4CGTA

Deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
678
structure length
678
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPADAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
total genus 228
structure length 678
sequence length 678
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cgtA01
4HCRH 3G9AB 3F7RA 1VFAA 1DLFH 3IGAA 1S9WA 4GQPH 3V6OC 4V1DE 4ZUSA 5FYJD 3AXIA 1I8LC 2EDTA 3QH3B 1CL7I 3KHOA 4P2QE 3CUPB 3B2UC 2VT0A 5E5UB 4W88A 2ESVE 4XCNA 1C3FA 5KN5A 5L0QC 4O2FB 1ZLUK 5C0FA 2D1ZA 2X4SA 4P8UA 3FZUC 3X3GL 3EYUH 2YL5A 4UTAL 2GHWB 3GBML 3KPNA 4KTEL 4RGNB 3KYOB 4MTVA 4Z7UA 4MCYA 4LCCC 1KEGL 4OUUB 3B9EA 2PW2B 2YWZA 4AIZA 3BN3B 3HMWL 4FQXC 3CHFA 4KQ4H 3CSGA 4AD0A 2NZ9C 2J5LC 2NX5A 4L4TB 2QHAA 4PTUB 1A7QL 1KFAL 4PV8B 3RKDD 3IDMA 2FWOA 3KWWB 1KCVL 1FLRL 1R3JB 4G6KL 1YNLL 2ADGB 3HI1B 1O7DC 2B4CH 2JE8A 4WDIA 4X7SH 2FH6A 4AT6A 2QQLL 2BVPB 1I1FA 3F5JA 4K8RC 4JM2A 5ICZB 5F7WC 5ANMA 3MOQA 5CILL 3I6LE 1DUYA 3LXAA 3FZUD 1XGYL 3FRUB 3CUJA 2EJ1A 1WIPA 3MV11 2NY6D 2OQJA 5F6IC 5E2JA 3T1WA 2VH5H 5JW5A 3S4SB 3I3BA 2Q3AA 5CIPH 4JDTL 3L5JA 1QKZL 3VDBA 4FQXD 1EV2E 1K8IB 1N6UA 3VXTB 3EJRA 1BQLH 3O11B 2ICWI 2HKFL 1EO7A 2PTTA 4WI4A 4JB9H 1HHIB 3MCLL 4KTYA 1BFOB 3O6LL 1LQSR 3BEVA 2HKHL 1MI5D 4OD3H 1BAGA 2G3IA 3SY0A 3V9FA 3GUTB 5MHSE 5B8CA 4AZBA 4XBGB 2J75A 1BBJA 3U0PA 1CN4A 4HUWB 1LL6A 1U8PB 4K8RD 5ENWB 4JHWH 3ALGA 2EDWA 1IL1A 5HHVH 5GJTL 1NCWL 3PXJA 4HEME 2R0LL 3VWKA 4DVRL 2VRKA 2AVGA 4Z7UE 5D5MB 1I1CA 2QPSA 1T04B 3D85A 2QHLA 1GZQB 2OMBA 1KGCD 2XZQH 4MJ6B 4V1DB 2BY1A 1H15A 2NX5E 5IBTL 1V3IA 2Y8VA 4P2QB 3VFNA 2CDEB 1QD0A 2ESVB 2OXGA 2NNAA 2VL4A 4PJHB 4QP0A 5GNZA 2D3VA 4M8VA 4WU5B 2FX8H 1I1YA 4UZSA 1HNFA 3WQ6A 3B9VA 4S0TD 2NR6C 2WZIA 1YQVH 4EUPG 3JBG7 4PS4H 4QHNB 3L3DB 3QCVH 1R87A 1Z5LB 2IPTL 5D7SL 5ANME 1MLBB 1HIML 2OZ4H 1J8HD 4GKZA 1FHGA 4G9FE 2WBJB 4HXBH 2ZE0A 3A6CL 1IT9L 3VGFA 5C6WH 2J88L 3SE9L 1A0QL 2HYMA 5B38A 1S7WB 1B1YA 1U2CA 3VOCA 4TTUA 3RDTC 1MRFL 2FGZA 1L7IH 1TPXC 3VXNB 4IIQA 1HEZA 4IOFC 4PJXA 4V2BA 2WB5A 4Y5YA 4UOW1 1HHKA 2O5ZH 4L4VE 2J4WH 3GMLA 3OKOA 2AK4A 1HKLH 5C6TH 3QI9A 1UA6H 4NZRH 3KLDA 1MF2H 2NR6D 5T3ZD 4H5SB 1TVHA 1LO5B 1KXHA 4JDZA 3ARBB 5A95A 1F13A 5SWQA 3W29A 3TN0D 5DQDL 2A3BA 1DUZA 3RU8H 3QUML 3HE6B 4P4KA 4QGYA 1G7IA 3VFGL 1GCYA 2NT0A 4OLEA 1UH4A 1IAKB 1DBAH 1DFBL 1BOGB 1ZJBA 3QXDA 2UVFA 4C57C 4OFPA 1S9WB 4N0UA 4F15B 1JGVH 2XN0A 3S35L 1U8QB 2NY4D 3HRZA 4YK4C 2IGFL 3H2WA 5DDHB 4BQCA 3N9GH 4C56E 4WKAA 5DFWH 3KYKH 3LEVH 2R56H 1F4XL 1T0NB 1ZVYA 4LCYA 4X4MA 4KV5F 1LEGA 1E4MM 1PLGL 3UZVB 4GBXB 4JKLA 3DSFL 4YDIL 1WNOA 2X4SB 4JRXD 1VRXA 2DI9A 3KPNB 3LS4L 4Z7UB 4XC3L 4XX1E 4PGZA 2I9LA 5EBWA 5LBSL 4EI5A 5MENA 4OLWH 4APQC 4AIZB 1NP0A 2Z8WC 4M7JL 2X1QA 5ESVA 1MFVA 1DWAM 3O6ML 5I0DA 3IDIA 3AMGA 4ZXBA 4GKOA 2EDQA 4OOUA 3EW3B 3R06A 3IXTB 1G7LB 5DRZB 2GUOA 1D6EB 3DUSA 5I2IA 4ONGH 2V7NA 4O2CA 5IWLC 3QXUA 1E4IA 3WDJA 2X4OB 4J3TA 5EU4A 5B21A 2O92A 1SFSA 1A7OL 1GRWA 2AEIT 2D03L 3TM6A 4H1LG 1HOCB 5ANMB 3KE0A 1E3ZA 3UJJH 5IMOB 2AK4E 4FQIH 1FNEA 1VB9A 4PJ7F 4NWUH 1YEKL 5ADOL 4J23A 5LQBH 1H0DA 2CR6A 2ORBH 4G9FB 2CRMA 1A5FL 3JSSA 4U1JA 1IQDB 3M46A 1A9EA 4APQD 3W9EA 4KRTA 5JTWA 1D5IL 1INDH 3W38A 4LRNL 4V27A 4N9OB 2G41A 2XNAB 3T0XA 4NKMA 4KC3B 3CMOL 3B2VL 2F8XC 3DMMB 1PQZA 4YO0B 5HYSA 1F3DJ 4OFVA 43CAB 1MREH 1A22B 3WH8A 1MRDL 1N4XH 2NXZC 2MJWA 4GW4B 4XP5H 1Q0YL 4L4VB 4XH2A 3SGKA 5B8CB 1F3DH 1MCWM 5IB2A 5ITFA 2HT4C 3QR2A 4MNQE 3QCTL 2EZ0C 1HF6A 4M81A 2VSCA 3D52A 2BDNL 1IM9B 1YEEL 3ALWA 1BGAA 5EUKA 3T0WA 4OZIA 3CZEA 2KUTA 3WXVL 4X8JA 4DTGH 4KQ3L 1G9ML 3FO2B 2E4TA 5MENE 4HUMB 5I66A 4Y4HC 4XNXH 3WFDL 4C56B 3GSUB 5SWZA 1KACB 1IILE 1A6TB 2BVEA 4NQDE 4OLXH 1SYTA 4FNRA 2HTKC 3BAKA 3GMMB 3QNXB 5EFDA 4TSBL 5EIIA 5E1AA 2WC3A 2GT9B 5A8PA 3OA5A 1UKPA 3WHE1 4HK3J 5HGBA 3CX2A 4TVDA 4JQIH 1TQWA 3QDJA 4XBEL 2GK0A 2JTDA 1JNLH 3VXUA 5I1EH 5TE6L 3PZNA 1IC4L 1KB9J 1KQYA 5TPWL 4B3LA 3IXAA 4L3ED 1K9EA 3HC0A 5K9KB 3VD3A 2X1XR 2Q7YB 5CPTA 3UBXI 2Q76A 3TV8A 1DQJB 2W9DL 3NZHH 3OGCA 1TZIA 3SN6N 4XNYL 4KI5E 4OZFG 2ITDA 3IETB 6FABH 3GRWA 3OKMA 4TTGA 4F7TB 4Y4HD 1XSJA 2EIBA 4PB0H 3H9SE 5C07E 1INQA 1XYZA 1FNFA 2HLAB 4M6ML 3RJYA 1T66D 2HTKD 4TOYL 5CD5D 4RL3A 4F7PB 3DRQA 4U6YA 2AJVL 2JB5H 2XRAL 2YPLA 3BPLC 1S7QA 1HHKB 4HT1L 3S2CA 3FB8A 3OKOB 2AK4B 3QYCA 1ZS8B 4M7KH 4ZPVA 5ADPH 1MRCL 1WIOA 4RGOL 4K71B 1XGZA 4AISA 2P45B 4QRRE 5JNYB 4R2GC 2ZWYA 1S5HB 5EG6C 4JDZB 4YN5A 3EOYG 1S7RA 5SWQB 2VAAB 3SCOA 2VB5A 3UJIH 3QNYB 1DUZB 2AKRA 1G7IB 2Q20A 5GS0H 1R24B 2R29H 3GSRB 1QBBA 2Z31A 3QXDB 5FYLD 1M05A 3ARPA 1BFVH 4TVPH 1II4E 4PGBA 1R5WB 1AGBA 1NFKA 4MQXC 3POCA 4NJAL 2J7GA 1JZ6A 3EFDL 2GAZA 3CHEA 3SKJH 1EFXA 3I6LD 1IAII 4X6FB 3W11C 4XUYA 4MNQB 1AR2A 2CSPA 3WFBL 4MJ5A 4U31A 1E6OH 4RE4A 4YHZL 1DSFL 1DEEB 5DHVH 2IH1B 3DETC 3VXUE 2HG5A 4HPYL 4LLQB 4XX1G 3V6ZA 1QYGH 3HE6D 5DHXB 3RVXC 2WXDM 5F7EH 2I9LB 3GBNL 3FY1A 4Y5XC 3ARGA 4K7PH 4OCRH 3BP4B 4BM7A 4HIHB 1W32A 3IDIB 4NQDB 5GS1A 3CZ8A 4Y19A 5GRVK 3DROB 2GUOB 4MNGA 3DUSB 1CZ8H 5J6HA 5L2KA 4W8LA 1ZHLA 