4K1GA

Structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPADSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into mechanisms of 3'-5' exonuclease activity and removal of bulky 8,5'-cyclopurine adducts by apurinic/apyrimidinic endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Endonuclease 4
total genus 102
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4k1gA00
5B7ZA 2QULA 1XLAA 3JU2A 4QE1A 3WQOA 4PGLA 1A0EA 4ZB2A 3QYSA 4QDPA 4LNCA 3KBNA 4ZBCA 6XIMA 1XLGA 2XINA 4HGXA 1XLHA 3QXBA 4OVXA 2HCVA 3UA3A 4W4QA 4ZB5A 1O1HA 1XIIA 1DE5A 1BXCA 4EACA 3QC0A 4HNOA 4YTRA 2NQJA 1XIDA 4DUOA 3XISA 3DBNA 3VNJA 3VNLA 8XIMA 4XSLA 1QT1A 3TVAA 2NQ9A 3KBJA 3XIMA 3GNXA 4HHLA 4J4KA 1DE6A 2QUMA 1MUWA 3U3HA 1A0DA 2GLKA 1XYLA 1XYMA 2I57A 3KBVA 4XIMA 3M0YA 3KCOA 3OBEA 1QTWA 1S5MA 3VYLA 1XLJA 2NQHA 5H1WA 3KBWA 3P14A 2Q02A 3UU0A 1CLKA 3M0MA 1XLMA 4YTSA 7XIMA 1I60A 1DIEA 1XLDA 4A8LA 3AYVA 1XLEA 5FA5A 1XLFA 5XIAA 2J6VA 4A8IA 2ZVRA 8XIAA 1BXBA 3M0XA 4XIAA 4YTQA 1A0CA 4GLEA 5XIMA 1XIBA 2HK1A 3P6LA 1XIEA 4US6A 1XLKA 2OU4A 2XIMA 1D8WA 4PFHA 5XINA 3U0HA 1DXIA 3AAMA 3KWSA 4QDWA 3ITVA 3KBSA 1XISA 1DIDA 3CWHA 2ZDSA 1XIGA 3ITOA 4GJJA 4XISA 1MNZA 3VNIA 3L23A 3IUHA 3C0SA 4E3VA 5EMLA 4GJIA 3N4AA 5B7YA 5AVHA 4X63A 4YTUA 9XIMA 3M0VA 3TC3A 4HHMA 5C9ZA 1XYCA 2QUNA 3BDKA 3ITTA 4QEEA 5J8LA 3VNKA 1K77A 3BZJA 9XIAA 4X61A 1XYAA 3KTCA 3CNYA 3M0LA 4QE5A 3VNMA 3AALA 3QZAA 4Q7IA 4YTTA 1XP3A 1XINA 1XICA 1XIFA 3ITLA 3IUDA 2QW5A 3KCLA 3BANA 6XIAA 1XIJA 5EMKA 4DVOA 3DX5A 2GUBA 3NGFA 5EMJA 2XISA 3UA4A 5EMMA 4QEHA 3BZGA 5TNVA 3CQHA 1QUMA 3C0QA 2I56A 4QE4A 3UXIA 4XSMA 2GYIA 2X7VA 3CQIA 3LMZA 3AYTA 4KW2A 3KCJA 1OADA 3C0LA 4X60A 5AVNA 2GVEA 4ZB0A 3XINA 2X7WA 4G56A 4A8NA 4A8RA 2G4JA 3KBMA 1XLLA 3CQJA 1XLBA 4K3ZA 1XIHA 4XKMA 5B80A 3ITXA 1TZ9A 4K1GA 1XLIA 3M0HA 5H6HA 1YX1A 3BWWA 3ITYA 2HK0A 1I6NA 1GW9A 1XLCA 4EAYA 1XYBA 3FVMA 5I7GA 3IUIA 1XIMA 2G0WA 3CQKA 1S5NA 3UVAA 4GQBA
chains in the Genus database with same CATH superfamily
3CB8A 4IP5A 2D22A 2OKTA 3QR0A 3TQKA 3NJ3A 2OR2A 5DBTA 1H5YA 4MKSA 4DM1A 3NL5A 3XISA 3WL1A 4H6RA 1UYQA 2PCEA 1QT1A 1Q7ZA 4AD1A 4H7VA 4HHLA 4KCTA 2ZZ4A 1DE6A 3WIJA 3LM3A 4ZL1A 1Y65A 5BYWA 1EGVA 1ESWA 1IGWA 2FPYA 4LWWA 3C2VA 4NF7A 4C6LA 3GC2A 4O4WA 3B9OA 4DF2A 1J96A 4ERIA 2CBVA 5CZ0A 3KL3A 4GLEA 1VFUA 4BZYA 2Z1VA 1G4TA 4J40A 5A8OA 1KGXA 4AZCA 3FJ6A 3WLIA 1NP2A 4HHMA 1G1YA 3MSDA 1HKIA 4LOCA 4EK7A 4YHGA 1UASA 4PCTA 3BOFA 3FVDA 2GOUA 1EDQA 1RD5A 3SN4A 1NF7A 2SFPA 4ADUA 1T5AA 3E0WA 1GOIA 3R12A 4X9YA 3MYPA 2CBUA 1DL3A 1AH4A 4KFPA 3V7PA 5GJPA 4S3BA 4TVCA 1N82A 2VFHA 3C5QA 2BVTA 3W53A 4JTRA 3VGFA 4WXYA 4PSRA 3LRLA 2VL4A 1P6CA 4FXRA 1X38A 5CCZA 2WVVA 1XBXA 1H0GA 3L65A 3K4AA 4UTWA 4DBDA 4P5UA 3NQ2A 3MYOA 4XUGA 4H8UA 5I3FA 2ZYFA 7TIMA 1JCYA 2GGIA 2HPIA 3Q67A 1UMLA 1EJTC 4O28A 3GXTA 4JTUA 5HNNA 3UEQA 1W9VA 4O16A 2XVNA 1C8VA 3V4BA 3QOKA 2BOEX 3O07A 5K2ZA 1H09A 1OWQA 1DWIM 3UJFA 5FJOA 1GEHA 2AL2B 2Y61A 1KC7A 3A4AA 3TW7A 4H00A 3MBDA 4POCA 3P80A 3CZ8A 2PLCA 3DAQA 3P0WA 2Y8KA 4IM4A 1W91A 2G41A 2V69A 1TA3A 3BO9A 1T6MA 4RDYA 1IWPA 3GG8A 3VI2A 4DYKA 3W76A 2PGFA 4RUBA 2IMRA 1J6PA 1UR8A 1BXNA 4N42A 2FFIA 4GQQA 4PBFA 2OOGA 1A5OC 2PRHA 3N19B 6A3HA 1XDMA 3UCQA 4H2HA 3H4GA 5AHEA 2OQHA 2YOCA 3H7UA 3AXKA 3GTNA 3VABA 2OZ0A 1UKSA 4HNLA 2ZC1A 1P7TA 3ANYA 1M7PA 3ES8A 4L1WA 1DHPA 2Y8UA 4JYDA 5LSMA 4XD5A 5KTLA 3VIFA 4N9CA 3OLDA 4EX4A 5CPLA 1A50A 4C6FA 1PDYA 4ZZ9A 1XGDA 2WC7A 4UTTC 5KZDA 4CVUA 2OKOA 3IJ9A 2PD9A 4P8UA 3AQUA 1HVQA 4GZ7A 3UR2A 3S1UA 1TR9A 2Y63A 3KBWA 1FX6A 1UB3A 1WCGA 2PGEA 2IUZA 1UR4A 2DT1A 3TSBA 3TA9A 3JR2A 2QZRA 5JUVA 3W71A 3DBPA 3I6EA 4GJIA 1PUDA 4JBRA 3IGHX 1IEWA 1H7XA 4JN7A 5HA7A 2QAFA 3RX3A 1B4EA 2FGLA 5FEZA 3LPPA 3S3GA 3PM6A 1DJGA 1R3YA 4UQ9A 2JBMA 4CCDA 1A49A 1HKKA 4MMWA 5AECA 1I2RA 4LNYA 3BLDA 1CXIA 2RDWA 4XV0A 2CIPA 4ZMGA 2E8YA 1YPFA 2OFJA 3D3AA 4K8EA 1RHCA 1ONEA 3T55A 2NV9A 4X22A 4PUKA 1BWKA 3PZGA 1PKNA 3P5YA 3ZJKA 2XIBA 4BQ3A 1ZALA 1A4MA 2O55A 4C65A 1P48A 1W5QA 4JD4A 3L4UA 4LC6A 1JNDA 1VH7A 1OFEA 2FIQA 4OV4A 3NQAA 3CC1A 4AVOA 3E5BA 3WQ4A 4LAUA 5C2CA 4EE9A 2OTDA 1KRCC 3UY8A 2YCJA 3A9BA 3DG6A 1GVQA 1E70M 4WD0A 5CG7A 2J6VA 2H3BA 4YWIA 4HK7A 5FF4A 3A13A 4U31A 3DENA 4FOJA 3T42A 3OA5A 1UP2A 2DDXA 1GVEA 2CHRA 1GPWA 2VDHA 3BLEA 1V0NA 1GZJA 1ZB5A 1JZ4A 3UWQA 3M0LA 4XB3A 1SJBA 1E6ZA 3FKKA 1W5NA 2FVKA 4UFMA 3UPWA 2P8CA 3WG6A 3GR7A 2YBUA 4GH1A 1EZ2A 1UIOA 3S2CA 1NELA 3NVDA 4IQDA 1ONXA 3AYRA 2WVTA 1NH6A 2BY0A 1RZMA 3EB4A 1BSLA 1A53A 3E12A 1X6LA 4L4LA 4D6HA 1ZGDA 1KO0A 3KAOA 1UR3M 3RYSA 3EPOA 1XQLA 2J74A 1NWTA 4O50A 2E68A 3PWGA 1LRTA 3WEZA 2J88A 5F2LA 2BSLA 3NG3A 2DGAA 3IVTA 3GYCA 3HBLA 4C6OA 4B5UA 3UY7A 2PRMA 1FWWA 1H63A 4BF9A 5BXRA 3DCPA 2FH8A 1NOFA 4O12A 2W62A 5AHMA 2CZ5A 3WH8A 1HT6A 1R2TA 4ZGYA 5HNRA 1TA3B 4NXKA 3WH7A 3HA1A 4S3AA 3NDYA 4MNKA 3WD2A 4XK2A 1PXGA 2O7QA 3LUTA 1CWYA 3KRZA 3UXDA 3ITOA 2FVLA 1JZ5A 4UNLA 1D7FA 3TE9A 4MFEA 1R8LA 1VB9A 2Z1BA 4RZ4A 4J3UA 3ITTA 3IARA 1EC7A 1FFRA 4GQRA 4KGJA 1NP0A 3TW6A 3WBWA 3QKZA 3TXZA 1EWEA 4ACZA 2EPHA 4MZYA 