4FO4A

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, complexed with imp and mycophenolic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
363
structure length
348
Chain Sequence
MHMLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant, complexed with IMP and mycophenolic acid.
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
molecule keywords Inosine 5'-monophosphate dehydrogenase
total genus 113
structure length 348
sequence length 363
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fo4A00
1TTIA 3FLUA 4FNUA 4Y96A 4JYEA 3KRSA 3EX4A 5AN7A 3M9YA 2YX0A 3B0UX 4NJGA 4PCFA 3P81A 3KAOA 4LRSA 4O10A 3GDRA 1ZJIA 4Z0SA 1JUEA 3ABSA 3IEBA 1OK6A 3NL6A 3HPSA 3SW6A 3RLVA 1TV8A 3EKZA 3F03K 4I7VA 4OGZA 3SZ8A 4A3UA 3W7OA 1LCOA 4UMAA 3W87A 3W2KA 2YDAA 1QR7A 5LNUA 3RU6A 4Z1CA 3EX2A 3UWUA 4EF9A 5U4NA 3GKFA 4QIUA 3LXAA 4A2RA 3EWUA 3QQ1A 1WBHA 3TFCA 3H55A 3ZFHA 1TMHA 2V2DA 4LTSA 2QCLA 3PAJA 5D03A 4S2CA 1NSJA 3UD6A 2FB3A 5D02A 1KLZA 4MY8A 5D2XA 1P0KA 5D2YA 2AAMA 1GTHA 4MY9A 1FCQA 1FX6A 1XI3A 1QFEA 3M7WA 3R2GA 3ABQA 4M6QA 4LUJA 5F4SA 1AMKA 4AVFA 5I3HA 2V9DA 7TIMA 4JTTA 5LHFA 2QR6A 1OABA 2W0UA 2QCNA 3G1YA 3HG3A 4MZ1A 4EF8A 1ME7A 3F1QA 2DJXA 3O06A 4RZ5A 1T99A 3I7RA 4ZQOA 3M5XA 2DZUA 2FQIA 4LS0A 3ABRA 3UWVA 3L0GA 1X1OA 2Z6IA 1K8ZA 1H7RA 5D32A 5G4WA 3W73A 5K7JA 3OA3A 5K9DA 2JGYA 1HUVA 1J4EA 1KFJA 1DJNA 1NFBA 2E09A 1NEYA 1PCKA 3O16A 2Y85A 5K3VA 3G22A 1SW7A 3L2IA 2RH9A 4FIRA 3TSBA 3NQAA 3WK3A 2F7FA 1F2JA 3QZEA 5CGQA 3OG3A 4XTDA 2QF7A 2QKFA 4XUGA 3MYPA 3PUOA 2R14A 2OT1A 3DHDA 3W1NA 1LP6A 3BLFA 3UZJA 1T0OA 5D04C 1SZGA 1SO5A 5DCBA 1WQ5A 1TPH1 3W7IA 2I9EA 3EEGA 3GXTA 1TCDA 1ONRA 1LBMA 3BPWA 1WV2A 3NEVA 1MSSA 2FPTA 4MPQA 3A9IA 1H1ZA 4IMEA 3TAKA 1C29A 3DH7A 4Q33A 3UWWA 3LV6A 3HO8A 1VGAA 2Z6JA 5CPMA 4JTIA 1TPEA 2NV1A 3G3MA 3UPWA 1B3OA 3WJXA 3VI2A 2DU2A 4WY0A 5L6UA 2WSRA 1VS1A 1S5VA 3EWBX 3UNDA 3SECA 3NPVA 2ZCGA 2DZXA 1ML1A 3PY2A 4KFOA 2BSLA 3BGGA 4DELA 4NX0A 4LUIA 1BWLA 2H6RA 3G18A 4WZHA 4DQWA 5KZDA 1TRIA 1ZHAA 3E9AA 4N9DA 4ZQNA 3HGSA 3MW7A 2ZRVA 3P8IA 1FXPA 6ALDA 5AHLA 3WK0A 1W5NA 1F76A 2WO5A 1RZMA 3W1QA 4PL1A 4HNTA 2QCHA 3CTLA 3PWAA 4WY0F 4GC4A 3S1XA 1SFJA 4ZQCA 5I3GA 5KMYA 1Z44A 1YDVA 3TK7A 1B9BA 5BRBA 4LC6A 4OHQA 1PCWA 3C2VA 4RJEA 1KM1A 1EX5A 1XBYA 3CEUA 2A7NA 1D9EA 1KM0A 2A6NA 4CQAA 1GVOA 3HGRA 3IVTA 3TIMA 1IXQA 2DJLA 4ONVA 3L5MA 4YMZA 3R5EA 4WOZA 2QCDA 3VFLA 4RXFA 3MP4A 1P1XA 5KTLA 2EHHA 3DKLA 3THAA 1LROA 3NNTA 5G2HA 1G6CA 3NPXA 3L21A 1P4CA 3LBCA 3QRHA 1R2TA 2GVJA 1H7NA 3W7MA 1ME9A 1TTJA 2GOUA 1QDSA 3PVFA 5CPLA 4IPIA 2B7PA 3BW2A 3WK2A 2VELA 4MZYA 4IPJA 3P82A 5D38A 2E6FA 3I65A 1ICSA 1MO0A 2Y88A 3UWYA 1OF6A 4TR9A 3L9CA 4HNNA 3FYOA 4CCCA 1KFLA 1K7EA 3E0IA 4UNKA 1R30A 4MY1A 3NR0A 3H54A 2ZBTA 5DCEA 2A5HA 5C6MA 1Z41A 1KA9F 2P10A 3GB6A 4BWLC 4IXHA 3T4CA 5DELA 5E0KA 2HS8A 2NUYA 2CLLA 2JKPA 1K8YA 2HS6A 3SJ3A 3LRLA 1ADOA 3LGEA 2VFDA 3NQ8A 3DBPA 1F05A 4ZQRA 1JQVA 2GJNA 4N4PA 3FKRA 3GZ3A 2D73A 2C1HA 2C13A 5BMWA 3EX3A 3FOKA 4UTIA 2B0MA 5I3IA 1JR1A 4FF7A 2TPSA 1MEWA 2JGQA 3W6YA 4LC8A 3PSWA 1Q6LA 3LHVA 5KITA 1Q6QA 4IMCA 4NJKA 1TYGA 3N19B 2V82A 2A21A 3S5ZA 3W88A 2RDTA 4GUHA 1SW0A 2F84A 4MKNA 3W7HA 1UUOA 1GQNA 4Q4KA 4IOTA 3MI3A 3NQEA 1KTNA 5FEWA 3C2EA 5J5DA 3LHZA 1RPXA 3GDLA 2QEZA 4RXGA 5D30A 3LCWA 5IBXA 1EWEA 3TXZA 1W0MA 3B03A 4O52A 3PBUA 4DEFA 4PH6A 1GVQA 1YXDA 4UMBA 2YW4A 3B4UA 2Y7FA 3FJ6A 3UY7A 1CX9A 1Q6OA 1X1ZA 2X1RA 3PG8A 1DVJA 4KKXA 3W7EA 4UUIA 3KFTA 3SFKA 2JBMA 4JIPA 3NQDA 3D0CA 2Y7EA 4LU0A 4FXRA 3F4WA 1EP1A 5G5IA 4O0ZA 1H51A 1RQEA 3A23A 1VZWA 2DZPA 2E6AA 4MIMA 2VFIA 1OFPA 1JRBA 3WJZA 1H62A 2H3BA 1F6KA 3QH2A 1FCVA 2G96A 2Y61A 3RK8A 3B0PA 1WX0A 3EB2A 4B5NA 4YXGA 3DFTA 3M43A 1ZNNA 3G1DA 3THQA 2PRLA 2FB2A 3DHFA 4N9EA 2PURA 1DORA 2ZZ6A 2YSWA 1Z48A 3STCA 3PM6A 2J6XA 4GNJA 5FF7A 3W1XA 4LS1A 2B7QA 4QISA 3PC0A 1GPWA 4RV8A 4Z0JA 1EUNA 4AAJA 1MZHA 1NVMA 4DXVA 3G1SA 5DCDA 2KZHA 3GVGA 3NL3A 2Q3RA 1KW1A 1GOXA 1H60A 3TA6A 2DZVA 2HTMA 1TPVA 3EKLA 3FFSA 1KFCA 1QOPA 1I2OA 3LI0A 1VC4A 4NU7A 2VOMA 4PTNA 4XKYB 1XBZA 2H3DA 5SWUA 4O1CA 4DO6A 1N55A 3LLFA 3IIOA 3N14A 4JN6A 3FJLA 3G1AA 1OHLA 3DZ1A 4JTSA 4O15A 4JIQA 4L4LA 2YGYA 4K36A 2YPIA 3ANYA 3UPBA 2R91A 1D3HA 1TO3A 4O1BA 4JTGA 3P61A 4O19A 1DV7A 1GZGA 1WYIA 3QW3A 3S42A 3W7GA 2E5BA 3W2JA 1OF8A 1UJPA 1DHPA 2VEKA 4UC5A 4RLIA 3L66A 1IGSA 1HO4A 4K37A 3R12A 2A4AA 1OFOA 4Z1DA 3OBKA 2FLIA 3LI1A 3N2XA 1KM3A 1VCFA 3NVTA 5CG7A 2CLMA 2YR1A 3WJYA 1AW5A 4UTWC 1FWWA 1OX4A 1K03A 1OX6A 1T8XA 2G97A 1W56A 3CWNA 4ORIA 4HNVA 1ZY9A 4UFKA 5AHEA 3QC3A 2P1FA 3RF9A 2VEMA 1RQHA 1K7XA 4BK9A 2QCGA 3S6DA 1W37A 4JNMA 5AHNA 1CI1A 2QUTA 4AF0A 4E0CA 2TYSA 3HQ1A 3IRDA 3IIZA 3UYCA 3T44A 3QEZA 5LGZA 4DO4A 1LLWA 3W2LA 1X6UA 3GKAA 4R53A 2ATMA 4UFHA 3GR7A 3S5OA 1F74A 4NUWA 1KTBA 3P80A 2ZRYA 3EWYA 3W1LA 4NZJA 4JX4A 2VEIA 2WJZA 4Y8FA 3BO9A 5EL1A 2LLEA 2ZZ5A 2QCFA 3G1HA 1YXYA 4MJMA 2NXIA 3HBLA 5BMXA 1Q3NA 4O14A 4XZ9A 5IBXC 2ZTJA 1QCWA 3MHUA 3TH6A 1T96A 2QAFA 2QUVA 1I2RA 3CIXA 5F1UA 5AYZA 1EWDA 3LHYA 4DF1A 2V5BA 4AWSA 3MO7A 1BTMA 3P67A 4AHOA 3N73A 3W7NA 