4K1GA

Structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPADSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Endonuclease 4
publication title Insight into mechanisms of 3'-5' exonuclease activity and removal of bulky 8,5'-cyclopurine adducts by apurinic/apyrimidinic endonucleases.
pubmed doi rcsb
source organism Escherichia coli
total genus 102
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4k1gA00
1XICA 8XIMA 2I56A 3BZJA 5XINA 1XP3A 4QE5A 1I6NA 2X7WA 3IUIA 4YTQA 4J4KA 3CQIA 5EMKA 1MUWA 4E3VA 3TC3A 1XLAA 5AVNA 3XINA 2QUMA 3LMZA 4ZB0A 3VNKA 3KBJA 5TNVA 1S5NA 4QDWA 1XLFA 1A0CA 3BZGA 1XLJA 5EMLA 2ZVRA 3BANA 3BWWA 2GYIA 5H1WA 6XIMA 6XIAA 1XYCA 2QULA 9XIMA 3AYTA 1XLKA 3M0VA 3QZAA 2XIMA 1I60A 3IUHA 4QEEA 3IUDA 3UA3A 4DVOA 1XYLA 1XIJA 1XIHA 1YX1A 4LNCA 3XIMA 4K1GA 3AAMA 1S5MA 1OADA 2GLKA 3ITYA 4QDPA 4QE4A 5C9ZA 3WQOA 4GJIA 1XIGA 4HNOA 4A8NA 3VYLA 1XYBA 2GUBA 2J6VA 3GNXA 3L23A 3M0YA 3FVMA 4YTUA 3KBSA 3QC0A 1MNZA 4X60A 1O1HA 4XSMA 2Q02A 4X61A 4XKMA 3KBMA 4GJJA 1TZ9A 3CQHA 3P6LA 1XIMA 4X63A 1DIDA 1XLIA 4HGXA 3KBNA 1XIFA 4PGLA 3VNLA 3UXIA 4GLEA 3KWSA 1QTWA 2NQ9A 3C0QA 4QE1A 3P14A 3UA4A 2QW5A 4OVXA 1QT1A 1XLEA 2ZDSA 3KCOA 3C0LA 3C0SA 3OBEA 2GVEA 1XLGA 7XIMA 1XLLA 3KBWA 3M0MA 1DXIA 3CNYA 3DBNA 1XIDA 1XIBA 3QYSA 5AVHA 2I57A 3ITVA 3CQKA 5B80A 1DIEA 2G0WA 3DX5A 2NQJA 1D8WA 4ZB2A 4YTTA 1XLDA 3NGFA 2XINA 4EAYA 5XIMA 1BXBA 3AYVA 4DUOA 5B7YA 3QXBA 5FA5A 3VNMA 1XLCA 9XIAA 4KW2A 4W4QA 4G56A 1XISA 3KBVA 4EACA 5B7ZA 4QEHA 3BDKA 3KTCA 5J8LA 4A8LA 2HCVA 4GQBA 1DE6A 3U0HA 1K77A 1XLMA 3AALA 1XLHA 4HHMA 5EMJA 1BXCA 5I7GA 3JU2A 3UU0A 3ITOA 3M0XA 2QUNA 3ITXA 4K3ZA 1XIIA 3CWHA 1GW9A 1XINA 1XYAA 3M0HA 4ZBCA 1DE5A 3KCLA 4XIAA 4A8RA 3U3HA 3XISA 5EMMA 3ITTA 2XISA 3CQJA 4PFHA 4YTSA 3VNJA 4HHLA 4A8IA 2OU4A 3M0LA 2X7VA 3KCJA 8XIAA 2NQHA 4YTRA 4US6A 4ZB5A 3VNIA 4Q7IA 3N4AA 4XIMA 5XIAA 1CLKA 1QUMA 1A0EA 2HK0A 4XSLA 1XIEA 2G4JA 4XISA 3ITLA 1A0DA 5H6HA 3TVAA 1XLBA 1XYMA 2HK1A 3UVAA
chains in the Genus database with same CATH superfamily
4IGMA 3SUUA 1GZGA 2WLYA 5J04A 1KFWA 3PZNA 2EGZA 3GSMA 4BWLA 1S5NA 3SGGA 3AIUA 4RE4A 1GOWA 2EPHA 5DMNA 5LHEA 3GTIA 3MANA 3SCTA 4NZ5A 2R9RA 2OELA 2BXYA 2ZXAA 1PV8A 3HFYA 4UQCA 5CBBA 1KTBA 4O54A 1ZCOA 3WJYA 1DVJA 1XHGA 5EB8A 3V5FA 1FTXA 3AFBA 3DZ1A 4AFYA 3FSUA 4HU0A 5A8MA 2O92A 1TCDA 3KBMA 2H90A 2ZX6A 1J0YA 1DTNA 2PTWA 4NI3A 1O5XA 1R30A 3DAQA 2D2JA 3TJLA 1MVYA 1UR3M 2QXWA 3GQYA 1DXFA 4JTSA 1FWCC 4U2YA 3UWEA 1Q7QA 2QJJA 3VD7A 1YDYA 3SCVA 5CQ1A 2Y8KA 1J0ZA 3LYEA 3ZYZA 1JZ2A 4L6OA 4B15A 4IIGA 3T1GA 1GVFA 3Q45A 3AYSA 3P5YA 1BF6A 4GQRA 4WJXA 3A47A 4S3CA 1Q6RA 1XIIA 4E5TA 1O12A 1VPQA 3DI1A 3EKZA 3FYPA 3QGAC 3N3TA 8XIAA 5IXEA 2O9TA 2PP0A 2OOGA 5RUBA 4R5EA 4DBEA 1AQMA 1DHPA 1HVXA 3WDPP 4K8HA 4A22A 1B3VA 3EKLA 4Y96A 1EJUC 3VINA 4UQAA 3S1UA 1YRRA 3NM1A 3PTKA 1X96A 2AKZA 4R88A 3SDOA 4JBRA 2E28A 4R7JA 1AMKA 1IWAA 3W0KA 5CZSA 3KBJA 3PZOA 2VDHA 1D7KA 4LC6A 4M5PA 1T96A 3RM4A 4QR6A 5AYZA 1KFEA 4JCLA 2DW6A 1ZAHA 3GIYA 4DN1A 1XYLA 4BI6A 3VMNA 4R9XA 5LNRA 2DU2A 1K70A 1Q6DA 3BSHA 5LXEA 3RLVA 2RH9A 4M7TA 4ZODA 1J4EA 4ZE5A 4B92A 3BMVA 1OX6A 2I7GA 1QNSA 3QC3A 4PCNA 1MQPA 3OO2A 2O55A 4DZAA 3KBWA 1SJBA 5HQEA 1QHPA 2WW5A 3ID7A 2E09A 5BWFA 3PUDA 1QI3A 3BAXA 5CG7A 2XFYA 5M3WA 1GVOA 1FWWA 2WQDA 1ZALA 5AC8A 3ATYA 5C9RA 5A6SA 4UFLA 1TPC1 1XSKA 4DO7A 4LY4A 4OOZA 4Q22A 2NXIA 2PDCA 4HPGA 1DQXA 2E77A 4MNLA 5DY2A 5C54A 1H3GA 1TJ2A 1EX5A 2QLYA 5C7HA 3HU7A 2V5DA 3CV7A 1XP3A 5U4NA 4FLSA 2YDSA 5BYWA 4H41A 5FJTA 1OM0A 3CO8A 3TK7A 3H4GA 3THAA 1IQ8A 4AXKA 1MEWA 2WJZA 1GYLA 3SGUA 1XQKA 1H41A 2YL6A 4YPJA 5CSSA 1JPIA 5LZLA 4H9TA 4ML9A 2Y62A 4JICA 1X7IA 4HNUA 1O7AA 2ZZ6A 3PJUA 2D23A 3E2RA 2B7NA 1EUNA 1B4KA 1GOKA 1BGAA 2IQTA 3URAA 4J3XA 3CUHA 2PC4A 3EEGA 1QI0A 3BQ5A 3A22A 1QTWA 5JBDA 4H00A 4CCEA 1XLEA 3NL6A 3EXSA 1QWKA 1NWTA 3S4TA 3WQ6A 1TZ7A 1J93A 4J3VA 3IGHX 3KLLA 1P48A 4IF2A 5FAGA 2PU1A 1WA3A 3QLDA 3TLLA 4AZCB 3ZSSA 8RUCA 3EDFA 3GXMA 3U2EA 2ZRWA 1F6YA 3U3HA 5LKYA 2VRJA 3CQJA 3FA5A 4L5ZA 3TZNA 2ZUUA 4IUGA 1V3JA 4ERAA 4UIOA 5EMUA 3T4WA 1LF1A 4FX7A 2XH4A 1D3HA 1DQWA 3ANVA 3FX4A 8XIMA 2I5IA 5FCZA 2FDSA 3WEZA 3H23A 2GZXA 4ZO7A 1POJA 1M01A 4ORIA 3VOFA 6ENLA 4LCQA 1AUSL 2W79A 3T42A 4QBXA 3WLMA 3WLJA 4FXJA 1XLKA 3VILA 1FWAC 4NX5A 1F05A 4CN6A 1S3HA 3SCRA 2VRQA 2VEIA 4QLJA 3V1PA 4O1FA 2VI0A 2A3BA 3PPHA 4H8NA 4X61A 1NOWA 3MMDA 4S3GA 2V68A 3HQNA 1L2QA 4H9VA 1XR2A 4GFSA 4DUVA 2D69A 5EMYA 3WNKA 1BFNA 2YPIA 1JYXA 4NAFB 4C7FA 1GPFA 1J79A 3BLIA 3ZVIA 3ZVHB 4AX6A 4YNGA 3RLGA 2FVLA 1YIXA 2Y8VA 5CKSA 4P7OA 5A6JA 1LL6A 3QR3A 1IEWA 4DJDD 1ZBKA 4KEVA 3MZ2A 3IARA 4WIWA 4GXPA 1G94A 1FUYA 1DOSA 4PFHA 3URNA 1JFHA 1Z41A 3FYYA 3VNIA 3N4AA 1WP6A 4FOUA 5KZDA 2NX9A 4HSHA 3ITLA 3GVWA 5ENLA 4UTFA 1UD4A 3NGJA 1HGWA 2DUZA 1ICSA 2FGZA 2QCCA 3PVFA 3OA3A 4J28A 3SRFA 3F1QA 1X97A 2BVTA 4LXFA 2Q8LA 3GM8A 1VEMA 1XYCA 3WMBA 1WCGA 1UP2A 3T0TA 3A12A 4FIRA 4UTWA 2P3ZA 4GFIA 5FSDC 2DPEA 2VX5A 3FA4A 5DCBA 3WLPA 1R86A 4QE4A 1W3LA 3R11A 3WQOA 5I00A 1F73A 7A3HA 4HBKA 4H1ZA 1ISZA 4GI8A 5EKYA 2R94A 