1UASA

Crystal structure of rice alpha-galactosidase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
362
structure length
362
Chain Sequence
FENGLGRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVDYLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rice alpha-galactosidase complexed with D-galactose
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
molecule keywords alpha-galactosidase
total genus 134
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.22: Alpha-galactosidase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1uasA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1uasA01
4BWLA 2WCSA 4CQ8A 4AMWA 3VNYA 1Z44A 3E0IA 2JKPA 4GUHA 2PRHA 3BAXA 1ME8A 3KOFA 3C56A 5LNUA 3DBPA 2ZZ5A 3DFTA 5G2WA 1S5WA 3G1FA 3WY3A 1VYPX 1EWDA 3FEMA 1OB0A 2C8NA 3TV8A 2E68A 5BMWA 4ZMGA 3ABQA 2Z1KA 2PWEA 2ZTJA 4HHPA 1VFOA 3CU2A 3RLVA 1VYSX 3NZ1A 3QJAA 1UCWA 4FHAA 3UPWA 3B05A 1GYNA 3FJ6A 1KM2A 2V82A 1JDAA 1JCXA 4KFNA 1O5KA 3BAYA 4MKNA 3UERA 1CXKA 3LRMA 1JF5A 4QAIA 1XXXA 2C16A 3L5LA 1G69A 5G4WA 2VENA 4LTSA 3MI6A 3PB0A 3PS7A 3K8MA 3PSVA 3K30A 2F84A 1SZEA 4UCFA 2CW6A 1E3XA 1K3UA 1I45A 2C1HA 2A6LA 2WNNA 1G7VA 3MYOA 4O1BA 1PHWA 3BLIA 2DIJA 2EO7A 2BTMA 4HIBA 3W1XA 4IQLA 1FWSA 5I3KA 3BSHA 3TW6A 4M7SA 1BTMA 1RR2A 3LTSA 2ZXBA 4LW7A 3ZOAA 4NJGA 1VB9A 5EYWA 4HNVA 3I6RA 3PR2A 3G0SA 3W7GA 3O07A 2TYSA 2RHGA 1J0IA 3WNOA 3CPUA 3W2UA 2GJLA 2Q3RA 1JFHA 2QCFA 1ALDA 4RXFA 3WJSA 4K38A 3T40A 4O28A 4W93A 1TRDA 3HO8A 5I3IA 2B7PA 3ANYA 4MPQA 2EF9A 3N9RA 3KL3A 4JYDA 4MOZA 1ZNNA 1C9DA 1OK4A 4JX5A 1XCFA 3CZNA 4MLRA 2ZRUA 1KXTA 1XI3A 1YDNA 2ALDA 1N55A 2CWNA 3WENA 2ABAA 3HOJA 1E3ZA 4WOZA 5C5YA 4UR7A 2X1TA 4M6PA 2HMCA 1H60A 1AL8A 2F7OA 4E2OA 2NX1A 3DXIA 4IMDA 3HPXA 2DH2A 4DBDA 1CIUA 4K8EA 3UG4A 4MY9A 1A53A 4LOCA 3UY7A 3GNDA 4K39A 4L4LA 4EOUA 2WNQA 1U5JA 3GDRA 1KTBA 4TIMA 1M7OA 6ALDA 1R47A 2Y5EA 1MSSA 4Z1CA 2ZRVA 3LM7A 3EJSA 2CFFA 1JD9A 3LLDA 4GE8A 3D52A 2FDSA 4Z0SA 2GVYA 4IXXA 1GYLA 3TXVA 2YA0A 3EWWA 3WEOA 2VOMA 4JFSA 3GR8A 1D7FA 5LNVA 1CX9A 4TMBA 3BAKA 4IOTA 2ZX5A 3LXAA 2PWHA 4NZFA 4DO5A 3Q2DA 1A5CA 1DOSA 3SJ3A 1CYGA 2D3NA 3W7IA 5F7UA 3LBMA 5D2TA 4N6FA 3EWYA 4AWTA 3P61A 3L0GA 1DEDA 5D32A 3LOTA 3W85A 2GOUA 4ZQCA 1OG0A 1O95A 3W1RA 3LCWA 3ZR4A 5D09A 3UWYA 5KMYA 3CPRA 3HJEA 3N9SA 1Q6QA 1MW2A 4KWUA 5K4ZA 3ZSSA 1KM3A 3P8IA 1Q6OA 1OSEA 4U28A 1VGAA 1O4UA 1JCMP 1Y7VA 4LV4A 3NQAA 2YFOA 2ZTKA 3WNMA 5J5RA 1TO3A 4JCMA 1G7UA 4OV4A 4WUIA 4U4MA 3KXQA 3PUOA 4UTTC 2ZXDA 2EGZA 3VGDA 4O18A 4QQ3A 4TX9A 3I7QA 4IX0A 2J24A 2E9BA 1OYBA 4JCLA 2NUYA 2QCHA 3NZRA 5HWNA 1CXHA 3E12A 1SZNA 3DHUA 2WOQA 3G8RA 4E2BA 2WSPA 2YGYA 2X2JA 1SQ7A 3VNDA 3NA8A 5T26A 2DJXA 5KITA 1V3LA 4PC8A 4UMAA 3S6DA 3K8KA 3NNTA 4NQ1A 1Q3NA 3L0KA 5G2IA 3W7HA 2JGQA 2V0TA 4JTEA 5AC6A 2NSXA 2Z1BA 3OVRA 1R34A 3HMJG 1IXNA 3EKLA 2Y4SA 5AOUA 4BI7A 4WXYA 1ME7A 1QR7A 2FPYA 1SO5A 1DHKA 3T7VA 3GKAA 2A85A 2BWGA 3SR7A 3TJLA 1J0KA 2Z0IA 1Q6RA 1H62A 2QUVA 4HN4A 4UQ9A 1O94A 4HT3A 1WO2A 1YXDA 1TQUA 3I68A 1UD8A 2C19A 1MFUA 3NPVA 5G1YA 1FUYA 2J9YA 1CXIA 4JTUA 2NXHA 4CNPA 3IJ8A 3VX1A 4WQ6A 4M19A 3A5VA 2YA1A 3USBA 4JY8A 1TMQA 2ZZ7A 4UNLA 3WJYA 2B7NA 1P5BA 3DI0A 4RZ6A 2Z6IA 2OW7A 3E02A 4PCSA 5AHNA 3EDKA 1G4PA 1YTKA 3P82A 2H3DA 3LCGA 4PEKA 1K03A 3B0VC 1EO5A 1LORA 3N2MA 1WXJA 3LERA 4NU7A 1WDWA 3VGEA 3NQEA 1HX0A 2E8ZA 4AEEA 4OQVA 1A5AA 1FX6A 2CZ5A 3C2OA 1HNYA 1DORA 1YPIA 3G8EA 3WJZA 2VR5A 3N73A 2FB3A 5CLTA 3T4CA 1ZAJA 2XN2A 2QDHA 1MZHA 1OFEA 1W56A 1T0OA 1HG3A 1OX5A 1RV8A 3W2KA 3M5YA 5L9FA 1BEUA 3A5FA 1GJWA 1ZHAA 3G18A 3TSDA 1J0JA 2DP3A 1W3NA 2ZZ2A 5E93A 3THAA 1TQWA 2XN1A 1K7FA 2I9EA 2VRQA 1K7EA 5KEZA 1XSIA 3ABSA 4JDBA 3ABRA 1K8YA 1PE1A 1B0IA 1CGYA 3TCEA 3UQNA 3VSTA 1CI1A 3ZSTA 3N19B 3GXTA 2YR1A 1VR6A 5C55A 3VE9A 3VGFA 4PH6A 4MJMA 3R89A 4ORMA 3HPSA 2YA2A 2OMAA 1BG9A 1GVRA 4WOQA 2CLKA 4MAZA 1RQBA 1OX6A 3T55A 4X9SA 3LX9A 3L66A 3H54A 2H90A 3QF0A 1IZJA 1HFBA 3W23A 3BG5A 3DFPA 3BUPA 1X8FA 2BY0A 3LPOA 1TQXA 4GUIA 1THFD 4AHOA 1E51A 2ZX8A 1KW1A 2QDGA 1U2YA 2QCCA 3C3NA 3DH7A 3M44A 3OG3A 2OW6A 1PIFA 4YXGA 2QPUA 3MMTA 4GC4A 4WY0A 3QGVA 2YZRA 3DHPA 1R2TA 2ZXQA 1V3JA 4ZQRA 1GPWA 3M47A 1AG1O 1QPKA 1LCOA 1ZAHA 2YYUA 5F4SA 4U3CA 4Y8FA 3KVJA 1PPIA 3ZWTA 2NV2A 4FX6M 3KL5A 1B4KA 2OJPA 3WDIA 3W1PA 1ONRA 5G2HA 5LNSA 3ELFA 4PEEA 4HA1A 3O6YX 1TCMA 3C2RA 4JIPA 4LV9A 1ZALA 4Z1BA 4U2YA 1RZMA 2P10A 3G1VA 4AIEA 5K3VA 3NPXA 3EJTA 4CN1A 1QHPA 2G97A 3VNZA 2TMDA 4GINA 1ZJBA 1WBJA 3W1QA 2F18A 3KHJA 1MXGA 5EBUA 4LU0A 4ZZ9A 3VMOA 1JRBA 3EDFA 1GVIA 3OLEA 5K7JA 1FWNA 3GYEA 1I75A 1D3GA 2CLMA 4MY8A 4MJZA 2BSLA 1SSDA 3T78A 3LTPA 4GKLA 4UR8A 5C6MA 1H7OA 2ISWA 3LCIA 1NVMA 2YW3A 3L4VA 1JUBA 5HUOA 2F61A 4LPCA 1TQSA 3VCRA 2PRMA 4O16A 5CZJA 3W2JA 5IBXC 3T44A 3PM6A 3EJPA 4A29A 4LXFA 5SWUA 2E6DA 2BHUA 2E6AA 2QMKA 3W7MA 2GUYA 1RQEA 3W7KA 1PS3A 5DLCA 4UTTA 1OFBA 1W37A 1L9WA 4PSPA 1EH9A 2ZUTA 5A2CA 3TFXA 1FXPA 3MHUA 4CN4A 3TQKA 3SFKA 3BMVA 1PHQA 5BOOA 4JX6A 1YDOA 1NOFA 5BRPA 2TSYA 3P84A 3WK1A 3R13A 1GT8A 2RDTA 1SW0A 2WQPA 4PA8A 1TTJA 5CPMA 5C2XA 3W37A 3MP5A 2V3FA 3L4ZA 4N9DA 3VI2A 2E8YA 5BRQA 