4EF9A

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 4-nitrophenyl isothiocyanate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
pubmed rcsb
source organism Leishmania major
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4ef9A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ef9A01
3DFQA 4EF9A 1ADOA 1OX6A 5HJLA 4FNTA 1TTIA 1W0MA 4DBDA 1H7XA 4ZZ9A 1K7XA 1B57A 2NX1A 2X1UA 3ZFHA 1AL7A 4AF0A 3ABSA 2FTPA 1ICQA 2DZXA 2DZVA 1GZGA 3Q2DA 4TX9A 3O6CA 2GJLA 2TYSA 2QCNA 1QR7A 3W3OA 2WNQA 4A2RA 1YYAA 2Q8ZA 4L4MA 3TA6A 3W1RA 1K8YA 1Z41A 3FKRA 4YXGA 1OK4A 1H50A 1EP2A 3TFCA 4XQ6A 1YPFA 2UV8G 3PB2A 1H1YA 2FPVA 3HQ1A 4CQAA 2I9EA 1M7PA 3E9AA 3CWOX 3M44A 3IEBA 2GVJA 4IQLA 3E49A 2Y7EA 4O1AA 3TUUA 1JQVA 2RHGA 2WV8A 3QC3A 1ZENA 3LRKA 4Z08A 2ALDA 2FDSA 3I7RA 1VYSX 2PURA 4FF7A 3MJYA 5DXXA 1FCQA 3GDTA 5DY2A 3A9IA 1OFRA 1GG1A 3MP4A 3OEXA 3W86A 3S42A 3C0JA 3SECA 1UUMA 3D0CA 4KFOA 2W79A 3G1VA 2Y7GA 4A2SA 1P4CA 2QCDA 4O53A 2X1TA 1X8FA 4HHPA 1XFBA 2E6DA 3IVUA 4N02A 3HG5A 4AVFA 4X2RA 3TAOA 4WXZA 4JR5A 2QAPA 1TV8A 2A6NA 4XBSA 2X2GA 4JIQA 1WDWA 1VYRA 3TW7A 1B9BA 2CZDA 3V1PA 3HB9A 1Q6OA 2C14A 1J5TA 1EPXA 4PL1A 3GXTA 3W6YA 3I7QA 1KTBA 1TPH1 4PODA 1VJIA 3CIWA 4O1CA 4MJMA 2YYTA 2VEIA 3OVRA 1ME9A 4ICNA 1SQ7A 3M0ZA 4WXYA 4O50A 1PS9A 1OFAA 4XZ9A 4I7VA 3MMTA 5F1UA 4LUIA 4UMAA 2XN0A 4ADUA 3M1ZA 2PRHA 4CQ8A 2HTMA 3G1HA 1VZWA 4AWSA 3HPSA 3PVFA 4OV9A 3W1PA 3I65A 3NQCA 3H53A 3NEVA 5IM51 4PFMA 4FX7A 3UY7A 1JCJA 3AO0A 2YFNA 5FEPA 3LXBA 1GOXA 2WNZA 5AOUA 1VQTA 4UTTA 4MY9A 4JYFA 2V2HA 1FWNA 2BZNA 5G2HA 3G1XA 4O54A 2FLIA 2V2DA 2ZZ7A 1G4SA 2OT1A 1F7BA 5C55A 4LVGA 3NO5A 1I2PA 4ZL1A 1WOAA 4HIBA 1NVMA 3M7WA 3B06A 3N73A 4FNRA 1PHQA 5HR6A 4JDBA 3UYCA 3OBKA 5EL1A 5LNWA 2GUUA 2EPHA 2ZA2A 1F74A 3C2EA 1JVNA 4MLJA 3B0PA 4ZQNA 1ZNNA 1TPC1 2NX3A 1SSDA 4K8EA 2ZYFA 2OJPA 2W6RA 3P80A 3DHDA 4GJ1A 1H60A 1L2UA 3MP3A 3QMRA 3PY2A 4K38A 1EWDA 1DJQA 1GVOA 3UWZA 1GYLA 1R47A 1Z42A 1JJKA 3UNDA 1OYAA 4MLRA 3S1XA 5EYWA 2QCEA 1JCYA 5SWUA 3G1AA 4JTUA 1JCXA 3L2IA 2V8ZA 4JN6A 4BWLA 4FX8A 2Z0IA 3C4UA 4WZHA 1OYBA 4RZ6A 1M5WA 2OT0A 3MHGA 5KITA 3P8IA 2C19A 1PCKA 4N4PA 4NNAA 2ZA3A 1I2OA 3GDMA 4CNNA 1N8FA 1IXNA 4HN4A 4YLWA 1SUXA 3HO8A 2DJLA 5F1VA 4PA8A 3IGSA 3S5OA 1A5CA 2B7PA 1FQ0A 1SW0A 1A50A 3C6CA 3W71A 2DZTA 1ML1A 3LTSA 1KLYA 2R91A 3WJZA 2A2IA 2CU0A 4IX2A 5KSWA 3NQ6A 4MY1A 1JQXA 1Q6QA 2DZPA 4WJEA 3M5VA 4MFEA 4NZJA 4IGHA 5HWJA 3O07A 3W1TA 4N9BA 3EX4A 2ATSA 3FLUA 4DPQA 3FFSA 3QSTA 4UTUA 5CPMA 4UTHA 4UNLA 1IGSA 2ZTJA 1JRBA 3W72A 2C16A 3O15A 3NQ2A 1W5NA 4L4LA 1WYIA 1Z44A 1PE1A 1TPB1 1RV8A 2J9XA 1PVNA 3IVSA 4MZ8A 4ZVJA 3C52A 3HGJA 3QF0A 4Z1CA 5HMSA 4MJZA 2H8XA 3TKFA 1AK5A 4QITA 1AW2A 1EEPA 4LWWA 5DBUA 1FY6A 4TMBA 1QOQA 5LSMA 1JULA 2DZSA 4ONVA 1YXYA 4O19A 1OF8A 2ZZ3A 2H3BA 1C8VA 4NXSA 3WK0A 1RQHA 5CPOA 3WK3A 2FB2A 3NYZA 1VYPX 4TIMA 3MW7A 3L5AA 1OK6A 1TPUA 2VFEA 4JX4A 3TU9A 4AHPA 3V75A 1VCVA 2GQAA 3K30A 5CSSA 3W1XA 1KFEA 1S5WA 3ATYA 4CCEA 3S1WA 5AC7A 3LLFA 4XKYA 2V30A 1M6JA 3UPWA 4YWIA 4A29A 1LOLA 3TC7A 5T26A 2NWRA 3SW6A 4FHAA 1YXCA 2VFHA 1LRNA 4JTEA 3B4UA 5DN1A 5G5IA 1O60A 3NPVA 4KWWA 1K8ZA 3L0NA 4PL2A 3EXRA 5L9FA 4CQ9A 5K4ZA 1XBVA 2A85A 2ZZ2A 2G96A 2WQPA 5EPDA 3QZEA 1PHWA 1MEWA 3NZ1A 2QR6A 4O12A 4QISA 4FEZA 1SSGA 4NJGA 3AJXA 5J5RA 3GXPA 4MYXA 4ZQPA 4R33A 2OMAA 3M5XA 3IIVA 3TSBA 3GB6A 5DLCA 4LNYA 2VFDA 5BRBA 1G6CA 1G4TA 3PUDA 3W7NA 2Y6ZA 4MOZA 2EKCA 4JXCA 3RU6A 1A53A 1SZNA 3PBVA 4B5NA 2J24A 3BGJA 1F5ZA 1LLWA 4N9CA 1OX4A 1BTMA 2NV2A 5FF0A 4Z0SA 3P81A 3EX6A 1O94A 3PAJA 4UFKA 5CG7A 5KZMA 3T78A 4DBEA 2P0OA 1HG3A 1UUOA 2E77A 3FOKA 2GQ9A 4J9JA 1YLVA 5K9CA 3USBA 1THFD 3P61A 3ELFA 4IXHA 1F2JA 1TPFA 3PSVA 5D2YA 3UQNA 4DPPA 4OT7A 1D9EA 3HJZA 3S5YA 3BG5A 3GNDA 2Y63A 2CFFA 3TW6A 1KBJA 4NQ1A 2VXNA 3IRDA 3DH7A 2ZRZA 3A21A 2A5HA 3NPUA 1W8SA 3BW2A 3O06A 4IMDA 2DU2A 1S5TA 3GDRA 3TSDA 2FPYA 1QOPA 3W7HA 4O57A 3KVKA 1VLWA 2QJGA 2AQWA 1PV8A 3N2MA 3HIJA 4LU0A 4BI5A 2BSLA 2VOMA 1EIXA 4RJEA 3T4CA 4PH6A 3DU0A 4R7JA 4TU1A 1LM1A 3M9YA 5GVJA 4GFSA 2Y62A 3O16A 2ZZ4A 5F2IA 1LORA 1KTNA 2Y89A 4FB7A 3KX6A 4AWUA 3C61A 3MHUA 3EWXA 2JKEA 2WOQA 2DORA 3EEGA 3N9SA 5D04C 1YPIA 4QAIA 1BWLA 4O18A 4R53A 1GVRA 3BV4A 5AC6A 1KM4A 3CHVA 4JYEA 3Q37A 1WOBA 1LBMA 2CZ5A 1DJNA 2TPSA 1ZHAA 4O0KA 4G1KA 2E5BA 3RFAA 1VGAA 2NUXA 1FCUA 5CZSA 4LC8A 1G69A 4O14A 2JGYA 3EWWA 3DENA 1MXSA 4A21A 1IXOA 2A7PA 1XXXA 3MYOA 4MY8A 3NQDA 1GVFA 1ZJIA 1DORA 4CLMA 4UTWA 3NQFA 1LBLA 3DKLA 3HPZA 3NAVA 2GVLA 4HNTA 1HL2A 5HQEA 3KRZA 4ZMGA 1GG0A 4ZQMA 1TSIA 4Y90A 2NXGA 3E12A 3CEPA 2CLKA 3W85A 1W31A 5D05A 2V0TA 3DFSA 2PRLA 5LNUA 5D03A 4NVTA 1EP1A 3FEMA 4BF9A 1I2NA 2ZRYA 2W0UA 3W2UA 1Z48A 1MO0A 3U2OA 3W1QA 1TYGA 4LS2A 3ANYA 4O1DA 2CLFA 4YL2A 1LOSA 2GQ8A 3U6WA 5F4WA 3TMLA 3MYPA 1XBXA 4AB4A 4EVZA 4IPIA 4BI7A 2ISWA 1FDZA 3GDKA 3NG3A 4O17A 4AEOA 4ZQRA 3QQ1A 3QPZA 2ZQ0A 3TQ0A 7TIMA 3NDOA 4R34A 3G1DA 4O4VA 3LTPA 4RCXA 3RLVA 1U5JA 2DJXA 4U4MA 4JYDA 1H7OA 3TJLA 1GVSA 5K4XA 4GUGA 3W1NA 5AHNA 1GYNA 2A21A 4ML9A 4FX6M 2CZEA 4UFMA 3WJSA 5U4NA 1KM1A 4N6EA 