4FO4A

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, complexed with imp and mycophenolic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
363
structure length
348
Chain Sequence
MHMLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine 5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant, complexed with IMP and mycophenolic acid.
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 113
structure length 348
sequence length 363
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fo4A00
4FO4A 2JKEA 3KAOA 3W7GA 2RDUA 3W74A 4LU0A 1TREA 3MHFA 3WJXA 1SO5A 2CLIA 4NJIA 1CX9A 2CZ5A 2ZZ1A 3L21A 3ABOA 1TRIA 1OFDA 4ADSA 5CSRA 1N7KA 2QUTA 4N6FA 1SW3A 5BW6A 3GK0A 1IGSA 4E38A 5DXYA 1IXPA 2O7QA 4UR7A 1DQWA 1VRDA 3IGUA 3FA5A 3S1XA 5A5WA 3Q2DA 1F74A 1M6JA 1UCWA 4P61A 4Y90A 4EWND 5H2ZA 2YW4A 1VYSX 3PSWA 3TSMA 3W1NA 1SO3A 3IV3A 2W6RA 1TMHA 2R94A 1G67A 1VS1A 5LZLA 1TTJA 2Y62A 4K8EA 2WSYA 1GVFA 1ML1A 3L67A 5BRBA 3ZWSA 2OJPA 2O7SA 3B06A 1X1OA 4TR9A 1OFEA 4UTLA 3P67A 3TMLA 1A5AA 1Q6QA 2DP3A 4LY8A 3W1PA 1F6PA 1TTPA 4UTWC 2JGQA 1ICSA 1M7OA 2C14A 3JS3A 3LXBA 5D2YA 3CQ0A 4UTKA 2ZQ0A 4Z08A 5I3JA 2HMCA 1CW2A 2DZUA 2VOMA 2NUYA 4XUGA 3OEXA 2RDTA 3QFEA 3U2OA 3CHVA 4NNCA 3W7EA 2ZRWA 2ALDA 1P0KA 3FOKA 3E12A 3MP3A 4HNVA 3LRKA 3T7VA 1I2PA 5HWNA 3S8HA 1EUAA 1PV8A 3W1MA 2CWNA 2HS8A 5BOOA 4BR1A 3B0PA 4MLRA 4Z0JA 3S0CA 4LUJA 3BG9A 2C18A 5CPNA 5AHNA 1K7XA 4M5PA 2ZZ7A 1OK4A 2ZDRA 1G7UA 3C8FA 2YPIA 5HMSA 3W1QA 1B9BA 3UWYA 1ZNNA 2ISVA 3HG4A 1VHCA 4MUZA 1RV8A 3TKFA 4DELA 1Z42A 4UTWA 4LV9A 3TSDA 3V1PA 4GBUA 2E6FA 2ZFAA 3NDOA 5D37A 1YDVA 1JR1A 3NM3A 3UY8A 1KM1A 3M47A 3W2NA 3LM7A 3W6YA 3M6YA 5CGQA 3EB2A 3WK1A 5J5DA 3S5NA 5D2VA 1FDYA 1WXJA 2PRMA 1XKYA 4IX0A 2WSRA 4UFKA 1IXOA 2CW6A 3L5MA 3W85A 1TQJA 4AMAA 3PB2A 2WKJA 4LVBA 3NVTA 3LBCA 4JYDA 3FKKA 5DBTA 4I9AA 2A1YA 3HIJA 3LDVA 3PBYA 2NUWA 2Z0IA 3W7OA 3P5YA 4LWWA 2XN0A 2J9YA 3GXPA 1F76A 5K9DA 4ZL1A 4MOZA 3HQ1A 2QEZA 2QCDB 4O19A 1LOLA 2VEIA 5BMXA 3B4UA 3MYOA 3H55A 1GPWA 4EF9A 2X1UA 1OX4A 4DXVA 4WY0B 5LSMA 1AL8A 2NV2A 5G1TA 3FLUA 3WJWA 1F6KA 1LYXA 1QPQA 1TV8A 1YADA 4AF0B 3V75A 1SU5A 5KZDA 3E49A 3TAKA 1OJXA 3ABQA 3LLFA 3N14A 1HTIA 4UMBA 2E5DA 5AYZA 4AH7A 3CWNA 2HS6A 3TC7A 3WFAA 1T99A 2A7NA 3LI1A 3VI2A 4UTHA 1OFRA 5IBXC 3P74A 1H60A 2PCQA 4U4MA 1PHQA 3TAOA 2Z2UA 3IVTA 3GNDA 3O1NA 3W76A 4CNNA 3MO7A 3HBLA 4JR5A 3LCXA 2H6RA 3Q94A 3PULA 2NWSA 4ZQMA 1NF7A 3N34A 1TB3A 3NQMA 2AGKA 4O18A 3SECA 1W3TA 4FXSA 4M6PA 1JUBA 4XQ6A 1GG1A 3DFTA 1GVSA 3VE9A 1TPH1 3MI2A 3I7SA 1W0MA 3SI9A 1YLVA 3SGZA 1K02A 4QNWA 1HO1A 3OVQA 2QUUA 3LI0A 1G4PA 1H7NA 3L9CA 2ISWA 3C2VA 1JJKA 3ABRA 2NUXA 1K8ZA 1EEPA 3DENA 4FX6M 5IBXA 5AC8A 4NJHA 3SSJA 4PCFA 1C9DA 1UUMA 2EAWA 3BO9A 2R14A 3LHUA 2ZRUA 1L6YA 3BARA 1OFPA 1P4CA 1B4EA 4AWTA 1TV5A 3A9IA 4OT7A 5CZTA 4N2YA 3KRSA 3TJLA 4P2VA 1SSGA 2AAMA 4JEQA 3BV4A 3I7QA 1SW0A 1H1YA 3MP5A 5L6UA 1H62A 1XCFA 2DJLA 4ADTA 3DGRA 2CLKA 3QMSA 1K03A 2DORA 3G24A 3L5LA 3M0ZA 1UASA 1OX5A 1ZAIA 1OFAA 3LCGA 2EHHA 1H7RA 4LC6A 5FEPA 3S5YA 4KFOA 4UTMA 4IWWA 1QO2A 3HG5A 4X2RA 3RNDA 1TSIA 4Y8FA 4HKPA 2QDGA 3LRLA 1B57A 1D3HA 3H54A 2GQ8A 3DHFA 3TROA 1FWSA 1OYCA 2QCMA 4GRSA 2CU0A 3H53A 1WYIA 4LOCA 2A85A 4S2BA 1TPB1 3FKRA 5TIMA 5C2XA 1ZHAA 3HGOA 4EF8A 4O8RA 1TPEA 3SGUA 3ATZA 3NR0A 2LLEA 4ORMA 1RQHA 4WX2A 2QKFA 4HT3A 1ME9A 4FNPA 4XTDA 1O60A 1XL9A 2V81A 3I68A 3QEZA 3M5ZA 2H3DA 3W87A 3KFTA 3QJAA 2V82A 3HJZA 1OX6A 2NX3A 4GUHA 2GQAA 5D33A 5F2GA 1NAL1 5DXXA 4PODA 2X16A 3NAVA 1MO0A 3DZ1A 1MEIA 3NQVA 2PRLA 5HINA 2V8ZA 4NUWA 5HWMA 3L0NA 1AW5A 2ZA1A 2OT0A 3CIXA 3NM1A 2G95A 3GR7A 3ZR4A 4UTTC 1MEHA 3UXDA 1VGAA 2WSQA 2JKPA 3I7RA 3THQA 4HHPA 4M6VA 4O50A 1P1XA 3QW3A 3LB0A 5CZJA 4TMBA 1FX6A 3DXIA 3JRKA 4NJGA 5D30A 2DZPA 3G3MA 3HGJA 3EWWA 3HGRA 2ZRVA 2VFEA 5EA9A 3G8EA 1GEQA 1H63A 5G2WA 5D38A 1OF6A 3CLMA 3EWYA 3Q37A 2BXVA 4LVAA 4RZ5A 3EX6A 1Q6LA 1UBSA 1QFEA 1R2TA 3TQ0A 3NO5A 4GUJA 3EEGA 5D2TA 3IIXA 5F2MA 3CEPA 2PURA 1ME7A 4FNQA 1FDZA 3NA8A 3BG3A 3EKZA 4GE8A 5SWUA 5KINA 1LROA 5L9FA 3YPIA 3TC6A 1GYNA 1VR6A 4IX2A 1A50A 4YMZA 2NLIA 4K36A 3QC3A 1W54A 2YCEA 4GUGA 3E96A 1UUOA 5U4NA 3TNOA 3ANYA 1O94A 4GUIA 1FWRA 3UQNA 5HR7A 3B05A 4KWWA 3LTSA 3C0JA 1VCFA 3TFXA 4MPQA 1TV7A 4CNOA 1PHWA 1DORA 5IM51 1FBAA 1Q6OA 3QMRA 3STCA 3TUUA 2E68A 1KFBA 4Z1DA 1KFLA 1KM6A 1RPXA 4IPJA 3QH2A 1KM3A 1OFQA 3LHVA 3HB9A 3N3MA 2QDHA 1KLZA 3S42A 4EOUA 1S3HA 2OMAA 3WK0A 1ICQA 3O6CA 1XC4A 5DCDA 4IMEA 1GVOA 1TCDA 3G8RA 1EP2A 2YZRA 3BGJA 4I7VA 2VFIA 3F1QA 5HULA 4XKYB 3C56A 4O57A 1H7PA 3QRHA 2ZZ5A 5LKYA 1TYGA 1LDCA 1L6WA 1TPFA 4DPQA 4A22A 1AW1A 4UUIA 2Q8LA 2G5WA 4FNRA 2B4GA 1VCGA 3FS2A 5LHEA 1JCXA 4CQ8A 3TK7A 1BWLA 1GQNA 2ZRZA 5G4WA 1MZHA 4Z1BA 1ADOA 3UPBA 1PS9A 4Q33A 1XFBA 2Z1BA 4JX6A 5J5RA 3WJSA 3TDFA 2VFHA 4QITA 5D03A 3GAKA 3LHZA 1F05A 3DFSA 2ZA3A 5DELA 4IMGA 4HNNA 1AG1O 4QAIA 2FPVA 1WBHA 1PCWA 1YXCA 2WNZA 1I2QA 3EWUA 1MEWA 3W71A 2D73A 3E9AA 4FIRA 4JTIA 2Y7FA 1B4KA 3W23A 1O5KA 3P61A 4JXCA 2GUUA 4UXDA 1D9EA 1LBMA 6ALDA 1FXQA 4BFAA 4RKAA 4UIOA 1E51A 3TQKA 1EPXA 2E1DA 2OCZA 1DOSA 2VEPA 5D02A 