1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
molecule keywords alpha-galactosidase
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
1PCKA 1LWHA 1JDCA 2VT0A 3OIXA 1MZHA 1YTKA 2GQAA 5EYWA 4GO9A 3D50A 1W56A 4BR1A 2TMDA 3S42A 3LV5A 1UD8A 2OJPA 1QAPA 1NF0A 4UZSA 2ZICA 2UV8G 1G67A 4WF7A 4DF2A 3VU2A 2A1YA 2WJZA 5DY3A 3O63A 1I75A 1PIGA 2Z2UA 3TXZA 4X9SA 1UD6A 4CQ9A 2RDTA 1YTDA 4AW7A 2Z6JA 1IXNA 1PV8A 1VLWA 1KM0A 1YXYA 3ZR4A 4AWUA 3C2FA 1HUVA 4UTJA 4OIFA 2Z1KA 3MW7A 3IV3A 3W7GA 5AYZA 2GOUA 3PG9A 4K8HA 4HOWA 4CCCA 3AJXA 4JY9A 2ZDRA 5K4ZA 3II1A 1VFOA 1KLYA 3BGGA 5EBUA 2CLHA 1GG1A 4R33A 3OLDA 2I1OA 1ME9A 1XGZA 4UC5A 1QNVA 4UIOA 2DJLA 3LBCA 3DFNA 1EA0A 2F1AA 4PCSA 3CT7A 1CPUA 4OU1A 1V3KA 5AYXA 1H1ZA 1AL8A 3M16A 1W31A 3N34A 1K8XA 1GVOA 4A2RA 3WFZA 3TAOA 3BV4A 3EDEA 1WZKA 2EHHA 1UD4A 3BUQA 4YCPA 3ZWTA 5CGQA 4GUIA 2YFOA 5F2MA 2FH6A 5BNKA 2E0PA 1OFOA 5AHLA 1QMLA 1NOFA 1AMKA 4YMZA 4AHOA 1H5YA 1O4UA 1SO5A 1D3HA 1SSGA 2EF9A 1CXHA 5HR7A 1OX4B 2VEKA 1OT2A 3UXAA 2VNCA 1B0IA 1GWJA 4HOZA 4UTKA 4CCDA 1TYGA 4Z1DA 5LGXA 3WENA 4O53A 4LV4A 3A47A 3DENA 1A5CA 4ORMA 1CGVA 1QW8A 3NG3A 2YA0A 1DHPA 3UCQA 3MP5A 3VNYA 2ZX8A 2I9EA 4PTNA 4JN6A 3I68A 3EWUA 4WUIA 3ZFHA 3NQ6A 4HP5A 3W07A 2F7OA 5KZMA 2NX3A 3NZRA 1JFHA 2W79A 3HO8A 2YW4A 5EKYA 3QF0A 2A6NA 1KXQA 4ML9A 2J6XA 2Y62A 2V2HA 1MW0A 2E6DA 2V0TA 3K8KA 4UTMA 2C15A 4IMGA 1XUZA 3TXVA 1CGWA 1AQMA 1JF5A 3BARA 3FIGA 3PBWA 3PF3A 3LCXA 1K3UA 5K9XA 1N8FA 2ZXAA 2NWSA 4LW7A 5LSMA 4O1DA 2A7RA 1I2RA 1JVNA 1W9XA 3NPVA 3WMSA 1FDYA 1UH2A 3BPWA 1HG3A 2ZA2A 1VFUA 2YDAA 4GI6A 3O1NA 3FS2A 1VYSX 3EWZA 4JTJA 2Y24A 1TMHA 1D9EA 2QMJA 5KZDA 4ZZ9A 3MYOA 1TREA 3MI3A 4MB1A 5BMWA 4B9ZA 5TQLA 2ZBTA 1SW3A 4FNUA 1YDNA 5EL1A 3LTSA 3W7JA 1SMDA 2GQ9A 2BXZA 5K2ZA 4HT3A 2Y85A 2A6LA 1JJKA 2A21A 3W74A 3TU9A 4Q32A 3JR2A 4O18A 1O7DC 4EF8A 5AHEA 2QDHA 1PHQA 3FKRA 4IWWA 2TPSA 2WVVA 1G7VA 1PHWA 4S2BA 2OT1A 1MXDA 1R33A 4U33A 5FF7A 6TAAA 2ZUVA 2EAWA 5MHBA 2WCSA 5I3KA 1AMYA 1SQ7A 1RD5A 4PL2A 3TSBA 3NA8A 1WYIA 4PEEA 1IXQA 1X1ZA 1G4EA 5DCDA 3L4VA 3W2JA 5D32A 3WJXA 5HULA 3NO5A 4J3SA 3UG3A 2ZX5A 2B7OA 2DZSA 3B05A 4OV4A 1CIUA 1OX5A 2Y5EA 1V3LA 4H4IA 2GVLA 1R30A 4UQAA 1HL9A 3P5ZA 3M41A 4GRSA 3AMLA 5D2WA 4HSOA 4JIPA 4AAJA 1GJUA 5AFDA 1NAL1 1BWLA 4DBDA 5HXMA 2QKFA 2ZZ4A 1WP6A 1BAGA 3FKKA 3S5OA 4BFAA 3W1XA 4MVAA 3HF3A 1JQVA 2HSAA 2ZRVA 2C3ZA 2GJNA 5CZSA 2PWEA 3IRDA 1OSEA 5E6YA 3SFKA 3BSHA 1IZKA 2E6FA 1R75A 1C29A 3UG5A 3L0NA 4RJEA 2YR1A 4MYXA 1GVIA 4AYGA 3OVRA 1JXJA 1TJPA 1XCFA 1UD5A 2V30A 4K6AA 4GQRA 5AOUA 3L2LA 4RCXA 2FPTA 2F7RA 1JCMP 1WO2A 1OYBA 2GJLA 3MHGA 1W5OA 4J28A 3M6YA 3RLUA 3HG2A 1KWKA 1V3MA 3I7QA 1BVZA 2A4AA 4ADSA 5AHIA 2C19A 5DY2A 4JX4A 2ZXBA 2KZHA 4HKPA 3BUIA 1TCDA 1L9WA 3QRHA 3GNNA 1C9DA 5J5RA 4HA1A 1GVRA 1WBHA 3DH7A 4PEKA 3NL5A 2ZE0A 1JUKA 3CTLA 3T78A 4O16A 2ZX6A 1TQTA 1JRBA 1OFDA 4FLQA 3BCFA 4HN4A 4PFMA 4PC8A 4UTWA 2JGYA 4MFDA 2V2DA 3W7HA 2H8XA 1VGAA 3GIYA 2EABA 1T8XA 4Z08A 3VMOA 4Z0JA 2WC7A 3M5YA 3KFTA 2LLEA 3IIVA 3SIZA 2GUUA 3S8HA 2OZ0A 3S0CA 3OG3A 3CIWA 4K38A 2B4GA 5A2CA 4WSKA 4K36A 4O50A 5E70A 4JFTA 1KB3A 5FEXA 3HOJA 4DF1A 1MO0A 1G69A 3B06A 4Y8FA 4FNTA 3OLGA 3C0JA 1TV7A 2WSQA 3GYEA 1TMQA 4GQQA 3RU6A 5F4XA 2ZFAA 4GUFA 4A2SA 4JTTA 4HNUA 2TYSA 3P5YA 4LVDA 3LDVA 2F7QA 2XN0A 4JICA 2Y63A 1MEWA 1QCWA 2BSLA 4PSRA 3ATZA 3S1VA 2YA1A 1MVYA 3ZQ9A 3TIMA 3S1WA 3A4AA 5HWNA 1LLZA 4RV8A 3L4YA 9CGTA 1DQXA 1X8FA 2CZEA 4O0ZA 4AEFA 2A2IA 3PM6A 2R94A 3ZO9A 1AW5A 4O10A 4HOXA 3KL5A 3W73A 1IXPA 2VFFA 3W23A 4XBKA 1TPB1 2X2GA 3M43A 4BK9A 3WNPA 3S6DA 1S3HA 2NXGA 3W1UA 3AJ7A 3W22A 3WNOA 2ZZ2A 3MBDA 1OF6A 1B9BA 4JYDA 3S5NA 1AW2A 3EJSA 3WK0A 5F1UA 5KEZA 3NM1A 1XBXA 3JRKA 2ZRZA 1WA3A 5D03A 2AAMA 4IXXA 3V75A 4JXCA 3M7WA 4WXZA 2GPTA 1VJSA 5G1TA 2P10A 5SWUA 2B7NA 3M5ZA 5EPDA 4N9DA 3FEMA 4JL1A 2YYUA 1KFLA 4AF0A 2BTMA 1VHCA 2RHGA 3IIXA 3HBLA 3HB9A 4LUIA 3T44A 4WOZA 4EVZA 3G1HA 2QAFA 1ZFJA 1O5KA 3FJ6A 3DFTA 3LCHA 1PZ3A 3TUUA 1UASA 3ZOAA 4J3VA 2BXYA 3CEUA 1G9HA 3N9SA 1G4PA 2VFHA 1WOAA 2X1TA 1KTBA 3GXIA 3WJSA 1JI2A 1QWGA 1VCVA 1PE1A 1DJQA 1F76A 4L4LA 4NNAA 4RR4A 3TMLA 2X2IA 2FHFA 4LOCA 4XZ9A 3N19B 3CTTA 3UERA 4XKYB 1PS3A 4M7SA 1JCLA 1PCWA 3EX6A 4K7YA 4KKXA 4YCOA 3W1PA 2B7PA 4Z1AA 3G8EA 3L9CA 3VSVA 4BI5A 4WSJA 3WNLA 5HJLA 2CZ5A 3TONA 2ZUUA 2DP3A 3NXFA 3IIZA 3EJPA 2E77A 4UTUA 1P0NA 4AMWA 4QAWA 4UTHA 4GXMA 3L4UA 3A9IA 4R7JA 3TMQA 4IX0A 1P6WA 1W5QA 5DCEA 1GG0A 3FAXA 3S9YA 3O06A 2R91A 1MEIA 1YPIA 4FHAA 3RMJA 2ZTKA 1JR1A 3HGOA 1RP8A 2P0OA 2V81A 2X1UA 2H8ZA 3BO9A 2BHUA 1MW2A 3W71A 5LKYA 3MMTA 2BY3A 1VJIA 2QCMA 5G1YA 3DHUA 2WANA 3LRMA 3VGEA 4OE7A 4EOUA 1KFEA 1WE5A 4POCA 1RPKA 3M47A 4WOQA 3G0SA 3LXAA 5TIMA 1IF2A 3DDGA 3DKLA 2QCGA 3TW6A 4UZUA 2C8NA 5E93A 4ZQMA 3O6YX 1EH9A 4ONVA 4YL2A 1JRCA 3KLLA 3LHYA 4Y6GA 4E2BA 2RDWA 1RPXA 1N7KA 1QHOA 1MXGA 3DKJA 1O60A 3B4UA 1WXJA 3EX1A 5LNWA 3G22A 3VMPA 3K8MA 4RLIA 5IM51 4HHPA 3GKFA 3IVUA 5C6MA 3TH6A 4DPPA 5J5DA 1F74A 4LS1A 1EP3A 1KFCA 2Y89A 1QPQA 1M7PA 3TDFA 1J5TA 2A5HA 3UWQA 2H90A 1MEHA 1OFAA 3A5FA 