1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
molecule keywords alpha-galactosidase
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
1MVYA 1Z44A 2G5WA 3KVMA 3DI1A 3GDKA 3QH2A 4UXDA 1ML1A 4OV9A 1SQ7A 4JTJA 2EHHA 2XN1A 1OFQA 1CXIA 3P7YA 1GG1A 2WNWA 3W7GA 2F7QA 4GBUA 1IGSA 4WOZA 2FH8A 4QM1A 3HB9A 3UG5A 4XTDA 2GJPA 1OF6A 4XUGA 2FH6A 1O95A 3BAXA 4PSRA 2H3DA 2ZUTA 1OK6A 1JR1A 3S6DA 1KGUA 3LBMA 3FEMA 4K38A 3GX9A 3DAQA 1E51A 1BVZA 3IJ8A 4RV8A 1HTIA 3TE9A 4UIOA 1QPOA 5F4WA 3EXRA 2Y7FA 3A5VA 1XBZA 4RR4A 1B4KA 1H60A 1R30A 1NSJA 4H4IA 3G1FA 2BY2A 4LU0A 1DHPA 3QC3A 5LNVA 3M43A 4JFUA 1Q6OA 2F1AA 3VSUA 3B0PA 1UKQA 3Q58A 4JTKA 1XBXA 4ZMGA 1KXQA 1I2OA 5CPOA 1DOSA 4DBDA 4N6EA 3BARA 2GQ8A 1L9WA 1SUXA 1FWWA 4LRSA 3W87A 4TVUA 4IQLA 1WA3A 3C56A 1H7RA 1K8XA 5D09A 3EX2A 3FJLA 2YIHA 2YGYA 3BVVA 1VHCA 1O4UA 4XQ6A 1ALDA 4E0CA 3DXIA 1VJSA 1GT8A 1XUZA 5KMYA 3DFTA 2E9BA 2OW7A 1N8FA 3VE9A 2ZBTA 3W71A 4AEOA 3OLEA 1RQHA 4GI9A 5K3VA 4IPIA 1YLVA 2CU0A 3G0SA 5KINA 2VEPA 1PHQA 1JDCA 1TCDA 2EAEA 3VX0A 1L6YA 5HULA 3CZKA 4M7TA 4WJEA 5HXMA 1VCFA 1T0OA 1XH0A 1OSEA 3GIYA 1PIFA 1RQEA 5DY2A 3WJZA 1I8JA 2Y63A 1PS3A 1P0NA 4RXFA 4GUIA 3PULA 5LNSA 4IXHA 1QHPA 3L2LA 1GOXA 1GVSA 5D2YA 3C2FA 3P61A 5HNRA 2FB3A 3VNDA 2CHNA 1GEQA 4TU1A 1SO4A 5BRBA 1Z48A 5A6MA 2HS6A 3W1NA 1DHKA 1KM6A 4IX0A 4XBSA 3WELA 1E43A 2E77A 4WX2A 2A4AA 1JI1A 1FCQA 4GWEA 3QMTA 3LRKA 3M44A 3W1MA 4O10A 3CTTA 1SZFA 4HSNA 3LCLA 2NV1A 2YA2A 1KBJA 2ZZ6A 3EX3A 3M1ZA 3KRUA 2RH9A 3I7SA 2J9XA 5HUOA 2AAAA 1RR2A 2X1SA 1LOQA 3EWBX 2A2IA 3A24A 3G1SA 4N02A 1EUAA 3C4UA 1ZJIA 3BAWA 3SZ8A 1W3TA 1TJPA 4UQBA 4LRTA 3TH6A 3VGHA 1OFBA 3IIPA 3TJLA 2XIBA 3EX4A 4IMEA 4LVGA 1UKTA 1TB3A 4N2YA 2CZDA 3WDIA 1XL9A 1VLWA 4WY0A 4QAIA 3VE7A 3TQVA 1GVOA 2QCFA 1I2NA 3QQ0A 3L0NA 3DX1A 5CLTA 1XKYA 1GVQA 2Y24A 1AMKA 4ZQNA 4IJBA 1K3UA 2G3MA 1DVJA 5HINA 1JUKA 2HS8A 2J9YA 3GXFA 5KZEA 1HO1A 4UNLA 4WSKA 3DFSA 3W7PA 1OT1A 2Z0IA 5HPOA 4LV9A 4FNSA 5A2CA 2VOMA 3MBDA 1UASA 1C8QA 3HOJA 4AEFA 3W2JA 3IGSA 1EUNA 4JTHA 2PWGA 1B57A 1NVMA 4JD4A 4JYDA 1QOPA 4PFMA 5E0FA 1C9DA 4JGDA 1WZKA 4KFNA 1RP8A 4ML9A 3MMTA 1TQWA 2CFFA 3PR2A 4J3UA 3W7LA 3GXMA 4K8EA 2DZTA 4NNCA 1QFEA 2E68A 2X30A 3C8FA 3LTSA 2VELA 4MY1A 4UFIA 1CGUA 1EA0A 1I4NA 4QISA 4UR8A 4FNRA 1DBTA 1M53A 2B4GA 1GVFA 4CVWA 1I45A 1VCVA 3GXPA 4FLQA 1X6UA 2IQTA 3CPRA 3TW7A 1FDJA 3G22A 1EB3A 1GTHA 1YTEA 3VGDA 3VCRA 4Q32A 2OSYA 1BPLB 5D2XA 3T55A 2G97A 4P2VA 1KW1A 4WLCA 1KGWA 3NL5A 1TQVA 2V5LA 4LVDA 4NJIA 3F4NA 3UNDA 1EPXA 3USBA 2G3NA 1SW7A 4NNAA 2ZA1A 3EDEA 3VX1A 4MZYA 3Q37A 5K9DA 3STEA 2A6NA 4EF9A 3OVQA 4DPPA 1NEYA 1KM0A 3KL5A 3NQGA 3NQ8A 3QGVA 3UWWA 1O60A 1WE5A 4XKYA 1I2PA 4HA1A 1F7BA 1QAPA 1BLIA 3P5YA 1TYGA 1V5XA 1VCGA 7TIMA 4FLSA 4HNVA 3MW7A 3C52A 2QMJA 1VFOA 4WSJA 1B2YA 1YPIA 4HPXA 3LHTA 3VFLA 3UEQA 2TRSA 3W85A 3W76A 4CQ9A 1RPXA 4GJ1A 3L4WA 1MO0A 1VFMA 1M7XA 3S1VA 4FX8A 1EP3A 4EF8A 3MUXA 2V81A 2NWSA 3FS2A 4LC6A 2DP3A 3LHWA 3P82A 2QDHA 5FEZA 4M5PA 1CGYA 3W7QA 3LXAA 2WNQA 3BUIA 3CT7A 1QWUA 2NSXA 2IGTA 2JKPA 2E0PA 2G95A 2QJHA 1ICPA 4FNQA 1I2QA 2OMAA 1DKWA 4LWWA 1PVNA 1OFOA 1KGXA 2ISWA 5LGXA 3C0JA 2FHFA 3D51A 1AL7A 2EADA 3KL0A 2GVLA 1F73A 3W1PA 3W1TA 2QDGA 1AK5A 1TTIA 1FBAA 4MKNA 1FCVA 4X9SA 3W73A 1GVIA 1KTNA 3ZFHA 2F84A 2GJNA 2OZ0A 1XBYA 3L5AA 1TPC1 1YXCA 4WUIA 2C3ZA 3TSBA 1GZGA 2V5BA 3E49A 3ZR5A 3G18A 3RIKA 3OLIA 3MWAA 2EABA 3NM1A 3BAKA 1TMHA 3ZSSA 1VYSX 3WNOA 5EPDA 3C2VA 3G1DA 1F5ZA 2GOUA 2V2DA 3HG3A 3TMLA 1OX5A 4HOZA 1K7FA 3EDKA 5IM51 4LPCA 1L6SA 5G5IA 2ZIDA 3MBFA 1GYLA 4J3XA 3DKJA 3WEOA 3WK0A 3BVJA 2YZRA 5DCBA 3DENA 3WN6A 1W5NA 2XVKA 4J3TA 2ZUVA 2D3LA 1YTDA 2XFWA 2V2HA 4IUOA 4WOQA 5D2TA 1LCOA 2Z1BA 3BGJA 1HWWA 3EDJA 1TPB1 1LOSA 1TRDA 3TQKA 3FA5A 3TQ0A 3UXDA 2QUUA 4O8RA 2WVVB 3PS7A 5F2IA 3BMWA 4R34A 4O4VA 3STFA 3II1A 3O8AA 1UKSA 2YW3A 1L2UA 4X9YA 4JTGA 4HIBA 3VM7A 3CHVA 4QNWA 5D02A 4A29A 3KHJA 5CSRA 3G1AA 2A1YA 1IXPA 1JRBA 2WKJA 1QR7A 1TPEA 1UB3A 4HPJA 5FF0A 1F76A 3TW6A 2V2CA 2NLIA 1K02A 1W5OA 4O13A 5CXPA 3HG2A 3UD6A 1ZENA 4NZFA 4O17A 5AYZA 2FTPA 3W23A 3E0IA 1SSDA 2WCGA 4BI7A 3LCWA 4HKPA 5I3FA 1UD2A 3UWZA 3BSGA 4O57A 5H2ZA 4UFMA 3LGEA 4ZQPA 1OJXA 3LV6A 3FJ6A 3PBUA 4UFJA 1ONRA 1A50A 5E6ZA 1WOAA 1T99A 1Z41A 2QJIA 3R2GA 3UY8A 4DO5A 4OQVA 2EACA 2JKEA 2EAWA 4KWVA 3RLVA 3TMQA 4UOQA 4M56A 2OYLA 4UTTA 4MZ8A 3BG9A 4Z1DA 4B9ZA 2DZVA 1YPFA 1PV8A 2H90A 1JFHA 2GJLA 3B8DA 2ZZ1A 3N9SA 4NXKA 3LI0A 4GINA 3HIJA 3MYPA 2D0FA 4H2CA 3QSTA 4IXXA 2AMGA 4NJJA 3P74A 4HOXA 3TX9A 2NX3A 5G2HA 5D2VA 2Y7GA 4GO8A 3UWQA 4AXKA 3I65A 5C54A 3EKZA 2Z6JA 2ZICA 4WD0A 3OLDA 3L2IA 1BEUA 2JK2A 2VEMA 1H7PA 2B7QA 1GJUA 1A53A 1TPWA 2FIQA 2AAMA 2HTMA 1XSJA 5F1UA 3BUBA 5A2AA 2V8ZA 3W7DA 1XD0A 8TIMA 1KWGA 3AO0A 4N9CA 4OBTA 4AAJA 4E2DA 3O6YX 1UA7A 2HSAA 4R53A 4IMGA 4NU7A 2DIJA 3CEPA 3PF3A 3IJ7A 3TAKA 4EVZA 5LGZA 1OABA 3DDFA 1QO2A 3W38A 2I9EA 3UWVA 1W5PA 2YW4A 2WNNA 3QF0A 3WDJA 1LROA 3LM7A 4PEKA 2GQAA 4HSOA 4NX0A 5DCEA 5EBUA 4JCMA 1Y0EA 3IIOA 3PVFA 4W93A 5E1QA 4IMCA 1XCXA 3WDHA 2TYSA 5CPLA 4J3SA 1FCBA 