4EF9A

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 4-nitrophenyl isothiocyanate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
pubmed rcsb
source organism Leishmania major
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 4ef9A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ef9A01
1DKWA 1OFOA 4RZ5A 4IX2A 3PSWA 1MXSA 5CPLA 1OK6A 2NUXA 4DF0A 2H8ZA 2I14A 3M6YA 5D32A 8TIMA 2OT1A 2RKXA 3MI6A 2DP3A 3TK7A 1G7UA 2CZEA 1GT8A 3FKKA 4AHPA 4Z0SA 5CGQA 2WV8A 4W9TA 1P4CA 4LVAA 3W85A 3LHWA 2V2HA 4O16A 5LZLA 3G3DA 4RJEA 2V81A 3DFTA 3A23A 2RDWA 2J9XA 2VFGA 1YTEA 5K4ZA 1DV7A 3ZWSA 1F5ZA 3W7QA 5HUOA 1UJPA 3P62A 5TBOA 1XM3A 2YGYA 3EXSA 3K30A 3B0UX 2DORA 4TU1A 3N73A 4XBSA 3IV3A 1DQWA 2X2GA 1QOPA 4HNNA 3O05A 1UBSA 2ZZ6A 3P84A 4CQ8A 5HWMA 2IQTA 1VGAA 3G1FA 1T96A 2DZTA 4OHQA 1P0NA 5CPNA 3CTLA 3QJAA 3NEVA 3W7JA 4B5NA 5LNVA 1OX6A 3RNDA 3S5ZA 1VC4A 3LLFA 4X9SA 3ZS4A 2WQPA 4O12A 4UNLA 3TH6A 3S8HA 1PHQA 3KOFA 4N4PA 2CWNA 2BTMA 2V2DA 4HSOA 5A8GA 1KTBA 1NFBA 2ZFAA 3HO8A 1RD5A 2A7RA 1OYCA 1X1OA 4PH6A 1VCGA 1XDMA 3N34A 1AW5A 1R2TA 2QEZA 3LLDA 4A2SA 1DL3A 4O11A 4E2BA 3W87A 4LVBA 4LWWA 5F4XA 2J24A 1OFQA 1YTDA 1GVQA 3A22A 4UTKA 3DBPA 3W9ZA 5SWUA 3LTPA 4AXKA 1ALDA 4MJMA 3TAKA 3WJZA 5K7JA 2C19A 2JKPA 1KM5A 4GBUA 5D03A 3M44A 3RU6A 1TPDA 4LC6A 3BLEA 3C8FA 5K9CA 4PL2A 2G5WA 5F1UA 2YW4A 5TQLA 2Q3RA 3CQ0A 2WSRA 5FEPA 3LXAA 5G4WA 3W7MA 3GNNA 5D30A 4ZQCA 2Z1BA 3SECA 3TQ0A 3QMRA 5EMUA 4WY0B 4K6AA 3HPZA 1H51A 3S1UA 5DN1A 3IRDA 4XBKA 3DAQA 4ZL1A 1Q6QA 3JS3A 1DOSA 3NR0A 1EUNA 5D37A 3DKLA 1F2JA 2JKAA 3O6CA 4UMAA 3W75A 5G1YA 3ZWTA 3R5EA 3GAKA 3PF3A 2I1OA 4LY8A 2GVJA 4K7YA 1RQBA 3O63A 1LLZA 1JCLA 1GJPA 2YZRA 5D2TA 1EWEA 4UTIA 2OX1A 4WY0F 3M43A 4M5PA 4M7SA 1J2WA 3O6DA 3G24A 1M7OA 4JTKA 1LYXA 2RH9A 3PS7A 4K38A 4O1BA 1QWGA 2H8XA 5LNUA 1H1ZA 3G1VA 4ZVJA 3HGJA 2VFDA 1QOQA 1VYPX 2PCQA 1E51A 2DZSA 3WJSA 3PB0A 3BARA 3G8RA 1I4NA 1MEIA 4LUJA 2NUWA 1WOBA 3L0NA 1H7NA 2WKJA 3WJWA 3W76A 2R8WA 1XBXA 2V9DA 4JR5A 4ORMA 3N19B 4JYEA 4POCA 3LBMA 1OG0A 1O4UA 3P81A 4Y8FA 1LRNA 3P5ZA 4U28A 3W1PA 1IXOA 3SGZA 3NDOA 2WSQA 3M1ZA 3M41A 1PCKA 1SZGA 4Z1CA 4ORIA 2E6DA 2FQIA 4IPJA 2QF7A 4M6PA 3CHVA 4EF9A 1PCWA 2O7SA 1JQVA 4NJJA 4MYXA 2HS6A 4XZ9A 4XQ6A 5BNKA 1PHWA 4NVTA 2Y88A 3NQGA 3L68A 3TMLA 3ELFA 4JNMA 4KKXA 3NO5A 4YXGA 1VQTA 2WOQA 1LTDA 2PC4A 1GYLA 4NX0A 4MFDA 1TTJA 1NVMA 5I3GA 3ABSA 2BWGA 4PODA 3ATZA 4CNNA 4GWEA 4EWND 3CIXA 3VNDA 1JULA 1VLWA 4UIOA 3TW7A 2PRLA 3E02A 2VXNA 2A6LA 4UMCA 5HWNA 1GZGA 1VCFA 1OABA 4JTIA 3EWBX 1TMHA 2DJXA 1U5JA 4O54A 3IIVA 2V2CA 4HNTA 3NQAA 3VCRA 1LOQA 4CNOA 5DXXA 1H7XA 4LS1A 3HG4A 3TR2A 3UXDA 2FJKA 5DBUA 5KZEA 3BG3A 1JUKA 2B4GA 5FEZA 5HJLA 1Q6LA 3DFSA 3CPRA 4MOZA 4S2CA 1EPXA 4MY9A 3W7OA 3VE7A 1R2RA 4IGHA 4I7VA 2B7NA 2ISSA 5D04C 3W1NA 2PRMA 3KVMA 4GRSA 1W5MA 1PE1A 2FB2A 3NG3A 3HOJA 3L21A 1JCYA 4GE8A 3I7RA 1AMKA 2QDHA 3M5XA 4NQ1A 1UUOA 2VEKA 3QFEA 2P0OA 5CPMA 1TQXA 1FQ0A 3FA5A 3UY7A 3SI9A 2ZRZA 3LCHA 4O4WA 1B4EA 1W5PA 3VKJA 2FB3A 3TC7A 2Z2UA 5BW6A 1OVDA 1PV8A 2J27A 3VFLA 1DHPA 4ZQRA 4Y6GA 1RR2A 2E6YA 5EA9A 2QJIA 3IGUA 3O8AA 4O28A 3SR7A 3NL6A 1HO1A 1XCFA 1H7WA 3QEZA 3N9SA 1H60A 2CLMA 3EX1A 4FXSA 1UUMA 4JTFA 4PCFA 3G1YA 4JYDA 3U2OA 4YWIA 3UZ5A 3TC6A 2Y7GA 2X1RA 3NQ6A 3STGA 1TPWA 1I45A 2RHGA 2GQ9A 3MW7A 1GVRA 3EX3A 2HSAA 4AHQA 4O0KA 3E12A 3NQCA 3CEPA 1M5WA 3EX6A 1S3HA 3PB2A 1TTQA 3NQ7A 4R53A 1FWTA 2E1DA 3DKJA 4GUGA 3CT7A 4FX6M 3ABRA 1S5VA 1LDCA 1LCOA 2TPSA 3A24A 3DZ1A 2P1FA 1TJRA 3TA6A 4O8RA 3QSTA 3GDTA 5AHLA 5CZJA 3B0VC 4UTLA 3W2NA 3GDLA 1VH7A 4NZFA 3IIOA 5U7SA 3NOEA 4UTUA 1MSSA 3PY2A 1S5TA 1L2UA 1WDWA 3IGSA 2OCZA 2PRHA 3F4NA 3STEA 5CG7A 2QJHA 4JTGA 3P80A 4R7JA 5DXYA 2E6FA 1IF2A 3W83A 4OWGA 4GJ1A 1QPNA 1WAUA 1F74A 1GVFA 2V0TA 3W7PA 5CKSA 3M5ZA 2G96A 5G5IA 4MIMA 1ZJIA 1SO4A 3BGJA 4AAJA 3KRUA 4IOTA 5CZSA 2A0NA 1TYGA 3LCXA 4PTNA 3KRSA 3MYOA 3HJZA 3UZJA 2Y7FA 4QNEA 1OJXA 1XBZA 3NGJA 1ZY9A 1SZFA 3PUOA 2R14A 3S5YA 3TUUA 4LNYA 5D2XA 5GVJA 1H63A 4JTJA 2Z6IA 4ADUA 3PBYA 2WNNA 4HNUA 3EWYA 4K36A 4MJZA 3R89A 3W07A 1WA3A 4J9JA 2PE4A 3L9CA 4ICNA 2QUUA 4FX8A 3TAOA 1FY6A 2NX3A 3B06A 1WV2A 4UR7A 3MI3A 4UC5A 1I2PA 4A29A 2C3ZA 3G1XA 2CLHA 3TDFA 1WXJA 1YXDA 2H3BA 2Y70A 4JTTA 5F2LA 3LHUA 1KM2A 3GR8A 4N9EA 4ALDA 3GXTA 2Y61A 4O13A 1BTMA 1QPQA 1VRDA 1SW3A 4DPPA 1KLZA 3GKFA 3DH7A 3GR7A 4LC8A 3HG2A 2H6RA 3G1AA 2OMAA 3QW4B 4P61A 2XFWA 5IM51 1EA0A 3WK3A 1GTHA 1GVOA 2A6NA 1SO5A 1ONRA 2BZNA 3FJLA 1U83A 3QYQA 5LNRA 3OG3A 4AH7A 1DJQA 4UXDA 4UFHA 1Q45A 1SSGA 1H1YA 3HBLA 4KFNA 2JBMA 3DFQA 2QJGA 3QW3A 1X1ZA 4BWLC 5K3VA 3C4UA 3BV4A 1TREA 3L5AA 4DO4A 1W3TA 1GVSA 1NAL1 1PS9A 3A5FA 1HO4A 5K9XA 5FEXA 4XTIA 1YADA 3STFA 2BX7A 3W22A 3AO0A 1PL9A 1YYAA 1A5BA 1KV8A 3Q94A 1W0MA 3LDVA 3NQVA 3LOTA 3WJYA 1OF6A 2X1UA 2NXGA 2Y7EA 4PFMA 2NV2A 5AC6A 4GFSA 3HIJA 3LCFA 3UD6A 2XN2A 3LHVA 1C9DA 4Z0JA 3I7QA 4IMCA 3SJ3A 1LROA 4BI5A 3VE9A 4U4MA 1F05A 4QM1A 2Y7DA 3AJXA 3FOKA 4DF1A 2F7FA 4O1AA 5CZ0A 4E2DA 1G4SA 1C8VA 1M7PA 3T4CA 3EKZA 1AL8A 1W3IA 1FWNA 3W70A 4CLMA 1F73A 3LTYA 1LBLA 6ALDA 