3UNTA 2JEPA 4IMAA 5IOBA 3IWPA 2X1TA 5M17A 2WO5A 1P7TB 4WOZA 1CGVA 4G2DA 1MFUA 2ABAA 2IPJA 5DN1A 2YDQA 3N14A 4CVWA 3WNPA 4OOZA 4WF7A 1UWAA 2BY1A 3RJYA 4LYRA 1FWIC 4NNCA 3V36A 2F9RA 1UA7A 3EMCA 3LGGA 4BWLA 3OTRA 2NWSA 4ZSTA 2MUCA 2PGRA 3ZLHA 1PJ9A 1H3GA 4DB7A 2ISSA 3MBFA 4HYVA 2WPGA 2D73A 3THCA 3FA5A 2P0OA 1PV8A 1O12A 3MMWA 3O06A 3TOPA 4MPQA 2PDWA 2PDNA 5DX7A 2X42A 3LTYA 5HPCA 5FOOA 3LLFA 4LUSA 2Z00A 2XIIA 4IIHA 3PB2A 1W31A 3SQSA 4GC3A 3CS2A 1VBRA 4GIYA 3WUBA 1AZ2A 5E0CA 4UTWC 3P6LA 2OU4A 4D6EA 3JVAA 4IHCA 3S0CA 1M03A 1ZCCA 2VKZG 4O10A 5LNRA 1LLOA 2CZVA 3WD0A 3RR4A 2FVMA 3RIKA 1D3HA 5G1YA 3WENA 2CXGA 1UG6A 1HTIA 3GR8A 3BG9A 3T07A 3TZNA 4GKTA 5DXXA 4A29A 5LIXX 3H2CA 2D20A 1GVRA 2Z0IA 3TWBA 3HZ3A 2VRJA 5HANA 4Z2KA 3QR1A 3DI0A 3LCIA 4O17A 4P2VA 4J3WA 1BYDA 4ML4A 2HVMA 2BS9A 1KFKA 2BODX 3EEZA 5HINA 3D47A 1I8JA 1X1NA 2ZKMX 1W1B1 4E2DA 3MI6A 1QJWA 1TV2A 2ZZ3A 3TTOA 3MHUA 4GI6A 4BQ2A 2IQDA 3F7JA 3NZRA 1CXHA 2YJQA 1GQIA 3CXOA 4F0SA 1U5VA 4DXKA 4HGXA 1J0IA 4OVXA 4LALA 4AX6A 3ZIZA 4IH3A 4F79A 3CEUA 1KM2A 3V5OA 3FX4A 1YE6A 1F05A 4O0ZA 4MJMA 1X7FA 1VBHA 2QS8A 3MS8A 2XZ9A 4IIDA 1ZL1A 3LLXA 4I9TA 3AMLA 4J2MA 3TYAA 4TTGA 4PBGA 3IV8A 1NWSA 4DBWA 4AXKA 4E8GA 2GQAA 3EYPA 3AWOA 4JFTA 1SFSA 2JQXA 3CL6A 1HX0A 5I23A 1KR1A 3QQ1A 1Q13A 4KWUA 4AZ6A 5AHNA 3WNKA 4MG4A 1H1NA 4QG9A 3R8GA 4ALDA 1L6FA 3FOKA 4HN4A 3HV9A 1UWUA 1Y5VA 3P61A 4QSFA 4HOXA 4KW2A 3SURA 3H22A 3VM7A 5A2CA 1IQ8A 3BV7A 3IJDA 1SZNA 1KRMA 2HE8A 5IBXA 2FPVA 2VGGA 5HJXA 2AQVA 3QFEA 3W29A 2WMHA 2A7NA 3CWOX 1E15A 2ISFA 4PL1A 3BSHA 4H8VA 2E6AA 4ZB2A 2ALRA 4Z1YA 1DORA 1PKYA 3LNPA 2NQJA 3VNLA 1W2VA 1UJQA 1LZOA 3CH0A 4GGBA 3NL2A 1PZ3A 2GLKA 1FWGC 4XIMA 5FJTA 1Q8AA 3NEHA 1WP6A 1EJVC 4GY1A 4DPPA 3PZTA 4RZ6A 4C6QA 1REQA 3BH4A 3OGVA 2F6KA 1WPCA 4X0VA 4HHHA 3LCFA 2VR2A 3IV3A 1DKWA 1DPMA 5EL1A 4HSHA 3PULA 2VD8A 4MADA 4AD5A 5HWJA 3G2GA 1OG0A 3DECA 2FJUB 3N13A 1TZ7A 3BAYA 3PZNA 4OGZA 4JNZA 4AVNA 1PX3A 3NQDA 2J13A 4JQ4A 2FMOA 3OVGA 3VFCA 2ZRZA 3SCSA 3TTYA 4MB4A 4QE4A 5BNKA 2NXIA 3FXGA 4XVDA 2TYSA 3L67A 1M53A 3WNMA 4AMCA 2BOFX 3A3WA 2WQPA 1H7PA 2Z1XA 1RH9A 1ME7A 3AJ7A 2WWCA 1XLIA 3R43A 3KLKA 2HK0A 1K9DA 3B0UX 4B5XA 1NFPA 4UTLA 3IEBA 3QW3A 3EMZA 3ZVHA 4LUSB 1I0DA 5CBIA 2RGLA 4R5EA 1M65A 1O7AA 1CGUA 3UERA 3O0KA 3FKRA 3W85A 3A4WA 2PU0A 4DWSB 3T40A 3H70A 4M80A 4LAOA 3F4NA 4P8XA 3VYLA 1IR2A 1C8QA 4MJ4A 1WQ5A 4MIMA 1EO5A 4QISA 3KZPA 1W1VA 4O1CA 4ZXLA 2E6YA 4FR1A 1Q85A 4DAIA 3VM5A 3H12A 4JTJA 1TRDA 4PTWA 4W85A 4YTUA 5TD4A 3BDKA 3E49A 1YE4A 3STCA 4LBUA 3M46A 4EOUA 1MUMA 3N1AA 5BXPA 2DSVA 2VUYA 3W7HA 1QNOA 1EHAA 5HUPA 3GVGA 3DHPA 4YCPA 3W4RA 4IJRA 1JYWA 1WKYA 2PP3A 3TMQA 2I56A 4IIGA 4ROPA 2ZWYA 4K8GA 3SFWA 4N4QA 1YTDA 3CQJA 4LF2A 1Q6FA 1PYFA 5MKGB 4AFYA 1O95A 1W8GA 3RGTA 1SU5A 3AC0A 3WJSA 3QGKC 1E6RA 3QLLA 5A6LA 1K7EA 1AH0A 1OCQA 3PPHA 3MKVA 2J7EA 1W1PA 4BS0A 5A2BA 1A5MC 2G97A 4B5VA 2ZX8A 1FWNA 5JVLA 6XIMA 1XRSA 2WSKA 4NZ3A 1TWIA 4DBSA 5FAJA 2BASA 2HVNA 2OYMA 3DGRA 1J79A 2VGBA 3FYOA 1D8CA 2FDSA 4MNJA 4FNQA 1BAGA 5KMYA 4W9TA 3CUJA 2F6UA 4J28A 3NO5A 1C92A 2FTYA 1E0WA 3HIJA 3UU0A 4YS1A 3VILA 5HMFA 4PUMA 5CZJA 3UJRA 1B2YA 4LVFA 2W4XA 3BG5A 1VHCA 2Z25A 1H62A 1OK4A 3N6QA 2EXOA 1ME9A 4C6EA 4C6BA 1H7NA 1PPIA 2Q71A 2V38A 4DUWA 4ZTYA 3GFZA 3TR2A 1FKXA 4GYKA 3W82A 4RNFA 5CC3A 2OODA 2GUBA 3GH4A 3AIQA 3PBWA 1HL2A 1JFXA 2H8ZA 3A6OA 2DVXA 2GUYA 1MSSA 1T40A 4HNTA 3MO4A 3VKBA 3E96A 1CB2A 3ZVHB 2INEA 4ZO8A 2BY3A 4PUUA 1H61A 5I3DA 3H21A 3L66A 1RY8A 4GUFA 3KHDA 4JTAA 4NRRA 5ABGA 5BROA 1FQ0A 4C6PA 1HXJA 2XUCA 5FI8A 1G4EA 2XINA 4MKNA 3WQDA 3VD9A 1ADDA 3ZSSA 2WM0A 5REQA 3TP4A 3VOCA 3N25A 1V3LA 4MJ2A 1JD7A 2DW6A 1W1A1 5IDZA 1FHVA 1VRXA 4KIRA 4NRSA 1Q7MA 2YDSA 2QIIA 2VC5A 1TV5A 2JFEX 3QZEA 1WNOA 1XPGA 2OX1A 2TRSA 3AROA 4IICA 3WMBA 3CWHA 3EDJA 2ZDSA 1JPDX 3V16A 4GE8A 1R9YA 1YBQA 1VFMA 1OIFA 1VEPA 3LBMA 4QJ4B 2C1HA 3C2OA 1MW0A 1ICQA 3PWIA 4Q7IA 2C13A 3KS5A 3HG3A 4RZBA 1XRTA 3JRKA 4RNHA 3G1DA 4OUIA 8A3HA 2AQOA 4B4FA 5MKGA 2QVNA 2NX9A 3TN4A 3THQA 4S3CA 4XSMA 3TLQA 1T99A 3C0LA 3N2TA 2DSKA 3LZ3A 2KAUC 2G4JA 4ZR8A 1QXLA 1Z7AA 2OWXA 1RPXA 2WMIA 3I3DA 3T78A 1FY6A 4ZQOA 1E0TA 3UETA 3CV1A 5I09A 3ARYA 3WLMA 2Z7KA 1VLIA 2IPWA 4U5IA 1B9BA 4MTVA 2Z1WA 1QW9A 1X1ZA 2RGMA 3MU7A 1ZP4A 3URAA 4J9JA 4AH7A 1KWGA 4XX6A 1R3VA 3OG3A 1XF0A 4LYPA 1TPB1 1O1HA 1DHKA 5DY2A 4UCFA 1QI5A 5FF0A 2BHZA 3RO8A 3MDUA 4GX9A 1Y5WA 3C4UA 2NQ9A 1VJIA 1FWTA 3RM8A 1QNVA 3ABQA 1QO5A 3P84A 4ICCX 1H49A 3LHZA 3L2IA 4NY2A 1EXPA 1BYCA 3QV6A 4LCQA 1JQVA 1WKFA 1P43A 4O54A 4O1AA 1XIEA 3KWSA 4O4VA 2NV1A 4M56A 3EWYA 2NVDA 5AFDA 1K7XA 3BZJA 1B5TA 2VR5A 2G5WA 3CUZA 3B04A 3TYZA 3WBAA 1GOOA 3AUOA 3ARXA 2H3DA 3SQLA 5BOEA 1KBKA 1CXKA 2A85A 4N2YA 1B4KA 2VDGA 3G1HA 4P7LA 4W87A 1E40A 3TYBA 3WQCA 3S5SA 3H2FA 3TA6A 5LXXA 3MI3A 4ES4A 1A5BA 4U3CA 3PFMA 1RD6A 2DORA 2FQIA 3M5VA 1DQXA 3LV5A 2AGTA 3LHYA 2C3ZA 1POJA 1FA2A 5AHIA 3C8FA 3IJ8A 3LMYA 4NHVA 1WE5A 4WKHA 3VUPA 1W0MA 1GKRA 2GSJA 2O92A 3UGRA 7ODCA 1RLCL 1UKOA 5HNUA 1TPDA 3UQNA 3HG2A 4D9PA 3HGSA 4RR4A 1PX8A 2OLHA 3DFQA 2BX7A 8XIMA 2E6FA 2XVKA 