1TWZA

Dihydropteroate synthetase, with bound substrate analogue ptp, from bacillus anthracis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DHPS, Dihydropteroate synthase
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 94
structure length 266
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1twzA00
1TWZA 4CCZA 4O0QA 3TYDA 3TZFA 3H22A 2YCJA 3H26A 3MCMA 2Y0FA 1TX0A 4NL1A 2Y5SA 4S3DA 3MCOA 1AJ0A 3MCNA 2YCLB 2YCLA 4DJEC 4NHVA 2DZBA 4O1FA 4D8AA 4DJFC 4MWAC 1Q7ZA 3H21A 3K13A 4DJDD 2VEFA 3TYCA 3H24A 1AJ2A 1Q7MA 1AJZA 2DZAA 2OGYA 2DQWA 4G9PA 2BMBA 1TWWA 2E7FA 3TYZA 3H23A 3BOLA 2Y5JA 3H2CA 1AD4A 3TZNA 3TYAA 2YCKX 4D9PA 4O1EA 3H2NA 1F6YA 1Q85A 4DJED 5JQ9A 3BOFA 3TYEA 4C1NA 4DJFD 1Q8JA 4DJDC 4MWAD 4DAFA 2VP8A 4S23A 1Q8AA 3TYBA 1Q7QA 4DJDA 3TR9A 3H2OA 1TWSA 4NIRA 4S38A 2H9AB 1EYEA 1TX2A 2H9AA 1AD1A 3H2MA 4DB7A 4NILA 4S3FA 2YCIX 4S3EA 4S39A 3H2FA 4MWAE 3H2EA 4C1NB 4DAIA 2VEGA 4S3AA 3V5OA 3H2AA 3NOYA 4D8ZA 4DJEA 4MWAB 4DJFA 4MWAA 4S3CA 3TYUA 4S3BA 4HB7A 4PZVA
chains in the Genus database with same CATH superfamily
4GNKB 1D9EA 4ZXLA 2P1FA 3H22A 3G1FA 1O94A 1W1ZA 3M0YA 3PJWA 4EPDC 1TR1A 1XLMA 3RLHA 2VGGA 3GDLA 3NSMA 3UCDA 5FJIA 1IZJA 1O1ZA 4DI9A 4ZMGA 1W3NA 4ROQA 4P7LA 4MNJA 3FFSA 4UR9A 4GO9A 4AIUA 4J3SA 4GXWA 2X16A 3CEPA 3W7IA 1REQA 2O7QA 1IGWA 3RRXA 1S2VA 1O60A 3EA2A 1GW1A 4JTRA 3SN4A 1ZS2A 3LY0A 3VDGA 4DO7A 4XG1A 1DJIA 3WIJA 2OKTA 4DN1A 4CNTA 4EAMA 4F66A 1C7TA 1JZ3A 3VO0A 2GGJA 2PDHA 1EO7A 4LS2A 2CZEA 3N2MA 3WLTA 5A8QA 3UP8A 4NASA 1JCXA 1Z41A 1EQPA 1Q6EA 1W54A 3W24A 5HAOA 4OUIA 4MOZA 1MQRA 3VD9A 3EX1A 1FA2A 3BJTA 4JR5A 4HZMA 3F2CA 1OIFA 1MMFA 2OKOA 3U3HA 1K3UA 1PPIA 3FNDA 3GHTA 4DBUA 4PMUA 4UZUA 3GR7A 5LNVA 1XM3A 4H6EA 4PUJA 2PDXA 3BQ6A 2Y0FA 2QCMA 1OJXA 1TX0A 1JZ7A 3NTYA 5C6MA 4OE7A 3A23A 2A3AA 1US3A 4KCUA 2ISSA 3SCUA 3SSZA 3W27A 1ME9A 1NU5A 3NYZA 5FCZA 4MJ2A 3WJYA 4UBPC 1W8SA 1NP0A 2WAGA 5CQ1A 4ATWA 4OV4A 4PTMA 4N9CA 3FSUA 3VK5A 1U5JA 1JCLA 1WDWA 2H3DA 4BI7A 3WCZA 4MMWA 1VFMA 3AICA 1B30A 3N2BA 2CZVA 1OCBA 3TJXA 3WG6A 2YW3A 2PTYA 1B1YA 3ZR5A 2JKEA 2YL6A 4HHMA 5MKGA 1Q8JA 4ZODA 2E40A 2F9RA 5DBUA 3S1GA 4HOZA 1W9UA 2BOGX 3NG3A 5BOOA 3H55A 4J35A 1GTEA 1DHKA 1E3ZA 2TYSA 3ISIX 3GFZA 4DBWA 3MANA 4YTUA 3H8AA 4QX4A 4QNEA 3PM6A 2UY3A 4QFUA 6TIMA 2HE5A 2XFRA 1I8JA 1EHNA 3RM9A 1O95A 4MWAA 2VI0A 1VFFA 1G0CA 3T2OA 1H7OA 1XL9A 4LAUA 3HQOA 2WNZA 3BLIA 1G67A 2G97A 4YTRA 2OYLA 4AZ5A 1PXGA 1ZALA 5CJMA 1H7RA 4Y2WA 3OG3A 2PC8A 2XGBA 1TPB1 4DXXA 4UNIA 1FWIC 4UTJA 3C86A 3WQFA 5C2XA 1NFBA 4KFOA 1PKNA 4DF1A 1KBKA 2NXIA 4P8WA 4GBDA 4I7VA 4IIEA 8XIAA 4A4AA 2E5DA 2QMKA 3WF4A 1JJKA 1PTAA 3W1PA 3ARZA 3B4YA 4J1OA 3VD7A 4YJ5A 3Q4DA 3PTMA 3BAKA 2DT1A 4GYPC 1TIMA 3KVJA 1EEPA 2VC7A 1FX6A 4B5TA 5FEXA 2VP8A 3W7KA 2QCGA 4HPNA 4ZOCA 5D33A 4HBKA 3WYZA 4MUPA 3L5LA 4X60A 3S2LA 4AWUA 4YTTA 2PWGA 1XLIA 2IUZA 4O28A 4PMDA 1VPYA 1YPFA 1XBVA 3YPIA 2D24A 5TNVA 4S3AA 1D3HA 2EGZA 1EJXC 3UWWA 3D6NA 3PTQA 3DERA 1HGWA 1XR2A 1EGZA 1E43A 2KX9A 1FWSA 3N6HA 1XF0A 1EGMA 4Z1BA 1XV8A 2FKPA 1QCWA 2PRHA 3BE7A 3G24A 4IIBA 3AHVA 3OP2A 1GUVA 3STPA 5DRCA 4AUBA 3ZYZA 1KTNA 3MZNA 3MV11 4ALDA 1EXBA 4Y9NA 1WO2A 2A7NA 1Z3NA 5HJLA 5LZLA 1AJZA 1UASA 5HNNA 3UWYA 2YJQA 3TONA 3W1TA 3F03K 4YIWA 2HPMA 3CL6A 4W8AA 4ZO7A 1BAGA 4H8UA 1W32A 3C3NA 3REQB 3P62A 3VCRA 1K7XA 1NDVA 3PBWA 4RW3A 5EKYA 3RK8A 1I75A 4ACYA 1OK4A 1NP2A 1S2AA 1L8PA 2G3FA 1Z48A 3TVAA 2Q09A 1Q8AA 1WDQA 3GXTA 3EDDA 5ABTA 1J0YA 1E40A 1PDZA 4O17A 4E4UA 3MZ2A 4XZWA 4H2HA 5J5DA 1S5NA 1C7SA 1JPDX 1KW1A 3CHVA 1KBBA 4UFKA 4C1NB 1EX5A 2PWFA 1GZJA 3SGUA 4O1CA 1BXCA 2WCSA 1UC4A 2OELA 4F8XA 5KETA 5J5RA 2WMGA 5GNYA 1HVQA 4XZBA 3QTPA 2E5CA 4AEEA 1OINA 1VPQA 4FAMA 1VJSA 4K8EA 4HB7A 1KM3A 2Y88A 3CTLA 4NAEA 4IGHA 3W7GA 5BMWA 1QRQA 2W66A 3LOTA 2WMIA 5BXTA 2VFEA 2DIKA 3IVUA 1WAWA 3TJ4A 2EPKX 2X2GA 1FCBA 1TSIA 3RXZA 5AC4A 1EYWA 5BXPA 4RXFA 3NEHA 5JBDA 4JL2A 4HU0A 3VKBA 4Z17A 3UA3A 1A5OC 3TW9A 2ZUNA 3W2KA 3R12A 4HHLA 4K1WA 2VXNA 1RY8A 1JDEA 3BH4A 3RF9A 1WCGA 3S1WA 4WK9A 3VMOA 3PANA 2ZX5A 1GW9A 3G77A 4OOZA 3TZNA 5DCEA 3WF1A 1UUQA 2DV0A 1P48A 2G50A 2QLYA 5E9AA 2WKGA 4UTWA 2ZQ0A 1Q3NA 2R9RA 5D37A 4G7FA 2PDPA 3FLUA 3IPWA 1TV7A 2DZVA 3NL3A 4US6A 3ECQA 4OBSA 3H2OA 4MNKA 5LNWA 2P88A 1OYBA 1JAEA 2DVXA 4UFJA 3WD4A 1UKOA 1XIEA 4HU8A 1BXNA 3PBGA 3AXHA 1ME8A 3CC1A 1E5JA 1XYFA 1TQXA 3IEBA 4GNVA 3IV8A 2DW7A 4JIRA 4UQ9A 4M7SA 1RUSA 2FFCA 4U2ZA 3C3UA 2BXYA 2QJIA 1A5CA 5JIPA 3O0FA 1F6PA 2J13A 1ITQA 3KS6A 1E1EA 4B16A 4EP8C 1U5HA 3W75A 3U4FA 3URQA 1I45A 3DFQA 3EPMA 2PLMA 3P5ZA 4RJEA 3BICA 2BHZA 1ZRQA 4GXPA 4X9YA 4G2DA 4C6EA 4J40A 1FH8A 2DZUA 4XK2A 2ZFAA 1KXHA 1EC8A 2RJGA 3WELA 1AODA 1P1MA 3LHUA 3V3WA 4B3LA 2OEMA 1PWMA 4IFKB 2XIIA 1KRAC 5HMFA 4MB4A 2JALA 4C6NA 2P8CA 3NUKA 1UR0A 5D9NA 1VYPX 3QKEA 3FDKA 1V5XA 1RBOB 2AQWA 3SADA 1V3HA 1SW3A 3RMEA 3KXQA 1PVNA 3NURA 1E3XA 3LZ5A 3PBYA 4GQBA 1AZ2A 2C71A 3WD1A 3VKCA 5REQA 2CZFA 4DY1A 5H8MA 2B31A 1CDGA 1TX2A 1J10A 2H6RA 1G4TA 4OUEA 4IGNA 3KCJA 3F2DA 5EMUA 4UQAA 1SJDA 3E6EA 1OABA 2NV9A 4QNWA 1FWAC 5CLWA 5D05A 