1TWZA

Dihydropteroate synthetase, with bound substrate analogue ptp, from bacillus anthracis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHPS, Dihydropteroate synthase
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 94
structure length 266
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1twzA00
4S3CA 4S3FA 4DAIA 1TWZA 2H9AA 2H9AB 3H2AA 4NHVA 4CCZA 3H24A 3V5OA 4DB7A 4MWAD 3TYEA 2BMBA 4DJFC 4PZVA 3TYCA 2YCJA 1TX0A 4DJEC 3BOFA 2OGYA 4DJDC 4NL1A 2E7FA 4NIRA 1Q7ZA 3BOLA 1Q8AA 4D9PA 4D8AA 4S3DA 4S3EA 4MWAA 4MWAB 4C1NB 2YCKX 4DJFD 2VEGA 2DZBA 4DAFA 3MCOA 4DJED 5JQ9A 4DJDD 3TYBA 4O0QA 3TYZA 1TX2A 3TR9A 2Y5SA 3H2NA 1TWWA 3TYDA 3H2FA 4MWAE 4S3BA 4S3AA 4S39A 4D8ZA 4NILA 2Y0FA 1Q85A 4DJFA 3H22A 1Q7QA 3H21A 3TYAA 3TZFA 4DJEA 1Q8JA 4DJDA 1AJZA 1AD1A 1TWSA 3H2MA 3H23A 1EYEA 2VEFA 4S38A 1F6YA 4S23A 2DQWA 4O1FA 3K13A 2YCLA 1AD4A 2YCLB 3MCMA 4MWAC 2VP8A 3H2CA 3NOYA 3H2OA 4HB7A 3MCNA 1AJ2A 1Q7MA 3TYUA 3H2EA 1AJ0A 4O1EA 2Y5JA 2YCIX 3TZNA 3H26A 2DZAA 4C1NA 4G9PA
chains in the Genus database with same CATH superfamily
3ZLFA 3EEGA 2V5JA 3WLTA 4DJFC 4IICA 5A6AA 1WXJA 4QR6A 1K9FA 1VRDA 3QH2A 4Q4MA 2E9BA 1X6UA 4DY1A 4AHPA 3W72A 3ARQA 3TJ4A 3W88A 6PTDA 1BVZA 3G6LA 4HA0A 2ZZ3A 4I90A 1TJPA 4OKDA 1XL9A 4N6EA 1MZRA 4LNYA 1AL7A 2NVCA 2GQAA 2GYIA 1BAGA 1TWWA 3GUGA 4UTTC 1R85A 1W1IE 3JR2A 4XTDA 5D9MA 2IKJA 3MP3A 1XQLA 2PTWA 2WJDA 4E2BA 3FYOA 1V6XA 2YFNA 3EMCA 1G94A 1UYQA 1UB3A 1IT7A 3TW6A 3R4IA 3CIVA 3SUVA 1SVDA 3MYOA 3BK0A 2AQWA 1F73A 4A6GA 2DQWA 5AHMA 2WVVA 4BF5A 3AFBA 3CQ0A 4JCMA 4B5SA 2OWWA 1LT7A 1TVNA 4M1BA 5AKQA 1E55A 5CSRA 3HGJA 4W7VA 3S5OA 4ZFCA 4YXGA 3O7UA 1E6RA 2YCIX 3S9ZA 2V3DA 3GDTA 4Z2IA 4HJWA 4G2DA 3W7DA 2ZRYA 2QCEA 2XM2A 3P6LA 4TX9A 7TIMA 2XDFA 2YBUA 2DT1A 2DW6A 1W56A 2VKZG 1OF8A 2PRHA 3IK2A 2O0TA 1F8MA 4AMCA 2PDHA 1X97A 1DQWA 1J2WA 3K5XA 4TVCA 5GNXA 4NIRA 5FL1A 1BVNP 4RZ5A 1H3GA 4HHLA 1X6NA 4PMQA 3UA4A 4UZSA 1X7FA 1N55A 4I6KA 3EWZA 1Y5XA 4L1XA 1BYBA 4IL2A 4MNLA 3TA6A 2P10A 4CCEA 3PPHA 3AIVA 4KEUA 4LQ1A 3VD3A 2OOFA 1Q6CA 4DIAA 3DYOA 4C1KA 3UPBA 4LW7A 3PZ9A 3AXIA 2QDGA 2AL1A 1JXJA 4UWMA 3TQVA 3O3RA 1ITCA 2X1UA 1IWPA 4DWDA 1Z42A 1S2CA 3ES8A 3M16A 4HVXA 1EZ2A 1F6YA 4ILSA 4I7VA 4OBRA 1JYXA 2PDQA 1FA2A 2OZ3A 3NZQA 3TK7A 1W9BM 3S6OA 3APYA 3DEQA 4AD3A 4N9CA 1CENA 4J3ZA 1QT1A 2ZUMA 4G9PA 4DF0A 4HNVA 2IPWA 1OFRA 3SM0A 2H9AA 3KRSA 4ATLA 3H12A 4M51A 1KC7A 2RDWA 1KV5A 4X63A 2ZDSA 2UY2A 4DJEC 5E9AA 4DNHA 3GIYA 4PMUA 1QNPA 2BASA 4AZGA 3PUDA 4BR1A 3JZUA 3N9KA 1E0TA 3OODA 3DKLA 4S3DA 5LIWX 4I8YA 3BG9A 3W9ZA 4H6EA 3PB0A 3TNBA 3XINA 1XG4A 4XIAA 1ZBKA 1YEYA 4FI4A 4O52A 2P1FA 1MW2A 2OELA 1F4AA 4QFUA 4FOJA 1UR8A 3NPVA 2HS8A 3M6DA 1A3WA 3AZRA 3KBNA 4ZOBA 3EA1A 2NQJA 1JPKA 1U33A 4C6EA 2F38A 4IISA 4FOUA 3BVJA 1H1YA 4PRTA 2OLAA 2QCCA 2YYUA 4JTQA 2D73A 1OQFA 3BL3A 3B9DA 4QS6A 2XVKA 1DTUA 1QXLA 3CQHA 3GIQA 3TLQA 3P93A 3K46A 3TYUA 4C6FA 3V1HA 2B31A 1TPWA 1KV8A 4JHMA 4NAEB 3RLUA 1J9YA 4GABA 2JE8A 3LCLA 1EX5A 1UD6A 4PSPA 3A3XA 3BXWA 2X1TA 1V93A 2V2CA 3EOLA 1GJWA 3WIJA 4IPNB 4C6NA 1R0MA 4GINA 5I3GA 1BQCA 1HJSA 2HCVA 4QX4A 3PP7A 2R1MA 3VNIA 1RCOB 1AQFA 2BHYA 9XIMA 4ZO9A 1YNPA 3G22A 3R0KA 3OQ8A 2ZWZA 4M0XA 2W6RA 1PYFA 4QBXA 3LX9A 3WUBA 2DZBA 3TN5A 2DSVA 1DQXA 1JPMA 3IV3A 3TU9A 1U5VA 2WZHA 2TODA 2PGEA 1G1YA 4IMGA 5H8MA 4JAWA 3UXDA 1LBMA 3EMQA 4ZZ9A 4RE4A 4JOMA 3VU2A 5DMLA 4D6FA 5I3JA 1JFHA 3PWAA 3EX3A 1Z32X 4MYAA 1TPDA 3BJFA 3PB2A 4TTUA 2BSLA 3ARUA 1WQ5A 3PNZA 1PKLA 2WNNA 4XD5A 5J04A 1R3TA 4UTKA 3HG5A 3CC1A 1BD0A 1X8FA 3R43A 4KQNA 1CXEA 3C0QA 3AIRA 2DUZA 1S39A 5HQEA 5ECUA 1XH1A 5A69A 4MMWA 2D0HA 3O2LA 2NUWA 4M6PA 1P0DA 1M41A 4IMAA 3OHIA 2UWFA 1W9PA 4KWWA 5AHLA 1FWSA 1JQXA 1GTHA 4HZMA 2W61A 1JGIA 5JIWA 3GNDA 1J01A 4LAOA 2Z1XA 3BMXA 2DJLA 3KL5A 2FZ8A 3PULA 1FWHC 4A22A 3WQEA 1W37A 1I60A 5MHBA 2DORA 4DYKA 4TOQA 3QKZA 2OSYA 4O53A 3KFTA 2OLSA 1HJVA 4JTRA 4QAIA 1FP8A 3G8EA 3H2NA 5HJXA 4C6DA 2J9ZA 1GOWA 4PEKA 1I75A 4JTEA 5I3KA 5CCZA 4JNMA 3M5XA 2R82A 1MDRA 4IFKB 1VFTA 1OYBA 4GWEA 3I7QA 1SMAA 3IWPA 5LA2A 2XWDA 1TPB1 3CT2A 2RFGA 3PS7A 4FX7A 3THDA 1W6TA 3QOKA 4E6MA 1E6ZA 2WBGA 4A2SA 3SRHA 4E3VA 1B3OA 1H09A 1UJQA 4MZ8A 5HJYA 3I68A 1UZ4A 1ISZA 1RBLA 4G6CA 3THUA 2QEZA 3WLKX 1VZWA 5EMMA 2F9RA 4IX2A 4UFHA 4MUPA 3O6CA 5AC6A 3DECA 2OR2A 3KAOA 2H90A 1E5NA 3FKRA 4AYGA 3BSMA 3NQGA 4KPLA 1JCTA 3Q37A 1M7JA 1NP0A 2V3GA 4Z1AA 1TX0A 1X8CA 1E0XA 3E2RA 1NAL1 8TIMA 1FFQA 3U5YA 3IJ6A 2W79A 3LHZA 5M3WA 3VFCA 4CCCA 1O6IA 2HZGA 2PRMA 5CLTA 1F7BA 4CQ8A 3TTOA 1KTCA 1FWCC 2OO0A 3MJMA 2QMKA 3PR2A 4W5ZA 2CIPA 2YL9A 2ISDA 2XPKA 3TJIA 3WDQA 1GK8A 4S3GA 4B3KA 3FOKA 3V0UA 2ZVIA 3KOXA 2YR1A 2D2JA 3IIVA 1F6PA 1UUMA 3QMRA 5BWAA 1KM2A 1UROA 3N34A 4BKNA 1XYCA 4WCJA 4YS1A 2HE5A 4F4RA 5ECVA 5FSDC 1LOQA 2W62A 1E6QM 1M1BA 4K8HA 4MOZA 3W7KA 4F0KA 4JYDA 3AHXA 3SBFA 5KTLA 2GJNA 1U5JA 2O56A 4FSAA 4NZ1A 3NZPA 4P7LA 2VQTA 5D02A 3EPNA 4H19A 4NJJA 2F6XA 3EWYA 1KCXA 3H4WA 5A6JA 7CGTA 1SO3A 4P2VA 1OT1A 1MUWA 3URNA 4C6CA 3PHAA 2PU1A 4IHCA 1PDYA 1RLDA 3VIFA 3K4AA 4FF7A 4UTHA 4IQEA 5ABTA 3GTFA 