4CGTA

Deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
678
structure length
678
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPADAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 228
structure length 678
sequence length 678
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cgtA01
1XGTA 4JVWA 2ATKB 4AW7A 4XP6L 5F1NB 2JIXD 3VO0A 4MA3B 3QQ3A 3FMGL 3O2DA 5MI0C 2EKSB 3TBVA 1W3KA 3AHYA 1RD6A 1GGCL 4M7JL 2QQLL 4OIFA 2BVOA 4X8JB 5IROA 5HGGS 4RMRA 5KSAB 4QO1A 5HYSB 1KCLA 1G7HB 3JUYA 4BQ4A 4N9OB 4EN3D 5I1IL 4GO9A 3VVGA 4TVPH 3UTSE 4JFUA 4G9FD 4ODBD 3RVTD 4HBQA 3OGSA 4X4YB 4HEME 4AZ6A 2B4CL 5L88L 3QWRD 3NDYA 2WZHA 1BWWA 4JFTA 3C6LD 3B5HA 2GTZB 4QHUA 2OLHA 3ABZA 4XI5C 4LLUA 4PGJA 4KUCD 3ARFD 3PWPE 4FFWD 4HIHA 3UG3A 4QNPE 5C0DA 1TA3A 1QFWM 3KPPA 4F8XA 3UO1H 2XPGA 5GZND 1OWRM 5FO8B 4TPRL 2FO1A 1I1YA 3I85A 2OZ4H 3TA3B 2EE3A 5IEHB 4PG2A 3H53A 3MLZL 1XIWB 1JGLH 3D69B 3GMNA 3G6DH 3UBXB 4UQEA 1VFFA 4E41D 3BVNA 3DX0A 1IRAY 5TD4A 4O4YL 4U3CA 4O2EB 1F2QA 3JUZA 3GSVB 3WFZA 4AIEA 3WD0A 1WIPA 1RJYA 3W39A 1MQRA 2QR0A 3VMPA 4WFFD 5EZIH 2EYSB 5FYJL 4MD5A 3WNPA 2PW2A 3ARSA 1MQQA 1XGQA 4JRWA 2RJMA 4EOWL 1MREL 5L2JA 5FA3A 2EDEA 2Q1EA 1NSNL 4PJDA 3SKNB 1DLHB 3H8NA 4X80L 1I7ZB 2FYYA 4H1LB 1D9KB 3C6SA 4QCIA 4PJIB 3RHWK 3BVUA 3B3IB 1JTOA 2Y07L 2WMJA 5HD8D 4JQVA 2F18A 4Z7UA 1R24A 2A6IA 3LSOB 4GKLA 2CLZB 5K9QI 1T80A 1R47A 3LEYL 3AMCA 3MRQA 3W0KA 2DQTH 3L3DB 5KSVB 3BRFA 5KTEL 4LLQA 5KW9H 1BG9A 3TBYA 2WP3T 4Q2ZB 1ZA6A 2P5WB 3OJMB 2LU7A 5D2NA 3KYMA 1F6LL 4ZXBB 5I1EL 3MBEA 2GDVA 1MLBB 5LA1A 5HHNB 3VDBA 3VX0A 1I9JH 3OXRB 1KJ3H 3OKDA 4HK3J 4KRMB 5D1QB 4AMKL 4JHZA 4TX8A 4DWSA 4JFHD 1MFDH 4D8PA 4IRJA 5DURB 1JZ6A 1R86A 4S11A 5D93B 1MPAH 3F5WA 5E95B 1HHHA 4J12A 43CAA 1YJDL 4ODHH 4MLIA 2D9QB 3BXNB 4GZEA 1S5HB 1D5IL 1Q0XL 1YECH 4QHKI 5KSBE 1X5AA 4NC0B 4MQXC 5D71H 4N0UB 4S2SB 4KVCL 4QT5B 5JQ6L 3O6KL 4UV4L 1PEWA 1WF5A 3ARYA 3V5KB 1UZ6F 4FS0A 2CUMA 3BIAX 3W2DL 2HFTA 5DJAB 2WKLA 1H4PA 4X4ZA 3REVA 5JDJA 2CKBL 5CIPA 1U8IB 2WBJC 2DH3A 4LAJH 2PF6A 3TYGH 2CO7B 3FT4B 4PJAE 4XAKE 5J57B 4O51A 4JREC 4I0PC 3L3GB 3F58L 2HFFA 3V0VB 1OIFA 1J8HD 3DX8B 4AISA 2AK4B 1IGFL 4HG4K 1S7VA 1P5UA 2XN1A 1KCVH 4RGMC 3IDGA 5F7EL 3RVUC 4P7NA 3FNDA 5IW3A 5LXGH 5FV2A 3HE7D 1IC7H 1UKTA 4QRTA 3EYSL 4G43B 5FGSA 2C3HA 2CD0A 3GSOA 2Q7YB 1E0OB 1ZSDA 4ODUA 3UBXI 4B16A 2DQUH 1NLDH 5AYIA 1J9CT 3S97C 2DKMA 1UWXK 4U6YA 