1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords alpha-galactosidase
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
3LBMA 3T7VA 2QLYA 3ANYA 3T4CA 1VAHA 1F6KA 5HNRA 5I24A 3KLKA 4LU0A 2NLIA 3FFSA 1KTCA 2C7FA 4FX8A 4LY8A 2V2DA 2X2HA 4O52A 3W07A 5F2GA 1ZAJA 3RILA 1V3KA 3BVUA 3K1DA 4OWGA 4O16A 3I6RA 5K2ZA 1SU5A 3BK0A 3IJ8A 4A2SA 3QSTA 1W1ZA 3WEMA 3WFZA 2YGYA 1MWOA 4P2VA 2EJ1A 5K7JA 4FLRA 2H8ZA 1IXNA 1PE1A 3NDOA 5EMUA 3H54A 1SSGA 2YXGA 1BG9A 1LLZA 2GJPA 2FPTA 1J4EA 3NPUA 3FJLA 4BWLC 2QAPA 1HL9A 2GVYA 2Y7DA 4GRSA 2WVUA 4AWUA 1EX5A 1XFBA 1KBBA 3KL5A 3NVTA 4UMCA 3SR7A 2A7NA 2G95A 3VM5A 1GVOA 2P1FA 4O4WA 1KGXA 3A22A 5U4NA 4NJKA 3NQMA 3W7DA 3D0CA 4AMXA 3PUOA 3NL3A 5AHIA 5HWMA 3EXSA 3BW3A 3TXVA 3GAYA 4IMEA 4LV4A 4FIQA 1IF2A 3V1PA 4HOZA 1K7EA 1I8JA 4FNRA 3LHYA 1D9EA 2DZWA 1QO5A 3LCWA 3C6CA 2YZRA 1DOSA 2FH6A 1GJPA 2D3LA 1TQTA 3EDFA 1TB3A 5D09A 5FF3A 5F4WA 1FCQA 1T8XA 3BLBA 3IIZA 4JDYA 1B9BA 3BLPX 1OYCA 2V82A 4JTHA 3UZJA 1Q3NA 1TYGA 1UKQA 2ZRZA 4H8VA 4S1FA 4CNPA 1G7UA 4TX9A 1ICPA 3P7YA 2QUTA 2WPGA 4E0CA 4UTMA 1FCVA 2QEZA 1LM1A 3QMSA 2E8YA 4PEKA 1W3NA 2Y88A 5D2YA 1AW2A 4BF9A 3NQ6A 3PBWA 5D2WA 1QR7A 1WOAA 1NM9A 1I2NA 3P74A 4WD0A 1VFOA 4JD4A 3TV8A 2E0PA 1XGZA 3DX2A 4NJHA 2AGKA 2YFOA 2E1DA 4Y90A 1FCBA 1THFD 2RKXA 4QNEA 4CCDA 4JFUA 3BAKA 2NWRA 3WFAA 1ME7A 2VC6A 3M5VA 3S1WA 3W7EA 3GR7A 1G69A 4NZFA 4UR7A 1UUMA 1U2YA 4JX5A 2FFCA 3OLEA 2EF9A 1VIWA 3VMNA 1OX4B 1PCWA 1KM2A 2ALDA 4E2BA 1U33A 1RVGA 2HSAA 1TCDA 1E40A 2YX0A 3FS2A 1CYGA 4UFKA 1JI1A 1ZS2A 4ZL1A 4OT7A 1G94A 1Y7VA 4GJ1A 3AJXA 4HNUA 1MXDA 1V5XA 1GWJA 3W7LA 2FPYA 3GK0A 3LXCA 3NO5A 2PRMA 2OX1A 1C29A 2JBMA 3VGDA 1IGSA 3EX2A 3W7IA 4PCSA 1H50A 1OFRA 4XTDA 3G1SA 3TW7A 3QF0A 2F1AA 3O05A 3P67A 2JKPA 5AC7A 2WNZA 1U30A 3VE7A 2BXVA 5LNRA 4K37A 4NQ1A 3WK3A 5HDRA 4X22A 1EPXA 4A2RA 1ZAHA 3LXBA 3GB6A 3L5LA 2ZZ2A 2FTPA 5C2XA 3IVTA 1WBHA 4J9JA 1KCKA 4JCMA 1G5AA 3HG5A 1UH2A 1Y0EA 2DIJA 2JK2A 1JCYA 3W88A 2B7OA 4RZ5A 1TV5A 2QPSA 4NVTA 4O14A 1YTDA 3TA6A 4HPXA 5H91A 4O1CA 1XSJA 4OU1A 3GR8A 3W7RA 3DHPA 3VGBA 3QM3A 4GUGA 5E0KA 4CQ8A 1RP8A 3HGOA 2ZXAA 1MSSA 3DDFA 1DORA 2C1HA 4OJYA 2ZWYA 3EJRA 2GJRA 1WP6A 3IIXA 4I7UA 4RXFA 1QI4A 1OHLA 2C6QA 4RR4A 4ADTA 3TE9A 5AFDA 2Q8ZA 1TPFA 2BTMA 2DP3A 1CI1A 3EXRA 4UTTC 1DJQA 4H3DA 1OB0A 3ATYA 3TC7A 1ZJBA 5KEZA 1VS1A 3FYOA 4UIOA 1Z44A 3F4NA 4RCXA 4W9TA 2AMGA 4U2YA 1K8YA 4QM1A 1ALDA 3TNOA 3M7WA 5A2BA 3S8HA 2YFNA 2FQIA 1HFBA 4MPQA 2X1SA 2E5BA 3TKFA 4TIMA 4UFHA 3WK2A 2ZZ4A 5DO8A 3UPWA 2WANA 1TTQA 1UBSA 2WO5A 3VX0A 3FAWA 2RDTA 5HWNA 5AB3A 3VM7A 2QCLA 2F7OA 3FW6A 1Q45A 4UTTA 3OIXA 4O50A 2CZFA 5G1TA 2RH9A 4X9SA 1JCLA 5CLWA 1H63A 2VEKA 3NGJA 1W31A 3QRHA 3G18A 1CLVA 5CXPA 3W85A 7CGTA 1JDAA 4AWTA 2FB3A 4GXMA 3TFXA 3G1YA 3HZ3A 4XBSA 3IVSA 4DF1A 1SO6A 2WCSA 2B4GA 2BLEA 3BSGA 1MFUA 2CXGA 5L9FA 2JGQA 2BSLA 2QJHA 1FY6A 3PM6A 1SMDA 1ME8A 1UA7A 4Z0JA 2WVVB 1I2RA 5G4WA 4UTWC 3NPXA 3GDLA 4WY0B 4OE7A 1SO4A 2Z6JA 4GNJA 4LUIA 1TIMA 3BAJA 4MAZA 3PY2A 1HO4A 1VCFA 3ZT6A 2V3EA 3EJUA 5BW6A 1E3XA 3CTLA 1UH3A 4ML9A 4AEOA 1TTJA 3NQ8A 5I23A 4IXHA 1TPC1 4RLIA 1YPIA 1CW2A 4O1BA 2QCMA 3WK0A 3LV5A 2QMJA 2I1OA 1TREA 2EKCA 2NUXA 4LOCA 3W7QA 3IRDA 1LWHA 1OT2A 2A6NA 1CGVA 4UTWA 2BHUA 3SFKA 1XUZA 1K8XA 3M16A 1QCWA 2DU2A 3LPPA 1BVZA 3WY3A 1CXEA 2VFGA 3N14A 4N6FA 1JAEA 1KCLA 3W86A 1MO0A 1TRDA 3CT7A 2G3MA 3EDKA 5KINA 3WJWA 3CPUA 2BY3A 4M6QA 1QI3A 3U2OA 3HG3A 2ISVA 2ZZ7A 1KB3A 3DU0A 3R8RA 1JQXA 3EX6A 2OCZA 2ALWA 3LHWA 4JS3A 1V3JA 2C8NA 5AN7A 1JF6A 4ICNA 2CPUA 2OSXA 3LRLA 3STEA 1OFEA 3TC6A 3NXFA 1VFUA 3UERA 1GTEA 1OG0A 4HOWA 4JTUA 2F7RA 2PURA 2VFDA 4KKXA 2BWGA 3W1LA 5CZJA 4UQ9A 3BLFA 2HMCA 3USBA 4LUJA 2A7RA 4XBKA 3CV5A 5E93A 2ZZ6A 3C61A 1J2WA 3W23A 4JX6A 1UOKA 3NM1A 1OF6A 1WZLA 1KM4A 5AHFA 1LCOA 2FIQA 4UR8A 4POCA 1SSDA 5E70A 4LVDA 3DHDA 3CZSA 1KXQA 2FH8A 2IGTA 4FEZA 1GOXA 5FEXA 4AAJA 2J6XA 1GVQA 5DBUA 1MEWA 4XKYB 3W7JA 5HUOA 4QAIA 2EEXA 2QPUA 3S6DA 1QWNA 1QWUA 2H3BA 3BG3A 4O11A 1U5JA 1OFPA 2A5HA 2Y5EA 4JTKA 1MEHA 3W1AA 1MXGA 3UG3A 3LDVA 2DJXA 2PWFA 4MLRA 1RQEA 4X0NA 3CTTA 4AMWA 5BOOA 5HR7A 4AHPA 1PIIA 5D04C 1W5OA 3TFCA 1JQVA 1B4KA 4XTIA 5LNSA 1ZENA 4R53A 4RX0A 1TMHA 4DO6A 2VFIA 4LV9A 4JIPA 4HN4A 4ADUA 3BAYA 2WKJA 4BI7A 1N7KA 3I65A 1W5NA 2OJPA 4KFNA 5HR6A 8TIMA 3VNZA 3N9SA 4NJGA 1KFLA 1QWGA 2FDSA 3EWZA 5BMWA 5D02A 4N9DA 3T55A 4AIEA 4HT3A 4H8HA 1I2QA 3GZ3A 4XUGA 6TAAA 3ZWTA 2OT1A 3QC3A 1M5WA 1YXDA 5HUPA 3L4XA 3KVMA 2YIHA 3F1QA 3KRUA 4NXKA 4GKLA 3L5MA 1P5BA 4ZVJA 1T96A 2D2OA 1ZAIA 3TDFA 3MWAA 3WJXA 2QUVA 2CLFA 1JIBA 1A53A 4K7YA 3DX1A 1TPB1 4ZQCA 5J5DA 4GQRA 3E96A 5HPOA 5F4XA 4JX4A 2GQ8A 4O15A 1OJXA 1ONRA 1QHOA 2ZX6A 4WSJA 2E09A 1L0PA 1YXYA 1L6WA 1YADA 1H61A 5BNKA 1RPKA 1KA9F 3N2XA 3O16A 3KRZA 2GVLA 3EWWA 3UYCA 3BCDA 3G1AA 1WBJA 4JL1A 1G7VA 1KGWA 1TPWA 2VEMA 3OA3A 4LS1A 4FXSA 3VFLA 3INPA 3W2NA 1QPRA 2ZRYA 3VSUA 3DX3A 1NEYA 3DGRA 1TJRA 3RIKA 1CGYA 4FLOA 3UXAA 2ZZ3A 3MBFA 5I3JA 3LPOA 1TJPA 3ZR6A 4NNBA 4UUIA 4PTNA 3CWOX 4Y6GA 3LHZA 4N6EA 1JULA 3CZEA 3O6CA 2XN1A 3K8LA 