1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
molecule keywords alpha-galactosidase
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
1F7BA 4NNCA 5LSMA 3ABRA 2DZUA 3O07A 2O7SA 1JXJA 1V3JA 5I3FA 1XBYA 1I2RA 3M43A 5A8GA 4FO4A 2VEMA 4JX6A 2V0TA 4LUIA 4U3CA 3EJTA 3W7OA 5I3GA 3GTNA 1MO0A 4GO9A 1I2QA 3UY7A 2G97A 1MXGA 4JN6A 3B0UX 1KM3A 1LOLA 3GLCA 4A2RA 3ZOAA 1GJUA 1L6YA 3G3MA 1NSJA 4GUJA 4HA1A 2DZSA 3THAA 2WJZA 2FLIA 2G5WA 3G24A 1U2YA 3HOJA 3QH2A 2OX1A 3NPVA 1HVXA 5LKYA 4NNBA 4U2YA 3W1TA 2P10A 3V75A 1D3GA 4TU1A 4XWUA 3LBCA 1W31A 3GNNA 1GVIA 4H7VA 2V2HA 2C0AA 1GTEA 5G2HA 3VI2A 2DP3A 4HOXA 4UQBA 3UPBA 4JTKA 3CLMA 1GQNA 1AQMA 1EWEA 2G96A 2J88A 2DIEA 1IXOA 2WKGA 2A2IA 3C8FA 1MW1A 3GNDA 3CWNA 1XSIA 2ZUSA 5CPOA 3W7RA 5HULA 4BF9A 1J4EA 1RZMA 4L4MA 4JEQA 2E6YA 3FYPA 1OHLA 3BLKA 3IVTA 3OLIA 4HHPA 4QAIA 2FYVA 4ZZ9A 3HGRA 5AYYA 3B04A 5BW6A 2PWHA 2EEXA 5TQLA 1P6WA 3EJSA 4PCSA 1YXCA 5D30A 2FPTA 4GE8A 3BVJA 2F18A 3IGUA 1F5ZA 3FS2A 1MWOA 2ZUWA 3N9SA 1S5WA 3WNNA 3UPWA 5IM51 3LPPA 3W7CA 3HGOA 1U83A 1GVRA 4QSHA 4JTIA 4LS2A 1Q45A 3RFAA 1CXFA 1MEWA 5CGTA 1E43A 3UERA 4AYGA 4LV4A 2E6FA 1FCUA 1QPQA 1WX0A 3ZR4A 1TPC1 3AXIA 5DBUA 1W56A 2CLMA 4MY8A 1THFD 1XDLA 4S1FA 4WUIA 2OZ0A 1LYXA 1EH9A 1FXPA 3TSBA 1MW2A 1KM0A 4WD0A 3LTYA 4N6EA 3FAXA 3I6RA 3C61A 4DO4A 1CXIA 1L6WA 1EP1A 2BXZA 2CFFA 4X0NA 3CEUA 3GBDA 4HOWA 2EHHA 3F03K 4O12A 4C1KA 1SU5A 4UTLA 3MW7A 1JVNA 1LM1A 2Y7EA 1W54A 1MZHA 3NQ8A 3QRHA 5DCEA 4FNUA 1TB3A 3HIJA 5EPDA 3SW6A 3EJUA 4J3WA 5BRPA 1KFKA 2QJIA 1VC4A 4S2BA 4IQLA 3GDLA 1GVOA 4YL2A 3CZGA 2E5CA 4JTUA 4LU0A 4L4LA 1GTHA 1OFEA 2B7PA 3ANYA 1DTUA 3L9CA 1UCWA 3L4UA 1I8JA 1G4EA 1NAL1 3EX6A 4ADTA 3M6YA 1JFHA 3N3MA 4GUGA 1K8YA 3MI2A 3ZO9A 7CGTA 1B9BA 4IUOA 2XVKA 4CNOA 1B4KA 4O4VA 2BSLA 3DX0A 3PVFA 3W85A 3BVTA 2YFNA 3T78A 4MYAA 4AEFA 2VELA 1MSSA 1KGXA 3CV5A 4IPIA 3TOPA 2Y88A 3UG4A 1TV8A 3UNDA 1PCWA 1OFQA 2GQ8A 4DXVA 1QOQA 3QGVA 4UTHA 1JG9A 4J27A 4W93A 1TPWA 8CGTA 3KRUA 2BX7A 1L6SA 1H7WA 2GPTA 1R33A 3CZKA 3DDGA 5K9DA 3BMVA 5I5RA 3YPIA 1QR7A 2TAAA 4BZYA 3K8MA 1LBLA 4UIOA 3GXTA 3R13A 3G1AA 4CQ9A 4Q4KA 1F6PA 3U6WA 3S6DA 2HS6A 2ZYFA 3L66A 3NL6A 4CN6A 2ZXBA 5EMYA 1D3CA 2BY0A 2FE0A 1WPCA 3BCFA 1FWRA 1CGYA 3S9YA 1HG3A 3NPWA 5CZTA 3MI3A 5FI8A 2XVLA 1JCXA 3NQ6A 1R34A 2EGZA 4W9TA 1G9HA 4Z08A 2WCGA 4JFVA 1ICPA 1VIWA 1RQBA 3EDKA 2WQPA 2DH2A 5KZDA 2BHUA 3TROA 2ABBA 4DF2A 4UFMA 1MEIA 1QPRA 3WDIA 3N34A 2F1BA 4GC4A 5HDRA 2ALDA 3O8AA 3BPWA 2ALWA 3OLEA 1UOKA 1EUAA 3CIWA 2OT0A 3L4WA 3HMJG 1WZAA 4XKYA 2V2DA 3ATZA 1GCYA 1TO3A 1XM3A 1N7KA 1LLZA 1FXQA 2YPIA 2RH9A 2A4AA 3BAWA 2B7OA 2PRLA 3BAIA 5D2WA 1KXHA 2VEIA 4ORMA 4FNSA 3VGFA 4UNIA 3HJZA 3EDDA 3E02A 3K8KA 1CGXA 3LHTA 2R91A 1HNYA 4UTMA 1DHKA 3DBPA 3EXSA 3GR8A 5FEXA 1I45A 5C54A 3C56A 3W7IA 5DFAA 1YADA 1VYPX 2QCEA 3LXAA 3O6YX 3BUIA 2FQIA 4LXFA 1SO6A 1SZGA 4GBUA 1HUVA 4UTJA 1FWTA 1EPXA 2A21A 2C18A 2Z0IA 4UUIA 1H7XA 3KRSA 3S5YA 5EY5A 3MJYA 4DQWA 4PC8A 3PC0A 2X2HA 1QO5A 4N9CA 2ZXQA 1ZS2A 5FEPA 3AXHA 4IPJA 5CG7A 5D05A 3VGEA 2J27A 1ZAHA 4JX4A 3KXQA 3W7KA 2WCSA 1OSEA 1JUEA 3W7HA 1ML1A 4XUGA 4TMCA 1RV8A 2GVLA 4HNVA 4UNLA 3ABSA 3UEQA 3NZ1A 1K03A 3HBLA 3A47A 1IXPA 2GJRA 1D9EA 4DF0A 3L5LA 3UWQA 4FX6M 1AQHA 3W7JA 3C6CA 1BVNP 5IBXC 4KMQA 1RP9A 3BLIA 4POCA 2EF9A 5AHFA 2ZX8A 4MIMA 3W71A 1QOPA 1VQTA 1SSDA 2QF7A 2J24A 5AC6A 3BC9A 1A5BA 3BAYA 1E3XA 5AN7A 1WO2A 2QLYA 1VYRA 1W9XA 2WVTA 1U5JA 3LV6A 4MVAA 1NM9A 1BKSA 3PB2A 3O16A 4NQ1A 1S3HA 1HL9A 4TMBA 4WQ6A 2DORA 4OV9A 3RF9A 1OYAA 3KFTA 2A7RA 1B57A 4H4IA 5DY2A 2JK2A 6ALDA 1XBZA 1H7OA 3T40A 4N9BA 4K36A 4HOZA 3GKFA 3WK2A 1B3OA 1CXLA 2QJHA 5KMYA 4QJ1A 4N9DA 2ISSA 1YTEA 4U31A 2QMKA 1XI3A 1Z41A 3O15A 4HT3A 1KCLA 5KTLA 4M19A 3SECA 5AFDA 1FDJA 1L2UA 3NM3A 1CXEA 4RXGA 1GYNA 2NUXA 4JNMA 1WYIA 1OJXA 3LLFA 2VXNA 2C7FA 2E4TA 2F7FA 5CSSA 2B4GA 3TC7A 3NQCA 3NQGA 4RR4A 1JCYA 3NQAA 5KITA 5DXXA 4EVZA 1DORA 4OIFA 1KBJA 3D4ZA 2J9XA 2E6DA 2D0HA 5E6YA 4RXFA 4J3UA 1W3NA 4HIBA 2WANA 2NUYA 3L5MA 4DEFA 2FTPA 4QNWA 1CGTA 4JXCA 3LI0A 2A7NA 3EWUA 3KL5A 3W1LA 3VX0A 1XD1A 1H7PA 3PM6A 1A47A 1O94A 2YA1A 2EADA 3KEHA 2GJNA 3LTPA 3M5YA 2YYUA 3NA8A 3WK3A 3EEGA 1XDMA 5T26A 2OCZA 3NQFA 4AAJA 1F6KA 3PG9A 2OYLA 2OSXA 5A6MA 4ZQNA 3TE9A 5FEWA 2W0UA 5F2IA 3NM1A 1WE5A 4UQAA 3QF0A 1P0KA 2QUUA 3TMLA 3UWYA 2CLEA 3HGSA 5D2VA 3VNZA 1BG9A 1JUKA 1TV7A 3IIPA 2QCNA 3TW7A 1TPEA 4LV9A 1F76A 3W83A 1GPWA 4H8HA 2YCEA 1ZY9A 1H7NA 1LBFA 1S46A 3SY5A 3H55A 1K02A 1YXYA 4K7YA 1QHOA 2KZHA 1QPOA 3KAOA 3P82A 1Q4NX 1QMLA 3PG8A 3T55A 4ZQRA 2WPBA 5G2IA 1ZJBA 2ZUVA 2RFGA 3IEBA 1OX4A 3ECQA 2HMCA 4BWLA 4J7RA 3T44A 2CLFA 1OFRA 4AIEA 1FBAA 2NV1A 4XTDA 1J5TA 2D0FA 1U33A 1LRTA 3KOFA 4H3DA 1K7EA 1MXDA 3MYOA 3B0VC 1F74A 3QQ1A 1OYBA 2P1FA 2YXGA 2D0GA 3G3DA 4OT7A 4E2BA 4HSOA 3B06A 4FX7A 1WZMA 3NDOA 4N02A 3IIOA 2DZWA 1FDYA 5HJLA 1T0OA 3KVMA 3CZNA 1HFBA 3GZ3A 1TTIA 3TXVA 2V30A 3TKFA 4UR7A 3W2KA 1TQJA 1NVMA 3OLGA 4J3XA 3BLBA 4PSPA 3F4WA 3N73A 5LNVA 2FH8A 3WNPA 4CNNA 1LORA 3SR7A 3BG9A 3WNLA 5D37A 5K7JA 3QEZA 1RPKA 3C52A 1G7UA 