1H1NA

Atomic resolution structure of the major endoglucanase from thermoascus aurantiacus
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
305
structure length
305
Chain Sequence
AKVFQWFGSNESGAEFGSQNLPGVEGKDYIWPDPNTIDTLISKGMNIFRVPFMMERLVPNSMTGSPDPNYLADLIATVNAITQKGAYAVVDPHNYGRYYNSIISSPSDFETFWKTVASQFASNPLVIFDTDNEYHDMDQTLVLNLNQAAIDGIRSAGATSQYIFVEGNSWTGAWTWTNVNDNMKSLTDPSDKIIYEMHQYLDSDGSGTSATCVSSTIGQERITSATQWLRANGKKGIIGEFAGGADNVCETAITGMLDYMAQNTDVWTGAIWWAAGPWWGDYIFSMEPDNGIAYQQILPILTPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO TYPE CELLULASE ENGI
publication title Atomic Resolution Structure of the Major Endoglucanase from Thermoascus Aurantiacus
pubmed doi rcsb
total genus 124
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h1nA00
2ZUUA 4TTGA 3POCA 5F7UA 4J7RA 1R86A 3PTQA 5M17A 1QHZA 1QI3A 3WMCA 4TVUA 3W24A 3AIWA 4UQ9A 5EB8A 3WKZA 3CPUA 3WBEA 2J7GA 5I78A 2WW5A 3WFZA 2WBKA 1VB9A 2WC7A 2XWEA 1CXLA 1MW1A 2WANA 3WDPP 3AS0A 2WMGA 3GH4A 1GJUA 3OGRA 2FHFA 1UA3A 3PZQA 1XSIA 5EFFA 5LA1A 1LG2A 5I0DA 2OSYA 1CWYA 3AIVA 4H8HA 2VVNA 1Q4NX 4PN2A 3CZJA 3CZKA 3VIHA 4Z2JA 2QPSA 5LA0A 2D22A 3WL0A 1UD3A 1JZ3A 3PZIA 4LYPA 3D5HA 3ZT5A 4OOZA 2XUCA 1MXDA 2CPUA 3ZR6A 3VIIA 5A6MA 4UFKA 3PZUA 4J3SA 2HISA 2D24A 2W62A 1ZJBA 2G3MA 4JHZA 2ZUSA 4NZCA 2VZTA 4UFHA 5A2CA 3SCRA 8A3HA 4D1JA 3AHTA 1LWJA 2J7FA 2VCCA 1GOMA 1CYGA 1H1NA 4XV0A 1E40A 1B3WA 2OYMA 3IK2A 3U7VA 2ZX7A 3WF1A 5TD4A 3NSMA 4DM2A 1ODUA 1M01A 1Q6EA 4MB5A 2BY3A 3KZSA 3SUWA 4J27A 1V3KA 1HL9A 2WKLA 2DSVA 3CUIA 4J3XA 4JL2A 4TX6A 3BAWA 5FKYA 4F66A 2WSKA 1JAEA 3BGAA 1ITXA 4BF7A 4QCFA 1JZ5A 3AICA 4WKAA 1VAHA 1QI2A 4PTXA 3VMOA 4KGLA 1DHKA 3THCA 2W92A 2PWEA 4ATLA 1B1YA 3M6DA 4AD5A 1FH7A 5C70A 1JFXA 4MB3A 2OSWA 3W29A 3RJYA 4AMCA 3WEOA 1NQ6A 3VGBA 1GCYA 1W9UA 2CKRA 1W1VA 1XV8A 3W82A 1ISXA 4U31A 2YKKA 4D6DA 1SR0A 3ZMRA 1GQKA 1UWIA 4KMQA 1V0LA 7A3HA 3BSGA 1B2YA 4JFVA 4JCMA 3UR7A 1OD0A 1IT0A 4B3KA 2Q8XA 2CHNA 3QOMA 1F4HA 6TAAA 2VCBA 2VOTA 2ZWYA 2CERA 2D0GA 4DUWA 1H11A 1B3VA 5HDRA 4IUGA 4H8VA 1OWQA 3AI0A 3PTKA 1IZKA 4MNJA 3WL1A 2WHMA 1KBBA 3RPMA 6A3HA 3K8MA 1HKKA 2XYLA 2WMIB 4HMEA 4CN1A 3OLEA 1XRVA 3VD7A 5CPSA 3A6OA 4LYRA 5M03A 2ZUWA 2W67A 3DYOA 4JFUA 3F5LA 5CJ5A 3WDIA 2YL8A 3BAXA 2BVYA 1XGZA 2NW0A 1I1WA 3AHVA 3WD0A 3FW6A 4LGXA 1CLVA 4W5UA 1DTUA 1E4NA 1TMQA 1W1YA 1OGBA 1GORA 4CVWA 4UZSA 3L4VA 3MSDA 1QBAA 3BCDA 5BROA 3DYPA 4QLJA 4PMOA 1E1FA 1PZ3A 2BVDA 2E9BA 1I1XA 5BXSA 5CSUA 2J7HA 3WQWA 2DT1A 4AZ7A 1EA9C 2PWGA 4DUVA 1UWSA 3WNPA 1HL8A 5LA2A 2PWHA 4DM1A 4E4PA 1LL7A 2V3FA 4C7DA 1C92A 3EMQA 1ISWA 1TE1A 2QPUA 1Q6FA 3WH5A 4K68A 1C7SA 3SCTA 1UQZA 1RPKA 1SYTA 2ZXQA 5AC4A 3T0BA 3QOKA 3AHYA 4AD1A 1GQLA 1UD6A 2WKGA 1XC6A 3DC0A 2QV4A 5BXPA 3SCQA 2CBUA 4M8UA 3S2CA 5DF0A 2V3GA 3AHZA 1QNRA 3AZSA 5KEZA 2BXZA 1KCKA 3W6LA 5A8QA 5C71A 1Q6CA 3BLKA 3GNPA 4MAVA 2G3JA 4EAMA 4OOUA 3OGVA 1BG4A 2ZUMA 4N42A 4UZUA 7CGTA 4W7WA 1PAMA 2VZUA 3EYPA 5DT7A 3WELA 3AS2A 2XIIA 3CO4A 4A4AA 2MANA 1E55A 3LPPA 3VM7A 4YHEA 3N04A 2G3NA 3D3AA 1LL6A 1EQCA 1UKSA 5A8NA 3RILA 4OIFA 3BAYA 3U57A 4OZOA 2XFYA 3SIMA 4PTWA 4A3YA 1G1YA 1L0PA 4W7VA 3WF2A 3WQ5A 3II1A 2B31A 3CHCA 2XWDA 5CLTA 1MW3A 1V02E 4KGJA 3M46A 2WAGA 2D3NA 3VIMA 4X9YA 1A3HA 2WHLA 3ZT6A 4FLOA 1VEPA 4QFUA 3SUUA 1JAKA 2GJPA 2VX5A 1JF6A 1UWUA 4CU8A 2IXVA 1MW0A 2TAAA 3IJ9A 2DEPA 3ECQA 3TOPA 3U5UA 4HOZA 1EIBA 1BFNA 1H41A 1WZMA 1IV8A 1C93A 3UETA 3HMCA 3ARPA 4M82A 3K8LA 2YL6A 1QI0A 5FL1A 5EBAA 3VNYA 1HVQA 2WB5A 1CGWA 2VZVA 3GTNA 5CPTA 4UQAA 1ISYA 3VIKA 3GBDA 4PUEA 1GUVA 3WNMA 2VR5A 5BXTA 1U30A 3THDA 1KXQA 1MYRA 2D23A 4JL1A 2WK2A 3VM5A 3VPLA 4UNIA 1E0XA 5AC5A 3VOCA 1PEZA 1J0KA 1VJZA 1HNYA 5A6SA 4D6EA 1UR1A 2WZHA 4X0NA 3W38A 1QPKA 1B3YA 1TZ7A 4UR9A 3AYRA 4AYSA 3CZGA 2Y5EA 3WBAA 1R8LA 1E0VA 4ACYA 2NSXA 4DUXA 3M07A 2VRJA 4QDMA 1BYDA 2BS9A 1MQRA 3MMUA 3VIFA 3N15A 5LYRA 1OGGA 1UKTA 5ABEA 4NRRA 4CCDA 2CBVA 2O9RA 3OZOA 3VO0A 4WIWA 2A3AA 1CXHA 2J7BA 1LLOA 1FHLA 5I3DA 1J0HA 5KZ6A 5IFPA 4QAWA 1GPFA 1EOMA 1WE5A 4NI3A 4AD3A 3WFLA 1KXTA 1PIGA 1EDTA 2FDMA 4CKQA 2J77A 3MMDA 1V6XA 1BHGA 2XPKA 3QHNA 1K9DA 4HOXA 3W53A 3MANA 4P8WA 1UR0A 1JNEA 2PWFA 3GM8A 4CD8A 2C8NA 1W1TA 5JBFA 3EBVA 3WH7A 1ZS2A 5I23A 1PIFA 4ZEPA 2WVTA 2WZIA 2ZUTA 3WDHA 1XSJA 1V3MA 1UR4A 5BXRA 4Z2IA 2DT3A 3VX1A 3W81A 4S3KA 1H4PA 2D1ZA 4WKHA 1BQCA 1KCLA 4GQQA 4WSJA 3LPFA 4PMQA 3MO4A 1UOKA 2G3IA 1E72M 1R87A 1V0NA 2X2YA 4UOJA 3VILA 4PSPA 2CBIA 3BLPX 4MJ4A 1GOQA 2W63A 2WHJA 2WMJA 2W91A 3BXWA 1FP9A 2YOCA 2GJXA 1OT1A 2AAAA 4EANA 1AQHA 4ATWA 3KL5A 2E3ZA 1UHVA 1WKYA 1NOUA 2UY3A 2CKSA 1GVYA 1E5JA 3VDAA 5I79A 4MAZA 3VX0A 4URIA 3DECA 1LL4A 4PMYA 1PX3A 4F8XA 1CZ1A 2O9TA 3T0DA 3WD2A 3NIYA 4FLQA 2E40A 4B3LA 1O6IA 3LPOA 3TTYA 2EPLX 3ARZA 1GOOA 1EXPA 1U33A 4KRUA 4JIEA 1G94A 1V6WA 4NSBA 4RE4A 3L4ZA 1JIBA 1XSKA 3ZSSA 2G8ZA 1V03A 3SUSA 1E6SM 2O9OA 2IXUA 4TTUA 1XYZA 3ZOAA 7TAAA 4MADA 2VZSA 2EJ1A 2E4TA 1E56A 2VT0A 4KRTA 4D6JA 3WUGA 4OKDA 3VGFA 3PZMA 1XD0A 2WVSA 4HTYA 1W32A 3ZJ6A 2J74A 2W5FA 2WHKA 3B8SA 4TVDA 3SCSA 5A8MA 2OWXA 4P8VA 3UERA 2Z1KA 1BTCA 2X09A 3TP4A 2RGMA 3VD9A 3ALGA 3VTRA 4L4PA 