1TPUA 4M6PA 4WQ6A 4RKAA 3C3NA 3KRZA 1JCNA 3NQCA 4EVZA 1AW2A 2ZFAA 4R7JA 1J2WA 1F7BA 3CQ0A 1NAL1 5F4XA 5D33A 4P2VA 3KRUA 4CQ8A 5FF0A 5F2GA 2EGZA 2ZZ1A 2VEPA 4GXMA 3O15A 4TMBA 1YADA 4NT0A 2Y7GA 3W7KA 1LOSA 3W71A 3DFOA 3IGUA 1GVSA 1QNVA 1SSDA 1SSGA 4UFMA 3S5YA 4JTEA 5BOOA 1JUKA 2WPBA 2C16A 5E93A 1A5BA 4O4VA 2ZRZA 4FX8A 2WKJA 1ZFJA 2NWSA 3MHFA 4FXSA 3W75A 1IF2A 1OYCA 1PV8A 2YW3A 2C6QA 2W6RA 3KXQA 1Z42A 1L2UA 4M5PA 5HQEA 5AC8A 2BTMA 2EPHA 3A5FA 3TKFA 5HWJA 4LV4A 3QYQA 3G0UA 2G5WA 1LM1A 3VKJA 3IGSA 3BLEA 4MLJA 4JX5A 1P0NA 3PS7A 4J9JA 4UNLA 2QAPA 4UTUA 3EX6A 1A50A 2ABBA 4ALDA 4O18A 3R8RA 4IWWA 1S3HA 4JX6A 8TIMA 3O6DA 3BG5A 1I8JA 2GPTA 1KM4A 2VENA 4GFSA 1TV5A 1OX4B 1OK4A 3QMSA 1EP3A 1A5SA 2Y63A 2Y6ZA 4AH7A 1ZAJA 2CLOA 1YLVA 3G8RA 3C52A 5AYYA 4UTTC 3CHVA 3O07A 1W5PA 2I1OA 2B4GA 3FEMA 3PF3A 4Z1AA 2X16A 4O53A 3TC6A 3SSJA 1OFAA 2EKCA 1XUUA 4JYDA 3UY8A 1ZAHA 4QAIA 1RR2A 4H6KA 2CW6A 1ZALA 4DPPA 5C5YA 3K30A 3IIVA 3B05A 1OFEA 2E5DA 4GUIA 3NZ1A 4NNBA 2ISWA 1FQ0A 2XN0A 2JKAA 1B4KA 3IIPA 3E49A 1IXOA 3TMLA 4OWGA 5K4XA 5HULA 5HWNA 5EBUA 1TQXA 1OG0A 4DO5A 3NM3A 1A5AA 3FS2A 1M6JA 2ZA3A 2WOQA 1EB3A 3M47A 4ML9A 1GYNA 2E6YA 5FESA 4PL2A 1LOQA 3W74A 3S0CA 3W86A 5LHEA 2AGKA 3C8FA 4C1KA 1TREA 3GAYA 1THFD 1SUXA 3NAVA 1TB3A 5FEXA 4UFIA 3FIGA 1XM3A 3CEPA 3GAKA 4UTKA 3C56A 1TIMA 1YTDA 3OVQA 4JTHA 3OIXA 4Y90A 1OFRA 1G7VA 5AFDA 3RMJA 3G1FA 2QCCA 4L4MA 5HMSA 4JDBA 3SGUA 4H4IA 3BLIA 3LX9A 5I3FA 3QQ0A 2GQ9A 4HPXA 2WNQA 4UR8A 1IXNA 4ZVJA 4JTUA 4WX2A 4GUGA 1R2RA 1JULA 5AB3A 2GUUA 1H50A 4TMCA 1K7FA 1C9DA 1RQBA 1G7UA 4K38A 1LBFA 1JCLA 3NQMA 3USBA 3JRKA 3LHUA 3YPIA 4HHPA 3C6CA 4FNSA 4NNCA 1TPFA 5D2WA 5FF2A 2H8ZA 2FPYA 5HJLA 4UCGA 1YPFA 2QCDB 1WBJA 3CIWA 5LKYA 3M5YA 4LY8A 4M7TA 1SFLA 1LLZA 2CZDA 3ZS4A 4JS3A 3QMRA 3DXIA 1LOLA 3O1NA 2NXGA 1H7XA 1PIIA 1DQXA 4IGHA 3O8AA 3R89A 1VYRA 2CFFA 3I7SA 3P74A 4FNPA 5LNVA 4LW7A 1LYXA 1QPOA 2GQ8A 1VLIA 1XBVA 4LT9A 4LVBA 3E96A 1LDCA 2OT0A 4O57A 3STGA 3LRMA 3PB0A 4WOQA 2CWNA 4UTTA 3W7DA 1AK5A 4NQ1A 2GQAA 3GDMA 2TMDA 1OJXA 3BG9A 2VFFA 4G1KA 3VE9A 1PHQA 3W72A 3LCFA 3GXNA 2Z1BA 4I7UA 3TC7A 3OVPA 4YL2A 4W9TA 3N34A 3MWAA 3MHGA 1QAPA 1BEUA 4CCDA 1ZENA 1C8VA 1TTQA 5DXXA 1ME8A 3PBYA 1ICPA 3P60A 3DFPA 5LNSA 4EIVA 5CPNA 1M7PA 1FXQA 4AHPA 1H7OA 4JICA 3VNDA 4K8HA 3HPXA 3O6CA 3MI6A 3CM4A 2NUWA 1W3IA 3LCXA 2Y89A 3M5ZA 1JCJA 2ZA2A 5I3JA 4UTMA 2VXNA 3KX6A 3LHWA 1PE1A 2NLIA 1EEPA 2VKZG 3W7LA 3QPZA 3TNOA 2ZZ7A 4AHQA 3V75A 5EMUA 4JDYA 3T7VA 3LLDA 4PEKA 5A5WA 3TV8A 5C54A 4N6FA 1V5XA 5ABTA 2O7SA 5DBUA 5AHMA 4OT7A 4MYAA 3LDVA 4JY9A 4NZFA 4O11A 5FEPA 1QO2A 1F5ZA 4IUOA 4LVAA 4YCOA 3NQ2A 2ZTKA 4QQ3A 1XFBA 1QOQA 1HG3A 2O7QA 4O8RA 5HR6A 2ISVA 5TIMA 1FCBA 5DLCA 4LVGA 3QM3A 3HIJA 4UFLA 1CW2A 3DU0A 4M6VA 2VFGA 4JD4A 2C0AA 4QJ1A 3AO0A 5HUPA 5F2MA 4XBKA 1VH7A 4PODA 2CLIA 5J5RA 3CLMA 2H8XA 3S8HA 3TMQA 2ZA1A 1YYAA 1M5WA 3N9SA 1VCVA 5F4WA 3PB2A 4GBUA 1FWTA 1GEQA 4UIOA 1A5CA 4GWEA 2RKXA 1DKWA 4WJEA 3SGZA 4R34A 1XL9A 1O60A 1XCFA 4N6EA 1WXJA 4O28A 4U28A 1RV8A 1KFKA 4XWUA 3WJSA 4LNYA 3C61A 1JCXA 4O1AA 3LERA 4AWUA 2G95A 3C0JA 3LV5A 2OCZA 1H63A 3SI9A 4AEOA 3TFXA 3UWZA 3V1PA 4BF9A 1WA3A 4OQVA 1W3NA 3G8EA 4MLRA 5CSSA 3S5NA 5F1VA 4DBDA 4GE8A 3EXSA 3GXPA 1PS9A 1N7KA 1FWRA 2XFWA 4IMGA 1G4TA 3ATYA 3L0KA 3NQGA 1S5TA 1DOSA 3M5VA 4R33A 2X2GA 4GRSA 4FNQA 3AJXA 1SZFA 2XN1A 1LORA 3MI2A 1VPXA 4O50A 4RZ6A 2FPVA 4LVFA 3W1PA 1LTDA 3NQFA 2C14A 4ZQMA 4Z1BA 2DZSA 1X8FA 3DFSA 1Y0EA 4O17A 5AHIA 2WV8A 3LRKA 4TIMA 1F73A 1ZAIA 5AC6A 4QM1A 1WOBA 1JRCA 3CC1A 3FYPA 4XKYA 3M0ZA 2FJKA 4Q32A 1SW3A 5TBOA 1AL7A 2C3ZA 2X1UA 3LXCA 4RR4A 4NJHA 2Q8ZA 4E2BA 4DPQA 4LVDA 1HTIA 3PUEA 3PBWA 3HG4A 1GYLA 2CU0A 1Q45A 3TDFA 4AXKA 1W1ZA 2YYUA 3DKJA 1AL8A 5EPDA 1B4EA 2RDUA 1GVFA 3EWWA 3BARA 2CLFA 1QPRA 2QCMA 2OJPA 3DENA 3NPUA 1GTEA 4BI6A 1I2QA 5GVJA 3L65A 3QSTA 2ZYFA 4CNOA 2A6LA 2CLEA 4QSHA 5AYXA 3W1UA 3GX9A 5CZTA 1G67A 3A5VA 5E1QA 3NL2A 4ADTA 2FFCA 5D37A 1DQWA 3LB0A 4GUFA 1EUAA 1X7FA 2E68A 3QSRA 1TJRA 2YFOA 4NNAA 4HKPA 1G4SA 1GG1A 4JY8A 4UXDA 3PBVA 3L5AA 5DXYA 4AMAA 2OMAA 5EKYA 1W5MA 4A22A 3LOTA 3W7JA 3I68A 4POCA 3W70A 4LV9A 5D05A 4UTWA 4ICNA 1QPQA 3PSVA 4OV4A 5K2ZA 3S9YA 3N3MA 4MFEA 3NZRA 2CZEA 4ZQPA 3QW4B 2NX9A 3NQ6A 2TSYA 2E6DA 1SU5A 1VHNA 3UXAA 3ZWTA 1MXSA 3SIZA 4LWWA 4PFMA 1FDYA 2YCEA 2OZ0A 3ZR4A 2JKEA 4JTFA 4MYXA 6TIMA 1H7WA 1XBXA 3MP5A 4N02A 1JCMP 5K9XA 1G4EA 2V30A 3EXRA 5G1TA 4ZMGA 3STFA 1JJKA 3L68A 1KV5A 4A2SA 2RDWA 5HR7A 5KSWA 4IX0A 4KWVA 2B7NA 3R13A 4IQLA 3JS3A 1B57A 4O54A 2GVLA 4D2JA 1I4NA 2C15A 4FIQA 4ORMA 4CNPA 1LZOA 3W1RA 4JXCA 4O4WA 4QNEA 3TR2A 3Q94A 1QO5A 2V0TA 1GVRA 1YDOA 1K02A 1KM2A 2FDSA 1FY6A 3TAOA 4FO4A 4JYFA 5BNKA 4H3DA 2QDHA 3T78A 2QJHA 5IM51 3KVLA 1VR6A 3NGJA 4O16A 2Q8LA 3NPWA 1OFQA 3DI1A 4RCXA 3C2OA 3N2MA 4QNWA 2EAWA 3LCHA 3Q37A 1QWGA 5K9CA 5HINA 3NG3A 3ELFA 2EF9A 1OYAA 4ADSA 1UCWA 5K4ZA 3UZ5A 3EX1A 2C18A 1VCGA 2A7RA 2ALDA 1H61A 1Q6RA 1KFEA 2BZNA 2BWGA 5FF4A 3HPZA 4X9SA 1LRNA 4OU1A 3GR8A 4IXXA 5AOUA 2Y62A 3NOEA 2A85A 3TQVA 3BVJA 1PVNA 4BFAA 2QJGA 5D09A 2J9YA 4IJBA 2NXHA 1AW1A 3WFAA 3W9ZA 1SR9A 1FBAA 