1WOBA 3CEPA 3KRZA 1N8FA 3NNTA 4WJEA 3V1PA 3EKZA 1C8VA 2GVGA 3W2MA 3VGHA 3PUOA 3W2NA 5KSWA 1KLZA 4IJBA 3CPRA 5HUPA 1KFLA 1WZLA 5LNSA 4J3SA 4MYXA 3HGJA 1O4UA 2NZLA 3LCXA 2NXGA 5U4NA 3WFAA 5CGMA 2YOCA 2WKJA 5D03A 2YGYA 2TMDA 3FYOA 4UTIA 2ATMA 1W5PA 2VFFA 1UA3A 2FPVA 3TTYA 3I65A 2WSYA 3P81A 4RZ6A 5EL1A 4YXGA 5HPOA 4OWGA 1GG1A 3UY8A 3EDJA 3EX2A 3WFZA 1ZJAA 3ZT7A 4JTHA 5MHBA 1KBKA 1M5WA 3WJZA 4N4QA 4LQ1A 3W7MA 4X2RA 4O17A 4CNPA 1A5AA 2D3LA 4O4WA 4FNTA 4O50A 1B0IA 5HR6A 2PRHA 4LVAA 4PH6A 4M8UA 4HNUA 1G5AA 4UXDA 1FWNA 2PC4A 1XH0A 1NFBA 1XCFA 2F7RA 5CZ0A 3BUQA 1DEDA 1HTYA 3C2RA 2B0MA 1VS1A 4LPCA 4UTWC 3QFEA 2D2OA 3EX1A 1WQ5A 1LCOA 4JFWA 1LP6A 3NPUA 3UG5A 2CLLA 3CZLA 3G1XA 2X1TA 2EAWA 1E40A 1V3KA 2FGZA 2QCMA 3S2CA 1VCVA 1XL9A 4LW7A 1JDAA 4LNYA 4P61A 3BVXA 4AW7A 3PAJA 4JTGA 3PWAA 4JS3A 1GEQA 1VPXA 2Q8ZA 1WXJA 5A5WA 4RJEA 5GVJA 1VCFA 3FA5A 3TQ0A 3VMPA 3GDRA 3BARA 3LPOA 4JD4A 2C6QA 1Q6LA 3DGRA 1UKTA 4RX0A 2OT1A 4NZJA 3TV8A 1YDOA 2G95A 2A6NA 1UH3A 3H53A 3JS3A 3OVRA 3R8RA 4OQVA 4UFHA 2NT1A 3WY4A 1EB3A 1O5XA 1FQ0A 3WY3A 3KE0A 3EJRA 2C13A 5HWMA 1JUBA 3M0ZA 3TW6A 5EKYA 4MZ8A 4A29A 3FW6A 3LX9A 4U33A 4MPQA 5K3VA 2ZX5A 1XH1A 4AEEA 3WDJA 2NWRA 1P4CA 4QITA 3IIZA 2WNWA 3ZS4A 4A21A 1CXKA 3QSTA 3WK0A 4NXSA 3CZSA 9CGTA 4HPXA 2DJLA 1BAGA 2E09A 3NOEA 3O06A 2CHNA 3SI9A 4ICNA 3CTTA 1ZAJA 4IX2A 1K3UA 3A21A 1XSKA 1F2JA 5LHFA 4B9YA 5HNRA 2ZWYA 2NUWA 3W7GA 5K9XA 4JGDA 3L2MA 1OGSA 3EWYA 4LT9A 3OLDA 1EP2A 1Q3NA 2V3DA 1WBJA 3OHIA 1JULA 2B7NA 3JRKA 1GOXA 3FLUA 1OT1A 3DKLA 1ZAIA 1T8XA 4PTNA 5A2BA 3L4ZA 1Z42A 4ALDA 1CX9A 2WSRA 4UCFA 3BUPA 1W37A 1JD9A 4A2SA 3WY1A 1QWGA 2DJXA 4AHPA 2ZDRA 3KVJA 3UQNA 2PCQA 6TIMA 5H91A 4IX0A 4BR1A 4EOUA 3DX2A 3L0KA 1AL7A 4KWWA 2E77A 3W7DA 4O1CA 2RDUA 6TAAA 3SSJA 1W0MA 4JIPA 3W7LA 3WN6A 3UG3A 1G4SA 1C29A 4HKPA 3SGZA 2ZA1A 1H1ZA 2ZZ7A 4FNPA 2YR1A 4PSRA 4FNRA 1VHNA 4H6KA 1RD5A 4K6AA 1KV5A 2NXHA 3EDEA 2ZX9A 3TMQA 4M56A 1GWJA 1LRQA 4IXHA 1HX0A 1CI1A 5F2GA 4AMWA 2ZXAA 1AMYA 1RR2A 1PZ2A 1JI1A 4R34A 1GVSA 3DH7A 3UWZA 2AGKA 1J0KA 4MFDA 3W70A 2E1DA 4JTEA 2QCLA 1O95A 5FEZA 2ZA2A 4X9SA 4FLSA 4UTWA 2YA0A 2TSYA 4AF0A 3ATYA 3MHUA 2GVJA 2V3EA 4E2OA 5AHMA 4YLWA 4NX0A 4GFSA 3F4NA 2F7QA 4UFKA 2JGQA 3RILA 3IVSA 3HPZA 3W87A 4FLOA 1UD2A 1CW2A 3G1YA 3NG3A 4M6PA 3LCGA 4ZQOA 4GRSA 1XCWA 4UQCA 4AB4A 2A7PA 3IJ9A 5DCDA 4S2CA 2Y63A 2ZRVA 3C3NA 1PJ9A 1TQXA 1JRBA 1YDVA 4ZQPA 2JGYA 2AAMA 3G1HA 2GJPA 1I4NA 4A3UA 5I24A 1KXTA 4EF9A 1XH2A 4LY8A 2XFWA 3L0NA 4FLQA 1CGVA 4ATWA 4GJ1A 4KWVA 1F73A 2GUYA 3P5ZA 1R2TA 1QW9A 3P67A 3QJAA 1T99A 4NUWA 5C5YA 1H7RA 2JKEA 2QDHA 5A2CA 1G1YA 5CZSA 4CQ8A 1L0PA 4JIQA 4OGZA 4PODA 2ZUTA 1TPUA 5DBTA 3AJ7A 1XXXA 1DJNA 3CQ0A 4O1DA 4RK8A 3DI0A 4LVBA 5G4EA 5E6ZA 3ZR6A 3B8DA 5AHNA 3TAKA 2HTMA 4K8HA 4Y90A 3KL0A 1Y0EA 3W73A 2FHBA 1ALDA 5E93A 3D0CA 3HO8A 2EABA 4DF1A 2YSWA 3OVQA 5BNKA 3VGDA 1GVQA 3VX1A 1T96A 3KVKA 5CPMA 2QCFA 1YLVA 2C3ZA 5EYWA 3PS7A 5J5RA 3PY2A 3WNKA 4JR5A 3WNOA 1O7DC 5G1YA 1WZKA 2ZICA 2OYMA 3L65A 3QPYA 1Z32X 4NT0A 1VFOA 3BLEA 3HG3A 1ONRA 1W3TA 1BTMA 2RDTA 4LC8A 3C4UA 4AWTA 4RCXA 3W72A 3QMSA 3GDTA 1OK4A 1LRNA 2Z6IA 3B03A 1QWNA 3DDFA 1K8ZA 5AYXA 4E0CA 3G0XA 3GXPA 3CLWA 4M5PA 4Z1DA 2X1SA 2FB2A 2YIHA 5CXPA 3OA3A 4M7TA 4RV8A 2PE4A 3U8GA 3CWOX 4PL1A 1DL3A 2WKLA 4K37A 3TAOA 4RLIA 4UQDA 1ZCOA 3W74A 2V8ZA 3FIGA 2ZZ4A 1CXHA 3DHDA 3L68A 5CKSA 3BH4A 1VGAA 4HSNA 3GBEA 1JR1A 2XN0A 1S5TA 3LHWA 4WXYA 1OFAA 4RKAA 3EXTA 5DCBA 3AMLA 2GUUA 2NSXA 1V5XA 1PHWA 3BUBA 2A5HA 1GYLA 1FCVA 2AMGA 1CPUA 3ZT5A 1MXSA 3CM4A 3W75A 1DVJA 3WENA 2NXIA 4JTSA 4ORIA 3TC6A 5G1TA 1H3GA 4ADSA 3FAWA 4RZ5A 3T7VA 3ZFHA 4WY0A 1W5OA 3NQEA 3BW3A 4K8EA 2RKXA 1KLYA 1VRDA 3AJXA 1VZWA 3N2XA 3SFKA 3L0GA 3W7EA 2BZNA 2PWEA 1I75A 4O0KA 3STFA 3BVUA 1IF2A 1PIGA 1TSIA 4AXKA 2ZIDA 2ISVA 2WNZA 4LWWA 3IIXA 5D2TA 5SWUA 1FCBA 2DH3A 2C15A 3EX4A 3STCA 1ZFJA 3TFCA 3TU9A 2ZTKA 4XZ9A 4I7UA 1S5VA 1KV8A 2CXGA 1DV7A 5ABTA 3DFSA 2NX1A 4UOZA 3U2OA 3G1SA 5BOOA 2YKKA 3K1DA 4AEOA 1AVAA 3NR0A 3FKRA 4NZFA 4DPPA 3WY2A 3EJPA 1OX4B 3QMTA 1P5BA 3LI1A 4ONVA 4UQ9A 4O19A 1KFBA 2AQWA 3T4CA 5L6UA 5D33A 7TIMA 2C1HA 5F2MA 2ZXDA 1JAEA 1SFLA 2E6AA 3BUDA 1TPB1 3M44A 4Y6GA 3H54A 5AC7A 3ZWTA 4JX5A 2G3MA 1VJSA 3NGJA 3GDKA 3GXFA 1QI4A 5I3IA 3TQVA 2E8YA 3VSUA 3GXNA 1JJKA 4LVGA 4IMEA 3JR2A 2XN1A 2QCDB 2Y2WA 1TQVA 5I3HA 3A9IA 1YDNA 2QPSA 1HWWA 1UH4A 5F2LA 3BAKA 3TCEA 3G0UA 2ZZ2A 2Y62A 3LCLA 4MKNA 5CSRA 3S1VA 1TIMA 1XV8A 2NV2A 3E0IA 3MBFA 2Y4SA 3LHYA 4WXZA 1SPQA 4NX5A 5A2AA 2YYTA 3G8EA 2QV4A 5AHEA 5LHEA 2Y7GA 2WPGA 1ICQA 3D51A 2F7PA 1BF2A 1FCQA 4GI6A 3W7QA 3M5VA 1XKYA 4NJJA 1O60A 3IVUA 1WOAA 4JCMA 2ZZ3A 3G18A 2W79A 4UTTC 4CGTA 3E96A 2NX3A 3FEMA 2F2HA 3D50A 3DZ1A 1H50A 1VJIA 1UUMA 3TK7A 1KTCA 1QPNA 4KFOA 2GQAA 3LGEA 1K7FA 3DI1A 5K4ZA 3W23A 1JF5A 1J0HA 2YFOA 3AMKA 1H1YA 1PCKA 3OG3A 3BVWA 1N55A 3M1ZA 4I9AA 2ZRXA 5HXMA 1DKWA 3RNDA 4PA8A 3F1QA 3M47A 4I7WA 4LOCA 4MB1A 3W84A 3W2UA 5DN1A 2OW6A 4FB7A 4HNNA 2CLOA 1DHPA 2BXYA 4XB3A 2H90A 5TIMA 3LRKA 5I3JA 2DIJA 4MY1A 3R5EA 3VFLA 1ADOA 4UOQA 4EWND 