1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-galactosidase
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
2C13A 3HO8A 2VRKA 4DBDA 3QSTA 5AYXA 1SSDA 5DCEA 3O63A 1EEPA 1UUMA 3W7OA 3T7VA 4WSJA 3BUBA 2NX3A 4HNNA 5DXXA 4JYDA 2ZX9A 3A22A 4UMBA 3UWUA 3GNDA 2J27A 4NXKA 2OW7A 4UTJA 3W1PA 3D50A 3QM3A 4G1KA 1E40A 1PHWA 3G0SA 1ME7A 3IIPA 1QMLA 2GJLA 3KVJA 2F7QA 2YCEA 3ZT6A 2RFGA 4JFSA 5E6YA 3QMSA 3IVUA 3W7LA 3O6CA 2ZUTA 4QNEA 1FUYA 1QPNA 1JQXA 1WQ5A 3BV4A 3LM7A 2OYKA 3P61A 3BH4A 2QAPA 1E3ZA 4N4QA 3W1QA 2CLOA 3PG8A 1QX1A 1YXYA 4JX5A 4UFIA 3NEVA 1ZS2A 3PVFA 1R33A 4CNOA 4O4VA 5F2MA 2Q8LA 5LKYA 3QMTA 3VGHA 2O7QA 2QUUA 2FTPA 1A47A 2FYVA 2NX1A 4OHQA 4GKLA 3AJ7A 5K9XA 2ZICA 5G5IA 3HG3A 4CNPA 1H51A 2NWRA 3I6RA 5U4NA 1UKSA 1OK4A 3D52A 4JY9A 1NF0A 1O95A 1VR6A 2V0TA 3NPXA 3EDFA 4ADSA 3TFCA 2ZRXA 4NUWA 3SIZA 1R2SA 1JXJA 5D32A 2VFFA 2E6FA 3EJUA 4MJZA 1PAMA 3F4NA 2A6LA 4NNAA 4A22A 1FDZA 2WO5A 1KBJA 4B5NA 4JD4A 1ZFJA 1HVXA 2Z1BA 1S5VA 2OW6A 3STFA 4TU1A 3C3NA 6CGTA 2GVLA 2A1YA 4JICA 1P1XA 3CZGA 3A5FA 3LXBA 3GIYA 4E38A 1UB3A 5LNVA 2E5DA 4MZYA 3W7JA 2JGYA 1WPCA 1EO5A 1AW2A 3LTYA 2Y5EA 1G6CA 4HOZA 4NXSA 3GX9A 4JTTA 5I3FA 1UD3A 3STGA 1EHAA 4CQ9A 1GZGA 3R2GA 2DZTA 1ZY9A 4X9YA 1TQVA 2FB3A 4DF1A 2QAFA 4GI6A 3ATYA 2BY2A 2D0GA 1I45A 4MJMA 2ZDRA 4GUJA 3B0PA 2E1DA 4WOZA 4AYSA 7CGTA 3VGFA 3C56A 3DAQA 4AHOA 3STCA 3T55A 4UQAA 3TC6A 4AH7A 2GQ8A 2H8ZA 1KCLA 3WY2A 1SMAA 1MFUA 1GJWA 4AHQA 1I75A 3M1ZA 3R12A 2GJPA 3WNPA 5DN1A 2DZXA 3AJXA 3WMSA 1IZKA 1DBTA 2D3LA 2QUVA 1LRTA 3WNOA 3L0GA 1K02A 1OJXA 2B7QA 2QCEA 1DOSA 3SR7A 1ZHAA 3TTYA 5HMSA 1CLVA 2DP3A 3H53A 2YW3A 3NR0A 3PR2A 3DKLA 3ZSTA 4UCFA 1N7KA 2Y85A 3STEA 3CIXA 4OWGA 1GYNA 3KWXA 2CFFA 3N73A 1GG1A 4QQ3A 4JTLA 4JTGA 1UBSA 3P5YA 3FS2A 3M9YA 1W5MA 3F4WA 1CX9A 4M5PA 2DH2A 4EF8A 1M53A 4W93A 1K3UA 2CLFA 3BW4A 3N9SA 4WZHA 5DELA 4WUIA 2B7PA 1AMYA 1TCDA 1TYGA 4IXHA 3W37A 4Q32A 1Q45A 2V5BA 3MWAA 1ICQA 1MWOA 3EEGA 4PFMA 2F1BA 3O1NA 3S9YA 3OVRA 2QCFA 4JIPA 1AG1O 3KL5A 3UEQA 4XKYB 4MKNA 4AF0B 3G1VA 2YIHA 3LLDA 1ICSA 3GXDA 2QUTA 2IGTA 5EBUA 3SGZA 1KFCA 4QAIA 3GXIA 1K7EA 3TOPA 1QOQA 3FA5A 3G1FA 3IV3A 4XKYA 3WJWA 3OVPA 5A6MA 1MXDA 3EX2A 3LI1A 4M8UA 1QWGA 1MZHA 1FBAA 3UERA 2QF7A 4FX6M 3W7CA 3WK1A 4AMXA 3SSJA 2YFOA 1W56A 2VEMA 3HPXA 3LHTA 3QZEA 3M07A 1ZJIA 4GC4A 1E3XA 2HSAA 4UTHA 2WQPA 3C61A 2EO7A 1QWUA 1XSJA 5D2YA 1GOXA 3G1XA 4UZUA 3INPA 5GVJA 2YJQA 2ZWYA 4OIFA 1LTDA 1KM1A 1L9WA 2Q3RA 3CQ0A 4ZQMA 3U8GA 3B0UX 3USBA 5F2GA 2ZE0A 1QHPA 5A8GA 3HJZA 3N19B 3I7RA 3GNNA 4AHPA 5HUPA 2DJLA 5MHBA 4JR5A 4D2JA 1RPXA 4CKQA 1TPEA 3LHZA 3PULA 3SECA 3AMLA 4MB1A 1OFOA 2QCLA 3A9IA 5D2XA 4BF9A 3BCFA 1LBFA 1D3GA 1DL3A 4O50A 1W37A 1ONRA 4UTTC 1OFEA 3KVLA 3TQVA 2ZQ0A 2BY0A 3AXHA 4TR9A 3UPWA 2XWEA 3P84A 3W9ZA 1QO2A 4O53A 4NI3A 4ZVJA 1F76A 1RQBA 3BVXA 1XFBA 4NJIA 4RX0A 2X30A 1VH7A 3LRMA 1HWWA 4HPHA 2C0AA 2GUUA 1V3KA 1UH3A 4I9AA 4JFUA 2G97A 2XIBA 3CZSA 3B4UA 1FQ0A 4AWUA 1EX5A 5TD4A 2KZHA 1FY6A 3AXIA 4DELA 3A4AA 4JS3A 3PM6A 2AAMA 3DX3A 4RR4A 1QW9A 1TPUA 3P82A 3HZ3A 3CZEA 4DO5A 1QOPA 4AAJA 5BW6A 2VR5A 3KE0A 1CXHA 5HULA 1QR7A 4FLSA 3FIGA 3CTTA 1GTEA 3S1XA 1KM4A 3S1VA 2Z1KA 4IPIA 1XH0A 4UTMA 4OV9A 3Q94A 2NSXA 3PBUA 1LLZA 1NAL1 4UMAA 2VFIA 4MOZA 3W76A 3TMLA 4UQ9A 1RQHA 1IXOA 4GFSA 3W2MA 4QIUA 1X6UA 3O05A 3IIZA 1JR1A 3VFLA 1TJRA 2NV1A 2H90A 5AC7A 3L4YA 3QC3A 3NNTA 4O57A 1VCGA 3S2CA 4QSHA 2ZX8A 3IIOA 5CSSA 5FF4A 2V2CA 4E0CA 1UD6A 3UG3A 1TPVA 1GEQA 4QNWA 4RZ5A 4P61A 1J0KA 1UASA 2I1OA 3VE7A 1PIIA 3TCEA 1B0IA 1NEYA 5TIMA 2F61A 4HKPA 3DENA 1EP3A 1TV5A 4UFJA 2G96A 2NUWA 3O6YX 4Z1DA 6TAAA 3BAWA 3QGVA 1NSJA 3BARA 1BEUA 2NZLA 1ODUA 3THAA 2V3FA 1P6WA 1L6SA 3N2MA 3C52A 4LY8A 3T44A 1V5XA 1XM3A 2EADA 3GYEA 1QPOA 2J9ZA 1F6KA 1SO3A 3G0XA 2B7OA 3GXPA 3TW6A 1CW2A 1N55A 1VFOA 4HP5A 4UTTA 2ZUWA 5CLTA 1OFRA 5H2ZA 2E5BA 2BZNA 4Z0SA 2I14A 2C18A 3NXFA 1GVFA 2R91A 2E8ZA 2E77A 1TTPA 3L21A 5LNUA 2VT0A 1W3NA 3W84A 2XN1A 3EWBX 4OBTA 2OZ0A 1A5CA 3CPUA 1KM5A 5D02A 4UTIA 1ZNNA 4XWUA 1JF5A 4Q33A 4ZQNA 4MLJA 4POCA 3I65A 3ZT5A 3EKZA 3W85A 4B9YA 2WPGA 1B3OA 1QNVA 4WY0A 5F1UA 3NAVA 3P62A 1W5PA 1OX4B 3VO0A 4WOQA 3TKFA 3DZ1A 1SFLA 1WO2A 2PC4A 4JEQA 3S0CA 1F6PA 2OCZA 1UUOA 4WSKA 4RXGA 5DFAA 4GUGA 1OK6A 2F1AA 4FF7A 4IMGA 3VMNA 1XXXA 1LRNA 5EA9A 3GR8A 4LVBA 5HDRA 1S5WA 3LPPA 1Q6OA 3OEXA 1OX4A 4K8EA 2CLIA 3PY2A 4QITA 1SFJA 1I2PA 2E6YA 1TQWA 4H8VA 1KTCA 1S46A 1KTNA 2VEIA 2V30A 2FHFA 2VELA 1SPQA 1OG0A 2CLMA 3C0JA 5C2XA 2C7FA 1Z48A 4J3UA 4X3ZA 3W7GA 3BG9A 2BWGA 4HOWA 4RXFA 1FCQA 5F4SA 1U30A 5DBTA 5F4WA 2BXYA 3W38A 2FJKA 1CGVA 3PB2A 1WXJA 4Z08A 3GZ3A 1TV8A 1JDDA 5EYWA 2X1UA 3OBKA 4R33A 1JUEA 2BHZA 1VPXA 4H6KA 4QJ1A 1B2YA 2P10A 2Z0IA 4IPJA 4XTIA 4S2BA 4EVZA 1XH1A 3GR7A 1RPKA 5KMYA 1PCKA 3WFZA 3BCDA 4R7JA 2ZTKA 3VU2A 3KVKA 1WA3A 4GUHA 2PWFA 1I8JA 4JXCA 4LS2A 3MBFA 3TSMA 3TU9A 2ABBA 3P81A 3EWWA 1DHPA 1MEWA 4K38A 1VGAA 4K6AA 2E09A 3UY8A 1UA7A 3LHWA 1KFBA 2YW4A 3V75A 4HNTA 3WDJA 2GPTA 3CLWA 2R14A 2V2HA 2QV4A 1W0MA 1WZMA 5I3GA 2RDWA 4I7WA 1R2RA 2WVSA 