1H1NA

Atomic resolution structure of the major endoglucanase from thermoascus aurantiacus
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
305
structure length
305
Chain Sequence
AKVFQWFGSNESGAEFGSQNLPGVEGKDYIWPDPNTIDTLISKGMNIFRVPFMMERLVPNSMTGSPDPNYLADLIATVNAITQKGAYAVVDPHNYGRYYNSIISSPSDFETFWKTVASQFASNPLVIFDTDNEYHDMDQTLVLNLNQAAIDGIRSAGATSQYIFVEGNSWTGAWTWTNVNDNMKSLTDPSDKIIYEMHQYLDSDGSGTSATCVSSTIGQERITSATQWLRANGKKGIIGEFAGGADNVCETAITGMLDYMAQNTDVWTGAIWWAAGPWWGDYIFSMEPDNGIAYQQILPILTPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO TYPE CELLULASE ENGI
publication title Atomic Resolution Structure of the Major Endoglucanase from Thermoascus Aurantiacus
pubmed doi rcsb
molecule tags Hydrolase
total genus 124
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h1nA00
5E70A 3AFBA 2CERA 3TTOA 3WUFA 1HL9A 2QV4A 1OSEA 3VIPA 2ZUNA 1R86A 4W93A 1V0MA 1KXHA 3WQ5A 5GNZA 1LL6A 1MW0A 1OM0A 1UHVA 4RE4A 2ZX8A 3KE0A 1D2KA 5CPSA 1ODZA 3NSMA 3IJ8A 3VILA 3WNPA 2XIBA 4CCEA 1VRXA 5A2AA 1A47A 1LL7A 1LG1A 1QNRA 1E6SM 1BGGA 3CUHA 4PTMA 2XHYA 3RIKA 1KR1A 1E55A 1V02E 3SCQA 3BMWA 5BRPA 3ARSA 2WMHA 3AHZA 3AISA 4D6GA 4RE3A 4TTGA 3EDJA 1DTUA 1KCKA 8A3HA 1ISZA 1E43A 2VNCA 5BCAA 3KL0A 3A47A 3BSHA 3W6LA 2X8RA 2WHLA 2VVNA 1GW1A 3AZSA 4B9YA 2E9LA 3CTTA 4ZE5A 1KR0A 3MANA 1GOIA 1C8QA 1XD1A 1V6YA 3A4XA 5CG0A 3OLDA 1GOKA 9CGTA 5LA0A 1J0KA 4XV0A 3WH8A 5JIWA 2DSZA 3L4YA 3WEZA 3VDBA 2YIHA 2WVVB 4OBRA 1B0IA 3AIVA 1NH6A 2D1ZA 1PZ2A 2OYLA 1BAGA 1V0LA 4W85A 1GHRA 2PB1A 1HIZA 3VNZA 4DUWA 1VEOA 4TVUA 1JXKA 2CHOA 1QW8A 4ACZB 2ZOXA 3BH4A 1EOMA 3SCSA 1E1EA 5IHRA 4AD0A 1H4PA 3T2OA 5E09A 4U2ZA 4DM1A 1B30A 4UZSA 4MPKA 3T09A 2CYGA 4F79A 2WHJA 4W89A 4AZ6A 4P7QA 2WBKA 1LF1A 1E70M 1F4HA 1Q6DA 4JFSA 3MSGA 4ATDA 1J0IA 5M5DA 4DUXA 5D8ZA 3L4ZA 3MKKA 3WUBA 4M82A 4FLOA 4J3UA 3WD2A 5CLWA 2XGIA 3BCFA 3VIKA 3WQ6A 5E6ZA 4AZ5A 2DGAA 2DT0A 4Z2HA 1R87A 2DH2A 3WNNA 1UR9A 3I3EA 3OLIA 3SCVA 3S6TA 5JUVA 5E6YA 2FHFA 4D1IA 1IT0A 4AD2A 1OIMA 3SEPA 3VGDA 1JFXA 4NRSA 4DWSB 3AS2A 1HP4A 4YN5A 3HMCA 1M04A 1C93A 2FHBA 1CXKA 3OGVA 4D6CA 7CGTA 1CBGA 3APGA 4UOJA 3WQ8A 5E9AA 4WSJA 2GK1B 3WNOA 1GVIA 1TZ7A 1C92A 2J47A 4PMQA 1FH7A 5A2BA 2WKLA 1QVBA 1JYVA 2FHCA 1RPKA 5CPTA 3VD5A 3VIMA 3SURA 2J8GA 1QI2A 4GO9A 3FY1A 5HOSA 3LPOA 4NRRA 3SUSA 3PZNA 3CZEA 2BY0A 2EPLX 4A3HA 3WF1A 1QNPA 1VFMA 2YDRA 3F5LA 1QW9A 3UR7A 1UD5A 5TD4A 3VIHA 4AZHA 3AXIA 2QLYA 4PMNA 4W84A 2WANA 3VMOA 1LL4A 3WF3A 2UY4A 2EPNA 3FAXA 3THCA 5FCZA 4KRUA 1K9DA 4ZXOA 1JI1A 1GOMA 1QNQA 2RGLA 2ZX6A 3E1F1 1W3LA 1J9YA 4JAWA 4PMRA 1W1TA 3ALGA 3WFZA 2WK2A 5EFFA 4V2XA 4JL2A 3CO4A 1W3JA 4NZCA 1MVYA 2E8YA 1UWTA 3UR8A 4GZEA 1P6WA 1C91A 1WDRA 3N1AA 4AEFA 3VU2A 5IFTA 3FHQA 4WJXA 4OBSA 5I77A 2VO5A 3N17A 1IZJA 1TG7A 4UQ9A 1B3XA 1M03A 3SCUA 2D0FA 3RPMA 3BAXA 4GZJA 1BYAA 3L4XA 3N13A 4N42A 4P7NA 3POCA 4TTUA 1EIBA 5KZ6A 1UQZA 5CJ5A 1XGZA 1HL8A 4RE2A 3WSUA 1E6PA 4WF7A 2W66A 1CNVA 2WVVA 5FOOA 1DWJM 1R8LA 4PMZA 1WZKA 2J7CA 2WPGA 3SCPA 1HKMA 4UQCA 3ZJ8A 3M7SA 2Y5EA 3VMNA 4HU0A 5FKYA 2GUYA 3QR3A 1NWTA 2BY3A 4ACZA 1UQYA 4P7LA 3WH9A 2XVKA 1E4NA 1GPFA 3ZOAA 3GNPA 3G6LA 5AYBA 3CHCA 4GPNA 3ZSTA 2YJQA 2WWDA 1UWUA 3EMCA 3AMLA 4Z2GA 1JF5A 1VENA 3N15A 2WXDM 4UFKA 5DFAA 1CGXA 3CMGA 2VZTA 3CZ8A 2VI0A 2AMGA 1UWRA 5I0DA 3D5HA 1E40A 2E40A 2W62A 2DSVA 5FIPA 1QHOA 2VQUA 1H41A 5LA2A 2W91A 4UQDA 1K6AA 2YBUA 2OWCA 2J7BA 3WMSA 2WMGA 3MMUA 1JZ4A 3BAKA 1I1WA 1ZS2A 4UFHA 2ZUTA 4NSBA 3EDFA 4KGJA 2VOTA 1CLVA 2WCGA 4DWSA 1HX0A 4UFIA 3W6MA 2VRJA 2RGMA 2WSPA 2WZIA 3K8MA 2ZX5A 4L4OA 1E5JA 5HXMA 1B1YA 1XRVA 3SCNA 1BGAA 3THDA 2PBOA 4AZGA 5I79A 1US3A 3GH7A 1OBAA 4CD8A 2BNJA 5D9MA 2JIEA 3ARQA 4DWSD 2GK1A 3AIWA 1HVQA 2Z1SA 4HZ6A 1JZ6A 3BAIA 2G8ZA 2WC7A 4UFLA 3DYOA 2VRKA 3U7VA 1KBKA 4KMQA 1ZB5A 2O9RA 3VO0A 4M24A 3F5JA 3AXHA 4J3XA 4B15A 3TA9A 1JAEA 4GQQA 3U57A 4AZBA 3VIJA 4JHOA 1UZ1A 3ZIZA 3IJ9A 2WC3A 1BVNP 4UFJA 2EJ1A 2VT0A 1OINA 3AYRA 5ABFB 1HJQA 3II1A 4D72A 1KQZA 3A3HA 3D3AA 3GNRA 4OIFA 3NSNA 1UG6A 1KWGA 1TVPA 4CCDA 3U7BA 3WDJA 1Z32X 3MUAA 4CUCA 1E73M 3SCTA 4L4PA 4PMUA 1QOXA 3NUKA 1UYQA 4W7WA 4FF5A 2VX6A 3WNMA 2VTFA 1R7OA 2BY1A 4AC1X 4TVCA 3WD0A 4K68A 1US2A 1BVZA 4TUFA 1JGIA 4UCFA 2XSBA 1MW3A 1E6NA 3AMCA 2GJPA 2CEQA 4AIUA 1C7TA 5BWFA 4MNMA 4JHZA 1G1YA 1W1PA 1BQCA 5I78A 2A3EA 4M29A 4X0NA 1I1XA 3WDHA 2VX7A 1KGUA 1DWAM 1HJUA 1HKJA 4Z2JA 1XHGA 1XD0A 4JZ5A 1HKIA 2PWFA 3AZRA 1JZ2A 2XSAA 4PRWA 2E8ZA 1W2VA 1FFQA 2BXZA 3WDPP 1M53A 3ARVA 4ATLA 3NJ3A 1B31A 1YHTA 3DHPA 2WNWA 1V08A 2CKSA 3FN9A 2DT2A 4P7RA 3ZR5A 1GVYA 3OLGA 4AIOA 3CH9A 4D6JA 1V6VA 1QI3A 3S2CA 3CZJA 4WIWA 1CIUA 1GQJA 3WL1A 1BSIA 1JIBA 3GXMA 4AW7A 3VNYA 2V5DA 3AXXA 4OUEA 2BVYA 3MS8A 4IM4A 5EFDA 1WKYA 3WH5A 1WNOA 3CMJA 4U3CA 1H1NA 2ZWZA 3OG2A 4H7VA 1NP0A 2ZUWA 5LA1A 1CXLA 3A4AA 1BG4A 2WMIB 3AICA 2WVTA 1ODUA 3GXFA 3AIBA 1W9UA 2WC4A 3SCWA 1JG9A 1CEOA 2X2YA 5C71A 1KCLA 4OKDA 2DT3A 1BYCA 4AWEA 1TMQA 3AMKA 1XC6A 3F5KA 1NM9A 3VM5A 1AQMA 5CLTA 5I2UA 2J77A 1FFRA 2DT1A 3TTSA 4UQBA 3SUUA 2WVUA 1CWYA 2PWDA 3BCDA 4PYSA 1NOUA 3ARUA 1B90A 1CGYA 3QHMA 1E15A 1NP2A 2C7FA 1CZ1A 2G3MA 2HVMA 3DYPA 4YHGA 2J7FA 