1M7PA 3GDMA 1C8QA 3M16A 4MJZA 4KWUA 3GXDA 3TX9A 3W1AA 3W86A 1XUUA 4NJIA 1IV8A 3C2VA 3W6YA 5BRBA 1CGUA 3TXZA 5FF0A 3NQ2A 4NXKA 3DENA 4Z0SA 1JRCA 1G69A 3DHFA 1QFEA 1VCGA 3DU0A 3ABQA 3LDVA 4B5NA 4H8UA 2I14A 1U30A 3PBYA 3P60A 1TPDA 4LS1A 3BLPX 5CPLA 4ZQCA 2DU2A 3LXCA 4IOTA 3ZWSA 3NXFA 4WF7A 1KXVA 3A4AA 1G6CA 1DBTA 4P2VA 1SO4A 1OFDA 2CU0A 3NL3A 4O14A 2PWFA 4AMAA 2Z1KA 3BAJA 3PBWA 3LXBA 4O53A 1JDDA 5F7UA 2ZA3A 3O6CA 3RK8A 1JGIA 1XBVA 4MY9A 5AYZA 3B05A 3VSTA 4QNEA 2YW3A 5HUOA 2IGTA 3NQVA 2W6RA 3IGXA 5E1QA 1SQ7A 3L5AA 4YCPA 2OW7A 1A50A 1YXDA 2QJGA 3M5ZA 1JF6A 3ZT6A 1NF0A 3IK2A 3PF3A 1DOSA 4BI7A 3BW4A 1KGUA 1UD6A 5AHIA 1G4TA 1ZHAA 3A23A 1H63A 2ZWZA 2WOQA 2FHCA 3AO0A 3P7YA 2C14A 2I1OA 3WDHA 3P62A 1GJWA 3NVTA 4UC5A 2EO7A 2BLEA 4WZHA 1QPKA 4N6FA 4WX2A 3WJYA 4QIUA 5BMXA 4DBDA 1SW0A 1Q6QA 2BY1A 4M6VA 1JL8A 4GQQA 2ZZ5A 4LUJA 3O1NA 2WVSA 4OBTA 5CPNA 1TV5A 2ZRUA 4O0ZA 1IIHA 1KCKA 1TCMA 4XKYB 3DFPA 3O05A 1W3IA 2X30A 4UZSA 3B4UA 1MFUA 3NQMA 1A5CA 1SZEA 4XBSA 3W07A 3LHVA 4OJYA 4Z0JA 3K30A 1OF8A 1KXQA 3L67A 2JKAA 2ZZ1A 4TVUA 1UD3A 1P0NA 3TDFA 4E38A 1Y7VA 5IBXA 3C0JA 5E70A 3IJ7A 5TD4A 4X3ZA 3L4VA 2NX9A 3KX6A 4PCFA 4AIOA 2DZVA 3QMRA 3DX1A 3W88A 1KGWA 2AAAA 3A22A 2WVVB 3BG5A 3N19B 3MP4A 3WMSA 1QHPA 1UD4A 4GINA 1TMHA 1EHAA 5K4XA 1OVDA 2Y89A 4MZYA 4TO8A 1IIGA 4FHAA 2VFDA 1PL9A 3UXDA 3W1QA 4FXRA 3LBMA 1VB9A 3CHVA 1XCXA 1EIXA 3KLLA 4AWSA 5EA9A 3UZ5A 1UB3A 4OKDA 4C1LA 1HL8A 3W1RA 3QC3A 1JXKA 1QNVA 2DZPA 1SMAA 2C8NA 4KFPA 3LOTA 1SR9A 3BK0A 1WA3A 3NO5A 1LZOA 2WNQA 3C2EA 1KM5A 4HP5A 3LCHA 4O1AA 1GVFA 1D3HA 3UWWA 4R33A 1AG1O 3S1WA 1EA0A 3GVGA 3STGA 4U4MA 4JY9A 2WC7A 3VKJA 2BHYA 3L21A 2E9BA 1ZNNA 3DAQA 3TUUA 1I2OA 2VC6A 2NWSA 4MZ1A 3CGTA 3SGUA 3CB8A 3GYEA 1RPXA 1WV2A 2CZEA 3NPXA 4O1BA 2P0OA 2B7QA 1K8XA 5KINA 1PZ3A 3L4YA 2Z1BA 3MMTA 5D2XA 4A22A 3NYZA 3TSMA 1KWKA 2F1AA 1TRIA 4JDBA 4DELA 3TA6A 4CN4A 3II1A 4Q32A 2EKCA 3I68A 4LS0A 4GI8A 2PURA 4BFAA 3HG2A 4HPHA 2Q3RA 4H2CA 1RP8A 4GUFA 5CGQA 1UKSA 2DZTA 1MFVA 4CKQA 1SW7A 5D02A 4I7VA 1YPFA 3HB9A 1D7FA 2E8ZA 3GXMA 3RIKA 1E51A 4Y9AA 2Y24A 3HZ3A 2QPUA 3M41A 2BTMA 4UZUA 2BY3A 1J0JA 2OMAA 3P8JA 4R7JA 4UMBA 8TIMA 1AMKA 1WBHA 4UTTA 4NNAA 1XSJA 1VH7A 3VE9A 3GIYA 1KFCA 5F4WA 4UTKA 3UZJA 3KWXA 2Y7DA 2GVYA 2FJKA 1JDCA 1SSGA 5G5IA 2ZX7A 3HJEA 2R94A 4LRSA 1TJRA 4LRTA 2ZCGA 1JQVA 3DFQA 1YTDA 4GNJA 1AL8A 3LCFA 3EJQA 5DO8A 3DX4A 1A53A 3BCDA 4UTUA 1JD7A 3VMNA 1H51A 2PRMA 1DJQA 4D2JA 4MLRA 5KZMA 3G1FA 3FOKA 3FKKA 3USBA 4PEEA 4WLCA 2ATSA 4YWIA 4HPJA 2A0NA 1J0IA 1KM4A 2WVUA 3W38A 1PEZA 1TTJA 4MJMA 4ZQMA 3VM7A 1HL2A 2TRSA 1VLWA 4KFNA 3NEVA 3EKLA 5HWJA 3R89A 2ZX6A 3W7PA 3PR2A 1JCLA 4MUZA 1EP3A 2UV8G 3RLVA 4IMFA 4PEKA 1VLIA 5E0KA 3VCRA 5J5DA 1M7OA 4NVTA 5L9FA 3GKAA 2YDAA 2X16A 3BGGA 2GJLA 4EF8A 1EEPA 4PFMA 4CLMA 1UD8A 1KM1A 3W37A 3S5NA 1DQXA 3E49A 2QAPA 3DHUA 4XTIA 1PHQA 1VR6A 4LTSA 3DFOA 3O6DA 1TQTA 3DC0A 5FF2A 3S5ZA 3GXIA 4M7SA 4Y8FA 1JCNA 3NQDA 2VFIA 2Y5EA 5G2WA 1C9DA 5KZEA 3BAXA 3VE7A 4BK9A 3C2FA 1H61A 2H6RA 2TPSA 1V3MA 1R75A 1LOQA 3OBKA 2X2GA 1PV8A 3ZR5A 2E5BA 3I7QA 4JYFA 2NLIA 1Z48A 3P80A 1QI3A 5K9CA 4AMXA 1OF6A 2WVVA 4XQ6A 3PSVA 3EWZA 2VENA 1SUXA 1SZNA 5I23A 3MP5A 3W9ZA 5F1UA 5FF7A 3HPXA 1ZJIA 3LRMA 1TQUA 1EX5A 1FY6A 2O7QA 3PUEA 4WY0B 1KB3A 1OFBA 2ZE0A 3WK1A 1XBXA 1TQWA 3QYQA 3THQA 1FDZA 4N4PA 4MAZA 3P61A 1A5SA 5D04C 2Y61A 1GZGA 1BEUA 4AWUA 3VSVA 4FIRA 5CZJA 1MEHA 1XFBA 2EJ1A 4AYSA 3ELFA 4TIMA 3W2LA 2CW6A 1FWSA 2X1RA 4JY8A 3BO9A 1G67A 5H2ZA 1OX5A 3TTSA 3TONA 5E9AA 1SZFA 4JDYA 3ZQ9A 1FWWA 3M5XA 5K2ZA 3UWVA 5U7SA 3IIVA 2J9ZA 4O28A 1OABA 1PVNA 2VRQA 2EQDA 3O63A 1YTKA 4O57A 1BPLB 5D09A 3LLDA 3K8LA 2YA2A 1BWKA 1TPFA 4MFEA 2DZXA 4JL2A 3UCQA 1TRDA 3M7WA 1QI5A 2CPUA 1EUNA 3GX9A 5DXYA 4O54A 1MW3A 4GO8A 3LCIA 4LC6A 1UA7A 2ZBTA 4DO5A 1X6UA 2YW4A 4UQEA 3GAKA 1LBMA 3TSDA 3LB0A 4UFJA 3M9YA 2A1YA 2Y6ZA 2C16A 1TQSA 4KKXA 4YMZA 2JBMA 4IWWA 4WY0F 1MVYA 1FX6A 3LTSA 3A5FA 3TJLA 4HN4A 4X9YA 3RU6A 4JTLA 2OSWA 4HNTA 3PBUA 1P1XA 4GQRA 3W7NA 1ZALA 1W5NA 4JICA 4N2YA 3VNDA 1BVZA 2FPYA 4FF7A 1UH2A 1RQHA 3I7RA 1VFUA 3MO7A 4IXXA 2ZZ6A 3UD6A 2IQTA 2WSKA 2XN2A 4O13A 3QZEA 3KL3A 2GQ9A 5CLTA 3HPSA 4QQ3A 2QAFA 1BLIA 4TX9A 4XBKA 2QUTA 4NJGA 1ME8A 1B4EA 3UWUA 1GT8A 2QR6A 4CCDA 1IZJA 1TMQA 1NOFA 2D73A 4FNQA 2ISWA 2CLIA 4JCLA 1LLWA 3S0CA 5LNRA 1JCMP 3R12A 3P74A 4WSJA 1DQWA 5LZLA 2F61A 3SJ3A 1HO1A 3MYPA 1G4PA 1PS9A 3GAYA 5FF3A 2CLHA 3C2OA 4O10A 2Y85A 3NL2A 5HWNA 1LWHA 2YJQA 3E12A 2ZRWA 4O18A 3OVPA 1R2SA 2J9YA 3TQKA 2VNCA 4N9EA 1VYSX 1TPH1 1KFEA 3HG5A 2V5LA 3MP3A 4WOZA 2CWNA 3IRDA 3TH6A 3LM7A 1GG0A 1QX1A 3LERA 4PL2A 5G4WA 3BW2A 3QSRA 4EIVA 1XGZA 4AHOA 3SIZA 1LWJA 2E68A 3VGBA 3EWWA 3NZRA 2Q8LA 1E3ZA 2H8ZA 4JYEA 1QWUA 1W1ZA 2WNNA 3W22A 1W8SA 2Y7FA 1ZENA 3MWAA 1B2YA 3LHZA 5AHLA 2NT0A 2VFHA 2QCHA 2Z6JA 4G1KA 1BSIA 3QW4B 3HF3A 5EBUA 5C2XA 3D52A 1TTPA 3QM3A 2VR5A 1IGSA 3A5VA 4R53A 2GOUA 5F4XA 4M6QA 3W1XA 1RVGA 2YX0A 4YCOA 3DXIA 1H62A 4CCCA 3MHFA 1GJPA 5I3KA 4ZMGA 5A6LA 4JYDA 4Y96A 1TREA 2EAEA 2QCCA 1CLVA 3UYCA 1I2NA 3NQ7A 3SZ8A 