1B3OA 1EP3A 1MRAA 3EKGA 1RQEA 4PN2A 3V7PA 4AVOA 1TTJA 3OVQA 1XFCA 1QPKA 5ABTA 2OQYA 3AOFA 1KFLA 3H53A 1OX4A 3BCJA 5LA1A 4QP0A 1MXSA 1X6NA 3QH2A 4A29A 3PANA 3UYCA 2HCVA 1JZ5A 1FY6A 1C9WA 3A23A 3EB3A 4LYQA 2XGBA 2ZQ0A 5AHIA 2F7FA 1RA0A 1ZBVA 1W2PA 1FH7A 3NPUA 4ATLA 1JUEA 3T07A 3MPGA 4BQ2A 1OQFA 4HZ6A 4JR5A 2PEVA 2CZVA 2DZBA 2F84A 2WSRA 4JFSA 4GIRA 4GNKB 2C0AA 2RFGA 3PN8A 2PUZA 5HUPA 4UZUA 3WBWA 4C1KA 5G4HC 3LMZA 3UCCA 3R8HA 4LPCA 4XAGA 2PCQA 3ZFHA 2GYIA 3GS6A 1Z69A 4M81A 2FQIA 3AICA 4HSOA 5D9MA 4JQ4A 5BU9A 2QCFA 2E1DA 3QOKA 1W1YA 4F0SA 3A3WA 3L68A 2X2GA 4NASA 4HNOA 2P0IA 4U5KA 4IIFA 3UZZA 2BGSA 2XN1A 3LHYA 1Z48A 3NXLA 3CYJA 3WNPA 4AD1A 4Q8MA 4U31A 2PZNA 5I3IA 3TLQA 5BXRA 4NSBA 1QNVA 5MHBA 2GUUA 3M6DA 4O0KA 2FPVA 5BNKA 1CI1A 4RZ4A 3I68A 1ME9A 1RLCL 4IWWA 1UOKA 1C9DA 1WXJA 1XC6A 2NX1A 1EWEA 1B9BA 4LUSB 3DFSA 4AC1X 1PKMA 3G22A 3DESA 4EK7A 4LV4A 5HINA 4NRSA 4HJWA 1LRQA 3LCWA 3MO7A 3UJ2A 3G5EA 3SR7A 2E25A 3FHQA 2PDMA 1RV8A 4PRWA 3VA8A 3VTRA 2JIEA 4C7GA 2HK1A 4X22A 4FOKA 5LIYX 3OGRA 3B04A 1E6NA 3GD6A 4LYKA 2YFOA 3H4WA 1V0LA 2DUAA 3WKZA 2D2GA 4AZGA 3VGHA 3B05A 5I02A 3VMPA 4CCCA 3M1ZA 3W7OA 2ZVIA 1IT7A 4QM1A 1XGEA 3KZSA 1MMFA 1TQJA 1QI5A 3SFKA 1KRAC 4UQEA 3E02A 5H8MA 4IISA 3RM9A 3H2FA 1MEIA 3NL3A 2CITA 4NILA 3VD4A 2A2IA 3TYBA 1R38A 3RU6A 1V0NA 5TQLA 3HPFA 1L8NA 1W3IA 2Y1HA 1JGMA 4O8AA 4RPQA 4FNSA 3TWAA 1KR0A 2CXEA 1UQYA 2EPKX 3HIJA 1NTHA 2WVTA 3FFSA 1C91A 5CPMA 1JD7A 4BEUA 3KOWA 4DHGA 4U2ZA 3ICJA 2CIPA 3CASA 4I5XA 4MNKA 1B3XA 3GDTA 3RIKA 1GKQA 4EKJA 1PCKA 1RLDA 4DEFA 1Y5VA 3LCIA 1WKEA 4Q3MA 3BGJA 3RILA 3GBEA 3B0VC 2ACRA 4BF5A 3NQBA 2ZZ7A 2I56A 4DF1A 1L2UA 1FHVA 3OYXA 3DKLA 3IVSA 1D3CA 4V27A 3C0JA 2F8QA 3S83A 1TR1A 3R58A 4C6OA 4HYRA 1GEQA 1SYTA 2X30A 1RQBA 3RO8A 4GG9A 3WD3A 1SFJA 1JYWA 4PTDA 3I6EA 4F8XA 2XIIA 3K5XA 2ZUNA 3SQSA 3TJ4A 3EBVA 4KCTA 2ZKMX 6TIMA 3H4XA 4UFJA 3FEQA 2VCBA 1WNOA 3S47A 3GDRA 1QNPA 3TUUA 4PMOA 3CHCA 1XIDA 3ZLGA 2VZSA 1EO7A 3GNPA 5DXYA 4JCMA 4LBSA 1SPQA 2PE4A 2GK1B 3LMYA 1XRVA 2Y8UA 4HHMA 3RCYA 5I7GA 4JGDA 4E3TA 2QKFA 1DJNA 1VFOA 3VFLA 3FDKA 1I2NA 6REQB 3WY1A 2AL1A 4C6FA 2ISVA 4Q8NA 3K30A 3C5QA 3UWZA 2XVPA 1XBVA 3L4XA 1JL8A 2D2HA 3ARPA 1UKSA 4K7VA 3LLFA 5H6HA 3FSTA 3GYCA 3G0SA 3ARZA 3EA2A 1XPGA 3RK8A 4Z1BA 4GVHA 3GU1A 5DXXA 2PBGA 3VM5A 1KM1A 1N82A 1GTEA 2G3NA 1ZJAA 1ZAJA 4Q8UA 3GB6A 3WK1A 4LBRA 1W9BM 3MBFA 3MI2A 2E9MA 4D6CA 5HMDA 3AROA 3GNRA 3P0XA 2ZOXA 4AIEA 3T0DA 4A05A 1X1NA 3BJSA 1UUMA 3QC0A 2BOGX 2ZX7A 3GZAA 4S3BA 3UY7A 1UH4A 1DWIM 4O4WA 1I4NA 4X9YA 2VGFA 5BCAA 1TR9A 2WPBA 1JVNA 4IIHA 1XM3A 4GIEA 1OIFA 1PE1A 3L4WA 2WV8A 4NI8A 2Z1WA 2NUXA 2ZZ4A 3NDYA 3AS2A 3GAYA 2NVDA 3UJEA 2HEJA 3VUSA 1W3KA 3SCQA 3V0UA 2E9BA 2ZXQA 3U2OA 2CZ5A 4AZCA 4ZTXA 4FR1A 2R1NA 1H1ZA 2CWXA 4YCPA 2WNQA 1S1PA 4JEQA 3MQTA 3G8EA 2AKMA 5LNUA 1JZ7A 1J9YA 3S46A 1OCJA 4FXRA 3B8UA 1UIPA 2PDIA 4IZGA 5D9NA 3GE7A 2YJQA 1CNVA 4Q4QA 4EAMA 3STEA 2D3LA 1ZPTA 5F4SA 2QIWA 4GYFA 5KZMA 3TW9A 3E0IA 5EMLA 1Q2SA 1UJPA 3STGA 1EA9C 4O50A 2Q01A 3VZZA 3OODA 4BJHA 1HTIA 1UKOA 2AMXA 1H49A 3KOYA 2Y63A 1FWHC 1OFPA 3QV9A 4HZ7A 1JCNA 1VRDA 3B0PA 5G2HA 3GXIA 1S2VA 3AISA 4ONVA 2HRWA 3DKJA 3ALGA 1R7AA 2YA1A 3BSMA 1JPHA 4OHQA 4HP5A 1ITQA 1H09A 1BD0A 2VEPA 2NSXA 3R10A 4PZVA 1S1RA 3MW7A 2WC7A 1EUAA 1GUVA 2I17A 4D6EA 2PPGA 1BXBA 1DJGA 3SCOA 2VGBA 3EPMA 1TREA 4MYAA 1H7OA 3QTGA 1RJRA 3SN4A 4K8EA 2DZSA 3AXMA 5PTDA 3BO9A 4Y9OA 4US5D 3L4TA 1GHRA 4F2TA 2P76A 4H9XA 3M5ZA 1FWNA 3LB0A 1EJWC 2HS8A 1DJWA 5DT7A 1F5ZA 2DGAA 5CJNA 1U1UA 3RR1A 1EOKA 1IGWA 3SM0A 3TU9A 3C2OA 1M7PA 3MCNA 3K8KA 3IV8A 2FTWA 4W85A 1RY0A 3A4XA 3BOLA 3PS7A 1WDSA 1WBJA 4HNNA 2GGEA 5DX7A 4BQ5A 1VH7A 2HNEA 2OEJA 1B30A 2YBUA 3HO8A 1TELA 3M0IA 1EZWA 5LNVA 4MB5A 4D6JA 1J96A 5EU9A 3T2PA 5CC7A 1W32A 5EFFA 3NA8A 1OFDA 4LYPA 3ZXWA 3N6JA 4GMEA 3THQA 1VBUA 2JALA 2HROA 1DPMA 3BOFA 1K7FA 1AW2A 3KOFA 4IQEA 2WHMA 1U83A 3VKCA 3C2YA 3A21A 1CB2A 4B5TA 1V51A 1HKMA 2E8ZA 1PVNA 2FZNA 4QGCA 2O0TA 2PLKA 4ZQNA 4O0QA 1SSGA 1BXCA 5AZ1A 3KCLA 1B31A 4XIAA 1BPLB 1QO5A 1XX1A 1EDTA 4DJDC 3HJZA 3WDRA 3G0XA 4AU0A 4KFNA 2V5KA 4QS5A 2GVYA 5E09A 2QPXA 3G6MA 1AQFA 1R47A 5AHFA 3TX9A 4RK8A 4F0KA 5A6LA 3IK2A 5HMSA 1I0DA 1WO2A 3NAVA 5A3HA 1E72M 1I6NA 4OZOA 2AL2A 4Z42C 1CLXA 1ZU8A 1GQLA 3HFTA 2VC5A 2A6LA 3FLUA 1E3XA 2DQWA 2PTZA 5HWMA 2J75A 2JQXA 3M5XA 5IOBA 4HNVA 2CBVA 1TMQA 5E0FA 4FK9A 1YDVA 5AHMA 3LXBA 1YPIA 3BLKA 4PBEA 4DELA 2Q71A 2A3LA 3ABZA 4D8ZA 1EPXA 2FTYA 4KWVA 1XDMA 2B4GA 3RPMA 4OUEA 4CQ8A 4MUPA 3I3BA 4CGTA 4RKAA 4S3EA 3TH6A 4Q32A 2X0SA 5DN1A 1B54A 4KQNA 3TV8A 1AQHA 4RDYA 1AL7A 3EX3A 2B7QA 2NQJA 5AYXA 1UR9A 3G1DA 5EPDA 3KTCA 2WANA 4P8XA 3VOHA 4Z17A 4S3AA 2QDDA 3THUA 1U30A 4LRSA 2BX7A 2EJ1A 1PL9A 1GW9A 5MF5A 4IPNB 3GUGA 2Y7GA 2FJKA 1J5SA 5K4ZA 3O06A 2DQXA 5EL1A 3DG3A 3HPXA 4JFWA 1RVKA 3NQGA 3V35A 2WWDA 2VFEA 3UVAA 5E6ZA 1L6SA 4MY9A 1LDCA 5BXPA 4MPKA 4UNLA 1K7XA 3TMQA 3WQ5A 2WKLA 5AVNA 4F79A 4MAVA 3EYPA 4GE8A 1FDYA 3TJXA 2HBVA 2Z7GA 1SO5A 1BYAA 3WUFA 4DYJA 3GC2A 2AQWA 2OT0A 1PHWA 3GDLA 3W2JA 3OTRA 3CU2A 4GY7A 1YTDA 4UCFA 1G7UA 1E1EA 2VGIA 