2I9UA 4NXKA 2WM1A 3S5OA 3BANA 2XN2A 1OX4B 2J47A 1Z69A 3ERPA 3CT7A 2GSJA 3OHIA 3M07A 3QY8A 1DJHA 3FN9A 2VHLA 2WC3A 4GQGA 5DY3A 4BY3A 4XIAA 3KRZA 2R8WA 4R7JA 4JQ4A 4RPQA 4ZOEA 2OYKA 4JKLA 2GQ3A 1Q4WA 1XH1A 1KGUA 1YBQB 1MNSA 4KFNA 3FV9A 3OVQA 1E6SM 4Q4MA 5CKSA 2WZIA 2Z1KA 4BEQA 2DZWA 3R0UA 4UTMA 3AMLA 3EDFA 4JHZA 3EMZA 1W6TA 2XYLA 1W9PA 1AH0A 3VDCA 4Q8OA 4AZBA 4ZQOA 1DXFA 3DHUA 3B8IA 2TRSA 3D3FA 3IIPA 2V0TA 3WQDA 4AXKA 1ZB5A 2WCGA 3L4XA 3T09A 5DXYA 1TWSA 1R9XA 1H3GA 1WKEA 4D6JA 3AALA 3G0UA 2LLEA 5CGQA 2BSLA 3IV3A 2Y8KA 4QLLA 1LDCA 1EHAA 3V1PA 4NILA 4TVCA 3SRKA 4PTWA 4TVUA 1OEPA 2C3ZA 2ONEA 3GWQA 3MC5A 3ZM8A 2WNQA 1BFNA 4QCFA 2A3EA 3MUXA 3G1RA 1KTCA 2CLFA 3WL0A 1Q6QA 3M6YA 2I5IA 3I3BA 4EKJA 2BHUA 1LG2A 4OKDA 1TG7A 4O0QA 1JGMA 1MQQA 2DVTA 2YBVA 1FWCC 1TPVA 1WZAA 1BG9A 3MPGA 3SCTA 4JFSA 4IL0A 3V36A 2IXVA 1ZHAA 3FIGA 7PTDA 3T6CA 3WFAA 4O15A 5I06A 4FNUA 1TREA 4GCAA 3ABSA 2CITA 2ZDSA 1GVOA 1XFBA 3EMCA 2R1KA 3CIWA 1KXVA 1KV5A 3UXDA 2XVKA 3QHMA 3DDMA 4DPPA 1QK0A 4GNJA 3DYOA 5GNXA 1R9YA 5CC5A 3HB9A 1J0HA 3NEVA 3SZ8A 4AIOA 3EMQA 4GYFA 3UQNA 3V0TA 4GZIA 1KCKA 1TE1A 2PGEA 4AYSA 2Y5EA 3TDFA 5LKYA 3VPLA 3ABQA 2HQAA 2G96A 3H4GA 1E51A 3AZRA 4ZE4A 2OEKA 2UY4A 3SAZA 4IPPA 1IQ8A 3ARSA 2BFGA 3ZMRA 2C1HA 2QUVA 1NEYA 2ZIDA 2PUZA 4H3DA 3CMGA 3WD0A 1NFGA 5I3FA 3HPZA 3POHA 2ZX6A 5I78A 4WXYA 5EGRA 4IXHA 2EPNA 1XQLA 3O1NA 1YIXA 5BU9A 2OQYA 1V0NA 1Q6CA 4Y7EA 1TB3A 4FX7A 4DEFA 1TPFA 2QUUA 2FPYA 2VDHA 5CJ5A 1A5BA 3UGVA 3GC2A 1S1PA 1O1HA 1V6VA 4UB9A 3GDBA 4JX5A 1CLXA 4HA1A 1W3TA 1V8EA 1TTIA 3B9NA 3VCCA 1W1A1 1TUXA 2QAPA 2DSVA 1XRTA 1UMYA 1XYCA 4AIBA 4E6MA 1K02A 3B40A 1TJ0A 2BX7A 1JZ6A 2VD8A 2XFYA 3W7RA 3PTKA 1QW8A 1T40A 4L6DA 2CNCA 1LWHA 3Q45A 3VIPA 3M0KA 9RUBA 4IM4A 4I9JA 1R3QA 2DZAA 3CQKA 3SCOA 4WSJA 5C8BB 4I5RA 3CQ0A 1JF5A 4RE2A 4NZ1A 2YCKX 1DVJA 1KXQA 1HVXA 1O6IA 1TA3B 2V5KA 3G1VA 3QGAC 4Z08A 4KIEA 3L4TA 2OOGA 3IIOA 2KAUC 2UBPC 4LUTB 2AL2B 4CD8A 1EJVC 3TW6A 2E68A 3EXRA 2VELA 3KCLA 2PDLA 1W9VA 4J4KA 4DZIA 1MW1A 1OFPA 1YDYA 5C54A 2JEPA 2AAMA 4GI6A 2J7HA 2YW4A 3S46A 1DHPA 3IGHX 1TV2A 2IPJA 1QNOA 3G1DA 3ANYA 1B5TA 4AISA 4X63A 1KTBA 4E0CA 4IG2A 4H19A 2CBIA 6REQB 4RZBA 3BO9A 4UOQA 3T05A 1PO9A 3L68A 3M43A 2PAJA 1XUZA 4AWTA 3ZR4A 4JQAA 5KINA 2GWNA 3O6CA 4Z42C 1A3XA 4US5A 3CZGA 3GHSA 1H7NA 3H6OA 1ISXA 3VIMA 3GVGA 2VGIA 2NQLA 4RNHA 4GPNA 4DJFC 4JNMA 1P0DA 1REQB 3W87A 1XIMA 4GI9A 4MDPA 2B7OA 3A5FA 4LBSA 2XJ7A 3KRBA 4KW2A 4BKNA 1MEHA 4FX8A 1A4MA 3DGRA 2VENA 5DANA 3DKLA 1ITCA 3FGCB 2WM0A 1A5AA 4CQ9A 3IIXA 4HNLA 4I3GA 2FMNA 3ZO9A 3R25A 4ZZ9A 2E6FA 1UKSA 1R87A 2PD5A 3K4DA 4AFYA 1FDYA 3PP7A 2I16A 3KBJA 2VD9A 3E49A 4UXDA 3OOQA 3JW7A 4L80A 2WBKA 4K36A 3DG3A 1R5YA 3AYSA 1AD1A 4KEZA 3GNDA 2E25A 1QXLA 3SCSA 1UUMA 1FUYA 2XHYA 1SUXA 3WK1A 4JTLA 2VEPA 5FKYA 3OZOA 1JCMP 1EX1A 1GG1A 1XRFA 4OWGA 1C3FA 2I1OA 2VL4A 1ITUA 1J18A 4UNKA 2D23A 3KL5A 2AOSA 3CUZA 4HYRA 3ZJ7A 1TJ1A 2DFAA 5E6YA 3V0UA 1IV8A 4W8BA 5CZSA 4DM2A 3GHRA 1DWHM 3WLLA 1XIFA 1H7WA 3ZR6A 4D6FA 4JTKA 3FJNA 4L56A 2XIOA 1OF6A 1VEPA 3FAWA 3W1MA 3THUA 3HPSA 4GZJA 2A3BA 5LA2A 5DEZA 1Z6KA 2PLKA 4WJEA 4C6PA 4K7YA 1K9EA 3QFWA 4M6PA 1UH4A 4JYFA 1X1ZA 3QY7A 3K8KA 3S8HA 1UH2A 2DEPA 4YMZA 5F4SA 3S6TA 5A6TC 2E6YA 1BYDA 2GSHA 4IJBA 2GQ9A 2WHLA 5MKGB 2OXNA 3OQ8A 4KERA 4E8CA 4JEJA 3QMTA 1W5QA 1RCXB 4AXNA 2BVWA 2XIBA 3IJ9A 2WJFA 3WLOA 1CXLA 5CSUA 5M3WA 3ANUA 3DHPA 5LIWX 1N7KA 4Z0JA 2GQAA 3S42A 3H4XA 3WDJA 4CVWA 5C5YA 1ADOA 1U1JA 4WDTA 5LNUA 4ATDA 4CNNA 4MLJA 1NH6A 1BSLA 3UJFA 3ITVA 3CHFA 5AB3A 2C13A 1FWRA 3U5YA 1R9ZA 2OZ0A 2YDAA 4JTIA 3NOYA 2W79A 1Q45A 2MNRA 3W23A 3OGSA 4AZ6A 1B90A 1JFXA 4MWAB 4PFHA 1IEXA 4F0HA 4P7OA 1CGUA 1EF2A 3PHAA 4NZFA 2Z1XA 4C6OA 4TVDA 1KM2A 4NJJA 3AMGA 4DWSC 2W0UA 4O57A 4J2MA 1V0LA 3H4WA 3HN3A 3LK6A 1JRCA 3KUMA 4RDWA 4K6AA 2IQTA 3MCOA 4PB4A 3U57A 4WHBA 1VHNA 8RUCA 2ZUSA 3P14A 4NNAA 3UCCA 3W1NA 1M41A 1KBLA 1J5SA 3W85A 3BGGA 4J7RA 1F6KA 4M8UA 1S3HA 1VS1A 1SR9A 2VCAA 2PWUA 3PY2A 5CGMA 3CHCA 4WDWA 2DQXA 1GQLA 3TYEA 1HFBA 1XYLA 3GZAA 4X2RA 1JCJA 3HV8A 5HJYA 1KNWA 3GYCA 2GPTA 4X9SA 2J77A 2WMFA 2YXGA 3VI2A 2H8XA 5AY7A 2AQVA 3H2FA 1Q63A 3MP5A 3CEUA 3WH8A 2XUCA 4QE5A 4PRWA 4PUEA 1SR0A 2GGIA 5HATA 3W84A 1ZP3A 3KVMA 1EDQA 3TWAA 2P76A 1GOWA 3PAOA 3S5YA 2Q3OA 1QBAA 5AZ1A 1VIZA 2EAWA 3MYPA 2RGLA 1PIIA 1M53A 1NQ6A 3CV6A 4Q8VA 1W3LA 5MF5A 3TQVA 1Q6DA 4GQRA 3SFWA 1B3WA 3R94A 3W00A 1E6ZA 1H7PA 4JTEA 1AJ0A 1YLVA 3XINA 3MB9A 3VNIA 4CD4A 3G0XA 3N1AA 3VYLA 2XGIA 5G4EA 1GT8A 1OGGA 1OZQA 2V3EA 3TTQA 4U4MA 3P61A 2IPGA 2QDGA 4QJ5B 4DWDA 1FKXA 1RBLA 3JU2A 2CBJA 3WBAA 3STFA 1OFAA 1J2WA 2PDGA 3WQOA 3FVMA 2Q8LA 1XLFA 4Q22A 5HDRA 3TIMA 3RJXA 4M51A 2MUCA 4PMQA 4HTYA 3GAYA 2VDGA 5GJMA 3ZT7A 4E3VA 3A3HA 5A8MA 4NNBA 2NQ9A 4WVXA 2OWWA 5C2GA 3W70A 3L4YA 3I6RA 3AUOA 4ZXOA 1G7UA 3Q67A 4ZQCA 3T2QA 4Z2LA 4PULA 5FJOA 4AH7A 2QDDA 1X96A 2ISFA 2PWDA 2GUBA 4JHOA 1R6WA 4MNMA 2C79A 2OODA 4C7GA 4KCTA 4LEFA 2ANUA 2V3FA 3OB8A 5DX7A 3DFTA 5LGZA 2CLOA 1EKOA 3AIRA 3WLNA 1SW7A 4GIEA 4LY8A 4F9JA 2RUSA 2VVNA 3T2PA 4IH3A 2DZSA 3RM4A 1QPOA 5CBJA 