4K1GA

Structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPADSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 4
publication title Insight into mechanisms of 3'-5' exonuclease activity and removal of bulky 8,5'-cyclopurine adducts by apurinic/apyrimidinic endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 102
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4k1gA00
1DIDA 4QE1A 4XSMA 4QEHA 3M0MA 3CWHA 2GVEA 5H1WA 2ZDSA 1QT1A 3C0LA 3XIMA 2QUMA 4GLEA 3QYSA 4ZB5A 3CQKA 1D8WA 1XLKA 4XSLA 3U3HA 2QUNA 4EAYA 5H6HA 3XINA 3NGFA 3CQIA 4YTTA 5I7GA 3QC0A 4QEEA 2XIMA 2OU4A 3IUDA 4HGXA 5FA5A 3C0SA 1QUMA 2G4JA 3KWSA 4K3ZA 2HK1A 3UU0A 1MUWA 1BXCA 1XICA 2GYIA 5EMLA 4A8LA 9XIMA 1TZ9A 3CQHA 1XLAA 4YTRA 3VYLA 3VNIA 1XLBA 3IUIA 4X61A 3KCLA 4QDPA 1XIDA 2X7WA 2X7VA 3ITLA 1GW9A 3ITOA 3P14A 3VNJA 5B80A 3QXBA 6XIMA 2J6VA 1XLCA 3KCOA 2HCVA 3AAMA 3GNXA 4G56A 5EMMA 3VNKA 1XLDA 1XLMA 3KTCA 4A8IA 3M0HA 2Q02A 3BANA 4KW2A 3M0XA 8XIAA 3ITYA 3OBEA 4YTQA 3U0HA 2I57A 4W4QA 2NQHA 5TNVA 4HNOA 4X63A 3TVAA 2XISA 3KBWA 5B7ZA 5B7YA 1XIMA 3UVAA 3KBJA 3KBVA 2ZVRA 5C9ZA 4A8RA 2G0WA 3BZJA 2QW5A 3XISA 3L23A 4QE5A 4DUOA 4PGLA 4QDWA 9XIAA 3KBNA 1I60A 3AALA 2GLKA 3DX5A 3ITXA 3CNYA 6XIAA 3JU2A 1OADA 1QTWA 1A0EA 4YTSA 1XIJA 1XYCA 4GJIA 4XISA 1DE5A 3FVMA 1DE6A 3KCJA 4J4KA 2I56A 1O1HA 3CQJA 4OVXA 4LNCA 3ITTA 4EACA 3LMZA 1XISA 4Q7IA 3QZAA 1YX1A 3UXIA 3IUHA 3KBMA 4E3VA 5AVNA 1MNZA 4HHMA 1S5MA 5XIMA 4HHLA 1S5NA 3BDKA 3UA4A 4GJJA 1XLIA 3DBNA 1CLKA 3ITVA 5J8LA 5XINA 4YTUA 3P6LA 1DIEA 1DXIA 4GQBA 4X60A 3C0QA 4US6A 2XINA 1XLJA 2GUBA 1XLLA 4DVOA 3VNMA 2NQ9A 3VNLA 4PFHA 3M0LA 1XYLA 1BXBA 1A0DA 1XP3A 1XIIA 1XIEA 4XIAA 1XYMA 4ZB0A 3UA3A 1K77A 3BWWA 2NQJA 1XYAA 3AYTA 7XIMA 3TC3A 4XKMA 3BZGA 1XIHA 8XIMA 5EMJA 4ZBCA 1XLGA 4A8NA 1I6NA 2QULA 1XINA 3M0YA 1XIFA 2HK0A 5XIAA 5AVHA 1XIBA 1A0CA 4ZB2A 3KBSA 1XLEA 1XLHA 1XYBA 5EMKA 3WQOA 3M0VA 1XIGA 3AYVA 3N4AA 1XLFA 4XIMA 4QE4A 4K1GA
chains in the Genus database with same CATH superfamily
1GYNA 3E5PA 2XIOA 1PIFA 5LA2A 2CZ5A 3AHXA 1U83A 3ITGA 2B0MA 3EA1A 4Y96A 3TYEA 3PS7A 1UCWA 1W1B1 1SFTA 2WSQA 3APGA 3DFNA 4OQVA 3VMOA 3VDBA 2G5WA 3URNA 1EJWC 2JGQA 1CGTA 3VNIA 1Q45A 5E09A 2XH7A 3A9BA 1FRBA 3W84A 4A3QA 4Z1YA 1DQWA 3C6CA 3QQ0A 4AMCA 3ZT7A 4ZQOA 4YWIA 1ZB5A 1ADOA 3VGHA 3M47A 3HV9A 1W54A 2DZTA 1ZUAX 3G1RA 5AY7A 3TTQA 3LCFA 2R91A 3VMPA 3DIPA 2R1MA 3VX0A 1IT7A 1A3WA 1J11A 5DMYA 1QPQA 4XZMX 3W7GA 7ENLA 4AC7C 3VU2A 1HJUA 4NZ5A 1TSIA 1GPWA 3E2RA 1VC4A 4O1BA 3GB6A 3SRHA 1U1JA 5IXEA 3FYPA 4X9YA 3DI0A 2E9MA 1V3JA 2OELA 2CEQA 1FWHC 3TAOA 2YB1A 4B3LA 2OKOA 3C3NA 5G1MA 3OZPA 3C61A 1JGIA 1PTAA 5ENLA 5JIWA 1WUEA 4QE4A 3CUFA 1KBKA 3BK0A 4WOZA 1ALDA 1I4NA 5C9UA 1NDWA 1UWIA 4ZZ9A 4LYQA 4U3CA 3GXNA 1LORA 1QBAA 3E5BA 1W91A 2GK1B 1E6PA 5CPQA 4PMQA 1MUWA 4C60A 3WMLA 1WDPA 3NVDA 3WQ4A 3W81A 2HWGA 4XZ9A 2A3BA 4JIHA 3P14A 4DJED 3NQDA 4D2JA 1TX0A 1QPOA 3QMSA 3NDZA 4NU7A 3I4KA 5DXXA 3IAQA 2V5BA 3WMCA 2NQHA 3F03K 3WQFA 3QOMA 1TUFA 3TQVA 4Y6GA 1FCBA 3W1UA 1QOPA 4KRTA 3K13A 3TXZA 4N02A 2G4FA 4O1AA 3TQ0A 4JN6A 4WKHA 1GOWA 1GQJA 1KCZA 4YCPA 4KFOA 3RXZA 4J3VA 3QPZA 4ZO6A 1OZQA 2NQZA 2WCAA 4S3FA 1Q65A 3O1NA 2ANUA 3V16A 4M6UA 4QS6A 3BICA 4AEEA 4AISA 1VBJA 3A4XA 3VKBA 2FTPA 4A3HA 4G1KA 3KS5A 3WEMA 4CCCA 3PUEA 3LB0A 5AHEA 2V5KA 4GXMA 2CKRA 4DWSA 2DVTA 4FXSA 3OLEA 4NNCA 4MUZA 4C6EA 1GOIA 3D5HA 2Y70A 3K1GA 5TF0A 2QJGA 3BJFA 4I9AA 5HBFA 2Y8UA 1UP0A 3TSDA 2QCNA 1Q5MA 1XQKA 3EX6A 3P8JA 3QN3A 4QLLA 4PRRA 3UU0A 1LOQA 1W1TA 4POCA 2GVYA 5I79A 2DH3A 4NJHA 1R3SA 1K9TA 1E40A 4V15A 2Q8LA 1LQ2A 2HCVA 1RY8A 2E6DA 3BANA 4XTIA 3ZT5A 2NX3A 5AZ1A 3CTTA 1CXFA 3MZ2A 1W0MA 3EA2A 3PPGA 1VBHA 3RCMA 3QZ6A 3TYCA 4GQ0A 3WIJA 1F8MA 2X05A 4J3ZA 4GISA 3VIHA 4L80A 3GDBA 1E4IA 6REQB 2EAWA 2Z2AA 4EWND 1BG4A 1E9YB 4ASTA 1Z9AA 2R82A 3GIYA 1K6WA 1L8PA 1ICSA 4W9TA 2TAAA 1V6UA 1XLJA 5CQ1A 1GYMA 3KP0A 5LHFA 1X1NA 4IMDA 3CUXA 1IWAA 3GVRA 1X97A 4PTWA 2J8GA 1KCXA 1YQ2A 2FZNA 2W79A 1PB0A 4XG1A 1CGUA 4RDZA 3G1HA 3MPGA 4LUJA 4Q8TA 5LA0A 1E1FA 1XYBA 1Q2SA 4YWSA 3FKKA 1YTDA 2YCLA 3C5QA 3UPMA 4RW5A 1ZAIA 4P8WA 3PAJA 1KQYA 4ZFMA 3GTHA 3M0MA 2VQUA 3OGSA 2BHZA 1GUVA 1YDOA 1I1XA 3WD2A 2XIBA 3VOJA 1E55A 1IV8A 3IJ7A 3ZVHB 1EHAA 3BG9A 1UOKA 3KVJA 4AD1A 4C6LA 2RH9A 1JD9A 1GOXA 2ZWZA 4UB9A 2ZYFA 2HXTA 4ZA0A 4UTTC 1FWSA 2VCBA 3MBFA 1ITUA 3FSUA 3TMLA 2J8FA 1N7KA 2PWEA 5B80A 1UWRA 3N3TA 3LQLA 3KOXA 1LJYA 1R2TA 1CEOA 4MLJA 1UR4A 1FWFC 3N9KA 1TVPA 4NAFB 3UT0A 4L6OA 5GJMA 1E4LA 1I60A 3F7JA 3AMKA 2WMIB 4RE2A 3B4UA 1NFBA 3TFXA 1OGGA 4BCEA 4I7WA 1MDLA 3BV4A 1QATA 5CZSA 4WKFA 4JL1A 4Z2LA 1NWRA 4XO6A 3FSTA 4CEXC 1UR8A 4Q4QA 3WQ6A 3EMQA 1C8XA 4PRTA 4FX8A 1K77A 3B8UA 2PP1A 5LA1A 4TXEA 2GFTA 3UQNA 1OYCA 2Y7EA 1K7FA 1ADSA 1BWLA 1UD8A 1JG9A 4IIHA 2QHAA 3R10A 1BKSA 1Q4NX 3LM3A 1JF6A 4AZ5A 2A7RA 1JD7A 2E1DA 3W24A 4AVFA 1W31A 3CB8A 1W9DM 4QSHA 3FA5A 5GNYA 5BXPA 5LYRA 2HZGA 3CEPA 1TO3A 4ADTA 2DZVA 2D24A 2WKGA 3TWBA 2DZPA 3H2MA 1BKHA 2HPMA 1G0CA 4IMGA 5EYWA 5REQB 3A9IA 2WLYA 5C8BB 4OWGA 4NX5A 1TFVA 4OBRA 1IXPA 1LT8A 2QJJA 5JQ9A 