4CGTA

Deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
678
structure length
678
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPADAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 228
structure length 678
sequence length 678
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cgtA01
4P2RB 2EEXA 5CKAA 2KBGA 3G5XA 3N12A 2FATL 2A3AA 1NWRA 1DBBH 5LWYL 1DQTA 3CZJA 5CINL 5GGRY 1JHLH 2HRPH 2C1OB 1FFPA 1JWSA 4NKOA 2HTKC 3FRPA 2E8ZA 4HU0A 5HHNB 1LO3L 1AQKL 3GSUB 4BQCA 2J7LA 3JTSA 1OW0C 3QDMB 4MB4A 3SQOH 4EE9A 3PNWA 5HHMD 3BO8A 4IJ3B 1E4IA 3RKDC 4RMUA 1QSFA 1WCBB 4OLYL 3IDUA 4UTFA 1GCFA 2QR0B 5KVFL 1I8MA 3V4UH 4NO2B 5LA1A 3HMCA 4OCRH 4NN6B 3TN0D 2WBWB 3VFNA 5FYKE 1RZKH 1I9JL 3MI6A 2VB5A 4AIZB 1FNSL 1FVEA 3QQ4B 3KLLA 4K7PH 1KB5B 1UWGL 2GK0B 5FO7B 3WJJC 5CD5D 4AZ6A 1RJLB 2ZNWA 3RZWA 4RFNB 3O6AA 3S36H 2MPAH 1OGTA 1NMCC 3G5ZA 1DJSA 3EO1A 1FRGH 2FWOA 4LHJB 1FO0H 5CJOH 4L8CB 4PTUA 5CJBA 3QPQC 3G6DH 3EFFB 5C0BA 1UVQB 4PSPA 2XA3A 3W28A 3OGSA 1EZVY 4ZO7A 3LSOA 4NQCE 4XX6A 3SCMD 3VRLE 4X7TB 1ZLUH 3TV8A 4IJ3C 2XNAA 3L3JA 4FOMA 5GZOC 4LF3B 5I73B 1MFEH 3Q3GB 4UQ2A 1QSZA 1CR9H 2MOVA 3U2SB 2BFVH 4WI4A 1T2QL 3AY4A 4GXVH 3LMYA 1NAMB 2EO9A 2XM2A 4KJYB 3UTSE 1JVKA 4NIKB 4YHEA 4HIXL 1NCTA 1U8MB 2ITDA 3QDGD 1B6DA 1OTUC 1PKQB 2D2OA 5DEZA 1HZHL 4JDZA 1NANH 3UJTL 5GXBB 4NQED 4HH8A 3O81A 5IB1A 3GO1H 1DDHB 2YSSB 4K7PX 2FR4B 3DJ9A 2X2JA 1TCRB 3D3VB 3BZFA 4ZPVA 4ALAL 3G6JF 1CE6A 4X4ME 4PY7B 2QL1A 2VJXA 4FFWD 2YD3A 3TA3D 4E42A 3ULUL 1C7SA 3VFTA 3QI9D 3L95A 4EI6A 5DLML 1CDCA 3SCNA 1JRHI 1N0LA 1HH6A 4F7MA 4YDIH 3HRZB 3DHPA 1OM3L 2ZZUT 3RA7H 3AZRA 3D87B 4UQ3A 5DRZA 1ZVHA 4R5EA 1H3XA 2UWEB 4J3WA 1QHPA 3CZ8A 3CU1A 4GS7B 4P3CL 2AJVH 5DURD 3T4YA 1VGKB 4GAFB 2QSCH 2QSQA 3RZCB 5JTWA 3NSXA 5IR1B 4YAQA 1YYMH 3TBWB 5D2NA 1Y6KR 3G08B 5FXCH 4U1LB 3L6FA 3QDME 4KDWA 4LSRH 4HK3N 1NDGB 4N9GA 3IDNA 2OP4H 5EULV 7FABH 5M5DA 2D4FA 5CPTA 5HI4D 3LD8C 3CUGA 3BOVA 1V02A 2DSUA 5GNYA 3BH8B 4Y4KA 2O5ZL 1QX1A 1CR9L 1I7ZA 1J0HA 1QI2A 4MQ7A 2Q76A 4P49A 3L7FB 3TT1H 3U5UA 1IT0A 5KS9A 3THMH 1T03H 4MD5B 3GBML 4K7FA 4ZUWA 5IV2A 1XR8A 1Z6JT 4LOUC 4MA8L 5EO9A 1RZ7L 3V6OA 1ZHKA 3MLPA 2VLLB 4U1JB 1BJ8A 1KPVA 3GO1L 1CFNB 1PS3A 2JF1A 2Z31B 2XIDA 2BSRA 1P7QD 1G9ML 2NXZB 3D25B 1TJIL 1QFOA 4QXGL 4YDVA 1M01A 4OLWL 2OZ4L 4P3WA 2EPMX 3MLRH 4D9LH 4QXTA 5JIWA 4M03A 3QEGH 4BSJA 4Z7NE 3O2VL 3C5ZB 2EE9A 2HA1A 4KC3B 5MHSD 2OTWB 1FP9A 4H1LA 2FYVA 4LCCB 4IDJH 4J1UB 2PXYD 5J11C 5MEQA 1KEGL 5CILH 1ADQL 1QFUH 4QHKI 3O3EB 5E9DD 3U9PH 1W3LA 4F7PB 1L8NA 1DBMH 5F7EH 1YYLH 5HI3C 1OSPH 5GGSY 2PYFA 4GKOA 4MCZA 3MV9D 4PRPB 1QFHA 4POUB 2F18A 1J8HD 1T7YA 4PJ7F 4X5LA 5AYQA 2DQGH 4OM0H 4D6CA 3A23A 2IQAA 3N1AA 1CD1A 2HJKA 4UNIA 4OZGF 3V95A 1QACA 3QFJA 4OZ4B 2VDOL 5GS1C 3C60A 2DWEA 4ODTH 2XFYA 4Z77A 1HI6A 4D0BA 1EIBA 3J7HA 4PJ9D 1UHVA 4MDPA 3LKOB 4RZCA 5EN2B 3TV3L 5DFVD 3ULUH 3L5HA 3FAWA 1ZWIB 1KN4H 1VFFA 1XGPA 5A16B 5MENA 5F7HA 1G6RA 3HAEA 1MFDH 3GIVB 3GFUA 1CN4A 4LSTL 1FFOB 4HAGA 1YJDH 4XGZA 4CU6A 4JO1H 4P8WA 5SX5H 4JO3L 5GRJH 3BPOC 4PRAB 3WLWD 3VXOA 4ODUA 5GS0D 3SDAD 1FC2D 1J1OH 4H25B 1XF2A 1QLRB 4H0GA 4G8GA 2XQYG 3PN8A 2V5MA 5GS1B 3QA3B 2CHNA 4ETYA 1Y0LB 3TO2B 3BUIA 2WW8A 5C86A 2Q6WB 1NMAH 3ESVF 2AQ2A 3DSNA 3D0VA 4ZFGL 2ZUXA 3ZE1F 3EYPA 4JRXA 2IBZX 2CUHA 4H0HB 4JFED 3CLWA 4HF5H 1OB1B 2F15A 3KL3A 1X4XA 2CR3A 2YLAA 4N8VB 3PHAA 4YNYB 5L0QB 2HVJA 2F54E 4O9HH 1QSEB 3ULUE 3K81A 4XAKE 5BO1H 1E15A 4E4PA 1D5ZA 5HHVH 5J11B 3OXRB 2PW2A 1SEQH 1H3UA 3IDYC 1QA9A 4POZC 2NPLX 3MACH 3BGMB 3PWPA 3OAZK 3TWCH 3OR6B 2APXA 3ZT6A 5GPRA 1MFNA 2X1OA 1B0RB 1NP2A 3T8XA 4RBPK 2AJ3A 3QCTL 1U8LB 4P7QA 4XP5H 4KROD 3CHEA 1JHTB 1FVDA 3RBGA 1P4IL 5CEZD 5HVWA 3OKOA 1JYXA 1HKLL 1XSIA 5DJ6A 1W1YA 1N8ZA 5JZ7D 4WHTB 5DC0A 2CDGA 4ZXBB 5E8NA 3V5KA 3EYSL 1BWMA 1CFSB 2O61B 2R29H 5DK2B 3UTTE 3LRSA 4WFHE 4PJ7A 2H9GB 3BIKB 5IM7A 2G3MA 3BAJA 3EFDL 1YPZA 2YBRA 1JGVL 1SBSH 5T3XH 1O7AA 3UPRB 5DEGA 5K9KB 4NWTH 3U46B 2F5AH 3JWOH 3NYDA 4TUKL 2X41A 5H2BB 3SJVE 3N9KA 2LTQC 4QRTB 4CD7A 1UXWB 4LSPL 3CSPA 3MMEB 4HKBB 5C0ND 1RHHA 2HJFA 4U0QB 2QJDA 2CLZA 4HULB 1IGFL 5GNZA 5HJ3A 1QO3B 1CS6A 3RGVA 4ODHH 4XNXH 1H5BC 1E4XH 3LEVL 3FQWB 2VX6A 1HQ4B 1V6YA 3CIQA 3HZYA 1ZU8A 5DUBB 3WMBA 1EHAA 3BPCB 2EKSA 4RMWA 5SX5K 3T65B 4HOWA 4YBLC 1UOKA 3I02A 2YD7A 3QUYA 5EU6A 4BH7B 4AMCA 2YD1A 2GHWB 4JLRA 2VLJD 5I1CL 1ITXA 5BW7A 2VDPL 4GSDH 5GS2H 2CDFB 2A1WL 4W84A 1RUQH 4P57A 5EO0A 3LXAA 2XWJA 1ISXA 2AMGA 1XGQB 5K93A 1LD9A 1HSBB 1FZOA 1AR1C 4U6YA 3PWVB 3GMQA 4ZODA 1J1XL 4JY4A 4PMRA 3H7BB 1AKJA 3PP4H 3MCLL 1AGBA 2UVEA 4RRPA 2YMXL 2YZ8A 4K7PY 5F3HA 4RAHA 5E99H 3CFIC 1CFVH 4XH2B 3HPJA 5FK9A 1KB5H 5FO9B 4XB3A 1JGVH 1SBSL 1W2PA 5C0GA 2R69H 3VFRA 4M8QB 4PJIE 4WTZA 4OUUA 1JMZA 4M62H 5TFSL 4W6XB 2CEQA 2VDNL 4PG9B 1G0YR 3IU4H 4XBGA 3L5WA 5BVPL 1DEEA 1HQRB 2LU4A 3AXXA 5MENE 5ID1A 2OYPA 3PV7A 4L4VB 2CGRH 4ZFFA 5E1HB 2DT1A 1P7KA 5LVEA 3MLVH 5CIPH 5EMYA 1TNNA 2ICEA 2XTJD 1H0GA 32C2A 4XHJC 5F7KC 4Y4FB 4YH6A 1A6WL 5EUOE 1P4BH 1E4WL 5FUZL 1K3IA 4G42B 2PF6A 2R1YB 2FHCA 3ZKSD 