4ZFMA 4E2OA 3MV11 1J01A 5M5DA 4ZE4A 3MSGA 3G6MA 2ESCA 2EBNA 5E0FA 1OBAA 4V28A 4V2XA 4PUDA 1E4LA 3NDZA 3AIEA 4P7RA 1R7OA 4ZENA 4GI6A 1MQQA 1UD8A 1LQ0A 3VVGA 1NWUA 1NOFA 2WLYA 5I2UA 5JIPA 2W66A 3NSXA 1JI1A 2J7EA 2YL5A 3O9NA 5FL0A 3MU7A 3PZOA 2UY4A 2ZUVA 5DO8A 5JUVA 4WLCA 2WMKA 1FP8A 4P7OA 1KWKA 1GHSA 1R85A 4QLLA 1UKPA 2WCGA 1DP0A 1MFVA 3VD3A 2OWCA 3K46A 3GBEA 3ZJ7A 3WNOA 3LPGA 4CVUA 4CU6A 2WC3A 1Y7VA 2DIJA 2WLZA 5CSYA 3RM8A 4E8DA 4MDOA 2WVVA 1CEOA 3PZNA 3E1F1 4PMXA 4BQ5A 3T2QA 3AMLA 3OG2A 4J28A 1O7AA 6CGTA 2ZE0A 4B9ZA 1C8XA 2J7DA 3RDKA 3SUTA 1UKQA 1VEMA 4EK7A 3N1AA 2WWCA 2J8FA 5E9AA 1VFOA 2ZX8A 2VX7A 4U3CA 3WNNA 2XJ7A 5A2AA 4LQ1A 4Q7NA 4W84A 4XUYA 4WKFA 1XD1A 4FLRA 4H04A 3CUHA 1KGUA 2E8ZA 2J25A 2YDQA 1V6VA 1C7TA 1FH9A 1JDDA 1J10A 2PBOA 1BAGA 2ZWZA 4OBSA 1MQPA 5D9OA 1UH4A 3W37A 1TVPA 3OZPA 2AOSA 2F61A 2JIWA 1QVBA 1WO2A 3UG4A 2XVNA 4YN5A 1RH9A 3NSNA 3F4VA 1K9EA 1W9VA 4W93A 1JG9A 2GJXB 2GFTA 2D3LA 4H8UA 3AXXA 2XSAA 3AIQA 1VFMA 3VNZA 3RIKA 4ACZA 3AS1A 1JD7A 3IANA 2EPKX 1NWSA 4M24A 3VMPA 2C7FA 3A4AA 1JZ7A 1W3LA 5I5RA 3KE0A 5GNZA 4AZBA 1VF8A 1G0CA 3J7HA 3WDQA 5A6BA 2EPMX 1JYWA 1JFHA 5I77A 2CYGA 4F79A 1J0YA 2E9LA 4GZEA 2ZUNA 2F2HA 3GYCA 1UQYA 1ZB5A 3ZM8A 4DWSA 2WPGA 3WD3A 4D72A 1XH2A 3NJ3A 1ZBCA 4WF7A 4J3UA 2ZXBA 3MMWA 3RO8A 1FH8A 2YA2A 1H2JA 4YHGA 1WDPA 2VQTA 4GZIA 2V5CA 4UQEA 2YL9A 4XB3A 4J3WA 5C8BB 1MFUA 1V0MA 2YLAA 4U2ZA 1HVXA 1TG7A 1KGWA 2PI6A 4JCLA 1US3A 2CCRA 2UY5A 3L4YA 1V3JA 1BSIA 3VGGA 1BLIA 5JBEA 3W25A 1CECA 5ABFA 4QCEA 4WJXA 2X0HA 3BMWA 4H41A 3ZJKA 3VD4A 3GZAA 2WZEA 4PMUA 3UG5A 5GNYA 1B90A 4W8BA 2ZX5A 3GXFA 4UTFA 1EO5A 4P8XA 5BYWA 5HPCA 3WUEA 3AIUA 1TA3A 2X8RA 4PMZA 5AYBA 4CCEA 4BS0A 4OJYA 1US2A 4MNMA 3ZT7A 4RE3A 1KXVA 2WC4A 2BXYA 2EPNA 1FFRA 3BC9A 1EQPA 2E9MA 1WAWA 4F9JA 1E4MM 1HKIA 5ECUA 5EMYA 5A6AA 5M3WA 4UCFA 3CBWA 2OSXA 1CNVA 2XVLA 1J11A 2X05A 1EO7A 4J3TA 2DSWA 2J8GA 3N12A 3ARQA 2A3HA 1E3XA 4R27A 1C90A 1CTNA 1PBGA 2GK1A 4P7QA 3WEZA 1EDGA 4AEFA 3L2LA 4D71A 4PYSA 2WVVB 4JKKA 1EHAA 2YDRA 1M04A 4FLSA 3VIPA 1J18A 1KXHA 1QNSA 1NP0A 1HT6A 5A8PA 4HZ6A 3ALFA 1D2KA 2V5DA 4AIUA 2V38A 3AMKA 2BY1A 2XIBA 1BGGA 5IDIA 1NWRA 1G5AA 2A3BA 1JZ8A 1V0KA 3WSUA 3L4UA 3W26A 5D9MA 3WEMA 4S3JA 1VBRA 3CMJA 2WM0A 4PMVA 4HPHA 3K8KA 3RJXA 4HP5A 5IHRA 4BZYA 2GJRA 3WY1A 5A69A 4CN4A 5D4YA 2CXGA 1QI4A 3SUVA 2D2OA 1B30A 1E6NA 3IJ8A 2WBGA 3VIOA 3CUGA 3A4XA 4PTVA 4M1RA 3CZLA 3CUJA 3PZ9A 3PHAA 1JZ6A 3FHQA 3EDJA 1UR8A 3VIGA 1WDRA 1ISVA 1ODZA 4ACZB 2D20A 4PSRA 1HJUA 2XVPA 1HX0A 2O92A 1OIFA 2QF8A 2OYKA 2VRQA 1WB0A 2QMKA 1E6XM 2WCSA 1VEOA 1KQYA 1J9YA 5DEZA 3WQ6A 4HU8A 2ZX9A 3ARYA 3PTMA 3AROA 1WP6A 1XCWA 2BVTA 4U5IA 2GUYA 4P8UA 5ABHA 3TA9A 2CBJA 1RP8A 4BQ3A 1SMDA 3EDDA 1U2YA 2D0HA 3CMGA 3FHAA 3EMCA 1V3LA 3OBAA 3VMNA 3MUIA 4DWSB 1DWAM 4JZ5A 1JXJA 4HA1A 2QHAA 3AMCA 5CXPA 4AISA 3AIRA 5A6JA 4M81A 3WNLA 2JE8A 3AMDA 4UQBA 3VUPA 4W5ZA 3T2OA 2DSZA 1JYVA 2VJXA 4UQCA 4F9DA 1FOBA 2G41A 5ABFB 4U2YA 4TOQA 3VKKA 4MPKA 4C7FA 1QHPA 1K6AA 4D6HA 1E71M 3EDEA 2JEPA 3ZSTA 2VRKA 2EXOA 1WDQA 4UFMA 1TA3B 4HOWA 3EDKA 4W85A 4ZXOA 4TX8A 4U33A 3GNRA 2FGLA 5I6SA 5DFAA 3WF4A 2D0FA 2CETA 1J12A 2YJQA 2ZICA 2VX4A 2BV9A 5FCZA 1GHRA 3WN6A 5FOOA 3POHA 1G01A 1UYQA 4W88A 3AIBA 3N11A 4BA0A 1HP4A 3WQVA 1UWQA 3VINA 1UWTA 2GDUA 2BNJA 2VQUA 3DYMA 4TVCA 1HJSA 1E4IA 2WSPA 1K9TA 2XHYA 3G6LA 4AW7A 2GK1B 3UEQA 5JBDA 3WH8A 3N9KA 4JKLA 3O2LA 1BVNP 2QLYA 3ARUA 3SCPA 2EO7A 1PPIA 2XVGA 4CCCA 4B9YA 4MB1A 2JF7A 2PBGA 3A4WA 1E6RA 5HNNA 1CGTA 1UG6A 4P7LA 1MXGA 1WCGA 3WQ8A 1C91A 3QHMA 2ZIDA 3B9EA 3WD1A 3A47A 3U5YA 2OYLA 1GONA 3TONA 4JFWA 4W87A 2V3EA 1CDGA 2BHZA 1MW2A 2DIEA 3CTTA 5GNXA 1ZJAA 3VIJA 4DWSC 1PZ2A 1W3HA 1BVZA 5CG0A 1D3CA 2O9PA 3CHEA 2GSJA 3SCNA 1NOWA 1BGAA 3UCQA 1H5VA 1S46A 1E70M 2WMFA 2CEQA 2VVSA 3RM9A 1PJ9A 1WZKA 2XG9A 1NH6A 1W3JA 2FHCA 5A94A 1ESWA 1FA2A 2VCAA 3OLDA 5FD0A 1E5NA 3QHOA 1W9PA 3N17A 3GH5A 3WQ4A 4ATDA 4CD7A 1QNPA 3W4RA 4HPGA 3EDFA 4BQ2A 1OT2A 5A1AA 1CXEA 4C7GA 1UZ4A 2VO5A 3KWXA 1XH1A 3FNDA 4OUEA 4R5EA 1ZBWA 4D6FA 3MUY1 1AMYA 3AOFA 1QW8A 4FMVA 1OM0A 4N0RA 2WXDM 5BCAA 5JIWA 3NCOA 4UOZA 4EE9A 1UH3A 2Y24A 4TUFA 4M29A 1CGXA 1DWFM 1QOXA 2VURA 5E6YA 8CGTA 5IFTA 4PCTA 1CGYA 1JF5A 1QNQA 4HZ8A 4AD4A 2DT0A 1KBKA 4QP0A 4AC1X 1C8YA 5GPRA 2J78A 2CNCA 4HU0A 1GOIA 2YLLA 1Q6GA 1ZU8A 3ZQ9A 4UFJA 1W91A 2PF0A 2YBUA 3WUFA 3OB8A 5HOSA 2VTFA 1TVNA 2NT0A 3WH6A 3UESA 2DH2A 1LWHA 4RE2A 1SFSA 3WNKA 3A3HA 1GOWA 1E15A 1KGXA 4PMDA 4H7VA 4Z2KA 4PTMA 3AJ7A 1BF2A 1JYXA 1ISZA 1VRXA 3ARSA 3LMYA 1F4AA 5CGMA 3MV01 3CHDA 2YA0A 4GO8A 2J75A 3BAIA 5A6BD 3BH4A 4U3AA 1GNXA 3RCNA 2XVKA 2ZX6A 4Z2GA 1W9XA 4WSKA 1HKMA 3NYDA 2J79A 1PX4A 4LX4A 3RMEA 4PCSA 2XTKA 4DWSD 2BHUA 3GNOA 3VDCA 5A6KA 2YBTA 4CD6A 3OGSA 3CGTA 2DDXA 2JEQA 1KR1A 2IUZA 3AYSA 3UG3A 3K4AA 1E73M 2XSBA 1GZJA 3VGDA 4YPJA 1C8QA 4X0VA 4E8CA 1LG1A 3JUGA 2BY0A 4Y7EA 2FH6A 2VC9A 2BFGA 1JDAA 3OLIA 4AEEA 1W9DM 1W9BM 1JYNA 1R7AA 2CITA 2DQXA 4P7NA 2WVUA 1OCQA 2DSKA 4PBGA 5ABGA 2CHOA 1AQMA 3FXYA 1ZL1A 3I3BA 4JFSA 1WNOA 1QHOA 3U7BA 3ARWA 3HN3A 4FK9A 2JFEX 1HJVA 4GKLA 4D6IA 3B9AA 2CIPA 3EMZA 1UH2A 4XX6A 3KL3A 2YA1A 3M7SA 