4EF9A

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 4-nitrophenyl isothiocyanate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase
publication title Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
pubmed rcsb
source organism Leishmania major
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4ef9A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ef9A01
1VZWA 2JGQA 3QH2A 3W84A 4ZZ9A 4GUIA 4BK9A 4U4MA 5FF4A 2ZQ0A 1DQXA 4Z1AA 3FEMA 1LLZA 1GYNA 3LRMA 4X3ZA 1KV8A 1KV5A 4TU1A 2AAMA 4G1KA 3DI0A 3INPA 1PIIA 4PTNA 1IIHA 1YTKA 3LB0A 3OHIA 5AB3A 3KOFA 3NR0A 2EGZA 3G1XA 1GG0A 8TIMA 2KZHA 3IVUA 2B4GA 4RX0A 5D2YA 5L6UA 2Z1BA 1SW3A 4GUFA 2V0TA 3L0NA 4LV4A 3NQGA 4M7SA 3QQ0A 1UASA 1GJPA 4BFAA 2DZXA 4HSOA 3O6CA 1QAPA 4N4QA 1JCYA 3ZFHA 2QJGA 3NZ1A 1XC4A 2ISWA 1JRCA 3MJYA 5DBUA 4OQVA 2CLHA 5G5IA 4EVZA 2W6RA 4JEQA 3QYQA 3EXSA 5H91A 4ADUA 3DFSA 2V81A 2A21A 5K9CA 2XN0A 3W1UA 1UB3A 2WKJA 3LHUA 3TW7A 2NLIA 4OWGA 5LHEA 1JRBA 4LC6A 4ZQRA 5HNRA 4FX7A 4ZQMA 3NQ7A 4AHQA 5MHBA 4CNOA 1W1ZA 1FWNA 4JTFA 2ZA2A 4CQ8A 5KZEA 3PWAA 1ZALA 4M5PA 1OF8A 5K3VA 3TA6A 2J9YA 4NQ1A 1G4TA 2VELA 3F03K 3A5FA 5CGQA 3HB9A 5F2GA 4LVDA 1AL8A 3S6DA 2YW3A 1WQ5A 4NJIA 4JNMA 2HS6A 3S42A 4I7VA 4AEOA 1EIXA 3MHGA 5F4XA 2C0AA 4NNBA 3NL3A 1AMKA 4M6VA 1AW2A 4MJMA 1D3GA 1GVQA 3E96A 3L65A 2W0UA 4XKYB 1L6SA 3KFTA 3GKFA 1DBTA 2ATSA 3UY8A 4S1FA 1MSSA 1TV7A 3I6RA 4WX2A 4LWWA 3A24A 2JKAA 4KFPA 4WY0B 2E77A 3NQMA 1W56A 3BARA 4FNQA 4LS0A 1IXOA 3W86A 4WD0A 3PBWA 5D05A 1GTEA 3O16A 3H55A 2QCEA 3G24A 3CU2A 5AFDA 5FEWA 2X1UA 1G6CA 1SO6A 3ABRA 2RDWA 4MFDA 3QSTA 3TCEA 2CLOA 4HNVA 1R47A 4Y9AA 1O5KA 2RKXA 4RKAA 2Q3OA 3W73A 1YDOA 2YW4A 4O10A 4PODA 4IUOA 3TROA 1YDNA 3PB2A 3I68A 3G1SA 2RH9A 4LRSA 1DKWA 1GEQA 3S1WA 2NUXA 2VFHA 1VQTA 2Y88A 5HINA 4RXGA 3DXIA 3CIXA 1XBYA 2PRLA 5K4XA 1H7RA 3W7QA 2Y61A 3C4UA 2V2HA 2WJZA 4E2DA 3B8DA 3ZWTA 1DJNA 1LBLA 1DJQA 2X30A 3HGRA 3M6YA 1Q3NA 3C8FA 1BTMA 4LS2A 3W2JA 4O54A 3V75A 2Z0IA 3TKFA 1DHPA 3L68A 4JR5A 1F05A 4UTKA 3FFSA 3GDTA 4IMFA 1KM2A 3HJZA 1ZHAA 3LLFA 3E9AA 1ML1A 3MYOA 1E51A 3UXDA 1TB3A 3QW4B 3W74A 1QDSA 3SIZA 4O50A 4JICA 3LI0A 2FPVA 2C1HA 4AHPA 5DCEA 5CSRA 5H2ZA 2ZRVA 1J4EA 3N73A 2GVLA 3QF0A 1GVRA 2YFOA 1WOBA 1QO2A 4U28A 2B7PA 3FJLA 3OVRA 4EWND 5I3HA 5K7JA 3A21A 5FF2A 3C2FA 1JCLA 1YXDA 1R46A 3TK7A 4CCEA 4BI7A 1I45A 3B05A 3GVGA 3NNTA 3TIMA 1OK4A 3DENA 3WJSA 4JX5A 1ZFJA 3ABOA 1K03A 4JN6A 3LCIA 2ZZ3A 1IIGA 4HNUA 3B0UX 5KSWA 1UCWA 3ZWSA 4O0KA 4UTWC 5D04C 3N34A 4JYEA 3FJ6A 2WPBA 1CX9A 1YXYA 3OIXA 4DXVA 4BF9A 4UNLA 1H61A 4RCXA 5F2MA 4DPQA 1W3TA 1W8SA 1YYAA 5HUOA 3S0CA 4Y8FA 5AHNA 1K8YA 3LI1A 2P0OA 4LVFA 1FXPA 1SO4A 6TIMA 1HTIA 1ALDA 3VFLA 3W72A 1G4PA 1ME9A 3N9SA 4BWLC 5EBUA 3M1ZA 5C54A 4WXYA 4O4WA 3QC3A 4MZ1A 3STFA 4S2BA 1H51A 3BW3A 2DU2A 2Z6JA 5BOOA 5FEZA 1QPQA 4PC8A 3NXFA 3NAVA 3A9IA 4NX0A 3NL6A 1K7EA 1LTDA 3I7SA 1GT8A 1Q6QA 3HPSA 4JXCA 1KBJA 3EWZA 3DI1A 5D2XA 4LV9A 3NQEA 4YL2A 5D37A 1D3HA 1W3IA 2BX7A 3T55A 3DFPA 2CZEA 1FQ0A 1JUEA 4QSHA 1XXXA 3PF3A 4JTUA 3UWQA 3L0GA 5AHIA 3G1HA 1GZGA 1M7OA 4X9SA 4P2VA 2Y89A 2QCGA 3P8IA 1ZNNA 3F4NA 4RZ6A 1X6UA 4GUHA 3P8JA 3SSJA 3UZ5A 2FFCA 2G5WA 3DBPA 1W5QA 3CHVA 2C18A 5F2IA 2C14A 1OG0A 5C6MA 4KFOA 1QPOA 4M6QA 2DJLA 3NOEA 3W83A 4ALDA 1TPH1 4ZQNA 2CZFA 3L5AA 3B03A 1TYGA 3B4UA 5AHMA 1A53A 3R89A 3G8RA 3UWWA 2WO5A 2FPYA 3UWZA 1G67A 4IMDA 3N19B 4XUGA 4DF1A 1AW1A 4JTEA 1G4EA 3PBYA 3FYPA 5DXYA 1GVSA 1XCFA 1A50A 5DY3A 4QAIA 1TQXA 1KW1A 3DKJA 4K37A 1A5CA 1HL2A 5CKSA 4BI5A 4O4VA 2GOUA 4GUJA 1LRQA 1XM3A 1GVOA 1EPXA 4JYFA 2Q8LA 4NNAA 5CSSA 1LBMA 3O8AA 3R2GA 4HSNA 3TSDA 3CEPA 1LZOA 3O63A 3MHFA 3DFOA 3BO9A 5CZ0A 1VCGA 2B7NA 4JX4A 1F5ZA 3PM6A 2A6LA 3A22A 4FIRA 1LROA 3L5LA 1YXCA 2P1FA 1K8XA 3QZEA 2DZTA 4AWUA 1FDYA 1H1ZA 3P81A 3LCHA 1N7KA 2BZNA 2C16A 2YYTA 4R7JA 3VNDA 3UWYA 4UTWA 1NFBA 4AF0B 4HPXA 5HWNA 4LVGA 1HFBA 1M5WA 1WAUA 1NVMA 1EX5A 4LUJA 5HULA 4Y90A 3MMTA 3NO5A 1F73A 3HG5A 1YPFA 4P61A 4ZL1A 3GZ3A 3GDLA 2E5BA 3V1PA 1NF0A 1YTDA 3QPYA 1SO5A 1F6PA 4IGHA 2ZRXA 5LNUA 3O15A 1WOAA 1SO3A 5K9DA 3W7EA 3CC1A 5BW6A 1GG1A 3DH7A 1W5OA 1MZHA 3ELFA 2NXIA 1PS9A 4LNYA 3RNDA 3B0VC 3Q2DA 5I3JA 1NEYA 1Y0EA 3NL2A 2CU0A 1L6WA 4HN4A 4WQ6A 2BWGA 5HJLA 2QCNA 1DORA 2RDUA 3GIYA 3LV6A 2GUUA 5LNRA 3UZJA 1O95A 2XN2A 1ZCOA 3O6YX 1VCVA 4ICNA 3FOKA 3BLFA 2C19A 3P74A 2PURA 3HGSA 1WX0A 4ORMA 1H7OA 1LLWA 4GWEA 3IGSA 1IXQA 2A85A 3EEGA 1SQ7A 3IVTA 5FESA 3NPWA 1QOQA 2WQPA 3QRHA 2HTMA 4N02A 4IPJA 4GJ1A 3VE7A 2C15A 4N9CA 5A5WA 4UTTC 3GDRA 3PR2A 4TMBA 1BWKA 1FDJA 5AHLA 1OFOA 5D03A 1HUVA 4JD4A 1JULA 4MYXA 4O53A 2RDTA 3SGUA 3W71A 3W1NA 2Q8ZA 3O05A 3CT7A 2VKZG 4PL2A 4DF2A 1T96A 1F6KA 1KM3A 4OV4A 1KFBA 3T44A 1XKYA 3TJXA 1G7UA 3FS2A 3G1AA 3TJLA 5CPLA 3BW4A 3GXNA 3T78A 2EAWA 1XI3A 1O94A 2OCZA 1TJRA 4OHQA 4ML9A 1X1ZA 1RR2A 3PG9A 5LKYA 4TIMA 3STEA 4RXFA 5AC7A 4Y96A 3G1DA 2V5BA 4FNTA 1B9BA 2QCCA 4GFSA 2C13A 3N2MA 5AOUA 4E2BA 1JQVA 4FNRA 5FI8A 3OA3A 4JTLA 4XKYA 2ZBTA 1U5JA 4UTHA 1JVNA 3VKJA 3E0IA 1VYRA 3IIVA 1A5SA 1LYXA 2VFIA 4MOZA 3BG9A 5AYYA 5D30A 4UC5A 2ZZ5A 