1TWZA

Dihydropteroate synthetase, with bound substrate analogue ptp, from bacillus anthracis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
266
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHPS, Dihydropteroate synthase
molecule tags Transferase
source organism Bacillus anthracis
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
total genus 94
structure length 266
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1twzA00
1Q7ZA 5JQ9A 4S3FA 3TYZA 4S3DA 3BOLA 1F6YA 4O0QA 1AJ0A 3TYUA 4S3CA 2YCKX 1AD4A 3K13A 2BMBA 3NOYA 4G9PA 4DB7A 2YCJA 2E7FA 4DJEA 4NILA 4DJEC 4HB7A 2DZAA 3H24A 4DJDC 4MWAB 1Q7MA 3TYDA 3H2AA 4DJED 4DJDA 3TZFA 4DJFD 4DJFA 2OGYA 3H26A 1TX0A 4MWAA 4CCZA 1AJZA 3MCNA 4S39A 3H2OA 4DJDD 3H2EA 4NL1A 2Y5JA 4D8ZA 2H9AA 3TR9A 2VEGA 3TYAA 3MCMA 2DZBA 3TYBA 1TWWA 4NIRA 3TZNA 3V5OA 4NHVA 2Y5SA 3TYEA 4PZVA 4MWAD 4DJFC 4DAFA 3BOFA 1Q8AA 3H2FA 4S38A 3H2CA 3H2NA 4S23A 4S3BA 1TWSA 2DQWA 3H22A 2VEFA 3MCOA 3H21A 1Q85A 3H23A 1TWZA 3H2MA 2VP8A 4O1EA 1Q8JA 1AJ2A 2Y0FA 2YCLB 4C1NB 2H9AB 4S3AA 1TX2A 1EYEA 4DAIA 4MWAC 2YCLA 4C1NA 2YCIX 3TYCA 4D9PA 4O1FA 4D8AA 4MWAE 1Q7QA 4S3EA 1AD1A
chains in the Genus database with same CATH superfamily
1DXEA 3VC5A 1MEIA 5D2YA 4HMNA 4Q32A 3QR3A 1O1HA 3WUFA 3SN1A 3W2KA 2GPTA 1ZRQA 4WK9A 4XD6A 2PP1A 3WBYA 1XINA 5GVJA 2MUCA 1EBGA 4LVDA 4R7OA 3ZXWA 1B3VA 3WX7A 4C6FA 4UQ9A 2XVLA 1X6UA 4FZIA 2HTMA 1XLFA 3OQEA 1RLCL 1EXPA 1J0YA 1RH9A 2XU2A 3E1F1 5JH1A 3W26A 4OFCA 2QLYA 2J78A 4WEVX 3AISA 5BRQA 4LEQA 1ML1A 2QZRA 3AWNA 4ROQA 3H2OA 4AZGA 2A7NA 1KLZA 3GTNA 3VIMA 4NAFB 2J88A 4E0CA 3GB6A 3WNMA 3BLLA 3EB3A 4IFOA 1MRAA 3BGAA 3E5PA 2BG5A 1UMYA 2CETA 1F76A 1K4HA 3G3MA 4RE2A 3MSYA 3BICA 5HPCA 1CPUA 1PYFA 3EOOA 4MVAA 4O4WA 1W8GA 4IG2B 4XKYB 2XFWA 1ISZA 2VEIA 4DZHA 3CK5A 3KVMA 3CNYA 4AXNA 1I6NA 4NKCA 1KWKA 3DHPA 4QRNA 3L4UA 4KERA 3NDYA 3HOJA 4LY8A 3BW3A 3WJYA 4TIMA 4E4PA 8XIAA 1EPVA 3NO3A 1XUZA 1V6UA 4C1KA 4WX2A 1E6XM 4F9JA 1W9XA 3SCTA 3SUWA 1UKPA 2Z00A 3QGAC 1QW8A 1ISWA 2DPEA 1V7AA 4UTTA 1TPVA 4CQAA 3M1ZA 1CNVA 3RITA 2PDHA 4GG9A 3PSVA 1XDJA 4BA0A 1UZHA 3LLDA 1AD4A 2ACUA 1E9YB 4OHQA 2F61A 2UY5A 2NV1A 5M5DA 3EDJA 4KWUA 2J8GA 3QF0A 5TNVA 1TV7A 4LUTA 3MMUA 2HMCA 1DJIA 1V03A 4P8WA 1BPLB 5KINA 1VYSX 3UXKA 4HTYA 4JTCA 3CYJA 3JZUA 2X2GA 3OG3A 3QFWA 2B7OA 4DLFA 2KZHA 2H9AA 1ZBWA 4PTVA 4QBXA 1RZMA 4NX0A 2DU2A 4LU0A 4M6QA 1JFXA 4J27A 3MKVA 1W6TA 2NT0A 1V6WA 5AN7A 3WQOA 1ZENA 1E15A 1BF6A 1GTEA 2CHOA 3UGVA 2O9OA 3M0JA 3T0AA 4NZJA 2XH4A 3E3HA 1WZAA 4X0NA 3W1AA 3DFYA 4BZYA 1XIIA 2WZIA 4LUSA 3UG8A 1ZTVA 4E2VA 1P0BA 2ZA2A 1Y65A 2FB3A 2YA1A 3SR7A 3LCWA 3CUXA 1UPPA 2TODA 2QCHA 2PTYA 3NTYA 1R8LA 3GDLA 1K7XA 2GUBA 4J1OA 4DX3A 2PRHA 3URBA 3MT1A 2V5KA 3AHXA 1KXVA 3S9IA 3T07A 5A1AA 2WVVA 1KFBA 3G5EA 1QU4A 2YDAA 3CQIA 5E93A 3V1PA 3W7EA 5C8BB 1MEWA 4MIMA 4LVAA 1FUYA 3SURA 1A3HA 3MV11 3PZGA 1F8IA 3E0VA 3CQ0A 3KOFA 5RUBA 1S46A 3GC4A 1G67A 3TW6A 1D7KA 2GGGA 1LLZA 2DQXA 2NLIA 1QVBA 4DNMA 1HUVA 3TU9A 1JRCA 1SZFA 2PLJA 5K2ZA 2OZ0A 4XB3A 2DSZA 2WPBA 1V0MA 3I6EA 3VIIA 3PUOA 1EBHA 4M51A 1X6LA 3GSMA 2O9TA 3F5LA 1JI1A 5FJIA 1VEMA 2ACSA 4ZXLA 1UC4A 2QT3A 2YZ5A 1XLLA 1MMFA 3ALGA 4M8UA 3UXDA 3TP4A 4HK5A 1UD2A 1TTIA 3NQVA 3A3XA 2QVHA 4GFIA 3I6TA 3C0QA 3CH9A 2VP8A 1TPH1 4ZQNA 2BGSA 1RY0A 1LG2A 4XIMA 3WQEA 1AMYA 1TG7A 3GIPA 3ZLGA 3QBUA 3WY1A 4PMQA 1D3GA 4WD0A 3WUBA 1P43A 4WY0A 2Y6ZA 2CLKA 3LY0A 1NOFA 2F6KA 3RM4A 1R2RA 1NWSA 3UWUA 1BD0A 1F3XA 5C9UA 4LEFA 4H7CA 4EKJA 4H8UA 2CWNA 7REQB 3CHDA 3NA8A 4QLKA 3GM8A 5I3KA 2R1KA 2AGKA 1I2RA 2C3ZA 1WE5A 3GDKA 4GNVA 4GINA 4DHGA 1JUBA 3ID7A 2DVUA 3G0SA 2PCQA 3REQB 1GYLA 3L23A 1TIWA 5IM51 1NP0A 2HZGA 3L9CA 2BOGX 1E55A 5JBDA 3N04A 2Z1XA 1TPDA 4C6OA 4HNVA 5DBTA 3O7UA 3OB8A 1PX8A 7ENLA 5EB8A 3DG3A 1IEIA 2VQUA 3P7YA 1NDWA 1JL8A 4A2SA 1C8YA 3BQ6A 3FKRA 4JY9A 4DPPA 4L1WA 3VKDA 4JKLA 5BRPA 3TC6A 3T08A 3G1DA 3RLHA 5C71A 1TV5A 1OINA 4QDPA 1KR1A 2WC7A 1DIOA 3OLIA 2PMQA 2DT3A 1TX2A 1K02A 1MUMA 1UH4A 2B0MA 3W4RA 3PSWA 3B4UA 1P0KA 2Y88A 4Y9MA 1H49A 4AZBA 5JQ9A 3IJ6A 4JQ3A 3K8MA 3RAOA 1G4SA 1PWLA 2FJUB 3BOLA 2NV2A 3IK4A 2INEA 3P8IA 1VENA 4UTHA 1JULA 5TF0A 2VZUA 1A5CA 3FFSA 4AFYA 3QV6A 4DI9A 5KZMA 5AC7A 2XPKA 3UETA 2YJQA 1D9EA 7A3HA 4PL1A 2FH6A 1MXSA 2OEKA 3IGUA 2YFOA 4HPNA 2J6XA 1JYWA 2ZADA 4GY1A 4EF8A 2PGRA 1H11A 4HN4A 1TTQA 3AALA 3PUEA 3L0NA 1H09A 4WQ6A 1IQ8A 4JTLA 1VQTA 3LPGA 2YSWA 4H8NA 3W76A 4J3UA 1F73A 3QC3A 3JZEA 1UASA 5T9BG 5DXYA 4ZO9A 3UBPC 5FAGA 4B5VA 2OSXA 3ANYA 1PPIA 1J11A 4PCFA 2X1RA 1LLOA 4DIAA 2W62A 4E3VA 3UZZA 3HQ1A 3ES8A 2JFEX 2A3AA 1X7FA 1EYEA 1V08A 2CYGA 5B7YA 3O16A 1X1OA 3CMGA 2BOFX 1OFRA 4K36A 3OG2A 3PVFA 2QVNA 3KS5A 4OBTA 4Q22A 4X2RA 3LSCA 2DSKA 2VL4A 1BYCA 1Q2RA 3WLQA 3E0WA 1RUSA 3OHMB 3GH5A 2YCKX 3MA8A 5HWJA 1RLDA 3LCIA 4CQCA 1R6WA 3AHYA 4MY1A 3VUPA 2DJXA 2HWGA 1YNYA 3TFCA 4K2SA 1O68A 3P82A 1CT5A 1WO2A 3CH0A 3SBFA 4GQQA 3W82A 2PDCA 3LOTA 1FWJC 4A4AA 5FJOA 1QOQA 1ONRA 3R11A 4FALA 2JALA 1FOBA 3GTIA 3R79A 1DVJA 4DUXA 3AIRA 5FJUA 4FOUA 4BWLA 3F4VA 2QUTA 3B97A 4FEZA 2OYLA 3VE9A 4Y8FA 6XIAA 3HG2A 