1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
b'FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-galactosidase
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
2XVKA 1OF6A 4M5PA 4DPQA 5CPMA 3QSTA 3BW3A 4LXFA 1ZCOA 3ABOA 3QMRA 3ZWSA 1AQMA 3IVSA 4QIUA 5FEZA 4BF9A 3M5YA 1SZGA 4J3WA 3EX3A 1CYGA 4JDYA 1XKYA 1TV5A 2V82A 3S8HA 4DF2A 2V2CA 3NL5A 1VHCA 3LI1A 3AJ7A 5KMYA 3L65A 3F4WA 4OBTA 3VM7A 1H51A 1KW1A 5KINA 1SU5A 3HGJA 3MYOA 2YOCA 2YYTA 4KWVA 1W3TA 4N6FA 3R13A 2WSQA 3S5ZA 3TTYA 2E5CA 3I7SA 3D4YA 2ZUUA 3A6OA 2V2HA 2QF7A 4GI9A 1UOKA 1GVSA 4QITA 3BVTA 3DHUA 3P5YA 1OFRA 1QNVA 4X22A 5BMWA 3A24A 1FBAA 4J3SA 2DZPA 3L4VA 5D04C 5AN7A 2VNCA 2BZNA 2F61A 3W7IA 1OX6A 1CW2A 1PAMA 1W0MA 1RQEA 2X1TA 1QWUA 3CTTA 4A2RA 2OW7A 1J5TA 1OFEA 2V5LA 1VIWA 4N9CA 1TPVA 2J27A 1R30A 1CIUA 2CWNA 2VFHA 2F1AA 4HOWA 3KRSA 3BUQA 3S5NA 4JIQA 1PE1A 3GDRA 4GUHA 1W5OA 3TDFA 4LRSA 3W23A 3W38A 4LUJA 1NM9A 1EEPA 4RXFA 1JRBA 4JTJA 4UMBA 5HXMA 3HF3A 1ML1A 1XH0A 3VGFA 1YXYA 5LNRA 5A2CA 1X1OA 2DU2A 4UNLA 1TPFA 4UMCA 1Q6LA 4BK9A 4U4MA 5TIMA 4AH7A 3QF0A 1M7PA 4O16A 5AHIA 3KVMA 3EJQA 5F2MA 1AW2A 1A5SA 4FIQA 2AMGA 1KM3A 4GWEA 4XQ6A 3BAJA 4HPHA 1X7FA 3TQVA 4I7WA 1NEYA 1MXSA 5D37A 3IGSA 2C7FA 3C2EA 2F7RA 2ATSA 5E0KA 5LNSA 2DZVA 2RDUA 3SI9A 3P7YA 3WDIA 4ZQRA 1ZJIA 1JRCA 1B2YA 4QAWA 1NF7A 2BY1A 1U2YA 1S3HA 2WJZA 4JY8A 3BUIA 1V7YA 1BTMA 1UH4A 4XB3A 1N8FA 3O06A 4E38A 4AEEA 3NA8A 2C15A 2ZFAA 3W7CA 3KL0A 3MP4A 3M07A 3IGXA 3GK0A 3O6CA 4IGHA 2ISVA 3ABRA 4WZHA 1A50A 3GX9A 4Z1AA 4MAZA 1JR1A 2C13A 2VKZG 1I2RA 1TPB1 1LWJA 1SUXA 1XGZA 5EMYA 3GKFA 1TIMA 4N2YA 3MYPA 4H8VA 3TQKA 4IPIA 3C6CA 5HNRA 3HGRA 4IPJA 1RQHA 3LXAA 2YA0A 3EB2A 1UD6A 1KM2A 4AB4A 5SWUA 4O14A 1TV7A 2KZHA 4O13A 5DCEA 3TSBA 4IMCA 1MVYA 4IUOA 1J0IA 1H63A 3C8FA 3GDMA 3W70A 3EKZA 2B7OA 3W1LA 4U33A 5E93A 1TQUA 1K8YA 4WOZA 4AEFA 5EMUA 4OKDA 2JK2A 4O19A 4S2CA 3HGOA 3SR7A 3UNDA 4UTHA 2ZZ4A 4JXCA 3DDGA 5I3JA 1LTDA 3W1PA 1LRQA 3DDFA 4DPPA 1YTDA 2G96A 4UQCA 1U5JA 2V30A 5I3KA 1QPRA 3EJRA 2E4TA 1EA9C 2YXGA 1LZOA 4AIEA 1ZAIA 3NQVA 1OT1A 2PWFA 1RV8A 3P80A 3DU0A 1UD5A 1XSKA 4AEOA 4AMXA 2OJPA 3L0KA 3MBFA 2D3NA 4BR1A 2ZA2A 4P61A 3PC0A 3L4TA 1OX5A 5K7JA 4OQVA 1WYIA 5F1UA 1OFDA 1N55A 3EJUA 3CEPA 2LLEA 5ABTA 1VYRA 2WSKA 4TIMA 1ODUA 3VE9A 1FWTA 3BH4A 1HL9A 1KM0A 4IXXA 2ALWA 3VX0A 3CZSA 1TPDA 2ABAA 3TC7A 4AHQA 1TQXA 1JIBA 1SZEA 1QMLA 3F03K 2IQTA 1QFEA 1V3MA 3IJ8A 5KZMA 4D2JA 2ZYFA 4HKPA 1GVFA 3PWAA 1KM5A 2V0TA 1JDCA 1YDNA 3BMVA 3A23A 2QJIA 4OT7A 1WZAA 1BVZA 5D33A 1XI3A 3WY2A 5A2BA 2DIJA 1TREA 1WA3A 4NNAA 4NX0A 3B0UX 3B8DA 5IM51 3W2JA 3KWXA 5CLTA 3FS2A 2BY0A 1B9BA 4UOZA 1QO5A 2ZA1A 1Z32X 3W84A 1TPUA 1LCOA 4NQ1A 5I3FA 4JNMA 2FIQA 2V3FA 1EA0A 4LPCA 3UXDA 3MBDA 3NYZA 4MY8A 3JS3A 2Z0IA 2O7SA 3TW7A 2JBMA 3B4UA 3CWOX 4JN6A 2C1HA 3B0VC 1SMDA 4HOZA 1JDDA 5AC8A 5DXYA 2VFIA 4UC5A 1V3LA 2J6XA 1WBHA 5DBTA 4DO4A 2WSRA 3CM4A 3PY2A 1XBZA 3EKLA 3F1QA 1AL7A 1YYAA 2QAPA 3EXTA 4JR5A 4RXGA 2VRQA 5D32A 3C2RA 4MZ1A 2Z1BA 3W7QA 1W5QA 2CHNA 1K3UA 3W1AA 2OYMA 3FOKA 3BUBA 1YDOA 2ZICA 3BG5A 4O1BA 3FYPA 5DBUA 1VFOA 4DELA 4K38A 4FEZA 4JX4A 1PIFA 3EX6A 4IQLA 3TC6A 1HVXA 4PCFA 3BCDA 5FESA 3TFCA 3GR7A 1TTJA 3QPZA 3WEOA 1CX9A 1RPXA 5G5IA 3LI0A 2DZSA 1GPWA 4LW7A 3KLLA 1T96A 4JEQA 1SO3A 3W71A 3CWNA 4EF8A 3SY5A 2YR1A 1PV8A 1KM1A 3PSWA 5FF4A 4DO6A 4UTMA 1DHPA 1CDGA 4O53A 2V9DA 3EDEA 1TRDA 2A7RA 1R46A 4O50A 2H8ZA 1JAEA 1M7XA 1CXKA 2VEIA 3VGHA 1HO1A 1O94A 2ZXQA 3WENA 1MW1A 4CN1A 1UKQA 1R2TA 1VCVA 1W56A 3PBYA 4LU0A 4B5NA 4CQ9A 5CSRA 1JG9A 4HP5A 5CZSA 2OZ0A 2E5BA 4Q4KA 1MSSA 1FY6A 1XUUA 3W7PA 3G1XA 2ZA3A 4LRTA 2AGKA 3M5XA 1NSJA 3W85A 1H60A 2EPHA 5D38A 5DY3A 3STGA 1HT6A 1PS9A 4ZL1A 3DH7A 3TA6A 3BAYA 2J88A 1XD0A 4O15A 1MWOA 3W7DA 3E0IA 5LKYA 4BI6A 3K8MA 3UQNA 1FX6A 1W8SA 4UFKA 4JFSA 1KM6A 3S1WA 1P1XA 3IVTA 1F7BA 4ADUA 1U33A 1GZGA 3STFA 2DORA 4DF1A 1ME9A 5F4XA 1H7XA 4BI7A 3QW3A 1EUAA 1UD8A 3A4AA 1KFBA 4NJHA 1LOLA 4H2CA 4NVTA 2VXNA 1Q4NX 3LLFA 1J0KA 1KXHA 1G4TA 5CZ0A 4Z0JA 1A5CA 5E6ZA 3DFTA 5LNVA 3OLGA 1FCBA 2QCLA 3HJZA 3P84A 3GR8A 1MEHA 3W9ZA 3C61A 3KRZA 5CGMA 3IGUA 5K9DA 1OYCA 5K4XA 4U28A 4IXHA 1LBMA 3O15A 4ZZ9A 5IBXC 4GJ1A 3I7QA 4KKXA 1CXEA 1UA3A 1WQ5A 3KVKA 4LNYA 1WV2A 4GUJA 2TAAA 2OSXA 4UQDA 4GI8A 4GQRA 1LBFA 5E1QA 1KV8A 2GVLA 2ZCGA 4XTIA 1MFVA 4UQBA 1Y0EA 4WUIA 2E6YA 5FF0A 5CGQA 3IV3A 2XVGA 2NUXA 1K03A 2NT0A 3SW6A 4E2BA 1AMYA 1O95A 2VEMA 4Z0SA 4JTLA 1QPNA 1KTNA 4J3UA 3NQAA 2H3BA 2PRHA 2QCFA 3TFXA 4WY0F 3R5EA 3W7HA 2WC7A 4RLIA 3UCQA 3W1RA 4UZUA 4W9TA 2QDHA 3CZGA 3T55A 2GVGA 4ALDA 3GXNA 1VR6A 2FPYA 5AFDA 1UH2A 4OV9A 1M5WA 5FF3A 2OYLA 1E40A 2Z1KA 4BA0A 5GVJA 4DO5A 3QW4B 4WF7A 5E0FA 3S2CA 2CU0A 2E6FA 3VNDA 2WCGA 3LRMA 3HZ3A 2DJXA 3RK8A 1SO4A 3IIXA 4O18A 3QFEA 2Y7DA 4FO4A 3CEUA 5HQEA 1R75A 3EWZA 1K02A 3VE7A 1KV5A 2Z6IA 2UV8G 3S6DA 3EWUA 4NXSA 3G1HA 4K7VA 3NL3A 3NNTA 3WJYA 4WX2A 3KHJA 2Y2WA 1DBTA 2QJGA 4LOCA 5D2XA 2F7PA 1M7OA 3K8KA 1VRDA 4K7YA 2ZZ5A 2BSLA 5G2HA 4KFPA 3TW6A 3L67A 2PWEA 1VS1A 4MY1A 5K9CA 1CGWA 1ICSA 1F76A 1QOQA 1FWWA 