2BFGA 2VEGA 2YB4A 3AIUA 1KFJA 1WOAA 3FSUA 2QDDA 4XUYA 1W5OA 3WYZA 2DH3A 3RF9A 1S5WA 1TJ0A 4W7WA 1GVFA 5FJRA 4R85A 3FNDA 5G1MA 2R82A 1WZKA 2HV5A 4MKVA 1VFFA 4OWGA 1OABA 1Q6LA 4CNTA 1CZ1A 3K4WA 3AHZA 1TCMA 1MEWA 1MRQA 3VKDA 4IL0A 2EKGA 1JGIA 2ZADA 1E55A 1QNSA 4X61A 1TTIA 4NJKA 1XV8A 3QR3A 4JX5A 3WMSA 3OP2A 3E2RA 3GC4A 1K4GA 3ALFA 3WLRA 4Q8OA 1IXOA 4DVOA 3G1RA 3W1LA 1IYXA 2POZA 4DO6A 1A3XA 4B5NA 3GHSA 2WZTA 1TWZA 3MSRA 3W1RA 3VIMA 4FF7A 3L7RA 5HJLA 3QY8A 3ITXA 3ARZA 1EPXA 3USBA 2GJXA 3KOXA 1DTUA 3SN0A 1V8EA 5HQMA 2AKMA 3F2CA 1DJIA 1XFCA 4PN2A 3LSCA 3HU7A 1UQYA 2G95A 3M0JA 4DYJA 2AMXA 1BXCA 4H2CA 4RW5A 2PODA 1OC6A 4DO4A 1AQHA 4KF1A 1US0A 5BMXA 3W38A 3LPFA 3LCGA 3AO0A 3GM8A 3EB2A 1TJ1A 4LJ3A 4FX8A 3NDZA 2XVPA 3F03K 2JIEA 4Z1BA 1K02A 2FYMA 2R6OA 1TO3A 1Q4NX 3TTEA 1Y7VA 3L4YA 1DIDA 2VX4A 1K70A 3EWXA 1CGWA 1D3GA 1M04A 2XWEA 3F4VA 3RAOA 2QLYA 3DKJA 4TVDA 2WAGA 1QOQA 3VKJA 3B0VC 1EEXA 1BSIA 3OGRA 3U7BA 3R89A 5M3WA 4GISA 5K3VA 4XZWA 1EB3A 1HO4A 1BRLA 4GVFA 4KFNA 2BP1A 4TUFA 1UR1A 3QOMA 2C0HA 3FYYA 1OYCA 2OEKA 3GE7A 1K03A 3G3MA 3WF3A 2TAAA 4Q7BA 3MJMA 1MDRA 4DX3A 4REQB 1GVOA 4F0KA 1JAKA 3A24A 3WEOA 2CBJA 3LCHA 2DFAA 4E4UA 5DELA 1U1HA 1YRRA 3LHVA 2YBVA 3U7VA 3R13A 4ZO9A 2QGYA 2VXNA 1X96A 4Y96A 3B9NA 1A5SA 4NZ1A 1S39A 3UPMA 3H2MA 4M6QA 5JIWA 2J7CA 1ZBVA 5F2IA 1SZRA 1FCQA 4PZVA 4JKMA 4Y6GA 2XDFA 3N2XA 3AICA 2C14A 1OQFA 2PWUA 1EP3A 3FSTA 4V1XA 4KERA 2PWEA 2WZHA 3F4DA 4GFSA 2BHYA 4N9DA 3ZQ9A 4OQVA 4KIEA 3DC0A 1PL9A 1KCZA 3VKAA 1VFSA 1DXEA 2XGZA 4G7EA 1UKQA 2VC7A 3E2VA 3RU8X 3W1QA 4UOJA 4A05A 6CGTA 1EBGA 2NQZA 4GUJA 1R38A 3RNDA 3VD4A 3T0DA 5F2MA 1GJWA 4NAFB 1Q6QA 2YCLB 3M7WA 4AMAA 3MWAA 4V15A 1ML1A 3IK4A 4I8DA 1NM9A 4KKXA 1Q63A 3I7RA 4LT9A 5LHEA 3ARVA 4PTVA 3DHFA 5EPDA 4Z1DA 1V6XA 3TXVA 3GZ3A 1RCQA 3B97A 4NKCA 3BCFA 5I7GA 3SUSA 3JZEA 1KGUA 4CU7A 4XBKA 3VE9A 5M5DA 4RZ5A 4IX2A 4UQCA 2D2JA 4GKLA 1A5NC 5E9AA 4BWLC 3AXMA 2ZFAA 2X1SA 4ZB5A 4ZQPA 3F2BA 1X7IA 1Z42A 4JCLA 4R7OA 2V63A 3E02A 2P3ZA 3GH5A 3SDOA 4UZUA 3E2SA 3NL6A 3QY6A 4LW7A 3VOFA 5H1WA 4XD6A 2XN0A 4W8LA 4Z0SA 1VF8A 1XLFA 3OODA 2PWHA 2V5DA 2GK1A 3ZR4A 3U6WA 5BWAA 3GG0A 1Z6KA 2BVWA 4IIBA 3K5XA 2ZQ0A 4F9DA 2JIWA 4CQAA 1VCVA 3VCRA 3N29A 4JTHA 3GKAA 3GB6A 2Y1HA 2OJPA 1AD4A 1ZUAX 4MWAB 1FUYA 1O68A 4UTIA 4E38A 3WJWA 3M43A 4L9YA 4OIFA 5E93A 1UJPA 3HMCA 4PMVA 4C6NA 1DWHM 2CKSA 1E3ZA 4IFRA 1DJWA 2IKGA 3UXLA 1FCUA 4PMXA 2V3FA 2O9RA 4WSKA 3GIYA 5GJMA 3L5MA 3IANA 3LERA 4QJ1A 4RDWA 2A7PA 3G1SA 4QDPA 2XH7A 3CHVA 1E9IA 2PAJA 4C6IA 3NQBA 4XBJA 4AIOA 4CU6A 4CEXC 3MT1A 3HURA 4HOWA 1X6NA 2E67A 2YA0A 3M47A 1QTWA 4AC1X 1UR0A 4GBUA 4GABA 3USZA 3N9SA 3FS2A 1T7LA 1QWGA 4R3UA 2O4MA 5IBXC 5DT7A 2CESA 5FA5A 1XI3A 3SAZA 4EPBC 2I5GA 3BPWA 3S2LA 4M5PA 4F2BA 1ICPA 1FHUA 1K9EA 4TXEA 3TC7A 4HP5A 3UG5A 3N4AA 1GYLA 4E6MA 4F2UA 1I45A 4WIWA 1ISWA 3GK0A 1RR2A 1KKRA 3L2LA 4NJJA 1N8WA 3V18A 2ACQA 4MNMA 2J7FA 4IGHA 3A9IA 1SZGA 3GNNA 1XJBA 1N8IA 3WDIA 3SCNA 2GYIA 4JR5A 1Z89A 1K8YA 4LGXA 1KLYA 3C61A 3HPFA 5CLWA 1AJ0A 4K37A 1XIHA 4HYWA 4XKMA 3NUKA 3V35A 1MW2A 1TKKA 2Q3RA 3LQGA 2E28A 3TK7A 4L1XA 2WW5A 1J6OA 4H8HA 3AMDA 2CWNA 2WNNA 4S1FA 1FWFC 1OIMA 3MUAA 1QHOA 4IQEA 3R2GA 1O4UA 3HV8A 4PMRA 1I1WA 2QJGA 6ENLA 3IJIA 4NASA 4IXHA 2POTA 4LFYA 1AG1O 1GKQA 1AQMA 2Z24A 1QPNA 4JN8A 3C2FA 4WOQA 3GU1A 3NXLA 2XPKA 4PE8A 3QTPA 5TAOA 1QR7A 3R11A 3GZAA 4JFUA 2CLHA 1IEXA 4H9ZA 5CGMA 2EEXA 1IEVA 1UZHA 1CGXA 3KXQA 4JAWA 4F0RA 3U2ZA 2YFOA 2XSBA 4J3XA 2VX6A 4JCMA 1G69A 3GVRA 4S3JA 4GXPA 2PI6A 3AUJA 1DQUA 1PZ2A 5KEZA 3K1GA 2Q8ZA 4G1NA 1Z44A 5J04A 1EYWA 3G6LA 3W3OA 3HQ1A 2WSPA 3WBYA 3BARA 2WZEA 4JGDA 3V75A 4MZ1A 1LBFA 2G0WA 3WFZA 4NZ4A 3PBGA 1FWHC 1J8VA 3TNOA 4CCZA 2E7FA 2D3NA 3BXWA 1XKYA 2QPXA 1GHSA 5J5RA 3GD6A 4GZIA 4AD4A 2V2HA 1B0IA 1XBYA 2XN1A 3PZMA 2Q09A 2ZDRA 2GK1B 4IQJA 2MNRA 3EDKA 2NW0A 1YNQA 2F2HA 4M19A 4MYXA 4JY9A 3GW3A 4QJ5B 5F4SA 1EJXC 1V6UA 2QUVA 4JPGA 1XWYA 4JTLA 4L6DA 2EBNA 2Q8LA 3G3DA 5AOUA 1H0IA 2J47A 3PR2A 1CW2A 1ZPTA 4MF4A 2GDVA 4Q8WA 1IIGA 3O6YX 4RE4A 3AS1A 3QKEA 3BSGA 1OGBA 3VMPA 3RR1A 3HGRA 5A1AA 4QE5A 5C54A 2ZZ6A 2YL6A 4D6GA 1NSJA 2QCMA 2DZTA 5CKSA 2P0IA 2PPGA 3MKKA 1P1XA 1FBAA 4DZAA 4MUZA 1KFLA 3DG3A 2VD9A 3RMEA 3DEQA 4A8NA 2BZNA 1EKOA 2J4GA 4CUCA 4XZIA 2IPFA 2AAMA 3EWWA 1A47A 3VA8A 3CAKA 1SYTA 3REQB 3QV9A 1OFPA 1XCXA 3T09A 4PGLA 3W2JA 3FLUA 4K7VA 3IVUA 1R3SA 3QXBA 1E0VA 2O56A 1XIIA 1YTKA 1QW8A 2E5DA 1ZS2A 4GI8A 2J7BA 4DWSC 3QFWA 3K1DA 1JUBA 1UH3A 4UTMA 2F6XA 3TFXA 2UWFA 2Y24A 3QMTA 4WX2A 4FHAA 1Q65A 1DQWA 3CIVA 3B9AA 2NQHA 3EAUA 5DLCA 3T2OA 4UWMA 1KW1A 4ZENA 4GZJA 4YHEA 4GOAA 2RDUA 3UR8A 1VBJA 1SJCA 3AHXA 2VGIA 1XH0A 3UZXA 3B05A 2PGWA 1O5XA 3MP4A 5FF2A 1JIBA 3SBFA 4YJ5A 5HNTA 1W17A 1ENUA 2B31A 5I3KA 1JCLA 1TB3A 4QG8A 4B5WA 2G96A 1EQCA 5BXSA 4DBUA 4HCLA 3QHOA 4MWAC 1HL8A 4Q32A 4GJ1A 4O1DA 1SFTA 3BE7A 1N2VA 4RKAA 3VD5A 5DMYA 2YDAA 4WCJA 3U2OA 4H8NA 5DXYA 3PAJA 3T8QA 3UR7A 2GJNA 4QX4A 2PDKA 1NOWA 2ZOXA 3CPUA 4PUWA 3V1PA 4QS6A 3P0XA 1AW5A 2V2DA 1MWOA 4EAYA 3CLWA 3V0SA 4R7JA 2UV8G 3MVTA 3WF0A 3PFRA 3GQYA 1Q6DA 5GJNA 