5HNNA 4JIHA 3SFKA 1EIBA 2V82A 1R9YA 3B8IA 2FHCA 4V33A 4W8LA 4JX4A 3C0SA 3AYTA 1XCWA 2GUYA 1A4LA 3AS3A 4FA3A 1W9UA 3BLDA 2WKLA 1R7OA 1DXFA 4A8LA 5C2GA 2VDGA 4PFHA 1JI2A 3N11A 2WCSA 4HHHA 5A6SA 2IMRA 3PTDA 1PX3A 2P8CA 3NR0A 4ZZ9A 3AIEA 4QLJA 2V68A 1PCWA 2CZFA 1UB3A 3F4NA 2E67A 1E1CB 2WLZA 3FK4A 4L64A 4PCSA 5D8WA 3ANVA 3AS2A 3N3TA 3C3NA 3FVDA 3VYLA 2WVUA 1O66A 3FOKA 3VZZA 3FVMA 5HK4A 1CX9A 5I23A 3PBGA 3BG3A 2Y85A 3L4XA 4XISA 3VNLA 1QASA 4ICCX 4H8HA 2QJMA 5HBFA 3WLNA 4IFKB 5CKSA 4MF4A 2E1DA 1CXLA 3B8SA 3THQA 3LXCA 1UJPA 4XTIA 1R7AA 4CNTA 3HURA 3VIGA 4YIWA 4PMNA 5DO8A 3W0KA 2E6YA 4OBSA 2XVNA 2OGJA 4G5DA 1IZCA 3CUJA 5DT5A 4C6BA 2AMGA 2FGZA 4YJ5A 4CU7A 4G7EB 4YVPA 1AVAA 3QZEA 1QW7A 3WFAA 3GYCA 3E2VA 2J74A 1TWZA 5EFFA 4W8AA 3MJYA 3ENLA 1JZ6A 3LSBA 2PA6A 3GU1A 2YFNA 1C29A 1E6RA 3C4UA 5FOOA 4QP0A 3VKJA 3C2VA 5CPTA 3S6OA 4LAZA 1N8IA 2WMHA 4LCSA 1XRFA 1Y5XA 3KCJA 3OIHA 4I5RA 4CLMA 4B90A 1IV8A 1YXDA 1LOLA 4P2VA 4ADSA 3PY2A 5LIWX 3TN5A 4DYKA 3CAVA 2ZWYA 3QY7A 3K8KA 4IIGA 4WDTA 1XFBA 1ZQ5A 1HP4A 2ZRWA 5CBBA 1ALDA 2G96A 3CAQA 3M5XA 3LMZA 4H00A 2A7RA 1SZGA 2I5QA 2Z4GA 5FEPA 2FGLA 4UTTC 3TDFA 3GG1A 3PTKA 4YTUA 1TE6A 3NM1A 1ICQA 2G3IA 4A22A 5EMKA 3TUUA 3AWOA 2ZFAA 1PIFA 4DJFA 4MWAA 2WCGA 3IAPA 1EDGA 2HBVA 3EWZA 2E3ZA 1UKOA 2IQDA 2X1TA 2I16A 3SCQA 1XH0A 1CGYA 2ZDSA 3ARVA 3CMJA 1RY8A 3EKZA 4NHVA 4JXCA 1I45A 5BXSA 1NDYA 3EWCA 1LUCA 4EWJA 4X9SA 4F79A 1H41A 4PTMA 4HIBA 2VKZG 1IIGA 4BFAA 4D6EA 2QEZA 3I7QA 1CCWB 1KM5A 2VOMA 3GNPA 1W9BM 4Y2WA 3D46A 3HG5A 4KCUA 3MY9A 2WZEA 1TPUA 2XSXA 1YBQB 8TIMA 1RSCA 2J24A 4AEFA 2JBMA 4DWDA 4XAGA 5EMYA 4IF2A 4GBDA 4Y9NA 1XICA 1S2WA 1S3HA 5CG0A 1Q7ZA 3PZNA 4CKQA 4M24A 3TN3A 4D71A 4MKSA 2BB0A 1GHSA 1WDPA 1SZEA 4DLMA 4O0QA 3MSRA 1I1WA 3FIGA 4UBPC 4JL2A 1FKXA 3CZEA 1TPWA 1I2PA 4WJ8A 3BSGA 1PZ3A 5BWFA 4X22A 5B7ZA 4KW2A 1D3HA 3NWRA 1SFTA 4HU8A 2WANA 2JK2A 3VIHA 1LL6A 2XM2A 2R1MA 1XGDA 3DEQA 1AQ0A 3M0ZA 1YNPA 2DIKA 1GNXA 5AHIA 4OT7A 4IM4A 2GVYA 5GNXA 1Q4WA 4JKMA 4Z0SA 4C90A 1J0IA 1V77A 4CUCA 4LBUA 1TVNA 3AS1A 3PULA 2BLEA 1PVNA 4NVTA 3U7VA 3C0LA 5MF5A 5CH9A 4ALDA 2VX7A 2WXDM 4JY8A 5JUVA 4LV4A 5C2XA 2NQ9A 3QTGA 2HISA 2QIWA 4O54A 3ARZA 3ARUA 3BAJA 2V5DA 1EEPA 3WJSA 5CQ1A 5E0CA 2XM1A 1G5AA 1MFUA 3NUKA 2V5BA 5CPSA 4LF1A 1JNEA 3VDGA 2WMIA 3SQLA 7TIMA 1IXOA 1LTDA 4OOUA 1SVDA 1AUSL 2OTDA 3SEPA 1Q13A 3LZ5A 4GUGA 4J3TA 4D6HA 3AMCA 1RK6A 3QKEA 4LF2A 3M5VA 1G94A 1GVEA 3WQCA 6XIMA 2TYSA 3HF3A 1LQ2A 3HB9A 4XO6A 4FX6M 3QKZA 1MI3A 3M0KA 1OC6A 1FWTA 4BKNA 4GXPA 3O6CA 1OX4B 3L66A 2VCAA 2D2HA 1G4TA 1ZLPA 4O19A 5EBUA 1BG9A 2P8BA 2DZXA 2W61A 1XQKA 3CV7A 4OV9A 4BEUA 1QR7A 4EP8C 3TR9A 1Z69A 3HO8A 3T0BA 4LUJA 3W84A 3ABOA 3UPBA 4CD8A 5A6MA 1F8MA 1GVFA 2Z2UA 4GVHA 4BF7A 2EJAA 4I3GA 2INFA 3FA3A 1EF3A 4MWAD 4MB4A 1LROA 2A3LA 1L0PA 4RK8A 1JPIA 3PPFA 1IWPA 3B05A 3U2ZA 5CXPA 4GISA 4XWUA 4WY0F 1J6OA 1E9ZB 4UTLA 3WK3A 1NF0A 4DY1A 1DIDA 4FNSA 2J7HA 3P84A 3DESA 4WGXA 1UMLA 4FXFA 3UPMA 3WFLA 3E2SA 3R7MA 1T0OA 2J7FA 1QNPA 2CERA 3GO2A 1SGJA 3GY1A 1Y7VA 5KZ6A 4AHPA 1XLBA 3E38A 1US2A 4AEOA 2FPVA 3KOYA 4BQ2A 4XKMA 4YS1A 1H7XA 4CU6A 2BHYA 1O7AA 3K4WA 4KBXA 4XTDA 3N19B 4I9MA 4DB7A 3N1AA 4GH3A 1RR2A 4HNNA 3QFEA 2EGZA 1GONA 2FZMA 3W07A 3MI6A 1LM1A 1IEVA 4NJGA 3SGGA 3HTWA 5D03A 2X2YA 3K5XA 4I8YA 3FJ4A 3L21A 4MPQA 5AC8A 3RU6A 3DECA 1KXTA 1OX4A 3ICJA 4L4OA 1RJQA 2RJHA 4Y7EA 4UNKA 2PD5A 4X63A 1UBPC 4R33A 1U1HA 3DUGA 4LC8A 2XIJA 1SMDA 3CASA 1UWQA 1ME9A 3VCRA 3T0DA 3AUJA 5K9DA 1EPXA 1EGZA 3AU6A 1O5RA 2G37A 3CV2A 2EPMX 4KQNA 2HPIA 1RXOB 3I68A 1EDTA 2PWUA 2WLYA 4G7FA 2AQWA 3TNOA 4WUIA 2Q3OA 1UH2A 3DENA 4MJZA 5HUPA 1JAKA 3OBAA 3SSZA 5AC5A 3AJ7A 5A6BD 5I3JA 1ZL1A 3VKCA 4AZ7A 5AZ1A 4KEMA 4W7VA 4XAFA 5FF7A 4RPQA 2ZA3A 3IGHX 4W7UA 4LW7A 1S2AA 5A6BA 4W84A 3LXAA 1UR8A 2QPSA 3PG8A 3MI2A 3WF2A 3NSNA 3O0FA 3UWWA 1QHPA 4YVXA 5F2IA 3UG5A 6REQA 3W85A 3NQ7A 5JU6A 6ALDA 5A8NA 2VX6A 3W1LA 3RCNA 1HNYA 1CWYA 2VC9A 2D0GA 4UTIA 4LXFA 4YWSA 2BS9A 2VFHA 5FJTA 3RILA 1EQPA 1JXKA 1KTBA 4KWOA 2FZ9A 1JPKA 3SY1A 4XVEA 1UWRA 1XLDA 4F4RA 2J9YA 4IQEA 2IW0A 2XVKA 2GVGA 2YDSA 3AIQA 1O4UA 4AC1X 1U22A 4O14A 1SO5A 1K77A 2XVPA 1SJAA 3HN3A 1EJRC 1CI1A 4YXGA 1PAMA 3U4AA 4IIDA 3QOKA 3ZJ8A 3IIVA 3W6MA 4XBSA 4R7JA 2HNHA 3WJZA 2A85A 3S46A 2WKJA 2VRQA 2VYOA 1Q6CA 3W7LA 4OV4A 1O5KA 1S2VA 5F2GA 2PDJA 3TV8A 4GC4A 3D5HA 5BCAA 5CPQA 3M6YA 4J3SA 1EJUC 1I1XA 2BXYA 3OOQA 1K7FA 5D2WA 4Z2IA 1PKMA 4DUVA 4A3YA 1YXCA 4ML9A 5FJPA 1Q66A 3URNA 1EUAA 5FA5A 1WOBA 3G1VA 4HT3A 3RR4A 4L9ZA 3P81A 4WSJA 1J12A 5FJJA 5E6YA 2QDGA 1PKNA 4MWAB 5C9XA 2CHRA 4FR6A 3W53A 4G2DA 3POHA 4JCLA 4J7RA 1PHQA 3CO8A 3FAWA 3L2LA 1F2JA 3JU2A 4ZSTA 4YWIA 4D8ZA 2Y7DA 2BVYA 3GAYA 1W3IA 2XGIA 1MDRA 2VXNA 1VKFA 2DDXA 2VEMA 4N0RA 5TIMA 7XIMA 2Y8UA 4DF2A 3FJLA 1OC5A 2ZBTA 4FNQA 2VTFA 4N02A 3ERPA 1E0UA 2V5LA 3DGRA 3ZIZA 4GIRA 4HCDA 4QGCA 1G1YA 5SWUA 5EL1A 4O18A 4GI8A 1Q8JA 2WSPA 5CEWA 4U5IA 4LPCA 3OW1A 1Q4NX 4OIFA 5HWNA 4YCPA 4H3DA 1XG3A 2YA2A 3E49A 1OCQA 3W7HA 3DI1A 3T44A 2X42A 1NDZA 1GUVA 1BAGA 1PTDA 2ALRA 4IPNB 3K4DA 3KRBA 3PAJA 3GXIA 3RU8X 1W1IE 4KFPA 