4FO4A

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, complexed with imp and mycophenolic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
363
structure length
348
Chain Sequence
b'MHMLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine 5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant, complexed with IMP and mycophenolic acid.
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 113
structure length 348
sequence length 363
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fo4A00
4HHPA 2WO5A 4UTUA 2DZTA 2RDWA 3WK1A 2Y88A 4PCFA 1QAPA 1W5PA 3EXSA 3BLIA 5AHEA 4EIVA 3GR8A 4OBTA 3C2FA 3TQKA 1GVSA 2J6XA 2Z2UA 4S1FA 4LRSA 4NJHA 4OGZA 3H53A 3HGSA 5FF4A 2GVJA 3LXCA 1SZGA 1NFBA 2G97A 1NF7A 5AC7A 1TRIA 5G2IA 4BI7A 2DZVA 3GK0A 5EL1A 2Y61A 3EX4A 3W88A 1OYAA 3KRZA 1QCWA 3S5ZA 4WXYA 3F4WA 3GYEA 2YW3A 3LRKA 1KM2A 1I2PA 3L2IA 1FCVA 1ICQA 4BF9A 4WJEA 1RR2A 1KM1A 5T26A 2RDUA 4JTHA 1HO4A 1FUYA 4MYAA 4LS2A 3P74A 4JDBA 1E51A 4FNSA 2DORA 2O7QA 2A85A 1EEPA 2EPHA 3R8RA 3G8RA 3NPVA 1OX6A 5K4XA 4MY1A 5KITA 2NWRA 4BWLC 1AL8A 1I2OA 3QMSA 3PUDA 4YCOA 2Z0IA 3EWUA 3L67A 4CCCA 1Q6QA 1W3TA 7TIMA 3PC0A 2ABAA 4HNTA 4AHOA 4JIPA 2A2IA 2C3ZA 1Z42A 1DJNA 2ZZ5A 1FWNA 2YSWA 5EKYA 2QCNA 4JGDA 1ZFJA 3UD6A 5DN1A 2Y89A 3W2NA 3DKLA 1BEUA 3LCLA 4ALDA 5D04C 4XBKA 4O17A 1XDLA 2PE4A 4RK8A 4O52A 4K37A 3GKFA 3A5FA 2Y7EA 4Y8FA 3GXTA 3G24A 1YYAA 3W22A 2CLKA 3SY5A 2C18A 3STFA 1OG0A 2YX0A 3TNOA 2R94A 1SFLA 4J9JA 3SIZA 5L6UA 2YGYA 5LHFA 3NNTA 1C9DA 5H91A 3W73A 4MLRA 1F73A 5EA9A 1ADOA 2H6RA 1X1ZA 4UTIA 3TV8A 4AXKA 4POCA 3TQ0A 3B03A 3B0PA 3A5VA 4TMBA 4UTMA 1F6KA 2QEZA 1VQTA 3OA3A 3G3DA 2Y7GA 4FO4A 3EXRA 4X22A 3ABOA 3M1ZA 3F03K 3CEUA 3M5XA 5BMXA 1UBSA 2V5LA 4TU1A 4Z1BA 1ICPA 1QFEA 4WUIA 3N34A 3C0JA 3UY7A 1KM4A 1EWEA 4JTFA 3P80A 2C0AA 3DENA 1ZAIA 2RKXA 2OMAA 3M41A 1KV5A 4Y6GA 3NQDA 3YPIA 1KFEA 1N8FA 3MI3A 5F1UA 5I3GA 2JKEA 2I14A 4IQLA 1DBTA 4L4MA 4D2JA 1LZOA 2W0UA 1TO3A 3DZ1A 4UMCA 1R30A 3NDOA 3NQCA 1SO6A 2B7OA 2LLEA 1BTMA 1MEIA 3C2VA 3G1AA 5CPOA 3TW7A 3V1PA 4RV8A 1S5TA 1XUUA 4S2CA 1P4CA 5TQLA 1G4TA 5CGQA 1FWTA 6ALDA 2KZHA 5BNKA 4KFNA 1TPB1 1LM1A 2QCEA 3C8FA 1DJQA 4WD0A 3W7DA 4AWUA 1GQNA 3H55A 2A7PA 1TPH1 3CPRA 1V5XA 2FPYA 4I9AA 3T4CA 1VCGA 1XCFA 4ZQCA 2NUXA 2FDSA 4JDYA 5FF7A 1QMLA 1TTPA 4WZHA 4RXGA 3BK0A 4NVTA 1NF0A 1YXDA 4AHPA 3W74A 5AHLA 3T78A 1YTEA 3T55A 1THFD 4FEZA 5ABTA 4NNBA 2ATMA 1SR9A 2WSYA 3MBFA 4O53A 4O28A 1GWJA 1GVOA 3TKFA 3PBWA 3W1PA 2HTMA 4UFJA 4KWVA 5LNWA 3TFCA 1BWKA 4JN6A 3I7RA 3E9AA 1B4KA 1DQXA 1WBJA 3IEBA 1C29A 3NQVA 3R13A 4XUGA 2A4AA 4U4MA 1Q6OA 3A23A 2ZRUA 4R53A 2GVLA 3KAOA 3P61A 5C5YA 4N4QA 5EMUA 3TX9A 3B05A 2V2CA 3TDFA 2NXIA 1PCWA 2QCFA 4UTHA 3HF3A 3UPBA 2CFFA 4HNVA 5A8GA 1VLIA 3LDVA 2J88A 4E2BA 2JK2A 2I1OA 3EWYA 2TPSA 2I9EA 4Z1AA 4ADUA 1TB3A 4QITA 4O0KA 3W7RA 1IXQA 1QDSA 3LERA 1LTDA 4R7JA 4ONVA 3MBDA 1K7XA 3E02A 5AHIA 1PCKA 2HSAA 3W2JA 3TCEA 1ZAJA 4LV9A 1DL3A 4FX6M 4UC5A 1M6JA 3G1SA 4UXDA 1W5QA 3MYOA 1CW2A 4CCDA 5G2HA 1V7YA 4O1CA 3PUEA 3QW4B 1ALDA 1QO2A 3E12A 1DORA 3C2RA 4LWWA 2VFIA 1EP3A 4JICA 5F4WA 2ZZ7A 1TPFA 5G1YA 1G67A 1TJPA 1H7OA 2GQ8A 3AJXA 3IIOA 4A29A 4N6FA 3AO0A 3W7IA 3LGEA 4FIRA 3GAKA 3W72A 5DY3A 3UXDA 4YWIA 4MZ8A 4K6AA 3FYPA 3LRLA 4NXSA 2ZBTA 1XDMA 3DFOA 4MY9A 3E49A 2QF7A 5HINA 3CHVA 2JGYA 3P5ZA 5BMWA 4LRTA 1EUAA 3QMTA 2JKPA 2Z6IA 5DBTA 4E0CA 4NJIA 4HPXA 4NT0A 1OFDA 3G1FA 5HWMA 3PAJA 3MI2A 3A21A 3TSBA 3LM7A 3NM3A 1H60A 1SZEA 1SW3A 2X2GA 2ZDRA 1S5VA 3ELFA 3ATZA 5IBXA 3HQ1A 1ONRA 1HL2A 2H3DA 3R12A 2V2HA 1OYCA 1H7XA 4H3DA 3TAOA 5LNRA 3MUXA 2YFNA 1ZAHA 3ZWTA 2V82A 2RH9A 4Y90A 1LOSA 1EPXA 1VC4A 1PHWA 1OF8A 2BZNA 4NX0A 1YTDA 2ZQ0A 3O6YX 3SFKA 4UCGA 2ZCGA 3TMQA 1JUEA 1L6SA 1LCOA 3HO8A 4O13A 1XUZA 1H1YA 4Z0JA 3NXFA 1LBLA 4LVDA 2PCQA 3HG5A 1J4EA 1NVMA 1ME8A 2DZWA 3C3NA 3B4UA 3HJZA 3B04A 3T44A 2QUUA 4UTTA 1Q6LA 5D03A 4YMZA 1SW7A 5FEZA 2OZ0A 3QQ0A 3USBA 3L65A 3IIZA 3MO7A 1X8FA 2IQTA 4DO4A 4O54A 4S2BA 5LKYA 1GZGA 1QPNA 4WY0F 2AAMA 3P81A 1K02A 4QISA 3M43A 3T7VA 1ME9A 3ABRA 3G1HA 4WX2A 4PL1A 2DZPA 1UB3A 1OK4A 1D3GA 1D9EA 4FHAA 2CW6A 2ISVA 5IM51 2DZUA 3BGJA 1LRNA 2FB3A 3F1QA 3THAA 3IVUA 2QJIA 4ZQMA 2FLIA 2E68A 4RLIA 2GUUA 2GPTA 4ZQNA 1S3HA 3W2LA 3NYZA 1EP2A 3PBUA 3B0VC 2ZFAA 4ORMA 4LVAA 2Y63A 2VOMA 3NR0A 4JTGA 2VFGA 2BXVA 4LW7A 1JULA 3W75A 3C56A 1O60A 1TQJA 3M5VA 2TYSA 2E09A 2Z6JA 5K9CA 4GC4A 1ZY9A 1GVRA 2E6FA 2EF9A 2QDGA 4WXZA 1M7PA 2R8WA 2A5HA 1OFEA 1HTIA 3LOTA 4LUIA 1DVJA 3WJYA 3C52A 1KBIA 3F4NA 4MVAA 4PFMA 4ORIA 3PWAA 1LORA 1Z44A 4DF2A 2QJHA 3OVPA 1PIIA 1U5JA 5HQEA 3IIVA 4JTEA 1P5BA 3NPXA 1DOSA 4NNAA 5AN7A 3ZS4A 1TCDA 1R47A 3QSRA 1OFAA 1YXYA 1ZCOA 1S5WA 5LHEA 1W8SA 3DFQA 1OHLA 4O1AA 1R2SA 3DXIA 3MP5A 1VPXA 3EWBX 2ZRYA 4NUWA 1LBFA 5KSWA 3W1RA 5FEWA 1L6YA 2E1DA 4IUOA 3W2KA 5I3IA 1TPVA 4O1DA 5G2WA 3PUOA 1A5CA 4NZJA 1IF2A 4XTIA 2HS6A 4IJBA 1SSDA 4JD4A 1UUOA 4GUFA 3P8IA 3W2UA 1B9BA 3BO9A 3CM4A 4IWWA 3TFXA 1KM6A 3GAYA 3SR7A 4B5NA 1F76A 5AC8A 4UFHA 1KFKA 3LHYA 3IIPA 1YDOA 4YCPA 3I7SA 4L4LA 2DP3A 2Q3OA 4IX0A 3GDLA 5AB3A 4HIBA 1JRBA 3S6DA 1M7OA 