4K1GA

Structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
283
structure length
283
Chain Sequence
b'MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPADSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 4
molecule tags Hydrolase/dna
source organism Escherichia coli
publication title Insight into mechanisms of 3'-5' exonuclease activity and removal of bulky 8,5'-cyclopurine adducts by apurinic/apyrimidinic endonucleases.
pubmed doi rcsb
total genus 102
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4k1gA00
3M0VA 1I60A 3VNKA 4HHMA 1A0DA 1XICA 1XLMA 4Q7IA 5B7ZA 4W4QA 3CNYA 5XIAA 7XIMA 3BWWA 4YTTA 4XISA 1XYAA 1QTWA 1XLGA 2J6VA 1XIDA 1XISA 3KBJA 5EMLA 4XIMA 3KBMA 3U3HA 4QE1A 9XIAA 2ZVRA 3C0SA 3ITYA 3KBVA 3KTCA 3QYSA 3M0LA 1XP3A 1XYBA 3GNXA 4QDWA 3M0XA 1OADA 4J4KA 4DUOA 2X7WA 4YTSA 4DVOA 5AVHA 3BANA 5EMMA 1TZ9A 5B7YA 3KCOA 1XYMA 4YTUA 4K1GA 2GUBA 3ITLA 4US6A 4X61A 4ZB5A 2GVEA 4YTQA 2NQ9A 4GJJA 3LMZA 1S5MA 2I56A 3OBEA 3XIMA 2XIMA 1XYCA 1QT1A 3IUIA 1XLFA 3JU2A 2G4JA 1K77A 1XLLA 3C0QA 3KWSA 3M0HA 3VNLA 5B80A 3CQKA 1XLIA 3UXIA 4GJIA 4E3VA 2G0WA 2QUNA 4QE4A 3KBSA 1A0CA 1I6NA 3M0YA 3UVAA 3FVMA 1BXCA 2GLKA 5AVNA 4K3ZA 2OU4A 3KBNA 3TC3A 3VNIA 1DE5A 4HGXA 4ZB0A 4A8IA 2NQJA 1DXIA 3DX5A 2XINA 2ZDSA 4LNCA 3AYTA 1DIEA 1DIDA 1YX1A 3BZJA 4XKMA 3ITVA 3QXBA 4XIAA 3M0MA 3WQOA 1XIBA 4A8LA 4KW2A 1QUMA 5XIMA 1D8WA 3NGFA 1CLKA 4PGLA 5FA5A 5EMJA 1DE6A 3AAMA 4XSMA 2XISA 3VYLA 6XIMA 3VNJA 4QEEA 1A0EA 1XLBA 1XLHA 4GLEA 2QW5A 4XSLA 1XINA 3CWHA 4PFHA 3XINA 2I57A 3TVAA 3CQIA 3QZAA 1MUWA 3UA3A 4EAYA 1XLKA 4QDPA 3VNMA 1XIHA 3XISA 4HNOA 4ZBCA 1XIJA 3KBWA 3KCLA 4EACA 2HK1A 1XIGA 8XIMA 8XIAA 1XLAA 1XIEA 3DBNA 2X7VA 3AYVA 4OVXA 4X63A 4G56A 3ITTA 5EMKA 2NQHA 3AALA 3N4AA 4GQBA 4HHLA 1XIIA 5XINA 3U0HA 2HCVA 5TNVA 5I7GA 3CQJA 4X60A 1GW9A 1XIFA 3L23A 2QUMA 3P14A 4A8NA 9XIMA 1XLCA 4ZB2A 4YTRA 1MNZA 1XLDA 1XIMA 3P6LA 2QULA 6XIAA 1XLEA 3IUDA 3UU0A 5H1WA 1XYLA 1O1HA 1S5NA 3QC0A 4A8RA 1BXBA 4QEHA 3IUHA 3UA4A 4QE5A 5C9ZA 3BDKA 3C0LA 2GYIA 5H6HA 2Q02A 5J8LA 3ITOA 3KCJA 3CQHA 1XLJA 3BZGA 3ITXA 2HK0A
chains in the Genus database with same CATH superfamily
2GVLA 3CMFA 4ZOAA 3RRAA 3AROA 2EPOA 1AMYA 4I9AA 4H9VA 1MI3A 3BWWA 3EA3A 5CEWA 3VDAA 3L7RA 4XAYA 5GQBA 3VZXA 4MHBA 1OCNA 2OEJA 5DT5A 2F8QA 3BXWA 3MZNA 3EWZA 2PP1A 3N2CA 3M44A 1POKA 3G2GA 1ODZA 2ACSA 1UKSA 1JI2A 3EYPA 5E5CA 3WL1A 4E38A 1K8CA 4JFTA 4NU7A 1DJIA 2Y5JA 1BWKA 5CC3A 1BEUA 2Z2BA 4M19A 1XL9A 1O5XA 4A8LA 4KESA 3WQEA 3OZPA 4Y96A 3GXNA 3G3DA 5ABTA 3KVJA 4LCRA 2GSJA 3S0CA 1A0EA 2VZVA 3C2OA 1CECA 3INPA 1LF1A 3OZOA 1FUYA 2OR2A 3GDBA 3RR1A 3GNNA 2BY3A 3WBWA 1RVGA 3KCLA 4Y7EA 3VGGA 4LVBA 5CQ1A 3GBDA 4QS5A 3CQJA 4JTFA 4JYFA 2HEJA 1LWIA 4NXSA 2DUXA 3R12A 3FEQA 5F7UA 1HIZA 3OIHA 3I4KA 4W5UA 3S5NA 5HJLA 2P0IA 2GJNA 1I1XA 3IANA 1C8XA 4DJDC 1P1XA 2ZRZA 2A3LA 3M5XA 1UR8A 4HHMA 1P4CA 3W81A 3QPYA 3CM4A 1FDZA 3W07A 3W1LA 3AZSA 3UWZA 4PCNA 2CXGA 2NT0A 1LRTA 3L4YA 4LBSA 1JCTA 3XIMA 2ZZ5A 2OO0A 3UD6A 2DZBA 2G4JA 3KWSA 2JALA 1XCFA 3PSVA 3M43A 3QV6A 3TKFA 2Q71A 2KX9A 3W1RA 2L5HA 4XKMA 4J3UA 1QAPA 2EG8A 3WD2A 2X30A 5HJXA 1H51A 3WQCA 1SR9A 4AVFA 3SQLA 1PWLA 4XO7A 4LFYA 5A6SA 4QIUA 1G94A 3TYEA 2Q8XA 5AY7A 1I2PA 2HK1A 3CH0A 3LQLA 1DJHA 4PTVA 2VR4A 3L23A 3P14A 4KEVA 3W73A 4GUFA 4AB4A 1XLDA 4B3LA 4TMCA 4JL1A 4LPCA 1Z89A 3EWBX 3QOMA 1TMHA 3WCZA 4DF2A 2WCSA 2PFHA 2SFPA 3PJWA 3F2BA 4HA3A 2EHHA 3S5OA 3WFZA 4H2HA 4AY1A 4BEUA 4KERA 3W7EA 2ZQ0A 1DP0A 3H4WA 3CNYA 4LGXA 1QTWA 2A3AA 4PRWA 4HP5A 2V2DA 3HN3A 1N8FA 3AHXA 3JS3A 5EPDA 2ZRXA 2E5CA 1UD2A 4AEFA 4PUDA 4IIGA 2DPEA 1BVWA 4AX7A 3LMZA 2C15A 5BROA 3PWAA 1ZNNA 3U7VA 2J79A 2REQA 3WUBA 3CHEA 4PE8A 3RILA 3NOYA 3VX1A 3ZLFA 3CC1A 3GHTA 4FR6A 3BJFA 4KH2A 1NJJA 5FJJA 3CAWA 4OE7A 4I90A 3GHRA 3PPFA 4NQ1A 3VYLA 3H2EA 3S9IA 4IJCA 2PDKA 4NJKA 4QEEA 3B8VA 3RXZA 5AECA 4XSLA 3NURA 3Q2DA 1MYRA 3TR2A 3B0VC 3P80A 4LAMA 4FIRA 4NKCA 1D3HA 4A21A 3G8EA 2WNZA 4L6DA 3S1XA 1QFEA 1Q6GA 3CLMA 5XINA 4V2XA 3NR0A 5CZKA 2DZXA 4MJ2A 2C14A 2PPGA 3SURA 5AHNA 2QJNA 3LN3A 5I24A 3P62A 4H9UA 4L65A 5I3FA 1B4EA 3W28A 4LEFA 1BXBA 5LXXA 2Z1BA 1IT7A 3T09A 4PB3A 1XLJA 1WDRA 4MYXA 4DWSD 4BK9A 3WZ0E 1LG1A 1FA2A 2FGBA 4IQLA 2QDEA 1PZ2A 1F8IA 3O63A 2QPXA 1E4NA 3NOEA 4W7WA 1EC9A 3NL2A 1I75A 4F3HA 2Z2AA 3PF3A 5E6YA 3D3FA 4RE2A 5DXXA 4H04A 5BRPA 4X2PA 2J8GA 3N12A 3P3BA 4B5XA 3HTWA 1OFPA 2DUAA 4K3ZA 4IMDA 3DHPA 1EDGA 4PCTA 3NG3A 2Z7KA 4LYKA 3SY5A 1YX1A 4KMQA 3ZT7A 1FP8A 5KINA 4RDVA 2ZZ3A 1AVAA 5T26A 2CWNA 2CW6A 2QMKA 3QSRA 1E9ZB 3WF1A 1U5VA 1QJWA 1GG1A 3CS2A 3MDUA 4BR1A 4J3VA 1JFXA 4JICA 3SUUA 2NUXA 1H7WA 5CPTA 2QT3A 3GR7A 4LVDA 2FDSA 5JVLA 4AX6A 2OQYA 3MKKA 4AAJA 4AZ6A 2DJLA 1M9HA 1CLXA 2Q8ZA 2DDXA 4JQ2A 3LB0A 3TYBA 4UTJA 1AW1A 4YCOA 3CBWA 3JRKA 4AHPA 1C91A 1B3YA 3T0BA 4NUWA 5GJPA 1X39A 3GDLA 3U4AA 2Y7DA 1BVZA 4QXIA 4JFUA 3P60A 4PMXA 1V02A 3ZSSA 5HWJA 5EBUA 1EYWA 1CGVA 2CBUA 3NWRA 1W9VA 2D2GA 3L12A 4O18A 4AY8A 5E9XA 3SCVA 1XYCA 4RW3A 3TOYA 2D24A 1K77A 1MXDA 4CCEA 1HJWA 1M7XA 4BEQA 3VNIA 4GYFA 5DCBA 3MJMA 3SFKA 4LVAA 4IIHA 4LNCA 3ITVA 