1TTQA 1JIBA 3NNTA 2ZYFA 4XBSA 4J3TA 4LVBA 1ICQA 1K7EA 1QPOA 2A7NA 1VC4A 1LM1A 3L4XA 3BK0A 4KFPA 4CN1A 3EEGA 1OGSA 1DVJA 3GXNA 4TU1A 1FWRA 5LNRA 5CSSA 2E09A 3P81A 4QAIA 3F4NA 5G2IA 4NXKA 1GEQA 3O05A 1SZNA 3SSJA 1LYXA 5D2VA 4M7TA 4K7VA 1FXPA 4Z0SA 1XUUA 1UD3A 1WDWA 4MY9A 2CZFA 3MP4A 1AL7A 4UQCA 3LBMA 1DJNA 3FW6A 3CHVA 3TJLA 1JL8A 3L67A 3LHVA 4RX0A 3L5MA 4UFJA 4LTSA 4FB7A 1Z42A 3W7OA 2C0AA 4XUGA 1VHNA 3DX0A 4GFSA 5EA9A 3LRKA 3EJRA 5A6LA 3VM5A 3VCRA 4PL1A 4LV9A 4OT7A 2VXNA 3W1NA 4RKAA 4Q4KA 2P1FA 5DBTA 4MZ1A 2OW6A 2DZXA 1RR2A 3PWAA 1VZWA 6CGTA 3R2GA 1UUMA 3MYPA 4DQWA 1TTIA 1TTPA 3S5ZA 1XBZA 3UWYA 1A53A 4NVTA 3PBVA 1GCYA 3PBUA 4O57A 2NXIA 4JR5A 4WD0A 2V2CA 4FIRA 1B57A 5CGMA 3ATYA 3TE9A 1KTCA 3GAYA 1CGUA 5F2IA 3MP3A 3SECA 3ZT7A 4IMDA 1ZCOA 2NLIA 1HL8A 4GE8A 1VQTA 3TCEA 4JNMA 5LNUA 1TV8A 1LOLA 4N6EA 3DU0A 3LM7A 4IMEA 3FA5A 3PB0A 5CPNA 3ABQA 4MZ8A 4N02A 3W37A 2JGQA 4MY1A 3BVJA 4JDYA 1EUAA 2FB2A 4LNYA 1XC4A 1SMAA 4JFUA 3MJYA 3MI2A 1FWTA 3G1VA 2EJ1A 2ZUWA 5CZ0A 1GYNA 1EWDA 2OX1A 2VEPA 4A29A 2VENA 5G4WA 2XWEA 1XBVA 1O95A 3JS3A 3ZT5A 1M53A 5LHFA 3BG9A 1AQHA 3GR8A 3KXQA 2PWDA 2E1DA 4O8RA 5CZJA 4FO4A 5A5WA 3W1AA 1KW1A 3KVJA 6TIMA 2QLYA 1T96A 2Y4SA 3CEPA 3WJWA 4OKDA 2V9DA 3GXTA 2FPYA 2Z6IA 3HPSA 4X3ZA 3FOKA 4O11A 1UKQA 1HTIA 3NQ2A 1ZENA 2J9XA 1IIHA 2ABAA 2E6YA 1EO5A 4GUHA 1JXKA 3GLCA 2E8ZA 3BAYA 3NQAA 3WY3A 4LRTA 1UJPA 5C54A 3W75A 4X22A 1CGXA 3VE9A 3TTYA 4MOZA 1QWNA 2TAAA 5AHFA 4CNNA 1KFJA 1KBKA 2NV1A 2DZPA 3EX4A 3WJZA 4I9AA 3RFAA 3W38A 1T99A 1I4NA 4MAZA 2FFCA 3EKLA 4JFWA 3K1DA 5IBXA 2NUWA 2G97A 4WQ6A 3KVLA 3EWWA 3A23A 1VS1A 3WEMA 1A50A 2YX0A 5U7SA 2CLEA 1KM3A 2QV4A 4U28A 1G4SA 3WEOA 1KCLA 3QZEA 4MZYA 4AMXA 1KM2A 4XKYA 3HIJA 2YSWA 3BLKA 1VRDA 2AAAA 3LV6A 3QPZA 1EIXA 3NQGA 4O12A 1TPEA 1HO4A 1X6UA 1YLVA 5HR6A 2WOQA 2F7PA 5L9FA 3GDMA 4JTHA 3CC1A 1S46A 2FGZA 1DTUA 3S2CA 3GXFA 5TBOA 1BVNP 3PAJA 3KVKA 2QDGA 5CGTA 1DBTA 3NEVA 1L6WA 3WN6A 1FCQA 3YPIA 4ZL1A 6ALDA 4FX7A 1KTNA 3C2OA 1OT1A 3LOTA 4LS2A 3TTSA 1ODUA 2ZUSA 5CLTA 1H7NA 4RZ4A 5GVJA 4LU0A 3LCLA 2QCEA 3DX2A 1W5MA 1G94A 3IK2A 4CNPA 4UXDA 3BSGA 1EEPA 1F7BA 1D3CA 2D0FA 1Q6OA 3VNDA 4IMCA 3W88A 1P4CA 4FLRA 2E9BA 2WSKA 1KLZA 3LHTA 4OHQA 3A6OA 1TPWA 4ZQRA 3B0UX 3HJEA 2RH9A 3G3MA 4AHPA 3SI9A 1SFJA 1H7XA 3IJ7A 3P61A 4HPHA 1QWUA 4X9YA 3BW3A 2IQTA 1K03A 1OB0A 1FDZA 1HO1A 3PUEA 2QCFA 2X2HA 3F4WA 3O15A 1WZLA 3WK2A 3QMRA 4ORIA 4CKQA 1KV5A 1W0MA 2VEIA 3C6CA 4O13A 4AF0B 2ZX9A 5D37A 2YZRA 1H7OA 3PG8A 2V3FA 2CFFA 4C1LA 1NSJA 1QO5A 2NXHA 1BLIA 3B04A 3ZWSA 1F6PA 3KL3A 3RF9A 5ABTA 2D73A 1BTMA 4AVFA 3M1ZA 4CN6A 3G1XA 1DKWA 3DAQA 3DHFA 3FYPA 3W2LA 2PC4A 1ZAIA 2YJQA 3HMJG 3WDIA 2NX1A 3WK1A 1H7PA 1OG0A 5CXPA 1ONRA 3GNDA 2Q3OA 4K8EA 1R34A 4MY8A 4UNIA 1TQVA 2C13A 2ZZ3A 3TV8A 4M5PA 1FY6A 3DZ1A 4LS0A 2ZUTA 5AN7A 1UB3A 2CLOA 3W72A 3W1LA 1W5PA 4NI3A 4G1KA 3W87A 3B03A 4PODA 3TFXA 1DQWA 1KXTA 2CXGA 1F73A 3W83A 1H7WA 2EGZA 2C6QA 1KGXA 2J9ZA 3DI0A 7CGTA 3LHUA 3QW3A 4OBTA 3RLVA 2D2OA 1KXHA 3ECQA 1P0KA 2FQIA 4XTDA 1QI4A 3GX9A 3GTNA 5KITA 2FDSA 1XSJA 3SJ3A 3LI1A 3TQVA 3NQCA 4UFLA 2ZXQA 1TTJA 2VUYA 4U2ZA 3VMNA 4UFHA 3W7KA 4GBUA 1GT8A 4E2OA 1CLVA 1KFBA 1YDVA 3L4TA 1E3ZA 2YW3A 2Y2WA 4HPXA 5HUOA 5HQEA 4JDBA 4KWVA 1XH0A 1NVMA 3NDOA 1TPC1 5LZLA 4AB4A 1X7FA 1XDMA 2YIHA 4XQ6A 1EB3A 1RV8A 3QFEA 3TA6A 2QUUA 3TKFA 2BXVA 3V1PA 2XN2A 3C4UA 1UKTA 2QAPA 3TSMA 1RQHA 2DZTA 2OYMA 5CPMA 1DV7A 1NM9A 3DDFA 2GJPA 3G0XA 2A85A 1XDLA 3TOPA 4O14A 1VPXA 5F2LA 3DX3A 2QCCA 4HIBA 2E5CA 3E02A 1M5WA 1QDSA 2VOMA 2QJGA 4IOTA 1MSSA 3M0ZA 1SZGA 1S5TA 1UD2A 5HMSA 3D52A 2XVLA 3E96A 5D05A 1YPFA 1Y7VA 2FHCA 4TMBA 3PBYA 4BWLC 2PCQA 4AMAA 4EF9A 4ALDA 3D4YA 4MLRA 1M7XA 4TIMA 2YFNA 1D3GA 2C18A 1R47A 4BA0A 3WY4A 2F1BA 3MHUA 3GAKA 3B0VC 4CN4A 3VKJA 5CSRA 4RXGA 1HT6A 3E0IA 2E6AA 2Y7FA 2CLLA 2TRSA 4FNRA 4UFIA 1OFQA 2QR6A 1KBJA 5LNSA 5I24A 3QMTA 3AMKA 4NJKA 3ZSTA 3DFQA 5AC6A 5DFAA 4TO8A 5D2XA 3W7MA 4GC4A 2F61A 1CGTA 3C61A 4FNSA 4NJGA 3Q2DA 4RZ6A 4UQ9A 4NZJA 1OX4A 3KEHA 1F6KA 1SUXA 4R34A 3HG5A 3VGBA 3SR7A 3C2RA 4AWTA 2ZRUA 1MW1A 3GK0A 1I2QA 1A47A 1K02A 4UCFA 1IIGA 3CWOX 5FESA 3QMSA 3AXIA 3R13A 1VH7A 4OQVA 2DIJA 2EADA 2QMKA 3CZLA 3BAJA 1HVXA 3UXDA 3LHZA 5AB3A 2XVKA 3KE0A 2VFIA 3P62A 1SPQA 1W3NA 3BLEA 1QPNA 3PC0A 3BMWA 2ZTJA 1VYRA 2Z0IA 2ZCGA 5D2TA 3UEQA 5HUPA 3TC6A 8CGTA 1TQXA 2E5DA 3F03K 1OFEA 3KOFA 2PRLA 1JAEA 3BAXA 2FJKA 3IVTA 3VX0A 4JGDA 2DH2A 4GWEA 1L6YA 3STGA 5KINA 2QCLA 4YXGA 1PIIA 4H2CA 1GTEA 2G5WA 2EPHA 1CXIA 4GUGA 1KBBA 2BY2A 3HPZA 4H6KA 3KLKA 3KAOA 5IBXC 2ZQ0A 3NQFA 2WCGA 2Q8ZA 4PH6A 1K7XA 1IGSA 4AXKA 3UPBA 1ZNNA 2CLFA 2VC6A 4UMBA 1QPRA 5DXXA 5C55A 3OVQA 2X2JA 1DL3A 5FEZA 1OFRA 4JCMA 4AHQA 3TFCA 3KX6A 1QO2A 1VIWA 1Q3NA 2PWFA 3GKAA 3GZ3A 3OLEA 4NUWA 1MFVA 2NSXA 3MWAA 4Z1BA 1XXXA 4O17A 4WY0F 4WY0B 1Z44A 1VB9A 2WNWA 1SO6A 3WDJA 2ZRYA 1BG9A 2JKEA 3L4WA 1H63A 3L66A 2OSWA 5I23A 2ZX7A 1KGWA 3ELFA 4DO4A 4JEQA 3L4ZA 1ZALA 5AHMA 3L2IA 2VEMA 4OGZA 4N2YA 1YXDA 3QSRA 1SZEA 4WX2A 4FNPA 2FH8A 2WSRA 4NQ1A 1H51A 5BRPA 1GJWA 1U2YA 1VLIA 