5CC3A 1QK2A 4NZCA 1VFUA 4XVDA 4XZMX 3SJNA 4GCAA 4IJCA 1M65A 1TR1A 6TIMA 2D1ZA 1OCNA 1W32A 5IM51 4ZO7A 4H9ZA 1O66A 4NYYA 3WQ4A 5IBXC 1JRCA 2VEKA 1A5CA 1NH6A 4C6PA 2WJZA 4Q4KA 2ALDA 1QFEA 2Q8ZA 5D04C 3B40A 1WKFA 3VMPA 1I0BA 3TR9A 1K8ZA 1XI3A 1S5TA 4LAKA 1VFMA 1P7TB 5LIUX 2I9UA 4E8CA 1VIWA 4IIGA 4QE5A 2QPSA 3TWBA 4F0SA 3PJUA 3ABXA 2IXVA 4PFHA 2RJHA 4IG2A 2EPNA 1E1CA 2WKGA 3WQWA 3V75A 4B92A 4MJZA 1G4EA 1ZPTA 5D32A 4XVEA 5BRQA 4TUFA 2HV5A 4PCPA 4UFKA 1VPYA 2VDGA 3MVTA 2D0FA 3FY1A 1JAEA 3IK4A 1FWBC 3T1GA 3DKJA 2O9TA 4I9MA 4FO4A 3VKKA 2NV1A 4DF2A 1HG3A 3IIXA 3M0KA 5LNSA 1DJIA 2OMAA 1DOSA 3WBAA 3G1FA 4L80A 2CZFA 1JDEA 2QCDB 2ZICA 3VIPA 4X0NA 3V1PA 2GQ8A 5IDZA 1H49A 2KAUC 5H1WA 3G1RA 4NT0A 4PULA 4D6DA 4LPCA 4MM1A 4BY3A 4AZ5A 4MAVA 2ACQA 3LHYA 4RNHA 4E5TA 3N1AA 3QKEA 2VC9A 1SO4A 4KIEA 3GDLA 4WSHA 1XRFA 4JEQA 2JKEA 4RZBA 4JTDA 4A05A 3LBOA 1WPCA 3OQEA 1CGTA 3NQVA 3RDKA 1ZAJA 3GU2A 3SAZA 3M46A 4POCA 2GJRA 1K1DA 5I3IA 1GQJA 4XAZA 3L2IA 4GA8A 2FZ9A 3UWVA 2YJQA 4QNWA 1RV8A 1FXQA 1YTEA 1IXOA 1OX5A 1GOXA 5EMLA 4RZ6A 4KFNA 2X8RA 2XUCA 1Q6FA 3PF3A 1U1JA 1ZS2A 5E93A 4LFYA 3SRDA 1UZHA 2AOSA 4LF2A 4IPJA 3L5LA 5AB3A 4QG8A 3UESA 1J0IA 4N9EA 2PGFA 5I6SA 3P5YA 1P0KA 3CZEA 4TV5A 1SFTA 3TR2A 4GD0A 1XIBA 1VS1A 3ENLA 1OK6A 3NDZA 1NP2A 3AIEA 3T7VA 1QI3A 1QHPA 1XICA 1EPXA 3C0JA 4DJFD 2VC5A 1R7AA 4AF0A 4HT3A 4G7EB 3EA3A 4N4QA 3LHVA 1IR2A 1XUUA 4D1JA 1TTQA 4MWAE 4F2UA 1CEOA 2KZHA 3B4UA 4MKNA 2ZXAA 3TLLA 3DCPA 2J6XA 1D7KA 3GNNA 4AVNA 4DWSB 1OHLA 3DX5A 5M1TA 4NZ5A 5AECA 3BLLA 4QM1A 3ATYA 3H4GA 5F4WA 1F8IA 1QTWA 1B90A 3AICA 1I9CB 3PZNA 3KL0A 4MYXA 4V1YA 3I3EA 2CXGA 3VKAA 1K03A 4EWND 4WJEA 1E3ZA 1UBPC 2Y88A 3KCLA 2ZUTA 2WMIA 4PUKA 2ZKMX 1BXNA 2V3FA 2X16A 1E0UA 4QS5A 1QO5A 3RCYA 4JX6A 3FW6A 1EO5A 1OEPA 1W9XA 1RQEA 3SW6A 1DVJA 4ZO8A 3SN1A 1Y8BA 2V8ZA 3ZWSA 3G1YA 2OPJA 3QPZA 4B3ZA 5C9RA 1ZY9A 2P50A 3ITYA 3FLUA 4S3EA 5K4XA 3C8FA 3B0UX 2YL5A 1C8XA 4EIVA 2J7EA 4NRSA 3W37A 4LH8A 1KBJA 3RO6A 3PBGA 1ZJBA 2Y5SA 1IXPA 1UMLA 4M7TA 6ALDA 2PP0A 2IPJA 1FVPA 3LNMA 4PUDA 1OCJA 2REQB 3NXLA 1D8CA 5AHIA 1AD1A 1MFVA 3H23A 3QRHA 1XPYA 3UCCA 1BF2A 2Q09A 3O16A 4HSNA 1M7OA 4MWAC 4D6EA 5DEZA 1P6CA 3KOYA 5FJOA 3CT7A 4CQDA 1XG3A 5I78A 4C7GA 3CLWA 3W6YA 3P82A 4PC8A 2QHAA 3E9AA 4DO5A 3LM7A 4WJ8A 3K2GA 4S3CA 4LUTA 3RUBL 2FIQA 3LLDA 2VC6A 5D2VA 4CCZA 1HKJA 5ENLA 2WVTA 3WK0A 3CIXA 3DU0A 5I02A 6ENLA 1C7TA 2WOQA 4REQA 1E51A 4JGDA 2CEQA 3DESA 3IJIA 5DANA 1FBAA 3WF2A 2ZRWA 3N4FA 1XH0A 2ZZ5A 3CZ8A 2Y85A 3EPOA 3HPZA 3QQ1A 4H9VA 2BXZA 3ICJA 3G2GA 4KCVA 3O1NA 4YTTA 1H7XA 4A2RA 1I1WA 1JXKA 1UCWA 4UR9A 4BCEA 4DJED 1ICQA 2UY4A 3TYZA 1NOWA 4EXAA 3UXAA 4O50A 2VI0A 1NIUA 4UFJA 1L6FA 1Q85A 3MSDA 4GO9A 2HTMA 2Y7FA 4OUIA 1KD0A 2INEA 1W3NA 1F07A 1HTIA 4KRUA 5CZJA 1J10A 1UUOA 4PMJA 3W38A 1Q4WA 2YXXA 1AFSA 4L6OA 4S23A 2Y5EA 3FA5A 1UD5A 3KWSA 2J88A 4W9TA 4Z1CA 3MCMA 3QY8A 1JD7A 3HGOA 1FHDA 4FXFA 4NNAA 1H51A 2VM8A 2NUXA 2Z26A 4LYPA 3QW4B 5LIKX 3E0IA 3PANA 1ONWA 3STGA 5KZMA 1W1B1 3WQVA 4C1NB 1ZNNA 4V1XA 4AW7A 5HNUA 4TVUA 5FF3A 1RJPA 4RXFA 2ZA1A 4DPPA 4OOZA 2HPMA 1CYGA 1RHCA 2VGFA 2PWUA 1TVPA 2PWVA 1JUKA 2NUYA 3IJ9A 4NASA 4MJ2A 4GFIA 4W87A 1KWKA 4Q8MA 1V3MA 3W7RA 5FKYA 4HK6A 1KBKA 4NI8A 3ZLHA 3LSCA 2DY3A 5AZ1A 1FWJC 3T40A 4J5NA 1F6KA 1OZMA 4IT1A 3EWWA 1XINA 4W86A 4JQAA 2XHYA 2ABAA 1A0EA 3VIJA 1XBXA 1HKVA 4ZTXA 4DHGA 3GIPA 4WX2A 2D69A 1I6NA 3C86A 1ECEA 2OQLA 3S9IA 3W7IA 2VUYA 2WSKA 2DH2A 2GQ9A 4J3UA 3NL5A 4F2BA 3CUZA 3QC0A 3U8GA 3F5JA 4GI8A 3BV7A 1EYEA 1EJXC 2CBJA 4PB3A 3CUFA 3R0UA 5BXPA 1K70A 3EEZA 4IOTA 3BLKA 2QJGA 4XK2A 1GPFA 4AIBA 3U2ZA 1DTNA 4XZNX 3CMJA 3U3HA 3OO2A 2OSWA 4CNTA 1CLXA 4FEZA 3IUDA 1P6BA 4O0ZA 3EDEA 2J7BA 1B9ZA 1V6YA 2YB4A 3PSWA 4M56A 3SEPA 1FH8A 5LXEA 1ZJAA 1V6VA 2DP3A 3AIWA 4JN7A 1SJAA 2EJ1A 2POZA 1X7IA 4Q4OA 2XIIA 3QBUA 1JG9A 3OGVA 3H6OA 1H7RA 1KGXA 3L23A 1A80A 3P84A 4DUXA 1Q2SA 5HNRA 4C6MA 3I65A 2OGYA 1K9EA 1XLMA 4JCLA 1J0YA 5CZSA 4OGZA 2E0PA 3SURA 4AEFA 4XZBA 1FHVA 1YTDA 2G5WA 2VX6A 4BFAA 1C7SA 3GH7A 3KTXA 5G2IA 2I5IA 1EGVA 4GYPA 5HK4A 1KFWA 3OVQA 2FZDA 4X3ZA 3IEBA 4JD4A 2V5BA 3ALFA 2CLHA 1GORA 2E9MA 4GVHA 3AYRA 3T07A 4XKMA 1UR9A 1C9WA 3CL6A 4AD1A 2XFYA 5CJNA 2RJGA 3W2UA 1B0IA 4O17A 4CKQA 5E0CA 4IFOA 4O1AA 1N8WA 1FCVA 4IGMA 5TIMA 4HD5A 4R88A 3K1DA 4AIEA 1UP2A 1DYSA 3ZLGA 3QC3A 2PU0A 3CQKA 4AWUA 3S2LA 5I3FA 4RX0A 1XIHA 2F7FA 1V03A 3AHYA 5BYWA 2XSBA 3PJXA 3CHDA 3CIWA 4LS2A 1C93A 4HMNA 1S1PA 1NDZA 1NVMA 4L9XA 1D7FA 1CXLA 1J96A 3NG3A 2ZIDA 2O92A 1VEOA 2WQPA 5FACA 1S1RA 1EDQA 2ZC1A 3RX4A 5BZAA 1ISXA 1QNSA 3P74A 4PMXA 1H7PA 4JEJA 3WFAA 1S5NA 2XN0A 3NM1A 3LN3A 2J24A 3CZLA 4KRTA 1LQ0A 3ARTA 1DXIA 2VWTA 1NOFA 4Q22A 4Z1DA 1A50A 3GVGA 4HPJA 2QKFA 3EKLA 4Y90A 2IS7A 3ID7A 3D46A 2DH3A 4KWUA 3PWIA 2E8ZA 2WKLA 3S2JA 2PLMA 3EA2A 3NQMA 4C5YA 1S5WA 3GK0A 4BA0A 3UZYA 5FJPA 2DIJA 3UR5A 4PMVA 3CL7A 1OY0A 1Y5WA 3W7LA 1XLEA 1LUCB 5KZDA 4OECA 1XUZA 4G7FA 3DC0A 2VFHA 4WDUA 4WGXA 2X0YA 2XJ7A 4EXQA 3N2OA 2JGYA 3BARA 1XCWA 4EF9A 1KKRA 2PDWA 1DE5A 5AN7A 4UZUA 3I10A 4GI4A 4UFIA 2BOEX 1IEIA 3VAVA 3FX4A 