4NC1E 2Y25A 5B38G 4JM2C 1W9PA 4KUZL 3ZKNC 1N6QH 4HS6A 4MQXD 4C7DA 5JORB 4CD6A 2X4UB 5DVLA 5ETUB 1QSEA 4YXLL 1T2QH 2XZCH 4AQ1B 2J8UA 1CDUA 2WUBL 1ERNA 1FGVL 3ULUC 3KPOA 3VXSE 1UZ8A 3V0WL 1J9YA 4PRAA 4LSPL 4RGMC 2NX5D 3RVXD 4HKBA 4JFHD 4OZOA 4U1JB 3W9DB 5GGTH 1WT5A 3H9SB 2YPKA 2CNCA 5C07B 4GRWH 2GTZB 2Y4SA 1WEJL 3W2DH 5CP3A 4XNMA 4FXGB 1HIZA 4U05A 1EVUA 3QQ4A 4GG6A 4NUGL 1S9VB 3V8CA 1GXEA 2Q8AL 4JM2D 1YN6A 3ARRA 5LGHH 4XVJH 4PBGA 4IDJL 3Q5OA 1MJ7H 1KXVC 3X3FL 2IEPA 1MIEL 4QRRB 3VWKC 4D6JA 4P3WA 1BP3B 2GYSA 3IRZA 3QRFM 1UWUA 1QPKA 4QGTA 1RP9A 1QLEL 1NLDL 5DFTA 1PD6A 5BOZG 4YXHH 3WKZA 2WAGA 3MLYH 4EDWH 2F7RA 4NZTL 3LEXA 1OB0A 3WQVA 2IALA 3GSNH 3QXVA 4Z95H 3WQ8A 3SJVE 2WIIB 2A6DA 1Y18A 2CDGB 3BN9C 3WIHL 4ZFGL 1W1VA 5JQ6H 1QI5A 2A1WL 1A64A 3P4OA 4Y19E 1JGIA 2Z91B 3QUYA 5DD6A 2DSKA 1MW1A 3OB0H 5EIIB 3RNQB 4UOZA 1A6WH 4MNGE 1MCQA 2X89A 4GSDH 2XJ7A 1T0OA 1NWRA 4Z78B 1KTLB 4KRPC 3VD7A 3L2MA 5J6GA 4GS7C 1BLIA 1FN4A 3BPNC 1ZA3A 3VXUB 1LG2A 2YJQA 3ARUA 1RUMH 3MOBL 1MFCL 1QSEE 1NL0L 3VWKD 2R8SL 1DEDA 5MP6H 3D85D 3HC0B 5I8KH 3VGGA 5C7XL 4ATLA 3OGCB 3RFZC 2YR3A 4XZUA 4HJ0C 1J11A 1XF2B 1GGBH 2B1HH 4LDOB 2P44B 4FQHA 1CE6B 4IIQC 4AEEA 2EE9A 3BN9D 4TNVF 1INQB 2E8ZA 1I1XA 1QHZA 4D6CA 5HYSG 1VIWA 1CEOA 5GRUL 3QI9C 4RFEA 2Y7QA 1A6PA 4DGIH 3CVIL 2BNQE 4GG6E 3BXWA 4HPOL 5JR1H 3L1OL 4Y4KB 4CBPA 4ACYA 3S37L 2VERN 1DHKA 2HRLA 2Y6SC 4KRPD 4XMLH 1OWRM 5KTEL 5CSBA 4P4KC 3VXSB 3GBLA 2OJEA 3EO9H 4L1HA 5DJCA 2CHOA 2JCCE 3K4DA 3S6TA 3VX1A 3N04A 3N85H 1UUQA 4PJBA 1F6AA 2A9MH 3OHXA 4MJ4A 5DQ9A 2JIWA 2WCAA 4Y4FC 4YHML 2ZCLH 4R96A 3FB7B 4Z7VB 2EDXA 1M05B 4HJ0D 4I3SH 4GKLA 1R85A 5IMMA 3VXQB 2QR0B 2WP3O 4OFYA 4R6UA 2VWEE 3G6AA 3G5VB 3SGDH 5CIPA 3EMCA 1CD0A 1BJ8A 3UTOA 4P2YA 1NUDA 1GAFL 1HHJA 4KKNA 5F3BB 1NLBL 2NY5C 2ZOLB 5CZKA 3CFCH 3AIWA 2AK4D 1QFWI 3DTXA 2MMXA 3QI9D 2IWGA 3T1FB 1HSBB 2IPKA 2HJKA 5CINH 1FZKA 4XHJD 5GSVB 3VGAC 2DD8L 3MV01 5DD0H 3T4YB 4FXKB 3KAAA 3TBVB 1CI5A 3CH1A 1BYAA 2R4SH 3U36B 3GZAA 3KYNA 2HG5B 1VFMA 4JKPH 4N5EC 2HT2D 4P4KD 2K9UA 3VXRA 3MZGB 3V4UH 1C7TA 1G9EA 4ZXBC 4GXVL 3ROOA 5KSBF 3REWA 3SJVB 1K3IA 4L9LA 2MKWA 2V2TB 4HPGA 4KJWD 4HGWB 5IQ9A 1ADQH 3HI5L 2DM7A 4YQXL 2DM2A 3PNWA 4Y19B 2R69L 3LKQA 4GKSA 3WIIL 4Z0XA 5KVFL 3IS0X 2F5BH 5IB1B 3ZR5A 2OSYA 1J0KA 3HRPA 4AEHH 2NYYD 3SUUA 4D9QD 1JWUA 1MCWW 4HS6B 3WDHA 4F9LC 3AICA 4Y16A 4Z9KB 3QP3A 1EOKA 4NUJB 1JZ8A 4OCMC 5GGRY 4AL8L 5GGVH 2C3WA 3MRPB 3F12A 1QSEB 3ARDA 1QI0A 4DWSB 4NQVB 1VAHA 4G8GE 5IBUB 4M5ZL 3OAYK 4WFFE 1CDGA 4QLRA 4EI5D 4LSUL 5MEND 1MCHA 1RUAH 1KPUA 4EDXB 3PWLA 1UZ8B 3KPMA 3BKYH 3SPVA 3D9AL 4N5ED 2ZUQB 4ZXBD 3KL0A 5DJDA 2FX9H 4F3FB 2XFXA 2VLLB 4BFBD 4HF5H 1OAXL 3Q6FA 1ZHKB 5FK9B 4OI8A 4LLUB 3JTTB 3EAKA 5DK0A 4OCXH 1NWUA 3GIZL 4J3OC 4UV7L 2FIKB 2BNQB 4GG6B 1YYLL 5CS7A 1RPQA 3ECBA 5FKAA 3GNOA 2QJDA 4U0RC 3GJEB 1JPST 3MLRL 1X5ZA 3BX7C 4EXPX 1ZANL 5EO1B 4R8WH 2JCCB 5D70H 4ONHA 1QI2A 5M5DA 2IAMA 2V5YA 3O8XB 2MCG1 3JWOL 1VGEH 2E7LA 3H9ZA 1DZBA 1NAMH 1E71M 3UTZA 2XVPA 2Y2WA 5MERA 3DX3A 5D2LA 1TQCB 1OPGL 2A6DB 3KPSA 2H45A 3FN0H 3L3JB 1GPFA 1U6AL 1TZGL 2GJ6E 2W0PA 3LKNB 5CJBA 1VFUA 5DD6B 1QR4A 1HVQA 3SDXF 1CLYL 1SM3L 2DBLH 2JKXA 4UFLA 5FHBL 3PZTA 2AERT 3X11A 1P6FA 4E42A 4N1EA 2PO6B 3PWJB 2WHKA 4PGJA 4FP8L 4KMLB 2QLVB 3ARFB 1KXTA 4DKDC 5JUVA 3W6LA 1J1XL 4BJLA 3M17B 5DMGD 1E1FA 4C83B 2GW5A 5IVXA 1KTBA 3DVFA 4P23A 5SWZD 3UG3A 4ZQKB 5C70A 1X9QA 4DQOH 3G6LA 4FQHB 4O58L 1L9MA 2B7DT 5DJ6B 1I8IA 1OAQH 4GAYB 2OTPA 5AG9A 4XC1L 4DK6A 3U30C 2BJMH 2MCPH 2P8LA 1GORA 2Y7QB 4QHLB 3QDJD 4CVZB 4GKNA 5HHQA 1ISYA 2VDPL 4TUJB 3BGMA 3VXUD 3OAZH 5KVMC 1RH9A 2QV2A 1Z9MA 4G8GB 2DQEH 2A77H 1DBKH 5I1IH 5DJ2B 4HFWA 4OT1H 1P4IH 3LRSA 1DBML 3GKWL 1G7HA 1XGQA 1PX8A 1WDQA 4U1SA 1B90A 2Z31C 4M62H 3DECA 3A5VA 3L5HA 4BQ9A 4MA8L 4YFDB 1F6AB 1PYWA 4LPXA 3CIQA 4PGCA 5GS2H 5DQ9B 3U4BH 3LKSA 5E8NA 4KU1A 4QFUA 1NM9A 3VG9B 3PWUA 1Y0LB 1KJ2L 5D2LE 3KPSE 32C2B 4LCIL 4NO5B 4W6XB 2VRQA 1NGPH 5KJRH 1DL7H 1KN2L 1NFDF 1XGRA 4HZAA 4I0PC 4FQ1L 2YPLD 2YLLA 3TYGH 5FGBA 3VIFA 1QOKA 3G6JE 5GGSB 5F7MC 2HJFA 3NABL 1F00I 2EO9A 4JY4A 3TNMA 2EDOA 4UDUA 2YUWA 2DWDA 2MPAH 5J9PA 1HP4A 1XGTA 4NQXA 4F9PC 3WQ5A 3AIUA 3ARGC 3BEWA 4KKLC 4YBLC 4NOFA 3KYNB 2NY5H 1N8ZA 3NACL 5F1NA 3BJ91 4JY5H 2OR8A 1X5GA 1RZKC 3HNTH 3SE4C 3WH9A 4W4OC 5C0IA 1WP6A 4K9EL 2Z31D 1EJ6A 3WFHA 5KVEL 3PHOB 1DWGM 5IVXE 5IOPB 1OSZA 3KJ6L 5IQ9B 3L3GB 4HX1A 3BUBA 3GXDA 3NCMA 5FOOA 1QBLH 2GJ6B 3LKQB 4GKSB 5J57B 1QWUA 3TCLB 2IADB 1NQBA 1WC7B 1HCFX 1LP9E 1KEML 4LXFA 4ELKB 2UZIH 1JGUH 1EFXD 2OWXA 3L4YA 4KDTC 3CXHK 4LLWA 3NFSH 5HVWA 4Y16B 1UQZA 3CH9A 2XV6B 1UENA 1CGYA 1PZ2A 1WIUA 1WLHA 1E6QM 5HYFA 1OP3K 4NZCA 5D96B 3GSOB 4MXVE 2BS9A 1KPUB 3GHBL 3PWLB 4OQ1A 3ARGD 3U7AA 2DJ4A 3STZA 3V0VA 3RPMA 2VQ1A 3CXDL 1CFTA 1BQSA 4MAYA 4Q2ZB 2RHEA 4Y19D 4Y89A 5J11B 2XFXB 5ID1B 2ZWLT 4EN3B 4M29A 3X3GH 3ZSTA 4UTAH 2OLDA 5L2KD 3WD5L 3KPLB 3GBMH 1GQIA 5KBNC 3UPRB 5A1AA 2P49B 4BSVB 3U0WH 3BWAA 2F74B 5EO0A 4OF7A 1FOBA 4BKLA 3JVGC 2HJLA 1HL8A 2WM0A 4H8VA 1QSED 1JZ7A 2A0LC 3DX6B 4NFCA 2D0HA 