1OJXA 1R30A 1QWGA 3O1NA 3L67A 2Y7DA 4O16A 5G2IA 5AYYA 3TNOA 4LW7A 1QO2A 3OA3A 1KV8A 1O5XA 4MUZA 5CKSA 2P10A 3CIXA 5EBUA 1RR2A 4HPXA 3WK2A 4RX0A 4FXSA 4I7UA 4AF0B 1FDJA 3L68A 1FCVA 3W1AA 1GVQA 2ZBTA 3M41A 2DP3A 3INPA 2I1OA 3PUOA 4HPJA 2G5WA 3UWUA 4DELA 1L9WA 2NLIA 2R14A 3ZR4A 2CLHA 2YCEA 1T96A 3CEUA 1XDLA 3HG4A 2GVGA 3B05A 1Y0EA 2H3DA 3LTYA 3NZRA 3LCGA 3C2RA 3ZWTA 3JRKA 2CWNA 2A7NA 3NQEA 1ZALA 3LHZA 5HUPA 1JUEA 3GKFA 3WJYA 3M16A 3CT7A 3G0XA 3ZS4A 3T55A 4BWLC 1WX0A 3OIXA 3GNNA 2PE4A 3O6DA 1C29A 4QNEA 4KFPA 4O1BA 2Z2UA 3I7SA 3DFNA 4LVAA 4WOQA 1LZOA 4UUIA 3HGOA 5AYZA 5D2VA 5AB3A 3W1MA 4AMAA 3GKAA 4JS3A 1JUKA 4BR1A 3NQ7A 4QNWA 3RF9A 3STCA 4HNUA 4NNBA 1AW1A 3CB8A 3Q94A 3L5LA 1TRDA 4O52A 1KFLA 4M6PA 2C15A 3DFOA 4MZ1A 3SZ8A 4X9SA 1TTQA 4NJKA 5E0KA 2QUVA 3IIOA 4O8RA 2VEPA 1A5BA 2JKAA 4NJJA 1EA0A 1BWKA 1WV2A 4RXFA 3LBMA 1X6UA 3UY8A 3BGGA 5D32A 1WXJA 3FS2A 2Y70A 4XBKA 1EUNA 2VELA 4NX0A 1NEYA 3FA5A 5K9XA 3F4NA 5HULA 4ORMA 3GAKA 5I3HA 1IF2A 3B0UX 2QJIA 3GVGA 1B4KA 2ISSA 1QPRA 1G4PA 1S5VA 4O13A 1XUZA 4KFNA 3W22A 3OG3A 8TIMA 2NV1A 2J6XA 1TTJA 5HINA 3P84A 4K7VA 3MI3A 5BMWA 3STFA 1GTHA 3I6RA 3GLCA 3LRLA 3LHTA 3EWZA 2F84A 3P74A 5DCBA 4ADSA 4XWUA 1T0OA 4JDYA 2VC6A 4PEKA 1CI1A 4HT3A 5FEXA 3KRSA 1PL9A 4LTSA 4XTIA 1LCOA 3SGUA 1F05A 1NF0A 1HFBA 4UNKA 1OABA 1FWWA 5BMXA 2EF9A 2RDUA 1ZAJA 3H55A 4JTLA 3LCHA 1DQXA 3G18A 2CW6A 1EP3A 2X30A 5KZEA 1U83A 2YX0A 4Z0JA 4MVAA 1F76A 1XI3A 4RZ4A 1TRIA 5F2MA 1SZEA 3W23A 3BW3A 5I3FA 2FJKA 1NF7A 3CWNA 2Z1BA 1TIMA 5CZTA 1BKSA 4IOTA 5HWMA 1GEQA 2C13A 3W2JA 3KVMA 4W9TA 3IIZA 1LBFA 1HUVA 2QKFA 2ZZ6A 4M19A 3R89A 4JY9A 4M7TA 1GT8A 4K37A 5LKYA 4MFDA 3W7LA 4C1KA 5F2GA 3DFPA 1YADA 1K7FA 2C3ZA 6TIMA 1UB3A 3TV8A 2E68A 1VC4A 2QCFA 2A4AA 3MWAA 3RNDA 2G95A 1TPEA 3QW3A 3B04A 1V7YA 1DQWA 3LHYA 3C8FA 5G4EA 4QM1A 4IWWA 4DQWA 1KFJA 1LLZA 3UWQA 2CZFA 5A5WA 4UC5A 2VENA 4JTKA 5CZJA 2YYUA 3NM3A 1W5QA 1VCFA 2BXVA 3BVJA 5G1TA 1R2TA 2HS8A 3L0KA 1SO5A 4C1LA 2BX7A 3LV5A 1OF6A 1JUBA 3W2NA 1Q3NA 1TB3A 4S1FA 1H7PA 3TROA 4AHOA 1WA3A 5K7JA 4JTHA 5D02A 2X16A 3EWBX 2G97A 3PUEA 5CSRA 2CLIA 3L5MA 4FNPA 3G24A 2BTMA 4NJHA 5BOOA 1DV7A 4IMGA 4QJ1A 4RZ5A 3HG3A 1T8XA 3UPBA 1ICSA 5LNSA 2V9DA 1DVJA 2NXHA 3R13A 3JS3A 3B0VC 1F6KA 1ZCOA 3W1LA 3BK0A 3IV3A 3S1UA 4UR7A 2TMDA 2QF7A 3NQVA 4CCCA 1A5SA 3THQA 3CPRA 1HO4A 3S0CA 5LGZA 1K3UA 3G1SA 3PBWA 4EWND 3STGA 5FESA 1ONRA 4E2DA 1B4EA 1TMHA 4MKNA 4E38A 4UCGA 4GC4A 3S8HA 3GDLA 3DKJA 3NR0A 1XUUA 2NX9A 2TSYA 2Q3OA 3LCXA 4WOZA 1S3HA 3NL2A 2P1FA 2H8ZA 4JICA 3G1YA 1KW1A 3SGZA 1FWTA 2EGZA 3IIXA 4H4IA 1H61A 1OFBA 4XKYB 2NUWA 4JTFA 1OHLA 3ABQA 4YCOA 3KVJA 2V81A 3M6YA 5DELA 1W5OA 1LYXA 1FCBA 4Y96A 3O8AA 4FNQA 4LVFA 5H2ZA 5A8GA 4KKXA 2ZRUA 1JCLA 1KV5A 2FPTA 4LS0A 3DI0A 1K8XA 5AHEA 3QW4B 4OV4A 2NZLA 1XBYA 4DF0A 3NA8A 4K8HA 3PG9A 1O95A 3E96A 4FIQA 1VPXA 1I2QA 1L6YA 2QCMA 4GBUA 5CPNA 1FWRA 1KLZA 4A22A 3W87A 5AYXA 3OVPA 1TREA 4LVDA 4HNVA 1OFOA 2ISVA 3VKJA 1XM3A 3BG3A 1QPQA 2R94A 2Y88A 3VFLA 3W7DA 3UZJA 2IQTA 4LT9A 3W7CA 5AFDA 1OX4B 4FNSA 4H6KA 4JTTA 3W7EA 1MZHA 2Y85A 5I3JA 5LHEA 3TJXA 3TH6A 2Y61A 4NUWA 3TR2A 2WSRA 4NU7A 1YTKA 3P8JA 3I68A 1IXPA 1KM0A 4IJBA 1E51A 1SFLA 1KM3A 3WFAA 4O11A 5CGQA 1V5XA 2QCLA 1G7UA 2JK2A 3P7YA 3PBYA 4N6FA 1KM5A 4WY0A 1ME7A 4JY8A 3VNDA 4FNUA 3KHJA 4LRTA 1L6SA 1X1OA 3PBUA 3PB0A 4IUOA 4UR8A 3BLFA 2QCCA 3EXTA 3EKZA 4E2BA 4IMFA 3NL6A 1YTEA 2ATMA 2QAFA 2R8WA 3DI1A 3KOFA 4JTGA 3IVTA 3W76A 3MUXA 3W70A 1TJPA 4M5PA 2E6YA 1HO1A 3MBFA 3G22A 2V2CA 1RVGA 4MPQA 2HSAA 3RMJA 3W7RA 1F73A 1SZFA 2QDHA 4Q33A 1KM2A 4JD4A 3M47A 3MO7A 1X1ZA 1LRTA 3SY5A 2YGYA 1W54A 2FIQA 1A5AA 3M43A 1RD5A 2B7OA 1DKWA 4K39A 1SW3A 1D3HA 1IIGA 4LUJA 1JR1A 1G7VA 3TQVA 3L9CA 1QNVA 3R8RA 3NPWA 3PC0A 4TMCA 1L6WA 3QSRA 1W56A 1EWEA 1PCWA 1VLIA 3A22A 5D30A 5U7SA 4Q32A 3T44A 4LRSA 5EMUA 2Q3RA 1NFBA 2RFGA 3L0GA 2H90A 4OGZA 2NWSA 1QMLA 4FO4A 2QDGA 5G1YA 1AW5A 1FBAA 2PC4A 5AN7A 1J2WA 3MBDA 3EX3A 3NQ8A 3B03A 3G1FA 4DO5A 3SR7A 3HMJG 2I14A 4UTJA 1SR9A 4IX0A 4TO8A 1F6PA 2E5DA 5MHBA 2NXIA 2F7FA 1UCWA 1KM6A 2QUUA 1ME8A 1K02A 1XL9A 1VCGA 3LDVA 1I45A 3PWAA 5FF2A 4YCPA 4GUIA 3PF3A 3T7VA 4EF8A 1YDVA 5E1QA 2E1DA 3WJXA 3WK1A 1MSSA 3W7OA 4YMZA 5LHFA 4D2JA 4LY8A 4DF1A 3HF3A 3IIPA 2RDTA 1R46A 1DOSA 4P2VA 1TCDA 3P62A 1UJPA 3EX1A 4GWEA 4O15A 3HPXA 4K36A 4ADTA 4WD0A 1G4EA 1H63A 1AL8A 2B0MA 1CW2A 5DXYA 1P0NA 5CZ0A 3A5FA 3L65A 1FDYA 5F2LA 3OHIA 1FXQA 3G8EA 3IGXA 3QFEA 5G4WA 1GQNA 1XC4A 2DZUA 2A7RA 2YPIA 2TRSA 2E5CA 1QFEA 5AC8A 3ZWSA 3RK8A 3P67A 3W2MA 3TIMA 4RK8A 2Y7FA 3W74A 3BG9A 3GR7A 3DZ1A 1YTDA 2CLEA 1H62A 4H3DA 3LCWA 1YXDA 1KFCA 1H7RA 3FYOA 2EAWA 5I3GA 2GOUA 3W7JA 1GTEA 2WSYA 2C18A 3LX9A 2QCDB 1QDSA 1W3NA 1O4UA 1H51A 1TJRA 4Y6GA 4EIVA 4HKPA 3TC6A 4RLIA 2NUYA 3GXNA 5IBXA 4IMEA 2J9YA 3TX9A 2WNNA 2Z6JA 3OVQA 3UWWA 3FKKA 1OFQA 2QUTA 3TFXA 1Q6LA 3N3MA 3JR2A 4UMCA 3DBPA 4NJIA 2A6LA 2RDWA 5AHMA 3O6YX 2E6FA 2X1RA 3W9ZA 1QPOA 2LLEA 4WUIA 1KBIA 2ZTKA 1LOQA 4BFAA 3G0SA 5EKYA 5KINA 3QMSA 4ORIA 2C0AA 3L66A 3WJWA 3QM3A 4NXKA 5KTLA 4GNJA 1YDOA 4OE7A 1TQJA 3S1VA 3L21A 