1ISYA 3STFA 4WIWA 1V6WA 3QXBA 2G3JA 4J1OA 1Q2RA 1VYSX 3POHA 3M0VA 1K4GA 1SFSA 3GTIA 3M0HA 1XLKA 1R3YA 3CQIA 1GKRA 3W71A 3S83A 4HBKA 4GUFA 3WF4A 1BSLA 3A21A 2BS9A 1IEWA 4NHVA 1JF5A 1EC7A 3LBCA 3MT1A 4CNSA 3TOYA 1T8XA 4BJHA 3NPUA 2Y7EA 4UTMA 2FGLA 3UWYA 4TX8A 1KR1A 2ZX6A 3EOUA 3CV1A 4XO7A 3TX9A 1IYXA 3LK6A 8XIMA 3BLFA 4UQDA 4A3RA 5CC6A 3I4KA 2R9RA 3EX6A 3GM8A 4IPIA 4RK8A 2ZUSA 4Q3MA 4LJ3A 2D2OA 3OG2A 2DVXA 1Y65A 3OYXA 4LB3A 1DQUA 2CITA 4LYRA 4QQUA 1YW1A 1QVBA 3RM9A 2Z27A 5HWNA 3NQ8A 1MXSA 2B81A 3WLJA 1DWFM 1BWKA 3C2FA 2Y7GA 5T91A 4DI8A 4GXPA 1VF8A 2INZA 5CC7A 2EKCA 4DJDA 3TFCA 2J13A 2ZCGA 2OZTA 3ITVA 4AISA 3DFHA 5CAKA 5JMUA 2GZXA 4CN4A 3W7NA 4L7ZA 2I1OA 4K7VA 4XAFA 1UC5A 2D0GA 1JR1A 3AJXA 3AROA 6TAAA 4NF7A 3DYMA 4K36A 4H2CA 1OFAA 4WOZA 1F4HA 5FEZA 1NY1A 2A1YA 2BY0A 1FFRA 3TXVA 3QMTA 3VIIA 3GBDA 1XDMA 3REQA 4LOCA 4CQAA 4LC8A 3STCA 1JD9A 2DFAA 4A3QA 5CQ1A 3WUFA 2BLEA 2ODOA 2Q8XA 5L6UA 4CVWA 4JDYA 1YXDA 4AZCB 2JIEA 3KS5A 4ADSA 1DORA 2ZXDA 2ZZ4A 4MGGA 4Z1BA 3EKZA 4F66A 5BXRA 3W1AA 1RPXA 2Z1WA 4WK9A 2QV5A 3PG9A 3CGTA 2BTMA 4MJ4A 1JDFA 2BWGA 4J27A 1VIZA 4ORMA 4FS9A 3RIKA 2DIKA 3MUZ1 3L4VA 2VOTA 8A3HA 3LXBA 4GX8A 2CLPA 3LPPA 4YNGA 3FYYA 1Q8JA 1TCMA 3WMCA 4A8RA 4O10A 3GG0A 2PDGA 3WLOA 3M64A 4ASTA 4F0RA 2OSXA 4H9YA 4P5UA 5AYXA 2J74A 5CPTA 4UR7A 3D3AA 1I45A 3BCFA 4CNNA 1DIKA 4NZFA 5AYZA 1DWHM 1O94A 1VBJA 5EMKA 2PDCA 3QHMA 3TZNA 3WK1A 2QT3A 3KRZA 1SW7A 1Z6KA 1KTNA 2CZ5A 1Z3NA 2YIHA 2PP1A 1P0EA 1KXVA 2G3MA 4D6HA 3O8AA 4C7FA 2C18A 1K4HA 3QN3A 1BLIA 4HOXA 1Q4NX 4ZQMA 5E1QA 3TKFA 3P2VA 1QR7A 2VRQA 5U7SA 1UWSA 3RAOA 3WLLA 3AXHA 1VR6A 1GOIA 1CW2A 2PTDA 2YZ5A 1WDRA 1TWIA 2V5KA 3WNKA 1KXHA 3G5EA 2FH8A 2G4FA 1WZMA 4I7WA 1RH9A 3BGJA 3FHQA 5C2GA 3LRLA 3H21A 2CLIA 4CD7A 3VZXA 2WHJA 3Q65A 1T41A 4UBPC 4HN4A 1QPOA 3C52A 4JICA 1RJRA 5D03A 4EXBA 1OX6A 3W6LA 5M03A 3VVGA 5C2XA 3NQ7A 2FHCA 1AD4A 3WYZA 3TN6A 2E28A 2YA2A 1S5MA 2NVAA 4K37A 3GS6A 1LL7A 1QNVA 2B7PA 4XZWA 3WLPA 3RG6A 4K68A 1CDGA 1ALDA 3AIQA 2A3BA 2IPFA 4NJIA 1GHRA 2WSYA 3FFSA 3L4XA 1IT0A 3W07A 3WBEA 5ABHA 1E73M 4FR6A 4YYFA 2H8XA 3VMOA 4KCWA 5I07A 4ZE5A 1BG9A 4O19A 4R3UA 1HT6A 4LB4A 1HP5A 4LAZA 1JQVA 3T55A 1G7VA 5JIPA 2CU0A 4MG4A 4FPSA 3TCEA 4FF5A 3INPA 1HFBA 1R3RA 1EKOA 3PTQA 1CGWA 1EGZA 1MFUA 3QYSA 1KFLA 3MMWA 1XIMA 3OBKA 1YMYA 1DWJM 3LA4A 3OGRA 3WEZA 5EKYA 4EX4A 5I79A 2MUCA 1WUFA 3Q94A 1KQZA 4MB3A 3R6IA 4N4PA 1WO2A 2J27A 2F2HA 3PTMA 4LEFA 4LVAA 2GGGA 4GZJA 4PODA 4HU8A 3C2EA 2QCHA 1UHVA 2IKIA 3RPDA 5JH1A 3SRKA 3NEHA 2A79A 1VFOA 1HUVA 5K9CA 2Y24A 3F4WA 2HSAA 3LCHA 5CPNA 2A21A 2GGIA 1DEDA 2VX5A 2VVNA 1PYMA 3LZ3A 1HF6A 3S8HA 3U4FA 3QPYA 1UA7A 4GVFA 2HMCA 2W9MA 3W4RA 4XZ9A 4MWAD 3PTKA 3FAXA 4ZXLA 1UKOA 1FKXA 3FJ4A 3TYCA 3T78A 2DGAA 3CMGA 3IAQA 3S4TA 3RJYA 2PWDA 4C6QA 1V0MA 2D3NA 4D8AA 5G2WA 5LGZA 2EBNA 3PBUA 3URQA 4LU0A 4YMZA 3VE7A 3NYZA 3MHUA 3CHEA 3ZSSA 3GUWA 1Q6QA 1M6JA 4DBWA 3A4AA 3ABOA 1UOZA 2FVLA 4HQVA 4TR9A 1BKSA 3R58A 3UZ5A 3SIMA 4JFUA 4QHRA 1T99A 4GQ0A 3MUY1 1ZENA 4NJKA 4XBJA 1A4LA 2J75A 5I3DA 3H2MA 1Q66A 4G1NA 1F61A 2WB5A 1JDAA 4DM2A 2Z00A 4HA1A 5FIPA 2YKKA 2VL4A 4ZQNA 4QXIA 4E2OA 1RPKA 4IMEA 1QI4A 3L9CA 4F40A 1XLIA 5K4ZA 2PDXA 2IQTA 4FR1A 1MEWA 1OZQA 2RH9A 4GQGA 5XINA 1TFVA 3VGDA 3B8IA 1U5HA 3AS0A 5BXSA 2WVSA 1TJ2A 4I6VA 1NDWA 3OVGA 4ML9A 3GR4A 3E96A 1UKPA 1YPXA 4O4WA 2J62A 4KT2A 5I7GA 1VP5A 3U5UA 1HJQA 3IRDA 1F3TA 5CGMA 1YBQB 2DV0A 3SCUA 3A3HA 4UQCA 3BAXA 4PA8A 3GR7A 1CT5A 1EZWA 5C0QA 1K6AA 2DUAA 3MI3A 1V02A 3O6YX 3C8NA 4Q8VA 3MV11 4F0LA 4ZR8A 4NNBA 2YB1A 4YIWA 2R24A 2NV9A 4ATWA 2EAWA 3MSRA 1DIDA 3KOFA 7TAAA 4HZ6A 1AL8A 4MADA 2OT1A 4HMCA 4XTIA 1KTBA 1E15A 1E3XA 3W73A 3SSJA 1EO7A 1EEPA 1X39A 1IQ8A 2FQIA 4YWSA 1V3IA 2WHKA 4X9YA 1NFPA 3CYJA 3KW3A 1O7AA 3UWWA 1K8YA 4AH7A 4MJMA 1MRQA 1B9BA 1W1PA 4UQ9A 2X42A 3UBPC 4IH3A 4BZYA 1Q6DA 4YTQA 1UWQA 2HVNA 2YBTA 3MSYA 3SZ8A 4D2JA 2RDTA 4P7RA 2PC8A 2UY5A 4IPPA 1MDLA 1CGVA 3C2RA 3LQGA 4CQCA 1RALA 1R87A 3DFOA 1WX0A 1SSGA 1JCJA 2WSRA 2DEPA 1J4EA 3PY2A 4LTSA 4HOWA 4QJ1A 3GW3A 2Z7GA 2ONEA 1QMLA 5A8MA 3DERA 4AEEA 1JEZA 3KRBA 3R13A 1C3FA 3CAWA 3PBVA 4TMCA 3FS2A 1V51A 4U33A 3BWWA 5DCEA 2AQVA 1OBAA 2XGIA 3ARVA 5A6BA 4AU0A 2WC3A 2DSZA 4FXJA 2FZNA 4R33A 4F79A 4JR5A 5GPRA 1KCKA 1SR0A 3WF3A 1L0PA 2QULA 3MKVA 1M7XA 4JHOA 1V08A 4D6JA 3P8IA 1ADSA 3VDGA 3PFRA 4LXFA 4UOQA 5G1TA 3K1GA 1W1YA 4Q4QA 1A4MA 5A5WA 3W1XA 2W92A 4J35A 1GTEA 1TIMA 4Q8UA 2ATSA 1YDOA 2WBKA 4Q8WA 4H8UA 1ZCOA 1NFGA 1EP2A 1RA5A 1SZFA 2HJPA 3CM4A 4CEUC 4GNJA 1B4KA 4UQEA 4BF9A 3RU6A 2CBIA 5DN1A 3QR3A 2E68A 4HKPA 3WQDA 3AALA 3B8VA 2UBPC 3CUJA 1ODUA 1IE7C 1WDSA 2OZ8A 4HSHA 1UJPA 4AZBA 5DXXA 1YQ2A 4GXMA 1Q65A 5CAHA 1ZAHA 2KX9A 3URAA 1A5OC 4AAJA 2JEPA 2VRKA 4DPQA 2IXUA 1FWEC 2O7SA 2DT3A 1E1FA 1TV3A 2JFEX 3SY8A 4G5DA 5EMYA 2INFA 1CXFA 3N73A 4L4OA 3BLOA 4C6KA 3NZRA 4XSLA 1J12A 3CEPA 2XH0A 3MYPA 4RZ4A 4G8TA 3M5VA 3LCGA 4OUEA 1SU5A 2Y7DA 5LXXA 2VEGA 2BVYA 4XQ6A 3NQFA 3RCNA 1NARA 4M6QA 4C91A 3W22A 4GMEA 3V4BA 1FDJA 1YLVA 3W81A 4EACA 4H9XA 2BGQA 4UR8A 1VRXA 2R94A 4ZTYA 1LLZA 4ZODA 1W17A 