1W3KA 5I24A 1GOKA 5DMYA 2BHYA 4JHOA 2BY2A 2WMHA 4M56A 1GW1A 1H3GA 1QNOA 1LF1A 1UR2A 1AVAA 1V08A 4D6CA 2EEXA 3KEHA 3AQUA 3SCUA 3AHXA 1WZAA 1ZBKA 3L4TA 1J0ZA 3ARTA 3RM4A 3ZO9A 4CGTA 2J7CA 1M53A 1JGIA 2A3CA 2W4XA 3QR3A 2CESA 3AFBA 1AQ0A 3SCOA 1QBBA 5CGTA 4AZGA 3UR8A 5D8WA 1XCXA 2ZOXA 3AZTA 4NRSA 1HJXA 3S6TA 1EDQA 5D9NA 4CN6A 5IXEA 2GDVA 2VZOA 2EPOA 2HVMA 1YHTA 3IJ7A 1L8NA 4PEEA 2EQDA 5CPQA 3O6AA 1MWOA 1V6UA 4AZHA 3VU2A 5A2BA 1QI5A 1KWGA 4Z2LA 3CZEA 1Q6DA 3OLGA 1MVYA 1XH0A 3K1DA 4XZBA 3ZJ8A 2XM1A 1KQZA 3BAKA 5D8ZA 4AD2A 5AYIA 3GDBA 2VNCA 3K4DA 4LYQA 4U5KA 2V3DA 2C0HA 3VDBA 1H0GA 2ZXDA 4H2CA 3WF0A 1B3ZA 1NWTA 5E0CA 3KL0A 1OB0A 2G4FA 4KH2A 5E09A 1H09A 2UY2A 4FF5A 1B0IA 3T0AA 1E6QM 1B9ZA 2Y8VA 1HP5A 3AMGA 4GQRA 3W0KA 3CIVA 2E0PA 3HU7A 4A3HA 1IZJA 4WK9A 3IAQA 4UFLA 1NM9A 1X1NA 2WWDA 2NT1A 3W6MA 5D9PA 3HJEA 1JI2A 2XFRA 4AZ6A 1SMAA 2F8QA 3I3DA 4AWEA 3WD4A 1E43A 4MJ2A 4KWUA 1JDCA 3T08A 2YDSA 4HA4A 4CU7A 1CXFA 2PC8A 4GZJA 4GPNA 2ZXAA 4PMNA 1TFVA 4UQDA 3PZGA 2Y8KA 3AS3A 2XGIA 1JD9A 3VDHA 4HZ7A 1BYAA 1UWRA 4AZCA 4B16A 3L2MA 4XZWA 1A47A 1M7XA 3BCFA 3GXMA 3WMSA 1VIWA 1EGZA 2WCAA 1GJWA 1CXIA 4AIEA 2GVYA 1WDSA 2J47A 4EKJA 1HN1A 3ZR5A 3CZ8A 2QMJA 1HJQA 1G9HA 1CGUA 3B9DA 5A8OA 3OIHA 1E6ZA 4LPCA 3BMVA 2VI0A 4ZE5A 4JKMA 3IAPA 1BYCA 2PWDA 5BRQA 1YQ2A 1UR9A 2OWWA 3WUBA 3AZRA 1XHGA 3NUKA 5CLWA 1ECEA 4OBRA 5A3HA 1NARA 1VFUA 1ZBVA 3PZVA 4Q22A 1E3ZA 1VENA 4IISA 4BQ4A 1E1EA 1OIMA 2X0YA 4MB4A 1DWHM 3FAXA 3WDRA 1W1PA 4B15A 3T2PA 5A6LA 3I3EA 1JXKA 3CLWA 3ZIZA 2FH8A 3MKKA 1QW9A 1JZ2A 1EOKA 5HXMA 4GIAA 2XM2A 2J4GA 2DPEA 1HIZA 4AZ5A 1CIUA 5E70A 3TTOA 1FHDA 2FHBA 3TTSA 3PBGA 4TXEA 4JAWA 1EHNA 3WIJA 4UOQA 1V3IA 1Z32X 4MDPA 2RGLA 1E6PA 1K9FA 3PN8A 1GQJA 1HXJA 3W28A 4L4OA 4AXNA 3DHUA 4CD4A 3L4XA 1DWGM 1BPLB 1V6YA 3ARRA 3MUAA 4GI8A 3L4WA 4RL3A 1FFQA 1WZLA 3SCVA 4J3VA 1N82A 1J0IA 4GO9A 2VMFA 4W7UA 3CH9A 1JNDA 1I75A 3BSHA 1H49A 2VX6A 4W86A 3APGA 4GINA 3SURA 1CBGA 1OGSA 1W2VA 3FN9A 3AXHA 3ARXA 1BYBA 1CGVA 4HMDA 1HJWA 2X1IA 1UD2A 2DSUA 4PMRA 3MS8A 5IHSA 2UWFA 2DT2A 3AISA 4BCEA 4Z2HA 2DH3A 2XGBA 1UKOA 1UZ1A 3FY1A 2A3EA 3DHPA 2VR4A 9CGTA 4GI9A 1GVIA 3GXDA 5BRPA 4HMCA 3GXIA 2DGAA 3N18A 2WNWA 2JIEA 2VL4A 3SCWA 4IPNB 1VJSA 1ITCA 4QLKA 1JL8A 1RD6A 4UFIA 3W27A 3F5JA 1CLXA 3MUZ1 1TCMA 3WH9A 3VGEA 1DEDA 1E9LA 1XYFA 3WDJA 3OA5A 4IPLA 1DWJM 4HA3A 1W2PA 1HF6A 1V3HA 1RP9A 3QGVA 2FGZA 1NP2A 5BWFA 3WENA 2WYSA 1OD8A 5FIPA 1P6WA 2AMGA 1OSEA 2YIHA 4IM4A 3VGHA 3ARVA 1OINA 1KB3A 1CPUA 1UD4A 3GH7A 4CD5A 2JF6A 2W61A 1KFWA 1C3FA 4AZIA 1VBUA 1UUQA 2J62A 1TR1A 4MNLA 3BAJA 2XFFA 4M80A 4AIOA 3NDYA 4ML4A 1KR0A 3CUFA 3AXIA 4GXPA 1WPCA 1X6NA 5CQ1A 4AD0A 4AZCB 5A95A 1TUXA 2Y2WA 5DT5A 5GQBA 3WF3A 4JFTA 5E6ZA 1PX8A 1DWIM 1LJYA 3N13A 5CZKA 3WMBA 4V27A 1EH9A 1X6LA 3FAWA 1D7FA 1CXKA 4MNKA 3F5KA 4CUCA 5HPOA 2VUYA 1H0IA 3VD5A 4D1IA 1E0WA 3SEPA 4PRWA 3PZTA 4D6GA 1VFFA 1HKJA 1UA7A 2Z1SA 1J0JA 1B3XA 1B31A 1BG9A 5HBFA 4AY1A 3CHFA 4W8LA 2JALA 2E8YA 4MTVA 2WMIA 5AY7A 3TTQA 1V02A 3T09A 2PB1A 4NF7A 2Y4SA 1M03A 1CENA 4W89A 4ZXLA 2OLHA 1GQIA 4LXFA 5EFDA 1JZ4A 4W8AA 1UD5A
chains in the Genus database with same CATH superfamily
3G2GA 4TTGA 3NO5A 4LY8A 3LTYA 2AGTA 1ME8A 3O3RA 2I17A 2YXXA 4N9BA 2BTMA 2ZC1A 4QGCA 3WBEA 5I78A 3LCHA 4LSBA 4KIRA 1VCFA 2XWEA 3FOKA 3WDPP 3OTRA 4GBDA 4GVGA 2PP0A 3DXIA 5FF3A 4O13A 8RUCA 4Q6XA 2OSYA 2QCHA 1CWYA 3ZXWA 1Q4NX 3LERA 2RJGA 3E0LA 4IIEA 1Q65A 4MGGA 3WL0A 2QT3A 2UBPC 3KS5A 4OOZA 1J8VA 2DP3A 1W5MA 4J3SA 4AG0A 2HISA 5FJUA 2D24A 2OVLA 4CQDA 1EF2A 1U1UA 1GTEA 4NZCA 1JUKA 4A29A 2YXGA 3HFYA 4LUSA 2VCCA 3EKGA 4XBJA 3U7VA 3M0VA 2W6RA 4DBWA 3BURA 3NSMA 2QUUA 1A5MC 3R6IA 3RX4A 1IEXA 3GXTA 1Q6EA 4MB5A 2BY3A 3SUWA 1AA1B 4J27A 4N9DA 6XIAA 1HL9A 3W00A 2DSVA 4GBUA 3URQA 4CCZA 4JL2A 1O5XA 4TX6A 4AEOA 1W5QA 4Q4OA 3C6CA 3QZAA 4BEQA 4WKAA 3EX6A 4RR4A 1V79A 2NSOA 2OZ8A 3COTA 3UQNA 1LTDA 1QI2A 3THCA 1DQUA 4UC5A 3W1LA 1B1YA 3M6DA 1P6BA 1LZOA 2P10A 4I7UA 3CWOX 3RJYA 1XKYA 1P0NA 3C52A 1K70A 3VGBA 3USZA 1F61A 2CKRA 3VZYA 1W1VA 3CO8A 4S1FA 2YKKA 3R8GA 1K03A 4ERIA 4FXSA 3BLEA 1SR0A 1Q6LA 2ZZ6A 2PE4A 4XVEA 5K9XA 2PLMA 4JFVA 4MF4A 4JTUA 4C5ZA 3UZ5A 5F4XA 3WYZA 1XLHA 1U5HA 4IP5A 4EPDC 1B3VA 1SO5A 5HDRA 4IUGA 4GNJA 1J6PA 4H8VA 1OWQA 4WY0B 1MZRA 3PTKA 4RNFA 1IZKA 4MNJA 3RPMA 6A3HA 1YADA 3WQFA 4IF2A 4X61A 3A6OA 4LYRA 2W67A 3HIJA 3VCNA 3F5LA 3S46A 3WLHA 5I02A 3JRKA 1Z6KA 4PULA 1O5RA 2ABAA 5D32A 2R82A 4C1NA 1ONRA 1E4NA 2XH2A 1JCXA 3EEGA 4DO4A 3S0CA 4UZSA 1X7IA 2QJNA 2XGZA 3GHSA 5FF0A 5BROA 1JCJA 4QLJA 2AMXA 4GWEA 2E9BA 1I1XA 3W85A 3ZYZA 2ISFA 2DT1A 5D30A 4AZ7A 4DUVA 3W73A 1UWSA 3WNPA 5LA2A 4E4PA 4O11A 2V3FA 1ISWA 2E09A 3GDLA 3W1MA 2OGYA 3WH5A 3SCTA 3GW0A 3MCMA 1UZDA 4XZMX 3D46A 3T0BA 3QOKA 4C6NA 3F2DA 3ZWTA 4LAZA 2QV4A 2ZTKA 2C3ZA 3G0XA 4V15A 2ZCGA 3MDWA 4H00A 3B9NA 2J8TA 4LUSB 3GNPA 1W5OA 1ONEA 4OOUA 3OGVA 3SY8A 4NZ5A 7CGTA 1PAMA 1T6MA 3EYPA 3AS2A 1VFSA 2B7OA 2XIIA 1EYWA 4Q8UA 2P5NA 4HCDA 3LBOA 1E55A 3U9IA 1KRCC 3VM7A 4EX4A 2GWNA 3KWSA 3N04A 1ME9A 5C9WA 1BEUA 3TCSA 1BXNA 3U57A 5I3FA 3S47A 4JEJA 3P74A 1R0MA 4A3YA 4YIWA 1MNZA 3ZFHA 2HEJA 4FI4A 3UFYA 