3LCIA 3W73A 2AAMA 2A1YA 3NXFA 4AHQA 5C2XA 3TXVA 4UTLA 2FQIA 2QCHA 4N9DA 3NGJA 4UFIA 3EB2A 4S2BA 4Y9AA 1P0KA 3IGUA 1UASA 1FUYA 1JCNA 4TR9A 5FEWA 1YDNA 1D3GA 4BK9A 1KFKA 4K6AA 2FFCA 3LRMA 3FIGA 1UBSA 3PG8A 1KA9F 4UFJA 2C1HA 4KWVA 4N9EA 1WAUA 4M6VA 1R2SA 1TPDA 3KAOA 1ALDA 4JTJA 5K9DA 3DAQA 1GPWA 3M5YA 1VS1A 4PCFA 1W5PA 1G67A 2A0NA 3UWVA 4RR4A 1WBJA 3LM7A 5TIMA 3GK0A 2PRMA 1ZAHA 1H7WA 2PCQA 3TMQA 1Q6RA 1AMKA 1W37A 4K7YA 1RQBA 5D2TA 1ICPA 5L6UA 1ZFJA 2YDAA 3PULA 1B3OA 4WX2A 2VKZG 4E0CA 5TQLA 4LC6A 1OYCA 3W7GA 3VE7A 3THAA 4GUHA 3LB0A 3T40A 1P1XA 3LHWA 1XDMA 3LV6A 1LP6A 3HG2A 5LGXA 1DL3A 3CTLA 1KTCA 1DBTA 3NQMA 3R12A 4N2YA 4CNPA 4WY0F 4U28A 5D37A 4UTIA 4LVBA 5HNRA 4FXRA 3NM1A 5HUOA 4UTTC 1SO6A 1SO3A 4UFHA 1VH7A 3P60A 1MEIA 4RV8A 3G0UA 2ZFAA 4Y8FA 3F4WA 4CNOA 5HWNA 3C2FA 4DO4A 5BNKA 3QJAA 4X3ZA 3LOTA 4Z1AA 3UXAA 2VEMA 2ZZ1A 1FX6A 1Q45A 2FB3A 4DO6A 3S6DA 4JTIA 4O28A 5FI8A 4NT0A 4POCA 5FF3A 3NQGA 2ZCGA 4WQ6A 1HTIA 3A24A 3KRUA 1LRQA 1XBZA 3A23A 5K3VA 3W7IA 3W83A 1EX5A 2KZHA 3LBCA 5LNVA 4N4QA 5DCDA 2B7QA 1SU5A 4UTWC 4AXKA 3W7MA 1N7KA 1EUAA 1K03A 1W1ZA 1TPVA 4IXXA 1VR6A 3EXSA 3SI9A 3CC1A 4OBTA 1R2RA 2CLOA 2AGKA 2J27A 3SSJA 3BARA 3TDFA 1O5KA 3H54A 4S2CA 4UTKA 4BI6A 3G3DA 3TK7A 4HSNA 2V82A 2O7QA 2YFOA 3QRHA 1IIHA 1SO4A 4Z1BA 5I3KA 5DY3A 3W7QA 5J5DA 3NNTA 3QYQA 2OX1A 4NZFA 3W2KA 3DXIA 3N34A 2J88A 4OHQA 3GYEA 4QQ3A 1OFPA 3P82A 4DF2A 1GJPA 5D2WA 5C5YA 2V5BA 1AG1O 1QAPA 3C56A 3E0IA 5H91A 2QCGA 4JIPA 1OVDA 1ZAIA 2ZRVA 3MHFA 4JX6A 3LI1A 3G3MA 3MI2A 4A3UA 3NL3A 2CLMA 1SZGA 3Q58A 4O10A 3CU2A 3W07A 5DBTA 4ALDA 1NAL1 2VFGA 4P61A 3CLMA 4AH7A 2ABBA 3TXZA 2V5LA 2XN1A 2ZDRA 2Z6IA 1TV7A 1WBHA 3SIZA 5C6MA 4DXVA 3ABOA 5FEZA 3BW4A 4HNNA 2OCZA 1LROA 2WO5A 2JGQA 2J9ZA 4O0ZA 1XCFA 4JNMA 4ZQOA 3GZ3A 3TQKA 3EKLA 3N2XA 4NNCA 2YSWA 3C2VA 3QQ0A 2ZA1A 3VCRA 5LZLA 3LCFA 5D2XA 3EWUA 3SJ3A 3O63A 1C9DA 3LXAA 1W3IA 1RQEA 2JBMA 1NSJA 5BW6A 3QEZA 3W88A 1TPWA 3FYPA 3QH2A 4AWTA 4JX5A 1FXPA 1LDCA 4UXDA 5G2WA 3HGSA 2WSQA 3LHUA 4NX5A 1EB3A 3G8RA 4OWGA 3W2LA 2O7SA 3LERA 4MIMA 3PM6A 4AAJA 3S9YA 3NOEA 2HMCA 2JKPA 4IPJA 3PS7A 3E02A 4MYAA 4OQVA 1I4NA 3KVLA 4GE8A 4UTMA 5HR7A 4RXGA 2WKJA 1J4EA 3W84A 2D73A 4JTSA 3HBLA 2ZRWA 3UWYA 2E09A 1RZMA 2VFIA 2CLLA 5D33A 5AHIA 3W7KA 4GXMA 1FWSA 1M7OA 3ABRA 3PSWA 4M6QA 3NL5A 5F4SA 2B4GA 3BLEA 3W7PA 2YR1A 2ZZ5A 5D38A 1MEHA 3LLDA 3VE9A 1QO5A 3SFKA 3KFTA 3P5YA 1OX5A 1JCMP 3HOJA 1VHCA 3QPYA 5FF7A 2YW3A 1KFBA 1SW7A 4GUJA 3W75A 2WPBA 1BEUA 3LXCA 1W5MA 3N14A 4XTDA 2VEKA 2BWGA 1VRDA 3EX2A 5DCEA 3TCEA 4MZYA 5AHLA 5IBXC 1I2RA 3R5EA 5K2ZA 3BO9A 3NPXA 1H7NA 1H5YA 4PC8A 1TTPA 1I8JA 3UD6A 4CCDA 4GRSA 3P5ZA 2XN2A 1XKYA 3ATZA 3S5NA 1IXQA 3PR2A 5EA9A 5AHFA 3S5ZA 1VHNA 2VFFA 2RKXA 1OFEA 5D09A 3MP5A 3TE9A 5CPLA 5EY5A 3A5VA 1JRCA 3GIYA 4UMBA 3UXDA 1ZY9A 1H1ZA 4GUFA 1QCWA 1LTDA 2C6QA 4JEQA 1TQXA 4WY0B 5KZDA 2ABAA 3R2GA 6ALDA 3C3NA 3NVTA 1X7FA 2RH9A 4LV9A 3DFTA 4I7WA 2OZ0A 5TBOA 4X22A 1K7EA 2DZWA 4UFLA 4RKAA 4QIUA 3TAKA 3GR8A 1T99A 4IMCA 2X1SA 5C54A 2YXGA 1SFJA 3CM4A 2EHHA 1QPNA 3VI2A 2YW4A 2QEZA 3YPIA 4JGDA 2GPTA 3FJLA 3MI6A 3KXQA 4EOUA 5FF4A 1WQ5A 3QMTA 2XFWA 3F03K 3DGRA 3FJ6A 5LNRA 2HS6A 4I9AA 1PIIA 3N9RA 1RPXA 3U8GA 1SPQA 3GAYA 4Z1DA 2Q8LA 4HSOA 4O4WA 5E93A 4XUGA 2B7NA 3STEA 1DHPA 5ABTA 3DHFA 3BLIA 2E6AA 4FIRA 4LS1A 4QSHA 3C2OA 3N19B 1CX9A 3TSMA 4PTNA 3B8DA 3UZ5A 2H6RA 2YZRA 3LCLA 4OU1A 3GX9A 3LI0A 3EWYA 2WJZA 4DEFA 4ZQCA 5KMYA 3O05A 5F4XA 4UIOA 2BLEA 1GWJA 3F1QA 3W1UA 4LV4A 4Q4KA 1OFDA 3LHVA 1W3TA 3NQAA 2ZRXA 3CQ0A 3BPWA 5I3IA 4M7SA 1N55A 1TV5A 2GJNA 2QJHA 1OG0A 4LOCA 3RLUA 3HGRA 3M5ZA 1P5BA 3LGEA 1TO3A
chains in the Genus database with same CATH superfamily
3USZA 1OX6A 2VRKA 1W3HA 1K7XA 4B2DD 2NX1A 3CWHA 2OPJA 3ITYA 3V0UA 1MVYA 2DZVA 1GZGA 3Q2DA 3WUFA 3O6CA 1UKQA 2GJXB 3WN6A 1QR7A 1BRLA 3LD5A 2WNQA 4A2RA 5I03A 1YYAA 3AHVA 4L4MA 1Z41A 2HPIA 4LYRA 4AIBA 3UPMA 1YPFA 2UV8G 2HXUA 1RPKA 1KWGA 2J8FA 5AC4A 1MFVA 2ZWZA 4X63A 3H21A 3QHNA 3TUUA 3NJ3A 4Z08A 1LWHA 1FWDC 1EIBA 1UKSA 4XVEA 3AYTA 4ROPA 3UJ2A 2RGMA 2OYMA 4WJXA 3RPDA 5JBDA 2YBTA 4ACZA 2AMXA 1D7FA 2BVWA 4GX8A 1BHGA 1TKKA 2W79A 2IS7A 2QCDA 4MNKA 4O53A 1YE6A 4F79A 3CZLA 2E6DA 3HG5A 3CZ8A 2J7EA 4JR5A 2QAPA 2A6NA 1KO0A 3VKBA 1ITQA 3NCOA 1WDWA 3AIQA 4JQAA 3PFRA 4Y2WA 3TW7A 1X6NA 1UD6A 4LBSA 3HB9A 1Q6OA 1XSIA 2C14A 4PL1A 3CAWA 2WWDA 1AA1B 3W6YA 4H19A 1KTBA 4Y9MA 1X39A 4O1CA 2YYTA 3W4RA 3MJMA 3BTNA 1CBGA 3EKGA 1EDGA 3QZAA 2WC3A 2FZNA 3BL3A 2PGWA 2XN0A 5EFDA 2VZVA 4CQ8A 3WUGA 4OV9A 1B3XA 3B9EA 5IM51 4P8WA 1NDWA 3DG7A 3AO0A 4X0VA 4GIYA 3LXBA 3IANA 4UBPC 4MY9A 3VOHA 2XISA 1FWNA 5G2HA 3G1XA 1L6GA 2ZZ7A 1F7BA 5C55A 4OVXA 2WJEA 3MC5A 4ZL1A 1WOAA 2VJXA 1V4YA 2DH3A 4I9TA 1W1B1 3VNJA 4EACA 2EPHA 4KRZA 1Z89A 4DUOA 1UD3A 1HX0A 2NX3A 2GK1A 1EOMA 2ZYFA 3QFWA 4YS1A 2OJPA 2W6RA 5B7YA 5JH1A 3DHDA 3FAXA 3QMRA 3DFYA 1JEZA 1HKIA 3WD4A 3UWZA 3MV11 4HN8A 4R88A 3CAKA 3RG6A 4GKTA 5HBFA 1JJKA 3UNDA 4ZB5A 1EBHA 4PTWA 2QCEA 4LNCA 3ABXA 1Z9AA 1MUMA 4F0MA 4H2CA 4P7OA 4L1XA 4P7QA 4RPQA 4ZFCA 2Z0IA 3C4UA 3MS8A 1R9YA 3U2ZA 