3NAVA 5BRBA 1LT8A 5IOBA 3T05A 3A12A 5EMJA 4YTUA 5IHSA 1UD2A 3DFSA 1FWAC 4IFKA 3W84A 1XLBA 3K30A 3GE7A 2EPHA 5KZ6A 1PUDA 2CBUA 3VKCA 4E38A 3UJSA 5M2FX 3GKFA 4QIUA 4ICMA 1GVYA 2QF8A 3A24A 5A3HA 4GY0A 3MMTA 1ESWA 3VNYA 5GNYA 1P43A 3A47A 1XD0A 4HPGA 1MWOA 3L4TA 4RLIA 4HTBA 2FVKA 3JS3A 2WLYA 5IDIA 3UPWA 3T44A 2AGKA 5AC7A 1IIGA 2ZUUA 2G0WA 4WD0A 2G3IA 3CWOX 3CO4A 1GYMA 3CTTA 2QNEA 3Q58A 3L2MA 4HJFA 3SB0A 3NVDA 4LUSB 4GYFA 4GFSA 3B97A 4NL1A 3WH6A 4CN1A 5K9XA 4KGJA 1TV5A 1XLAA 1QNOA 2YL6A 3IJ7A 2DT0A 3PAJA 2E09A 4MWAB 7REQB 1OJXA 2FMNA 5I3HA 4TO8A 3B8SA 1K3UA 4RNIA 3WQ5A 2VCAA 1JAKA 3HPAA 4F0MA 4QSFA 2QUVA 1D2KA 2BOFX 3I4EA 4YL2A 5F2LA 1FX6A 2NQHA 1TYGA 3COTA 1IV8A 3TXZA 3UG5A 1GVSA 1YRRA 4PEEA 4ZGYA 1GOOA 3CHVA 5C71A 3N4AA 4PBEA 5A95A 1VQTA 2G97A 5MKGA 3MBDA 3T9PA 1JZ6A 5CC5A 2YLAA 2F84A 3H7UA 2BY3A 2OZ0A 3WY1A 3OOQA 3K13A 2HBVA 3DHDA 3B06A 2YCLB 3ZVHB 2EG6A 2PDUA 3WDJA 5IXEA 5H8PA 3GDKA 4WOQA 3KRUA 1GVRA 4GYJA 2PZ0A 1V7AA 3M1ZA 5E9XA 4FIRA 2HRWA 1G01A 1A5BA 1F2JA 4O16A 1BRLA 4F8XA 1E6NA 4FAMA 3ZT7A 4Q7IA 1HO1A 2ZZ1A 4QE1A 5TNVA 1JCYA 2OJPA 2ZA3A 3RCMA 3C6CA 4J9JA 4AVFA 4IQLA 2B4GA 3GU9A 1UWAA 3G1SA 4XWUA 1FHUA 4JFWA 3VOIA 4JTKA 1EUNA 2YYTA 2HDJA 3N12A 3MZNA 2OX4A 3W0KA 4EKJA 3CPUA 2DUXA 1OCBA 4IMFA 1FCQA 4QGCA 3BJSA 1X1NA 3N2XA 3WFZA 1OIFA 4L4LA 5FF7A 4A3YA 1EHAA 3RR4A 2E1WA 3L7RA 3HQOA 3W2JA 4ALDA 3QLDA 1W9VA 4Z42C 1UW9A 3SQMA 4JTFA 3TNOA 3TP4A 1J0JA 2A7NA 1P7TA 4KGLA 4WSKA 3WDPP 1ICPA 1M01A 3UWZA 3QSTA 2QS8A 3CU2A 3VD9A 4XBSA 4E4UA 1X98A 3ITCA 1PSCA 1OK4A 2VMFA 3C2VA 4CD6A 3E6EA 4H04A 4GG9A 5J5RA 4Q7NA 1ZAIA 3MDUA 1H61A 4K38A 2ZRVA 3BJTA 3B3DA 4A8IA 2JKAA 1HW6A 3I6EA 1TTIA 3RRXA 1FWGC 1PXGA 1FXPA 3L0GA 4GUIA 1GOKA 3IVUA 5HULA 3HV9A 4LVBA 1SM9A 5D33A 3LI0A 4EE9A 3PZMA 2QPUA 3RLHA 3AZTA 3MA8A 4GC3A 2ZXBA 3BAWA 1EB3A 1NTHA 2EG7A 3N15A 1MEIA 1EP1A 4WDXA 4D6IA 2G3FA 4DYJA 3NQCA 4XAPA 3OIHA 5CEWA 4WSJA 3CV6A 3SR7A 4XUGA 1OGSA 2BG5A 1XLLA 4ROQA 5XIMA 4AWEA 4HNTA 1I8JA 2QCDA 4PTNA 2HPIA 3GQYA 4WUIA 1FWTA 3BMVA 3N6JA 4GNKB 1PX3A 1O95A 3QGKC 4XD6A 3VNJA 2V81A 2GJLA 4FLQA 1LRQA 4B5WA 2VZOA 3EDDA 3F03K 2PDLA 1PTDA 2ASHA 5HMFA 3MSGA 4QE4A 5LA0A 2Z1SA 4NILA 1DWAM 2WSPA 2XM1A 4YTSA 9RUBA 4PN2A 2W91A 1TZ7A 1IEQA 3DI1A 2NWSA 2VVSA 2VOMA 1I0DA 1TSIA 1VEPA 3NOYA 3S9YA 2OG9A 3FXGA 2TYSA 1A3XA 3FK4A 1YTKA 1ECQA 4QP0A 4GC4A 1WKYA 5DLCA 3RRAA 3Q67A 4AG0A 1XIJA 4W8BA 3NJ3A 3PG8A 3TROA 2VEPA 1UKQA 1GVIA 4FHAA 3PBYA 1A0CA 3HQNA 4W88A 5K7JA 1M53A 1VCGA 3N2CA 1WDPA 4Y8EA 3ZZ1A 2R91A 3G18A 4DF1A 3GHRA 1R30A 3EWCA 1P1MA 3AYTA 5HUOA 5C5YA 3DFNA 5AYYA 1LQ2A 3RMEA 1E0VA 5DMYA 2V5LA 1DP0A 1P4CA 1US0A 4C5ZA 3AU6A 2I17A 2QXWA 3KLLA 2DZPA 4RL3A 4X9SA 3SCQA 4G7EA 1DBTA 3EB4A 4O0QA 3TQKA 3WBYA 1W1VA 4L61A 1QW7A 1XPGA 4IMDA 4CEXC 2VFDA 2ICSA 3VIGA 3FEMA 3WX7A 1OFDA 5HOSA 2X1RA 3WL1A 1FWWA 2CW6A 4O8AA 2J4GA 3P7YA 4F48A 2FTYA 2GVLA 3LD5A 4ZXOA 3ISIX 4UMBA 1HJUA 1E72M 2WV8A 4GXWA 1R6WA 3WD0A 1EJVC 3VNLA 2WPBA 1Z8AA 3BLDA 4WDTA 3W1RA 3CMFA 5D05A 1FRBA 3OLDA 3WQ8A 3RM4A 4JFSA 4JY8A 2ABBA 3EBVA 1RUSA 3G1XA 3WJZA 1WA3A 5CG0A 5HMDA 2FZBA 1CI1A 1OWQA 4HU3A 1PBGA 3KS6A 5LHFA 3NURA 5J5DA 1QU4A 5IRPA 1QWKA 2J7GA 3LM3A 2VRJA 5TQLA 4XAGA 1E4NA 4DLMA 2E4TA 3W7PA 1N8FA 1DWGM 4W7WA 4UC5A 2ZX8A 4GQRA 3PZQA 2O9RA 1H5YA 3OB8A 2CKSA 2VX4A 3BG5A 5FA5A 3T2OA 4DZAA 1Z41A 3VGBA 3N2TA 1JZ2A 3S2NA 2ZRUA 3EDJA 3LGGA 2YOCA 4PMYA 2JQXA 5CZTA 3IGHX 2VGBA 2X7VA 3IIZA 1B54A 3S1WA 2JGQA 2V5DA 3PUOA 5J8LA 3UP8A 4M24A 4DBDA 5A6MA 1UKTA 2HQAA 1O5KA 3AU2A 3T0AA 3ATZA 1P0NA 4JQ2A 4AIOA 1MXDA 3EX2A 1ML1A 2GVGA 5CSSA 3ARRA 3F5KA 2B0MA 2REQA 3GAYA 4C6BA 3APTA 3RM8A 7ENLA 1LQAA 4QG9A 3KDNA 1JYVA 2GUUA 3WO8A 1GEQA 2D20A 1KRBC 1GWJA 2E3ZA 5CH9A 1K9DA 5E6ZA 1LWJA 4FA3A 1Z89A 3LPOA 1DL3A 4HCDA 1FDZA 2PTYA 2DZAA 1RR2A 2CHRA 4NY2A 3MHFA 1NFBA 1QASA 2GSEA 1DJQA 1WAWA 3RFAA 1EBGA 3H2AA 1VBGA 1A5KC 3C3UA 5LZLA 5BCAA 2GLKA 5D09A 1DIOA 3NQBA 3ABRA 3RITA 1H50A 1V6UA 1DV7A 3N18A 4I5RA 3VGFA 4RW5A 3PPCA 3CWHA 4GQQA 4RJEA 1US3A 3OZMA 3QVQA 5BOOA 2GJPA 4BI5A 4LRSA 3RJXA 1PKNA 5DO8A 1E4MM 2YCEA 4M1RA 4PBFA 4RDWA 2XGZA 1YE6A 3T0BA 1ITQA 3GFYA 4Q4PA 3SIZA 1PAMA 1SJBA 3A4JA 4U4MA 3PAOA 2QCLA 3IUIA 5DMNA 1OX4B 5L9FA 3MZ2A 5A6TC 3FJLA 1EH9A 1SFLA 4KWSA 1QI5A 3CJPA 4KKXA 1HVXA 5E0KA 3AXKA 4UTWA 2WM0A 3UVIA 2AMGA 1RP8A 1GG0A 1F3WA 1JULA 1PX8A 2ZYFA 3WMBA 4Z1YA 5I24A 3W02A 3GVQA 4M19A 3VOCA 2CHOA 4HOZA 2OKOA 3MDWA 3VD7A 2I5GA 1SYTA 1J93A 3B9OA 4FNTA 1T40A 4ZCWA 1K7XA 1W3JA 4BEUA 4C1NA 5KETA 4B3LA 1ICSA 1XR2A 1GJUA 4L4MA 3BV4A 3U57A 3C61A 2OEJA 2VGGA 2QYGA 3HURA 1N82A 4JIQA 2NSOA 5GJPA 3B0YA 1PZ2A 1J8VA 4CUCA 3KBJA 1G67A 3TAOA 3QHNA 4MDOA 1R2RA 3UJEA 1TCDA 4GLEA 2B7QA 3ZR6A 2Y2WA 2BVTA 2DSUA 5C9UA 4DI9A 4YJ5A 3HU7A 3WF0A 2ZRXA 3W7JA 3ZJ6A 1V0NA 1G5AA 3B9NA 4FZIA 4L1WA 4L64A 1BXCA 3LTYA 2V6AA 3H2FA 3MUIA 3EMZA 2O9OA 3IANA 1B3ZA 3VUSA 1JPIA 5AY7A 1KBBA 2C7FA 1EQPA 1W5NA 3GDBA 2JALA 2PD9A 5G4WA 4UQAA 2I16A 1XYLA 2ACSA 1QI0A 1Q6GA 4GO8A 2C19A 5GQBA 4M81A 3XISA 1G6CA 3HIJA 1HL2A 3DN5A 4BWLA 4OTKA 4OT7A 4AXNA 1PEZA 