4V1DE 1YPZF 5F6HI 4WKAA 2JEQA 4J8RB 3VWJC 2R1YA 1WBZB 2I5YL 3MRPA 4YO0B 2E27L 2ICWI 3CCHB 3AGVA 3FFCD 4OF7A 2VITA 5C92A 4GKNA 5E94A 2EDRA 4P9ML 4YE4L 1ZS2A 4JFXA 1DBKL 1W3HA 3OKMA 4RGNB 4RNRA 5JOPE 5AEAA 4I18C 3DXAA 4Q9RH 1HVQA 4NO0D 5AZEH 2VOTA 2BRRH 3CJJA 4KY1L 4P5TD 4XNYH 3KYMA 1K3ZA 4O5LL 3L5WB 1A64A 3GSVA 2QV2A 2X0HA 3D39E 3VD5A 2CIKA 1U8QA 5C0CA 4Y2DC 3EJZC 3CDYA 2FH8A 4QWWD 5LQBL 2X1QA 1NLDL 4TX8A 3HPJB 4HV8A 2AGJL 1H09A 2HJLB 5E4EB 1F58H 1E28B 3VNYA 4P23C 4G5ZH 2LABA 3BC9A 2X2IA 2ERJC 5CP3A 3O8XC 3V6ZB 3U7WL 4IISA 2NTFB 2VQ1B 4RAVB 2IAMC 4HZLA 4L8SB 1GZJA 2C3GA 5IB5B 1OGAE 5ID0B 2E7CA 1FG9C 4OGYH 2R0LH 2ADGB 2DJSA 3VW3L 1LD9B 2O5YH 2UUDH 1H0DB 2EXYD 1MFCL 2Z8RA 2WMGA 1LP9E 1S5HB 3KPSB 1RPQA 3TPUB 5ADPH 1FYTA 5CPSA 4MJIB 4K71B 5FUZH 5FECB 3RUGE 3SO5A 4JDTL 5DRWB 2PTTA 4IMKA 1MCOL 1F6AB 3N13A 1TJGL 3RHWK 4DGYL 4D6FA 1CBVL 2IMNA 2BCKA 5JZ7C 1U9KA 1U8NA 1JAKA 4I2XE 2OLDA 1ZLWK 1A4KA 2FDMA 2BJMH 3WS6A 3RM9A 2EKSB 3QNYA 3EDKA 3HZYB 1VGEL 1YEFH 4M7JH 3R8QA 1HQ4A 4PGCB 5A6LA 1CDJA 3FCTA 1A4JA 4CVZB 1A7BA 2RGMA 2WVSA 5T5NF 4LASL 5E2UL 1XH0A 3IRZA 1ONQB 1TZGH 4DVRH 3BUQA 3QEUB 1ZA3A 5EO1A 4A2LA 1YEKL 5I71B 5DEFA 2ZWYA 1INQB 5I15H 5F9AC 3I6GB 4QRTA 1KNOA 2A77H 1E0VA 1UZ8A 4XMLH 2O9PA 4X6BA 4ZNCD 2DQEL 3KR3L 1BLIA 1NAKH 4M82A 1L6XA 3RVTD 1ED3A 5DEGB 5KAQF 1ZLVH 1NGYB 3WHE0 1BZ7B 1IGYB 2VDOH 1GJIA 1SMDA 1SYVA 3U48A 4AK1A 2DT0A 3W0WA 6FABL 4HGWB 5DK2A 2CLRA 3GSRA 2O93L 3BISA 5HD8D 2XY1A 5E8NB 2QBWA 4KK6D 2KZ1B 1AD0B 2WAGA 5HPMB 1W9UA 4EUPA 5DJ6B 3AMLA 5MEOB 2DSKA 1MQPA 3PP3H 4PJBA 5EZIL 4MB5A 3SJVD 1LNUB 3QG7H 1UKTA 4NWUH 3O6MH 2D03L 4ZOAA 3U1SL 3T8XB 3IFPB 1XGTB 2Z4QA 3HC0A 3SDDC 4OLXH 5EOTA 2V38A 3O8XB 1BYCA 1YDPA 4M80A 4O5LH 4X5WB 1DQQB 2JJWA 3BUYB 3NDZA 1JWMB 3OKKB 5FCUH 1EAPA 3WO4B 4K8RD 4NQUA 2HT4D 3I75A 5BJTB 1I8KA 2WBKA 5GISL 1CFTB 3B9KA 3OXRA 5IOPB 1RMFL 3GM8A 1QI5A 1TZIB 1AQKH 5CBEA 2VZOA 1HDMB 1KXVC 4FFZH 1FOBA 3BQUC 1EJ6A 2IFFH 2OXGA 5ACLA 4G8GE 4G9FA 4WFED 4QY8A 2VRAA 4JRXE 4FNLL 3KPTA 2BVOA 4QHUA 3TT3L 1ZANL 4PJ8D 4PP2B 3MANA 4OZGA 4ZSOE 3MJ9L 4FZEH 5JOFA 5T3ZH 3CDGB 3QPQD 5JPNA 4QT5B 3HI5H 1JFQH 4HBCL 5EWIH 4GXUM 5TDOA 3C6LB 2G2RA 2W65B 4UBDD 4OT1H 4ZAKB 5JHDB 5BO1L 4FQCL 2EKJA 3RI5K 4BZ2H 4JQVA 1F13A 2C3WA 4LSVL 4WW2B 3ZIZA 2VCBA 3B9DA 1QNQA 3HG1E 2F5BL 3VXOB 1KJ2L 2HWZL 3M8OH 3RL1B 2QEJA 4OCXL 5IB4B 2YUVA 2HT4C 1UA6H 1KPUB 4JHAL 4BUGA 2IFGA 3PE9A 2BSED 3RL1A 1W9BM 3IF1B 4JO1L 5K9OB 2FHFA 4WW2A 3PZIA 1XGPB 4V1DA 3T3PE 5D2LA 1DWAM 1OL0A 3MU7A 1L7TH 4KRNA 2VDLH 2FE0A 1B90A 4H20L 4XPAH 1S9XB 2KL6A 5B39A 3HE7D 2MMXA 2UWEF 4KJPC 3OXSA 3CDGA 2NXYB 4XMLL 1HI6B 2R1WB 5LWYH 4I2XB 1LF1A 4HPOL 1ZL1A 3WIJA 2D7OA 1LHZA 5HXMA 2ZOLA 3HHRB 5HYJD 1EBAA 3O4LB 4NM4H 1ZB5A 3FT2A 1NBZB 4NJAH 4F15B 4C56B 4M1CC 4UTBH 2VIRA 5I77A 1IMHC 4PRPA 2YPKA 2Q87A 2VLKD 3DXAD 4FFYL 2UY5A 1IC7H 3I75B 5BJTA 2I26N 4WDIB 5JHDD 2FL5A 1EAPB 1TG7A 3QUYC 4M61B 3VXRD 3VMOA 3V5DA 1GPFA 1S8DA 3V7AE 1OLZA 1KN2H 4NNPH 5MEQB 1NJ9B 4RRPG 1H3PL 1J05A 5EOTB 1O0VA 1VENA 5E08L 2Z4QB 2QMKA 4L5FH 5L2KE 1FCCA 1HKMA 3KXFE 3AC0A 4OJYA 4ZUVA 2WWCA 1JDAA 4X80L 3K8KA 5DJDA 2J47A 3K8MA 4ODSL 3KPQA 3K8LA 4IHOB 1LILA 4ZS6C 1CLVA 5E9DB 5I6XC 2WQRA 4YDVB 4PUBH 3WH8A 2NTSP 4PJBB 3VX0A 2JCCF 1JGLH 1MHHA 1TTUA 4P8XA 3HG5A 2ZNXA 1UJTA 1IAII 5DO2D 1YZZA 2ZUSA 3VG9B 4XMPH 4OIFA 1OGAD 1QSFD 3GSRB 5EO9B 1EBPA 4MX7B 3W0WB 3ARDA 3R8BB 4PJEE 3L7FA 2J7HA 2EDYA 4MAZA 5BRZD 5IB3A 1WCQA 4WHDA 3TBSB 1I7ZB 1FNHA 4GW5B 1O5DT 1UEMA 5EORL 2HTLD 4QXGH 5FKYA 2H26B 4LKXB 1ORSB 2NXYC 3DECA 3N9GL 4KGLA 1CQKA 5D2NE 3AMCA 4NRYA 1ONQA 1IAIL 2GT9A 5DD3L 1HKKA 1JTPA 5D7SL 2VDRH 4KDTC 4N9GB 4GI8A 4J12A 5GGVL 3QQ9C 3RX8A 3NSNA 3G08A 3WMSA 2XN9D 4MNGA 3U0TA 3NABL 3PDGA 4U1KA 1SY6L 2VURA 1S7VA 1P4BL 2YRZA 5HGDB 3F7VA 3GKZA 4P3CH 3OWEA 4MNJA 4GT7A 2QQLL 1W9PA 3FFCE 1JI1A 3BKMH 4B3LA 2V5RA 5E8PA 4I0CC 4AQOA 5HHXH 1MI5A 4ZENA 4HIIB 5JW4R 3HZ3A 1HH6B 3BAIA 1OWQA 2V3GA 1NANI 1ADQA 4CKVX 4PGZA 1UWIA 3M45A 4LU5L 1OCWL 5ICZB 1JD7A 4EQ2A 2OR9H 1AXTL 1CE6B 3IYLW 2DLTA 3CZFB 3ZSTA 1TQSA 1YA5A 5A94A 3ARBB 4GKSB 1HIZA 5ID0A 3QH3A 4KY1H 3S37X 3W0WD 3RJDA 4LPUA 2EABA 1FPTH 5C08A 5DRXB 3ZDXF 4J2XA 1FVCA 3NDYA 3VGHA 1UR8A 3F7PC 4CVXA 5J13C 4U33A 2Y06L 4TOQA 2K3TA 4MJ6B 3VXTA 2XTJC 3NPZB 1M05A 4HJJH 3HG3A 1W3JA 3MS8A 2VE6A 2H6PB 3UO1L 3PV6A 1N3NA 1RZKC 1AGEA 1U3HD 1U8QB 3T0AA 3KPOA 4CBPA 2X4UA 2HTKD 4U1SB 1CDIA 3FO2A 4E2OA 2EIBA 5AUMA 1CGXA 4P7NA 2E5EA 4CU7A 4L8CA 1WT5C 4MDIB 1AD9B 2FEEL 2C3VB 2R4SL 3DVNA 2PUQT 5BV7L 2Q7YB 2ICWA 1CT8A 2J2ZA 5DVMA 1KJ2B 5E94B 3EYVB 2E40A 1FLRH 2GK0A 3MRHA 4F57L 5TQ2H 2R23B 3A6CH 2YA0A 3W82A 3DX7B 3B9KD 1UXSB 3P0GB 2G8ZA 1WK0A 4J28A 4JFFD 3AFBA 1HH9B 2KQNA 1MUJB 1I9JH 3JTTA 3BE1L 3SCVA 3QG6A 3LQZB 2X0YA 4FXGA 4L8DB 4YDJB 2ADFH 4MCYB 1A1MB 2W0KA 3IJ9A 3NIGF 3SJVA 4CCCA 1V6WA 4MNQA 1Q4NX 2YD4A 2PO6D 3GNRA 1CCZA 3MNVA 2NY4C 2YPLB 3T3MF 3OZ9L 2A6KB 1ULVA 1HQRA 4URIA 1DEEB 5M95B 1PG7X 1H3WM 4PMVA 2YZ1A 4RWYH 1BG4A 3QWQB 1CICD 3WF0A 1TXKA 4DFHA 3HE6B 3KLDA 3GSXA 3IJYA 