2WKLA 4DELA 4JHOA 4JN6A 4OUIA 2W67A 3IIOA 3AAMA 5CLTA 4PL1A 4HHPA 3RR4A 4LAZA 3QLDA 3EMQA 1ECQA 1J5SA 3O9NA 3WQ8A 4CNUA 2EJAA 3NPWA 4XD3A 4DJFC 4ASTA 2ONEA 3CAVA 2HE8A 3OODA 5LNUA 4IQDA 2VFDA 3OG3A 1HZYA 3SUWA 4V15A 3PZOA 1K9FA 1RQBA 3BAJA 3PULA 1VYPX 4F0MA 1UBSA 1ME8A 1WCGA 2WPGA 3G1XA 4HA4A 4A8RA 3WJYA 3AU2A 1W1VA 4AZGA 3VIPA 4PODA 4EPBC 2I5IA 5LHFA 1UW9A 3GH4A 1Y5VA 3W7HA 1WXJA 3EOSA 3ZWTA 4JN8A 3WEOA 2JEQA 4HMEA 3RPDA 3TWBA 3MVIA 1HKKA 3ZJKA 3CUHA 1DOSA 4K38A 2KZHA 4UTWA 3M5VA 3TFXA 4JKLA 2VGIA 3WMBA 4UFJA 1IXNA 1UH4A 3UR5A 3P7YA 3D6NA 4LAUA 3SY1A 3L4WA 5LIUX 2VR2A 2DSZA 5ABFA 3G18A 3W1PA 2CXEA 4MUZA 1TUFA 3USBA 2NW0A 4A3YA 1R3WA 1Q6RA 3II1A 1LQAA 1TV4A 2WKJA 4IUOA 1VLIA 1V7YA 4HNUA 1JL8A 3B3DA 1C29A 1JPDX 2CLHA 4UBPC 1WP6A 4K8EA 5HMEA 3PVFA 5HK4A 1VPQA 3QPEA 4AIEA 4HJWA 1NFBA 1ITCA 4F2BA 3P61A 1E40A 1XSIA 4ILSA 1W5PA 2NQHA 1JAKA 4N7QA 2J77A 2QAFA 3LYEA 3FDGA 1XX1A 1EQPA 4AHQA 5G1YA 1LG2A 2W3ZA 4ZXLA 3TA9A 3PP7A 1YMYA 4XTDA 3MUZ1 3ARUA 4EOUA 3V5CA 5PTDA 2V8ZA 3PG9A 4WKHA 4JFSA 2R8WA 2BGSA 2Y5EA 2PDPA 4HK6A 1MFUA 2PUZA 3AICA 1O5KA 1RJPA 4AD4A 1XBXA 3FKRA 1ECEA 4D1IA 4XVEA 2XYLA 1G69A 3ICJA 3M46A 3BK0A 3MUCA 3TLQA 2E77A 1KTNA 2VT0A 2RDXA 1N55A 1TWIA 1V03A 4H9ZA 3L0GA 4GIRA 3I7RA 2VFGA 3M16A 1WOBA 2YDAA 3DHUA 1QPRA 4Z2IA 1EJSC 3MKCA 3U8GA 4LCQA 1RPKA 2ZX7A 3R1ZA 5EYWA 3G1VA 1BLIA 4Y90A 1SFSA 4PC8A 1OGSA 4UFHA 2YL6A 2W4XA 1IR1A 3UG8A 2J66A 5KZDA 3BLLA 3PFRA 4OVXA 3NTYA 1E70M 1FCBA 3ZLGA 1K4GA 1X6LA 4DJFD 2VWSA 3KTXA 3AXKA 5A6LA 2QEZA 1E5JA 4NP7A 1E6QM 1VPYA 3LHZA 3WQDA 1S2CA 2NXGA 5BCAA 3RRXA 3IWPA 1K8YA 3EXSA 3I6TA 1NEYA 1TIMA 5AYIA 5ABGA 2P10A 3FEMA 1JD7A 2E9LA 4GZEA 4AIOA 4OOZA 4CLMA 3LCXA 2QJMA 4EX4A 3IJIA 2E3ZA 4QGCA 5E0FA 2WSRA 4Z0SA 4EPEC 4UCGA 1J8VA 3G1YA 1B3ZA 1GVIA 2ZUMA 4XZLX 1OADA 4C6DA 3BLPX 4OU1A 5E9AA 1K7FA 4CCZA 3VDCA 2P8BA 2HMCA 7PTDA 4Z1CA 3VMPA 5C55A 3WDIA 4Q4OA 1RCOB 1JCLA 5AYXA 3G0XA 4DM2A 2OX1A 4DY1A 1AH0A 1XRTA 1DIEA 1DIKA 2XH7A 1O4UA 1X1NA 2ZWYA 3LHWA 1N8IA 1QPQA 4O12A 1VRXA 3MC5A 1SJDA 1XS2A 4DPQA 1J0KA 1EWEA 3W7KA 2QCFA 2ISDA 2ISVA 1EA9C 2ZVIA 3CZ8A 1J9YA 3O0KA 5M3WA 1SZEA 1US3A 2PTZA 4DN1A 2WO5A 1SQ7A 3VMNA 4EACA 4IQJA 3KVKA 3ITTA 1BGGA 1EHAA 1F4AA 1Z44A 3BICA 3E49A 2WBGA 3EB3A 4PRTA 4TO8A 1HP4A 3QN3A 2ZZ1A 4PUJA 2B0MA 3CZGA 4XQ6A 1B0IA 2X1UA 3CPGA 1HJVA 3E0VA 2AMXA 3A64A 5BWAA 2WWCA 1V3KA 1TE6A 1OCJA 4ECLA 5I3GA 1X7IA 1JFHA 3RO8A 3WQVA 5A6BA 1MNSA 4EK7A 1DJWA 3G1RA 1GOKA 5M17A 3MV01 3MB9A 2WHKA 3WIJA 5AHMA 1UKPA 3M0XA 4NZ4A 1H41A 1Y0EA 4GUJA 4F48A 3MUXA 3NZPA 4RK8A 5C9RA 4N6EA 5L9FA 3O2LA 4AD2A 4JAWA 4LU0A 4LSBA 5A1AA 3HGSA 2ZX9A 3GQYA 3SN1A 1ZUAX 4QLLA 4CCDA 3LI0A 4G7FA 1DIDA 3FDKA 2NV1A 2HBVA 1UH2A 3W7NA 2WMHA 3VD9A 3BVJA 1OEPA 3CL6A 4HN8A 4E2OA 2XSAA 3LDVA 4DBWA 4D6HA 4K37A 2H8ZA 3HQOA 5DMNA 3CWHA 4DWSA 4NJIA 3UGVA 3WLRA 4M80A 2R1LA 1JPIA 4EPKA 1SO4A 2OSXA 5JIWA 2D23A 3ZMRA 4C7FA 1U1UA 2DGAA 1B54A 4OBSA 1ZZMA 3ZR4A 1PPIA 1FWSA 1TPVA 3EB2A 2GOKA 3PC0A 4MF4A 3UJEA 1ZL1A 3MI6A 1JNEA 2WMKA 1CXEA 1UG6A 1TR9A 1PKLA 4HU4A 3FJ4A 3LLXA 1WZMA 2FQIA 5DFAA 3S46A 3DFPA 1S2TA 4A4AA 4TU1A 4B3KA 5IDZA 2W6RA 1FWFC 4YWSA 1KCZA 4G1KA 4PMJA 1ODUA 4O53A 3VNKA 3BMVA 1CENA 1A0DA 3SRHA 2AL2B 3K46A 3GTIA 5BW6A 4EF8A 2OB3A 2UBPC 3DYMA 3TMQA 1AK5A 4GRSA 1UCWA 1TQJA 1XC6A 1A5MC 3TDFA 4B90A 4MWAE 3S6TA 1WUFA 2ZX6A 2OQHA 2EXOA 2KAUC 4Y8EA 3H7UA 4B5TA 4IMGA 4PUKA 1W9BM 3LQGA 4MJMA 4O1AA 1ISXA 3DBPA 5LIXX 1HO4A 1H7XA 2XIBA 1TJ0A 2HVNA 5KMYA 1XJBA 2AGKA 5DMYA 1MVYA 1BTCA 1CGUA 3TV8A 1YTDA 3OGSA 4RDZA 1Q6EA 3EDFA 4PZVA 2BSLA 4B15A 2WYSA 1MZRA 3KHJA 1GJPA 1K8ZA 4AEEA 4OUEA 4XZIA 1VCGA 1KTBA 3SBFA 3ENLA 4GC4A 2NX9A 2WC4A 3ARSA 4TTUA 2DEPA 3SSJA 3QMTA 1ITQA 3QVQA 2B7PA 1ZU8A 3VD3A 1J0YA 1W6TA 3GHUA 1WDDA 1F5ZA 2BV9A 4Z08A 2EPLX 2J24A 4NSBA 4Z0JA 5TQLA 1KO0A 1FHDA 3S2NA 5FF7A 4MVAA 3I3BA 4ZO6A 4U3CA 2E0PA 3OHIA 1V77A 3G0UA 1B1YA 3PANA 4PB4A 1KM4A 4D8ZA 3VD5A 4W4QA 3GTFA 1PKMA 3QBUA 4K8HA 4H01A 3VABA 3R11A 2DIEA 2E5DA 3SFWA 1UYQA 3C2EA 4ZEPA 4Z2GA 1XYMA 3WLQA 3FHAA 3ITLA 3T55A 3KOYA 5CJ5A 3H2FA 3SJNA 3W1UA 4C6NA 2O9OA 2QHAA 3GY1A 1PWMA 4U3AA 1FWAC 2NVAA 5FL0A 3POHA 1IR2A 3UF9A 4OV4A 4GY1A 2BVDA 5AC8A 4GI8A 3BJTA 4Q8PA 3IGHX 4HCDA 1W1B1 1SO6A 1NELA 3NQ7A 1SPQA 3WYZA 2YJQA 1JRCA 4KCVA 3UZWA 1AW2A 2A7PA 3PTQA 2V5JA 2WMIB 2G3JA 4LX4A 3BMXA 4PTNA 3Q67A 3R94A 1CXHA 4JPGA 1DPMA 4MNKA 5FJTA 3TLLA 1A4MA 1VH7A 2VENA 4MIMA 3GVGA 1XFCA 3V0SA 1YXCA 2W66A 4LY4A 5HXMA 3T2OA 2YX0A 2HCVA 4ATWA 2VGGA 2WHMA 1OZQA 2NV9A 9XIMA 1US2A 1M65A 1GYMA 5I06A 4O4VA 5A3HA 1KFKA 3VNYA 3U2EA 1WKYA 2A6LA 1EJVC 3BDKA 3L5AA 2C16A 1UB3A 4XTIA 1TMQA 1K1DA 1WQ5A 2Q6ZA 3UETA 4KS0A 3P81A 2E40A 3THQA 3CEPA 2V30A 1JQXA 1QI5A 3WQWA 4W85A 4X9SA 3WD0A 4UMAA 4F9DA 1U1JA 3GBEA 3RU8X 1OFQA 3C61A 5E09A 1K6AA 1OX6A 4J3ZA 4JIPA 3AIVA 1V6UA 2C6QA 3FVMA 5AC5A 3KBNA 2JBMA 2ZADA 3DHFA 4C6MA 3HA1A 1E0VA 4PMVA 4AMCA 4KW2A 1JPHA 4UOQA 3G1HA 5D32A 2YXGA 3HIJA 1E56A 1FH7A 4IMCA 4DXVA 4IXXA 1RR2A 4GLEA 4HPXA 1LQ0A 1VJZA 2BZNA 4U28A 4M8UA 2ZXAA 3NZQA 5M1TA 4EANA 4EPDC 2E6YA 1IWAA 2W27A 4QFUA 