1H1NA

Atomic resolution structure of the major endoglucanase from thermoascus aurantiacus
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
305
structure length
305
Chain Sequence
AKVFQWFGSNESGAEFGSQNLPGVEGKDYIWPDPNTIDTLISKGMNIFRVPFMMERLVPNSMTGSPDPNYLADLIATVNAITQKGAYAVVDPHNYGRYYNSIISSPSDFETFWKTVASQFASNPLVIFDTDNEYHDMDQTLVLNLNQAAIDGIRSAGATSQYIFVEGNSWTGAWTWTNVNDNMKSLTDPSDKIIYEMHQYLDSDGSGTSATCVSSTIGQERITSATQWLRANGKKGIIGEFAGGADNVCETAITGMLDYMAQNTDVWTGAIWWAAGPWWGDYIFSMEPDNGIAYQQILPILTPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO TYPE CELLULASE ENGI
publication title Atomic Resolution Structure of the Major Endoglucanase from Thermoascus Aurantiacus
pubmed doi rcsb
molecule tags Hydrolase
total genus 124
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1h1nA00
2FHFA 3L4VA 4WF7A 1BPLB 4BS0A 2G3IA 5C70A 4W8AA 4TTGA 3W6MA 3AXXA 4U2YA 2JF7A 1ZL1A 1X6NA 1HVXA 4QDMA 2VURA 5CLWA 3G6LA 4R27A 3VDBA 4QAWA 3SCQA 1LG1A 1TVNA 4XV0A 4W5ZA 2EPOA 5DO8A 2PWFA 1R8LA 3EYPA 1UYQA 3MUAA 4UZSA 1A3HA 1PEZA 3MV01 2ZUMA 1KCKA 1EDTA 3RCNA 1M53A 5IFTA 2J25A 4W7WA 1PBGA 3W25A 2XHYA 3OLGA 1GOQA 4UFMA 3WQVA 1MQQA 1VJSA 2JE8A 2WYSA 3WH8A 2VZUA 1XYZA 4TTUA 2ZUNA 2ZUSA 5BXRA 2WPGA 2XYLA 2WK2A 1MXGA 3PTQA 3CPUA 1ITXA 1JAEA 2VR5A 4BF7A 3N11A 1E72M 1ZBWA 1K9DA 1KQYA 2QMJA 2WMHA 3AHZA 3T0DA 3ZO9A 3SUUA 3SUSA 3II1A 3GNOA 1UUQA 4FF5A 1V3HA 5LA0A 3CHCA 4AD2A 4MNLA 3WUBA 3IANA 1W9VA 4XX6A 4K68A 4FLQA 4GI8A 1H0IA 2CIPA 4J3XA 1W9BM 3GNRA 3NSXA 2XVNA 2PBOA 3K4DA 3EDEA 3ARPA 5LYRA 2X2YA 2YJQA 3ARWA 3BLKA 1OSEA 1WZLA 4EANA 1JZ5A 2Z1KA 1D2KA 1W9XA 2DPEA 1C8XA 5ABGA 4AY1A 3N13A 2GK1A 3UG3A 1CGTA 2WCAA 3RPMA 3DECA 3GXDA 2XVLA 3AMLA 3OLEA 1CGVA 2YA1A 4UOQA 2AAAA 3PZUA 1J11A 1NOWA 4NI3A 3ZT7A 3LPFA 3VDHA 1XSJA 1V6YA 4D6JA 4Z2HA 5M5DA 4LX4A 2E9LA 3IAQA 5M03A 3VIMA 3PZTA 5IXEA 2XFFA 4AMCA 1TCMA 3WMSA 3TTOA 3ZQ9A 3WELA 2F2HA 4MDOA 3VTRA 1LLOA 1B1YA 3ARQA 4B9ZA 3KL3A 1GPFA 3SURA 2O9RA 1WPCA 1UR4A 4ATLA 4HA1A 1FOBA 1H3GA 3F5JA 4P7OA 4JHOA 2WVVA 2J8FA 1W1TA 2X09A 2ZUTA 1QOXA 4PSRA 3PTKA 2DSVA 1QI2A 1J0JA 4GZIA 3S2CA 1E4IA 2WWDA 2J62A 4OUEA 5FL1A 1US2A 4UQDA 1IV8A 4MAVA 4AZHA 1E6RA 2VI0A 1MXDA 4CCEA 4D72A 1E5JA 1W2VA 3GXFA 1C7TA 1H4PA 2CXGA 1S46A 1JYVA 3AS1A 1WDSA 3APGA 2VZVA 2FH8A 3VU2A 1M01A 1L0PA 2J47A 2WM0A 1W1VA 4WKHA 1IZKA 1OWQA 2J7CA 4GQRA 3W6LA 1BVZA 3ARYA 1JYXA 4HOXA 1CXKA 2V5CA 2PF0A 1A47A 1TG7A 1C3FA 4DUXA 2JALA 2WCGA 1Q4NX 2BVYA 3FNDA 3CHFA 4F66A 1I1XA 1ISXA 2J77A 2CBIA 3L4ZA 5I79A 3VGDA 1GOWA 3BCDA 1QHZA 2EPLX 1AQ0A 2DSWA 3CMGA 1XSKA 1JAKA 1BLIA 4HMCA 2ZXAA 5A8MA 2FH6A 4AZ5A 2D0GA 5E6ZA 3T0BA 1PX8A 4ACYA 3WUGA 1XC6A 4L4OA 3WF4A 3W53A 4GIAA 1UKOA 3RO8A 4PMXA 1UD8A 3MUY1 1HXJA 4AZ7A 3NDYA 3OA5A 1KR1A 3WF1A 2RGMA 4MAZA 3OZOA 3PZQA 2D3LA 2W66A 3PN8A 4WK9A 2PWGA 4OKDA 3WMBA 3MO4A 2J74A 5HOSA 3EMQA 3OLIA 1VJZA 2YDRA 3T0AA 1GOKA 2J4GA 3QHMA 1EIBA 1QW8A 2VCCA 2WHMA 2BY2A 4C7FA 2D2OA 3VIPA 4KMQA 1B2YA 2WMJA 4KWUA 1EOMA 4MNKA 3WNLA 4OJYA 2OYLA 3T2PA 2G3MA 3BSGA 1MQRA 4FMVA 4NF7A 2J75A 3OGRA 4B15A 2W62A 1PAMA 4RE2A 3CH9A 4V28A 2O9PA 4GZJA 4PMUA 3W28A 1UWQA 4UZUA 4CU8A 3MU7A 1C8QA 1K9TA 3MSDA 3UR7A 5JIWA 2DT1A 2GVYA 2D20A 3N15A 1G94A 2VX5A 3FXYA 1EO7A 3KL0A 3K46A 1V6WA 2E9MA 4AZIA 2CHNA 1CXEA 3AMGA 2VX4A 3AIQA 2ZX6A 3VIHA 2Y24A 4D1IA 4TXEA 2Z1SA 1G5AA 1HJQA 4PMQA 1E4NA 1VFMA 2VO5A 4TOQA 5TD4A 3WNOA 3VD5A 3PZ9A 3RM9A 4ZEPA 3WL0A 4HTYA 1OBAA 4PTWA 1PIGA 4XZBA 3AIUA 5BXTA 3BCFA 2CBJA 5EBAA 1OINA 3A47A 2O9TA 1CZ1A 1U30A 2NT0A 2Y8KA 5AY7A 1FH8A 5E09A 2DH3A 3THDA 2GJPA 1BYDA 1QI0A 5C71A 5JBFA 2DDXA 4YHGA 2OWCA 2GDUA 2DT0A 3AISA 3M46A 4CGTA 1IZJA 1PX3A 3QHOA 2E3ZA 2X05A 4UFIA 3KWXA 3WD1A 3FY1A 4E4PA 2VRKA 1HIZA 3TTQA 4A4AA 2VZTA 1OGSA 5JUVA 3VGGA 4YHEA 1E0XA 4MNMA 4PN2A 2EPNA 1UQZA 1H11A 1B9ZA 2VZOA 2YL9A 3AOFA 1EQCA 1JIBA 2YL6A 1GQKA 1V3KA 2ESCA 3WEZA 3ZJKA 4M29A 4OBSA 1JNEA 1W9UA 1ISVA 1E1FA 1CLXA 2J7HA 1CGWA 3CLWA 4BQ4A 2XM2A 1ECEA 2CCRA 1HL8A 4XB3A 3LPOA 3T2QA 3WDRA 3ZOAA 2ZWZA 3L4TA 1FFRA 5DEZA 3ARUA 2VVSA 1XH1A 4P7RA 2ZX9A 4JHZA 4PCSA 5ABEA 3W4RA 1E71M 5CPQA 3RDKA 5DF0A 2VRQA 3QOMA 3QOKA 4UQCA 3GH7A 4MJ2A 1JF6A 3TA9A 3OZPA 1EXPA 4AWEA 4AD5A 1I1WA 2XIBA 1H09A 2VQUA 2YBUA 3N17A 1VFFA 1KQZA 3O2LA 1DWGM 1JXKA 3ARRA 1VBRA 4Z2IA 1NP2A 4B16A 2D22A 5BXSA 1SFSA 1E6ZA 5CGTA 2E8YA 5HDRA 1XHGA 1Y7VA 3SCTA 4CKQA 1V08A 1P6WA 3VGHA 4B9YA 4JKMA 2G4FA 3A4XA 3GXIA 1WDRA 4UFHA 5AYBA 1J01A 5A8PA 1DHKA 1UD4A 3ALFA 3FAXA 3WF0A 2Y8VA 4H7VA 3VIJA 1GQIA 1YHTA 3BAXA 2AMGA 3LPPA 1KXTA 4Z2JA 2FGLA 3WFZA 1GZJA 3NSNA 3EDDA 4H2CA 1UKTA 4PEEA 4J3TA 4PTXA 4AZ6A 4EK7A 4X0VA 4NRSA 4JFVA 4PBGA 5ABFB 1M03A 2G3JA 1MW2A 1PJ9A 1B3WA 4CU7A 1JZ4A 4CD7A 1CGUA 1OGBA 1LL6A 2XFRA 4HP5A 4DWSD 3CZ8A 1UD3A 3U7VA 1DWAM 1E0WA 2YIHA 3TP4A 4D6EA 1ISZA 2DGAA 2BXZA 3BMVA 4J3SA 1MYRA 2ZUWA 1OT2A 2WMIB 3WMCA 4YN5A 1UWUA 4PRWA 3TONA 2BVTA 4IM4A 1IT0A 1R7OA 1E55A 1W1PA 3WQWA 5IHRA 3MMWA 5A69A 3W26A 2Y4SA 1R87A 4WIWA 1D3CA 4M81A 1H49A 1UH3A 2V3FA 2BFGA 3WFLA 4GI6A 2BV9A 2O9OA 1B90A 5D4YA 2VT0A 1HNYA 2WC7A 3D5HA 5EFDA 4UTFA 1QNPA 3AZSA 3SUTA 4MNJA 1H1NA 3VOCA 4F9JA 