4FO4A

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, complexed with imp and mycophenolic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
363
structure length
348
Chain Sequence
MHMLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine 5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant, complexed with IMP and mycophenolic acid.
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 113
structure length 348
sequence length 363
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fo4A00
1KM1A 2BSLA 4OHQA 1R2RA 1TO3A 1HG3A 4O14A 2V2CA 1H63A 1TB3A 4CNNA 1OFEA 3W1PA 4JNMA 3DHDA 1H7PA 3P62A 5HINA 1T0OA 5HWNA 4M6PA 3G0UA 5D30A 1C8VA 3GXTA 1SZEA 5CPOA 2Y88A 2XFWA 3MI6A 2H3BA 3FYOA 3A5FA 4H6KA 3B03A 4O0ZA 3WJXA 3LV6A 4CQ9A 1LCOA 1TV8A 2J9XA 4LS2A 2QCDB 3BLEA 3M6YA 4XKYB 1L2UA 5AHMA 5HMSA 5LGZA 3Q2DA 3LTYA 3HB9A 1A5CA 2GQ8A 4EWND 3PUOA 2CZDA 1ME8A 3ELFA 4RXFA 1QO2A 4LUJA 4A2RA 3KFTA 4O4WA 5E0KA 3NO5A 2TPSA 5L9FA 1YXDA 5D04C 2YDAA 4DBEA 1QMLA 1XUZA 1EA0A 1FWNA 2PURA 3G1AA 4AVFA 3W86A 4MKNA 1IIHA 3VI2A 3UZ5A 4DEFA 2FB2A 3SJ3A 1KFBA 4FNPA 5F2GA 1Q6OA 4FNRA 2NZLA 2QKFA 5I3FA 1OF6A 3DFOA 3GR7A 5EBUA 3NQ8A 2Y7GA 1BKSA 4LT9A 3DU0A 3NEVA 2CLLA 5LKYA 1ZAJA 3LTPA 1MEHA 1DV7A 4JS3A 4QITA 3B4UA 1FX6A 2YFOA 4UFKA 2QJIA 1RVGA 4X3ZA 3HOJA 5T26A 4IJBA 2DU2A 5EA9A 3TX9A 3R2GA 3NQMA 3NGJA 1T96A 4BI5A 5F4XA 4PH6A 2YXGA 2HTMA 5F2MA 4O1BA 3QYQA 3ABRA 5LNUA 1JVNA 1JR1A 2Y63A 1K3UA 2EHHA 1G7UA 3MJYA 3QH2A 3UZJA 2ZRYA 2QCMA 1LP6A 2ISWA 3W23A 1RQHA 1KM4A 4AF0B 4EF9A 4RX0A 5KMYA 1DQWA 5AYZA 2QUUA 1LROA 2A21A 1IIGA 3TMLA 3CPRA 3G1HA 3SY5A 1WDWA 3EX6A 3GKFA 5D37A 2NXIA 4MZ8A 3IGSA 3S1UA 3KX6A 1QNVA 3UWVA 1C29A 1VLIA 5DCBA 3W87A 3KVKA 4YMZA 3QMSA 3N9RA 3DKJA 4AWSA 4MLRA 5HULA 3KVJA 2C19A 2A6LA 2CLEA 1DJNA 1SSDA 4UFIA 3V75A 4FNSA 3PG9A 3STGA 3M5XA 4FEZA 1K8ZA 3DZ1A 3DKLA 3E9AA 4J9JA 1GVOA 1VLWA 4ALDA 1E51A 3TCEA 4WY0F 1X1OA 3LX9A 2WNQA 4Z0JA 3HQ1A 2VFHA 2CU0A 3LI0A 2J88A 2R94A 3LCFA 4CNPA 3TUUA 2ZZ6A 2YYUA 3QFEA 3HPZA 2ZA2A 1PV8A 1D9EA 1I2QA 4NZJA 3QJAA 5LNWA 3B0VC 3IEBA 5AC7A 4AHPA 3NVTA 5G2IA 3CT7A 3PG8A 3DBPA 1KFEA 1H7WA 2HMCA 1FUYA 3PBUA 1A50A 3L66A 4FNUA 4QQ3A 1LLWA 1DJQA 3EXRA 1O95A 2NUXA 4NVTA 4YLWA 5TBOA 3TKFA 3PF3A 1H7NA 3LBCA 4ZVJA 4M19A 1LRNA 2JGYA 3SFKA 1W37A 2RFGA 1VYSX 4UTIA 2Y7EA 1NF7A 3IIZA 1SR9A 1EP3A 2Q8ZA 2VXNA 1GT8A 4YWIA 4UFMA 3OA3A 3PY2A 1WBHA 5L6UA 3L2IA 5I3GA 4GUGA 2R8WA 5CZSA 5G1YA 4UTKA 2OCZA 4YCOA 1XI3A 1KM6A 1YPFA 1TTPA 1B4EA 5FEXA 1X8FA 3IRDA 3NPWA 1A5SA 4BI7A 5EL1A 3TAKA 1H60A 1W8SA 1J2WA 4MYXA 3IIOA 2GVJA 3HGRA 3W7GA 3GVGA 1G4EA 2A6NA 2RDUA 4YXGA 3LCGA 4ZZ9A 1M7PA 1SW3A 1ZHAA 5CPMA 1UUOA 2OJPA 3A23A 4LRSA 4N9CA 4YL2A 4GE8A 3C8FA 1SW7A 2D73A 5AOUA 1LRQA 3W7IA 4NXSA 3CQ0A 4LVAA 3UXDA 1GEQA 2PC4A 3W1NA 1THFD 4IGHA 1GQNA 3W7RA 4JTKA 3O16A 3WK1A 2NXGA 1DQXA 1VR6A 2VEIA 1G4PA 2ZRWA 4TR9A 2X1RA 5J5DA 4WUIA 2V9DA 3LHYA 3DFSA 2QAFA 3W84A 2VFGA 2ZFAA 3C6CA 4JYEA 4ZMGA 2VFDA 3NQ7A 3G0SA 3W1UA 3W7PA 4X9SA 3LHVA 4I7UA 2J24A 2CZEA 4ADTA 3W7MA 1NSJA 3G1FA 3TIMA 4GJ1A 1TCDA 5BMWA 3ABOA 4LOCA 3H55A 4IXHA 4ZQRA 1W0MA 4K39A 1IXPA 1H61A 2CLMA 2DZUA 1K02A 2NLIA 1VCGA 5H91A 3TW6A 1ZJIA 3PBVA 2Z6IA 4JICA 3PUDA 4DPPA 3ABSA 4MVAA 3GDLA 3QMTA 3ATZA 4DF0A 1GG1A 3IVUA 3MHGA 2B7PA 4FO4A 1YTDA 3UWZA 4OGZA 3W72A 3G22A 1FXPA 4FXRA 3CM4A 4ML9A 4ONVA 3FJLA 2ATMA 2Z6JA 3DI0A 1KV5A 6ALDA 3S5ZA 4JX4A 1FXQA 2V8ZA 3NQEA 5FEZA 3KRUA 4HNUA 1J4EA 3NZ1A 4JEQA 3W7KA 1Q3NA 2PCQA 4A2SA 4U28A 3S6DA 3IIXA 1A5BA 1H51A 2EKCA 2QJGA 1HTIA 4BR1A 3W88A 5HQEA 3N2MA 3LHZA 5D2YA 5AYXA 2AAMA 3M5VA 5KZEA 3RLUA 1SW0A 2J9YA 3L68A 1N8FA 3G8EA 4TMCA 2Y61A 4BWLC 3K30A 5D2XA 4ZQMA 4WXYA 2Y7DA 2DZPA 1WQ5A 3NQFA 3BARA 4A29A 2C0AA 3BLIA 1GJPA 4RLIA 4HIBA 3L5LA 3DFPA 2NX1A 3PAJA 1QWGA 1O5XA 3TFXA 1X1ZA 4Q33A 3M5YA 2Y89A 5F4WA 4Y8FA 3NXFA 3W1RA 3L0KA 3NNTA 1Q6LA 3F4NA 3GNNA 2Y6ZA 1K8YA 4Y6GA 3P84A 3C2RA 3QPYA 3HGJA 3EEGA 4X2RA 2YSWA 1IXOA 3S1XA 3TJLA 2DP3A 3VFLA 3IVTA 1OFRA 3VKJA 3CB8A 4GXMA 4IPJA 1KTCA 1TPEA 2A4AA 1WV2A 2BWGA 3S5NA 3WK0A 4JY8A 3PS7A 3PVFA 4MFDA 3BG3A 4HKPA 3EX3A 4I9AA 1RQBA 1D3GA 3TNOA 1OX4A 1KBJA 5CSRA 2A1YA 4GRSA 3A22A 1DBTA 2E6YA 4AMAA 2H90A 4LS0A 4OE7A 3S8HA 1JCMP 1VQTA 2H3DA 4JX5A 1OFPA 5KZMA 1MXSA 3KHJA 3N14A 2G96A 3N3MA 3ATYA 4HT3A 1QPRA 1FY6A 4AWTA 3FFSA 4XWUA 1O94A 3SSJA 3O05A 4OQVA 2FTPA 4M6VA 3TE9A 3A21A 3WK2A 2ISVA 4MY1A 4O18A 1JCJA 5D02A 2GVLA 4NU7A 2G5WA 3NL5A 3W7QA 5AHFA 5LNRA 5HWMA 3UY7A 4IMFA 5TIMA 4DF1A 2J6XA 2GOUA 2OX1A 2QR6A 5AHLA 1YLVA 5I3JA 5IBXC 1GVRA 2E6DA 4W9TA 4Y9AA 4H3DA 3VCRA 1LTDA 1F7BA 1OFOA 2WNZA 2RHGA 3DXIA 1PCWA 2WO5A 2Q8LA 4MY8A 1WOAA 3W1TA 1VZWA 2ZYFA 3BK0A 5FI8A 3P8JA 4XTDA 5DXXA 2FQIA 3IIPA 3EXTA 3CEUA 3GIYA 4HNNA 4E2BA 3P74A 1K03A 1SU5A 3P81A 1OYAA 4UTMA 1WBJA 1CI1A 2YYTA 1N7KA 5DELA 3C3NA 1SQ7A 4QISA 3LHUA 4TIMA 3MMTA 3P67A 5G2HA 5K9DA 5G4EA 3W3OA 4UCGA 3W7JA 1HO1A 3G3DA 1FDZA 1M6JA 2BX7A 3GYEA 5CZJA 2I14A 2OMAA 3LBMA 5CKSA 3L67A 3LXCA 3NQAA 4UMBA 3EX2A 1XKYA 3DGRA 1F74A 5FEWA 3T78A 5EY5A 1JCXA 4MFEA 3QPZA 1L6WA 4HHPA 3CU2A 