1Y0EA 1GJUA 1UASA 3MHGA 3LPPA 3R2GA 1S46A 5HMSA 4CKQA 3W75A 1KB3A 3LXCA 3L65A 1MWOA 3PVFA 4K8HA 2JK2A 1MW3A 1RP8A 4NXKA 3LLFA 5AHEA 1FCQA 2PRLA 2HTMA 1OX4A 4N9EA 1ZJIA 2V3EA 3EJQA 8CGTA 1QPQA 2VEIA 5D04C 3BLBA 1AK5A 3EXRA 4HNTA 2C14A 2XVLA 4YCOA 2VFGA 2DIEA 1TPB1 3AJXA 3VGHA 5LHEA 1UKTA 4AIOA 1ICPA 3TAOA 3GX9A 4TR9A 4LVDA 4LRSA 2EAEA 1R33A 3GXMA 1MEHA 1SW7A 3VM5A 3FYPA 3G1SA 5FF2A 3EX1A 3W9ZA 1LOSA 2GQ9A 3GXDA 3TXZA 2EAWA 3P7YA 2CZDA 4G1KA 2DZWA 1VJSA 3UG3A 3S42A 1TQTA 3BAIA 5E0FA 4AHPA 4AWSA 1C8VA 3HPZA 3O8AA 1QO5A 3FYOA 2NXGA 3MBDA 5FF3A 2Q8ZA 1YADA 4AMAA 2OSXA 2DZTA 3R12A 4XTIA 1MEIA 1TV7A 4UMCA 2ABBA 5FEXA 3VSVA 1SO6A 1MW0A 3SY5A 1AW5A 2W6RA 1WOBA 2CZEA 4AAJA 3OLDA 2VEMA 4HPJA 1CGWA 4OKDA 4GXMA 5F4XA 2ZX9A 2EACA 4O14A 1VJIA 1Q6LA 2BY2A 4UCGA 3UXAA 3GBEA 3PSWA 4KWVA 4GQQA 4NZJA 5K9CA 1MW1A 1JAEA 5FI8A 4ICNA 1XH2A 1OGSA 3KVLA 3RNDA 1M7PA 7TAAA 3CEUA 1F73A 4JTJA 3V75A 1KV5A 3UYCA 4LNYA 6TAAA 4CQ9A 1KXHA 3DFNA 4WX2A 3EX3A 2FHBA 2GPTA 2WVVB 3WNKA 2I1OA 5C54A 5HPOA 3N3MA 5LGZA 2NZLA 3OVPA 3TW7A 4RX0A 2H6RA 3WFZA 3O63A 4NXSA 1KBBA 5GVJA 1DJQA 3I7RA 4O1CA 2XIIA 1D3HA 2R8WA 3SGUA 1TPH1 3L4UA 5EKYA 4JIQA 1X7FA 4NJIA 1EO7A 4LT9A 3UNDA 1KM0A 4QAWA 3SSJA 4B9ZA 2P1FA 3C2EA 1QMLA 2ZUUA 1JDDA 2NT0A 1H7NA 1DBTA 3CT7A 4MZYA 1VQTA 2ZBTA 1H1YA 5D37A 3BCDA 4AHQA 1N7KA 5TD4A 3U2OA 2ZE0A 3BLKA 3STEA 4DQWA 4OV9A 1PCWA 2E4TA 3SECA 1FWWA 3UWUA 4UTLA 1V5XA 5F2MA 3UWQA 2OYKA 3W2NA 2X16A 1T99A 3EX6A 1WV2A 3FKRA 4N6EA 3W7PA 2A2IA 1G5AA 3CTLA 2AQWA 6TIMA 5E6ZA 1MXDA 3HBLA 3GDLA 3PUEA 5EL1A 1PIIA 2HSAA 3DHFA 1FXQA 4FIQA 3TE9A 1I8JA 4O19A 4RV8A 4CCDA 5DN1A 1K7XA 4AF0B 3DX0A 1NF7A 1LTDA 4HPXA 5AHLA 3TFCA 4J3SA 5HINA 3BUBA 2FB2A 3CWOX 1JDCA 3WJWA 1TV8A 1F74A 3KWXA 3WMSA 3WDJA 2GVLA 3BC9A 1EPXA 3BW4A 2B7QA 2CU0A 1XH0A 3ZT7A 3W1UA 3GB6A 4OGZA 5H91A 1T8XA 4UFLA 3S1VA 2H8XA 1UOKA 1KGXA 3WK2A 2ZZ3A 3S1WA 2ZDRA 1G1YA 1UH4A 1L6YA 1BKSA 5A6LA 3PG8A 2BX7A 2XVGA 1R2RA 3VE7A 2CLHA 4L4MA 5FEWA 4N9BA 4JN6A 3W71A 4WY0F 3GDMA 5AHFA 1DKWA 4UTMA 2FH6A 5KINA 1FCUA 2GVGA 1MO0A 1I2PA 3KEHA 1WYIA 3PC0A 3RLUA 1OJXA 1H7PA 2AAAA 1WQ5A 1F05A 5CPLA 1JR1A 2WV8A 1PEZA 1J5TA 1N8FA 1WAUA 4NX5A 2E1DA 1CGVA 2FQIA 1E43A 3WK3A 2H3BA 1PIGA 2ZICA 4CCCA 1W5NA 2J9XA 4JTTA 1U83A 3STCA 2Y61A 4O0ZA 4C1LA 1HO4A 3FAXA 1TRIA 4MYAA 5EA9A 3VKJA 3KX6A 1C29A 3P60A 3NR0A 1A47A 5DY3A 4JS3A 4FEZA 4U31A 4XKYB 3EXSA 1ADOA 4FX7A 3WEMA 1PL9A 1I2OA 3IJ9A 4UQBA 3IGXA 5TQLA 3QW4B 4UMBA 1K8XA 1SMDA 5AHIA 4LC6A 3BGGA 4O13A 4CN6A 2QCLA 3U8GA 2UV8G 5I3FA 1MFVA 1G67A 1BWLA 2F2HA 4JXCA 1IIGA 2BXVA 4WY0B 1AMKA 2R91A 1RQHA 4IUOA 3MW7A 2IGTA 4MIMA 5CPOA 1ODUA 1IIHA 4TMCA 2OYLA 1QAPA 4J9JA 3L4TA 4KMQA 3S1UA 5DXXA 2X2IA 3QYQA 5DELA 4OBTA 4A2RA 2EHHA 2QF7A 2ZCGA 1KV8A 1LOLA 2X1SA 4PL1A 4UQCA 1F5ZA 1XUUA 3W7JA 2VFFA 2VNCA 5LNRA 4GJ1A 2WPGA 3DU0A 2V30A 4X22A 4N2YA 4DPQA 3A6OA 1UUMA 3W76A 1BAGA 2ZX7A 4WSJA 2W79A 2Y63A 3AO0A 4NNBA 4OWGA 3EWUA 4UZUA 4O17A 2DZXA 3DFSA 2X2HA 1HVXA 4HSNA 1OFPA 1ZFJA 1I2NA 4IMCA 3NG3A 4HNUA 5AB3A 4HP5A 1W8SA 1HL9A 3KVMA 2F7QA 1XC4A 1CGUA 1TV5A 4OE7A 5CGMA 4UFJA 2X30A 3LCFA 3L2MA 2O7QA 4Q32A 4RCXA 4FXSA 3QH2A 4K6AA 5DCEA 3LHZA 3O6CA 4Q33A 1EUNA 1UD6A 3GAYA 5CKSA 5FEPA 1SUXA 1FDZA 1SMAA 1RP9A 1M6JA 1XCWA 5A8GA 2YOCA 2QUTA 2XWDA 4R33A 3I65A 4FMVA 5D2WA 3VX0A 4QNWA 1TPUA 4LVBA 5LGXA 1KFLA 1TJRA 3FW6A 1H7RA 4PODA 5K4XA 1E40A 3W70A 1KM6A 2FHCA 2ZA2A 1VFMA 1QDSA 1H7WA 1YTEA 2WKJA 4JR5A 4FIRA 5ABTA 3VU2A 2C7FA 5LZLA 2PCQA 2OYMA 3BPWA 3G0XA 3C0JA 1B9BA 3NAVA 2FLIA 4MY1A 1C8QA 4Z0JA 7TIMA 4JDYA 1JI2A 4HSOA 4AWUA 2JKAA 3QPYA 3OVQA 3O16A 3A23A 3SW6A 3LB0A 3B06A 4N02A 3W74A 4MLJA 2CLLA 4UNKA 3L0NA 2WSKA 2PC4A 4J27A 4NJKA 3W7RA 5G1TA 1GVFA 2F7RA 1NSJA 2VFIA 3C52A 1VRDA 3TUUA 4J3UA 5I3HA 1R30A 1OF6A 4XWUA 3BVWA 3QM3A 5EY5A 2A6NA 3TROA 5J5DA 2RKXA 2ZQ0A 4J3WA 4AMXA 4AB4A 4AVFA 3NQVA 2QUUA 3MP4A 1XBZA 3A9IA 1QOQA 4I7VA 4I7WA 3U6WA 2VELA 4ALDA 3W07A 3Q37A 1Z41A 3IIVA 2VRKA 3L21A 2JGYA 3LGEA 1GZGA 4U2ZA 3GVGA 3CLWA 1W1ZA 3TK7A 3A24A 3BAWA 1DHPA 1W0MA 4BZYA 3EWXA 3S5YA 3QSTA 3WFAA 3LRKA 2ZUSA 3NQGA 4UTJA 4LC8A 4KFOA 3RMJA 1VCGA 4ADUA 3LHVA 1SR9A 2EADA 1B57A 1YXCA 3FKKA 3L4YA 1S3HA 2CPUA 3II1A 1UD3A 3A4AA 5CGTA 1FDYA 2PWGA 3HG4A 2QJIA 4K36A 5EMUA 4HNNA 4LY8A 1XV8A 1QCWA 4MFDA 2Y85A 3GTNA 1VZWA 1TSIA 2VFDA 2V3DA 2AGKA 4GUGA 3OLIA 4PTNA 1FY6A 1H5YA 2EKCA 3ECQA 4EF8A 2D0HA 3ZWSA 4QIUA 3LCLA 3S5ZA 3NQ2A 1XDMA 4AEFA 3JS3A 1X1ZA 1XH1A 1QWNA 4JYEA 4UC5A 1JXJA 4AYSA 2Y7EA 4PCTA 4O53A 5CSSA 1DV7A 4M6QA 1H3GA 3TOPA 1KM4A 3GLCA 2V2HA 3L67A 4OT7A 4Z08A 2VEKA 4DF2A 4NT0A 3E9AA 4O57A 3A21A 4LUJA 2W0UA 4NJHA 1YXYA 1W5OA 3KVKA 3GNNA 1LDCA 1JCLA 1TPFA 1UA3A 2VC6A 4JFTA 1L2UA 2CLEA 1WX0A 2RFGA 3M5ZA 3W7EA 4Y9AA 2QJGA 1CPUA 2DORA 3B8DA 4J3TA 1AVAA 4PSRA 3QFEA 2PE4A 3Q58A 1OT2A 1KFJA 4N4PA 4M8UA 3TKFA 4ZL1A 3LHWA 4Y96A 4LWWA 3DKLA 2ZUVA 3S0CA 3QC3A 2CXGA 1EP1A 1VCFA 3DC0A 1SZFA 2Z6JA 2KZHA 1JXKA 1W9XA 2P0OA 4JICA 1QW8A 1JUKA 3G1YA 3F03K 3JRKA 4UZSA 5FEZA 4WSKA 1EEPA 4GQRA 5I3GA 1DJNA 2YDAA 3IVUA 5D2YA 3CC1A 3CLMA 3G24A 2WCGA 4O52A 4MYXA 4RLIA 3HJZA 