3ABOA 4ZL1A 1OX6A 5EMUA 3G0SA 1H60A 1HTIA 4AVFA 4BI5A 1LTDA 3EWXA 1LROA 1V3LA 5LGXA 3BMWA 1O5KA 4DBEA 4U28A 5C55A 2ZTJA 1RQEA 3PBVA 3DKJA 4JTJA 4K7VA 1HO4A 3IJ8A 2QKFA 3STEA 3BSHA 2C19A 1XUZA 3W1UA 1TJPA 3P8IA 4AHQA 3A24A 2ZUUA 3Q94A 3VGGA 2R8WA 2F84A 2FDSA 1K7XA 4B9ZA 1OFPA 3DHPA 5AC8A 3W1MA 3HG4A 2WV8A 4FXSA 2Z2UA 4FX8A 3N14A 2VOMA 2QEZA 3QW3A 4K38A 1G7VA 1J2WA 1XD0A 1MW0A 1UJPA 1Z44A 1X8FA 1X1OA 2V81A 5DLCA 3LHUA 5LNWA 2XIBA 5E0FA 3I7SA 1CIUA 3KLKA 4MLJA 1CDGA 5BRQA 2VEPA 3VO0A 4U2ZA 3HQ1A 1M53A 1PS3A 2JKPA 2J6XA 2ZRYA 2VFEA 4NJHA 2X2JA 4OHQA 4Z1CA 2EACA 4NI3A 5D38A 5TBOA 4OV4A 2V3FA 5FF4A 3DFTA 1EWDA 1WAUA 1VFMA 5DELA 3QQ0A 4DO6A 4OU1A 4NJKA 1M7XA 1ME9A 2VFGA 4AH7A 1UASA 4FIQA 1EA9C 3S1XA 4ADUA 1EO7A 1XC4A 3GB6A 2OYKA 1L9WA 4ZVJA 4UNKA 1LDCA 3KVLA 3G22A 3PUDA 3S8HA 3VMOA 4O11A 1VHCA 3R2GA 4JTTA 4GWEA 1SFJA 4J3TA 1X7FA 2VUYA 3CIXA 3CC1A 5CLWA 2VEKA 4AF0B 5F4SA 1UKQA 1AW2A 2V9DA 2VKZG 1OFOA 2X1UA 3WEMA 4QAWA 5C6MA 2XVGA 1IXQA 4GUHA 3PB0A 1R46A 3MHGA 1UUOA 1G94A 3IV3A 1JI2A 2X2IA 5HR7A 2OSYA 4QM1A 3W76A 1YPIA 2V82A 3MBDA 3B0PA 1HT6A 1OB0A 2FH6A 3BVVA 4DPQA 3INPA 4CN1A 4O8RA 2LLEA 3FFSA 3WJSA 4WOQA 1KBIA 1OK6A 3TFXA 1PPIA 2BY2A 1LOSA 3EX3A 2D3NA 3L2LA 3LRLA 2XIIA 5FESA 2G3NA 4Z1BA 1ODUA 3P5YA 4JFUA 3GR7A 1OYCA 2WSPA 2H3BA 5D32A 5F1VA 4TR9A 1SO5A 3BSGA 3E9AA 1W5QA 1CYGA 1KBBA 1TTQA 4IMGA 2H3DA 4JTFA 4GXMA 3MI6A 4WSKA 1KTBA 1QDSA 2E5DA 3TNOA 3PULA 1PIFA 2EPHA 4UFIA 1F05A 1HXKA 4CVWA 1AW5A 1SW3A 1I2PA 5HINA 1KFJA 3N9RA 5LGZA 5KEZA 2Q3OA 2ZQ0A 3W3OA 4UCGA 4UR8A 3IGSA 1AK5A 2WO5A 2RHGA 4BWLC 2R14A 3G1DA 4Q33A 1SO3A 3NL5A 2FFCA 2F7OA 4JFTA 1YYAA 4CQAA 2VT0A 3EDFA 3VU2A 2I9EA 1QCWA 2OJPA 3W2JA 2QCDA 3WJXA 3EB2A 1Q6OA 2BHZA 1SMDA 2QDGA 5I0DA 3WNMA 3RLUA 3CPUA 3CU2A 3ZSTA 1AW1A 1UBSA 1JCJA 7TAAA 4LVFA 4LVDA 2E0PA 4H8VA 3Q2DA 5D2YA 2TYSA 5AOUA 4X22A 1BWLA 2BWGA 3ZSSA 3Q58A 1OT2A 4FLRA 1OG0A 2Y70A 3LV5A 5BMWA 5HQEA 5HMSA 4JFSA 4GI9A 2FIQA 3W1NA 1CGWA 2QMJA 5DY3A 1ICSA 1JIBA 2RDWA 4NU7A 4UMCA 1VAHA 3D4YA 3BV4A 3KHJA 2HSAA 1QW8A 3M07A 3S1UA 3CZEA 2H8XA 4J28A 3CT7A 3NAVA 3L4TA 4CCEA 2XWDA 1R2RA 2ZFAA 3BLFA 1IXNA 3PSWA 4OE7A 3WELA 3L2IA 4BA0A 1JQXA 1TYGA 4GKLA 1R30A 1V7YA 1M6JA 1PE1A 3TJXA 3BGJA 1TCDA 1TPVA 3OEXA 1EO5A 4FMVA 4Z1AA 5AB3A 2A6LA 1KM6A 3GK0A 1H5YA 3VM5A 4FEZA 2PWDA 3FJ6A 4MOZA 1KA9F 3VNYA 3DFNA 3EWBX 2QCGA 1NEYA 4ML9A 3TIMA 3WJWA 3L4XA 2BXVA 1Q6RA 2FHFA 4IMCA 2CZDA 3LCWA 1UD5A 4UMAA 2WSQA 2YZRA 1KW1A 1WP6A 1WDWA 1KTNA 2XWEA 3G1VA 4O52A 4E2DA 2QUVA 1PIIA 6CGTA 1PAMA 2HS8A 3P84A 3RMJA 2VRKA 3FJLA 4RZ4A 1R47A 4O15A 2CLKA 2A85A 4GIAA 2V2CA 3CTLA 3QPZA 4IGHA 4JL1A 3MUXA 3S42A 2ABAA 1IZKA 1QO2A 1X1ZA 2CZFA 1ME7A 3N2MA 3OIXA 3WEOA 2CZ5A 3G8RA 4IMDA 1FUYA 4K39A 2FB3A 3DX3A 3TR2A 3W1PA 1KM2A 1KWGA 3S5OA 3UXAA 5LNUA 2ZRZA 2V5BA 3BG3A 3A6OA 2J25A 1QAPA 4O16A 2PWGA 1NF7A 1W5MA 3Q37A 4J9JA 4UFLA 3EXRA 4PCTA 4QISA 4GUIA 4J3VA 4BI6A
chains in the Genus database with same CATH superfamily
4WGKA 2FO4B 2P3YA 1ZCRA 15C8H 3LKPA 1FL5B 3QUMA 2JIXD 3SCMC 5KJ7E 4KH2A 2LAGB 5IMMB 2P48B 4GKNB 5CEYB 4ZMZA 2LLLA 3M43A 1Q0XH 2JMRA 1EEYA 2DD8H 2WLKA 3HC4L 4G6FD 1NFPA 2DYRB 4C56A 3QORA 3NA9H 4CDGC 3MTWA 1T04B 4CSTA 1YUKB 3FYIB 4EUPA 5CLYA 1CB7B 2BNQE 1XO8A 4NASA 4B0MB 4HPYL 1E1CB 4W5ZA 4LGXA 3W7OA 4N2GA 3AAZB 3LZFL 4GO9A 1BQ5A 4CILA 1ZJHA 1L8PA 3AXKA 3UW6A 6XIAA 1QQDA 4F8LA 3UY7A 2G97A 1TTFA 4IGBA 3MN8A 4JN6A 2GDQA 3E3QE 1Y65A 1ZRQA 1T1ZA 1QFUL 3H1ZA 4E41A 3AIQA 3SUVA 3WTXA 3FL7A 1HVQA 2PNDA 1CUOA 4LEOA 3U46B 3G3MA 1N3NB 2ZOOA 3LV3A 3LEVL 1AQDA 3DK2A 3GMOB 4HA1A 1GOMA 4GUJA 4JO1L 2PW1B 2WWNA 3ES6B 1QA9B 3PQYA 1A6VL 3MRJB 4Q89A 3G24A 3L48A 1LEGB 4M9OA 2Z34A 3HOJA 3NPVA 1QFPA 2I32A 3JVAA 3W75A 3JWNG 3MUGA 2OR2A 3N85L 1AZVA 2HT4D 3ARYA 4EN3A 5BS0D 4YZWA 3W1TA 2YAPA 3LZRA 5L8KB 3NCCB 2B5IB 5FV2A 3S4SA 1GVIA 4H7VA 4WTZG 3TEZA 3GNNA 3GVVA 4J39A 1BJ1J 3O3AB 1AQFA 1SVDA 4N9GA 1TG7A 1X98A 2DP3A 3VI2A 4KO5A 1S9VB 1V7NL 3UPBA 4GXUN 3TO4C 2WJFA 3CLMA 1N0LA 4FG4A 2XBDA 4KHTL 1GQNA 5ENWA 1UUQA 1PBGA 5JZ7D 3BGGA 4MD0B 1G84A 5ID0A 1S9WB 4X8GA 3SDDD 2PETA 5KSBB 3DIFB 1J96A 3CWNA 5D7LB 1XGQB 4BK5C 3W7RA 4WY7H 4GSDH 1L6FA 4HS6A 1TFPA 4N0YH 2E6YA 2PA6A 1OHLA 1YDPA 4JFFE 4QRTA 4P2OB 1C8YA 3VG0L 3ZHDA 3CVHH 1BXUA 1O6TA 3M0YA 3UEZA 3GDBA 1TQBC 3LSOA 2FYVA 1JRHH 4HHWA 4AC1X 4QAIA 1CT8A 2AXWA 2QR0B 2AL1A 3URBA 5LHDA 1A6PA 1VZHA 1BBDL 3LS4H 3NCMA 1M03A 3LMJL 3K6IA 3TJIA 5CJ8A 4JQXA 3NJGA 3S5LA 3A13A 3TV3L 1AJ2A 1ZHLA 2DQMA 4NQXB 3T2LA 1FZJA 3B9KD 5CWSA 3S5LG 5IJCC 2FPTA 3IMVA 2E5EA 1GKQA 3FTSA 4U1SA 1DANU 2BNJA 4GE8A 1IAIM 3O9WD 2F18A 3UAJD 5KSUA 3PPHA 3IGUA 4QRQB 2F58L 1N8IA 1MWOA 3X3GL 4L5FL 3HR6A 3D4GA 2QBWA 2VZVA 2OSLB 1MCLA 2ICWI 3AREB 2C9PA 4LSVL 4XAKE 2D69A 4NZ3A 3E6HA 3ORJA 4JEGB 3ZTCC 3QPQC 3U0WH 4NAFB 5D9PA 4EDXB 3WLHA 3DVGB 2E6FA 3FQRB 3EOSA 5I5JA 3MO1A 3VFTB 2VXTL 4Y0GA 4QOKA 4PI2A 5HHOD 2DT0A 4HPOH 1JZGA 1OGAE 5EEWA 1IBHA 3RGHA 4UDTA 1HAWA 4FI4A 3WQ5A 3R8GA 1SN2A 4NL1A 4HUUB 3TSBA 3QZOA 3ZIYA 4I1RA 1MHHA 2A6DB 4L9LC 