4UQAA 3ANYA 3QRHA 2FPVA 1RP9A 4FNTA 5I3IA 1N7KA 2FPTA 4K39A 3NQFA 3A4AA 4O52A 2WSPA 1MEHA 4DO4A 4M6PA 3D4YA 1TV7A 4GIAA 4NVTA 5AC7A 2QMKA 2QUVA 3NL6A 1SZGA 1L6WA 1JGIA 3LRMA 1H3GA 1SZEA 2ZA3A 1R2SA 4JICA 1F05A 2NT0A 1A5AA 1D9EA 1NF0A 3LB0A 3HBLA 4LUIA 4D2JA 3PSVA 1FDZA 4O53A 5DBUA 2ZUWA 3BPWA 2Y7DA 4QJ1A 5TIMA 3TAOA 1VAHA 1BWLA 1U83A 1KV5A 1W5MA 3NL2A 3TSMA 2O7SA 1AL8A 4WF7A 1P1XA 3SJ3A 1VC4A 3EWZA 1Q45A 3EJPA 2CLFA 4XB3A 3I6RA 2JGQA 4Y6GA 1EA9C 3LX9A 3EJQA 4AF0A 1HVXA 3CIWA 3GBDA 4O11A 1XCWA 4JTFA 3R8RA 4JXCA 5AOUA 2FHCA 1V3MA 2B7PA 2ZRZA 4NI3A 3L21A 5GVJA 2WANA 1HFBA 6TAAA 5HR6A 5LNUA 1PJ9A 1KM4A 3LPPA 1OT2A 7CGTA 1PCKA 3NQEA 1ME7A 3VGBA 2PURA 1R2RA 2A0NA 2XWEA 4XTIA 1ZJBA 1ADOA 1LWJA 4JIPA 3TJXA 3G0UA 4NJKA 1SW3A 6CGTA 1H5YA 2VNCA 3K1DA 3WNLA 4O1CA 3R12A 3TIMA 1FWTA 3BC9A 3S2CA 4WXYA 4PL2A 3UYCA 3OG3A 1OX4A 1M5WA 2FLIA 2D0GA 1JD9A 1ZALA 3NZRA 3GKAA 3L4TA 5E93A 5DFAA 3L65A 3S5YA 3BG3A 3VSTA 1TQJA 2RKXA 3TOPA 1IZKA 1QWNA 3HGJA 3THAA 4B9YA 2QUTA 1MW0A 4ZL1A 3MP5A 2BLEA 1DL3A 4YL2A 3STGA 1CPUA 1GJWA 3P81A 3GTNA 3QPZA 2PRMA 4OT7A 3FAWA 1PIIA 1TQUA 2YFNA 1G7UA 2VR5A 1SMDA 1VYPX 2Y61A 2P0OA 1HL2A 5AHEA 4CN6A 4AWUA 3LHYA 3HG5A 5AHLA 4BA0A 2ZX9A 2OW6A 1YYAA 4IMDA 3WENA 1H7OA 1Q6LA 2NX9A 1KXTA 3IEBA 1UA3A 1TCMA 2D73A 3KLKA 3B0UX 4CCCA 3A5FA 3GDTA 3BAJA 2YFOA 1X1ZA 3WNKA 3DFPA 3R5EA 4U2ZA 1HL9A 2DORA 4MVAA 1XC4A 1H50A 4JN6A 2DJXA 4Z0JA 4QAWA 3I7QA 2W79A 1Y7VA 2ZWYA 5FEPA 1FX6A 3VGFA 1KFEA 4O0KA 3FW6A 3UERA 3IRDA 3W84A 3W7KA 3GKFA 1JDAA 3VSVA 3A6OA 3M41A 4DF0A 4XBKA 1LYXA 2RDUA 4HHPA 2ZZ2A 3RFAA 4CN4A 2DZPA 2Y89A 3L66A 5F2MA 2FQIA 2Y70A 3AXHA 3TROA 3SECA 1UD6A 3ABOA 1ZCOA 1JCJA 3EDFA 2BY1A 3DH7A 4ONVA 4ORMA 4OU1A 5D33A 3GR7A 1EO7A 4GE8A 4QQ3A 1G67A 2DH2A 1VH7A 4LT9A 3NQ2A 4YMZA 2A85A 4BI6A 4Y9AA 1LBFA 3W2NA 2V82A 2QKFA 2RHGA 5I23A 1S5WA 3D52A 2NXHA 2F1BA 4AYSA 3S1WA 2EGZA 5DELA 3EJSA 3BCDA 5I5RA 2PCQA 1LRTA 3WJWA 1EP1A 1H51A 3AMLA 4MYAA 2X1TA 3KAOA 4ADTA 5LZLA 2WPGA 3NNTA 4OJYA 2DU2A 2QLYA 1XXXA 1RV8A 5KZMA 5FF4A 3NPXA 1SZNA 3O06A 3QW3A 5F7UA 3C2EA 4XWUA 3IIZA 1KM2A 2CWNA 3S5NA 6ALDA 2XVLA 3VMNA 1VIWA 2F18A 3ABRA 3GDMA 4N9BA 4RX0A 2QCHA 1T8XA 1BF2A 5CSSA 1EWEA 1AW2A 1G5AA 2V3EA 2YOCA 3B03A 5F2GA 1QI5A 1KM3A 1ME8A 1PE1A 3D0CA 4CNPA 1LBMA 3U8GA 4UQ9A 2YPIA 4A21A 4PC8A 2P1FA 3TA6A 3VO0A 1TPUA 3TCEA 3O05A 2F7RA 4H8UA 2TMDA 4CQAA 1TIMA 2QCCA 4S2BA 2CZ5A 4FLOA 3BUDA 3HG4A 1GTEA 2E6AA 4LUJA 2WO5A 3KE0A 3NQVA 1G1YA 1WPCA 3P80A 1W8SA 2V3DA 3GAYA 3TXZA 1CW2A 3CC1A 1KFLA 3BLIA 5HR7A 4GUJA 1G4PA 3ATZA 4MJMA 1FY6A 3BUQA 5A6LA 1UUMA 2WVSA 3BVUA 1KXVA 3NDOA 1AVAA 4S1FA 1R75A 5K7JA 1KTCA 3BLPX 5D2WA 4AYGA 3KVLA 3PBYA 3DDGA 3PC0A 3M9YA 1RPKA 4W9TA 4O50A 4CCEA 3UZ5A 2YYUA 5FF2A 3DBPA 1L0PA 3LRLA 4Q33A 3M47A 1KFBA 1B9BA 2J88A 3O6DA 3NQ7A 3TC6A 3PG9A 1VHNA 2ZX7A 2YX0A 3VKJA 3H54A 3HMJG 5AHNA 1JCNA 4JYFA 4WY0B 3K30A 2Y88A 4RKAA 1YDNA 3LCXA 3CM4A 2H8ZA 2OYKA 2BHUA 3FFSA 4PL1A 5FI8A 2WQPA 1QPQA 3EJUA 1CXLA 1H7NA 5HMSA 1W37A 1NF7A 3LHZA 2KZHA 1MEWA 1F6PA 4UTTC 4MAZA 1VR6A 1ZAHA 4AWSA 2C14A 2A7PA 3HO8A 2XWDA 1QCWA 2FB2A 4LXFA 2QAPA 3W83A 1JULA 4YLWA 4AW7A 7TAAA 2E5CA 3NPUA 3FIGA 2CLHA 5H91A 2ALDA 2QAFA 5KTLA 1TREA 2C15A 4UZUA 5L9FA 5C5YA 5AN7A 3QQ1A 1D3HA 5CZJA 1AQHA 4MLJA 2VEKA 3KL3A 4XZ9A 4HOWA 2VFEA 3TTSA 3C61A 1GCYA 3RMJA 1JF6A 3BCFA 4MFEA 1TTQA 3BMVA 5TQLA 4H6KA 1V3LA 1O94A 3SW6A 1CDGA 1P6WA 4HT3A 3BG5A 3V1PA 3BVTA 4HP5A 1D3GA 1H1YA 2ABAA 3C2OA 5CGQA 3LDVA 1LTDA 1EEPA 2WVTA 2PRHA 2UV8G 4FIRA 1IIGA 4EOUA 2ATSA 4K37A 1HX0A 1J5TA 2QEZA 3WNNA 2W0UA 4RJEA 2YR1A 3B0VC 1EP2A 5CZSA 1ME9A 3NL3A 4TR9A 4DPQA 4Z08A 1XUUA 3W75A 1HXKA 1B0IA 3DKLA 4PA8A 1AW1A 3QFEA 4OE7A 4UZSA 2NV2A 4YCOA 3LV5A 2BY0A 3DC0A 2QCDA 2OX1A 5C55A 4FXSA 3DHDA 3AJ7A 3TONA 3W2LA 4UCFA 1UJPA 1X7FA 1FXQA 2BXYA 1R34A 3P60A 4EIVA 2ZXAA 3E96A 3WY3A 1IV8A 1KB3A 4RK8A 4WQ6A 3SIZA 2QCGA 3B05A 3PBWA 3WNPA 3TUUA 1JL8A 2WC7A 3MP3A 4C1KA 2F61A 4MB1A 5EMUA 4N4QA 4OKDA 1GPWA 1ZY9A 1EO5A 5CGMA 4I7VA 5G2IA 4HNTA 1HO4A 1WQ5A 5TD4A 3DZ1A 3HPSA 1TPDA 1JCLA 4UQEA 4U31A 4CNNA 3S1XA 4BI5A 1IIHA 1Q6RA 3G1YA 2YYTA 4YCPA 3ZR6A 4UUIA 4FX6M 3NQCA 4GO9A 4OGZA 4NX5A 3CWOX 3W22A 3F1QA 3WK3A 3LTPA 2BY3A 1KFJA 2GPTA 2O7QA 1XD1A 4JFSA 3HJEA 1F2JA 1W1ZA 4N9EA 3KOFA 4JR5A 4Z1AA 1W31A 1JQVA 4XKYB 5G4WA 1WXJA 4A3UA 4X3ZA 1D3CA 1JUEA 3KFTA 4RZ5A 3WY4A 2D0HA 2HMCA 2C0AA 4LS2A 3NVTA 1BG9A 5BMXA 3AMKA 5G1TA 4UMAA 3DHFA 1TQSA 2YA1A 1J0HA 1UOKA 1G4TA 5EL1A 1GYNA 3GB6A 3L67A 5J5RA 3G1HA 1E3XA 3L0KA 3N73A 4HNUA 3TFXA 4J3WA 2FHBA 1TMQA 1THFD 3GAKA 2CW6A 3CB8A 3S42A 3W1XA 2NXGA 4X2RA 3RF9A 2OSXA 5D32A 1DTUA 3DHUA 1CIUA 2OSWA 1P0KA 4YWIA 2DIEA 3JS3A 5CZ0A 5D05A 2QCMA 1MXDA 1O5XA 4JX6A 3BH4A 3EXSA 3PUOA 4GUGA 4KKXA 3V75A 4CLMA 5G4EA 3ZOAA 4IGHA 2ZUUA 1J4EA 1H63A 1MXSA 4CGTA 2GQ9A 1VS1A 3GZ3A 3DX0A 3HPZA 4BK9A 5AB3A 4PCTA 2OT1A 4KFPA 3HZ3A 4PODA 5DLCA 1JXJA 2FYVA 4WXZA 2WCSA 2WSRA 1SFLA 3R13A 5DBTA 3WJYA 4PCFA 2EF9A 1A5SA 4JNMA 4PTNA 4AMAA 4DBEA 1P4CA 5D30A 2BHYA 2CLLA 1W54A 4QNEA 2FGZA 3WNMA 