5J5RA 1R47A 2VNCA 2BXZA 2NT0A 3E12A 4HNUA 4JCLA 5KZMA 3PB0A 1JCLA 5FF2A 1JD7A 2HTMA 1P0KA 4J3XA 1NOFA 3LXCA 2D0HA 1P4CA 3HGRA 1UD4A 3PUDA 1J2WA 1SSGA 5G4EA 4OQVA 2FPVA 4L4MA 4AEEA 5E93A 1SW0A 2Y7EA 4LS0A 4Q4KA 1AQMA 1VZWA 3W7MA 3NQ7A 3WDHA 2V2DA 3BLIA 3KVMA 4OE7A 5HNRA 4RZ4A 1JULA 3LCFA 2NLIA 4ZQOA 3DHDA 3EJRA 4LVAA 3DX4A 3MP3A 1W3TA 2W79A 1CXLA 1WBJA 4DPQA 3WEOA 2WC7A 3LERA 3EWUA 3IIXA 1TB3A 5A6LA 1GT8A 1PZ3A 2WSKA 4NX5A 3H54A 4AVFA 1SW7A 2B0MA 4AXKA 1RZMA 1CXIA 1KM0A 3LTSA 2XIIA 2VFDA 3L9CA 3TDFA 1TQXA 1HTYA 2W0UA 3RU6A 1SZNA 3N3MA 3VGGA 3LB0A 2CLHA 1BF2A 3WY4A 2ZRUA 3QRHA 2WPBA 3BAXA 4U28A 1FWSA 5I24A 1B4KA 4E2DA 3GXMA 3DU0A 2Z2UA 3RLUA 1ZJAA 1ZAIA 3EWZA 4RV8A 4ZMGA 4YCOA 5LHEA 1AK5A 1OFPA 3HIJA 4JTEA 5HINA 3WJZA 2OSWA 4DQWA 2QCHA 3D0CA 1UD2A 2FB2A 2QJGA 3NQFA 2OYMA 1GQNA 2YGYA 1M7OA 3W73A 1RP9A 3A21A 2DU2A 1SMDA 3TXZA 1KBIA 5LHFA 3DFTA 2F7RA 3VGDA 1I2OA 1BWLA 2WJZA 2ZX5A 1FCVA 4N6EA 3S42A 4IJBA 4LVDA 4TIMA 4UNLA 4O17A 3MO7A 4Y6GA 3BLPX 1OFAA 1V3MA 1W8SA 4LTSA 2ZXDA 3QEZA 1PCWA 3MP4A 4IX2A 3RMJA 2TAAA 3W1RA 4O13A 5ABTA 1H7NA 3ZQ9A 1H7XA 3UWYA 4MUZA 3LCXA 3WNKA 2E6AA 3TONA 3GDLA 1FWWA 1C8QA 3LRKA 4O10A 4UR7A 2QDHA 4A21A 4M56A 3CIWA 1RR2A 4LC8A 5EPDA 2V81A 3W74A 1KLYA 2DJXA 4LWWA 4NJGA 3LOTA 1V3JA 3PF3A 1JUBA 5EY5A 3KOFA 5AOUA 3JRKA 4B9ZA 3BLBA 1Q4NX 2J88A 1IXQA 2EJ1A 3N9RA 4O52A 1QPRA 3DI1A 4PEKA 1J5TA 3L5LA 3NPUA 1GWJA 2QKFA 3N34A 3P74A 4S2CA 2TYSA 3A24A 3E49A 4JFWA 5BRPA 3CGTA 1A50A 1W54A 2ZZ4A 4Y96A 2QJIA 3BLKA 4CGTA 5D38A 4O19A 3CEUA 1CGXA 5H91A 3BUPA 3SY5A 3QQ1A 3UY7A 3E96A 3P60A 3ATZA 1G69A 2ZXQA 3ZS4A 3ANYA 5LZLA 1YYAA 3BPWA 4O18A 4GRSA 4HN4A 3NDOA 2QLYA 3B05A 3FEMA 2BX7A 3BK0A 4AIOA 1T99A 2A6NA 1NFBA 3N2XA 3TFXA 4H4IA 2VOMA 1CGTA 3DDGA 1WZKA 1QPQA 1O94A 1K03A 3DI0A 4N9DA 4N9CA 3AMKA 4O1DA 5LGZA 3BUDA 3C2RA 3IEBA 1VC4A 1W1ZA 1LLWA 3PBYA 3K8LA 3WJSA 2E8YA 3W1UA 2NXIA 1M5WA 2JKEA 1XD1A 1LOLA 3WJXA 2ZBTA 1RQEA 1IIHA 1XBXA 2NT1A 1YPFA 3HPZA 1H61A 3GDRA 1V3LA 3QJAA 4HPJA 1O5XA 1T96A 4RLIA 5DLCA 5AHLA 5AFDA 4N9BA 3QYQA 1TPWA 4NZJA 1KGWA 1MW0A 1L0PA 4IOTA 4ML9A 4MLRA 1HT6A 4OU1A 1TQJA 5FF0A 4HPXA 1QFEA 3DH7A 3CZLA 3HF3A 2ZX6A 2CLLA 4O12A 4JYEA 1EA9C 2ZRVA 3BO9A 5FI8A 2ZXBA 3BSHA 4WY0F 3G1AA 5FEPA 4NU7A 4J28A 1H50A 4ORIA 5KSWA 1OHLA 5LNWA 3FOKA 1H7WA 3TTSA 1KWGA 2QCDB 2GOUA 3MI3A 3W07A 2G3NA 3II1A 5AN7A 1AW5A 3NQGA 1FXQA 4DEFA 4UTLA 3ZSSA 2ZRWA 4S1FA 4U4MA 1ZENA 3UWWA 4XB3A 2FHBA 2QCDA 1G4EA 3BW2A 3LCIA 1IIGA 3MI6A 2QCNA 5D30A 1Q6LA 1I4NA 3W1NA 1E43A 2ZWZA 2ZCGA 4LPCA 5CPLA 1PZ2A 3G22A 4O4WA 3G3MA 4IUOA 4K36A 3D51A 1SZGA 1H7RA 2QCGA 2BY3A 3GXFA 4IMEA 1MFVA 2QJHA 2EAWA 3GAKA 3I68A 3QSRA 2Y88A 2WCGA 4JYFA 3WY3A 3WNMA 5D2TA 3HPSA 3L5MA 1HTIA 1DV7A 5E70A 1FDYA 1GVQA 3R13A 1LWJA 2VFHA 3W23A 4PODA 3WDIA 1U83A 1F2JA 4LUIA 3DFNA 4KWUA 3O06A 3NQVA 1JXKA 5KEZA 2Y7DA 2C19A 4H3DA 1TCMA 4DBEA 1LZOA 3G24A 3KFTA 3L0KA 2DZSA 2YA1A 4WXZA 4U2ZA 4JL2A 1FDJA 3M16A 5HJLA 5D37A 3CC1A 3UZJA 3W22A 4GQQA 4K8HA 3HG4A 5LNSA 4AF0A 5CLWA 3DFPA 4K37A 2D3NA 5F2IA 4U3CA 2E9BA 1I2QA 1K8ZA 4FNUA 3KXQA 4QAWA 3EX4A 3NYZA 2OX1A 2VEPA 4WX2A 2ZZ2A 2A85A 1EWDA 3UG5A 1MVYA 5E9AA 3ZR6A 1K8XA 2F7OA 2NXGA 2V5LA 4LVGA 1UKTA 3Q37A 1PVNA 2CXGA 1HO1A 1YDOA 4ALDA 5K4XA 1G7UA 2A7PA 2YPIA 1WOAA 3KAOA 3TMQA 2YFNA 3OLEA 3TNOA 3OLGA 1CIUA 2EACA 3F1QA 1LYXA 1H62A 4J3VA 3FFSA 2WKJA 1TRDA 2VXNA 4HSNA 3OIXA 1PHQA 1G94A 2A0NA 3FJ6A 4IMDA 3WK0A 4JFTA 4MZ8A 4FMVA 1TQUA 2WNQA 1Z44A 1OX6A 3C2EA 1OYCA 4PH6A 3LTPA 1JDAA 3M47A 1OVDA 1QWNA 4PL2A 3CB8A 2VRQA 3W70A 2P1FA 4J27A 3NG3A 2WCSA 3H55A 3DBPA 3EXRA 1JF6A 3L65A 3VNDA 2GVYA 4EIVA 1BAGA 3S5NA 2WSPA 2TPSA 3GK0A 3GLCA 3PBWA 3VI2A 2OT1A 3NL3A 2XVLA 4FIQA 3ZR5A 4PSRA 5DY2A 4FNQA 1KFEA 5D03A 1CYGA 3LHYA 5CZJA 4N4PA 4RZ6A 3GTNA 3KL3A 1VYSX 5CG7A 1QI5A 1G4TA 1TMHA 2E6DA 1H7OA 3G0UA 4LVFA 4O8RA 3DFOA 4NNBA 4UOZA 4NVTA 3HMJG 3WEMA 2WVVB 4KFOA 3DXIA 4JGDA 1QW8A 3FLUA 2JKPA 2EQDA 3IIVA 1PJ9A 2BLEA 2X1RA 1C29A 3VSTA 5F1VA 1VIWA 3WJYA 3VGEA 4MVAA 1OF8A 1YPIA 1R2TA 3S6DA 1PE1A 1N8FA 1VLIA 3UZ5A 3RK8A 3M5YA 5BOOA 4AMAA 3CM4A 1ZALA 3G8EA 1JGIA 1MO0A 3PAJA 4FX7A 4MY9A 1ZCOA 1VS1A 1OT2A 3PSVA 2OT0A 1EA0A 3DHUA 2WOQA 3M5ZA 3QW3A 2VENA 3MHGA 3G1DA 4HT3A 1UH4A 4C1LA 3IJ8A 4UFMA 1Z42A 3PBVA 1JJKA 3C6CA 1A5AA 4WXYA 1VHCA 3QF0A 4LS1A 5G1YA 1XD0A 4JTUA 3IJ9A 2GUYA 1VB9A 1FWTA 4P2VA 2ALDA 3B06A 3UXAA 3QH2A 4GO8A 2YXGA 3W7DA 2AMGA 1PS9A 3W7NA 4Z1AA 1UD8A 2PWEA 4HHPA 4EOUA 2ZRZA 3M41A 2E0PA 5CZTA 1K7XA 4E2BA 4PCTA 4O16A 3TJLA 3OA3A 1GJUA 3MUXA 2YA2A 2H8XA 4XQ6A 3A47A 1XL9A 2D73A 1JCYA 3GBEA 2BY1A 3S5YA 2V9DA 4C1KA 1G7VA 4CCDA 3B03A 4EF9A 1H5YA 3FJLA 3CT7A 5K9CA 2YX0A 3S1WA 3ABQA 3TW7A 2ZZ7A 1W5QA 3EDJA 3WENA 3KX6A 4LT9A 3HBLA 2ZUVA 4DO4A 2C15A 2RH9A 2A4AA 3WK2A 1KFLA 4J3SA 5G1TA 3N14A 2C8NA 1SU5A 1HL8A 1BSIA 4FNTA 3KLLA 3ABRA 3CEPA 1MW3A 4LU0A 1LOSA 1F74A 3EWYA 5AC8A 1CDGA 4MY1A 1YXCA 2PWHA 1XDMA 4HIBA 3L2MA 3SI9A 3U6WA 1A53A 1DJNA 1G4PA 4N2YA 5U7SA 1IF2A 2OYLA 2YZRA 1TPH1 1WZAA 4OKDA 5I3HA 1R30A 2O7SA 2ATSA 4IXXA 