1MVYA 2PWFA 3P81A 3ZR5A 3W72A 4UFIA 1QO2A 2IQTA 1OFAA 1F7BA 4FNUA 3TONA 1GTHA 4RK8A 4A22A 2A7PA 5H2ZA 4IX2A 4JFWA 2V2DA 1RD5A 3L4WA 3NQMA 1GVOA 1KGWA 3NL5A 5A5WA 3EDDA 2OSYA 1QX1A 1KM1A 4IPIA 2A1YA 1IXPA 3WN6A 1DQXA 2QKFA 1HUVA 2Y6ZA 2E09A 1NFBA 4O1AA 3FA5A 1A5SA 1X1OA 3BUQA 3TDFA 1EUAA 4AXKA 5DFAA 2XIBA 1LROA 2ZWZA 2ZX6A 3ZS4A 2FH8A 2XFWA 5BW6A 3G1HA 4AEOA 1XCXA 3D4YA 3P62A 2Y88A 5FESA 3W7NA 2XWEA 4J3XA 3PBYA 4UOZA 4TO8A 1M5WA 3IV3A 4XBSA 5DO8A 4JD4A 2ISSA 3NXFA 3PULA 3AXIA 4RZ4A 4RXGA 2J9ZA 3TAKA 3LXBA 1B4EA 4UNIA 3W87A 1LWHA 3CHVA 2YKKA 2OX1A 3QSRA 1OFQA 4WJEA 3R5EA 4DPPA 3FFSA 2EJ1A 4FNQA 3MWAA 1YLVA 5AFDA 1QNVA 4BWLC 3QQ0A 2QCDA 3KRSA 1LRQA 4P61A 2E5CA 4FLRA 4DBEA 4O1DA 5CZTA 3W1MA 4EIVA 3EWZA 1EA0A 3GXNA 4KWWA 3C8FA 4LRTA 4CVWA 1CDGA 2V8ZA 3EEGA 2NXIA 3M1ZA 3MP3A 2VFHA 1TQVA 3W7LA 4NNCA 2ZZ6A 2FPVA 4MUZA 3LRLA 3F4NA 5HULA 1Q45A 1GTEA 1GVSA 3IRDA 2Y24A 4FB7A 4ORIA 2Y89A 4UIOA 1UJPA 1VS1A 5DBTA 4IMGA 3BVUA 4HPHA 1HL8A 1QI3A 2DH3A 2E5DA 1TPVA 3MI2A 4P2VA 5F2IA 4N4QA 2GJPA 3MYPA 3PF3A 4MB1A 1JIBA 3W2MA 4ZQOA 2WSRA 1G6CA 4GO8A 3TX9A 1DTUA 3BUDA 1RPXA 2B0MA 1L0PA 1HTIA 1XBXA 5FF7A 3IEBA 3QRHA 2WC7A 1KXQA 2FFCA 4FF7A 5LHFA 5CZ0A 2OT0A 2DJLA 3BCFA 4WD0A 1KFCA 2DU2A 1V3MA 1WP6A 3FAWA 1UA7A 3WK0A 3HIJA 4CNNA 2E0PA 2QJHA 3H55A 1TPC1 4WZHA 3DGRA 4YLWA 1JULA 1OVDA 3S9YA 2WNZA 5FF0A 1LBFA 1WPCA 1OF8A 5AC7A 4LVAA 4QM1A 2V2CA 3ZR6A 3BG9A 2NUXA 3C2FA 1ZCOA 3B04A 3IIPA 1JCJA 3IVTA 4JGDA 1UH2A 3WY4A 3NPWA 1XL9A 5E9AA 3IIXA 2GVJA 1ICQA 4BI5A 1KBJA 3VMPA 1J2WA 5E1QA 3B0PA 3VGBA 4UQAA 4HOXA 2H8ZA 2GJNA 4QISA 5HWMA 3MJYA 1EP2A 5TBOA 1QPOA 2FPTA 3ATYA 2VEPA 1UKQA 5HDRA 3WNNA 1OYCA 4A21A 4DO6A 4LUIA 4O0KA 3LHTA 1FWRA 1W5MA 1R46A 1RPKA 4B9YA 4R34A 1IV8A 3KLLA 3KRUA 3M6YA 2V5BA 2ZYFA 2ALWA 2QMJA 1BF2A 5BMXA 4HKPA 2YXGA 2NUWA 1QPRA 4BK9A 5D2VA 3BLFA 4J3VA 3RIKA 2GQAA 4H2CA 2NWRA 4OHQA 2BY1A 3ZQ9A 3UZ5A 4JEQA 3IGUA 3CEPA 5FF4A 4M56A 3HGJA 3W3OA 3QMSA 1BSIA 3O06A 1O7DC 3RU6A 3EX4A 2EQDA 9CGTA 5LNWA 1OT1A 1GWJA 3STFA 1IXQA 4Z1AA 3ZT5A 2J27A 1K8ZA 1QI4A 4UFHA 3OEXA 1AW2A 5AYZA 2WVUA 1TYGA 3W1AA 2GUUA 2YSWA 1XD1A 3NQCA 3PUDA 2C6QA 3STGA 3DFQA 2WVVA 1HT6A 3TTSA 3FJLA 5IM51 4LVFA 1F2JA 3DDGA 3EJRA 1LBMA 2YJQA 1I4NA 3BARA 4IMFA 1TCDA 1TPEA 2EABA 3NL2A 2C13A 4HOWA 5L6UA 3NO5A 1BLIA 1VPXA 3BV4A 4JNMA 2E77A 3NM3A 2F7PA 3DX1A 4ZQMA 3W7DA 2D3LA 1J0HA 2WSYA 5BRBA 3FIGA 1ZENA 2Y7FA 3TA6A 3MI3A 1AL7A 4IGHA 1G9HA 1P1XA 3DX3A 3I7SA 4LQ1A 2FJKA 3HZ3A 4S2BA 1IF2A 3DZ1A 3IIZA 1PS9A 3PBWA 2VT0A 3PWAA 3W6YA 4ADTA 3AJ7A 1NAL1 3IK2A 1W3IA 3BSGA 3PBUA 4GRSA 3EXTA 3LI1A 1TPDA 3EDJA 3TTYA 3RILA 1H1ZA 3BVXA 3PY2A 4H4IA 3D50A 2CZFA 4I9AA 2NLIA 3W86A 3VGGA 2WVTA 1KBIA 2ISVA 3AXHA 3C2VA 2R14A 3THQA 3VO0A 4AF0A 3UCQA 1KXVA 1FBAA 3G1AA 2A0NA 1HTYA 3C6CA 3QEZA 1AQHA 1VAHA 3WJXA 1KWGA 3W73A 1CXFA 3G3DA 4ML9A 2YX0A 4JTIA 4ZVJA 1CXEA 5G4EA 3RFAA 1VHNA 3NEVA 5DCBA 4BF9A 3UD6A 3UPBA 2GQ8A 5AN7A 3UXDA 3VM7A 1YYAA 2J6XA 1CXLA 1LM1A 1ML1A 4ONVA 5F2LA 3INPA 1YTDA 1V3KA 1VC4A 3KLKA 3HG2A 1J4EA 3OBKA 1D9EA 5HR6A 2F7FA 3NPUA 3SI9A 2JBMA 1M7XA 1KCKA 4GIAA 5CG7A 5I0DA 3TNOA 2OT1A 4FNRA 2NX9A 1LLZA 4JTHA 3GXFA 1SFLA 1PV8A 1XSKA 1UB3A 4JTLA 1HO1A 4S1FA 3W84A 3NL3A 1DVJA 3DAQA 3GIYA 2Q8LA 4XBKA 1FQ0A 5I3JA 2QV4A 3UWZA 4FLOA 3BG3A 5I24A 3LDVA 3CZEA 1CGXA 4LS0A 5F2GA 4ZQNA 3TH6A 4O8RA 4KFPA 2YYTA 2V9DA 3WELA 1JF6A 2TPSA 3TSMA 1KWKA 4ADSA 4O54A 1TIMA 2D73A 4DEFA 3IGSA 1JD7A 4UOQA 3BO9A 5F4WA 1LP6A 4E0CA 4O50A 1VIWA 3GK0A 4AH7A 3CIWA 3DKJA 1F6KA 3ZT6A 3QQ1A 5HR7A 2WANA 1SW3A 2J88A 1KTNA 3LCHA 5CZSA 1B3OA 2E5BA 1GVQA 2FGZA 3ZFHA 3EX2A 1H50A 4QITA 3M9YA 2G3NA 4HOZA 3OA3A 2ZRXA 4AW7A 5E0KA 2QLYA 1XM3A 1VHCA 5D2XA 5AYYA 3HB9A 3LBCA 1HWWA 2C18A 3W1TA 2Y70A 3S8HA 8TIMA 3V1PA 4CGTA 1BVNP 3P74A 1EP3A 3HGOA 4D2JA 2OSWA 1W54A 1EA9C 1U30A 1UKSA 3GZ3A 4FX8A 1GG1A 1S5VA 1W3TA 3W7QA 1FWTA 3L2LA 3NYZA 1GG0A 1AMYA 1U33A 5EMYA 1YDVA 3LHUA 4OIFA 1LWJA 3FLUA 1TPWA 5CSRA 1M53A 5BNKA 2FTPA 3KL0A 3SIZA 2ZXAA 2ZZ1A 2A7RA 3NL6A 2YPIA 1FCVA 1GEQA 1OABA 3KRZA 3BGJA 3WY1A 1TTPA 1W5QA 4IWWA 3BW2A 2O7SA 4X9YA 3KAOA 2C3ZA 4POCA 3PAJA 4LVGA 2FIQA 2Y7DA 3F1QA 1H61A 3BLEA 4JTSA 2EEXA 5A2BA 1LOQA 1TMHA 2Y7GA 3TC6A 1LRNA 4IMEA 3PB2A 4JTGA 4R7JA 2C0AA 2TAAA 4H3DA 1VH7A 5CGQA 3SZ8A 1D3CA 4WLCA 1EX5A 1SFJA 2WKLA 3P8JA 7CGTA 5LKYA 4NUWA 3LI0A 4NNAA 2B4GA 2QCMA 4MVAA 4XUGA 3RF9A 3NVTA 2BHYA 2VXNA 2WSQA 4O12A 1AQMA 4GO9A 4UFMA 3W7OA 1ICSA 2QCDB 3HQ1A 4RJEA 3A47A 1QWGA 4XKYA 1UD5A 3UY8A 1JCYA 2A4AA 4BFAA 2WKGA 3BVJA 1QW9A 1TREA 2NX3A 4JX4A 3S5NA 3TSBA 4EWND 1XD0A 4NVTA 3CV5A 2AAMA 1IXOA 1PAMA 3UWWA 4MZ8A 1YPFA 1I2RA 1KFEA 4UTIA 5CLWA 4I7UA 4JL1A 4CQAA 2RH9A 4IJBA 3IJ7A 3CZKA 3JR2A 3OIXA 1LRTA 4FLSA 4CNOA 2BXYA 1KA9F 1SPQA 3FS2A 3N2XA 5DXYA 5AC8A 3KFTA 4FNSA 2NWSA 1UD4A 3HF3A 5D33A 4O15A 3O05A 1P0NA 2QEZA 1JL8A 4FNPA 3W38A 1WZLA 3OLGA 1JGIA 1JI1A 3OHIA 3WNPA 5G5IA 4UTUA 2ZRZA 4JFVA 3NDOA 4LS2A 4UQEA 4M6VA 3F4WA 3M43A 4RZ5A 3WDHA 4PL2A 4CLMA 4PFMA 1NM9A 2CLOA 3VSUA 5U7SA 1VFUA 1W31A 3AMKA 1JRCA 5D03A 1ZJAA 4UTWC 1SU5A 1GJPA 1X6UA 2A5HA 3GXPA 2EPHA 1VCVA 