4CGTA

Deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
678
structure length
678
Chain Sequence
b'DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPADAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 228
structure length 678
sequence length 678
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cgtA01
1KTKE 4NM8H 1BGGA 3UDWC 4MAVA 3VFGL 3UERA 3BUQA 4OOZA 4KAQH 1TQSA 3JUGA 3P0YH 2IJ0C 5J8OA 2GDUA 5DC4B 1YMMA 5KS9E 4PRIE 5IK3B 1D5IL 1ITXA 1S9VA 4FQ1L 3WIHL 3CFBA 1O7VA 4J23A 1TZIB 3WXVL 5F9JB 3OAYH 2FSEA 5C08B 2UYLB 2YDSA 1Z6JT 2AQ2A 5A2FA 1FHDA 5JPNB 3ZYOA 1LO4L 1KLUB 3STZA 1I85C 3L1OL 5C0FB 2IEPA 3IKCA 4RX4A 2NY0D 5HPMB 2NY5C 1AR1D 5HHXL 4GO6B 3JZ7A 3ARBC 1DE4A 3RHWF 3AAZB 3ESUF 3K8MA 1UD6A 3GMOB 2GITB 1UXWA 1EIBA 4Z2KA 4OF0A 1EUUA 4N0YL 1CF8L 2CGRL 1MEXL 2CUIA 3F12A 4XP1L 3A47A 2AERT 2YSSB 5IW1A 1MCBA 4L3EE 3KPLB 4PMOA 2X09A 2ZP0T 1JV5A 4MNHA 2BMKA 4FN0A 2XZQH 4UILL 1DL7H 1UKQA 2DJSA 1QHPA 1QNRA 1KEGL 2MPAL 4OFDA 1QACA 3L5WB 4EN3A 4OLXL 3MA7A 3MO1B 1UA3A 2E7BA 3KNBB 1FVDB 4P59L 5E9DA 4WW1A 3O4LA 5EOTA 4MLSA 4G8GE 4YDJB 1RU9H 2R56H 1P4LA 3SJVA 5I1JH 3WFHA 2YMXH 2V2TB 1F45A 1OQXA 3ROOB 2JF1A 3HZVA 3WHXA 4HX1B 2DS4A 3HZKB 4LVOB 3U4BH 3TBTA 4HKXB 3C5ZD 2O5ZL 4HFWA 5H37G 1AGCB 3BWAB 4KDWA 1IGFH 2FRGP 4O9HH 1VADA 5L88L 5JBDA 4ZPVB 3QJFA 5F93C 3QPXL 2NY7L 2V2XB 2VXUH 4XH2B 4ZNEE 4AM0A 5F9WC 4IIQA 5HI3D 1P7KA 2ZG3A 4PRBB 2D31A 4RGNE 4PBWD 1JZ4A 3U82B 1GPOL 1AGEB 4W6WB 2H45A 1XF4B 4PP2A 1YEIH 1W72L 2X2HA 5HHOE 4NN5B 3SKMA 4U1HA 4JLRA 1IAIL 4ZDHA 1RIUL 4XRCA 4CADB 2GUOA 1REIA 2YA1A 3HZMA 5E70A 5IJKC 3P40A 2AXFA 2BVUA 1XGTA 4GAGH 4LPYA 3QHNA 2NY1D 2WLYA 5E1AA 1DWAM 3B5TA 1K9EA 3EMQA 2BRQA 2QMKA 3U9UA 4V1DB 1HHHB 1P7HL 2OM5A 4NO3B 3MLUH 4KJWC 4TSCL 1DFBH 1NDGA 1A6UL 3KXFB 1K6AA 3UEZA 3FT2B 2E6PA 5IB1B 2UVFA 3GMRB 3WIFB 2FX7L 1CVRA 2NNAA 4Z7WF 3L2LA 4L4VE 1M4KA 1CDBA 4NO0D 3I3BA 4AJ0A 1T83A 1MLBB 1OGTB 2VITB 1M7DB 5EC1A 5MEPB 1E4IA 4NWUL 3SKNB 3BPNB 3ZDXF 5JXAH 2E9BA 1S7VA 2WW5A 3L9RA 3RA7H 1U36A 4A3HA 3CHEA 3V79C 4I48B 1SMAA 2WINB 2XZCL 4UQ3B 4P57A 1EDQA 4JDTL 2PYFB 1FGVL 3ZDZF 4PJEA 4N0RA 4HK0B 4OD3L 4P8WA 2BFVL 3LKRA 5I24A 3MCG1 4GRLB 4OUUB 1C92A 5IB2B 3E6HB 1NFIB 3MV8A 3CVHA 2A3CA 2HLAA 1QNPA 4Q74A 3JV6B 4PRID 1JGDB 5IFTA 5I6XC 4N0FA 4OLZH 2ADFH 3KYKL 4D2NA 2F54B 1LEGA 4PB0L 3U36B 5E4IA 4YDKH 2HKHH 1KTCA 1E4XL 3S35H 2DWEA 4K8RC 4JRWA 1H3XA 3GGWA 3P9MA 2I5YH 2V5TA 5E9AA 1J86A 1B3YA 4B0MM 1JZ2A 1NEZA 2WZIA 4TVPH 1KYOK 2ZWZA 3KZSA 1U8NB 2J3SA 1D5MA 1CL7H 2VUYA 4KK5D 3U7BA 5L9DH 4RISH 1GJWA 4YXHL 3C8DA 5FKAA 1QSEB 3HUJB 3IVKA 2CDGA 3FTGB 4P2QE 2XN9E 4P3CH 4L3ED 3M45A 4K3DL 4NZTL 2BVOA 1B6DA 1KBKA 1DN0A 1KIQB 1N5YL 1JWSB 3AFBA 3P4NA 3P4OB 4K71C 2VDQH 3BAWA 1I4FB 5GGQH 3G04B 5JA8B 4Y5XB 2D7PA 5E94B 3CVIL 3QH3A 5I71C 4JKMA 4KZDL 1E4WL 1U9KA 4R26L 3LKPB 1TZGL 5BO1L 5EZIL 4J2XA 3MUIA 2NXYB 1NJ9A 1TPXB 3Q6FB 4M24A 1WB0A 1RZKL 4PUDA 3LS5L 1KJ2B 3MBEC 4G6AD 2PETA 1WZLA 5E7FA 4G80B 1US3A 4M4RA 1U2YA 1QFUL 3WUBA 5DUPH 4FXKB 1X5XA 3JV4A 2AEQH 3SE8L 1F3DJ 4NQSB 4HH9A 3E3QC 7CGTA 1CD8A 4YHKL 4HLZH 4IRSC 1YEKH 4WRLA 5F9DC 1KULA 5D1QC 4B53A 1L4IA 3LPFA 2CXKA 1UACL 1JHKH 1TQCB 2XYLA 1HJUA 1Q9KA 2EDFA 2L4OA 3U4AA 4M1RA 1ED3B 4JJ5A 3RUGB 4KK5C 1RZGA 8CGTA 3WF3A 4HZLB 1TFVA 3V0VA 3MI6A 7A3HA 4RGND 4OFKA 3GUTA 3RDTC 1WDPA 4NRXB 1QVOB 1ORSB 5HHOD 5TQ2H 3ARDD 1GCFA 5LWYH 1GHFH 4QHUB 1NL0L 3S6CA 3MRMA 3NZHL 3CPLB 3KVQA 3QCTL 4M9PA 5C7XL 1F58L 3QISA 3T2NL 4UU9A 3VH8G 4OZHF 2OQJA 2Q8XA 3WQ5A 1QLFB 3MNVA 1CT8A 3O6MH 2X1IA 3CU7A 4Z7OF 2VN7A 3NGBC 4G6JL 4DW2H 1JRHH 3QIUD 1A8JH 1EK3A 4X6CF 3ULVC 1AIFB 5LQBL 3AFLA 1PFCA 4L4VD 4NJAL 4Y4FA 1H4PA 2Z91B 1OAZH 4GAJL 4NFBA 1NFKA 5GS2H 2CLVA 5E0CA 1RJZB 3T0EB 1UJ3B 2DQCL 1CLZL 3HFMH 4M7JL 2LU7A 2D4DA 4L9LC 3ZO9A 5LXGL 3LEVH 3EJZC 3DV4B 1IAKA 1BTCA 1HNYA 5SX5H 1RPQA 3DX8B 4QOKB 3TIDA 2DLFH 1MRCH 1BEYH 1R0AL 4LCYA 4WKHA 4KU1A 2ITCA 1UWUA 1I1FB 1PZ5B 4ZFFA 4Q2ZA 4PBXA 4X8JB 4L5FL 3VFSA 4EJ1C 4TXEA 4X9HA 4HS8L 3QWRA 5C6TH 4UBDD 3IFLL 1F6FB 4RGNC 3WELA 3H53A 2VZ3A 3EFFB 1AC0A 5DK0B 3G6JE 5GSRA 1HH6B 1EOKA 3W27A 5CWSB 5HPOA 2VDLH 4HFUL 2MCPL 1T21A 1T5WB 3EYFA 4XCNA 5MENE 4GFTB 1MWAH 3MRNB 6FABL 4ZOAA 5IVXF 5CAYB 4OAWA 1ZANL 5E00A 5I8OL 2NZIA 4NSKB 4OCSH 2WC3A 1E5JA 1NPUA 3MLVH 4MX7A 3RWFB 3AHXA 3OIHA 1ZEAH 5A8MA 5JZ7D 1V7MH 3B2VH 1AD9A 1MJJA 1PKQA 2FLRT 1ZOXA 1FOBA 2DGAA 1Q9LA 1ZL1A 4Y1AE 4OZIE 5ICXA 3ZR5A 1XMWA 1DDHB 1X5HA 4ZFGL 2GFTA 1P69B 1YC8A 5IMKB 4PJIF 4LCWB 3SKOA 1NOUA 2XN9D 3AY4C 4XB7A 1IC4H 2CSPA 4OUOA 1KJMB 4ZS7L 4OJYA 4MNGE 4KPHL 5IBLC 4DVRH 1IM3A 2XQBH 5JXED 2P24A 3VXOB 1FZJB 5TE6H 2VDPH 4C58B 3BUIA 3KHOA 4YHPA 3TBWB 4XCYB 5D5ME 3VXSA 3X11A 3MRGB 2RQ8A 1U6AH 3GO1H 1DJSA 1N6QH 3N0PB 4NO5A 1CK0H 4KMLB 4UV4L 3VX0A 1TQBB 4L8SB 4PUEA 1NBVH 2BOCA 3STLB 2I60H 3BAYA 5F7DA 2CH8A 1KXVA 5HHNA 5IGXL 1QSFB 1UH2A 3CSYB 3DVGB 1BIHA 1HILA 4NKDB 4HT1L 1FNGA 3O8XD 1JNHA 2UVEA 3KPPB 3PJSB 4AEFA 4F8TA 3AICA 5E6IA 1J8HE 2DTMH 1ZA3A 2UWEB 4DGIL 2XM2A 3UZEA 4QXTB 4MA7H 3GSXB 2JIXD 2HH0H 