4JYEA 3NQ6A 1H63A 1OFOA 1T8XA 2Y70A 1N55A 4BR1A 1JCYA 1PVNA 1LRTA 1TPUA 3O16A 4JY8A 3EWXA 3LB0A 3ZFHA 1SU5A 2CLIA 5C55A 2H3BA 2OCZA 3IVSA 5EY5A 1FWRA 3L0KA 1XKYA 4K8EA 2GVGA 4FNRA 1TJRA 4MJZA 1XBZA 3NPWA 3PG8A 5C54A 3M5ZA 2FJKA 4N9BA 5K2ZA 3GNDA 4LNYA 4FF7A 5LGXA 3NM1A 2GQ9A 4HNNA 3I68A 4HSOA 2C13A 2CZDA 5KINA 3S5NA 4JYFA 3W23A 3R89A 2G5WA 4NX5A 3WK3A 3FJLA 2F84A 3I65A 3Q94A 4UFKA 1W56A 3HPZA 1KM0A 4HNUA 1TV5A 3W1UA 2C14A 1VHCA 3HGJA 4DO6A 4QQ3A 3NQMA 4AHQA 2A7NA 4QJ1A 1GYNA 2H8ZA 3GR7A 2X1UA 3W1TA 2ZRZA 4MOZA 2YXGA 3LLDA 2R14A 3D0CA 1DQWA 4GNJA 2NUWA 1OF6A 2V0TA 1ICSA 2B7QA 3UXAA 3ANYA 5CPMA 3ABSA 3KFTA 1H61A 3NL3A 5FESA 4DPQA 2CZEA 4UFIA 1QOQA 3BARA 1AMKA 3M16A 4AWTA 3W86A 3MMTA 1KW1A 3TSMA 3TH6A 4KKXA 1VH7A 3KVKA 4M6VA 5D33A 3LCWA 1A53A 4JTTA 4TR9A 1SUXA 5F2MA 1F6PA 2X30A 4UFLA 3BV4A 4UR7A 2V9DA 2QR6A 2Y62A 3GLCA 1B4EA 1XBXA 4K39A 4PC8A 3MWAA 4JY9A 4DBDA 2ZRWA 5K4ZA 3W7CA 3QH2A 3TMLA 3GDMA 2BSLA 4GFSA 2WJZA 3G0SA 3O07A 5EYWA 5AYXA 3RFAA 5G1TA 1MSSA 3DI1A 4IMFA 4M6PA 2VC6A 4TIMA 3EWWA 3O6CA 4N2YA 4Q4KA 3LHTA 4Z0SA 3UQNA 1JCJA 2NV2A 4DF0A 3DI0A 3NL2A 4YLWA 4JTKA 4H4IA 4O1BA 1CI1A 1JCLA 2A0NA 3M5YA 1KFJA 1H1ZA 4PODA 1YPIA 3G0UA 3PVFA 4OE7A 5HR6A 1YPFA 2NUYA 1IIGA 3H54A 2ZZ6A 2A21A 3NGJA 4O14A 1I45A 2QDHA 4JTSA 4QNEA 4RXFA 3WJSA 4A3UA 5C6MA 3TC7A 2ZRVA 2Y7DA 1FXPA 4BI6A 4ADTA 3M44A 1K3UA 4DBEA 4BFAA 3DAQA 1GOXA 3CT7A 5D37A 1FY6A 5AOUA 2VELA 3FJ6A 6TIMA 4O10A 4FNUA 4MKNA 1WBHA 1VS1A 5FEXA 5I3FA 2A7RA 4XKYA 3DBPA 4BK9A 5LNVA 1EX5A 3VE7A 3TJXA 3UWQA 4O4WA 4OU1A 3GXPA 2A6NA 4Q32A 5CG7A 1F2JA 5DXXA 1TPDA 3MI6A 5K7JA 1WA3A 1W37A 2FTPA 3LV6A 4CQAA 1O94A 4DQWA 1IXPA 4NU7A 2X1TA 3QSTA 2TRSA 5KTLA 3LI1A 3UY8A 1Z48A 3CU2A 1R2RA 1F74A 1AG1O 2C19A 3P84A 2NX3A 1YXCA 3NZRA 4UTJA 5CZ0A 4XBSA 1X6UA 3W9ZA 3FOKA 4EF8A 5CZTA 1RZMA 5KZDA 3TXZA 5GVJA 3W7QA 4QNWA 8TIMA 1LRQA 3VFLA 1IIHA 5F1VA 5HNRA 4IGHA 1MO0A 3OBKA 4M7SA 5AC6A 3MHUA 1PL9A 3NL5A 1K8XA 1NSJA 4ZVJA 3EX1A 4UTWA 3SECA 3UWZA 3TAKA 1JUKA 1ME7A 4LUJA 3P8JA 3B06A 3CLMA 3G1YA 3C2OA 2UV8G 4LT9A 3VI2A 2WSQA 3LLFA 2J9XA 4LV4A 4M5PA 3W07A 3KVMA 5J5RA 1W54A 3TW6A 5A5WA 3N19B 3S5OA 5D05A 4GJ1A 3CTLA 2TMDA 5LZLA 3SSJA 3Q37A 5MHBA 4N9DA 1G4SA 5E93A 3HBLA 3NQ8A 2QKFA 3BG5A 1RV8A 5D2WA 3NOEA 5U4NA 3B0UX 2H90A 4JTUA 4UMAA 4N9EA 5LSMA 1TYGA 4CNPA 3M0ZA 3W83A 3O1NA 3KXQA 2C1HA 3DH7A 3L0GA 2E6YA 1TPEA 3PBYA 2YZRA 1KLYA 5K9XA 3CIWA 4OT7A 4PA8A 1FDYA 2OT1A 4A2SA 3GKAA 3PS7A 1T0OA 1H62A 3FEMA 3S1XA 5CPLA 3TJLA 4GUIA 4CCEA 1P0NA 2ZYFA 3W87A 2WNNA 3MW7A 3O63A 2QJGA 1H7WA 3S1WA 3PB0A 3OVQA 4DELA 5DLCA 5HWNA 3W7LA 4EWND 1GTEA 3QYQA 4I7UA 4ZQPA 3S42A 1FBAA 5DBUA 5F2LA 2FFCA 4FNTA 3W7JA 3WJWA 1SSGA 3W7NA 3FS2A 2XN2A 2Y6ZA 1HG3A 2PURA 4UTWC 1FDJA 3EXTA 1LLZA 1XI3A 4O8RA 4Z1CA 3IGXA 3QEZA 3L66A 1RD5A 3P82A 3ABQA 2WNQA 3S1UA 5HUOA 1LP6A 3CB8A 5CSSA 1KTBA 4RZ4A 1K7EA 1LOLA 3LTYA 1UUMA 2R91A 3N3MA 4FNPA 3G3MA 2E6AA 3NQEA 2Z1BA 1SO4A 1GT8A 2X1RA 3C61A 2CLEA 3OEXA 4MY8A 3N2XA 2Q3RA 4MLJA 4IPJA 5CZSA 3LCFA 4XZ9A 2P0OA 5TBOA 1GG0A 4JNMA 3UWVA 1RQBA 1L6WA 3L21A 1Q45A 2V5BA 2QAFA 3PM6A 5D2XA 1B57A 1PHQA 5SWUA 2B7PA 3DGRA 2WKJA 5E1QA 1PS9A 1DV7A 2ZTKA 4NJKA 2OX1A 2QCCA 1JQXA 1TRDA 1SW0A 1GTHA 4MJMA 3G22A 3MJYA 2CZFA 3S0CA 4RCXA 1TTIA 1I2QA 1R2TA 4MZ1A 4Z08A 2ZA1A 1VLWA 3L0NA 3GB6A 1B3OA 1C8VA 3NAVA 1XFBA 1JRCA 4R34A 3A22A 3VE9A 4UR8A 2H8XA 1O5KA 4PEKA 4OWGA 3GNNA 3NQ7A 3P5YA 1FCBA 3O6DA 5DCEA 3VCRA 3MHFA 2CLFA 1ZALA 3NL6A 5HR7A 1TPWA 1HFBA 2ATSA 3B8DA 1VJIA 3KVJA 4LVGA 1TTJA 4UNLA 1YLVA 2WSRA 4RKAA 1ZJIA 1W0MA 1NEYA 3FKKA 3IVTA 3LRMA 3W71A 3HG3A 5I3JA 2QCHA 1SZNA 4GUGA 3EB2A 1LDCA 1K8ZA 1KTNA 2C6QA 3W76A 2JBMA 4N6EA 2ISWA 2B4GA 3O05A 3NO5A 2D73A 4O12A 1EUNA 4XWUA 2F7FA 5IBXC 4C1LA 2JKAA 4MIMA 4PH6A 4N02A 1WYIA 4LC8A 3BPWA 2B0MA 4K8HA 2ZZ1A 4AVFA 4O11A 5G5IA 1KTCA 3M9YA 1MZHA 4LY8A 3VKJA 4NJJA 2BX7A 3N14A 5AHMA 4MUZA 1RQHA 4IOTA 4C1KA 3G1VA 1KFLA 4CQ8A 3SI9A 3LX9A 4JTLA 4M7TA 1HO1A 1W3NA 3QPZA 4AF0A 4MPQA 4UTTC 5CKSA 3CEPA 4TX9A 1A50A 3S9YA 3CWOX 3W7PA 1BKSA 4JIQA 1FXQA 3UPWA 4CNOA 2V30A 2DZXA 1VHNA 2ZRXA 3OIXA 4A22A 3W84A 1W5OA 2HMCA 4O4VA 4RZ6A 1WAUA 3UNDA 1P1XA 2BWGA 1D3HA 3L5LA 3PSVA 3W1AA 4BWLA 1WDWA 2HS8A 1VYRA 4ZL1A 3LHZA 5AYYA 1KLZA 3CQ0A 3NEVA 1YDVA 2FB2A 4WQ6A 3G0XA 3UYCA 1FWSA 3INPA 1O4UA 1OK6A 4GRSA 3KRUA 1J5TA 1OFPA 4JXCA 1QPOA 4O18A 5DY2A 3TUUA 4MZYA 2OJPA 3E96A 1RVGA 4MFDA 3RU6A 5I3KA 4JS3A 3HIJA 2CU0A 2A1YA 3EX3A 4NXKA 4UTKA 2VEPA 4IPIA 5AYZA 3MYPA 5AHNA 3W85A 3WJZA 4UUIA 1G4PA 1UJPA 3W1NA 3W7GA 3N2MA 3QPYA 3TROA 3NQFA 3IGSA 1H7NA 4G1KA 3S1VA 5F4SA 3QF0A 3LHUA 3N73A 1LYXA 2XN1A 4A2RA 3P62A 1VCFA 1JUBA 3TXVA 5F4XA 2WV8A 3GIYA 3NG3A 1KM5A 3RF9A 4LVBA 5CZJA 2DU2A 1TPC1 3DFTA 4X2RA 2QCLA 2GQAA 1BWLA 4MFEA 5TIMA 2WPBA 4LVFA 1OJXA 4Q33A 2ABBA 5EBUA 4LOCA 1U83A 3WK0A 1A5SA 3GX9A 1QOPA 3LV5A 5J5DA 1EB3A 3HPSA 4BI5A 2W79A 1W1ZA 1QR7A 3RLUA 5D2VA 3UZJA 2X16A 5I3HA 1I8JA 3HGOA 5LNSA 1JCXA 5BOOA 1WQ5A 5K9DA 3KOFA 2GJLA 4GUJA 2FPVA 1I4NA 1GPWA 1Q3NA 3OVRA 4ADSA 4P61A 2ALDA 5D02A 4XTDA 2TSYA 3BVJA 2QCDA 3M6YA 2E77A 1H7RA 