1DOSA 1U2YA 3G1XA 1XYLA 3HU7A 5I0DA 3TTQA 2EPHA 4DO7A 4LVFA 3KX6A 1PUDA 3TJXA 1JUEA 3W7QA 5LIUX 4C65A 1QW9A 1H1NA 4IGSA 3UG4A 4KKXA 1K03A 4UOZA 1IGSA 3MPGA 3CUGA 3H24A 2AL1A 5CC3A 2UWFA 3KTSA 2CLOA 5LA1A 4DJED 4ZQRA 1X97A 4X3ZA 3O0KA 2J7EA 5FEWA 2Q71A 1V6XA 1TTPA 1KM3A 3GC5A 4PMZA 5EY5A 3QLLA 2VO5A 3TQ0A 3TTEA 3W7RA 3ABRA 1PTAA 5D9PA 3GNXA 3WMSA 1E1CA 3VIOA 1L8NA 2Z27A 3R8HA 3DI0A 4A21A 3DG6A 1QDSA 1AH0A 2V2DA 4MZ1A 1C91A 4IUOA 2E6AA 2YCEA 3IANA 4O1BA 3CQJA 5GNYA 3WEOA 3LBMA 3AXXA 5DRCA 4AAJA 3LM3A 3SUSA 1Q63A 4P7RA 2NVCA 2HK0A 1D3CA 3OGVA 2F9RA 3U48A 5HDRA 4J9JA 4MWAE 1K7EA 1PYMA 4M6UA 3E9AA 5EMJA 3QN3A 4NG3A 3MP3A 1VRDA 3L2IA 1A49A 1VHNA 3TYZA 3LGGA 1W9PA 4WKFA 4HOXA 1XRSA 1I0BA 4S3CA 3WDJA 2FTWA 1UQZA 1HTIA 4ZQOA 4FLSA 1A5KC 5DMYA 1BXCA 3G24A 1X8CA 4A6GA 3IVSA 2P5NA 3W86A 4JFVA 4UFKA 1U30A 1AL8A 4LUIA 3S1UA 1KCXA 1BGAA 4O53A 3K30A 3KS6A 3AIUA 4Q4OA 3UYIA 3NQBA 3NYZA 4US5D 3ABSA 2RFGA 4AY1A 4R5EA 3D6NA 3RFAA 3IV8A 5CC5A 3DIPA 1ZJAA 2ZRXA 4F2BA 1PXGA 3C52A 1N7KA 1PSCA 2Y5JA 3CBWA 4O50A 3G1SA 4EE9A 4I7VA 1O1ZA 2WZMA 1R2TA 2DFAA 4GCXA 3F1QA 1P6CA 2R1LA 1AW5A 1DJNA 4WRHA 3PAOA 3V3WA 4C6KA 1LLWA 1QAPA 2J25A 4LS0A 4GGHA 3ANUA 1C93A 2I57A 4Q8TA 2GVLA 3RX3A 1RA5A 4FB7A 5I00A 4O1CA 4NASA 2E5CA 2QAFA 4PRRA 1YEYA 3BAWA 1BSLA 1AQMA 3N14A 3W7CA 3NQ8A 4AISA 1OF6A 4XUYA 3SZ8A 4A8RA 1XLHA 1VBHA 3SQSA 3K46A 1CW2A 3HFTA 1ONEA 3OVRA 3WK2A 2POTA 4LOCA 3BZJA 4O16A 3M0HA 3EDDA 1M41A 3BPWA 4UOJA 2CLLA 2MANA 4AZIA 1P0EA 4ZSUA 4A3QA 3TKFA 3KM8A 3FEMA 5DQPA 2P1FA 1OT2A 3D3AA 4C6NA 2A3EA 2QUVA 1R9XA 1VBRA 3OVPA 2X16A 3UW6A 3A5VA 2DUXA 2CFFA 4W5ZA 3L4VA 2OVLA 4GZJA 2CZEA 4ZBCA 4UQEA 5D04C 4NYUA 4S2BA 1V3MA 2FZ8A 1CYGA 2IPJA 3WH7A 1PCKA 3Q58A 1BYAA 3L5MA 3NPWA 4IPJA 4EACA 1M68A 1WAUA 2C0HA 4JTKA 1GVIA 2EEXA 3AS0A 4KH2A 4Q6JA 1XLMA 4XIAA 1AH3A 4Q3MA 1FWDC 1GZGA 4QX4A 4AC7C 4OTKA 2HE5A 5T26A 3U0HA 5E0KA 4HZ7A 1F3TA 1I75A 3C2EA 3AYSA 4WDUA 2VEPA 5CGQA 2XZ7A 3KOZA 4ADUA 5LXEA 3E96A 3GU9A 2Y8VA 4L5ZA 4LALA 1H4PA 1Z3NA 4FX8A 4DO6A 1M3UA 3STGA 4B2DD 3MHFA 4IMCA 3FV9A 5U4NA 4G1NA 2NT1A 3F4WA 1VFLA 3VNJA 1PKLA 1XKJA 3QMTA 2DSUA 3GKAA 3CLMA 3EB4A 4ZMGA 4XO7A 3HQPA 3EDKA 1FDZA 5EA9A 3UJ2A 1KTCA 3GFXA 2QCDB 4QHRA 3GTXA 3P74A 1XLEA 4AMCA 2V63A 4OU1A 3O8AA 4MZYA 5D02A 3CEUA 4I5UA 3KCOA 3VA8A 1V51A 1OBAA 2XDFA 3ITCA 5I78A 5HQLA 1GWJA 1ONWA 5GJPA 4LGXA 3W1RA 1W1YA 1F4AA 3RM8A 3GD6A 4JX5A 4WKHA 4HN8A 2YX0A 4PRWA 1E9LA 4ZFMA 3OYZA 3GXPA 1XSKA 3SCVA 2EPKX 4RKAA 2BNJA 4B3LA 1XJBA 2IQ0A 3NGJA 3ZWTA 1V6YA 1C8QA 1R3QA 4K8EA 4WVXA 3F4CA 3LK6A 1CXEA 4BF5A 4FXRA 5JVLA 2WSYA 4MWAC 3WK1A 3BL3A 3NQCA 1EEXA 1BRLA 4JKKA 2OX1A 3S2JA 2VT0A 4I8DA 4NP7A 3NSMA 3DBNA 1E0TA 3HGOA 1F5ZA 2PF8A 1F6YA 4LYQA 4D6FA 3NJ3A 3NDOA 4YHGA 3C2YA 1TUFA 2QV4A 1QI3A 4E3TA 4IHCA 5BU6A 3GUWA 4IZGA 3U2CA 2R1PA 4WSHA 2WV8A 5U7SA 3G8EA 3FJ6A 4LT9A 1VF8A 1KM4A 1AQHA 1HF6A 2UZ9A 3A4JA 1MQQA 2RGLA 3LB0A 1KM6A 3KXQA 3SN4A 1XM3A 2DH3A 2EG7A 4H4IA 1BGGA 4QG6A 3HJEA 3JS3A 3BMVA 4MJ4A 1LCOA 2QCNA 3QRHA 4HNOA 5CPLA 4PMVA 1GQNA 2OOFA 3A22A 1E6NA 2DZTA 4CCDA 3R6IA 1FWNA 3T1GA 2HXUA 2XH2A 2OLAA 4Z2GA 4DI8A 4I7UA 3F7JA 2BY3A 3OEXA 4GYFA 2W6RA 3AHZA 2GSEA 1ZBVA 3E2QA 3DN5A 3LUTA 1S2TA 4KPLA 3AJXA 4PB5A 1XFCA 2V38A 5FL0A 3B0VC 3WNKA 2ABBA 5HNRA 2PDQA 4MTVA 1OC7A 4XZBA 2I5GA 3GXFA 3ZT7A 4ZTYA 2ZUUA 2FHFA 4IXXA 3S3GA 1HJWA 3LEPA 9RUBA 3ZWSA 4C1LA 3SY5A 2V6AA 3AYVA 2P3ZA 3SADA 3UJRA 1PZ0A 3GVRA 4CVUA 4L7ZA 3ZZ1A 1MW1A 1XGZA 4N4QA 1A5AA 1EJSC 4OUIA 2A6LA 3BTNA 1WAWA 2Q6ZA 1HKMA 3ONBA 2WHLA 3VI2A 1AA1B 1OCBA 1JZ7A 2Q02A 3AXIA 1IXPA 2Y7EA 2RDWA 1WKYA 3ZSSA 3CPUA 3T42A 5DF0A 3W3OA 3W1UA 4QDWA 1KNWA 2R24A 2UY3A 4G6CA 3CZ8A 3H4WA 4W85A 4KWWA 1WZKA 3RCMA 1CGTA 2XH0A 3HPAA 3E12A 2WO5A 5A8QA 3N4FA 4IL2A 1FHDA 4HYWA 4UCGA 3GBEA 4GUFA 3HGSA 3P0XA 4TMBA 5G1YA 3LV6A 1Q85A 1XQLA 3TWAA 1Q6RA 1JPDX 1QATA 3UWVA 1CB2A 4PRTA 2R94A 4JDBA 3N15A 4K68A 4PH6A 2NQJA 4JTEA 2X1IA 3BJSA 1GG0A 4ICNA 1JAEA 3GRIA 3WDQA 5REQB 2JF7A 3MP4A 1OGSA 1E5JA 1Z7AA 3L65A 4UFLA 5E9AA 3VD9A 2OXNA 2I17A 1O94A 3W7JA 4GKTA 4KIRA 3ALFA 2H8ZA 3QR0A 4BQ5A 2ALDA 1ITUA 1HJUA 1UYQA 4PEEA 3S9YA 1LT8A 2AAAA 4ASTA 1OCJA 1W9DM 3GXNA 2O9RA 3FKKA 5DELA 1OEPA 4C6PA 4DWSA 2BGNE 2QJNA 3W70A 1GEQA 3NFUA 1C3FA 5I03A 4V28A 4B5WA 4AYGA 1FX6A 1XF0A 4ORMA 1E43A 3NCOA 1N2VA 2OELA 4K8GA 4UOQA 5H91A 3FHQA 4TVCA 3SCRA 1B4EA 4CD6A 1RQBA 2WQPA 2X0SA 5XIMA 3THUA 1UWAA 1XIBA 4U33A 3EWDA 3GNOA 1AH4A 2DIEA 1HZYA 3DZ1A 1HVXA 2BBFA 2NQLA 4UXDA 3AUOA 1VS1A 1TJ0A 3TXVA 2ZXBA 5JXQA 6A3HA 4MY8A 1M01A 1S5VA 3WYZA 3WLLA 4RJEA 1UR0A 4C6CA 4O1FA 3WBWA 4JL1A 1QI2A 4KCWA 1ENUA 1YKWA 3B8DA 1GG1A 3VCCA 3HPXA 2KX9A 3DOPA 3NZGA 1U33A 4JTJA 4Q4KA 1JDFA 1B57A 5CZTA 3M0IA 1JD7A 3TYUA 1JGIA 2G8ZA 2CKRA 2ADAA 1OT1A 4MKNA 2D24A 3CIWA 4TX8A 3PZMA 4P7LA 3EKGA 4GNJA 2YPIA 4JBRA 3C2FA 1FRBA 5AHMA 1OADA 3CGTA 2CNCA 1KW1A 1HN1A 2O92A 1VBGA 1YPIA 1E6QM 1MXGA 1V0LA 2POZA 3PG9A 4MNJA 4JPGA 3V0UA 3UGRA 5JIPA 4R9OA 2QS8A 2WNZA 1AFSA 2QGYA 2CLHA 2UY2A 3EXTA 5DBUA 2IPWA 5HULA 4IMFA 2ZUSA 1QO2A 1TB3A 1EIXA 4DN1A 1J96A 1VEPA 1US3A 