WA 2VFHA 3KVJA 3LLDA 3W1RA 4K6AA 3GDRA 5TQLA 1Q6OA 1QPOA 1R30A 4AMAA 4Q4KA 1PIIA 3W7KA 3EXSA 4M6VA 4IOTA 5CGQA 3BGGA 1LLWA 3DH7A 3W2LA 1G7UA 4MKNA 1SFLA 2TMDA 5AN7A 3L0NA 3M9YA 4A2SA 2V30A 1H61A 4P2VA 4PTNA 4LUJA 4UUIA 2YFNA 4JS3A 2Y85A 3LXCA 3P5ZA 3IVUA 4K37A 4QAIA 3BGJA 4A3UA 1A53A 4NNAA 4FXRA 3CHVA 3STCA 2FB2A 3CWOX 4O28A 3W86A 4ZZ9A 1H7PA 2C14A 1F73A 1VCGA 3C6CA 2Y63A 1W5NA 3WJZA 4JGDA 1XUUA 3EX6A 1EX5A 3E0IA 1TJPA 4QSHA 3W73A 4BI6A 4DPPA 1H7XA 3W2NA 3C2RA 5K3VA 4DBDA 1B3OA 3QJAA 4N9DA 5D05A 5K9XA 1TV8A
chains in the Genus database with same CATH superfamily
3K8MA 3GWQA 2X1IA 2Q8XA 3VM5A 1JR1A 3TXZA 4XUYA 4UQEA 3EDFA 1E1EA 1ML1A 4Q8PA 1PZ3A 4FI4A 3SCSA 3VA8A 1FCBA 3VZXA 1XDJA 2DSUA 1IT8A 2GJNA 1XBYA 1O66A 1AH0A 1CZ1A 2WOQA 3GDTA 4MWAB 4AZ6A 1RR2A 1LT7A 1BF2A 2J6VA 1EEXA 4O1CA 4O50A 1FCUA 2XSXA 3ME3A 1EJUC 3W26A 2W9MA 2ZWZA 3L23A 6ENLA 1XBXA 4ZTXA 5HULA 3WY1A 1SJCA 3WD0A 4ZOBA 1W5OA 1WKDA 1F3XA 2FYMA 3C4UA 2BASA 3QVQA 1A5NC 3MB9A 2NX9A 3VX1A 3UZWA 1XPYA 3HOJA 2Z1VA 3GW3A 1FKWA 1EQCA 4FP1A 4H8NA 1XS2A 4XAGA 5C54A 4JHZA 2ZXBA 4X22A 2JIWA 4J3WA 3V0TA 2G0WA 3R8HA 4P7NA 3GIYA 3CEPA 4QNWA 1TQXA 3L0KA 5KTLA 3KW3A 5FF4A 5DXYA 1GT8A 3H7UA 1OGBA 2C1IA 2RDXA 4N6FA 2FMNA 3SN1A 5AY7A 2I5IA 3WNMA 2PGRA 1CPUA 3LCIA 2YCLA 1ZPTA 4GVGA 4WY0A 2WLZA 3RITA 3KL5A 4PUUA 4JQ3A 2PDNA 3QYSA 4J1OA 3CH9A 4RNFA 4JL1A 3NVDA 4JAWA 3SSZA 3LTSA 3S1UA 3F5KA 4TVDA 3NQCA 1TCMA 3LCWA 3ZVHA 5LIXX 3W1LA 4H9UA 3K4DA 2ANUA 1J9YA 3EDEA 4GUFA 1TREA 5G2WA 2ZX7A 3VD7A 2YOCA 3GYEA 1UR9A 4N7QA 3CL6A 1JZ7A 5HQMA 3W83A 1XRFA 1OX5A 3UPBA 2GWNA 4UR9A 2PDWA 3AOFA 2PLCA 2PDQA 4WDUA 1S2CA 1J10A 2WC4A 3KBMA 3BDKA 3MYPA 4ATDA 3H2OA 3D46A 2V5BA 3S5YA 2NSXA 1ADOA 1UUQA 1PUDA 1JI2A 3TYEA 1XP3A 4IFKA 2OVLA 5HJLA 4JIEA 4XZHA 5EYWA 1PL9A 2HPIA 2FPVA 4Z2GA 1LOSA 2DVUA 3L5MA 1UD3A 4KWOA 1E4MM 1RCOB 3FXGA 1LQ0A 3PTQA 1LDCA 3NL3A 2YCKX 1FWCC 4JFTA 1M5WA 1HO4A 1GTHA 3WKZA 4ZB5A 1W9XA 3D6NA 2WM0A 3PAJA 2PWEA 4O16A 4X0VA 1V0NA 3H21A 1FH7A 2D2JA 3ARRA 2V68A 2VQTA 3PANA 3UWUA 1GOOA 1Y5VA 1R2TA 3WBWA 3CAKA 3M6YA 3PZQA 3IK4A 4MB3A 5MKGA 7TAAA 1E6PA 1FRBA 2DZUA 4EPEC 5C8BB 1L0PA 2HE5A 4EWJA 2Y89A 1ZBCA 5JH2A 1SW0A 4JQ1A 4BQ5A 3KOFA 2E4TA 4P8WA 3SGZA 2GUBA 3VUSA 5E5CA 3VOFA 3QW4B 3L5LA 2WSPA 4N2YA 1D3HA 3NAVA 1NWRA 3FVMA 1B3ZA 3O6CA 5HNNA 3MMTA 1ZFJA 4D8ZA 1W5QA 3TP4A 1HL9A 1GVOA 3V4BA 3G1VA 1VH7A 3CYVA 3AYRA 4M24A 2XGBA 2PZ0A 4L80A 2Q02A 4X9YA 3OBEA 4JXCA 5G5IA 1WDPA 3AIVA 5FAGA 3BZGA 3PZGA 5E0KA 2KAUC 3N9RA 4O18A 1MNSA 1B31A 1PX3A 2VKZG 4I7WA 4QS6A 1XIEA 4H8HA 1VYPX 5E0FA 4BR1A 4L61A 2W6RA 4PC8A 3O1NA 1OVDA 2GJXA 2C71A 2EHHA 4RW5A 3PTKA 3P5YA 5TF0A 4L1XA 3KCOA 4U5IA 1L8PA 4QG6A 2UY4A 1GW1A 3VIJA 5FF0A 3MMDA 3UGRA 3VO0A 2V5JA 1H49A 4Q4RA 3AHVA 3QMTA 4O1BA 5JIPA 1EGVA 3M0MA 2DT2A 2DZBA 3K1GA 2Y62A 4QLJA 3AMDA 1TPFA 2WVVA 3IIZA 2CERA 3WF3A 2XVGA 4KT2A 1PZ1A 1T7LA 4RUBA 1GYMA 3CZLA 4OIFA 3ZFHA 5FIPA 3WQPA 3QZ6A 1Z8AA 1NAL1 1WV2A 4YHEA 3BLIA 2UV8G 3ANYA 1BQGA 2YDAA 1DQWA 2E0PA 1TZ7A 1ISYA 1NVMA 1G1YA 4CCCA 3TKFA 4AD4A 4HMEA 2QW5A 2PDPA 4O4VA 4LUIA 5C6MA 2IPJA 4EACA 3W3OA 4WEVX 4AYGA 2GVLA 3KLLA 1Q4WA 4MWAE 1V8EA 2YA1A 1US0A 2YCJA 3SUTA 2EG6A 1JEZA 1JYNA 3R1ZA 4L6OA 1UMLA 1YXYA 4LUTB 4DY1A 3BTNA 2WMHA 2VT0A 2C1HA 4WIWA 4GXWA 3EYPA 4EF9A 3P84A 2PDJA 3BGAA 1KGXA 2IQ0A 4CVWA 2E9LA 3CV2A 4C6NA 4F8XA 5EMKA 1G4PA 3ZJ7A 1M3UA 1UD5A 4UFIA 4CVUA 