4AZHA 3PZIA 3LZ5A 2GL5A 2XH0A 3GIQA 5C2GA 3WBEA 4AC7C 1RAKA 4HPHA 1W54A 1E9IA 3SUVA 4UMCA 4IUOA 1VC4A 1VFUA 1T99A 3FIGA 3KWSA 1Q6LA 4N6FA 1JQVA 2DT1A 1A4LA 2GVEA 1RA5A 4N6EA 3KM8A 2HDJA 4AD4A 4EWND 3DX5A 3GWQA 3BL3A 4OBRA 1QBAA 3JZEA 3EAUA 2XIJA 4GH1A 4RNHA 5D4YA 3H7UA 5GJPA 1OK6A 2VZOA 3F7JA 1UPMB 3M0ZA 4O8RA 4A8RA 4C6PA 5DLCA 3TNBA 3VOCA 2NVCA 4WY0F 2X16A 2V81A 1A5SA 1PX8A 3UERA 2E5BA 3ONBA 4J9JA 1I8JA 4F4RA 3CS2A 1TUFA 3AIRA 1UD2A 5AKQA 3BXWA 1E6RA 4C6DA 1E15A 3EDKA 2UZ9A 3R79A 3NNTA 5LIUX 2W5FA 3PUEA 2ZIDA 3M07A 3OHMB 4JYFA 4HK5A 2ZRUA 2PFHA 4IIBA 1XC4A 2BGNE 4DZHA 2GSEA 3VX0A 3LCHA 3NZGA 4XAZA 1W6TA 5AYBA 2BY2A 1WUEA 4CCZA 3VU2A 5FEZA 3UG8A 4MY1A 1TA3B 5GQBA 4LT9A 2PWDA 3W74A 4GH3A 2Z24A 3UPMA 1AL8A 2YLLA 4GK8A 2IPGA 1HIZA 3AMLA 3NSMA 1LRTA 4PGLA 2NQLA 3D3AA 1CLVA 2JK2A 1GOIA 2DZAA 2X1TA 1XS2A 2PGFA 4XD4A 3N13A 3QZ6A 5AC7A 1THFD 1ZJIA 2QJGA 3LG3A 1DE6A 3APYA 1AH0A 3TC6A 4CD5A 1TV3A 4D9PA 4PRRA 1XINA 3GKFA 2GK1A 1RVGA 4W8AA 3W76A 1DTUA 3EWYA 2ZZ3A 1J01A 3WNLA 3V16A 3JR2A 2OYKA 1FX6A 1FDZA 4LF2A 4UFIA 3TTYA 1V03A 4XIMA 2WB5A 3N18A 6REQA 2FJUB 1OABA 1TPB1 2C8NA 3CJPA 3TYEA 2YXOA 2YBVA 1JZ6A 3HTWA 3VMOA 1LZOA 2WNZA 1ECEA 3DH7A 4MDPA 1REQB 1R6WA 2ZVRA 2QYGA 4PSPA 1SZNA 3TOPA 3SB0A 1E6ZA 3B4UA 5A95A 1HFBA 4GUJA 1JDDA 1I2PA 1VENA 3DUGA 3VK5A 3QV7A 1Y7VA 2XFRA 3W1QA 2BSLA 5CLTA 1V08A 2WJEA 3WL0A 2CLHA 3S9YA 2HPIA 3RX2A 4O14A 3PM6A 1EH9A 4BF9A 4ROPA 3HQ1A 4CVWA 2OXNA 3U4AA 4HYWA 3PWAA 4INFA 5E0CA 3OYZA 9XIAA 3KL5A 1EDQA 2PD5A 4ML4A 2PP1A 1TE6A 3BCFA 3QY7A 4MB1A 4QQUA 5HR6A 1KXHA 4TX9A 5AHNA 2XN2A 5KMYA 3BURA 2YCLA 1SR9A 3U6WA 3V0TA 1NVMA 2X7VA 4B2DD 3KCJA 3IIZA 3MUY1 5I6SA 1RCQA 1TJ1A 4LC8A 3QMTA 2E67A 1Q6GA 2QZRA 4D8LA 3VKJA 2QCEA 4MTVA 2XGIA 3QJAA 2DZPA 3PAOA 2QJIA 3NQCA 2WSPA 3NWRA 4QHRA 1FWIC 4W7UA 3CL7A 4DJDA 3E2VA 1Z6KA 1KCXA 2V30A 4L9XA 3BUVA 2VEFA 4IIDA 4DWSB 4KFPA 4TIMA 5KITA 1TG7A 1BEUA 3QSTA 3U2ZA 5BOFA 5DELA 2DDXA 3BICA 3HPZA 4GGBA 3WN6A 3GBDA 4GRSA 4WVXA 1YYAA 1PZ0A 2CLPA 1Q4NX 3HZ3A 3MUZ1 5D2VA 1IT0A 4N0RA 3WLNA 4AVFA 3SURA 4F40A 1QPOA 4HU3A 3AI0A 1OJXA 2GWNA 2ZZ5A 4PB3A 1DIKA 1SU5A 5AZ0A 3B3DA 3IANA 4I9AA 3E0VA 3F5JA 3ES7A 2XSAA 2FFIA 3P74A 3MYOA 3FJLA 5C55A 3ZM8A 3DYOA 1EJXC 4N9EA 3W6MA 4AY1A 5DRIA 4GCAA 4ZOBA 4F48A 3M0HA 5DMLA 1W1TA 3NQAA 1K6WA 4LANA 1AH4A 2E0PA 3ABXA 2A7RA 1VIZA 3KVJA 4L4PA 1UWSA 3ZJKA 2AMGA 3W38A 3C52A 5A8OA 1H63A 4QJ5B 1LWIA 1DWAM 1XCFA 3Q2DA 1W8SA 1WZAA 1YNYA 1Z3NA 3TIMA 2QUMA 4TV5A 1L6GA 4QS6A 3EWCA 1HW6A 3CIVA 1KTNA 4ILSA 1FQ0A 1S38A 2Y70A 5C71A 2Z2AA 3N17A 4JFTA 2O9RA 1LP6A 4IMEA 3TJIA 1K4HA 3VOGA 2PRHA 3NL2A 3T6CA 4IPLA 4DYKA 2DIKA 3G1SA 1BVNP 2OTDA 4L7ZA 1JRBA 1ZTVA 4PSRA 3CUZA 3VVGA 1DJHA 3QPEA 1GOOA 4R27A 3DYPA 3FYOA 3W1AA 1FRBA 2ACUA 4CCDA 1V6TA 5CAHA 3GG0A 2OWWA 2PGEA 3IS4A 2O4MA 4HPNA 2VJXA 2ZDSA 3W2KA 3KCOA 4KGLA 1ZRQA 4GQ0A 6TAAA 4PC8A 3MO4A 1X39A 4W5UA 3FGCA 1WE5A 1G4SA 3WDHA 1FWGC 4M3PA 4M6QA 2QDEA 2WZIA 3CUIA 5T9CE 3AWOA 3T9PA 3WF1A 4IP7A 4AX7A 4JTHA 1TRDA 2O7QA 3ARRA 2OYMA 1TWWA 3TSBA 1QXLA 4B5XA 2PWEA 4Z2GA 1OFEA 4BKNA 5IFPA 3P62A 4ZO6A 4LAUA 3PJTA 3N04A 1Q6OA 4KWSA 2VEMA 3SIMA 1RALA 4H83A 3EWUA 4WGXA 4KRUA 3BZJA 4AZ6A 2CHOA 4I7VA 1HKWA 5F4XA 3TQKA 1F3XA 1PO9A 3L66A 1R3VA 1B3YA 4UNIA 1XL9A 3L65A 2CFFA 1A0CA 4N7QA 4W8BA 3IAQA 3VAVA 4CD8A 1OCBA 3DHUA 2XVKA 2JKEA 2DT2A 4YN5A 1WDQA 2OYLA 3M7SA 3W7GA 4MKSA 1QATA 2FZ9A 4EVZA 1PTDA 3OGVA 4JTRA 4QITA 1SO3A 3OOQA 2AGKA 1Q6EA 1UWUA 3RRXA 1MNZA 4X60A 4FLOA 2PLCA 3ZSTA 1VQTA 3CQHA 2J27A 3L5AA 2LLEA 1KKRA 4CQ9A 2J7FA 4E8DA 5A2BA 4ACZB 3WDJA 3KP0A 3BAYA 3BW2A 4NG3A 4LTSA 4NXSA 4CQCA 3EWZA 4NHVA 3N2OA 1BWLA 3WD1A 2NZLA 3SRKA 3G1VA 2RDUA 3AIQA 3AALA 5G1YA 3ABQA 2ZX9A 3BJTA 4A3YA 4PUMA 3MKVA 2J66A 1VRXA 1L0PA 1ISWA 2NT0A 4FALA 4TTUA 2HTMA 3TA9A 4NNAA 5HJLA 3QPZA 3KW3A 1KCZA 1N8WA 2XWEA 5XIAA 2WKGA 4AIOA 2KZHA 3L2IA 1RJQA 4JIRA 3B4YA 1KTCA 4YYFA 4B5NA 2JIWA 2OSXA 3BLPX 2CERA 1OF6A 4EXQA 2FH6A 4MZYA 1WAWA 4HNLA 4LRTA 3S42A 2CBJA 3AHVA 1XLFA 2J25A 1NDVA 2G3JA 3UJFA 2ZYFA 2ZRVA 5DQPA 1O94A 3P81A 3PNZA 3L0NA 4FAMA 1GQIA 4CD7A 3GO2A 1PBGA 2IXVA 4Z1DA 2ZZ2A 4Q8PA 1IT8A 1L6YA 3I3EA 2J78A 3BOXA 3SQLA 2GUBA 3M0YA 3A3XA 3EOEA 1SR0A 2P5NA 4E2OA 4QAIA 2YKKA 1NM9A 3PPCA 4JXCA 3LGGA 1DIDA 1HJQA 3BG3A 4FEZA 4HCDA 5AHLA 3WK0A 1ENUA 2YIHA 4FA3A 2W61A 3QMSA 3ZOAA 3BTNA 1CEOA 1E4LA 1FWJC 3B9DA 2Z27A 2QUVA 1IZKA 3HQPA 2IUZA 2NX3A 1QFEA 1PYFA 1W9VA 1WXYA 1WKDA 3Q58A 2WXDM 4FOJA 3MV11 3WNMA 4WK9A 2WVUA 2VNCA 3IJ8A 4F0RA 1V3IA 3N2MA 3FVDA 3S5SA 4MWAE 4O11A 4GABA 4WGHA 1CLKA 4NJIA 4JQAA 4PL1A 4DIAA 4V1YA 1VEOA 1OD8A 3H6OA 1LG2A 4YIWA 1JZ8A 1C8QA 3PY2A 3KDOA 3XINA 4IG2B 3U7VA 4DZIA 3UFYA 1U5HA 3RXZA 2GQ9A 3CTLA 4H4IA 3VM7A 1FWTA 1XF0A 3U48A 2DJXA 4G5DA 3L2MA 1YADA 3V18A 1S5TA 1OF8A 2PC8A 4PL2A 3I65A 1TWZA 1EGZA 3MT1A 4CKQA 5A94A 5BMWA 1M53A 1TA3A 3NQ6A 3I7QA 3IJ6A 3QQWA 3PJXA 1LL4A 2HVMA 3BMWA 4JIEA 1TB3A 3II1A 4WOZA 1NFBA 3NPXA 3HBLA 4D6FA 1FH9A 3EEZA 1OFBA 1YXDA 3RDKA 4HA1A 3S6DA 4A8LA 2DORA 3QQ0A 4G1KA 4BK9A 3TN6A 5FJRA 4H8UA 3MCOA 5GVJA 3CB8A 4FXSA 3S5ZA 