1BQCA 4F48A 5IBXC 4PCPA 1XSJA 4PUKA 1GTHA 2OWXA 4GBUA 3OO2A 3UWQA 1UWIA 4S3GA 3EEGA 4UNLA 4HOWA 2D3LA 2XSBA 3M46A 5K7JA 2WWDA 1W3LA 3CAWA 3GZ3A 4XBJA 1MFVA 3PZUA 2XIOA 4CQDA 4MKVA 1E72M 3MSGA 5DANA 1FDYA 4ZQPA 3C61A 6TIMA 5HMFA 2WWCA 2GJPA 1RD5A 4ZO7A 3OGRA 2HV5A 1AW1A 2Y4SA 1XLKA 1F05A 5DY3A 1W9VA 1TO3A 1EJXC 3W7GA 2ZE0A 1XLJA 2VZTA 4PUMA 4HA3A 3G0XA 4ONVA 4FIRA 5TQLA 4UR8A 1XIFA 4YVVA 2A3HA 2PSNA 1UZDA 4UMAA 1OYAA 1UUOA 2OEMA 3BANA 1J5TA 4C5YA 2ZC1A 3KEHA 1NIUA 4W7WA 3U9IA 3VGDA 1WZMA 3HMJG 1AJZA 2NLYA 2Y7FA 3KRSA 4AD4A 1DWJM 3N4EA 1VFMA 1NF7A 1ITXA 1V3HA 4WGHA 4JTRA 4XAZA 1Z32X 1GOQA 2AAMA 4GZ7A 4DQWA 1B54A 1KFWA 4YTSA 4S3KA 4GACA 1HL8A 1YLVA 3GHRA 5FF0A 4DYJA 1SO3A 5C5YA 3GC2A 2X09A 3UZ5A 1DV7A 3CIVA 4ZOCA 4GFSA 3VDBA 3IUHA 1A3WA 4B2DA 3SCOA 3W24A 1WP6A 1I9CB 3U2OA 3GH7A 4X61A 2OSWA 3WCZA 3GDBA 2R8WA 3FY1A 1EP3A 4JR5A 4FXJA 5LA0A 3TE9A 5CBIA 1J2BA 2BVDA 4H9MA 2CLFA 3WD4A 3LBCA 5DCEA 3G77A 2VMFA 4XAPA 4Y90A 1R38A 4PBGA 2AKZA 5IFPA 3H2AA 1XLIA 2GQAA 4RV8A 1JJKA 4JN8A 3BVJA 1SSGA 1UD8A 1JDDA 3IS4A 3N73A 3QQ1A 4GO8A 1R30A 4IQLA 1Q6LA 3VD7A 4M5PA 3BQ5A 5B80A 4DPQA 3SUUA 4IIEA 4UFIA 1EDQA 4HOZA 1Q6FA 2Z1SA 3TWBA 3MBFA 4L65A 3CU2A 4TX9A 4HTBA 2VR4A 3LV5A 1I8JA 3NQDA 4NAEB 2DIJA 4D2JA 4TVDA 3BJFA 3U4FA 4NU7A 4UC5A 1PIGA 5D33A 2CBJA 1H51A 1QNRA 1YNQA 5HNTA 1IGWA 4REQB 1RAKA 2JE8A 1OFEA 3JUGA 3M7WA 3I4EA 3SUTA 2HS8A 3EXRA 4GJ1A 1FWBC 3QPZA 1DWFM 3NQ2A 2ISVA 4BCEA 2VRJA 4JIRA 1EA9C 1DL3A 2QCFA 1WQ5A 3FGCA 1Y8BA 3VZXA 5HPOA 1KO0A 3LPFA 3RN6A 5C7VA 4LUTB 3ZFHA 4Q8OA 3WF1A 4MAVA 2F7FA 2GJNA 1T8QA 3UVAA 2D69A 2J8TA 2EPNA 5LKYA 2VVSA 1EO7A 4FNPA 1IT8A 2JEQA 3S1VA 1R86A 4KS0A 4B9YA 4JS3A 3BW4A 2O4QA 3EWBX 3B9DA 1IT0A 4W89A 1UWUA 3BOXA 1XRTA 4Q7NA 2JQXA 3VOJA 3TONA 3L2MA 4JICA 3UXAA 2Z7KA 4FS9A 3CEPA 3VD5A 2CXGA 2QW5A 2ZZ1A 3M0LA 5LHEA 1GQIA 2W27A 3GVWA 2PURA 2WZTA 3CZGA 1KFEA 1IF2A 4IFRA 1SYTA 4PMXA 3UVIA 3P2VA 5DFAA 3ONCA 3KZPA 3CS2A 4FAMA 4HA0A 3VIKA 3VMNA 1DE5A 3EX1A 3APGA 4AWSA 5D05A 5EMLA 2FGBA 5EYWA 5F7UA 7CGTA 3LG3A 5T9CE 1V3IA 1TJRA 1O95A 1XP3A 2E0PA 2QXWA 3L4WA 5A6KA 3R5EA 1K8ZA 5MHBA 1DJQA 3VM7A 3D3FA 3S0CA 4TV5A 3W2MA 1G7UA 2DORA 2E68A 4NZ3A 3VDCA 3N13A 3FN9A 1NELA 5A6TC 4ATDA 4GXWA 3GHTA 4LSBA 3A23A 4DNHA 2V81A 4WDXA 4ES4A 3NL6A 4J3VA 2DZPA 3KZSA 1V0NA 4GVFA 3AMGA 5D09A 2G95A 1CLXA 2PDIA 2XFRA 2TRSA 2C1IA 1GT8A 2XN1A 2Y24A 2WQDA 1BWVA 4LX4A 5A69A 2O55A 4AB4A 3W28A 4A3HA 3KHJA 1HKVA 4DO4A 4HPHA 2EG6A 1JCLA 1TQJA 3BZGA 4ZENA 3NL5A 2R82A 1Q6EA 4H01A 1E4IA 3WH5A 3CT2A 2EXOA 3LRMA 1ZB5A 2X1SA 3QR1A 3H8AA 2PLMA 3GKFA 1RCXB 4RXGA 2GGEA 5BXTA 1UG6A 2WHKA 4XK2A 1TUXA 1ODUA 5C70A 4JQAA 2WSKA 2OEJA 3M0MA 3W2UA 3WEMA 1FHUA 3AOFA 1ZJIA 2OMAA 5J5RA 1I4NA 2XGBA 5DEZA 1J0KA 2NQHA 1BXNA 1CXIA 4UUIA 4JEQA 1JZ4A 1W3NA 1OYBA 3OBKA 3WJXA 1C8XA 2GZXA 1BXBA 4QEEA 4E8DA 5XIAA 2CZDA 1FQ0A 4HNCA 4PODA 3UP8A 3EOUA 1GYNA 3KBWA 1JDAA 5AHNA 1AK5A 3SB0A 3A4AA 4UR9A 4HMCA 4JFWA 4LYPA 3ITTA 3SGUA 3KCLA 3MO7A 2QUUA 3URAA 3UCDA 3WD1A 4HK6A 1ODZA 3HPFA 5J8LA 3BAKA 1XPYA 5HOSA 5A6JA 3S1WA 4XZWA 2WC4A 3VO0A 3OZPA 2OQLA 1ZBCA 3LM7A 3SGZA 3RPMA 1S5WA 2ZRYA 1UA7A 4I7WA 1V6TA 4B16A 5CSUA 4GABA 3WL0A 4ZFCA 1Q6DA 3WQVA 4FNUA 1QJWA 4O28A 2D20A 4AZ6A 2VENA 4D1JA 3TJLA 4GKLA 1E6ZA 3QOMA 1XIEA 2NWRA 3O6DA 1HO4A 5AHLA 3R25A 3TYBA 2ACQA 1MEHA 3B8WA 3WLSA 2HEJA 2X40A 2VGBA 3TMQA 1PDZA 3CT7A 5BWAA 3BE7A 3H6OA 2F6XA 4UTFA 3SCWA 3REQA 4XG1A 3KRUA 4ILSA 1GOIA 3HGRA 1GOOA 4Q8MA 2IUZA 1F6KA 3PBMA 2GQ9A 4B3KA 3GR7A 1POJA 4P7OA 3MMTA 2C14A 3B04A 4YN5A 4IX2A 5TBOA 1TV2A 3N2MA 4LBRA 2W79A 3THAA 4YYFA 2PDBA 1GPWA 4RNIA 1Z41A 4WY0B 1P6WA 2E4TA 3VOCA 2BHZA 3WD3A 3CAKA 8XIMA 3A6OA 3PZVA 2OQHA 5ABFB 2XSAA 2OB3A 4CN1A 2W5FA 1H63A 1FH7A 1WB0A 3WNNA 4DJEC 2NQ5A 1XG4A 3RJXA 4CU8A 4RDVA 1BWKA 1QWGA 3WQPA 4DZ5A 3NO1A 2F2HA 3BUVA 6ENLA 4Y9OA 2XIQA 4C6JA 1VBUA 3QY8A 1S39A 3CZKA 4P8XA 3N6JA 3CB8A 4AWTA 4Z2LA 2GJXA 1ISXA 5C55A 2Y8KA 3GAKA 4IJBA 1EP1A 1QK0A 4Q8QA 4NI3A 1EC9A 2B7QA 2BDQA 1W1ZA 3ARSA 3GNNA 1C9WA 4R53A 1SSDA 4RDYA 4XAYA 2Z6IA 3FDKA 5C9WA 4ZGYA 5I09A 4XZNX 5CSYA 1ZGDA 4EPEC 3ZLHA 1B3WA 5FD0A 3PWIA 3IJQA 3Q67A 2GWNA 2CLPA 3TOPA 4P8VA 1E3XA 3RXZA 3IIZA 2ZE3A 1UR3M 4X60A 3T81A 2H3BA 2WHMA 2P88A 4Q8NA 3FA5A 3TMLA 4URIA 1KGXA 3WBAA 1YDYA 2D73A 1VLIA 1W3TA 2WOQA 2Q8XA 5CCZA 2HJPA 4KF1A 4HPJA 2PP0A 4FXSA 4PMYA 1LWHA 4PCTA 2PZ0A 3UESA 4O1AA 2VGGA 4UMCA 1V4YA 1XYFA 2FMNA 5ENLA 4IFKA 1J2WA 1WNOA 1MUCA 3P93A 3GG7A 3CV6A 2H3DA 3TYDA 2AL2B 4AU0A 3N2CA 2Z29A 3ATZA 3AZRA 2JKAA 5EBAA 4A05A 2NX1A 3SAZA 2PBGA 3R10A 3VKKA 1KRBC 3BCDA 4JTAA 2IQTA 4C6LA 3SW6A 1ZPTA 1KC7A 1TYGA 3NZPA 2W63A 1HL2A 1H5VA 2D0FA 3WQWA 2EQDA 4FLRA 2D2JA 3W74A 2DW7A 3W73A 4EAMA 4AUBA 1HGYA 3VU2A 2WMKA 3HPSA 1CLVA 3W88A 1LL4A 3IIOA 4LAUA 5IHRA 2ZUWA 3NXFA 4LYRA 4MNMA 4PEKA 4L6HA 3OIXA 2Z1BA 3IRDA 3S2CA 4H9TA 5K4XA 3GVGA 3UT0A 1EWEA 1EJVC 1G6CA 3IJ8A 4IIHA 3F03K 5G1MA 1TPC1 4OECA 1M65A 1KR0A 3O15A 3TW9A 2QULA 1EJWC 3KL0A 1HJVA 4IL0A 4GUJA 1ADOA 4L4MA 4QCEA 1OY0A 1T40A 1M03A 1M5WA 2RJGA 3VIPA 4JDYA 3VNDA 2E9LA 4IWWA 5KITA 1MW2A 