3AI0A 2Y5EA 5LA1A 4NRRA 4CD5A 1US3A 2PWEA 3N9KA 1WE5A 4B3KA 1B3VA 4HU8A 3WDJA 3VIIA 2DT2A 4GQQA 2YDQA 2RGLA 4UFLA 4AEFA 2JIWA 1CTNA 4P7NA 4Y7EA 2F61A 2ZUUA 5HBFA 1U2YA 2J79A 5A6JA 4UNIA 1AVAA 3GH4A 1BFNA 5CQ1A 1BG4A 4JCLA 4QLLA 4HPGA 1HKJA 1V6VA 3L2LA 3OLDA 3MUIA 4LGXA 3PZOA 3NYDA 2WSKA 2XGBA 4DM2A 2CERA 1E5NA 1OB0A 2PWDA 3BGAA 1VENA 1V03A 2OWWA 2VVNA 4S3KA 1E3XA 3UG5A 5D9OA 4QCFA 3OG2A 1BGGA 2CESA 3RJYA 2EPMX 3GTNA 4NSBA 5A6LA 3K8MA 4ACZA 1J18A 4HZ6A 3WH6A 3AQUA 3LPGA 4A3YA 2GFTA 2E40A 5EFFA 4KRTA 1FH7A 4KGLA 2MANA 1JYWA 5GNZA 3T09A 3RM4A 4CD8A 2HISA 5D9PA 5DT7A 8A3HA 2YKKA 1GONA 3GH5A 1UKPA 4TVDA 1K9FA 1SR0A 3DYMA 4QLJA 1OT1A 1GNXA 5A2AA 1TA3A 1GORA 3FHAA 1HF6A 1J0ZA 1E4LA 4F79A 2FDMA 4BQ5A 5CSUA 5BCAA 4H8HA 1B3XA 1KCLA 3WNPA 1VEMA 5C8BB 1OGGA 1CDGA 2DH2A 1HT6A 3AIEA 3WQ8A 4AYSA 1UWTA 4L4PA 4AD0A 4WKAA 3GDBA 4DUWA 4JKLA 4PCTA 4JAWA 3IJ9A 1EHNA 4CN6A 4JIEA 2EPKX 3B9AA 3DYPA 4AZCA 3PZNA 4LYRA 2C7FA 1KR0A 3EDKA 4M80A 3N18A 3EMZA 4TVCA 2CKSA 2CEQA 2OLHA 4ZXLA 3TTYA 1UA7A 2VCBA 3K1DA 5I78A 1G0CA 1G9HA 2X0YA 1WDQA 1CYGA 3VNZA 1QI4A 1WAWA 3SCUA 6A3HA 3VDAA 3AHXA 3MKKA 3AS0A 4DWSA 2C0HA 3MMUA 5A6BD 1ODUA 2W63A 2BHUA 1QW9A 2ZXBA 1UG6A 4PMYA 1KWKA 4BZYA 4ZE4A 4ATWA 2DT3A 3MUZ1 3THCA 1CIUA 4MDPA 1JFHA 1FH9A 2G3NA 3OGSA 2WSPA 3ZR5A 5A6MA 1H2JA 5A8OA 5A6SA 2ZE0A 4D6HA 3M7SA 1TVPA 4PMDA 3WBAA 5F7UA 3NCOA 3VILA 3WBEA 5JBDA 3J7HA 1JZ2A 3QR3A 4BQ2A 3AMDA 2BY3A 4HOZA 4CN4A 4M82A 1KBBA 4ZFMA 3T2OA 5CPSA 3O9NA 3K8LA 1E3ZA 3ZT5A 3NJ3A 3UESA 3AIBA 3CUJA 5I2UA 2NT1A 3GM8A 1F4AA 2WZIA 4TUFA 3BC9A 3DYOA 3I3DA 2XJ7A 2GJXB 4W88A 3IJ7A 3AHYA 1HN1A 1JDDA 3FHQA 3JUGA 4EKJA 2GK1B 2IXVA 1RD6A 1V0LA 3K8KA 2PI6A 4A3HA 2GJRA 1V3IA 1LJYA 4D6GA 1J0KA 1BG9A 2A3HA 2A3AA 2QMKA 1BVNP 3HMCA 2EBNA 3RM8A 4N0RA 1JZ6A 2X1IA 1MFVA 5KEZA 2DSKA 1KGWA 4N42A 1QVBA 4GKLA 4QFUA 1LWHA 4H41A 1O7AA 1FP9A 4W7UA 4J7RA 1CBGA 1WB0A 1E9LA 2ZX7A 3AXIA 1G1YA 5I3DA 3F5LA 5BRPA 3ARXA 4OZOA 5I77A 4OIFA 2BVDA 1XRVA 4PMZA 4XZWA 2WVVB 1UOKA 4TX6A 1ZJBA 1GHSA 3WDQA 1UWRA 4CVWA 3VGBA 4IUGA 5I24A 1BTCA 4HZ7A 4H8VA 3DHPA 5CGMA 1DWJM 2D24A 3VX0A 3D3AA 1SYTA 3UCQA 3EDJA 1C7SA 3VM5A 1HJSA 2OSYA 1RH9A 4WSJA 4M56A 3SCSA 3O6AA 3B9DA 3ZSSA 4U3AA 1AQMA 2V38A 2WLYA 5I5RA 4UQAA 5FL0A 1GW1A 1UHVA 4H04A 2FHCA 1C92A 3AXHA 1E1EA 2WHKA 3GZAA 1W3LA 4PMNA 1M7XA 4W8BA 1QBAA 4AEEA 2D23A 4AD1A 4HA4A 1KBKA 4PMRA 3OIHA 1CENA 1JDAA 4LPCA 5A8NA 2WVTA 2W67A 4YPJA 1V0MA 1UD2A 2UY2A 3ARZA 2DSUA 4CCCA 1HJUA 1QHOA 1W3HA 4FLRA 1R85A 3PBGA 4IISA 4MB1A 4F8XA 2W5FA 2XIIA 2WWCA 1LL7A 3FAWA 1NWTA 3I3EA 2Y2WA 3B8SA 3CUIA 2WLZA 5BYWA 4UFKA 5A95A 2QPSA 4P8WA 4V2XA 5A2CA 1TUXA 4AD3A 1K9EA 1EQPA 1RP8A 3AHTA 1KB3A 3ZIZA 2OYKA 1QNRA 2V5DA 4OOUA 1AMYA 2ZXQA 4WLCA 1FP8A 2E8ZA 1JI1A 1UR0A 5E0FA 3WDIA 2YLAA 1MW3A 2WMIA 5A6BA 2ZIDA 2BHZA 2VUYA 1GHRA 4W89A 4NZCA 2VC9A 2OSWA 5ECUA 4UQ9A 3CIVA 1EHAA 2WZEA 4KH2A 1VBUA 5CXPA 3M6DA 4AZGA 2VMFA 1BHGA 1JZ7A 2XPKA 3PZVA 4W87A 1XH2A 4E8CA 2QPUA 2G41A 4D6CA 2VTFA 4Z2LA 3BAWA 4MB5A 4MPKA 1LL4A 1G01A 3WN6A 4AISA 2AOSA 1TFVA 3QHNA 1ZBVA 5IFPA 2J7BA 2FGZA 4W86A 2J8GA 3IAPA 4U2ZA 2WC3A 2YL8A 5GNYA 3VMPA 1F4HA 3G6MA 4JKKA 4PSPA 2C8NA 2XVKA 3VD9A 2WBKA 3CZEA 3SCPA 2TAAA 1JZ3A 4HZ8A 1UZ4A 1XYFA 4D71A 2WXDM 4UQEA 3L4YA 4LXFA 2O92A 3TTSA 3ZSTA 1VB9A 3WUFA 1PZ2A 2D0HA 3BAYA 2CPUA 5HPCA 3WIJA 1O6IA 2E4TA 3UERA 4OOZA 1ZJAA 2XWEA 5GPRA 3VUPA 1Q6EA 5A3HA 2ZWYA 3PTMA 1B30A 1JL8A 1VEOA 2E9BA 3EMCA 1UR8A 3OBAA 2VX7A 4JL2A 5I23A 1WZKA 1W3KA 3PHAA 2WW5A 5FKYA 1ISYA 3LMYA 1HJVA 3WF3A 1GOOA 3I3BA 1W9DM 4CD4A 1XSIA 2CHOA 2VZSA 2XGIA 4U33A 4UFJA 3ZJ8A 1FFQA 4HOWA 3GBEA 3RJXA 4FK9A 1NARA 2EXOA 4HU0A 3WF2A 1VAHA 1HKIA 3AMCA 3A6OA 4MB4A 3CO4A 1KXHA 3L2MA 3VD4A 5E0CA 2F8QA 4JFUA 1CXFA 1E6SM 3BAKA 3KZSA 1HJWA 1GUVA 4U3CA 2WHJA 3AS3A 1NP0A 5EB8A 1XD1A 3SCNA 1LQ0A 4P8XA 4M8UA 3MV11 1QNSA 1Q6FA 4LYQA 3POCA 1C93A 4U31A 1UR2A 1JF5A 1UZ1A 1ZBCA 2WNWA 3VKKA 3W81A 4DWSC 2GSJA 1EO5A 1KXVA 4AIOA 1JYNA 4RE4A 3L4XA 1CLVA 1Q6DA 5HNNA 4IPLA 1W2PA 2JEQA 3WEMA 4D6IA 3WDHA 1X6LA 1JNDA 2WZHA 1B3ZA 1DWHM 2G8ZA 4E2OA 4CD6A 4GXPA 3N12A 1MW0A 3U5UA 2QHAA 2Q8XA 2CBUA 1UR9A 1ITCA 3CZGA 3GYCA 4HMEA 4W85A 4UR9A 1B3YA 3WD2A 3VGFA 2WMGA 1ISWA 1V3JA 1RPKA 3WD0A 5AYIA 2JEPA 1H5VA 3VIOA 1Z32X 2XM1A 3HJEA 1XV8A 4P7QA 3UG4A 1FHLA 1XGZA 4CVUA 3VINA 2UY5A 3ARTA 1D7FA 4MTVA 2BNJA 1KGXA 3F5KA 4GZEA 3SCOA 1W1YA 5D9MA 1JD7A 1V6UA 1E4MM 5HXMA 4D6FA 1XCWA 1E56A 1B31A 3NUKA 1W91A 5DFAA 3MANA 1ZU8A 1PX4A 1DTUA 4ZXOA 4QLKA 5I0DA 1J0YA 5CLTA 2XVPA 3T08A 3ZJ7A 4AC1X 3W37A 5E9AA 2IXUA 3W29A 1QI5A 3VO0A 4QP0A 1BF2A 1AQHA 3WKZA 2WB5A 2JF6A 2J7EA 5BWFA 3NDZA 4W5UA 1JI2A 1QHPA 1BGAA 3NSMA 2XVGA 1E6XM 1ODZA 2WBGA 1BQCA 1EH9A 4EAMA 3A4WA 5D8WA 4FLSA 2EQDA 1CEOA 1JXJA 2D1ZA 3CGTA 3W0KA 5CJ5A 1C90A 3WUEA 5LA2A 4RL3A 2GJXA 1DEDA 3WQ6A 3M07A 1UKQA 2WC4A 5I6SA 6TAAA 3ZR6A 1PIFA 5AC5A 5EMYA 4FLOA 4W84A 4UQBA 1ZB5A 3CZKA 1CNVA 2QV4A 1PPIA 1E43A 1GQJA 1I75A 4C7DA 1J0HA 3CTTA 3U57A 2BY1A 4CCDA 4W8LA 1OIMA 2ZOXA 3WNNA 1GVYA 2D0FA 1XH0A 3WSUA 5JBEA 1E6QM 3SCRA 2DIJA 3AS2A 3KL5A 2A3BA 4WSKA 5JIPA 1WNOA 2CBVA 4D1JA 2WHLA 3PZIA 