2DORA 1GVFA 2QDHA 3LTYA 5DXXA 3LOTA 4PA8A 4XBKA 1LRTA 1EP2A 4XBSA 2QKFA 1ICQA 3FYOA 4XWUA 4GE8A 3HO8A 3W75A 3W7KA 4PFMA 1H7XA 4LTSA 5HR7A 4WJEA 4LY8A 3I65A 5F1VA 3P5ZA 1DVJA 1LOLA 1XL9A 4A21A 4NZJA 1OX4B 1AG1O 2FIQA 1F7BA 3C2EA 5ABTA 4L4LA 1EWDA 1QWGA 3TC7A 3ABQA 2QJIA 4QIUA 4MY1A 4UR8A 3KVJA 3O07A 4MFEA 2NUWA 2Y63A 3QQ1A 1TPFA 1H7NA 4UFKA 5I3IA 1CW2A 2V5LA 1QPNA 5EMUA 2ZTKA 1B3OA 3BGJA 1MEWA 3EKZA 3EWWA 2D73A 4E38A 7TIMA 3C3NA 3MBDA 4JY9A 1FX6A 3MO7A 5G2HA 2H8ZA 1TTPA 2A0NA 5CZJA 2HS8A 3W23A 3NQ6A 2IQTA 1GTHA 2CLKA 4O52A 4PL1A 4WOZA 4O57A 4IWWA 3DZ1A 3EX6A 1Q6LA 4D2JA 4I9AA 4JX6A 4AHOA 3R8RA 3MP4A 2H90A 1QNVA 1KM1A 2QAPA 3C6CA 1DV7A 3PSVA 3JRKA 3A23A 5LNWA 3H54A 3LHYA 4O18A 5D02A 3QPZA 1LOQA 2EHHA 4MY8A 4Q4KA 4LVAA 5HR6A 5J5DA 3W7PA 3ZR4A 3W7MA 4OE7A 3LCLA 2CW6A 1VR6A 1SFLA 3WJXA 4FX6M 1K7FA 2F7FA 3LM7A 2CLIA 3C52A 2ZYFA 3CM4A 3ATYA 5D32A 4XQ6A 3ABSA 4B5NA 1AL7A 1TTIA 3LXCA 3HOJA 4KWVA 1TV5A 4O14A 1XDLA 2YXGA 1XUUA 4A2SA 3P61A 5K2ZA 3WK1A 3GNDA 3P5YA 1QCWA 1LDCA 3I7RA 3LTSA 4IMCA 4LU0A 1OFRA 1PVNA 3NPXA 3W7HA 3W7NA 3OVPA 2V30A 4CNNA 4I7UA 1GWJA 3EB2A 1Z44A 3CTLA 3NM3A 3DFNA 3N14A 1M6JA 2DZVA 3HG3A 4Z0JA 3TH6A 2CZDA 2X2GA 4AWSA 1G7VA 3LV5A 1GOXA 3TSMA 3M5VA 1V7YA 1W0MA 2LLEA 4GNJA 3HG4A 1K02A 3HF3A 4O16A 5HWJA 3IRDA 1OYBA 1SSGA 3IV3A 4UIOA 2WSRA 5FF7A 2GQ8A 4IMGA 2B7OA 3C61A 5IBXC 4YLWA 5CZSA 5I3FA 2JGYA 2ZCGA 1EUAA 4WOQA 1W37A 4WZHA 1YTEA 4K7VA 1SU5A 1B57A 2QCDA 4AMAA 4AAJA 1OFPA 3TFXA 3M0ZA 3RMJA 2VFEA 2TPSA 3LRKA 4NX5A 3IVSA 3DFTA 1RD5A 3GDKA 3UWUA 1EEPA 4AWTA 3PG8A 3IIOA 1YPIA 3M5ZA 1EA0A 1K8ZA 5LGZA 2V8ZA 1FXQA 1WBHA 4RR4A 1BEUA 5FF3A 1C8VA 3EX4A 3IIZA 3MYPA 1GYLA 4NUWA 6ALDA 3LRLA 3EXTA 1AW5A 3P60A 3GR7A 1G4SA 2JKPA 1KTBA 1TPC1 3PBUA 2FB2A 4UR7A 3G0SA 5G4WA 1VHCA 4RV8A 5EKYA 1EWEA 1UBSA 3W7CA 3W88A 1IGSA 1SZFA 4R33A 2QUUA 3GAKA 4RK8A 5G2IA 2FB3A 2J88A 1YLVA 5EYWA 3TMLA 2VEMA 1WV2A 1P4CA 1HG3A 2QJHA 2QDGA 4ADTA 2X16A 2WV8A 3E49A 1Z48A 1PCWA 3CIWA 3NL5A 3BLEA 1G69A 4FEZA 1V5XA 2WNNA 1GQNA 1Q6RA 2FPTA 2HSAA 4LRTA 2CLLA 3EWUA 2G95A 3QJAA 3LHWA 5J5RA 2ISVA 5BMWA 3Q94A 5K9XA 3HBLA 1OF6A 1PHWA 1JJKA 2Y6ZA 1FWTA 4X22A 3RF9A 2ZZ1A 4NJKA 2VXNA 3FKKA 3BVJA 5U7SA 3AJXA 5I3GA 4ZQPA 1Q45A 3TMQA 1XBVA 3W7IA 3TX9A 4C1KA 4IOTA 1FWWA 5E93A 4UFIA 3BG3A 5A8GA 2CZ5A 1B4EA 3W2LA 1ADOA 3W85A 5E1QA 3RK8A 3WJWA 3CLMA 4MJZA 4UFLA 3TV8A 3USBA 5D2WA 3HGJA 3THAA 5AYZA 1FCVA 2R14A 4GUGA 2W79A 3OEXA 2BTMA 3NQ2A 1FDZA 3C2VA 3NPUA 4MUZA 3W1MA 1X1OA 5BMXA 3G18A 4LS1A 3KRUA 1XBXA 4JS3A 1FWRA 4QNWA 1DQWA 3LHZA 3OBKA 3UD6A 1JCXA 3LGEA 5KITA 2QUTA 1TJPA 2VFDA 3UQNA 5IBXA 2JKEA 4IJBA 2Y7DA 1MO0A 4QM1A 4RJEA 3TU9A 5LGXA 3HIJA 3H53A 2TMDA 5G1TA 1FCQA 4EF9A 3S5NA 5HQEA 3A5VA 2DZSA 2E6FA 3PB0A 5CZTA 3SI9A 3QSRA 3W2KA 1I2OA 1RV8A 3W22A 1X8FA 4LVBA 1TRDA 3W76A 3M5XA 2NX9A 3CPRA 3KX6A 4MKNA 3T7VA 2YYUA 4HPJA 4NXSA 1DL3A 3TAOA 5AC8A 4MPQA 3NQCA 2ZRYA 4IX2A 1O60A 1VYSX 3RLVA 4DF0A 3N9RA 1X7FA 2PE4A 1F74A 3GB6A 1FWSA 1VGAA 3P62A 1J2WA 4JTSA 2E68A 4BI6A 5KZDA 2XN1A 3LCGA 1I2QA 2R91A 3R13A 3TXZA 4IXXA 3FA5A 1EP3A 2ZRUA 1VC4A 1SW0A 2OZ0A 4ADSA 3CEUA 1L6YA 5T26A 3P80A 5FEXA 4EIVA 1MEHA 4JTGA 3BK0A 3S5ZA 2V2DA 1FCUA 2OT1A 1VPXA 2E6YA 4EOUA 3NQDA 3EXRA 4UTJA 4GC4A 3G0XA 2E6DA 2NWRA 3UYCA 1OK6A 4N2YA 2VEKA 5HWMA 3LHTA 3BLIA 3KXQA 4Y6GA 2ATMA 4NJJA 4S2CA 3W87A 4BWLA 1W3NA 3GXTA 2PRHA 4N9BA 3W1PA 1OFDA 4DELA 1W5PA 3W07A 1TQJA 2A7RA 1CI1A 2I9EA 5EL1A 5F2LA 4MYAA 4O0ZA 1VHNA 1RVGA 4WXZA 2H8XA 4Z1BA 1PV8A 2CLFA 4QITA 1UUMA 4IQLA 1W31A 4ZVJA 1B4KA 3LLDA 4GRSA 4O13A 2J9ZA 2X1TA 4M7TA 1H60A 3CB8A 3GXPA 4K7YA 3S1XA 3GYEA 2QCHA 2WSYA 4FNUA 5LZLA 3LHVA 4M19A 3EWXA 2NXGA 3JR2A 4QNEA 4UTIA 2WOQA 4JIPA 2A7NA 3CWNA 2VFFA 3ANYA 3TQKA 4AB4A 1U83A 1SPQA 2DJXA 3BGGA 4MVAA 2ISSA 1OX4A 4K39A 4C1LA 1MXSA 4ZQOA 2RFGA 2YX0A 3SZ8A 1KLYA 2CWNA 2YFNA 2NWSA 2NXHA 5DLCA 1P0KA 1KFCA 1YDVA 2ZZ4A 1QO5A 2I1OA 2ZA3A 1VLWA 1TPEA 4MLRA 5DN1A 4DPPA 5D38A 3NA8A 1LORA 2PC4A 4NJHA 5FF0A 2J24A 3W7JA 4FXRA 1P5BA 4LW7A 3G1YA 4JIQA 1LM1A 1YADA 1WDWA 2YCEA 4N9EA 1KM4A 3MHUA 3SY5A 3UNDA 2NX1A 4FF7A 4KWWA 1A5AA 2Y62A 4A22A 2H6RA 4LT9A 3F4WA 3PS7A 1JQXA 2YDAA 2A7PA 3MW7A 4XTDA 3SR7A 3M16A 2QCMA 2ZRZA 5K4ZA 1PHQA 5BRBA 3W2MA 2DZUA 4MZYA 4N9DA 4HHPA 2NV2A 3LBMA 4UUIA 3STCA 3TW6A 3FLUA 3L5MA 4TX9A 3W1TA 1PL9A 3MWAA 1BKSA 2ZRWA 1OFBA 2R94A 3EX1A 2YPIA 3PSWA 2NZLA 4KFNA 1ZAJA 1P1XA 1KFEA 2NV1A 5DCBA 3B0PA 3MP5A 2ZZ6A 1WA3A 3EX2A 2CFFA 3HGOA 2P10A 4WY0A 3TSBA 3B06A 2Y85A 5GVJA 1NSJA 5DY2A 4FNPA 5CPNA 4H4IA 2OMAA 5FEPA 5I3KA 3NEVA 4ZQCA 3MBFA 3PAJA 1Z42A 1RZMA 4R53A 5DELA 4CNPA 1H1YA 1LOSA 1UJPA 2EPHA 3M43A 2E09A 4DO5A 5D33A 3L66A 3N2XA 4EF8A 4UMAA 4CCCA 3C2RA 5F4SA 3SFKA 3UWVA 3BW2A 4O28A 3WK2A 2FJKA 3NVTA 4MZ8A 1S3HA 1TIMA 1S5WA 1OFEA 2Y70A 3EWBX 5KMYA 4JTIA 5F1UA 2JBMA 4UCGA 1SFJA 2E6AA 2H3BA 5TIMA 3TQ0A 1TREA 1OABA 2Y7GA 4JYDA 2R8WA 4PCFA 5IM51 1SSDA 2QCLA 3MP3A 4H6KA 1KBIA 3W7RA 3DFQA 4LOCA 2YSWA 3GK0A 1W54A 3GX9A 4YWIA 5AHFA 4FO4A 3VCRA 4JTKA 3U6WA 3I7QA 4FHAA 3QMTA 1Q6OA 1OJXA 3NQAA 4NZFA 3G22A 