3C2EA 1MWOA 4E0CA 2R14A 2ALWA 1XM3A 3F1QA 4GI8A 1GYLA 3HQ1A 4O0KA 1E43A 2QPSA 1VCGA 3EXRA 1JUBA 3ABSA 1DHKA 1TQSA 4GI9A 2EAEA 4FF7A 1KA9F 3I7SA 1ALDA 3MI6A 4AIOA 1QR7A 3EB2A 2R8WA 4QNWA 1YTEA 1W54A 3EWYA 2X1SA 3P60A 3DFSA 1H60A 2QF7A 5H2ZA 1I2OA 2X30A 3G18A 4JIQA 5FF4A 2HS6A 3VGDA 4O1AA 4U2YA 3FJLA 4UQBA 1THFD 4J7RA 5CPLA 3TJXA 1LP6A 4XWUA 1DOSA 1J4EA 3ZS4A 1BWKA 2RKXA 4M6VA 2ZZ5A 2FB3A 3GR7A 4M6PA 1T0OA 4IPJA 5KMYA 2ISSA 4KFNA 4GIAA 3W9ZA 2YOCA 1XD0A 4UUIA 5D04C 3L2MA 3CGTA 4WJEA 3NQEA 3GBDA 3BW4A 1TV5A 5D02A 3NPXA 3B0PA 1LROA 3T4CA 2Y7EA 3W1QA 3ANYA 2BHYA 1LLWA 5F7UA 2V5BA 1SSDA 1HTYA 1EP2A 1WBJA 3DC0A 1WOBA 3EWBX 3H55A 3G24A 4NX0A 4CCEA 3MUXA 2CLMA 3BG3A 2E5BA 3DFOA 2J9YA 5HWMA 3G0UA 3FYOA 3IJ9A 2BLEA 5F4SA 3UZ5A 2YGYA 4O28A 2I14A 1K7FA 2E8YA 3ZR5A 3BMVA 1RZMA 1BSIA 4LRSA 2NZLA 1J0IA 3VM7A 3M9YA 4ZVJA 4DF0A 2D0HA 1E51A 1LCOA 4TMCA 3WY2A 1V5XA 5BMXA 3EKZA 1OABA 1DEDA 3GVGA 3C3NA 3W7NA 4BZYA 3UY8A 5I3JA 2CLKA 2H3DA 4NJHA 3W3OA 1SW0A 5K4XA 3TAKA 1Q4NX 3BG5A 1SO4A 5AHNA 1C8VA 2J27A 3ABRA 1SO3A 2CWNA 5E6ZA 5I3FA 3P74A 1WAUA 2FYVA 3Q94A 3THQA 3CB8A 1AVAA 2ISWA 2FHBA 3NPWA 1EX5A 1GPWA 1TCMA 1RQEA 4H8VA 3LI0A 1QOPA 3WFAA 5E0KA 7TAAA 2HTMA 2WKGA 3QQ0A 4LPCA 1E40A 3LRLA 5KSWA 3IGXA 1CXKA 3OHIA 4O19A 2OW7A 4UNKA 4MJMA 5FF0A 1JDDA 4N9EA 3KL0A 2NUXA 3OEXA 1M7OA 1QX1A 3WNMA 1ZAJA 2ZRXA 4N6FA 5TD4A 2FE0A 4UTTA 3BUPA 1U33A 5F2GA 3VNZA 4RK8A 2VRQA 4IPIA 3GDKA 1HNYA 2ZRWA 3KHJA 3NQDA 4JD4A 4JTEA 3UWVA 4ADUA 3WNNA 3WY1A 2C16A 3USBA 2X1RA 4JTSA 3S5YA 4Y96A 3W2MA 2Q3RA 1ME7A 1J0JA 3U8GA 3UWZA 3CWNA 1LRQA 2FPVA 3MO7A 2VFEA 5E9AA 4MJZA 3DXIA 3G1DA 3KRZA 3KWXA 4QQ3A 2NX9A 3THAA 1OYCA 4ZQNA 2HMCA 2W0UA 4UQDA 1KBIA 3NPUA 4M6QA 3TQ0A 1CI1A 1EP1A 3AO0A 3LCIA 1EHAA 2H6RA 3R12A 2DJXA 1TO3A 5LGZA 3LERA 1N55A 5EY5A 2C14A 3O6CA 5C5YA 1QPKA 5DLCA 4TVUA 4HNTA 3N2MA 1Y0EA 4TR9A 3RILA 1PVNA 4B5NA 4IMFA 3RNDA 2NT1A 3VGFA 4H8UA 1JULA 3P67A 1GVFA 3FAWA 3NVTA 3DHDA 4UR7A 1G4TA 5I0DA 2ZZ6A 2Y7DA 4OJYA 3E9AA 3W70A 1JDAA 1LBFA 1KM1A 2ZA3A 5G4EA 2Y61A 3TR2A 4AH7A 4IJBA 2YXGA 5DCBA 1ZY9A 3QQ1A 5A8GA 4RXFA 2J88A 2XVGA 3BVWA 1H50A 1L2UA 2DU2A 1CXLA 1ZAHA 3QW4B 1K8ZA 1ICPA 1E3XA 1W37A 4H8HA 1WZMA 3LXBA 3W7IA 3CZGA 3W7LA 4AEOA 4HNNA 1KFKA 1M6JA 2TSYA 4JY8A 4W93A 2X16A 4YWIA 2VR5A 4D2JA 1TIMA 2WNQA 1R2RA 2F84A 1ZJIA 1LRNA 3M5XA 2F18A 3L65A 1OF8A 4JTKA 4NJJA 2B0MA 3TC7A 3W7RA 2WQPA 2DZUA 1B3OA 1B2YA 5A6MA 4UFMA 4LC6A 5F1VA 3HJZA 3RK8A 2BX7A 2QCDB 1BEUA 2BZNA 3IIPA 4AIEA 2C1HA 2WNZA 3ABOA 2XN1A 1OVDA 2V82A 3PUOA 4FEZA 1L6SA 1KM6A 1GVSA 1GOXA 4LC8A 4UMAA 2QJHA 2WSYA 3W2KA 1LWJA 4JFSA 4O4WA 1NEYA 1PL9A 3P80A 1TPVA 1G7UA 1UBSA 1OK4A 3C2VA 1CW2A 4NJIA 3LTPA 1ZJBA 2E4TA 5D33A 3PY2A 1VAHA 2QCDA 1PPIA 3D0CA 5FEWA 3BCDA 3W7PA 3HGSA 5HNRA 2W6RA 1VYPX 4CQ8A 1XKYA 3P84A 3DBPA 5AC8A 4Z1CA 3SZ8A 3O6DA 1ML1A 2Y88A 3PULA 4KMQA 1S5WA 3DI1A 4NZFA 1TPFA 4WXYA 2PRMA 2PURA 1IV8A 1I2NA 3EXSA 4JYFA 3EJTA 1R2SA 4DELA 3U6WA 3EWXA 1JD9A 1Q6QA 3LGEA 2GQ8A 3N2XA 4E38A 1UA7A 3P8IA 2QCHA 3T7VA 2QUTA 3NZ1A 1J0HA 1XH2A 4LVFA 1Z41A 4UR8A 4PCFA 1TJRA 3M5VA 5HINA 3VSUA 4ZQPA 2RDUA 2D3NA 3UZJA 2F2HA 3W2NA 4FLOA 4JTGA 1TQUA 1G6CA 3PB2A 1NF7A 3DHPA 3BLIA 3LXCA 1QW9A 3HG4A 5LHEA 3WNKA 4DO5A 3BVUA 3HZ3A 4DBEA 4LUJA 4I7UA 1UUOA 2WPGA 3DFPA 3IIOA 2JBMA 1F2JA 3IVSA 1PZ2A 4FNQA 4LT9A 4JFVA 2QPUA 1FWSA 3K8LA 4PSPA 2EKCA 4O52A 3LCFA 2RFGA 4M8UA 2ZZ7A 5I3HA 1XSKA 2WO5A 2ABBA 2OT0A 4MUZA 4C1KA 1TQJA 4CQAA 4IGHA 1HFBA 5BRQA 1MXSA 2Q8LA 2JKPA 1EWEA 1LBLA 2ZWYA 2NV2A 4QIUA 4IX2A 4I7WA 4ADTA 2FTPA 2DIEA 1TPDA 2V5LA 1JCJA 4QJ1A 1GQNA 1LTDA 2V8ZA 1UOKA 3GDLA 5G5IA 3QSTA 1LORA 1LOQA 3CM4A 3EXTA 3CLMA 3CZSA 4J3UA 4OWGA 2ALDA 4Q33A 3UWUA 2WSPA 4FMVA 3STCA 2XIBA 3L21A 4QM1A 3PVFA 4JX5A 3WJYA 4CNOA 3UYCA 5U4NA 2WVTA 3STFA 1PEZA 1AK5A 4NU7A 2VFGA 3CLWA 2CZDA 2VELA 5EMYA 5FI8A 1O5XA 3MBFA 4N4PA 3G1SA 1OFBA 1R46A 4GINA 4RZ5A 5EMUA 3NAVA 1X1OA 2Z1BA 2BY1A 3O16A 4LVGA 4UFKA 3GBEA 3VX1A 1CXFA 1P5BA 1F05A 2QUVA 3N73A 4GNJA 4N9CA 2EEXA 3EJUA 3UNDA 4DEFA 3NYZA 2E68A 2A7PA 2VKZG 1B4KA 4HPJA 2Y6ZA 1XCXA 3TSDA 1U30A 3LPPA 4UOQA 1KXVA 1ZHAA 4A3UA 3CU2A 1J2WA 4FX8A 5K3VA 1I45A 2G3MA 3C8FA 5I3GA 1FBAA 1LRTA 5A2BA 3KVMA 3W76A 4CLMA 3VO0A 1JGIA 3C52A 1TSIA 3O8AA 3S1UA 3BAWA 3GXMA 3A21A 2DZVA 1WV2A 3VGGA 1H3GA 3STEA 4JYEA 3TNOA 4U4MA 3UY7A 2YKKA 4ZQCA 3G1YA 3FFSA 3VFLA 3QH2A 3L0KA 4NNCA 3INPA 1CXEA 2ZWZA 4Y90A 3A24A 4O1CA 1H7RA 3I7RA 1XCWA 1U5JA 4PCTA 3GB6A 4DXVA 5E0FA 2WPBA 3BAIA 2XFWA 3BUDA 4BWLA 4OV9A 1BKSA 1JUEA 2DORA 4LVAA 1JCYA 4PA8A 2DH3A 3GDRA 2O7QA 3W86A 4FXRA 3UPWA 5C2XA 1Z32X 1GTHA 2G95A 2GVYA 2OMAA 2GVJA 3HG3A 3ZT6A 2FIQA 1A5AA 1Q45A 5D09A 4WZHA 2JK2A 3SGZA 3CV5A 4GUJA 1HXKA 1F5ZA 3SW6A 4P2VA 3R8RA 4CGTA 5AYYA 1H1YA 2WVSA 3G8RA 3HGRA 4Y9AA 1D7FA 1KGUA 3BH4A 4NNBA 1OHLA 3OA3A 5K9CA 5G2HA 1W8SA 4A21A 4BF9A 4J9JA 2VFDA 5HDRA 1FXQA 5HPOA 1RP9A 4UTIA 2CLIA 2XIIA 1XV8A 1R2TA 1QI3A 4UTWC 3IJ8A 1FCBA 3TQKA 3IGUA 4S1FA 4R53A 5DELA 2IGTA 4N4QA 1SFLA 1TRDA 3BW2A 3VE7A 2AQWA 1YYAA 3MHFA 4BI6A 1FUYA 