3O6FD 3FKUS 1IT9L 1E0XA 4P5KB 3C6LB 3SPVA 3X13B 2ZCHH 1OARH 1XEDA 4JE4B 1WDSA 5I1EH 1W91A 2J4WL 1RP9A 2ORBL 2OI9B 4NN6B 5TD4A 3NABH 2R0ZL 1P1ZA 3AMKA 5JQHC 2PWEA 4JO2L 3GJFH 1TR1A 3LAFA 4X4XA 2VH5L 3P4LA 4XC3H 3ZR6A 1BF8A 1K2DA 4KY1H 5JXEC 2PN5A 3DSFH 4OCRH 5IF0A 1F90H 4ZSOE 3EUUA 4X6EA 3VDCA 3MMEA 4FQ2H 2IPKA 4N9GB 4JAMA 4JY6B 5GS0L 1I1YA 2ATPA 5C07B 1PQZB 2R4RL 4YHML 2H2SD 3OGCA 2YFNA 3ULUL 4WDIB 5FV1L 5CEZH 2V2WB 2BNUA 2APTA 2GSIB 4HPYH 4KMQA 3IYLW 3DIFB 5C0CB 2VLLA 5DJYA 2JJTC 2YRPA 3AJ7A 4ZUWB 1A6VL 5GGSB 3DYMA 4OZGA 4F9DA 4XGZB 3WIHA 2DQIH 4AEIL 3WE6B 3LEXA 3ESVF 3EYVB 3D39A 2WUBL 1MQKH 3PE9A 2ZG2A 4ENEC 4X7SH 1JI1A 4UT7L 2DM4A 1N64L 4M7LL 2YK1L 4CU6A 1Q6GA 1B6UA 1KQYA 3IDJB 1U3JA 4AIEA 4Q9CA 2R69H 4QHKI 4LEOB 4RMTA 1SFSA 3U6RA 5IJKA 3QYCA 4HCRA 1ACYH 3DJ9A 3BVWA 5CS7A 5MEND 1S3KH 2ADJB 5F89B 5HY9B 3DX7A 2X1PA 3ALGA 3FB8B 2PR4L 3CH1B 3GEWB 5JLZA 4TOYH 2O61B 1KPVA 3WN5C 2O5XH 3L3DB 3OKLB 2EDJA 3T0XA 2NQCA 4YFLF 3V2AR 2N7AA 4PJ9D 5KG9B 1ZHKA 3MACL 4Y1AD 3QO0A 1I8MB 4PJ5E 4U1JB 3I6LE 4UDUA 5E8EB 5TE4L 4HKZB 4I8DA 2FYVA 4LBEB 5GRVL 3IDNB 4O58H 1QKZL 3IDUA 1I9EA 4XCFH 4KRMB 4OI8A 3ULUC 2CBUA 3VILA 2P48B 4Z7QF 2B0SH 4AZCB 3W39A 1E72M 3O4LE 2EKSA 4PGCB 5F7FA 1PLGH 1DUYA 4Z2IA 3BAIA 7FABL 5DJ2A 2QSCH 5F7UA 1B3VA 4G8EA 4H25B 4WGVB 5DI8B 3WD1A 2BSRB 1IQWL 4D1JA 4F2MA 1XGUA 4ML4A 1JUFA 2FECI 2JTDA 3BZFA 1E6SM 1PY4A 2AABH 1NFDA 4X9IA 2XGBA 5ABFA 3NIDF 4X7DC 1DUZB 3DWTA 4F7TA 1O7AA 4P46C 1LO2H 4N5UA 2YL6A 1TCMA 1A7BA 2OXGA 1AXIB 3HMCA 1G7LB 1J8HD 3CLEL 4PJ8D 4LSVH 2OCFD 4HWBL 3RGVB 1ODUA 1F6LL 1QRNE 4CD6A 1WICA 4MB5A 5EIIB 2OZ4L 1IZJA 5C0JB 3O9WB 2ESVA 5C0AB 1E27A 3P9LA 3V5HA 5LAXB 5EZOH 3VI3F 4HLZG 2W9EH 3KG5A 3MV7B 3DMMD 5KVGL 5IFHL 5ABEA 4PJ9C 1F4WH 3IDXL 5E8NB 3VWKB 3QGVA 5KJRL 1IC5L 1HXJA 2FWOB 3VIHA 3C09B 1PVHA 1T22B 3DXAE 3RRQA 4WUUB 2JLLA 4NNXB 4ODHL 4P2RE 1S7WB 4PJHE 1QYGH 5BRZA 3WSQL 1QR1A 3KLSA 4HBCH 3PWNA 2BSTA 4ZAKB 2XFRA 4KZEL 4GW4B 3FQNB 2W61A 2J6EH 1MOEA 3V6BR 2ZOXA 1NANH 1S7RA 5FA3B 3IDMA 4XZUA 4M8QA 5IESH 4XMKH 3S34H 4M6ML 3WNMA 3ZKND 3SCPA 3PWUA 3SE3C 3PWLB 3EMZA 3CZFB 4R7DB 5IB5A 3JTSA 4Y19D 3IU3B 2D9CA 4BELD 4QYOB 4H26A 4UT6H 2XA8H 3GH5A 2OR8A 2EEAA 3P9WB 2JEQA 4TVCA 4O2CA 1KV3A 3PHSA 5IROC 1H8SA 4JZNB 2C8NA 1BFTA 3PHOA 1FO0H 3MMDA 4M43H 1JCKA 1F3DH 3CLFL 4YFLI 2IBZY 5FYJL 1YQ2A 2B4CL 3SCOA 1JTPA 1JHTB 2Q7YA 1RJCA 1JWUA 1MAMH 1F8TH 5J6GA 1NC4A 1YJDL 3U83A 2JF6A 4G3YH 5DFVD 1XD1A 5I1GH 5D7IF 4BQ3A 3DMMC 3V7AE 43CAA 3LQZB 4Y2DB 4WHYH 5DD0H 1V3JA 1P9MC 3ALPA 4P23C 4TSAL 3QBTB 4NXKA 3QUZB 3D2UA 2WBJB 3OF6D 4RAVA 4RX4D 4AZ8A 1MCRA 3MLYL 1NP0A 5F88B 1FC2D 4DKDC 1MW0A 4GG6E 1J5OH 1GOGA 2Z31D 2G9HB 4GXVH 4JPVH 4ZMAT 5A94A 1TA3B 1DWIM 5GHWL 1D5XB 3VIGA 4QDMA 4JFOB 4TNVK 4UZGA 2VLKA 1JIBA 1NAMB 5J89A 2IF7A 1SBSH 2X5PA 1CL7I 4XPHH 4YHLL 4R2GD 5F7EH 3LS4L 2WHLA 3WEXA 1HJXA 2E6QA 4PJ5D 4LARL 4N8VG 3ES6A 3I6LD 1JN6A 3B9EA 3QG7H 3EHBD 2G5BA 1LDSA 4L9LA 4LLYA 4NYLB 2ERJC 4I3RL 2DT3A 1IBGL 1F11B 1XAUA 2COQA 4C59B 4B5EA 1EAJA 3WUWB 3O4LD 4KRLB 3BVUA 5EC2B 1A6WH 4EOWL 3AVEA 5FCUL 2VLJE 2J7DA 1AE6H 3WY3A 4RMWA 1T66D 3QHZL 3QXAB 4PCSA 4LYRA 1OAXH 1ZV5A 4FQLL 3QIWC 4N5ED 4E41E 2X4SB 2CUHA 4XWGH 3MRQA 3DHJA 5A2KH 3ULVH 3P77B 5AEAA 4X6BB 4PJFB 1T7WA 2WUCL 5C3LD 2D3LA 3N13A 1TLKA 1VEMA 4QRQA 4L1HA 1TETL 1XF2A 1QRND 3BAEH 1T1XB 3CK0L 5DTFB 3U7WH 1WT5A 1CFQA 2BCKA 2JJSC 2ZJSL 3BX7C 1UD3A 1R7OA 5FAAA 2WVUA 2F7PA 2V5MA 4O2EB 1A3LH 1OCWL 2FH8A 1IGIH 1ONQA 5DJ0B 4E4PA 1MNUH 1UH3A 4GW5A 5BV7L 2VDKH 2EECA 4P4RB 5DJAA 3AY4A 1V6VA 2DIBA 3MROA 4AH2A 3WNLA 2YUZA 4MNQA 1O7SA 2VZSA 3VIIA 3DXAD 1IEBA 2BV9A 1Q0XH 4WV1C 1T20B 4NN7B 4NQXB 4P2RD 5AYUH 4JKPH 1NQBA 1NCTA 5I66A 1INQB 3O2VL 1CXKA 5GS1C 2V9TA 4WJ5B 3UP1A 1I9JL 1QFOA 3EOAB 5I5RA 3VWJD 1UA7A 4Y7MA 1ETZB 4M62L 2HN7A 1T66C 5DEFB 5EORL 1ZVSB 1TQTA 1JRHI 1E3XA 4HBQA 4UFHA 3ARFD 1H2JA 3BJLA 4UOW0 2GT9B 4Z76A 2ZCKL 1B90A 2BRRH 4WI8A 1U8OA 4XNQA 4I2XA 1IFHL 1T4KB 4JQVC 1OWRM 5L2KB 1CDGA 3VW3L 4Q9RH 4FQIH 1XFPA 5HYEA 1BAGA 1KXQA 3BDYH 4Y5VA 5DD5L 1ZU8A 5IIEA 3FO0L 3QUYB 3RWGB 2Y9RT 1UG9A 2EO7A 4MJIA 4JG0L 2EABA 4LK4A 4OGYL 2XNAA 4RAUB 4ZUSA 1LEIB 5E8PA 2DLGA 4YO0B 3TN0A 5JBEA 1N0XH 2VISB 1G7HA 5EN2A 1VPOH 3ORJA 2YUXA 3PV7A 2IGFL 2ILLA 4CDGC 3W24A 2AJYL 2IFFL 2DLHA 1FL6A 2EPNA 1YUHB 1XIWB 5D8ZA 1KN4L 2G75A 3B8SA 1UB5B 3AMCA 2Z1KA 2IH1B 2WIIB 5T1LB 3LRSA 3S2CA 2AK1H 1FGNH 2VTFA 3EJQA 1W8NA 5CIPA 1MY7A 3V52H 4RA3A 5EUOA 3WNPA 3FN3A 4K23L 3LHPH 3QDMB 1NC2B 2JJTA 4R97B 2WCSA 1H49A 1YY9D 2EO1A 1JD7A 3CZNA 5ACZB 3POHA 3VCLA 4F57H 3ARFC 1A6AA 3S4SA 4J8RB 5F6IB 3IJ9A 3SDXB 2YPVL 4LSDA 4QHNB 4KI1A 4BS0A 5HVFB 3O3UN 2DQEH 2Y6SC 5GRUL 5KTEL 1S5IH 2V5CA 2FO4A 4U0RC 3G6DL 2X4PA 4QLLA 3TONA 2EDXA 4YHNB 4LSPH 5A2CA 3EO0B 5CJQH 3NH7L 4PREB 4DK3A 3RWEB 1FYTB 2VLJD 4PR5B 1Z9OA 1NBYB 1TJHL 3TT3L 3TO4D 3GSWB 1BFOB 3FCTB 4KTYA 3CU1A 4FP8L 4RGOL 1BLNB 4KVCL 1IM9B 3TH3T 1VERA 4JFVA 1E0VA 4E41D 4HG4K 2CMRH 4R0LB 2NSXA 5BXSA 4YXLH 2EH7L 3GI9H 1EO8L 1MCLA 4XP4L 2ZSVA 1EGZA 3WSUA 1JMXA 1SYVA 4XAWH 