3O6FC 4HHAB 5GPRA 1A7QH 1KFAH 2V9QA 4QTIH 4Q9RL 4UT7L 5I8EB 1UKSA 3PWPA 3AIBA 1KCVH 4ZD3L 1FLRH 1A1NA 1FZJA 1JF1B 4JDVB 1GW1A 4G6KH 1YNLH 1W0VB 2UVEA 2X9WA 3VDHA 4CU8A 3MSDA 1GOWA 1EXUB 1A4KA 2OX5A 4ZUWB 3QUXC 2XN9E 1ISVA 1PBYA 2QQLH 4FQ2H 2BK8A 3RAJL 5JLZA 2WMPA 3BMWA 1HVXA 3GHEH 1XAUA 1WWWX 1CFSA 3KPSB 4PJHF 4GMTH 1AR1C 5DJ0B 1YN7A 1T6WA 2JJUA 3S35X 4LASL 5E1HB 3DPBA 3CFBB 1Q9LA 3G6JB 5F7FA 3BXNA 4OZGA 3X11B 3VD9A 4E42B 4NKDB 1QKZH 1XCTA 2F54E 4GLRI 3VFVA 1PY9A 3KGRA 3L6FB 2A0LD 5E8DH 2XY2A 1KXTB 3MXWL 5IFAL 1AXIB 3MCLH 3OKKA 3P77A 5BJTA 2XXCB 3GJFH 1IQWL 3O6LH 4KRLB 2AQ3A 1F6LL 4OCSL 5IVXB 5M7QA 3AZSA 1IKNC 5CSZB 3VMOA 5CJQL 4YAQA 2FH8A 4YDJA 5L0QB 2VDLH 3QUYD 1LP9B 1I8IB 3AM8C 3HR5B 2BV9A 5HDQH 3BKCL 3RPIB 2CXKA 3MZTA 2PXYC 1MIML 3LX9A 2YSSB 5DUBA 5HHQB 3NDZA 2H41A 4F37F 1TIUA 3CX5J 1UR0A 4MB5A 1CQYA 3ET9F 4L3CB 3CJJA 5IBTH 1WZLA 2E6QA 3LQZA 4F9DA 2DDQL 5HPMA 2E9JA 5GGUB 4HFWB 3AHZA 3RNKA 3PWPE 4HP5A 4P8VA 1G7HB 1XGQB 4GUPA 2EIDA 4ESKA 2R0ZH 4LOUC 3LRLA 3ILPB 1EH9A 4RFNC 4CGTA 2CPCA 3AREB 1R34A 2ZSVA 1GPOL 2DLTA 2F7OA 3LV3B 4M6NL 3ZDZE 4WFHE 2H3NA 4K2UL 1JDDA 1OBAA 4GZIA 4BQ6A 1BAFL 1HIMH 3AFLA 4ZFOB 3V2AR 2FE0A 1AMYA 3C60A 1FPTL 3CSYA 3BZ4B 4ODBD 2HJFB 4HQQH 1YJDH 2CRIA 4GZJA 5HOSA 1KJMA 4TVPE 2OJZH 3QISA 2X4TB 3DVNB 1A0QH 4ALAL 5D7KE 4WFGD 4L9LC 3S8WA 1YMMB 1BBDH 5IDIA 1NWTA 4JG1L 1XZ0A 4L8BA 1DJSA 1MRFH 2X40A 2XN9B 4ZSOE 3EJZC 3OZ9L 2ENSA 1A4JB 3TFKD 2FHBA 1UM5L 3NZ8A 2QSCL 1ROWA 4OFYD 2AJ3B 4FLSA 1KT2B 3LEYL 4ODXA 1G6RH 3ULSB 4RAHA 1LK3H 2D7TH 3VFGH 3QUMH 1E4KA 3NIGF 3ARDC 2X4NA 2F54B 4ODWA 4XNZC 4AZCA 1DFBH 1IGCH 2DN7A 1HWHB 5FKPB 4ETQA 1KB5L 4KROC 3BQUA 4HA1A 3S36L 2I25N 3VXRD 1RIVH 4R97C 5C0JB 1G7PB 3BZFA 4IDLA 2GY7B 1I4FA 4X6CE 1F4XH 2VLKA 3STZB 5DA4A 4Q58C 4CU7A 2CPUA 4OZHA 4AYSA 5EC1A 3EJZD 4UZUA 3EYPA 5DLML 4YDIH 3D25B 1AQMA 2KDGA 3L4WA 4LDLB 2NY1C 4KJYA 4H8WL 3CU7A 1RIUL 3K46A 3LS4H 3H42H 4RMWA 5F21B 5CEYB 4N9GA 2NMSA 1LJYA 4JKKA 5IHSA 1KPVB 4BKLB 1TVNA 3ZR6A 4Y16D 5CPQA 4RDQG 4K55A 4M7JH 1D5MA 3O6MH 4GRWE 3ARDD 6TAAA 4JO2L 3PWPB 5DWUL 5IHZB 2ALWA 1Y6MR 3M7SA 2Z92A 2DB8A 5CBAB 5LXGL 3PABB 2Z8VC 4HC1H 1W72B 3NPSC 4LSVL 3RDTB 1RK1B 2XPGA 5T5FL 4U7MA 3PUCA 4KI1A 4C7GA 3QEHB 2B8OT 1CGSL 2D03H 4S3JA 5IMLB 1MPAL 1HQRA 3GSXB 4IMLB 4P8XA 5DJZA 4Z2HA 2A74B 2YRZA 1YEKH 1J18A 2DICA 1Q9LB 1U91B 1ZBCA 3BXNB 1A5FH 1AGFA 3FHAA 4NM8H 3RWCB 4EBQL 1U30A 4X80H 4Z2GA 3WJJA 4RE2A 3P4MA 2P5WA 4I3RL 3ZSSA 3MLTA 4LRNH 1BWWA 4ELMB 5ABHA 3CLEH 4HS3B 5F88B 3CMOH 3B2VH 5EU5A 2IMNA 5IB5A 5KOVC 3SGEI 4P7RA 3P77B 4I2XA 2IAMD 1NKOA 3WDQA 1KN4L 4ZSOB 4P23C 3U9PH 1LEIA 1QLFA 3KVQA 1BPVA 5AUMB 1Q0YH 2FO4A 5DHVB 1K85A 1A2YA 3TCXA 3KPSD 3PGDB 5CCKL 4JKMA 4KTDL 3FQUA 5AD0A 3T77A 3QCTH 4RIRB 1Q94B 4OBRA 3HTLX 5CHNA 5ABFA 2BDNH 3MGAA 2FR4A 3MRQB 1UA3A 5F1KC 1NARA 1KWGA 4WVRA 3WXVH 4K3JH 4KQ3H 1G9MH 5DUBB 1HI6B 2ED9A 4PJFA 5HBFA 2HVMA 4MADA 4LHQB 3FQTA 3KLAA 4JN1L 4MD0A 5GSRA 3WFDH 2ICCA 9CGTA 3MJ9A 1PZUB 5EBLA 4M8QA 4X6CB 4P9HC 2WMIB 5FAAA 1SJHB 3RVTC 3LCYA 4AIXA 4L4PA 4P23D 3PL6C 1FFPA 2UY7A 1RK0B 2ZSVB 3C9NA 3H3BC 1S8DA 1G6VK 1RVFH 2EYTA 4XBEH 5BXFA 5IW6A 3Q3GA 4QXWA 3QEQA 4J27A 4MAZA 5TE6H 2WMKA 1CIDA 1IC4H 4JANB 5FGBC 3VSUA 2QSQA 5TPWH 1FH9A 2CLVA 4WI3A 5C09D 1GOGA 4HWEH 4NQSA 3W0WA 2CLRA 1ZTXL 4EVNA 2LU7A 2W9DH 1KCRL 4RMRA 1K6AA 1YMHA 4EK7A 4GRWB 1F4WH 3RWHB 1JFHA 3HNVL 1C5BL 4H88L 4ZNCD 1GOQA 4Y2DA 2DI7A 5K59F 2EDHA 3HG3A 2P5WE 1I7RB 5T1LB 1R3KB 3TA3A 3ZQ9A 1RUKL 4M6MH 1B9ZA 1MCDA 4BH8A 1J1PL 4M03A 1U58A 4I2XE 4PJEF 3VSVA 4ZFMA 4PV9B 5C0ND 3MXVH 1LD9B 4TOYH 3RVTD 4KGLA 5KSAB 3V5DA 3IK2A 2AJVH 3ZKSD 3IJHB 4UFHA 3FN9A 3NCYP 2NXZB 4HMEA 1C16A 4FZEH 4YDLB 4YX2H 3IDNA 1E4XL 4ATDA 3C2SA 3MGOB 1MRCH 1NC2A 5SX5H 7CGTA 2V3DA 4RGOH 3PE9A 1UH2A 3RZCA 2Q86A 1L6XA 3GSNB 3P0VL 1IAMA 2IQ9H 4HH9B 4MMZC 4J2XA 2G3MA 5DD3L 2YKKA 4XCCH 3E6FB 2JIXB 4FNLH 4ODWB 5LWYL 2D73A 3A23A 4Z7OF 1FL5A 2CMRL 2I9TB 3EOAB 1ZLWH 1FO0A 4YHGA 4HOWA 2YDSA 4QCIA 3BIKB 4MAYC 3HB3C 4KI5F 3BT2H 1KLUA 4MDIB 4MJIA 4NJAH 1Q72H 3EFDH 4KDVA 3ZTJG 4ZXOA 4KVCL 4ODHL 5B4MD 5I23A 3O3AB 2YK1L 3QIUA 4MNKA 3WFBH 4J4PC 5K93A 2BOCB 4KJYB 1XSKA 3QEQE 1E0VA 1WISA 2VMFA 2VITB 1AIFB 3HNSH 2WVVA 2FHCA 1OL0A 3GBNH 3CZLA 1TZ7A 1XCQB 4JIEA 5HDLA 1BQHB 1OAYL 2DQJL 3BZDA 1RPKA 1D5MB 4FQPA 4E4PA 1H9VA 3PP4L 3MBEA 1BTCA 4LX4A 1WBYA 3S37X 4WKFA 3G5YB 4Q74A 1HXKA 3TF7C 3BKML 4JPWH 3TO4B 4MAYD 2DQGL 3HB3D 2CDFB 5I17A 3HG5A 2WV3A 1NP2A 2V5TA 2CJUH 5GZND 3SCQA 1UWQA 1DN2A 4PJ8C 2YIHA 4ZFFB 4CD5A 4DUVA 1I9RL 1YECH 5GRXG 2WWMC 1C7SA 2WUBH 3SO3B 4AYGA 3KR3L 3PDOB 2XFYA 3V0WH 1GJIA 2Y24A 3BPCA 4R2GB 3HS0B 1L9NA 4LSPH 4U1GC 4FRWA 1JGEA 5J12B 5JO5B 4HUVA 1SVCP 2WSPA 4ZUTA 3P4MB 3PWPD 1O0VA 2YKLL 4LP5A 5FA3A 2DQUL 4YGVA 1QZ1A 1TVDA 3QFJA 4WFEE 3P0YL 4I2XB 2OCFD 4GT7A 4OUEA 3GMQA 2R2EB 4M4RA 4NOBA 1P7QB 4G80A 4NUGH 5E9AA 3AHXA 2CIPA 4MJIE 5IW1B 1EHXA 2XKSA 3C5SA 2ZUUA 5GZOD 3X3FH 1MIEH 3QGVA 3WEOA 3Q2CA 4X0KA 4DK3A 5GS0D 3BPOB 3NGBB 3NFPB 5CHNB 2EO7A 5ABFB 2BVQB 2WWMD 3FMGL 2CO7B 2YC1B 