3W1TA 3V3WA 3KTCA 2FB2A 1GNXA 3U2OA 2C0HA 3AYSA 3NO5A 2F8QA 1SFLA 4XZLX 1SZEA 5B7ZA 2DJXA 1R86A 2PU1A 3KM8A 1QTWA 2OVLA 5A69A 4UTJA 1Y7VA 1DJQA 1ENUA 4HT3A 5HDRA 3VDGA 4IX2A 1J18A 1B5TA 1GHSA 2RDUA 2FHCA 1XRFA 3W7JA 1MNZA 5I3HA 3NQGA 4NQ1A 4OECA 3T81A 3JR2A 1RJQA 3RHGA 2XH2A 2ZA2A 1FUYA 1XYLA 2Z1BA 3VD3A 3PB2A 1CI1A 2WK2A 1VYSX 3LNPA 4DB7A 3FXGA 2V81A 1GGOA 3OIXA 4AZ6A 4Y90A 4M82A 1SSDA 3UJFA 3A24A 3SSJA 3W71A 2RUSA 3HOJA 4UCGA 4IG2A 3O06A 3M5YA 5DCBA 3UXKA 4ACZB 4DO7A 1US2A 4C6FA 5KSWA 2QT3A 1LM1A 3B9NA 1OM0A 4XD5A 4PUKA 1WOAA 1JDCA 1LBFA 4XBJA 3S1VA 4XTDA 4N4PA 2BVYA 3RUBL 2J6VA 3BLKA 3CHFA 3N15A 1HJSA 4O54A 4PMJA 4OUEA 2ZUNA 3INPA 2V2HA 3PZUA 1W2PA 2X0YA 3W1MA 4RNJA 5FSEC 1MZHA 4UBPC 3NUKA 5C5YA 1J0HA 5CZTA 3H54A 2AL2B 1RD5A 1TMLA 3C86A 1RH9A 1Z48A 3FA3A 1MUCA 4Q8WA 3UY8A 3VGBA 3CQJA 2BY2A 2INZA 1X8CA 3UXIA 3I4EA 4FP1A 1BHGA 4PMXA 1LRTA 3R12A 4F0LA 1R9XA 4RLIA 3C0QA 2ZUWA 3WEOA 1ME7A 2QPUA 4Z2IA 4GYKA 4R9XA 1IT0A 3KZPA 3PJTA 4GVIA 2J7CA 3BAWA 3OLIA 1ISZA 3GO2A 4DHGA 3RFAA 3V5OA 4QJ3B 3WLLA 3O0FA 2CC0A 1TELA 3VX1A 4LYRA 3GKFA 1VKFA 3EKZA 4H6QA 3EBVA 4XV0A 3AXKA 2ZTJA 5FJOA 3TOYA 1I0DA 2PAJA 4PBGA 3O2LA 5AC6A 4O50A 3JZUA 2PI6A 3FAXA 4HJFA 5IDIA 3UGVA 2Z26A 1J0KA 2YFNA 5A95A 1U5VA 3M5XA 3M6DA 2FZ8A 1JDEA 3N2MA 1WV2A 2D2GA 4FX7A 5AHMA 2QVNA 1P6BA 3S42A 5AHLA 4XAGA 1WKDA 2ISFA 2PDPA 2VXNA 5IM51 2VFIA 3PZTA 5U4NA 4I5UA 2YL9A 4XD3A 3CL8A 4N2YA 3STFA 2QCGA 4NASA 2PWFA 1HL2A 1CIUA 2OOFA 4PUNA 1H1YA 2C15A 3BVJA 3G3DA 4BQ2A 3W1LA 4AZ7A 3AROA 5GNXA 4OFCA 4S23A 1M68A 2GUBA 1UKOA 2AL1A 2H3DA 3W87A 3P7YA 4JDBA 1HXJA 2OG9A 1Z41A 4K2SA 1UC5A 4H9ZA 3BZGA 4QSFA 5EMJA 2C79A 3QR0A 3MWCA 3MKVA 4HTBA 4ERAA 1RALA 3ICJA 1J10A 5H2ZA 2EPOA 2OLHA 3GBEA 4M56A 3WDQA 2D3NA 3DFOA 3T40A 3GS6A 3V0SA 5A2CA 4MWAD 1CLVA 5I7GA 4JIEA 1LL7A 2YL5A 5A6BA 3GFXA 2H6RA 1R2SA 1G6CA 3VD9A 1TJPA 3I7SA 3JS3A 1UWSA 4H3DA 3GTFA 5AB3A 4P7QA 5G1TA 4Q4SA 3VNYA 4AVNA 4P8UA 1ZBVA 1TV2A 3USBA 2YA2A 3EB3A 4ZOCA 3QYQA 4FIQA 2IPGA 2PDJA 1OX4B 1TQXA 3LOTA 4DO6A 3HF3A 4LTSA 3SY1A 3AIVA 4XKYA 2ZUSA 3R79A 4NI8A 3U9IA 1MW3A 3CNYA 3CGTA 3WBXA 3W83A 3UXAA 3B03A 3ZT6A 4W88A 4GJIA 3S1XA 2ZZ5A 4IM4A 3CWOX 1TPVA 3VFCA 1K9FA 2P8BA 3C56A 2H8XA 4OZOA 4KRZA 3WD4A 2CESA 3TONA 2HS8A 4ADUA 5I02A 3LHZA 4C6OA 3GU9A 1V3LA 5BXRA 4IIBA 3G18A 2AAMA 2E6FA 2XVPA 5GVJA 1EF2A 4Y2WA 2OX4A 2VEIA 2NQJA 3WF3A 4IP5A 5AC5A 3LTSA 2JKEA 3M0YA 2FQIA 3VD5A 1I2RA 2E28A 1HKMA 4WJEA 2C71A 2VZSA 5I77A 3AYRA 2BXZA 1JI1A 3NNTA 3H24A 3ZWSA 2VR2A 1GORA 2J9YA 4XSLA 4Z2KA 4CVUA 3TU9A 3ARQA 5HNRA 3DERA 3LLXA 2Z1WA 4HCDA 3W2NA 1BXCA 2QV4A 4UQEA 1P1MA 4F9DA 2PLJA 1YMYA 4D8AA 1UKQA 2ZUVA 2JEPA 3WMSA 4S3CA 3M0XA 1D3CA 3V18A 4CNOA 3MYOA 5FOOA 1VFOA 1M1BA 4HYVA 1E72M 1A5AA 2PGWA 2FDMA 2XWEA 1NDYA 1H41A 5A2BA 2W61A 3WQEA 3WJYA 2OT0A 2D2OA 4GY7A 4QAWA 3RILA 2CHNA 4LUTB 1XF0A 1P48A 2PDLA 1KM3A 1S1RA 2D0FA 1ZU8A 3BH4A 4JGDA 1LBLA 5G2WA 2E1WA 4QBXA 3GBDA 3LERA 4P8VA 3GQYA 4LS1A 4GK8A 1A4LA 1TKKA 3H2OA 3CBWA 3HG3A 1YLVA 2WSRA 4BF9A 2OEMA 3DN5A 2GGGA 2ACUA 4AZCB 3KBSA 2O9OA 3SY8A 4IZGA 2PRMA 1BVWA 1LOLA 1JYXA 4JOMA 5CBIA 1EJVC 3GH4A 3SJNA 3FGCB 2VP8A 4FNTA 1U5JA 2XM1A 1OG6A 4JHMA 1ITXA 1DHPA 2G4JA 3Q45A 1N2VA 2J7HA 3L9CA 4GH1A 3PWGA 1H0GA 4HU4A 3UGRA 1W9VA 5DXYA 1GKPA 7A3HA 3UWYA 2FJUB 3KCOA 2INFA 1B9ZA 3KDNA 3CUHA 3RNDA 2EBNA 4WUIA 3ZJ7A 1BXNA 1OCNA 4RZ6A 3VKDA 3WJZA 2XGZA 3BAKA 3HV8A 5EU9A 4TR9A 4N4QA 2FH6A 2FHBA 3NYDA 5HA7A 1F6YA 1G4PA 3O6CA 4UR8A 1PYFA 4UTTA 3ARPA 4G9PA 3GVGA 3MO4A 2A6NA 3REQB 3MMWA 3WH6A 3F4WA 2AKMA 1TV5A 4YCOA 2AAAA 3G1AA 3OBKA 4K1WA 2BLEA 1V03A 5F1UA 4MDOA 1YPIA 5CPSA 1A5CA 1CENA 1FDZA 2WVTA 2G37A 3WBAA 4QITA 4AIBA 2XSXA 4XUYA 4Y8FA 4K68A 3WNNA 2E5DA 3AUOA 1NIUA 3CL6A 1HW6A 2ZX8A 4XSMA 4JYFA 4RJEA 4NYUA 2X8RA 4DJEC 2W6RA 4GLEA 4MNLA 5M1TA 3MA8A 2I5QA 1BD0A 4JQ3A 1UD3A 3AIRA 3W7MA 1ITCA 3AIQA 5DRIA 5FA5A 4AFYA 3GXIA 3BMWA 4UWMA 1A5LC 2HXUA 2DUAA 3VYLA 1GONA 3AIEA 2R1NA 3FW6A 1BQGA 3VUSA 3ZFHA 1S3HA 1JCXA 1X1OA 2HV5A 1VJIA 3OZMA 1IEQA 1PVNA 2WKJA 2YB4A 4NP7A 1OCQA 4H01A 3W01A 2TRSA 2EEXA 1OWQA 1GOOA 4FS9A 3WK3A 3SCQA 2GLKA 2YIHA 1FA2A 4B2DD 1XBXA 4PTMA 4G7FA 2WB5A 3WK0A 4DZIA 3O9NA 1X7FA 4KEMA 2PRLA 1LDCA 1AA1B 2BNJA 1HT6A 2WZEA 1VFTA 2PFHA 4ZXLA 3GTIA 4CKQA 1GCYA 2YYUA 3GY1A 4KFNA 3SRFA 1FOBA 1VEOA 1MXSA 3LSCA 3R2GA 3PY2A 3M0LA 1LG1A 4FB7A 1SR0A 3WLSA 1GK8A 3MP3A 1CT5A 5LIXX 1LBMA 3UR7A 1YNPA 4AHPA 4ZE4A 2BWGA 3MSRA 2B4GA 3IJ8A 3M0VA 3BJTA 4F66A 1JR1A 1UR0A 1SPQA 3WNKA 4KWUA 5EB8A 2ZUUA 3TYBA 1TV8A 3VA8A 3A3HA 3W82A 3BLLA 4RK8A 3RX4A 1CX9A 1D9EA 1XRTA 1EPVA 1UA7A 1AZ1A 4UQ9A 5I24A 3FJ4A 2VMFA 2WZTA 3NTYA 4CEUC 3TOPA 3R11A 2VC5A 3HJZA 3WCZA 1Q3NA 1XLCA 2Q02A 1VD6A 3SQMA 4DLFA 3KX6A 1J12A 1MI3A 2PDIA 4L1GA 2R6OA 4CU7A 3N18A 1J96A 1SVDA 1GYLA 2XH0A 3UCQA 3WQVA 1Y5WA 1GQLA 2OEKA 5AKQA 1S39A 3QHMA 5H8MA 4FXRA 2REQB 1W1A1 4CD4A 3GW0A 1UROA 3GW3A 5HQLA 3GG7A 3RF9A 2QGYA 1O1ZA 1TWIA 3STPA 1I6NA 4R88A 1Y65A 3CPRA 1KLZA 1MRQA 1DHKA 1LLWA 2C8NA 2HVOA 2ZXDA 2WW5A 4DWDA 4OHQA 5H1WA 5CPNA 2FGZA 5F2IA 3H7VA 1VB9A 