4CQ9A 3LCXA 4NU7A 5LNSA 4Z1CA 4YXGA 1NF7A 3CQ0A 1KLZA 2ABBA 3DHFA 2GVGA 4Q33A 3VE9A 1ZY9A 1L9WA 3VI2A 4O1CA 2NUYA 4HKPA 2EKCA 4DO6A 1SW7A 3W1XA 2E5DA 3LXAA 4OT7A 4I7WA 1KM6A 1R2RA 1LCOA 3W2NA 4UTLA 3S1UA 1N55A 1H62A 4UTTA 3W1AA 3TUUA 4KKXA 1JCJA 4AH7A 3DGRA 3QEZA 3OG3A 1A5BA 2AGKA 1KA9F 1M7PA 3C0JA 5TBOA 1KTCA 1AK5A 3QW3A 4K36A 2ZTJA 2A5HA 3TDFA 3C56A 2CLMA 4O11A 4R34A 1QMLA 1W5NA 1UUOA 4M6PA 5C5YA 4ONVA 4Q32A 1VH7A 2HMCA 4YCPA 2FQIA 1TCDA 5AC6A 3HQ1A 3L21A 1KM0A 1NAL1 2DZPA 2ZZ2A 1RQBA 3NYZA 5KZMA 3S9YA 3LCWA 2OJPA 2VC6A 1H63A 2YR1A 4K8HA 2YZRA 4PH6A 3HMJG 3BPWA 3O06A 3SECA 2ZA1A 3BG5A 5TQLA 4HT3A 4AXKA 1KM5A 4TR9A 2C3ZA 1OX6A 2CLEA 1VRDA 3FKRA 3BV4A 1IF2A 3P84A 1BWLA 3TXVA 3GLCA 5LHFA 4NT0A 2VOMA 3NQFA 4OU1A 2Z2UA 5G2WA 4IXHA 3LTPA 3IIXA 3W2UA 4NVTA 2EF9A 3W9ZA 3W6YA 1TPUA 4A3UA 4J9JA 3G1VA 3D0CA 1OFQA 3GKAA 3O6DA 1FBAA 3SW6A 3G8EA 3LXBA 2Q3RA 3EKLA 1RQHA 2DP3A 1XBZA 3LCFA 4OGZA 3KAOA 5U4NA 1TSIA 2BLEA 4JTTA 1VLIA 5D2TA 4Z0SA 3P67A 1JUKA 2C6QA 3RLUA 2GQAA 1ME8A 1XUZA 2Z6IA 3N3MA 3L9CA 1O5XA 3KHJA 3UPBA 1TTJA 3ZS4A 3PBVA 2E5CA 3W7LA 2E1DA 3FIGA 4GBUA 3QM3A 1Z41A 1XDMA 4DO4A 1RPXA 3DKLA 1R2SA 1H7WA 1IXNA 3SGZA 1VYPX 2G96A 3HPZA 1H5YA 3TAKA 2H3DA 3QFEA 4FX8A 5EPDA 1VS1A 4TMCA 3W1RA 2B7QA 4MIMA 4JTJA 2J27A 2PCQA 1QPRA 4UMCA 3G0UA 4CCDA 4QJ1A 1TV8A 4UMBA 4MY9A 4UXDA 4AVFA 3WK0A 1PCKA 1RQEA 4RZ4A 2GPTA 2VENA 1N8FA 2VFGA 2QR6A 3LX9A 4N6EA 5C2XA 1F2JA 4JTHA 5L9FA 1D9EA 2O7SA 1SZEA 3DAQA 4MLJA 4ORIA 5G1YA 1ICPA 4K6AA 4O8RA 3NM1A 3S5OA 3G1FA 1O4UA 1DOSA 1KFKA 4RZ5A 1LRNA 3RU6A 4K38A 4HNTA 1EUNA 4PEKA 5EY5A 5D09A 2GJLA 3UY7A 3W3OA 1S5TA 3LBCA 4CLMA 1JCNA 2A4AA 4IX0A 2J9XA 1T99A 2RHGA 5F4WA 1ZAHA 2ABAA 5C55A 4GXMA 1TPVA 3S1VA 2ZZ7A 2PRMA 3GAYA 2XFWA 2Y7EA 4UFMA 3IGUA 3M9YA 4O12A 2VEIA 1ZJIA 3MI6A 2AQWA 4N4PA 1WXJA 2J6XA 4AF0A 3B04A 2QCDB 2I14A 4JGDA 3NG3A 3W1QA 3PUDA 4Z08A 3W7OA 1S5VA 1TO3A 2WNZA 3TFCA 2G97A 3M5YA 3U2OA 3P82A 3G3MA 4WUIA 3P7YA 3PC0A 2BSLA 1R2TA 1T8XA 3AO0A 3UPWA 3C2OA 3JS3A 3RFAA 1J5TA 5AYXA 1FCBA 4O15A 2YGYA 4IPIA 3WJYA 4O19A 1ONRA 3NQ8A 2GQ9A 3QMRA 3WJZA 1ME7A 3L0KA 4YMZA 4NNCA 1FUYA 1KFJA 3WFAA 3DHDA 3E02A 1XFBA 4XZ9A 4DEFA 3M41A 4N6FA 4JDYA 4LUIA 3T40A 3G3DA 4NJGA 4E0CA 1SUXA 1IXPA 3PULA 3R5EA 1GPWA 1I2NA 3EX3A 1QFEA 2QF7A 3HG2A 3TQVA 3MI3A 1PE1A 2TSYA 4POCA 3WK3A 3YPIA 2WSQA 4W9TA 3IEBA 1H7PA 2V2CA 3U8GA 1SR9A 1EB3A 2ZDRA 1R30A 2FTPA 1WBJA 5LSMA 1KTNA 2GVJA 2UV8G 3UXAA 2VEPA 5G4EA 4UTMA 1K7XA 4L4MA 4O17A 1OX5A 4TO8A 1ZAIA 2NX3A 4DBDA 3HPXA 2QAFA 2V82A 3PVFA 5BNKA 4UFHA 2A2IA 2QUVA 1FY6A 4DQWA 4A2RA 5HMSA 2B0MA 3ATZA 1EP1A 4UNKA 3TNOA 3W70A 1TPDA 3M7WA 3R12A 4UFJA 4XTIA 1T0OA 3IGXA 3NQVA 3E12A 3NZRA 1TPB1 4X2RA 4FB7A 1MEIA 2A6NA 3TR2A 4FIQA 3MUXA 3PUEA 3KVLA 1KFLA 2TYSA 3O1NA 5E0KA 4BR1A 1TPWA 3KRSA 3SJ3A 1I4NA 1P0NA 3Q58A 2GJNA 4CQAA 1OVDA 4NXKA 4FXSA 3S5YA 2FLIA 1W5MA 3KVKA 2V9DA 3GDMA 3LERA 1I2RA 1TTQA 5AHEA 4FNSA 1LBFA 3LDVA 1QOPA 3K30A 1HO4A 4DBEA 4O1BA 1OFAA 4H3DA 1JUBA 2F84A 5CG7A 4YCOA 4QISA 1OHLA 4HNNA 4WY0F 4Z1DA 5KINA 5LNVA 2A1YA 2ALDA 2BXVA 3T4CA 2X1RA 4JY8A 3EWYA 1SZGA 1F76A 1LP6A 5DCDA 2X1SA 4K8EA 3GR8A 2TRSA 3W1LA 1C9DA 5HUPA 3OVQA 4IMEA 1I8JA 3NDOA 4UTUA 2OT0A 3NPVA 3L2IA 3M44A 3KRZA 1SZNA 1I2PA 5EA9A 5CPOA 4ZMGA 2QEZA 1JCMP 3S8HA 1TMHA 2FDSA 4QQ3A 3STGA 2QCFA 3M47A 1OYAA 3W7DA 5D2VA 4HIBA 1L2UA 3L67A 3TE9A 1ICSA 3CWOX 4LC8A 3W7GA 2DZWA 1K3UA 3PY2A 3IIPA 1JR1A 3Q37A 4A29A 1THFD 2O7QA 5AN7A 1OYCA 4O1DA 3NGJA 1VJIA 1VCFA 4RLIA 1WYIA 4JDBA 2ZFAA 3DU0A 2OX1A 3TC6A 5KTLA 3KVMA 2Y7FA 4OV9A 1C29A 3MI2A 2JK2A 1QR7A 4O1AA 4OBTA 2WNQA 3F1QA 3PUOA 1HO1A 1H50A 1ZENA 5CPMA 1TRIA 3QMSA 5DBTA 3THQA 5SWUA 3GNNA
chains in the Genus database with same CATH superfamily
4MGGA 3QH2A 2BY3A 4G1NA 2WJFA 4U4MA 3F4VA 4BS0A 1JL8A 3TCSA 1HL8A 2V3FA 1GYNA 5LYRA 3LRMA 4QAWA 1M53A 2BY2A 4NZCA 1R3QA 4AEFA 3P14A 4G1KA 4PTXA 1NP0A 1IIHA 1YTKA 3LB0A 3SBFA 1E0TA 2HISA 3G1XA 1GG0A 1TZ9A 3V0SA 3PZNA 2WMKA 3LS9A 3MDWA 4RX0A 5L6UA 5C8BB 3KBJA 4F2BA 5CC6A 3S6TA 1TZ7A 1A4LA 2JEQA 1ODUA 4BFAA 4HZ8A 1QAPA 4GYPC 1GQKA 1G01A 1R38A 1XC4A 1JRCA 2ACRA 3QXBA 4PMYA 2PODA 1EZ2A 1V6XA 2IKJA 1GQJA 2OELA 2Y24A 5H91A 3DECA 4Q8MA 3IJ7A 2XGIA 3V5CA 2HNEA 4KBXA 2WKJA 2WB5A 3LHUA 4MADA 1JRBA 4LC6A 4AHQA 1UMYA 4GH3A 4CNOA 3ARTA 1ZB5A 5E9AA 3URAA 1EGZA 4JTFA 1A3XA 2XVNA 2J9YA 1A0EA 3WLOA 3T09A 3W25A 4DJFD 5CGQA 3AIBA 1Q2SA 2YW3A 3VGFA 2VUYA 3T8LA 2YKKA 3S42A 1ISWA 4I7VA 1EIXA 3MHGA 3KOYA 4KMQA 1ADDA 4NNBA 3NL3A 1UBPC 1UWQA 1AW2A 1XYBA 3E96A 1P0EA 3PFMA 2OLHA 3KFTA 4XZLX 3UY8A 4H41A 4HMDA 3ZSTA 3NQBA 4HPGA 1MSSA 3I6RA 5CAHA 2JKAA 1LWJA 2J7BA 4C1NB 3B97A 3NQMA 5GJMA 1W56A 4FNQA 3W86A 1UD6A 2OZ3A 3S3GA 3CU2A 3SCVA 1EJVC 4MFDA 1XRFA 3A4XA 3CV1A 3QSTA 1YNPA 3TCEA 2CLOA 2W63A 1GQIA 3TQPA 4YU1A 2YLLA 3UG3A 3SY1A 1QJWA 4Y9AA 4W7UA 1O5KA 4ZOBA 4M82A 3BJSA 2RKXA 3B0XA 3AWOA 4KETA 2YW4A 3QGAC 2NVAA 3SCWA 3TROA 3CK5A 2QVHA 3WH6A 4MJ2A 1DKWA 1JCTA 2DSWA 1JNDA 1TWZA 2MUCA 4LGXA 1H2JA 1XBYA 1P1MA 1GGOA 1VPQA 1BQCA 1UZDA 5AECA 3C4UA 3GDBA 2VR4A 1DJQA 4Q8VA 