4MOZA 5CZJA 5EA9A 2IQTA 4Y9AA 4N2YA 4CLMA 3RLUA 1SPQA 3M1ZA 1G4PA 5D2TA 3T55A 2A2IA 1GJPA 2QCEA 1J5TA 4HIBA 2R8WA 2YFNA 3TJLA 4MFDA 4HN4A 5T26A 3KVMA 5KZMA 5F2IA 5FI8A 3STEA 4UMCA 3I6RA 3WJWA 3G1VA 5HUOA 3TQ0A 3ABOA 3W2MA 1DL3A 4XTIA 5DN1A 4TX9A 2Y7DA 3M44A 3CB8A 1RD5A 1YPIA 4FEZA 3DGRA 3PG9A 4WXYA 3W7QA 5A8GA 3LHTA 3Q58A 3P62A 1KM6A 3B04A 1W5QA 4S2BA 1FDJA 1UBSA 2V5LA 3TE9A 1E51A 1ALDA 4FX7A 3QPYA 3F4NA 3M6YA 4DF0A 3W3OA 3HG5A 4PC8A 1KBIA 3BK0A 3GDKA 2E1DA 1W8SA 1RVGA 4I9AA 3VE7A 1VYSX 4BR1A 1VJIA 2GVGA 4K6AA 1XC4A 2ZRUA 4CNNA 1YDNA 1JCYA 1W54A 3B8DA 1TPWA 3L5LA 1EP2A 1U83A 4JGDA 3P5YA 3C4UA 3E02A 3EXTA 3CWOX 4E2DA 1KV8A 2Q3OA 3W2UA 3C2RA 1L9WA 5DY2A 1O94A 3NQVA 2AQWA 3MBDA 2YYTA 2QDGA 1OFDA 4KWWA 1WAUA 3TUUA 1GT8A 1TRDA 2RHGA 4I7WA 4XBSA 3NO5A 3SY5A 3OVRA 4NXKA 2QJIA 3GYEA 4MJZA 1SQ7A 3T40A 3W2NA 3QFEA 2V81A 1HFBA 2E5CA 4NVTA 3U6WA 4HNUA 3TSMA 4ZL1A 5L9FA 4M7SA 2VC6A 2WSYA 4JR5A 3HB9A 3W85A 3BV4A 3HF3A 5U7SA 2UV8G 1KFBA 1U5JA 2Z0IA 3G1XA 1FUYA 3W07A 3S1VA 5HWMA 3UXDA 2PRMA 3CU2A 3KHJA 3L0NA 4XQ6A 4UTJA 5EYWA 1KM5A 2TRSA 1VHCA 1WDWA 1H7PA 5EY5A 3TCEA 5HNRA 1L6WA 4ADUA 4FB7A 1O5KA 3W7PA 3HMJG 5CKSA 1QMLA 2PC4A 3JR2A 1TPC1 1PHWA 3U2OA 1LRTA 1NF7A 4N9BA 3EWZA 4CQ9A 3GNNA 2QUUA 4CCEA 2X1SA 4OV9A 5LSMA 1ICQA 3LCLA 2OX1A 4K7YA 3MMTA 1UUMA 2NWRA 2Y70A 1NF0A 3MYOA 3IVSA 2X1TA 4N9CA 2HSAA 2RFGA 4KFNA 1N8FA 4FX6M 3QJAA 2E77A 4FHAA 3RFAA 1SZNA 2NZLA 3G0SA 3LTPA 2FTPA 3LTYA 2BLEA 5DBTA 3BG3A 3PUDA 1YXCA 3BW4A 3VCRA 5AC7A 3B06A 5H2ZA 3BGJA 4EWND 4UFJA 2R94A 3TXVA 4EOUA 1QPNA 1K3UA 4MZ8A 3UWQA 3GDTA 3G3DA 3LCIA 2ISSA 1F6PA 1XUZA 4S1FA 2WNNA 4OE7A 2ZDRA 4JEQA 4WXZA 2B7OA 3IV3A 1R2SA 3LCGA 3C2FA 4K39A 3NL5A 4K8EA 1R46A 3A22A 3N9RA 2ABAA 3KOFA 3MBFA 5CZ0A 1XDLA 4JTJA 3UQNA 5D2VA 5LGXA 3W23A 3NXFA 4O1DA 4P61A 3MUXA 3NQ7A 4LS2A 1UASA 5G4EA 3DAQA 2CZ5A 3S1UA 1P5BA 3LBMA 1XKYA 1HL2A 1YTKA 4M19A 3EWXA 3QF0A 3G24A 3WK1A 4LOCA 3IVUA 2X30A 3NM1A 3W1MA 1FDZA 1VYPX 4UTLA 3HGOA 4JTLA 4A29A 1EIXA 1KTCA 1L6YA 2WQPA 3FKKA 2H90A 1GWJA 1AG1O 3M41A 3MJYA 3PR2A 4WUIA 5FF3A 1KLYA 1TV7A 1SO3A 3IGXA 3TW7A 5C55A 3GLCA 1H5YA 3A24A 1TJPA 4TO8A 4AF0B 1TPB1 1JUBA 1SO4A 3FA5A 4OBTA 3O6YX 3I7QA 5DY3A 5CSRA 1TQJA 4A21A 4E38A 4UTHA 3G0XA 1JVNA 2DZTA 2ZZ2A 3HOJA 1VQTA 2BXVA 2J24A 2HMCA 3CPRA 2JK2A 3W7RA 2V2HA 5G2WA 4WY0B 2CLHA 4IX2A 2NUXA 2ZZ4A 1BKSA 1HO1A 5I3KA 2J88A 1XDMA 4BWLA 5C2XA 4DF2A 2A1YA 2PRHA 4U4MA 3IIXA 4NJIA 1FWSA 1JQXA 3SR7A 3P8JA 4JTKA 1A53A 2A0NA 4O12A 1EPXA 2ZRXA 4Y6GA 4FNRA 3QMTA 3RNDA 2WNZA 4O13A 4IMFA 1I2PA 2YZRA 3DFNA 2NV2A 3H53A 4X2RA 2CZFA 3HGJA 3KVJA 3U8GA 4O0KA 4LRTA 2W79A 3OEXA 1G69A 4UR7A 1XXXA 3P5ZA 3W1AA 1YTEA 2CLKA 4GUJA 3PULA 5TQLA 2J27A 2Z2UA 3DI0A 1OX5A 2VFHA 2PCQA 1MEIA 2PE4A 4RZ4A 3NYZA 4KFPA 3LM7A 1TPDA 1LBLA 2C19A 5FEZA 2FIQA 3NDOA 3B0VC 2NX1A 1KBJA 3TJXA 3OHIA 1FCUA 5KZEA 2ATSA 3TU9A 4NXSA 4C1LA 1O4UA 3HG2A 4HSNA 3W22A 3NA8A 3W1TA 5AHFA 2DP3A 1LRQA 3BW3A 4AWTA 1O5XA 3HJZA 3Q2DA 1DBTA 3GNDA 1H1YA 2BX7A 2DORA 1OYBA 4QITA 2DZWA 3W76A 1VRDA 4HSOA 4DBEA 4MVAA 3W84A 4YCPA 3TQKA 1SZEA 4YWIA 4RX0A 1FWNA 2V2CA 2J9XA 1MEHA 1GG0A 2ZRWA 3W83A 3DFQA 4TU1A 2A7PA 1K8XA 4BI7A 3CT7A 4PA8A 2V8ZA 1I45A 3L67A 4YLWA 2NX3A 2ZQ0A 4HPJA 3TSDA 3M16A 1W3TA 2YXGA 3ZWSA 3A21A 3GIYA 3LXBA 1UB3A 2VFEA 2XN2A 1W31A 5G2IA 1S5WA 4MUZA 1I2NA 4X3ZA 2I14A 2J9ZA 4HT3A 5CPOA 1DJQA 1OFBA 5LZLA 1ZCOA 5H91A 5G1YA 3O63A 3W7CA 1TTPA 1IXPA 1VLWA 4NX5A 1W5OA 1WOAA 3P7YA 4AB4A 1L6SA 3ATZA 4FNTA 3TROA 3O05A 3INPA 4N4QA 4IMDA 3MP3A 1R47A 4WD0A 5LNWA 2WSQA 4BI5A 2ZZ3A 1PL9A 3TW6A 4GJ1A 1OVDA 4X22A 5KINA 4RK8A 4ZZ9A 1M7OA 2P0OA 1BWKA 1IIHA 3E12A 5BW6A 1IIGA 3TX9A 3KVKA 3S1WA 1SO6A 4Z08A 1D3GA 5CZSA 5MHBA 3GK0A 3P84A 1O95A 5F2LA 1TSIA 5LNRA 1EA0A 1V7YA 4NJJA 4K7VA 2GJLA 3LTSA
chains in the Genus database with same CATH superfamily
3AYTA 4RZBA 3WYZA 4FNUA 1JDDA 1UPMB 3LG3A 1UJQA 3M9YA 1RY0A 1E9ZB 3C86A 3KAOA 4J3SA 3GH4A 3CTTA 2DSVA 1U1HA 4ATDA 3ABSA 2XUCA 3NL6A 3HPSA 3QQWA 3SZ8A 1XYBA 4I7VA 1VPQA 4D6FA 2EPNA 3RU6A 5C9RA 1F4AA 2HK1A 5U4NA 3GKFA 1TIWA 3KE0A 1EIBA 3WH6A 2V3EA 3QQ1A 3VC6A 3H55A 1OZMA 5D03A 1RPKA 1KLZA 4MY8A 3WLSA 1NP2A 4MY9A 2J4GA 1FCQA 2J7EA 1D8CA 1A5LC 4NAFA 5F4SA 2F61A 5CBIA 4AVFA 2V9DA 1ESWA 4GH1A 2QR6A 2QCNA 3G1YA 3HG3A 3NGFA 4CUCA 1ME7A 1W32A 3VZYA 1OIFA 4MKSA 3UWVA 3ABRA 2X42A 1LJYA 3WQPA 1JGMA 2Z6IA 1K8ZA 1H7RA 4LF1A 5D32A 4HBKA 2ZXDA 1DJNA 4JKKA 4J4KA 5FSEC 4HZ7A 1UQZA 1HT6A 2IPGA 1OCNA 3P2VA 4FIRA 3WNOA 4AC1X 5CJ5A 1WKYA 1VBRA 4KETA 1F2JA 1CBGA 3HV9A 1QOXA 1OCQA 3OG3A 4G7EA 5HMDA 2GJPA 1Y5WA 1LP6A 3GXFA 1XCWA 2OTDA 2X09A 1Q8AA 1TJ0A 1WQ5A 5I77A 1Q2SA 3EEGA 3MUIA 3ZT7A 4AU0A 2VRQA 2XDFA 4C6DA 1JDEA 1MSSA 4CN6A 3A9IA 4FP1A 3B8IA 1C29A 3LV6A 3ZSSA 1VGAA 1G94A 4DZIA 3VI2A 3UNTA 2DU2A 2VNCA 3B9DA 1EPVA 2PGFA 1VS1A 2YDSA 1BGAA 3TYUA 1T41A 4OECA 3FN9A 4KFOA 1PZ3A 4LUIA 3NWRA 5LIWX 4PEEA 4HA3A 2RAGA 1TRIA 3E9AA 2J77A 2PU1A 1OGBA 3CUHA 1PUDA 5AHLA 1EZ2A 1RZMA 4PL1A 3K13A 5IFTA 1SFJA 1J93A 4CCZA 1MW3A 1Z44A 1GJWA 4CQBA 1O1HA 3EMCA 3WENA 3VC5A 3WDHA 3WLHA 1D9EA 4DWSB 1O1ZA 