4XKYB 1JR1A 1KFCA 3QM3A 5F2IA 4LS0A 2CZ5A 1OX4B 3FKRA 4I7WA 5LGZA 4CLMA 3NQ2A 1F5ZA 4OHQA 1R46A 1AL7A 1AW5A 2YYUA 3W7MA 4LU0A 4IMDA 1CX9A 2WOQA 2NX1A 1O5XA 1SPQA 2ZA2A 3I7QA 2J9YA 4PTNA 3HGRA 3QW3A 4IMEA 3NQGA 4R33A 1VYSX 4K38A 1Y0EA 5KZMA 1G69A 3L5AA 4W9TA 3TA6A 4TMCA 2PRLA 2XFWA 4QM1A 2YR1A 2RHGA 3RMJA 1GVFA 3N9RA 1JCNA 1OVDA 5BW6A 4DO5A 4Y9AA 1TSIA 1KA9F 2DJLA 2DZSA 3GVGA 5EPDA 3W7HA 3JR2A 3BG3A 3GDRA 1LROA 1T96A 2BLEA 5DCDA 2CLMA 1FDZA 4GBUA 1EIXA 2Q8LA 1UCWA 3W70A 2VFDA 4KWWA 3PSWA 4EF9A 3E0IA 3LI0A 4KFOA 3EKZA 3WJXA 4HKPA 5G4EA 4GUHA 1AW1A 3P60A 3OG3A 3A9IA 3CC1A 2RDTA 3O8AA 4HN4A 4YL2A 5AHFA 4IX2A 1KBJA 2EKCA 4QAIA 4DF1A 1P0KA 5DXYA 2WNZA 3EX2A 3W6YA 2GJNA 2PRHA 4AEOA 3VNDA 2YW4A 4NNCA 3BW4A 4HPJA 4WY0B 3QRHA 3LCGA 3SGZA 1SO5A 3NVTA 3HPXA 1YTKA 2VEKA 2DJXA 2QCGA 5FF3A 4KFPA 4NQ1A 1L2UA 1I2NA 2V8ZA 4JEQA 1VRDA 3G8EA 1WXJA 1F7BA 2QUTA 3DHFA 3R2GA 1QO5A 3ZR4A 3RK8A 1Q6RA 2A6LA 1OX4A 1XM3A 3WK2A 2VKZG 1JQVA 2YPIA 1O95A 1QNVA 2NV1A 2RFGA 2PRMA 2CLHA 3W2MA 3TIMA 2B7NA 2QUVA 4OV4A 1WOBA 4I7VA 2EHHA 1QPRA 1F05A 3Q2DA 3R5EA 1VYPX 4ICNA 3QMRA 4YXGA 3NQAA 2YCEA 1KV8A 3W1QA 3U8GA 4U28A 3IRDA 4FNQA 4NJGA 3RLVA 1KM3A 4JYDA 4O19A 4ML9A 1XBYA 4TO8A 4DPPA 5G4WA 1VR6A 4ZQRA 1G4EA 2CWNA 3LXBA 4O0ZA 3CWNA 5DELA 3ZWSA 1MEHA 3LCHA 1I2RA 4CNNA 4JTJA 5HMSA 2VFHA 2NLIA 3I6RA 3LBMA 3HB9A 1T99A 3NA8A 4DXVA 4FIQA 3HG4A 4X3ZA 4EOUA 3KVLA 1YDNA 4RR4A 3N9SA 4OV9A 4FX7A 3HG2A 2QAPA 3W3OA 1OFBA 1YADA 3DKJA 1SFJA 1AK5A 1OYBA 3LTSA 3BW2A 4UMBA 3PB2A 2V81A 5KMYA 5AFDA 1ZNNA 4WY0A 4JX5A 2E6DA 3W7OA 2Y7FA 3PF3A 4GE8A 1J2WA 3TE9A 2PC4A 3STEA 5HJLA 1SQ7A 4MYXA 5D32A 1GYLA 1GG1A 5FF2A 2FPTA 3RNDA 3L9CA 1VGAA 3PULA 3DHDA 2O7SA 1LOQA 4K36A 1KFBA 3GDTA 3MHGA 4PL2A 3EEGA 1TV7A 1W31A 1RPXA 2VENA 4WOZA 5H2ZA 1H50A 2EAWA 3DU0A 3V75A 3SZ8A 4AH7A 3BGGA 5HWJA 2GOUA 4EVZA 3C2EA 3GZ3A 2EGZA 1JCMP 3FFSA 1XXXA 3M7WA 1TREA 1G7UA 1G7VA 1L9WA 2E5BA 3BLFA 1QPQA 1OFRA 2G96A 3PR2A 3W1MA 3W7KA 1VZWA 4UTLA 1SZFA 3TK7A 4FB7A 4LTSA 2VFFA 2ZZ2A 3LXAA 3M47A 4AB4A 2NX9A 2J9ZA 2J24A 2NXHA 2X1SA 3LBCA 3KRSA 4AWSA 4FXRA 4UFMA 4LS1A 3A24A 3HMJG 4O57A 3KX6A 3O06A 1WOAA 3HOJA 3PY2A 1ZENA 3GDKA 1N7KA 1VCVA 3UZ5A 1PV8A 4LC6A 1X7FA 4X9SA 5LNUA 3FA5A 2V2DA 4XQ6A 2YDAA 3DFNA 3MP3A 4ZMGA 3STGA 2P10A 5FF0A 1DHPA 1A5AA 3W7EA 1W5NA 3S5YA 4O50A 2YFOA 4IXHA 3QQ1A 3LCXA 5D30A 3EKLA 5D2TA 2VXNA 4JX6A 1ML1A 3P67A 4UNKA 4RJEA 4AF0B 1EWDA 2Q8ZA 4CQ9A 4JX4A 2FQIA 4OQVA 4Y96A 4IXXA 2NWSA 1W5MA 4IMCA 4Z1DA 5CPNA 3QZEA 3PG9A 3TQVA 3IIXA 5CSRA 1DKWA 3PBVA 3TC6A 1X1OA 1IXOA 3JS3A 2YYTA 3NPUA 4GXMA 3S8HA 3IGUA 1GEQA 3DFPA 1UASA 1IXNA 5C2XA 3QFEA 1SO3A 1M5WA 1PE1A 4RZ5A 3P7YA 1A5BA 3FYOA 3LHWA 5DCBA 1FCUA 1K03A 4P2VA 4M19A 3NZ1A 1GVQA 5D2YA 1WV2A 4K7VA 3SGUA 4ZZ9A 3BLEA 3WFAA 4AAJA 2C15A 1H51A 5D38A 5D09A 3U2OA 1EP1A 4FX8A 5BRBA 2ZA3A 2AGKA 4M6QA 2VFEA 1TV8A 3FIGA 3UWUA 2WQPA 1JJKA 2NXGA 1MXSA 2W6RA 1LBMA 3LTPA 3C4UA 1K7FA 1JVNA 4K7YA 1HUVA 3LCIA 4H6KA 4GWEA 2CLOA 1MEWA 1TTQA 4N9CA 3THQA 5F2GA 4ZQOA 1QWGA 1H7PA 2OT0A 2XN0A 4JR5A 2ISSA 1IGSA 2Y85A 4IMGA 3G1DA 1WX0A 2AQWA 1FQ0A 4A21A 2QCMA 2FIQA 1RQEA 1XL9A 3TSDA 3W1LA 3ATYA 4QIUA 3C6CA 3CIXA 3T40A 1K8YA 1AW2A 4O16A 5KZEA 3O15A 1EA0A 4JTIA 1GJPA 1FCQA 3QC3A 1NAL1 2NZLA 2G95A 3K30A 1TMHA 3KHJA 5K3VA 3G1XA 3L68A 2JGQA 4HT3A 2QCDB 5FEPA 3TU9A 1XBVA 4HSNA 3UWYA 4QSHA 5HULA 3EWZA 3JRKA 1OX5A 4RX0A 3TR2A 3EX6A 3G18A 4AMAA 3QJAA 1G6CA 1OFQA 3U6WA 4UIOA 5L9FA 2ZZ4A 2BTMA 1Z41A 3W1XA 3SJ3A 1H5YA 3STCA 4N4PA 3FLUA 3IV3A 5FI8A 1TIMA 2CLLA 3BG9A 1LLWA 3LHVA 3SW6A 2J27A 3MP4A 3DFSA 3Q58A 4FXSA 5E0KA 3OHIA 1XC4A 3BW3A 3UWWA 2E5CA 1W3IA 2P1FA 2VEMA 5U7SA 1OABA 2ZZ3A 3L5MA 2VEIA 1ZHAA 4DEFA 1FX6A 2C16A 2ZTJA 4NZFA 1TQXA 4E2DA 4O15A 5HUPA 3GXNA 4WOQA 1FWWA 4E38A 2E5DA
chains in the Genus database with same CATH superfamily
4U10A 1V0KA 1QAPA 2FJUB 3TQKA 4LRSA 1MRQA 3WQ4A 2VL4A 2WHJA 3HGSA 4XB3A 2DZVA 3GK0A 5EL1A 5LA2A 3EX4A 3W6MA 3W88A 2GJRA 5FJTA 1I2PA 3L2IA 4XO7A 3QYSA 3I6EA 1Q7MA 1FOBA 4U5KA 4KIRA 4MYAA 1WKFA 2VCCA 4FNSA 2O7QA 4JFVA 1LT8A 2EPHA 4ENLA 3G8RA 2QGHA 5ECUA 4K1GA 4BWLC 2Q6ZA 2BNJA 3PUDA 1EC8A 2Z0IA 3L67A 1PX8A 1Q6QA 3LM3A 3PC0A 1EHNA 1JZ8A 5DEZA 3BZJA 1TR1A 2BFGA 5HMEA 3H12A 2ZZ5A 5AVNA 4HZ6A 2OELA 4JGDA 3UD6A 2Y89A 4LEFA 1R8LA 4GINA 5CH9A 2G8ZA 3LCLA 3M64A 2CZVA 4H9UA 2NQ9A 4O17A 1XDLA 2E1WA 3S5SA 3ZJ7A 3NZPA 4LH8A 2CLKA 3SY5A 5C7VA 2YX0A 1SFLA 4AEEA 1EC7A 4JQ1A 1ISWA 3PJUA 3T0TA 4LYKA 4WSKA 5EA9A 4UTIA 2D3LA 2GGJA 2GJXB 3R94A 4UTMA 1E4IA 1U5VA 2Y7GA 3EXRA 4X22A 3OA5A 4ZENA 3M1ZA 3M5XA 4GCXA 1KFWA 1UBSA 4TU1A 1ICPA 3ONCA 2WZMA 3UJ2A 2BOEX 3O0KA 4JTFA 3TTQA 3P80A 1B90A 4H9MA 1ZAIA 2OMAA 3M41A 5E0CA 1KV5A 3U2ZA 4H1ZA 3EDEA 3O0FA 3RHGA 3ITVA 3ITOA 2JKEA 4L4MA 1ECEA 5ABHA 2W0UA 2WZTA 4YTUA 2PAJA 3TYEA 3VGFA 2B7OA 2LLEA 5EFDA 5GNZA 1M3UA 3SUVA 4G2DA 4RV8A 3MUY1 2OLHA 2G3IA 4HK7A 1XUUA 4S2CA 4XX6A 5TQLA 3H2AA 1CNVA 1FWTA 6ALDA 1CXIA 5BNKA 3VOCA 2ESCA 4KFNA 2VRQA 1TPB1 1LM1A 3W7DA 4MMWA 1AJZA 5D9NA 3GG1A 2BVWA 5DF0A 2A7PA 1TPH1 2FHCA 1WUFA 3QQWA 4I9AA 1UQZA 4ZOAA 3AMCA 2X0HA 