4MFDA 1A47A 4U31A 4DO5A 1D3GA 2R8WA 2WVSA 3NA8A 3MHFA 3B05A 4GI9A 2FPVA 3P62A 5I3IA 3PG9A 2YW4A 3DH7A 1DQXA 1DEDA 2V81A 3C56A 3E0IA 5FF0A 3G8RA 3DKLA 4LNYA 1AQMA 5I3FA 1RQBA 3KE0A 2R94A 4E38A 1TPUA 3MHGA 1H1ZA 3NQ2A 1JGIA 1KM6A 3BH4A 3VNYA 2PC4A 1QI5A 4GQQA 3BVXA 1NF7A 4IQLA 3W74A 4RZ4A 5EL1A 2WC7A 1PEZA 1W3TA 1VCGA 1W5MA 3TX9A 3F4WA 2YKKA 4QIUA 2G5WA 1QOQA 4AW7A 1FDJA 2V30A 3WY1A 1AL8A 3W2JA 1VJIA 5E0FA 1OFBA 3OVPA 4RZ6A 3A47A 3Q2DA 4A3UA 2QMKA 3L2IA 3A5FA 2RDUA 3LCGA 8CGTA 5I3KA 4I7VA 2H8XA 4JICA 3VX1A 3O6DA 3UZ5A 3L66A 1QPNA 4U4MA 5EBUA 1JXKA 1XC4A 1OYAA 3PAJA 1Z32X 2NT0A 3K8KA 2G96A 1QFEA 3IV3A 4UFLA 3LB0A 2Y70A 3S2CA 1H7RA 1G9HA 3G1HA 3I68A 1R2TA 4NUWA 5D2VA 2B7QA 3HPSA 1TQVA 5BRPA 7TAAA 1H7PA 4RXGA 1SMAA 3G3MA 1O5XA 3FOKA 1I45A 2DZSA 1K7FA 1W37A 3N3MA 3B04A 4CLMA 4FLSA 2NX1A 3W1PA 3LTPA 4QSHA 3HIJA 3KFTA 3TQVA 5D05A 1CXHA 5TQLA 3VGEA 1O95A 3GDTA 4WUIA 4GWEA 4ALDA 1J0IA 3G1FA 1KXHA 3NL5A 4CQAA 1B3OA 2NXIA 3IK2A 3QEZA 4UTIA 5CZSA 3IEBA 3UY7A 3CLWA 3LHTA 4JXCA 4IMCA 3RLVA 2YW3A 1X8FA 2QUUA 2V2HA 3MBDA 2ATMA 1R75A 1KTBA 5LSMA 1LOLA 1TPH1 4K39A 1AMKA 3DFTA 3NYZA 2EADA 2NT1A 4AIOA 4GI6A 3W7GA 2QCFA 1H51A 2V0TA 3GXFA 2A2IA 1VPXA 4GUJA 4LRSA 1LP6A 1YDVA 3T44A 4JGDA 1PIGA 1XCFA 5EA9A 3W2LA 2OYMA 1L6SA 4UMAA 3L4VA 4WSKA 4RK8A 3HJEA 3QQ0A 5BRBA 2X1TA 1H1YA 2NWSA 3FJ6A 1KFEA 1IXOA 3NPVA 4GUIA 3UG4A 3TIMA 5TIMA 1KBKA 1SW0A 3GYEA 4GIAA 2ZXBA 3RNDA 2QDGA 1WO2A 1XL9A 4AMAA 5EMYA 4O12A 4MYXA 1KM5A 1GVSA 4JR5A 3F03K 3BG9A 1PS3A 1YLVA 3EWBX 1OGSA 1KFKA 5D32A 5G2WA 4PC8A 3G22A 3S9YA 2FHBA 2VRKA 3PF3A 2ZA3A 2HTMA 1FX6A 5E9AA 3NQVA 1H7XA 5KITA 2RFGA 3ATZA 1QPQA 3MHUA 4WQ6A 5CG7A 1OYBA 4LVAA 1C8QA 3CZLA 1T0OA 1TPEA 3PSVA 3IVUA 1GQNA 5DCEA 1K7XA 3KX6A 3SGUA 4FNQA 5FESA 4NNCA 1G6CA 4IWWA 2A6LA 4XZ9A 3NAVA 3EXTA 1MZHA 1R33A 4J28A 5KTLA 3W7PA 3LERA 3M47A 2DZVA 3ABSA 1FWTA 3WDIA 4NT0A 1WOBA 3BAWA 1XDLA 2E6AA 3WENA 2TPSA 3STFA 5F2IA 3ECQA 3BG5A 1ZY9A 4PSPA 1H62A 1SO3A 1W56A 4CKQA 3VO0A 4LW7A 1BEUA 4Q33A 1EA0A 1WE5A 1I75A 1W9XA 2LLEA 3PULA 3MW7A 5HULA 3EB2A 4IX2A 2ZZ1A 3FKKA 3U6WA 1LOQA 3AXIA 1TCMA 1A5SA 3CU2A 5F1VA 5I3GA 3ABRA 3ZOAA 3GKFA 1YXCA 4MY1A 2YDAA 3DENA 4O0KA 1KGUA 2V3FA 1VH7A 5LZLA 3VGHA 3B06A 3VCRA 1ML1A 1B4EA 2C16A 2Z6IA 3CLMA 4FX6M 4PODA 2P10A 3T40A 3KL0A 4ZMGA 1QPKA 3TU9A 1P6WA 2E4TA 3ZR5A 1LBLA 3A5VA 3G1XA 4IOTA 3HF3A 1KLZA 1XCWA 3Q94A 4I9AA 2QCDA 4O1DA 1OFDA 2ZQ0A 4JYDA 2YCEA 3WELA 1XV8A 4UQBA 1CIUA 2CWNA 2X16A 1JUEA 4UC5A 2YJQA 1QDSA 4Q32A 4H8UA 3QPZA 1PL9A 1SFJA 2CLEA 4AH7A 5E1QA 4LRTA 2YOCA 4X3ZA 2NZLA 4KFPA 2PRHA 3BW4A 4UCFA 4BK9A 3MI3A 2J9YA 3O07A 2Y63A 4MUZA 2FYVA 1VLWA 4LPCA 1AW1A 2AAMA 1JFHA 4FXRA 3TH6A 4PCTA 2ZRVA 1OFAA 2A1YA 1HT6A 3MO7A 4H6KA 2D0GA 3S5YA 3A23A 5KSWA 5AC8A 3DHUA 1QOPA 3DKJA 1T99A 3GKAA 4PEEA 4M6VA 5LGZA 3BMVA 2VOMA 3EX1A 4LS2A 2QV4A 1LYXA 3DFQA 1GPWA 3FEMA 4ZQOA 5BMXA 5DELA 4UQEA 4Z1BA 3G3DA 1S5TA 1MEIA 4QAWA 1JUBA 3NZRA 4K36A 3TXZA 5E6ZA 3M0ZA 5DFAA 4PFMA 3OEXA 3P61A 1VYPX 3M43A 1Q6QA 2Z1BA 4R33A 5KMYA 4DBEA 3QGVA 2F7PA 2NSXA 1PHQA 3W2KA 3UWUA 4AYGA 5CZTA 3M9YA 3EKLA 1UD2A 4J3XA 5HJLA 5AHEA 2TAAA 4K38A 5BRQA 1BTMA 4PA8A 3UCQA 1ME9A 3GDMA 4DXVA 1OT1A 3WDJA 1RR2A 5K9XA 3PB2A 2B0MA 1ICQA 2ZXQA 2ZWZA 5HQEA 2J24A 3TQ0A 2NV2A 4JFVA 2I9EA 1F6PA 1HO1A 1I2PA 3W83A 1BKSA 2ZA2A 2QDHA 4G1KA 1A50A 2Y85A 2XIIA 3EKZA 3GNDA 1G67A 1AG1O 1PCKA 2HS6A 2ZYFA 5AHLA 5FI8A 5FF4A 3IGXA 1S5WA 4PL1A 4UQCA 2VFFA 3EX4A 3RMJA 4KWWA 3BUBA 3C2OA 1CXLA 1ADOA 1NF0A 5LNUA 5F2LA 2OYKA 3CIWA 1RP9A 3LX9A 3QPYA 3TSMA 4OQVA 2EPHA 5CKSA 4CCCA 1XKYA 3LI1A 2NX3A 2ZTJA 2PWGA 3BUQA 3SW6A 1ICSA 4E2OA 4AXKA 1QO2A 5K9DA 3AXHA 4CVWA 1GYLA 2ABAA 3LXAA 2E77A 3WJYA 1OSEA 4J3UA 3LGEA 3ZSTA 4BI6A 2CLMA 5D2TA 3HJZA 3ABOA 1VHNA 3TONA 4DEFA 4J7RA 2FGZA 3W1MA 1EB3A 3TMLA 3EDDA 2ZDRA 1EP2A 2VXNA 2EABA 1NOFA 3R2GA 2EAEA 4AF0A 3BO9A 3B0UX 1WV2A 2PWHA 3VKJA 3NPWA 3BARA 4HNTA 3CZNA 1VFMA 5K3VA 3N2MA 3L5AA 2GVJA 4WXZA 5CSSA 4JY8A 1M6JA 2EHHA 3O06A 4EOUA 1R30A 4UNKA 5I3HA 3A6OA 3C0JA 3WNNA 3G8EA 3UWVA 1YDNA 3EWUA 4GO9A 2ZUTA 1WA3A 1ZALA 3TMQA 1UUOA 2E5DA 3GXDA 5CGTA 3DHFA 2PWDA 4NX5A 2WKLA 3EDJA 1H7WA 4DPPA 1LBFA 3S5ZA 3M5YA 4KWUA 1CGXA 3JRKA 2WSKA 2BY0A 1XUUA 3L21A 4CN4A 3NQ7A 2W0UA 3QMTA 4X9YA 3W7KA 2R91A 4JEQA 3LHVA 2OMAA 1GYNA 2Y4SA 3B8DA 1CXKA 1XDMA 3HGRA 3PS7A 2CHNA 1L9WA 3LTYA 3QW4B 3S5NA 3ZT7A 1K3UA 2DZXA 4JTJA 5L6UA 2VRQA 5FEWA 4YL2A 1F5ZA 3NG3A 3EJTA 3P82A 1VJSA 4E2DA 2YR1A 4N02A 4TR9A 3LTSA 1GT8A 1JJKA 4CN1A 4IXXA 3OVRA 1IZKA 3A9IA 4H2CA 4FF7A 3EJQA 2F18A 2F1BA 3SECA 2DH3A 1DTUA 4O18A 4MFEA 1ODUA 1JDCA 2X2IA 2CZDA 2TSYA 3D52A 4LC6A 4NI3A 1RPXA 3BPWA 4PH6A 1MVYA 4PSRA 2IQTA 5KZDA 1HUVA 3D4YA 2YYUA 4QISA 3SGZA 3W1RA 2GVGA 1UD3A 1HL8A 1LTDA 2C13A 3LLFA 3W2MA 2ZUSA 2GPTA 2ZFAA 3NQAA 3RFAA 1OFOA 4ATWA 3NL2A 1VGAA 1D3HA 3PB0A 3QZEA 1BLIA 3UWQA 2Y61A 3BLKA 4R7JA 3GBEA 2ZRUA 5F1UA 1HX0A 1AL7A 1LRNA 3Q37A 3KEHA 1G4TA 5C54A 3I7SA 3IIPA 4UCGA 3EJSA 3KAOA 3LBCA 3S1UA 1F7BA 2WSPA 3DFOA 3KVJA 4N4QA 4QQ3A 1AQHA 1KXVA 