2VFFA 1QMLA 3BG9A 4UUIA 2W0UA 5I3IA 1G67A 1VPXA 3HPSA 5FF2A 3YPIA 1L6SA 3MBDA 3PC0A 1W3NA 3MJYA 5D2YA 4JY9A 5AHNA 3QMTA 4AB4A 2YW3A 3PBVA 3GB6A 1X8FA 4UMBA 3HB9A 2DZWA 5ABTA 2Y62A 2DJLA 1XC4A 2CW6A 3TROA 3A5VA 3L65A 4ZQOA 3HPXA 3O06A 3NM1A 3M5YA 5G2WA 4BR1A 3P8JA 1TSIA 2QKFA 3NAVA 2I9EA 2QR6A 4IXHA 1TIMA 5G4EA 1XI3A 4HSNA 4IPIA 1R46A 1QDSA 3UQNA 3W2JA 4QNWA 3LRLA 3W1UA 1F6KA 2GQ8A 5EYWA 4CCCA 5AC8A 1G4TA 3UWUA 4JYFA 1EB3A 1TPB1 3S0CA 5LGZA 4EVZA 3I6RA 5F2IA 4Z08A 1YXCA 3UWZA 4O57A 2YDAA 4FEZA 3S5NA 5EKYA 1W5OA 4GUIA 2ZRUA 3SFKA 4NNAA 3LRMA 2YR1A 3DFOA 4H6KA 4RV8A 1O5XA 4GUFA 5BMXA 2ISWA 4WXZA 3LXCA 1YPFA 3W6YA 4N9DA 1SU5A 3FIGA 2A1YA 1X6UA 2C0AA 3ABQA 5LSMA 3T78A 4K8HA 3IVSA 4AHOA 4NXSA 1FCBA 3W2MA 3O15A 5C6MA 4BI6A 4N4QA 2C13A 3L67A 3GK0A 3W71A 3UWWA 3UWVA 3O1NA 1OFDA 1TB3A 4O10A 1B3OA 1ICSA 4EOUA 1JRCA 3L5MA 2NX9A 4MZ1A 3RFAA 4JX6A 2OJPA 2CLLA 3C0JA 2JK2A 3OVPA 1LRQA 1TRDA 4YMZA 1O5KA 1HL2A 1K8YA 4OBTA 1S5WA 3G0UA 3LTSA 1KBIA 3W1TA 3TFCA 1OK4A 1LORA 1KV5A 4NNCA 2ZQ0A 3V1PA 3EX4A 4E0CA 4RXFA 3L5LA 1TQJA 4WQ6A 2J9ZA 1ME7A 1LM1A 2GVGA 3RMJA 3QQ0A 3BGGA 4H4IA 5HUPA 5I3KA 4KWVA 2X1SA 2A4AA 5DCEA 4H3DA 1OYAA 3NZ1A 3M5VA 2E09A 3P82A 3LERA 3M7WA 3P60A 2G97A 1W5NA 4OQVA 3UNDA 4LV9A 4UFLA 3L66A 4M7TA 1PVNA 2FPYA 3EWZA 4Y9AA 3TSMA 3NM3A 5FEWA 1T8XA 2ZZ7A 3MHGA 5L9FA 4QISA 1HUVA 3NPWA 1NEYA 4A2RA 3MI2A 3CC1A 3W3OA 1OFBA 3O07A 4NXKA 3NQEA 2QCNA 3CIWA 3LV5A 2CLKA 3GXNA 1G6CA 4FXRA 4X3ZA 3HG5A 4QAIA 1G4EA 5I3JA 1ML1A 1LBMA 3LM7A 4GUHA 1IXPA 1ZCOA 2YYTA 1NF0A 3B4UA 4CQ9A 3BLIA 1W56A 2ZA3A 1ZAHA 2QAPA 1GWJA 4O18A 5KTLA 1CW2A 1K7EA 4JEQA 3TX9A 1THFD 5BMWA 1Q3NA 1JUBA 1TPFA 5FF3A 4ADSA 3W7RA 4L4MA 1JUEA 3W7DA 2C16A 3TE9A 1DVJA 3FS2A 3SW6A 1G7VA 3U6WA 1RPXA 2DZXA 1QFEA 3E96A 4WUIA 4S1FA 4O53A 2ZRXA 1P1XA 1V7YA 4O50A 3UXAA 2CU0A 3LXBA 4JX5A 3UY8A 5HQEA 3E9AA 1KFJA 3ZR4A 3PR2A 3T44A 2FFCA 5HWJA 3NQ8A 3TIMA 2PURA 3UWQA 1A5CA 2HS8A 5LHEA 5MHBA 1GTEA 4O4VA 6TIMA 3OA3A 3Q2DA 4IJBA 3MHUA 1WYIA 3C2VA 1KM6A 1AL7A 4EIVA 1ZFJA 4JDYA 3A21A 4GC4A 4O0ZA 2ZA2A 4S2BA 3WFAA 4DBEA 3QQ1A 2NX1A 4WOQA 4YL2A 3N3MA 3H53A 5AHMA 3DHFA 3QC3A 1GG1A 1DORA 4FNQA 3DFNA 2FTPA 2EKCA 3WJXA 3NNTA 1L6YA 3GX9A 4CCEA 2ZDRA 4LUIA 3LRKA 3GDKA 1SUXA 1VCVA 3SSJA 1OF8A 3R12A 3QH2A 4JIPA 3QSRA 4XKYA 3P74A 3CB8A 4DBDA 3SIZA 2FIQA 4IMDA 5IBXA 2W6RA 3W7HA 3HGOA 2NWRA 1FX6A 1LBFA 1BKSA 2GPTA 3PUDA 2F84A 4DF2A 5DELA 3GIYA 1H7PA 1JCJA 3QPYA 1TV7A 4MZYA 1RZMA 2A7NA 4RR4A 3KVKA 2FDSA 1N55A 1W54A 2ISVA 2TYSA 4NJKA 1GG0A 2B7PA 3E0IA 2CZDA 5KZMA 1FXPA 4JIQA 5HR7A 4A3UA 2E5DA 4QSHA 4HPXA 1GEQA 1IGSA 1JCMP 2CZ5A 2VEPA 5AC7A 2ZRVA 1FWSA 2FPVA 5LNWA 3PSVA 5U4NA 1K3UA 3GYEA 5TIMA 3U8GA 1YDNA 3RLVA 3GNDA 2ZTJA 4G1KA 4IQLA 4MZ8A 1Z42A 4AEOA 4Z1BA 4Z1DA 1EEPA 2WPBA 4M6VA 4O52A 1TRIA 2V82A 3I7SA 3NXFA 3QMSA 5F4SA 3MP5A 3O16A 1W5QA 1XFBA 5EBUA 3JRKA 4Z1AA 4K8EA 3MYPA 3GDRA 4UFJA 4RCXA 1XKYA 1EWDA 2YX0A 4AMAA 2D73A 2B0MA 1QCWA 3CEUA 4AF0A 1KBJA 1LOSA 1VYRA 1W1ZA 5E93A 4UNKA 1FWRA 3KFTA 4O17A 5D02A 4ZQPA 1VS1A 3ATYA 4FNSA 3INPA 2GQAA 4JD4A 2ZTKA 2EPHA 4ZQMA 4BWLA 1JQXA 2VFIA 2ZRYA 3NQ2A 2QCFA 2G95A 3QM3A 2C18A 1KFLA 4NUWA 4MLJA 4LRTA 5AHEA 1AK5A 1W37A 3EWUA 1K7XA 2RDTA 1M6JA 3P5YA 4FF7A 5K4XA 5CSRA 3L0KA 3W7KA 4LT9A 5FF0A 1F6PA 3ZFHA 5KSWA 2OZ0A 5C5YA 3LCWA 1KA9F 2X30A 4UTJA 4TMBA 2B7QA 4TX9A 2NWSA 5EY5A 5T26A 3KAOA 4OV4A 5EL1A 2DZUA 3TW6A 1A50A 1TPC1 5AFDA 1KM0A 5AB3A 1I2OA 4JTEA 3LI0A 4K7VA 3W73A 2YFOA 5H91A 1FCVA 5F2MA 4NX5A 5DY2A 3Q58A 3THQA 3NZRA 4P2VA 4DO6A 1TV8A 1YXYA 2ZZ5A 4N02A 3CWOX 4HT3A 1XL9A 3F4WA 1FDYA 1K03A 2QCMA 1FCUA 4JXCA 4WXYA 3WK2A 1QO5A 2BLEA 1SO6A 4LVDA 5AHFA 5AYYA 3OIXA 1TV5A 3SGUA 3LCGA 3NL5A 1VLIA 3DENA 2ZCGA 4IMFA 2CZFA 1BWLA 1JCNA 3EX2A 2Y63A 4FNTA 2Y6ZA 3DXIA 3W1LA 3C6CA 1G69A 4QJ1A 3W7IA 2ALDA 2E6AA 3F03K 1OHLA 2XN1A 4X22A 3C2OA 1G4PA 1A5AA 4TR9A 5AYZA 1K8ZA 3M0ZA 1HTIA 1K8XA 4LVGA 4ZMGA 3GXPA 2AGKA 1C29A 4FNRA 3B04A 3R13A 1EX5A 4QQ3A 3G0XA 3N9RA 4FIQA 1Z41A 1VHCA 3BW4A 3PBWA 4NU7A 3KVJA 5LKYA 5AHIA 3KXQA 2QCCA 2ABAA 2LLEA 1RQHA 1RQEA 3IIZA 5HMSA 1R47A 2GJNA 2CLIA 2NLIA 1ZAJA 2QCGA 4NZJA 4LU0A 3IEBA 3QZEA 2NXHA 4FX7A 3T7VA 2H3DA 2J9YA 4LW7A 3PAJA 1Q6RA 5K2ZA 3STCA 3HGSA 3DFPA 5G1TA 2DZPA 4HKPA 4JGDA 2TRSA 3FEMA 4CCDA 4NNBA 4MFEA 1A5SA 4QIUA 4JICA 5FF7A 1LP6A 4WOZA 2Y85A 3KRZA 4LVFA 4GUJA 3TXZA 1HFBA 5FF4A 1VYSX 3LB0A 4WJEA 3G1HA 4MY8A 1FDJA 2CLEA 2YCEA 1R30A 3PM6A 3FYOA 3A9IA 5KITA 3MP3A 1TPVA 5CPOA 1P0KA 4JDBA 1KM3A 1TPEA 3PWAA 2UV8G 1BEUA 3TCEA 3TJLA 5LNSA 4E38A 1OYBA 1GQNA 3N2MA 3G1DA 3MBFA 2R94A 4FHAA 4MYAA 4TO8A 2ZZ2A 5KZDA 3DU0A 1MZHA 2TMDA 4NJIA 4FB7A 3BW2A 2GJLA 7TIMA 3CLMA 3EWXA 1KM4A 3CWNA 5L6UA 3TNOA 2KZHA 2C1HA 3EB2A 3TV8A 5CZTA 4O19A 1ZAIA 2A7PA 4TMCA 1I2NA 4RZ4A 1UASA 4UFMA 2WJZA 1XDLA 3MMTA 3RK8A 1KTNA 3GDMA 4I7UA 1K7FA 3EEGA 1B9BA 1FBAA 2QAFA 1D3GA 1KTCA 2QUTA 1JRBA 3NQMA 1T99A 1F76A 3P7YA 5DLCA 3LCIA 4YLWA 3F1QA 5DBTA 4DXVA 3W7GA 4C1KA 2P10A 2ZYFA 4RZ6A 1SW7A 1ICQA 3OBKA 3RLUA 2NXIA 2B7OA 3IIXA 1I2QA 3B0PA 3MUXA 2ZZ4A 3H55A 3KVLA 1SZNA 