1Q3NA 1GOMA 1BTMA 4IIDA 4QHRA 2BODX 2Z0IA 3TKFA 3L68A 3DESA 3T2OA 3E9AA 3MYOA 1E51A 1B3VA 1QDSA 1M41A 4L61A 2FPVA 3HM7A 3TP4A 4AHPA 2VRJA 2ZRVA 1J4EA 4RL3A 3N73A 2RGMA 1QO2A 2ZX6A 2CBJA 1H0IA 4GYPA 1M65A 3FJLA 3QY6A 4TX8A 4EWND 3HJEA 3WF1A 3M0VA 1JCLA 1UP2A 5A3HA 3TK7A 3GVGA 2INEA 4UTFA 2GFTA 1F9CA 4PBEA 1NOUA 3P3BA 3WJSA 4AYGA 4JX5A 3ABOA 3MQTA 3O3RA 4ZFMA 1RY8A 4YVPA 1OCJA 3V18A 4HK7A 3N1AA 4YNGA 4XSMA 1T6MA 4XO7A 3W4RA 1KD0A 1W17A 1VFUA 3VGHA 2IXUA 4AC1X 3IJLA 5GNZA 3WEMA 4M81A 3T2QA 1W8SA 1YYAA 3C3UA 4MWAC 4RPQA 5E9XA 4XIAA 5EBUA 2CCRA 2OX4A 4F4RA 1RK6A 4O4WA 4MZ1A 3BW3A 1KR1A 2X05A 2PTDA 2ZVIA 4V33A 1QPQA 1BD0A 3COTA 3I3BA 4NX0A 4S3GA 1LTDA 4ML4A 2F6KA 3K13A 1KBJA 3EWZA 4GJIA 1CGTA 4NYUA 3KWSA 3TW9A 1IGWA 1KWGA 4LBSA 2Z00A 3VIGA 4AYSA 3T55A 2CZEA 4ATWA 1JUEA 4QSHA 3ZZ1A 3UWQA 1BPLB 4LBRA 2I57A 1ITXA 1OGBA 3G1HA 3SDOA 3N9KA 1RCXB 4A8LA 3P8IA 1ZNNA 4S3DA 1P6WA 4GACA 4RZ6A 2YZ5A 1X6UA 4GUHA 1FVPA 3SSJA 2G5WA 4I3GA 2HZGA 3DBPA 1YE6A 5TD4A 2ZUSA 2C14A 2XFFA 2WCSA 1IWBA 1UD8A 2YA0A 2FZNA 3S46A 3NOEA 4ZQNA 4AEEA 1E0VA 5BXRA 3VMOA 3UWWA 3LN3A 3UWZA 1J0HA 3PZIA 4H9MA 2Z1KA 3I6TA 1G67A 3N19B 2XZ7A 4XUGA 4DF1A 1AW1A 3BSHA 1V3LA 3FYPA 1XCFA 3E0FA 5GJNA 2BVTA 3RR1A 4F8XA 3N13A 1TQXA 1W1B1 3STPA 4HNCA 3DKJA 4K37A 1A5CA 1ESWA 3AHXA 3CL8A 3RCNA 2GOUA 3GH7A 4GUJA 2BB0A 2PWDA 2QJJA 5CSSA 3R2GA 2CKSA 2XISA 3SN0A 3TJ4A 3O63A 1LZOA 5E5CA 4IIGA 5CZ0A 1VCGA 1OBAA 4JX4A 3PM6A 2VGFA 2A6LA 1C8YA 4PMOA 4ASTA 2IUZA 1UYQA 1TJ1A 4KEMA 3HURA 4CD8A 4E4FA 3LY0A 1H1ZA 2C16A 3RPTA 1JD7A 2QJMA 4R7JA 1NFBA 4HPXA 3GVVA 3U5YA 2P50A 1SJDA 4LVGA 4QDPA 4QJ3B 3VK5A 5HULA 4ZXLA 3NO5A 3CYJA 1EBGA 4MWAA 3V1PA 2W5FA 4PUKA 1C91A 1OD0A 3O15A 3NYDA 2VC5A 2CXEA 5K9DA 1Q63A 3CC1A 4B15A 1YBQB 2ON3A 3RNDA 3NL2A 4WQ6A 2BWGA 3U9IA 1OY0A 2RDUA 3GXIA 2O0TA 4IIFA 4W8BA 3ZMRA 3KL5A 3O6YX 1VCVA 2PFHA 4A3QA 3HGSA 2D22A 1H7OA 1LLWA 3UXIA 3P0XA 4TVDA 1IXQA 4RNIA 3TYZA 3VM5A 2ZC8A 1NTHA 3N29A 4B3ZA 1CGWA 4ZO9A 1QK0A 2VZSA 1QOQA 3QRHA 4GJ1A 2PDMA 1FFQA 1KXTA 4A3HA 4LYRA 5AC5A 4D8LA 4KCTA 4JD4A 2DSKA 1JULA 2RJHA 4CU6A 4O53A 3DCPA 3PFRA 4KQNA 2ZIDA 3WLIA 3UR2A 1KM3A 1TELA 4QS6A 1KFBA 5EBAA 5A6JA 5A2AA 1V0MA 3BAIA 5DQPA 4IJCA 3WLPA 3L4WA 3SQLA 3BW4A 2AKZA 3SQSA 3XINA 1ZTVA 1O94A 4B5VA 4DWSA 1TJRA 3UPMA 1RR2A 4PRWA 4TIMA 4RXFA 3N2MA 4KCWA 3NCOA 1P43A 3WG6A 4LXFA 1DE6A 1CBGA 1XH1A 2DFAA 2WLZA 1K6WA 1RJQA 1JVNA 4GGHA 1WZMA 4C6MA 3BG9A 2VVSA 5D30A 2WVUA 2ZZ5A 2QDHA 2OEJA 4PA8A 3V0TA 1TV4A 4KGLA 4TTUA 1V3KA 3QOKA 3M7SA 2XM1A 3UZZA 1H7XA 5I77A 1FHVA 4Q8WA 1XL9A 4HU4A 4NZJA 3QPEA 1AG1O 1ZS2A 3TLQA 1C93A 1F8IA 3C2EA 1QWGA 1CTNA 4MUPA 3KVJA 3QGKC 4MFEA 5A6BA 1TPFA 4ZE4A 3MCNA 3AI0A 2ZTKA 5JBFA 1UD4A 1W1A1 3EWWA 3WMBA 7TIMA 3ZM8A 3C3NA 4JY9A 4ZB5A 3TTYA 4C7GA 3VOCA 3MO7A 4L4OA 2H8ZA 4AZHA 2HS8A 2FHFA 2D0GA 4PL1A 2XPKA 1G5AA 1VKFA 2C1GA 2W27A 4HBKA 3R8RA 4GY7A 3MP4A 3D46A 3PP7A 3C0QA 2H90A 1EJWC 1X38A 4D1JA 3C6CA 1J0YA 3JRKA 3KBNA 1IEIA 3H54A 3LHYA 1V79A 1LOQA 1X96A 4C65A 2OPJA 3W7PA 4BQ5A 4QG9A 3LCLA 5BRPA 4NASA 4GX8A 3NZQA 3UZXA 4H6QA 4MF4A 3M0HA 3LM7A 2CLIA 1RCQA 4XQ6A 3ABSA 4ZSUA 1ITUA 3CLWA 1TJ2A 1UW9A 1XDLA 1XUUA 3KE0A 4R3UA 3GG7A 3GNDA 3P5YA 1XLGA 3I7RA 4OZOA 1OFRA 2NQJA 3W7HA 2I17A 5D4YA 3UBPC 3RO8A 3EB2A 1OT2A 3DFNA 1S5MA 1Q6DA 2PSNA 2C79A 3TN5A 4Z0JA 2CZDA 1TV2A 2X2GA 1XYLA 3LYEA 3GTIA 1V7YA 4DZHA 3C8NA 1S2UA 5E0FA 3U2ZA 3S1GA 2YDQA 3SGGA 1T7LA 4J5NA 2WHLA 3C61A 5IBXC 4YLWA 2WYSA 4N42A 5CZSA 2I5QA 4C90A 1EUAA 6REQB 4WOQA 4LNCA 2D24A 1SU5A 1JYWA 1J11A 4S3KA 1B57A 2QCDA 2YDSA 3VZXA 2BNJA 2CHRA 5IOBA 2PWEA 4WHBA 1QK2A 1XF0A 2VFEA 5TF0A 1PTGA 4IG2A 3IVSA 3DFTA 3FNDA 3AMKA 3ORWA 3PUGA 4JQ2A 3IWPA 2JF6A 1K9EA 1EA0A 5LGZA 1ZP3A 1FXQA 4RR4A 5FF3A 3IIZA 3CUHA 4NUWA 3LRLA 2X0HA 2HV5A 2J78A 3PNZA 5IXEA 4MAZA 1CWYA 4UBPC 1VHCA 2EEXA 1EWEA 3N04A 3GFYA 4QROA 1GJUA 1IGSA 1GORA 4M1BA 3M64A 2E25A 4U2YA 2CWXA 5G2IA 3PJTA 1YLVA 3TMLA 3ARZA 1WV2A 1P4CA 1HG3A 1E15A 2VZVA 2QDGA 3FSUA 4ADTA 1E6SM 2IPFA 3AU2A 3GRIA 3CIWA 4UOZA 3NL5A 2PDNA 1BGGA 1F4HA 3TR9A 1G69A 2FJUB 2WNNA 1DJIA 1NWRA 3SY8A 3WDQA 1HKWA 5J5RA 4W7WA 3P2VA 3UCCA 3Q94A 1HGYA 4X60A 4IPNB 1OF6A 2ZKMX 2Y6ZA 3VIPA 3N17A 3WQCA 4EXQA 3RF9A 1JXKA 4CQDA 3BVJA 1AQMA 1PEZA 3CHDA 1CGUA 3MUY1 3WIJA 1KWKA 1GZ1A 3TX9A 4IT1A 4IFRA 1CLXA 1R6WA 1JI2A 3F5LA 4IOTA 2XH2A 4UB9A 3GNOA 1UR2A 2Y5SA 3WJWA 4H7CA 3CLMA 3TV8A 3UCDA 1PKMA 5D2WA 4XX6A 2Y5EA 3OG2A 2R14A 2IPJA 1XD0A 2MNRA 2YA2A 2ISFA 3OEXA 3S5SA 1P7TA 3NQ2A 4A3YA 3W1MA 1NM9A 1XBXA 5JUVA 4Y9MA 4UQAA 3UD6A 3MCMA 5I7GA 5IBXA 8RUCA 2Y7DA 3HIJA 3H53A 4DB7A 2XH7A 2R1KA 3S5NA 5C9RA 2PWHA 3EPMA 2E6FA 3PB0A 3QSRA 3IARA 1X8FA 1BF2A 4Z2IA 1EJXC 1P6BA 3KX6A 1QNSA 4B9ZA 2VDGA 1OGGA 1KBKA 1TFVA 3CO4A 3TAOA 1UH4A 5AC8A 2Z7KA 3CZEA 3CGTA 4MPQA 3GTFA 3UF9A 1FFRA 4DNMA 4PMDA 1XYAA 3JVAA 3PZ9A 3QLLA 3P62A 1WO2A 5KZDA 3I4EA 2XN1A 2OYLA 2R91A 3WLMA 1W9UA 3ARUA 1X7IA 4P7OA 5T26A 1G0CA 4CVUA 1MEHA 3BK0A 3S5ZA 1GW9A 4CU7A 4GLEA 3WLQA 2HROA 2GK1B 3VAVA 2ZX9A 3W82A 2E6DA 4CEUC 4JHMA 4CD7A 5FAJA 4N2YA 3FX4A 4U33A 4Y6GA 