1QPKA 4QSHA 2H3BA 3MYOA 4U28A 2ZX8A 3U2OA 5CLWA 2PWEA 2ZTJA 2ZZ4A 5EMYA 4BZYA 3OA3A 3HGRA 3PUEA 3IVTA 3ZS4A 5EA9A 3TKFA 1G6CA 3LHVA 1X8FA 1LDCA 2QPUA 2VFFA 4ATWA 3NPWA 1LLWA 4NUWA 1BSIA 4Y96A 1QW9A 2X2JA 3NOEA 4MOZA 1BAGA 1XM3A 2PE4A 5CPMA 4FX7A 5D38A 3FLUA 4Z0SA 2ZCGA 1Z32X 1PIGA 3WJSA 3WFZA 4JTLA 3W7RA 4IX2A 3OIXA 5LSMA 3NM3A 3VI2A 2D3NA 5FEWA 1IZJA 1OFAA 3DHPA 5AYXA 3S5OA 1YXDA 4Y90A 2Q8LA 2V30A 1CGXA 3LXCA 2ISSA 4AHQA 1UD8A 2X1RA 1DQXA 3G24A 1E40A 4TMCA 3RU6A 1IXNA 1WZAA 2A7RA 3UG3A 3TC7A 1M6JA 4U33A 3QMSA 4Q4KA 5I3HA 1XSKA 4U4MA 4AB4A 4YXGA 6TIMA 2ALWA 4NJHA 5U7SA 2WNZA 4AWTA 1F74A 3EB2A 5KEZA 4RZ4A 3HF3A 1TSIA 3EWXA 2ZRYA 1MZHA 1FWNA 4CCDA 2JKAA 2VXNA 2VFHA 4O4WA 3KRSA 3W1UA 1KBKA 2WJZA 3LCIA 1CI1A 3C3NA 2Y6ZA 1HUVA 1W9XA 3CQ0A 3STCA 3FKRA 2ZZ3A 1S5VA 4PEEA 4ICNA 1OG0A 4GUHA 3GXIA 2LLEA 3W7MA 1TPFA 3A22A 3EDDA 1BTMA 1W3IA 4ZZ9A 2W6RA 3KEHA 1F6KA 1TO3A 4DF2A 3VNZA 2X2HA 4UC5A 1IXQA 1JVNA 4E38A 3FYOA 2BWGA 3L5MA 3M16A 1RQBA 5K4ZA 2J6XA 4J27A 1TPH1 2E5BA 1DQWA 2I14A 5BRQA 4B5NA 4TIMA 3QSRA 4LS0A 4UR7A 2NT1A 3W1LA 2XN0A 5HDRA 2GUUA 2E6FA 2WVUA 3WJXA 1G4SA 3G8RA 5AHMA 5DY3A 2YXGA 3RK8A 1OB0A 5SWUA 3VGGA 1QX1A 3L9CA 3A47A 2EO7A 3NAVA 3P62A 3O1NA 4LC8A 4E2OA 1J0IA 2Y2WA 4GNJA 2G96A 3WY2A 3T7VA 4O0ZA 3EXTA 3SI9A 4GQRA 3L2MA 2J27A 4K7YA 4JEQA 2F7OA 5D04C 4OIFA 4DF1A 1FWRA 1YTKA 3S1UA 1AG1O 1LM1A 3PB0A 4WY0F 1JF5A 2J25A 3VMPA 1KBBA 1VGAA 2ZA2A 3CWNA 4FNPA 3ZT7A 3EX1A 4LVFA 3PSWA 2ZWZA 4K6AA 4N6FA 1ZS2A 4DXVA 1HTYA 3G1VA 3N3MA 3SGUA 3M5ZA 2Z6IA 1OFRA 3K8KA 4TX9A 3NQMA 5BMWA 1ICQA 2ZYFA 4OWGA 5LHEA 2NX1A 5AFDA 1BKSA 1CGWA 3GXNA 2AQWA 3OBKA 4ADSA 1MEIA 4EWND 3ZO9A 1SR9A 1Q6QA 3OVPA 9CGTA 1V7YA 3YPIA 4ADUA 5K9CA 1JCXA 4IMFA 2ZDRA 1SU5A 3VNYA 1QO5A 3SR7A 1MW1A 1VB9A 2BHZA 1LOLA 3TSDA 3PG8A 3PUDA 4A2SA 1VRDA 1YADA 2C13A 3I68A 2QPSA 1Q4NX 3WK1A 2X1UA 4LTSA 1GJPA 2CLEA 3W2UA 3CGTA 5AYYA 3NEVA 1J0KA 2ZX5A 3M0ZA 4JX4A 4O18A 2Q3RA 1PL9A 3W7CA 2X16A 2QCDB 1CGTA 5I0DA 4JDYA 3GR8A 4HN4A 2V0TA 3ZWTA 1OYCA 3W7HA 2BX7A 3BAYA 2WOQA 2Y4SA 1TQXA 2EPHA 5F4XA 2BXZA 3A21A 3QZEA 4IPJA 2QCLA 1HNYA 2PWHA 4NT0A 3BW4A 2CLKA 1U30A 3IIVA 1SMAA 1VFUA 2C18A 3ABQA 3ZQ9A 1NOFA 4U3CA 4FXRA 2TSYA 2WKGA 4NNBA 4K8HA 2BZNA 3W86A 1FWSA 4IOTA 5MHBA 1CXEA 4PSPA 3BLFA 3TNOA 1OX4B 5I3JA 5CKSA 1RVGA 1H61A 3N19B 1JQXA 4AF0B 4WZHA 1UH3A 3W72A 1K03A 3UPWA 4UNIA 1R47A 4FNUA 3G0XA 4GUFA 3UZJA 1OF8A 4GC4A 4IWWA 2Z2UA 3M5XA 2OYMA 2YSWA 4JTTA 1OFDA 3VGEA 3C6CA 2A6LA 3HPXA 3CZSA 3L4UA 3W7IA 2BXVA 2B7NA 1K7EA 1VQTA 5EYWA 4FIQA 3O6CA 3DX2A 4M6VA 5KSWA 4JY9A 4MIMA 3GXTA 1DEDA 3L68A 4H7VA 3ECQA 5IBXC 3VMOA 4FHAA 5HWMA 3SGZA 2NUWA 3UPBA 3NGJA 1XCFA 4O1AA 2WVVA 1QNVA 2Q8ZA 3GLCA 5EKYA 2OT0A 1KXHA 3NXFA 1PEZA 4Y8FA 2CLOA 3FYPA 3LI1A 3H55A 5E6YA 1YDOA 2ZX6A 2F2HA 1LWHA 3O63A 2WV8A 4R33A 4N9DA 1NM9A 1M7PA 3QPYA 4HNNA 1GG0A 2D2OA 3BO9A 2JBMA 3OVRA 4MPQA 4MUZA 4E2BA 3GDLA 5F1VA 3TK7A 3M6YA 1TV8A 5FF7A 3T40A 3UWYA 3H53A 4TMBA 3DU0A 3WMSA 1E3ZA 4GQQA 1JUBA 3N14A 3NO5A 2XN2A 5AHFA 5DXXA 2A5HA 3BW2A 1HT6A 2Y62A 2P10A 1O5KA 1ICSA 1VZWA 4GKLA 3ZT6A 4O12A 4KFOA 3IIXA 4S2CA 3RILA 3DFQA 2E8ZA 4M7SA 1QPRA 2C19A 4MYXA 2NUXA 5HWJA 1OFEA 4KWWA 1AQMA 1UBSA 5BOOA 1O7DC 4AEEA 4GFSA 5LNRA 1DV7A 2EKCA 3CPUA 4L4MA 1SO3A 1OX6A 4AIOA 3EEGA 1A47A 3T78A 2E5DA 3EJTA 1MW3A 4NJGA 3OHIA 1U5JA 1MWOA 1QI4A 2Q3OA 3TTYA 4H3DA 5D37A 1UD5A 5I3KA 3JR2A 4UNKA 4MY8A 4I7UA 1W5QA 1PHWA 3W7EA 3B4UA 3D50A 1UH2A 3FAXA 1R33A 3PY2A 3BVWA 3EWWA 3TU9A 4BR1A 2CZFA 1MXGA 3OLGA 2QCEA 3Q2DA 4FMVA 2EEXA 1H7WA 1VLIA 3LLFA 4X22A 1UD3A 5LNWA 4JL1A 1CXKA 1A5BA 4M8UA 2J24A 1LORA 3K8LA 5AC8A 3LHUA 1WZMA 2GUYA 2A21A 4JDBA 2XIIA 2VFDA 1JAEA 4LNYA 3L4VA 1QMLA 1W56A 4ZVJA 4GRSA 1LRQA 4L4LA 3W2MA 5A2BA 3LCGA 5K9XA 3WFAA 4UMBA 3CTLA 4O1DA 5I24A 3S9YA 2VKZG 4JTSA 2ATMA 3G1XA 3WEMA 4JCLA 4O54A 4UTLA 1Q3NA 2Y7EA 1C29A 4NZJA 3KX6A 3MI2A 1CX9A 4LVAA 3BGGA 1PZ2A 3ATYA 5F4SA 2VUYA 5CG7A 4X0NA 8CGTA 4FO4A 4JX5A 3AXIA 1XI3A 4Z1CA 1MFUA 1TTJA 2ZRVA 1R46A 2ZRXA 4CNOA 2H6RA 2PWDA 1NAL1 4AIEA 3S0CA 3NQDA 1S5TA 5I3GA 3UXAA 4JY8A 4AVFA 3W7OA 2F7PA 1UUOA 2VFGA 1KWKA 1JG9A 1JCMP 4JYEA 4LY8A 3NR0A 2ZXQA 1B4EA 4JS3A 4BF9A 4UTHA 1QHOA 2EQDA 3W07A 2QV4A 1TRIA 3I7RA 3CIXA 3DX3A 5U4NA 4GI6A 4UFLA 1KLZA 2DJLA 1KCLA 5TBOA 1J0JA 4TO8A 3W1AA 4MLRA 5KITA 4BWLA 5DXYA 4RLIA 2V3FA 3BUPA 4LVBA 3KWXA 1KV8A 4FB7A 3EKLA 4ORIA 2I1OA 1WBJA 2CLMA 3P8IA 2CXGA 2GVJA 2DZSA 3B04A 2A7NA 4G1KA 2NZLA 1VJIA 1TJRA 4JTIA 4UTWC 5T26A 2DZXA 4BFAA 4HPHA 4FLRA 5FEXA 3LLDA 4JL2A 3G3DA 1X1OA 3GXDA 1JJKA 2VENA 4Z1BA 5K4XA 1K8ZA 1S3HA 3CLWA 3LCFA 1GQNA 2XVGA 5D03A 3QYQA 4K7VA 1PPIA 3VU2A 3W70A 3ABSA 2ZRUA 3BK0A 2QCNA 1B3OA 4KMQA 2RFGA 1BWKA 4UFKA 5J5DA 3TV8A 1XH2A 4U2YA 1OFPA 1XDMA 1XFBA 2R91A 1HG3A 3K8MA 2FJKA 3IGXA 1OGSA 5E70A 1WV2A 3IVUA 4KWUA 1FXPA 1ZAIA 3L4YA 1KA9F 1WYIA 5HWNA 1LRNA 4N4PA 4DO6A 4LW7A 4PH6A 3SSJA 3IV3A 4ALDA 5L6UA 3BSHA 3FOKA 3GBEA 3KRZA 1WAUA 1G9HA 3CZEA 2E1DA 5HQEA 3F03K 4I7WA 1JIBA 2WSQA 4GXMA 5AHIA 5AC6A 3MHFA 3UCQA 1G4EA 3DFOA 1QW8A 