1ZTVA 4UFJA 3ORWA 3TVAA 3H8AA 2WJZA 3QEZA 4S23A 4NJIA 5IXEA 2BXZA 1S2WA 4L4MA 3E3HA 4UQEA 2CNCA 3K46A 4YTSA 3NZGA 3VKCA 3N6JA 1EEPA 4O53A 1GOXA 2R1MA 4OV9A 1C7SA 3T7VA 1D8WA 1EFZA 3VDCA 3NGJA 3FEQA 4XTIA 3AXIA 1L9WA 1OBAA 1LWHA 2E9BA 4DM2A 4UTKA 3BG3A 3B3DA 4LCSA 4GBDA 3OHIA 4EVZA 3W1PA 3W1NA 3FHAA 3TSMA 3RXZA 2PSNA 5D38A 3ITLA 3G1AA 2QXWA 5T8GA 3SEPA 1LUCB 1VJZA 5FL0A 3KW3A 4GVGA 1B3VA 4LF1A 5ABEA 3MUIA 4DPQA 4O52A 4HYRA 4GACA 1E1CB 4FOKA 3H7VA 5DCDA 4OHQA 3ZT7A 1XDJA 4ADTA 1XD1A 3WQ6A 4RDZA 3OHMB 3AS2A 4DRSA 2DP3A 4ECLA 4RCXA 1ZQ5A 5D04C 4YPJA 3OLIA 1QMLA 2DSWA 4GFIA 4ZO7A 4GMEA 3UWZA 4I6KA 4TV5A 1AL8A 4BF7A 2VRQA 3DIPA 1VR6A 1WV2A 2I7GA 3A22A 4IWWA 4GCXA 3BGGA 1HVXA 1EJSC 5D8ZA 5GNYA 5JXQA 5DANA 3S5ZA 2WKLA 3NM1A 1RAKA 3WLKX 4E8CA 2WMGA 1VBUA 2DJXA 1W1YA 4GXWA 5AYBA 4E0CA 5A8GA 3C0JA 3DOPA 1LG1A 1MUCA 4AIEA 2GOKA 4PYSA 4ZOBA 3PP7A 4JXCA 1QI3A 3TYDA 1S2CA 2I14A 1VEMA 1B30A 3PY2A 3O05A 2PTDA 4LS0A 3H2AA 4BI7A 5C2XA 2V5LA 2NXHA 4DXVA 1JF5A 1O60A 2C1GA 4IJBA 5A6MA 1WUFA 1R2RA 2R8WA 3GXIA 3PVFA 4LVDA 4DAFA 3IAPA 1LCOA 3FFSA 5FJPA 3WDRA 4IG2B 2HQAA 1G5AA 3S5NA 3AIVA 4HSOA 3MANA 4FMVA 5FEPA 1V3KA 3QHNA 5I79A 2V30A 1DIKA 3GXFA 3M16A 2R1KA 1KXTA 4AD2A 1X6UA 1HP4A 3MUY1 1W37A 4AU0A 1KTBA 1C93A 2BOGX 1K9FA 3BUVA 3TTQA 3GBDA 1NDVA 4RXGA 1FCBA 3WSUA 1CDGA 4PMNA 3HPXA 3PF3A 3LXAA 3GHTA 1JR1A 4MB3A 3PSWA 4HTYA 4IQLA 5I78A 1E6SM 1U5JA 3FEMA 2XFFA 4O11A 4J35A 5I0DA 4D1IA 1Q6CA 1QHZA 1C9WA 2VWSA 4KRTA 3GDMA 2X40A 5ENLA 4FNSA 1XLDA 1OGSA 3ZMRA 5FJUA 3VTRA 3SCOA 1GONA 4Z08A 4GJJA 3ZVIA 1M68A 5BRQA 4B9YA 5HATA 3LEPA 5A8PA 3N15A 4WR3A 3SSJA 4EAMA 4JYFA 2IW0A 1MXDA 1V6TA 1ZCOA 4RPQA 5JQ9A 1VFOA 2FLIA 4WXZA 3GFYA 1RJQA 1E1CA 2HBVA 1BKHA 1LRQA 4JICA 4D6CA 1TUFA 2VTFA 4ZTXA 5AVNA 2FHFA 1HG3A 2YLLA 5DMLA 4DJDA 4N9BA 3W23A 4CN1A 3L4WA 4CD8A 5CBBA 1PTDA 2PDMA 4JIEA 4GXMA 5LYRA 1DP0A 3EKLA 5G2WA 4H41A 1RP8A 2ABBA 2Y6ZA 1KXVA 4LTSA 3STFA 3PZIA 2UY4A 4DJFA 1I2PA 1G94A 5IM51 3IGUA 3LD5A 2WMKA 1ODUA 2CHNA 3VOGA 4DUOA 4HMDA 4Y2WA 4GUGA 4L4PA 3GX9A 1AH3A 5H8UA 1MUWA 2QKFA 1P5BA 2CWXA 3WF4A 3ATYA 1BKSA 1Q2RA 4W8BA 5G5IA 4EPEC 2J79A 4D6IA 2Y7EA 3MSYA 4GYPA 1F6YA 7TAAA 4A3QA 4D6DA 5IHSA 1QFEA 1OCJA 5BRBA 1FDJA 3FAWA 1PSCA 5U7SA 1CI1A 3ATZA 4E3VA 2OGYA 5BU9A 1XR2A 2QUNA 5A8QA 4IG2A 2WLZA 1CXFA 3QF0A 2I5QA 3WUEA 1OYAA 1OSEA 2REQA 5A6TC 2Z1SA 3UWUA 4BR1A 3BANA 3W88A 4Q7NA 3SUWA 2XVLA 2DZBA 1TSIA 3VGGA 2A6NA 5A69A 3S9YA 1NQKA 1GHRA 2NQLA 3LM7A 1LT7A 3W25A 3IJQA 1IT0A 3RU6A 1YDNA 1KB3A 1EA9C 1EJ7L 3MTWA 3M4HA 2ADAA 5I07A 4YWSA 5GNXA 1UPPA 7PTDA 2B0MA 3M1ZA 4Q4KA 3N73A 4G8TA 5CZTA 1GW9A 3GR4A 3T81A 1UD6A 3GYEA 4UTUA 4UBPC 5AN7A 3WH6A 4MM1A 1ODZA 3W00A 2A4AA 3CPRA 2WSYA 5EGRA 1PIIA 5D2XA 3FXYA 4J3TA 3BCJA 4WVXA 1YADA 1HJVA 2HNHA 3LB0A 3SN1A 2F61A 2Y7GA 4JNMA 2YXXA 1IV8A 1JCNA 2PU1A 4NZJA 3ZR6A 3M5YA 1RALA 3IJ7A 4FF5A 3O2LA 3FAXA 5I00A 2PTWA 4JQAA 1OB0A 1LRNA 3OBKA 2B7OA 3FA4A 3S5YA 1KBJA 1D2KA 3HM7A 1FWCC 1H2JA 2JE8A 4CLMA 3UXAA 4MB5A 3NURA 3BLLA 1EIBA 3F5JA 4PRWA 3MC5A 1VD6A 1E72M 1OJXA 4HPGA 3WQEA 3QJAA 2RH9A 1D3CA 2MANA 1F3XA 3SADA 2L5HA 3VDHA 1KLZA 4S3DA 3NQ8A 1TRIA 1YBQB 1HN1A 1H1YA 4LBSA 2HE5A 1OFQA 2RFGA 2OZTA 1ITQA 2CKRA 3HB9A 3WBEA 3QV8A 1UD8A 4TV6A 3HMJG 3TNBA 2ZICA 5EKYA 4UNIA 2DIEA 1K8CA 4C90A 3T0CA 5LA2A 1XM3A 3MQTA 2YL5A 1KM3A 3EX1A 4MAVA 1WA3A 2VFGA 2NX1A 2TSYA 2E0PA 4QE1A 4BY3A 1D9EA 5FSEC 4GINA 4S39A 2DVUA 1TFVA 1SMDA 2GVGA 2Z2UA 1EH9A 3ICJA 2BVYA 2YL9A 4GI9A 4ZQRA 2JK2A 1E0XA 3WQWA 3WJYA 3WF1A 4UUIA 4CCEA 1TMHA 3PTMA 1L6SA 1JYXA 5A6BA 1HW6A 4X3ZA 4D8AA 4EF9A 4K2SA 3LNMA 4K7YA 1OVDA 4JZ5A 3PBVA 4A22A 1GT8A 2ZVIA 1XISA 3W70A 1M41A 2XYLA 2WKGA 3IK2A 3GAKA 4WDWA 4W5UA 2A3BA 2VFDA 2NUXA 1OG6A 2VCAA 1GOMA 2Y5EA 1EGZA 3UF9A 1JXJA 3MKCA 4QIUA 3SCPA 2YA1A 1H7WA 3BJFA 4C1NB 1WXZA 4OFCA 3VAVA 5FSDC 4DNMA 2OSWA 5FD0A 1M7XA 4X60A 3TJ4A 2BGNE 4MZ8A 4B92A 4PC8A 3NM3A 1HP5A 1WBJA 3W7NA 3L4XA 4K1GA 3BMWA 3EXRA 3CZJA 1RVGA 2WM1A 3TKFA 3G5EA 5D9NA 1MMFA 4RNJA 1XDLA 4K39A 5L9FA 1UD4A 2NSXA 3KP0A 3FYPA 1KA9F 1KXHA 1HZYA 2Y2WA 3M07A 4RDVA 3GLCA 3UP8A 2ISVA 2O0TA 4KWVA 1CXEA 4N4PA 1TMLA 2ZXAA 3BCDA 4X2PA 4UTHA 5I02A 3WLTA 3TN3A 1YNPA 3O63A 2CLEA 4B15A 3O1NA 3PN8A 3VZZA 4UMAA 3GSMA 3GXPA 2P76A 5LGXA 3AYVA 5XIAA 4ORMA 4HU8A 2G3JA 1DXIA 3LXBA 4CN6A 4Z1AA 1G6CA 2X2GA 3LU2A 4NAEA 1LWIA 1FWSA 2PLJA 4KQNA 4QITA 2WV8A 3Q58A 2XIOA 2NVCA 4ZQMA 2ZA1A 4WY0A 5CXPA 5DQPA 3NQ6A 2DUZA 2CETA 5EMMA 4W7VA 1OCBA 3VPLA 4B90A 3KL0A 2CZDA 1E56A 1XC4A 5G1TA 3VK5A 4J5NA 5ECUA 2ESCA 2O9OA 1UP3A 1EUNA 3S2NA 5LIWX 3AMGA 4C5YA 2GGEA 1PTAA 1IWAA 1RCOB 5H6HA 4JX4A 3N2OA 3SM0A 3R79A 5F1UA 2CLFA 2OMAA 5CPNA 3UVAA 1EDTA 3W26A 4JIQA 4MDOA 5BOFA 4ZQNA 4C7GA 5CJNA 1D7KA 4F8XA 3ZWTA 1DE5A 3H6OA 2GJXB 3IS4A 3WQFA 3HF3A 3GTFA 5KZ6A 3GWQA 3U3HA 3LCWA 2ONEA 2VENA 1TV7A 2FJKA 4UTTA 1JDAA 1RY0A 4AY8A 1RV8A 1XLEA 2PWGA 4QLKA 2OWCA 3W1XA 5FL1A 4HCHA 2J7GA 1QOPA 3UCCA 2A2IA 2W67A 4O1EA 1ITCA 4NT0A 1RA5A 1YXYA 1EL3A 2XN2A 2HNEA 2VCBA 1GWJA 4FZIA 3T44A 2FTWA 2PWDA 2R9RA 3CNYA 3CAVA 2OLSA 4EWND 1MQPA 