4EI5D 4X9YA 2I25N 4N0CD 4ODVL 3W27A 5AD0A 2FO1A 4HPGA 4OM1H 5EC1A 4V1DD 4XC3H 1Q6EA 1G5AA 3OJDB 3WF2A 5JBEA 1S3KL 3WFZA 2JJTC 5TPWH 1E0WA 3WUBA 1IEBB 4Z7WA 2VTFA 1N82A 1B1YA 5CIPA 2EDNA 1MCRA 4W7VA 2D3NA 1GGIL 1D2KA 4A3HA 5IBLD 3U7WH 3BN3B 3PGDA 4TVPE 1WFNA 1U58B 2IWGA 2VLJB 4U6YB 5TE4H 3HMXH 3O9WA 4JRXD 4JZJC 4LGRB 4UZSA 5ECUA 2JALA 4GQRA 2XWJB 5BCAA 1MFCH 5HPCA 1TENA 1OCWH 2W67A 2APBA 2D7NA 2DN7A 5EBWA 2GK1A 4JLRB 1C08B 4S1QL 4OKDA 4G8IB 5HYFA 5L2KA 3BPCA 4K23L 2Z91B 1JPTH 1NEZA 3KDMB 1UCBL 2RFXA 3RGVC 1W72L 3MJ7A 1K9TA 4LASH 5T1DL 1BPLB 4M1DH 2X4RB 3VD4A 1YECL 1PD6A 2RQ8A 4XB7A 5DD3H 3PZOA 1DBJH 2DQTL 1MAKA 5C09B 1FL6A 2JFEX 5I18L 4Y16C 3VFUB 3ZL4L 1A5FL 3WY4A 5A2AA 4NCDA 1HNGA 4UOW1 1S7TB 3WFBH 2YBRB 3Q5TA 1ZLWH 3A24A 1XHGA 3MYZA 2ZUTA 5HY9B 2DIEA 2Z8VC 4AEHL 1EO8H 3FN0H 4BQ9A 3L4VA 2H9GA 3BIKA 3NFPB 2WVVB 5DJ8B 1IZJA 1K5NB 4W81A 1A6TB 2ZP0T 4X4XB 5DUML 1FYTE 5F7DA 4IOIB 1VJSA 2YD8A 4QHNB 4NRRA 1OF2B 2UY4A 3FHAA 3W6MA 1N8ZB 5J0BA 4D3CL 4TUJA 1CXEA 3ZDXE 4YDKL 1SJHA 4GRLD 4EVNB 2VXUH 2F54B 1EHXA 1OAUL 1Z0MA 4QOKD 1QVOB 2X4NA 4NX0A 2FGLA 4CW1A 2GVYA 2AJ3B 1MCDA 1CFVL 5E00B 3MCKB 4Z0XA 3RY4A 1E9LA 2V7NA 4U3CA 3KWWA 3W0WE 1DWJM 5IMMA 3PTKA 3SUUA 1GOQA 5C0CE 3F8UB 1KB3A 2N7AA 3DARA 5TFSH 4MS8D 2VCAA 4ZUUB 4MXWH 3HFML 3QWRD 4YQXL 4V28A 4HUVB 4GW1B 5K33A 3OJ2C 3GMNA 2IAMD 1WPCA 4OUOA 1D5ZB 2ZSWB 4HPHA 1X1NA 2XKNA 2HVJB 3GI8L 1V8HA 3QXTA 2C3HA 2BHUA 2E6JA 4D6EA 4DN3H 5LGHL 2FZ3A 3B2VL 3VIFA 3WNNA 4UU9A 1NCCL 3F7RA 5FM5M 2PYEB 3QEQB 2BFGA 4FTVB 1V6VA 1C5BL 2DIAA 5GJSL 5HBFA 1UM4L 2J78A 1Y18B 1VF8A 3WIFB 4HZ6A 5K9JL 1ZGLA 3QNXA 5D7JC 2DQDH 4X6CF 4H7VA 3PDDA 3ARFB 1BJMA 3QA3A 1DL7L 3BWAB 3KPRE 4Y89A 4D9LL 2RJMA 4PJEF 4UDTA 5DC9B 4W8LA 4G8GB 2EICA 5JUEL 2EECA 4H25A 5GGUB 5HHOE 4D6IA 5F72S 1AXSB 2C7FA 4AL8L 2YD9A 1I9IL 1U8HB 4NF7A 1X7QA 5GGTA 4Z2JA 2DQUH 1FP8A 5JW3H 3FB8B 4KRMB 3VI4E 4E41D 4ODWB 4XGZB 4C83A 3S4SG 5KTEL 1WAAE 2XG4A 2FECI 4JANA 4OFKA 1E71M 1EH9A 1FBIL 3ZTNH 2WW5A 2GJJA 1KC5H 1FA2A 1DUYB 2VAJA 4Y7MA 2HKHH 1I1YA 5ANMA 2K7PA 1SYSB 2XPGA 3IJSA 4X5XA 4UB0H 4H20H 1QNRA 1XCTB 3U4AA 3N04A 3S3PA 1BLNB 1ACYH 5D7LA 3EO0A 3HNTL 5TPWL 3KPPA 3LV3A 1R34A 2XZQL 1FZKB 4OZ4A 3QFJB 5KSVA 5BVPH 3ARRA 3RTQB 1QNZH 1TFHA 1X5XA 5GZNC 4K3DH 3WL9A 5L8JB 3ZKMC 1FH9A 4CAGA 1UWSA 3ZJ8A 3LEYL 1VEMA 2Q86B 4IIQC 3RNQB 1FZMA 3RWCA 3O6FC 1ROWA 3MRIB 4JFHE 4XP9L 3ZKNC 3RJXA 1US3A 4DAGH 1DWGM 3C9NB 4D72A 1AXIB 5C0AE 3DX0A 1K9FA 4ZAKC 4U1IB 5DJCA 3H0TB 1VFUA 4DGVL 2E27H 2VCCA 3R0MA 5KSAD 3CK0L 1IAOA 2DWDA 4LARH 4LCCA 4LX4A 5I74C 2Q3AA 3L1OL 3MRRA 3HUJB 1UCBH 5JMRA 1M53A 3VGEA 4PTVA 2GSJA 4K3HA 4XZBA 1V08A 3P11H 2PC8A 3RGVD 4NQCB 3DX6A 4DWHA 3VCLA 2EO7A 2Y7QB 3G5YB 1N2RB 1ZLSL 4M5YH 1A2YA 4JFHD 3E6FB 3TTQA 4Q2ZA 3S5LA 1JGLL 2J25A 2UY3A 3CX5J 1NH6A 5IEKA 4GXVL 3IJHA 1ZHKB 1EPFA 2O92A 4KTDH 1AVAA 4XP1L 2EH7L 3VU2A 5IV2B 4ZUWB 2CRIA 5DQ9B 3RX5A 4RFEA 3TJHC 5KS9B 3I3BA 2J7GA 5C0BE 4BQ4A 2F53D 1U6AH 4FP8H 3RWDB 3MREB 4P5TA 4JKMA 1W3KA 1T04A 4DEPC 4LLQB 5D5ME 5E6IA 1US2A 3PTQA 1UKSA 2BSSB 1I8LC 4XBPB 3VFSA 3CPLB 4UNTA 3HLAA 4RGOL 1J9YA 2CKBH 3IDNB 2F7QA 3WIHA 2F8OA 4ODHL 4YHNA 4POYA 2AXJA 4HKZA 5KSAB 3TBWA 1D9KA 4N0CC 5AYBA 5IR1A 4P3DB 5SV4A 1ZLVK 3VE0B 4YPJA 5E2VL 4FG6D 1LO2H 1MIMH 3ARYA 4AYFA 3DO3A 2D0HA 1FN4A 2EPLX 1BOYA 4LIQL 4D1JA 1HJXA 4ZFOA 1A47A 4J3OC 3HG1B 2XICA 3HRZA 3DYPA 3X13B 4PJ7E 5T33H 4F7MB 2OWXA 2NY4D 4APQB 3WD2A 3BKML 1I4FB 1KCSH 2WANA 3AOFA 2DGAA 4R0LB 2XT1B 4J7RA 4F3FA 5JNYB 3FQTA 4UQDA 3L95B 5D1ZD 1FFNB 1KGUA 1YN6B 4XBEH 4CD5A 4GMTL 5HYQB 1TCRA 3D3VA 1MQQA 4OCNC 4NSKB 3D3VE 4JM2F 5IMLA 3NCJH 3K7UA 3ABZA 5GGTH 4PTMA 3VXMB 4CVUA 1AP2B 4D8PA 3AZSA 4HUXB 4LCCC 5DQDH 1JGUH 1S7UA 2A6JA 3LY6A 3MV7E 4AIEA 2ZCKL 3GSNL 1QPPA 3U7VA 3KPMB 3ROOA 3V2AR 5DT7A 2DBJA 1MW1A 4LF3A 2AEQL 2HRLA 3MC0A 4RA3A 1KXQE 1LP9B 2EIDA 4JKLA 3UO1H 1PG7W 4TUOA 1PY4A 5IXEA 3PP3K 5INDA 3VX1A 4PMOA 2VXQH 4OCWH 1UKOA 3OPZH 4MQXD 1UYWL 3PGFH 4I77H 5IFAH 3WDPP 3U79A 3X14B 4UFHA 3BRFA 1FFRA 3G5ZB 4I5BB 3MGTB 1YNLH 2J4WH 1ZSDA 3FJTA 4M48H 4L3EA 1OIFA 3QDGE 4NNYB 3FKUS 2HKHL 2MFNA 3EDJA 3C08L 4TULL 3V7AG 3QQ4A 5JXAH 4UOQA 3KHOA 1CFQB 1A6UL 5JPMB 1JNEA 2VDQL 1MOEA 4MNHB 4W7WA 3BP7B 1CPUA 4W7UA 2XKSA 4NGHL 2AW2A 5JPMA 2I5YH 3VIOA 3MRBA 4KUCF 2W59A 2QR0A 5GGRB 2UZIL 4NC2B 4CADB 3QB7C 1QSFB 1S5IH 1X4ZA 2G60H 2MKWA 4M1GH 5I1DB 3CZGA 3MGTA 5CSGA 2ZX8A 3BO8B 4BUHA 3VO0A 3PNWB 3F12B 5GRYA 2APTA 3JTSB 4MMXC 2XRAH 3GSUA 4KMTL 1V6UA 4BH8B 4MHHI 4PJ8C 4YFEA 1T0MA 5INDB 1MYRA 2XN2A 3PZ9A 2C1OA 3HN3A 4P4KD 1NLBL 3MRLA 4JN2A 2B8OT 2VQUA 1LK3H 4JFWA 1IAIH 2W1NA 3BJ91 1OAKH 3WQWA 2D31A 3FB7A 1AGFA 4GI6A 1S7UB 2A6JB 1B31A 4LYPA 1F4AA 1VFOA 4WTZG 4HC1A 5C2BL 1PLGL 1NGZB 2XZCL 2WYSA 2IBGA 2ESVE 2FX9L 1JFXA 4NHCL 2OJZL 3BXNA 1R0AL 4I3SL 1MH5B 4XNZB 5DVKA 4MVBD 3ZYIA 1NFIB 1UG9A 1GAFH 1PYWB 5F21B 3N1FC 2X05A 1CTNA 1G7IA 1XGRB 2Z93B 1OVZA 5DMYA 4HMCA 1UQZA 3MUZ1 4YHOH 2WLYA 4LCWB 3GH5A 3L2LA 2P8LA 3IGAA 5ITFB 5D1QA 5C08E 1FDLL 4OCRL 4PV8B 3PWUA 2HLFD 4KTDL 1R8LA 5I1JL 3CTTA 