1SO6A 3TFCA 2VEIA 1UH4A 4OHQA 4UMCA 1DORA 2YKKA 3GDRA 3FKKA 1G69A 3W1QA 1OHLA 1S46A 2FDSA 3F4WA 3NZ1A 1KCKA 3UY7A 4C1LA 3KLLA 4H8VA 4POCA 1WP6A 3BLKA 4JFTA 2R8WA 1P5BA 2C1HA 4CN1A 4M19A 1SPQA 2RDWA 2VRKA 1CXFA 3A23A 3ZWSA 2WSYA 1AW5A 4LS1A 1KM5A 1MFVA 2Y85A 3N34A 5LHFA 1V3KA 4JTUA 3SFKA 4UTIA 4AMWA 2WKLA 3Q94A 3KVKA 1ZHAA 4MJZA 4ZQMA 5EY5A 2DZWA 3MI3A 2ZZ5A 1V3JA 1CYGA 3NQ6A 1FCUA 3S8HA 4UTWA 3GVGA 2B7OA 4QITA 3BLBA 4FF7A 4LV4A 5C2XA 1CGVA 3DI0A 3TDFA 1OYAA 3N2XA 4J7RA 4P61A 1TPVA 2VFIA 4AHPA 5K2ZA 1SFJA 1XV8A 4O14A 5F2LA 2RDTA 1GWJA 1JDDA 3TR2A 1KTBA 1VYRA 4NQ1A 3NQAA 5C6MA 5E9AA 3E9AA 3JRKA 3W7JA 1G94A 3AJXA 1BVNP 1KM1A 2F7FA 1H62A 1EIXA 3ZT5A 1XDLA 1ZJAA 3SY5A 3W37A 1AMYA 3S5ZA 3L4ZA 2CPUA 3MO7A 1K7XA 3RLUA 2WPBA 1UD4A 3LERA 3W9ZA 3E12A 3VM5A 2E09A 2ZZ7A 3WK2A 1WDWA 1I2RA 2R94A 3G3MA 2AGKA 2ZTKA 3T4CA 3N2MA 1SSGA 3GNDA 2YDAA 3ELFA 2JGYA 4M6QA 1EH9A 2CZEA 3LOTA 3O16A 4AH7A 3A9IA 1DJNA 4UQDA 3GK0A 1N55A 3E02A 2NXIA 1MW2A 4NXSA 3W3OA 4J28A 4FEZA 2QJGA 1EWDA 2ZQ0A 3IK2A 3M5YA 3QJAA 3MHUA 1SO5A 2GJRA 1TQTA 3UG4A 1XGZA 3L5LA 4OV4A 1CXHA 2ABBA 4BWLC 3THQA 4JFWA 1PAMA 3OEXA 4UTJA 1R2TA 4UQCA 5G2WA 2GVYA 1K8YA 2X2IA 3G8EA 4RCXA 3P5ZA 1OYBA 3HGSA 3MHGA 2C8NA 2YA0A 5HJLA 3P84A 4UTUA 4GI8A 4UOZA 3LPOA 1LZOA 3PM6A 1RZMA 5E0KA 4LOCA 3CU2A 3CZGA 3M07A 2YCEA 3BV4A 2QF7A 4QIUA 5BRPA 4O16A 4O28A 3W88A 2NUYA 4I9AA 5G1YA 3IGUA 1PCWA 1H1ZA 3PBVA 3M7WA 2FE0A 3LTYA 4ZQRA 4ZQOA 5BW6A 1DJQA 2CLIA 1TV5A 3BLEA 1WBHA 2VT0A 2FFCA 3HQ1A 3UWUA 2DZUA 4UTKA 4R7JA 3W1RA 2ZXBA 3EWYA 2R14A 5FF3A 3O07A 2OJPA 1LLZA 1G7VA 3INPA 4UFHA 3RNDA 3CEUA 3QM3A 1I75A 5LKYA 4JIQA 3L0GA 1IXOA 3W2KA 1FUYA 1PZ3A 4O1BA 1Z42A 5DCDA 1TTPA 1IF2A 3PAJA 3KVJA 1EHAA 1WOBA 2TPSA 2Z1KA 3EWUA 1OVDA 3KXQA 4MZ1A 1XBVA 2EJ1A 3C2RA 3QMRA 1QDSA 5DN1A 4PCSA 2TAAA 3CZLA 1T96A 3B06A 4CQ8A 4O19A 2C16A 3NG3A 3CLMA 1LBLA 1W3NA 3EJRA 4J9JA 1QOQA 3EX6A 2PC4A 4A2RA 3BVXA 4DQWA 5DO8A 3MI6A 3P8JA 1KFKA 2ZRWA 1MSSA 2E8YA 3IJ9A 3LBCA 5CZTA 3DX4A 4O15A 2WSKA 3T44A 4AHOA 4CKQA 2B0MA 3TXVA 2YJQA 1QWGA 2V9DA 2H8XA 3W6YA 3P67A 2C7FA 3L4XA 3QW4B 1GVRA 1W0MA 3M5VA 1WX0A 4K36A 2E6DA 3NPVA 1M7OA 2NWRA 1WO2A 3UQNA 2X2GA 1J2WA 2J9ZA 5IBXA 2ZXDA 3BW3A 5A5WA 4UTMA 3DGRA 2GVGA 5A8GA 1D7FA 3W74A 3CV5A 2OCZA 4MFDA 2BSLA 3W7NA 1FDYA 3BAIA 2C6QA 2ZFAA 2Y5EA 4DELA 3NYZA 4J3VA 3O15A 5CPNA 1JD7A 3DFNA 3PWAA 5HUPA 3GYEA 1JRCA 5CGTA 2PRLA 3ZR4A 1SW0A 3MP4A 4JFVA 3NA8A 5ABTA 1JXKA 2ZE0A 3HJZA 5BNKA 5FESA 1VPXA 1XSIA 1EX5A 1HL8A 3GNNA 1KBIA 1ZFJA 1UCWA 3ZSTA 1U33A 4LQ1A 2QR6A 1NFBA 1WZLA 3N9RA 2DH3A 1KLYA 1KFCA 1CLVA 1JI2A 1C8VA 1RD5A 4MY9A 4ZQCA 1ODUA 4JTEA 3WY1A 4RXGA 2BTMA 1PS9A 2ZUSA 1A5CA 4H8HA 4A22A 2VRQA 3IVSA 3PB2A 1YDVA 1ZNNA 2E4TA 4DEFA 3LXBA 1QPNA 4AMXA 1H7XA 1JCYA 1YXYA 4RZ6A 3R89A 3HGOA 5KZDA 3D4ZA 2ISVA 3U6WA 1OK4A 2E6YA 4UCGA 3LCHA 1XH1A 3MJYA 1LP6A 1QI3A 1FQ0A 2VC6A 2FPYA 1ZAJA 2PWFA 3QEZA 1U2YA 3CZNA
chains in the Genus database with same CATH superfamily
4WUUD 2DIAA 2W94A 5C0AE 1Z44A 5IFTA 4PBDA 4IQJA 4FI7A 2FGWH 4NSKB 1SQ7A 5IFPA 5IGXH 1UXSA 2EHHA 4XC1H 4G7EA 2F58H 1OFQA 3P7YA 1J2BA 2AQ3A 2F7QA 3PY9A 1A0CA 3TTOA 3H7BB 2ADIB 3CDCA 3D9AL 2DSVA 4QM1A 1T5XB 4MD4A 2X1QA 5IQ9B 1OQFA 4PJFA 1OF6A 1CFNB 3O3EB 3UYRH 1ACZA 3CUHA 4HYTB 4G9FB 4Z0XB 2HYMA 3PZVA 3F12B 3BAXA 5ECVA 4C6FA 4J8QA 4H0GA 2B5IC 1OK6A 4LCSA 3CX2A 4N42A 4MJHA 1KGUA 3AMGA 3LRHA 4GXVL 3BKJH 3E8VA 4F3FB 1AQFA 3QUZB 3FEMA 3LBMA 4KQNA 2VZUA 3FU8A 1O6SA 3ABKB 3EYFA 1ULVA 2ICEA 5DUBA 5FV1L 1ZK9A 2WO2B 4D9RD 3GH7A 3PTQA 1QVOB 3I6GA 4RV8A 1HTIA 2D69A 4UIOA 2RACA 2GOKA 5FOBA 4ZD3L 4HLEA 1QOKA 4L3ED 5KVFE 4Y7MA 3FRPA 2IKIA 4LJ3A 3KBWA 2H3NA 3GQFA 4HD9A 1B4KA 4DVOA 3IJYA 1TQCC 1HCYA 4LCYA 1CLYH 4TL5A 4W9EC 1NFPA 4K7PY 4P3CL 4KRTA 1WHOA 1RZ8B 3ZKMD 1NLDL 2QGDA 3KYAA 5LN8A 5H2BA 3ITLA 3UA3A 4AZ8B 1E5YA 5CCGE 3VXNB 5D9NA 2BY2A 4LU0A 4DM1A 5ES4B 1DHPA 1GEHA 4Y2LA 3M43A 5LNVA 4S1QH 5J6HB 2I5QA 1RZFL 3BPNC 4HLZH 5JPMB 2XFFA 2F1AA 3LV3A 5DT5A 5F7EH 4F2MB 4YR6A 4CSSA 4FOUA 4A55A 1XBXA 1V0NA 1EXHA 1DOSA 3I9GH 3PTDA 4N6EA 4L05A 4F58L 5DEFA 2GQ8A 3D39A 5I07A 1FWWA 2XKSA 2ON3A 4IQLA 4OIIH 2NNXA 3UH8A 1H7RA 1A6VH 4UB0H 4KJWC 1SY6L 4DZ8B 3CAWA 3EX2A 4OCSL 4J35A 5HI3D 3OJDA 4EXAA 2BASA 1P2CA 5FJIA 3JWDL 4QO1A 2YGYA 2WN2A 3I9AA 4PTDA 4XD3A 2NVDA 2P9RA 4E4UA 2ZKHL 3EGSA 3UVAA 4E0CA 1VJSA 4L80A 5B4MC 5LDSA 2NQ9A 2OMUA 4XPAL 3DFTA 1N8FA 3VI4F 2E76C 3C60D 2EILB 1I4FA 3T2NL 1HJBC 1JWUA 3AT0A 4GCXA 4F92B 4IPIA 3O3AA 4I9TA 3JVGC 4X42A 4XVUD 3WLRA 3QIBA 1A4BA 3GS6A 5D72H 1BZ7A 3QIUA 1L6YA 1UURA 1NH6A 4OFKA 4OB5L 3MA7A 2OPCA 3F4CA 4LSVL 1A6WH 1S8DA 5E2TL 4WJEA 5AVNA 1VCFA 3T77A 4QTHA 2LU4A 1ZLUH 4ZMYA 1PVHA 2BZCA 4ODSL 1OSEA 1OV8A 4P48A 2DTSA 3GIYA 4Q7NA 4R97B 3W0WA 5DY2A 3LJ3A 2HZGA 1PG7H 1W0WA 3QHTC 4PR5A 2DQXA 1ZT4A 3OMZA 1WS8A 3ALFA 4RXFA 3MU3A 4JZJA 1HC1A 3RPIB 3PULA 5HR7A 4Z7NE 3WE6B 1CF8L 4CNUA 4NZ5A 1KLFB 1RZ7H 2O6EA 3L48A 3ZMEA 3C2FA 1E28B 2R8SH 2FWOB 4QRSA 3MNZB 1R3KB 2CHNA 3F5KA 3RWGA 1TVPA 1OE2A 5IQ7L 1D6EB 1UM4H 5I8EA 