2D3LA 2PI6A 1ISXA 3O2LA 1JAKA 5IXEA 4F9DA 3VOCA 2NW0A 2F8QA 2FH8A 1WDSA 4MB5A 1NWSA 2ZUVA 1SYTA 1AQHA 1TVNA 3O9NA 3OBAA 4OZOA 2GSJA 5FD0A 1JD9A 1R85A 1W1VA 2E9BA 3IAPA 4M81A 2G41A 3PZGA 4DM2A 2G3IA 1C8YA 4C7FA 4PSRA 3FHAA 1RH9A 3BMVA 1VFOA 4FLSA 4S3KA 2UY2A 3KZSA 3VIFA 4DUVA 2CKRA 4W5UA 1TUXA 2DQXA 1FP8A 1QI5A 5JIPA 1B9ZA 3AHVA 2OWWA 1JNEA 2B31A 4JFTA 1MFVA 1VFFA 1UZ4A 3LPGA 4HU8A 3L4VA 2EQDA 5A8OA 1EA9C 5D9OA 1HJSA 4AXNA 4PMVA 2C0HA 5BROA 2WCSA 2XFYA 3QHNA 4FMVA 3WNKA 4P7OA 2W92A 1DP0A 5ABFA 4LXFA 1QBAA 3VKKA 2JEQA 2UY3A 3MMDA 3W81A 4KWUA 4PSPA 4W8AA 3WBAA 4PTXA 2WBGA 1PJ9A 3T0DA 1H2JA 4BA0A 4BS0A 2YBTA 4PCSA 3PZIA 2ZXAA 2NSXA 1C7SA 2ZXDA 2OLHA 1MXDA 3KWXA 5CGMA 5A6KA 1W9VA 4J28A 2WAGA 3RJYA 1GJUA 2YL9A 1JDAA 1ISVA 4W5ZA 4UOQA 1V3MA 1H49A 1HP5A 1LWJA 2V3GA 3ZSSA 3ARWA 1VJZA 3PZMA 1QPKA 4W7VA 1SFSA 1QNSA 1J12A 2TAAA 1V3IA 1BF2A 5HNNA 4MADA 3ARXA 1PIGA 1L8NA 3ZT5A 2WLYA 4CD6A 5I3DA 4BQ3A 3N04A 1WCGA 1BFNA 2VURA 2GVYA 2UY5A 3MO4A 1KB3A 3K4AA 5KEZA 2ZUMA 4CVWA 1BYDA 1E9LA 3O6AA 2BXYA 5CGTA 5HDRA 1RP9A 3NCOA 3WEMA 4EE9A 4BQ2A 4JFVA 2PBGA 3LMYA 1PX8A 3W26A 3SUWA 4XUYA 1CLXA 1UKTA 1AQ0A 3KL3A 4AD4A 1JFHA 2QPSA 3N18A 5CQ1A 1ISWA 2O9TA 3U5UA 1H5VA 1W32A 2VX4A 4GO8A 3TP4A 2DIJA 1JD7A 1UWSA 4B16A 5FL0A 4FLRA 1UH3A 2FH6A 2WLZA 1KWKA 3DHUA 2DSKA 1EXPA 1V3KA 3DYMA 2F61A 1Q6GA 1J11A 3GH5A 4MNLA 3VGGA 4D6EA 1BYBA 1QI0A 2WMIA 4MJ4A 5A6MA 3AIEA 1ZBKA 5M3WA 4LQ1A 3EMZA 2BVTA 1IZKA 3U5YA 4UQEA 1SR0A 3WELA 4N0RA 3GM8A 2VX5A 3BGAA 1W9XA 4B3KA 2ZXQA 3NSXA 1KFWA 1GQLA 4J3TA 2IXVA 3K1DA 2Y8VA 3K46A 1UUQA 3ARTA 5D9PA 1ZU8A 3PN8A 2QMKA 2XTKA 2V38A 3CZLA 3W4RA 1B3VA 1LG2A 1X1NA 2YKKA 5EB8A 4J7RA 3IK2A 3IANA 4P8VA 3WDQA 5A6BA 3L2MA 5HBFA 3AROA 1UD8A 3WEOA 4M80A 4NI3A 4HOXA 4AMCA 2VL4A 1UH2A 1ESWA 2GFTA 1EO5A 4AYSA 1UR2A 1UD3A 1Q4NX 5A6LA 4CN6A 5A6BD 3ZJ7A 4U5KA 2BY2A 2CBVA 2V5CA 3FXYA 2XG9A 4UFMA 1HVXA 2XUCA 4PTWA 3CUGA 3J7HA 3WUEA 4EANA 3SUTA 2X0YA 5A95A 4BZYA 4CGTA 2XIIA 3IAQA 5JBDA 1PX3A 4XZWA 1IV8A 1GHSA 1UR4A 1ZBVA 3WF4A 2BFGA 2E3ZA 1MW1A 3PHAA 3DECA 4NF7A 4ZXLA 3WKZA 2XFFA 4MB3A 2G4FA 7TAAA 1JYNA 2VVSA 4ACYA 1GCYA 1UR1A 1R7AA 1BLIA 1XV8A 4OOUA 3RCNA 1EQPA 4CN4A 2F2HA 3SCOA 3K8KA 1E4MM 3WNLA 1W91A 1UR0A 1EO7A 3T2PA 1V6UA 1TR1A 2DDXA 4J3VA 2ZUSA 1CXFA 1ZL1A 5M17A 1W9BM 2D3NA 4E4PA 2XWDA 5ABGA 1L0PA 3I3DA 1PZ3A 4QLJA 3LPFA 4GINA 4IPLA 5I24A 4XX6A 4PMDA 2FGZA 3ZT7A 3IJ7A 1FA2A 1JI2A 1WZLA 1K9FA 1NWUA 2XM2A 1EGZA 4GI9A 5C70A 1OD0A 3WDIA 4J3SA 4PUEA 5A8QA 1G9HA 4PEEA 1B2YA 3AJ7A 3OZPA 1GZJA 4ATWA 3AI0A 1EOKA 4D6DA 2EO7A 1JXJA 1MXGA 1OGSA 3FNDA 3T0BA 3EMQA 3K4DA 2A3CA 2CCRA 5A8MA 3W24A 4GKLA 3WENA 2VC9A 1ZBWA 1FHDA 3VIOA 4HA3A 1ISYA 1WB0A 2EBNA 1O7AA 4U31A 3UEQA 2VCAA 4AEEA 1C3FA 2DPEA 3TOPA 3W27A 1GORA 5ABEA 3VGEA 2VQTA 3GTNA 3NYDA 1EDGA 3PTKA 3NDZA 2X05A 1MQRA 4AZ7A 3VGFA 3A6OA 5EMYA 3UESA 1NOFA 3SIMA 2NT1A 1DWFM 1K9TA 4GXPA 4GZIA 3CGTA 1J0JA 2J4GA 3OZOA 4LYRA 4PUDA 4CU8A 1V3HA 2WKGA 2X09A 2G3NA 2QHAA 3M07A 4CD5A 1BTCA 1E6RA 2CBIA 2BHUA 2CHNA 2Y4SA 4W87A 1JYWA 4D6HA 4ZEPA 2V3DA 2VZUA 1HF6A 3RDKA 1DWHM 3L4TA 4GI8A 4MAVA 1E6ZA 1VBRA 4QLKA 1WAWA 1B3WA 1X6LA 1U30A 3WIJA 5EBAA 1KGWA 2XVLA 3AHXA 3PZ9A 4J27A 2Y8KA 2OSXA 1QBBA 3MU7A 2XFRA 2J75A 2IUZA 4H2CA 5A6AA 5IHSA 3ALFA 1GOOA 3M6DA 1VB9A 2WHKA 1ECEA 1CXEA 1NQ6A 4R5EA 4JCLA 5CXPA 3VM7A 1CGTA 1MYRA 4JFUA 3PTMA 1OGGA 5BRQA 3ZJKA 2VMFA 4CU6A 3ARZA 4JCMA 3WDRA 2J79A 1S46A 1PEZA 6TAAA 4H04A 4D6FA 3RO8A 1CYGA 4B9ZA 2GJXB 1J0HA 3EYPA 2ZUUA 4PMXA 3WY1A 1E3XA 2JIWA 1V6WA 3WQVA 5AC4A 1HJVA 2VZOA 2J62A 5A1AA 1SMDA 2O9OA 1UKSA 1KBBA 5CSYA 2VZVA 4CCCA 1H0IA 4PMYA 4CN1A 3W82A 4M8UA 3GDBA 5LYRA 2XYLA 3QOMA 1MWOA 4V27A 3B8SA 2GJRA 4DWSC 1OT1A 1W1YA 1OIFA 1XSIA 4J3WA 1EQCA 1QHZA 3WN6A 5AC5A 4OJYA 1J10A 5FL1A 3VTRA 1UD4A 4AD1A 4EK7A 3EDDA 4UZUA 3MV11 1HJWA 2JALA 1KGXA 1ZJAA 4H8UA 1GJWA 2JEPA 2PWEA 1Q6FA 2VCCA 4QAWA 4P8XA 2BVDA 2W63A 4HPGA 1HKKA 3CUJA 5CZKA 3CZGA 1GONA 2FDMA 4TX6A 4W7UA 5HPCA 3N12A 4AISA 4PCTA 2D0GA 3VINA 2YOCA 2D22A 3AIRA 4B3LA 1JYXA 3UG4A 3WL0A 4XZBA 3AHTA 3EDKA 3GXIA 3WD4A 3CHDA 3MSDA 1PAMA 3UERA 1E0WA 4M1RA 4AZIA 1CXIA 2OSYA 2FGLA 2XVNA 1D3CA 3KL5A 4UTFA 4LYQA 5A8NA 5JBFA 1YQ2A 4CKQA 1DWGM 1KXVA 4CD7A 1UR8A 3AMGA 1UD2A 3EBVA 4GI6A 4JKKA 4C7GA 1CXHA 1V3JA 2DEPA 1QI4A 3GH4A 1JNDA 4C7DA 2MANA 1VEPA 3RM9A 2EPKX 2BS9A 4GQRA 3PZTA 1V03A 2JE8A 3PZVA 2W67A 4LPCA 3MV01 3BLKA 3G6MA 4TVDA 1W9DM 1TCMA 4AD5A 3W53A 3WUGA 4HA4A 3AYSA 3BC9A 1EH9A 3ZM8A 4IISA 1FOBA 3B9DA 3UETA 4X0VA 1XH1A 1LWHA 3GXDA 5E0CA 3T08A 1UD6A 2W4XA 3CPUA 4ZENA 4FK9A 2D23A 5A6SA 3BAWA 1UH4A 3QGVA 1E1FA 5I23A 4F66A 3AOFA 2EXOA 2EPOA 3VDHA 1NARA 1CGWA 2PF0A 1AVAA 1HN1A 1AMYA 5DEZA 4QCFA 2JFEX 4S3JA 2A3HA 4U3AA 3GNOA 2WYSA 2ZIDA 1QHPA 3CIVA 1ITCA 2WM0A 3T0AA 5BXPA 4TXEA 1PBGA 2V3EA 1VEMA 2WMKA 3W0KA 4LX4A 1WZAA 2VZSA 4GIAA 2G3JA 4V28A 1J01A 1ZJBA 4MNKA 1WZMA 1H11A 1XCWA 2VCBA 2DH3A 3MUZ1 4F9JA 3W29A 3OLEA 4AZCB 4PTVA 2WCAA 1KXQA 2ZX7A 1OWQA 3HU7A 4QFUA 4BQ4A 1PPIA 4QLLA 1JZ5A 5A69A 1U2YA 2BV9A 1ZBCA 1XSKA 1KXTA 1CPUA 4XB3A 3VGHA 2CNCA 3PZUA 5F7UA 1E0VA 1VF8A 2GJXA 4H8HA 2BHZA 4MDOA 