1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-galactosidase
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
1LRQA 2A5HA 1F6KA 4AEFA 1F5ZA 2BXZA 2YPIA 2ZCGA 4O1CA 1Z48A 3BAIA 4MB1A 3GYEA 1JJKA 1H7WA 4ZQPA 2YIHA 3UG3A 4TVUA 3NOEA 2YA2A 2CU0A 5CZ0A 5FI8A 1CXLA 1TPH1 5LZLA 1TPEA 4N2YA 2TPSA 3QYQA 3M1ZA 2X2JA 3NM1A 2VFIA 4QJ1A 1UD4A 1FUYA 1H51A 3O05A 2ISWA 2VOMA 5E1QA 1B4KA 1XD1A 2F7PA 3MWAA 4MZ8A 1U33A 1SR9A 1IGSA 1R75A 3RLVA 1R46A 3UXDA 3M5YA 5TD4A 1V3KA 1KTCA 8TIMA 4LXFA 4DO6A 1NSJA 1QI3A 4JTUA 3O8AA 3KLLA 2DJLA 1MO0A 3ZT7A 1Q3NA 1SQ7A 4LVAA 5LNVA 3BH4A 3IGXA 1JUEA 2FE0A 4LT9A 4BI6A 3L4VA 4RJEA 1Q6LA 2BXYA 3TSMA 4UQBA 5EY5A 3W7LA 4EWND 4ZZ9A 1VCFA 1ADOA 1MFVA 3TMQA 4W9TA 4KMQA 3OVRA 1JCJA 3A9IA 4IMCA 5DBTA 1P4CA 1O94A 1U30A 1EA9C 3PBUA 1LCOA 1H50A 3W84A 2D3LA 4WJEA 3LCGA 2QCNA 1KM4A 3CZNA 2F7FA 4ONVA 1QHPA 3BSGA 1XCXA 3TROA 5AC8A 2YX0A 2V2HA 1GVSA 3W83A 3QQ1A 4JFSA 1QNVA 2Y88A 2Y24A 2H90A 4XB3A 3IIZA 4M5PA 2VFGA 5HR6A 1UKTA 2WOQA 3JR2A 3HGRA 1RPXA 1X7FA 5DY3A 1M7XA 4WZHA 2UV8G 3OVPA 3KL3A 4WSJA 3ZFHA 1TQXA 2RKXA 2E8ZA 4OJYA 2V0TA 4MY1A 3BW2A 3FIGA 2WSKA 2ZE0A 3CU2A 3P84A 2EADA 4HOXA 2XIBA 3IRDA 3DFPA 3MI2A 2C14A 4JX4A 4O50A 1ICQA 2X2GA 3STCA 5KEZA 2EACA 4O19A 1TRIA 3HG3A 1NFBA 5I3GA 3H55A 1TCMA 5KSWA 4LS0A 1G4TA 3DHFA 2TMDA 4B9YA 1F76A 3BG9A 3MP3A 4UTMA 2E6DA 3NR0A 4ZQOA 5DXXA 3K1DA 4UFKA 4MJMA 2Z6JA 4QAWA 1MEIA 3NDOA 2OW7A 4AHOA 3ZSTA 1UCWA 1O5XA 1R30A 2QDGA 4UR8A 4NI3A 2J25A 1UD3A 3SGZA 2VFHA 3VNYA 2CFFA 1AVAA 4FLRA 5I24A 3VGHA 2P0OA 4YL2A 4GNJA 4WF7A 3C2VA 1HT6A 5K2ZA 5G1YA 2ZICA 4UTTA 1OF6A 3L0GA 4UXDA 3A5FA 3LBMA 1DOSA 1KWGA 3S0CA 3D4ZA 1Q4NX 1CI1A 5G4WA 3IJ8A 4PCTA 4Z1CA 2WPGA 2FH6A 2GPTA 4OHQA 3G1FA 2ZXDA 4LVDA 4JTIA 4NJJA 3EDKA 5D33A 1OK6A 2RDWA 4AB4A 4B5NA 3VNDA 3T7VA 3ZT6A 1QO5A 1KM1A 1PHWA 3W6YA 1BWKA 4UNKA 4IMDA 1FCVA 1IXNA 5FEXA 4GFSA 1KFKA 3W37A 1TJPA 3W7CA 4AWUA 1LLZA 2V5BA 2EO7A 1ML1A 1SFJA 4A3UA 1VB9A 2GQAA 4QITA 3LDVA 1F2JA 3TJXA 1EHAA 2B0MA 5EYWA 2QCMA 2WNQA 3W88A 1I2PA 1V3LA 1LWJA 2NXIA 1P6WA 1KGUA 2CZFA 1SZEA 4NX0A 1D3GA 1L6SA 4ADSA 4E2DA 1ZAJA 4ORMA 3TAKA 3DZ1A 3TIMA 3W72A 4J9JA 1FCUA 2XN1A 1KM2A 4G1KA 4TMBA 2FPVA 1LWHA 4N02A 4XKYB 2DU2A 2WSPA 1MW1A 1RP8A 1JR1A 5A2CA 1XUUA 1WE5A 3MO7A 3S1WA 3LLFA 3UG5A 2VEIA 3HPXA 1WA3A 3R8RA 1JF5A 1AL8A 4MKNA 1WBHA 4HN4A 4NU7A 1XH0A 4IWWA 1HFBA 1H3GA 2E68A 3NQDA 5KZDA 3D4YA 1XDMA 1SSDA 1KWKA 5U4NA 1U83A 4TX9A 3TC6A 4PEEA 1GVQA 3FEMA 3UWYA 3P61A 3W7KA 3BK0A 5D04C 5CXPA 2FB2A 2ZA1A 4K38A 1VFOA 4S2BA 1QDSA 4NZJA 2Z6IA 3KAOA 1D3HA 3W85A 2F2HA 1KFEA 1KBBA 1WXJA 1IZJA 4JTJA 2CLLA 2QAPA 3GXDA 3W7IA 4O0KA 2ZRZA 1A5CA 4JGDA 3VE9A 4MFEA 2Y7DA 1PCKA 3LBCA 3TMLA 5G5IA 5KZMA 2C0AA 3B0PA 4O8RA 3EXSA 2BX7A 4GRSA 4O57A 1UKQA 1WOBA 2NUYA 3GNNA 1BSIA 2QCDA 2WJZA 4U31A 1UD6A 3ZWSA 1V3MA 1HNYA 2NX3A 2DZWA 4DPQA 5DXYA 3UPWA 1KCLA 2JGQA 3VMPA 1PV8A 1H60A 3LRLA 4H2CA 4U2ZA 3B06A 5HINA 2BHZA 3N14A 2DZXA 3EWXA 3EJUA 3FOKA 3B0VC 1H62A 3FA5A 1S5TA 2FHCA 5D2XA 4UTIA 3WY2A 1PVNA 4FX8A 2IQTA 1LZOA 2DZPA 2WNWA 3CIXA 4NT0A 3HMJG 1TPC1 4EVZA 1DORA 2D73A 1LRNA 2GVGA 3PVFA 2PC4A 4FLQA 1P0KA 5TIMA 3OG3A 1AQHA 1BF2A 2YCEA 1VYPX 4R33A 4DO4A 2GJRA 2ATMA 1OYAA 3WK1A 4UZSA 4Y9AA 1GWJA 2Z1BA 3NZ1A 3UERA 1KV5A 1K03A 2Y85A 1JGIA 4GI8A 4J7RA 4I7VA 3D50A 1RPKA 3CT7A 3GXPA 1N55A 3OBKA 1A5SA 2FYVA 4O28A 5CGTA 4QISA 3BAYA 1WZMA 3RILA 3G1YA 1JCNA 3KL5A 5CG7A 3M43A 2Q3RA 2QMJA 4FMVA 4WLCA 2R14A 2Y62A 2AQWA 2QDHA 1SO3A 4I7UA 5A6LA 4B9ZA 4H4IA 3TJLA 3LGEA 2NT1A 1AL7A 1YTEA 3RLUA 1KGXA 1WX0A 2ZYFA 4MIMA 2ZX6A 1G4PA 1THFD 4O52A 2ZBTA 1JCXA 3GLCA 1SZNA 2H8ZA 3W87A 4CGTA 1EO7A 1ZJIA 3L68A 1G7VA 1EEPA 3PBVA 4FNRA 3NEVA 3U6WA 3IV3A 3BUQA 3LI1A 4ZQNA 3W70A 1ZAHA 4OWGA 2YZRA 2KZHA 2YXGA 3EB2A 3KLKA 1OFQA 1K8XA 4K8HA 1UOKA 4MYAA 4RCXA 3G3MA 4OKDA 1IXQA 4ML9A 1HL8A 4E2OA 3W1LA 2F7QA 1YTKA 2QJGA 5CPMA 2YW3A 2CLIA 3QMTA 7TIMA 4MUZA 3F4NA 1LDCA 1OYCA 3N34A 3MUXA 1CDGA 1G7UA 1KM3A 1JCLA 1QPRA 4LVFA 4O1DA 4JDYA 3FS2A 4JTFA 4U28A 5BNKA 3TFCA 1GQNA 4GKLA 3NL3A 1RQEA 3W86A 2E77A 1ZAIA 4DPPA 1B0IA 5KINA 2Z1KA 2QEZA 3PG8A 4O13A 3M6YA 2AAAA 3DFSA 1DJNA 2TYSA 1MEHA 4E2BA 3M07A 5I5RA 1OFAA 2V2CA 1SPQA 1XDLA 2EKCA 3S6DA 3CZLA 2OSYA 1GTHA 4FXRA 2C3ZA 1JIBA 2QCLA 1A50A 3JRKA 1O7DC 3B0UX 2OYMA 1NF0A 5KITA 5F4SA 3DC0A 3L21A 3GR7A 3W1AA 2GUUA 3LCWA 1WPCA 3WEMA 1GEQA 2QJIA 3G1DA 3N2MA 3GDKA 3EX6A 3SW6A 4HNTA 3KE0A 3HB9A 4GUHA 5FEPA 1WDWA 1CXEA 3CPRA 3A6OA 1M53A 3KVKA 3UY7A 1W0MA 4FX6M 5DY2A 3CQ0A 1W1ZA 2BY2A 4OU1A 3EJQA 3CLWA 1FXPA 4IX2A 3LXCA 1B4EA 4JIPA 3BLEA 5TQLA 1HVXA 3W71A 5I3IA 2G3NA 3M0ZA 2ZFAA 1FWRA 2VT0A 5G2HA 4BR1A 3GAYA 4AWTA 4UTLA 1ZJBA 4CLMA 4NJHA 4RZ5A 1PHQA 2YJQA 1CW2A 1FDZA 4DF1A 3FKRA 4GWEA 3I7RA 1EP1A 3NZRA 2WKLA 2F1AA 5DCEA 3TK7A 1JL8A 5DCDA 5I3KA 3QPYA 3MHFA 3QEZA 3LX9A 4BI5A 3QZEA 4OQVA 4JX6A 2NUXA 3DHUA 4POCA 5I3FA 4X9SA 2PWDA 4J27A 2HMCA 1LBMA 2NXGA 5BRPA 3PULA 4K36A 3VKJA 4M6PA 1NEYA 1W5NA 3BAKA 3WK3A 2VRKA 3L5LA 3BVTA 3GK0A 1YXDA 1J0JA 3OLGA 2BY1A 3H53A 3DX1A 