4ZB5A 2P1FA 1HKWA 2YFOA 3VOGA 3U2CA 3A3WA 5FI8A 2GQ8A 5A6JA 3P84A 5D02A 2BXYA 3B06A 2OOGA 1MXDA 3N6JA 3VGGA 4YNGA 1VF8A 3RO8A 2Z00A 1L6YA 3FNDA 3KCLA 3MI6A 1PKMA 4BKNA 1AD4A 4LCQA 3GH5A 3M0HA 4GKTA 2QDGA 2OPJA 3SN4A 1SW7A 1TR1A 2G3FA 1T0OA 4MTVA 4FF5A 1QI4A 1KTBA 3E0VA 4IPJA 1PSCA 3FN9A 4O1CA 4HKPA 3MVIA 5G4HC 1JZ8A 3ES7A 4D6GA 2PDHA 2PB1A 4JCMA 1J0ZA 2ZX6A 3NZRA 5HR7A 3E1F1 4ICMA 4UTKA 3W38A 2RJHA 3B9OA 1VGAA 4AAJA 5DMNA 3EXTA 3TDFA 1XSKA 3L0GA 1F4AA 3E74A 1XPYA 1K02A 2PGRA 4ZB0A 3ARWA 4WRHA 3CC1A 3GXFA 4IFKB 2I9UA 1JZ5A 4L61A 3UERA 3TWAA 3BARA 4H8HA 2VRQA 4WLCA 4HU8A 3WDHA 4FLQA 3FCPA 4FIRA 1P7TB 5KETA 2ZFAA 1SO3A 1L6WA 3O6DA 1M65A 3M0KA 4JFUA 4PSPA 3W1NA 3C8NA 5DT5A 3B8VA 1FKXA 4JICA 5HATA 2ADAA 1XLAA 2ZA1A 3W6MA 4DUVA 3UESA 1UZHA 4Z2GA 5AN7A 2Q3RA 1R87A 2QDDA 4DF0A 3P67A 1P6CA 3DYOA 3RGTA 4MPKA 3AFBA 4YTQA 3DFSA 3JW7A 3NL6A 4HNOA 1V02A 2PWVA 4HHPA 3KBVA 5EGRA 5FF3A 2PF0A 1DWFM 1O94A 4JAWA 3GVVA 3TEVA 5A6KA 3QTGA 5JBEA 3T05A 4DWSD 4ZQCA 1PO9A 4HNLA 5AVNA 1K70A 3P6LA 1JYVA 3LD5A 2WAGA 4CD6A 1DIKA 3EKGA 2W66A 5HJXA 3HQNA 1UBPC 4IT1A 2WO5A 5D33A 2PA6A 3A64A 2PGEA 2RAGA 1F7BA 3W29A 5DBUA 4Q8QA 3DGBA 1E0WA 2OQLA 1UUOA 3S2NA 1DP0A 4LC6A 2PDWA 5C0QA 3KHDA 2NV9A 1CXEA 3IIXA 1IEXA 3B0PA 5HXMA 3LTYA 3VIIA 4CU8A 4UZUA 3WNLA 4QQUA 4BK9A 4GUGA 4F2TA 2Z1SA 2HS6A 1FWTA 4L4PA 3HJEA 4AEFA 4HYRA 3RK8A 1JUKA 3QRHA 3WBYA 3QXBA 1US0A 3ARSA 3VKCA 2X0SA 2WC4A 1LUCB 3SCTA 4IUGA 1ISWA 1C92A 2QDHA 4W89A 3S0CA 1WXJA 3KBJA 3LV6A 1ZENA 4ZXOA 5KZMA 3QLLA 4AU0A 4DUXA 4H00A 1H7PA 3U57A 4WJXA 2CU0A 1S46A 4FNQA 3DHUA 4JCLA 4I6KA 1H50A 3DFTA 4GYFA 4HCLA 1QOXA 1KV5A 2YDAA 2IPWA 2IKHA 1JZ7A 2CLMA 4LEQA 1BVNP 1WZMA 2ZXAA 5E5CA 2W27A 1XYMA 3GYEA 1Q6OA 2YKKA 1FCVA 1DIOA 3BG3A 1W3IA 3NWRA 1V3KA 2QCDA 3I6EA 5LIKX 3HPSA 3ONCA 4IXXA 3VFLA 2OODA 3TCSA 1KW1A 4UR9A 3UETA 3GX9A 2VWSA 2Z6JA 4H8VA 5LNSA 1V0LA 4MDPA 4F79A 1H63A 1TG7A 2IQTA 5CSSA 2Y7DA 5CZ0A 3Q94A 2XIMA 2I1OA 1NEYA 3K8KA 4MJMA 1F4HA 3WLRA 4MKVA 4B4FA 5D04C 4ZE5A 1SMAA 4O1FA 2ONEA 4JTEA 2QJMA 3WF1A 1PJ9A 4Q7NA 5D38A 2BGSA 3TYAA 4YN5A 2EJ1A 4L6HA 2R94A 4JEQA 4JQ4A 4UQAA 3FJNA 2R9RA 2GQ9A 3W9ZA 1EOMA 1QU4A 3T08A 5H8UA 2HISA 5D2VA 2I56A 2V30A 4D6CA 3ZS4A 5H91A 2CLHA 3GDKA 2BFGA 3F1QA 3A4WA 1W32A 1C7SA 3CV1A 1EIBA 1N82A 1DIEA 1K4HA 4FNSA 1XCXA 1KXTA 3HO8A 2VELA 3W2JA 3CB3A 1FWBC 3VGEA 1IXOA 4MWAC 4Q32A 1XRSA 2Z2UA 1XCFA 4WY0A 1FCUA 1J0IA 3V36A 3APTA 3URAA 1AK5A 1RLCL 3WLMA 4DJFD 5J5RA 3H12A 3HFTA 4ZCWA 1TV7A 3AOFA 2Q8XA 2BHUA 2BBFA 4ICNA 4V1XA 3PJUA 3BLIA 1UD4A 1WDRA 1V77A 3F2DA 1KR1A 3WLQA 3FAWA 2CPUA 2ZX5A 4GVFA 2DDXA 3N19B 2X0HA 1VBRA 1CYGA 1W9XA 1LTDA 2DUZA 2PU0A 5C9WA 2XFWA 4GBDA 4MADA 4GABA 1T5AA 4DJEA 1XLDA 2BOFX 2ZQ0A 1DJGA 3EDEA 1ELSA 1RQEA 5DMMA 4JIQA 4JYEA 4HZ7A 4EXBA 5BW6A 3EZ4A 3CHEA 3WNOA 2Z7GA 4GVHA 2EQDA 4FOJA 3TNOA 1FWWA 3OYXA 3WFLA 2HE5A 1R7OA 4MFDA 1JUEA 4LNCA 3HG2A 4D6FA 1TTQA 3PBGA 2ZRXA 4M1BA 4U5KA 4TTGA 4I5XA 1EA9C 4U2YA 1OC7A 4J3SA 1OGSA 2RGMA 4DVOA 1H62A 1CPUA 4CNNA 4NG3A 4H7CA 1LL6A 4MFEA 3BE7A 3B8WA 2E77A 2OQHA 3NG3A 1NOFA 2WVVB 2J78A 1P6WA 2V5JA 3CXOA 1R3YA 1F74A 1VFSA 1GZ1A 4GGBA 4OJYA 3OBAA 3VI2A 1E5NA 1TV4A 4H9XA 3U3HA 1R47A 3B8TA 4HMDA 1HKIA 3EB2A 3I10A 3JZEA 2P76A 3RU8X 3J7HA 4GD0A 4FI4A 4MIMA 4CQCA 3GK0A 5FACA 3PPCA 4ZSUA 3BURA 5BMWA 3IUIA 3ZZ1A 1KKOA 4QFUA 4O28A 1CXIA 1GEQA 3MB9A 1ZJAA 3AAMA 1EYEA 2A21A 1XH1A 3UY7A 3KOFA 4UMCA 8XIAA 4IH3A 1EZ2A 1ESWA 2Z4GA 4KWVA 4X2PA 2QV5A 3H8AA 3OZOA 1TJ2A 1SQ7A 4X9SA 3DC0A 5TAOA 1Q6QA 2G0WA 3L68A 4DAIA 3MI3A 1J2BA 4JX5A 3CZKA 3PBUA 4UUIA 4I5RA 5DFAA 3K4DA 1XYCA 1QI5A 3AHZA 2CNCA 2J88A 4M81A 3VZXA 2XGIA 4S39A 2ABAA 2X40A 3H70A 1S1PA 2OXNA 5CAHA 2VFGA 1B31A 5CPTA 1R3TA 7CGTA 1W6TA 5CPOA 2VGIA 4JS3A 3PVFA 1YE4A 3C2EA 1YNYA 4Q8PA 2DGAA 4XZNX 3OG3A 4PFMA 1QNVA 5CEWA 4LRSA 3PP7A 4TMBA 2QQ6A 1LF1A 4TQTA 3CAQA 1EGVA 4ORIA 4H4IA 1CGYA 4DXXA 1WNOA 3EMCA 5D9PA 2X30A 5KZ6A 1W3JA 3Q37A 1NELA 5KEZA 4LVAA 1VIZA 3UYCA 4UTMA 4PBEA 4HB7A 1H1NA 4K37A 3ITOA 1TV3A 1H7NA 1R9YA 3EPNA 4RXFA 1W3HA 2VO5A 4JBRA 4KGJA 2TMDA 2X1UA 3ABOA 2IPFA 3KLKA 3FOKA 3G0SA 4EE9A 4LB4A 1TWZA 1XRVA 1UJPA 3NVTA 3C3UA 1FXQA 4CNUA 1PBGA 1BRLB 3AXXA 2CKSA 3HGSA 2NW0A 4WZHA 4QDMA 1KBLA 1LOSA 2OSXA 4IQDA 1V79A 3S2LA 2NSOA 4IQEA 2DT1A 5DX7A 3RRXA 2V2CA 3KP1A 4U2ZA 2EO7A 4HZ6A 1M04A 4EXQA 3W07A 1Q8JA 1JIBA 2WNWA 5EBAA 5T91A 2RFGA 1E15A 3FYYA 4JKKA 3RM8A 4ECLA 3ABQA 4YYCA 1ME9A 4ZSTA 3ZJ6A 4RZ5A 4GX8A 3LZ3A 4K8EA 3PZOA 4XIMA 4AIEA 1U2YA 5JBDA 3KFTA 3ANYA 3ORWA 4NZ3A 3NEHA 4ZOEA 4JX6A 1Z32X 3KS6A 1TPUA 1EHNA 2WMKA 3HGOA 1O7AA 5C7VA 5A6LA 3WX7A 4PUWA 4IP4A 2YCIX 4GG9A 2B7OA 2YDRA 1V0MA 4U4MA 3UBPC 4DBWA 5BCAA 1B0IA 4B92A 1M7XA 3E38A 3PZVA 3BLOA 3IJIA 1GTHA 3IJDA 1RAKA 2NQLA 4HNCA 3B05A 2FYMA 3QSRA 5KINA 4NJKA 2QJHA 4QG9A 3N2CA 2YGYA 2NVDA 1DEDA 1L9WA 2Y1HA 1MDRA 4M80A 4G8TA 2WJZA 3N29A 2VKZG 5G4EA 1HL8A 4A6GA 4W87A 3WD1A 3EX2A 2X42A 2C7FA 3AALA 4E0CA 1YDVA 4V27A 1YW1A 1UPPA 2V8ZA 4PR4A 2HROA 5M17A 3OO2A 1PKYA 5HWNA 1D3GA 5GJNA 1EXPA 1ZQ5A 3L67A 1JNEA 3W00A 3MU7A 5I06A 4FA3A 3BMVA 