5E70A 2FHBA 2XWDA 1JGIA 4JL1A 3L4WA 2A3CA 2YOCA 4MJ4A 5A2BA 2WKGA 5A1AA 3F4VA 1W32A 1EDGA 4GI9A 1V6XA 1WZMA 1GOIA 3WENA 7TAAA 1XCXA 3AIRA 5BROA 4Z2KA 1U33A 5M17A 1JDCA 2XSBA 1BYCA 4JCMA 1CGYA 3UETA 4BCEA 4AW7A 3B9EA 5CZKA 3AJ7A 3CHEA 1DWFM 3QGVA 1UD6A 5D9NA 4BA0A 2YBTA 4M1RA 1R86A 4MB3A 1KXQA 1J12A 4LYPA 4P8UA 1CXIA 3W38A 3UEQA 5FCZA 4OBRA 4GO8A 5FIPA 2WVUA 5FD0A 3SUWA 1CPUA 3AICA 1HVQA 1NWRA 3WH5A 2UY4A 1V0KA 2XFYA 2VQTA 1VF8A 1H41A 3BMWA 3WQ4A 1EDQA 3BXWA 3RMEA 1BYAA 2DSZA 3CZLA 3E1F1 4J3WA 1E6NA 4CN1A 3BLPX 4UCFA 1W9PA 5IDIA 1YQ2A 1V02E 3MSGA 4ACZB 3CBWA 4PMOA 2YA0A 4AZBA 3WH9A 4R5EA 3VD3A 5FOOA 5D8ZA 3VIKA 4UOZA 3FW6A 5A6AA 1E40A 4S3JA 1QNQA 1GOMA 3AIVA 4AIUA 1GQLA 2J7DA 2WMFA 2WANA 1Q6CA 2DEPA 2PC8A 3WL1A 3DC0A 5ABHA 3RILA 1CXLA 4JFTA 2VNCA 4Q22A 2VRJA 1TA3B 4J3UA 3SIMA 3TOPA 4TVUA 3VMNA 1KGUA 2UY3A 1EGZA 3AHVA 2XTKA 5IHSA 2BXYA 1MVYA 4WJXA 2E0PA 1PZ3A 3GBDA 3WH7A 3WEOA 1SMDA 2HVMA 4PYSA 2WMKA 2V3GA 4HMDA 3IJ8A 1TMQA 1C8YA 2VR4A 3WNMA 1M04A 1UH2A 4ML4A 1LWJA 4WKFA 1GJUA 1HL9A 4Z2GA 4XUYA 1B0IA 2DIEA 4X9YA 7A3HA 4AZCB 1RP9A 1WP6A 1QNOA 3L4UA 4MADA 3RIKA 2W92A 4HPHA 8CGTA 5HPOA 1EA9C 3CUHA 1K6AA 2GUYA 2NSXA 1XD0A 4JFSA 2QF8A 1ZBKA 3CZJA 3SCWA 3VD7A 1E73M 3S6TA 2ZX8A 1E70M 1ZS2A 3N1AA 3U5YA 3WNKA 2CYGA 3AFBA 1WKYA 2VCAA 1NWUA 1HP5A 1E0VA 4JZ5A 3MMDA 3PZGA 1VEPA 1WDPA 4DWSB 3AIWA 3VIGA 3BAIA 3ALGA 2WAGA 3VGEA 1HKKA 2QLYA 1N82A 3U7BA 3EBVA 4M24A 3IK2A 4RE3A 1FA2A 1NOFA 3AMKA 2BY0A 4D6DA 2A3EA 4GO9A 3WDPP 4W7VA 5BRQA 1GJWA 4BQ3A 4HA3A 2B31A 3A3HA 9CGTA 2XSAA 2OSXA 1NH6A 2ZUVA 2PBGA 1LG2A 3VVGA 4JFWA 1V02A 5KZ6A 2EJ1A 2UWFA 2ZX5A 5ABFA 1HJXA 4U5IA 2W91A 3PZMA 2JIEA 4V27A 1OM0A 5M3WA 1NWSA 1V3MA 1LF1A 4H8UA 2JFEX 1VFUA 4F9DA 2EEXA 3WY1A 3BH4A 3VX1A 5BXPA 2ZXDA 3WQ5A 1WO2A 2BHYA 4CUCA 3SCVA 3HN3A 4GINA 3BAJA 2EO7A 1L8NA 4DUVA 1V0NA 2VL4A 3W24A 2YL5A 2WCSA 1J10A 3AYSA 3UR8A 7CGTA 5DMYA 1WCGA 5A8QA 4J27A 1GCYA 4Q7NA 5GQBA 3POHA 3ZT6A 1UWIA 2BS9A 4UOJA 4U5KA 4AIEA 1W3JA 1CECA 5CG0A 1UWSA 3MS8A 5E6YA 3DHUA 4C7GA 4LQ1A 1ESWA 2YLLA 3A4AA 2D3NA 2GDVA 2J78A 3AZTA 4E8DA 1DWIM 1BAGA 1MWOA 4QCEA 3NIYA 1CGXA 2X8RA 3BSHA 2DQXA 4AD4A 5A6KA 1CXHA 4J3VA 2VOTA 3W82A 1VFOA 2XG9A 2CKRA 2WVSA 4B3LA 1C91A 3ECQA 1R7AA 1MQPA 3VDCA 1NM9A 4P8VA 4ZENA 4J28A 5GNXA 4IPNB 3CUFA 2J7FA 1JZ8A 1JFXA 3CHDA 1TE1A 5DT5A 1UD5A 1UKSA 2OYMA 3AZRA 2VJXA 1HP4A 1VIWA 2ZICA 4KRUA 1J0IA 1BYBA 2CITA 1KWGA 1OD0A 1QI3A 1E6PA 1H0GA 3VPLA 1BSIA 1UH4A 5AC4A 3HU7A 1E15A 3SEPA 2VX6A 3W27A 1OD8A 1NQ6A 1SMAA 4PTMA 1HX0A 3WD4A 4CU6A 1FHDA 1J9YA 1OCQA 1UR1A 1UA3A 3ARVA 3N04A 4X0NA 1EOKA 3OB8A 3CMJA 1Q6GA 3ZJ6A 2W61A 3OGVA 4AXNA 2NW0A 2V3DA 6CGTA 4TX8A 3AROA 2X0HA 3AYRA 3VNYA 4URIA 1OIFA 1TR1A 1MW1A 1TZ7A 4KGJA 1UQYA 1DP0A 2PB1A 1KFWA 5A94A 4GPNA 1JD9A 3VIFA 3CUGA 3VM7A 2J7GA 2PWHA 2XUCA 1WZAA 3GXMA 2CETA 1MFUA 4PTVA 2YDSA 3SUVA 3VMOA 1QPKA 1NOUA 4ZE5A 4P7LA 4W93A 1VRXA 3ARSA 3ZM8A 1X1NA 1QBBA 1CWYA 5CSYA 2OWXA 4PUDA 3GNPA 4PUEA 2YA2A 3KE0A 2IUZA 1GVIA 2CNCA 2V3EA 3EDFA 3WD3A 4DM1A 4EE9A 4PMVA 3KEHA 3FN9A 1V3LA 1HKMA 5CPTA 2WKLA 2W4XA 3ZMRA 3K4AA 1JG9A 4ATDA
chains in the Genus database with same CATH superfamily
3TZFA 3GY1A 3N2BA 2FZ8A 1RCOB 5TQLA 3VK5A 4L9XA 2G3IA 4X3ZA 2WSYA 1QW7A 4YTUA 2JF7A 2QUTA 3GXPA 4H9UA 2QIIA 4QSFA 2VURA 5CLWA 1Q7MA 1TV7A 1VP5A 3G6LA 4R27A 3SCQA 1TVNA 1I2OA 4C1NA 3BOLA 3EYPA 4UZSA 1A3HA 3QMTA 3FV9A 1Q45A 4EIVA 1TWDA 2VGIA 3CL7A 1KTCA 2ALDA 2MUCA 2XHYA 1LT7A 1MQQA 1VJSA 1NDZA 4NJGA 2I9EA 4XQ6A 1J2BA 1ZFJA 4IT1A 4TTUA 2WPGA 2XYLA 1MXGA 2DZWA 1T41A 4LU0A 3HG5A 4JTEA 2VR5A 3DFHA 3MDUA 4DBDA 5JVLA 2ABAA 3N11A 1RK5A 1E72M 1R30A 1ZBWA 3AHZA 4GI4A 2H3DA 3AYVA 4FIRA 1E0UA 4Q8OA 1QXLA 4AD2A 3WUBA 3IANA 3TC3A 4K68A 4FLQA 5DCDA 1H0IA 4J3XA 3KLKA 3NSXA 3KLLA 4GH3A 4R53A 3W83A 1FWGC 1WZLA 4IJBA 2X40A 1Q7QA 1D2KA 4OTKA 1C8XA 1Q13A 4GACA 1CGTA 2WCAA 3DECA 3GXDA 2GVEA 3FIGA 3OLEA 2YA1A 1JPIA 1TPH1 1TUFA 1VLWA 2AAAA 1F9CA 1I6NA 4G6CA 5EMJA 4JY9A 2YDAA 5CZSA 4JQ3A 2Y89A 1V6YA 3WJXA 5M5DA 4LX4A 2E9LA 4C6CA 2CLIA 3QQ0A 4GK8A 5M03A 5K9CA 2PUZA 4AMCA 1Y5VA 1MMFA 1LLOA 4B9ZA 2YYTA 3SURA 1KM4A 1UR4A 1OFDA 2FB2A 4Q4KA 1M7JA 1FOBA 4C6NA 3F5JA 4P7OA 4Q8UA 1W1TA 2X09A 1Q66A 5LNUA 3HG2A 2CZ5A 1Q5MA 4GZIA 2R1MA 1U1HA 4I5RA 5FL1A 1IV8A 4M6PA 2VI0A 1MXDA 1OZQA 4R7OA 1I8JA 1E5JA 4UNLA 3GXFA 3KZPA 3LN3A 1IR2A 2UZ9A 3H4XA 1JYVA 3AS1A 3PSWA 3T07A 2DW6A 1QPQA 2VR2A 5EMMA 2WM0A 4ZOEA 1GG0A 2DJXA 4GQRA 2J7CA 2I16A 3QC0A 1RXOB 4CQBA 4H9VA 5D2XA 4E2DA 4XAPA 3OHIA 3DH7A 4OFCA 3B8DA 4TIMA 4DUXA 3BPWA 1JCLA 1FCQA 4F66A 2CBIA 5HUPA 3W2LA 5I79A 3VGDA 1GOWA 2R8WA 2IPFA 1QHZA 3ITTA 3W7EA 3CMGA 3DDMA 2J6XA 5AN7A 1JAKA 1BLIA 5A8MA 3GX9A 3QY8A 3NOYA 4L1XA 1IQ8A 2NSOA 1BD0A 3WUGA 3WF4A 4GIAA 3LA4A 4PMXA 1UD8A 4ZO7A 3OZOA 3UR5A 5T91A 3QW4B 3PN8A 3W7NA 3RLVA 4O0ZA 1P0KA 5HOSA 5C2CA 4XD6A 3OLIA 2V5LA 5EL1A 2O56A 1JPKA 3LI0A 3LZ3A 4CNUA 4QDWA 1JCTA 1D9EA 3W7IA 1EB3A 2D2OA 1NTHA 2ACQA 3MYOA 4KMQA 2ISDA 2WMJA 3C2FA 2Z4GA 4OJYA 1WKFA 2W6RA 2V5KA 4JIRA 3T2PA 2G3MA 4FMVA 5CZJA 1EJXC 3M1ZA 3CH9A 4V28A 1FWDC 4LY8A 4GZJA 1RV8A 3T1GA 1UWQA 1NJJA 1N8IA 