3BK0A 2GK1A 3SM0A 1YXDA 2G3JA 4ICCX 4CN6A 2XJ7A 1K6WA 1YTEA 3LY0A 4G56A 4CD8A 1KXVA 4YPJA 3CZ8A 1YRRA 1MNSA 4UFJA 3TFCA 4AX7A 1BWKA 1DQXA 3R13A 2A4AA 3MTWA 1VFUA 4OKDA 3SGGA 3Q67A 2GVLA 3A6OA 5FACA 3MZNA 4NSBA 3TX9A 2B31A 5CBJA 1IZKA 3V36A 3Q4DA 4YTTA 4H83A 1PCWA 3HF3A 4AXNA 4HCDA 4HNVA 1KC7A 3LDVA 3FNDA 4E2BA 2JK2A 4GBDA 1A3HA 3WUFA 2TPSA 4Z1AA 4RNFA 4YVXA 1VBHA 1AMYA 1SR0A 3PZIA 3UJEA 3SRHA 5EMYA 3MBDA 2BXZA 1PCKA 3B8WA 3LMYA 3W2JA 1DL3A 3O6AA 1P7TB 1WZMA 4HA4A 3RCMA 1FVPA 3VFCA 4CCDA 1BFNA 1L6FA 3KM8A 3QW4B 1ALDA 3E12A 4LWWA 3FYYA 2VFIA 4H6QA 1LQAA 2XH7A 5JMUA 3S46A 4M82A 2Z1XA 1MW3A 1TJPA 4WKAA 1YBQA 4S3GA 4FIRA 1O66A 5BROA 2ZWYA 1OD8A 3WN6A 4MY9A 3E49A 4MWAE 2JGYA 4L1GA 2DFAA 3P5ZA 3CNYA 2HPIA 4LRTA 5DBTA 4NJIA 4B2DD 2QNEA 4UQEA 4HPXA 1W6TA 3U5UA 4W8BA 2ZVRA 3MI2A 1MQQA 2XIJA 3NM3A 2OTDA 2X2GA 1CB2A 2XHYA 3ELFA 3UXLA 2QIWA 3KBMA 3ATZA 5IBXA 3HQ1A 4RV3A 4RW3A 4HA0A 1QI5A 3CV1A 1NFGA 3NZGA 6A3HA 1HW6A 2AKMA 3SCQA 1ISVA 3TN6A 1UWTA 3ZWTA 4ZFCA 2RH9A 1EPXA 1VC4A 4NX0A 4LX4A 3VGDA 1VPYA 2ZQ0A 4WGHA 5BRQA 1GZJA 1FWCC 3TMQA 4J3UA 4UWMA 3N4FA 1XUZA 1XLCA 1XGEA 4LVDA 3AISA 4L6DA 3WNMA 4V1XA 4XD5A 1NVMA 1ME8A 3R8GA 3HJZA 2QUUA 2WVVA 2OZTA 4C6FA 1NDZA 5FEZA 1NP0A 5A94A 2XM2A 1YE4A 4KMQA 1JZ2A 4DO4A 3KBVA 5LKYA 3LQLA 1QPNA 2O92A 1R87A 3C5QA 3P81A 1K02A 2FZ8A 2DZPA 4GI8A 1ITUA 2WCSA 5C70A 2EPNA 1S2TA 3J7HA 4I9TA 4QSFA 3H24A 5A8QA 1UIOA 2ISVA 5IM51 2DZUA 1W3KA 1NDWA 4DXKA 3F1QA 1MUCA 3RX4A 4ZQMA 3SQSA 1JXJA 4RLIA 5EMLA 1S3HA 3BAWA 2WZEA 3REQB 2PGEA 3EOSA 2ZFAA 4KCTA 2YBTA 3OO2A 3B8IA 4C6BA 2VOMA 4W84A 1J0YA 1QNSA 4LW7A 4Y7EA 3VKCA 3W75A 3W28A 1O60A 1TQJA 3M5VA 5FOOA 3EDKA 2E09A 5IFPA 1UH3A 5K9CA 3WBAA 3QVQA 2E6FA 1BGAA 5EB8A 4WXZA 3XISA 2DH2A 3OBAA 4IZGA 1OFEA 1HTIA 3LOTA 2XFFA 1VFSA 1V0NA 4YVPA 1WAWA 3LYEA 3C52A 1KBIA 4ORIA 1PDYA 3QFWA 2F6XA 3VAVA 2QJHA 1U5JA 3NTYA 4JTEA 4QRNA 3KBNA 4E5TA 2CKRA 1TCDA 1OFAA 1YXYA 4NZ1A 1ZCOA 3ARQA 5LHEA 3DFQA 2C8NA 4JQ4A 3E0VA 1TELA 4PULA 2EO7A 3P2VA 4Q7NA 2RDXA 2E1DA 4O1DA 3GH5A 3PUOA 1IF2A 1F3WA 1R3QA 1J10A 4AZCA 2HS6A 2YKKA 1NM9A 2WANA 5XIMA 3OTRA 4L6HA 3W2UA 1B9BA 2DVTA 3TFXA 1UROA 3COTA 3E6EA 4YCPA 3I7SA 2PODA 2ALRA 1PZ2A 2BHYA 3ZQ9A 2YBVA 3QLDA 4Y9NA 5AB3A 4AD1A 3VTRA 1JRBA 3BJFA 2GGGA 1EQPA 4JYEA 3NQ6A 1N55A 5HNNA 3MQTA 1LRTA 5M2FX 3ZFHA 4HTYA 3IVSA 3UETA 2D0HA 1PEZA 4HU4A 2F61A 4A3QA 3CAVA 2GVGA 3GXDA 4HBKA 1XLIA 1HZYA 5C54A 5LA0A 3M5ZA 1OC6A 2AAAA 4CCZA 2VZSA 2QPXA 4FF7A 1C9WA 3SN1A 1KGXA 2GQ9A 1Z3NA 1IV8A 2INEA 4NZ3A 4E4FA 4Q4QA 3SRDA 2NSXA 3WEMA 4HSOA 1ISXA 2CZDA 1FWEC 1BPLB 3W23A 3CUHA 3R25A 4UFKA 3DHUA 2Z28A 3QHMA 2C14A 1TMLA 1X38A 1JXKA 2H8ZA 4UZUA 3LENA 1KRBC 1PIFA 4JCLA 2ZRZA 4H19A 4HA3A 3LLDA 4DI9A 4JZ5A 4RDVA 3N6QA 1UJQA 4HPHA 1E0VA 2V0TA 3UXAA 2R6OA 5CPMA 3GNPA 3KFTA 1H61A 3A3HA 4NILA 2CZEA 3B97A 3SCWA 1QRQA 1GOQA 4XKMA 1KXQA 1XYBA 4M6VA 4TR9A 3MU7A 4UFLA 1X98A 4L5ZA 2V9DA 4ML4A 3WQVA 2GWGA 3PBGA 4ZXLA 4JY9A 3W7CA 1E0UA 2D2OA 3RO6A 3GDMA 4LUSB 2HEJA 3WLSA 1BVZA 3CHCA 1TA3B 5MF5A 4Q4KA 3T2QA 3KHDA 3PHAA 4KCUA 2CLPA 3UQNA 3LGDA 5C8BB 4YLWA 3VIPA 1SJBA 4KEVA 4JTKA 5A6LA 4MSSA 1FWFC 4NG3A 1LF1A 1IEWA 1KFJA 4PODA 2XTKA 4WDTA 3PVFA 1QHOA 5HR6A 5IXEA 1T8QA 2A21A 3MUZ1 1I45A 1F3TA 4JTSA 1KD0A 3WJSA 3THCA 4QEHA 3NUKA 4FA3A 3EBVA 2Y7DA 4BI6A 3GFYA 4ADTA 1KR0A 1K3UA 3DAQA 3CT7A 5AOUA 2ZXQA 3N3TA 4GMEA 4C5YA 2A3LA 4FNUA 2OQLA 5FEXA 3OP2A 1K9TA 2JEPA 4DXXA 1U1HA 3DBPA 5LNVA 1EX5A 3VDHA 3TJXA 4O4WA 1NWSA 2VCBA 4CN1A 5DXXA 1TPDA 1RVKA 4YTSA 1XIGA 1WA3A 3LV6A 1IXPA 2GSHA 8RUCA 3CU2A 4BJHA 3SCVA 4I9JA 3AIBA 2CHNA 3QR1A 3W82A 3NZRA 5CZ0A 4XBSA 3T0BA 3P14A 4QDMA 5CZTA 5KZDA 4QNWA 3L4ZA 1BXNA 2VR4A 2E3ZA 5F1VA 5JBEA 4IGHA 4PMNA 4M7SA 5AC6A 4OBSA 1PL9A 3GTHA 3WD0A 4XK2A 2GYIA 3SDOA 4UTWA 3UWZA 5AYIA 3GC5A 1W1TA 2D22A 1V02E 3WNPA 1XLDA 4ACYA 3C2OA 3S2NA 4WLCA 5IOBA 1NTHA 3UZXA 3EOEA 1HJVA 4KRZA 1XP3A 3WG6A 3W07A 5J5RA 3A4WA 1GORA 4KCVA 1R3YA 3HFYA 3S5OA 3WMSA 2W91A 2PC8A 4AEFA 3SSJA 5MHBA 3AZTA 3HBLA 5D2WA 1WP6A 3NOEA 1T40A 3KS5A 4V33A 4MB4A 4PMYA 2CBIA 3PTDA 4B16A 2H90A 1YKWA 4JTUA 4ECLA 5A8OA 1TYGA 4OUIA 1UA7A 4QDWA 4PUEA 2Z25A 3KXQA 3AIVA 5LIXX 1GZ1A 7REQB 2WVUA 3WELA 1KLYA 4J3SA 4OT7A 4XD6A 1XINA 1BYBA 4US5A 3AUJA 2V5KA 5CPLA 3TJLA 4GUIA 1XRFA 3AZRA 2ZYFA 2UY5A 3MW7A 1BTCA 2QJGA 3V0SA 1GW9A 2HE5A 4DELA 1ZLPA 3N4AA 4W86A 1KO0A 4HMDA 3QYQA 4X0VA 1EOMA 4H8HA 3PZUA 4EWND 4BS0A 5DBUA 4ZO7A 4JTQA 4LUYA 2BY0A 5C9WA 1SSGA 3I3EA 1GW1A 3FS2A 4LF2A 4XAGA 1LLZA 1A47A 3IGXA 3I10A 4TTGA 2ZUMA 4K2SA 3AMGA 4REQA 3Q45A 1QW9A 2XU2A 3N17A 3CB8A 4JFUA 4WKHA 5CSSA 1KTBA 4RZ4A 4W8LA 3G3MA 3NQEA 3A4JA 3N2XA 1QXLA 3GIQA 3HA1A 4D1JA 1QPKA 1LG1A 4LUTB 1JG9A 3ZT6A 5TBOA 1GG0A 4JNMA 3UWVA 1G5AA 1RQBA 4YHGA 2QAFA 3PM6A 1PHQA 5H1WA 2B7PA 3NQBA 2FZMA 1PS9A 1R7OA 3BJTA 3JZUA 3ME3A 3G6LA 2YBUA 1XWYA 4B5VA 2ZTKA 3ARYA 2WBKA 5GQBA 2ZUTA 4CKQA 1UWIA 4D6JA 1JQXA 1K9DA 1GTHA 4MJMA 3G22A 1UWRA 4RCXA 4YTQA 4PRWA 3VOGA 2ZA1A 3GB6A 3VOFA 1C8VA 1V3JA 1XFBA 3VNMA 1JRCA 1Q6CA 4G8TA 2P50A 1O5KA 1FWBC 3L4WA 3P5YA 5DCEA 2XFYA 1MRAA 2E7FA 5I3DA 