3SCRA 2BJMH 2RGLA 1MFUA 1VFMA 1G0DA 1VFAB 4QXUL 1R3HB 3WN5A 3BEVB 4KH2A 2A3AA 3MRPA 1IAOA 3GXFA 4HJGA 2R2BB 4Z0XA 4RFOH 3V0AC 5BMFL 4LSSH 3DRQB 4RRPG 1YEGH 4BSJA 5FYKL 2APWA 2B1AL 2X70B 2X4QB 2UUDK 3U0WL 4MZ2A 4AD5A 1QUNA 2R0LL 4XP5L 2RGMA 2MKWA 2R29H 3QWOB 1UJTA 3F7YA 3UTPE 4K3HA 1MFEL 3KYMA 4JR9L 3MV9E 3CD4A 3OHXB 2CLZA 2XG4A 4IOFC 1WWAX 1KB5A 2DL2A 2DH3A 4UQAA 4QP0A 4YHGA 3W11D 4WHCA 2PF0A 4PRPA 5D2NB 5ABGA 4ODWA 5KVDL 3K46A 1E0OB 4DCQA 5H35A 2X1QA 4W81A 1A02N 1A4KB 1JVKA 5TF1H 4YDLB 1YEFL 1KCKA 5DHVH 1X5JA 4NUGL 2ARJQ 2OSYA 3SIMA 4OZGE 8FABA 3ZQ9A 5JDSB 3SURA 1XR8B 4G6FB 5J6HB 2WMHA 1ZS2A 5HDRA 1T1WA 3AIQA 5F72S 5JQ6L 3BDBA 2FIKB 5JNYA 5TDOA 3AS3A 1OM3H 2BS9A 3FY1A 4QY8B 3QO1A 3BKCL 1AHWC 1FNSL 4RFNC 4APQA 4X7FC 5L8LB 3MOBL 4DN4L 3FQWB 4G6KH 2J8UE 4M1DH 4EI5B 1DBBH 1S9YA 4ZO9A 1UM5L 1I1AD 3MUAA 5DJCB 2XY2A 3PWPA 5BCAA 5FCSH 3TV3L 5A2JH 2A0LD 5IW3A 2MOVA 1J8KA 3QUMH 3H42H 1E1FA 5EU7C 1NFDF 4M5ZL 5IBUG 3PP3K 3JWDL 1WF5A 3QI9D 2QHRH 4OIIH 1KBGH 2OR9L 1A1NB 4M82A 1CCZA 4NHUA 1MAKA 2FNBA 4QRSA 3ZTJH 5AC5A 4D72A 4HS3A 1LP9B 2DRUA 4XBPB 5F9OH 4LDOB 3S37X 1KJ3H 4HU0A 3RL1B 2J78A 1JNLL 4P2CG 1SY6L 1OWWA 1SM3L 1RZJH 4C83B 3VM5A 2EDYA 5JORA 4O2FA 5D7JA 3QQ4B 2XVPA 3QDJA 3W11C 1HKLL 5D6CA 2EC9T 3MUY1 5DEGA 1JFQH 3X14A 1H3VA 3BUDA 4P48A 1GGBH 1EFXA 3EDFA 2NY3C 4MXVF 5EZLA 1CD1A 3WF2A 4OTXL 4K9EL 3MRHB 4M7LT 2OSLB 1X6LA 2DWDB 5IROA 1F6AA 4JM2C 1VGEH 4MDJA 4MMZC 3CSPA 3FB7B 3IAQA 2VZUA 4Z78A 3L4XA 3VRIB 4J3UA 1GGUA 3KPMA 4M80A 4NUJA 4HWBA 4U1SA 5CFHA 2OZ4A 4Q9QL 4PTXA 3VGEA 3O3EB 4P2OA 3AISA 1W0VA 3FO9A 2CIPA 1P9MA 3EGSA 3HC0A 4DWHA 1UEYA 4I0KA 2NZ9D 1U30A 1N4XH 3IS1X 3MNZB 4FQHA 4UUJA 5E6ID 3MXVL 4QF1B 4JFDB 3SCMC 5DWUL 4HS6B 2WAHA 5HVGB 4OCXL 4L3CB 5CP3H 4IRZH 1FH8A 4NQTA 4PRNB 1XR9A 2PTTB 3HN3A 2A6JB 3QA3A 2XFXB 2EADA 5ADPL 1UWIA 2C3VA 3ISWA 3RZCC 1DBAH 5EO0B 2BHYA 5KVFH 4X6FB 4X4ZA 4FFYL 5IB3A 5D71L 3KJ6L 1HJQA 5GS3A 1UG6A 4OLYL 3F65A 5BRZE 1Z9LA 4WWKC 3VRJA 3OJVC 2A6IB 3UC0L 4MSWA 3CC5B 5E5MA 3JV5A 4MJ5A 1PG7X 3UTPD 3TZVA 3BYTA 3MV9D 3V6FA 5M03A 2WSPA 4YX2L 4UI2A 5F1NA 1NGXA 4YHIB 3H9YA 3A22A 3IJYB 5TF0A 4PIRF 1BAFL 4V28A 3ULVF 4LSRL 3BI9X 1MIEH 5KSAB 1NANI 4OD2A 1VFOA 4PGBA 2VERN 5KN5B 3GBNH 4ESKA 1PG7W 4NKMB 2VI0A 2BNRA 3UPCA 3TNNB 5HYSB 5E8OA 1WTLA 3O11A 1YY8B 5C0BB 3W2DH 2JEPA 4LSQL 2CRYA 3WLWD 2YXFA 5CSZA 5DZLA 2PF6A 4GQRA 2EDHA 1QLEH 4P0DA 4PPTA 3SO3C 2KPNA 4BSWA 3O9NA 3K81A 1KELH 3CSBA 2V9QA 3OXSB 1OSPL 2VX6A 1QEWA 5JW3L 4NRRA 2MHAB 3S5YA 1UWEH 4RNRA 2D1ZA 1TVNA 3O4OC 4LRIA 3C5SB 1R5IA 5DF0A 5F21B 1ZTXH 3K3QA 3UJIH 4XNMA 3DHUA 4AZ7A 5JOFA 4HV8A 2HT3D 4HXBL 1TMCB 4L3AA 4JN1H 2PBGA 3PTMA 5IQ7L 2G60H 2V3EA 4EDXA 3FOMB 1CFSB 5EOCJ 2CO6B 2VSCA 4ONOA 4ZNCD 1XH2A 3H9SA 4TQEL 2P5WA 4L8CB 1SMDA 1PZ2A 1XV8A 1CTOA 2VLKE 3L3HA 4J4PA 5GS1A 3UO1H 5FM4A 4U1IB 4AZHA 1EBAA 1XF5A 4QHMB 5ILTL 3IJSA 4Y2OA 2PB1A 4PRHE 4QFUA 1SYTA 1IKFH 3T1FA 1EEZA 4J3VA 5HD8C 3FT3A 4YHYC 3BQUD 4QWWD 3PIQA 1BF2A 3B9KB 3MJ9H 5ECJE 4N68A 3AS1A 3VXRB 2Z1SA 2IWGA 3WFEH 2D7MA 35C8H 3LIZH 1OCQA 3WLWC 2XIIA 3GNMH 2W62A 5K9KA 3VXNA 3QFDA 3KPOB 5DRNA 1JZ6A 1KC5L 3F7VA 3W6LA 3KYNB 4FZEL 5EUKB 1YN6A 3KYOB 3EJYD 1I7UA 2PKDA 4FTVA 4FFZL 3TIEB 1UKSA 4Y4HD 2GK2A 1A3QA 3Q1SL 4S1RH 4R4ND 5E2TL 1F3JB 4A3YA 4HUUA 3AMGA 4MAYB 3L3GB 4XBGA 1K8IB 1NGPH 1X4YA 4U05A 1YPZB 3HE6B 3N06B 4QTHB 5TDPB 2JIWA 4UQ9A 3SHSA 1CQKA 5DVKA 4PGEB 1ZJAA 3C60D 3CFKA 4IMLA 4JRYB 3FN0L 5ADOH 1MQRA 1UEMA 4K3JL 3V6ZA 1ZLVK 4GAFB 3TJEH 3EOTH 1CBVH 2EPLX 5CINH 5B39A 5BJTB 1MCOL 1T0OA 4B9ZA 4XP6L 3HRPA 2GTZA 3K4ZA 1UR4A 4LCIL 2E9LA 4D71A 3S36L 2SEBA 2CQVA 4MB3A 5C0RH 4LVEA 3MMWA 4LNRA 1QFWH 2AJVL 4M7ZB 5BRZD 2XIDA 1YEHH 1BD2B 2W66A 2Q3ZA 4MWFA 2XRAH 3UROR 3AB0C 2Y5EA 3DUUB 2GY7B 5E7BA 2V3GA 3H9HB 1OP9A 4IS6A 3VFOA 4EKXA 1T3FB 4Z8FL 4PFEA 1DVFB 1YECL 5EFIB 3WY1A 1HZHH 5D6DC 1BYAA 4KROB 4X0KA 5FCZA 1XSKA 2NTFB 1BVLA 4Y4HC 1KB9J 1FRGH 4R4NC 5EPMA 2ARJA 3DGGA 2ZPKH 1JXJA 1HQRA 1ISXA 4C7FA 5BS0A 3RNQB 2V5SA 4WHDA 1BQHG 5MI0C 3RWDA 2YL8A 4LLUB 2VO5A 1XCQB 1NH6A 4LRNH 4GRMA 3RL2A 4TPRL 1PX4A 3IXTA 1MJ7H 4EIZC 1KCUH 4NKOA 4FQJH 3LRKA 4D6FA 4U6HA 1QQDB 2X44D 3MRRB 4RMUA 3M1BA 3BFOA 4MJIE 1BP3B 1BVKB 2P8LB 3FRPG 2G3NA 4POYA 3UEQA 1AQHA 1NKOA 2O93L 4OLUH 3QCVH 3D2UD 4WU5A 4C56A 4JQXA 1ZLSH 1V0MA 4F7MB 3ZDYE 3QNYA 4G8FB 2NY0B 5D93C 5KZCD 5J3HC 3GRWH 2FHBA 2HT2C 2R15A 3RPIA 1RUQL 4ATDA 1C90A 3BGFC 1QW9A 4M1CD 2QQKH 1XGYL 3ZTJG 4BZ1L 3TYGH 2ZSWB 2IC2A 4JFEA 1YA5A 1MHHA 1U95A 3NCJH 5I74C 2IAMC 4K2UH 1RSFA 1A5FH 3ARVA 5AUMB 5D8JH 4EVNA 1I3GL 4M6OH 3UESA 2CERA 3MRJB 4PRHD 4POZC 2HJLA 1TE1A 4M6NH 2CEQA 1S7SA 2AI0H 4LHJB 4XVJL 1WSST 1JPST 1G0CA 1W0YT 4MNMA 5F7MC 4FQCL 2G2RB 5C08E 1GZQA 4M1GH 2HA1A 5FA4B 5IFAL 1CPUA 1HHGA 4GXPA 1LD9A 2YD8A 3U7YH 2OLHA 2GVYA 2AK4E 2F1BA 4W5ZA 3P73B 5F3BB 1U8MA 3BDXA 1EHLH 3E2HC 4HWEH 3QRGH 1KCRL 2FIRT 4MA3A 2C7UA 2HVMA 4OZFH 2IALB 3D0LA 1DQDL 1HHJA 5DLML 1V0KA 3CUIA 3NTCH 3IXAA 3EBAA 3TLRA 1OD8A 4NZRL 1HXYB 4AD3A 5JHDA 3C5ZB 3S8WA 5DJDA 5I2IA 1ZT4B 3ECBA 3PABB 4LKXA 