4K7VA 3EX1A 5A8GA 1ZJAA 5HQEA 2RH9A 2GJNA 3P67A 2XWDA 4J28A 2QCEA 1G9HA 3EXTA 1JI1A 4M6VA 4X2RA 1R2RA 1T99A 2PE4A 3OLDA 3F4WA 3BUPA 3BVXA 2C15A 1OGSA 1J4EA 3IK2A 2E5CA 3CPUA 5KZEA 1VR6A 4BA0A 1LROA 1LTDA 1ZCOA 2C19A 2R8WA 3C56A 3GR8A 1SZGA 4J3VA 1KFLA 3EWZA 4R53A 2QCFA 3IJ7A 5E70A 5E9AA 1AMKA 4AXKA 3HZ3A 3ABRA 4RZ4A 2ZUUA 2P1FA 3M41A 3IVUA 2QV4A 4A2RA 3LCFA 2V8ZA 1R33A 1X1ZA 2QCHA 3LXBA 5D30A 2TSYA 3L4UA 2JK2A 2HS6A 2AGKA 1J0IA 4N9BA 4OV4A 3S5OA 4OE7A 4JYEA 3ZR5A 3L4YA 3DU0A 2HTMA 1RQHA 1V3JA 3W22A 1OFOA 4Y6GA 3WDJA 4GIAA 4CN1A 4UMAA 4UNLA 3DAQA 1FQ0A 2DP3A 4GUJA 3W3OA 1FCQA 3UWVA 2G96A 1TPVA 1TRDA 3DFTA 3EEGA 2ZZ5A 1PZ3A 2ZUSA 1R2TA 2CZ5A 4UIOA 3SY5A 3LTYA 4RV8A 2ZXQA 5CZTA 3WNMA 2GJLA 3GDLA 1UH3A 4O53A 1K02A 1XBVA 1S5WA 2DZVA 1KCKA 1G67A 4UCGA 2CLHA 1E40A 5DCBA 1EUAA 4PL2A 4NQ1A 4WQ6A 2G3MA 1V7YA 2C18A 5LNWA 3OEXA 1C8VA 2TAAA 3MBDA 3NPXA 3N3MA 4IMEA 1UH2A 4GO9A 5DBUA 4GE8A 1HUVA 2OMAA 5FF7A 2F18A 3W7PA 3OLIA 4IXHA 3DX0A 5C54A 1CXIA 1QWNA 3OVQA 2CLOA 2RDUA 4FF7A 6TIMA 4AMAA 2WANA 1O4UA 4IUOA 1VQTA 3Q58A 1W5PA 3PC0A 4WD0A 1QAPA 3UXAA 4MZ1A 3HJEA 3NQ2A 3STEA 3L0NA 5D09A 4M7SA 1ZS2A 3TR2A 4UMBA 1D7FA 3BAXA 3LCXA 1W3TA 2WCSA 5U7SA 3W7JA 5AC7A 3S2CA 1O5KA 3P7YA 3Q37A 1H61A 3E0IA 3M9YA 2ZIDA 2X30A 5G1TA 6TAAA 4WY0A 2ZWYA 2PCQA 2OW6A 2FIQA 3NXFA 3VM7A 2PRMA 1JRCA 3GKFA 3D0CA 4OT7A 4UZUA 3S1XA 2HSAA 3PG9A 4YCPA 3LHYA 5AYXA 2WCGA 3VX0A 2OZ0A 4XBKA 4FLOA 3DI0A 2WVTA 4BZYA 3DH7A 5I0DA 1W3IA 1JI2A 1CPUA 1EIXA 3Q2DA 3EJRA 1XD0A 1EPXA 3BLIA 1DV7A 1W54A 4PH6A 3SFKA 1HL2A 1O95A 2GVJA 1C9DA 2WSQA 1K7XA 3TQKA 1VJIA 4MPQA 4JFVA 2QPUA 3QFEA 4FO4A 3WJXA 4MAZA 1JUBA 2EAWA 3B4UA 3O1NA 3HO8A 3BUIA 3DKLA 4RZ6A 4AMWA 4GXMA 1H7PA 3UWWA 3VI2A 4AEOA 3Q94A 5BW6A 1BEUA 4LC8A 4O14A 5A2BA 1GJWA 1KXTA 1GCYA 3GX9A 3S5YA 4AW7A 2C1HA 5CZSA 3DFOA 3M5XA 5FEZA 1CGXA 1IV8A 2LLEA 4X0NA 3W7EA 1DQXA 4HT3A 1K8ZA 3AO0A 3TOPA 1BTMA 1TPDA 1VPXA 4AVFA 4DEFA 4HNUA 1ONRA 2J24A 3WNKA 1SZFA 4EF9A 4M7TA 3RF9A 2PWGA 3GXNA 4HSOA 1F73A 3M16A 1T0OA 4RX0A 4CVWA 3IEBA 1GVIA 1LLWA 1Z32X 1VCGA 3D51A 3G18A 4NJGA 3PY2A 2QF7A 4HKPA 1ZENA 1VC4A 3LM7A 3QMRA 4BK9A 1SSGA 3GTNA 3W9ZA 3LLDA 1EX5A 4JTHA 3A22A 3LPOA 3M5VA 3LHWA 3LV5A 4JXCA 3W1MA 2C6QA 3VSTA 3E96A 2F7OA 1DTUA 5AHMA 3RK8A 2A2IA 1LYXA 5HULA 1O60A 4DELA 1YXYA 3WDIA 1QPQA 1KFCA 4NJKA 2DH2A 2CZDA 3DENA 2Y61A 2Y6ZA 1M6JA 2ALWA 4UTWA 4FX7A 2PRHA 4MLRA 3GDMA 4UQ9A 1K7EA 1PZ2A 1ME7A 5MHBA 4GUIA 3VE7A 2Y63A 3GXIA 1QPKA 5KTLA 2BY3A 1G94A 1EWEA 4FNPA 2QKFA 4E0CA 1QPNA 1F74A 3AXIA 5EL1A 2FFCA 1RZMA 3VSVA 2Z2UA 1XFBA 1L6WA 3BMWA 4JCMA 4JR5A 1CGUA 4UNIA 2A85A 3GBDA 3ABQA 4JFWA 1QI5A 1T8XA 2A6NA 2FTPA 4JFUA 2XFWA 4AMXA 3GB6A 3II1A 3BLBA 2X1SA 4W93A 5AHLA 4GI6A 3PSVA 2PWEA 3HG5A 5D05A 5K9CA 1LOLA 1L6YA 1PAMA 1BG9A 2QCDB 2JKEA 3L5AA 2X1UA 4LVGA 1H1YA 2EPHA 4P2VA 2J6XA 1YPIA 3N73A 2PRLA 3NM3A 4GBUA 1OB0A 5L6UA 4D2JA 5HWMA 1ODUA 5DLCA 1VZWA 3UD6A 2J88A 1F6PA 1KM0A 2VR5A 3PF3A 4UQEA 3NQVA 2V5LA 2QUUA 5AYZA 1IXPA 2OT0A 1DEDA 4HOZA 4S1FA 5IBXA 4LV4A 3ZS4A 2YA0A 1QHOA 1MEWA 1VFMA 2ZA3A 3IIOA 4NXSA 1W9XA 3CTLA 1CXKA 1XBYA 4AEEA 1UB3A 1C8QA 3CZSA 3P8JA 4UTJA 4NVTA 3C61A 3L4XA 1YTDA 1S3HA 1CGTA 4XQ6A 3W1XA 3RNDA 4N6EA 3IGSA 3T78A 4AAJA 3NQEA 1PPIA 1FBAA 2ZX9A 4HA1A 1VAHA 1JG9A 4FNQA 3WENA 2C16A 4HPHA 4RXFA 1CX9A 3PUDA 2X2HA 4UQAA 1VLIA 1VYSX 2HS8A 3WJWA 3P80A 5D2VA 3HGJA 3VMOA 4LV9A 3P5ZA 1H7XA 5FF3A 1JDAA 3W38A 3WK0A 2WSRA 1DHKA 1HL9A 3E49A 3EKLA 4R7JA 2EEXA 2GOUA 3L5MA 1UUOA 4CNPA 4IPIA 3S9YA 3TSDA 1HWWA 5CSSA 1FWSA 2WQPA 3O07A 1D9EA 3SGUA 5CLTA 4FNSA 1JQXA 3SIZA 1OFRA 4HPXA 2I9EA 1TJRA 1LM1A 4LC6A 2NXHA 2QCCA 3P81A 3KEHA 2CXGA 1XBXA 1TQTA 1XH1A 2B7OA 3UPBA 4KWVA 1L0PA 3G0XA 3EWUA 1GJUA 4LRSA 3RFAA 3SZ8A 2FGZA 1WQ5A 1F7BA 3L2MA 1E51A 3TC7A 1AW2A 4DF0A 4PCFA 1XGZA 1ZALA 2NWRA 2V3DA 2ZUTA 2ZWZA 1TPFA 2PWFA 2GVYA 3MBFA 4JYFA 4UOQA 2AMGA 4HOWA 1W8SA 2Y7FA 2WKJA 3CM4A 5IM51 3EX2A 3GVGA 3W1QA 1R2SA 5DN1A 1SW7A 2H8XA 4FNTA 3TCEA 4Y8FA 3O6YX 1G1YA 3BARA 3DI1A 3QF0A 3NYZA 3W7OA 5J5RA 4WY0F 1A47A 3UWQA 4DBEA 4X3ZA 1PIIA 3PUEA 1YADA 1TQWA 4X22A 3P60A 4MJZA 3W7GA 2D2OA 2ZZ7A 1W37A 1XUZA 2ZZ2A 3STGA 1XCWA 2E0PA 1U5JA 4EOUA 1OFBA 4M56A 1I8JA 3C2EA 3NL2A 3W1RA 4H3DA 4HNVA 1MW0A 3NQ6A 5FF0A 4GC4A 5HMSA 2F84A 3W1UA 3QSTA 4GUFA 1BWLA 3QSRA 1EUNA 4TO8A 2F61A 1VHCA 4O10A 3STFA 3C2FA 1TQVA 4PL1A 3TV8A 2YW4A 1H5YA 3G8EA 3ZO9A 2E6YA 1FY6A 3W2UA 4RLIA 2VEPA 4GQRA 2BXVA 2J9ZA 3WNPA 5CLWA 3OA3A 3GDRA 1SW3A 2VKZG 1DVJA 4UFMA 3CGTA 2VNCA 3PBYA 1EP2A 1TV8A 4O18A 5T26A 3W1TA 3DDGA 1JQVA 4JS3A 1GVFA 1TPB1 1K8YA 1UJPA 3BGJA 1XKYA 5D2WA 3B8DA 1TREA 2BHYA 3HF3A 3U8GA 3A47A 1TV5A 2NLIA 5TBOA 1TQJA 3FJLA 3W7QA 4I7WA 4PODA 1OVDA 1WZLA 3QH2A 5K9DA 3VGEA 4IMGA 4XUGA 3KFTA 3KRUA 5LNUA 1PIGA 4AYSA 1OFDA 4NNCA 3NAVA 4Z1AA 1QW9A 2V2DA 2VC6A 3WJZA 1OABA 4ZQCA 3BC9A 4JY8A 1MW2A 4IOTA 4UTHA 3S8HA 1P0NA 2QR6A 4H8UA 3BW3A 1CGWA 3O6CA 4DF2A 2YDAA 1QOQA 1JDCA 3INPA 3N19B 5KMYA 5E6ZA 2A7RA 5GVJA 4QM1A 4LY8A 2EHHA 2ZXAA 1R34A 2ISVA 3TDFA 4UMCA 5AHIA 3OIXA 