4EF9A

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 4-nitrophenyl isothiocyanate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
pubmed rcsb
source organism Leishmania major
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4ef9A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ef9A01
3W72A 2FPVA 3CIXA 5D2WA 1KBIA 3W2MA 1H50A 2Y63A 4FF7A 3U2OA 5H91A 3OVQA 1TCDA 4X22A 1YTKA 4XZ9A 2X16A 5CSRA 1MZHA 4PCFA 1MEIA 3PSWA 5FF3A 3NAVA 3TQKA 4RKAA 2W6RA 1JCMP 2FDSA 3HPZA 1RVGA 1TPFA 3TQVA 1OFAA 1Q45A 2QUVA 5AFDA 3S1XA 3SFKA 5HULA 5BRBA 1LRQA 4M6PA 1D3HA 4Z1BA 1QWGA 1DBTA 3W7DA 5SWUA 1OK6A 3TXVA 1OHLA 3N73A 7TIMA 5D02A 2QR6A 3W87A 3PVFA 3G1SA 3H54A 2JK2A 1JVNA 4AWTA 4POCA 3HOJA 4A21A 3BO9A 3B4UA 1JJKA 3W9ZA 3KVKA 3NPXA 4FNRA 1LYXA 2JGQA 4ZL1A 3G18A 3CQ0A 2YX0A 1I2QA 3S9YA 4PEKA 3W84A 2QUTA 4KWVA 1A5BA 3LCHA 3NA8A 1LTDA 3OHIA 4FHAA 5BOOA 3UZJA 1PV8A 1ICQA 3MP3A 3M5ZA 5CZTA 4RV8A 5D2YA 2VC6A 1ZY9A 2NXGA 2ZZ6A 3OVPA 3HG4A 5HUOA 1S5WA 3NQMA 3G3DA 2BXVA 2H8ZA 5TIMA 1LROA 4FXRA 3NO5A 2GVGA 4QITA 3BK0A 5D30A 3V1PA 3W22A 1A5AA 3M43A 3QQ1A 3UY8A 3N2XA 5G1TA 5AHFA 5BMWA 5CKSA 1VCVA 3GXTA 2WSRA 3DFNA 3THQA 2I14A 5FEZA 2EKCA 1WA3A 1OK4A 1Q6QA 1JUKA 2CWNA 2V8ZA 1ZALA 2PCQA 3O05A 3W6YA 3OVRA 4JTUA 2FB2A 3EXTA 3QZEA 5A8GA 5DY3A 3TW7A 1OFQA 2W0UA 2VENA 2RDTA 5TQLA 3EWBX 3PUEA 8TIMA 1F76A 3W88A 1VCGA 4IXHA 4ZQPA 5MHBA 1XBVA 4WY0B 1G67A 2Y85A 1SZGA 3L68A 1P0KA 2YXGA 4PA8A 3TQ0A 5AOUA 3INPA 3M9YA 5K9XA 1VYSX 1Z41A 2E5CA 1FWTA 3M1ZA 1JRCA 2C19A 3LCXA 1ZNNA 4GUGA 2RH9A 1IXQA 3LCLA 3OEXA 4MZYA 3NQ7A 2Z6IA 4N6FA 1RZMA 5D03A 1OX4B 2VKZG 1YPFA 2A21A 4U4MA 2CW6A 2DU2A 2H3BA 1C8VA 2QJHA 3HMJG 4NU7A 3P67A 5GVJA 3LTYA 1X6UA 3IIZA 3L9CA 4IGHA 3W1LA 5CPLA 1EWDA 1H7XA 5AHMA 1O5KA 2DP3A 4UR7A 2ZZ7A 3WK0A 1S3HA 4LVBA 4PTNA 2R8WA 3IIPA 1FCUA 2Z6JA 4UFLA 2J9ZA 4KFOA 4JX6A 3UPBA 4K6AA 1ME8A 2NUXA 3ELFA 1OFEA 1ZAIA 1LORA 1OFRA 2WO5A 1EP3A 4FX6M 3LRMA 1H1ZA 2EF9A 1YXDA 4PL1A 1W31A 3B05A 4GUJA 5AYYA 1OFPA 1Z42A 3M5XA 1LBLA 3FJ6A 1PE1A 4HNNA 2QUUA 1F74A 2RKXA 3QW4B 3TE9A 5KZDA 3SJ3A 3I65A 2WQPA 2B7OA 3GR8A 3WK3A 4LUIA 3DFTA 3E49A 1NAL1 1PCKA 2DZWA 1R30A 1H7OA 3LI1A 1R2RA 4M7SA 2QCNA 4LVFA 4Y6GA 3W2LA 1B9BA 1VGAA 4JTTA 4UFMA 3BLEA 3S5OA 3I7QA 4UCGA 1T99A 3C3NA 1KLYA 3L5MA 4LC8A 1WQ5A 3AJXA 3F1QA 1ZAJA 1YXYA 4FIQA 2J9XA 4N9EA 4WXZA 4IX2A 1L6YA 5CZSA 5FF0A 2ZRYA 1TQJA 1VJIA 4ADTA 1W3IA 4OBTA 1ME9A 1KFJA 3OG3A 3VE9A 2NUYA 1EX5A 4UNLA 2RFGA 5K9DA 3T55A 1JUEA 5KTLA 4I7UA 4R34A 4NX5A 2IQTA 3MI2A 3GZ3A 1YYAA 4LT9A 4GRSA 2QCLA 4P61A 4UTIA 2GOUA 1QPQA 4FNPA 3NQEA 4OWGA 2V82A 3TIMA 2Y88A 1OX6A 3Q2DA 1IGSA 2C13A 3ZFHA 3G1XA 1T8XA 2Y7EA 4HT3A 4ONVA 1SO3A 2QCHA 3H53A 4JY8A 2NXIA 5AHNA 3GNDA 1OF6A 4LW7A 2EAWA 2NX9A 3DHFA 3EWXA 3EWWA 1UUMA 3HIJA 3PWAA 3IIOA 4RJEA 3LRKA 4NJJA 1GVRA 6ALDA 3KOFA 4H4IA 4AB4A 1KFEA 3QYQA 1HL2A 2NWSA 3PBUA 3BG9A 3NPWA 1B4EA 3RNDA 3UWVA 3L0GA 2TYSA 3IVTA 1OFDA 2CLMA 3FFSA 4R53A 3NR0A 1TPWA 2E1DA 3CEUA 2CFFA 4ORIA 1YDVA 1AK5A 4ZMGA 4WJEA 4DXVA 3W1NA 2NWRA 1FWNA 4PODA 4E38A 1VQTA 3W85A 1EUNA 1ZFJA 2D73A 3SR7A 2PRHA 1N8FA 1LLWA 2VXNA 2JKAA 5F1VA 1VCFA 4I9AA 1OJXA 4HNTA 4CCEA 4XUGA 5I3FA 4HN4A 3PG9A 4DELA 2AAMA 4Z1AA 3LHUA 3W74A 3P84A 3HF3A 1AMKA 1H5YA 2TSYA 1HFBA 4N4QA 1AW2A 1SQ7A 1N55A 3HGSA 1U5JA 1EWEA 3WJSA 3ZS4A 3VCRA 1KTCA 5K4XA 3QJAA 3GKAA 1IXOA 1XI3A 5U7SA 3TV8A 3JS3A 3MMTA 4MVAA 3W7HA 4DO6A 3VNDA 3QMSA 2X2GA 4CNOA 3LBMA 2R14A 4N02A 1PIIA 1KFCA 2P0OA 2H90A 2YYTA 3GDRA 1I4NA 3W1AA 4FNQA 1QDSA 1WOBA 3ABOA 3P61A 3FIGA 3TDFA 1VZWA 4MUZA 4OT7A 4N6EA 5D2TA 1VRDA 3S5ZA 5C2XA 4JTSA 2ZZ1A 3NM1A 3W86A 4UUIA 3W2KA 1H7RA 1ZENA 2W79A 3ATZA 3DAQA 3NQDA 4XTDA 1L9WA 1RQEA 4LRTA 3S1UA 3G0XA 1SU5A 3FA5A 4M7TA 4UFJA 4R7JA 1VYRA 4O4VA 1XKYA 3PF3A 4JTKA 5C6MA 4UTMA 4Z1DA 1IIHA 3S5YA 5EY5A 2ZZ4A 4YCOA 1H60A 4NJIA 3W7GA 2DZVA 2ISWA 4NVTA 1SZFA 3CB8A 1SZEA 3UPWA 3W07A 2G97A 2E6FA 2ZDRA 2GQ8A 1JCXA 1CX9A 3TUUA 4JNMA 2JKPA 3W2NA 3E9AA 3STEA 1H7WA 2XFWA 4MZ1A 4EWND 3O15A 1ML1A 3SI9A 5D2XA 4WY0F 1H1YA 3P8JA 2VEMA 3W23A 1J4EA 4YL2A 2JGYA 2BZNA 3QSTA 3EKLA 4DF0A 4LVAA 1LLZA 4HPJA 3RFAA 3B04A 3HO8A 4O52A 3RLUA 4LNYA 3H55A 5AHIA 3CHVA 3GLCA 4K7YA 5CPNA 5HR7A 4WUIA 4XBSA 2E77A 1TJRA 4LVGA 3Q94A 2QCGA 4Z08A 2V2CA 3GNNA 3QQ0A 3TH6A 1EA0A 1GQNA 3QM3A 1LM1A 4JYEA 3PC0A 1G6CA 4QSHA 5DELA 3I7SA 2ZYFA 1SSGA 1AW1A 1JULA 1WOAA 3RK8A 2Y70A 1TJPA 5AN7A 3DBPA 1T0OA 4JGDA 4O4WA 1WV2A 2B7QA 1I8JA 1TRIA 3SGZA 3PBVA 4NXSA 5KINA 2QCCA 4NT0A 3PB0A 2R94A 1KFBA 4H3DA 4GFSA 4PL2A 4GJ1A 3W1MA 4HSOA 3N34A 3UD6A 5EA9A 3L5LA 4UMBA 3R12A 3GX9A 2V2DA 4UFKA 1SW0A 2QAFA 3NQGA 3V75A 3C2OA 3TMLA 3FLUA 4UTLA 2CLLA 1OABA 1G4PA 1I2PA 3NPVA 4BWLC 5KZMA 3NQFA 5LNSA 4E0CA 1K8XA 2ZA1A 3I68A 4O28A 5DXXA 3GDLA 4FO4A 5LGZA 1XDMA 1SPQA 3M47A 4Y9AA 4JS3A 4DBEA 1F2JA 1XL9A 3IIXA 4AWSA 4LS1A 3LCIA 3F4WA 3C2FA 5E93A 3W1QA 3M44A 2ZRZA 4FNUA 4A29A 1JCYA 5K3VA 2QJIA 4JR5A 1IXPA 1SO5A 2EGZA 5C55A 3M5YA 3LDVA 3M7WA 4WOZA 5HMSA 2VEPA 3DKJA 1TPDA 3SECA 3ABQA 3L67A 3T40A 3KHJA 2I9EA 1AL8A 4BI7A 