4DY1A 1CGTA 3WMCA 1OBAA 1KBIA 3CIXA 4GYKA 1JFXA 3E9AA 4QNEA 4DJFD 3GVVA 3SI9A 1GYNA 3GR7A 8A3HA 2HMCA 4DJED 5ECUA 3PJWA 5D03A 4CNPA 4ZQCA 3UG5A 4TTGA 2A3CA 3MHFA 2Y6ZA 3TXZA 1XRTA 1QR7A 2PRMA 4GPNA 2J7BA 1GVRA 3W01A 4W5ZA 1MYRA 1HJVA 1PZ2A 4W93A 4GZ7A 3AXXA 4QX4A 1IXOA 2J9ZA 4QQ3A 1NELA 1Q6FA 1REQA 1E0XA 1LT8A 4FP1A 4PUJA 3WBXA 2NXGA 1BAGA 2YDQA 3AAMA 3EA1A 4LEFA 1GVSA 1ZB5A 4HK7A 3PF3A 3AS3A 2J6VA 1SO6A 5DBTA 4NXKA 1NOFA 3ORWA 1F7BA 1TTPA 4EF8A 4U5IA 3UXIA 4MJ4A 4NZ1A 1P0DA 1FA2A 1MNSA 4IL0A 2Y24A 3DC8A 1SZEA 5GNXA 1YNPA 1VJSA 3H26A 2OX1A 2WCAA 4GXWA 1FP9A 2C91A 4WSJA 3OU8A 5L9FA 3NEHA 4JTFA 4M6PA 4W9TA 3QW4B 1DE5A 1WX0A 1WUFA 4S38A 3GLCA 2VVSA 2QS8A 4IFOA 1BTCA 1Z44A 5IM51 2QIIA 4MPQA 2BV9A 4FSAA 5CEWA 1J0IA 3MVTA 1T7LA 2BXZA 7ENLA 1CCWB 3LHWA 1UW9A 1NDZA 3QMRA 4BEQA 4WF7A 1JCJA 9RUBA 3KWXA 4OWGA 5AY7A 4YTQA 4L1XA 4J4KA 1M9HA 3R43A 3G1HA 3WQWA 1F3EA 3SRDA 4M0XA 3MP4A 2WPGA 5LA2A 5I3FA 1KFBA 3P5ZA 3FY1A 1LT7A 3CC1A 4L65A 1TUXA 4US5A 1CGYA 1VYRA 4HA0A 3VIKA 2CU0A 3CAWA 4J27A 1NWRA 5A6TC 3IJLA 2WZEA 5G2IA 3OZYA 1YBQA 4DWSA 4BF7A 1XYBA 4Z2KA 2QDGA 3TYUA 4A2SA 3WQGA 4PMNA 3L4ZA 3KTXA 4MZ1A 1XIMA 1DHKA 4UCGA 3WH8A 3WELA 3O6CA 4WHBA 1CYGA 1DWGM 3UZJA 3VGGA 2A79A 2ABAA 5TF0A 4MNJA 1YDOA 4BR1A 2P3EA 3S2CA 1A53A 1OG6A 2C18A 1QNQA 1YDNA 2ZRZA 4WLCA 4ZCWA 1OZQA 4R9OA 1CXEA 1E56A 4GHRA 3QQ1A 2WMJA 3EZ4A 1BSLA 1TV8A 2EHHA 4PMJA 4S3DA 4B91A 1KKOA 3GNDA 4NJHA 4DF2A 4O15A 3RU8X 3W1RA 4CEXC 2YW3A 5A8GA 1PKYA 2V5CA 3DBPA 3IAPA 5FACA 2R1LA 4QNWA 1E73M 3I7SA 2GDQA 3GXFA 1XCXA 2XFWA 2R82A 3KHDA 2V2DA 5LGXA 1DWHM 3ZZ1A 4UFKA 4DM2A 2PDHA 2OO0A 2H3BA 3LV5A 3K13A 2YCKX 3MJYA 4JTCA 5A5WA 1ZLPA 3R2GA 4QEEA 3EGJA 3GXPA 1VPYA 2NT1A 1BF2A 4FNQA 2W62A 4JPGA 3MSYA 4F9JA 3FDGA 2DP3A 2B31A 1W1PA 4GI6A 3EOSA 3BK0A 2XIOA 2YGYA 1VP5A 3CUXA 1T0OA 2DVUA 3HN3A 4GD0A 5HPOA 3ARXA 1P6CA 3WX7A 4PMXA 3WLKX 3N34A 2EPOA 2WLZA 3WH6A 3UZWA 4IT1A 1D8WA 2XZ7A 4DQWA 4P61A 3TDFA 3RCMA 4NNCA 2WBGA 1D3GA 4I5UA 3R7MA 2FHFA 3VABA 2PDUA 5DFAA 2A3HA 1MEHA 1OFQA 4XBKA 1RCOB 1GVYA 2BNJA 4WUIA 3RR4A 2Q3RA 2DJLA 2WSYA 4O1CA 4N42A 1R2RA 3A64A 3OA5A 4LF1A 4MJ2A 4MWAD 1FWEC 3QM3A 3PZMA 1VFLA 5LSMA 2FMOA 1TJ0A 1JF6A 2Z2BA 1XLBA 3E12A 1IHIA 3GH5A 2PLMA 5HATA 4UTMA 2Y89A 1RHCA 3SGZA 3VE7A 3RITA 4FLQA 1TMHA 4JZ5A 3WJXA 2IMRA 1OINA 3DECA 3VIJA 3P67A 4LVAA 3AHXA 4HU4A 3W7CA 1FWBC 3FXYA 3UCDA 4ATWA 4O0ZA 4HMCA 3LHZA 4E8GA 3P7YA 1MQRA 3PC0A 1X8CA 4OECA 2P0OA 1VD6A 1XSJA 1VCFA 1ZSXA 4GJJA 4NY2A 1K8CA 4IMAA 4KCUA 1BWKA 4FNTA 4NZ3A 3C0QA 2OPJA 4X0NA 3C0LA 5BRBA 7XIMA 3AU2A 5AC5A 3FN9A 2Z6IA 2O9PA 2OLSA 1GWJA 5FF2A 4I9MA 4ACZA 5I3KA 4KW2A 4MFDA 1XISA 4PCTA 3BDKA 4LVGA 2G50A 8CGTA 5AYYA 1FXPA 2VX6A 5I03A 1PEZA 5HNNA 1J10A 4KWUA 2VFFA 1FHDA 1QBBA 1Z42A 4HNTA 3TYDA 3AZTA 3OEXA 4ZSUA 3NDOA 3M0LA 5F2IA 3WJSA 4ZB5A 3F5KA 1CENA 2JF7A 3KFTA 2NWSA 3PWGA 3NO1A 2IKGA 4GKLA 2REQB 3PUOA 2IS7A 1IWBA 5FF4A 2P1FA 1UD5A 1ODUA 4UQBA 3T2OA 2H3DA 2EPNA 4AEOA 5A6BD 3WUGA 2TPSA 2DSVA 4YS1A 4XZIA 2VXNA 2FHCA 1VPXA 4UTLA 5F1VA 2R1MA 2JE8A 3P80A 1MW2A 2YL8A 1G69A 1DJQA 1E9LA 1HGYA 3ARSA 3GK0A 4GI9A 4K1GA 3XIMA 3HG5A 5LIXX 5I24A 4ICMA 2FIQA 3W7HA 2YZ5A 4C91A 4E2BA 2HV5A 4AG0A 1UHVA 3GH7A 3VFCA 3VPLA 3O05A 3P61A 3H2MA 3W86A 1GK8A 2XHYA 1J0JA 1JI2A 2J7DA 1QW7A 1UYQA 4LH8A 2OWCA 2VFDA 4GA8A 1K03A 3I3DA 3IV3A 4HCLA 2WMHA 5M2FX 1QOQA 3IJQA 4J5NA 4U10A 3KDNA 1FH8A 1EPVA 1FWFC 4AHQA 1QNOA 2WZMA 4R7OA 5A69A 4GUHA 3M6YA 1LYXA 1OB0A 1OK4A 4LUTB 3AXHA 4N9DA 4MAZA 1FCVA 1KGWA 3WQ8A 2OB3A 4CNSA 3MCMA 1QCWA 4GYPC 1ITUA 2D1ZA 3PZTA 1EB3A 4XTDA 3NQMA 3BZGA 3W1MA 1W3NA 2X0HA 3BANA 1MDRA 2XYLA 3SECA 3RGTA 3MUCA 2EKCA 1FVPA 3IIOA 3ARYA 1FHUA 2EBNA 3VDHA 4RDVA 2CCRA 4QCEA 2NVAA 1E4MM 1XD0A 3LDVA 3SUWA 1WKFA 1SQ7A 3WJZA 1V77A 3ZR4A 1AODA 4K7YA 3BJFA 4EXAA 3EB2A 3SBFA 1PKNA 1U1JA 3PFRA 3KBNA 4RW3A 2Y88A 4AH7A 2P8BA 3VIPA 3A9IA 3CLWA 3N6HA 4S2BA 4XO6A 3QPYA 3ZS4A 4DXKA 4E6MA 3DOPA 3LXCA 2XINA 4KEZA 4MLRA 3ATZA 1YW1A 4MSSA 1JIBA 4NRRA 1H51A 1E9YB 1EF2A 5HANA 1W1A1 3WEMA 3B03A 4AY8A 3FKKA 2W6RA 3NURA 3T81A 2VELA 4ZXOA 2P50A 3TONA 1GT8A 3V4BA 5EMMA 3OVPA 4KFOA 2E5CA 4TQTA 2VMFA 4NNBA 4NYUA 6CGTA 2AQOA 4JFVA 1OCNA 4H6RA 2GQ3A 3TQ0A 4AHPA 2L5HA 3VIMA 4Z2IA 1YE6A 1QMLA 3CAQA 3NOYA 2RDXA 3IUIA 4B3ZA 1TE1A 1E1FA 3ENLA 2UWFA 2XTKA 4K39A 3T8LA 1H61A 2C16A 4G6CA 3LXAA 3TW6A 3M0VA 4XZHA 4B2DA 1T6MA 1K8XA 2OGJA 4AWTA 1WDPA 1CXFA 4FX8A 1CGVA 4H6KA 4QDPA 4JTGA 3QGVA 3PFMA 1W9DM 4XWUA 2C1IA 2HISA 1US0A 3MI3A 4JNMA 4KS0A 5IBXC 3GTXA 1JZ3A 2C19A 4B4HA 3ANYA 2YA0A 1X1OA 3OQEA 1E6XM 1X98A 4WSKA 3CQKA 2G0WA 3QLLA 2BDQA 4MUZA 2BZNA 1I0BA 3W7IA 2B0MA 4ZSTA 1UD3A 4CEUC 2PODA 3LD5A 3W27A 1ICPA 5I3JA 4P8UA 3NVTA 1O4UA 2V3GA 3WLHA 2G4FA 3ITXA 1Q2RA 1G01A 4I3GA 5C9UA 1VFTA 1TIWA 4IJCA 4OU1A 4DBWA 2HJPA 4M7SA 2F9RA 4XZBA 4C6QA 4AZBA 3C4UA 5AB3A 3NEVA 4XG1A 4JKLA 3SFWA 4DJFC 2RDWA 2BG5A 2INZA 4M80A 1MXDA 4DJEC 3GHRA 3APGA 3TROA 4B16A 5H8UA 1P7TB 3LLDA 1VB9A 4Q7NA 1EJSC 3R8GA 3P0WA 3VIHA 4REQA 1RQHA 2PDNA 1A80A 2OR2A 5BROA 1X38A 5T9BG 4HT3A 1JQXA 5ABHA 3FJ6A 4C7DA 