1C8XA 3N11A 1FH8A 2DSWA 3WBEA 1Q6CA 3AS0A 3NDYA 1KQYA 2YLLA 1O6IA 4JKMA 1E0XA 1XH2A 2E4TA 3CHEA 1V02A 1G94A 2UWFA 1JZ7A 3WD1A 3POHA 3SUVA 1V0NA 2WWCA 3ZQ9A 4HA1A 1M01A 3AMDA 2XGBA 3W37A 2D24A 3RILA 3WQ4A 2YL6A 1E56A 2D0HA 4Z2IA 4YPJA 1WDQA 5BXSA 3UCQA 1QNOA 4WLCA 2CETA 4WKFA 1OB0A 1BHGA 2CXGA 4URIA 5I5RA 1UKOA 2YA2A 2BHYA 3VD7A 1H09A 4AIEA 2PC8A 2GDVA 4D1JA 4LYPA 2YL8A 3EDEA 3ZMRA 4QCEA 4QP0A 1ITXA 3BLPX 1DHKA 1HNYA 2JF6A 1UKQA 1XYFA 2A3AA 3AQUA 2J74A 2NT0A 1JDDA 3GYCA 3PZOA 4A3YA 1GOWA 2ZX9A 1GOQA 2ZXBA 1M7XA 1A3HA 3WFLA 4JL1A 3CBWA 2QF8A 3PTQA 2OYMA 1U33A 5D4YA 4KRTA 4WSKA 5A3HA 1RP8A 1J18A 4IPNB 3WH7A 1GNXA 3OGSA 4HOWA 1CENA 3ZJ6A 1W3HA 3ZO9A 5D9NA 2YA0A 5GNXA 4Z2KA 3TTYA 4F8XA 3KEHA 2XVPA 3ECQA 4RL3A 1VIWA 2ZICA 1NOWA 5C8BB 4W86A 2J7GA 1GQIA 3VIGA 1D7FA 1TA3B 4X9YA 5ECUA 2YDQA 2E9MA 3VDAA 3RM4A 4CU7A 1LJYA 1G0CA 3TTQA 1MW2A 5D8WA 4KH2A 4W88A 4IUGA 3MMWA 2YDSA 3GBEA 1E6QM 5E0FA 2ZWYA 1NWRA 2Y24A 3JUGA 3N9KA 4MB4A 3HN3A 2J8FA 2PWHA 3BAJA 5BXTA 1HT6A 1XYZA 3VD4A 2WMFA 4UR9A 5DT5A 2D20A 2VJXA 8CGTA 4Q7NA 3OIHA 4Q22A 3AHYA 3QHOA 1FHLA 1HJXA 4MAZA 3WMCA 3CZKA 1GQKA 4H8VA 2OYKA 5GPRA 2IXUA 2AOSA 3VVGA 1JF6A 4HZ8A 2W5FA 3BAYA 5DO8A 5CSUA 2J7EA 3F4VA 4BF7A 4MJ2A 1TE1A 1PIFA 2C8NA 2J7HA 1SMAA 4KGLA 1EHAA 3RM8A 3T2QA 4D6IA 3ZT6A 4Y7EA 1E3ZA 1DWIM 1OT2A 2OSWA 2WZHA 3WF0A 4Z2LA 1Y7VA 1PX4A 1XSJA 1V0KA 4CD4A 4ZFMA 4E8DA 1WPCA 4BCEA 5I6SA 1W2PA 3VD3A 1E4LA 2QPUA 2JF7A 1H0GA 2WSKA 4H41A 4AY1A 2W61A 3CLWA 1OD8A 4P8WA 2OWXA 3AIUA 3QOKA 3B9AA 1MQQA 4P8UA 5A2CA 4A4AA 1EDQA 4AZCA 2X1IA 1TFVA 1WO2A 2ZE0A 5ABHA 4HOZA 2DSUA 2O9PA 4YHEA 1Q6EA 4JFWA 2WHMA 1JDCA 1UKPA 3L2LA 5BXRA 1BG9A 1LQ0A 3VDCA 3VD9A 4U5IA 3WD3A 2PWGA 2WZEA 1RD6A 3AS1A 2HISA 2WMJA 5DF0A 2GDUA 3ARRA 2XJ7A 1B3YA 2Z1KA 3PZQA 3OB8A 1CECA 1J0YA 3BXWA 3ZR6A 1W9PA 2VRQA 1WP6A 1FP9A 1F4AA 1E72M 3VIIA 1MQPA 2CESA 2V3FA 1K9EA 3VX1A 3WH6A 3A4WA 1G01A 1WE5A 4OOZA 3VX0A 1VJSA 3SCRA 1X6NA 4D71A 1UA7A 5AY7A 4EKJA 2DIEA 1CDGA 3FAWA 1UWQA 2X0HA 3WF2A 3L4UA 1CGUA 5IFPA 1JZ8A 4CVUA 1UOKA 3WMBA 4UNIA 5BYWA 2AAAA 6A3HA 3NIYA 5DT7A 3M46A 1JL8A 2EEXA 2WVSA 2XWEA 4HPHA 5A8PA 3VUPA 3UG3A 4E8CA 2YL5A 2VUYA 3OA5A 1OCQA 3CUIA 3WQWA 5A6JA 3CUFA 2A3BA 3PBGA 2XPKA 4HP5A 1HXJA 4HMEA 2D2OA 3OGRA 4MTVA 4EAMA 1DEDA 3RJXA 1CGVA 1JZ3A 2CIPA 3FW6A 2J25A 1VAHA 1E6XM 3B9EA 4UQAA 3VGBA 1J0ZA 4BQ5A 4U2YA 3TONA 2E0PA 1I75A 2XM1A 1N82A 1VFUA 1E71M 5GQBA 2VR5A 1LLOA 4M56A 2CBUA 1WDPA 2CPUA 4PN2A 7A3HA 2Q8XA 1E5NA 4E2OA 1GUVA 2YA1A 4JKLA 1EHNA 1UA3A 4MB1A 1E4IA 4HMDA 2ESCA 4AD3A 4W8LA 5GNYA 5CPQA 4ZE4A 4PMOA 3W28A 2VR4A 1W3KA 1V3LA 4ML4A 1FH9A 3AIQA 5A94A 1XCXA 3ARYA 5IDIA 5AYIA 1TA3A 2J7DA 3HJEA 4LGXA 4R27A 2XVGA 2YLAA 4FLQA 1G5AA 1CTNA 3K8LA 2EPMX 2O92A 1H3GA 1V6XA 4UOZA 3CHFA 3VMPA 3AZTA 4TOQA 3W25A 1XH0A 1UWIA 2WW5A 3MUY1 1B3ZA 1BPLB 5DMYA 4WK9A 4HZ7A 5JBEA 4QDMA 3LPPA 6CGTA 3BSGA 2J78A 3MUIA 4WKHA 5HPOA 2CITA 3GBDA 3VPLA 4HTYA 4MDPA 4PBGA 1MFUA 4HMCA 3GZAA 3UG5A 1EDTA 1VBUA 3DC0A 2CBJA 3I3BA 3AS3A 4U33A 4TX8A 4WKAA 2WB5A 3W38A 1OGBA 2QMJA 3L4WA 4MNJA 2Y2WA 3RMEA 3ARPA 4JIEA 5M03A 1C90A 4W8BA
chains in the Genus database with same CATH superfamily
7ENLA 2CERA 3HQNA 1PWLA 2ZA3A 3B0UX 3DI0A 3WJYA 3KUMA 4W93A 4NYUA 1KXHA 5GNZA 5T26A 4RE4A 2ZX8A 1SFTA 1D2KA 5AHIA 4FAMA 2FZBA 4GHRA 1SZNA 2DVXA 1A47A 1LG1A 2NQ9A 1EPXA 3W02A 1E6SM 1BGGA 3U2OA 3S2MA 1E55A 4Q6JA 2QXWA 3C2FA 1DBTA 3URBA 3SCQA 1Z41A 4QJ1A 4XBSA 3ARSA 1G4TA 5EU9A 3U2ZA 3LGDA 3EDJA 8A3HA 3P61A 2PD9A 3H4GA 1E43A 4XAYA 5C9RA 1JQVA 2C71A 2G50A 3GDKA 3IVUA 1RALA 2HROA 2X8RA 2VVNA 2FMOA 1K02A 2X7VA 3HTWA 2ATMA 3TJLA 2E9LA 4XKYA 3LI1A 3V18A 3P81A 5LA0A 4EF8A 2CLEA 2FIQA 4XV0A 3G8EA 2DSZA 3UPMA 4OBRA 3EPOA 1SW0A 4ADSA 4O1AA 1NH6A 1LBMA 2OYLA 1BAGA 3KS6A 4WRHA 2ICSA 2GGIA 2BX7A 2CHOA 3GLCA 3LENA 1QW8A 4ACZB 4V1XA 3BH4A 1OK4A 1EOMA 1E1EA 1EXBA 4AD0A 1Q45A 4F0SA 3DG3A 4UZSA 2YCLA 4MPKA 3XIMA 1QTWA 1YXDA 3GR8A 3T09A 3NEVA 4X2PA 1YMYA 4B91A 1LF1A 1E70M 1F4HA 4FXSA 2BOFX 1R30A 1WKEA 1UP2A 4ATDA 1IEQA 3BQ6A 3VKJA 2ZTKA 4DUXA 2QS8A 4IFKB 5FF2A 3TVAA 3WUBA 1RK5A 2Z2AA 3WD2A 1MMFA 3KLLA 2GOKA 1K7XA 3BCFA 4I6KA 3WQ6A 2W9MA 3INPA 1UR9A 1Z3NA 4GZ7A 3UJ2A 2HDJA 4G2DA 3SCVA 3S6TA 2FHFA 3RRAA 5CBBA 4D1IA 3W7NA 3BGGA 3VGDA 3G3MA 5T8GA 4DWSB 2J8TA 5AZ1A 2ABBA 4XD6A 2OKOA 3MO7A 3HM7A 2VYOA 3OGVA 4KBXA 2RH9A 2QYGA 4L56A 4BK9A 4HK7A 4MG4A 4EIVA 2ACRA 1VHNA 4C1NB 3RLHA 3VAVA 3NNTA 4CQAA 3A5FA 3GZ3A 3V0TA 3AU2A 3EA3A 4B5SA 1QI2A 2PDYA 4GO9A 5G4EA 1OC5A 4S39A 1KM0A 1MZRA 4IWWA 5M1TA 3STPA 3S1XA 4S3GA 5GVJA 2NXHA 1W6TA 3KOZA 3PY2A 4L9XA 2DZVA 3UA3A 2PDLA 5J5DA 1QW9A 3VIHA 1F3XA 3IWPA 4AZHA 3W3OA 2EPNA 3FAXA 3PS7A 4DJDA 3G1RA 4I6VA 3SBFA 4ZXOA 1OABA 2WQPA 1F05A 1AH0A 1W3LA 1TWDA 5D09A 4IQLA 4PMRA 2NZLA 3ALGA 2OO6A 1Q66A 4Q8MA 2WK2A 3JZUA 4LAOA 4JL2A 3S5ZA 1ZENA 4DJDD 2PCEA 2FVMA 5ECVA 1PYMA 4C6KA 4GZEA 1P6WA 3N1AA 1YXCA 3VU2A 1G4PA 4TX9A 4WJXA 3BV7A 4L64A 5FF3A 3N6HA 2VO5A 2FQIA 3BG3A 4QDPA 4K1WA 3M41A 2R24A 3SCUA 2D0FA 2DZWA 1EGVA 2PDJA 3R25A 3N6JA 5TNVA 4TTUA 3L5AA 5KZ6A 3BZGA 3W07A 1XGZA 3C6CA 3FK4A 3H23A 3B05A 1SJAA 1E6PA 