3GAKA 4MYXA 2ZZ2A 2O7SA 3NL2A 2FB3A 1GVOA 3ZWSA 1TMHA 5F2GA 2TRSA 1MO0A 5CSSA 2DZXA 1G69A 1QO2A 1DJQA 1ADOA 1KTBA 4PC8A 2V5BA 1LBMA 2WOQA 4G1KA 3TFCA 3NNTA 3UYCA 1QPRA 4JTIA 1TREA 4A2RA 1SFLA 3LLDA 4ADUA 3ABRA 3DI1A 3BGGA 3NL6A 5G1YA 2CLHA 3WJYA 3QPYA 3L66A 3EWYA 4IOTA 4Q32A 2ZZ5A 2J6XA 3S0CA 1H7NA 3IIVA 1K7EA 3BG5A 4O0KA 1DQXA 4O8RA 3W71A 1KM1A 5FF7A 3CU2A 2V81A 4JTEA 3CWNA 4P2VA 1HG3A 5DXYA 3GDKA 3KRZA 5BW6A 1O94A 3MW7A 2BLEA 4ALDA 3LM7A 3THAA 4OE7A 3UWWA 4EIVA 3LB0A 3HG5A 3NZRA 1TV7A 1GWJA 2QCDA 3NG3A 5HUPA 4O1CA 1M6JA 2J9YA 4OGZA 1XDLA 5J5RA 4WXYA 4JTGA 4UFHA 3GDMA 2X1UA 3TJLA 2C16A 3GVGA 4BI6A 2C3ZA 5HNRA 1UJPA 1MEHA 4C1LA 4JD4A 1VHCA 5F2IA 4XKYA 2I1OA 3NDOA 3DXIA 3IV3A 3PY2A 1FXPA 3A21A 5D38A 2X1RA 1K7FA 1O95A 2H6RA 3S8HA 2PRLA 3P74A 4RZ5A 2A85A 2ZRUA 4QISA 3BLIA 1PHQA 2E6YA 4E2BA 2WSYA 1BKSA 1V5XA 3A24A 1JCJA 2B0MA 2V30A 5EBUA 5G4WA 3UQNA 1XXXA 1BWKA 2WPBA 1P0NA 1VPXA 4IXXA 3LV6A 3SSJA 1PS9A 5DCDA 1FBAA 4WY0A 1HUVA 3GB6A 3HG2A 4FEZA 2RDUA 3OA3A 4HNVA 2BWGA 4AMAA 4FXSA 1QPOA 3W7QA 5DCEA 4YLWA 4WOQA 3UY7A 3EKZA 4DPQA 4UIOA 4IMEA 5AC7A 5G5IA 2ABBA 4O11A 3C2EA 1IF2A 3UWUA 3W7JA 4TMCA 3MWAA 4MJMA 3N14A 3LX9A 3O63A 2QEZA 1SUXA 2WKJA 1WDWA 4JEQA 4EF9A 4LU0A 5F2LA 4JX4A 2FFCA 3SGUA 2QJGA 3PR2A 4A22A 1SSDA 5FEXA 2YGYA 2Y7DA 3W7RA 5F4WA 2UV8G 5AYZA 4IPIA 3PUDA 3NVTA 2PURA 3U8GA 3UWQA 1LRNA 2QDGA 4O1DA 1K3UA 5D2VA 4GUHA 1O4UA 4AHOA 4NXKA 2JBMA 3AO0A 4UC5A 2ZA2A 1KTNA 3KXQA 4JDYA 4O16A 4MYAA 3LGEA 4X9SA 5K9CA 4DO5A 4RXFA 4O1BA 5HWMA 3MHGA 1DV7A 5G2IA 1LDCA 2A7RA 3QEZA 3DU0A 3JR2A 4QIUA 4UR8A 2V0TA 2X1TA 3NEVA 1NVMA 4I7WA 1W3NA 2YFNA 5K4ZA 4OQVA 1MXSA 1GT8A 1DKWA 4R33A 5DBUA 3NYZA 4AVFA 4C1KA 2A5HA 4KWWA 1D9EA 3PUOA 2YPIA 3LXBA 1YTDA 3EX3A 3G1VA 1OFBA 4UMAA 4PH6A 2FJKA 4JTFA 2NX3A 4FB7A 3C52A 3M16A 1M7OA 3DFOA 3OBKA 1THFD 1TRDA 1GZGA 3WFAA 1FXQA 3EEGA 3G22A 1WX0A 1TPEA 1TV8A 2A7NA 4ZQCA 1L6WA 5HQEA 4O15A 5F1UA 2ZZ3A 5AYXA 2QCMA 2Y62A 3CC1A 1QMLA 4QAIA 2Q3RA 2A7PA 2VFHA 1GVFA 1XBZA 1H51A 5G2HA 3C61A 4HIBA 2QCEA 1VS1A 4Z0SA 3FJLA 1WYIA 3TW6A 3EX6A 3W7KA 3NQ6A 3MYPA 2VOMA 4O17A 5AHEA 1YDNA 1DOSA 3W76A 2VFEA 3MBDA 1LBFA 3P81A 4BWLA 4K39A 4MFDA 1NF0A 3I7RA 3B8DA 1I2OA 2J27A 5G2WA 2ZA3A 1W8SA 4CNNA 4AF0A 4UFIA 5AC8A 4IPJA 4JTHA 4MFEA 3UNDA 4CCDA 4LV9A 2Y7GA 3FKKA 5LGXA 3KVLA 1SW7A 3BLFA 3LCFA 3W1XA 3O6YX 1G4EA 1LCOA 4O18A 3TSMA 2QCFA 2CU0A 4K8EA 2YCEA 2NLIA 2C18A 3P82A 4K8HA 5L9FA 4UNKA 1B3OA 3O6DA 5F2MA 5KITA 1LOLA 1GG1A 1MSSA 1CW2A 3B03A 1YPIA 3G1HA 2YZRA 3F03K 3EX2A 5K2ZA 5HWJA 1W5QA 3UWZA 5LHEA 3FS2A 1W5NA 4JYFA 1KBJA 2H8XA 1ALDA 1VR6A 1C29A 4IJBA 2YR1A 5CPOA 3B0PA 2BTMA 2CZ5A 1VLIA 2NUWA 3T4CA 3KVJA 3MI6A 4M5PA 3N9SA 3TU9A 4BI5A 1WBJA 4JIQA 4LWWA 1PL9A 2E6AA 2PRMA 2NV1A 1TQXA 4DPPA 4DEFA 1OVDA 3SY5A 1KFLA 3S42A 1HO1A 5C54A 3KAOA 4LC6A 2VEKA 3PAJA 4ZQNA 2J88A 4K37A 4ZQOA 5HWNA 4J9JA 3ZR4A 5AB3A 3L5AA 3R13A 5FEPA 1K8ZA 1HTIA 1EP1A 3E0IA 4CLMA 3MHFA 2WNQA 1F6KA 1A53A 2A4AA 2FPTA 4X3ZA 4QNWA 3S5NA 3C2VA 3CWOX 1TYGA 3KVMA 4RX0A 4UTWC 3W73A 3NGJA 1R47A 2OX1A 4LY8A 2XN0A 3GXPA 4NZJA 5I3GA 1G7VA 4O0ZA 1QOPA 3GXNA 1L2UA 3W7LA 3DFSA 3WK1A 4EOUA 1P5BA 1N7KA 4XTIA 3LHVA 3L0NA 5E0KA 4O12A 3TJXA 1TO3A 2HMCA 2GPTA 1ZHAA 2QKFA 4RZ4A 5DCBA 2EPHA 3O07A 3KX6A 1KM2A 4IMFA 3HGJA 4JTJA 2BSLA 4DF1A 1ZJIA 4O13A 4AAJA 3BGJA 3TC7A 2B4GA 4KKXA 3NQAA 1KV5A 2OZ0A 3M6YA 4JIPA 2GQAA 3U6WA 1RQBA 4GE8A 4HSNA 4IQLA 1T96A 1W37A 2GVJA 3O6CA 3W7CA 1GJPA 1FY6A 3QMTA 4CQ9A 3B0UX 5DY2A 3MJYA 3CTLA 1XUZA 1U83A 4MLRA 2A6LA 1QCWA 2DZSA 4M6QA 1X1OA 4EF8A 3GDTA 3PBYA 4LTSA 2CZDA 3B0VC 3D0CA 1KM4A 1BTMA 1OYCA 4Q4KA 4NQ1A 1NF7A 4LVDA 4Y90A 3QFEA 4AXKA 4OHQA 3VFLA 3I6RA 3G8RA 3L65A 4XWUA 1ICPA 1F7BA 1LP6A 5BNKA 5LHFA 2NZLA 4OU1A 2F84A 4A3UA 5I3HA 2GQ9A 5EPDA 4TMBA 1NEYA 3P62A 1FDJA 3A5FA 3BG3A 4S2CA 1FDZA 4CNPA 1YTEA 4NNBA 4UTTC 5FESA 1YADA 4O54A 3W7OA 1QOQA 5I3IA 1F5ZA 1GYNA 1RQHA 2Q3OA 3NXFA 1VHNA 1WAUA 3C6CA 5HJLA 3VKJA 2JKEA 1K03A 1SFJA 1G4TA 5TBOA 1K02A 1I45A 3EXSA 4L4LA 2FIQA 5FEWA 1UASA 4OV4A 3QW3A 1H7PA 3LHZA 1QR7A 3P5ZA 1UB3A 3LBCA 3FEMA 3NZ1A 4LV4A 4RR4A 3LHYA 1A5SA 2CZFA 1UCWA 3G3MA 3A5VA 1DL3A 4JY9A 3LI0A 1TTPA 3P5YA 3STGA 3SIZA 2PC4A 2HS6A 3E02A 1F05A 1QO5A 4QJ1A 1CI1A 3LCGA 3DHDA 4TIMA 4ML9A 4ZVJA 2CZEA 3TSDA 2V9DA 1UBSA 3YPIA 4MIMA 2ALDA 1QFEA 1XUUA 1Z48A 1P4CA 2E5DA 3NL5A 1E51A 3IVUA 2QAPA 1XBYA 4NX0A 4RXGA 3P60A 3KRSA 4N9DA 4O50A 2KZHA 4N4PA 1GVSA 1KW1A 4GUIA 2AQWA 3WK2A 4ZQMA 3G1YA 1KV8A 5G4EA 3RMJA 1KM0A 4Y8FA 5D32A 1OYAA 1X7FA 2Z1BA 3EWZA 2GJNA 5CGQA 4WD0A 4GNJA 2Y61A 2ISVA 4CCCA 1VH7A 2X30A 1KFKA 3UWYA 1UUOA 3TA6A 2OT1A 3A23A 2ZQ0A 5F4SA 4ZQRA 2QF7A 2ATSA 4GBUA 3N3MA 1Z44A 4CQ8A 1OG0A 4FX7A 3W1TA 3Q37A 4DO4A 1ZAHA 4BK9A 4HKPA 4O14A 3LRLA 2A2IA 3LXAA 1AW5A 3HJZA 5EL1A 3EB2A 3G8EA 1I2NA 1RD5A 3HGRA 1QPNA 2CLEA 3G0SA 3TC6A 3A22A 2YDAA 4YWIA 1Q6RA 3GAYA 2FPYA 1TIMA 3ATYA 4N9CA 4DBDA 1RV8A 2QCDB 1JUBA 2ZCGA 3W2JA 1B4KA 1X1ZA 2WV8A 3HGOA 3G1DA 1XBXA 1PVNA 1GEQA 3IGSA 5ABTA 4HHPA 5CG7A 3M0ZA 1R2SA 4E2DA 3N2MA 3P8IA 2E5BA 3L2IA 3PSVA 4XKYB 