1SSGA 3U2OA 1FDZA 3W88A 4MZYA 2CLOA 3EDJA 2ZXDA 1LOSA 2F84A 1I2QA 4GKLA 3R2GA 2FLIA 3CLWA 3GDLA 3MMTA 1IXPA 1XD1A 3VU2A 1TPH1 1Q3NA 2XWDA 2F7FA 3PG9A 1Q6OA 4QNWA 2QCCA 5F4SA 1RQBA 3ATZA 4DXVA 1G1YA 2NUYA 3RIKA 2QMJA 3LB0A 1IGSA 3T44A 2H8XA 2FH8A 3VGBA 3VM5A 2D73A 2HSAA 1KWKA 2CZ5A 1KLYA 3NQFA 2XN2A 1JCJA 5T26A 1SW7A 3G0XA 4MYXA 3WELA 1KFCA 3WDJA 1Z48A 5LNWA 5EKYA 3QYQA 2WCSA 2Y7GA 3BO9A 4U2YA 4GIAA 1TTQA 4JTUA 2EO7A 1YTEA 1QO2A 4IMFA 3U8GA 2ZX8A 1BPLB 4AHOA 3BMWA 1ALDA 3IIPA 1TQVA 1Z42A 2BY3A 1GJWA 4MB1A 5CPLA 3KX6A 3K1DA 1YADA 1J4EA 2CLKA 3QQ1A 3TX9A 3OLEA 1LP6A 4IWWA 3KE0A 3VFLA 1TV8A 1GJUA 1TMQA 5DXXA 3W74A 1GEQA 3VCRA 3M6YA 3LHWA 4U31A 3LXCA 1ZAJA 3TAKA 3S42A 1MEIA 3FIGA 1G67A 1DTUA 2ZRZA 2V8ZA 1F74A 2VC6A 1HO4A 1Q6QA 3PBWA 3Q94A 4WY0A 3N3MA 4M6VA 1EO5A 1YPFA 1FWSA 5LGXA 3NPVA 1XBXA 3Q58A 2FDSA 3N9RA 2NV1A 3T40A 3GLCA 3VGGA 2ZRWA 4GC4A 1N7KA 2J9YA 3STEA 1HFBA 1UJPA 3QZEA 4KFNA 1JI1A 1HXKA 2WVUA 3LPPA 3LCWA 2A7NA 1EUNA 3NG3A 3NQEA 3K8LA 3O6DA 5EBUA 1CXLA 1B4KA 1Q45A 1D3HA 3FA5A 2VELA 3EX1A 1DV7A 1VCGA 2YA2A 3UERA 2CXGA 2YDAA 3MJYA 1D7FA 2OX1A 3TTSA 3LBCA 4JX5A 4O0KA 3EWBX 1PVNA 1LLWA 3N9SA 3BG3A 4ZQCA 4OGZA 1VYSX 2ZWYA 3BUPA 4Z1BA 3W7JA 5HWMA 3ZT7A 2QLYA 2X16A 3GIYA 1YPIA 1P4CA 3W2LA 2D2OA 1OFPA 4ICNA 1NVMA 3KVLA 4KWUA 1IV8A 1JDAA 1KBIA 3G18A 4UTKA 5CPNA 1KCLA 3ECQA 2NXGA 2VFEA 2QCMA 1EWEA 1QAPA 2TSYA 2OCZA 1JF6A 3KLKA 3BVJA 4UFJA 4NX5A 3DX3A 2VENA 4FIRA 2EHHA 1CLVA 3DX1A 1TJPA 4WY0B 1KFJA 1OK6A 4UQ9A 4JCMA 2FE0A 4H7VA 3GBEA 1C8QA 3VMNA 2Y70A 5C2XA 3ZS4A 3QRHA 2ZUWA 4UTLA 1KBJA 4JL2A 5AYZA 1BG9A 4DBDA 3ZR6A 3HQ1A 5CLWA 2YPIA 3GKAA 3NZRA 4AW7A 1JD9A 3B03A 4LC6A 3BLIA 2FTPA 2WVTA 3LDVA 4WQ6A 3MWAA 1S46A 4MPQA 2QEZA 1CI1A 4M6QA 3TIMA 4HNTA 3CIWA 1QI5A 4FNTA 2ZDRA 1WZMA 2YW4A 3S5YA 1JF5A 3ZT5A 1T8XA 2Q3RA 4G1KA 2ZZ3A 3P5ZA 3AXHA 4UTUA 3NQMA 3HPSA 5E9AA 1W3IA 2BHZA 4MLJA 4TR9A 4O8RA 5DLCA 2HMCA 4UUIA 2WANA 5KITA 4NZJA 1FCUA 1EWDA 1JI2A 4GXMA 2VFDA 4TO8A 3WNLA 1WBJA 2X1SA 2WNNA 2VRKA 4RZ4A 2ZZ2A 4FNSA 3G0SA 2H3DA 3EJPA 4AWTA 5G4WA 3UWZA 1PZ3A 4UZSA 4ADTA 3OIXA 5BRPA 4K6AA 3G1DA 1AW5A 4N9BA 3O6YX 3W2KA 5D09A 1DQWA 5EL1A 3NR0A 3PG8A 5AHFA 1B4EA 2ATMA 5I24A 4Q33A 1G4EA 3TONA 2BHYA 2J9ZA 5AHMA 2Y89A 4BWLC 5EPDA 3CIXA 4FMVA 4JYEA 2I1OA 1DORA 5HR6A 1VLWA 4UFHA 1W5PA 2Y24A 3WNNA 5G2WA 1TPWA 3C3NA 4UFIA 3BVWA 1V5XA 1VJSA 2XVLA 4FNRA 4GFSA 2EF9A 3FYOA 4GO8A 3FKRA 3M9YA 5BNKA 3HIJA 1PZ2A 2DH3A 3GXMA 5AHLA 3DI1A 4OU1A 1MEWA 2A85A 2ZIDA 5IBXA 1O5KA 4NNCA 4N9EA 2PWGA 3MI2A 4A22A 1OYAA 3DFNA 1K7XA 4WLCA 3QSRA 3PUEA 3IIOA 1JXKA 3Q37A 1O4UA 2RKXA 3LBMA 3EXSA 1PIGA 3BSGA 1ZY9A 1VYPX 1QWNA 1PCKA 4JICA 1LYXA 2FQIA 2EAWA 2GJRA 3CLMA 1G69A 5L6UA 3L9CA 1K8ZA 3LHVA 1JD7A 4LVFA 2A2IA 5DO8A 2P10A 2BLEA 3QM3A 1F73A 1A5AA 3N73A 1MO0A 4TMBA 1SQ7A 1MW3A 4CN6A 5CXPA 2GOUA 4QNEA 1EH9A 1BKSA 2W0UA 3N19B 4QQ3A 1S5WA 3R89A 4NXKA 2Q8ZA 3TNOA 1HL2A 1H5YA 3LCHA 2DH2A 3B05A 4M19A 5BOOA 2R8WA 1JULA 1JVNA 1B0IA 3DKJA 4R34A 4O0ZA 4FF7A 3ZSSA 3DXIA 2VFGA 1XSJA 1YDVA 2CLLA 4LVAA 3M43A 3LV5A 4POCA 1OSEA 4AVFA 2JKEA 4MY9A 3ZR5A 4YL2A 1O5XA 2ZX6A 5EY5A 3DX0A 2OYKA 1G5AA 1LRTA 3PBUA 3EJTA 1GJPA 1H7PA 1JCNA 1YXCA 2G95A 3I7RA 3NL6A 3UWQA 3QMSA 1WOBA 3NPWA 2CPUA 1YTKA 4LUIA 5F2GA 3WY1A 4UFLA 1BWLA 1C8VA 3NXFA 3BVXA 3WDHA 1PEZA 4CLMA 3VSTA 4XBSA 2VT0A 5HULA 3NDOA 4YWIA 2E09A 1Z41A 4Y9AA 3WNPA 2QCNA 1ZS2A 1UH3A 3E9AA 3ELFA 2E8YA 5H91A 5BMXA 2QAFA 1EP3A 5D02A 3PS7A 1K7FA 4WXZA 3NAVA 1IZKA 5I3GA 3SECA 3RU6A 2F2HA 5AYXA 2G5WA 5A6LA 1J2WA 3HG3A 1XBYA 4MIMA 3TOPA 2D0FA 5HMSA 3A21A 2Y4SA 4HNVA 1I2PA 1ZJBA 2PURA 3RNDA 2ZZ7A 4JFVA 1XBVA 1W54A 1W5MA 4N9DA 4ZVJA 4GO9A 2ZUTA 3W75A 3NQGA 2Z2UA 1WZLA 3CU2A 3I6RA 3NQCA 3WMSA 4A29A 3L4YA 1AVAA 1P6WA 3CV5A 1UD4A 3L4XA 1OFBA 2WKGA 5D2VA 3PVFA 2EQDA 3NPUA 1H3GA 3G22A 5U4NA 1AL8A 4ADSA 4XWUA 1O7DC 2NXHA 1CGYA 3TSMA 1HTIA 2C14A 3OVPA 3DBPA 7TIMA 1BEUA 4LWWA 3W7MA 1F6PA 5A8GA 3WJSA 5AB3A 1WE5A 4L4MA 2Y88A 3C56A 8TIMA 5AOUA 4AYGA 3FW6A 3D0CA 2YCEA 2E77A 9CGTA 1QI4A 1A53A 3W3OA 4MUZA 1Z44A 2WNZA 3HOJA 3LTSA 3NQDA 1KXVA 1L6WA 3S1UA 4EWND 1MW0A 4JL1A 1SPQA 1O60A 1VAHA 4YMZA 1G94A 4FX6M 2WSPA 2V3DA 1KFEA 1R47A 3W76A 3FAWA 5KZEA 4J7RA 4RV8A 1AQHA 4IX0A 3L66A 3NM1A 1EX5A 2GUUA 3TSDA 1XH2A 3TK7A 4TX9A 3AXIA 1SFLA 1GTEA 3QQ0A 1Y7VA 5LZLA 5BRQA 4YCPA 3N2MA 4O12A 5D05A 4W93A 5A2AA 3WJXA 2GPTA 4PL2A 4WJEA 1TO3A 1L0PA 3HPXA 2PCQA 3CB8A 2EGZA 4PC8A 3WK1A 2BXVA 1JJKA 3EXRA 1ME7A 2QR6A 3TU9A 1A47A 2WNWA 1HTYA 3H53A 3SFKA 1XC4A 4JGDA 5E6YA 2XWEA 1X8FA 2CLMA 4IMGA 3FJ6A 3WN6A 4J9JA 1H7RA 3L5LA 4Z1DA 3ABSA 2J9XA 3W1NA 3IVUA 4O4WA 3VNZA 3G3MA 2EJ1A 4NZFA 1ZALA 1SZFA 3MUXA 3LTPA 4JTFA 4XTDA 2YFOA 1LDCA 3S5OA 1XL9A 3VI2A 4EF9A 1H50A 3G1YA 4JY9A 3DI0A 4NU7A 1XM3A 1HNYA 1M6JA 5HJLA 5EYWA 4M7TA 3E12A 6ALDA 4H8UA 1B57A 2Y61A 4ZMGA 1D3GA 3KAOA 1TB3A 3P74A 3W1QA 3A9IA 4RJEA 4JFWA 4K36A 4LVBA 1XFBA 2G3MA 4E2OA 4NJJA 1W5NA 3L2IA 2XN0A 5EA9A 2ZRVA 2DP3A 3KEHA 4EVZA 1QOPA 4UXDA 4I9AA 3M5VA 3UXAA 2WO5A 4CVWA 1FQ0A 3O16A 3GVGA 3PF3A 4MLRA 