3MCOA 3UXDA 1OZQA 4R9OA 1O95A 3CV7A 2QKFA 1BSIA 1C93A 3ANVA 4QR6A 1SR9A 2XVKA 3GTFA 4H6KA 2GGIA 4QG9A 5ECVA 4NAEA 4JFWA 1JFXA 3ONBA 1KV5A 1H09A 2EPNA 5T8GA 3C2FA 1W56A 3T4WA 3RCNA 1PX4A 3OLIA 4B3KA 1NY1A 1PXGA 3NSXA 3ZR5A 3B9NA 5GPRA 3GG7A 2FZNA 3RRAA 1E6XM 4IQEA 1K4HA 4JNZA 4GCAA 1OFPA 2Y8KA 3FLUA 1T8XA 3H4WA 1SZGA 3WENA 4HHPA 3A3XA 2DZXA 4GK8A 4DJFC 5I24A 5D09A 2DJXA 5D2YA 4UBPC 3GW0A 3URNA 4PH6A 2NQLA 4J3ZA 3ZT7A 4CCEA 1XIDA 3OYXA 1HJSA 3UY8A 4LYKA 1AW2A 4TMCA 5D04C 1S2WA 3E12A 1KR0A 4C5ZA 2V3FA 2PDHA 2QDGA 4AIBA 4US6A 5DY2A 3HG2A 4ZEPA 2NQZA 3QPYA 5D2WA 2ZIDA 4LQ1A 1E72M 3V5FA 1P48A 3LGDA 2PRMA 4B2DD 4DAIA 3LHTA 4BHYA 3RIKA 3O15A 1QDSA 2OKTA 1MRAA 3A47A 1CXEA 4AF0B 5T26A 3NEVA 2ZCGA 2OMAA 2VFIA 2WHKA 4KRUA 1XISA 4W4QA 5EMLA 1J6OA 4QBXA 2VZOA 4ZR8A 2BY2A 3RILA 3C0LA 4WKAA 3VVGA 1N8IA 5HMEA 4UIOA 4G7EA 4QDMA 3VIHA 4W88A 1FDZA 2V38A 3VPLA 4L7ZA 4S2CA 3P8IA 3NYDA 2FZ9A 3LCLA 4RE4A 5FOOA 3WEMA 1PZ0A 1OYAA 3GXTA 2XU2A 1TKKA 2ZICA 4UFMA 1KM6A 3T09A 1H4PA 2NQJA 5LIUX 4S3FA 2IPWA 3EKGA 4XVDA 2PODA 1VRXA 3I6TA 1HKKA 3CL7A 5IBXC 4LVFA 4HPHA 3WNKA 2C6QA 5CZ0A 4XBKA 3K4AA 2VEKA 2WSQA 3VABA 1CXLA 3DFTA 3O7UA 5KZEA 1OIFA 3V5CA 3SBFA 1KWGA 3TZFA 3ARQA 1V6YA 3NFUA 3W2MA 4MKVA 2XSAA 4ZSUA 3IIPA 4D6HA 4KS0A 4EX4A 1JG9A 1Q8AA 5I79A 2Y61A 4J2MA 1HW6A 1S38A 1QRQA 5D2VA 3GFYA 3WF4A 3E6EA 4DIAA 3INPA 4RDZA 4C6BA 5KINA 3T2PA 6XIMA 2CHRA 4EVZA 1EPXA 4HMNA 2PRLA 3L67A 2QUTA 2ZDRA 3FX4A 4PUDA 4DWSC 1BXBA 3QHNA 1V3LA 3WK0A 3VKCA 2XIIA 4KIRA 2Q6ZA 2PWFA 2H6RA 1TJ1A 5LNVA 1UWRA 4YWSA 3DFHA 5CQ1A 2AAAA 2AL2B 1AVAA 1WPCA 4JYFA 2XDFA 3W7QA 4GBUA 4QCFA 4NZ3A 2OCZA 3DG7A 1E56A 4JTEA 3N4FA 1TX2A 3KBWA 2DIJA 1X39A 2QYGA 1MUCA 4E38A 3OHIA 4BCEA 1H50A 1BG4A 4IIBA 5EB8A 2XM2A 2WKJA 2ZKMX 4UXDA 3AHYA 3SRHA 3VIFA 4E4PA 3TYZA 4AEEA 1SO3A 1P0DA 1AA1B 1Q4NX 2D0HA 2QEZA 4AEFA 3IVSA 2W79A 3USZA 2PEVA 1J8VA 2QF8A 1LWJA 5CBIA 1E71M 3B97A 2A79A 3EMZA 4I5XA 1NM9A 2ZC8A 3WD3A 3A4XA 3ZM8A 5D9PA 4PRWA 4AZ7A 1MEWA 5CC5A 2PURA 1RP8A 2Z00A 3CQHA 4HTYA 3VKJA 1IEIA 1E40A 4ZOEA 3B40A 3QKZA 3QHMA 4FLQA 5CC6A 4JTGA 3NL5A 4IMGA 5D4YA 4WGHA 3CPGA 5CC3A 2OLHA 1XRSA 3DG6A 4LW7A 1WKEA 5CEWA 1IIHA 4GQRA 5FD0A 1ONEA 3RPTA 2BOFX 3BXWA 3N9KA 3WH9A 4UOZA 1V0KA 2JE8A 2V5CA 1RJPA 4WY0B 2C15A 3APYA 2GVJA 1SVDA 4XX6A 3UWWA 4XZBA 4H2HA 3A3HA 2CHOA 1VEMA 3O3RA 2X40A 3PG9A 2DUZA 3MHUA 4PMZA 3G22A 3W38A 3U48A 4UTMA 1UIPA 4H9VA 4TV5A 3T0CA 5LA0A 2ACSA 1E15A 3FK4A 2Z0IA 3B8WA 1C8YA 4E8CA 1PTAA 4B5XA 2CWNA 3O0KA 4DB7A 1VLIA 4OUEA 4FX7A 1QWKA 2OX4A 4GJIA 4PCTA 4M19A 3DECA 4IWWA 1QPKA 3GG8A 4J3VA 3E1F1 1V51A 2R1NA 1TCDA 3USBA 2JKPA 2HNHA 1FHLA 6ALDA 1XYLA 2VR2A 2YL8A 4TR9A 2QAFA 1A5UA 3W37A 1DWHM 3BLEA 3CT2A 3SECA 3M44A 1QNSA 1H63A 2O9TA 2Y7DA 3FYPA 5K4XA 2J7HA 2V8ZA 1IV8A 2A3LA 3OGRA 1GPWA 1P1XA 3R94A 2XH7A 5FL1A 3FKRA 1BGAA 2WVVB 4DM1A 5XINA 1UG6A 2W4XA 5A69A 2TYSA 4BEQA 4L56A 2E5CA 5TIMA 3VNYA 1EJRC 3UA3A 2JBMA 2PLKA 2F6XA 2ZZ1A 4O1AA 3VD5A 2R24A 3H2NA 3T7VA 5D02A 4NZ1A 4HNTA 2IPFA 1OF6A 4DF2A 1A3XA 3MDWA 3LZ3A 1HFBA 4G2DA 2FTPA 3OVRA 5BXRA 3TU9A 4MAVA 1W54A 3AS0A 1LUCA 1DOSA 1KFLA 1MRQA 3BLFA 4Y7EA 4URIA 1H0IA 2VC6A 2QCCA 2CBJA 1IT0A 2HK1A 3FYYA 3ZVHB 1T5AA 3MPGA 1M7JA 1CIUA 3MWAA 3UWYA 1YPXA 1TZ9A 3EWBX 4B2DA 3UJ2A 4KIEA 4D6EA 3KE0A 3OQ8A 3GR8A 3LMYA 3FA4A 2J88A 5IHRA 1X98A 3NXFA 1TIWA 4XSMA 1TVPA 3DN5A 3F1QA 3RLGA 4CQAA 6REQB 1TE1A 4IMDA 1R7AA 