3MP5A 3TK7A 4QQ3A 5LSMA 1JCLA 5F4XA 4DF2A 5BMXA 3R2GA 1GTHA 2X1SA 1W3TA 4MY9A 3LTSA 4B5NA 2C1HA 5CZJA 5KSWA 3EX1A 1DHPA 1OF8A 2WSQA 3N19B 3W7NA 1DQWA 3VI2A 1TPUA 1DJNA 4N2YA 2WNNA 4AEOA 3DENA 2A6NA 1P1XA 2P10A 1I2RA 3EX4A 2FLIA 1EPXA 3BW3A 4Q33A 4ADSA 2ISSA 4WZHA 4MY8A 3G1AA 2ZRVA 1Y0EA 1RR2A 1FWRA 3QC3A 1F73A 1QNVA 3CM4A 4S2BA 2Z0IA 4M19A 1JR1A 2VEIA 4NJGA 3W3OA 4UTWA 6TIMA 1OX4A 3G1FA 3TMQA 4UTUA 2DORA 1GVQA 4CQAA 4TR9A 5IBXC 2AGKA 2V5LA 3R5EA 3E12A 2ZRXA 1W5OA 1L6SA 3LOTA 4I7VA 5I3JA 3P7YA 5AHLA 1KA9F 5C5YA 3T78A 4MJZA 1AL7A 3TFXA 4O10A 1W56A 4JN6A 5T26A 3RLVA 3T7VA 3RU6A 4NNCA 1W5MA 2YW4A 2ZTJA 2DJLA 1GG0A 4JYDA 4LUJA 3UXAA 1D3GA 4ORMA 3B06A 1KM6A 2VELA 1K8YA 1H62A 1JQVA 2G96A 1EB3A 3M5VA 4HPXA 2V2HA 3UXDA 2Y89A 3DFPA 5KMYA 3S6DA 1GPWA 4LRSA 1Q6LA 2HSAA 1B57A 1IIGA 1Q6OA 4BF9A 3STFA 2Q8LA 3USBA 2H3DA 3PULA 1XM3A 1FCBA 2CLKA 3JRKA 3IEBA 1TTQA 3LLFA 1JRBA 3WJWA 4YMZA 1TPC1 5FF4A 2GVLA 1LRTA 2YYUA 4JTLA 3RF9A 2C0AA 5HINA 1J2WA 3IVSA 4AHQA 3O16A 3L21A 4MY1A 1J5TA 1XCFA 4FNSA 2DJXA 3HG3A 3BVJA 3PM6A 2XN1A 1DVJA 5A5WA 3W70A 4TX9A 5LNUA 3DFQA 3NQ2A 3W75A 1NFBA 4JDBA 3KFTA 2OJPA 3MI3A 4RK8A 4BFAA 1GYLA 1R46A 4UTTA 3NPUA 3MP4A 4O19A 4RLIA 3MO7A 2NX1A 3TAOA 3BARA 3SW6A 2FTPA 5DN1A 5EKYA 2E68A 1RPXA 1TPB1 2VFDA 3BV4A 1LOQA 3LXCA 1AG1O 4Y96A 3E96A 3EWUA 4O53A 5FI8A 1C9DA 1VYPX 4K36A 4D2JA 4TO8A 1YDOA 3NQCA 2YW3A 3GIYA 3C0JA 4U28A 3N9RA 4IMDA 2QDHA 3GR7A 2CLOA 3NOEA 5CZ0A 3C4UA 3ZWTA 1JCNA 5U4NA 2LLEA 5K7JA 4RZ6A 5L6UA 3C8FA 4XQ6A 3HPXA 4AF0B 3LHTA 3CPRA 4JX5A 1FX6A 1W5PA 1FDYA 3F4NA 2E09A 4JXCA 4UXDA 2VFGA 4O57A 3KRUA 5EYWA 4LS2A 3W7EA 2FQIA 3S1WA 3W1UA 3PBWA 4Z1CA 3CIWA 4M6VA 4XBKA 4Z0JA 2ZRWA 2TPSA 4NUWA 3MYOA 5DBTA 2ZFAA 4OV9A 3GKFA 3S1VA 3T44A 2B7NA 4UTJA 1A5CA 2YSWA 5AC6A 2BX7A 2WJZA 1HO4A 4IX0A 2R91A 4WX2A 3BW4A 3MBFA 3LV5A 1S5TA 1TTJA 2G95A 3W83A 4FX8A 4IWWA 1ONRA 3NQ8A 1GTEA 2J24A 1FWWA 2Y6ZA 5LZLA 1F6PA 1PHWA 1TTIA 4GXMA 2EHHA 3WJXA 2Q8ZA 4TU1A 3HQ1A 1OFOA 5LNWA 4K38A 2NXHA 4IUOA 3QMRA 2C15A 1X8FA 3C56A 3CLMA 4WQ6A 3QRHA 3DZ1A 3QF0A 1EUAA 1KM5A 3TXZA 4FIRA 2VFFA 2B7PA 4PFMA 4GUFA 4NJHA 2A1YA 1WBHA 3W7MA 4NJKA 1XC4A 3O1NA 4KFPA 5I3KA 2OCZA 1H61A 3FYOA 2RHGA 4LOCA 2DZUA 3NM3A 1FWSA 4FNTA 3W7PA 2Z2UA 5LKYA 3SZ8A 3PS7A 2A0NA 2ATMA 1DORA 4O1AA 5IM51 2GJLA 5CPMA 1O5XA 1TB3A 1G7UA 3FKRA 3P80A 4AHPA 1G4SA 4NZFA 1KLZA 4ICNA 1PCWA 5FF2A 3Q58A 5J5DA 1JQXA 1VLWA 3L0KA 3DH7A 1IXNA 1TSIA 5D09A 2XN2A 3IGUA 1W54A 3LCWA 1TV5A 3FOKA 1VC4A 3TR2A 3IGXA 3DI0A 3NL3A 2P1FA 4EVZA 2NV2A 3TSBA 3TCEA 4AWUA 3FYPA 1K7XA 1ZCOA 3G0UA 4BR1A 4UTKA 3HB9A 3BW2A 5LNVA 1FCQA 3BPWA 4X2RA 2Y7FA 4LS0A 4IMCA 5D33A 1S5VA 2DZPA 2YFOA 4MZ8A 2ZBTA 1Q3NA 1LZOA 1A50A 1SZNA 1TPVA 3PG8A 2TMDA 3LERA 1M7PA 3QSRA 3GYEA 1BWLA 4S1FA 4H6KA 5EMUA 4YCPA 2HTMA 4MPQA 4QM1A 2E6DA 3EXRA 3DKLA 3HBLA 3IRDA 3TROA 2OT0A 3HPSA 3LTPA 1LOSA 1YLVA 3CT7A 5H2ZA 3G24A 2OMAA 1M5WA 1SO6A 2ABAA 1FCVA 4A2SA 1EEPA 3LHWA 5E1QA 4JICA 1FQ0A 5IBXA 5D37A 1WXJA 2GUUA 1ME7A 3C2RA 1W1ZA 3QH2A 1XFBA 3TNOA 1FUYA 3K30A 5LNRA 2WNZA 4KFNA 1MEWA 3TKFA 3O06A 4UTHA 3W7IA 3W1PA 4MLJA 4L4MA 3R8RA 3MHUA 3A9IA 1ICSA 2CLFA 3CEPA 4YXGA 5DLCA 1O60A 4DQWA 3OIXA 4ZZ9A 4MKNA 1W0MA 1H63A 1TPH1 2C6QA 3W2UA 1KM3A 5D05A 3WJZA 3UZ5A 2G5WA 3O8AA 2PE4A 5D04C 3ANYA 3STCA 1SW3A 3TAKA 1GOXA 2DZTA 1EP2A 4AH7A 1SO4A 2F7FA 3DGRA 3GK0A 3PB2A 4MOZA 3R89A 3ABSA 1OX5A 1QAPA 4GC4A 1R2TA 3VE7A 2O7QA 2HS8A 1EIXA 2ZTKA 3TX9A 3NQVA 4GWEA 4QNEA 1V7YA 1SR9A 1OYBA 2CLIA 4N9BA 4UMCA 3QPZA 4NNAA 2RDWA 5HR6A 3W1RA 4IMGA 1NSJA 4RCXA 1BEUA 2C14A 4W9TA 3M41A 4HNUA 4K7VA 3MUXA 2VFIA 5KZEA 1YXCA
chains in the Genus database with same CATH superfamily
3W72A 3CIXA 1KBIA 3W2MA 2POZA 2Y63A 3VILA 2FHCA 4X22A 4XD5A 4PCFA 1MEIA 3SQMA 3NAVA 4QJ3B 4RKAA 2YL5A 1JCMP 4PUKA 3HPZA 1AQMA 5JBEA 1EQCA 4FALA 2QUVA 3BSMA 3QGVA 2I16A 2Y4SA 4FLRA 2REQB 2W67A 3B97A 3W82A 5H8PA 1LRQA 2VQUA 1IWBA 1K9EA 2CBVA 1DBTA 5SWUA 1OK6A 4YTRA 4MB3A 4Q8OA 3VTRA 3OHMB 4V1XA 3PVFA 1IGWA 1PSCA 4GJJA 3BO9A 2ZXQA 5LIKX 1F8IA 3KVKA 3NPXA 4Z1YA 3HZ3A 1LYXA 1PKLA 2JGQA 1BFNA 2VMFA 2BMBA 2XIBA 1CXFA 2DT3A 1E71M 3QZ6A 2XM1A 3OHIA 1NJJA 1E9IA 1K1DA 1U22A 2CLPA 3H4WA 1PV8A 1TE1A 1D7FA 3M5ZA 3VKDA 6ENLA 4P8UA 4Q7BA 1E4NA 1XP3A 1S5WA 4A3QA 4NY2A 1XPGA 2VZVA 1HP5A 1LROA 3NO5A 2GVGA 4QITA 5RUBA 1W1IE 2PDKA 1BYDA 3CK5A 5A6BA 3GTIA 4BS0A 1TVLA 2YCJA 2PDHA 3DFNA 5A69A 3QVQA 1ZALA 2X40A 1V08A 1PZ0A 2QV5A 4XSMA 3QZEA 3TW7A 1IHIA 2VENA 5TQLA 1XSIA 3EWBX 8TIMA 4KS0A 3W88A 1VCGA 4HHHA 1PX8A 3NZGA 3IJLA 2Y85A 3L68A 3GHTA 4JTDA 1P0KA 4Q4QA 4F79A 3N6QA 4DJFD 3LCXA 1ZNNA 4NAEB 2RH9A 2QDDA 3NQ7A 2VKZG 1E73M 4DLMA 4U4MA 4E3TA 1RSCA 3SCUA 3T2QA 2YIHA 1LQAA 4Y9OA 1O5RA 3U3HA 3OTRA 3CASA 5CPLA 4U2YA 2J6VA 1H7XA 5BZAA 2PLCA 3LQGA 1X6LA 3FX4A 1S3HA 4LVBA 1VFMA 8RUCA 3DG3A 2Z6JA 1V3HA 3GWQA 3UNTA 4ZFCA 1XRFA 4FAMA 1VF8A 4LAMA 5REQB 3ELFA 4IQDA 5IOBA 3LRMA 3C0LA 2ZOXA 2QPSA 1H1ZA 5A2BA 3UA4A 3ZVHA 4PL1A 5CC5A 3WNLA 1GZJA 1QRQA 4HNNA 1ZPTA 1F74A 3GTFA 3QW4B 3AWNA 4KEMA 2O9PA 3AZRA 5CAHA 2NW0A 1QI3A 