4PBFA 1EC9A 4HHPA 1HF6A 1XG4A 3LSCA 2VCCA 4PUWA 4K36A 4CD6A 3S5YA 5G4WA 5I79A 1I75A 3T0BA 3UBPC 4ADSA 3YPIA 1ZL1A 4QE1A 3ECQA 1LTDA 1YXYA 3NVDA 4RLIA 3QR0A 4YTTA 2C71A 1PTGA 4KCWA 4A35A 2FPYA 4A4AA 2DW7A 4W4QA 3AIWA 1XDLA 2F61A 5J8LA 2BHZA 3L5MA 3PSVA 3VIIA 3AIVA 5GJNA 4TVDA 4O1EA 3S1VA 3W81A 2YW4A 3BV7A 1NIUA 1R46A 1NQ6A 4IHCA 1E5JA 3W72A 3A24A 4RR4A 3WFAA 1AH3A 1QUMA 5HDRA 4URIA 1TYGA 2XJ7A 2YDRA 3WUBA 2VOMA 1J6PA 1HO4A 1V79A 4C1NB 1BTMA 3CQIA 3W7NA 1K8YA 4IM4A 2E40A 4B9YA 2VDIA 3CGTA 3MSDA 3G1RA 3R13A 1SGJA 1V4YA 4M56A 4LW7A 3LN3A 2WVVA 1LUCA 3MHGA 3T4CA 3DXIA 4XUGA 2RUSA 3R0KA 4Y90A 4KH2A 4PB4A 4B5UA 1Q8JA 3KOXA 4O12A 3REQA 1SJAA 2WZHA 1QI2A 4ZOAA 1MUMA 2ONEA 3WNOA 1HL8A 4I9TA 4YTUA 3R94A 4J1OA 1VYPX 3P8IA 4NZ4A 4XKMA 4GXMA 3L7RA 4DB7A 4N4QA 3TTSA 1RCXB 3IJ9A 4L64A 2A0NA 3UA4A 4OVXA 1QAPA 2ZCGA 1I1WA 4JTUA 1XRFA 1Y5WA 2H6RA 5H8PA 2OJPA 1SFLA 2PP3A 5LGZA 1UWQA 4V28A 3GUWA 1JCYA 3WQEA 1FWSA 1V6UA 3VZYA 1H60A 3INPA 3NQVA 1QK2A 3CL8A 3IJ7A 1KLYA 1NWSA 3L0KA 3WIJA 1N55A 5HPCA 2Z25A 3HGSA 1W5MA 4MIMA 1TTQA 2OKTA 3S1XA 1RP8A 2GDUA 3C61A 1KRMA 3W82A 2ZTKA 2TSYA 5HQMA 2HS6A 1GVQA 3OZPA 3NOEA 1XH2A 2A7NA 5M03A 1KM5A 4GX8A 1BYDA 1XUUA 3CXOA 4AISA 2QGHA 4C90A 1V6WA 3QHMA 4AWUA 1PIGA 3D46A 3K8MA 1NF7A 2V67A 1KBJA 1GJWA 3K46A 4O4VA 1ISXA 3GC4A 4X2PA 4KT2A 3EXRA 1E5NA 2J74A 5JVLA 1FKXA 4OBTA 1QRQA 4S3JA 1IXPA 2JGQA 1O95A 3EMZA 3OIXA 2GOKA 2V3EA 4Q4RA 4WD0A 1T8XA 4DAFA 3GFZA 4GYPA 3G8RA 4YVXA 2ISDA 4BY3A 5LIWX 5FEPA 2WKJA 3LZ3A 2GSJA 3W53A 3GHSA 1W3JA 3B06A 1XBXA 2ADAA 4UUIA 1UKQA 1Q6CA 1A5CA 2X1IA 5EYWA 1DIEA 1GW1A 2NLIA 1F8IA 2MANA 4NKCA 4W84A 2VD8A 2CYGA 3FNDA 4PTVA 3K2GA 4ZTYA 3BAKA 2YBTA 2D2OA 2OT1A 1C7SA 3AHYA 3THDA 1XRSA 3PTQA 3UU0A 4XBSA 4UFHA 5HAOA 3ZLFA 4AQLA 2E9LA 4C6LA 3SSJA 5G5IA 1IV8A 6ALDA 2E68A 3IGUA 1JUKA 2Z26A 5CC6A 4QG8A 4E4FA 4MWAC 1H2JA 5BMXA 5FJIA 1Q3NA 1J0KA 2VM8A 4C6IA 4QJ3B 3DENA 3MWAA 5I78A 2REQA 3NO3A 1GYMA 5D09A 2RAGA 2HQAA 4GUGA 3BGGA 1M1BA 2PDLA 4YWSA 2Y61A 2QF8A 1UROA 4HJFA 3LM7A 4U3CA 4XZMX 2WBKA 1R3YA 2VQUA 1Q85A 1TCMA 1RPXA 4LEQA 3W7LA 2BVDA 1R2SA 2GVLA 3O6AA 1TVPA 4GYJA 4XAPA 3AU6A 3K4DA 4J40A 2A5HA 2G97A 1NSJA 2J88A 5HR7A 2BWGA 4B3KA 3TTOA 3U5YA 2YZRA 4JY8A 4ZB2A 5DRCA 3I6RA 2Q6ZA 1P0KA 5DO8A 3B97A 1Z89A 1LROA 1RJPA 2YXXA 4WDWA 2NV1A 1OT1A 4KF1A 5IBXA 1JI1A 1EJTC 4W88A 4A8IA 4OFCA 4FB7A 3TEVA 1KWKA 3NQFA 1R7OA 2Z1XA 5A8PA 2X41A 3UWWA 1DP0A 1YKWA 5HMFA 5C9WA 3EX1A 3AC0A 3H22A 2ISSA 2X0YA 5C6MA 2PDWA 1K3UA 4LUTA 1UKTA 1HP5A 3GXDA 2BFGA 5DT5A 4ZGYA 3KP1A 4JYDA 4DJFA 3C2VA 2ESCA 5L6UA 4YU1A 1YMYA 3AUJA 4LCRA 4DJEA 3O63A 4P5UA 1J2WA 2XH2A 2PRLA 3T7VA 3W7QA 4C6JA 4IPPA 2VUYA 1AA1B 1FCBA 2VX7A 5HJYA 2ZX8A 2ODOA 3LRLA 4MADA 3CBWA 3CAKA 2W67A 1SO4A 4V1XA 2C14A 3ITVA 2V63A 5CSRA 1FP8A 3VXGA 1R3TA 4EAYA 2DFAA 4PMQA 1C7TA 3H70A 1KBLA 2AL2B 3BQ6A 4W87A 1QHZA 1K77A 1DQUA 1N2VA 3DEQA 4RZBA 1M7OA 2CBUA 2EAWA 1J6OA 1S2CA 5I77A 4RE3A 2ICSA 3FJ4A 4EOUA 3CEPA 5BZAA 2IKHA 2MNRA 2Y7DA 5D38A 1SW7A 2G4JA 3OLEA 4YHEA 3UVIA 2V3FA 4RDWA 3WYZA 1O6IA 2YX0A 1QVBA 1Q4WA 3O2LA 1BLIA 4V15A 1E40A 2IXUA 2DZXA 2J7GA 3R5EA 1CGUA 3BWWA 3MMUA 1JZ4A 2X1UA 4BZYA 3QN3A 2NQ5A 5CPQA 3W85A 4IOTA 4UC5A 1JCLA 2UV8G 1X6LA 3DERA 2A4AA 4JD4A 3W26A 4PRTA 1VBRA 2QVNA 1QASA 3C86A 1LORA 4D6HA 2GSHA 1CXHA 3DFOA 1HN1A 3K1DA 2YCIX 4Q33A 1U1HA 3KRUA 2DVXA 3SY8A 2VT0A 2ZFAA 3NL5A 4J2MA 1B0IA 3GU9A 3MP3A 3ZJ6A 1DJZA 2I57A 4FNRA 2BMBA 3ZO9A 3MKKA 1DWFM 1VJIA 4G7EA 3SUSA 4RXGA 3M0JA 2CLFA 1LG1A 2EKGA 2ZUMA 2IPWA 3NSNA 4ZFCA 1NH6A 4OE7A 3MA8A 4GNVA 3CZJA 1XLMA 1KBKA 3WD2A 2A6NA 5BOOA 4CN4A 2G37A 3EDJA 4GBDA 3QY8A 4YLWA 4RNFA 4D6GA 1T8QA 3I4KA 2OEMA 1JNDA 1TVNA 1QPNA 1CX9A 3CIWA 4Y9NA 4HPJA 2ZBTA 3UETA 3GVRA 1A5MC 3B8SA 1QK0A 4ZR8A 4BWLC 4AYGA 1IIGA 4KEUA 4AVNA 1OY0A 3RJXA 2CESA 2UY3A 1RD6A 1TPDA 3F2BA 1P7TA 4I9JA 4S23A 2ISWA 2MUCA 4GGHA 1VFMA 3WEOA 1FCQA 3BGAA 1EIXA 3P93A 1PTAA 3POHA 1KM0A 1XD1A 4HMEA 1PZ3A 1M7JA 3PPGA 2VUNA 4GISA 3AQUA 1AK5A 3NTYA 3P84A 3RX4A 1XJBA 5IDIA 5E9XA 3DFPA 2J8FA 4KESA 1JAEA 3IJDA 1B1YA 1ECQA 2B81A 2G41A 2F6XA 2PTYA 1M68A 4NU7A 3EPNA 3QYSA 5CAKA 2CHRA 2EG6A 2XVLA 3SRHA 3ZT6A 4O1DA 3VIFA 2DZWA 3FOKA 7REQA 4ERGA 4BA0A 5CZJA 3B8DA 3LGDA 4CNNA 1P6WA 2RGMA 1KC7A 5SWUA 1UR2A 3LPFA 3TR9A 1O5QA 4TUFA 4HHLA 2PZ0A 3L9CA 1EGMA 3LPPA 1OT2A 3GNOA 3F4DA 1P4CA 3HOJA 2IQDA 1ALDA 4JFUA 2J77A 2X1SA 2HK0A 5CPOA 3VGEA 3EX6A 4LVFA 3UPBA 1H0IA 1BYBA 3COTA 3OIHA 5XINA 3W23A 3R1ZA 1GOXA 4FO4A 4L6DA 1OHLA 3HG4A 2O9OA 4KIEA 4XZWA 1OGSA 3UJSA 3OLGA 1EQPA 3KVKA 1VLWA 4C1NA 3RYSA 3GZ3A 1N7KA 1YNQA 1J12A 5IHRA 3QV8A 3AMCA 1ONEA 3GNNA 1JDFA 4D71A 1XIJA 3UGRA 1E1CB 2I14A 1P1MA 3CB3A 4DO6A 4AUBA 4RUBA 1J11A 3DHPA 1PXGA 4Q4KA 4S3KA 2V5JA 2VVNA 3B8TA 3KRSA 2VZUA 1JDEA 1B4EA 2PLJA 3TSDA 5EBAA 3TC7A 2A21A 1VAHA 4M8UA 2WNNA 2BB0A 5CC3A 3PZQA 2D24A 3VKAA 1O60A 1BRLB 3KBVA 1JXJA 1JAKA 1ITCA 3M4HA 2VR5A 1SZRA 2QCLA 3ZR5A 5C8BB 2GGIA 3WLRA 4RNIA 5T8GA 3BVJA 2HXUA 2XVNA 2XU2A 3LTYA 5JH1A 5U7SA 4E8CA 2FVMA 4US6A 1LOSA 1YE4A 3TE9A 2CETA 4IP5A 3SCWA 2HBXA 1AW5A 4PMRA 