1W5OA 2QCFA 4R33A 1GOXA 3P8JA 1A5BA 2WPBA 4JS3A 4M19A 5I3GA 1R30A 4NX0A 3QZEA 4MY9A 2X30A 4IGHA 5F4XA 3A5FA 4HIBA 2NX1A 2I14A 4N6EA 3ATYA 1W1ZA 1RR2A 3GDKA 3IVSA 4LRTA 1JUEA 4N9BA 4ML9A 2GJLA 3NL3A 4MYXA 4N9EA 1FXPA 1OVDA 4AXKA 3L2IA 5CPOA 4ZZ9A 4NJKA 1XBXA 3M9YA 3PY2A 2R91A 4O1DA 5C54A 2FTPA 4O13A 1HFBA 1H1ZA 1WBJA 2QCNA 4LVFA 1TPWA 1YTDA 3AJXA 2F7FA 2A2IA 2EGZA 3T40A 1ZAHA 1QMLA 4DEFA 1VYRA 4QJ1A 3DI1A 5D32A 5CZ0A 5HNRA 2YFNA 1BEUA 3AO0A 4OE7A 2YYUA 5AHIA 1KW1A 2B7PA 3PB0A 3O06A 3EX2A 3BW2A 1AL7A 3NL5A 1L2UA 1SFLA 4X9SA 4RR4A 1TPUA 4QIUA 3S5OA 3SIZA 5FF4A 3STEA 3LHWA 4DO4A 4YL2A 1K3UA 1R2RA 2VEMA 3A22A 4JX5A 1EWEA 1W31A 1FCBA 2A6NA 4N4QA 3LHTA 2OZ0A 4PTNA 2JK2A 3FIGA 4NNBA 4O0KA 5D04C 4RK8A 5TBOA 4DPPA 4MY1A 2V30A 2J88A 3W7IA 5K7JA 2WNNA 2X2GA 2YYTA 3CC1A 4ONVA 1QAPA 1W8SA 2PC4A 3INPA 1NFBA 1RQBA 5KZMA 4Y9AA 4PEKA 3PG8A 3DU0A 2B0MA 3LCIA 3JR2A 4WZHA 1W5NA 4BWLC 3M43A 1WV2A 3NNTA 1Q3NA 4CNPA 2J24A 3DBPA 4IXXA 1KM4A 1KA9F 3TCEA 3DI0A 5D2XA 3TXVA 4OBTA 3KX6A 1Z48A 2DZTA 4TX9A 1SZFA 5AHMA 3UZJA 3DHDA 4MJZA 3W7HA 2G97A 3M5YA 1C8VA 3TSBA 4FX7A 3G0UA 1TTQA 3TXZA 3OA3A 3MBFA 4LVGA 4DO6A 3G1HA 5K4XA 3TMQA 2GVJA 4AB4A 4RJEA 1RVGA 1VJIA 5KTLA 4MJMA 4OWGA 3PUDA 2F84A 1YXYA 3EXRA 1F73A 1YXDA 1QR7A 4NXKA 3W70A 3KOFA 2C6QA 1TPDA 1QOQA 4FNUA 2ZRXA 3T55A 3QW4B 4TO8A 1LLWA 1FCUA 1X6UA 5K4ZA 4RXGA 3DFNA 1I2OA 1I8JA 5D05A 5FF3A 4RZ4A 3HO8A 4JTTA 4JTHA 3NL6A 5HUPA 4BWLA 4WXYA 5HJLA 3FYOA 5F1UA 1H7XA 1LRQA 4EVZA 3NQGA 3O63A 2C0AA 4M7TA 5HR6A 4DQWA 3N73A 5BMWA 4Z1AA 1OHLA 5HWJA 3RLUA 4DF1A 4O12A 1FQ0A 3A24A 3TH6A 3B0VC 2ABAA 4JDYA 4LV4A 3OVRA 1ALDA 3NGJA 1T0OA 3WK2A 5G1YA 4ICNA 3EX1A 2NV1A 2ISSA 3NPVA 2VFFA 1D3GA 1OYAA 3GR8A 2QUVA 3MHGA 3QQ1A 3LCFA 2CLEA 2FPTA 4AWSA 3KRUA 2R8WA 2NZLA 2Y61A 1N8FA 5CSSA 3DFQA 2A21A 4UFMA 1KTNA 2BZNA 4ZQRA 3DKJA 2Q8ZA 2CZDA 4PH6A 4PC8A 2I1OA 1OFBA 3G18A 3TW6A 5LNWA 2DJXA 2JGYA 2E6YA 3ELFA 1ZCOA 3O6YX 1JCMP 1OG0A 4O14A 5EY5A 3W2MA 3RFAA 1C29A 4WY0F 1U83A 1ZJIA 1IF2A 2C19A 4Q32A 1M7PA 1G4SA 1BKSA 3NQ2A 4OV4A 1WDWA 3VFLA 4O28A 4FXRA 3QSTA 2RFGA 4Z0SA 4Y6GA 1IXQA 2ZTKA 1O95A 3IIOA 2ATSA 4RX0A 5AN7A 2E77A 4MVAA 1H61A 1WA3A 2CLFA 1LBLA 6TIMA 2PE4A 2TMDA 2RHGA 3TQVA 5AHFA 2W0UA 3UWQA 3GXTA 3IEBA 3N9SA 1LLZA 4KFNA 2W79A 3G1XA 1OYBA 1LM1A 1GTHA 5F2LA 3GB6A 1JUKA 4E0CA 3DKLA 4N02A 4NZJA 4ZQNA 2X1RA 5DN1A 4UTJA 3LCHA 2BX7A 3W1TA 3G0SA 3W88A 1BTMA 4RLIA 3KRZA 4JTGA 3HG2A 3BLIA 4ORIA 4ALDA 4TMCA 3W3OA 3E02A 1ZALA 4LS0A 3OIXA 1DHPA 1KBJA 3W2KA 1G6CA 3OBKA 4AEOA 1YDOA 3FJ6A 4EIVA 3EX4A 2ZA2A 3BW4A 1K7FA 1J5TA 2P0OA 1V7YA 3CPRA 2E09A 2CLLA 4FEZA 1DJQA 1RZMA 2UV8G 5I3IA 2RH9A 3P5ZA 3E0IA 4S1FA 4DBDA 4DO5A 4TU1A 1XBZA 3L68A 1F7BA 2QJGA 3A21A 5DCEA 1ONRA 3MI3A 3M5VA 3R2GA 2FIQA 3SFKA 1GT8A 1KV8A 3M1ZA 4GUFA 1OABA 3FFSA 1QNVA 4HSNA 1SO4A 3CIWA 3I65A 3P80A 3N2XA 3P8IA 1THFD 1HUVA 3ABSA 1GTEA 4R53A 5D2WA 3W83A 3HGSA 1RQEA 4JTUA 2QCGA 1XM3A 4HN4A 3OG3A 5AC7A 2QAPA 4O4VA 3LBMA 3S6DA 1QWGA 5AYXA 4JNMA 3GZ3A 4FF7A 3TA6A 1AK5A 3NL2A 4UFHA 1PVNA 5F1VA 2ZZ4A 3LLDA 4C1LA 3DH7A 4H6KA 4ADUA 3HPZA 2HSAA 3W7JA 1Z44A 2WNQA 4NT0A 4B5NA 5EYWA 3VNDA 3LCLA 2FQIA 3GKAA 3M44A 2EF9A 4A21A 3GVGA 2E6DA 3W7CA 2V2HA 1ME8A 4S2CA 3UWWA 3PAJA 5A8GA 3G0XA 1GG0A 1FY6A 2A7RA 2GPTA 2P1FA 3GAYA 3M7WA 4IMFA 2H3BA 2E5CA 4O16A 1SSDA 3LHYA 4K7YA 2YGYA 4BI5A 3PG9A 3MMTA 4AVFA 4BI7A 1F5ZA 1EP1A 4O15A 2QAFA 3SJ3A 3PM6A 2WOQA 3EX3A 2YDAA 2FPYA 2P10A 4GFSA 3TV8A 4ZVJA 3SZ8A 2FJKA 4X3ZA 3PC0A 1WOAA 2VELA 3TIMA 4N9CA 1R47A 3CM4A 3W72A 2CZFA 2ZBTA 4C1KA 1WX0A 2NX9A 3F03K 1P0NA 1GYLA 3STGA 2EKCA 2XN2A 1WOBA 1XI3A 1KFJA 1H50A 4O0ZA 2ZZ2A 4LVDA 3EXSA 5AB3A 1BWKA 1OK6A 1VLIA 4GC4A 1M5WA 3C61A 4MZYA 1HG3A 4HNTA 3W1RA 1LCOA 2I9EA 3W1LA 1TJPA 3B0UX 1ZY9A 3THAA 2GQ9A 3T78A 5KSWA 1Y0EA 5LGZA 4NZFA 5DCBA 3PUEA 1S5VA 2V5BA 3ZFHA 2KZHA 2ZZ6A 1HO4A 4JGDA 4N4PA 1DVJA 1TIMA 3G1SA 4TIMA 4LNYA 4JTFA 4K6AA 4WQ6A 2C1HA 3LCWA 3WJYA 4IJBA 3FYPA 1VC4A 2CLHA 3C3NA 4OV9A 1NSJA 4A2SA 3LV5A 5FEWA 5LNSA 4CCCA 5EKYA 1JCNA 5K9XA 4WD0A 4HSOA 1LORA 4QNEA 5F4WA 1IXNA 3W7MA 3B04A 4YCOA 1JULA 2Y63A 4BK9A 3RU6A 3FJLA 4FHAA 1R46A 3A5VA 2ZCGA 3BLEA 4IPIA 1DQXA 2B7NA 3WK3A 1B3OA 3K30A 1I2RA 4OU1A 4ZQPA 3TFCA 3MW7A 2CFFA 3W1XA 3G1YA 4AHPA 5LGXA 4JTKA 4J9JA 3KVMA 3O15A 1R2SA 4DF0A 3PVFA 4K37A 4O54A 5GVJA 2AQWA 4R34A 3NYZA 1JVNA 2BSLA 1VLWA 4UFLA 1EP3A 4NXSA 1TTIA 4WJEA 3LTPA 4MIMA 4XWUA 3TR2A 3CU2A 3NPXA 3W7LA 3MYPA 5FF0A 1DKWA 1J4EA 1V5XA 1TPVA 4I7WA 4N9DA 2YX0A 3BLFA 3NZRA 1I4NA 3GDTA 4QSHA 3TJXA 1H5YA 1YTEA 3W73A 3VKJA 2ZYFA 2FB3A 1A53A 1AMKA 1JQXA 5CPLA 3EKLA 3GXNA 3RLVA 2JBMA 2YXGA 4KKXA 1SR9A 1PIIA 2VEKA 3QPZA 5CKSA 3R5EA 3QM3A 4JTEA 2VENA 1VZWA 4JD4A 5FF7A 5E0KA 3UPWA 4HNUA 1DJNA 5ABTA 1DBTA 2YR1A 4WUIA 2J6XA 3S9YA 1G4EA 3LTYA 2Q3RA 2DZXA 3MJYA 1Q6RA 2Y6ZA 2VC6A 3CTLA 4QISA 3R89A 5LNRA 1FWNA 2QJIA 4LT9A 2TPSA 4XBSA 2WQPA 3B8DA 3LXAA 1EX5A 3W1UA 2Z6JA 3B03A 3TX9A 2Y85A 3LRMA 3UYCA 1SPQA 3L65A 3PSVA 4O53A 2V0TA 4AHOA 3ZS4A 4JYFA 1OF8A 3CEUA 3KVKA 1Q45A 5EL1A 1JQVA 5FEZA 4UFIA 3GX9A 3G1VA 2H90A 3F4NA 4H3DA 4I7UA 