1JI2A 3N2BA 1GYMA 1H7OA 1R2RA 2QCNA 3CWHA 5C2GA 4JNZA 4DXKA 7REQB 2Y24A 5A6BD 3W53A 3I7QA 3LU2A 3DESA 4UCGA 3DHUA 5AKQA 3L5MA 1LT7A 2J7BA 4L80A 3IACA 4FSAA 4J28A 1HQTA 2ZRYA 1QNQA 1UKSA 4HK7A 1FKXA 1IEIA 3NVDA 2NUYA 4UNLA 2RFGA 1J93A 3T55A 4WDXA 1C3FA 5KTLA 1UROA 4GRSA 2QCLA 3S83A 5HNTA 1GJWA 1EJUC 1I1XA 4HCDA 1B3WA 1D2KA 1E6XM 2PC8A 5A8OA 2Y88A 5JBFA 4YTTA 1TKKA 2IPJA 3OBEA 2FVLA 3QV9A 2ZIDA 4HT3A 4GYPA 1XLDA 4L9XA 4IMAA 1HP4A 5AHNA 1OF6A 4LW7A 1M68A 4H9YA 1IV8A 3PWAA 4RJEA 4M29A 1GVRA 3AXXA 1QNOA 3VCNA 4JKMA 3QYQA 1EC7A 4HMCA 3MMWA 2NWSA 1WDPA 3IAQA 1B4EA 2BHYA 3RNDA 3UWVA 2TYSA 4L6DA 3VIOA 3DYMA 3IVTA 3GTNA 4LXFA 1OFDA 2CKSA 1CTNA 2XTKA 1FWBC 2IKGA 3NR0A 3CEUA 4A05A 1YDVA 2WMKA 1VQTA 1ZFJA 2D73A 3COTA 1S38A 3RUBL 4DJDC 1SM9A 2JKAA 1VCFA 1OJXA 4CCEA 4HN4A 3PG9A 4AD4A 2AAMA 4Z1AA 3P84A 4FR1A 3ID7A 1H5YA 1QNRA 4PULA 3HGSA 1VFHA 2J7CA 2J25A 2BDQA 1AQ0A 3VCRA 3QGAC 5K4XA 3HPFA 1XI3A 5U7SA 3TV8A 3QMSA 2AL2A 2ESCA 4UQEA 1BYAA 2VUYA 3MUIA 2H90A 3BLDA 1RBLA 4LUTA 4PR4A 4OT7A 4ZO7A 1B30A 4CD5A 2D22A 5C2XA 3IPWA 4JTSA 2XSBA 4KRTA 4CU7A 3NM1A 1V51A 4ZOAA 4UUIA 1ZENA 4O1EA 1OC5A 1L9WA 3GG1A 1PTGA 3G0XA 1SU5A 4KCTA 4O4VA 5DT7A 4J27A 3S5YA 5EY5A 4IQJA 4YCOA 1QK0A 3TOYA 4NVTA 1JDEA 3CB8A 2BV9A 4UQAA 2VX6A 3W07A 2XH0A 3DEQA 3HU7A 3FDGA 4E4PA 1HVQA 3QHMA 2OVLA 4MWAB 2J4GA 1CX9A 4JNMA 2JKPA 3W2NA 3BCFA 4MZ1A 3ARTA 1ML1A 3KS5A 3WNOA 4WY0F 1H1YA 3VNLA 3W23A 4IPPA 1O1HA 1TVPA 4ZE5A 2BZNA 3CQIA 4KEUA 2BFGA 4B5TA 3HO8A 2OSYA 3RLUA 4LNYA 5AHIA 5CPNA 1Y8BA 3R6IA 3VAVA 2WZTA 1TJRA 4LVGA 3Q94A 4KWUA 1E9LA 1ITCA 1GQNA 1LM1A 1KGWA 5DELA 3AUJA 1XHGA 2Y5JA 1AW1A 4M0XA 3E0FA 1XYCA 4O4WA 1KGXA 2OSXA 4FR6A 1ZRQA 4HGXA 1PYFA 3PBVA 5KINA 2OOGA 5HNUA 5IFTA 3PB0A 4H3DA 4GFSA 4GJ1A 3UD6A 6XIAA 1H3GA 3L5LA 4DYKA 4UMBA 3BCDA 3V75A 4UTLA 1FH9A 1E9YB 1OABA 2HBVA 3NPVA 5KZMA 4CNTA 5LNSA 5CAKA 2ZX6A 4Q8UA 4BQ5A 2YB1A 3WCZA 4TUFA 4HA3A 4RNFA 3PTKA 3VFCA 2P88A 3HQPA 1F2JA 5HJYA 3APTA 4AWSA 3KWXA 3KBVA 3F4WA 3C2FA 3GM8A 1PIFA 5E93A 2RDXA 3SUTA 3EOUA 2QJIA 1IXPA 1Q4NX 4N7QA 3CAVA 1D8WA 5HMSA 2VEPA 1TPDA 3ABQA 3L67A 2OU4A 3MSRA 4BI7A 2ZZ2A 3GYCA 1XRSA 4GI9A 4Q8QA 2ZUWA 1GVOA 4K3ZA 1TWIA 1AODA 2QGHA 4YN5A 4WJXA 3E38A 1QWKA 3BJSA 4LH8A 1OSEA 2R24A 3SCVA 2PTYA 1NELA 1WZLA 3FY1A 1GPFA 2WOQA 7XIMA 2VUNA 4KWSA 1BRLB 3UYCA 4H2HA 3N2OA 1Q8JA 3PPGA 4CCZA 1TREA 4A2RA 1SFLA 2I5IA 3ABRA 1F3TA 3DI1A 3GH4A 1FWGC 4PRTA 1OT2A 3WJYA 4QTGA 3L66A 4IOTA 1EH9A 5I02A 2J6XA 1H7NA 3RX3A 3WEOA 3VKKA 4IJCA 3BG5A 4O0KA 5FF7A 4QDWA 1K9DA 4JTEA 1US3A 2PDFA 3FVMA 4IT1A 2DPEA 3FJNA 1QXLA 3QXBA 5M17A 1O94A 3MW7A 4LBUA 2YOCA 3THAA 4M56A 4EIVA 1P0EA 3WLRA 1TWWA 5XIMA 4H2CA 1E6PA 3NG3A 2BB0A 4W5ZA 4GGBA 4LGXA 4OGZA 1GOKA 3E2RA 3SBFA 3CZ8A 1XDLA 1CB2A 1T40A 3D3AA 3GDMA 2X1UA 2QUNA 2C16A 1UJPA 4C1LA 1E6ZA 4NZ1A 4PUMA 5F2IA 4UB9A 1OC7A 4V15A 3C2YA 4C7GA 5BROA 4DM2A 1DTUA 4Z2GA 5FJIA 1O95A 4RZ5A 4Z42C 4QISA 4EXQA 3NO1A 3N4AA 3VKBA 3CPGA 3EDJA 3WH6A 4NI8A 5C9UA 3VDCA 3WBAA 2WPBA 5EMLA 2EO7A 1P0NA 4HU8A 4HVXA 1PS9A 1Q7ZA 1M04A 5DCDA 1UUQA 4IIFA 3HG2A 3CUGA 2RDUA 5LYRA 4HNVA 2OELA 3V0UA 4AMAA 4ICMA 1RY0A 3W7QA 3LPGA 4UIOA 3UA3A 2YXXA 2ABBA 4AUBA 4GI4A 1PX4A 3MWAA 1DWHM 3O63A 4H8UA 8XIMA 1UR3M 4H01A 1CGVA 5FEXA 3KTXA 3W7RA 1MFUA 3PUDA 3BAJA 2GFTA 1DIEA 2DGAA 4AC1X 3UXIA 2FZ9A 2IPFA 4AHOA 4DZ5A 2JBMA 4TV6A 3SO7A 3OLIA 1M03A 2PGFA 4DO5A 1J0HA 4O1BA 4XK2A 1VBRA 4PB3A 1KRCC 1LDCA 4BA0A 3QEZA 1RP8A 4PMVA 3ANUA 4UR8A 2X1TA 3NEVA 4PMRA 4I7WA 4S3AA 2YFNA 1JZ6A 3ZJKA 5K4ZA 1MXSA 1GT8A 1DKWA 4DBWA 4FPSA 5DBUA 2DUXA 4G1NA 3IGHX 1S1RA 4KWWA 1D9EA 2YPIA 1O6IA 4HPGA 3EX3A 4XIMA 2F2HA 3G1VA 3PBGA 1BYCA 2FJKA 3UFYA 2DVUA 3MC5A 3M16A 3WMBA 5ABEA 4HNOA 3DFOA 1TRDA 4ROPA 3OG2A 1OEPA 1TPEA 1MDRA 3VGGA 1UWSA 1CCWB 4REQB 1E4MM 3GVVA 5F1UA 5FJJA 4NKCA 5H8UA 3OZMA 1J79A 2Y62A 4NZ3A 2WM0A 1XBZA 1H51A 4HP5A 4GQBA 2WMGA 2A3HA 3PHAA 4QBXA 1VS1A 4Z0SA 3L4XA 3DFYA 3FJLA 3VGFA 1WYIA 4P7OA 3P0WA 4I6VA 1PUDA 3W7KA 5CSYA 1XSJA 2F61A 2BXZA 4I3GA 1S3TC 2BNJA 1YDNA 3NXLA 3P81A 3QYSA 4BWLA 1I2OA 2J27A 1UPMB 3NOYA 5FL0A 4AF0A 4TQTA 4UFIA 4BY3A 2XIJA 1SJAA 4LV9A 4DWDA 2Z4GA 1ECEA 4ZEPA 1VAHA 3LCFA 3O6YX 4RE0A 1G4EA 3UJEA 1LQ2A 2QCFA 3BSHA 2YCLA 1V0NA 2NLIA 4D6JA 2HWGA 1VJSA 5KITA 1LUCA 1LOLA 2EG7A 2G8ZA 1CW2A 2WJEA 2YZRA 5LA1A 3TYDA 1UC4A 2ZWZA 4GPNA 3OZOA 1VR6A 1IZCA 4DAIA 4IJBA 8A3HA 3VDBA 3ZZ1A 2BTMA 3T4CA 2VZTA 1NM9A 1V3JA 3ARYA 3WLSA 1AZ1A 1J0YA 1HJSA 1EJWC 3JVAA 1WKEA 1B1YA 3SADA 4JFWA 3S42A 4KIEA 1EBGA 4QE1A 5C54A 3KAOA 3PAJA 4ZQNA 2WMJA 4K37A 4ZQOA 2XGBA 1XIIA 2CERA 4J9JA 5AB3A 5FEPA 4WDWA 1K8ZA 1OZQA 3MHFA 3WLTA 3VNYA 2WNQA 3GHUA 1A53A 2WLYA 1P7TB 3ZT6A 2ADAA 4NI3A 2BVTA 2XSAA 3C2VA 3GHSA 4OFCA 4FXFA 3WYZA 3W73A 1Q6CA 3NGJA 4QR6A 1JYWA 2HPMA 2OX1A 4LY8A 4O0ZA 5DMMA 4GYFA 3W7LA 3DFSA 3WK1A 4RV3A 1CLVA 1N7KA 3MMUA 1YX1A 4XTIA 2YCKX 4MDOA 1TO3A 2EPHA 1DWAM 1SGJA 2CBJA 1ZJIA 4FI4A 1SZRA 2Z28A 4KKXA 2OZ0A 2VT0A 3M6YA 4H6EA 1A47A 4QRNA 4LCRA 3VGHA 3R0UA 3OOQA 3T9PA 4IQLA 1O66A 1PAMA 1E6NA 1T96A 2OEJA 3O6CA 4PCTA 4XIAA 