2G5WA 5FKYA 1KB3A 4DXXA 4C5YA 4AD2A 3NQEA 4ENLA 2AAAA 1KQZA 4LCSA 3GG1A 1SZFA 2GVGA 5FL0A 3BSGA 3ZWSA 3HM7A 3G77A 4AY7A 3EWBX 5D04C 4GJ1A 3BARA 4LAMA 2C1GA 3HGJA 3O07A 2V0TA 1KGUA 4GVIA 3QVQA 2YCLB 1GONA 3H7VA 5A6BA 4ZFMA 1CGWA 1GQNA 4E4PA 3ANUA 1E6QM 1DXIA 3CWNA 1R3RA 3IGXA 4UB9A 4GC4A 3RMEA 4XZNX 2IKIA 4XAYA 3UYIA 1PS9A 2XM1A 3S9IA 4JL1A 2D0HA 4PUKA 2FDMA 4QTGA 3WH9A 4OIFA 3LPGA 1XQLA 4PTWA 4DO4A 2Y4SA 3DN5A 3URBA 2WMGA 4IJBA 1IEVA 2TAAA 1W2VA 3ERPA 1DIOA 3ITTA 1XGDA 3QKZA 3UWVA 1KCKA 3HG2A 5I3DA 3RN6A 3DCPA 3N14A 3DFTA 1US3A 2BTMA 1MW3A 3C8NA 5JH2A 5E1QA 1V6VA 1XW8A 5FAJA 2ZXBA 5AYIA 1E51A 3W7JA 5I2UA 1V8EA 3UNDA 1H4PA 3LENA 3G2GA 1S2TA 1YTKA 4WY0B 3LQGA 4JN8A 3CV6A 4J3UA 3HPSA 4KERA 5BU6A 1MUCA 1I2QA 1W5NA 4R53A 3M0KA 2BY0A 1ZJBA 1HL9A 3AS0A 2HE5A 4CU8A 3VCRA 3BLFA 3VDGA 2YR1A 4LOCA 2YXGA 2ZE0A 4L1GA 2XSXA 4GJIA 5HWJA 1VCVA 4GI4A 5D30A 1HX0A 2PAJA 3H2NA 3WENA 1SJDA 3NJ3A 4AAJA 4H04A 1V7AA 1A3WA 1OC6A 3M16A 4PUUA 1B5TA 4EF9A 7CGTA 3A5FA 4DLFA 5TD4A 5I0DA 1HJWA 4OGZA 3H54A 4ADTA 4E38A 4XUYA 4H19A 4JTAA 1C29A 1F61A 4IFRA 2FZMA 2CZFA 3I7RA 3LBCA 4Z2JA 1MI3A 3M9YA 1NP0A 2PI6A 4OOUA 2DH3A 3N19B 1GHSA 2EEXA 2CKSA 2B7PA 1PB0A 2BS9A 4XSLA 4P7RA 1UH2A 2XG9A 1NU5A 1D8CA 1OYBA 1UA3A 3B0UX 3WD4A 1UZ1A 3B9AA 4ROQA 1UJQA 3NZ1A 3CUFA 2PS2A 2EG8A 3SADA 4IPIA 1Z9AA 4MY8A 5F4WA 5JBFA 3ARTA 2J9XA 1WOBA 4YHGA 1F74A 3CPGA 1PAMA 3DFYA 1TPWA 2EXOA 2OZ8A 4JHMA 3AMKA 2VFHA 3FGCB 1TPVA 3A5VA 4QAWA 4ZQRA 4HA3A 1XIHA 4J3WA 3CZ8A 1EHNA 1Y65A 3S3GA 1QPRA 3DFNA 3MTWA 4MMWA 3B8VA 3N9SA 4RE0A 3OJGA 1JXKA 4KETA 5D32A 1N8FA 3P2VA 2WHJA 3UXDA 4D1IA 2EPMX 3SY1A 5K2ZA 4KRTA 3C3UA 3NQ8A 2DT3A 2E4TA 3DG6A 3UG3A 1W1B1 3ARUA 2BXVA 1UZ4A 3WBAA 2WK2A 4PTNA 1OIMA 3UZ5A 4LAZA 3W87A 2NWRA 1GQKA 2DIJA 2PWGA 3S6TA 1WYIA 3RO6A 4WEVX 3ITGA 3PTMA 2PGRA 1ME8A 4XV0A 1GEHA 1IXNA 1UD6A 3GG7A 4JN6A 1EEXA 2XISA 5HOSA 3D3FA 1JUBA 1XH1A 3CPRA 5ABFA 3M46A 3U2CA 5D05A 2OOFA 3F4VA 3PBYA 4XKYB 6XIAA 2QJHA 2DUXA 4GY0A 4GX9A 1TO3A 3T40A 4IMGA 3H24A 4IMCA 3SIZA 4JQ2A 1PX3A 4ICCX 1RBAA 1TJRA 1UR4A 4EPBC 1NQKA 5E9AA 3TN4A 1SMDA 4IGHA 5HNRA 2KAUC 3FAWA 4LVBA 1W5OA 4JX5A 4A3RA 4AD3A 1TWIA 2Q8ZA 2PA6A 4G8TA 3VIGA 4H9UA 2WMIB 2J7EA 3IVTA 1QNRA 5CJ5A 2CXGA 1FHLA 2OG9A 4H7CA 3TNOA 2YYTA 1BG9A 3M0MA 4X2RA 5DF0A 3DBNA 4MJZA 1UBPC 4XB3A 3S2MA 2ALRA 2UY5A 5J5DA 2V2HA 1KQYA 2C15A 3HA1A 4UMBA 1MW0A 3LCGA 5JIPA 4YL2A 1QHOA 4O17A 3GIPA 1S2UA 2VENA 3W71A 1WDWA 1ZZMA 4OT7A 5LIKX 1LM1A 1PHQA 4JY9A 3U57A 3IVUA 3S1WA 2X09A 1PUDA 4PMDA 5HMEA 2GVJA 2WSQA 3M7WA 3W25A 2QR6A 3UWQA 3N2BA 1M03A 2XPKA 3TAOA 3MYPA 3H21A 2A3EA 3CO4A 3N1AA 1XBZA 1SUXA 4JYEA 3LK6A 4WKAA 4DRSA 1EP1A 1UP3A 2QUUA 3CAVA 3LUTA 1XWYA 3N6QA 2PGWA 4Y6GA 4R3UA 1UOZA 4DPPA 3N3MA 3QW3A 4H2CA 4DUXA 5FJPA 5FSEC 1O5KA 4FI4A 3WQDA 6A3HA 2VWSA 4HPXA 4XK2A 3IJIA 3ZQ9A 3VGDA 3CZEA 3K4AA 2ZRXA 1LWHA 4DNMA 2QCHA 4H3DA 1MW1A 4XSMA 2OGYA 1TZ9A 1XFBA 3WBYA 2Z1BA 2BVWA 4D2JA 1ITXA 4LALA 1MZRA 3WMSA 2ZZ1A 4TR9A 3N25A 2PCEA 4EANA 2VC7A 4DUOA 3EA3A 4QSFA 3O9NA 3EOOA 3WG6A 2VC6A 3V36A 4JKMA 3S8HA 1WV2A 3BMXA 1HQTA 1FFRA 5LYRA 2OSWA 4W7VA 5KINA 4KIRA 2FKPA 3VE9A 4AW7A 3QFEA 5C0QA 1MWOA 3QR1A 1E0TA 3VI2A 1EO5A 3PUGA 1EC8A 4QFUA 1MQQA 2WAGA 3W7PA 5EMKA 1OSEA 1DKWA 3GW0A 3NSXA 4LAKA 2ON3A 2WWCA 4J7RA 4GINA 3ITCA 1JCTA 2C13A 2GQAA 6XIMA 9XIMA 3JW7A 1RPKA 2TMDA 4TO8A 1LLWA 1XYFA 3AHTA 1KXQA 2WQPA 2BOEX 3TYZA 1V93A 3L5LA 4V33A 3L21A 1QPQA 3VGBA 1CW2A 4V2XA 2I9UA 2YSWA 1KXTA 2IQ0A 5AN7A 2NUWA 1DORA 5K9DA 4S39A 2WM0A 4FX6M 1A3XA 4GZEA 1E1CA 4ZMGA 3C2RA 4GACA 2QCNA 2DSWA 3CMJA 3DGBA 1UC5A 3DIPA 4H6QA 3NYZA 2HWGA 3Q67A 3ARWA 4EWJA 2PDJA 1BYCA 3AXKA 2EQDA 4I6KA 5MKGB 4LQ1A 1HKVA 2FVKA 3A4AA 3LCLA 3QTPA 1R85A 2PB1A 1J18A 1H7RA 3GRIA 3GX9A 2YB1A 4DI8A 3U0HA 1GVIA 3CHEA 5BWAA 3MDUA 1V02A 2VO5A 2XGZA 3QZEA 1BRLA 2IKJA 3CZKA 3PNUA 1IYXA 3N12A 4Q4MA 3MB9A 4K2SA 2NQHA 4PTMA 2HSAA 3EXTA 3KTSA 4O53A 4YCOA 2YL5A 2YL9A 3C2EA 4WCJA 4PODA 2OZ3A 1OFRA 4MHBA 5HXMA 1Q7ZA 4RW5A 5DEZA 3SO7A 2ZA1A 2PBOA 4PCSA 4K6AA 2CKRA 3E49A 2Z00A 4A2RA 1X1ZA 1PZ1A 4JTTA 1XLJA 2J7HA 1NP2A 3W2LA 3CHFA 5I3HA 1AJ2A 2PDPA 2GJNA 2Z1VA 2H9AB 2Z2UA 1E0WA 5D33A 2QCDA 2P8CA 1XUZA 4NAEA 1RZMA 2VD9A 1TTIA 3T0AA 2ZTJA 3TR2A 1UA7A 4QLLA 1ONXA 3L23A 3WSUA 3AZSA 4H9YA 4ZEPA 3N4FA 2VZTA 1O5RA 5FF0A 3QBUA 1V5XA 4TOQA 2GDVA 3SCPA 4IMDA 5IRPA 4IQDA 1CIUA 4ES4A 1K9DA 3UR8A 3W29A 1I2OA 2NV2A 4UNKA 3M5YA 4HTBA 1LCOA 2PDXA 3FS2A 3TZFA 4UTTC 1KBBA 3IEBA 4LUJA 5HUOA 3SY5A 4O16A 3AUOA 5EFDA 2YDAA 1LQ2A 1RBLA 1YEYA 3QEZA 3MV01 2KX9A 3GDMA 3MDWA 2VP8A 3FV9A 3HPAA 4H01A 3AMDA 1WZKA 3KRZA 4N9CA 2C3ZA 9CGTA 2DZVA 3W88A 1G4PA 1YBQB 4F2BA 3HV8A 3DFHA 3THCA 4LB3A 4QE5A 3T8QA 4IL2A 1LLZA 2JEPA 3H2AA 3LI0A 4UR9A 3SUTA 2EG7A 2DZTA 4U28A 3VKKA 2HVOA 1SMAA 2PWUA 4OJYA 3W28A 2W92A 4WY0A 5CSUA 4AF0B 3H12A 5CSYA 4M1RA 4E2VA 3PBVA 3WF3A 1KXVA 4LNCA 4C60A 2V2CA 3IIPA 1V6YA 1EOMA 4LBUA 4DXVA 2BVYA 1B90A 3UG4A 3BLEA 4HYVA 1TV5A 1QJWA 1WZMA 4Y9MA 4FIQA 1X6UA 2DH2A 4JHOA 3LHUA 1DJXA 3B9NA 3T09A 3CUJA 1S2WA 3GKAA 3H8AA 1U22A 3ZIZA 3DHDA 5I3GA 