3L3OB 1T0NB 1WC7B 4WFEE 5KSBF 5ICZA 1YEEL 2NLJA 2WQ8A 3G6AA 4GZJA 1JNJA 4XCCH 2ZUNA 2EC9U 5D9MA 3OB0K 4NBYB 2FDBP 2R39A 1FNEB 1P2CA 5DGRA 1QBAA 3HZYB 4X7TB 4P5TB 4X83A 5E24E 2VE6A 4BQ4A 3T3PF 1OGAB 3BP7A 1N5AB 3ETBF 3T8XB 4EQ2A 5C0GB 3LZFH 2JELL 4JFUA 4NNPH 4PD4J 3TNMB 4OZIF 3UTZB 3WMSA 1AJ7L 4P7OA 4JPWL 2RCSL 3RTQC 1AI1L 2J47A 3SDAB 1AGFA 1R3JA 4JM2A 1RURH 1G7MB 1BBJA 2VKXA 5CCKH 1P6AB 2GJJA 5F1SA 3VDAA 5I8KH 4PJXB 3KWWB 4Z5RA 4UQEA 2EDDA 4MA8L 1HOCA 3O3AB 1LWJA 4JY4A 4TUJA 3OSKA 3MJ8B 1B9ZA 3REWA 3BE1H 2P5EB 2WNWA 1DP0A 2IADB 3T65B 2EPOA 5HNNA 4S2SB 1UR8A 3EYPA 1ZHBB 1WCBA 5FHBH 4PS4L 4JG1L 2BXYA 4M03A 1FO0B 5DUBA 4ELKA 5HGHB 4KQ4L 3VKKA 4Y16C 4YDVB 4GPNA 3ARGB 4JZOB 4ONFL 2XYCA 1UKTA 1YYLH 5LJYH 3SCMA 1CXEA 3CZ8A 2EZ0D 5ECUA 5M17A 4DGVL 3RNKB 2Y7QA 3RWJB 1DQQB 3CUPB 5DDHA 4AWEA 4UTAL 3FFCE 3A4AA 2CLRA 3OLGA 1U93A 1JPFA 1C1EL 3EYQC 3FB5B 1PSKL 3PZNA 1YQVH 2HTLD 3PGDB 3PWPE 2FZ3B 3QUXD 4QRPA 4QRUA 4CGTA 3NPZB 4ZTOH 2A77H 3MRKB 4H8WH 3B6SB 3I9GL 1CLXA 1ADQH 3RZCA 3M17A 4Q6IA 5KS9B 5GXBB 3KXFE 4MJID 5T1KD 1G7IA 3MGAA 1SMOA 4J6RL 5FGBC 3PL6D 4IRJC 5A95A 2Z4QB 3MRLB 4HD9A 5J1AA 5FDWA 2YD7A 1VKXA 3VSTA 1R5WA 4TUKH 5JO5A 3B43A 2WBGA 4H1LB 4RGMB 2WM0A 1JYVA 2X4TB 3JVGC 3CZLA 4NC0B 3GBLA 3OG2A 4LSUL 3MGOA 5GZND 1UM6L 3HS0A 1MRFH 4G6MH 4PV8A 3VXUB 2FATL 2PXYB 4GKSB 3JV0A 1AFVH 2W9DL 4WEMB 5DYOA 5FDYA 4LIQL 5DQ9B 3I85A 1UWTA 3FW6A 1QI4A 2ESCA 3MR9A 3QUKA 4MXQC 4AD4A 5GGRB 3WLBB 2XVGA 3NBNA 3DC0A 3T3ME 4HC1L 1WITA 5I1LA 1RHFA 2APXA 1QO3B 3G5XA 3MGTB 3H7BA 3W9DA 3O6LH 5HHME 2WHJA 2F54E 1B4JH 1EEUA 5C08D 4CKVX 2RAMA 1CE6B 1Z9MA 1GL4B 4F15B 3NN8A 1A0QL 2XIBA 4A6YL 3KLAB 2AK4D 2HTLC 1FIGL 1U8PB 2AXGB 4CJ0A 2X0HA 4G8GB 3T0VA 4XNXH 3WJLC 1FNHA 4DWSC 4YDIH 1C5CH 3R8BB 5FKYA 4JZJB 2X42A 1L0XA 3SDYH 1K8DA 2DI7A 1FLRH 4OGXL 4MA1B 3SKJL 2VMFA 5A8OA 5T33L 1QSEE 4LNVA 4GW1B 2QL1A 1CZ8L 3HUJE 5K93A 4QTIL 5KSVA 1SBBA 3MX0A 4YNYA 1U3HC 2NY4C 2CIIB 3AXLB 3IFOB 3QXDB 2C4XA 5F8RC 3WFCL 1Z32X 2PW2B 2OJZL 4WFED 2DDQH 3T08A 4MNKA 5B38A 3BP5B 3MCKB 5C2BL 5DK3A 4QT5B 5FYJU 4LF3B 4D0BB 2X4UA 4OCYH 4AEHL 4YUEH 1W3JA 3MLRL 3DO7A 2HFGH 3DBXB 3TYFA 3BPCB 5EU5A 5E2VL 3CMGA 4P8XA 5T3XH 5GS0D 15C8L 5HHOB 3CXDL 4M5YH 3ARDB 4D3CH 4LGPB 5J57B 1DQJA 3LV3A 4KK6C 5C0DA 3BEWB 4CCDA 1DSFL 4H88L 3EW3B 5EULV 4HIIB 1KEML 4RMRA 4TSBH 1NKRA 2A2QT 4O51B 2F15A 3GB7B 1NEUA 2R8SH 5CG0A 1MJUL 5FYJE 3H54A 4X5WA 1DTUA 3NFNA 2FHFA 2Y24A 3BUPA 2C3GA 4WTXA 2BOBB 1RIHL 1AQDA 2JKXA 3GXNA 1W9UA 3A23A 4LSTH 4S1QH 3OGRA 1F4YH 2A6DA 1MREH 5ESAB 1P5UA 1HDMB 2NXZD 4PUBH 2VRQA 5KEZA 1BZ9B 3O45B 4L4VB 1FG2B 3OKOB 1C08B 4Z6AT 4N90D 1ODAA 3VFGH 4MD4A 1KENL 4O5LL 1YMHA 3HMWL 3GHBH 4Q6YA 2W4XA 4BH7B 5KANG 4APQD 3FQTB 3T4YA 3FFCD 1EDGA 2ZUTA 1KNOA 3HZ3A 4WU7B 3OTTA 3WXVH 3DX4A 3PWPD 3GMNB 5FECB 1KCLA 4V1DD 5CILH 5C0EB 3FZUD 3QQ9D 3L5XL 1NCCH 4L4TA 2PWFA 2DIJA 2Z93A 4OBRA 1LO4H 5F1IB 5L7XH 1ULVA 1TVHA 4L4PA 3LPGA 2WCAA 4BH8A 3KXFD 4WF7A 4NPYA 3GSNL 5EBWB 5CMAB 5DSCB 3OX8A 3VFTA 2Q8AL 1OSZB 3C5JB 4LVOC 4YFEA 3CLWA 3I50L 3U2SB 2OL3B 3T0EE 2V7NB 3KDMA 1CF8H 4P3WA 1MEXH 1KPRB 4PJHF 3BCFA 4V27A 4W8LA 4IDLA 5GGTH 5D7JD 3RWHA 3K8KA 2D03L 4MD0B 2ED8A 2EIZB 1SEBB 3N04A 2F8QA 3FJTA 1HJSA 5D6DA 3PWVA 2CD0A 3WUGA 3F7RA 4HUXA 5I9QB 1KTDA 4XUYA 2W65A 4A2MA 1N2RA 3D9AH 3REVA 5I1AA 1UZ1A 4P2QB 4S3JA 3KPRA 2XN9B 4M29A 2E9JA 5B3JE 2J12B 1HQ4A 2K3TA 2EDTA 4BFBD 1E4NA 3TCLA 1K3IA 2IFGA 5HHMD 2C3WA 2F54D 4FXGA 3WO4B 5MP6L 2BVTA 1N26A 2YKLL 3GDBA 3HI6L 1MJ8L 1S9WA 2CK0L 2Y36H 2A83A 3S37H 3V9FA 1NDMA 2Q6WB 5C0IA 4ONGH 1C8PA 4FTVE 5LGKA 3BHBA 3DRTB 4LMQI 1V8HA 4P2OD 2QKIB 1KXTA 2D7OA 3QQ9C 1M7IA 4YPGA 3THML 4WO4A 4UQ2A 1F4XH 3BPLB 3I2CL 4QNPE 5EBGA 4XZBA 4QRRA 3SY0B 1IL1A 2HVJB 2NY7H 1PGRB 1QSED 1U91B 4LCWE 1ZLWK 3O6FB 4OZFG 2VR9A 5I1IH 4M02A 1U8QA 4PP1D 5BQ7A 2LFGA 2AS5M 1CXFA 5GRJL 4GG6F 1W72H 1LNUA 4TULL 3BPNC 4K3GA 3MSPA 2G8ZA 4JHZA 2IAMA 5I30L 4XWOC 1Y6MR 4PMQA 3LPPA 3VXTB 3F4VA 4YH6A 2F58H 4GRLC 3CHCA 1CGVA 2NXYD 2CITA 4YHEA 1WWWX 1QSFE 2XHYA 1QPPA 4NQCB 1ERNA 2BDNL 4F7PB 1J9YA 1RQ5A 2ATKB 4WW2A 4B50A 1IRAY 3TZVD 2R9HD 4PJ7E 1S7XA 3B2UC 1AY1H 1TTGA 4YBLB 2UWEE 1FVEA 5DHVB 4OQTH 3EO1B 1I8IA 4HIJB 4LHUA 5F7NC 5BZWB 4N0UA 3WY2A 5I2UA 5D1ZB 2LU3A 3INUH 5FYJD 5I76A 2F7QA 4NWUH 2VZTA 4KDVA 5E5RB 3S97C 1A7OH 2MCG1 4LLMA 1X6NA 1YDPB 1ODZA 4PJBA 4J1UA 3BMVA 1OWQA 4GBXA 2DMBA 1FFPA 3N1FC 4OD3H 5IKCB 2V3DA 2B31A 4PJGB 5AG8A 5KANI 1HX0A 1JJUA 3NACH 5DMIL 3RKDC 3CFDA 5EZJA 4C4KT 1LL4A 4QCFA 3L7EB 1JTTA 3FHAA 3HR5B 5ERWA 2CDEA 2XGIA 4BFIA 4G7YL 1FFNA 1PG7H 4UV7H 4RZCA 5IHLB 4M81A 1IE5A 2GJRA 4W6XB 3O3BB 4LPVA 5C07E 4C56E 3OAUL 3EOBB 3LCYA 4FNPA 1CVSC 3CTTA 12E8L 3G6JB 5DS8A 3Q3GA 1CFNB 5DMGC 5TH2B 2NXYC 2LE9A 4Y8AA 1JF6A 2YPKA 3QCUL 2IQAA 5I8EA 2DM2A 3PTQA 2Z92A 4CCEA 1U92B 1G84A 3GSRA 2R9HC 5ESQA 5BOPA 3T0ED 5TE7L 3ZKXC 4PJAA 1OVZA 3MFFA 3ROLA 1JPGB 2XXMB 5I18L 4OIAA 1N5YH 1RUKL 1H15A 2Q1EA 2ADIB 1U8IB 4LVHB 1TQCC 5FYKU 3VXPA 3N12A 5BXTA 3EIFA 2N1KA 3E6FA 4Z7UB 2EE6A 4CVXA 4PYSA 2YDQA 4Y16A 5AD0B 3I6GA 