2I17A 4EPBC 5DY2A 3MJYA 2GVEA 3CTLA 3GR4A 1U83A 1XV8A 4MF4A 5BXSA 4MWAA 4XBJA 2XFRA 1FTXA 4UNIA 5JH2A 4M6QA 1A5KC 4JBRA 3D0CA 1CXIA 1BTMA 4Q4KA 2ACQA 3UJFA 4NQ1A 2YCIX 1NF7A 2ODOA 4Y90A 3V5FA 3KBJA 1PYMA 2YDSA 3R4IA 4OHQA 1W3HA 1XPYA 1XWYA 4LAKA 4XWUA 2FFIA 1LP6A 3IUHA 2J8FA 4XAYA 2PBOA 3AQUA 5I3HA 2VGBA 4TMBA 4G8TA 2VWSA 3CUXA 1UD5A 1REQB 1J6OA 2ZVRA 4CNPA 4AVOA 2Z1XA 3F4DA 1YADA 1Q13A 2XFYA 1Q65A 1F5ZA 3EMQA 3NXFA 3C6CA 3VKJA 4W8AA 2HE5A 3ITOA 2FIQA 1UASA 2IS7A 1XCWA 1VFSA 4J3XA 4I5RA 1QR7A 3M07A 5BRPA 4OUEA 1A5SA 2YA1A 4QLLA 3A5VA 1DL3A 3P5YA 2XGIA 1RJQA 2D3LA 4DI9A 1E15A 4OKDA 1B5TA 3DYPA 2ICSA 3MVTA 1F05A 1QO5A 1MRAA 3WDQA 1CI1A 4GINA 4A8IA 3S47A 2Z1SA 4ZVJA 2CZEA 1UBSA 2WVSA 3M0LA 2VZSA 1IT7A 4GH3A 3WLLA 3NL5A 4AWEA 2GUYA 3CS2A 1XBYA 1Z69A 4NX0A 4U5KA 2E9BA 3P60A 3VNIA 3KRSA 4N9DA 1ZTVA 1M53A 2DZAA 2WHKA 3REQB 4N4PA 1GVSA 1VEMA 3FYYA 1OZMA 4GH1A 4HPHA 4GUIA 4ZBCA 1BXBA 3WK2A 1SFSA 4Y8FA 1Q4WA 2Z1BA 4AZIA 3EPMA 1XX1A 3CUZA 3V0TA 2XDFA 2FGBA 5CGQA 1P6CA 4MWAD 1H5VA 2WSKA 3SUWA 2OT1A 3ZVIA 1OWQA 3KLLA 2EPKX 3DHPA 3WUBA 4CU6A 1WZMA 2W5FA 3Q37A 2WJFA 2ZXAA 5HAOA 1QNSA 3LRLA 1ISWA 2GQ3A 2D23A 2ZUNA 1AW5A 5EL1A 1I2NA 4DNHA 1CWYA 5CLTA 5GNYA 2CLEA 5C2CA 3TC6A 2YDAA 4YWIA 2FPYA 2QCDB 1JUBA 3WL1A 4CD8A 1E1CA 2WV8A 4HNLA 2ZVIA 3Q4DA 5ABFA 4E2DA 5CC3A 2I5QA 3P0XA 3MUAA 2INZA 1FH8A 4XKYB 3MP5A 4CQDA 1UWQA 4QQ3A 1X1NA 4H7CA 1EPVA 3H6OA 3BOXA 4AX7A 2PS2A 5EFFA 1Q6DA 3WD3A 4B5NA 5A2AA 4BEQA 1R6WA 5CZJA 1V3LA 4P8XA 1P0DA 2H9AB 4I9JA 3WMCA 2WSQA 1XD0A 3W7NA 1V3MA 4JN7A 3CHFA 3ZT5A 1DQWA 3DUGA 4KGJA 3DENA 1VEPA 3WELA 1JGIA 1RLDA 1FH7A 3GBEA 1A3XA 3CV6A 1T41A 2ZRVA 4AG0A 1Y0EA 3FA4A 1S39A 2DDXA 1FWRA 3I3DA 3G6MA 3CM4A 4S2BA 2WC7A 4B5VA 1VFOA 4M19A 1AD4A 3S9IA 2R1PA 3TC3A 3VX0A 5IBXC 2OX4A 4DY1A 4NASA 3E12A 3QR0A 1W5OA 4I7VA 5I3JA 3BTNA 4GXWA 2XVKA 1KA9F 4KPLA 4H9ZA 1EKOA 3TFXA 1W56A 5T26A 4QLJA 1Q2RA 3TLLA 3QZAA 4NRSA 4LX4A 2R6OA 1UKTA 4KERA 4NNCA 1GVYA 1W5MA 3G6LA 2Z24A 3UGVA 2VDGA 2CKRA 5I7GA 1UD3A 4PB4A 5E9XA 1XH0A 4ORMA 3B06A 1ZGDA 3QV6A 1H62A 1V02A 2G96A 4XKMA 2RAGA 4HPXA 1GK8A 3UXDA 2GL5A 2Y89A 3DFPA 3IANA 1MNZA 4HA0A 4LRSA 3VD3A 1IIGA 4DI8A 3AXMA 2H3DA 4CNSA 1XM3A 1FCBA 2BOEX 3TYBA 3IEBA 4E4FA 3WJWA 2V3FA 2Z29A 1LRTA 1PZ3A 1EBHA 3QBUA 2PDPA 3T0CA 2PWGA 4WR3A 4MAZA 1J2WA 3POHA 4RDWA 2VWTA 4H7ZA 4AHQA 3O16A 4FNSA 5A6AA 1UP0A 1DVJA 5A5WA 3W70A 2QIWA 4LNCA 3VIJA 1QUMA 1JPHA 2XIIA 2NT0A 2R1MA 3MP4A 2NX1A 3TAOA 3CPUA 1S1PA 1US2A 3SW6A 2FTPA 1EFZA 4R88A 5EKYA 3E6EA 2E68A 1RA5A 2BY2A 4LAZA 3E96A 5C0QA 3U4FA 2YW3A 2G3FA 2QDHA 3OGSA 2GWNA 3C4UA 3ZWTA 1AQFA 5K7JA 3SUUA 5C8BB 2PDQA 1TELA 3UJSA 1FX6A 3F4NA 2F6KA 4PMQA 4O57A 2CETA 4DYJA 5EYWA 1BTCA 1I6NA 4Z1CA 3CIWA 3LG3A 2PDWA 3AHXA 1C8YA 4NUWA 3MYOA 5DBTA 5E70A 5BWFA 4OV9A 1MW1A 3EOLA 3T0TA 3T44A 2PCEA 5F7UA 4L9ZA 4UTJA 2RJHA 5AC6A 3AALA 2WJZA 4I8DA 1HO4A 2R91A 3MBFA 2G95A 1ISVA 1GOIA 1NOWA 4L6HA 1FWWA 4C91A 2Y6ZA 3RO8A 4C6KA 5LZLA 1TX2A 4GXMA 2XVPA 1PTDA 3HQ1A 5LNWA 2NXHA 4FP1A 1US0A 1U33A 1X8FA 1I0BA 2TODA 4B9YA 3QRHA 1S2CA 1EUAA 1LL4A 3CV7A 3TXZA 3URNA 4AEEA 2A1YA 1WBHA 3PZVA 4MNLA 1EA9C 3L2LA 5I3KA 5KEZA 4CD7A 3VDAA 2JF6A 4XZLX 5MKGA 3NM3A 1FWSA 4JQ4A 3URQA 9CGTA 2BXYA 3LSCA 2WHMA 2Z2UA 4IGMA 1IQ8A 2WCGA 4LAOA 1DE6A 1O5XA 3L4TA 2QDEA 4ZB0A 3FKRA 1BYBA 3P80A 3SQSA 4QCEA 3B8SA 4QXIA 4NZFA 3EAUA 4HCHA 5J5DA 3L0KA 3DH7A 1IXNA 5D09A 2QZRA 3TYAA 1AA1B 2EG6A 3DI0A 1EDQA 3MT1A 2IPGA 3EA2A 3TCEA 4AWUA 1R86A 4H9VA 1D7KA 3HPAA 1GHSA 3HB9A 3BW2A 3SCSA 2YJQA 2AQOA 3V1HA 1O5QA 3HQOA 3ENLA 3DX5A 4L6OA 4B4HA 3AIEA 2RGMA 3NUKA 3LERA 1TJ2A 4IP7A 4WSKA 3UZYA 4G2DA 5EMUA 2IW0A 3GZAA 2PPGA 1TR9A 4QM1A 3HV9A 3EXRA 3DKLA 4BHYA 3TROA 1UR9A 4MB4A 3SGGA 1UC5A 4TVCA 1EJSC 2W91A 1YLVA 3RPDA 3CUJA 5EMYA 1SO6A 1PWLA 1BF2A 4A2SA 4JICA 2P3ZA 5JMUA 1GQKA 5D37A 2NVAA 2FTYA 2HE8A 4DZHA 3CQKA 4YYCA 4TXEA 1W1ZA 4TV5A 3QH2A 1XFBA 1EJTC 2J79A 4LY4A 5BYWA 3W7IA 2VI0A 3A9IA 3FSTA 1W17A 1FP9A 1HJQA 1REQA 1Z8AA 1FRBA 3AXHA 1HIZA 1YNPA 1W0MA 3GU2A 1H63A 2C6QA 2QPUA 3WLPA 2WQDA 1OGBA 3O8AA 3ITYA 2PE4A 3DIPA 3ZR5A 3RMEA 1UPPA 4BQ4A 3D3FA 1GOXA 2OTDA 5GQBA 5T91A 2CYGA 1IEQA 3PB2A 3K46A 2HVNA 2DEPA 3MDUA 1X39A 4GC4A 1OIFA 2O7QA 3EDKA 2ZTKA 3D46A 5J8LA 4OBRA 1OYBA 2YA0A 3UG4A 3UR5A 3PZ9A 4N9BA 2QVHA 1UWTA 5AZ1A 1W1PA 4IMGA 3GXMA 1NSJA 4BQ2A 1BEUA 1KKRA 3IJDA 3WY1A 1NWRA 3THDA 5D2WA 3DN5A 1H50A 4FF7A 4Z2IA 3OVQA 1TCDA 1YTKA 4V27A 1JAKA 2GWGA 2X16A 3A4XA 1MZHA 4AZCB 5CSRA 4DVOA 3NSXA 2FDSA 1RVGA 4Y9NA 5AFDA 3S1XA 1FHLA 3SFKA 5HULA 4M6PA 1D3HA 4JTAA 3WL0A 5FJPA 1QWGA 3PJTA 3N73A 4A3YA 4S39A 2JK2A 3WBEA 3BJFA 2CNCA 1GNXA 2D0HA 4HNCA 3HOJA 3BSGA 1KXVA 3KP1A 1HKWA 3MO4A 2A3CA 5E9AA 4ZL1A 3GHRA 3S9YA 3KBMA 4MKVA 3K1DA 4KWVA 1A5BA 5I07A 3NA8A 1LTDA 5BOOA 3OW1A 3UZJA 5CZTA 2VC6A 2NXGA 3OVPA 2YA2A 4G7EA 4FOJA 3PNUA 3NQMA 1FHDA 4E3VA 4J3SA 3CIVA 3BK0A 4HK5A 1DXEA 3M43A 1HL8A 3UY8A 3N2XA 5I23A 5AHFA 1K4HA 3GXTA 5AZ0A 1R3WA 2WSRA 4Q6XA 4H9TA 1AH4A 5A6MA 1EXBA 2V63A 1WA3A 1DJYA 1LG1A 2NQ5A 2CWNA 2PCQA 3W6YA 3VVGA 4JTUA 1E0WA 