1XI3A 1Y8BA 3TROA 3IIVA 7TIMA 1EJVC 2G3NA 4G1KA 3TAKA 2W67A 4JYEA 5CJ5A 5BU6A 1F9CA 4MZ1A 1XLEA 4LVBA 2Y8VA 4TVCA 4D71A 3ICJA 1AL7A 1HZYA 4CD8A 3N2OA 2OEJA 5DMNA 4LH8A 4Q33A 2NWSA 4JNMA 1EP2A 4KFNA 3GNNA 1DIKA 3U4FA 2PDXA 5FSDC 1RY0A 1WZAA 3NO3A 3DGBA 4WOZA 1OC6A 1YIXA 1Z48A 2D2HA 5LHEA 4LBSA 3MMUA 2YL6A 2BBFA 4F2TA 4B3ZA 1WDWA 3NPUA 3A23A 4KF1A 4C1NA 1HN1A 3OZMA 4DHGA 1LWHA 2ZX5A 2X8RA 2XWEA 2RKXA 3LBMA 4XD6A 2PF8A 2OODA 4AXNA 4JTSA 1FXPA 2QGYA 1EIXA 3WEZA 4L4PA 3AWNA 3W87A 3UYIA 1QASA 4ERAA 4H19A 4PMYA 4BA0A 1JDCA 1UPMB 1TIMA 3BJTA 1R5YA 5BOFA 5K9CA 2VENA 3BLKA 5IDIA 1PKNA 3TFCA 3U7VA 3H26A 5BMXA 3YPIA 1GVYA 1CX9A 1O6IA 5L9FA 3R2GA 3CB8A 3I6RA 4GNKB 4KWSA 4LYPA 4YJ5A 4ZO7A 1C3FA 1HL8A 2QDEA 1OB0A 4JCLA 4Z2LA 1E1FA 3ITOA 3UZJA 4AHQA 4FIRA 8XIMA 4CN6A 2FZMA 3KRUA 1VBHA 4ZCWA 3WLSA 2OOGA 4GA8A 3N6JA 3TC7A 4KWVA 3NDZA 1R9XA 2J27A 3AISA 5C2CA 1KNWA 4M56A 4DYEA 2VI0A 2YJQA 3GG0A 4PMDA 4POCA 4JTJA 4DELA 3P14A 4GUJA 3UPMA 2J9ZA 1DJYA 3NGFA 2J13A 3WZ0E 2D23A 2QV5A 2WZHA 2WV8A 1EF2A 3OW1A 4HA1A 4C1LA 2G3MA 2V9DA 1ZBVA 4OGZA 3AICA 1F74A 3F2BA 1OZMA 5K7JA 4IX0A 1BHGA 1BVNP 2QCDA 3WO8A 4MY9A 4W8BA 2VEPA 1AQHA 3E38A 2C18A 5D03A 1FWFC 1SJBA 4UR7A 1VJZA 4OTKA 1UBSA 3PK7A 2NVAA 3S8HA 1ZHAA 1F6PA 3K8KA 1NOFA 4CD5A 3RUBL 1XLLA 3KBVA 4JDYA 2NUXA 4JCMA 3LHUA 1X38A 3GXMA 1ONRA 1X1OA 4AIOA 2PCQA 1RQEA 5LA1A 2PDYA 3V1PA 5I0DA 3VNZA 2Z28A 3HQNA 4XVEA 2GUYA 3RPDA 3BG5A 3E49A 1MZRA 3ARYA 3CUIA 2R1MA 4O0KA 4DF0A 1JQVA 3DI1A 1KCZA 3SCPA 5J5RA 1O1HA 1MFUA 4PR4A 2Y0FA 2ESCA 4ZSTA 1GVSA 1EPVA 4Q4SA 4V1YA 2Z1WA 5EMMA 3FYOA 3SZ8A 3WDIA 3HIJA 1Z44A 4OWGA 5A8GA 2C0AA 5JBEA 3EDDA 3VFLA 4O1FA 2J8GA 1KTNA 4FOKA 2QF7A 3W82A 3V3WA 2CYGA 3N3TA 3VUPA 3I3EA 2WVSA 3RXZA 1IQ8A 1AD4A 1RCQA 2DUAA 2W0UA 2Z6IA 4GUIA 1US3A 1HVQA 1NP2A 4HCDA 4XTDA 2QT3A 3W7GA 4Z1AA 3O06A 1LUCB 3QMRA 4JTLA 3JS3A 2ZZ5A 4K7VA 4GY0A 4AC7C 2PDKA 3W07A 3WLRA 1FHVA 5A6MA 3R79A 4V33A 3ARUA 3SSJA 5D32A 4QS5A 3VE9A 4FNPA 2E6YA 1EZ2A 3FOKA 3QSTA 4UWMA 2CBVA 1OFOA 4MDPA 5AB3A 2VGBA 5LYRA 1AUSL 5LIYX 4J7RA 4IXXA 3VD9A 3G0XA 1SW3A 1I2QA 4Y90A 1QOQA 3HA1A 5AHNA 2B0MA 5I07A 8XIAA 4PMQA 3M0KA 4Z0JA 1XDLA 4AZHA 1WE5A 2CW6A 3PJUA 1ME7A 4RE2A 1O7AA 2ZE0A 1JCMP 1PVNA 1EH9A 2PGFA 2Y4SA 3COTA 5AOUA 1WZMA 2FH8A 4AF0A 4AISA 4Z2JA 3SFKA 1LM1A 3AI0A 3MP4A 3LSCA 3MY9A 4XD4A 3C2EA 2A3CA 1SSDA 3VU2A 2WC3A 3R8GA 1C9DA 1VR6A 5CSYA 5GJMA 1R9YA 5A2BA 4FXFA 1KM5A 4DZAA 2DSVA 1ISZA 1W8SA 1B30A 1Z41A 4H04A 3QPZA 1XQKA 1UWSA 3FAWA 3AHTA 4NF7A 2XIQA 4P7LA 5B7ZA 3PB0A 1OEPA 4QP0A 3B0UX 1GORA 2R1KA 4GLEA 5HQLA 2X30A 1W37A 3R0UA 2D2GA 1X6NA 3PSWA 4C6IA 5H8UA 5D8WA 3SCUA 1QBBA 5G1TA 4KCTA 3MUCA 3HBLA 4XZMX 5AYXA 4PODA 4IQJA 1XR2A 3W7HA 1WXZA 4Q7IA 2CKSA 2VWTA 1BVZA 2YCLB 2VOTA 1GJPA 1EHNA 2G37A 3TIMA 3D0CA 2I5GA 1UBPC 1ZSXA 1N55A 3W74A 4LV4A 5BYWA 1Q3NA 2C3ZA 2J4GA 3GAKA 4E2DA 1ZB5A 1L6SA 2RJHA 4J3UA 1UZ1A 3UZYA 4ADTA 3L4YA 4NZ4A 3VDBA 2P3ZA 2VEMA 3M7WA 5FF3A 4GIEA 4J2PA 3NQ2A 1UJQA 1PBGA 3KWXA 1C92A 1SU5A 1W2PA 1UJPA 2ZRWA 3BAWA 1JZ8A 1FVPA 1HT6A 3NSMA 1PB0A 3JVAA 2IS7A 3NQ8A 2HE8A 2REQB 2PC8A 1WA3A 4GFIA 3HGOA 3PNZA 3I10A 3IRDA 3KRSA 2DUXA 3RCYA 4PSPA 4ICNA 1EBGA 4C90A 5LNUA 2G97A 1XD1A 1BXCA 4AHOA 4QQUA 5BROA 3GFXA 3WLIA 1A80A 3TWAA 4CCDA 2WC7A 1FWHC 3G6LA 3STEA 3PPGA 4Q8QA 3WELA 4LY8A 3KEHA 4XKYB 4JDBA 3RF9A 2W92A 1OCJA 3BL3A 2A7RA 5A6LA 3ZSSA 4YVVA 2A7NA 4KRZA 3FA5A 