4MDOA 2A6JA 4NZTH 4TVPD 1HL9A 2CRZA 4MZ3A 3V5KA 2Z93B 5TGBB 2DLFL 3OXRA 2V38A 1AP2A 4XVTL 3AGVA 1R5IA 5DVMA 2V9RA 1MEXL 2ZKHL 4Y5XB 3FQTB 3DLQR 1QRNA 3E8UL 2DGAA 3QDHA 2PWHA 2ZUMA 3WE6A 1UM6H 1AGDB 1WFOA 1X4YA 3MJ8B 1H09A 4NO0A 1GIGL 4X5LA 4W7VA 1HXMA 4K94C 4K3DL 3G08A 4K68A 4Z7VF 2UWEF 3N18A 3HKFA 1S8DB 3SOBL 1KIQB 5C0AE 4G6FB 3DI3B 5BXFB 5IW6B 3BSGA 3C8KB 3NCBB 3QEQB 4CMMB 3SQOH 2EKJA 1MFCH 3IFLL 2MNUA 1NL0H 3ZYJA 2R8SH 3HUJE 2QBWA 5C0GB 5C7XH 2FBJH 4ZDHB 1MNUL 1HH9B 1YMHB 4S10A 4TYUA 5ALBL 2CK2A 4PLKC 1FVDA 3BLBA 3BIAX 3F5WB 3QXWA 2XGBA 1AXTH 4DCQA 2J25A 5A43C 3NA9L 3GM0A 4BH8B 1HINL 3CH8A 2HVKA 3H54A 4W87A 5A6SA 1JHKL 2ZUSA 4HDIA 3CVIH 5TH2A 4PJIA 1ZV5A 4TX6A 4TQEL 4HPOH 3L1OH 1ZLWK 2PNDA 1U9KA 3QBTB 3S37H 4J6RH 3ZHLA 1H2JA 2DF3A 3W82A 1F3JA 5KTEH 4JFDA 1FNGA 4AH2A 1NGXA 1NAMB 2AXGB 2Q86B 1D6VL 1D3CA 3C60D 4LKCA 4ZTPH 4OJFL 4RAVA 5HGAA 3KYAA 1TA3B 1RJLB 3N50A 4OD2B 1XEDA 4CADB 3BQUC 4O51A 4F8QA 1I7UA 4UNIA 4HV8A 1BVLA 4PLKD 1EO8L 3SDDA 2DEPA 1QRNE 4JG0L 3WEXB 2LVEA 1SYSB 5I9QB 1TQSA 2HFTA 3OL2A 5CJ5A 4PG2A 4QRUA 3NPZB 1NLBH 2WW8A 2OSXA 1JPTL 4PN2A 4MX7A 2C1OB 3RGVA 4XPTL 3MNVB 2DD8H 3B6SA 4POYA 1KSRA 1H0GA 4GS7B 3JUGA 3D51A 5HI5C 5DS8A 3MJ7B 1UJ3C 2WVVB 3WIJA 4C55A 5DT7A 1CFNB 3RO8A 2CIKA 5D6DA 4GXVH 3WFCL 4AD5A 2ICEA 1KPRB 1CGXA 1GOHA 4LQ1A 1B3YA 2JCCF 5IB4A 4EQ3A 3BCDA 3JV4B 3QCUL 5EU6E 1W1TA 3BQUD 4YQXH 4JPVL 3U1SH 1VSCA 1N64L 2F53A 3WIIH 1WBYB 5DK3A 5F8QC 3RTQC 2CH8A 8CGTA 5KVFH 3QHOA 1FFNB 3DO7B 2J12B 4AD2A 2HTLC 2I27N 2VLKD 1YC7A 2GJJA 4U7SA 4JFFD 4DVBB 1FLTX 3H9HA 5DI8A 4WI2A 5I17B 5C0AB 1Q6CA 5EFIB 5LA0A 1UA7A 5GNYA 1FDLH 4XAWL 2PETA 4AL8H 2F8OA 5KZCB 1BX2B 2X2YA 2OXHA 5AZEL 3TV3L 3HUJB 4G7YL 4QNPF 3OGSA 5IKCA 1Q38A 4LSUH 4JFDE 1MUJB 2EKSB 5HI5D 3MRIA 4G8FB 4HUVB 2XUCA 4NN7B 1SYVA 4PG9B 3T0EC 3WXWH 5E03A 5T5NG 1XT5A 5TF1L 3L3KB 2DQHL 1OAXH 4JFXB 4YGVB 1YEJH 3GXMA 5FO9B 5ESAB 1FVEA 3G04A 5CZXC 3WD3A 2W9EH 2WZEA 4UU9A 3KPPA 1MCOL 2FD6L 3GIZH 2EEAA 2HTLD 4H20H 4DEPB 1BJMA 4PLJC 2I60L 1QNQA 3GGWA 4K3EL 5D71L 1KYOJ 4P2CG 3OR6B 4ZNEA 1NMBL 4J1UB 3MLRH 4L8DB 3QFDB 4LHUG 4HKZB 1K4DA 1QA9B 1Z9LA 1QEWB 4M1DL 2A6JB 4UQ2A 2OWCA 4O02H 5J1TC 2YZ1A 5DR5L 3OXRB 2P5WD 4F2MB 1RJYB 3FFDA 1QRNB 1OPGH 1HILB 2IBGA 3DNKA 4DFHA 4D3CH 1UZ1A 3QEGL 3QUMA 3SCRA 4JO3H 4PEEA 3BDXA 3B5HA 4NO0B 3K2UH 1VA9A 1F90H 4WNQB 5FHBH 2FEDC 4PLJD 4RX4A 2XTJC 4FP8H 5CP7A 4JREC 4Q6IB 5JA9A 4QKXB 1P4LB 1EDGA 5CGMA 1NKRA 4OLVL 5KVGL 2A3AA 5C2UB 1UYWH 4B3KA 1R3HB 1VCAA 2E7BA 4Y2DC 2J62A 5B3NA 4P2RA 5GRZA 2PF0A 5EU6B 5J13C 4BH7A 1DANT 5E95B 3CMJA 3TA3C 4NRYA 1J9CT 3X13A 3SUVA 3IFOA 1BQUA 2QEJA 2GUYA 3GXNA 2OW6A 4DCQB 4FN0A 2XN1A 5GHWL 1YUHB 3FAXA 3ARQA 3ETBF 2V2XA 2EYSA 1P84J 3N11A 2HVKB 2CK0L 2VDPH 2Y36L 3FQXA 3SCMA 5I1CH 3RZCC 5HDBE 1IEAB 2FEDD 4X7TA 5FKYA 1WUNT 4RQQA 3ZE0E 1N6VA 3SEPA 4GRLA 3QAZC 4U0RB 2XTJD 4LL9A 5E9DB 4JFDB 3MRNB 1P6AB 3GKWH 4XZBA 3W0WD 4CCEA 1YY9D 1GGCL 3DVGA 3MLZH 2GJRA 3EYFB 4MA8H 4Y2DD 1MYRA 1AFVL 4NP4L 1BMGA 2R1YB 5JIHA 2ATKA 2P7TB 1SJEA 3TA3D 4X9YA 4YLQT 3Q0HA 1ZT7B 1E3XA 2QMJA 3GNML 1JWSB 4Y5VB 3EJQA 3QIUC 4BZYA 1KN2H 4NQTA 1H49A 4X5XB 2EPLX 4FQ1H 5GRYA 3WQWA 1S7XB 4LGRB 1I8MB 2KQNA 3Q5TA 4QXTB 4HOXA 1C5CL 1FIGL 4KMQA 1INEL 4WJ5B 1NC2D 1KXQA 4RISL 4R3SA 3WS3A 3GJFB 3LRKA 1WAWA 5GGQL 3RZCD 4M3JA 1LK2B 5FCUL 3ROLA 3UP1A 3NACH 5J3HD 1XGPA 1AGCA 4HWZB 2APFA 2VXUL 4WGWB 4DZ8A 1UB6B 3MBEC 2VL5A 1DVFA 3VXMB 4ERSL 4K9EH 1ITCA 5KVEH 5IB4B 1HKJA 5IW3A 3FO0H 3AI0A 3B8SA 4XWOC 3CK0H 5CLWA 4MJID 1I8KA 3TTYA 5KVDL 5BS0E 1PZ5A 3VWJB 5J7CC 3H9HB 1S9XA 3QIUD 2VOTA 3MRBB 1GQLA 1UD8A 1AHWC 4N90E 4YHPA 3C5ZC 4Z2KA 3G6JF 3DUHA 1D5ZA 1H8SA 2YL8A 4PY7A 3U2SB 1JN6A 2QADC 4LVHB 3GHBH 3GO1L 5IM7A 4IRZL 1TJIL 5DYOA 4FMFA 1ES0A 4PJGE 5CWSB 5I74C 3MBED 4Q7DA 3UR8A 1SYVB 1PSKH 4PRPE 4L5FH 1P1ZA 1A14H 3DO3A 1RHHB 2EECA 1U36A 3WD5H 4DO6A 4F9JA 4YE4H 1EK3A 1CPUA 1U8KA 1TJGL 5FYKL 3P9WB 4LLAA 3O9WB 3G9VA 4KXZH 4XWOD 2HN7B 4HGKC 4JVUA 2APTA 1ZK9A 2BY2A 1JD9A 2RJMA 2WCGA 1LP9F 2FATH 2BOBA 3CO4A 2X2HA 1WJ3A 4Q6YA 1U42A 3QSKB 4ZXLA 1KXQE 1GVYA 4ZD3H 4FQLL 1LVEA 5AYUH 1IEBA 2HVJA 4WI7A 3TH4T 2QADD 4YBLB 4FA8A 1B0IA 2QHRL 3AHYA 4KJPC 4U6TA 3UCRA 2FLBT 3NCEB 3RAJH 3PG2A 4WRLA 4W68A 2UY2A 3I75B 2OTWA 1E6PA 1G6RB 1QSFA 4IM8A 3QFJD 3QQ3A 4L8SC 2BVUA 2F19L 3TTOA 1G0DA 4URTB 5H2BB 3WUFA 5D93B 4LASH 3LKPA 2X42A 4B7IA 3VNZA 1NAKL 1Q0XL 3GIVB 3IKKA 4QLKA 1C08A 3NFNB 4ZAKC 1QNZH 4JLRB 3O45B 1GZPB 5I1AB 5C0DA 1MVYA 2HT3C 4HG4J 1IZKA 5E4EB 1S7TA 3OX8A 3T0VA 1B30A 3PZGA 4M02A 4FFWC 2OL3B 1A02N 2AOSA 2F1BA 5IFAH 4JFPA 5I6XB 4IJ3B 1NGZB 3QA3A 4EEEA 3BUPA 3VI4F 3B4NA 2PW1B 1MW3A 4OCSH 1HJQA 5H94A 4UAOC 3MUZ1 1LWRA 3ORJA 4BH7B 2F7QA 1QRND 5CXPA 4LYPA 4KJPD 2HH0L 1G94A 5F96L 5CJQH 1QPPA 2ZCKH 3AOFA 2B1AL 2JK5B 2FNBA 2W65A 3DV6B 3DBXB 4R90L 3ULVC 3TTSA 5C0RL 5BS0B 1N2RA 1CICA 4ACZB 1IGJB 2EYSB 1IM3A 1J12A 2X41A 4RZCB 2DMKA 5D7LA 1PPIA 4MD5A 3SCMB 3N0PB 1R86A 1DP0A 5B3JE 4X7TB 1MHCA 4RQQB 1P7KB 1VADA 2DQDL 2HT3D 1XYFA 1OVZA 3D39A 3G6DL 2DDQH 2ZOXA 1R3IH 1G9NC 