1VHNA 1Z48A 3W2LA 1MEHA 1ZHAA 4Q32A 5AOUA 4BK9A 5AYXA 1VJIA 4JX4A 4HIBA 3T40A 1ME9A 1AW1A 3KX6A 4OU1A 1RVGA 5BRBA 1FUYA 1IIHA 5DCDA 5F2GA 4FIRA 4KFPA 4GXMA 5E1QA 4L4LA 2CLOA 3PBUA 3IGXA 1JCXA 3WK0A 1OX4A 4UTWC 1JVNA 2OT0A 2QUVA 2VKZG 4TIMA 2H90A 5FI8A 5G2IA 3LGEA 4CQAA 4DELA 4WY0A 1MO0A 2VELA 1LZOA 1SQ7A 1OFEA 3P67A 3H54A 4D2JA 4JTUA 5AN7A 5E0KA 2Z6JA 3C61A 1PIIA 1Y0EA 3I65A 4YCPA 4LRSA 1DQXA 1OX5A 3EXTA 4N6FA 4AWSA 3W74A 3P61A 4NJHA 3EKLA 4UFIA 4UTHA 4ML9A 4XTDA 1QPOA 3W72A 4WD0A 3HMJG 1FXQA 2GOUA 2YSWA 3NA8A 4WZHA 5DCBA 3TMQA 3NL2A 1H5YA 3GLCA 4R33A 1QAPA 3FLUA 2E5CA 4MKNA 4UCGA 3S9YA 4UR8A 4OE7A 4NT0A 3LX9A 2CLFA 5C55A 2AAMA 3MWAA 1TJPA 2VEMA 2YPIA 4OT7A 2Q8LA 4HN4A 1MEWA 2EHHA 4MUZA 5D05A 2A5HA 2EAWA 3NL3A 4MPQA 4BI7A 1Q6OA 5D2VA 3S5OA 3LHTA 2QCEA 2EF9A 3G8EA 3O6YX 2E77A 4I9AA 2V5BA 3W23A 3LV6A 2FLIA 3NPUA 4DQWA 1VR6A 1XUUA 2TSYA 1ADOA 4OGZA 3TSBA 3FFSA 4EF8A 3NYZA 3W7CA 1J5TA 1XBVA 2EGZA 3TKFA 1GOXA 1TPUA 4YCOA 2JGYA 5IBXC 1GPWA 3LHZA 1H61A 1UCWA 4MY1A 2A21A 4KFOA 4A21A 1B4KA 4UFKA 3P8IA 2X16A 2QCDA 3W2UA 5I3FA 5I3HA 2RFGA 4LS2A 4M6QA 2GUUA 2V8ZA 5D2WA 3MHFA 2JGQA 1O95A 1YTKA 3PVFA 5HULA 1DBTA 5J5DA 5HNRA 5DY3A 1TTIA 3G18A 3TU9A 4ZQNA 2WSYA 3UPWA 1IXQA 1DJNA 1IIGA 4HHPA 5G2HA 1T0OA 3PULA 1CX9A 1JJKA 5BOOA 1KFCA 5EPDA 3IVUA 1A53A 3DGRA 1SFLA 4UTTA 3G1SA 4Y90A 1N8FA 1L9WA 1P5BA 3C2RA 2WNZA 2E5BA 4JS3A 4LOCA 4XWUA 1Z44A 4AVFA 2Q8ZA 1SW0A 1LRTA 3W2KA 2X1TA 2VENA 3GZ3A 2YYUA 1BWKA 1B57A 3THAA 1SSDA 4HPJA 3ANYA 1EIXA 1KFEA 2Y89A 1D9EA 4IWWA 1AG1O 4N6EA 1AW2A 4LTSA 4N9CA 3DI0A 2JKEA 3C2EA 4ONVA 3NQDA 4RXGA 4C1LA 4PEKA 2BXVA 3W7LA 4IMEA 3OVQA 3OVRA 3QPZA 3PG8A 1ME8A 3N2XA 1NSJA 5LHFA 1ICPA 3OEXA 3BVJA 3GVGA 3M16A 3LI1A 4FO4A 1X7FA 4IMGA 4R34A 2V5LA 1YDOA 4RKAA 3TQKA 2VOMA 2NV1A 1R2SA 3FKRA 3HQ1A 3GAYA 1VZWA 3T55A 4BF9A 2J6XA 3G0SA 3PUEA 4LV4A 1XBYA 3NPVA 1ZENA 2Q3OA 4IX0A 3BG5A 3I68A 3V75A 1NF7A 2ZBTA 3RF9A 4UTWA 3BK0A 3HG3A 4DPQA 4WX2A 4N9BA 1EP1A 4UTTC 3C56A 1QPRA 4K39A 2NUYA 2QCHA 1KFKA 3WK1A 4O1CA 1FDZA 1W31A 1JR1A 3UPBA 1KFBA 4KWWA 2A85A 1LLWA 3USBA 2DZVA 3QRHA 2BSLA 2RDUA 3IIPA 3R8RA 3G3MA 3LCLA 4MVAA 2QCLA 1I8JA 2HTMA 2ZZ3A 4RX0A 1SO3A 3TSDA 1FWWA 2CFFA 3SZ8A 3S1XA 2V30A 3VI2A 4IUOA 1N7KA 4CNPA 1WOAA 3CM4A 3PG9A 3MO7A 4HNVA 1WQ5A 4Q33A 1ZALA 1TO3A 4RK8A 3S6DA 3DHDA 3HGRA 3GKAA 2QCDB 3DI1A 2GVLA 1EP3A 3S1WA 4M19A 1TTPA 2YXGA 2WNQA 2Z0IA 4K37A 2VFEA 4O15A 2VC6A 3UWYA 5FESA 3MP4A 4IXXA 3C3NA 4OV9A 3W1QA 5K9DA 1ZNNA 2C14A 2O7QA 3NQFA 3W88A 3W86A 1J4EA 1YPIA 5C2XA 1D3HA 5A5WA 1KLYA 1F7BA 2W79A 3B05A 4A22A 2R91A 4QITA 3M47A 1OFAA 1SR9A 3S42A 4XUGA 2HMCA 3W1XA 3D0CA 1TPH1 1H7OA 1WBHA 1RV8A 3S1VA 4XKYB 2ZA1A 4LS0A 1H62A 3FYPA 1GYNA 4DEFA 2FPTA 3BW3A 1KM1A 4PC8A 4JTHA 2VEIA 4JTLA 1OFRA 3HF3A 4BFAA 1W8SA 2YFNA 5D33A 2DU2A 4NJGA 5KMYA 1XUZA 2NZLA 3B8DA 2ZRWA 2AQWA 3W1RA 1XXXA 4JN6A 3EXRA 4Q4KA 1EUAA 5CSSA 1IXNA 5C54A 1SPQA 3LHYA 5HR6A 3JR2A 3B03A 5F1VA 3W1MA 4PA8A 1OX4B 3W7NA 3R2GA 3Q37A 4ZZ9A 1YLVA 3IVTA 1WBJA 1QR7A 2WO5A 3C2FA 1UB3A 4ADTA 3TQVA 4JTSA 1CI1A 2XN0A 1LOLA 3L2IA 1EP2A 1QNVA 3QF0A 4FNUA 2C15A 5D09A 3W1AA 1L6WA 3BO9A 1FCQA 5KINA 1I2RA 3KHJA 1OFPA 3ABOA 3E49A 3OHIA 5HINA 4MLRA 1SFJA 4RLIA 5F4WA 1QO2A 4Y96A 4I7WA 3NPXA 4PL1A 4X2RA 2E68A 1H7RA 1TCDA 2A2IA 4AWUA 3LBCA 4O1DA 4AF0B 4AWTA 2ZZ1A 4GNJA 3M9YA 2ATSA 3CU2A 4JY8A 5LGXA 3TXVA 2C6QA 1KW1A 1WX0A 3EWWA 5D38A 3SY5A 3W84A 2ABBA 4DO5A 4FNPA 3BLFA 2J88A 4O14A 2ATMA 2QDGA 3L0GA 4N2YA 3TJXA 3BPWA 3N14A 3C52A 3W7EA 1H50A 3FJ6A 3G22A 1YDVA 2VFHA 1V5XA 1K02A 1SZEA 3TFXA 1O94A 5J5RA 3UYCA 1HG3A 5H2ZA 4UTMA 3NVTA 1O60A
chains in the Genus database with same CATH superfamily
1A3WA 1DWFM 4H9YA 1OK6A 1TJ2A 4D6GA 4FPSA 4B91A 2QGYA 3M6YA 8TIMA 4P8WA 2GJXA 3DERA 2RKXA 4R9XA 1C93A 4CN6A 2CZEA 3NXLA 4AHPA 4KWOA 1KGUA 3TN3A 1UKPA 1XR2A 1P4CA 1V3IA 4JTDA 4O16A 4B92A 5LZLA 1W9BM 3G3DA 4RJEA 1XLAA 1ZS2A 1YTEA 4AIEA 1XPGA 5TBOA 4FR1A 1B9ZA 4WKFA 4TU1A 4W5ZA 4L9XA 3VIKA 4JTQA 1Y5VA 3ZJ8A 4XBSA 1E5NA 1PX3A 4I3GA 1UIPA 1A80A 8XIMA 3WELA 4S39A 4OHQA 3QJAA 4B5NA 3S5ZA 4O12A 4R7OA 1EGMA 4IIGA 1AA1B 4MMWA 3CJPA 3I3DA 1GQJA 5M03A 4HSOA 1US2A 1NFBA 2ZFAA 4CVWA 2A7RA 5DT7A 4CVUA 1WPCA 1X1OA 1VCGA 1XDMA 1XWYA 2VI0A 3CZ8A 5RUBA 2WC4A 1AW5A 1UR0A 2BVWA 1GYMA 4M80A 1DXFA 1MMFA 2VCBA 4NHVA 4E2BA 4A2SA 1XD0A 3W87A 1DXIA 1BSLA 4IG2A 3LTPA 3QN3A 5HNNA 3TAKA 3WJZA 3UJEA 3M44A 4YVXA 1TPDA 1XS2A 1QI2A 2D23A 4LC6A 5F1UA 1B54A 2ZVRA 1TVNA 4CGTA 3V36A 5FEPA 3LXAA 1RALA 3GNNA 2A3AA 2W4XA 4ZQCA 3UEQA 4XAGA 4LAUA 2OU4A 1EJRC 1UA3A 3KBNA 1EHAA 3S1UA 3U57A 2WZEA 3ZT6A 3DAQA 2DSUA 2GJRA 3KLKA 4GZIA 2AMGA 4WIWA 1UROA 3UBPC 4LEQA 4KW2A 1NY1A 3GAKA 3AWNA 5HNTA 4LY8A 2GVJA 1RQBA 4UQBA 3WZ0E 1GJPA 1TFVA 5D2TA 4DJEC 3G2GA 4QLLA 3QZ6A 2C91A 3VGBA 4F9JA 4M5PA 1J2WA 4XZHA 2J79A 4JTKA 4ICMA 1LYXA 3V18A 4O1BA 4QRNA 1QWGA 2PODA 5LNUA 4PB3A 3DDMA 3L0NA 1H7NA 2WKJA 3WJWA 1QUMA 2V9DA 1EGVA 3N19B 3AYVA 2QYGA 3P81A 1O1HA 4FLOA 4AD4A 4KWUA 3NDOA 1E4IA 2I5GA 2WXDM 1KXQA 4YNGA 2REQA 3M0IA 4EPDC 4DWSD 4ORIA 2YJQA 