1QO2A 5A8MA 1VZWA 2XGIA 2YYTA 4QROA 2QCHA 4W86A 2PD5A 2VQTA 3DFYA 3W1AA 4GYPC 3MA8A 1KGWA 5GNZA 1W1ZA 1TR1A 3WH5A 2WCAA 4M1RA 4GIEA 2E8ZA 4IPIA 3POHA 4P8WA 5CSRA 1X98A 4HPXA 3VDBA 3DH7A 3EEGA 1AVAA 4KCWA 4FI4A 3VOJA 1THFD 3TZFA 5LNSA 1C8XA 3P81A 1ISZA 2XH0A 5HOSA 3H2NA 3KBNA 2Q8XA 5ABFA 3B4YA 1VJSA 4HNOA 5AZ0A 1ZY9A 2OT1A 1SQ7A 4Z0JA 1S5VA 4MVAA 1XGEA 3MB9A 2PDPA 4PSPA 2FMNA 1F9CA 1NIUA 3CWNA 4LPCA 2YZRA 5EBAA 1PIGA 2IS7A 3UR5A 2D24A 3BLOA 4KWOA 3ZWSA 3SCVA 2UZ9A 2DH2A 4TO8A 3CBWA 2P5NA 1PWMA 3SY1A 5C9UA 1VEOA 1GW1A 3TYUA 3F1QA 4D1JA 1F7BA 1N55A 2HRWA 4AF0A 1LWJA 1JQXA 3B06A 2XSXA 2PWVA 1J0HA 1UWSA 1W9XA 4RLIA 1M6JA 3KVKA 3TC3A 1X39A 2YBTA 3N4FA 3PUGA 3M6YA 5AC6A 5CPTA 1CGYA 5CC7A 1GCYA 2VEIA 1FH8A 3KCLA 5C7HA 3UZJA 1GQNA 3CAWA 4KS0A 5H8PA 2CLKA 4NP7A 4L9ZA 2GUUA 4MY9A 3ZYZA 1SO4A 5SWUA 1OYBA 4A8RA 1TJPA 2A3LA 2VI0A 3IAQA 3EOLA 4NAFA 4XTDA 1Z48A 4LUJA 4UR8A 4PB3A 3CO8A 2QJNA 2E6DA 2JGQA 2W91A 4LANA 3TIMA 3RLHA 2ZWZA 3KM8A 3CZEA 1MEIA 2XHYA 1HKVA 3SSZA 2O9TA 3EA3A 3KOWA 3RLUA 3F4CA 1UKPA 5REQB 5IFPA 2FHBA 4O1FA 3ZO9A 5LNUA 3GG7A 4R9XA 1O5KA 1E0UA 3PG9A 1LOSA 1CB7B 2ZRUA 5DF0A 2GFTA 1XHGA 4A3RA 3WLPA 3TMLA 5LIKX 3REQA 1EO7A 3QMSA 5DEZA 1SW3A 1TVNA 2PBOA 1RXOB 3RO6A 3PBYA 3VCNA 2XG9A 1KCLA 1UHVA 4LB3A 5AC7A 4RE3A 1QW7A 1E9ZB 4M8UA 1DIEA 3RPDA 4ZE4A 3G0SA 3BURA 3EDDA 2D0GA 2GGJA 2XH2A 5I5RA 1G67A 4HTBA 1XPYA 1JF6A 2VWTA 4IPPA 2FDMA 4NQ1A 2AMGA 2VDIA 3CZLA 1XYCA 5HQLA 2ZUTA 5U4NA 1XRVA 3EOSA 1UH4A 4TX8A 1J0YA 4DZIA 3U48A 3HJZA 4J3SA 3UYIA 3EOUA 1E6QM 3S5OA 1W3KA 3H24A 4DWSD 4JKKA 1T0OA 3A64A 4DELA 3SR7A 3A5VA 4JIPA 4OBSA 4A2RA 1WAUA 4PCSA 4Y8EA 1W3LA 4W5ZA 1B1YA 2V6AA 1XLLA 1TE6A 4QHRA 3ENLA 3P74A 3SI9A 2Y7DA 3R94A 5M2FX 1JI1A 4L65A 2WZMA 3GDKA 2VFEA 4V27A 3SW6A 3WQ8A 1S5NA 4PMZA 3E9AA 3BMXA 5GQBA 1HJSA 3TROA 4JHOA 5G4WA 4MNLA 1SO3A 4MGGA 3DFSA 4L56A 3L5AA 4PEKA 4F0HA 1NWRA 2ZRVA 3URBA 1L2QA 4LU0A 1GTEA 1RJPA 3S83A 4ROQA 5F4WA 4IPJA 3ECQA 3EWCA 2ACRA 5EFDA 4TU1A 1NU5A 1W3HA 4B2DD 1MFVA 5I24A 1Z9AA 3OLGA 1RQHA 1KXQA 1AQFA 2ZVRA 4JTIA 3S2JA 4O8RA 2HK1A 3GHUA 1AD1A 5LNVA 3PTKA 4TVUA 4GD0A 3M9YA 4FNTA 3GNDA 1TIMA 2QCDB 3VNIA 3EX4A 1XQKA 4Y9MA 4LY8A 3T0AA 2HXTA 1K9TA 4CU8A 1DJQA 1GNXA 1YMYA 2F8QA 1R3RA 2D0HA 4QLLA 5L6UA 1ONRA 6ALDA 4B3LA 1WKDA 3L0NA 3MO7A 1BQGA 4AD0A 1J01A 3WFLA 3QMRA 4AY7A 4WGXA 5HQEA 5A5WA 4B16A 3W75A 1E4LA 2CEQA 4GVHA 2GVEA 2P88A 3PUDA 3AWNA 5AYXA 5CGTA 1YIXA 1R3QA 1UUMA 1NFBA 3KOYA 4HA1A 1YDVA 3R58A 2HTMA 4LAKA 3GDTA 4H9MA 3M0HA 1L8PA 5A2AA 1JJKA 2KZHA 1W9BM 3H4WA 5G2IA 1F5ZA 1QVBA 2ZZ7A 3CQKA 4JTCA 2XH4A 5BU6A 2Y5SA 4HHPA 1U1UA 3K8LA 3GNPA 3UPBA 2BG5A 1VYSX 4QRNA 4DLMA 4JQ1A 1P0EA 1K7FA 4CNNA 3VIJA 1J18A 2ZZ5A 1Q45A 2A3CA 2HS8A 3KTSA 2C79A 4KEUA 4A6GA 4PUEA 1UR2A 2F38A 2H8XA 1ZBKA 2QR6A 3TQPA 1KBLA 3OVRA 4LH8A 2BVDA 5FF7A 3R25A 1FCVA 4Y9OA 3VD7A 2JF6A 3H54A 3HGOA 4US6A 5EY5A 1SSDA 1YDOA 3RPMA 3C0SA 2J75A 1PCWA 3OIXA 4RPPA 2YPIA 2VVSA 2AKZA 3B8IA 4L6HA 4LV4A 2C71A 3TN6A 4PA8A 4HMCA 1UQZA 1OFRA 1L0PA 4HNNA 2HBXA 2V81A 5HAOA 1ZRQA 1QRQA 1CENA 4PRRA 2UY2A 4LQ1A 4OU1A 2C18A 2NX3A 2QDGA 5C7VA 2OELA 3G8RA 4AIUA 4QQUA 3AIBA 4KRZA 2O4QA 2PS2A 5JIPA 4CQCA 1LQAA 1VCGA 1LLZA 4GK8A 1BWLA 4LNCA 1K6AA 3NOYA 4XD3A 4RK8A 1U5HA 4C6JA 1JCTA 2WHMA 2AL2A 4PMOA 1EZWA 2WJFA 4I9JA 4KETA 3WQVA 3STGA 3B4UA 1KM5A 3C3NA 3EXSA 1F6KA 4QSHA 4S38A 3P82A 5FAGA 5HR6A 1JVNA 3JZUA 1WDRA 4O1BA 1KRBC 1UWTA 2ZRYA 3VC6A 2WVUA 4Q3MA 4LVAA 2R1NA 2QF8A 5FKYA 4HSNA 2YX0A 3ZJ6A 1PHQA 4IMFA 1XYAA 3W7QA 4LRSA 3NPUA 3G24A 4HA4A 2E40A 3E6EA 4CEUC 3IUDA 2TODA 1RP9A 1KCKA 2I9EA 1FDYA 2J24A 2E9MA 3GO2A 4MY1A 4WHBA 5TNVA 2Q01A 3CQIA 5DMNA 3QM3A 4REQA 1H7RA 4JX6A 3IIVA 4U4MA 2WYSA 2LLEA 1US3A 4PEEA 3NPVA 5BOOA 1FH7A 2ZX5A 3IIPA 2DZVA 3PNZA 2GJRA 1V3JA 3O6AA 3O6CA 1I6NA 4GYFA 4X2RA 3H26A 4O19A 5A6AA 3EA2A 3FDGA 1VCFA 4ATLA 3VZYA 3EMQA 4IPLA 5F4XA 4ZCWA 4DJEA 4LX4A 1PKMA 4D6JA 1EC8A 1SZEA 2ZX9A 4US5A 3VNYA 1QI2A 4PB4A 3DFTA 3SJ3A 1JDDA 3T2PA 4K68A 1V3MA 1S2UA 1DIOA 1PIFA 3F4WA 1UR9A 2E5BA 2HROA 2QCDA 1JXKA 3U4FA 1UPMB 3NEVA 2QCGA 4HU4A 2Z26A 3T08A 4A8IA 4H7CA 3DYMA 3GTIA 1H5VA 1QASA 1BF6A 3KBSA 1FOBA 4WJEA 1S3TC 2OCZA 4NX0A 3EX2A 3APTA 5ECVA 3DESA 4C60A 1VENA 3IGSA 1ZZMA 2EAWA 4M6VA 3AS0A 4Y9PA 3UYCA 4XAYA 4A3UA 1C9DA 1DXFA 3ISIX 2QCEA 4FX6M 1UD2A 4D8LA 3CMGA 1UCWA 4GX8A 3I3BA 4U3AA 2FTPA 4QQ3A 3BL3A 2ZTJA 1F74A 1YLVA 2GVLA 3E0LA 4ILSA 1YX1A 5A8NA 2IKJA 1E73M 3AOFA 4AYSA 2DIJA 1UZDA 3VDAA 1UUQA 3CO4A 4E4PA 4OBTA 1XBVA 3INPA 1L2UA 3AI0A 1PX4A 2VMFA 2INFA 4IMDA 3JUGA 4DUVA 4KMQA 1WUEA 3OG2A 4BEUA 4C1LA 4J27A 3KP1A 5E6ZA 1L6WA 1LLWA 1VFHA 3CT7A 4RV3A 2RDXA 2VHLA 1UD3A 2YYUA 4P7RA 5C8BB 5LNWA 4EXBA 3EA1A 3B9EA 3PC0A 5D2VA 3KX6A 3GXNA 3II1A 2D0FA 4NZFA 1C91A 5EMLA 2XJ7A 4IPNB 3HPSA 3C8NA 5C55A 1VKFA 4XZ9A 4QP0A 5DMMA 5AB3A 4YTTA 2FB3A 4QFUA 4AX7A 3WDHA 2ODOA 3O0FA 1Q2SA 4F3HA 1TTPA 1OT2A 1Z32X 8CGTA 1NF0A 4A4AA 3BOLA 4HPNA 3LYEA 4HK6A 2GDUA 3TV8A 5RUBA 1R30A 4C6KA 2ZCGA 1C3FA 1O6IA 3W72A 2CLIA 2VNCA 3W02A 3W1TA 1NJJA 1U33A 3L21A 2GSHA 4YVPA 3O3RA 1JZ3A 2Z2AA 