1K9TA 5CGQA 5JMUA 2BP1A 1IZCA 2OQYA 3Q37A 4LJ3A 2D20A 2QEZA 3EX1A 1G94A 2VX5A 4MSSA 5DCEA 1N8WA 3NNTA 1V6WA 2HE8A 2E9MA 2PP0A 4RZ5A 4ZQRA 3AMGA 1D8WA 3UCCA 3AIQA 1KLYA 4DI9A 4D1IA 1HJQA 3S5OA 1FDZA 4G9PA 2VM8A 1G4EA 5KZEA 1IEVA 1MNZA 3WL0A 1WA3A 2B7OA 4E8GA 3AIUA 4NQ1A 3BCFA 3P62A 3VCCA 1OINA 4FOKA 3B8VA 3WFAA 2O9TA 3WK3A 1U30A 2NT0A 3HQPA 5E09A 1DHPA 2Y70A 3MUXA 3TKFA 3WQCA 1UJQA 4DVOA 2QPXA 3TX9A 3LI1A 2E6DA 1KNWA 2GDUA 2DT0A 1L6GA 1X39A 2H6RA 1PX3A 3QHOA 1RUSA 4TMCA 2E3ZA 2YCLA 1ZJHA 3VNIA 2VRKA 4TV5A 2AGKA 3HGSA 2XU2A 4A4AA 4S3FA 5JUVA 1V93A 2YSWA 3TU9A 4PN2A 2QW5A 4J5NA 2EPNA 4XSMA 2CW6A 2VZOA 1B9ZA 3AOFA 1V3KA 1RJRA 2ESCA 4KEVA 1W9UA 1I45A 4BQ4A 2J9XA 2J7HA 2XM2A 3IJQA 3UPMA 2PDBA 1HL8A 5EPDA 2CC0A 3CIWA 3WDRA 3E02A 3ZOAA 1QK0A 1FFRA 1LLZA 3N3TA 3G3MA 2IS7A 2ZX9A 2YCKX 3TMQA 4ES4A 5FEPA 4DO5A 4IIBA 4QEHA 1D3HA 3RITA 2ZZ6A 3BCJA 1EXPA 1TWSA 1I1WA 3HIJA 1R0MA 1VFSA 2XIBA 3MJMA 2P8CA 3N17A 3UD6A 2VC7A 1VFFA 3ITVA 3O2LA 1ONRA 1JULA 3MSYA 1DWGM 1JXKA 3A4JA 3ARRA 1BSLA 1L8PA 2NVAA 1NP2A 3RCYA 3HBLA 1SFSA 1KRCC 1LUCB 5CZTA 4IQLA 1Y7VA 3QBUA 1EJ7L 1V08A 3VOGA 2R91A 4JKMA 3A4XA 3GXIA 1WDRA 5AYBA 3NA8A 2VEMA 3FAXA 1GK8A 4B5NA 4LRSA 3G18A 4O54A 4BI5A 1SU5A 1WXZA 4GXWA 4Z2JA 4NZ3A 4B3ZA 2ZYFA 3ZYZA 3UY8A 3TJLA 1YNYA 3CEUA 4EK7A 3S5YA 3GFZA 4JFVA 1RQHA 4PBGA 2G97A 1YDOA 1OEPA 5FF7A 1B3WA 1J6OA 1XRTA 3GG0A 4NASA 4CD7A 3HQOA 1JZ4A 3IK4A 4HYVA 2C79A 4DWSD 3KS6A 3SZ8A 1UD3A 3U7VA 3TSBA 3G1AA 3SY5A 4GNJA 4E4UA 3LHVA 1O95A 4C6KA 2B0MA 3A5VA 3WMCA 2OODA 4KIEA 4PUKA 4LEFA 3TONA 1IT0A 1R7OA 3FA5A 2Y4SA 2BFGA 2OZ3A 4H3DA 3LCLA 5HA7A 2O9OA 1B90A 1DKWA 2VT0A 1HNYA 2G0WA 1KBLA 3IUDA 3WK2A 5KINA 4MNJA 3TQVA 2Y5EA 1KM1A 4AHOA 1S2WA 5LA1A 4CD5A 3AUJA 5KITA 3NM1A 4GUHA 3S2JA 4QJ4B 1B3VA 3Q45A 3CWNA 3WDJA 2F2KA 3VIIA 2Y5SA 2DQWA 4GQQA 2OZTA 3EEZA 3S1WA 3CAVA 4Z1BA 2F61A 2W27A 3UWVA 3R0DA 5A6JA 2DZAA 2TMDA 3HO8A 5CBBA 3GH4A 3QKEA 4ZQCA 4XIMA 4XAGA 5CQ1A 1FCVA 1VPXA 4Q3MA 4QLLA 3S1XA 1K7FA 2DUAA 1HKJA 1V6VA 4JY8A 3OLDA 4ICMA 4IMAA 1EPVA 1MEIA 1LROA 1XBZA 3EGJA 3QY6A 2XGBA 4R88A 3TQPA 4BK9A 1F3XA 4MJZA 2PWDA 5C9XA 1V03A 1FXPA 3UG5A 3QV8A 2YX0A 1E1CA 3V0UA 4B5XA 2PDNA 3K8MA 3N6QA 1J18A 3AQUA 3S2MA 2RAGA 4KRTA 4Q4MA 3KBMA 3OPSA 3FXGA 5AC6A 5GNZA 1TV3A 4U28A 4JX4A 1IT8A 3DGRA 4L6DA 1F8MA 1SR0A 4HNOA 1GNXA 1TA3A 3D6NA 1HF6A 3OEXA 1EKOA 4IMFA 1UUOA 5H8MA 3VKBA 3N2TA 4H8HA 3IEBA 1N2VA 3WNPA 1N55A 3VOJA 1I0BA 2P53A 3QV9A 1ZAIA 1WUEA 3P6LA 4DPQA 1LORA 4B2DA 3UWUA 3AIEA 3ABXA 4JTCA 4OE7A 4AD0A 2J13A 1E9ZB 1WDDA 3C3NA 1EYEA 4LH8A 3FGCA 4CN6A 4GYPA 4JIEA 1W3NA 3WQGA 1TZ9A 3CT2A 1KR0A 3EDKA 5KMYA 1EL3A 3H7VA 2CEQA 2OLHA 4ZXLA 2PC4A 1DTNA 1O1ZA 4JTTA 2VEFA 1G9HA 4C5ZA 2X0YA 1WDQA 1A5UA 3TW9A 4GVGA 5LXXA 3SCUA 3VDAA 3C2YA 4I9AA 1K77A 2C0HA 3B4YA 1OYCA 5A6BD 3C2RA 2PFHA 4DJDD 1ZUAX 2BHUA 1UG6A 3TW6A 1RK6A 4O1FA 4BZYA 3TOYA 1R3VA 1GG1A 4PCPA 2DT3A 3PUOA 4MDPA 1JFHA 2GSEA 1PIIA 4UWMA 3ZR5A 3SSJA 2HWGA 3PWAA 5A8OA 1VC4A 4D6HA 5AHFA 3QEZA 4G7EB 3J7HA 4NAFA 3TLLA 1N8FA 5I07A 1OFBA 4M82A 3JS3A 4ZFMA 3T2OA 4LBSA 4Y9PA 3CUJA 3VKCA 3HGOA 5I2UA 2NT1A 3LV5A 1NDVA 1X98A 3E2VA 2XJ7A 2GJXB 3O07A 1HN1A 1VFTA 3RRAA 4EKJA 2FZMA 3PP7A 1GVFA 2IXVA 1RD6A 3PUEA 3T40A 3BLDA 1IIHA 1V3IA 4PUWA 2A0NA 5F1VA 1J0KA 4Z0JA 2A3HA 3TCSA 3W00A 2QMKA 2AAMA 1DE5A 2DSKA 3B9OA 2V69A 4N42A 4QFUA 4H41A 4O0QA 1CBGA 1H1ZA 4US5D 3QFEA 1E9LA 5FA5A 4EPBC 3TSMA 4KW2A 4C6DA 3ARXA 4LUYA 3NQGA 4PMZA 4XZWA 1HGYA 1H63A 1UWRA 4HA0A 1S39A 5I24A 4HHHA 1EJVC 2C6QA 2VGFA 4H8VA 1TCDA 3GS6A 3PAOA 4C91A 1ME7A 4J40A 4LC8A 2GVJA 1HJSA 4PMJA 3LLDA 2OSYA 4GIEA 2YCEA 1G67A 1S2CA 4WSJA 2XH0A 2GLKA 3ZS4A 3ZSSA 4LUSA 1P1MA 5HANA 2V38A 5I5RA 1VPQA 5HWJA 3MI3A 1UHVA 4H04A 2I5GA 1ALDA 1GQNA 4LVFA 3CH0A 1M7XA 3W2KA 2F7FA 4AEEA 1Q63A 4HSNA 3GIYA 1PL9A 4NXSA 4LPCA 4FXFA 1X1ZA 3FSTA 3C0LA 1NVMA 2WVTA 1V0MA 2UY2A 3WQPA 3ARZA 4JYFA 1H1YA 1EC9A 1O94A 1QHOA 2NQLA 1R85A 2XIMA 3N9RA 5C9WA 1OFRA 1M9HA 2W5FA 4LB4A 3QPEA 3ZLHA 1JGMA 1LL7A 1EBGA 1NWTA 1PUDA 2NWSA 4JHMA 2WLZA 3ZVHA 4A21A 5FAJA 2GJLA 2EG6A 4UXDA 4P8WA 4B91A 4CNPA 1H7NA 1LDCA 3IUHA 4UTTC 2XDFA 1LT8A 3SN1A 3H70A 3ZIZA 3TIMA 2V5DA 4OOUA 3V35A 1J6PA 2ZXQA 2E8ZA 1JI1A 1UR0A 2FZBA 1W3TA 2YLAA 3U3HA 5E93A 3PJTA 1J5SA 2VUYA 4QM1A 3CPRA 3FJ4A 4F0HA 3NPXA 1GKPA 3CM4A 1IT7A 3GW3A 4ZOBA 5CXPA 1VBUA 4AZGA 3ITLA 1UUMA 2XPKA 3PZVA 3T78A 4D6CA 4D8ZA 1KTBA 2X1RA 4AISA 4HJWA 4LOCA 3URAA 2QCGA 4JOMA 2J8GA 3IAPA 4O28A 3SM0A 3MZ2A 4U2ZA 1R3SA 2WC3A 2OX1A 3HGRA 5GNYA 1F4HA 1EC7A 4K6AA 4JKKA 2XVKA 2WBKA 3GVVA 3CZEA 1V5XA 4FX8A 2PEVA 4HZ8A 4IL0A 1UZ4A 4WDWA 3TTSA 1KW1A 1VB9A 1T6MA 4UMBA 3WUFA 2R9RA 1PZ2A 1X7IA 1SZRA 2PA6A 4CCZA 2QQ6A 4AYGA 2RDWA 3WIJA 2E4TA 4OOZA 2JBMA 2QCEA 2Z6IA 1JDFA 4CNOA 2XWEA 4GY7A 1XCFA 3M0MA 3YPIA 3N2MA 1O5KA 3EMCA 4K8EA 2Q71A 1K7XA 2UV8G 3OBAA 3C2VA 5I23A 2QXWA 3GR4A 5E5CA 1W3KA 2WW5A 5FJTA 3PG9A 3WF3A 1ZAJA 2H8ZA 3PY2A 2OMAA 1W9DM 1XSIA 4H9XA 4QJ5B 5HMEA 1RPXA 3N3MA 3GBEA 3MYPA 1R9ZA 1YDYA 3UXLA 1A5BA 3NZRA 2EXOA 2DORA 1HKIA 3DENA 4ZVJA 4ZTXA 3BMXA 3T44A 2E68A 4JFUA 1HJWA 1OFOA 3P80A 2PLKA 5EB8A 3EZ4A 4P8XA 3CAQA 