2A6NA 1GVOA 4XZIA 3TIMA 3GU1A 2HEJA 3QR0A 3NSMA 4L5ZA 1SJCA 2DJLA 4F0HA 3L5MA 2DIJA 4Z2KA 4R7OA 3AXXA 3WIJA 1E43A 1VBUA 1ITCA 3DKLA 1ZU8A 3THAA 2WNWA 1KGWA 3L21A 1AQMA 1P4CA 3QRHA 3OZMA 1R2TA 3ZOAA 4W88A 5J8LA 5XINA 5IDIA 1TTJA 5CPLA 4F66A 2OKTA 1H3GA 3WK2A 2OWCA 4MZYA 4WJXA 3I65A 2OEMA 1OF6A 3L9CA 3JW7A 3EMZA 3U4FA 1HVXA 1AD4A 5DX7A 1BSIA 5C9ZA 1ZUAX 2AQOA 3H54A 1XQKA 3DGBA 2A5HA 1Z41A 4JZ5A 1IEVA 2DW7A 2O9PA 1WCGA 2P10A 3T4CA 1EHAA 4GQBA 2HS8A 4AC7C 2AMGA 2QV4A 2JKPA 1K8YA 4AX7A 3SJ3A 3LGEA 3DBPA 1JNEA 4KH2A 4ZQRA 1JQVA 4XUYA 3GZ3A 4UTIA 2P3EA 1W91A 1UZ4A 5I3IA 3A4AA 2YL6A 1IT0A 4LC8A 3LHVA 4GYPA 4NJKA 4ASTA 1TYGA 7REQB 2V82A 1GOQA 3VDBA 3ANVA 3W88A 4GUHA 2QS8A 1R7AA 1UUOA 4IOTA 3NQEA 1KTNA 4JQ2A 5J5DA 1RPXA 3GDLA 4E8DA 3U2EA 3R94A 1DE5A 1W0MA 3B03A 3PZNA 2FZNA 4UMBA 2OO6A 1ZS2A 2Y7FA 1LWIA 1JG9A 1CX9A 1QBAA 3WEMA 1V02A 2X1RA 3W7EA 1W1YA 4IPLA 1EGZA 3GG1A 4UUIA 1LF1A 2P76A 1EBGA 4JIPA 3NQDA 3CHEA 2DT2A 3QR3A 4LU0A 4G5DA 1ECQA 1ZZMA 1EP1A 3IJIA 2PDXA 4CVWA 2OG9A 4BEUA 1RQEA 3A23A 2IKHA 2QMKA 3O7UA 4J3WA 5IOBA 2V5JA 2VFIA 4WLCA 3LPOA 1RK5A 1FFRA 3WFZA 4L9YA 1H62A 2H3BA 2WVSA 1F6KA 3QH2A 1M68A 4DVOA 3NOYA 4GYPC 1X6NA 1XLEA 2G96A 4E5TA 4B5NA 3ARQA 2GGGA 2OZ3A 1M7JA 1ZNNA 2FB2A 3WMSA 3TNBA 4N9EA 2DVUA 4QX4A 1J10A 2YSWA 2AL2A 2FTWA 3LN3A 2J6XA 4ZFMA 4GNJA 1J6PA 3W1XA 4QISA 3PC0A 2Z27A 4YHGA 4NKCA 3K2GA 3N13A 4AX6A 1EUNA 4WDWA 2AAAA 3WDPP 1FH7A 5EFFA 5DCDA 2WBKA 1OZQA 4D71A 1EJWC 3GTIA 1BG4A 1XGZA 3UJSA 2PBGA 2YCJA 5AKQA 4NU7A 2VOMA 4F79A 4LCQA 4JNYA 1SMDA 3FJLA 5ABFA 4GMEA 1DYSA 3QV9A 2YGYA 1E0VA 2V3DA 5JIPA 1TO3A 4MWAE 3P61A 1DV7A 1WYIA 4W8LA 2YBUA 1UJPA 3MKKA 2XFFA 1P1MA 4UC5A 3L66A 1UR3M 1IGSA 1HO4A 4JFUA 4G8TA 4Z1DA 1YKWA 4WGXA 1KM3A 5CG7A 1HJUA 2YR1A 4DYJA 1V3HA 4HOXA 1FWWA 1OX6A 4GXWA 3TTQA 1K9FA 2G97A 3WFLA 4E3TA 4HNVA 4UFKA 3RF9A 3QC3A 3OLDA 4Z2JA 3H2NA 1XPGA 3S6DA 4WHBA 1E73M 3WLJA 4AF0A 3WF2A 3ARWA 2TYSA 1VPYA 3GNRA 3T44A 3T4WA 1MFUA 3HPFA 3R8HA 3W2LA 1X6UA 3S5OA 4JOMA 4NUWA 4L1WA 3EWYA 1JXJA 3HM7A 1XS2A 4CD4A 2VEIA 3A4JA 4Y8FA 2LLEA 2VC9A 2QCFA 2FH8A 4HU0A 4MJMA 2MNRA 1Q3NA 3E2SA 4NAEB 8A3HA 3MSYA 1S5MA 2VR2A 3VOIA 1KWKA 2W27A 2QUVA 1EL3A 2PF8A 4EKJA 1X7IA 1RLDA 2V3FA 3M64A 3P67A 4AHOA 1CXKA 4D6IA 2PODA 4Q4PA 1FWGC 1AW2A 4S23A 2WC4A 3BCFA 5CPTA 1HGWA 3K5XA 1U33A 4CQ8A 5E9AA 4QEHA 3BTNA 5F2GA 2EGZA 1UR9A 4TMBA 4NT0A 3CQHA 4KEVA 1QNOA 1B9ZA 3W71A 1M53A 3KTXA 5ABEA 1ONWA 4WKAA 1GVSA 1SSGA 1SSDA 4UFMA 1S2WA 4R5EA 5BOOA 2D1ZA 4UWMA 3WF1A 4O4VA 2IKIA 2OGYA 5GJNA 4FX8A 2WKJA 2NWSA 1PV8A 4XVEA 3CJPA 3ARUA 1L2UA 3ZJ8A 2VZOA 5JH1A 3A5FA 2PDCA 1UKQA 5IDZA 3TKFA 5HWJA 1E3XA 4LV4A 1C3FA 3QYQA 2WVTA 4BQ2A 3VKJA 3KBMA 4JX5A 4GVHA 3EA2A 3G2GA 3CLWA 4UNLA 1PDZA 4ALDA 1FWEC 4M6UA 4YU1A 4NP7A 1AZ2A 4N0RA 8TIMA 5HXMA 4JEJA 3O6DA 3EA1A 3FDKA 4C6KA 4J3TA 1OK4A 2BFGA 1CWYA 1NQKA 1CPUA 1EP3A 1A5SA 4XIMA 3CZKA 4HNCA 4CD5A 2Y6ZA 3WY1A 1WKFA 2CLOA 2FVKA 5AYYA 1GQIA 2XFRA 3CHVA 3O07A 3UG8A 2XH0A 4Q6JA 3VU2A 1Z8AA 3LEPA 4Q4MA 2CWXA 3VA8A 4D1JA 3L2LA 1LUCA 4JYDA 3VGBA 2H9AA 3UY8A 4QAIA 1RR2A 4D6GA 1GYMA 2PLJA 3E3HA 3W6LA 3IIVA 4GBDA 3ITXA 1Z7AA 3GG7A 6CGTA 2VZVA 4C7GA 2FZ9A 3TMLA 1KGXA 4OWGA 3GRIA 5HULA 4EACA 4O1EA 3F2DA 4DO5A 1A5AA 4WEVX 4YYCA 3MUAA 1RJRA 1UZHA 2GDQA 4MB3A 1X38A 4PMOA 3S0CA 3GAYA 4GO9A 1UA3A 2GUYA 4S3KA 1UP3A 3KCOA 3WSUA 3CEPA 3GAKA 2C1IA 4UTKA 1WDSA 4C6NA 3DC0A 4NYYA 4H9VA 3OVQA 4JTHA 2REQA 1OFRA 4Y90A 1G7VA 1S46A 1H0GA 3FY1A 2ALRA 4JDBA 3RO6A 3LX9A 1HJXA 3NVDA 2ZUSA 5AECA 4IQJA 3EBVA 4P5UA 4JTUA 5D8ZA 4GUGA 1R2RA 1JULA 1QHZA 1P7TA 3B8UA 1HQTA 4HJFA 2OSWA 3DFHA 1RQBA 4K38A 4EPEC 3NQMA 3JRKA 3TW9A 5D2WA 2IMRA 3RX2A 2FPYA 1YPFA 1FTXA 3LNPA 3CIWA 4LY8A 9XIMA 4L61A 1RCOB 1LLZA 4UQEA 3ZS4A 3COTA 1TVLA 1RSCA 2NXGA 3T6CA 1CGXA 2PTWA 4U33A 7A3HA 2DVXA 4BA0A 2O56A 1QPOA 4PUKA 1XBVA 4B91A 1LDCA 2FGLA 4BEQA 3PB0A 4S3BA 1VFSA 2WVVA 1MZRA 4DZHA 4IICA 1R5YA 2UY3A 1OJXA 2KAUC 3IUIA 5DQPA 4QFUA 3LCFA 2EG7A 3S4TA 2Z1BA 4FSAA 1W9PA 1FKWA 4HZ8A 3G6MA 3WLNA 1QAPA 2ZUVA 1ZENA 1NP0A 1SJAA 4EIVA 3EAUA 1G0CA 1OC6A 2FTYA 1E6NA 3QGAC 3MI6A 1CDGA 3CM4A 1U2YA 3ZMRA 3WD4A 3PWGA 4LYRA 3BOXA 3W7LA 4FLQA 4AHQA 3TR9A 4KEZA 3T7VA 3V18A 1A5KC 4XIAA 1QW7A 2FGZA 3FGCB 1V5XA 3RR4A 4JFWA 4M81A 4OOZA 5DBUA 1ISYA 4OT7A 3A12A 4AYGA 3APGA 3UCQA 3E2RA 5CH9A 4L6OA 2E7FA 2OEKA 4QQ3A 3LMYA 2O7QA 4U2ZA 1JFHA 5TIMA 1FCBA 2E8ZA 3ARZA 5DLCA 2OX4A 1RBLA 4GQRA 2HV5A 4LXFA 2PWDA 2C0AA 4QJ1A 3AO0A 2ZX5A 3R58A 5HUPA 1IEQA 1I0DA 3B9AA 2XPKA 1QWKA 3PFRA 3S8HA 1TR1A 4HCLA 1IEWA 1ISVA 1GEQA 1OD8A 3H21A 4W7WA 4E2VA 2ANUA 2D23A 1XLGA 3LQLA 2B81A 1TX0A 3EOOA 4F8XA 4DYEA 1O60A 1L8NA 4U28A 1RV8A 1KFKA 4XWUA 2NT0A 4LNYA 1AQ0A 3C61A 1JCXA 2V6AA 3DIPA 4O1AA 3C0JA 3W29A 5I09A 5CPSA 2IPFA 4C6MA 4HA0A 3SI9A 2WM1A 1TG7A 1FH8A 3IUHA 1CGUA 1PTDA 3VO0A 3CV1A 1KNWA 4MLRA 5CSSA 4DBDA 4GE8A 2WHMA 1DOSA 4DX3A 3M5VA 1BYAA 2CHNA 4GRSA 4FNQA 3AJXA 4G56A 2PMQA 2XN1A 2QW5A 2Q02A 2PC8A 4RZ6A 2FPVA 3W1PA 1LTDA 1BPLB 3AQUA 4QSFA 4GHRA 2ICSA 2DZSA 3EEZA 4GACA 1MUMA 3AUJA 2W91A 5AHIA 1ZAIA 2QHAA 4TX8A 1OY0A 1JRCA 