1O1HA 4O1EA 3DCPA 5HUPA 3P67A 2DVXA 1UJQA 2Y88A 1A3HA 1LT8A 3S5SA 4QAIA 2WHLA 4FLOA 1VEPA 1S5WA 3SUUA 2G97A 1MNSA 3ZLGA 1JF6A 1R9ZA 3D0CA 3TEVA 5TF0A 2J24A 3E49A 3TOPA 2YZRA 4C6OA 2GZXA 1JCYA 2HS6A 3KOFA 3G1YA 5KTLA 1PKNA 4Y9PA 2YL6A 1NF7A 2DZTA 5EBAA 3VNYA 1HVQA 1NJJA 4UQAA 1J5SA 3NQAA 1GUVA 2X1RA 3H21A 3TVAA 5CH9A 4QQUA 3P0XA 1MYRA 4LALA 1VS1A 2NQ9A 3H24A 5J5RA 3VPLA 5AC5A 3U2ZA 3S6OA 1B54A 1I60A 1VJZA 4QM1A 1HNYA 5A6SA 4WD0A 1QPKA 1B3YA 2QV5A 4GZ7A 1TZ7A 3OYZA 3T4WA 4MOZA 1SJDA 3UZWA 1J96A 2NQ5A 1R8LA 1E0VA 4ACYA 3ME3A 1NELA 3V5OA 3S2MA 4C1NB 3MSRA 4O0ZA 1OGGA 1HO4A 5ABEA 3TXZA 4CCDA 4WGXA 3OZOA 4KWWA 4PFMA 2A3AA 1GVQA 1FHLA 1ICPA 1LLOA 4B5SA 3HBLA 5KZ6A 4HMNA 1YBQA 3EEZA 5GVJA 5IFPA 1XDMA 1H61A 3WFLA 3KS6A 1PIGA 2QDDA 4CKQA 1WOAA 1BHGA 1TJ2A 1K9DA 3W53A 4HA0A 4P8WA 3LI1A 1UPPA 3OQEA 1ZS2A 1U5JA 1IQ8A 3QQ1A 3HPSA 4RK8A 4HNTA 4JXCA 4Q7BA 1XSJA 2DUAA 3LZ5A 3TKFA 3QVQA 5C6MA 4H8NA 5BXRA 1MI3A 4Z2IA 3VX1A 1ZENA 2PURA 4S3KA 2D1ZA 2PU1A 3GY1A 3G1RA 1GQNA 4GQQA 3B8WA 3E74A 2R9RA 4IXHA 5GJMA 4US5D 5AHNA 1E72M 1VYSX 4MKVA 4QR6A 1KC7A 3AC0A 2FQIA 2W63A 2WMJA 3QKZA 1FWHC 3H7VA 2L5HA 2YOCA 5HWMA 1TTQA 1YYAA 4LNYA 1G6CA 1O68A 3KL5A 4ATWA 1XLDA 1RBLA 2WNZA 4LJ3A 3M7WA 1GVYA 4QDWA 2HNEA 4O28A 1Q2SA 2CLMA 2CXEA 5I79A 1F2JA 3GG0A 4URIA 5M2FX 5EKYA 1LL4A 2A21A 1S5TA 3R1ZA 4F8XA 1CZ1A 1Z3NA 4ZA0A 1RK6A 5BWAA 4FLQA 5H1WA 2RHGA 4ZTYA 4B3LA 3TTYA 3EWZA 1EXPA 2PDCA 4J2MA 2Q71A 2HK0A 4QE5A 4OFCA 4I9TA 4TIMA 1RQEA 5HATA 1TPVA 3URAA 4H6KA 4LY4A 2ZZ1A 3MBFA 1SPQA 1XSKA 4PFHA 1E6SM 5A8GA 5H6HA 7TAAA 4MADA 2YPIA 1P0EA 4KRTA 3BQ5A 4D6JA 2A7PA 3GKFA 3LDVA 1VLIA 4QQ3A 3B05A 2J74A 2PDWA 3CJPA 2A85A 2W5FA 3MUCA 4TVDA 2QNEA 5HNTA 1O5QA 3ALGA 1RZMA 3G3MA 3MSYA 2E25A 3M0ZA 3HF3A 4GI4A 2REQA 3G3DA 3S2LA 3BJFA 5D02A 2X42A 3LLDA 5B80A 3W3OA 3H53A 1LQ0A 2J9YA 5AFDA 3RN6A 2WLYA 5I2UA 2W66A 2J7EA 1S2AA 3TYDA 4HYRA 1YXDA 3LENA 5JUVA 1FP8A 4HBKA 1YDNA 3TDFA 4I5XA 3TE9A 1R38A 4YNGA 4F2TA 4EIVA 3VD3A 3MP4A 3BQ6A 2OWCA 1YE6A 2VUNA 3WNOA 3HPZA 3SGUA 4H7ZA 1Y7VA 5CSYA 3LOTA 1TB3A 4PMXA 1YBQB 2RUSA 3UNTA 3OG2A 4J28A 2ZE0A 2J7DA 5G1TA 4WOZA 1KLZA 4IUOA 2PZNA 2ZA2A 3ZWSA 1VEMA 2J8FA 1EBHA 2XJ7A 5A2AA 1F6KA 4HHLA 4LQ1A 3L65A 2VEIA 2X41A 2Y0FA 4JR5A 1XD1A 4WKFA 4FLRA 3GNNA 3I7QA 1J10A 1C9DA 4N9CA 2G95A 3U8GA 5D9OA 1CW2A 5T8GA 2YW3A 1QVBA 2PSNA 1V7YA 2FJKA 3QPZA 4JTKA 3ZLFA 3M0KA 5ECVA 1ITQA 4QIUA 2D2JA 3GYEA 4DZAA 3BDKA 4H8UA 3WBWA 4DZIA 3AIQA 4AX6A 4HK6A 4M7SA 2F6KA 4JN8A 1OF8A 3AU2A 4JD4A 3A4AA 4XAZA 3CMFA 1YDOA 3VC5A 4HHHA 4AZBA 1G0CA 2FTYA 3J7HA 3CT2A 4ICNA 1V5XA 5LNWA 1JYWA 1J2WA 4BWLA 4F79A 1NFPA 2XN0A 3NG3A 1O12A 3MBDA 1ZB5A 2Z1WA 4MYXA 3WQCA 5GJPA 1XH2A 5LNRA 4WF7A 4DPPA 3RO8A 3MMWA 1H2JA 4YHGA 3KZPA 3VNLA 2V5CA 2YL9A 4J3WA 1V0MA 1T5AA 1HVXA 1KFLA 1KGWA 2PI6A 5LHFA 1US3A 2PDIA 3L4YA 2FIQA 3VGGA 4JTHA 3G1SA 1JCNA 1S2CA 2BBFA 3IVSA 4WJXA 4I90A 3AXKA 4H41A 4O12A 4MUZA 3AXMA 2WZEA 3UG5A 5GNYA 1VPXA 3QC0A 3S9YA 4QROA 1KKRA 3R0KA 1FWBC 1EO5A 3GDRA 5HPCA 3AIUA 4JX4A 1M7OA 3WQOA 2REQB 8XIMA 3EWBX 3NL6A 2VELA 4L56A 1FDJA 5AYBA 1NU5A 2NX3A 1US2A 4GUGA 4MNMA 2WJZA 1KXVA 2GQ9A 1ZJHA 3PAOA 1EQPA 1RV8A 3GFZA 3W1XA 2E9MA 1WAWA 5KETA 1HKIA 3OIXA 5ECUA 4DNMA 3W6YA 5I3HA 3MCNA 3W7QA 5M3WA 3ITTA 1YPIA 2XVLA 1ZCOA 3K13A 3L21A 3M0XA 2J8GA 4MY1A 3OBEA 2PA6A 2ZVRA 1PBGA 1EZWA 3GNXA 4LB3A 2GK1A 2VFHA 4D71A 3L2LA 2A7RA 1Q85A 1LRQA 1QNSA 3AO0A 1NP0A 1Q6OA 1TUFA 4EXBA 2ZRWA 3ALFA 1HG3A 1WOBA 1D2KA 2C71A 5MKGA 3ANUA 4JTLA 4ZOEA 4Q7IA 2BY1A 1TV3A 5DELA 5IDIA 3FGCA 1R6WA 2C13A 3NQCA 1QOPA 2OR2A 3TSDA 3WEMA 4GYKA 4O50A 3T78A 4PMVA 4HPHA 3NQDA 3O16A 2O4MA 3RJXA 5IHRA 4DF2A 1GG0A 2GJRA 1XW8A 3WY1A 1SVDA 3W7MA 2CXGA 3SUVA 1B30A 4G7EA 3KLKA 3OHMB 4PTVA 4GC3A 3FA3A 3CZLA 1WUEA 1GVSA 2ONEA 5J8LA 1A4LA 2GGEA 2D2HA 4A3RA 3OVGA 1ISVA 1K3UA 2D20A 2QF8A 4GYJA 2VRQA 5LZLA 3MTWA 3M0IA 3K4WA 3TAKA 1J9YA 2A3LA 2Z7GA 1R9XA 2DY3A 3PTMA 3SN1A 2R1PA 3AROA 1WP6A 2GUYA 1UCWA 2CBJA 4BQ3A 4JICA 5C54A 1SO3A 4JIRA 1CCWB 1XYCA 1LT7A 3TYAA 3GLCA 2A6LA 4L1GA 2Z27A 3E5PA 1XINA 1EEXA 1JXJA 3A3XA 4GIRA 1Y5XA 4F2BA 2VENA 3AMCA 2NXIA 3UR2A 4AISA 3WNLA 1I2NA 4HN4A 4EWJA 3QGKC 2DSZA 4DPQA 1OC7A 1DIEA 3CL7A 1RA0A 1TTPA 4HU4A 2PDYA 3EWUA 4PRTA 3SN0A 4WX2A 2E6FA 3TNBA 4I7VA 3OVPA 5LKYA 4C7FA 1A5NC 1FWJC 3M64A 1E71M 2JEPA 4RPPA 3MHFA 2VRKA 1PTDA 2EXOA 1WDQA 3M47A 4QEHA 3GHTA 4HOWA 5BMWA 1GTHA 1RJQA 2P3ZA 2Y1HA 2R6OA 2IPJA 4FNUA 2PFHA 4PRRA 2VC5A 4TX8A 5BOEA 3CAWA 2B7PA 1OYCA 3W7OA 2CETA 1J12A 2ZICA 1XLMA 2IS7A 5FCZA 3L23A 3WN6A 3N11A 4J2PA 2FZNA 2DZUA 2VQUA 3DYMA 1E4IA 1SFTA 4G6CA 2GK1B 2DZVA 5BOFA 3LS9A 2V5LA 4JKLA 3O2LA 4FXJA 3SCPA 2EO7A 4GFIA 1NSJA 2XVGA 5FJRA 3A4WA 5HNNA 2PTDA 3KFTA 1XF0A 4EOUA 1B4KA 1C91A 3QHMA 3FA4A 2IQTA 4AVOA 1ZLPA 2OYLA 4YLWA 2XIJA 4JFWA 5MKGB 5G4HC 4ZMGA 1CDGA 4Q8TA 2XZ9A 3I4KA 3FGCB 1MW2A 3RAOA 5GNXA 1Z8AA 1ZJAA 2QAFA 4GH3A 1SW3A 1PB0A 1AUSL 3IIOA 1W3HA 1BVZA 3QW4B 3MCOA 1KTNA 2GSJA 2PDNA 3A64A 3SCNA 3LHVA 1M41A 2NLYA 4GVIA 4LVAA 4X22A 1PJ9A 5C55A 4G7EB 2FHCA 4IPIA 2YB4A 3DFHA 2VCAA 3OLDA 5FD0A 2ZKMX 2DFAA 4E4FA 4HK5A 4B4FA 3QV7A 1UZ4A 