4LW7A 3UZ5A 1GVOA 4CCDA 4U3CA 1FXQA 1TV7A 4UC5A 5D2TA 5HWNA 1SMAA 1W3NA 2JBMA 3NPVA 4I9AA 4QSHA 4FIRA 4UFJA 1TTIA 1WP6A 3YPIA 2ZX8A 3G1XA 2Y7EA 1DQWA 4IXXA 4Z1BA 4GINA 5AHNA 3TA6A 2X2IA 4UOZA 3CWNA 4OGZA 5EPDA 2CLEA 3HGSA 1JXKA 3NG3A 3PUOA 4C1KA 4Q32A 4BF9A 3RU6A 1VHNA 1UA7A 2CZEA 3LOTA 3NQ7A 1TQSA 5C6MA 1KGWA 3ATZA 5G4EA 2ALDA 5CGQA 4Z0SA 1JCYA 4IMFA 2XN0A 1UH4A 1UUMA 3DHPA 1WV2A 4PA8A 3QGVA 5FEWA 1FWNA 1G4EA 1F05A 1XCFA 1NAL1 2YYTA 2V3FA 3BAJA 3O63A 3W2MA 3B04A 1K7FA 3UCQA 3L66A 3LI0A 3CTTA 4CN4A 4O1BA 2FDSA 1P5BA 2WNZA 4XZ9A 4CQ8A 2YR1A 3EDFA 1BPLB 1JDDA 2ZTJA 1GTEA 2CHNA 5FF4A 3L65A 3L4ZA 3CZGA 1FCBA 3NPWA 3B03A 1XXXA 1G69A 1CGYA 2ZX5A 2Y2WA 1KBKA 1TYGA 3CB8A 2Y89A 3CZKA 4S2CA 5CZJA 3PSWA 1ZNNA 4CQAA 3QQ0A 4WUIA 3THAA 5K4ZA 3BVVA 4JTTA 4J3XA 3G1HA 3B05A 4AH7A 3W75A 3CHVA 3CC1A 1EWDA 1FWTA 3W7NA 3PM6A 2C7FA 3NVTA 4O4VA 3CIWA 4LRTA 1AMYA 2ZZ4A 4UFIA 4WY0B 4UQCA 1WZKA 1Q45A 2B7NA 2GUYA 1KM5A 4Q4KA 4PEKA 3TH6A 1U2YA 2XIIA 9CGTA 2BHUA 1PJ9A 3G8RA 4P61A 2WO5A 2OSXA 1AG1O 4E38A 1JXJA 3W7RA 3BW4A 1SU5A 1V5XA 1Z44A 3CEPA 2ZDRA 4LUIA 3G0UA 3QPZA 2ZZ6A 2NT0A 1XSJA 5E0KA 3IGUA 3VGGA 5E6YA 1QPOA 5EBUA 1DL3A 1H63A 4LTSA 4AF0A 3E12A 4O12A 1UD5A 4JCLA 2YFOA 1LBLA 3QMSA 3FW6A 5CPNA 1B57A 4NUWA 1MFUA 4U33A 1G5AA 3A4AA 3LTSA 3BG3A 3TX9A 1OG0A 4KFOA 1MXSA 4TR9A 3W73A 1KW1A 1PEZA 1RV8A 2WV8A 4QAIA 4XWUA 2ZTKA 5D38A 5F4WA 4UCFA 3UG4A 1XI3A 1Q6QA 1S5VA 2Y70A 1Y7VA 4UTKA 4FNUA 1A53A 1KFJA 1E43A 4CNOA 3TUUA 1I75A 2ZZ3A 3CV5A 1MXDA 2DJXA 3GAKA 2VFFA 4CN6A 1ZFJA 2BZNA 3E02A 3W2JA 3HJZA 2ISSA 2ZRXA 1G4SA 2QCGA 3KVLA 3NL6A 3S1UA 4FHAA 1OFEA 2V30A 2A1YA 4H7VA 3DGRA 1D3CA 2JKPA 5G2IA 3HG4A 3TFXA 2CWNA 3DX2A 5HJLA 1TCDA 5CKSA 3A5VA 2J9YA 4FXSA 5LGXA 4XBSA 4O11A 1A5AA 2CLKA 3EWYA 3MYOA 1BVNP 1OK4A 1I2OA 1X6UA 2E09A 3I6RA 3MHUA 3BCDA 3GNDA 5F4XA 3WK2A 3ZOAA 5I3JA 5LSMA 1SO6A 2BWGA 3EWBX 3QRHA 3WJYA 4J3TA 3KVJA 1SFLA 1GG0A 1GYNA 2ABAA 1ALDA 2EF9A 1JCMP 2QUTA 2C8NA 4GQQA 5H91A 3ZQ9A 1JFHA 2E6AA 3BAWA 3KL0A 1WZAA 4LQ1A 4JTLA 3FLUA 1HG3A 4JL2A 3WNOA 1LOQA 3C3NA 4K37A 3GBEA 3DX4A 1OX4A 2A4AA 3N9RA 1UKSA 3W74A 4YWIA 5EMUA 1HTIA 3KVMA 3KX6A 4H8VA 1X1OA 4MY8A 1XM3A 3H54A 5SWUA 3HPSA 3W7MA 3ABSA 3GXFA 4NXKA 1UD8A 2EQDA 1KXQA 3G24A 3LTPA 2NX9A 4UQDA 1CYGA 1M5WA 1MZHA 2B4GA 4ZVJA 4Z1DA 4LU0A 3I7QA 1YDVA 2RHGA 3KHJA 2YOCA 3NQAA 1HO4A 4ICNA 3UYCA 2V81A 1YYAA 3BVWA 1R47A 4JNMA 3OHIA 4LOCA 1B2YA 1HXKA 4J3WA 1W5QA 3FYPA 1OJXA 1N7KA 3GDTA 3WJSA 2JKAA 2ZX7A 1EB3A 2D0GA 1H7RA 5A5WA 1Z42A 2D0FA 2ZA2A 2VRQA 3HG2A 1W5OA 5AC6A 5K3VA 4QNEA 3PS7A 3GIYA 3VX1A 4K6AA 4DQWA 2A0NA 2Y7GA 4LS1A 2X16A 3BPWA 2YSWA 2WVSA 4ATWA 3TNOA 1VLWA 3BCFA 1KA9F 3DX3A 2YYUA 3MJYA 3S1VA 1KTNA 3NQGA 1MW3A 5AOUA 3LCLA 4LS2A 3SSJA 3IIPA 1MXGA 1S46A 3W7DA 3TTYA 1QR7A 4UUIA 1KB3A 3EWWA 4KFNA 3LHVA 4PC8A 3W2KA 3EJSA 2RDTA 3TW6A 3ELFA 1LORA 4TIMA 1ICPA 3DDFA 1IF2A 4EF8A 1RVGA 1JF6A 1J0HA 2I14A 1MVYA 4FIQA 3L0KA 1ZY9A 4H8HA 2ABBA 2BSLA 1VRDA 6CGTA 2J9XA 2WVVA 4BWLC 4CNNA 3R89A 4K7YA 1EA0A 5EMYA 1TSIA 3VGBA 5HPOA 2CLMA 3UWUA 3P8IA 1K3UA 1I45A 3GXMA 1W31A 3C2OA 3NNTA 4JN6A 1KV8A 2WSYA 3W7HA 3W1PA 5K7JA 3IIXA 3N2XA 2D3NA 2NSXA 2DORA 2VEKA 4IGHA 5F1UA 2GVLA 4N9CA 4JIQA 3EKZA 1B9BA 4A29A 5L9FA 1M7OA 2DZUA 2DZSA 3W2LA 3BV4A 1TO3A 2E5DA 3L4WA 4AHQA 1BVZA 5DFAA 1HTYA 2VXNA 2ATSA 3G1VA 5FESA 4WX2A 4ALDA 5CPOA 5H2ZA 5HXMA 4GUGA 1GZGA 4NNAA 3CLMA 1GOXA 4UFLA 3P62A 1YXCA 5DO8A 3PB0A 3BG5A 3EDDA 1JAEA 4IJBA 4JTKA 2GQ9A 4MYXA 2EJ1A 3ECQA 3VMNA 4UR7A 3W2NA 5BMXA 2YFNA 2Q8ZA 1MSSA 1IIHA 1TTJA 4BFAA 3BVUA 4N9EA 3QW3A 2OX1A 1DHPA 3V1PA 2ZUWA 1PL9A 4JTEA 4AHPA 2FPYA 4ADTA 5CGMA 4QIUA 4JD4A 3T44A 3NL5A 3M7WA 1KLZA 5K4XA 5HR7A 4HNNA 2DH3A 2A6LA 1WAUA 3SI9A 3AJ7A 4Q33A 2DIJA 3FAWA 1CLVA 3L2IA 5AB3A 3K30A 5I3HA 3NQFA 1XBZA 3ZR4A 3W07A 4L4MA 3C52A 5D02A 4LWWA 1QOPA 3C8FA 3EJTA 1C29A 2XWEA 4RK8A 5HDRA 1KFBA 4UTUA 1YDNA 3GZ3A 4KKXA 4QNWA 1QWGA 2FH8A 1E3XA 2OT1A 1HO1A 1SO4A 3C6CA 1QI4A 3F1QA 4LNYA 1OHLA 4JEQA 4JY9A 4JDBA 3AXHA 4FLSA 1WYIA 2NUWA 2VFDA 3KRZA 2A7PA 2G97A 2ZRYA 1OT1A 2E1DA 1EP3A 3LRKA 3HPZA 1JRBA 5CSRA 4DXVA 1XL9A 4YCOA 4A21A 1SW0A 1P1XA 4U4MA 3KWXA 2E4TA 3RMJA 1JUKA 3BGGA 2WNNA 3G1SA 2YGYA 1L2UA 3UQNA 2X1TA 1I2NA 4LPCA 1TMHA 2BTMA 3IJ9A 5A2AA 4YMZA 3G3DA 3R2GA 2OJPA 3ATYA 3MI3A 1QX1A 5A6MA 1QFEA 4HP5A 1DKWA 3DFQA 4XTDA 2BLEA 4MZYA 3HGOA 1QO2A 1A5BA 3LERA 3O16A 3WNLA 4GI9A 4ZQRA 5HWJA 1YDOA 2CLFA 1RD5A 1XV8A 2XN2A 3QC3A 3MYPA 1WO2A 3CZEA 1KBIA 1KLYA 5I23A 2O7SA 1MWOA 1FDYA 3NA8A 1AW5A 3ANYA 3U2OA 2ZRVA 3AMLA 1OT2A 5AFDA 1DBTA 2I1OA 3WY4A 3P5YA 5AN7A 2WPBA 4MLJA 4JICA 5K9XA 4R34A 5EA9A 1NOFA 3KXQA 3D52A 4ZQMA 3ZSSA 2QUVA 4MY9A 3VNZA 3WMSA 4NZFA 3JS3A 1OYBA 2EGZA 2PURA 4CCEA 3USBA 1H7NA 1UA3A 1ICSA 7CGTA 3EX3A 3G1AA 4JX5A 5C55A 1Z41A 1TTPA 5DELA 1I2RA 2XVKA 1AW1A 3LV6A 5LNRA 3KOFA 4A22A 3TQVA 3ZR6A 4WXZA 1NM9A 1Q6OA 3T4CA 3K8MA 3TSBA 4J3SA 3EDJA 1OF8A 1BAGA 2FJKA 3EXRA 1CIUA 2QPSA 1X8FA 3TQ0A 1KBJA 1VGAA 4LVBA 2QMKA 1JVNA 2XVGA 2FPTA 3BVJA 2B7PA 1GPWA 3FFSA 3WFAA 1CGVA 