4NT0A 3TJXA 3GXIA 3M1ZA 1DEDA 1XCXA 4PCSA 1CGVA 1KFLA 1MFUA 5HPOA 3W7OA 4WOQA 1JQXA 4WSKA 2A1YA 3AO0A 1UKSA 2ZRUA 2A0NA 3NVTA 3GAKA 2FH6A 4PTNA 4UQAA 1G9HA 1LM1A 2WKJA 3HPZA 4FX7A 3BV4A 1JCXA 4LS2A 1LRNA 3PB2A 3QMTA 1E3XA 2PE4A 3TROA 1QR7A 3DFOA 3CZLA 3D52A 2TYSA 3MHUA 5DCDA 5FEXA 3UG3A 3GXDA 3FLUA 3SZ8A 4IOTA 3P81A 1UD2A 3VNYA 4BWLA 5HUPA 2BXYA 3MP3A 3W2NA 4QISA 1OABA 3UZ5A 1ICQA 1K7EA 5CKSA 1GT8A 3MP5A 3BLFA 3PB0A 3EX4A 5C54A 1HUVA 5D30A 2X2GA 4GUIA 5FI8A 2ZE0A 4LVDA 1H7NA 2NXIA 2CLFA 2QUVA 3W87A 2X2JA 4U3CA 4ORMA 3LXBA 1PCWA 1TQJA 1KGUA 2H6RA 5AHEA 1WAUA 2NWRA 4P2VA 1QWGA 3OHIA 2NWSA 2OSWA 3KFTA 4C1LA 1KBKA 2AAMA 1J0HA 1WX0A 3G24A 4O1AA 2Y62A 3GDTA 4K37A 1EP2A 1IZJA 2B4GA 3C52A 1EPXA 1OFQA 5HUOA 2XIIA 1IXOA 4CNOA 2ZXBA 4DBEA 2VUYA 4JTEA 1XH1A 2YKKA 4GRSA 2Y5EA 2ISWA 3LM7A 1VB9A 2V5BA 1PHQA 2WOQA 4FLQA 2FFCA 3SGZA 1JQVA 1CGXA 3VO0A 4O1CA 1EO7A 1VC4A 4MKNA 4H8HA 2FB3A 1PIIA 2QMKA 3C4UA 1H62A 5LNUA 1L9WA 2GJLA 3E49A 2BHUA 1W1ZA 3OEXA 3W1TA 1TJRA 2QUTA 3GXFA 2RDWA 3P62A 3HG4A 3CPRA 2ZUSA 1GG1A 4EIVA 4HPJA 3L4WA 3INPA 5AC7A 3W83A 3VGDA 1OYBA 1RD5A 1KLZA 3OLDA 3UPBA 3K30A 4ZQNA 4DEFA 1TPEA 5F2LA 2D0HA 2GJNA 5F1VA 5F2IA 3TE9A 3B0PA 4JX6A 2Y6ZA 3PR2A 6CGTA 2WSYA 3IRDA 1G4PA 4RZ6A 4UR8A 3S9YA 2E68A 4UCGA 4C1KA 4I7VA 1CGUA 2RDTA 3MI3A 5A5WA 1GYNA 3KXQA 2FB2A 3UWWA 3F4NA 3LCGA 1HWWA 3H55A 4J3XA 4AMAA 3D4ZA 3IJ7A 5HDRA 1QCWA 4HN4A 2AQWA 1UUOA 1ME8A 2ABBA 2DIEA 3DGRA 4B9YA 1F5ZA 4BZYA 3LLDA 1XCFA 4UTWC 4N02A 2PRLA 1J0JA 3DHFA 1P0NA 3BAWA 3IK2A 3D51A 3CC1A 3DENA 3T4CA 2PRMA 3LGEA 4GQQA 4WD0A 3L2MA 2WVSA 2CFFA 3GZ3A 4AXKA 5I3HA 1VLIA 5G2IA 1LLZA 1H61A 2PWHA 3QJAA 3HBLA 1DL3A 3EX2A 1TYGA 4K8HA 3TXVA 2CLHA 3C2OA 1OT2A 4Y6GA 4BFAA 3VSUA 2WNQA 1W37A 3CHVA 3Q2DA 2BXZA 4M7SA 5HR7A 4TMCA 1PL9A 1JCMP 4PEEA 1BWKA 3CTLA 3W1UA 1ZHAA 3GNNA 1PHWA 4O57A 2G97A 4E2DA 3UY8A 3BCFA 1GTHA 1W31A 3P67A 3W2UA 4R53A 5DFAA 3WY4A 4AHPA 3UG5A 2X30A 3NPXA 1UA7A 1I8JA 2ZQ0A 3L4ZA 1TQSA 3W1XA 3IJ9A 2HS6A 1MW2A 4AF0A 2WPBA 5I0DA 1AG1O 4YLWA 5BRBA 4JTTA 1PS3A 3LHTA 4JTHA 4R33A 3DKLA 2O7QA 3LOTA 2V81A 1JFHA 2AAAA 2E5DA 4UTJA 3IIZA 1W9XA 3GBDA 4LT9A 1LORA 3A5VA 4M8UA 4FNPA 3BC9A 2ZX5A 4NI3A 2NSXA 4UTTC 5FEPA 1SFJA 3GXPA 3LCFA 4YXGA 4LC8A 2QCHA 2NX3A 1CPUA 2WQPA 1QDSA 3IEBA 7TAAA 3C2VA 4MJMA 4PEKA 3L2LA 4ZQMA 1JUKA 2R91A 3S0CA 4IMEA 4X9SA 1TTIA 1JUEA 3FEMA 5TBOA 2IGTA 2QCDB 5AYYA 2CZEA 4RK8A 3DFSA 4PSRA 4LS0A 1OF8A 2C19A 2ZRYA 4HHPA 1GVOA 4CCCA 4M6PA 4JS3A 4CCEA 3RLUA 1BF2A 1KXQA 3CGTA 4WXYA 4X9YA 3LHUA 1D3CA 4UR7A 4O52A 3FJLA 3A47A 1AW1A 4AF0B 4CKQA 2B0MA 1TMHA 3WFZA 4NJIA 5KZDA 2YYUA 3NEVA 3D50A 4PSPA 1H1ZA 3E02A 3NOEA 4UNKA 3DX4A 5D2WA 2RFGA 3ABQA 4EOUA 2WPGA 3ZO9A 1FDYA 4AIOA 3N14A 1MXGA 3G1VA 2NT1A 2TRSA 2I9EA 2Y7EA 2D0GA 2E9BA 3GXTA 2YIHA 2GVJA 1TQWA 1GVIA 2NX9A 3DAQA 3HMJG 1WOAA 1D9EA 1I45A 4CN4A 4GBUA 1A5BA 1OK4A 5F7UA 4JTKA 3JRKA 4PH6A 2QCGA 3S1VA 2CZFA 1VHNA 1WO2A 1SR9A 1W3NA 3N34A 5C55A 2QPUA 4HA1A 1PPIA 4UNIA 7CGTA 4XKYA 3BPWA 5I5RA 5LGZA 2JKPA 1IIHA 3WNMA 3I68A 2V3EA 3BAKA 1TSIA 1OHLA 1YLVA 2QPSA 3G3DA 1P0KA 4X3ZA 2XFWA 4O28A 1QPOA 3NO5A 4QM1A 2OMAA 3R12A 4Y90A 2A6NA 2WKLA 2BX7A 3OA3A 2EADA 3GB6A 1KBBA 1YXDA 4FNUA 1QPQA 1G4SA 3VGEA 4AYSA 3BG9A 3CQ0A 3RFAA 4MJZA 3ZWTA 2ZZ6A 1SW0A 3T78A 5CPOA 4FB7A 2ALDA 3VKJA 3GDKA 1TPC1 1I2OA 4MFDA 4FLSA 4MZ8A 3TV8A 3G1AA 1KTBA 3DFPA 4JDBA 4K39A 5TD4A 5K9XA 1OJXA 4N4QA 3BGJA 3HGSA 3WK0A 3DZ1A 1GOXA 3QC3A 4B9ZA 4FHAA 4A21A 3THQA 5I23A 4JYDA 1DJNA 2Q3OA 3AJXA 3W7RA 1TCMA 4E0CA 3W73A 4FNQA 5E70A 2CW6A 3UG4A 2CLEA 1OVDA 1E3ZA 4UOQA 2RHGA 2PWDA 3WEMA 1S5TA 2C16A 5J5DA 2VR5A 4PODA 1AMKA 4R7JA 5K2ZA 1LBLA 2QCEA 5FF2A 3BK0A 4HPXA 1IIGA 4XKYB 3WJWA 4A3UA 5J5RA 3BUDA 2QV4A 4RZ5A 3BSHA 3UEQA 3DHPA 3ZT6A 4FLRA 3E96A 1R2SA 1VFUA 1HL8A 3P8IA 1RP9A 1VGAA 3CT7A 3CZKA 3O8AA 3I65A 1JCLA 3DX2A 1XV8A 1XDMA 2X1UA 4UIOA 4Z08A 4HSOA 2EACA 2ZRXA 3TMLA 5DN1A 3M41A 3NQ6A 3KRUA 3W2MA 5LHEA 5BW6A 1UB3A 5CG7A 1Q6RA 3UPWA 1H1YA 1KWGA 1QX1A 3OG3A 3UWUA 4XUGA 2FYVA 4CQAA 2A4AA 3FAXA 1SMAA 4LQ1A 3B04A 3U6WA 2GJPA 3UWYA 1T99A 4JTSA 1RZMA 1KB3A 2HS8A 1GWJA 3O07A 3WNKA 1OGSA 3NL2A 1I75A 2A7PA 3L4UA 2FPTA 4JIPA 2DJLA 3TR2A 3LRLA 5L9FA 2VOMA 3EWXA 4PA8A 4N6EA 4YCOA 1FXQA 1S5VA 3NGJA 2VEKA 3W7GA 1I4NA 2ZX7A 2NZLA 3LX9A 1XCWA 2BY2A 4MOZA 3VMOA 2ZX9A 4GINA 2ZTJA 4JYFA 2B7PA 4GE8A 3NZ1A 1H7WA 4MFEA 4JCLA 3W22A 1U83A 1KCKA 1E51A 3GAYA 3SJ3A 1KGWA 1GG0A 3G0UA 1WXJA 4LVGA 4OE7A 3ATYA 5C5YA 1QI3A 1UCWA 3FKKA 3PSVA 1ADOA 2QJHA 4UQEA 1IF2A 1KA9F 5U7SA 1F2JA 4BI5A 5CSSA 3A22A 3ANYA 5G1TA 2F1BA 3LCLA 4M56A 3EDFA 3W7EA 5HWJA 2D3LA 3LTYA 1SO5A 3NQ8A 4A2SA 1FDJA 1LROA 4MYAA 2JGYA 1CXFA 3KVJA 4ML9A 1BLIA 3G1SA 4H6KA 1WZKA 1SZNA 4HSNA 3L21A 4ONVA 1WPCA 4OV4A 4UTWA 4JTGA 1T0OA 2DZXA 1BAGA 4TU1A 4MVAA 2I14A 2FGZA 4UFMA 5AHNA 3O1NA 3LRKA 2YZRA 1UD3A 2NV2A 2OW6A 1KXTA 3UZJA 5K4ZA 2DZWA 3G1FA 2F7OA 1OG0A 2WV8A 5KEZA 2Y63A 4U2ZA 3II1A 1UASA 4IJBA 1VPXA 4J3TA 4RX0A 1RVGA 4XBKA 1ZAHA 2OT1A 3VSVA 2QUUA 1LWHA 3EDKA 1OX4A 5KSWA 3A5FA 4N4PA 