2W66A 1KFLA 4MY8A 1A5UA 3P8JA 1KCZA 1WZKA 3SCPA 4DB7A 1U1JA 3RO6A 2BLEA 4Q6XA 2ZE3A 3HJZA 4ACZA 1PE1A 1QPRA 4HCDA 1GKPA 2GUUA 3WQDA 2WWDA 1A80A 1GZ1A 3N6QA 3MP5A 3AMLA 4UFKA 3V7PA 1CGXA 3MVIA 1QMLA 2C14A 4L6OA 3GDTA 4JYEA 2DSVA 2VWSA 2CLFA 4Y9NA 4IFKA 3RR1A 4DUOA 1H41A 4LU0A 5LA2A 2A85A 2OWCA 1POJA 3SJNA 3M5XA 3S2JA 3BAKA 3UZXA 5C9ZA 4MFEA 3LU2A 4KGJA 4LOCA 2VOTA 4HCLA 2WCGA 4DWSA 4NI8A 4UFIA 4XIAA 2RGMA 4RPQA 4H6QA 4JY8A 2WZIA 1GW9A 3SO7A 1F07A 2PDWA 1TJ1A 1EJ7L 3N14A 1JEZA 3SCNA 4C6EA 1H61A 2A6NA 3HA1A 5CJNA 1H60A 5LNRA 4GA8A 2YR1A 2VEIA 1H62A 1XLGA 2JIEA 4DWSD 3ISIX 1XG4A 1N7KA 3M16A 4HZ6A 1JZ6A 4WVXA 2G8ZA 8XIMA 4UFLA 3DYOA 3L12A 2FPTA 4H9UA 5AFDA 4QITA 3S83A 5G5IA 1ZB5A 4QISA 1UJPA 4A22A 4M24A 4XAPA 3TA9A 3GNDA 3DFNA 3H53A 2D2HA 4GQQA 5CBJA 1T6MA 3VIJA 4JHOA 1CCWB 1J93A 3GY1A 2WC3A 3M43A 1OINA 3EB3A 1HJQA 3II1A 1KQZA 5CZTA 3W2MA 2DUXA 1XLFA 1PL9A 1UG6A 2POZA 3LTYA 2OTDA 4GY7A 1I9CB 4HZMA 4PMUA 3TN6A 3G1AA 4NNCA 3NUKA 3WG6A 4FF5A 2VX6A 4DBEA 3TE9A 3NQMA 2VTFA 2F2KA 4DF1A 2ONEA 1BVZA 4UCFA 2PDMA 2HK0A 4KT2A 2X40A 4TO8A 3AMCA 4AIUA 1CB2A 2CWNA 1R3VA 4WOQA 1RCXB 1G1YA 1BQCA 1XIJA 5I78A 4AH7A 3PSVA 4PUUA 2A3EA 1EGMA 5SWUA 2Y7DA 1A0EA 1KGUA 3I65A 3STGA 3JS3A 4S3EA 1XD0A 3UWWA 1P0EA 2PWFA 4HNVA 3C86A 4O1EA 3P67A 3WDPP 3LSCA 1ZAIA 4ATLA 3FA4A 2DY3A 4B92A 1NEYA 5F2GA 2CKSA 5DBUA 1A5OC 3FN9A 2PRHA 3RR4A 3GE7A 2FB3A 4JN8A 3OLGA 4AIOA 3EWYA 2OFJA 4IIHA 3BMXA 2P53A 3S2CA 2VFDA 4ZA0A 2R1KA 1IR2A 1BSIA 4AW7A 1M1BA 4DBDA 4F4RA 2Q09A 3MS8A 5EFDA 2V67A 1PV8A 4EOUA 1RBOB 4OGZA 2INEA 2H3BA 1GYLA 5LA1A 1BG4A 1IYXA 3W1LA 3GXFA 3W7KA 1W9UA 2OELA 4LCRA 3OVQA 1QPNA 2FZDA 1ZJHA 2VUNA 1CEOA 1TPB1 1KCLA 3W1TA 4OKDA 3UYCA 1TMQA 4FR1A 1RZMA 3DFHA 1NM9A 3PBUA 3VM5A 3QW4B 5CLTA 4LVBA 2CLOA 2NX1A 3SFWA 1MUCA 1M68A 3PJXA 2DV0A 1W8GA 3IPWA 1CWYA 4PCPA 4E2BA 3ARUA 1B90A 1UMYA 2Z1WA 2EG7A 4H00A 3QHMA 1E15A 1CZ1A 3F2CA 1SR9A 2CLKA 2HVMA 5AECA 1FKWA 3EZ4A 2PI6A 1LTDA 4GCAA 1EF2A 1JAKA 3LBOA 3GIPA 5JH2A 3SGUA 3A9BA 3NL6A 3B3DA 4F9DA 3PNZA 2NW0A 2F8QA 3W1RA 3CAKA 1TX0A 1WDSA 3MJMA 1NWSA 3DZ1A 3BLEA 2QUTA 4LW7A 1RV8A 2V0TA 3OBAA 1AD4A 1W1VA 5CC7A 3RPDA 2E9BA 4DYJA 3P2VA 1R47A 1H7WA 2PDBA 3KWSA 4C7FA 4PSRA 1RH9A 3BMVA 4FLSA 3NO3A 4S3KA 4W5UA 2IPGA 5JIPA 1FKXA 1EL3A 1GKQA 4R9OA 3EKZA 4QQUA 3RFAA 1VFFA 3GVVA 3STFA 4HU8A 4XQ6A 2EQDA 1ZCOA 4FEZA 1HO4A 3C52A 3M0KA 3MW7A 4KFNA 4MIMA 2C0HA 5BROA 1QT1A 2Q02A 3HG5A 4HBKA 3H7VA 5U4NA 3WNKA 2W92A 4RDVA 1H7XA 1QBAA 4BJHA 1P0NA 3VKKA 2JEQA 3LOTA 3STEA 4P5UA 3UNTA 4PSPA 1RK6A 3WBAA 5HQMA 3KW3A 3NQDA 1P43A 2W6RA 3O3RA 2YBTA 1DJWA 2OLHA 5C5YA 3KWXA 1K8ZA 4X60A 1W9VA 2WAGA 1GJUA 1VFHA 5G4HC 1ISVA 1YEYA 5FSEC 5LIYX 1F5ZA 3UU0A 2V3GA 1LWJA 1OFPA 2TAAA 1PKYA 1OK6A 1V3IA 3ITVA 1ZQ5A 4MADA 4US5A 3ZT5A 2QW5A 3WMLA 2GGHA 3N04A 3LS9A 4M5PA 1KB3A 5KEZA 4H19A 4CQ8A 3PPFA 2BXYA 3T07A 2WQDA 1RP9A 3IRDA 4EE9A 5MKGA 4JFVA 3IIOA 2PBGA 4US5D 3L5MA 1AQFA 1PX8A 1DIOA 3N2MA 1FVPA 3SUWA 4FX7A 4NIRA 3PR2A 2KZHA 2QPSA 4H6KA 2FYMA 2O9TA 1FX6A 3BLDA 3OG3A 1H5VA 1W32A 3F2DA 1FTXA 2Y6ZA 5DX7A 3V1PA 1JD7A 4JR5A 1UWSA 3EX3A 5LNSA 1LROA 1V7YA 4IP7A 4J40A 5REQA 2PLCA 1N8FA 4YTTA 3AWOA 3OZMA 2QIIA 2DSKA 5KITA 2AQVA 1EXPA 1V3KA 3DYMA 2F61A 5HATA 4CNPA 3W7MA 3HO8A 2VOMA 1Z7AA 1ONXA 4HNLA 1EB3A 1QI0A 4J3ZA 3WJWA 3EMZA 2BVTA 4O1FA 3AC0A 3WELA 4N0RA 3LHVA 2Y5SA 2Z1BA 3MYPA 2IXVA 3K1DA 3K46A 1JCYA 2WKJA 2XTKA 1TV5A 3LM3A 1LG2A 5EB8A 3CT2A 2YPIA 5HULA 3DAQA 1S5NA 3RCMA 1UROA 5A6BA 1BVWA 4CNTA 2WSYA 3TK7A 3SADA 5IBXC 4M80A 4HOXA 4AMCA 1XYLA 2CWXA 4Q4SA 2G96A 3VOFA 5HK4A 1EO5A 3BJTA 3LMZA 4AYSA 1TE6A 1SZFA 1Q7ZA 2QF7A 1XISA 5A6LA 4XTDA 1UBSA 4CN6A 5A6BD 3LGEA 3ZJ7A 4MUPA 1IWBA 1Q3NA 2XG9A 4UFMA 3PSWA 1O66A 1HVXA 2XUCA 4INFA 4PTWA 5AHMA 4JN7A 4RV3A 3CUGA 5KZEA 2H8XA 3SUTA 4FZIA 4ZQCA 3NTYA 1XYCA 1IV8A 1TWIA 2INFA 4LC6A 4GQ0A 3M0MA 3PHAA 4NF7A 5AHEA 4ZXLA 4ZO6A 1C9DA 2V2CA 3C0SA 1XV8A 4OOUA 1EQPA 4DZIA 4IG2A 1W1A1 3CS2A 1E4MM 2VGGA 3QQWA 3JZEA 5E5CA 1V6UA 1TR1A 2DDXA 1YDNA 1V93A 3NQVA 1YIXA 2D3NA 3ABXA 5I03A 2C0AA 4E4PA 2YCKX 5ABGA 3I3DA 4TQTA 1KBIA 3CPRA 1SO3A 3QZEA 3PAOA 3AALA 5I24A 4C6NA 2Y1HA 3ZT7A 1UWAA 2PDXA 1GK8A 2FPVA 1JI2A 1EGZA 1OD0A 3S5YA 4PUEA 2O7SA 4PEEA 2NLIA 4M7SA 1TMLA 1XYMA 3B0YA 4ATWA 1XICA 3EPNA 1OX6A 3LI0A 3CB3A 4CNSA 4ILSA 5EMLA 4D6DA 2EO7A 4Z1DA 4GMEA 1I45A 3EMQA 3K4DA 3DCPA 3LXCA 4RDYA 2MNRA 1ISYA 1O7AA 3QW3A 1N55A 3EXSA 2DPEA 1AG1O 3W27A 1RLCL 2GZXA 5DCBA 4H4IA 3GTNA 3NYDA 2Y63A 4MZYA 1S5WA 3GDLA 3LHTA 4DYEA 1IXOA 4ZOEA 3A6OA 3LCIA 1NOFA 3W83A 2NT1A 3L0GA 1W1B1 4GXPA 4L9ZA 3FJNA 3OZOA 3MY9A 4BI7A 4UB9A 5EBUA 1V3HA 4ICMA 3E38A 2G3NA 3GIQA 3H55A 2PAJA 2BGNE 2BHUA 3ITOA 3IUIA 3GW0A 2V3DA 2ACUA 4WY0F 2VZUA 4Q7IA 4S2CA 3L4TA 4RJEA 1E6ZA 3GFZA 1EJSC 1SFJA 3N4FA 4RNFA 2XVLA 4J27A 2OSXA 2WSQA 3GNNA 2IUZA 5HMSA 1S2CA 1XIIA 3HG2A 4GACA 4JCLA 4F0LA 1TYGA 1YADA 3BK0A 5CXPA 1DV7A 3VM7A 1MYRA 3W9ZA 1MRQA 2X1UA 1OGGA 5F2IA 3CL8A 2VMFA 4WCJA 4MMWA 4MKVA 4N4QA 3WLOA 4G1NA 3MSRA 6TAAA 4H04A 4WSHA 1NFBA 2PGFA 5D32A 3BGJA 1CYGA 2GJXB 4HNUA 2P0IA 3WY1A 1E3XA 4AY8A 2VZOA 3PUEA 5A1AA 2G0WA 1R2TA 1UKSA 