1XH1A 4OUEA 4JTJA 2QIWA 4L6OA 3CPGA 1OM0A 1W3NA 5JIWA 1KCXA 1HFBA 4AH7A 4JTDA 4M29A 2QQ6A 2Z2UA 1QOXA 5E6YA 4INFA 1J79A 2I5QA 3NNTA 1DXIA 2W79A 3F4NA 4IX0A 1QNQA 1OF6A 4KEUA 1JR1A 4QP0A 2VYOA 2J78A 2CNCA 3B0PA 4REQA 4DYKA 4L64A 3RU8X 1Y5VA 3FEMA 1W91A 3WUFA 3OB8A 1BXCA 2VTFA 3NM3A 3WH6A 2WNQA 3HB9A 3UJSA 3PJUA 1GEHA 1Z9AA 3A3HA 1E15A 4ICMA 1KGXA 4Y9MA 1I2OA 4XISA 3CAQA 5CGMA 1AZ1A 3U0HA 3QC3A 3CHDA 1TPWA 3VKCA 1H5YA 1KW1A 4LF1A 4HQVA 5CZSA 5A6BD 2XH0A 4MJMA 3BH4A 3QN3A 2R1NA 1W9XA 4WSKA 4BI6A 2J79A 3JZUA 2VKZG 1PX4A 4V33A 3RMEA 2XTKA 2AL2A 4AMAA 2PP3A 3ABZA 3VYLA 1XDJA 2ISVA 1DXEA 4GIYA 1GVRA 3PJTA 1T41A 2JEQA 2IUZA 3R79A 2WSQA 1E73M 2XSBA 1GZJA 4C1LA 4YPJA 4QX4A 3JUGA 5HNRA 2FPYA 1KFEA 3THUA 4JPGA 3Q45A 3ABRA 2BFGA 4OE7A 1JDAA 4AEEA 3LTPA 1W9BM 2YGYA 1JYNA 2CITA 3EOUA 1XBXA 1ADSA 2DQXA 3IVTA 5LIWX 4G5DA 4YU1A 2WVUA 3OYXA 4NJKA 4IX2A 1VCVA 2CHOA 1DQWA 1AQMA 1FBAA 5D09A 1UMLA 3OODA 5LSMA 1HJVA 4GKLA 2CIPA 3L0NA 1ZGDA 1L6SA 2QJGA 3AU6A 4N4QA 4I3GA 1H60A 1AJ2A 2ZVIA 4Z1YA 2R8WA 3GTHA 3GC2A 2WMHA 2A79A 5EMUA 4M56A 4D6CA 2EEXA 3MZNA 3AQUA 1POJA 4FSAA 1VBHA 1J0ZA 4L7ZA 3ATZA 4YVXA 4Q3MA 1FUYA 4CGTA 3N73A 1M53A 3WJSA 1T8QA 1JGIA 3QR3A 3SCOA 2OOGA 3P5YA 5CGTA 4AZGA 2F6XA 3UF9A 4ORIA 5HQLA 3S6TA 3TYBA 4PBFA 1X97A 2GDVA 5EMMA 1P0DA 1L8NA 2EQDA 2ACSA 4DWDA 3O6AA 1MWOA 3CIWA 4ZO6A 1TPH1 2OQYA 1ML1A 5HMFA 5A2BA 3W1QA 5HWNA 4Z2LA 1FCQA 2IW0A 3CIXA 3N6QA 5GJNA 1QMLA 2PWVA 2XM1A 2HE8A 5I7GA 1MZHA 4PODA 4V1XA 3B8VA 3MWAA 3GQYA 1H0GA 3W72A 1OB0A 3ZR4A 4F3HA 2UY2A 4FF5A 4YTRA 4XO7A 3TR2A 4REQB 3P60A 4XZIA 3QPEA 1VBJA 4Z0SA 3W0KA 3CIVA 4GY1A 3N4EA 4JEQA 4MLJA 1RA5A 1IZJA 3CTLA 1I9CB 1NM9A 2WWDA 4MKSA 5D9PA 1JCLA 4AZ6A 1SMAA 1NAL1 5FSDC 2H9AA 4C6PA 4KCWA 3R8HA 5C2XA 4O14A 1OG0A 4MJ2A 4KKXA 2QEZA 3QW3A 3IIVA 4UWMA 4RV8A 4HA4A 2FLIA 1N8IA 1BWLA 1IIHA 1HW6A 4UQDA 3AS3A 4HZ7A 1UWRA 1IEWA 3GHUA 3UJEA 2IPFA 1A47A 2AL2B 5CSSA 2PCEA 3HG2A 1XJBA 3V75A 1XFBA 5C9RA 1MEIA 1VIWA 3VNIA 1EWDA 4Q8WA 4EKJA 1HN1A 5B7YA 3NAVA 2QMJA 1G9HA 1CGUA 1LM1A 5A8OA 4ZZ9A 2VI0A 3IAPA 4NNCA 1AMKA 1PCKA 1VCGA 3NZPA 4RJEA 4JNYA 2GOUA 1KM0A 4GH1A 1Q45A 4Q4PA 1NARA 2PLJA 1DHPA 1KM3A 4DBEA 4Q22A 3KDNA 1E3ZA 2JKEA 4DZHA 2OMAA 6ENLA 3K30A 1XYLA 1OIMA 1Z48A 3T1GA 1IWBA 3KVLA 1DWHM 4B15A 3KOXA 4EXQA 1AW5A 2HBVA 1D8CA 2FZ9A 2C1IA 2VFFA 3UPMA 3M4HA 5LXEA 4BHYA 3DIPA 1FWWA 3SY1A 1JZ2A 4O4VA 1EOKA 3UY8A 2DPEA 4GLEA 1HIZA 3IJ6A 2C16A 2INFA 3QYQA 2UZ9A 4AZ5A 2F84A 3PBGA 4YJ5A 4XO6A 4JAWA 4IH3A 3RCYA 4F0LA 5DMLA 2WZTA 1OG6A 3B3DA 4LU0A 1MXSA 3PN8A 1GQJA 5D37A 2MNRA 4L4OA 4ONVA 3DHUA 1PCWA 3D47A 2Y89A 3LQLA 2QCFA 1YPFA 1F05A 4RL3A 1FFQA 3SCVA 1J0IA 4GO9A 1XR2A 2VMFA 3S2JA 4O0QA 1JNDA 5G4WA 3SADA 2WJEA 1KTCA 1OGSA 1W2VA 2B0MA 1BYBA 2PDXA 1RK5A 2X1IA 2DSUA 3LCWA 1X98A 4PUUA 2DT2A 5DCDA 4H9XA 4BCEA 3GVWA 2DH3A 1GYMA 4PEKA 4GQGA 3FY1A 2A3EA 1FTXA 1RBAA 1L6FA 3NFUA 1FCUA 2NVDA 3SCWA 1VJSA 4QLKA 1JL8A 4UFIA 1ZCCA 2GOKA 1E9LA 3WDJA 1K7EA 2PAJA 1RP9A 3WENA 1OD8A 5FIPA 1T7LA 3GVRA 3N4FA 1EJ7L 2H9AB 2CU0A 2XN2A 3VGHA 1EC8A 1D9EA 3EA1A 2IKHA 3RITA 2OXNA 1S3TC 4Q8PA 2Y70A 1FWRA 2NQHA 2W61A 3EZ4A 4YTUA 4AZIA 1VBUA 2HDJA 3GE7A 3H26A 4M80A 3NDYA 4GY7A 3CUFA 1JDFA 4PMJA 1JEZA 3KOWA 3AXIA 4AD0A 2AQVA 1MDLA 4PL2A 4LBSA 5E6ZA 1DWIM 4JNZA 1PS9A 3N2CA 1X6LA 3M5YA 1XLAA 4JTCA 1CXKA 5DRIA 2OLSA 1A4MA 4IPPA 4DYJA 5BMXA 3LXCA 3LSBA 3E0FA 3NQBA 5HPOA 2OCZA 2PLKA 3HGOA 3R13A 3EPOA 4PRWA 1VFFA 2V5KA 5DY3A 2FFCA 1B3XA 1FHUA 3TLLA 1B31A 1SM9A 3TLQA 3MI2A 3IJQA 3U48A 3PBUA 2E8YA 3T09A 2QS8A 3THQA 4GIEA 1UWAA 1KM4A 3P62A 2Y4SA 1PKMA 4FNPA 1M03A 4ZO9A 4W89A 1QCWA 4UUIA 1GQIA 4ZVJA 2WJDA 2PTWA 1Q2RA 1W6TA 2A1YA 3KX6A 1JZ4A 4W8AA 3GRIA 4MKNA 1O1ZA 3WLNA 1YTEA 4IG2A 4IIBA 5M17A 1TZ9A 1KBJA 5CAKA 4LRTA 2HNHA 3W24A 3AIWA 4UQ9A 5EB8A 1TV8A 3WKZA 3SR7A 3AYVA 1TPDA 2FDSA 2G96A 2WBKA 3CS2A 4K36A 1DPMA 4FXRA 3IGXA 1ZAIA 3TWBA 2KX9A 4YTTA 3AS0A 2FHFA 5DQPA 4J4KA 5EFFA 3DFYA 1CT5A 4A21A 2R14A 1I8JA 1TTJA 2ZRUA 1SZGA 3AUJA 2VVNA 3CZJA 3CZKA 3GU2A 2QPSA 2QR6A 5LA0A 1FWFC 2D22A 1UD3A 3TOYA 3WMLA 3PZIA 1DE6A 4LYPA 2WQDA 3D5HA 4CNSA 2XUCA 3NGFA 2CPUA 3ZR6A 5CAHA 5CKSA 5HULA 4I9MA 1U83A 2TSYA 5A6MA 3N2TA 1QXLA 3NQMA 1QR7A 3PZUA 4DIAA 3NQEA 2WM1A 5KMYA 3ID7A 1ZJBA 2G3MA 1VHNA 5A2CA 3SCRA 5FJIA 4JTGA 2J7FA 2OX4A 2QF7A 2W3ZA 1HGYA 4CNUA 1B3WA 3DZ1A 3O8AA 3KW3A 4NT0A 4JY8A 5TD4A 3GIPA 1ODUA 1W1B1 3N25A 1RXOB 1TV7A 4KPLA 3RG6A 3KZSA 4F2UA 2WKLA 4Y8FA 3SRFA 5FKYA 4A3QA 4ZODA 1T40A 1OABA 3HV9A 1XI3A 3E2SA 3P81A 3BGAA 3QR0A 4MG4A 1ITXA 4BF7A 3QEZA 4QCFA 4OGZA 4AVNA 1VAHA 3RGTA 4AF0A 3W7JA 1KRAC 1DHKA 2V81A 2W92A 3IACA 3HG3A 3BTNA 4PTNA 2WJFA 4AMCA 5LIYX 3EXTA 1TWZA 2FFIA 1PTGA 1W9UA 2RDXA 3WQDA 1XV8A 3CH0A 1JRCA 1ZALA 1A5CA 1UWIA 3DFPA 3PF3A 4KMQA 3W87A 3BSGA 3UWEA 1SSDA 5F2GA 4FO4A 1IT0A 3T8QA 2CHNA 3QOMA 5U4NA 2GWGA 4A35A 1AH0A 1F4HA 6TAAA 1WKEA 4RX0A 2XIQA 3GTIA 3KDOA 2BWGA 3LXBA 5D04C 3AI0A 1DV7A 4O8AA 2DUXA 2YFNA 3WL1A 2I7GA 2WHMA 2A4AA 5AYXA 3H2FA 1HKKA 3P7YA 2ZDSA 3IARA 4Z42C 2YFOA 3OZMA 4GUJA 1VPYA 5CPSA 5M03A 3FCPA 3PS7A 5CJ5A 2QVHA 1XGZA 4LGXA 4Q4MA 3AWOA 3NZRA 4PCFA 4LUIA 