2JGQA 1RR2A 3AMKA 3CZEA 1EIXA 1SW3A 5MHBA 1MZHA 2OSYA 3W6YA 4O54A 2E6DA 3BAXA 2E8ZA 5F4WA 1F6KA 2FHFA 1VZWA 4O1DA 3DFQA 1R33A 2JKAA 3VMPA 1E43A 3G8EA 1X6UA 4FXRA 3WJZA 3V1PA 1ICPA 3VX1A 3BW4A 2ZTKA 2CZDA 4FLOA 3M16A 4RR4A 1FUYA 2EABA 1UBSA 1TCDA 4CQ8A 3W1MA 3TKFA 3UWVA 3T7VA 1QW8A 4J27A 3ZFHA 2B7QA 3GYEA 1DQXA 3MHFA 1DOSA 3OVRA 1G7UA 2B7NA 4K8EA 3YPIA 3OLIA 5FF7A 4ORIA 3BLEA 4Z1CA 3BLKA 4HIBA 4GNJA 3ZOAA 3G8RA 3OBKA 4QSHA 3TQ0A 2Y7FA 4CNNA 2A6LA 2VFFA 4CNPA 3GNDA 1GCYA 4UTTA 1UKTA 1MXDA 3O05A 3THAA 3W7KA 2EKCA 3LV6A 3QGVA 1EB3A 2ZWZA 3P82A 4JFTA 3BW2A 2C0AA 2ZBTA 3C2FA 3BGGA 4NJGA 2GQ9A 4WSJA 4LTSA 1OX4B 4OHQA 3QH2A 2BTMA 4OWGA 4PFMA 5G1YA 1OFOA 5D2TA 2W79A 3FFSA 3C0JA 3W72A 1DVJA 4QAIA 4PCTA 1P5BA 2RH9A 3RF9A 3TH6A 4DQWA 3S1XA 1SO6A 1DJQA 1CXHA 5DCBA 3NQ7A 4O17A 5HWNA 3BVVA 4UTIA 1U30A 2GQAA 1JCYA 3KOFA 2X2IA 3UD6A 1L6SA 2E1DA 1NFBA 2H90A 3DC0A 3EWWA 3TUUA 2C8NA 4AWUA 3RILA 5G4EA 2A5HA 3M7WA 1G6CA 2A21A 3HO8A 3M0ZA 2YA1A 2V2DA 4RKAA 4O11A 2J25A 2ZXAA 1QHOA 1AK5A 6TIMA 2YGYA 8CGTA 4IX2A 4TVUA 4KWWA 6TAAA 1QHPA 1SSDA 4RCXA 2DZUA 4HNUA 3LPOA 1JUBA 3EWYA 3AMLA 3SSJA 1XSIA 5D03A 5AC6A 1TQTA 1R34A 1F05A 1V3KA 2J24A 3HB9A 3B06A 3MI6A 1GYLA 1HG3A 5C6MA 1RPKA 3MW7A 3HG5A 4JTIA 1QW9A 5DY2A 1CGTA 2Z6JA 3W86A 2FHCA 3M44A 3N2XA 4KMQA 4J28A 3WY3A 4FX8A 3LERA 3PM6A 2NUWA 5FEWA 3EEGA 4ATWA 3EJSA 3UY7A 3PUDA 1NOFA 4HOXA 2C18A 1G7VA 1BSIA 1DHKA 2TMDA 3TJLA 3CPUA 3ZSTA 1KFKA 3P61A 2P1FA 4HT3A 1FXPA 4S1FA 1IXNA 2VEPA 3ZR4A 1VFMA 2QKFA 1I2NA 3L0GA 3EDDA 1ZENA 3L5AA 2WVVA 2E6AA 2NLIA 1XXXA 2X1RA 3WK3A 3WNOA 5A6MA 1FCVA 4FXSA 3H54A 3NM3A 2NX1A 2YSWA 4L4LA 1H7OA 1ZFJA 2ZUVA 2QDGA 4IMDA 3W7NA 1QPKA 5KTLA 4QJ1A 4Y8FA 2EEXA 3BAIA 5TQLA 5CZJA 5D2YA 4JFUA 1DKWA 4HNNA 3NQ2A 3TAOA 2TPSA 1EHAA 2HTMA 4O4VA 2E0PA 4H4IA 1LOQA 2FPVA 1ZNNA 4ZQOA 1K8XA 2GVYA 3MO7A 3HG2A 1UUMA 2F18A 2FHBA 1KM4A 3O63A 3P8JA 3SIZA 3QPYA 1TTPA 2YX0A 2YW3A 3ZQ9A 2GUYA 2PC4A 4LY8A 4CCDA 4OJYA 3GTNA 2Y85A 4UCFA 5H2ZA 1M53A 1IXQA 1OB0A 1VH7A 1ONRA 5HINA 2X2HA 3BLPX 4GI6A 2P0OA 3P60A 2Q8LA 4X0NA 4LV4A 2YFNA 3WK2A 4ZQPA 4OIFA 2BWGA 2YJQA 4AMWA 1THFD 3LHZA 3KL3A 1HX0A 2WVVB 4CGTA 3QEZA 1PJ9A 2ISSA 4AAJA 3M47A 1NF0A 3PUOA 3STCA 1C9DA 3BARA 1V3JA 1L6YA 4XZ9A 1TRIA 2XIBA 5CGTA 3HJEA 2EAEA 1R2RA 2CLIA 2G3NA 1EP1A 2C6QA 3SGUA 2F7QA 4I7UA 3W7LA 4GUGA 1JL8A 1WP6A 1KTCA 1C29A 2W6RA 2C3ZA 3BLBA 4H3DA 4GUFA 3TCEA 1VQTA 3L0NA 3LCIA 3BVUA 3L68A 5CZTA 3PBVA 5LSMA 1OFAA 3UYCA 3JR2A 3OVQA 5K3VA 3LHYA 1B3OA 4S2BA 1FWNA 2GQ8A 5LHFA 3RMJA 2ZZ1A 1XUZA 4KFOA 1NAL1 3USBA 2XN1A 3KL5A 3LCXA 4AWSA 4NUWA 1GVRA 1XDLA 2QCDA 1ZJAA 1FCQA 4O10A 1L2UA 1X1ZA 1RP8A 1JGIA 4Y96A 3M5ZA 4NNBA 1VCFA 5I3IA 1VJIA 1CXIA 3DHDA 1WDWA 3TMQA 3WFAA 2OT0A 2R14A 1JXJA 5DELA 1BVNP 1GVQA 1FWRA 3W07A 2FJKA 3PAJA 3W37A 3CZNA 4Q32A 4X2RA 1KGXA 4DF0A 4JD4A 4LS1A 2DZTA 4NJKA 4PL1A 4UMAA 4LV9A 3PULA 1GQNA 4J3VA 3V75A 3TXZA 2R94A 3RLVA 3L5MA 3R8RA 3MHGA 3IIVA
chains in the Genus database with same CATH superfamily
4X98A 4XAWL 3OBEA 4P9ML 2VQ1B 4WFED 4J3WA 3D0AA 1OGBA 1WCBA 5JR1H 2ARJQ 5GZOA 1CL7I 5MENB 3AU6A 2KQMA 5F9WC 3NIGE 2F0CA 1HVQA 5REQA 3VIFA 2V2HA 2R7EB 3DSFL 4PJXF 1WFOA 5E95B 4DN3L 3ZE1F 3W7IA 5I1CL 3D33A 1KB5H 5LGJB 3QRGH 2XNAB 2CIPA 3WKPA 1CIUA 3QUMB 2ZWLT 3KHQA 1MDAA 4XVJL 3BUQA 3TEYA 5HD8D 3QO1A 3U1QA 2WXQA 4LUJA 4U1LB 3WTYA 5HXMA 4PRDB 4DAGH 1X1OA 5H1WA 1HJWA 4V2BA 4IU2B 4UILL 1J8HA 5B39G 4O16A 4KPHH 2PBGA 5F2MA 4DO7A 1YY9D 1Z3NA 3HCVA 1SM3L 3ARTA 3VXNB 1HEHC 4F48A 2HG5A 3BIKB 5HBBA 3UG8A 2CBUA 3KBWA 3TIEB 2CUAA 2FMNA 1B2YA 1NF7A 4FJ6A 5E08H 1FL3B 3R7QA 3MV8D 1GVYA 4XB3A 4G7FA 5BZZA 3O6AA 4D9RE 2CDGB 5FAJA 1E73M 4RDQG 3OYZA 1SMOA 2GAZB 1LWJA 4QCEA 1G1CA 1RQHA 2QVKA 3SGDH 3FK3A 2GK1B 2C34A 4LSUL 2WO3B 3B3DA 4E68A 5D6DA 1ZLEA 4IMAA 4MWFA 2OQLA 3UNDA 2CD0A 4L1LA 3DDFA 1F07A 1JK9B 1LMKA 2MTAA 3MRPB 1MPAH 2AQNA 3CNKA 1KYUA 1S7QB 4XHJD 3G6AA 3VSQA 1N55A 3PNZA 2CCWA 1XS2A 3VG9C 2IQ0A 4ISVB 1GW6A 1Q8MA 2H2SC 3DPBB 3VZYA 7REQA 4M6OL 1ZP4A 2HKHL 3BEWA 4BH8B 3QYSA 3K4WA 4E42A 4PJXB 5KZ6A 4HT1H 2BJML 2L7QA 3RVWD 3HNSL 3LB6C 3LEXA 4ELMA 2HJLA 2VC2L 3WTUA 4UOZA 2ZOXA 3TTQA 1EPVA 2H6PA 5DT5A 4PJ7A 3MNZB 3UTSA 3OZLA 3TT1H 5T9BG 2X38A 1R5VB 2ZOOA 4JVPA 4DUOA 1T66C 5CZXC 2ZICA 4XH2A 1I4FB 2HPMA 4INFA 2BOGX 4NZCA 4LW7A 1WB0A 5E6SB 1KB5A 2WQSA 4XD6A 1CFTB 2WXRA 4BF7A 1DHPA 5FK9B 3NTCL 3MX0B 5J9PB 3H4XA 2OOFA 3D69A 3W24A 3SPHA 4F1SA 1YY8B 2YD1A 4AY8A 3D9AH 2B7DT 2Z34A 3DH7A 3QWOB 3S1WA 3GSXB 1U33A 1GTFA 1OP3K 1B9KA 1MYRA 4LT7A 2OMVB 1H4PA 3BKMH 1A25A 2PAJA 4EXAA 2IH3B 2VRAA 2Y2YA 2Z3FA 5HTSA 5C0CB 1YEIH 1S2CA 4A7UA 4IXHA 1QAWA 5D1ZC 3O15A 2BNUA 1XTMA 5ECGA 1CCWB 4ZB5A 2OSXA 1LBFA 2A83B 1T1WA 1VHPA 1VZIA 3KBEA 3L3HA 3WJJC 1U1HA 1RV6X 3QE5A 4XNZC 2Z91B 3GJFB 2NUXA 3TVMC 4CNUA 3QPKA 1ACXA 4NQCB 3CT2A 4W86A 5F0JB 4WY0F 5BQ7A 3RLHA 1E27B 4DHLA 43C9A 5C6WH 4Y16D 1NL0H 1J5HA 5E2WH 2WXPA 1P9MC 3ARWA 3ZIYA 3EWZA 5E4EC 2YD0A 4I13B 2I57A 5KG9B 2Z6IA 2NZ1A 1PO9A 4MCNA 3NNTA 4PV1C 3SSZA 5L0QB 3CJJA 3UR2A 5ERWA 3ZM8A 1K2DA 