2REQB 1LWIA 5C2XA 4IFOA 3SADA 3VKKA 1UIPA 3TQKA 3E0FA 4K1WA 3B97A 1FWNA 3H7RA 3GUGA 1Q6DA 4IPLA 4YWSA 2DZPA 3WEMA 4DEFA 5DY3A 4AX6A 1DWHM 2Z7KA 3W01A 4IIFA 2QHAA 4FNQA 1XLAA 4QG8A 4ICCX 1W1ZA 1XIMA 4UTTA 3IJIA 4GH1A 3CZGA 3PBMA 4W85A 4LS0A 4XD5A 3A3XA 4AIBA 1RPKA 3EA3A 3KOFA 3UQNA 1H5VA 1UJPA 1Z32X 2ZADA 1XV8A 5KZDA 2A7RA 2ZA3A 3UG4A 4Q6JA 4ZB2A 4Q8WA 3NURA 1EEPA 1FHLA 3HPZA 1NQKA 4GYJA 3ARTA 1D7FA 5CBIA 1FY6A 2BNJA 1W1IE 1ITUA 1JD7A 1M68A 2Y62A 1V77A 4PL2A 1E4MM 5HXMA 3STEA 4D8AA 3RO6A 1E56A 3QSTA 3NUKA 3MANA 3O15A 4IX0A 4ZXOA 5C7HA 5I0DA 2XVPA 4EACA 3EA1A 2OVLA 4UC5A 3HG4A 3W37A 1FHVA 1MEWA 3LY0A 3W29A 2IXUA 4MF4A 1IGWA 4FIQA 4PE8A 1AW2A 1AQHA 1IGSA 3KVMA 2J7EA 1X97A 1RCXB 4ZQPA 4W5UA 3NL3A 2XVGA 1IEWA 1IE7C 4EXQA 1HGWA 5GVJA 3MW7A 5D8WA 4FLSA 4KWWA 3LERA 1G4TA 1CEOA 2ADAA 2GVGA 1JXJA 2D1ZA 3CGTA 3S1GA 1ZJIA 4DIAA 4RL3A 2D2HA 2VDIA 1XINA 2FYMA 1J96A 1UKQA 1DE6A 4CNTA 2PTYA 5LGZA 2HK0A 1PIFA 5AC5A 4ZO6A 3H55A 4LUIA 4IG2B 2QV4A 4C7DA 2NV2A 2OGYA 2ZVRA 4LWWA 2D0FA 4NVTA 4WY0B 3WSUA 1POJA 3AS2A 2A3BA 4IP4A 4X2PA 5JIPA 1WNOA 2R1LA 3BO9A 4GUIA 5CCZA 3FOKA 4NYYA 1P1XA 3FFSA 4MJ4A 2WKGA 2CWXA 3M5VA 3QQ1A 1V6XA 4O4VA 2CLFA 3QGKC 7TAAA 1XCXA 5BROA 4Z2KA 1OK4A 3LHTA 3QPYA 1U33A 3TYEA 2XSBA 4WR3A 2VEIA 4JCMA 3UETA 4BCEA 4QTGA 1F73A 2IMRA 1FKWA 3CHEA 1JUEA 5D02A 3H26A 3QGVA 2ACSA 3FCPA 5DBTA 4LYPA 3LGDA 4MFDA 4P8UA 1CXIA 3B0XA 4OBRA 5FIPA 2FGBA 1Z44A 3SUWA 1CPUA 4HB7A 1NWRA 3TXVA 3T6CA 3GNNA 2VGGA 1VF8A 1MSSA 3PK7A 1O66A 3WQ4A 4DJEC 5AKQA 1BYAA 3CZLA 3E1F1 1B3OA 3NGJA 4EXAA 1E6NA 2GGIA 3P5ZA 4CQAA 1V02E 4ACZB 4MUZA 4PMOA 3WH9A 6REQB 4R5EA 3VD3A 5FOOA 3GHTA 3MDWA 5A6AA 1E40A 4S3JA 3CV2A 1GQLA 2YW4A 2WMFA 1Q6CA 2DEPA 5ABHA 5EBUA 3WLJA 3DOPA 4J3UA 4NP7A 4ZR8A 3NQEA 1YNPA 3U2CA 3SIMA 5D09A 1EIXA 1G7VA 4HNLA 5LHEA 4GVFA 2UY3A 3AHVA 4KPLA 2CZDA 3S5ZA 2BXYA 1Q6QA 4AY7A 5D38A 4AB4A 3GBDA 1LOLA 1W0MA 1XYLA 4JQ1A 4PYSA 2WMKA 3HJZA 3R1ZA 2VR4A 3MHGA 1XYBA 4ML4A 1GJUA 3BZGA 3NQCA 3N4AA 4X9YA 2DIEA 1RP9A 1WP6A 1QNOA 5JU6A 4MADA 3PNUA 5HPOA 1NF7A 1MRQA 2BBFA 3CUHA 1K6AA 2GUYA 4LB3A 1VFHA 3TN4A 2PURA 5F2MA 4PODA 1ZBKA 2WV8A 4FEZA 3VD7A 1NFPA 3TMLA 3I7QA 1NF0A 1WKYA 1QU4A 1E0VA 1LUCA 4ZB5A 5BOEA 1NY1A 5HNUA 1WDPA 2IW0A 2PDPA 3AIWA 4XUGA 1HKKA 4N6EA 3NL2A 4JPGA 4XVDA 1B54A 4JTUA 2NQJA 1FA2A 1NOFA 1JPHA 2X30A 3R0UA 4FO4A 3PM6A 2Q3OA 3A24A 4GO9A 4MY1A 2DJLA 1SW7A 4NJJA 3VC5A 2VFGA 1R5YA 3A3HA 3RNDA 1NH6A 3W9ZA 1V7AA 5C55A 3VVGA 4JFWA 1V02A 5CSSA 5CPNA 2ZX5A 4EPKA 4O0KA 4OV9A 3SY1A 2FZ9A 3PZMA 1JPMA 3ATYA 4Y9OA 5M3WA 4XBKA 3NQBA 4H8UA 4R85A 5K9XA 1VKFA 4EVZA 4F9DA 4ZGYA 1ME8A 3WY1A 4CQ9A 5HINA 3C2OA 2DZTA 5AZ1A 1F8IA 5EGRA 3T8LA 3A23A 2CLLA 2ZXDA 3VOFA 3T7VA 4PB3A 1C29A 1L8NA 3V7PA 1GT8A 3LTSA 3W24A 4DJEA 2V68A 2PDQA 2YL5A 2WCSA 3V0TA 3AYSA 2JGQA 5GQBA 3E0LA 1X96A 2BS9A 1MZHA 4UOJA 2ZRXA 1CECA 1F6PA 4QE4A 3CV1A 3PBWA 3LNPA 4I9JA 2YLLA 1DWIM 1BAGA 1MWOA 4E2VA 2X8RA 3PR2A 3TAOA 4ADUA 5A6KA 2P76A 2TRSA 3TJXA 4MIMA 4UTLA 1BWKA 5DN1A 4P8VA 2QS8A 4ZENA 4J28A 1JZ8A 3DUGA 4FNUA 4JIQA 4BJHA 3KHJA 5DT5A 2BOEX 4Z0SA 1UKSA 2VJXA 1HP4A 3L5LA 2CHRA 1XG4A 1KM0A 2ZICA 3KVLA 1E6PA 2E6AA 3RYSA 3VPLA 4M7TA 1BSIA 1UH4A 2Y0FA 2A21A 1DJYA 2V6AA 3HU7A 3G1XA 3DI0A 1QRQA 3LGEA 4LVAA 4WD0A 2X7VA 1HX0A 2O4QA 3UR2A 4LAOA 3B05A 3ARVA 3N04A 7REQB 1W54A 2ZTJA 3CMJA 1Q6GA 5CSRA 4XZLX 4MKSA 2W61A 4P61A 4D8LA 6CGTA 3AYRA 3NO3A 3PPHA 4H8NA 2KZHA 1MW1A 3VNJA 3BLIA 4KGJA 4AX7A 4Q8NA 1JD9A 3VIFA 2P10A 3T55A 3CUGA 3KVJA 2PF8A 2PWHA 2FMOA 3STFA 1YIXA 4PTVA 4PEKA 2YDSA 2YYUA 1QPKA 3KBWA 4P7LA 1OC7A 4C60A 3ZM8A 1NELA 1JQXA 4DF1A 2V3EA 4EE9A 4DM1A 3WD3A 4HHPA 3RK8A 3NTYA 3SRKA 5CBJA 2PSNA 4E6MA 4YTRA 1BEUA 2YFNA 2WKLA 2W4XA 3OYXA 4C6FA 4ATDA 4WF7A 4Q8QA 1BPLB 2ASHA 3IUIA 1OFQA 5HMFA 4W8AA 1SPQA 4TTGA 1GGOA 4WJ8A 4ERAA 3W6MA 1Z42A 1KCZA 4U2YA 3W7OA 3M16A 2WNNA 2QULA 4UTIA 3TVAA 1I0DA 5C9ZA 2C1GA 3T9PA 2QDGA 4XV0A 4A22A 3KDNA 3HTWA 5DO8A 1KFKA 4ZFCA 1R8LA 1ZGDA 3L12A 4IHCA 5HK4A 3KCJA 1NEYA 1B4EA 3RCNA 1EDTA 3DKJA 4W7WA 3W25A 3ITCA 1LYXA 3OLGA 3UF9A 3W3OA 4WX2A 2FIQA 2WYSA 2A79A 3JW7A 2NVDA 2VZUA 1XYZA 1FVPA 1EJWC 3LGGA 3IJ6A 4GXMA 4NNBA 3CPUA 2JQXA 2EHHA 1ZALA 3F4CA 1KQYA 2QMJA 1OG0A 3RGTA 1VH7A 4G7EA 4FF5A 3T4CA 4Q6XA 1BKHA 4HCLA 3QYSA 5H8UA 4MNLA 2PDLA 4XX6A 3G2GA 2CIPA 3KRBA 1W9BM 2PBOA 2QJHA 1U22A 3ARPA 3UU0A 2X2YA 5J5DA 2YJQA 3BLKA 4GRSA 2GZXA 2ZE3A 1K3UA 3GK0A 3TDFA 3C0JA 1S5MA 3U2ZA 3UWYA 4KCUA 4AC7C 3IS4A 3B8UA 4JNZA 3UWQA 4LUTA 1ZRQA 3NZQA 1J11A 4NI3A 3UGRA 5AFDA 3PZTA 2YR1A 5D2VA 1ZPTA 1XGEA 2HPMA 3WMSA 4ERGA 3WELA 2F2HA 2C13A 4EX4A 2JK2A 1B1YA 3ARQA 4S2BA 3EWYA 1HG3A 1VR6A 1XFCA 1XIBA 4HA1A 2OU4A 4YXGA 3V36A 1QOXA 4PSRA 4L4MA 1QI2A 5EYWA 1J0JA 4GBUA 3VFLA 3AWOA 4FS9A 5FJJA 4OUEA 1US2A 4UQDA 1GWJA 1RAKA 4AZHA 2DZUA 4LC6A 4GKTA 1XLIA 1W2VA 3KOYA 1UR3M 3H4GA 3L68A 1S46A 1OVDA 4NUWA 3VU2A 2J27A 5ENLA 4ML9A 3LTPA 3M44A 4LV9A 1W1VA 4WKHA 1IZKA 3CMFA 1OWQA 2GPTA 3V5FA 3W6LA 4NY2A 1BVZA 5BW6A 4IUOA 2HXTA 4LVDA 4HOXA 1CXKA 3CQIA 2DU2A 2V5CA 2PF0A 4AMAA 2WCGA 1Q4NX 1XBYA 3OZYA 3CHFA 1I1XA 4IH3A 1H62A 4RPQA 1EA0A 3L4ZA 3TC6A 5K3VA 