3EB3A 4XO7A 3CC1A 3FYPA 4XKYA 3M0ZA 4Q4SA 1XSKA 5TBOA 3MV11 1WDRA 9RUBA 2C3ZA 1PSCA 4E2BA 1E40A 2HPIA 3PZTA 4G2DA 2HQAA 4LUTA 3PUEA 3PBWA 3TJIA 3B8TA 4JNZA 1WDQA 4RUBA 2YYUA 1E9YB 3LQGA 3DKJA 4EWJA 2DZBA 1NDYA 1B4EA 2RDUA 1GVFA 3BARA 3WUBA 1QPRA 2QCMA 3BUVA 4X60A 2CHRA 1W1VA 3DENA 2R1LA 1GTEA 5GVJA 3L65A 2ZYFA 1HKMA 4ZTYA 4CNOA 3W1UA 4U3AA 4HPNA 1GNXA 2VYOA 3A5VA 3GC4A 1ADSA 5E1QA 1B3ZA 1DQWA 3FA4A 4RNIA 4GUFA 2PSNA 1TJRA 1DTNA 1OADA 4LAMA 1G4SA 3SUSA 1GG1A 3VMOA 4EE9A 1KD0A 5DXYA 3BLPX 1FKXA 3PZIA 4Q7NA 3V16A 2HJPA 1H09A 4JKLA 3W70A 3MUCA 3PSVA 4OV4A 4MFEA 3NQ6A 1SU5A 2XIJA 4LNCA 3EOLA 2OZ0A 4ZCWA 2GGIA 2WHJA 4MYXA 3ANUA 1DWGM 3MP5A 3AMLA 3HA1A 4AW7A 5G1TA 1KV5A 4U5IA 2J47A 4A2SA 4ZB0A 2R1NA 4IX0A 3R13A 2QNEA 3FHQA 2UWFA 4FALA 4D2JA 2C15A 4UOQA 2MANA 4CNPA 4DHGA 4IP7A 3F2CA 5D9PA 5FJIA 1JFXA 4KCTA 1KM2A 2FDSA 1FY6A 4S3GA 3V5CA 1KXQA 4FO4A 4PCNA 4JYFA 2QJHA 2R9RA 5IM51 3PPFA 3NGJA 2E9LA 4PR4A 4GABA 2VP8A 3SM0A 3ZR5A 1OFQA 4MB5A 3CUFA 4IFOA 4RCXA 2VOTA 3C2OA 2GL5A 4QNWA 5K9CA 3Q37A 3NG3A 3EPOA 1B54A 9XIAA 3RX3A 1OYAA 1Y8BA 4ADSA 1UCWA 1C90A 4GVFA 3WF0A 1HP5A 2GDUA 3QGVA 1H61A 2BZNA 1RJQA 1UD8A 1LRNA 3GR8A 3KCJA 2A85A 3BVJA 2Y4SA 4H6EA 4DUVA 1WUFA 4C7FA 1YHTA 5D09A 3M7SA 4JFSA 1TX2A 1SR9A 3CMFA 2IQTA 1J96A 1CECA 3RAOA 5G1MA 3MVIA 2CEQA 2HVOA 8XIMA 1GJPA 5AVNA 2QDEA 1BD0A 1J5TA 3MDWA 2R8WA 5T26A 3H2OA 5F2IA 1UR4A 4PMZA 3STEA 4UMCA 3M0HA 4KIRA 1BXNA 3L7RA 3W2MA 4HHLA 3VOJA 4QJ4B 3ITTA 3RM4A 2YA0A 3BLLA 3W01A 3CB8A 1BLIA 4TV5A 3ZVIA 1XX1A 3DGRA 3WKZA 3W6MA 4WXYA 3W7QA 2G3MA 1VFTA 2QUNA 4L9XA 1FDJA 1UBSA 2V5LA 4FX7A 4ROPA 3GS6A 3AHZA 3W3OA 1EFZA 2DUZA 4QHRA 3ZJKA 3GDKA 1VJIA 4GQQA 1WUEA 3MZ2A 1W17A 2ZRUA 3RN6A 1YDNA 2VWTA 3ME3A 1TPWA 4IT1A 3L5LA 4ZOBA 3FW6A 2GOKA 2Z7KA 3OA5A 3UYIA 4AZHA 1PXGA 3GXMA 3WBAA 4QE4A 4C5ZA 2Q3OA 3CO8A 3UR2A 2OU4A 4REQA 2P8BA 2QDGA 1OFDA 1ZCCA 3OZPA 2BG5A 3GH7A 3TUUA 1TRDA 2RHGA 4I7WA 4XBSA 3RGTA 2QJIA 2NT1A 1HFBA 2E5CA 4NVTA 4HNUA 3PPHA 3GHTA 2QJJA 4JR5A 5BU6A 3CV6A 1F61A 4H9XA 5U7SA 3WDQA 2UV8G 3H24A 4E4FA 5AZ0A 1FUYA 3W07A 5HWMA 3UXDA 3KHJA 3UETA 4K1WA 4UTJA 4UZUA 2TRSA 1VHCA 1QPKA 2DGAA 5EY5A 1RA5A 4I5RA 5HNRA 3UR5A 4FB7A 1D3CA 2ZUTA 1CCWB 3R43A 3JR2A 3U2OA 1LRTA 1NF7A 5I24A 2X1SA 3LCLA 2QJNA 4Q4RA 1GK8A 2J7CA 3E5BA 1M3UA 4XAGA 4IIBA 2ZKMX 4AIEA 2IS7A 1TMLA 1E4NA 1N8FA 4FX6M 1Z3NA 3TQPA 3NIYA 3QJAA 4CN4A 4GJIA 3GUGA 4FHAA 2VM8A 2NZLA 3G0SA 3LTPA 5LXXA 1V6TA 3GBEA 1K6AA 4G7FA 1YXCA 3BW4A 3VCRA 5AC7A 5HNNA 5H2ZA 5JUVA 4PUUA 3SFWA 3E6EA 5HOSA 3AWOA 5B7ZA 4XZMX 4ZFCA 3UA4A 3WZ0E 2A3AA 4ERIA 3T8QA 1JYWA 2ISSA 1NOWA 4OE7A 4WSHA 3RYSA 3GVWA 1ZB5A 5REQB 3IV3A 1R2SA 3JU2A 3LK6A 4LPCA 3LCGA 2V38A 4D8LA 3NDZA 3A22A 3M0MA 2AL1A 3URNA 3H6OA 3VNMA 2XWEA 2WLYA 1FHLA 4P61A 3AISA 1XIEA 3NQ7A 3DAQA 4XV0A 5H6HA 3ISIX 5EFDA 3U48A 1L8PA 3SN0A 1Q63A 4MB4A 1V77A 3TP4A 4CN1A 1ODUA 4FF5A 3IVUA 2J8TA 3GNOA 3W1MA 1K4GA 1VJSA 4JTLA 3BLDA 1KTCA 4OVXA 1L6YA 3FKKA 2PZ0A 1J2BA 4DJFC 1P0BA 5FF3A 3TW7A 2VVSA 5BRQA 5C55A 1OSEA 1FWJC 3PTDA 1P43A 3FA5A 4L1GA 2ZX9A 3I7QA 4P8VA 4Q8OA 4GCAA 3IARA 3U5UA 3AXIA 1VJZA 1VQTA 2BXVA 3ZJ6A 4IGSA 3W7RA 2V2HA 5G2WA 1MUCA 2Z2BA 4ZOAA 4IX2A 1CZ1A 4YVVA 3EKGA 1Q6GA 2ZZ4A 3FV9A 2J88A 3AIQA 2WMGA 4BWLA 2PRHA 4KWOA 4NJIA 5I00A 3LMZA 2GGEA 2GJRA 3DUGA 4JTKA 2XHYA 3GFYA 5CCZA 1J5SA 4IMFA 2YZRA 2NV2A 3H53A 4X2RA 1J0YA 5C9XA 1G69A 1H49A 3BSHA 3USZA 1XLKA 1XXXA 1HF6A 5DFAA 4UBPC 5A69A 1W9UA 4GUJA 3PULA 4AIBA 3FEQA 4S3FA 1UKSA 2EO7A 3NYZA 1GOIA 3CAWA 3TLQA 3U9IA 3BCJA 2F2KA 2NX1A 3TJXA 1HL9A 3OHIA 2QT3A 1B0IA 3TWAA 2CXEA 3TU9A 4WIWA 2QVNA 8CGTA 2VX7A 5I23A 3N29A 2DP3A 3T9PA 3BW3A 4LALA 4HU4A 3BMVA 4H19A 4LAZA 4HA4A 4QITA 4FPSA 2Z1WA 4KWUA 4DBEA 4MVAA 3W84A 1E1EA 1JIBA 2J62A 3REQB 4RX0A 2J9XA 2PP0A 3H4GA 1GG0A 2ZRWA 4PMRA 3W83A 4YTQA 1LWHA 3DFQA 2BVWA 3KBVA 3LS9A 4IFKA 3W53A 2AGTA 4HPJA 1J0HA 3KWSA 2DIEA 1E6XM 2I56A 3VCNA 2PP3A 5CEWA 5EGRA 3A21A 3P0WA 5CZKA 4D6JA 4FMVA 1F3WA 4GVIA 1W1PA 3WQOA 5KEZA 5CPOA 1DJQA 4GC3A 4DWDA 4KRTA 5H91A 3O63A 5I5RA 1ZJHA 4RE4A 1VLWA 1BF2A 4NX5A 4AB4A 3P7YA 3ATZA 3INPA 1CGWA 2VC7A 4XKMA 4R9XA 3QKEA 3TW6A 4LY4A 2J7FA 5AC5A 4BF5A 4GO8A 1BWKA 1IIGA 3KVKA 3AS2A 3S1WA 4GX8A 1J9YA 3AALA 1S3TC 1WDDA 5MHBA 1GGOA 1DHKA 3GK0A 3P84A 3GTNA 5LNRA 1EA0A 1E6SM 2YLLA 3NO1A 1V7YA 1HKJA 1UZDA 1TTIA 4Y96A 1UP0A 2WANA 4IP4A 4V28A 3MUZ1 3KRSA 5AN7A 4NJGA 4PCFA 3P81A 3VABA 4AZBA 4O10A 1GKPA 3UERA 4Z0SA 3WUFA 5BYWA 3IEBA 3MA8A 1TV8A 3EKZA 3W7OA 3AU2A 4WJ8A 1UKOA 3KTCA 4Z1CA 5GQBA 3UESA 2XSXA 3UJ2A 3N4FA 4QIUA 3LXAA 2VUYA 2VCBA 3EWUA 1EJVC 4KPLA 3ZFHA 4XZHA 3UJFA 2V2DA 3PAJA 4EPBC 1NSJA 2FB3A 5D02A 5D2XA 1P0KA 2VX6A 5D2YA 4LSBA 3MUY1 4C91A 3M7WA 4M6QA 3LNMA 1QASA 3AS0A 1H0IA 2DFAA 5KZ6A 3UBPC 4TVDA 1VFUA 1F8IA 1XIMA 2EPKX 1WXZA 2DJXA 3O06A 1IZJA 3I7RA 2FFIA 1CENA 4QG6A 4AD3A 3CAQA 2ADAA 5G4WA 4TV6A 2JGYA 1HUVA 1KFJA 3IV8A 4QEEA 2E09A 1NEYA 3TTYA 2FJUB 5HDRA 3CPUA 1SW7A 3TSBA 4LB4A 1D7KA 1TZ9A 3QZEA 2FKPA 2QKFA 4FXFA 3MYPA 4NASA 4UQDA 3R4IA 3BLFA 4TUFA 1SZGA 3ONCA 3ES7A 4H41A 3GXTA 2QGHA 4UOZA 5D9NA 1WV2A 4MPQA 