3W7NA 2GQAA 5AC6A 4IX0A 3TK7A 4QSHA 2GUUA 3TXVA 3PUEA 3GDRA 3W7CA 1OVDA 2DJLA 3I68A 5LHEA 1F6PA 1TPVA 4Z0SA 4EF8A 1WOBA 3LCXA 2ATSA 4WY0B 1Q45A 1FWTA 4O8RA 1XCFA 1PIIA 4PC8A 1Q6RA 1AW2A 2P1FA 1B9BA 1EWEA 2A7RA 3MI2A 3C4UA 3B0UX 1U83A 1SZNA 4RV8A 3B04A 1TPUA 1IXQA 1JJKA 2VEPA 3DENA 2NWRA 1XBVA 4N2YA 1KFLA 2YR1A 2PRLA 4UNKA 4Y90A 5HR7A 1TPB1 1I8JA 3MW7A 3KXQA 5TQLA 3N9SA 1NEYA 5IM51 1VYRA 3UQNA 3R8RA 1PVNA 2CW6A 4AH7A 1W5MA 3GKAA 4O54A 3O6YX 4O50A 1GG0A 4QM1A 5EKYA 1YXYA 4QIUA 5C5YA 2XN1A 2E5DA 2R91A 3ZS4A 6TIMA 1Z42A 2B7QA 3CIXA 2DZWA 3W7HA 3W1LA 4NUWA 3G1XA 4FXSA 4JTLA 3FLUA 3BVJA 3W83A 4O53A 3E0IA 3U6WA 4UTJA 4HNVA 2QAPA 3FA5A 1L9WA 1SO4A 2F84A 1MZHA 1VH7A 4LVGA 2DJXA 4ORMA 1DKWA 1O4UA 1O60A 4LW7A 4I7VA 3W7OA 1EWDA 4UXDA 1S5VA 4Q4KA 1H7RA 2QCLA 1OYCA 3MP5A 3EB2A 1BWKA 2P10A 3LI1A 2ZQ0A 3UWUA 2EAWA 1KTNA 4UMAA 3P60A 5C2XA 3KOFA 5HJLA 4IPIA 5AHEA 4XBSA 1YADA 1ZY9A 1W5QA 4AEOA 1FBAA 4NJHA 3N2XA 2H6RA 4ORIA 1WA3A 1G4SA 1JQVA 4JIPA 3MYPA 3E02A 3HPSA 3F4WA 4ZQPA 2E68A 1BWLA 3QRHA 2ZBTA 3M43A 3KAOA 5LSMA 2RH9A 1TPWA 5DXYA 3LTSA 1F6KA 4JD4A 5AHNA 1DOSA 3Q37A 4N9DA 3W1XA 4LS1A 3W07A 2KZHA 3I6RA 4A22A 1KM5A 1QFEA 2HSAA 3USBA 3G3MA 3S42A 4RCXA 4NQ1A 2JKEA 3F03K 3KVLA 5D32A 3W73A 1OFBA 3LHTA 4BWLA 4NX5A 3HMJG 1G4TA 1SPQA 1AG1O 2ALDA 4NJIA 3PC0A 1Q6QA 1PL9A 2X1TA 1QO5A 4OBTA 1U5JA 1VC4A 5BOOA 3CLMA 3C56A 3LXBA 4BI6A 3RMJA 4FIRA 1TTQA 4M6QA 1LDCA 1VS1A 5E93A 3CWNA 4JTHA 1UBSA 4DBDA 3TSBA 1XDLA 3T44A 1TMHA 3R12A 2HS8A 5LZLA 5D05A 4O16A 1GVQA 2YPIA 2VFIA 5K2ZA 2V0TA 1I2NA 3B8DA 3LCIA 4Q32A 4FNQA 1ONRA 2NWSA 1F5ZA 1NAL1 1PHWA 3STFA 5LNSA 2A2IA 1KLZA 3P80A 3HIJA 3HF3A 5KINA 1QPOA 3G18A 1YDNA 3NQVA 3PM6A 2QF7A 3I65A 2DZVA 4P2VA 2NUYA 3PWAA 4FNTA 3QM3A 3TXZA 4IMCA 1UJPA 1GPWA 2QJHA 3MBFA 4GWEA 4RJEA 1YDOA 1OHLA 3DHFA 3I7SA 5HR6A 1TSIA 3DI1A 3P7YA 5D2VA 1I2PA 2W6RA 3L0GA 5K4XA 3O07A 3MUXA 3RLVA 3THAA 2NV1A 1P0NA 5DY3A 3LLFA 3PSWA 4WD0A 1WYIA 3TSDA 1B4KA 1UUMA 4JYDA 4KWVA 4D2JA 5KTLA 5F2IA 3O6DA 1T99A 3GDMA 4UTUA 2WOQA 5BW6A 4JDBA 1Z41A 4UTWC 3QW3A 1F73A 4UR8A 4GUJA 3FJ6A 2GPTA 1L6SA 4S2CA 2H8ZA 1TRDA 5K7JA 2FB3A 4UFHA 3W71A 1ML1A 3TC7A 1EX5A 2QCGA 1ZAHA 1L6YA 2O7SA 1LBMA 4L4MA 1OYBA 3EKLA 2C13A 1ZCOA 1H1ZA 4BF9A 3T55A 2DZXA 1K7XA 4XUGA 3TW7A 5D09A 3MP4A 3L9CA 2ZZ4A 4NJKA 3QF0A 2XN2A 2GQ9A 2C16A 1LM1A 4MZYA 3QQ0A 5IBXA 3FKRA 3WJWA 5AYYA 4ADUA 3PBWA 3QC3A 1BTMA 1VYPX 3OVPA 2ZRVA 1R46A 5EYWA 3GX9A 1GTEA 1OG0A 3EXSA 4L4LA 5LGXA 2G97A 3NQCA 4Y96A 1QOQA 2E6AA 4IOTA 5AC8A 3E12A 1JCLA 1TV7A 3HG2A 4ZQCA 1ME9A 5DLCA 1SFLA 2W0UA 1OFDA 3BGGA 3RFAA 5K4ZA 2Y85A 3LM7A 4Z1DA 5ABTA 2TYSA 1A53A 1N55A 5AFDA 3BG5A 4OV4A 2WNNA 4IMDA 4AHOA 1YXCA 2Z0IA 3FEMA 2QCDA 1QAPA 4XKYA 3TROA 1YTEA 1GYNA 2ZA3A 4UFJA 3TMQA 3CHVA 4ICNA 3H54A 3GB6A 2B7NA 1PE1A 3TC6A 1FDJA 1ADOA 4QNEA 4RZ6A 1XM3A 3E49A 1W56A 4I7WA 4R7JA 4JTUA 3QZEA 2E77A 3EWWA 4NXKA 4JY9A 5BNKA 5A5WA 3W2KA 4WOQA 5AHIA 1I45A 2Y70A 1GYLA 3IIVA 1JUEA 4PTNA 3C61A 2X30A 3WJZA 3HG5A 1FCVA 2A7NA 1I2OA 1RZMA 3LCHA 1AK5A 1JRBA 1T8XA 1F2JA 4BFAA 1TPFA 3O15A 2NX3A 2DORA 5BRBA 4GNJA 3O1NA 2BTMA 1XL9A 2ZZ1A 3B06A 4DXVA 1W3NA 2C1HA 2FJKA 1W5NA 3SI9A 2V82A 4MZ1A 3M7WA 4RZ5A 2X1SA 3BW3A 3BO9A 1YYAA 2FPYA 4UIOA 2NUWA 1FCBA 5H2ZA 1XC4A 3OVRA 4UR7A 4GFSA 1DORA 1TREA 1LOSA 4N6FA 1MEWA 2ZRXA 4AF0A 2CLOA 1JQXA 1SO3A 4N9BA 5G4WA 5KZDA 1RPXA 2H8XA 2R14A 5F1VA 1K7FA 4LNYA 4AAJA 1VCVA 5DBUA 2Z2UA 1P5BA 3O6CA 3HG4A 4G1KA 2Y62A 4AB4A 4Z1AA 3TQVA 4O52A 2CZFA 5F2LA 3MP3A 3WK3A 1BEUA 3PBYA 2QUTA 3B0PA 5F1UA 3AO0A 2JK2A 3L65A 5KITA 5C54A 2C15A 3A24A 4GUFA 2PRHA 1ZAIA 3LRMA 4K8HA 4NJGA 1EP1A 1SO6A 4E0CA 2CLFA 1HUVA 2HS6A 3UD6A 5GVJA 2QUVA 1G6CA 3EWXA 1TV5A 1YDVA 4XTIA 3RNDA 4NNBA 3NOEA 5FF4A 3G0XA 3UYCA 3C2OA 1R2TA 2B7OA 3GAKA 2XN0A 3W22A 1WXJA 3R5EA 1B3OA 3GK0A 4RR4A 2A0NA 3BV4A 4GC4A 4R34A 3QW4B 5AN7A 1R47A 2YW3A 4O0KA 3TJXA 3LRKA 2V5BA 1EEPA 2CFFA 4XBKA 3UY8A 2F7FA 2WKJA 4LVFA 3H53A 4ADSA 4A3UA 5CPLA 1G67A 2G95A 1EIXA 1MEIA 4N4QA 4AWUA 2ZCGA 1G69A 2OT0A 1QPNA 2FIQA 3LB0A 4Z1BA 3LV5A 4E2DA 2P0OA 3M41A 4JDYA 2YCEA 2LLEA 5SWUA 3PR2A 1D3HA 3BPWA 4MJZA 2JBMA 4OWGA 1WAUA 2OZ0A 4CCEA 4UTLA 3DFTA 4UFLA 3YPIA 3P8IA 1A5AA 4LWWA 4UNLA 3C0JA 3O63A 1ZENA 4IWWA 2QCEA 5D38A 3CEPA 3UPWA 4WXZA 4K8EA 2ZZ2A 5HNRA 4GUHA 1RQEA 2VFEA 3STEA 3RF9A 5G5IA 1KFCA 3TU9A 4PL2A 4MUZA 1AW5A 1QDSA 1SO5A 2V2DA 4O13A 2Q3RA 3T4CA 3GNDA 4KWWA 3M44A 3W74A 3Q94A 5DCDA 3ABQA 3L0NA 4QJ1A 2QDGA 5G2WA 1HO4A 4M7TA 1GWJA 3UWQA 4CNOA 1XBXA 3WJYA 5LHFA 1ZNNA 2A7PA 3QQ1A 1H1YA 4HPJA 5CG7A 2I1OA 1ALDA 4LUIA 4N02A 3L5AA 1F76A 4JXCA 4O10A 3TFCA 5LNVA 1SUXA 2YFNA 3GZ3A 3S9YA 1KM0A 4UTHA 1P4CA 1TPDA 2QEZA 4KKXA 5E1QA 3MWAA 3NL3A 3NAVA 2VOMA 2I9EA 3EWYA 5FF0A 4N6EA 4NZFA 3WJSA 4O1AA 1M7OA 1LORA 4RZ4A 2V30A 3RU6A 1MO0A 4PEKA 3SR7A 2IQTA 4IUOA 1TJRA 2E09A 3M5ZA 1I2RA 4IXXA 4UTWA 1AW1A 2ZZ5A 1DHPA 1VPXA 4LRTA 4AHQA 4UTTA 3S1WA 1RR2A 1TTIA 4DPQA 4JR5A 1NVMA 1LYXA 4NNAA 3EKZA 1O5KA 3HBLA 2ABAA 3EX4A 4P61A 3MO7A 1FCUA 4S2BA 4R53A 3KRSA 4MLJA 2QCNA 4LU0A 5CPNA 4WQ6A 4TMBA 3T40A 3P82A 1AL7A 1FWWA 3JR2A 