3CUJA 2B7NA 3QV9A 3BV7A 1G9HA 2X16A 5CZJA 3OLGA 1TVNA 2PBOA 4AUBA 2QV5A 2Z1KA 4DXXA 4NNCA 3AZRA 1CYGA 3CMJA 4QR6A 3STCA 4DIAA 4CNPA 4IJBA 4WJEA 4JQAA 4GI4A 1H7NA 1O5QA 3PSWA 4MOZA 1XGZA 1GVYA 2RJGA 4JX4A 1O60A 5HMDA 2PCEA 4XUYA 1MDLA 1XISA 2C7FA 4AZCA 1AH3A 4XZNX 4ENLA 2VC5A 1YPXA 3A3WA 1J2BA 3K4DA 1XYBA 3WDQA 3ZOAA 1VYSX 5SWUA 2BOFX 1DWAM 4HTYA 4IX0A 3WJSA 4LF2A 4KFNA 4L4PA 4JTHA 5B80A 1IZJA 3VKJA 4JBRA 1W5OA 1ONEA 3R4IA 3T07A 2UV8G 2DSUA 3VIKA 4JTDA 3GNOA 1Z48A 3VNZA 4F0HA 4OOUA 5GJMA 3NQGA 2XGIA 4Q8QA 3UG4A 1UR2A 1GQKA 2OWWA 3RX2A 2GGGA 5LA0A 1GVSA 2IKHA 2QYGA 3QRHA 3B04A 4JQ3A 1OSEA 3K1DA 1I2NA 1KV8A 3O6AA 4C65A 1Q4NX 1NQ6A 1QO5A 4EKJA 5J5DA 4S3AA 1KA9F 2VX5A 3AALA 3H22A 4LB3A 5JUVA 4FP1A 2JGQA 4R5EA 1E4IA 2VTFA 5EU9A 2BVTA 3FS2A 1S1RA 2DQWA 6REQB 1PV8A 1RXOB 3OYXA 2PGRA 5DY3A 1VR6A 4M3PA 1QXLA 5F4XA 3ZVIA 1NY1A 1V3LA 1IT0A 1AD4A 2TMDA 5I3IA 4Q4KA 3JUGA 5FJRA 1NH6A 2WSQA 4AWUA 4W87A 4DZIA 4NILA 3PM6A 1BWVA 1P0EA 3GM8A 5DBTA 2QDDA 4AQLA 2V2CA 1R3QA 3ZFHA 4QDMA 1SFTA 1UH3A 3QFEA 1M68A 3VNLA 4IP4A 4UQEA 3CZLA 1R9XA 2E8YA 4AWEA 3UPMA 2XZ9A 4A8IA 3WBEA 4U2YA 1XH0A 1F3XA 1Y65A 3OIXA 3UR2A 4GYPC 3KRUA 1R3VA 1US0A 4CN4A 2I57A 3E0WA 1FVPA 1XGEA 2Z24A 3CB8A 1UD3A 4GBUA 2F6KA 2VEPA 1HJUA 1W1TA 4HNNA 2QDHA 1OIMA 5ABEA 1NWUA 3ARVA 4GQBA 4I5UA 3QYQA 4QTGA 3WUEA 1H50A 3W23A 3FKKA 4CD8A 3AHTA 5BXTA 3WLIA 1HJXA 1JEZA 1W8SA 4LH8A 1PKYA 3NCOA 2AQWA 1XD0A 2ASHA 3LHTA 5F1VA 2DW6A 4G7EA 1UUQA 3M07A 3LU2A 2D1ZA 1EJWC 4QCEA 3G8RA 4JTGA 2VFHA 2HVOA 4CVWA 2GGIA 5DRCA 4FSAA 3GNXA 4H9XA 1KBIA 3VOCA 2XFRA 4AZHA 2MANA 4MB5A 3VFLA 1TCDA 4W89A 3NDYA 4MTVA 8CGTA 2B4GA 3H24A 3DGRA 5K2ZA 1XLFA 1SU5A 3A24A 4C91A 1DYSA 3TU9A 2G0WA 1W1IE 1XWYA 3LHVA 3TC3A 3S9YA 1W9PA 3A4AA 4TR9A 1W3KA 4C1NA 1VFHA 3VC6A 1G01A 3R7MA 3ELFA 2PCQA 1NWSA 3S4TA 3S1UA 4WCJA 4FK9A 4FLSA 1A5OC 1GONA 3DERA 1UP3A 3FA3A 3BGGA 1KFEA 3HO8A 3PUDA 4YIWA 1Q3NA 3T81A 1SUXA 4Y9PA 5LZLA 2NX1A 3C8FA 5A6KA 2Z7GA 3ZLHA 4GGHA 3QW3A 2J7GA 1HL2A 1UIOA 1W5NA 2BHUA 2CU0A 1QK2A 4JKMA 1OK4A 3M0ZA 4V33A 1FWTA 2CZEA 3RLHA 5I07A 3GYCA 2YXXA 4NL1A 2G97A 4R33A 3WNNA 3S9ZA 4L4LA 2IPWA 1CZ1A 1GK8A 4HB7A 5H6HA 2FH8A 1HL8A 1VP5A 2GVGA 3GTNA 1Q8AA 3WLSA 3PN8A 2ZTJA 4GNJA 4OGZA 5D2WA 3FAXA 3O06A 5C7HA 3KBVA 3KP0A 3TE9A 4XZ9A 2VWTA 2J6XA 3M47A 4R7OA 4WR3A 2DW7A 3IGUA 3M9YA 2Y8UA 2ZXQA 5I77A 5DBUA 4V27A 4OBRA 5G4EA 5CBIA 1KM3A 5FJUA 1FP9A 2GLKA 3T0DA 1IWPA 2GJXB 5A8GA 3VFCA 3FV9A 2VFIA 3A47A 2PC4A 1NOWA 2VXNA 3NZ1A 1EPXA 3BTNA 4PL2A 3STFA 1CW2A 7TIMA 3UGRA 4IUGA 4TUFA 4IMEA 1L6GA 3DXIA 1VPXA 4NRSA 1Q13A 4MB1A 1T41A 3GIYA 4F66A 5BYWA 4PBFA 1P5BA 2JKPA 4KIEA 2PWUA 3LA4A 4UQ9A 3FOKA 1BG9A 2PDIA 4IG2A 1XH2A 2HRWA 1HKWA 4I3GA 2QJGA 2XTKA 6ALDA 2D20A 4MB4A 4A3UA 1Q6OA 2WK2A 4LAOA 1OG0A 3GXIA 1UMLA 3W71A 1GPWA 3L65A 1G4TA 3O05A 3U3HA 4AD3A 4QE1A 1TIWA 3LCIA 4QDWA 3PR2A 1LDCA 3FGCB 3OJGA 3N6QA 1R86A 5CPSA 3UW6A 4CQ9A 4KWVA 3BOLA 4IL0A 4CQDA 4OZOA 4MJ4A 3FN9A 1KC7A 1VAHA 3ZO9A 3AIRA 3GIQA 3NQVA 5HA7A 4XWUA 3WQ6A 1X7FA 1QRQA 1FFQA 1DHPA 1EF2A 4RE3A 1XUZA 5LNRA 2CNCA 4DUVA 1GNXA 1BF6A 4IISA 3N2MA 3CV6A 2PSNA 2OTDA 4HYRA 4AD0A 4ZFMA 3H26A 1REQB 3WK1A 4XZWA 3CPRA 3K8LA 1CGWA 3ABQA 3ALFA 3URNA 1ZSXA 3ZJ7A 3P0XA 2PP0A 1PO9A 4PMQA 3RPMA 4TVDA 2WNQA 3FYOA 3W9ZA 3THAA 4LOCA 3DI0A 3GHSA 3TJIA 5E93A 3DUGA 4UTLA 4N2YA 2NWSA 1MWOA 3H54A 4AMAA 3W7PA 3AU6A 1J0JA 1AZ1A 3T0AA 3W6LA 1G4PA 2CLPA 4UFMA 3LXAA 5H8MA 3MT1A 4GUGA 3TNOA 4PMOA 1MDRA 1AQHA 3NGJA 3TUUA 5TBOA 4XD6A 4IIDA 3GFXA 4S3JA 4K7YA 1P6CA 3TW6A 1ADSA 1H61A 3AJXA 3NPUA 3PJXA 3C4UA 3W7LA 5I2UA 5AN7A 2J7DA 2W63A 1I4NA 4M56A 5HNTA 3TTYA 3VAVA 1Z6KA 3RAOA 2X42A 4RL3A 3BPWA 4HGXA 4ZQPA 4YJ5A 2BWGA 3PZQA 3BG9A 3C5QA 4BS0A 3U48A 1JZ6A 4WSKA 2PGWA 1MEHA 4WQ6A 1W0MA 3QGAC 3XINA 3APGA 3KEHA 2NQ5A 5DMMA 5CXPA 4OTKA 5AB3A 3G1SA 4IP5A 1E3ZA 3J7HA 4ZSTA 3WLTA 3NQDA 3QJAA 2GJPA 4LALA 3TW7A 4ML4A 4AZ7A 4H8UA 3M0JA 2X7VA 3QFWA 1EDQA 2CBVA 1E1CA 5ABHA 1MUMA 3SCQA 5LHEA 1XIFA 1WDWA 4A3HA 5GNXA 1V51A 3GXPA 1GKQA 4AZ5A 1SSGA 3BCFA 4Q8VA 2BX7A 3MHGA 4PCSA 4WDWA 1OT1A 2D0FA 1TRDA 4GOAA 3UYCA 4KCWA 1GPFA 1ZGDA 5T8GA 1SJCA 3KBMA 2AAAA 4YVPA 4B3ZA 4IJRA 1BYDA 1BTMA 2W5FA 3B97A 4F79A 4IZGA 1YTEA 3H2AA 4M6UA 4G8TA 3EDDA 1UP2A 3C0QA 3CYVA 2F9RA 4NY2A 2DT1A 2OFJA 1K8XA 1QPKA 5IBXA 2AAMA 1EP3A 2PDYA 2WPBA 4QJ3B 3TYAA 3LEPA 3OLEA 4MWAA 1Q45A 2R9RA 2E09A 1MQQA 1S38A 4XB3A 1SO3A 3PJUA 4BI7A 3TYUA 1UIPA 5DT7A 1E5NA 4BF7A 5JH2A 1JVNA 4WXYA 3UYIA 4PUMA 1DIOA 3HOJA 5EMUA 2H9AB 1H1NA 1D3GA 3CV7A 3HPFA 5HUPA 3CIXA 3CHVA 2Y62A 3ME3A 5MKGA 5CC6A 3GKAA 4L80A 2GQ9A 4INFA 4I7WA 3RM9A 2OLAA 3H2NA 1A5CA 1DBTA 1GORA 1XLGA 5CPQA 1GKRA 2PD9A 4UMBA 2WZEA 4LUTA 4O0KA 1PB0A 4GWEA 5EFDA 3AZTA 7A3HA 4C1KA 2YL9A 1UROA 4O17A 4BQ5A 4ICNA 4X9YA 4HOZA 3R79A 3VIJA 3B0UX 4WY0B 1P7TA 1YYAA 4HHHA 5EA9A 1VF8A 2DQXA 3IVTA 3HGJA 4R9XA 4ZE5A 4E3VA 2FFIA 3N25A 3EOEA 3PTDA 3SADA 1Z32X 4WOZA 3HJEA 2IXVA 3RMJA 5E6ZA 3RLUA 1C90A 3TROA 1Q66A 1ZJBA 3G6MA 1X96A 1UQYA 1WKEA 5FF2A 3N2BA 1EX1A 2JEPA 3GWQA 3UA3A 4H9TA 4TMBA 3K8KA 1C8VA 4PUEA 3VE7A 3DU0A 1S2UA 4Q4QA 