5EOCJ 3CASA 2YPLD 4TN9A 1UWTA 1BJMA 3FAXA 4GKOA 4DIXA 4IBZA 4JQIA 1I1AD 1IFRA 3GI8H 4OLYH 3G04B 4J2QA 5I9QC 2G3JA 3C61A 4DZ5A 3FEQA 5TDOA 3QO1B 1LQ2A 1EP1A 3CK5A 2C3XA 1IILE 3NA9L 5EEVA 1X5JA 2WAQA 3OKEA 3R4RA 1GOGA 3GDCA 4YXKL 5JHBA 3O41B 4MNQD 3GBDA 4HOWA 5DVNA 3CEUA 3CYJA 4HK6A 2EDOA 1BLNA 1LM1A 4XD4A 5I07A 3H8AA 3FB6A 2R1PA 4FNUA 5GZOA 3HIJA 5EPDA 2X4TA 3EJUA 4J3WA 1KFKA 3IXAA 1DLHA 2EIDA 3NIFB 5EO0B 1RK1B 5F6HJ 1F3DJ 4K3HA 4GY1A 3CZGA 2MHAB 4N6RA 3MRLA 3M0VA 3BQ5A 1ZVYA 4C56D 1PWLA 1OGGA 3H6AA 5LBVA 1OFEA 1KBGH 1O5RA 1G4EA 2QZ5A 3EX6A 4YNGA 4XO4A 5C0CA 4ADTA 3N3MA 4GUGA 2Z0BA 4IMLB 7CGTA 1B9BA 3B3DA 4MA1C 4Q9QL 4PE8A 1ADWA 2L7JA 7XIMA 2QQNH 1EPFA 5M94B 1QBLH 4LPWA 3DX0A 3CE1A 3MMEB 3W85A 1IT9L 3BVTA 5I76A 4BDVB 2CMRL 5KJRH 3MO1B 3P2BA 4H0GA 5F7MC 3TU6A 4AEFA 4E41D 3BH8B 3KLQA 5IB3A 5HGHA 1KGXA 4PP2A 1RUQH 2F5BH 5C08D 4YXKH 3UG4A 2H3NB 3CZFA 3UNDA 5T1JA 1PCWA 2NLYA 4WRLA 4KUCF 4QRPD 1ELSA 3BKJH 2Z1XA 4WSGA 1LHZA 1R3VA 5B4MC 4HW6A 4IFOA 1MIMH 3S37H 3QI9A 2DLFL 1E8XA 3QV8A 3PHQA 3R7RA 1L6SA 5I5MA 3LQAH 2JKWA 1H7WA 3RX5A 4NY2A 2O6PA 1PLGH 2V5YA 2EXWC 4K3JH 5HATA 4ZGYA 2DLEA 5K9DA 4OCRL 2D2CC 1WUNT 4NLHA 4BH7A 5AAWA 2CNCA 1QR7A 4YSDA 2ZUMA 3ONCA 3YPIA 4F2MA 5D1XB 4JW3A 2O61A 1MQKL 4Q4KA 3U6WA 3ZE0E 1KBLA 2JB6B 3DG6A 3BFOA 2HS6A 3S6DA 3L66A 1NGPL 2FZ8A 5EMYA 1R3WA 5ECJE 1WKDA 2BY0A 3BCFA 1WPCA 3B8YA 1ZLEA 4DP1X 1HG3A 1XKJA 2ESCA 3NPWA 4GGBA 1S9YB 3LKOB 4JBRA 3IFOB 3T8MA 3RAOA 1P7QA 2XVLA 5HJDA 2EH7L 1UQYA 3EOOA 5HGBA 5EU9A 5IB3B 1R34A 3NIDE 5EMLA 1A0EA 4LKCA 2UYLB 1K9DA 3QEHB 35C8L 4TSAL 5GISL 2NW3A 2FJHA 1VIWA 3V5HA 1ICPA 3ABKB 4X9HA 2WQPA 4XI5C 2DH2A 5B38A 5C0DB 2NZIA 3AYTA 3GQYA 5FACA 5KZDA 3NMEA 5ITBL 2ABBA 1S2VA 1VPQA 2V9UA 4Q4QA 2AXGA 1NFAA 3D4CA 5JA9A 3WDIA 1D5BA 4AQ8C 2IOOA 1GSKA 2F1BA 3TZVA 2NOYA 3CQQA 3NGFA 3S36X 1ZV5A 4FB7A 5F3HA 2PDWA 3RDTA 1AOZA 4OT1H 2QT3A 1UOKA 4JDTH 2VL5B 3RWEB 1BD2E 3BOFA 1LO4L 2CKBL 1GAFH 3OO2A 1FLRL 1YEKH 1WZAA 2NQDA 3A6CH 2B3IA 4LLQA 4XKYA 3FQ2A 3SJNA 3S1GA 3UYIA 1VACB 5CJOL 3WLTA 3EYSH 3ATZA 3LZOA 1IL1B 3F65A 3D2UA 1JCVA 3WIHH 2HK0A 4M51A 5CZVL 3PHQB 1N7KA 1YMME 4H1LA 2G75B 1FXQA 1HJWA 3O6KL 4Z7NB 2QYGA 2WXKA 3DKHA 1A4BA 1F3RB 3KM1A 1JF1A 5BQ7A 4NQCE 5EU6A 5D5MB 4POYA 2B7OA 4Q14A 3G6DH 2B2XH 4BGLA 5CSZB 1O12A 1KXHA 4OCWH 2NLJB 3ATAA 1ZPUA 2O55A 2WBJA 5K59F 2V7NA 5IWLC 3DARA 3BI9X 3PFQA 1Y07A 4QF1A 4ZMLA 1E5JA 3LYEA 3AG1B 2KKQA 1ZQ5A 2EXOA 1YEFL 3HA1A 2EE3A 1KIUB 3HPLA 4L8SA 4DTGL 1EOMA 1QLEB 3FQNA 2NVDA 4UTMA 1QNZH 1DHKA 1KCUL 5CPSA 2H0PA 2ZUQB 3C56A 3BKYH 5HHOE 5DFAA 3MXVH 2V5DA 5EOTA 1S7RB 1BZOA 3QWQB 1KTKE 4LXFA 4AX3A 3SSGA 4KXAA 4WNSA 4G6AC 1SO6A 1SZGA 3S3GA 4UTJA 1FWTA 5H94A 1RZPA 2F53A 3KYOB 4GG8B 1X5IA 4M1CD 2CUAA 4N8VB 1XIBA 2KL6A 3D25B 1GQIA 5M5DA 3BIBX 3QNXB 3RCMA 2XVPA 4AISA 2OODA 2J72A 1Q8MA 4ZNCD 5CR1A 1H7XA 1TWSA 1UR1A 4Y4FA 4U1GC 5HD8C 1Z7AA 3KPQB 4BUQA 4I5BB 5JOPD 1H8SA 1SDYA 2C26A 3MUIA 3RWDA 4WKAA 1K2DA 1BZ9B 1QO5A 4QRRD 3UJIL 5FEPA 2QVIA 3U9PL 4ZYKB 3WD3A 1RVFL 2XM1A 1GGCH 3LQAL 3DGBA 1WFOA 4JX4A 2PYED 4EX4A 1XR2A 4KK8C 3O4OC 3W7KA 2DMBA 2CYGA 5AAPA 4XMVA 4PBVC 1QSFD 4C6MA 4F48A 2OTWB 1CLYL 4MDIA 1E9OB 4F9DA 4QRTB 5BXRA 1RLDA 3MREB 1BW8A 5ECGA 4CD5A 2R69H 3GMNB 3JUYA 5EO9B 4BFJA 2DMKA 1N5AB 3NK3A 4ZSTA 1YUHA 1N8OE 4MJ5B 1YJDC 4X7CC 1S78C 3TT1L 4QRPA 2IPKA 2W4XA 2GPZA 5DWUH 4QHKJ 4WFGE 5IJKA 3HRZA 2ZUXA 5I8CB 2X9WA 3N3EA 2WKOA 3BKCL 4NUGL 1AXTL 2OO0A 3SCRA 4DF0A 3UWQA 3UTZB 4FX6M 4L8SB 4JN1L 3FUHA 4PIRF 7ODCA 3ENEA 4TOYL 1RP9A 3BLIA 2EF9A 2OSLA 5GRXG 2CRZA 2ZWLT 4S3KA 4HSQA 1A7BA 1XGTA 5E95B 1QOPA 5EC1A 3OG2A 4NQED 2J24A 1I9RH 1N67A 4Z2LA 3PV6A 5AC6A 3BC9A 1XFPA 4MQSB 3L3OA 3FNKA 5AN7A 3GMLB 1W9XA 3DA0A 3QUXA 3WTVA 4L2LA 1U8OA 1E9IA 4UBDC 5EBLB 1TA3B 2V68A 1FV1A 1D5IL 4JRLA 1E28A 2N7AA 3MRHA 3RPIB 3MFGB 4AZUA 4NQ1A 4BFIB 5ILTH 4TMBA 2ROXA 4OCXL 4KK5C 1NPUA 4FQPA 3DOIA 2D9CA 5C1MB 3KFTA 4Q7DA 4Y2LA 4S1QH 4UI2A 3SQBB 2A7RA 2F68X 3NP4A 2D3VA 3QN3A 4IPPA 4LAOA 3SFWA 4FI7A 4WDIB 3G04A 4BXSV 4ERAA 4IG2B 4H83A 3IE4A 1YE6A 4D8LA 1Q9OB 2Q7NA 5EZOL 3D69B 3RDTD 1FHDA 1HQTA 5KMYA 1I8IB 5JW5A 3KAAA 2A3EA 2ISSA 3OHMB 2QMKA 5G4NA 4ZPTB 1J5OH 4HOMA 4JPVH 1P7KA 1KGIA 2JLLA 3L3HB 1KCLA 1MCWW 4B7IA 2OVLA 2CKBB 4OSUL 4IYKA 1R3JA 3BZ4A 3KHQA 2LU4A 1SBBA 3J7HA 4G9FA 5CO1A 3INOA 2VMJA 1TEYA 5DMKB 3WF1A 4RNHA 4KY1H 3NM3A 5J04A 5AQ0A 2YD2A 2NUXA 4JNMA 2ICWB 3AFLA 4CVZB 4YFDB 2R1NA 4JFZL 3LLFA 5I03A 5F9AC 1CD1A 1QNQA 2L7UA 3CFUA 1YY8B 4OIBA 5EZLB 1N19A 4HVBA 3T3ME 4Y5XB 3N3TA 3PF2A 2K4WA 1A3LH 3E74A 4TQEL 3NQAA 2R7EA 3BN3B 3ZJ6A 1WNOA 5KITA 3AXLB 1DORA 4OIFA 4F1SA 2D0HA 3T81A 2NUYA 3L45A 5A16A 1NAKL 1BQLH 3SCQA 1EAJA 4WI0B 3MNZB 1P9MC 4N8CL 1H6FA 1KB9J 1P53A 5GIRA 3LENA 4HJGB 5L4JA 1MFEL 3CXOA 3BVNB 4PMNA 4IRSC 4IIBA 3I6KA 1JRHL 4J23A 1PZ0A 4GACA 4Z7VB 1XZWA 3LNHA 3RZCB 2YYUA 1HDMA 3M5YA 2IGLA 3WH7A 2FEJA 4AAJA 1F6KA 2OYLA 2FX8L 3LN5B 1SJBA 3TE9A 2VL5A 3NO1A 1SGKA 5C08B 5FEWA 1S9WA 1V8EA 5D4YA 2VX4A 1FHUA 2CLEA 3CD4A 2W3ZA 2GITA 5ADPL 5D2VA 3X14A 3C6LB 