3BLFA 3BLBA 3L5LA 5G2WA 3UD6A 4P61A 3W7QA 1C8QA 4LQ1A 1W5NA 3DGRA 2D0GA 3LCWA 1WQ5A 3L0GA 3L68A 2J24A 4WY0A 3S1XA 4IQLA 3CQ0A 3I6RA 2WKLA 3KRSA 5H91A 4LWWA 3W7CA 3NL3A 1WX0A 3LPOA 3LLDA 3B8DA 2HS8A 3NQ7A 1XD1A 4O54A 5AC7A 3WDHA 4UTLA 4H3DA 4NXSA 3P8JA 1AW1A 4QISA 2AGKA 5CZTA 2VRKA 1UCWA 4QSHA 4N9BA 4QNEA 2DZWA 2V3EA 2A0NA 4BI7A 2WVUA 4WLCA 2PWHA 3VGHA 1EO7A 1XH1A 3NM3A 8TIMA 4HNVA 4MPQA 3AXHA 5KZEA 5I5RA 1K8YA 3VI2A 3UWWA 5CG7A 4ZQOA 3SGUA 2G96A 4MIMA 4NX5A 2D3LA 4ATWA 1O94A 3IGSA 3NQ8A 1UH3A 4AEEA 7TIMA 3H54A 1XFBA 3HPXA 2YCEA 4O4VA 4NT0A 1EA9C 2BY0A 2OCZA 1EUNA 1KM5A 3NL2A 5CKSA 3P82A 3WK3A 2ZZ1A 4L4MA 5A2AA 1FCVA 2CHNA 3LLFA 5L6UA 5FF3A 3PR2A 3WELA 3D4ZA 3W1TA 1YXCA 3BC9A 1XL9A 4U31A 4J3WA 1J0KA 3BGJA 1EPXA 4FIQA 2CPUA 1JQXA 4I7VA 4J3XA 1WZAA 3CZEA 1QI5A 2YA2A 1G5AA 4KWUA 4UCGA 2PE4A 2YYTA 1ADOA 1Z48A 2WNNA 4S2CA 2FLIA 1ZJAA 5D38A 1FQ0A 3DX4A 3GDTA 3OVPA 4U3CA 3BVXA 1G1YA 1Q6RA 2G3NA 3OBKA 3Q37A 5F4WA 3G1FA 1HX0A 1XI3A 1S5VA 4B9YA 1UA3A 4CVWA 4JTFA 1KCKA 4FX6M 5DO8A 3TX9A 2OSYA 1JCNA 2JKAA 3EX3A 3T55A 1W1ZA 3M07A 3L5AA 3G3DA 1OK6A 1W3IA 4JTLA 1HL2A 1YADA 3NQMA 4FXSA 4AWSA 1ZS2A 4IXHA 4EIVA 3EDFA 5E1QA 1FWWA 3QM3A 3N9RA 5KTLA 2EACA 3CPUA 3K30A 1UKSA 1TPH1 3P7YA 2Y70A 3QEZA 4LXFA 1JI1A 1PS9A 3N14A 5FEPA 3BUBA 1CDGA 3M44A 3QPYA 4M56A 3IEBA 3HGJA 4MYAA 1LBMA 1GJPA 3NQVA 3NGJA 1SU5A 4JS3A 4K37A 3W6YA 3PS7A 3LB0A 1BF2A 5DBUA 3E12A 2GJRA 1W3TA 1JD7A 3PSVA 1CYGA 3UG4A 1XSIA 3Q58A 4TX9A 2H3BA 1GVQA 4DO6A 2B7QA 1AG1O 4UNLA 4X2RA 5I3IA 1LOSA 1KM4A 2AMGA 3TK7A 1KV8A 2ISVA 2C7FA 3LHWA 3C56A 5BW6A 2J25A 3VSTA 1V7YA 3BVTA 3LX9A 3A22A 3LCGA 5CLWA 2EO7A 1WPCA 3ZSSA 1P1XA 4O1BA 2NWRA 1QHPA 1L0PA 5DN1A 1VFMA 3QGVA 1I2PA 3EDDA 4J27A 3R5EA 1OYAA 1TQWA 2CU0A 3NOEA 1V3JA 4JX6A 3BLPX 2V3DA 2BHZA 1LZOA 1U83A 3O07A 4JCLA 1LDCA 3W85A 1QOQA 3BAKA 1KWGA 2QEZA 3R89A 4FLSA 4HSNA 3CZNA 2PRHA 3NL6A 1VR6A 5LNVA 4MFEA 2EQDA 2OYKA 1SZFA 4JL2A 2QCNA 5BRBA 2BWGA 4YLWA 3W1RA 3UQNA 4O15A 1TPUA 3TROA 1GZGA 3W1MA 3A5VA 3EDKA 3CPRA 1A5SA 5CPOA 4KFOA 4UOZA 1YDOA 3KRUA 3GXDA 3PSWA 4XB3A 3RIKA 4UTTC 2XWDA 4AYSA 3DX1A 2OYLA 2ATMA 1RQBA 3PUDA 3OLIA 1VCFA 3LTYA 3QJAA 1JF6A 3G1AA 4EWND 2ATSA 1CX9A 2YPIA 3BVVA 4JTIA 3CIXA 5K9DA 1TRIA 1PJ9A 3EJQA 3CZKA 4K39A 4KWWA 2GVGA 1CGYA 5T26A 3W84A 4M19A 1TB3A 1MFUA 4A22A 2WV8A 4H7VA 4IUOA 1RVGA 3TW7A 4ZMGA 1OX6A 1H61A 4JTUA 3U2OA 1PIFA 1A5BA 3FLUA 1BPLB 4GKLA 3EDJA 2WVVB 3W2UA 5BOOA 3GXPA 4QITA 5D2YA 4MKNA 4GJ1A 1FX6A 4UQEA 2OSXA 4W9TA 3SY5A 2NUYA 3QC3A 5FF2A 2F7FA 4DPQA 2ZXDA 3NR0A 3T40A 1ICSA 2ZIDA 2Y7GA 2ZA1A 3N3MA 1IXOA 1MW3A 4UMCA 1DORA 1XBYA 1FWNA 3H53A 3ZR6A 1HWWA 1UH4A 1FDJA 5D30A 1JG9A 2GUYA 2WKJA 1QFEA 5DXYA 4GO8A 4LY8A 1IZJA 5HWJA 1PAMA 4ICNA 1H62A 1SR9A 2NT0A 4XTIA 1FCUA 5K7JA 1OJXA 1Q6LA 3W7EA 2CW6A 1SW7A 1JCXA 3D51A 2O7SA 1B4EA 3EX2A 3I65A 2QJIA 1NFBA 3W7DA 4X0NA 1ME8A 3QYQA 4E2DA 4MLJA 1OFPA 1I8JA 2PWGA 3E49A
chains in the Genus database with same CATH superfamily
2XGBA 3H42L 1II4E 2LLNA 3ARUA 3C5XA 1JDCA 1PCKA 3OIXA 3RO8A 5H2BB 5DO2C 1X39A 3VC5A 2AZUA 3JTBA 2ZG1A 4HD9A 2N0MA 3B4NA 3BWAB 2X3CA 3D50A 4XN8A 2WLIB 3LYEA 1W56A 1WFIA 3S42A 3LQAL 3OC8A 3S1GA 4FF9A 3OR7B 2R51A 4PJCB 1F9CA 1QAPA 2OJPA 4QG6A 1NF0A 2BSSA 3KBHE 2ZICA 5E6IB 2I60L 3QCUL 1JHKH 3ES7A 4UDTA 4L9YA 4R5EA 1OY3B 1IGWA 2WJZA 3HG1B 1RY8A 4F8OA 2DDXA 4NKIH 3QQDB 3IUIA 1YE4A 4ODTL 2Z2UA 4CSSA 4MA8L 1UR8A 1F56A 4Z3EA 2OGJA 2E67A 1UD6A 4GAAA 4L3FA 3ZL2A 5ISZA 1XFCA 3AAZB 1IXNA 5FF6B 2R2HA 4O51B 4HUVB 4KU1A 4EANA 1YXYA 1DIEA 1NGYB 5IQ9A 2P49B 1DBKL 1NC4B 3QI9D 5IJKC 3FB5B 3GHEH 5H2BA 1NWSA 3UO1L 1XLDA 2Y0FA 2F8OA 2AV1B 1I7TB 2X0VA 3RDTA 1PKLA 3FYEB 1TOXA 2QGHA 4KH9A 4NB7A 2FGWH 4DPBX 5L6YH 4IPNB 3OKKA 4K8HA 5I79A 1SZRA 1MVUB 2Q9OA 4NKOB 1FGNH 5C09A 3TBVA 4O4YL 5I73C 4Y4KC 1AIZA 1USQA 4XPHH 1T5KA 2O9TA 1F4HA 1BBJA 1I1AB 1U4FA 4ES8A 1KELH 2X0SA 3IMUA 5EU4A 2XG9A 2O5XH 2FQGA 1KLYA 1S3TC 2X2UA 4YWSA 3ZDYE 5LB1A 3EYSL 2DMBA 3APNA 2OU4A 3NJKA 3D7PA 5GRJL 5CJXA 1QK0A 2OLDA 1UZHA 5C07D 4D8PB 2O5YL 4WK0B 3K2GA 4UIOA 4DCQB 1E4KC 4WUUA 3DFNA 1EA0A 4PCSA 4X6DA 1NEPA 4G9FA 4WSGA 1D5XA 1V3KA 4QRTB 2P8PB 3RDKA 4UT7H 2A6IA 1VADB 1XF4B 4ZTOL 4ZX3A 1K4CA 1A3LH 4N2KA 1JTOA 3J27A 4NGHL 2IFGA 4M3KB 1A3QA 1LLOA 1DFBL 1ZBVA 3CHCA 1K8XA 3ITLA 3VZZA 2WIIA 5CIPB 4LLWA 3WFZA 4CSTA 1QJWA 1XTLA 4MWFA 3EDEA 2UVEA 4D8ZA 4N8CH 2PGEA 1H3PH 4K7FB 5JHLH 2BVEA 4GA8A 1UD4A 2DBLH 5C3IA 4GUIA 2BWDA 3NK4A 2AFNA 4IP5A 5IXEA 2WZMA 2BVPA 1CE6A 2E0PA 2JF7A 1I53A 3R1ZA 3MFFB 3TYEA 4PJEA 5DJ0B 4LESA 2AQPA 3SE3A 5E51A 4XCEA 4Q8WA 2WBWB 4LLQB 3PDDA 1W8EA 4OGYL 3TYFB 4EIUA 1NC2B 4P2CG 1T2QL 2IKHA 4Q7NA 2NY0B 1TVDA 1F8TL 2Z31D 5MERB 1BDYA 1Q1PA 1D5MB 1O4UA 2E7LA 1SO5A 5JIWA 3ARBA 4Z17A 4AKPA 1ZDSA 3MV9E 2G3XA 4WW2C 5F9DC 1OX4B 2J6VA 3UXAA 4AQZA 2HA1A 2HLEB 5B38A 2IANA 3AIUA 5D72H 1HYSD 1GWJA 4M81A 4KCVA 4XNAA 3V55A 1AZ2A 3CFJB 4QY8B 1TYGA 4Z1DA 1V5JA 3EYVA 4O53A 4P2RA 3TW7A 1W1IE 1TFHA 3HKFA 3OAYH 4I9WD 4K0OA 3TA3D 3MMWA 1I9JL 4OTKA 3VVGA 1OQOA 4LV4A 1X5HA 