3KL0A 3HOJA 5I3JA 1HXKA 1T0OA 3NM1A 1P5BA 2FQIA 1KM6A 3IRDA 3GB6A 1YDVA 3SW6A 4XBSA 5AYYA 3QFEA 3ECQA 3ZFHA 3GKFA 2QPSA 5F2LA 1PEZA 1HL9A 4Y8FA 2ZZ3A 1KV5A 1QI4A 4WF7A 1W31A 3BMVA 1MEIA 4ZQRA 3W88A 4U2YA 2YSWA 2TSYA 3NQCA 1UD5A 1SO6A 2FDSA 3AO0A 3QW4B 4ONVA 5AC6A 2Y6ZA 1YADA 2BSLA 4GBUA 5I3IA 2A7RA 3P67A 3W7HA 3NL6A 1OF6A 1U2YA 2CZDA 1BVNP 1JFHA 1KXVA 5E0FA 3RILA 4UFLA 3W7IA 5AHMA 4OGZA 1JD9A 4J3TA 2V8ZA 3QPZA 4I7UA 5AHFA 4JNMA 4Y90A 3P8JA 4BI6A 1OSEA 1L6YA 2HMCA 3CZKA 1C9DA 1JI1A 1MEHA 5KZDA 1OB0A 5HR6A 8CGTA 2CU0A 2Y63A 2VFEA 3DGRA 4FO4A 4MPQA 1Y0EA 1PV8A 1VQTA 1TPC1 4LW7A 3L4WA 5E1QA 1AL8A 2BHYA 1HL2A 3C2VA 3VX1A 1EO7A 3M6YA 3BMWA 1RP8A 1KBKA 3OG3A 1FWNA 2QCCA 3L4XA 4XTDA 4M19A 1CI1A 2YA0A 2UV8G 3W2JA 3THQA 1W5NA 5AHEA 3TIMA 4A29A 4YMZA 3VCRA 1SO5A 1EIXA 5K4ZA 3B04A 2PCQA 3TROA 3W1AA 1DVJA 3NL5A 3UWVA 2PURA 5CPNA 1HX0A 3LPOA 5LSMA 1HFBA 3LDVA 1KBBA 3BC9A 1KFJA 4UFKA 1XUZA 1KFKA 2QMJA 4UOQA 2XN2A 7TAAA 1F5ZA 4FXRA 1WP6A 3BVUA 1ZAJA 4JL1A 2JK2A 1K7FA 2E68A 3GVGA 3BSGA 1XDLA 5CGMA 3VSVA 1JQVA 2ABAA 3L0NA 3R8RA 3V1PA 3BVJA 2J9XA 2OSYA 4UQDA 2VFGA 4LUJA 1B4EA 4JTFA 1Z32X 3UPBA 2EEXA 4UMCA 3LLFA 1WX0A 2Y89A 3W72A 2DZWA 4GUFA 2CZFA 1LBLA 1OFQA 4KFPA 3W7KA 2XVKA 3IK2A 5D2WA 1VJIA 3MHFA 4UTKA 1TTIA 3W75A 2WVTA 4FLQA 3I7SA 2ZUSA 1G5AA 4M6QA 4OT7A 4PCFA 3RIKA 2I9EA 5BRBA 3HG5A 3W7EA 3IVSA 2Y70A 3U2OA 2VEKA 4FXSA 4J9JA 2F2HA 5I0DA 4GE8A 5EKYA 4NJHA 4MAZA 3BGGA 5CGQA 5T26A 1GVOA 5A2CA 1ML1A 4YWIA 1XBZA 3NVTA 3FYOA 1I2RA 3ELFA 3ZR4A 2AAAA 3NQ2A 3PSWA 3DKJA 1SO4A 5I5RA 3SGUA 2Q8ZA 3ZT7A 5F4XA 3CPRA 4O11A 2PWDA 2CZEA 2J24A 2YYUA 5A2AA 1RV8A 3BLFA 5AHNA 3A6OA 3L4VA 4PL1A 3EJQA 3MMTA 5HWNA 4LOCA 3NGJA 3UWZA 6TIMA 4O1CA 1FWRA 4K39A 3WK3A 3DX0A 5AB3A 4PSPA 1GCYA 1Q6RA 1YTKA 4I7VA 5IM51 3CU2A 3W1LA 2QDGA 3K8KA 5KZEA 3LBCA 4O28A 2CWNA 3NL2A 2BXVA 2CLKA 4TMBA 3VKJA 3EWXA 2CLEA 4FLOA 3W6YA 5HWMA 4TX9A 2D0FA 1D9EA 1P0NA 1JCJA 4R53A 4J3WA 4CN6A 2ZIDA 1IGSA 3EXSA 2CZ5A 2WSRA 1U33A 4ICNA 3TAOA 3LI0A 2YDAA 4BWLC 1EWEA 9CGTA 1SZEA 3K8MA 1ZJBA 2D2OA 1X7FA 1TO3A 1KB3A 1X1OA 1TSIA 3WFAA 1TIMA 1F73A 2R94A 5DCDA 2DH3A 3WNLA 1H7PA 3ABOA 2J9YA 3P80A 1W9XA 2WV8A 1ZAHA 3BG5A 1VJSA 4IGHA 2EAEA 4NNCA 4QM1A 3M7WA 1ALDA 3ZWTA 2H3DA 3CHVA 4AEFA 3KRZA 1MXGA 2ZZ6A 4UUIA 1TQSA 2XN0A 1DQXA 1WOBA 4K7YA 5K3VA 1DTUA 1XV8A 3DC0A 1VHNA 1YDNA 2FPTA 4HNVA 1RVGA 4AYGA 1G4SA 2C16A 3NQEA 5TBOA 1G9HA 3O15A 3WY1A 3FKRA 3JS3A 1S5TA 3BW3A 3YPIA 2OSXA 4LQ1A 3VNYA 3BUQA 4GI9A 1NF7A 3HQ1A 3NQMA 3G3DA 1KXHA 7TIMA 4GO9A 2J6XA 3W86A 1KGXA 1EPXA 1JVNA 4N02A 2C14A 4X2RA 4OJYA 4KWWA 4MZ1A 4XBKA 4CN4A 4K7VA 4X9SA 2X1SA 3W1XA 4UTWC 5G4WA 2WKGA 3LHVA 3FAWA 4FIRA 1WDWA 5J5DA 3NQ8A 4O0KA 4WLCA 1UCWA 1PIFA 1WYIA 1VFUA 2ISSA 1XCWA 2X2HA 2ZTJA 5EMYA 4IQLA 3TQKA 1FCBA 1FX6A 3VE9A 2PRLA 3VM7A 5LGXA 2A21A 3M0ZA 1MW1A 3E0IA 2LLEA 2DZPA 3CZNA 2RDTA 5L6UA 1KGUA 4ADTA 3PUEA 4N6FA 3VM5A 5FEXA 1TQTA 3CLMA 1DJQA 4L4LA 4LNYA 3NO5A 4NJKA 2GQ9A 3IVTA 4CLMA 3VX0A 4FHAA 5CPMA 5HPOA 5LNRA 4GINA 4JX4A 2NUXA 4DO6A 5C5YA 5BNKA 3M5XA 4H7VA 4KKXA 5G2IA 3IGUA 4PEEA 4BA0A 1NVMA 5K7JA 1YXDA 1KXTA 4DXVA 4U33A 2AGKA 1VYRA 4AEOA 4KFNA 1CGWA 1THFD 4A2SA 4DF0A 5C55A 3BLEA 2Y62A 1EH9A 4M6VA 4BWLA 1J0IA 2NUYA 2A7NA 4Z0JA 5DO8A 1CGYA 1TTQA 1SR9A 1JCXA 4M6PA 1LBMA 3G8RA 1PPIA 3W2NA 5SWUA 2JGQA 3LGEA 4MIMA 1BVZA 4H2CA 4O54A 2X2JA 4CN1A 2DORA 1H1ZA 1LOQA 1KM2A 1WZLA 3W7RA 1FXPA 2EPHA 4PCSA 3NZ1A 3CWOX 3LCWA 4UCGA 1JCNA 3MYPA 2G95A 3K1DA 1RD5A 2VKZG 1AVAA 4JFVA 1SQ7A 2V3EA 2VC6A 2Y7FA 1XSKA 3DDFA 1OYBA 3W87A 3L4ZA 1ME9A 3FW6A 5E0KA 2VUYA 3PWAA 1GVSA 1YTEA 1XC4A 3BUIA 4BK9A 4DF2A 3TK7A 5K2ZA 4WQ6A 2ZX7A 3L4UA 5CGTA 1W3IA 3NQ6A 3FKKA 3OVQA 3LBMA 3TSDA 5AYZA 1EB3A 2WVUA 4UIOA 2GQAA 5FF3A 2EHHA 3M5VA 3LX9A 4GWEA 1TJPA 4UTUA 2ZYFA 3C2OA 1LWHA 4WD0A 3RNDA 5KTLA 4UTWA 2DIJA 2PWGA 3DFQA 3TSBA 3HGSA 1QPKA 3EX3A 3JR2A 3T4CA 1UH2A 4UZSA 4LV4A 3C2FA 2X2IA 1GTHA 5DY3A 3D4ZA 3LCHA 2WNZA 2RKXA 1DKWA 2NXHA 1H63A 1TPFA 1LDCA 5CSRA 1IZJA 1MSSA 3F03K 3BAJA 5HQEA 3TC7A 3NQDA 5E6ZA 1L6WA 5D2VA 1XBYA 2ZA3A 4Y9AA 2JBMA 1TRIA 2JKAA 1BPLB 4FB7A 1OFBA 5FEZA 1JL8A 1D3HA 4JTSA 4AMWA 5BRQA 3UD6A 1B9BA 3UCQA 2TRSA 3T78A 4BR1A 5F7UA 4FNPA 1WBHA 1S3HA 1HG3A 1W5OA 3BG3A 4HOXA 4XZ9A 4RKAA 1MW2A 1C8VA 3ZO9A 3DHFA 3TAKA 4GIAA 3C4UA 1M7PA 2Y61A 4JTJA 2DIEA 1AQHA 2DZUA 4O1BA 1GG0A 3EDDA 5DXYA 1JCMP 2J25A 3LXAA 4GNJA 1R75A 3BVTA 3VMOA 2NV2A 1QO5A 2Q3OA 2QEZA 2FLIA 1EUAA 2AQWA 3PUOA 4JTHA 1AL7A 2WNNA 3S1UA 3SZ8A 2PRMA 3W2UA 3W83A 5BMWA 4JTKA 2EKCA 2YR1A 2A5HA 1LM1A 4IMFA 1F7BA 2CHNA 2F7PA 4DPPA 1DEDA 3MBDA 1D7FA 4RJEA 3VNZA 4YCPA 1O60A 4PTNA 5DBUA 3GDKA 2DZVA 2ZRYA 4AWSA 1EP2A 3W71A 4MFDA 3A23A 4Z1BA 1H3GA 3L67A 4GUIA 3TJXA 3IGXA 3L2IA 4JDYA 1R46A 3O8AA 4O0ZA 2PE4A 4UNIA 3BVVA 3M43A 3UG4A 5D09A 1XCXA 1GJPA 3S5ZA 3RLVA 5EMUA 3GBDA 3BAIA 1JG9A 1YLVA 4TVUA 2GJNA 1QDSA 5AHIA 3NM3A 4BFAA 1KWKA 2NX9A 4KMQA 4A3UA 3CV5A 2FGZA 3ABSA 4ATWA 2Z6JA 1CPUA 1M6JA 1FCUA 4MYAA 5A2BA 3GDTA 1XSIA 3NOEA 3I7QA 2EABA 4TO8A 4UQBA 2FH8A 2ZZ5A 