3VILA 5KMYA 3SRFA 1OG6A 5FL0A 3LI1A 1XF0A 2PCQA 3L0KA 1AJ2A 4HCLA 4NSBA 4K8EA 3VE9A 2PD5A 1J2BA 3A6OA 3GXPA 1J5TA 1DJWA 1JGMA 1S3HA 1B3WA 3W1QA 1W0MA 4B15A 1THFD 4DAIA 4ENLA 4DYEA 5DY3A 4PMDA 2E5DA 4KEMA 2NQ5A 3VIHA 4O14A 2LLEA 2CZVA 4RDVA 2PUZA 4JY9A 4KMQA 2OVLA 4QROA 4XKYB 1JZ3A 3NCOA 4GJ1A 2YLLA 3MU7A 4IIFA 2OO6A 3OZOA 1W54A 5H91A 2QUMA 3W7EA 1E4IA 2A3LA 3UR2A 3F5LA 1YPFA 3TE9A 3WQOA 3GU1A 5HBFA 2R1KA 1V6TA 3DG7A 3MBFA 3TA9A 3DGRA 3PZUA 1VLIA 1WB0A 3MPGA 3N3MA 4P61A 2C8NA 1W5QA 4H41A 4DJFA 4MNMA 3SFWA 4AXKA 3FSTA 3L5MA 3F4CA 5BXTA 3PPFA 3WK3A 2XU2A 2P8BA 3TCSA 4P8WA 3R8HA 4WKHA 3ITXA 1MXGA 1OABA 4JX5A 4AB4A 3WEMA 4IUGA 3G0SA 3VXGA 4U2YA 2NSXA 4GIAA 3RHGA 3UVAA 2VURA 3B8DA 2DZUA 4CNPA 1OM0A 2FB3A 2Z2AA 2C13A 4LAUA 1Q5MA 4UTTA 5LIXX 3H24A 1GQKA 1S3TC 4OQVA 4LGXA 1B30A 1VAHA 1VKFA 1D8WA 2EPOA 1R7OA 1D3GA 5C6MA 1PJ9A 2E7FA 2YGYA 2ON3A 2POTA 3HPFA 1QO2A 2R6OA 2E6YA 2VHLA 1AW1A 3A4WA 2I57A 3NPWA 3D0CA 5FJJA 1MZHA 1KLZA 1TE6A 2H6RA 4QDMA 2TRSA 1FWDC 4LBRA 4GBUA 3JUGA 2WMKA 2QCGA 3E1F1 4W84A 2C6QA 3LNPA 3CPRA 2CERA 3W24A 3R94A 1LUCA 3HF3A 3KBVA 3R0DA 4Y7EA 4NRRA 1ITXA 1XW8A 2OWXA 1C8QA 1T5AA 3I6RA 3AISA 3U2CA 3WLNA 1WYIA 2GOKA 3EOOA 5EB8A 1MNSA 2CNCA 1Q3NA 2FMOA 1JL8A 4Q8QA 5FJUA 1P1XA 4NZ4A 3UCDA 1GVEA 3MMUA 4CCDA 2JF7A 1OFPA 4ZFMA 1C9DA 4HPNA 4GY7A 2D24A 1JZ4A 1UKSA 4QJ5B 3OG3A 1KXTA 5REQB 3VOGA 1S46A 2EPLX 2VZVA 1PCWA 2E5CA 3UZJA 2YDRA 3UFYA 5FI8A 1IWAA 3GDMA 1CCWB 3SCPA 1JFXA 2FGZA 4BEQA 3F4NA 1XDLA 1VFLA 2Q8LA 2PDBA 4Q8OA 3E02A 1UBSA 2E6FA 4TV6A 2WZMA 3NGFA 3D5HA 4DXVA 2VFEA 3OBEA 4CLMA 2BY1A 2SFPA 2X7WA 5LYRA 2G96A 5FESA 2BNJA 2F6UA 3F2BA 2ACRA 1TZZA 5FAGA 1QNQA 2QAFA 1MO0A 4F3HA 1W9UA 1OFQA 3WUEA 1DIEA 3UG3A 5H2ZA 3TH6A 5C8BB 2BHUA 3M6YA 2OCZA 3CWNA 3M0YA 5DT5A 1QOXA 4DJEA 1E9YB 3EYPA 1VD6A 1TPUA 1PS9A 2B7OA 2DZXA 3VNZA 1E71M 4LRTA 2J77A 4IXXA 1OD8A 2YXGA 5F1VA 2PDKA 3O6DA 3W74A 5TD4A 1E56A 3I3BA 3F2CA 2OQHA 1LCOA 1PB0A 3QTPA 1W5PA 1TPC1 4MDPA 3WNMA 3CLMA 2CWXA 1DJZA 4QAWA 2G3NA 2ZWYA 3ME3A 1WOBA 1MQRA 3HG3A 2GVJA 2WNWA 3HJZA 3UERA 4JTUA 1MNZA 4MNJA 3BLEA 1TRDA 2XZ7A 2XG9A 4GUJA 1EFZA 3B0VC 4FXSA 4AZCA 4IX0A 1FWFC 1WKDA 2WC4A 1WBHA 4QG6A 4JIRA 2ZE0A 3ONBA 4ORIA 4NJGA 5E6YA 3HGRA 2AAAA 4X22A 1ZP3A 4B5XA 1AW5A 2IKHA 1UZDA 4MKVA 1PTGA 3GHUA 5MKGB 1JCMP 2GQ3A 2ACUA 4N9BA 3LHWA 3WSUA 3GTNA 5CPMA 4UUIA 1KFKA 4BQ4A 1RLCL 2ISWA 3WLIA 4J3XA 1CIUA 3OYZA 3CH9A 1UH2A 5JVLA 5AC5A 4J28A 4UFLA 1OD0A 4QDPA 2ATMA 1BRLB 5C2CA 4GH1A 1Q6LA 1W3HA 5CPLA 1ISVA 5I09A 3WBWA 1BPLB 2FFIA 4TTGA 2OXNA 4IP5A 2UY3A 2VZTA 4B9YA 4NJHA 4S2BA 3TC3A 3T81A 3ZT6A 1U83A 2PC4A 2W0UA 2X30A 1JCXA 2Y70A 2OEKA 4FLRA 2P88A 1YHTA 2O9PA 3MI2A 1LYXA 3IAPA 1W3KA 1SFJA 3UU0A 1FY6A 1LOSA 1U30A 4S3FA 1TREA 2OT0A 5FOOA 5TBOA 1VLWA 3WLRA 3VINA 1XFCA 4LWWA 1Y7VA 5C9XA 1AQHA 1R3WA 5DRCA 5A2CA 5G1YA 5HA7A 3TDFA 3WLSA 1YNQA 3BMWA 3FNDA 1NELA 5A6SA 2FTWA 1HVQA 1OCQA 1X96A 3VCRA 5DF0A 4J3SA 3MUAA 3VZZA 1DXEA 4DWSC 1QPRA 4DUVA 1M3UA 1JZ7A 1GEHA 3VKBA 4GHRA 3CUXA 2GDUA 4JTLA 2EGZA 2XIQA 4EPKA 1HX0A 1EBHA 1ZB5A 1EYWA 3EDFA 4ZQCA 3VOHA 4ZOEA 1S2AA 4W93A 5FSEC 1Y0EA 5EMUA 3SUWA 4WRHA 4QTGA 2D3LA 3UY7A 5HUPA 1ZALA 1XLFA 3N11A 3LRMA 5ABFB 4D6GA 1JYNA 2Y8UA 1BYAA 3TSMA 4GISA 2G41A 4FNRA 4BHYA 1REQB 3GXDA 3RN6A 1TPH1 5AHNA 3GVRA 4Q6XA 3MHGA 1XP3A 2OKTA 1J11A 1HXJA 3KBMA 3W70A 3MC5A 4Z2KA 4CD8A 1B3YA 4GVIA 2E1DA 1ZCCA 5JU6A 2E40A 3H7VA 3USBA 4AC1X 4PZVA 3WDHA 2PGWA 1UPPA 3VNDA 1GYNA 3LOTA 4JBRA 4JKLA 4Z08A 2V82A 4OOUA 1XFBA 2PWHA 4MLRA 2VENA 4Q33A 4H7VA 1M68A 4J3WA 5G1MA 1XV8A 3K8LA 4ML4A 2W27A 3T42A 4AVOA 1CNVA 2TPSA 1HL9A 4C7DA 1CGYA 3EGJA 1R86A 3R11A 2PDYA 1UWUA 1CB2A 4Z0JA 4K7YA 1F74A 1OFBA 6CGTA 1AG1O 1K6WA 1RY0A 2Q01A 2GPTA 4L6DA 2OWCA 2IPGA 3TYAA 4GKTA 2HXTA 4WQ6A 3S47A 1UMYA 1EJSC 3OJGA 3ITLA 5PTDA 4R7JA 4ZENA 1UH4A 2VCCA 3UYCA 2PE4A 4NG3A 1IWBA 2DVTA 2J7FA 3E2SA 1V77A 4MHBA 4MUZA 1XYBA 1L9WA 2RGMA 4GQBA 4M82A 5HQMA 2OFJA 3MUXA 4A3UA 2XVLA 1RVKA 1RBAA 1PHWA 3I7RA 3ZXWA 2ZVRA 1BWLA 1OGBA 1WXYA 3QTGA 1KKOA 1Y5VA 4LBUA 4ZQPA 3CZGA 3ZFHA 4WF7A 4AC7C 4DBEA 4HNUA 4OE7A 1HIZA 3SO7A 1PPIA 1IEXA 1EX1A 5ABEA 3FVMA 5JH2A 2OX1A 4PUJA 1L6YA 1FKWA 2YFOA 1ZFJA 1E43A 3ITOA 3VUPA 1LOLA 2P3ZA 2CPUA 1PIGA 4DO7A 1JI2A 1K8XA 4G56A 4WR3A 1GQIA 3T8LA 1B1YA 2HNHA 4O0KA 3R89A 3UF9A 1LG1A 4D9PA 3QGAC 2Q6ZA 4UNIA 4CNUA 3ANVA 1GNXA 2QMJA 3LLXA 2VUNA 3WDRA 2VXNA 1NSJA 3SCRA 2PWFA 3V0SA 3HG2A 2WCSA 4DM1A 2JKPA 2CZEA 3S3GA 1R3SA 1RXOB 1QCWA 4B5UA 3HPSA 1S2WA 2PURA 3E5PA 3FV9A 1NF7A 1KRAC 2V5CA 1BKHA 2MANA 2V68A 2W63A 3G6MA 4F0HA 4O12A 1F76A 3E2VA 4US5D 4Q4SA 3VKJA 4DUWA 1VHNA 1SJDA 2PF8A 2H3BA 5FJTA 2BP1A 3CNYA 2DZWA 4M80A 4RDYA 1VYPX 1UPMB 4AX7A 4L9ZA 3AQUA 1L2QA 4RR4A 1XWYA 2AKZA 4O28A 5IBXA 3F4VA 1AVAA 1VPXA 4E3TA 3M0XA 4I9AA 1PZ3A 3AYSA 5JXQA 3AJ7A 3GHTA 3S1GA 4Q8TA 2G95A 2CLEA 1ITUA 2NXGA 1XHGA 3EXSA 4K8GA 2A7RA 3EWXA 1R47A 3LBMA 1EUAA 1W3LA 5BW6A 4QJ3B 1ZBWA 2WLZA 1S2VA 2HBXA 2RGLA 4IZGA 1RAKA 4ACZB 1YXCA 1XIDA 4HCHA 1GHSA 3SCNA 1Z69A 1KW1A 4PTMA 4PYSA 3NR0A 2JIWA 4HK5A 3KL3A 3GG1A 