1FWWA 3R12A 3N9SA 2NX1A 3IIVA 4JFTA 2CW6A 3VSUA 1QMLA 2E9BA 4ORIA 1I2QA 4FB7A 3VO0A 6ALDA 4O1AA 2O7QA 4GO8A 4KWWA 2YA1A 3L9CA 2FQIA 3LPPA 3BLFA 4WOQA 3FKKA 5LKYA 1XSIA 3K8KA 2ZUVA 2DIEA 8CGTA 4A2SA 1XC4A 2ZQ0A 5F2GA 1ME8A 1TQUA 1PS3A 5F7UA 4RKAA 4YLWA 4N4QA 4OIFA 3TONA 4PTNA 1OSEA 4PSPA 1GG1A 3SJ3A 5HNRA 3W76A 3S5ZA 2Z0IA 2XVLA 2BY0A 3W1NA 4O17A 2H6RA 3QJAA 1I4NA 1WOAA 4O16A 3M5ZA 4AYGA 4ZMGA 4OBTA 4UTWC 2WKGA 4XKYA 3W23A 1JD7A 3LCHA 4HPJA 3NPUA 2E8YA 3DXIA 2R94A 1QWUA 3FJ6A 5EKYA 3UNDA 3AJXA 1WBJA 4M8UA 4NX5A 1VIWA 3BUDA 3TXZA 4MOZA 2Y4SA 3G0SA 3LHZA 1VFUA 3PB2A 3WY3A 3ABOA 1H1ZA 3I65A 1GT8A 2FLIA 4UTTC 4IPJA 3MI6A 4QQ3A 4O54A 4JYDA 1YPFA 2V3EA 4OV9A 4TMCA 1AQMA 4EIVA 3BMVA 3MHGA 1LP6A 2GQ8A 3QM3A 5ABTA 4MFDA 2ZZ1A 4CQ9A 1Y0EA 1TB3A 2EABA 4MVAA 4HHPA 2VFEA 3GKAA 3NQ8A 2NZLA 1UBSA 3S42A 4WXYA 3ZT5A 2F7RA 1GJPA 3UWZA 3OLEA 1OX5A 3MP5A 2FHFA 4GJ1A 2V82A 3T40A 4YXGA 3FAXA 3T55A 3LCIA 1IIGA 4X9YA 4IQLA 2WC7A 1XH2A 5FF2A 4L4LA 1SO5A 5F1VA 2D0HA 1NVMA 2FB3A 2X1RA 1FX6A 2V9DA 3HQ1A 5IBXC 3GXTA 1Q6RA 1CXFA 4N9DA 1TTQA 1VYRA 4O15A 4AF0B 3DHDA 3TTSA 2W79A 1DJQA 2OYLA 3I68A 3M44A 3TE9A 2ZRWA 3PR2A 3I7SA 1JULA 3PBWA 3WEOA 1ME9A 3QW4B 4XTIA 1QW8A 1J2WA 5HUOA 3UY8A 3WDHA 4Z08A 5D03A 1N8FA 1GYLA 4K39A 4AIEA 2WVUA 2A21A 2E6FA 2Q3OA 2QLYA 5E93A 2R91A 1UD2A 5LGZA 4JTSA 5AYYA 3LRMA 4CCCA 4U2YA 1BLIA 2JGYA 1HX0A 1W5MA 1LRTA 4CKQA 1VJSA 3KRSA 4HIBA 3CEUA 2Q8LA 2VUYA 1LBFA 3WN6A 1L9WA 1PCWA 3TW7A 2OSWA 1IZKA 2QAFA 3SECA 4Z0JA 3VFLA 1KXVA 2OCZA 3ZWTA 2P10A 5LHFA 4WOZA 1GVRA 1CXHA 3O6DA 4C1LA 4BI7A 2GJPA 1OX6A 1SMDA 4HSNA 2VEMA 5F2LA 3VU2A 3DKJA 3DFNA 1RP9A 2QJHA 2VENA 1W56A 3IVTA 1VS1A 3LHUA 3WY1A 4FEZA 3HBLA 3RIKA 1KTBA 1IXOA 4RXGA 2NWSA 5D37A 3NO5A 2F1BA 3LXAA 3E9AA 5C2XA 2TRSA 2NV2A 2J27A 3TAOA 3WNNA 4TU1A 2G95A 2W6RA 1TPWA 3UEQA 4PFMA 1T96A 1EH9A 3AMKA 5AHFA 3O15A 3TKFA 1OFPA 1QCWA 3NGJA 1ZHAA 3BUBA 5BRQA 2YKKA 4BWLA 1OX4B 3BSHA 5G2WA 1YLVA 4PSRA 3TXVA 3R5EA 4NNBA 4PCSA 1NF7A 3EX4A 1G6CA 4WSKA 2FHBA 1PIFA 4DO5A 3BO9A 2RFGA 2G5WA 4IX0A 4J3UA 3HOJA 2ZRUA 4RR4A 5F2IA 5HUPA 3O06A 2C13A 2EAEA 3R13A 4KWUA 3NQMA 5BMWA 4DBDA 3VGDA 4N4PA 4JL1A 1UASA 3L2LA 1TMQA 1M7PA 1TIMA 2E5BA 3WELA 3EDEA 1RQBA 2VELA 5LHEA 2ZXBA 3UZJA 1VH7A 4O4WA 3C0JA 1VCVA 3L4TA 7TAAA 5E0FA 1AK5A 3FYOA 3PWAA 2CPUA 3LHTA 3MW7A 3S5NA 4AIOA 3P82A 3MP4A 4M19A 4M6QA 3V75A 5CPLA 1PS9A 3SR7A 5BOOA 3K8LA 2H3DA 3VGFA 2AAMA 3L67A 1JD9A 3PAJA 2IGTA 1LOSA 2A7NA 1SUXA 4H6KA 3BLPX 3EJPA 3C2RA 1PE1A 2W0UA 3A23A 4Y90A 4Y96A 1H7OA 3WFZA 5F2MA 2H3BA 3HIJA 1XSKA 4ADUA 3G22A 3TU9A 1J5TA 3A24A 3VM5A 4NJIA 4UFHA 3VCRA 1EO5A 4N6FA 5BRBA 3A21A 1J0KA 5AHEA 2WVVB 2B7QA 2OYKA 2DZTA 3F03K 2Y5EA 5D2YA 3IVSA 4ZL1A 3LB0A 3DBPA 1B3OA 1TPUA 5J5DA 4JTGA 3NQCA 5D32A 4KFPA 3P74A 1RR2A 3M47A 2PWHA 3THQA 1KM6A 2NV1A 1KXHA 4K8EA 3MMTA 5LNSA 1BKSA 3BLKA 3CWOX 4AWSA 5C5YA 3C4UA 4LUJA 4O0ZA 1FDJA 1E3ZA
chains in the Genus database with same CATH superfamily
2A5HA 1YUHB 5KBMA 3WU1A 3SUUA 1YEKH 1Z9LA 4I2XE 2ZTBA 1W15A 2R69L 2VDLB 3SN1A 1QNZL 3VOFA 4Z5RB 4LOVA 1TPH1 3VXRD 5IFAH 5D72L 4NQED 2JQMA 4QJ1A 4KY2A 2PLJA 1H6TA 4AQEB 3MLXL 4JFDE 4AY7A 4NFDA 4C7FA 2YD9A 4WO4C 5ID0A 4I9JA 4ELMA 4F7EA 1NFDE 4ONFL 2Y7NA 3C60C 4LXFA 5JA8B 5J0BA 4JTUA 2KLSA 1AC6A 4LSRL 3QJTB 5HJBA 2FZ3A 5ICUA 3SE3A 2CR0A 5HHPA 3IGXA 3UTOA 1Q6LA 4LPXA 4MD0B 3WF3A 4W9TA 4KMQA 3SDOA 2OMVB 1P4CA 3TNNB 4QYOB 2Q09A 5IJKA 3ESVF 1Q9KA 1NGQL 1OGTA 5AC8A 1A0EA 3QQ1A 1QNVA 1FH7A 5IEHA 3KPRB 1ZLDA 1GOHA 4GRMB 1I1AC 1M7XA 2MOVA 4DI8A 3FIGA 3CU2A 4Y2DD 4YDNA 4PUNA 4LNRA 5GS0D 1H49A 3FONA 2FSEA 3ARYA 5TE7H 1S7RB 4B9YA 2W4XA 3JWNG 2PSNA 3KH3A 4AZIA 3ZE2B 3K1DA 5TQ2H 1YEIH 2YPKA 5JYMA 1F3XA 1N5YH 4F7MB 2J25A 1I1WA 5I24A 1FH8A 3VC5A 3RL2B 2ZICA 3NCJH 1Z6JT 2O1AA 4Y9FA 3ABGA 3VD3A 4R0LA 3ARFA 3LRHA 1TU2A 2R1PA 5ANME 4BSVA 1FG9C 1HDMA 1IXNA 3ISIX 5CLYA 4AWUA 4DJFD 4D7PA 4QXUH 2BVOB 3OKYA 3S96A 4KRTA 3W88A 1KGUA 1IVLA 3RJQB 4PRAA 1Y0LB 2HX9A 2XG5A 4PI0A 1E8XA 3DO7A 3A9BA 3TNMB 4MB5A 2HVMA 2G3JA 3MRBA 4MNLA 4KBPA 2B5IB 4TF4A 3TBCA 3UETA 3QWQB 2B1OA 2VEIA 5CSGA 3HPXA 5EC1A 4DNLA 3GMMB 2NY5H 2VD8A 4HS3B 3WBXA 1S9XA 1KWKA 3P3YA 3NJHA 4P2QD 3TC6A 3WHE0 2FBRA 2HJKA 1FO0L 4XWOC 3P61A 1KCUL 1ETJA 1U1HA 3MRHA 2LABA 2AXHA 4NHVA 4ANUA 1QUNB 4XNMA 5DK0A 1JGVH 1OGGA 4PY7B 5T1JA 4V33A 4YFLF 1KOAA 1C16B 5FO8A 2UUDH 3T2NL 3MV9D 1ZTXE 5GJNA 1X5LA 4AJVA 1LO4H 3L95B 2GSHA 2O5ZH 1MJJA 2BDNL 3M46A 3KLHD 1H62A 1P5UB 5BZZA 1B6DA 4YFEA 2GJRA 2J4GA 4UZSA 2CBJA 3GGWB 2VMJA 3O3EA 4KWOA 4O28A 1KC5L 3S6OA 2DM3A 1FUNA 4FMVA 3PPCA 1AQKH 4PFHA 5DJAB 4IQJA 5HYSB 2VX7A 5IOBA 4CGTA 3R11A 2OMZB 3KD4A 3DLQR 3U6WA 3LI1A 5FYKL 2YXGA 3INUH 4ML9A 2G3ZA 1WFJA 3QJVB 2G60H 3QFWA 2WQSA 4MUZA 2CHWA 2K7QA 1JCLA 1E28B 2CDFA 3FS2A 2OX5B 5BNKA 1RJYB 2DQEL 2DQJH 3B2XA 4WCYH 3MNMA 3L5JA 2ZJSL 4WWID 5C07E 1SPQA 1L7IL 3OP2A 1O7DC 2DI9A 5I73C 5I16A 2VDRH 4NC2B 1GZJA 2PBOA 1W0MA 2ZP8A 3DNKA 1VENA 5H94B 1L6GA 3CLWA 3NIGB 4KIRA 3SCPA 4BUQA 1IO4C 4X80H 4D8AA 2O26U 1HJWA 2QF8A 1EP1A 