3IVKA 3F5KA 3TVMB 3R4DA 3LRHA 4H8UA 4B3KA 2KQNA 4UFKA 3OZ9H 3NIFF 4L4TE 4PJBF 2OR7A 4Y5VC 3FCTB 5T1KB 4UINL 3JV4A 1T66C 2R15A 5D7KD 2A6KA 5FOBA 1LK2B 3GB7A 2XV6B 2ZICA 4G9FA 3RA7H 4Z76A 2F7OA 3FRUB 3G5XA 4L4VB 1OTTD 1XF3A 1G7LB 3ROLB 1BIIB 4HAFA 1GGTA 3C6LA 4JM2D 3BAJA 3WEXB 4UIKL 3DVFA 4NRZA 1CE1H 3LKRB 2P43B 3C08H 3W38A 5IF0A 2NXZB 3MTRA 4JLRB 4F3FB 3EYOA 1SM3L 4GS7C 3ARFA 3UG4A 3U30C 4IPNB 3ZL4H 4J3TA 1UA6L 4MJ6A 3OBAA 1UWSA 3RPIB 1T89C 3OXSB 4DGIL 2JCCA 2ZKHH 4RMSA 1ZB5A 2OR8A 4NQXA 1FOBA 3AVEA 1RJZA 4NQVA 1WC7A 2VKXA 3ZO9A 3V8OA 2NW2A 4ZUWB 5F72S 3BGFB 5I1GH 5A69A 4R4BA 2ITDB 1XF1A 4LCCA 2VLKE 4U1IA 3LXCA 1HXYA 4PJ7B 2GUOA 1N59A 4JVUA 3BE1H 4ELME 2CLRB 1AY1L 1RSFA 3LIZL 5J1TC 4M93B 3D4YA 3GSXA 3VFVB 4GPNA 3ARXA 4WTZA 1QPKA 4G80B 2C7UB 2WWCA 1ORSB 3IKCB 1MRDL 5SWZA 2W62A 1OT2A 4XVSL 3UPCA 1K3ZA 5CZVL 2DWEB 3MCG1 2N1KA 4AYSA 4F7TB 2NTFA 5DUBB 1K8IB 3MI6A 4MD0A 3MLYL 3UROR 1JAEA 5KEZA 4KRUA 1EGJH 4OUUB 1SYTA 3S35H 3VJ6B 1CFVH 5I8EB 3FN3A 4LLVA 2D3NA 3JVGC 4NO0B 1P7QB 1UD3A 4WUKH 5D7SL 3MA7B 4WSJA 1NGXA 5EC1A 1YEDA 4AT6B 3BZ4B 3LXAA 2ZIDA 4QHMA 2ARJA 5DD0L 4WTZG 5FYKH 1I9EA 3V9FA 1MF2H 2YMXH 5DA4A 2OBGA 3L6FA 5TE6L 2YN5A 5LWYL 2HVMA 2UV3A 2WC7A 5BW7A 2PXYC 4MXWL 4F37K 2XTLA 3QR2A 4LDEB 4X9BA 5A2IH 2PWHA 2I24N 1QPXA 3ZO0A 4NQEE 4PGBB 5C8JB 5LQBH 4ODVL 4JFDE 4X6EA 2FECI 3GM0A 1N8ZA 4MXVF 1TVPA 1RVFL 1T20A 4XP4H 5L0QB 1I8MA 3BXWA 1H3VA 4D9QE 4C4KO 5JOFA 2YUZA 5GGUB 3SPVA 5B3JE 2FE0A 5IQ9A 1KGCD 1Q9WA 5A6SA 3F65A 2V17L 1BZ7A 1F4AA 1VACA 3HR5A 1FBIH 4ISVA 3WUWA 2K1MA 3T4YB 3KHOA 1F5WA 3DUUA 3AB0C 3QUMB 1TZ7A 1HILB 1I1FB 3U2SA 2XVKA 3QOMA 1EAPA 1U8KB 1WAAF 4JANA 3RTQC 1V8HA 5K33A 3T2QA 2AXHA 2JJVA 2JB6A 1QLEH 1P1ZB 1QRND 4OZ4B 2BRRH 5EORL 1FP9A 3VFPA 4Z95L 2HLFD 5EB8A 1J8HA 3PXJA 2WVTA 1MJJA 4HS3B 3SOBL 1WTLA 3VSVA 3WUWG 3O9NA 3KPLA 2VB5A 3FO0L 2ZSWA 4NO2A 1MCWM 2J74A 4KKLC 3ILQD 4PREA 4TNVK 5HHMB 5M17A 4UOZA 3NPSC 2FGWH 3BYTA 1MWAH 4GG8A 4QAWA 4IDJH 5EN2A 4U1NB 3T0AA 2G60H 1PDKA 1DBKH 3ZDXF 3OF6D 3EFFA 4PB9L 4WJ5A 3MRNB 3PL6C 4HMDA 1MCBA 1SMDA 1FHGA 1R3HA 4GKOA 3ULSA 3MLSH 4AC1X 1J05A 1B3VA 5T3ZH 3B5TA 4HLZH 1IGML 4DVRL 3E6HA 1NGZB 1V6XA 3SE4C 3N0PB 4OT1L 1F58L 4MB3A 4OD1L 5C6TL 2ID5A 2QV2A 2HN7B 3RNQB 4W93A 4ZS7H 3C8KB 2J8GA 3T8XB 5IHUL 3K3QA 5IFAH 4NKMA 3ZE0E 4JM2A 5FYKU 4LKCB 4FQ1H 2G3NA 3I50H 4JHAH 1H3UA 3G6JE 1N0XL 3IXTA 2ZWZA 1FZMA 3PZIA 5TGBA 