2E9BA 1OX6A 2EGZA 3QQ1A 1SZGA 5A5WA 3OLIA 3OLGA 4M5PA 1SZFA 1F74A 1JRCA 4LT9A 2DZPA 4O8RA 4TMBA 5C6MA 1DHKA 3B0VC 1KWGA 1GZGA 3CC1A 2GJNA 1DHPA 1FWWA 3W7OA 2TYSA 1SW7A 3GXNA 1VCVA 2OZ0A 2DORA 4ZZ9A 3CM4A 1G4SA 5LGXA 2BHZA 1EHAA 4ZQMA 5G5IA 1KFJA 3JR2A 3GNNA 2ZX5A 2OYLA 4NZJA 5CPLA 1E51A 1O7DC 1BAGA 4WF7A 3GAKA 3WDHA 4M7SA 1R47A 1CGUA 3BUPA 3BLEA 1X7FA 4JTEA 4IX0A 3NNTA 1D3CA 1VRDA 3NZ1A 2F84A 1JCJA 3C8FA 1RV8A 3BC9A 1TSIA 3C2VA 3QH2A 2C0AA 3W84A 1TTIA 2VFHA 3W37A 4WY0F 3EWXA 3VGFA 1VYRA 4AEFA 3B03A 3NQDA 4EVZA 2CLLA 2C14A 2PE4A 4EF9A 4NU7A 3G0UA 1WZKA 3W72A 2V8ZA 2GOUA 2ZX8A 2VNCA 4JTIA 4JTGA 2F61A 4A21A 1WZMA 2VEIA 3P80A 4XB3A 4JCLA 3E49A 1MW2A 5D33A 9CGTA 1SUXA 3PUDA 3L0NA 1GJWA 1MW0A 5CPOA 5FEZA 2Q8LA 1UD8A 2TMDA 3R5EA 3TQKA 2FLIA 3VSVA 4AF0B 3LCXA 3KRSA 1QHPA 1X1OA 4MZYA 4AB4A 4AEEA 2CLOA 3OBKA 4X2RA 1XCXA 3BAXA 3MI6A 4LWWA 4ADSA 3L68A 5FF2A 4U33A 1KBIA 1W0MA 3KWXA 4S2BA 1KV8A 4JTSA 4JL2A 4J3SA 1XXXA 2X2GA 5D38A 1KM3A 3L9CA 5F4SA 1FXPA 3BW2A 3UD6A 5AC6A 1KV5A 4Y96A 4O54A 3ZQ9A 2DJLA 2A4AA 1PIFA 5U7SA 3P5YA 3OHIA 1X6UA 3TJXA 2GQ9A 5GVJA 1FWNA 1M7OA 4P61A 4K8HA 4CGTA 4N9EA 1W54A 1QX1A 3W1TA 2NV1A 4M8UA 4KWVA 1KTNA 2UV8G 3NQFA 4B9YA 4TU1A 3WNLA 2EO7A 3L4YA 2FHCA 2A85A 3CPRA 3H53A 3MYPA 3NQGA 2HS8A 3CWNA 2WJZA 3QW3A 3FIGA 5HXMA 4GUHA 3H55A 5DY2A 1N8FA 3VGGA 1FDYA 1EUAA 4HPJA 5CZ0A 2X30A 2WOQA 3D51A 1XH1A 1W5QA 2ATSA 1CDGA 2RDWA 4Q4KA 3DFPA 2A0NA 2QJGA 3M07A 2EAWA 3CHVA 4HSOA 4FNPA 3L65A 3W6YA 3C52A 2X1UA 3W7CA 1I2OA 3HPXA 1LORA 4FB7A 2ZRWA 3NM3A 2FE0A 2VKZG 4JY9A 1HNYA 3SIZA 4Z08A 4C1KA 1DKWA 1PJ9A 1OX4A 3KVLA 4O4VA 1Z41A 3HB9A 1XSIA 1O5KA 1ZCOA 2D0FA 3DBPA 3GBDA 5DLCA 1B57A 2CLHA 3W1XA 3VU2A 4CQ9A 1HL2A 2FHFA 3I7RA 4LXFA 4HPHA 5TD4A 1UD4A 1EH9A 4Z1DA 1Q6LA 3LCHA 3TTYA 1WPCA 4B9ZA 4C1LA 2EACA 2E68A 3E02A 2DH2A 3DX0A 1UA3A 4O1AA 5AYYA 3PBVA 3HBLA 2YA0A 2QCNA 2G3NA 3DFNA 1EA9C 4WXYA 3HG4A 3AJ7A 1XBVA 5AHMA 4HA1A 3L0GA 4L4LA 4MB1A 3V75A 4DF2A 4Y9AA 1R34A 1TQSA 1Q6RA 3W75A 1KM0A 3MP4A 3TROA 3W70A 3FYPA 4Z1AA 2QCHA 1SPQA 1WXJA 4FO4A 3WNKA 4O28A 1FDZA 5K9CA 3SI9A 3GVGA 3M44A 1VR6A 5SWUA 3W3OA 1J0KA 4BZYA 2C3ZA 1SO5A 3G24A 3NEVA 5K4XA 1G4PA 1PS9A 2WQPA 1UJPA 3WNOA 2YA1A 5IBXA 4MY8A 1FWSA 1DQWA 3EWYA 3E12A 4MZ8A 5CGMA 2QF7A 1HG3A 4WZHA 3IIOA 2ZRXA 4WJEA 1GG0A 3DX4A 1DVJA 1GEQA 2DZUA 4DELA 3ABQA 2Z2UA 4PL2A 3S0CA 2YPIA 1UB3A 1LOSA 4B5NA 2VEPA 2D3NA 1PVNA 4FLQA 1HXKA 2DZTA 4DBDA 1TV7A 3O8AA 1N55A 3NL6A 4LVGA 3M5ZA 1SQ7A 2JGYA 2BXYA 4A29A 1PPIA 1OABA 5DXYA 3O15A 1PAMA 1LRQA 4JFWA 3E9AA 4NNAA 1XH0A 1AW5A 4LVFA 1JXJA 2BY2A 4L4MA 5LKYA 3ZR4A 5HMSA 1CGTA 5D30A 3LOTA 1DJNA 1BF2A 1F76A 3T78A 5H2ZA 3UWYA 4N2YA 4MY9A 3WEOA 4OGZA 2PCQA 2QAFA 2WPBA 4XWUA 2Y62A 4QJ1A 5F2MA 4UZSA 4JIQA 1YDOA 3LCFA 4Z0SA 2ZZ5A 2A7PA 2WVVA 1UD5A 1JCMP 4BWLA 1JI2A 3S5OA 3IJ9A 3GX9A 2CZEA 5I5RA 3BGJA 2B7PA 4WY0A 3FLUA 4LQ1A 5HINA 4HKPA 4UFJA 3S1XA 2WVTA 1NFBA 4NXSA 4HNNA 1MXSA 1L2UA 1OVDA 2CLKA 3TUUA 4FNUA 3AO0A 4JFSA 2Y7GA 1VYSX 1JL8A 2ZICA 3W73A 4OKDA 5DCDA 3W22A 1IXQA 2TRSA 2Y89A 3N19B 1WYIA 4IJBA 2PRLA 2H6RA 5A6LA 1JDDA 2Z1KA 3TW6A 1EO5A 1ZHAA 3PSWA 1WAUA 1ZJIA 4O13A 4HHPA 4R34A 4YMZA 1V3MA 2ZE0A 4UNIA 3W7HA 2O7SA 4CN6A 2J88A 2VENA 4O19A 1PZ2A 4UZUA 2WSRA 2AQWA 4UQAA 4UTUA 5K4ZA 1PV8A 3GDKA 2QCGA 4YLWA 3ZO9A 3DXIA 3EX3A 3R13A 1SW3A 4AVFA 1LLWA 3QYQA 2OSYA 1S46A 2A21A 3A24A 3OG3A 3BVWA 1XH2A 1IIHA 4LTSA 4DPQA 1S5VA 3GLCA 4HOXA 1L6YA 2V9DA 1FXQA 2ZTKA 1ZJAA 3Q58A 1JG9A 3W1UA 4FNTA 4GINA 3TCEA 5EYWA 3VMPA 1R2RA 2E6YA 3TAOA 2GUYA 3W7NA 5CPNA 3HPZA 1OF8A 5D37A 1OK6A 1EWEA 6TIMA 4FNSA 1JR1A 3CEUA 3S1VA 3PBYA 3KHJA 3C2RA 1F05A 2NUYA 1F2JA 3L4ZA 2XN0A 2CFFA 2J27A 2WNQA 3THQA 1EUNA 2XN2A 1KWKA 1FBAA 3LLDA 3EDEA 1OFQA 1IXPA 3HO8A 2CZ5A 2QCEA 3L2MA 1EO7A 1KLYA 4NX0A 5DN1A 4W93A 3M1ZA 2WV8A 4I7WA 3W1QA 1VLIA 3EEGA 1Q6OA 3AMKA 4JTLA 4RV8A 4XKYA 1H3GA 3ZT5A 3UY8A 1JRBA 1KFBA 3MP5A 1TMQA 3STCA 3K30A 1VB9A 3WN6A 3CIXA 1SFLA 3CQ0A 2OW7A 1D7FA 3A4AA 4Z1CA 5KZEA 3WY2A 3UNDA 3TOPA 3GIYA 2NXGA 2YA2A 4YXGA 2QKFA 3MI2A 1K02A 1H7NA 3PC0A 5EPDA 1UD6A 3VE9A 3RF9A 2ZXDA 3THAA 3WK1A 5KZMA 3DI1A 2XWEA 4BR1A 3R12A 1DBTA 1H60A 3BLIA 3W1NA 3P60A 3BVJA 6ALDA 3BVTA 5EY5A 2Y6ZA 1XSKA 3I7QA 3DDGA 4K7VA 5DCBA 1VQTA 5DXXA 1E43A 1ZFJA 1KM1A 1YTEA 1BPLB 2XVLA 3O1NA 5FEPA 1K03A 4J27A 1SZNA 3DC0A 2QCCA 3SY5A 4WLCA 4J3WA 2YSWA 3CB8A 3O63A 3L4UA 4DF0A 1C9DA 3N34A 6CGTA 2XIBA 1VC4A 3LM7A 4UFIA 4JTFA 4GO8A 2E6FA 1GJUA 3NQCA 1EP3A 3U8GA 3BUDA 3B0PA 4HSNA 3JS3A 1FWRA 4H4IA 2D73A 4IPIA 3P81A 1TQWA 2ZUVA 3RU6A 2AAAA 2JKAA 2WKGA 1TTPA 3SZ8A 3BCFA 3TK7A 2H90A 1R46A 3VSTA 2V3DA 1TPVA 1M7XA 3TSBA 3TSDA 3PVFA 4JYEA 3KVKA 4MZ1A 5I0DA 3G0SA 1Q4NX 2WNWA 3RK8A 1WX0A 1XI3A 1K8ZA 1P4CA 2ZIDA 3SSJA 1H5YA 2YYTA 4RKAA 1EWDA 1CPUA 2B7NA 4LVBA 3CEPA 3P5ZA 3K8MA 1XD1A 1JVNA 5G2HA 3BVVA 3W9ZA 3MYOA 5J5RA 3BMWA 1BWLA 2ZUWA 2E6DA 5LNWA 5EKYA 4N4PA 1A5CA 3NQEA 4MOZA 1PZ3A 1RD5A 3WY4A 3FAXA 4N9BA 3KLLA 2E8ZA 1UCWA 3P8IA 1XBZA 1BWKA 1TQXA 4AWSA 3CGTA 5LNVA 2VELA 1UKTA 2D0HA 2CW6A 4WOQA 