1MMFA 1B90A 2AV1A 1SO4A 4GSDL 3OZ9L 3AZUA 2FQEA 3G6JF 1Z48A 1YPFA 3WO8A 3SRKA 4PJBF 4AGQA 3V95A 3WBWA 4K9EH 1DHKA 5C0ND 3WELA 1IBGL 3TBBA 3ZJAA 4WX2A 4ZS6D 2DJUA 1MZZA 3V5HB 1UATA 3WIIL 3ISIX 4GWEA 4D1IA 4KZEH 2I07B 5IHUH 5I15L 4ZQTA 2INZA 3Q67A 1HIML 1FZJB 3CTTA 2J8OA 4JN8A 5E8PB 2AFNA 3GHPA 3KVQA 3NEXA 4XCCL 3AWEA 2HQAA 2YA2A 3FDGA 3QQ9D 4Y8DC 3UAAA 5I6XC 3C75A 4GAGL 4XBMA 1GRWA 4DF9A 3M1ZA 2BNRB 2HSIA 4QRFA 5FWRA 5HUOA 2B81A 2RJGA 1N3NA 3ATFA 2P43B 2ZCLL 4KRMB 3S5LA 5CR1A 1LOQA 5HA7A 3EWBX 4N02A 3RLGA 4ZPTB 2WXHA 2IUZA 4BFEA 3VG0H 5JXEA 1XIDA 3WXVL 5BQ7B 2ZXGA 2AQNA 2OR9L 4NIKB 1NMCC 3SQBA 2WXPA 5AL8A 4BH7A 1TJPA 3H9SB 1NWPA 4UQBA 1U58B 3MQTA 4P3DB 3TH6A 3B3IB 2FR4A 4K8GA 3HN8A 3VGHA 5IMLB 3IIPA 4LSTL 3DO7A 5DANA 4XC3L 1Y6KR 1HKFA 3AXMA 1K2DA 2XN9B 2J74A 4AT6A 3PHQA 1T4WA 2BSBA 3SOBH 2CBUA 5E5CA 2E9GA 1VLWA 4XMKH 1DJSA 3M0LA 4EUPA 3BUTA 5ACZB 1GVOA 5A6IA 1QUMA 5AVHA 3LSOB 5J4MA 2V38A 3HI5L 2NZ1A 3V2AR 3X1BA 4Y5VC 1GVQA 4GY0A 3GZOA 4ZQNA 4LBAA 4J3OF 2EDKA 2D31B 3SCVA 4E5TA 1I1FA 4LKCA 2X4OA 3QUKB 4P49A 5HY9B 3QEUA 5JHDE 2H9GA 4EIBA 3N3TA 1MHHB 3QEHB 3IFOB 2LQRA 2XWCA 4LRNH 3QQXA 1K4DA 4NUJA 3LN4A 1HO1A 3GIQA 2DQDL 3GU9A 3NIFF 5AKQA 1T2JA 4ZA0A 1JK8A 5HPOA 3ATDA 4FNSA 2NRDA 4LCCC 2VOMA 5E0CA 1HHIA 1C8QA 1KRCC 2ICEB 3F4VA 4JQVA 1T0NA 1RV6X 4NQXA 1A5LC 4JTDA 1DCEA 3IGSA 1JGEB 1G1OA 2EDLA 1B57A 2XKUA 1S7WA 3HCVA 6FABH 5HYIA 3KOZA 4PFMA 5AOMA 2WBJD 2BOFX 1LD9B 4X7CC 2SFPA 2EH7L 5DGRA 4YSEA 3U0HA 3L3DB 4JQ4A 4KFNA 3QFDA 3U6RA 4PJDE 5C6TL 2FZ8A 1QA9A 4QDWA 2DLTA 4UQ2B 1TQWA 2CFFA 1SRDA 3PR2A 1R3HA 5JBDA 3W7LA 2VQ1B 2R4RL 4B5ZA 4XIMA 4PRDB 2JKSA 1XYCA 2BNQA 3W01A 4QTFA 4X98A 3TZVA 1QFEA 1Z3NA 3NZGA 4G42A 4GG8A 4PB0L 4C6NA 5AECA 4YIQA 2NLJB 4ZTPH 2D9QB 1QSED 4S1DD 1OWWA 1EA0A 2V5JA 1TEFA 4FNRA 2ZOTA 5IEKA 1JV2B 2WQRA 2J2ZA 5HGBB 2ADGA 3N2BA 2KLRA 3GXPA 2IQTA 2J8UB 3P73B 2VO5A 4MCMA 4RZCB 1GTHA 1YTEA 1ZLSL 3IBEA 3S6CA 3VGDA 4OD2A 1UWEL 2D24A 3GSQA 5DURB 3WD4A 4YQXL 2XH4A 5AAWA 1RCOB 3LAFA 5I1DB 4MS8D 1SJHA 4IG2B 3VFTB 4LF2A 1KGWA 3KDOA 1WLHA 4BZ2H 3AWFA 3QZWA 2DVTA 1TQVA 3NL5A 3D6NA 2FAUA 3B2VL 4K5PA 2HV5A 2E7MA 1E5JA 3F4NA 4LVDA 1TKWA 1P1MA 4NJIA 3RVUC 2BIHA 3TN0D 4XPHH 1X6LA 2PXYB 5HHNB 3EO0B 3VX1A 4FFYA 4YQXH 1TUFA 4EJ1C 5EDSA 1V6TA 1EF3A 3STEA 1I85C 3EA2A 4EF9A 4F9LC 5CFAA 1IUZA 3L9EA 5LUMA 4ALAL 2BWQA 1EHNA 2CK2A 2HG5A 5D7LA 1W1YA 3NQ8A 1Y0LB 4P46C 6REQB 3L81A 4ZSOA 1OP5K 2GWNA 3P77B 3IGAB 4HCRL 5IJDC 1O7DE 25C8L 3M8OH 4FJZA 4E9QA 4MMYB 4WRHA 7TIMA 1QLEL 3BISA 4IOIA 1U6AL 2XPYA 4GOSA 2MOGA 1T1WA 2X4TB 4LOUC 1PMYA 5DA4A 5D7IA 3QFJE 4HNVA 4NQED 1J0YA 4GBXC 4ZO7A 2N59A 3BVNA 3ARFC 1AAJA 3C52A 2IV8A 1VFOA 3UGVA 5EU7C 1YPIA 1KEML 5LCVL 4KO5A 4TUOB 2FO8A 1UW9A 1X4ZA 5GGVH 2PCFA 1E28A 4HIEB 4DQOH 4E9TA 1A5FH 3C60C 4WKZA 4X7DC 1INEH 1LJMA 3G5YA 1K5NB 3PUCA 1SDAB 4M7LT 4KZCA 5AVUB 5FUCC 5HDOA 1EF2A 1NWUA 5CUSL 5FKAA 1RURH 3OSVA 4IU2A 4FA8A 3C5JA 4KZ0A 3SD2A 4MZ2A 2DW5A 4MA7L 5FEZA 3B6SB 3RWFA 1QI0A 2QTEA 1MJ7L 4HKJA 3W7QA 4F8LA 3ONCA 2DUXA 5KSBE 1G7MA 1J5DA 3X1GA 4D3CH 1GYCA 3BUYB 5DRZB 4W87A 1QWUA 2NSXA 2JKPA 3KW7A 5IJKA 2E0PA 12E8L 4HUCA 4BINA 1ICPA 2ATPB 1HI6B 1HP4A 1I2QA 5IDIA 5JU6A 1XR2A 4PJBE 4LWWA 2C3GA 3QPXL 1I0DA 5BXSA 1PL3A 1OFOA 1CFQB 6XIAA 3KPLB 3C0JA 3SO5A 3PP4H 3ZDWA 4HK3J 5DS8A 1OGAD 2CPCA 2EADA 4O02A 5D70H 5IRPA 1OCCB 3L5JA 1ISXA 1IFHH 3BPOB 1H6TA 3W1TA 3RAJL 3FSVA 4HJ0C 1E9QB 5KW9L 2C1IA 3FKUS 5CSZB 5DDHA 1KPVB 3F7VA 5D96B 1OM9A 2P3YA 1ZWIA 5E8OB 2EDQA 4HTBA 2F84A 3L5AA 5EU6A 1JYXA 1U58A 1MCSA 1TPC1 3WJJC 1FPTH 1XBYA 1MQ8A 1ZAGA 1A4CA 3HB3B 4AZUA 3TURA 2FKPA 1A6UH 1G7PB 2IDCA 1HZLA 5FA4A 1IT7A 1VRXA 3S3BB 1T22B 2J66A 3G18A 3URBA 2AV7A 1UWYA 1KBWA 2P8LA 2XKNB 3WOVA 4JBSA 1TMHA 1FZKB 3MRPA 2PTXA 2IPJA 4U4IA 3VFOB 3PWNB 4XPBH 1KB5L 4UIKL 3SCMB 2GOUA 4FMKA 2V2DA 3IFPB 4JX0A 4B5SA 3DOPA 1Q0XH 4GAGH 4UBDD 1U92B 3HC0B 4HOZA 4LANA 4AOFA 3PAZA 3VFRB 1JZ6A 5D93B 4S11A 5G5IA 5LJYH 3S46A 3QXUA 4RMSA 3QCTH 3AQZA 2QGCA 2QHAA 2ZYHA 4HWBH 3UDWA 2RD0A 1EAQA 2XM2A 4D9QE 3DKJA 2HJKA 4KCUA 3U9IA 3EO9L 4FKEA 4APXA 5JORA 2HISA 3WK0A 3QZ6A 2D2GA 2QR0A 3GTFA 3H7VA 2KKQA 1GVYA 5DO2D 2YD9A 2YZRA 5DCBA 3M7FB 5KVFL 1RZKL 1TENA 4FQ1L 4CGUB 2X4PB 4DUWA 5TH2A 2D3LA 5IQ7H 5MERB 3C6SA 2V2HA 2I9TB 4O2EB 4PY8J 2WINA 1MH5A 1JF1B 1NELA 1J6PA 5F3HB 3QORB 1KY6A 1OM3H 4A7GA 5C0RL 5K9JL 1I8AA 4F33B 2KL6A 1B6UA 3EDJA 1TPB1 1QWHA 1YEHH 3CX5J 2OG9A 4MKSA 3TQKA 3LIZL 2FATH 3P69A 3TQ0A 2OTDA 4YDJA 1CDCA 5MEOB 4O8RA 4KW2A 3PLYA 2JNZA 4DXXA 3LD5A 4JPVH 5LDUA 4JB9H 2O6CA 5F88A 2OM5A 5AKRA 1W32A 5A6JA 1E72M 3II1A 1P7TA 1MDRA 5D71L 3JZYA 2ADIA 1LO0H 1RXLA 1KJ3H 1ZLVK 2HEJA 3PBMA 4QNWA 5IROC 4B95C 4QLJA 4A29A 1BBDH 4UTBA 2ADFL 1TNMA 1CUOA 3WUWB 3CH8A 3KPOB 3D12B 5DYFA 5FO7A 3WLWD 5CSRA 2IALB 2IVFC 4AVIA 1XCTA 1V8EA 2A1YA 3G1AA 4WR3A 2WKJA 1FAIL 4PJ5B 1TPEA 2KLSA 2WCPA 3GSQB 4JO2L 4DUOA 4XPAH 5BYWA 3TW6A 4KJYA 3RTQB 1KIUA 3FB6B 4TTDD 4A38A 5DC2A 1HSBB 1GMIA 1W5OA 4YAQA 1E65A 3DX7A 2CMRH 2XA3A 1F90L 3VG9C 3L45A 2UXGA 3DCPA 1N0LA 