3V7AG 2G5BA 4IHOB 5B8CA 4XZUB 2BNUB 5LGJB 1QHOA 4Z7QE 1VBRA 1OGTB 2AQ1A 2XQYK 2FHFA 1B4RA 3BSZL 2R0ZH 1NMBL 4KHXH 5CGTA 2ERJB 2F53D 5JMRA 4WI6A 1A7PL 1CD1B 3N1PC 3VIIA 4Q97A 4QWWC 4AQOA 3MU7A 1KB5L 1C7SA 1S9VA 4N5UA 3RCNA 3IJSA 4CMMB 4CCCA 1N2RA 5I3DA 12E8L 4QRQA 3FT3A 3KWXA 2P4AB 3OB0H 1F3DH 4P4RB 3WEZA 2NZIA 3HI1A 4NFDA 2XTKA 1XH0A 5DXWA 3L2LA 3WQ6A 3VWJC 3RVVD 3P0VL 5CEZE 6A3HA 1YYML 4L29B 3VXSB 1EVUA 5JXEC 1A6UL 5LCVH 5I71B 1FGNL 4EDWH 1GGIH 1BG4A 3E6FA 2BERA 1KTCA 5HVWA 2BX5A 4TVCA 3LRSA 3IDJB 1E1FA 1LE5A 3H9SB 5CSZB 4WV1A 4DKAA 5DRNB 3CMOL 2BMKA 4D6EA 3MYJA 1FJ1A 3V95A 3ULUL 1CXFA 3KLAA 1HHKB 3VM7A 3KLDA 3L4ZA 1NCBL 3REWB 2Y7QA 1WCQA 2EPLX 3TT3H 3S96A 4EKJA 3PZTA 3FB6A 5IHRA 4JZJA 5FUOL 3TBSA 2O61A 4BA8A 5A95A 5D1XC 3A4AA 1IVLA 4NC1E 3EFDL 4ENED 3O6ML 1MHPH 1XR9B 4WDIA 5EBAA 4OZHF 5JBDA 1PG7L 2X4SB 2BSED 4OGAD 4JFQA 5E9AA 4HCRH 4OZIF 1LGVA 4RE3A 2Y6SD 5H35B 2KBGA 3SBWA 1O0VA 1PQZB 2VQ1B 1T4KA 3DBXA 3D3VE 1JUFB 3WXWL 4WW1B 4HQQL 1J7VR 1E0XA 2OSLB 1SY6H 3MRCB 3MR9A 5ESVA 1ZHNA 4DZBB 4L8BA 4WCYL 4W85A 1QEWB 4G6FB 2F61A 1MXGA 2WINB 5ICYA 3WY4A 3GNPA 1ZJAA 2X4PB 3O0RL 1TZIA 2C0HA 1OM0A 1HJSA 5BWFA 4KROB 2D4FA 4U1SA 1DBAH 4ATDA 4NGHH 4ZDHA 2XG9A 5IOPA 4KV5E 5EPMB 4WUUB 3MROB 3WY1A 1U3JA 2X6MA 5DJ0B 3FFCA 3CD4A 2OX5A 2NQCA 3MV7B 4ZPVB 5C0RL 3WDQA 2ZXDA 1AJ7H 1DANU 1QSZA 2DQHH 4OZFG 4O2FB 5DQ9A 5BRQA 1XF5A 2ZCLH 4DO5A 1DBJH 2XG4A 3SGEI 3W11C 1G7QB 3MOAL 3B9KC 1KENL 3U4AA 5JR1L 2WYSA 1UR9A 2WP3O 3TT1H 2OYPA 4YDVB 1WV7T 3O9WB 4B9YA 2ADIB 1TJHL 2ZUYA 1RUKL 3EGSA 3HTLX 5AEAA 3VRJB 5HYIA 3SUTA 1J10A 4PJEA 3IDYC 5HHOD 2CNCA 1Z0MA 5C0BE 3DROB 4NQUA 4XP9L 3CC5B 4KMTH 1OM3H 1VRXA 1KBBA 3D9AH 2R4SL 1HXJA 4P2RB 4Y8DC 3OF6A 3H3KA 3SN6N 3TWCL 3MA9L 2QJDA 3NTCL 5CJOH 3T1FA 1CDBA 4PRBA 3HRZA 2JELH 4DN4L 1PZ5A 1E4LA 1H15A 1WJ3A 3QG7H 1T5WA 3VDHA 4V2BA 3DMMC 3CIVA 1MEXH 4HBCH 1M7XA 2CETA 1KCSH 3TV3H 3KPTA 1NANH 4ZPTA 3S37L 1GJUA 2DTSA 4X5WB 4ZFFA 1M53A 1B0RA 3PZ9A 3OKNB 1RI8A 4KI5D 2AXFB 4F7EA 1G9ML 3L9RB 1R3LB 2B5IC 3SDXE 5JO5A 1M01A 4P2QB 4KQ4H 3WJLA 5E6YA 3QO1B 4GFTB 1ED3B 5DMKA 1MJ8H 2FX8H 3VGBA 1JZ8A 4F9JA 1RJLB 4M1GH 5GRJL 2CLVB 4YXHH 4Q7DA 5I75C 1KGWA 1TIUA 4CD6A 1AHWB 5C2BH 1AE6H 2E7LA 4PJDE 3W0WE 4K55A 1RMFL 4P4KC 1V6UA 4QHNA 4PR5A 5FF6B 2W61A 4UQBA 3CZJA 4PJ5A 4XNUL 1KJMB 2D0HA 4LCWA 2CERA 1Q72L 4V1DE 3HUJB 2OSYA 2NX5D 5EOQL 1BJ1H 3LV3B 4ZAKC 4AH2B 2AJSH 