4M0XA 5H8PA 2WSPA 5D38A 2FDMA 2J7HA 4FO4A 2PWDA 3IRDA 4ACYA 5U4NA 5I3DA 2FMOA 2CZVA 5JBDA 4A35A 2Q09A 4OECA 2G95A 4GHRA 3IJQA 3WN6A 4JTEA 3C0LA 1QHPA 2O92A 2E6DA 3PZNA 1KQZA 3ZZ1A 1XBVA 4NZFA 3M0VA 4E2VA 1ELSA 2H3DA 3KZSA 3HFYA 1FY6A 1NF7A 4DO7A 5E70A 4WJXA 3I10A 1JYNA 3I6RA 3UVIA 3C2VA 2ZUTA 1F6KA 4ZVJA 1G1YA 4ROPA 2BGNE 2Y8KA 1SJBA 2BB0A 1FHVA 3ZS4A 4D2JA 4YTSA 3B06A 4DJED 2G50A 2NXIA 4X22A 3W85A 2X0HA 3RG6A 4QP0A 4MDPA 1KGXA 1AMKA 3K5XA 1IZCA 3FYPA 1Z41A 5E0KA 4DBEA 1QNOA 4GXPA 4Y8FA 2XIJA 4UFIA 2ATSA 2XVGA 2NV2A 3OBKA 2YYUA 5EMJA 4QSFA 5HULA 3C2FA 2HPMA 4BF9A 5BNKA 4PFHA 5CC5A 1TSIA 2OWCA 3REQA 3TXZA 1JPMA 4OBTA 4H8VA 4FX7A 3PPHA 2PWEA 2Z00A 4UQBA 4HTBA 1JDAA 1H63A 2GPTA 1QU4A 3VZZA 1J0HA 3FSUA 4E4PA 4D1JA 1E6RA 1W37A 1QNVA 1E71M 4S23A 1QR7A 5BOFA 2YLAA 3K2GA 4TIMA 1P1MA 5FCZA 2DZPA 3GU2A 4JXCA 2DSVA 2NWRA 4E2BA 1OX5A 3VOJA 2DT2A 1YQ2A 4QQ3A 4ATDA 3TYCA 4QLJA 2GVYA 1QBBA 2OXNA 5AC4A 3L0KA 1R6WA 3NQCA 4REQB 1YE6A 2V6AA 3IJ7A 3TYDA 2CITA 3ZR5A 5FAJA 1V8EA 4Y2WA 4Y9NA 2ZVRA 1M7PA 2JIWA 1VBRA 3B40A 3P5YA 4FHAA 4AU0A 1RK5A 3KCOA 2DZTA 2DVTA 3L9CA 5K9DA 3IS4A 1KCXA 4GQ0A 3SSZA 2TSYA 4H9MA 3EWYA 3ATYA 4A29A 4IPIA 3E3HA 1KLYA 3MSDA 4LUJA 5GNZA 2QNEA 4OFCA 4NX5A 3QY8A 1M41A 1AL7A 1C93A 4I6KA 1TKKA 4U5IA 1ZBCA 1WNOA 4NZJA 1V7AA 3JZUA 1ZCOA 1V3HA 2W9MA 4EF9A 2CEQA 4V1XA 1UQZA 1F3TA 2RGLA 1LCOA 2O4MA 3GRIA 4CU8A 2NQZA 4BQ3A 1A3WA 2UZ9A 4YU1A 1QI4A 1L0PA 1ZBWA 1UWSA 2GL5A 1PE1A 2J74A 1U2YA 1BYBA 4ZBCA 3W22A 2GVJA 1ME7A 5BMWA 4GZIA 1YLVA 4I9TA 1OFEA 1KM1A 1VS1A 3VGBA 2W92A 4NNAA 4YYFA 3A9IA 3MP4A 5ECUA 1F6PA 3QTGA 4UZSA 4UNKA 1TA3B 1KFCA 1BAGA 1X38A 3WQPA 3UU0A 4QSHA 4JEJA 1B3OA 4JTJA 5C8BB 2A5HA 5TAOA 1ML1A 5AC6A 4AIBA 5HOSA 1HKMA 4JYEA 5BMXA 1LWHA 2CLFA 4IG2B 1XIDA 5D4YA 4XVDA 4CNNA 3BAYA 4S3BA 4DNHA 2VCBA 2O9PA 2J88A 3HU7A 5EMMA 4NAFA 5C9WA 4D6EA 3DC8A 2OLSA 3SCOA 1EXBA 1NVMA 3NXLA 1PS9A 1KWKA 4KQNA 3W87A 2QUNA 1MQPA 1GKPA 3TTOA 4O8RA 4Z1AA 3OLDA 1BPLB 1TPFA 1OF8A 5HUOA 2ZUNA 3OOQA 3B8SA 4PEKA 3W82A 1ADOA 1ZS2A 2YDQA 1H0GA 2CLMA 4C90A 4C7DA 2HWGA 2GGJA 4XBJA 1WXYA 3RM4A 5KETA 1XINA 1FH9A 2BVWA 1XLKA 4QDPA 5I79A 4QX4A 4IPJA 4BI6A 3MBDA 3U5UA 3HPZA 1K03A 5D2YA 2H8XA 3E6EA 3O6DA 2WSYA 3GNRA 1P0NA 1W1A1 4ERIA 5A8OA 3VKAA 3WH5A 5HPOA 5IFTA 1OZMA 4LXFA 1NDWA 4IICA 4F40A 2YFOA 2DT3A 3W1AA 3ZVHB 4GO9A 5TF0A 2QCCA 3ABXA 3OQEA 7REQB 4ZQNA 1R0MA 3EKLA 3NXFA 3DFHA 3CAKA 1W8GA 4AY7A 5DEZA 2YBTA 1MZHA 5I3HA 3B4YA 9XIAA 4FLQA 1VBHA 4JQ4A 5EL1A 3VE9A 5G4WA 1VD6A 2IQ0A 5JXQA 2G3NA 4WHBA 1TPWA 4FNSA 3FAWA 4C6KA 1H09A 1W1YA 4JTTA 2WZMA 1AQMA 4I9MA 2VEIA 1AJZA 3CH9A 5D30A 1JZ2A 1OFRA 3OHMB 3H21A 1LUCB 4XG1A 3B0PA 3IK4A 3NSXA 3PB0A 1ZPTA 2YL8A 5AYZA 1ZP4A 1EC8A 3GB6A 3S42A 2YZRA 3UCCA 4PEEA 5EGRA 3T2PA 2O7SA 2YR1A 4YVVA 3B8IA 3IV3A 7ODCA 2B7OA 3RX4A 4JIIX 3TTEA 1XKJA 2O55A 2R24A 5A2AA 1FOBA 3AYVA 2E1DA 1RD6A 5CLWA 1GTEA 3QLLA 3NQBA 4Z2KA 4HU8A 2X1SA 4N6FA 2CKRA 2Q8LA 1HJQA 3GVWA 3MUAA 4HK7A 1QPNA 2BODX 2YXOA 3LENA 3PPGA 3PJTA 3WF2A 4W88A 1N8WA 3ITOA 4US5A 1G7VA 3TNBA 1UR0A 1GW1A 1KB3A 2Y63A 1WDQA 3P5ZA 3QV7A 2V0TA 1EYEA 3PUOA 2PMQA 2J25A 4ZTYA 3P0WA 2E6FA 1VFFA 3UZJA 4ZGYA 1W1PA 3ABZA 5H91A 3AS2A 3PAJA 4PBEA 1I9CB 5JBFA 3KOFA 2XZ7A 1R3YA 3FX4A 1RALA 4F0RA 3ARTA 3F4DA 4QNEA 1REQA 5LNVA 1NP0A 3A23A 4BQ2A 1VBGA 2J9XA 1R3RA 2QV4A 2WJFA 1VB9A 2BHZA 1MUCA 4IPPA 4GACA 1KRBC 4IWWA 4W9TA 3NAVA 4DAFA 4CQCA 3APTA 3BSHA 3CJPA 3QGKC 1MW2A 2VGFA 3WBAA 1RQHA 3W88A 2QCLA 3F4NA 4WGXA 1VENA 3PBVA 1EP2A 4BZYA 3ATZA 4H1ZA 3GUWA 2WJZA 1EJTC 3KP1A 4BWLA 4LNYA 5G2HA 3M7WA 2I14A 4UTUA 1F74A 3W3OA 2Y70A 1K9EA 4DJDD 4C6QA 4HCHA 1LL4A 1SYTA 2ATMA 2FB2A 2DORA 1BD0A 3G0SA 4MPQA 2W61A 4JIEA 4ADUA 3M5YA 4JS3A 5CG7A 5LNWA 5HWNA 3WH9A 3R58A 4K36A 3W4RA 2OCZA 3G24A 1DXEA 1KD0A 4HA1A 1JF5A 1KLZA 1NFGA 4AW7A 1DJZA 4RZ4A 1J6OA 1TJ2A 3AIEA 2X05A 3HMJG 1SZGA 4C6LA 2PA6A 2PODA 2DUZA 4HIBA 1TZ9A 2XVKA 4CQAA 4HNTA 1M53A 4QJ4B 1QPOA 4S3DA 3VUSA 3O16A 4V28A 1VCFA 1XXXA 3UJSA 5D02A 1H1YA 1I6NA 2PDFA 5HBFA 1W9XA 4R3UA 3EMZA 1U1HA 4GY0A 2WCGA 3K8MA 4D9PA 1NFPA 4E5TA 5HAOA 3L66A 3PWIA 3IRSA 1AJ2A 3LTYA 4D71A 1I2OA 3CZEA 3VXGA 4P7NA 2VX7A 5EKYA 3P74A 2BS9A 2IXUA 2OJPA 4MB3A 3V35A 3E9AA 1T6MA 3TFCA 4RE0A 3RU6A 3V5OA 5DX7A 2H90A 3RFAA 1J93A 3H6OA 3FJLA 5I7GA 5F2LA 4CUCA 3IVUA 1G6CA 4FXSA 4S1FA 1UWTA 3TN3A 3CZKA 2I9UA 2TYSA 2WW5A 5FACA 4CD7A 1OCQA 3A4WA 1NTHA 3S2MA 2JKEA 2VC6A 3EEGA 5HWMA 2ZRVA 3BCJA 4ZE4A 2J9ZA 1RJQA 3QKZA 2W62A 3FY1A 4NT0A 1OFDA 2GQ3A 2XFYA 3GAYA 3KOWA 1KCKA 1SZNA 1TPEA 1GEHA 1XP3A 2J4GA 3TN5A 3W75A 3RN6A 3LTPA 3F4WA 4XZMX 3V16A 1G67A 2ABBA 1JDEA 1SJAA 3R25A 1GOMA 3PZTA 2Y85A 4JY8A 1Q4WA 1U5HA 2Y1HA 4XKYB 5BXSA 4NI8A 4W7UA 1FKXA 3VK5A 1GZGA 3BSGA 3VDBA 2CETA 5A5WA 1VC4A 4F8XA 1DXIA 1ITXA 1H2JA 4H00A 3AIUA 1JYVA 3HPXA 1QOXA 1KM0A 3TZFA 4FNPA 1EH9A 2IKIA 4J9JA 1TWZA 3E38A 2OG9A 1J18A 2VQTA 2NXHA 4MY9A 3GW3A 2XISA 4HOWA 4EWND 4TX9A 3SIMA 2V5CA 4CN6A 1ZRQA 2YOCA 4LB4A 3EWCA 4FPSA 4U4MA 5KZ6A 4F2UA 2YGYA 3MJYA 4O11A 3GW0A 4NJJA 1OB0A 8XIAA 3EX3A 3FA4A 4DX3A 2Y61A 1WAUA 2C71A 3E0FA 1DTNA 