3TK7A 3OU8A 3QPYA 1LO0H 4TUOA 5IVNA 1FO0B 2HK1A 5BW7A 4IISA 5FOOA 4K36A 3VKJA 5M5DA 2O6DA 3WTUA 1J0JA 4NZUH 3DX1A 3P67A 5E94A 2P7TA 2KBGA 3R0DA 1VBJA 2J66A 3GTFA 3XINA 5DQDL 5IW6A 1FH5H 3QZOA 4F7CA 1RZGA 5C86A 3MVTA 2NZ9C 4JW3A 3AU1B 3QXDA 2G4EA 1G7HB 4M62L 4EOWH 1V02A 4EZJA 3L4UA 1MCWM 3VTTA 3NEOA 1T1XA 3WYRA 3HRZA 2EJAA 3REQA 2GGIA 4C4KT 3LOWA 1UM6H 3UYPB 1AZRA 2QPFA 4XZLX 3WE6B 4WGVB 1KKOA 2VH5H 3VFUB 3VDBA 4HZLA 1N64L 3HI5L 2E7MA 5L8JB 2OK0L 1O6SA 4LHUG 3VC6A 1KCKA 5D1XD 1JCTA 1ITBB 4ZPVA 4AWJC 1GGIL 1C8VA 4TMPA 1UGKA 2VDQL 4AENA 4OCXH 3TS8A 3QY7A 3DX0A 1FLRL 3L1GA 3TYCA 4CADA 4GW5B 5IRPA 1O4UA 4K15A 3WUFA 3OKEB 2FEEL 5JIDA 1D7FA 3BAXA 4X6BA 4XZNX 1J12A 3X1NA 1H61A 3MLZL 3UJSA 5LIKX 1JZ5A 2HPTA 4B9JA 4NERA 1FZOB 1EDTA 4OT7A 4YCPA 2VDLH 5AYXA 1ET8A 3DOSA 1EYWA 3DI0A 5AD0A 4MVBC 3QEUB 1OEPA 2BFVH 1WB0A 3PGFL 3ZYJA 4M93C 4PH6A 1FIGH 1IT0A 1OIFA 3I02A 3B4UA 1MI5B 1KTJA 4AEOA 5L88H 3H70A 4ZSOE 4AGLA 5F6HI 3S5YA 3V79C 4H19A 2XIMA 3OZOA 3DX8B 1FJ1A 4HU2A 2WB1A 5BS0B 2DZAA 1BAWA 3PJWA 2VC5A 3TYAA 4EF9A 3OJGA 4Q8UA 3LKQB 4EN3B 1LLWA 4TNWK 4QJ5B 2V5KA 2YEQA 3PPHA 1VC4A 3I75B 1SYSA 3Q2NA 5A6SA 3HPLA 1QABA 3EO0B 4NDMA 4D8OA 3A22A 1QACA 4K7PL 2C6QA 2XICA 2AXFA 4ABWA 3FGCA 1KFCA 3CMJA 2XM1A 1H0DB 4F8NA 1M7UA 4HD5A 2ZCKL 2ICWI 1A6UH 3BPCB 2BY3A 1EGVA 4FNPA 2XQYK 3F5WB 2ESVE 2FFCA 4J1UA 2AKRB 2JKLA 4C1NB 5H8DA 1MLBA 5K9CA 4GPVA 4YHNB 4XTRD 9XIAA 1JUFA 3N73A 2PRLA 3KS0H 1ODUA 4XO6A 5GGSB 2J7EA 4G7YL 4UT7H 1QBBA 1EQPA 1X96A 1QNRA 4FTVA 2CLZB 4WI6A 4N2KA 1C8QA 4OU3A 3CZSA 3NCFB 3W1ZA 5KSAD 4MCMA 1YTDA 5C07D 3MBEA 3ITVA 3ZZSA 1ZXKA 3MXVH 2VDQB 3MRQA 1BFOA 3VOHA 2C16A 1AZ2A 3FFCB 5I66B 1MCQA 5FF3A 3ZJ8A 1DHKA 1BA9A 3OSVA 5CLXA 5EB9A 4LCWB 2Y3AA 3C09B 1OFRA 3QZPA 3P81A 1EGZA 4NJAL 2R69H 3KW3A 5SWQA 3LY6A 1AY1L 1E51A 1QNZH 1D7DA 3O4LE 3MLXH 4JPGA 3U4KA 3MRCB 1VFSA 4ONFH 2GL5A 3P60A 4KI5F 5DZJA 3GMLA 1CC3A 1W3JA 1U8IA 4LSRH 3FCTB 4E41E 4JIHA 2HE5A 1JPHA 1YPZB 1G0YR 1U1JA 3ZO9A 2Z4QA 4GFXA 2QXWA 3WNPA 3MNVB 4RFOL 1OBAA 3SQMA 3PBYA 1SXCA 3ULVE 1K8IB 3HAEB 3UJIL 4ONHB 3SURA 4FAAB 3E6FA 4EXKA 3ARSA 1WZLA 2XIQA 1Q6CA 5F97E 3KFTA 3ZMNA 3MRMB 1PQZB 2DLFL 4QNPF 1OABA 1OF2A 4PTTA 3LKSA 2EDJA 1P0NA 3SDAD 4QRPD 1R6WA 2RALA 4HKZA 4HUUA 2A7RA 3TXAA 1QOXA 4EDWL 3TEVA 3PWPE 1JZFA 1YEDA 2LOEA 5ILTL 5EBWA 2Q0ZX 3KLSA 5FFOA 2Y7EA 4QEHA 3D2TA 5I02A 1OY3B 5LGJB 2R6OA 4PY8I 3PUOA 4BF9A 2HBXA 3RU6A 3KCPA 3ZHNA 1CICD 5HGDA 1LEIB 1S7XB 4ANWA 3L6FB 1UZDA 2SFPA 1W9BM 3IFLL 3O45A 4LYPA 3GMNA 4HNLA 5FEWA 5DD5L 3KS6A 1DQKA 3VRIA 5IHBA 3B04A 1NOAA 4PJ8A 5JXED 3CZGA 1SJVA 1H5BC 2J71A 2PU1A 3CT2A 3CB8A 3QXTA 1E6PA 1E4JA 4Z23A 3V0SA 3I3BA 5T1LB 3JTSA 3W75A 1EWDA 1L9OA 3UPRA 4H9XA 5EZPA 1AMYA 4H8PA 2XGIA 1KCUH 4N0CD 3KPSB 1U2YA 2BW4A 2G3FA 3IDYC 3CEPA 3T2NH 3VGGA 2OI9B 1L9NA 5CPNA 2EE2A 4DAGL 1W6TA 4NUWA 4PV9B 3B8YA 4KRUA 2ESVD 4TR9A 4UQ3A 4QAIA 3EPMA 2BDNH 1KIQA 1Q6QA 5CEXB 1NSNL 2MANA 2ZSVA 2B0SH 1LNUB 2WMIB 4ZQTA 4P0DA 4B3LA 3UFYA 5F93C 3HG4A 5SV4A 4YEEA 2VSDA 1X9UA 1GL4B 2ADGB 2GYIA 1A5AA 1KKRA 4L4VD 3X3FL 4AD2A 1SO6A 1XPYA 3WJYA 1KC5H 1YYMH 4JHWL 1R9YA 1CB2A 4JFXB 3CZFB 5CC6A 2E6AA 2EKJA 3B34A 3QORA 5K39A 2HN7B 4ZRGA 1NCAL 1OAZL 4U7MA 4DP7X 1OX4A 2JB6B 1UKSA 5EMUA 3BGFC 1ETA1 3Q3GA 5H4YA 1C12B 2W8CA 5SWUA 4C6PA 4F5CE 5LXEA 1ES0B 1U8QA 5FYKH 2PA6A 4JQ1A 3D47A 4H9YA 1HO4A 2F68X 1O7VA 2IPTL 3FYPA 3GSQA 4ZPTB 2ZYRA 1BYOA 1MFBL 1X1NA 1WS8A 3D69A 2JIXA 1VDGA 2H7WA 2DQEH 2D0FA 4C5ZA 4QNEA 4GKZB 4W4OA 2ZJSH 3AT8A 3WEAA 1L7IH 1KJMB 4PYHA 4XE0A 4WK4B 4C59B 2BASA 3ZTNL 2RB8A 1VD6A 1Y5VA 1NINA 1MXGA 2Q86A 3W7DA 1KB3A 3LHVA 2PUZA 3VIPA 4Z7QE 1J0HA 1X5IA 1QW7A 4HWZA 4FF9A 5IFTA 1BZQK 5DJ0B 1JYNA 4DP2X 2J8UE 5AB1A 1S7SA 4E41D 3UWUA 5L8KB 5BNXD 4DXKA 4K3HA 1IQWL 2ZUNA 1UCBH 2DLEA 4A2GA 1SXBA 1FHVA 2RAMA 5AVSB 4AHQA 4M43H 5GXBB 2OTUA 3ULVD 4NM8L 4HH9B 4KX8A 5T1MA 1FH2A 3OMIB 4ELDA 4QEEA 1TA3B 2IMNA 1O75A 5FUCE 5EEVA 1FFOA 4FP1A 2VCCA 3NA9L 3CDGA 3ZIZA 5DQDH 1EC7A 1PL9A 2AK4E 2FPYA 4ADTA 4JD4A 8FABA 3NL5A 4DN4L 3P0YL 2RA1A 1N8OE 1CD8A 1XTMA 1NAMA 3L2IA 2EDRA 4M62H 3C52A 1PDKB 3PWPD 2XWEA 1U93B 3GZ3A 2CO2A 3RB5A 1RAMA 4JEQA 4JDBA 3F7LA 3V6FB 3PJSA 3H2MA 1N64H 3HI5H 2JJUA 2OK0H 2E4TA 1V6XA 1GGIH 4LO9A 1TMHA 3RY6C 2VDQH 3MI3A 5A6MA 2BLEA 3ZLQC 5FUOL 4QXTA 2DQTH 2WZEA 3T3PF 2Z28A 4AJ0A 4TVPL 3SE3C 2GABA 4Z0BL 2DQHL 4MLJA 4ZQMA 4Q9BA 4RAVA 3KYAA 3MLZH 5KSUA 3RDTB 2YQBA 1JVLA 1JXGA 3O8XD 3OC8A 4WI2A 1AW1A 1UWRA 1A6TA 2J6VA 4LB4A 3NQBA 3T4CA 1EHNA 1CIUA 3EXRA 2Y1YA 4XBMA 1PEWA 3PGFH 4IOFD 5IROD 3HVDA 1WWCA 3N9SA 4N1CA 4ZMPA 1NLBL 3K1KC 5CIPB 3EOLA 3UAJA 4C7DA 1A8JH 2GI0A 3C60B 2CEQA 2QT6A 1PS3A 1GK8A 4DWSD 4C8XA 4IBSA 2DQFA 3QIUD 3OYZA 2WKGA 4GSXA 5D8ZA 4NAMA 1M1BA 5CEWA 3HAEH 5KAQG 5C8BB 3WMBA 3UESA 5TGBA 5A16B 4TMCA 3E74A 2X12A 2J7LA 5D5ME 4R0LC 3ARFC 1Y0EA 1KEGH 4WXYA 1GJPA 3PNWB 4F9LC 4IU2B 2J12B 4OFIA 2PTWA 5EEUA 3LCIA 2X2YA 3F7VB 4L4LA 3HOGA 5F1VA 3EJZC 5DEFB 1VYRA 5C0CB 3U83A 1HXYA 3ZQWA 4P23D 2ZRWA 4LLYB 2DQ6A 4MAYB 2XZZA 1O0VA 1EXUA 3UTTB 