1GEHA 1K9TA 1J12A 1J0ZA 1CB7B 2OWCA 1EJ7L 4GXPA 2W0UA 3THUA 2DUZA 3N4FA 4ZQPA 3A3HA 4O8AA 4B5XA 5MHBA 1XBVA 1G67A 2IPWA 2YXGA 1NOFA 3NSNA 3INPA 1MDLA 3M9YA 1VYSX 2E5CA 1LF1A 4YPJA 1HF6A 1FWTA 2I56A 4GUGA 3E3HA 4W4QA 3OEXA 3PANA 4S3GA 4N6FA 3W27A 1OX4B 1A4LA 5C71A 2DU2A 2H3BA 4AFYA 1C8VA 1V6XA 2QJHA 4NU7A 1X6UA 3L9CA 2ZE3A 5A8NA 2FKPA 4C6PA 5AHMA 1SJDA 3QGKC 1VP5A 3LZ3A 2CC0A 3OLGA 4UR7A 3N13A 1FCUA 4IQEA 4QJ5B 1H1NA 1UIOA 1NIUA 1UQZA 1ZAIA 1LORA 1J18A 1JF5A 1EP3A 4FX6M 1HKMA 4PMYA 3WD2A 1E0XA 2YXOA 1YXDA 2VL4A 3B05A 4GUJA 4IJRA 2WZEA 3M5XA 1PE1A 3ZMRA 2NSXA 3SJ3A 1JYNA 2X2YA 1W32A 3WK3A 1LL6A 3DFTA 1HKIA 4M7SA 5LIUX 3RJYA 4JTTA 3TA9A 1FHUA 4AZHA 3BLEA 1BAGA 2KX9A 1ZQ5A 3O3RA 1T99A 1H0GA 1WQ5A 4IP5A 3AJXA 1UMYA 2VRKA 2XU2A 3P2VA 4FIQA 3MSGA 4KETA 4N9EA 3OGVA 5A95A 1L6YA 2PDBA 5CZSA 1TQJA 3NYDA 5C9ZA 1ME9A 4XB3A 1WUEA 5GNXA 3OG3A 1E4LA 3FCPA 1V93A 4QS5A 1SFTA 4YVPA 3GXIA 4R34A 3GZ3A 1YYAA 4UTIA 1QPQA 3NQEA 4OWGA 2V82A 3UEQA 2V5DA 2C13A 5HXMA 2Y7EA 2PDUA 3WQVA 5BOFA 4FZIA 2WBGA 4DNMA 1JG9A 2V67A 4JY8A 1DJXA 4C5ZA 2NX9A 3DHFA 1UUMA 2QV4A 4JL1A 3GH5A 1VPQA 3LRKA 1ZP4A 3LZ5A 4AB4A 1E56A 1HL2A 2DQWA 3EA3A 2PDXA 3L0GA 1X38A 2X41A 2CLMA 5HMFA 2DUAA 2PF8A 3FFSA 4IG2A 1VIZA 2E1DA 4ZMGA 4WJEA 1FWNA 1QOXA 3IJIA 2GOKA 4F40A 2PWVA 1UKPA 1W3JA 3SR7A 4PN2A 5F1VA 2J8GA 3RIKA 2F2KA 5I3FA 3HFTA 1E43A 3CB3A 3HF3A 2TSYA 2ZXBA 1HFBA 4N4QA 1SQ7A 3IUDA 1J0IA 3WJSA 3VZXA 5IRPA 1EJRC 1KTCA 3TW9A 1IXOA 2ZKMX 1CECA 4DO6A 1NDWA 2E9LA 2WWDA 4QJ4B 1W1YA 2X2GA 4I8YA 3QC0A 3LBMA 3T07A 3HURA 1KRMA 2OSWA 3CH0A 1KFCA 7PTDA 4G5DA 1XRTA 2IQ0A 1XRVA 4GY7A 3RXZA 2Z27A 4GD0A 1I4NA 3MANA 4XO7A 1QDSA 3PZOA 3ABOA 3PJUA 4R3UA 3FIGA 1NDZA 4J40A 3AC0A 4H9MA 1VRDA 2WZHA 1LG2A 1V6UA 3W2KA 3LNPA 2W79A 2XH2A 4JTQA 3ATZA 3DAQA 4XTDA 2VGIA 4LRTA 3FA5A 1VYRA 3GQYA 3XISA 3ZT7A 3PF3A 5C6MA 4UTMA 3WN6A 1ITUA 3O9NA 1KRAC 7ODCA 2FH8A 2GUBA 4KCVA 1HKJA 4LYRA 1R3SA 2ISWA 2MANA 2J77A 4JHZA 3KOXA 1AFSA 3LQLA 1C93A 1WDQA 4MDPA 3L4ZA 1R8LA 4C65A 1S5NA 3K4WA 3N17A 1ONXA 1YPXA 3SCOA 4TTGA 1MI3A 4D6FA 2GQ8A 2GZXA 1JCXA 4LUYA 2E9MA 1ZSXA 1CLKA 3E9AA 4XZNX 4KGLA 1H7WA 4EWND 2OO6A 3N1AA 2D2JA 3SCRA 3P8JA 1J4EA 1V0LA 4YL2A 1NQKA 4D6EA 3EKLA 5E6YA 1S5MA 4XZIA 2XISA 3H55A 2E77A 1M1BA 4WDUA 3LYEA 1EA0A 4LUSB 1JAEA 1TV4A 4HD5A 3KM8A 3PC0A 4QSHA 2A3LA 5EU9A 3WO8A 3VDGA 1WOAA 1K6WA 2EXOA 1KXTA 2Y70A 5AN7A 4DUXA 3GIQA 3DBPA 1TMLA 1WV2A 3MCMA 2OYKA 2B7QA 1EL3A 4GHRA 4J3WA 4HN8A 2YZ5A 1WPCA 2HNEA 2PTZA 4GK8A 2EG8A 2R94A 1KFBA 3KHDA 3QY6A 3GU1A 4MHBA 2OQHA 3DYOA 2YDQA 2PMQA 3R12A 3GX9A 2QAFA 3NQGA 5FIPA 3TMLA 4UR9A 4TVUA 2CLLA 1NP2A 9XIAA 2IKIA 2ZA1A 3I68A 4FO4A 4GIAA 3WF1A 3N2CA 5DX7A 4B15A 3V5OA 2OYLA 3WUEA 4ZOCA 4JS3A 1XL9A 2HZGA 4JN8A 3IIXA 4LS1A 4MADA 4QQUA 4B16A 2Z00A 3W1QA 2ZRZA 2VR5A 4FNUA 4XZBA 3VIKA 3F2CA 1M9HA 4KEZA 1JCYA 5K3VA 3KL3A 4JR5A 5BWAA 3CTTA 1K8CA 3M7WA 4YTUA 3AOFA 3DKJA 3MVIA 3T40A 4JIHA 3ITVA 1JZ3A 1IWAA 3GAKA 4MYXA 3SN0A 3EYPA 1IT8A 1RUSA 4ZENA 2DZXA 5A94A 1QO2A 1ADOA 2Q71A 2INFA 2FGZA 4G1KA 3TFCA 3UP8A 4CNUA 4RDVA 1J9YA 2J75A 2ZX9A 4ADUA 1YBQA 1WZKA 3AYVA 2QIIA 3EWYA 1GJUA 2BHUA 2DT0A 3S0CA 3CH9A 4K1WA 1DQXA 3KTCA 3W71A 2V6AA 1CZ1A 2G3NA 3M64A 2NVDA 1J8VA 3CWNA 2ZXDA 2Y8VA 3WD1A 3ZXWA 3D5HA 3GIPA 3KRZA 4L4PA 1W9PA 2P50A 1KCZA 3AHYA 1Q7QA 3UWWA 1QPKA 3LB0A 3HG5A 3NZRA 3WLKX 2CHRA 5HUPA 3H2EA 3KL5A 2J9YA 3PFMA 5J5RA 4WXYA 4UFHA 3ZJ8A 4DJDA 5LXEA 4BI6A 5M1TA 4ZO8A 4NF7A 3RR4A 2VVSA 5I5RA 2CWXA 4IFRA 3A21A 3GRIA 4M51A 1KD0A 2H6RA 1R3VA 1XCXA 3S8HA 2PRLA 1EGVA 2ZRUA 3XINA 5C7VA 1J6PA 3SURA 2WSYA 2NQHA 3A24A 3ZJ6A 1UH4A 2GGIA 4PTMA 3NQBA 3SSJA 3GU9A 2CBIA 1JYVA 4S3CA 2DIKA 1W2PA 5DCEA 3T05A 2YL9A 3EKZA 4QLKA 3GC2A 4IMEA 5AC7A 5G5IA 4O11A 4AISA 4OZOA 1VENA 1GGOA 4MJMA 3N14A 2QEZA 3S5SA 5DANA 5DEZA 3R0DA 1XISA 3V18A 3SGUA 5T9CE 3JUGA 5M2FX 2QJGA 1MQQA 4A22A 2WHJA 4YHEA 4ECLA 2Y7DA 3NURA 3W0KA 2UV8G 5AYZA 3V7PA 4IPIA 4UBPC 1FWIC 2HXTA 1WAWA 3U8GA 2QDGA 2UY4A 4ATLA 4NXKA 1H11A 3AO0A 4JDYA 4O16A 3ZVHB 4X9SA 4NG3A 5HWMA 1W1A1 4H7VA 3SSZA 2Z1WA 3DU0A 4QIUA 1C90A 1GW9A 1B9ZA 1W3NA 3O0KA 1XYBA 4OQVA 3WQFA 4JFUA 1PXGA 2XSXA 3M0JA 3OU8A 1I75A 4C1KA 2BVWA 3LXBA 4UMAA 4PH6A 5TF0A 4AD1A 4DJDD 2NX3A 1UD8A 3C52A 1M7OA 1THFD 4GNKB 1FXQA 1TV8A 4AIBA 4KCUA 1KFWA 4LEFA 5HQEA 4O15A 1MUCA 3BAIA 3UXKA 2QCMA 1E6SM 2C7FA 1QMLA 2VQTA 4F0HA 2GGJA 3QHNA 3H24A 2GSEA 2E8ZA 3OB8A 4HOWA 4ZXOA 1YE4A 4MPKA 2OWXA 3UF9A 4OJYA 5J04A 3AYSA 3ECQA 3W76A 2PB1A 2VFEA 3CO4A 4J3ZA 1NOUA 3MBDA 4MFDA 3AS0A 4H8NA 4DAFA 5G2WA 1W8SA 3B8WA 2I7GA 4GABA 1HNYA 5AC8A 4JFTA 4JTHA 4IHCA 3UNDA 3GE7A 4M80A 4C1NA 1CBGA 4NSBA 1SW7A 5GJMA 1MZRA 2VCBA 3MCNA 3PTQA 2XGZA 1UR0A 2X8RA 3C8NA 3W1XA 3VC6A 1W8GA 4MGGA 3TLQA 4HZ7A 1FOBA 2CU0A 3KWSA 3P82A 3FA3A 3H7RA 4K8HA 5L9FA 2IXUA 3O6DA 1E1EA 2PI6A 2GJXA 4KRZA 2JF7A 3F03K 4HU3A 3A13A 1W5QA 3UWZA 1RALA 4KCWA 5LHEA 2F9RA 3FS2A 4PTDA 4PBFA 4PYSA 1RA0A 4V2XA 5D9NA 3VNJA 4RZBA 3B0PA 4Q4OA 3RU8X 3MI6A 1RLCL 5CBIA 3N9SA 4HA4A 1IEWA 2Y0FA 4BI5A 2HXUA 4JIQA 5IDIA 4Q8TA 1XLFA 1PL9A 