5A6SA 3F5JA 3A9BA 5DRIA 3RO6A 2FQIA 2QF7A 4M6PA 3I6EA 3P0WA 4RNFA 4DZAA 3WUBA 1HJWA 2CKSA 2OSYA 1PHWA 2XH0A 2Y88A 3IK2A 4F2UA 2CBUA 1FWAC 4ZSUA 2VT0A 4JHOA 1R6WA 4INFA 4YTUA 1HF6A 4AISA 2WOQA 3CUZA 1LTDA 2PC4A 2W66A 3ZLFA 1GYLA 2WHMA 2ZXDA 3NZGA 1U1HA 2X8RA 4PODA 4W7UA 4M81A 3T09A 4MNKA 3G6LA 2WB5A 1GQLA 2A6LA 1VEMA 3AWOA 4S3BA 3EWBX 1U5JA 2GK1B 4CNOA 5DXXA 1CBGA 4LS1A 3TOYA 1UWUA 3UXDA 1XIDA 5FEZA 3SCVA 4BF5A 4L5ZA 1Q6LA 4QDMA 4TX8A 4WVXA 1EPXA 3W7OA 4QCFA 1UZ1A 2B7NA 3U7BA 2DV0A 2PSNA 4E8CA 3VDHA 4OIFA 2FB2A 1ENUA 2Y2WA 4XIMA 4ROQA 2P0OA 1MFUA 1FQ0A 1TQXA 3FA5A 4QG6A 4CN1A 5C2GA 1B4EA 1EBHA 3H2FA 3VKJA 5BW6A 4HJWA 2J27A 3NURA 4ZQRA 3MUY1 5CCZA 5CPTA 3O8AA 2O55A 5FCZA 3CQHA 1GZJA 2ALRA 4KCWA 4PBEA 4K2SA 1YMYA 1H60A 1JZ4A 2XDFA 2EPLX 4OVXA 4QAWA 4KF1A 3G1YA 3U2OA 4ZODA 1Y65A 1GVRA 2V5JA 1JZ3A 2XIJA 1RSCA 3L4WA 4G8TA 1TZZA 3NQCA 3PB2A 7ODCA 1MNZA 1TTQA 1FWTA 2WYSA 4RNHA 4Y9NA 1F4HA 1LCOA 5IFTA 3WLHA 3A24A 2ZUWA 3DZ1A 1TJRA 4ZE4A 2ZXAA 3WUGA 1GW9A 3QSTA 6A3HA 1XGDA 4PMUA 4B4HA 3W25A 3W2NA 1TR1A 3GDLA 1XPYA 1EJSC 1VH7A 3IIOA 3KL3A 1X6LA 1L2UA 1V6TA 1WDWA 2DSVA 2NVAA 3LM3A 2OCZA 2PRHA 5FA5A 4V28A 4L9ZA 4CD5A 3ARRA 3P80A 1HKMA 5DXYA 1IF2A 1MI3A 1I0BA 4EPKA 1TELA 5LIXX 1QPNA 3EZ4A 4LBUA 4L65A 2V0TA 5CKSA 1P0EA 2OWXA 4UTFA 2ONEA 1P6WA 4ES4A 3ONCA 1SO4A 3KRUA 3RM4A 5CZSA 3TYCA 1TYGA 3EMQA 2FYMA 4G7FA 5EMKA 3HJZA 2QQ6A 4WDTA 1EIBA 2DIEA 3MKVA 1ZY9A 4WDWA 4Y9PA 4NP7A 3OLIA 3PUOA 4LNYA 4MM1A 3D46A 4FSAA 3WO8A 3TTYA 2Z6IA 5AZ1A 2HBVA 3GU9A 6ENLA 4HNUA 4K36A 1WA3A 2PE4A 1Q8JA 2HNHA 1FY6A 2NX3A 3VKAA 1XYMA 1DWAM 2VX6A 2CLHA 2Y70A 2ZX7A 1VB9A 2QDDA 4B2DD 3UJFA 1KM2A 4N9EA 3A47A 1BTMA 4JPGA 4W85A 4UQEA 3GR7A 3CV7A 5D9PA 1OT1A 3G1AA 3QW4B 4P61A 1AQHA 5KETA 2VTFA 2V38A 3HA1A 4CEUC 2P0IA 5I2UA 5CC5A 4NIRA 1BXNA 3KEHA 4D71A 1Q45A 2JF7A 2NT1A 2ZX9A 2PDKA 1H1YA 2QUMA 2R1PA 5A6BD 4QS5A 3VGGA 4BWLC 2HQAA 3VIIA 1Z89A 1TREA 2C1GA 4OBSA 4GCAA 3A5FA 5GJMA 5K9XA 1YADA 4B90A 5AC4A 4AX6A 3UG8A 1W0MA 3EWDA 3LDVA 3EPOA 3PZ9A 2VEGA 4OUIA 4PUEA 2NXGA 4LAZA 3H4XA 4PFMA 1UC4A 4DYJA 4GFSA 1BVZA 5E9XA 3LCFA 4HA4A 4IIHA 2XN2A 3LHVA 1C9DA 4JTCA 4ZOBA 3VIGA 4JFWA 1IHIA 4GI6A 4RDVA 3W28A 4DYEA 1JYXA 1XGEA 1JYVA 2R9RA 4O1AA 3AYRA 1JAKA 1M7PA 3FN9A 3THUA 3SCOA 1HJUA 3E74A 4CLMA 1J6PA 1CGTA 4MHBA 2QMKA 1WZAA 3W82A 3GNRA 2VFFA 1PKYA 2G3FA 2KX9A 5FF2A 4JNZA 1H0GA 4NI8A 2I17A 1BSIA 4S23A 1E6SM 4LB4A 1TCMA 2YW3A 3PBVA 3GB6A 1X8FA 4HU0A 4UMBA 4A8LA 4HZ6A 4FK9A 1ISYA 4TV5A 4JKMA 3M0MA 4H1ZA 2YBTA 3O06A 3U2EA 3N11A 3P8JA 1W9DM 1TSIA 1WXZA 2XFYA 3IUIA 1XYCA 3FHAA 5FJRA 2I9EA 2QR6A 3VMNA 1TIMA 5G4EA 4HSNA 4IPIA 1R46A 1J0KA 4QR6A 1A3XA 3UQNA 3LS9A 4QNWA 3W1UA 5EYWA 4CCCA 1XQKA 4JYFA 5BU9A 1RJPA 4C7GA 3I6RA 4NAEA 4Z08A 1YXCA 3S5NA 2F2HA 3FV9A 2FVLA 3S46A 3BZGA 2YR1A 1OGGA 4H6KA 4PEEA 4GUFA 3UA4A 1W91A 1UW9A 1I6NA 4GZJA 1EJ7L 4N9DA 1SU5A 3FIGA 4F0LA 2C0AA 3ABQA 1FCBA 3SRDA 3L67A 4YU1A 3UWVA 3N2TA 3O1NA 1EXBA 3AQUA 4DZHA 4EOUA 5H1WA 3L5MA 2NX9A 2HNEA 2OJPA 1UD6A 1MW3A 3OG2A 4YMZA 2ZX6A 4XO7A 3LPFA 2AKMA 3K5XA 4I6VA 3RCNA 4LF2A 3JZUA 3PAOA 3PBMA 2OSWA 3LTSA 3WNMA 3TFCA 2O4QA 1IT8A 3PZUA 4NNCA 4BJHA 3BAKA 1L2QA 4CKQA 1FH9A 4LBRA 5I3KA 1Q66A 2W62A 5DCEA 1YDYA 2GK1A 3P82A 3LERA 1R38A 3ZJ6A 4C90A 4EE9A 1H11A 1FA2A 2MUCA 3ABXA 4DO7A 1T8XA 3GUGA 5L9FA 1LQ2A 2V5KA 2VX5A 3U2ZA 3PZMA 1C3FA 1HXJA 3NPWA 1JDCA 3MI2A 4XD5A 3CC1A 4ZE5A 3W3OA 3MA8A 3NQEA 2QIIA 1G6CA 1A5MC 2OGYA 3U4FA 1ML1A 4GUHA 3EDJA 3I4KA 1PWMA 3BLIA 4U10A 4UR9A 2ZA3A 1ISXA 1HJVA 5KTLA 4NY2A 1W1VA 5BMWA 1V8EA 1JUBA 3CH0A 2VGGA 5FF3A 1XICA 2DGAA 4K68A 5DX7A 2G0WA 1LG1A 4L4MA 4MWAA 3WDHA 1UHVA 3TE9A 1DVJA 2GUYA 1G7VA 4NZ3A 2DZXA 1GQKA 1P1XA 1V7YA 1CCWB 1X38A 3UXAA 3AXXA 3UY8A 2PBOA 1KFJA 1UWTA 3ZR4A 3PR2A 2FFCA 5D9NA 3W37A 3PPGA 5A8PA 3QGVA 4NRSA 5MHBA 4X63A 1GTEA 4O4VA 1RXOB 1AH0A 1VBHA 2FMNA 4C5ZA 3CO8A 3OP2A 4V27A 2WBKA 1VFHA 2ZA2A 3GVRA 3WFAA 3VNMA 3WH6A 1EYWA 4WOQA 1DP0A 4YL2A 5IDZA 2X1IA 3DHFA 1GG1A 2FTPA 6CGTA 3CUFA 3GX9A 3BMVA 2QXWA 1SUXA 3SSJA 3KWSA 4QP0A 4XKYA 4M0XA 4BF7A 3VCNA 4G9PA 4DBDA 1YBQA 4HCHA 4C6BA 1FOBA 4AC1X 2Y24A 4QLJA 1UZ4A 2W6RA 3A4XA 1XIEA 1NOFA 3P0XA 2GPTA 3PUDA 2VMFA 2P53A 3N4AA 2DUAA 4BCEA 2FDSA 4IISA 2TYSA 4NJKA 2B7PA 2WMHA 3NO1A 4A3UA 2E5DA 4HPXA 1JCMP 3S1GA 4LALA 4BY3A 3PP7A 3E2SA 5U4NA 3QGKC 1OSEA 3EEZA 2O0TA 1PZ3A 1SGJA 1BF6A 1WDQA 2PBGA 1QU4A 4DM1A 4G1KA 3S6TA 4MZ8A 3S2MA 4GG9A 4Z1DA 1GGOA 2Z4GA 2VQTA 3IUHA 2C1IA 5F4SA 1B90A 1B31A 4MB5A 3MKCA 5EBUA 5E6ZA 1XKYA 4GY0A 1S2TA 3AMCA 2VX4A 2YX0A 3VD9A 1J79A 4AF0A 2JIEA 3MSYA 4NL1A 2FGBA 4HA3A 3MQTA 1VIWA 4FNSA 1DJWA 2GQAA 2OOGA 2AKZA 3BLKA 3NQ2A 4TVUA 4Z2JA 3QM3A 1WCGA 1RPKA 4LRTA 3N12A 4PTWA 1FWFC 3EWUA 2RDTA 1M6JA 4IL2A 5C7VA 4B9ZA 3W7KA 1Q5MA 5FF0A 3VIOA 3WH5A 2AGTA 2VUYA 4E4PA 4W8LA 3XIMA 4NG3A 4U33A 4AZGA 3WF2A 2FZDA 3PNUA 4MWAB 2B7QA 3V35A 1LWHA 5E09A 4OV4A 3VC5A 2A3BA 1A50A 1WUFA 2WJFA 5AFDA 2WMIB 1UP0A 1I2OA 2HJPA 2PP3A 3D6NA 4F3HA 3I6TA 4K7VA 3W73A 1XSJA 1FCVA 1TUFA 5DY2A 4C6PA 3Q58A 4H6RA 2ZZ5A 2FVKA 2VWSA 4BKNA 