1W6TA 4IMEA 1OT1A 1TVNA 4J27A 4Q33A 5FAGA 4WF7A 3SBFA 3SQLA 2Z6JA 5CPMA 2NV1A 3G3MA 3UPWA 1JDFA 1XIDA 3NUKA 3C0LA 4M0XA 4JN7A 2WSRA 1HN1A 2XGZA 3H2CA 5ABHA 1S5VA 2GDVA 4DBSA 3N3TA 1ML1A 3TOYA 3VKBA 3SRFA 2PB1A 2BVTA 1M65A 2VT0A 3GU9A 2UZ9A 4MADA 3MW7A 4ERGA 4HPHA 2Q8XA 1GQLA 4IMAA 3TTOA 2P3ZA 3PWAA 3STPA 5I3GA 5KMYA 1EC8A 3MS8A 5BRBA 4NYUA 3SRDA 4LC6A 1FOBA 3OGSA 1M9HA 1KM1A 1WKEA 1EX5A 3UU0A 1XBYA 1UW9A 2A7NA 1KM0A 5B80A 2WBGA 3HGRA 4DWSD 3L4ZA 1IXQA 4ONVA 1W9BM 4X63A 4US6A 4RXFA 3RLGA 2J7HA 3QY7A 1P1XA 4B9YA 3VKCA 2EHHA 3W81A 2ODOA 2PDKA 4YTTA 4NZ1A 4DWSC 5E0FA 3LBCA 4PMYA 2Y8VA 2VGBA 5BWFA 1JPHA 1H7NA 3H2MA 1Q7MA 3NCOA 2GFTA 3BXWA 3PVFA 5CXPA 1LUCB 5ABFB 4IPIA 3OZOA 2B7PA 4H1ZA 4IIEA 1W1B1 2VELA 3WQ6A 3VDAA 3P82A 3EYPA 1ICSA 2Y88A 3J7HA 2BMBA 4OBSA 4CCCA 1K7EA 1XLDA 3H2AA 3SO7A 4JIRA 4KRZA 1W8GA 2YB1A 2NVCA 3UF9A 4F0LA 4AEFA 4HNLA 1R8LA 3U0HA 3ARTA 1P6BA 3EOUA 3A47A 5E0KA 2NUYA 5BWAA 2HS6A 3NQ8A 3TZFA 1F05A 2CCRA 2PWGA 1BAGA 4NI8A 2GJNA 4MWAA 2D73A 2C1HA 2C13A 3FOKA 3AS1A 4AZ6A 3WUGA 4CEXC 2CBVA 4FF7A 1BWVA 2JGQA 3PSWA 4Q3MA 4XK2A 5KITA 2PPGA 4AD2A 2HVNA 3CZEA 1ZJBA 4L7ZA 3S5ZA 1HJWA 3E0VA 1E1FA 5AY7A 3W7HA 4NHVA 3WQVA 5FEWA 3IJ9A 4MM1A 4I5XA 4RXGA 5D30A 3LCWA 3CBWA 1V6YA 2Y8KA 3PBUA 3V7PA 3GHRA 4YWSA 4K8GA 4W89A 3PG8A 1DVJA 4WSJA 1F8MA 1E55A 4MMWA 2JBMA 3N2BA 2YDRA 4MTVA 2IPJA 3BJFA 2V63A 4PMQA 2D3LA 2Y7EA 2G50A 5CLWA 3S83A 3F4WA 3WH8A 2XH2A 1BVZA 6TAAA 2G37A 1KFWA 1H51A 5FJOA 3EMQA 2DZPA 2E6AA 4WRHA 4MIMA 4ZE5A 2JIWA 3MCNA 2VDGA 3DG3A 1JAEA 3ICJA 2ZXQA 3VOFA 1JRBA 2QIIA 2RJGA 1POKA 3IAQA 1WX0A 3EB2A 5FACA 1TA3A 2YB4A 1UIOA 1TKKA 3DFTA 3G1DA 3THQA 2PRLA 2VZSA 1ITUA 3DHFA 3STCA 5HJXA 3VIJA 3EA3A 1UYQA 2B7QA 2VDIA 3UZWA 4RV8A 5IRPA 1A3WA 3WLPA 1DIEA 4GZIA 2J74A 2GJXA 3W24A 3GG8A 3G1SA 3GVGA 2HVMA 1GOXA 1H60A 3RX4A 3TA6A 1OGGA 2DZVA 2HTMA 3RDKA 1WPCA 3SUWA 3WQGA 1QOPA 3LI0A 3SN1A 4ILSA 2NQ5A 3FNDA 1Z89A 3H26A 4BQ3A 4PMVA 5SWUA 5JMUA 5HANA 1PKNA 4CQCA 3DZ1A 3T0TA 4JTSA 4O15A 1SFTA 4K36A 2WLZA 1D3HA 4O1BA 3UZZA 4XAPA 4ZSTA 2DQXA 4GGBA 4J5NA 3W7GA 4XO6A 4PTMA 3W2JA 1OF8A 2REQB 1DHPA 3LM3A 2X0YA 3AC0A 4K37A 2WC7A 2HROA 3LZ5A 3QVQA 4U31A 2VRKA 3LI1A 3E0FA 2WMHA 1TWWA 3WJYA 4KCWA 1IQ8A 1ZP3A 1E9LA 3WL0A 1K7XA 2QCGA 3Q4DA 1W37A 1PZ0A 4TTGA 2QUTA 4I9JA 1XSJA 1Q65A 5HATA 3VUPA 4E0CA 4IGMA 3UYCA 1CIUA 5LGZA 1XGDA 4DO4A 3GKAA 3FVDA 4UFHA 1PEZA 3BQ5A 1F74A 1JGIA 4JL2A 4NZJA 3BO9A 4AZCB 1OBAA 5EL1A 1ZLPA 3WCZA 2CERA 1YXYA 3GO2A 5BMXA 4XZ9A 2QDDA 3MHUA 2C71A 3TH6A 5GPRA 1TVPA 3N2TA 3QOMA 3VKKA 1XFCA 4UTFA 3QKZA 2EJAA 2WZIA 3SN4A 3MKCA 4JBRA 1GOWA 1GQJA 1TPUA 4WQ6A 4RKAA 1UH2A 2E9MA 3SSZA 3C3NA 1YW1A 1JCNA 5EMKA 3MO4A 4P7RA 1U1JA 3AMGA 4RDYA 5RUBA 2HPMA 2ZFAA 4R7JA 1X6LA 3H2FA 1R3YA 1CXFA 1ZQ5A 3RRAA 3B97A 3V1HA 2PBOA 3VIFA 5T8GA 1VFHA 5DRIA 4J40A 3TN5A 1GORA 5LXEA 4QAWA 1QNVA 1O7AA 4JTEA 1F9CA 1W9VA 1JUKA 1XICA 1M1BA 2I16A 2X0HA 2HZGA 3MHFA 2GWGA 1IF2A 1ELSA 2YW3A 3GHUA 5LIXX 3KXQA 2CBUA 1J0IA 3VFCA 1TUFA 1Y65A 2WSPA 2J25A 2WMFA 2HNEA 4M8UA 5AC8A 4DUOA 2W66A 3JUGA 1NELA 2BV9A 1TR9A 2P53A 3SGGA 3G0UA 1LM1A 1AMYA 3BLEA 3SCVA 3M0JA 4HK5A 4A6GA 4DB7A 4MNKA 3CB3A 1BKHA 2XIBA 3EX6A 2ABBA 4UQ9A 2POZA 3R8RA 1KB3A 3ALFA 2I17A 4JX6A 1OWQA 2PDIA 2V67A 3OGRA 4HOZA 2GPTA 2VGIA 4GFSA 5DT5A 5A3HA 2AQVA 5M03A 1YQ2A 4AH7A 1ZAJA 2G0WA 2X41A 2YIHA 3OYXA 4UTTC 1W5PA 3ALGA 3U5YA 2I1OA 2B4GA 1UWQA 2X16A 1MRAA 4O53A 3QOKA 2X1IA 3H7VA 3MANA 1XH1A 4RNJA 3OLEA 5M5DA 2E25A 1W1A1 1EDQA 3VDCA 2XINA 3K30A 1OFEA 1VRXA 1KQYA 3NZ1A 4ZODA 3KL5A 4HPGA 3E49A 1PBGA 1XYFA 3XINA 4AZ7A 4JQ3A 2VZUA 3DECA 3FS2A 4GFIA 1OC7A 1QW8A 5BXSA 1R3RA 2WOQA 5DMMA 3WH9A 3M47A 2GJXB 1DWHM 3D3AA 3WNLA 3OPSA 2ASHA 1GW9A 4PL2A 1KC7A 3PPGA 1NY1A 5LHEA 2AGKA 3C8FA 4C1KA 1I75A 1THFD 1RBAA 4YYFA 1P0EA 5A6BD 3WLMA 4PRRA 1ZBWA 5HNTA 4LJ3A 1TE1A 3PTMA 3UR8A 1HGYA 5ABGA 1YTDA 3W02A 3OIXA 4HVXA 2OYKA 3VZXA 3RMJA 3G1FA 5HMSA 3M0KA 4PUEA 7PTDA 3HMCA 3SGUA 4MWAC 4HU8A 4H4IA 1OEPA 5I3FA 3QQ0A 4XZNX 2GQ9A 5FA5A 4ZOCA 3CV2A 1GKQA 4ZVJA 1TZZA 5CG0A 3RG6A 3EOEA 4EANA 1H50A 3BANA 3N6JA 1G9HA 1C9DA 2BB0A 3WDIA 3AIRA 1LBFA 1JCLA 2XZ7A 4XG1A 5BROA 3USBA 3YPIA 4QXIA 3TLLA 4ATWA 2HNHA 1YEYA 1OQFA 4DJED 3K46A 2GVYA 4KMQA 4A35A 2EQDA 3CHDA 3N4EA 3O1NA 3KDNA 4P8XA 1H7XA 4DZAA 6REQB 1E6ZA 1KO0A 3CWHA 3R89A 2O9OA 1VYRA 3A3WA 3WD2A 2DV0A 1RCXB 3Q45A 3P74A 4LW7A 4UQBA 2GQ8A 2Q01A 1C7TA 3CL7A 1UC5A 4HK7A 4H2CA 1E5NA 1ZTVA 4UTTA 3CQKA 3QV8A 4IFRA 4JCLA 4ATLA 1BYDA 4NQ1A 2GQAA 3SCWA 4C5YA 4L65A 4BF7A 1VEPA 2VFFA 1PDYA 4HYWA 1ISZA 3W72A 4S3AA 1EO5A 1U5HA 2HCVA 1PIGA 4X0NA 4FR1A 1UMLA 5FJTA 1GJUA 1OM0A 3OVPA 3WD3A 3MWAA 3WQWA 2CLPA 3AI0A 1TTQA 1UC4A 3PBYA 1IZCA 3P60A 1KRCC 2FHCA 4REQB 1N82A 6XIMA 1JF6A 4AYSA 3UG4A 1TJ1A 2NUWA 1W3IA 4IH3A 4IIHA 2ZA2A 5I3JA 2VXNA 3KX6A 4EXBA 1EEPA 2GGJA 4MF4A 2VKZG 4XD4A 3QPZA 2QPUA 2B31A 2Z24A 3F4CA 4ZE4A 1JZ2A 4YHEA 4JDYA 5EMUA 4P8WA 3GG0A 4I5UA 3U4AA 1P48A 4PUDA 4RPQA 3DDMA 4GYJA 5AHMA 3D46A 1TWZA 4O11A 5FEPA 1F5ZA 1FP8A 4MPKA 1P6WA 1XFBA 4O8RA 5HR6A 4LVGA 3HIJA 3HJEA 2VC5A 4UFLA 4RDZA 4M6VA 