4HNUA 2DVXA 3MUAA 3I6RA 3THCA 4N9BA 1JYNA 3N2TA 4XZ9A 1YX1A 2A21A 4GIAA 1VFSA 1QPKA 4AQLA 2W9MA 4C6IA 1P48A 2CXEA 4DRSA 2ZZ5A 5H2ZA 2WK2A 4TV6A 1B4KA 4S39A 3DU0A 3VGBA 5D2TA 1Z44A 5D2VA 3TYAA 3KVKA 1TELA 5BMWA 1H60A 1EJ7L 3TOYA 2FZBA 1U5JA 4DJFC 3A5FA 3U5YA 4H2CA 2PI6A 1J0HA 2YR1A 4NZ5A 2DQWA 3DYMA 2EJ1A 3NQMA 4QNEA 5CLTA 3H2MA 4IGNA 4O1EA 2C16A 3BMWA 1OQFA 2Y1HA 2Y0FA 4W4QA 3EA1A 1K8YA 1FWSA 1RBOB 3QSRA 3S9ZA 4XZMX 1W1B1 3BV7A 1MSSA 4GIYA 4GWEA 3EWWA 3C86A 3F2DA 4JAWA 4NT0A 4D8LA 4KFNA 4AW7A 4XX6A 5LZLA 5I24A 1J01A 3LNMA 1JYXA 2ZICA 1QOPA 3A9BA 3BC9A 4GXMA 2V69A 1MNZA 3QEZA 4KMQA 3A3HA 2ZQ0A 4PSPA 3W29A 5FF4A 3GK0A 1R87A 1XCXA 5AVHA 1ZALA 4J3XA 4GI9A 4HVXA 1JXJA 2WJZA 1S3TC 4LRTA 1H62A 3TQVA 2DT1A 2OSYA 2BTMA 1L6SA 3RPDA 4I9JA 3NDZA 1GQJA 5IRPA 4DWSB 2A3BA 4N2YA 1OG6A 2Z7GA 5HNUA 1QWKA 3V1HA 4S2CA 3CPGA 1P4CA 4EXBA 3RDKA 3UPWA 2VUNA 4Z1DA 2G0WA 1JCMP 4ZVJA 4MPKA 3WF3A 2EPLX 3H55A 3WMCA 4H7ZA 4JNYA 4LH8A 1K3UA 5F2LA 1PEZA 2XISA 1DXIA 3G3DA 1PB0A 3RMEA 4A29A 3P61A 5FESA 3W7PA 3NAVA 1GZJA 1TV3A 1LG1A 4WJXA 1MYRA 2GSJA 2ZYFA 5CJ5A 5K4ZA 4TOQA 3BXWA 2XTKA 4QS6A 1GCYA 2NSOA 2PBOA 4QLLA 4V27A 1BHGA 3IV3A 3K1GA 2PWEA 3MHGA 2Z24A 2AKMA 3M0YA 4I6VA 1SFSA 3B9OA 2QCGA 3AXMA 1JDCA 1JF6A 1BYBA 1H7OA 1J6PA 4OBRA 2V3FA 3RX4A 5A2AA 4KEVA 3ITOA 2ZX9A 4NX5A 3S8HA 4B9ZA 5HINA 2DUAA 4MHBA 2BASA 4QG8A 3PWGA 5I3GA 5FF2A 2NWSA 4GH1A 4PUUA 1WOAA 2VR5A 5HR6A 5FJRA 1TE1A 4AF0B 1NVMA 2C79A 4RW5A 5HATA 1UIPA 1JDEA 3AMLA 3UJFA 3LTPA 4W93A 3IEBA 4HSOA 3HA1A 4FI4A 1YRRA 1X1ZA 1UQYA 2G4JA 4DYEA 1XL9A 2CIPA 3H12A 3M0XA 1U1UA 1VP5A 1OX5A 1YTEA 3LI1A 1Q8AA 1NFPA 1G4PA 4MADA 1ZUAX 2PTWA 1KM1A 2IXVA 4JIEA 3U3HA 2J7BA 2C91A 2E8YA 2J7DA 4CCCA 2YBUA 1A5NC 3TA6A 1RA0A 1ZHAA 2CCRA 4Q8PA 1OSEA 3DAQA 2G41A 4JOMA 4K38A 5BW6A 1V02A 1UHVA 1S2CA 1WUFA 1XSIA 2CZ5A 1A50A 2OT1A 4L61A 3JVAA 1OZMA 3EKLA 3GQYA 2YA0A 1DQWA 2V2HA 1EXBA 3ZJ6A 3EWXA 4LYKA 4PC8A 1XYCA 1CDGA 3TQKA 5HWMA 3VGHA 3UYCA 5AZ0A 4CQ9A 1A4MA 3TROA 2ZOXA 4C91A 1GQLA 4UQBA 1NM9A 3W1QA 2FTYA 4ZA0A 1TV4A 1E0VA 4N6FA 3LI0A 2X05A 3HIJA 3MUIA 3U5UA 1UOKA 4Y9PA 4AMAA 1NWTA 2ZX8A 4CEUC 3ITXA 4AWEA 4JHMA 3G6MA 3P0WA 4M19A 4ZOEA 2OGYA 2QQ6A 4WJEA 3H4GA 3T2QA 4CNOA 2VFEA 4LCRA 4CCZA 1EWDA 3G1RA 3PZIA 3WLJA 4Z08A 5BNKA 1AMKA 4WF7A 4Y8EA 1H0IA 4B5UA 2VZVA 4US6A 4ZXOA 1KQZA 2GUUA 4Q4RA 1JF5A 2VC6A 3TC7A 3UERA 2Z1KA 3UXLA 3DFQA 2PDGA 4GO9A 3RJYA 2ZZ7A 2P10A 1SQ7A 3EOLA 1IZKA 1K6WA 5EMUA 2OR2A 1JZ3A 3WDIA 2JIWA 3BW2A 4I6KA 4WOQA 2J27A 3L5AA 5FEZA 1ZBKA 1DHKA 4LUSB 1Y5VA 3TYCA 4F0SA 2FIQA 2V67A 3S2LA 3W22A 3EMZA 1R46A 4EF9A 1BWLA 1NOUA 3FYPA 5AYXA 4QAIA 4E5TA 1V3KA 1AZ2A 1EC7A 1W1A1 3OA3A 3WQ6A 5HJXA 3UFYA 1IR2A 3KAOA 2PDLA 2VEKA 2F38A 2C15A 3LPPA 3WLPA 4DBEA 5A95A 2Z0IA 1FP8A 2PFHA 3RLVA 1Q45A 4N6EA 4ZB0A 1V3JA 4ECLA 1LDCA 3MUXA 3UNTA 3AFBA 4AIOA 2VFFA 1PIIA 1TZZA 2E09A 2B31A 3AO0A 3UR7A 2IKJA 4GD0A 1OG0A 5H6HA 5H1WA 2ZZ4A 3T4CA 1S2UA 4KIEA 2QMJA 4L1XA 3H4XA 3F4DA 3V0SA 2NX3A 3W37A 3TN6A 3GIYA 4PZVA 3SO7A 1P7TA 3WQ8A 3BOFA 1CGUA 1IYXA 5H8MA 2HPMA 3R58A 3VOFA 3RF9A 3M47A 2XFYA 1IEQA 2ZX6A 4ZE4A 5AB3A 4L4PA 4C7DA 4GC3A 1NSJA 3ZO9A 3ITVA 3WNPA 2PD9A 2G3NA 5LIYX 4L9YA 7PTDA 2XYLA 1IEWA 1EH9A 1UZ4A 4H9UA 2C13A 1EP2A 4LNCA 3NL3A 1V93A 1WDWA 2J9ZA 4RE4A 3PTMA 3SRDA 5BXPA 3NVDA 1OFBA 4IG2A 4R27A 4MFEA 5BYWA 3T4WA 3CWNA 4XZHA 2IKHA 1JD9A 3OVGA 4X9YA 3STEA 1RPXA 5I5RA 3O2LA 4NRSA 4DVOA 1BVNP 3P80A 1HO1A 4GYPA 1Z9AA 3VX0A 2R6OA 1KFJA 1P1MA 5HAOA 4PULA 1CGWA 1CBGA 3RRXA 2QR6A 3NEHA 2GDVA 5A8PA 4P7QA 5DN1A 3IJLA 2PRLA 4Q8WA 3F2BA 3IJDA 2DZBA 5D9NA 1DORA 4U4MA 5AFDA 3V5OA 2GK1A 3C8FA 3MSDA 1JZ5A 3U8GA 1BSIA 3W2NA 3E0IA 4JN7A 4TTUA 4J35A 3A47A 3OLEA 1CLKA 3H53A 1JCYA 3W71A 2EBNA 1SUXA 4K39A 3S1XA 4DWSD 1PL9A 4RZ5A 2HSAA 3PB0A 3SJ3A 4QISA 4D6GA 4E4FA 4UMBA 3CUHA 4R7WA 2OZ8A 4Q7IA 2YCIX 3R12A 3ZVHB 3QC0A 3VMPA 4JX6A 2A5HA 2JKPA 3CPRA 1T6MA 3WNOA 3VNIA 1VIWA 2SFPA 2WC3A 2NUYA 4HZMA 5F4SA 1Y5WA 3PB2A 3WIJA 5KEZA 3OHIA 4JTGA 4O0KA 3V75A 1FXQA 4YTQA 1BVWA 1JRBA 3C56A 3RM9A 1A5UA 2BV9A 3VC6A 4NILA 1K8CA 1RJRA 3EBVA 2X7VA 4HNTA 2VCBA 1TZ7A 1TVPA 2FMOA 5REQA 4M29A 4XD4A 2DP3A 3IJ7A 4H6QA 3TAOA 1HJXA 1YXYA 1DQUA 4PR4A 1YIXA 2HS6A 1E4NA 4HHPA 3WQ5A 1RVKA 4K37A 1YPFA 3L67A 3CO4A 3LU2A 3C0JA 1T8XA 5AC4A 3EGJA 3S6TA 5ABHA 3VDAA 5BMXA 3KL3A 1VFOA 4L1GA 3KBSA 2VHLA 3M9YA 3GXDA 2DW6A 3GNDA 2ICSA 2AGTA 4QJ1A 3BH4A 1S38A 2VJXA 4AWUA 4F0KA 3WL1A 3ZS4A 4Z2HA 2HNEA 1K1DA 3GFYA 3N9RA 3TW7A 1JG9A 1DEDA 3V16A 3S47A 3GDTA 4GK8A 1W91A 3B9NA 1YHTA 5BRBA 4S3FA 3CJPA 1Z48A 3OODA 1HVQA 2GK1B 1RVGA 4TR9A 3G1FA 4HK7A 3H7RA 4LB3A 1EGMA 4QJ4B 3ARRA 1KFCA 2HCVA 3EXSA 4J28A 3R4IA 3K2GA 1GVYA 4CQBA 3NG3A 1FWCC 4MUPA 3C8NA 1TWDA 4NJKA 3NNTA 2C19A 2DV0A 3M0VA 4ACZB 2W66A 1XS2A 4DJDA 2FKPA 1HKWA 2VCCA 3U2EA 3FXYA 5FEXA 4BS0A 3NVTA 4O57A 1WPCA 2FYMA 1XGEA 1Q6OA 2TMDA 3OPSA 2CESA 2BXZA 1YDOA 4TTGA 2YLAA 4GJIA 4KESA 1H1YA 1W3KA 1OB0A 3HPZA 3VNYA 2QCEA 4DM2A 3RIKA 4FHAA 2OO6A 4U3CA 2V3DA 2WM0A 4B5XA 4UTJA 1VFFA 5DMMA 1MW3A 4F0LA 3UWZA 2HE8A 3H7VA 1W1TA 4NNCA 2PAJA 1X8FA 