1ROWA 1X3DA 2CUIA 4K9EC 4K7FA 1DQJB 2VVNA 1FHLA 2BJML 4P2OA 3ULVH 1OPGL 1LEKB 5JIKA 3WJJC 1Z5LB 4JFFD 4N0CC 5I8OH 2JFEX 4X9HA 1O7VA 5A43C 4PS4H 5M95B 4QXTA 3MODH 2WIIB 3CJJA 3TBTB 4E42B 4HAGA 4Z7VE 5J13C 1QO3A 4JRXB 2WHKA 4O58L 2ZUNA 3QIWD 3AUVA 1OP5K 4U1KB 4RMVA 4AIZB 1KACB 2HRPL 1D5MA 3FB7A 2WHLA 1AD0A 4P5TD 2AJZA 1I8KB 2IGFH 3DO7B 5DSCA 2FJHA 4Y0GA 3VGEA 1KIPA 3RWCB 2IAND 4UTFA 4UT6H 1TUXA 4WI4A 1PYWB 3O2DL 1P2CB 3GSQA 1W91A 3VRIB 2VMFA 3QEQE 3T77A 2ADGB 2ADFL 4C7GA 4Y1AE 2HA1A 4YHEA 3NABH 4TNWK 3GUTA 5DD6B 3FO1A 1HE7A 1KCRL 2SEBB 1U8MA 3KPRE 5JA8B 4Z77B 4D0CA 2NW0A 4U4BA 2P24A 5GRXG 1D5BA 4LPCA 3CXDH 1Y0LA 2HT3D 3BPOB 2ZX6A 1TE1A 4ZUUB 4TOYL 2IPTH 3SUWA 5IBUG 4PJXF 3X12A 3W29A 5CJQH 5AWNH 1NANI 4EQ3A 3OHXA 4IOSD 1HHJB 2J62A 3P30L 3VGHA 3FB8B 4S0SD 2FX9H 1U8OB 2E27L 2BFGA 2XZCL 3QDJB 4X6DA 3WQWA 4X9IA 1J0ZA 5I1DB 4KJYB 1CLYH 2WNGA 1B90A 1CT8A 1KIRB 4HPYL 1R34A 1VJZA 1UQZA 1OD9A 4LAQH 4IIQA 4DUWA 5DJXB 1CFSA 3S34H 4P5KA 5E99L 4W84A 2EXYC 4ODTL 4XNZB 1V0LA 1IT9H 3DDGA 4B3LA 5KBNC 1A7QH 5CPQA 2BVQA 2CXKA 4PRDB 5MERA 1NLBL 4JN2B 3SO3C 5IV2B 4XMPL 4U49A 2W92A 4FLOA 4RGNB 3U0PA 2OWXA 3EYPA 3BAYA 3S6TA 3QQ3B 5BZWA 5IB5A 2NY5H 3QHTC 1A3LH 5D70H 3EMQA 3T04D 2BVOB 1R5VA 4EBQH 4J3VA 4ONGH 4GAYA 4JFVA 4LSRH 4S1SL 3FRPG 4C83A 2X4RA 1QSVA 4KZEL 3D39A 3N12A 2UY4A 4M48L 1UZ4A 3TPUA 1JCKA 2NY2D 5EA0H 4UUJA 2EC8A 2GJJA 5ADPH 3ME0A 3L5WA 2HTLC 4U31A 3VXUB 3T2NH 1EHLH 3OSKA 4HOXA 3OA5A 4PLKC 4UQCA 1FAIH 2EDJA 4RIRA 1P9MC 1FE8H 4NXSA 1X1NA 3VUPA 3IKKA 3T08A 4HIHB 4E41E 1XYZA 5DFWH 4FXKA 1TA3B 1W9DM 4H41A 2Q8XA 4M29A 3W53A 4JRYD 2XVPA 5J9PA 1PGRB 4NUGH 1DBML 1ZHLA 3KPPB 2I07B 3GSNH 3OJDB 4NSKA 2XPGB 1Q6DA 3T3MF 2P46B 1C5BH 2DQJH 3LD8B 4WFFE 2OYKA 1G01A 3VFMA 3PL6A 3WYRA 5C6PB 2BC4B 4JZ5A 1GQLA 2D31A 2YRZA 1WDRA 3GMNB 1A22B 3A6BL 3BVNB 1IM3B 4YGVB 2NY1D 1T0NA 5MEND 4NWUL 4GKNA 3TIDA 4WK9A 1CU4H 3U79A 5DLMH 4H5SA 2W66A 2NX5A 3LS5H 4OSUL 15C8L 1RJYB 3MRDA 3W39B 2QR0B 3DX6A 1IGJA 5E2VL 1UFUA 4AEHH 4MTVA 2UWEE 2PW2B 2BY1A 1XGQB 4KGLA 4IDLA 3U0WL 3L4TA 5C08D 5AAMA 1R3JB 1E4JA 2R0LL 4R4ND 3D25A 5D9PA 1I85C 1V05A 4JFFA 1XF2A 3MV8B 1LO0L 4P57B 1HP5A 2A6DB 3FOMA 1JHLL 3RU8H 3IRZA 4K23L 2JJUA 4Z7UB 2XFXA 1R24B 1UM6H 4N0YL 1FC1A 2FJFB 3M1BA 3VMOA 1N5AA 1G94A 5CBAA 2BVPB 4JFHE 4X7FC 2MANA 5A3HA 1DQMH 3ARWA 2O9PA 3KYNB 4LLQB 1T21A 3QIWA 3QO0A 1EO8L 4FFVC 3KDMB 3NZHH 5K9KA 4ETQA 4LIQL 