2VFGA 3ZR6A 1VH7A 4F3HA 2CLIA 4F0SA 5CBBA 3BOFA 4Y2WA 2ZUWA 3CLMA 2H8XA 4V33A 3TMQA 1M5WA 3IK2A 3PBMA 1SGJA 3DC8A 1CYGA 3GM8A 1V3KA 2RKXA 3SGZA 1A47A 3EDEA 4QE1A 4GQ0A 1QI4A 4R34A 1CB7B 1XCFA 4DUXA 4QDMA 1EOMA 3R79A 3WJSA 2ACSA 2YBTA 4RV3A 3LERA 4AWUA 2G95A 3DG6A 3F7JA 2OCZA 4HU3A 3U57A 3TFXA 2PGEA 3UWZA 1QK2A 3V1PA 1E70M 1WA3A 2BVYA 5HBFA 3S5NA 5F1VA 3EXSA 5JU6A 1SR0A 1R0MA 4IMGA 3U2ZA 3CUZA 3NQGA 1S5TA 3KM8A 1NFGA 3RM8A 5CAKA 3IJDA 4TTUA 3QHOA 3ARVA 4S3DA 3POCA 2GZXA 4O50A 3QTGA 2JF6A 1LL7A 5BZAA 2C14A 1KCZA 4U10A 1E0TA 1QT1A 4HJWA 4EK7A 3SRHA 3H7UA 2WV8A 3ZSTA 4U2YA 2CYGA 3C5QA 4HA1A 1SW3A 4Q32A 1B3YA 4V15A 4RR4A 4S3EA 3AYRA 2WB5A 5JH2A 3WBXA 1HTIA 2CU0A 3IJQA 1Q45A 1KR1A 1WZMA 3FAWA 5EPDA 3WLOA 3WN6A 1KXHA 2CLFA 1V0NA 1B1YA 4OTKA 1CEOA 1ENUA 2X0SA 2BNJA 4D6HA 2OSXA 4HGXA 1HJVA 2X8RA 5GNYA 2DW6A 1US2A 1Q4WA 1EUAA 5C71A 4GKLA 2WPGA 3QSRA 3AJ7A 3SCQA 1UD3A 4JY8A 4JQAA 3OODA 3L5AA 3GVVA 4A22A 1J12A 4POCA 4LV9A 4UTWA 3MSRA 4ICNA 4F2TA 3S9YA 3N3MA 2CZEA 3AOFA 4MHBA 2NX9A 2TSYA 2E6DA 2JIEA 5MKGB 1R87A 3ZWTA 2J79A 1MXSA 3SIZA 4O8AA 2YCEA 5AZ1A 2PZNA 4LFYA 2JKEA 1SJDA 6TIMA 2EBNA 1XBXA 2D2GA 4N02A 3QTPA 1JCMP 1CB2A 4URIA 4ZMGA 3STFA 1JJKA 2RDWA 1UOZA 3DERA 2YL5A 2HBXA 5DMYA 1VFLA 4HMNA 4XB3A 1SJBA 2NV9A 2WHKA 4RL3A 1E72M 2GGHA 4YIWA 2R82A 3BOLA 4GNKB 3W1RA 4QNEA 3TR2A 4X2PA 3Q94A 1UA7A 1LLOA 1K02A 2A3LA 4BKNA 3BDKA 3T07A 3TZNA 3GXDA 3R8GA 4H3DA 2QDHA 3T78A 3WQDA 1M41A 1KR0A 3RMEA 3UG3A 1VR6A 1EO7A 1FWBC 3IAPA 1E5JA 1HKKA 3VNLA 1CGTA 1DE6A 5JVLA 1SYTA 3VOCA 5HINA 3AIBA 4EP8C 4F0MA 3A64A 4XAFA 3NYDA 5K4ZA 2C18A 1VIZA 2R1PA 2DT0A 3WLIA 3S2CA 1V02E 3GW3A 5FF4A 4FZIA 4MJ2A 4KQNA 3VD5A 4LEQA 4FI4A 4I8DA 4MDPA 4L6DA 3WMBA 1AW1A 4ZR8A 3THUA 2J8GA 5EA9A 4Y9AA 1DTUA 4DNHA 4H7CA 2YXXA 1BTCA 1G4PA 5D2TA 2A2IA 2QCEA 3BE7A 1FVPA 4HIBA 4HMCA 4CEUC 1AQHA 1V79A 5A6AA 3KVMA 5KZMA 4D6DA 2ON3A 2PTDA 5FI8A 3T1GA 3I6RA 5C70A 1I6NA 2QGYA 3ABOA 4J3ZA 4XTIA 4AZIA 3M44A 1RD5A 3W27A 5FJPA 2P5NA 2V5DA 5A8GA 2BS9A 3LHTA 1KM6A 3OZYA 1B90A 4S2BA 3UFYA 4B90A 1E51A 1M7XA 5FJJA 2HXTA 1OGSA 3QPYA 3TONA 3F4NA 1I1XA 4HCDA 4LF2A 4S38A 1KBIA 4WDTA 2E1DA 2GYIA 4E8CA 1RVGA 3AIUA 4I9AA 2GVGA 4LH8A 3HU7A 1MXGA 1LL4A 1XC4A 1NWRA 1PZ2A 1JCYA 1W54A 1Q5MA 1EBHA 1J01A 2WM0A 3E02A 4KEMA 5CLTA 1QUMA 3OQEA 2IKGA 4KIEA 2WMJA 1Q7ZA 1KV8A 4LAUA 1SVDA 3B3DA 1O94A 4PCPA 3MBDA 4PTDA 4PULA 1PIFA 1O68A 1BG9A 3SY5A 4NXKA 3ARYA 2J13A 1T8QA 3PZ9A 4O0QA 2BGQA 4DJEC 1AQFA 3T2OA 2WZMA 5A6TC 2PWFA 7TAAA 1JD7A 2I57A 3G1XA 2PDBA 3S1VA 2XYLA 4JKMA 3W38A 4DAIA 5EYWA 1A4LA 2V69A 1EJXC 3TCEA 3JZEA 1ECEA 1O5KA 4NL1A 3W7PA 4W7UA 1TPC1 1PHWA 1S2AA 2OEJA 4N9BA 3GNNA 2WJFA 3Q67A 2QUUA 1XLMA 4CCEA 4OV9A 5LSMA 1ICQA 4XZWA 4MG4A 1N8WA 3GXIA 3MMTA 1UUMA 4A8LA 2QYGA 4N9CA 3IVSA 4RE2A 4L80A 3NEHA 1W2PA 3GY1A 3AAMA 5DT7A 3RFAA 3LTYA 5DBTA 1S1RA 3WD0A 4GINA 4EWND 4UFJA 2R94A 3TXVA 3SCUA 2WJEA 4EOUA 3F5JA 3ID7A 1MFVA 2RGMA 4XZBA 3UWQA 3GDTA 1MDLA 3K1GA 5A8PA 2VI0A 4XAZA 4S1FA 4OKDA 3PJWA 2DZAA 4WXZA 5M3WA 3TJ4A 3DX5A 4K39A 4B4HA 3WH5A 2BGNE 4K8EA 2ZOXA 3PZQA 1EHNA 3MBFA 5CZ0A 1YX1A 1XDLA 4JTJA 2DSWA 3AXKA 4IQDA 5LGXA 3NXFA 4RPPA 1XIHA 1Q6DA 1A80A 1Q6CA 5G4EA 2Y5EA 2OQHA 2RGLA 2VEFA 5E5CA 3RO8A 1XKYA 3AROA 3VXGA 2DSKA 2W3ZA 3EWXA 3WK1A 3I6EA 4LOCA 2RUSA 2FDMA 2X30A 3NM1A 4G1NA 2VZTA 1VYPX 4UTLA 4S3CA 2YKKA 3W25A 4A29A 5EB8A 2A79A 1W1IE 3UEQA 3QY8A 2WQPA 1RD6A 2H90A 2WMIB 1E56A 7ENLA 3M41A 4GH3A 4IISA 5H8PA 1GHSA 1SO3A 3KWXA 3IGXA 4GY1A 4TO8A 1DIKA 4YN5A 1JUBA 4OBTA 5FSDC 5CSRA 4A21A 3V5OA 3VIHA 3G0XA 1JVNA 5LA2A 3E2VA 2DZTA 4GPNA 4GOAA 4YTUA 2J24A 2HMCA 2VO5A 3CPRA 3EGJA 1C7SA 2CLHA 2NUXA 1JDAA 1HO1A 5FD0A 5D9MA 1BF6A 1H5VA 4ZGYA 1J18A 2A1YA 4U4MA 3IIXA 3UXIA 3BAJA 1NQ6A 4DRSA 4M80A 2VR5A 3P8JA 3RM9A 4B3ZA 1JYXA 3RHGA 1GCYA 3RLHA 4Y6GA 4PSPA 2WNZA 3EDKA 1IGWA 2DH3A 3DFNA 4E3VA 3K4AA 3KVJA 5FIPA 4O0KA 3UCCA 4LRTA 4MAVA 2PWEA 3OEXA 3WNPA 2D0HA 3P5ZA 2PDQA 5E9XA 3W1AA 1YTEA 3CK5A 2J27A 3QLDA 1NARA 1HKVA 2VFHA 2XG9A 1MEIA 1A5UA 2WZHA 2FHFA 5LIKX 1LBLA 2E1WA 3K8KA 4N7QA 2FZ8A 3T09A 5FEZA 2FIQA 3NDOA 3B0VC 2XVLA 1WZLA 2FMOA 1XW8A 3GIQA 1TELA 3ABZA 4CNUA 1HP4A 4E8GA 1V6XA 4WKHA 1O4UA 3W22A 3NA8A 3WNKA 2O4MA 5AHFA 1DP0A 1WO2A 2I9UA 3BV7A 3Q2DA 1DBTA 2BX7A 3GNDA 2OYLA 3SCOA 5A2AA 3W76A 4HSOA 3WO8A 2ACUA 3TQKA 4GXPA 4HCHA 4YWIA 1XGEA 4MAZA 1R3WA 3ZJ7A 3UXLA 2A7PA 1K8XA 2OZ8A 3CT7A 3GQYA 1B30A 3L67A 2AOSA 4Z2HA 1HNYA 4YLWA 1VP5A 2NX3A 2ZQ0A 3MDUA 3N04A 1DWFM 1IYXA 1EKOA 2HE8A 3AHTA 3M07A 3AIWA 2YXGA 5FAJA 3ZWSA 4I9TA 3GIYA 2VFEA 4C6OA 2XN2A 3APTA 5G2IA 2VCAA 2J9ZA 3IUDA 5I03A 5A8MA 5LZLA 1X96A 1EQPA 3OJGA 5G1YA 4KGJA 3QYSA 1Z9AA 3CZJA 2MUCA 1WOAA 4E2OA 5CJMA 4J3XA 4FNTA 3TROA 4IMDA 4CQDA 3KOYA 1MNSA 5LNWA 1OCJA 2WSQA 2J7GA 2XFYA 3P3BA 2FVMA 4RK8A 7CGTA 5BW6A 2Q71A 1VENA 1D2KA 2OPJA 4UQAA 4Z08A 1LG1A 4FXJA 5F2LA 4BQ5A 3QV6A 3SQMA 4K7VA 3LTSA 1JI1A 3FLUA 3AIVA 4JYEA 4US5D 4CU7A 3EX4A 2OOGA 2O9RA 3B0UX 3VTRA 4JL1A 3BMWA 1WNOA 1E1CB 4RE0A 3GDRA 1JUEA 1OK6A 4H9UA 3F03K 1FHVA 4OGZA 4A3UA 3ZLHA 2ZX7A 4TVUA 4UMAA 4GYKA 1UD4A 3POHA 