4FZIA 3E2QA 1XS2A 2UY4A 1ZBWA 4RUBA 1EL3A 3AS3A 4GUGA 1PWMA 1Q66A 3WBYA 2JBMA 2J7BA 3PBMA 4XUYA 3T2PA 4DI8A 2QS8A 5JU6A 4I90A 1PKNA 3ITXA 1EUNA 4KEZA 2F7FA 3AYRA 3H2EA 4C1LA 2CBVA 1RA5A 1IEQA 1JNDA 2ZUNA 4HMEA 5CG0A 4DZ5A 4ZE4A 1B1YA 4K8HA 1W3HA 4O11A 1SJDA 4RNJA 2OLSA 3M9YA 3SUUA 2P3ZA 4NJJA 1UR4A 1HKJA 3DDMA 3TEVA 4IOTA 3SQLA 1CXHA 5FJJA 3T05A 1PKMA 1GOKA 5FAJA 4M7TA 1HO1A 3C0QA 4H7VA 3QPZA 1F3XA 5CKSA 2BS9A 3CB3A 3POCA 4H41A 3W7PA 5LYRA 4CNOA 2V30A 8XIMA 1VHNA 3AICA 3OIXA 2HMCA 1WAUA 3BV7A 3L5LA 3UW6A 4B91A 4BWLA 5CC6A 2HS8A 3F4CA 1QI0A 3VNIA 1DIKA 1DYSA 3IRSA 3LHZA 1FFRA 4M1BA 1YDVA 3G0XA 3A64A 2PD5A 3MVTA 1O4UA 4IQEA 3NJ3A 1UD5A 4W87A 3ARVA 1QPOA 3CMGA 4NZCA 2OJPA 4GCAA 4MFDA 1WKEA 3RU6A 4JS3A 2CU0A 4NXKA 2INFA 2VEPA 2IS7A 2PPGA 2PTYA 5AHNA 3OODA 1V8EA 2BY1A 3VKAA 3T81A 4UCFA 3TROA 4I6KA 3LHUA 3CZLA 1LYXA 1VCFA 3AAMA 1JUBA 4HVXA 4LVBA 5CZJA 2OLAA 2DU2A 4X2RA 1XQKA 4YYFA 4NAEA 4A4AA 4RE3A 1F4AA 1EJSC 5T9CE 3VD7A 2FKPA 2IKHA 4DX3A 2QYGA 4PBGA 4JL2A 4BI5A 2HWGA 1WXYA 5BXRA 2Y8VA 3ZVHB 5LNSA 1JCXA 4R3UA 1WQ5A 5K9DA 2QMKA 5B80A 3ZO9A 4DB7A 4XZLX 4GUJA 4GOAA 3IJ6A 5A6BD 2E8YA 2TSYA 2QCDA 4EKJA 2RJHA 1J6OA 4J7RA 5HA7A 2VGBA 4GGHA 3WEZA 2DT1A 3R0KA 4RE0A 4D6HA 5I06A 4OHQA 3TC3A 4BQ4A 3TTEA 3BSHA 1TE1A 3UG5A 3NEHA 4DIAA 4ILSA 1XLBA 2ZA2A 2J9YA 4IFOA 4G7EB 3AS0A 3QW3A 4M1RA 2Z4GA 4R33A 2VTFA 4MWAC 3L5AA 4W9TA 2PRLA 3AXIA 4J3TA 4K3ZA 4QM1A 3EZ4A 3RMJA 1GVFA 3EPOA 3BH4A 4Y9AA 3DEQA 2DZSA 3GVGA 3BG3A 3WQ5A 1T96A 3GQYA 2CLMA 1FDZA 3SJNA 2XISA 3D47A 4RZBA 2OO6A 3MDUA 3W70A 4EF9A 1VEOA 3OVGA 3GBDA 4B15A 4NZ5A 4JTDA 2CC0A 3WQPA 3GO2A 3L2LA 3JU2A 1DP0A 4GI4A 3CC1A 2C79A 3O8AA 2AL1A 3PZMA 3ZSSA 3VU2A 2WK2A 3VGHA 3DFHA 1KBJA 2EKCA 4KETA 4GPNA 1JPMA 4H9VA 4XIMA 1MQRA 2VC7A 3FVMA 3W6YA 1DJZA 4I3GA 3BW4A 1SO5A 3HPXA 2QCGA 6XIMA 4KFPA 1L2UA 2MNRA 4DWSB 1ZCCA 3BC9A 3QGVA 3GNRA 3PJXA 1QO5A 3PZOA 3ZR4A 2QV4A 1EFZA 2WWCA 4UOQA 3BUVA 1OX4A 1XM3A 2GVEA 4EXBA 4X61A 5HPCA 4NASA 5D8ZA 3TN4A 2OGYA 4MUPA 1C91A 4OV4A 4I7VA 3Q2DA 4ZSUA 4H9ZA 3QMRA 4YXGA 1W1A1 4IF2A 4QEEA 2VCAA 1M65A 4U28A 3DYOA 1O5RA 3VDBA 3CAQA 1M68A 1EX1A 4O19A 3ARWA 4P7RA 1I60A 3PJTA 2OG9A 4HPGA 1SFTA 3DIPA 5AECA 5DELA 3ZWSA 1P1MA 4DBSA 5TAOA 3LBMA 3HB9A 3DN5A 1RK6A 1J0IA 2DQWA 4B3ZA 3HG4A 4W4QA 3KVLA 2PDCA 2R9RA 3UNTA 4FS9A 1VFFA 3U2CA 3N9SA 4OV9A 2O9PA 4W93A 2QAPA 1XGZA 3PPFA 3WLHA 1AK5A 1JFHA 1DPMA 3S1GA 3GVWA 4UMBA 2NQHA 2V81A 3T8QA 2Z24A 4N42A 4JX5A 2E6DA 3W7OA 3RDKA 3URNA 3WD3A 1T41A 2WXDM 6XIAA 5HJLA 1SQ7A 1VENA 3CO4A 5FCZA 2P8CA 1GYLA 1GG1A 1S46A 4QTGA 2FPTA 3PULA 2O7SA 1XC6A 1SVDA 4K36A 5GNYA 1KFBA 3MHGA 4PL2A 3VO0A 5JVLA 1W31A 5H2ZA 3DU0A 4S3CA 5LIUX 3AS2A 3BGGA 5HWJA 4DJFC 4Q8QA 3C2EA 3KOXA 6PTDA 2J7DA 3VNZA 1TCMA 4LYQA 1L9WA 4J27A 3UVIA 3W1MA 1KBKA 2ZIDA 1ZB5A 1VZWA 1GKRA 3GRIA 1ONEA 3GDBA 2J24A 2CIPA 2IQDA 4DJDD 1XGDA 2WHLA 2V5DA 3VDGA 4AWSA 4BHYA 2ACSA 3UF9A 2I17A 2NV9A 3O06A 2WB5A 1ITCA 1ZENA 1BG4A 1RBOB 1YIXA 4BY3A 2IUZA 1R85A 2PP0A 3MMUA 4LC6A 5LNUA 5JBFA 3FA5A 3DFNA 3MP3A 4ZFMA 4ZMGA 3STGA 2P10A 1CGTA 3QGAC 2FH8A 3HQNA 2X2YA 4S3KA 4GC3A 4XSMA 1EJTC 2YFOA 4IXHA 2E9BA 3QQ1A 3BCJA 4AY7A 3NDZA 1A5UA 1QW8A 5M03A 2XIQA 5DRIA 4UNKA 2ZX9A 4RJEA 3QZ6A 2Q8ZA 4OQVA 2FQIA 2NWSA 1W5MA 2ZX6A 5CPNA 3I3BA 1SJCA 1ZSXA 3TQVA 3N6HA 1XLHA 3TC6A 2QVHA 2P3EA 3JS3A 1XLJA 4HNOA 5EBAA 4GXMA 4IH3A 3DFPA 3ZZ1A 4H9XA 1XIIA 2G4FA 1M5WA 1PIGA 3R0DA 3H70A 4WGXA 1RBAA 3VKDA 3LHWA 4PUJA 4M19A 4M0XA 3WNKA 1IWAA 1FHDA 4EPEC 2XIIA 2Q02A 3BLEA 3WFAA 4AAJA 4X63A 2C15A 1FWDC 3KP1A 5D38A 4S38A 4FX8A 1TVLA 2AGKA 2VFEA 4MWAB 5C2GA 3OG2A 4UZSA 2C7FA 4YWSA 2NXGA 5CJ5A 4ACZB 1EJWC 1MXSA 2W6RA 1LBMA 1QHPA 1GYMA 2JIWA 2QVNA 2BGSA 3C4UA 4K7YA 2J7GA 4W7WA 1UG6A 4H6KA 4GWEA 4HU0A 3ZR5A 2DUAA 3QTPA 1MEWA 4WEVX 1R6WA 3IWPA 1NP2A 4DM1A 2XN0A 3CQKA 3VINA 4A21A 1RD6A 2F2KA 3TTOA 3CIXA 4G7FA 3WEOA 3H22A 1JCTA 1OD0A 1GUVA 1GJPA 1S2AA 3F5LA 2FVLA 2WVSA 2VGGA 2G95A 3K30A 1TMHA 3KHJA 1EQCA 3BMVA 1UD8A 3G1XA 2JGQA 3TU9A 1XBVA 3JRKA 1PBGA 3O3RA 1OX5A 3WQFA 1RJQA 3A4XA 3U4FA 3U6WA 5L9FA 3W25A 3R10A 3H8AA 4AY1A 1TR9A 1E6PA 1H5YA 3FLUA 3DGBA 5FI8A 2PDKA 3KL0A 2GWNA 1VBGA 3MP4A 3Q58A 1XC4A 1ZBVA 3BW3A 3UWWA 3ZOAA 3VOHA 5U7SA 4XO6A 1UHVA 3OZYA 2BDQA 3GU1A 2C16A 3UZZA 3FXGA 1QJWA 3BQ5A 2J13A 1TQXA 4XZMX 5HUPA 4WOQA 1FWWA 4X0NA 3N2TA 4HHPA 3F5KA 5I7GA 4UTUA 2DZTA 4D9PA 3GVVA 2RDWA 3WK1A 2W4XA 2W62A 1W5PA 2DW7A 4NL1A 3BLIA 3GR8A 4OBTA 5H8MA 1XIFA 4M81A 4S1FA 3GW3A 3WIJA 4OGZA 2FGBA 4XSLA 2QMJA 5BRPA 2G97A 1NF7A 2OPJA 1VJZA 5FAGA 4RDYA 1GVEA 3GY1A 2Y61A 2V3EA 4AIOA 1BQCA 1OYAA 1GQIA 3N6JA 3KRZA 1QCWA 5J8LA 4AVOA 5LIKX 1QK2A 4ZO9A 1B3ZA 4UOZA 4CVWA 4BF9A 1KM1A 5T26A 2RDUA 1L6GA 4P7NA 3M0HA 1E40A 3CS2A 1XFCA 4CD6A 2A85A 3N18A 2E8ZA 3PTKA 1EXPA 4GVHA 1E0XA 2XH0A 5HNUA 5BWFA 4JNYA 1NARA 3GS6A 4CCCA 3NXLA 2HROA 4HNTA 4AHOA 4JIPA 5M1TA 3SQMA 1Z42A 1E15A 1HP4A 2YSWA 1BRLB 1W17A 2QCNA 3SUWA 3FV9A 1QATA 2WJEA 1REQA 1Z9AA 1R3WA 3QPEA 3W2NA 3DKLA 4ALDA 4I5RA 4EAYA 3WUEA 2XZ7A 1PZ3A 4O52A 3WLMA 4K37A 3GKFA 3HPAA 1X39A 1EZ2A 3GXTA 4KPLA 3L23A 1YYAA 