3NM1A 2B4GA 3A5VA 1OX6A 2E5CA 1FDYA 1SZGA 4MJMA 3LLDA 1EPXA 3LCWA 2BXVA 3IVSA 3W76A 4ZL1A 3S5OA 1JUBA 4O1CA 3W2JA 3B05A 2VC6A 4RXGA 3INPA 1K7EA 1TQJA 2WJZA 5FF3A 2CLIA 4MPQA 4HSOA 2X16A 3O06A 3G8RA 1SFJA 5BMXA 1H7OA 3DFNA 2AGKA 1TPC1 2ABBA 1VJIA 2ZZ3A 2NXHA 5CSSA 3W1AA 1EUAA 2V2HA 3HPXA 1KV8A 1X7FA 2FFCA 2PE4A 3C2EA 4UC5A 1MSSA 1TJPA 3U8GA 3BG9A 1KM3A 3ZWSA 1HL2A 4O57A 5D33A 4NX0A 3GLCA 1LRTA 3OEXA 1TQXA 1H5YA 5MHBA 3GAYA 4K37A 3SW6A 3THQA 1Z44A 4EVZA 1KFKA 4RK8A 5G1TA 2NX9A 3NL6A 4TX9A 4CCCA 4LVDA 1P1XA 4N4PA 4MIMA 2WPBA 3NZRA 2VEMA 1VHCA 4DELA 1KA9F 3LDVA 4K7VA 5DBTA 1LZOA 2BLEA 4CCDA 3O8AA 2ISSA 2EPHA 2DZTA 3M47A 4O15A 3UPBA 1AMKA 3TDFA 4EIVA 1OX4B 1V5XA 1W54A 5A8GA 1ZFJA 2FPVA 2VKZG 3NPXA 3UXAA 2YGYA 3NQ2A 3S5YA 1SZFA 4LC6A 1OFAA 2C6QA 2JKPA 4LY8A 3TA6A 3QMRA 4WZHA 4JYFA 2O7QA 4PCFA 1TYGA 1DL3A 5HUOA 1OK6A 1LBFA 4DO5A 2V5LA 1V7YA 2WSRA 4Z08A 2EF9A 4B5NA 1QOPA 2A5HA 2WQPA 3G24A 1VCFA 3NG3A 4JTJA 3GXPA 4XQ6A 2YX0A 4JGDA 3W75A 3NPVA 4WOZA 5CZTA 3MBDA 1KFJA 1C9DA 2VEKA 4PFMA 5D03A 1R2SA 4CLMA 2J9ZA 3DH7A 3IGXA 2UV8G 4JTFA 2ZTKA 3W70A 5C6MA 2QDHA 3GDTA 2WSQA 3A9IA 5EPDA 3OVQA 3S1VA 4IX2A 3TQ0A 3C2VA 1S3HA 4UUIA 4AXKA 2CLKA 3LERA 1PS9A 3EX1A 3S0CA 3W2LA 3STCA 4LTSA 4K7YA 3W2MA 3SIZA 3DAQA 8TIMA 1OFQA 5DY2A 1ME7A 1ICQA 1KLYA 3NYZA 4DF2A 4K38A 3TR2A 3EWZA 3SZ8A 3NQGA 1QPQA 2VFFA 2E5BA 4MY9A 5K3VA 1LOQA 4UTTC 1RV8A 2CWNA 1W5OA 4FX7A 5D2WA 4YCPA 3G1YA 4TU1A 4IMEA 2ZDRA 5HWJA 2GVGA 5U7SA 2ZZ7A 1W3TA 4JIQA 3G1DA 3OG3A 1UCWA 1H50A 2W79A 3N34A 4N9EA 1ICSA 2JGQA 3MHUA 4C1KA 1EB3A 2E6FA 1W5PA 3G1SA 3HG3A 3M0ZA 1JCYA 2TSYA 4K36A 3AJXA 4O12A 4JN6A 3EWBX 2A85A 3PSVA 4ZQNA 1RD5A 2FPTA 3M16A 4CQAA 5DCEA 3G1VA 1LBLA 1VRDA 2RDTA 4KFOA 4OT7A 3VNDA 1KW1A 4KFPA 4IQLA 3NL2A 3VE7A 1I4NA 1FWRA 5FF7A 3W2NA 1XDMA 4UMCA 4JTIA 4U4MA 3NPUA 1FWSA 1ICPA 1VGAA 4FHAA 1OJXA 2C3ZA 2C18A 3M9YA 2X2GA 4WY0A 1QCWA 3CTLA 2ZA1A 2EGZA 2ZRZA 1X6UA 4JTTA 1IGSA 1KM2A 1EUNA 3W85A 3W6YA 1IXNA 2ZTJA 4DO4A 4RKAA 1JUKA 3NA8A 1W1ZA 2VELA 3HO8A 3MHFA 4OV9A 1TRIA 3NDOA 1YPIA 2X1UA 3PB0A 1G7VA 7TIMA 5HUPA 4FIQA 1EP2A 1XBZA 4NNCA 4E38A 3FIGA 5J5RA 3DFQA 3ANYA 1DVJA 3E96A 4KFNA 3BLFA 1PHQA 1XFBA 3PULA 1XXXA 2Y7FA 4HN4A 1TTJA 1PCKA 3Q58A 3LRLA 3GXNA 3F1QA 1IF2A 5FF2A 3FKKA 4WX2A 5I3KA 2B0MA 3W1QA 4R33A 2GJLA 3R89A 1Y0EA 1XBYA 5C55A 3ZFHA 4IMGA 3N19B 1S5TA 3FYPA 3I7QA 4K6AA 4GBUA 1AL8A 3LOTA 2Z1BA 1LOLA 1JULA 1B57A 4FX8A 3V1PA 4NJJA 3BGJA 1JRCA 4MOZA 4TO8A 3EWUA 3HJZA 1TPH1 1FCQA 4DQWA 4FB7A 1QR7A 3I7RA 4QAIA 3M1ZA 3T7VA 1YTKA 3NR0A 4HNTA 4O17A 1UASA 5FEPA 3BW4A 3OBKA 1W3IA 5K9XA 1S5WA 2CLHA 2YZRA 1P0KA 3JRKA 1GVFA 2NV2A 3D0CA 3VE9A 1VHNA 3MI3A 3CIWA 4NT0A 3ZWTA 2FDSA 4S1FA 1OK4A 1H7XA 2FLIA 2GJNA 3CC1A 1OF8A 1OX5A 3FOKA 1SSGA 5U4NA 3W2UA 4CQ8A 3CWOX 4LVBA 1GVSA 4JX6A 2QCCA 2J27A 1K8XA 2JKAA 3QEZA 2QCFA 4X22A 4ZQOA 1Z48A 5FESA 3LGEA 3U2OA 3FS2A 4H4IA 4PODA 5EMUA 3C2FA 3C52A 4HSNA 5F4SA 3W9ZA 3WFAA 2DZSA 5DN1A 4BK9A 3SGZA 4WJEA 1GOXA 3SECA 5AB3A 4LC8A 4LV9A 3TV8A 4GUIA 2CZ5A 1UB3A 3UNDA 1ZALA 3KVMA 1KBIA 2TMDA 3TH6A 4EOUA 2BZNA 1CW2A 5K9CA 4Z1CA 4O28A 3IGUA 1OABA 3GR8A 4C1LA 4O19A 1GZGA 4FF7A 3IV3A 2ZRUA 5D2TA 3NQDA 1J5TA 3GDKA 4HPXA 4QNWA 3HGSA 3W7DA 4JTGA 3MYOA 3P61A 2C14A 4OU1A 2RDWA 3LCLA 2WSYA 2WV8A 3PB2A 4O1DA 3JS3A 2AQWA 3OIXA 3SGUA 2Q3OA 5KSWA 3OHIA 3ZR4A 1R30A 5CGQA 4MYAA 2YW4A 3RK8A 2PRMA 1LLZA 3N73A 1NFBA 3QSTA 4XZ9A 3QSRA 1TIMA 2TRSA 4M5PA 4LV4A 1H62A 3W7EA 4POCA 4JTSA 1GTHA 3LHWA 4JTEA 3TAOA 1FQ0A 1WX0A 5CZ0A 1KTBA 3W1MA 4PA8A 2OT1A 1CX9A 1HFBA 2RKXA 3P5YA 1JCNA 3R13A 5I3IA 3UWWA 2VENA 1NF0A 4O11A 1F05A 3HGOA 3L21A 3NM3A 3NQ6A 4M7SA 3LXAA 1M5WA 3TQKA 2QCHA 1W31A 3TSMA 4FX6M 3BW2A 3KRZA 2E1DA 4PL1A 2V81A 1XUUA 3P5ZA 3L5MA 3UWYA 4A21A 5I3HA 4DO6A 3W7LA 4O4VA
chains in the Genus database with same CATH superfamily
4TVDA 1CGUA 1E40A 1U1HA 2BSLA 3DOPA 3GW0A 4OUEA 4XZBA 1MRQA 4OHQA 1TO3A 2PS2A 1HG3A 3W1PA 1E4IA 4JNMA 3DHDA 3N6HA 4J5NA 2PD9A 1H7PA 3P62A 5HINA 1G01A 4BF5A 2HEJA 4CEUC 4J3ZA 3VD3A 4BQ5A 3BGAA 1NTHA 3GY1A 1BF2A 3NWRA 3UCCA 5CSUA 1M01A 1V79A 2Y88A 1DE6A 3A5FA 1JNDA 1Z69A 2BY2A 4CQ9A 3SFWA 3H4WA 2J9XA 1NIUA 2QCDB 4EXAA 2PU1A 3LTYA 2GQ8A 1B3VA 4EWND 4ZA0A 1SJAA 1ME8A 1AJZA 1P48A 4O4WA 2XIMA 4UR9A 4QE5A 1XUZA 3ARSA 1EA0A 1FWNA 1P7TB 3G1AA 3W26A 4Y9MA 3VI2A 2FB2A 3MMWA 1I60A 4FNRA 4BS0A 2QKFA 1F07A 3WQOA 1XH1A 1I1WA 3NQ8A 2YCIX 3WNOA 3FNDA 1EJVC 3PK7A 3B4UA 3PZNA 1FX6A 4WR3A 2QJIA 1RVGA 3HOJA 2X0SA 1V93A 1WDDA 3OZOA 5EA9A 3MDWA 4PH6A 1E4LA 1JR1A 1LL6A 3LPPA 1B31A 3GU2A 3UNTA 3P6LA 4GPNA 2ACQA 3EB4A 5AYZA 2YCLB 4A8LA 2A21A 1IIGA 3TC3A 5D37A 4HPHA 4XD6A 2GLKA 3URQA 3UWVA 3WMCA 2CC0A 2H9AB 3VIFA 3ID7A 3PZQA 4YMZA 2INEA 4AWSA 4CU7A 3R25A 1F3TA 3CL7A 5HULA 1UOZA 3KVJA 1TKKA 2E0PA 4GVHA 1MQQA 1DJNA 1H09A 2ZWYA 4FNSA 3MZ2A 5H8PA 1JZ2A 4F0MA 3PG9A 4XZLX 2XWEA 3GTFA 3GZAA 3A4XA 3HFTA 1K8ZA 3QLLA 1LT7A 3WIJA 1J79A 4PCPA 2G3JA 2BHYA 2E40A 3KE0A 8XIAA 2AGTA 5A8OA 2VFHA 1MW0A 1LQ0A 1X7IA 3L4UA 4GISA 4GHRA 2ZZ6A 2YYUA 4HNLA 1PV8A 1A49A 3RM9A 1M3UA 1GKRA 4WDTA 2D2JA 3OYXA 1H49A 1PTAA 