3ZR5A 3ITCA 2X09A 2WZIA 5MHBA 2C19A 1ECQA 1B3XA 1DTNA 2GDQA 3R0DA 5HK4A 2I16A 2CC0A 1V93A 2ZXDA 2IQTA 1I2QA 3UZWA 3CJPA 5E6YA 3MZNA 1XGZA 3GDRA 1SJAA 2QPUA 3OZPA 3FHQA 1A4LA 1AK5A 2XU2A 2DSUA 3VE7A 1AQ0A 1OX4B 4AZHA 4X0NA 1CLVA 2RJGA 1W6TA 3W7GA 5E0FA 1ALDA 3W7LA 5DCEA 1KV5A 4QBXA 1I2NA 4UR7A 4S3FA 4Q4MA 3HQNA 4MSSA 4HPHA 2BWGA 4HK5A 4YYCA 1LL4A 3JW7A 4FA3A 1ECEA 3BAIA 4IUOA 4LEFA 4W88A 4YVVA 4GA8A 3AZSA 1EJUC 2WSQA 3U5YA 2QMKA 3E0FA 1QI0A 4OJYA 1OM0A 3LTPA 4S2CA 1VIZA 1OFDA 2X2YA 2ISDA 4E4FA 1OCNA 5DBUA 4Q22A 3UWEA 6TAAA 4IXXA 4GPNA 5EYWA 4WLCA 4GIAA 2IPGA 4XAPA 1BLIA 1XYBA 3MV11 3CUFA 4XAZA 3UWVA 1VBGA 2VEFA 2JGYA 2QHAA 3PB0A 5H8MA 4TR9A 1PO9A 2DUXA 5HBFA 1F76A 4ICNA 4N0RA 3AHTA 3E74A 1H1ZA 3A3HA 3BW4A 3WUFA 2WMJA 5I3HA 1V6YA 3L5LA 1I2OA 1EBHA 5LA1A 4Z2HA 2AL1A 3U5UA 2J27A 2RDTA 2VEPA 1G7UA 5EA9A 3D6NA 4QDWA 1TIWA 3GTXA 4BI6A 5FF3A 2DJLA 3V5CA 4PUDA 2BBFA 5KITA 1E9LA 2XFYA 9XIAA 2E9LA 3I68A 4P8VA 1YXDA 1OC7A 1JL8A 3ZZ1A 1V7AA 1VFLA 1JG9A 4E2VA 7ENLA 4F48A 2GGHA 2YKKA 3VX1A 2YW3A 3P7YA 3C0QA 4DJED 3PAOA 2Y5JA 2ZRWA 2W79A 1QHPA 3M7SA 2Z6JA 5I3GA 3GDBA 2J6XA 1AUSL 3DXIA 1R6WA 1V0MA 1JEZA 2GZXA 2GQ3A 4HU0A 6PTDA 2RAGA 1YDYA 4I5RA 1JZ6A 3P2VA 1IE7C 4S3GA 3AXHA 4AHQA 4KGLA 4L61A 2FKPA 2WNQA 1GOKA 2WBKA 1JI2A 1OX4A 3KZSA 1CT5A 2FFCA 3H7RA 2G3NA 2E5CA 4V33A 1PDZA 4NG3A 3WNOA 3SGZA 1MZHA 1WDSA 3WDPP 2X41A 1XUZA 5ABHA 3W84A 3MMTA 2D2GA 2VZOA 1J4EA 5DO8A 2Z1KA 3M0YA 4IL2A 1UBSA 3OZOA 1ADSA 1TJ2A 2D69A 4V2XA 3ME3A 4QAIA 3OPSA 4FR6A 1ZJHA 4PB5A 1AMKA 3NIYA 4FLSA 3HTWA 4Q8TA 4CNSA 1KV8A 3QSRA 3I65A 1TG7A 4QEEA 5CC5A 1TTQA 3KVMA 4H3DA 3AYSA 3GUGA 1XCFA 2ZUVA 4MUPA 4UQBA 1PAMA 3U2EA 3T4WA 3H55A 2WKJA 1KFCA 3VIIA 3W1UA 2H9AA 5HXMA 3L4TA 1US2A 4CN4A 3B9DA 1X97A 1ZAJA 2C16A 4O18A 4PH6A 4G56A 2E3ZA 5JU6A 4F0LA 1TPUA 2DQWA 3WQ5A 3NA8A 1WYIA 2QV5A 4V1YA 5HULA 3ITYA 3NQCA 1UC4A 4F40A 1HL9A 2PDIA 1A5LC 1NOUA 2XIQA 1UZ1A 3U8GA 4YL2A 1E1FA 4ASTA 1UUOA 2PLMA 2PP0A 1DVJA 2FHCA 4JN6A 1AJ2A 5CPQA 3P8IA 3SUTA 2FGBA 5I6SA 3R5EA 5K9XA 2PB1A 2PF8A 2ZA3A 1SFLA 3VINA 1UOZA 3C86A 3ZOAA 2W0UA 1JULA 2J9XA 1LOLA 1PEZA 3M0KA 3OZYA 2RHGA 4JOMA 3E2QA 5D9OA 5F7UA 4GG9A 1R2SA 1UWRA 3KTXA 1ISVA 4I5UA 4PCPA 4JTQA 2REQB 4Y90A 5C9XA 5HMEA 1FVPA 4DQWA 2YA2A 2VX5A 1JZ8A 3SCWA 5D9MA 4Z1CA 2W27A 2A5HA 1A5CA 1F6PA 1TMQA 3I6TA 3TDFA 2NSOA 3RRXA 1KM6A 3WNNA 1XYFA 5FESA 4B91A 1EWDA 4XAGA 3I6RA 2FGZA 1XP3A 1GPFA 3A47A 4N6EA 4DJDC 4IZGA 3CHCA 3BV4A 1UD5A 3IRDA 3ZXWA 2V9DA 1GYNA 4GNKB 4URIA 3FGCA 3QH2A 3N3MA 3RMJA 3CQHA 3Q4DA 2ZA2A 3UG3A 3LRKA 1HF6A 3B8DA 3LMZA 4IF2A 3K13A 1RQBA 3LOTA 5A6BD 4XWUA 2G3IA 4YN5A 3DFPA 3HPAA 1KWKA 3V1HA 4D6FA 5B80A 1Z41A 1JFHA 4Q8NA 3WFAA 3RG6A 3NR0A 3BSMA 3SZ8A 3V0TA 3WQGA 1WDPA 2WANA 1GVYA 3ANVA 3W22A 3TAOA 3LBOA 3Q94A 5AC5A 1JD9A 8RUCA 2P8BA 3EPMA 3CEPA 2VYOA 2DPEA 1XH2A 1W5MA 4GUHA 2WNWA 3STPA 3BW2A 3WK3A 2CW6A 4XZNX 1XYMA 1W56A 3NQFA 5IRPA 4IIEA 3VZXA 1JPKA 3MUXA 4Z2GA 4IISA 5E1QA 3R7MA 3SGGA 2EJ1A 3LXCA 3QN3A 1MDLA 1OFBA 2HVOA 4LBRA 1GJUA 1E51A 3THUA 3AMCA 3I7SA 2YCKX 5JBEA 2HEJA 4FX7A 3T1GA 4Q8UA 4AHOA 2HMCA 2Y0FA 4GVIA 4DF1A 1SFJA 4OKDA 2EPMX 4J3ZA 5TQLA 4EP8C 1JYNA 3TWAA 4Q8PA 4UIOA 4GGHA 2QGHA 3TN5A 3WMLA 1XIJA 5EMKA 4AY1A 4JNYA 1TWWA 1K8XA 1EGMA 3M64A 4Z2LA 2OOFA 1W9DM 3NPXA 3KOZA 3KBMA 4KWSA 5C6MA 3B0XA 2X1UA 4F4RA 4QTGA 1UW9A 4IFKB 1BGAA 2OT0A 3WZ0E 3IIZA 2DZXA 4UQDA 2VP8A 2G8ZA 2VFIA 4C91A 2RUSA 1SM9A 3BLIA 3WF2A 1JGMA 1XLAA 3H23A 4LVBA 3QC3A 4DZ5A 1G01A 1LG2A 5LXEA 1EJWC 1NTHA 4XVEA 4Q8MA 4IIFA 3QC0A 2CZFA 3VOHA 4ZQCA 1ADOA 5CAHA 4XSLA 3TC6A 3EWUA 2YZ5A 2VEMA 3CV7A 3AHVA 3FK4A 1ITXA 3NQ7A 3TUUA 4P7OA 3ARWA 3SRDA 2J8TA 3NYDA 4U5KA 4PCNA 4F66A 3U4AA 2W9MA 4H9VA 2V0TA 2VR4A 4H01A 1XIBA 4Q6XA 1XLKA 3EX3A 2CLLA 1QI4A 1JDEA 3TYCA 1O5RA 4L4OA 1OX6A 3IUHA 1KCXA 4M82A 1TTJA 1QNRA 3P67A 5J8LA 4WUIA 5G2HA 3WJZA 1BVWA 3TFCA 1AA1B 3CTLA 1S5TA 2IXVA 1TQJA 2P3EA 2YDRA 3C2EA 4C7DA 3WH9A 3BICA 1P0KA 5T26A 3DU0A 3IACA 1FHDA 1IXQA 3BZGA 3GS6A 5CSSA 3FIGA 3K4DA 1R86A 1F3WA 1OFAA 2WSRA 3W86A 1IEQA 1DBTA 4WY0B 2QVHA 3LX9A 3TJLA 3VKKA 4LRTA 2Y89A 1Q7QA 2P50A 4M24A 5KINA 4DY1A 3R8RA 3M5XA 1RUSA 3N18A 4EXAA 1GUVA 3LQLA 4C6DA 1GOQA 2Y8VA 3G6MA 1BWVA 4MHBA 3PPFA 2C91A 5CPOA 1XIMA 4AG0A 2QAPA 2V5CA 4RX0A 4UXDA 2W61A 1TV3A 3LGDA 4DHGA 4B3ZA 3BQ6A 4NYYA 4LAZA 4MWAE 1VPQA 4ZE5A 1JYVA 2PZ0A 1AW2A 1XSJA 4MY8A 2O9PA 1KM0A 1O66A 1I1XA 3NZPA 3BLPX 1TYGA 1DJNA 1QDSA 3L9CA 1CYGA 2QF7A 2V3DA 5CPMA 1ZP3A 1F8MA 2WMFA 1GQJA 1I60A 4AWEA 4D71A 3POCA 4ML9A 1BXBA 2E09A 1XL9A 4US5D 1KNWA 4J2PA 3RRAA 3CASA 3HFTA 3AIEA 4AUBA 3SUUA 5JBFA 2VFFA 4X63A 4LUIA 4LEQA 3VIKA 3ARUA 4WDTA 2VJXA 3NSNA 5LIUX 2V67A 3EDEA 4RL3A 4GO9A 3UNDA 1Z8AA 4IFKA 4Y9AA 4PMDA 1J2WA 2QCFA 4P7QA 4Q8QA 1OF6A 4JIRA 1IZKA 4L6OA 7REQB 1YPIA 4CQ9A 1B3ZA 2JKAA 5CQ1A 4QXIA 6TIMA 1KRAC 1E5NA 1P1MA 1ITUA 1UBPC 3LV6A 1XD0A 4YNGA 1J11A 3L4ZA 1Q3NA 4JTEA 2CU0A 2PDLA 3SIZA 1E71M 3CB3A 1BHGA 2EKCA 2G37A 4LYQA 2CHOA 3CYJA 5C71A 2NZLA 2ZUUA 1XLGA 4NIRA 1M3UA 2HJPA 1CGTA 1LBMA 2PURA 4HCDA 1FWAC 4HNCA 2J9ZA 1W3TA 