5FJRA 2X40A 3L4UA 4ZE4A 3M0MA 2NX1A 3G1AA 4I9TA 4HNCA 3VIOA 1DKWA 3V5CA 1YBQA 3R5EA 3CUGA 3CUIA 5FJIA 3GBEA 5FD0A 4L56A 2OYMA 3HFTA 4ZBCA 5A6BD 3TYBA 3GZ3A 1EXBA 3VDBA 4N7QA 2DQXA 3N9SA 1TMLA 1VYRA 5HR7A 1JPHA 3BQ5A 1BYCA 1EJ7L 3ZS4A 1M7PA 3IVTA 1R3QA 1WKEA 2Y63A 3EDKA 4Y9NA 2V9DA 3QY6A 5KEZA 1W3TA 3GW0A 1G4SA 1TV8A 3H7RA 3UJFA 5I00A 3IIPA 3APGA 4PMOA 3CAKA 2ZOXA 2HS6A 3MWCA 1PX4A 2VD9A 2BVWA 3VX0A 2VR2A 2TSYA 4HB7A 3AO0A 3W2NA 2DVUA 1PZ0A 3LMZA 2AAMA 2QGHA 2VDIA 3ZIZA 4Q4RA 3T6CA 4AZIA 3DOPA 4RW3A 4FOKA 3TONA 3TYEA 1P6WA 1GVFA 2CLOA 3BE7A 1PL9A 1EC9A 3I3DA 2R1PA 3W28A 1PVNA 4S1FA 4YU1A 3N17A 4UQBA 3HGSA 2WAGA 3RX2A 4WDWA 4WGHA 4DNMA 4LS0A 2VWSA 4IGNA 3IV8A 4HYWA 2FVMA 1GOQA 1VBRA 2C15A 2X1IA 4OBTA 1O1HA 1TTPA 1UR3M 4LEQA 4Q32A 1H2JA 1YIXA 2NQLA 1U2YA 3F7JA 1LL4A 4RE2A 5AHFA 2WNZA 3HM7A 1M5WA 3WJXA 1YE4A 4P8VA 3FEQA 3NL6A 3VYLA 1E6XM 3S6TA 1KM5A 1LWIA 1MW1A 2HEJA 2J8FA 4O1DA 2WKJA 4Q8NA 3DFPA 3W82A 4LSBA 1K77A 1WDWA 1YPIA 3TW9A 4ZVJA 3FVDA 1FWNA 4UFMA 4LANA 1E9ZB 3GTXA 2WYSA 3GH4A 1UP3A 3SGGA 4Z2GA 2FFCA 1O68A 3H2CA 3UXLA 4EAYA 5CPSA 3N04A 1G4PA 5EBUA 5D9PA 4DBSA 3HN3A 3M41A 1HGWA 1ZQ5A 4FNUA 3WNNA 4KFPA 1UOKA 3BLPX 3RX3A 3M5YA 2A5HA 4Z17A 3HV8A 3VGEA 1Q63A 3UG4A 3W75A 3VC5A 1OGGA 2BV9A 4PH6A 3NZ1A 2OGJA 3A23A 4IUOA 2Q71A 1DJYA 3C0LA 3TAKA 1ZL1A 2GK1B 1JIBA 1US2A 1H63A 3POCA 3V0TA 3ZJ8A 2IQDA 1XSIA 2C1IA 4Z2JA 3PFMA 1TV2A 3KZPA 5HMSA 2ISVA 3FGCB 2PRLA 1XYAA 2CKRA 3VM5A 2X05A 4LNCA 1X1OA 1EWEA 3TN4A 4S3KA 3UJRA 3AUJA 1LWHA 4NXSA 2O4MA 5CBBA 2FKPA 3MI6A 1AQ0A 5C9WA 4J40A 3GNRA 3WD1A 4CD5A 1MYRA 4KESA 5CBIA 3B03A 2P3EA 1DE6A 2OYKA 1EIXA 8XIAA 2P5NA 3H22A 2PDIA 4DZHA 3GC4A 1VFSA 1NQ6A 1XRVA 3FA3A 3TSBA 2ZQ0A 1JZ8A 3PUEA 4WHBA 1RBOB 3TFXA 4HA4A 2ZADA 1R3VA 1EPVA 2Z1VA 2XSAA 1EP3A 3T4CA 6REQB 2V38A 1XLJA 4GACA 2BOGX 1XIGA 3HMCA 1FDYA 1MRAA 4LAMA 2Z6IA 4H9UA 1Q7MA 3SN4A 4DQWA 4GIRA 1FOBA 4B91A 5RUBA 4U3AA 1SZRA 2VQUA 3BPWA 3R8RA 4AZ7A 3KVLA 3NXFA 1LF1A 3W83A 1S38A 3V7PA 1G0CA 1DJNA 3Q2DA 4H8VA 1E9IA 3WLHA 1LTDA 1CECA 3U9IA 4KCTA 3QV9A 4DN1A 1H62A 4LUSA 1EIBA 1CGUA 3GLCA 3QPEA 4KW2A 5HDRA 3P80A 3SDOA 3TSDA 1GVOA 1IR1A 2D22A 1Q6RA 2EG8A 4MWAA 2C0HA 5T8GA 7REQA 3ANUA 3G1HA 2QIIA 3SCWA 2A7PA 3R8GA 1PDZA 5LKYA 4R27A 1R5YA 1VFHA 4AWTA 2VGIA 2RDUA 2W4XA 5A6LA 3FA4A 3E0VA 5CSUA 2DJXA 3LHTA 3W7MA 1VJIA 3QQ0A 4ZEPA 5EU9A 3BOXA 1QJWA 4K1WA 1A5SA 1I2NA 1P5BA 2JK2A 3BDKA 4GJJA 3QGVA 3FDGA 3AMDA 3NPXA 4FK9A 2YCLA 3ZVHA 5HXMA 4JYFA 3A9BA 1EA0A 1KA9F 3CTLA 3KWXA 3AHVA 4Q8PA 4JX4A 3OVRA 2D2HA 1JCLA 3L0NA 2GGEA 3UYIA 4HNOA 4MF4A 4UB9A 3TMQA 1HZYA 3BW3A 3GFXA 4J4KA 2GUYA 1CXKA 1QNRA 1TG7A 1H0GA 4Q7BA 4B4FA 3UWQA 3N13A 2X2YA 4IF2A 5HNNA 3THAA 3DUGA 3W86A 2XZ9A 1O5XA 2OODA 1R9YA 3AMGA 2RKXA 3QZ6A 3G0XA 3MKCA 3PC0A 1K9TA 4D1IA 4KERA 4P7OA 1CBGA 3TC6A 4E8GA 3EWBX 5B7YA 7A3HA 2QIWA 5JQ9A 2OTDA 6XIAA 2P53A 1GCYA 1UIPA 4QRNA 4JXCA 2PBGA 1SZEA 4PTDA 6XIMA 3A22A 1HNYA 3JU2A 1FCUA 2QJIA 1SW0A 1BF6A 4WXYA 3PBMA 2J8GA 2H8ZA 3WD2A 2HXUA 3GXFA 3E74A 5BOEA 5I5RA 3CS2A 3VI2A 3P0XA 3IUHA 4EANA 4WJXA 4KWOA 3ARPA 3H2EA 3W29A 4IFRA 3KHDA 3DDMA 3H55A 4V27A 3VD4A 3KHJA 4QQ3A 1VPQA 2V0TA 1IXNA 2FLIA 3VNKA 2GUBA 3NQEA 1JRBA 3QFWA 1J0HA 4KCUA 5F1UA 1A5UA 3II1A 3WN6A 1BYDA 3WZ0E 3R10A 1V7YA 3U4AA 2R8WA 4LY4A 4GE8A 4ES4A 3TTQA 3N2BA 5LGXA 2JEQA 3OBAA 5T9BG 4N9DA 4IP7A 1Q6EA 3B8WA 4FNQA 2WCGA 3P3BA 2GSHA 2V69A 8CGTA 1P48A 4NZ3A 5TF0A 3GG7A 3U2EA 4OV4A 2P0IA 1RA0A 4H7ZA 4OBSA 3A64A 1QI2A 5KITA 3TJXA 4H7CA 5CSYA 4MIMA 4JTGA 4IM4A 4JIIX 4GZEA 2F6KA 3R7MA 3ZJ7A 1V3HA 3AS2A 3BW2A 4PCNA 2PGRA 4KS0A 4DWSD 5F2GA 2ZDRA 1W91A 2EO7A 4S2CA 3N4EA 3SUUA 4JPGA 3FN9A 3KP0A 3OLGA 1EXPA 4B9ZA 4XX6A 4YHGA 1LRTA 2XGBA 4GVGA 2CZDA 2P8CA 1LLWA 3EOSA 4HZ8A 3G1DA 3LV6A 1FH7A 3CPGA 2QJHA 4X2PA 1I4NA 3A3WA 1PTAA 3H8AA 3A13A 2WSQA 5AVHA 3W6MA 4GUGA 4DO4A 1IXQA 2YBVA 4Y9PA 4BQ3A 3MP4A 3DYPA 1ONRA 1KO0A 3VDAA 2ALRA 2QQ6A 2I7GA 3VPLA 1CGXA 4GRSA 4ERGA 2VC7A 4U5KA 5DX7A 2Z2UA 1GPWA 4JFTA 2Y61A 4YVVA 4JIPA 5HANA 2YSWA 3LY0A 1VH7A 3W2LA 3QW3A 2Z4GA 1GZGA 1YNYA 2QDDA 2DZVA 1LLOA 2A3AA 1NWSA 3HPXA 4FX6M 5DCBA 3WMSA 2PDMA 2WHLA 3W23A 1GW9A 3EB3A 2YL8A 1AZ1A 2ZZ6A 4UNLA 3TV8A 2WZIA 3ZR5A 1PKMA 2GDQA 3W00A 4E4FA 1K8CA 4Z2LA 4P7QA 3W7QA 2QUNA 4O57A 4JL2A 1J6OA 1UWIA 1HJWA 4PSRA 2W67A 3L5AA 4HK7A 2G8ZA 3H54A 2QR6A 4R85A 2PI6A 3RU8X 4C6IA 1JVNA 3ORWA 4R34A 4NYUA 3EOEA 3WQCA 3W2MA 5I23A 3L12A 3FJNA 2YDQA 2J7CA 3BO9A 4DLFA 4ADTA 1UZ1A 3QZAA 2ZX5A 2VELA 1BSIA 3DG6A 3HFYA 1L8PA 1KLYA 1I2RA 4JZ5A 3GO2A 1VJSA 5M5DA 4Y96A 3Q45A 2AL2A 5A94A 3NL2A 4HMEA 3UWEA 3B0PA 1TJ0A 2V2DA 4NAFB 2WM1A 4PCFA 1MW3A 4X0VA 1V79A 3UCQA 4LBSA 1DWIM 4MPQA 4JTSA 4YHEA 2C3ZA 4HSOA 3OEXA 5E70A 1IEVA 3P61A 4A29A 2WWDA 2E67A 4C65A 5FEPA 2NW0A 1WNOA 4UTLA 3CBWA 1JI1A 5FF0A 2WNQA 3DC8A 5CJ5A 2BFGA 3UWUA 3EAUA 1BQGA 2GJXB 4E2DA 3NL3A 1TUXA 1RVGA 4I3GA 1CXIA 3U2OA 3QHOA 4HZ7A 3EXTA 2PLJA 3E0LA 1TWSA 2A2IA 4LVDA 1EQCA 3IACA 1KCLA 1QOPA 2E25A 4MY9A 1UR4A 1V0LA 2PODA 1OIMA 2BVDA 1O60A 3C4UA 3FSUA 3EX1A 1B31A 1PKYA 2D23A 3NO3A 4IGSA 