1GYNA 4FIRA 3NVTA 1R2RA 3N2XA 3TSDA 3E74A 4OBTA 4CN1A 3ITTA 3TLLA 3QOMA 4PL2A 2F7FA 5D2YA 3KRZA 2E77A 1W1YA 4DBWA 3BPWA 1QHZA 4QJ5B 1J10A 3N19B 4MOZA 1ZPTA 5AZ0A 2OJPA 4GYFA 3TH6A 3MV11 4Y9AA 1ZJAA 1TSIA 1GJWA 2PWEA 1Q6FA 3GVQA 5J8LA 4P8XA 2BVDA 2W63A 1IE7C 4HPGA 2PMQA 2FDMA 2Z28A 3TJIA 4XUGA 3VINA 1Y5WA 1E1CB 2FMNA 4PC8A 1EFZA 3O6YX 4D8ZA 1JYXA 3HGRA 4AVOA 3D3FA 3GXIA 3V4BA 3MSDA 4XD5A 3TSBA 4AG0A 1JPDX 2FGLA 5ENLA 3R43A 5TQLA 4H6RA 2E6DA 2JQXA 5JBFA 1PKLA 4GVFA 4CD7A 1UD2A 3DFSA 3QV6A 3EBVA 5HQLA 1TRIA 1QI4A 4GE8A 4N2YA 1JNDA 1LUCA 4C7DA 1RQEA 2MANA 3DH7A 3FJ6A 2BS9A 1O68A 1X38A 4GQRA 1P1XA 2BOEX 4DY1A 1V03A 1AMKA 5T9BG 4LPCA 4IOTA 1OYAA 3BLKA 1DORA 1TCMA 3EA2A 2WPBA 3W53A 3O6DA 1KCXA 4FO4A 3AYSA 4AHPA 4DF0A 1FWEC 2P3ZA 5JH1A 3PUOA 3UETA 3DN5A 5HQEA 3GXDA 2A21A 5E0CA 1PIIA 3WFAA 3LXBA 1G6CA 3T08A 2BDQA 1YTEA 4ZENA 3BAWA 4AU0A 4F66A 1WXJA 1HGWA 1THFD 5CGQA 2EXOA 4NYYA 3CC1A 1AVAA 1AMYA 4QCFA 1EZWA 2Y7EA 2JFEX 3WJZA 3VYLA 1UJQA 4N7QA 5GJPA 1F3EA 2WYSA 3T40A 1QHPA 3CIVA 3MHFA 4E0CA 4F2TA 1GPWA 4YYCA 5F2LA 1PTAA 1VEMA 1KM5A 3U6WA 4J4KA 3SB0A 1AL8A 3U8GA 2VZSA 4GIAA 1LP6A 2G3JA 2E28A 4MNKA 4C1LA 3SRDA 2E68A 4M19A 1WZMA 1MUWA 4NILA 1XCWA 1EP1A 2XFWA 3MUZ1 3W29A 3SGZA 2WCAA 3UVAA 1BEUA 4AWTA 6REQB 1U2YA 2F6UA 1XSKA 4A2SA 1FWSA 4XB3A 3VGHA 1NDYA 1E0VA 1VF8A 2GJXA 1Z44A 5BMXA 3UWZA 1C8XA 5CPOA 5I3HA 7REQB 3RAOA 3NDYA 3WQOA 1KQYA 4H83A 1AW1A 1CB7B 2OGJA 2J9YA 3R11A 4A3RA 1M01A 2XGBA 1UPPA 3W37A 3W7QA 2D24A 3RILA 3MCOA 2YL6A 3SI9A 4YPJA 1WDQA 2YW3A 1GTHA 4GG9A 1QFEA 2PDGA 4J1OA 4ADTA 2CXGA 4URIA 4ZR8A 3DENA 2KAUC 5CBIA 5CSRA 3W7EA 2P10A 3LA4A 2OQYA 4AIEA 4PULA 2GDVA 3HMJG 2VGBA 3ZMRA 2E6AA 4IGMA 2JF6A 3BDKA 4LVFA 4CEXC 1LLZA 4J9JA 2NT0A 2PURA 1E1CA 1JDDA 3PZOA 1H51A 3ABZA 3WFLA 3E0LA 3CBWA 1TJPA 5D4YA 3KVKA 3LYEA 5A3HA 4GLEA 1X8FA 1J18A 2PA6A 3W1AA 3RLVA 1ELSA 1S39A 5JQ9A 4X9SA 4MZ1A 2XINA 2HWGA 4Y9MA 1W3HA 3ZO9A 5D9NA 2YA0A 4Z2KA 5U7SA 3KFTA 3GU1A 2A7PA 2VFFA 1NF7A 5C8BB 4W86A 1KLYA 2NV2A 5ECUA 3L65A 3EXTA 3ONCA 4AHQA 2YB1A 4PMJA 4NAFB 1J4EA 3FYYA 2Z2UA 3TTQA 1MW2A 5D8WA 4IUGA 3MMWA 5DLCA 1E6QM 1XLCA 3P93A 1NWRA 4MB4A 3N25A 4WZHA 3BAJA 5BXTA 5DT5A 1ZP3A 1IIHA 3QHOA 2A5HA 3QYQA 1GQKA 4H8VA 4RR4A 5GPRA 2OG9A 3LEPA 4WOZA 3VVGA 4EXBA 1JF6A 3BAYA 3JW7A 1KTCA 4UTJA 3OZYA 2J7EA 5M2FX 1EHAA 2YZRA 3TR2A 1VHCA 4Y7EA 3B40A 2ZBTA 3LCWA 3VNKA 3WF0A 4Z2LA 1Y7VA 1E9YB 1EWEA 2VM8A 3UBPC 3W74A 2GGEA 4GBDA 4ZFMA 4UBPC 4GUHA 4F0KA 4JNZA 4BCEA 3COTA 3NYZA 3C2RA 5KMYA 4AY1A 3CLWA 3NR0A 3S5NA 3AIUA 5D30A 2CHRA 1MQQA 4HYWA 4P8UA 2HE5A 1EDQA 2RDXA 4M0XA 5DRCA 2DSUA 1A0DA 3B0XA 4JTQA 3S46A 6REQA 2PTZA 5K9XA 5BXRA 1BG9A 3WQCA 3TQKA 3B8IA 2HRWA 2OCZA 2PWGA 5CC3A 2NUXA 1ADOA 5TAOA 2VEPA 3LNMA 7REQA 3RUBL 3DHFA 4XZHA 1PXGA 1ITQA 1CECA 3BXWA 4JIPA 4YLWA 2IKIA 4GYKA 1MEHA 2VRQA 4NVTA 3VIIA 1MQPA 2V3FA 3VX1A 3WH6A 2ZDRA 5FJRA 4L4LA 4MY1A 4HPXA 4LWWA 3IGHX 4N9DA 1UA7A 5AY7A 2OZTA 1H1YA 4ZO7A 1ME9A 2ACSA 3BW2A 3LRLA 1LOLA 3L4UA 4WDXA 4UNIA 3STCA 2V5LA 3DFQA 4KPLA 1AD1A 1OCNA 4HPHA 5J5RA 2PP0A 4ES4A 3VUPA 3UG3A 5HWNA 3OA5A 4Y8EA 4Y8FA 3E12A 3I10A 3C2YA 3IARA 2OX1A 1IT7A 1LORA 4HP5A 4UWMA 4HIBA 1RUSA 4EAMA 4MTVA 3WLLA 4GYJA 1DEDA 1FDZA 1CI1A 5GJNA 2UV8G 1SFLA 4DI9A 3TQVA 3CQKA 3S1WA 5GQBA 2R91A 1TV7A 7A3HA 4C5ZA 2PLKA 5D2VA 4K37A 1XQLA 1YNYA 1P1MA 2CLHA 5FJJA 4UTUA 1R9XA 5CPQA 4PMOA 5DXYA 3OHIA 5BMWA 2QR6A 1V3LA 5KSWA 3WQPA 4ML4A 5A94A 3ARYA 4XD3A 5AYIA 3RN6A 4Z17A 4LGXA 4R27A 2XVGA 4H8NA 1G5AA 4NAFA 1CTNA 2O92A 1DIDA 1XXXA 1XF0A 4KFPA 4UOZA 3CHFA 3VMPA 2WNZA 1PHQA 1UWIA 2QT3A 5JMUA 4DIAA 3B8DA 1SQ7A 5HMEA 1T0OA 4MKSA 2POTA 3FJLA 1EJUC 3TNBA 3HURA 3QRHA 2DZAA 4LANA 3LPPA 3N73A 2RFGA 2J78A 4WKHA 1C9WA 4OVXA 4IQEA 5HPOA 2CITA 1S2WA 3GBDA 3VPLA 2JKAA 4PBGA 2P3EA 1PDZA 3GZAA 3P0WA 1EDTA 2I9UA 1VBUA 1I0BA 3UZZA 1RJPA 4C6LA 1WBJA 2PTDA 2X1SA 2X1TA 4ECLA 3AS3A 2ISFA 3L2IA 2QJGA 1V79A 2Y2WA 4DLMA 1KRCC 3TTOA 6TIMA 1HL9A 1OSEA 3VIPA 1K6WA 2RHGA 4GI4A 3WQ5A 1OM0A 3KBSA 3O0KA 4BF5A 4BKNA 3NSMA 1K8YA 3IJ8A 4GUIA 2WO5A 3WNPA 4IIEA 4ZQNA 4CCEA 3DU0A 2WJZA 2ZFAA 1W3TA 3VNLA 4QGCA 2A7RA 1QNRA 1Q7QA 1QRQA 4PTMA 3CH0A 2AQWA 1KR1A 4QAIA 2PDNA 2OVLA 3GC4A 1Q6OA 5BRPA 3S9ZA 2IKHA 3TMLA 2E7FA 1KCKA 1L8PA 3PANA 1ISZA 1KW1A 5BCAA 3KL0A 3H2EA 2FTWA 3I6RA 4A8NA 3W6LA 3KS5A 1BXCA 3AZSA 3MANA 1L2UA 1V6YA 1BD0A 3A4XA 1GOKA 3VZYA 3W75A 1P4CA 1TPFA 3L4YA 1VS1A 1TB3A 3EOOA 3AIVA 1PZ2A 4W85A 1D3HA 2PB1A 1HIZA 1J2BA 4DUWA 4TVUA 2H8ZA 2IQDA 2ZOXA 1L6FA 3SCSA 3KDNA 3ZVIA 5IHRA 2EF9A 3W01A 5HNTA 2Z29A 2WHJA 2VXNA 3W1NA 3Q65A 3EB2A 4GGBA 1W3IA 4DQWA 1EJXC 3IV8A 5IBXA 4ERAA 3MSGA 2H9AB 2B7NA 1D9EA 1R46A 3CHVA 3B9OA 1JGMA 3LERA 5H91A 5LKYA 5CLWA 4H9YA 4LVAA 2XGIA 4XBJA 3T7VA 4Z2HA 3KM8A 2DH2A 1RD5A 3OLIA 2RKXA 5E6YA 3UWUA 1TV4A 2R94A 3OP2A 4IPIA 1JFXA 2OZ0A 4NRSA 4JQ2A 3AS2A 4Y90A 4O1CA 5I02A 3WBWA 1HP4A 3RYSA 8TIMA 1CXKA 2HZGA 7CGTA 1Z6KA 3PJTA 3ZR4A 1GJPA 2CZ5A 3AYTA 1W5OA 4CCZA 4WSJA 3WNOA 5GJMA 3ONBA 3FIGA 4C6IA 4K2SA 3WLNA 3HV8A 3ANUA 3VIMA 1QXLA 3B04A 3S4TA 4IMDA 1L6WA 4YTRA 4NRRA 4CNUA 3PBMA 1KFEA 2PEVA 1Q65A 2QCGA 4MWAE 2CLMA 4JEJA 