3G6MA 1W1YA 3T08A 3NVTA 1WNOA 5G2IA 3PG8A 5M03A 1H7WA 3VMPA 4FNUA 3MV11 4Q7BA 3PJXA 3P0XA 1DJQA 2CXGA 1Q66A 2ALRA 2DUAA 1JYVA 4F0HA 4JHMA 4X60A 5CJ5A 1DWJM 4ZVJA 1AQHA 5HQMA 1CXFA 1VYSX 1V6XA 3HU7A 1NF7A 2Q8ZA 1GT8A 4EWJA 3UCDA 1CXLA 4DYJA 3VOIA 3PY2A 3B8TA 3APYA 1WBHA 4CKQA 1KCZA 3IK4A 3UT0A 5A8MA 1XI3A 1KM6A 5BXTA 4K68A 4OBSA 4ZODA 3TYAA 3H21A 3URAA 4DJEC 1A5SA 3NPWA 3BH4A 4BI7A 4S23A 1H60A 3AWOA 4R85A 2GVJA 1OT1A 4MWAD 2VR4A 3HGRA 3VX0A 1G4EA 2V5KA 3ABZA 1XIEA 2VGIA 4ZZ9A 1JEZA 4M82A 4N9CA 2OJPA 4LRSA 1F9CA 3M0KA 9RUBA 3SO7A 3CQ0A 4C1NB 1QI5A 4MDOA 3BUVA 1W1PA 2OSYA 1XX1A 3MMDA 4KWUA 2W9MA 4TR9A 1REQA 3WQPA 4CD7A 3TYUA 2OYLA 2E25A 3DFSA 4ATWA 4HZ8A 3W84A 2VFGA 1XYLA 1J0ZA 1WKFA 4F0RA 4I7UA 3NGFA 3ALFA 4ADTA 1NSJA 4GJ1A 1UIOA 1ZCCA 2GDUA 4FF5A 4IXHA 2FZ9A 3TTSA 3KCOA 1IXPA 4B2DD 2PBGA 1VCGA 4AD0A 3TW6A 4J3SA 2Z6IA 3WLOA 1ZBCA 4W5ZA 3GC4A 3V5OA 1HW6A 3HQNA 4FOJA 4GACA 3BMWA 2YDRA 2BNJA 2BBFA 1GG1A 4CN1A 3F2CA 1GQKA 5JUVA 3JW7A 3G22A 3KL0A 1HL8A 1KWKA 4ML9A 3U7BA 4M29A 1S5NA 3FJLA 1IEQA 2YZ5A 3DI0A 1KV5A 3GUWA 2ADAA 4JL2A 4B9YA 4HYRA 1S46A 5FEZA 3W7KA 5I79A 3L4WA 4QFUA 3F4CA 3DYMA 4C6LA 3IIXA 4LAZA 2E9MA 2QJGA 1HTIA 4L1WA 3WO8A 4QG6A 2X1IA 1Q7MA 5AYXA 1FWCC 2J78A 1SW0A 2J9YA 5H6HA 1N8FA 1QPKA 3QTPA 2Y61A 4BWLC 3V0UA 3K30A 1EQCA 2Y7DA 2PDHA 4GA8A 4C6MA 1GJPA 4KEZA 4MNJA 3GVVA 4XVDA 4RE3A 4GYPC 1B2YA 1J9YA 4LCSA 3NXFA 1Q6LA 3GC5A 3L0KA 3TYEA 5BXSA 3C2RA 1XIBA 3QPYA 2PGEA 3THCA 3H8AA 2YSWA 3HV8A 1K9EA 3S1XA 3AIRA 1SJCA 4DBSA 4JN8A 4Q8MA 2GSJA 2QNEA 1QK0A 2CZVA 1TJ1A 3PVFA 4J2MA 4KRZA 4DWSC 1RQBA 1KBJA 5CSRA 2A1YA 5HMDA 1CB7B 3RCYA 1O1HA 2E6YA 2UZ9A 4INFA 1POKA 4LS0A 4AFYA 1E1EA 1QW7A 4ZENA 3N3MA 3ATYA 5EFDA 1JAKA 3T8LA 4QX4A 3JZUA 1NDWA 4XWUA 1O94A 1UZ4A 1RCQA 2XINA 3BJTA 3O05A 4KGLA 4OQVA 4M6VA 3TE9A 4U2ZA 2ISVA 3E2VA 3WH7A 4HZ7A 5D02A 2G5WA 3W7QA 5HWMA 3UY7A 4PTWA 5JH2A 3BMXA 1H5VA 1MDRA 2J6XA 5EMKA 2OX1A 2QR6A 5I3JA 2NSOA 5IBXC 5C9RA 1GVRA 2E6DA 4MJ4A 5TF0A 3VCRA 1OFOA 2WNZA 4JFSA 4Z2KA 1F61A 2WZTA 3W1TA 3BK0A 5FI8A 4XTDA 5DXXA 3VGFA 2FQIA 1WKEA 2DVUA 3IIPA 3CEUA 5C9XA 3P74A 1K03A 4GJIA 1OYAA 4UTMA 1N7KA 5DELA 3C3NA 1SQ7A 3LHUA 3GTIA 2P76A 4IFKA 3VGDA 2FZMA 5G4EA 1HO1A 1WDQA 2NQ9A 1NY1A 1QNRA 3WUGA 3TWBA 1GONA 4AEEA 2I14A 4UOJA 3ZSTA 5DEZA 1J0IA 5HK4A 1XKYA 1F74A 2XM2A 3T78A 2NQ5A 1JCXA 1JFHA 3B8VA 4HHPA 5AC6A 4IX0A 3QHMA 1GK8A 2GUUA 5KZ6A 3PUEA 1ESWA 4ICMA 1E0WA 5H8UA 4DJEA 3LCXA 1DTUA 5ECVA 4WY0B 1GGOA 3ZLFA 1FWTA 4O8RA 5EMJA 2YIHA 1Q6RA 4I90A 1Q8JA 4GKLA 2A7RA 4ZB5A 3MI2A 3OHMB 3C4UA 3B0UX 3QTGA 2XISA 4HCHA 3DENA 4EPBC 1J93A 1KFLA 3KZPA 3P3BA 2PRLA 5HR7A 1TPB1 2VEFA 1I8JA 3KXQA 5TD4A 3T8QA 5IM51 1M53A 1PVNA 1W1A1 1MNSA 3E2QA 4O54A 3OOQA 4O50A 2PWHA 4QM1A 5EKYA 4QIUA 1ZP3A 3CIXA 4NUWA 1KCXA 4FXSA 2FGZA 3M07A 3BVJA 3E0IA 3QGKC 3VDGA 5G1MA 1L9WA 1SO4A 2F84A 1K9TA 4EPKA 3WD1A 2DJXA 1DKWA 5REQA 1O60A 4I7VA 3W7OA 1UWQA 1EWDA 2J75A 4AD1A 2BY0A 4XAGA 1XC6A 2P10A 4HJWA 1KTNA 4PCNA 3BJFA 5CJNA 2GJXA 2RGMA 1MW3A 1WA3A 2NVAA 3EDKA 2WB5A 1PX3A 3R10A 4PMVA 4GBDA 4L56A 1BWLA 2ZBTA 4LCRA 2OO0A 2RH9A 3ORWA 1A4MA 3K13A 5JVLA 3VMOA 1F6KA 3ARTA 3NO1A 4JD4A 3EPOA 1NOWA 3WMLA 4E4FA 4PGLA 1XYCA 4MKSA 3VNYA 3W1XA 4LS1A 4LX4A 3W07A 3JUGA 2P0IA 3USBA 3G3MA 4RCXA 3BAXA 3GTXA 3KVLA 3HPAA 3SRKA 1OFBA 4Q4MA 3CUXA 3ANUA 4BWLA 3UERA 5AZ1A 3HMJG 3WNPA 1UH2A 2CBJA 3PC0A 2X1TA 4OBTA 2IQDA 3KTCA 1UBPC 4PUJA 3C56A 4BI6A 3M0VA 2PLJA 3CAVA 3NYDA 4GYPA 5E93A 3TYDA 1UBSA 3TSBA 1US2A 4GVIA 4FZIA 4BA0A 4ACZA 5TNVA 4LXFA 4XAYA 4GVFA 2HS8A 5M1TA 4AC1X 2PTWA 2VFIA 3B8DA 2OLHA 1A5KC 2OSXA 1V0LA 1RLCL 4LYPA 3F2DA 1KLZA 3P80A 3HF3A 1XH2A 1QPOA 3G18A 1YDNA 4PB3A 5KINA 2QF7A 2DZVA 4QXIA 4FNTA 5A69A 3R94A 3O9NA 3TXZA 3FSTA 4AC7C 4XD5A 4DWSA 2Q01A 2TAAA 2X0HA 4UNIA 2GGHA 2BY3A 3UVAA 4HMEA 1ZRQA 1I2PA 2W6RA 3L0GA 2AKMA 4QCEA 3O07A 1CB2A 3AMGA 1C91A 1E9LA 4ASTA 2NV1A 4NF7A 1QI2A 3TSDA 3ZT5A 1WYIA 1UMYA 2E8ZA 5KTLA 3O6DA 2BOGX 4F0KA 2PWUA 4PFHA 5BWAA 1Z41A 3QW3A 4D6GA 3NURA 4UR8A 4HMCA 3FJ6A 4FLRA 5A2BA 1QI4A 2H8ZA 1UD4A 1K70A 5K7JA 3WDQA 1ML1A 4B16A 2WZMA 1ZAHA 1T40A 4JN7A 2C13A 3A4JA 4WEVX 3N17A 3T55A 1K1DA 2DZXA 4XUGA 3VGBA 3NSMA 3MP4A 3TEVA 3L9CA 4NJKA 2GQ9A 3W82A 2YL8A 4MZYA 3TZNA 5IBXA 3WJWA 2D0HA 1E5NA 3QC3A 4HMNA 2ZRVA 3RRAA 4LUSA 3IPWA 3GX9A 5AC5A 1OG0A 3MKKA 4KCWA 3OP2A 1QOQA 2PPGA 4IOTA 5AC8A 3E12A 1TV7A 4MKVA 1LQ2A 4WJXA 3TP4A 3B9EA 2WC4A 1FWEC 2Y85A 4A05A 5ABTA 1OZMA 3RAOA 1A53A 1N55A 5BOFA 2ZUWA 3NFUA 2ISDA 2C1IA 2XH4A 4IMDA 1VBJA 1YXCA 4V33A 5CPQA 2CLPA 3TROA 3GTNA 1YTEA 1GYNA 2ZA3A 9CGTA 1HIZA 4D6FA 4ICNA 2P3ZA 2B7NA 3FYYA 1V6WA 1PE1A 1UD6A 1ZJAA 1XINA 4CUCA 3W28A 1HL9A 4DJFC 4EE9A 1UZ1A 1Z89A 3E49A 4R7JA 3QZEA 3TN4A 4Z17A 1EYEA 2BV9A 3KBNA 2BASA 2Y8UA 4AX6A 4WOQA 2Y70A 3IIVA 1PIGA 7XIMA 1B1YA 5J8LA 5I02A 1FCVA 1R8LA 3LCHA 1AK5A 4Q7NA 1T8XA 3QV6A 3PZVA 3O15A 5IHRA 5BRBA 1KRBC 4GNJA 3O1NA 1ADSA 3EOUA 1F8IA 1EC9A 2C1HA 2PTYA 1E70M 1QJWA 3VNJA 4MZ1A 1XIIA 3M7WA 4NY2A 3BE7A 4AUBA 2GVYA 2X1SA 3GBEA 5JBDA 4EKJA 1R86A 2YB1A 2C71A 1FCBA 4GFSA 1MEWA 4FLQA 1K77A 1C7SA 