1XBVA 3LHUA 3Q58A 6ALDA 4JCMA 4UQCA 2X16A 1KA9F 2WVVA 1D3CA 4O14A 3S5OA 1X1ZA 3MP5A 3EJTA 2F18A 4CCCA 3G1SA 4XUGA 5A5WA 3P5ZA 3W1TA 1Q6QA 3ZWSA 2WKLA 1O7DC 5C54A 1VLWA 5D05A 3EJSA 3OHIA 1EUNA 1F05A 3QMRA 3W7PA 3VMPA 3LV6A 5C6MA 3L66A 1VCFA 1UKQA 1UJPA 2X1TA 1O4UA 3G1YA 4YL2A 3FAXA 2WANA 1H1YA 2ZA2A 3HB9A 4BI7A 1LORA 2YKKA 1G67A 1TMQA 1XKYA 2Y7GA 3CWNA 1DQWA 4BI5A 3BAKA 3R89A 1KTBA 3HGOA 4UFHA 2FHCA 3WN6A 4LV9A 3TXVA 1U5JA 3FYPA 3LCGA 3GAYA 4GJ1A 1A5SA 4JDBA 3TV8A 4ADUA 3MJYA 4UC5A 2F7FA 1KV8A 1GPWA 2ISWA 4JN6A 4ORMA 3EDKA 1JIBA 1WAUA 2OMAA 1ADOA 2XVGA 2Z6IA 1X8FA 4FLRA 2CPUA 4NZFA 3KRSA 1BWKA 3DHPA 1XUUA 3OLDA 1J4EA 1GYLA 2ZFAA 1LCOA 4WJEA 1BKSA 3BAYA 4LRTA 1Z41A 4E2OA 1KXQA 1ME8A 1WE5A 3WELA 2ZZ1A 1OFDA 2EF9A 4HA1A 4UNKA 3EX6A 3IJ7A 4FNSA 1HO4A 2HS8A 1BTMA 4Z1CA 1L2UA 3RF9A 2FH6A 3MYOA 3L2LA 3NA8A 1VAHA 3SJ3A 5CZ0A 5K9DA 1IXPA 4CQ8A 4PC8A 3NZRA 4ZL1A 2A2IA 3BGJA 3VGBA 3B0VC 4FNRA 4OV4A 1JDCA 3UNDA 2Y2WA 5CXPA 4FX8A 1PIGA 4RK8A 5CPOA 2X2GA 2Y24A 5CKSA 2FPYA 4GQRA 1G1YA 3T40A 4QISA 5DCBA 2GJRA 4RCXA 3P8IA 3QQ0A 5D04C 3KEHA 1WV2A 3EB2A 4WY0B 1BLIA 4UQEA 1OGSA 3VSUA 2E5CA 2H6RA 2WSYA 4NQ1A 3S8HA 3C8FA 4MYXA 5BMXA 5FESA 1J0JA 5HUOA 5I3KA 1Q3NA 3TQ0A 4NX0A 3LV5A 1B57A 4CNNA 1KW1A 2PRHA 4JY8A 2GVJA 4JIQA 4ZQCA 3UXDA 1QCWA 3OLIA 5IBXC 4NJJA 1E51A 1R34A 2QPUA 1OYAA 2WNWA 4O1AA 3DX1A 5TQLA 5L9FA 4EWND 3EDEA 4TMCA 4JTIA 1O5KA 5KITA 4BZYA 4H8UA 1TPDA 1UA3A 3EKLA 3E9AA 1PL9A 2B4GA 3EX1A 4O15A 5HXMA 3DX2A 3TA6A 2F84A 2E4TA 4CVWA 2YYTA 2TMDA 3W1MA 1IXNA 4UXDA 1GVRA 1UOKA 3W3OA 4IWWA 3GDMA 3BVWA 3GKAA 1OT1A 2QCMA 4KWVA 3WNNA 3IGSA 1CXFA 3R5EA 1VYPX 2GVGA 4J7RA 3B8DA 3PG9A 1AW1A 1H60A 1CXKA 1TV7A 1A5BA 1JI2A 2RDUA 2ISVA 2IQTA 1LP6A 4U31A 2B7NA 2FFCA 3NQAA 5I23A 1ICPA 3CTLA 1AMKA 2C6QA 1QI3A 3Q2DA 3G18A 3MHUA 4W9TA 1XH2A 3TE9A 1QAPA 4M7SA 3W2KA 2P0OA 1LROA 1QHOA 1V7YA 4PA8A 2EGZA 2CW6A 1K8YA 1PS3A 4MFEA 2FE0A 3D4YA 4MY8A 2BTMA 2HS6A 1BG9A 3GXNA 1DORA 3M44A 1I2NA 2XWDA 2NWSA 3HGJA 1DHKA 3O07A 3KLKA 4GXMA 3UWQA 8TIMA 1TPB1 3G1HA 4LRSA 1IV8A 2G5WA 4FEZA 5G2HA 2G3MA 1T8XA 3TR2A 2Y4SA 5D33A 1VFMA 3W7QA 4A2RA 1TREA 4AWTA 4CQAA 4YLWA 3QPYA 1HNYA 2ZA1A 2BHUA 2QMKA 1J0HA 4ZQPA 3GXTA 1SW3A 2ATMA 3TUUA 1GVIA 2C3ZA 2V82A 3ZOAA 2QR6A 4NT0A 3DFSA 4ZZ9A 3TX9A 3RFAA 1HUVA 3A5VA 2FIQA 1JUKA 1SUXA 5FEWA 1KM3A 4X22A 4LXFA 4LC6A 5HWJA 2ZXAA 5G2WA 1JAEA 1CXEA 5IBXA 3L4TA 3TH6A 3LRLA 5CZSA 4IX0A 2ZUUA 1VCVA 3K30A 1NM9A 4M7TA 3L5AA 3L68A 3MW7A 3E02A 1LRQA 1CGUA 2C1HA 3PC0A 1MXSA 1JRBA 3KHJA 3NPWA 3P7YA 1YTDA 5HR7A 3SFKA 2H3BA 5KINA 3UQNA 1M7XA 4HSOA 1KCKA 1OX5A 1SZFA 3LCLA 5EL1A 4R34A 1XGZA 4GI8A 1TTJA 1KLZA 2RHGA 1VRDA 2W6RA 1JRCA 4AIEA 4JX6A 3W2LA 1XI3A 1OABA 3O6DA 2ALWA 2YOCA 3HJEA 2R8WA 1Y7VA 4YXGA 3O16A 3UYCA 4AW7A 5FF7A 4X0NA 3EXTA 3NPVA 3MI2A 1XCFA 2WSQA 4H8HA 3EJPA 1EP1A 4N9EA 4UR8A 4IMCA 3KRUA 2OJPA 2V3DA 4CCEA 3HG2A 2XFWA 4AB4A 3PS7A
chains in the Genus database with same CATH superfamily
4UNVA 4AJYV 1EEPA 4QKXB 2BOCB 4BFEA 1SY6H 2F53E 4HD5A 3Q5YA 3QM3A 2IKHA 3MV8A 4UOJA 1IGTA 3WU1A 3MPGA 3MZNA 4U5KA 1Z9MA 1HKIA 2YGNA 4FA3A 7A3HA 3LM7A 4GS7B 1UXWA 2GIXA 4FQQB 1GW9A 4X6CB 1ZAGA 1ZS2A 5E5MA 3PVFA 4CNOA 3L9RB 2VCOA 3GRWH 3KXFA 3B2DC 4GT7A 3V0TA 1XB6A 3D0AA 2ZICA 3HG3A 4GFIA 4Q3MA 2WZTA 5U4NA 3ANVA 5CM1A 4ZFCA 1I1YB 3GMRB 3EH4B 3KNBA 1EANA 4XBPA 5HHPB 1PAMA 5AVVB 1ZFJA 2DF3A 3CZGA 4QCFA 4E38A 1ZGDA 4HHWA 4HOZA 1PKMA 2H4EA 3RNQB 2YZ1A 5MEOB 4DJEC 5IFPA 2ZDRA 2C9VA 1WFIA 2E67A 2E1DA 3BZ5A 2ERJB 5D1QE 1JP5A 2D3JA 2NCEA 5I1CH 5C0CE 2F9BT 3BUYA 3H2CA 4PJBE 2B7QA 2BWIA 3DTXA 3K2UH 5MENE 1XGYL 4BQ2A 5TH2A 3RHWK 3WD5L 4DVOA 2GSHA 5IR1A 4HD9A 3C5SA 4EIGB 4FXJA 3G77A 1H9DA 4PW3A 4NO0D 4IGMA 4JPSA 3TESA 2J7FA 1FWDC 1DIOA 5I6MA 2F1BA 5DR5L 5DA4A 3FU5A 4UTBA 4XKYB 4E9SA 3BIKB 1ICSA 5E6ID 4IG2B 1OAQH 2JQAA 1T5WB 4ACZB 4K8RL 3HR5B 1NOWA 4XWOC 1WFNA 1CI5A 3ESPA 3LQZB 4AMXA 1KSRA 1BYCA 1N0XL 4KMTH 1XSJA 1NAMH 2AJSL 3MC0A 1FPTL 4UZUA 2DL9A 1T1WB 5HYSA 3JZ7A 2Z4QA 1A5FL 2Z7GA 1GKOA 4OBSA 1MVUA 3M17B 3RX5A 4HS8H 2YAFA 4PJ7F 4D2JA 4CKQA 3H0TB 3PULA 3RVWD 4L4JA 3TN6A 4MB4A 3IK4A 5EBAA 3KOZA 1M57B 2FIKA 1EAOA 3PQYB 3BVXA 4LLVB 5E0CA 3V5OA 4JGNA 2DLFL 4KUCF 1FY6A 3AXIA 3N2CA 1BQHA 3NK3A 3PF2A 1QW9A 3TPUA 4RDQG 2WAGA 3TWYA 4JPGA 3ZE1E 4NC1E 4K9EC 3DOPA 4CU7A 3FIGA 5CBAA 5EBWA 1O75A 4YSOA 3W9DB 4YSAA 4UMAA 5CP7B 4RZCB 2VDRL 4J4PD 1BQGA 2FGWH 3B4YA 4C6JA 2J4WL 4RE3A 4Q9RL 4JRYD 2ZX8A 4YO0A 4HZAA 3REVB 1P2CB 1AZNA 2WUBL 3D39E 3CCHB 5EBGA 5LN4A 3N50A 4RA0C 2E76C 1IBZA 4NPJA 3QARA 2J6VA 4H20L 1SO3A 1AYOA 4JGMA 5CEZL 1IEHA 3NXFA 3ASOB 4CQDA 3KEDA 3Q2NA 4V2BA 3SY8A 3WBYA 4AG4H 5IOPB 2ZKMX 2YBGA 1XGDA 4NJ9L 2WPGA 3OWRA 3MA7A 1TE1A 5DK3A 1JYNA 3H7BA 3BIBX 5C2BH 5HDRA 4DHLA 1KGJA 2PCPB 1I8IA 4HZ6A 3DYMA 2CO2A 3NFPA 2ICSA 2GGHA 4QNPE 2PDQA 4QHMB 4GVHA 3M46A 4Z08A 3GZ3A 1SJCA 1QYGH 4LAQH 3VI3A 3FTGA 3JQOB 3DX8A 4XI5D 2EE2A 1AD0B 4PI2A 5KMYA 1Z0NA 2PWFA 4JXCA 3TSMA 4L9LA 2PP7A 1NAMB 1OW0A 4GRMB 3ME0B 1OTTC 4GUOA 1S2TA 3LPGA 5E8OB 3AQDA 3AHXA 