1UQSB 3LUTA 2GSIB 5AVWB 1GGBL 3BD3A 4JRXB 3VXRD 2CHZA 3W57A 2YLAA 3FO9B 1KLYA 3OM3B 5IB1B 1SW7A 3MLUL 4BFKA 5B8CC 3AG1B 3EF4A 5DWUL 5CEZD 3DGBA 3OODA 3M1OA 3GTXA 2YO3A 1W8GA 2CLKA 3CFUA 1J4EA 4QXUL 4IOSD 2DKSA 1TJIH 4UTBH 3VXME 4HJ0D 3PNWB 2NY5H 3QAQA 3OB0K 2FJFA 1FVCA 4JKLA 4NWTH 4TVPH 3GLCA 1E6QM 3LPPA 3B8SA 4YHPA 2HFGH 1CYWA 1DTNA 1XR2A 2E7CA 3JV5A 1IC7H 3GIYA 3LH2H 3MKCA 4ICNA 4LLMA 3E2QA 3TA4D 4JPVH 4JM4L 4GMTL 3FSTA 2EHHA 1A1MA 3WUWG 4WY0B 3W5NA 1CWVA 1NJ9A 2WQXA 3RIFF 4R7WA 1Q9LB 4JCMA 2APBA 3VMNA 4LCCB 4WK9A 3EIFA 5GS0D 1EEZA 1JRHL 4Q8TA 4RIRB 3RM8A 2B1OA 2EPMX 3DTXA 2IPKA 1F6AA 2HKFH 1XJBA 4MQTB 4XNQA 3MCLL 5KITA 3EYUH 4ELKA 3WNLA 4G5ZL 4H7ZA 5CC5A 4QRNA 5IQMA 3U4FA 1ADQL 1QSFA 1YYMH 3RUGF 2KQNA 4RDVA 4MUPA 1RJZB 3MV8B 1V0MA 3B4NA 3DXAA 3PZOA 4XBPA 2BWIA 2J7CA 4A2MA 2QEJA 5I0XA 4XPBL 2ORBH 5IOKA 2XFXB 3KJ4B 1HNGA 5A8PA 4ZOAA 1MEWA 4ZQTA 4FXGB 4KDWA 5KAQG 4DJFC 4LUTA 2GJRA 4NFCA 4UB9A 4QG8A 2ZNWA 1G7HA 5CXPA 3IVKB 1CB7B 1BKSA 2AXJA 1S5WA 4AH2B 5D5MF 3GSNH 3CC5B 2CBVA 3STZA 4FKKA 1SJHB 3A3HA 5CSZA 4N0UA 1XHGA 1F0LA 1IGFL 5AVRB 4AG4H 4YL2A 3T9WA 5DRIA 3SZ6A 3UAJD 3WO4B 1MRFL 2COVD 5F2GA 2WINB 5HULA 1BD2A 3CCHB 4Q9RL 2D3VA 3W39A 1ZMYA 4XBEH 1RSFA 2WN2A 4MS8C 2OQJB 5E6ID 1LDSA 3LN5A 1ZAGA 3H2MA 1G1OA 4Q4EA 3TOPA 5HMSA 2BIPA 1K72A 4LHQB 1O12A 1A7RH 4WTWA 2B59A 3ABLB 1WCQA 4F7MB 3IGAB 3JV0A 2VC5A 1L0XA 4Z0XA 4HPOH 1OIFA 3VOIA 3OQEA 4FG0A 1CGYA 2IFFL 1D7DA 4PMOA 2XFRA 3UJJL 3Q67A 3FHQA 5D7IE 2VURA 5FB8A 3IDXH 1FWBC 3W3OA 3RUGB 5EORL 2ZP8A 2WNZA 4ZAKC 4MXQD 1A2YA 1KLFB 4P8VA 6PTDA 1FFNA 1A5OC 4RV8A 3BJ91 3DX7A 1D9KC 5JXAL 2ZOWA 3LY0A 3F7YA 4Q52A 4TLUA 3P9MB 4HG4J 3NACH 5EMKA 4PL2A 3T8QA 1TO3A 5GQBA 5BXPA 3KS0H 4FQCL 3THCA 2X1XR 4N42A 2WLKA 4B9CA 4G7SB 4IGNA 3NA9H 1E4IA 2GC4C 1V79A 2DQUL 2K7PA 3VI2A 4RAVA 3TJEL 3KAOA 3EOEA 4LF3A 3JVGA 4KMTL 9RUBA 4G8TA 4FA6A 5JNYA 1Q94B 4YHIB 1ZLWK 1A6WL 5EA9A 2YEVB 4A7GF 3BDYH 4UXDA 5E7BA 4E8DA 5AUMB 1ZEAH 4Q6IB 5CR1A 3TC9A 1ILSA 3W7OA 4Y8EA 1AKJD 2VKXA 1M71A 3EGJA 5MKGA 3KM1A 3NFPB 2QZRA 3AM8A 4UQAA 2CSPA 4Y16B 3QISA 5MEQB 4PJDA 2P49B 1WBZB 2CXEA 2TYSA 5MP6H 1NKGA 3TJHD 4YIWA 1CLZH 2J5LB 1PY9A 3SDDD 2BXYA 3W2NA 4MA3A 4DXKA 2CHOA 5H37A 3P6LA 1BP3B 3EX4A 1CF8H 4UWQB 4M6UA 1J05B 5FI8A 1CZ8H 2NXIA 2X2JA 4Y1AE 1PQZB 1NWSA 2H6RA 1B0RB 2ZZUT 3NABL 5C0IB 4PJEE 3R79A 1NIFA 5CD5D 4LSPH 3VXRB 3SYCA 4CNOA 4GT7A 2WYIA 4NQQA 5C09A 3U4BH 3SGZA 4L9DA 3VO0A 1VC4A 1NAML 2XVBA 3QXUA 4S0SD 3U2IA 2QUTA 4XWGL 3SCMA 4JFXA 3P62A 2ZUSA 5DHDA 4NUGL 1ZPTA 2V0AA 4HPGA 3N1PC 5GISH 3MUAA 2NYYD 1EQCA 3EH1A 2WSYA 1G4PA 3U9UA 4M8QB 5D1QD 3WD1A 2VDLB 1UR0A 5CSBA 3KXQA 1Q0YL 3PG2A 4OM0L 2WO4A 1HSBA 1OPOA 3NOYA 2O5XH 1OK8A 4BGDA 1KSRA 1FH5L 4HQQH 5MERA 1XCFA 1P0NA 1XAUA 4LOFA 2XETA 4RLDA 1FHGA 2MRYA 2BP8A 4WD0A 1IT8A 3N2JA 4F9DA 4RE3A 2FECL 4E9WA 4IRSA 3UU0A 4XX5A 4H1ZA 3Q3GA 3UMTA 3K6FA 1G0CA 2XPYA 1UB6B 2WUBL 1AXTH 1WT5A 3MLVH 4F3HA 3JQOB 2Q87A 1CDUA 5JH1A 3W29A 3BWSA 1I8JA 5D4IA 1TMLA 1DCEA 1FL5B 3GHEH 4HU4A 1ZPUA 1XH3A 2FO4B 4LFHG 3V4PH 3GJEA 2CR6A 3LQAL 3NIDF 4PHXA 1HSAA 2NNAB 3EOAA 4PRTA 3U0HA 3JZ7A 1ACZA 2JKNA 2I9LB 3CAWA 4N8VB 2OWCA 2VM9A 5JHDA 4W70A 3EUDA 1EDGA 3TM6A 1G7LA 5CZVH 3ZE0E 4ZUVB 4L6OA 2C3HA 3HI6L 3T3ME 3Q4DA 3V4VH 2VERA 5ADPL 5IBUG 2LVCA 1EEUA 2CHDA 4NNYB 3Q2VA 2ZRYA 1IR1A 5IW6B 1VBGA 5IIEA 1FVDA 1D3CA 1FNSH 3WFZA 5KZDA 1GKPA 4WJ8A 3G5ZA 3R0NA 3TIDA 3G1VA 1GVIA 3DAQA 4X50A 1UZDA 5CBAB 1OK4A 1JWUA 4PH6A 3FO1A 3KWUA 5DFTA 5CHNA 3KGTA 5LGZA 2D7NA 4JNYA 2V3EA 3ECVA 2EIKB 4O28A 1DQQB 3VJ6A 3MC5A 2D2HA 5DJDA 2K6ZA 1X5FA 4D9LH 2ADJB 5IZ7A 3E3HA 4AMKL 1YN6A 1A3ZA 1DQDL 3RAJL 3K81A 4NBXB 4JM2C 3PJSB 3DZ1A 1TTCA 2YAMA 3W7RA 3QFDB 4JFHD 3CZJA 4UF7C 5E70A 3UG4A 3ZLQC 2W92A 3QQNA 1S5TA 2C16A 1B3VA 4A3UA 3ANVA 1XF5A 3JWDL 4GBXD 2X4SA 1VPOH 3U7YH 3RGBA 3P8IA 3H3BC 1JPHA 3GR4A 3KLAA 1UT9A 1SYSA 3QHTC 4E41E 2JKJA 3PJLA 5BW6A 3FCBA 5DJ8A 4RGMC 1EFQA 5E6IB 3BUYA 3J07A 2YL8A 1JWSB 1YNQA 3HS0C 4C8XA 3NIDB 1R7OA 4B2DA 1VKXA 4JZJB 2PYED 2A9DA 5F9OL 5D7EA 3SY6A 2QIWA 3BRFA 3MOAH 4XP4H 3SO3C 4MOZA 2ZX9A 4DJDD 3PAOA 3DETD 5DWPA 5IW3A 3GAYA 4Y9OA 5B38G 1TJMA 4AY7A 3GS0A 1IF2A 4XZUB 3CH8A 5ISZE 4WKAA 1FJ1A 3NPZB 2WLLA 1H0DA 5G1TA 2VGIA 4UMGA 1IJNA 1ODAA 3VKCA 4W68A 2XX0A 1NDZA 4HSNA 4JTGA 3DSNB 4P23A 2QTEA 4UT6A 5DMGC 3LRKA 4KK9C 2P8BA 3GHPA 1KXTA 4ODXA 2LU3A 4FAMA 3T4AB 2ON3A 2FBJH 3W3BA 3IWPA 2BIHA 3IF1A 1KIPB 3TQPA 4IF2A 1UGKA 5FM4A 1RUQH 4C47A 2GJZA 4GZ7A 2PS2A 1IGTB 3OJVC 1NOLA 2W3ZA 1W9UA 3L7EA 3FQNA 1XGTA 2KH2B 3FMGL 3ZHFA 4AYFA 2NR6A 4FXRA 3S1GA 3HNTH 4NUQA 1A6VH 3V0VA 3SE8H 2F15A 3SE4A 2VVSA 4O02L 3IJEA 1TFHA 5D8ZA 5LB1A 2OA9A 4UTTA 2RCSL 3P82A 4KUZH 4G42A 1RJLB 1W0VB 4F15C 4OWGA 3JUGA 3IUIA 4WFFD 1AKJB 2MTPA 2DYSB 2WLZA 3RF9A 2HUHA 3EGDA 3CMGA 3HPLB 2PLTA 2Y3AA 2NY7L 5T5NG 4G43B 4ZO7A 1OD7A 3SDDB 4L9LA 4ZUTB 5EIIA 2ZXAA 2OMWB 4ZTOH 6ENLA 3IDIB 2F6UA 5IB5B 3ML8A 3LPOA 5D03A 1GYCA 3BWAA 3DTDA 4XP9H 4OD2B 4MJIA 1BBJA 4UDTB 4OUIA 4A7TA 4JKWA 3I75A 2R0WL 1HEZA 1I1FB 5AOIA 3S6OA 4NQXA 