4G7YH 1IC4H 4TL4A 4NWTL 2Q7YA 2G5BA 4JNZA 5H37A 1Q7ZA 4ENZA 5FLVA 4U6YA 1K4CA 1CJYA 3ARTA 4I48A 4WKHA 5IFJB 2QZRA 3VFLA 2VEMA 3QDGD 2QJHA 3IVTA 1DN2A 5GRZA 1S7UA 3Q0HA 3V10A 4P5RA 4G8FA 2BINA 2EUZA 3FCGA 4TU1A 5LUMA 1S7VA 3VI3A 4BQ4A 4JZJA 4G6ML 3MGOA 1F6FB 1ND0A 1SBBA 4L18A 4NJAH 3G6JB 4J3ZA 3HOJA 4I3RL 1YKWA 4YGVB 5F72S 5EOCL 5SX5H 3E8UL 4HH8A 4NQCA 1DJSA 4AVIA 3CV2A 4NBXB 4OCLC 2ZXBA 1ONQB 2NR6A 2HFFB 4XMXA 2PO6C 2R2HA 1C1EH 1JNNH 1MHCB 1SUXA 2X4UB 5K59E 4BFGA 2H45A 3BWUC 3LD8C 4UFHA 4KKCD 3VCRA 3TBYA 1P7QD 3L1EA 2XPYA 2CR3A 5AHEA 3CHDA 1ESWA 5DC9B 5C9JB 3UJIH 1T0NB 3THQA 3SE4C 1KXHA 3BMXA 3MMTA 1AJ2A 4W70A 4LH8A 4Y4FD 3KYKL 4GOAA 2O9RA 4AEFA 1M3JA 3E6HB 2PDKA 2YA2A 3NG5A 4CGUB 2EH8L 2Z91B 1XL4A 3FCUB 4CC4C 4JVUA 4GRWF 4WI9A 5FYLH 1OAXL 2CXKA 4Z7VE 4EDWH 4BF7A 2J1YA 2ZKXA 1NCIA 3O3DB 3UGXA 4UTCA 1IKOP 2VLJE 5T9CE 5ILTH 4R7OA 1NC4A 2V5MA 1NBZA 1MFVA 4TSBL 3OVRA 4KJYA 1DWHM 4D3CL 2V38A 1EA9C 4ELKA 5LXGL 4HCLA 3IFLH 1RIHL 4NQDA 5DD5H 5I73B 1UQZA 3GSWA 3S88L 3Q8BA 4S3AA 5HDLA 3HB3D 1FZKB 3GI8L 3S37L 2BP3A 3U7WH 4RL3A 1KR0A 2A1WL 1YBQB 1BZ9B 3MI2A 4CEUC 2EACA 4A4AA 4HB7A 3H55A 2Y6SC 5DXXA 4DK5A 4YHPA 1MEIA 4UBDD 4Z7NB 4ZO7A 4IIHA 1A22B 3HRZC 4FJZA 1XX1A 4JFHE 4URKA 1AVAA 5IBTH 3HMXH 1GZQA 4QY8A 5KJ7E 2J8GA 2OZNA 5HTSA 3L7EB 2BMKA 5D96C 3RJXA 2ZXDA 3FU7B 4QHKJ 2GCYB 3EDKA 1ILSA 4G71B 3ZT6A 4KKLC 4CU6A 5JQ6H 1UACL 5FEXA 3TCXA 4A3UA 2XDHA 2GQAA 4L7ZA 2I07A 3G5YB 2WXGA 3K6IA 3SUVA 1TJ2A 1NSNH 5CZXC 1V3LA 2GKIA 1HP4A 1AHKA 2VZTA 1ZWIA 3NZQA 1KM2A 4TMBA 1ACXA 4G9FE 4PMOA 1G84A 1XUUA 4BZ2L 3X3FH 4GAYA 3R8RA 1K5NA 4DEWA 4JPIA 3QUXC 1R85A 4GGHA 3NQDA 4JN8A 15C8L 1MUJB 1OP4A 4X2UA 3NCBB 5IQ7L 4GEIA 4K38A 1TQCB 5B1JC 1NCAH 4YN3A 5AENA 1OAZH 1XG4A 5K9OA 1CIDA 3PWVB 4OLXL 2EDXA 1P4LA 1S9WA 1IM3D 5I0XA 1PZ1A 4EF3A 1KDJA 4L9YA 1U8MA 1RU9L 4PJEF 3K6SB 5GISL 1MFBH 3WQFA 2NPLX 5DI8B 3PWLA 4FOJA 4Y2OB 1FFQA 2WNWA 2EYRB 2HFGL 3KPLB 1CEOA 5IB5B 4M93B 3ZTNH 3U2ZA 2X0HA 2EDMA 3WK1A 3MYJA 3UERA 5CIPH 1UT9A 1OIOA 4JEJA 2JKXA 3BESR 2O5XH 4LYKA 4AG4H 1TZZA 3N9GL 2HT4D 1VFBA 3NEHA 4CNIA 1PD6A 4P5MB 2R14A 2YXXA 2QDHA 4B5UA 3TJLA 1YEHH 5JOPE 4CVZA 3D34A 4YXHL 4PJGF 1FE8H 4TLUA 3LZ5A 1IQWH 4RDVA 2PDJA 2C34A 4W4NA 1M41A 5B39B 5IFAL 5SX4I 4NM8H 1KCWA 1BEYH 3PF2A 4O1DA 2JKTM 3S9IA 4U28A 4N2NA 3NA9H 3R94A 1Z9SB 2INEA 2AAAA 4NHUB 4TNFA 1ZRUA 1NWSA 4LLAA 1QEWA 5C09E 1A50A 4F1SA 1EGJA 1EZSA 4DN4H 4GYFA 5ABFA 3P0YH 4U1JB 1MUMA 5AZ1A 1U42A 3B0UX 1CE1H 2WMJA 1XZ0B 4YSDA 3G1DA 2IC2A 2OMNA 3MRRA 4QXIA 3KVKA 4FX6M 1W1ZA 3SIMA 5LGYA 3HV9A 2NY1D 4KVNH 5C3TA 4XCNA 1A4JB 1E1CA 5LG1A 3HE6A 4OVVA 4ISVA 3OKMA 5I6MA 3LS4H 4YO0B 4PJ6A 1P69B 2NTSP 3LX9A 2YD6A 1IAII 4MA3A 4DN3L 2NUXA 1K2DB 1S9YA 4M6PA 4PMYA 2VRKA 4XBPB 5D9SB 3OSKA 2GJNA 4QSFA 2KKQA 5EOTA 4TVPH 2O6EA 4Z0BH 4JQVC 2DQHH 5E9DB 3MO4A 3KPRE 1MH5B 2BVEA 1TWIA 5CC5A 1TSHA 4MMZA 5E70A 4LZKA 2I24N 4QGTA 2Z8WC 2ZUUA 3M41A 2QV4A 4A2RA 4QRQB 2AXJA 4G59C 4IS6B 5EF0A 1E6ZA 3W82A 1LMKA 4JFHD 2ADIB 4E8CA 2OKMA 3GHUA 3WE1A 3ZE2E 3WDJA 1ZCCA 5C8JA 3OF6A 4TM9A 1NLBH 2NX5B 1S2TA 2IKJA 2WZPA 4P7OA 2CJ3A 3ZUCA 2C4FT 1G7QB 2Q87A 4HHAA 4OJEH 2C18A 2OZ4A 3MRIB 4PE8A 3RWHA 3WLTA 1U3HA 2HTKD 3UZVA 1CXIA 2NY7H 3PZTA 1KGCD 4XO3A 1BJ8A 3CCHB 4U10A 1OOAA 3H8AA 4UMBA 3LCXA 5JLZA 5I71C 3BFQG 2ADAA 2I9TB 4Z7UA 3O0LA 4HVBA 1NQBA 1K4GA 5KYYB 2I7GA 4JDVA 3GKFA 5D2NE 2OZ0A 4LEEA 1BZDA 3CPLA 3GYCA 5I0DA 3MJ8A 3R0MA 4NFBA 3O9NA 4NO0A 1OTSC 1O95A 5G5DA 4M3PA 4PJCA 4PJXB 4IEFB 2WTPA 1BEUA 2JTDA 4PJ8C 1ERNA 3G5XA 5F8RC 3U2CA 5ESVA 4U1LB 4NWTH 4ZMYA 1A7NL 4BCZA 3W9EA 4M7TA 2Z25A 2FZBA 2EDNA 3P77A 4PTUB 3PY2A 4W9JC 1R3LA 4HKPA 1Q7QA 4EK7A 4GP5B 1XVSA 1AQKL 4PB4A 2CO3A 5REQA 1U3JA 5HULA 1AUSL 3NESA 1YRKA 3N6YA 2EVIA 3WUWA 4WNQB 1H5BB 4MMYB 2J6WA 5I79A 2VW6A 3AXIA 4JJ5B 1JPGA 3V0IA 2UWEA 2G60L 4QRTB 1M2VB 4HS6A 1T8XA 1IC5L 1AODA 1LP9B 3UZEA 1QWHA 4W93A 4I3RH 2JF7A 1E2WA 1M9HA 3WUZA 1PAMA 6A3HA 1BG9A 5EOCH 2WB7A 2J6EA 4XC3H 1HN1A 3X12B 4P2VA 3E8UH 2R8SL 5I8EA 1LF1A 4NPYA 5FA4A 2GY5A 2QUUA 3IDYB 4CNTA 5JIKA 1NOUA 3GNXA 1D5ZB 2ZA3A 1XYBA 1G1OA 4Z77B 2FVLA 1SEQL 3PZQA 5HVFB 3B8TA 1A1MB 1PDYA 3W9DB 4X80L 3ZGIA 1VAHA 3OR7B 4X5XA 1JPST 1RCXB 5GSRA 1T7WA 1A8ZA 1GS7A 4M82A 3VMOA 4B0MB 1LO0L 4W6YB 5FGSA 3VXRE 5HHVL 4NQEE 5EBMB 3L5MA 4IPIA 3UP1A 1WFIA 4ZMAT 1TJRA 3BKCL 3FC8A 2VQUA 3HLKA 3UPBA 3I2CL 1F6LL 4PB0H 4A66A 1F7BA 4U1MA 1ZANL 1S7TA 1RJPA 2NWRA 3IJIA 2EH8H 5ERWA 5IIEA 2MWCA 2XWXA 3M86A 3W1QA 3EJYC 1HC1A 3BGFB 2XJLA 3WLQA 1OAXH 4QO1B 5HVHC 3UWQA 2DQDL 2EILB 1N82A 4IBWA 4P2YA 1UM6L 1BP3B 7PAZA 1ZRQA 4M9PA 3RFRA 3SQRA 4Y0GA 4F33A 2F84A 5AEAA 4RV3A 4D3CH 2VH5L 1XKJA 2EDFA 3STFA 3KWTA 3RWEB 3G8EA 3MHZA 3G04A 5LXGH 2VEPA 2I7OA 4HMEA 5CGYD 5XIMA 4GQ9L 2VKZG 1RIHH 2CALA 5D7IB 4PB5A 1JQVA 4LDOB 3S88H 3P4MA 4NS0A 3GI8H 1BVOA 3S37H 1ZLSL 3WF0A 4JRYA 4XR8C 2XSKA 4IMGA 3ZK0A 4XN4A 2BVTA 2D3JA 5J12C 4WJ5B 2A1WH 4TNVK 4ATTA 1OFDA 4NNCA 1GH7A 4OIAA 5T9BG 2H8PA 4YBQC 1QRNA 2IWGA 2IGLA 4D6CA 4N24A 2EG8A 5BZWB 2E9MA 4JG0H 1PNCA 1R34A 