4X80H 3OR7A 3VNZA 3H85A 1U3JA 1UOVA 5DUPL 5G55A 1EGVA 3ARPA 4LV9A 2XM2A 1AP2B 1IQDA 3W83A 5ESQA 4CC0A 3CV6A 5IHUH 4H8HA 3T0EC 3TLLA 4TS6A 3VDGA 4P23B 1A6UL 4V11A 1H7NA 3OQ8A 1S46A 1K02A 1OY3B 1RZKH 1QHOA 2EDHA 2KZHA 2NSMA 4FP1A 4CAGA 1T2JA 3ZKXC 4Y16C 5F96L 4N3UA 4DEPB 4HZ1A 2Y8VA 3HMXL 3L1GA 2Q71A 3LA4A 3A3XA 4E9QA 1RK0A 5AW9B 5JOPE 5E7BA 3RUGE 1IT0A 3QEGH 2Z31B 2EH8H 1OX4A 2HMCA 3T44A 3C8KA 4ZQKB 2CLFA 4US5A 5D9SB 1VJZA 1BM3H 2AKZA 4XTDA 3MBWA 1Z9NA 4N28A 1E4WH 3BPLB 1U33A 3HFFA 4MA7H 3F5LA 3THDA 4DAFA 4ZUWA 2DMCA 1TSRA 5DUBA 5C07D 1MXDA 3MYOA 3C75A 1F74A 1RIVL 4NKOB 3LKQA 4YSAA 2Q8AL 5AB2A 3R7QA 1BFVH 3H2OA 5F8RC 4B5VA 3F00A 4OF5A 5B1KA 4ZFFB 1O1ZA 5CC5A 4PMQA 2WLHA 4N02A 1ZHBB 2J8UA 2NXZB 3OD3A 4OF7A 4D8PA 5IFHL 1BPVA 2FGWL 2DZWA 4EIGB 3RX8A 5EO1B 1URLA 3X12B 5JUEL 2F8XC 1FDYA 2J44A 1DR9A 4NQTA 3TCTA 5KW9L 4JUTA 4XP9L 3TA3D 1AZZC 3IFLH 3FT2B 3NPSB 2RFXB 5HHVH 3TXVA 3DX6B 4JEJA 1XR9A 4OD3L 1TQJA 2WBJB 3TA3C 4QROA 3OLGA 1KOAA 1UM4H 1SYVA 2NYKA 4J3XA 5J1TC 2EZ0D 5CEXA 3F4WA 1IKOP 2FH8A 4Z3IA 3WNPA 4M61A 3VTRA 1LORA 4LP4A 3BG9A 1QK0A 3RWFB 3QZMA 3IXAB 5K7JA 4P23D 4OBSA 5GRJH 3IF1A 3NSNA 1EL3A 5TJWK 3FY1A 4M5ZH 2IUZA 3BKJL 3QEZA 2FZBA 3AG4B 4YHYB 4X6FA 4XC3H 3KPSB 4XHJD 3CEPA 5FIPA 3VZXA 1S9KC 1AJ0A 3QJOA 2ZADA 1J9RA 1KFAH 2PR4L 1M6OA 4POZD 3RNQB 3NNTA 3EKZA 3W2NA 3FA3A 5JOEA 1TFVA 5KSWA 1QRND 4DFIA 4NNYB 4HN8A 2D4DA 4FDWA 3RHWF 4IJBA 1T89C 5E0QA 4A2LA 4WWPA 1DBBH 4OF6A 3CPRA 1N8WA 3BPOC 2HTKC 3HE7A 3AHVA 4WO4D 1O4UA 3CXDL 2CIKB 1OC6A 3H7VA 4WENB 3U6XA 3WF0A 2OL3A 2YOCA 5C71A 3ZVIA 4UTIA 2YBRB 2ATMA 1W5PA 2VFFA 4MMXA 1ZHBA 2WYHA 4L2YA 3ULUD 1OW0C 1PTZA 1E5BA 5HPOA 4W88A 4IJTA 4I0PD 4RDWA 4KO7A 1JNLL 3ULUC 1ONXA 3WFZA 4PJ5B 2B81A 3ZT7A 4JTHA 4QS6A 5D7IE 1PY9A 4XPTH 1FNLA 1IFHL 5D2LE 2X6BA 1HEJC 1CFVH 1N4XH 1AQ8A 1IQ8A 4GFTB 5LCVH 3BURA 1HWGB 3IETB 1NCDH 3FBKA 3SCWA 2H2SD 1NC2D 2KPNA 3KGRA 2OMTA 4UIKL 3SGJC 1A5AA 3AHYA 2GY7B 4CNPA 3U36B 2VIRB 4O02B 5FGSA 2FO1A 2V0AA 4MKSA 1R5VA 2H2SC 3GMPB 1B0IA 2GJ6B 3TZFA 1ZIAA 3CPLA 3AQXA 1E72M 4G2AA 5D8WA 2W0LA 3IRZA 4LFHD 4XNYH 2JI1A 3DBXB 3K71B 2PC4A 1HSAA 3W1UA 3K2KA 2G3ZA 3G6JE 4NQXA 2F7RA 1I9EA 3VA2C 3QBTB 3PWLA 4HC1A 3V4PB 1H15B 1YNKL 4PGEB 3BUQA 3TS8A 3RTQD 3TN4A 4AYFB 2XZ9A 2CO7B 2B0MA 3B97A 4PD4J 4PJ6A 1I1RA 5J0BA 3S8GB 3QFEA 4XAGA 4UTWC 3ZE1F 4EXPX 2DJUA 1IEVA 4X9FA 1LCOA 2CW6A 4BV1A 1VERA 3UG5A 1MAKA 2CLLA 4ANWA 5FECA 5CHNB 3WXWL 3EPMA 5TQ2H 4H1ZA 4PJXE 1IKFH 3BKML 3SY0A 2FEEI 4OQTL 4JRYA 5E51A 1MF2L 4AEIH 1F3XA 2CIKA 1YHTA 1YX1A 4AW7A 1E6NA 3M0JA 1KN4H 3BL3A 1S6NA 2FD6L 5EWIH 4ZUTA 4QNPF 2JCCE 2VE6A 4QYAA 4F7CB 7FABL 1T41A 3OG4B 1VPXA 2APWA 3MVSA 3UBXI 3RZCA 4Y8EA 1TDQA 4HGWB 1EXGA 4QEHA 1B4JH 4G6JL 4RH4A 3UO1L 1EGZA 1VCFA 1VD6A 3FA5A 3ABGA 2K4AA 2GBUA 5EV7A 1RXOB 3OIHA 4FFVD 4HXAL 3TQ0A 3LPOA 4OJAA 1E5ZA 4URIA 1WAPA 4OY9A 1PO9A 5DUMH 1HJQA 3LS4L 1JWSA 3WU1A 2EKGA 1T7WA 1UKTA 2BNUB 1I1XA 1OAXL 1GSMA 1DJGA 4YHOL 4BUHA 3QCVL 3H53A 5AVUB 1M3UA 2PDYA 4OQVA 2H41A 3RUGF 2NT1A 2VLME 4DGVL 4JMNA 1E4MM 2KHAA 1G1CA 2IGFH 2EDYA 4GAJH 1HSBB 1FQ0A 3WY3A 2G9HA 4PTXA 3KE0A 4QT5B 4RDQG 2WQUA 3ZGIA 1HHKB 2JFCA 2C13A 1AFVH 2WHJA 4L1WA 4WDUA 5BO1L 3Q1EA 3CHFA 5C9ZA 3G5YA 4AC4A 1HIZA 4A29A 3H42H 3LX9A 4PYGA 4A2DA 1RAKA 3SDCB 1QI0A 3NIDF 3AWGA 4AEEA 1QYGH 1AJZA 3KS0J 1U0QA 2DPKA 1XYFA 3C8NA 2V5KA 1MIEL 3T4YB 3DN5A 3IIZA 3OAZK 7REQB 3B2UC 2CCLA 2HLEB 4N26A 4H6EA 3M6DA 3WK0A 4OZGA 3CZSA 1D2KA 2DBLL 2AV7A 5ITFA 4QDWA 1R3KA 5LN8A 2INFA 5FW7A 1XCQB 4R7XA 4PFEA 5GSVB 3VXQA 5CEZE 1D5ZA 3SE4C 3BMXA 3C9NA 1ECYA 3KPOA 4CGUB 3LKQB 1XTLA 3HZYA 3Q2CA 1K3UA 3AFBA 5EA0L 4D6CA 5BWFA 2WIMA 4M8RA 4QRFA 1F2JA 3E2HC 1RALA 1BQHB 3MBXH 1EJXC 3MROB 2ZWYA 4MNHB 4MTMA 4S10A 3VXRE 3TN6A 1KPRA 3VXSD 4JGDA 5JW3H 2ALAA 3BXNB 2VKXA 5G5DB 3EWYA 3VIKA 3I3EA 5FGCB 4F57H 1Q3NA 2V3DA 5KVEH 3MV7A 5B22A 5KWYC 5KVFH 3VYOA 5I1LB 1OTUD 1AIFB 1AZRA 1FH8A 4AZ8A 3P11L 1T40A 4IS6A 1W1IE 2WINB 2HLFC 5CR8A 3OHIA 1I8KA 4B4FA 2P24B 5ISZB 1UC5A 2NPLX 4AYDC 4U1KA 2X05A 4KKBC 3CO8A 3FLUA 3EJJX 4OD3H 3FXGA 2YKLL 1HN1A 3HG1E 3PPEA 4L3CA 5B8CC 1O9WA 2CBMA 5BO0D 3ULVL 1OXYA 3CH1A 4PTNA 4D6FA 3LJ3A 4P2AA 3RGBA 2ZCHL 3U7YL 2JALA 5DX7A 4FRWA 1T20B 3QXVA 3BUPA 3FOLA 3GLZA 4Z7UE 3ITOA 2DSKA 2O6DA 4JE0A 3MBXL 4RGNC 1QWGA 4KKLD 2IH8A 2WQVA 2IPGA 3CWGA 4YH6A 4AHPA 3F5KA 3O6AA 1DJWA 4C4KT 1JPFB 4JR9H 2YCLB 3UQNA 1WBXA 2PCQA 3GHEL 1KB5B 2CBJA 1HQRB 3GSQA 4PJAB 3STZB 1JV2A 1XEUA 2XV3A 4MA8L 4QWWD 1HZYA 1T21B 4U1JA 2X6AA 2V5CA 2OMWB 1REQB 4S39A 3WLNA 1AL7A 2CWXA 1AGEA 2WTPA 4RAUB 3HNVH 4LAQH 3BWUC 3LHAA 4D9PA 6TAAA 4GYKA 4HJIA 2NY6D 2ZC8A 2AV7B 3B7RL 1NZRA 2F74B 3EHBC 4Z7NF 4TTGA 4S3EA 1DL7H 3MVIA 3V4VL 1NBZB 4M7JL 3RTQA 1UQSB 4GABA 1BM3L 4ZUVA 2QSCH 3VB8A 4UAOC 2ZZ7A 1HE8A 2YR1A 1A0CA 2VISB 1N64H 1VHNA 4PJXF 4XCFH 3QEGL 4OCMC 4L8CB 1O7AA 3ZL1A 1S7TA 2NXHA 3MDUA 4AD2A 3EDEA 3NFNB 1QFWI 3ULSB 4MCYA 1UM6H 3W9DA 3ZDXE 5BRZE 3MRKB 4PV9B 3TMQA 4WHYG 1L6XA 1LRQA 3U1SH 4GZEA 1HX0A 4BQ2A 3MV7B 3HQOA 2BOGX 5F2GA 3T2NH 4MFHA 