3KFTA 3LQLA 2I57A 4NAEB 5T91A 1LBMA 3B05A 2BVDA 3EOUA 3HFTA 1FHLA 2WMIB 3C2YA 2EXOA 4ZB2A 2WCAA 4FOJA 5FL1A 2Y7GA 5BXSA 2A4AA 4MFEA 1XDMA 4BK9A 5DMLA 2ZZ6A 1NQKA 1XLLA 4H9VA 1S1RA 4LS0A 1B0IA 2WVVB 3W1XA 4G8TA 4IX2A 2QJGA 3U48A 4AD3A 2QPSA 4WKFA 3BAWA 5DMYA 3IS4A 3LXBA 5TD4A 3SSJA 3WNPA 1NIUA 4PTVA 4WQ6A 1PZ3A 5I02A 3BLPX 1D7KA 1UPPA 1DV7A 2A3CA 5LYRA 4WUIA 2IXUA 4LGXA 5CSYA 1UW9A 2XINA 4LYPA 3IJ7A 1E0TA 1R3VA 1GNXA 4FLOA 4GY0A 4CKQA 2PDYA 4EX4A 2Y89A 4I6VA 3CH9A 3EKGA 3IK4A 4Z2JA 4L1GA 4KEMA 2YA1A 2FFIA 4IJRA 2E8ZA 3AXIA 3K2GA 5I6SA 3K46A 1UJPA 4NAFA 3UR2A 2F6XA 3RYSA 3CPRA 4KQNA 2ZE3A 1MQPA 3WQ6A 2FGLA 3ZS4A 4L65A 5TIMA 4DIAA 2IKJA 3P2VA 1HKKA 3SB0A 3SY5A 3QQWA 1XDJA 1VFSA 2E09A 3C0SA 1YMYA 1SSDA 2ADAA 4R7OA 1FP8A 1LOLA 4RNIA 3R13A 1C8VA 4G56A 3R89A 3HMCA 3E12A 5T9BG 4FNPA 4DQWA 1HP4A 2JF6A 3EZ4A 1DJYA 3PPGA 3VKDA 3DI1A 3UZWA 3UWVA 3CJPA 4DF2A 3R10A 4RUBA 4WDUA 3B8TA 2V6AA 2HXTA 2YL5A 3D3AA 2GJXA 2PDJA 3ZWSA 4RE4A 3UR7A 3GR4A 3KWSA 2VRJA 3KBSA 3RO6A 4I7UA 3EXSA 1EJTC 4O18A 4GIRA 3RLUA 3QPYA 3WQWA 1KR0A 3UT0A 1QBBA 4OJYA 5G5IA 5CZ0A 1QHZA 3G1YA 3PTDA 3W26A 5CGTA 4KPLA 1PTDA 3UR5A 4YNGA 4LC6A 3WMCA 1E6RA 1MVYA 2FB3A 3MP4A 4S3EA 1AUSL 3I4EA 3SRFA 4PGLA 4O1DA 1ZFJA 3NVTA 1P0KA 2FQIA 1SO3A 2D0FA 1DWJM 1I0DA 1I1XA 5A6KA 1W9BM 5G1YA 4KIRA 3W7EA 1US0A 2YKKA 4H9TA 5JH2A 1V3JA 1F76A 3FX4A 2NLYA 3W02A 3PNZA 4AU0A 3A3XA 4M3PA 1IIGA 1HL2A 1WBJA 3B9OA 3CQJA 4TV6A 4XZIA 4CNPA 1VENA 3DXIA 2VZSA 4Y8EA 5A6LA 4UUIA 2OFJA 4I9AA 4MWAC 2ZXQA 1ZZMA 2Z27A 4IUOA 3UY7A 3TOPA 3BOLA 2DIEA 1J8VA 5FF3A 2E4TA 1AD4A 3OLDA 1ISZA 1IXNA 3SCPA 1O12A 4D6GA 5LA1A 4BF7A 3W01A 5JQ9A 6ENLA 4GYKA 4O50A 2NLIA 1ICSA 3QKZA 2J8FA 4UFLA 1CLKA 5EA9A 4LAKA 3BQ5A 1KFLA 1HJVA 2DSUA 3FVDA 5FEWA 4Q8NA 4IL2A 2X1TA 5HJXA 3BLKA 3IGUA 4CD7A 3NZGA 3DC0A 3ZQ9A 1ZGDA 1N82A 4H9XA 4O0KA 3OZYA 4FF7A 1V6XA 3AOFA 2DZXA 3VD5A 4GUFA 3NQEA 1NF0A 1O5KA 4KGJA 2VR2A 2WV8A 2DU2A 4K39A 3FK4A 6A3HA 2QGHA 1GG0A 5BRBA 1HKIA 3MUCA 1EH9A 2EPLX 1NWUA 4DO5A 3ORWA 3MUAA 1Y5VA 3H7VA 4LW7A 4U10A 3MJYA 3B06A 3TP4A 4F0MA 1PX3A 2I5QA 2NZLA 1VJZA 3GXFA 4R34A 5CCZA 3CGTA 1LLOA 1X38A 1X8CA 1K6WA 4Y9AA 5T26A 2QV4A 2GK1A 1HF6A 4DZHA 5CAHA 4JYEA 4KRTA 2PDKA 2QF8A 5A1AA 4PC8A 5KZEA 4TXEA 1V3IA 3VIIA 1FWNA 3FOKA 4I9MA 5EBUA 1L6YA 1QT1A 1W1TA 4Q7NA 2PE4A 4LEQA 2DSWA 5I79A 5FF4A 1TV3A 1VFHA 3MUY1 2OPJA 3HGRA 1AL8A 4NX0A 1ML1A 4M7TA 4IOTA 4P61A 3GNOA 3NR0A 4HA3A 1J6PA 1E15A 3PSVA 3CYVA 3DIPA 4G6CA 3TJIA 3LG3A 1JDAA 3CUXA 4AB4A 1I2RA 2QMJA 4NJKA 3N34A 1W5PA 4UFIA 4GCXA 3LD5A 3W82A 3WUEA 2YA0A 3M46A 3O63A 3GNPA 4GA8A 4LOCA 1O4UA 3F2BA 3E38A 3LGDA 1R47A 1QW7A 3Q37A 4NP7A 1DWIM 4HN8A 4W87A 1I2NA 3LXCA 5FEZA 3L0GA 2YZ5A 2Q8ZA 4JX6A 2V5BA 4MPKA 4IIDA 3T8LA 2QCHA 3BLEA 5U4NA 1YX1A 1EEXA 3CH0A 1OCNA 1OD0A 3OPSA 4EWND 3TLQA 3NQ6A 3AS2A 5J04A 1HKMA 3I6TA 2ESCA 2F7FA 4MYAA 3QLDA 2P8BA 1S2WA 2BWGA 4ZTYA 2E5BA 4R5EA 2WHJA 5KMYA 1W5MA 3OZPA 1CGVA 3OVGA 5A6SA 3HPXA 4NJIA 1YTEA 3CZJA 1BQGA 1I60A 3TLLA 5DMNA 1IZKA 2A79A 4JTJA 3PZQA 1DTUA 4X22A 3ZXWA 3E0WA 2WNNA 2X0HA 1GOMA 1KRCC 3TOYA 4QEHA 3PZIA 3M0LA 4UTWC 2W4XA 3BK0A 2GL5A 2ACUA 1EOMA 4UTTA 1V7YA 1B31A 4ATLA 5CG7A 4CN6A 4LVGA 4A22A 4JX4A 3RR4A 1EJUC 4FXFA 3S1UA 1KFEA 4HCHA 3D5HA 1DWAM 3JUGA 4Q8PA 4MG4A 2WNWA 2OWCA 5I3JA 2IQ0A 1C8QA 2RDXA 3KVKA 1CI1A 3KBNA 5C2CA 3VZXA 4LX4A 4PFMA 3GDTA 2B81A 4W7UA 3UJSA 2O9TA 4PB3A 3RILA 2QF7A 4YL2A 1GJUA 1ISYA 2UWFA 2QPXA 1UCWA 4PBFA 1E9IA 5D2WA 5FF0A 4ZVJA 2X8RA 2AKMA 4YU1A 2DSZA 1H61A 1F6YA 3ARQA 1GOXA 3GKAA 2PC4A 2XTKA 4Q3MA 3COTA 4XO7A 4QQUA 3IAPA 3L23A 1GYNA 4QSHA 1WOAA 2OWXA 3TYBA 5JH1A 3M1ZA 1E1CB 3GE7A 4LV4A 4GKTA 1WDDA 2J4GA 4DXVA 3GUGA 4LSBA 7XIMA 2G41A 4W85A 3T1GA 4ADUA 4MDOA 3EWWA 1XKYA 2Z29A 2VEGA 1D2KA 2H3BA 2J7CA 4EACA 2AGTA 3RMJA 3S5SA 2YGYA 4YWSA 4K7VA 4D8ZA 1F8MA 1ISWA 1R3SA 3IJDA 1F3TA 3AXMA 3WLJA 4W4QA 3NGJA 4PODA 4L9YA 1M6JA 1EOKA 3M41A 4F0LA 2FZ9A 4PCPA 4OQVA 2OLAA 3O6AA 4CN1A 1HIZA 3W37A 2TPSA 5DO8A 1GHRA 4W88A 3N25A 3QLLA 3W7CA 3TXVA 1S39A 5E93A 1KKRA 3WLHA 3LV6A 4C90A 1Q7ZA 2ZUMA 1K4HA 2YFNA 1F2JA 1M3UA 3MBFA 3P3BA 2PDQA 4RR4A 3WLMA 3W0KA 4YPJA 3P6LA 1JCNA 3FXYA 4A35A 4HMCA 1LUCA 2HMCA 5C9XA 4AF0B 2AGKA 2XFFA 1VFUA 3OVPA 4B2DD 3NYDA 1WKYA 1TWDA 1R2SA 1Q2SA 4UTHA 2PF0A 2FZNA 2J7DA 3F5LA 1TE6A 1W31A 3VNKA 2GJRA 2EPOA 2PP3A 1OB0A 4QEEA 2CCRA 4J27A 3QOMA 4ADSA 4ZL1A 1PIFA 4LVDA 3E3HA 1LJYA 4MLRA 3WNOA 2YCIX 4G1NA 5D30A 1I1WA 1OT1A 5I24A 1C8YA 4Q32A 2WSRA 2HSAA 4GQ0A 3QV8A 2G5WA 4K68A 2ZZ4A 2XVPA 3RCYA 2PTZA 2YDSA 3W2UA 1GYMA 2ZRVA 1Z42A 4PH6A 2OYMA 2IQDA 3USZA 1S2UA 2QJMA 2J7BA 1J9YA 4RK8A 2PI6A 4QAIA 2EBNA 3N14A 1T5AA 1JYWA 3N4FA 3WK2A 3THAA 5G1MA 4NSBA 4QG6A 3M5XA 4Q6XA 3UG8A 1EBGA 2WOQA 3LCWA 3VDHA 1LQ2A 4A05A 1PEZA 2J7GA 3CL7A 3ZVHA 3W2LA 3QXBA 5CZTA 4JKKA 3HQNA 4IP5A 3AO0A 4WKHA 4J3UA 3OA3A 5KTLA 3BW2A 3AIEA 4ZOAA 2WO5A 3B8VA 3SQLA 4MB1A 4AVOA 5CPMA 1QW9A 2DY3A 4UWMA 3CIVA 4JHMA 3PJUA 3ATZA 5A2CA 1V6WA 3VUPA 5C9ZA 2XDFA 2V38A 3PJTA 4BFAA 4DWSD 1F4AA 3EWCA 1F3XA 1X98A 3AAMA 2FHCA 5D03A 3MI2A 1R85A 