4TU1A 4Y90A 4DO4A 1O60A 2OZ0A 3K1DA 3CZSA 2AMGA 3EB2A 3GAKA 1JCNA 1KFBA 1GCYA 5A6MA 1NEYA 3GDKA 2VFEA 1QFEA 2ZFAA 1UH3A 2CLFA 2ZA3A 2D0FA 3VFLA 2YCEA 1LYXA 2WO5A 1KM5A 3PG9A 2YFNA 3TQVA 3TIMA 1A5BA 3CIXA 4IXHA 2F1BA 5HJLA 2WVSA 3NQ7A 3NQFA 2DZVA 1SZGA 3L2IA 3M5XA 1SO3A 4IPJA 4YMZA 4JFUA 3HGSA 2PURA 3ZO9A 3W88A 2GJRA 3W22A 2ZWYA 5E6YA 3M0ZA 4QJ1A 1JQXA 3L9CA 3SGZA 4MFEA 2QAPA 3EKZA 5EPDA 1Z48A 3BUIA 2BHZA 4AYGA 3LTYA 4YWIA 1ME9A 4XTDA 5I5RA 3QPZA 1CLVA 2G5WA 3TJXA 3L4XA 2QAFA 2ATSA 3UG5A 2WPBA 3D51A 2FYVA 3QW3A 4GWEA 4X2RA 3BLPX 2Z2UA 3Q94A 3DI1A 1EWEA 4MZ1A 2NT1A 5DY2A 2YIHA 4H7VA 3C61A 3VMNA 2QCNA 3PBVA 3CTTA 3E96A 1O5XA 4PCFA 2V81A 4C1KA 4OJYA 4DF0A 1G4TA 5MHBA 2DZUA 4BR1A 4ATWA 2LLEA 2D2OA 1A50A 3P80A 3GXIA 4A3UA 1BPLB 4K7VA 1EHAA 2J25A 3RK8A 3DX4A 4XZ9A 2QCGA 4O4WA 3O6DA 4KKXA 3R8RA 4FXRA 5TIMA 1TJPA 3G0UA 3W2LA 2BXZA 1G94A 3O15A 2HS8A 5F1VA 2RDWA 2ATMA 1HXKA 3MO7A 3CZLA 2WJZA 1FDJA 4UXDA 3TU9A 2CLIA 1H63A 3TMLA 1MEWA 3B4UA 4H6KA 3BH4A 3P5ZA 3KE0A 3D0CA 1WZKA 1FCBA 3G1XA 2FE0A 3GR7A 1JG9A 2ZUWA 1G4SA 3L68A 1P0KA 2ZZ4A 5AHMA 1G4EA 4FO4A 4H8UA 4CCEA 1VLWA 1JVNA 3M5VA 3BVTA 5IBXA 3QMRA 1XGZA 1OK6A 2WNWA 2XN0A 4DELA 1OFOA 1PCKA 3DDFA 2A7NA 4J28A 2E6FA 4M7TA 4DXVA 4Z1DA 3P5YA 2F1AA 1XBYA 3C4UA 4S2CA 3M41A 1CGTA 2Q3OA 3QZEA 4UUIA 1GOXA 4Q4KA 4WF7A 5DCDA 1CW2A 3B0UX 1WBHA 5A2AA 4JL2A 1AW1A 1OYAA 2QR6A 2TRSA 1UD2A 5KSWA 4NJJA 1MXSA 2HS6A 4A2SA 1JUEA 3MUXA 3ATZA 1VLIA 3CB8A 1XUZA 4E38A 4ZQPA 5D05A 1QPNA 5AYXA 2NV1A 5HQEA 5LSMA 3WNLA 4XQ6A 1F6PA 4UTHA 4H8VA 1PZ3A 4LS1A 3EJUA 4GNJA 3HG3A 4M5PA 1UBSA 1W5PA 3W7CA 3YPIA 1H7XA 1I2QA 4QNEA 1WE5A 1QHOA 3W1LA 4W9TA 5D02A 4UTKA 3M7WA 4K7YA 1B2YA 1IZKA 5HXMA 3M16A 3HGRA 1HL2A 1TQJA 2CHNA 2R94A 1XFBA 3GDTA 2FHFA 3EWBX 6CGTA 3CZGA 4RR4A 5KZDA 3NGJA 3O1NA 3AMLA 3GBDA 5CXPA 5HUPA 1WA3A 1P4CA 2X1RA 3S1XA 3CGTA 3TR2A 2ZIDA 5U4NA 3BVVA 2C15A 3MBFA 4QSHA 3N34A 1XSJA 4GI8A 3WY2A 1XDLA 3IIOA 3M07A 1L6SA 4EVZA 5K9DA 3QMTA 2ZA1A 1SO4A 3DFOA 3D4ZA 5HWJA 4FNTA 2G3MA 4JY9A 1KTCA 1ZY9A 2X1UA 4NI3A 1TTQA 2V5LA 3NQ6A 4JTKA 2A21A 4XB3A 1SSGA 4GUJA 5CPNA 5D30A 3NQ8A 2OCZA 5E70A 1OFRA 3BW3A 5KTLA 4Y6GA 4YCPA 1OFDA 2PWDA 4GFSA 1LZOA 3H53A 3EDEA 1IGSA 5HNRA 3TC7A 3GKFA 4GBUA 2VUYA 5I23A 4K37A 3MHFA 3BK0A 2JKEA 3L5MA 3IVSA 3NM1A 5D38A 4GI9A 4OU1A 1UUOA 1ZS2A 1EB3A 3E49A 1RVGA 1LBLA 4H8HA 4O10A 4UTWA 3HG5A 1WZMA 5DBUA 5K9XA 2B7OA 3A22A 1XKYA 1GQNA 3K8LA 1T96A 3NQDA 4B5NA 3DX2A 2VKZG 1JJKA 1WZAA 1PZ2A 3LV5A 1R2SA 2Y62A 1TB3A 4N9CA 1PJ9A 4JYFA 1QOPA 3BMWA 2D0GA 4E2DA 1Z32X 1KFKA 4U33A 3B03A 2E6YA 4EF9A 4UFKA 1OX4B 3TQ0A 1P6WA 2ZRWA 1S5TA 1BWKA 3UEQA 4R53A 2QCEA 2G96A 2I14A 3TMQA 3UWVA 2X2GA 3CM4A 1OHLA 1V7YA 4X3ZA 2XVKA 1LLWA 4JTFA 3G22A 3G3MA 3P67A 1KBKA 3DHDA 3N14A 4X0NA 3LV6A 4FLQA 1R75A 2Y2WA 3LHYA 5F1UA 1KLYA 4GI6A 1H51A 1L6WA 1F76A 2ZRYA 3CWNA 3FOKA 1KCLA 1QI5A 1Q4NX 2DZPA 3W1NA 4J7RA 3LCXA 1KGUA 3ABOA 3L5AA 3S5OA 1QWUA 5KZMA 3G1DA 4DF1A 3W83A 4BI6A 4TVUA 2QPSA 4NX0A 1NF0A 4RKAA 3DENA 1XBVA 3BAJA 2BY3A 3CQ0A 2BZNA 1ZAIA 5KZEA 2G95A 5K2ZA 1KLZA 1VYRA 2RDUA 1PVNA 4O11A 4WXZA 4UQDA 2YW4A 1K02A 3S2CA 4YL2A 1JQVA 1TTIA 1Z42A 4BA0A 4GUFA 4O4VA 2BLEA 3UZJA 1WOAA 2DZSA 1BVZA 1DL3A 1EIXA 1DQWA 3NOEA
chains in the Genus database with same CATH superfamily
3QDJD 5E4EC 1UACH 3CHXA 1P6CA 1EZVY 4K4KA 1DYSA 4BWLA 3RNQB 3T8LA 2G4FA 1GOHA 4CQ8A 2XWCA 6XIMA 4AMWA 4QRFA 1YEGL 4OFQA 3BAXA 4GG6E 1LXMA 2F19L 1N70A 4W9JC 4B5ZA 3C56A 4B6ZA 3DFTA 2NY1B 2CKBA 2YWZA 2Z7WA 3BZ4A 1BJ8A 3V0WL 2A3EA 5MF5A 3MACL 3WY3A 3ET9F 2FKPA 1EWDA 4HFUL 4JG9A 4Z7VA 4L05A 3O4LB 5CR1A 4RLDA 2VXSL 2C8NA 3TV8A 2I9TA 3RN6A 1R7AA 2ICEC 4Y5YA 5A1AA 4XNZB 2Z1KA 5EBWA 4KY1L 3H4HA 3EF7A 5DMIH 3ZZ1A 1AGFA 2EZ0C 2PDFA 4XN8A 3VH8A 2WW5A 1YEEH 3BDYH 1OAXL 3QIUB 5I18L 3NZ1A 4RPQA 3SGJA 5DJXB 1UCWA 3K13A 4ENLA 4NPYA 1AXSB 1CE1H 2LT9A 3CAQA 4LL9A 2V82A 1JDAA 2JE8A 3NMEA 4V11A 3N42B 2AJ3A 3N1PC 1BVWA 2J47A 3UERA 3QC5X 1H2JA 2JF7A 3ZYIA 1NPJA 4MKNA 2ESCA 5TDPB 4F1SA 1OM3H 3VWKB 5DDHA 2C16A 3FQRB 4E41D 1G69A 5DC0A 3OAYH 3FDKA 1ZVYA 1A1OB 2G75A 4NUJA 3U79A 3ECUA 4P7RA 1EJFA 5D1ZI 1ZU8A 4HGXA 5C0IA 2WZAA 3PSVA 5LBVA 2F84A 1OAKL 2QHAA 1U8LB 1VRSA 4KEUA 4LQFL 4P3CL 1I45A 3PDGA 2FQFA 3D12B 4HH8A 4LB4A 2BTMA 1RL1A 2OGJA 3BSHA 1BTMA 4L29A 1BOGA 2DQXA 4E5XG 1AG0A 3AQYA 3X1NA 3ZOAA 4NAEA 2JJVA 1XVSA 1VB9A 4GO6B 3MUGB 1T21B 3UZEA 1QRNA 5CGBA 5EYWA 4KDWA 3PR2A 3G0SA 3OJDB 1E4XI 2DS4A 2P8PB 4LEBA 4OLVL 3GUTA 3M7FB 1HKFA 3P0YH 2TYSA 4A37A 3GBMH 3OWRA 1E50A 1W1B1 2GJLA 4L37B 3H85A 4LGSB 3PNUA 1IEVA 1BZOA 3JUZA 1AQFA 1TRDA 1XG4A 3UCCA 1UWXK 3HO8A 3ANYA 4MPQA 4RAHA 1ZV2A 2EF9A 1ZANL 1AR1C 3SDAA 5CCZA 5LBGA 3I6KB 1XLCA 3CFBA 4O51A 4G8GB 5KYXA 4I0PA 4JX5A 1L9SA 1ZS8B 5HDLA 4MAVA 3PF2A 4DP1X 4Q7NA 3TWBA 2JIWA 4DYKA 5J6SA 2J72A 2JCCF 1S4IA 3GRWA 3RPKA 3NRPA 5MHSD 2BS71 1YDNA 4HN8A 2CWNA 2P49B 4GT0A 4UT6L 3MO1B 3VQMA 4DCQB 4M6PA 1AI1L 4E2OA 2Z4QA 3VXSA 1OGPA 2QKIB 4WHTA 3WQCA 4HT1H 2EXWD 2GSMB 3DJTA 1QR1A 1A53A 3QFDA 3TZVB 4KNTA 4K39A 2WXNA 2QL1A 4G42A 3SBFA 5IFTA 1NIBA 2N0MA 2PF0A 3S83A 1KTBA 3FRUB 