4GJ1A 1B3XA 1UH2A 1LG2A 4F3HA 3VPLA 4EANA 3IK4A 2ATSA 3W3OA 1YPXA 1XIHA 3HQPA 3MJYA 3UNTA 1JZ2A 2YL6A 5HULA 4XK2A 1XIFA 3F5JA 1KM2A 2YOCA 4DF2A 3EEZA 1XD1A 1IWPA 2TYSA 2ZRWA 4V33A 4UTWC 2W0UA 1V3HA 2VFFA 3TXVA 4KS0A 4UTLA 2HQAA 3A47A 1SGJA 2PDBA 3GR4A 2HK1A 3D47A 4MMWA 4WF7A 1B3OA 1J8VA 2FMOA 1E70M 3GKAA 3I6RA 1QASA 3E0FA 3GFYA 3RM4A 1RVGA 3VVGA 1GW9A 1L0PA 4DELA 2AQWA 2E8YA 3GNXA 1Y5VA 1H4PA 4QS5A 4YPJA 4Z0JA 3L4XA 4UNLA 4XX6A 4X63A 1L6FA 3O6AA 3LI1A 1VBUA 1JJKA 3OJGA 4OV4A 2IXUA 4AYSA 5T26A 3R8RA 4S3EA 3MJMA 2PDFA 2VD8A 4JEJA 3F5LA 3BPWA 3PC0A 1HVXA 4N7QA 4HHMA 4NUWA 2YYTA 2DIKA 1BEUA 3LCIA 1YBQB 3PR2A 4HMNA 2WC7A 2W92A 4ADSA 4LAOA 3KVMA 2OSYA 1XUZA 3C8FA 4JQAA 4LUSB 2F6XA 4UMAA 1MQQA 1BGGA 2OJPA 2QULA 3QZEA 5DEZA 1AH4A 1K9DA 1OF6A 4EIVA 3QV8A 2P3ZA 1WO2A 3RPDA 3ZO9A 1BLIA 4J2PA 1H0IA 1ZLPA 1IE7C 4FAMA 3TZNA 3DI1A 3TN6A 3GXTA 4JTJA 1QR7A 1OABA 3O0KA 3VM5A 4U10A 2GJRA 3ABXA 3E2QA 3NZPA 3N04A 1UKPA 4KIRA 4B3ZA 2F6UA 5CGTA 1EO7A 2QCLA 4G2DA 1F61A 4BHYA 7REQB 2GJXB 2V3DA 2XDFA 1I45A 1W37A 4XB3A 3TLQA 1NQ6A 3L0KA 1K8XA 2I57A 1KXQA 4I90A 1UYQA 2VFHA 3FFSA 4H6RA 3N13A 4AWTA 1W5NA 3BLPX 1FWRA 2FPTA 1VHNA 3DXIA 1Q7ZA 4M6VA 3WN6A 1PTDA 3G0UA 1XDLA 3CYJA 4IISA 3TA6A 3HZ3A 5CKSA 2CLIA 2DV0A 5J8LA 4NJIA 1U33A 3UYIA 4NVTA 3SW6A 4AX7A 2DZSA 3HMCA 3L21A 1UG6A 1A53A 1ZBKA 5FJRA 1FP8A 4HJWA 2XIQA 1MVYA 3UCDA 3BL3A 3P3BA 1AQMA 4O10A 3MUCA 4TMCA 5A8PA 1JVNA 5IHRA 3TYUA 4EX4A 4JKLA 1V7AA 3C0LA 1Z3NA 3FEQA 4LS0A 4MWAA 2QXWA 3B0VC 2ON3A 3IV8A 4ML9A 3O63A 4FLRA 1NOUA 1QNOA 3KOZA 4BQ3A 3EOEA 5I6SA 2I5GA 2X1IA 5FSDC 5CZKA 3AO0A 4R7OA 5ABFA 2NVCA 1TIMA 3SFWA 3GRIA 1JCNA 1NOWA 5CAKA 4TTUA 2OQYA 3RJYA 3VCNA 1RY0A 3SUVA 1KQZA 2WJDA 1UZDA 4FEZA 3KBNA 1GG1A 3CIXA 1PCKA 5ABHA 4MLRA 3KOWA 5JUVA 5RUBA 4XISA 2JF7A 1DE6A 3S4TA 3BSMA 3TX9A 3RYSA 2W63A 1TR9A 4Y8EA 3KTSA 5CG0A 3A3XA 4KWOA 1W1YA 3MSDA 4GQBA 4LX4A 3E2VA 1EC9A 4QIUA 3IIVA 2G8ZA 1F3TA 4HK6A 4KWSA 1C8QA 3NQ6A 3HM7A 4IL2A 1DXEA 3KEHA 1ZCOA 1F9CA 1BYAA 1G7VA 1K4GA 3CU2A 1FHVA 1H7OA 3LPGA 1HF6A 1EGZA 2Z24A 1NARA 4K36A 2IKIA 1OFEA 1UR3M 1M41A 1HGWA 1Q6CA 4IPPA 4JZ5A 2VHLA 4EPKA 3FLUA 4GGHA 4O4WA 4S3BA 3GC5A 3GR8A 3MSYA 4K8HA 4E8CA 1MO0A 3GYCA 4UFHA 4FOUA 3MCMA 1AL8A 3SCPA 1S2AA 1VAHA 3TQPA 3SIMA 4W86A 3RG6A 4QDPA 1JCMP 1ICPA 4BY3A 3LBCA 4LALA 1HKVA 4N0RA 1HO1A 3KRBA 3TN5A 4V2XA 4Y9NA 4FALA 4F2BA 1QI0A 4Z1BA 3K46A 4JTUA 4TVDA 4H9UA 4HNUA 5I3GA 3PBMA 1JPKA 1W1PA 5LKYA 4FXFA 3L4UA 1DQUA 2Z28A 4C6PA 2ZCGA 4ONVA 4ICCX 2VRKA 4GNJA 3T09A 1W9BM 4O1DA 1LP6A 5BWAA 2A79A 4U3AA 1OCJA 1AFSA 3BAIA 1B3VA 5HWMA 1ZZMA 1ECEA 2QAFA 1QK0A 2CW6A 5FCZA 3KL3A 5MHBA 3G77A 5DANA 3DECA 1TZZA 2ZVIA 1W9PA 4K38A 4ZMGA 1J6PA 2BX7A 3PWIA 4QCFA 4S3KA 1SZNA 3T0CA 1RA5A 1T8XA 1GQIA 3FYOA 1XLKA 1IWBA 1W2VA 5DMLA 4WDWA 1C8VA 3ME3A 3QGAC 3NXFA 3EDJA 3M43A 1XLBA 3CIWA 2I17A 3LYEA 3PPFA 4HNNA 1TA3A 2NV2A 3D3FA 2FH8A 3AJXA 2Y7GA 3UNDA 4WQ6A 4WIWA 3ENLA 1HJWA 1WKEA 4OOUA 1DJIA 1SJCA 3S8HA 3ZM8A 3SFKA 1KV8A 4M29A 5G5IA 3BAYA 3KAOA 3AJ7A 3B8SA 1YDYA 1WE5A 1AMKA 4AZGA 3W7CA 1KBJA 5CPLA 1XL9A 3TW6A 1N55A 3HPZA 1PKLA 4O14A 4GZIA 4GZJA 4CNTA 4DJFC 3P80A 1P4CA 1ZALA 5FJIA 4FO4A 4S2CA 3MT1A 8TIMA 3HB9A 9RUBA 3T0AA 3VNLA 1XP3A 4XIAA 4X0VA 4NAEB 2C6QA 4XKMA 2NX1A 4X3ZA 4PUEA 4JTDA 3PNZA 3QV7A 3MZNA 3P62A 4QJ1A 4YMZA 3U2EA 2QJNA 4HU0A 1YADA 4BF5A 4K1GA 1MW2A 2ZIDA 3UZWA 2GSJA 3S2MA 4JNYA 2DJLA 2PD9A 4DLMA 1NVMA 1TMHA 4JTHA 3W7IA 1UP2A 1T8QA 3DCPA 4KF1A 1OZMA 3O8AA 3CASA 4JQ2A 4B5WA 3PZ9A 4O0ZA 2EKCA 3QV9A 1ZCCA 3VINA 4FX6M 3QQWA 4HIBA 3N4FA 2OEJA 3TJXA 4EVZA 3RCYA 2VGFA 1H61A 1R5YA 1YYAA 1P7TA 2ACRA 2WJFA 2ICSA 2VRJA 3E9AA 3RN6A 4K6AA 2H9AA 1QHOA 2Z25A 3MWAA 1PHQA 3QHNA 1ZJIA 3W75A 5TQLA 2QCMA 4GXWA 3UG4A 3UZZA 1X7IA 3L66A 2CLLA 4B2DA 3I65A 4NL1A 3H7UA 2MNRA 1YPFA 1KR0A 3BSHA 4KCWA 4EOUA 2XZ9A 1BSLA 1M5WA 1H5VA 2PD5A 3N11A 4DZ5A 4ZVJA 6TAAA 4X60A 2EG6A 1UIOA 3DU0A 4UZSA 3WD0A 1GJPA 3TCEA 2DQWA 1XYAA 1O4UA 3MP4A 2V63A 3AXMA 1PZ3A 3K4WA 4AD5A 3GC2A 4PMNA 3CWNA 2VJXA 3WQPA 3GFZA 4IFOA 3NL3A 2ZUTA 2FZDA 2WBKA 3R1ZA 3ERPA 4GYPC 3MHGA 5BOOA 1HL9A 5CXPA 3H2CA 2V3GA 1G7UA 3LHWA 3TE9A 1QK2A 3GXDA 3NQ7A 1EGMA 1JRCA 1UQYA 5DQPA 1GOQA 1REQB 1TTJA 5CLWA 4OV9A 5ECUA 4PBFA 4AY7A 7TAAA 4DY1A 1V02E 4YVPA 1T40A 3U5UA 3PNUA 3SRDA 2ZC1A 3AIBA 5D9OA 4UTWA 3V5CA 4Z1DA 5EPDA 3UG5A 2ISDA 1PIGA 4R85A 2OT1A 2QVHA 2AMXA 5BOEA 1C3FA 3QJAA 3LCXA 8A3HA 1FWGC 2DIEA 5HNUA 3L2MA 3U2ZA 2XN0A 5CCZA 2WMGA 3W7OA 1R9ZA 3LPPA 3R43A 1XI3A 1EPXA 1HN1A 4A2SA 3O05A 2OZ0A 2QS8A 3S2CA 3VIMA 1HNYA 1LUCA 3S9IA 3M41A 4AXNA 2QYGA 4KCVA 1FWDC 1BSIA 3W7PA 3ZYZA 5C2CA 4U28A 3H2AA 4EWJA 4RV3A 3IAPA 3UZJA 4EPEC 4KCTA 2FGLA 3G24A 2BXVA 3S3GA 4UCFA 1G4EA 3WF2A 1AW5A 1WB0A 4UC5A 4XAZA 2P50A 3PG8A 4E4PA 2UY5A 2CXGA 2BDQA 2D22A 3PBWA 4MUPA 2GJPA 3W26A 3VNZA 2YX0A 4MB4A 5FAJA 1JCTA 4D72A 4BI7A 3GG8A 3HG5A 1RR2A 1IEIA 3P8IA 5MKGA 4GIEA 5KMYA 2E0PA 4ZOAA 1BF2A 5U7SA 4HSHA 2DU2A 3GG1A 2WANA 5EMMA 5D4YA 2DQXA 3WL1A 1NF7A 1BQCA 1G4SA 1TUXA 3GZ3A 1I0BA 3DZ1A 1XIMA 2VI0A 4TX6A 4FHAA 5K9CA 1XCWA 2HVMA 