3PUEA 4IG2B 4Y8EA 1QK2A 1JUBA 2C0AA 3LHTA 3GZ3A 1KV8A 4UTWC 4XD4A 4CVWA 3DESA 1GKQA 3NQ7A 3BCDA 3V18A 4G8TA 3G1HA 4AB4A 1PZ3A 1OK4A 4L6DA 3WQWA 1EA9C 1B3OA 3I7RA 3C3UA 4DM1A 3TQVA 1QU4A 4H2HA 1M9HA 1TE1A 3QZ6A 3N3TA 4AYGA 1OC6A 1KM6A 1UQZA 5F2IA 2B7QA 1SFJA 3QKEA 3XINA 1FWEC 2P0IA 1GQLA 1UD6A 4O52A 5DCBA 5ENLA 2CBUA 4M8UA 5CG7A 3C4UA 2OFJA 2V3GA 3URNA 1QNRA 1B4EA 2BXZA 5KEZA 1LROA 3W6LA 5A8QA 2FJUB 3W1NA 5C71A 2H6RA 4ZOCA 3BG3A 3KBVA 3RR1A 3LCFA 5F1VA 2GVLA 4JS3A 1RBOB 4TMCA 3WELA 1YXYA 3CO4A 1BD0A 2MANA 3O63A 2QAPA 2PPGA 2DQWA 2G3NA 3D3AA 3TC3A 5G1YA 2V6AA 5F2LA 4BI7A 4DJDA 4KCUA 5C2GA 4LVFA 2YCKX 4Q8NA 2XFYA 4PTWA 1SUXA 4HK7A 1W8GA 3FVMA 4U4MA 1G1YA 4G9PA 3SRHA 1BXBA 4RZ6A 4AF0B 1XS2A 3EB2A 1TELA 1V02E 3S9IA 2WAGA 2D3NA 2ZA1A 3VIMA 4X9YA 1H63A 4QFUA 1XLCA 3PTDA 2IXVA 5D2VA 5IBXC 3HPFA 1K6WA 1TX2A 4ADSA 1R3RA 4HOZA 2PTZA 3HMCA 4PUKA 3K8LA 1QI0A 2A6NA 1IWPA 2VZVA 3GTNA 2QUMA 4A6GA 3GBDA 2Z1VA 1A5LC 2B4GA 3QY6A 1U30A 3THDA 1KXQA 5BZAA 1A5OC 6REQA 3DFQA 2D23A 3DDMA 3WLOA 1XIJA 3EOEA 1XIHA 3VM5A 4UNIA 2C19A 3F03K 1H7RA 3MPGA 3PULA 4WJEA 1J6OA 1K7XA 4M51A 2Y6ZA 1KFJA 3VOCA 1SSGA 4FNTA 2IKGA 1IXQA 4DJED 4H9ZA 3RX3A 1SZRA 4GVFA 4UR9A 4U28A 4FNRA 2VC7A 3CZGA 4NJGA 1P6CA 3ONCA 2NSXA 2DIKA 3O6YX 4FX6M 3RRAA 2BS9A 3MMUA 1IXOA 2OEJA 3N15A 1AH4A 4HB7A 2X7WA 2QZRA 1TV5A 2CBVA 3GWQA 2O9RA 3VO0A 3AAMA 1J2BA 4H3DA 4JN7A 4BEUA 1J0HA 1VBGA 5I3DA 4BF9A 2WV8A 4ZL1A 4G1NA 1GG1A 4QAWA 1EOMA 4AX7A 1JPMA 4PUMA 4NI3A 2NX9A 1M5WA 1EDTA 3WLQA 3MMDA 1V6XA 2DJXA 3TW7A 1KLYA 1BRLA 4HOXA 1KRMA 3MANA 2HRWA 1UR0A 1JNEA 2PWFA 5HK4A 4CD8A 5JBFA 3WK3A 5I23A 3UYIA 3R2GA 4DNHA 3IJDA 4IIFA 3FJ4A 4X63A 4AIBA 2I9UA 1UR4A 3A9BA 4Y2WA 1R3SA 4DJEA 1BQCA 3ABOA 3PWAA 1NY1A 1A0DA 1UOKA 2H8ZA 1KO0A 2QULA 1V0NA 4Q8QA 2X2YA 3PB0A 4UOJA 3VILA 1MRAA 2JQXA 1N55A 2WHJA 2W91A 3BXWA 3OVQA 2AAAA 1D8WA 2PDGA 4LANA 4QSHA 2V30A 2Q8ZA 4TQTA 4X2PA 3WO8A 1UHVA 2D69A 5FEPA 4OUIA 3R0UA 3SRDA 1NOUA 2UY3A 1E5JA 2ZZ4A 3VDAA 4IQEA 3VX0A 4B5VA 2JKAA 3KCLA 5LNUA 3Q4DA 2PGWA 4PMYA 1R46A 2O9TA 1CB7B 1AW2A 3W2LA 3WD2A 2QDHA 3W1UA 2E40A 1R5YA 5F1UA 3LPOA 3CV2A 4WEVX 3ARZA 1G4TA 5EY5A 2ISWA 4S38A 3F4CA 4MWAD 4RE4A 4POCA 4O53A 3ZSSA 4K37A 1V03A 3TN6A 4AQLA 2IXUA 4JTQA 1VKFA 1XYZA 3ZOAA 2VZSA 2EJ1A 3O0KA 2E4TA 2VT0A 4HJWA 4OKDA 2Y5JA 3VGFA 1XD0A 4H19A 2WVSA 2V0TA 4KQNA 2NQLA 3W7IA 5C9XA 3TN3A 4JQ4A 4JNMA 1PIIA 4AY8A 2AGKA 2OWXA 4WDUA 5A8MA 3OVRA 3UERA 1TWIA 1BTCA 2FPVA 2QPXA 3GDMA 4LBUA 2W9MA 1TCDA 1YMYA 6REQB 3KCJA 2CLKA 4E2OA 1J5TA 1D7KA 1P5BA 3TU9A 4ZE4A 3MSGA 1OBAA 3IV3A 4V28A 4V2XA 4PUDA 4HTBA 4K38A 3DBPA 3NDZA 4ADUA 3TZFA 3VVGA 1QRQA 1G4SA 2PMQA 4LC6A 2OKTA 3OPSA 1EJSC 3I65A 5FL0A 3LHZA 2HBXA 4ZQMA 2XDFA 3PZOA 2UY4A 4JTTA 4QTGA 3BCJA 4GXWA 1C8VA 3XIMA 2YCEA 4WLCA 2WMKA 2VGGA 6XIMA 1GHSA 3S1XA 4QLLA 3WLTA 3PR2A 2WCGA 4R33A 2G50A 5FESA 1MFVA 1AZ2A 3BJTA 1BF6A 3CQJA 2AKMA 3GBEA 4MPQA 3H2MA 3LPGA 4CVUA 5MHBA 4CU6A 2WC3A 1H50A 3RM8A 2WVVA 1CEOA 3PZNA 3E1F1 4M5PA 5BU9A 3AMLA 2ZTJA 1H7PA 1L6WA 1O7AA 1A53A 3LV6A 1NFBA 3FLUA 4PE8A 3RDKA 3U6WA 1BRLB 1UKQA 2CHRA 2ACUA 4U3CA 2HMCA 4OTKA 3O07A 1E9YB 4LH8A 2P3EA 2YYUA 1RCQA 3TV8A 2J25A 3TW6A 4KESA 3KRBA 2PBOA 3DG3A 2OX1A 3H4XA 2ZWZA 1MQPA 1OZQA 3GIYA 3DN5A 4AXKA 1FDYA 2JIWA 1WO2A 2WZMA 3E0IA 4XZLX 3UG4A 4QS5A 4YN5A 1RH9A 1TMHA 3VOIA 2VR2A 1W9VA 4XAFA 4IL0A 4MFDA 3AXXA 1FWDC 2FYMA 4UB9A 3RF9A 3E0WA 3AS1A 4J9JA 1JD7A 4F0HA 3IANA 3MHGA 5H8PA 5I5RA 2QDEA 3WDQA 3M9YA 5I77A 4OQVA 4CQBA 2CYGA 3DH7A 4P61A 3GYCA 1UQYA 3DU0A 4DWSA 4D72A 4KW2A 4N7QA 3LZ3A 4J3UA 2ZXBA 4OWGA 3S83A 3L67A 1FH8A 3ZVIA 2FB2A 1WDPA 3PC0A 4NAEA 2TODA 4IJCA 3MYOA 1FQ0A 2CLOA 1XCFA 3LCXA 2O56A 2CCRA 2IKIA 1V3JA 3AUOA 1BSIA 1QJWA 1BLIA 3HQPA 3T81A 3W25A 4F0RA 1XUZA 3H7RA 3OG3A 5ABFA 4DO6A 1EL3A 2X0HA 3RU6A 2ZC8A 1NIUA 3VD4A 2TYSA 4PMUA 3T44A 3N9SA 1RLCL 5FEZA 1B90A 5I3JA 4W8BA 2ZX5A 3GXFA 1GZ1A 4UTFA 3G1VA 4P8XA 5AVHA 1W37A 3OOQA 1XYMA 2V5JA 4PMZA 4ZB2A 2OU4A 3SZ8A 4CNTA 4BS0A 3TYZA 2PF8A 3ZT7A 3TJIA 1XIFA 1VJIA 2WC4A 5AHMA 3CWHA 3BC9A 1VR6A 4R9XA 3TMLA 3VFLA 3DG7A 5A6AA 1R2RA 4CNPA 1XRTA 3PBYA 2OSXA 1CNVA 4IQJA 1J11A 3C8FA 2X05A 4GRSA 1UUMA 1I2QA 2DSWA 1PSCA 1XICA 3N12A 1E3XA 4R27A 1CTNA 4AWTA 2E6AA 3LYEA 5EMKA 3WEZA 2YR1A 4LWWA 4PYSA 2WVVB 4JKKA 1EHAA 3NA8A 1PL9A 3KP0A 1K02A 4S23A 3HFTA 3DHFA 1J18A 1KXHA 3MJMA 1EX1A 5F4WA 3N2XA 1HT6A 4OU1A 2V5DA 4R88A 1WXZA 5DANA 1DJYA 2XIBA 3N2MA 4WZHA 2A3BA 1JZ8A 4K8GA 4OECA 1I2PA 3ZZ1A 3L4UA 4CNOA 2FZDA 5D9MA 3W7EA 3B03A 4TMBA 1T96A 3K8KA 3HQOA 1OX6A 4MSSA 4L65A 3DENA 5A69A 1Q5MA 1RJPA 1QATA 5REQA 3DHDA 4JYFA 2BOEX 4HYWA 2D2OA 3AALA 5BU6A 3TFXA 4E8GA 2WBGA 3VIOA 3A4XA 2DZSA 4M1RA 4UXDA 2XZ7A 3CUJA 2G5WA 3FHQA 3ITVA 3EDJA 3VIGA 1WDRA 3I7SA 1ODZA 3N3MA 4LAUA 1X7FA 3UU0A 4Z1AA 1ICQA 2OYKA 2WCSA 1VEOA 4ZB0A 3SQMA 3HA1A 2OPJA 4HU8A 4GA8A 5AHLA 1RP8A 3QGAC 1SMDA 3CEPA 3TMQA 2D0HA 5JVLA 4J3ZA 1V3LA 3OBAA 3VMNA 3MUIA 4DWSB 3W83A 4QDPA 2UV8G 4JZ5A 1LQ2A 4QHRA 2QHAA 4B3ZA 5CXPA 3AIRA 3DOPA 4UTTA 4NAEB 4M81A 4WJ8A 3AMDA 2GYIA 3EPNA 2PGEA 3VUPA 4YYCA 3G8EA 3CYVA 4UQCA 1FOBA 4HIBA 5ABFB 2XINA 5FJPA 