3WQ5A 3WLHA 1JQXA 4RPQA 1F4AA 5G4WA 5KZDA 1HT6A 5F1VA 1CGTA 1VCVA 2Z2UA 1P5BA 5CEWA 3L4YA 1HGWA 2Y62A 1FH7A 1ZLPA 9XIAA 4XUYA 2WKGA 4BZYA 5F2LA 1EFZA 3MP3A 1BEUA 3I4KA 4HNCA 3AO0A 1V08A 2JK2A 1UWSA 5KITA 4JQ1A 4DHGA 4I6VA 2F38A 3A24A 4F66A 3H2MA 3AAMA 3UR8A 3CH0A 4E0CA 4OOUA 3AHTA 5GQBA 1L8PA 3BOLA 4DWDA 4PULA 3EPNA 5GVJA 4XTIA 1BKHA 3TTYA 1YNQA 2FVKA 4FOKA 1R2TA 2B7OA 3A13A 3HZ3A 2XPKA 1UR3M 2UY4A 3GK0A 2C7FA 4GC4A 1J01A 3LPOA 5AN7A 1QBAA 3TJXA 1XIMA 4DBWA 4XBKA 5HXMA 2PWDA 3UY8A 1JZ6A 2WKJA 4C6EA 3H53A 4Z2LA 2G95A 3B0YA 1MEIA 4PSPA 4AWUA 2OT0A 1XGDA 4JDYA 1QK2A 2YCEA 2LLEA 1MI3A 1D3HA 4MJZA 2XH2A 3MDUA 5HOSA 1WAUA 4MB5A 3VKDA 2D2OA 5IDIA 1EGMA 4UTLA 5JBEA 1A5AA 3W24A 3F4DA 3OZYA 3O63A 1TWZA 3SCOA 4U5KA 4WXZA 4ZB0A 4X61A 2ZZ2A 3EDJA 5LA1A 1RQEA 1UWTA 4KIRA 3STEA 2OO6A 3BAKA 1XISA 3UR5A 2WLYA 1DYSA 1QDSA 2V2DA 3ITXA 3AICA 3GNDA 4KWWA 4QROA 4IICA 2MNRA 2GJPA 3BC9A 3ZR5A 1VF8A 1GWJA 3LQLA 4GYKA 1XIDA 1UROA 2NSXA 4JL1A 4QDMA 4N02A 2WJEA 2OEJA 2YA0A 4GI8A 4JXCA 1REQB 1U5HA 1KRAC 2VJXA 4GQGA 3SUUA 1TELA 2YFNA 1TPDA 1L0PA 2EG7A 2QEZA 4KKXA 1V4YA 4LUYA 2D2GA 3AZSA 4N6EA 4NZFA 4E2OA 3S83A 3G6LA 1CGXA 2TODA 3WUBA 4HK5A 6PTDA 4IL0A 1TJRA 4RDZA 5EMMA 2E09A 3M5ZA 1I2RA 3WYZA 2PDNA 5CPTA 1G0CA 3EWCA 2FVMA 4WDXA 2W63A 5BCAA 1EC7A 2EQDA 4DPQA 1H1NA 3VGEA 1NVMA 1TFVA 3B4YA 2ABAA 3OW1A 2VRKA 4R53A 2WSPA 4JQ2A 3KRSA 2QCNA 5E70A 4MG4A 1AL7A 3JR2A 3LBOA 2B4GA 1UP3A 1JXKA 3CMGA 4FK9A 4XV0A 1SZGA 4MJMA 3EA1A 1EPXA 3WD3A 2BXVA 4O1CA 3N4FA 3W2JA 3AMKA 1R9ZA 4WIWA 3LZ5A 5FF3A 2HNHA 3FVMA 5DMYA 5XINA 2V63A 1MW1A 4HSOA 2X16A 5T8GA 1RK6A 4GGBA 5AY7A 5BMXA 3ONCA 3ICJA 3AS1A 1J2BA 4MADA 5CSSA 3WSUA 4DM2A 3WF0A 1EUAA 1TMLA 3PBGA 1X7FA 2FFCA 1E0UA 2PE4A 3GU1A 3WLLA 1MSSA 3UW6A 4AZHA 4ZSUA 4PUDA 3U8GA 1C8QA 3QY8A 1G1YA 1HF6A 5D33A 3WNMA 2OX4A 2WANA 3RRXA 5I06A 3FK4A 3GAYA 3THQA 4DJFA 1KFKA 1OGSA 3RX3A 3AIBA 1V02A 4CCCA 1TR9A 2RAGA 3K2GA 2RDXA 2WPBA 3NZRA 1UUQA 4ZO9A 1FHUA 1VHCA 2P50A 4JIRA 3VZZA 3ZVHA 1ISZA 3LDVA 2XM1A 4DM1A 3O8AA 4GG9A 1FA2A 1RBLA 1V3IA 1JPIA 3UPBA 4I6KA 1VB9A 3TDFA 4S3FA 2JF7A 2XZ9A 5A8GA 5DX7A 2YGYA 2VDGA 1VD6A 1M7XA 1US3A 3VKAA 2HE8A 3FJNA 4JEJA 2YCJA 5GJPA 4OECA 2DIKA 1OK6A 3DECA 3E1F1 3QZAA 2WSRA 3ITLA 1WCGA 1WZMA 4Z08A 4B5NA 3G24A 2A5HA 3L2LA 4MPKA 4XQ6A 2YX0A 4YS1A 3IAPA 3ZXWA 4EXQA 3PZ9A 5A95A 3MBDA 1KFJA 1PZ0A 2VEKA 2OWXA 2Z1VA 2ZTKA 3GDTA 3A9IA 3BLLA 2I5GA 3S1VA 3REQA 3HMCA 3D3FA 4IX2A 3TQ0A 2OZ3A 4F0SA 3OLIA 4AXKA 3WDJA 1UA3A 1XP3A 2WLZA 3S0CA 3W2LA 4XSLA 1RHCA 3STCA 4LTSA 2D1ZA 1JFXA 2AL2A 4HTYA 9XIMA 1KBKA 4K7YA 2OLSA 3MSGA 1XLHA 2AQVA 1IT8A 1ZSXA 3W6MA 1R3TA 1R7OA 5EU9A 1FWGC 3A47A 3T4WA 2J13A 3TR2A 3SZ8A 4B4HA 4IIEA 2VFFA 2E5BA 1FH8A 4H2CA 4IFKB 3AYTA 3GG8A 5EMYA 4HP5A 4TX6A 4FLOA 5LA2A 1XLKA 1AQMA 1W5OA 2NLYA 3G1YA 3CZEA 5BRQA 2GVGA 2VWSA 3GYCA 2PDIA 4JIQA 3GXDA 3TN6A 1DWAM 1JD7A 3UJRA 3KOWA 2W79A 4IF2A 4N9EA 4C7GA 2OU4A 2JGQA 2W61A 4A8NA 3B8WA 1W5PA 4WVXA 2YL9A 3HG3A 1JCYA 2HQAA 2TSYA 3AJXA 4K36A 4O12A 3VKBA 4KBXA 2INFA 3U5YA 2MUCA 1J6OA 5DCEA 2FZNA 4KFOA 3I4EA 1KW1A 3B3DA 3UZZA 3AHZA 4XZMX 1H0GA 1XDMA 4O8AA 2VDHA 4LYRA 2X2GA 1QCWA 2WMKA 1RXOB 3CTLA 1N8IA 7A3HA 3FV9A 3WUEA 1DJWA 3KOXA 1XPGA 3PPHA 2ZE3A 2QV5A 4RW5A 1QBBA 4F2UA 3W6YA 2VTFA 3VDBA 1CECA 4NG3A 1BXCA 3W53A 3IUHA 4OV9A 3CAQA 2PP0A 5D8ZA 2XWDA 1UKPA 3S9ZA 4FIQA 1PKNA 2EKGA 3WNKA 3DG6A 3DFQA 3ANYA 2VR2A 4KFNA 1XFBA 1UPMB 3ME3A 3NOYA 4HN4A 3LRLA 3F1QA 5REQB 3FKKA 3AI0A 5I3KA 3AQUA 3KRBA 3PANA 1IV8A 3COTA 1VKFA 5A6LA 2GJXB 3N19B 2RUSA 1GZJA 1AL8A 1LOLA 1JULA 1HGYA 4Z1YA 4NJJA 1I1XA 2CESA 1NM9A 4I5XA 3R7MA 2YJQA 3AZRA 4UB9A 4TO8A 1TPH1 3WF2A 4DQWA 3TA9A 3VCCA 4YN5A 4PUWA 2YDQA 4KETA 1OBAA 4O17A 1AQ0A 3TOPA 1NOFA 1ZQ5A 4AW7A 1OCQA 3PBMA 1RJQA 1OM0A 3NZGA 1GVFA 1EPVA 4EP8C 1HVQA 2V5CA 4E8DA 3OPSA 3ZWTA 1V0MA 2FDSA 4RE2A 4S1FA 1OF8A 3W2UA 5HATA 3IJIA 4RDYA 4DXXA 3IK2A 3KLLA 5A6SA 4X22A 4AWEA 4P7QA 4IG2A 3UEQA 1PYMA 1NP2A 2Y5SA 3MUCA 4QR6A 3C52A 4JFTA 3UG8A 1TR1A 4WJEA 3QZ6A 1GOXA 4ACZB 1TZ9A 1TX2A 4I5UA 1IT7A 3MCNA 4OZOA 2X0YA 3MV01 1ZALA 3WF1A 4EOUA 4XD4A 1XJBA 1GKQA 2E4TA 4Z1CA 2KX9A 1OABA 1CLKA 4C1LA 2VGGA 5LXEA 2F8QA 3S4TA 3ARYA 4DWSB 1E4NA 4K1GA 1AD1A 3GDKA 5LIKX 1UR4A 3CV1A 4M80A 2C14A 1OD8A 3LCLA 4GC3A 3O7UA 1UH3A 4O1DA 3JS3A 2AQWA 5FJPA 5KSWA 2I17A 2WVUA 3ZR4A 2B81A 1C7TA 1OIMA 3GVQA 3RK8A 2R82A 1BAGA 5ABFA 1RY8A 1NFBA 3QSTA 3LPFA 5BU6A 3CUGA 4Q4SA 4M5PA 3W7EA 4POCA 1GTHA 3IUDA 5HNTA 3I10A 4JTEA 4CD8A 4LF1A 3R43A 3P5YA 1JCNA 3QPEA 1RCOB 3WH8A 3UWWA 1FHVA 3A12A 4PCSA 4W8AA 3HGOA 3NM3A 3CT2A 3SDOA 2YLLA 4ROPA 4JPGA 5A6TC 4FX6M 3DESA 2E7FA 4PRWA 1XUUA 4Q8NA 3P5ZA 4S3CA 1SFTA 1WDSA 3OZMA 4LUSB 1R2RA 1YQ2A 1MMFA 1H63A 4ZTYA 2VZSA 4TV5A 3PTQA 3UA3A 1KFWA 4JTAA 5C7HA 5HWNA 4M6PA 1C8VA 3GXTA 1SZEA 4QLKA 1CNVA 1TMQA 1YHTA 2H3BA 4B3LA 4Q4OA 3TLQA 1TV8A 3M6YA 1XD0A 1L2UA 2OFJA 3AISA 2CZDA 3LEPA 5A6MA 4RXFA 2ASHA 1QO2A 4LUJA 4HNOA 4A2RA 5A94A 3NO5A 1K9DA 5L9FA 5D04C 1VEPA 4NZ5A 1CGYA 2YDAA 4DBEA 1PZ3A 4XAPA 4MKNA 2EJAA 2VO5A 3SJ3A 1YE6A 2OB3A 1KFBA 4H7VA 5I3FA 5EBUA 3DFOA 