4CGTA 3PHAA 3LPOA 1TG7A 3AYSA 4N9BA 4PCSA 3CUIA 4RDWA 3W6MA 2NQLA 2J8TA 1A3WA 2EJAA 1YPXA 1WKYA 2V5KA 3KDNA 4PGLA 3VIHA 2CLFA 1T41A 3R0UA 4OOUA 1UUMA 1JDCA 3N12A 1W31A 1B4KA 1KR0A 4RNJA 4GRSA 3NO3A 3VUSA 1LL6A 1B3XA 3AZSA 4M7TA 4ICCX 3WL1A 1W1YA 1Q4NX 3GXPA 3S1XA 1NOWA 4GZJA 1TMLA 3E2SA 2WSYA 3CZKA 4FNUA 3LHVA 3V16A 2FTWA 2WOQA 1WXZA 2VFFA 2QJNA 2GSHA 4AB4A 2VR2A 1OX4A 4K39A 4C1LA 1MXSA 3GQYA 1YDVA 1PJ9A 4KCVA 2YXOA 3CV6A 2PDFA 4MLRA 3D47A 2Y5JA 4W89A 2RDXA 1PYMA 1LORA 4NJHA 1EJUC 2OSWA 2Y4SA 4LW7A 1LM1A 4PR4A 3I3EA 4N9EA 2NX1A 1GQLA 4KWWA 1A5AA 1BSLA 3WLNA 5A6SA 2ZXDA 1XPGA 2YDAA 2A7PA 5I79A 3M16A 2QCMA 5K4ZA 4HHPA 3HFYA 3TW6A 3RCMA 2Z1XA 5A8NA 3L5MA 1XIGA 2HXTA 4WRHA 1BKSA 3T0AA 1MXGA 3EX1A 3PSWA 1MUMA 5A6TC 3FVMA 2EQDA 2G3NA 1EC9A 3B0PA 4TVCA 3MP5A 3EMZA 4LAUA 4ZOCA 5DY2A 5IHRA 4FNPA 4I9JA 1FWJC 4H4IA 2OMAA 4AD0A 1B0IA 5REQB 3PAJA 1Z42A 1QW8A 3UNTA 2GUYA 4C6CA 4CNPA 4F0LA 1H1YA 2EG6A 2EPHA 3ZR6A 1W3JA 2DT2A 4UMAA 4GG9A 3SCUA 3SFKA 1A0DA 1E3XA 2FJKA 3NVTA 2Y70A 4JTIA 1SFJA 4XAPA 4Q4SA 3U2CA 3L12A 4A4AA 2Y7GA 1WDPA 2L5HA 2VQUA 4P7RA 2DIKA 4X0NA 1SSDA 2QCLA 1SFSA 1KBIA 3W7RA 4QG8A 1W54A 4YWIA 2XTKA 3VCRA 3I7QA 4FHAA 5M1TA 4YJ5A 1W1IE 3EPOA 3NQAA 3G22A 4L1WA 1UR4A 3ES8A 3MDUA 1JDEA 4BEQA 2GLKA 3URNA 8A3HA 3VE9A 4MSSA 4PMQA 3VI2A 4G8TA 2G3FA 1SW7A 1E56A 2E5DA 4O1FA 4I7WA 1R2RA 1POJA 1JZ2A 3W2NA 4UTTA 1IT7A 2DZAA 3TUUA 2WM1A 2OXNA 1B31A 1KA9F 3VIKA 2YB1A 3T08A 4FAMA 4K36A 4HOZA 3C56A 1P0DA 2QULA 1QMLA 1SZRA 3SN1A 4ONVA 2V5DA 4Q32A 4CNTA 2XIJA 4LCSA 4CD6A 5I6SA 1OC7A 3APYA 1TMQA 1QHPA 1GVEA 1X6LA 3WLKX 3L21A 4J3SA 2WC4A 4JOMA 2JEPA 1QATA 3E5PA 1D2KA 1IEVA 4F0MA 5JQ9A 4K8HA 4YTQA 3HMJG 2J8FA 2HE8A 3GVQA 1DIOA 3VKDA 3VIIA 1KM5A 2C3ZA 1RJPA 4RDZA 1VRDA 3BV4A 1F07A 2VOMA 2WMHA 2QXWA 1BQGA 4HTYA 4JAWA 2PWUA 4A05A 2J66A 3WDJA 3IIXA 1KCLA 3CQIA 4NVTA 3AS0A 2VZOA 5CBJA 1OFQA 1QTWA 3O6DA 3SW6A 4H9ZA 4H01A 2WMIA 5I03A 3LXBA 2YCJA 3LCFA 5U4NA 1TSIA 4KESA 1W9PA 3AALA 2WVSA 3RRXA 4ERIA 3H8AA 1Q6EA 2D0FA 2Z6IA 4QRNA 3WLHA 3BZJA 2O9TA 3CQKA 3L9CA 1O5XA 5A8QA 1PUDA 2EO7A 3UPBA 2WVVB 4GBUA 5I78A 2VDHA 4RW5A 3QM3A 4NZ4A 1MW3A 4DO4A 3GG8A 1R2SA 1H7WA 3SGZA 1S38A 2G96A 1H5YA 2WMGA 4US5D 3TAKA 3H7UA 3W1RA 3VFCA 2XM2A 3MB9A 4BCEA 1DJXA 4MIMA 2CBVA 4UXDA 1PCKA 1RQEA 4HHLA 4RZ4A 2QR6A 4UNIA 5C2XA 1F2JA 1KRAC 3EOSA 2O7SA 3THUA 1MRQA 1ICPA 4LSBA 4X61A 3M0LA 1H49A 1R86A 2JIEA 5CC3A 4OOZA 4HNTA 3BXWA 3WQPA 4Y8EA 1S5TA 4CLMA 2CPUA 3M0MA 2IW0A 4L9YA 2RHGA 1BVZA 4PTDA 5F4WA 1MW0A 1ZAHA 4AXNA 5KZ6A 4GXMA 2PRMA 4HZ7A 3FVDA 4E8CA 1ELSA 4UFMA 1JZ4A 4O12A 4AIOA 1ZJIA 1A80A 1E6XM 5I02A 2AQWA 3WQ8A 1AQFA 3KM8A 3NOYA 4GX9A 4YYFA 1PKLA 3H23A 1J12A 4R27A 4S3AA 3WH9A 1J0IA 3WD4A 1FP9A 4Z08A 2ZXAA 1VJSA 2WQDA 1V02E 3WEZA 2G97A 3M5YA 5CEWA 3SUUA 1R85A 5DMNA 3AO0A 2HWGA 1J5TA 5AYXA 1FCBA 2C0HA 1HKIA 3PPGA 1BRLB 3WJZA 3WBEA 1ME7A 3L0KA 4YMZA 3AICA 2BGNE 2BVWA 1DTNA 3WFAA 1AMYA 3E02A 4MB3A 4XZ9A 4N6FA 4LUIA 4PMZA 3GC2A 4ROPA 1HIZA 3DC0A 3UU0A 3LEPA 1K8CA 2FH6A 1IXPA 3PULA 1ISXA 3WQ5A 1R9YA 1GPWA 1I2NA 1D3CA 2ZVRA 2Q8XA 2QF7A 2PGEA 1W9DM 2BBFA 2WJDA 3PJXA 2V2CA 4LAOA 4UQDA 2W92A 1EB3A 1XWYA 2B81A 2VURA 3DYMA 2X2YA 3BL3A 1WBJA 1QWKA 2DIJA 1P0BA 2XG9A 5E6ZA 5G4EA 4RE3A 3CUXA 2EJ1A 2PCEA 4TO8A 2BVDA 4N7QA 3VDAA 4DBDA 5CZKA 2QAFA 2V82A 3PVFA 3RAOA 2A2IA 2PBGA 3FXGA 3NURA 5LIKX 1LT8A 4LUSB 4EPBC 3GBEA 1UD2A 3RUBL 1I6NA 3GC4A 4UNKA 3VC6A 2UBPC 1DE5A 3W70A 1XIHA 3MV11 2IKGA 3R12A 3R79A 3PTKA 1UWSA 1T0OA 3IGXA 4A8IA 3E12A 3A9BA 4X2RA 1KCZA 2QIIA 3OZMA 4U5IA 1EYWA 5FCZA 5FL1A 3GVWA 1TJ0A 4OTKA 3SJ3A 1I4NA 3WF0A 5CCZA 1TWIA 3RR4A 4JL1A 4IQEA 5EFFA 2V9DA 5AHEA 3DYPA 1LBFA 4E6MA 3LDVA 1A0CA 3K30A 2R1LA 5A2BA 5CG7A 4BQ2A 4WY0F 4GI8A 1S1RA 3E0LA 2A1YA 2ALDA 2YCKX 2PC8A 4JN8A 1C7TA 2TRSA 4I9TA 1VBRA 4Q8NA 4IMEA 3ZJ6A 1V3IA 4UTUA 2OT0A 4IPLA 2E8YA 2V68A 1CLVA 4ZBCA 1MMFA 1ISYA 1EHNA 3W02A 3R8GA 2ZUVA 4QQ3A 4H6EA 3PTMA 2J74A 4Z2GA 1QBBA 1L2UA 2ACSA 2HRWA 4DAIA 3TE9A 3V7PA 1ADSA 5IFPA 2DZWA 4PMUA 4XUYA 4X63A 7ENLA 1L8NA 1U33A 3BCJA 1VCFA 4W84A 2F2HA 4JDBA 1X8CA 5KTLA 2PAJA 5I2UA 3MI2A 1QR7A 3F1QA 4PUMA 2DT3A 2OG9A 1ZENA 4AIUA 3IRSA 1TRIA 5DBTA 5CPTA 2WMFA 3THQA 4B3LA 3DBNA 4HK5A 2SFPA 4S38A 3GNNA 2AKMA 4ZZ9A 4GUIA 4BK9A 5FF4A 3FEMA 3U2EA 4MPKA 4IM4A 2J7CA 4TU1A 5MF5A 3K8MA 4TUFA 1B54A 3DG7A 4P7LA 4PTNA 4WEVX 1AJ2A 3NSXA 3WQOA 2VUNA 2DT1A 5A95A 4XZWA 3POCA 1EQCA 3IVUA 1GYMA 4HU0A 4R7OA 2W67A 2Y1HA 1SW3A 2V0TA 2PGFA 1EGVA 1LG1A 4NP7A 5A8PA 3QQ0A 1UASA 4HSOA 1UH3A 1R5YA 3NZ1A 3MC5A 2ISWA 4OQVA 4DYKA 2CLHA 1QXLA 5G5IA 6TAAA 2W6RA 2WXDM 4JEQA 3BH4A 2PD5A 3EXSA 1YRRA 2BFGA 4MNKA 5D9MA 2J7EA 4GZIA 2V81A 2A21A 1E55A 1FKWA 2XN0A 3FA3A 4J3WA 6REQA 3TW7A 2NLIA 1N8WA 3AXKA 2ACQA 4FX7A 4ZQMA 3NQ7A 3WX7A 3HPFA 1R3YA 5MHBA 3WH7A 4FMVA 3CAQA 1J5SA 3PWAA 5C0QA 2W3ZA 4WDXA 3TA6A 2YDRA 1JF6A 2VELA 3F03K 3AXHA 1AL8A 3B8SA 1WQ5A 4NJIA 4JIRA 3UCQA 2HS6A 4Q4OA 3TYUA 1XIFA 3PN8A 2C0AA 3NEHA 4L9XA 4IUGA 4MJMA 3UEQA 1SVDA 2WHJA 1L6SA 4IJRA 2X0YA 5CJNA 1TV7A 3TJIA 1IQ8A 5CGMA 3AROA 3F5KA 4WY0B 3UA4A 