3ARBD 3ESUF 4J3XA 3A5VA 5I0ZA 1KLGA 4XVJL 3WELA 2ATPB 2WK2A 2R4RL 4FMFA 5DSCB 2ATKA 1ITCA 1VGEH 1YEFL 3OGVA 2VLKA 4QYOB 4GUPB 3KJ4C 2F7PA 1FRGL 4HKZB 1RJCA 5KSAA 5KN5B 4MAVA 1EEQA 3S36X 2DQIH 1RK0B 1UACL 1S78D 1P2CB 2ID5A 1JCKA 2R15A 2QPUA 1KPRA 1P7QA 3CX5K 4NJ9L 1JK8A 1JNLH 4LVNB 5FYLH 3X3GL 4Z76A 5LA2A 1NWUA 1X5IA 3T0DA 2EDKA 3SGKC 1IC7L 3QJFA 2EYSA 1R3LA 3OTTA 2YL9A 1JF5A 4P5KB 1X9QA 3VFVA 3DUHA 3V4PL 3WIIL 2QADD 3WMCA 3WN5A 3SUSA 1V7NL 4IM4A 3ZL4H 3RJYA 4KZDL 3NFSL 4YPGB 3RL2B 1MLCA 1HVXA 3F6IA 3BYTA 4HWEH 4M48L 4Y19B 3IJHB 4GXPA 1T1XB 3RWFA 1SMAA 4LSSL 3K2MC 4TTDD 3S5LB 1OT1A 4HGKC 4XVUC 4XCEA 2P5EE 4KGJA 5T5FL 3V4UL 4FMVA 5F1IA 1OPGL 4JGJA 4PGBA 1JBJA 3CSYA 4OIBA 1MPAL 3U1SH 3QIBB 5EUOB 3Q6GH 3O6ML 4KWUA 4BFBD 3OAUH 1CXFA 1JGDB 2X4OA 4X0KA 3RVWC 3IDMB 5J12B 4U7KA 3QOMA 3CFBA 2XRAL 5CD3A 5ERWA 3QR3A 4LK4A 1JZ2A 1UWEL 5EUKA 1ZS8A 4P4RA 1U8IB 1I7TA 1FAIL 3MFGB 1R7OA 1INDH 3NZ8B 3FONB 5A3HA 1ZLUK 1NARA 2APVA 3BH9A 3ILQD 5DHVB 1EA9C 3O4OB 4WO4C 4PYHA 2E7LC 2OJEB 3MR9A 4BJLA 2GUYA 5ADOL 1UD4A 1XSKA 4P0DA 3EYFA 4PRHB 1J0IA 2AK4D 4HIXH 5D8JH 4M6OH 4RX4A 3TONA 4KTYA 2CRMA 2J75A 1MRDL 5KVGH 2IBZY 3VXUB 4Y5VB 5FOJA 2NNAA 1VSCA 3SCMB 2Y72A 2E3ZA 4H8WC 4FQIL 2DM4A 4X8JA 1GVYA 3CFJA 4NPYB 3D0LB 4BZYA 5D7JB 2VL4A 3VD9A 1CLXA 1BZ9B 1CZ8L 2AJUH 4TQEH 4DW2L 1I1YB 4L29A 3CH8A 1GJWA 1SM3H 3TIEB 4BYHA 3PXHA 4F7CB 4FABL 1U3ZA 3N1MC 3KJ6L 5BOZG 1T89C 5TF0A 3U5YA 3QHMA 2GCYA 3NACL 1T21A 4WUUA 2EE6A 3FB8A 4ODXB 3ZKQD 3GTNA 4WV1A 3WH6A 3C5JB 4OKVB 3S6TA 5C0DA 2JIXB 3OGCB 5F1NB 5EZJA 1KQZA 2A2QT 5KZ6A 1BSIA 3DURA 1ZEAL 3QXDB 5TQ0H 4XPGL 4OLUL 3TH4T 1RZFL 1EFQA 1FAIH 5C09D 3QNXB 2BV9A 1HEZB 2OR7A 3CFJB 1FGVH 2F61A 4PLNC 3GUTA 4PJDE 2GJRA 1T80A 2AABL 4GZIA 4FTVA 3MV7B 3RVXD 2D7QA 3SDXA 3CZKA 3CX2A 4C7FA 2NX5D 3RTQC 1EEYA 4PCTA 4CKQA 4K3JL 1QFWH 4S1RL 4UOW0 3BSGA 4FLRA 1V0NA 3ZYOA 3TIDA 4AC1X 3QUXD 2BY3A 2FGZA 3U36B 1A6WH 1WFOA 4GRWH 2OJEA 3MRQB 4U1GB 5DHVA 4GW1A 1BJ1H 1IAKB 2F5BH 2Y23A 1GSMA 2J5LC 4N8PA 3WO4C 3UC0H 1Q6CA 3TTYA 2DYPA 5I8CB 1BYDA 5AYUH 2M1KA 4CL7A 1YMMB 2IG2H 5F9DC 4TQEL 2MSPA 1F2QA 4DW2H 4PMQA 1ECEA 5EOCH 3DSFH 2GJ6A 4Y5VC 5DS8B 3DGGB 3KNBB 3MJ8A 4KQ3L 2CNCA 2VXTH 5DK0B 4KK8C 2V7NB 3WHXA 3OAYH 1EDTA 3P9LA 3ZO9A 5HGAB 4CW1B 1AC0A 3BEWA 3RWIA 5EUOA 1IL1A 3MNWA 3QIBA 4C57C 1QVOA 2X4NB 4NYLB 1W32A 4P99A 4FQQA 2N4IA 4OZHB 2C5DC 4LEXH 4AY0A 2F54A 1I9RH 1E4NA 4OI8A 5F1IB 2ZUMA 1ZLSH 3AS1A 1MY5A 5BV7C 2BVDA 4XTRD 5C6PB 4Y19A 5HPOA 5IIEA 2CIIA 3EJUA 1E55A 1A6PA 1XV8A 5DJ8A 2Z35B 1K6QL 5ECJE 4YPGA 3RL2A 5D9NA 3JWDL 4ZS7L 2EXYC 3BMWA 1A8JH 3BSHA 2WCAA 1A3HA 1T89A 1Y7VA 5EOQL 2BMKB 1G9NH 1R3LB 5A6BA 3ARFC 1Y6MR 2R2BA 4RAUB 2VZUA 5KZCB 1GC1H 2VNCA 4JL2A 4B15A 2A9NH 4ORGB 2X4RA 1N6VA 2P7TA 3QAZB 1UYWH 4LNVA 1BFTA 1A3LL 3MJ7B 3W29A 4PJFF 3MLSH 1LE5B 12E8L 2NR6D 4GUPA 3DX9B 1NEZB 2JJSA 4ZD3H 3TNNA 1E6XM 3DDFA 3CFCH 4OFDA 1ZJBA 5L2KB 2ATPA 3CH1A 2GITB 2JB6B 3UP1A 1C5BH 1WZLA 4HFUL 4LLDB 3W0KA 3GJEB 4MA1C 4R4BB 2XN9A 4JAMA 1RUQL 3HZVB 4YHZL 3T1FA 4PJAE 3MV9E 5T33L 1YQVL 4N1CA 3HS0B 1WDQA 1KIRB 4LHQB 1UGNA 1S9WA 4Z7QE 4N68A 5DHYB 3BXNB 1OIMA 2FJFB 2XI9A 4JHBA 2A6DB 3EO9H 3KL5A 8A3HA 3UTPD 4HEPG 1GORA 1NBVH 5I1KL 1M04A 4H8WL 4ELMA 4TTGA 3S7GA 2ZUNA 3W11C 4JPKH 3O6FD 3QUKA 1I1FB 1QBML 1XIWC 2PW1B 3O3DB 2YL6A 4Y5XB 5HGHB 3L2MA 4G6KL 2DAVA 5EC1B 1I8IB 4J3UA 3LB6D 3NFNB 2D31B 4F8TA 3RI5F 5JUEH 3G6MA 5DO8A 2DDQH 3WXVH 1GIGL 3WHE1 1SJXA 3OB0K 2JK5A 1OGSA 4X6DE 2W9EL 4LSUH 5HDBF 1HL9A 1K8DA 4XC1H 4WKFA 1RD6A 3T2PA 3D69A 3WNLA 1HNFA 3BDXA 1MW3A 4FQXC 3T0EC 5C0CD 3MNVB 4MJ4A 3D52A 1TTGA 2VXSH 4I48B 2D7PA 3MUGA 12E8H 3N1PC 4QHMB 1R0AH 1ZJAA 1IC5H 4JM2D 5CZXD 4U6XB 4F9PC 1T4KB 1K6AA 2OMNA 4CADA 2XFXA 1YEJH 4L8DA 3G6LA 1YMME 3MRBB 3VI3F 1K9EA 3FRUA 4YHLH 3T08A 4O4YH 5IQ7H 4Z7UE 2B0SH 1H15B 4EN3C 1H5VA 4PR5A 2EJ1A 2ZUVA 4HH9A 3FT3B 4P23D 1MCPH 1V3JA 4PJEA 4NNYA 3EYVA 3QUXA 1WTGT 2AEWA 1KJ2A 2V5CA 1T1ZA 1ZSDB 1U8KB 3MBXL 3FQUA 5E99L 1KJVB 1QKZL 4PJHF 5AAMA 3DX3A 1AD9A 3SCSA 2XWTA 4MDIA 4OD3H 1ND0B 3NZHH 4PJBF 3O6FB 3VGFA 2Q8XA 1LG2A 5JQ6L 4I4WB 4U1SA 3KXFD 4G3YL 1BFVL 3OGOE 1WGOA 1G9NL 4WF7A 3IDGA 2OL3H 5LQBH 2X7LA 1JPSL 3GBLA 3MYJB 2YIHA 2EDQA 3HAEH 5A8NA 3V52H 1S9YB 2ICWJ 4CVXB 5C0IA 1KBKA 1DN2A 4HK3J 1JPFA 3B5TA 1AP2A 1KULA 3ALPA 4S1DD 3SPVA 3UBXG 4AENA 3P9WB 3ETBF 4MA8H 4Y1AD 5GRXG 3BQUB 1UWQA 2DQUL 3ARFD 5DZNA 4I0PD 4EN3D 3WEMA 1CXLA 1AGDA 3MJGX 2AK4A 4DJMA 4GKSA 2P5WB 1JNHB 4Z78B 2VI0A 1RUAL 5DUPH 2BVPA 3WFHA 2NY4B 3BJLA 1KC5L 1W0YT 4R3SB 3REVA 3AIEA 3CDFA 5JNYA 1HJSA 1IV8A 4MA3A 1E0OB 3ULVD 4U3XA 4WFFD 1B0GB 4HIIA 2VKWA 1AE6H 3QDJE 3O3AB 2YXFA 4LSTH 2FLRT 3C2AL 2P48B 4GO6B 2X89A 5DD1H 3F7VB 4M7LL 1UJ3B 5HBBA 3ARQA 5D9SB 2HT2D 2IANA 4ONFH 3O3BB 1JPTL 3BIAX 4P9HC 4NRXB 2DOCA 4Z7VE 3VE0A 1Z5LB 3HAEG 3SDYH 5ETUA 3U0TB 3FFDB 4BS0A 2YR3A 2VR5A 4JY5H 4P7RA 4HUNB 2LVCA 3OG4B 5DMIH 5IVOA 2CKRA 3PWJA 4PJFA 1XGYH 4ZUSB 5TQ0L 3F62A 4PJ5E 2P8MB 5ALBL 4RE2A 1CFBA 3ZT5A 1UZ1A 3NPSB 1W2VA 5E6IB 2EDTA 2F53E 2H26A 4AMWA 4P5TB 3EHBC 2QPSA 