3GR7A 3TYZA 4A6GA 2Y7GA 3L7RA 3NEVA 4IGNA 2CLLA 1MEHA 2DEPA 5GPRA 1RPKA 4UFKA 2YFOA 3WD4A 1WZAA 4X3ZA 1BXNA 4D6DA 3R2GA 4WHBA 3TLLA 3NQMA 3NGJA 3TZFA 1T96A 5E09A 4BI5A 2YXGA 5F2MA 4HA3A 1JVNA 1ODZA 2Y63A 4Q8UA 2GSHA 1G7UA 3QH2A 5A6AA 3UZJA 1QI0A 7PTDA 3KEHA 4XZIA 2QCMA 1RQHA 3MUAA 3AS3A 4W4QA 4EF9A 2VCBA 3DDMA 5KMYA 3SQLA 2L5HA 3M0HA 3DERA 3CPRA 3G1HA 4G7FA 3SY5A 1WDWA 1VIZA 3BWWA 3EX6A 3GKFA 3VK5A 1CENA 4U33A 5ECUA 3DUGA 2PF0A 3S1UA 3KX6A 2VZVA 5DCBA 3EA2A 3QMSA 3N9RA 3DKJA 4QP0A 3ZLGA 4MLRA 1X98A 4R7WA 4W8BA 1MZRA 3M6DA 1SSDA 3V75A 2WZHA 3E0VA 3STGA 2KAUC 4FEZA 2EPMX 4UWMA 3VIIA 3SGGA 2IMRA 3E9AA 1GVOA 2IPJA 3VABA 2WWDA 4UQDA 2DSZA 1X1OA 3LX9A 2NW0A 2WNQA 1M03A 1NARA 2ZOXA 2P3EA 5FJRA 1BQGA 4F4RA 2CU0A 1QNQA 3LI0A 4QDPA 2WVVA 1ISXA 3LCFA 3RM4A 4CNPA 1I0DA 3GVWA 4BY3A 2AKZA 1O5QA 3QJAA 5LNWA 3B0VC 3IEBA 3APGA 3V16A 3WMBA 4F8XA 5JBFA 5LIYX 1KFEA 2HMCA 1DJZA 2XIBA 1E43A 2CBUA 3EXRA 3W25A 3FDGA 4DJDD 5DANA 2WBGA 3CHDA 1H7NA 3LBCA 1C93A 2FVLA 3KBWA 1EO7A 1LRNA 2JGYA 1W37A 2XU2A 4UTIA 1SR9A 4J35A 4ZXLA 1E3XA 3KP0A 4F40A 4YWIA 3BCFA 5L6UA 4GNVA 5I3GA 4GH3A 2J79A 3SRDA 1J11A 1B4EA 3CJPA 1M04A 4KESA 1X8FA 1DWFM 1HJQA 3RDKA 2VP8A 3VFCA 2JQXA 2O9RA 1WDPA 1J2WA 5C9UA 5AYIA 3IIOA 4Z2HA 1FP8A 2G8ZA 4H83A 4NI3A 5BXPA 3IJLA 4X2PA 2BODX 5CPMA 1UUOA 3A23A 3ZJ6A 3WQVA 4GE8A 1SW7A 2OWWA 2D73A 5AOUA 3W7IA 1T7LA 5MKGA 3E0FA 4NXSA 3UXDA 1GEQA 4UBPC 1THFD 4IGHA 1GQNA 1W9UA 3RG6A 3W7RA 1GOQA 4D71A 2GWNA 4L1XA 3E6EA 1DQXA 2HBXA 2ZRWA 3WQWA 1SGJA 5FAGA 5J5DA 2VZTA 1W1VA 4YTRA 2VFDA 4GZIA 1QHOA 4AZ6A 3W1UA 5JIWA 1S2TA 1C3FA 4HU0A 4HA0A 2CZEA 4KPLA 4AZCA 3IV8A 1TCDA 2F6UA 3RYSA 2ODOA 3H55A 4UCFA 1XFCA 3CUHA 4LQ1A 1W0MA 1I75A 3ONBA 4K39A 2DZUA 2ZVRA 2NLIA 1T8QA 2R1PA 1ZJIA 2W66A 1OD0A 3PBVA 4PRRA 5FSEC 1VJSA 4X0NA 3W81A 2B7PA 1BF6A 3M7SA 3BAYA 5EFFA 3L4VA 3GO2A 1V02E 1FXPA 4FXRA 3CM4A 1XG3A 4QCFA 3VD7A 4DRSA 4B15A 2ATMA 2Z6JA 6ALDA 3S5ZA 3KM8A 4JX4A 2V8ZA 1L2QA 3KRUA 3EYPA 4JEQA 2DUXA 1Q3NA 2PCQA 5M3WA 4U28A 4NRRA 1SFSA 3USZA 1A5BA 2EEXA 2YL6A 3GDBA 1HKVA 3KOZA 4XZHA 3N15A 5HQEA 4CCZA 1SMDA 1Q6FA 3RLUA 1E4MM 3G8EA 4JFWA 3NUKA 3KDNA 4ZQMA 4ZO8A 2HE5A 4WXYA 2XZ7A 2BGSA 1EQPA 3FY1A 4HIBA 2PEVA 2NX1A 3PAJA 1QWGA 1O5XA 4Q33A 3ZVHB 2DQXA 3VNZA 4AD2A 1DXEA 1K8YA 2Y6ZA 3EKGA 2BB0A 3M0YA 4AZGA 2PDPA 5CH9A 3HGJA 3EEGA 4KH2A 1IEVA 3VFLA 2D3NA 4O0QA 4LEFA 4IPJA 5I0DA 3BDKA 2BWGA 4JY8A 3PS7A 1MUCA 2CWXA 4TVUA 2CETA 1FHDA 4Y9NA 4I9AA 1OX4A 3VC5A 3CUZA 5M2FX 4JFVA 1DBTA 5A2AA 4NHVA 3T42A 3VNLA 2VOTA 4QJ5B 1JCMP 3AUJA 4M81A 2W91A 2W27A 4PN2A 4JX5A 1D8WA 2BP1A 1QPRA 4M8UA 3BLDA 2FMOA 3FFSA 4IM4A 3SSJA 2O9OA 3MT1A 2PB1A 2BXYA 1H3GA 4C6KA 3REQB 3TN3A 2AAAA 1B90A 3E5BA 5FAJA 4O18A 1JCJA 2VURA 3SCWA 1CIUA 4KEUA 2GVLA 1V6UA 4NU7A 4D8AA 4LBSA 3NL5A 4QSFA 1M9HA 4IMFA 1P0EA 2AL2B 2CKRA 5AHLA 5CC5A 4YNGA 4Y9AA 4W9TA 3LUTA 4AEFA 4H3DA 2BG5A 5H1WA 3N11A 4O1FA 2VCCA 4GYJA 1PCWA 3WLRA 3ZJKA 2Q8LA 4MY8A 3SCTA 1VZWA 2ZYFA 1XIGA 4HOZA 1UQYA 2V3EA 4KWSA 4PTXA 3BXWA 4UTFA 4G7EA 3NVDA 3KUMA 2VC7A 1SU5A 4HMDA 3UG3A 1PWMA 4ERIA 1WBJA 4K1WA 2YYTA 2C91A 3V18A 2I5QA 4R9XA 1GW1A 2IS7A 3VTRA 3AOFA 3MMTA 4GQQA 3GHTA 1EJWC 3W3OA 4UCGA 3W7JA 3DHPA 3G3DA 2QHAA 3GIPA 4GIEA 2Y5JA 2BX7A 3N4EA 1DIEA 4KW2A 2I9UA 4XAFA 1JIBA 3L67A 4D6JA 4UMBA 2J62A 3EX2A 3BV7A 5EY5A 1XQLA 1L6WA 2GQAA 5BOEA 2G3NA 1OVDA 2DJLA 5JIPA 3URNA 4QE1A 3DC0A 1TPVA 4EF8A 1WOBA 2ATSA 1JPKA 3VM7A 1Q45A 1FWHC 4DXKA 4WF7A 1BFNA 1XCFA 3VIPA 4RPPA 1E9IA 1AW2A 2P1FA 2FHBA 4YTUA 1J10A 1XLCA 4XB3A 3E0LA 3R6IA 4PBFA 5CAHA 1H41A 2A3LA 1U83A 1QATA 5I23A 3B04A 1TPUA 3KHDA 2VEPA 2NWRA 3RO6A 4N2YA 4M3PA 2YR1A 3SCQA 2PI6A 4PBGA 1Q85A 1VYRA 3UQNA 2CW6A 4AH7A 2D3LA 2PP3A 1W5MA 3GKAA 3O6YX 3FX4A 3ECQA 1GG0A 3ZYZA 4LBUA 2XN1A 2E5DA 3ZS4A 2B7QA 1JPHA 3W7HA 5HJXA 3VKCA 2D22A 3G1XA 4JTLA 4I5RA 4FXFA 1E9ZB 1YRRA 3LENA 1HKMA 4WCJA 3FJ4A 1J0YA 4LVGA 5AC4A 3MP5A 1OYCA 3IS4A 2POZA 1XLJA 3UWUA 3ZT7A 1ZJBA 5HMFA 3KOFA 3TOYA 1LLOA 2XIJA 5AHEA 4XBSA 1YADA 1ZY9A 3SCVA 1FH9A 2O92A 3N2XA 4ORIA 3VX1A 4G2DA 1JCTA 2PDMA 4JIPA 3MYPA 3E02A 1KGXA 3HPSA 3ARZA 2J47A 4NAEA 2J8GA 2DSVA 3QRHA 3R0UA 3QKZA 3KAOA 2G37A 3OBEA 5LSMA 4CNUA 5A6BA 5DXYA 3AWNA 1UR8A 4C65A 2W4XA 1A5UA 4B90A 4A22A 3RGTA 5B7YA 1KM5A 1QFEA 2HSAA 4IG2B 2D20A 2PWEA 1J6PA 2X7WA 3S42A 4ILSA 2Z28A 3W73A 4DYKA 3LHTA 4NX5A 1AA1B 1BSLA 4AY7A 1G4TA 3E38A 2J7HA 2ALDA 1EKOA 1Q6QA 1PL9A 1U5JA 5BOOA 3CLMA 3LXBA 4W5UA 4B5SA 4FIRA 4M6QA 2ZX5A 1LDCA 2J7CA 4YIWA 3H12A 1FFRA 3MZNA 3UVIA 1XHGA 1OADA 1TMHA 4QEEA 1HXJA 4NL1A 4O16A 1QOXA 5K2ZA 1TV2A 3PZMA 3CAWA 4Q32A 1ONRA 1F5ZA 2FHFA 1NAL1 1PHWA 3HQOA 2A2IA 2GGEA 1QNSA 3PM6A 3PFMA 3I65A 5HMEA 1YDYA 2E3ZA 1B3YA 4AZBA 4Q8WA 4L9ZA 1IYXA 4V1YA 1GPWA 2A3CA 3A3WA 4RJEA 1OHLA 2Y2WA 5HR6A 2ANUA 5ABFB 3DI1A 1TA3A 1W32A 5C71A 3BICA 4ZE5A 4ZBCA 2HROA 5K4XA 4RW3A 3T81A 4HVXA 3THAA 4EPEC 4WD0A 3PSWA 1F3WA 1B4KA 1HVXA 4KWVA 1PXGA 4KRTA 1XYBA 4D2JA 1NDYA 2F61A 4PUNA 3W0KA 1UWAA 3WDRA 3VA8A 4F9JA 3E0WA 1EA9C 2GPTA 4S2CA 4G56A 2QCGA 1V3KA 1LUCA 2QMKA 3AXXA 1L6YA 2GL5A 3CZGA 4LEQA 1FVPA 4CN6A 