3UESA 4MHBA 2P8CA 4LC6A 1KR1A 5AVNA 3SUWA 1A3HA 4G56A 1TUXA 3KOYA 1NF0A 3ARSA 1UROA 3ZWSA 3BCDA 5G2HA 4Y9MA 3UQNA 1A5CA 1VPXA 3UFYA 2BLEA 2P5NA 3QR0A 3OBKA 3S47A 4DO5A 4O0QA 3H4GA 1CNVA 2W3ZA 3O63A 2EAWA 1RH9A 2F2HA 2PDBA 3V16A 4XO7A 3N2BA 1DWIM 3NVTA 2FB3A 4HYWA 1TJ2A 1O12A 1NARA 4GNVA 2QCDB 1FA2A 2V6AA 2CZEA 3DBPA 3BARA 3FJNA 1E0TA 3WF2A 4C6PA 3KP0A 2Z2BA 3W1MA 1BEUA 4H9YA 1FOBA 2P1FA 4B91A 2IKIA 5F4WA 3W1RA 1XLHA 3PZNA 3UJEA 4AMAA 4TTUA 3W7KA 2W27A 3CNYA 4IJCA 4PBEA 4GQQA 1GQIA 2VCCA 5AN7A 2OO6A 5JQ9A 4D8LA 3EBVA 3MZNA 1EXBA 3ALFA 3E5BA 4LF2A 4P2VA 3WCZA 2XJ7A 4EXAA 1S2AA 4YS1A 3GHSA 3OGVA 1WB0A 4K37A 2VWSA 2ZUNA 4F3HA 4A3UA 5ENLA 3TTSA 3WBXA 3ZQ9A 2P3EA 2RGMA 4NNAA 4FSAA 4GH1A 3KS6A 4ML4A 1F73A 3HFYA 2JFEX 3C6CA 1SMAA 1TVNA 3GTNA 3HPFA 4ZO8A 4DPPA 4BI6A 4QEHA 5MF5A 5FJUA 2C8NA 4DJDD 1Q7MA 3HURA 5D05A 3UCDA 1DHKA 3UY7A 4OOZA 3NDOA 4O14A 1V02A 3VC6A 3QQWA 1VIWA 2E6FA 4C6OA 4IJBA 3W00A 2EKGA 1BKSA 1DE5A 1KM0A 1GYLA 1XCWA 2ZWYA 3O2LA 2WCGA 3BUVA 1RD6A 5D2XA 3TYBA 4F9DA 3H23A 1EGZA 1I6NA 3V18A 2Q8ZA 5EA9A 1W1ZA 4IMFA 3W2JA 3CUFA 3K30A 3KBJA 1GW9A 4MZYA 4NX0A 2O9RA 3SW6A 4RR4A 1M7PA 3NPWA 4HMCA 2ATMA 4PMXA 4EAMA 4BI7A 4C6DA 1T6MA 3D47A 1LL7A 1VBRA 2DJLA 3MO7A 1MFVA 1QR7A 2WHLA 3PUDA 4GYKA 2Y70A 5B7YA 3T40A 8A3HA 5GVJA 2VDHA 1IEVA 3EA3A 2BG5A 1GOIA 3QY7A 4LXFA 5BCAA 4AEOA 4ZVJA 2ODOA 3IJLA 4AU0A 2BV9A 4L9YA 3P60A 1SZFA 1F8IA 2AQOA 3KXQA 1KXTA 3GXPA 4L1WA 4BI5A 4RJEA 3LHWA 2X7VA 1IGSA 1KD0A 4OKDA 1RY8A 1JJKA 4UQ9A 3PN8A 1EC8A 4N4PA 3W7MA 3TUUA 1J96A 3M1ZA 3EX3A 3AALA 4A6GA 4CD4A 1XX1A 1J79A 3B9EA 3FN9A 1F07A 4TIMA 3W7DA 4HZ7A 1LYXA 4XZ9A 1E0XA 4CQ8A 5C7HA 4QGCA 5FKYA 3WDJA 3IJIA 4H83A 2E25A 2D24A 4YPJA 1TPDA 4UZSA 2VGGA 2P50A 2E8YA 5CSRA 3REQB 4HHLA 2VRJA 3LBCA 5M3WA 2OGYA 2I9EA 1JVNA 4I9AA 3DFSA 2RGLA 2BGNE 3LUTA 1TB3A 2Y7FA 3IJ9A 1CGVA 1FCVA 3AWOA 4QJ3B 1V02E 1JGMA 3RO6A 3DIPA 1WNOA 3FFSA 2AMXA 5C9XA 1HXJA 3NGJA 1UASA 1UR0A 5XIMA 4LEFA 5DT5A 4HCHA 4F79A 1XGDA 4HHMA 5A8NA 1TTIA 2E68A 4WXZA 1DIOA 3M0LA 2PD5A 4MFEA 4ACZB 5CPOA 2ZUSA 3QZEA 3M0YA 4DWSD 5LKYA 4HNLA 1VQTA 4MB4A 1EBHA 2I16A 1S5NA 1DJQA 4FO4A 6PTDA 4M1RA 3ZT6A 3DHFA 1V6WA 4IG2B 3MZ2A 5I03A 1MUWA 1MXDA 4NL1A 2CLEA 5M1TA 2RH9A 2J7DA 4H7VA 5DRCA 3CWNA 1UD4A 4LX4A 1EUNA 3N9SA 4G7EB 4TTGA 5TD4A 5AZ1A 5I09A 5AYZA 4XWUA 1UKQA 4Q8WA 3UZ5A 2YL5A 3W71A 2OSWA 4F66A 4WR3A 1L8NA 4CNPA 1M41A 3HPZA 4K38A 4H8VA 4RNHA 3NTYA 3A4JA 3N17A 2X05A 4BWLC 3CC1A 5ABTA 2Q8LA 4H6RA 1YADA 1ONXA 1P1MA 4BFAA 1I60A 1XLIA 4CNUA 1BYBA 3XIMA 3TMLA 1BQCA 3T44A 4L1GA 5MKGB 5H2ZA 2VEIA 1E0UA 1U5HA 3H2CA 2WMIA 1MEHA 3URQA 2FLIA 3GKFA 3W1XA 1XGEA 3KDOA 1GONA 4GYPA 4IPLA 4PRTA 1DWFM 4KETA 3AIWA 1TV4A 3TTEA 3ABQA 4YIWA 1QVBA 1S5VA 3OZOA 4GJ1A 3WMLA 2WCAA 4GZIA 2IUZA 2WVTA 2DEPA 3M5XA 3LPOA 4MJMA 5H6HA 2E3ZA 3EMCA 1GZJA 3P67A 4XBJA 5ECUA 3C8FA 4DJEA 1CGUA 3C0JA 2P76A 2CWXA 1QBAA 1SW7A 2D0GA 1S1PA 3ITLA 1RV8A 3BMXA 3GIPA 5KZDA 1DWGM 3WK3A 3AHZA 3RK8A 2F2KA 4M51A 2HQAA 3C0QA 4EXQA 1T0OA 4W5ZA 4W86A 1ITQA 1JI1A 2J78A 3EOSA 1DEDA 3GIQA 4V2XA 3W0KA 5BXTA 1HGYA 1C8QA 1J0JA 3GR4A 3ONCA 3LK6A 3KBNA 3VIKA 2Q09A 3H2FA 4S3GA 3PZUA 4IIEA 3H8AA 2XPKA 5I77A 1W31A 5CH9A 4TO8A 3BAJA 4KH2A 4GQBA 1NDWA 4B5VA 4S3EA 2JIEA 2Z29A 4G7FA 1Y5WA 1T8QA 1RA5A 2Z4GA 2DSWA 5XIAA 1D8CA 5KZMA 5A94A 4C65A 1ISXA 1ICSA 4PUEA 4GJJA 4QJ4B 2GVGA 1KXVA 3HG5A 3OVGA 3AXKA 1ZCCA 4HMDA 4Z17A 