3KVJA 1BEUA 1MVYA 4AUBA 3A5VA 3S42A 2E6AA 3HO8A 3GVWA 3G77A 1AODA 2VT0A 2XVGA 1C91A 3HMJG 2X09A 2PTZA 1NOUA 4DB7A 3V16A 2V2HA 1KWGA 2QVHA 3WJWA 4A21A 2W5FA 4UTIA 4WKAA 3ZSTA 4XZHA 4H8HA 3VIKA 3KXQA 3RF9A 1E6PA 2ZX9A 1WP6A 1KM3A 5D2WA 4LVGA 3NQ2A 1H1ZA 1J18A 3CHCA 1W8SA 1YKWA 1TA3B 3T2PA 5F4XA 2VZSA 1Z48A 4AX6A 1R2SA 3BCDA 1A53A 3KCJA 3AXXA 2PCEA 2J6VA 2Y62A 3NDOA 2AKMA 3ECQA 3UGVA 1OX4A 2ESCA 1HKIA 3O15A 5LIYX 4DUOA 4J2PA 4W8AA 3S1VA 5SWUA 3NQ6A 2DDXA 1LRNA 1S5VA 4PUEA 4DRSA 1XQKA 3S5SA 4TU1A 4V15A 4XZLX 3W3OA 4LYQA 3K4DA 3M07A 1B3VA 4M5PA 4PR4A 2E9LA 1VBHA 3HTWA 2MNRA 3KOZA 3NZGA 4C6JA 3WBXA 3SCSA 1TZ9A 4R9OA 2PMQA 5XIAA 4EF8A 4R7WA 3W26A 4PTVA 1H7WA 1XISA 3J7HA 1V3JA 4ZOAA 3A4XA 3WH7A 1OT2A 4BF7A 1ELSA 1SZNA 3E0FA 4KETA 4EPEC 4IQJA 3QV6A 1RP9A 1IHIA 5G4EA 4L4PA 3EX4A 5G4HC 2BX7A 3L4YA 3GSMA 4YN5A 3L2LA 1NDVA 2XFFA 1TTJA 5BU9A 1IT8A 3AMCA 3GC5A 3WH5A 1PHQA 4JIHA 1GOMA 3ZJKA 1JYWA 3KBSA 4K3ZA 3IJLA 3JRKA 2EF9A 2YW3A 3S1UA 1QWGA 1E5JA 3H53A 1UR1A 4AQLA 1DPMA 3WNOA 2A0NA 2HROA 4R5EA 1NM9A 4J2MA 2FPVA 3OA3A 4TVDA 3QEZA 5KZEA 1EA9C 2QJMA 2XTKA 4GJIA 4JFVA 2R1LA 1GW1A 5DT7A 4B2DA 2XIBA 1PO9A 2QPXA 4A4AA 2WC7A 1JPDX 3IS4A 1TMQA 3WCZA 4UXDA 4MZ1A 3PZTA 1QW9A 2E8YA 4K39A 1C90A 4PB5A 1MQPA 2VP8A 3EWUA 3NFUA 2FH6A 1H60A 3NQAA 1J5SA 2NWRA 2QCMA 3BAYA 3M47A 4QJ4B 3ARXA 2OQYA 3MS8A 4NZJA 3FAWA 1J79A 4XISA 3TTSA 3WQGA 4US6A 3W7HA 1IZCA 4DZIA 3WUGA 3A9IA 3JZEA 3LQLA 3LUTA 3B8TA 3ZT5A 4B5NA 5D4YA 2NLYA 3AHTA 4YVXA 4MLJA 4QCFA 3G3DA 2F2KA 4XKYA 4U28A 4V28A 3WK2A 1ZLPA 2HE8A 2Z1BA 3B9EA 1EJWC 1OC5A 4IL0A 3NO5A 1KCZA 4CU8A 3SJ3A 2YCKX 3BAIA 3A5FA 4M7SA 4IIBA 3T2QA 1GJPA 1QPNA 1UP0A 1XKYA 3W1UA 2A4AA 1WV2A 1QBBA 1W5MA 3K8KA 4C60A 2IUZA 2YDAA 2XH2A 1S2TA 5E0FA 4AIUA 3VMNA 1FQ0A 3CAVA 5DXYA 4FMVA 5CGQA 3Q4DA 5LNWA 2GDVA 2E77A 3DGBA 4FLOA 3YPIA 4YYCA 3MANA 1ZRQA 3NSXA 3GZAA 3KP1A 1RJQA 4MB5A 1TV7A 3V5FA 4YCPA 4LALA 4CVUA 3UXIA 4AZ6A 5JBDA 2Y4SA 2VEMA 2XFWA 3FHAA 3USZA 3MUCA 1AK5A 1AH3A 3W01A 4MB1A 3TJLA 3JVAA 1AUSL 3G1VA 1SZGA 3MO4A 4GYPC 4PCSA 4ATDA 1TMHA 2L5HA 4AHQA 1V3LA 4M8UA 3RR1A 4URIA 3WD4A 1KBLA 3OZPA 2YDSA 4MFEA 3O06A 1PWMA 3UR7A 1KM1A 1L6SA 1UC4A 1XLGA 5BROA 3TW7A 1LZOA 1EDGA 4UTFA 5E5CA 4LF1A 5CGTA 1VFFA 3WLMA 1BFNA 1XYMA 4JQ3A 3IJDA 3L21A 4G1KA 4GNVA 4RE0A 2VZUA 4X61A 3L68A 3UZXA 3ZM8A 5CBJA 4DX3A 3SI9A 3CB8A 4OWGA 5JBEA 3AC0A 3IPWA 5DELA 3KVKA 1BGAA 5CPOA 3RMJA 4B5VA 2O7QA 4XV0A 1LL6A 3KTCA 2VTFA 4S3AA 2BHZA 3GKAA 4EVZA 4IIHA 1LJYA 1R9XA 5DQPA 3OPSA 1I2QA 4UCGA 2VFFA 4M6VA 3BAJA 3E3HA 4KEVA 4INFA 2RHGA 3H70A 5EPDA 1KGUA 1GONA 1GKPA 2WVVB 1F5ZA 2Z24A 3GXMA 3FCPA 3V35A 3RYSA 1Z9AA 4A8NA 1MMFA 2J78A 2GWGA 4LCSA 2Y5JA 1I2OA 3UZZA 4PUMA 3W76A 4H9TA 2OYLA 5REQA 3WJYA 3SY1A 4RV8A 3KE0A 1W2VA 5D2TA 3B9AA 1U22A 4W5UA 3S6DA 2EQDA 4LCQA 2CFFA 3TWAA 2EHHA 3IJQA 3NIYA 3BQ6A 2EPMX 2A85A 2A3CA 4PBGA 2X0SA 3ARWA 3NGJA 4DELA 4HPHA 4Y9MA 3GH5A 3LXAA 3P14A 4XD3A 3CK5A 3ZMRA 2C1GA 4IMCA 2EEXA 4OZOA 2PEVA 5LSMA 2VJXA 1QBAA 1FH9A 4X60A 3WJSA 4W85A 1PV8A 4YVPA 4FALA 2VR5A 3TYDA 1WBJA 2WMHA 4WY0A 3LYEA 3KCOA 1PIFA 1KFCA 2GGHA 1YXYA 5DRIA 4ROPA 2VFGA 3TZFA 1JDCA 5AYIA 4JNYA 5DCDA 3WMLA 3S0CA 2FDSA 3FIGA 1KR0A 4RPPA 3BICA 3GY1A 3M5ZA 3FYPA 3ARSA 3W1MA 3T0DA 2RUSA 4GGHA 4LUIA 4EOUA 1ADDA 4PMZA 4HTYA 3DI0A 4DXKA 3LPGA 1OFEA 3E0WA 4AZHA 1WUEA 3UETA 4F2TA 4E0CA 1G7UA 4U3CA 2Z7KA 3SSZA 5F2IA 1VBUA 2H9AB 1WDQA 1AZ2A 2J9XA 1QAPA 1C8YA 4H6QA 2PA6A 3QSRA 1TB3A 4O8RA 2PDNA 3H4XA 3V36A 3O05A 1GYLA 1OC7A 4DJDC 2WJEA 2V63A 5E09A 1XLHA 1YX1A 2BODX 3KLKA 1KBIA 3S46A 1T6MA 2CCRA 3HZ3A 4GK8A 1B57A 4I9JA 2BXVA 3AXMA 1OYCA 3WH8A 4QDWA 1H1NA 1H41A 4WEVX 4AWSA 1EEXA 5FEWA 1LM1A 3R25A 1A5NC 5CZKA 4WXZA 1EL3A 1NQKA 4GH3A 3PN8A 1DXFA 2Y1HA 3GVVA 1JF6A 4EAMA 3WL0A 3R12A 3OVPA 2ZZ7A 4JKMA 1KM4A 3M7SA 4UOZA 3O6AA 4XO6A 4JN8A 1BGGA 4KEZA 4IGHA 2WANA 5D2YA 1IZKA 2UZ9A 4M29A 5BMXA 4PCTA 1NDYA 2WMJA 3W7OA 5DBTA 2V30A 3AWNA 3WKZA 3EPMA 3HOJA 9CGTA 3BCJA 2NT0A 1ZSXA 2EJAA 3K4WA 3WLQA 5A2BA 4O18A 5A8NA 4D6CA 4PL1A 2ISFA 1N8IA 1GZJA 2QCFA 2PF0A 2YX0A 5K2ZA 1Q7ZA 1QPKA 1M9HA 4GUHA 4GI6A 3LV5A 2HISA 2C79A 4LT9A 2HVMA 5F2MA 1G4TA 3CXOA 1AMKA 3U7VA 2Z1KA 1T0OA 3S1XA 5KSWA 3S5ZA 5M17A 2FPTA 2XFRA 3VCCA 1W1TA 4QEEA 3NQDA 2QDEA 2Z6JA 4O54A 2I5QA 5I77A 4MFDA 3MW7A 1GT8A 1D3HA 2W3ZA 3S5YA 2IMRA 3OLEA 2J66A 3TTYA 4JNZA 1KNWA 4NXKA 1W2PA 2PLKA 3HBLA 3AZSA 3AHZA 5BNKA 1JJKA 2DW7A 3QF0A 4I7UA 3T4WA 2CC0A 4OFCA 3VTRA 3GFZA 3TTEA 1QHOA 1SPQA 1DJHA 3NDYA 5BWFA 5TAOA 2C14A 3RGTA 1Q6OA 4OVXA 5K9DA 2ZUWA 5ABFA 1TKKA 3TQ0A 3GYCA 2NLIA 1REQA 4ADUA 3DENA 1AQMA 3AIBA 1B4EA 3OIXA 4R9XA 1AJ0A 3M0LA 3UT0A 4ERIA 1PZ1A 4LVFA 4H6RA 1B5TA 4JL1A 3RK8A 3P8JA 3NSNA 2ZE3A 2BZNA 4NI3A 1NJJA 3VIMA 4ZQOA 1QPQA 2C1HA 3LSBA 4ZMGA 3DBPA 3E12A 4E4PA 3ZOAA 3IGSA 3BH4A 1JDDA 2J7DA 5D2XA 3FJ6A 3BURA 3R2GA 1QRQA 5D30A 4QSHA 1XGDA 3CZJA 3O0KA 4TXEA 3NA8A 4Y9AA 2NXIA 4KH2A 2PB1A 1C92A 1Z44A 4DZ5A 1HGYA 1V5XA 1V4YA 1F05A 1OFOA 1TX2A 2X41A 1ZBVA 3GTHA 1HP4A 3PZVA 4IJBA 5D8WA 3N3TA 3GYEA 1I1XA 5T26A 4LUJA 3KVMA 1SJCA 