4JZOB 4PBVC 3VGEA 4FFWD 4L3AA 2VXVL 4PJGB 5K9QI 4PRPB 3PV6A 4Y0GA 3SDDC 3IGUA 1GPOH 2G9HA 3L3OA 4LKXB 3QUXB 3R1GH 5IF0A 2ZX7A 12E8L 4NNXA 1QBML 1SJEB 2DLGA 4PG2C 4I77H 5EOTA 3VH8A 3NCYS 4M48H 3ZYOA 3TVMA 2V5RA 3RGVC 1FPTH 4HIXL 4IHOA 5I78A 4BK4A 4M7ZC 1JWMA 3RIFK 4JFDD 4R3SB 1H3GA 1UQSA 3ROLB 2JJSC 5D6DC 3WUWA 4ALAH 1B31A 4NCC2 4QOKB 1HHGB 3T4AA 4JG1H 4Z7WA 2DKUA 2NY7H 4X6EB 3KL5A 3GH5A 3LKOA 1DQQB 5KSUA 2LTQC 3QWRA 2P8MA 2EDJA 2QSCH 3SDDD 3P9LA 4YDKL 1Z9OA 5CAYB 1U33A 3S96A 4DN3L 2IG2L 2H2PD 5EU7C 2Z4QA 3LEYH 2HMIC 3GSVB 3HAEA 3TH3T 3QEUA 1U3HC 1NBVL 3L3IA 4R0LB 3RIKA 5EBMA 5C08A 3WIHA 3RGVD 3I9GL 4PBXA 1I7TA 1PDKA 4WY7L 2CHNA 5DEGA 5BZDB 1KB5H 1RV6X 2B0SH 4I13B 1B0GA 3S36H 1HP5A 2VX7A 2FJFA 4ZUVB 3AISA 2ITCA 3GMPA 3IDGB 5F9OH 2A6IB 2WINA 4ODSL 5IM7B 1UR2A 2ZXBA 1A1MA 3D2UA 4ELMF 3TZVA 5AY7A 3O6KL 1MFEH 2F53D 1BEYL 5DLMH 2CEQA 4IMKA 4GQQA 2BFVL 3SQBA 2AJZA 4IOIA 1JHTA 2V2WB 3JV6A 1RIUH 5E6IA 4F80A 3E1F1 1BD2E 4PSPA 3K8LA 5D4YA 1XF4B 2WIMA 4GINA 2HMID 1P6WA 4HLZH 1HE7A 3BH8B 1JAKA 5DSCA 3WUEA 4GQRA 3N1PC 1DN0B 4JQVA 3BUYA 5CZVL 1AY1L 4QRPD 4LF3B 1TCRB 3QIWC 4M1GL 3RVVC 4EZMA 1ND0B 1OARH 1A7RL 3HPJA 1LNUB 5TDNB 3UEZA 1RZ8A 3EGSA 2YUXA 3E2HB 4UV4H 1E9LA 2DJUA 2Q6WA 5LA1A 3L7FA 5H35B 4PP1C 4Z7WE 4GRMA 2F18A 3WF0A 3WF1A 3EDDA 3EYSL 4P5KB 4X6CF 4O4YL 4NKOA 2PYEB 4YR6A 1CGSH 5F1IA 3AXHA 1ITBB 4ZS6C 3QOMA 1FIEA 1MPAH 4UI2A 2EH8L 2VXTL 1OGAA 5GQBA 4H04A 1JVKA 3DGCR 3MOAL 3WNNA 2Q1EA 4HG4K 5I1LA 1KLFA 5JUEL 4G3YL 3LKPB 3MRLA 1CXIA 2GDUA 4OFDA 3EO1B 5SV3A 1S5IH 5C0DB 2DMCA 4LSTH 3H53A 4N68A 3O3BA 4I3RH 4XNZB 4Z2LA 4LEOB 3QIWD 4Z8FH 5A3HA 3RVVD 3HZYB 5BRZA 4JFPB 4ZTOH 4HKJB 4KROB 5D7IA 3UESA 4GRWF 3VFWA 5DMKA 4U4BA 4R97B 1OW0A 5EOQL 3HU7A 1IC5L 3FRPG 4U1LB 5H94B 4PP1D 3WS6A 4MXQC 5FCSH 3I2CL 5BO1H 1V7NL 5CMAA 4KTDH 1Y6KR 4F58L 3H3PH 4HCRL 3NSXA 3LPOA 3GSWA 5HI3C 3WIFA 4ZS6D 3RWIA 2NY1B 1FNHA 1CG9B 2RGMA 1YY8A 4P3DA 4RWYH 5DJYB 1IM3B 1BLNB 4RMSA 4GRLC 4MQTB 3B8YA 4RX4D 4PCSA 2LVCA 2WVTA 3ULVH 2V7HA 3B3IB 3QR3A 3WF4A 4U6VH 1YEHH 1PKOA 3OLEA 1LG1A 3TBSB 1ODAA 2AJSH 4L9DA 3UROR 4FQQA 5JOEA 4V2CB 4PGDB 4P2RD 5C0BE 1O7AA 4YGAB 5M94B 3MUHL 2ZCHL 5DUML 1UD4A 3PV6B 1V7ML 2X1PA 5KS9F 3UO1L 2G9HB 3FOLA 3L3OB 1R8LA 4KQ4L 4ZOBA 4QWWD 3QDME 3Q6GH 3RWFA 1CFBA 1BD2B 3QRGH 4FLQA 5A8QA 5I15L 4DAGL 3BVXA 5JOPE 4A2MA 1NEUA 4P5TA 5HI3D 1GHFL 3MRJA 5F7NC 1EXPA 1ZTXH 3MMEA 3SCMD 3O3EB 2X2IA 2Z35A 4X7SL 5KZ6A 5H37H 3HNVH 4GRLD 1C5BH 4B41A 4WEMB 2VX5A 2FSEA 4XTRC 1DVFC 5DTFB 4LRIA 2X8RA 4IS6A 1C12A 1J1OL 1J1PH 5ESQA 4KKCD 5BRZE 3N9KA 1M6OB 3MNZA 3ABZA 3APGA 4XRCA 3IYLW 1T6VN 1A47A 2XWBA 1E4XH 4D0BA 5FA4B 2R0KH 2DIEA 2EDFA 1X4XA 3E6HA 3CC5A 5E2WH 3MV9A 3QEUB 1S7UB 3MO4A 4JB9L 3MLUL 1VERA 4JFOB 5LWYH 4CJ0A 2CMRH 5I75C 1I7TB 2DMBA 3PWNA 3DX7A 3TBTB 1XR8B 1PGRB 2HAZA 4J8RA 3MFFB 1HTYA 1GVIA 4XTRD 4DGYH 2ITCB 3GMPB 1DVFD 1R5VB 3LMJL 3OTTA 4AMXA 3PXHA 5HHVL 3BDBA 2PBGA 3HI6L 4ODHH 4X6BB 5GGSY 3PL6B 1E5JA 4NDMB 2XZQL 3K74B 4IOIB 4OV5A 1AXSA 1Q9WB 1JHTB 3AIEA 1V3JA 3JV6B 2BRRL 1WK0A 2VZ1A 5FM5O 3VH8G 1I1AA 3IFNH 1DLHA 3F6IA 1BSIA 1FZMA 4PRHA 4Z7WF 1OAYH 4LDEB 2D7NA 2AV1A 1N3NA 1RP8A 3LDBC 4PJ7A 1US3A 3UTTB 2DPEA 2FX8L 3UYRL 3PP4H 2D3NA 3TLRA 3ZIZA 2YDQA 5FOJA 1VJZA 4PS4L 1CZ1A 1MHEA 5C0BB 2W1NA 5BZWB 3H7BA 3WUWG 3QCVL 3LN4A 2Q6WB 1UVQB 1HXYA 3KNBB 4PYGA 4Z7QE 2DQGH 4LCUB 3CZKA 1OCQA 5DC4B 3SGDI 2OZ4L 5IK3A 1AKJB 1VACA 4UNTA 3QDMB 2FCBA 4A6YH 5D7JA 5F1IB 1PZ3A 1I9RH 4WHYH 1I3UA 2WQ8A 1A8JH 4Z77B 1W2KT 3KR3H 3RL1A 3DX8B 1EDQA 3GH4A 2D3LA 1VKXB 3HAEG 4PUBL 1CWYA 5EPMB 3DYPA 4UQAA 4W89A 3W6MA 1KJ2A 1L7IL 1I3RA 1X7QA 3HC4H 2V3FA 4Y88A 4FZ8H 2YKLH 3HCVA 3LSOB 3F7VB 3OAUL 3BP6B 4PRWA 5C6TL 1HKLL 3OKNB 5BRZB 3ULUF 1UA6L 3P0YH 1MF2L 3QIBA 4WCYL 3VFWB 5DMKB 4I5BB 2NW2B 5FUZL 1JXKA 3ARVA 3IJYB 4WV1A 2FEEI 1QSFD 4P2OC 3NSNA 4XPFL 3IAGC 4I1NB 5FOBB 3MQIA 3T65A 4X5WA 4S3KA 4LLMA 3RY5A 3WIFB 4NNYA 1JGVL 1LE9A 5EN2A 3UX9B 3O3DA 3UAJD 3OKDA 3N9GL 2A73A 5IB3B 3KYKL 5HGDA 2H26A 5A2CA 1HXJA 1KV3A 2QMKA 4NPYA 2DLFH 1K2DB 1E1EA 4U6XA 4XVTH 3VFRB 5BXSA 3G5XB 5FV2A 2CLZA 2OWWA 2ZKHH 2ARJA 4QF1B 2XA8H 4FTVA 1BGXH 2NY2B 3E8UH 4PJ7E 3BSHA 5KG9B 1QO3A 4X98A 1BYDA 3WO3B 3U46A 4OAWA 3RBSA 3FT2B 1GIGH 2DYPA 1GNXA 3SKNA 3D0LA 4K3DH 4HWBH 4MWFB 1T1WB 1UWSA 3M45A 4JRYE 4OLWL 2XWJA 1W91A 3CBWA 1CLZH 4PMZA 3SGJA 5FCZA 5D1XC 1T7XA 3S98A 1FRGH 3TVMC 1CICD 3L9RA 3WENA 5C92A 3F7PC 5T33L 2NW3B 3IFLH 2HFEA 4MA3B 1PKQA 3DV4A 1JNEA 3CUFA 2MHAB 3FFCA 3CCHA 4PJCE 4P3CH 5D7LD 5D1QC 2YUZA 1MNUH 3GB7B 3R0NA 3NMEA 1SJVA 2GSJA 2Z35B 3B9DA 4GAFB 4LQFH 4RMUA 4MB3A 4U1GB 1XHGA 1NC4A 4P99A 3D39D 4G9DB 4U6HA 3P4NA 5DO8A 2FSEB 4YHNB 2JIEA 5C0CA 1BVKB 3A67H 5DEFA 5IJVA 5HJ3A 5IMKB 3NA9H 2VI0A 1IGYA 3NCCB 4FQIL 2FYYA 4WO4A 4D0CA 2C3VB 1HINH 2ENYA 1NOUA 3SCPA 4R7NB 4K8RL 5T1KA 2WNWA 2ORBL 4TQEH 3BSZL 3QO0B 3H9YA 5IFPA 1O5DT 3MROB 1GOIA 3H3KA 4ZFOL 4N8VG 2A9NH 2VE6B 4NKQB 4D0BB 4PJXF 3TVMD 3U9UB 3E6HB 1PFCA 3BWUC 1CLCA 3DX9B 4QAWA 1D6VH 5CLTA 3KHQA 4OJFH 4CMHC 1KGWA 1E6SM 4BSWB 4NO2A 2OMNA 2H32B 