4TQTA 3MT1A 5LNUA 1JI2A 3UWUA 4EF9A 3I6TA 4ACYA 3FVMA 4CD8A 1D7FA 3VUSA 4A2RA 3HTWA 4LTSA 2QCLA 4PGLA 5TD4A 3UD6A 2J7DA 3CAVA 3CV7A 2AAMA 1YNQA 1L6GA 1FX6A 3N6QA 4F0RA 3V4BA 2HK0A 2X7VA 4LUJA 4M29A 5I3HA 7TIMA 4JTTA 1E0UA 1OABA 1DJXA 3MU7A 1N8IA 4EF8A 2AKMA 1V0MA 1YNPA 1M03A 3CHFA 3F1QA 2O55A 3O0FA 1T99A 1US3A 2DZUA 4Q8VA 2FQIA 4LS0A 3L0GA 2PS2A 4Z42C 5XIAA 3UP8A 4NILA 3OA3A 2CKSA 4OIFA 2PDWA 1XF0A 1AJ2A 1NFBA 1PCKA 4WK9A 1YIXA 2Y85A 3CT2A 3KBNA 5K3VA 1S39A 3QZAA 1W3LA 3DHUA 3L2IA 4J3UA 2RH9A 2NQHA 2F38A 5DEZA 3PFMA 1PB0A 4L4OA 1A0CA 5CAHA 2QF7A 4XUGA 2AL2B 3PUOA 2R14A 3G1RA 2OT1A 3DHDA 2GQ3A 3UZJA 1T0OA 3SCSA 1MNZA 3AYVA 4DUWA 5DCBA 3UJRA 2Z00A 3W7IA 2I9EA 1TCDA 2ZWZA 4ZEPA 7REQA 3CUGA 5DANA 3DH7A 3UWWA 5BU9A 3S2LA 4C6IA 3WLLA 3GWQA 3V0UA 1TPEA 5DRCA 3L4TA 4WY0A 3BH4A 5L6UA 3CQIA 4PMNA 4DXKA 3O6AA 3EWBX 1I9CB 4Q6XA 3NPVA 2ZCGA 3PY2A 5FKYA 2BSLA 4NX0A 4PB4A 2E8YA 4KF1A 3ZZ1A 4IQEA 2ZUNA 2V5CA 3L23A 4YNGA 3G18A 2D2HA 1R3VA 4DQWA 2IUZA 5KZDA 1ZHAA 1MQRA 2WCGA 1EF2A 1DWJM 4ZQNA 2XSBA 1FXPA 4LUSB 4PE8A 1CLVA 4WKFA 4HNTA 2QCHA 3CTLA 3V35A 4Q8WA 3S1XA 4Q7IA 2VD8A 4ZQCA 1GVYA 1YDVA 1WKDA 1B9BA 4OHQA 1PCWA 1XYAA 4UCFA 3KHDA 4GZ7A 3MJMA 3VKDA 2G4FA 5HA7A 3CEUA 3K8LA 4GJJA 3KDOA 4CQAA 3MV01 2DDXA 3ES8A 2NQZA 3R5EA 3BAXA 4WOZA 2PD9A 4P8UA 3U3HA 3VFLA 2PI6A 4AY8A 4JFVA 5KTLA 3DHPA 4JN8A 1LROA 1XQLA 3NNTA 3IS4A 4H7VA 5G2HA 1ODZA 3L4UA 5IHSA 1IT8A 2GVJA 5JXQA 3BWWA 1SMAA 4B5VA 4NRSA 4QCEA 3LGDA 1JPKA 3ONBA 2BY2A 1XG3A 1AODA 3BW2A 3VD9A 1QHOA 5TAOA 4GY7A 3P6LA 4QR6A 5D38A 2E6FA 4FA3A 3UWYA 1HL8A 4HNNA 1XCXA 2P88A 4DJDA 2Y8UA 1KFLA 4QDPA 3E0IA 1V6UA 5M1TA 4B92A 1R30A 1XIGA 4MY1A 3NR0A 2ZBTA 1FH9A 2IXVA 4QTGA 2CC0A 2CNCA 5C6MA 1V3IA 4GQGA 3UG5A 1KA9F 3MCMA 1EYEA 4HK6A 2VQUA 1DJIA 4BWLC 4IXHA 5DELA 3MSDA 4GY0A 2DT3A 2CLLA 1ADOA 3NSXA 1H11A 3LZ3A 4N4PA 3UPMA 5BMWA 3EX3A 1L2QA 4C6EA 4GIYA 4CNSA 1JR1A 1HJQA 1UR0A 3F4VA 1MEWA 2PTYA 2PAJA 3TYZA 4IMCA 1TMQA 4ZO7A 3PWIA 5FL0A 4NZ5A 1SW0A 4C7DA 4MKNA 1GOMA 4MGGA 4QCFA 4Q4KA 2W9MA 5BCAA 3C2EA 4DAFA 5IBXA 5IFPA 1EWEA 4H9YA 3VIIA 4XSMA 2BHZA 5T91A 3B9NA 4JHOA 1IHIA 1UUQA 4DEFA 4LX4A 4PH6A 3V36A 3LPFA 3B4UA 2POTA 3FJ6A 3UY7A 3PZMA 1Q6OA 3QV7A 5LIYX 5A8OA 4KKXA 3QC0A 3OYZA 3WX7A 4H9TA 3BAKA 1AVAA 3SFKA 4R85A 3G5EA 3D0CA 4LBRA 3PN8A 4GI8A 2QULA 2NSXA 4Q8NA 1DJWA 4Q8MA 3CZGA 5HQLA 1JZ3A 4QG8A 1NOFA 4ZENA 3M0LA 2Y2WA 3GBDA 3WJZA 2NQ9A 3A4XA 5HPOA 3CL6A 1FCVA 2PLMA 2Y61A 3B0PA 4ICMA 3IJ7A 1KCXA 1UH3A 1XRTA 3QZ6A 1S2UA 1RA0A 1US0A 3FXYA 2PURA 3HZ3A 2ZZ6A 4NI3A 3CZLA 1EC7A 3R0DA 2INEA 2I5GA 3HQOA 1GPWA 3CXOA 4AAJA 5D8WA 1MZHA 1QVBA 1KCKA 2NSOA 2KZHA 3NL3A 2Q3RA 3QPEA 1L6FA 2DPEA 1XLHA 4MUPA 3FFSA 1OB0A 1RK6A 1JZ7A 2OLHA 3E0LA 1DJZA 1XBZA 2H3DA 4LUYA 4O1CA 4DO6A 1A0DA 1N55A 3N14A 1PYMA 3F5KA 4AY1A 4JIQA 4L4LA 3S6TA 2YPIA 3SAZA 2R91A 4DJFD 4JTGA 4O19A 1NWUA 2GUBA 1KWGA 3GSMA 3R12A 3GVQA 1OFOA 3T08A 2FLIA 1A4MA 2VHLA 3AZTA 1VCFA 4FR6A 3NVTA 2CLMA 4C6JA 4EAYA 1AW5A 4UTWC 3WMCA 3KUMA 4GI9A 1K03A 1W56A 3CWNA 4ORIA 2P1FA 2WVVB 1RQHA 4JCMA 4BK9A 3PBGA 1CI1A 1C91A 2OQLA 3VNIA 3IRDA 3IIZA 4BCEA 4PMDA 4R53A 3SQSA 1QNQA 5B7YA 4MKVA 3P80A 4JIEA 2ZRYA 4JX4A 4PMJA 2WJZA 4OZOA 2ZZ5A 3G1HA 2NXIA 3HBLA 1IV8A 4O14A 5IBXC 1BYCA 4Z2IA 3AMKA 1VF8A 2QAFA 1I2RA 4PMXA 4QBXA 2BDQA 4GK8A 3CIXA 2PDYA 1G5AA 3LHYA 4DF1A 2V5BA 1L0PA 3MO7A 3R7MA 3GU2A 1BTMA 2D0GA 4N42A 3N73A 3W7NA 3WD1A 4BJHA 1M01A 1E6PA 3NQCA 3BICA 4DWSA 1F3EA 4XVDA 3FSTA 2PDUA 1NAL1 3UVAA 5F4XA 5D33A 4P2VA 5FF0A 3BURA 3WMLA 3O15A 4A3HA 2Y7GA 3W7KA 4NSBA 1ISWA 3VKAA 1U22A 2WCSA 1ITQA 1E3ZA 5CC7A 1RAKA 2WPBA 2C16A 1XLCA 3RPDA 4BS0A 3MWCA 1A5BA 4AIUA 2ZRZA 3AS3A 3M0XA 3O9NA 4X0VA 1CXIA 2QLYA 4FXSA 3W75A 4AD5A 2C6QA 2W6RA 2Z1VA 2EG8A 1R7OA 1FRBA 3DFYA 9CGTA 5HQEA 1PTAA 2EPHA 3TA9A 2XVPA 3OW1A 1RP8A 3LGGA 1VB9A 3WDJA 4I6VA 2XVKA 5C9WA 1OC5A 3EDJA 3QBUA 4Q22A 4MLJA 3TOPA 2BOGX 1P0NA 4J9JA 2YCKX 5C2GA 4UTUA 4O18A 3ORWA 1S3HA 4HQVA 4WSKA 3ZO9A 2R1MA 1I8JA 4LQ1A 1KM4A 2VENA 4I3GA 1GKRA 5AVHA 1OX4B 3VMNA 2Y63A 1OD0A 2I5IA 6PTDA 1YLVA 1K9EA 3ABXA 3KTSA 4MB1A 3G8RA 3C52A 3P14A 2BGSA 1BVWA 3DOPA 3FEMA 5I02A 4Z1AA 3EB4A 3WH7A 3AYSA 4PZVA 3BJSA 2BOEX 2IW0A 3TC6A 2XTKA 1KBKA 1IWBA 1OFAA 2EKCA 3SSJA 1ZAHA 3BAYA 3OG2A 3KOWA 2CW6A 1ZALA 3SCPA 1V6VA 4K68A 2E5DA 2GSHA 4GUIA 1RCQA 3MVTA 4NNBA 2ISWA 2XN0A 2JKAA 2UY5A 3I4KA 4HMDA 5JBEA 3R10A 1W3KA 1IXOA 2GSEA 1EXPA 2WKGA 5A94A 2WJDA 3ZYZA 1TQXA 2OVLA 1OG0A 3NM3A 2HWGA 3KOXA 4DM1A 1W3JA 1BQCA 2XSAA 4ML9A 1GYNA 3WBWA 1A0EA 2PDMA 1LOQA 3L4YA 3W74A 2IPWA 2VWSA 3R0UA 3W86A 3KEHA 5A1AA 1TREA 1B5TA 3R11A 1WZKA 2PU0A 1R3QA 4IJRA 4WCJA 1TB3A 2XWDA 4UFIA 2Q6ZA 2BBFA 3H4WA 1AD1A 1RALA 4ZO9A 3C56A 1TIMA 2A3EA 1QBBA 2QCCA 5JBFA 3BLIA 3CQJA 4IFKB 4HPXA 2WNQA 3MQTA 4NG3A 1IXNA 3CYJA 2FH6A 4W5ZA 1IR2A 4B15A 2GUUA 2J7BA 1UR1A 3LPPA 2XJ7A 4TMCA 5A8QA 4JQ4A 2GLKA 2ZICA 4FNSA 4NNCA 1TPFA 5FF2A 1UPPA 4I9MA 2YBVA 5HJLA 4UCGA 2QCDB 1UWTA 1GZ1A 3FYYA 3M5YA 1MW1A 1FHDA 3SY1A 1BRLB 1SFLA 4M7TA 4V1XA 3I4EA 5CC5A 2PDFA 1F3TA 4UNIA 4JS3A 3QMRA 2GK1A 3DXIA 1LOLA 3PJXA 2CETA 1PIIA