4RW3A 4MPKA 1GZGA 3SFKA 1QHPA 3ZVHA 4WUIA 4D6HA 1YW1A 3N34A 3PPGA 4GVHA 3EDKA 1KV5A 4W85A 5D2WA 3UXAA 3V16A 3M43A 4ZXOA 5TIMA 4U33A 4IJRA 1XRSA 2FGLA 2Z2BA 5I6SA 5DY2A 1OCJA 2D0FA 1XG4A 1RVGA 3OP2A 1TPUA 3VI2A 3F4DA 2VX4A 4HSOA 2BV9A 3C0QA 1VYRA 1G01A 4UCGA 4DAFA 1F7BA 5K7JA 2B7NA 1UWQA 3VINA 1EP3A 5FAJA 5CBBA 2BNJA 1W5PA 1ZP3A 1HJSA 2WSPA 3OW1A 1GVEA 1K9TA 2XHYA 3WK2A 1GYLA 5JBDA 3STGA 4ZOBA 1PWMA 2R24A 3WH8A 3BO9A 4DJFD 1G4PA 3JU2A 3W22A 5I3GA 1PPIA 4CCCA 4B9YA 4MB1A 2JF7A 1CGTA 3LHYA 1MXGA 3FEQA 5LNVA 3ES7A 3DC8A 3WD1A 4C6IA 4N6FA 2QKFA 3U5YA 1E0UA 3V35A 4W87A 2V3EA 1DJGA 4DI9A 4BWLC 3CTTA 9XIMA 1M1BA 3VIJA 2Q3OA 3BZJA 4RNIA 1BWKA 5JU6A 4Q8OA 1D3CA 2O9PA 3CHEA 1NOWA 1UROA 5FACA 5REQB 3UCQA 1OFOA 3NOEA 2NUYA 3RM9A 1XLFA 2XG9A 3QY8A 5A94A 1PV8A 1E5NA 1W9PA 1S38A 2TMDA 2FVMA 4S3CA 3N2OA 3WQ4A 5EL1A 4CD7A 4TR9A 5G4EA 1QNPA 6ALDA 4GJJA 4K1WA 4HHPA 4C91A 3IUDA 4ZGYA 2VO5A 1XXXA 3FNDA 4IXXA 4R5EA 1ZBWA 2G37A 3MUY1 3XISA 4FMVA 3NQ6A 5BCAA 3LM7A 4EE9A 3B8TA 3L5LA 1PZ0A 1CGXA 4HSNA 2VURA 4FR6A 1CLKA 2ASHA 4PCTA 1CGYA 1XWYA 1TPC1 4FS9A 3B04A 4AD4A 1KBKA 4IQDA 1C8YA 5GPRA 3DAQA 3NPWA 3T8LA 2E6YA 2YLLA 1EPVA 4IQLA 2NT0A 1FX6A 1GT8A 1LWHA 3WNKA 5EYWA 4O17A 3IV8A 3Q65A 4PMDA 4Z2KA 3M0MA 4PTMA 4AY7A 3AJ7A 5G5IA 1ISZA 1O94A 3ARSA 3ZVHB 3MV01 1H1ZA 4GO8A 3GNDA 4HNCA 4JQ3A 5LIUX 4RDYA 2Y5SA 4JIHA 4IGHA 3KP1A 2HWGA 4XSMA 4Z2GA 1HKMA 1YE4A 4R53A 3W7CA 4HPJA 1ZY9A 1MMFA 3GNOA 5A6KA 2JGQA 3KBNA 4UTKA 1IR1A 2YBTA 2ON3A 3OGSA 1RY8A 3UYCA 2DDXA 1BSLA 3AYSA 2VM8A 2PU0A 3B0YA 1LG1A 3LBMA 2V2HA 2YDAA 3E96A 2VC9A 2JGYA 3LX9A 5CGQA 3OLIA 3T05A 1W9DM 3BOLA 1KCZA 3EAUA 3EWWA 2YX0A 3W7NA 1FDZA 4E2BA 4P7NA 3R94A 1EJTC 4J1OA 2DSKA 5ABGA 3VE7A 1R3QA 3THAA 4JFSA 4S2BA 1WNOA 1QHOA 4AAJA 1Y5WA 2FMOA 2DW6A 1TIMA 1DIDA 4XX6A 3VKBA 2X0SA 3FKKA 1GOKA 4E5TA 2BY2A 1MO0A 4WQ6A 2VEPA 3L0GA 4ZQPA 3QFEA 1V08A 5LXXA 1E1CA 5DRCA 1ENUA 4GE8A 3AHXA 3SY5A 3EX2A 3L4TA 3ARTA 3OEXA 1U5VA 3RM4A 3ZO9A 3S42A 5E1QA 4CNNA 1AQ0A 3CU2A 5D8WA 3AZTA 3GB6A 3LA4A 4NX5A 4PGLA 5D9NA 4KERA 2EPOA 3NZ1A 3R5EA 1YHTA 4LEFA 5C7VA 5CPQA 3B0XA 1ZTVA 3CL6A 1WXYA 1KWGA 3WLSA 3CZEA 3ZS4A 4NAFA 2YBVA 4KWOA 4XZBA 3F1QA 4JDYA 2BSLA 3EOOA 2H8XA 1KQZA 1THFD 2BXVA 1XLLA 3UA3A 4AD2A 1TMLA 2VNCA 3K4DA 4GCXA 1SFLA 4GHRA 4LYQA 1NDWA 2V3DA 3VDBA 2ZXDA 1B3ZA 4C6EA 2O55A 3KL0A 1G7VA 2AQWA 3BGJA 4NZFA 3T0AA 1B9ZA 2Y8VA 1HL2A 4RUBA 4WCJA 4GQRA 2SFPA 3KOYA 4PUNA 1TJ0A 2P50A 3HU7A 7TIMA 3NTYA 4WK9A 4UFLA 3C2RA 1XGDA 2NT1A 4XZ9A 3I3DA 2VD8A 1E43A 1U1HA 4LRSA 4IHCA 1HGWA 5H8UA 2GPTA 2VEMA 1CXFA 4GPNA 3OO2A 2ZXAA 4PMNA 1JDEA 3TZNA 3C5QA 1XIDA 2RDTA 2Y8KA 2Q02A 2X40A 3VDHA 1X39A 3TROA 1BYAA 4L9YA 5KZEA 3RLVA 3L2MA 4A8NA 5CC7A 3MP5A 4FOJA 1XIIA 2GJLA 2HPMA 2WCAA 4AIEA 2GVYA 2J47A 3LQGA 4W9TA 3W01A 3NVTA 3B9DA 3BL3A 3OIHA 4AFYA 1E6ZA 3EXSA 5FJJA 1ITUA 4ZE5A 3MB9A 5BRQA 1YQ2A 1UR9A 5CJNA 1UB3A 4DX3A 3WUBA 2HPIA 9XIAA 4EPEC 5CLWA 1ECEA 5A3HA 1VFUA 1YPXA 1ZSXA 3PZVA 5AHEA 4IISA 4GCAA 1UMYA 5I06A 3VCCA 3WLPA 4XQ6A 3WDRA 3QY7A 5A6LA 5E9XA 1XLKA 2I57A 1MUWA 3A21A 2OEKA 3MA8A 3KTCA 3FFSA 4LAKA 2POZA 4PB5A 2XM2A 3TSBA 4GGBA 3PG9A 3A22A 5DX7A 1VLWA 3CT7A 1CIUA 1KBLA 5E70A 1Z89A 2H90A 2FHBA 1E1CB 3TTSA 4TXEA 3RXZA 3E0VA 2FVLA 1DJQA 1EHNA 3GS6A 3NQ2A 3TQ0A 4MDPA 1XBYA 1EC9A 1ZJIA 1E6PA 1K8XA 1HXJA 2NV9A 4AXNA 5J5DA 3WG6A 3L4XA 4CD4A 1DWGM 3ARRA 2XN1A 4GI8A 4Z17A 3VFCA 3B06A 4M6VA 1A50A 1EP2A 3UNDA 2Q09A 4W7UA 5HMDA 4Y6GA 2JKPA 2VX6A 1ZHAA 5AB3A 3AXHA 1CGVA 1HJWA 3H12A 3MS8A 5IHSA 2UWFA 4NAFB 3MKCA 3H2AA 3S1UA 1HO1A 2XGBA 4ZB5A 1UKOA 3DHPA 1VHCA 3VC6A 2ZFAA 4GUIA 2E5CA 1JULA 3QTGA 1F73A 2WNWA 2VL4A 4IPNB 2VXNA 1ITCA 1X1ZA 1RD6A 3W27A 4OT7A 2V67A 1WKDA 1FWTA 3LM3A 1XYFA 3OA5A 5CC5A 2DJLA 4G7FA 3FV9A 2WYSA 1W17A 1HKWA 2AKZA 3JW7A 1P6WA 4LV4A 1C29A 2V9DA 3ITOA 3RX2A 4RZ4A 3V0UA 3BOFA 4FHAA 4IM4A 4NYYA 3ARVA 1OINA 1KB3A 1UD4A 1MSSA 1V7AA 3CC1A 4S3GA 2J62A 4AIOA 4IP4A 3BLFA 1XBVA 3GHRA 4GXPA 1WPCA 3W9ZA 3W7HA 3UWWA 3WQPA 2Y2WA 5DT5A 2PUZA 4JFTA 1TIWA 3P61A 3JR2A 2O7SA 1W56A 2VHLA 3N13A 1OX4A 3LRMA 1W5NA 3HG5A 5K3VA 4R34A 3RRXA 1EH9A 4Z1BA 4D8LA 1Q8AA 3UBPC 3CV7A 4L1XA 3N19B 2BGNE 3PP7A 4UTJA 3CQIA 1H0IA 1RY0A 1E0WA 3PZTA 4D6GA 1HKJA 1UA7A 2Z1SA 2TRSA 3CWNA 1VFLA 3W84A 3CHFA 4QNWA 3NGJA 3LY0A 4Q32A 2Y85A 4W8LA 5G1MA 4Q8VA 1GKRA 3C2OA 3UCDA 3TTQA 1IIGA 4ZR8A 2GVGA 4CQAA 2P88A 4O16A 3GKAA 4NILA 4H6QA 5T26A 3UZXA 1CENA 4ZXLA 2OLHA 2LLEA 4IP7A 5E5CA 5EFDA 4US5A 4A2SA 5IOBA 2VOMA 3AWNA 4YL2A 3POCA 3NPXA 3I6RA 2POTA 3EB3A 1R86A 1TQXA 2G3FA 2X1SA 3PTQA 3M5VA 4ROPA 3VKDA 1MEWA 1QI3A 3WMCA 1P7TA 2P53A 3FJLA 3CPUA 1UP2A 1T8XA 3WFZA 3SM0A 4HYVA 3LV5A 1VB9A 1DJHA 4NU7A 4L9ZA 5HR7A 2WANA 3GH4A 3OGRA 1FKXA 4PA8A 4IMGA 1UA3A 3KBWA 3PZQA 2I56A 5LA1A 4UBPC 4A3UA 1TYGA 4HNUA 6TIMA 4QEEA 2OTDA 3AIVA 2I5IA 3U2EA 4PN2A 1EGVA 3EB4A 1AG1O 4Z2JA 1NFGA 2ALDA 1JZ3A 3LNMA 3Q67A 3W7GA 4GABA 3QSTA 1MXDA 3BW2A 3VIIA 3P14A 4W4QA 4UFKA 3A5VA 4XKYA 3GXNA 1N8WA 4FNSA 3FYPA 3QF0A 2WOQA 2INEA 4D1JA 3AHTA 1QO5A 1ZUAX 4IICA 1GOMA 1CYGA 4XV0A 1E40A 4GQBA 4AVFA 3STPA 2ZX7A 3A3WA 3WF1A 4DM2A 4JTFA 1F3XA 3FKRA 