1W1ZA 3DHFA 3MV01 2AQOA 2XIJA 5HINA 3SGUA 2FB2A 2QLYA 3N2MA 1W3IA 1CX9A 2PPGA 3U48A 2W66A 1N2VA 4S38A 4HN8A 2XN1A 3CV7A 1QK0A 4FNPA 1TE1A 4V2XA 5JBFA 4AEOA 3DIPA 3LGEA 2E5BA 3OA5A 3CHFA 4JTTA 3CEUA 2VR4A 4MKSA 4JQ4A 3BG3A 1XJBA 3M9YA 3E2QA 3ERPA 4Z0SA 4RDZA 1ME7A 4AD5A 3VABA 1HL8A 3QM3A 1EOMA 4R53A 1HJXA 1UASA 1VCFA 3LCWA 1KRCC 4GY1A 4NQ1A 4XD4A 3AIUA 1TJ1A 4CGTA 4PL2A 3S2MA 4OJYA 5FEXA 3LG3A 1GZ1A 2JF6A 4ZOCA 1RD6A 5DMMA 4AFYA 1KFJA 1HKMA 4O1CA 4PUNA 4CQBA 1XDJA 2J79A 3GB6A 3RILA 2FZMA 5B7ZA 1ADOA 1SSDA 1QUMA 1O5RA 3F4DA 4HNLA 3W53A 2PS2A 4P8UA 1WDDA 2HK0A 2J7HA 4NU7A 4O4VA 4MTVA 2CHNA 3TIMA 2A3HA 4ERAA 4CN6A 4ZO6A 3TVAA 4FB7A 1X1ZA 1GKQA 1HO4A 4HHHA 4HHMA 3W87A 1TPVA 1BG4A 3GHSA 3ABQA 3BANA 3UPMA 1U1HA 1MEHA 1I2PA 3DHUA 3BTNA 1V02E 3LENA 1WE5A 3PVFA 3GAKA 3S5NA 4A3HA 3VZYA 5G5IA 4BI6A 4PE8A 2EKGA 3W85A 4CD4A 3PZIA 3ZVIA 2VX7A 3SN0A 3SQLA 2AL2B 5AYBA 2PP3A 1A3HA 3DFYA 2XN2A 2HVOA 1E4LA 4XUYA 1YDYA 1EGMA 2WZTA 4AY8A 3S2CA 2RAGA 3T08A 4RPQA 3GRIA 3VNMA 1WOAA 1H5VA 3QJAA 1TWZA 3L67A 1XBZA 3NYDA 4U5IA 2F8QA 2J47A 3ZYZA 3LPFA 1VENA 3NVTA 4ICCX 2BMBA 3DBNA 3HA1A 3URBA 4ACZA 2R14A 4GBDA 3THCA 4BI7A 2C91A 1WZLA 1Z7AA 4B5TA 3MKKA 3AS3A 3WEOA 4IXHA 5DFAA 2GGJA 5HR6A 1PCKA 4UTJA 3UXKA 4ZB0A 4ZB2A 3W2KA 3C2YA 2ZUVA 1TUFA 4W4QA 4H8NA 4ZL1A 7XIMA 1C8VA 5LNVA 1F3EA 4AD2A 4ONVA 2WHMA 3BGGA 4PGLA 1JZ5A 3T8QA 3W27A 4QLLA 4TX6A 1IGSA 4D8ZA 5BOFA 2NX3A 5A8QA 3C2OA 3B8UA 3AMKA 1KM0A 1UWTA 3PWGA 4H01A 4ZSUA 3GNXA 1XCXA 1L6GA 3R79A 2YXOA 4CU7A 3MB9A 4L9YA 5H6HA 4IG2B 1E1CB 4QEHA 2DSWA 3UD6A 1X6LA 2R1NA 4LYKA 1FTXA 3RLVA 1ZJHA 4DBUA 1O12A 3UJ2A 2CLMA 3PBWA 2BGNE 4JKKA 3T09A 1SR9A 1E70M 1ENUA 3P67A 3OLIA 4QNEA 5F4SA 2HNEA 3PM6A 2XVPA 5HWJA 4ACYA 4H9MA 3ZR4A 2QDHA 3V5OA 2Y8VA 5AVNA 4XBKA 1KB3A 2DU2A 4A35A 2EPKX 4JTHA 4AYSA 4HIBA 5I03A 1OG0A 3QFEA 1MUMA 5JUVA 1O5QA 2X1SA 2EXOA 4LV9A 4PRRA 3TUUA 3PUGA 5A6KA 4KWVA 4HA3A 4P8XA 4YWIA 4XSMA 3AMLA 1N7KA 4JYEA 1PE1A 1TPEA 4OU1A 2TMDA 3U0HA 1CWYA 5G2HA 4IJRA 1LBLA 1X38A 4KBXA 3W7GA 1LORA 4JTCA 3E5BA 4CNOA 2X2GA 3BZJA 3PSVA 1K02A 1A5MC 4N42A 1XKJA 4S3BA 1W1A1 2FYMA 3LS9A 5CLWA 1GGOA 1UQZA 2WZEA 4HU0A 4F9JA 3NM3A 2CLFA 3C5QA 2GL5A 3TEVA 5A8PA 3N14A 1KRMA 2ZXQA 2CETA 2VEFA 3P81A 4Q6JA 2UV8G 1EOKA 1W5OA 3AYVA 4F9DA 3NSMA 3LZ5A 4NKCA 2WK2A 1GQNA 5EBAA 1T7LA 2CLKA 2QJNA 4PMRA 2OOGA 4JTJA 3NUKA 1GUVA 1TVLA 4UCFA 3SADA 3GNOA 1XBVA 4UMAA 3WNPA 1NWTA 3LCIA 3CV2A 3ZQ9A 3DHPA 1LP6A 1YDVA 3VOJA 3BAKA 1XLDA 3GD6A 3CH0A 4GIYA 3DG3A 3BGAA 2XISA 5DY2A 3EWDA 3RLGA 5LHEA 1KM6A 2GK1A 3QMSA 3ARZA 4K6AA 4ZB5A 3OP2A 1EF2A 1CLKA 3SECA 2GVEA 4H00A 3PJTA 5CG7A 3FGCA 4GOAA 5FAJA 2GSJA 3AI0A 2A6LA 3PZOA 3BSGA 2QAPA 1VJZA 2C0AA 1FUYA 2WXDM 4EPDC 4AF0B 2TAAA 4CU6A 1U1UA 4O15A 3QV7A 4DAFA 1E1EA 1XBYA 4EP8C 3P5ZA 5HPOA 3O0FA 2NT1A 1LROA 5HWMA 3W1TA 3WQFA 1FWRA 4MY8A 4JIEA 3RPTA 2PWGA 3GC2A 3DFQA 3WDIA 4DEFA 1A49A 1XYZA 1E40A 5BMWA 4Z2HA 1NEYA 1KFEA 4L5ZA 1H4PA 3IIOA 2NZLA 1XGEA 2WVUA 2PDPA 3CYVA 1K7EA 5D9NA 4EWJA 4HGXA 6REQA 3M0IA 3HB9A 4PB4A 1ZTVA 5C7VA 2DSKA 4PTWA 4HP5A 2ISSA 2BXYA 2Q02A 4O1EA 2QVNA 2O4QA 2P0OA 1UUQA 2WMIB 4IIEA 4AD4A 4AD0A 3QV8A 3AUOA 2G37A 2VEIA 1H7OA 2FPYA 3NWRA 4FXRA 1L2UA 4KIRA 3WD3A 2YCJA 3FXYA 5T9CE 1EJUC 4MNKA 4FIQA 3IGUA 3PTDA 4MAZA 1XCFA 2BDQA 1M03A 3DFTA 2IKGA 5FF4A 5CKSA 3LDVA 1XM3A 3LCXA 4ZA0A 5MF5A 1XH2A 4UMCA 1UD8A 3CAQA 1D3CA 5K3VA 4I5UA 5EFDA 1MQQA 3MCOA 3E38A 4H83A 2RDXA 4MVAA 4C1LA 3G8RA 1AH0A 5HMEA 4B90A 4J3VA 4X2RA 3AS1A 1TV4A 1BHGA 1BTMA 1Q7QA 4U10A 3EKGA 3IGXA 3LEPA 4I5XA 2DZTA 4KRZA 4ECLA 4HU4A 1YADA 6A3HA 1O4UA 1VGAA 3ZO9A 3L65A 5HNTA 3V18A 4H2HA 1POJA 3VGGA 5F7UA 2JBMA 2ZRZA 3ITTA 1XS2A 4UOJA 3KEHA 3UGRA 1JCNA 3MO7A 3OTRA 2CXEA 2ADAA 3EXRA 4QCEA 2WQDA 2ZFAA 4US5A 7PTDA 1R9ZA 2A6NA 4JS3A 5CJMA 3V3WA 1HN1A 2ZUNA 1UR2A 4LUTB 1ODZA 3M0ZA 1R8LA 3I7SA 3UQNA 1O1ZA 2BY2A 4PUUA 5A8GA 2NVDA 1NWUA 1XIEA 3P60A 2ANUA 1LDCA 4REQB 1JUBA 2OEMA 3ELFA 3LERA 5C55A 4GYKA 1H11A 4H6KA 4NAEA 4M6UA 5EYWA 3BOLA 3AWOA 1Q8AA 1RQBA 1B2YA 1KGWA 3MP5A 4Y6GA 5H8UA 3HG4A 2I14A 1LBFA 2NV2A 4XZIA 2QUUA 2VD8A 3VDCA 3VC6A 5IFPA 1XRTA 1VEMA 1FCBA 1ME8A 3U6WA 1MI3A 3LRKA 1RD5A 4DJDD 3HQPA 3CZKA 1UWRA 2XH7A 4GPNA 3N9RA 5D38A 1GQLA 4H4IA 3D6NA 3W1LA 1E6SM 1V0KA 3SCTA 3P62A 3SY5A 2Y6ZA 4IP4A 3KOWA 1RZMA 2VYOA 3VO0A 3UR8A 3KZSA 1XYFA 3RXZA 4MY1A 3THQA 1V3KA 4MPKA 3U7BA 1EC8A 1AA1B 3IARA 5EGRA 2Y8KA 2AMXA 2OB3A 3N6QA 2BGSA 4LX4A 1SGJA 5AHEA 2XVNA 4O13A 3F1QA 1XIFA 1KFBA 3MQTA 1R38A 4GZ7A 4LV4A 3VCNA 3QR1A 3O9NA 4UTUA 1IZJA 2Q3OA 4PRWA 4FX8A 1Q13A 3QY7A 2Z0IA 4GZIA 3OGSA 2WO5A 2J8TA 1EF3A 3D3FA 5D8ZA 3CUHA 3GNPA 2O55A 1LG2A 1B3XA 4J3TA 2VDHA 1KQYA 1RSCA 4WY0B 2F61A 3ABSA 2PZNA 4N2YA 1CPUA 1FHLA 1SO6A 3LLFA 1EHNA 4HMDA 2IW0A 1MUCA 3VA8A 3VOFA 3DH7A 3GXIA 3VK5A 1SQ7A 2YZRA 4QLJA 5I06A 3SCVA 1DHKA 1TQXA 4C6OA 4UIOA 3WFLA 5C7HA 5LNRA 3LGDA 3QLLA 4XG1A 3OZYA 1XC4A 4YTRA 1R2TA 4YCOA 4LUYA 3C56A 5IHRA 2H3DA 1ONXA 3ZWTA 1XRSA 4PFMA 1DJXA 2XWEA 4PTXA 2C16A 2PFHA 4WY0F 3LB0A 4CQ9A 1W31A 4ZSTA 4WVXA 1HKKA 3B05A 3B04A 1PI