3GDMA 2G3MA 3KOZA 1KM5A 3IUDA 2YIHA 3DG6A 4QCFA 4OIFA 1ONRA 3CPUA 4W8BA 1EWDA 5DLCA 3H8AA 3BQ6A 3VD7A 4E6MA 1OFBA 5FSEC 1P6BA 2XSBA 4GY7A 4UR7A 4O1FA 3ZSTA 4G7EB 3QMSA 5EY5A 1BG4A 1LOSA 2DH2A 5IDIA 4MWAB 2EGZA 3NQEA 2NSOA 3LNMA 3CWOX 1UUOA 4IFOA 2PDBA 4K7VA 3WLNA 1D7FA 3PY2A 3QPZA 2P53A 2FJUB 3KM8A 4C6CA 2FLIA 4PSRA 1G0CA 2VC7A 4LUYA 2OWXA 3BLEA 3U2CA 1QNSA 2YB4A 4KRZA 2Z4GA 3H7RA 4XIAA 3DKLA 2YBUA 3PAOA 1H5YA 4IFRA 5LIKX 2WWDA 3DECA 1P0KA 1ZJIA 4ONVA 4TX8A 3WK0A 3VVGA 1JXJA 1EJUC 3DGBA 3LS9A 4NF7A 3T7VA 1VRDA 1I8JA 4UB9A 4A2RA 1IEWA 1G4SA 3AXXA 2JFEX 4MY1A 1UOZA 3GK0A 3EB4A 3N4AA 3P8IA 2VO5A 1S46A 3S1VA 2WSKA 3WLOA 4A8NA 4GI9A 3NM3A 4O0QA 3N9KA 5DF0A 3AS0A 2PGFA 3ANYA 4LBUA 2XPKA 1AFSA 4ZMGA 1A50A 2I17A 1KQYA 4FIQA 3OZYA 3GG7A 4BF5A 3ITXA 3KFTA 2FZMA 4ADSA 1O12A 3CL8A 2QGYA 4A05A 4O1DA 1NOUA 1YRRA 4LC6A 4MPKA 2Z1XA 2OELA 1PSCA 3RLGA 3UG5A 3H2OA 5D05A 2VZOA 4FNUA 2QAPA 2AQVA 4O54A 2FZ9A 3MCMA 3UCDA 1R2RA 2RDTA 1E73M 5C5YA 4ACZA 4Q22A 2BTMA 3ZT6A 4X61A 5M03A 4UC5A 3OBAA 3KAOA 3VA8A 2VMFA 2D0GA 3EWXA 2OYMA 1EIBA 2ZCGA 2JQXA 3DFOA 1ISWA 3M0IA 1W3JA 3ARWA 4MZ8A 3EWUA 3TAOA 5CC7A 4POCA 2XINA 2HZGA 3G77A 3ZIZA 4GX8A 4BFAA 2ZOXA 1KRCC 1GGOA 3VILA 3W70A 2EEXA 3R6IA 1J0IA 1DTUA 1S5TA 1XLBA 1H3GA 2UY2A 3LLDA 3E02A 2HPIA 1R47A 1IEQA 4FI4A 4XK2A 1XD1A 1W1ZA 2A85A 2EQDA 4JX5A 3M6DA 4N4QA 4GH1A 2QUUA 2CBIA 2O9RA 4G56A 3ZVHA 1GVQA 4E8CA 1E6PA 2AL2A 4GG9A 1F8MA 3WH7A 3VGFA 1MNZA 1C7TA 5DXYA 2EJ1A 1VHNA 4TX6A 1XYLA 1O1HA 1JCMP 3EAUA 3UXDA 2FFCA 1PHWA 3BAXA 2FJKA 3NO1A 4AIUA 3LI1A 3NNTA 4PTDA 1EFZA 3S1WA 3EOUA 2GDVA 1CTNA 3I65A 4LW7A 3S1GA 1DWGM 1HQTA 3BOFA 3LTSA 4O1CA 4WX2A 4MNMA 1FBAA 1NDZA 2ZDRA 1QOQA 4YYCA 3EBVA 1GT8A 4BA0A 4YTUA 1OF6A 2VJXA 2XUCA 5DELA 4DWSB 4LRSA 3OVQA 3OO2A 1S2VA 3DDMA 3IUIA 4M5PA 4DBUA 4HNVA 3TJ4A 1CPUA 1LLWA 3TJXA 3GDTA 3LBOA 3CLWA 4D72A 1OYBA 1A47A 4GNKB 1LZOA 1Q2SA 4LF1A 3VCNA 3PZIA 1IEVA 1XI3A 5BRQA 3GG1A 2R1PA 2CESA 1RHCA 1BF2A 1S5WA 2R82A 2OLHA 4QQUA 4FEZA 5FEPA 2OQLA 1RZMA 2V69A 3TVAA 1TVPA 4UWMA 3QZAA 1W32A 1TTIA 2ZXDA 2JIEA 5CZTA 4KWUA 1PZ3A 3B9EA 3L4UA 4MKSA 2O7QA 3NEVA 4UR9A 1GZJA 1E6ZA 4JHZA 3AXHA 1XSKA 3GH7A 4KGLA 4G6CA 5CG0A 2ZX8A 1BRLB 2OEMA 4YTRA 4IGHA 4FOJA 2PEVA 5FEZA 5BZAA 1EUAA 3HG5A 2ZRUA 3AS3A 2WJDA 1LRNA 3TOPA 1EA0A 4KEZA 4NHVA 1XICA 4Q8MA 3N4EA 4HT3A 1T8QA 3PWGA 3EDJA 3U2ZA 4ZR8A 1ZQ5A 4ZXOA 5FJPA 5FF0A 3QW4B 3W7DA 3L2LA 4Q8UA 1F2JA 2VX6A 5EMYA 2ZC1A 3HF3A 2NQ9A 2FTWA 1EX5A 3PBUA 4DYEA 5A8QA 1E4LA 1SSDA 3NL6A 5HINA 3H4GA 4QHRA 1V6XA 2D3NA 2WC7A 3DESA 3UR7A 3VIMA 1XH1A 1PX4A 3VCCA 4GZJA 1TYGA 3M0KA 3W25A 4YCPA 1D9EA 4P7RA 1JGIA 3HV9A 4X3ZA 4J3SA 4RNIA 3RCNA 5KTLA 1VFTA 2QW5A 1WZAA 4W8AA 4MMWA 4MY8A 2ZUUA 5DMLA 1RV8A 3W2JA 2XSXA 1S1PA 3VD4A 2G8ZA 3SRDA 4B91A 4TV5A 2FZ8A 4IOTA 3V0UA 1C7SA 2XWDA 4GE8A 5LKYA 3ANUA 1XLCA 1XCXA 3KLLA 4L9XA 3NYDA 4YWIA 3L2MA 1JPKA 4RZ5A 3AWNA 4GKTA 1WAWA 3UCQA 5A6JA 2FZBA 3EOLA 4YMZA 5BXRA 2RFGA 4U33A 3MWAA 2VEGA 2PE4A 1HO1A 3KRZA 3OPSA 4BQ4A 1CXLA 3C3UA 3T4CA 1IQ8A 3TTQA 5C54A 1ISYA 3GVQA 1FH8A 3D3AA 4URIA 2G3IA 1J5TA 3BLOA 4PULA 3OBEA 1GJWA 3MYPA 1EJXC 4O10A 3PUEA 3IIPA 3M0YA 1OIFA 3PBMA 1LOQA 1B31A 2PB1A 1TPC1 4H7ZA 1V6VA 4ZOEA 1GJUA 1RA5A 1GWJA 4ZO8A 2O0TA 3H53A 3LRLA 4MYAA 1WXZA 3Q4DA 4WKAA 4WY0A 2I1OA 2FGZA 1EEPA 5I03A 4LVGA 1TVLA 4IPNB 3DFQA 1H0IA 4GC3A 1H7RA 2PDLA 5F2MA 3O1NA 2X2GA 2VL4A 4J3XA 3LM3A 2YDRA 3MMWA 4GUIA 1KBBA 4S3FA 3O07A 2VQUA 4ZB2A 2DSWA 5G1TA 1UR3M 1Q7QA 3MSYA 2YZ5A 1XFBA 2BXZA 5CPNA 5J8LA 1VBJA 2FPTA 3AIQA 4GVGA 4LYRA 2A3BA 4XISA 3NA8A 5EMLA 1LUCA 1IYXA 1V3IA 2XH4A 3F2CA 1ZCCA 1TFVA 2GUYA 2YW3A 4DVOA 4M81A 4FALA 4UOZA 5BU9A 4HZMA 2VM8A 1AW5A 1KXQA 1Q6LA 3W7OA 3E0LA 4FS9A 3F03K 1U5JA 3DX5A 4HK5A 1SR0A 3AMKA 3TYZA 4F9JA 2QCEA 4ADTA 3CO8A 4KEMA 1UZ4A 5HR6A 2OGJA 2ZFAA 2HTMA 4C6BA 3CT7A 4K39A 4DJEA 4IMFA 3MANA 3NYZA 3PS7A 3G22A 5A8NA 2JE8A 5BOOA 2VVSA 2ZRWA 1JXKA 1OFOA 2GJRA 4TXEA 1ZHAA 3QQ1A 3MI2A 1UC5A 3TEVA 4YHEA 2QIIA 2YDSA 3R0KA 1XIEA 2VCCA 3W1NA 1UA3A 4IIBA 2DJXA 4DNMA 1OK6A 1MW0A 1YNPA 2WHLA 2Y6ZA 2IQDA 5BWFA 4FF7A 1UD4A 1XHGA 2V5BA 1ENUA 3R10A 3BV4A 3OGVA 2VKZG 4UTMA 2PDNA 5FF3A 1A3HA 2OYKA 1ZY9A 2WQDA 3WNKA 3SAZA 2ZA3A 1W2VA 2UY4A 4LS1A 2AOSA 4I7VA 4JNZA 2J7CA 4PMZA 5HNUA 3PNUA 1CLVA 2P88A 2VD9A 3IIZA 4AWSA 4IGNA 3NQ2A 4UTIA 3QY6A 3FXGA 4R53A 1IZKA 1QVBA 1AZ2A 4AYSA 3AYSA 1EDTA 2QCDB 3R89A 2R14A 1RP9A 3QZ6A 3VO0A 3S47A 4B16A 3WDPP 5J04A 4AG0A 4DUWA 3B9NA 3CTTA 4N0RA 1B3VA 4GIEA 1Q6DA 4D6GA 1CIUA 1J96A 4LWWA 1I0BA 2BHYA 1IF2A 2ZDSA 4GIAA 3E2RA 1UPPA 3ISIX 1E9YB 1RLDA 3W7QA 3NSMA 5LIWX 3GE7A 3NSNA 3NQ8A 2V3GA 1SZFA 2V5DA 3MSRA 1H4PA 4B5VA 4AZCB 2XFWA 1E51A 4RJEA 4YN5A 2BFGA 2E4TA 2POZA 1E1EA 1R30A 4B9ZA 1QOPA 3LBCA 3TW9A 5BXPA 1E9LA 2PDQA 3ID7A 1PJ9A 1NWRA 3SCUA 4HNLA 2PLMA 4D8AA 1DHKA 2F61A 3AMLA 5CSYA 4TVCA 3W0KA 2DH3A 4QAIA 1M03A 1E43A 5A2CA 1MEIA 4C6FA 3KCJA 1EEXA 5GNYA 2ZXBA 2OOGA 1I60A 5CBBA 3IEBA 1CWYA 4YPJA 5C6MA 5REQB 1J2WA 4JTCA 1PYMA 3VKBA 1E0UA 2OMAA 2C79A 2X1TA 4O57A 6REQA 4U31A 5A94A 4WLCA 4L56A 1ZFJA 4JQ1A 3E0IA 1DEDA 5CKSA 3A12A 