1OTSC 1NBQA 4F58H 3LKSA 1B0WA 2BVPA 3DG6A 1UXLA 2VE6A 3L5AA 5IFJA 4KKPA 4M43H 4X61A 1S9XA 3NM3A 3W7NA 4X42A 1BOGB 3D05A 4FF9A 5IUCA 4IQHA 3FUIA 4I1PA 2FCBA 5DUMH 5D1QB 1FZMB 1DVZA 4H4IA 1K8XA 1XP3A 3BD5A 2Q86B 2DUAA 4FZIA 3STBA 2YUZA 4ZJ9A 2ROYA 1X39A 1FG2B 3ZQ9A 5EIVA 2VLLB 3WTTA 3I3BA 3NO3A 3BLPX 3CU7A 4EF3A 4WSHA 2OMTA 4RMSA 4JJ5A 1RZJH 4OD3L 2BWGA 3GZPA 5HYJD 3QULA 4ZW3A 4L9XA 3VFMA 1V3JA 4G7YL 3CK5A 1D5MA 3WIHA 4A7VA 1XBDA 2MPAH 5FUOL 2A3CA 4JQ3A 1X4XA 1PWMA 3KJ6L 2Y1AA 5K3VA 4HFUH 1OAKH 4KTDL 1XDLA 4XO6A 2FGBA 4E9SA 4ETQB 1IKNC 4KEUA 1HXMA 3MCKB 1I7ZB 4N9OB 3BWUC 3PTDA 2AJYH 3WIFA 3OGCA 4J3VA 2HVJB 3MHGA 4KXAA 1IEVA 1OF6A 4HJGA 2XIJA 2HBVA 1E67A 1ZS8B 4N90D 3PZMA 3LI1A 4RNHA 1RALA 4G83A 1ZDSA 1NCBH 4BZ2H 1HAWA 1XRTA 3HU7A 1J9YA 2DQEL 3JWNH 2CHWA 4QITA 3DHUA 3TF4A 4WI0A 2AV7A 2O5ZH 4NRXA 3UBXI 3L4VA 4XVTL 3D2UA 3JVGC 3PUUA 1V6YA 3RBGA 3AICA 2ESVE 4TNGA 2XIOA 5CPQA 3ESUF 3SUWA 2H26B 2ESCA 4AV0A 3S5NA 3UETA 3AM8C 3UBGA 3KRBA 1EEPA 4Z3HA 3RJQB 2R15A 4AJVA 3V5CA 1Z3GL 3DUUA 3T05A 1IT7A 1JPGA 1NMBL 3QF0A 2DLTA 3QIWC 2F19L 3L17A 4P5KA 4JY6A 5B3JE 5T1JA 4IZGA 2YAFA 2KMWA 4LO9A 4BFBD 2VN4A 4OTKA 1P7QA 5B1JA 1V6XA 3N04A 1V7YA 3LA4A 4GBXB 5GGVL 3PAYA 2PGEA 3AI0A 4ZMWA 2JKSA 4UZGA 3ARBA 2EDJA 5AVHA 2FVLA 2ISVA 1FNGB 1A50A 1FF5A 3ABMB 4N2YA 1A4BA 5HQMA 2AOSA 2A9ML 3URQA 5FYLL 1TV7A 4O13A 1CT8A 1BYBA 1M56B 1DWGM 1MVYA 4IUOA 1PX8A 3Q1SH 2PYEB 2B7OA 6PAZA 3QI9A 3CZUB 4AY1A 3RTLA 2XC8A 4DQOL 5FJJA 4R97B 1TJ1A 3R0KA 2LAGB 2E4TA 4IOIA 4YSDA 4LCSA 4REQA 1SVBA 2D3NA 3PP4H 2EXWD 1OX5A 4OQVA 2M26A 4V1DD 3ZZ1A 1WYIA 4QGCA 5FO8A 1WKYA 4POZD 1F4WL 1MELA 2OXNA 3SGGA 4FQJH 5KZMA 2ZYFA 4IKIA 5JIQA 2F53A 4NGHL 1B3ZA 4HIHB 2XN9A 5D33A 4QXTA 2WLIB 4U3SB 2FZBA 4V33A 5IM51 2IAMD 3ARDD 4D7BA 4IRJC 4NQ1A 4HJJL 5I3FA 4DX3A 4KXZH 3MBDA 3JS3A 3OG2A 1UACH 4WFHD 3TW7A 5DXYA 3G6MA 4DGIL 1GHFL 3DV4A 2VDOB 3MMEB 1K3UA 2X9ZA 3BUBA 2HTKD 2Q7YB 5IB2B 3N42F 4AQEB 2XH4A 2P5EA 2RGMA 1YHTA 3IU3A 4AISA 3LI0A 4NC1C 4J40A 2EE0A 3VI3E 5FF4A 4DO6A 3UESA 4AQ8C 1A5FH 4OY9A 4KJWC 1XCTA 4LB3A 3A4WA 2VUOA 5BMFL 4CN1A 5DHYA 5AAPA 5DZAA 3MLYL 1V7ML 1MSSA 5DFWH 3BTNA 3JV6B 5FOBB 2V5YA 4ZNEA 1JPSH 3PWPA 2JJTC 5KS9A 3PL6A 4IBLT 1KM6A 2CHRA 4JPKH 4CVXB 5F7YC 4B5ZA 3IXAA 5E5UB 4HALA 1N8IA 4FTDA 4ZW8A 3PWVB 4JCWA 4OFQA 3G08B 1P4IH 2AXWA 1XQLA 2WLMA 4C56A 2XXGA 1DXEA 3FTYA 2CAKA 1DQML 4LNYA 1T7WA 1CYXA 1CLCA 1I60A 1C5CH 4OECA 5GJNA 3LHAA 3MJGX 1HOCA 4CBZA 1Y0EA 1M9HA 4OV6F 1EF3A 4JANB 3HC0B 3I9PA 4Z0SA 3DX6B 2HZGA 3W1RA 4OUUB 1Y6MR 1KELH 4PD4K 2Q3XA 1E40A 1TO5A 3GI9L 1UYWH 5DT7A 3VNDA 1KBLA 2DJXA 4OV5A 1IKFL 1J93A 3L3OB 3QFEA 1P7BA 4HK7A 1HWGB 1K02A 5I8OH 2G5BB 2FWUA 5FO9A 2QSCH 3LSOA 5C1MB 3TNMA 3KMDA 4FYTA 1A66A 3CUXA 1TJ0A 2GJ6E 1KT2A 3G9VA 1AGFA 3CLWA 5C0AE 4F37K 4PGDB 3N42B 2ZDSA 3RIKA 2QMJA 2K8MA 1U22A 4MB5A 4DZ8B 1H6UA 1KFGA 3AREA 1DQIA 4AYBA 2AJZA 1MNZA 5LNWA 3BPNB 3THUA 2XG4B 2QHAA 3IIPA 2BY3A 1XLLA 2O92A 1FPTL 4PWIA 4AE0A 5T1KD 3ESOA 3ZTNL 4Z9KB 1GMEA 1HO4A 2CO6B 1M6OA 4GUCA 2IS7A 1YPFA 3GUGA 1UC5A 2PYFA 5F7EL 4LSTH 5I6XB 2JJSC 4NQDE 1X9LA 2PCEA 2VJ0A 4M00A 1EUNA 4OR1A 1ZJHA 1CTMA 3RTQC 2WXDM 2NQ3A 3FUMA 3QZOA 2VMEA 2GCYB 2QT3A 2C1OA 3N1AA 1RQ5A 1YPIA 4DLFA 2Y1ZA 1D2PA 3RU8X 1AO7A 4B5XA 1KBIA 3P2BA 3HR5B 2XDHA 5FCZA 4LUYA 2ANUA 4OLVL 1NDMB 1FP8A 3LNEA 5E8DH 3PPEA 3S48A 4N2HA 4QGTA 1UT1A 4HG4K 3ZS4A 4RA3A 3ALFA 4Z5RB 4M24A 3MJ8B 2AI0H 4HKXA 5EBWA 2TODA 4Y4FC 3B2VH 4LC6A 3BLIA 4O0QA 4P7OA 4WQ6A 2BCMA 4FNTA 1YJDL 4XVUD 1T0NB 2DTMH 1GYVA 3P5ZA 5I16A 5E9AA 4DP4X 4IKLA 4NKDA 1GC1H 1RVFL 2Y1HA 3OKLA 4LLWA 1I9IH 2CDEA 4FNSA 4C58B 1AW5A 4DW2H 3H9SD 4NZDA 4UIKH 4CNIA 5CN3A 4G2DA 3LYRA 1IBZA 4MNQA 1T03H 3QTPA 4KCVA 1VJSA 1BW8A 1G7JB 5F6IB 3BQ5A 1ENUA 3AABA 3J8F7 4LQFH 2FFIA 5LN4A 4ALAL 1U2HA 1HQ4B 5D1ZA 1A7BA 2H7WA 2A85A 3BPLB 1YZZA 3NGBC 1RH9A 3MI2A 4YNYB 2QELA 3CUPB 3PUEA 1A22B 1O4UA 2HX8A 2GITA 4HKBA 5HYSA 1XO8A 3WJJA 1S9WA 3TVMA 2EG8A 2V9UA 1HCYA 4ONGL 2A2IA 5DO8A 4I4WB 4LCWA 1EH9A 3S5LB 3R89A 1CLXA 3S6TA 2CKBL 3EJYD 3K4AA 4XC3H 4MMZB 3UGUA 3WU1A 5D7LA 3SGEI 5JQHC 3FCTB 1P9MA 4DVRL 1YDVA 1HZHL 4CMMA 4V1DB 4POCA 2PZNA 5DSCB 4ZOEA 3MRQA 2E47A 4M7ZC 1R85A 1SLVA 1P43A 4L8SC 3EF7A 3NPWA 1YTKA 3WY1A 3UC2A 4IS6B 4PS4H 3WF1A 1PEZA 3N11A 1GZHC 3OHXB 1MQPA 2OKOA 2VZ1A 4FHJA 5B80A 3RO6A 1P7TB 5D02A 3NAVA 2VW4A 5I3GA 2WLJA 2DF3A 5E1IA 3T0TA 5A6LA 2IAMB 2OI9B 3ARDB 4NY2A 1AGCA 4JTCA 2YCJA 1FO0L 2X70A 3ZRFC 2E9IA 3S36L 3IJHB 4BFJA 2HVKB 1AI1L 4YDJB 1GPOH 1BXXA 2Z2UA 2CESA 3CU2A 5B8CA 5D70L 1KIQA 3PGDB 4ZYKA 2H1PL 5DDHB 1KQYA 3PPGA 4Y19A 1AL8A 3IMWA 1U8LA 2DSVA 3DERA 4ABWA 3NESA 3TVAA 5JOEA 1XWVA 1WWAX 3NFUA 4Q74A 1G7MA 5T3ZD 1IJ9A 1TF4A 1IC1A 2YCEA 3E8VA 1OB1A 3HOJA 2DM4A 3BISA 1VFBA 1FVPA 1X5LA 4D6EA 3HMXH 3RWIB 2B31A 2OWXA 3GBMH 2CMRL 5AQ0A 2EXTA 2NSMA 2YOAA 2PCFA 5TAOA 1TZ7A 1HTYA 3G5VA 2A9AA 3RJYA 4X9GA 3C3UA 2Y7QB 3BOLA 4NF7A 1P5VB 1CICD 1JAKA 4QYOB 2YFOA 3DOPA 4PRBA 4YK4B 2V33A 5HJLA 2CWXA 4LEEA 2QFRA 2MOGA 4QDPA 1C9SA 5DK0B 2CR3A 2JKTM 1TB3A 1FP9A 