4XVSL 2X2YA 1V6XA 4JKPL 3CFCL 1JNNH 2W60A 3TYGH 4LQFH 1FP5A 1MFAH 4TVPL 1OQXA 2OSLB 5DGQA 4DVBA 4OCSH 5ABGA 3QUXC 5I1IL 3VSVA 4ONGH 4CMHC 1GCYA 1SMOA 3OIHA 5CILL 4D3CH 4Q6IB 15C8H 1Y6NR 3QDMD 3OGRA 4MJIE 2KPNA 5BS0D 2EE3A 1EOMA 1E3XA 4DOHB 2CO6B 4IHOA 2XIBA 3BPLB 4P2CG 4OQTH 4A6YB 1F3DH 2EIEA 3KPSD 4GKZA 4H41A 1DSFH 3VXSA 5L9DH 4KKLC 1KYOK 1FNEA 3QO0A 1MREL 3W2DL 3LAFA 4NUJA 4F58L 2CCRA 2F8VA 2ALWA 1TFVA 3TVMB 1TQWA 5IBUB 1KXHA 4PY8I 3ZLQC 2YRPA 4Q22A 3P9MA 4HMDA 3AI0A 4I0PC 2WNWA 3KLHD 2P5ED 5J6GA 2VIRB 1RP9A 2GDUA 4HUMB 4YGAB 4J27A 5L88L 3Q1SL 2AGJH 2JKXA 1ACZA 3WL9B 4EDXB 3PWNA 3HE7A 4PJ9B 4UZUA 2IBBA 1P4IH 3EDEA 4PBWD 3GNMH 1O7VA 3GB7A 3L3DA 3WEXB 3KPPB 3FB5A 1J1PL 4XCYA 3L4UA 1S9KC 4PJHE 2V2WA 4P5TC 1IEAB 3I6KA 5IVZB 3SDCA 5DFAA 2J8GA 3U0PA 2WBJD 4N1EA 3IJSB 4S3JA 4Z95H 1SYSA 1XMWA 2ICES 3WUWG 4PJHB 3H9ZA 4OTXH 3KAAA 3BVNA 3CNKA 1RIVH 4F37F 5I5RA 1JTOA 5T1LB 1NBQA 2V7HA 4APQD 3T77B 4OZIE 3QXWA 4Q0XH 3H3PH 5CP3H 4HQQH 4JPIA 2ESVB 3FZUC 1J88A 1U8HA 5LJYH 1A7QH 1NAMH 4AEIL 2OP4L 3HJEA 1I7UA 2A83B 1WP6A 4ACPA 2B4CH 3II1A 1DVFB 4NP4L 5JHDA 4NQVA 2DBLH 4JDVA 1A7RH 3ARFA 2HLAA 2B5IC 4G8FB 4IRZL 3HNTH 4PYGA 1VAHA 3T0ED 3BKCH 3VFWA 4PP2A 1EUUA 3HI6H 1EGJL 2WHMA 1V0KA 4PGDB 4IM8A 4ZO6A 4D6JA 3T0BA 3SKOB 1OP5K 3VFPB 1DZBA 3ZDZF 4JZNA 4XNZC 3LMJL 1LDPH 5IFJA 3C5SB 4UQAA 5FHBH 1HDMA 2BC4B 3OMZA 5IG7B 2VABA 4KQ4L 2A73A 4NQDE 2XJ7A 5C9KA 4QGYA 4BZ2L 1A3QA 1GXEA 2A74A 1GNXA 3GMNB 3RGHA 4OZIF 5J6HB 4MZ2A 3D2UB 5HI5C 1JFQL 3CXDL 4NOFA 1DE4B 4IMKC 2DJUA 3NJ3A 4X5WA 4I9WD 3ZKXC 1R5VA 4Q74A 2WBGA 4PTWA 3JWOC 1MRCH 4C7GA 4Q6YA 2YS4A 4YFLF 4NHUB 3UTTB 3WEZA 2DB8A 2JJVA 3MRFA 1T1WB 4OGXH 5DFVC 4Z0XB 2FX8L 1G7HB 2HKFH 2MJWA 5B3NA 1VKXB 2Q8BL 3H9SD 4JVWA 3BRDA 1NQBA 4PB0L 1QRNA 1QZ1A 2CPUA 3HMWL 4H5SA 2EADA 4YC2B 1QRNE 4O51B 5HHPB 2EIZB 4TUJB 1G9HA 4ZUTA 2V3EA 1FE8H 1J12A 2E7LA 1FJ1A 2GY5A 2J74A 1J18A 4MD0B 1A6TA 4X4XA 1F5WA 1MSPA 4PGJA 3DPBA 4Z7VB 4WEMB 3HNSL 3S96B 1NMCB 1N26A 5A8OA 4PLOB 1BZ7A 4HZ8A 4NUGL 4OQTA 3T2NL 2K9UA 4XWGH 1A6AA 1P1ZA 2X4PA 1UZ8B 2SEBB 3O11A 5FGBA 1HJWA 4WCYH 2X42A 4JL1A 3DMMB 5DEFB 4YIQA 4IUGA 4WKHA 5AG9A 4F9JA 3DROB 3EOBA 5EU4B 4JHOA 4E41E 3BAYA 5BRPA 2OZ4H 2YD6A 2HVMA 4LSVH 5AWNL 2FO4A 1RULH 4HWUA 1EFXD 4DWSA 3KYOA 2RFXB 2AQ1A 3FTGA 4PGCA 2WZHA 3QULB 3GSQB 4C58B 4Q0XL 4IDJL 3QCUL 4X6CB 5ABHA 2MQ0A 5GRUL 1IQDA 4L3CA 4HLJA 3ULVL 3GH4A 4AZ7A 1RP8A 1AO7A 1KJMA 4PS4L 5HVHC 1EEUA 3MFFA 4NQDD 2JIXD 3PZVA 1CL7H 4WW1B 5GHWL 4UV4H 5CUSL 2DM2A 4HZAA 1AH1A 4UQ9A 1HHHB 3VWJA 4JR9H 4MJIA 4NJ9H 4WU7A 1VFBB 4LRIC 2P42B 4ONHB 1S5HA 2AJSH 1RUMH 4PJAB 4KMQA 2E4TA 1WFTA 4TSBH 5IMKB 1IVLA 3C60C 4KVNH 5I1GH 1NFDE 4QF1B 5D1QD 3QUYD 5EU6D 5T3ZD 4OOZA 5I1LB 2GJXA 4V2BA 3TN0B 1QRKA 1TVBB 4L8SA 5D7LE 1EJOL 4EI5B 1V7NH 1DQLL 2XZAL 3MBXH 3P40A 1ZANH 2X4SA 2HJLA 5BXTA 4NKMB 1VDGA 3VGDA 2HFGH 2C8NA 4NZJA 1MCOH 3CXHK 4JFEB 3F5WA 3IJYB 2HMIC 3WF4A 5F89B 3HE6A 1HT6A 3WFEL 4Z7UB 4M56A 3A4XA 1OTSD 3WXWH 1NGWA 2XWBA 3KYKL 4PFEA 2OCFD 1D5MB 3KYMB 3CXDH 4NKIL 4OUEA 2BVQA 1BFNA 4HG4K 1QTYT 5EBLA 1F3JA 4NQSA 4Q9QL 4Q7DA 1VACB 4MNQB 4AEIH 3BKJH 3TA3C 3SCWA 2DKUA 5AC5A 4MCYA 3VSTA 5BWFA 4F7TB 1IGJA 5JXEA 3HA0A 5BMFH 3RM8A 3LQZA 4OGAD 1KTRL 1NFDF 4ODSH 4YO0A 1DBBL 1HH9A 3BD4A 2OL3B 1DBAL 3FOMA 4NQEB 2EC9T 1NAKL 3EJYD 3P3YA 1KOAA 4GIAA 1U93A 1W72B 1F8TL 3CVIL 3PWLA 5ADOH 1VHPA 3VRIB 4UT6H 1N59A 3DVNB 2C3VA 2C26A 1OARH 4UFKA 3GHEH 2ORBL 4NFDA 3F7YB 2ZUQB 3O9WD 4XPFH 1H5BA 1NCCH 1XD1A 3H7LA 4WI3A 1E56A 1E1FA 4PG9A 5JBDA 2X4UB 3QG7L 1JZ4A 4WCYL 1JF6A 3PV6B 2RIKA 4P59H 2ZXBA 5I8EA 1I7RA 3BZEA 4PTXA 3VXTB 3RVVD 3R4DA 3WE6B 4N0YH 1DWIM 2MANA 2ZCHL 1FVCB 1D9KC 1L0XA 1CU4L 1OQOA 3T3PF 3AIVA 2R9HD 5LA0A 4UUJB 4Y88A 4P9HL 1HHGB 3WF1A 3N0PB 3QH3B 3VILA 4P2OD 4PJDB 1KUMA 1U30A 4QF1A 5J8OA 5SWSD 3GJFA 4IS6A 3D9AL 5E5RB 1S7SB 1FZOB 2C7UB 5IGXL 4LYRA 1V03A 2R0WH 4YXHL 3UJJH 3QHZL 3P77B 3C8KA 1BX2B 3SDCD 3GZAA 2WHJA 2R29L 1KJ2H 3QHNA 4FRWA 1KBGH 4X6CE 5TE7L 4BZ1H 1T6WA 4BQ5A 4A6YL 1YEDA 3GSQA 2I24N 3QULA 3MRMB 3QUMH 4YX2L 1OP3K 5HD8C 3MXVH 1NFDB 5MERA 4UFIA 1INEH 1RIUL 1MREH 3AS2A 2CLZB 2B2XL 1H9VA 2WUBH 1RHHB 2HJFB 4PMUA 3O41A 3PHQA 1HHIA 2X44D 1XYFA 4BFEA 2X6MA 3BZ4A 3IFOB 4HK0A 4NFCA 5F6HJ 1MHEB 4OCXH 4PRIB 5H2BA 1GOKA 3WENA 1L0PA 3GMPA 3D39D 4GW5A 4NKIH 4R90H 2MCG1 1CICB 2EDDA 3VH8G 4YEEA 5LG1A 2R0ZH 2CQVA 3JV6B 2D03H 3S96A 3DSFL 3BPNB 1KELH 3DV4B 5GRZA 3MV9B 3GJFK 4X9BA 5ICXB 3MXWH 5ILTH 1FH5L 2F9BT 5C0EA 3OAYK 3V79C 2RAMA 1QLFA 4XNQA 4LMQE 2B0SL 4U7SA 3LRMA 1R87A 4E41B 4M8UA 5F88B 3ZYJA 5MEPA 4O51A 3A4AA 2B39A 5LXGH 2OQJA 3PJSB 1KTBA 4IRSA 3BLBA 2PWGA 1UD6A 1DLFL 3KPQB 4W86A 5TGBB 4UT7L 3NTCL 1MCBA 3IAQA 3MRFB 1OWWA 5D9OA 5B21A 1B0RA 1T22A 3VA2C 3SGJA 3S6CA 1DSFL 3VH8A 1T66D 1NJ9A 5JQ6H 5BYWA 4AMKH 2F2HA 3MNZB 2VISB 5IW3A 3PWPB 4XPBL 1MF2H 5IBLC 1GIGH 3MBEC 3V5DB 4M61A 1PX4A 4YX2H 3CLEH 3D2UA 2M8XA 4WDIA 4Z2KA 4P2RD 2F19H 2IXUA 2GJ6D 2A74B 5IROC 3IU4L 2A73B 2YPKB 2NLJB 4EXPX 1W0WA 4C56A 1U8JB 3D39B 3LKPB 3L5XL 4DN3L 4HA3A 4LLVA 4LSQL 3VFPA 