4ZOAA 3S3SA 4QRTA 5BXRA 3HUJF 2CYGA 3PQYA 4I0CC 5HYQB 1CYGA 1T1YB 4NN5B 4P57A 1EO8H 3MGTB 2AXFA 4J8RB 3SDCA 4JG0H 1PEZA 3TZVC 2WZPD 4ZMAT 1FP5A 1OGGA 1KIPA 2F7PA 4PJ5E 1X4ZA 4IEFB 4KK8C 1A3RH 3QWRD 1FBIL 1BM3H 3D5OF 1HKIA 5E6IC 4WHDA 3PHQB 1OSPL 4WW1A 2RCSH 3J7HA 4AD4A 1MVUB 2VIRB 4U1KB 4FNQA 3CLFL 2NXYC 4ZENA 4OLXL 5C08D 2BSRA 4HK0A 3U0TA 2FL5A 3SKOA 1MHHB 1GL4B 3BRDA 3CLWA 2PYFB 1FH8A 4GJTB 3WFCH 1ISWA 2OYKA 1O6IA 4K3GA 4TVCA 4PJ7B 5E94A 4JZNA 3QCUH 2NY0C 3OQ3B 5I0ZA 4Y1AE 1N64H 3VDAA 1WDRA 2XSBA 1XGUA 1MHEB 4E8CA 5F9WB 1UEYA 3SE3A 2DM4A 1P5VA 3N17A 3D2UD 3TZVD 4CW1B 2CGRH 3ARWA 4P46A 1S78C 4JRYB 4O5LH 3TO2B 3HZVB 1DWHM 4NRXA 4KK8D 4P5MA 4NO3A 3HZMB 4X7DC 2EH7H 3WH6A 5D2NC 5D7JB 3L5IA 5E6ID 3RWEA 3WFLA 3MRFA 3DYOA 3G5ZA 3TV3H 1MCSA 5I71B 2G3NA 4G7YH 1SEQL 2P47B 4PJCB 6FABL 3TIEA 1UACL 1AQKL 2D2OA 5BVJB 2J7FA 4ZUUA 3LD8C 2NXYD 1DDHB 3MRHB 4WHTA 1K6QL 4LLYA 3POHA 4QO1A 5GJSH 4X4XB 1Z2KA 3KLHD 2JB5L 3Q48A 2DQHH 3AAZB 4DN4H 1W72L 4M7KL 1KLGB 5ADPL 4UFMA 2NLJB 3QIBB 3WS6C 5E8EB 2FD6H 4HBCL 1TENA 2D0GA 3IRPX 5FEBA 4P59L 1BZ9B 3IU4H 4K3EH 3RWDB 3B5TA 5D71H 3GMOA 2J2ZA 2VR9A 1UOKA 1LE5B 1OGAD 3C09C 2CITA 1NSNL 2R29L 3ESVF 3MX0A 4D0DB 1KC5L 3T65B 1S7SB 5DFVC 2B2XL 2VVNA 1CXHA 3CFEA 4NNYB 4BELD 1RSFA 2FZ3A 1NFIB 2X10A 1QUNA 1LILA 5HGDB 4U2ZA 5IEHA 1UJ3B 3LAFA 3FCTB 4WUUE 3P30H 3BFOA 3SKJL 2CLZB 5A16A 5BRZD 1OLZA 4AMCA 5BQ7A 4MYWB 3QEGH 5DK2A 2G2RA 4PJ5B 1N5YH 3TIDB 3L7EA 4F66A 3VXPB 3RTQB 5INCB 2B31A 1I1RA 4OAWB 3C5JA 4HIEB 1TNMA 1ONQB 2VUYA 4JO1L 3CZGA 1KJVB 4XNQA 1KB5A 5ERWA 5L8JB 1MCLA 5F7EL 1MWAL 5F3HA 1XIWB 1JZ5A 4WTZA 3MUAA 1JPFA 4NBZB 4GAJL 4OCRL 4P5TC 4TUOB 4WW2C 5E2UL 3ILQC 1ZLSL 3A47A 1ZHBB 4OLVH 5DZOA 1MY5A 4DKEH 1X5AA 1WBXB 2HFFA 1ZT4A 2HFEB 4QY8A 4N8CH 2XI9A 1VPOH 3IVKB 3GDBA 4NYLB 1CZ8L 2X4QA 4QTHB 1M71B 3ZT7A 3QHNA 3QDGE 5IQ7L 2DH3A 4Y1AB 1NC4B 1FCGA 5DQJA 3JWDH 4S1SH 4DOHE 1QG3A 1NBYA 5EULV 3HHRB 1E0WA 3UBXG 1UG9A 1YEFL 1AJ7L 5GHWH 1T2QL 2XZCL 1QQDB 3RKPA 1U93A 2I26N 3MPCA 3VI3F 5CD3A 3PZMA 1IGYB 2AXHA 2GSIA 3I02B 1S7VA 2JEPA 4OCWH 3JWOC 4MA7H 4E41E 4E9LA 2FRGP 5FECA 4OM0L 2GKIA 5I16A 4CCDA 4PUEA 3UTSA 5GGTL 5JOFA 4JL2A 4KUCF 4P5TD 3ILQD 5DJ8A 3W2DL 1MHPL 3IDJA 5F89B 5BVPH 1OGBA 1YNTB 5CUSL 3VTRA 4PJ9A 3WD1A 1JUFB 3TJEH 1GGCH 1UZ6F 1QFUH 1FHLA 2IQAA 1OB1B 5MEPB 4HZLB 5CJOL 3VG0H 3ZKMC 4F37K 1AFVH 1GC1C 4NP4H 5C0EA 1CT8A 3PHSA 5LGHL 3RUGA 1P69B 3STLA 4HUKB 4OQTA 3GSQA 4O9HH 4XVJL 2DL2A 1NBZA 1KTKE 1Z6JT 2L0DA 3FT4A 3RX5A 2CKBB 5DT1H 4MJ2A 2FJHA 3AB0C 2A83B 3IDYB 3MLYL 3GEWB 3BYYA 3VFPA 4N1HB 1INEH 2W67A 3OG4B 1E4JA 2VISA 1LO2H 4Z95L 1NCAL 4LVNB 3PZUA 1I1AC 3A4WA 1WCBA 43C9A 3D1MC 3MV9D 4OTXL 5HHOA 2GFBA 1N5AB 4R27A 1G7QA 3QZWA 3UTPE 2CKNA 3SKOB 4WUUB 4HJGB 1XH3B 2O9OA 3ZM8A 4CD7A 3V6BR 1AE6H 4IRSA 4TPRH 3ZJKA 2WBWB 1RAMA 2BZDA 4NQCE 2I07B 1JNHB 1OQXA 3LPWA 3BP7A 5E94B 3T2OA 1RULH 3N1FC 3BDYH 4OLZH 4POUB 3C08L 4BZ2H 1YYMH 5D1ZA 1ZGLA 5A6MA 4M6OH 1RMFH 5DUPH 3OKEA 3SDAA 4PMUA 3PGCA 2WNGA 3KPRE 5KVDH 4P46B 4I18C 1RURH 5FB8B 5MP6L 5BYWA 1VEPA 1ZWIB 5I8KL 3WMSA 2D23A 3KWXA 6CGTA 1AVAA 2JEQA 3F5LA 4DUXA 1WV7T 1NGYA 1OM3L 3D18A 3UTSE 2PI6A 4P8WA 1I1AD 3MCG1 1XF5B 3QAZB 1W3KA 2J77A 4JCLA 2EDDA 4PRHD 5C8BB 4IRZH 1OAKL 4D8PB 1TJIH 1H11A 3QDGB 4AZ8A 5IJKA 2J8UF 4LLYB 5IT2H 3ALXA 1UR8A 4DOHB 3WSQH 3D69A 4DGIL 1A9BA 5JR1L 4JEGB 1W3LA 2R2CA 3D3VE 5FM8A 1KTCA 2DH2A 1TJGH 1RZJH 4MNHA 5FYKH 4WV1C 3IJ8A 3D0VA 1ISZA 5KSBE 1HH6B 1U8OA 1FZOB 1TFHA 4XAKE 4XGZA 5JIKA 3L5XH 1D9KA 4E41B 4IPNB 3GMOB 4PTTA 1E6NA 3EOBA 4JGJA 3SDXA 2SEBA 2BNJA 5GNXA 1H8OA 5JPNB 4BQ2A 2GK1B 3LKRA 4OSUH 4QHUB 4FQLH 4NNPH 5A6JA 4NBYB 4FHBD 3VRJA 3FQNA 3BVNB 4Z76B 2YD5A 3FB5A 1E4WH 1I9JH 2QHRH 3M1BA 5I1DB 5IEHB 2VKWA 5ICXA 5HYJA 4MSWB 2QF8A 4X9FA 5MI0B 4MNJA 5K9OA 4PRNA 4EANA 2R15A 3ZT6A 1T5WA 4U1IA 3QIBD 4PJGF 4OKVB 2F19H 5DK2B 2G2RB 2GTWA 5CINL 4W8BA 2J8GA 3O2VH 3EO0A 1V6VA 4NSBA 4D6HA 4LNRB 3SGJC 1Q0XH 3K8KA 2ZSWB 3ULVE 2L7UA 1KB5B 5D9SA 5K33A 3BVUA 4CNIA 2O61B 1T1ZB 4PP2B 1QW9A 1NDMA 1EEQA 1OLLA 2OI9B 2F61A 2G8ZA 5TE4H 1EERB 1ADQL 1AHWB 2GSGA 4JFZL 3IJ7A 3C5ZB 2HFFB 4QY8B 2D4DA 1KIRA 2F5BL 3KDMB 3PZIA 2FEEL 4NQCB 4J28A 1QNPA 2X4QB 4DZBA 2OTUB 2DSVA 3MLSL 4AEHL 4FTVD 2VR5A 2HH0H 5F96H 5I74B 3MC0A 2UYLA 2BXZA 2V5DA 5I5RA 4WO4C 4ONFH 4P48A 4PMQA 3EHBC 1P9MC 3KPRB 5GGVL 5C0RH 2DYPD 1H3UA 2EPOA 3VPLA 4UFJA 3OMZA 2AJUH 1S7VB 3QH3A 1CIUA 2CBJA 1RUAL 4BUHA 3BKYL 4JHBA 1JPSH 2NY3C 2X6MA 1JTOA 1FYTA 4NN6C 2DQDH 4O2FA 3G6DH 1UWGL 3SDXE 3FFCD 5JOFB 3ULUL 4HF5L 5DZLA 2P48B 3C8HA 5B22A 3KYOA 4OCXL 2OR7A 4OUUA 1NC4D 5GGVY 1R3LB 2PW2A 3EKCA 1BVZA 1YA5A 2BMKB 3SDCC 2X9YA 3JTSB 1OY3B 4X4ZA 5C0CD 3QJHB 3D3VB 2WHMA 12E8H 1QBMH 3MKKA 2QSTA 4HFUL 4L4TA 5LJYH 1V02A 3ELAT 4NT6B 5DA0B 4PJBF 5KSBB 4WO4D 1HHHB 1WFUA 4PV8A 4R8WL 3OPZL 1R3JA 4M80A 2X4PB 5T1KD 2FJHB 3GMRB 4ONOA 5EZLB 2ADGA 3HI1A 1A3LH 3TWCL 3DXAD 2ZX5A 4DWHA 1NAML 3Q5YA 4GW5A 1MAMH 1TCMA 2NY3D 2VABB 5ICZA 1WCBB 2JJVA 2O93L 4MB4A 3KLLA 3OR7B 2GFBB 4N1CA 4Z7NF 4D6FA 5EU3B 3IJSB 5B3JF 5F7UA 