4MKNA 4HPXA 2E5BA 1NEYA 2Y7DA 3L0GA 3OHIA 4NX5A 3UD6A 5FESA 3ZWTA 4UR8A 4OGZA 3DFOA 4NJJA 4PL1A 4E2DA 4LRSA 1QOPA 4GXMA 3BVJA 3RMJA 4JN6A 5KMYA 3A23A 1G69A 4PFMA 5AC6A 1ZFJA 2QCDA 5F2IA 3BW3A 2CLMA 2HTMA 1O5XA 3IIZA 1F2JA 4UNLA 2YSWA 4L4LA 2QF7A 1YTKA 4WY0A 1H51A 5G5IA 1LRNA 3UNDA 3N9RA 3NQAA 3QYQA 4L4MA 4A3UA 3KVLA 4AF0A 3O05A 3S1UA 5TQLA 3O8AA 3N2MA 1PCKA 1OFOA 4XZ9A 4YCPA 1Z41A 3W7PA 5FF2A 1QPRA 4U28A 2QCLA 3C2EA 4Q4KA 2BLEA 3W2UA 3GYEA 5K3VA 2H8XA 2TYSA 5G4EA 4IMDA 1SZGA 1H7OA 3KHJA 1LOQA 2GOUA 2TRSA 2H8ZA 5U7SA 5LHFA 3QSRA 4GWEA 3NOEA 5FI8A 4JTSA 3IGSA 1L6SA 5CPMA 3HMJG 4POCA 3KVJA 4CQ9A 3GNNA 2A5HA 3NXFA 3P7YA 3HF3A 2X1SA 4IMCA 1AW2A 3S5ZA 3W7NA 4PL2A 2FFCA 2RKXA 2Y89A 3W7DA 1JCYA 1U5JA 5DBUA 2VFGA 1VYPX 3LX9A 3HOJA 3W9ZA 3NPWA 2GJNA 3NQ7A 3QMTA 1L9WA 5CZSA 3MUXA 5HQEA 4A2RA 1TQXA 4BF9A 2A4AA 3T44A 2V2DA 3W86A 3UZ5A 5E1QA 1G7VA 2Y88A 5LNVA 3N19B 4YLWA 1QPOA 3IGXA 3O6DA 1TRDA 3VCRA 5K2ZA 2DZWA 3P81A 1SO6A 5C55A 4ZQCA 4Z1CA 1YPIA 2QCEA 4OQVA 1FDJA 5D09A 3TW7A 2Y70A 3KXQA 3UXAA 1JRBA 4O10A 1OX4B 3G1AA 1CI1A 5EMUA 1N55A 2C13A 4MZ8A 4GNJA 3L0KA 3MBDA 1GZGA 1FCQA 4JTJA 5DY3A 5G2IA 3W2JA 4LS2A 4FB7A 3RK8A 1QPNA 4JICA 4QM1A 1X8FA 4XBKA 5C5YA 3R12A 2VFDA 2Y7GA 3HPSA 1A5CA 1LRTA 2WO5A 4WOQA 3R8RA 1RD5A 2C16A 1JCJA 4YXGA 3C2FA 3QF0A 3NQEA 3BPWA 5KZEA 1W5MA 2WV8A 1LBFA 2EPHA 3DAQA 3G1FA 5HUOA 4YWIA 3HG3A 2WJZA 1K8YA 1W5PA 4MY8A 3NQCA 1S5WA 3NQ8A 1WAUA 4AAJA 4CLMA 3NQ6A 1XDLA 3S1WA 1VHNA 3P84A 3UWVA 4IXHA 5K9CA 5LNUA 3IRDA 4RV8A 1QO5A 1KV5A 4UTIA 1ICPA 3PWAA 3GDLA 3GKFA 1KTCA 1GVQA 3HPXA 4LTSA 1SW7A 2J9ZA 4UCGA 1YPFA 2B7OA 3CB8A 3IIVA 1EB3A 3CWOX 1I2NA 2RDWA 1LP6A 1S5TA 3R13A 3OVPA 3BK0A 5I3FA 2QCHA 3FEMA 3I6RA 1SFJA 2QR6A 3UWZA 4W9TA 1TO3A 4IOTA 3MHUA 3BG5A 2A0NA 3PUOA 2OT1A 1XUUA 5EBUA 3SW6A 3GDRA 2QCCA 4FX8A 1DL3A 4Y96A 1EA0A 2V5LA 4LUIA 4D2JA 1X1ZA 1IIHA 1KM0A 1W3IA 4CQAA 3L5AA 5AHLA 1G4TA 3PBWA 4G1KA 2Z6IA 2B7QA 2NXHA 2BWGA 4K38A 5C6MA 3C52A 4JX4A 3VE7A 1SZEA 1LOSA 2E6AA 1MXSA 3LXCA 8TIMA 1VH7A 4JTLA 4E2BA 1K7EA 1KLYA 1SQ7A 2XFWA 5DY2A 3S1VA 4X22A 3GIYA 3UY7A 3W7RA 1K8XA 3MWAA 4UFJA 3LOTA 2NWRA 2DU2A 2VXNA 1A5SA 3EXTA 4JY9A 3WJZA 1IIGA 3BGGA 3STFA 1VPXA 1T96A 4O52A 3QQ0A 3Q58A 3M16A 2PRHA 1QCWA 4MFDA 3EWZA 4GJ1A 1W56A 4R7JA 1NF0A 3SY5A 4MYAA 1ZENA 2GVLA 3M5XA 3DFPA 5AYYA 1GWJA 2J9XA 4FNSA 4O17A 5I3KA 1P5BA 5G2HA 1PE1A 3PR2A 5DLCA 3TU9A 1KBIA 3G3DA 1XUZA 3MP4A 2V9DA 4MLJA 2FB2A 2ZZ3A 3G22A 1W5QA 1VCVA 1EIXA 1JCLA 4NU7A 1J2WA 4DF2A 4K39A 4XTIA 4AHQA 2YFOA 2V2CA 4MFEA 1FUYA 4NNAA 3NQFA 2ATMA 2ZTJA 1UB3A 3IVUA 3U6WA 7TIMA 3M41A 4RXFA 2TSYA 5I3HA 2X1TA 4UMCA 1XBVA 2IQTA 3P62A 4O1BA 1UJPA 3TE9A 2Y7EA 4JIPA 2YW3A 1VQTA 4RZ6A 5F4SA 1NVMA 5AOUA 4IQLA 2A7PA 1PL9A 5T26A 1TJRA 3GLCA 1XXXA 3LERA 1KFKA 1YYAA 3RF9A 1SZNA 3W84A 1SUXA 2FDSA 3NQDA 5BNKA 3C6CA 2Q3OA 4O4WA 1JRCA 4UMAA 2J27A 4WOZA 3P60A 4XKYA 3EWXA 4FNTA 1KTBA 3W07A 4ZMGA 4JIQA 3GDMA 3SR7A 1KFCA 3W22A 1W3NA 1EWDA 5MHBA 3C4UA 2OX1A 2DZSA 3IIPA 3D0CA 1FWWA 4JYEA 1EUNA 3NPUA 4UNKA 5FEXA 4HPJA 4UTTA 4A29A 4M6QA 4QQ3A 5H91A 1DV7A 5EPDA 3O16A 3USBA 3PBVA 3T4CA 1XBYA 4O1CA 1FCVA 1KM2A 3W1AA 2BTMA 4O11A 3NEVA 1ZAJA 2C3ZA 3CT7A 2ZRYA 3NZ1A 1MSSA 1I45A 3P82A 3UWUA 4O1AA 3MI6A 3LGEA 3EWBX 3U8GA 4CCDA 3W2LA 5KITA 4WXZA 3NG3A 4NQ1A 1LTDA 2CZEA 3PF3A 1T8XA 3PS7A 3W7KA 2DZVA 4H4IA 4KFPA 1KM5A 4KWVA 3O07A 1W37A 2A6LA 4OHQA 5AHEA 3W75A 4NVTA 4RCXA 4MZ1A 4CCEA 2GVGA 1WQ5A 2FLIA 4AWUA 1YDNA 3C2RA 2NXGA 4M7SA 1H7WA 3F4WA 1X7FA 3G1DA 1XDMA 4K7VA 5CG7A 4UTUA 4LS1A 1KFEA 1HL2A 4BI6A 5E93A 1TPC1 4JY8A 3L66A 2QJHA 3QPYA 4PA8A 2XN1A 2G96A 2C15A 3W7QA 1GVRA 3C2OA 4LW7A 4UC5A 2ABBA 4ZQOA 5AFDA 1LZOA 1O4UA 4IUOA 1QDSA 3LV6A 4FIQA 2VKZG 2JKAA 1FWTA 3PBUA 4DBEA 4LC8A 2NXIA 2CLOA 1GJPA 4K8HA 4JDBA
chains in the Genus database with same CATH superfamily
2Y0FA 4FO4A 2BVTA 3ZJ7A 1XLCA 3AISA 1Z69A 1ADDA 4X61A 5HK4A 1BSIA 4FR1A 2CNCA 3RCYA 4Y9OA 2D2OA 1UYQA 3TN3A 2F2KA 1MWOA 1OFDA 2VT0A 4ADSA 3WN6A 3L4UA 3GC4A 1IGSA 3WQCA 4HMCA 3FA5A 4P61A 1UCWA 4Y90A 4U2ZA 3AZRA 3TSMA 1K8CA 1Q6FA 1XRVA 4NG3A 3OLIA 5FJJA 1VS1A 2WSYA 3L67A 3AWNA 4UTLA 3NOYA 2DP3A 4LY8A 4IJRA 3W1PA 3WQ4A 4UTWC 2DSZA 2JGQA 2C14A 4L9XA 3FK4A 3ARTA 5M1TA 3V36A 4UTKA 4Z08A 5I3JA 2VOMA 2NUYA 3BLOA 5TF0A 3KS5A 3THCA 2RDTA 3QFEA 2NQJA 3U2OA 3CAVA 2BHZA 4NNCA 2ZRWA 2CITA 3ZT6A 2J7BA 3G6MA 2JIEA 3MP3A 3T7VA 3UVAA 5EFDA 1MYRA 2CWNA 4GNVA 1OINA 1V02E 2REQA 5DT5A 3WH7A 1VFHA 4GGHA 1YPXA 3BG9A 4M5PA 2ZZ7A 1OIMA 2DVTA 3C8FA 2YPIA 3W1QA 2ISVA 3HG4A 4MUZA 3H2EA 1Z42A 3RPMA 2Z7KA 3Q65A 3VNJA 4GYPA 4GBUA 1TVPA 2E6FA 3UR5A 4TXEA 1NFGA 4ZGYA 1JR1A 3ARYA 3LM7A 3WCZA 1ZGDA 3TZFA 3M6YA 3EB2A 1BGAA 1FDYA 3VILA 4HPHA 2PRMA 4Q8VA 2Y8KA 4UFKA 3WDJA 3MCMA 4B3KA 1JPDX 1TQJA 2VCAA 1XLDA 3WX7A 3WF3A 1MZRA 1BQGA 1BYAA 1IEXA 2VCCA 4HK7A 5DBTA 4I9AA 4WR3A 2PF8A 1SMAA 1V6VA 2A1YA 3HIJA 4PMUA 4RPQA 3CUIA 4QDMA 1JXJA 4LWWA 2XN0A 2O9RA 1VFFA 2J9YA 1UPMB 5D8ZA 5K9DA 4ZL1A 4HA1A 2QEZA 2BNJA 3JUGA 4O19A 1LOLA 5HNUA 4ZENA 1TMQA 3CL8A 3B4UA 3MYOA 3H55A 5IDZA 1GPWA 1OX4A 2VZTA 3QR3A 3MB9A 1C8XA 