4OCXH 3MMEA 2XSAA 2W9EH 2LU4A 4FOMA 4NHUB 3JTSB 3HMXH 3SQOL 3EKCA 1BVLB 5JBEA 4D6HA 2MMXA 3OKDB 1EXUA 4DWSB 2IANA 3NGBC 5E09A 1MNUL 1NC4D 4D8PB 4H0HB 2Q8AH 1QR1A 1NC2D 1WAWA 1OTSC 1HHHB 1FPTH 1X5KA 1FYHB 5I1CL 3PZOA 2VDOL 1CICB 1A4JB 1DR9A 1QPPA 2R1WA 1QYGL 1FO0H 4MAUL 3H54A 1U6AL 1UENA 1ZLVH 4U2YA 1A14H 4P7RA 2VLJD 4XP1H 1LDPH 4DZ8B 5C0JB 1IGCH 3EBVA 1MCOL 5DRZB 2K7PA 5DGQA 3WD5L 4J4PC 3N85L 5E6IC 3R1GH 4NM4H 2NYYD 1VEOA 1NGQH 4U1LB 5FYLE 4WNQA 4XBEL 3PABA 4UOJA 4V2XA 5JIWA 4EJ1C 2CGRH 4EN3C 2XFFA 2VXUL 1BQSA 2C8NA 1J1XL 2F5BL 3RVTC 4MNMA 1Q4NX 3DLQR 3LN9A 4H04A 4ZUVB 2ENSA 2UYLB 5EO0A 3TJEH 5K59E 2VDML 3G08A 1RZJC 3BKCH 2V5RA 5D7IB 1LMKA 4XCFL 3WMBA 4LCIH 1EMTH 1HQRA 1O6IA 4FFWC 3MJ8B 4AYGA 4G5ZH 4GRMA 2X1PA 4HGWA 3GMRB 3W9DA 1A47A 3I9GL 2VCBA 2XJ7A 1KLGB 5DTFA 4OIIL 2EXWD 3GNRA 3HZVA 2P1YA 3GZKA 5J8OA 4MNQB 5DDHB 4ODUB 4TTDC 4R2GD 5FFLA 1S3KL 1KEML 3FHAA 3IVKB 5HDOA 3ZR5A 1TG7A 1SBBA 1P84K 5GS0D 4NN6C 3IFNH 2MPAH 3C60C 5GHWH 5CBEA 2R9HC 3QA3A 4DCQB 3I3BA 4LSDA 2Z9TA 4BH8A 3PWVA 3GJFH 1NBQA 1U95A 3P73A 2X40A 3BYYA 2CSPA 5ADOL 1AQHA 4N8PA 4XNYH 4MYWB 1CZ8L 5BVPL 3G5XB 1KPUA 1XF3B 3P11H 3QPXH 3Q6FB 1E6RA 5IR1B 4JKWA 3VI3F 1S9XA 1FLRL 1JRHL 4MNHB 1OAQL 4Q0XL 1NMAL 4NRZB 1AMYA 3GGWA 1K9FA 1LQ0A 3WXVH 5IF0B 2A74A 1MVFA 4HUUA 2WK2A 5IW1B 1U3YA 5CINL 3ARVA 1N5YH 4JRYA 1B3XA 2BNRD 3LKOA 4J28A 2IBZX 2DDQL 1RULH 4P3CL 1S7SB 2JCCB 1RUMH 5D1ZB 4Z7WB 1RJZB 2J7CA 4FNLH 1A7OH 1DUZA 4ZUSA 4JO3H 4NQVB 1IT0A 1INQA 1MW0A 3RX5A 1WC7B 4TVDA 2EDRA 3WIJA 3HPLB 1NCTA 4I5BA 5HHVL 3IFPB 5F1IA 3Q2CA 1O7SA 4R4BB 1YEGH 2P5ED 4JFEB 2HVJA 2IXVA 2ED7A 4KK6D 2XACC 4LCYB 4CKVX 1MH5A 2GUOB 5D7LE 5HVFB 3HAEG 1QWUA 3WNNA 2RGMA 3GSXB 1OGAD 2FB4L 4M7ZB 5C08A 2VDQL 1SHMA 3VGGA 3VXPB 1VGEL 4K8RL 5SWZB 3X17A 5D6DA 3UAJD 4GRWF 2OR9L 2W60B 1IMHC 4Q58C 2NTFB 2D0FA 4MD0B 4G6MH 4YHOH 5I16B 4UFJA 4GKZB 4LSUL 4P5MB 5IVXE 1KJ2H 6FABL 2XKUA 1AI1H 4LLVB 4ZOEA 4XPAH 1RZ8A 2ZSVA 1P69B 5HOSA 1E4WL 1NGXB 5EC1B 1YEDB 3L4WA 2EH8H 4N1CA 3AIEA 5IW6A 4QHMB 4YBQD 1PVHA 4GXPA 2J77A 1HINL 2Q3AA 3CZFA 4E0RB 3C8DA 4BQBA 1S7QA 3BEVA 3LRLA 3G04A 2FX7L 1FL5A 1QSFD 3BP5A 5C0GA 3VWKC 2GUYA 1GPOL 1CF8H 4LNRB 3DGCR 2EADA 4NDMA 1KGCE 4LOUD 3PN8A 5F89B 3CH8A 4P46D 4NJAL 1RZ7L 3GMQB 2F74B 5T3XD 1E15A 4RMTA 3FFDB 1NC2A 4ONHA 1N8ZB 3U7YH 1INDL 5D9NA 1I8MB 1U91B 2V2WB 4NHCH 4Y4KA 1XSKA 1TPXC 5TQ2H 3HE7C 1F11B 1GVIA 1E40A 