1FH8A 1EEXA 5KZMA 1YEEH 4Y8AA 5FF2A 2BZDA 4GIOA 2IPKA 4XBEH 4OGQC 1JHKL 3GHSA 1NOFA 5D55A 1P4CA 2YSSB 2IXQB 4OQVA 5E93A 4F8PA 1AQMA 4FSAA 5ESQA 1JULA 3ECVA 3N06B 3TO4A 2UYLB 3NEOA 4MNGB 3V5HB 5D93B 4OUOA 3D1MC 3QB7C 4F2ME 1KM0A 3EGDB 4CILA 4F5CE 1EJSC 2VFDA 6A3HA 4X99A 4PJGA 4W9ZA 3ZDZB 1IMHC 1ECZA 1SRDA 2OZ3A 5DJCB 3GXMA 1HEZB 1H0IA 2JSFA 4YCOA 3O8XA 2PTVA 1T22A 1XSOA 5F7NC 1P84K 5HPMA 8XIAA 4OW6A 4JO2H 5KS9F 4FTVE 1U8QA 4RFEB 5BW7C 3DFTA 2YRPA 2AQ1A 1I2OA 4IBLT 4JBSA 3ZL2A 3VG0H 4RNRB 3IMSA 3QO0B 3BLPX 2CO3A 3GNML 5DRXB 4LTSA 2AQOA 2GSIA 3T1FB 2QF8A 4HK5A 5T1KA 3LCXA 3SE3C 4C56B 1NANH 2QDHA 3KPSB 3T3PF 4LWWA 5C9RA 2F58H 1QU4A 5I6OA 4HUXB 1QG3A 3N9RA 4O52A 3WQGA 2NY2D 5A6AA 3Q1EA 4MWAC 2KERA 3BJFA 3UTSB 3ATZA 1G69A 2X6BA 2BX7A 4N24A 4F0SA 1TR1A 1XIEA 2PD9A 4R5TA 3F5WA 2Q5BA 5B7YA 3W0WD 4XP5H 5KYYA 4ZK8A 3I02A 3OAUH 1A2YB 2NXZC 3RVUD 1OTUC 4EXPX 2O6DA 3HZMB 4AX6A 5IHZA 4FQ2L 3WIHA 3MCYA 1IE4A 4BWTA 3AUWB 4QDPA 3N44B 3OKMB 1DLFL 1N2VA 1J0ZA 1HH6A 4JY4B 4DEFA 1ZEAL 2C9PA 1TQBC 1JUFB 5LWYL 2PU0A 4NZUH 2Z00A 4ZFZB 2NW3B 3NH7L 1QZ1A 2DM4A 2KUTA 5AFAA 3AYRA 3MI6A 4KIEA 1R3JB 4EIZC 3ZJKA 4NRXB 4PJFA 3S4SG 2ZJSH 2IADA 3GXFA 3ZVIA 4OM1L 2ITDB 1SBBA 3AWFA 4EN3B 4FQXD 1FDYA 4HS6B 4LANA 3U7YL 2DKMA 3W23A 3WDIA 5G55A 1UWGH 5DO2D 2AXJA 3CV6A 5KEZA 4W4OA 4BFGA 1EXPA 2DZSA 3HUJF 1ZD6A 2CZVA 5DF0A 3AU6A 2X09A 3IBOA 3URNA 3QWOB 4U3CA 1BMZA 2E9BA 4NKMB 4B60A 2O61B 5F7YC 4W9KC 2YUVA 1NCCL 4I3RH 3ZR6A 1RV6X 1AS6A 1UKTA 1YYML 4PJ6A 5E95B 1YRKA 1AZBA 4QXGL 4QOKE 3QSKB 1SGJA 2V69A 4JIEA 1BM3L 4FEIA 3WK0A 5GSRB 1S7QB 4P3CL 3VKDA 3B1UA 4PL2A 4X4YA 3VFNB 4J27A 2IH3A 2ZSVA 2L0DA 1GGCL 3VXPA 3W1ZA 4DJMA 4ZTYA 2AVFA 2XVLA 2CJTA 5DY2A 2XLLA 4RZ6A 3HMXL 1TMHA 4X6DB 2KI6A 1A6ZB 3PZOA 5LJYH 3TZVB 2A9BA 3UYPA 3T4WA 4D9RE 3QWQB 5C2UB 4LCCC 4PP2B 1P9MC 1KELL 3VSTA 1QACA 3TN0B 1OF8A 3S6DA 1I3RB 1ZGLA 3RK8A 1KLGA 4RAHA 3EPOA 4HK3J 2G3XA 5KYUA 2OOGA 1OT2A 4Z3HA 2OT0A 1M3IA 5A3ID 3QXDB 2P49B 2FRGP 4AXWB 1ZL1A 1E9PB 1MREH 4OLYL 3QH2A 4PJDF 5HHQA 1E0UA 4Z1AA 4HQQH 3VD2A 2YAQA 2FLBT 3GI8H 2F15A 3TJLA 4H5SA 1FBIL 3D05A 2D31A 4FG6C 5I1GL 1K1DA 4OSUH 1F58H 1Q8AA 3COOA 4LSBA 4L29B 1GAFL 1HDMA 2CCWA 2D69A 5C0BD 4OZOA 1OP5H 2ZZ7A 1W5QA 4H83A 4QGYA 3AMGA 3ZTNL 3SQMA 5G1TA 2C8NA 4ZI8A 3L54A 3QNXB 3GM8A 2VZOA 4TOYH 4MMXC 1SYSB 3J2PA 5ABAA 1BZ8A 1BLNB 1JGUL 2C4FT 1RSYA 4AKQA 3RR4A 1JF1A 1JV2A 3D85D 4KHTH 1ZLEA 2EXOA 3GPSA 2HVBA 1RUKL 2IO5A 3LN3A 3RIFF 4RRPM 4XNYH 4IHOA 1MEIA 3FN0H 2IWEA 4YSDA 1TT6A 2HN7A 2Z6FA 1OSYA 2B15A 2VAAB 4OD1H 4PRAA 3B5GA 1MCEA 4BI6A 4LOUC 4GMSH 4Z8FH 3F4CA 1MEHA 3SEPA 4F2BA 1EAPB 5XIMA 3JUYA 1RJQA 3C2VA 4G9DA 4UM8A 3V4PA 3AB0C 4Y7OC 1CI1A 5JXEA 1P7TB 4UMSA 1HEJC 3TROA 2HTLD 4H9XA 3II2A 3X1NA 1AQ8A 1GRWA 2BRQA 1D2PA 3AYSA 1U8HA 4GKNB 2CNYA 1FAIH 2ADJA 4B9PA 5BPPA 3KM1A 4JTFA 4NN7B 4U6YA 3QZBA 4DK5A 1HILB 1ZT7B 3DSNB 4W87A 3S3BB 4GRLA 3IVSA 2WJ5A 1ID5I 4J9JA 2PTUA 3EPMA 3P9LB 2IMRA 2PW2A 5CGQA 2H32H 1JDEA 4X6CE 5BOJA 3L1OL 3PSWA 5I5RA 5IB4A 3S5LB 3H26A 4O11A 4LBUA 4L4OA 5HWNA 3EBVA 4B3LA 3UWZA 4PGDA 3DX0A 35C8H 5HDQH 3CU2A 4Y7MA 4TMBA 1MI3A 3MBEB 2W9DH 3RLGA 4WSHA 1YNTA 1E4HA 2WSRA 1OGTB 3HV9A 4M9OA 3QIBA 5T5NF 5D7EA 5F88B 2KZ1B 1UUQA 2F5AH 4P99A 1QA9A 1VHNA 5ETUA 1RK5A 1NBCA 3EEZA 5E2UL 4N02A 3ILQC 2Z1WA 2ZYIA 4KWWA 2XWBA 3AS0A 1LL4A 3KUMA 4FIRA 3OPUA 1T20B 4WLCA 4JFFB 3VFUB 4BH8B 5E1HB 4H01A 3NVQA 1BHGA 3MANA 3WS3A 4L1BA 4HW6A 4E41D 1A21A 1XL4A 1PVHA 3BE7A 4DAGL 4ORGB 4L4LA 3RHGA 2V3GA 5CPMA 5HPOA 4JX4A 3O6LL 4IU2A 5LXXA 4PEEA 5KOMC 1A64A 2QHLA 1HHHB 5JHBA 4HFUL 5J06A 1V54B 4DF0A 1S2CA 1WDQA 4Q2ZB 1EH9A 2Y62A 1TENA 4AT6A 1TTQA 1DQJA 1ZMYA 3C6LA 5AAMA 3L3OC 4M7KL 3FVMA 5DQDL 2XYCA 3B9OA 5E8EA 1CD8A 5C0IA 3CWOX 1RD5A 3L5WA 4HHLA 5AYQA 3DDFA 3W87A 1GVSA 3R19A 4PHXA 2R82A 2IC2A 1JNDA 2YC1B 3L4UA 3MUAA 2QDWA 3PHOA 2GQAA 3M5VA 5I82A 5EH1A 4HIXL 2W65A 2XI9A 3NOIA 5EWIH 3IJSB 2YD8A 4ZODA 3S37H 4ZUTA 3T4CA 5E7FA 4QROA 4I48A 4ANKA 5MEPB 5I79A 2WXIA 1BCIA 1G7QA 2QV2A 3PQYE 3SKMB 1T7ZA 2ZKWA 2V7HB 2IH1A 1QFPA 3K71B 1BXUA 2X4SA 3OMAB 1SVCP 2DZUA 4JRXB 3AWOA 1AACA 3MV9A 1N5AB 5EUKA 2OSLA 1BWVA 2EDRA 1AL7A 3S1UA 1YNQA 5EB8A 2K3HA 1CLYL 4A55A 1NKOA 3ARED 1D7FA 2CK2A 1HIMH 2XFXB 2X2UA 1OAZH 2VUOA 3W71A 4MFDA 4WWKC 4FDWA 1ES0A 4GUIA 3UC0H 4ELKA 1FE8L 4K5NA 3KLHD 4GVGA 1M41A 1Q1JH 3QZLA 3M43A 4HMNA 4FHJA 1FZKA 4ZTXA 5C7ZA 3CV5A 2NQ3A 1YNPA 2AQVA 5KZCD 3N1PC 3Q58A 4JVUA 2QS8A 4F9JA 2WXRA 3ULSB 1VD6A 5JIPA 4DUVA 4TNEA 4XUGA 1HXMA 3QPXL 4MJ5B 1PY0A 2PF8A 5D05A 5E9DD 1TFPA 3ZQXA 3ITVA 4BUQA 2YBVA 2UZPA 3EYQC 1HCVA 4CDHA 3SFWA 1NMCB 4FOMA 5C9UA 1UXSB 3C8KB 3MJYA 4UC5A 3NIFB 4X8JB 3FU7B 4KBXA 1KO0A 4K5LA 1JIBA 4CD4A 1AC6A 1BFOA 1C12B 2Z6IA 3SSGA 1VIZA 1VF8A 4FMKA 3AY4A 5I1HL 2HFEB 5FAJA 2A9NH 1BQCA 3WGVB 3MTXA 1MAMH 3R0MA 4BM7A 3HMWL 1TJGH 2WLIA 1V5JA 1MHHA 1T83C 5HMDA 4YBQD 1JN6A 5EO1A 2OV0A 5LG1A 2C7UB 4GLRH 3TVMA 4J3OC 1GIGL 4BK4A 4O2CB 5I3KA 4Y4HA 1V8HA 4L8SC 4N25A 2N56A 1AANA 1GGIL 3MRJA 3WEBA 1E51A 3UDWC 1MFDL 2DQUL 5FPIA 