3MSYA 1HJWA 4Y9OA 2VX4A 2ZRYA 1XCFA 1P0BA 3PWIA 2FMOA 4ROPA 4WOQA 5M17A 3C5QA 2PGFA 5HR7A 4BI6A 5LIUX 4AD0A 1T99A 1QWGA 5HUPA 4IF2A 1G7VA 1YTDA 3WJXA 3Q65A 1J0KA 3RX3A 2JE8A 1ONEA 3PBMA 2YA2A 2ACSA 1E1FA 4HKPA 5TF0A 3SURA 3NPXA 4QDPA 4QTGA 1I6NA 1VFOA 4EPBC 3EOLA 3REQA 4TMBA 3U2OA 4PTDA 4LU0A 4HK6A 3BAYA 1CB2A 4BQ4A 4CGTA 5CBIA 3QJAA 2BVTA 3MO7A 4U31A 5IDZA 1TQJA 3OHMB 4IPJA 1JF6A 2W27A 2DQWA 5IXEA 2VQUA 4YTSA 3DBPA 4NX5A 4NRRA 3VVGA 5BCAA 2CHOA 4HCLA 4O14A 1JI2A 1MZRA 1IXOA 1NVMA 3GXNA 4F48A 4C1NA 2PZNA 4JQ2A 3TXZA 3T9PA 5DXXA 4HNTA 4FALA 3F4NA 1ADSA 4IFOA 2VGBA 1GVRA 1F3WA 3M0XA 4TX6A 1UD2A 3URNA 4F79A 3WN6A 3UNDA 3UPBA 2IW0A 3ARRA 1RPKA 2FHBA 2ZYFA 2Z2AA 2E28A 4O12A 1XP3A 3SCWA 1DPMA 4W9TA 3UGRA 2PEVA 1V93A 1V3MA 2OJPA 1I2QA 3VGGA 1NDYA 4HMEA 8A3HA 3UYIA 5I5RA 2VEIA 3VIHA 4PEKA 2VR4A 3ARVA 3E74A 3PVFA 1J2BA 1W2PA 3A4JA 4PUWA 1OCJA 1MEWA 3FDGA 4BF5A 3A4XA 5JVLA 3O2LA 2P0IA 3MT1A 3W81A 5D02A 4E38A 3WF2A 5AVHA 1C93A 4O8AA 1N55A 1K9FA 3QY6A 1VD6A 4C60A 1XIIA 3VMNA 4BHYA 1UBPC 1XCWA 2XH7A 4AC1X 2JGQA 2JIEA 1VPXA 4N9DA 3JVAA 1KM0A 3C8NA 4Q8UA 4H41A 3IK2A 3NM3A 2ALDA 4H9YA 1HQTA 2PDWA 4ZEPA 2WKLA 4INFA 2VO5A 3D46A 2CZDA 2XZ7A 5EMJA 1FY6A 4KEUA 2ZVIA 1ZJIA 1E6XM 5CH9A 1UD4A 5HWMA 1H1ZA 1JEZA 4V33A 3PS7A 3S2JA 4PTNA 2ZICA 3OEXA 1KFBA 3HO8A 4J5NA 4NIRA 3UJ2A 3GXPA 4WX2A 4LCSA 3HTWA 2CETA 5BWFA 2V8ZA 5EPDA 5L6UA 1PX8A 4D6HA 3AIWA 3G8RA 2FZMA 2ZX9A 2ZXDA 1MNZA 4ZQMA 4B5WA 1XLCA 1W1B1 1MDRA 2FJKA 3V16A 3L67A 3NIYA 3VDAA 2UY5A 3ITXA 1LQAA 3MUZ1 2O4MA 5A6BD 3GXIA 2BHYA 3RR1A 2PDCA 4AC7C 5A3HA 5A6MA 2D0GA 1DIKA 1HNYA 3LMZA 4H1ZA 3UU0A 1AH3A 1DJZA 1OQFA 1HX0A 5HMEA 3SI9A 3F4VA 4Q6JA 2XWEA 2ZZ1A 4GC4A 3OU8A 1TJRA 2FGBA 2DIJA 4E2OA 5AHEA 3ES8A 3RJYA 2V3GA 1W8GA 3KX6A 2BY1A 2R82A 4NYUA 4DJDD 1UZDA 3GTNA 3WJWA 2OZ8A 3C6CA 4B5SA 5BWAA 1PUDA 1WUFA 2GJXB 4O1AA 3G2GA 1RBAA 4F0SA 2DJLA 4HK5A 3MY9A 1ZL1A 1W91A 2X1UA 4C1LA 1BEUA 3WENA 5A2BA 4HYWA 2XSAA 1L6GA 3SUTA 4Y96A 3T81A 1UA3A 2CLMA 2HVMA 4BCEA 1LP6A 5AYZA 1SPQA 5DF0A 5LIXX 4MFDA 4TX8A 4GUHA 1PDYA 1TV5A 5I77A 2JKPA 2PRMA 4TOQA 4DI8A 4JCLA 1D8WA 4WXZA 3V5FA 1GJPA 3B9AA 4H00A 1V3LA 4MGGA 3FYPA 2POZA 5EY5A 3N2TA 3A9BA 4XKYA 1T7LA 1R7AA 2R1MA 3TC6A 3LPGA 4R53A 3AZSA 4KCVA 4LRTA 3XISA 3H7RA 3T55A 3T07A 4F2UA 3WKZA 3G8EA 1TTJA 1K8CA 3N18A 1E73M 5HNRA 3LEPA 2OQHA 1UPMB 1BGGA 1WXYA 3W38A 1SW0A 3VUSA 1EJ7L 3NWRA 2Y5SA 4V1XA 2VEMA 3GC5A 1ZLPA 1B3XA 4NHVA 1YXYA 1A50A 2ATSA 4O53A 2XM2A 3BV4A 1R46A 3MHUA 5D8WA 4TU1A 5HBFA 3H70A 3M0ZA 2JEQA 2QGYA 3GSMA 2E7FA 3MDUA 1F07A 1A53A 2Y5JA 4OT7A 3TSBA 1SVDA 4H9ZA 3ME3A 5BNKA 3IIVA 3KRUA 1XRVA 4JS3A 4FLRA 1D7FA 4HPXA 1DE6A 4WY0A 3VMPA 1PSCA 3KL3A 3A22A 1N8FA 2NQZA 1VRXA 4GFIA 1D3GA 2BGSA 2Z28A 1JG9A 3KCOA 1CXKA 1IEQA 3E9AA 3LSCA 3TR9A 2CLKA 5BW6A 2OVLA 2J27A 3TJLA 3HURA 2DUXA 3CWHA 4Z1DA 3UZZA 1KV8A 2CBVA 2NT0A 2NUYA 1EPXA 1MEIA 3EXTA 3VZZA 2WMHA 3H2AA 4MJMA 1EGVA 3U5UA 3UA4A 3BTNA 2CESA 5DCDA 4LUSB 2O9PA 1R2TA 4IMGA 1KRMA 1TCDA 3NL5A 2YYUA 1GJWA 3FW6A 4PMOA 3PWAA 4I8DA 1LL7A 3GDMA 1P6BA 1YPIA 4PN2A 3BDKA 5K4XA 3MBDA 4JY9A 4M19A 4S3KA 4QITA 2J74A 3TQ0A 4TMCA 1CPUA 3RU8X 4WIWA 1YHTA 4JICA 1FFQA 1QI0A 4I7WA 2NQJA 3P8IA 4XV0A 3KLLA 1OHLA 3C56A 1A80A 3AIBA 4CU8A 4LH8A 1PB0A 1FXPA 1H62A 2Y63A 1Q4NX 4U5KA 2WSQA 4H4IA 4A8RA 5M2FX 3VKAA 3EOEA 3B03A 1E0UA 2FGZA 2WHKA 3HBLA 1JYXA 3P7YA 4JN8A 5JBFA 3W7HA 2YLLA 3WQGA 3UR8A 6TAAA 3PPCA 1RY0A 3N2XA 3KRSA 1G4SA 1UQYA 3AHZA 3ATYA 3VNDA 1QAPA 4YVXA 2DORA 4UOJA 1DQWA 3LGEA 1Q6LA 4I90A 1IR1A 4XBJA 3NSNA 3QEZA 1HL9A 1RJRA 5LIKX 1LTDA 1UBSA 2OU4A 3LX9A 1HJQA 4S3FA 4PCNA 2O92A 2ZRXA 1TVLA 1M03A 4IQDA 1Q6FA 4JTTA 2ZRUA 5CPSA 3CBWA 4D1IA 5AN7A 1OZMA 1IWPA 3GQYA 8TIMA 1OX5A 4TUFA 5A6AA 2BBFA 2F2HA 4S3GA 1FCQA 1W5OA 2G3IA 4IQLA 3IACA 3L9CA 1EP1A 1H4PA 2OSYA 3H26A 2WANA 2J8GA 4JL1A 3ICJA 3GZ3A 4GLEA 3AUJA 4K8HA 1XUUA 3IJ8A 3BJFA 2VCCA 2X05A 2BY2A 1FWBC 4UQDA 1XYAA 1P5BA 3UF9A 2PP1A 3TTOA 1XYZA 5BRQA 3VIJA 1CCWB 3HGSA 1HJSA 2HPIA 4S2CA 4PEEA 3R43A 2W62A 3IUHA 1AL7A 1KKOA 4J3TA 3VGEA 4MY8A 1O68A 3PG8A 4UMAA 1HKWA 3PAJA 1XD0A 3FEMA 4YWIA 3KTXA 1JPIA 2INZA 2C0AA 1R2RA 1XH2A 4Q8MA 4CQAA 1UC5A 1AQHA 3NQBA 3LZ3A 1GKRA 3OLEA 3TE9A 3TNOA 2A6NA 5D09A 1MW3A 2J6XA 4MKSA 4JQ3A 2XFWA 2PS2A 1MZHA 3G5EA 1H5VA 2XIMA 3O07A 3UZJA 3EWXA 4LNCA 2Y8VA 4XISA 3CQHA 4YS1A 4EPKA 3L66A 2OZTA 3R6IA 4HYVA 3DENA 3GG0A 3SCQA 3II1A 4HJFA 4CU6A 5HQLA 4AZGA 5A94A 2WJZA 5K9DA 3NQVA 3OIHA 1WOBA 1J96A 2R1NA 3PB0A 3QRHA 4LWWA 3L65A 4J3XA 3K1DA 4KWSA 2WVUA 1QWKA 4H9UA 2V5JA 3FGCA 4KH2A 5HMSA 4JZ5A 3MJMA 1QPRA 3OYXA 3TUUA 3M0VA 1EA0A 1JQVA 2GJPA 5A69A 4IGMA 3ANVA 4L64A 3RFAA 3C61A 5FL0A 4C7FA 1TZZA 5AVNA 1C91A 3TA6A 3ENLA 3WQCA 2BZNA 4HK7A 1KM4A 3AI0A 3T4CA 1BTCA 5AC6A 1GWJA 2C18A 3H23A 4CCDA 3DHFA 4EXBA 1EJSC 3MVIA 5DLCA 3QHOA 1G4EA 5L9FA 1JL8A 2E1WA 1KFJA 4C6JA 3WK3A 1LT7A 3U4AA 3TKFA 2Q6ZA 4MKNA 2RDTA 2VC6A 1R30A 2HK0A 4NUWA 2VC5A 2ZRWA 4PCFA 1BKHA 2GGHA 3IARA 4ZGYA 3W73A 3F4WA 3BWWA 4M6VA 1W9DM 2CC0A 1M7JA 3JS3A 5BOFA 1J79A 2NWRA 3PPFA 4AD1A 4F4RA 