5JOFB 4OTXH 3ZKMD 1CR9L 1OD0A 2ZWYA 3WKNA 2NY3D 1Q9WB 3DSNA 4OM0L 4HU8A 2ICEB 1VACB 3BD5A 3SE3A 1XT5A 4MDIA 1QRNE 5F6IC 5EUOE 3WUWB 1QP1A 3DUUB 1W1VA 1W1YA 2DJ4A 5DWUH 2NY0C 1JP5A 1H3PL 3C5ZC 1WT5A 4JN1L 4PMZA 3B2UD 1CGUA 2PWEA 1BQCA 4C54A 4X98B 3HC0A 1IL1A 3MRLA 2YPKB 2WPGA 2GJPA 3KLSA 1ZAGA 4PJEE 4YQXH 1OTTC 3BQUC 3GK8L 3Q1SL 1TVHB 3F62A 5HJ3B 1KXQA 5FECA 2BVEA 5J1AB 5IJKA 3UTTB 2WVSA 1CFNA 4M6MH 4ZNEA 1LP9B 5I2IA 4FZEL 2KL6A 3KPLB 4BZ2L 1HK6A 3VCLA 4MQTB 4RE2A 3JSSA 3HG1D 3MCLH 1U3HB 4GG8B 3TO4B 3NAAL 1RZIB 4P7LA 3DPBA 1IM9D 3QH3A 4X5XA 1IKNA 5EZOL 4ZTPH 3KL5A 5HVGB 4WJ5B 5F9OL 4AEFA 4X6BA 3HI6L 1R3HB 4Y4HD 3X3GL 3ULSB 1U8JA 4JZNB 4XPFL 3E2HC 4QRRB 3VIPA 5DJ6A 4YXKL 3BISA 4LGXA 3U9UB 3E6HB 1AP2B 3CH9A 2JB5H 2FZ3A 5I76A 1J0KA 4CAGA 4PTWA 1AC6A 1BPLB 3SDCD 1FH8A 1SR0A 4U1HB 4RBPH 2V3FA 3CCHB 2RB8A 3TTQA 4GT7A 4UQ2B 4WWID 1MI5E 5EU6B 2BNQD 3DDFA 1JE6A 2DQIL 3BH8A 4OUOA 2A3AA 2F53E 3CXHJ 1S9KC 3LHPH 1R7AA 2FSEB 5JW3H 5MI0B 4PJBA 3VILA 2F58H 1ZU8A 1P4BH 1JRHI 2G5BB 3G6AA 2AVGA 3WF1A 3RVWD 2BNRA 1CQYA 1BAGA 5GGQL 4TX6A 4O00A 1NWTA 3A22A 5DEFB 1DSFH 4EIGB 4Z78B 3OR7B 2QLYA 4E5XB 5CSYA 3OPZL 5TE7L 4IS6B 3VFGL 3FMGH 2VL5B 1TITA 2A6JB 2YK1L 1GGCH 3UJJL 4W5ZA 1XMWA 2QQLH 3W24A 1MW3A 2H41A 5D7JA 1NAMH 5ISZD 4NC2B 2JJTA 1U93B 4UQ9A 1YEEH 4PJIF 1DL7L 2ITCA 5ANMA 3LOWA 3TZVD 2X4NA 3SCVA 2H32B 1OGAA 2ZCHL 4LVEA 2V2TA 4H25A 3E1F1 3N1GC 4MXQC 2X4QA 2B4CH 5HGDA 2F19H 3K0WA 1V3IA 4HWZB 1ZTXH 3MLUL 4A6YB 4JE4B 1YEFH 1WVZA 1YEIL 3L5HA 1LE5B 2YA0A 3QJFA 5EOTA 1FJ1B 5GGTA 3KLAB 3QUXD 4BSJA 1R46A 1UM5L 3JZ7A 3T0EE 5GNXA 1AGBA 4XX1E 2EYTA 2R1XA 4EUPA 3FB6B 4HF5L 4KKCD 4TPRH 4B5EA 2O61B 1I3VA 4YLQT 1YMMD 2BVTA 4J3WA 4JHBA 1BLNB 2DS4A 2DQXA 4DKEH 4KRLB 3MRRB 2HJLA 5E8DH 1GOFA 4O4YH 3ORJA 5GXBB 5GGSB 3IU3B 4PRIB 3AY4A 3QDMD 1ZHKB 3QEGL 4TUKL 2Z1KA 3CNKA 1VERA 3R8BB 1OAYH 2D7MA 3LEXB 2Q86A 3PJSA 4EOWH 1MREH 4OZFB 4X6CE 4IJ3C 5ESVB 5C86A 5J3HC 1NSNH 5CP3A 2YSSB 3I75A 2XWEA 3V0WL 5LAXA 1CCZA 1FP5A 3M6DA 2XWTA 3BKML 4U1SB 5J1SC 4AD1A 1GYAA 4MCZA 4HH9A 5DR5L 2XVGA 4TSAH 1AKJA 4ZDHB 8FABA 4ZS6C 5I19H 3W9EA 3QIUD 1ACYL 4ZXOA 3FFCB 5KTEH 4WWKC 1JZ7A 5KVDL 4LHJB 5FDYA 5HHOE 5C6WH 1XF5B 3MJGX 3BRGC 1SJEA 1M1SA 2YD7A 3F6IA 5I1EH 4IPLA 5EBMB 2ADJA 1F4XL 1FV1A 4NRYB 3M8OL 1Z9SA 4O9HH 4PLOB 4AMKH 1W9VA 1AGFB 4ZFOB 2DLFL 4UAOC 4UV7L 1WAAA 2VYRE 4BH7B 5C0FA 5ALBL 3MYZA 5SWSA 4M4RA 4MLSA 