4AY1A 1U95B 3FRUA 3QZWB 1J0ZA 1OAUH 2J6EH 5DC9B 4IRSB 3PQYD 4JFEB 2DBLL 3WEZA 3DX0A 3S4SA 1V0LA 5HVHB 2PWEA 3SE3C 4UAOB 3SDCD 3QUZC 4CVXB 4GQ9L 3SE8H 1K8IA 3VXTA 3OKEB 1T20A 1DQLL 1HHIA 1MCNA 1JXJA 1X6LA 1BFOA 4WK9A 1A7PL 2A6KB 3I9GH 1UCTA 2CKSA 3W25A 1J05B 3GUTA 3R4DA 4XXCC 1FYTE 1JE6A 1EHNA 2UUDH 4DQOL 4PMDA 1VESA 1NFDE 4HUWA 1JRHL 1U8PA 3V7AG 5ENWA 1OAQL 1W3JA 3T3PE 3O41B 3ZKXC 4EI6A 5E5MB 4W4NA 4PD4J 3PTKA 2DT1A 4UTBL 3HFMH 4OFIA 2OW7A 2ADIB 1T04A 1IE5A 4EQ2A 3OJMB 2WC4A 4MJ6A 4V1DA 3IT8D 3BKJH 1KULA 1DBKL 1V02E 2DBJA 4OGXH 4P2QA 1XD1A 1EFQA 2EDNA 2CDEA 4OGZA 4PJHA 3GI8H 1AY1H 2ERJC 3O3UN 4M62L 4B15A 1CDBA 1XF1A 4M1GH 3ZDYF 4WU5A 5BRPA 3SDXB 1A7RH 4O00A 4F33B 5I73C 3UPAA 5F7YC 1VENA 3U4BL 1CDJA 4GOSA 4QHNA 3L3DA 1Z5LA 3LQAC 3PZQA 4PR5B 5I2UA 1U8HB 5EZIL 5IROA 4BYHA 5KJRL 3QXTA 1G7JB 3EYSH 1U8NB 3TYGL 3VIMA 1OAZH 2WBJA 2IANE 3RVUC 5JHLL 1UWXH 1NGWB 2EH8H 1MCIA 3MOAH 4BA0A 1S7WA 3IAQA 4GXUN 5IVNA 1W1YA 2NY5L 2ZJSH 1SEBB 1U3HB 3QNZB 3WN5C 5D9SB 4JY5L 3VXNA 4WLCA 3O4LB 3EMQA 4NM4L 3CFJB 3GXTA 4UQCA 3AMCA 3P4LA 1Z0MA 4H8WC 3L4TA 4H5SA 4YHYC 3T2NH 1LO5A 2ED8A 4AK1A 3OZOA 1V3LA 4RFOH 3ARBA 5EOQH 4JHAH 1JGUL 3FO9B 5E0FA 2H9GB 2YOCA 2Y5TB 3X12B 3VW3H 1JFQH 1N26A 4PGEB 1D5XB 2UYLB 1IAKA 2XY1A 3NFSL 4R4NC 1PS3A 3RKDC 4F58H 1BOGA 1U8IB 3HG2A 15C8L 4X6DE 1GJWA 3RVUD 3HJEA 1MJ8H 1U8QA 2XKNB 4XP1L 5DDHA 1TR1A 4G6AC 1K4CB 2YBRA 5MEOB 1BJ1J 2APWA 2CETA 4R4FH 1T0NA 3LPFA 4XVUC 3TBYB 4PJHE 1EGJH 3SURA 2C1PA 1FYTB 3BAWA 3FAWA 1BJ1H 1EAPA 4TRPH 1NFDB 2OM5A 3BJLA 4GBXA 4PJ9C 3UTPD 2BVTA 3WH5A 1I85A 1HKFA 2GJPA 1R7OA 4CUCA 3VE0B 3OJDB 1TQBB 3THMH 2NY6C 4A6YB 3S88H 1XMWA 3ZDXF 2KQMA 4C7FA 3U0WL 3MV8A 3HZKB 5JPMB 2I5YH 2ZCHH 5DUMH 1V7MH 3UO1H 3FB6B 1XH1A 3W81A 3D87B 2PN5A 1F11A 5I15H 4DAGH 4R4ND 1JGLH 4QTIL 2VVSA 4CD4A 4S1QL 1MCEA 1CF8L 3P73B 5HY9B 3IXTA 1G7LA 2F5AH 2PUQT 5DRZA 4PTMA 1F8TL 1GHFH 1D6EA 2XZAL 1OGSA 3W0KA 2OSLA 4HW6A 3HZ3A 4G6AD 1H3TA 2X7LB 3UTSD 2W60B 2XSAA 1CGTA 1ZS2A 2BNRA 2X4OA 4GW5B 4FQ2L 1NEZB 4JVWA 4XVUD 1G7MB 4LLVB 4RDQF 3O2LA 3GHEL 3VM7A 4DGVH 3VFSB 1NDGB 4PJ9D 1HOCA 1RQ5A 5IMOA 1J1OH 4GMTL 1A1OB 4HMCA 3DC0A 5JIWA 5DJAA 5DRNA 5D1ZC 2VCCA 2JF6A 5FD0A 4U33A 4G9FA 1BGGA 4XZWA 2IANB 1JF6A 5F70A 4HD9A 5ILTL 1IQDA 2NTFA 4N5UA 4FF5A 2DTSA 4XAKD 3C6SA 1OTSD 3S5LB 2XNAA 5EB9A 3PZOA 3HE7A 2W92A 1T20B 2EC9U 5E8DL 4W84A 4XXDB 3DMMA 1KTDB 4YO0A 3MLUH 2VQUA 43CAA 3WD4A 2YRLA 4WIWA 4MXWL 4WU7A 4JQXC 4GW4A 4L4VA 5D6CB 5JHDA 4U2YA 5HHOD 4RBPK 4PD4K 1OP5H 2VDLL 4G8IB 3LMJH 4IRSD 4EI6B 5HDQL 1BWMA 1IM9A 4HWUA 1FE8L 3HI6H 5JIPA 3MV8E 1H4PA 5D1ZD 3FO2A 5C2BL 3VFUB 5FFLA 4X6DB 1GOKA 1DR9A 2GQHA 3SDAD 4KRMB 1D9KC 1UC6A 3MO1B 3GSUA 4Q9BA 5EZJB 4C56A 2BRRH 1OGTB 4G43B 5FO7B 4NX0A 1A6TA 3BMVA 1LQ0A 3FNDA 3GMMA 2DAVA 3QNXA 3AS2A 2GT9A 1V8HA 2R0ZL 4LGPB 3UYRH 4OJYA 5ACZB 1HT6A 3PZ9A 1RJZB 1B0RB 2BNRE 1LL4A 3W24A 4CD8A 3NIGE 1C1EL 3TN0C 1ZEAL 4PBWD 1BIIB 4KVNH 5L9DL 2CBIA 3RQ3A 5EWIH 5K9KA 2R0WL 1ZA6A 4C4KT 3VRLE 2Q7YA 1G1YA 1LO0H 1DQJA 4YIQA 1GOFA 3UG5A 4LAJH 3LQAH 3S4SG 2NT1A 4HQQL 4Z6AT 1JMXA 3RHWF 4CVWA 1IT0A 1YJDL 4C59B 2VUOA 1EDTA 2NY4C 1EUUA 1JCKA 2OJZL 3IETA 1B3WA 3VCLB 4B5EA 4F7TA 2VLJA 3E3QE 1D9KD 2ZUYA 1HSAB 4PUBH 2HLAA 1BBDL 1YNKH 2CERA 3AROA 5FYJH 3TESA 4ZPTB 5DJXB 4F7PA 2AI0L 1UWEL 4R7DB 3WJLA 5I75B 2Y06L 3OAUH 5JHDE 3NTCL 1ZS8A 1U8LB 3WNMA 4UCFA 4J3UA 4KRNA 2Y1VA 4WCYH 1RZKL 3WL9B 5JNYA 4ZE4A 4J12A 4I9WE 5FUZH 1S5HA 5HYJD 1G6RL 4UDTB 1UWRA 2VAAA 1LK3L 2D7TL 2JB6B 2ZUVA 3BD4A 3QNYA 5SWSA 1E28B 4XPFH 2P4AB 4QXGH 4Z7QF 1R24A 3WD2A 3GSRA 1IGCL 5TE7H 1TMQA 2N7BA 3SUWA 1WFNA 4M6AA 4HJJL 1BREA 5JMRA 5A2IH 4WI6A 4BZ1L 3ZE2E 5D9NA 3DGGA 3WO4C 1RIVL 2YBRB 1R5WA 1IC1A 3C6LA 1MY7A 2OL3L 3MRDB 5C8JB 2M2DA 2C1PB 4X6FA 5E08L 1EAPB 4MNQA 4RGNC 4JZJB 5DVOA 4RSVA 3AXLB 3MTRA 4KHTH 4Z5RB 1DEEA 1I3GL 2IH1A 4ENEC 5LYRA 4LLQA 1FNAA 3QOKA 1JV5B 3H42L 3MV8B 3WEMA 3MSPA 3L95A 1HJVA 2MQCA 3EYVB 5EO9B 1H5VA 3AY4A 2PB1A 2UY3A 3VIOA 4F7MB 3BP4A 1T22B 1F11B 4HIHA 1UKOA 3U6RB 4NQDA 2EDYA 5T33H 4MGXA 2XWTA 5A2JH 3VD4A 3AJ7A 2BSTB 3DROA 1RUPH 2VLJE 2R2HB 3NCJH 1UM4H 2OSLB 3QO1B 1FYTD 2W38A 4BQBA 4HC1L 1VEMA 1T1XB 2BNRB 1CFQB 2BVOA 4NC0B 5JORA 3ZO0A 1U0QA 2YD8A 4XP6H 5EC2B 2X4UA 4JY6B 1MCFA 5ETUA 1CNVA 1IGMH 4RGND 2Z8SA 3W28A 3PTMA 5DJAB 4ENED 1FORH 5DRNB 5I8CB 2VZUA 4K8RH 4E2OA 3WF3A 3BSZH 4NM8L 5TF0A 5EDXA 5IEKB 4M3KB 4L4TD 1EJOL 4X80L 2NTFB 3W9DA 5SWSE 1J88A 3H55A 3L4ZA 1LEKB 1EHAA 5DXWA 3C6SB 3H9SA 4TUKH 5C07A 3CLEL 3HE7B 2GTZA 2V5MA 1V3HA 1A6AB 1KNOB 1C92A 1MCCA 1CLXA 4FMKA 4FXGA 1W9BM 3SIMA 3LB6D 3U9PL 4OLYL 1MH5B 1A6ZB 4WU7B 1S9VA 2DSWA 4PJCF 5JHDB 4K7PX 3VMPA 4QRRA 1I3VA 1SZNA 4NSKB 4KKBD 4MDJB 1FC1A 2DQCL 1FBIH 2DQTH 1VF8A 1TQUA 1CVSC 4UOQA 5K59E 4K3JL 1JHLL 1OSPH 3WNKA 2WIIA 2APXA 4OZHF 1SY6H 5D1XB 2CDGA 1C8PA 3U57A 4GG8B 3CLFH 4PJEE 1T66C 1CXKA 5DD5H 4UIKH 2Z91A 1BZ7A 3PGFH 5CD5C 3RNQA 4LIQH 3WUGA 2VZ3A 1M7DA 1C93A 2P5EB 4Z78A 1KTLA 5FYKE 1IGTB 1RVFL 1R6VA 1T83A 5IROC 2VC9A 2VR4A 1NOFA 3W26A 4YHLL 5DURB 4Z7OE 4MQ7B 2WUCH 5T3ZH 