4H8HA 2VGBA 3OQ8A 2OYMA 1VKFA 2QCMA 2XIIA 4JXCA 2UY4A 2YCLB 4L4OA 4EWJA 3HJEA 5A8MA 2E28A 1TV5A 3WQPA 1ONWA 4AY1A 5C9WA 1KXTA 3IV8A 3DENA 3ARXA 4GYPC 1JCNA 4FNTA 2Y6ZA 4IFKA 4DWDA 3QXBA 2ALDA 2E6AA 3AFBA 3KDNA 5C9ZA 2INEA 2HE5A 1A5AA 5AYZA 1R3QA 1HTIA 2NQHA 1K8XA 3GXPA 2Y4SA 1ZGDA 2AGKA 3T0DA 1C29A 4KWSA 3B04A 3C8NA 1EX5A 4QJ3B 2XSBA 1VAHA 2EBNA 1UMYA 2HEJA 3PBWA 3Q45A 5AHIA 1YE4A 4REQA 3IIZA 2I7GA 4RE4A 1R47A 2GJNA 1WDRA 2CLIA 3FGCA 2NLIA 5C70A 4LU0A 3IEBA 3W29A 2NXHA 1XYLA 3DFPA 1J8VA 2TRSA 3OLGA 4H9MA 5AYIA 5HMEA 2C8NA 3N3TA 4PUUA 2WZHA 4GYJA 3HMCA 1OD8A 3BC9A 2DDXA 5FL0A 1M9HA 4C6FA 1HFBA 3LGDA 2X0SA 1XRVA 3WH9A 4MY8A 3QV8A 1TMLA 3T07A 4DUVA 3WD0A 3PM6A 3FYOA 3QOMA 4YTTA 3F5KA 4W84A 1ZCCA 4DJDC 2PDUA 4PFHA 1P0KA 1LWJA 2XU2A 1BEUA 3TCEA 3TJLA 3G1DA 3MBFA 4NJIA 3BW2A 3CYJA 4UOZA 4GY7A 3EB2A 3H21A 3ONBA 4GZEA 4QTGA 2VDHA 3LUTA 4GYFA 4F66A 2HISA 3MMTA 1AQMA 1VPQA 3E38A 1FBAA 2XIMA 3MANA 3SSZA 2EO7A 2VP8A 1V3HA 4PYSA 5DBTA 3W7GA 2P10A 1SJDA 2PTYA 1ICQA 2ZZ4A 2OR2A 3H55A 1VHNA 1Z48A 5FJPA 3WQOA 4B15A 2I9UA 1PJ9A 1ZHAA 2VR4A 5AYXA 4E5TA 1V6YA 3T40A 2G37A 4F79A 4GI4A 5DCDA 2C7FA 1AJZA 1PEZA 3QYSA 4LYRA 5HMDA 4FIRA 4P7OA 4KFPA 4GXMA 4YN5A 1DTUA 3WFZA 1E40A 4MNJA 2ZE0A 2WVTA 3IGXA 6REQA 1EYEA 3RMEA 4TIMA 3KTSA 4CQAA 1UWAA 4AEEA 3SQLA 1MO0A 1LZOA 4PCSA 5HOSA 3P67A 1IYXA 1TA3B 1XCXA 3L4YA 1TMQA 1MVYA 1PIIA 3NYDA 1DQXA 3SCPA 3W53A 4NJHA 3EKLA 3T81A 2R82A 3RAOA 1FXQA 1VFMA 2QVNA 4LJ3A 4ERAA 3TMQA 3R43A 4MWAE 3NL2A 1H5YA 4R33A 3ANUA 4FLQA 1E56A 4QJ4B 4NT0A 3LX9A 2AAMA 2XHYA 2VEMA 3B9AA 1UQZA 3IWPA 3RX3A 1FKWA 2Q8LA 1TWZA 2XZ7A 3APTA 4MUZA 4IUGA 4MPQA 4NZ1A 1VEPA 3LHTA 3O6YX 4I9AA 4C65A 4XV0A 3F2CA 4M56A 4G6CA 3L4UA 1XP3A 1QI0A 3UJRA 3WD1A 2JGYA 2QW5A 4ICCX 4AZ7A 3L4XA 3L4VA 4RUBA 1QI5A 1OCQA 4UFKA 2HK0A 3WMBA 3TNBA 1DJYA 3MHFA 3CHFA 5HNRA 1CGWA 1W2VA 5DY3A 2NSXA 4LCQA 5G2HA 3W27A 1T0OA 2NQZA 3E2QA 2Z28A 4KCTA 4GO9A 3Q4DA 5FJTA 1C7SA 3MUIA 1RJRA 4UTTA 1SFLA 1HP5A 4C6NA 1N8FA 3E0WA 1L9WA 3C2RA 3CASA 1CXHA 2Q8ZA 1SW0A 3W2KA 2X1TA 1BWKA 4DWSB 3ANYA 2IKJA 1GOWA 5I09A 1HW6A 1SJBA 1D9EA 4HHLA 1AG1O 4J3ZA 3THCA 4LTSA 1J11A 4N9CA 3DI0A 3WF0A 3E0FA 3HN3A 1VIZA 4ONVA 3OTRA 3NQDA 1BTCA 1ECQA 1JGMA 3TTQA 1V79A 4C91A 3M0XA 3AU6A 4HK5A 1ME8A 5LHFA 3AHXA 4H83A 3BVJA 3LI1A 1M04A 2V5LA 2ZX8A 3NSNA 3QTPA 3H2NA 4HD5A 1R9YA 1R2SA 3AYTA 4GI8A 4J3XA 1VZWA 2FZ8A 3G0SA 1CGVA 1XBYA 5I6SA 1XIHA 4PTDA 1A4MA 4I5XA 3KS5A 4UTWA 3HG3A 4DPQA 3U7VA 1EP1A 1GPFA 4EANA 3CAKA 2J74A 1QPRA 2QCHA 4O1CA 1W31A 1JR1A 4WGXA 1YPXA 5IRPA 4J5NA 2PGFA 2Z26A 1KFBA 4BQ4A 1JPDX 3IGHX 4QCEA 3VKBA 1VF8A 2BSLA 3DCPA 4PR4A 4M6UA 3RCMA 3R8RA 4DLMA 1DE5A 2ZZ3A 1QK2A 5FJOA 2DUXA 5HPOA 2CFFA 3S1XA 2V30A 3GTHA 4IUOA 3UXKA 1RH9A 3PG9A 4HNVA 1EO5A 3IJLA 2R24A 4HPGA 4RK8A 3S6DA 3HGRA 3VUPA 3VNKA 3GKAA 2VR5A 4D8LA 3DI1A 3WKZA 4MWAD 5ECVA 1U33A 4LAOA 2WNQA 1PBGA 3N2CA 3UWYA 3VFCA 3MP4A 3FSUA 3L4ZA 4US5D 1T8QA 3CAWA 2O7QA 3W86A 4H2HA 2FMOA 1KLYA 1F7BA 5I00A 3AZTA 3LD5A 4A22A 3RUBL 3GSMA 3M47A 3CB3A 3BQ5A 3CT2A 3GY1A 3PJTA 2YA1A 1SR9A 4QEHA 2HMCA 3AS2A 2PGRA 4GIAA 1H7OA 1WBHA 5DF0A 2DSKA 1QI3A 2HBXA 1H62A 1GYNA 4HZ7A 2FPTA 1K8CA 2JEPA 3ZJKA 4H9UA 3ICJA 3WLPA 5D33A 2DU2A 1Q7QA 2NZLA 4R88A 1MNSA 2REQB 4AD1A 1MDRA 3PBGA 1JZ7A 2BOEX 5E0FA 4B4FA 4WKHA 1O5RA 3ISIX 4P8VA 3EXRA 5D9OA 3ZZ1A 1EUAA 5CSSA 2EKGA 3UZWA 2VRKA 4KT2A 1WXYA 4W8BA 1BXCA 1YBQB 4V33A 1J9YA 3W7NA 5I23A 3NQBA 1WBJA 4Z1YA 4JQ3A 4H7CA 3LG3A 3TQVA 2XN0A 3VNYA 4OOUA 2D69A 3W1AA 1I2RA 4BEQA 6PTDA 3KHJA 2QGHA 3ABOA 2EJ1A 2OODA 1GOIA 1SFJA 1PPIA 3BZJA 5F4WA 4XSMA 4YTQA 1IEXA 2V3FA 3M7SA 1HVQA 1TCDA 4AWUA 2GGEA 3H7UA 1RA5A 4IFKB 2YZ5A 2ZZ1A 3A4JA 4GNJA 1EF3A 2ASHA 2Z1KA 2AAAA 1VEOA 2D3LA 1WX0A 1CEOA 2V67A 3KTCA 5D38A 1US3A 2PDCA 1CB2A 1CGYA 2CXGA 3WEZA 3BLFA 4BHYA 2ATMA 3M0LA 3BPWA 1JL8A 3VXGA 1OZMA 3W7EA 3G22A 3QR3A 1YDVA 3I3EA 2JALA 1FHVA 1K02A 1TE6A 1O94A 4JCMA 4E2OA 1W3HA 3VZZA 3RRAA 2GVYA 3MU7A 2XWEA 3UXLA 3PSWA 3ARWA 2NUXA 2VZSA 3AS3A 4DF0A 5HJXA 4MKVA 2YL5A 2DP3A 2G8ZA 3W38A 4WJXA 3BCJA 1G7UA 1HGWA 1GT8A 3FKKA 3LK6A 2QV4A 3UERA 1QJWA 5CJMA 3W81A 2PWHA 3GVWA 4W9TA 4LVAA 2BY1A 2V2HA 2GYIA 1E0UA 2V81A 4GACA 1KCLA 4UQCA 3VPLA 3DC0A 2ZUNA 2RDWA 4Y9MA 2VFGA 1CENA 2OQLA 1F5ZA 2YDRA 3KHDA 3B8SA 4AD5A 1YE6A 5BZAA 3N18A 3KDOA 3WIJA 2DORA 3AMLA 3TA9A 4J1OA 4QFUA 1DQWA 2X2GA 4HNNA 3B40A 1NU5A 4CD6A 4W7VA 4G2DA 2DZTA 1P0NA 3BAYA 3CTLA 5ABGA 4IQDA 1OX6A 3RNDA 4K1GA 3ZS4A 2WQPA 2EPOA 1PHQA 1ZJHA 4N4PA 1GNXA 2CWNA 2FHBA 4G7EB 5A69A 2PTDA 1V93A 3H6OA 4XISA 1J6OA 4L1XA 3ARPA 3E5PA 4CNSA 5I06A 3N34A 3ECQA 3OGVA 4F2TA 3WQCA 1L6GA 4O11A 4LVBA 4NSBA 3GXFA 1OFQA 1YTDA 2X40A 1GVQA 3VD3A 3GR4A 3DBPA 2OQYA 3W9ZA 2VYOA 3H4WA 5DMMA 4AD0A 5K7JA 1KM5A 4GBUA 3RU6A 3BLEA 3EA2A 5K9CA 4C6OA 2G5WA 3CQIA 2Q3RA 4YTSA 2J7EA 4KMQA 3W7MA 4GVHA 5G1MA 4DUOA 2WNWA 2PI6A 4K6AA 3HPZA 5BXSA 1J0YA 2PA6A 1QRQA 3H2EA 1Q6QA 4OZOA 4JL2A 4C60A 1PXGA 3AUJA 3NR0A 5JH1A 5DFAA 1WDDA 2JKAA 4UMAA 2G4JA 5CQ1A 1SR0A 3R5EA 4C7FA 1UD2A 3KBJA 1XISA 2W91A 1JCLA 1EWEA 4UTIA 1XV8A 