5LSMA 3RYSA 1WO2A 1B90A 1QPQA 1YADA 1XCWA 5KZDA 1TE1A 1PWMA 1U5HA 3S2LA 3TAKA 3LLFA 1HTIA 4LSBA 4UMBA 1T40A 4Y7EA 2J8TA 5AYZA 3CWNA 2HS6A 2HPIA 4INFA 4E5TA 4QLKA 3K2GA 2NVAA 3UJRA 4UTHA 3P74A 1H60A 1O5RA 3L12A 1VBGA 4U4MA 3VC5A 2Z2UA 4JIEA 2OWWA 4JKMA 3MMDA 1MQPA 4CNNA 4B15A 4IIBA 6REQB 4LAUA 1UA3A 1UWUA 3QVQA 4ERGA 3GNRA 1TB3A 1CBGA 3SECA 1W3TA 2GQ3A 3BJSA 4GHRA 3H24A 3WLKX 4QX4A 3LG3A 4IG2A 4C6DA 3OVQA 2WMKA 1LUCB 1G4PA 3B8WA 1XIBA 3ABRA 1F3EA 1GKPA 3WF4A 2VRJA 5IBXA 3UJFA 3L4XA 3WF2A 3CZLA 1IT0A 2ZICA 3BO9A 3LHUA 2ZRUA 3K4WA 4AWTA 5LYRA 1TV5A 1X8CA 3A9IA 4N2YA 5GPRA 1PDYA 3TJLA 1E6PA 2AAMA 2NVCA 4R9OA 1H1YA 2VGBA 3MP5A 2YBTA 3V7PA 3ITXA 4S39A 4MNKA 4M80A 4IFOA 5E6YA 1EHAA 2G3IA 3TYZA 1UASA 1OX5A 3LCGA 1H7RA 3KBMA 2WHMA 3A4XA 3S5YA 1Q7MA 4KFOA 2IQ0A 2PD9A 3FX4A 3VO0A 4PMXA 1E73M 5JIWA 4CQDA 1TSIA 2J7EA 1ZL1A 2VC9A 2PWVA 1FKXA 4IZGA 5KEZA 3LRLA 1B57A 1D3HA 1CIUA 1CXFA 1V79A 1B0IA 2GQ8A 4DN1A 1QOXA 3TROA 4AVNA 1TV4A 3H53A 1Z89A 3QGKC 4KEUA 3RR4A 4S2BA 1MQQA 1TPB1 4AFYA 5C2XA 3IPWA 2OU4A 3SGUA 3SUWA 2VD9A 4XTDA 1O60A 2V81A 2PTZA 3FCPA 2F2HA 1RCQA 3HJZA 3S2JA 4CD6A 7PTDA 4GUHA 7REQB 5D33A 3VMOA 5DXXA 1ITXA 2X16A 3T1GA 4FPSA 5FJIA 2JQXA 3R0DA 3NQVA 2PRLA 3CQJA 1XD0A 5GQBA 3I4KA 2G95A 2ON3A 3ZR4A 3CWHA 2XTKA 2JKPA 4HHPA 4O50A 3MSGA 3LB0A 4K1WA 1NIUA 3HQPA 2PWEA 4N0RA 4TMBA 1GNXA 4I90A 3VZZA 1TE6A 1BYDA 2VR4A 1Q2RA 1D7FA 1OF6A 5IFPA 4RZ5A 2BXVA 4LVAA 1UBSA 2HVOA 4UQCA 2XWEA 1D8CA 4A8IA 3MCNA 1Q7QA 4R3UA 1KRBC 4GE8A 5SWUA 1KXHA 5L9FA 3T4WA 3T8QA 3TC6A 1GYNA 1VR6A 3LZ5A 4TTUA 2NLIA 4GUGA 3KS6A 1GKQA 4LAKA 3N2CA 3CAQA 3BCDA 5HR7A 4AVOA 5HNTA 1XGEA 4AZIA 2O4QA 3U57A 3TFXA 3I4EA 1BVZA 4DYEA 1Q6OA 3TUUA 5LIKX 5A6SA 2E68A 3VDBA 1KFBA 3IJDA 2D2GA 4BQ2A 1KCXA 3QH2A 2EG8A 3VTRA 2XM2A 3OLEA 2QDHA 1PPIA 2BGSA 1D8WA 3WK0A 2R82A 1GVOA 1TCDA 2CWXA 5A6AA 4US6A 3G8RA 4QS6A 1EP2A 3REQB 4XKYB 1H7PA 3C2YA 4IH3A 2WMIB 5CQ1A 4JQ3A 1TPFA 2BOFX 3OTRA 1A47A 3CASA 4FNRA 1JNEA 2B4GA 4CVUA 1VCGA 4N42A 3S2CA 3GUWA 3SRHA 2QGYA 4CQ8A 1BWLA 3H8AA 4Z1BA 1M9HA 3VCNA 3SCTA 4Q33A 2Z1BA 4AISA 5BWFA 1DWHM 1IZKA 3N3TA 3WKZA 3DFSA 4IMGA 4IMAA 5I00A 4DBUA 4HHMA 4QAWA 1C91A 4J28A 1UWAA 2WNZA 4IHCA 4YJ5A 3HPFA 4AIOA 4MB1A 2D73A 2DW7A 2CETA 1JCTA 4OIFA 4XVDA 3P61A 2GUUA 5A6BD 4I3GA 1EDGA 3TQKA 3ITGA 1GJWA 1DOSA 4JKKA 1F07A 4R33A 1UKPA 1GOXA 1UOKA 3AZTA 4JS3A 1XHGA 5F4XA 4AD1A 3R0KA 4HIBA 4A4AA 1WUEA 3TTQA 4N6EA 4L6HA 3IVSA 4JTRA 1JUEA 3FEQA 4ML9A 3AHVA 4MYXA 4WKHA 1UIPA 2MUCA 3N15A 1PYFA 1EKOA 4NJKA 1XBXA 2XUCA 3EPOA 4CD8A 4O13A 5FL1A 6ENLA 2A3CA 1ISWA 1WBJA 2QCNA 4C90A 1Z3NA 1QK2A 3AJXA 2F7FA 1UQZA 1TWIA 5D32A 5HNRA 4GI9A 3AO0A 3NZPA 5AHIA 3SO7A 3GG8A 1V3MA 1AL7A 1SFLA 1NWRA 2Z4GA 3S5OA 3VGFA 4B5UA 2G3FA 3GG0A 1CB7B 4AIEA 1W17A 1FWGC 4I8YA 2HBVA 1O1HA 4W85A 4NNBA 4RK8A 1E0XA 1SM9A 2J88A 1ZQ5A 5K7JA 2X2GA 3ABXA 3TW9A 4ONVA 4QGCA 1DP0A 1QAPA 2PC4A 2AGTA 4Y9AA 2YCKX 4B2DA 2O56A 3DU0A 4XO6A 4WZHA 2XHYA 1Q3NA 3MZNA 4CNPA 1J11A 1KM4A 1DJZA 1WDRA 3TCEA 3DI0A 1UW9A 3LZ3A 1R7OA 2C71A 2HVNA 3KX6A 2QF8A 3T09A 4A3YA 1CGUA 3H7RA 2XGBA 1SZFA 5AHMA 1R85A 3IK2A 4A8NA 4FX7A 4HCLA 5E0CA 4MUPA 4G6CA 3QHNA 4DO6A 2FGZA 1WB0A 3TMQA 3VIGA 5CXPA 4AB4A 1KRMA 3CV1A 4E4FA 3EXRA 1A49A 4MMWA 1YXDA 1X96A 4NXKA 3KOFA 2PDXA 4QCFA 5ECVA 4BF5A 2ZRXA 5I77A 2RGMA 1B1YA 3QN3A 4LAOA 5K4ZA 1E9LA 2QMJA 2I57A 3V35A 2OXNA 5D05A 4NF7A 3WSUA 1UHVA 2DPEA 2HXUA 2BHUA 1EJ7L 3W38A 4WXYA 3D3FA 5HJLA 3FYOA 2C7FA 4BY3A 4EVZA 1YBQA 4JQAA 3N73A 4AX6A 1GOIA 3QZAA 3NO1A 3NZQA 1OHLA 5HWJA 3NIYA 3EDDA 4E2VA 3A24A 3XINA 4KRTA 3IJ6A 4CCZA 3N18A 3WK2A 4GZ7A 1Y5WA 1RY8A 2NV1A 2ISSA 3IAQA 2YL8A 3NPVA 2O55A 3WMLA 4Z2LA 2Q01A 2VFFA 1OYAA 3KLKA 2PP1A 5AECA 4AWSA 2E0PA 2R8WA 3GFYA 2Y61A 2ZXAA 1TJ2A 4HYRA 2A21A 4UFMA 2BZNA 1EBGA 4HZ7A 4GI8A 1W8GA 1UWSA 3WBEA 3TW6A 3TYBA 5AY7A 3ELFA 2E6YA 4GCAA 5DMYA 1OG0A 4O14A 1MMFA 1C7SA 3W2MA 1U83A 2C19A 1FTXA 4Q32A 2ZUMA 1BKSA 3ICJA 4OV4A 1WDWA 1XINA 4O28A 4QG9A 2ZTKA 1O95A 1DIKA 1DJXA 4MVAA 3BLDA 1LBLA 6TIMA 2PLJA 3TQVA 5AHFA 5IFTA 5JQ9A 1JL8A 1LLZA 3F7JA 3KTSA 2W79A 2RJGA 4GZJA 1UP3A 1LM1A 3PZ9A 3WDHA 1W1PA 2GOKA 1W1A1 5F2LA 4N02A 4UTJA 1BTMA 1KWKA 3W3OA 1UUQA 3W2KA 3OBKA 1AA1B 1YDOA 3FJ6A 4QG6A 4H9TA 4Z2GA 2PZNA 1J5TA 2P0OA 1XYCA 3BAWA 6A3HA 1LL4A 1RZMA 2RH9A 1UZ1A 5A2CA 4CU7A 4TU1A 3WY1A 1F7BA 3EKGA 1XH0A 1HX0A 4KETA 5FJPA 4H01A 2WAGA 3BAYA 1KV8A 2WHKA 4GUFA 1MUMA 4DLFA 2WVVB 1GQKA 2HJPA 4FOUA 3CIWA 2BGQA 3P8IA 1UQYA 3BCFA 3QLLA 1FHDA 2C79A 1H3GA 1UMLA 4HN4A 3MUAA 4ENLA 1QNQA 4EWJA 3TLLA 1F6YA 3APTA 3ZSSA 4Q8MA 1V02A 4JNMA 2A3EA 3RJXA 4UFHA 1HJQA 1PVNA 1AJ2A 5EGRA 4RV3A 1TA3A 3EOOA 3U4FA 2A3HA 3WUFA 3DH7A 4KT2A 3KOYA 4ADUA 2X09A 3W7JA 3KE0A 3GTXA 1X6LA 5EYWA 2PLMA 2X05A 3RU8X 4J3VA 1ZBWA 3M44A 5I0DA 3FW6A 4A21A 5ABHA 2PDKA 4JFSA 1HL8A 1ME8A 3PAJA 2GDUA 1R3RA 3MWCA 1IR2A 5A8GA 1GG0A 2D2JA 4L64A 3PP7A 2GPTA 1TX0A 3GAYA 4O16A 4AY7A 2YGYA 3PG9A 4BI7A 4C7GA 2XIQA 2QAFA 2BY0A 1NDZA 4HZMA 2FPYA 4GFSA 3TV8A 2EPKX 4ZVJA 4UR9A 1WOAA 1KCZA 2O9OA 3E0VA 3N4EA 1XDJA 2CZFA 3K5XA 3NSMA 1WX0A 2BHYA 2XPKA 2WC4A 