2E6YA 2VWTA 3BCDA 2EPLX 1XSKA 3WBXA 2ZQ0A 4S38A 3CYVA 2FH6A 3T0BA 3URNA 3E96A 3GG7A 4RR4A 1F76A 3I68A 2OG9A 1TPUA 4GMEA 2V30A 1UKOA 4QITA 3CHVA 3LRKA 4QS6A 3PC0A 3A12A 1FWSA 4M1BA 2A3LA 2H3BA 3MUY1 2PRLA 4Q4SA 4YMZA 3PZQA 3ANUA 2W66A 1MO0A 4WK9A 1PDZA 5D03A 4AUBA 2VFHA 3IIZA 3MO4A 3EMQA 2FPYA 4XZMX 5AB3A 2YDRA 1MRAA 4GA8A 4XAYA 1ML1A 3IVTA 1EIBA 3UYCA 2VCCA 2BY2A 3PF3A 4M5PA 4U4MA 4HHMA 3VIPA 1L6FA 4W9TA 3FLUA 4KWUA 1EOMA 4J1OA 4MNKA 4PH6A 1OF8A 4EWJA 2OYLA 3BSGA 4H7CA 3WQDA 3OGRA 4RK8A 2W62A 1PAMA 4RE2A 3MI2A 2RJHA 3OP2A 5G4WA 3W28A 3MU7A 3W1MA 4MZYA 3PPCA 4YLWA 4IJCA 5CJNA 2ACRA 2NQZA 2CZVA 4JTIA 3K46A 4I7VA 4XVEA 4AZIA 2CHNA 4BFAA 3HQ1A 2ZX6A 2XN2A 3O6DA 2GUBA 3I10A 4GY0A 1ZNNA 4PMQA 1Z8AA 2VO5A 3G8RA 2Y5JA 2WJZA 4Q4PA 4OHQA 4ZEPA 3KCLA 1W31A 1OBAA 1DVJA 4UR7A 1DJZA 1PB0A 3B8TA 4WY0F 3SECA 2WQPA 3MB9A 1FUYA 4N02A 1FH8A 1YTDA 4WJEA 3P5YA 3MP3A 2GJPA 1QI0A 2EGZA 2TSYA 4I7WA 3WMLA 1VQTA 2R6OA 4YJ5A 5C71A 1XLGA 4L1GA 1TELA 3R13A 4R9XA 4BI7A 3M46A 4CGTA 5TAOA 1IZJA 1GTEA 1UWAA 3E0IA 1XLFA 1S5TA 4UFIA 3KWXA 3WD1A 3AALA 4Q7BA 1HIZA 4M6VA 4C1KA 4YVPA 4GQBA 5DRCA 5FI8A 1EP3A 2P0OA 2FVMA 3VGGA 4OU1A 4YHEA 3M0JA 2X1UA 3ORWA 3EX3A 3G0SA 3DZ1A 4QE1A 1H11A 1EQCA 1AZ1A 3V18A 2V0TA 4L9YA 2HVOA 4OBSA 3KOWA 2J9YA 1PE1A 4Q7IA 1CLXA 3CLWA 2P5NA 1SO6A 4JEQA 2BB0A 2CCRA 2PDMA 2NVCA 1PS9A 3ABRA 4OWGA 3T2QA 3RAOA 3L4TA 3W76A 1XH1A 1ZZMA 3U4FA 3W4RA 3EKZA 1SZFA 5CPQA 2VRQA 1T8XA 2HEJA 5TBOA 3AC0A 4AWEA 4AD5A 1RJPA 1H09A 1JUBA 2QV5A 5ABTA 3D3FA 3OVQA 2J24A 2NQ9A 1TQJA 7ODCA 5BXSA 1E6ZA 5FESA 1U83A 3VKDA 1UIOA 5DX7A 1QPOA 5CGTA 3LCFA 2BGSA 4RZ4A 3P7YA 3SCTA 3W7HA 4BWLC 1QWGA 2G4FA 4UFHA 2R1KA 4FB7A 5I3JA 2B4GA 1UD4A 3CC1A 2GWGA 4H7VA 4I3GA 3VIJA 5T9CE 5EKYA 2FGLA 1GZJA 1LQAA 1XW8A 4X9SA 3FDGA 3UXKA 1WQ5A 4AZ6A 1IXNA 4KS0A 1J79A 4KT2A 5ABFB 1M03A 2PTZA 1PJ9A 3A64A 3REQB 3QMRA 1YMYA 1OGBA 1J8VA 3KS5A 3CZ8A 1OFPA 1E0WA 4WXZA 2BXZA 1M41A 3BMVA 3LENA 5K4XA 1E0TA 1TWZA 3MT1A 1OT2A 3CS2A 5FSEC 2WMIB 2PRHA 4IG2A 2FJKA 3IVSA 1WOBA 4PRWA 4XBSA 1E55A 5IHRA 3BSMA 1R87A 4Q4QA 1YBQA 1D3CA 4WY0A 4M81A 1UH3A 2V3FA 2CLOA 4XAZA 3BURA 3QR1A 3WLOA 2AQOA 3PWGA 5HWNA 1TTQA 3LHZA 3CEPA 3TWBA 1DPMA 3D5HA 2BG5A 5EFDA 4UTFA 4LANA 1H1NA 2PWEA 4CQCA 2GJNA 3RLHA 2GYIA 4B3KA 1KKRA 1U5HA 4HU8A 1QOPA 2DT2A 4WGHA 2YDQA 2RGLA 4UUIA 4QAIA 4UFLA 5CEWA 1OCJA 3DU0A 2ZUUA 1U2YA 1LBFA 4MY9A 1WYIA 3CU2A 2FMNA 3KTSA 3LQGA 1BFNA 4XTDA 2QJNA 3HZ3A 5LIKX 4B5UA 2HV5A 4DZIA 4C65A 2ZC1A 4JCLA 3LNMA 4LAZA 5I03A 3BVJA 3W2NA 3NYDA 4ONVA 3F4DA 4DM2A 2CERA 1LRQA 4X60A 3ZZ1A 3VDGA 3N4EA 1VENA 1TX2A 1E3XA 1TREA 4PUNA 1YPXA 1BGGA 3HB9A 4PRRA 2EPMX 4TU1A 3GTNA 3BDKA 4HZMA 4Y8EA 3KDOA 6TIMA 1UMLA 4ACZA 1W5NA 3WH6A 3L7RA 3LPGA 4A3YA 6REQA 2GFTA 2E40A 3MUCA 5EFFA 3TYBA 3U4AA 4AXKA 1Z3NA 3DGBA 3LDVA 2MANA 3ZLGA 2VFFA 3M4HA 3G3DA 5LZLA 4CD8A 2HISA 2FTPA 1S3TC 1EZWA 3EOEA 1LTDA 2PTWA 1OX4B 4REQB 3M0KA 5G2WA 3VA8A 4DF2A 1OT1A 3G1FA 3W6YA 1GORA 2VD8A 2DZBA 3NQFA 5BCAA 4IMGA 3RHGA 4EP8C 1FCBA 1J2WA 1EF2A 3CB3A 2XZ7A 3OODA 2C3ZA 1OGGA 2PAJA 3P84A 4IJRA 1UWTA 4MZ1A 4L4PA 4A8NA 2IKGA 4DUWA 3HF3A 4LBRA 1AK5A 1KBJA 3NL6A 1EHNA 3B9AA 1W17A 4YIWA 1FWEC 2XFWA 4O8AA 3N18A 3EMZA 3VUSA 1G69A 2AKZA 4TVCA 2CKSA 2BVWA 3RFAA 5IRPA 1U5JA 3USBA 1AW5A 3TTYA 1VCFA 3GTXA 1I60A 2VCBA 3K1DA 3QMSA 5I78A 1G0CA 4I7UA 3DFPA 4GJIA 1Y5XA 3MA8A 3VNZA 2V81A 4G5DA 3MKKA 1RA5A 4RDYA 3BLEA 4X2RA 1PCWA 3P14A 2AQVA 1KV8A 2W63A 1QW9A 2I5QA 4PMYA 4ZE4A 4UTWA 1R3YA 3EWZA 1CIUA 3H2FA 3DFTA 1H2JA 5LIUX 1DQWA 3FJNA 1QNVA 4GGBA 4FZIA 2E25A 4A35A 3VE9A 3WBAA 4K3ZA 3NCOA 3WBEA 3EWBX 3FEMA 3AMDA 3V5OA 3MCMA 4JEJA 2BY3A 3M64A 1DJHA 3GU9A 3IV3A 1KBBA 4IQJA 2ZC8A 3O9NA 3K8LA 4H6KA 3ZT5A 3OVGA 2IQ0A 2AL2B 4JN6A 3M0IA 2A5HA 3GM8A 1JR1A 4LRTA 4FP1A 3IJ7A 5HUOA 3FHQA 2GK1B 1K02A 3OVPA 3MPGA 2IQDA 2VGBA 1V0LA 3K8KA 3TW7A 1OX6A 2MNRA 3S2LA 1ADDA 4AVFA 4D6GA 1BG9A 1GPWA 1XX1A 1BVNP 3LXBA 5HWMA 1JZ6A 3ME3A 5JXQA 1KGWA 1K8ZA 3W71A 1QVBA 4GKLA 1FP9A 4W7UA 3GR8A 1WB0A 5E0KA 4MPQA 4RV8A 4C6BA 1S2AA 1W5PA 5D32A 3URBA 2BVDA 3I6TA 1XIHA 3DXIA 4HCHA 4TX6A 1ZJBA 4CVWA 3UJSA 1R2TA 1BTCA 3DHPA 1DIDA 4V1XA 1FWAC 3ZLFA 1FWRA 3HM7A 3D3AA 1SYTA 3UCQA 1C7SA 3O63A 1VGAA 1A4MA 2GDQA 4O52A 3SCSA 4U3AA 3IWPA 1AQMA 2WLYA 4HNUA 3QV7A 3EWWA 4FHAA 5FL0A 3GRIA 3D46A 4PUUA 2Y7FA 3Q65A 3GZAA 1VBGA 4W8BA 2OPJA 1C9DA 1E9IA 2D23A 3S83A 3OIHA 5A8NA 1F3WA 3ITGA 4YPJA 3G1DA 1UD2A 4GOAA 4JIPA 7REQA 2DSUA 4MLRA 4CCCA 1W3HA 2CLKA 5A6TC 3I3EA 1SGJA 2RH9A 2WWCA 3FAWA 3IIOA 4DNHA 1XR2A 2Y2WA 3B8SA 4ZOCA 1ZTVA 5BYWA 4A05A 5K2ZA 1JJKA 3OO2A 3HOJA 4ZB0A 2Y7EA 4AG0A 1I4NA 3ZFHA 1P7TB 1AD1A 3QLDA 2Y8UA 1FP8A 4JTQA 5E0FA 3WDIA 5JH1A 2P3EA 2PTDA 1K8YA 1S2TA 7ENLA 2ZIDA 1GYNA 3WO8A 4RV3A 4B4HA 3M0LA 4G56A 5F4WA 1P43A 2PLMA 4KCTA 2WZEA 4KH2A 3M6DA 4LAUA 3TTEA 5LNRA 4NZ4A 1XH2A 3TNBA 1X6UA 3KVKA 4Z2LA 1QJWA 4MPKA 1G01A 3WN6A 1VBJA 3GR7A 1ZBVA 1LQ2A 4W86A 2Z1WA 4C5YA 5C54A 2C16A 3G6MA 1EXBA 5I3IA 3W75A 1FWWA 4UTJA 1JZ3A 5AC7A 3FVDA 4D71A 3KRSA 3L4YA 1PHWA 4Q8MA 3E49A 1XM3A 4M7SA 3EEGA 4GG9A 3R5EA 3L65A 1Q4WA 4IFKB 2QJGA 2ZWYA 1EPXA 3V3WA 1B30A 1JL8A 