3QJAA 1QAPA 4BI5A 1A5BA 4JDBA 3TAKA 1JCNA 4MVAA 1HTIA 3MJYA 4OV9A 3UG5A 5A2CA 2C19A 2ZX9A 2NXHA 2QCDB 1O94A 2Z0IA 3VI2A 5G1YA 2O7QA 4RJEA 5CLTA 4FHAA 3PBUA 1M53A 2H3DA 2BXZA 3QFEA 3D50A 3KXQA 4YCOA 4CNOA 4MKNA 3SJ3A 1X1ZA 3HOJA 3GXMA 2F2HA 7TIMA 4FMVA 5C55A 1TQJA 1P1XA 1GG1A 1AVAA 1LBMA 3ZFHA 4GUFA 3TTSA 2J9ZA 5T26A 2OT0A 3HMJG 1V3LA 2WCGA 2WSQA 4MLJA 3GTNA 3C2FA 4ZQNA 2WNNA 2OSWA 4AYSA 4ZQRA 5CGQA 1XBXA 3LHUA 3HQ1A 4H7VA 4D2JA 4EWND 5G2IA 3M41A 5ABTA 4IPJA 1CXFA 1UKSA 4IUOA 5LHEA 3NOEA 3IJ7A 1AK5A 3P84A 2CLIA 3M5XA 4CNNA 3GXPA 3LRKA 4HP5A 1HTYA 5HWJA 3W7MA 3VMOA 2ZBTA 1GVIA 3FA5A 4MJMA 2C15A 1TO3A 4IMDA 4OIFA 2Q3OA 5D2XA 1LWJA 4TVUA 3QSRA 4TMCA 3CZGA 1SR9A 3HGJA 2NUWA 1OX5A 1AMYA 2ISSA 3GXTA 1W3IA 4UTJA 4U3CA 1CGWA 4GC4A 1B2YA 4QNWA 5D03A 1XBYA 1Z42A 3HG2A 2JKEA 3W38A 4AHOA 1U83A 3TJLA 1H7OA 3OLDA 5FF7A 3EJPA 1EP1A 3ELFA 3DAQA 4KFOA 2I14A 2DIEA 2NX9A 3DFSA 4K6AA 4LC8A 3WJSA 2ISWA 4QITA 2BX7A 2ZX7A 2QJIA 4WX2A 3P8JA 3BUIA 2F7QA 1G1YA 1NSJA 1I4NA 2XVGA 4O17A 1R2SA 3L0KA 3W2UA 4UXDA 3N73A 2RHGA 4ONVA 2G97A 1DL3A 3RLUA 3UXDA 1WZAA 1O60A 1UH4A 4MIMA 3QMRA 2Y7FA 3NR0A 4CCEA 3O6YX 3G1VA 2E5CA 4OV4A 2Y24A 1WQ5A 4KMQA 2C18A 1P0NA 3DZ1A 4A22A 4M6PA 1WDWA 5TBOA 2BHYA 3WMSA 1KBJA 2GQAA 3L2LA 1Z48A 1V7YA 5AYXA 4EF8A 3KL3A 4N9CA 3CZKA 1LRTA 3DI0A 2WSYA 3PUEA 3STGA 1MFVA 3KOFA 1VZWA 3S42A 1UASA 5AYZA 2VR5A 4JYFA 4JNMA 4GI8A 3L67A 3W71A 2GUUA 2X1RA 3LRMA 1NVMA 3IGUA 1W8SA 3IGSA 1CXIA 2Q3RA 3B4UA 2BZNA 4ZQPA 3UEQA 1PHWA 1QPOA 1TQUA 4HIBA 1A5AA 1RQHA 3C2EA 2EQDA 4MYAA 3GDRA 4M7TA 3OVQA 3PG8A 4JTTA 1J0JA 1QW9A 1J0HA 5C5YA 1SZEA 1GCYA 1YTKA 1IIGA 1EIXA 4YCPA 2CU0A 3C4UA 2Y2WA 1P0KA 4FIRA 4IMGA 4U28A 3FKRA 4J3TA 2ABBA 5A8GA 4O53A 1BSIA 1HVXA 4XQ6A 3LV6A 1RZMA 2F7FA 2VFEA 3ZSSA 3II1A 2X2JA 4BA0A 1QNVA 1EEPA 2KZHA 1DV7A 5DY3A 1F73A 4S2CA 2W6RA 3VNDA 4TO8A 2XFWA 5LHFA 4UTHA 2PWEA 1GTHA 3G0XA 4M19A 1NAL1 3BSHA 4JN6A 1S3HA 3MUXA 1FQ0A 4UTLA 3WJZA 3UPBA 3C3NA 3LI0A 3MMTA 4JFTA 4UMBA 3L4WA 3L4TA 3BAIA 2XWDA 5AOUA 1QMLA 3IIVA 5DBTA 1TRIA 3PWAA 4UFMA 1KXTA 1QW8A 4UOQA 3ZWSA 1OK4A 3UWZA 2FJKA 3BV4A 1IV8A 4U2ZA 3G1DA 2OW6A 2V5LA 1HWWA 1GVFA 1YYAA 1MW3A 4GE8A 5MHBA 1CX9A 2GJLA 2W79A 3R89A 5A6MA 1G4EA 3WNMA 4O57A 3HGSA 3W76A 5G4EA 4M56A 2P0OA 4ORMA 4ORIA 1LROA 1M7PA 2FB2A 1LZOA 4PCFA 3UQNA 1J5TA 5F7UA 4DO4A 4O10A 4DQWA 1ZNNA 4EIVA 4BFAA 4AHQA 4J3VA 3GXIA 1LDCA 2V2CA 2V5BA 4IGHA 4UNLA 4HNVA 4K8EA 1FCUA 3BGGA 1XM3A 5CPMA 5AHNA 1JF5A 1E3ZA 3LCIA 4WOZA 1BVNP 1KFCA 1C8VA 1JUKA 2ZCGA 4YWIA 5E6YA 1TPDA 3TR2A 1VHCA 4FX7A 2J9XA 2R14A 3N9RA 1TV8A 4NJIA 1JD7A 4LS0A 2QR6A 3YPIA 4Y8FA 3PR2A 2ZUUA 4OHQA 5IBXC 4GFSA 1YPFA 2XVKA 4UOZA 3AMLA 1JCXA 2ZA1A 1FUYA 3WNPA 2Y7EA 2BY1A 5IM51 2J25A 3M6YA 1W5PA 3MP3A 3D4ZA 3W87A 2VUYA 3UWWA 1JD9A 1KW1A 4NJJA 1MW1A 3A21A 4UQDA 4IMFA 1IZJA 4OBTA 1XD0A 4O0ZA 4MJZA 1O4UA 3LCLA 5CSRA 4UTKA 4GBUA 3ZS4A 2VT0A 5A2AA 1B0IA 1GVRA
chains in the Genus database with same CATH superfamily
1UADC 2MRYA 1S2TA 1RXLA 4G8EA 4XOAA 5D4JA 2VKWA 4LRNL 1R5VA 1ZTXH 2CM5A 2X2HA 5T8IA 2YWYA 4FQPA 5H2BA 7A3HA 2CLVB 2J20A 4XXWA 1UIPA 4P2VA 4YQXH 1JK9A 3LZPA 2EKJA 1CEOA 2V5CA 4EJ1C 2VH5L 1XFBA 3SR7A 3ARPA 5C0EA 3WLSA 4ZB2A 3O2LA 3V4VA 2HVKB 1M9WA 3F5KA 4LFYA 5E4OA 2FH6A 1N26A 4EN2A 1TQTA 2J56A 2I32A 4LBAA 4OZGB 1ZLUH 4WEBL 5E5RB 5JVLA 4UTMA 4GUCA 2QEZA 2IAND 3DRQB 1UM6L 4HSAC 4NQCB 1FCBA 2CDFB 3UTSE 2EIMB 1A6AA 4JX5A 3M0VA 4E2BA 4KKNA 3QFDB 1JI1A 2F5AH 1WK0A 1Y7VA 2V8LA 3AWOA 5D2NB 3UJTL 5LN8A 4WHCA 1IGSA 1T3FA 4L2YA 2F9BT 2LE9A 4C6FA 1Q6GA 5LNRA 4Z7UE 2DM4A 3L5LA 3IVTA 3E38A 3HNTL 4F0LA 2UZYA 1S8DA 5D93B 4O1CA 2XNAA 3JWDL 3PJTA 4CQ8A 3WQFA 3FQUA 2DLFH 3DTXB 2GJRA 3IIXA 3XIMA 3CFBB 5E56A 3ELQA 2EG6A 3EXRA 1FGNL 3UBXB 4AYFB 4EN3A 4LVEA 2VERA 4NKDA 3ZRCC 3RX4A 1I3UA 3CHSA 3P2TA 3VNJA 3ABLB 1XO8A 4U6XB 3SPGA 1EEZA 4AL8H 2NYKA 1TTQA 3DX8A 2Z1SA 4NCC2 1GGOA 3G6AA 4NUPA 1FG2A 5TE6H 1Q45A 4HG4J 3QDGB 4N0FB 3MRNB 1KB5H 2F6UA 2CXGA 2H9AB 4Z2IA 4KHTH 1JZFA 3QIBB 3LKQA 3B7TA 5C0RH 3DLQR 4MAZA 1XF2B 3ZT6A 4E9SA 5GS3A 1I1XA 2W9DH 4A2DA 3W2DL 3OB8A 4FQ1H 3G5WA 1SLVA 2IADB 2J8OA 4UB0L 4HHWA 1KLUB 2BHUA 3SFKA 1FFPB 5M17A 1K4DB 2VFGA 3W86A 4HJ0D 5E9XA 3CT7A 2ZOLB 2G3MA 2E7BA 3SE8H 2JELH 3N4AA 3GG7A 2QGBA 3KYAA 2V5TA 2DQIH 3QJQB 1TFVA 2CPUA 1E6QM 3STEA 3NCWA 3KGUA 4PJAB 4TRPL 3V5HA 3AWGA 4WKZB 1IJNA 2YS4A 4OCXH 1XIFA 3SYCA 2PTZA 2Z1PA 1E4NA 1LXMA 2CM6A 3P2DA 1SMOA 2ZZ6A 2A9CA 1KM4A 3QDMD 3DHDA 2FH8A 2IGTA 4NO2A 5I2IB 1MRDL 2P8CA 5GGQL 4D0CB 3P73A 5EZPA 2OX5A 1U93B 1S39A 2V9TA 1RQEA 4NRYB 1KIUB 1PIIA 1AJ7H 1NBCA 4XTIA 2VFIA 2Z6FA 5LXVA 1HAUA 5IB4B 1II4E 1INEL 4IGBA 4KK6D 4AQ8C 3N9SA 3GIPA 1QFWM 3C5SB 4WI6A 3SURA 3U7WH 5DYOA 1I2QA 5AZ1A 1KIPB 2OXGA 3U2EA 2EDOA 5IROA 3NWRA 4GKLA 1AH0A 2D2GA 5AVVB 3L5MA 3TDFA 2VO8A 1F58H 3MNZA 5EZOH 1NAKH 2X3AA 3STBA 1EAQA 2J7CA 3TJHD 1YADA 5EC2B 2ADFH 3GHTA 3RBSA 1O0VA 1Z69A 3EWWA 2YXMA 2EH7L 5GS0D 4RAVA 2ZRYA 3H8AA 3HI6H 2UBPC 4K1GA 4L8BA 3MDJA 3CWOX 1PZBA 2IDFA 3SPHA 4EPSA 1JPKA 5I73C 2FPVA 2Q76A 3PJXA 