1M68A 3KCLA 1EHXA 1LK3L 1UA3A 3VWJA 1Q38A 2AQRA 2B4GA 1MLBA 3DG3A 4ONHA 1FNGB 3ZKND 3X2QB 3P40A 2TMDA 3QBTB 4ANUA 2XY1A 3POHA 4DY1A 3BVWA 3GKAA 4CA4A 3MRRA 4GY0A 4M43L 5AD0A 1WXZA 4MNGE 3HFTA 2C34A 3BKML 4PB3A 5D7IB 2A9DA 3HLAA 2EPMX 2O55A 1S9XA 3X12B 3ZDZE 3W2KA 5C0AD 4I9MA 4KK5D 4GOAA 3SUVA 1SY6L 3KBVA 3QG6B 1WBYB 3GXNA 1DORA 5TNVA 1O9VA 3VXSA 4PR5A 4ZUSA 2NQLA 5ICZA 8TIMA 4PRDB 2YD2A 1DJIA 2XWZA 1JZEA 4MKMA 5AW2B 5I8EA 1R3LB 5CAHA 3C60A 1KCBA 4C56E 3MJGX 2ADFH 3GRWL 4Y5VC 3KPSE 4DYKA 4PLOB 1G43A 4LCYB 3VXNA 4MJHA 2B59A 3PC0A 1GYCA 4C4KT 1ZLSH 1YTDA 5REQA 3U9PH 3OXRA 2HJKA 3AU1B 4R34A 4U1NA 4XOEA 3UTSE 2R8WA 4PLJC 4AW7A 2Z2AA 2BC4A 4P4KD 2CLZA 1C90A 1A7RL 3CAQA 3PHQB 3SDDB 3UWUA 4PB0L 4FXTA 3RX4A 2XPYA 1E40A 1P53A 4IPLA 3O6FD 1C9SA 2RFGA 4PS4H 1JVKA 2OXHB 3IVUA 1LNUB 3KCPA 5EEWA 1Q65A 5GJMA 1E3ZA 5I1CL 1FIGL 1US3A 5I5JA 2Y8VA 4O5LH 4J8RB 4LNRB 5F2MA 5ECGA 3K2UL 2EDTA 1F11B 2OS7A 4PCPA 2WWMC 3ARFB 2NSOA 2QIIA 1HOCB 2CLVB 1EDTA 3C0LA 1T80A 2WHLA 3NPXA 4CKVX 1Z6KA 3UJEA 2JELH 3BP6B 5KSVA 4MKVA 3RZCC 1P0DA 1GKQA 1HIZA 3D0VA 3IEAA 1GVYA 2BCMA 3MLZH 4OLVH 4OCSH 1S4IA 3HFFA 5CZXC 1EK3A 1UD3A 3TVAA 1ZY9A 1OAQL 3WD4A 4BRJA 3U0PB 2XIOA 1OB1A 1UP0A 3EO1A 4MA7L 2EYRB 2XXFA 4KEMA 5K1VA 4I0CC 4NRYB 5F9WB 3JBG7 2C9XA 3Q43A 1F41A 1AS8A 2APSA 4H25A 1NAML 3MA8A 3SGKC 4PRPB 2UXGA 3QDJE 3QUYC 4HS8L 4TNVK 5DHYB 4LHQB 4UCFA 4X5QA 1I7TB 3N41F 3OJMB 3M45A 4DIXA 2ARJA 5FC9A 1OTSC 3P5YA 4PRBB 5TDOA 4JNYA 3E0GA 4NT6B 2H3KA 4LU5L 1Q7ZA 1SBSL 1PDZA 4MMZA 3FVDA 4X6DE 3TV3H 2FX7L 4OLXL 1AG1O 1I8MB 3LLDA 1X7TA 1PWLA 1ZA6B 2F8XC 1SJDA 2H2SD 4WQOA 3G1FA 4G72B 1DVFB 5SX4H 4D2NA 4BQ9A 3WKMH 4GH1A 1UWQA 3HPXA 4PUJA 1ZDQA 4RGND 1OF0A 1IU1A 3GJEB 4NQDD 1G0XA 2WAQA 4TLKA 4IRJB 3H9SB 2IPFA 2IQAB 3GNNA 5HJGA 1RPXA 3MRLB 1GNXA 5D7SL 3JZUA 2HSIA 2HROA 1IEAB 1LBFA 2XFRA 3WBWA 1J9TA 4JQXC 4ZMPA 3S3JA 3ZIYA 1NCWH 1N7MH 3TW9A 4C1NA 4HC1A 4HIEA 4E8GA 4AG4L 3K2MC 4PMUA 1DQVA 2O6PA 3N4EA 3TYBA 1Z66A 3KPLB 3F84A 3NFNA 4IQJA 1RA0A 2NSXA 5C2BL 3GRIA 4S11A 4QEEA 2CCLA 3QOKA 4NN6C 2AQSA 2CMRH 3IIZA 4RRPA 4XG1A 5DJXA 3LKQA 2FLRT 1RJPA 3Q48A 2BNQA 3IRSA 3WQDA 2WIMA 2V5CA 4ZRGA 1G9ML 1NPJA 4LAQL 4N87A 3DIVA 3SE8H 2NY1B 3V79C 1NGQH 1HQ4A 1WWCA 2CU9A 4RWYH 1IGFH 1OV8A 3BUVA 4JHMA 3ZGIA 4H4NA 3P9MA 2R91A 3MLUL 3VE0B 1CBVH 4FL4B 3T4AA 4XZUA 3VIOA 2QJJA 1OD9A 3ZE1B 4Z7OB 4Z1YA 1ZNNA 4RMSA 3NJGA 1F4WH 4MLJA 3OM3B 3LZPA 4G6AC 4IBZA 2X7VA 4A38A 3EADA 3W27A 1OK6A 1DFXA 4D7BA 1HE8A 5EOCJ 1W9UA 1S5WA 4GRWH 1EFXA 2CLIA 2K4WA 3T9WA 2DB8A 3C5JB 1N59B 4ZD3L 5DANA 15C8H 3O4OC 5FYKD 1YDYA 2C7FA 2K1MA 3AADB 4PUEA 4YGAB 1F42A 4DZ5A 4MA8H 2FJKA 3ARBD 1Z7JA 1R3HA 1NH6A 4IHBA 3MR9A 1EEUA 3TEZA 1AIFA 5ENWB 2UXTA 4R33A 4LHJB 4AYFB 1IT7A 1CICA 3MRMA 5I6LA 3GR7A 3CHDA 2PI6A 3UJRA 5I2UA 1G7HB 4O58L 1LO4L 4K38A 1ITBB 1TXKA 2QKIC 3LHWA 1BX2B 2GPTA 1VRXA 3VABA 4KAQH 5DURD 4WKFA 2XGBA 2XXMB 2XXCB 1RJZB 4KX7A 2NQDA 5C70A 3WYRA 3DRTA 1SJHA 5ERWA 2HTMA 3CDZB 1RJYA 3QZWB 4UTAL 2YPKB 1UD4A 2FPVA 4B7LA 1SW0A 1L9MA 3W7MA 5FOJA 1X98A 4PGCA 2H9GA 2RAMA 2NYZA 4L0ZA 4LVAA 1LDPL 3T0ED 4DQOL 3R58A 3VQLA 3LH2H 1TB3A 5A6LA 2ITFA 1U9KA 4HZ8A 2FEEI 4G7RB 2X9WA 4JFFE 4MYPA 1EBGA 5IFAH 4LSQH 3ABGA 5LAXB 4Y1AB 3CU7A 1YEYA 1QFWH 4YHLH 2C9RA 4KI1A 4RV8A 4MAYD 5LG6A 3OZLA 4TLSA 1MNNA 4PGBB 4GSDH 4RAVA 4XP5L 4MDRA 4M4RA 1DJXA 1UXMA 4HGKC 1RY7B 3ES7A 1CVSC 1KV3A 2HYMA 2HRHA 2P8PB 1H7NA 5CD5C 4QYAA 4X5XA 4O10A 3GMMA 1H19A 2ODOA 5DC4B 2PA6A 4LYQA 1JUBA 4HUWA 5K39A 4IBYA 4B9ZA 1I1WA 2EINB 2MNWA 1QPRA 3ARGA 4Y2DC 4S2CA 1DQDL 3SZKC 4EDXB 5BRPA 2WUCH 3NCYP 3VGAC 4YX2L 1FCGA 3UY7A 3V55A 1C5BH 3F64A 2ZJSL 3ZS4A 2J7EA 2QLYA 4DZBB 4F9DA 3QDAA 3PFRA 1WZKA 4GRWB 3VU1A 1O94A 3GHEL 2HVJA 1UWGL 4N85A 3WGUB 3E7JA 3PBYA 3K8LA 4PWEA 4ZX3A 1RZFH 2NXIA 1S7VB 2SODB 3NCOA 1RQEA 3FTWA 4HFWA 1KLUA 3QJAA 1ICTA 1IEVA 3HNTH 3AGWA 4N9BA 1HT6A 2R0WH 2NR6A 1P48A 2VR7A 3S36X 1QW7A 2GAZA 3U4EB 4I3RL 6REQA 5A69A 4JRXE 5KBPA 4E68A 1DE5A 3ZTEA 1FXQA 4MB5A 3SY1A 4XODA 1FL3B 2HVNA 5DUBB 3BQUD 1Q72H 4PJ8D 4JVPA 3ZE0F 1T3FA 1EJVC 2MH4A 2Z35A 1SEQL 2QJHA 3PIQA 1ZTXH 3QA3A 1HTIA 2AP2A 4RNIA 4MJID 2D7QA 3O06A 2K7PA 2R59A 2BSRB 2Y7DA 4DBEA 3FFDB 1FHUA 1YUHA 2CBOA 5D1ZD 5IXEA 5IJVB 2NXZB 2B3RA 2R2HA 5IHRA 5HHMB 1JZGA 4P23B 2OX1A 4CVZA 4EZMA 5FF6A 2ZOKB 1GHRA 4E9LA 1MREL 1UP2A 4WUUA 2WMPA 5K4XA 4HQQL 2WWDA 1LMKA 5AZUA 2IOIA 3OIXA 4IP4A 1G94A 2J8GA 3RL2B 1V0LA 1U93A 3NIFE 1OVDA 3W70A 1SM9A 1F58L 3PZGA 3ROOB 4V33A 3S5NA 3GLCA 2EUWA 4FIQA 4MJ6A 4D0CB 3GW0A 3GMOA 4O8RA 2VDLL 1K72A 3TYGH 2A3HA 2WYZA 5IHSA 3EOBA 3VGEA 3PLYA 3DVGB 4A66A 1IBDA 2V9RA 5HI5C 3FULA 1MG2C 4FQLH 3PAUA 3G1DA 3FN0L 1XPYA 4Y9FA 1SJEA 3DRQB 4UFMA 3C6CA 3N0AA 1E5ZA 2JQMA 1CWYA 3UXAA 1GPOH 1CC3A 2H26B 7FABH 3KHOA 3THDA 2PWEA 4GK8A 4GMSL 5KAQG 1UWUA 3DGCR 1IO4C 2HG0A 3P77A 1OF2A 5LN8A 3LNDA 4HU4A 3ULUD 2VR8A 3KPMA 2P5NA 1JRHI 3BQ6A 3W4RA 3C5ZC 3TW7A 3EBGA 1H4PA 4WO4D 2X53A 3N14A 2VGIA 2CUIA 4OJFH 3I10A 2MCAA 1WDSA 1F3TA 1LE9A 3J27A 1R9YA 4XZIA 2IJ0C 1XR9A 4OKDA 1RULH 