1QNPA 1J8VA 3F5LA 1OVDA 5TD4A 3AXIA 4AMAA 1NTHA 4BI5A 4PMNA 3VMOA 2AKZA 2WANA 3BURA 4PBFA 3MP3A 4KRUA 2VDGA 4S3DA 5FF7A 4MLRA 1GOMA 2RGLA 2ZZ7A 4UMBA 4H9ZA 3HPZA 1MZHA 3G0UA 5EFFA 5CH9A 5CJMA 1EP2A 1A5NC 3WJSA 4GD0A 5C9UA 1VQTA 2CFFA 1MXSA 4IX2A 3CO8A 2HBXA 1AK5A 3F2BA 4GNKB 1C91A 1WDRA 4JNMA 3VZZA 1OX4B 2C1IA 5IFTA 2PD5A 3FHQA 3VNMA 1YPIA 4RZ4A 3AUJA 3A22A 1IZJA 2EGZA 4UQ9A 3BLIA 3TJ4A 3RMJA 5LGZA 3VFCA 2V82A 3AXKA 5LNUA 3QV8A 2A79A 4GZJA 2YYUA 3CUXA 4P7NA 3POCA 4I3GA 4EX4A 5AYYA 5CJ5A 3KZPA 5HR7A 3HQ1A 1HL8A 1KFJA 4Q3MA 4OQVA 3H54A 1FUYA 4PMZA 2A4AA 3REQB 4N6EA 2WZTA 3ZJ8A 1PCWA 1DIEA 2VEKA 3VMNA 4HU0A 2AQOA 3QR3A 1NWTA 2BY3A 3Q67A 3OA3A 2XVKA 1E4NA 1GPFA 4UCGA 3KVLA 3ZOAA 3GNPA 5AYBA 2YJQA 1V8EA 5I3IA 3H4WA 4B2DA 2Z4GA 3N15A 4HPJA 3KOFA 4FS9A 1YE4A 3KBJA 3TAKA 2VI0A 4LBRA 2H9AA 4AX7A 1K8XA 3H26A 2AL2B 4LV4A 3CAWA 3NPWA 5C7HA 4NAEA 3M1ZA 2VQUA 2DZUA 1WUEA 3ZLGA 1LRTA 2QQ6A 1P6BA 4B2DD 2W91A 1K6AA 2GJLA 2YBUA 3W2NA 3H4XA 4AEOA 5HJYA 3G1YA 5K9DA 1DPMA 3S9IA 3O8AA 2CU0A 2ZUTA 2ZVRA 3EDFA 3CQJA 3FDKA 2V2HA 1WA3A 3AXMA 3EWUA 1RY8A 2VRJA 2WSPA 3K8MA 2ZX5A 3DDMA 2C6QA 1B1YA 4HK5A 2V5JA 1BGAA 3THDA 2GVJA 4PR4A 4UTTC 3BOFA 1US3A 3GH7A 4QE4A 2PU1A 3M4HA 5FEXA 2BNJA 3S47A 4Z0JA 4EXAA 4RCXA 3EXRA 4AB4A 1W56A 2EG8A 1DIKA 2VRKA 2RDTA 4XZMX 1KBKA 4KMQA 4K7YA 2XIMA 2O9RA 1KO0A 3LCGA 4B15A 4KQNA 3EKGA 4DELA 1CX9A 4JTDA 4UTIA 3M5VA 4AZBA 2YX0A 5AOUA 3EX4A 4UFJA 2EJ1A 1JCMP 2VT0A 4E5TA 3EWWA 5ABFB 1FDYA 2V30A 4HYVA 1RQHA 1JR1A 4DYKA 1XLDA 2BODX 3SJ3A 4Q4MA 1EYWA 5TIMA 3PM6A 1U1UA 4B5NA 1TVPA 4CCDA 3MUAA 4ADUA 4CUCA 1WKFA 4L4PA 3QMRA 3QV7A 1UYQA 4ZFCA 1RVKA 4AC1X 1R7OA 2E5DA 3M0LA 1US2A 1FWCC 4TUFA 4LAZA 2XSBA 4L4MA 1E6NA 2GJPA 1W8SA 2CEQA 1OX4A 4DNMA 4IQJA 3NPXA 5BWFA 4UTHA 4JX5A 3G8RA 4F0MA 1TCDA 4MNMA 3CTLA 1W1PA 3NXFA 1EF3A 4V1YA 2PLMA 2NWRA 4O11A 1UZDA 1JZ2A 1HKIA 4JICA 4TU1A 3ITXA 3NQFA 1GGOA 4D2JA 3FJ4A 1W2VA 3ES8A 3LBCA 3PPHA 4L80A 2WNWA 5EMUA 1V08A 3UWQA 4LCSA 2X42A 1GVYA 4B90A 3MI2A 3REQA 3P0XA 4UMAA 5AHFA 1GQJA 3SAZA 3WL1A 4DF2A 5D2WA 1R5YA 3Q94A 3VNYA 3U9IA 2V5DA 5G4WA 1WKYA 2PDCA 1SZGA 2G5WA 1H1NA 2ZWZA 4U3CA 2ZUWA 4LUJA 1CXLA 3A4AA 2WMIB 1ODUA 5LGXA 4OV9A 4MYXA 3SCWA 1IZCA 3TW6A 5C71A 4HPNA 3CWOX 4AWEA 2YSWA 3NOEA 3F5KA 1K1DA 1J5SA 3NL2A 2AL2A 1AQMA 3LLXA 3R8GA 2INZA 4K3ZA 1O94A 2WVUA 1W37A 5HINA 3BCDA 1NOUA 1W5PA 1CLKA 3GTIA 2D2JA 4ERIA 4NJIA 3VE7A 2G3MA 3EGJA 1ISXA 3QPEA 2EG6A 1NF0A 2VC7A 2A6LA 3C4UA 2X7WA 1FCQA 2YB4A 4DAFA 1XPYA 2XH7A 5E93A 2XGZA 2XIQA 1SYTA 1DJXA 4HSHA 2ZC1A 1XLEA 4GVHA 1AH3A 4YMZA 3IAPA 4M81A 5D2TA 4A35A 1VFOA 3KZSA 3VIFA 2CKRA 4O0ZA 1TUXA 3N4EA 2BWGA 3K5XA 1QI5A 1GVEA 3G77A 3B9NA 2OWWA 2DZBA 1MFVA 3M64A 4O15A 5A8OA 3QPYA 3QLLA 5D9OA 3NQGA 4PMVA 4KCUA 3HQPA 4FMVA 5MF5A 4G7EB 4Y6GA 5ABFA 3UY8A 3F4NA 4LXFA 3E5PA 4GX9A 4RW5A 3QJAA 3ORWA 4FB7A 2UY3A 3EB4A 1EC9A 3JU2A 1OYBA 3MMDA 2IKGA 3MYOA 1VPYA 2WBGA 3T0DA 3W76A 1Y5VA 3GS6A 4FX6M 4LNYA 2P8CA 1OFDA 5CGMA 2GDQA 3URNA 5D04C 5A6KA 3CPGA 4JEQA 3MT1A 3GO2A 4F2UA 4FA3A 2WJFA 4IMCA 3C3UA 4UXDA 3B06A 1V3MA 4E3TA 1B4KA 1VCGA 4Z08A 1H49A 3ZSSA 1UC5A 1VJZA 3PZMA 1R3QA 4W7VA 1QNSA 1Y5XA 4CLMA 3F03K 3TZNA 2VC5A 1TRDA 3BV4A 3W1MA 5LSMA 1R3WA 1PIGA 4X2RA 2I16A 3GB6A 1BFNA 2X0SA 3MO4A 4NJKA 1LLWA 3HGSA 4GVGA 2ZUMA 4CVWA 4OV4A 1SW7A 3NWRA 1IWAA 4RZBA 3LMYA 3DHDA 1MO0A 3TXZA 3GHTA 4XUYA 1ONRA 2ACQA 1KFBA 3GUWA 1VC4A 3TYZA 3N18A 4HJFA 1ISWA 1P5BA 3ABQA 2QEZA 4OWGA 3U5UA 3GTHA 2Y8UA 2VX4A 2V9DA 4GO8A 3RRXA 2OB3A 3H21A 1UH3A 2WLZA 3T0CA 4QQ3A 2PRMA 3C56A 1ZGDA 4HTBA 1GQNA 2OO0A 1H7RA 5FJUA 4X22A 3B97A 2WMIA 4QG8A 1G4SA 3AIEA 5FEPA 1SW3A 3U5YA 4HGXA 4RX0A 4JIRA 2Q3OA 3L66A 2ADAA 3U2EA 3E0IA 3WLQA 5HANA 1JCNA 3RF9A 3FYPA 4PUMA 2V6AA 2Y61A 2FJUB 2V38A 1B3VA 1OX5A 4AC7C 4BWLC 3TYUA 5H8PA 4QSFA 5CG7A 4J7RA 4IPPA 2VP8A 4PCNA 3IV3A 1UD8A 1QPOA 1Z42A 3MDWA 1GG1A 1XGEA 4NQ1A 2EHHA 5BU6A 4L61A 4O57A 3U2CA 4F0RA 3CQ0A 4AWUA 2J13A 5DELA 3C8FA 4K39A 2ZYFA 2BY2A 1FHUA 2OMAA 1OZMA 2V5CA 3FXYA 3G5EA 2PGEA 1I4NA 4NX0A 3RG6A 5BRBA 1OF6A 2OR2A 3BUVA 2QULA 3G1VA 4KWVA 4NZ4A 2GPTA 3RK8A 2DP3A 1J6PA 3J7HA 4EANA 3W70A 2BG5A 4CGTA 5H8MA 1KLZA 3VK5A 3DC8A 5AC6A 3IAQA 4M3PA 5JBDA 4XAFA 1GHSA 4G7EA 5FA5A 1ZY9A 4JTGA 1MW1A 3GYEA 4GNVA 2HXUA 1XL9A 1Z8AA 1GVSA 3GVGA 2G4FA 4HHHA 1UR1A 3B8WA 1BLIA 5LIXX 2QCNA 5CPMA 3SW6A 4CN4A 1XIEA 2KX9A 3GDRA 1LQ2A 4D9PA 3CIWA 1ICPA 4S3BA 5B7YA 4J3VA 1ZL1A 5M17A 4TMCA 4ORIA 1FWTA 2XWDA 4Q4KA 1XJBA 4HD5A 5LIUX 3LPFA 4GINA 2DJLA 1F7BA 2PTWA 3IJ7A 3XISA 3IIZA 4Q8OA 1WZLA 2FZMA 3AJXA 4B5XA 3RHGA 5A8QA 1SZEA 4C1KA 4DXKA 3OZPA 2RJHA 2XH4A 3IJDA 3FA3A 1S5TA 2OZ8A 3OYXA 3UWEA 1EOKA 3FKKA 4NUWA 5MHBA 2DVTA 1ML1A 1JXJA 1OGSA 1S1PA 3ZS4A 4LTSA 3T0BA 4QM1A 2A3CA 4FX8A 1D3GA 4GKLA 3TKFA 1ZBWA 3VIOA 4HA3A 1VBJA 2CC0A 2EBNA 3UEQA 1C3FA 2OPJA 3TOPA 2G4JA 4HNCA 3OVRA 1C29A 3TUUA 2CXEA 4LUSB 3NDZA 4AZ7A 3NDOA 1N8WA 3VGFA 4F2BA 3SIMA 2TSYA 3VNIA 2NV1A 2CZFA 5HJXA 4XAZA 3CGTA 1J0JA 2J4GA 4LYRA 4PUDA 1MNSA 2WKGA 1ADSA 2QUVA 3M07A 4HCHA 1BTCA 5F1UA 3BG5A 1E6RA 2CHNA 2TPSA 3A21A 3NQAA 4ZEPA 2QAPA 1DWHM 3H2OA 3IVSA 3MB9A 3GKFA 2WM1A 