4UMBA 3W22A 3RDKA 1SR9A 1AZ2A 4GACA 3PJXA 3S9ZA 3S1WA 2OCZA 1RK6A 4YXGA 4R9OA 3MKKA 2G96A 4O19A 3BJSA 4JTKA 4LS2A 3SM0A 1DORA 2J27A 1VJZA 2QNEA 3BC9A 4BA0A 2YDSA 1E1CA 2A85A 4OU1A 4EF8A 5LZLA 3BWWA 5I3IA 2JGYA 3W7EA 1AW2A 3W02A 4OTKA 1TREA 1GVFA 4AF0A 4Y7EA 1GZGA 3M46A 3RX2A 1E6RA 3TNBA 3T1GA 4FOKA 1KM6A 3O6YX 4NSBA 2KAUC 3USZA 1RA0A 3G1SA 2IPJA 3TLLA 1ZY9A 1EKOA 3ANVA 3WYZA 1O5QA 4GI4A 4X0NA 4AG0A 4MYAA 5MF5A 4IGSA 2PTYA 2HTMA 1TPEA 3LHVA 4PMZA 1IR2A 2F7FA 3L12A 3VOIA 3WLIA 1OCBA 3LCLA 1AODA 3TYZA 4U33A 2YBVA 4MY9A 2D0HA 2WZMA 2XWDA 3NR0A 3A4AA 2F9RA 3WSUA 3ZJKA 4C1NA 4HYWA 5FL0A 2GVGA 3WJXA 1IIHA 3L7RA 3W88A 3QKZA 3BCDA 4AHQA 4ZTXA 4PEKA 1TE1A 4H19A 4YU1A 3A6OA 3QR1A 2P3EA 4S38A 1RCXB 1W5QA 3CTLA 3L65A 4RE0A 1ZL1A 3RITA 1TPDA 4DX3A 1DWHM 1PIIA 1D7FA 1AMYA 3GNRA 3UJ2A 3CIVA 3HMJG 1FHLA 1YRRA 1FQ0A 1XQLA 1JULA 3SCNA 3T7VA 1E0TA 3G1XA 2ZRVA 1L2UA 1SFSA 2Q6ZA 1XIEA 5E6ZA 4JXCA 3UR5A 3LGDA 1MUMA 2ZZ4A 2FZBA 1H60A 3TP4A 3LXCA 3BGGA 3IGSA 3SN1A 4DPPA 4J3TA 3OEXA 2PP0A 4QX4A 3P81A 1EJSC 1DIDA 2A6LA 1BWKA 4LYKA 4JN8A 4FNUA 1FWCC 3T9PA 5D30A 3CUJA 1EC7A 3M0ZA 1TRDA 2ZWYA 1G1YA 3U6WA 3SEPA 3IUDA 5FJJA 1UWTA 3WMBA 4DO5A 1JI2A 2YA0A 2TPSA 1W3KA 3ARTA 4I6VA 3VK5A 1KB3A 4J1OA 3NPVA 4BF7A 4XWUA 3IPWA 3UZXA 2B31A 2Z2BA 1JQXA 4A29A 2CERA 4Y9PA 4NILA 4WD0A 5BRBA 3TJLA 2VX4A 2ZX9A 2FFCA 2W67A 3KVKA 2QEZA 4IIGA 2V3EA 2C3ZA 3MHFA 5ABTA 1YXCA 1XJBA 4QDWA 2VUNA 4Q7BA 2DEPA 2AOSA 4RDVA 4IMCA 3N12A 1BTMA 5DCDA 4LYPA 2A7PA 2C19A 4NRRA 3MY9A 4DI9A 5D8WA 4Q7IA 1SZGA 4HQVA 4M8UA 4E3VA 1PV8A 3NYZA 4ZEPA 3NSNA 3WJWA 2OYKA 2J8TA 3L4YA 3DKLA 4H6KA 4FSAA 1J6OA 1POJA 3K8LA 3K5XA 3PZIA 4GINA 3RR1A 4HP5A 1IR1A 3WELA 3RMJA 1A5UA 3VIFA 4PA8A 2DUXA 3NZ1A 3CT2A 4KKXA 4D6IA 2EPKX 1EP2A 5F2GA 2XFFA 1WA3A 4IG2B 3V0UA 4GE8A 4R33A 4C6BA 1JPMA 4KEZA 2CHOA 1JXJA 4EP8C 4UTFA 2J25A 2Z6IA 4PL1A 2PRHA 2INEA 1ZGDA 2ATMA 1R38A 3SCUA 4MKSA 4NRSA 4CN6A 1WBJA 2UY3A 1I2QA 2XGBA 1T7LA 2I16A 3QQ1A 1VR6A 3BGJA 1E0UA 5CJ5A 3H22A 4ERIA 2RJGA 5A3HA 2ZUMA 4ML4A 3U0HA 1UZ1A 3IJQA 2J75A 2BOEX 2ASHA 2FPYA 3PF3A 4YHEA 4CCDA 3GLCA 5L6UA 9XIAA 2XVLA 4H1ZA 2D69A 3N2TA 2J66A 2QPXA 5FEXA 4DUWA 4PUUA 4PYSA 1KFKA 3R89A 3QY8A 4FXJA 2PZ0A 1YNQA 4HSNA 4PMRA 2OKTA 4WSJA 2KZHA 2D23A 3S5YA 2A1YA 3VNMA 1UUQA 1GHRA 2GDVA 1C9WA 1E9ZB 5KITA 1UQZA 5AC7A 4I9JA 1BRLA 3OU8A 3IS4A 3IJLA 4DJFA 3R13A 3HG4A 4QE1A 1I2OA 4E6MA 3CH0A 2V3FA 5LXXA 1OC6A 4LNYA 3QFWA 4CCEA 5LNUA 4W5ZA 3E02A 3R8GA 3N73A 1ZHAA 3CJPA 1QUMA 3E0IA 1JGMA 1EUNA 3WQWA 4D8LA 4D71A 1RSCA 2CCRA 4QROA 5BRQA 1XIDA 3W2MA 2J47A 3MYPA 5T9BG 2WKLA 2PBOA 1GJUA 2VTFA 3MTWA 1IGSA 3VZYA 4HOZA 2O55A 3THCA 3OP2A 1HKJA 5C70A 5E9AA 4J7RA 3UWUA 2DZXA 1ECQA 1NSJA 2ZA3A 1GG0A 4DQWA 1PTGA 4BS0A 2E6YA 3DC8A 4MY1A 4JTQA 1EB3A 2I14A 3VABA 4ZFCA 4GIAA 2PDKA 3ITTA 4BZYA 1EBGA 3PFMA 1FWIC 2VVNA 3F2CA 3L2IA 7PTDA 2DY3A 3BDKA 2QR6A 4K39A 3W1QA 1Z8AA 3EWUA 2GJLA 2Y62A 1VCFA 4L56A 3F4VA 1A0DA 1BYDA 1G5AA 3UD6A 1UH4A 4MJ2A 2W62A 4V28A 3WZ0E 2EHHA 3B9AA 1I2PA 2JQXA 4XAPA 3H53A 4HMCA 4G6CA 4LY8A 2E3ZA 3SIZA 1YXDA 2CIPA 4Q3MA 2J77A 1A3XA 3WKZA 3ZIZA 2QUMA 1GVRA 1MEHA 4JKMA 3CQKA 3H23A 1CB2A 4A3RA 3PTDA 1B57A 4GNVA 3QC0A 2IUZA 2VC7A 4UNKA 2WQPA 3I7QA 1XW8A 3W7RA 3U8GA 3VOCA 1KWKA 4ZQPA 3UEQA 1E4MM 1IXNA 1Y5XA 3H7RA 4B5VA 3V1PA 1F3WA 4H9YA 4ROPA 4GYPA 3VAVA 3TYDA 4BEUA 1I2NA 4D1IA 3LRKA 1UIPA 3HBLA 5PTDA 2HMCA 4XKYB 4I8YA 2WM0A 5D9NA 4LSBA 3TW9A 4PE8A 5KZDA 5FF7A 5DELA 3FY1A 3MCOA 1TWWA 3O15A 3EWBX 1KCLA 2NWRA 3G1VA 4CCZA 4EACA 2V6AA 3M44A 5CC6A 1RK5A 2ZBTA 3ZR4A 1XYFA 2DSKA 1OX6A 2XN1A 3C2FA 4NZJA 1SM9A 3PTMA 4PC8A 3ABSA 1PHWA 4W7VA 4CVWA 3E6EA 3TA9A 2W4XA 1EDGA 4CD7A 1Q6DA 3ARUA 3OVGA 4M1RA 2VCAA 2R1KA 2VZUA 3G8RA 2CBVA 2O0TA 4DJDD 1QPNA 4JTFA 4UFKA 5CC5A 4F0SA 4WY0F 5C9RA 4TOQA 4ATLA 2C1IA 1MSSA 2NLIA 3PN8A 4RXGA 4P7OA 1WXYA 4RE3A 2CLOA 4R34A 4QLJA 3TK7A 2DSVA 1AVAA 4RNHA 1JZ6A 4H9MA 1WDWA 1V08A 4LAKA 4KT2A 4C6NA 4FMVA 4PCNA 3QMRA 2FJKA 4W4QA 4KGLA 1FKWA 4ZGYA 3I3EA 3EDFA 1GW1A 1LRQA 2YSWA 3S2JA 1B4EA 1XWYA 1B4KA 2DZUA 3GG0A 3GM8A 3HPXA 3VKJA 5IDZA 3GTXA 3IVSA 3S83A 3L4TA 4L7ZA 3H4WA 3K8MA 1OJXA 1XSJA 3AS1A 1M6JA 4B4HA 2HNEA 5CLTA 3QVQA 4UOQA 3KVLA 1V6WA 1UD2A 2CETA 1X6NA 3OHMB 4JY9A 2C18A 2ZRYA 4Q22A 1VIWA 2XIIA 4X2RA 2C1GA 5KTLA 5FESA 2ZTKA 3VM7A 2XG9A 3VIKA 5A8NA 4PH6A 1HIZA 1VFUA 1EDQA 1NWUA 5CC3A 5AVHA 1E3XA 1XLHA 3WK1A 3EOOA 4QRNA 5AYBA 1M3UA 1O6IA 4C5ZA 4CQBA 4FR6A 2D2JA 8RUCA 2YXGA 2F61A 4CD8A 4PMYA 4QHRA 6CGTA 1Q7MA 3GR7A 1NTHA 3PHAA 3W7NA 2CLFA 3ITCA 1K6AA 1UMYA 4JFSA 5AYXA 4MZYA 5D05A 2GGJA 4BI5A 3I3DA 1LYXA 1ZAJA 1PAMA 1WZAA 3VOHA 5EL1A 1DVJA 3NO1A 3STCA 2ZE0A 2O4QA 1R0MA 3SUSA 3T4CA 4HPNA 4WEVX 2DW6A 4H41A 1S2VA 4GWEA 2ZOXA 3R0UA 3PK7A 4MG4A 1RP8A 3QOKA 2CZDA 4DBSA 1RQBA 1S5WA 3HPAA 3D3AA 2VENA 4C6KA 3MW7A 2XSAA 2BY1A 4C91A 1K1DA 2FZMA 5BWFA 3CMFA 1YX1A 1DV7A 1S5MA 5BXSA 3T0BA 2QPSA 1WP6A 1KLYA 3UF9A 1ML1A 2PTWA 1WCGA 2ZXQA 2IKGA 1B3YA 2Y0FA 2JF6A 4IMEA 3R94A 3WH7A 4FNPA 1XINA 1MQPA 4KERA 3WG6A 3WQOA 2C0AA 3QR3A 3LX9A 2CITA 2O9TA 1FWNA 2V82A 4IGNA 1KRMA 