1B2YA 4MWAA 3G1AA 5CPMA 1FCQA 3W7IA 1U33A 4U33A 3KCLA 3M0XA 4KFOA 2YKKA 2A6LA 4KFPA 3U2ZA 1JCNA 1JPIA 4PYSA 2QJHA 3PZTA 1XWYA 1AW5A 3HZ3A 1GQLA 4A3QA 4ERIA 3BWWA 3N34A 3UG8A 5DQPA 1VENA 3GDBA 3LPPA 3VMPA 1VFTA 1EA0A 2VP8A 4IX2A 2GZXA 2GOKA 4TVUA 3SQSA 2TAAA 4ORMA 3CMJA 1UWIA 4MUPA 2FJKA 1LL6A 3THQA 1HIZA 2V3GA 2EEXA 1W2VA 3OO2A 5AVHA 4IP4A 4JTQA 4CQCA 1QOXA 2YBVA 1P0KA 2E77A 2E9BA 3TYCA 3W1AA 1VFHA 3T81A 4GZ7A 2NUYA 1XCXA 3LMZA 1QPQA 3O05A 2V5DA 1XM3A 3P8JA 3CB3A 2NQHA 1TJ0A 2D2OA 1C7SA 5A8QA 2DT3A 4ADUA 4L9ZA 5IOBA 1IHIA 3QM3A 3M64A 3TQKA 2GK1B 3QGAC 4LBUA 2GVYA 2P0IA 4HJWA 4AD1A 3B4UA 2NSOA 1XXXA 3OLEA 3M7SA 3V0UA 4LU0A 3TCEA 4ZL1A 3DX5A 1XYMA 2RUSA 4QAWA 3TC6A 1ODUA 3HPAA 1TV3A 2EGZA 3RFAA 3WD4A 1W3NA 1WDQA 2FKPA 2YLAA 2C13A 3WJSA 4AY8A 2DVTA 5D8ZA 2PAJA 4NHVA 4Q8UA 2BSLA 1E9IA 1SR0A 3W7EA 2WBKA 2YCIX 2IKGA 2NVDA 3EA1A 2HV5A 3JUGA 2BB0A 5H91A 2DVXA 5HR6A 4Q8VA 1MO0A 2XUCA 5M2FX 1W32A 3VGHA 2E7FA 3T2OA 2O9OA 2A3BA 5EKYA 4MLJA 4P7QA 3REQA 5BRPA 2BY0A 3AZSA 3OOQA 1BRLB 3PF3A 4JR5A 4FNQA 3W6MA 1Q6CA 4DXVA 3EWCA 1EGMA 2D3LA 5T91A 1HL2A 3C5QA 3WJYA 3WK2A 3W1PA 3R13A 4Y8FA 3H2AA 5CKSA 2EQDA 3RCMA 1TRIA 4NZ5A 2CFFA 2WWCA 4AD0A 1LJYA 2J7BA 4IFKB 1T99A 4W5UA 1J2BA 2PPGA 5CPSA 4AB4A 4WHBA 1ALDA 4GH3A 5G2IA 3UVAA 1B3WA 4NJHA 3CHFA 3PPHA 3MVIA 4O15A 4NU7A 1LBLA 5FESA 2CXEA 3CYJA 3GZAA 3KX6A 2I56A 2JK2A 3W6YA 4Q4OA 3TWBA 2J7CA 2PTZA 5FEXA 1KRMA 4D1JA 1XV8A 2OYKA 4MJ2A 3DAQA 4B5TA 3T42A 3BLDA 3A12A 2WMJA 4O0ZA 1W91A 3B8DA 4XIAA 2XH2A 4DO7A 1S1RA 2DZPA 4LAOA 3TNOA 4X0NA 2PWGA 4E0CA 1PS9A 1SFTA 5CC7A 4BJHA 3RU6A 1MW0A 2DPEA 3NQVA 3ITCA 1AZ2A 4IL0A 4JFUA 1F6YA 4GZJA 2Z24A 4L65A 3BLOA 3V0SA 1HNYA 3QH2A 3BE7A 3U4AA 4AFYA 3W7JA 4DBWA 5G4HC 2YDQA 5T9CE 4JTUA 1OC5A 3STFA 2RFGA 1W0MA 3LPGA 2P0OA 1E6ZA 5CZSA 4LVGA 3SAZA 3A5FA 3BMVA 3PZIA 3EXRA 3CQIA 4R53A 4YVPA 2YA0A 4RXGA 3P61A 3L4TA 5GJPA 7REQA 3WF1A 1RXOB 1J12A 3TJXA 2C91A 2ABBA 1Z6KA 1U1JA 2XGZA 5BWAA 4IP5A 3CMFA 1BYCA 4NIRA 1XLFA 3UCCA 1B9BA 5I5RA 4BK9A 1UKSA 3DYMA 4U10A 1UH3A 2WMIB 5I06A 3DDMA 1J2WA 2G4JA 1YE6A 5IHSA 4WDTA 5REQA 1TUFA 4AD3A 1GKRA 3GH4A 2AL2A 5LGZA 5D30A 2PMQA 3A9BA 3NIYA 2QNEA 4Q4QA 1VKFA 4QSFA 2DT1A 3ES7A 2NV2A 4LUSA 5GQBA 2WKLA 1Q6GA 2BXZA 1ZNNA 4IQLA 3U7BA 3CQ0A 2A5HA 1Q6LA 3EWZA 3PZOA 3G3MA 4GX8A 3L65A 1K6AA 5IRPA 4AHPA 3VGBA 4QX4A 3ARXA 2PBOA 4MB1A 2VD9A 4KRTA 2QCEA 4WJEA 4FOJA 4FEZA 4GCXA 1AODA 3IEBA 3O16A 3A5VA 3PC0A 4JN6A 5FL0A 1LLOA 2BHUA 3U2OA 3AUJA 2G5WA 4J28A 2Y5JA 1RBOB 1TPEA 1YDVA 3WQOA 3NQFA 4CNSA 1IXQA 4C60A 4NYUA 2RDTA 1FWJC 4UFLA 3TQPA 3DU0A 4X60A 4AUBA 3MMWA 5I00A 3SUUA 4MMWA 4J4KA 1K7XA 2OR2A 4C6JA 3HV9A 4PUNA 1M1BA 4OU1A 4WDXA 4UMCA 4AZCB 2VRQA 2ZQ0A 4D6FA 4JOMA 2DIEA 4NJGA 3SJNA 4L4LA 4HU0A 2B81A 1D3CA 3LB0A 4XUGA 1TYGA 1TVLA 3AMCA 1I2RA 1LT8A 3GH5A 4UNIA 1B1YA 3MI6A 4LRSA 3R12A 1LORA 3GVQA 4RDVA 2HROA 2PU1A 1HKIA 4D6IA 5DO8A 4NZCA 2GJXB 3QLLA 4DNHA 2QMJA 1W1YA 4INFA 3B05A 4GE8A 3N2TA 3PB2A 2Z2AA 4LBRA 1QWGA 2G3FA 5G4EA 3S83A 1AL8A 2NUWA 4O53A 4H01A 3XINA 3H2EA 5AHFA 3UG5A 4PA8A 5HDRA 2UY2A 2WNNA 2Q71A 1L6YA 1FDYA 3FXYA 4RDWA 3H53A 1H7OA 4JNYA 4KBXA 3S2CA 4E2BA 4JIIX 3BW2A 2F6KA 4DJED 3S4TA 1K9EA 4LSBA 6TAAA 1HQTA 2H9AB 1JZ2A 2QUUA 3HJEA 3I4KA 2OLSA 4ZXOA 1OWQA 3K46A 3VKAA 3RN6A 4HU8A 2IKHA 1YYAA 2UBPC 3WLQA 4XISA 1F7BA 3KVMA 1T96A 1NFGA 1UOZA 2XVLA 4O52A 1W6TA 1QNVA 3MWCA 3ZVIA 4PTXA 3UWVA 5LNRA 