1C5CH 2DJ4A 4YR6A 4HA4A 3O4LA 5E2TL 2JCCE 2OK0L 1TUXA 2R56L 2V9QA 1QNSA 3MLWH 4YBHA 1F97A 4LVNC 4LIQH 3E2HB 4JFYB 4NZRH 4NC0B 5K9JH 5I78A 3VFWB 4G80B 4OFYA 3AIQA 4Y4HC 1CZ8H 4O2EA 2Q6WA 5L6YH 2NYYD 3MBEB 1DVFA 5D2LB 4BKLA 1EQPA 2PBGA 3KPLB 4V1DB 1QLRA 2JE8A 2GFBB 5E4IA 1T7ZA 2BJML 1KGXA 3BPLC 1MNUL 2ZPKL 4OGXL 3EO9L 3IF1A 1KEML 4PRAA 4HUUA 5SWZD 3JXAA 1RJZA 1DWFM 2LFGA 4JPIB 1KPUA 1Q6DA 3QZWG 2AEPL 3FY1A 4GLRH 1XF1A 3L4ZA 4N9OB 4FQPA 4YQXH 5DJZA 1MCWW 5HVGB 2WHLA 2XFRA 1TZGL 4JVUA 4DVRL 4Z2HA 5MENB 5CZXC 3CBWA 3TNMA 1BM3H 3D5OF 5J4MA 4HS6B 4OF3A 3PUCA 3MBEA 3DX8B 1ZWIA 2W65A 1BAFL 4R4NC 5TH2B 4R0LC 3U82B 2HFFA 1IEAA 3I6KB 5IVZA 3JUGA 3O2DL 1MCCA 1UKPA 4FQ2H 4Z77B 2CETA 4JFYA 2ZIDA 3TYGL 1X5YA 3M1BA 3HTLX 2G3JA 5IB2A 1WITA 1HXMA 3STLA 4BK5A 1K9DA 2IQAB 1CXIA 1QBBA 1AIFB 3PWNB 2V3FA 1M7IA 1C91A 5H94A 5L0QC 4X6FB 1TETH 1W0WB 2EPKX 4AXNA 5J6GB 2NZIA 5CBEB 1T20A 4B3KA 5ALBH 4O02L 5EZIH 2GKIA 7A3HA 4DGIL 4BQ3A 4K94L 2NY0D 4X0NA 4JZOA 1MCIA 4MAYC 1BGGA 3GXTA 1K4DA 4J4PC 2RGLA 1JRHL 4X7FC 4WO4B 3TVMA 1YDPB 5KTEH 1KIPB 1OGGA 3IDXL 1AR1D 4MWFA 4MDOA 3HC0B 1T22B 4KQ3H 4P46C 3AIWA 2J8OA 3AB0B 3TCLA 4GZJA 1SHMA 7FABL 1E6QM 4UTAH 1B9ZA 1NC4B 4X7SH 1MJ7H 1LNUA 4S11A 4PD4J 3ZTNL 4IRSB 3UPCA 1YC7A 2WHKA 4ATDA 5T1MA 2XVNA 3LCYA 4TVSa 5F88A 5MEPB 4E41A 4PN2A 4FG6C 4GAGL 1IM9B 5F1SA 1LL4A 1XD0A 1X3DA 2NY5H 5C0EB 3U7YH 3HZKB 2VDML 2XN0A 2XHYA 3MV9A 4OSUL 1BQUA 1QW8A 2L7JA 1UR4A 3MODH 1SYVB 4JQVC 2E7HA 2HH0H 2W60B 1NGYA 4I18B 5C0AA 3KE0A 5I8OH 3N15A 3OX8A 1UWXK 4C4KT 4X6BB 2WIIB 2J88H 4YEFA 5JDJA 4K3DL 1KTDA 4U3AA 1CIDA 1GQKA 1KNOB 2WVUA 1T66C 4ALAH 3JVGC 3QFJD 4DOHE 1YEIH 4JFZH 3BP5A 3EOTH 3O41B 3PHQB 4KKLD 5GSVA 1ZA3B 1VEPA 2ARJB 4NRZB 5EOCL 4OV5B 2D23A 1NPUA 3L6FB 1NFDA 5EU3A 1A4JB 1X6NA 4I8DA 5AWNH 4ERSL 1MIML 3MRMA 1NWSA 4XUYA 4NRXA 2NCMA 3GXDA 2ARWA 3T4YB 3Q2CA 2L7UA 5CFHA 4RFOH 5DRZB 4RSVA 2XYCA 1JWUB 3ZR5A 5ISZD 1NC4D 3MOAL 5ESAA 5HDBE 2PXYB 4LNRB 2AXFA 1F6AA 4HMEA 4TVDA 4KROC 4JO2H 4GSDL 1TVPA 1BX2A 2R0WL 2V6HA 4U6VH 3UJJL 2PTTB 4YXHH 4UTAL 4R26H 5JR1H 3A6BH 1IKNC 4M7ZC 3WUWA 5HOSA 4F7EA 3VFTB 4G8GD 4R3SA 2DD8L 5EIIB 4FXLA 1H11A 2ADGA 4HPYH 3BZFB 3FNDA 3KLAA 3FQNA 1LDSA 1MY7A 1WBXB 2R56H 4X6EA 3RU8H 5IB5A 4PJGF 1MJJA 2UY2A 3D18B 4YFLI 3TZVD 4JKPH 1WZ1H 1OW0A 5DJXA 5EOQH 1E28A 3INUL 1JPFB 2A1WH 4HV8B 5F9OH 4KJYA 3O6KH 1HCVA 3BLKA 1IGML 3WE6A 5KSUA 5KOVC 4GO8A 4ONGL 1WIPA 1G7LB 2J8HA 2X7LB 1E72M 3SOBH 4YWGH 4X8XA 5DD6A 3TGXA 5JIPA 2JF7A 2R0KH 4X7TA 3TBTA 4AL8H 4PJBE 4LQ1A 3SKNA 4KI5D 2Z1KA 2ZPKH 4WUUE 3LSOB 4MAUL 1H5BB 4KJPD 5BXRA 4NZCA 1V3MA 5C0BB 3F7YA 3EDDA 1WV7T 2ED8A 1CTOA 3DXAB 3G9VA 5C3TA 1UWTA 2NY1B 3DVFA 4FQHB 1R33A 1CD8A 4X4ZA 3U4BL 4RNRB 5EA0L 1OGTB 1U8KA 2HFEA 3NN8B 1JZ6A 3S34H 5GS0C 3ARTA 4H26B 4UZGA 4ZFZA 3WLWC 2OSYA 2B5IB 3WH7A 3MRPB 5FV1L 1HNYA 4NWTL 4NQEA 2OL3A 3FOMB 2BNUB 3H42H 4EN3A 1DBML 4NO2A 5F7EL 1HKJA 3OLDA 5ACMA 4OV6F 1BQCA 1MCHA 5DMGC 1IGJB 3BXWA 3TC9A 2XFXB 3CC1A 2J6EA 3T04D 32C2B 1QNZL 4QRRB 1HILB 4L4PA 3G6DL 3P4NB 5EBLB 2YKLL 3RUGF 1E1EA 2QV4A 4EDWL 3IANA 5ID1B 4YJZL 4AEFA 4D0CB 4NKOB 2BVQB 3CD4A 3N18A 1WIOA 4OF6A 4LSSH 1K8DB 4Z8FH 3VG0H 5D71L 3VINA 1RIHL 1TQTA 3W24A 3QXVA 2QHRH 1DUZA 5D2LF 5I76B 4P2QD 4JFEA 4M8QA 3SE8H 3I3EA 5FGBC 2ADIB 3WIHL 3CFEB 2PW1A 4OTXL 3W5MA 2C0HA 2BNQE 5BZDA 3K3QA 1A9EA 1BBJB 3L5JA 1HXYA 2WBJB 3LQAH 4ZE4A 3H7BA 3F58H 4KI5E 2V17H 3GRWA 3AJ7A 2DQCH 4PRDA 1CK0H 3SDDD 5DHYA 1HSBA 4JR9L 1XGQA 5HSFA 3H9SE 1FH5H 1KCSL 3JUYA 5DYOA 1IZKA 1LO5A 3VWJB 4BQBA 2E7MA 1QFPA 3DGCR 2QMJA 4X99A 4OZIA 2YFOA 2V5DA 1QKZH 5I0DA 3PZNA 4XVJH 1DANT 3QUYB 5EU6B 2WV3A 4OLEA 3WLBB 3LEXA 3UBXB 4BH7A 4QTHA 3QI9B 5T3XL 2JIEA 3VIMA 1KJMB 1DVFD 1KTLB 1JJUA 2GITA 3MV11 4HHAB 3HPLB 4GRLC 4RDQG 3ULUD 3AMDA 4WENB 3TNNB 3T1WA 4G9DB 3FTGB 2RB8A 2VDKH 3MRNB 1OM0A 2BY0A 2CRZA 1QO3A 1JNJA 4BA8A 4DEPB 1KIQA 1MHCA 3MXVL 2P7TB 5F93C 1AGCA 4QNPE 4LOUD 5EPMB 2XKUA 3MMEA 2CYGA 3F7QA 4YIQB 3Q6FB 3DMMA 3MMWA 5A8PA 4TSAH 5GS0H 5IWLC 2A77L 3IS1X 1H8OA 2SEBA 3O11B 4PJCE 1A6AB 2X4PB 3CMOL 1A3RL 3QZWA 4QLLA 1CLCA 3T0EA 2MCPH 4NNPL 3IS0X 3NACH 4WWKC 3SBWC 4NO0A 4PRWA 1A1OB 1MFBL 2VDPH 4Z7VA 4PJ7B 1S7QA 1FLRL 5E9AA 1JI2A 1EHLL 2UUDK 4F15C 3GJFH 5ILTL 2FYYB 3RZCC 2Y6SC 4DQOL 1B0IA 3ARSA 1JV5A 5DHVH 3UMTA 3W37A 4HXBH 4PG2C 2DLEA 4J23A 1LL6A 5DC4B 1JHTA 2HRPL 3FO0H 1IFHL 3MNWB 1S5IL 1Q9WB 5FYKH 1BD2A 2P43B 3RWIB 3W9DB 4AIOA 1TA3A 5FYKU 4GG6E 4ELME 1WO2A 3T0VA 2V2TA 1KTKE 2KH2B 3UTTA 2DM7A 3DGGA 3MJ8B 4W87A 5INCB 2J7EA 5FL0A 3CZEA 4HBCH 4WUUD 3UTSB 4TOYH 3VWKA 5J6HA 1WAAF 1Q9OB 1EX0A 2DH3A 1ZA6B 4DKEL 1VADB 5DJAB 2BC4A 4JG1L 4YNYA 1OGAB 3MX0A 3C5SA 4N8CH 5CEZH 2MQ3A 1OB1A 2IFFL 4N5ED 4HWEL 3CMOH 3SKOA 3BPNC 3I9GL 1JF1B 4NN5B 3BN9D 1UB5B 4TYUA 5DF0A 5IF0B 2MQCA 1UZ4A 3GUTB 3UXFA 3GRWL 3MJ9H 4FZEL 4UI2A 1MWAH 1ZT7A 3D0VB 4H1LG 4LSRL 5A95A 5CBAA 1EHLH 4G8FA 4NZTH 1Y0LA 3DTXA 1OOAA 4JDVB 4GRWE 1WE5A 4NQVB 1J87A 5KW9L 1QG3A 1SJEB 5CD5C 1E5NA 5DMGD 4LHUD 4WGVB 2B1HL 4GKLA 5I75B 2O5ZH 4ODUB 1RJYA 4HU8A 1T21B 5KSBF 