2YEVB 5H94B 2BWDA 3MNVB 4GSRA 3A6CH 4E38A 3SKOA 1VFFA 3JWOC 2NYYD 3GNMH 2EDBA 2EEFA 1LNUA 4NRRA 3T0WA 4CNIB 4NGHH 5LWYH 4KIEA 4B9PA 4G5AA 4P2RE 3IB4A 2YLKA 3RTLA 5I3KA 5I1HL 4XD6A 1QPNA 3EW3B 5CPSA 4AYEC 1SGJA 1G9HA 4AITA 1OF2A 3SDXA 4IQHA 1A6UL 3HZYB 2D7NA 1UT2A 1I45A 2BOGX 4JKNA 5HYEA 3GUFA 3VFMA 3MRQB 5D05A 1ZLSL 1AGFB 4ZB0A 4JRYE 4WUIA 2ZVRA 3AHTA 1CICA 1UM4L 1SLXA 3FTZA 1XIBA 3P3BA 5I1EH 2H3KA 4F2TA 4GPNA 1LDSA 2QCFA 3MOBH 5GGRY 3IEAA 1XCFA 5E03A 5IP4A 4C7FA 3FRPA 3C60B 1CN4A 1KBKA 4ROQA 4B2DD 1XIJA 3F03K 3MZTA 5C7XH 1L9MA 4HGWB 1OGSA 3QJFA 1TOXA 4NUMA 6XIAA 5E9AA 1H7XA 3OX8B 1RZFH 4HPOH 4E2VA 1LG2A 1IAKA 3CZLA 1EFZA 3IVUA 1AZRA 2F6XA 4H25B 3RPIB 2OTDA 4DN4H 5FESA 1YX1A 2NMSA 2DBLL 2R1NA 4M29A 1XYAA 1T21B 4J28A 3WDIA 4K3DL 1HXMB 5I26A 4PRPD 4JEGB 3BG5A 4KRUA 4MHBA 4WV1C 4L1SA 1BYCA 1AANA 1IQ8A 2AGJH 3Q5OA 4MNGE 1IE5A 1OP3H 3C6SA 4PN6A 4HZ6A 5EZIL 2YDAA 3FN3A 4RFNB 3V52L 3VGHA 5J13C 5AW6B 3WUWG 5E5MA 4AENB 3ZVVA 2E4TA 2N4IA 1T5WB 5KVEE 3WF0A 1LWIA 3UJFA 2J7EA 2JJSC 3VFUB 4MJIA 1F0LA 3PAZA 1NP0A 4MD5B 2XPKA 3S88L 4K5OA 3A3HA 1KYUA 4ZQKB 1SFJA 2I7OA 4AUUA 1VPQA 2HKFL 2E7CA 1AFVL 1AZBA 2AC0A 3MVSA 2P44B 3BE1H 2ZRVA 3GS6A 1U8CB 4N85A 1BQLL 1L6XA 3ULVC 1JNLH 4Y4FA 3NFNA 3DROA 4WHYH 2IQDA 4MX7B 4G6FB 3FEMA 5LQBH 3TH3T 4Z7OF 1I1WA 3M0ZA 1F1GA 3PL6D 5L0QC 1ZJHA 1OAKH 1DWFM 1C3FA 1SUJA 2DWEB 1CLKA 5AHEA 4K38A 3WCYA 3K6OA 1OW0C 4TL5A 1MIML 1MRQA 2XQYK 4AW4A 5EBWA 4RNRB 4K3HA 3W57A 5T3XH 2W4XA 4Y4KD 2XIIA 3EKZA 3JYCA 5FI8A 2OI9C 1S5WA 3N43F 4YGVB 1WGOA 3QPYA 5CCKL 4REQA 3LXAA 5E5LA 2FQDA 1ZT7B 3TONA 4A2MA 1I8UA 4WGVB 3MLVH 5INDB 1NOFA 5E0CA 4RNFA 4DOHE 2FKPA 1WV2A 2HEJA 1ZTXL 1A4MA 3LS9A 4UNKA 2DWDA 1X98A 4M0XA 4YQXL 1DVQA 3TMQA 5DA0B 5DMGC 3C8DA 5CGTA 2PWDA 4LVNB 4XPHH 4PJCE 1KV3A 4XNBA 5E5CA 4NLHA 3IDGB 3RHWF 5HHPB 3E3QC 4ELMF 1FSKB 4TR9A 1GT8A 1FP9A 4BF7A 3ZJ6A 4JLRA 2YXFA 1BXVA 1YC8A 1XLJA 4Q6IC 4ISVA 1TIWA 3UP1A 4ELKA 4CVXB 2DEWX 3A3YB 3QJSB 3TJPA 1J79A 4JZJC 2ICWA 3O6FC 4QXUH 2XYBA 2GVGA 3KRBA 3LLFA 1SBBA 1Z5LA 2C13A 3C5ZB 4P46A 3M86A 3F01A 4DJDD 3ZRSA 3RFAA 5ABFA 3PB0A 2FL5A 5HI5C 4LIQH 2EIZB 5E4EC 3O11A 5HANA 4S3EA 5IB5B 1YPXA 4PCKA 2F9RA 4B9IA 3KVJA 3V4LA 4QQ3A 1O5PA 3QEHB 1M7UA 1E2ZA 1JGVH 5E2UH 2R6OA 1F74A 2F5AL 1BBDH 1YHPA 1VPOH 2A7BA 3CZJA 1VCVA 1FWJC 3SM0A 5BS0D 4U1LA 4JK0D 1JWSB 3PWPD 5K1JA 2OYLA 4NPJA 4JHVA 4WF7A 3BLEA 4ICMA 1IVTA 5KS9E 1ONEA 3EHBB 3ARFA 3UBXI 5CH9A 3K71B 1WH0A 4MRBA 3TBTB 3RWCB 1S5IH 2DLFL 4D9PA 3UT0A 3QDJB 5D33A 4LEOB 4PJDA 5LCVH 2BM3A 3VWJA 5ACZA 4KUCF 1BZOA 2V2WB 4ADSA 4PS8A 3GH7A 3TO4D 4JM2F 2P46B 3CC5B 1W0MA 2EG8A 2ONEA 4FFTA 3T77A 1HL4A 3C75A 1OCJA 2CIIB 3EFDL 4AL8L 1T22A 2J8GA 3SCTA 1HZHH 4XNQA 5JYMA 5TE6L 3JW7A 2R1YB 4C56E 1BX2A 4M61A 4YDIH 1A1MB 3MYPA 2CO6A 1R19A 3QEUB 4XAPA 4Q22A 1KB5L 2JB5H 4B3ZA 2GHZA 4KHTL 3C52A 4QEEA 3LSOB 3NEOA 4Y9CA 5C0RL 5D7LE 1E27A 2DOCA 5FM4A 3BWUF 3P9MA 5DJ6A 2RD0A 2W9DL 3GBDA 3N42F 4M5ZH 5F6HI 1KB9J 4FQ1L 1ZBWA 2IDQA 2EDLA 3D0LB 3PBMA 2KC0A 4PE8A 4ZBCA 4Y5XB 4HPHA 4CVZB 1AG6A 5E24E 2WXRA 5GGSA 4B6ZA 4L4JA 1LO0H 1M56B 3PAYA 1J6PA 4URIA 1Y0LB 1NOAA 3AJ7A 4MB1A 3SE8L 2JELL 3QEQE 1Q6RA 2VWSA 4XD5A 2MMXA 4GS7B 5K1VA 4OZ4A 2DQIL 3SI9A 3C87A 3G24A 4OCXL 1FCCA 1QLRB 4XODA 1N9PA 2OQJA 1HG3A 2GC4C 5D7SH 1ZCCA 3MUZ1 5ADPL 3O8XA 1P4LA 1NGZA 1XF5A 1E6RA 4UT6H 4HC1H 4AYDC 5JIQA 1S38A 2DZTA 2W9EH 1I3GH 1ZLWK 3IDIB 4B9GA 3F2BA 1DYSA 3DETC 2EDKA 1PAMA 3E9AA 4JFWA 1BMZA 3WQ5A 1JXJA 5C0AE 2YPKA 2VISB 3GY1A 3RYSA 1AJ7L 1W3KA 2AW2A 1MI3A 3UTSB 5IMLA 2YRPA 5FECB 3N44B 2XTJC 1FWGC 2A7PA 1B3JA 1R3WA 4GFIA 1OP4A 3U7WL 5PTDA 5FHBH 2E7MA 2JTYA 2DMBA 1LQSR 2Y7GA 1LQBC 3QFJE 5CFAA 2B31A 2TRSA 5BZZA 5EIQA 5EZOL 2R2BB 4NQUA 1NAKL 4Z7UB 5A6LA 3KCPA 1ZJIA 4OQTA 2B9BA 3AFLA 2Y1AA 2C3HA 4GW5B 3AIRA 2ADFL 4PP1D 1IAII 3EX3A 3BSMA 1SW3A 4U6TA 1RKRA 3HI6L 1J9RA 1AQFA 1KPRB 2VDMH 4GINA 1R2RA 2BW5A 3KLAB 4U4IA 1OF8A 2WAGA 4FF5A 1F2JA 2HCVA 3A6CL 3LKNB 1IXPA 2K8MA 4FP1A 2JKNA 4A7QA 3GNML 2O5ZL 3UY8A 2CR0A 3AIUA 2UWEE 4U7MA 3CASA 3LQLA 4NGHL 2X0UA 4HEPA 5LWYL 3ZHNA 4M51A 1TU2B 1E4XI 5EGRA 4LASL 1K02A 2PMQA 2JKLA 5EPDA 2EXYC 4B3KA 3G08A 3BLIA 1Q6DA 1Q1JH 3CZUB 1RJYB 4X5XB 3TVAA 3ARBD 3VFOA 3VXME 3R43A 3VYPA 3BZGA 2DEPA 2FSEB 1QSED 1XF3B 3MA8A 2EDXA 3DC0A 4P4RA 3BKYH 5JHDD 4FYTA 1A80A 1MCNA 4KOBA 3GZOA 4XNZC 3NQCA 3U8GA 4HSNA 3WJLC 3CFIC 1CFMA 4LYRA 1EZSA 3Q43A 2NR6C 4ACYA 3UTPD 4DO7A 3L7EB 4ZMYA 3QJHA 3LYEA 1M7IB 4B4HA 4JYEA 4HJFA 4J12A 2QZ5A 2X12A 5I1EL 1GORA 2GAZB 2VN4A 3RFRA 5JUEH 4FHJA 4Z7VE 4AT6A 3MOBL 4W9LC 5DCCA 3VXSD 3MYJB 3H70A 1QACA 5JH1A 1A5CA 1MCOH 4MNKA 3H9SA 3QPEA 3P8IA 1BQHB 4FOUA 4MDIB 3H7RA 4X6EB 1UZ4A 3QJAA 4PS7A 5C09E 1RY0A 5FPIA 5C8JA 5C7XL 5C07E 4PG2C 2O56A 1M53A 2IDTA 4TVPD 1RZFL 1I9JH 3NCMA 3GXMA 5F9JA 1RK5A 1J8SA 2J9ZA 4LLVA 4DN4L 3WE6A 4G1EA 1Z9PA 2BS71 4XO9A 1WDPA 4BSWB 1ORQA 1OVZA 1D6EA 1UUQA 3HAEA 2ATAA 2QR0B 1KDJA 4JHUA 3APGA 1US0A 3A9BA 1JZ8A 1KJMA 4ZE4A 4B3LA 4G7YL 3TJ4A 4YSTA 3VQ2C 4QO1A 3WH8A 2AGJL 4YMPA 4HJJH 1HS6A 