3GH4A 2C19A 4TUFA 4FLRA 2ZA3A 1I2OA 3GDMA 3AYSA 4CNNA 4YLWA 1F3WA 1ZZMA 3GDBA 2DJLA 1KKOA 4GINA 1UH3A 1RJRA 4OIFA 4QXIA 3S5OA 3O0FA 1J12A 4WHBA 4JHOA 4KS0A 4Y9OA 3PWIA 2E9MA 4B3LA 1YQ2A 3U48A 1PZ3A 2A2IA 1XYLA 1CGYA 3LGDA 1Q65A 4MY1A 5HNNA 4MFEA 1R3YA 1Q6DA 1TE1A 1CDGA 2QLYA 3EX4A 4ILSA 3SCPA 3FLUA 1SGJA 3MUCA 1VEOA 1GQLA 3PZQA 4UNLA 1JRBA 4UTFA 3TZNA 2C16A 3O15A 1WYIA 1EO5A 3ZSSA 3UBPC 1JAKA 2H8XA 1DJHA 2IKHA 4GZJA 3ITLA 1A4LA 4QITA 5TAOA 4LWWA 1KBBA 3TC3A 2Z25A 4R7OA 4TMBA 4U3CA 1U22A 4ML4A 3A13A 4KEVA 2DZSA 3GU2A 4O19A 1OF8A 4NXSA 1CNVA 1H2JA 1HKKA 3MANA 4TIMA 4E8DA 4KGLA 3ERPA 3V75A 1VCVA 2TODA 1IGWA 2GQAA 3K30A 5CSSA 3W1XA 4DJDA 1W3JA 2VWTA 3VOCA 1S5WA 3ATYA 5TD4A 1A5KC 2IPGA 1M6JA 5BU9A 4A29A 7A3HA 1CGVA 2PDKA 4CEXC 1G94A 3SUWA 1XWYA 4NRRA 1T5AA 1MUWA 4PUKA 3BQ5A 3B4UA 2BGQA 1FA2A 2R1NA 1OIFA 5LA0A 5K4ZA 1IEVA 4PSRA 1ITXA 4CD8A 5GQBA 2QUMA 3MUIA 4HMNA 1NQ6A 1QXLA 1SSGA 4GZEA 4LY4A 5DEZA 4LF1A 1OY0A 1UWRA 2OMAA 1V0NA 2CHOA 3L12A 3CPUA 3QC0A 1G6CA 3I6EA 2DUZA 2Y6ZA 4AUBA 1POJA 1IZKA 1A53A 3PBVA 3BGJA 3JU2A 5E6ZA 4H9ZA 1UH4A 1OX4A 5FA5A 5AYIA 1XHGA 2GQ9A 4Q8TA 4LQ1A 2FTWA 1ZP3A 4EAYA 2XGBA 3OYXA 2CXEA 1ISZA 3URBA 4AFYA 3BG5A 3SCSA 3GNDA 2PGFA 3TW6A 4NQ1A 1VFSA 4AZHA 2ZOXA 2A5HA 3RILA 2WPGA 1ZP4A 2DU2A 3QVQA 1RP8A 2FPYA 1QOPA 4LAOA 1I60A 1L2QA 3KVKA 3VIFA 3RUBL 3E38A 2VQUA 2BSLA 3MKCA 1PWLA 2O9PA 1LQ2A 3T4CA 3DU0A 4TU1A 1LM1A 4X60A 2F9RA 3IS4A 3O16A 1DYSA 2ZZ4A 3WFLA 4XD6A 1KTNA 4CU8A 3CGTA 3NWRA 3SY1A 4FB7A 3MZ2A 2J79A 1NH6A 4ES4A 3MHUA 2AL2B 3EWXA 3N9SA 4HU4A 5D04C 4QAIA 3BGAA 1KM4A 4QR6A 3CHVA 2X0HA 1RK5A 3Q37A 1LBMA 2CZ5A 3VYLA 2TPSA 1ZHAA 4O0KA 4AW7A 1EGMA 5CZSA 1G69A 3DENA 3FN9A 4HK6A 1Q85A 1B1YA 1TJ0A 4MY8A 3NQDA 1Z32X 4DY1A 3CQKA 3HURA 3K4DA 2XIJA 1A5UA 3AYVA 3PPCA 2GVLA 3DC8A 1MNSA 2NXGA 2OTDA 3CEPA 2CLKA 1V7AA 1TA3A 3MUZ1 4M24A 5D03A 4NVTA 3FEMA 3QV6A 3VTRA 1I2NA 2W0UA 1V3LA 3QR0A 4KCVA 4PN2A 3U2OA 4JN8A 4JFTA 3ANYA 2CLFA 4YL2A 5F4WA 4GVGA 4L5ZA 4EVZA 5IOBA 4BI7A 1FDZA 2VQTA 2J7BA 4S3KA 3CL8A 4C65A 3NSMA 1DTNA 1T41A 2Z27A 2WBKA 5RUBA 1WKEA 1GVSA 4OBSA 1BSLA 3W1NA 2VC9A 4ZGYA 4FX6M 1AH3A 2DUXA 1DJIA 1CGUA 3EOOA 1KM1A 4I8YA 4N6EA 2CPUA 1QWGA 4WGXA 5IHRA 3O2LA 5G2IA 1N8WA 3OA3A 3UXKA 2P10A 3ARQA 1B3WA 3ZJKA 3UT0A 5HJXA 4HPXA 2W3ZA 4AF0B 1QJWA 1GKPA 1GVQA 4JFWA 2OWCA 3M41A 5JH2A 4HPJA 3T0BA 5IDIA 3UWUA 2CLPA 1KQYA 1JGMA 3ZT5A 2CLHA 1UWUA 1XDLA 3P0WA 2GVGA 2H3DA 3LTYA 1Q63A 2GVEA 3C2RA 3ZWTA 3KWSA 1G9HA 5A8PA 2O92A 2YBUA 1QW8A 3OZPA 3G0XA 3UZWA 4KF1A 2GL5A 2PE4A 4G7EB 4JTAA 2CESA 2VT0A 1MQRA 4QHRA 1VP5A 4C7GA 2FMNA 4GMEA 1ITCA 3UW6A 5FJPA 4JNZA 1RY0A 5D2VA 5AB3A 2BOEX 1NWRA 3GWQA 2C79A 1JUKA 4BR1A 1GZJA 2DVTA 2QIWA 3OA5A 4JL1A 4QNWA 1TG7A 1UKTA 3OYZA 1X8CA 3RF9A 1KD0A 1FH7A 4HNUA 4OOUA 1W6TA 1QRQA 3L5LA 1J0ZA 4O52A 3T8LA 2O9OA 2Z1KA 4M6PA 2WJFA 3MTWA 3SJNA 4MZ1A 4D6FA 3SZ8A 4UQEA 4CU6A 4X9SA 3WMSA 2QUVA 4KWSA 1W2PA 1A5BA 1ISWA 3O3RA 2EJ1A 4C6OA 1BWKA 9XIMA 3VD7A 4QS6A 3FS2A 4XB3A 4NX0A 3FA5A 3F4NA 1FHUA 4F3HA 2OO6A 5I3HA 1EQPA 3BOFA 1TVLA 3B0UX 1RCOB 2UWFA 1B4KA 2ISSA 1QPRA 4O13A 4WEVX 8TIMA 1KGWA 5HINA 4Q8OA 4LB3A 3STFA 3N04A 1GTHA 5DF0A 3LHTA 5D9NA 1WP6A 2F84A 2ZX7A 3BICA 4XD3A 2DSVA 1GHSA 2DZAA 4JDYA 3WLPA 4M3PA 3N6QA 3NSNA 3SUVA 1NP2A 1PL9A 4LTSA 1LCOA 5BXPA 1E0UA 1F05A 1HFBA 4Q7BA 3TP4A 3T09A 2Z28A 5BMXA 4H1ZA 2PC8A 5I77A 1JDDA 1EC8A 4XSMA 5KZ6A 3N17A 1ZAJA 4JTLA 1GOQA 3AICA 3R11A 2HK1A 5FD0A 5BOFA 4M0XA 2CW6A 2BNJA 1EP3A 2W91A 3WQCA 2ZC8A 2PDCA 3VM5A 1U83A 1XI3A 4RZ4A 1TRIA 1DWGM 2EJAA 1Q6EA 1NIUA 4IOTA 1EFZA 3IIZA 2Z24A 2QKFA 4XZBA 3RM8A 3MKVA 4U2YA 4M19A 4M7TA 4NRSA 4K37A 4MFDA 3W7LA 4C1KA 3MQTA 3DFPA 2C3ZA 2X40A 3SN0A 3STPA 3Q65A 1VC4A 3FNDA 4HK5A 1JI1A 1BXCA 3WF1A 2ZX9A 2A3HA 3CHEA 3V3WA 1AQFA 4JIEA 4O1EA 3ARRA 4UC5A 4GQ0A 2PWDA 4L1GA 2FHBA 2BXVA 3NZPA 4XZNX 3L0KA 1SR0A 2W63A 3PFMA 5DFAA 5BOEA 4S3DA 2HQAA 2CERA 3PUEA 5JIWA 2YL8A 5JMUA 3G24A 3VD3A 1I9CB 3WDIA 3AS3A 4Z2IA 4QJ1A 2W67A 4RNFA 1V6WA 1ICSA 2Q01A 1LF1A 3BOLA 3RR1A 1ZCOA 3WDQA 2XHYA 1OC5A 4F2TA 2A3EA 1RBOB 2PWUA 3NQVA 2V5KA 1PZ1A 3THDA 3CPRA 1K3UA 1W9BM 3PBWA 5LIKX 4H04A 3WF4A 4PUUA 3H26A 3STGA 1L0PA 5FESA 1ONRA 2HVNA 4E2DA 1B4EA 5E09A 4GPNA 1TMHA 1F8MA 2PAJA 4ZOBA 4MM1A 3W6MA 2PF8A 4WOZA 1S3HA 4AX6A 1VFLA 3CAQA 3LM3A 2EGZA 3IIXA 3WLKX 4XKYB 3CPGA 3OLGA 4IP4A 1HVXA 1DWJM 3ZLGA 1E0VA 3GG1A 1FCBA 1EQCA 4BS0A 4G9PA 4F48A 2BDQA 3KLLA 5JBFA 1TWDA 3EB3A 4PUMA 1QI2A 2X7VA 4J27A 1YMYA 2QZRA 2ZRUA 1XCXA 3AHZA 4OFCA 2FPTA 2O56A 2WVVA 1DJYA 2HEJA 3QW4B 2SFPA 1VRXA 3M64A 3NA8A 3CUGA 4KH2A 3N4AA 4IQDA 4IQEA 4OZOA 1AZ1A 2VOTA 1FWRA 1QPKA 3OW1A 6CGTA 3BG3A 1QPQA 3W37A 2Y88A 3BJFA 3W7CA 5AFDA 2OZTA 3UVIA 4H6KA 1MZHA 3M0YA 2Y24A 2VRQA 2WZIA 3TJXA 2Y61A 3GTXA 4DLMA 1LUCA 4B5UA 1YTKA 2XPKA 1OC7A 4W88A 4MWAB 1E51A 4PMQA 3XINA 1SFLA 1XLFA 3WFAA 3AQUA 5JXQA 2HK0A 3FEQA 1C8QA 5T9CE 3EOEA 1JXJA 5EBAA 4ECLA 4WY0A 1ME7A 3KHJA 4WSHA 4LRTA 4E5TA 1L6SA 3GVVA 1JZ8A 1JPKA 4WVXA 4H6EA 4NZ1A 3KM8A 1GONA 4UR8A 4H01A 4E8GA 4E2BA 1V02E 2XH0A 1YTEA 1UW9A 