2QQ6A 4LAZA 3TNOA 3GTXA 2J7FA 3SIZA 5L6UA 6ENLA 2X09A 3GHSA 3NNTA 1C9DA 1KB3A 5H91A 4IMAA 4WDUA 1ELSA 3HM7A 3LZ3A 1ADOA 4UBPC 4QXIA 1VIZA 3TV8A 4POCA 3WYZA 4AW7A 3B03A 3MCOA 1UWSA 2E9MA 3A5VA 3RIKA 2PTDA 1VQTA 4PYSA 3SB0A 3UJRA 1H0IA 4GX8A 3G3DA 5FJOA 2GVYA 2OKOA 1Q85A 3ABOA 1VAHA 1J11A 3F03K 3CEUA 1RCOB 4Q22A 2VDIA 1QFEA 3C0JA 4AC7C 3UY7A 4IUGA 3T9PA 5T91A 1EOKA 1M41A 2C0AA 2XINA 3UCQA 2XIMA 1FHUA 2RKXA 2V38A 4U3CA 3ZJKA 4HU3A 2V67A 4J5NA 3YPIA 3KP0A 3AHYA 3DC0A 3MI3A 5F1UA 2EJ1A 4M8UA 5I3GA 1N2VA 2PBGA 1R86A 4D2JA 4AZ5A 1LZOA 1TO3A 3WDQA 3VIJA 2BOGX 1MVYA 1GNXA 1SO6A 3NQCA 1JZ4A 3URBA 2R1KA 5CPOA 4E4UA 3TW7A 4MG4A 1WKYA 4PCNA 1P4CA 4LCRA 3WQ6A 2J7HA 1BSLA 1QOXA 4IFKB 4WD0A 1E4LA 3PFMA 2XH2A 4AFYA 2FPYA 1GPFA 1JYVA 1OQFA 3T4CA 2X0SA 1VCGA 3TVAA 4ZQCA 2NUXA 1H2JA 1CXFA 4HYRA 1TTPA 2DSKA 3WQWA 5CCZA 1US2A 2WJDA 5ABTA 2WSYA 3AALA 3OGRA 1GVOA 2IKIA 5LNWA 1B9ZA 4JN6A 4L9YA 3CZGA 1GKQA 1WBJA 3BOLA 3E5PA 3NQVA 4U4MA 4L4PA 3VGEA 1OG6A 3KAOA 4B5TA 5ABFB 4N4QA 3OZPA 1VF8A 3BE7A 4B5XA 1P48A 3U7VA 2QCFA 3TYZA 4U3AA 4D72A 3ZYZA 2AL2B 2PWUA 2CFFA 2CCRA 4F4RA 4XAPA 5A8GA 5ABGA 3GR4A 2I1OA 4XVDA 4PBEA 2I9EA 4ADUA 3VNKA 2WW5A 4O0KA 1IXQA 3W7RA 4K8GA 1NDYA 2RJGA 1LTDA 4ONVA 1GCYA 4J35A 4LV9A 4MDOA 2QUMA 5JH1A 3H7UA 1XRVA 1UC4A 1K6AA 1WDSA 3KTXA 3BLLA 3MYOA 3RX3A 3THDA 3VGGA 1GK8A 3UVAA 5FJPA 3MV01 3PUEA 1J96A 3VYLA 2Q01A 2ZUSA 5HMDA 5FL1A 4AZHA 1TPFA 5G1YA 2REQB 1G67A 4LY4A 1H7OA 4P8UA 4N6FA 3RAOA 3LGEA 2WKGA 4NF7A 4FAMA 5FD0A 5DX7A 4K6AA 3FYPA 4NXSA 2Y0FA 1B5TA 3WLOA 3ALFA 3WL0A 4LALA 5HINA 1AVAA 1S2WA 5FSDC 5BMWA 2I9UA 4HOWA 3VVGA 4DJEA 4E0CA 4F66A 3UCDA 1U30A 1A0DA 4NT0A 1QT1A 3CXOA 1OFDA 4QLJA 3G1FA 5CC3A 5HWMA 1AH4A 2W61A 3KL5A 1CB7B 4I9MA 4E2VA 1GJWA 3EMQA 3KWSA 1GHSA 2CHRA 4DAFA 3WLTA 3D5HA 4ZODA 2VX5A 4GIAA 4Q8MA 3PZTA 3R12A 2Z1SA 2V2HA 2VWTA 5E09A 3EGJA 1Q6FA 5HOSA 2W27A 3CHEA 1ZAHA 4PB5A 1DJWA 4Y90A 1LOSA 1J5SA 3IJ9A 2BZNA 2PFHA 4JHZA 2QDDA 1TE6A 1L6SA 3HO8A 1E1CB 4HGXA 1H1YA 2G41A 2BY3A 1LBLA 2PCQA 3NURA 4Y8EA 3HG5A 1J4EA 3C3NA 4MTVA 1M03A 3G6MA 2OEMA 3UBPC 5LIYX 1Q6LA 1SW7A 2OZ0A 4F0MA 4Q3MA 3L65A 4BQ3A 1X8FA 2IQTA 4GYPA 1GZGA 4IIBA 1TKKA 3PPHA 2AAMA 3TWAA 1U33A 1ME9A 3G1HA 2CKSA 3LZ5A 1IR2A 5DT5A 1V77A 3IJQA 3BGJA 1GGOA 1PPIA 3THAA 3IVUA 2ZE3A 3ABXA 1S5MA 3O2LA 3UP8A 3BOXA 3W2LA 3BDKA 1EP2A 1JL8A 2X40A 3E38A 3RPMA 2XZ9A 3T6CA 2Y63A 3JW7A 2OQYA 5BXTA 4JTGA 2VFGA 1JULA 2I5IA 2WMGA 2TYSA 9XIMA 4GC4A 4WSHA 4HP5A 2EF9A 2PS2A 2QDGA 5IDZA 3C0SA 4LUIA 2I57A 3ICJA 2WZHA 1DVJA 4GG9A 3BLPX 2Y8KA 2E67A 4AIEA 1FWJC 3PWAA 5C71A 2W67A 1V08A 1FWIC 4DF2A 3NIYA 1K9FA 3QTGA 4DZAA 3NPXA 4NNAA 4GZIA 2PDIA 1EGVA 1S5WA 3DXIA 2PU0A 3PPCA 4NUWA 4OFCA 5KSWA 3VD5A 2BP1A 3WQGA 2I56A 4IUOA 4JHMA 3K8MA 3IANA 1EDGA 5HPOA 2UBPC 4HK6A 4JD4A 2GDVA 1UUOA 3H4WA 3EDJA 1EYWA 3BO9A 1EO7A 3SR7A 4B5NA 4ICMA 1X7IA 4EK7A 4GH3A 4RE2A 1A0EA 4BA0A 4HZ8A 4KEUA 1HKKA 3RILA 4Q8TA 4BR1A 3TOPA 1JCYA 4JY8A 1CXLA 3OIHA 2OCZA 5EY5A 1FWRA 1XKYA 1OINA 3OQ8A 2P5NA 2DIEA 2DY3A 4FI4A 4ROPA 1A4MA 1L2QA 1S38A 4MJZA 1XBZA 3T1GA 2FJKA 1HGWA 5K2ZA 4LNYA 3APYA 3NM1A 4C6QA 3I68A 2C13A 5KINA 1GONA 1AA1B 1XH0A 3R89A 1OB0A 2G5WA 4NX5A 3WK3A 3I65A 2BBFA 2CESA 1W56A 1TV4A 4CNUA 3HPZA 4I8YA 3WF4A 1VHCA 3HGJA 4E4PA 4QQ3A 4V1YA 1DXEA 1VP5A 3G5EA 1BG9A 1GYNA 2WNWA 1E55A 4Q6JA 1H4PA 4MOZA 5I0DA 1UUQA 3SIMA 2YXGA 4C7GA 1M53A 1XPYA 2Y24A 4MKVA 4GNJA 2NUWA 4PMJA 2VZTA 3NL3A 4UFIA 4HA1A 1AD1A 3M16A 4AWTA 2WVTA 3BAXA 1S5NA 1D8WA 5D33A 1A53A 1JGMA 4E8GA 2J77A 1I6NA 2X30A 3BV4A 5C7HA 4F0LA 2QR6A 1VBUA 4K39A 2GK1B 1XBXA 4PC8A 4OUEA 4DBDA 3CAWA 4Y2WA 3VIMA 3TJ4A 4GYFA 3WLNA 2WJZA 3O07A 3U4AA 1EEXA 1MSSA 3DI1A 3FW6A 2PCEA 2VC6A 1HJUA 2VQUA 3EWWA 3OBEA 2ZOXA 1QUMA 4TVUA 2NV2A 2Q09A 4GQ0A 1E4MM 3SCSA 1CI1A 2XG9A 3WDPP 2A0NA 3G0UA 3MANA 3MA8A 3PUGA 2NUYA 3H54A 3SN0A 3NGJA 3U5YA 3AJ7A 4QJ4B 1LL4A 5H8PA 2QDHA 1X6NA 4RXFA 4A3UA 4GD0A 4GFIA 3TC7A 2XGZA 3M44A 5HNTA 2ISFA 2YCLA 4B5SA 3P93A 1FY6A 2VELA 4GIEA 1AQMA 1JPKA 1LL7A 1KNWA 4O10A 2D2GA 3HURA 1YMYA 5I6SA 5A8MA 2A7RA 3PNUA 4XKYA 2DH3A 3WH8A 1EYEA 3PJWA 1OBAA 3UWQA 5H6HA 2A6NA 3EB3A 4Q32A 5CG7A 3VMNA 2PWHA 1HN1A 1A5NC 3WF0A 2ZX7A 5K7JA 3HU7A 5A6JA 1O94A 4DQWA 4NU7A 1RBLA 3QSTA 3UY8A 1Z48A 1R2RA 1H41A 4J3WA 3M7SA 1E6QM 1AG1O 2G0WA 2VO5A 1XLMA 3V5CA 3PN8A 4UTJA 5DQPA 4DUXA 4QFUA 3W9ZA 4FOKA 3TXZA 2GJPA 2A3EA 2J47A 4NRSA 1HVXA 3W7QA 1VB9A 8TIMA 1IIHA 3PANA 3KZSA 1J93A 2OSYA 3MHUA 1JZ3A 1NSJA 3LU2A 3EX1A 4ZVJA 3WX7A 1JUKA 1ME7A 4JBRA 3BXWA 3P8JA 4LUJA 3NDYA 3LPGA 4BF5A 3VIOA 4IQDA 1M01A 2VX7A 2UV8G 4TV5A 3EWDA 2PSNA 2CITA 3VOJA 3VI2A 3OQEA 2WSQA 1RY0A 4LV4A 4M5PA 4IGMA 3WZ0E 5I03A 1WDPA 3TW6A 3B0XA 1MDLA 3CTLA 5LZLA 3M46A 3CT2A 3BG5A 2F6KA 3JUGA 5IDIA 5LSMA 2WVVB 3HTWA 3M0ZA 5FL0A 1DQUA 3DH7A 4S3JA 3WUGA 4AUBA 3L0GA 2YA1A 3VIFA 1TPEA 2CHOA 4Q4SA 5K9XA 3CIWA 3UG8A 4C91A 4A2SA 3PS7A 3A3WA 1K9EA 5B7ZA 3FEMA 1TJ0A 3S1XA 5CZKA 2UY3A 1P0NA 1PX4A 1CXKA 3SURA 1H7WA 8XIAA 2PGRA 3S1WA 2QPSA 4DHGA 1K4GA 5HWNA 4I8DA 1GTEA 1AQ0A 3S42A 4Q8OA 3WMBA 1FBAA 4ROQA 1TJ2A 1UR3M 1C7TA 3WJWA 