1T5AA 4DAIA 2QYGA 2D0HA 3R1ZA 5G2IA 1LWJA 3DHDA 4S3EA 5F1VA 2LLEA 2OCZA 5CBJA 1H7NA 6TAAA 3PR2A 2PWHA 2PLKA 3RO8A 3ECQA 4M0XA 2NUWA 1SW0A 1GW1A 3STFA 1YDVA 1OFPA 1Q6QA 3EA3A 4F0RA 2VFGA 4F3HA 2A3CA 4ACYA 2WCAA 3IPWA 2O7QA 3I10A 1L8PA 2YL9A 3MW7A 1Q7MA 5FAJA 5I3IA 1IXNA 2GFTA 3WF0A 4DELA 2Y7GA 1WBHA 1RD6A 2Z1VA 1B3OA 2ZUVA 4KT2A 1GOKA 1A5OC 4H9VA 5E5CA 1S5TA 3ZQ9A 2X30A 1SJBA 4RUBA 4F2TA 1RP8A 1UCWA 2HXTA 4PN2A 5CPMA 2V5CA 3URQA 4GZEA 1E73M 4TU1A 3GS6A 3PC0A 4A3UA 3C3UA 4HYVA 1CIUA 1XYZA 3EPOA 1H61A 3BAXA 1EJTC 4UQAA 1C8VA 3G2GA 3APYA 1TR9A 3AC0A 4C7FA 5LGZA 4NNAA 4M1BA 4QXIA 1KM0A 3WD0A 1RBAA 3G1YA 5TD4A 4GIEA 1OGGA 1XLCA 5HR7A 1Q6GA 4RCXA 3KBNA 4PGLA 5KTLA 1E56A 2OKTA 1QNOA 3T78A 1QCWA 2D2GA 1F7BA 3QM3A 4NJIA 2VFIA 3KUMA 3QTPA 4JIPA 3KBVA 3T40A 3QW4B 1QUMA 1W8SA 4MB3A 4U28A 5HANA 1O60A 3VOGA 3SRFA 1FP9A 5G2WA 3TR2A 1ITQA 4KGJA 2XN0A 2ZTKA 3BO9A 5LNWA 2VDHA 3ZLFA 1C7TA 3MO4A 4N9CA 4U2YA 1JVNA 1O5XA 4D1IA 4PL2A 3GTFA 3PBWA 5C2CA 3BJTA 2CEQA 4O4VA 3AMDA 4JIIX 2FQIA 5H8UA 1OIFA 4NL1A 2IPGA 1BTCA 4N42A 2ZRUA 5C9ZA 1REQA 4H2HA 4RV3A 1UOZA 1DWHM 4AIBA 2ZDRA 2P76A 2QDEA 4FMVA 3KDOA 5KSWA 1XR2A 1WCGA 3LENA 3GHUA 1HT6A 3ME3A 1PDYA 1K9FA 3E2RA 3A12A 1ZY9A 1M7JA 3VILA 5I3DA 2J75A 3I3BA 1KV5A 3S4TA 4O15A 3TC3A 2GDUA 2X0HA 5MKGB 3B9EA 1GJUA 3R89A 2WVTA 3SQMA 1RPKA 1GORA 4IXHA 2H6RA 2GOKA 3ZR6A 2V5JA 5EKYA 1XCFA 4DWSC 1ICPA 2GJRA 4O11A 2OLHA 4UR7A 4KEUA 1GEHA 1XD0A 4MZ8A 2WMJA 1BF2A 2CBVA 3WLTA 2HVNA 1A5MC 2O9PA 2BWGA 1EB3A 5AHEA 1TREA 3FYOA 3EEZA 1L2UA 2Z25A 2W67A 3UWYA 1DWGM 4INFA 3M44A 3U57A 3EX2A 4ZQCA 3LHTA 2P0OA 4UNIA 1OFDA 4LVBA 4ML4A 5D32A 1I60A 3DH7A 3TZFA 2PU0A 1MDLA 3LRLA 4W5UA 3T9PA 4RXFA 5DCDA 1DKWA 2YOCA 1G9HA 5LIXX 1IIHA 3N25A 2PDMA 2C1GA 1XX1A 3O6AA 1ZJBA 1BG4A 1FA2A 3PF3A 5I79A 4XV0A 3QLDA 4GX8A 3HBLA 3NGFA 1S5NA 2WMFA 1VPXA 3BAYA 1XYBA 4CNUA 3QHOA 4LC6A 3BMXA 2J7CA 3W81A 3ZM8A 3MP5A 3T0CA 4WOZA 3T6CA 3TA9A 3NPUA 4S3AA 5I06A 5M3WA 1XWYA 4HQVA 3QMRA 3PZOA 3I3EA 2VZSA 4Q8VA 2WVSA 4ZL1A 2R1NA 4RE3A 2G4FA 3NXLA 3W1XA 3UJEA 1YW1A 1TMHA 4AZCA 1C7SA 3UXIA 2DT2A 3WH9A 1Z8AA 4NSBA 2Y70A 3MDUA 4GQRA 4GGBA 4JFUA 1P6BA 5DY2A 1C9DA 3FCPA 1NWRA 2ONEA 2E1WA 3R8RA 3Q94A 1VCVA 4QG9A 1UUMA 1EOMA 3USBA 1ADSA 3DXIA 3CTLA 5E6ZA 3PP7A 3A9IA 3MC5A 1M9HA 8A3HA 1XIDA 5K9CA 3PNZA 1V02E 3APTA 2VGFA 1FFRA 2DUZA 3YPIA 4B4FA 1XI3A 1H1ZA 2NV9A 5LGXA 1FFQA 3W6YA 1LYXA 1NARA 1EYWA 1F61A 4MSSA 1AZ1A 1SPQA 4DAFA 3PPCA 4GOAA 1ZS2A 4QSFA 2PZNA 4BF9A 1GVRA 3H23A 1XBYA 4ZR8A 1KA9F 3AZSA 1XBVA 3JW7A 2QGHA 2D1ZA 1SR0A 2O7SA 4OWGA 3KW3A 3MYOA 1HKKA 2VNCA 2C8NA 2WM1A 4Q8UA 3KL5A 3VINA 3SM0A 5LSMA 3EZ4A 3P5YA 4CVWA 1PWMA 1OHLA 5CZJA 2I1OA 2A7PA 4BI6A 1KBJA 1L6GA 5C9RA 1XH2A 1L9WA 3LTSA 2ZTJA 2DH2A 5G4HC 4GLEA 2V3EA 3BLIA 1QBAA 3WQ4A 2NZLA 2Q3RA 5F1UA 2PS2A 3QYSA 1R3SA 1PZ1A 2ZA1A 3P8JA 3EOEA 4YL2A 2OX4A 1EFZA 1AG1O 4DJFD 3PBYA 4RE0A 1KCZA 3KOXA 2ZCGA 3UQNA 3SCNA 1IWAA 1XDLA 1GVQA 1CZ1A 4CCEA 2PWGA 4F2UA 4S1FA 3W75A 5CAKA 2ZXAA 1NDVA 2VOTA 4AD0A 1KM2A 2B4GA 1SW7A 1SFJA 1A0DA 3DX5A 2ZVRA 3A64A 3C2OA 1EX5A 4QE5A 3L0KA 2CPUA 4JNMA 3O6YX 2F84A 3WMLA 1XH1A 1F74A 4MB5A 1YTKA 1JGMA 2PPGA 1KBKA 1VJSA 2B7NA 2ZRVA 4Q4MA 4LVGA 4MYAA 4HZ6A 5DT7A 1E5NA 3UZJA 1OCNA 3NYDA 1KD0A 4HBKA 1PS9A 4ZO8A 2CKSA 1KCLA 2V30A 3G18A 4OZOA 3UEQA 3QJAA 1GQKA 1TRDA 3A4WA 5IBXA 3PNUA 1OM0A 1AJ0A 3GHSA 4YU1A 4YCOA 2P3EA 2W3ZA 3QGVA 1RQEA 3SJNA 1OWQA 4W9TA 2BMBA 3TN4A 2YCJA 4JZ5A 1RHCA 4DJEA 4GQBA 3SCPA 1FBAA 4FNRA 5G1TA 3ARTA 2E8ZA 2RAGA 3TTOA 1SZRA 4C6MA 2O4MA 4C5ZA 4JFSA 1VPQA 2XIBA 3PUDA 1TA3A 3FLUA 4G8TA 3SCSA 4OGZA 3WLRA 2ISFA 2XJ7A 3MHUA 3IWPA 2GQ8A 2NUXA 5A3HA 3CUFA 3ABQA 1KRMA 4RR4A 3A24A 2VFDA 4MB1A 2RDUA 3MQTA 1RP9A 5I6SA 1GJPA 4EANA 1S1PA 4O0ZA 5I07A 1W5NA 1JUKA 2HBXA 1UPMB 4HHLA 1EZWA 4ERIA 1MVYA 1QRQA 3DFPA 1VFHA 3NOEA 3T05A 1PV8A 3LCGA 2C7FA 2FFIA 4DBSA 2EG8A 4GE8A 3NZQA 3W6LA 1WDSA 1GKRA 3E0FA 3ATYA 3QSTA 1H5YA 4EXAA 4PMJA 3I65A 3AU2A 3DGBA 2VD8A 3R2GA 3W7MA 1UJQA 2YL8A 4G7EA 4UTKA 3OYXA 3AHTA 4RZBA 2XZ9A 3MZ2A 6REQB 2GJXB 4LS1A 5KMYA 3TTSA 4G9PA 4EWND 1E0WA 1X98A 3LRKA 1GGOA 3S83A 1PKYA 4U3AA 4PSRA 1DP0A 3W01A 3B8TA 1UWSA 2RDTA 3E5BA 3TSBA 4JTTA 4EPBC 5A5WA 5FIPA 2I9UA 5IFTA 2AQVA 2Y61A 3DDMA 3WLIA 3DFNA 3P62A 4IIBA 1ZAIA 2OZTA 3GVQA 4FOJA 1XD1A 2QKFA 4N4PA 2HVOA 1J10A 4CNNA 1E6PA 2CZVA 1PZ2A 3POCA 1AW2A 4IH3A 2NXHA 1KB3A 2FJKA 4I5XA 4GUHA 1V0KA 4QSHA 4H41A 2PC8A 4ZB5A 4L4LA 2CLEA 3N2OA 4L6DA 2UY4A 2VURA 2VR2A 3LZ3A 1VYPX 2JGYA 3AICA 2YXXA 2Z28A 1IWBA 2PDXA 1YE6A 3O07A 2BHUA 5D30A 3EWUA 4DBWA 4OOZA 4KCVA 1G01A 1XIHA 3LHYA 5D4YA 2TSYA 1DWIM 3M7SA 5BROA 4E38A 4LFYA 2RUSA 3VIFA 1POKA 5A6AA 3MZNA 1FHVA 2FPTA 4EXQA 1TCMA 1RJPA 4QDMA 4LWWA 3H70A 1EZ2A 3NZ1A 1HGWA 1W54A 3VGFA 1R3RA 1XIJA 3SUVA 3AIBA 1VR6A 1HG3A 2J79A 1E4MM 4EX4A 5AYBA 3MCNA 2PDFA 3B03A 4DJDD 5G4WA 4S3JA 3KWSA 3MDWA 4QR6A 4CGTA 3EPMA 3PTQA 3LHWA 4Y6GA 1VIZA 3C2RA 3NPXA 4A35A 4BI7A 3LHUA 2DZSA 2VELA 3CC1A 3H22A 4U31A 1DJXA 3KE0A 2Q8LA 3KBJA 2CC0A 3WMBA 2V9DA 3S2MA 2OFJA 3ZT6A 1HJQA 1S1RA 1QO5A 1UKSA 2VC7A 2I5IA 2TAAA 