3OW1A 1IT8A 2QCEA 2Q02A 4LYKA 3BAJA 2ODOA 4A3HA 1XLEA 3OO2A 1ONXA 1Y65A 1DIEA 1E0XA 1VFLA 1F61A 3KOXA 1L9WA 2CLLA 2D2JA 2CW6A 4AX7A 3DC8A 3GH7A 5F1UA 2QCFA 3NQDA 2WWDA 3W28A 4GACA 4RNJA 3NQFA 3BC9A 1GVYA 3HGOA 3MMTA 4LBUA 5FF7A 3TYCA 1EWEA 4M1BA 3GDRA 1PYMA 5ENLA 3KHJA 4QISA 1LUCB 3BGAA 3DKJA 1IR2A 2CPUA 3LHYA 3EOOA 2CLEA 3UWUA 3SN1A 4C6IA 1SMAA 2AMGA 3T42A 1H51A 3NNTA 3BOFA 2QVHA 4XAPA 4TV5A 4O16A 4AD5A 2JKAA 5D8ZA 3LHZA 2ISVA 3SN0A 4U5IA 1Q7QA 3KLKA 2CERA 1OYAA 2F2KA 4UR8A 2UY2A 1Q6OA 1EWDA 3CM4A 3UJEA 2XVGA 5JMUA 3QC3A 1JCYA 1AQFA 4NYYA 1GQKA 1QI5A 5F2LA 4ZE5A 3TN6A 2YOCA 3WSUA 4ZB0A 3AMKA 5XIAA 2HV5A 4QDMA 2P5NA 1RCOB 4P8VA 4W93A 4FNTA 5IM51 2QCLA 2ZXBA 1XW8A 4JFTA 1LYXA 1YNPA 5DFAA 3FKRA 3UWEA 2A21A 3UNTA 1UWTA 1KQZA 1SO6A 3W7MA 3WEMA 2GZXA 1ZCCA 1ZJBA 4IIHA 3MMWA 3VGHA 4PMRA 3KBVA 3DAQA 4TO8A 4GO8A 4N0RA 1ZBVA 3E5PA 4A21A 4JFVA 3U6WA 3CHEA 3VGBA 1Q66A 3UFYA 1DXEA 4HMNA 3OODA 3ZVHB 3WUBA 2CKSA 1GGOA 4NQ1A 3CMJA 5D32A 1JGIA 3LBCA 4GMEA 3TCSA 1POKA 1U83A 4V27A 1H0IA 3U7BA 1F4HA 1WDSA 2X2YA 2EKGA 4FEZA 3HOJA 2G4JA 1K1DA 1I2OA 1QPNA 1KBJA 2GWGA 5EBAA 4O1BA 4WY0F 5LSMA 1TPUA 3QBUA 2ZZ2A 4EVZA 4P2VA 2YL8A 3M0JA 4B4HA 1AW2A 4HA4A 4YTQA 4DBEA 3WDPP 1MUWA 1TJ2A 2WYSA 3WNKA 3O16A 1H41A 4PUDA 1RH9A 2JF7A 3LB0A 3PZOA 4UQEA 2YFOA 1UOZA 1VLIA 4Z1YA 1VJIA 1E0WA 2GOUA 2GGEA 3N73A 3HV9A 1LRTA 1XLDA 3ZJKA 4C1KA 3NPVA 7A3HA 2ZWZA 4CVUA 2W63A 5I3DA 4UOZA 4O13A 2HROA 1OFRA 4HGXA 2CLPA 3DH7A 3N29A 4XZNX 1O7AA 1EXPA 2V30A 1UWSA 1C8XA 1A5KC 2DH2A 5EFDA 3QF0A 2PWHA 1LL6A 3LGGA 1K9TA 4BJHA 2O4QA 3ARUA 3ARYA 5CZKA 1EQCA 4F0KA 2DUAA 1KM1A 5CZJA 3E2QA 1TMHA 8XIMA 3UERA 4JN6A 2BMBA 2Y8UA 3W1RA 2XG9A 3QV6A 5CC7A 1HO1A 1XYMA 3W7LA 1FWEC 1LCOA 2YCEA 4A8IA 2FZDA 1UROA 2ZADA 4W86A 1ZAHA 1Q85A 3M64A 1R3YA 1HN1A 3QGVA 4GE8A 4IIGA 1M04A 2RDWA 5AKQA 3QW3A 4P7NA 1EDTA 1LLWA 2G95A 3WQPA 2AKZA 2AMXA 3SUSA 1CGTA 2DVUA 3HJEA 4W7WA 4GI4A 7ENLA 4JEQA 1RPXA 5JXQA 1JXKA 3VOJA 3E5BA 4IMFA 3LPFA 2CWNA 2OLSA 4N6FA 3AWNA 3TTEA 1R86A 3RU6A 2P3ZA 3FAXA 5BYWA 3TYUA 2Y7FA 3S0CA 2WVVA 5E5CA 3QHNA 4XD3A 4ZR8A 1IF2A 1YYAA 1JRBA 4DF0A 3WF0A 2PPGA 1ZY9A 2NVCA 3AYTA 1DQXA 2QHAA 2YDQA 1A0EA 3EWDA 4B92A 4FZIA 3GFYA 3STEA 3MP3A 4UTTC 4S2BA 3EX6A 2QPUA 1X97A 1OFOA 2DP3A 3W2MA 4G9PA 3SW6A 2OQLA 3FYOA 1UWRA 3NXLA 5EMMA 1CNVA 4JTAA 4Q4RA 2DT2A 1FH9A 3LLFA 1MDLA 1CEOA 4GKLA 4EIVA 4YN5A 4BQ5A 1EIBA 1E56A 5HWJA 3LHVA 4FPSA 9XIAA 4E8GA 4GY1A 2WLYA 1ONWA 1BKSA 3K8LA 2NX9A 3DUGA 3ITYA 1KRBC 1BVWA 2FH6A 1M01A 3QV9A 5AHNA 3VX1A 3K30A 1UZ4A 3HQ1A 3WMBA 1G6CA 2IKIA 4JTUA 3PSWA 4LS1A 4E3TA 4NZCA 2I17A 2Y24A 3A24A 1AVAA 5EYWA 3MS8A 3ZSSA 3AU6A 4L6OA 4GHRA 3NQMA 1J6OA 1DBTA 3QMRA 1P1XA 3APTA 2Z6IA 3PUDA 5ABHA 3KW3A 1U1UA 4MIMA 1LWIA 3LI1A 1J12A 5K7JA 4ENLA 1ESWA 1B9ZA 3CPGA 3GXDA 1V51A 1Q13A 4O52A 2I14A 1ENUA 2CXEA 3H21A 4F2BA 4W8LA 3GR8A 4HMDA 2D69A 4AZ7A 4AMAA 3WQEA 1HGYA 1ZPTA 3TFCA 4W84A 2F6KA 1I9CB 1B3ZA 2HEJA 3WFLA 2IS7A 5HPOA 1EUAA 3I10A 3SY8A 4L5ZA 1QHOA 3LERA 4XVEA 2QS8A 3VINA 4KT2A 3UXKA 3L4UA 1C92A 2QDEA 1VLWA 5D2TA 2V69A 3UW6A 2W9MA 3N9RA 5HXMA 1WXZA 1XLAA 3K4AA 1MRAA 4OFCA 4R7WA 1IXPA 3UETA 5CAKA 3MMDA 4PCSA 3GB6A 1AQMA 2E6AA 5F4WA 4X61A 3RUBL 4WJXA 4KRZA 3WDQA 1HG3A 3IGSA 1WNOA 2PCEA 4XKYB 2VZUA 4HZ6A 3MI6A 2Q01A 4EE9A 4DYKA 3M16A 1JIBA 2TODA 2HE8A 2OG9A 2NQ5A 4NVTA 3TR2A 1CX9A 3G3MA 1BTMA 3UXLA 1UYQA 1PJ9A 4W7VA 3BLLA 4UQBA 3T08A 3W6YA 1TKKA 2PLJA 1PZ2A 3V18A 1EO5A 2VGFA 5FJTA 1VRDA 1BVNP 1IEWA 2X30A 1H50A 4C6LA 3FHQA 3GUWA 4BR1A 4GJJA 2ZTJA 4LB3A 2EJAA 2CZ5A 2ISWA 1MYRA 1XWYA 3BJSA 4MY1A 3DG6A 4PCTA 2FTYA 1BYBA 1EZ2A 3S6OA 1SZEA 1DOSA 2Y61A 4FX6M 4AZIA 1SU5A 4N6EA 4WY0B 5T8GA 3W7OA 4QLJA 4HJWA 3HF3A 3OGVA 4D6IA 4PL1A 4GWEA 4DJED 3VABA 3NSXA 1S46A 2VCBA 2WSYA 1OF8A 1UHVA 4DUOA 1T96A 3PFMA 1VHCA 1B4KA 1NSJA 1DYSA 2RDUA 1XIJA 3TWBA 4PUNA 4LVBA 5I0DA 4C6FA 4B9YA 3DI0A 2YPIA 4KGLA 4FNSA 4B2DA 4EPEC 5F1VA 2V81A 1ZQ5A 4MF4A 2Y6ZA 3MQTA 5H2ZA 1FCVA 3S1VA 1E9ZB 5LNRA 2WMJA 4H7VA 4UR7A 4W5ZA 2WVTA 2QUMA 3O8AA 1QASA 3EA1A 3GIYA 4KWVA 4UQCA 5E6ZA 1JCTA 4H6RA 1G4PA 4HHHA 1XIGA 1O5RA 2QJJA 1XSKA 1XG3A 2QAFA 4O54A 3GU2A 2EG8A 3LRMA 4HSNA 3W6LA 5HWNA 5I23A 3K13A 4QQ3A 3FJ6A 2OX1A 3BARA 3A64A 3EEGA 3VE7A 1AG1O 3G22A 1XYBA 1CT5A 2F84A 1QDSA 3INPA 1EZWA 1W37A 4GZEA 2VZVA 3VD4A 3A3WA 5CJNA 2ZCGA 1EJRC 2PB1A 3BV7A 4FNQA 5IHSA 1JDCA 1C9DA 3WD2A 1UR8A 4RV3A 4HNUA 4U2YA 3VD3A 3GX9A 2NXHA 4B91A 3M5YA 2JGYA 3L7RA 2GVJA 1E72M 2BS9A 2A1YA 3L5AA 1AH4A 4CD6A 3EWBX 4XAZA 2PFHA 3LMYA 1JPMA 3UBPC 3VIOA 3C0JA 4WKAA 5H6HA 3SCRA 1YE6A 1AZ1A 5XIMA 1KLYA 4AX6A 3QR1A 2AAAA 4DZ5A 2HS6A 3ZIZA 4BWLA 3NZQA 5B80A 3DFSA 4D6CA 2FJUB 2P0OA 3V35A 3M0HA 5G2HA 3U2CA 5I2UA 1LRQA 3HMJG 1QNSA 2F61A 2XIQA 3WO8A 4Y9PA 2OSWA 3NCOA 4DBDA 3CLWA 1RV8A 1XPGA 3SJ3A 1UD5A 4QS6A 2DJXA 3WUGA 2A7PA 2E8YA 1IE7C 1R38A 3QZEA 5AYBA 1BD0A 2PRLA 1M9HA 2D2OA 3NQ8A 1QR7A 3RPMA 4N4QA 2PBGA 5F7UA 1ISVA 3I65A 3GFXA 4IGSA 4JBRA 3RLGA 2D22A 3A13A 1TYGA 1RSCA 1FWHC 2BV9A 1BXBA 4N9BA 2PTDA 2GVLA 1RQHA 5XINA 4MKVA 5HPCA 4WSKA 3W76A 2O55A 