3STGA 3WLLA 1OCQA 2O92A 3M0VA 5REQB 1N2VA 3WQWA 2IKIA 1WOBA 3HV9A 1XI3A 4MNJA 4GH3A 5AB3A 4GC4A 1M5WA 4MZYA 4HNTA 3VGHA 1LCOA 2BVDA 2DZBA 3AC0A 1ZY9A 3M0KA 2GQ9A 5IOBA 5KSWA 4HD5A 4NZFA 2B31A 1WNOA 2KZHA 3DERA 1CLVA 3ZJKA 3LNPA 1DVJA 1TIMA 4DLMA 4TIMA 4JTFA 2OQHA 4K6AA 2PBOA 2C1HA 3WJYA 4F0HA 2DY3A 3A6OA 1VENA 2VVNA 1S1PA 4FALA 4CCCA 1R3VA 2ZVIA 4YTQA 4C6BA 3WDPP 1IXNA 4BEQA 4DJFD 2NQ9A 5LIUX 3I3BA 4EE9A 4MPKA 4FHAA 2V5DA 4UOJA 2B7NA 3WK3A 1B3OA 1I2RA 3SDOA 4OU1A 4ZQPA 1SJBA 3W1XA 3CQHA 4AZCB 4JTKA 2VGFA 1H09A 4C6JA 4J9JA 1R2SA 4QSFA 3PVFA 3W6MA 1BF6A 3FYYA 1A3WA 3OLGA 2VZVA 3NGFA 4L4PA 1JVNA 5BCAA 3MY9A 3RN6A 1P0EA 1EP3A 4WJEA 2J8FA 3GTNA 2QZRA 3VZYA 1EJWC 3W7LA 2J74A 1UG6A 3E5PA 2O9TA 3BLFA 1I4NA 2Z24A 4QSHA 3VD9A 4PCSA 5DT7A 5CPLA 4C7FA 3CV6A 3RLVA 1RK6A 2JBMA 3K13A 1BGGA 4IP7A 3GTHA 3R5EA 1DJHA 1Q4WA 1A5UA 5FF7A 5E0KA 3LPGA 3UPWA 4HNUA 1DJNA 2YR1A 2J6XA 1E6NA 4DJFC 1DXIA 2IKJA 3VIOA 5GJNA 1IWAA 3SSZA 3AXXA 2Y6ZA 2VC6A 1VIZA 3B8VA 4QJ3B 1EX5A 1PIGA 1V4YA 3SQMA 3W1UA 2WM0A 2Z6JA 3SQLA 3GU1A 3QBUA 2PDLA 3M0LA 3M6DA 1L8NA 3PSVA 4O53A 2OYKA 1NP2A 3FAXA 1OF8A 3CEUA 4M56A 5E5CA 3F4CA 3PFRA 2SFPA 3GX9A 3TTYA 4H3DA 4I7UA 3TN6A 1NEYA 1QT1A 2Y7DA 2GUBA 2P8CA 4YTRA 1JZ7A 3OHIA 3W25A 1EPVA 5ENLA 4NJJA 2FGLA 3WG6A 4G8TA 4HJWA 4J3SA 4E2DA 5EMKA 5A6TC 2BOGX 4GYFA 3RMJA 3TVAA 5KMYA 3A23A 4PFMA 4GH1A 5AC6A 2FYMA 1MXDA 1J0KA 2QCDA 5F2IA 1O5XA 1FA2A 1F2JA 2YSWA 2WNWA 2BBFA 2QF7A 5AC5A 4PULA 2AQOA 3LA4A 4XB3A 1V0NA 3QYQA 1CXIA 3WLIA 4M29A 3UJEA 4GLEA 4AF0A 2WXDM 3WQ6A 4DWSD 4TV5A 1AH4A 3DGBA 1IZJA 3G5EA 1UOZA 1W9XA 2BASA 2Z25A 5AYIA 3RUBL 2R1PA 3CTTA 3CXOA 5FF2A 3W81A 3H7VA 2ZOXA 4XD4A 3WLSA 4X60A 3TLQA 2H8XA 1SZGA 3CV7A 3VKKA 1IEWA 4GNKB 2FZDA 4PBEA 2GK1B 2QUMA 1XH2A 3LMZA 2ZWYA 3M64A 5JH1A 3NOEA 4JTSA 3IGSA 1U1JA 3WQEA 1Q85A 2V5KA 1XG4A 2A5HA 1ZRQA 1MRQA 4PL2A 2FFCA 2Y89A 3ZOAA 4U3AA 3NXLA 2QHAA 3LX9A 2DIEA 2GJNA 3NQ7A 1L9WA 1KXVA 1CYGA 3T44A 3SUUA 4JCLA 2V2DA 3S1GA 3PK7A 4J4KA 2IMRA 1PTAA 3N19B 1NWSA 1YRRA 1OZMA 1R3TA 3O6DA 3WUEA 3VCRA 1WZMA 3EZ4A 1UWIA 4C6CA 2WLZA 4Z1CA 1Z32X 4DWSC 1FDJA 3N4AA 4BQ5A 1Y5VA 4JQ2A 2YKKA 1JRBA 4C6OA 1OX4B 1CI1A 5CH9A 1JAEA 2C13A 5ECUA 4GI6A 3MBDA 4LS2A 4AD0A 1J0HA 1MVYA 4JICA 5FACA 1X8FA 4DM2A 3OODA 1UD8A 4XBKA 4MADA 1JNDA 1AQMA 1A5CA 4TV6A 2V3FA 3R8RA 1RD5A 4ROPA 2A3LA 2CHRA 3C2FA 3NQEA 3EB4A 4C6PA 4ZEPA 4S38A 2EPHA 4DHGA 2VQUA 3U5YA 3NQ8A 2VM8A 4ZOEA 4AAJA 1IEQA 1XLAA 1SZRA 3ERPA 1XDLA 7TAAA 3VC6A 1UP0A 5MF5A 4PTVA 3GHRA 5LNUA 3IRDA 4GJIA 1RUSA 5BXPA 2HQAA 3E5BA 4NYYA 1GEHA 2WVTA 5CC5A 3PWAA 1EC7A 5DEZA 2A3BA 1YPFA 4IG2B 1LP6A 4YS1A 1S5TA 3TP4A 3FEMA 1M7JA 3UWZA 4RE4A 1FP9A 4W9TA 4H00A 3ISIX 3ITTA 3V4BA 3KZSA 4XO7A 1WE5A 2J79A 2HROA 4Y96A 3WFZA 1KNWA 1IIHA 1KM0A 4HOWA 3ONBA 4CNTA 3EBVA 4K38A 1C93A 4JX4A 1LOSA 3LXCA 4EP8C 4JTLA 4E2BA 1K7EA 2QMKA 3DYOA 1EFZA 5DY2A 1HT6A 1ISYA 4X22A 1UD6A 4NHVA 3W7RA 1K8XA 4WDTA 1F3WA 2WJEA 2DU2A 3WJZA 3BGGA 3GUGA 3QQ0A 2PRHA 1FWCC 3NYDA 5PTDA 4GJ1A 5AZ1A 1Q5MA 3ZMRA 4G5DA 4QE1A 1FH8A 5AYYA 1GWJA 1TR9A 1AH3A 1EEXA 4O17A 1I75A 3GS6A 3CLWA 4GINA 4X0VA 4G7EA 2PEVA 3GH5A 1KRAC 2HVMA 4H9UA 2DT0A 5ABGA 4L4OA 1JCLA 1QWKA 4AHQA 2YFOA 3STPA 2Q02A 4AWEA 1QNPA 5CBBA 2ATMA 3U6WA 1RXOB 3AIBA 2OKTA 3M41A 4KRZA 4RXFA 2TSYA 3GXIA 5I3HA 3HQNA 4E3VA 1JDFA 3TOPA 2YW3A 3OLDA 3AXKA 1FFRA 1NVMA 3GZAA 4J3XA 3COTA 4DX3A 2IQDA 5EB8A 1XXXA 3LERA 1KFKA 3RF9A 1IQ8A 2BFGA 4O8AA 5BNKA 3C6CA 2Q3OA 2J77A 1TV3A 1BRLA 4UMAA 2J27A 2GSEA 2OYMA 3P60A 3EWXA 1EQPA 4FNTA 4MNLA 3R1ZA 3ZYZA 4JIQA 1F4AA 1W3NA 3GU2A 4LEFA 4I6KA 4JYEA 5E09A 2V3GA 3KEHA 3N04A 1TV2A 5H91A 2OLSA 3CL7A 5I6SA 4PUKA 3PBVA 3S83A 3CHEA 1XBYA 2HISA 3UCQA 4JQ4A 1ZJBA 4D6EA 1ZP4A 3P82A 4O1AA 5CZKA 3EWBX 2DDXA 1PWLA 2CBVA 2OGJA 4CCDA 4F2UA 4EXBA 1WZKA 4NQ1A 4U31A 5C8BB 3PF3A 4WGHA 1CB2A 3PAOA 4AIBA 4KWVA 3KBJA 3O07A 3TONA 1W37A 4OHQA 3K4DA 3M0XA 1G01A 3L23A 1ADSA 4LYRA 4AWUA 3GVRA 2VVSA 1XLJA 3A64A 4I8DA 4AQLA 1LQ0A 3VIPA 5AZ0A 4MAVA 3SN0A 1EL3A 1X7FA 3PPGA 1UC4A 3N25A 1KQYA 1Q66A 5E93A 1VAHA 3L66A 5FA5A 4HMEA 1TZZA 4S23A 1WDSA 2C15A 1N8WA 1XIGA 1GVRA 4ZQOA 2D0HA 5AFDA 2EG6A 3LV6A 3OA5A 4FIQA 1JDCA 2JKAA 2WB5A 4DBEA 4JQ1A 4LC8A 2NXIA 1E4MM 4DB7A 5HMFA 3PN8A 3PZQA 2PLKA 4JDBA 4JN7A 2JKEA 1QK0A 2PGRA 2HV5A 2OEJA 3W7GA 3I6TA 3UA4A 3RG6A 3W74A 1TREA 4XD3A 3AU2A 2CEQA 1SO5A 1TVNA 2ZZ1A 3L21A 4PB3A 5FKYA 1N7KA 4L56A 4HNLA 1SW3A 3GK0A 3LSBA 3AS0A 3MPGA 4LAMA 5I7GA 3WMSA 5IHSA 4E38A 5JBEA 1FH7A 1VFUA 1O5QA 3S1XA 1V3JA 3LSCA 1F74A 1M6JA 5DFAA 4EWND 1VBJA 1VYSX 4JHZA 2IXUA 2OWXA 1R0MA 4DJDA 1TMHA 1MW3A 3E0FA 2Y5SA 3ORWA 5JUVA 1GVFA 1ML1A 3TYDA 4GIEA 2ZADA 2OJPA 3B06A 1TZ7A 3P67A 4GK8A 3TMLA 3TN4A 1A5AA 1MI3A 4YNGA 1F6PA 1TTPA 2YB1A 4WJ8A 1KCKA 4ZE4A 1JI2A 4JNYA 4W7WA 4RW3A 2PDGA 2X42A 1TUFA 2HMCA 2DZUA 1RLDA 4G7FA 3BLLA 3OEXA 2PF0A 1V0MA 2NQLA 1FVPA 1P0KA 3FOKA 1GZ1A 5IRPA 4QJ4B 1QW9A 1I2PA 3L2MA 4ZODA 4ZSUA 5HWNA 1EUAA 1M7XA 4XZNX 1PZ2A 1UD2A 2CHOA 3AIQA 3B0PA 5HMDA 2PCEA 4H7ZA 3S0CA 2EPLX 2C18A 5CPNA 1C8YA 5AHNA 2OODA 1OK4A 4DYJA 1HKWA 2QGHA 2J7CA 3VXGA 