2H3DA 3FCPA 5AHMA 2BGSA 3E5PA 3BOXA 2X1UA 3NNTA 2XSBA 3B9AA 1EQPA 4HNNA 1ICQA 3CAVA 5T9BG 1DPMA 3HO8A 1W1B1 4H4IA 1N7KA 5DT7A 1W3JA 4JICA 4MG4A 4Y96A 2BVYA 3UJFA 3FW6A 3IGSA 3RM4A 1G4SA 5HNUA 5FEPA 2FFCA 2NWRA 3TA6A 4Z08A 4NRRA 1XIHA 1Z69A 1PCKA 1GOQA 3NM1A 4IZGA 1YNYA 1Y0EA 2G8ZA 3GVVA 2XWDA 8RUCA 3PY2A 3ID7A 3NQAA 4YYCA 3HF3A 4GI4A 3W4RA 4A3YA 4U4MA 1M53A 1OD0A 4K39A 1LRNA 1Q85A 1QJWA 1SZEA 1GOMA 1DIEA 4DI8A 3NZRA 4DX3A 1XC4A 2QIWA 3IUHA 3NZGA 3JZUA 3H55A 2HNEA 1MYRA 3T78A 5I3JA 4N9CA 3S2MA 5A8MA 4GI9A 3UWQA 5DF0A 3LG3A 1PKMA 4JFVA 4LB4A 4CQBA 1RPXA 3KHDA 1UW9A 1PO9A 3E74A 4FAMA 4CQDA 3NWRA 4H1ZA 4XZNX 4XG1A 1YW1A 2YIHA 4U2ZA 4C6CA 2E1DA 4JX6A 5HWJA 5TNVA 1TTJA 4AVOA 1RPKA 1WYIA 1E1CA 3ARWA 4HA4A 1M7XA 3N1AA 1BTCA 2OT0A 1EFZA 4ZFCA 1OM0A 2YXXA 2OLAA 2OX1A 3MUXA 2GGGA 5A6SA 5SWUA 4Q22A 5D9MA 3RM9A 3GXFA 1LQ2A 3ZO9A 5HJXA 3HJZA 1IT7A 3EGJA 3VDCA 4PUJA 3C86A 3O0FA 1TPUA 3ENLA 3NQGA 3CUGA 2WO5A 5AHIA 1JD9A 2QJIA 3M0JA 1VPYA 4A8RA 3LHYA 1RA0A 3Q65A 3C2VA 3VIMA 4OJYA 1VJSA 1D9EA 4M6QA 5JIWA 4ICMA 1C91A 1NWSA 2DP3A 1H1YA 4K8GA 3DFPA 5EPDA 1AW1A 4HYRA 1VFMA 4L6DA 1W1TA 1EWEA 2Z1XA 4IPIA 2F61A 1WP6A 2XVNA 4JN8A 2VELA 3GR7A 2PLJA 1GTEA 1REQA 4B5WA 4YYFA 3GC5A 3THUA 1KFWA 2RDWA 3ITTA 3DFOA 1XIFA 3AU6A 2PWDA 5ABFA 3CUJA 3EOOA 2XG9A 1W3LA 4PCPA 1MQPA 3EEGA 4AH7A 4ZA0A 1S5MA 1EZWA 4XZIA 3BV4A 1HKMA 4IPJA 4RPQA 2F9RA 2HMCA 3HQ1A 3IJ6A 4EIVA 4BQ2A 1UH2A 5C9ZA 3LRMA 1ME9A 4MNMA 4D8AA 2Z1KA 3TW7A 3CO4A 2WPGA 1DQUA 1GOWA 1O5KA 3IWPA 1RZMA 3DOPA 5C70A 2O7QA 1EJ7L 2CLFA 4WGXA 4RZ5A 4DLMA 4HT3A 4XKYA 1DJXA 3WLOA 5AFDA 3JZEA 3NQ7A 3II1A 4BQ3A 4WDWA 3LXAA 1UH4A 4AD2A 1VB9A 2BGQA 3EPMA 1DIDA 1ZALA 1AH3A 4A05A 3RG6A 4FOUA 3LGEA 1U5JA 1Y5XA 4IPNB 1GEQA 3ITVA 4FR6A 4UQCA 1F6KA 3UETA 3VE7A 3ATYA 3O07A 2GSJA 1GCYA 1XHGA 4MUZA 2PFHA 3MV01 2OPJA 5FJTA 5ABHA 2VX4A 1PEZA 4GRSA 1DXEA 1E5JA 5FJOA 3CPRA 5LNWA 2PS2A 3WJWA 3CASA 3UT0A 4MTVA 4QLLA 4JEJA 2G4FA 4JHMA 3VDAA 4H9XA 2EXOA 3PBYA 4A21A 3MP3A 4ZQNA 1W1IE 3V35A 3MT1A 4AMCA 2E5DA 1PTDA 1FKXA 3CL8A 2JGYA 3QBUA 2D0FA 4Q6JA 1U83A 2ALRA 3DBNA 3S2JA 4XKMA 2GJPA 1W17A 3SRKA 4UCFA 2O92A 1B90A 4QDWA 3PBVA 2TRSA 2WW5A 4OT7A 1V3KA 4ZOAA 2H9AA 3M0IA 4E5TA 1K8XA 4DZ5A 4WUIA 1UMYA 3SQLA 4GY7A 2RJGA 1XRTA 2BZNA 2DZTA 2AMGA 1MVYA 4LCSA 3MUZ1 2AGKA 3DENA 3LPFA 4Q8OA 1LOLA 2FZBA 2XIJA 4AVFA 3K1DA 2TSYA 3V75A 4FLOA 3MHGA 4HOZA 4BF7A 4NILA 1TELA 2YXGA 5L6UA 3H54A 4DXKA 2R94A 1E3XA 3F03K 1JPDX 3S2LA 3TK7A 1RBLA 1X6LA 3KVKA 4S1FA 1PYFA 3EWDA 1PX8A 1I4NA 3S5SA 2TPSA 1GK8A 1UP3A 2WPBA 4JL2A 1M01A 5LIKX 4GVFA 4UTKA 2AQVA 1XKYA 3VCNA 1ZJHA 4ZTYA 1NP0A 4XZWA 1K6WA 3I7RA 2DFAA 1W5PA 1ITXA 1H7WA 1L6FA 5H1WA 4K36A 3GX9A 4QLKA 4LYRA 3T8QA 1W9VA 3R4IA 3WQVA 3GYCA 3CZJA 4IGMA 3OLGA 4V28A 5CG0A 3AMKA 5A8OA 1K4GA 3I7SA 1FX6A 1YPIA 1O68A 3QTPA 4KPLA 5F7UA 1DWJM 1P4CA 1PDZA 3GBDA 2YSWA 1A4MA 4FNUA 3T08A 3KTXA 2DSZA 2VMFA 3F7JA 5HQEA 4DUXA 1BPLB 3TYAA 1S2TA 4KEZA 3ES8A 3WNPA 1E70M 1JDEA 2OZ8A 1BWKA 4NXKA 2P88A 4FB7A 4Q4PA 1CWYA 2ZDSA 1QT1A 5I3GA 4A22A 4YCOA 3OG3A 3KTCA 2W66A 4QEEA 4NG3A 1YEYA 3HTWA 1NFBA 4WZHA 4C1KA 5CSUA 7PTDA 3WK1A 3LGGA 3WLTA 3P2VA 4C7FA 3NDYA 1J0KA 4PEEA 3RLUA 3BANA 3WNOA 4O12A 2J7FA 4QNEA 1NFPA 1DJHA 4REQB 1QAPA 3WIJA 1K9DA 4DM2A 1DV7A 2MUCA 2YW4A 4PN2A 5KSWA 5HR7A 4N6EA 4GQGA 2REQA 4J3TA 3A13A 4UNKA 3C0SA 3POHA 1WUFA 1P7TA 4HSOA 5A2CA 2PZNA 4JN7A 3IV3A 3E0VA 