3VKAA 1MDLA 1WAWA 1QCWA 1B3WA 2YCLB 1F9CA 5EBAA 2OKTA 3AHXA 1A5SA 3PZ9A 2NQZA 4GABA 2XFRA 3ALFA 1GOOA 3M6DA 1VB9A 1ECEA 2RJGA 3EX1A 2VC6A 4HT3A 4WEVX 4ZL1A 4JDBA 3RGTA 3PBYA 4MGGA 2ZRWA 1CGTA 4P2VA 3GU9A 1EC7A 3IUDA 3Q37A 3UQNA 3KVJA 4IMEA 3U3HA 1PEZA 1DQXA 4GYPC 1J0HA 3M7WA 3P84A 3GC2A 2JIWA 1T96A 3WQVA 5AC4A 1HJVA 3S2LA 5K7JA 2Z2BA 5CSYA 2VZVA 3N2OA 2E1WA 2GGGA 4CCCA 5B80A 4DBUA 3TN4A 2XYLA 3BE7A 1DTNA 4MM1A 4V27A 1AJ0A 1B57A 4U10A 4ZB2A 1NFPA 3A12A 4GXMA 3LBMA 1F76A 3NZPA 1K7FA 1OIFA 1OF8A 1XSIA 1NAL1 5AC5A 2YW4A 3N29A 3I7SA 2XN1A 4EK7A 3EDDA 2JALA 2C1HA 3AU6A 3JRKA 4DZAA 3DFOA 1VJIA 3E0FA 4NXKA 1HKKA 3V0SA 2P88A 2F6KA 4TX6A 1A4MA 2YOCA 1GTEA 1DYSA 3KBMA 3LLDA 2PP3A 4D8AA 3UG4A 4IICA 3PFMA 5G2WA 4NJHA 4ERGA 4F3HA 1IHIA 3KBNA 3M0XA 3CHDA 1JQXA 3GG8A 4E6MA 3UERA 1JDFA 2OEMA 2I57A 3KL5A 2ISDA 4UTFA 3CK5A 4XZLX 2HTMA 4DPQA 1Q8JA 4QG6A 3QM3A 1DWGM 1KXVA 2E1DA 2FKPA 4I7WA 1EC8A 1VH7A 1UR8A 4EPDC 3GD6A 4QS6A 4JKKA 1L6GA 1UC4A 2W3ZA 3T44A 2VEMA 1CXHA 3W7DA 3VOJA 1DJGA 5DMLA 3RM9A 2QGYA 4FNUA 3PZTA 1RJQA 3RX3A 7PTDA 3MV01 4TV6A 3PPGA 3OQEA 1B9BA 4HA4A 2O4QA 4ICNA 3R4IA 4MSSA 4IFOA 3BC9A 1EH9A 3ZM8A 4IISA 3UXKA 3B9DA 4WGHA 4LUSA 3ZVHB 3RCYA 1SVDA 1BKSA 4FK9A 1UH4A 2A7NA 2BGSA 3QGVA 3SN0A 9XIMA 3AOFA 3DOPA 3W2JA 4EWJA 3VDHA 1LRQA 4U3AA 4LAUA 2OLSA 3CASA 3GNOA 4UUIA 3CV7A 2VD9A 4Z1BA 2HV5A 4NZ5A 3QV9A 3ID7A 2WM0A 2ZRVA 5BXPA 4TXEA 1PBGA 4O4WA 3HGOA 2V3EA 1K4GA 3PF3A 3ZXWA 3EX2A 4LX4A 1XBVA 1WZAA 5EMMA 4V28A 2FDSA 1ZJBA 2X41A 1OFRA 5H8UA 3NPUA 3W86A 4Z42C 5CAKA 2GVGA 4KESA 2VCBA 1SSDA 3OLEA 4S3FA 5DCDA 4AZCB 2DUZA 2ZX7A 3HU7A 1XBZA 2C19A 3GK0A 4QLLA 4BQ4A 5A69A 4R7JA 1TPUA 4DJEC 3CV2A 1CPUA 5D05A 3PWGA 3UWYA 2CNCA 2CLPA 3PZUA 4RE0A 5F7UA 3OO2A 3V36A 2BHZA 4PGLA 3NM3A 1Q6CA 1V5XA 3AS0A 4A8LA 3T0TA 1JCJA 3DXIA 1EYEA 1VCVA 4NY2A 1O6IA 1ZP4A 1XBXA 3WZ0E 1YNQA 1XH2A 1V02A 1G94A 6ENLA 3KCOA 3WD1A 3A3WA 4HA1A 5HMFA 3OTRA 1Q6LA 4DLFA 5C2XA 2D0HA 2QKFA 5IDZA 4KKXA 4WKFA 1OB0A 1YDVA 1BHGA 4O4VA 4Q8UA 3W7CA 5I5RA 1LT8A 2YA2A 2Z26A 3WQEA 1LRNA 4YTSA 3DERA 1HG3A 1K4HA 4D1JA 3EDEA 2E6FA 2WNNA 4QP0A 1OFBA 1POKA 3BLPX 4WDTA 3LGGA 1XYFA 2A3AA 2Z1XA 2CLLA 4MF4A 1T7LA 3G22A 4A3YA 1GOWA 2ZX9A 3ITYA 2Q8ZA 2ZXBA 1EA0A 1OEPA 4HQVA 2CZEA 3IGUA 3PJWA 1DJIA 2YXGA 3DFTA 2AL1A 3WH7A 3TYEA 4UTTA 1AFSA 1CENA 2V2DA 1X39A 3O05A 2GL5A 1QAPA 5HA7A 5GNXA 4IH3A 2ZADA 3TTYA 2XVPA 3PBVA 1QWKA 3W7GA 2ZICA 2J7GA 1GQIA 3VIGA 1D7FA 4DWDA 3QC3A 1A49A 2YDQA 1BXBA 1PYFA 3TIMA 3RM4A 1SSGA 3MBFA 1XIDA 3R7MA 3RLGA 3SGGA 4CU7A 1LJYA 3BLOA 3P80A 1XQKA 1F74A 4WX2A 4W88A 4LUTA 5E0FA 2ZWYA 2ZTJA 3CNYA 1FWFC 3ANYA 3HN3A 4K1GA 2J8FA 2X1RA 1HT6A 3VD4A 4LS0A 4O1DA 3LQLA 4UR9A 4JD4A 3N3TA 4J5NA 4Q7NA 3W85A 3ZVHA 1U1HA 2PU0A 2B4GA 4O18A 4QIUA 3CZKA 3TU9A 3NZ1A 2IXUA 2AOSA 1E51A 1KM1A 5DO8A 3LHYA 3T8QA 5FJPA 4W4QA 1SMAA 1JULA 4KGLA 3GR4A 1ZSXA 2B7PA 3W2KA 1E3ZA 4H9XA 1OT2A 1TUFA 2OSWA 1U5HA 2WZHA 3H2AA 3NQ8A 4X63A 4ROPA 6PTDA 1KRAC 3CM4A 1BQGA 3FVDA 5I7GA 4CD4A 4AXKA 3O0FA 4ZCWA 1W2PA 4R33A 3MZ2A 2QPUA 2JF7A 1Z9AA 1H0GA 2HMCA 3F7JA 3FX4A 4JGDA 1M7PA 5K2ZA 3B9AA 3MWCA 4A4AA 4AZCA 2X1IA 4HOZA 4GCXA 3WLKX 4R34A 2WHMA 2PTYA 1UKPA 3L2LA 2R82A 2JBMA 1LQ0A 1S5MA 1AL7A 3LK6A 1FWHC 1A5KC 4ZZ9A 4U5IA 3WD3A 3EEZA 1VR6A 4IMAA 3IIXA 1RD6A 4NU7A 3B4UA 3GW3A 1FWNA 1TTJA 5HWJA 2AGTA 2GDUA 1I2NA 1X97A 3ARRA 2OT1A 3TYCA 4DRSA 3PULA 1I2OA 2XJ7A 1B3YA 2Z1KA 3W2LA 3OB8A 3L67A 3ZR6A 3GSMA 1LOQA 3I6EA 1R2SA 3W7IA 2PUZA 1M65A 3DESA 3S1GA 3R8RA 3UXIA 5AVHA 4OOZA 1OCBA 4C6PA 1XLLA 3W73A 3SCRA 1X6NA 2DW7A 3P74A 3TNOA 1CDGA 3FAWA 1PTGA 2XSXA 3QY8A 3DFPA 1JZ8A 4CVUA 5BYWA 2AAAA 4L7ZA 3NIYA 5DT7A 4K36A 2WVSA 2EEXA 3UR2A 1O4UA 4QJ3B 1XRSA 3RLUA 3EPMA 4BF9A 1G4EA 2ZRUA 3NQEA 4R9XA 3CUIA 3CUFA 2XPKA 2TYSA 1TWSA 4HMEA 5TBOA 1CGVA 1WOAA 4YIWA 5A6TC 2CIPA 3FW6A 3D46A 4MKNA 1EWDA 2J25A 1VAHA 4OUIA 1BRLA 1J0ZA 1GEQA 3LV5A 3NL5A 1TR9A 3W1QA 1VFUA 1FXPA 1LLOA 2CPUA 4PN2A 1PS9A 1E5NA 1GUVA 3BL3A 2YA1A 1EHNA 3VKBA 4KEMA 3DG7A 3FDGA 4GUGA 2AGKA 4W8LA 4ZE4A 3A13A 3KX6A 3H2FA 3RXZA 3VKDA 2A3LA 1EEPA 1XCXA 1JPHA 3UZJA 3SQSA 3MP4A 1NU5A 1XIBA 3ZLFA 1M9HA 1H3GA 4KWWA 3OVGA 4TOQA 2HXTA 1XH0A 2VKZG 2ZQ0A 2WW5A 3L9CA 3MUY1 1B3ZA 1Q4WA 5DMYA 3UCCA 1YE6A 4RZ6A 3WQFA 5MKGB 1DHPA 2ZZ2A 4K6AA 4RNJA 3MUIA 3GHRA 1ITUA 3TC7A 1MFUA 4HMCA 4C6CA 3LLFA 1CT5A 3LNPA 3WCZA 4HJWA 3DC0A 2CBJA 4N4PA 3GG0A 4R3UA 4TX8A 4YS1A 1O95A 5REQB 2WB5A 1K77A 1OGBA 3FOKA 4MNJA 3EOEA 3UF9A 3W7RA 1G7UA 5A8NA 5E70A 3AFBA 1DQUA 4PA8A 3WUFA 3E2VA 3IJQA 2ZUNA 4NP7A 1R86A 1JPKA 3TSMA 2DZSA 3C8NA 1V0MA 1LL6A 1MW0A 4GQGA 4YCPA 5CPSA 4CQCA 1ODZA 3ABRA 2NXGA 3VILA 4DBSA 4S1FA 3T6CA 4N9CA 1XIMA 3QKZA 2VEGA 4JHMA 3S9YA 2XHYA 3F4WA 2GVEA 3TC3A 3R8HA 1HTIA 4LAKA 1LBFA 3K4WA 4GUJA 3BMWA 2WMHA 2QVNA 3AHZA 4D6GA 4RE3A 4KW2A 4ZOCA 1PZ1A 1Q13A 4IGSA 5AYZA 2WJEA 2VNCA 1UBPC 3N3MA 2YBVA 2ZRYA 3H70A 4LY4A 3A47A 3BSHA 2WHLA 2DQWA 4B9YA 2BB0A 4ZE5A 1KR0A 4HMNA 3WK0A 1C8QA 1XD1A 2VDIA 3OLDA 9CGTA 2GUBA 3WH8A 5JIWA 2J9XA 3WEZA 1YRRA 2YIHA 1B0IA 1HKVA 2D1ZA 1S2UA 4UTLA 4HA0A 1JPIA 4QG9A 1A3WA 1X98A 2C91A 4B3ZA 1WOBA 4DHGA 2W79A 5AC8A 