4F0KA 3P3BA 4MNMA 1UC5A 3WFLA 1MXDA 2PF8A 4UTWC 3EXTA 4P8VA 3KBWA 4ZGYA 4FR6A 3LA4A 4Z2LA 3L66A 3ABQA 2GL5A 3S1UA 3NSNA 5HUOA 1LP6A 2XFRA 3H2NA 4GY1A 4LNCA 1K7EA 3CV2A 1QBBA 2E6AA 3BOFA 2X1RA 2OQHA 4MY8A 2DT2A 1XG4A 1P6BA 2JF7A 1HKVA 2D2HA 3ZT5A 4IPJA 5CZSA 2QT3A 4CD7A 4E2OA 4XZ9A 2YZ5A 5CJMA 3IACA 4ZCWA 5D2XA 4KEMA 1GEHA 3EDDA 4HD5A 2WKJA 5E1QA 2BHUA 4LF1A 1V0MA 4WVXA 1R3TA 4WSJA 2IPGA 4F40A 4NJKA 3EB4A 2QCCA 2JALA 1S1RA 3WH6A 3MJYA 1RALA 2IPWA 2CZFA 7REQA 2X05A 3RM4A 1I2QA 1R2TA 4MZ1A 1VIWA 4W8AA 4Z08A 3L0NA 4W85A 1B3OA 3KLKA 4AZCB 4L65A 4R34A 3A22A 4MNLA 4J28A 5F7UA 1EDQA 1JDCA 5EMJA 2HBXA 4JQ3A 3AUOA 2DGAA 4PZVA 1FCBA 3IJLA 3O6DA 3ECQA 1TPWA 3IJIA 1IWPA 1CT5A 4IFRA 1PZ1A 4AVNA 1ZU8A 4RKAA 3E3HA 4QP0A 3WL1A 3WDJA 3FKKA 3LRMA 3C8NA 3DFYA 4LFYA 2QCHA 1HIZA 1SZNA 4J3ZA 1IT8A 2YIHA 3DOPA 5AZ1A 3S9IA 3VC5A 4E3VA 3NO5A 4B5WA 2D73A 2UWFA 4PMVA 2PLJA 1S2UA 1VFTA 2JKAA 4PH6A 1B30A 3BPWA 1FKWA 3V18A 1MNZA 2ZZ1A 3W53A 1C3FA 1TWWA 1Y65A 5G5IA 1KTCA 3RR1A 1MZHA 1U22A 2VDHA 4JPGA 2OYLA 2PDUA 5HJYA 3SCPA 3N14A 3WQCA 5I5RA 2OOGA 1XX1A 3TN3A 4C6OA 4JTLA 1IEIA 1EJXC 3T0CA 3TZNA 4GACA 3H6OA 3UPWA 2V63A 4C7FA 1OSEA 3W26A 2ZRXA 3GD6A 2D3NA 1W5OA 4O4VA 4QE4A 2ANUA 1TWSA 3W1AA 1QI3A 2DW6A 3E1F1 3V0TA 5AYYA 1KLZA 3MC5A 1TWIA 4GJIA 1BLIA 3CK5A 4GRSA 2OYKA 4JXCA 2EG7A 4EX4A 3AYSA 2X41A 1S1PA 3E96A 2J8TA 3HIJA 3BCFA 4UTKA 3AHXA 1W9PA 3GFZA 2AQVA 3MYPA 4PB3A 3H2OA 4UUIA 1L0PA 1TVNA 4ZXOA 4ZB0A 3W1NA 3W7GA 4C6KA 3QPYA 3NQFA 1Z6KA 1H7NA 4MF4A 3QF0A 2VWSA 1K70A 3P62A 5TF0A 3B40A 1PO9A 1R3RA 3TXVA 1RHCA 2WV8A 3NG3A 1XDJA 3RF9A 3Q65A 1F9CA 2GQAA 1BWLA 5TIMA 4Q8NA 1E73M 4LGXA 3BICA 2HK1A 3GUGA 4LOCA 3WK0A 3GX9A 4LAMA 1QOPA 3LV5A 5A95A 3EA3A 1QR7A 5DMLA 1QW7A 2D1ZA 3T2OA 3A3XA 5I3HA 2WSKA 1V3MA 1I8JA 2OZ8A 4QG8A 3CZJA 3CZKA 2HZGA 3K8LA 4C1NA 2GJLA 1I4NA 4ADSA 2ALDA 3P0XA 2QXWA 1IT7A 1KFCA 1V3KA 2DZAA 3WY1A 1LT7A 4I7WA 3AHTA 1POKA 4AD4A 2OU4A 1XPGA 4LU0A 4IMDA 1TX2A 4DWSD 1CX9A 1SPQA 4Q6XA 3HGRA 2GOKA 4L1XA 4GO8A 4K38A 4YNGA 1Y5XA 1Y0EA 2PBOA 5KZMA 1G69A 3TA6A 4TMCA 3ZJ8A 3MUCA 2XFWA 4ZEPA 4NYYA 3ZR6A 1XCWA 1XRTA 1HT6A 3T4WA 4LAOA 2WMKA 1UWAA 1FWHC 2HQAA 4DO5A 1JZ5A 2BVYA 1TSIA 4P5UA 1KCKA 1KA9F 2AMXA 2NLYA 3W7HA 3GDRA 1RCXB 3MKCA 1LROA 3K2GA 5T8GA 2VZVA 1UCWA 2HVNA 1Q8AA 3EKZA 3WJXA 4AIUA 1UQYA 2WJFA 1KRAC 1F6YA 1AW1A 3OG3A 5JXQA 3JVAA 5AHFA 3FSUA 4IX2A 4P8XA 4WJXA 3GHUA 2J8GA 4H2HA 4PMRA 3V0UA 1WDRA 3LEPA 2WNZA 2GJNA 1DJGA 3I4KA 4P7OA 2PF0A 3ARUA 4HPJA 4WY0B 3LCGA 4C6MA 5REQA 3EPNA 2QZRA 1YTKA 2DJXA 2RAGA 5FF3A 2ZVIA 1W2VA 1MW1A 7A3HA 3RK8A 1XW8A 3CHFA 2CWXA 3WK2A 2VZOA 4DYEA 1HJWA 3WO8A 3W2MA 3TIMA 1KCXA 1EXBA 3FHAA 2YCKX 2B7NA 2ONEA 1WOBA 1QPRA 5MKGA 1UPPA 1ISZA 1TX0A 5E6YA 3UERA 2NW0A 4YIWA 4RPQA 5FSEC 4DLMA 2FFIA 3IRDA 4DY1A 4NJGA 4KCWA 3UT0A 3CWHA 4JYDA 4ML9A 1XBYA 5G4WA 3HPFA 1G4EA 2CWNA 3LXBA 1ZJHA 2VC5A 3RGTA 3LCHA 1I2RA 4CNNA 4JTJA 1JDEA 3MMDA 4REQB 1T99A 4DXVA 5IFTA 3C0LA 1DTUA 5FKYA 2HNHA 1XISA 1OGGA 1DEDA 1DIOA 1V6VA 3W3OA 2WWDA 3DKJA 3W24A 5A6SA 3LTSA 4FXJA 5ABEA 5KMYA 5AFDA 1A5LC 2CYGA 2Y7FA 3KUMA 3TE9A 1V79A 1V7AA 3CO8A 1LJYA 4OVXA 3ZSTA 3WD1A 2XYLA 4Q4OA 1JDDA 2PP3A 3VIIA 3L9CA 9XIAA 3DHDA 1NJJA 2IPJA 2VENA 3SZ8A 2XSBA 4EVZA 1Z8AA 3KOWA 2BMBA 4FOJA 2OVLA 2WMFA 2DSZA 4XAZA 2VURA 3TR9A 3BLFA 3PR2A 3KRBA 4CD5A 2V3GA 4BCEA 5M3WA 1SZFA 3TK7A 5FJUA 2WMIB 3VD4A 3BQ6A 2QGYA 4KERA 1EJUC 2NSOA 4ZE5A 2J7EA 1T7LA 3HMJG 4O57A 4MWAD 1B3XA 3GDKA 2ADAA 3W29A 3WLRA 1N7KA 1VCVA 3RO8A 3UZ5A 5I07A 4TQTA 1KXHA 5FF0A 2MUCA 2O0TA 3MV11 3AWNA 7ENLA 3S5YA 4GX9A 4GABA 4WIWA 4BEQA 4CU7A 3LCXA 1LWHA 2VXNA 4JX6A 1JAKA 1EWDA 4CQ9A 4IXXA 4IMCA 3ZIZA 4CEUC 5HAOA 1DKWA 3PBVA 1IZCA 4IJCA 2YYTA 3NOYA 2ZUWA 4WR3A 4A35A 1LQ2A 5C2XA 3QFEA 2A79A 1M04A 4RZ5A 1ZRQA 3FYOA 2VQTA 1YPXA 3M0YA 5DCBA 3GE7A 2FMNA 2PI6A 3VGBA 1WV2A 4GXPA 3M0VA 6CGTA 3RJYA 1CLVA 2Z1VA 2WSPA 2QPUA 1H51A 4MJ2A 3U2OA 1CLXA 1EP1A 1WKDA 1XSKA 3USZA 2PDJA 1TV8A 2KX9A 3UWUA 3GG8A 5E70A 1JJKA 1DXFA 1JVNA 5DANA 1XJBA 3LCIA 3T07A 3HQPA 4Z1YA 1VEPA 1KQZA 4KESA 1TTQA 3GUWA 1E9YB 4JR5A 2ISSA 1IGSA 2AQWA 3S2MA 3W1LA 4QIUA 3C6CA 4URIA 3DG3A 3T40A 3EMCA 2W66A 1K8YA 3APGA 5KZEA 3O15A 4JTIA 4I5UA 2I16A 1JI1A 4DNMA 3QC3A 2O9RA 3UR8A 3LPOA 4KWOA 9RUBA 3WD4A 2VYOA 1R3SA 4JTRA 4S3AA 2W92A 1XLGA 4HT3A 4C6LA 2QCDB 5FEPA 4H9TA 4HSNA 3JZEA 4GI6A 3EX6A 3RLHA 2BODX 3QJAA 5A69A 1A0CA 2NQJA 3NO1A 3OU8A 2WCAA 4R5EA 1HGYA 1Z41A 3DERA 3W1XA 1B31A 3RPDA 3A13A 1XD0A 1U1JA 1O7AA 4YU1A 1LLWA 3LHVA 2ISDA 2J27A 3DFSA 5E0KA 1TZZA 2C1IA 1Q65A 2H9AB 1W3IA 4GKTA 3AQUA 3ARTA 5XINA 4OOUA 2TODA 3L5MA 4J2MA 3CJPA 4EAMA 1FX6A 4GA8A 4B2DA 4WKFA 4HU8A 2YCJA 3LG3A 2ZTJA 3A9BA 4E2DA 4H8NA 4O15A 2OX4A 4H7CA 2JEQA 4ACZA 7ODCA 2E5DA 1K77A 1MW0A 1VPQA 4OBRA 4DJFD 2WO5A 3IUIA 1UD3A 1X1NA 2ZC8A 4XZNX 4EIVA 3PK7A 3B0YA 3C2FA 2J6XA 1TWDA 3BL3A 4QLKA 1WE5A 3FN9A 3LXCA 3VCNA 1XYFA 1CENA 5AC7A 5G2IA 4MB3A 3ONBA 3A4AA 2J78A 2XVLA 2XVKA 2JFEX 3RU8X 5LA1A 3GTIA 3HFTA 3LRKA 1TFVA 4PTDA 4CU6A 2V5JA 1TUFA 4JTHA 2Z7KA 1XCXA 3P74A 4JDBA 1E51A 3MSGA 3GFXA 3R8RA 4H04A 1FWAC 1B3VA 