4YVXA 3WDHA 4DNMA 3S2NA 1M68A 1OX6A 4DQWA 3EEZA 3BJFA 3GFZA 3W88A 5DN1A 1FWWA 1QHOA 4I90A 3LY0A 4M5PA 2OXNA 2PA6A 1PIFA 1UZDA 3SI9A 3BLLA 4A8IA 2PRHA 1UIOA 1ZQ5A 2W5FA 4HK5A 3FHAA 4I3GA 5AYIA 1BVWA 3GVRA 1VBGA 2OZ0A 3N73A 2GJLA 2FZ8A 4OV4A 1OYCA 2DH3A 4LRTA 4EWND 3IJ8A 3BV7A 3QQ1A 4MY1A 4PBGA 4Q7BA 2QDDA 3IJDA 1IEWA 1MNZA 5BXPA 4DEFA 2PDUA 1VPQA 3BAIA 2BMBA 5PTDA 2WSRA 3CLMA 1H1NA 4N02A 2WNQA 3W1UA 1TWIA 1KFJA 3LD5A 3P74A 3LDVA 1KCLA 2AOSA 3UD6A 1QFEA 3WNNA 3VXGA 4ZMGA 4WRHA 1H3GA 1J93A 1IWPA 1K9FA 1M65A 1VHCA 1XIMA 2VR5A 3TV8A 1ME8A 1ISWA 2ZA2A 2BDQA 1F3EA 3FVDA 3GDMA 4GYFA 4IH3A 2R1PA 1R3YA 1OT2A 1WQ5A 3HPXA 2OWXA 2RAGA 1I2OA 5E9AA 4AVNA 3THCA 1UP0A 4C6FA 4DJFA 1EJWC 3DFNA 3SN0A 4EANA 4IGHA 2FPYA 4Y9OA 1DHPA 5MHBA 1XIIA 3PSVA 1SUXA 3LQGA 2CLMA 1W9UA 4H9TA 2PWHA 4ICCX 1V79A 1YKWA 3E2QA 3OYZA 1GPFA 2HS8A 3VDHA 1DVJA 3GZ3A 1WDDA 1XFCA 5CZJA 1SFJA 1GHRA 5C71A 1X96A 2FH6A 1HKVA 2DZSA 2E5BA 2QZRA 2E9MA 1FWRA 4S23A 5J8LA 5CAHA 3NZPA 1OFDA 2FDSA 3SR7A 1ZRQA 2E28A 3U0HA 1FHUA 5D38A 3UJRA 4X63A 1H5VA 4GIAA 2YGYA 4WSKA 4LJ3A 2NXHA 3QZAA 4KGJA 4KCUA 4H9ZA 3L12A 5RUBA 1K7FA 3N2CA 1JUKA 2YCEA 1CGTA 2DW7A 4L5ZA 2VFHA 3KVJA 3LLDA 4K6AA 5TQLA 1Q6OA 3FA3A 4Q4KA 1PIIA 3HQPA 3TN6A 3EXSA 4IOTA 2I5QA 3BGGA 3W2LA 1SFLA 2TMDA 3QHOA 2AKZA 3PTMA 5ABGA 2V30A 2VC7A 2WZTA 2VZUA 4F4RA 1H61A 4DUOA 4UOJA 4JS3A 1A0EA 2Y85A 4DUVA 4PUMA 3LXCA 2TODA 1U5VA 4RNIA 4QAIA 3UR8A 2WSKA 1PTGA 4FXRA 2FB2A 4ZE5A 2BVDA 4L9XA 3AIQA 2OU4A 2Y63A 1XUUA 2VCAA 3EA2A 4AX6A 3E0IA 1TJPA 4QSHA 3W73A 2NT0A 3W2NA 4DBDA 1B3OA 1JCTA 2XYLA 3WLPA 2XIMA 3KS5A 1WXYA 2J47A 2GGHA 2A3EA 1QNPA 2CZVA 4ZXLA 2QXWA 3S6TA 3W24A 2Z26A 3WBEA 1L2QA 4W7UA 1KKOA 4JY8A 4OBRA 2Y5SA 5A6JA 4DPQA 4MJZA 3QN3A 4PCFA 1FWGC 3ZXWA 4EPKA 2AAMA 3L4WA 1AFSA 1UWQA 2VOMA 4S3JA 4FLSA 1VZWA 3PWIA 2YL9A 3XISA 2OTDA 1R85A 3TXVA 3EB3A 1FBAA 4AX7A 3TSDA 1XQLA 4CN4A 2F7FA 2YZRA 4H7ZA 2OSYA 3BW3A 1S5TA 3B06A 4D6GA 4F0RA 1OK6A 3KL0A 4CN1A 4YXGA 3W7OA 4NSBA 4NI8A 4S39A 3IK2A 1K1DA 2C19A 2BNJA 1TPH1 1QPNA 3LI0A 1VGAA 2QUVA 3MANA 4LANA 1N82A 3G1YA 1VD6A 1FWTA 3V36A 1LBFA 1UD2A 3B0VC 4F0SA 4X2RA 1G5AA 2ZUUA 1KKRA 3WQGA 3MHFA 2OT1A 4JD4A 1ITCA 3W29A 4FR1A 3VNMA 2PDFA 1Q65A 4F0HA 1A47A 1WO2A 3E2SA 1X7FA 4JPGA 3STGA 1W1VA 3MCNA 1UYQA 3W75A 3WQ5A 3TW6A 1ENUA 1OC7A 4IIGA 3C61A 4GI6A 4HN4A 1OY0A 3QOKA 1FWAC 1B3YA 3L66A 2RDUA 4H3DA 1PWMA 3WH7A 1SJDA 1WDRA 4HPXA 1H1ZA 4KEUA 3N11A 4DI9A 5BU9A 5EBUA 1KFKA 2QJNA 2ISDA 1D7KA 3TN5A 4PB3A 4LS1A 4HSHA 2HTMA 3SIMA 3HN3A 4ZQMA 2DW6A 4GUHA 1P43A 1KW1A 2DIKA 4E4FA 4TQTA 1Q7ZA 4JZ5A 2X1SA 2CCRA 1GJWA 2W61A 4HTBA 3GM8A 2XM1A 2WLYA 2DV0A 4AZGA 4J3SA 1VRDA 4NVTA 4Y9AA 4E2VA 2EPMX 4XAYA 5AYBA 3OBAA 3F4NA 3FEMA 2ZA3A 1R3TA 3BQ6A 4D6CA 4FNRA 1VFLA 3QV9A 2QHAA 5KITA 3CHDA 4DJEC 3TVAA 4KCWA 3TR2A 3KWSA 1FWBC 3AIEA 2O55A 2NVCA 3CXOA 1VEPA 4GC3A 4W7WA 2CLHA 4ZB2A 3ORWA 2J9YA 1KM1A 1JDAA 3ALGA 3DFYA 3WL0A 4GXPA 7A3HA 1K8CA 4S3KA 1EHAA 3BO9A 1X7IA 3EDKA 1AJ0A 3M5YA 3S1GA 3SIZA 1EYWA 2YB4A 4UTUA 3N29A 1R3VA 2ZFAA 3NM3A 3KP1A 3THAA 3VDGA 4F2BA 3OP2A 4KEMA 3TLQA 2JF6A 1KM3A 1Q45A 1VF8A 2B4GA 5E6ZA 4UB9A 4IMCA 4B4FA 5EFDA 3IRSA 1IE7C 3UA4A 2VURA 3RLVA 3DYPA 3NO5A 4QHRA 1B57A 1M03A 4FNSA 1CGXA 4O1EA 5JBDA 1AJZA 2WWDA 3VX0A 3MVTA 5HANA 4MM1A 2I7GA 2J62A 3DKJA 1E0WA 3P0XA 3F2DA 1WBHA 4MWAC 1XLGA 3NSNA 1Y65A 5DBTA 1IXPA 2YYTA 4FX6M 1X8FA 2ZYFA 3TJ4A 4L4OA 