3O6DA 1QPKA 2RH9A 3PS7A 6TAAA 3FK4A 3VU2A 3R6IA 2VFDA 1XIGA 4TVCA 2DZSA 4AZ6A 3PB0A 3BARA 1I4NA 4LUJA 3QC0A 5I0DA 2R8WA 1XBXA 1W8GA 4S3KA 1E0WA 4Y8FA 1LRNA 4U28A 3SGZA 2WSQA 3R58A 4FLRA 4LCRA 2X0YA 3EDKA 2WW5A 1EJVC 2HVNA 1QBBA 3H24A 4XUYA 4D8AA 4GVIA 4KCVA 1JQVA 4FS9A 3SRKA 3VGHA 5CLTA 4NJJA 4MYXA 5JUVA 4XQ6A 3BJTA 5BNKA 3BXWA 1J0IA 1O66A 4NVTA 3WDQA 3ELFA 4H00A 1NDZA 4KKXA 4X0NA 4P7QA 1T41A 1B3WA 4LANA 1VQTA 1N82A 1NM9A 3S83A 4NX0A 1I0DA 3WQFA 4Q8TA 3HM7A 2J7HA 3EPNA 4YVVA 4CNNA 3CIXA 3VNDA 3GZAA 3TW7A 4M29A 1GZGA 2XH2A 1KQZA 1OABA 4JTIA 2DJXA 3MVIA 2VZVA 3IIVA 3W4RA 2V2CA 5BXTA 1LOQA 2HROA 5GQBA 4JHZA 1UBPC 4HTBA 3BG3A 5CXPA 4MUPA 1NOUA 4PCPA 3F7JA 3DFSA 1R85A 3MT1A 5GPRA 1KNWA 1NELA 4IGHA 5D04C 3W1NA 2PRMA 1E1CA 2D2HA 4EPEC 1PE1A 3F2BA 1GHRA 3HOJA 1JCYA 4V1YA 3K4DA 3M5XA 1UUOA 1SM9A 3A3WA 3FA3A 5C9UA 3H8AA 3QFEA 5CPMA 4PZVA 4IGMA 1AZ1A 1Y8BA 3TC7A 1DIEA 2Z2UA 2VZOA 3VFLA 2QJMA 5EA9A 1EDQA 2VC5A 2ZWZA 2BGQA 3SY8A 3NL6A 1HO1A 3PZVA 2ON3A 1H7WA 2FJUB 3EX1A 1UR1A 1Z7AA 4JTFA 1E6ZA 1IZKA 1JPHA 8XIAA 1XLBA 3TC6A 2Y7GA 3STGA 3NQ6A 1TPWA 2RHGA 3EX3A 2HSAA 4AHQA 4AU0A 2YCIX 2WLZA 1KR1A 4NAFB 1UD3A 2ICSA 2OVLA 3ITGA 4R53A 3WCZA 4TTGA 4B5UA 1ITUA 2W67A 1VFLA 3TVAA 4QE1A 2DVXA 2TPSA 5EBAA 4C6DA 2OSXA 1OIFA 1MXGA 3GDTA 5CZJA 4UTLA 3FJ4A 2V3EA 3NOEA 4RE3A 1VFTA 3BGAA 4AXNA 2W3ZA 4XD6A 1S5TA 3PANA 1H09A 2QPSA 4CNUA 3P14A 2NQ9A 3STEA 5A1AA 4B5XA 5CG7A 3WLQA 4JTGA 3MCOA 4R7JA 1CECA 4GJ1A 2V63A 2E4TA 4FOUA 1HGYA 3F5LA 3MTWA 4GY1A 4E8GA 1F74A 3UZXA 1OC7A 4F0HA 2G96A 4MIMA 3P3BA 4DJED 1H41A 1ZJIA 4LQ1A 4Z2HA 2IUZA 2A0NA 3KRSA 4HZ8A 2Y7FA 2A79A 2OLAA 1XBZA 3NGJA 4LX4A 1ZUAX 1DWHM 1IWBA 5D2XA 2CEQA 4JTJA 4Q8MA 4ADUA 3PBYA 2WNNA 4FZIA 3R89A 1KWGA 3IJIA 3QHMA 3DG3A 1KKOA 4F0SA 1Q7ZA 1CGUA 2QUUA 4PSRA 3TAOA 1GCYA 1V03A 1AZ2A 3LY0A 1RCQA 4UC5A 5H6HA 5FAGA 1I2PA 3TDFA 1WXJA 3DC8A 3KL0A 4FI4A 1K9TA 3D5HA 3LHUA 1GVIA 3GR8A 4ALDA 5CGMA 5HQMA 1JZ8A 3C0SA 4O13A 1MQPA 1V51A 3ARYA 5I3DA 1K6WA 5IXEA 4QHRA 4XAPA 3VC6A 3LU2A 4ZXLA 1Q6EA 3GH4A 4HA0A 2XFWA 3AS0A 1EA0A 2BZNA 1ONRA 1SZRA 3QYQA 2XUCA 4UXDA 1E71M 3WMSA 2ZUVA 2JFEX 2J78A 1W3LA 3G1RA 3GG7A 3HBLA 2PGEA 2JBMA 1R86A 3QW3A 4RE0A 1AFSA 2CXEA 3C4UA 1QASA 5IOBA 3RHGA 2CBVA 1JCTA 5A6JA 5EMLA 4E2VA 4DO4A 4EK7A 4XD4A 1AODA 5CH9A 1HO4A 3JW7A 4JL1A 4XTIA 1F3WA 3AO0A 1A5BA 1KV8A 1GHSA 3Q94A 3NQVA 4L64A 1OCNA 1OF6A 4RNJA 3QGAC 2NV2A 4GINA 4AZCB 3M0JA 3QQWA 3I7QA 1Q13A 3SJ3A 1SJAA 2TAAA 2CYGA 4M24A 4QM1A 3RJYA 3B8WA 3GG0A 1AVAA 1IEWA 1F3TA 2D2GA 4H7VA 2RGLA 5CC3A 3WLLA 1C8VA 5DRCA 2CCRA 2X41A 3EKZA 2CESA 3W70A 2ZUMA 1QW8A 1XFCA 1XDJA 2J7DA 3LTYA 4L61A 1G1YA 3TQPA 5BOEA 2QUNA 3KZSA 3BG9A 5I24A 4UUIA 2W0UA 3ES7A 3I10A 4JZ5A 1Q6FA 1TV3A 4KETA 7CGTA 3AYSA 5FAJA 3PC0A 2WHKA 3OGRA 4FLSA 5AHNA 4J35A 4AB4A 2V3GA 5A2AA 3TYUA 2Z7KA 4GVFA 3O6AA 5BXRA 3TROA 1G5AA 2FZMA 1JPIA 3HURA 3NM1A 4LUSB 1N8WA 2RJGA 2VVNA 2QKFA 1R3YA 5BU6A 3KOWA 1POKA 1P6CA 4HU4A 9RUBA 4IXHA 1XI3A 1BYCA 3LRLA 1F6KA 1CWYA 2BY2A 2UWFA 1G4TA 2EPKX 1XRFA 2E25A 3S0CA 2WAGA 5LGZA 3P2VA 4EVZA 2XH7A 4ATDA 1GVEA 3E2VA 3VOJA 2WMIA 1Q8AA 4ZB0A 5EKYA 2VJXA 5DMYA 3B3DA 4IIEA 2VURA 2ZRUA 3SFKA 4NNAA 2ZUSA 3DFOA 2E3ZA 3K2GA 1A3HA 4WXZA 2GWNA 3EBVA 5CC6A 3T4WA 1R8LA 3H12A 4QS6A 4ERGA 1X6UA 5AZ0A 4FALA 4K8HA 3W2MA 3LPOA 3GK0A 4GBDA 3UWWA 1OFDA 4HOZA 1B3OA 4Y9OA 4XIAA 1JRCA 4GXWA 3OLEA 4MZ1A 3RFAA 4JX6A 5XINA 4P5UA 3LMYA 1E1FA 4D72A 2XG9A 4U5KA 1O5KA 2YLLA 3BAXA 4URIA 3WY1A 1HL2A 4OBTA 3FXYA 1XLLA 3T8LA 3G0UA 3BE7A 4H04A 2GDQA 1X98A 3GG1A 5BXPA 2WMFA 3CZKA 3V1PA 1B1YA 3VOIA 4RXFA 3L5LA 2J9ZA 1LM1A 1F07A 4H4IA 1X96A 1XRTA 3N2OA 4CU8A 4H3DA 1OYAA 3NZ1A 3M5VA 2WLYA 1CGXA 2ZC1A 4OQVA 3UNDA 4W8AA 1Q4NX 3L66A 4Y9AA 1GOMA 2ZZ7A 1H3GA 4QISA 7REQA 1HUVA 5EMMA 2MANA 4A2RA 5ABEA 4I8DA 3UCCA 2QCNA 3GFYA 2W63A 4FXRA 1G0CA 1G4EA 5I3JA 5I07A 1R87A 1F3XA 4OKDA 1IXPA 1ZCOA 2YYTA 1GEHA 3UGVA 1WZLA 2QIWA 3B4UA 4CQ9A 1W56A 1RLDA 3SCTA 1ZAHA 4LGXA 4HGXA 4GCXA 2OKOA 3TX9A 2IPGA 5C9XA 3F4DA 1V6UA 1CLKA 3K8LA 1SJCA 5DO8A 2JE8A 3S6OA 3MKKA 3K1DA 2GGIA 3TZNA 2C16A 1E9YB 3QV9A 3FS2A 4KRUA 3SW6A 3ZVIA 3U6WA 5FSEC 1RPXA 1EJUC 1QFEA 3URAA 5HANA 3TN4A 3MDUA 3RIKA 3W02A 3WQGA 2ZRXA 1WDPA 4JX5A 5HQEA 3SN1A 2EG8A 2YL9A 3NQ8A 5HWJA 4NZCA 4RE2A 1UKSA 3TIMA 1WUEA 2VZUA 4NYYA 3UWQA 3H2CA 4D6IA 2HS8A 1NFGA 1VBGA 3GE7A 6TIMA 1E0TA 3MV11 4ATWA 4IJBA 3MHUA 1WYIA 4QE4A 2BDQA 1EF2A 1AQ0A 2NV9A 1A5NC 4GC4A 4O0ZA 3IARA 4EXQA 3CZEA 1RP8A 1V0LA 1V3JA 2R1MA 2WBGA 3QC3A 3POHA 1ZZMA 3OW1A 1DORA 4FNQA 4GQQA 4GLEA 4W86A 1E6RA 4DZ5A 2POTA 4LUIA 3LRKA 3QH2A 4L56A 3QSRA 3S2CA 2O9TA 1HN1A 3P74A 2FIQA 4IMDA 4DJDD 5IBXA 3W7HA 4WSHA 2NWRA 2D2OA 5AKQA 1UKQA 2J47A 4IGNA 4GZ7A 3QPYA 3VNLA 4RR4A 3KVKA 3E0IA 2CZDA 1J0HA 1LT7A 3B0YA 5FKYA 4QSHA 1GEQA 1IGSA 3R10A 1C8XA 4S3AA 1FWSA 2Q02A 1TWIA 3AIRA 4HNCA 1W1IE 3TZFA 1K1DA 1EDTA 3U8GA 1YDNA 2QJJA 1T6MA 2QJNA 3GNDA 4L6DA 3BTNA 3GHUA 2R1NA 1Z42A 1QW7A 3AZSA 2WPBA 4HPNA 1ISWA 4RW5A 3PTDA 4PMRA 2QVHA 3GIPA 1DQUA 4GGBA 3MYPA 4UFJA 3CHEA 3UG5A 2JEQA 3SCSA 2FZNA 