1Q8AA 2FGLA 1BKHA 4RW3A 4DPPA 4DEFA 2J62A 3SFWA 1OVDA 4H00A 4Q8WA 1ONWA 4M8UA 2AMGA 3OVGA 1HO1A 2AL2B 4LC6A 1T6MA 1W6TA 3H2CA 2NT1A 2BY3A 4LUTB 3S6OA 1OD0A 1EP1A 3E0IA 1J96A 4CLMA 1F6KA 4QNWA 3S5NA 1OD8A 2NVCA 5ECUA 3MJMA 2E67A 1TYGA 3KBSA 1JZ8A 4UTWC 2D0GA 5LXXA 3T09A 1R47A 4MG4A 2QUMA 3GXPA 5I3GA 4IL2A 2GGEA 1L2UA 3I3EA 3QY7A 4GZ7A 5EBAA 3SEPA 3TYCA 4EAYA 5C70A 5E0KA 4O12A 2HMCA 5DCBA 4RZ4A 1F3XA 4DF1A 3HGJA 1Z3NA 1F07A 1HW6A 4O13A 3BGJA 1IYXA 1KV5A 3II1A 3RM9A 2HDJA 1S2WA 4CQBA 8XIAA 4GZJA 1J5SA 2Y8KA 4GE8A 1YDYA 2HK0A 2GVJA 3CZEA 1FY6A 4L61A 3BZJA 4X60A 5H6HA 4GKTA 5CEWA 2DZSA 1X1OA 3S3GA 4LTSA 2V3EA 1A0EA 3B0VC 1KM4A 3VIFA 2J66A 3BAWA 3LK6A 4ERAA 4E8DA 1JPKA 3VFLA 3U7VA 3GFZA 3G8RA 1HX0A 3L65A 3UW6A 5LHFA 2F84A 2YKKA 4IF2A 2IKHA 1OADA 2GQ9A 3GC4A 1NEYA 1FDJA 3A5FA 3AYTA 3AZSA 2QNEA 1FWHC 5HMDA 1EF3A 1FDZA 3E74A 3LA4A 4UTTC 3W7OA 1QOQA 2AOSA 5HJLA 2Q3OA 1WAUA 2JKEA 5A8PA 1SFJA 5TBOA 3EXSA 4J3UA 4L4LA 4OV4A 4X2PA 3QW3A 2F38A 4TX6A 4J4KA 3KBWA 1BLIA 1EDTA 1MNSA 3UZWA 4E8CA 3AU6A 3P5ZA 3VABA 3NZ1A 4RR4A 4HHLA 3LHYA 3OGRA 2ACSA 3K8KA 4JY9A 4ZB2A 3LI0A 4AZ6A 3STGA 2O4QA 1CENA 3SN4A 4MTVA 3K8LA 1DPMA 2HS6A 5HMEA 3E02A 3DERA 2XIQA 4HMDA 4QJ1A 2DSWA 3GFYA 1A0CA 2V9DA 3WLJA 1QU4A 4J1OA 2ALDA 3QR3A 1QFEA 5I77A 1QT1A 3O6AA 1OY0A 3WIJA 3DG7A 4PGLA 4HA1A 2DH3A 1PZ1A 1Q85A 2KZHA 1V6VA 1Z89A 4ZQMA 4UTFA 3RMJA 5HBFA 1PKNA 4QE4A 4CD6A 3TEVA 3EWZA 1MW2A 2OLHA 1T7LA 2ISVA 4CCCA 1VH7A 3UWYA 1U30A 2V5JA 3A23A 2ZQ0A 3S2NA 4JIEA 5F4SA 4Z2JA 1FWCC 1TUFA 1EZ2A 3CXOA 1JXKA 4GO8A 3GY1A 4Q22A 1OG0A 4FX7A 4RE4A 1A4MA 1X98A 2JFEX 1TWSA 4P5UA 1TZ9A 2HRWA 1P0BA 2A2IA 2HROA 4PUNA 1XGEA 1OGGA 1POKA 2XHYA 1QPNA 3G0SA 2ANUA 4D6GA 2WC3A 2GK1B 3VOFA 4DBDA 3A47A 5B7YA 1B4KA 3HGOA 2WNWA 4XZWA 4AXNA 3HJEA 3IGSA 5EFDA 5ABTA 5CG7A 3T08A 5IHRA 4M3PA 3PSVA 1J0JA 5LSMA 1JCLA 5F4XA 3I6TA 3WEMA 4D6CA 3R2GA 2X1SA 4MY9A 2V69A 4NAFA 3QQWA 1DHPA 4XX6A 3AMKA 2VCAA 2B31A 4N2YA 2WNNA 1O1ZA 1U2YA 4AEOA 2EPLX 4R5EA 3RLHA 5AYBA 2Q6ZA 3EX4A 1FHVA 4ADSA 2OODA 4W88A 1V3IA 1RR2A 3QC3A 4NHVA 2Z0IA 4GY1A 4NJGA 4MB5A 3G1FA 4UTUA 4WKFA 2VC9A 4GZIA 4TR9A 5DQPA 2AGKA 2V5LA 4OOUA 2VO5A 2X0HA 1GCYA 3N11A 3LOTA 4Q8PA 3U4AA 5AHLA 3ICJA 3KP0A 4JQ3A 4US5A 1UD6A 3W00A 3RCYA 3RU6A 5DRIA 4XO6A 3PJWA 1GONA 3G2GA 2BG5A 4JYDA 3E1F1 4LUJA 1KXQA 3ONCA 4B3LA 5PTDA 4L1XA 1K8YA 2FYMA 1A0DA 3TTOA 2AQVA 4WJ8A 5FAJA 4GKLA 3CHEA 4HB7A 3S6DA 4GCXA 1UWAA 3TYUA 1GPWA 2ON3A 1Q6LA 3R1ZA 2HSAA 1B57A 1Q6OA 4YS1A 1FWFC 1I1WA 3USBA 4TTUA 5FKYA 4AYSA 1NTHA 4ERGA 5BU6A 3WLQA 2WKLA 1TTQA 3W28A 1XJBA 5HQMA 3ZSSA 1TUXA 2YYUA 5ECVA 4RUBA 3UERA 4GYKA 2X0YA 5HINA 3WNPA 3L21A 1J5TA 3LBOA 2DJXA 1KBKA 1VFFA 2W27A 2XN1A 5EMJA 1JD7A 2WSPA 1RH9A 4JDBA 4ZFMA 3NPUA 4O19A 4HU4A 1GHRA 5DN1A 3GNXA 1RPXA 2VFDA 4DX3A 1AG1O 2J13A 5FI8A 3B4YA 3G77A 2IQDA 4D2JA 1YDOA 3NQCA 1EOKA 4U28A 3N9RA 4IMDA 3DECA 3QOMA 4UQBA 2VR2A 1JCNA 5LA0A 3NWRA 1BHGA 1UH2A 2POTA 5L6UA 4BEUA 3C8FA 3DGBA 4XQ6A 3EOSA 3HPXA 2WCAA 4AF0B 3BL3A 4JXCA 4UXDA 2IXVA 1QASA 1KR0A 3KRUA 2WVVA 1H41A 3S1WA 2D2OA 3PBWA 1WB0A 3EB3A 1RBAA 4GACA 2R1NA 4US5D 2YCLB 2E7FA 2Q8XA 3S1VA 4RPQA 4MWAE 1QI4A 1LUCB 2YSWA 3M0XA 3M0YA 2EJAA 1XH2A 1XQKA 3BDKA 3CHDA 1TTJA 3W83A 4FX8A 3BOLA 4B3ZA 3NQ8A 2E25A 3IK2A 1EHAA 4HOXA 4M6UA 5H1WA 1F6PA 4NZ4A 2EHHA 2FTWA 4IUOA 3SRKA 3QMRA 4PMOA 4W89A 3IARA 3C56A 3CLMA 4OOZA 2WMFA 2VFFA 2B7PA 3CZKA 4NJHA 1UG6A 3W7MA 1CEOA 4NJKA 1ELSA 2OCZA 2PWFA 1V6TA 1PX3A 2XYLA 3FYOA 4LOCA 3BC9A 3MSYA 4FNTA 2O4MA 3PS7A 5DRCA 5HA7A 3PUGA 2A0NA 1BGGA 2PODA 2VJXA 3AUOA 4JTCA 3WH9A 2TAAA 4D1IA 1B3ZA 1G7UA 1B3VA 3QTPA 4AHPA 1G4SA 2OYMA 4EWJA 2L5HA 1JQXA 1EZWA 4PZVA 2XN2A 5GPRA 3GVQA 1W54A 2GGGA 2R82A 4UZUA 2P1FA 1JI1A 4EVZA 4NYUA 3H2MA 3AIQA 3FYPA 3G0UA 4UTKA 4C60A 1OQFA 1XIHA 3F2BA 2DW7A 1VBHA 1XF0A 3R25A 1JCTA 2C79A 2Y7FA 4AD5A 1R7OA 3H8AA 4IMCA 1DTNA 2YFOA 3B40A 3WLMA 1LZOA 1A50A 3UCQA 2TMDA 3H2NA 1TVNA 1BWLA 4LBRA 5KZ6A 4HJWA 3RPMA 4YCPA 3ALFA 1JDCA 4L7ZA 3HBLA 3MKVA 4BF5A 3BUVA 2OT0A 3HPSA 3B0YA 5FSDC 1LOSA 4L9YA 1CDGA 1V8EA 2VRJA 2OMAA 1MW3A 1XDJA 1FCVA 1EEPA 3LHWA 2GJPA 4W7WA 4J7RA 5IBXA 3SM0A 1WDDA 4DYEA 2GUUA 1ME7A 1A80A 4QEHA 1FUYA 4KFNA 3WD4A 2C1GA 4F4RA 3TKFA 4UTHA 4F2UA 5JXQA 4L4MA 1HJUA 1ICSA 3WX7A 4U33A 3CEPA 4YXGA 1O60A 1HJWA 3KL0A 3QKZA 1UHVA 3OIXA 1N8WA 1TA3B 4HQVA 1TPH1 5TNVA 3UCCA 2KAUC 3WJZA 3UZ5A 1IR1A 3GC5A 4S38A 3WSUA 3ANYA 3STCA 4CN4A 5JQ9A 3TAKA 4IPLA 2DZTA 3MV11 1FVPA 3G1RA 3GK0A 2RGLA 3CL6A 4MOZA 4GIEA 1OX5A 1QAPA 3OPSA 4I5UA 2HS8A 1EIXA 3TX9A 1VEOA 4HHMA 2D0FA 2CLIA 2FZNA 3PN8A 5HNNA 1CNVA 4NNAA 1L8PA 2RDWA 5HR6A 2X09A 4C6MA 4UOJA 1QNPA 4PRRA 4W9TA 2HPIA 1F9CA 3C5QA 3MUXA 2VFIA 5KZEA 1YXCA 2D2GA 3W38A 4IIBA 1ZU8A 2FPVA 3AMCA 4NL1A 2FHBA 4IFKA 1L8NA 4QFUA 5B7ZA 5H91A 1NDYA 2WBKA 3Q67A 3VD9A 3RX4A 3UBPC 2ZUVA 4D8AA 4GY0A 3TQKA 4BJHA 1GORA 2PA6A 3IWPA 3MKKA 2PWDA 3AMDA 3CQJA 3RM4A 2JEQA 5BRBA 4YJ5A 3PZNA 4LEQA 4AD0A 4Z1BA 2W66A 4GYJA 4ZE4A 7TIMA 5D02A 3W87A 2HVOA 4YHGA 4ZXLA 3RO6A 4POCA 1R9ZA 1UR8A 1A5LC 1GOOA 1JJKA 4DB7A 2HEJA 