3VCNA 4JDYA 5AC8A 1VYRA 1UIPA 3W88A 3T78A 1PX4A 4D8LA 4QE4A 4IP7A 4OIFA 4NZ4A 1K7EA 3N9SA 4MTVA 4CNSA 4REQB 1RQBA 3WH7A 4QSFA 2XSBA 1I0BA 2E9LA 3BZJA 1V79A 1ECEA 1FWGC 2Z7KA 5IOBA 5TAOA 3NQAA 3R8RA 1OK6A 5CBBA 4DXKA 2POTA 2GVGA 3R4IA 2ZE0A 1F7BA 3CB8A 4NKCA 1TTQA 5J8LA 2TMDA 4KEVA 1W9XA 3BCDA 5I07A 1HO4A 3A21A 1E4MM 4X2PA 4RZ4A 3EGJA 1E1CA 4DYEA 3P84A 4GX8A 3TH6A 1EF3A 1LOSA 2VURA 3B9EA 5CEWA 1V02E 3GTIA 3TAKA 2PCQA 1KR1A 3VFCA 4BF9A 1DJQA 1E55A 1G1YA 1A3WA 4WR3A 1S5MA 3WJSA 2QJNA 3GRIA 1UG6A 4UTUA 2QT3A 3IUIA 4K38A 4A2RA 3S5NA 3S2MA 3P5YA 3HQPA 3WQ8A 2FHFA 2YB4A 3L4ZA 3W1LA 1ZBCA 1P7TB 4TX9A 3W1UA 1TPH1 2VEKA 3H2EA 2VFGA 4KRUA 2YB1A 3CK5A 4QJ4B 4AYGA 6CGTA 1SFSA 4ACZB 5HINA 4N02A 4GOAA 3MWCA 2SFPA 2ISDA 1XISA 2IMRA 5IFPA 3FEQA 3GAKA 4JKMA 5LIYX 1T0OA 4ZTXA 1FH7A 3T0DA 2QCCA 1SJBA 2PTWA 3W1QA 4AF0A 4FMVA 1SO4A 3A5VA 1TRDA 2X7VA 4NI8A 5KZDA 4DLMA 3NOEA 3NL6A 4I5UA 3URBA 1DE5A 5A6BA 5M03A 2VR5A 5ABFB 3G18A 1TFVA 1TPC1 2VFFA 1HJUA 1J11A 1SSGA 3IVTA 1B3OA 4O1EA 5B7YA 2NV2A 3GNNA 2J78A 3IANA 2NXGA 1SJAA 1EPVA 3O7UA 1O5QA 4ECLA 1DWGM 1XGEA 4G7EB 2J62A 2ACQA 4PA8A 3KWXA 3KP0A 4ZA0A 1VZWA 4GBUA 3DG7A 4DJDA 2PWVA 3S83A 4QAWA 3VILA 4G1KA 1NWSA 3GNXA 1KM6A 5CSSA 3ZT6A 1FRBA 5K9CA 3FJ4A 4M81A 3N3MA 1E6PA 3P0WA 1KCXA 5JU6A 2TSYA 3KOZA 3D47A 2PWEA 2XH4A 2ICSA 2R94A 1W1YA 3ZLFA 4DZAA 3M44A 4K1GA 3P81A 3W9ZA 4XAGA 1EC7A 1GZGA 2E6DA 3AJ7A 4B90A 5HOSA 2HZGA 3GO2A 3K8MA 3BCFA 3MKVA 4GUJA 4QR6A 2PODA 1UR3M 3LBMA 2OT0A 3C0LA 3QSTA 4EF8A 1MI3A 1OFQA 1FHDA 1BG4A 3OGRA 3THQA 2UZ9A 3UZYA 3KTSA 4AHPA 4JFWA 5AC5A 4FSAA 2VZOA 3GY1A 4U33A 3SIZA 3IRDA 3H24A 5B7ZA 5K9XA 4PMXA 2VUYA 4TTUA 3GK0A 2YL9A 3U0HA 3N12A 4ZSUA 5IHRA 1RALA 3M6DA 1U30A 1Y5XA 3IGXA 1L6FA 3V0SA 1XHGA 4R33A 3NQCA 1UQZA 2DGAA 2X1SA 2FPVA 3DFYA 1TUFA 1K70A 1RXOB 1Z44A 2W92A 4MZYA 1LG1A 1GORA 3SCVA 3FHAA 4O8RA 2VRQA 5T9CE 1WZMA 2BB0A 3AIQA 3MA8A 4HZ7A 1BRLB 4EXAA 3OG2A 2OCZA 3ES7A 3S1XA 3AIVA 3W7NA 2Z1BA 3GTHA 2Z6JA 1H09A 4F0RA 3NDOA 5M5DA 2V2DA 4UMCA 2Z00A 3A47A 4L6HA 1WV2A 2X0YA 3N4EA 4WRHA 4AW7A 3SEPA 6XIAA 4KFPA 3BSHA 3GS6A 4CNUA 1JVNA 2BASA 3KZPA 3RM8A 1RJQA 3NFUA 2E3ZA 1JYVA 2VVSA 1OD8A 4LCRA 4L61A 4CEUC 4LAZA 3UCQA 1MXDA 2GDQA 3EB2A 4GIYA 2HVOA 4IZGA 5CPTA 2E67A 4F40A 5AHFA 3E0LA 4D6DA 5FSEC 4H7CA 4CUCA 2JIWA 1CGYA 3EB3A 3BW4A 3GTFA 3TA9A 4X3ZA 2HJPA 3W7DA 4AWEA 2D20A 1R7OA 1OC6A 1XXXA 2QUNA 2Y1HA 4IUGA 2YZRA 4ZB5A 2G8ZA 3QPEA 1W56A 1A3HA 2ZC1A 1X8FA 3RX2A 2W61A 1AW1A 1YPXA 5AYXA 4H9MA 1NDZA 3DOPA 4XUGA 3N2OA 3A12A 2Z1SA 2O7SA 1CW2A 4H6QA 2EEXA 1G9HA 1IWBA 4RE3A 4I5XA 1W3JA 1CLVA 7TIMA 2A6LA 1ODZA 1DWFM 1HT6A 1GONA 5DQPA 1PL9A 2Y70A 5HQEA 1WKDA 4A8NA 4Q4OA 2C1IA 3IVSA 1NFPA 3MI3A 1MSSA 1FFRA 1ECQA 1JXJA 3WLRA 2HBXA 1BPLB 3EPNA 1OX6A 3AMDA 3APGA 2ASHA 5BU6A 3WDRA 3B0XA 2XH0A 6PTDA 2DSKA 4B4FA 2BOFX 2R24A 2WSKA 1OM0A 3KHDA 1RA0A 3L4WA 1ZJAA 3O9NA 5I3IA 2PDNA 4KCWA 3RAOA 3PBUA 2DDXA 4XAFA 1WA3A 3HA1A 3CS2A 1TMLA 4A2SA 3EX3A 4JOMA 3OLIA 2QULA 4FOKA 1JPKA 1R8LA 4QG8A 5A2AA 1LM1A 3SIMA 3W07A 2VQTA 4EXQA 2QEZA 2ZZ7A 2F38A 2MANA 4A6GA 3F1QA 3CO8A 4RDYA 3VC6A 3APYA 1QNVA 2B7PA 4KBXA 1NTHA 4ML4A 1ZTVA 4GXMA 2BXVA 1A5UA 5BRPA 3DEQA 1FWFC 1PE1A 5KZ6A 1V02A 3VDBA 1UWQA 4E4PA 1VBGA 3LCGA 2HBVA 4EAYA 1G01A 1E4NA 1JAKA 3W7JA 5LA0A 3IAQA 3G6LA 1TMQA 2NUXA 1QPQA 4LYQA 1VKFA 3NDYA 1IEVA 2ABBA 4C65A 1OVDA 2NVAA 2NSXA 3QSRA 3RRAA 3NQ7A 2ON3A 4ZO9A 1H11A 3ZWTA 4PRTA 1UUOA 2I56A 3PZTA 3W3OA 4S3CA 5HNTA 5MHBA 4NT0A 4UCGA 3WLSA 2O0TA 1ZAIA 1JZ2A 2J9YA 4QE1A 1TR9A 4P7RA 2XM1A 3QQ0A 5H8PA 3LU2A 3ABOA 3AIUA 3VNJA 1Q2RA 2YR1A 1TCMA 3WL1A 1D8CA 4AHOA 2BXZA 3PUGA 4CCEA 4FXJA 1QNRA 2W67A 4PL2A 1V6YA 1TVPA 2ZZ3A 4NI3A 2ZWYA 1U22A 3PK7A 2V82A 3QR0A 3M4HA 1W2VA 2FH8A 3VU2A 3A4AA 4DVOA 3GG1A 3F4CA 5LHEA 1VEOA 4E2DA 4L1XA 1LRNA 2D2HA 5BMXA 3U2ZA 1PZ0A 3EAUA 4MM1A 2EKCA 5ABGA 4A29A 4ES4A 4JTHA 1YQ2A 2QZRA 3RX4A 5AYYA 1JR1A 4XIMA 1CENA 5D38A 3TN3A 1F74A 4LAOA 2P53A 3A6OA 1RA5A 1WX0A 2BODX 1LL4A 4GVGA 5CG0A 4QROA 2Y85A 2ABAA 2CHNA 3CLMA 2PU1A 2A2IA 5DT5A 2YX0A 1L2UA 3AWOA 2CXGA 4JIPA 3QW4B 3DGBA 3GVRA 1UP3A 5EFFA 3ITCA 1DJXA 4L4MA 2VDIA 5FIPA 3M0IA 1UA7A 1JYNA 2QNEA 1RLDA 4YHEA 1XIHA 2OT1A 3I3DA 3A4WA 4FR6A 2Z1WA 1OFBA 4NJHA 5AHLA 4Z0SA 3R0KA 4YYFA 4RL3A 5FJPA 4OV9A 3CAQA 4JPGA 3AJXA 3HIJA 1XC4A 1V08A 3W7PA 1IT0A 3EWYA 3LHWA 4S3DA 3U7VA 3N6JA 5F4XA 4HOXA 1PHQA 1VR6A 3OZMA 1WB0A 4CQ8A 3OTRA 5C9UA 3KBWA 3N15A 4GGHA 4LF2A 2I9EA 2X0SA 1PTGA 1RK5A 1DXIA 2PDFA 3LCFA 4Q4KA 4WOZA 1R0MA 3MWAA 4JGDA 4QDWA 4R27A 1JUEA 2J7EA 3UG3A 1XX1A 4IMAA 1LF1A 1ZP4A 2Q8XA 3ALGA 3BAXA 1J4EA 3HPFA 1E4IA 2E1DA 2D3NA 1GOKA 3LS9A 2ZXAA 1UWIA 1SM9A 4WGXA 4FB7A 4LUSA 3CZEA 3GW0A 4XQ6A 3WBEA 1L6WA 4CQBA 1H1NA 1N8IA 1B9BA 2PD9A 1RLCL 1JZ4A 4ASTA 1HKJA 4FA3A 4BQ2A 1B3YA 1VC4A 4MB3A 3W53A 1CGWA 1XFCA 2GFTA 3N11A 4PUKA 3T0CA 3CIXA 3VOFA 3UG5A 1EP3A 3PBVA 4ICMA 1I4NA 2XN0A 3WNLA 1E6QM 4B3ZA 3B0UX 2ZDRA 2PLCA 1QMLA 2P50A 1SZRA 4NL1A 4GABA 1VH7A 1CB7B 1TZ7A 3AXKA 4RV8A 3DECA 5DCBA 2V5CA 2X1IA 5IBXA 4DX3A 4W89A 1O5XA 3VOHA 4QGCA 1KGWA 