3WUEA 1CXKA 3LTPA 5E5CA 1KV5A 4J35A 1WZLA 1FFQA 3ME3A 4IH3A 6PTDA 1E0UA 1ISYA 3N4EA 2VC9A 3U7BA 4EP8C 1VHNA 1J8VA 1JEZA 4QSHA 2Q09A 3QRHA 5A6AA 1EWDA 3NIYA 3RRAA 1EP2A 4OTKA 3F4WA 5CPNA 5E93A 5LNWA 1XYMA 4RDZA 1UKPA 5CCZA 3OZOA 2WZTA 2DSKA 4HZ8A 4G9PA 1DXEA 2VFGA 3SCSA 2V5LA 3GXNA 5CC5A 1UMLA 4M82A 1Y0EA 2YB4A 1TIMA 1H11A 4DI9A 3ABRA 4U33A 4TX6A 1NEYA 4WJ8A 3WNNA 3GYEA 1TX2A 1EBGA 1G1YA 1P1XA 3SN0A 3WLLA 4E4UA 3RG6A 1E6PA 3G3MA 3P6LA 4IMFA 4UQ9A 2VZVA 1YXCA 4XD3A 2ISFA 3W73A 1V3MA 1R0MA 3S0CA 3GR4A 5I23A 1ZFJA 4L4OA 3PZUA 1O66A 3EOUA 4Q8VA 3E3HA 3OLDA 3STFA 3WLOA 4KWWA 1FCUA 1ZP3A 4OV9A 4MYXA 4NUWA 2GQ8A 3GG8A 4GQBA 1XG3A 2NSOA 3NDZA 5KEZA 3TQVA 5KTLA 2ZX5A 5DBUA 1G6CA 2CHNA 1K8ZA 3HQOA 4JTQA 2QCGA 3AZRA 3L4UA 1H7XA 4AWSA 7ODCA 4AZ5A 3USBA 1EX1A 3LI1A 5KSWA 3CV1A 2D20A 3U5UA 2FGLA 1VEPA 3MC5A 5EGRA 4NVTA 4AD0A 4AWEA 2G95A 1KFCA 5CGTA 1OD0A 1IEQA 5HWNA 1CGXA 2X7WA 4XD6A 4B4FA 4PBGA 1VCGA 3OB8A 4XKYA 1Q66A 1VFHA 5D2TA 3PWIA 5JU6A 4I7WA 2E6YA 4LS0A 2JBMA 1NDWA 4YVVA 1HJUA 3QY6A 4O52A 4A21A 4DF0A 1JG9A 2RJHA 4ZOEA 3WO8A 2QJNA 4XZLX 4Z1AA 2BY3A 1YTEA 4H6EA 1UUQA 1B9ZA 1JPMA 1W91A 2WMIA 3JUGA 3PTDA 3VNZA 2FLIA 4NQ1A 1ELSA 3LLXA 2GOUA 2AQVA 3DHFA 3H2OA 3R25A 4QDMA 1C8YA 3GVQA 3LRMA 1VJZA 2D3NA 2VWTA 1SSDA 4YWIA 1S3TC 3UR5A 1LOLA 3RCNA 3AJ7A 1Y5XA 1ZUAX 1A5AA 3TXVA 4LUYA 3JRKA 1B57A 2QNEA 2HXTA 5K9XA 4ZQPA 1KCLA 3TWBA 2BGQA 4OQVA 5FF7A 3UWUA 4MVAA 2D22A 2OWXA 2QQ6A 3W2MA 2PTXA 2UBPC 1A0EA 2FMNA 5D8WA 3TVAA 3IIVA 2R14A 3WQFA 1R9ZA 2YCEA 4LNYA 3K1GA 1F4HA 2GWGA 3VUPA 3KEHA 3GU2A 1OC7A 1CTNA 5DY3A 3V0SA 2FZDA 2BY1A 4K68A 3ELFA 4G1NA 5E6YA 1WB0A 3WZ0E 5T26A 3HGOA 4GOAA 4CD4A 4NJKA 1W3TA 1YHTA 2FHBA 3TTQA 1I9CB 4KRZA 3LBMA 5LNSA 3C2FA 4A8NA 3FVMA 4HZMA 3LX9A 3I4EA 4PA8A 3NYDA 1ZBCA 4LAOA 1IZCA 4QLKA 4RXFA 3W75A 4A3QA 2AAMA 1ME7A 3F2CA 3FK4A 4MF4A 3HURA 3VIOA 3W02A 4FS9A 4QG9A 1MXGA 1GZ1A 3W84A 3A3HA 3RF9A 1V0MA 3V3WA 3ARVA 4J3SA 3UNTA 4LV9A 4I6VA 4HQVA 3FW6A 1PDYA 4D72A 5KETA 3E38A 4O1AA 4M24A 2ANUA 2ZUWA 2I5QA 3PAJA 4PEEA 1UIOA 1AZ1A 4GO8A 2BOFX 3OG2A 4UTTA 3K8LA 2OODA 1XKYA 3TYAA 3HJEA 5F2MA 3EDEA 2ACQA 2E1WA 4LS1A 3GXTA 3SW6A 4A6GA 3QFWA 3LU2A 1HT6A 3D47A 4LY8A 1J0HA 4H9ZA 4O13A 3B9OA 4WDXA 1F3TA 2Y0FA 1NOUA 3BAJA 3W1TA 1TVLA 1W8GA 4L6HA 2Z28A 1HXJA 1LWJA 1XI3A 2C1HA 3W1LA 1UASA 4AEFA 4A3UA 3TMLA 2C6QA 2W3ZA 4O18A 4XO7A 1E4IA 3RLHA 5TIMA 3JS3A 5GNZA 5J5RA 1W1ZA 3LSBA 3KLKA 4MKNA 4UZSA 2X2YA 2Y5JA 4MNMA 4TVCA 4ATDA 4Q8QA 2CLLA 5B7ZA 1X8FA 1WDRA 5MKGA 2G3FA 3CQ0A 1BHGA 1KM4A 1QU4A 1UQZA 4NJGA 2J62A 1ADSA 4JTDA 4RZ6A 1V7YA 1F4AA 1MDLA 2X8RA 1BXNA 4KBXA 2ASHA 5EBUA 2VCAA 1ONRA 1OVDA 1XBYA 5DANA 4Z1YA 1IE7C 1L6FA 4NAFA 3UPWA 2P53A 1F2JA 2TODA 3BLOA 2DVTA 3ZVHA 1E6SM 3CWOX 2QMJA 2D73A 3MSGA 3RPDA 1XPYA 4ECLA 1OCQA 2FGBA 4TVUA 1V3LA 3WLQA 1VZWA 4J3ZA 2JEQA 3S5NA 1E0VA 3KAOA 4YVPA 3QZAA 4DWSD 5D9OA 3UA3A 3N9RA 1W5PA 2FFCA 2DEPA 3EX4A 2V3DA 3ZLHA 1S5MA 1G67A 3PULA 3QHNA 2INFA 4GQQA 2H9AA 4DBUA 1EHAA 3UF9A 4KKXA 1EKOA 3SJNA 3H55A 3MVIA 3MWCA 1UR0A 3UXAA 5CH9A 2VDGA 3NQ7A 4JQ1A 1BQCA 1JDCA 1M5WA 4F9DA 4Q7BA 4JKKA 4G2DA 2OSYA 2OX4A 4KGJA 5XIMA 1BVZA 3KHJA 5A1AA 1ML1A 1UB3A 5CZKA 3VC5A 4UXDA 3PP7A 4M29A 2OO6A 2QV5A 5JBEA 2VFIA 2WNWA 3Q37A 1ZS2A 3IACA 4Y8EA 1SW0A 1QO2A 2W66A 4REQB 4XTIA 3E0FA 1VF8A 1OGGA 1SM9A 3KL0A 4EPDC 2EF9A 4PEKA 4FZIA 3RFAA 1UC4A 3R0UA 3VDAA 4TMCA 3R6IA 4Q8WA 3W2NA 1XKJA 1F3WA 1X7FA 3H2CA 3BC9A 5LHFA 4MG4A 1SFSA 5T91A 4ZO8A 3G1YA 1EYEA 5CZ0A 2ZWYA 4C6NA 2GJXB 4EPEC 1JF5A 2J7CA 2X40A 3OBAA 3VCCA 3T44A 4E2DA 3GC5A 4IXHA 4EXBA 3F03K 1W37A 3KRBA 4Z0SA 3W07A 3LERA 3RM8A 1TRIA 3PHAA 3BW3A 5CXPA 2QV4A 4D6IA 4EPKA 3W22A 1IEXA 1VS1A 2VRKA 1MZHA 4C6MA 1MO0A 2F2HA 4AF0A 2X05A 5FJOA 3F5LA 3A4WA 1KRBC 4XQ6A 3TA6A 4I7UA 4U3AA 3PG8A 3VNDA 2POZA 3RX3A 4A3HA 4E0CA 4Z2HA 1XLIA 1T5AA 1R9XA 2WMFA 2VTFA 3P14A 3MMTA 4JIIX 4TX8A 1D7FA 3EOLA 4GIAA 4WZHA 3UY8A 1IF2A 1A49A 2ZXDA 4QG6A 3RHGA 3STPA 2QEZA 2DZUA 4H2HA 2CLEA 3VD3A 5D02A 1V3KA 2I1OA 4PCFA 3VKDA 1AZ2A 1RH9A 3NR0A 3Q4DA 4NF7A 4DZ5A 3VD5A 3KOZA 1Q6QA 2QT3A 3H7RA 4Q8OA 2VGGA 2Z4GA 2SFPA 2WVVB 1TPUA 1LUCB 4Y2WA 4AIBA 1GVEA 2OU4A 3ARQA 5A2AA 3REQB 4Q7IA 3NZQA 3M41A 1WKYA 4TV6A 3VKBA 3L67A 3ABSA 5D8ZA 4H7ZA 3MHUA 4GBUA 4FMVA 1ZQ5A 1LJYA 3I10A 3E96A 3CZGA 4WKHA 4DNHA 3PK7A 4LUSA 1MUWA 2J6XA 5DMMA 3W4RA 3WDQA 3S2LA 2VQTA 3ZJ8A 2CLOA 1ZY9A 4ZZ9A 3LGEA 3HV9A 2PWFA 3GDKA 2XH7A 1IZJA 1YQ2A 4CQBA 1E71M 3TN5A 1HKKA 3CT2A 2J9YA 1M7XA 4S1FA 3DYMA 4HTYA 1V3HA 3NFUA 5JMUA 4W89A 1OGBA 4MLJA 3S6OA 1IEIA 4HN4A 1VHCA 1Q65A 3LV6A 1XIFA 2R1KA 1TZZA 3KE0A 1DJYA 1YLVA 2AGTA 1F6KA 2V82A 1Q5MA 1FWDC 3NQDA 4PFMA 2FB3A 2ZUTA 1KLZA 3AHZA 1G5AA 1OWQA 4GC3A 4KMQA 2QF7A 4IIEA 2J4GA 4G56A 3R0DA 1UZHA 1TSIA 3UZXA 1KA9F 3TFXA 5EMJA 1NF0A 4UOJA 3JU2A 3M0XA 1TV7A 3WF2A 2QGYA 3LHVA 1UMYA 1WXZA 4K37A 1VBHA 4B5VA 3IGSA 3KL3A 4RE2A 5IHSA 1GPWA 3LY0A 4B5WA 3O6YX 1UPPA 5LA0A 3ES8A 3HMJG 2NW0A 1RY8A 4FHAA 3W7DA 3TC3A 2C0HA 4CVUA 3PBWA 2XFFA 2QAPA 1ZJHA 1Z32X 4Y9AA 3LEPA 2O56A 1JCXA 1BQGA 3BCDA 3PR2A 2E3ZA 2QDHA 4RL3A 4QROA 