2DS4A 3QUML 3EBVA 1OSZA 4HT1H 3RCNA 2DIJA 5A1AA 1FFOA 3KR3H 3O45B 5C0JB 4XXDB 1MRFL 2DF3A 1U36A 1G6RB 4F7CA 2LVEA 4P7OA 1QBMH 3AICA 1YEKH 2A38A 4G6JL 3P4OA 3QQ3B 2HN7B 3D85A 3GDBA 3RTQD 3U0PB 3D0LA 3FN3A 4HAFA 4TOYL 4X8JB 2E9IA 3A21A 1B3JA 3FB5B 3SCMA 1H3VA 1RPKA 4Y5VA 1DFBL 1ZGLM 4U1MA 5J9PB 1R3KB 3IFNH 1PGRB 2F8XC 2ZG2A 3O2VH 2DLHA 2IAMA 2W92A 1FNLA 4PBXA 4CMMB 1NCNA 2W0PA 1RAMA 5DQDL 2HMID 4M6NL 5EIQA 3MO1B 3E2HC 3CUJA 2NW2A 1HYSC 4HKXB 3B9VA 4DKFL 4ZFOL 2Y1VA 1NGPH 2PYFB 1MJ8H 1WQVT 3WBEA 4ELMF 3C6LC 4JJHA 3P9MB 4OGZA 5BRZB 3FONA 4HG4J 4NNXB 1W8NA 3O3EA 1I7TB 4U1NA 4APQC 1S9VA 2EDOA 5E1QA 5HHOB 1ZS8B 3IDIA 3DIFA 3PGCB 5KW9H 5H35A 4NUJB 4WHCA 2R4RH 1W91A 4IOFC 3QO0B 5FYLD 1A7QL 3O0RH 2WP3O 3IFLL 1BFOA 4LCIH 4PRBB 4GKZB 3ULVE 1RI8A 1JGDA 1OARL 3QRGL 4PMDA 2V5TA 4X80H 2I07B 4LPCA 2FIRT 3QHFL 4NM8L 1EFXA 3BD3A 1KB9K 3RPIA 5I79A 5CLTA 5L7XH 1WBYB 1NOUA 3RILA 3LVEA 1IM3B 4Z0BH 2BSRB 4Q6IA 4XCEB 4OCWL 1I1AA 5T3ZL 1KN2L 1NP0A 1LO4L 1T1XA 3H9SA 3GSOB 2Y5TA 1EO8L 3FN0L 5BROA 3W39B 5I1HH 1XGUA 4HIHA 3UX9B 4DVBB 3KLHC 1F58L 3AAZA 4K8RC 2DLFL 2NT1A 4ZOCA 3SDDA 3WN5B 3AMGA 1HCFX 5BXPA 4JG0L 4P48A 2M26A 5J13B 3V0AC 3TO4D 2R0LL 4UOZA 5IFTA 2EYSB 3QJFB 2QLYA 3RDTC 1XH2A 2PWDA 3L4XA 5KSBE 3SE8L 3VDHA 4ZUSA 3FO0L 1P2CA 1MRCL 3QJHA 2YD2A 1NDGA 1GHFH 1MEXH 1RULL 4WV1C 4MLIA 2DIBA 4HJ0D 5D70L 1VJZA 5HYJA 4XZUB 1T83C 2GJZA 3U6RB 1U3HB 1UFUA 5DSCA 1HOCB 3NZHL 2AKRB 3CPUA 3FOLB 3VXUD 4UQ3B 5B4MC 5D1ZB 2P24B 1YUHA 2VLMD 3QUZB 4PS4H 2H3NA 4OD2A 4F9DA 3E3QE 3U4BH 4JO2L 5ITFA 3MOAH 4KHTH 1N7ML 5FB8A 1DHKA 1RUML 4YXLL 5EC2A 3DV6A 1XR9B 5IW6A 1JNDA 4OIIH 1PYWA 4EI6B 4JB9H 4HS3A 3PZMA 4KPHL 4YUEL 4KUZH 4PMNA 3MRCB 1QBLH 3H3BC 2OSXA 1JNHA 3DUUA 3B2VH 2YSSA 4QRSB 4BFGA 1QQDB 5FIPA 1MAML 3SO3B 4U1HA 3OPZL 4Y5YA 1FO0A 4U5IA 5CKGA 1U8MA 3S35H 1NL0L 3SE4C 4TVPH 1OTTD 3UG3A 3HR5B 4KJWC 3ZHKA 3IXAA 1Q94B 2AJYH 5E24E 1RZGA 5HYIA 4YBLB 3CVHA 4W85A 4MNKA 4M3JA 5DTFA 2NY3D 2MWCA 4MAYB 5D1XD 5FL1A 3QWOA 2BOBA 4LCUB 3RA7L 1QUNA 15C8L 5JW3L 4YHIA 1I9IH 4DGVH 1UCTA 3PXJA 5DJ2B 2WWMC 4NO3A 3O6FA 4R4ND 5CEYB 3ULVC 3UG5A 1XT5A 3F12A 3F5LA 5B22A 2VL5B 3EJRA 5I1DA 1JNLL 1NBYA 4WI5A 3ROLB 4ACZA 3OL2A 3QUXB 1HP4A 5EDXA 1EOKA 4OBRA 3L3HA 1RUPH 4PR5B 3LRKA 4JGMA 3NH7H 2VUOA 1LK3L 4MNHA 4OZHF 1I3VA 4FS0A 4Y4FD 5FA4B 1CFQA 2FECL 4ATWA 2F19L 2WC4A 2HT3C 4KI5F 5DFWH 5DJYB 3RVUD 2E6QA 1B2WH 3BT2L 2VDMH 4QOKB 5SWSA 1WCBA 4JFQB 4LKCB 1G7PA 1FAKT 1QBLL 2EH8L 4JM4L 3QPXL 3NSMA 1L7IH 3SCTA 2YXMA 3FRPG 2BXZA 2VLRB 1MI5D 3S3SA 4NO3B 1JWSB 3L3IA 4DGIH 4DFIA 4M6AA 1CGWA 2Y8VA 4TUOB 4P5MA 2VERN 1PJ9A 4NHCH 4R2GC 4AQ1B 1EMTL 1L0QA 1N0XL 2FB4H 4C4KO 1NSNL 4M1RA 2VDQH 3QWOB 5HYJE 4UQEA 5A6AA 2A9NL 3NCFB 5E2JA 3OAUL 4P2RA 2NR6C 1RZGB 3BMVA 4WU5A 2PWHA 1MWOA 1XIWA 4D8PB 2JF6A 1REIA 5MHSE 3ALFA 3NA4A 3QUKB 3O4LE 4LLUB 4L3AA 1FO0B 5I8OL 1C3FA 3MBED 4QRSA 4TNVK 5JW4Q 1KG0B 1NAML 2PXYC 4FQIH 4PLKD 5D72L 1RURH 3KL0A 1WDPA 2PR4H 4K55A 4HS3B 2OW7A 1N6QL 5SWZB 3JUZA 4XVTH 1P53A 3DV6B 5IW6B 2XUCA 4I13B 1RK1B 2AJZA 1IKNA 1NUNB 1T5XA 1H2JA 1CBVH 1UD3A 4JPWH 4NBYB 2BNQD 3ALXA 3T1FB 3EJJX 1Q0YH 3OAZH 3LPOA 3LS5L 2F74B 4V2XA 1FLTX 1IC4H 5CXPA 4LLDA 1NGXA 4FQ2L 3VFOA 5DRNA 4ZS7H 4ZNEE 3WH9A 2WWKO 4OLVL 25C8H 2NY5C 1FYHB 1INDL 4P23B 3RY6C 3OV6A 43CAB 2XTJE 5E1AB 1NFKA 3N11A 4OCYH 5BS0A 1D5BA 1J01A 3HE6C 4KI1A 4ORGA 3W11D 2I60L 5HHQB 3QEHB 3P73B 2R2BB 3UYRL 2XG9A 3GEWB 2OTUB 3ARDD 4HPYL 2DDQL 3WXVL 2BMKA 4PUDA 4WWKD 4Y16D 4KHXH 1OLLA 2Y36L 4XNMB 2MCPL 5D7KD 4HCRH 3MROA 4RMSA 4V2CB 5KJRH 1A3RH 1JD9A 1Z9LA 4L5FL 1U33A 4K3JH 2NY0B 2BSTA 5EBMB 2NSXA 2JIWA 2VZ1A 2Z92B 1BVZA 2ZUUA 3R1GH 2E7BA 1B3ZA 2Y5TB 1OD8A 4AD3A 2R2HA 2JCCB 1FV1B 6A3HA 3DUSA 4HIJB 1FGVL 3U30C 8CGTA 1V0LA 3MOBL 5GRVL 4N0UA 4JJ5A 1XZ0A 3JSSA 4M5YL 2CKNA 5DJ0A 5HDRA 5CEXA 5A6KA 5A6JA 4OZHA 2CXGA 1AQDA 5EB9A 3NTCH 2VXTL 3BESR 4S1RH 2TAAA 4ORZC 2AK1H 3P9LB 1NMBL 4OM0L 5BZWB 5CCKL 1W9XA 4BQ8A 5DUMH 2VAAA 4UINH 3DX4A 2GI7A 5H35B 3TO4A 1BVLA 4ZTPL 5DDHB 1PZ2A 5I1AA 3ALGA 4DKAA 1DWHM 4FFYH 1KCLA 1T2JA 3AREB 3HFMH 3GXFA 1HHKA 1MCNA 4YC2C 5ALCL 1G7JA 2BZDA 1CF8L 4W8AA 2B4CC 3BP6B 3SCRA 4B7IA 5E5MB 2NW2B 2E9BA 2CJUH 3ISWA 1GUVA 2J5LB 1IJ9A 1EEYB 2IH3B 1WLHA 5IHUL 4R2GD 2DI7A 5JXAL 3VXMD 1OP9A 1KLUA 3M6DA 4NC1C 2J1KA 5TE4L 2UWEE 4U7MA 1MQRA 4C56D 3PHSA 4IIQB 3NA9L 4BFIA 2JJTA 5ISZE 4HXAL 1E43A 5TDPA 2FH6A 1R46A 2WVTA 5B38G 1XCTA 4S3KA 1X5LA 3LPWA 4NC1E 1S7XB 4RX4D 2G9HA 3DURB 5B3JF 1RQ5A 5ANMB 5C07A 3LZFL 3BUTA 5F7LB 5EZJB 3UZVB 1GZQB 4U5KA 3OKLA 1UWUA 1U8PA 1A6VL 4OKVA 2X1XR 3RWGB 1UA6L 1UA7A 3EJYC 1AXTH 4ODXA 2YA1A 4GS7C 2EQDA 3ILQC 1R3JB 4ZAKD 2GCYB 4HC1H 1BD2E 4ONFL 3U30B 1Z3GL 1X7QB 3QFJE 4YBQC 3RWGA 5DZOA 1TPXC 3TIEA 2Y06H 4G7YH 3UROR 1Z32X 1GZQA 4UDTB 1YNKH 1D5XB 3LN5A 3STBA 1BZ9A 1DQDL 4IRZH 3SCPA 1G1CA 3BWUC 3HZMA 4XNXL 4DZBA 3ECQA 2OWCA 4MB3A 1PQZB 2XVPA 1A1NB 1NBVL 5EH1A 5I1KH 4IIQA 1R85A 1F4YL 1UB5A 1T3FB 3VXUA 1KLUB 4MAUH 3FQXA 1ISYA 3UDWA 3MGOA 4Z7UF 3BDYL 1H4PA 4KJWD 1ZMYA 5I1CH 3PQYA 1OGAA 3ZE1E 4XV0A 5DJAA 