3UWYA 3DDMA 3TKFA 2XGZA 2PDFA 3V1PA 2ZFAA 3WH9A 4WDXA 1DJIA 3G6LA 5D37A 3W02A 1S46A 3M47A 1ZTVA 3RITA 3IRSA 1WXJA 1W91A 3UYIA 2G8ZA 5LXEA 1EJVC 3AWOA 2GJXA 1KWGA 1X39A 4LVBA 2J66A 3LBCA 1DWIM 3TEVA 1LWJA 1UD4A 4HP5A 3MC5A 1U1HA 3P0XA 3LDVA 2A3AA 4ILSA 2GDVA 2ZC1A 1UA7A 3AXHA 4LBRA 1GONA 4J1OA 2PDCA 3GXPA 1UP2A 1XLMA 1F76A 5GJMA 3RXZA 4AW7A 3HQ1A 3UGRA 3ZR5A 1CENA 3EB3A 3AHZA 3RMEA 1E6ZA 4ZBCA 4HOZA 2VEIA 3KZPA 2ZUVA 4IP5A 2X1UA 4G1NA 4E6MA 2XZ9A 3NVDA 3U0HA 3BQ5A 2XVPA 2NV2A 3WJWA 1LYXA 1TV8A 1M41A 1DWJM 3W00A 2YBVA 2E5DA 1VFSA 2UY4A 3TC7A 2OZTA 1DYSA 4MM1A 4GOAA 2Y4SA 5IBXC 3SADA 1PHQA 3TAOA 4DVOA 4K3ZA 2P88A 3W76A 5EMMA 4Q4MA 4DXXA 1ZJAA 5CGMA 3B9AA 4JR5A 3LCXA 2RUSA 4WIWA 2H6RA 1VPQA 1S2UA 3PULA 1QJWA 3IJ8A 2YOCA 4LUYA 1NF7A 2AGKA 1J9YA 1PBGA 4M6PA 4NL1A 4XQ6A 2I5GA 1UIOA 1A80A 2D1ZA 1Q7ZA 2DSWA 3SCUA 1GW9A 4EXQA 3LM3A 4RDVA 4JIRA 3VNMA 1YKWA 2ISWA 2CZVA 1K8ZA 2J6VA 1EEPA 1O68A 2PGWA 1UKOA 3DENA 3GIQA 4HHLA 4C60A 2W62A 3E2SA 3WYZA 3UFYA 2PFHA 3SSJA 4KIEA 3CHDA 3EDJA 2R14A 3UJSA 3M0JA 2CLPA 2V3EA 5I03A 2FZBA 1OFPA 1B4EA 4F9DA 4OT7A 1TELA 3PZGA 7ENLA 3TJIA 3QGAC 1HVXA 3BV4A 2VCBA 1XCFA 4EACA 4G56A 3DGRA 5CAKA 2CLKA 1QBBA 1L2QA 3G24A 3WQ8A 3LY0A 3GTIA 3A3HA 2WLYA 2EHHA 1AJZA 5CJ5A 5FEPA 1VRXA 1YW1A 4WCJA 1FRBA 3WL0A 4UTMA 4WVXA 1XIDA 4TUFA 2W5FA 4NY2A 5A8NA 1BYCA 2QDGA 4BHYA 4LYQA 2QQ6A 1OYCA 3E2QA 1AFSA 4GRSA 1P7TA 7ODCA 4Q3MA 3QQWA 3GM8A 1F3XA 1E4NA 1ZHAA 4JBRA 1ISXA 1HW6A 3HGOA 3ATZA 2LLEA 2QKFA 3CJPA 1XL9A 3M5ZA 2H3DA 3W87A 3Q67A 3KFTA 1JGMA 3QJAA 2V82A 2W92A 4GX8A 3AUOA 2GQAA 1R8LA 5C0QA 4AZHA 1NAL1 3OIHA 3GNPA 2W27A 4PODA 3F2CA 1MEIA 5HINA 4LQ1A 4BS0A 2V8ZA 3L0NA 2ZA1A 2OTDA 4XUYA 2BODX 1MEHA 4HBKA 2PTYA 3LN3A 2WKGA 1HIZA 4GQGA 3JRKA 4H7VA 5D30A 4B5VA 3EWWA 1KXTA 3T07A 4GGBA 3G8EA 3LPPA 1W9VA 4C5ZA 3KW3A 5C9RA 5EMJA 3EWYA 2G4FA 3Q37A 1DTNA 3EX6A 4YTUA 1A5MC 1Z8AA 1L0PA 1QFEA 2VR5A 4HK6A 3N6JA 2BDQA 3NO5A 2YDQA 1JDDA 3CEPA 3L7RA 2QLYA 3ITYA 4KCTA 4LXFA 4NIRA 4Y9PA 3YPIA 3O0KA 4IICA 5CJNA 4K36A 3QC3A 1H4PA 5ABEA 3TNOA 1O94A 3M0HA 2P0IA 3UQNA 4BCEA 5HXMA 4KWWA 5JIPA 3POCA 4PUWA 1P43A 4CNOA 4M8UA 3PZVA 1DORA 1FBAA 3QMRA 4GVGA 4ML4A 2V5JA 1KFLA 3IJLA 1KM6A 4TVDA 4IQEA 1VB9A 3URQA 3ARPA 4YVPA 1QI3A 3HB9A 2X0SA 5BWAA 3QR1A 4AU0A 4H8NA 1CXEA 3S42A 1S3HA 2OMAA 3R0UA 3O6CA 2ADAA 2FZ9A 4IGMA 4PCPA 3BGJA 4I7VA 3F1QA 3UW6A 4D6GA 4CKQA 4O57A 3R8HA 4P7OA 1R5YA 4J2PA 4HTYA 1FFQA 5I09A 4A22A 1AW1A 1JD7A 1V6UA 3FS2A 5LHEA 3AMGA 3PNUA 1GQNA 1MZHA 1OADA 4MG4A 1ADOA 1XLGA 1XFBA 3WJSA 3RLHA 3FY1A 3UBPC 2QS8A 4NZ1A 4B2DD 1F05A 1FP8A 2ZA3A 1EJUC 1AG1O 2FPVA 3W28A 2PDIA 1WBHA 3VDAA 1E6XM 3P2VA 1E5NA 3E9AA 2Y7FA 1RBOB 1TIWA 3LGDA 2XVNA 4UXDA 1FXQA 2VEPA 1VBUA 1W5OA 2QCFA 3DX5A 1B30A 1TZ9A 3B8SA 1LQAA 3D46A 3DBNA 3ZVHB 5I3GA 4NX0A 4IGHA 4GJJA 6XIMA 2NX1A 2X8RA 2ALRA 1EX1A 3KL0A 2G37A 2G3JA 4N9EA 3WDRA 1FXPA 2PDHA 4HSHA 2FHCA 4I5RA 5CPOA 4ZZ9A 1U22A 4Q4OA 4MJ4A 3WNKA 1LWHA 3T8LA 3M9YA 1E1FA 3PY2A 4PGLA 4GVHA 1XKJA 3TR9A 5IHRA 3NCOA 3BWWA 2PAJA 3KBVA 4WHBA 1VEPA 3FGCA 1RD6A 2FTYA 2P5NA 4DEFA 1G5AA 1FWEC 3DI1A 3VNKA 4LUSA 1JZ5A 3S6TA 3WL1A 3PB0A 3O06A 3OBEA 3BW2A 3GSMA 1L2UA 1TPUA 4X2PA 4TVUA 3STEA 4ACZA 3AIWA 4OZOA 4YL2A 1EC8A 5FIPA 3F5JA 3VUSA 3MA8A 1XRTA 1FCBA 3IK4A 3ITCA 1QNSA 2UZ9A 3LHTA 2GWNA 3FIGA 5D04C 5EMYA 1RALA 5TBOA 5GJPA 3GVVA 2YXOA 2WNNA 3CC1A 3VYLA 4CD7A 3INPA 3UGVA 1NFBA 1RQBA 5KZMA 4H83A 4RDYA 1J18A 2BY3A 4ATDA 3LCIA 4P8UA 3H12A 3JR2A 3WMBA 4J5NA 4CN4A 3U7VA 3M43A 4ZCWA 2GWGA 3FVDA 4B3LA 4LEQA 1NARA 4IXXA 4DO7A 1R9ZA 2E8YA 3WLQA 4ES4A 4PUDA 1KA9F 4YN5A 2W4XA 4ICMA 4OBTA 2XU2A 3P3BA 4MNMA 2DZTA 1CXHA 1M03A 1M3UA 2R1KA 3W7HA 4HA4A 3G0UA 3MBFA 1T5AA 3KP0A 2VNCA 2GVJA 4RJEA 1RVGA 5KTLA 4OWGA 3DYMA 2AQVA 2F84A 3UWEA 3VGBA 3ZM8A 1QR7A 5DMLA 3ZLFA 1TPDA 2VC7A 2PTXA 3GHUA 1BVWA 1E1EA 3G77A 3M0IA 3QW4B 3BXWA 1LLWA 2H9AA 3NO3A 1X6UA 4DWDA 3ALGA 3UT0A 1I8JA 1XIEA 4JPGA 4RZ4A 2E8ZA 3NL6A 3ES8A 1GK8A 4B5SA 1H7XA 3O63A 5HR6A 4R7OA 1F9CA 2WCSA 4YVVA 1GVEA 4QR6A 2CERA 2R1MA 4ZB2A 1FQ0A 3TQPA 3PTMA 4K68A 1ALDA 2UY3A 1J10A 3I10A 1T0OA 4JN8A 5G1YA 4YPJA 4ICNA 4F0SA 3CK5A 1D3GA 3GR8A 3L4TA 2QUVA 4AD5A 3QQ1A 4DJEC 3KRUA 1HKJA 3WFLA 1K77A 3OYZA 3XIMA 3VD5A 2F61A 1OGSA 3DFQA 5LA0A 4DIAA 1KTNA 5A2BA 2Q8ZA 4PH6A 1R38A 2XVGA 2JE8A 1Y8BA 1HP5A 1OFBA 5LNWA 3WEZA 2DJXA 2JGYA 4JHMA 1V6TA 3O6YX 4XAYA 3O2LA 4O0QA 1XPGA 4NILA 1G4SA 2V6AA 3NQ2A 2OZ3A 2WMGA 4ZB0A 1IXQA 4RX0A 4QROA 1KGUA 3V0SA 1H61A 3QV9A 2PE4A 1OGGA 3UERA 2C1GA 2ZUSA 3IEBA 2GL5A 4GC3A 1OYBA 1JPKA 4B16A 3HJEA 1OY0A 3M4HA 4E0CA 3WNMA 3DKLA 1PX3A 3IJ9A 8A3HA 1CGXA 3LCHA 3UJ2A 5BZAA 3KRZA 1GOWA 2QDDA 1PAMA 4LS0A 1FWFC 1DHPA 5MKGA 4UQBA 4EIVA 1OEPA 1PKNA 1S2VA 2D3LA 3ZZ1A 3EX4A 4L6DA 2DT2A 3BW4A 3JVAA 5AYBA 1U2YA 5CSYA 1A0CA 3CPRA 3OVGA 2E09A 4PSRA 1DJQA 5HAOA 1E6QM 3P5ZA 2PGEA 3E0IA 4S1FA 4XISA 1AQ0A 4DO5A 4A3HA 2WCAA 4QJ5B 4I6VA 3VUPA 2DFAA 2QJGA 5JMUA 4TTGA 4A05A 4HZ6A 1X98A 1RAKA 5I2UA 3SFKA 4PEEA 4EAYA 3LQLA 4AC7C 1NTHA 4H2CA 5KZ6A 4ASTA 4L6OA 1JDAA 3OZYA 4HSNA 3SJNA 1V08A 2I7GA 1HUVA 1GTEA 4R53A 