4YMZA 1FKWA 2YXOA 2I57A 2A3EA 2OO0A 4UTFA 4IP7A 3CL8A 3SFKA 4O13A 4E2OA 3OBEA 1GEQA 1UA3A 2ZZ2A 2HS6A 4NSBA 2EHHA 4L1GA 2DZPA 3PG8A 4LUTA 2BDQA 5LA0A 4NI3A 3VNDA 2OB3A 2EJAA 3N9KA 4UMCA 3QGAC 1FTXA 4ACZB 2ZE0A 1OFOA 3LBCA 2YXGA 3HOJA 1TVLA 1V03A 1QPOA 1DWJM 1ONWA 3I10A 2Z7GA 3KDNA 4QCEA 2ZX7A 4CQBA 1V79A 3WX7A 2GVYA 4CNPA 2UY3A 3C2RA 3W27A 3CLMA 1E4NA 3K30A 2VURA 1ME8A 3G8EA 4QS5A 2WHKA 1P4CA 1AFSA 3WQPA 1XLBA 5E70A 3R1ZA 3UG8A 1XKJA 2QUUA 4J1OA 4XO6A 1ELSA 3WLQA 2BHUA 5T9BG 2QCLA 1S2VA 4JKLA 4GQBA 4CCCA 5CBJA 2QCCA 4FXJA 2PEVA 4LCRA 2X16A 4KCVA 5C5YA 2PDBA 1OGGA 5D05A 5DT5A 1GKPA 2Y7FA 2WJDA 3N2BA 4OBRA 2WBGA 1H4PA 1ZENA 3EOEA 3KBJA 1V0LA 3JS3A 3W2UA 3DHUA 1R7OA 3BMVA 2NUYA 1I0BA 1DWGM 3GUWA 3KS6A 5BXTA 4JIIX 3BLKA 3M44A 2J8GA 1BVZA 3KL5A 3WLLA 4I9MA 1NWUA 5DFAA 4F0MA 5I03A 4JTSA 3TQVA 5T9CE 3K8KA 3UVIA 4A3YA 3TCSA 1C8YA 1XIGA 1NDYA 2EPOA 2PA6A 4MFDA 4HA3A 1J0ZA 1GQLA 3NNTA 1ZLPA 1HQTA 1UWIA 1XBZA 2BTMA 4BCEA 3G77A 4QM1A 2BLEA 1DYSA 4PL2A 4EXQA 1M01A 4NU7A 4H9XA 3OLEA 2WC4A 1ISYA 1Q6EA 4YLWA 1A5AA 4K36A 5BMWA 1W3NA 3DX5A 3UA4A 3LENA 3CUGA 2I9UA 1SW7A 3BOXA 4NXSA 1QWKA 2OYKA 2OEMA 3NL3A 1HGWA 2ZX6A 1R3WA 3EX6A 1ZJIA 3WK2A 3F2DA 2XFRA 4GWEA 4ZO6A 4JL1A 3WLOA 3QZ6A 2OSXA 3EBVA 3SRFA 4PTNA 1JPIA 4C6CA 4WZHA 4XZHA 3VIOA 1HKMA 1LT8A 2Z29A 1AJZA 1SZFA 3RM9A 5F1VA 4H6QA 1V02E 4MB1A 2E1WA 3JU2A 4H7ZA 1DWAM 3TQ0A 1XLHA 1TPC1 4EACA 3N11A 2OXNA 4QDMA 1PVNA 3IGXA 4R88A 4U33A 1V3HA 4QGCA 2I17A 4LS1A 2ZIDA 4H9TA 3QY7A 4B2DA 4JDYA 2WHJA 1KFBA 1W5PA 3MMUA 4M6UA 5DRCA 1HFBA 5A6JA 4WJ8A 4G9PA 5EFFA 2B7QA 2NLYA 4M51A 3AFBA 4KFOA 3W83A 5C9WA 2DZAA 3LDVA 4H04A 4C6MA 1K6WA 3NO3A 2W63A 4BF5A 3WN6A 2H90A 3Q37A 1SO5A 1HNYA 5FEWA 1P0DA 1TVPA 4ACYA 4UFKA 2ZXQA 3ID7A 7REQA 1U22A 3AISA 5IHRA 4PFMA 1UKTA 3W73A 2C0AA 2A79A 3W81A 1AMYA 4FEZA 4ZOEA 3EZ4A 3VMOA 1S2AA 3I3EA 3CHFA 1OD8A 4S3KA 4JQ3A 4NL1A 4A3HA 2NV2A 2HWGA 1GVIA 2ZUWA 3CUHA 2F7FA 5K4ZA 2C15A 4U10A 1MW3A 4XG1A 4PMUA 4PTDA 2O7SA 2R1LA 2J7DA 3PBMA 3S4TA 4WQ6A 1EF3A 3S1GA 1RBOB 2EO7A 2CLPA 3KRSA 3WELA 3HQPA 3GKFA 3GIQA 4HPJA 4GY0A 3XIMA 4BJHA 1T41A 1TE1A 3ABSA 5FACA 1GQKA 2R94A 3G1YA 4HVXA 1S5MA 1EOKA 5KZMA 3W37A 4B3KA 1IHIA 3UBPC 4PUNA 1DJZA 1RSCA 4PTXA 3AZTA 1F61A 2C6QA 4OT7A 3UJSA 3L23A 3CU2A 4M29A 5E09A 1U1JA 1BPLB 1PWLA 1F4AA 2ATMA 1KM1A 3A21A 4D2JA 3FA3A 1TPVA 2ACSA 3CV2A 3LCLA 4LV9A 4N02A 4HJWA 4Q4OA 3NGFA 2XTKA 3VFLA 2NT0A 3URQA 1OK6A 2ZUMA 4MAZA 1OADA 2XZ7A 2NQ5A 3CMFA 3PZ9A 1X8CA 1IZCA 1RQEA 1PBGA 4AXNA 4GHRA 5D33A 3TCEA 1UP0A 5EU9A 3GNOA 1G0CA 3PZQA 1WBHA 1XUUA 1R3TA 4G7FA 2QJIA 2CCRA 2AGKA 2HCVA 1K3UA 4LAMA 4W4QA 5D2WA 4YTRA 1XIDA 1JUKA 3W74A 3LRMA 4NI8A 1HUVA 1Q8JA 1P0BA 1C7TA 4JYEA 4PMYA 3ABZA 2WVVB 4JY8A 4O57A 3LCXA 1JCMP 2V5JA 4ZOCA 5CSYA 1NDWA 1XG4A 1OD0A 1YYAA 3KBVA 4XD4A 1FWEC 1F2JA 3P14A 4H83A 3O8AA 3GNRA 1TPH1 5K9CA 1W2PA 3V0UA 3GHRA 4XQ6A 2VOTA 2J62A 1EXBA 4GO8A 1VAHA 3BAJA 2XIMA 2QDHA 3B8WA 3TJIA 2X0HA 2WCSA 3M0VA 1KQYA 4BHYA 4IGNA 4DJDD 2QJHA 5CAKA 3QV7A 3WUGA 3PPCA 4FAMA 4QLJA 4AW7A 5CG0A 3BGJA 2DY3A 4O8AA 4D8ZA 3E1F1 2FZ9A 3SRHA 5KZEA 2XM2A 2UBPC 4A2SA 1MQQA 4TMBA 2G50A 1VS1A 4ICMA 2PWFA 4DI9A 1M7OA 4QCFA 5IDIA 1EJRC 4GC4A 2GL5A 2Z6IA 3L0GA 3QGVA 1SW0A 4ZSUA 4LC8A 1RPKA 4AZGA 4HQVA 2QEZA 3FV9A 2XGBA 3N6HA 4PULA 4M7SA 4AWUA 3S6TA 4C5ZA 2XFWA 4JQ2A 3VNZA 4IX0A 3GVQA 4DO7A 5A95A 3MUZ1 3A5FA 3VNJA 2ZTKA 5CZSA 3H2OA 1J93A 1A0DA 4I8YA 4R27A 3SO7A 1G4SA 2VGFA 1EP2A 1MW1A 3S9ZA 3Q65A 3DERA 4GNVA 3M0XA 3UJEA 2F84A 2PE4A 5C9RA 2FZMA 3A3XA 3B8VA 2QJJA 1IEIA 3EWBX 1MNZA 3MCMA 4UMBA 5D8WA 3W2KA 5DCBA 1M5WA 3SECA 3LG3A 1MYRA 1Q66A 3SCQA 3S6OA 6XIAA 5LHFA 1HJQA 1J9YA 1LTDA 4IFOA 4FALA 2OQYA 4LS2A 5FEXA 4ZB0A 2EPNA 3M0IA 3KRUA 4WKFA 1O94A 1UC5A 1WAWA 3BQ5A 3B8SA 2QJMA 5HDRA 2YCLA 3ARPA 2X05A 4UC5A 5BW6A 4O15A 3W7JA 4C7FA 1VP5A 1OT1A 3RM4A 4AYGA 2PDFA 2B7PA 4FO4A 1R5YA 4ZFCA 3KVLA 4GCAA 4CD5A 2Y4SA 1P6BA 3TW9A 1E5JA 3LPGA 4LYKA 3P3BA 2C1IA 2R24A 1SMAA 4G5DA 3T6CA 1RK6A 3BVJA 3F5LA 1V4YA 3U9IA 1FRBA 4RXFA 2Q6ZA 3W7RA 3S1VA 3OU8A 4DXXA 4GQGA 3UZZA 1JPHA 5D2YA 1VIWA 1MQRA 2DT0A 1XW8A 1G4PA 4JEJA 1W32A 1J0JA 1Q6OA 4UFLA 3TLLA 1B57A 2V68A 1F4HA 3WMCA 4U2ZA 1SGJA 4KH2A 4UZSA 2GQ8A 5A3HA 3DG7A 3CIXA 1NAL1 1DEDA 1GVSA 4FPSA 1DJXA 4AQLA 4UFHA 3CPGA 4MLJA 1JAEA 4GI4A 3STEA 3P62A 5JBDA 1SR0A 3NZ1A 3RLVA 2YGYA 1R9XA 3NDOA 4DYEA 3VO0A 3ARRA 3NAVA 4HZMA 3ZSTA 4S3EA 4FIQA 3P60A 4R9OA 4KPLA 4S2BA 3ARSA 1HJXA 3THAA 1QU4A 4Q4RA 3C56A 4AWSA 3EWZA 2GSEA 2EQDA 1P6WA 4PODA 1CXLA 2YW4A 1RJRA 2VX7A 2QDEA 3DDMA 3VIPA 3OB8A 5AC4A 2G4FA 2QIWA 1TV8A 4CKQA 1LM1A 1OF8A 5M1TA 4FOUA 3S46A 2C7FA 4IGSA 1KFEA 4HKPA 3AU6A 3L12A 2Z2BA 5D30A 2CLOA 3R10A 4TX6A 2XM1A 3AMKA 5LZLA 3LZ5A 3PHAA 3NWRA 1E1EA 2V3EA 3TSDA 3AAMA 5C0QA 3W0KA 3VC5A 2J66A 2CLMA 1PB0A 5C9ZA 3MWCA 4ZFMA 1UH2A 3RCYA 2VRKA 1NVMA 5CGQA 3CHDA 1VQTA 5EMYA 2NWRA 3RCNA 4YYFA 2ZXBA 4M0XA 3C3UA 3LSBA 1J10A 2OPJA 3UFYA 3WK0A 1E4IA 4M81A 1U30A 3BAKA 3CM4A 4MLRA 1EDGA 2ANUA 4AEOA 3ZS4A 4A35A 3SB0A 1FHLA 1XX1A 2Q3OA 1L6YA 2D3LA 5MF5A 1AL7A 4YXGA 4LSBA 