4JO2L 2IDTA 4ODBD 4UMCA 3EFOB 3MREB 5D2TA 1W9PA 2VLKB 3YPIA 5BXFB 4PV1C 2BB0A 2FCBA 2CLEA 1NL0L 2VGGA 5L88L 4HCFA 5FYKE 2P0IA 2PP8A 3MQTA 3L13A 1U3YA 3R58A 2WLZA 1UACH 3SOBH 1CG9B 3NIFE 3DHPA 2IADB 4GKSA 4DK6A 3BAJA 4JK0D 2IPJA 4R3UA 3U9IA 1FCBA 2I9LA 4N0FA 4RNIA 5M03A 2HK0A 1MI5E 5GIRB 4BZ2H 3ZTDC 3CZKA 4N68A 1U8OA 3FQUB 2ZOLB 4X0KA 3PGCB 3RU8L 1SR0A 2R29H 2K6ZA 15C8H 1A6UL 3SCNA 3KPTA 2GUBA 3QULB 3QI9A 2XC8A 3RWFA 4WY0B 2WBXA 4H9TA 3MV8A 3V6OA 2BHUA 1HXJA 4E38A 3UROR 3BW4A 2PLKA 3UAJC 3FPYA 5E0KA 3BXNB 4OLXH 1K3ZA 3NUKA 4O12A 3BAEL 3E3QC 5L4JA 2VN4A 1NGWB 1RU9H 1G5AA 4N87A 1KW1A 2E3VA 3XIMA 2W60A 3UG4A 4NSKB 1KXTB 1Y7VA 1FNEA 4A39A 3A4EA 5DZVA 1W0VB 4G7QB 3CV5A 3PWIA 5IT2H 2HFGH 4YDIL 3CDZB 5G2IA 3TFXA 1TCDA 2Z7UA 4FXSA 3MXVL 3D09A 2XGBA 3MHUA 1SN0A 3C8DA 2VAAA 1RJCA 2GFBA 2AP2A 2VXUH 1UUSA 3BAWA 2XZAL 4GY4A 4JTLA 3BEWA 5CZVL 1FV1B 1PKOA 4I77L 4YXHH 2XPZA 4PRWA 3N9RA 5F7AA 3FB7A 4XD5A 5A8NA 3CXOA 5DRIA 3A4FA 4NXKA 1ZLEA 4Q8BA 5IMKA 5AAPA 4UQDA 4MYWB 4ZVJA 3TBTB 2OQHA 3UYCA 4S39A 4LSSL 4LOCA 2POZA 4J3WA 4ZFFA 3VZZA 4K9JA 3O3UN 4R0LB 3ARFB 4ACYA 1TU2B 4OLWL 3QUZA 5F3BA 1IARB 3AIUA 2WHKA 1J2BA 2X16A 2YSWA 2DAVA 4LCWE 1KTNA 1FIEA 3ZXWA 4L2LA 3GLDA 3ZX1A 3FOMA 3LAFA 1ZVHA 1GR7A 1IF2A 3DO7B 4XIAA 3D0AA 2BVQB 4PUDA 4JZJC 1VRDA 3KBSA 4X6DE 3KBHE 4GSUA 4ODSL 1W31A 5C08B 3D2UA 2E7LA 3L5WA 3MRDA 2DORA 2XBTA 5L9FA 4DN3H 3AZUA 4LF1A 3STZA 4L61A 5CPOA 1E6SM 5DK0B 1LM8V 1YPZE 5DQJA 3EGXB 3LQGA 4MZ3A 4IJBA 2FLBT 2XXMB 4MYXA 3MU7A 3GDBA 3SYPA 2Q8ZA 1IIHA 2R39A 5EU3B 4L8BA 5K4XA 4GFIA 2WOBA 1MJJB 1F3JA 3L5IA 2BNUA 2DIJA 1WA0X 3QR3A 3QXBA 1EAPA 4X50A 5ICYA 3NQFA 3SCOA 5D1XE 1F3EA 2X87A 3QG6B 4QEGA 3RIAK 1VP5A 1KY7A 4YUEH 5EMKA 3CL6A 3BQ5A 4ODTL 4P59L 2BP0A 5FYKD 2PO6B 3KWXA 1P4BL 4RAHA 2CZVA 1NEPA 4U5KA 1DXIA 2R23A 4XTDA 4MZYA 3LD8B 2Y1ZA 5HWJA 4JRXB 5KETA 3QFJA 3HFMH 1QKZH 2WXJA 4YJ5A 3WY4A 4Z1PA 2P8PB 1KIUA 1C8YA 4R34A 1XHGA 1MI5D 3IDNB 3WMSA 4AQ1C 2PURA 3QZAA 1H6EA 1DIDA 5CCHE 2WW5A 1ULVA 4B7LA 5CEYB 5BS0D 3QPQC 1BOYA 3PPEA 4DZAA 3MA9L 2FPTA 1MWAL 4HLZG 4W8LA 3VFRA 3DIVA 3IDGA 4EN3D 4PD4K 1REQA 3VO0A 3QC0A 2YCJA 4KWWA 3LPGA 1B30A 4LRIC 3NCMA 2PPAA 2B0SL 1XAKA 3KPSE 2Z35A 5F7UA 1PLGL 3V55A 3A12A 4HHLA 5KYXA 4P07A 1AZBA 1A7NH 4GZEA 3IU3A 1KIRA 1EXPA 3DI3B 4EMZA 2GSJA 2PW2B 1UKPA 3LCHA 5FW8A 5BYWA 1T83A 4P4KA 1GVYA 1RZJC 1YYML 5IQNA 3RJOA 3MZNA 2OVLA 4MOZA 3G0SA 1EDHA 3TWYA 1H1ZA 4PTWA 4FFWD 4QQ3A 4WDIB 3P14A 4ZXLA 4AZ7A 4NYLA 1JNJA 3JUYA 2AJZB 2XA3A 5EEYA 2X9WA 4F8LA 1IL1A 1UCTA 3UBGA 3C5ZC 3OLEA 4PJ7A 1XF3B 3PQYB 5BJTB 3UJRA 1IC5H 1BQHG 4XMZA 2XQBL 1CXFA 4C54A 3RFZA 1L3WA 4O02A 4OZ4B 2GAZA 3I7SA 3PBWA 3RG1C 3R06A 1J2WA 2R8SH 1OPGL 1NWPA 4UDTA 2WZTA 3ECBB 4GG6F 1LWRA 2QLYA 2R91A 1WNOA 3OC5A 3FFCD 3LRMA 5DRNA 4UUJA 1BLIA 3V95A 2P45B 4POZD 5D96B 3DI2B 1IWBA 1BLNB 1O6SB 2Q8LA 4NP7A 1FRBA 1L9WA 2QAFA 1SEQH 4NBZB 5FIPA 1TZ8A 1XIWC 1KXVA 2BGQA 4EKJA 4G1EA 4LCWD 1SMDA 3V8OA 4PBEA 1T0PB 1SOSA 1WFNA 3RIKA 4PR5B 1IXOA 2WWMC 4HSQA 2ADFH 4MHBA 2HMIC 1UCBL 5DHYA 3WTWA 5HHVH 2DM4A 4M43L 2CHOA 4ICMA 2IV9A 3BKCH 5B1AB 2VDOL 1NF7A 3I2CH 3QUXB 1EJXC 5CBAA 1ZANH 1B3JA 2ITFA 5A6BD 2Y8VA 1QSEA 2OP4L 1TZAA 3FFDB 3QQ9D 3HS9A 3MSYA 4PLKC 3QUKB 5C2GA 1MWAB 2IXQB 5FD0A 3C0JA 4X99B 5DJ8B 3N06B 1BFSA 1CFNB 4S3FA 2DQDH 4Z2GA 4M19A 4IIZA 1PS9A 4QDWA 2CA4A 2AAMA 4A1RA 3AAMA 1RZ8A 3HIJA 4OZHA 1E6QM 5CCKL 4LKXB 4A37A 4QGYA 3CXHJ 4QG8A 1SYSB 4R9HA 5D7JA 2OYKA 1A6PA 4GQ9H 3T65B 4RX4D 4D6HA 3ZZLA 3P74A 3M47A 3IRPX 1MF2H 2AXFB 4Z76B 1HHIA 3FGCB 4Z7OE 2VSKB 4QRPE 4ZE5A 3GUGA 2DBJA 1ZLSH 4DQOL 3RVTC 2DQTL 4Q4MA 3WLWC 2X9ZA 3IGHX 2P88A 5ESQA 3SPVB 1GAFL 2RMNA 4J1UB 2Q8XA 5E0CA 5BXSA 2GIYA 1I1YB 5F0MB 1OP3K 2AERT 1W16A 2BS9A 4LT7A 1NGXA 3APMA 1NGYB 5IMOA 3M5YA 5IB3B 2VXTL 3MGTA 3RWIB 8TIMA 4JO2H 4O51B 1LLOA 1NARA 3KLLA 4D9LH 4BWWA 3GUWA 3HMCA 2ID5A 1XJBA 1TG7A 3ZDWA 1NL0H 4H8NA 3A9IA 3T9WA 2MUCA 4AE0A 2JEPA 1KM4A 4Y1SA 3G5ZA 3WXVL 3DGDA 3IGAA 1DYSA 1QHPA 3AYRA 2Y88A 1AGBA 1RD6A 3RKDD 5T1LD 4AQ8C 3HGRA 3OVPA 5M94B 3AMCA 4XK2A 1XIDA 1ZDQA 3KPSD 5T3ZL 4YHKL 4JX4A 4O50A 1CGSL 1P7TA 3TCLA 3SM0A 2VDOB 3L81A 3RU8H 1KEGL 4QAWA 2OW7A 1KGYE 1N2RA 3MJ9A 2A0LC 2G2PA 2V9TA 1JERA 4FQHA 4GT0A 2JK5B 1GC1C 2KLRA 4H13C 1W1TA 4I13B 3BAEH 3GC2A 4LARH 1YY9C 4LVNB 4R88A 3RPIA 4L80A 2CC0A 3GRBA 4HCIA 1FCVA 1IC4L 2EVFA 3RVVC 4L4VE 4S38A 1U3HC 5JNYA 3TJXA 5F6IC 1TTFA 3PUUA 4NX0A 4YDIH 5GZNC 4N2DA 4ADSA 1Z7JA 3NFNB 5H1WA 3B5HA 4MJIB 2BX5A 2GHZA 3DX9B 3LQMA 2EVJA 1WE5A 3FT0A 3S1WA 5F9JB 2JQAA 1P48A 2FT8A 1AL8A 5FYLD 4NU7A 1ITUA 4IWWA 3UTTE 4WCJA 3H9HA 1SSDA 1Q6DA 3IS4A 4IMKA 1Q72L 2XZAH 1HU8A 1DE5A 4ZBCA 5CZVH 3BWAB 4WWKA 4S2BA 4I77H 1KBBA 1WXJA 3WUGA 4EPDC 3NJIA 2VCAA 4HKZB 3ZMEA 2NVCA 4XZMX 1LDPL 1YEEL 5CBEA 1PCKA 2J2ZB 5DUML 2IUZA 5I71B 1U92A 4LSSH 1I1FA 1MFMA 3ALWA 2JGQA 1U95A 3T2QA 4OLWH 3N14A 5C0QA 4LEOA 3KCPB 3EJUA 4FYSA 4YC2C 4PJBF 4TVPE 4YOKA 3D5OF 1NLDL 1C1EL 1JNNL 2GJ6A 3UBXA 2R9HC 4OQTA 1TLKA 1CDBA 2DT2A 4R33A 1OYAA 3BPOB 3G6JE 3EZ8A 2UY6B 