1OINA 1T6MA 3S6DA 2VT0A 4JFTA 4E8GA 4XAYA 1TCMA 5ECVA 3M0IA 1OHLA 1ONWA 2WPBA 2P5NA 1Q66A 4WR3A 1RJRA 1XICA 4L4LA 1FBAA 4CQAA 1KXVA 1IF2A 5A6TC 3GAYA 2O92A 2J24A 3UWWA 2HSAA 1UD5A 2G3MA 1KXHA 2YCJA 3L2LA 3OQEA 2EJAA 2BVTA 1NP2A 2JBMA 5HQEA 3LENA 1QO2A 3FIGA 4JTTA 1WBHA 3GHUA 3AUJA 3CHCA 1YXYA 4C90A 2DSUA 1L6SA 4AY8A 4B9ZA 4DBDA 1O66A 5K9DA 4RZ4A 4B90A 4A4AA 1PWLA 5LIWX 3IK2A 2VFDA 1GVIA 5A8OA 2NT0A 4P2VA 4ORMA 1E4NA 4O12A 1F05A 3RCNA 2G97A 1O68A 3KRSA 1RCQA 2PGFA 1JZ4A 2HBVA 5AZ0A 9CGTA 1S5NA 1OFBA 4PTDA 3LDVA 4OGZA 1U30A 2E09A 4H2HA 1OX5A 3S47A 1FXPA 2X1RA 2J4GA 1UH3A 4GYJA 4PFHA 2J13A 4I3GA 3VOFA 1QPRA 2NVAA 1YTEA 5I3JA 4REQB 3UJSA 2ISSA 2PLKA 1RPXA 2ISVA 1E1EA 5DY2A 2C13A 1HJVA 3B0YA 1PDZA 1W56A 5I3DA 2BY3A 1FY6A 5D2YA 3QYSA 4DNHA 3GUWA 3EB4A 3QTPA 4LVBA 1E56A 2O7SA 3GHTA 5TD4A 1JPHA 3UJRA 2E5CA 5F7UA 4ZO9A 3WL0A 1X1ZA 2FLIA 2V5LA 4X22A 2RKXA 3TFCA 3T55A 2DSZA 2GDUA 4N6FA 4Z1AA 1ZJHA 4KH2A 1X6LA 4EF9A 3HGRA 5HOSA 4WSHA 1MEWA 3LBMA 3BG5A 4XD6A 3LBOA 3NDOA 3G22A 5B7YA 1M03A 1WDSA 4JTSA 4WSKA 4DBUA 2YL8A 2PMQA 1ZAHA 3S6TA 4BWLC 2XTKA 3AIUA 4YTSA 5D03A 2Y6ZA 2Y88A 1F07A 4N9EA 1GZJA 6ENLA 1UJQA 3B0XA 1OG0A 2WM1A 3AXHA 3KHJA 3SRKA 4L9YA 4GJJA 4MB3A 1R3VA 3BW4A 3DG3A 2VC9A 4QCEA 1QWGA 4NJGA 2IXVA 2NXIA 1XGDA 4ROQA 2XVGA 5HANA 2GWNA 3NQBA 4Q4PA 4GQQA 4A35A 1A0CA 3IRSA 4M24A 3CV2A 3LNMA 4B91A 4B3KA 4GQRA 1W5OA 1GVOA 2DZBA 2IW0A 1I8JA 1C7TA 3CLWA 4Z17A 3NA8A 1E5JA 2WHJA 4NAEA 1Q7QA 3YPIA 1MRAA 3UWZA 1THFD 3CLMA 1E0XA 4DRSA 3M7SA 4P8XA 1QI3A 5SWUA 4O57A 1QNQA 1BGAA 1XKYA 1H5YA 4AY1A 3QF0A 2FMNA 4NX0A 3CZJA 1V3MA 1ZBCA 4LU0A 3NL2A 4H9TA 5I0DA 1WXZA 3KBWA 2Y5SA 4UIOA 3VDCA 3KOYA 3S5OA 3R0DA 2QCHA 1TZ7A 3F4DA 1M01A 1F3XA 2QUTA 3VGFA 4BQ4A 4E2OA 4J5NA 4MJ4A 4IJRA 3P5YA 3OIHA 1R7AA 3DYPA 4JHOA 4I7UA 4C1KA 1EJ7L 1S2TA 1EDTA 1TJ0A 1CCWB 3GZAA 1XC4A 2OGYA 3ITVA 3A13A 4ERGA 3GDMA 1EO5A 3BQ5A 2C16A 1WZKA 4IQJA 1CBGA 2H3BA 3JRKA 5EY5A 1U5HA 3TSMA 4KESA 4AH7A 4DYKA 1W9UA 4LPCA 1DQXA 2FKPA 1CDGA 1U22A 2CWXA 1US3A 3PANA 4MGGA 3GIQA 3QFEA 4W8AA 5FF4A 4IGMA 3LV5A 4S3GA 2BASA 3NGJA 3PZMA 4WXZA 1QT1A 5FF0A 1VQTA 1A5NC 2GSHA 1OQFA 2PDNA 1NM9A 1P0NA 1LLZA 3V4BA 2WOQA 3L5AA 1VPQA 4JTAA 1WQ5A 1AJZA 3ARYA 1ONEA 2OR2A 4F2UA 2A3EA 5JXQA 4C65A 3M5VA 3IIPA 2J7FA 4JFWA 3N4EA 3EX3A 2WPGA 2V0TA 3GWQA 4L9ZA 2HNHA 1L2QA 3GU2A 1AD1A 1NU5A 4HTYA 1JPIA 3EPOA 1FVPA 1PX8A 3RLUA 4A8RA 1OD8A 2EPMX 2QW5A 4Z2HA 3A12A 1PUDA 4NIRA 1XUUA 3R25A 4GCAA 3WLTA 4O52A 4GUIA 3DEQA 1REQA 4XVDA 1O60A 4GRSA 4GUHA 3VIPA 4HVXA 3AU6A 4BFAA 2ZX7A 2JK2A 1EWEA 1EXBA 4OIFA 1W1ZA 4YHGA 3FHAA 3WUFA 4PODA 1KM4A 3ZJ8A 7XIMA 2V9DA 3BW2A 3H4XA 1H49A 3B9EA 4ZENA 3SCVA 1V4YA 3QY6A 1U1HA 5HWJA 4EK7A 5LGXA 2OO0A 1ZPTA 1XLEA 1PYMA 3UVIA 2VZTA 2R14A 1E6XM 1QHPA 1G01A 2DP3A 3M16A 3GAKA 3LPOA 1VJSA 4MAVA 3AQUA 4UOZA 5I5RA 1G67A 2YJQA 4CQ8A 5AHFA 3O3RA 5C7HA 2Y5EA 4MKNA 3MMTA 2A3CA 2OWWA 1S38A 4BQ5A 3W1PA 4AXKA 3T78A 3VNJA 4ZOBA 5TIMA 3FEMA 3QSTA 1TWSA 3N34A 5C54A 3PM6A 4PCSA 2YDQA 3DFHA 1R6WA 2A7NA 2ABBA 4KFPA 3PZGA 4JTLA 1ZSXA 4HA0A 3STGA 2VZVA 2O9PA 5EFDA 1K8CA 2RGLA 4AVOA 1PZ1A 3LK6A 4KPLA 3SCSA 2OWXA 2X41A 2BSLA 3V75A 5FD0A 3LTPA 5K2ZA 1B3WA 4ATWA 4WDTA 4GUJA 2QCFA 3GSMA 3WY1A 1OB0A 2Z1XA 3CYVA 2I9EA 4LGXA 2VM8A 4R5EA 2WLZA 3P5ZA 4C6QA 1J4EA 3BOXA 2UWFA 2WWDA 1PX4A 2IQDA 3P82A 1MQRA 5HMFA 1MEIA 2QCDB 4RR4A 5I2UA 1OIMA 5DBTA 4B15A 3OA3A 1OY0A 3M07A 1QVBA 3ONBA 4B5TA 4R3UA 1S2CA 2PSNA 4PB3A 5HNNA 2BGNE 1JYNA 1OSEA 2E9LA 1PDYA 4FLSA 2PPGA 2YZ5A 3ZQ9A 4LF2A 4XZWA 1AW1A 2WBGA 1PWMA 4EPBC 5D2XA 2A4AA 4E4UA 3CO4A 4IUOA 5EMUA 4HA3A 2J7BA 1LRNA 4WHBA 1VRDA 4JIPA 3WNMA 4YVVA 5GQBA 3EOUA 3N1AA 2OMAA 3HU7A 2GK1A 3BQ6A 4TIMA 3F2BA 1XG4A 1YTKA 4RX0A 3E49A 3LXAA 4RNIA 3VDHA 2IKJA 2OFJA 3W2UA 5TNVA 2GSEA 3MCNA 4Q4OA 3ABRA 3ALFA 4MZ8A 1WAUA 3B4YA 1TJ1A 4PCFA 4RCXA 5JH1A 2EPNA 3H55A 3FA4A 4R7WA 2W5FA 4XZIA 1KGXA 4M19A 1MYRA 2WYSA 5XIMA 1AH3A 4JDYA 3G6MA 1OK6A 4GC3A 1P0KA 3MMUA 4FR1A 3EWYA 4WY0B 1JFHA 1T96A 2WZHA 1BXBA 3H2EA 5HJYA 4HK5A 2PWHA 5E6YA 4JTGA 3QEZA 8XIMA 4H7ZA 2CBUA 4IHCA 1XH2A 2NXGA 4NZ4A 6ALDA 3W73A 4E2DA 4H8NA 3MI2A 2Y63A 3LU2A 3PTQA 1CW2A 4J27A 5DRCA 1NFPA 1LWJA 4J35A 4M3PA 3EAUA 1Q6RA 2A0NA 3UW6A 3SJ3A 2ZC8A 3D6NA 2VX6A 4QEEA 1VFFA 1RQHA 1K7EA 1EWDA 1OFAA 1V6VA 4TVUA 4E5TA 3EDDA 4L64A 3RPTA 3P61A 3CM4A 5C2GA 5D2WA 3CV6A 1Q63A 3LHTA 3GNNA 3VUPA 3DHPA 2VEGA 3HGJA 2WJEA 4FF7A 2YBTA 2YXOA 4YIWA 1AG1O 4AX6A 1LT7A 1QW9A 4AD4A 4BEQA 2DZWA 3S9YA 4DUOA 4FK9A 3VD4A 4AWSA 1KWGA 4TX9A 3RO6A 2CBJA 2ZE3A 2JIEA 1UB3A 3W2LA 2BB0A 4JNZA 2H90A 3G1FA 4TVCA 3EX1A 4L1WA 2O7QA 4DYJA 6REQA 1Q13A 2DORA 4HHHA 1VFMA 1DWGM 4QTGA 1JDDA 3NOYA 4DJDC 4MSSA 4C5YA 4Q8NA 3PPHA 3AYTA 1RHCA 3ZVIA 1VFHA 1EEPA 3IVTA 3MO7A 5IHSA 1BYCA 5C6MA 1AQ0A 5F4WA 2D1ZA 2XVKA 4AD3A 3WO8A 1MMFA 3AYVA 4HNVA 2YCEA 3IACA 4LB3A 2AGTA 2VFEA 2WMFA 2JIWA 3CWHA 4TUFA 2Y24A 5GPRA 1RD6A 2F2KA 4JTCA 4O18A 5CSUA 5FL1A 3CL7A 2CBIA 3ZVHA 2DT2A 1R85A 1K8ZA 4F40A 4MB1A 5A6AA 5JVLA 3MC5A 3NCOA 1CGVA 2Y8KA 2X7WA 4OE7A 3GU1A 3N2XA 4LBRA 1MWOA 4YS1A 4WVXA 