2QAFA 4CN1A 3NSXA 3G22A 3NTYA 4LYPA 3RMJA 1SZFA 3HV9A 4XZMX 4LH8A 4Q33A 4NY2A 3VGHA 1V02A 4DBSA 5CGMA 3MO7A 1LRTA 2WBGA 1W54A 2FIQA 2B7OA 1TZ9A 1JR1A 3L9CA 3EYPA 5HQMA 1Q66A 3T6CA 4D6IA 3QSRA 1TVNA 3CQHA 3AISA 1VLIA 1IHIA 1O7AA 3EDEA 2PP1A 1ECEA 2G4FA 3ZT7A 4BQ5A 3LQGA 4CQBA 3L0GA 3Q67A 2H90A 1YX1A 1E9YB 4Q6JA 4KRUA 4HYRA 2NW0A 2QDGA 3KRBA 1XINA 5AN7A 2EPLX 4ENLA 2ISDA 3G1FA 4DO5A 3G5EA 3O7UA 1E55A 2BASA 4AZ7A 2WQDA 1MWOA 1F6PA 1O5RA 1E6ZA 5MHBA 2NXIA 1CXHA 1OG6A 1ME8A 5GPRA 1EHNA 1K02A 1XL9A 3LDVA 2XVKA 1WKDA 4HYWA 4YCPA 2Y8VA 2W5FA 4EF8A 1FH8A 3HFTA 1LWIA 1UR9A 2XH7A 5IFPA 2EG8A 4EXAA 2BHZA 1BRLB 4D2JA 4DF1A 3HF3A 4AIEA 4AZGA 4R7WA 2WZEA 3EX1A 5E0CA 4K36A 3DN5A 4ADTA 1AL8A 1TR9A 4G2DA 4Z17A 1P7TA 3A5FA 2HWGA 4ATLA 5F2LA 2DW7A 3G8EA 4HHMA 3IGXA 3KL0A 2XG9A 2P0IA 2IQDA 1E71M 4HMDA 2TRSA 4JNYA 5AC8A 3CH9A 4F4RA 2DSUA 3P67A 3MUAA 1BF6A 2PBGA 3GR4A 3L4VA 1YHTA 3DZ1A 1YTDA 4C6FA 3WF2A 2CEQA 1YXDA 4IUGA 4KEMA 5AVHA 3AMDA 2BOGX 3BLOA 2EAWA 5I3GA 1GTEA 1QDSA 1W3NA 4I8DA 3GC5A 2NUYA 1VPQA 3B97A 2J9YA 3V36A 2PODA 1DTUA 3H4GA 4B91A 3TFXA 1Q6LA 1XYMA 4F0SA 3AHYA 3DBPA 2PZNA 2DZBA 2A6LA 4UQDA 5AHMA 4C6JA 1D8CA 3O6YX 3WLNA 3EMQA 4BFAA 2ZTKA 1LOQA 2CXGA 5KINA 1XFCA 4YIWA 2C0AA 5KTLA 4UWMA 1OCJA 4FLSA 3L21A 4Z1YA 3LCIA 3W73A 4AHQA 3B9NA 2XGIA 9XIAA 3OG2A 4S3FA 1EZWA 2QCHA 3K8LA 3EB2A 4S2BA 5FEWA 1BTCA 1JCNA 4LB4A 3AFBA 4HHHA 3K1GA 1G01A 1UBSA 4DO7A 1VF8A 4QE1A 3JVAA 1F3TA 2X8RA 3MSDA 4U31A 1BXNA 4DRSA 3L4WA 3KBWA 2RAGA 1KNWA 3URAA 1TPDA 2OO0A 3KAOA 3MUY1 1EC7A 1XJBA 5K9DA 3DAQA 1VS1A 3V4BA 1HGYA 2WC7A 3H8AA 2A0NA 4D71A 3LM7A 5LIYX 4IM4A 3MSRA 1IEXA 1ZAHA 3VDAA 4DYJA 1AVAA 2PUZA 2FGBA 3AXIA 2PDGA 3VAVA 5D2TA 1WDSA 1WDPA 3PULA 4B92A 6REQA 1A3WA 3W7GA 5ECVA 3ISIX 4GUHA 3UGRA 4WDXA 3SCRA 4FR6A 3UG4A 1X7IA 3LHWA 6TAAA 2PB1A 1DL3A 3CTLA 1GVYA 3T0CA 4CNPA 3AROA 5BWFA 3LU2A 4U28A 4UTIA 2ZE0A 3JW7A 3M0JA 2HPMA 3T05A 2Y5JA 4UFHA 1Y8BA 5ABFB 2OODA 3G0UA 2CCRA 4Y8FA 2NQJA 3C2FA 5LYRA 3A6OA 4X3ZA 2PGRA 4LAUA 4Q6XA 4S3CA 2E28A 4QBXA 1Q45A 4UOZA 3VNZA 3GTHA 3S6DA 1QNSA 4FA3A 1V6TA 2ZCGA 4WQ6A 2WLZA 1SFSA 2GLKA 1XBZA 3LLXA 3B8VA 3A23A 5CBIA 5K3VA 4EWJA 5LNVA 3F5JA 4N4QA 5CJ5A 5DT5A 1TPVA 4IXXA 1E73M 1R7OA 1CLXA 3SI9A 5A2BA 2J27A 1ITUA 1O5KA 4BI6A 4HSNA 1IIHA 3AHTA 2QGHA 5DY3A 5J5DA 2OX1A 4S3GA 1K6WA 1UOKA 1PB0A 4I5XA 4ICMA 4Q4QA 3P82A 3BCDA 1AD4A 3QHMA 2PF0A 4V1YA 5H91A 1VFHA 1UROA 1HJXA 1OVDA 4J2MA 1XH2A 2VC7A 4DVOA 4AWEA 4BCEA 3MI2A 4RDYA 3QGKC 4TX8A 1SZGA 4C6EA 2BGNE 2ZUTA 3Q58A 5DBTA 3ALFA 4RPPA 3CLMA 4AH7A 3OOQA 2ABBA 3TXZA 2Z6IA 2ANUA 3TYDA 2XWDA 2OCZA 2J9ZA 2BODX 1E6RA 4Q7IA 3LPPA 4O0ZA 2EPOA 3AS2A 3V1HA 3GHUA 3KZPA 4JTRA 3VCRA 4XO6A 2PEVA 5D2XA 3QKEA 1N8IA 1RQEA 2PWEA 3CJPA 5BW6A 2V68A 3K2GA 1E5JA 3ARZA 3DDMA 3XIMA 4UXDA 3HGSA 5D9PA 3AXKA 3WD0A 1EB3A 4OWGA 4GKLA 4IFKA 4MIMA 2CITA 4AAJA 1C8XA 3KTSA 5I07A 3CZEA 1ADDA 2JKPA 5GNZA 3UR7A 4MYAA 3ARPA 1R3QA 1UD4A 4YU1A 2O4MA 2VL4A 1VBGA 2OKTA 4QEEA 1RZMA 4H6RA 2CLLA 5AHIA 2ZXQA 4EX4A 3R43A 3UF9A 1XG4A 3ABRA 1S2VA 1ADSA 4Q4RA 1HW6A 1KGUA 3NL5A 4DZ5A 1YNQA 3BLEA 5LXEA 4UQCA 1P43A 2BGSA 2F2KA 5BCAA 3ID7A 4WIWA 3VX1A 3P5YA 4FZIA 4R3UA 3HOJA 3RDKA 1VHCA 2YW3A 5HMFA 1V6UA 1SW7A 2Q02A 4GUJA 2D23A 2CETA 2FZ8A 2GZXA 3CAVA 4XISA 5AECA 2VEKA 1DE5A 3W53A 2ZWYA 3R5EA 4AIOA 5K2ZA 3ENLA 3NPXA 1H5YA 4PC8A 1XIHA 4DBWA 3UD6A 1VD6A 4GRSA 5AVNA 1XKYA 3BZGA 1VJSA 4EPKA 3PR2A 2J77A 1S2AA 5I5RA 3BCFA 5DO8A 1S38A 3MP5A 5FSDC 5CPLA 1JRCA 3QXBA 4QJ4B 3A64A 1FVPA 4W8LA 4GABA 3M46A 3CMFA 3C3NA 3NVTA 3CUXA 1S2TA 2RH9A 4LV9A 1XYAA 4US5A 2J74A 5CPSA 1V6XA 2OZ0A 1NDYA 5TBOA 4X22A 3FJNA 1OGSA 4UFLA 4QQUA 4QIUA 2J13A 3H2FA 4H9UA 1OD0A 1J5SA 4JHZA 3CM4A 3VI2A 4DUVA 3GG0A 4XSLA 4AVNA 3PANA 2QYGA 3BDKA 3GFZA 3FJLA 1FHDA 3SQMA 1GHRA 4EOUA 3F03K 1R9XA 3FJ6A 4I9AA 2Z7GA 3N9RA 2D2GA 3GAYA 4Z1DA 4HMCA 3LY0A 3N2TA 2XH4A 3I4EA 5A69A 3BLIA 2J7HA 1JD7A 4PTNA 3UZ5A 5FIPA 4UR9A 3VGEA 4OU1A 3GX9A 3LI0A 1KR1A 4BEQA 2V69A 2BLEA 1MRAA 3D5HA 2DDXA 3W1UA 2XU2A 4KIRA 2I56A 4Q4KA 1OFDA 2IKGA 3D6NA 4AIUA 3NQAA 1E9IA 3BPWA 2GJNA 4PCSA 3RLUA 3HGRA 1P5BA 3LGEA 1TO3A 3EOSA 3SUTA 1ADOA 3VGFA 3ORWA 1TTIA 3PPGA 4DBDA 1I0BA 1H7XA 2NQHA 2DIKA 1AL7A 2DQXA 3ABSA 1XYZA 2FTPA 1OCBA 4L6DA 1AFSA 2XZ7A 1O68A 3OP2A 1UR3M 2ZDSA 2OVLA 4HU0A 2TYSA 2QCNA 1E15A 2UBPC 3RU8X 1D8WA 2Q8ZA 3TA6A 3W1RA 3FKRA 1EJSC 4LYKA 1TELA 2CBUA 1EP2A 3S2MA 2WVTA 2IPJA 1H1YA 4ZODA 5KETA 2WZTA 3HQ1A 1B31A 2ONEA 3MCMA 1E6SM 1M7PA 3E9AA 1O1HA 3IEBA 4IQLA 5A94A 4G7EA 4O1AA 3E3HA 2PDWA 3LRKA 4PRTA 5C2GA 2FDSA 3I7RA 3RAOA 1JL8A 4A8NA 5JQ9A 3IRSA 5FJOA 3KDOA 3R7MA 4L61A 2DT1A 1FCQA 3GDTA 3RPMA 4W7VA 4OOZA 4L6OA 3M0HA 3RO6A 3S42A 3QPEA 1YE4A 1MMFA 5EGRA 4KFOA 4GI4A 4JFVA 4B9YA 3CUZA 2DSZA 2X1TA 1X8FA 1XFBA 4FSAA 3TAOA 3F2CA 4XBSA 2WM0A 3CBWA 1B9BA 4MNJA 4I9MA 8A3HA 3ZJ8A 1QNRA 1DQUA 3I7QA 4PODA 1VJIA 4DX3A 3CIWA 2VEIA 3LYEA 4ICNA 2WZHA 4RNHA 1SQ7A 1V03A 1VAHA 2YKKA 1OFAA 2FHCA 5F1UA 3IJ6A 3E2SA 8CGTA 4AZIA 3FK4A 2PRHA 4R5EA 4LPCA 3HPSA 3DFHA 3H53A 1KCLA 3NEVA 4FX7A 4X2PA 3C0LA 2YFNA 