5LIUX 1F6YA 3BURA 1W9XA 4LS0A 1IXOA 2GGEA 1G9HA 1V03A 3O16A 4K1WA 3G24A 5FEWA 3F5JA 3ABRA 3A47A 3SCQA 4IH3A 1MI3A 4AD3A 3KP1A 3TOPA 5ABFB 3UR8A 4LF1A 1KFWA 4RKAA 2P8CA 4O10A 4PODA 4IUOA 3I68A 3GHRA 3S1WA 3PPFA 4HZMA 4DRSA 4AW7A 2QV4A 3BCFA 3RLHA 5AKQA 4CVWA 2Y61A 2V2HA 3ARPA 1FTXA 3AIQA 1LBLA 3HGRA 5C9XA 3M6YA 1LUCB 3W2JA 4EX4A 3V75A 4D8ZA 4LB4A 2WJEA 4IP7A 4DI9A 4R7WA 1F05A 4UTKA 4IMFA 4DJDD 1ZHAA 1ML1A 1KO0A 2D2OA 4Q6XA 4JICA 3LI0A 5CSRA 3SEPA 5FSEC 3UERA 1GVRA 1TX0A 1WOBA 4U28A 4BEUA 4F0HA 2B7PA 4IICA 4EPDC 3KLKA 1J6PA 3A3HA 1RK5A 3F7JA 5BWAA 1YXDA 3NSMA 4XZNX 3BQ6A 1POKA 4AVNA 4FR1A 3TIMA 3DENA 1D7KA 4PB3A 2XZ9A 4KEVA 3QV6A 4JN6A 1IIGA 3B0UX 2JQXA 1NDVA 1XLHA 3LBOA 2GWNA 3KOWA 2A3LA 3HA1A 1XJBA 3ZWSA 3LPPA 5CGTA 4JYEA 1MQQA 2Z28A 3FJ6A 3ECQA 4LCRA 2WPBA 4HOXA 1RHCA 4H8NA 1H61A 5F2MA 4DPQA 1QRQA 4Y8FA 1XLBA 5EMYA 4JL2A 3A64A 1H0GA 4EPKA 3QKZA 5BU9A 1G4PA 1QOXA 5C54A 4WXYA 4DBWA 3STFA 4S2BA 1H51A 3GY1A 1OC5A 4PC8A 1VEMA 3CTTA 1S2AA 1K7EA 3N2TA 3I7SA 1GT8A 3IJ6A 4UQCA 4AWEA 1H09A 4ZEPA 1QI5A 3KTCA 1TVLA 3WNOA 1TKKA 3ZLHA 3NQEA 4L6DA 4E8GA 1HVQA 1D3HA 2GK1A 5EMLA 3RJYA 1XXXA 1JNEA 3BC9A 4WJXA 3PF3A 3LSBA 4PB5A 1HGWA 3G5EA 4DXXA 4J2MA 3IANA 2G4FA 4R9OA 2XWEA 3SSZA 3CNYA 5CLWA 5DRCA 5E0CA 1J79A 2WZTA 1J9YA 1XCWA 4XAGA 1OG0A 5C6MA 2Q6ZA 4JQAA 4JKKA 4DIAA 3W83A 3TYEA 4CD4A 3B03A 1HJSA 1WP6A 2OZ8A 1A53A 3VINA 2G4JA 3B40A 3IS4A 3KL0A 4EAMA 3WMCA 5HMEA 2F38A 3S2JA 1D7FA 1A5KC 1BHGA 4XVDA 1A50A 4QAIA 3JU2A 1KW1A 3AIUA 1JAKA 4S3FA 2WBGA 1FH9A 1QPKA 1EPXA 3ARXA 4JYFA 3O8AA 3CZ8A 1JD9A 4RW3A 2WMJA 4W5UA 3QHOA 3DFOA 4GYFA 1M3UA 2FZ9A 1F5ZA 1LROA 1XRVA 1EOKA 2P1FA 1K8XA 4C5ZA 4PMNA 1ONWA 1FDYA 3DIPA 4HQVA 3LCHA 3CWHA 2BZNA 2YYTA 3VNDA 4ENLA 3BZGA 1R3SA 5HWNA 1HFBA 1M5WA 5C2GA 5CPQA 1K9FA 1NVMA 4LUJA 4Y90A 2VEGA 3HQOA 1F73A 1UR0A 3HG5A 4RE2A 1LG2A 4P61A 3MMDA 2E5BA 1BWVA 2BHUA 1VRXA 3QPYA 1G1YA 1F6PA 4IGHA 3RCYA 2BGSA 5LNUA 3ZJ8A 4R5EA 2PF8A 5REQA 4DZIA 1UKQA 1GG1A 3DH7A 1DJWA 3B0VC 2NXIA 1C9WA 1NEYA 5C7VA 2CU0A 2GVYA 4J40A 4HN4A 5HJLA 3T07A 2QCNA 3VU2A 4JIEA 4F2TA 2GUUA 2O9PA 3UZJA 1ZCOA 4YTRA 1UKOA 5BWFA 2C71A 3GW0A 3EEGA 1OCBA 4JKLA 3Q67A 2HTMA 5AZ0A 1V0KA 3PANA 1BWKA 4XD5A 1OFOA 1HUVA 4GIAA 1A5UA 3W1NA 3ZT7A 3CT7A 2VKZG 3VZYA 2W91A 4DF2A 4ZTXA 1PWLA 2R9RA 4GI4A 1XKYA 5XINA 1E70M 1UIOA 3FS2A 4OVXA 4HU3A 1JZ6A 2D3LA 5CPLA 2HNHA 4G5DA 1KXHA 3WKZA 3PG9A 5LKYA 2F61A 4Q22A 3Q45A 2V5BA 3AS2A 4GFSA 4LQ1A 4F48A 4AG0A 3EA3A 3OA3A 3PBGA 3S2NA 3NFUA 3LUTA 1HJQA 4XKYA 1RSCA 2JE8A 3OGSA 2KAUC 4PBFA 2PWFA 3WH8A 1GOWA 1QNPA 3VKJA 3E0IA 1V6YA 1E4IA 3IIVA 1A5SA 1LYXA 4MOZA 4XVEA 4QSFA 4UC5A 3RM4A 2DORA 4WSKA 4AD5A 4GA8A 3WDRA 3ZVHB 1U2YA 3L2LA 1ICQA 3OW1A 1TX2A 1AJZA 4JQ3A 1V4YA 3W7KA 1RALA 4WJEA 2YJQA 5DT7A 1M68A 3P5ZA 3A13A 1DVJA 5I07A 4Q8PA 5ABTA 5DMYA 1EWDA 3CZJA 1KCKA 3V0UA 3M4HA 2WZEA 1KKRA 1OB0A 3O07A 2Y63A 1S2VA 4FPSA 3P6LA 1H7NA 4UFKA 1V8EA 2V5LA 4BF5A 1JPKA 3OTRA 3SFWA 1Z7AA 3MTWA 4GMEA 1CGVA 1RA0A 3EKZA 5C9WA 4E38A 3KBVA 4HSHA 3MBDA 2OOGA 4EACA 5T9BG 5G2HA 4KF1A 1EBHA 1TTPA 3FYYA 2ZUNA 3NQ6A 5CXPA 1K4HA 4KT2A 4CEXC 1H1NA 2DV0A 3BLPX 1GVYA 4WOZA 5FIPA 1OGSA 3WCZA 4DJED 4JX6A 3QLDA 4E3VA 4X0VA 2DPEA 1QNVA 3H2CA 2QAPA 1KNWA 3PSVA 6XIMA 1BGAA 2WVVA 3A23A 5D02A 1F8MA 4KGJA 5T8GA 4OE7A 4C6NA 1Q8JA 4J3TA 1K7FA 2PDWA 1IEQA 3N6HA 3C52A 2ZYFA 2QPSA 2XGZA 3H12A 3QR0A 3ATYA 5D32A 1ZSXA 2XVGA 4MHBA 1GEHA 3E2RA 3GZAA 1TV5A 4O14A 4A2SA 3E0VA 5IHSA 2WM0A 3WK1A 1UIPA 3L2MA 3V4BA 4C6KA 4IMCA 4LU0A 1J96A 4IISA 1KQZA 1VJZA 6XIAA 1M6JA 2VNCA 1G7VA 1HP5A 1GOXA 3TSMA 3M5VA 3VIFA 4LX4A 1G94A 3HG4A 2BP1A 5HWJA 3IRDA 1SSGA 3IV3A 5FF7A 3ME3A 3MPGA 1PZ0A 3GNPA 2JGYA 1XINA 3GG0A 3F2CA 4I90A 2ZCGA 4K7VA 4L9ZA 4Q4PA 4C6DA 4B5XA 5A6LA 4HZ6A 5EU9A 2AGTA 1EEPA 3W00A 4AWTA 4YN5A 5JU6A 1DJHA 2OSXA 3T81A 1OT1A 2BY1A 4B9YA 3ARVA 2QDEA 2ZADA 3FA4A 1K8ZA 4HOWA 2GDQA 1K4GA 4IGNA 1C8VA 3H2EA 3EX4A 1U22A 1GYLA 1BRLA 3P60A 1SJAA 3AIVA 2WNWA 3GR7A 3HQPA 4GK8A 1KTBA 2NSXA 3PBUA 2FB2A 1UC4A 3G0SA 5G4WA 4GD0A 5EKYA 1UBSA 4G7EB 3GBDA 4QCEA 3VOIA 1SZFA 4NZ5A 3GAKA 4Z2KA 1YW1A 4ATDA 2PTXA 3QQWA 2VEMA 2XIQA 1N8IA 3WNLA 2JFEX 1PCWA 2OO6A 4B92A 1EXPA 3U7BA 4PTVA 3B8WA 3TYCA 5GNXA 3BLEA 1JGIA 3SCSA 2IS7A 1B3WA 3VX1A 1AQHA 1GQNA 1Q6RA 3WLSA 4L7ZA 3QJAA 7CGTA 3LHWA 3POHA 2AMXA 2ISVA 5BMWA 2PDBA 3AOFA 2VX7A 1FWTA 2DIEA 4X22A 3NDZA 4CUCA 4NJKA 3WBYA 4LUSA 3FKKA 5U7SA 2FMNA 1Q45A 3ZSSA 1BG9A 2GWGA 4Q7IA 3TMQA 3W7IA 1QNRA 4EKJA 1JGMA 1FWWA 5A8GA 3GHTA 2CZ5A 5E1QA 4YHEA 1XSJA 4GXPA 4UFLA 2ISDA 1IE7C 3B9EA 1H5VA 3UG8A 4F0SA 1ZBKA 1CIUA 1S5NA 2ZOXA 4M51A 5JH2A 5LIWX 5JVLA 2BTMA 5FACA 1FDZA 1HZYA 3NPUA 4H9YA 4MUZA 4D6JA 3G18A 1QHOA 2RUSA 1UKPA 1Q8AA 4LS1A 3CL7A 3KRUA 1W9VA 4M29A 1FHUA 1FWRA 1Y7VA 3OBKA 2A3CA 4MAVA 1FWGC 1S3TC 4LAMA 4AX6A 1JCXA 3BQ5A 2QUTA 2VFDA 3UQNA 1KRBC 4HU8A 3S2CA 4C60A 1FWFC 4QM1A 1UWTA 3ANVA 2TMDA 3G2GA 4GIEA 4EF9A 5HQEA 3A5VA 2D1ZA 1ZZMA 1I2OA 3WLTA 5I23A 2Z29A 1O1ZA 3CPRA 5DMMA 1ISVA 1YEYA 1DL3A 1WUFA 1HW6A 1TWSA 5CC5A 1O60A 1VYSX 4XISA 4PTWA 3RLVA 2FHCA 2OKTA 