1X5MA 2BOBB 3FHAA 4QXVA 4EACA 3B5GA 3G3LA 3MV7A 1HDMA 5HYFA 3SJNA 2VDRB 2X0HA 4AK2A 1YE6A 3E0IA 5CN1A 2FVKA 4WVXA 2TRYA 1AZBA 1JYWA 2XRAL 4XNUL 3FSUA 2CHDA 5D1XB 5C70A 5ISZD 2KX9A 4HKPA 1J18A 2IGFL 1NCAH 4UV7H 3ATAA 2GVEA 4MWAC 3DIFB 1U8OA 4OLZL 1ZLPA 2AJUH 4O57A 4LMQI 4PJ6A 5SWZE 4BE6A 5D9MA 5JR1L 3AZRA 4KROD 3F62A 1KTRL 3KCWA 3O9WC 5E94B 5MI0B 1ZBWA 5JPMA 2VW7A 2ZOLA 4HIJA 1I7RA 2X4SB 4FQLL 1BXCA 1BYNA 4PS3A 1SPDA 2BJML 3JWDC 2EC9T 3EMQA 4KXDA 1U93A 2QJIA 2AEQH 3R2GA 3UY8A 4DO5A 2EACA 3G6AB 1X7SA 3O9WA 5I1KL 1WKDA 1SY6A 2PYFA 4LPYA 1M7IB 3H3KA 3RUGE 4UOQA 3ITYA 3MCLL 3WQOA 4ALAC 1PY4A 3GJFA 3BG9A 4Z1DA 4C6OA 4UTTA 3UX9B 4OZHF 2R0ZL 4Z18A 5HI5D 5B38B 5I8CA 5IFJA 1RSFA 1HFUA 4KNQA 1JXFA 1F3JA 1PV8A 2GJLA 2H90A 5CZKA 3H8NA 5HPMB 5BUPA 2OOFA 3PAYA 4ZD3H 3U82B 4Y5YB 5L88H 1A5MC 4QO1B 2GGGA 4NXKA 1DQUA 4KJPD 5BMFH 4J23A 1D9KA 2D0FA 3K6IA 4H2CA 5EBLA 4K3EH 4NKDB 3VXUA 1Q9OA 3M0IA 4IXXA 2OB3A 3SCUA 2JELL 3CHFA 4G8GD 4H8WC 4FOJA 4BCEA 3S4SB 4TVSa 4TLKA 2PDQA 4OQ1A 4HOXA 2WMHA 1YNKL 5KBLA 2NX3A 3AU1B 4CD8A 4KUZL 4GO8A 5HHVL 4GABA 3B1UA 2B0SH 1M3IA 1URLA 1V7NH 2V2XA 3MRNA 3KYNA 4JO1H 5CSYA 3O4LB 2B7QA 2CO7A 3UMTA 5F1UA 4AL8C 2B3RA 3V8OA 3S5LG 4URTB 3FOLB 1PXGA 2ENJA 4B9PA 1Z3RA 3M0HA 5CG0A 4E68A 5DJ8B 4JAMB 2G3JA 1EFXA 3MFFA 2J7FA 2W0LA 3AO0A 2FSEB 3KVPA 4AAJA 1KYOK 2M1KA 1H3PH 1QG3A 4ZPVA 5BO0D 3O6KL 3INOA 2PS2A 4PMQA 1Q6CA 4N28A 5K9KB 1A7OH 1H09A 1Z1WA 3KNBA 1JMZA 4IBTA 4RISL 3IJ7A 2QT3A 4TV6A 3WS6C 1QO2A 4ZAKB 2OGYA 1W91A 1G7PA 2PDPA 4H6EA 3DV4A 4Q4QA 5ABHA 3TJHC 3AG2B 3ZMNA 2YLKA 2PEVA 1MUMA 3QF0A 4MNLA 5D1QB 4PEKA 1MCFA 1QFHA 5DCEA 1Z0MA 3ECVA 3PFUA 4JCMA 5EOTB 1XHGA 1Y0EA 3IIOA 4HB7A 3SKMB 8PAZA 1V03A 2FK9A 4H5SA 3SDDB 1H5VA 4F80A 1G7LB 2J57A 4UDUA 1PFCA 3HN3A 1XIWB 4LVEA 2Y23A 4M4RB 5LNEA 4Z1PA 1FO0H 4GQZA 2FPVA 1EERB 4FNTA 5HHMD 5GS0H 1N7KA 2BP8B 3W39B 2PDLA 3Q6FA 2NY1D 3REWB 4JZOB 3GQYA 2XOTA 4K39A 1A6AB 5GGTL 4D9RE 3C0QA 4MM1A 2ED6A 3KPRB 1WICA 1LQ0A 3AT8A 5LBVA 3BDXA 1MEHA 3L3JA 1WBXB 1TV7A 1ZSXA 2F9BT 2QADC 5BXFB 2QMKA 3UF9A 2Q3AA 3N1PC 5SX5H 3QUXB 1SZGA 1TZHB 2AXFB 2CBOA 3PPSA 4L9LC 4LCVA 1BTCA 1L6WA 3GSVB 1NGPL 1JGIA 3MJ9A 2FO4A 2X1XR 1H3GA 4HBCL 1BZQK 1JTOA 3CN4A 2ZA3A 3EOAA 3DO7B 2J1YA 2OA9A 3TZVD 4IMLA 5C0CA 1QYGL 3HNSL 1OAZL 1A5AA 1SGKA 5HGHB 3LB0A 3HBLA 1UB5B 1XGPA 3MLZL 3NIDE 1I8LA 3PSVA 2OP4H 4QJ1A 5LQBL 3VWJA 3TAOA 1GGCL 2VR8A 3VOCA 5EA0H 4HEME 1W5MA 1FFQA 2JCCA 5DMIL 1P1XA 4V2XA 3DYOA 4DK6A 1GQJA 1KGYE 4YGVB 3V5DB 3DI2B 1QD0A 3EJPA 3Q9PA 2CLFA 3HS0A 3R8GA 1T83A 5I02A 1S7SB 2JGQA 2XI9A 1KQZA 1P53A 3T0CA 3WKYA 3D07A 4Y6GA 3J27A 3SBQA 1AJZA 1RCQA 3EJQA 3AIBA 3ML8A 1HVXA 3CIWA 2DMHA 2H3XC 1T4KA 3U7YH 4J2XA 1K6WA 1XCWA 3WIHA 5DJYB 3NN8A 2YGVA 5AZEL 4PP1D 3VVWA 1MLBB 1L0YA 5IR1B 1TZIB 4YVPA 5LB1A 1BVLB 3IUDA 1G84A 2BVOB 3L7FA 3SE8L 1IEAB 5CD5C 2B7PA 5IEHB 1L9NA 5GVJA 1XWVA 1HXJA 1LD9A 1XTMA 1OWRM 5HR6A 1AKJD 4RA3A 2XPGA 4LBEB 4QXGH 3QDHA 3E6FA 3QUXD 2F6XA 1YY9D 3CDGA 5T1LD 3GJEB 3LBOA 1WFNA 4P2RB 1SN2A 4YMPA 2GFBB 4UM9A 1PCKA 4H25B 2APBA 1F4WH 1ME7A 2GAZA 4WTZA 4X6CF 5E5UB 4H04A 5E8DH 5JO5B 1R3TA 2Q01A 2BOCA 1ZJBA 4AY0A 1Q85A 2BZ7A 5GGSA 3G0UA 1EPFA 3FTVA 3IFLH 4N6QA 3DO3A 3ROOA 2ATAA 4TOQA 1H5YA 3CAKA 2DQHL 1POKA 2ZJSL 4O1CA 2PLMA 1E2VA 1MCOH 2TRHA 2J8UA 1QFUL 4JE4B 5FECA 2R9RA 3SB0A 3UTOA 2AI0H 4WXYA 3AM8C 4PL2A 4QCIB 1BQRA 4ELDA 3KLAA 1AZRA 3BH9A 3DUSA 3TS8A 3LKRB 4X6DF 3ARED 4AJWA 1M5WA 3GKAA 1RJZB 2GCYB 3GI9H 3NZ8A 4ZXBD 4B6ZA 3R7MA 3TBYB 2V8LA 2OMZA 4KIEA 1Q72L 4HT1H 4POYA 2HA1A 2CDGA 2NXZB 2VC2L 4Y2WA 3BG3A 2WMJA 3F7JA 4M7LL 1YUHB 3GE7A 1BOYA 1FLRH 1R5IA 2WUCH 5C0EA 1YNQA 1NEPA 4FZIA 1PKOA 1MW0A 3NAAL 3FJTA 4NKDA 1AOZA 2R83A 1GZPA 3EO0A 5C07D 1UOZA 4ZL1A 5LQBH 4XD6A 4NC1C 5HDQL 1TZZA 3MLZH 3MRQB 1SJDA 4NQEA 4KI5E 5ETUB 4MYWB 5GZNC 5E6IB 3GC5A 4R7XA 4H41A 3P81A 5CC5A 4PLJC 4UDTA 4H20H 2V2XB 4PRHB 5L4IA 5C7VA 5L8KB 4GISA 1FWEC 3TO4C 7FABL 5C2CA 4HBCH 4FS9A 3OKEB 5HGAB 2YGPA 3MXVL 2GGIA 1VYPX 1C08B 3SN4A 4D6GA 4EI5B 3VFMB 2P0OA 4J8RA 4HS8H 4PJ8A 2O5XL 3BPCA 3AU0A 5D1XE 4AWUA 1I1AA 4XMXA 4DAGL 4NRYA 4GX9A 3O11B 4G9PA 2OMVA 5GXBB 3LHYA 5AHLA 5AW3B 1D5RA 4H1LA 4LCIH 2GW5A 4IMDA 3KBMA 1R3LA 4JFDB 1AANA 4XMPH 4ZMXA 4OZIA 4IBQA 1KXTA 4MNQD 1Q6LA 4M82A 4WKHA 4ASTA 4ZXBB 4FHBD 4PJIE 1RK6A 1HYSD 4MB5A 2E86A 1NL0H 3BAJA 1CTMA 4OKVB 1PLCA 3ERXA 4WUUE 3DFPA 1CLZL 4MVAA 2XNAA 1XC4A 3VFCA 1H50A 5HYSG 2PD9A 3GW0A 2WB1A 2UVFA 1EYEA 3SO7A 1IT9H 3U4EA 1Y7VA 4YXKL 2W79A 2WXMA 2BDQA 1YEWA 3VGFA 3PZUA 4QIUA 2WNKA 4W4QA 2YQ2A 2A0LD 4O02L 2OLHA 2VN5A 3FW6A 3S1GA 1UC4A 2DEPA 2D23A 3SJVD 2POZA 3AM8A 4U10A 3HRZB 5DJAB 3NK3A 3A6OA 5BWFA 2HUHA 1LYXA 2RDUA 5A95A 2Q1EA 2VERN 5KANI 1VKXA 4CN4A 2ZZ2A 3BJSA 3TROA 3UWZA 2Y70A 4L9ZA 1UD6A 1ZCOA 3ZE0F 2PABA 1JCJA 2BNJA 4OF6A 1IAIL 3UPRB 5ABFA 4PJ7B 1IQDB 3MNMA 3D5HA 5BZZA 3D34A 3GK8L 3E0FA 1SOQA 5IG7B 1RJCA 4GAAA 4WEBH 3K81A 4NBYB 2LR4A 3VXSD 1A3LH 3D3AA 3PGFL 2OMYA 2WQSA 1MEXH 2Z93B 2OEJA 3NQ2A 4P2RD 1J8HA 4Y4FD 1Z9SA 1QK2A 2Z35B 1KBVA 2OPJA 2YZ1A 