3V6FB 3ARZA 3NDZE 3K2UL 4Q6JA 4JBSA 4M8VA 2ZP9A 5EO1B 2Y5EA 3N0PB 2IANE 1Y6MR 3V6ZB 4G3YL 3EGSB 2GJ6A 3D2UB 2BIIA 2VR7A 2C0HA 2XI9A 4P2QA 5C0ND 5C7XH 4ZMTA 2NV9A 1JGEB 4N24A 4DLMA 3KD4A 4GZJA 1T2XA 4EI0A 4OV5B 1CDUA 5FKAB 4AWJC 4NUGL 2E7LA 2EEAA 2R23B 1C16A 4JQXC 4K8RL 5HTSA 3WEOA 2VOMA 2X87A 1UZ6F 2ZOKB 4JFSA 1D7FA 4I4WB 1OC6A 1XFCA 1A5OC 4XXDB 2QSCH 3FBQA 1E9PB 3GIVA 4IOTA 3QUXA 5E9DE 3HV9A 2PWHA 2B0SH 3JTTA 3Q2DA 1N64H 4YBQD 4KWSA 3G5YA 3U7YH 3M7SA 4AZ6A 1OK0A 3QJFB 1JVOA 4G6KL 4GIOA 4N6FA 1DVQA 1RPUA 3EWYA 3T3ME 3V0WH 2HKFL 2QADB 2VXTH 5D32A 2BIMA 4P2OA 4IYKA 3S88H 4C57C 4IJ3C 4Q9RL 4NAFB 2H32A 3MUGA 2XG5A 4JHAH 2C3GA 3QLDA 3RZCA 4ZQCA 5HYQA 3W1RA 1J1OH 3DG6A 3LSBA 1UWQA 1J8VA 1B0WA 3ZR4A 1RCYA 3UWYA 1QABA 2Z6FA 4EKJA 3GYRA 5I0XA 5CWSA 5DT5A 3BISA 3RIAK 5M2FX 3U7VA 1NANH 3IFPA 1B3IA 3OGSA 3UXKA 4QY8B 2GEQA 3FU6A 2Y6SD 4PTUA 3C5JA 4AQAB 1KM3A 3K3QA 1Q6OA 3APGA 1ZLWH 4AGQA 1O4UA 1Q7QA 5D9OA 1ONQB 3IS1X 3TGXA 1BZ7B 2Q2EB 5I66A 1G7MB 4MJID 4OGYH 3WNMA 1GW9A 2QIWA 4K3EH 1J5OH 1X1NA 2PPGA 2ARJB 2HT4C 4HJJL 3ATAA 3BV4A 4P7LA 4HSCX 4FJ6A 4YSPA 3BZFA 3DMMD 3VXOB 5L2KD 3GSXB 3PGCA 4QQ3A 4W9GC 5MEPB 2YXOA 2J24A 2VN6A 4EXPX 3GZAA 2BC4A 3E8UH 5DC2A 2PGWA 3ZMEA 1QR1B 1AS8A 3DHUA 1IE4A 3VWJD 1R4XA 2UY6A 2VITB 3FT1A 4EUPH 3CSGA 1EF3A 4KO5A 2AMXA 4GBXA 1ILSA 3V4VB 2XG4A 2X2JA 1TE6A 4YC2C 4JQAA 4V1YA 3VNDA 4MMWA 2A6KB 3ZRSA 3O9NA 4UWQB 1YPZF 4RFEB 1QRKA 1KTLB 2CCLA 3B2UC 4OCXH 1NBQA 1NCDL 4MQTB 5AL0A 3T0EE 3OHXB 2K6WA 1EHNA 2ATKA 1G9ML 2OTUB 3SHSA 4O51B 3WEXB 4AJVA 4BZ1L 4EIUA 4CCZA 4KQNA 4OD3L 5G2IA 2OTPA 3RL1B 2QHRH 5ERWB 3W7HA 5J06A 3ALWA 1SY6H 2ZCHH 4GJTB 1N0XL 2Z1BA 1C12B 3EKLA 4GRLD 4NM4H 4LOUD 4ZQTA 2E67A 3BVNA 1Q38A 4WXYA 4GXVH 4PIRF 1XF1A 4L9XA 1L0YA 1I9RL 1YY9D 3QXDB 4H20H 5HJGA 1C7TA 5AWNH 3RFZA 1YEHL 2OZ4L 5HYJD 2PDJA 3TJLA 2XN9E 4KK8C 1Q6FA 2NYYC 4XNMA 5DJ6B 1H62A 1I7TB 4O8AA 3QUYB 2OODA 4AMCA 1PD1A 4E68A 2FGWL 4DNHA 4HN4A 3O2DA 5REQB 4PRAB 1JWUA 4HHAB 1O94A 3C6EA 3FZUD 3QDGD 3UA4A 4DQOL 4I9MA 1WO2A 4JQXA 3CZ8A 1YXDA 4IKKA 4CD8A 2YEZB 4CSPA 4JQ3A 1D7BA 1FUYA 2BNRB 1JK8B 5FGCB 2J9YA 3NRQA 4LUYA 3U7WL 3CUFA 1X9UA 3QCVL 4JM2B 1FE8H 2YA1A 3CSPA 3OKLA 3PFQA 1TMQA 2E9IA 2K6ZA 2EDOA 3GINA 4OI8A 4W5UA 4ZUTB 2CR3A 5GZNA 4BFFA 1LK2A 3O3BA 4AZ7A 2VC2H 4XMZA 3WJYA 4G72B 4OTXH 4TNEA 1BOGB 2K4AA 4A66A 2Z6IA 3VXUA 4C6DA 4WCYH 4MA7H 1BWWA 4YQXL 4PCSA 3TA3D 5I73C 4GRWE 5KZ6A 3HNVL 2CO3A 1YTKA 4P5KA 2H3DA 5MENB 3ARGC 2IH1A 4IMKA 2J78A 4Y8EA 1H4PA 2G4EA 2PTUA 4EKXA 2PEVA 1ZRQA 1KB5B 1VPOH 5L4IA 5DMLA 3RJYA 35C8L 1TTGA 4M6NH 3SYAA 3E2HB 1LORA 3SY0A 1BQGA 4AE0A 4XODA 4LHUB 3LERA 3M86A 5I1DB 1FVDA 5CF3A 5KUKA 3B3BA 1A4MA 1M3UA 1WUEA 4OQVA 2CK0L 3RNKB 4AQ8C 2V2XB 3S4SA 1BHGA 3PBUA 1RK7A 4MHBA 3WH9A 3CXOA 4Z7WA 1DL7L 3EOYG 3GJFH 3O4LA 5CLTA 4RW3A 4E3TA 2QGHA 3JXAA 1OFEA 4OUUB 2QVMA 1XAKA 1GZQA 2YK1H 4IS6B 1Z5LA 1OX5A 1U58A 2DLFH 4BSJA 3AG4B 2AQNA 1G6RL 3TSDA 1J0JA 2JIXD 2LABA 5DZAA 3T3PB 5E93A 3THAA 4BQ3A 2XN1A 3MRRA 3STZA 1L6FA 3WLJA 1BQRA 4EMZA 2VRQA 3WD2A 5HGDB 1XSIA 4CMHC 4JLRB 2I16A 4OM1L 2OZNA 1DFXA 4LY4A 4MNGA 4WJG3 1AACA 3ISYA 4EI5B 3KS0J 1BWMA 1K8YA 1UT1A 1CGYA 1PE1A 1RK6A 3KOYA 5D2NA 4L8SC 4LHJB 4A2EA 5CEZL 3CFEA 5F97E 3MN8A 1X5GA 2BFVH 1CI1A 2A3HA 4N90E 2P5WA 1UG6A 2ZXGA 2D1ZA 3N19B 5C55A 3VD1A 1ZHNA 1GMIA 3D3AA 1NL0L 4JKNA 1HJCA 4JLRA 4PJCE 4D8AA 2BRQA 4MNQA 1NBYB 3DV6B 1BG9A 4IM8A 1GVRA 2X6AA 4A3QA 3RY5A 2D7TL 3JVGC 4C60A 1QEWB 1R5WA 3KS5A 1N6UA 3PL6D 3DJSA 4R3SB 2CLKA 2NY1C 3HRPA 4YHPB 1E2VA 6FABL 1CLYH 4XVDA 2F6UA 1KCUH 3DVGA 3LX9A 1VEPA 4TVPE 1JF1A 1I53A 2H4EA 1TVDA 3C5XA 4LDOB 4EZLA 1X8FA 3QWNA 1P7QA 1YEYA 3L3OA 4GUIA 1CE6B 1U9KA 1LO2L 4GFXA 2XZQH 1BD2D 3TIEA 5ACLA 3UGUA 2AJVH 5IW6B 4Y88A 4AHOA 2QDGA 1IILE 3C3NA 3M44A 1HDMB 2EDXA 3ALFA 4GG6F 2QPUA 2OTWA 3MA7A 3ES6A 3O9WC 3MJ7A 4FD0A 3EOTH 5I74B 2P5NA 4HIXL 4WY0A 3DHPA 3Q2WA 3O11B 4NQUA 1R2TA 3CDZA 3U36B 4S3FA 2ICEA 4Y5YC 1AG1O 1QPKA 2ZG2A 2IH1B 2OLSA 2YBGA 2YYUA 5CQ1A 4U3CA 3T0EC 2VLKD 1MJUH 1T20B 3ZWTA 5AOKA 1MAML 1ET8A 3LKRB 3MRNA 5D71L 3SE9L 4O02B 4DUXA 4OECA 4YJ5A 4Z7VE 5B80A 3GMPB 2A3AA 4XQ6A 3KL5A 2GBUA 2OJPA 3WDIA 4OW6A 2BSSB 5EFDA 1OAQH 3EJZC 4GEIA 3INUL 3L54A 1WT5A 5ECGA 3NAAH 3RDTD 1TTUA 2FR4A 1ONRA 3MZ2A 2NY2B 2A74B 2J1XA 5EULV 4POZD 3L3JB 5ABDE 3EH1A 3S2JA 4HA1A 4MUPA 1TCMA 4RFOH 3IDXL 2JKTM 2N7AA 2YZ5A 3C0SA 4IFKA 1HYSD 4UIMA 4JIPA 3LQMA 4OFKA 5E8NB 5KJ4A 4U2YA 3DESA 3IAQA 3EGJA 2V69A 4BQ5A 2P10A 3G1VA 1G1OA 2M83A 4KKCD 1NP0A 2FDMA 3R58A 5B38G 3SADA 3LKSB 4RIRA 4BF5A 5I1JH 3VNZA 4YUEL 4YVPA 1FA4A 1K9DA 3H8NA 1GW6A 4TRPL 5DVPA 3W1QA 5F88A 5H8UA 2QQNH 1E5BA 1MXGA 1OALA 5G4HC 4LU0A 3SKJH 3WUGA 1I1XA 2I69A 1MJ8H 3VMOA 4KX7A 1TJIL 3EDFA 4F80A 5I1EH 4OBSA 1JRBA 4CGUB 1BP3B 4WGWB 3OTRA 1I75A 1P7KA 2EYRB 5TJWK 4MY8A 3T78A 4KTDH 4IEFA 4JAMA 4HUUB 2PUQT 1K4CB 2VLME 1O5QA 3CN3A 4UR8A 4JE0A 5TH2B 2V5YA 1H7OA 3LYRA 1YUKB 2NY6D 4M7KH 5CJOL 1HESA 3L4VA 1AJ7H 4EDWH 4Z3FA 1JUBA 2YW3A 4Q8PA 2F61A 3VD3A 5L88L 1E8ZA 4ADIA 1TQSA 5ERWA 2XV6B 3W2JA 1B3XA 5IBXC 4KXZI 2GDUA 3HAEH 5E5CA 4Z2KA 4GY4A 3NFSH 