4F8PA 4G1MA 2WCAA 3BHBA 4P4RA 4LCQA 1QLFB 4HSCX 2WMPB 1TJGH 4C4BA 1G9EA 3BDKA 1GY1A 4PGCA 1XIEA 4Z7QF 5DUPH 4GY7A 1LJMA 4JHUA 4WUUA 3ZTDC 2AGKA 5HK4A 4BJHA 1Y1DA 4LLMB 4EVNA 2QLVB 1AY1L 4UU9A 4MFDA 4R9OA 3OKNA 1JERA 2BV9A 4XMTA 3R0DA 2E1DA 2G2RB 5EZLA 3RDJA 1O95A 3VXUD 4DFHA 3AS0A 1OTUC 1A5LC 4JPKL 1EMTH 4G8IB 5HDOA 3B3BA 1ZVHA 2JXMA 2AXFB 1BKHA 2YA0A 1ZD6A 3P9MB 3D46A 2G2PA 4N1HB 5CBAA 3JTTB 4Q3MA 3H7BA 4AF0A 5BRZB 4X83A 1YBQB 4YLWA 5AHMA 4NX0A 2I85A 2Q76A 3F4NA 2NNFA 2Z4QB 1A1NA 3OR6B 3W9EB 5DHVB 3HE7B 3E5PA 3L8QA 3RILA 3BJTA 3HPZA 4BD4A 1OAQL 4FLOA 5INCA 1UD2A 3BGAA 3NG3A 4TNVF 2E7LA 1I9IL 4UQCA 2QSTA 3MLWL 3KHDA 1I3GH 3VUSA 4KMTH 2FECI 1OCOB 2R2EA 5F1IA 5DJ2B 4DBWA 2Z7WA 4S2CA 1N7MH 4HBCH 2DEPA 6PCYA 3FS9A 2ZRVA 3H9SA 1UROA 3B7SA 5E1IA 2XH2A 2RQ8A 4PJIF 3PGFL 4U3HA 3V10A 3ASWA 4HEPA 4KNQA 2APSA 4JZJA 3I02B 1PJ9A 3RWGB 5CP3H 2AJSH 3A4XA 4HMEA 1ZVNA 3WBDA 4M3HA 1YDVA 1N5YL 3Q43A 1GHRA 2NV9A 4ZQPA 1PFCA 1OF2B 3UTTD 4AE1A 1NMAL 4PUJA 2GJPA 1DWJM 1BYPA 1RUAL 2Y1AA 4OD2A 9PCYA 2GVEA 2ZKHL 3CN3A 4EF9A 1XH2A 1U42A 2P5EB 4GH7B 5SV4A 3AZRA 4OV5B 5EGRA 1AR1C 1EUUA 2FX7L 2WY3B 3CNYA 1RKRA 3WEZA 1XGYH 3P5ZA 3PWVA 1IGIL 2DQTL 2DWEB 4R2GB 1T99A 2AZUA 2R51A 4JO2H 4NUWA 3L08A 3C2YA 2JKEA 2I25N 1ESWA 1G1YA 3UR7A 4CQ8A 1O9ZA 1DDHB 5CCKL 1A14H 4JIQA 1XCTB 3CFIC 1YSOA 2VB5A 4OGZA 4S1QL 1TPUA 3I9IA 5DBTA 1N2RB 4WEBH 4QCFA 4KROC 5E4EC 5D2NB 1IX2A 2BW4A 3N6YA 4R96B 3ZL2A 3L1OL 3QZNA 4HH9A 5DJYB 4BKTC 4F7EB 1LE5A 3DI0A 3GG0A 3CDGA 3CV2A 4YN5A 1SF5A 4BCYA 1DBJH 4P05A 4F2ME 1HINH 2JQMA 2FHBA 3AACA 1ALDA 5E93A 3RJXA 2MNUA 2VJ0A 4JLRA 1PQZB 4MWAB 3WUBA 5MERA 2OQJA 4F91B 2YSWA 2CRIA 5FSEC 4C83B 3WJWA 1UJQA 3HS0B 3WEXB 3BD5A 3LNGA 4HCRA 3C6LD 4YO0B 4BFRA 3D39D 5AKTA 5F6HI 3E6FA 1DE5A 2BWIA 4CUCA 1XIWB 3PY2A 5F7YC 3A3YB 3EYUH 3HAEA 3SPVB 2XGZA 2VVSA 3ARGA 1ZLUK 4XNDA 1O7DC 5G1YA 1MAML 4ORGB 1OQOA 4KVPA 3QR1A 4P2RB 3SCMB 1JN6B 3L65A 4NT0A 3V4BA 1L7IH 4DP2X 1K1DA 3BJFA 4GAFB 1PBYA 5D1QE 4D0BB 1M7DB 2WBKA 1UCBL 4G7QB 4X5XB 1NCCL 3OB0H 4JY6A 5HYIA 3HG3A 4N8PA 3N4AA 4LC8A 5CZXC 3PL6D 2GK1A 2EUVA 4FQIL 3IFNL 1K5WA 3QMSA 1TX0A 2N56A 4H40A 5GGVL 3TEYA 4X7SH 1OK4A 3PHSA 1LRNA 3B03A 1JPSH 2FNBA 3DDFA 3MRNB 4M93C 4NRYB 4H8NA 3CXHK 2C9RA 4M5PA 4Z1DA 4AQLA 1QEXA 1YYLL 3GSNA 3LIUA 3O6FD 5BCAA 5CXPA 1FVEB 5EMMA 1E5AA 1FYTA 4HJJL 4M7TA 3WD0A 4NF7A 1IIIA 2PE4A 1T20A 3VWKD 3DI2B 5IOKA 3SQSA 2A4EA 2KAUC 2J1KA 3HHSA 4S0TD 4GFXA 4PL1A 1DL3A 4LSUH 3DRTA 5AZ1A 4WFGD 3TAOA 5JXQA 4UQDA 2ZOKA 1KYFA 3D48R 4UIMA 4WUKL 5J9PB 2IPFA 3L9RA 2XTJD 3FIGA 1A5OC 5FO7B 2Q8AH 5EZIL 4XH2A 3ZRCC 4E41E 2ZZ4A 2BGNE 5CKSA 1K6AA 4JKLA 1MELA 1A8ZA 5IQNA 4HSNA 4QG9A 4YDJA 1ZS8A 5HI4C 2IQDA 5DC4B 1K8DA 1S5TA 4YXLH 3QCTH 2A73B 3GTVA 4A3HA 3QE5A 1LK3L 4M5SA 4O2EA 1FQ9C 4Z7VF 5AG8A 1RVKA 2EP6A 3EXTA 4WI0A 4XC1L 5HVGB 2NSXA 1PHWA 1XIDA 5JNYA 2A5HA 2EIEA 1CPUA 3N42F 4JZNB 2BCKA 5MERB 3GEWB 3NRFA 2XQ0A 3ZT5A 4CSPA 1VENA 5DVPA 3WENA 1DVJA 2NXIA 4ORIA 4C7DA 1UIPA 4REQA 5G1TA 4I1PA 1KPRB 1XXFC 1DQIA 3KBEA 3TW9A 4RZ5A 1LEIA 2V5MA 3SKJL 4UZGA 4M81A 5ANMB 2XG4B 1VRDA 3SFKA 1VZWA 4NCC2 2I7SA 2FWLB 2BZNA 4NIRA 3SDAD 3WN5B 4LLDB 4YSEA 3AT9A 2V6AA 1CD9B 2DIBA 4PHXA 4K71C 4QX4A 4NNXA 5FM8A 4KEVA 4AZGA 4XO5A 1VZIA 1FA4A 1TVPA 1TSIA 4DGWC 2G5UA 2ZIDA 5JW4M 4NJ9L 4NHUA 5DVMA 1KNOA 5B38G 3EX4A 3TU9A 4YSQA 1Z9AA 3NJXA 4RQQB 4XMKL 3NZPA 4I7UA 5I1CH 4OVUA 1BA9A 3KP1A 5DD3L 1DSFL 2NX1A 4GVHA 4CVXB 5XINA 1WS7A 3ARDB 3JYBA 2AXJA 1JHLH 2YKKA 5HI5C 1AVAA 2YUXA 3S97C 1E9LA 1W6TA 3U2CA 3FTGA 4UINH 5F7NC 2PDUA 3WFBL 3HTLX 5LO7A 2XYLA 1S78D 3MJ6A 1NL0L 3EJPA 2X4NB 1XLEA 5DJDA 5FCSH 4IBUA 1DSWA 5IR1B 3QMTA 1P5BA 1EDQA 4I2XE 4E9LA 3LI1A 2B77A 3QUKA 2VDPB 3GPSA 4UQ9A 3WFCL 1E6QM 2RDXA 4O19A 4F7MB 1OAQH 3T4CA 4F33B 5D33A 2ZOXA 1HEZB 1NAKH 4JR9L 2A73A 3BLLA 4ZW5A 5F2MA 2ZXDA 1SFLA 2E6AA 1YN6B 3BZFA 5T33L 1TPB1 3H54A 3OR6A 2NXYD 1KCWA 2QL1A 4JANA 1FE8H 2YLHA 3ETBJ 4JX5A 4JVUA 5TAOA 4A3YA 5I3IA 3CUXA 1CN4A 3M4HA 5I71C 4L8CA 3SGDI 3UPCA 4R27A 3TQVA 3VSUA 3ABLB 1WFIA 1FFOA 2XKNB 3GTFA 3W0KA 5BZZA 5CC7A 3VE0A 1NC2B 3OSKA 4LVGA 5EMKA 3LKPB 3URAA 3MY9A 1RUKL 3T3MB 3CSGA 3JTSB 3Q5OA 5DD6B 5IFJA 1WFMA 5ABTA 3EOBB 4LF3B 4K3EH 2Z1VA 5ID0B 2Y2WA 4X9BA 3UPRA 2XPKA 4Y5VA 4PJFF 4Y19B 3CLFL 5LAXA 4CQBA 3L2NA 1BMWA 5CJXC 3GVRA 3RIFF 3RFZC 1YDNA 2POZA 5HY9B 4Z0BL 5E08L 5LDSA 1HWWA 3SEPA 2WBGA 4HBKA 1KXTB 3D39E 3RWJB 5B7ZA 1JP5A 4KK9C 2B3RA 1MFDL 1QWHA 2GIMA 1M9SA 5DXWA 1FVPA 2ZZ2A 3G0UA 1EFZA 4MKNA 5CSRA 4IH3A 5TE4L 4XCEA 3HNSL 2NV2A 4PRID 3MBFA 4HHHA 1RD5A 4HX1B 4K7PH 3C09B 4M6MH 1SPQA 3MR9B 1T1ZB 1W2VA 2WMGA 3DIPA 1J10A 3BOVA 4NX5A 4HUWA 3CNKA 4L0ZA 1A9EA 2W9DH 4LEOB 4P3CL 3U46A 1TG8A 1KPUB 5AHEA 5DT5A 3QLLA 4P5MB 2EIMB 3BYTA 2VLKA 2X09A 3MV8B 1ICQA 3D51A 1AHMA 3R0KA 4U1IB 3T6CA 2F7PA 4BXVA 2B39A 3O6FA 4KX9A 4ASTA 2A5UA 3AOFA 1OEPA 1MI5D 2CMRH 5CILL 4FG2A 3VC5A 3W7QA 4ERGA 2C9VA 2NY1D 4NJJA 1J1XH 4BEUA 3NDYE 4X6CB 5JPNC 1JNHA 1XCQA 1FIGL 2AEOA 4AOFA 2W79A 1L3NA 1G7MA 2MEJB 1KV3A 2J4GA 1XXDC 4NQEA 4R7WA 