3IS4A 4XXWC 2ROXA 3OKKA 2GJ6A 4NHCL 4UQ3A 1N5AA 4YHKH 3KLHC 2NXHA 2NY1C 3JW7A 3CB3A 1FIEA 2NV9A 4XN4A 2IQDA 3EJSA 4A1RA 2CKSA 4YYCA 4JK0D 3GGWA 1E73M 2X6CA 1QO3A 1ROWA 2WQWA 1JNDA 1DVUA 4S1DC 4Q9BA 4ENZA 5SWZD 2X1TA 1MI5A 5FK9A 2VDNL 4ADTA 1LK2B 4YDMA 4F1SA 2P44B 1S9XA 3BKCH 4H4NA 2H8PA 4LSPH 1BG1A 1ACYH 3CHRA 2J7CA 2XVPA 5I1KH 3Q2VA 1JNNL 4OF7A 1M1XA 2AQRA 2F53A 1S39A 4AQEA 4AL8L 2Z1PA 1SZNA 1HVQA 1I7TB 4EK7A 4Z0BH 2VEGA 3QA3B 4PRPD 4FTVA 2WINB 5DD1H 1UWSA 3TEZA 3IIZA 1KM2A 2QPDB 3TWYA 5CPQA 1QRNE 3GSOA 3OD3A 4TLSA 3AOFA 3WG7B 3RWEA 4Y2OA 1U21A 3LSBA 6ALDA 2C3XA 1VIWA 5E1HB 5L8JB 1XPYA 3RGBA 2G41A 2KZBA 1YHPA 3GDMA 1IAIH 2YARA 3VJ6A 3CO4A 4RX0A 4QLWA 3LDBC 4IBLT 1JZ7A 1R7AA 4ECNA 1D5ZB 1MRDL 3STLA 2XRAH 1T8XA 1SXNA 5HYJD 4FG6C 2JIEA 3SAZA 2P5EB 3X13A 2ZKXA 4EIUA 4JQXC 5F21B 3VQ2C 1EOKA 1EWEA 3PWIA 1G5AA 2V3EA 5AZ2L 5B38G 2XIOA 3B03A 3UOAB 4C7DA 1XR8A 4LVHC 2WZAA 3KBVA 3R1GL 2VEFA 5G1MA 4FI8A 3W2DH 1J5OL 1LBMA 3U8GA 5H8PA 5JW4Q 4YDKH 3MDWA 4JE0A 1QLFA 3AALA 2BSCA 3LRSA 3BH9B 4GLEA 5LIXX 3G6JB 3U3HA 4KTEL 1NC2D 3DX9B 4LHUD 3F5WB 3D87B 5CJXC 2FX7H 2ADFH 1JNHA 4RGOH 1BBDL 4WFGE 1SXSA 4BV1A 1D5BA 4K7PX 2TMDA 2W8CA 4PRNB 1MQQA 3O3RA 2ZCKL 4PBEA 2QCCA 1EBPA 4S2BA 3EBIA 5EMMA 2CZ5A 4FLOA 2VH5L 2X1IA 5HQMA 1V4YA 2WO5A 3Q9QA 4XMPL 1WPCA 3P80A 4NM8L 4ZTXA 3L5XL 4LSDA 4GAJH 4JB9L 1BYOA 5D1XA 5DRWA 1CW2A 3TXZA 2C9VA 1G4PA 1Q1PA 2WLYA 1YG9A 3C8DA 3TNNA 2NQCA 4LB3A 1BQCA 1VACB 4UOJA 4NAFA 1NIFA 4DWSB 2X6BA 5M3WA 5K9JH 4S1FA 3STZA 4DPBX 3HHSA 5C0RH 3BQUA 1AI1H 3MV8A 4QWWC 2OK0H 3CDZA 4HJ0D 1SLUA 1S8DB 4ZTOL 4EI5A 2C71A 5I19H 3PBYA 3PC0A 1NUFA 3MRBB 4QY8A 1ZLDA 3DEQA 1Q2SA 2QUNA 5L2JB 2HT2C 4P23B 1EOMA 5LGYA 4YDIH 3BD3A 3R7RA 5ID0B 4D6CA 1AXIB 2H2SD 1XQKA 3RPIA 2H1PH 3OKLA 5E4EC 1KFBA 5J3HD 1UUSA 4JTAA 3WE6A 1KCZA 1P4IL 5KUMA 2XZCH 1RLDA 3GDCA 3NAAH 2ZX7A 4Y5YA 3RE0A 4NO0B 1SJCA 2YX0A 3S9ZA 4HHWA 2FZ3B 2FX9L 2YBRA 4MS6A 4JZJC 3RVVC 1E0XA 2WWCA 4R27A 3H54A 4AV4A 1K8CA 3P3SA 4WK4B 3U5UA 2HX8A 4O2FA 2XICA 3QHFL 2X12A 4FQXA 1AZZC 1IGTB 1FWCC 4WY0B 1U36A 3CM4A 2XNAB 4KT2A 3AU1A 4LP5A 4UQIM 3CXFA 1XKJA 5IMOB 2MCMA 5K9OB 4HWZA 1H7NA 4XZUA 4Y4FA 4E36A 3NBNA 1W37A 4WCJA 4NLAA 1TZOA 4RDQG 2ESVB 3LHZA 3HMXL 1FZJA 1F41A 3NTCH 4QHLB 2GITA 4A39A 1I1YB 2YQGA 2VCAA 2DQHH 4IBZA 4OCWH 4OD3L 3TV3L 3RVTC 3VAVA 1XXDC 2WJ5A 1C8PA 1PUDA 1NARA 3MZ2A 2A7PA 4D9LH 2LVEA 2FB2A 3Q4DA 3OODA 2F38A 4Q97A 5BS0B 4A2GA 4R7OA 1GSKA 2ARJB 4G43A 2KZ1B 4AW7A 1KUMA 3S8FB 2XIMA 1YNTB 3QG7H 3PGDB 1JUFA 4X6FB 3I4EA 3TYUA 4W8BA 2J4WL 1LGVA 5C08A 2ALDA 5H91A 2AW2A 1RK1B 3WN5B 3MLWH 4F8QA 3O0LA 1NY1A 3TR9A 1FVDA 3P30H 1FBIH 4UZUA 2Y1HA 4LGPB 5C5YA 2YLHA 4ZFGH 2EEFA 2ZOUA 1MJUL 1D3HA 3QQ1A 5CZJA 5IB3A 2A83A 5ABDE 2Z1SA 3IXAA 3OGRA 1EAPA 5F7FA 3BN3B 4U4BA 4XP6L 4DIXA 4MLJA 2VEKA 3UWEA 2PU1A 5I1AB 3RFZA 2XU2A 3TTSA 4HGKC 3VI3B 2OLDA 3MJ7B 5IB1A 4WHTA 1C5DB 3FPYA 3PFRA 3BCFA 1D7KA 4IGBC 1P5UC 3ENLA 5CCKL 2C0HA 3HZYB 4PTTA 1O94A 1J1OH 3S37X 1P6WA 1NMAH 4WGWB 1QTSA 3UC0H 4GVIA 5FL1A 1F2QA 3MOQA 3ILQC 1UB6A 3V1PA 4HP5A 2WQUA 1D3GA 1Z3GH 3FU7A 1MHHA 4X9BA 4PCKA 2I9LA 2ABAA 3C2OA 1FL5B 2W59A 4NUJB 5JQIB 1MZRA 1WDRA 2ESCA 3HKZA 4NFCA 1VRSA 1FCGA 4PJEF 4FQHA 5CGYD 3SRDA 1L6PA 3CZFA 4XOEA 5ALBH 1KC7A 4K3DH 4UUJA 3WUEA 1J5TA 2GIXA 3QJHA 4NQXB 4CRPA 1GR7A 5D5MB 2W0UA 3AHXA 1KPUA 3QARA 5DK2B 4S3BA 4LLQB 1JGEA 3BHBA 2MQ0A 3UTZB 4HS6B 3DFHA 2BGSA 5IVXB 3FQWB 2ALAA 2OL3B 1B0IA 3QFDB 3U6RB 4HYVA 4GQBA 3R0KA 5I6LA 1J6OA 2J43A 3DGGB 3O6ML 4L4VA 1F56A 1R3HB 3V4PA 2OMXB 2ZXEB 5E99L 2OVLA 1GL4B 5HYQA 2J7GA 1TG7A 3WFBL 2YXMA 3BGAA 5GGTH 4BSVA 1NSNH 1R34A 3FU9A 1FO0B 2ZXAA 3ZYJA 4BGDA 4EIVA 3CXDL 3WY3A 4F15C 1XIIA 2EP6A 4I2XB 1WG3A 5INCA 4KI5D 4RK8A 1N6QL 3PBWA 4U1MB 2BRQA 4KDTA 1T20B 5FC9A 2QJDA 3AS0A 5C07E 2IAAC 1T4KB 4N4QA 3P0GB 1OCBA 5A8PA 5DJYA 1VFHA 3GTXA 2P76A 1KNOB 3HE6C 1FKWA 2MOVA 1JNHB 4NO0D 1IR1A 5CGMA 5G2IA 1NC4A 3ROLA 3MLVH 2JI3A 3I6GB 1WQ5A 3RA7H 5TD4A 3L9RB 1I8MB 3MACH 4Z7IA 2CIIB 2E74C 5DTFB 2W60B 4G6FD 4JPWL 2JB6A 4S3KA 3H3PL 2PW1B 4WHYG 4FSAA 1CLOL 3ZR6A 4XWGH 3UCRA 1UIPA 4UUIA 3B8YA 3NQCA 4NX5A 4E9RA 7PCYA 2XXFA 1I85A 2Z91A 1VZHA 2JKNA 2XT1B 2BY3A 1MRCL 2GAZB 3WJJA 1XD1A 5DZJA 3KOFA 1JPTL 1JPGB 4HS3A 5E5RB 3LLXA 4Z1AA 2IDUA 1QBBA 1YYCA 3CFKA 3P77A 3EXLA 1W31A 2IPTH 3JSSA 4AWJC 4P46D 2V7HB 4XZ4A 5EN2B 1XB6A 1YEEL 2WW8A 4RZ5A 4IRSC 1ECEA 1RVFL 3UL4A 1ZHBA 4JAWA 3SDCC 1JVLA 2C0AA 3Q48A 5E9NA 1WEJL 5DQ9A 4OVUA 4LUYA 5C07A 3LKSB 3DHFA 3ECWA 3IK4A 4UMAA 1J0HA 3TCLA 1GYNA 3GB6A 4O51B 5BV7B 1E3XA 1XZWA 3G1HA 3N73A 1JZFA 4U1SA 5K39A 4DGIH 4DZ8A 4OCMC 3I85A 4FXKB 2DVXA 4Q6YA 5GRWA 1THFD 2G0WA 4IJ3B 2YGQA 2CW6A 2Z00A 1BFTA 1NEUA 3GAKA 8RUCA 3ZTDC 2DQUL 4X2RA 1AOHA 1FG2A 1Q94B 3SQMA 5TDOA 5FKYA 3S98A 4ABVA 4C59B 1ZL1A 5D4HA 2PDIA 4YWIA 3D3VB 4NPYA 5I8KL 1SHXA 5MP6L 5CZ0A 3RCYA 2QCMA 1O5XA 1KXQE 1MOEA 3IFNH 4FADA 4JX6A 5CBBA 3BH4A 5C09A 1SYVB 1LILA 4MNGB 4XMKL 5EZLB 3ZZSA 1B4RA 4KKXA 4AD3A 4AX6A 5FM8A 1PX3A 4BKNA 4IGHA 1H63A 2VYRE 4XR8C 2X4RB 2VSMB 1IM3A 