1WUNT 1HWGB 3CVIH 3I3DA 3PQYA 3TBVB 1E4WH 1E6NA 4R26H 1OTUD 4AY0A 4AD0A 3BKYH 4JRXB 5EZIH 3X3GH 3I6KA 1RI8A 1GCYA 2FGLA 5D5MB 1RZKH 4YIQB 4FNUA 2NX5B 3H0TA 1CENA 1XCTA 1YEJH 3LEYL 3VXQA 5ABDE 1DBKH 4G7VL 4C7DA 3U7VA 2DQGL 4K3EL 4FTVD 4Z7VA 2OLDA 2AXJA 4F7CB 3TTOA 4IRJA 3Q5YA 5B4MD 2DDXA 4Q22A 3F5KA 1RK0B 4NQEA 5FYKE 5J56B 4R7NB 2DYPB 3O0RL 1UACH 2KQMA 1G6RB 1JWMA 1N7ML 3V4VL 5KZ6A 5ANMB 3RIFF 2VLRA 1J8HB 2X7LB 3GMQA 4GRWB 4PJ8B 4E0RA 1NCWH 4LCWD 4HQQL 1UUQA 3BD5A 4JPIB 1BQSA 1MAJA 1B3XA 3CHFA 5J12B 4OSUL 1UJ3C 3UTSB 3WUFA 3QB7C 1R33A 3MXWH 3S6TA 2C7FA 5I8CB 4PJDA 3PZTA 2GSGB 1VA9A 4F9LA 1B4RA 2VXTH 4JZ5A 3WHE0 3HKFA 1C93A 3SCWA 3C8KB 4OIFA 1B0GA 3WQWA 2AKRA 1IGCL 4LASL 4PYHA 3V5KA 4H8UA 3SUSA 2E7LC 1QSFD 3FHQA 3O6AA 4W8AA 3VFVB 2XT1B 4G6JH 5FEBA 5JIIA 3FNDA 5SWSA 5AAMA 2V7HA 2BHZA 4ZSOB 5JUEH 3BH8B 4XMLH 5GISL 4KWUA 4QHLB 4BQCA 3AZTA 1C12B 4L29B 4NJAH 4GAJH 1BGXL 1BX2A 43C9B 5C0AE 3C6LD 3K2MC 2XACC 4J3TA 1VBUA 3ZT5A 3VFMA 1LO0L 2DQCH 5E5UB 1CLZH 3FONB 4M7JH 3WF4A 5A8NA 4KHXH 5LXGH 1AD0B 1FPTL 1IC1A 5HGAB 5SWQB 3U0TB 1HSAB 4JN2A 5A2LH 1H5BB 1U3HA 1GJIA 2E8ZA 1R0AH 1A9BB 1DQLH 4KMTH 4PRDA 5E09A 2CKBH 4NP4L 2C3HA 2IPTL 1PY9A 4QRPE 5DXWA 3H3BC 4IM8A 4KJPC 3PF2A 1QLRA 2F7OA 2R0WH 4MPKA 3IS0X 2ZWLT 3MYZA 1YMMB 3QDHA 5HOSA 1SYSA 4B7LA 2LABA 1S9VB 1PX3A 2MCPH 1G9NL 3CFBB 4WUKH 5JR1H 3VI4F 4KI5D 5HDQH 2X2YA 3O6KH 5C07D 2F5BH 4C56D 1TQBC 2J88H 2ZKHH 4RWYL 4L8SC 1WBZA 4YR6A 1ISWA 3QWQB 1C5DB 3IKCB 4NBXB 1HKFA 1OTTD 4EIGB 1FORL 2OWXA 2Z31B 2XXCB 3N50A 1DE4B 4KK8C 4P9MH 1YNTB 5JPNA 4XMPL 1UXWB 2QLYA 1MLCA 5C0FA 1UZ8B 3FQXA 1YYMH 3KLLA 1TDQA 3F12B 5IW1B 4JFXA 3HMXH 3C6LC 2YWYA 3CZKA 2YD6A 2BMKB 3QXTA 2WMPA 4HOWA 1MFAL 3KS0J 2GJPA 1YNLL 4CMHB 2BSSA 4URTB 4NN6C 4EN3B 2IANA 3MA7B 5KAQG 3GXTA 1L7IH 1FN4A 5E9DB 5E6YA 1MW3A 5IVZA 3DECA 1QHZA 1IQDA 3O4LB 5EOTB 5TDNA 4Z0BH 1VACB 1HF6A 1E6RA 1OP3K 3MODH 5IT2L 4WI7A 1UWRA 3SJVB 3WFHB 1W0WA 2HRPL 3SOBH 3L5WA 5K9OA 1CNVA 1AXTH 2J8UF 3HZVB 3CFEA 3WHXB 1I7ZA 5GRYA 5FF6A 5LYRA 4FABL 4KDTC 4XVUC 1LQSR 5CJOH 2VRAA 4DUXA 1U58A 4L4OA 3SDCA 4Y5YC 3W53A 4NFCA 2IMMA 4YDJA 2YRZA 2V2TA 1IT9H 4KI5C 1W1YA 3AROA 2EYTA 1FVCA 4Z7NF 5FYKD 1G9NC 1NGZA 1HVQA 3TP4A 2GTWA 1VADB 3QHFL 2PO6A 4IEFB 3K80A 3QJFB 4YQXL 1K6QH 4CD4A 2LTQB 3S9DB 5KAQF 5DD6B 4HKXA 4AM0B 1M1SA 2OL3L 4XXDA 2VUOA 4IIQB 2R0ZH 4PB9H 1MVUB 1P7KB 4GMTL 2D31B 3MMUA 3N9GH 3NCYS 3GH4A 1UR1A 4PP2B 1QP1A 2X4RA 3U30C 3SKMB 3IJ8A 1SEQL 2YBUA 4JLRB 1CTNA 4X80L 5BXPA 4ZDHB 4XRCB 2EYRA 2GUOB 4IJ3C 4LCCA 5I19L 3LXBA 3HZMB 4F58L 4EUPA 1UCTA 2AXFB 1JZ3A 1GQJA 4LOUC 1XGTB 3SBWA 1NMAL 2W0FA 5E1AB 1XF4A 2F5AL 3U9UB 4B7IA 1JNDA 1Y18B 1CZ1A 2IG2L 2ICCA 1TJIH 2ZZUT 3IDIB 4IM4A 4KRPD 5FUZL 1N6VA 5D70H 4KV5E 2X2IA 3QIBC 4N42A 1DBJL 1CG9A 2NNAB 5DVMA 1VGKB 5B8CA 1QBML 2X6MA 4NZUH 5C0AD 5A6AA 2QF8A 3P0VH 3QFJE 5EC1B 4HZAA 1M71A 2AGJL 1S7VB 3BN3B 4FS0A 2MFNA 3GMRA 3K0WA 3L9RB 5D9PA 5ALBL 2X1WL 1TZ7A 5DJ8A 2AJUH 3GSNA 4P57B 3QDGE 3VWKD 1C8XA 4PJEB 1MLBA 1N64H 1OGTA 4M7LH 4PG9A 2WHKA 3RAJH 2ADGA 4QRPD 4AZBA 1SHMA 3MV8B 3CVHB 3RJXA 4UIMB 4HAFA 4UQ3A 3M6DA 3WQ6A 3MLTA 4N0FB 4H0HB 1KTRL 1T03L 4HK0A 1LEGB 2QQLH 2FB4L 4XHJD 32C2A 4GAYA 1IV8A 4ODVH 1EJOL 2DWEB 4Z2LA 4HOZA 1OGSA 3GGWB 3P9MB 3R06A 4DUVA 1UH4A 1QBLH 4FQXA 3MA9L 1NEZB 4NZCA 3T0BA 1JAKA 3U36A 3U46A 4LHUG 4DJMA 1D5MB 1MH5A 2AV1A 4D0CB 5GGVL 3WS6A 1CGTA 5IQ9A 5TE4H 5L2KE 5FKAB 4DOHE 3RGVC 1QKZH 1IAMA 3IVKB 2CDGB 1LDPL 1D6EB 5BVPL 3O9WC 3QOKA 4MCYA 1C7SA 2R2CA 2BVOB 1DN0B 2DBLH 1EMTL 3MZGB 1EPFA 2KQNA 4FZ8L 1TQWA 3P4NB 1JNNL 5DD3L 5DZOA 1WPCA 1A7QH 3BISA 3MNWA 3GK8L 2VWEC 5AG9A 3RIAK 4FLRA 5A2IH 1GQLA 4Y2DD 4TOQA 1IQWH 1I9RH 3QH3B 3VWKC 2VABA 2AV7A 1L8NA 3QUZD 5T3ZL 3C09C 3S5LA 1P7QD 5FGRA 5HI5D 3S36X 5AYIA 2OYPA 4G42A 3VPLA 1G9MC 1X5LA 3LMJL 1NJ9B 4RIRA 1I4FA 4BFEA 1FL3B 4FFWD 1RH9A 5F7HA 5E94A 3RX5A 4AY1A 3TO4B 2O9PA 4ZAKC 1G6VK 3JV4B 3CLEH 3TBYA 3OAZK 4PJBF 3P0GB 4XHJC 3D3AA 2YBRA 4IOIB 4FA8A 4OD1L 3AZRA 5HXMA 4GINA 5HPCA 1UB6A 3NA9H 2H3NA 1E4KC 4HWNA 4PJCE 1J0ZA 1FBIL 1R3IL 4LEXH 4NQSA 1EERB 4JJ5B 2YN5A 3LKQB 1RZGB 4GUPA 2JCCA 1IC5H 3C2AL 1A7NL 1BIIA 4KRTA 2QQQA 4X4MA 3FMGL 3GUTB 3DUHA 2XG5A 4I0PD 4JQIL 4KKBC 5HDLA 4P3DA 4NX0A 4IUGA 3RUGA 1GGCL 3MRMB 4NZDA 1MFCL 4MQSB 1QFWM 1TVBA 3PGCA 3LRHA 1Q4NX 3LQMA 4DKFH 4NDMA 4MADA 2OQJB 2B5IB 1RUMH 2ZOLA 5LCVH 3PV6A 1HWHB 5A6BD 1CT8B 4YE4L 4QHUA 4XV0A 2WBJC 1KJ2H 2VC2L 3WFDH 4LDEB 1OB1A 3FN9A 3VOCA 1CE1H 4HPGA 5EO1A 3AQUA 1BZ7A 2Q86A 4WI4A 5D1XD 2J7GA 1RUPL 5DUML 3G5YA 4BQBA 4FXLA 3BRDA 1EXPA 2B39A 2W0LA 2B8OT 5A8QA 3CLFH 3QFJD 4ZXBC 4KJYA 3RP1A 1VRXA 3THCA 3UTQA 4I1NB 1AIFA 5AYQA 5FUCE 4LLVA 3QDGD 3TIDB 3A6CL 1LWRA 4XBEL 1UWQA 4LCYB 1MFDL 3ZHKA 2ITCB 4NBZB 4ZFFB 4Q2ZB 2Z8VC 4NHCL 4X9BA 3VFSB 4W87A 3VFUA 1NMBL 3VD4A 4X9YA 4YAQA 3RCNA 2HKFL 4Z7VF 4TSAH 1AC6A 1QNZL 2W9LA 2YBTA 2DD8H 3ZKMC 3BAJA 3R1GH 1B2WL 1SZNA 4QOKA 3BXWA 3MLYH 2OMBA 5GSRB 4JHWL 1VESA 2Z8SA 2NY6C 4NM8L 3JBG7 5BXRA 1T21B 3ME0A 3EYFB 4XCNB 6A3HA 5FM5M 5J7CC 2E7LA 2P44B 4KAQL 5INCA 