5BXRA 1CGVA 3EFDH 3DGCR 4FP8H 4GZ7A 4HHHA 2W38A 3N5AA 1DHPA 1MQ8A 4Q56A 3UCQA 3LZ5A 1NGQL 1U42A 1Z9NA 3ZN6A 2HT3C 3EJZC 3OR7A 4PJCA 3GLEA 1OWQA 1OC5A 2PO6D 1JGDB 3FFDB 3QQNA 4RGNE 3U7YH 4JN6A 2GJ6A 5CC7A 4KVNH 1J5DA 3B2XA 3N06B 3ARYA 4EXAA 3NQ6A 3BGMB 4XVSH 3FB6B 3D12B 2F7OA 1W2PA 1GY2A 2AMUA 3QDJE 1ICTA 3MJ7B 1JFHA 1FE8H 2VXSL 4KKRA 4AG4H 2NX3A 4J2PA 1QNIA 1OF2B 2YW4A 2A6NA 1KXQA 4QLJA 3GGWA 5IOKA 4JANA 2A6DB 2R2EB 1VACB 1FPTH 4MMZB 2LFGA 3QUXD 4Z3FA 1BEXA 3VD2A 4U3XA 1XYMA 3TEZA 3LZPA 1YQVH 2V0TA 3L5HA 1S5IH 5GHWL 1JGUH 4UTMA 2QSCH 1IEQA 4E8CA 5BQ7B 4J8QA 3KBEA 2R6OA 3BQVA 1AQMA 2MNWA 2WZPA 4GXUM 3LCXA 4HYRA 2RH0A 4BCEA 4GRWF 5EEUA 3UZXA 3TFKC 2DJMA 4OLWH 3GBNH 3LKOA 4HLEA 4YS1A 5JXED 4C6OA 5LSMA 4O1DA 4EUPH 4P5KB 3UTQB 4GG6A 1JVNA 2AJXH 2PDYA 1W9XA 3SB0A 4IL0A 2R9HD 5FUZL 3WGVB 1UH2A 5J1AA 1FDYA 2PABA 1A3LL 5ID0A 4EN3D 2YDAA 3O1NA 1WCBA 1PNCA 3HC4L 2P9RA 3OPZH 2PUQT 4B50A 1RURH 3CBKB 3FB7A 3THCA 2QMJA 3WH6A 4YTRA 3MYOA 1A6WH 1TREA 4OFYD 4MB1A 4R7VA 3TEUA 3NUKA 4QXWA 3R79A 3WLBB 4F2BA 4JGMA 1E1CB 4MRBA 3HPAA 1G1OA 3J8F7 4QUOA 5T5FL 4B9ZA 4XNDA 1GGOA 2QHAA 2AVFA 4CA4A 1SW3A 4F33A 3X1NA 5SX4I 3W7JA 5JBFA 4M1CC 4HT3A 1TITA 4Y4KA 4L2YA 4E4UA 3W74A 4G7RB 4G71B 3CN0A 4LSSL 5HGHA 5KVGL 3JR2A 4APXB 4C8XA 4PYGA 3VQLA 2ZXCA 4O18A 3IBOA 5B1KA 1DQDL 3QUYA 1Q38A 4EF8A 1T6MA 4TQEH 3WJMB 2QDHA 3L12A 1XP3A 3EADA 2VO5A 3FO9B 2WVVA 4GXWA 1J9CT 5G4OA 5ALBL 1PHWA 2OT1A 1AR1D 5C0RH 3DOPA 3FB7B 1A1MB 4UIKH 3VG0H 5EZJA 3W6LA 2C1OA 4PJIA 1KD0A 4GY4A 5IHHA 3S88L 2EAWA 5AALA 4WUUE 3CFEB 4JKMA 1PV8A 2J78A 4H6RA 2WCSA 1M3UA 2JKIS 3BQ6A 1SQ7A 1K6AA 2DMCA 1YYLL 2BFGA 5CAYB 2VLJE 2Z8VC 3VRIA 4PL2A 4FQHA 3TSBA 1EJXC 5A6JA 2P24A 3WJXA 3X3GH 1IXQA 2EP6A 1G4EA 3L4VA 1X1ZA 1NCGA 2WWOA 2YD4A 2P50A 1T5WB 4J3SA 3U7AA 2ZX5A 2F15A 2VUOA 3GXUB 2CLRB 3TBWA 4ODUA 3WTXA 2B7OA 2VC9A 1CIUA 3O6KL 3G9VA 1GA2A 2Y5EA 3NGFA 3FH7A 4HCHA 3T0CA 2ZWKA 3T0EC 3IE9A 4LHJB 3OA5A 3P5ZA 4KQ3L 4NFDA 3HRPA 3SUUA 1PSKH 3NCOA 4K7PH 3AU1A 1LUCA 1RLCL 4AAJA 2RALA 4ETYA 2DOCA 3GUTA 4J12A 4OZIA 3F5WA 1T20B 3V4VA 4QJ4B 2ZZ4A 5HHMD 1V08A 4O2CB 3V4BA 1RLDA 1XFPA 1J10A 2JQZA 4LLYA 4OZFH 3MJ7A 2ZRVA 4ZSOA 2HN7A 5CZSA 2PWEA 3G6DL 2APBA 4MMXA 4PTTA 3ZK0A 2VMJA 3GGWB 5E6YA 5C0CA 2CHOA 4RMQA 3TJ4A 4Z5RA 3ZLFA 1KTRL 2D7TL 1WKEA 3PXHA 2UY2A 3KNBA 5BXFB 3K6SB 3ELQA 5H35B 4IKKA 4RJEA 4ATDA 3N85L 2GGGA 1OC6A 1H1NA 3I6GA 4IBTA 4AYGA 1MJ8L 4OCRH 5KAQG 3SO3C 1IT7A 3GMMA 5HJDA 2PU0A 4GQRA 1Y6NR 1YVLA 3L2LA 5D7LD 4EI6A 1VFFA 4HK5A 3S2MA 4KY1L 1YNTA 3GSXB 3ZDYF 3T81A 4HIEB 3E0LA 3C5JB 3BTNA 2HFEB 2X4TB 3ABZA 4LCYB 2GJLA 3GKWL 4DFIA 5D9SA 5DZ9A 2ID5A 3UZQB 2GSJA 3MHGA 5GNYA 5IVXA 3RLUA 4QHNB 1QQDB 4PTDA 4BCZA 5E8NB 3I7QA 3MKGA 4Y4HD 7A3HA 5HJGA 1WCGA 4AYBA 2H4EA 2ADFH 3EJJX 3D05A 3NJXA 4JX4A 4JO1L 1WUEA 3PIQB 3BUIA 5SWQB 1KCZA 1GXEA 1L9WA 3ORJA 4Z7NF 4NJAH 4C47A 1WBHA 3DH7A 4PJ6A 1S1RA 2K9FB 3NL5A 4KKBC 5T5FH 3S36L 3UTSB 3CTLA 1RK1B 2ADJB 2FJGA 2FUQA 1DQVA 4FGMA 4G8AC 5AVWB 3H2OA 1U3NA 4KCUA 5J3HD 3BCFA 3BXNA 3NIFF 3IDJA 1KYOJ 3WKYA 3ZU8A 4PC8A 2QSVA 2XICA 5CCHE 2KT6A 2PW2B 3WIHA 5E1IA 1BAWA 4LASL 2VRJA 3LD8B 2BOBB 2V9QA 5KS9A 1KPRA 1A0DA 2V2DA 4PTUA 1MREL 2H8XA 3N2OA 1EXGA 2VXTH 3N04A 1VGAA 1IAIH 4RGMB 4QRAA 2VXQH 1T8XA 2C7UA 2GK0A 4EK7A 1KB9K 1YSOA 1ZK5A 3ITTA 2MOQA 3VNKA 2NQLA 3MC0A 5C2BH 1G1KA 1P5VB 1XL6A 2WXQA 3GZOA 3QJHB 2EYRA 1GZHA 2WC7A 5AG9A 5KYYB 1Z9AA 1I8UA 2X4PB 3OAZK 3JTTB 4AZ5A 1AQDA 3SIZA 2PCFB 3S8HA 4JAWA 2FQEA 3S0CA 1U8CB 1QFUL 1ZSDB 2LAAA 3EIFA 4OLXL 1KDIA 5EOTA 5A2CA 4WSKA 2B4GA 5JW5A 5E70A 1WUZA 4K36A 4O50A 4U6HA 2VD9A 1KB3A 4YVXA 3P3YA 3WD5L 3ILQD 4OJFH 4YSOA 4DF1A 4Y4HA 3BFWA 3O2DA 4Y8FA 1H6EA 3WF0A 2A74C 3UAJA 2ESVE 4G8GB 1EO8H 1E6XM 1W72A 1XDJA 1TQBC 1KZQA 3KPTA 3NZ8A 4HCRH 3RU6A 2Y1ZA 4W70A 3KOXA 3MLVL 4HNUA 4JTTA 3L1GA 3HE6B 1J5SA 2ED7A 4JICA 1WK0A 5T33L 3OR6A 3AYSA 2N59A 4MLSA 3JV4B 4M7ZB 2YL6A 3V4PH 4A55A 1QCWA 4IIGA 1AANA 2EE6A 2X6MA 2WSDA 1S9WB 2BSLA 5E6UB 1U3HC 1MVYA 2XV0A 3UTZB 3AREC 3BZGA 4NZ4A 4G7YH 2YEZB 2W07A 5HHXL 1LWRA 4A68A 4N2OA 5A8MA 4JN2A 4JO2L 2W9DL 3QPEA 4Q4SA 4Y1AB 1FH5H 4FFYH 1DQXA 2X2YA 2CZEA 4HZ8A 4AEFA 3PM6A 4LOUD 5EBWA 1DFXA 4IDLA 2GI7A 3VUPA 4FQIH 2OWCA 2EVFA 2VZUA 5JOEA 5CKAA 1SVDA 1EJ7L 3UZEA 3O8XD 4YPGA 1IAKB 3WHE0 1X6NA 4GP5B 4QXGH 2Z7KA 3APYA 2ENPA 4Q0XH 4WTQA 5DC4B 4UINL 3DHDA 3T0TA 2WQXA 1BWWA 3FQYA 2XY2A 3G1RA 3M43A 4GOSA 1Z3GH 3D0AA 1IUZA 2Q76A 5D9NA 1FHLA 3WH5A 2PPAA 2NXGA 2VAJA 3UTSD 2G2PA 3W22A 2DUXA 3CAKA 3SYAA 1M6OB 5L2JA 2WHLA 4JYDA 2Q0ZX 1IX2A 1AW2A 2BG5A 3W0KA 2JIXD 4RDQF 3B2UD 5KVGE 2IAAC 4O2FA 5TQ0H 4BIKA 3BLOA 4AZHA 5CZRA 1A2YA 3OKYA 1RHHA 2NCEA 5I8EA 4XNXH 1JZEA 3M7WA 2GK1B 4GBXC 5E2WL 3LMYA 3C6SA 5A2JH 1HNFA 1YHPA 4X5XA 5TDOA 1B30A 2P10A 3RGVB 4F7EB 4FFWC 4N9DA 2Q5BA 3LS5L 2J7EA 1SDDA 4JL1A 2UZ9A 1AXTH 1IAOB 4AF0A 1C5BH 5DQJB 1GNXA 4NEHB 2R29A 3L2NA 1FG9C 2RHGA 1WFOA 3IIXA 1FZMA 2XWXA 2Y25A 4HHGA 4YIWA 3M0YA 3VG9B 2X44D 5C97A 1AH0A 4BF7A 3DFHA 4D7PA 3RCYA 5E2VL 3JSSA 1YMME 4UM8B 3DVGB 2YMOA 3FJ6A 