1WAUA 5K9CA 1EGVA 4JIQA 5I09A 2G3MA 1SZGA 3G1FA 4X0VA 3R12A 2ZA2A 1IGSA 5E0KA 1KW1A 4BHYA 4XZ9A 3JVAA 1B3WA 4LB4A 4PMYA 1LL7A 3WMLA 3G1AA 1TWSA 3VNLA 5I06A 1LBLA 1PIIA 2YA2A 3CZLA 3SCUA 7PTDA 1XLLA 2PF0A 1JJKA 1PWMA 1H1YA 1PCWA 1QOPA 4X9SA 3LM3A 1WQ5A 2J47A 2ALDA 2Y85A 1XYZA 1EA0A 4NL1A 3UCQA 4WR3A 3AIBA 4GUIA 4UTIA 3IIXA 5HQLA 4XX6A 2XIBA 3TCEA 1JRCA 2Y2WA 5A8QA 1U5JA 2Q3OA 3OLIA 3SAZA 3CUGA 4DAIA 3IK4A 5H91A 3ABOA 4RCXA 1NWUA 4ZE4A 1NAL1 5FJUA 4ZQOA 1IR1A 4H8VA 5F2GA 1FBAA 3AXIA 5CBIA 3VZXA 4DPQA 5HBFA 3MKCA 2VEGA 3LPOA 1OC5A 1VR6A 3BW4A 4IX2A 1E9ZB 5ECVA 4ACYA 3KVLA 4IXXA 2WOQA 4P7LA 4GO9A 4RV8A 1SW3A 3WH5A 4OBSA 4E3VA 4FXFA 4BQ3A 4S3FA 4I8DA 4JTJA 1A50A 1UP0A 4TU1A 1ISVA 4UFMA 2E8YA 2OLHA 4JS3A 1TV2A 3OHIA 5C7VA 1NDYA 2O4QA 2V38A 4CU6A 1GOMA 3PG9A 3SCNA 2V8ZA 2QHAA 2E6AA 4HMNA 2NLYA 1O1HA 4UTJA 4WQ6A 3PZVA 2H8ZA 4HGXA 3SZ8A 3ZT5A 4RJEA 8TIMA 1ZP4A 4I90A 2XM2A 4ZO9A 2Q8XA 2WJDA 1R87A 4WRHA 4EIVA 1KM3A 1E70M 1A5OC 2E6DA 4M6VA 3VO0A 1W9PA 3WQ4A 3QXBA 1VBJA 5G2WA 4UOZA 1TKKA 2FPTA 1R5YA 1S2AA 3E5BA 3E2SA 1A47A 4Q4PA 3CWHA 4L61A 4NJJA 4PR4A 3VOJA 1GCYA 4HHHA 1VLIA 3W7EA 3WLSA 3N29A 4PUDA 3GDBA 3ZT7A 4AMCA 1WBHA 3RUBL 5GPRA 3F2DA 3LNPA 5BW6A 2PDFA 5CPSA 1XLAA 1G7VA 4XAFA 3JZUA 1TMLA 4IFKB 2PDYA 1GQJA 4AZ7A 1P0EA 2R91A 2TRSA 3KVMA 3V5CA 2FZ8A 1LRNA 4PMUA 2XUCA 3IUDA 3QGKC 2ZA3A 3W1PA 4M1BA 1VKFA 2XZ9A 2PWHA 3CT7A 5AC6A 1UZDA 3GNXA 4HN8A 4Y7EA 5F1UA 1UUOA 3HGRA 2P10A 2PURA 3MMWA 2PDBA 3CL6A 2NQ9A 1GKRA 4B5SA 5I5RA 3WH7A 2I16A 2YCJA 2GGHA 4M6UA 4Z08A 1XLDA 4WXZA 3MP5A 1TJPA 4NZCA 1Q63A 4IX0A 4MZ8A 4WOQA 2JKPA 3UGVA 2QJMA 2GJPA 4XVEA 3T78A 1R2TA 2XVGA 4UQDA 1J5TA 5A2CA 2EO7A 4PCPA 3N2CA 4K3ZA 4ZBCA 1CT5A 3QV6A 2OQHA 1MFVA 4PE8A 3B0XA 4PTXA 3OBKA 1U5VA 3B40A 4WX2A 4YTSA 3AS1A 3L4YA 2V9DA 1CWYA 5C2CA 1HJSA 4RZ5A 3V1HA 4MKVA 3S2JA 2FH8A 1AFSA 1SVDA 1L9WA 2W4XA 3CLMA 3O15A 4L80A 2Z1SA 5FOOA 3NO5A 2YFNA 5K4XA 2A3AA 1A3HA 2DV0A 3WK2A 1K1DA 4Q6JA 2TYSA 5BRQA 4MB3A 5M5DA 1S39A 2XSBA 4Q4OA 4UTHA 5CJMA 3WLTA 3C3NA 4CUCA 3B0YA 3UEQA 2GJRA 2QPSA 4G7EB 4MB4A 3F4NA 3GTHA 4GZJA 4AB4A 3VDBA 4D6DA 4ADUA 2PDKA 2G3IA 2JF6A 1ZCCA 3T2QA 2XDFA 4Z2LA 1IXQA 1M04A 3W37A 5CPLA 3KBSA 4O28A 5JXQA 3GTFA 2B7OA 4FF7A 3UD6A 2F6KA 4AD5A 4M19A 1HZYA 2JKAA 2QW5A 3OBEA 1R3QA 4O1BA 1TV4A 2VURA 3VX1A 1W9UA 4M51A 1W3HA 3UW6A 4DUWA 4XVDA 3R89A 4PYSA 3I6TA 4LX4A 3FXGA 4G7FA 1W0MA 4HSNA 4C65A 4F2UA 2Y5EA 2ZWZA 3PSWA 3TFCA 1F07A 4O10A 4WKFA 4W7WA 2VX4A 1KRCC 2OQLA 4YMZA 2GUYA 4NIRA 2OCZA 2HE8A 2CW6A 3KZPA 4UR7A 1XGZA 5G4EA 1MRQA 4UWMA 4NT0A 5HJXA 3ZJ7A 1UR8A 2I5GA 4L4LA 5FA5A 3SSZA 2E6FA 3RLUA 4KWOA 3S9ZA 3LQLA 3M43A 3EPOA 3D5HA 4P7NA 3M44A 2VHLA 1RUSA 2ZRYA 1HO1A 2GJXA 5ABGA 2ABBA 3UT0A 5H1WA 1I60A 1Z8AA 1JPDX 4DWSC 2ATSA 2GPTA 3OQ8A 5BXTA 1QW8A 3OW1A 7REQB 5BRPA 3OZMA 4Y9PA 3G24A 3RAOA 5D9PA 4CQDA 4Q6XA 3O0KA 2CBIA 1OFAA 3MU7A 2POTA 3VGFA 4IQJA 1H62A 2OKOA 4GY1A 3FAXA 3CHVA 3CYVA 3NUKA 3TCSA 2Y5SA 1EXPA 5AVHA 5HK4A 4I5RA 4X3ZA 1BG4A 4ZA0A 3C56A 5H2ZA 3G0UA 4UR8A 1EC7A 1UD8A 2V5BA 2FZBA 4BCEA 5DMYA 5C70A 1JD9A 4TMBA 1NARA 4Q4SA 2J8GA 3ALFA 1PPIA 5CGQA 1FKWA 1DV7A 1W56A 2BLEA 4IGNA 4JAWA 5JIWA 1ZAIA 3LTSA 2ATMA 1P43A 4CNOA 4YTRA 1EJ7L 3W7MA 1KFKA 3WF0A 4MWAB 3L4VA 4B90A 3GW3A 3DG7A 3ZMRA 3EDDA 3KS6A 3W1NA 3E2QA 1YPFA 4ZL1A 3OGSA 4WXYA 4F0LA 5F7UA 1XXXA 4QJ1A 2D0GA 2FB2A 2G8ZA 2DSZA 4LGXA 3T55A 1NFPA 4YJ5A 4QXIA 1K7EA 3PB0A 3IWPA 3L12A 1TQXA 1EZ2A 1RR2A 3IUHA 4H7VA 2RDTA 3AYRA 4EX4A 1W9XA 1GG0A 4HK6A 4ZQMA 5FL1A 1C8VA 3CH0A 5FEXA 2GLKA 4C6EA 2Y7EA 1JYVA 4ZOCA 3ISIX 4ALDA 1AMYA 3UWYA 1HVQA 1XDJA 3UR2A 4GLEA 1RBOB 3EB4A 2WMKA 3O1NA 1A5KC 1R3WA 3R8RA 2CLMA 1HP4A 5FI8A 4QJ4B 3DGRA 5B7YA 1ODZA 1V0KA 4CNUA 4L4MA 2VEKA 3LCFA 1UWTA 1ZGDA 2PF8A 4IICA 1F9CA 3QF0A 2ACSA 3WCZA 3BLLA 1DJIA 4ASTA 2CEQA 3BPWA 4N02A 3E0LA 2G96A 3PBMA 4HOXA 1XSIA 5K7JA 1KNWA 4Z1CA 2PMQA 3P3BA 5AOUA 3LA4A 2OZTA 1XICA 1YPXA 1A5UA 4GUFA 2VOTA 2E5DA 5AC4A 2ZADA 5EA9A 1U2YA 3MUIA 5A8NA 4ZB0A 4AHOA 1KV8A 3ZWTA 4FR6A 4C1LA 5IFTA 1A4MA 4JDBA 2QULA 4BS0A 3FHAA 5JQ9A 3N2TA 1GJUA 3LS9A 3MI6A 3NPWA 2QCMA 3GHUA 3NXFA 3WJWA 1AW1A 4MFEA 4ORMA 1B2YA 2YLAA 4W8LA 5D2WA 1OADA 2F38A 1KM2A 4GQGA 4O57A 1CBGA 2JGYA 2PTDA 3GHTA 2PDQA 1CDGA 4FPSA 2IPJA 2OFJA 2ZE3A 2Z7KA 3K4WA 2WHLA 4C6BA 3MUXA 2YYUA 3EWWA 4LVDA 1BSIA 4HMDA 4L9YA 1G4TA 3C0SA 4Z0JA 3E5PA 1KR1A 5FESA 3GH4A 5I07A 5FD0A 4PUNA 3UQNA 1F76A 5BXSA 2HNHA 3VNMA 4PB5A 1FXQA 3ZR6A 4LSBA 2WCGA 2F6UA 3QHOA 1UWRA 1C90A 3IPWA 4AMAA 3DI0A 4WSHA 3B9EA 5M1TA 2J79A 4U4MA 3RPTA 3DDMA 3TOYA 1Z7AA 5CGMA 1UWAA 3H2EA 3S1GA 5FIPA 3Q94A 1DEDA 1RK5A 3VNJA 4UBPC 1I45A 3O6DA 4Q8TA 1ONWA 5BOEA 3NQ2A 5REQB 4JIPA 3GFXA 2DIEA 3TSMA 4QRNA 5FJJA 4D8AA 1GJPA 4POCA 4HVXA 3O7UA 1Q13A 1JYNA 1H1NA 4HOZA 1ZNNA 4BI7A 4UMAA 4HA4A 1EQCA 3P82A 1LBFA 1VFSA 2C79A 3D6NA 4JTIA 3WQPA 1VYSX 3CH9A 5KZ6A 1EEPA 3NM3A 1POKA 2CNCA 4MDOA 3VDCA 2DSUA 3DU0A 3L2LA 4P7QA 1XH0A 3FEMA 2XIMA 1KD0A 1TPEA 2OEKA 2R6OA 2A1YA 2CC0A 2RHGA 4JEJA 3N2XA 1JULA 1UWIA 5HULA 4DX3A 2PD9A 2QUTA 2UY2A 3BAWA 2BASA 1M3UA 4F66A 2OVLA