2EXWC 1P5BA 3OPSA 4NM4H 4AY1A 1SDYA 4WF7A 2IPGA 3CQFA 1ILUA 1BFVL 1CFQA 3WDRA 1W3LA 2VJ8A 3JWDH 1U2YA 2D7MA 3NPSB 3QPZA 1UWAA 1U3HD 3ARDC 3GSOB 1AQDA 4IBTA 1PV8A 4B9FA 1B3IA 3BWUF 3FT2B 1FWNA 4N5EC 4M19A 2W9DL 3EBHA 5C8JA 2JKTM 4HH9B 1XIIA 4PB5A 3SCQA 2YCLB 2GJXA 4KRZA 4E8DA 1JK9A 1XAUA 2E68A 4XNZB 2EDQA 1XF3A 4B5TA 1RZ8A 3TC3A 3CFDB 2VFGA 4EAYA 4LUJA 2BRRL 1NIUA 2IALA 2FWOA 4C83B 5JMOC 1AP2B 4DWSC 3L08A 4XBGB 3RIKA 4APQD 1CDCA 3B9KC 3V4BA 1H3VA 2FSDA 2Y70A 4FXSA 5C0JB 3X1EA 5EKYA 3OJDB 3N11A 2BNRA 3OIHA 1K6QH 3GSRB 4BSVB 2J44A 4U6HA 3FYOA 2AAAA 2Y1ZA 4ZCWA 2HG5B 2PWDA 1I3VA 3MLXL 5JOPE 4UUJA 2DZBA 2MKLC 4AISA 4LSPH 1Q13A 1MFAL 3B2XA 2VYRE 3LBCA 4N0FA 3AB0B 4FYRA 4R0LC 1DFBH 4HJEA 4J8QA 1MCCA 1IGSA 4CMMB 2R7EB 3AABA 3QCTH 3MLRL 4OFYD 2RAGA 3L13A 4WGHA 4YAQB 4RZBA 1FWEC 2AQQA 4TSCL 4HVBA 5FGBC 4ZXBC 2ZZ6A 4F7KA 2XN0A 1B0GA 3LN5B 3WO3B 3DC0A 5I0ZA 1PYWA 4OR1A 1ZGLP 4UF7C 2MMXA 3NQKA 3IGAA 2Q71A 3K4DA 3L3JA 2WMIB 4UOW0 4M3HA 4R7WA 3BEVA 3DV4B 5J6GA 3S5SA 1P1ZA 1EPXA 1JVNA 4JFHD 4PRPE 3M0JA 5AY7A 4IKNA 3KCJA 3FO9B 4Y5YC 5HJ3A 3G6DH 5EWIL 3S37L 1YPZA 3E0IA 4JPIB 1ADQA 3IDJB 1YN6B 4ADTA 4GG6A 4FQCH 3APNA 1D6EB 1O5QA 1KXTB 3EZ4A 5C6TH 3M5XA 3NWRA 4L6HA 1UR4A 1OAKH 4M6NL 2E3VA 4D3CH 1X4YA 4Z7VB 4AVHA 3FFOA 2VX7A 3DXAA 3ZUCA 5A8OA 3WQ8A 1O7VA 2DEXX 3SRFA 3CN1A 1N9PA 4JGJA 4HA4A 5CZRA 5CSYA 2Y7FA 1YEHH 4S38A 3FW6A 2VUYA 4IIFA 1ACYH 4R4FH 3NACH 4YK4C 3NZSA 1GGOA 4Y2OA 3H9SE 2EPNA 3UC0L 1L9OA 3MLVH 4G1NA 1Q1JL 2R1XA 3FXGA 4AM0A 2VQ1A 3RNDA 1IAKA 4G6MH 4PJIF 4B9GA 5C6WH 3V4VA 3QC0A 1GTHA 2PW1A 2G60H 3GD6A 3VNLA 1H63A 3E3QC 1XG4A 3K80A 1IE5A 2OYPA 3HU7A 1RZIA 2ZC1A 5GRXG 2N1KA 1W72H 1NCDH 2G41A 1HG3A 3BG3A 4HOXA 2H41A 2DMHA 2DV0A 3RUBL 1BZOA 1M7PA 3ZYZA 5BU6A 2PLKA 3EDDA 2YDSA 3LXAA 3QEQD 3L3OB 4PMOA 2NV2A 4YGVA 4L37B 4JTHA 4WU5B 1G7LA 3G6AA 3PS6A 3W83A 4U1MA 5IJKC 1OP4A 4RSVA 3NAAH 3EB4A 4TS6A 2ZCLH 3GSNA 3NCJH 4IRZH 2ZCKL 4H8WL 4J3OH 4IQEA 3U25A 2L7UA 2HJFB 4JJ5B 2A9NL 2F0CA 2GJZA 5JA8B 2IPUG 5C86A 1F6FB 3UOAB 1SZRA 1Z5HA 1TJGL 2YXWA 3KLAB 1J48A 4RPQA 5DHMC 4QHUA 1IZCA 2SEBB 3DA0A 4O14A 4M3JA 3LDBB 4Q4MA 3LM3A 2CA4A 1R3KB 4P57B 4Z7OE 4CC4A 2YL9A 4RNHA 4QJ4B 3VMPA 1KB5A 3WLBA 3AIBA 1MPAL 2DAVA 1WDAA 5FJPA 2DVXA 5A8PA 2YAEA 3F8UB 3NZ8A 2FB4H 5INCB 3NJFA 3TLQA 2ZKHL 5DS8B 1WE5A 2JCCA 4B50A 3UR7A 1UA6H 1JGEA 2HS8A 3VIHA 1KZYA 4TTUA 2YK1H 3CAVA 1XQLA 4J39A 4FNRA 1YDPA 5ECUA 5EU7C 1M6UA 3QUMH 3DTDA 4D8AA 2ZT9C 4RK8A 3VILA 1JXFA 2Q6ZA 5C2CA 2CO6A 1ZVSA 5HUOA 4YPJA 1OYAA 2ADFL 4LL4A 3U9UA 3V1HA 1O5KA 5TTRA 3O3DA 3TTQA 1TLMA 1GYAA 2OMUB 1QLFB 3ITCA 1VYPX 4V1YA 2OMBA 2VKWA 4NKDB 4K15A 1LP6A 2F54B 5FYKU 1S2WA 3QIUB 3WLRA 4A04A 1DQLH 4ZUWB 4G43A 3TBWA 3LMJH 4KO6A 3B40A 4Y1AE 4ELMA 3L45A 3THMH 2WZEA 5F3HB 3UJSA 1JCKA 3BEWA 4G3YH 4I5BB 3CL7A 2ATKA 3OVUB 4S3EA 5I15H 4NQEA 4KPHH 1JZ6A 3WLHA 1SN5A 2CAKA 1RSFA 5TFSH 4PS4L 2MTAA 2FR4B 3QXWA 1GHFL 3AC0A 2W60A 2Q7YA 4O5LL 4AEIH 2A0LD 2W07A 2CYGA 4I90A 4IU3A 4UYPA 3HCVB 1FZMB 4WFEE 1IM9D 4MM1A 5C9WA 3QVAA 1KRCC 1R5VA 1Y1DA 3L95A 4NERA 5GZOD 4DK3A 2BP5M 4QX4A 4JUTA 4HIHA 1KLZA 4JX6A 1Z89A 2GEEA 4AIEA 5EC1B 4G11A 1LUCA 4OCLC 1DXIA 1LD9B 5E4EC 2OWWA 1C1EH 3LEXA 2FD6H 2QL1A 4XXCC 4OCSL 5CJ8A 4GRWE 3ML8A 2E7LC 2DQHH 3PANA 3OZKA 4CGUB 1H49A 3FT4B 3SOBH 2JJTC 5FO7A 4N1HB 4RMWA 1QSED 4IICA 3QMSA 3WFEH 1PSKL 4JX5A 2OI9B 5A16B 3PZNA 3TJPA 4GY7A 4IH3A 4CD7A 1D5ZA 2MPVA 4RISH 4NAEA 4NEHB 4FXFA 2Q8LA 1G6RA 3QUMB 1NDMA 1OGAB 2NX1A 4K94C 4OHQA 2OX4A 4KKLC 3CFKA 2BSDA 1U8JA 3F4DA 4XE0A 2HLFC 3D52A 4IDJH 3PTQA 1J6PA 4PS8A 2X05A 2X1QA 1KRMA 1FDZA 1Q9KA 3QYSA 3VZYA 5K59E 4JICA 5JHAA 4B3EA 2X4TB 3JV6A 1IBBA 2Y5EA 5LLIC 1HZYA 3IJDA 2Y7QA 4G9FB 4WHTB 2X4OB 1I1FA 4DF1A 3SDAD 4DN3H 4GI6A 2DVTA 5BMFH 3P0XA 3C56A 2QVFB 4LCVA 2EO9A 5AYUH 4KKAD 4ETQA 5HHME 4NCC1 1WRFA 1EKOA 2AK4A 1TQCC 4WRHA 3IDIB 3TTYA 1SR0A 3ECUA 2IANA 4HOMA 5F3FA 4KDWA 2NX5B 5HBBA 4ETYA 2YD7A 3NCCB 3DVNB 2OCFD 4IIQC 4P2RD 3GJFA 5JPMB 2CIPA 1NCWL 5BROA 2BCKA 3MKVA 3M9YA 4P59L 3RL1B 3RZCB 3P2TA 3H3PH 1HGWA 2CDEB 2I56A 3UR5A 3OGOE 4Q32A 1ICQA 1GA2A 3L7EB 1ZHBB 2FCBA 1CLCA 1P69B 1PTGA 4E9XA 2VCAA 5CSZA 3O4LB 4YH6A 5C0ND 1UXLA 5KBLA 1E7VA 4WDIB 4HJIA 1TKWA 5ISZD 5F1IA 3WK1A 2CMRL 5E9NA 4NSKB 4OIAA 1ZJIA 1E65A 1A4LA 1XIJA 2JB6A 3QIWA 3OMZA 4I0PC 3QDJB 3NBNA 4KZCA 5F2GA 5A8GA 2DJ4A 4HYWA 4M8QA 2L04A 2AK1L 4C6IA 4YHPA 1L7IH 2IMNA 3OO2A 2CGRH 2CDFB 1NGQL 1E4MM 2Z31D 2R6OA 5IOKA 4RWYL 1IGFL 1F76A 5IB2B 4NJIA 1NFDA 2RACA 3UADA 1X9UA 5C07A 5HVWA 3S3SA 1E4XI 1PLBA 5KBNC 5BW6A 1F4WL 4PG2A 4APQA 3WIFA 4QGTA 4GP5B 1FF5A 3RVTD 1E27B 3DPBA 4KRPC 1Y65A 3WBXA 3SOTA 3STZB 2WCPA 4N0UB 3SSZA 2WBJC 3BSZA 3D9AH 1ZTXE 3QHFH 4G7VH 3F58L 3V5KA 1J1PH 2XGZA 15C8L 3NSYA 4PWKA 4W8AA 4MA8L 4E0CA 4JRLA 3P2DA 1GGBH 1MHEB 3JV5A 4PVMA 5HGDA 4S0SD 4HKPA 4PCYA 5HJDA 5B80A 1OPGH 1RCOB 2IEPA 3THAA 1HHKB 1ULVA 1AXSA 4LBEA 2VC2H 4B6ZA 2J9ZA 4HU0A 4BZ1L 4KAQL 3SDYH 5LNUA 1YW1A 4YHKH 4HWBH 4DERA 3ZT5A 3W85A 3TWCH 4WY0A 3P62A 3B5HA 1AFVH 1IYXA 5SWSD 2E1WA 