1GA2A 3DX0A 5AB3A 1JCTA 1AO7B 4PCTA 2DQJH 1TCRA 4ZB5A 3MV7D 5KYUA 3VFMA 2JVUA 3DRQA 1DQQB 3IDGA 5DLCA 4Y1SA 1JXJA 1OZUA 1BWMA 1NICA 4ICMA 3BN9C 5JR1H 3NJFA 4P57B 4LCWA 3UC0L 1FL3A 4PR5B 1RUMH 2AQOA 1E5ZA 1NDMB 4G1MA 3X1NA 1M2VB 1CFTA 2I9UA 4PCFA 3EBHA 2NXYB 4XMUA 4PTNA 4AMAA 2AK4D 2WWDA 2J1ZA 4L1TA 5D30A 3NJHA 3ESOA 3S2NA 1PAZA 4DETA 2VDKB 4KRPD 3QKEA 2X44D 5JW3L 1WTLA 4P0DA 2OJ1A 4L1WA 4NKCA 3MUJA 5M5DA 5IHUL 4PLJD 1T3FA 3WAKA 4U28A 3U2OA 2VDPB 1KCUH 4WI8A 1TZ7A 2ZZ4A 1CK0H 2V2TB 1M7DB 5EO9B 3ABZA 4HX1A 3SPVA 5B3JE 2P8PB 3OA3A 2WBWB 3VFOA 4FC3E 5EORH 4KBXA 2PO6D 3SCMA 3SEPA 4JO2H 3GRIA 4P8WA 1AGDA 2Z64C 5E4IA 1LDCA 1ESOA 1X8FA 5IM7B 4D8LA 2VWEC 4PUBH 1BD2B 1ONQA 3V5KA 5AAWC 1NAMH 3MJ6A 8FABA 4X60A 4MOZA 4M48H 1L8PA 2Y8KA 4KX9A 3IAQA 1BAGA 1YW1A 4ACZA 1E8YA 5IVOA 1AGCB 3SCTA 1HCVA 2BSEA 3D0LA 2VAAB 3EOUA 2FL5B 1UWRA 3E5BA 2WJZA 4B3ZA 3QNYA 5D38A 4Z0SA 3HNTL 4MQ7A 3HMXH 2V6HA 4YWGL 1YZZA 4LSRH 3UACA 3O6FC 5F9JB 1E6JH 1JVOA 1T21B 5A1AA 3QJHB 2EPLX 2XQYA 4NWTL 4AQ8C 1H1NA 2BRRH 5E2TH 3Q6GH 3H9SA 4LSVH 1TG8A 1XGYH 4AIUA 2NY5H 3GBML 2FMNA 3S3PA 3LKPB 3NA9L 1UGNA 4KKLD 3WNJA 4BWWA 3QUMH 2FYYB 2Q8LA 5SWSD 4NCDA 2V30A 3LXCA 4ONGH 3KM8A 1C7SA 1SJBA 2J7DA 2YOAA 3DGGA 3T2NH 5AAPA 2R1WB 4NQCA 2H5UA 3H7UA 1MCHA 5D8ZA 3VA6A 2ENSA 4U33A 5D7KD 3QUXC 1P4IH 1M6JA 1SXCA 3XIMA 4OZGE 4Q4KA 5I3HA 3EO9H 2E9LA 4HWNA 5EU4B 6TIMA 3GJFK 1A80A 3IPWA 3WTXA 4J5NA 4U6YB 4YSAA 4B9KC 1IVLA 2WQXA 2X4OB 1OANA 3VPLA 3LN5B 3QQDB 4NJHA 2JKIS 4AWTA 4XBPA 1FNLA 1CZ8H 4HIXH 5DJZB 5J13B 4WWPA 4EANA 5DHXB 4XO3A 3EWXA 3V7PA 1S9XB 3MBXL 1Q0XL 3SKOA 3AHVA 2Y36H 3A6BL 4UTAL 1BQHG 2JKAA 1EGJA 1XGQA 2VFHA 1KBKA 4DP7X 1H6FA 1E6OH 2EE6A 1CI1A 1P5UA 1WNOA 4Z7UA 4G1EB 3SO3C 1I7TA 2Y6ZA 4YHLH 4FXGC 1D9KC 3P0XA 3IU3B 3CQ0A 1H15A 5E2JA 3BN9D 3VWKC 2WMIA 5FIEA 4H6RA 3STCA 3FKRA 4FFTA 1OG0A 2F1EA 2XUCA 1RZFH 2LLEA 1TPFA 4KO9A 3EDDA 2F19L 2K7PA 1HCFX 4ODBD 2VH5H 4AG4H 5EFIA 3KEHA 3FCGA 3DOSA 2AXGB 3DIFA 5C0GA 3VNZA 1EQPA 1F6KA 4M1BA 4DF2A 4UC5A 1VFBA 3CUJA 1IXQA 3GXUB 3AU6A 4XTDA 4E38A 3FF8A 3K2MC 4NYUA 3MCOA 3HG1B 1RQBA 4J27A 1Q6GA 3WFHA 1DQWA 1TPH1 3K4AA 3IJHA 2I14A 3UPMA 3B7UX 5KJ4A 3QYNA 5HP5A 2HCVA 4MHBA 1ZTXH 1KGCD 3NGBC 3OX8A 1KCUL 4JN1L 4WHCA 1N7MH 2NXYD 4XMVA 5BZWB 5C0BA 5HYSA 1MRQA 1NGXA 4JFFD 1TVLA 1JZHA 1IC4H 3KWWB 3WF3A 2G2RA 1QNPA 3IDIA 3VXSE 2C9AA 2X41A 2XN0A 4PVNA 5HDRA 1WKEA 3ZYIA 5KVEE 3G8RA 3WQCA 4BUGA 4OZFB 5DY3A 2YXGA 4JZNA 3A4DA 3T4AC 1OB0A 2XG4B 2A4ZA 4H0HB 1N59B 4AM0A 3L9CA 1R1CA 2EO7A 5IV2A 3P62A 2AJ3A 1AZ1A 3O1NA 4LC8A 4XCEA 5IY5B 4K94C 4GXUN 5BRZB 4L29B 4XI5C 3EYVB 3VSQA 2WBJA 4O0ZA 5HATA 5CAKA 3TN5A 5L7XL 1I82A 1HNGA 4FS0A 5KYXB 2J27A 1K3ZA 2F7OA 2Z25A 3MSYA 5D04C 2VL5B 4ZXOA 5HNUA 3T4YB 3T0EA 2WUBH 4O5LL 1AQKH 2HRPH 3GHEH 2P5WA 4NKMB 4P5TA 1UM5H 4X5XB 2J78A 3EZ8A 5G4HC 1AG1O 4IOIB 4EPDC 3PB0A 1HSAB 3KCJA 2OTWB 1TYEB 1CZ1A 1VGAA 4UMSA 2CHXA 2VE6B 1ZHNB 3ARGB 5DD3L 4DTGL 2GGEA 4LESA 4K6AA 3VRIB 4MUPA 3QO0A 4N6FA 5HNNA 3TC3A 4C6BA 2EXYC 5C0DA 5CSUA 1UJ3B 1U8PB 4BBWA 3ZUNC 3H42L 2HVBA 1XSOA 4G6MH 3NQMA 2PDBA 3MJ9H 3CQIA 4OWGA 1VPYA 3V0VA 3U2JA 3VXTB 3OZMA 5I1GH 4YSQA 4LCWD 4JFFB 1ELSA 2NX5A 3ZDZF 4FABH 5L2KB 3QUYA 1FTXA 1MEIA 3OVPA 4ADSA 4B90A 1R9YA 1WD8A 4G70B 2Z92A 3NJGA 1A3LL 1JCXA 1XICA 4IFKB 4HLJA 4Q6JA 5B39B 4FR6A 1INQB 4P5TC 4HKJB 3V9EA 1Q90A 2H9AA 3RQ3A 3AIQA 4BSWB 2AQPA 2EEDA 4FAAB 3NOYA 3SR7A 1LOLA 4A2SA 3I68A 3BZ4B 2QPSA 3MPCA 3IDMB 3L08A 3FQNB 1H6UA 5FGSA 4EDWL 1CWYA 3LEXB 4R85A 3WK1A 2XACC 4H9XA 2AJVH 3ARVA 15C8H 3AIUA 4F2ME 1PDKA 5F89A 2EVIA 3QY6A 2FLBT 2CDEB 3NEVA 2G3ZA 2JKRM 4Y2DC 1DIOA 4O18A 1KCSL 4Z7WA 1EJUC 3H70A 1YHTA 5TFSL 1CGTA 1IQWL 4KTDL 2R4RH 5CSZA 2ESVE 5GGVY 5I0DA 1DTNA 1LWRA 3S96B 5F8RC 2JK5A 3MLVL 1WAAE 1G6RA 1US3A 3GR8A 4HN4A 4JEJA 2W9EH 3APYA 1QSZA 1OYCA 3ZWTA 5LGZA 1TELA 3BAYA 2WMKA 3S34L 1LL1A 1DCLA 3ESVF 5F4XA 4ATDA 3FN9A 2OXGB 4PWHA 1S2WA 3VFVA 3N1QC 3L5HA 4IPJA 4QG8A 4ZAKD 4AV0A 1VA9A 4LEQA 3GMOA 3NP3A 3BPOC 3Q2CA 2F6KA 3BW4A 4DJEC 1KZYA 1I1XA 4G5DA 5AD0B 3ITOA 5K1JA 3MT1A 2C18A 4X8JB 4FXRA 5KVGL 4MNMA 1T89A 1V10A 2FJHB 2VR7A 3L7EB 1E6QM 2TSYA 4PGBB 4CW1B 1EZWA 5BZAA 1DWFM 1UZ6F 1XX9C 2C3HA 1JHKL 4JKPH 2BZNA 1FWSA 4EIZC 1UZ6E 1YEJH 4NM4H 1RL1A 3JT0A 3QIWA 4HS8L 5MEQB 2N1KA 2XY1A 5TQ2H 4LEFA 1OX4B 1GK8A 4DP5X 1RVGA 2CERA 3VOHA 4N0CD 4D0CB 1WXZA 3B2PA 2ZOXA 3TYCA 4A3QA 1K03A 2XZ9A 2XV6B 2NY1B 1W9UA 2AP2A 2ZCHH 2P8CA 4GUFA 3UZJA 1OF8A 4BFBD 3A3HA 2AZAA 3LD8B 2OYMA 4IM8A 1T1XA 2K4AA 3UBXB 2YSWA 5IR1A 5JPNC 3M5XA 4PRAA 2Z29A 3W7IA 4PP1C 2N0KA 2B7NA 4GFXA 4S3GA 3PJLA 2GGJA 1BQLL 1VQTA 1LM8V 3RM8A 4RCAA 4FIQA 1IKOP 1Z5LA 4YNYA 3C60A 1F3DH 4LYPA 5BWAA 3I9PA 3O3BB 2XWTA 1BFSA 5AAMC 1QK0A 4IDJH 1DEDA 4WCYL 3IJSB 1KYAA 1QPXA 3EYQD 3L1OL 3GBNH 5HWMA 5IBLC 3SGZA 3V4VA 5H35B 1W2PA 3G1RA 2X1PA 1SUJA 2ZOOA 1F45A 1NUNB 4G8GA 4H44C 1QNVA 3EB4A 3HBQA 4MTMA 1KC5H 1GOOA 4O8AA 2J56A 4M7KH 2NTSP 1A5UA 5ACLA 1P7TB 2VW6A 2CLPA 3GRWH 2IXQB 3GI9L 4PG2A 3V4UH 4PJ9A 3LEYL 1BWWA 3CPLB 1ZQ5A 3LV3B 1NDGB