1MUWA 2Y5SA 3AI0A 1VYRA 5E93A 3O0FA 3UW6A 4HU8A 4O17A 1RBLA 4C1NA 1QATA 2E40A 4GYPA 2PDBA 3KP1A 1ZJAA 1O1ZA 2X7WA 3INPA 4IFOA 1U30A 1P7TA 2EPHA 4BWLA 1JQXA 2QCFA 2G95A 4ZGYA 1VFSA 3T9PA 1BQGA 4MLJA 4NKCA 2HPMA 1W37A 2FHCA 3KTXA 3P5YA 2XIQA 5CSRA 2PDFA 3O7UA 1XGZA 4GK8A 2VCAA 3EMCA 3HQPA 3WG6A 2BASA 3LCWA 3GWQA 2E9BA 2X30A 4DUWA 4NRRA 4Y7EA 3SFWA 3TW6A 4QG8A 3NSXA 5H91A 5F2MA 1PIFA 3THQA 4N0RA 3WLKX 3MSGA 4P2VA 1OC5A 1YXYA 1WNOA 4DWSA 3CWOX 1TWSA 4B5TA 4HU3A 5A6KA 1XL9A 3HPFA 1FDYA 1K03A 1SO6A 4LVDA 2QV5A 3FJNA 4R5EA 1PAMA 3LCGA 2ZCGA 3LZ3A 2Y63A 4UNIA 2PS2A 3W1LA 3T2QA 5CLWA 1UD5A 1G01A 2BGSA 1G69A 3F03K 1OHLA 2UBPC 3IS4A 4B3ZA 1G4PA 1EA9C 2EEXA 4TR9A 3ZR5A 2BHYA 3M0ZA 3R0DA 1EXPA 3WNLA 2PB1A 4ZMGA 4OTKA 3VM5A 4DZIA 3R13A 1QVBA 4A4AA 4QQ3A 1HIZA 2PDGA 3N9RA 4FIQA 2QS8A 1VHCA 2E67A 2XSAA 1RQHA 1RQEA 4NF7A 3I4EA 3CMFA 2WMGA 4NZJA 4LUTA 4IFRA 1J01A 4LW7A 2FTYA 4D6HA 3PAJA 1Q6RA 1RAKA 3STCA 3HGSA 1JI2A 5T8GA 4JGDA 1J5SA 4YJ5A 5CBJA 3ZR6A 3OZOA 1RCXB 3CHCA 5BWFA 4D6CA 2DSWA 3QKEA 5FF7A 2HK1A 3C0LA 4LVFA 3W6LA 4MB3A 4GUJA 5FF4A 3CMJA 1L6FA 3G1HA 2XYLA 5G4HC 4J4KA 2WVVB 5CAHA 5KITA 4LCSA 2Q6ZA 3MP3A 4Q8QA 4JFVA 1KM3A 3WH8A 1TPEA 2UV8G 5H8UA 3ZIZA 5LNSA 1E4NA 3N2MA 3CH9A 3EGJA 2WKLA 5IFPA 4UQ9A 2R94A 4FHAA 3R8HA 1MZHA 4FB7A 7TIMA 2V5CA 3AICA 1RVKA 5L6UA 2VUNA 5GJNA 3OIHA 1C92A 3OU8A 3CK5A 4A8RA 1ZBVA 2A7PA 2PC8A 2Z25A 4LB3A 4TMCA 3K1GA 4RZ4A 2NVDA 3RK8A 3PTQA 3CUXA 4PUJA 4I6KA 2BV9A 3E5BA 3EEGA 1UR2A 4AC7C 1KTCA 2V69A 2XINA 3DGBA 3R0UA 3NQMA 1T99A 4PB5A 3NTYA 4YWSA 4C1KA 5A8OA 4RZ6A 3OBKA 2WQDA 3RLUA 2B7OA 3BICA 3IIXA 1I2QA 3AIQA 1IE7C 1SZNA 1OC6A 3W6MA 1KCXA 4ILSA 4LNCA 1XLEA 1E6XM 1MEHA 1J2BA 4W88A 4ASTA 4KIEA 1ME9A 1AW1A 2WC7A 1RVGA 1FUYA 3UP8A 3BLPX 5E1QA 1DWGM 3PBUA 2GVEA 3EA1A 2D3NA 1ZBWA 1JVNA 2QUVA 2H90A 3WYZA 4DELA 2OZ8A 4LYPA 4DY1A 1SQ7A 1OFEA 1XG4A 4EAMA 4MB4A 2PZ0A 3SCNA 1OX5A 4M3PA 4N6FA 4AWSA 2IQ0A 3W74A 5A95A 2PLKA 4UTHA 4ML9A 3G5EA 3W72A 3HMJG 4PUWA 2R6OA 3NA8A 5IDIA 4C6QA 2WM0A 1IEIA 4WZHA 2DQWA 1UP3A 2OEJA 4A35A 4MKNA 3BLOA 3MWAA 1LL6A 3MUZ1 2WCAA 2GJPA 3L12A 2VGIA 3QHOA 1F8IA 3W23A 3NPUA 1MUMA 2TSYA 1FWGC 4LEFA 1TV2A 1QI4A 2EPMX 3FFSA 3LYEA 1J5TA 1A0CA 4DBSA 4YCOA 3PZQA 3FDKA 4H8NA 2A21A 4Q7NA 4A21A 2VZTA 2X16A 2QCDA 1OZQA 1ZB5A 5I3FA 5I3HA 5H8MA 4ZO8A 5A6BA 4GC3A 2V8ZA 1W9UA 1JYNA 4FF5A 4AYGA 1TTIA 3QTGA 4ZQNA 4H19A 3UPWA 1IXQA 3NVDA 4HHMA 4DWSC 1IIGA 3M64A 3T05A 4BS0A 4IT1A 3PULA 2TODA 1CX9A 4Z17A 1MDLA 3SY1A 4QDPA 3MUCA 1LQ0A 1P5BA 1RUSA 4JS3A 2VVSA 4LOCA 1XIFA 1UC5A 4PB4A 2O92A 2V3DA 3GZ3A 1JF5A 1XLMA 2YYUA 4C7DA 1B57A 3THAA 1SSDA 2QMJA 4PBFA 2BBFA 5EB8A 3WH7A 2Y89A 1KCZA 3VVGA 4N6EA 1AW2A 4QLKA 3SBFA 4DHGA 4IGSA 1RBOB 3O0KA 3GQYA 4CNTA 4PEKA 1XLDA 2BXVA 3OVQA 5HXMA 3OVRA 3OYXA 3PG8A 3F4VA 3M07A 3E0VA 1ICPA 4Q22A 3HFTA 4PMYA 4IMGA 3IANA 1MW1A 3OODA 4IJRA 4R34A 4LUSA 3D3FA 1YDOA 4RKAA 1KD0A 3AIEA 1SMDA 2Q8XA 4Q4OA 3HQ1A 4GKLA 3T2OA 3GAYA 3VAVA 3MDWA 4MJ2A 5HAOA 3UXIA 3KOYA 2Q3OA 3BQ6A 3VIPA 1FFRA 1NF7A 2PWFA 5LYRA 2ZBTA 3WQWA 3RF9A 3BK0A 4CU6A 4GNVA 4N9BA 2NUYA 3LENA 1FDZA 4M51A 4JCLA 4J28A 4AX7A 1DJGA 1KRBC 5M17A 1BPLB 4IMAA 1S3TC 3VABA 3QRHA 2RDUA 3S3GA 3GUWA 3LCLA 3TR9A 4RX0A 1PTAA 3TSDA 3SZ8A 4CNPA 1I9CB 1XLGA 3CM4A 4ZOEA 3MO7A 2R1LA 4Q3MA 1POJA 3IJ7A 5HA7A 3BOLA 3WDIA 4Q33A 1ZALA 3MB9A 4J40A 3VYLA 4U31A 1HKVA 2P8CA 2DH3A 4GX8A 2Y8UA 3U0HA 3QY7A 4HBKA 3TTOA 2VFEA 3PFMA 5KEZA 1UR3M 2RJHA 3C3NA 4J3UA 4KS0A 3W1QA 5K9DA 1UWQA 4HZMA 5E5CA 3GM8A 1HX0A 4D9PA 3NQFA 3EDDA 4JQ4A 1YPIA 3BJSA 4JIIX 5A5WA 3USZA 4UZUA 4UOJA 2FFIA 4X2PA 1R0MA 2IKGA 4F40A 2GUBA 4UZSA 1TWWA 2ZA1A 1K4GA 4LS0A 2D1ZA 4ACYA 3BW3A 3AHZA 2VEIA 4JTHA 4JTLA 3GBEA 2WZTA 2O9PA 1UD4A 2YFNA 5LIUX 4NJGA 1XUZA 4ZR8A 1M41A 3AHYA 3HV8A 2AQWA 3CQJA 4XG1A 4TTUA 3XINA 3ZSTA 1TZ9A 5BROA 3LQLA 1IXNA 3WLOA 1EC7A 4GMEA 4FOJA 1EGZA 1KO0A 3R2GA 4CN4A 5KZ6A 1SVDA 1RK6A 4ADTA 1UP2A 1E6NA 1CI1A 1LOLA 2ANUA 3IRSA 1EP2A 2HVOA 3U4AA 3UVAA 1AH3A 3MMDA 2C15A 2ZUTA 5D09A 2VDGA 1L6WA 4ROPA 4F4RA 3IAPA 1QNOA 3V0UA 3THDA 1OFPA 3OHIA 3E49A 2J8GA 3EA3A 4PMXA 3U5UA 3RLGA 1Q2RA 4Y96A 4I7WA 4ZXOA 4R27A 1E55A 2CKRA 4DXXA 1W32A 2E68A 1B3XA 3LBCA 4O1DA 2HPIA 4AWTA 4M82A 3WNNA 4CQDA 1V0KA 2CHNA 5LGXA 3P6LA 2C6QA 2F6UA 3W84A 2ABBA 2PF8A 1LF1A 4HCLA 1I75A 2Y8KA 4FNPA 2WHJA 4ZEPA 3EOEA 3TJXA 3IJQA 3N14A 3MZNA 5REQB 4ZA0A 1SYTA 1V5XA 2G3NA 1SZEA 4HPHA 4KIRA 3ITOA 3UYCA 2ZXQA 1O60A 3K13A 1DKWA 1ZJBA 2BOFX 3EAUA 4RZ5A 4ZB2A 1MXSA 3VNZA 3AIWA 5CPLA 4IIFA 4XZMX 5HMFA 3WMCA 2H8ZA 3AMGA 2I14A 1E72M 4DX3A 1LUCB 2OT1A 4E4FA 2ADAA 3OVGA 3TK7A 3PJXA 3QLDA 6XIMA 2YCLA 4WSJA 3RGTA 4Z0SA 3WUFA 4OECA 3K4WA 1NDVA 4R85A 2EPNA 4DYKA 2F9RA 4ACZB 3NDYA 1OQFA 3ERPA 2J9XA 4Q6XA 5K4ZA 2WK2A 3GVQA 1WKEA 3ZWSA 3W7QA 4IICA 1UJPA 3CAQA 1PTDA 1XM3A 2YGYA 1JNEA 3K30A 3CPGA 2O56A 2DT3A 1OGBA 3HQNA 3QVQA 1JNDA 1QOPA 3CV6A 4GIEA 5GNYA 2ZZ6A 1ISVA 3VGFA 2ZE3A 5HWMA 2IQTA 4JBRA 1VGAA 3ARSA 2ZUUA 3W7JA 3SM0A 4TOQA 1W1A1 5LNVA 1RJQA 1VC4A 4RDZA 5J8LA 4UNLA 3TH6A 1ADDA 3KOFA 2D0HA 2W5FA 5A8GA 