3S0CA 2C4XA 4GIRA 1GGUA 3QUHA 4QR7A 3TBYB 1GKPA 3BVNA 3BJTA 2E6YA 4LSUH 4M6MH 4AQEB 1OG0A 5C09D 2Y5TB 2YN5A 1U30A 3U36B 3NABH 3GS6A 1NY1A 2ZVRA 4L4TB 4IBSA 3QWNA 5KSBB 5IFAL 2CALA 1B2YA 4XHJD 2EICA 4W4QA 1BAFL 3LB6C 1SQMA 2ZTKA 5EO0B 1O1HA 1WCQA 3MBFA 3P81A 4P2AA 4NWTH 1KFBA 3RGVD 4XTRD 5I3GA 5LDSA 2F6UA 3CL6A 4R8WH 4JCLA 2Z1XA 1ECYA 4C65A 5CKGA 1JD7A 2FJHA 4ZT1A 2DEWX 4PVBA 4N2DA 2FZBA 2CUHA 4QLRA 4LS0A 4O51A 3ZGHA 3GUTB 1NGXA 2LVEA 5LDUA 2UWEA 2WXLA 2BVOB 4PJCF 2ADYA 5E8PA 1CXLA 4DPQA 2JTDA 5DMJB 2WUCL 3V9FA 1WFMA 5DMLA 4GW4A 4S1DC 4PH8A 1ZP4A 1C5CL 4JDEB 2Z93B 3DV6B 1F4YH 5JORB 2DMBA 2B0MA 4NO0A 3R06B 3I3EA 3VXOA 5EN3A 1X5GA 4US5D 3CU1A 1QKZH 4MADA 2GJ6D 1ZJAA 3N43B 1OCBA 3CLFH 4M62H 1RZFL 2HXAA 3MSGA 4PYSA 4QT5B 2QKIB 5E6IA 1M7OA 3HNTL 2DU2A 5EOQL 5DMMA 4PUWA 2R0WL 4N90E 4TIMA 1TJ1A 4OV5B 4OD2B 4Z7VE 1BRLA 4O13A 4U1JA 4U1LA 5CILH 2E6AA 3TONA 4PJHF 2DT2A 2VC2B 3Q1SH 4Z76B 3B97A 4LCRA 4NYLB 1E8YA 5D7LD 3CHFA 3KYNB 1QNRA 4KXAA 5DRNA 3DI1A 4PEKA 5LGHH 1J5TA 3RWEB 3P74A 4I5RA 3E49A 2V68A 4YDLB 2ZZ4A 5G4HC 4Y96A 4B5WA 5RUBA 4FS0A 2NNXA 1NIEA 3JV4A 3V0IA 1EDHA 1ITCA 1CYXA 4E3VA 1ZTXL 4HN4A 4Q8VA 3AIWA 4KZ0A 3T9PA 3BOLA 2VMEA 4ENED 4REQB 2G9HA 5IIEB 4IGBD 5EOTB 2I9TA 3WJXA 2E40A 1ZHKA 2HPIA 2NT1A 1YPFA 2L3BA 4LP4A 5DLCA 2DKUA 3F7YA 4WGWB 4GBXC 4ML9A 2X70B 5FF0A 1QR4A 3HF3A 5EFIB 2GK0A 4WJ5B 1U3ZA 1YEJL 2D8KA 4IYKA 4J4PA 3E8VA 5H35A 5SX5K 2I7SA 4MWFA 1OHLA 1SOSA 4NFCA 1A4KA 1T5XB 3SN4A 4JRYA 4DJDD 1VKXB 5F7LB 5CBBA 2NLJA 3ZSSA 4S1FA 3PWNA 4PJXB 4NQCD 5B3JF 4F7PA 2YXXA 4KETA 1WIPA 4DNLA 3PJSB 3L1FA 1T04A 3N42F 2K7QA 1EZWA 1PD0A 2XZCH 2WWNA 4L8CA 3GAKA 3EYVA 4LKXB 3VFTA 5FS5A 5D8ZA 5KVEH 3MRHA 3GSXA 3U1SL 2PTTB 1GK8A 2OQJA 3DFHA 3DK0A 2PWUA 1S9VB 2J1KA 2H32B 4JBRA 4WKZB 2VISB 3ES6B 3E0VA 4AUJA 1KIRB 4HMEA 2V5LA 1RK1A 3KDNA 3E5PA 1GPOL 1C8XA 2EACA 3F7VB 1GONA 4J3VA 3FFSA 2VUKA 1XBRA 1JPFB 2FUTA 2WNQA 1OYCA 1MNZA 5C0RL 2JXMA 1S9YA 3P93A 3IU3A 3K6FA 1BAGA 4A39A 4PV9B 1A6UH 5J9PA 4H7CA 5AYIA 1IARB 1KFEA 1HQTA 2CKNA 1G4TA 1SJBA 3EW3B 4IOSD 1KN4L 4LVFA 3E2HC 4OJFL 3UEZA 2DQGH 1ZANH 5BQ7B 2N0MA 2IKJA 3CFBA 3WKZA 2IWGA 2JK5B 1JGIA 2CK0L 2Y3NA 2WIIA 1W2PA 4PJAA 3QW3A 3MHGA 3IJ8A 1JJKA 2NQZA 1VHCA 1CG9A 2CESA 1FWTA 5EPMA 3JWDL 1E28B 5KN5A 1PS9A 1YYLH 5GZOA 4CJ1A 5BXPA 3E6FB 4EPDC 2P5WD 2D1ZA 3OA3A 3MUXA 1COBA 5CEZD 4GZEA 4JKWA 2BY1A 3S5YA 1X44A 4N2OA 1SM3L 2Q8AL 3BP5A 1RQ5A 1E1CA 3WNJA 2FQGA 1PZBA 3JV0A 1IIKA 3V7MA 1JWSA 2F54E 4KJWC 3UC2A 3ABQA 2D7TH 2CLPA 3MWCA 3V6FA 2A4AA 2CIIA 4G83A 3NA9L 3U6XA 3S1GA 3ETTA 1WC7B 5E4IA 3UZEA 1IF2A 3SDCB 4V1DD 2D03H 1YE4A 4M48L 3N25A 2Q0ZX 3GB6A 2DSVA 5AYYA 4LVNC 3MU7A 1F9CA 4BFNA 1W31A 3K2KA 5D1QD 4WENB 1BF5A 5AC6A 2OPCA 4OD3H 5B1BB 3WS6A 1KXVA 5JNYA 4JNMA 4I1RA 1VGEH 1OSEA 2Q3AA 1RMFL 2PNDA 1U8PB 2WHVA 3T42A 2VFEA 3D4CA 4Q8WA 4LSPL 4YFEA 3WTTA 1A3LH 1N70A 2MJWA 3VX1A 2WBWB 3G5VB 2ADIA 3ONBA 4L4VD 4AY0A 5E1GA 4JPWL 4XTDA 5B1JA 1YY9D 1KR1A 5AHEA 4DETA 3WL1A 3QRGH 2XPKA 3LPOA 1HFBA 3BC9A 4UFKA 2VLLA 4AD4A 4WI5A 1WP6A 3W0WA 1Y0LB 1ZBCA 4QHLB 4WHCA 3T65A 1GQLA 4JN1H 4L3EB 2NNRA 1EDGA 4PREB 2I25N 4K5MA 1JPEA 2EEXA 2R9HC 3NIGB 1YEKH 5F9OH 4N8VB 3RLHA 5BVPH 4LLYA 5B8CA 4P5MA 2ZUSA 5FJRA 3ARVA 4ENLA 3S8FB 2F2KA 2WW5A 3U1QA 4U3SA 2IF7A 2XICA 3HS0C 3WUBA 1ADSA 2ENQA 2IBZX 3VH8G 4K8GA 2ON3A 1OGAE 3P0GB 3BFOA 3ARDB 5F4XA 2VB5A 1UKPA 2J24A 5AHNA 1ZRUA 1BVOA 5AB3A 1G7JB 4X4ME 2Y69B 2DTMH 3PP3K 5AWNH 4FABH 4FQXA 1XIGA 3LKPA 5H4ZA 3IDMA 3QUZB 2CEQA 4Y4KC 2GBVA 3GMLB 4QRRD 2V2WA 2IDSA 3PPGA 2P1YA 3HPFA 1OAKL 4P2CG 3DX6B 2J9YA 4D3CL 3SODB 1E6NA 3C3UA 5IHWA 4G9FE 3P0WA 2WZIA 5SV3A 1DQXA 3A64A 2GT9A 3DX9B 2YEQA 4IFRA 3IE4A 1XF2B 3LQGA 4GI9A 1YEHL 3URAA 4QCEA 1FL6A 1ACYL 4R4FL 3GG7A 3NACL 3LV3B 4MZ1A 4CN4A 4G8GB 2E6JA 1EOMA 5FYJH 3CFEB 2OU4A 2WOBA 4XPGH 1JSYA 5M95B 4O0KA 1T66D 2VLRB 2NX5E 3KLQA 3MXWH 4IQLA 4G6ML 2MTPA 5KSUA 2DZPA 1QEWB 3D39D 3HVNA 4R7NA 5FHAH 1BAWA 1J8KA 1TDQA 5KVGH 3PUEA 1GUVA 5DVNA 1DJWA 5BWAA 4LNYA 4FQ1H 3QGKC 3MQIA 2PCFB 3VX0A 4NO3B 4GINA 2PLMA 3HAEA 4Q7BA 4C4UA 4YTQA 3LIZH 1US0A 1UP3A 3CFNA 3FS9A 4X7EC 5C55A 4BWLA 3MUHL 1X7QB 2NUYA 5AYBA 4JFPA 2O6CA 2APBA 5ITBH 4M6PA 4AFYA 5LGYA 3O4LE 4ZB2A 4H13C 1H1ZA 2BP0B 3B9AA 1J9QA 1DO5A 3K1DA 4KMTL 2Y5QA 5FJIA 3RWFB 4W81A 1XC4A 4DF2A 1G1CA 4KJQD 5CGTA 4IRZL 4JN8A 2VL4A 4K9EH 4ANVA 5C0BA 4UTWA 4BJLA 2YEZB 3RM4A 4UYQA 4ZBJA 3VIMA 1MRQA 3S2JA 1MSSA 2YPVH 3SPJA 4POZD 5H2BA 1SOQA 1G0CA 43CAA 2R1KA 4FF9A 2GCYA 4H19A 2R1YA 5GGSY 3W02A 3D85A 3N40F 1S3HA 2NY4D 1S7WA 3RWGB 1ETB1 4R27A 3D34A 1MFEH 4GIAA 4ZUVA 1AQHA 2J8UA 4O1BA 5I6NA 3CN0A 4L5ZA 2R2BB 2GQHA 4I4WA 4BK5C 2AQWA 2PN5A 4UIMB 4N0UE 1AG0A 2VLJB 3QT2A 2FGWL 5I0WA 1ZIBA 3DJ9A 3E2RA 4MAVA 1U2HA 4AENB 3L67A 5A8QA 1UA6L 3P4OA 1BD2B 4XN5A 1JMXA 1XAKA 3OX8A 3BVVA 2D4FA 1XLLA 2YK1L 4PJGF 5JIIA 2QVHA 2VDMH 5AOLA 4XX6A 3MRDB 2IKIA 2JVUA 4DBSA 5JZ7C 3QUML 4FFWC 1XF1A 2Z6JA 5F71A 3L7RA 4OZIA 4UQCA 2LHAA 2V8LA 5DD5H 5FUCE 4GP4B 5SV4A 3V5CA 1HXYB 4PU2A 1NFKA 1F05A 5JLZA 3O6AA 5CC6A