4QROA 3BQVA 3R7MA 1MHEA 4RGNE 3C86A 1ZLPA 1Q8MA 4XSLA 4MQSB 2DIEA 1W9UA 1OGTB 4XP4H 1DWAM 4UQIM 4WX2A 3BUIA 2F7QA 2XVGA 4O17A 3WQCA 2FX8H 5HMEA 1UOWA 5T5FA 2B39A 3RVTC 3WQ4A 3O7UA 4HYVA 3UXDA 1O60A 1S2WA 1R7OA 3M0YA 3EYQD 3SYPA 2REQB 4RMUA 4A22A 1SY6A 2B14A 3BE1L 2ODIA 4U1NA 1LJYA 2NX5E 5IB1B 5CZRA 4ZMPA 2GUUA 3B9EA 4NAEA 1CXIA 2DQEH 3V0VA 1JNLL 2PDBA 2EQDA 4KGJA 2IWFA 3K6NA 1NA8A 5LQBL 4C7GA 5FX3A 4HSQA 2YQBA 1HVXA 4R0LA 5D9SB 1OAKL 2ZXGA 3UROR 4GG6A 4Z42C 1QTWA 3QV9A 3C9NB 2JB6B 3L3OB 4FQXA 2X09A 1RUPL 5CHNB 1MAMH 1AD9A 3L3JA 5DBTA 4DF9A 3PWAA 5GGVH 1BVLB 4O8AA 5T3XL 4EP8C 2C9UA 5FAAA 4G6CA 4N0UA 1D2KA 5ICYA 4HB7A 4GAJH 2RGSA 4IBQA 3BUTA 5EU3A 3VXNB 4JRYB 4C5YA 4NHCH 2EE0A 5BRZD 4DSYA 3K2GA 4F9LC 2XSXA 1M7PA 1E6OH 4G1NA 1DQJA 2WXIA 4QXIA 2P8PB 1JK8A 4J40A 3GSRA 1E3FA 4NNXB 3MLVL 1CK0L 4TUJA 3BUYA 4BSJA 3L3HB 2BJMH 1VHCA 2GGEA 3LAFA 3BTNA 3FB8A 5H6HA 2MCAA 4S3AA 3MP3A 1IO4C 3UWWA 3FU6A 2Y1VA 2ZOUA 4JN7A 4C47A 1D5ZB 3GMMB 2SEBB 5CSRA 1O4UA 3KOWA 1KULA 3HV9A 3RBGA 4KEUA 1X44A 3T7VA 3NESA 4KH2A 1HE8A 3T1FA 2B16A 3EOTH 3PWVA 3GTFA 1LGVA 4OBRA 2EJ1A 5F2FA 1NUFA 2ICES 2EDEA 3H54A 1J10A 4H9VA 3M46A 4JTAA 2GVYA 1FN4A 3SDAB 4QXUL 3BYTA 4OD1H 4MNGB 5DJ0A 2F74B 3D0CA 5KETA 1I8JA 1D9EA 3JZUA 4LIQL 3C6CA 4LGXA 2OMTA 4F8OA 4XN8A 4AZCA 4UAOB 1TB3A 2Y06H 1XQLA 5FF3A 2VABA 3IIZA 3EYOA 1JGVL 4AE0A 5E2UL 3KPPA 4OJAA 1BBDL 2G2PA 4WFED 5HJGA 5CG0A 1VPOL 4K5NA 2AITA 3REVA 5KSAC 4E0CA 1L9PA 1FCVA 4Q8WA 3LRSB 3REWB 3RGVA 1ZWIA 1AHWB 4QCFA 3UP8A 4JQ1A 1X4YA 5GRZA 4Y90A 3CX5K 3GR7A 1G69A 4D6JA 4L4VD 1VKXA 3M0LA 4LSDA 3WF4A 1NU5A 3BOLA 4BFFA 2E7LA 2YX0A 1S5IL 2R9RA 5DRNA 2ZUMA 3FA3A 4ZMXA 5LCVL 4PCSA 4AC7C 2O6CA 3FF7A 1QFPA 3IF1A 4A2RA 5C2XA 4DJEC 4JZNA 4DN1A 3GVRA 3QI9B 1WUFA 1UH2A 2DWSA 4RZ5A 2AJSH 5D1XD 2QNEA 1HZHL 5K39B 2XG4A 1TTBA 3MFFB 2EUVA 5AYQA 1CD0A 3HE6A 3HS0B 2G41A 4D9RE 4HJSA 4HS6B 4YDIL 4Z3TA 1WDAA 1AS7A 1U5HA 1TPFA 2BTMA 4QHKJ 3CDZA 2Q87A 2JB5L 3E6EA 4K5PA 5KEZA 1W3LA 1IM3D 3DVGA 4PB3A 15C8H 5HYSA 5I66B 3IETA 1MJ8H 5FW7A 1NFKA 1FWIC 3IJSA 4QJ4B 4BCEA 1ZA3A 3SGDI 1AHMA 1E0XA 3EAKA 4JHWH 2HJFA 4M5ZL 4GB9A 4RNJA 2CZFA 3W0WE 5CLWA 3KTXA 1N8WA 3H56A 3E6FB 4AWTA 3QIWA 5CBIA 3DYOA 1AY1H 4AEIH 3EFOB 3BEWA 4RWHA 4DZ8B 1ME8A 3DSFH 4P3DB 1LD9B 2K1MA 2IKJA 2WXNA 4PTWA 2BASA 4PJCB 5MHSE 2C7UB 2YD3A 1JMZA 3QUZA 2GLKA 2NY3D 4Q4EA 1VEOA 4Y8DC 2E5EA 1E5BA 3RWDB 2VMJA 1NH6A 3J7HA 4BFBD 1BOGB 1LWHA 1OT2A 5D7SL 4FFWD 1EBHA 5D7KD 1KCLA 4HC1L 1MO0A 3QQDA 2W9EL 1I3GL 3FU5A 4PW4A 1QI3A 3ESPA 3MJGX 3APMA 5BQDA 2FZ9A 1UQSA 2ICEB 4HKXA 3D39A 4LKXB 1VACB 4C1NA 3CV5A 4G42A 4S0SD 3MKKA 3RM4A 4OFYA 3F12A 3H4FA 1UOKA 3WX7A 2YAQA 3NM1A 2JJTC 3ZJAA 1SSDA 5E8EA 4MNQA 4FEZA 4X5WA 5FHBL 4QT5A 1MEWA 2GTWB 1GOQA 3TU6A 2QPUA 2JJUA 2Y5EA 4LLYB 4KVCH 3U1QA 3LDVA 2O4EA 1V7NH 2K3TA 4W9EC 3KDMB 4AHPA 1W5OA 3CQJA 4U0RC 4KXDA 4RDBA 2HPOA 1Q9OB 5KS9B 4R85A 3EBHA 3S34H 4ZFZB 4H1LA 4DGWC 4HN4A 4BI7A 1SF3A 5EUKB 2K0RA 4ZA0A 2Z35B 2PP1A 4DUVA 3GZ3A 5IW6B 1L5GA 2OT1A 4QG9A 2VDML 4WHTB 1YG9A 4QD2E 3FCBA 4BYHA 4JFOB 5JHMA 2NQ5A 4XAFA 5JPMC 3JV6A 1H41A 4HIIA 1YXYA 1I7TB 3M17A 4OGAC 4GYFA 1F11B 4AQEA 4LOUD 5HGAB 3INPA 4XI5C 4IIGA 1AI1H 2J7HA 3U2ZA 2VERN 3MBFA 2JLPA 1ITCA 1PAZA 4YPJA 4L6OA 5JXEA 1YC7A 4EDXB 3ECWA 1MHHA 2X4OB 4Y2DA 4UILH 1Q1JL 1DQXA 5D7LB 1KEMH 1JP5A 3GMQB 5AYTA 1AQMA 4GRWH 3VFRB 4DAGH 4ZO8A 3CFMA 3ES8A 1JGIA 3BKYL 1OAYH 3LMJH 2A99A 3OF6D 4NPYB 3LGDA 1BWVA 5H8MA 1VJIA 3VINA 2ATPB 3DX5A 4YHPB 4PS3A 3QEQB 2H8XA 2HE8A 3HBQA 4BUQA 4UFLA 1QFEA 2G2NA 1HCVA 3B56A 3PQYD 3MKGA 5JUEL 4ABWA 3AU2A 5IQ9A 1AR1D 4AZHA 2V2XB 4X7TA 2OL3B 4HWBH 1W37A 4X6DF 1MCOL 1M9HA 4PU2A 4QQUA 3MOAL 3BQUA 1I7ZA 1HQRB 5TF1H 4NAQA 1JTPA 5CZSA 1EOMA 3ALPA 3MBDA 2ATMA 4J5NA 5K59E 3T81A 1BQHG 2GKIA 4L1WA 4K39A 2IXQB 5CBAB 4C57C 5C0AB 1I9JL 2W0LA 3B4NA 4L4TD 1QHQA 3NFPB 3CXFA 1VPXA 4FJ6A 1Z5YD 4YUEH 2XBZA 2WNGA 4WSKA 1QT1A 1UZ6F 3UG4A 4AYID 5TIMA 1YEHL 4XHJD 1EHNA 4MGXA 2XRAL 4KKRA 4GBXB 4O12A 3V0FA 2ARJA 2F6KA 2X3CA 3M7FB 4HQVA 4PC8A 3ULUD 2EXWC 3VCLB 4MWFB 2VRKA 3PF3A 3QFJB 4HJJL 4GISA 1QSFD 2R0ZH 1E4XH 3N1AA 1FGVH 4EVNA 2EO9A 3WL9A 3GLZA 4MM1A 3SOTA 3FZUC 2WWDA 4FOKA 4KO6A 4FCHA 5KTLA 3W7PA 2RB8A 4WUKH 4X4YB 5BUPA 2VZUA 5L2KD 1EZUA 2FX8L 4GYPC 3LA4A 2XIOA 1XEUA 1RHHA 2HN7A 1JXDA 4CKQA 1OM3H 5EFIB 5HULA 4XP5H 4IX2A 3ECVA 1B4TA 3MV9D 1RZQA 3ABRA 5HK4A 1YXCA 4FNLH 3REQA 2EE3A 2J6EA 4IRJC 2HROA 3F6LA 2DQEL 4NAFB 1XLLA 5AW9B 2VP8A 4Y2LA 1U36A 6REQB 2UWEB 1OFDA 5C0FA 1YDYA 3UCDA 2OMWB 1QDSA 4GAAA 4XBMA 3QPZA 1TLMA 4M4RA 2XUCA 3ME0A 3EBAA 3S2MA 3S47A 3S2AA 3SJVE 3BZFB 2C71A 3ZYIA 1HQ4B 2C3XA 1KELH 3VXMB 1MAML 4RE2A 1QOPA 3OOQA 3AY4C 3AT9A 5GGVL 3AXMA 3NK4A 2YQ3A 4D0BB 3OWRA 2B15A 3QFGA 1GPWA 3CSYB 4D8AA 1J48A 1WA0X 3IS0X 1S5TA 3AITA 1TX2A 4Z3IA 5KYWB 4GAJL 5CEYA 3OSVA 2CXKA 1UZ1A 5FV1L 1AUSL 4NHCL 1Q6QA 4WWPA 4IU2A 3TBYB 4UM8B 2BIQA 2WWKT 4V27A 4LX4A 3GDMA 1HHIA 3G6MA 5HI4C 3PB2A 4LRIC 3GSOA 2NV2A 4YAQB 4Z7VB 3TIDA 2AERT 4G1KA 2Y85A 1G7PB 3FH8A 1U8HB 1AG1O 2AEOA 4WW2B 