3VWJC 3T77B 5CGTA 4PJ8B 2A3BA 4S3DA 5LO7A 3AHVA 4C6NA 4Y4KC 4ENEC 5C0DB 1E5AA 4ODSH 3IVKA 2V5JA 4O52A 1EO7A 4RNHA 2KHAA 2G4GA 3BUQA 1IB5A 3O2DL 2GQHA 4KERA 3VNJA 3HZMA 4JRLA 2Y07H 4QPEA 5DLML 3INOA 4FG4A 2YAMA 2GY7B 3EJJX 5FYLL 3C3UA 4BH7A 2E77A 1FFNA 2WMPB 3GG1A 3M6YA 5HNTA 4MSSA 3PJLA 2J75A 5CJXA 3F7KA 3E0FA 1IT9L 2XYBA 1DUZB 2ZZUT 5IM7B 1TG8A 1JMXA 4LAZA 3DOPA 3AG1B 4JPVH 3V6ZB 4F7KA 3A6OA 4ROQA 4PP1C 3ITGA 1SM9A 1IEBA 5TQLA 3W71A 4KNSA 2G3NA 4Q7DA 4ODTH 3FO9B 4P59H 3K2MC 3RAOA 2WKLA 3ZZQA 1RJRA 1P4BH 1AD0A 1VFHA 4JX6A 3U7WL 2HMCA 3RDTD 1IUZA 4BRJA 3MCKB 4FQXA 1AR1C 2N3JA 4IU3B 1JI1A 5DZPA 4X2RA 1GSKA 3IK2A 5IBTL 3HMXL 1VR6A 3GSQB 3DTXB 4GQZA 1BYAA 2C19A 2UVEA 4U3HA 3GJFB 3C56A 2JIXB 4U1IA 4R53A 4X63A 1BXBA 3CX5K 4NKCA 2MQCA 3C60D 3DGCR 3QFDB 1BQUA 5CINL 2CO6B 1ZPUA 4J3OF 1J0IA 3MA9H 5JQ6L 1MWAH 3JWOL 3LCYA 3VYNA 1RHHA 4OZIA 4Z7NE 3OG2A 5DZOA 5HVHB 4W5UA 2CZ5A 3SY5A 4JHAH 5SWZA 2GJLA 3VVGA 1JBJA 1PLGH 3JV5A 3BRFA 4JB9L 2XH2A 1DVFA 4PJDB 8PAZA 3W7PA 4W7WA 4IXHA 2ZPKL 2VXVL 3BCJA 3OG4B 1I31A 2HPOA 4MDJA 1VQTA 2HA1A 1QLEL 3PV6A 1GGOA 2JTYA 4TV5A 3P7YA 4DBWA 5C0CD 5T1MB 5D7SL 2G0WA 3FNKA 2FIQA 1FFOB 2B9AA 4LP8A 4MAYD 1TX0A 3CDGB 2WCGA 4NCC1 5E8PB 3UTTD 5J12B 5DC0A 1DCLA 1EIXA 8FABB 3AQZA 2V67A 1NBYA 2XQBH 1VJIA 2R1KA 1TEGA 1NBQA 1ZVSB 4AJYV 4NZ3A 3DKLA 2X6VA 3VI2A 5AB9A 1RLBA 1OPGH 3DVGA 1EEXA 3IWPA 2VN7A 3NCCB 3TR9A 2E9JA 3OPZL 1K8ZA 3QDGE 2B3IA 5KVDH 3KLAA 4FP8L 5KS9F 2J8TA 3ATEA 2O5XL 2A6JB 3NFUA 5IDIA 5AOJA 4AG4L 4MKSA 4TVPD 3HIZA 5DR5H 4OR1A 3MR9A 4AY0A 1UR9A 1JZHA 4F7TA 1KV7A 5JW5B 4M6OH 5DJDA 2YMOA 2QVIA 3V6OC 3ZM8A 4YFDB 1F3DJ 1YEHL 4LEXL 4QCIA 1YXYA 4DELA 1FE8L 2GDVA 4W1TA 2Y61A 2H3NA 1ZT1A 4QDPA 5TDPA 1N26A 4N0UA 4XWOD 3VE7A 1EWEA 1URLA 4RAVB 3VXOA 4Z2KA 3LQAC 4IBZA 1BXXA 3GBDA 2VDOH 4E4PA 1BEYL 3GS7A 2XFWA 3II1A 2GJJA 1A6TB 3T3ME 1L6YA 1XIHA 1E30A 2CSPA 2OP4H 4GBUA 1PZSA 8XIAA 3BQUA 2VLRB 4N5EC 1AD4A 1VZWA 1CE1L 5DJXA 5AYZA 4JQ2A 1E27A 4HOZA 2IPKB 4OH2A 4Z78B 3ITYA 5E7BA 1VFMA 4HLEA 3IIOA 1Q5MA 1G0DA 3VCLB 1R19A 4KVNL 2VX6A 1SYVB 2J1KA 2P8LB 2XIDA 2FJFB 5C0BA 1Z3GL 5CCKH 3VFTB 2IWFA 1FZJA 4HPHA 1MVFA 3LS4L 1FHUA 4UQAA 3AG4B 2A4ZA 1P6BA 4HK5A 4XXCA 1O9WA 4BELD 5TGBB 1QLEB 4H20L 4DGWC 2VN3A 1S8DB 5EF1A 3NRFA 4Z3GA 1FWFC 1U8NB 2RQEA 4DQOH 3OKKB 2B7OA 2JV6A 3S2AA 2VITB 3FN3A 3QR2A 1GJUA 3MFFB 4JAWA 1ORSB 5GS1A 1GAFH 1ZALA 5EA0L 2A6DA 1IC0A 3QWRA 3IGKA 1SW7A 4Y8FA 2VM8A 4LLUA 5IJKC 2VXTH 1ZLVH 4PW4A 4L1HA 2BWDA 1E5NA 2YQ3A 5HYSG 4HT1L 5HAOA 3W1RA 4QWWC 3BUYB 1U8KA 5F3HB 4WO4B 4XNUH 1TQVA 5E9DE 3WFBL 4OF7A 5HHNA 2X1OA 3VI4F 3WXVH 2C1OA 1JV5B 3OA3A 4FG2A 2AOSA 3U4FA 4UFMA 5INCA 2VNCA 1TV8A 4BKLB 4L5FE 4YNYB 4PWGA 5KSBB 4YAQA 3QISA 5E56A 1S7UB 1TREA 3DIFB 2NY7L 3VYLA 3IPWA 3UTZA 2CE6A 3VGEA 3BZFA 5T3ZH 4K68A 4JZJB 4YHKH 5DC4B 1TUPA 1CGSH 1ND0B 3AAZA 5FJIA 2VC6A 4E9VA 4ZQCA 2YEZB 1KV3A 1I1AB 4IM4A 1DQVA 2QR6A 1RZJL 1FL6A 3GBLA 4AVJA 4HKXA 3DA0A 4NO5A 4NQCB 5AYUL 4BF5A 3OIXA 4MA8L 2NZ9D 2GIXA 1SMAA 5KYWA 3F12A 1A5OC 5DJ2A 2X2IA 3FQRA 3V5CA 1QFWH 2R2HB 1QSFB 1S2AA 1YW1A 4B9GA 3REVB 5FIEA 1EFQA 4NO3B 1JCYA 1QLRB 2MKLC 3P93A 1JP5A 4O1BA 4PPTA 1CBVL 3LYEA 2R7EA 5IVXB 4CNUA 3WJMA 1ESOA 4UIMB 3BO8B 4M6NL 3VRJB 1T03L 4XVEA 4PJHF 5XINA 2VMEA 3B2MA 4Q6IA 5I03A 1WCGA 1CT5A 3EOEA 2W0LA 1Q72H 3ARZA 4HKBA 3AGWA 5J6HB 2WMHA 5BWAA 2H1LM 4OLVL 4LRTA 4DX3A 2XTKA 4Y9EA 4L9ZA 1JYWA 2HT3C 2ZSWA 3D0VB 3T1WA 1R3HA 1AG1O 1QA9A 1Z44A 1LDPH 2PDFA 2ZZ6A 1YEEH 4MVBD 2PLCA 3VA6A 1BWMA 5DUMH 4TNGA 3N50A 4XC3L 4AYFA 3CHCA 3MUZ1 4B5EA 4HEPA 2AXGB 4PRIA 2PR9A 1CTMA 3GJFH 2JVUA 4Y88A 3W73A 1DQJB 4AQ1B 3BLLA 4XBGB 1LE9B 3TGXA 3LNFA 1KFJA 2FWOB 2Y22A 4S2SA 1ELSA 2J7BA 4HCGA 4Y1AA 4UNTA 1NLDH 3W2JA 3I4KA 2ZRXA 4ZYKA 3VYPA 1B6UA 1ZBVA 3EYVA 3B4YA 2X70A 1LP9E 2BCMA 5CKSA 4R26H 3BSZA 3A5VA 2Y36L 3KYMA 5IEKA 4HKJA 1X6UA 1D5XB 2DT1A 4GO6B 3TVAA 4KIEA 2BWGA 3EWBX 4R7DB 3K91A 3CO8A 5L2KB 1HYSC 4GQQA 1J18A 1UHVA 4M29A 4GI4A 1AYRA 1FNGB 5IHRA 1IR2A 2ZVRA 3E5BA 1LGVA 3RFZC 3RL1A 2A4AA 4WTXA 4Q14A 4PB0L 3O2DH 4YHMH 5EZLB 2YD4A 5BUAA 5DLMH 3GDTA 2P24B 1UQYA 2D0GA 3VIFA 1H7RA 5HOSA 3RVWC 1YC8A 3FT2A 1Z42A 2ZA2A 2V6HA 2WAHA 2W07A 4OV5B 3C5ZB 4YSQA 1KXVC 1IT9H 2X0YA 5TF1L 3DX3A 5D2LF 2V9QA 1CFSA 2WWKT 4RVBA 3WG7B 2WBWB 1X5GA 4Q8WA 3EJSA 3SGDI 3CS2A 3CUPB 1EBGA 4PBXA 2ISDA 1DQQB 4FIQA 5EUOE 1ZY9A 5BW7C 5T1KA 1YMHB 4B41A 4GAYB 3IB4A 1EWHA 1K5NB 1XCTB 2IDSA 3NNTA 4O58H 4UINL 5F1UA 5E9DD 1Q13A 3EKZA 2DZUA 1WAWA 1XIWB 2ATSA 5HXMA 2WO4A 2MMXA 4PGBB 5CHNA 2X05A 1P4LB 1S9WB 2DOCA 2B20A 4JG0L 1EDGA 2IDUA 1U4FA 5D7IE 3NZUA 4ZFMA 4CVXB 4EIZC 4QIUA 5HR7A 2NX5D 2WHMA 3WFLA 4MRCA 1XGPB 3FAWA 2YOAA 1TSRA 2DIBA 5CINH 4ZUVB 4RK8A 3JWOH 3KPNA 3SOBL 5L2JA 1FSKC 4CAGA 2FH8A 5E00A 1GC1L 4JY4A 4KNQA 1W8GA 1AC0A 1RZPA 2A7PA 1OT1A 2E1DA 1KGCE 2QKIA 1SW0A 5JUEH 4JB9H 5GNZA 2YZ8A 3SJVD 2FIKA 2VLKE 4LPCA 2CH8A 2PTDA 3N40F 2VL4A 1QFEA 2ZPKH 2VXVH 3ZQXA 1A5BA 2BIQA 1JRHL 4C56A 1QNSA 1QSVA 1WO2A 1KBIA 3EYQC 1QLEH 2R29L 4QE4A 2OZ3A 1AW5A 2ZRVA 5AFDA 1KRAC