3L0NA 3DHDA 3SFKA 3U2EA 5FKYA 1L6WA 1ISYA 5AHNA 1GOOA 2JKEA 3I3BA 3WK1A 5F1UA 4JXCA 3FYPA 2VZSA 5REQB 1HTIA 3RJXA 1VIZA 3PFMA 4UTMA 1IXPA 1GVQA 4KEUA 3WF2A 3A6OA 3CO4A 1KXHA 3VD4A 3OOQA 4DO6A 3TXZA 3OG3A 1F3TA 5E0CA 3Q58A 5HAOA 1CXFA 3E5BA 3GC5A 4V33A 1GUVA 4U3CA 5FF0A 6ENLA 1TV2A 3T05A 3AS3A 1NP0A 2GUUA 4ROPA 3SCNA 5XIMA 1THFD 5H8PA 3MV11 4U10A 4U31A 1OCBA 3W81A 1YLVA 4DWSC 1WX0A 3ABZA 3SBFA 1CLVA 3P74A 5JH2A 2YPIA 1A0DA 4RNFA 5HNNA 2JEQA 5FEXA 4ZSTA 2ZKMX 3GDMA 1B3ZA 5LNSA 3AU6A 2G8ZA 4UIOA 1MDLA 4C1LA 3GZ3A 3N12A 3U5UA 4H83A 1YADA 2VELA 2R14A 2CBUA 3KP1A 3MCOA 3NEHA 3ISIX 2PDUA 1AW1A 1UR9A 4L6OA 3UA4A 4QG9A 5C5YA 4HMEA 3KRUA 1XS2A 1AG1O 3EB2A 3WD2A 4WCJA 2QYGA 2WMGA 3U48A 2VFIA 2FTYA 3GAKA 1Y8BA 4F0LA 3FX4A 4R7JA 5EA9A 3T42A 3HJEA 3TFXA 4D2JA 1TR9A 1US0A 2W79A 1YTKA 3EPMA 5C9RA 5AYXA 3VINA 2HCVA 3NG3A 3LCHA 1KGXA 3UZYA 5CC7A 3CUZA 1C8VA 1B31A 3AU2A 3OQ8A 1CT5A 2ATMA 5DFAA 1S2UA 1PX4A 1HQTA 4O4WA 1DTUA 1UB3A 2FZDA 5BNKA 2PDFA 4RW3A 4AC1X 4PULA 1OADA 3G1HA 5E9AA 3W1AA 4PFMA 1L2QA 3NQ7A 1AD4A 4QP0A 3WKZA 2WB5A 3UGVA 1WUFA 1UBSA 2YXXA 2HNHA 2R24A 3NDZA 2QJMA 4JYDA 1QHPA 4O1DA 3NSMA 1ODZA 4HNTA 1EH9A 3TN6A 3V4BA 2EQDA 4YCOA 1W5OA 3E2RA 2YCJA 1FTXA 4JNYA 3UCDA 1BVWA 5CJ5A 4NAEA 3WLTA 5LA2A 1JCMP 2P8BA 3GHRA 1DEDA 4K8HA 3WQ6A 3QM3A 5FJUA 1R9XA 3ZR4A 4MM1A 3EX6A 2BODX 3R8RA 3P8JA 3L66A 4ILSA 1XQLA 4FLOA 4W84A 5FJRA 1XYMA 1ZB5A 4MGGA 1LCOA 1GZ1A 3NZPA 1E43A 2HS8A 1J0HA 3CTTA 5LKYA 4ZQNA 3IIXA 4WOQA 4W8LA 3JU2A 2ZOXA 4BY3A 4JTAA 3SCRA 4L6HA 4WSKA 4CEXC 3T81A 5IBXC 4KWVA 4D1JA 4GUJA 2XSXA 2XWDA 4PGLA 1JGIA 3W23A 1UASA 4DYKA 3PNZA 3L4WA 1LOSA 2YOCA 4C6JA 1OZMA 1TV8A 1M7PA 1QAPA 2P3ZA 1EDGA 1WZMA 3WENA 4RXGA 1FX6A 4C6LA 3PPGA 1AA1B 4Z1CA 4RX0A 4LALA 1TJRA 3P82A 1DXFA 4EF9A 1K4HA 3VCRA 4DN1A 2Q8LA 1NFGA 2ON3A 4DJED 2VEGA 2IQTA 4Z17A 1PYMA 3UEQA 3RU8X 2C0AA 2HRWA 1XLMA 2AMXA 4DJDC 2UY4A 2XFYA 3NO1A 1D8CA 1H41A 2BGNE 2AKMA 1EDQA 2PU1A 3EXSA 2BLEA 1EF3A 5G2HA 1LOQA 1IR1A 3B0UX 1A5OC 1YQ2A 2ISVA 4Q8PA 3CBWA 5D33A 5D8ZA 4L4LA 1TO3A 1FXQA 1SM9A 3N2CA 2HS6A 1R38A 4UBPC 3AIVA 4QG6A 2J7DA 2WANA 1MXSA 4DI8A 3WL1A 3OVRA 4AU0A 4FX7A 4Q22A 4XBJA 2D69A 3W1QA 2IKIA 1JCJA 4HNNA 3S47A 3VMNA 2OELA 1EGZA 2XTKA 4MUPA 1H7OA 5AYYA 1MVYA 2NLIA 2FZNA 5L9FA 3N73A 5LSMA 2VD9A 2HVMA 4JTKA 3V75A 2PTXA 2V3GA 4HMDA 1I2RA 1TMQA 1M04A 1T5AA 1UH2A 4WKFA 1LWJA 1RJQA 4Z2GA 4FPSA 1B0IA 4N7QA 4JDYA 4AZCB 1TPC1 3WCZA 2W92A 5HR6A 4DF0A 3UBPC 4CQDA 2NSXA 4NJHA 2QF8A 3UXAA 1SW0A 3SCWA 1XF0A 3EPNA 4PTDA 1LRNA 4P2VA 4BKNA 1V79A 1XIDA 1PCKA 3BJTA 1NWUA 3CL8A 3LHUA 1OCNA 3BAIA 3VGEA 3R0KA 1KRBC 5IBXA 3PBYA 2OLSA 3CV7A 5AYZA 1XLJA 3KTXA 3UP8A 3K2GA 1TPDA 2WNZA 4AVNA 2NWRA 5EU9A 1YRRA 2B31A 6XIMA 2OX4A 2ZUVA 5I3GA 2PDXA 1LG2A 2J88A 1RR2A 2I17A 2UWFA 4Y2WA 2BX7A 5ABFA 1HJXA 3O16A 4HK5A 1OJXA 2D2GA 4S1FA 2JIEA 1XBVA 3G1YA 3REQA 1NWSA 1V3MA 1LF1A 1RQBA 2JFEX 3W1PA 3UJRA 3VX1A 1EGMA 3SCVA 3HN3A 4DJFC 3O6YX 3BAJA 2Q01A 2I5IA 1V0NA 3S9YA 4MG4A 2C1IA 3P67A 3BWWA 1DJXA 1FWBC 5I3KA 3LBCA 3WQEA 2BASA 3UR8A 5A8QA 4DLFA 2V63A 3POHA 3QTPA 5F4SA 3MP4A 3PWIA 1UWIA 4U5KA 1KM2A 3MS8A 1F61A 2X1TA 1ESWA 1NAL1 1F2JA 2J78A 4ORMA 5BWAA 3N2OA 4LNCA 4QCEA 1SFLA 1Z89A 1XICA 1UROA 4AD4A 3A9IA 4Z08A 1T0OA 1D7KA 3RUBL 3TC7A 1CLKA 2CKRA 1C91A 3ECQA 4KBXA 4ZL1A 1R7AA 1MQPA 3VDCA 1KA9F 3G0XA 5GNXA 3NL5A 1TTPA 1PTAA 3C0SA 3BOXA 4JGDA 1TE1A 4H4IA 2OYMA 3GTIA 8XIAA 1YPIA 2QUUA 2Z2UA 4QEEA 3CK5A 4AF0B 4OBTA 2DY3A 2Q02A 4LUJA 5AC4A 3G24A 1W8GA 3V16A 3CWHA 3W7CA 3QZ6A 1REQB 1A5AA 2VX6A 1OD8A 4S3BA 3QTGA 4PFHA 4CU6A 1RY8A 1J9YA 1N7KA 1SJDA 1EOKA 1BF6A 3D47A 3HFTA 2NW0A 4TX8A 4F48A 3VNYA 2PS2A 3R12A 1Y5WA 2ZVIA 1TR1A 3W7DA 1TZ7A 3U8GA 1UQYA 1J4EA 4A3UA 1KFWA 4N9EA 4GYFA 1DJGA 3MVTA 1M1BA 2QR6A 5HQMA 3I6EA 4RJEA 1WZAA 3GXMA 1OX4A 4REQA 2HSAA 1QDSA 2YCLB 3WQFA 2OTDA 5G1YA 4ZE5A 3ANYA 4OGZA 4W93A 5CC3A 1X1NA 1A4LA 2HMCA 1Z7AA 1CWYA 5CSYA 4NZFA 2GQAA 4GIRA 4PUEA 2IUZA 3KE0A 2CNCA 4F4RA 1FWFC 3C8FA 4RPPA 5HNRA 2GGHA 3K4AA 3ENLA 2WKJA 2FHFA 2PDJA 4HTBA 1XISA 3SB0A 5T9BG 1S38A 4O13A 3GUWA 4EAYA 4F40A 1H51A 4WVXA 2PGEA 4NNAA 3AXXA 4XKMA 1MI3A 1HVXA 4QDMA 2X0SA 3R79A 2ZRYA 3VNLA 3LZ5A 2PRMA 3GW0A 4QAWA 3DC8A 4B5SA 1SZGA 5IDZA 2Z2AA 1UYQA 2Y61A 3MV01 4DJFA 1TZZA 2ZUMA 5HULA 1KCKA 1M53A 1MNSA 2J25A 4B5TA 2C19A 4UFMA 3WQVA 2JE8A 2J9ZA 4DO7A 3WH8A 4HJFA 4B4FA 4BR1A 3CQKA 1KC7A 1UP2A 2DVUA 4XK2A 5DXXA 1XPGA 1LP6A 3PS7A 3P3BA 2VDGA 3RLGA 3PTQA 3SRDA 4IX2A 1ITXA 1JAEA 3LG3A 1MUMA 4BF7A 2WMHA 3T0DA 3ZO9A 1OQFA 3SUUA 3SUSA 3II1A 3W7MA 5FEWA 1UUQA 1V3HA 4K8GA 5LA0A 2DZSA 3L9CA 4IPJA 1W9VA 3GQYA 2WSQA 2DP3A 5BU9A 3WQOA 1OC5A 2P0IA 3DCPA 3E12A 1PZ0A 3K4DA 3IIPA 2OR2A 2V5JA 2VP8A 2AL2A 5LYRA 4KF1A 4H01A 2QAPA 4WEVX 4IOTA 1XI3A 1TMHA 4EANA 3H2EA 1W9XA 3PAJA 2DPEA 3W70A 3CIXA 5ABGA 1HKWA 2GK1A 3ITXA 1SFTA 3RPMA 2XVLA 1CGVA 1ITQA 4UOQA 1JPDX 4E38A 2Z0IA 1NOWA 3MTWA 4L5ZA 3ZT7A 3VDHA 1AL7A 1RBAA 1XSJA 5T8GA 4WQ6A 1RY0A 2QUVA 4O12A 3IAQA 1R3TA 3BTNA 3W87A 3B03A 5IXEA 3TTOA 1O5XA 4JR5A 3ZQ9A 3GHSA 4IMEA 4LBUA 1XUZA 3VTRA 3MBDA 3KL3A 5TIMA 4I8YA 4H7ZA 2O9RA 1WPCA 4ATLA 1E51A 2WM1A 