4UTTC 2FATL 4OGYL 4AG4H 3GHEH 3FEMA 3TWYA 2YPLE 4ELDA 1QU4A 3DZ1A 3GNPA 5I8OH 1KXQE 1YEEL 2RJMA 4MXWL 3T71A 1KTCA 1WEJH 1H50A 4NQCA 5EU6E 1UUMA 5B39G 3TK7A 1T2QH 4PRDB 5AC5A 3DXAA 3QCVH 1TPXB 4WU7A 5ISZD 1BFOB 2GQAA 4KFOA 3FU5A 4HKZB 2ITDB 2XQBH 4LBEB 2OMYB 3FUMA 4R0LA 4U6XB 3H24A 1Y5XA 1K8IB 8XIAA 1WCBA 3OF6A 3E9UA 3SCMA 1PCKA 4V27A 3BVWA 5JBEA 3MGOA 4LSTL 5T3ZH 1QLEH 5I2UA 2WZPA 2O6FA 2GI7A 6PAZA 5HXMA 5D7SL 1RJLA 1DKWA 3RNDA 1A3WA 3T4AB 3F1QA 4I7WA 1FO0H 3OKEB 4HU8A 3W84A 5HHNB 3PIQB 2GJZB 4X5RA 5J11C 3A4WA 1JDFA 1DHPA 2CLOA 4N2HA 4AV5A 2BXYA 4OQTH 3OODA 4RSYA 3FB6B 5IP4A 3LRKA 4D6JA 1NEPA 3DNKA 2DIJA 2UXGA 3QDAA 1U91A 4NZRH 3VNJA 4DWSC 4EWND 2CR0A 1C8QA 4ODTH 3MMUA 3NCBB 4R96A 1LE5B 2FJUB 3TX9A 4R4BA 2XZCL 1GW9A 1DYSA 3C2VA 3W6YA 1CLXA 1PKQB 1NARA 3ZDZF 3DX9A 1E9YB 4FZIA 1PCSA 4BRVA 3RVTC 5F71A 1NUDA 3M88A 5ALCL 3AYSA 5CSGA 3DENA 1ACXA 1FLTX 4QOKB 1JRCA 3CVHA 4NC1E 3CSYA 4WEBL 1G69A 2YBTA 1VFAA 2IXQB 3LQGA 4Y5YC 5I3DA 4MF4A 1ET5A 3ABQA 2UZIH 4H8UA 1AOHA 3SZ6A 5T3ZD 3K0YA 3PBYA 5HQLA 4YPJA 5AL8A 5FDWB 1UA6L 2JJSA 3UZEC 4BK8A 1TPDA 4Q8NA 1RZFL 4ZQCA 1H0GA 5K1VA 2VDQL 3KPRD 3LXCA 3N1GC 4R0LC 4UM9A 1S2EA 5DJ0B 1WA0X 4B5ZA 4WF7A 4LSSL 1KXVA 5A6IA 1G9NL 1X5MA 1DBTA 4K1WA 2H8PB 1GZQB 1SO4A 1F1AA 1OFDA 4KIEA 2NY2D 4GAJL 4A2HA 3S3SA 4ONFH 4X99B 2MQCA 1JDDA 3E1ZA 5DZPA 2OMZA 3DOSA 2PR9A 3KS5A 3G6DL 2NY5H 4CADA 3NDZA 4IU2B 1JGIA 4O2FB 4LLWB 1S1RA 1N5YH 1AGDB 4MY9A 5KYXA 1S5NA 1KRMA 5JDSA 3VSTA 5DDHA 3ANVA 1V0NA 4WW1B 4QUOA 3TCLA 4N0YL 1S2WA 2ATAA 3HR5A 5IREA 1SQ7A 1VZGA 1ID2A 3LEYH 1E4NA 4YCPA 1LE9A 4NM4H 1HE7A 3H4GA 3BE1L 3HRZC 2CKBH 5D7JA 3PF3A 4R2GD 2XBZA 2NX5B 4K5OA 1URIA 3QFJA 5HDQL 1DOSA 3BW4A 3APFA 4OTKA 3ITVA 5A3IC 1ZHAA 1MF2H 4AEIL 5CBAB 1O66A 3KR3L 3MLXH 5ENLA 1KFAL 4RX4D 5E5MA 4X4YB 4E0RB 4K9EC 2WOQA 3N11A 4RV3A 4XAYA 5TF1H 5HVFB 3LKRB 2X4PB 1TCRA 1T4WA 3FOMA 2IQ0A 1RIUH 1GGBL 1O1HA 2E4FA 2EO7A 1PSKL 2AXGB 4GYBA 5HDBF 3VVWA 5I0YA 2VDLL 1QPKA 4L37A 4N6FA 4KXDA 2J77A 4QIUA 4KNSA 1SW0A 3Q9PA 1Q6QA 4PJ9A 2BY1A 1JSYA 4M6VA 4P4KD 5FB8B 1DQLL 2ZZ5A 3IJHA 4RWYL 3WYRA 3USZA 4LEQA 4HV8B 1AY1H 2XN9E 4OGXH 5ANMA 4UB9A 5CPNA 4LBUA 1QVBA 5KS9A 4OFVA 4G8FB 4MDOA 3QV9A 1AGCA 2O4EA 3SYOA 2ICSA 3ZLQC 1BD2B 5T1MB 3NAAL 4WK0B 4FP8L 2PTVA 3SY6A 4P2RD 4ECNA 1C9WA 3G6JA 1KO0A 4Y7MA 4XAZA 2N0MA 4QE5A 2ZAHA 4G11A 1JMXA 3ZKSD 3DO7B 4M3JA 2G60L 1NTHA 4AE0A 3F85A 2B4CH 1TIUA 3OXRA 2E7MA 3D39B 3HEIB 4WZ9A 4ODSL 3D6NA 4JM2C 3ONBA 3H21A 2PODA 3K30A 2H5UA 2IAMA 3UAAA 2DLFH 4WW2C 4GX8A 1EZUA 3MDJA 4BWLC 3MRGA 4PRPA 2UUDK 3EIFA 3MAWA 4L8SC 3V95A 3IWUA 1K72A 3Q13A 5INDB 4BQ5A 2ZZ1A 3OAWA 2CHWA 3HAEG 5LA0A 1Y7VA 4J6RH 4GB9A 4HK3N 2H2PD 4LCWB 1SJEA 1DL7L 4DW2H 4FJ6A 2WHKA 3IJ7A 3WLIA 3U1PA 5ACZA 3JWDH 3L4VA 3EFOA 3AUJA 3PAOA 1FGNL 3PXHA 4PCFA 4AIOA 2DZVA 4MQXC 1SM3L 3W88A 1JCKA 4R88A 2AAAA 5CF3A 1XLHA 5DHDA 4YDZA 1F58L 3CC5A 4DVBB 5C6TL 4ZX5A 1KUMA 1SBSL 1JDEA 3N18A 4EDXA 3GY1A 4N0UB 1KBGL 2QF8A 1LK2A 1UD4A 4OW6A 5B39A 2Z8WC 2DW5A 1S8DA 1ES0A 3QQ3A 4N90E 3CS2A 4FHAA 4ZTPH 2PGWA 4FCHA 2VFDA 2ID5A 3TN0D 2AERT 4AM0A 3S96B 5I1KH 1JNHB 4YYFA 2B14A 1B1YA 4XP6L 1T1YA 2PWUA 5L2JA 3RXZA 4F8TA 3CHVA 1UVQB 1BJ1H 1XCXA 3FN9A 4NERA 1TUFA 2WQAA 3BH9A 2R1LA 5FYLE 4QEGA 5EA9A 2QELA 3VI3B 4B3LA 1JGDA 4H1LB 4J1UB 3BGMB 4JFDB 4ZSOB 3GNXA 1Y18B 2EC8A 1N6QH 3VXTB 2WYTA 2TRYA 5JU6A 1JXKA 1A6ZA 5GGRB 4RLDA 5C09A 1Q7ZA 5AEAA 3OMZA 5EFFA 3BE7A 3U0PA 2RACA 5LKNA 4NYLB 3IU4L 3OKLB 3OXSA 4QHLB 4OZIE 4D3CH 1T7LA 1KIQB 4PV8A 2H45A 3SQLA 1HXMB 3VXNA 3IPWA 3S1WA 4HX1A 3QC5X 2XIDA 4U4MA 1T66C 2COVD 3EYVB 1XYZA 3HPAA 3FTWA 1ZNNA 3DAQA 3TESA 2GK2A 3Q6FB 1I2OA 2VC6A 2XFYA 3ZTNH 1S4IA 4AV4A 5TDNB 5IOPB 2VDMB 1BQLL 2PB1A 1NCUA 2F53B 4GG8A 4DKFH 4XWOD 5LGJB 3GYEA 3QZWB 2VM4A 5E9DD 2CXEA 3NPXA 3Q8FA 5GGQH 4O1BA 4S3CA 1G6RL 3KYNB 4RCAA 3QJQB 3RMEA 1ZIBA 5D2XA 4KK6D 3MMTA 4A22A 1SZRA 1WIPA 4DJDA 1EFQA 4KQ4L 4PUMA 1EZVY 1K4GA 4GYJA 4F7TB 1W3HA 4DELA 3UWEA 2EE2A 3MA7A 4F15B 2EKCA 2JJSC 2Y07L 3I68A 2NYYD 2EE6A 4ICMA 1UB5B 3AZTA 1E9QA 1UB6A 3V4LA 3O2DA 3KLDA 2Q3RA 4HPHA 5KVDH 4CQCA 2DBJA 4QXTB 1UKSA 1JJUA 1MFVA 1X9QA 3FTYA 2IG2L 3HE6A 5E6RB 1TR9A 1QNRA 4DLMA 3MZGB 3OWRA 4KNTA 4PJCB 1UWYA 1F90H 4UT7H 4FA8A 4FXFA 4XO7A 3WQ8A 4PW3A 1MZZA 4QE1A 5D02A 3CFKB 1KELL 5CUSH 1D7FA 1SXNA 3BOXA 3WLJA 4GUOA 1MFNA 4FC3E 3HI1A 4S0SD 2P3ZA 4Q4IA 1U8CB 5EULV 4Y9AA 3GIZH 3Q2VA 4ISVA 4DX3A 4BFKA 1KLFB 3Q5TA 2QPUA 3ILQC 1YDPB 4PJGF 2XICA 4AVNA 1KJ2H 2J5LC 4IOIA 4HXAH 4D2NA 1UOZA 2BY3A 1NMCC 4UTTA 3LSOB 4UMBA 3C86A 2P42B 3CZ8A 4NNAA 4XRCB 2B1HL 3ET9F 1VH7A 4EZMA 4Q52A 4RQQA 2BOEX 2AEIT 4DEPC 5F4WA 5AWNL 3DUSB 3ZMNA 4QRNA 2UVEA 1GQJA 3U7BA 2L4OA 4UTKA 3P0WA 4GIPD 4GVIA 1G7QB 5G5IA 3TEXA 2ZX7A 1LK3H 3IFOA 2DWEA 1E5CA 2HVKA 2ICWA 1GVYA 5I6SA 1NEZB 4PBXA 4PUBH 5AB9A 5IHLB 4LRTA 3S34H 3VKBA 4KOCA 3IMRA 1F45A 3CAWA 5KBLA 2FJHB 3H9SE 3MKGA 3BPLC 1A53A 1TVHA 3DX4A 5FHAH 3C5JB 4Z5RA 5REQA 3US1A 4Q6YA 1JZDC 1DJQA 1MCPL 2ZSVA 4M02A 3SKOA 2JK5B 4NNYA 2XGBA 4ROPA 1PZUB 1MI5B 5A8NA 1KYOK