3P0YL 5GHWH 4I3SH 4ALAH 4OAWB 5E00B 3Q5OA 4OLWL 4ELME 5DK0A 4MX7B 1QD0A 3JWOH 5CWSA 4DO4A 3HAEH 3HI5H 3VU2A 1AD9B 1MJJB 1PKQB 1U0QA 3H3KA 2E8YA 1LWHA 1Q9LB 5C3TA 1C16A 4LARH 4PJDF 5ICXB 5L2KD 5CJXA 4TTDC 1D9KA 1DLHA 4I3RH 5DJZA 1IBGH 2UZXB 3SKOB 3PQYE 5L8JB 5MEQA 3WFBH 2EXOA 3QUYD 3RWIA 5J13C 4EOWH 2IPUG 4YHPB 1RP8A 5FCUH 3VXSB 3X11B 4B3LA 2OYKA 1KJMA 4WTWA 3L3IA 3D0VA 3AM8C 4FQLH 4J3XA 4YWGL 3MRIA 4R8WH 2BOCB 3SGDH 5F7DB 4NQVA 2XZQL 2J79A 1DL7L 2BY3A 5HHNB 2ZOKA 4NN7C 4WO4D 3D50A 1HILB 2WUCH 2X4NA 4WSKA 2G4FA 1FNGB 5T1LD 4XPAH 1JNHB 4F7EB 1QNQA 2FECL 2VLRE 3NCCB 5E6IB 1ZA3B 4DKEH 3L2MA 5MEOA 1J0IA 4ZD3H 1RU9L 2R56L 2ZJSH 3CSYA 2YMXL 3ZDYF 1V7NH 4LPWA 3C2SA 3N15A 3W5MA 5EOQH 3U4BL 1H3PH 1INDL 4QXTA 3IJ7A 2AW2A 1P1ZB 4KK9D 4P5KA 2R4SH 3BGMA 5DFWH 3M07A 3X13A 2OW7A 3VXME 1IGFL 4X4XB 1XF1A 1I1WA 3AHTA 4MGXA 1XT5A 3G08A 2VXUL 4XI5D 2CRZA 1LK2A 1K2DB 3OLDA 1K9DA 1CLVA 2OMNA 5IF0B 4F3FA 4CDHA 1ZSDA 3KS0H 1XF3A 2EIDA 3PZGA 1YEIL 3UMTA 3MV9B 2IPKB 4JFDE 3AIEA 4AQ1B 2Y5TA 4M62H 3WD4A 3UX9B 4JAMB 2P4AB 1I1YB 2ATPB 4OZ4A 5FGCE 1KGUA 5JW5A 1NCNA 4LPUA 3VIJA 2I07B 2I26N 3OGCB 1ISZA 3MRBB 2EPMX 5FM8A 1TNMA 2BNUB 3UZQA 5CUSH 4GAGL 4Y5YA 5EB8A 1XIWC 3VRLF 2VLLB 5HYIA 3DURA 3BD4A 4LDLB 5DJYB 2BY2A 2I27N 3TH4T 4LAQH 4OZGB 3MLUL 5I6SA 2UY7A 1DFBL 4UFLA 3LEXB 3VFPA 1PIGA 3DDFA 5TGBA 5A69A 4UFMA 3D39B 3OKNA 1KQZA 3W26A 3DIFA 1JPSH 1K4CB 1E4LA 1JF5A 5C70A 4RBPK 5I79A 4JG0H 1J1PL 1JHLH 1QFHA 3KPSA 4LQ1A 3ARRA 5F6IC 5JXAL 3RA7L 4LIQE 3KR3H 3V4UL 5BZDA 1DQTA 2IFFH 3U6RB 5IFJA 4ISVA 1LL7A 2ZXDA 2WXDM 25C8H 1OM0A 5JIWA 3UZVB 1FE8L 4N1EA 3WD2A 2NYYD 4QRTA 5JLZB 4G6FD 3ZE2F 4NKQB 4TX8A 5C0BE 4OLZL 1QNSA 1KPVB 4R0LC 1IGML 4K23H 3QIBA 4BA0A 4QKXB 3MU7A 5I1KL 4PTUA 3S35L 1GOOA 5EG6C 1ZHKB 3L4VA 5F7KC 3PNWA 2UV3A 4V2XA 4H0IA 5SWZA 2H41A 3B9VA 4PY7A 3BSHA 2AAVA 2I5YL 1HIML 1Q0YH 4ZUTA 2IANE 2YC1A 3PQYD 5GRUH 4POUB 3W39B 4RE2A 1CL7L 3BIBX 2L7UA 5KG9A 2EKSB 5HGDA 1I8MA 4TX6A 2Z35A 5E8EA 1RAMA 3NH7H 4WWID 3GBEA 3IDNA 5DJ2B 4G8EB 1MI5A 3KPTA 4FP8H 4P3CL 4RGOH 1KLGA 5E1HB 4URIA 4KVCH 1NGWA 4BJLA 1XGUB 4F2MB 1H0DA 1JUFB 5EDXA 2GK1A 3BZFB 5HDBF 4KUCD 1E28A 3QT2A 5GNZA 5ABFB 4OIBA 2NTSP 1EO8H 2X1OA 4XTRD 4ZO7A 1GQKA 1QI3A 4D6EA 5GGQL 2GKIA 4H25A 4F7TB 5DI8A 3TEUA 3CX5J 2FJGA 3CFCH 4DZBA 5D2NC 1W72B 3BCDA 4KKCD 1CWVA 3P11H 3ARUA 3K8LA 2VDNL 2VLRD 3TA3A 3WDJA 2V9RA 4YDLC 3MREA 3VIKA 1CICA 3THDA 3D4ZA 5BMFH 2ESVB 1ZS8A 1E27B 3V5HB 3VXRE 3F6LA 3NFPA 3C60B 3RZWA 1A4JA 5DUPL 2Y07L 3U0WH 2NW2A 4XXCC 2CYGA 2R0LH 3IJHA 3PBGA 3Q48A 3S3SA 5EIIA 3DROA 1YEKL 2EXYC 3A4WA 4EI5C 1O6IA 5JPMA 1NBZA 3CZGA 3VXMD 4JR9H 3T3MF 2EXWC 1JHKL 2HFFA 3LQAL 1B3WA 3T2PA 4FRWA 1KPUB 1RD6A 5DHXB 1UADC 1Q6EA 2YZ1A 1LLOA 5BRZB 4NC1C 1QR1B 5KW9H 4U6YA 3IKKA 3RI5F 3PWNB 2BSTB 1N3NA 1JDAA 1YPZE 3RVXC 1CI5A 4NUGH 3O2DH 4JFDD 1S7RB 1RY7B 3EJSA 3IDMB 4XZUB 4U3AA 4M8QB 4NNXA 1S7WA 2WCGA 5LWYL 1OAQH 3PWUB 1G01A 1JG9A 3L5IA 2P49B 3WFLA 1WV7T 5IB5B 1Q6CA 2D0HA 5JQ6H 1NM9A 4H26B 4XTRC 4JVWA 5FA3A 1DR9A 2AJXL 1LHZA 3MOBH 3UETA 2YD2A 3HUJF 3PHOB 3O6ML 4LFHG 5DO8A 3CZFA 3VFRA 2ZNXA 4DW2L 4GQ9L 1JRHL 1S7UA 4K7PY 4X6DA 3M7SA 1QW8A 2Q7YB 2NR6D 4E8CA 1QNOA 4PYGA 2YL5A 4HZ8A 1JWUB 4MJ6A 5J6GB 2E3VA 5L2JA 1NC4B 1OAZL 3FO2A 2FR4A 2HMIC 3G5VA 3ILQC 3VUPA 43CAB 1G9MH 1JHTA 1I8LC 3IGAA 3CDGA 3LEVL 3BH9A 1SY6H 3HC3H 3D2UB 1SM3H 4NKIH 2CJUL 4OQ1A 2DLFL 1BEYL 1GC1H 5KZCB 2HG5A 5KSAD 1CFTA 1B0WA 1CGWA 4XB8A 5E0QA 2UWFA 3ARTA 4PLOB 2A9MH 2FJHA 1WBYA 2WBJA 4UQBA 3TTQA 5DVLA 2VLKB 5C0BD 4CVZA 5D72L 2JCCF 4NIKB 3D85A 5JIKA 2VDLL 2Y8VA 1E6PA 1MWAL 1FH7A 2IMNA 1IZKA 3U7AA 3WEXB 3ES6B 1JN6B 1OTSC 3RUGF 1E43A 1E6JL 2G5BB 1NAMA 1PBYA 4ZXBA 1A9EA 2IAND 1ZEAL 4L9LB 4LLYB 2M2DA 1V7ML 5IMLB 3B2VL 4MNJA 1NLDH 4UCFA 1TVPA 3OPZH 5IHZA 2HJFB 2RGSA 1FH9A 5AC4A 3KHQA 4Q9QH 2GYSA 3CZSA 1ZBVA 2EQDA 1R87A 4P4KA 4Z95H 1IC4L 1F00I 4OZHA 4GKNA 4DVRL 3SDCD 2XQBL 2NW0A 4PMUA 5TE6L 2VDPL 1BQUA 3GXIA 5DWUH 5I0DA 1VFUA 5GRWA 2XVKA 4OCXH 2HRLA 3GO1L 1U6AL 3NOIA 4LLQB 1N6QL 3QXAA 4X6CA 2PO6D 4Y4KC 2WK2A 1M03A 2EEBA 3Q2CA 3WH9A 2MWCA 1NBVL 1T7VA 4FMKA 5ADPH 5KSAC 2WZEA 1XF2B 5IW6A 1I1XA 1CFQB 2BCKB 4UDTA 3WDHA 4MHHI 4FFYH 4X4ME 4XVSH 3NCFB 3VXRD 4D9LL 5IVNA 1KR1A 1ONQB 1EUTA 2HFEA 5CEYA 5SV4A 1AKJA 5D71H 1FSKB 4GW5B 4ZS6C 2DTML 4OLYH 3VH8A 5DJAB 1T1XA 3VIPA 1A7PH 3GFUA 4MA7L 2HH0L 3MROB 4DGYH 4AH2B 1IEAA 5I17B 4MNQB 1KB3A 1RULH 4KVNH 5CZXD 5A1AA 2ZCHL 3TCXA 1ZGLM 4S1SH 1UD8A 4OLEA 4QCIA 5ID0A 2YUVA 4D6CA 5I1EL 1J18A 2H32A 4P4RA 1OGBA 3EYUH 4JHBA 3NABL 4AT6A 5I66B 2YPLA 3EYOA 3AM8A 5DT1L 5IVXA 2CKSA 4JFPA 3LSOA 3IAGC 4XC3L 2HN7B 5D4QA 2R2HA 1CGUA 3BP6B 4NRZA 3R8QA 3TA9A 1INQA 4KY1L 2YIHA 3DSFL 1F90L 1S9KC 2V5DA 4X98A 5CLWA 4P7QA 4QNPF 2VLME 5DMYA 4Z76B 4FQ2L 3U9PL 1U8OB 4XNQB 4I2XB 5IWLC 2OBGA 5JW3H 2G3IA 4PJIA 1FZKA 2WPGA 1NCUA 5CEZL 4DN3H 2E7HA 4ORGA 4HPYL 3B9KC 2XWTA 3RVUD 4ZXOA 4Y5VB 3P30H 1KXHA 2HVKB 1U2CA 4HXBH 4TVSa 5IIEB 3BZEA 3AXIA 1R75A 1R7AA 3LRMA 4K7FA 4MJIB 2DQIL 2P5EE 2XNAB 5IQ7H 5LA1A 4ZUSB 5E8PB 4J7RA 3IF1A 2Z8RA 