3HG1A 1XAUA 5FM5M 3V6FA 1MLCA 2DM3A 2GSIA 1I1WA 1IM9A 2IQAA 4YBHA 2DD8L 1EOKA 1Q0XH 3DURA 1JNEA 3LH2H 1KFWA 2YPLD 4I9WD 1H3XA 5J12C 3STZA 4JREB 1F2XK 3MLRH 4I0PB 4KVCH 1S78C 1T5WB 3O6KH 1J87A 4PRNB 1F42A 3IT8D 4NO5A 3IXAB 2CKBH 1GVYA 2VX5A 1MCEA 5EBGA 3PZQA 4RGMB 4M43L 3MLWL 3UTSB 2HJKB 3WKZA 2FRGP 2WANA 4HUWA 4RQQB 1RFDH 2BNQA 1J0YA 4J27A 2BOBA 5GS3A 5DT7A 4YE4L 1R33A 2NX5E 3F58H 4ZFGL 5EBWA 1E5NA 1OSZB 3K46A 2EXOA 5GRZA 4TYUA 2ZG1A 4OCLC 3KYOB 1KELL 4JFWA 1M6OB 5F7EH 2VWEE 4Y5VB 4PJ5B 1KFAL 1F3RB 5SX4H 1KXTB 1JPSH 4G3YL 2DLIA 2DQEH 1VENA 4FABH 5A94A 1IAMA 2K7QA 1UYWL 1Q9OB 3DNKA 5EU4B 5EIIA 1OLZA 2A3CA 3NA9L 5FDWA 4KJWC 3RPMA 4P2OB 4DAGL 4Y16C 3KE0A 3FONB 3NJ3A 5KANI 4BZYA 1E4IA 4LLDA 5ISZA 3T0EC 1PIGA 4RZCA 4MA7L 3EYVB 3T65B 2VZSA 2Y6SC 4UINH 4G6AD 3WDIA 3WD1A 4GS7B 2BXZA 2X1WL 3U30B 4P8XA 5HI4C 4MCYB 4EI6A 4PEEA 4RSVA 2VRJA 5IHZA 4WFED 3V52L 1HNYA 1NAKL 4OF3A 3V0AC 3CHFA 2FWOA 5T5NG 2IH1A 1RUPH 3MGOA 4UIKH 5JUEL 1D5MB 3FB7B 4YBLB 1W3LA 2AI0L 4UT7H 4NRXA 2AJZB 4PJFE 1SM3H 4NNYA 1HQ4B 2R39A 3TYFB 2BCKB 1HWGB 1UA6H 4FLSA 3OGCA 2VKWA 5DT1H 4DGIH 2YLLA 3CVHA 5C71A 1YMMA 3E0GA 5IBUB 5C0CD 4JY4A 3NSNA 1A5FL 3OGOE 3T77B 5IB4A 5KVEL 3MUY1 1EZVX 4QXUL 2KZ1B 1FH5L 1NKRA 1GZPA 2YL5A 3GUTB 2Z8VC 3C2SA 1CDHA 3QDMA 4MZ3A 4L8CA 1T7VA 4D0CB 3O4LA 1AY1H 3LIZH 4FMVA 3VXNB 3BAWA 3MC0A 4PD4J 1RV6X 4LK4A 3ZHDA 2QQKL 1B0GA 3OKKA 3CPLA 4NQCD 4XVSH 5DS8B 4FG6D 5HGHA 5A2LH 3CFDA 4PG9B 2E6JA 4OZHA 3DVNB 3OHXB 3CFEB 4CCEA 1JTTA 1KXVC 2EC9U 2I9TB 3LPOA 5EWIL 2PXYB 4OZIA 5C0AB 4CVWA 5I9QC 2PWDA 4PUBL 6CGTA 1G7MB 4H2CA 4BFIA 3TO2A 1TQWA 4OQTH 1GONA 1NGWB 4DW2L 4OFVA 1NBVL 3BZFB 3QIUA 5DF0A 1CT8B 2VABB 2WQRA 4NPYA 2PETA 4GUPA 5DD0H 4MX7A 1FFPB 1CFSB 4JQXC 3QNYA 5HYEA 5A6LA 5E1AB 5KG9B 5H94A 3UR7A 2XUCA 2YDQA 2D7OA 2B1HL 3U0PB 3NZ8B 4XVTL 4H0IA 5IB5B 4Y7MA 5SX4I 3ES6B 1VGKA 1I7TA 4DEPC 3CFJA 4ODVH 3C8HA 2YFOA 3WSUA 2MQ3A 5IJVA 2DF3A 1XCQA 1RVFH 4AENA 4BSWA 3AB0B 4GAYB 4C55A 1VKXB 1R6VA 2A3EA 3O3EB 1G6RB 3RTQB 4C83B 2OP4L 3WUBA 2GTWA 3D39B 3EYFA 2VL4A 3VFUB 4MHHG 3TPUB 3A24A 4JPVL 1CDGA 5KSUA 2J6EA 1OL0A 4UUJB 4TVPE 3TJHD 2V17H 3OTTA 3T09A 3L5WB 3BQUA 4Z2LA 5M3WA 5CP7A 5TFSL 1X5LA 1EXPA 5FHBH 4WW2C 2DICA 4XH2B 5HYQB 1BVZA 5E2UL 4OGZA 3VGAC 2ARWA 4D6FA 3M17A 4RIRB 4NKIL 3HNSH 2EO1A 3JBG7 1EAJA 2AK1L 1M05A 4QTHB 4FXKB 5F88A 1U92B 5MENE 4U6VL 1B3WA 4FFYL 2NW3A 5HDRA 3NPSB 4JKMA 1ZHLB 