3T07A 4CQCA 3RMEA 1GOIA 3TW7A 5D09A 4E4UA 1KR1A 3IJ9A 2Z24A 2QUNA 3WLMA 4U2YA 3ZM8A 4WSKA 1LM1A 3TYCA 1NOUA 4HSHA 3LK6A 1GTEA 2ICSA 4GYFA 3EXSA 3EZ4A 5LGXA 4AVNA 2E6AA 1DWHM 1E1CA 4DLMA 3HG2A 3QGVA 3WEMA 5DMNA 4GZJA 1ME9A 3CHEA 3V5CA 1SFLA 4TUFA 1XS2A 1U1UA 5K4ZA 2BGQA 3LM7A 1XLFA 3LMYA 1IQ8A 5AFDA 1PJ9A 1S1PA 1Y8BA 1PDZA 2Z0IA 1JPDX 1KQYA 2OGYA 2R6OA 4XKYA 1QU4A 1W9BM 4PCTA 1CWYA 1PKYA 1XV8A 2GWGA 3TMQA 1UQZA 4AYSA 4Q4PA 5IRPA 3TC6A 4J28A 4D1JA 2YCKX 3ALGA 2E9BA 3ITOA 1FDJA 3WFZA 1W56A 4JNYA 3BAJA 2E77A 3WN6A 3B9DA 1JDCA 3MKCA 3H70A 5A5WA 1I45A 5FKYA 3ES7A 4V2XA 3GW3A 4QRNA 4PTMA 2X30A 3WLSA 3WLNA 3HG5A 4UOZA 2E8YA 1HNYA 2YA1A 4AMCA 4MNMA 5AZ0A 3AALA 4BFAA 4P8VA 5HNUA 3ABXA 2DORA 4NIRA 2BTMA 1I6NA 3B06A 3V3WA 4DXVA 1S2CA 2I16A 1QW9A 2V82A 3CMJA 2WMFA 4RZ5A 3BW3A 4DB7A 4ENLA 1GW9A 1YYAA 3W37A 2FPYA 3H7RA 5E9AA 3O0KA 4LGXA 1W17A 3OVRA 1TREA 1LOSA 1EDQA 2CHOA 4H2HA 5DRCA 2WBKA 3ITTA 5DT7A 1WP6A 3N2OA 4YHEA 2H8XA 5FCZA 3T0CA 5JXQA 4AB4A 1MXGA 2OQHA 3GR4A 1FWIC 1GYMA 4O52A 4XK2A 2CZFA 4NZCA 2CCRA 1EXPA 3K4WA 3QXBA 3L65A 1ITQA 5C7VA 6ENLA 4GUFA 1M65A 2I56A 1E15A 3ARWA 3EGJA 2O9PA 2WVVB 5PTDA 2HS6A 3UD6A 2XVGA 2Q71A 1G6CA 4ZCWA 2B31A 3VDAA 2PUZA 4KCTA 3FAXA 4NNBA 3G0XA 1JPMA 3VOGA 2YXOA 3W22A 2POTA 1Z8AA 4HCDA 4RR4A 4E8GA 6TAAA 4J3XA 3G5EA 1RALA 3LRKA 1EEPA 2CFFA 2QIIA 3OVGA 4LSBA 3PHAA 3W29A 4ADSA 2VI0A 1W1IE 1S39A 3IGHX 3BMVA 1G69A 1WUEA 4H8NA 4J27A 5SWUA 3PR2A 3BPWA 4M6UA 4CCEA 1FKXA 5H8MA 3QN3A 1OC6A 2BOFX 3DFTA 1M68A 4UFLA 3YPIA 4EACA 4JQ4A 3UF9A 1ADDA 3G77A 3P8IA 1RCXB 4J2PA 3C0JA 2QCEA 3BCJA 3CEPA 5HNRA 4JCMA 2VFEA 3WH6A 2DVXA 1PB0A 3RF9A 5D9PA 1Q4WA 1UYQA 3TU9A 5EGRA 1F4HA 4DYEA 3PJWA 4O13A 3NDYA 3T4CA 3M44A 4E2VA 3Q94A 3ABQA 3L0NA 4QJ1A 4M7TA 4IJRA 5MKGB 3CV2A 2DT0A 4IPLA 4CNOA 3BLPX 1XBXA 3WJYA 1EGZA 3H2EA 3QQ1A 4JIEA 2ZICA 2J8FA 5KETA 5FL0A 2WMIA 3H2CA 3U2EA 2FTYA 4O10A 5LNVA 4N0RA 3N29A 4IIDA 1Y5VA 5IOBA 3QOMA 4PUEA 1KXTA 2Y24A 3AIUA 3TTQA 3CGTA 3VIJA 3NAVA 1RH9A 3EWYA 4AZCB 3QV8A 5I00A 1NDVA 3SEPA 2A79A 3RU6A 2WJFA 1PO9A 4PEKA 3SR7A 3UJ2A 2IQTA 3LPGA 4IUOA 4IXXA 1S2AA 5CXPA 4L6HA 5D8WA 2PGFA 2IPWA 3JVAA 1VPXA 5T9CE 1I9CB 1VFOA 4JR5A 1TIWA 1X8CA 1LYXA 3EKZA 2W67A 3HBLA 3EX4A 1MW2A 3MO7A 2WWCA 1R0MA 4MLJA 1NP0A 4WQ6A 4JTDA 5ENLA 4PB5A 5DT5A 4CNSA 3CMFA 3NM1A 1WAWA 5A8PA 1FDYA 1W3LA 3LLDA 3LCWA 4PMOA 3W76A 2PDUA 3P93A 4ZL1A 2E28A 4E8CA 3S5OA 3H26A 2DSWA 1VBRA 1X6LA 1F3XA 1P43A 1TUXA 1KO0A 1LWHA 4GX8A 5BWFA 3QQWA 4HOWA 3DG3A 3C8NA 4BEQA 3G8RA 2HXTA 4H7ZA 1E72M 1GOWA 2AGKA 1MYRA 2NXHA 5GNZA 4C6JA 4MWAC 2V2HA 4UC5A 3IARA 2OQYA 1NQ6A 2ZDSA 1KM3A 3ZWSA 1FP9A 1KGUA 2BMBA 1HL2A 3MPGA 2QDDA 4UQEA 3CNYA 4JTQA 3OEXA 5C9ZA 1H5YA 4KS0A 1BVZA 4G8TA 4XIMA 4K37A 4EVZA 4LPCA 5I78A 5G1TA 2FH8A 1E56A 4XO6A 4URIA 4KIEA 4KEVA 4LVDA 3WQ6A 2WC7A 5LXXA 4E5TA 2GUYA 2VEMA 3H7UA 3ENLA 1TV3A 4DELA 2CPUA 4U5IA 1LZOA 1FWDC 4CCDA 2ZIDA 2ISSA 2DZTA 4HD5A 4IGSA 5KEZA 1BSIA 2QQ6A 2WZEA 1AMKA 3TYBA 3MANA 4EIVA 2PLCA 1OX4B 3N2TA 1V5XA 4XKMA 3UXLA 2VQTA 2FPVA 1GPFA 3S5YA 1OFAA 2C6QA 2REQA 4H1ZA 3CQHA 4JOMA 1U33A 4IIHA 1A0DA 3LLXA 1RD6A 2O7QA 4PCFA 3V5FA 3R11A 4XBJA 1BTCA 2QGYA 1TWIA 2V5LA 1V7YA 2RJGA 2R9RA 2EF9A 4JQ3A 2ACRA 3CBWA 2DIJA 2WQPA 1N8WA 1VCFA 3GXPA 8XIMA 4H9TA 1XDJA 4WOZA 5CZTA 3VILA 5FIPA 2CYGA 1C9DA 1AH3A 4PFMA 4CLMA 3VIKA 2EPKX 3W70A 3WLQA 3U2CA 3F7JA 3OVQA 1SYTA 1R9XA 3GXMA 3AYVA 3EX1A 4MAVA 4XISA 2V68A 3ISIX 2HVMA 1EC8A 2DT2A 2QJNA 4TXEA 4G7EB 1GZ1A 3SIZA 3W2MA 4RNJA 8TIMA 3U9IA 1OFQA 3K1GA 3ARXA 5HNNA 1ICQA 3NYZA 4DF2A 4K38A 1NWTA 3DG7A 2Y5EA 3NQGA 3ITCA 1UD8A 1YBQA 4L6OA 3APTA 4UTTC 4YCPA 1EJ7L 1NWSA 5U7SA 2DDXA 4W88A 4BCEA 3GC2A 2PD5A 4ZB2A 1Q65A 2QT3A 1ICSA 1EZ2A 1CDGA 4NYYA 1TJ0A 4C90A 3ITVA 3DEQA 1J0KA 2XGIA 3LS9A 1ZJHA 3R1ZA 2WPGA 3D46A 3PSVA 1RD5A 2FPTA 3M16A 5CGTA 3G1VA 1LBLA 1VRDA 3F4VA 3QHNA 3VE7A 2C79A 3VD4A 1B54A 4HA4A 3BSGA 4UMCA 2QMJA 4IMAA 4LYQA 2C3ZA 3M9YA 1LT8A 1K6AA 3H2OA 6XIAA 2O9TA 3VOJA 2ZA1A 2EGZA 2IKHA 2CBVA 4V15A 2QGHA 4JTTA 1IGSA 1GKPA 1EUNA 3GM8A 3M0XA 3CUFA 3CASA 4QE4A 4IIBA 5BYWA 2ZTJA 3A4AA 3M0LA 2DH3A 4QG8A 1JUKA 3HO8A 2ZUMA 1GORA 1TRIA 3NDOA 3PB0A 1G7VA 4OJYA 3QLDA 1GJWA 4US6A 4E38A 4NZ1A 3AIVA 2FTWA 2IPFA 3E74A 1XXXA 4PBEA 1B9ZA 1ONXA 1UWRA 2DFAA 4MGGA 3KL5A 4R33A 3R89A 4LAMA 3BOXA 5C55A 4IL2A 2QPUA 1OCNA 4K6AA 1S5TA 3I7QA 4GBUA 1TX0A 4B9ZA 3LOTA 3T2PA 1UIPA 3O3RA 4LNCA 4V28A 3BGJA 3SN0A 4XG1A 4BEUA 3KWXA 5CQ1A 1ZBWA 3EWUA 4GY1A 1JDDA 2R1KA 2HNEA 4NAEB 1B3ZA 1FCQA 1D3CA 2HPIA 2UY2A 1QR7A 2QV4A 4QAIA 3WBEA 3VVGA 3WF4A 1BHGA 2XVKA 4IQJA 4HNTA 3CZLA 5FEPA 4Q8VA 3BW4A 5K9XA 1S5WA 4PEEA 2GDQA 3AIWA 3VE9A 8A3HA 1VHNA 2GJNA 1OX5A 5U4NA 4GCAA 3CWOX 1GVSA 4MWAA 4JX6A 4WDUA 1PUDA 2QCCA 2J27A 3U5UA 2JKAA 3QEZA 4ZQOA 1Z48A 3ZQ9A 3LGEA 4UQ9A 3U2OA 3FS2A 3QV7A 4H4IA 2ZX9A 2IKGA 5EMUA 1NH6A 3W9ZA 4BK9A 2J6VA 3PZIA 1AZ2A 3EMCA 1AH4A 2Z1KA 5AB3A 4JKLA 2BVWA 4LC8A 4LV9A 4HOXA 2AOSA 3TV8A 1EF2A 4GXPA 1J12A 1KBIA 4AXNA 1LJYA 2BZNA 1CW2A 4YPJA 5K9CA 1BYBA 3HN3A 5A3HA 4O28A 3IGUA 3GR8A 1JZ7A 2V38A 1GZGA 3IV3A 1J5TA 4DUOA 2BS9A 4HPXA 