4LAMA 2J88A 3CV7A 2WPBA 2WXDM 4KESA 3DHDA 2X7WA 4S3JA 2HRWA 5AHIA 4A3YA 1XG4A 2QXWA 4FXSA 2PURA 5JUVA 1FQ0A 3C52A 2D0HA 2ZRZA 3W1AA 4FR1A 2VNCA 1KFCA 1UP0A 4Z2IA 1W1IE 3TMQA 4ILSA 4JAWA 2ZX7A 5DMMA 3AS0A 5HANA 1YNYA 3AQUA 3WH5A 4YCPA 4UTFA 3R8GA 3TFXA 2Q3RA 2NWSA 4XD5A 5A8PA 2PA6A 1AFSA 3R8HA 3GDKA 5I3KA 4S39A 1IHIA 2WB5A 5EB8A 4IWWA 4YHGA 1ZJHA 3BG3A 2NQHA 2Z0IA 1GVSA 1MRQA 3I4KA 3LUTA 4C91A 5GJPA 3ELFA 4I8YA 2QJHA 4MYXA 3SGGA 6ALDA 4FHAA 4IQEA 4L1WA 4P7QA 4DWSB 4D71A 5FA5A 1F5ZA 3B0PA 1V0MA 1YNQA 1VCVA 3E0IA 4QJ3B 4GGBA 1KXTA 1LZOA 1AK5A 2FLIA 4KKXA 3OJGA 3C2VA 5D04C 2XH2A 2J24A 1IWAA 4LT9A 3WQ5A 4AZCA 3WMLA 1OYCA 3KVLA 1OT2A 1SMDA 1W1PA 5ABEA 3DCPA 4ORMA 1BYCA 2DZTA 2W91A 3EDKA 4DPQA 4N2YA 2INFA 3VNMA 1EA9C 3ITLA 4L9ZA 3GVVA 1TV8A 4NRSA 3ZT5A 3ZLHA 3SBFA 4ORIA 4Q4PA 2BLEA 1MW0A 5PTDA 4RZ6A 4L9XA 3WDIA 3W6MA 1UWUA 2PMQA 1TO3A 2FVLA 3NL2A 3WFZA 1TELA 3OIXA 2ZTKA 4NZJA 4IX0A 3MW7A 2YDRA 3CV2A 3EYPA 1M7XA 1CXFA 2CEQA 1BWVA 2AL1A 3SUVA 1FBAA 3AYRA 3NQGA 5LGXA 3BAIA 3LM7A 3NPWA 2C91A 4DLFA 1UH3A 2D2GA 3RCMA 4LVAA 3CPUA 3HG3A 4NY2A 3QC0A 3W7QA 3TTSA 2YCJA 3WLKX 2WZEA 1A0CA 1K8YA 3SJNA 1NOUA 3S3GA 4MADA 1GVQA 3USBA 1P6WA 2V67A 4DM1A 5CSRA 3HFYA 3R2GA 1F9CA 3MYOA 1VCFA 5FACA 5DN1A 5IFTA 2V9DA 3M5VA 2XGZA 4HZ8A 1GTHA 2B7QA 1D3CA 4B5NA 3FKKA 3N13A 1BVZA 3B9DA 3K4WA 3PZ9A 3WNMA 5LXXA 4UCFA 1UR4A 2EO7A 3ZOAA 2GGGA 5K2ZA 1I2PA 1R3TA 7TAAA 4O19A 1DKWA 3PF3A 4DJFD 1OIMA 2GVYA 4Q7BA 3BLOA 3ZJ8A 2WZTA 1OGBA 2GLKA 1PCWA 1RVKA 3VM5A 3W2NA 1UR2A 1V6UA 4JFUA 4CQDA 2ZX8A 3S9ZA 2P10A 3B0VC 3N2CA 3NDZA 3S6DA 1HL8A 5G4HC 3DESA 3IUDA 1LQ0A 3PR2A 4B5XA 1H63A 1K03A 5DBTA 1BHGA 4DUWA 4AIEA 4L4LA 3LI0A 1TPDA 3VE9A 3ONCA 3WX7A 3HG4A 3LPOA 1RZMA 4FNRA 4MPQA 1DJWA 1OADA 3R0DA 3WK0A 3G1HA 3WQ4A 1ZU8A 5C0QA 1L8NA 3QYQA 2A3HA 1VBUA 3KTCA 4A8LA 1ICPA 1EUNA 3SQSA 4A3UA 4HT3A 3AXXA 5M1TA 3TQPA 3NZ1A 3VXGA 1F73A 3UD6A 3WLQA 5FAJA 2VFIA 1MFVA 3T7VA 5G1TA 3FY1A 3OA5A 4LB4A 3O0KA 4UMBA 2QIWA 3M0MA 3R1ZA 1H0GA 1NJJA 2XVNA 3W83A 4PBGA 1W0MA 1U5VA 2RH9A 3ZVIA 2WJDA 5CC3A 2BGNE 3SECA 2VM8A 2WW5A 1OWQA 3WBWA 4GVFA 1C29A 3WLPA 4WF7A 3AS3A 2GJLA 3BLDA 3DU0A 1WP6A 5FJRA 4HSOA 1SFLA 4I9TA 2WHMA 1UD3A 3GH4A 1P43A 1H1YA 1EC9A 5AHMA 1ONRA 1J93A 4HP5A 5LNSA 3GG7A 3W74A 4RCXA 1E4LA 2NSOA 4MAVA 3P74A 5EU9A 4CU7A 4DNMA 1H5YA 1YW1A 2PDUA 1HKVA 3LCHA 3PWGA 4FK9A 1XKJA 1DIDA 1V7AA 2NX1A 1TWZA 3JR2A 3V7PA 4GG9A 1CIUA 1VYSX 1JDDA 3O06A 1EIXA 2G3MA 2R91A 4C6QA 1MXSA 4RDVA 2VT0A 3LPPA 1X6UA 1CYGA 5HA7A 1VBRA 3EEZA 4MY9A 5C7VA 1JPHA 3SR7A 1VF8A 5AYIA 4ZO8A 2GUUA 7REQA 2CKRA 1XCXA 2OR2A 3N6QA 2ALRA 1Y7VA 3KOFA 1QHPA 2A7RA 1QUMA 3A9IA 4AZHA 2BGQA 4HTBA 4C7DA 1V77A 3DFHA 4FP1A 4JTSA 4XUYA 3RDKA 3EDJA 3GVQA 1TWIA 5KSWA 3TX9A 5E0CA 1FHVA 3NVDA 4DNHA 1TIWA 5A8GA 1EB3A 2DZPA 1SFJA 1VP5A 3FSTA 4AD2A 5H91A 3G0SA 4LUYA 1J01A 3PFRA 1G94A 3O6DA 3SO7A 2QIIA 1N2VA 1ZNNA 4NXSA 3ABXA 3CASA 3MKKA 3QQ1A 3VOCA 5CPOA 4KWWA 4N7QA 4DJEA 2PDIA 1H49A 3E2SA 3N3TA 2OOFA 3S4TA 1RVGA 3HJZA 1OCQA 4XTIA 4M1RA 1GQIA 1XIBA 3NQ2A 3ITTA 3STGA 1QOPA 4E4FA 3L2IA 5EMKA 3BLFA 2W6RA 3LRKA 4UIOA 3VNLA 1S5WA 2IPWA 3OBAA 1EJWC 4PE8A 5GPRA 3AYVA 3SQMA 3QM3A 1T8XA 5D4YA 1FDZA 1GPWA 2YCLA 1XC6A 3FYYA 3FJLA 4LJ3A 4ICCX 2REQA 3CTTA 3FA3A 1DJNA 1PS9A 2RGMA 5H8UA 2OZ3A 4GH1A 3KBMA 5D2YA 5HNUA 1PV8A 1K4GA 3MKCA 4BWLC 3ARTA 3UYCA 1XLKA 2B7NA 3RLVA 3EKZA 4NG3A 3LNMA 5FJJA 3FA5A 2NVDA 3G1SA 4C6KA 1W1VA 2ZA2A 5I03A 2OMAA 3DYMA 1POJA 2WVSA 4S23A 3DN5A 3UPMA 2G0WA 3U9IA 4FLQA 3V5CA 4FS9A 3F4DA 4DO4A 3UXIA 3P93A 4RXGA 3GC4A 4HU3A 4AQLA 1Z7AA 3POCA 4B3KA 1TTPA 3WLIA 4K8GA 1FDJA 4Q8TA 1GEQA 1OBAA 4ADTA 3NAVA 3PULA 4FF5A 1VGAA 1ZBWA 4OZOA 3VNYA 3P82A 3SY1A 2XSXA 4K37A 4NNCA 4GISA 3I3EA 2HDJA 1B3VA 4O11A 4AEFA 4QP0A 4CCZA 4LALA 3OYZA 1LROA 3PZUA 1QI4A 4JNZA 4LUJA 4ZOBA 4JCMA 2R1PA 4NZ5A 4OVXA 3TQKA 1Q6GA 1YADA 3HU7A 2BG5A 3PZMA 4O1FA 4X0VA 4IQJA 3CXOA 3WY1A 3DX5A 5E0FA 1JNEA 3IJIA 3UVIA 3ITGA 2J9XA 1PYFA 1SZNA 1J5TA 2HS8A 1XBYA 4JXCA 3MO4A 5BZAA 1K8ZA 2XZ9A 3VKJA 2YIHA 2WWCA 3WBXA 1TPWA 5E0KA 3AMCA 1E9YB 2G3NA 5RUBA 1AW5A 1OFEA 3I68A 3KS5A 4GY7A 4WSHA 2G37A 2YLAA 1B57A 2VC9A 3JRKA 3Q94A 3TC7A 2HXUA 4FLSA 1EYEA 4OBRA 1XIDA 3W25A 3QVQA 4PB5A 3T0BA 4Z2HA 4LCQA 2ZA3A 3CL8A 1YXDA 4GJIA 3BMVA 3E0FA 2VWSA 4G5DA 1MUCA 5JIWA 2X41A 3C8FA 4OU1A 2J25A 2GUYA 1X39A 4M80A 4PUMA 4OHQA 4AAJA 2IKHA 2WSPA 4ZENA 4PSRA 2NUWA 3ZSTA 7CGTA 3QMSA 3V1HA 5AC7A 1LBFA 3AHTA 3L21A 3VA8A 2PZ0A 3AROA 4HCDA 1X1OA 2ZUVA 5CPNA 1RP9A 1NWTA 5HMDA 3TK7A 1Y5WA 4OGZA 6XIMA 3BMWA 1DTNA 5CXPA 5A6JA 2HNEA 5F2IA 1KO0A 3LA4A 4MUZA 4BA0A 3B97A 3AC0A 2ZKMX 3PUEA 4IXXA 3EOSA 3T4WA 1UR9A 1AJ2A 1JQXA 1TPEA 3L0KA 3V4BA 4LF1A 1PWLA 1GQJA 1KQYA 3ITOA 1TWWA 3RIKA 4E5TA 3GD6A 1XLJA 4FIRA 2WZHA 4ML9A 5GVJA 4LNYA 3KP1A 3HZ3A 4UTKA 2V63A 3DZ1A 2JBMA 3CWOX 3VOIA 3TSDA 2QQ6A 4PMVA 3SDOA 3LCXA 1CXIA 3ZJ6A 4DUVA 3VIFA 2VX5A 1PHWA 1LT8A 3H2MA 3KOYA 5A8NA 4JY8A 4ZQPA 1WZLA 1THFD 1DL3A 2QCDA 3WH9A 2ZC8A 1Z32X 3QH2A 4YVPA 4K3ZA 1B2YA 3TW7A 4Q33A 1BWKA 3LTYA 1QI3A 4M24A 1FKWA 1H60A 4DJDC 