2WNZA 2HNEA 1VQTA 4UTTA 3EDDA 2NSOA 4O54A 2FLIA 2V2DA 4C5ZA 3IGHX 1AQ0A 4LVGA 5E6YA 4W7UA 3SCQA 1I2PA 3BSGA 3GVRA 2UY4A 4LUYA 4HIBA 1B3VA 3SRKA 3M7WA 3N73A 3FXYA 3VOIA 4FNRA 2Y1HA 3UYCA 5EL1A 2GUUA 5DRIA 4JL2A 2IKJA 2WC4A 2YCIX 2YDSA 2PU1A 1F74A 4YTUA 1P6BA 4MLJA 3B0PA 3CNYA 3DHUA 3CUHA 1E0TA 4MGGA 1XPGA 3ZOAA 4Q8MA 1SSDA 4F2UA 2A79A 2D0HA 1REQB 4GJ1A 1HQTA 1L2UA 2BXYA 3LMZA 1QNQA 3K4AA 5CBBA 2AL1A 3VC5A 1R3SA 3V18A 1LG1A 4IIGA 1Z42A 4NAFB 1OYAA 4YN5A 4B4HA 3PBMA 4MLRA 2WWCA 4JTUA 3WLTA 1UR2A 4AZ5A 1NM9A 2B31A 3EMZA 4JN6A 3V5OA 3UZYA 3VK5A 1QASA 1PCKA 2X7WA 4HGXA 2VCBA 3J7HA 2HVMA 3IAPA 3PHAA 2VM8A 1AJZA 4PA8A 1ZJHA 1A5CA 2FH8A 4HTBA 2J7GA 3C6CA 3W71A 4TX6A 1ML1A 3A4JA 1AMYA 2R91A 3WJZA 3NQ6A 2C8NA 2PFHA 4WJEA 2GQ3A 4XD4A 4NZJA 4IGHA 3O07A 1AJ2A 5DT7A 2D1ZA 1XLMA 2YA2A 1LLOA 3QZ6A 1ZB5A 5CPMA 5C9ZA 2F2HA 3W38A 3NQ2A 4GI8A 4L4LA 1TPB1 1RV8A 3KCLA 1PVNA 4MZ8A 4ZVJA 1O5QA 3AU2A 3C52A 3HGJA 3QF0A 5HMSA 3IUDA 1MRQA 2PTYA 2PDXA 1EEPA 4ATWA 1FY6A 1OCNA 1Q6CA 3VXGA 2H3BA 1FOBA 3WK0A 1RQHA 4CNSA 1NTHA 2FB2A 2HRWA 3NYZA 1VYPX 4IJCA 3MW7A 3L5AA 2CHRA 4DJDD 1TPUA 4DI8A 4AHPA 4F0HA 1FWEC 4CCEA 3AUOA 3S1WA 4CD5A 3TLQA 3UPWA 4YWIA 3DBNA 1M03A 3WBXA 4E8CA 2NWRA 4H83A 4JTEA 2J8TA 3WBWA 3PK7A 2YDRA 1UIOA 3GSMA 4H8VA 5DN1A 1VFUA 3WSUA 5G5IA 1H09A 1O60A 3SM0A 4GCAA 3NPVA 5MKGB 4KWWA 3L0NA 4PMVA 4MG4A 1XBVA 2VVNA 4AEFA 2WQPA 4XV0A 5EPDA 3QZEA 2ZUMA 1W1TA 1K1DA 2MUCA 2WMJA 4CKQA 1SJAA 1PDZA 4AZCB 3AJXA 5XIMA 4R33A 3SN1A 3WDJA 3BZJA 4F0KA 3M5XA 3IIVA 4ZE4A 5DLCA 2VFDA 1G4TA 1GOKA 2HNHA 3S2NA 4Z2LA 3WMCA 2EKCA 3CXOA 2R6OA 4REQA 2J24A 5A6MA 1QT1A 1BTMA 3RR4A 3P81A 1O94A 3EPMA 3GU1A 2P0OA 1HG3A 1UUOA 2E77A 4J9JA 5K9CA 3N4EA 3USBA 1PUDA 3ELFA 2WVUA 1F2JA 1WUEA 4JQ2A 1NFGA 3BURA 1KXTA 4DPPA 1D9EA 3HJZA 3DIPA 3RCYA 2Y63A 2CFFA 1KBJA 1MDLA 2DPEA 3IRDA 3IK4A 2ZRZA 1B0IA 5I7GA 4IMDA 1GVEA 1W8SA 3O06A 4GXPA 2X0YA 3GDRA 3APYA 4GIRA 3EPNA 5CSUA 2QJGA 1W1PA 3N2MA 3HIJA 2V67A 3FXGA 4BI5A 2VOMA 3NVDA 4H9XA 1M7XA 4RJEA 1ZLPA 1YBQA 5I79A 4BJHA 1OADA 3AIRA 4GFSA 1LORA 3SDOA 3T1GA 3E0WA 5DMNA 4E3VA 3KX6A 5EMJA 4HPNA 2D20A 4AWUA 4E2VA 3C61A 2JKEA 2XZ9A 2WOQA 5A8MA 1BWLA 1NU5A 3OLEA 4R53A 1GVRA 5CBJA 3DERA 3BV4A 5AC6A 2X0SA 1ZJBA 3WH5A 2E5BA 1JYWA 2NUXA 1FCUA 2BY2A 1ZSXA 2J4GA 3N4FA 1M65A 1UZHA 5A6JA 4A21A 3N6HA 3EA2A 4XAFA 3SCTA 1IXOA 3PZ9A 2XFRA 1H49A 1RBAA 1R86A 1YW1A 5C9XA 1GPFA 4JZ5A 3NAVA 5HQEA 1EXBA 1GG0A 2X05A 3E12A 1Q7ZA 4V2XA 1PBGA 5A95A 2VYOA 3DFSA 2PRLA 5LNUA 1EP1A 4MSSA 3VIIA 4YTQA 5FJRA 5CCZA 1YNYA 3CL7A 3M0MA 4NHVA 1TYGA 4HYVA 2QJNA 3U6WA 1XYFA 3QY8A 3TMLA 4AB4A 5CC7A 4IPIA 3NG3A 3T08A 2RJGA 1TFVA 4O17A 4RE4A 3QQ1A 3N2CA 4QLLA 3TQ0A 1EDTA 1Q4NX 3G2GA 3ITGA 4R34A 1BVWA 3LTPA 1M68A 2DIEA 1U5JA 1P7TB 3VMPA 2ZUUA 1H7OA 1UWTA 3QOKA 2VUYA 4UFMA 5REQA 1KXQA 3KZSA 1NARA 1OJXA 3BMXA 3QYSA 1K4HA 4V33A 3O1NA 3L67A 4ZR8A 3TNOA 5C7HA 4S39A 1QO2A 1TE6A 1KV8A 5CKSA 3CIXA 1OC6A 4B5WA 4PBGA 5EBUA 1RR2A 1E6NA 3WK2A 4RX0A 1QOXA 1FDJA 3L68A 2E1WA 1XH1A 3INPA 1ZTVA 2I1OA 3PUOA 2PPGA 3GQYA 1IT0A 1L9WA 2R14A 3VNYA 3OPSA 3VOJA 3CEUA 1SMDA 3HG4A 4US5D 3AALA 1E4MM 3JRKA 4J3SA 5HUPA 1FWHC 1W91A 1LL6A 3CT7A 2OG9A 1PAMA 2XFYA 3OIXA 4D9PA 2V5DA 4QNEA 4KFPA 4F9JA 3T8QA 3U57A 1FWIC 2YA1A 4KWOA 4ZEPA 3DFNA 7REQA 1LZOA 1EBGA 3HGOA 2I5GA 3F2DA 4E2OA 4AMAA 3AUJA 4F66A 4U5IA 3NQ7A 2OQHA 1RLDA 3TN5A 3PZIA 1BPLB 4AD5A 1MI3A 4P8XA 4PUWA 1JPHA 4B9ZA 3Q94A 4ERIA 1TRDA 2VD9A 1F8IA 2DIJA 3A3WA 2A3AA 2PLJA 1ZQ5A 4HCDA 3TJ4A 1TTQA 4NJKA 5E0KA 2BVDA 3UCDA 1ISVA 1RSCA 2JKAA 4NJJA 5DX7A 3KOXA 2P8CA 1JF6A 1WV2A 1XH0A 1X6UA 3UY8A 3BGGA 5D32A 2CKSA 2VGFA 2YCJA 4NSBA 1EUNA 3WNMA 5K9XA 1V51A 3H24A 4ORMA 1V6VA 3GAKA 3GUGA 1IF2A 4JN7A 3VFCA 2QJIA 1W1YA 1EO7A 4LJ3A 2J6XA 1TTJA 3WD3A 4CGTA 1ODUA 3P84A 4K7VA 2REQA 1WDDA 2UY2A 3VDHA 3SADA 5C9UA 4XWUA 3VILA 4PEKA 5E9XA 1CI1A 4Q4SA 3TTSA 1YEYA 4LUSB 1KRBC 1WZAA 1KCKA 1A3XA 4UNKA 2INFA 1OABA 1LQAA 4L65A 3PBGA 1CLKA 3SFWA 1E0XA 3G18A 2PSNA 2VWSA 2P88A 2VC5A 4RW5A 2VR2A 1QHZA 1MW0A 1JFHA 4GQQA 2G3JA 1SM9A 4MVAA 4Z0JA 1F76A 4B15A 3K5XA 3CHFA 1QI5A 5F2MA 1SZEA 3W23A 1KXVA 1EPVA 4YVVA 3VIHA 2WYSA 4PB3A 2E9LA 1BKSA 1E1CB 4ZB2A 1TX0A 1GEQA 1E43A 1HUVA 5FACA 3WMBA 1QK0A 1UOZA 2ZZ6A 4JY9A 1W17A 4L80A 2YB1A 3CO4A 5AZ0A 2AAAA 4IPLA 1PPIA 2QCFA 4F0RA 2IKIA 4JKMA 1TPEA 4GX9A 3KWXA 2WHLA 5G4EA 4QM1A 3CV6A 4DQWA 2FTYA 1LLZA 3UWQA 2A3LA 3UA3A 4IICA 2VENA 5CZJA 2YYUA 2D0GA 3BVJA 1UIPA 1QW9A 2HS8A 2QW5A 1SO5A 2PDFA 1JUBA 3CS2A 3NQBA 5G1MA 3WH8A 4JIHA 2VR4A 2XWEA 1JFXA 4S1FA 1YNPA 4J3UA 2ICSA 1H7PA 1WA3A 3V5FA 3T0TA 2G97A 3GXIA 4FNPA 1TUFA 3RLGA 5BOOA 2GGJA 1DV7A 4IMGA 2D0FA 4RZ5A 1R87A 1T8XA 1W1IE 3UPBA 2PD9A 4OTKA 5FAGA 5LNSA 1DVJA 4HCLA 3JS3A 1F6KA 3IV3A 3K13A 3WQGA 4IJRA 4XZWA 4JKLA 3S1UA 5H6HA 2G3FA 2QF7A 3MWCA 2UY5A 4MUPA 3IUIA 3KS5A 3THQA 3VX0A 1HO4A 5HPOA 4EXQA 5T91A 3HFYA 4WDUA 3WQPA 4Y9NA 1KBKA 4MKNA 4UCGA 4CNUA 3S8HA 2JF7A 2NX9A 1QVBA 2Q3OA 3G1YA 1KW1A 5CLWA 2NV9A 1FWTA 1DIKA 4H4IA 2JIEA 1D7KA 1KGXA 3ABQA 1GNXA 2Z1SA 3WLJA 2V81A 3M6YA 4H8UA 