5GJSL 3H6OA 3NWRA 1ASPA 3LZFL 2E27L 1PZ3A 4JRYA 4YN3A 1UASA 3ZOAA 5CN3A 3VA8A 3TUUA 1IBHA 1IGIL 1MWAL 1QVOA 3QZOA 2IDTA 3VCNA 4MD5B 2PXYC 3H4FA 3FO2A 5LAXA 3HCVB 1G9HA 3RL1A 3K6OA 5GRWA 3ZHNA 3R0KA 4PYSA 2W81C 2VFHA 2X1TA 1EMTL 1JPTL 1KTBA 3WS6C 1P7TA 5DK2A 4WFGE 3JTTA 2FSDA 1G7HB 5D1XE 1VPQA 3VJ6B 4A6YL 4L4LA 3SN0A 3PJTA 3PIQA 4NNAA 2VDLB 3R06A 1R3LB 4XVEA 5EFDA 1ISYA 1DIDA 1GOWA 3SCVA 4GQZA 3N19B 5GGRA 3UERA 5D03A 1Q9OA 3FONA 1PCWA 4XBGA 1AJ2A 3O4OC 4QGCA 4OLVL 2D69A 1QYGH 3WMLA 4X9IA 1H9DA 4EO5A 4UNTA 4UT6H 3TTOA 3W1PA 2B7PA 4OZGF 3WFBL 4S3CA 3WLRA 1H3VA 4BM7A 3U4BH 4PTUB 4KKPA 2ZUUA 4O58H 3IRZA 3TONA 3WUZA 5DQPA 3RPMA 1CN4A 5ID1B 4AQ1C 4L1LA 2R23B 1LK3H 1NCAH 3FUDA 4GNKB 4JZNA 5JHDB 1YPZE 1BVWA 2A3EA 4WI5A 1F41A 1UWIA 3U2SB 4B4HA 4ZQOA 3DETD 4IOFC 1TPXC 4PB9H 4HPOL 3A9IA 2XV6B 4UTAH 1W5QA 3SO5A 1YDYA 2BP8B 4P2AA 4EDWH 1W32A 3LMJH 3DVIA 1YEDA 4PJ9B 2R91A 3O06A 3NPSB 4OGYH 3WQVA 2OMVB 5FCZA 3AG2B 3QUZA 5FLVA 4DUVA 4AYMC 2X1UA 1G7PA 4MJID 4N0UA 4AH2A 2BHUA 3NTCL 3S3PA 3TGXA 3SKNA 5AAWA 4JREC 5EZIL 43C9A 3BOFA 2DI7A 4GT0A 2BY3A 2QCMA 3DHUA 3PWPE 2ZKXA 1KFEA 4LCVA 4L29B 3XISA 5K9JL 2C1PB 1VPOH 2GFBA 4OFCA 4PS8A 4FQLH 4B91A 1XQLA 3F7YB 3RVTD 1XL4A 2QCGA 3LSBA 5F96L 5IGXL 2Q8XA 5J11B 3CHDA 2QADB 2ZP0T 4GZIA 4MNHB 1KN4L 4OZ4B 2IQ0A 2F58L 4FJ6A 1NBCA 3KLLA 4H40A 3MLRH 1JRCA 4S2SA 2G8ZA 4HIPA 3LHYA 3V5KA 1Q0EA 4HCLA 1KEGH 3QUZB 1N7KA 4IU2A 4QTHA 3DKJA 1O60A 1RCYA 3B4UA 2I7OA 3NIFE 1UWEL 1HSBA 1PCSA 2IAMC 2YLKA 3BQUD 4MB4A 1ZLVK 3RWEB 5C1MB 4GT7A 3QB7C 4LSRL 2A3BA 4PI2A 2VN5A 4HIQA 1YW1A 4JOMA 5A3HA 5J5DA 2Q2EB 2X12A 4UI2A 2Y89A 4FYTA 1QPQA 5I8CA 1AY1L 2CM6A 4HJJH 2D24A 1MEHA 1OFAA 3NNTA 1TTQA 3VB9A 4OH2A 3VFGL 4DAGH 1XIWA 5ICYA 4Z8FL 2HK1A 3CPGA 2OFQA 3CQFA 3PCYA 3WIHL 1QPOA 1JPIA 4WFFD 3DJTA 3MV01 4CN1A 4KX7A 4OZIF 4XAWL 2WBJC 4US6A 3Q6GH 1MIML 5LQBL 1V6VA 4NCDA 2OL3L 1AHKA 5MEPA 1ANUA 5L2KD 3DG7A 5F7BA 1SZNA 1H8NA 1B9KA 3CK0H 2O5ZL 4MS8C 4XI5C 4XODA 4M7TA 1UD3A 3EOTL 4FEMA 2NY1D 4V33A 3TNNB 1KCWA 2WWKO 1WDWA 1OTUC 5DJ6B 5I6NA 4H8PA 3C6LC 4XO6A 3WO4C 1LM8V 2ETWA 3AVEA 4E9YA 3MRJA 5DJDA 1DJNA 2X3BA 1D5ZB 5DF0A 1T4WA 4WFEE 4QXGL 1JL8A 4I9XA 3L67A 4RX0A 5L8JB 3BVDB 4ASTA 1U5HA 2VIRA 3P73A 1Z42A 3PPCA 3DROA 4PRAB 5KANG 1SHMA 3GSOA 4E9RA 2RGLA 1SHWA 2BB0A 4FXJA 1HNGA 3FN0H 1SFDA 4Z7IA 4KVNL 3PPSA 3QIBB 3LRKA 1YEKL 4EQ2A 5A6LA 4LAKA 3VCRA 4IK6A 3UOAB 2WINB 1FORL 2QV2A 2JKTM 2UY4A 2VCCA 4OT7A 4PL1A 3R7MA 4HGKC 3IGLA 4HF5H 3N2JA 4LDOB 3AXLB 3TO2B 1E4XI 4A7VA 3CVIH 2I9LA 2BNQD 1RR2A 3OKMB 3GJFB 3P40A 1M2VA 3ZTEA 2WJ7A 3P77A 1VZWA 3RR4A 2IBZY 3LQGA 1PVHA 3U2EA 5JMUA 2PTDA 2VLKE 4LF1A 1AZNA 2D9QB 4PIRF 3V4PA 3S5ZA 1YRKA 1TTPA 1TTIA 1XBZA 5D5MB 4IG2B 1A53A 4J8RB 5FK9B 1OPGL 3PBUA 2NXIA 4Z0BL 1LO4H 5EF2A 1MCCA 3BLDA 3QBUA 1B3XA 4CU7A 3TE9A 2FSEB 3PPGA 4X98A 4RW3A 1BG1A 3GD6A 3E2QA 3VNJA 5AW7B 3AY2A 4PCYA 4AT6A 1EHLH 3NCFB 4WRHA 1MCPL 2CNYA 1Q0YH 3E0WA 3QZWG 2NLIA 4JG1H 3I74A 3AIVA 4GE8A 4JNMA 1TV8A 3MJ9H 2CWXA 3LM7A 4IMEA 2F5AH 2H6PB 1JP5A 3FC8A 4TSBL 5DR5L 2ON3A 3ABQA 3FA5A 3MBWB 1TJ0A 4DJED 4PJGE 3H1ZA 3BN3B 4OIAA 1RCQA 2JGQA 2XSBA 1J05B 1CLYL 1IGFH 1KRBC 5IDIA 5GZNA 3ARBB 3BE1L 3IS4A 4JDYA 2Z3FA 4DM1A 2C4FU 5EU6B 1XAUA 1IGMH 1XR9B 4E9QA 5CEZH 1W17A 4LNYA 4FKHA 4JFOA 5L2KB 3ULVL 3W11D 2CRYA 2R1YA 2QQNL 4KK6D 3DXAE 3Q2LA 4DEWA 2G4EA 1F3RB 4GKTA 1RZPA 1UENA 3CSPA 2OX1A 3WN5C 4AQLA 3VKKA 1J8RA 2VEPA 3P3BA 3KWWA 4A29A 1MCKA 3ABKB 3V2AR 4AT6B 4QR7A 4JHOA 3QDGD 4TUOA 3H7BB 1M53A 2J8OA 1DWAM 3ZZQA 4A7GF 1DQJA 4V28A 2V4LA 5HY9B 3KYKH 2AK4D 4PMQA 3BP5B 3ES6A 1KW1A 3DIPA 2A9NL 3OKNA 3KVJA 4AGNA 4IDJH 2QQ6A 1T96A 3H6AA 4Z7WA 1RZGA 3WJWA 1TSHA 4OKDA 1AHWB 4MCNA 3BT2L 3FOKA 2J8FA 4M8QA 2ZCHH 4XOEA 3TBSB 4P9HL 4F37K 2F54B 1LMKA 2DQ6A 4Y2WA 2HT4D 2FBOJ 2VDPH 3ZE1E 3S35L 3AXXA 1QR4A 4U5KA 3C5SB 43CAB 9XIMA 5KYXB 1UJPA 5C54A 2NXYD 4TQ8A 3P3SA 2TAAA 4BFIB 3GHTA 3RITA 4A05A 3F2BA 3IU4H 4HH8A 2PWVA 4M48H 1B2WL 1X9RA 4GAGL 2NV1A 4KK6C 2JJSA 3EX4A 1ES0A 4I9AA 4N2GA 3VKDA 3WJZA 1AH4A 2B4CH 4DI8A 3P9WB 1C16A 1ZGLP 2FFCA 3BPCA 1P5UB 4JFWA 4L6DA 1NIUA 4DEUA 3H2FA 5IBXA 4QXUH 1LDSA 2VDNH 3MLSH 3MNZA 1GTFA 3PNUA 4IPLA 2CBUA 4RE3A 4WQ6A 3QEUA 1I1AD 1XS2A 3O9WC 4FI4A 5MI0B 1UWGL 3WEXB 2XJKA 4C1NA 5I66A 3FTZA 1AHWA 2CLEA 1ADDA 2Q01A 4F0SA 2F58H 2QV4A 2YSSB 2ZCKL 4U28A 3LYRA 3WEOA 3TLQA 3QZEA 2WXFA 3AAZA 3DUUB 1EJ8A 5SWQA 3QRFM 3ZHDA 3SPVB 1LD9A 4ZPTA 5FA3A 4XKYA 5GPRA 4BZ2H 1YY8B 2YSWA 3BLKA 4JVPA 4F1ZA 4OFPA 5FK9A 3LV6A 1KXQE 1EIXA 3ZKQD 4S38A 2NSOA 1TPEA 2GGIA 1SGJA 5BXPA 5K9QG 2YKLH 1I8LC 1A4BA 1TJGL 3L3OC 5DRWA 4AI7A 1SFSA 1BZEA 2F08A 3IGAB 1C16B 2Z7ZA 2B7DT 5CP3A 5BRZA 1K9EA 4JTHA 3CC1A 2IALA 2XN9D 4FYSA 3U0TA 2FGZA 1NANI 4HV8A 3ZZSA 1ECEA 3IJSA 4L0PB 2H2PD 4HJGB 3ERPA 3SE8L 1LQBC 4MNQE 3MJ8A 5TBOA 1DLHA 3E3QC 2DLEA 4HJ1A 1PZ1A 5A69A 1DBTA 2DW7A 4JMXA 4N9GB 1XRTA 3AY4A 4P59H 2B2XH 4R9HA 3D39D 8FABA 2ZE3A 3ARSA 5EIIB 3QXAB 1OT1A 4TSBH 4N2HA 1ZTVA 4J6IA 4DKEL 3PHOB 4PB4A 3HS9A 5KWYC 2DUZA 1Q94A 1W15A 4XGZB 2ZUSA 1E4WH 