2ZXBA 1HVQA 2YCLA 4JCMA 2I5QA 1PTGA 2QCGA 1XM3A 3H4WA 2DGAA 2HNHA 4LYKA 4O4VA 2FGBA 4GQ0A 3WBXA 1ISZA 3GZ3A 3O3RA 3GBEA 1JZ4A 3TA6A 1AK5A 3NL2A 4EKJA 1U33A 2J7HA 3CAWA 3O9NA 5F1VA 3NDYA 3GC2A 4KWOA 2BV9A 3LLDA 2DT1A 1R3YA 3WLHA 1N82A 4AZGA 4QE4A 4CNUA 1TVLA 3DN5A 5CC6A 1KKOA 3NUKA 3VNDA 2FQIA 3GKAA 4B91A 2E6DA 2V2HA 4F4RA 4TX8A 3JZEA 3G0XA 1I1WA 1FY6A 2A7RA 2P1FA 5I79A 1Q13A 4K7YA 4JL2A 2YCJA 3DCPA 3PZNA 2Z2BA 4D71A 2PP0A 4CEUC 1YDYA 3SZ8A 2EXOA 2NT0A 4X3ZA 3TN5A 2VELA 4PRWA 4N9CA 3CM4A 3R7MA 2YLLA 3UXKA 3THUA 3IUIA 2ZBTA 5FJTA 1WXZA 1KC7A 4DBSA 1IT8A 1IHIA 4J35A 3GNOA 4HYWA 4A3RA 1H50A 4O0ZA 3VOHA 3SN4A 3EXSA 2BGNE 3C61A 3T0CA 3W1LA 3B0UX 5T8GA 3E74A 1KBBA 1Y0EA 2AL2B 5LGZA 4RNFA 2YDSA 1BRLB 1TG7A 3PUEA 4PZVA 1WDPA 3S47A 1UH4A 4JGDA 2WYSA 4ACYA 1UWTA 5J8LA 4Z17A 4LNYA 4WRHA 1VC4A 4PMJA 3C3NA 4OV9A 1K9EA 3WH5A 3LV5A 5H6HA 3WLOA 2VX6A 3GE7A 1JCNA 3JW7A 1LORA 4QNEA 3W7MA 3UCCA 3F2BA 2TODA 4HU0A 1J96A 1FOBA 1W9DM 4BK9A 4GIRA 4L1GA 3RU6A 4GACA 2VURA 3IV8A 4KMQA 4CVWA 3FA4A 4IPIA 1CPUA 2D24A 4W88A 2WJDA 3CV2A 3OJGA 3G1YA 5LGXA 2E1WA 4BZYA 3CQIA 4R34A 2NSOA 3NYZA 2BSLA 5CBIA 4S3BA 1IV8A 1B3ZA 3TR2A 3ID7A 3SGGA 3NPXA 1S5NA 3MYPA 1QHPA 5FF0A 1F8MA 4MWAC 1J4EA 4LAZA 4N9DA 3S4TA 3QYSA 3ZJ8A 3HTWA 1XYAA 3TJXA 1YTEA 3BDKA 1QXLA 3ARSA 1US3A 2FB3A 3C0LA 1A53A 1NH6A 1S2CA 3LU2A 5H1WA 3TYAA 1XW8A 3PBGA 1SR9A 1XICA 2VDIA 3QPZA 5CKSA 1OG6A 1L6GA 1OGBA 4JTEA 2P8BA 4FAMA 4HU8A 1XLFA 4JD4A 4KEZA 3PWGA 3W6LA 3WUGA 5ABTA 4Y2WA 4WUIA 3WBAA 2G50A 4WF7A 3LTYA 2Q3RA 3EAUA 2G4JA 2DZXA 3MJYA 1Q6RA 9CGTA 4LGXA 3R89A 5LNRA 2PBGA 1FWNA 2QJIA 4LT9A 3PJXA 4XBSA 1E3XA 2X2YA 4WK9A 3SEPA 1UR8A 2Y85A 2ZUWA 3S9IA 3BAJA 3LRMA 4AG0A 1SPQA 2J62A 5EBAA 3R25A 4S3FA 1Z6KA 3L65A 4IQDA 1W9BM 4AHOA 5HNNA 3ZS4A 4JYFA 1JZ3A 1Q45A 3KP1A 4FLSA 3G1VA 2H90A 1VPYA 1K9DA 1OB0A 2WVSA 4HPXA 1DJWA 2E5BA 3N29A 4W5ZA 1RJQA 4NX5A 4BJHA 3ZWTA 4UR8A 4OGZA 4DUVA 4PCNA 4KIRA 3JZUA 4GG9A 5FJOA 4LY4A 4GXMA 1VIWA 3BVJA 3V18A 4ZXOA 2OQYA 3GXDA 4YU1A 3MSDA 3IGHX 2ZUNA 1TMLA 1V3LA 4L4LA 1NDVA 1YTKA 4J3ZA 4LCRA 3UNDA 4HGXA 3BAKA 3NQAA 1Q2SA 4A3UA 3KVLA 4PUJA 3RPTA 3S1UA 1XFCA 4P8XA 5TQLA 1GJUA 1XP3A 4U5IA 4XZ9A 1WDDA 4YCPA 1C8QA 1H0GA 1QPRA 2QCLA 3C2EA 3MANA 4Q4KA 2EPNA 2OB3A 1XLEA 1MW2A 5ABFA 3B9EA 1PKMA 2YZ5A 1LOQA 2GOUA 2IS7A 4J2MA 3WLRA 3QSRA 5CG0A 3VNZA 5CPMA 3AICA 3P7YA 3HF3A 1K70A 1DXFA 2YLAA 1E9YB 1AW2A 4RW5A 1EF2A 2R6OA 4IUGA 2RKXA 3QHMA 5DBUA 3VX1A 1LUCA 2GJXB 3EPMA 1VYPX 1E56A 3W9ZA 3TTOA 5CZSA 1NU5A 1F8IA 2A4AA 7A3HA 4GISA 4F79A 3W86A 3UZ5A 4AIUA 5E1QA 2IKGA 3MKVA 5LNVA 4L7ZA 4YLWA 3VFCA 4KS0A 2OEKA 4ZQCA 1UR3M 2QJNA 1YPIA 3UPMA 3RX3A 3UZYA 2O9PA 4FOKA 4Q8QA 2ZX6A 3WQGA 3L4ZA 3TW7A 1EJRC 3P6LA 4O10A 3G1AA 5EMUA 4MZ8A 4S3KA 4JTJA 1BG4A 5DY3A 5G2IA 3W2JA 4FB7A 3RK8A 3E2VA 3C8NA 4G9PA 2BVYA 1S38A 3VNYA 3K1DA 4W8BA 4RE3A 3GC5A 2WO5A 3V5FA 1X6NA 3PNZA 2WHJA 3QF0A 4XAGA 1X97A 1XLHA 4YWIA 4HPGA 3MCOA 2FZMA 5TD4A 1PTDA 3NQCA 1PSCA 1S5WA 2A79A 3NQ6A 1VHNA 3FJ4A 2OG9A 3MT1A 3CUHA 3KM8A 3OGRA 3ZSTA 4XAFA 2GGJA 2YDRA 2DIKA 4DAFA 1QO5A 2PU1A 2WQDA 1KV5A 1PZ0A 2XYLA 3KCOA 3GKFA 4P8VA 4C7DA 2HDJA 3SAZA 4BQ4A 1KRCC 2UY5A 3OVPA 4NKCA 1VKFA 4IOTA 3CMFA 3MHUA 2Y24A 5JH2A 3BG5A 4DUWA 4ZSTA 2A0NA 3PUOA 5EBUA 1QI2A 3SW6A 1DL3A 4HU4A 1XD1A 1EA0A 3A47A 4D2JA 1X1ZA 2VWSA 3L5AA 1G4TA 3AIVA 3VNLA 4G1KA 2B7QA 4IPPA 4UOQA 2BG5A 1EO5A 1IWBA 1SR0A 1SZEA 2E6AA 1MXSA 8TIMA 1KLYA 3WO8A 1SQ7A 1S39A 3S1VA 1T41A 3WD2A 3VOCA 5LA1A 4Y9MA 3LOTA 1J79A 4GXPA 2VXNA 1SFSA 1RP8A 4MWAE 4JY9A 1IIGA 1XX1A 1A5OC 4O52A 3M16A 2ZUUA 2IXVA 2XINA 1ZBKA 4GQRA 1OQFA 4R7JA 1NF0A 4XVEA 3OZPA 1I9CB 1W3JA 1ZENA 2GVLA 1ODZA 2J9XA 3KCLA 4FNSA 4ROQA 3PTQA 3WBWA 5I3KA 2VUYA 3PR2A 5DLCA 1J0YA 3APGA 1QASA 5I24A 4OOUA 4KQNA 4MLJA 2FB2A 2DVXA 3QPEA 4FLRA 2GYIA 2PPGA 1XYZA 3G22A 4KEMA 1EXPA 2BXYA 3B0XA 3KBSA 4NZ4A 3QV6A 4NU7A 1E4LA 4FZIA 4XTIA 1YE6A 3TJ4A 4MFEA 1JI1A 3NQFA 7TIMA 4JEJA 3AQUA 3VCCA 4U10A 3T6CA 1UZDA 3UU0A 3UNTA 1SMDA 2NLYA 1MDRA 2X1TA 1EBHA 4NAEB 4UQEA 4UQAA 4O1BA 3W37A 5CAHA 2Y7EA 4EXAA 4HN8A 4RZ6A 2Q8XA 3UA3A 4IJCA 5F4SA 3BTNA 4IQLA 1XYMA 1PL9A 3A12A 3GLCA 2ZVRA 1JYVA 1IT7A 1VFTA 3OOQA 3NQDA 3QZ6A 3AROA 2OELA 1V8EA 4PRRA 4XKYA 4ZMGA 3GDMA 1QNRA 1EWDA 3C4UA 1RP9A 3RHGA 1BQCA 3IIPA 4URIA 1EUNA 3PBMA 4UNKA 4DJDD 3OQ8A 1NFPA 4A29A 4C6NA 3LS9A 1DV7A 3BICA 3EOLA 5EPDA 4PB5A 2PTDA 1KM2A 3FSUA 2BTMA 4O11A 4O1EA 3ZXWA 1ZAJA 2ZRYA 1RK5A 3KCJA 2PU0A 1HGYA 1PIFA 4Q6XA 3NG3A 2O4MA 2CZEA 1BXNA 3PS7A 4H4IA 1KM5A 1W9PA 2OOFA 3OPSA 3W75A 4NVTA 4U5KA 2Z2AA 4EAMA 1PX8A 2GVGA 1RA5A 4FSAA 2PSNA 1FKWA 3C2RA 2NXGA 2Z7GA 5HQLA 1H7WA 3DC0A 3EMZA 3URAA 4K7VA 1ZCCA 3G1DA 2W63A 4UNIA 3DUGA 1KFEA 1HL2A 1MUWA 4E4PA 3QPYA 1R87A 3H26A 1RHCA 3PTKA 2OSXA 4DJDC 4IUOA 3W24A 2VKZG 3T0TA 2XVLA 2CLOA 2ZXQA 2POZA 3E2RA 4LX4A 1UR9A 3KAOA 3A9BA 1WAWA 1XR2A 1FWIC 3GFZA 2HBXA 4LU0A 3MHFA 5HOSA 1DXEA 2DSKA 2CLIA 1QUMA 4UCFA 1HJSA 3SFWA 1QRQA 2QUTA 2G3NA 1A5KC 4IIEA 3D3AA 3A13A 2O7QA 2WPGA 2YCIX 4UR7A 1DQWA 4GFIA 1VRDA 4LH8A 5D9PA 3AYTA 3Q2DA 4WDWA 2V38A 4KW2A 1W32A 2X7WA 2OO6A 5H2ZA 