1GT8A 3T2OA 1ZNNA 4U2ZA 5FF0A 4DM1A 3DUGA 1P0DA 4C91A 4BWLA 3CYJA 4AZ6A 2WBKA 1U22A 2PDQA 4QHRA 3QEZA 3PB2A 4R88A 4IG2B 4I7VA 3IGXA 1J0IA 5I09A 3KHJA 3MKKA 3ERPA 4FLOA 5FSDC 1XLIA 5E6ZA 4LVDA 4ZQPA 2TMDA 4AZ5A 2DGAA 2DT0A 3DIPA 1R87A 1ECQA 3I3EA 1IT0A 4AD2A 3C5QA 2PZNA 3WBXA 2PDFA 1QW7A 1KM2A 2HJPA 2XISA 4LCQA 1UP0A 4ONVA 3O6CA 4YN5A 3BANA 1MRAA 2VFEA 1M04A 3NZGA 1C8VA 2FHBA 2JK2A 1CBGA 4E8GA 3APGA 3NURA 4LJ3A 3WQ8A 3AYVA 4FNPA 5CSSA 2HK1A 1OC6A 3WO8A 2J47A 5AC7A 4PMQA 3KVMA 4LC8A 1Z48A 2WKLA 1QVBA 2FHCA 1RPKA 5CPTA 1EP3A 1VD6A 5F2MA 4I5XA 3LPOA 1J5TA 3SUSA 3NGFA 4E4UA 3PZNA 2FB2A 3CZEA 4JOMA 2EPLX 4A3HA 3DKLA 1VFMA 4PUJA 3UR7A 4XISA 4W84A 3WF3A 1LL4A 3FCPA 3QVQA 3THCA 1HQTA 3GDMA 4O0KA 5FCZA 3LG3A 1K9DA 1KM3A 3A24A 1F2JA 1QNQA 4JXCA 3E1F1 1DXEA 1J9YA 3VNJA 1I2PA 4JAWA 1W1TA 2FTYA 3GC5A 4LUYA 4W9TA 1W3JA 2TRSA 4NZCA 4KERA 2E8YA 1UWTA 1VP5A 4PUWA 2Z0IA 4Q8NA 3UR8A 4AEFA 1XUUA 4KCVA 3W00A 3GQYA 5I77A 4RV8A 1X6UA 3N17A 3SZ8A 3CV1A 3ZWTA 3MUCA 2QUUA 2ZCGA 3L5LA 2DU2A 4GVIA 1R9YA 3R13A 3BAXA 3W1XA 4IQDA 3L4XA 3G1HA 3H8AA 4DZHA 1DJNA 3UGVA 3BWWA 2FZ9A 4KEVA 5TF0A 3H12A 2QJIA 2P76A 1XLKA 4ASTA 2DZTA 3L7RA 3T1GA 3WSUA 2H90A 5CC5A 5FOOA 1DWJM 3E96A 1R8LA 3LB0A 3NXLA 2J7CA 2WPGA 3S3GA 3RU8X 2Y5EA 3WK3A 4AY7A 5FKYA 5FF4A 2GUYA 1VKFA 4P7LA 4HNTA 4E38A 2GQ9A 1LWIA 1IEWA 1IEIA 3G6LA 3H22A 3CHCA 3S0CA 3W7JA 4LB4A 2OQLA 1O5KA 1TV8A 2ZZ6A 2YXOA 4QTGA 5I06A 2WXDM 2VGFA 3G2GA 3M0YA 3CMGA 1AH4A 1T8XA 2VZTA 3AO0A 1YTKA 4O28A 4PODA 4WJ8A 3CZ8A 4FNQA 2AMGA 4GYPA 1BTMA 3D5HA 1E40A 4REQB 2W62A 1O60A 5FIPA 2UBPC 3MPGA 5BWAA 3NQ7A 5CPNA 4UNLA 4KETA 2J24A 3NO5A 2R9RA 1ZS2A 4UFHA 2L5HA 1A0CA 2R8WA 5LXEA 1HX0A 1V6TA 2QDDA 2FLIA 1GYMA 1E5JA 1XRVA 3NL3A 2TODA 2GWGA 1LUCB 4AZGA 5K4XA 5I79A 2ASHA 1LQAA 3A9IA 1OBAA 2YYTA 1JVNA 4E2VA 1ZALA 4O8RA 1KKOA 2OX4A 3AIWA 1HVQA 3BAIA 1F6KA 3NO1A 3U7VA 5I3KA 3WLMA 4CNNA 4ORMA 1T8QA 4IZGA 3VO0A 3F5JA 2QV5A 4GC3A 2E25A 3AXHA 4J3XA 2Y85A 1KRMA 4M6VA 3TOYA 3PFRA 3WLPA 3B0VC 3U57A 1BWLA 1UZ1A 1BVNP 3HPAA 2BXVA 3ZZ1A 1J96A 3AYRA 2IS7A 4ZB0A 3A3HA 3D3AA 2UZ9A 2BP1A 4OIFA 3NSNA 4OHQA 4R7OA 3OJGA 1KWGA 3R79A 3U7BA 5C6MA 1Z32X 1O12A 1E73M 3PK7A 4EPBC 1Q2SA 1M41A 1EZ2A 1QK0A 3QYSA 2BY1A 2BMBA 4NL1A 3QFEA 1Y8BA 4K68A 3TXVA 1JGIA 1US0A 3GTFA 3HPXA 5F4WA 3DG6A 3UJSA 2A2IA 1TIWA 1Q8AA 4Q4OA 1S2TA 3NQ2A 3M5YA 3IEBA 3QZ6A 4WY0A 4JHZA 5AB3A 4IJRA 2REQB 5H1WA 4X0NA 4QSHA 1I1XA 2C16A 2VX7A 1H1ZA 1DWAM 1HKJA 5XIAA 4KEZA 4Z2JA 1TPH1 1L6YA 2XSAA 1WQ5A 1FFQA 1M53A 3ARVA 1TWWA 2DUAA 3QN3A 4E4FA 4YWIA 1ZAHA 4H7ZA 4PBEA 1Z69A 3KTCA 1KA9F 4G56A 2DT2A 2AKMA 4P7RA 4G8TA 1VBGA 4EPEC 4D6JA 1V6VA 2X30A 3CZJA 4DO7A 4WIWA 1CIUA 3GXMA 4BEQA 3G1SA 1DJZA 3AXXA 4IM4A 3W22A 4YWSA 5FACA 1YBQB 3OODA 3CMJA 2IQTA 3PTDA 2Q8LA 4GJJA 1NP0A 1DL3A 3AICA 3T4CA 2WVTA 2F9RA 3AIBA 2WC4A 4Y2WA 1JG9A 4DJEA 4HU3A 3M47A 3E2SA 1BYCA 2HQAA 2R14A 3AMKA 1XC6A 4REQA 1PHWA 3NOYA 4RUBA 2J77A 1EJRC 2DT1A 4GH1A 3TTSA 4CQDA 2F84A 4UQBA 3SUUA 1OCJA 3NVDA 4PYSA 4DJED 4A3UA 4FALA 3TMQA 3E6EA 1YYAA 1NP2A 4GNJA 2PF8A 3QMTA 3DYPA 5E1QA 2GYIA 2J7FA 4YHGA 3VXGA 1YDYA 2D3LA 2PS2A 3OQ8A 5C2CA 3VOCA 2FH8A 3RX4A 4MB5A 3CAQA 2ZUVA 2ZRZA 2HEJA 1VZWA 1TVNA 2GSJA 1M5WA 5FD0A 1MNZA 4HSNA 5E0KA 4GY1A 4KCTA 3SN4A 3S6DA 1OFEA 4MYAA 2ZZ3A 1O5XA 2G41A 3PZGA 2G3IA 4Q33A 1DXFA 1C8YA 3QMSA 3FHAA 2UY2A 2DQXA 1YPXA 5C54A 1DE6A 1ONWA 1JNEA 4X61A 4HN8A 1UZ4A 3L4VA 4QNWA 1EA9C 3EOLA 3OW1A 4AXNA 4JS3A 1DXIA 3SM0A 2XFYA 1RXOB 3QHNA 2PE4A 3ZWSA 4P7OA 3S5OA 3K30A 1DP0A 2BBFA 3OVPA 4KS0A 2O55A 4WXYA 4KWUA 4W8AA 4PE8A 4PTXA 4H9MA 2NUWA 1TREA 3I4EA 4BA0A 3KBVA 5LZLA 3G1FA 4BS0A 3MZNA 5FJOA 2HS6A 4PCSA 2ZXAA 2NSXA 4O1BA 4C6OA 3QGKC 1C7SA 2ZXDA 4KWSA 1XUZA 1TJ0A 1XM3A 4DX3A 4J28A 2YL9A 4B4HA 4W5ZA 3C3NA 3PC0A 3AUOA 3ARWA 2CZVA 3VFLA 1QPKA 3GKAA 1SFSA 3CT7A 4L1WA 3BO9A 3PG8A 3ME3A 5HNNA 2QVHA 3ARXA 1L8NA 3ANVA 1AUSL 3NAVA 5I3DA 4US6A 1WCGA 1ME8A 4LY8A 2GVYA 2UY5A 2REQA 3USZA 1AJ2A 1A5MC 4GFIA 1E9LA 3DI1A 3LD5A 5HDRA 3NCOA 3WEMA 3V0UA 7XIMA 1PVNA 4BQ2A 2OU4A 3W26A 3SECA 1CLXA 1UKTA 2OZ3A 4WD0A 3BJFA 3UFYA 4AD4A 4O0QA 1VYRA 4DI8A 1HL2A 5LXXA 4DJFC 1OQFA 5CEWA 3IGSA 5EGRA 4FLRA 1HZYA 1RA0A 2NVDA 4IL2A 3DHUA 3LTSA 3V5FA 1GG0A 3URAA 3GH5A 1I8JA 4D6EA 1YBQA 5B7ZA 3UZYA 1BYBA 1XX1A 4PB5A 3VCRA 3FV9A 3TTEA 3ZLHA 4MJ4A 3F4DA 2Y88A 2NUYA 3HBLA 2Y7GA 4UQEA 3KDOA 1SR0A 1S2VA 1G7VA 2VX5A 3HB9A 4HYRA 1IXQA 2FTPA 2RDWA 4FSAA 1W9XA 3WLJA 4B3KA 2ZXQA 1KFWA 2J66A 2Y8VA 4ENLA 1LZOA 5FEWA 1UUQA 1UR3M 3IUHA 3V5CA 5D9PA 3PN8A 4PFHA 3CZLA 3W4RA 1X1NA 3C0JA 5LHEA 4LALA 2VFIA 2C15A 1FWGC 3IANA 3MCNA 4P8VA 3WDQA 3R94A 4O8AA 4A6GA 3CL7A 3L2MA 5HBFA 4FNTA 2ODOA 4NI3A 3TCSA 3SSZA 1UH2A 1UR2A 2Y62A 1RY0A 4JTHA 4ML9A 3ITGA 5HUOA 1EX5A 4IGNA 2YGYA 2CBVA 3HIJA 3SY1A 1H7OA 3SDOA 3PUGA 2Z6IA 3PBWA 1ZFJA 1BKHA 4G6CA 4O53A 3TJXA 5A95A 4BZYA 3ITLA 3NZRA 1XBYA 1PX3A 4XZWA 2YCIX 1RBLA 1UR4A 2PGRA 3WF4A 2VFGA 2BFGA 4L1XA 3UVIA 4Q8QA 7TAAA 1IXPA 1GCYA 1R7AA 3B8UA 2F2HA 3K8KA 1W91A 1UR0A 2PDIA 3UJRA 3T2PA 3W87A 3IJIA 4O12A 1ZUAX 3UA4A 2ZUSA 5BZAA 1W9BM 2VHLA 4RLIA 2EAWA 4HHLA 5LIWX 2ON3A 1L0PA 1PZ3A