2A3EA 2W61A 1KTBA 1AMYA 2I57A 2QDEA 2Y1HA 3HO8A 1RD5A 1OYCA 3IACA 3AALA 4JN7A 4XKMA 2PZNA 4B5VA 4J7RA 3GU2A 2OB3A 2QEZA 2CBIA 4LWWA 1FHUA 4KGLA 1ZP3A 3A22A 1V0NA 2XWDA 1NJJA 2POZA 5SWUA 1ALDA 4MJMA 9XIAA 1W2PA 2FVMA 3DYOA 7ENLA 2L5HA 3T8QA 3BV7A 4EXAA 3TOPA 3C8FA 2ZIDA 4PL2A 2YW4A 2CETA 2OEKA 3CQ0A 2WSRA 3ABZA 1VBJA 2DVTA 4S3CA 5D30A 3QY6A 3BAJA 2Z1BA 2WHLA 3ITYA 1H51A 4DI8A 1XYFA 4GD0A 2Q01A 3TN5A 3IRDA 3M0VA 4XBKA 5DN1A 2PU0A 1CB7B 3CO4A 1DOSA 1XSIA 4E8DA 5D37A 1EUNA 3DKLA 1F2JA 3O6CA 3W75A 1UH2A 3PF3A 1W3JA 2I1OA 1YNPA 3QHNA 4XK2A 2WJDA 1YNQA 3O63A 1LLZA 2YZRA 3UR2A 3M43A 4PMJA 4M7SA 3G24A 1M7OA 2XFFA 1MQRA 3CL7A 4K38A 1IEQA 4ZVJA 1QOQA 1VYPX 2DUZA 3WJSA 5LA0A 3ARTA 4D8ZA 3S2JA 3W76A 1P1MA 4JYEA 4POCA 1OG0A 3WBXA 1DJIA 2CLPA 4TV6A 1L0PA 1IWAA 3W1PA 2G3MA 7A3HA 3M1ZA 4A3RA 3SADA 1SZGA 4Z1CA 1UZHA 2P8BA 2E6DA 3FHQA 3QR0A 1FH8A 1MRQA 3WSUA 3PPCA 4IPJA 2GSJA 1X6NA 1E5JA 4H7ZA 7TAAA 4JAWA 4EF9A 1PCWA 3BUVA 5JVLA 3VCCA 2BXZA 2HS6A 3TTSA 1BG9A 1B30A 1C8QA 1Z3NA 4XZ9A 2QT3A 3GHSA 4C6KA 3NQGA 1UQYA 3L68A 4JNMA 4EX4A 4HHHA 3NO5A 4XO6A 4YXGA 1HVXA 3QBUA 1TTJA 3RX2A 1NVMA 2KAUC 4Q7IA 3N04A 3ABSA 2BWGA 5I3GA 3NJ3A 2OKTA 2FTWA 2GOKA 2XH4A 1VLWA 4I9TA 4UIOA 3O3RA 2PRLA 3QV6A 2BNJA 2VXNA 2PDPA 1Q6CA 1VCFA 3NWRA 1TMHA 1BAGA 4O54A 2A3CA 3UJ2A 1VJSA 4Q4SA 3VCRA 3OZPA 2DZBA 2NLYA 1TJ1A 4J2MA 2F2KA 3TR2A 2FJKA 5KZEA 4UB9A 3FW6A 2W27A 1HJQA 5JBEA 5LA1A 3BOFA 2PTWA 2RDXA 2XFRA 1OB0A 4LYKA 1IR2A 3CPRA 3GHRA 4MOZA 4S2CA 3L7RA 3VE7A 4CD4A 2PDIA 1R2RA 3N13A 4Z42C 2ISSA 3CL8A 2ACRA 1ESWA 3KVMA 4GRSA 1W5MA 3NG3A 3L21A 4GE8A 4GFIA 4KEMA 2INFA 4HK6A 1XINA 4X60A 3AHVA 3VOFA 3CQKA 3LCHA 5C2CA 1W5PA 4XZNX 4BQ5A 1PV8A 1DHPA 1V4YA 4Y6GA 1Y5XA 3IGUA 4O28A 4PULA 3SR7A 1XC6A 1XCFA 4RW3A 2GGJA 3N9SA 2CLMA 4FXSA 4XVEA 4ACZA 4IIBA 4PCFA 1HQTA 1HKWA 1CLXA 1MFVA 4JYDA 2X1RA 1JGIA 3MW7A 2VCCA 4D6DA 2WSPA 4MDPA 1R7OA 2DQXA 4O0KA 5CGTA 1X97A 5LIYX 1Z69A 3CEPA 2I16A 4MG4A 2F8QA 2XVKA 4I90A 1S3HA 3V3WA 2OGJA 4W7WA 3NQ7A 1UR8A 3DKJA 4GUGA 2V5DA 4PUKA 3ABRA 2Z1SA 1DJZA 2P1FA 4G1NA 1AUSL 4LH8A 4A8IA 1KRCC 4DI9A 3B0VC 2PEVA 5DT5A 3Q67A 1NOWA 4OFCA 1EQCA 5U7SA 1MSSA 3PY2A 4MPKA 3N15A 2PWGA 2J8TA 1J12A 1Q2SA 3WDRA 1QWKA 1DE6A 3CIVA 3H2AA 4LY4A 2SFPA 3W83A 5JIPA 1BD0A 2C79A 2QZRA 3M0YA 4D6EA 1WAUA 2OWWA 1GVFA 3W7PA 1H49A 1CT5A 4F0KA 5G5IA 3RLHA 3BGJA 4IOTA 4US5A 4PTNA 3LCXA 4H9ZA 2PFHA 4QNEA 3QFWA 1KBBA 4GQ0A 1RBAA 2B31A 1SZFA 3FNDA 1FWHC 2R14A 1R5YA 3TUUA 4CUCA 1H63A 1E1CB 2F61A 3EWYA 3RX4A 4MJZA 4DAFA 4J9JA 4W87A 4GA8A 3S47A 1OINA 4PSPA 3EOSA 3RM8A 4AG0A 3FY1A 3V7PA 4UR7A 3MI3A 3AHTA 1XQLA 2J8FA 4A29A 2C3ZA 3G1XA 2H3BA 4JIHA 1HKIA 5F2LA 1TZ7A 3NZQA 8RUCA 3GXTA 2Y61A 2WANA 1NFPA 1KRAC 1QPQA 4GJIA 4GGHA 1JEZA 4DPPA 3PPFA 1DIDA 3DH7A 3TYDA 4LC8A 3UJSA 5MKGA 3R1ZA 2OMAA 4UQAA 2YDQA 5IM51 3WX7A 3WK3A 1GTHA 1SO5A 1OADA 3FJLA 5LNRA 3OG3A 2J7CA 4B3KA 4AH7A 2CPUA 2CHOA 2CIPA 5BCAA 1K4HA 1PO9A 3D3AA 1ECEA 2IPJA 4KBXA 1SSGA 4XAFA 1LL7A 1TV4A 2INZA 2QJGA 5K3VA 1UH4A 3M6DA 5D9MA 3T42A 2RUSA 4PN2A 4R9OA 1W3TA 4QDWA 5FEXA 5XIAA 2BX7A 3W22A 1PL9A 2FKPA 3TTEA 3LOTA 3NFUA 3KBWA 1G94A 5AC6A 3HIJA 5EFDA 3UD6A 3CWHA 2DSZA 4LYQA 2PMQA 4YYFA 5ENLA 3OO2A 3VE9A 4U4MA 2Y7DA 4ZENA 1HP4A 4DF1A 2Z2AA 6XIAA 2GGHA 3DX5A 4R7WA 4AVOA 5HQLA 4FA3A 2J77A 2XGBA 1AL8A 2D20A 5M3WA 1F73A 4H9VA 3CUJA 1UR9A 7PTDA 1QMLA 1QNQA 3R0KA 1UR4A 3WLIA 1OIMA 5I3IA 3VUSA 1PB0A 4CU7A 3YPIA 5DQPA 3UR8A 1JFXA 2HV5A 1XIJA 4JQ1A 2YXXA 1KB3A 3MBDA 1P0BA 3WENA 5D2YA 3WLTA 3CMGA 4JY9A 2YA2A 1QNSA 3QMTA 1UYQA 2OTDA 4V1XA 3HB9A 2Y62A 2X42A 1XC4A 5FIPA 3A5VA 4AZ5A 3W01A 1B3ZA 3WBWA 1R3SA 3HPXA 3M5YA 3V0TA 3OZMA 3SUUA 4PRTA 1WO2A 5CAKA 1E9IA 1ELSA 3U3HA 3W2JA 4DBWA 2GQ8A 3H7VA 1ZP4A 4AZHA 1K70A 5AC8A 1U2YA 3QLLA 1EB3A 5F2IA 3WEOA 3IJ8A 3B8VA 3TEVA 3UWZA 2OLHA 2YDAA 4FEZA 1XSKA 4ERIA 2JIWA 3EPMA 3UG4A 2X7VA 4IJCA 3OHMB 4ZCWA 3RITA 1DWJM 2J25A 3ZOAA 4PMNA 4RV8A 1VBUA 1O5XA 1WKYA 5BMXA 2ISWA 1OY0A 3HTWA 3LXCA 3W6YA 1YPFA 4A3HA 1JZ5A 3OGSA 2AL1A 3T78A 3IVSA 4NXSA 3MCMA 3O15A 1W9XA 4BI6A 1DPMA 4F0MA 5M1TA 5A6AA 2C13A 3W71A 1T5AA 3ID7A 3EOLA 1XLJA 3HU7A 2VD8A 4I9MA 2CLLA 3KCOA 3C0JA 3ANVA 2JK2A 1CXKA 3OVPA 4QBXA 4JFUA 1E9ZB 1KGWA 1NWRA 1V08A 4IM4A 1A5OC 1S5WA 3VINA 3GH7A 1GOKA 1KBIA 4XAZA 2XIBA 1OK4A 4NASA 4HMNA 1KV5A 5CPSA 2ZQ0A 1DJHA 1ODUA 1TQJA 3WL1A 1ME7A 2GVGA 3RMJA 3MY9A 3BGGA 4XSLA 3SURA 4RZBA 5HUPA 2X1SA 5JXQA 1CXIA 1E0XA 2ZXBA 3P60A 5MF5A 2G97A 1W5NA 4QSFA 4LV9A 3N6QA 3RPMA 4LXFA 4M7TA 5DMLA 2FPYA 3TSMA 1RP9A 3KCJA 5FEWA 3MHGA 2BY3A 2J7BA 4PRWA 2DIJA 3RU8X 1OG6A 1OFBA 3O07A 4NXKA 4JQAA 2CLKA 1H0IA 4PE8A 1M3UA 3OQEA 3S2LA 1LBMA 3TWAA 3KLLA 1D8WA 1K9DA 3WF4A 3RO8A 4KCUA 2QAPA 1GWJA 3L23A 4JEQA 1PIGA 3GG8A 4AIBA 1THFD 1XIIA 1TPFA 3OYZA 4JN8A 2IKHA 4ADSA 3W7RA 1EOMA 4AD3A 1L8PA 3RN6A 1JUEA 3W7DA 3OB8A 3K4AA 2GLKA 3E96A 4WUIA 3VZYA 4S1FA 1KXHA 4O50A 3LXBA 1LJYA 1VFFA 3GC4A 1J18A 4CQCA 4MADA 2E7FA 4JKLA 3H7RA 3II1A 4XZLX 4ML4A 3F2DA 5LHEA 1IZCA 2YL6A 3VKCA 3OA3A 3WD4A 1QXLA 3ZYZA 1KM6A 1AL7A 4EIVA 3WQ4A 1ZFJA 2WPGA