3L2LA 1ZA6B 4HWEL 4QRSA 4YIQB 4V1DD 1MFAH 2BSSA 3LOWA 4OF8A 2FB4H 2E7MA 1F4WL 1XF2A 3S5YA 4P2QD 1E4NA 1SEQH 1CE6A 2VLJB 1UACH 1AQKH 2ESVD 2VRAA 1I1WA 1K6QH 3Q1SL 3NVQA 3AU1A 2HISA 2CBUA 2EPKX 2W91A 3MXVL 2VLME 2G60L 3VINA 4Y4KA 3FT3B 2X4RA 4YX2L 4FZEL 4JFSA 1W72H 1LDPL 1MFNA 2ICWB 4YZFF 3B9AA 3HE6C 3VXSA 2V5CA 1VHPA 4HBCH 2PBOA 5CSYA 5EIVA 4OGAD 4P59H 1U8JB 2X0YA 2WBJD 2IQ9L 5JDSB 4F15C 5SWSB 1N0LA 4XCCL 1F2QA 4HULB 4TXEA 4FNLL 3BUIA 2YPVH 1NSNH 5EA0H 3AMKA 4X4YB 1KC5H 5D8WA 1L7TL 4Z7VA 3FB7A 3EIFA 2B2XH 2PF6A 5EH1A 2D24A 4K7FB 5TQ2L 3VXQA 2QR0A 5I30L 4WWKB 4M24A 3G5VA 2VNCA 3DGGB 3EYOA 3PIQB 4U1HA 3T2QA 3ZLQC 3BT2L 4GBXC 3NSMA 1MLCA 1YDPB 3C6LB 1FQ9C 2O9RA 1Q72L 4NRZA 5F3BA 5EUOE 3HMXH 1ZLVH 2ZOLA 5D4QA 3T1FA 4WSKA 1HSBA 4LGSB 2VN7A 2FYVA 5GSVA 4PJFF 3T4YA 1QSVA 4FXKA 3TBVA 3ARBD 3N1GC 2B20A 3U36A 5JXAH 4AQOA 2PWGA 4JO1H 2WCSA 4N0CC 5IESL 3HNSL 1D5BB 4FOMA 5E2TH 3L95B 1MWAH 3WKNA 1NJ9B 5KW9H 3BESR 3SJVA 1YPZE 2V2TA 3WFEL 1H5BB 1ZVSB 1ZLSH 4GAJH 5E2UH 4HGWA 1KCLA 3QB7C 4PJEB 5D2NB 2XWTB 3K7UA 3KYMB 2VDRH 3VILA 5IB1A 1T5XA 2XVKA 5MHSD 1RZ7L 4JPWL 3LD8B 2J8OA 4AJ0A 5IQ7H 4GBXD 1JGDA 3KZSA 2BVOB 2CJUL 4NUJA 4ZODA 4EUPH 1ORQB 2H8PB 1YEFH 2X70B 1AJ7H 1YECL 3MRPA 3PWVB 4UT9H 3BGAA 4LK4A 2OK0H 4NQVA 4DWSA 4UQDA 3T0BA 3MS8A 2J8FA 2APBA 2YN5A 3FTGB 4EDXA 5TDOB 4JGMA 4LBEA 4N0CD 1ZBKA 4OM0H 3DMMC 1ZBVA 4F3FA 2VLLA 3VD5A 5FK9A 1ZHKA 5FGRA 4LLUA 3JTTA 1PJ9A 1MHPH 4Z7VE 4AIUA 2UWEE 5CUSH 1EBAA 3RWGB 3H0TB 3IKCB 3A24A 4M1RA 5B8CC 1FGNL 2BNRD 2FIKA 2BNQA 5CJOH 1XF3B 1FHDA 4YJZL 4YBQC 3GJEA 3U4EB 5T5NF 1VBUA 4TOQA 1QFPA 3FL7A 5EO1A 4YXKH 1GZJA 2JCCA 2H2SC 1U41A 4G9FD 2YD9A 2ZX9A 3O8XA 1OWQA 1NANH 5ICYB 3M07A 5L2JB 1JAEA 2WANA 5J4MA 1EEYA 1NCAH 4HBQA 3HE7D 3JXAA 4OTXH 3DMMD 2PTUA 2R1XB 3L3JA 4NXSA 1UM6L 3LKNA 1BZ7B 5E00B 3NN8B 4XWGL 3DWTA 3ES6B 4YEFA 5EUOB 3ECQA 5HHME 4L4VD 3VFTB 2VDMH 4HCRA 1W8NA 1KB9K 5AC5A 1M7DB 1JPGB 3C08H 2PO6A 3PWJA 4HIIB 1HYRC 4P9HL 5GRVL 1QLRA 2IFFL 3ARFA 5F1SA 3EUUA 3DX4A 4YBQD 4QYOB 3SQOL 1IM9D 5I76B 3OLDA 3M17A 3E0GA 25C8H 2H2SD 1LO4H 1YPZB 4XPHL 4C83A 4QRSB 2FBJL 3J8F7 1FFOB 4W7UA 2BSSB 4C56D 4ZQKA 2PCPB 1OM3H 4MAUL 4M4PA 1AXTL 5DJ6A 1N59B 4GAYA 2AK1H 4BFEA 1OAKH 3EFFB 3GBDA 1E0XA 4YHEA 4Y5YC 4UR9A 5FYLH 3AU1B 4YPGB 3GI9L 5CGTA 5E09A 2YEZB 5DRWB 4QHLA 3ZOAA 1ODUA 4CVZA 4K71C 4TUJA 4XHJC 3I50H 3S3PA 2XKUA 2X4RB 3O6AA 4J6RL 4PB9H 4G8GA 4JAMB 4H1LH 5DJ2A 2HT2C 4BF7A 3V6FB 4ZTPL 4KJWC 3BUDA 4WKHA 5EZOL 1B3XA 2DT2A 3AUVA 4I4WB 2VLJD 1E73M 2UWEB 1Y0LA 5F9DC 1HDMA 5T1MB 5JZ7C 5L7XH 32C2A 3EYOB 4NO5A 4U1HB 4D9RE 2NYYC 4RMQA 2CUHA 1M01A 1MLCB 4G8EB 5CEZL 4NRZB 4AC1X 3VX0A 5GGSA 2F58H 4QNPE 3CC1A 1MXGA 2YA1A 2AS5M 3DDGA 5B39B 5DO2C 4EI5C 3RVWC 2VDOH 5IR1B 3F4VA 1WDPA 5FF6B 4JE4B 4PRIE 2ED7A 4U7KA 4I18B 1MFDL 2X5PA 3LQMA 3A22A 3PHOA 5IOPA 2CR3A 1IBGL 3L3GA 4KMTL 5HDRA 2EEDA 4JFZH 3TBWB 4N0FA 3U1SL 2GJ6A 5FDYA 3CFKB 3U48A 3TCLA 2IADA 3C6LD 5HHMB 1WC7A 1EA9C 1W0WB 1T5XB 4ELKA 4LHJB 1HQ4B 3MLSH 3RA7H 4WEUD 5DMYA 5JZ7D 5BWFA 2J3SA 5TD4A 4MNQD 4HUUB 3KXFE 1JGDB 5JMOC 3B9KA 1FDLL 5E6ZA 1M7XA 4FQCL 1V3KA 1AD9B 4XCYA 2R1WB 5DO2D 3GSOA 3RVWD 4GIAA 3QXAB 4LBEB 2EAEA 4NQDD 4Q2ZA 1T4KB 3WXWL 3ULVF 3DUUB 3VA6A 3DVIA 5ID1A 1UWGH 3ULUH 1WQVT 5ACLA 4EN3A 4OZFH 2OZ4A 5CSUA 1N0XH 2CCRA 2EDKA 1RU9H 1YEJL 3KPLA 2HWZL 3UPRA 3RBGA 2ZG2A 4FNPA 3V5HB 4BSVA 4I48B 1MWOA 2W9EL 3SGKC 2F74A 5FYKD 4H20L 4H25A 4U1MB 3D50A 4Y8AA 4JPKL 2P46B 4OKDA 3DX6A 4HFUH 4HHAA 5BV7C 1K5NB 3IU3A 5I8EA 4HTYA 1LLOA 3OPZH 2XIBA 1JF1A 5DMGC 1CGUA 2Z9TA 4JDVA 1W0VA 3GK8L 3OB0K 3V79C 1V05A 4KI5D 3TWCH 4ORZC 4ZFZB 4O02L 3ZKQD 1EXUA 4ZUWA 3OG6B 3ZMRA 3ZHKA 1EEYB 2BCKA 3H9SD 5C07D 2D7QA 1V03A 1UB5A 2J7CA 4HKXB 3AZTA 4D3CL 4AD3A 5GIRB 5DJ0A 3UTQB 4JO3L 3UDWA 2FGWH 4ATWA 4W7WA 5F6HJ 1T83C 3CFBA 3G6JA 3FONB 3K2UL 4FG6D 4YNYA 1F90L 4NKDA 1A7BA 4GQ9H 4QRRD 1WBZB 3PBGA 5GXBB 3L6FA 1QLRB 2E27L 4UUJB 2FBOJ 1DQLH 1YEGH 4K94L 2YS4A 3IDUA 4PRIB 1UYWL 5IBUG 1A7PH 1AD0B 4NCC1 1BFNA 4UQ9A 1I8LA 1FH7A 4OLUH 3MA7A 5ISZE 1G84A 4PYHA 4UT6L 1ZJAA 4NC1C 5CSZA 2V9TA 3NDYA 3ZO9A 1JRHH 4RA3A 1LP9A 3OGVA 3P40A 3F8UB 2LU3A 5IFJB 3HR5A 3KEHA 1QNRA 1UWIA 4Y4KC 3RPIA 4OD1H 3MBXL 3VXOB 1H3PH 3DI2B 3KXFB 3WHXB 1OTTC 3INUH 3MV7E 3BH9B 4UTBH 2YSSA 1CK0L 4DKAA 2VKXA 1LGVA 4L8CB 5I1CL 3CMGA 4L3CA 2EYRA 4M1CD 3T2PA 4XCFL 4EJ1C 1E4XI 2LU4A 3DSNA 3LN5B 5GGUA 4KZDL 1WWCA 2R4RL 4Y8DC 1TZHB 5FYJE 2H6PB 1MELA 5I3DA 3ILPA 4NXKA 2MQ3A 3MLZL 4IRJB 3AREA 1M7IB 3RL2B 1UKTA 2NTSP 3LV3A 1ODZA 3MACL 2OYMA 5I1GL 1HDMB 3L3HB 5EZIH 2W66A 4ZFOA 4WUKL 2YD3A 3VIJA 1X5FA 1V6UA 4Y4KD 3BZ4A 1OTTD 3T3PF 5IG7B 5JHLH 1EVTC 3CVHB 4IBLT 3VXSD 3QUZB 3RP1A 2X4TA 3DVNA 1ITXA 4TSAL 3MMUA 2X1WL 1YMMA 4NHUB 4DM2A 1TUXA 2IBZY 3V6OE 4F7CA 2XN9A 5GS1C 4UQ3A 1HK6A 4NM4H 5AWNL 3CFDB 5JQHC 1A4JA 1UXSB 3MLVL 3AS1A 4DJMA 1EX0A 3FO0L 4N0FB 2VZOA 2AJ3A 1KT2A 5C1MB 1B2WL 3CK0L 4N8PA 2VX4A 3ULSA 1FG2B 1S9YB 2VXSH 4DWSC 1K8DB 3B9KB 2F54A 3H7LA 15C8H 5FKPA 4XPBH 3FOMB 1QI3A 4TULL 4XP1H 4XCYB 5C0JA 1ZOXA 1H8NA 2ZUQC 1G7PA 3CHCA