2DV0A 3SPIA 3FDKA 4YFEA 2VFFA 4KWWA 3TN0A 1OAUH 5C09B 5E2JA 4AXKA 4R2GD 1GYLA 2B59B 5ENLA 2YDQA 5HQMA 5C07B 3HJZA 3FQWA 3V5OA 1CF8H 4LVHC 4ZNEE 4FZ8H 1W1VA 3L7FA 2CIPA 3VKJA 1S2UA 3NPWA 3EOTL 5J11B 1F4YH 3SDDD 4WXZA 4EOUA 3RHGA 2AF2A 4JBSA 3C0JA 2C4FU 4C58B 1ZHNB 3PHQB 1N59A 2E5DA 4WDIB 4E4PA 2FGWH 2VLLA 1A7RH 3DG7A 2VQTA 3H6OA 2HWZH 2WSKA 1WBYA 3N2TA 1EOKA 1PG7X 1CZ1A 1SVDA 4I18C 4LLDA 4B5ZA 5D7JD 5FEWA 4RGNB 2IH3B 3VFNB 4JJHA 5FGSA 1PKNA 3W28A 4WGWB 3MCYA 4BFJA 5ISZD 5BZWA 1DTUA 4O18A 1HYSC 3IDMA 5BUGA 5DDHA 1UWSA 4DWSD 1F56A 5LJYH 3GXUB 4GXUM 5SWQB 2CGYA 4BK4A 1PGRB 4O58H 1IM9A 4PRHE 5LUMA 3GBEA 4G8GE 1TPXC 1IC7L 2NX5B 1LE9B 3G5ZA 1Q5MA 2ENSA 1F7BA 1A7QH 3CMFA 5J6HA 1S6NA 4W5UA 4I3SL 5C6MA 1JRCA 5C9RA 3OMIB 1QQDA 2B08A 4QJ5B 1FVCA 5I6PA 1N12A 2ZX5A 1Z9NA 5HGGS 4M7SA 4OI7A 2A74A 3KP0A 3TPUA 1AG0A 2ZG1A 5I6KA 3JTTB 4Y4HD 4RZCB 4HH9A 4JQAA 2AJSL 3CBWA 1OD0A 2YCLB 4QRPA 1L8PA 4Q2ZB 3KPQB 4HK3N 1CFVH 1KG0A 4GC3A 2P8LB 3CVHA 1CB2A 4PR4A 4IBSA 3V5KA 3DO4A 1NC2D 4E6MA 3P4OB 2Z27A 5FUZH 3L68A 4S2BA 4MVBC 2YGVA 15C8L 4MZ3A 2Y8UA 4M62H 3MRBB 4S1QH 2DJLA 5CP7A 4AIZA 2FWLB 5ALCH 3MR9A 1W6TA 4JHWL 3RY4A 1RK1A 1UP3A 3HZKA 3Q2NA 3PXHA 4CU6A 3EYUH 3NCJH 3CUFA 2A1WH 3C6EA 4N6RB 5DY2A 3ZDZF 1AY1L 1P69B 4AEIL 4YS1A 1DQLH 3ZTEA 4NYUA 3WIFA 3RY6A 3DSFL 3W7CA 3UPRB 2FE0A 3W9EB 2F54A 1OGAA 5RUBA 3HB9A 1XSIA 3DBPA 3OMAB 3PP3H 2PMZA 1H0DA 4X4KA 4PJ9B 2VR7A 5ANME 3EGXA 3D5HA 3AWEA 5F97E 4B9ZA 1EFXB 2PTDA 3PDOB 4FAAB 4ELMA 5AYYA 5F7NC 1PZ1A 4JPWL 3L0GA 3RZCC 5CZKA 1IGWA 1U8JA 3QHTC 5CKGA 4DPRA 4QE5A 2WMFA 4DT2A 3B7RL 4WK4B 2NXYD 3AIQA 3O6AA 1US3A 5A16A 2YA1A 4JDVB 4X7CC 1GOOA 3B9KD 2IFFH 4N90E 1XGUA 1OG6A 1IBGH 1HXKA 4DBDA 1NC4A 1V8HA 2E6QA 5DXYA 5HHVL 4L8SA 1DWIM 4WU5A 2XU9A 4KVCL 1V7NL 4OCMC 2BY2A 4V1DE 1A1NB 5HMSA 4OLVH 2YXXA 5IR1B 1DJNA 2PF8A 5KVFE 3GRGA 1E2VA 3S34L 2NY4D 2Y62A 4AV5A 4FALA 1KT2A 3US1A 3SGDH 4BWLA 3S5OA 1W80A 3GX9A 4Y16D 3U6RA 3HB3B 3LSCA 4LSBA 1I1AB 4HG4K 4DJMA 2ZICA 3MODH 1IXQA 3N19B 1QRNE 3HKZA 1IAOA 1NMCB 5JPNB 4X0VA 2AQTA 1ZHAA 5E00A 3D48R 1YUHB 1I1FB 2CPCA 4J23A 3HBPA 1VCBC 6ENLA 2FJHB 4JM2A 5KSBF 2V37A 3K74B 2R56H 3AREB 4UTUA 3P3YA 3KPRA 2E7HA 3MV7E 5BXFB 5I18L 4GVGA 4IGMA 5CEZE 5JHAA 3KW8A 1S5VA 3OKYA 1HJUA 1ZJAA 3W1UA 1P0DA 3TZVB 5HGBA 2A6IA 4UILL 1NEZB 1LO2H 2X6VA 1KEML 5D96C 1BM3H 2XN2A 3AG3B 4LUYA 4R97B 3B3DA 4NBZB 5AW3B 4Z77A 3H6AA 4DAGL 3RQ3A 2JQMA 2HZGA 3WIJA 4I7WA 2HJPA 3BDXA 3T0AA 4ENEC 3W0WB 3D2UA 3AQXA 1SVCP 4HPGA 1P7BA 1OAYL 3LMJL 1NJ9A 5DWPA 3U5YA 5TH2A 2LFGA 4PVMA 3TBWB 3PC0A 4B95C 4P9MH 4TUKH 1M1XB 3DUHA 3AVEA 3A12A 4KJYB 4LEXL 3XINA 2YXVA 4NQXA 1S9VA 3P30H 1RUKH 1RZJC 3CB8A 1PZAA 4QWWC 2XIBA 4HWBL 2NYZA 1AD1A 5DZVA 3GMPA 3ITOA 1TETH 5BJTB 1JYXA 1M7XA 1DQMH 3SPJA 3QWOB 2HG0A 3RVUD 2BOBA 2YPLA 5DVKA 4KHXH 3HPJB 4NQCD 5C71A 3S4SB 4YUEL 4IFOA 4IQEA 1CDBA 5DJXA 2EP6A 2DIAA 2YAHA 3BPNB 1CBVH 2Z2BA 2WJDA 1RURH 4OV9A 5BWFA 2A3BA 3BPCA 4P2AA 4FHAA 4YCOA 1IT8A 1G4MA 1IFHH 2R0ZL 1K3IA 1E4XL 2F2HA 1IKNA 1FGVL 3SDCB 1GC1C 4KFMA 1TFPA 4ALAH 3DTUB 1T1YA 2VDQB 5CGQA 3R8QA 4GH1A 1FA2A 1T1ZA 1ZT1A 5GRVK 2KT6A 1HWHB 3K3QA 2CLIA 3MV8A 3LRKA 5D2XA 5I17A 4IKJA 4XP5L 1WC7B 4EDWH 1OX5A 2ISSA 4I8DA 5I8OH 2HH0L 2MCG1 4ZRGA 3HG2A 4FNLL 4ZO6A 1U83A 2EO1A 5FHAH 3ELFA 5JOFA 3UR5A 3VD1A 2EIDA 4LHUB 1ENUA 4LC8A 1P53A 3KPOA 2VDKB 3HMXH 1OWRM 4GRWB 4QRSA 1D8CA 1L8NA 1R2SA 3QDGD 3MQIA 1V54B 2XFYA 3RLUA 5DQPA 4L4PA 5EFDA 5FGCE 3VNLA 4Q4MA 4AQZA 4UIKH 1R5IB 4Z2LA 4B3EA 3ZKXC 3I4EA 5A94A 2EYTA 2LLGA 3QIBD 3WLQA 1KBJA 4XB8A 3KJ6H 1MFVA 1OQFA 3MNMA 1KELL 3KM8A 2X1RA 1P7TA 4HX1A 1XGEA 3W11C 4XN5A 1F1DA 2FZ8A 4QG8A 1OP5K 3T2QA 4YXHH 2BP5M 5CINH 2W6RA 4I0PB 1QFHA 3ALXA 3H7BA 3RM9A 4UTLA 1E5UI 3ZTJH 3C3NA 2YCIX 3LI0A 2PCYA 2V5SA 3IIVA 4UFMA 4APQA 3FJ4A 4UOQA 1GJIA 1OK4A 1A4LA 1IV8A 2ZQKA 4X6CE 1P84J 4QG6A 5B1JC 3WS6C 1G4EA 4JGNA 2R4SH 3W76A 1OAUL 2QHAA 2AJZA 1RD6A 3B2VH 1Z0NA 3UQNA 2WMPB 1N5AB 2V17H 1A6PA 1NCCH 1CF8L 5J6GA 5B1AB 4N8UA 3AG4B 4PV1C 1FBIH 4G6MH 4IIQC 2YD5A 1JUKA 1F4YL 3HR6A 4ZYKB 2WHJA 1QZNA 1GZQA 3NPSB 3BIKA 4UOZA 4HHHA 4UUJA 1JD9A 2B4CH 2FGWL 1A7RL 5A8PA 3QB7C 5ETUB 4O0ZA 1FIEA 2HWZL 1UEMA 4GFXA 3LBMA 4OF3A 5I1GH 2G0LA 4JHOA 4JHAH 2XISA 3W07A 3MGOB 1ZAJA 1JNEA 2BERA 1IXNA 2C4XA 2Q0ZX 3NVTA 4YE4L 3A22A 3CHCA 3NL3A 2MANA 4O58L 4QLJA 3V1PA 4LOVA 3T4AB 3Q2WA 4RMTA 4Y8AA 1Z9LA 2X4SB 1A7QL 2Z29A 1GMEA 2V82A 1Q3NA 4IUGA 1UKQA 5FUCE 1JUFB 3PWUA 3SCMB 2HJLB 3T65B 2RIKA 1DANU 4P57B 3NQ6A 4BH8A 1B3ZA 2CKBH 4XWOD 2ZUQB 4NN6C 2RKXA 3SJVB 4QNEA 2QQNH 2RFXA 5HY9A 5I6OA 4PBVC 1TDQA 4UR7A 3LKSB 4WI8A 1UUMA 2FJUB 4PRAB 4OB5H 5GGSY 4TLSA 4K7PH 3LYRA 1CFVL 1E40A 3WXVH 4Z7WF 4IL0A 5HSFA 3GK0A 1KZQA 3CSPA 4RE0A 5TF0A 4DP9X 2L3BA 2Z1XA 2F1AA 3ECBA 3GSUA 5FUZL 5E6RB 4GEIA 5KBKA 3RJDA 4M62L 3D08A 4S1QL 4E68A 3LKOB 2PETA 3VDBA 2B7OA 5ALCL 1YTDA 1WBZB 1TA3A 4TUFA 1U2CA 2AL2A 1UP2A 1B3YA 5IB2B 5F6IC 5KVEH 4NZCA 4ODXB 3NCJL 3SE3C 2A1WL 2C1OB 1QFUL 3FUJA 2Q8ZA 6XIMA 3AAMA 3INUL 3LQAL 1DQLL 2VC7A 4G83A 4AXNA 2NY1C 