3T0AA 2WZMA 3G18A 3L4UA 3CQ0A 4PEKA 3OBAA 3W84A 2C8NA 2QUTA 1E4IA 2PP1A 1QI5A 4ZCWA 1BVZA 4F2TA 1A5OC 3LPPA 4FHAA 1J0KA 4EACA 4HSHA 3I3BA 4RV8A 3PZTA 3RRAA 1C7SA 3CO8A 1E1CB 3TJIA 1SR0A 5CXPA 3G3DA 2BXVA 3BICA 2H8ZA 1HXJA 5TIMA 4FXRA 5ABFB 1C91A 2VRQA 2GK1A 4C7FA 3D47A 3QQ1A 5G1TA 5CKSA 1L6GA 3FAWA 3THQA 1CXHA 1HGYA 1OK4A 3FSUA 3VU2A 2V8ZA 3C3UA 3O05A 1E70M 1IR2A 2OGJA 2FB2A 3EXTA 1HT6A 4LPCA 4ZODA 2GYIA 3HN3A 2RDTA 5BOEA 4DM1A 2W61A 3PUEA 4IXHA 4LYPA 4WY0B 4W93A 1SZGA 5AYIA 4PA8A 3IJ7A 4D8LA 1Q6GA 1NFGA 1GKRA 4X0VA 1YIXA 3LCLA 3R0KA 3MWCA 1XLGA 1R85A 1C9WA 2Z6IA 1J11A 2CIPA 4AEFA 1YPFA 3EEZA 2CW6A 3F5LA 1JNEA 2OKOA 3EDEA 5ABGA 3P67A 5GVJA 2PU1A 3IIZA 4Q3MA 3VA8A 1EWDA 2G3JA 3QLDA 4EK7A 3T4WA 3BWWA 2ZZ7A 3RGTA 4PTNA 4Z2HA 3CL7A 3IIPA 4UFLA 1AQHA 4KFOA 4HYRA 3UPBA 2V3DA 4K6AA 4F0SA 4GQRA 1ME8A 4P7QA 2NUXA 4FS9A 2BHZA 2WO5A 2EF9A 3T8QA 5AYYA 1OFPA 5A3HA 3CMJA 4Z2KA 2QUUA 3RJXA 2RKXA 4M1RA 2V3GA 3N3TA 3CUFA 3CQHA 3I65A 2WQPA 2B7OA 4LUIA 1CIUA 3AFBA 1R30A 1UD4A 1W9UA 1XGZA 5M03A 3ZYZA 3AI0A 4H8HA 1E9ZB 3NEHA 4Y6GA 3W2LA 1B9BA 3B3DA 1VGAA 4WKHA 4UFMA 1ZBWA 3S5OA 3TTYA 5A8MA 3WH5A 1ENUA 1CXEA 3WF2A 2OR2A 1KCLA 2UWFA 3BURA 3R10A 4YVVA 4J2PA 3DC8A 1P6WA 1ZAJA 1YXYA 1XLLA 2GDUA 4GO9A 3PK7A 4WXZA 4IX2A 1G0CA 3R7MA 9RUBA 3OP2A 1W3IA 4OBTA 2EPNA 2VC5A 5I6SA 3GTXA 2PEVA 1EX5A 3O2LA 5K9DA 2O55A 4LFYA 1JUEA 4Q4PA 4I7UA 3WF4A 4NX5A 4H19A 1MVYA 3MI2A 4LT9A 4WVXA 4P61A 4AIUA 2XZ9A 4NILA 6TAAA 1AJZA 2VNCA 4IP4A 3ZFHA 3G1XA 2FDMA 1FFRA 5EB8A 4HMEA 1TV3A 3FXGA 3TQPA 3CLWA 3GNDA 2GGHA 3EWWA 3MKCA 3HIJA 3KTSA 1PBGA 1H4PA 2W4XA 6ALDA 2XWEA 1KFEA 4H8VA 3BG9A 3NPWA 4AX6A 1XIBA 3V0SA 4YWSA 4R53A 2J7EA 1AK5A 1YMYA 5DT5A 4Q4RA 4DXVA 3W1NA 2NWRA 2QULA 4CUCA 4E38A 1TZ7A 3JW7A 3UG3A 4PCPA 2Q02A 2PRHA 2HISA 1N8FA 1LLWA 2Q09A 1A3HA 4D72A 4QEEA 3AJ7A 4ILSA 1J10A 3SIMA 2D3NA 3U2EA 3A64A 1N55A 1XYFA 3WBYA 1U5JA 1EWEA 3N18A 2X7VA 4LB4A 2QPXA 5MKGB 1UD2A 3AISA 3QJAA 1PKYA 1WDRA 4V33A 1EYEA 1XIDA 1XS2A 2XVGA 4ACYA 1LJYA 4QROA 5HK4A 2WJDA 3PFRA 3MA8A 4ICCX 4N02A 1PIIA 2FVMA 3GDRA 3GSMA 1PDYA 1WOBA 3WF3A 1VKFA 1VZWA 3E5BA 1DYSA 1HJXA 1R5YA 3S5ZA 4IFOA 4AQLA 1BQCA 1NWUA 3NQDA 2X42A 3S1UA 4UFJA 5H8MA 5AY7A 4K8GA 4ENLA 1TJ0A 1V0KA 3CYVA 1IIHA 3GDBA 3MUY1 2YBTA 3W25A 1RPKA 2DSUA 4XUYA 1W9XA 2OZ3A 2G97A 2E6FA 1CGTA 2ZX5A 2ZDRA 4YU1A 2VZOA 3C0QA 3TUUA 1JEZA 3EKGA 4ACZA 5FACA 3O15A 2OOFA 3SI9A 5D2XA 1XLEA 3VNZA 4X0NA 1EXPA 3QSTA 4ZO9A 4DF0A 3RFAA 1X7IA 4O52A 4GQGA 4LCSA 3GLCA 3GW3A 4WUIA 2QCGA 2V2CA 1NY1A 3QQ0A 3VD4A 3QM3A 1W1VA 1IEVA 1G6CA 4DJEC 3B9EA 3RK8A 4HU0A 3PWGA 5JH1A 3BQ6A 3WH8A 3OQEA 1TRIA 3SGZA 2WMIA 3B9OA 3VM5A 2QCCA 2IKJA 1EO7A 4S23A 3WQDA 2O0TA 1W9BM 3NFUA 1G1YA 1QW7A 4PL2A 1JYXA 1ODZA 4HSOA 3N34A 3WUFA 4UFKA 5CPQA 1SW0A 1Q63A 1E40A 1TA3A 3C2OA 4R7OA 1G4PA 1I2PA 3S9ZA 2OXNA 4O0QA 4C6LA 3NQFA 4E0CA 3CT2A 1K8XA 1AVAA 4LALA 5DXXA 3VX1A 5LGZA 1XDMA 4Q6JA 1MFVA 4RW5A 3M47A 4QX4A 1N82A 4OUIA 4Y9AA 4DBEA 1XC6A 2G4JA 2P8CA 1ZP3A 2DIEA 3AROA 1KB3A 1XLMA 2G3IA 4ZOEA 4WGHA 5MF5A 4GZEA 1IWPA 4XVEA 3VGDA 4WSJA 3KCJA 5CC6A 2EGZA 1VFLA 3M5YA 3LDVA 5FAGA 2PD5A 3WF0A 3SECA 3L23A 3SCNA 3SRDA 4HZ6A 1AL8A 4P8VA 4C7DA 1YNQA 1L0PA 2O7SA 4AD2A 3NL2A 3ZWSA 2GLKA 1O12A 3MZNA 5F2GA 2TRSA 3U9IA 5CSSA 4EX4A 1G69A 5C9WA 4QDPA 2PTDA 1A3WA 3BANA 1EC8A 3HA1A 4ZTYA 1U5VA 4OBSA 4JTIA 4E6MA 3U48A 1JDAA 3P93A 3NL6A 1SVDA 5G1YA 3QPYA 3OLDA 2ZZ5A 3KOWA 3IIVA 1K7EA 1JL8A 3VIPA 1LWHA 1KC7A 1KM1A 4C6BA 3CU2A 1OCJA 1HG3A 5DXYA 4G7EB 5D9PA 2BLEA 3LM7A 4MUPA 1UBPC 3ARVA 4MNMA 4LYQA 3N29A 4WHBA 1GWJA 2XZ7A 1M6JA 5FOOA 5BU9A 3TR9A 5I79A 4WEVX 3CNYA 1Q7MA 2C3ZA 4R7WA 1JD9A 1MEHA 3DDMA 3NTYA 4JD4A 5I00A 2RJGA 3NDOA 3NZQA 4WCJA 3IV3A 3PY2A 1FXPA 3STPA 3EMZA 2JIWA 1U5HA 5D38A 1WDSA 3GBDA 1AMYA 3P74A 3OZPA 3B8VA 3NZPA 4J2MA 1E3ZA 3BLIA 4E2BA 1BKSA 1V5XA 2V30A 5G4WA 5EBUA 3UQNA 1HVXA 3H12A 1BWKA 1EJXC 4S3KA 3L12A 4IXXA 1C7TA 5A6LA 3LV6A 1DJGA 1FBAA 3PAOA 4WY0A 1HUVA 3GB6A 3A3XA 3OA3A 7TAAA 4FOKA 4FXSA 5T8GA 3UY7A 5CJMA 3MZ2A 4DPQA 1JIBA 1UOKA 3LM3A 3WQWA 1IF2A 3UWUA 1PO9A 5ABHA 3TN5A 4TMCA 2BY1A 3ARPA 3LX9A 4JPGA 2WKJA 1WDWA 4JEQA 1OIMA 3TJ4A 4LU0A 3KEHA 4JX4A 1QTWA 3GG7A 3PR2A 1SSDA 1DP0A 2YGYA 5F4WA 1GUVA 4JEJA 3ONBA 3BMWA 3NVTA 2PURA 3UWQA 1LRNA 1K3UA 3SRFA 3MB9A 3SCPA 2GJRA 5D2VA 3LPFA 4GUHA 1O4UA 4UC5A 2ZA2A 2ZC8A 4B2DA 3S4TA 3W81A 2G3MA 3MUZ1 4RXFA 2FH6A 1N2VA 2DVXA 4JFVA 3RILA 4C6NA 3WFZA 4S3EA 4JQ1A 1X8CA 2OB3A 5FCZA 1XIGA 1E5NA 3E2QA 3M7SA 2W62A 4R33A 3UZXA 1M41A 2A5HA 2V38A 3ZLHA 2EPMX 1KQZA 2OQYA 3LMYA 1OFBA 3QPEA 3OBKA 1Y65A 4E5TA 3AHVA 1WX0A 1KRBC 3L7RA 2XH7A 2Y2WA 4TVDA 2A7NA 4S3FA 1NP0A 1HKVA 2ZZ3A 4MSSA 3VDHA 3CC1A 5FD0A 4KBXA 4QAIA 2Q3RA 2A7PA 4EPDC 5FJOA 5G2HA 3C61A 2AKZA 4HIBA 2QCEA 3LSBA 4NIRA 3JU2A 4CN6A 3TW6A 3EX6A 3AXIA 4PSPA 3T8LA 5JIPA 3NQ6A 3MYPA 1DOSA 3AIUA 5D8ZA 4H6RA 1NF0A 3I7RA 3AWOA 5TD4A 3UJ2A 5AC4A 2ZA3A 3V36A 3AIBA 1QK2A 4X63A 2UY3A 1ZBVA 4IPJA 4MFEA 4CCDA 2PF0A 2Y7GA 3KVLA 4EKJA 2OLSA 3BLFA 1R3RA 2W3ZA 4IIDA 4UOQA 1DIKA 4O18A 3TSMA 3SN1A 3RCMA</