1JZ2A 5EFDA 1DQXA 1T96A 3AQUA 3B0XA 3WQDA 4NYYA 2YDRA 3LXBA 1OK6A 3GG0A 1ME8A 3P6LA 4MMWA 4DUWA 1HL9A 3S5NA 3P60A 2OU4A 5LNSA 2QPUA 4POCA 3G1AA 2WNWA 2X1UA 2FVKA 4QE1A 2WSRA 1QPOA 4FPSA 3BCFA 1I2QA 2WHJA 3WH6A 3FDGA 3F2CA 1W32A 1B30A 2XN2A 3K8LA 3O06A 3MWAA 4PUDA 1G0CA 3B8UA 3TNBA 3PBVA 4IGHA 2WMIB 4QCFA 4UFJA 1PJ9A 3VMOA 4W8BA 3GW0A 4C6QA 1W5OA 1TV8A 3R0KA 4JGDA 1TWIA 4A8IA 4Q4PA 2JEPA 3WUGA 4IICA 1UKTA 3UY7A 5HJLA 2BVTA 3CWHA 3I7RA 4DM1A 2V0TA 3IGSA 1M7OA 3XIMA 2QMKA 2WAGA 3MVIA 2X41A 5CZKA 2GGHA 3K1DA 3PFMA 4KWSA 1VFUA 4V15A 2CW6A 3UR5A 2B7PA 4Y96A 1M53A 2NQZA 3CUZA 1VFTA 2D2OA 1K8XA 4K1GA 4JQ2A 3LD5A 4JTQA 1FY6A 4PYSA 1B3YA 4X0VA 4DO5A 2V2CA 4XBKA 3EAUA 1ZP3A 2QJGA 4QM1A 4D9PA 4E2BA 5DXXA 1VEOA 2GL5A 3L12A 2OODA 1F3WA 3HGJA 4HU4A 3B0PA 3TFXA 4HD5A 1WDQA 4EAYA 2HK1A 3NOYA 2PTDA 1AODA 1SJCA 4K7VA 4QAWA 3UY8A 4K1WA 2DVTA 3LTYA 2OG9A 4H9XA 1LOQA 3TIMA 4Y9AA 1CXHA 4BY3A 3GDMA 5G5IA 1K9EA 3E74A 5AYIA 4UCFA 2FPYA 3NSXA 5F2MA 2P0IA 5CPNA 4H6RA 2QJIA 8RUCA 5FSEC 3PS7A 4D6DA 4UTMA 1R85A 2ZZ2A 4IISA 1DIEA 4PA8A 4HSNA 3TAKA 7REQA 5LNVA 3CQKA 4IPPA 3CXOA 1W37A 1P5BA 4NZ1A 5AVNA 1BFNA 1X1NA 5AYYA 4N7QA 4JQ1A 4PMUA 3EX6A 3ITGA 1LUCB 1EUNA 3FGCB 2NX9A 4JTFA 1M7PA 2PUZA 1AJ2A 3XINA 4UQDA 4XD3A 4HA4A 3RPTA 3QGKC 3HG4A 4LAOA 2G3JA 2QAPA 4REQA 4XD5A 2W92A 3DG7A 2YDQA 4WCJA 1W2PA 2EO7A 3L4ZA 1MQRA 3M43A 3VKBA 4AVNA 1QNSA 4NAEA 2V3GA 1W5QA 2QHAA 4GUIA 2XWEA 5E9XA 1J9YA 3EB2A 5CG7A 3TH6A 4TXEA 1AL7A 1REQB 3F5KA 2E7FA 1LORA 3OJGA 1B0IA 3ZR5A 2GVEA 3VTRA 2NVDA 1MQPA 2Y5EA 4YTRA 5K3VA 4WSKA 2QF8A 2PTZA 3P67A 2IXUA 4IGMA 4HU3A 2E40A 5HXMA 4RNFA 3R8GA 3NQEA 4U2ZA 3OZYA 4J4KA 3LCXA 2F2KA 3AMKA 1VCGA 4TMCA 5A2CA 1N8WA 1XBXA 4F9DA 2FZNA 1SW3A 5TAOA 3UR2A 4IJRA 4PMRA 1B90A 4IJCA 1QTWA 4O52A 1E4LA 2HDJA 1L6FA 1ECQA 3LA4A 3NO5A 5D8ZA 5CJMA 2A79A 1NOWA 3N2BA 4IMAA 3VCNA 3PK7A 4XVDA 1OX6A 1CECA 2J66A 3FX4A 5CC6A 4E2DA 2GSHA 3Q65A 1KFLA 3MI3A 3PZTA 4H83A 2W4XA 4CQ8A 4P7NA 1TSIA 2ISDA 2A4AA 2FVMA 1KXHA 1Z6KA 3ZJ7A 2VVNA 1V3LA 1HXJA 2ABAA 2ZX5A 1BRLB 2XH7A 2YYTA 2Q09A 1UP3A 4RPPA 4HP5A 1W2VA 3MV01 1FWRA 1TPEA 1NJJA 3RLGA 3FSUA 3ZYZA 1D7FA 1A47A 4F0MA 3AAMA 5A2BA 3B4YA 3WN6A 3H2EA 1WUEA 2YLLA 3GXTA 4O10A 5LHFA 1CXKA 3NQAA 4H6KA 4B5TA 2BY0A 2NXGA 5AECA 1DJYA 4XZIA 2FB2A 3W2LA 3B8VA 5LIKX 4R85A 1E1FA 1FWFC 2DJLA 3QPYA 4K8HA 5CC7A 3QV7A 1VH7A 3EDEA 5HA7A 3A13A 4AVOA 3JRKA 1DTNA 3CMFA 3MKCA 2J9XA 3WLKX 1HW6A 2X7WA 1ZNNA 3WBXA 3VGEA 2IPFA 3FA4A 3N29A 3T2OA 4LS2A 3BARA 4JFTA 3T55A 2MNRA 4JTUA 1WXYA 1BKSA 2CITA 1QPRA 1J79A 1XYMA 2DZWA 4HPXA 3RYSA 1E9IA 3UF9A 4MGGA 3ABZA 4WZHA 1G7VA 2ANUA 1YPXA 5FACA 1R3WA 1ZAJA 4GI6A 4HJFA 4DXKA 4FF5A 4ZTXA 3VUSA 4CD5A 3WKZA 4B91A 1PE1A 3BG9A 4NAFA 3LNPA 2X0YA 3WNLA 1TIMA 3GLCA 3MMWA 2DEPA 2AMXA 1V79A 2WZHA 4C7GA 3V4BA 2OJPA 4A8NA 3QW3A 1NY1A 4GVGA 2PGWA 1LBMA 3S5OA 3WD2A 3FYYA 4O17A 1E1EA 2BSLA 9XIAA 3BWWA 1G69A 5GQBA 3GG8A 2L5HA 3FNDA 1LQAA 1VBJA 1KXQA 3VNZA 2XG9A 1WXZA 3S2NA 4GJJA 4JYEA 2VD9A 3RUBL 1NH6A 2IKGA 4NZCA 3OLDA 2YBVA 2PTXA 4MG4A 8CGTA 5DRIA 4TO8A 2UV8G 1TJ1A 5L9FA 4MOZA 4JHOA 3VPLA 2BY2A 1TWSA 4M7SA 3N4AA 1CGVA 1XV8A 1A80A 2R14A 1VAHA 2J62A 1WXJA 4GCAA 4KFOA 3W87A 4Z2JA 4JTSA 3NQFA 2CLIA 3CTTA 3C6CA 1JYVA 3R94A 4AG0A 1X96A 2QCLA 4F40A 5FI8A 2VDIA 1UD3A 4AD2A 5M03A 1EKOA 2OWCA 4BK9A 4J3ZA 4AY7A 1HQTA 4MFDA 1KRCC 3O1NA 3CL6A 4KETA 4B15A 1SMAA 2YXGA 1RCOB 2Z6JA 2C0AA 2QCCA 2BP1A 3V7PA 1A5LC 1OABA 2XIIA 2FZDA 5AYZA 2XGZA 2QCMA 3T7VA 4AZCB 4AIEA 2A6NA 4FK9A 5H8PA 1UIOA 4L56A 3S5SA 4IP5A 3QMSA 1ZCOA 5M2FX 5A94A 1V8EA 3Q4DA 4AHQA 5I77A 4DUOA 2OPJA 2PODA 1R3VA 2JF6A 1X39A 3TLLA 4M6VA 3PANA 2KAUC 1J8VA 3KRZA 1JCXA 1FWHC 4QIUA 4AZ5A 4GMEA 4M6PA 3MJMA 4IOTA 5DX7A 2WBGA 3SIZA 4Z1YA 4H9YA 4O1DA 3KDNA 1GZ1A 3H2CA 4GRSA 1RALA 4E2OA 2V8ZA 1PHWA 2VEFA 2E9MA 3RK8A 3W1TA 1VJIA 3E6EA 3W1PA 3VX1A 1JQVA 3TCEA 2E5DA 5CZ0A 2EKCA 1W5PA 3PJTA 2PDNA 1M7XA 3OTRA 3OBEA 2QIIA 1RCQA 3HG3A 1K4GA 3BV4A 3UNDA 2C71A 3SSJA 5DMLA 2DSVA 4R9XA 3MS8A 3PPHA 2HRWA 3CL7A 1NTHA 4HA1A 1DWAM 2VI0A 2YXOA 3UZYA 3GZAA 4YNGA 5CJNA 2NSXA 3QZ6A 1UD5A 1L6YA 1K6AA 3SI9A 3E02A 3LBOA 2GGJA 1DBTA 2J47A 3VIJA 2A1YA 1XIGA 3TCSA 1XC4A 3CUIA 1GOXA 3W27A 3GIQA 3QY6A 3V35A 1IR1A 4DJDC 4GY0A 2NVAA 1UBSA 1JPMA 3I4KA 2YBTA 1ISVA 1JQXA 3IVUA 4GQ0A 1ZJHA 2H90A 1I2NA 3LX9A 3TX9A 4FOKA 5MKGA 1B9BA 5PTDA 3UZWA 4G56A 4GY7A 4PUJA 4M3PA 2GVJA 2QJHA 1H7PA 3O9NA 4UFHA 5CGMA 1AQFA 2QJJA 1B3ZA 1RBLA 1THFD 3H2FA 1R3YA 5HQEA 3SY8A 3WLOA 2BZNA 3RG6A 3VFLA 1VGAA 3MCOA 2TPSA 1H2JA 1JPHA 1UR9A 4LAMA 3UWEA 4Z0JA 3SN0A 4JYFA 1EHNA 2WNNA 3LMYA 1LP6A 3FHAA 4HGXA 3T0TA 1LRNA 3KLLA 1QI0A 3ARPA 2PRMA 2GJLA 3OZMA 2DT0A 4NF7A 3EOSA 4MJMA 3WDPP 3DFOA 5JBEA 2CHNA 4F8XA 1P7TB 3COTA 3GTHA 4QQUA 3W7KA 2ZUTA 3W7DA 3L5LA 4OUEA 2PC4A 4PUEA 1DJWA 2DSWA 4UZSA 4TX6A 3UZXA 1XHGA 4EIVA 3ZMRA 3WQGA 1HX0A 4R88A 5LYRA 1JZ8A 1A5BA 3MWCA 1BEUA 4GHRA 5FKYA 2WVVB 4MAZA 1UR2A 1HFBA 1B9ZA 4B3ZA 5IOBA 3ARWA 5EMMA 2OO0A 2EPOA 3SDOA 3OVQA 4RLIA 2E5BA 4XZLX 5C7HA 1KLYA 5A8GA 5C0QA 1QT1A 3N9SA 5AKQA 5A8MA 5CPOA 2CU0A 3VAVA 