3W7DA 1A3XA 1TA3B 4OU1A 2RDWA 2WSYA 2WV8A 1JYXA 1ECEA 3BQ6A 4NP7A 4B2DA 3AXHA 2PRMA 3QSRA 4GO8A 1ZPTA 1H62A 2EG6A 3TAOA 1VEOA 1JDFA 1FQ0A 1WX0A 4PA8A 3OB8A 1B0IA 1HFBA 3NQBA 4QG9A 4F79A 3N4AA 3R13A 4D72A 5I3IA 2PDBA 2VENA 1NF0A 1F05A 1LUCB 5HDRA 3NQ6A 3RXZA 3LXAA 1XRVA 1GOOA 1EZWA 3TQKA 1W31A 4ICCX 3TSMA 1L8NA 4MB4A 4GQBA 2CIPA 4DO6A 4A21A 5I3HA 3V35A 4JIHA 3QGAC 1N82A 4UZUA 1KM1A 3KS6A 1XIJA 3TONA 1FFQA 3SQSA 2OOGA 4CNNA 1ITCA 3AFBA 3AHYA 1E1CB 2JIWA 1VFLA 3G0UA 1HP5A 1P6WA 4QLLA 1S38A 3VPLA 3LY0A 5CC7A 1TWDA 3BQ5A 4AVOA 2XFWA 3MI6A 5EBAA 3B03A 3WJXA 5HQLA 1R7AA 3LV6A 2OVLA 4XKYB 7REQA 4IPNB 5DMMA 5LGZA 3PPGA 3HB9A 3PUOA 3ELFA 1W3JA 3KFTA 5E0KA 1Q6EA 4GGHA 2IW0A 4HU3A 1VPYA 4AVFA 1C90A 1IIHA 4P5UA 3SUVA 1UMLA 4ML4A 2HK0A 5F2GA 2PGRA 5G4HC 4LT9A 1W2PA 3DU0A 2HZGA 4M51A 5LKYA 2XVLA 3LTPA 3RPMA 3UP8A 4JS3A 4H8UA 4QITA 1PZ1A 1Q6GA 3II1A 4U31A 4PMJA 4IJBA 2DU2A 2YLAA 3GWQA 1Q8AA 1CZ1A 1KRCC 3I3EA 5F4XA 2HDJA 3WL0A 2HISA 2ZX7A 4O1BA 3QYQA 1LQAA 4WLCA 4D8ZA 3ABRA 4ZSTA 1IEXA 1JG9A 3CV7A 4D6IA 2OZ8A 4H8HA 3KTXA 1BWVA 3ZOAA 3U4AA 3F5JA 1KM4A 3MSYA 5FJUA 2HWGA 4R7OA 1A3WA 1DQWA 3KDOA 3Q65A 4D6EA 1Y5WA 1GOKA 1W9DM 1VBGA 1T41A 3PZTA 3RIKA 3IGSA 1EJXC 3VKKA 3XINA 1DWGM 3ARPA 1QNVA 4NSBA 1C29A 3W87A 3IJ6A 4NRSA 3PPCA 1FHLA 1RP9A 2QYGA 1NDZA 2A6LA 2CLEA 3WLPA 2UWFA 4UFIA 3IJ7A 2FZDA 3THDA 2VUYA 3QFWA 1CXKA 5ABEA 3DZ1A 3DKLA 2P5NA 2DT1A 2WMHA 4WY0F 2WC3A 3M4HA 3S2JA 3N25A 1G94A 4EXBA 3HQ1A 3L4TA 4B91A 3CHCA 1UKTA 2J88A 4IUGA 2VNCA 4ZR8A 3HPZA 2ZA2A 1F3EA 1SJBA 1D9EA 1I2QA 2P53A 3SB0A 4AHPA 1P6BA 3T9PA 2ZKMX 1J18A 4IFRA 2XJ7A 3PBUA 1A50A 3L66A 4QS5A 4DAFA 4QQ3A 4F0LA 1LLWA 1JDEA 1EH9A 3AMCA 4H19A 1O95A 2NUXA 1V8EA 4FLSA 5TBOA 1PKMA 2QDEA 3QVQA 4KRUA 3OQ8A 3W38A 1EDTA 3N12A 4G9PA 4Y8EA 3AU6A 3SFKA 2RFGA 3IIZA 3Q4DA 1EP3A 2VXNA 1YEYA 3DYPA 4H6RA 4UFMA 5D9MA 3OA3A 2ZUUA 4Z2IA 3L2IA 1NWUA 4GUGA 5CZSA 4UTKA 4XX6A 4YCOA 1QI3A 1YPFA 1TTPA 4C60A 2BGNE 2YOCA 3WX7A 1YX1A 3IRDA 3ES8A 3PN8A 2XH0A 3FXGA 4GK8A 5EL1A 3TAKA 3GH4A 1W8SA 3N1AA 2YBVA 3MUZ1 1D2KA 2V6AA 2DZBA 2HXUA 4IZGA 1BVNP 3GVGA 2W62A 2A6NA 3SAZA 1CPUA 1XLAA 4GVGA 4JAWA 3MVTA 1UHVA 2J7BA 1SW3A 1ONWA 3N13A 5T9BG 2OQLA 3TW9A 1ZHAA 4C6DA 3MY9A 1EJTC 2C8NA 4YL2A 2WMIB 4MSSA 4RNHA 4CU8A 2PODA 3PTMA 4C6NA 1KR0A 3W1NA 4H04A 3EA3A 3O16A 3WK1A 2WK2A 1VR6A 2VEIA 1G4PA 3PPFA 1U30A 1XICA 2V9DA 3LHYA 1IR1A 3A3XA 4TV6A 4R3UA 4ZMGA 3AC0A 3FSUA 3KS5A 1CXEA 4A3HA 1R85A 2J24A 4PZVA 1CBGA 3W7MA 1A0EA 1AVAA 3TIMA 4U3AA 3WENA 1WZKA 5BMWA 4W89A 3ABOA 4LOCA 2DPEA 1O7AA 2PP1A 3VIHA 3WZ0E 1OG6A 2CLMA 2VRQA 1VEMA 5GJMA 5H91A 4GH1A 4PTDA 2FZ8A 4JICA 3PUDA 4DPPA 3B8UA 3GDLA 2QZRA 4DF0A 2PFHA 1P6CA 3N6QA 1M7JA 3IVUA 3MHGA 2VMFA 4FO4A 4J1OA 1SMAA 4MJ2A 4QBXA 2YKKA 2WAGA 3UWZA 2YXXA 4OGZA 2PDGA 4ONVA 2WHJA 3HTWA 1FXQA 3P0WA 3V7PA 2VVSA 1CT5A 1J4EA 4A2SA 5MF5A 2C1GA 4Q7IA 4IIFA 2PDQA 4Q3MA 3S6DA 2BVTA 1WKDA 2E9LA 3SCRA 1R3SA 3BCDA 5DO8A 3OU8A 4W7VA 3LHZA 5D2YA 2AAMA 2XSXA 4BF7A 5KZEA 5HJYA 3UZXA 2DZPA 1L6FA 3NQFA 1UOKA 2C0AA 3BLIA 1GOMA 1V7AA 3V4BA 3L5LA 3DX5A 3RM8A 1TVPA 1X1ZA 3M5YA 2Y89A 5F4WA 4Y8FA 2JEPA 3VM5A 3F4NA 4RDWA 3P84A 4B92A 3UXIA 1IXOA 3TJLA 4D6HA 2DP3A 3EWDA 3S5SA 1XGEA 3G2GA 2EXOA 3GHUA 3IVTA 3VKJA 4DO7A 3CB8A 3S6TA 3GUGA 1KTCA 2REQB 2A4AA 3T0TA 3S5NA 4MFDA 3LSBA 3BG3A 4MTVA 4LH8A 1RK5A 4HKPA 3EX3A 1D3GA 3TNOA 1TZZA 3WBYA 4GRSA 2OGJA 3A22A 2VD8A 1OIFA 2OZTA 2H90A 3EOSA 4OE7A 3S8HA 1OFPA 3KW3A 3HURA 1MNZA 2XFFA 3KHJA 3N14A 1U22A 1J0JA 1FY6A 4GIRA 4AWTA 3NDZA 2Z27A 2UY3A 3A21A 5A1AA 2YA2A 5M5DA 2G3IA 4MY1A 2AMGA 3TN5A 2O56A 3OO2A 1HN1A 1OC5A 1DJIA 2XUCA 4BJHA 1JL8A 1KKOA 5TIMA 2OKTA 1OCBA 3WQ4A 3HFYA 1YLVA 4D1IA 1MWOA 1FOBA 3SUSA 2I7GA 2RHGA 1ZBVA 2BXZA 3QYSA 4H7CA 4C6BA 5BU9A 2PDWA 1WOAA 3MA8A 1YBQB 3FCPA 3P8JA 2PZNA 3SURA 3VOHA 3AHVA 4HNNA 4E2BA 1ISVA 3UPMA 4ATLA 3P81A 4S3AA 4XZNX 1D8CA 2VQUA 1CI1A 3L4XA 5C0QA 2G3FA 4QISA 1VFTA 5G2HA 4CGTA 4OBRA 1FDZA 2WHLA 8CGTA 5IXEA 1M6JA 3GYEA 5CZJA 4ZOCA 2XVNA 4EX4A 2BHUA 5B7ZA 3OBAA 3LBMA 1PIFA 5ABHA 3LXCA 3NQAA 4AG0A 1LL4A 1GJUA 3DGRA 3DIPA 4MFEA 3QPZA 3CU2A 3W7NA 4L9XA 4QS6A 3MMUA 4QSHA 3TXVA 3GDRA 4Z42C 3I68A 3GHRA 1VFUA 4Z0SA 3EPMA 5M17A 2Y8KA 1UG6A 1XWYA 2OYMA 1NU5A 1XD1A 3CQJA 1ITXA 4DUVA 4PC8A 3W6LA 1B9BA 2P8CA 3S6OA 1ZU8A 1PDYA 1R3YA 3PWIA 1QTWA 3N2CA 4RV8A 3E2SA 3B0XA 1IXQA 3RPDA 2XSAA 1WKYA 1XBVA 5CLWA 3U48A 1JGIA 3MW7A 1O6IA 5TQLA 3MKVA 3N9SA 1NEYA 3R8RA 2ZVIA 1XSJA 3WEZA 1XW8A 5E6ZA 1BLIA 1DHKA 1W3KA 1YXYA 1KKRA 2R91A 3BAWA 4ZOEA 6TIMA 1UH4A 2DZWA 2D0FA 3ANVA 3L2MA 3U6WA 4HNVA 2QVNA 2QAPA 4PSRA 2FZBA 1UWIA 1DJGA 1VH7A 1RJRA 3WF3A 4LW7A 4MWAE 3M0JA 2VUNA 4UXDA 1PSCA 4Q4KA 1H7RA 3EB2A 3LI1A 2ZQ0A 1KRMA 2EAWA 3HA1A 4UMAA 2EPNA 3P60A 2WVSA 5HJLA 2CBIA 4IPIA 5HAOA 4RV3A 1YE4A 3F5LA 3WH9A 2VCAA 1W5QA 1FBAA 1UR2A 2DSUA 2H6RA 4JBRA 4XD3A 1E71M 2ZUSA 1XLIA 2DVTA 3CIVA 3B9NA 2E68A 3ZSSA 3UWEA 3LTSA 3OIHA 5AHNA 4N9DA 3R0DA 4EAMA 1QUMA 2CKSA 4MWAB 2XIQA 3U7VA 3IJDA 4H01A 2KZHA 2ISFA 3I6RA 1XSKA 4GLEA 5E6YA 1W91A 1XYAA 3GU9A 5D32A 3M0MA 3OA5A 4PRTA 4HYVA 4Q8TA 1ZS2A