3SI9A 1U1UA 4OKDA 3DYMA 3VNKA 4M51A 1EOKA 1GOKA 2VEFA 1QFEA 2OWCA 4LAUA 1EP1A 1TVLA 3L23A 4GY0A 4PGLA 1TPFA 2GL5A 3JU2A 4NAFA 1Z69A 4AMAA 3RU6A 1KCKA 3H6OA 3HA1A 4EXAA 4Z08A 3RM9A 2QAPA 1LCOA 2PS2A 2WMIA 3SR7A 1Z42A 1W5MA 1A3HA 1V0KA 1UZ4A 1KM5A 4JTIA 2VL4A 4RV8A 3LSBA 3WLJA 5K4XA 5F4SA 3FS2A 1C8YA 1X6UA 2F38A 3NAVA 2F6KA 1FHDA 4BWLA 3V0TA 5E9XA 2VWTA 1DJWA 1DKWA 3EDKA 2EGZA 3MVTA 4PCTA 3U4AA 2ZKMX 1GPFA 4LY4A 2NXHA 4Q6JA 3WUEA 5ABEA 5F2LA 4D9PA 3GIPA 2OZTA 4ZQMA 4ES4A 3ELFA 3PSVA 1FWJC 3AMLA 4C7FA 2NV1A 4B5SA 1JL8A 4I8DA 4K3ZA 2VDIA 1G69A 5EFFA 2YBUA 5CG7A 3COTA 3DG7A 3UG8A 3VCCA 3OOQA 1E6SM 2F2HA 2E67A 5I07A 4HOXA 4IGHA 4D6JA 4G56A 1IEVA 2FTWA 4QISA 3V5FA 4C6DA 6TIMA 5REQA 2HE8A 3G0XA 3DFQA 3BTNA 4WCJA 4QAIA 5A2AA 1XSIA 3PJWA 5DT7A 4ZO8A 5DLCA 4IFRA 2CXEA 1I1WA 3MV01 2Y4SA 1Q4WA 3PUGA 1Z6KA 3EEGA 3OVRA 5DY3A 3OLGA 2CZVA 1SZFA 4J4KA 2X09A 4HN4A 1YHTA 1LL4A 4IWWA 4LBUA 3IGHX 2NX9A 5HMDA 3DBNA 1DJXA 2V2DA 4CQDA 4PRWA 5HK4A 2A3LA 1KKRA 4W84A 5LNRA 4NXSA 4LUIA 5F1VA 5HNTA 2D0GA 2XPKA 4UFIA 2Y5JA 1KBBA 4O4VA 1IZKA 2OYMA 2OYLA 2FVMA 1JRBA 1PCWA 3AWOA 3TN4A 3WEZA 3LMYA 3TMQA 2OLAA 3AHYA 4Y9AA 4LVDA 1RLDA 2PDYA 4HGXA 2WCSA 3THQA 3HTWA 3PZQA 1OYAA 5JIPA 1NY1A 4ACZA 4PMDA 3P2VA 4L4OA 4YLWA 3OGVA 5T9CE 4M0XA 4GI8A 4A3UA 5FKYA 4TX8A 3EGJA 2XJ7A 1J5SA 3UWEA 4H2CA 4JX4A 1UWUA 1IIGA 4IP7A 2AMGA 1H11A 1ME8A 3WQ8A 1R2RA 4JR5A 2WVSA 4US5D 3VD7A 3VCRA 4P7NA 1AQHA 3CHVA 2BY0A 2TSYA 3AZSA 3H2FA 1QW8A 3BCJA 2AL2A 3W23A 4H83A 4HD5A 1JF5A 4HHLA 1ZNNA 1CLKA 3GNOA 3WH9A 3DESA 2OLSA 3AS0A 5A5WA 3L4WA 4LANA 1K8YA 2WCGA 5FEPA 3K4AA 2Y8VA 1F8IA 3CEUA 2YXXA 4D6DA 2BV9A 4C6IA 1RBOB 4W8LA 2VX5A 4H04A 1C90A 2R1LA 4J40A 3TTOA 1KBIA 4JL2A 2WC3A 1GVSA 2UV8G 2VEKA 5M3WA 1YEYA 2YW4A 1JXKA 3MANA 4LT9A 1EH9A 3R5EA 4RPQA 3AS2A 5AC4A 4IIDA 3RR4A 4GFIA 5D37A 1N8IA 3VKAA 4LRTA 1B54A 3W76A 3FKRA 1NDZA 2PF8A 3EMZA 4A8LA 4UQCA 3URBA 3MUAA 5I09A 3GNDA 5FJTA 2JEQA 3LCWA 3R4IA 4HOWA 3M1ZA 2GQAA 3ZR6A 4IIEA 4KW2A 3F5KA 3ITYA 3F4NA 2WHLA 3QW3A 1CB7B 4IIFA 1UOZA 2NWSA 2ALRA 3UVAA 1OC5A 2VUYA 4O11A 3UZYA 2OB3A 3ECQA 2W91A 4GO8A 2X1TA 2VEMA 2GVJA 4H7VA 4GNKB 4I9MA 3VO0A 3N2BA 2QJIA 3G6LA 3I6TA 1GT8A 1M7PA 3I68A 2SFPA 1V3IA 2PUZA 1CXKA 4P61A 3T6CA 1JDAA 4J3UA 1WX0A 3UPWA 2G95A 1V0NA 1UWAA 2D3LA 1SJBA 4DM2A 3WK2A 1QPKA 2FVLA 3PWAA 1UW9A 4FPSA 3OGRA 3VIGA 3OHIA 4O16A 3ZXWA 4ZB2A 1V5XA 3IEBA 2PE4A 3QPEA 4KWWA 4QQ3A 4KBXA 3B40A 2B7QA 1C9DA 4LF1A 3C2VA 4XO7A 4AZBA 4ZL1A 4Y9OA 1UA3A 1ZJBA 4GPNA 3M7WA 1V93A 4M6PA 2E25A 3U4FA 3WFZA 1KRAC 3OTRA 1D7KA 2GYIA 9XIMA 1LWHA 4RNFA 3A4JA 5LNWA 1FWEC 4ZQRA 4HBKA 1TVNA 4S3JA 3VTRA 3UCCA 2R1PA 4F9JA 3LG3A 3T8QA 5J04A 5F2MA 3Q2DA 2ZRZA 3MKCA 4H9VA 1R8LA 1SZRA 1H51A 3KWXA 4RUBA 1KC7A 1VCGA 3N17A 2YA1A 3NQCA 2QIIA 2WWCA 4O15A 4XUGA 1OX4A 1TX2A 3TV8A 5FJUA 4GH3A 1GJWA 3KDOA 4GMEA 3TKFA 1ZBWA 1WPCA 2VCCA 3WLKX 1FCQA 3FK4A 3NOEA 3KBMA 1K3UA 1QBBA 3UXDA 1KFCA 4GI6A 1KM1A 5D8ZA 1IGWA 5CGMA 4NZ1A 2XINA 3EOSA 3VIOA 1A5KC 1MW1A 1NWTA 3LRLA 3SECA 3P0XA 2ZZ7A 1ODUA 1W1VA 4NF7A 4CNPA 1J2WA 1W3LA 1XIBA 5I3FA 3QHOA 4Q4KA 1XXXA 4LAMA 1A50A 3AMDA 3BGAA 1F6PA 3M4HA 4MWAB 3DKJA 4DZHA 3WQCA 3G1DA 3XINA 2I5IA 1ADDA 1E51A 2OU4A 4GA8A 4ZO7A 3W7KA 2XIJA 2FB3A 1X8FA 3W1XA 5HINA 3SQSA 3SURA 4LAZA 1H7XA 3DAQA 4CNSA 3NDYA 3H4GA 5A1AA 3G8EA 5ABFB 2VDGA 4WGHA 3E96A 2EPHA 1M7OA 1H09A 3DG6A 1T99A 3BUVA 3AU2A 3FV9A 1R30A 3WDIA 4OUIA 4J3WA 3K2GA 3WDRA 3URQA 3TQKA 3WJSA 3NQEA 4HPGA 3CUGA 1A5SA 2OO6A 3B3DA 3M0JA 1H7WA 4HZ8A 4UFLA 1O5RA 2Q71A 3PFRA 3IIZA 1S5TA 2HDJA 1YE6A 3UA4A 3RMEA 3T2PA 4IQLA 1JDFA 2QDEA 3CAVA 5DN1A 4LUTA 4PUDA 2ODOA 4BI6A 5FJPA 3LN3A 1XC6A 5AHIA 4GX9A 2Z29A 4W5UA 2EF9A 1VRXA 2ZADA 5XIAA 1CGXA 4DYEA 4IXHA 5EMKA 2XFRA 2B7PA 3AWNA 5C55A 2L5HA 3AHTA 4KRUA 4A21A 1KFJA 3N3MA 5EMYA 4AZCA 3WLOA 5T8GA 5H8PA 5CJMA 1S3TC 2C91A 4LXFA 4GZEA 4Z0SA 2ZXBA 1O12A 4HMEA 4EAYA 4DJDA 4KETA 4OOZA 3CAKA 4MHBA 4H8UA 2YCKX 4N6EA 2ZZ1A 3FGCA 1G9HA 3B8DA 2V69A 5IFTA 2CYGA 1XDJA 3RLGA 3RX3A 4CLMA 4CUCA 1HTIA 4REQA 4PEEA 2OZ8A 3VGDA 1FP9A 4RKAA 3SUWA 2GQ3A 1MNSA 4IX0A 1VLWA 2P0OA 1DJNA 4HZMA 1P1XA 3MQTA 1NH6A 2TODA 3AICA 4LV9A 1GKQA 4O13A 1E0VA 1DPMA 1DWAM 1KA9F 3KLLA 2JKPA 1OFQA 4O8RA 5D2TA 1VYPX 3V1HA 4RL3A 1E6NA 2KX9A 3QC3A 3L4VA 3N6HA 2WHMA 3REQA 5M2FX 4NNBA 2BS9A 2CZFA 3G2GA 4HPJA 4XBKA 3T0DA 2J7DA 3W4RA 4ZBCA 2B81A 3LEPA 4N42A 3S5NA 3H21A 3N9SA 5K4ZA 1F73A 1DJHA 3EPMA 1JFXA 2PURA 4YVXA 1RXOB 2NZLA 1WUFA 1YIXA 2VEPA 1IEWA 3A5FA 4G7EB 1DJZA 3MBDA 1EJXC 3KXQA 2BTMA 1IHIA 1K7XA 4F0HA 1KGWA 5FEZA 1TA3B 2D20A 1GVYA 2PDCA 1VHCA 4LVFA 1GKRA 3F4CA 5IBXC 2P8CA 4OBTA 1EFZA 2J62A 4K7VA 1MXGA 1XGEA 2X2YA 2OSWA 3BOFA 3BLEA 3OBEA 5DCEA 5DF0A 1BPLB 2RDXA 1EF3A 3GHRA 3NQFA 2WMHA 3UP8A 2H8ZA 4OT7A 1QRQA 4ENLA 2QLYA 4M7SA 1D3HA 3OVPA 3A23A 4B5XA 3NZQA 1HP5A 4Q4RA 3T8LA 2PODA 3IUHA 4YL2A 3EKLA 3PULA 4B16A 1TTIA 4LOCA 5XINA 4I9TA 3BAJA 4Z1CA 4MY8A 3UPBA 1A4MA 4E2BA 3ARRA 4LCRA 3WH5A 3NJ3A 4R27A 3STEA 5A8GA 3A21A 1P43A 4ZODA 1XGZA 3N9RA 5HUPA 1O95A 4ZTYA 1POKA 3TZFA 2BOGX 1QXLA 2I7GA 4A8NA 