2DEPA 1W9UA 1BLIA 3ZXWA 4H7ZA 2EKGA 2P76A 1UQYA 1PYFA 4JOMA 2XSBA 1E3XA 3ICJA 1PX3A 1JCLA 3KLKA 4LS0A 1B90A 5AHEA 1UZ4A 3EB4A 4GACA 1S1PA 2NZLA 3RX3A 3PG9A 4DLFA 4HOXA 1TX2A 1HZYA 1VPXA 1I2QA 3VGBA 2CYGA 2JFEX 4GQBA 4A22A 3S6OA 3OVPA 4NZ4A 4LVDA 1OFOA 1SJDA 1XM3A 1DWFM 2EQDA 1NDZA 2R94A 3VFLA 3FVDA 1XQKA 2W66A 1N2VA 4AZ6A 3R10A 3TZFA 4LT9A 1Q5MA 4FNSA 3R8GA 4JTTA 3GNOA 4D6HA 3E6EA 4JQ3A 5G4HC 3T81A 4HA1A 4J4KA 1QI3A 2GVYA 2OQYA 4EXBA 2FVMA 1FWFC 5BZAA 3A12A 4JY8A 1G0CA 4FNUA 1OQFA 1X1OA 3PB0A 4GVHA 4IUOA 3MMWA 2QCCA 4I5UA 3EXTA 3EKZA 3THCA 2F8QA 3NL6A 1EJ7L 4EP8C 3UCQA 2EPNA 1UWSA 2VP8A 3MUXA 1M04A 3W70A 1XW8A 3BLKA 2F61A 2E6YA 4NILA 1UR4A 1PTGA 3ITTA 1RVGA 3BMWA 4MPQA 1SYTA 1SZRA 1VIWA 4F0LA 3MSYA 1U5HA 4ZSUA 5BXRA 4NKCA 2PDIA 4HZ7A 3WH7A 1A5AA 3M43A 4NG3A 2PI6A 1BWVA 1SW3A 1D3HA 1IIGA 3TQVA 1QNVA 3PC0A 4TMCA 1L6WA 3WIJA 1EWEA 3P6LA 1MYRA 2BHYA 4XO7A 4Q32A 3T44A 3E2QA 2RFGA 1T40A 1CXFA 1QMLA 4FO4A 3G77A 1FBAA 3AOFA 1J2WA 3MBDA 1Q13A 3EX3A 3B03A 1OD8A 3PZUA 3HMJG 4UTJA 4FALA 1DJXA 2NVCA 1HL8A 1JI2A 4GH1A 2E5DA 1KCXA 4HNCA 3FGCB 4QDMA 1KM6A 2QUUA 4C6MA 4B5SA 2XDFA 1I45A 1CB7B 4S3JA 4PUNA 4GUIA 2V5JA 2NQ9A 3PF3A 3ZSTA 4LCRA 1IE7C 1Z8AA 4H8NA 4J3ZA 5E1QA 2E1DA 3WK1A 1MSSA 3LZ5A 5A6BD 1UR1A 2IMRA 1DOSA 1E1FA 3P62A 5CJNA 3GTNA 5LIWX 3P93A 3VGGA 3WNNA 2P53A 4WD0A 3Q4DA 4W5UA 1CW2A 5A3HA 2PDQA 2G3MA 1KRCC 2ZC1A 4G6CA 5CZ0A 4AD3A 5BXSA 3I3DA 2NVAA 1GQNA 1TMLA 1XC4A 2DZUA 3S9IA 4C1NB 2A7RA 2YPIA 4XKMA 3WEMA 3ZWSA 3RK8A 4IMAA 3W2MA 3UVAA 3TIMA 4RK8A 3OZOA 1JYXA 1WXYA 4HD5A 3BG9A 3CUIA 3GR7A 1TUXA 2CLEA 1F4AA 4QJ3B 4PTVA 3BANA 1NWUA 4H3DA 4I6VA 3LCWA 3LN3A 1A5MC 4D1IA 1Q8AA 2F38A 3FYOA 3W26A 2GOUA 3W7JA 2WSYA 2QCDB 1O4UA 2ZX8A 2E25A 1XG3A 3GXNA 5IBXA 4IMEA 4W86A 1K9FA 5F7UA 2WNNA 3OVQA 1FTXA 2WHJA 2FVKA 1OFQA 2QUTA 4L9XA 4D6EA 4GK8A 2DH2A 1KB3A 2W9MA 3JR2A 4UMCA 3K8MA 3VOGA 2W4XA 2RDWA 1Q8JA 1VPYA 2BY3A 2E6FA 1E0WA 4ORIA 2BVYA 1Q6GA 3POHA 5I78A 4Q22A 4PE8A 4OE7A 1WDRA 1C90A 3UZZA 3S1VA 1BYAA 5GNXA 1CIUA 2AAMA 2A1YA 1XRFA 3OZYA 4JIRA 2WSKA 3MZNA 3N29A 4QE4A 5HMDA 4GNVA 1E5NA 4Y9AA 4TR9A 1UASA 1FUYA 3ECQA 1GW1A 4XZLX 2OSWA 1D3GA 4DM1A 4FF5A 3FIGA 1KA9F 4GQGA 3V7PA 5HNTA 3OVGA 4Q8PA 4KPLA 1AH0A 1WAUA 5CAKA 3WDHA 4D72A 2QXWA 3S1GA 3M5YA 5C7VA 1JD9A 3OBEA 5CAHA 5TIMA 1Y5XA 5DQPA 4C7DA 1UZ1A 1MQQA 3TMQA 4DWSA 3QTPA 1DJZA 1ISXA 1I75A 1ZFJA 4JKKA 2PWHA 3DYMA 4WX2A 3ONBA 3PTQA 5TQLA 4EKJA 2J47A 4QP0A 2TAAA 2BY1A 3HG2A 2O9RA 1P6WA 2A3BA 4LVBA 1W8GA 1C8YA 5CQ1A 4ZTYA 4O0QA 3IV8A 1SO6A 4AY7A 1SO3A 1M7JA 3P60A 1MXDA 5A1AA 2ZFAA 1XRSA 2VURA 5HWNA 4PUJA 5I2UA 3AWOA 3QJAA 1HIZA 4Z1AA 3GUWA 3PJUA 1JDAA 1E70M 4R9XA 3EDJA 3SCOA 4POCA 3T0DA 1LRQA 4K1GA 4BQ4A 3W7IA 1VB9A 3H2OA 5DCDA 1GQKA 2B7QA 2WCSA 4EANA 4ZENA 1EUAA 1N7KA 4BHYA 1VR6A 3EXSA 5BRQA 3KDNA 2CLOA 3SSJA 1JAEA 1Q4WA 3BARA 1JZ3A 4DZIA 2IXVA 3H54A 2OX4A 1M9HA 1GYMA 2V82A 3S3GA 4MADA 3KP0A 3R6IA 3UJEA 4KEZA 1NOFA 1AQMA 3GRIA 3NGFA 3UG8A 3U0HA 2PLKA 1P0EA 1OFPA 3CL6A 5BXTA 3KS6A 3D3FA 4FPSA 5C5YA 3VIPA 1HJSA 1AG1O 3ITOA 4JIPA 3LNMA 4JX6A 3E5BA 4MMWA 2ACSA 2DT2A 2WSPA 3NL3A 2VNCA 4GISA 3CU2A 3W07A 4ALDA 1HF6A 2DW6A 3VIJA 2V5LA 3T4WA 1TV7A 3SIZA 5C6MA 3ABOA 4DAIA 2JGQA 2J7CA 1WZLA 3IJ8A 3TCSA 1PDYA 2YLLA 1XCFA 1UC5A 4G5DA 3TQKA 3EKLA 1FFRA 3N2XA 1QBAA 3H7UA 2YSWA 3C2VA 2ZA1A 5MKGA 5LZLA 3LCFA 3GHRA 2PD5A 3AU6A 4M1BA 4PRWA 1J96A 1HVQA 1PZ2A 2JBMA 1NSJA 1S2UA 3OB8A 1TPWA 2GDUA 4AWTA 4JX5A 3WQ4A 1FXPA 1LDCA 4GC3A 4ZSTA 1IR1A 1LWJA 1Y5VA 3G8RA 1QWKA 2O7SA 3LERA 5I06A 4DJFA 3S9YA 3NOEA 3B8TA 2HMCA 2PU0A 1OSEA 3NDZA 4IPJA 3E02A 4OQVA 3ABZA 1ZCCA 3DUGA 2CBJA 4W8BA 2YJQA 1IT8A 5A2CA 3HBLA 2ZRWA 3UWYA 1XIDA 3KBJA 1R3VA 4LUTA 7ODCA 2H9AB 1HGWA 4FLQA 3M07A 3NDYA 3PSWA 1H11A 5HOSA 1FFQA 5D9OA 4M6QA 2YCLA 4WDTA 4MF4A 3MMDA 1XGDA 1X96A 2PDPA 3CV7A 4M80A 2P50A 4L9YA 4W8AA 5D38A 1EHAA 2HV5A 3VE9A 2FZBA 2IPFA 4TTUA 1Q7QA 1Y7VA 1QO5A 2INEA 5FL1A 4H7CA 1JCMP 3TA9A 4C5YA 4Y9PA 1KFBA 2WPBA 1BEUA 1W5MA 2QDDA 2CHNA 3N9KA 2AMGA 3AXHA 1OGBA 2BWGA 4R85A 4CUCA 1YBQB 2QF8A 4I3GA 3HU7A 5DCEA 3BLPX 1VFOA 4MZYA 5AHLA 1I2RA 1ZJAA 4ZE5A 1C91A 4JHMA 2Z2BA 1TTPA 2QQ6A 4CCDA 3P5ZA 4NI3A 1PWMA 3ATZA 1IXQA 5EA9A 1VHNA 2VFFA 4IGSA 1NQKA 1OFEA 5D09A 5EY5A 3A5VA 3GIYA 3ITVA 3SN4A 4GUFA 3LSBA 5CEWA 1LTDA 4KETA 4JEQA 1GQIA 5KZDA 3CHDA 1KBLA 4XK2A 2J7DA 4ICCX 3ZLHA 2XIQA 2IW0A 3ZJ7A 1UP0A 4KWUA 4KGJA 3ITCA 4E6MA 1BD0A 3PP7A 4IMCA 4HJWA 4OUEA 4MPKA 2E8YA 4D1JA 1EL3A 3YPIA 4JGDA 3ARSA 4PULA 1EC9A 1IV8A 4IZGA 2FZMA 2B81A 3H12A 2NVDA 3SAZA 2HS6A 4AD0A 2POZA 1TWWA 4J2PA 3WLMA 4HU3A 4XUGA 4NI8A 1DHPA 5CG0A 1S39A 2E6AA 4FIRA 1A5LC 2WCAA 4QSHA 2QPSA 4J1OA 3U7BA 2JF6A 3SUUA 3KHDA 1U5VA 3GYCA 3EWYA 5KMYA 5F4XA 1GWJA 3B9AA 4LV4A 2PWGA 5REQB 3LHVA 1JPIA 1ONXA 4ERAA 1F3EA 4M7SA 1AZ2A 4GGBA 1EH9A 2VHLA 3IK2A 4LOCA 4HOWA 4ZXLA 3AZSA 4ZO9A 1CYGA 1I6NA 3D47A 4CEUC 3DFQA 1RA0A 5HJLA 1W0MA 2ZIDA 2FJUB 4ZZ9A 2ACRA 1B57A 2J66A 4AF0A 4DNMA 3QY6A 4C6PA 2R1LA 4PUDA 2GJLA 4HZ6A 3REQA 4HSHA 3W3OA 2WHKA 2R1MA 1LG2A 4HMEA 1K8YA 4YXGA 2XVPA 