3EGDA 4IEFA 1LNUB 4WO4C 5T3ZH 3MKCA 5HMFA 1G94A 1WZ1H 3FUMA 4YHZH 4PRNA 4NILA 5EG6C 5C9XA 3IDUA 4H20H 4YYFA 3BOXA 5H37H 1Q9LA 4GSDH 4JQ3A 2FTWA 3WBYA 1U93B 3TYCA 2HRHA 2E9BA 1OGBA 4PJDB 2IWFA 2JKSA 3MRRB 1H3PL 3POHA 3W39B 4N2EA 4KXBA 4ZQRA 2K7QA 3VACA 5KG9A 3ZVVA 1KPVA 2RH9A 5DEZA 4DGYL 2YEZA 4PMNA 2RQEA 1PTDA 3HS8A 2FFIA 1RZKC 1MFNA 2E76C 4JDZB 3H9SD 2AK4A 3CVHH 3HTLX 4ACZA 2XWBA 2IQTA 1K03A 4NZRL 3ZE0E 4OGAC 1BMWA 3QORC 3FCTA 4JQVC 3IGKA 4X4XB 3PUEA 1FNLA 3F4WA 1WZLA 2EECA 5C0CB 4NC1C 3LUTA 1O5PA 3QMRA 5E5UB 4CKQA 3VXUD 1SBSH 4O13A 2DKMA 2ZX9A 3STLB 4KEUA 5D37A 3LB6D 1KGIA 1S3KH 2OP4L 2XFXA 3BQUB 3D09A 4FXKB 5ENWB 3TFKD 1URIA 4FALA 4K3JL 4G6AC 4N2LA 4ACYA 1KB5A 5ACMA 3APDA 2V37A 4MM1A 1FDLL 4M93C 3S3BB 5IFAL 4I6VA 4OECA 1GTNA 2IMRA 1BLIA 3MFFA 1KZYA 2V8MA 3AROA 4GVGA 5E09A 4ZUSA 1F6PA 2OFJA 2O72A 3OZ9L 4G1EB 2O5XL 3FPYA 2D3VA 4OJEH 3SSGA 5HYQB 3M1ZA 1KIPA 5BV7B 4K37A 5C2GA 1KIUA 3CFNA 1N6VA 1SYTA 1EYWA 2WTPA 4FL4C 1V6TA 3DAQA 3DV4B 1D5MA 3W6YA 1Q2RA 1NCHA 3DHFA 1LOLA 1CEOA 5J1SC 2LU7A 1T1YB 3ZDXF 4IQHA 5FYLD 2HUEA 2YJQA 5TDOB 3W56A 4OKVB 4JANB 2DWDA 5CXPA 4X6BA 2DDQH 3M64A 1XF3B 2CRIA 4YO0A 5IB5A 3H12A 1R86A 3SAZA 5CEZE 5I8KL 3EW3B 1IARB 3FCBA 4M5PA 4LBUA 4IT1A 1FY6A 4GW5B 4BFEA 4M6NH 2ZADA 5JR1L 4XN2A 1JGVL 1P1ZB 5IVXE 1T8QA 1OE3A 1M57B 4JO5A 2CLOA 3W72A 4UM8A 4XRCB 4OM1L 2HISA 4FHJA 1EDYA 1EZLA 1UZ6E 1X5AA 4PODA 1E5JA 2NQJA 5E2TH 4F9LA 5C9JB 2UX6A 4HFWA 1DQWA 1KXTA 2CXGA 1LEGA 2XZ7A 1DBJH 4G42B 3TEWA 1BYNA 2BINA 1OB1A 4GKZB 4HSQA 3WBXA 5CSZB 3K2IA 2EH8L 3QJOA 2EVHA 4JKLA 3A0OA 1QR1B 4IOSD 4X5XB 4RFOH 1ZLUH 3QW3A 3EZJB 2D2OA 4AWEA 1T21A 5DUBB 3F85A 4PJ5D 2KLTA 2WYHA 4LL4A 4ABUA 1DN2A 5LKNA 2FQIA 4XTDA 1QI4A 3CXDH 3DTDA 4Z77B 5H35A 3CLFL 2FDSA 3GX9A 4QCEA 3I9GH 4U0QB 5E2VH 2G0KA 2ZXQA 1KGJA 5EC1A 5HDOA 3M0HA 2VUYA 4HZMA 5INCB 2MFNA 4UFHA 1IC0A 2J62A 1D7BA 1GT8A 1L4IA 1CLVA 4NDMB 2NNRA 4BDVB 5FWRA 2CGRL 4DK6A 1HSAA 3LQZA 5BVPL 4CD4A 4HPXA 5HUOA 2YSTA 4YX2H 3FS9A 2VR6A 4KWVA 4K5LA 4Q4QA 1NVMA 3Q5YA 3IWUA 1G5GA 3SKOB 4AB4A 2LV4A 3TWCH 2IXQA 1EB3A 4HIXH 3N1MC 1RV8A 2PP9A 4AZUA 5I1CH 2BXVA 4OIIH 2QUUA 3TKFA 5I6XB 2YD7A 1HVQA 3B9OA 1R3LA 3JT2A 3E6HB 4E9LA 5IP4A 3PTMA 1HS6A 2H1XA 4D6GA 3QS2A 3FQTB 1D5IH 4KXZI 2W0KA 2OYMA 5C0JB 4P5MA 3IFNH 1IKNA 4GLRH 1VBRA 3DDFA 4FG4A 1IU1A 1U8OA 4LRIC 1O6VA 4KVCH 5G55A 1TJ2A 4NENA 1TVLA 1V51A 4R97B 3OAUL 1O9ZA 4XZUB 3I4EA 3EO1A 4MAVA 5J13C 1NL0H 2Z7YA 4HIBA 3AIBA 2AEOA 1MFDH 4IBZA 4GMSH 1QDSA 4JO3H 3E02A 3FT3B 5J6HA 5F89B 3SQOH 2ZUQB 3CFKB 1IWAA 1UTDA 4Y2DD 1RH9A 2IPJA 3W9DB 4C91A 3UP1A 2XVLA 5A7BA 2VN4A 3E1ZA 4CNTA 3I6LE 3O3RA 3B43A 4TMBA 3VYLA 5CR8A 5H8DA 3SO7A 2G9HB 1M1XA 3NFNB 1GW1A 2ARJQ 3HQNA 4PV8A 4LCSA 3L95B 2FZNA 3P9MB 5D1QB 1XLIA 2R4RH 3ESVF 2VWEE 2NYYD 3S3CB 3RPTA 2CG9X 5D7EA 5I8EB 3EJYD 1E4LA 4LLMA 5I1HL 1R17A 3WH7A 4WVRA 2YFNA 2C18A 4FOKA 2D22A 3KHDA 4HT1H 3WY4A 2WQUA 1S5NA 3EHBC 4KI5E 2X4QB 3VKJA 5EOCJ 5T3ZE 4NN7C 3G2GA 3HNTH 1NIAA 5LNVA 4ODUB 3PFUA 3VXSD 1R19A 2VXVL 3CDCA 3CB3A 3E0IA 2R69A 4ENZA 4FNRA 1H6UA 4XZHA 3F64A 1OD9A 3EYOA 1KBJA 3PZNA 5LNSA 5JH1A 1QP1A 3F2CA 3ZSTA 1MCEA 1AGDA 4NERA 2X4TA 4LCYA 4FMFA 3GJFK 4QXVA 3CZFA 4HETA 1J8KA 4GC4A 2F61A 4KDWA 3O0LA 1CGTA 1S4IA 2WO4A 3C61A 5BXTA 5AAPA 2HT4C 1POKA 3IPFA 4NRZB 2B1HH 2A7BA 4FZEH 1KCSL 1ZBWA 1F6KA 1EZVX 4MMXB 1MHPH 2GUOB 4EKJA 5C6WH 4AM0Q 5D1ZC 4L0YA 4G8EB 3RGBA 1Y5VA 3EOLA 4H8WL 5IG7B 2X41A 3SGKC 1BQKA 3OV6A 2DEWX 3GK0A 4AZ7A 1NMCB 1RZ8A 2H6OA 1EPFA 1RK1A 2VR3A 3F2LA 1BJMA 5I8CB 2OKMA 3MXWL 4GRWE 4RRPM 3MBEC 5A8OA 4DN4L 3TO4B 1MIEL 3GSXA 3NFUA 2WTOA 4DWSC 5HQLA 2HJFA 1ROWA 4FI7A 4NAMA 5F6IC 3FUJA 3T0BA 2WZAA 3QHFH 1UKPA 3HE6D 5D1XA 5AUMB 1U8HB 4OQVA 3IAGC 2EADA 5I6PA 2EDRA 3KVPA 1E5ZA 4PGBA 4PY7A 1HVXA 4QHNA 1HKKA 2XVKA 4GVHA 2ROXA 4KK8D 2XFYA 3BURA 1GAFH 3VXQB 1B3ZA 3PC0A 2QVIA 2PLJA 1E5NA 1V77A 5CR1A 4Z7QE 1GMEA 3H3BC 4JZJB 2VGIA 1VYRA 2C3XA 3RGVA 1U8CA 4W9HC 4F7EA 2Z0IA 2HT2C 4P5TD 4EXPX 3V0DA 2YL8A 1I8AA 4HEMA 1IB5A 4WKZA 1ZHBB 3U46B 4PV1C 2I5QA 3FSVA 3MPGA 1TWDA 5F0PB 2FJGB 3GZKA 4IRZA 2VYRE 3VX0A 3WFEL 2FJKA 1BX2B 1QU4A 2XI9A 3D2UB 3LKQA 1FNGB 3GMQB 4GW1B 4MD0A 4ZX5A 2LABA 3HG1E 1E30A 2B4CC 3CN2A 1GTEA 1CL7L 3ROOB 1ACXA 3QIBA 3E3QE 2EPHA 1BYBA 2HYMA 3KXFE 4Q74A 3MOBL 2MNRA 3OODA 4FOUA 4H6KA 2IG2L 3BVNA 3VKBA 4MHHI 2QFPA 4P4KA 4PH6A 4I9JA 1T6WA 2AV7A 2ICEC 5T3XE 2OMYA 4XE0A 2WMJA 1OW0C 2V7HB 3ARGD 1DWIM 5C55A 3P77B 3AB0B 3QUXB 2GJZA 4N6RB 1UT9A 5I76B 4QPEA 3D3VD 4XMVA 3W3BA 4YEFA 1B0GA 3HE7B 3KX6A 3ELAT 1EDHA 2PWFA 4GQPH 3GZ3A 3PWLB 2NSXA 3FONB 5EBWB 3MWAA 4HUMB 1ZXKA 3EG9A 3R18A 1XXXA 5EU6A 4AY7A 1AKJA 3R4IA 5HPCA 1FRGL 5CJ5A 1D6EA 2ENQA 3H6JA 3QEQA 3WFDL 4XZIA 2XIOA 2F53B 1U95B 2VYOA 4GI4A 2CUHA 2J75A 2OTUB 5MP6H 3SOTA 1YDPB 4I6KA 3K4WA 5IFHH 3L66A 4I89A 2X6VA 1L9QA 3JV6A 1NCBH 4J6RL 2M26A 1F8MA 1KT2B 4X6CA 5I19L 3R43A 4TULL 2HK0A 4J3BA 4MA1B 4B0MB 2VXTL 3MOQA 1VESA 4KVPA 5D71H 1H2JA 4W9GC 4FNPA 4X5RA 1P69B 3V6FB 3MODL 3PAUA 2C9VA 2PA6A 2DB8A 3E2HC 2WSRA 2GJZB 4N6RA 