1BF6A 2XYLA 4BJHA 1V51A 2QIWA 2PTDA 2C1HA 2QF7A 3W6LA 3Q58A 5D9MA 3TUUA 2POZA 2QMKA 3OZYA 1WYIA 1K9EA 1W17A 1BG9A 3APYA 3GVQA 2QUNA 3NGFA 1LWIA 3Q65A 5LNVA 3UWQA 2PBGA 4O8AA 5BOFA 1VEPA 1QJWA 4HA1A 4C7DA 4K7YA 4DPQA 2VX7A 2G3NA 4J3XA 2V67A 1R3RA 2ZDRA 1V6XA 3NQ8A 4A8IA 2H9AB 5E0FA 2E9BA 2QZRA 1VH7A 1FTXA 3KE0A 4MAZA 3BO9A 4FZIA 4N9BA 1B3ZA 3WD3A 4A3YA 2ZVRA 1SJDA 4ILSA 3THDA 1VFLA 3HQ1A 1EQPA 2FTYA 3KCJA 3N14A 2CHRA 3GH7A 1A49A 5DO8A 2NT1A 3OODA 3OG2A 4HSOA 1DXFA 1O5XA 1J79A 1X96A 4AIOA 3NIYA 2A5HA 2P0IA 2EXOA 3D0CA 2PCEA 1WZLA 3HFYA 2REQA 3TC3A 3PTKA 3GDTA 3IJ9A 3W1RA 3SCRA 3FVDA 3LCGA 1QO5A 5EA9A 4F0MA 3PUOA 2RDTA 4IPLA 3OPSA 3MMDA 5A6MA 4WJ8A 4UFJA 3SAZA 2ACSA 2QMJA 1UD6A 3C52A 1GQKA 4F0RA 1XKJA 2ZDSA 1S5VA 2WSKA 4BR1A 4TV5A 3NQMA 1VP5A 2PCQA 4XZBA 1OFRA 3CQIA 3NSMA 1Z7AA 3SSZA 1Q6GA 2HJPA 1J0YA 2J9XA 3NO3A 4GVGA 3KL5A 1HKKA 1TZ9A 2E68A 2J9ZA 3DDMA 1AUSL 2ZICA 1J93A 3OYZA 1R3QA 4W7UA 2PTZA 4O0QA 1F76A 3PAOA 3CPUA 2CLPA 3M6YA 3TTYA 3NL5A 2E4TA 1QWKA 4NY2A 4DEFA 4DNMA 3SGGA 2Q3OA 2YLAA 4PUMA 1M9HA 3NXLA 4XD4A 3HQOA 1R3WA 4JIRA 3GUGA 4I7VA 1ZP4A 3W28A 4RW3A 2P10A 4LCSA 3QW4B 1ZRQA 1KTCA 1CLXA 1JPDX 4G5DA 4DI8A 3VILA 3WUGA 4Q33A 1XBVA 4GY1A 4US6A 1X38A 5CJNA 1VEMA 2ZRUA 3EWCA 4WGXA 1XBYA 1HJQA 5K9XA 2PDGA 3UWVA 1QW7A 3G1YA 2JE8A 3QMTA 2G3JA 1SO5A 2DT0A 2WNNA 3SN0A 4D6HA 4NYYA 1G4TA 4LBSA 3UG3A 1UUMA 1A5OC 4IFKA 3N4AA 2IS7A 4UQDA 1VPXA 1AL7A 1XV8A 4LV4A 3ES8A 4JFVA 3LZ5A 1MZRA 4Q8OA 5MKGB 4RDYA 4MNJA 3SGUA 3MUY1 4O1EA 1TPWA 4L6DA 4XBSA 1IYXA 3FX4A 4QNWA 1DOSA 4RPPA 3CQHA 4YTRA 2GZXA 3THAA 2VNCA 2DH2A 5LIYX 5BROA 2X7VA 3VNDA 4JN7A 3PB0A 4CU6A 4GBUA 4NI3A 1BTCA 5I00A 1WOBA 5CZJA 1IXQA 3KL0A 3SCOA 1W1IE 3W2KA 3QGVA 1GVEA 1ZFJA 4XAFA 1OFDA 3ARVA 4HPXA 1GVQA 1UP3A 3CZGA 1NP0A 1PE1A 3WH8A 4PTNA 4GIYA 1EEXA 2Y89A 2RDWA 1FH8A 2YPIA 1A80A 5HQMA 3FJ6A 3IGXA 3EYPA 2VD9A 3WUBA 2NLYA 3EA3A 1OVDA 3VE7A 1RV8A 3IANA 2OZ3A 4MVAA 2XVNA 4R7JA 3TC6A 3A22A 1XLIA 1E1CB 3IWPA 4JD4A 1JEZA 2OGJA 5CH9A 2ZZ3A 3AZRA 5CSRA 1FX6A 2PZNA 2GUUA 3OB8A 1UWQA 1OT2A 1VS1A 3UA3A 2W9MA 3DHFA 1JAEA 4AF0B 3B97A 3TR2A 3LRMA 4PMUA 4AB4A 2VC6A 4IPIA 5I23A 2GOUA 4UNIA 3DFYA 2CFFA 1EL3A 3AXIA 3QM3A 1EZWA 4GFSA 3ISIX 1XM3A 1D8WA 4GZ7A 3U5YA 2HRWA 3BLDA 1CTNA 1GTEA 3GVWA 4WX2A 2GDQA 3W72A 1YDNA 5BU9A 1NWSA 2YW3A 1JNDA 4GUFA 4LJ3A 4DXKA 4C1NB 4WDXA 4DO4A 3W25A 3QLDA 3FXYA 5K7JA 2GGIA 1BWVA 1SU5A 2VURA 1WKFA 3T07A 1Q85A 3ZMRA 2E6AA 1SYTA 1CXHA 2ACQA 5FAGA 1CXLA 4GOAA 2GGEA 1V8EA 3BZJA 2X16A 1W8GA 1Q6EA 3EXRA 4QE5A 3AMGA 4L4MA 3V7PA 5E0KA 3AI0A 4DWSB 3RLVA 4DAFA 1C93A 2WXDM 3C2YA 3TTSA 4W93A 2HPIA 3VE9A 1EC8A 4W8BA 4JTRA 4E8DA 4NKCA 5AYYA 6PTDA 1Z44A 4HCHA 3AISA 5LHEA 3GDRA 4IOTA 3AIWA 4PTXA 1D8CA 2NUYA 4AEOA 1EJTC 1NAL1 4AZIA 3NZGA 1X98A 3IIOA 1MW0A 1RVKA 1XFBA 2AGKA 2WNZA 4S2BA 3VXGA 3ID7A 4PZVA 3S46A 4UQBA 2V38A 2AKZA 2ESCA 4U5IA 5JBFA 1NQKA 3WLHA 1XFCA 4L9XA 3TW7A 3ZSTA 4WXYA 1OEPA 3PG9A 1AQFA 3LM7A 3ZLGA 4PMVA 2ISWA 3S6OA 1DTNA 4GCXA 3WLNA 3RJXA 2Z7KA 2V68A 3LY0A 1TMQA 5CGQA 4AHOA 3C0SA 3KWSA 1SSGA 1TB3A 4L1XA 5A8MA 1P0BA 3UXLA 4RDWA 2Q8ZA 1FFQA 4KEVA 4O53A 5F4XA 1JCLA 5BMXA 2LLEA 1OT1A 1X39A 3VMNA 2PLCA 1QDSA 3ATYA 7TIMA 1CZ1A 3TJIA 2WZIA 3RLHA 3AS3A 3P0WA 3SUTA 3N2OA 4Y9MA 3SUUA 4XQ6A 3KUMA 4FNRA 1TPB1 1LLOA 4AW7A 2DVUA 3WENA 2XHYA 3CZ8A 5CBBA 4U31A 3HIJA 6XIAA 2P53A 2QF8A 5BNKA 1A0EA 3POCA 3ATZA 3PZNA 5HMSA 2YCLB 4NZCA 1M7JA 1J01A 1QCWA 2VGGA 3NQAA 1RJPA 3LQGA 1E9LA 2GVLA 2Z1KA 4N9DA 1ISVA 3GNPA 3SADA 1OF8A 2WHKA 1XLLA 3ANUA 2V5DA 2QUUA 4O17A 1ISYA 3KTXA 3W0KA 2FGBA 4MF4A 4DN1A 4UOJA 5AFDA 1F6KA 2FIQA 2UBPC 3M64A 3AMCA 3CMJA 3C2OA 4JY8A 1EUAA 4V1YA 1VENA 3W86A 2GVEA 3QPYA 2GJNA 3XIMA 4PB4A 3N25A 3QKEA 3BMXA 3B0UX 3E0LA 3H26A 4XVEA 3DUGA 2VDHA 1EQCA 3W1AA 5E93A 1V6TA 1WDQA 4M7TA 3ITLA 5G1YA 3W74A 3LA4A 1KFEA 3B9DA 4HK7A 2VR5A 1SUXA 3PSWA 1ICQA 2DW7A 3UR2A 5FIPA 3WNPA 2E7FA 3IJ6A 2DFAA 3SZ8A 1UKTA 3CPGA 1DTUA 2BG5A 3G5EA 5AYIA 1FDJA 1SO6A 3KRZA 1KO0A 4D6EA 5IBXA 2YR1A 3E2SA 3LS9A 4JYDA 5GNZA 3UR8A 2IMRA 3HPFA 4DBEA 1KFLA 4KIEA 1IZCA 1QNSA 2DIJA 4C6MA 1DXIA 1ONRA 5BU6A 2Z27A 2E40A 5LXEA 3BLFA 4EAMA 1PKNA 5C9XA 3MSGA 1AJ0A 2DPEA 5GJPA 2WNQA 1MFUA 3QH2A 2QGHA 3WF4A 2J7EA 1GWJA 1XH0A 3D46A 4E2VA 4LEFA 3L4ZA 2WSPA 7ODCA 2J7GA 3CHDA 1PX3A 3N6QA 2WV8A 1K03A 2WVVA 3S5ZA 3KW3A 4H6EA 2R8WA 3TH6A 4QJ4B 1DL3A 3GTNA 3NPXA 3TSBA 5CBJA 4HA4A 5A6BD 4LW7A 5G2HA 3AC0A 1HUVA 4QR6A 3W27A 4HN8A 3UFYA 1Q8AA 5CC7A 5E0CA 5JH2A 3JVAA 1E3ZA 4AD2A 4ZQNA 4ACYA 4X61A 1TJRA 2X2GA 3W85A 4JIIX 3L0NA 2CLEA 4LQ1A 3CQ0A 5BRPA 1RBAA 2Q01A 1DWIM 4PULA 1P5BA 1ODZA 3ALGA 1VCVA 2AQVA 2XISA 4XZHA 3O16A 1I75A 5C9ZA 3CZLA 1HGYA 3LI0A 3XISA 3VKKA 1TIWA 1V6YA 5M03A 3WDJA 3R7MA 5G4WA 2WQDA 4QP0A 3R58A 4QM1A 4E38A 4P5UA 4TU1A 1V7YA 1P0DA 4OVXA 3WF0A 5C2XA 3TIMA 4WDUA 2EG7A 3LMZA 3ARZA 4PUJA 4IJBA 4R53A 4PSRA 4YTUA 2W3ZA 4JQ1A 3SB0A 4IF2A 4YJ5A 3RRAA 3Q4DA 2A3AA 2VOMA 5BZAA 2D2HA 2Y85A 1TE6A 4HU3A 1KM0A 1JQVA 4MB5A 5AECA 3WBWA 4E4FA 2UY4A 4CN4A 3W7QA 1NFGA 2Z1VA 4PB5A 2NQ5A 2FHFA 5E1QA 2DZAA 3VDAA 3MP5A