2BV9A 1OX6A 1FP9A 4I5XA 5KITA 1AL8A 1I2OA 4TX6A 3QMSA 2YA0A 4YCOA 3EWUA 3TA9A 2PWVA 1UWQA 1X6LA 5CAHA 2VEGA 1DJNA 2VR5A 5HQMA 2GSEA 1FWNA 5EKYA 1E9LA 1AQHA 2GSJA 4J3VA 2DZBA 4PMUA 1XH1A 1BKHA 2WC7A 3F2DA 1BEUA 3I4EA 2GGHA 5CEWA 3RX2A 4DZHA 3A5FA 4CQDA 3WDIA 4Y8FA 1HKIA 3G24A 1MFVA 2ZADA 2DVXA 2F8QA 1MW2A 2C18A 2XIOA 3N15A 3AIEA 3STFA 3AU2A 4J9JA 4LPCA 5LHFA 1HKWA 3L4XA 3W73A 4MLRA 4PUDA 1X1ZA 4GZJA 4US6A 4AXKA 3TQ0A 3QBUA 3B0PA 3VDCA 5BXSA 4Q7BA 4B4HA 4IP5A 1OC5A 3SRKA 2G3MA 1F6KA 2RGLA 4KH2A 1UD6A 3OA3A 3R11A 1Q6GA 3M0LA 5AC4A 1IGWA 3UR7A 5CPTA 3CASA 5BMXA 1FKXA 3FA4A 3CAKA 2V5LA 4UQBA 1UBPC 2BG5A 4WUIA 3N34A 1KM4A 4W5UA 4K1WA 1EWEA 5CGMA 1M9HA 5D9OA 3E0FA 3DENA 1DHKA 1XR2A 5HJXA 1UKOA 2PWFA 2D69A 2XWEA 4F48A 1OZQA 4R7WA 1KFEA 4KWSA 2I14A 4IQLA 3DG7A 3BAJA 1F3EA 2PDYA 2AQOA 4UMCA 3TQPA 3WH7A 1R30A 3NDOA 4LYRA 1MEIA 3G1AA 1VJSA 1S5TA 1W9DM 1FH7A 4MPKA 5CGQA 2KZHA 4L7ZA 4Z2HA 5JH2A 1CLKA 1OIMA 3C8FA 1DJQA 1UKTA 3UJFA 1GQNA 3H55A 3U0HA 1MMFA 1V5XA 4F9JA 3L7RA 2VRJA 5B7YA 1XCFA 3UZYA 4GNKB 4AWEA 1QMLA 2EG8A 4WZHA 4RXGA 3WENA 1ESWA 5CLWA 2YJQA 1NF0A 1UD2A 4AHPA 1SR9A 3MBFA 1Z69A 3KLLA 1GWJA 3TKFA 2FZ9A 3W1PA 1C7SA 2HDJA 4IGSA 3WF3A 2E4TA 4J40A 3E9AA 1B4KA 2E40A 4ZR8A 3VXGA 3P61A 4GVGA 1FH8A 3DX5A 5C5YA 3C2YA 3B05A 2V2CA 2QIIA 2O9OA 4UTHA 1EHAA 5A6MA 4PCSA 2FTWA 2YXOA 2OSXA 2JE8A 4JL1A 3N25A 3WKZA 3CHDA 4IPNB 2VVNA 4QITA 2Y5EA 4L61A 4KGLA 4R7JA 2WHMA 4CQCA 3IK2A 1DIEA 5FJRA 5AHIA 2OYMA 1ZAJA 2IPFA 4UC5A 4HZ7A 1W5QA 2G3FA 2WLZA 1W9UA 3SADA 1EBHA 1V7YA 4JKKA 2VGFA 4O1CA 1EBGA 2R1LA 4NI8A 3C2RA 2VGIA 3WBEA 3AJXA 4A29A 3AO0A 3W7IA 1JAEA 5DY3A 1AH3A 3UXDA 4YWIA 5D4YA 4MZ8A 4RDWA 1Q2SA 2ZBTA 1XDMA 3DFOA 3H7RA 2QF7A 1WB0A 1EUAA 3URQA 3QMTA 2JKPA 1GQKA 2Z6IA 1EJRC 5A6KA 3N12A 3RR4A 4JTAA 4UQCA 1R7AA 3PAJA 2NT0A 3A21A 3E0LA 1KRCC 3TSBA 1XHGA 1UMYA 1H60A 1J8VA 1SZEA 2ZDRA 1S5VA 3CLWA 1MZRA 4MADA 3THUA 1HL2A 3B9NA 1JDFA 1RAKA 1DE5A 1OYCA 4H3DA 3OW1A 3KCJA 2YFNA 5A3HA 2XSAA 2NQZA 1E6RA 2AL2A 4DYJA 1A5MC 3O6YX 3SFKA 4UCGA 3PP7A 3RJXA 1JUEA 1UWUA 3MMWA 3OZMA 4Z0JA 3BTNA 3NXFA 4ASTA 1LUCA 3HV9A 1G0CA 5I78A 4AD2A 1EO5A 1E6XM 3B4UA 1XYZA 3HJEA 4L56A 3T44A 5J04A 1QBAA 2FDMA 5D03A 4F0HA 1W1IE 4YTRA 3QQ0A 1YW1A 2GGIA 1JI2A 1V03A 2DT0A 2QUNA 3U7BA 1XH2A 4WY0F 3T7VA 3ABRA 4WX2A 4PL1A 2Y8UA 1FRBA 2SFPA 2REQA 3K1GA 2UY2A 1D3GA 1D9EA 2YB1A 2CW6A 1HJSA 1G01A 1UZ4A 4UOJA 1O12A 1W1VA 4E3TA 1I0BA 4PB4A 2E68A 4LBSA 3CQJA 2GUUA 2GPTA 4QAWA 4ZQNA 3GG0A 3NYZA 4DJEC 3B0VC 4LVAA 3GU9A 4A8IA 3VA8A 1KBBA 4UQAA 4Q8WA 3NR0A 1PDZA 4DM2A 3U2EA 2Y1HA 3PZ9A 3MWCA 3C56A 4N7QA 3GNOA 4OIFA 3IK4A 4MJ4A 1A3WA 3H21A 1ZY9A 1QHZA 2X8RA 1X97A 1M7PA 2P0IA 2R8WA 3RUBL 5E9AA 4ATLA 3TLQA 1UR0A 3WJYA 3WQOA 3EYPA 3TNBA 3AXHA 3DECA 2PDPA 1LORA 2OFJA 1Z44A 3ITCA 3VCCA 3IIVA 3ALGA 1Q6DA 1P5BA 4A8NA 3ZS4A 3A12A 3DHPA 3QSRA 2XVPA 5TD4A 3NVDA 3CTTA 1OHLA 1XD1A 3QHOA 4D6EA 4O1AA 3NWRA 5DMMA 3EWBX 3VM5A 4O1FA 2Q8XA 3ZLGA 4XAYA 5FEWA 1L6YA 4GYPC 1TWZA 3W2KA 2D2JA 1REQB 3WBXA 3ARZA 1A5CA 4NZJA 4XTIA 4C6PA 4PFHA 1J18A 4IJBA 4X9YA 8CGTA 1PX3A 3BCDA 4F9DA 4DO7A 3CM4A 4IWWA 1NQ6A 4JQ2A 1F76A 4UFHA 1KFKA 4F2TA 3LHYA 2G37A 4L4LA 1B3WA 2DP3A 2Q3OA 4FALA 1DWJM 4IX0A 4HIBA 5CQ1A 1O1ZA 4CQBA 1H63A 1PSCA 6REQA 1PTGA 4C60A 3MY9A 1T8XA 1OFOA 3AIUA 1EGZA 4M29A 3O16A 1TPUA 1H5VA 3EWXA 1V6XA 1SU5A 1X96A 1IYXA 2H3BA 4HK5A 4ATWA 3U48A 5M17A 2BHZA 3G1RA 4HYVA 2I5GA 4K8EA 3WH5A 4R9OA 1NOWA 3TYAA 5DMNA 2OKTA 1TJRA 3PG8A 2OO0A 3ZJ6A 4N9BA 2HBVA 3GNDA 3BWWA 2YXXA 4HNNA 2CETA 1TVPA 3TYCA 3S5NA 2F84A 3WLLA 2ZXDA 5I77A 4NRRA 3QV7A 4CGTA 1YNYA 2R24A 2A7NA 3H23A 3S3GA 3UZWA 3SCRA 4QJ1A 3GR7A 4BQ2A 4LCQA 5DO8A 2R14A 3H7VA 3UG3A 3D0CA 1DQWA 1OF6A 3TLLA 1E9IA 2EQDA 3ABZA 4M3PA 3S4TA 1ODUA 3LBOA 3ANYA 3PZGA 4GQGA 3ABSA 3UCCA 3MDWA 5FESA 4DPQA 1C90A 1AMKA 4DYKA 4IHCA 3W86A 3MMTA 1KW1A 4PMDA 2BASA 3I6TA 4NI3A 3TH6A 5A8PA 3N1AA 1VH7A 5A1AA 5F2MA 3F7JA 4QGCA 4UR7A 3GHRA 3WSUA 4NAFA 4H6RA 2ZRWA 5K4ZA 2VUYA 1C8QA 2B81A 1QNQA 2BSLA 3V7PA 3ID7A 3G0SA 4JFSA 5EYWA 6TAAA 1HNYA 5AYXA 3RFAA 5G1TA 2ZKMX 3W00A 3R79A 1S2CA 2QV5A 4UQ9A 2PDXA 4TIMA 3O6CA 3UR5A 3TOYA 3VC6A 1VRXA 1GVIA 3LHTA 4TOQA 4Z0SA 5CBBA 1AFSA 1JCJA 3L4TA 4DF0A 3DI0A 3NL2A 5TNVA 3B8VA 2EJAA 4O1BA 2PDWA 3OHMB 3M5YA 1H1ZA 2J66A 3CQIA 2PDBA 4IG2A 4C6EA 1YPIA 5T9BG 3B9EA 4OE7A 1YPFA 3FEQA 1IIGA 4O14A 5CAKA 2A3CA 1J0JA 1XF0A 5BXPA 4HHHA 3F2BA 1MUMA 4QDPA 4FPSA 3SFWA 3CH0A 3VMOA 3KEHA 4D6IA 5D37A 3TYBA 1P6WA 3GYCA 3FJ6A 6TIMA 2OODA 4QS5A 1J79A 1ITXA 2ZUUA 1VS1A 4MKNA 5G4HC 5I3FA 2OSWA 1XYMA 2NVCA 4MAZA 5GJMA 1UW9A 3KBSA 2BVTA 4X60A 2O56A 2NQLA 2PLKA 3MI6A 4ZA0A 1W37A 2X1TA 4P8WA 1U2YA 2TRSA 3IJ7A 3LI1A 3MJMA 1KGWA 4JN7A 2NX3A 4F2UA 4QCEA 1YXCA 3KWXA 4S3EA 1X6UA 2VVSA 1EGMA 1RZMA 2DPEA 3LLXA 3P6LA 5GVJA 4JHOA 3VIGA 4QLLA 1LRQA 4WDXA 5E0FA 1MO0A 3OBKA 1KWKA 1TMQA 3LD5A 1IR1A 2PWGA 1K8XA 3NL5A 1JZ6A 1NQKA 1PYFA 5RUBA 4ZBCA 3CLMA 3G1YA 2FGLA 4Z2KA 2WMHA 4LT9A 2HNEA 4B3LA 5HATA 1WUEA 3VNYA 2PEVA 3KDNA 2J9XA 1G9HA 3N13A 5A6BA 4JFTA 1W54A 3N9KA 1EC9A 3ES7A 5D05A 4GJ1A 3HMCA 1G4SA 5E93A