1CLOH 2HTLD 2JH2A 4A21A 4AG0A 2QMKA 3W7MA 1Y65A 3FK4A 3W7KA 3FDGA 4UTTA 2HB0A 2AKRA 3A6CL 3FTZA 5FO8B 1W37A 3UZVA 1EH9A 5JORA 1W0VA 2ZUTA 5A2CA 3EAKA 4H8WH 5KG9A 5JW4M 3MHUA 3EPNA 5DK0A 3O2VL 4A39A 2BASA 1MRCH 3F12A 2FT8A 2H6PA 3BT2H 4JX6A 4LSVL 1YDOA 1HHIB 2TSYA 5FO2A 1XGTB 3W39A 4Q8OA 2YXVA 3CNKA 4YLCA 1L2QA 1V0MA 3DIPA 2RDTA 1NWOA 2DLFL 5HGAA 1SF5A 3ARBB 4M8QB 1TTJA 2RAGA 2VWSA 1HKMA 5C2XA 2NXYC 4LFHD 4M7JH 3LZ5A 2J7BA 3T8QA 3GLZA 1UASA 4F2ME 3ESMA 1S46A 2R82A 4IPPA 2BRRL 2BG5A 3X1GA 3LXCA 4QY8A 4YK4C 2CA4A 3L65A 2EECA 1SEQH 1TJXA 3VSQA 2PTYA 4K8HA 2YGOA 1D5MA 3GW0A 1D6VL 1RP8A 5IVXE 3MRNB 5AHEA 3D69B 4JR9H 2ADGB 3QQ3A 4U3SB 4CSSA 1FCQA 3FYEB 1ZK9A 2XZCH 3QPQD 2JMRA 2APBA 4G5ZH 4I2XA 4PTTA 5FB8B 4H1LG 3MUUA 2VEIA 3HC4L 1QPQA 3BN9D 1CD1B 2XOTA 3Q8EA 5C08E 1NFDA 1N2VA 4IG2B 2YQBA 4NAFA 1AK5A 5D1XA 2W4XA 3TYFB 2XBDA 3EXRA 5D04C 4EPEC 4E8CA 2C14A 3VINA 2H3NA 2N7SA 4Z0BH 2VN7A 3QUYC 3SN4A 4RSVA 4G6MH 5LIXX 2Y2TA 4YL4A 1J05B 1PZSA 4LAOA 3WMLA 5E6IB 1TZHB 4PN2A 4U4IA 2ZXCA 2WMHA 2VRJA 3WD5H 1UKTA 4K3JH 3VFMB 1K6AA 1XYCA 2AQOA 3TAOA 4BRVA 1GGYA 4XPBH 5CN3A 4LRSA 2EAEA 2PYEE 1KOAA 3FOLB 4UT9L 3RVXD 2VZUA 3ZBMA 4UT7H 3VM5A 2ESVE 4G80A 1ZLEA 2XIQA 3G1SA 1KGYE 4M48L 1XSOA 4PJFA 43C9A 3P9LA 3PP4H 4IJCA 1KIPB 2YXXA 3GXDA 4FABH 6A3HA 1XCQA 2O9RA 3ASWA 2OFQA 1Z9LA 3ZDZE 5FYKU 4ELME 1RAMA 2CEQA 2DZWA 2O0TA 4F40A 2G3IA 3QFWA 4PJHE 1E71M 5IHBA 4G7SB 1EGJH 3BAIA 5E0FA 1R3JA 1C8VA 4KXZH 4ZGYA 3O8AA 3WI9A 1QO5A 5K9QG 3KCOA 1Z6JT 2PYED 2Q8ZA 3WL1A 4AMAA 5HDQH 3SE9H 1Q8MA 5DMYA 3NJGA 9XIAA 1I1CA 4YHKL 3NZHL 4GXVL 3MC0A 3PPCA 3S35H 3TFKC 3REQB 1XIWC 4Q14A 5FEXA 1J9YA 3SY5A 1DBBL 3WG6A 4NC2B 1RUQH 2WBJA 3NEOA 2BDNH 1WOBA 2W6RA 2PTWA 4XUYA 3ASNB 5LAXB 4CJ1A 3V8OA 1CLZL 4HPJA 1LDPH 3PN8A 4OKDA 3BVNB 2EACA 3SUVA 1C12A 3QEUB 1KJ3H 1ADQH 1NU5A 2EKGA 3N1QC 2R39A 3EWDA 2CU9A 3QNZA 1KQZA 3PNRB 4GQQA 3QUKB 4KWVA 4NZJA 2COQA 1ZSDB 1LQ2A 4PP1D 3T9WA 1MW1A 3F6JA 2CWRA 4DOHE 2AJXL 2JKSA 1KCXA 1HL4A 3C2YA 3OX8B 4WI5A 1C5CH 5LXGH 5HPMA 3F4VA 4ICNA 1NFIB 4M9PA 3EHBD 1FUNA 3TBBA 1OGSA 3IDIA 1UOZA 1U6AH 2RFXB 2EUXA 3CEUA 1E5YA 3CUXA 3HC0A 2J56A 3UYCA 2Y06H 2PPEA 5KOVC 5KAQG 2ADFL 2E47A 4LNYA 1MY5A 6TAAA 1RSCA 4ML4A 1KXHA 2SODB 5C0AB 3PWLB 3DFNA 4XP9L 1RZ8A 2WINB 4XZ4A 3K7UA 4HJJH 5GGTH 4BKLB 4DN3L 4GIRA 2FHBA 4DHLA 4HKPA 4PTUB 5ACMA 1JPST 5C54A 1E2ZA 1OF0A 1TG8A 3FU8A 4K7PH 5D4HA 4C90A 4PMQA 1T21A 4XBEL 2XACC 2NZLA 3E2QA 4NENA 1MI5B 3SDCB 3OVPA 1NFDB 4RX0A 2FT7A 1RA0A 1PCXA 4GYKA 5C0FA 2PTXA 3WJMB 3TNNB 3OP2A 1KBBA 2AI0L 3MUJA 2X3CA 3U2SA 3I7RA 5AY7A 3K71B 1CS6A 5GVJA 2NZ9C 5B4MD 1D3HA 5DHVH 1WKDA 2R8WA 3SGUA 4XAKE 3FGCA 2IAMC 3H4WA 3L4UA 2O4EA 2RTTA 4L1DA 5E4IA 4B3ZA 4PJ5E 5IGXL 5ITFB 1EO7A 2E27H 2JB5L 4LT9A 2V63A 3FV9A 1FWFC 1IEIA 3CYJA 3EWCA 4GH3A 2F54A 3SSJA 3JW7A 3QHNA 1FGNL 4JN1L 4PRHA 4ZFZA 4M43L 2NT0A 1DBTA 4JY5H 5INDA 4XCYA 1RIVL 3G9AB 4PJXE 4AM0A 2ZBTA 4MZYA 2OOGA 4FF5A 1N7KA 4AHQA 3DPBB 1MZRA 3ZTEA 1OG6A 1V3IA 1KDIA 1A3LH 1WBXB 4FF7A 1I8LC 1BD2A 4D71A 1DBJH 4DQWA 5A2KH 4OV9A 1AXSA 2W0LA 4EIGB 5GS2H 5I16A 3SECA 1IKFL 1PF3A 4NSKB 1EEUA 3ITGA 2X4UA 1CFNA 3KS0H 4YE0A 1J2BA 2CRYA 1CU4L 1PUDA 2CLVA 2F08A 3NZ8B 3C8DA 3MJWA 2ILLA 4N6EA 2VLRE 2A2IA 3LGGA 1KYDA 1WC7B 2AZUA 3ES8A 1KXVC 4OD1H 5E6ZA 5C0DA 1MXDA 5TGBA 3GDLA 3K2GA 2IOMA 5EMKA 1ZPUA 3BN3B 1C8YA 5EL1A 1JZGA 4MWAE 2AV1B 4KK9C 4JPWH 5L9DH 2KQNA 3PDDA 1P69B 2X0YA 5CSZB 2WHKA 3VQ1C 3IUHA 3S6CA 1I8JA 3WE6B 4O19A 4PMUA 2VMCA 1SY6A 1JGEA 1PKLA 5HJ3B 5DN1A 5MEQA 3EFFA 3BSZH 3TFCA 5H8MA 3WXVH 2W1NA 5F1SA 3UX9B 4QDWA 5CJNA 4P46C 1DFBL 2EEFA 4DP8X 3ITCA 3WMCA 2QTVA 2G5BB 4GUOA 2OU4A 2POZA 4GMEA 5HI3C 1FG2B 3WMSA 5F7HA 2GVLA 1FO0L 3W56A 1G4RA 2VM3A 1UXSB 3BD4A 4PJ5A 1YA5A 4QIRA 3SYQA 3T3MB 1A5MC 2O61A 3RPDA 4G42B 3ZT7A 3GB6A 1G7MA 4OGZA 4PULA 4L8BB 1ITUA 4PRHE 4ZFCA 4KFZC 4CBPA 1T8XA 4WFHD 2H8XA 3RRAA 3QIWB 1G1YA 4TV6A 3TWAA 4M3HA 1FZJB 2BLFA 3IKCB 1EEZA 1BKSA 3EOEA 4WCJA 5DHDA 3VE7A 4CLMA 4R6UA 1ZS8A 3RWDB 4N9BA 4XZBA 3GVRA 5MEOB 1OTSD 2KBGA 1E5AA 4AX6A 4OJEH 4UTMA 1R87A 2DJMA 1TELA 3F83A 2QQLL 1GOMA 5KINA 4U0QB 5IFHH 3HTWA 3FN0H 2PR4H 4FC3E 4L9LA 1OL0A 2JKWA 2ZOLB 3DBSA 4UU9A 3VXUD 3MREA 3PIQB 1F02I 1MHCA 4FQXD 3SDCC 3PGDA 2VLRA 4DJFC 1BMGA 5DRXB 3WLSA 1H5BB 4FJZA 3UZXA 4DZ5A 5HNUA 4HK5A 1TR7A 3WLWD 4XVTL 1H7PA 1YMHB 3DVFA 2WMIB 4MD0B 2OMVA 5T1LB 1RK0B 4DK6A 3GSRB 3IJDA 1PEZA 2H7WA 2OCCB 4WO4B 4UINL 2CJ3A 4NX5A 3RVUD 3FU0A 4YXHH 4HNCA 2E1DA 4OQTL 4DP2X 1A5NC 2D7OA 3R6IA 3ECVA 4ZFGH 1E43A 4ZXBB 1HE7A 2Z26A 1BSLA 4GOSA 1N59A 2H3BA 1PIGA 3DXAE 3IMRA 4JQVA 5CP3H 1LE9A 3T0WA 2APWA 2ZICA 4AT6A 4LX4A 2WGNB 2JELL 1GZPB 4K9EH 1HHKA 5KSUB 1M4KA 4YO0A 2YPKA 4NPYB 5L2JA 3LY6A 3FAXA 4HIIA 5FDYA 5IUSA 2PDQA 4O0ZA 2XH0A 5HD8D 5EA9A 5A95A 7PTDA 3QZOA 2HWZL 5J6HB 4K9EC 3P60A 4JO4L 1NBYA 3NR0A 3OAUH 4W8LA 5DY3A 4GRLA 5CS7A 3VYOA 2WXHA 4PGCA 3TJHD 4G82A 3EXSA 2V5DA 2FATL 3U48A 4WK2B 4YXKH 3UACA 5HI5C 3D6GA 4AYID 1ADOA 1VERA 1PLGH 4HUKB 1QSVA 4X8CA 3ZZQA 4K7PX 4ZQKB 3WEMA 1I2OA 5L4JA 2E7FA 3M1CA 3I85A 3IJ9A 2WJ5A 3IGXA 4JO1H 3FO1A 2FO1A 1YEWA 