1M01A 1ECQA 3EX1A 3CLMA 3CUIA 1S2WA 1H7WA 4F66A 4IIGA 5T9CE 3E3HA 2V63A 3QMTA 1L2QA 1S5MA 1S5VA 1JZ5A 3AICA 2X2GA 1K4HA 4XVDA 3IUHA 3IGUA 5XIMA 1P1XA 4DBUA 3RNDA 3VMOA 3R7MA 3IIXA 2XH4A 4LV9A 1FH7A 1JFXA 4MB3A 4B5NA 4C90A 1RQBA 3LBCA 5HJYA 1S3HA 3WEOA 1NQ6A 1GCYA 3O1NA 1Q66A 3MO7A 4ORMA 1OX4B 4DXVA 4AHPA 3FX4A 1ISXA 5A6TC 2CLLA 3ZMRA 1GQKA 1W8SA 1V0LA 7A3HA 1B2YA 4JCMA 1NDYA 3UR7A 1WKFA 4QG9A 4H9YA 3BW4A 2GVEA 2VCBA 3B4UA 1YKWA 2CERA 1H11A 1SW7A 3M44A 4FX7A 4DF0A 5MF5A 2PWUA 2KZHA 1JUEA 4IGSA 3CYJA 2OZTA 2CZEA 1QDSA 3K8MA 2XYLA 3EGJA 1XRVA 3VD7A 3DYOA 1I4NA 1TPFA 4JFUA 3VK5A 1W3TA 2YL8A 2PDKA 3PUOA 4R9OA 4XD5A 2BVYA 3AHVA 1PYMA 4IGNA 2DU2A 4FR1A 3IIZA 4W5UA 2Z6IA 1CB2A 4US6A 3L9CA 1P7TB 3L4VA 3MSDA 1QK0A 5KZMA 1SJAA 1QBAA 4LB4A 5C0QA 2QUVA 3DYPA 4YYFA 1OFRA 5BXSA 3OQ8A 5CSUA 2J7HA 4YWSA 2PWGA 5RUBA 3NXLA 2PWHA 4RW5A 3W2NA 2F6UA 1LL7A 1C92A 3EMQA 3WJYA 5J04A 3G1DA 4Z1DA 1GKPA 1QASA 1RPKA 2ZXQA 1FCVA 3BWWA 3AHYA 4AD1A 3PUDA 3GVVA 3LXAA 3T0TA 3SCQA 4XKYB 3AHZA 2O7QA 3AZSA 1XC4A 3G0SA 1KCKA 3G8RA 3I6TA 4HNLA 5EPDA 3V5FA 1Q6CA 3BLKA 1F3EA 2QGYA 4MAVA 2G3JA 4CEXC 3GFXA 4N42A 1BG4A 3KCOA 4UZUA 1B9BA 3IGSA 2VZUA 4Y90A 5DT7A 3H8AA 3V3WA 2FKPA 3WFAA 2HROA 1LL6A 1UKSA 3RILA 1RHCA 4OIFA 3BAYA 3CQ0A 2INZA 4DELA 4H1ZA 3TAOA 3NYZA 2PZ0A 1LLZA 5FEWA 4JIQA 1XLIA 1L0PA 3WF2A 4HT3A 3WQ5A 3II1A 2B31A 2ISDA 4I7WA 1TPB1 1TVLA 1VFHA 5CPNA 3BVJA 3TJLA 4A8RA 3C56A 1JPHA 1GYNA 2DORA 3A4JA 3OJGA 4XZNX 4B92A 4UTUA 1JAKA 2VX5A 1UWUA 1MW0A 2TAAA 4LS1A 1NVMA 2DEPA 1XX1A 4TV6A 1EIBA 4DO7A 1YNQA 1H41A 4B5TA 3BLOA 5G2HA 1IV8A 1Q7QA 2WB5A 5K9DA 3VIKA 4PUEA 3WNMA 4HZMA 5AYYA 3HZ3A 4GUFA 2OO0A 4I6VA 3PB2A 2WK2A 2I9EA 2GGHA 1PUDA 1E0XA 4S3EA 1F76A 1TRIA 1J0KA 3H2EA 3T7VA 3UJ2A 4D6EA 1UR1A 3W71A 4YWIA 3AYRA 4MMWA 4ZSTA 1YIXA 3DGBA 4JTRA 4NZ3A 3S9ZA 4FF7A 3HGRA 4IWWA 3LGDA 4DUXA 2PC4A 3STEA 4GXMA 4QDMA 1MQRA 3T40A 3VIFA 5LYRA 4ASTA 2OJPA 1F5ZA 4WIWA 2J7BA 3R25A 1J93A 4F40A 1RSCA 1TWDA 1TJ1A 3NWRA 2DW7A 3E02A 4FALA 4YCOA 1GPFA 1W0MA 1WE5A 3R58A 1YNYA 2J77A 3VABA 7ENLA 1QPRA 2YW4A 3W7RA 4A22A 2X30A 2D73A 4XD3A 2C8NA 1WYIA 3GX9A 3WH7A 1OFBA 3UZJA 1PIFA 4ZEPA 3FYYA 3B8IA 5HINA 3WDHA 3WLJA 5CSRA 3E6EA 1EFZA 5K9CA 3G1AA 2F38A 2DT3A 1H4PA 4WKHA 1KCLA 4GFSA 4JQ2A 3APTA 3QLLA 4PBEA 1YNPA 3MT1A 5LGXA 1R87A 4IFKA 1TTIA 4PSPA 2CBIA 3BLPX 4C60A 3EPMA 4MJ4A 1D3GA 4ENLA 1FP9A 3P0WA 2DZAA 2GJXA 4X2RA 3NO1A 1AQHA 3IVUA 2E3ZA 4IL2A 1LRNA 4LVDA 1WKYA 3VCRA 4BKNA 4RE0A 3E2VA 2CKSA 2VGBA 2YCLA 3CAVA 3KRUA 3IEBA 3UJFA 2MUCA 4MAZA 2AQOA 3DECA 5D05A 1PX3A 4L5ZA 5H2ZA 3T0DA 3MKVA 3FJNA 1U33A 4J40A 4KRUA 4JIEA 1G94A 4E4UA 1V6WA 4JOMA 4NSBA 4O1AA 1X8FA 3L4ZA 3QQWA 1JIBA 1H51A 1VC4A 2PDQA 3ITCA 2G8ZA 1DJZA 4U10A 1XIEA 3SUSA 2O9OA 4TTUA 2WNNA 4LUYA 3PZMA 2ZZ3A 1PDYA 2ZZ7A 1W32A 3FSTA 1TKKA 1XFCA 3B8SA 4P8VA 3M5ZA 2Z1KA 5IDZA 3VOHA 3VD9A 3BE7A 3UW6A 3VTRA 2CLIA 2VDGA 4L4PA 3VE9A 4ZFMA 4XBKA 4ERGA 1J01A 4O10A 2R1MA 3YPIA 1RALA 3G6MA 1HZYA 4LOCA 2EBNA 4NZ4A 3LCGA 3AIEA 4NKCA 1R7OA 1UD8A 4GACA 3DI0A 3R4IA 1NOFA 4S3FA 1EJXC 3NSXA 3GUWA 1TREA 2YL5A 3O9NA 3VNKA 3QQ0A 4Y9AA 1A49A 2NX1A 3MU7A 1EUAA 4B2DD 1M3UA 5DO8A 1XISA 2BMBA 2R1KA 3UD6A 3PK7A 5I03A 4AWUA 1R85A 3WCZA 1DP0A 3NURA 2Z29A 3K46A 1N8FA 3ZJ7A 4YCPA 2GUBA 3RYSA 3PSVA 5DXYA 2WLZA 4E8DA 1WDWA 4UMCA 4BQ5A 3T2QA 6CGTA 1C8XA 1JPDX 4R7JA 4ECLA 1A3XA 4DLMA 1RR2A 4HCLA 1FVPA 4EK7A 1RPXA 3GFYA 3N1AA 4DJDC 2WWCA 1VFOA 2ZX8A 4MLRA 2VX7A 3W2MA 6PTDA 5G2IA 3DFSA 4XUYA 4W84A 3VA8A 5IRPA 4H04A 2E8ZA 2YDQA 3CUHA 1A5UA 1C7TA 1JDDA 1H1YA 3QMSA 4C6CA 1BAGA 2FZ8A 2J6XA 1UH4A 1O95A 1TVPA 4Q6JA 2F61A 2BX7A 1VGAA 4IFKB 4LBRA 4B2DA 3T42A 3NSNA 1JQXA 1XKJA 3F4VA 3SBFA 1ZZMA 4NXSA 4W93A 3VUSA 1NF0A 4YS1A 2GJXB 2GFTA 3GVGA 4UNKA 1VFMA 3NR0A 3PWGA 1UBSA 3RIKA 4ACZA 2XIOA 4XTIA 4C6LA 2YCLB 3L12A 3FDGA 2C7FA 4UR8A 1JZ7A 1W3LA 5GNZA 4E2VA 3QV8A 4C6QA 5A6BA 2EPMX 1JFHA 4NI8A 3H55A 2GGIA 2CLHA 2ZUNA 2F2HA 5F2MA 3W7KA 1DJNA 2WPBA 4QG6A 1OEPA 2C79A 3G1XA 3P2VA 1JJKA 3WD3A 3WZ0E 3C0LA 1ZBCA 4GC4A 5IM51 4UQEA 4XB3A 2P76A 3SAZA 1MFUA 4N4PA 4U2ZA 5E93A 1TG7A 5HANA 2G0WA 4JCLA 1EPXA 4ILSA 2VWTA 3O7UA 5JBEA 2Z7KA 3HG4A 3NDOA 4NUWA 4QCEA 2DZWA 1GGOA 2FGBA 3ZJKA 3GZAA 1T99A 4NY2A 4MVAA 2W27A 5BYWA 3WUEA 3VKJA 5FEXA 5LHEA 2X8RA 2Z24A 5CPOA 3W86A 4NHVA 1P48A 2EPNA 5ABTA 2BG5A 4AC7C 4Z1CA 1E4MM 2C6QA 3QTPA 5D03A 5EMYA 5CZ0A 1TO3A 4DJEC 3NQ8A 4IMEA 4NJHA 2PGFA 2GSHA 1EO7A 3GK0A 1WBJA 3ARQA 1R9YA 1C90A 2VEGA 4MHBA 1KM1A 1GEQA 2X1TA 4P7QA 4FNQA 1I6NA 4AEFA 3DKJA 4FIRA 2QJHA 3VOFA 1M04A 1ZPTA 1E51A 3TXVA 3UGRA 3VIPA 1P1MA 3V0TA 2J13A 3W75A 2OZ3A 2V38A 2Z0IA 3AMKA 1BGGA 1NWRA 1G5AA 3L2IA 3QSRA 2BGQA 1VD6A 3W1PA 1T0OA 3UVAA 1K8YA 3WSUA 7REQA 3W26A 3HO8A 4S3JA 3CMJA 4I5RA 5D33A 4DAIA 2QW5A 2C1GA 5CZTA 3IJLA 5LIKX 1J4EA 4ZTXA 1S2TA 2FPTA 3A5FA 5D4YA 2VFIA 4I6KA 2DVTA 4PUJA 3LB0A 1X8CA 2QGHA 4GK8A 1E6NA 3IJ8A 3W7DA 5I3IA 2ISSA 3CUGA 3HGSA 3PZ9A 2PD9A 1WQ5A 4ACZB 4PSRA 4HN8A 1HJUA 2XVPA 3L5AA 2O92A 1OIFA 1ZNNA 2HXUA 1FCBA 2F2KA 4JDBA 3GTXA 1KQYA 3A9IA 5DEZA 3WQ6A 2ZX9A 2RDUA 4GX9A 1XCWA 2PDJA 5HWJA 2HVOA 2BVTA 4U5IA 5K4ZA 4P8UA