3TN0B 2FEDD 1G7HB 3SGKA 3VIOA 3BRGC 1JBJA 1DVFD 3H8NA 4CMMA 1S7QA 4Q0XH 3L5JA 2DKMA 4Z2JA 3D4YA 1MQKL 4HMCA 5FL0A 4X7SL 3LKNA 4KROD 1BYCA 1QG3A 6TAAA 1FL6B 4PMVA 2F1AA 3B83A 1LEIA 2PYEA 1M53A 4PTVA 2G75B 5ILTH 2VQTA 1QFPA 3VFWA 2XUCA 3EYSH 4MAYC 3LRSB 4DUWA 2UWEF 3ABZA 1HE7A 2VDRH 2R69L 1NWUA 2UZIL 5CIPB 4B16A 3HE6C 2ICES 4U6TA 1HINL 1ACYL 2WSKA 5EUOB 3NIGE 1S3KL 1E40A 3D1MC 3OKMA 2IH1A 4JGUA 5CJBA 3W28A 1E70M 1HKMA 4I3GA 4HOXA 3X12A 3VCLB 1W32A 1FA2A 1A6AB 4TOYL 4U3HA 3S4SB 4F66A 4LU5H 2O5XL 4JO4H 3QDMA 1RFDH 1WWBX 5J9PB 5EU3A 1CYGA 2FO4B 4IPNB 4OFIA 1KUMA 2X4PB 2AK4B 5ACZA 4AZGA 4ORZC 3BN9D 5ISZA 5E2TH 4O58L 1P84J 3H55A 4XCFL 3VXUE 2OK0H 4RE4A 5DZNA 1GOQA 4EI6A 3DX9A 1UENA 4OGZA 4KI5F 3HI1A 2E9IA 1PLGL 3FRUB 4HKJA 2J75A 1GAFL 3EO0A 5A16B 1ZVYA 4HCRL 3S7GA 1DVFC 4QXWA 1FCCA 5FO9A 2ZSVB 3GSWA 1SYVB 4HIXH 5KBNC 5CP7A 3FN0H 4BUGA 4L8DA 4K3JH 3TFKD 1IM9A 3BP4B 1V08A 3WN5B 3UG4A 1WZMA 2X41A 3WKNA 1AQKL 4JFFA 3MRPB 4HJGB 4Z0XB 2BNQE 2CHNA 1CDYA 3GSQA 4LCIH 4AL8H 3S36H 4OKDA 5AAWA 4NRYA 1IT0A 2JB5H 1GYAA 5GGRY 1VFAA 3L4WA 4LSVL 3BEVA 4HUWA 1BM3H 4TVUA 2GY5A 2PI6A 3HNTL 3CZJA 3F7YB 1YNKH 5EZOL 2X4QA 2W9EL 1KB5B 1YECH 3BVVA 2GUYA 4G43B 3UR8A 1BJ8A 4PRPB 1F4WL 4ODWB 4DCQB 1ZBKA 1D6VL 5H35B 2NY0C 2O9RA 1AR1C 3W9EA 5DMKA 1MHPL 3HE7A 5CEXA 2NXZB 2EIBA 5GRVK 8FABB 4P5TD 1FJ1A 1QYGL 5I15H 4K8RL 1WKYA 2W60A 1FCGA 1T1WB 1OGAD 1A4KA 5JNYB 5TDOB 3TTSA 3DETD 2R1YA 1W1PA 5IESL 2DB8A 1DEEA 1L9NA 1NUGA 4APQB 4XMKL 2LQRA 3FFCB 1S9YB 3SDAD 3PP4H 4JB9L 3W81A 1AQMA 3PWPB 4I18A 1XZ0A 3F5WA 4XXCA 2QADD 4UT6L 3M46A 2XA8L 4D9RE 4KGLA 2XN0A 3SGJA 1XYZA 2DT1A 4U1MA 3FQWA 4GS7B 4EI5A 4GQQA 1V05A 4NHUB 1K4DA 2P5ED 5F6HJ 4M43L 4EE9A 4QRSB 2YL9A 1RUQH 5D96B 4E9LA 3APGA 3AHZA 1H11A 4TRPH 2M26A 3DLQR 1XGYH 1OAYL 3ARGD 4G3YL 4YHZL 5JORB 4O2FB 3C5ZC 1HNGA 3G6MA 3D3VA 1I3GH 2X4OB 4KKAD 5D7JB 1JYNA 1OBAA 3BT2H 5E2UH 3QDJB 5A3ID 3RL1A 1SJEB 3MJ6A 3QXWA 5D6CB 4BQ8A 4FNLH 5SWZE 3S96A 2CPUA 2PW1A 1UWSA 3X14B 4GOSA 4C83A 4JAWA 3VMNA 1D9KD 4OLVH 3FFDB 4S0TD 1KCSL 5EZLB 4MAUL 1CD1B 5HI3C 1WISA 5HYJA 2VCAA 4PTTB 4GJTB 3WQ4A 4AENA 4GXVL 4OB5H 2ICEB 3TWCL 5BWFA 3FO1A 2UUDH 1F6AB 4WCYH 3AU1A 1T1YA 2K7QA 1HYSD 5BW7C 1T2JA 1BOGA 5HHMB 2APFA 1ZA6A 1MVFA 1MI5E 4Z78B 1SBSL 1O7DC 3O41A 3MRFA 1VF8A 3AIUA 3KPMB 5HHPA 5F7EL 2BVQA 3SDAC 4OCWH 1P4BH 3RIKA 2NY1C 5C6PB 4WGWB 4P2OB 3QG7L 1CXLA 2YZ8A 1ZT1A 3GXDA 5BRPA 1I3UA 3VFNB 1I8LA 3VXUD 4FFVD 5GZOD 3VRIA 2PXYD 3HC0B 3EGSB 1MCDA 4Z7WE 3ZYZA 2KUTA 4MVBD 4QAWA 4E42A 3NAAL 4MQXD 2BERA 1TXKA 1LQ0A 3ZDXE 1QR4A 3HPJA 3S98A 1AE6L 4U7MA 4X6DF 1XR9B 2DQTH 4U4BA 1OAXL 3P3YA 3QA3B 5SX4I 1RJLA 4KKAC 1AJ7H 4R4FH 4XWGL 2C3VB 5EBLA 3F62A 3WDPP 1AI1H 2BNQD 3ULVL 1UWXK 2WMIB 5IB3B 1V3LA 4PRNA 4Q97A 1HYRC 5F96H 2OTPA 3ZJ7A 3B3IA 4G8GD 2XFXA 3QEQA 4PSPA 3PP3H 3PZVA 4JVPA 3MLXH 3BAEL 1N6UA 1MF2L 1GGTA 3VRJB 3HG3A 4X7EC 4JFYA 5D7IA 5EO0A 3U7WL 4MSWB 5E5MB 4MJ5B 3V6OE 1EGJH 1L7TH 3BKJH 3TZVB 1HYSC 1A3LL 4NM4H 3QZWB 3EO9L 3V6FB 1FP9A 1EQPA 3RY6A 5F1NB 3BXNA 4M93B 4XNYL 3WUWG 4RGMC 7TAAA 4GXUM 2F2HA 3CC5A 5FO7A 5ENWA 5I1CH 4ONFH 6CGTA 1JNEA 4KHTL 4YHOH 2B2XH 4OD2B 4PGBB 1JGLL 3U79A 3H9ZA 4G9DA 5E08H 4FFVC 2BNRB 1W3HA 5AYUL 2JK5A 4JKPL 3X17A 1C1EH 1ZB5A 3O11B 5DA4A 4UTBL 4Y4KA 2AMGA 1F2XK 1HSBA 5CSZB 3BH4A 4ACYA 4HLJA 3MBXH 5EMYA 3GIZH 2WQRA 3PDGA 3U0PA 1EZVX 5FUOH 3I9GH 4BSWB 5HYQB 1AXSA 4NQCE 5KN5A 2FEEI 4NKMA 1WFUA 5HYSA 3JSSA 1QEWB 1Q1JH 4OKVA 2HLFD 3BLPX 1KIRB 4RNRB 1RZ7H 4WI2A 3AZSA 4D6IA 1R5IB 1V0LA 2DMKA 4D9RD 1WCQA 2VIRB 2BRRL 1J05A 1H09A 5JOFB 4HV8B 4UQCA 4W70A 1J1OH 2P1YA 4OCNC 2HTKD 3VD3A 3HAEB 5K9JH 4YFDB 2GCYA 1IGTA 1MWAA 4EDXB 4FQIL 4G6AC 5CBEA 2MNUA 3H9SB 2P5WB 4ATWA 2W9DH 3OG6B 2GJ6A 3ZL4H 4MA1C 2FL5A 4TNVF 4PJGE 3T77A 3L3HB 4N8VA 3V5DA 4PJFF 5DRWA 2VL5A 5T3ZE 3AREA 1XH1A 1XF5B 4HC1H 3ARWA 1MCIA 4DK6A 1VPOL 4JY5H 2VQ1A 5E99L 5SWZD 4AZIA 2D7TH 5EO9A 2KKQA 3T1FB 3DTXA 5ETUA 3FT3B 4OI7A 1EZVY 3SDDA 1HL9A 2HWZH 3RVWD 4A6YH 4YK4B 5IWLA 2C9AA 2VXVL 1JD9A 1EV2E 1I7RB 2AK1L 4RCAA 4AG4H 5HI4D 3QP3A 2AJZA 3KJ4C 5CD5D 5HYFA 3WKMH 3ARDC 2YLAA 3K4AA 5K9KB 3VXNB 3B9KA 1GGIH 2DLEA 3QFDB 5DRNB 3LB6D 3F7VB 3LHPL 5FO8A 3UBXG 4OGXH 1XH3A 5EU6A 3SKJH 1VJZA 1YN6B 4GO9A 5T33H 1I7UB 4FTVB 1CZ8H 4F57L 4Z7OE 1WTGT 5DVOA 3RO8A 3SEPA 2VZ1A 2GFBA 1QBBA 1U3YA 4HUUB 4F9PC 1HJWA 4X6CE 3KPOA 2OJZH 4JREC 2DQEL 4XBGB 1S5IL 2HTKC 5EUKA 3KYOA 3QIUC 4XNUH 4AW7A 4Z7UE 5BV7B 3TIEA 1JYWA 1OOAA 5LKNA 2J8HA 1A3RH 2P7TA 4LSPL 4P2QD 5CJQL 1FL5A 5EIVA 3CFKB 4JRXE 3EJPA 15C8H 3HRZA 1CLCA 4DAGH 4G9FA 3UDWA 3DHMA 1KWKA 2NX5E 2CMRL 4AIZA 3PWJA 5B39B 4YXLL 2KBGA 3WDRA 1D5ZA 3GI9L 1YHTA 5ESVB 3AYSA 2FD6H 3GJFA 1I7TA 2GTZB 4XAWL 4JRYA 1UR9A 1DBML 3EMCA 2SEBB 1AGBA 3EKCA 4LNRB 4UBDC 4O02L 1WDRA 1MJUH 1ZBWA 2J4GA 2XV6B 3N1PC 4Z2HA 5GNXA 4DFHA 4MWFB 3F58H 4RFOL 4LSSL 4BA8A 4U1KA 5IVXE 1MUJA 4PJ7B 1I85A 1B1YA 1YEGL 4JDZA 5ANME 3TVMD 4GRWE 4CL7A 4IS6B 1U8HA 1F2QA 3VFOB 4BQ2A 1NARA 4KJQD 3ARBA 3W0WA 3UTSE 1R46A 1WIOA 4X0KB 1KENH 2E7CA 1BVLB 2R29L 5BROA 5JZ7C 4X5XA 2XI9A 