1LQ2A 3NO3A 5FEWA 1JNDA 2C18A 3ECQA 1D8CA 4ICCX 2J75A 3IVSA 4IT1A 4I8DA 3UWVA 4FZIA 1T0OA 3RLVA 1C9DA 2BY2A 1TV3A 5T9CE 3V7PA 3WQOA 3GNDA 3AISA 1RH9A 4AC7C 4M24A 2X0SA 3MMTA 2QPUA 1K7XA 1E6SM 1RBAA 5I78A 2WVUA 3E12A 2Y88A 4HPNA 4UMCA 4NAFB 4I9JA 1GVEA 1W3HA 4FNRA 2P76A 4GBDA 3LERA 1R7OA 2J13A 4H8HA 3ALGA 1QI0A 2Z1SA 3P67A 2Q3OA 3RIKA 2VUNA 2E28A 4P61A 3AUOA 2VUYA 1T5AA 1CGXA 2PI6A 5H2ZA 1UWQA 1DV7A 4JY9A 1ZTVA 1ONWA 1QASA 2Y5SA 2ZE3A 2P1FA 1UD8A 1RJRA 5KITA 3FXYA 3WJWA 2WMIA 3R8HA 4GYKA 1BSIA 2R1NA 1QCWA 1NWTA 3E5PA 2GUBA 3I4EA 3HM7A 1VFSA 1PBGA 1KXHA 1OC6A 1S39A 3TQKA 1ITUA 5D2XA 5T91A 3CQKA 2FGLA 1RA0A 1P43A 1XPYA 1OC7A 4PMYA 3BCDA 2PRMA 3SM0A 2YBVA 1K70A 4C7GA 2PDGA 3F2DA 1V6WA 4D6JA 3S2LA 2IKJA 4M1RA 2CZ5A 1EJRC 4O0ZA 1M5WA 2PBGA 1KR1A 3TSDA 3VIGA 4RDYA 4FMVA 3FLUA 1KFLA 1VYRA 3UWYA 3AHVA 1H7PA 3W6YA 3P82A 1SVDA 2FB3A 2FKPA 4BJHA 1DORA 4QISA 3VKCA 2ON3A 4NZ1A 4RR4A 4KT2A 2OO6A 4UFLA 3QHOA 1BSLA 3E2QA 4DJFA 1LT8A 4ZZ9A 1GOXA 1L2UA 5TD4A 5M5DA 5LSMA 3K1GA 4UQDA 2XHYA 3F4VA 5CCZA 1TUXA 2WBKA 3W38A 4U10A 3KL3A 4JTIA 3A5FA 1GVRA 4O1BA 4NZCA 3T78A 1ZJAA 1O5RA 4G5DA 4NG3A 1OX4A 1WX0A 1DJYA 7XIMA 3ITGA 1TCMA 3NQMA 1NIUA 3VX0A 3IV8A 3TR9A 1V08A 3N34A 4TQTA 2OT1A 1LOLA 4GISA 2VZTA 1VEPA 1CB7B 1YKWA 2R6OA 2HV5A 3W1TA 2CFFA 3OQ8A 1HP5A 1QNPA 7ENLA 2RHGA 6CGTA 3BGAA 1BYAA 3CZJA 3FFSA 3ABSA 1OM0A 1CB2A 1ICPA 5FI8A 3KZPA 2BDQA 3WF0A 3W37A 2ZUSA 1IGWA 2A1YA 1UWAA 3TCEA 4P7OA 3LG3A 2PF0A 2PLCA 4ORMA 5DANA 2ZX5A 2VOTA 3NUKA 3E1F1 1UR4A 4DYJA 3B9AA 2WCAA 3SEPA 4HSHA 4JNYA 3KS5A 1U22A 2XU2A 4ZQOA 4DEFA 2A6NA 3LM7A 4FX8A 1V6YA 5DCDA 3WLJA 5AC7A 4AFYA 1F76A 1NQKA 3C2RA 1E0XA 3QM3A 4KRTA 3WEZA 5CPLA 1UHVA 3TC7A 3A4XA 3KLKA 1DQXA 4LV9A 2E1WA 1TZZA 1GOWA 3R0DA 4N9DA 3DZ1A 1TJRA 2WMJA 1W3LA 1UJPA 4EXQA 3SCPA 3PZUA 4MAZA 4MLJA 4G1NA 3NPXA 2RH9A 2CIPA 1PZ1A 5B7ZA 2BY1A 1HW6A 1WPCA 1HN1A 1XPGA 4M82A 2PDMA 2A7NA 3R2GA 3KS6A 4UNIA 2B31A 1MO0A 2CLOA 1PAMA 5B7YA 3GD6A 5DQPA 2BY0A 2P50A 4WDUA 2ZZ2A 3KWXA 1MFVA 3WQ5A 3COTA 3UJFA 4D8LA 2PDHA 1KXVA 3UPWA 3SIZA 2NQJA 1EO7A 1QMLA 1GQLA 3WFLA 1A5UA 3O7UA 3PFMA 4XSMA 1PKNA 4J3WA 3RO6A 1F05A 2XDFA 1YPIA 4JR5A 1FCUA 4F4RA 4Q6JA 1W5MA 2WB5A 1ZP3A 2C1HA 2HBXA 2QJHA 4DLFA 4FXFA 2BMBA 2DT0A 4PFMA 1EPVA 5C70A 1O68A 1LBFA 1GHSA 4RPPA 2XFFA 2G41A 4O50A 1EO5A 3V3WA 2PWGA 4S2BA 3Q37A 2NVCA 1Z69A 1N2VA 1YBQA 5D2VA 3W76A 3MY9A 4HU3A 1VKFA 3C86A 1JF6A 2DU2A 1HGWA 4GVHA 1TV5A 2WMGA 3UNDA 5TIMA 2J9YA 3PB2A 1IIGA 3WH6A 3KDNA 2QZRA 4GA8A 3BARA 1JDDA 3VKKA 4NXKA 4IMAA 4AC1X 4Q8OA 4WEVX 4DI9A 1OINA 4RNHA 2GWGA 3DIPA 3KX6A 3UZ5A 3RK8A 2I16A 4YNGA 4OQVA 2IPJA 1KRAC 3WELA 4Q3MA 4DXKA 1Q85A 1DL3A 2ABAA 3AI0A 1ME9A 5I3JA 3WD3A 1J11A 1Q8JA 3ABOA 3KUMA 1KKRA 3EMCA 1R9YA 2A3EA 4S38A 3STEA 1XIBA 4JTRA 1Q63A 3E2VA 2B81A 3MVTA 4AZBA 1DWHM 3VU2A 4H41A 4DPPA 1BHGA 2DIKA 5A8PA 2J7FA 3P93A 3QZEA 4M6PA 4EAYA 2ISSA 4UFKA 1JZ4A 2D22A 3HFTA 4W84A 2VEKA 1KBJA 2PTDA 3TAKA 1D7KA 3A6OA 1WA3A 3DENA 1F7BA 3LCLA 3QC0A 1XC4A 4PMNA 4Y9AA 4B92A 2VD8A 4PUNA 4UTFA 1VFUA 5C7VA 1LLOA 2VFFA 3AXIA 3I68A 4XD5A 3KBJA 5G2WA 5I23A 1V0LA 3LSBA 4P8XA 5A95A 3BC9A 1ZBVA 2E7FA 3UERA 3BLIA 4DWDA 3VOHA 3LD5A 1S5MA 1D2KA 4L1WA 2CYGA 3P84A 3DEQA 1OCBA 2A7RA 1H49A 2J27A 1XDJA 3OVRA 3A21A 1AD1A 4G9PA 2ZUVA 3W7RA 2GDUA 1TRIA 1V02E 4Z1DA 3VUPA 1YXYA 1WV2A 3PTKA 4Z1BA 3UXKA 2PDUA 1V79A 1B4KA 1VIZA 5I0DA 3IARA 1YPFA 1JCXA 3R43A 2Z29A 1E4MM 3W7GA 1KBKA 1QO2A 2GGHA 4QBXA 3W83A 4FF5A 4X63A 3TONA 1VHCA 3QOKA 1W9DM 3VGDA 5BOEA 1PDZA 5LYRA 2FIQA 2HSAA 3RM8A 3SCNA 3WNMA 1QHZA 2V3DA 1L6FA 5AYYA 2QULA 3LCFA 5FJIA 3CB3A 3DG3A 5CGMA 3PBWA 2LLEA 4QE5A 3W7IA 1TE1A 1CI1A 4WJ8A 4N9BA 3SCWA 4AISA 1NDYA 1LBMA 4JCLA 1HXJA 1LRQA 1VFOA 2VEFA 3GIPA 1UPMB 1UD6A 1TREA 4XBKA 2D0HA 2Y7EA 4KCTA 3VOIA 3VOFA 5CH9A 3M1ZA 3F4CA 4ZB5A 4AWTA 4O15A 4J27A 2YCEA 4CNSA 3A13A 4EWJA 3LHYA 3N3TA 1U83A 2QVNA 3UT0A 4Z17A 3QC3A 2CZFA 4HYVA 4TOQA 2GDQA 2NLYA 2OT0A 5G5IA 3R13A 4R7JA 4M6VA 1EUNA 4REQA 3BLDA 1BRLA 2QF7A 1MSSA 1BFNA 4B5NA 3ANVA 1QI3A 1BGAA 4BCEA 4L4MA 3MCNA 3S5ZA 1MXGA 3SY8A 3BMWA 3GLCA 3TP4A 3FJNA 1T40A 2E9MA 3UG3A 2XN0A 4HBKA 1J12A 3T8QA 5ECVA 3RCYA 3GTHA 4S3CA 4GVIA 2PTXA 4MDOA 2FHFA 1B9ZA 4E2DA 4IFKA 1YTKA 1UD5A 1S5NA 1H62A 1QATA 4OWGA 2GYIA 3V75A 2J8TA 4GABA 2X2YA 1GEQA 1QBAA 3L5MA 2B7QA 2VVNA 1U33A 2V81A 3BW4A 2JF7A 1EF3A 1LROA 4EXAA 2FTYA 3N11A 5D33A 2WHJA 1A5AA 2VEMA 2A0NA 4DUOA 2C0HA 3E2SA 2ZA1A 3H4XA 1W5QA 3VINA 1EBHA 4GJJA 4E4UA 2FZDA 2W91A 3OU8A 2FVMA 3M0HA 3WX7A 3QQ0A 3EKZA 2X09A 1A0CA 3WLPA 2Y4SA 1NU5A 1KV5A 4RLIA 3L4XA 4C1NB 4R34A 3KOXA 3S5SA 3T0CA 5AYBA 4ZTXA 4Y9MA 4BHYA 2R91A 2VDHA 3BURA 3TN4A 2F6UA 4PTMA 2VC9A 4PN2A 2HVMA 3GH5A 5REQA 5AZ1A 5KEZA 4Y9OA 3THCA 1YBQB 5JMUA 1CXKA 4E0CA 1EGZA 4GQRA 3MU7A 3TMLA 2WVSA 2I9EA 1FWGC 1XIGA 1YNYA 2YL5A 3SUTA 2EKCA 2H9AA 5AOUA 5EB8A 3U6WA 3U0HA 3B4UA 3MDWA 4RV8A 4CN1A 5CJMA 4Q32A 4DJEC 1K3UA 1XIMA 1TJ1A 1MRQA 3TZNA 3LPFA 4O16A 4KIRA 4KEUA 2CLIA 1A80A 4HCLA 1PX3A 3V5FA 2P3EA 3T0TA 5HR7A 4KF1A 4JFWA 3HB9A 4IF2A 1V3JA 4GCXA 2Z25A 3OYZA 4HZ6A 1K7EA 3QYSA 3GZAA 