1QOXA 1SSGA 1JDCA 2E4TA 1WDDA 1MXSA 4ORIA 4Z42C 2DEPA 1BYBA 1PKLA 1OEPA 2JALA 4V28A 1S1RA 1DJYA 3WLSA 2R91A 3FJNA 1H50A 2QT3A 1H51A 3K2GA 1R47A 2OG9A 3TJXA 1OINA 1IF2A 3UA3A 1XCWA 3CUIA 4BQ4A 1JZ7A 1CIUA 1FWBC 3DBNA 4W8AA 3OIHA 4N6FA 4K38A 5CJMA 2Y70A 2A3HA 3B0PA 5H2ZA 1X1OA 1H7OA 4P7NA 2V5KA 1R9ZA 3Q2DA 4U28A 3NFUA 4AZCB 1FXPA 4JS3A 1M9HA 3GW0A 4HT3A 1WX0A 3GVWA 1B3YA 2P53A 2RKXA 4FSAA 3MP3A 3KVJA 2F2KA 2DW7A 1LQ0A 2PBGA 1CBGA 2OZ8A 4Q8VA 3S8HA 1F3EA 2QQ6A 1SVDA 4PMQA 3A4JA 4AD3A 1QBAA 2QW5A 3OYZA 1RBLA 2VO5A 4DBEA 3QPZA 3O16A 2Z27A 3K8MA 3S9IA 2PLKA 3PWAA 3CHEA 4FLQA 3MDWA 3MW7A 4H6KA 2ACUA 2V3GA 2VELA 2PFHA 2DT2A 1NY1A 4FK9A 2WJEA 1I9CB 4Z2IA 3N2MA 4AZ5A 3GXDA 2CITA 3N04A 2WNZA 4IT1A 1GK8A 4E5TA 3WQOA 1UROA 3G18A 3HFYA 4FB7A 1K1DA 1VPXA 3P5ZA 1SPQA 4BI5A 3PZVA 3RHGA 2W3ZA 1XSIA 4HBKA 3VOIA 4ATDA 3AHYA 1QBBA 4PBEA 3T9PA 1Y0EA 1YTEA 1ZAIA 3GTHA 1F07A 4FXFA 1XLMA 2FZDA 1V6VA 3LI0A 3QBUA 5AZ1A 3IJLA 2X0SA 4G6CA 1V51A 1KTCA 5LKYA 4HN8A 2NXGA 1GGOA 4XISA 4ADSA 2OX4A 2DSZA 1Y5XA 3S42A 3E5PA 3W7CA 4GH3A 5AC8A 4GIRA 5CH9A 3CT2A 2VVNA 4R53A 5CZKA 1LP6A 3PSVA 3QVQA 3BK0A 3UXIA 4PRTA 2PP1A 1YQ2A 3LHUA 4R34A 3UWWA 3ZFHA 3BC9A 1R46A 4H9UA 3BAXA 4C1NA 2Y88A 4XO7A 1NFGA 1XS2A 4NZCA 4K6AA 4J7RA 4NZ5A 3H4XA 3SJNA 3SUVA 1A3HA 1GOWA 4FXSA 3ANUA 2BGQA 4FNRA 4XKYB 2BXVA 1W1IE 3ZJ7A 4O14A 3FJ4A 3SY8A 3W24A 4H9YA 3FCPA 3KFTA 4DN1A 1SUXA 3V5FA 1FWDC 3S6DA 3SCRA 3KRBA 2W66A 1E6XM 3O9NA 2XIJA 1FDZA 2YB1A 4KWWA 1GYMA 4R33A 1QPRA 3ZT6A 5HR7A 2AQWA 4ONVA 5D32A 4Q4PA 2YCEA 5XIMA 1EOMA 4KCUA 8TIMA 3OBAA 3VIGA 3NSXA 2FZNA 3DFNA 5B7YA 1GZGA 4TMCA 3NCOA 2HSAA 2PUZA 2WHLA 2OLAA 1M1BA 3MCNA 5I77A 1EQPA 1XICA 1XIFA 3GY1A 2P1FA 4LB4A 1F3TA 2VC6A 5C70A 2GPTA 1MVYA 3W01A 1ZJBA 4NAEB 4EPKA 5CJ5A 3NQGA 5C2GA 4ZXOA 3SGUA 1QUMA 5CSUA 2CPUA 4P61A 2W6RA 3WKZA 2QPSA 3GH7A 1PHWA 3W7DA 2FPTA 1QATA 1JUEA 3RN6A 1LL6A 1ZBWA 4Y8FA 5HMSA 2QYGA 4K3ZA 4B5SA 2YIHA 1WOBA 5D03A 3FY1A 3LS9A 2PRLA 1B31A 1R7AA 3WO8A 1CNVA 1KR0A 2QULA 2HZGA 3PUEA 1XFBA 2W5FA 4CNUA 4ZVJA 4I90A 1PYMA 5BRPA 5HJYA 5BWFA 2V8ZA 5PTDA 1VC4A 3B8UA 3EWDA 3TAKA 2NT1A 1TUXA 3A23A 3GFXA 3LHWA 4IOTA 4GZEA 3UZYA 1DOSA 5JMUA 1O5QA 1WKEA 4MYAA 5I06A 4W89A 3LN3A 1RK5A 2I1OA 2PDXA 4GUIA 2WXDM 3T8LA 5H91A 2CFFA 3QPEA 3CIWA 4DWDA 1A5KC 3N4EA 3NQMA 1Z3NA 1IZJA 1S2TA 4GNJA 4A21A 3GDLA 5TBOA 4AISA 1QK0A 2VM8A 4MWAA 1ZSXA 2PDHA 5A94A 3UT0A 1TPEA 3A4XA 1CEOA 3WLJA 3W7IA 1CECA 2UY5A 5JH2A 3IRSA 4QR6A 2CYGA 4NILA 4UTJA 1PCKA 1QK2A 2YR1A 3UCDA 3RPTA 3KE0A 2YLAA 5E9XA 3PBUA 3MSGA 4FP1A 1V5XA 3RUBL 1YPXA 3ONCA 5D9PA 1AZ1A 1BF2A 1S3HA 4KEMA 4G1KA 5FCZA 1EX1A 3O15A 1VYPX 3BJSA 4W84A 4EF8A 3AIRA 2EG6A 1R87A 2DT3A 4ERAA 4UR9A 2WCGA 3FJLA 3PK7A 2OVLA 4R7WA 3W87A 3DYOA 1HO1A 2OWWA 1IT7A 3QW4B 3SQMA 1V6WA 4WSHA 3OJGA 2WQDA 1TJRA 2PCQA 5EB8A 1AODA 3TH6A 2A21A 4I3GA 3RX4A 1KD0A 3OVPA 3O7UA 3N2CA 4PUJA 2QUMA 3T4CA 1CTNA 1E43A 4M3PA 4HZ7A 1HIZA 3KDOA 3IPWA 1KFWA 4WJXA 3OOQA 2WC3A 4UQAA 4UOQA 3ABXA 1ZNNA 1EF2A 3MY9A 5HUOA 1I75A 1G7VA 4DI8A 4TX9A 4AEFA 3VGDA 4H4IA 3WD4A 2BNJA 1WDQA 4F2TA 2DUAA 2DV0A 3LI1A 3N12A 5AYZA 5CEWA 4NNBA 4BQ5A 1ICSA 1W9PA 2G3MA 4HZ8A 3SCUA 3ZLFA 2E1DA 1W1TA 2AAAA 1RCXB 3W7MA 3W2LA 3PZOA 2DU2A 3G0UA 3E0IA 4Z17A 3KCJA 3IIOA 3I4EA 1WO2A 4FNPA 1HJWA 5TF0A 3DKLA 4JIHA 1H41A 4AB4A 4XKYA 3VX0A 3UD6A 5D02A 3SCTA 4FLOA 3FVMA 1S46A 4YU1A 3COTA 4AZIA 3QYQA 5J5DA 1C29A 4QJ3B 1RA0A 3N34A 1TELA 2FH6A 4W93A 2V2CA 2CERA 3IJ6A 3M41A 5FIPA 3OEXA 2R14A 2X30A 1ZU8A 1T8XA 4JL2A 3PJWA 1GZ1A 2OO6A 3MV01 1PS9A 2EPLX 7XIMA 2WPBA 1F8IA 1V0KA 1TCDA 3VGEA 3CZKA 1Z69A 4DEFA 4PFHA 1LQ2A 2XVGA 4NX5A 2FZBA 1IWBA 4XZBA 4UFIA 2WLYA 3AXXA 1KKOA 4HB7A 3VNKA 4XZLX 3LHTA 1E6NA 3QHMA 1VPYA 4N7QA 3M5ZA 3UESA 4RJEA 1FXQA 1UWQA 1WDWA 3R0UA 3DHDA 1IXNA 2EG7A 3ONBA 1B3OA 3NQEA 3GVVA 3GIPA 2VCCA 3R8HA 4IGMA 4YVXA 3CAQA 1TZ9A 2B81A 2OEJA 4CQDA 5A6SA 1NARA 1MRAA 2WOQA 1E4MM 1GG0A 4WDXA 3UGVA 4I7UA 3TR9A 5TIMA 3PNUA 4DJFD 5FJIA 2HDJA 4GQ0A 3ABRA 1EC9A 2YCIX 1BYAA 4HNVA 4DUXA 4D72A 4J4KA 3MUCA 3CZGA 3ELFA 3VCCA 1LDCA 4O0QA 3F5KA 1JPMA 3RJXA 4EIVA 5AY7A 4KT2A 3PJTA 3WLNA 3G1FA 4A8LA 3H2EA 4PTMA 3HPZA 1EP1A 3KOFA 4B4HA 3DN5A 1UIPA 1YNYA 3LA4A 2A1YA 4JDBA 4L9XA 1V7YA 1PTGA 4FS9A 3OW1A 1OZMA 4DLFA 3CYVA 9XIMA 1YKWA 3T2QA 2AOSA 5DRIA 2P10A 3W6MA 2CBIA 3THDA 4DZHA 5AKQA 5D2TA 2A0NA 2YSWA 1NQ6A 1LORA 1HKWA 3DYPA 4IJCA 4MDPA 4JHZA 2PF0A 4HIBA 6REQB 1JZ2A 4RW3A 3UJ2A 3XINA 4Q4SA 4HZ6A 4L80A 3L68A 3ABOA 1IIHA 2PDCA 3QSTA 1EX5A 3MHFA 1JDFA 3NSMA 1ZJAA 1KBIA 4L64A 4XZMX 2RJHA 3VDGA 5BCAA 3IVSA 4Q33A 3B0YA 3FDKA 3OA3A 2X1RA 4MOZA 1W3JA 4Y7EA 1WXJA 1YEYA 2NLIA 4BEQA 3MJYA 4JEQA 2X8RA 3ZM8A 1OZQA 1JRBA 3MPGA 5DY3A 4DJEC 4LUYA 4OE7A 1WXYA 1ISXA 2ISWA 3VU2A 1CLXA 3N3TA 3PTQA 1UZ4A 2D2OA 3W2NA 1H60A 1LOQA 4BK9A 1ZAHA 4BKNA 3CMJA 4I6VA 4INFA 2IKIA 1K4HA 3BAWA 3G1VA 4I7WA 3H53A 1LJYA 5AVHA 1TPFA 3WBXA 2CZEA 3FGCB 4QNEA 3NQVA 2WK2A 1IR1A 1EYEA 5D4YA 3HQOA 1A5UA 4I7VA 4DO5A 3BGAA 4AVFA 3WNLA 3YPIA 1QPQA 2BGSA 1ZBCA 3S1WA 2ATSA 1W54A 4BFAA 2R1PA 3KHJA 1CCWB 3ZLGA 3EDFA 5F2GA