2YW4A 3GH7A 3PSWA 4MSSA 1SO3A 2VC5A 3MKCA 4Q4SA 4B3ZA 1TTJA 5BRBA 2V67A 1CECA 1OFEA 4TR9A 4LUTB 2CBUA 3QTPA 4KERA 4N7QA 2DUZA 3OB8A 4GA8A 1GZJA 3JS3A 3LXBA 3QKZA 1AMYA 3VD7A 4A6GA 3CQ0A 3OGVA 1BLIA 2ZQ0A 1CW2A 3W0KA 3ZIZA 5I06A 1TWWA 1XRSA 4FP1A 1F3TA 1C7TA 1H1NA 2J25A 3Q45A 1V6WA 3DEQA 5FAJA 5JBFA 3E12A 4HNVA 1QHZA 1SJDA 2XSAA 3HFYA 4LPCA 3W1MA 3HM7A 2HS8A 2FH6A 3LK6A 3A4WA 4WSJA 2PLCA 4RUBA 1PKYA 4LUJA 4IIDA 1H41A 4FI4A 3TYUA 5I02A 5HMSA 1LG2A 4F0RA 5C7HA 4PUMA 1LL6A 1RBLA 4KF1A 4GKLA 4FLQA 3A4JA 1RV8A 2L5HA 1EGZA 3TSDA 1XYBA 1Q8AA 1QI0A 1YDVA 4L1XA 5HBFA 3TA9A 3SCVA 3UY8A 4ACZB 2EJ1A 3I3EA 2DH2A 4DUOA 5FJUA 3S5NA 4KESA 4H6EA 3R43A 3KOXA 3V1HA 3OZOA 1KKRA 3O0FA 1HGWA 3BSMA 3N2TA 3W85A 4AMAA 1GVIA 4PTDA 2DSUA 4NZCA 2VTFA 1AD1A 4F0MA 1JGIA 2HWGA 3FKKA 4LYPA 2WC3A 1LG1A 4J3UA 2NUWA 2Z0IA 3W7OA 3DECA 1A3HA 1I0DA 4MOZA 1E4IA 3SQSA 4K2SA 3SURA 4EF9A 4V1XA 4AY1A 5C7VA 2ESCA 4WY0B 3A3XA 5G1TA 3FLUA 1VP5A 4W4QA 3S5SA 1BVNP 1SU5A 1C3FA 4QDPA 3ABQA 1FWJC 2XSXA 3QTGA 1ONWA 3LGGA 3WFAA 3RR1A 2A7NA 3LI1A 3VI2A 1NWUA 1OFRA 1J2BA 3M07A 3WDIA 2PCQA 3UCDA 3IVTA 1EXBA 2YXXA 3ZT5A 1A5LC 3ARWA 3HBLA 1CGWA 1GHRA 3MUY1 4Z1YA 3Q94A 2ZX9A 3VKBA 2NWSA 4ZQMA 3NQMA 4M1RA 2GVEA 4YYFA 4FXSA 4IIGA 4AC1X 3VA8A 1JUBA 4A3QA 1GG1A 2OWCA 1GVSA 3MI2A 3I7SA 5F7UA 4C65A 1ITQA 1YLVA 3SGZA 4OOZA 2IW0A 3NQBA 1K02A 1EGMA 1HO1A 1A0EA 1GORA 2UY2A 2WHLA 3LI0A 2Y2WA 3PUGA 2D20A 1B5TA 3C2VA 3VGEA 1FHVA 1JJKA 1GOKA 5AC8A 3ONCA 3ME3A 1UROA 3C0QA 2PDJA 3C5QA 1KB3A 1C9DA 1UUMA 5C9ZA 4PUNA 4AZBA 3ITVA 1L6YA 2DVUA 5M2FX 1HJVA 3BARA 4W8AA 1P4CA 4QEHA 2D0GA 4DJEA 3FJNA 4LALA 4P2VA 3II1A 4JEQA 3SCWA 3I7QA 3F4DA 1SW0A 3PJWA 3B97A 4Y8EA 5L6UA 4W8LA 2DJLA 2IPJA 3QMSA 1K03A 3BC9A 3L5LA 3GHTA 4ZFMA 1ZBCA 2VD8A 2AL1A 4R5EA 2J13A 4LC6A 4AXNA 1PZ1A 3CGTA 1V3KA 3T0BA 3HG5A 3RNDA 2PZ0A 3THDA 1FHLA 3AHTA 5HA7A 1B3WA 1JPHA 3H54A 3DHFA 1UKTA 4QLLA 1OD8A 2C8NA 4PFHA 2QCMA 3KBNA 4C91A 4DWSB 1VJSA 2CU0A 2R9RA 4GZIA 1XLLA 5CPSA 2PDBA 2A85A 2IKHA 3FKRA 2DT3A 1E9IA 3MVIA 4EF8A 4ZTXA 3NR0A 4F9JA 1RQHA 4WX2A 4HT3A 1ME9A 4FNPA 3QEZA 5MKGB 1EA9C 3IANA 2O0TA 3VGDA 4MDPA 1E43A 5BROA 1REQB 4NSBA 3H70A 4ECLA 5F2GA 1TR1A 5FCZA 4WGXA 3VNIA 3DZ1A 2ZDSA 1RSCA 4KGLA 1IZCA 1EJSC 2YB4A 5I07A 5HWMA 1EDTA 5FJRA 3GU9A 1O7AA 2OT0A 4UQ9A 3GR7A 3UXDA 1JD9A 3THQA 4M6VA 3ARRA 1P1XA 2JFEX 3QW3A 5CZJA 3H4XA 1NOUA 1FX6A 3DXIA 3CNYA 3G3MA 4QDWA 3HGJA 3FHAA 4FXFA 2ZRVA 4YHEA 2ZX7A 5EA9A 3VIKA 4U33A 4R7WA 2AAAA 4XX6A 3RX4A 5D38A 2XIOA 4WEVX 1H49A 2FFIA 1WKDA 3LPOA 1CXLA 1Q6LA 3K8KA 4I9TA 3O7UA 1R2TA 3TQ0A 4GUJA 3EEGA 3IIXA 1M68A 1OT2A 8RUCA 3VIJA 3FVMA 2PURA 1ME7A 1FDZA 5DRIA 3EKZA 4KPLA 3WENA 3N4FA 3URNA 4I5XA 4CNSA 1O66A 3SCPA 3E96A 3DG3A 3ANYA 4GUIA 2EQDA 1BF2A 3U5UA 3LTSA 3C0JA 2CPUA 1TV7A 2W66A 2HK0A 2PDMA 1NJJA 4I9JA 5IM51 5EU9A 1QW8A 3STCA 1KM3A 1OFQA 3N3MA 4H6QA 3RCNA 3HPAA 3FXYA 4JIIX 4UB9A 1W3KA 3AIRA 4IMEA 4DZHA 4JTQA 4H9MA 4P7RA 3WDQA 2YZRA 5HULA 4D8ZA 3C56A 2Y8VA 2ZZ5A 4UBPC 3R79A 5LKYA 5BYWA 1P48A 1HF6A 4UUIA 2Q8LA 2OQLA 2VZSA 1POKA 5BRPA 3BSHA 3HU7A 3CB3A 4UTFA 3EA3A 4BKNA 3KLLA 1H5VA 3UPBA 3IUHA 4IL2A 1PS9A 4JX6A 5J5RA 2C0HA 3RIKA 3LBOA 4BF7A 2VFHA 2V68A 4QITA 1UR0A 4Z42C 3GAKA 1F4HA 3P0WA 5DELA 2OSWA 4HNNA 4QAIA 3BJTA 1YXCA 3AYRA 3T2OA 3EOEA 1I2QA 1W2PA 1R3SA 3W71A 2FJUB 4OJYA 4FIRA 1B4KA 3V16A 3B3DA 2CKRA 4JXCA 2QXWA 3BLPX 1LBMA 3B0YA 4BFAA 4UIOA 4GY0A 3ARZA 2OCZA 3SCNA 1X38A 1UR1A 1A5BA 1EGVA 2GZXA 4M19A 1KBKA 4S3JA 3EYPA 5D4YA 3QZEA 4MY9A 2X30A 4MHBA 1E70M 3OP2A 3DG6A 1VEMA 2DSVA 1PXGA 1RR2A 3S2MA 4N9BA 3PJTA 3N9KA 2XISA 4E8DA 5I23A 3UF9A 2Z1SA 3WLJA 2D2HA 3N11A 1G9HA 2ONEA 4O1DA 5C54A 2INFA 1EF3A 1HFBA 3QR0A 3QLDA 3H6OA 4LVFA 1TPWA 4AD3A 2EGZA 1T6MA 3SB0A 3EDFA 3IARA 1QMLA 3WMCA 3NWRA 1ZB5A 1BEUA 2YYUA 2WK2A 2OYLA 4V15A 4FOJA 2B7PA 2VMFA 5BXRA 3EX2A 4X9SA 4RR4A 3SIZA 4JL1A 5FF4A 3LHWA 4MWAA 3UVIA 1I0BA 3BE7A 5T9CE 1K3UA 1R2RA 2EPOA 2F6XA 2VEMA 4JX5A 1BXBA 4N4QA 4PTNA 2BB0A 5HMEA 3NURA 3VOIA 4XIAA 3W7IA 4FK9A 5I78A 1GPFA 1WKEA 1W3HA 3D47A 1WKYA 5AVNA 4LBSA 2GK1A 3LEPA 2ASHA 2B0MA 2ZX8A 1W5NA 3AXIA 1NDYA 1WV2A 3NNTA 2E25A 2J24A 4IT1A 4M81A 3N6QA 4XSMA 5D2XA 3TXVA 1EJTC 1Z48A 4TX9A 2ZX5A 3P14A 1P0DA 3UZJA 3DHDA 1HN1A 1W1TA 4MJZA 2G97A 5B7ZA 3M5YA 3KTCA 5E6ZA 2REQB 2PUZA 5TAOA 3WH8A 3OA3A 2D0FA 4LVGA 3G1HA 5K4XA 3AYSA 5HPOA 3NJ3A 4MJMA 4EPBC 4J27A 1CWYA 3PUDA 4ZTYA 1T7LA 3BMXA 4CU6A 1F73A 1WPCA 1VFOA 1EZ2A 3MV11 5CEWA 4FNUA 3T55A 3A4AA 5AC4A 4FXJA 3VMNA 3CQKA 1IR1A 4YWSA 2Z00A 4DZIA 4X9YA 2IUZA 3HO8A 4C1NA 5HJYA 4JTHA 1PJ9A 4BWLA 1LRQA 3F4VA 3NQGA 3B8IA 3ZQ9A 1GQLA 2J4GA 2P50A 2CKSA 4S3GA 3B0VC 4JDYA 4LV4A 1UBPC 1JFXA 2YBUA 3CL6A 3HV8A 2J75A 3NGJA 2PWGA 5ABFB 3S6OA 4A35A 3EX1A 4KWSA 3H2NA 1V51A 3UXIA 3LCFA 2CLEA 2FPTA 4HCDA 2GGHA 4ATWA 5IDIA 1EH9A 2INZA 1ZP3A 4DRSA 2QNEA 3GTFA 4C6MA 5HATA 2WKLA 4PC8A 5GNZA 1HJUA 2F6KA 4NI8A 4XG1A 1JCMP 4I5UA 4QG8A 2OZ8A 2HNEA 2VDGA 4JNZA 1C29A 4WY0F 4R27A 3H2FA 1MNSA 3VFLA 5CCZA 4LANA 3CYVA 3IIOA 5AN7A 1JZ8A 1EYWA 1WA3A 2DV0A 2XFRA 2BVWA 2QIIA 2BY1A 4AZ7A 3GXTA 3N9SA 4B9YA