1FHLA 1ONEA 1OK4A 1VEPA 3RM4A 4IIFA 2FKPA 3S4TA 2PDMA 4MNMA 3APTA 2XIBA 1K9TA 4CQAA 2DVUA 3CWOX 3M44A 3E49A 1US0A 2Y7EA 1UBPC 3WNKA 4CVWA 2QV4A 2WV8A 3TOPA 3VZXA 4OKDA 3QC3A 1C92A 7REQB 3ANVA 1JCTA 2ALDA 1FH9A 3UJSA 1VYSX 1S2CA 3UERA 1FP9A 2V3EA 3HZ3A 4MHBA 4FF7A 1VIZA 3GW3A 3MJYA 5DXXA 4AC7C 5DY2A 1HJUA 1OFRA 3L4TA 3MP4A 3OEXA 3W86A 3KOZA 1NELA 2DGAA 3C0JA 3B3DA 1UUMA 2VD8A 3ZVHA 1DXFA 2Y7GA 1X97A 1ZRQA 3IVUA 4N02A 4AVFA 4X2RA 1TV8A 4W89A 2G4JA 4HA0A 4C6DA 2IUZA 2X2GA 3ARYA 2OOFA 1BYBA 4IG2B 2CZDA 4QSFA 3V1PA 4QRNA 3TLLA 1XSJA 1J5TA 1EPXA 3W0KA 2NT0A 5TF0A 4NYUA 1TPH1 3NOYA 1C93A 4EPDC 3H6OA 4PSPA 5J8LA 2Q8XA 2PZ0A 3ZR6A 3HQOA 4WXYA 4O50A 1JZ5A 1PS9A 2J8GA 3PPFA 4QS5A 4XZ9A 4X0NA 3MMTA 3WDPP 2PDHA 1TV3A 4UMAA 1NOUA 3VNKA 1W3KA 4P7RA 2WJDA 4ADUA 4X9YA 1XDJA 3RYSA 2WMFA 5XINA 1VZWA 1PO9A 3NQCA 1Z6KA 4PFMA 3UY7A 3WYZA 5B80A 4GHRA 4WCJA 1GOXA 2BP1A 1HKJA 3GNXA 4QDPA 2V2HA 2J78A 1EXPA 5C8BB 3E2VA 3THUA 2XIOA 2OT1A 3II1A 3R4IA 1PZ0A 3RX2A 3WQ8A 4ZOAA 1Z3NA 1NVMA 1UZDA 2O0TA 2VCCA 1PHQA 1V3IA 5HR6A 3D46A 2ZA2A 1V3JA 1R0MA 2GSHA 2VCAA 3VGDA 1TPC1 4PMZA 4J35A 4DIAA 5ABEA 4K8EA 3P80A 4CD6A 4ERGA 3MP3A 4X61A 3WQWA 3GNRA 5CH9A 1EWDA 1GVOA 1E1CA 2DUAA 1NWTA 1BGGA 1R47A 3NEHA 4YTSA 4BEUA 4J3XA 3QGVA 3HPAA 1DPMA 1W9XA 4JTQA 1JCYA 5SWUA 2W27A 1JCXA 1GOIA 3L2IA 1A0EA 2V8ZA 1ECQA 1MQPA 1JNDA 4FX8A 1JDCA 2OGJA 3VKDA 1XLAA 4DB7A 2VO5A 4P5UA 1OYBA 4RZ6A 8XIAA 4XAYA 2OT0A 3MHGA 5KITA 3P8IA 3WCZA 4YTRA 5I23A 1BQCA 4NNAA 2IPWA 1IXNA 3R0UA 2PWFA 1SUXA 4N7QA 5I02A 4O8AA 3AXXA 2E40A 4B3KA 2B7PA 3KP1A 1XX1A 2ZICA 4P7NA 3EOLA 1DE6A 1DIEA 5KSWA 1JQXA 3M5VA 4TOQA 4Q4PA 4H9MA 3KW3A 4MDOA 4DPQA 3FFSA 2AKMA 4TQTA 1IGSA 2ESCA 2ZTJA 3ZIZA 3W72A 1EYEA 4RDVA 3SEPA 1A80A 1UHVA 1R38A 3U9IA 4I9JA 3BWWA 2ZUWA 3IVSA 1B3YA 4MJZA 1AODA 3CK5A 1AK5A 3N3TA 4U10A 2ZE3A 1JULA 1AUSL 1SJBA 4J3VA 1BF2A 5JVLA 1YXYA 1R85A 4S3EA 3TW9A 4WDWA 2ZZ3A 1EZ2A 4HCHA 5CPOA 3WK3A 1TZ7A 2ZX6A 2ZXDA 2WM1A 1BYDA 2YL6A 1OK6A 4PTMA 3U4AA 2VFEA 3PZTA 1NP0A 3HV8A 4P7LA 5A6SA 2FVLA 4QEHA 2JIWA 3LLFA 4XKYA 3TYCA 1ODZA 2V30A 4E4FA 1TZZA 2VUNA 2XM1A 2DT0A 3SW6A 1P0BA 4IIEA 1YXCA 1LRNA 2E8ZA 2CNCA 1CT5A 1K8ZA 3EXRA 5L9FA 3SY8A 1BFNA 2XSAA 4CQ9A 2ZZ2A 2G96A 3L4XA 1KR0A 3F4DA 4G56A 2I5QA 1A4MA 1MEWA 2J7FA 4C6NA 2QR6A 1XIMA 3A3XA 4FEZA 4QJ5B 3PZOA 4B4FA 5GJMA 4NJGA 5J5RA 1PEZA 3GXPA 4MYXA 2RDXA 1J10A 3GB6A 1UC4A 4LNYA 5BRBA 3R25A 2DV0A 3W7NA 4MOZA 4JXCA 2QUNA 1XYBA 1H41A 2QVNA 3RU6A 1SZNA 4NAEB 3N12A 4M82A 4KERA 3WQ5A 3U4FA 4Z0SA 4MKSA 3PAJA 5CG7A 5KZMA 4I5RA 1XRTA 2QJMA 1J0IA 1R5YA 3CB3A 4RE3A 1F07A 1LUCB 3RRXA 3P61A 4GY7A 4IXHA 1IWPA 4MWAA 1TPFA 3PSVA 5D2YA 1TV2A 2X42A 2PDJA 1JPDX 3UQNA 4OT7A 4P8UA 1UD8A 5E0FA 3WKZA 3QOMA 5D4YA 1JPMA 2VXNA 4H41A 7CGTA 3GBDA 4C6QA 1S5TA 1PKYA 1RK6A 4LSBA 1H1NA 3MCNA 1J0HA 4O57A 3VC6A 4BA0A 4NZ5A 1PV8A 2FYMA 1EIXA 6XIMA 4LBRA 4R7JA 1BVNP 3M9YA 3OQ8A 5GVJA 1FWGC 4E3TA 2Y62A 5F2IA 1PXGA 2Y89A 3C0QA 5HMEA 3WH9A 3IUHA 3SB0A 5MF5A 5C2CA 3CASA 2DORA 2VX6A 1C3FA 4C6IA 2Z29A 4JYEA 4CN6A 1WOBA 3S2CA 4G1KA 2VTFA 1PIFA 1QATA 1VGAA 2R1PA 1UR0A 2JGYA 3EWWA 1MXSA 1MNZA 5CJMA 1JYVA 2A7PA 2PS2A 3MYOA 2QMKA 1GVFA 3K8KA 2VX4A 2I9UA 3B8IA 1XLGA 4CLMA 2HJPA 5EMYA 1AQHA 4UTWA 3NQFA 1LBLA 4AQLA 1Z69A 2P3EA 1HL2A 1KKRA 3KRZA 3GG8A 4ZMGA 1OZQA 4ZQMA 1TSIA 3SCNA 2WNWA 1CGXA 2YDQA 3W85A 3FGCA 3KL3A 2VDGA 2V0TA 3CTTA 4BF9A 1HJVA 2WCGA 4I6KA 3W2UA 1V6YA 1MO0A 1L8PA 3QV8A 3W01A 3W1QA 3RIKA 3WL1A 5LA1A 4TVUA 3WQOA 1LOSA 2HISA 1XBXA 3GS6A 2VGGA 3G1RA 3GDKA 3WD1A 5C71A 4AEOA 4ZQRA 5DMMA 4ZA0A 3CQIA 2ZQ0A 3H23A 2DQWA 1F4HA 3QR3A 3G1DA 4O4VA 3RLVA 1E4LA 3ARXA 1UH2A 4XG1A 3TJLA 7XIMA 4GUGA 1TJ2A 1JYNA 5AHNA 1GYNA 1QU4A 2A21A 3GE7A 1UWIA 4KESA 5U4NA 4C1NA 1SVDA 3APGA 4NL1A 3SIMA 4ZXOA 3ARUA 4O16A 2WVSA 4W85A 4LW7A 2DT3A 1LQ0A 2O4QA 4MUZA 1O5XA 1X1NA 4QLKA 5C9RA 4YTTA 4I7UA 3PZVA 4J5NA 1FCVA 5IHSA 3W1AA 1XD1A 1P6CA 2ZBTA 2AGTA 2DP3A 1E3ZA 3ZVIA 4C6LA 3ZR4A 2YCEA 3N13A 4TVDA 3LS9A 4PMDA 2WK2A 1CXKA 3NZRA 1R8LA 2BMBA 1T7LA 4H9YA 4PZVA 3NQEA 1ZALA 3GKFA 3TJIA 4H7VA 3LBOA 2F6UA 1WX0A 4QDWA 3O6DA 3GNNA 3RJXA 3A47A 1YIXA 4PEEA 1YKWA 4O1BA 5M2FX 5T9BG 4WJ8A 3TTOA 4UUIA 4K68A 5PTDA 1IT7A 4JQ1A 3CO8A 2XJ7A 3GKAA 4JS3A 3P14A 5ENLA 3NXLA 3LZ3A 1KC7A 4N0RA 4NNBA 5B7ZA 6PTDA 1U1UA 1KFLA 1Q6FA 3VU2A 3N2BA 4AX7A 4L4OA 4RE0A 2EPMX 5M5DA 3BOXA 2ZUSA 4ATDA 5TNVA 1EA0A 4ZCWA 3LBMA 4ZO6A 3TONA 4Q8VA 3AC0A 1NEYA 5HULA 2XVGA 4FMVA 3N15A 3MSGA 4LEQA 1CEOA 1XLCA 4W87A 4GIAA 3PJTA 1XUZA 4KFNA 3W22A 4XZHA 3OG3A 2NV1A 3WQDA 2ASHA 3WLRA 1UQZA 4B3ZA 4RW3A 3MI3A 3FW6A 2PDYA 3I6RA 3B9OA 3LRLA 3P74A 5DCBA 2VC6A 3B4YA 1PTDA 3KRSA 4CQCA 1TIWA 3H2NA 4XTIA 1UWAA 1RCXB 1Q7MA 2YXXA 4NZ3A 1NF0A 3TYZA 1FWWA 4W84A 1RY8A 1K70A 1U1HA 2RDUA 1WE5A 3MKKA 3H55A 1J2BA 1G5AA 3LCHA 5IXEA 1DQXA 4EK7A 1ZBVA 1OIMA 3IPWA 3GXFA 3ARVA 5KZEA 2YX0A 2JE8A 2Q6ZA 2GK1B 3BW3A 1CZ1A 1D2KA 5A6BA 3FA3A 2Z1BA 4DJED 1TIMA 3SRDA 3C8NA 3BMVA 3PN8A 4TV5A 3VO0A 4ACYA 4LCSA 1PYMA 3R89A 1FWAC 1GT8A 1EKOA 4Z2JA 5LKYA 2PDNA 1YADA 3C0SA 3TR9A 5DMYA 1Z7AA