3WS6A 4DPBX 4JEJA 3CWGA 4J8RB 3FQXA 3VIPA 3W9EA 3BGGA 2RUSA 5DJYB 4NZTH 2CERA 2IKHA 2UV8G 1MFVA 2VLJD 3MXWL 4MBOA 3OKNA 5AKQA 2O9PA 4NO2B 4EZKA 3FJ4A 4GE8A 1NWPA 2F2HA 4TUJA 4JXCA 4CQBA 4DXKA 4EDXB 3SB3A 2IBZX 3NJFA 4G8GA 1VFFA 5GJMA 3O9WA 4PCKA 4NQSB 4GJJA 4J6IA 4ERGA 2BB0A 3EAUA 2R91A 5GNYA 5F70A 1UWGH 1ZLWK 3U83A 4IUOA 1TCRA 3QQ9D 5L2KA 3KYMA 3EYUL 2Z1XA 3FFCE 2LW3A 5TF1L 2XTJB 3MLTA 3HE6A 3RAOA 4HWZA 4O9HL 2UWEF 8A3HA 2OYLA 1KMGA 1MF2L 1I8MB 1JV2B 1H3VA 4HJGA 4KMQA 2EC8A 4RRPM 5I6SA 2NLYA 5DELA 3UGVA 2B1AH 5FYLD 1KJ3L 2EICA 4V2CB 4AV4A 4DWSA 4D72A 2FEEI 3UYPA 2P24B 1ISVA 3EA2A 4FOKA 5BU9A 7REQA 3FPYA 1K3IA 4U7SA 1B0GA 3OPSA 1IWBA 1VDGA 1XUUA 4B5VA 3WBDA 5EU4A 3R7MA 3QEHB 4JPWL 2NX5D 4U6XA 5BVPH 5L9DL 1CDBA 4FOMA 4EZJA 1C08B 4UDTB 1FI8C 2BS8A 2CKBH 2DVUA 1L0QA 3NJLA 4IGBB 1WFTA 1QO3A 3DO3A 2OQLA 4WSJA 5DRZB 2Y63A 3TYZA 3GR4A 1MFNA 5FJTA 4Q7DA 1DE5A 5IFJA 3AHXA 3S3SA 3GMOA 1NCCH 4YK4B 5J3HD 4O17A 3BLLA 4HSNA 1PLGL 1O6IA 3GSQA 1I2NA 5DS8B 4LAMA 1OAUL 1SM3L 2EPMX 4NPKA 1V27A 5DDHB 4DNLA 3KVMA 2IFFH 2YN3A 1XCTB 1EXBA 5D9SA 3QRFM 5CPSA 1CGUA 3FQ1A 5IMMA 1PDZA 1TV5A 3HFML 3A6CH 4PWEA 5CGMA 4UFJA 3MREB 2NY0B 5M3WA 3ARSA 4N86A 3LEXB 4XWOD 2QHRL 4Q32A 1WAAE 2PPFA 5DZ9A 5J13B 1I7RA 3DRQB 1DWJM 4HS8H 3PABA 4A05A 1NJ9A 4U1SA 1DSFH 5F1IA 3NQIA 4F7MA 3WH7A 2KLSA 5DWUH 4QQUA 1RP9A 3N06B 4DZAA 3FT9A 1M6JA 1XCWA 4N0CC 2YOCA 2IF7A 2X70B 2I5QA 2XBTA 3CHFA 3LG3A 3BGAA 5GSVB 4F2BA 3VX0A 3NZ8A 4PW9A 4OFYA 4QNWA 5JOPD 1YO4A 3QORA 1TJRA 3FQXB 1YY8B 1AS6A 3NESA 3AFLA 3LEYL 4MMZC 3FO1B 3KLHC 1VFMA 1XR8A 4FXLA 3FT2A 4ZX6A 2L3BA 2ICWB 1NGZB 3IGLA 1VBGA 5C09E 1M1BA 1QBLH 1MFDH 2PTTA 3QJVB 4XPHH 3S34H 2C7FA 1NKRA 5G5DB 4F9PC 3PTQA 2OP4H 3S6DA 1EDQA 2VDML 1IKFH 3GK8L 3MR9B 1OGAB 2KHAA 2WYIA 3P02A 3HFFA 4J6RH 2O92A 3SGKA 1LO4H 1A6UH 3C0JA 3NAVA 5XIAA 1H3TA 2FLIA 1C8QA 4IOFD 3QRHA 5BMFL 2YGQA 3HAEA 4HBCL 4PVBA 4XK2A 3IGFA 4QYAA 2PXYD 2JEQA 1THCA 1QSEA 4K2SA 1YSOA 3JT2A 4FL4C 2CCWA 2DVXA 2OMYB 4QG6A 4NLAA 2XV0A 1QFWM 3B06A 1WSST 3RUGA 4MLJA 4QI3A 4RMTA 4CVZB 5EBMA 5C09D 1U3JA 1QFWH 2WSKA 1NSNL 4J27A 4MVBD 1Z9MA 1P0EA 3GH5A 2C3WA 4AXWA 4G6CA 5G1TA 3W7RA 2XZ9A 4K3DL 1NSJA 3C52A 1VRDA 4D8PA 3DTDA 3TH2T 3QM3A 4AK2A 4QCEA 5EY5A 3TYEA 3TROA 3E2RA 2KPWA 1MVFA 5C9WA 1ZHBA 5ITFA 2VGBA 5CPTA 4JFDD 1BF8A 3WLLA 4AB4A 5HNTA 3NQVA 1BREA 3UTQB 2WLNA 5JXAH 5GRWA 4P4KD 1QOQA 4I7VA 1GGBH 1XISA 3NJXA 1M6OB 1GH7A 4HIXH 1UW9A 1YEDA 2PYFA 1HKLL 4PB0L 3W07A 4OCWH 3GGWA 3IIVA 2WLIB 2NCMA 3DOSB 4LHUD 4QTIH 4WI2A 2VRKA 3LH8A 1KN4L 1MI5A 3SDCA 2JGYA 3UR7A 2Y23A 4N20A 3CUJA 3DPBA 2MJWA 4FQLH 2PU1A 4U2ZA 3RX3A 2HAZA 4WWKD 1YEGH 3GBML 4OJCA 1MAJA 2JQMA 3A24A 3BAWA 5CMAB 5PCYA 5T5FA 2KZ1B 4MAYB 5B3NA 4N42A 4LF3A 4BZYA 3S5YA 3GMQB 3HNTH 3DRTB 2YK1L 1CI5A 4UZGA 4C4UA 3EJYC 3O4OB 4YE4L 1JNNH 1IGMH 1BM3H 2BWQA 4LHUG 3NZUA 4LC8A 4P5TB 4PMXA 3N17A 4K73A 1HI6B 1A6VL 3ZJKA 2KPNA 4GBXC 4AYFA 2J6EL 4ADUA 8FABB 5A8OA 2OWWA 5JW4R 3LQGA 3GNML 4R2GD 3VYNA 2EDEA 2YUZA 4X5XB 4DP4X 4GVGA 5LXEA 4GG8B 1F11A 3LN3A 3ZK0A 5I8OH 1A6UL 3A4AA 1FKXA 1BXBA 2Z24A 5ICZA 1QNOA 4QR6A 2P8BA 5DQJA 2IV8A 1WZ1H 2A3TA 2V9RA 5EOQH 1FKWA 2DV6A 1XV8A 4OUOA 1JNLL 1QCWA 1FL3B 4BK5C 2Y85A 2DN7A 4DFHA 1AI1H 1N6QL 4XB7A 3PZIA 1XL4A 3RY6A 1TSIA 4ZNCD 3ZKNC 1OM3L 3WFHB 1X6NA 2HVBA 1PJWA 3LNDA 4JPIA 3OLIA 1UZ1A 4M80A 4YHGA 2ZPKL 3JWNE 5BOEA 3X12B 2EKCA 4OAWA 5JNYB 3COOA 2XUCA 3QYNA 1HP5A 2ENSA 3XINA 4B9PA 4PJIB 2UWFA 3KW8A 3P4OB 3RR4A 2V17H 1H3PL 4EOWH 4UMGA 3VI4E 3NVQA 2MRYA 3OX8A 4AEFA 1X1ZA 2R0WL 3JS3A 1REQA 4UC5A 4JO3H 4AD2A 2HRPH 2H6OA 1JXJA 2JF1A 2ZOXA 5CSSA 4P2OC 4NYYA 1D9KB 3MRHB 4EP8C 1XGQB 3KZ8A 4UTAA 1YAZA 2Q8BH 1YMMB 3SYOA 3OWEA 3LSOA 4PYHA 4PRTA 3TOPA 5C0NC 3GLCA 4PTMA 2IFFL 3RP1A 4HUUA 4Z08A 3L3GA 4NT0A 2CAKA 3CSYB 3E9AA 1GYWA 1GTNA 1W3LA 4DESA 4OLVH 4LUJA 2FB4L 2WBJB 1BD2B 5GGSB 4XHQA 5F44A 3CFBB 1XF5A 5BZDA 1C8XA 5C8JB 3PZTA 3NK4A 4IBSA 2WXFA 1P7QD 4P2RA 1BD2E 1GAFH 1JPTL 2YUWA 1JCLA 2BW4A 2VC6A 3EOUA 5T8GA 1X3DA 3VI4B 4FQPA 4MS8D 1CI3M 4NZTL 4ENED 1HCYA 3B7UX 3IJSA 4LLVA 1L2UA 4ODWB 4B41A 1WX0A 3GB7A 5XINA 3MV9B 4YBQC 5CNHA 3RGVA 4R83A 1BXCA 1UTDA 1CVSC 2YCKX 1HQ4B 5A8PA 1AZVA 4OZGA 3DX7A 3OJDA 4K3HA 3THML 3WFDH 1OP5K 3QFEA 1ZHLB 4LP5A 4RISL 5F9JA 2VYOA 2FJGB 4X6DB 3TKFA 5FR3A 2DLTA 4EPSA 3N12A 2FBJL 2BP3A 4HZ1A 4F2UA 4NC1E 3S0CA 1KPVB 2OA9A 1VCFA 1SZFA 4M1DL 3S96B 4PHXA 2KZHA 1QFWI 4QRPA 3WD1A 2DQMA 4QHMB 4K5OA 2O6FA 4LSUL 3GJFA 2IPUG 4JGNA 1Z3RA 3JYBA 4YXLH 2EYTB 2L0DA 2QBWA 3HE7C 4HYVA 1J1XL 2Y6SC 4P07A 5F8QC 5FCZA 1IJNA 1EC9A 3H2PA 3CVHH 4GQRA 2LQRA 5FYJU 1VRXA 3N11A 3MROB 2YDAA 5D2YA 5I3GA 4X6FA 2W8CA 3ETBJ 3PFUA 1A64A 1DN2A 2Q86B 4N2GA 3ULAB 4ZNEA 1RSFA 4Y4HB 3VRJA 1F6FB 1F4WH 1CCZA 32C2A 4RLIA 3UG8A 2CA3A 1HWGB 4ERIA 1MVYA 5BWAA 2VDLH 3NSCA 3UJJL 5LA2A 4QMEA 4PJEA 4UT7L 3V4PA 5C86A 5KBDA 5J9PA 3ES7A 4XOEA 1Q66A 4KWOA 5IDZA 3ZR5A 3HCVA 3L5WA 3W72A 4X8JB 4O58H 1KEGL 4GH1A 2HPTA 3S5LB 4OCXL 4GABA 4KC3B 4YHPA 3I6GA 5JBDA 5H2ZA 4BFBD 3KPRE 5FOBB 4PBFA 4NIKB 4G11A 2E7DA 4LCYA 2V2DA 1X5AA 3D3VD 4XNUH 5T1KB 4A63A 3D3FA 4OFDA 