3HG4A 3EXTA 3LOTA 2INFA 2VZSA 1ZBKA 4MM1A 1I0DA 1RBOB 3AUJA 4L6HA 2J62A 1J01A 1QT1A 1TTPA 3W27A 2YCJA 3NVDA 4PB5A 3CL7A 2F7FA 5G1MA 4AVOA 4LT9A 1HKIA 1XM3A 5I09A 4ZB0A 4EP8C 1GVOA 3BZJA 3JVAA 3F5LA 4AEOA 2YPIA 3H55A 5AHFA 4RDWA 1FTXA 2QCMA 1CBGA 4JNMA 2FPYA 2Y0FA 2ALDA 3AIWA 4WRHA 3LBMA 2NSXA 1JUBA 3VTRA 4ZQCA 4XX6A 5K3VA 4OJYA 4ZQRA 3D46A 4A22A 2Q3RA 1FWRA 4DO4A 1A5KC 1EJ7L 5GPRA 4DRSA 1GW9A 4P7QA 1DVJA 3S6OA 1GQIA 4FX6M 4ACZB 4C60A 4AH7A 4ML9A 1XYZA 3O0FA 5C9ZA 4NIRA 1UKQA 2VDGA 2QJIA 1JZ8A 3BQ5A 2P0OA 5D03A 4DO6A 1ZJHA 3NL5A 2AKMA 3W2NA 4Q4RA 5I02A 4RKAA 3T40A 3PHAA 1X8CA 1PUDA 1E6NA 1H60A 3UJ2A 4MJZA 1FWIC 2X7WA 1TZ7A 4ZOCA 1TPDA 2X0YA 1VBUA 1IT8A 5HATA 3PBYA 3RYSA 2ZIDA 2QDGA 4GJIA 4HPGA 2QR6A 3JZEA 5A6AA 3O15A 2ZZ7A 4L4OA 3CXOA 3AYTA 1TJPA 1EP1A 1WBJA 2A21A 2ZE0A 3EPOA 3U7BA 3WLMA 4QM1A 2QJJA 4LAKA 3W74A 1KGUA 3VNJA 2PU1A 3RHGA 5JBEA 4PMDA 1X8FA 1W54A 3LX9A 3NZGA 4DF1A 3ZYZA 4JDBA 4QNWA 4RV3A 1F6YA 3EA2A 2EO7A 3E74A 1KTCA 1WKDA 1LM1A 2WZTA 1E15A 4HVXA 3STGA 4AXKA 4X60A 2XN2A 3TCSA 3W6MA 4XZHA 4X0NA 2WAGA 1UOKA 2AKZA 3IJ6A 2VOMA 1PVNA 3IUHA 1WZKA 3URBA 4O14A 3HG3A 4DJDA 5E0CA 1BVNP 1QK0A 2X1IA 1A3XA 3HV8A 2EF9A 3T1GA 5XIAA 1XSJA 1AH4A 3V4BA 4AF0B 2F84A 1BQGA 4S2CA 5AHIA 3W72A 2C1IA 3M0LA 3AIBA 4TV6A 3MPGA 3MMDA 3M7SA 1F61A 1RD5A 1GG0A 4X2RA 4E8GA 2WANA 2Y89A 4YLWA 1S2AA 4EE9A 3IIXA 5FSDC 1TG7A 2Z2UA 1TB3A 3VIFA 3A4JA 3RX3A 4GI6A 4FOUA 1XLIA 2QKFA 4MNJA 3C2YA 3GFZA 3UWEA 2FZNA 1XGDA 5AVNA 5CGQA 3URAA 3MMUA 4WDXA 3SJ3A 2ANUA 1R85A 2D2HA 4YL2A 2NZLA 4MG4A 2ADAA 2CERA 3MA8A 1KR0A 3EEZA 4HOXA 2YA2A 2YB1A 3U2OA 1CXIA 3F7JA 3S8HA 4NASA 2XJ7A 3L4ZA 1G5AA 2X41A 1KXTA 2QUTA 4XAZA 3IJLA 4MWAC 5A6BD 4IPLA 8XIMA 3SGUA 1UZ1A 3DI1A 5FKYA 4HHLA 2BASA 3S6DA 3CIVA 4NJHA 4MZYA 5J5RA 2RUSA 5HNRA 3SCRA 1HL9A 5MF5A 5A8MA 3TX9A 3GYEA 4ERGA 3WNLA 4DF0A 1T7LA 1SW7A 4K68A 3GVVA 4Q7IA 2VP8A 4HMCA 3NZRA 2QS8A 2CBJA 3CUXA 2NQLA 4WUIA 1A53A 4J4KA 4D6FA 5AFDA 4GFSA 1YDOA 1V0MA 1V4YA 2PTYA 4UR8A 2XIIA 3FGCA 4H4IA 4DB7A 4H6QA 1TMLA 3CGTA 3D0CA 2CHOA 5IHRA 4XV0A 3H2MA 1F4HA 4DWSC 1DQUA 2V5KA 3EOOA 1PXGA 4IX2A 4IIFA 3QXBA 3HGOA 1IIHA 2HS8A 4O4WA 3ONBA 1NAL1 3HZ3A 3DHDA 1RP8A 3SB0A 1J4EA 2P3ZA 4GIYA 3ORWA 1WUEA 4NRRA 3IIVA 4J35A 3N15A 1JRBA 3TA6A 3N14A 4W86A 3S3GA 3LLFA 3GR4A 3W7JA 3VZYA 5LA1A 3H2CA 4P8UA 5CSRA 2QCGA 4G2DA 2MUCA 1X1ZA 1LLZA 3LHUA 3QR1A 4EAMA 3M41A 2VNCA 3DYOA 3AMGA 3KXQA 1XBYA 2Q02A 4XAFA 4WY0F 3O3RA 3CWNA 3CUGA 1XCWA 4JTLA 3H70A 3CV2A 3VC5A 4M29A 2PDXA 2WVTA 1GQNA 4GNVA 3O8AA 5D8WA 3SCSA 1DQWA 3ARPA 2V68A 3KRBA 2OYLA 4FR1A 4GPNA 4K1GA 2GVEA 2ZC8A 4YTQA 4Z2LA 4HN4A 3APYA 3LZ5A 3NQAA 1OBAA 3RGTA 5K7JA 3UXIA 1ISVA 4IIEA 4CNTA 1DE5A 5CPMA 3BUVA 1EXPA 1NOFA 1JUKA 2EPHA 2PAJA 3UXLA 1HVXA 3ARZA 2RKXA 4GVFA 3T6CA 3MV11 5IM51 3I3EA 3VNDA 4RCXA 1VEMA 1R8LA 4J1OA 2BLEA 3T2QA 4FAMA 4RZBA 3CQIA 4XAGA 1WBHA 3WDRA 4GYPA 3T4WA 5I6SA 3DFSA 1XUUA 2C1GA 2NT1A 4QLKA 2F2KA 3GFYA 2XVPA 3MI3A 1HFBA 3AOFA 4RXFA 2GQAA 3EX2A 4MFDA 2WV8A 6TAAA 2AGTA 3I7QA 4LJ3A 2FHCA 4LCSA 1KGWA 1V0KA 3WLHA 3C52A 3B03A 1GZ1A 3R5EA 1TWSA 2O9TA 3WH8A 3LCGA 1OYCA 1R87A 3I6EA 4S3EA 2J7BA 1JZ5A 1TPUA 4ZO7A 1XLMA 3GS6A 4N42A 3WD4A 1FHUA 1L9WA 1CXFA 2IW0A 3BLKA 3THUA 4W8LA 4KCUA 3WMLA 4H2CA 2DVUA 4L9YA 3PUGA 1DJNA 3UWUA 4DHGA 1PCWA 1TPB1 2HS6A 1I2RA 1SW0A 2D73A 3LCWA 1EOKA 1CGTA 4I5XA 1MMFA 2BG5A 1W17A 4TVUA 1ZLPA 4LUTB 1PTAA 3MUIA 1B5TA 2CCRA 2CLKA 3IGXA 4AVNA 1B30A 3MUY1 4QG8A 4CU6A 4PSPA 2ODOA 4UZUA 3LMYA 3SR7A 1GCYA 1OT2A 1G4EA 4MKNA 2FVKA 1H1ZA 3NGFA 2GK1B 3TTSA 1PTGA 5DRIA 1VLWA 2CLEA 3GU1A 4WK9A 3EWDA 3GC5A 3MSGA 4L5ZA 1OD0A 5DY2A 4LUSA 1QW7A 1XV8A 4NI3A 3LGDA 5F2GA 3CTLA 4DBSA 1JIBA 4F0LA 2D2JA 1E1FA 5LIYX 4HMNA 1TX2A 4DZHA 4CEUC 2D2OA 3EKGA 1TA3A 2P8CA 3SI9A 4OT7A 1FWHC 2YCKX 2A3HA 3T42A 4PCFA 1H5VA 4KRUA 2Y7GA 3OGRA 3N2TA 5HQEA 1OGGA 3N1AA 4DQWA 4H8NA 2WOQA 3EDEA 3BLFA 3NIYA 3GR8A 1K9TA 2ACUA 4KKXA 2G96A 4LEQA 4BKNA 2EBNA 2WMFA 1KM2A 1T8XA 5FESA 1J6PA 4JZ5A 4AHOA 3OZMA 1EBGA 3NFUA 1IWBA 1M7JA 4F2TA 5FJOA 3EDKA 4MLRA 3IGSA 4LUIA 5U7SA 1SO5A 4QAWA 1TR1A 3A9BA 2V9DA 2VURA 2OPJA 1B9BA 1XF0A 2H6RA 2EAWA 3B8UA 4PYSA 3G6LA 1OFAA 4HPJA 1JJKA 3W2UA 4J7RA 1YDVA 5FF4A 3SCTA 1FDJA 1IHIA 2YCLA 3AMCA 5CAKA 1JI1A 4MSSA 1AJ0A 2QF8A 2I5GA 4AXNA 5HDRA 3IACA 4GCAA 1PDYA 1OD8A 2IQTA 2JK2A 1QNQA 1XIIA 3UWWA 3LV6A 1FWNA 5H8UA 4GYJA 1BKHA 1PEZA 4LRTA 1LL7A 4KETA 2DZSA 2PF8A 3OTRA 1A5BA 3MO7A 1THFD 4JEQA 3AO0A 4CKQA 3CU2A 3KVMA 4ICMA 2A3CA 4DZAA 3WUGA 3CQHA 1R9ZA 5ENLA 4I8YA 1MW1A 1ICQA 1A4LA 3VKDA 1FX6A 1O95A 2OX4A 2J7EA 3WDJA 1NDVA 1DWIM 3TK7A 1E72M 1KW1A 1L6SA 4MGGA 4CCCA 4PTWA 4PA8A 2DVXA 3WFAA 1TX0A 1M01A 4OHQA 3B0XA 3OLIA 1SFJA 1HX0A 2JF6A 1T96A 5C2GA 2OU4A 1B57A 4DZ5A 4E8DA 2VZUA 5CSUA 4IM4A 2AL1A 1R7AA 3QQWA 1UMYA 2XGZA 4XZBA 3KVLA 1OX4B 4GUHA 5JH1A 2WLYA 3KW3A 3WJZA 7TAAA 1DXFA 1JCNA 4B9YA 2PP3A 5F1UA 1JCYA 4LS0A 3C0JA 3QR0A 4J2PA 4N9EA 4XD4A 1XRVA 3IJ8A 3QH2A 3EXRA 3BW3A 1AL8A 3DFNA 4A2SA 4RNFA 2XVLA 3PTMA 5F2IA 4HD5A 3FSTA 3N17A 2V3FA 3SGZA 1YADA 1LL6A 2YYTA 2XH2A 5BU6A 2V3EA 2XM2A 5C2XA 