2J8FA 4AHPA 2ZUTA 3PTKA 2DSVA 3P0XA 5LHFA 2VHLA 2E5BA 3S2CA 4LY4A 2WWDA 2J62A 2E5CA 4MAVA 1E6RA 4NL1A 3GE7A 1RBLA 2QDEA 4CCEA 2HZGA 4D72A 1H7WA 3NM3A 1WDWA 1C7TA 2OEMA 4GWEA 2OQLA 4LCRA 3LSCA 2OLAA 4DO4A 4ERIA 3F4WA 3GSMA 3H6OA 1OY0A 2G96A 4L80A 2Y1HA 1W1A1 2GWNA 3RF9A 3NQ8A 2F6KA 3O0KA 2QCFA 1JYXA 1OC6A 3NGFA 3M0VA 3R8HA 4YVVA 5AECA 2XH2A 3ATZA 1A47A 1C3FA 1Q7ZA 2BVYA 2TYSA 5D2YA 3TV8A 1ISXA 4AHQA 2IPWA 4UNKA 4GZ7A 3R7MA 2IPGA 4PUMA 2OFJA 1AQ0A 1T7LA 2DSWA 4CNNA 4HMCA 3W1XA 4AZ5A 2D0GA 3UY7A 3VNKA 1PX8A 4QDPA 3S1UA 4UB9A 2BGQA 4DXKA 3N9SA 1KR1A 2RGMA 4MAZA 1P7TA 2D3LA 4IXHA 4UTKA 2E28A 4O1EA 5MKGB 2Z00A 4ICNA 3WMBA 3TYAA 2WJDA 1FWCC 5D04C 4MMWA 3T0AA 1EZ2A 3KP0A 2J4GA 3QHMA 3G8EA 1JCXA 1R9YA 1XIFA 4RCXA 5CH9A 3QYQA 2WQDA 1QW8A 3SFWA 2E09A 4C7FA 4PZVA 2VC6A 3BLOA 4IICA 1ZP3A 1B2YA 9XIAA 1QR7A 3IACA 1MQRA 4NF7A 1TPB1 3SRHA 4XKYB 4KKXA 4B15A 4IGNA 1MZRA 2Y63A 4KETA 2GGEA 2A7NA 4A8RA 3W1NA 4CU8A 3USZA 2OEKA 3WX7A 5B7YA 1WAUA 3MSDA 3UR7A 5JIWA 1IHIA 3SR7A 1TV5A 1O12A 5AOUA 3PBUA 3FXYA 4C6EA 2INEA 1EO7A 4GC3A 1KRMA 2W9MA 4AEOA 5ECVA 3BW3A 2FTWA 1K1DA 4KCWA 2E1DA 2HJPA 3TQ0A 5CAKA 2G3FA 1F3EA 2VOMA 4IFKA 1ZAHA 2Y24A 4TXEA 3ABQA 1HFBA 1O4UA 1G5AA 1E4NA 3G77A 4E4FA 4TOQA 2QCMA 1FDJA 1S3HA 3W7PA 3WNOA 3VD5A 3PZ9A 1QOQA 1A53A 5DQPA 1TQXA 2AL1A 3THQA 1X38A 4MWAB 4PTWA 4MYXA 5BXTA 2CBJA 4QR6A 3A47A 5LNVA 5REQA 3AUOA 3I4KA 3P93A 4QNEA 1R3RA 3HV8A 3QN3A 3I6RA 4JICA 3DEQA 1BYDA 3B8WA 4AWTA 3VOHA 5JBFA 4YHGA 2OWCA 3IPWA 1XKJA 3AISA 2VYOA 1GJPA 4KRZA 1IWPA 2WO5A 2FVLA 4E4PA 4AQLA 2RFGA 3C86A 2VXNA 2VZTA 1OGSA 1E0XA 3NEVA 4MNMA 4BHYA 8TIMA 1UQZA 2OJPA 1JIBA 2B7NA 1GQKA 2ZCGA 3F7JA 3WEZA 4M29A 1JNEA 3PJXA 3VFCA 3EX2A 1CGWA 4O18A 1ECEA 3DN5A 2QUMA 1KFCA 3HPAA 4IMCA 3UZXA 3LPOA 4PL1A 2XIOA 3R8GA 2RHGA 2ZWZA 1VLIA 1PKYA 4WDTA 1GYLA 3ARUA 5DEZA 2VVSA 4JHZA 5ABEA 1FKXA 2PLCA 2NLYA 5FJOA 1E71M 1OK6A 2GQ8A 3KXQA 3QOMA 3QOKA 4DYEA 2NQHA 3TYUA 2ZDRA 3U9IA 1P4CA 3VXGA 3PTDA 1KQZA 4A2SA 2VEPA 1VBRA 3SY8A 2HBXA 2J6VA 4LUSB 4B16A 1YXDA 3NFUA 3KBVA 2E8YA 5HDRA 1PYFA 3TSDA 1ICSA 4XO7A 3B04A 4HK7A 1F05A 1U5VA 4EXBA 5HMDA 1TPVA 4B9YA 4QS5A 4LEQA 2ISSA 4DX3A 5A8PA 4IL2A 1DHKA 2NUXA 4C6MA 3ALFA 1TRIA 1EUNA 3WF0A 2OO0A 2POTA 5LGXA 4HU4A 4QHRA 1YHTA 3H7UA 3VI2A 2AMGA 3LPPA 4YTSA 4GE8A 3NSNA 4H2CA 1UKTA 2O4MA 6PTDA 4J3TA 4PTXA 4PC8A 4IGHA 4X0VA 4UMCA 1P6CA 4A8IA 5C7VA 4OQVA 2G3JA 3NOEA 1MW2A 3XIMA 4A2RA 4S3AA 1OHLA 3VZXA 4ZZ9A 2E1WA 2HPIA 3GXNA 1CB2A 1DOSA 4HP5A 1LL6A 1FWIC 3JZEA 4KFNA 3WLMA 3TP4A 4J35A 1ISZA 2HROA 4RNJA 1S1PA 4J3SA 5A5WA 2ZUWA 3PANA 3SRFA 1SVDA 5GJNA 4YN5A 2FPTA 3VABA 4IM4A 1W1PA 2R94A 5A69A 3W26A 1XLHA 1H49A 4XZNX 3Q2DA 4M0XA 1DIKA 1XL9A 3WFLA 3C6CA 3S9IA 2BV9A 1SJBA 1R47A 4JBRA 4DZ5A 3RX3A 2WC7A 3KRZA 3E3HA 3LCIA 5DLCA 3UVIA 1QNPA 4DY1A 4F9JA 1CI1A 2QCNA 2PDHA 4NRRA 4IF2A 2QCCA 1US3A 3N9KA 5HJYA 3SGGA 3LSBA 1WE5A 2ZA2A 3K1GA 4K37A 1AODA 4LT9A 5G4HC 3N6HA 6ALDA 2JIWA 1CTNA 3EOUA 4Y7EA 1SZEA 3M5YA 5J8LA 2HXUA 4C6QA 1S2VA 2BMBA 3N19B 2J79A 1KFLA 4UNIA 4MFEA 1AVAA 3EWDA 4QNWA 5G2IA 3W7GA 4WDUA 4FXJA 4ZA0A 4NJIA 3MUIA 1JCYA 3PVFA 2V9DA 3MBFA 1OB0A 3W7LA 3BLFA 1K8XA 5M2FX 1Q65A 4EWND 1ME9A 4QCFA 3ANVA 3OG2A 3QZAA 2CESA 5AHMA 3RJYA 4NSBA 3ABSA 4JX5A 3WLLA 2X16A 5A6LA 4O11A 5IOBA 4HZ6A 4FR6A 3S5SA 3EWCA 1H7PA 5RUBA 3P8IA 4KGLA 3BICA 1RBOB 2PPGA 3T09A 3RM4A 1LBMA 5I06A 4GYKA 5D9PA 1YKWA 1GONA 3GDKA 1UKPA 4TVDA 4RKAA 1SR9A 5EY5A 3L2IA 4J4KA 3DYMA 5A2AA 3M0ZA 3FHAA 4MY8A 2FDMA 4BQ5A 2PODA 3QQWA 3LQLA 2HNEA 1B3XA 5DCBA 1XDJA 1UMYA 5PTDA 3I7SA 2DH2A 2POZA 1HT6A 4ALDA 3CL6A 2ICSA 4AYSA 4WKAA 3ZWSA 3GDBA 5H2ZA 2ODOA 4JKLA 4ZOAA 3NZ1A 2C18A 3GVQA 2EPKX 3DYPA 4AZCA 3PZNA 4LYRA 3GYEA 4BF9A 4L56A 1DYSA 1TX0A 4M80A 3V1HA 1Q85A 5LIYX 2A2IA 2Q09A 2A85A 4GUFA 1UA7A 3BV7A 3LXAA 3PG8A 4M6UA 4DXVA 2AQWA 3QKZA 1ENUA 3AHXA 3L5AA 3GIPA 2ZZ5A 4F0MA 2ZXBA 4M19A 4YCPA 5FSDC 3MUZ1 3LBMA 5CZ0A 5DBUA 1FH9A 2G3NA 2WSPA 3BJFA 3PUDA 5A6MA 4UMAA 3AJXA 3HPSA 3NXFA 1W1B1 3LU2A 3WLRA 4XIAA 3CQ0A 5E9XA 3OTRA 3M7SA 5F7UA 3GTFA 4FNTA 3VILA 1K7EA 4LF2A 5HMSA 4BQ2A 2CFFA 1T8QA 3S42A 4HOZA 3OA3A 2OKTA 4A29A 4K1GA 3A5FA 3AAMA 3UESA 5HQEA 3SQLA 3BC9A 3DYOA 3I3DA 1XRFA 3TJIA 3NPWA 1OYAA 4W88A 2VFEA 2YBVA 1VHNA 3JUGA 3ERPA 3IJLA 4J2PA 1YPFA 3NPVA 2XGZA 2GJRA 2ZFAA 3BW2A 1LJYA 1VPYA 4JDBA 3HMCA 1UZDA 2EBNA 3OYZA 3RM8A 3EB4A 2X1IA 1RD5A 1O7AA 1IYXA 2ISFA 1EUAA 4GQ0A 3AXIA 4NZ1A 3F5LA 3I4EA 1P48A 4OZOA 2OZ0A 4B5WA 1XRVA 1XLDA 4FXSA 2WVVB 2PDIA 1UOKA 1GHSA 3WDQA 1EJSC 3VGBA 4IUGA 3MJYA 4HZ7A 5BOOA 3WLPA 4QSHA 3GDRA 2D24A 3EDJA 1GVEA 3VM5A 4S2CA 4N9CA 1RH9A 4E0CA 4Q4RA 3O6AA 3GFXA 4W4QA 1QO2A 1PTDA 1EBHA 2BSLA 5DRIA 4AF0A 1GW1A 3OBKA 4QQ3A 2QCHA 3FS2A 2FHCA 3UPBA 3CJPA 2A6LA 3W1LA 1TJ1A 1E1EA 1W3LA 3LCXA 1REQA 2HDJA 1KCXA 3GHUA 4AD1A 3BOFA 3QJAA 4QJ1A 2Z24A 3W2JA 1CENA 3R4IA 1TVLA 3DHFA 4AWSA 4E3TA 2I56A 3W85A 2CLHA 4DWDA 1HJUA 4FLRA 4IISA 4E3VA 1XLEA 3JZUA 1GZGA 3FSUA 3SJNA 4UFKA 4WHBA 5A95A 1IEQA 3SSZA 1O68A 4HYWA 1DORA 4V2XA 5A2CA 1K9EA 3U2OA 1EQPA 2PCEA 1RP8A 3QXBA 4LAKA 1C9WA 3AHTA 1W56A 1KB3A 2GGGA 2OYKA 4WLCA 5CAHA 1Q2SA 2ZZ4A