4YQXH 1JZ2A 4ROPA 3WKZA 3VB8A 3OBAA 3HFML 1L5GB 1ZVHA 2IDCA 1GPFA 2WMFA 4GAYA 1MFBH 3IAPA 3MRKB 5FM5M 1A3LH 1FLTX 3HI5L 2YQBA 3PF3A 5FJOA 1D7KA 3TJXA 1DJYA 4FAAB 3D0VB 3V4UL 1XCXA 4RW5A 1XF2A 2HVNA 5IMMB 1L9NA 3V6ZB 2WZPA 5KYYA 3PB2A 3QMTA 3HMWL 4OCXL 3MHUA 5EBLA 3GXDA 4GRLD 3UJIH 5B22A 4RFEB 3GIVA 1EBGA 1GT8A 4QGYA 3WSQL 2QUVA 1MSPA 1HJSA 1PEWA 3QA3B 3K7UA 4NO3A 1RIUL 1U8KB 4N2EA 2NWRA 5A6IA 1GSKA 1BFOB 4C1LA 4M1DL 5EU3B 5LA0A 4F4RA 1NCJA 2ISWA 5ECUA 5BROA 2PCPA 2PP7A 1HKKA 4AD2A 4DJFA 3FQXB 3R0MA 3KPSD 4IBZA 1INEL 3WHE0 3O8XD 5KSUA 4E4UA 2IKGA 1OYBA 1J12A 3LKNA 5A2JH 3I02B 4LE8A 3ULSA 2VXTL 5LUMA 4NC2B 3H8AA 1H19A 1S9KC 4OD1L 4EK7A 2AXGB 2JQAA 5T1KB 5A5WA 3KPMA 3F64A 1GOKA 5FKAA 2YD4A 3F4NA 4XBJA 2Y36L 4BHUI 3NCFB 4AMAA 1GS6X 3IKCA 5IHUH 3IJ7A 4KY2A 3UO1L 4AZ8A 3DFYA 5T1MA 1MG3C 4K7PH 3VQLA 1QLFA 4NN6C 4ODWB 3WBYA 4MA1B 1DQVA 4ROQA 3AZRA 3KP1A 2X5PA 1OP3H 4TVCA 3HMXA 4O57A 1A6UL 1P6BA 3BHBA 3TN6A 1BQSA 1YEWA 3WY4A 1BAFH 3V5KB 4NNXB 1EYEA 3RPIA 1SEQH 2N1TE 3WQ4A 3QWRD 4AF0A 2KPNA 5KSBE 5D1XD 4R33A 3SDXB 4NQVB 1CD9B 2VAAB 3VFTB 3IIZA 3GBDA 2EDHA 3HZVB 2ZSWA 4AZIA 4HHAB 4KRZA 2GFBA 4ZAKA 3SODB 8PAZA 3IEBA 1QDSA 3U7AA 2Y9RT 5EN2B 2Z1SA 2FJUB 4YWGL 3F7VB 4BFGA 2IPTL 3MN8A 3SJVA 2CZEA 1D9KA 3O6MH 4JRYB 1MHHB 4BQ5A 3VPLA 3OXRA 2PTZA 4CCCA 3PL6C 3TYDA 3RITA 1PDYA 2FEDC 1BF2A 3WD5H 3JTSB 5F8QC 1R3KB 5HDBE 4PMZA 2QPXA 3H9SB 4WK0B 3D0LA 3VUAA 1NQBA 1MXGA 3SQMA 3KPLB 2GBUA 1X4ZA 3QDAA 4AUBA 2GVJA 2WQDA 3HMJG 1MVFA 3Q06A 2BNQE 2UXGA 3B0YA 5HHNB 4ZUSB 4UNIA 2A0LC 2PLKA 3BPWA 2B5IB 1BZQK 3FUJA 1V6VA 3UTPD 2EIJB 3Q05A 1PTGA 3X13B 3NO5A 2VERN 2EADA 4N22A 4FNUA 1G4SA 4Y9CA 3GFXA 4KVCL 3VKJA 1GOMA 4XAFA 3VG0L 1N64L 4XB7A 4D0DA 1Q65A 3KCLA 1AZCA 1QABA 1QW7A 2VLJE 5DTFB 1AHWC 3THQA 1TKKA 5J5DA 4YBQD 3BVNA 2VR5A 5EC1A 5MI0C 5K2ZA 4K07A 3BK0A 4MMYA 1SUHA 2O0TA 1JPKA 2BVWA 1PKMA 4FLRA 4P4KC 3W2DL 2CK0L 4R96A 1TZ8A 3UL4A 2BZ7A 1PFCA 3S4SG 1CE6B 2RBLA 4DBUA 3BZFA 3AREC 3UPWA 2B9AA 4K8RD 4BKNA 3WNKA 5G4MA 5SWQA 2ATPB 1PKQB 3W7GA 4CD4A 1IGIL 4PMFA 4GVGA 1E51A 3HPJA 1GG0A 1WXJA 3FKKA 3QS3A 5I1JL 5U7SA 2WMPB 2ADYA 5K1JA 4ZDHA 3ZE1B 4KAQH 3LTYA 3QDJA 2X0UA 4DEUA 4Y9FA 1WZKA 1FWXA 3L21A 3UXKA 3A12A 5HI4D 3QCVH 3NZQA 4C6QA 2G2RB 1Q1JL 3B9EA 4OCWH 1PZ5A 1GQJA 3OKDA 2E86A 1R19A 4OLWL 1WAWA 4AVHA 1LWHA 4R90H 5E1GA 2JELH 4O54A 6A3HA 3UYOD 1F6KA 4PRHA 3LH8A 2R2BB 1Y8BA 1JNHA 1CICB 2VCAA 4R7LA 2E40A 4NHCL 1MCOL 4L8BA 1NUDA 2ICEC 2QADD 3F00A 2R8SH 1W15A 5E0QA 4WK4B 3IN0A 4QSHA 3K2GA 2FJHA 3ONBA 1W0WA 4UTFA 3J2PA 1P4BH 5KVEL 3CFNA 4NJGA 1I1XA 3QH2A 2NW3B 2FGLA 1OFOA 4GLRI 1PYWA 1YRKA 3BPCA 1S7RA 4DZHA 1X4YA 3QIUD 4H44C 1TMCB 2WZHA 1FIGH 4GCXA 4QHMA 2DT1A 1U30A 4J4PD 1LWIA 1NGQL 3KOFA 3UDWC 1VERA 3QZWG 3ULVE 3VW3L 4GRLB 3EKCA 2DEXX 4HGMA 3H4FA 1B1YA 4R8WH 1TSRA 4QR6A 4Z2HA 2E7LC 2QVHA 4N2CA 4EKJA 3GNPA 5KUMA 1R6VA 4I7ZC 3AIWA 4FABL 15C8H 1A6ZA 3NEHA 4JB9L 3LQZA 3QDMA 3KPSB 3PRZA 1E4HA 4PWFA 3O8XB 4OOZA 3UZQB 3L3DB 1HP4A 1W2KT 4JM2A 2NX1A 2QGYA 1H7OA 5EF1A 2QHRL 1S5IL 4F93B 1CFVL 2OMXB 3BAIA 4BSWA 4NS0A 3AHVA 3TAOA 3GSRB 5CH9A 1LOQA 2A3TA 4Z7OE 2GVYA 1WC7A 5I1AA 2Y8KA 3WLOA 4BUHA 3RWFA 1Z69A 1LP9E 5D6CA 3CV6A 3WK2A 2PTDA 5DD0H 2VZSA 2WVVB 4RISL 3H9HB 4XPGH 2K70A 1S5HB 4JKMA 5G2NA 3HS0A 3AU1A 2R56H 5C07A 1EXUB 3DMMC 2ZC8A 2AXFA 1S38A 5CU9A 3EYSH 1YNKH 2V2XB 1U8NB 5D1XB 1ES0A 1ZJAA 4N6RA 1R5IA 2J44A 3S34L 4Y96A 1V0NA 1ZLWH 4KJPD 1K85A 5AECA 3FF8A 3DHDA 4EQ3A 3TN0C 3SIKA 4PMJA 2YGOA 3CZNA 5D7HA 3OF6D 5DI8B 4DF0A 3T6VA 3KPRE 5GS1C 1YMME 2NNFA 1F86A 4PUNA 2P50A 2AEWA 3VGAC 4AXNA 1RURL 3EX3A 1AS8A 5EO9A 1FYTD 4S23A 3TC3A 3GFZA 4YBHA 3WAJA 3DUSB 1RIHL 3AJ7A 4PWGA 5C2BH 4A3HA 1DSFL 1L9RA 5J57B 5MEOB 4QRUB 4OZIA 4Q8BA 1BQGA 4JY5H 5E24E 1GVSA 1NMAL 4DVBB 1WAAA 4LSRH 2D31B 1W2PA 1F58H 3IB4A 3QBUA 2YAEA 2V67A 1S2VA 5CGYC 3U83A 1BZ7A 5HSFA 2IPUK 1VIWA 4WWPA 2HX9A 1V02A 4L4TD 4XAKD 2NLJB 4QNPE 5K59F 4OCYH 4G8GA 1PE1A 3VFUB 3GZAA 4O58L 1DL7L 3REWB 3F58L 4UMBA 3HF3A 1DVUA 1XH0A 3MRRA 2R1WA 1K5NB 1GW9A 2WP3T 2KZBA 2OR7A 4GG6F 2Z0UA 1X7IA 5L9DH 4B3KA 4L3AA 4X99A 1HXYB 4G7EB 3TQVA 4X8GA 4IBYA 4GSRA 3TJ4A 3S2NA 3D3VE 1YYCA 2DJMA 4RPQA 4PD4J 4JY8A 3BUIA 4PRAB 1AYOA 4JS7A 2VXUH 3NRQA 4AEEA 5D71L 1WD8A 3KL0A 4JRFA 1JMXA 3ABRA 4HVBA 4OKVB 5AC5A 5LXVA 1MMFA 4IG2B 1AOZA 3C6CA 4X2UA 3FCUB 2EC9T 4CC0A 2F9BT 5CC3A 4UAOB 1X3DA 1JYNA 2W88A 3H70A 4G8IA 3LQAC 4BQCA 2ITCA 1JV5B 5H37H 3KGSA 4U33A 3M88A 1BM3L 4MA8H 1TIWA 4X7SH 1IU1A 2JK2A 1E2WA 3UBFA 4NZTH 4IIDA 4P2OC 4PJ5D 2J7FA 5C6PB 3FB8A 5DD1H 5I6MA 2GWGA 1E6SM 4KK5C 4DJED 3CEPA 1KJVA 2WSKA 3QH3A 4K3DH 3VE9A 3IDJB 3L9RA 2LGNA 3FB6B 1EF2A 3PHSA 3TC7A 2QW5A 3UADA 1AUSL 1SZEA 2X41A 2A3AA 2IQTA 2J8UE 4D2JA 2DQJH 3ISYA 4I9WD 4MJ6B 4BFEA 4HLZG 5BOZG 3R4IA 1UZ8A 2KZ1B 4U7SA 3A23A 5IFAL 4GY7A 1XI3A 4ZZFA 5A2BA 4TUFA 1BX2A 1CT5A 1T5WB 3W2JA 3KWXA 1E2ZA 1B9BA 2IPWA 5FYKL 5JO5A 4JFFA 3TCLB 3H2NA 1FV1A 3GLDA 2XGZA 4LSQH 4F7PB 5L7XL 3DHJA 1KC5H 2XRAL 4Y5YB 4FXJA 3D87B 5AW4B 1L6XA 3T65B 5D2LF 1W5QA 2CHNA 3U4EA 