5AZ1A 5DYFA 3T8XB 2UVFA 3QHOA 1KGWA 3LIZA 3SGEH 3RPTA 4XNAA 3UP6A 1IEWA 5F1OB 5A5WA 4GLRH 5I77A 3DYPA 2OSYA 4PJ9C 4HJEA 1R9ZA 3ME0A 2V2WB 3CASA 5BXFB 3WN6A 2VB5A 1VBRA 1WTGT 1AQKL 1XWYA 3MA8A 4FQJH 4KDTC 2E09A 4LOUC 1A5SA 1YE6A 2VDGA 4A68A 3H9YA 3VXGA 3S97C 4B0MM 3UO1H 5IQMA 4ZUWB 4E9XA 1ZLVH 2CQVA 3RIAF 1MCCA 3IRZA 2ZX6A 1LROA 1B31A 2WY3B 5I8KL 2AFNA 2C1OB 4RE0A 1XCXA 4APQC 1PZBA 2HKFH 5CD5D 3GMQA 2Y88A 4L1BA 3GI9L 1TV2A 3AISA 3UO8B 3B8UA 4A38A 2KI6A 3LMJH 5DZJA 3RCYA 1TIUA 2BSSA 4DZHA 5FSDC 3FT4A 4LSPL 5CZXD 2RQEA 5I8EB 4XBSA 5DO8A 3NXFA 3GPSA 1WKFA 3OQRA 4FZ8H 4NQED 2J9ZA 4MAUL 3ARED 1EZ2A 4UIMB 2QR0B 2HK1A 4PJDB 1F4HA 2MTAA 2IWKA 1KELH 2PP7A 2YKKA 5F6HI 1DIDA 2OX1A 2BJML 3QSRA 3UTQA 1Q85A 5FUZH 3KCWA 2YB1A 1HKJA 2QJMA 4LEOA 3QXBA 1KGCE 4GQ9L 1BZEA 5BUGA 2EJ1A 1A7RH 1YLVA 5D1XE 5A6JA 4LSSL 2FX8H 2A9MH 3AY4A 5FCSH 4TQTA 1DJWA 2QCDA 3GC3A 5E08H 1PYWB 3RVWC 4PJCF 2EDMA 3SQSA 3AU0A 4FF9A 4GVIA 2HRPL 3GG8A 4DBEA 2HKHH 1YN7A 3LKNA 4E9WA 4K94C 3SCUA 3MVIA 2NW3A 3PHQA 4PFHA 4XSLA 3ARDA 2Z9TA 5ITBL 2HZGA 1W2VA 2C9RA 3SBPA 2ZZ6A 3FN3A 2B5IB 2MOQA 5EN2B 7FABH 4MUZA 4QJ4B 2OYPA 4AWEA 2OK0H 1M04A 4MA8H 4Q4OA 4DGYL 5F6IC 3ATEA 3C60C 2PF8A 1NIDA 2EIJB 3E6FA 1AR2A 5KN5B 4MDIB 1GTEA 4HS6B 1QI2A 1LHZA 2Y24A 3IRDA 4FB7A 3BIBX 3QNYA 4NZRH 4YEEA 1N7ML 1NGZA 3H2WA 3X1FA 3BT0A 4ORIA 4XNXH 2VW4A 3T2NH 5IJCC 4BK4A 1UJPA 4ZAKB 3UT0A 1BIIA 4NQEA 4L8CB 3UTSA 4AY1A 3ESVF 3BVUA 4X4ZA 3GHBH 5JW4Q 2C4FT 1W0VB 4NUQA 5K9JL 3Q6GL 1HINH 4XAGA 1EJOL 4N4QA 4GLRI 3PF3A 1V5JA 2BP1A 3F7JA 2BOLA 1KJ2A 1EIBA 4CBZA 4F2TA 1TSHA 3QCUL 4L8DA 1QUNA 1H3XA 1MCOH 4KO6A 4AU0A 3P0VH 4GO8A 2ZSVB 2OMXB 1SF3A 4PJEB 3V4PB 3B8TA 1FV1B 5BMFH 5JIMA 4U1MA 1FLTX 4XX1G 3HHMA 3ITLA 4XD3A 4AKQA 5FF7A 3O3AA 4JG0L 5LHFA 1IGCL 3PY9A 5CZ0A 2A73B 4NZ8A 3WH6A 1FE8L 4WO4C 3CVBA 2X2UA 1FVDB 2QSVA 3UMNA 2W95A 5KJRH 1V3MA 3FB7A 3VXRE 3QW9A 3QY6A 4OD2A 4WI0B 2NY1D 1QA9B 1YJDH 3ZLQC 1IBDA 3H55A 4WZHA 3DGRA 4R2GB 1OVDA 4N8PA 1K3ZA 2WNZA 4M1BA 3HLAB 1EZUA 4AIXA 1D5ZB 1FVEA 4D1JA 3UEZA 2X10A 4MJ6B 2ZQKA 2QZQA 3EZJB 2DUZA 4CD6A 2CBMA 2VXQL 4G6AC 3WKML 1EOKA 2APFA 4AQLA 1EQWA 3NFPB 3RX9A 1DJHA 1KG0A 2FSEB 3W11C 1GPFA 2NUXA 3BG9A 1EJSC 3C2FA 1ZCOA 1JCJA 4JGDA 1IB5A 3M1OA 3KBNA 3NPWA 1XL9A 4GXPA 1ZHLA 3UJSA 5DHYB 3VXME 4BDVB 2BIOA 4P4RA 2NPLX 2UUDH 4FLHA 3UYRL 1KBJA 2DEPA 3LMZA 5HMFA 2CK0H 4FTVE 1ZTMA 5HJBA 3VGBA 3T0ED 1A3RL 3OC8A 4M1CC 2Q87A 4AD0A 3UVIA 3CJJA 1CLXA 3H7LA 4ZODA 3FSUA 3MJYA 1QPOA 4RGOH 3PBGA 1G6RA 2V9UA 2WZ5A 2VEPA 3ATYA 1J7VR 1UKQA 4ODUB 4GMTH 3WNNA 4LUIA 5AW9B 3U30C 2LLGA 4FKKA 1V6VA 5ADOH 3T3PF 5K9QI 3MRCB 1R46A 3HRZA 1FWRA 2DW6A 1QHQA 4C6PA 2LHAA 5DWPA 4R34A 3LEYH 5EZJA 1ZCCA 2Q0ZX 3HMXL 1W17A 2PDNA 3M6YA 5H37G 4NO2A 4BEIA 2CJTA 3QR1A 4GA8A 1R17A 3MUCA 1HF6A 2YQGA 4PR5A 3PXHA 1SHXA 2HA1A 3CLFL 3H0TB 2FBJH 4HCRA 5FUOL 3SCMC 1QPRA 5DMIL 1R5YA 1OTUC 1VBUA 4GAGH 2IPJA 2QPXA 3N18A 5D2VA 2VQ1B 3T71A 4PRAA 1RIHH 2XWRA 4F8LA 4J3VA 4PCNA 2OX5A 4MQXC 4F7PA 4H2CA 1FRGL 2HG0A 3ZQ9A 2CDEA 2WO3B 1U93A 3IGUA 4JEQA 2O61B 2J66A 4JX0A 1CBVH 4UBDC 4TOYH 3CFTA 1R3HB 5D7IB 1PXGA 4PRIE 4NCC2 1KYFA 2AMUA 3E6HB 4NQDA 3CK0H 4AX3A 3L7RA 2HTKC 3NSXA 3R06B 4I3SH 4DJMA 1IFGA 4GXUN 1GWJA 3F7RA 3STFA 3HA1A 2HV5A 3APDA 3PJUA 3WYZA 1QSFA 1XZ0A 5D70L 4ANVA 4I8YA 1I1RA 1RVFH 1JPEA 4J3OD 5JLZA 3MRMA 4CVUA 3EFDL 5A94A 5C71A 3Q45A 1U8PA 2BVQA 1YPZB 1E9QA 3MNVA 4PJIA 2Z4GA 3MLXH 5D7KE 1CURA 3AXMA 2GABA 1KTDA 3MQIA 1MCKA 3PHAA 1E5NA 2SFPA 4KVNL 3SJVA 2YD7A 1NOUA 3FJLA 5D6DC 5DEGA 1SY6L 4HULB 5IHWA 1LBMA 3MRBB 2YJQA 4GW5A 3TT1L 1KRAC 2P0IA 3ZZLA 4OUEA 4W84A 1Q13A 3URNA 1E3FA 1A4BA 1PY9A 2CHXA 4HALA 3VXRB 2EABA 1PZCA 2X89A 4P99A 1JNDA 2ZOTA 5DURB 3KBSA 1TFHA 3H9SD 1B4RA 1SDYA 3NDZA 2GTWB 4HOWA 4PUMA 8RUCA 3U0TB 2DQGH 3RPBA 5CU9A 5L6UA 4I5RA 5ECJE 3TN6A 3QFJA 1VPXA 2D31A 2EDHA 4N2LA 2ZAIA 3EH4B 2V2XA 3U2JA 3AU6A 4XO7A 2WWKT 2F7PA 3I2CH 3S5SA 4XPTH 1IAIM 3BP6A 1U8OB 3BWSA 3WNIA 4GFIA 1DZBA 2HRWA 1J0HA 3F7VA 4IRJC 4DEPB 1WNOA 5INDB 1LG2A 3MRLA 1INQA 1I3UA 3QS3A 3Q8FA 1AL7A 4ETQB 1R9XA 3APMA 2XFXB 3TVMB 3H42L 1EKOA 4K3ZA 3RWEA 3CN4A 3DX3A 3LEPA 2J1KA 1MEXH 3X14A 3HZ3A 1ZWIA 3GSOB 1IF2A 3DZ1A 1MCOL 2MCAA 4JMNA 4WI8A 4KZEL 1JS4A 5JQ9A 3AHVA 3PHOA 2H2PD 4RWYH 3T0EA 4LFYA 5D9MA 1HEZA 5AVYB 2QHLA 4LPUA 4MA3A 3UJTL 3VDCA 4IISA 1NAL1 4ADTA 2XUWA 3VIKA 15C8H 3BSGA 4L56A 2IANB 3D9AL 1WFIA 4PJ5B 1M6OA 3QUYD 4X8XA 4B53A 2X28A 4BCXA 2APXA 3CFDA 3HMWH 1OTTC 3PWNA 4EF3A 3ULSA 1TPDA 3MV7A 4QHKI 4DKEL 1TWZA 1H1ZA 4JTQA 4AZCA 1PQZB 3QUXB 3NEEA 5TQ2H 1F2QA 1EGZA 3C2VA 4RMSA 1CZ8H 1E0VA 3P4MB 3VO0A 1OZMA 1MFAL 4HKZA 1ZP4A 2CETA 2R14A 3PJWA 4B5XA 1OF2B 3FQNA 5LNGA 2O1AA 3ARYA 4ZXOA 1PNCA 1FBAA 5EH1A 4FULA 2OJEB 3C6CA 2VGGA 5EBMB 5HBFA 3J2PA 1ZL1A 4NOBA 4NBZB 2JQXA 1C5BL 3ILQD 2ZCKL 4YHZH 2OZ3A 3WLNA 5G4EA 1UPPA 1ZPTA 1L6XA 3IFLH 4R3UA 1WFUA 3RRQA 3EPOA 2WUCH 3WIIH 2HFGH 5JIIA 1NGYB 3DX8A 4C83B 1M1XA 4E42A 5AFAA 4WHYG 1INEL 1KLUA 3VM7A 1RJQA 1YNPA 2JXMA 2J6XA 4KY2A 4V27A 4C59B 4OCSL 4B5UA 3MODH 4J4PC 4KIEA 4RNJA 5F2LA 1T6WA 5HPMB 4ONVA 1G7JB 3IETB 1V3KA 3OBKA