3UG4A 3N9RA 1UC5A 1FWSA 1VGAA 2G3MA 1J2WA 3LCGA 3R13A 3TXZA 3FA5A 2VI0A 1VC4A 1VPYA 1REQA 4C5YA 4ADSA 2OODA 2HE5A 4JPGA 4GZ7A 3RXZA 3ITCA 4QG6A 1M04A 2GGGA 3GNXA 3N25A 7A3HA 1CZ1A 4FLSA 4GC4A 1OK6A 3REQB 1JEZA 3THDA 3LHTA 3ARRA 2XVPA 2ATMA 3W87A 4BWLA 3AMCA 1LJYA 3GXTA 4H7VA 3VGDA 1VP5A 4H19A 4DELA 3OGRA 3JZUA 3QC0A 1A5OC 2A7RA 3GG1A 4MYAA 5H8PA 1RVGA 4QJ4B 4NAEB 1EX1A 4IQLA 3SADA 4O13A 4B5WA 2J9ZA 2G3IA 3ZT6A 3CB8A 4K7YA 6CGTA 3N3TA 5LZLA 4C6OA 4M19A 2E67A 3KTSA 4QNEA 4ACZB 4C7DA 4F9DA 4CCZA 3BCDA 3ANYA 3TQKA 3BGGA 3EDFA 2CERA 1V08A 3ZXWA 4H9VA 3OQEA 4ZQOA 1HXJA 2YFNA 1E1CB 4ECLA 5LA1A 1YE4A 4GH1A 2GSJA 2ZZ4A 4FLOA 4F2UA 1VLWA 3QBUA 1ZRQA 5D38A 2I16A 1VF8A 4JEJA 2PC4A 4UOQA 5FF0A 3AXIA 3FJNA 3S4TA 3TZFA 1GUVA 1TA3A 2E0PA 4JFUA 1WDWA 4MNMA 2EBNA 3SY5A 4DUVA 5FKYA 2Y62A 4A22A 4Q8OA 3PS7A 3W26A 1ONEA 4CNSA 4GISA 1ZCCA 2NV9A 4RNFA 1US2A 2DZUA 3NXLA 3LBMA 3FLUA 3ZJKA 2PTYA 3W1TA 3M0KA 5D9OA 1MNSA 1OG6A 2ICSA 1Z3NA 2E4TA 1DIEA 2YPIA 1CCWB 3RPMA 2RAGA 3I3DA 5BOEA 2VD8A 4HD5A 2OYKA 1VEOA 4WY0A 2P10A 3FGCB 2C8NA 5LIXX 2ZXQA 1NSJA 3MV01 5T91A 2VCCA 4HA4A 1E9LA 5I3KA 1DYSA 3NEVA 4RE0A 4WR3A 4PBGA 4ZQCA 1XIEA 1K1DA 3WLLA 4DY1A 3K4WA 4R53A 3WMLA 2GZXA 4NIRA 2P3EA 2O4QA 4JFWA 4DO5A 4GYKA 1AZ2A 2J7FA 3N2XA 4EF8A 1EC8A 2AL1A 4CCCA 2PA6A 3KZSA 2XINA 3UWVA 2DEPA 3WK2A 4PMJA 4DM1A 2G0WA 4GNVA 3IACA 3EB3A 1S3HA 1TIMA 2OWCA 2RJGA 4JTAA 5F1UA 4JZ5A 2E6AA 5TIMA 3TQ0A 2AOSA 1TREA 5EMJA 4JYDA 5CJMA 2R8WA 1IV8A 1K9DA 3MMUA 5IM51 1JZ8A 4H1ZA 1KBLA 3DFQA 4JTRA 1QU4A 5AHFA 2VX4A 4FO4A 1Q5MA 3VGGA 4JTKA 2OQLA 3U6WA 2QYGA 1LUCA 2X41A 4MB4A 5H8MA 1PKNA 2WSPA 3QHMA 1RA5A 2OO0A 4NU7A 2PDKA 3LQGA 5CSUA 4HJFA 1ONXA 5M03A 1IYXA 2Y2WA 4HKPA 2IKIA 2ZXBA 3SURA 3BWWA 3GIPA 3LXAA 1LCOA 1N55A 1H62A 3W1AA 3KCOA 3VVGA 3ARWA 3DGRA 4IHCA 2WHKA 1PKYA 3C0JA 4LEQA 3TEVA 1AVAA 2VP8A 1KTCA 3QW3A 3TDFA 4O11A 4R34A 4I6KA 4GI6A 1O12A 4M6PA 2WKGA 3G6MA 3SB0A 2OWXA 1RQBA 3RILA 1WCGA 4MWAD 5KZMA 3S9YA 2OJPA 1E4NA 2YR1A 3B8IA 2HVMA 3BPWA 3SECA 4AFYA 5TQLA 2VCBA 2X42A 4K2SA 5CSYA 3CUJA 1V6UA 3FKRA 1IF2A 4NZ3A 3TXVA 4NT0A 3AHTA 3IGHX 5G4HC 2DQWA 5G2WA 2XYLA 1AH0A 3W2UA 2EF9A 3W9ZA 1BF6A 2WLYA 1E40A 3G1VA 1A47A 4ZFCA 1FBAA 4G56A 5CAKA 5FOOA 3G8EA 1XISA 3F4CA 1O6IA 2Q3RA 3EKLA 2DP3A 1OC6A 1XBZA 5JIWA 2DW7A 3PBMA 2BLEA 4CQCA 4WLCA 1FH8A 4JTTA 1E6NA 1DEDA 2R6OA 4LUTB 2ZUUA 1ME8A 2I5IA 1C3FA 1XUZA 2QGHA 4QX4A 5AYBA 4CN4A 1V3HA 3A6OA 5FAGA 3KHJA 3UXLA 2Z27A 3PBVA 3FIGA 3D6NA 1PWMA 3IJIA 4X9YA 3ONCA 4L1XA 1XDMA 1KXQA 1RPXA 4B5TA 3W28A 1LL4A 1PDYA 2H3DA 3QFEA 4NY2A 4NL1A 3UJEA 2ZX7A 3KP0A 4DWSD 2B7QA 2FDMA 3UWEA 2J27A 2PCQA 1QPRA 5H8UA 5GPRA 5JXQA 1DWHM 1IZKA 4UMBA 3WK0A 1N8FA 2BV9A 1GW1A 4N6EA 2OR2A 5DRIA 5HANA 1D9EA 2A3AA 4GO9A 3H4XA 1WNOA 3RM8A 4ORIA 4GXWA 4PYSA 4GBDA 4EWJA 2E8ZA 3AQUA 1UR8A 4H83A 3EPNA 1VFTA 2H9AA 1LRNA 4QEHA 1GKQA 2EPLX 3SRKA 2J13A 2GJLA 4H2CA 3EDKA 3AXXA 1T99A 2RGLA 4FR6A 4UQ9A 3WBAA 3GXFA 2MANA 3E5BA 2XFWA 4B4FA 1JYNA 2UY4A 3MI6A 3H2NA 1T5AA 3LENA 4N4PA 4UWMA 3WO8A 3CUFA 1OEPA 3S9IA 3PK7A 4RZBA 1XGEA 3G1RA 3PUDA 3RPDA 5A6BD 1S5VA 3OIHA 3IJDA 3P82A 3P7YA 4DZ5A 5HOSA 2BSLA 1R2TA 3VOJA 3TNBA 3C2OA 1PSCA 4JTQA 3VNZA 2W62A 4QLLA 2YGYA 4JIIX 3II1A 5CC7A 1ZBWA 2GQ9A 3QMRA 4PE8A 3VD3A 4KWSA 4BF7A 1KFJA 4FLRA 3DHDA 2X09A 1XFBA 1L0PA 1T8QA 1MFVA 3V5FA 3LLXA 2X1IA 1CXIA 4NJGA 1ZL1A 4KS0A 4LANA 1CB2A 3EX3A 1CLKA 4DWSC 3HG2A 4GFIA 4EXAA 1X39A 4YHGA 2HPMA 3QY8A 3AZRA 3IEBA 4UZUA 3U8GA 1IEXA 1R30A 2ODOA 4RPPA 2V63A 3EMQA 2UV8G 2FVKA 1ZAIA 3HPXA 5BNKA 4IMAA 4UFHA 5DF0A 3AIRA 4DQWA 3KHDA 4XV0A 2PDGA 4B3KA 2O56A 1JPIA 3AHZA 5CLTA 4XTIA 1EYEA 1TPB1 1MEIA 4GVFA 1P48A 1JI1A 5LA2A 5HXMA 1TR9A 3KVLA 2TYSA 2QVNA 2BY0A 1UUQA 3IK4A 2GJRA 2XIMA 1OVDA 4NXKA 1EO5A 4FXSA 3S5YA 2QUNA 4M56A 1AH3A 1E6ZA 3ZVHA 1QOPA 3RDKA 3RX2A 3E2QA 1OFAA 1A3HA 4H8VA 2ZX8A 4YCOA 3SO7A 4ZO7A 1CPUA 4GNKB 3EWYA 3MZ2A 1F76A 3W1LA 1DP0A 3SRHA 1C9DA 4O0QA 1I8JA 4LFYA 3NPVA 4HYVA 1OIMA 5T9CE 1FHLA 2VRQA 1D8WA 1SZNA 5EA9A 1WZAA 3MSRA 2Z2BA 3OZYA 2HVNA 2I9UA 4FSAA 3AZTA 3WD1A 2QCFA 3IJ8A 1I9CB 4HIBA 5MKGB 3UR5A 3L67A 3BMVA 4GVHA 2DH2A 5FA5A 2C1IA 3CWOX 3PNUA 2XIIA 3W7GA 1Q7QA 4HNLA 4JNZA 3PY2A 3IIPA 4WCJA 1JR1A 3Q37A 4PTMA 4OBRA 1BYCA 1IEWA 3VKCA 4O1DA 4LYKA 3NGJA 5DANA 2J7HA 2WWDA 2YCIX 2OX1A 3UJ2A 4S3EA 4O1AA 4OBTA 3VDBA 4AQLA 2WNQA 4O8AA 4ZGYA 1I75A 5CPMA 2PS2A 5RUBA 4L6OA 3QMSA 4HCDA 4ZSTA 5ECVA 2PDHA 4MWAB 1F3TA 3SUSA 1XGZA 2JGQA 1JFHA 5JH1A 1FP8A 3WQ6A 1DQXA 1LLZA 1XW8A 2PEVA 2DQXA 4X3ZA 2EPOA 5HPOA 1KV5A 2V38A 1XHGA 2AAMA 3INPA 1PIIA 3OHIA 2WZMA 5AB3A 5JBEA 1OM0A 3NR0A 1E0XA 2EGZA 4S3BA 5DFAA 8TIMA 4DLMA 3WMSA 2B4GA 4D6EA 2Z1BA 5I0DA 4GUFA 4Y9OA 3L0NA 4LV4A 3NQGA 3UVIA 1DWGM 1GJPA 2DZXA 1XGDA 1YX1A 1CEOA 2QJGA 5DBUA 3RLGA 3WNPA 1K77A 4AY8A 3U4FA 3H2AA 3DFSA 3KS5A 3W1UA 3QZ6A 5C71A 1UB3A 2XUCA 2PPGA 3R58A 3W53A 4OWGA 3GU2A 1SGJA 1HL9A 2VGIA 4ZQRA 3L4TA 4H2HA 1W1ZA 3EBVA 3PZTA 4CQ8A 1Q4WA 5KZEA 1HKKA 4NHVA 1ZALA 1OF8A 1B90A 2CIPA 2NW0A 1G4TA 3WDHA 3HB9A 1IT0A 1OIFA 4UOJA 4LVDA 4JNMA 4FA3A 6PTDA 