3GSUA 3BAKA 5EPMB 2ARJB 3DGGB 2ENSA 4K7PH 3WCYA 1HQRB 1SJHA 5IP4A 5BS0B 4W84A 5IHUH 3TOPA 4AIUA 4ZTPH 3BD3A 4GRMB 3MJ7A 3IXTB 1U2HA 4YGVB 5TF1L 1SJVA 4NKOB 4MCZA 5D7KE 4NQCD 5F9AC 3E8UL 4U6HB 4R90H 1DWJM 1XRVA 2E27H 3M1BB 2X9WA 3SDXF 4DQOH 3WO4C 8A3HA 1KOAA 4DTGH 4HULB 5E2WH 1CXIA 1FV1A 1FZMB 2ZCLL 2WWCA 1WCGA 3BO8A 5C86A 4X99A 1OM3L 2QPUA 1CLOL 4H0GA 5D1ZD 4C56B 3GZAA 1BJ1J 3MUGA 2HJKA 3QNYB 4G6KL 4M1DL 2DAVA 3EAKA 1DBBL 5D2LA 4HGKC 3VGHA 2D03H 1MIMH 3RPIB 2UY2A 1XD0A 3BPLC 5C0ND 3O8XC 3QUML 1KB5L 3H42L 5HHVL 2P46B 5JIPA 1G94A 2WKLA 1E6XM 3HPLA 4JFEB 2QHRL 4OIIL 1MHHB 2DQHL 4G8FA 1WE5A 3G9VA 5JTWA 2MKLC 5T3ZD 2EDEA 3O6FC 2YD4A 4EVNB 5GGUA 3N85H 5F9OL 1ZLVH 1YMME 4M56A 1KJ3L 1S7SB 3GI8L 2P8MA 2DN7A 5C09A 1CIDA 1RZJL 3A67H 4HJ0D 4LGSB 2F8OA 1GZQB 4HA4A 4XVTL 5IB4A 1FNFA 4UB0L 5A6LA 1HHGB 3T0AA 3MRJA 3BVTA 4RQQA 1G5AA 1U8MB 3OL2A 4HDIB 1JFQL 5EWIL 5BRQA 2D7QA 1A3HA 3KPQA 4XNZC 1B3JA 1NAKL 3QSKB 4MA3B 4PTWA 4MTVA 3HB3D 5A6SA 1UVQA 1HHJB 2ZUWA 4M7KL 3UCRA 3WYRA 3IXAB 3P73A 5F3BA 1CXHA 5IMOA 1VGEL 5JHDB 1I3RA 5DJDB 1BBDH 2F53A 3VD5A 5I2IB 1D5BA 2YA2A 1HK6A 4CU7A 1H3GA 3ECBB 4LKXB 2V38A 2H2SC 1WAWA 1XYFA 2E7MA 4TTUA 4RRPA 3G6AB 2NLJB 3QG6A 2X89D 4KTDH 5ICZB 2N56A 4JFFE 1AH1A 3C5ZA 3CXHK 1P2CB 1ZT4A 3HLAA 5E9DE 3UG3A 5E8DH 2C3XA 2AVGA 4JL1A 2VE6B 4JRXD 1M6OB 3BVNA 5A43C 3BP7B 3NFSH 1N4XL 1RVFH 3SJVE 4TVDA 2ARWA 2NX5D 2NY3B 4OM0H 5IJVA 2BDNH 1RK1B 2Y1VA 1R3JB 2ZXBA 4IRZL 4JM2B 3VE0B 4HJ0C 4OFYD 3T8XA 3LH2H 4Z5RB 2ALWA 3L4YA 3WD5L 4JKWA 3UTZA 3GBMH 1HOCB 2DYPD 1P6FA 1RZJC 4LQFH 4JY4B 4LP5A 1DBAL 4TUJB 1E6QM 5KVFL 4I4WA 1G7JA 1LP9F 4KRPB 3REWB 2J6EA 2R2EB 4MDIA 1JYXA 3ZYIA 1OF2A 2QSQA 3KWWA 1WCBB 1BVNP 3ZJ6A 1CDJA 5HVHB 4KUCF 1JAEA 3O3AA 5DUBB 4ELKB 3UTSD 4XPGH 1Q94A 4I13B 5A8PA 2IADA 3S35X 3SCMB 2VDMH 3L95B 2Y7QB 2P47B 3PDOA 5DDHB 2Q8BH 4FK9A 4NO0A 1FO0A 2CLRB 4YXKL 1U93B 1JPFB 3CH9A 4Z7QE 3SUTA 4QRPB 1QSVA 4QRUB 1A64A 1WZ1H 1MIEL 3OAUH 1VAHA 5D7KD 3RZCB 5T1DL 3M17B 4Q6IB 3GBNL 1EXUA 1G7IB 2F8VA 3TBSB 2FZ3A 3MYJB 1R6VA 2AEIT 5INDA 5J1AB 1VKXB 2TAAA 5HBFA 3D6GA 4RFEA 4WNQA 1QLEL 2FYYA 1XCXA 3MRKA 5JO5B 1CN4A 1WQVT 1B0RA 3NIDE 2JB6B 1AQ0A 3MBEA 1KELL 5TE7H 4PRIA 3L6FA 3MGOB 1GXEA 2A1WL 3CV5A 2Z4QA 3D3VE 1UWEL 2YD5A 1I1RA 4OM1H 4W4OC 2AAAA 4LKCA 1RUKH 4IRSA 3WIJA 1ZTXL 3UJIL 1WDQA 4PJEE 5DYOB 1RZ8A 3KL5A 5D1QA 3CDCA 3OB0H 2FDMA 4HIHA 1H3UA 1HCFX 3MR9B 2VZVA 4PJ8C 3QUKB 1SR0A 4JN1L 3RU8H 1HHKA 3MV8E 4H5SA 3VI3E 5HYJE 2G60L 1HTYA 1YMMD 3G5XB 3I75A 4GKSA 3U57A 4AK1A 1I8KA 3RDTA 1XGPA 3LEYH 3WLBA 1QOXA 1HHIB 4G7VH 4L3EA 5TJWK 5HYSG 2DQGH 2DQFA 3NN8B 1P7QB 5T1MA 1PAMA 5DO2D 2V17L 3VD9A 3KEHA 1IKFL 1WK0A 2O5YH 2AJ3A 2YS4A 1K8DB 1E6OH 5DT5A 3V4VH 4H1LH 1K5NA 2EH8H 1IMHC 1U8PA 35C8L 4HWZB 2QBWA 5KSVB 2Q76A 5DURB 1K9FA 2CPCA 4YNYB 3NIFF 3GXMA 3ZKNC 2BZDA 3C9NB 5HHQA 3CCHA 1LJYA 5B38B 3QXUA 1EEQA 2LVCA 2X4UB 1EEYA 4JFFD 4EN3D 3OKDA 1HXMA 5E9DD 3SCQA 2C1OB 5EU5B 1CGSH 3QXDA 3QEHA 1JPTH 2VT0A 3DNKA 4QHKJ 5ELIA 3GNRA 4CKQA 3LOWA 3I02A 4LF3A 3SJVD 4I0PB 4YHYB 2BVEA 3DVFA 1DQJB 3LV3B 5D9NA 5C0DB 3BPCA 1ZLUK 3WIIL 5DFVC 2UY5A 5I78A 5ADOL 1RUAH 5D7SH 5DRXA 2WZHA 4DZ8A 3TJEL 1BGXH 5AZ2L 2VC9A 3EOTL 4EZMA 5CINL 5FB8A 3IFNH 4AYSA 1ZT7B 3M8OL 3NFNB 5HJ3A 2QV2A 1AQDB 5LBSH 1FPTH 5FHAL 3KPNA 1JGEA 4TUOA 2N7BA 2FX9L 2Z31C 3HE7D 5C0RL 5D1XB 1E15A 4O51A 4OFPA 3R4DA 4FQQA 1QFWL 4F9PA 5DA0B 2EDOA 3K1DA 2MQCA 3QEUA 4R96A 3QFJB 4MD4B 4DFIA 4WK9A 2XRAL 4OCMC 2H8PA 3QIUA 4HPOH 4O4YH 1YMHB 4IDJH 2G3MA 4JANA 2CNCA 3LDBB 5ESAA 2NMSA 4R2GC 5L0QC 1BZ9A 4UT9H 3QDGB 3CFIC 1KNOB 4X9FA 1HZHL 4CMHC 2XVNA 4MLIA 4AZ5A 3EHBC 4P49A 4L4TB 2Z93B 4RWYH 1FRGL 2CKNA 2VR5A 4BH7A 2Y2WA 1J01A 1TVHB 3CNKA 2I9TA 1EQCA 3OKEA 4G5ZL 1DLFH 4P2YA 3IFPA 4ZUUA 4ZPTA 3IK2A 2XZAH 3GMNA 1FORH 5ITBH 1JK8A 4LRNL 3OX8B 4MZ3A 3T2QA 2DSUA 5C0EA 5HGGS 3VFTB 2EJ1A 2ZX5A 2X9XA 1MJ7L 2WZPD 1QI2A 2GEEA 1KCUL 2GJ6E 1MCWW 4D8PB 4FQJL 4K94H 1AO7A 2OWWA 3UJTH 4LYPA 3KDMB 4N5EC 3AB0B 3NCBB 4KUZL 1GNXA 2ICWA 3D3VD 3RWHB 4UTFA 1JTOA 2EEDA 4Y8DC 4ZYKB 4OLUL 3OLIA 4M3JA 1YPZF 3QCVL 2H9GA 3PWVB 1U41A 3UBXB 4D6JA 1KTDB 2LTQC 4DOHB 2DICA 1OD0A 1N2RB 3DOSA 4N0CD 3REVB 3MV8D 5I1AB 5HYJD 2RB8A 3KPRB 2Y4SA 3GRWL 3OG4B 3JWNC 3DYPA 1HQ4B 1I3VA 2XPGA 1SEBA 2JF7A 3TCLB 3BYYA 4XX1G 3IDYC 2QQKL 5MI0B 2D9QB 2A9NH 3TYGL 1T2QH 4FXGB 4QEGA 3V0WL 4JFQA 4EK7A 1GONA 3NCJL 1UCBL 4LL9A 4FABH 2VURA 1R3LA 2A83B 4PN2A 4M6OL 5C0IB 3BHBB 4WEBL 5JXEA 1JI2A 2AI0L 1UD5A 1JF1B 1JGVH 2JJWA 1KXTB 1PKQE 4YPGB 3NYDA 1Z0MA 3TC9A 4WO4B 1KGXA 4UQ2B 1U8JA 4UIKH 4JHAH 4M1GL 4Y89A 2D0FA 3QHFH 4QRRB 4ONHA 2WBKA 3OJDA 4YQXH 1IL1B 3HNSL 3U7YL 5ABHA 3EDKA 3BLKA 2OL3H 1W3KA 3UJJH 3VWJC 1EHLL 5FM5O 3NCEB 2CESA 1QA9A 3QNZB 1U8QB 4HWEL 1X5KA 3QRGL 3NZ8B 1ZMYA 4L8BB 3QQNA 3CDFA 3O8XA 1NCAL 5FK9A 5AWNL 1LNUB 3CX5K 4PJCB 2VB5A 1V03A 3DV6A 1CGYA 4X80H 3VXSE 2IAMB 4Y88A 3UPRB 3CZEA 2JIXA 1NCBL 4MDPA 9CGTA 4NT6A 1NMAH 2VRJA 1H0IA 2WHMA 3HA0A 4MB4A 1CFVH 4ZOEA 3UAJD 2J7FA 4KQ3L 4XCCL 5D2LF 3VG9B 5FUZH 2C1PA 1EVTC 4WW2B 3BOVA 1A1MA 4ODBD 1H3TA