3WMSA 4PTXA 3Q2DA 1K9DA 3BOXA 4LY4A 4PMNA 5FI8A 1P0NA 3GKFA 2YXXA 1WDRA 4LFYA 1S2CA 4H8VA 3W72A 3GG8A 1JNDA 1SGJA 2KZHA 4Q8QA 3JZEA 3B8WA 1XQKA 1Q65A 1X6LA 4KMQA 2VTFA 1P0EA 2VX7A 1GOOA 1J0ZA 2JFEX 1P4CA 1XGDA 2VX6A 3ZFHA 3SUUA 4ICNA 1B54A 3UWZA 1T41A 3VIKA 3HG5A 2Z1VA 3UG4A 1EDGA 1U2YA 2F6UA 3AISA 2Y62A 3CB3A 4WEVX 4NZ3A 4UFMA 3PZGA 4D72A 4GYJA 4DO6A 4TR9A 4JDBA 1CBGA 3BUVA 3E2VA 4ZFMA 3MV01 4XO6A 3DFPA 2OO6A 4N4PA 1A5MC 4MWAD 3E96A 3LM3A 3CAWA 3BSMA 1QO5A 1W17A 3N19B 3QV7A 2VKZG 4S38A 3BSGA 1ODUA 5E1QA 4IICA 1YDOA 4DB7A 1AQ0A 4MB5A 2VFHA 4DYJA 1KBIA 3ONBA 3AU2A 4URIA 3RPTA 1V3KA 1E5NA 5REQB 2EG6A 2X09A 1OGSA 1ICQA 4S3BA 4F3HA 2Q71A 4MSSA 4H2CA 4EF9A 3NGFA 4ERAA 3VFLA 1UD6A 1XJBA 3KOWA 1E0VA 5KZMA 4Z1AA 3KDNA 4QG9A 3AZTA 4NU7A 5BOEA 3OLGA 4GZ7A 2HK1A 5HR6A 4HD5A 3U8GA 2O9RA 4J2PA 4IPNB 3QR3A 2E9BA 4YLWA 3ARWA 4Y9MA 3MUIA 4Q4SA 3UXAA 5I09A 3S2CA 3C4UA 1MW2A 2RFGA 1X7IA 1WAUA 1PCKA 4GRSA 4EWJA 1M7OA 3V75A 3TYZA 2HCVA 4IP4A 2ZZ5A 1MFUA 4F2TA 5FEPA 5GNZA 2FTWA 4J3VA 5FSDC 1YXCA 2WC4A 4NJGA 1L6SA 5ECUA 3GIQA 3O15A 3STCA 5F2MA 2CIPA 4LUIA 2VOTA 1E6NA 3G6MA 3O05A 3K1GA 2J6VA 1GPFA 2IPFA 2L5HA 2Y4SA 2H9AA 4Q4QA 3S5ZA 4HN4A 3H54A 1F05A 4XZ9A 4R9XA 4PYSA 3U2EA 4DELA 3V5OA 1QVBA 4IMDA 4F9DA 2W5FA 1CGXA 1KB3A 3S47A 2XISA 4TQTA 1CECA 2R1LA 3WDHA 2A3LA 3TNBA 3JZUA 2OLHA 1UKQA 1RD5A 3EB4A 4M5PA 5TQLA 1K6AA 4AZCB 4LBRA 3BVJA 5CPLA 2Z25A 3EDEA 4R3UA 2GDUA 3CYJA 2VWTA 3P67A 4GYPA 4UFHA 4U28A 3TN4A 4IPLA 2DW6A 4XSMA 4XVDA 4B5VA 2WKJA 3C2OA 4J3ZA 2HISA 3PB2A 5FD0A 5A8OA 1FP9A 1DQUA 5G4WA 3RG6A 2CYGA 2VRKA 4ZBCA 4DUXA 3CHDA 1PBGA 3GTXA 3CMFA 2V5DA 3RHGA 1QTWA 5AZ0A 3H2NA 5C7HA 1A47A 1C9WA 2XIJA 2H8ZA 3NZPA 4XAYA 1GYLA 3M5ZA 3SRDA 1DP0A 1WBHA 4JQ1A 3GVWA 3DFOA 4BEUA 3O6YX 4GX9A 1Z9AA 2CLIA 1QJWA 1PKLA 2CWXA 5I7GA 4REQA 3QFEA 1FCUA 3UESA 1XS2A 4TTGA 5KEZA 1PKYA 4LTSA 3L12A 3WUFA 1VCGA 3RGTA 1S5VA 1IT7A 4PZVA 4S1FA 3LLXA 3LRLA 4Q7IA 2V68A 4LXFA 3GBDA 2EPMX 3TU9A 2Z2UA 1V4YA 4M6QA 4U3CA 1KCZA 1FWTA 1LOQA 4BZYA 1BF2A 1P6CA 4ERGA 1GZ1A 5GJNA 3OBKA 1BQCA 2PDMA 3LNPA 4QRNA 3CZKA 2NW0A 3VM7A 4O0ZA 1E70M 3FCPA 3L0NA 2V2HA 5E70A 2EJ1A 2J8TA 3MU7A 3LENA 3PZVA 4IMEA 2P3EA 3R7MA 2WJEA 1UJQA 5F2GA 4WD0A 1P7TA 4DBSA 1C90A 1Z8AA 3QTGA 1F3EA 3NXFA 4FIQA 2ZUUA 3MSGA 4HVXA 4PR4A 3G1XA 1ZENA 4QLKA 5D2XA 4HIBA 4ACZA 3UJRA 4H04A 2WZMA 5FF2A 4UTLA 3TCEA 3WQVA 1YDVA 3GLCA 1WE5A 2PSNA 1LORA 1G69A 1UP2A 1HW6A 1NAL1 4QJ1A 4IHCA 1QK2A 3BW3A 4DAIA 2B4GA 2H90A 1R3WA 5K4ZA 1HZYA 4HNNA 3UZ5A 4M6UA 5DT7A 3LSBA 1GK8A 2WQPA 4JIQA 3GHUA 4H8NA 4AD4A 3F7JA 1XINA 1RQEA 4RNFA 1XH0A 1FTXA 2VFDA 1WYIA 8CGTA 3KE0A 1QNQA 1QO2A 3QPZA 1CTNA 4IG2B 2G3JA 1KWGA 2B0MA 5ABFA 3EPOA 5BROA 4RDZA 3M7WA 3MCNA 1BGAA 2WPGA 3B4UA 2OX4A 4V15A 1ME7A 1PIGA 4FXRA 2XU2A 5G2WA 1RHCA 4ZFCA 5A5WA 5JBEA 4HA0A 4G7EA 1A49A 2ZOXA 4PBEA 2OSXA 3QOKA 1FXQA 1GCYA 2FVKA 4AY7A 3RITA 3RCNA 4MHBA 5U7SA 2PP0A 1BF6A 2Y7EA 1XPYA 5D2VA 4WZHA 4EANA 2WLZA 2QVNA 1L2QA 2VJXA 3BZGA 1XRSA 2G4FA 2GSEA 2WK2A 3VZYA 4C5ZA 4P8UA 2DT3A 3P0XA 2ATMA 4GIAA 2BOEX 4V2XA 3T0AA 4TIMA 5I3HA 3MDWA 1JULA 4QHRA 3PN8A 1NY1A 5FOOA 4HPGA 3KL0A 3CT2A 3IRSA 3QN3A 4XZMX 1UR1A 2GJNA 2ZBTA 2Z26A 5HQMA 3VGDA 1GOQA 3L4VA 4Q8WA 3TC3A 2PU0A 2V5LA 1ADDA 2YBTA 3BMXA 3BGJA 3TSMA 3B8SA 4WDXA 1NOFA 2GVEA 3GU9A 5CPQA 3T8QA 3SRHA 3SFKA 2JQXA 3CQIA 3EX2A 3B8UA 4C6DA 1ALDA 1BSIA 4XD4A 1Y0EA 3LN3A 2BVYA 7REQB 3N17A 4D8AA 4QXIA 2FYMA 1S2TA 2BY3A 4H7ZA 2C6QA 2EG7A 4RLIA 4Y6GA 5HUOA 1XICA 3IJ6A 3NZRA 4DHGA 2J75A 1QOQA 2QCNA 3K5XA 1X6NA 4X0NA 4XZHA 4WCJA 3S2NA 4CN4A 1YRRA 1QATA 2J9ZA 3CV1A 2CHRA 1NM9A 1BRLA 4OOUA 3TYAA 1QPKA 1KFKA 3THDA 4M56A 3MHFA 4KWUA 1IZCA 1MWOA 3S9YA 3BXWA 3I7SA 2E9MA 2FDMA 5IBXC 1NOWA 3N04A 4KWOA 4Z1CA 3BG9A 3WH6A 5TBOA 3CUFA 2QKFA 4RKAA 3R58A 3VX0A 4ZQNA 3SM0A 3CAVA 1IEIA 3XIMA 3PG9A 3GIPA 4N9EA 1GEHA 1EL3A 1Q5MA 1OC7A 4I6KA 3WBYA 4UZSA 3TEVA 2R6OA 2QW5A 1RD6A 3QGKC 2EPHA 4U3AA 3WF3A 4GI8A 2YBUA 4ZCWA 5ECVA 3EBVA 2OO0A 4BS0A 3TZFA 2CLHA 2C15A 3N4AA 4E2BA 4J9JA 5D9PA 3MSRA 4LYRA 4QM1A 4XTDA 1VAHA 3TAOA 4D1JA 3NO1A 5GQBA 4RX0A 2YCLB 4IMCA 2X42A 5HK4A 3CUHA 2REQB 4PMZA 3LYEA 1WXJA 3LQGA 1QOXA 1BLIA 4YVVA 3ALFA 3W29A 1L0PA 2OGJA 3D0CA 5H1WA 1UZ1A 4EK7A 1S38A 3R79A 4H6KA 3LDVA 3LCLA 3PZNA 4W5UA 3KZSA 4XX6A 3B3DA 1E71M 1AMKA 1UD8A 3OBEA 2VZTA 2IKGA 1ITXA 1PKMA 4AVFA 1CXEA 1US2A 5CLTA 4Z2GA 1DEDA 3NM1A 1GKPA 4CQCA 4HNVA 2BY0A 4O10A 2X40A 4XBSA 1SZFA 3TV8A 2YSWA 1XD1A 3ARXA 4CCCA 3UEQA 3IJLA 1SQ7A 3CUGA 2QUTA 3LV5A 2I5GA 2PGRA 3VKKA 3PJXA 3ZLGA 2A85A 5BXRA 1RP8A 1H2JA 4OECA 4LQ1A 1G5AA 4C6CA 2PTXA 1GHSA 4M29A 3WZ0E 3CUJA 4V1YA 3GXMA 3S9IA 2CU0A 5FAGA 4OTKA 1XBXA 1VFTA 1U33A 1OG0A 3TTYA 3UPWA 1EBHA 4GC3A 1LLZA 2AQOA 3VOGA 1JUBA 3T40A 3VC5A 1YDNA 3E1F1 3ABRA 1SJCA 4LPCA 2DT0A 2V3DA 1A0DA 3P60A 4XBKA 3J7HA 1WPCA 5LHFA 4XWUA 4R85A 2VEFA 4YCOA 1RR2A 4XD6A 4D2JA 4HNOA 4HSHA 3UWQA 4PMYA 4HU4A 1ELSA 2DUZA 4D6EA 2C14A 3QZAA 1M5WA 1WDPA 1WUEA 4Z2KA 3ABZA 2JK2A 2EQDA 2X1RA 4B15A 2YXOA 1FVPA 3M7SA 3OVRA 4QCEA 3MHGA 2A0NA 1OFDA 3GBEA 3W4RA 1YE4A