1OD8A 5F4XA 1JXJA 3WELA 1AMKA 3BAJA 3WDIA 1XG3A 1GVQA 3L65A 3SM0A 2W0UA 3OZOA 2GDUA 3OLIA 4B2DA 3GH4A 4G7EA 3MUIA 4WX2A 3H4GA 4LWWA 1DJZA 1FWEC 4KFPA 3C86A 3T4WA 4WD0A 5D05A 1GTEA 1R7OA 1UZ1A 5AFDA 2X1UA 3G77A 5FJUA 1W2PA 1R47A 4JCMA 4AZBA 4ICMA 2Q3OA 2FZ8A 3NO1A 3W73A 1YDOA 3G1SA 1M7XA 3FN9A 2RH9A 2VFHA 1VQTA 5HINA 3A3WA 3N6QA 3QTPA 3VIOA 1XLCA 2PRLA 1H7RA 2QMKA 1WKEA 1UQZA 2VR5A 4OKDA 1VBHA 1CB7B 3U48A 3B8DA 4HVXA 3ZWTA 3KEHA 4LS2A 3CH9A 3DX5A 4O54A 4HCHA 5GJPA 2TODA 3KOXA 5EGRA 1EDTA 4DBSA 3GDTA 3KRBA 3UXDA 3QW4B 3W74A 3B9OA 3SIZA 4O50A 2A3EA 1FKXA 2C1HA 3R25A 3KCJA 5H2ZA 3LG3A 3V3WA 1Q7MA 2W9MA 4QDMA 2GVLA 3ITTA 4GQQA 3QF0A 2VD9A 2YFOA 4XD4A 3WUFA 1U1JA 3LM3A 1VENA 2Q09A 3OQ8A 1QNOA 2BHZA 5I3HA 5K7JA 3A21A 5A6MA 2ZX5A 5FF2A 3LQLA 3C2FA 1R46A 1E9YB 3B05A 4J7RA 1EHAA 3CS2A 2INFA 1OK4A 1DIKA 3ZR5A 4PEEA 1VFSA 4M8UA 1ZFJA 1EZWA 1HNYA 3BMXA 2ZZ3A 4HNUA 1GONA 4AZ5A 3ZQ9A 5KSWA 1UCWA 4JTCA 1XIIA 4QE4A 4O0KA 4UTWC 4INFA 5D04C 3B9DA 4M0XA 2D0HA 1EF3A 3GO2A 1YXYA 1AH4A 3LU2A 4A35A 1EXBA 1U1UA 4DXVA 3H4WA 4Q3MA 4BF9A 4UNLA 4HB7A 2AMGA 1W3TA 5HUOA 3CL6A 5AHNA 2NVDA 2P0OA 4EAYA 4LVFA 1FXPA 2Z1VA 1SO4A 1HP4A 1ALDA 3VFLA 2QGYA 3W72A 3EEZA 3UJSA 4URIA 3UZYA 1CDGA 3WSUA 2IQ0A 4GI9A 3RM9A 7TAAA 5FEZA 3BAYA 3TOYA 3GTHA 1AA1B 5TNVA 3NAVA 3A9IA 5LIYX 4IL2A 4U3AA 2X7VA 4JXCA 2DSVA 3DI1A 1MUWA 1VBGA 3TTOA 1LLOA 4YL2A 5D37A 3TWBA 4IZGA 3DFPA 1XCXA 3FCPA 1FQ0A 5FJPA 4IG2B 2YL6A 4HMNA 5A2CA 4LCQA 3ABZA 9RUBA 4XO6A 1LT7A 3L0GA 2A3BA 1GZGA 1GOIA 4X9SA 5LXXA 4E8DA 2Y89A 2QCGA 4KRZA 4ZOAA 2B31A 4IP5A 2FFCA 2REQB 1DWJM 1W5QA 4GQRA 1PIFA 2DSUA 3EOUA 4QFUA 3S9ZA 1QPOA 2IMRA 1E4MM 4ALDA 1VBUA 1TPH1 3UGVA 3L5AA 1B9ZA 5AHMA 1GOKA 2OSYA 3E2VA 2OVLA 3R89A 3G8RA 2BS9A 2FPYA 3O0FA 3BJTA 3H24A 7REQB 5A1AA 4YYCA 4IMDA 5JIPA 1E1CA 3AWNA 5DXYA 3W38A 4Q8UA 5DY3A 3GFZA 2CEQA 1E71M 1OCNA 5CKSA 4BI5A 3WFLA 3F2BA 4PUUA 2CBUA 1X97A 3PZGA 4QCFA 3EZ4A 2Q8LA 3GXDA 1LBMA 4HSNA 3WD3A 4MJ4A 4RE4A 3MHFA 3M0IA 3R10A 2J77A 3A22A 5M17A 3W27A 4GQBA 3IUHA 2DZTA 3XIMA 1PAMA 3T0DA 1E9IA 3P81A 2XIOA 4J27A 2FH8A 4LPCA 1M01A 1JIBA 4UTWA 4AF0B 2CZVA 3NDYA 2PDLA 1GKRA 2OEMA 3TYBA 1WAUA 4WGHA 1EX5A 4H8UA 5XIMA 2Y8KA 5M3WA 2P76A 4FP1A 1YPFA 2XHYA 1A49A 2AL2B 1P7TB 1AQ0A 5C9ZA 3GZ3A 1NWTA 4CNUA 2P3ZA 3FGCA 1RCOB 3WFZA 1WOAA 3GNRA 1HJWA 1SO3A 3W7EA 3MJMA 5BW6A 1W5OA 3ELFA 1PS9A 4HYWA 2ZC1A 4LNYA 3Q2DA 5I3JA 1Y0EA 2WC3A 4MG4A 2V3DA 1L6WA 4J3ZA 1DORA 4RUBA 1NDWA 3LV6A 5LNRA 3VOFA 2XN2A 3BLFA 2PURA 1XLDA 4D6HA 4ORMA 3PJUA 1TIWA 4GWEA 3NWRA 5JBDA 1XIMA 3IGSA 2A85A 4KIRA 1U5HA 3IVTA 5FESA 4C6BA 5FJIA 5D9NA 3NPWA 4TQTA 4MWAE 3SCPA 2WQPA 4PMVA 4N02A 3DC8A 1A5NC 3R0KA 4PUWA 2C15A 4N9CA 1KXVA 4UTTC 3GDRA 3PR2A 4TMBA 4DAFA 1CYGA 2X40A 5E6YA 5D03A 4QEEA 4QXIA 4MYXA 3VM7A 2G41A 2RDTA 3SGUA 3W71A 2Q8ZA 3VPLA 3O05A 2V69A 3UVAA 1T96A 1F6KA 3T44A 2QIWA 2BGQA 3K4DA 2ANUA 3AUJA 2DH3A 4HMCA 3HTWA 2X7WA 3M0JA 3OZPA 3GXNA 3T78A 2D23A 1UWUA 2EAWA 1XI3A 1WKDA 4W4QA 4GINA 1XRTA 2OCZA 5AC7A 3G1DA 1B9BA 2QCCA 4F66A 3OP2A 2YB4A 3R43A 5AOUA 2O4MA 3E74A 1XDJA 1WXYA 4FOUA 1JQVA 1FA2A 1QI0A 2ADAA 5HAOA 1EJRC 3TWAA 4QJ5B 4I5RA 3W0KA 2J47A 3U3HA 1XICA 1U5JA 2J62A 5CPSA 2VZUA 1RXOB 2FYMA 4C1NA 3KL3A 3TVAA 1GVFA 3WQVA 5DXXA 4NI8A 3OGVA 3AMDA 1KKOA 1MQRA 4GKTA 4XBKA 1EP2A 3FYOA 4UCFA 1W3HA 2J7DA 4PFMA 3ITYA 3P93A 3I65A 5F1VA 4R9XA 1LOLA 5M5DA 4A21A 1OX4B 1JZ5A 4U31A 2FIQA 1F7BA 1E0WA 4R88A 2GYIA 3NVDA 3TC7A 1VB9A 4BZYA 4MB5A 3SCTA 3QQ1A 4GABA 4K3ZA 5I3IA 1XIDA 5EMUA 4DWDA 1NWSA 2DUZA 3LNPA 4QR6A 3W6LA 3BGJA 1MEWA 1WZKA 5BU6A 1NFGA 1WAWA 4H9TA 4QBXA 3VNIA 4AISA 3T0TA 4D1IA 1MQPA 7ODCA 1FX6A 2XJ7A 1VD6A 2A0NA 1E73M 4FOJA 5CZJA 1XSIA 2IQTA 2CLKA 3H2OA 4O52A 4LUTA 2EG8A 4IWWA 4D2JA 4AHOA 2E1WA 1J10A 3ZIZA 4PN2A 1KM1A 3U0HA 5LNWA 4MB1A 4H7ZA 2QF8A 2EHHA 2OLAA 3WF4A 4Q4KA 2I5GA 1UP0A 5J5DA 2DVTA 3W7MA 2CW6A 2AQVA 4KCUA 3Q4DA 1SFLA 4FX6M 4Q8TA 3CM4A 5H1WA 1AL7A 3LXCA 4KWVA 1O5QA 3K4AA 2QT3A 2YXGA 3P61A 4TV6A 5K2ZA 3S2MA 2Q02A 3GE7A 4I5XA 1QCWA 3CUZA 3HU7A 3AYTA 3LTSA 3CHEA 3WQWA 4TOQA 3W7NA 3OVPA 4CN1A 3TLLA 2V30A 4I7UA 1GWJA 1Z44A 3CTLA 3NM3A 3ZT5A 1O66A 6A3HA 3O6AA 2DZVA 3HG3A 4AWSA 3HN3A 3LV5A 1W2VA 1JPHA 2LLEA 4GNJA 1K02A 3HF3A 1UROA 1OYBA 2VM8A 2WSRA 4IMGA 2YBTA 1KRCC 3M07A 2DDXA 3BANA 2XFYA 1HJUA 5HA7A 5I3FA 4UR9A 5BROA 1V0LA 4PCNA 1YTEA 3SUTA 3IK2A 4L56A 4AMAA 3E6EA 1KGXA 2VHLA 3TFXA 4S39A 4HA1A 2TPSA 3LRKA 4G2DA 4NX5A 5I3DA 5FD0A 3WZ0E 3UWUA 3CZGA 3SQMA 2Z1WA 4DJFC 3HPAA 4J1OA 4CU8A 3M5ZA 2V8ZA 3J7HA 3MYPA 1V51A 1WPCA 1ZBVA 3NSNA 1G4SA 2JKPA 2GOKA 4L5ZA 1UH2A 1IR1A 3PZOA 1M9HA 3KS6A 4RV8A 1V6VA 3W88A 1HQTA 1DQUA 3AYRA 2FGLA 4N0RA 4R33A 2G50A 2QUUA 4PUDA 1W6TA 2Q71A 1UPPA 3ZO9A 4AZCB 1EOMA 4JBRA 1ITQA 4E5TA 2FB3A 5EYWA 3PZUA 3FJ4A 2QJHA 1BLIA 1F3WA 2X16A 3E49A 1Z48A 5ABGA 1DWAM 1E72M 1RBOB 2R1NA 2V5JA 1CNVA 1QBAA 5BZAA 1FRBA 5A8OA 4FEZA 1V5XA 2YOCA 3EOOA 2FPTA 4HHMA 3EWUA 2QMJA 1AD4A 3LGGA 4WDTA 3MVTA 1ZP4A 4U5KA 1JJKA 3BSGA 1EGMA 2ZUTA 5E09A 2ZZ1A 1W32A 4IIEA 1O5RA 3AJXA 5I3GA 4ZQPA 3ZYZA 3CMGA 4PB4A 1PYFA </