4GIRA 3SY1A 4B16A 5D33A 1T40A 4JTHA 4LNCA 4UFKA 5HPOA 4IF2A 4D9PA 1DTUA 3EDJA 4LVAA 2FGZA 1OBAA 1J11A 2ZTKA 4Y2WA 1XBZA 3VD4A 3CEUA 2GWGA 1W5MA 3QGKC 5GNZA 3TH6A 3F4WA 3VNDA 3IPWA 2R1LA 2WJEA 3RRXA 3K8LA 2EPLX 2GQ3A 2XHYA 3VILA 3SQMA 3TDFA 2GK1A 2A21A 4LB3A 2JKAA 3UPWA 3DC8A 3EWYA 4K2SA 3A21A 3MDUA 5CBBA 5FJJA 1IWBA 1LZOA 4Q8TA 1TMQA 1ELSA 4MNLA 5C9RA 4P8XA 2X0HA 5BZAA 1JCLA 3WMSA 2ACRA 4IM4A 2CIPA 4JIRA 5EMUA 1ISVA 4LUSB 1P0NA 4XK2A 1KBKA 4YL2A 4HSNA 4Z1YA 3HQOA 1O4UA 3NPXA 3IJQA 3N14A 4GGHA 3PPCA 4O1DA 1SQ7A 3AXMA 1IEXA 4MJ4A 1IYXA 3BW4A 4MPKA 4S2BA 1XF0A 2OSXA 1MXSA 2GQ8A 2VC5A 4LWWA 3OQEA 3T2QA 4O13A 2VFEA 3L7RA 5AZ0A 3VZYA 4A3RA 1W3IA 4A3HA 4V15A 3CAQA 4I9JA 3R0DA 1U1HA 4GMEA 2ZRZA 2Z1BA 3RAOA 4LEQA 5E9XA 3M41A 5DXXA 1SFSA 5DFAA 1Z3NA 4WJXA 3EB2A 4TXEA 1I2NA 3BG9A 4HN8A 1RQBA 3TONA 3G6MA 3GTHA 4JTAA 3HMJG 3BVJA 1UKOA 2OG9A 2HRWA 3HMCA 1ICPA 2VM8A 4TX9A 2GGJA 1HVXA 3CWHA 1H0GA 3B04A 2VFDA 4YNGA 3VOIA 3LRLA 3GU9A 4FK9A 2POTA 3TC3A 4IGNA 1SO5A 1XINA 3APTA 3B9DA 2X41A 4LTSA 2FTWA 3KBSA 3PR2A 3NEHA 4PL1A 4LS0A 2D1ZA 3CV1A 3L4UA 3BAYA 3M0VA 1V0MA 3SADA 3V5OA 3CPUA 3A22A 3MKCA 2VEGA 4GVIA 3WLKX 4US5A 4M3PA 4XZLX 3WLLA 2XH4A 1JL8A 4K8HA 3W76A 1ZTVA 2WSYA 4P8UA 3PULA 3DESA 5AC6A 1OFEA 1E9ZB 4FZIA 1XG3A 3IGUA 3JRKA 3LCHA 4GO8A 1YDYA 1XH2A 3GHTA 1JCYA 3MUIA 3TFXA 1XL9A 4M6PA 4ENLA 2MANA 2JEPA 2QCFA 4PFMA 1GG0A 4H6QA 1XYFA 3KCJA 3O6AA 3N12A 1RALA 4F0LA 2X1TA 4U3CA 2V67A 4QDPA 4I5UA 4GNJA 5HNRA 3ZYZA 1OG6A 1OCQA 4W84A 1WBJA 3VM7A 2NX1A 2HBVA 3SY8A 1NF7A 2X1RA 2YR1A 3D3AA 2CKRA 1POJA 2C16A 2VC9A 4UTHA 3PUEA 3BC9A 3DCPA 4HPJA 3T6CA 4EF8A 4HA3A 3UNTA 2V2HA 4OOUA 2ZOXA 4O57A 2XN1A 3LHVA 4DVOA 2FHFA 3B9OA 1KWKA 4GFSA 3LCXA 2INEA 2E67A 1GOXA 2PWVA 1K02A 2WZIA 3VCRA 2VDIA 3L2IA 4GZEA 2GJRA 1XG4A 3VGFA 2DZWA 1WUEA 4JIQA 4YU1A 4DZHA 4ILSA 1F4AA 2ADAA 3EX4A 1KBJA 3CTTA 2H8ZA 1M7OA 3CM4A 3RPMA 1KGUA 4DF1A 4C91A 2VCBA 4I8YA 5C55A 5C0QA 4KWWA 4OQVA 2HVNA 3G1FA 3ZWTA 1IZCA 1GHSA 5CLWA 2PWUA 1X97A 3Q67A 4J27A 1I1WA 3NL2A 4OV9A 3WBAA 2IW0A 3P7YA 1Z32X 1P0EA 4KWUA 5A1AA 4WVXA 5J04A 3LBOA 5LXXA 1ZS2A 4AY7A 1CGYA 3N2XA 3UR7A 2PGEA 4J3XA 3MJMA 4R3UA 1N8FA 1BTMA 2VD8A 4OZOA 3DYOA 3SUVA 3VOHA 3BAXA 4UTIA 2YXOA 4ZBCA 5I3DA 2VO5A 3JU2A 2Y8UA 4IL2A 2F38A 4Q6XA 2FMOA 3SM0A 1QI3A 3NXLA 1I2PA 1AQ0A 1ONWA 1EIBA 4P8VA 4LOCA 3JW7A 4UMAA 3UWEA 1TR1A 3VOJA 2FIQA 1E9YB 3GUGA 4PMRA 4E6MA 3N04A 3PP7A 3I3DA 3O9NA 1OSEA 3PJXA 4QE1A 4C6KA 1EJXC 1OQFA 1QOPA 1VYSX 4RDYA 3TN3A 2WNWA 1F2JA 1R38A 3FEQA 4PMVA 3MO4A 2BY1A 1LOQA 3ABSA 4JTCA 5CPQA 3PBMA 4CGTA 1TR9A 1PIGA 1Q7QA 3G2GA 3R89A 2NXGA 1F76A 1KRCC 3ATZA 3WFLA 4R85A 5CPLA 3PHAA 2V3DA 5BWFA 1UWAA 1ZAHA 3ZJKA 2ZZ6A 3G8EA 3BOLA 2AL1A 1GQJA 5IBXA 1BG9A 1HJQA 4JKKA 3W72A 3LI1A 4ZQPA 3RHGA 1FWEC 1XD0A 3GH7A 3K13A 3NQEA 4JYDA 4TV6A 3S0CA 1RK6A 3W23A 4V27A 4AZIA 2J79A 3R8RA 3S6OA 4FIQA 1G6CA 3ABXA 1PZ2A 3G8RA 4HYVA 5IFTA 4JTKA 2PD9A 4NASA 4ADSA 4M80A 2EF9A 4UTTC 4UNLA 5FJIA 3FGCB 2Y7EA 1OFAA 3HG4A 1EC7A 1RSCA 3WH8A 1UR2A 1YTDA 4ZQCA 2PU0A 2BXVA 3E2RA 3MUY1 2VGIA 2E6AA 4EK7A 1F5ZA 1TWWA 1XLMA 1JRCA 1V6TA 1P6CA 3UERA 4B4HA 1EC9A 4GGBA 1C90A 4LNYA 3KUMA 3R25A 4ML9A 1V3MA 1A5OC 1B4KA 4NNBA 2VZTA 1CB7B 4C6LA 5IFPA 1QHPA 2FPTA 3RDKA 3T9PA 4LGXA 1WZLA 1EUAA 1VC4A 5HJYA 3EWUA 5CBJA 5DBUA 1YBQA 1EJTC 1K8ZA 4DUWA 2Y24A 3U6WA 4F40A 3L4XA 2XTKA 4IMEA 1KBLA 3BJSA 5AC5A 5GNYA 4BZYA 2DT0A