1D8WA 1WZLA 1W17A 3FEQA 1TWWA 3CWOX 5LXXA 1J5SA 3QXBA 3CHEA 3ARQA 2J7GA 4AY8A 3NL2A 4PTWA 4ROPA 4NY2A 3RRAA 4LJ3A 3WDHA 4IT1A 2YZRA 1MUWA 4S38A 4QFUA 5KZDA 1BQGA 3SIMA 2R91A 1TA3B 3SRKA 1IEXA 2PDKA 2VZOA 3H21A 2RKXA 4O8RA 1W3HA 3MYPA 1H50A 1R3TA 3FXGA 3INPA 3BLEA 3M5YA 1J93A 2H9AB 1YTDA 2I9EA 4PB3A 5M1TA 2OYKA 3S1GA 1V7YA 3SRHA 1P0DA 1CXFA 3B0YA 3OZOA 4MNKA 3HV9A 5CAHA 2ZUNA 3VZYA 1DJGA 1AD1A 2D3NA 4BR1A 1MWOA 1CB7B 5LNUA 1TKKA 2BY1A 3TQPA 1HIZA 3OA5A 4BEQA 4IP7A 2ATMA 1OJXA 1FCBA 1FCUA 1P1XA 1X7IA 3GU2A 3DYOA 1DJZA 2XINA 4H1ZA 5D2XA 3HM7A 4YMZA 3DKJA 1QPQA 1QFEA 4PCNA 1ZSXA 4XSLA 1K9DA 3P14A 2J13A 2QCDA 4FNTA 2OT0A 4YPJA 1E71M 1NU5A 2P50A 1UP2A 3R0UA 4CNSA 4GPNA 2YW3A 4UWMA 3B3DA 4WXZA 4IQJA 1Y0EA 4QNWA 3DBPA 3M07A 3BURA 1T41A 4JD4A 5G4EA 4DZIA 1QNQA 1UKQA 3ZSTA 1KRAC 5IDZA 3G0UA 4Z2KA 3UG3A 2ZRZA 1N82A 3PJWA 2YGYA 3W7IA 1GK8A 3DHFA 3QQ0A 4IMEA 4CD4A 1T7LA 2OQYA 3N34A 1TTJA 3WF4A 3C5QA 3TSMA 3DFSA 4PE8A 2Q01A 1QNVA 2ZC8A 1EA0A 3NEVA 3PPGA 4OJYA 3W83A 1U83A 4GQGA 3KBMA 4JEJA 4C1NA 4PBFA 2D23A 2ZKMX 1ITCA 3TK7A 1ELSA 2PWVA 3WUEA 3QQWA 3MBDA 4EK7A 4US5A 4H19A 2FLIA 4ZO6A 2PWFA 4Z17A 1XLGA 3HZ3A 4L6OA 1KBLA 5EU9A 4JN6A 4C6DA 3P3BA 3MUCA 4HYRA 4MLJA 1SJDA 5DMNA 1Q3NA 2WNQA 1PTGA 3EX4A 1KQYA 1FCVA 1VZWA 5IDIA 3H7UA 1M6JA 1SM9A 5CGTA 1T99A 3AHVA 1TMQA 5T91A 1CEOA 1N55A 2WYSA 3LGEA 3Q2DA 2JIEA 3R13A 2HROA 3DFHA 3KP0A 3WLMA 5AY7A 4TQTA 4N9DA 4P61A 5J04A 4RW3A 2VEGA 4FO4A 3PJXA 1A3XA 5HQMA 2EAWA 1UR1A 4IX0A 5GJMA 1LQ0A 1B1YA 5A6LA 1JR1A 1OIMA 1RK5A 1WBJA 4GA8A 3W7OA 3EX3A 2FHBA 1Q5MA 3H2NA 3LDVA 3W23A 4S3BA 3KTXA 4W86A 1B5TA 3N12A 3QHMA 4L80A 4JTIA 1IZJA 1KBBA 3M16A 3RNDA 4J2MA 4V2XA 3GYEA 1QK2A 3CLWA 3Q45A 4ICMA 2QUMA 1E0XA 3VNKA 2E77A 2YCLA 4UIOA 2I14A 2C6QA 4HPGA 2FTPA 3GNRA 1RV8A 1FHLA 1FWAC 4BQ3A 2XUCA 3M5ZA 3HV8A 2PCEA 4KRZA 5LNRA 1SO6A 3KFTA 3WK0A 1NP2A 3EMCA 3WJWA 4XSMA 4Q4SA 3P5ZA 4PTXA 3GFZA 5JH2A 4AD3A 1KCKA 3O05A 4QITA 3BDKA 4Q7BA 1NAL1 3TTYA 2CWXA 3KTCA 3TEVA 4V1YA 4EPDC 3G22A 1LRTA 1MZHA 3WSUA 4FLOA 3IRSA 5I3HA 3VK5A 2O0TA 3V0TA 2PF0A 1WYIA 4ERAA 4NJJA 1EL3A 3CB3A 4FX7A 5L6UA 3AYRA 1OF8A 1XLAA 1TMLA 1GVOA 2NW0A 1VCFA 3LN3A 4AYSA 4WDWA 4Z1BA 4FIQA 1EOKA 5C54A 3ABXA 5EPDA 2XWDA 4IPIA 3U7BA 3IUIA 1OZQA 1GHRA 3EPNA 4FP1A 3HMCA 2ZIDA 1X6NA 1VPYA 1ONXA 3CHFA 3DYPA 5BOOA 1KGWA 1GKQA 3IJIA 2F8QA 4MJ2A 3CV1A 3VVGA 4PMDA 3BLPX 1BYDA 1J0JA 4KCTA 4O12A 2Z26A 5DLCA 1BKHA 1CTNA 5BXRA 3TXZA 1KBIA 5JIWA 2VC5A 3AXKA 4CN6A 4NZ4A 4RZ6A 4S3DA 1Q2SA 4M81A 3T8QA 3AZTA 1WKFA 1W0MA 2ODOA 3DKLA 3GR8A 4BWLC 1OD0A 2WJDA 1WV2A 3PN8A 3LCHA 1TCDA 1GW9A 4M1RA 3VOHA 2FVLA 2RHGA 2VX4A 2BGQA 3QV8A 1MO0A 1F6PA 1O6IA 1BLIA 1XRVA 2Z1WA 3N6HA 3G1HA 3W7NA 4NXSA 5D37A 1GOMA 3PZ9A 3II1A 1TRIA 4AH7A 4HJWA 3BG5A 3S42A 4RNJA 1BTMA 3GX9A 3VXGA 2YB1A 3NURA 3FAXA 3KP1A 4KRTA 3MCMA 1JCJA 1H0GA 3XISA 1LF1A 3CL8A 3LLFA 3AIWA 3TZNA 4ENLA 2OZ3A 4H7VA 1WX0A 3M64A 5AC6A 1U1JA 2GYIA 3RCYA 2XHYA 4ATWA 2REQB 1ECEA 2ZXDA 3G6LA 4HHMA 3TJIA 3MU7A 3I7SA 3GXMA 1TQXA 2YKKA 1HKJA 1R9ZA 2Y89A 3D0CA 2X8RA 2EKGA 1FDJA 4FSAA 3ES7A 3MB9A 2RGMA 5E1QA 4NJHA 3IJ9A 1A53A 2J4GA 2VQTA 1L6WA 2Z2AA 2F6UA 3USZA 2Z2BA 3AROA 1O12A 3LCLA 1XKYA 4B4HA 1B2YA 3VABA 1EQCA 2H8XA 1XBZA 4DBDA 2C18A 1YYAA 3J7HA 2YL5A 1CGXA 2VM8A 3RLUA 2W0UA 2ISSA 3EA2A 4YTTA 1LZOA 3PHAA 4GX9A 2JKEA 2EHHA 1D8CA 3R43A 2PE4A 1OFQA 5DCBA 1TPFA 1YBQA 4UTWA 1QMLA 1GYMA 2E6DA 4DBUA 1JEZA 1A0CA 3ZT5A 4J3WA 4AX6A 3S5YA 2J6VA 3OLGA 4WLCA 4AIUA 3H26A 2VX5A 2G3FA 3TLQA 4GNKB 4QE4A 2JGQA 1XUUA 3PM6A 5GPRA 1XW8A 1IXQA 5FF3A 3VDHA 4HCLA 2HQAA 2I7GA 3MUZ1 3GWQA 5IHSA 1QPNA 4E6MA 2PDPA 3O63A 5CLWA 1CENA 3TYEA 1GKPA 1UWTA 4A3RA 3CZLA 4NRRA 4ZE5A 3FS2A 3UU0A 3CQHA 2CLMA 3TJ4A 5CZSA 3M4HA 1PBGA 4ZOBA 2OLSA 5KETA 4IQDA 2HVMA 3N6QA 3W72A 1J4EA 4LANA 4ERGA 4W88A 1KWGA 5M17A 3TVAA 1GPFA 4B92A 2Q8ZA 1VJZA 5CSSA 1ESWA 3QZAA 3PFRA 1QHZA 4Z1AA 4D8AA 3BAIA 3KHDA 1VD6A 3WZ0E 4OE7A 3BLKA 1MZRA 2XFFA 4C6EA 3OQ8A 1Q7QA 1LRQA 3UJSA 5XINA 3THDA 3MTWA 4QROA 3B06A 4PTDA 4LQ1A 4RDWA 2INZA 3LCFA 3BGJA 4X2PA 3DERA 2BFGA 1SZNA 1NFBA 4IIFA 3IGXA 2E28A 3K13A 3AXHA 1XIMA 2WSQA 2ATSA 3BSHA 4PBEA 2IS7A 5JMUA 2ZWZA 2VWSA 1OYCA 2D22A 9CGTA 3ITLA 1U5HA 2PLCA 4LUYA 1FWEC 3MUY1 5HJYA 3SECA 1KKOA 4BI5A 1H7RA 3NZRA 4W87A 1VRXA 3ISIX 4HSHA 1OK4A 3QYQA 2ON3A 4L9XA 1ADDA 4Z42C 5BOEA 1TFVA 4I9TA 4GYPC 1KGUA 3UA3A 4ZEPA 3WELA 2P53A 4LBSA 1EGVA 3GBDA 4MYXA 1QI5A 3WDRA 4O8AA 4ZQMA 1F4HA 4AXKA 4D6IA 1EC8A 5G2HA 4ACZA 3V36A 3W2JA 1JIBA 1UD4A 4D6JA 3N18A 2VUYA 1R0MA 1ZU8A 1SR9A 2ZUMA 3M6DA 2DZVA 3QHNA 1WA3A 1J18A 5D9OA 1W1VA 4JNZA 1WKDA 3IACA 3RGTA 2ZX7A 4CD7A 3LPOA 1W5MA 2WKGA 2BVWA 3W1MA 4RX0A 3ELFA 2OKOA 3UD6A 5BU9A 1XISA 3EMQA 3QVQA 1PO9A 3VGGA 5FCZA 1W1PA 4LTSA 4CN4A 4FF7A 4IP4A 3HQOA 3SCUA 1DJHA 2EF9A 1Z42A 1Z89A 4JCMA 1NEYA 1WDDA 3N3MA 4NZFA 5T8GA 4JTHA 3WBEA 2ACRA 1ME7A 4GVIA 4DZAA 5ECVA 2WMGA 2PGFA 1TJ2A 5FSDC 1YDNA 1UH3A 3KWXA 4LY4A 5AOUA 2CBUA 1OGBA 3N17A 3R0DA 3MKKA 1M04A 1UC5A 1UA3A 1QHOA 4EOUA 4E4UA 2DGAA 3ORWA 3W1NA 4LRSA 3KOWA 4WXYA 1NWUA 4R34A 2O56A 3CYVA 2VGIA