4P9HC 5GZND 3IXTB 2K8MA 1MG3C 4X9GA 4BQ6A 2YC1B 4E9TA 3EYSH 1CD8A 2AANA 4IKNA 5IFPA 4HKXB 5T1DL 1XM3A 4LLMB 4GI8A 3MX0B 5KVMC 4YNYA 5CWSB 5E00A 2QPSA 2RAMA 1VCGA 3VWJB 3V3WA 1FE8L 5DD6A 4TXVB 3U48A 2R1NA 5JIMA 2ISFA 4AZIA 3QEGL 1BWVA 3OQ3B 4CC0A 4I3GA 1ISXA 2WB1A 4AIOA 3EB2A 3GMOB 4IKIA 3GI9H 4BQ5A 1R87A 3QV7A 1W54A 4MAYD 3EWYA 3ONCA 1MUJA 2HQAA 5E9DA 3F7YA 4QO1B 3DFSA 4F40A 4QNPF 4IRZL 1OT4A 5E1GA 1CIDA 4LHUA 1B3YA 1QTYT 1M42A 4P46B 3P2BA 5I1KH 5E94A 3MCLH 1T7YA 4XWGH 3L6FB 5D4HA 5GRYA 2Q7YB 1DR9A 2XA8H 3D0LA 2ENYA 5DRXA 1MWAB 3RJQB 1AP2B 2I85A 2JI3A 2L7EA 3U79A 5HP5A 5JHDD 2RKXA 2VGGA 3GVRA 3T04D 5DJ8A 5DMIH 4ORIA 5HDBE 4TVPH 2AJXL 5CWSA 5E00B 2ZZ5A 1MI3A 4IHCA 1OK8A 5KOVC 2XYCA 2E46A 1HQ4B 3O3EB 1ETZA 1T0OA 3A6CL 4JN1L 5CGYC 5F9OL 1P7QB 5ES4B 5MHSE 4L8CB 1P43A 2VDML 4KFNA 1A5KC 1SJXA 5E4EC 3H56A 4UUIA 4AXWB 2FO4A 4J8RA 4TRPH 3PUGA 3V16A 2PODA 3NZQA 4FR6A 4F9DA 3L17A 2UXFA 3GBDA 4YDZA 5BPPA 3BW4A 4W5ZA 2V5MA 4R2GB 1TV5A 1JCTA 4I2XA 4L23A 3O4LE 2JI2A 4KXDA 3NPXA 1LE9B 2Y5SA 3T4CA 3AM8C 2Y7EA 2JJVA 4G1MB 3H2NA 4YBLB 3QWNA 3SRDA 3LVEA 3CUIA 1B88A 2RD0A 2WXLA 3IU4L 4AV0A 4E36A 3TV3L 3EWBX 1SSDA 1HTYA 1EP2A 3DC0A 3H55A 2QV5A 3EFOB 4UWQB 4NX0A 3KS6A 2ZJSH 4HBCH 2H45A 3MUXA 4N8VA 3DFOA 1OOWA 4F7MA 2J9YA 1NAMB 2H3NA 3QUXA 4B3EA 2BLEA 5MEQA 1HHJB 3UZ5A 4O28A 3H26A 4G9FB 1EEYB 1FI8C 2ZXGA 5FM8A 2XU2A 5T91A 1EZWA 1MHEB 4ADJA 2NZLA 2BNRB 2XHNA 1TJGH 3QV8A 4TV6A 4DF0A 2H32A 3O6LH 1CD9B 4YSPA 3RP1A 3WJJA 2W88A 1ET7A 8PAZA 1GOMA 1CWVA 1CF8L 4E9SA 2OTUA 3WKPA 1J12A 4YVNA 3GF8A 4S1DD 5JXEA 4Y9NA 3WUGA 3MRCA 4NQEA 1GS8A 1OABA 4GYPC 4TSAL 3U9PH 3GVGA 3SN4A 3LAFA 4PJBF 3QIWC 4U3SA 5AWNH 5GGTL 1ONXA 1A4KB 5I3JA 2HJKA 4HWUA 3BZ5A 4DRSA 3TEVA 1E4JA 3RWIB 4NJHA 4BS0A 2WGNB 2IDSA 2DW6A 5DVPA 1ZT4A 4Q8QA 1UQZA 3BG5A 4X2UA 1C8VA 1DQML 1U8NB 3AFLA 4K3GA 5ESVB 3V4LA 3UJ2A 1WFNA 1SO3A 5BW7C 1KJ2B 4EZLA 5I76A 3X11A 3K72A 4PS4L 3U0WL 2V2TB 1SJHB 2KQNA 3Q94A 4EQ3A 2FHBA 2ZC8A 4KEMA 4LLUB 1XIJA 3UXLA 1A6UH 1V7MH 3KS0H 1AKJB 1QA9A 1UJQA 5B39B 1H8OA 2HTMA 5IF0B 3SJVD 4GYJA 1EAPB 2R0LH 2NZ1A 2ZAIA 3HZVB 3HPLB 3ZYJA 5ABFA 1LK2A 1L6ZA 3LRLA 2ACSA 2W92A 5E2JA 4ZXBC 3MXVL 2WXJA 4G6JH 5B3JE 4AUBA 3RX8A 4MJMA 3ZDWA 3VCCA 2PU1A 2C4XA 2B9BA 4K23H 5FF0A 1KC5H 3KL0A 3EHBD 5HYFA 5IESL 3OEXA 3ALPA 1GGBL 2ARJB 4XMXA 4BFGA 2DQUH 1KLUB 3DX5A 5TDNA 4B9FA 2EXWD 1H15B 4QHLA 1ZAJA 2WMFA 4NO2B 4YR6B 5DYOB 1MAKA 4P46A 4L2LA 5TD4A 1GSKA 3U1SH 4AQEA 1NY1A 2KPWA 3RLGA 4GKSB 5EU7E 1QNPA 1T0PB 2EIMB 5LGKA 3H4WA 3FOMA 3GDKA 3HI1B 1K5NA 1CENA 4RNHA 1DQQA 1L9OA 2H9GA 4FFWD 3M0XA 2P5ED 3ML8A 1A7PH 4NM4L 3QFDA 4Z1PA 3ZHLA 4YHPA 1XVSA 3D5OF 4JTSA 2W63A 4ZS7L 1XGQB 1AXSA 3L5WB 2O4EA 4Y96A 2Q3RA 2V2WB 5I6OA 3MVIA 4JZOA 3GC4A 1FCGA 1RJZB 4DEPB 5DRNB 1UPMB 4NHVA 4PMYA 3EOAA 1ETA1 5EZIH 1WF5A 2IFFL 2DY2A 4UAOB 1JZ7A 1LRQA 2FPVA 3MT1A 2D9CA 3MA9L 4QLWA 3TJHC 1YEFH 3SODB 5D2NC 2SFPA 3GM0A 4JE4B 3SCMA 3KRZA 4JZ5A 2OJEB 4MMYB 4YHIB 2PLCA 4MJHA 3U6XS 4KKLC 4H9MA 4G8IB 4CMHC 4LVHC 4QQ3A 3THAA 3V4VH 3U25A 1N8ZB 1IRAY 4ZQNA 2HMCA 3PFQA 3PP3H 2HNEA 4PGDB 4ZDHB 1C12A 4JFQB 3R7RA 4LAQL 1U1JA 3TQ0A 4BKNA 3QDGA 3PAZA 4O2CA 4XAFA 3JQOB 1L0YA 1P2CA 3KLAA 4KK5D 4UOW1 3VWKB 5HHQB 4G5ZL 1N59A 5C7XL 4NKIL 1S38A 3ALXA 2VR8A 4PVBA 2VKWA 1ITUA 1F90H 3R12A 4OKVA 5EIIA 3RX7A 1CVRA 3LERA 1N82A 2C14A 1A7QH 4N0CD 3T3MF 1QPKA 5DLCA 5EY5A 3V0VB 4HNTA 2YEQA 3CVBA 4J4KA 2GSIA 1DEEA 2JSFA 1Y0EA 3IFLL 3C0QA 3W53A 5JR1H 4YMPA 2GW5A 4NZUL 2IS7A 2VVSA 3RILA 3RB7A 2G60H 4MJ5B 1INEH 3I50L 4H8UA 1YMHB 4BK5C 2G4JA 5F1NB 4I13B 1CFVL 2DS4A 1MZZA 4RDQG 5AW0B 4R3SB 5C09B 3SQRA 4ZMXA 5LVEA 3PABB 4GSRA 4WWID 5FLUA 3MDUA 4Y16D 2DQWA 4KETA 1KM1A 2ZA3A 3T0DA 3NQKA 3BO8A 4ONOA 5DJCA 4REQB 2BCMA 5DTFA 1O9VA 4HFUH 3D5HA 3QDGB 5AB3A 4GKZA 3WL9B 4MXVF 1U3JA 4RMBA 4RXFA 2J88A 4X22A 3QG7L 4RZKA 4HJSA 1QWKA 2XVGA 4P23B 2QFRA 3WJMA 3N2BA 2DU2A 1HHJA 2R2HB 1RIHH 4DCQA 1CXLA 3DUUA 3VFVA 3VD9A 1ZAHA 2ZSWA 4GG6E 1K8ZA 3SUVA 4BKLA 4LVNB 1F5WA 3RUGB 2X0UA 4MRCA 3QTPA 5IMOB 1W37A 4WI0A 2K6YA 2VLRE 4H8HA 1WZMA 5AOZA 4WV1C 3QDMB 1CCZA 4I1PA 1E73M 4S39A 3BZEB 1YKWA 3CZGA 3QPXL 4AEOA 2NUTA 1NQKA 1X7SA 4XVJH 1M6JA 1OGAE 3PWNA 4HK3N 5ECGA 5C0FB 3THMH 1R3IH 3UT0A 2B3RA 1HKWA 1ZU8A 1MPAL 2WXOA 1OLZA 2NLJA 3AWOA 1OAYL 2WNQA 2F84A 4IBWA 4I3RH 3K2KA 2F18A 1E4HA 1E0VA 1OF8A 2OMUB 1ZT4B 4U1GB 2B0MA 3W7RA 2VZSA 1RUQH 1RHFA 4P9MH 2DPEA 2HXTA 1KDJA 5JO5A 1B3OA 2WQPA 3VILA 3CDZA 5LIUX 1ET8A 2H6PA 1P4IL 2I32A 1A5FL 1X9UA 2A9DA 1KIPB 3L7EA 5F7AA 1D5BA 3RK8A 3D6GA 1BEUA 3IIPA 2ESVB 4G8GE 1U8LB 3WOVA 1J0YA 1OVDA 4I3SL 4XGZA 4LLYB 1AS7A 1CB7B 3ZE2B 4MMWA 3OVGA 4LC8A 1AZCA 1NFIB 4LAMA 4JQAA 2YMXH 1XR8A 3FRPB 5JHMA 3P0XA 3OAYK 1A64A 4OU3A 2WSYA 1NDYA 4AE1A 2EDYA 1NL0L 4JFSA 1Q9LB 2QLVB 2Z93A 3QUMA 1TYJA 3CXHJ 1QUNB 4OJCA 4KTDL 1PL9A 1TPVA 1WDSA 5DGRA 5CILL 1DBBL 1QSED 1R9FA 3O0RH 4GW5A 3Q9PA 4HKBA 3LTPA 1RALA 1NFDA 3HQOA 4J1UB 3LB6C 3GRWA 1P1ZA 5FW6A 2VCAA 3AWNA 3BPOB 4OM0H 3BYYA 2V2XA 5JDJA 1ZJBA 2DWSA 4GGHA 1L0QA 2X09A 5EBGA 5D33A