4I2XB 3C09C 5E5MA 1ULVA 2QADB 3GTIA 4ERGA 1IKNA 2DD8L 1PIFA 4GG6B 3ATDA 3SKMA 2HFEB 3N44F 2W38A 1TTJA 1CX9A 3GMPB 1FWAC 3M7FB 5SWSD 4G8EA 3EDEA 4LU5H 2NNXA 1CG9A 4OLEA 3JWDC 4FXKB 3LN9A 1ECYA 3OVUB 4D1IA 4WWKD 3QIUB 3W85A 4ZQKB 3QO0A 1GA2A 1Q5MA 1IEBB 4M48L 1UFUA 3E0IA 5MHSD 2BIMA 4JFSA 3NSNA 1MI5E 4PGLA 5D5MB 3DBSA 4GFTB 4LKCB 4ICWA 2EPLX 1DQKA 4A3QA 3GMQA 1J0KA 1VZGA 2UX6A 1OEZW 4HPNA 2PDCA 4A2EA 3IGUA 4PG9B 2AJ3B 3T9PA 1YIXA 3KHDA 4XPFL 1W72L 4WKZA 3C2AL 4GQRA 1G0XA 4XZIA 3PBMA 3FO2A 3WDQA 4OZFB 1BYNA 4HUXA 3UCQA 4UZUA 1IL1B 4PP1D 1OP5K 4NWUL 3WS6C 1ZT1A 1JFQH 1UH2A 3QIWA 4DPBX 2J2ZB 1DJZA 4U4BA 5K93A 4Z76A 4F33A 5XINA 5ANMA 3KWSA 3G1HA 5DS8A 3VUSA 2YPLD 2YMXH 1RJQA 2F7PA 1VRDA 3TS8A 2IGLA 5E9DA 2PWEA 2HT2D 1UHVA 6FABL 5D2LB 4AD4A 43CAA 4HCDA 1XD1A 4YYFA 3FT0A 1OOWA 1P6FA 5MEPB 4MZRA 3T44A 1TX0A 4I48A 3B7TA 1XICA 1JCJA 1KFCA 3QYQA 2YCLA 2IF7A 1TTQA 2AAVA 3PZTA 5FCUL 1G0DA 1HIZA 3NCJL 2F6XA 5G4OA 3TX9A 3WD2A 3VFLA 3W74A 2AABH 4GXUN 1RERA 3U6XA 1RZPA 4F8QA 2VC6A 3KDMA 1XGYL 2J74A 4TNEA 2FDSA 4NZ3A 1MN4A 1URIA 4BELD 3T40A 3QKEA 4U6TA 2ZRWA 2J3SA 2VITB 1A6AA 1NIEA 1VP5A 4JE0A 4XGZB 1ZLSL 1FYTB 1YNLL 2R0LH 1OTUC 2OX1A 4O0KA 2Z1VA 4IRJA 4ZQCA 5C9KA 5C86A 1T21A 1TKWB 1GAFL 1SJEB 2D2OA 2O6CA 2ZPKL 2MCPL 3G18A 3LV3B 4KO6A 1JF1B 1AR1B 1B4RA 2NXGA 2QCMA 3HTWA 5H8MA 3WIIL 4UT6H 3KLKA 4UFJA 1REQA 5IJVB 4FR1A 4UDUA 2QJDA 4K71B 3BGFC 4PREB 3Q6GL 4JHZA 2HJKA 4UQ9A 3IJYB 2I56A 2X7VA 4P2YA 1R3IH 5EO0A 5IUSA 5FDWB 5AYZA 1BG9A 3O81A 5HJ3B 4BE5A 3E3QE 4PMDA 3FTVA 4L4TB 4RWHA 3LDVA 1KZYA 2RD0A 3M8OH 1GYAA 2QEZA 2CZVA 1CI1A 1MIML 2UY7A 1RU9H 2W59A 3C8KA 4AQ8A 1ID2A 5A7BA 4UTUA 1BXBA 2A73B 4Y7EA 3HR6A 5CINL 3SGKC 4N1CA 2CKSA 2Z93A 1XRFA 1N67A 2JJTA 4IIGA 4A3YA 1B31A 4UZSA 4EDXA 3FQ2A 4W5ZA 4I9TA 3EOTH 3TO2A 3FB5A 3V2AR 1WFIA 2VH5L 4LL1A 4FALA 5JPNA 4PUEA 3LIZL 4XX1E 3B56A 3UP6A 4GO8A 4BWTA 3FKRA 3KPPB 2GL5A 2XG5A 4MSSA 3KWWA 3MJ9H 1KCWA 3MV9D 5I73C 1TV2A 4AIXA 1O5KA 3DARA 4M7LT 1RXLA 5ESQB 1K7XA 4NZ5A 2EDRA 3FT3A 5SWZE 3EMQA 4FSAA 5EWIL 3CLMA 2PW1A 2WB7A 1J0YA 3E6HB 2FLBT 3PV6A 4JN7A 3LHVA 4LVFA 1YA5A 1JK8A 3ME0A 4PJ5B 2ZUMA 4NXKA 3VIJA 2C3VA 2JFEX 4XSLA 2X53A 2R8WA 5JMRA 1LEKA 1Y0LA 3LV5A 4D1JA 5HNNA 1YVLA 2MEJB 3GMLA 3WF4A 3EJTA 1JCNA 3NXFA 2FJSA 5IVNA 4FD0A 3S46A 4WJXA 3AIVA 5IHLB 2BSTB 3KZSA 1NDVA 1UH3A 4LUSA 3PWLB 4FULA 5DD6A 3ID7A 4JIHA 3HG3A 3H6AA 3SY0A 1MZZA 2FWSA 1YUKB 2VHLA 2EUVA 4ZSOA 5IM7A 4XPTH 4KCWA 3UF9A 3L3GA 3ESNA 1L7TL 1ORQA 1WZLA 2QGEA 4AVOA 3L4YA 4RBPK 1L7IL 4AKQA 1CI3M 1LK2B 2EQDA 4QO1B 4C60A 4QJ4B 3SAZA 1LGVA 4XWUA 3HZMB 1IVLA 5ELIA 5GRYA 4A6YB 2DQTH 2WAHA 5E5CA 3ZBMA 5A8GA 4HKZA 3W11C 3QJVB 3WIHH 3SE6A 4AYGA 4BEQA 3W0WA 2PABA 5BXRA 3B9VA 3MKVA 5SWSB 4U6YB 3NQDA 2JJSA 3TCSA 3PPHA 3QYNA 1V6TA 3TV3H 4WGKA 3D08A 1VAHA 5D9SA 3FAWA 4EDWL 4WUUA 4K3JL 4ZFOB 2Z26A 4WWKB 2I5YH 4PJ9D 3RTQA 3VNKA 5D7JD 2ICWB 3DJ9A 4O12A 2AK1H 3QDGD 3C8HA 4ONFL 2ILLA 5HY9A 3CVHH 3BJLA 4Q8PA 4F7EB 5HDLA 1DP0A 3WN6A 2IAND 3AIQA 4N5EC 4JFDE 2WXLA 2J9XA 3DURB 3RX4A 5JPMB 4EF9A 1DFXA 3DI0A 1MNNA 4M5YL 1IGCH 1M6JA 3GS4A 3VXUE 3GNRA 3E12A 5TDOB 2DWDB 2IBZY 3WCZA 4H8WL 4MD5B 3W1QA 4Y4FA 4MKVA 2J8HA 1C5DB 2WWMD 2RR3A 1W5NA 3B8IA 3VKAA 5E99H 4JJHA 2DP3A 4IEFB 5E2TH 3MJ9A 3M1ZA 5JIWA 1OGAA 4X5WA 1JQXA 3IPBA 2AJVH 2LOEA 5B4MC 2NY4D 3GAKA 4LSUH 3RZCD 1AMXA 3EEZA 3K2UL 3H0TA 1ZB5A 4M81A 3HPZA 1T0MA 3FONB 3DFOA 2F54E 2P43B 3VXOB 1UJTA 4NKOA 3KCOA 3MLZL 2YPLB 3QEQD 1IB5A 1P1ZB 1OSYA 4LCRA 1TELA 4QDWA 1KGUA 1R1CA 3E2RA 2QLVB 1WX0A 2CGRL 2QSQA 1HI6A 4PRPA 5CN1A 1RZIA 2J88L 3L5XL 2HKHH 1OFQA 2HWZH 2Y25A 4JTEA 4A37A 3CHEA 2Q01A 1VB9A 1PHQA 2WOQA 3FSOA 1VPQA 3I6TA 5BVJA 4MKNA 4XVSL 3CQFA 1PIIA 3RX5A 1MHCB 4AJ0A 2QGCA 4JHAL 1M1SA 1I1AC 2E25A 3EYFB 2K0RA 4E5TA 3OLDA 3OKMB 3K30A 2E7BA 1MAML 1O5QA 2E67A 4XI5D 1HHIA 3OWRA 1K6QL 3AIEA 3H4WA 2EUWA 4R4FL 4XMKH 1WBXA 3Q5OA 1HYSD 3GY1A 1FBIH 4L8SA 1E8WA 4F0MA 3QUYD 4OI9A 3S3JA 3SCRA 1GZHA 2YBVA 3AXMA 4LK4A 3IK2A 1B90A 1OC5A 3GZ3A 4PGBB 4O1FA 2PWHA 2CLHA 2EXSA 2JMRA 4C4BA 5IW1B 4PTWA 4YDVB 1T1ZA 4K15A 4QE4A 2XI9A 1XIGA 2O6FA 3UJRA 2ENYA 3RWGA 4POYA 2RHEA 4CSZA 4OJAA 3SO7A 1UB5A 4PZVA 4WEEA 3BWZA 3Q44A 3TNNA 4XO9A 1SF5A 2MPVA 5J0BA 2QNEA 3CVHA 4C6MA 5DGQA 3LOTA 2IXQB 3N41F 1US0A 2KDYA 4XWOC 5EU9A 3TL5A 3NOIA 2NSXA 3GXPA 5EB8A 2NX3A 3N3EA 3RPMA 2GT9B 2KKQA 3PGFH 5EZPA 3AQXA 2BS8A 3MLTB 2G5UA 1PU0A 1X5YA 4KBXA 5JW3H 1OF8A 1RJYB 1O9VA 4NSKB 3N2BA 3NP3A 4N5UA 3NDYE 4UOW1 2BBFA 4E9LA 1M3IA 3UFIA 1XG3A 3ZO9A 1L6PA 1KY6A 3VWKD 1T6BX 4HZ6A 2NUPA 2PODA 3CAVA 1B0GA 5C9JB 1FC2D 1JXFA 5KVFL 5EMMA 3HJ0A 4L9ZA 1WO2A 3VIIA 4PYGA 4PGZA 5KYUB 2IKJA 3MV9B 5IVXA 3WHXB 2B39A 4JG0L 1QPOA 4Y90A 1HKLL 4I89A 1E5AA 4MGXA 2N3JA 1QUPA 1I7UA 3RFAA 3T78A 2Z2BA 4FB7A 3GKWL 4N26A 2VUNA 1S1PA 5K69A 1A1OA 2JEPA 2R24A 1TCRB 4LL9A 4IBWA 4OZHE 1Z9SA 4XKYB 1B30A 4TULH 3OJDA 5KTEH 2XSKA 1CFNA 4CMHB 1RUML 4YO0B 3ARXA 4L1XA 3IJQA 5E94A 3CZKA 1ASPA 4RRPG 1XDMA 5JUEL 1PFOA 1ZLUK 3JTTA 3M41A 3KRUA 3G7TA 3BN9C 1LO2L 3AGWA 2P80A 3RX8A </