5K9CA 4Q8NA 4N9CA 4XKYA 2PS2A 2PDJA 1AUSL 3PNZA 1FWDC 4RPQA 1CT5A 2Y7FA 3PZMA 3W7CA 3VIOA 3LSCA 4DO5A 3TSMA 1NSJA 3SGGA 5D9PA 3A3XA 1ZALA 4AD1A 4C6JA 1UKTA 5ABFB 3SDOA 1Y7VA 5AVHA 4GH3A 4US6A 4S39A 1K6WA 3V0TA 4HMDA 1UZDA 4JFVA 3TSBA 3USZA 2PWVA 4PR4A 1A5NC 1WZLA 3MO4A 3UEQA 4WXZA 4H83A 1W2PA 3KBSA 4HYWA 4UTHA 1FDYA 3BH4A 1SGJA 2MNRA 1B3XA 1XG3A 3UZYA 4JTAA 1JCJA 3B9DA 1Q2RA 5E1QA 3BAKA 3FHQA 4BY3A 2C3ZA 3GC4A 5LA2A 4ZFCA 3N73A 5AHLA 2NLIA 2ICSA 4JTQA 4F0KA 2W79A 3L67A 2ZICA 3BO9A 1Z8AA 1F73A 4ES4A 3VI2A 3KBWA 5FOOA 3GU9A 4U2ZA 3TJLA 1UC4A 4FXRA 3DFYA 5MKGB 5TNVA 2VX4A 5IXEA 1GOOA 2OKTA 3MS8A 1X1OA 4LVFA 3M64A 3W1QA 5C0QA 1XKYA 3U57A 1UWIA 1OG6A 3L2IA 4FLRA 5HMFA 3QV8A 4V1YA 1BXNA 2HXUA 3BZGA 1ICSA 3L4TA 4WSJA 3WMSA 4GFIA 4I7UA 1N82A 2RGMA 2DZVA 3BSMA 4Q33A 5FD0A 3AMDA 1OJXA 4MWAD 2E25A 5CZSA 3Q45A 3M4HA 1C92A 4Q7BA 4JIRA 2Z28A 2P5NA 2AQOA 2Z6IA 4NAEA 3W2MA 1RY8A 2DZWA 5FL1A 3N19B 4HKPA 1GUVA 2POTA 1FFRA 4PRRA 4GGBA 1XLLA 3UQNA 1FRBA 3MQTA 2HROA 3AQUA 4UNLA 3ZT5A 3GX9A 4NYYA 2E9BA 3L4VA 4P7LA 1IGSA 3SN4A 3WF3A 2ISFA 3WG6A 5FEXA 1D8WA 3GO2A 1CLKA 4PGLA 1JGMA 3F5KA 3CAQA 3WK3A 1KRMA 3NPVA 1EC7A 1WDPA 1L8NA 3EPNA 1QNRA 5G2IA 2R1KA 5I5RA 2Z27A 1DWJM 1LORA 4JTUA 2EPKX 3WQFA 2HNHA 3UY8A 3BGJA 3B8WA 4CD5A 3DH7A 7CGTA 3U4FA 5GVJA 3W00A 2ISWA 3VDHA 2R1MA 3N9SA 2C19A 3WENA 4BWLC 4KGJA 1NF0A 2Z26A 3LPGA 4KPLA 5AHEA 2FYMA 3STPA 4C5YA 4NZ5A 4UTWC 3M6YA 3OB8A 1XYAA 1DJXA 1E55A 5IRPA 2GSEA 1A5LC 1JDCA 1PTDA 4WF7A 1O7AA 4QG6A 3NVTA 1KKOA 3LNPA 3CIWA 1A5SA 4B4FA 1OABA 2WC3A 2ZRYA 3PPCA 1T99A 4PH6A 1PIGA 1VQTA 3FVDA 3N18A 1F3EA 3CUIA 3VMOA 3AHZA 3V1HA 1CX9A 2UY3A 4QE4A 1R2SA 4QJ1A 3AJ7A 3SRFA 1Q6FA 4RNJA 1TQXA 4D6DA 3RNDA 3GVRA 1JG9A 1Q7ZA 3UJRA 2OSYA 3WF4A 2CC0A 1GOQA 4EVZA 1XDMA 3UNTA 2R94A 1ZAJA 3GUGA 2RDWA 2I7GA 4MADA 2OGYA 5LXEA 3R8GA 1Q6CA 1RLCL 5K4ZA 3Q65A 2H3BA 1R46A 3OVPA 3S2JA 4NNBA 1YE4A 1FKWA 1TTQA 2ZZ4A 4ZO9A 1Y5XA 1X97A 2PD5A 2DIJA 4KFOA 1UASA 3P6LA 5H1WA 3E96A 3W2KA 3RJYA 1KNWA 4PBGA 1VEOA 1GVFA 3NDZA 2HK0A 1J10A 1QDSA 3RF9A 3BG5A 4O13A 3NQFA 1WE5A 3MHFA 2J6VA 1PX8A 2ZWZA 3B05A 4MFEA 1Z3NA 1EGVA 5C2CA 4O28A 3FIGA 3DYPA 2IKGA 3EX6A 4F0SA 3WDHA 3LGEA 1VFMA 8TIMA 4WVXA 2Z1WA 4IL2A 7REQA 2WXDM 1YXDA 3THDA 2PURA 2YKKA 4RXGA 1BXCA 1XRSA 1MXSA 1TWDA 4Q6XA 2QIWA 4O52A 4ERAA 4NVTA 4XBSA 3M0MA 3WL0A 3MWCA 2INZA 4US5D 2QVHA 2ZTKA 4GX9A 4A3QA 3GNPA 4IHCA 2G3FA 3NL3A 1KFJA 3VDGA 2AMGA 5L6UA 4H9YA 3IAPA 2WVVA 1YNQA 4B2DD 3DOPA 1FCQA 3SN0A 1H11A 1MRAA 1RK6A 5IHSA 3TN6A 3T05A 1LP6A 4JKKA 5A2BA 2WKGA 2QUMA 2Z6JA 2ZKMX 1F07A 2FMNA 1OGBA 4LTSA 5HPCA 2IPFA 3OVGA 4QEHA 5AZ0A 2V67A 2HE5A 3LXBA 4HZ8A 4DYKA 4ROQA 1PIIA 3CHDA 1Q7MA 3MW7A 1UR1A 3HG2A 5F4SA 3A3HA 1OQFA 4QITA 2WM0A 4JIQA 4EIVA 2QLYA 1XDLA 1LYXA 5C9XA 4MAVA 1Z9AA 3NEHA 2EG7A 2C13A 4I5RA 3REQB 5A69A 3ES7A 4GINA 4GO8A 3VCRA 2VRKA 4GXMA 3WJXA 1HUVA 3SECA 1JULA 4XUGA 1IEIA 4UQAA 2WNNA 3GXMA 4B5SA 3G1AA 4MZ1A 3VM7A 4AD5A 1QWGA 1L2QA 3H12A 3UP8A 3ZXWA 1LTDA 4M7SA 1AODA 5D8ZA 1X98A 1JD9A 5DCEA 9CGTA 1I45A 4KFPA 3N2OA 4FXJA 1P0BA 1W3TA 3FA5A 3GTXA 1OY0A 1XIHA 4JDYA 4QROA 3XISA 3ZJ6A 1YW1A 1VFLA 3DBNA 3HMCA 3RMEA 4A6GA 5GJNA 2VFEA 3VM5A 3EZ4A 4UOJA 4QRNA 1WYIA 3QTPA 3UWQA 4WD0A 3SUVA 5LGXA 4ZA0A 3E5BA 1E3XA 4B5UA 2V2HA 2OVLA 3HQPA 5HNNA 3IJDA 1JYWA 1OVDA 1FHLA 2GSHA 1EHNA 2GJLA 5T9BG 4PUWA 1VGAA 3GG0A 2E6AA 5AKQA 4H6RA 2D3LA 3O6YX 3FJ6A 1L6YA 5DN1A 3WLKX 1SMAA 5I3KA 4JHMA 2C8NA 2PGEA 3ARQA 5IBXC 1KM6A 5C9UA 3C3NA 1GYNA 3H7VA 4ZL1A 1CGYA 3WNOA 3ARXA 4NAEB 5BRBA 3PZ9A 4Q8WA 5CJNA 3JU2A 3W02A 3A5VA 2V5LA 4YVXA 2PZ0A 3TQVA 1C8YA 3LZ3A 2DP3A 2VRJA 1KCLA 2QUVA 4FNTA 2NUWA 4L9ZA 3TWAA 2O4QA 3B0YA 2VR5A 4J40A 3FK4A 3R0UA 5MHBA 3N6JA 2EG6A 6TIMA 1DJGA 1FQ0A 3W86A 3RDKA 3HQNA 1JYXA 4FA3A 3HPAA 3SZ8A 1IXPA 1DKWA 2EKGA 4P2VA 4UIOA 2D69A 4HQVA 2V82A 3CUZA 8A3HA 4WDTA 2ZYFA 4JX6A 3RUBL 4LY8A 3T8LA 3I7SA 1C9WA 2IUZA 3AS1A 4JYDA 1XLEA 2PRHA 3JR2A 4GZ7A 3IPWA 4HSNA 1VJSA 3WO8A 3W24A 1M6JA 2G37A 3L0NA 1K02A 2TODA 4XAPA 2BNJA 1E9IA 4HA0A 4XO6A 1EKOA 3UR8A 1RPXA 3LXCA 5CSSA 4R27A 4J28A 4CEXC 2G5WA 4CGTA 3ITYA 1QHOA 3N6HA 3T44A 2NVDA 1LT7A 1XQKA 1EZWA 1QW8A 2J78A 1YHTA 3BANA 1KWGA 1A49A 2PWFA 1YDYA 3URQA 4KWOA 4YHGA 4C6IA 4CVUA 2NX3A 3B8TA 3DFTA 4RUBA 2F2HA 3MBFA 4W7VA 1AQ0A 3N3MA 3EX4A 1TV2A 4DM1A 1XG4A 3MP3A 4CD4A 3PZVA 2E67A 1TV7A 2UWFA 5G4HC 5XIMA 3OA3A 1G7UA 4YXGA 3D47A 1RCXB 1XLHA 2YA1A 3S83A 4YS1A 3QKEA 1P0DA 2V38A 3W29A 1R3SA 4IGSA 3WQGA 1POJA 2PTWA 1ALDA 2HNEA 2ACQA 6A3HA 4Z42C 2QPSA 1S5VA 1EL3A 4CU7A 5CBJA 4W5ZA 3R8RA 4CQBA 4CNOA 2WQPA 3OA5A 3CK5A 4CQ8A 2Z1VA 2CKSA 4I6VA 1ISZA 4E4FA 2YW4A 3K30A 4E3TA 1WDSA 4NJGA 3NQ6A 1EQCA 4WZHA 1Y5WA 4L1GA 4L7ZA 1S3TC 2OEKA 1S2WA 2VHLA 4P8WA 3NJ3A 1Z42A 1W31A 3S5YA 4FB7A 1OWQA 3KHDA 3PK7A 4TTGA 3P8JA 3ZJ8A 1HJSA 2CHRA 3KTCA 4LQ1A 2FTPA 1E1CB 1UWUA 1X6UA 1UZHA 3PG8A 3SW6A 3G1FA 2PWHA 1IV8A 8RUCA 4IQEA 3RJXA 3ZR6A 3HPSA 4DI8A 5C71A 3N4FA 4Q8TA 4O8AA 4L61A 3V36A 3DAQA 2EPMX 2QQ6A 3GDKA 4L64A 1V6TA 1GTHA 4M6QA 3WMCA 3OG2A 1V3MA 1SMDA 4IP7A 2XIQA 3W7MA 1SZRA 2CLLA 3QEZA 1QI2A 2ZZ6A