3JV0A 4MLSA 5BV7H 4XP9H 1D6VH 4TSCL 1BWWA 1Q9OA 1SJVA 3TESA 4KJQD 3QRFM 2NXZC 1HHKB 2A6IB 2BHZA 4MJ2A 5D9PA 2GYSA 1RZFH 5J89A 1U8IA 2QTEA 5DDHA 3OF6D 3BE1H 1MAJA 2FJGA 4RWHA 2VAAB 5INCA 1UQSA 5CD3B 1JN6B 2J6EL 4P46A 5K59E 5BZWA 3IDMA 2V2TB 4RGNE 2X4OB 1UASA 4Y5YC 3MCKA 5IWLA 2O9OA 2YDRA 3VKKA 1TA3B 4ZSOB 3CVHH 1Q1JH 4NT6A 1AQDB 3A6OA 4WUKH 2D3LA 5CEXB 4PGBB 5F70A 4M62L 4JAWA 4EVNA 3U0WH 1XZ0B 1SJHB 2A0LD 4JJ5B 3AXIA 4GBXC 3H55A 3PZGA 5A69A 2IPUK 1UR1A 4JY6B 2YK1H 4G6MH 4KRUA 4KDVA 3BSZH 4LRIA 2F58L 1RZJL 4JQIL 4K3EL 4IOIA 1CL7I 5ISZA 2NQCA 5FOBB 1EXPA 4OOUA 3HC3L 3NFSH 1A3LH 2GW5A 5CSBA 3MPCA 3ZJ7A 1M7DB 2UYLB 1QEWA 4OCSL 5KZCD 1D6EB 3HNVL 3BRGC 4LDLB 4MS8C 1VRXA 4QAWA 3T0EB 2FSEB 4R9HA 2UZXB 3KPRA 5ENWA 5I1EL 1RZKL 4P4KB 3F6LA 4P5KA 1L0YA 5ICYB 4AWEA 2OTUA 1IQWL 3Q6FA 2W9EH 5KOMC 5C08D 3GSNB 5I6SA 1OTUD 5HHQA 3RDTB 1C7TA 4Z76B 1F02I 3RX7A 1F8TH 3CVIH 4Z7VF 3NCYS 2QSTA 3N85L 3DBXA 5KN5A 1YEEH 3MRNA 4H0IA 2J3SA 4LLYA 2V9RA 4GBXD 1RHFA 3CZLA 3BPOB 1KJ3L 4PIRF 3HPLA 1CICC 5ABFB 1X6LA 1AFVL 3KVQA 1MQ8A 1H0IA 3QI9A 1BIHA 4MXWL 5D6DA 2A3BA 3TM6A 1ERNA 3Q5OA 1MCQA 1QFUL 4R4FL 1RH9A 2ZWLT 1HTYA 3WJJA 4PV8A 1JHKL 4L1HA 5FYJE 4KKBD 1RK1A 2AJZB 3LKRA 1LO5B 4D0DA 2Z93A 1EERB 4N8CL 4Y19E 3O9WB 4ZPTB 5I16A 1Q9LB 4NCC1 3QIBD 4AJ0A 1PG7L 3GMMA 4XAWL 3QUMA 4NZUH 4GH7B 3H8NA 5SX4H 2XTKA 4KJQC 2WBJA 1JGEB 1ZT4B 3BCFA 2DL2A 1FNGB 4LLUA 5BZDB 5I6XB 5I2IA 3HB3C 4FTVD 2ADIA 4WU5B 5HGBA 5D7LD 5D7SH 3ZMRA 4YHMH 1T6VN 2A3HA 3JV4B 3L9RA 3GSXB 4JEGB 1G84A 3MSPA 4ZQKA 1V0MA 4P5MB 1F4XH 3DHUA 1HHJB 1N64L 2VR4A 4HBQA 5BXFB 4ZO8A 4WI9A 3L3IB 1YYLL 1OTSC 4D0CA 4BH8A 2VLRA 1F90H 2KDGA 2PETA 4K23H 3EYOA 2DMBA 5GGTL 3CC5B 3W4RA 1CGUA 2NT0A 1LO0L 2EEAA 4U2ZA 1MWAA 1A0QH 4OD3L 1NCWL 4RCAA 2DPEA 4HDIA 1C8XA 4UTBL 4YDJA 4Z0BL 4QOKA 2OI9B 5GGRA 3I84A 4FQJH 4F9LC 5IHBA 5KVDH 5D7IF 3N9GH 1JHKH 1KCVL 4AW7A 3GK8L 4BSVA 5IHRA 3DX7A 2CD0A 1FG2A 4GG6A 1D9KD 2WSKA 1LJYA 2GFTA 2R23A 3ALWA 3MRHB 1NDMA 1BVKA 1XCWA 4Q97A 4HJGB 1CT8B 6FABH 2Q7YA 4DM2A 4JFFB 4HZ7A 4KKNA 3W2DH 3X14A 4FQHA 3ARWA 2NYYC 3DRTB 4H88L 2VX5A 4JRWA 3A4WA 5IBTH 2GSGB 5AUMB 4PRID 2EAEA 4CUCA 4PJ8B 5JO5A 5T3XE 3O9WC 2XTLA 3P0VH 1IQWH 1YEHH 3ARGD 5DD0L 5DD6B 5JW4N 4UDUB 4QXUH 2H6PA 5CAYB 2VE6B 2ZKHL 2WINA 4MJ6A 2J77A 1T5WB 3IXAB 3QQ9D 4JKWA 4NWUL 1M6OA 2EXWC 3K1KC 3WKMH 1WF5A 2CKBA 3N85H 5DRXA 5DJXB 2WKGA 1QD0A 2PB1A 5A2IH 5GRUH 3BDBA 5BMFL 5J57B 2Q8BH 3NUKA 5JHLH 3THDA 2V17L 3QUZD 1QLEH 3NPSC 3DVIA 1FFNA 4CN4A 4O58H 4F7EB 3SY0A 1UKQA 4LHUG 2IQ9L 5EC2B 3WEOA 4PRHE 2MNUA 2ZSVB 5TJWK 5LGJB 1ZEAH 2H2PC 1IBGH 3P4MA 4KK5D 4DO4A 3G9AB 3BAXA 3MSGA 1J86A 3HC3H 2LV4A 4QRPE 5D6DC 4DCQA 4TN9A 1MHPL 2BERA 5D1ZA 2COQA 1JDCA 4TNWF 1MFUA 1K4CB 2EXOA 3VIPA 4M93B 1S7VB 4JPKL 4OF5A 2AKRA 4OBSA 4NXSA 1HOCA 1UH4A 4NZUL 1LL7A 3ILPA 5D71H 2L0DA 4U1KB 5HYJB 1W0VA 1BEYL 1MJUH 5L8LB 3SE4A 4Y1AE 1E6NA 3AU1A 2DSVA 4LSPH 2FATH 3TH2T 1WCGA 1OCQA 3FMGL 3HLAB 4F37K 3E8UL 3ARGB 4IRSC 2C4FU 4LLQA 1TIUA 2OMBA 4GXUN 4N0RA 3VXRB 1TQCC 2N1KA 1QI4A 2WAHA 3RWDA 3RIFK 3C60D 1N64H 2J8FA 1IEHA 1HIML 3NAAH 4YZFE 1BHGA 3F58L 1DN0A 4BQ2A 4YHYC 1YNLL 1PEZA 2D73A 2NW0A 2B4CL 3IAGC 3EKCA 5F9JA 5I3DA 3HZKA 5KVMC 1XGUB 1UWEH 3W39A 3RUGA 4U6HB 5AAWA 4PP1D 5C3LD 5CQ1A 3GSOA 5FYJL 1IM9A 5CPQA 1UR0A 5E0FA 1G6VK 5M03A 1I1AB 3E6FA 1MHHB 5ESVB 4G7VH 2CIPA 4JFDB 4HXAH 4N8VG 1H49A 4NBZB 1IM3A 5DT1H 1WBYA 1DVFC 3SIMA 1DQJB 3DC0A 4M29A 4OM1L 4CN6A 1YMMD 2VRQA 3SDAA 2HLFC 2YLLA 1LDPL 1YY8A 3SDCC 5GGQH 3TCLB 1OSEA 5LCVL 1ZT1B 1IGTA 2DQFB 1KIPA 2ZX9A 1IAOB 2DWDB 4YXKH 5KAQG 3WS3A 1WIUA 3DIFB 2KKQA 3PGCA 1XCXA 5C71A 3MUJA 4XB8A 4NNXA 4U1NB 3S37L 4HWBA 4Z6AT 1K4DB 5DJCB 4Z2IA 3VSUA 1A7NL 5L2JA 1P5VA 3VXNA 4UNUA 3GI8H 5IEHA 3PGFL 1R3IH 2JTDA 3GBNH 2Q8AL 5T3ZE 5IFAL 1Q9KA 1FZMB 2ZUYA 1QFWI 3MV8D 4JGUA 2DQHH 2Q86A 1F2XK 3EYUH 4LCWE 3RNQA 4GRWB 2EC8A 3HCVA 3MO1A 4HFWB 4YDLB 2W9DH 4BCEA 4M5ZL 5F8QC 1DP0A 4CMMA 2IGFL 1LEGB 4LP5A 2IAMB 3S88L 3RTQA 3H3PL 5IB2B 5KSVB 3ARGC 3ZHDA 1FZKA 3NOIA 5HDQH 5IKCA 2AV7A 2R1WA 2P5EA 4GMSL 1UG6A 2IH1A 3QNZA 5B39B 4ZFMA 4X5XB 1KCUL 2ZWZA 2ESVD 2HN7A 3DX8A 1JYWA 3TA3A 4AYGA 4M7LH 3RVUC 2CMRL 2UZYB 1KFWA 1SVCP 5K9OA 5F6IB 4MDJA 4GMTH 2VC9A 4XXDA 4NI3A 3O45A 1AHWA 5HI5D 4UILH 1BIIA 4FP8L 5FM5O 4PRNA 4HUUB 1V02E 4P2OB 2PI6A 3SGDI 1U95A 2YUXA 4OGAC 1CNVA 4JN1L 1GOHA 1W1TA 1LVEA 5GGUA 4J6RL 1I8LA 4YZFF 1ZHLB 2G2RB 4KVCL 3C6LA 2EDHA 3UERA 1YNKL 4OD1L 1UM6H 3QDJB 4Z7WE 4QT5A 5E4EC 3UCRA 3WIFA 4S0SD 4XCNA 5F96L 5CGMA 1Y18A 3G5VA 4OZGB 3TLRA 3AM8A 3IAPA 1GL4B 3OB0H 2BVOB 5CJQH 5F9WB 5CP7B 4UU9B 2FZ3B 4QY8B 4AZ5A 3EYUL 3LKNB 1GVIA 3TA9A 4KKAD 4IRJD 3IETB 2NLJA 3TCXA 2J4WL 3OG2A 3KXFB 4QCIB 1ZA6A 1R5IB 1CFTA 2VDLL 3B9KB 4N0UE 1MVUB 3UTSA 2ZOKB 4YHGA 2JELH 4DK3A 1JWMA 3OKKA 4WFFE 5IK3B 2VISA 2WMPA 2WMJA 4PJIA 4F8QA 5I24A 2LAAA 3V4VH 3DRQB 4EK7A 4AEHH 3JWDH 2WBJC 2AK4E 5F9WC 4JM2B 4HJJL 2NW3A 1BD2B 4QCFA 1Q1JL 1WWWX 2AAVA 1JPGA 4QRUA 3JV5A 3EOAB 3HG1D 3NIDE 1U92A 3NIFE 4EBQH 3JWOL 1MQKL 4Z8FL 1SEQL 1GGUA 5IHSA 2OQJB 3PJSA 4PPTA