2H0PA 1NDMB 2AFNA 5DJYB 3UZXA 4HCHA 3QXAB 5DEGA 4XH2A 4DFHA 3VX0A 3UAAA 4C83A 4OFQA 5AB3A 4O4YH 1VZHA 2WW5A 2VOTA 2XQ0A 4JQXC 4XD4A 4AVNA 2VEKA 2OMVB 2BP8B 4MWAE 1XDTT 4GXMA 3HZ3A 3KCJA 3IVSA 2HZHA 5D7IF 2VXVH 4ODSH 4KKPA 2WVVB 4UTWC 3PGDB 1LK3H 1HO4A 3A67L 1MVFA 3ARDD 4HFWA 3A13A 1TJGH 5I6NA 4G9FA 1MFNA 2P48B 5C7VA 2IFFL 3MRIB 3FOLA 2HK0A 1IBGL 1UVQA 1BD2A 3FU7A 4JJ5B 3U2OA 3L3DA 2ZZ7A 4FFYH 3K46A 4ZDHA 3UXFA 2PR4H 3CQKA 3MBEC 1QSVA 5FDYA 3MRRA 4PRHB 3AU1A 3MUHL 2I7SA 4LL9A 3BLFA 5FOBA 3N17A 1PB0A 3FQRB 4QS6A 1U8IB 3PNWB 3WEBA 4H0HB 1J8HE 3NVDA 4PTMA 3H4GA 2PI6A 4G6FD 2NUTA 1QWUA 1OFPA 2QSTA 3OWEA 1GKEA 1S4IA 5E0QA 1F3JA 3MODL 4U1MB 1TELA 4XUYA 2BIMA 1U8LA 4LCQA 3BAYA 2NW3B 4O1FA 1SXAA 4UM9D 25C8H 3VG9B 3VCCA 2R56L 8TIMA 1FWFC 4CDGC 12E8H 1KB9K 1M5WA 3WF3A 3LN5A 4NXKA 1J88A 4GUQA 4KVNH 3QORC 1S1RA 1YEGH 4Y5YC 1XGDA 1LO2L 1QP1A 2KLTA 2O9OA 1NWOA 2ZX6A 4WSJA 3U0TA 1PWLA 1BM3L 2VX7A 3QQ3A 2WMGA 5BNKA 1NPNA 5EEUA 3WGUB 3KRZA 3TO2B 3G1RA 3G1AA 1NEZG 1JPHA 3UXAA 2UXFA 1TJPA 5DT1H 3SY8A 1HKIA 4Q0XH 5KN5B 3BP7B 3C09C 4PUJA 3WD0A 4P9ML 4TUKL 5JW4M 3IS4A 1KLGA 5D72H 3BO8B 1DEEA 2NQ3A 3QNYA 5JIIA 2CJTA 1RJCA 5ESVB 2XWRA 3P30L 1RUKL 3NQKA 3UBXG 4X9IA 2OJEA 3PJSA 5ANMB 3HC4H 4RV3A 3W81A 3HQOA 3QYCA 1QOQA 2HPIA 3RWGA 3BN9C 4HS3A 1TETL 1OFBA 3Q2DA 1DQML 3P0GB 4I7VA 5INCB 3V16A 4LYPA 5F0PB 3C5ZD 4HTBA 3Q8BA 2NW2B 4KI5D 3VOJA 2APBA 4J6IA 3BJTA 3WG6A 2WXLA 4KHXL 4QHMA 3ZVHA 4CD7A 3G3MA 3V8CA 1MWAB 2KMWA 1U95B 5D1QA 3TBBA 4OF5A 4QOKE 1PKQA 1S7SA 2DRUA 1GQKA 2PTXA 2ZWSA 1BQKA 2EZ0D 4AGNA 3G1FA 1M71B 3S4SG 1RURL 1ZMYA 1GW0A 4OUIA 1RAKA 3OPZH 4NHVA 1LOLA 1SNRA 3MU3A 4P5RA 1AMKA 3IJEB 3NYZA 1OGPA 1IFHL 5L2JA 4V1DB 4RCAA 5DYFA 5C0BE 5FCSH 4ERSH 4ALAL 2QTEA 1BGGA 1KCUH 3QQ0A 3EHBD 1BZ7B 2W07B 5C9UA 4GVHA 1TJHH 1A4JB 3QDJD 2F58H 5GGRB 4I9JA 4I0CC 1LUCB 3ZTCC 1FX6A 4EDWL 1QRNB 1HEJC 4RE4A 4NQDA 5I8OL 3AT0A 3ZHFA 1LLOA 3HS9A 7PTDA 2OL3H 1FJ1A 5FHAL 3SGUA 3ENLA 1BGXH 2QZQA 3NSXA 4P2OA 5I9QB 3HMXL 1JN6B 1KTDB 2YKLH 3MV7B 3P9WB 1WOBA 3IJYA 4GW1B 3FK4A 2WUCH 1HOCA 4FMKA 4XMZA 1W56A 2L7JA 3B3IA 1YNYA 3N0AA 3LRHA 1T5XA 2W0FB 5EMKA 4N2DA 5I3GA 4UIKL 1KBWA 3L23A 4MY1A 1IYXA 1F58L 3P1VA 4Y9PA 3ROOB 2Z6IA 1HIMH 3VD0A 1W1B1 5IREA 3IARA 1KTLB 3G1XA 5B8CC 3OXRB 2BZ7A 4IOFD 3HF3A 5E94A 2GWNA 4YS4A 3OR7B 4YXHL 4F7MB 1CIUA 4PUKA 4IISA 1JUEA 1D5MA 3WQDA 5CINL 1ICTA 4F0KA 4N2KA 4D7PA 3KGTA 1BF8A 1R9XA 5D7EA 2FNBA 3BJSA 1AGCA 1OC7A 2CHZA 3S4TA 5D1ZB 2JJWA 1U1JA 2QV4A 3RRQA 2PO6C 1JUBA 5JORB 3ARGB 5E6ZA 2X4RA 4FAMA 1I3RA 1SYSB 1Y6NR 3OEXA 3B2DC 1VYPX 1OTSC 4LDOB 3UWUA 4X6DA 5CZTA 1Q94B 3B2VL 2V17L 1OT1A 1NCCL 3SN4A 1WWBX 2ZA2A 1FBIL 4G6ML 1A50A 1S3TC 3M88A 3UTSD 2CO2A 4CD4A 5A2KH 4H7ZA 3BUBA 4K4KA 2B4CL 4MNHA 1QO2A 1I7UA 4HDIB 4PREA 5D2TA 1XL4A 5CF3A 4JFHE 5H35B 1EZVX 4DP5X 2EABA 2Z8WC 3C12A 4RRPM 3ILPA 1ZS8A 2GTZB 4F37K 4JHAL 2PTWA 2CUHA 4LGRB 3P4NB 3HMWH 3EWUA 2PXYA 5C0GB 5CZXC 2Q8XA 3EJZC 4ZXBD 4L0PB 4KWUA 2VX4A 2X6UA 3WFBH 4PQXA 3QZWA 3L8QA 3MRHB 4HPOL 4UBDD 1RZKC 3CH1A 4RAHA 4DI8A 3BSZH 2QDWA 4L3AA 4DHGA 2BSSB 2PKDA 1ODUA 2BCKA 2E9IA 1JWMA 3LKRB 3MMEA 3QSKB 3DJSA 3C2SA 4K5LA 5IJVA 1OFOA 2XZ9A 1D3HA 2FNWA 1FQ9C 4HUXB 2CKBL 2DZEA 2AABH 3DRTA 2QQNL 1YHTA 4LUSB 5HJXA 5KYYB 2IJ0C 4WSGA 2BOCB 3K4DA 3DFOA 2WBJA 4K7PL 4KRZA 3CXDH 4GG8B 4LSRH 3WXVL 2ZKMX 1G7LB 4GJIA 1DHPA 3ERPA 3BOVA 3FTGA 3DXAA 4OTKA 5DVLA 1F3EA 4PRBA 2CHOA 3I6LE 1LE5A 1CGUA 3BUPA 3KVPA 3NZPA 3K0WA 3BC9A 3C2VA 2C0AA 4JQ2A 1BAFH 3Q5TA 4GQ0A 1PEWA 5KVEL 3CAQA 3TTEA 4KKAD 2HT4D 3Q2VA 1IC5H 3FRUA 2BDNH 4X6CB 1TCRB 3HV8A 1TTFA 4ODUA 4FA7B 4AEEA 1O7VA 1I3VA 4QCIA 4EI5B 3FBQA 3IJHA 3DVIA 3AAZA 3H6JA 4S2SA 3ANVA 4P2RB 4JL2A 2X2GA 2VDNB 4IOSA 1KV5A 2BSTA 2B20A 2Z91A 3RL2A 2DQCH 4HALA 2XI9A 3N91A 5KBPA 1BIIB 2XWXA 4O4YL 3K1GA 1DZBA 3UXKA 4DAFA 5LDSA 5DF0A 1FLRH 4ONGH 3VAVA 3MRLA 5ACMA 4J3OF 1P2CA 4EQ2A 5KOMC 5IFJA 2VXVL 4ODSL 1H5BC 3KLQA 3ILEA 1TV4A 4I9WE 1LK3L 4NIKB 1IC0A 43CAA 3IWVA 4U6HB 4B27A 2O5XH 1TJGL 3AXLA 1PQZA 4HIJB 4G8AC 5ERWB 3VTAA 2EACA 1CG9A 4PMEA 2VM8A 2DH2A 1UA3A 3LK6A 2BC4B 3HG4A 4B9FA 3SBWA 4DF2A 3KNBA 2VITB 4FFYL 4LL1A 1Z7JA 2WP3T 3K6IA 2AZUA 4BDVA 4XPHL 3ITTA 1CDIA 4NENB 1NWPA 1J0KA 1WCBA 2ZXWB 2CKBB 1N0LB 4RSVA 2AL1A 1PDKB 1R6WA 5EBMB 1UB3A 2DDQH 5XIMA 4YNGA 4QJ3B 1TZIB 4QDPA 1KFAH 5DHEA 3HVNA 1QKZH 1ITXA 2APWA 4F0HA 2VLME 4KDWA 3MRGB 1LQ2A 3FSOA 1KIRA 4MY9A 3L54A 4ZPVA 4JKWA 1X5ZA 25C8L 3GKWH 5C7ZA 3IJ9A 4PMOA 2C9XA 3E74A 3SJNA 4OVVA 4MCZA 2HWGA 12E8L 1H3PH 3LNIA 1VP5A 2CLKA 1OCBA 2ZOOA 2PPDA 4L3EE 2OSLA 1ZHLA 4KVNL 1P5VA 2DWTA 5LA2A 4TV3A 2XKSA 3QZOA 1YEGL 1EO5A 2FJGA 3K2KA 3RDTD 5KBDA 4GAYA 3I3EA 5TK2A 3AC0A 1ZP3A 4CN6A 4R90H 1CFNB 4NZ1A 1A8JH 1M05A 3ZO9A 1DSWA 5IEHA 1SHXA 2WP3O 3OG3A 3HN8A 43C9B 3SCPA 1GKRA 3D69B 5DT1L 4G7QB 2WM1A 5BCAA 1FL6A 3C6LD 4Q0XL 4OV5B 3S1VA 2NXZB 4YC2C 3IDJB 4TTDC 4Y1AD 3KDPB 4JREB 5DR5H 2XWTA 2HT2C 3CBRA 4PHZA 1CB4A 4JTLA 2YRZA 2ICWI 1HKWA 4GIPD 3STCA 4E0RB 3HC4L 3V2AR 1SFLA 4MWAB 3B97A 2APTA 2HBVA 2HKHH 2D3VA 2XWBB