4M8QB 3F7QA 3IDNB 4U3HA 1P4IL 1QQDA 4LF3A 5DHXB 3PL6B 2DMBA 3NN8B 2X41A 5C08E 2D31B 3SOBH 3FZUD 4P5TC 1R5WA 5E8NA 2DQGL 3FO0H 2XN9D 1BFOB 1JFHA 3PE9A 1KJVB 1NJ9A 4GKNB 3TIDB 3QUZA 1MFCL 1DDHA 4YNYA 1H8OA 1C91A 3A3HA 5I23A 3H3PH 2H2PC 2ED8A 3KAAA 4PB9H 4CJ1A 1AD9A 5D4YA 4BQ9A 1S7TA 5A3ID 4YPGB 2EACA 1OAKL 5DJDB 3D25B 2NXYC 1IGMH 2ZCKH 2ZUTA 3S5LG 2V3DA 5IB2B 4A3HA 1XF2B 1V7NL 4JFXA 1BFNA 1XR8A 1F58H 3FOMB 4J6RL 5HPOA 4R7DA 1UT9A 1WKYA 4Y5YA 4HH8A 3IF1A 2GFBA 4XCNA 3D0VB 4D0DA 5CBAB 2HT3C 1WDSA 2C1PB 3OAUL 1T21B 2EDQA 3QO0B 4HUVA 1V0NA 3EDDA 3DRQB 3OIHA 3MUHL 3SHSA 4ETQB 1MAKA 2PCPB 3MMEB 1EIBA 4QXWA 2Q6WA 1N0XH 5LBSH 1OB0A 2J5LC 1EXUB 4ATLA 3AAZA 1J5OL 1K4CB 3BSZH 1NOUA 1NMBH 2VLJE 3V6ZA 1QR1B 5C0CA 2DEPA 3VWJB 3QULB 4NP4H 3EJSA 4OCRL 2PKDA 1HL8A 5LA2A 2DBLH 1JFXA 2FGLA 2P8LA 1KB5H 4KUZL 1A7RL 3U1SL 2TAAA 4M1CD 1U8HB 2WUBL 3CX2A 3ZJ8A 4NQEB 1BJMA 1GGBH 3GSWA 3FTGB 3R06A 1E1EA 4P9HL 1U3ZA 1QBLH 1J1PL 3P0GB 2E5EA 4D6CA 1UWGL 1N4XH 1CEOA 1A6UH 1AGEB 5IMMA 4NQCA 1FGNH 2GI7A 3F5JA 1CDJA 2EPKX 4D9LL 1WCBA 2EDXA 1MIML 5AZ2L 3TOPA 5I74C 5JIHA 4PB0L 1UR0A 3O2WL 1BIHA 4JPWH 3G08B 3ULUH 4G7VH 1W9BM 2WZPD 1BX2B 2IPKA 1AR2A 35C8H 3PQYD 3BPNC 1Q94A 3V6OA 1HKLH 2HKHL 4GRMB 5FUOH 1GJIA 4HGWB 2XIIA 4M7LL 4PJ8D 3NDZA 5AYUH 3NIYA 3BCFA 3EFDH 2E40A 4HWEH 1WZ1H 3HZVB 4U7SA 4LVNC 1CLZL 1PG7H 5EFIA 7CGTA 5BV7C 4HZ8A 1OF2B 3MRJB 4NWTL 5I1AA 1HEZA 1H9VA 5J6HA 1X5XA 4RGOL 3MRHB 3GMPB 4RDQG 2ESVB 3KPSD 1CBVL 1BEYH 5CBEB 3QXAA 4JCMA 3WXWH 3IAQA 2CXGA 5E70A 4OD2A 3VIMA 3NIFE 3PWVB 4PJBE 1U95B 4WCYH 1UVQA 1CL7H 4G8EB 3BVXA 4Y19D 3CK0H 2FCBA 4YHLH 1KPUB 2BNRE 4ZFZA 1X5FA 2CMRH 2Z0BA 3O0RH 5GGRA 4OFPA 4ONOA 3B9KB 2EE9A 2J8FA 1MCWW 1TVDA 2XXMB 3MNVA 3RGVD 1NUNB 4D6DA 5K9OA 4AZ5A 4WRLA 4Q9RL 1KEGH 3HLAA 2P5EE 1AR1D 3HAEB 2OTPA 5KOMC 3IDYB 2A38A 1RIVH 3LKOB 2GJ6A 2Q8BL 4WHCA 2ZNWA 2DSZA 4ZUSB 3QWOB 3MOAH 1OGAE 3HUJF 1ZLUK 1KENH 3NCFB 2DQCL 5I15L 5ICZA 2LTQC 2GJXB 3G6JB 3BRDA 3OB8A 4GBXD 3O6FD 1T1ZA 4Z6AT 3ULVF 1MFAH 2XN9A 3CXHK 3DMMB 1TJHH 4DUVA 1RUKH 2HVJB 4MWFB 4KZDL 1SEQL 1F3JB 4HXBL 5CD5D 3N1MC 1MH5B 5DHVA 4XP9H 4PMRA 4BK5A 1A9BB 2Z35A 2R4SH 4KGJA 1RZKL 5E8PA 1T3FB 4NJ9L 1IQWL 3TWCH 4PP2B 1T0MB 4JFSA 1TTGA 3ISWA 2B5IB 4KQ3L 4F7CA 1TETL 4R96B 4Z0XB 4DN4H 2ZOLB 4I0CC 4YHYC 2XKSA 4QHKJ 3HN3A 4IRZL 3LPPA 3O3DA 1GSMA 4HIEA 2D3LA 1P7HL 4MS8D 4JG0L 3B9DA 3K2UH 3GIVA 4YFDB 1QSFE 4QCFA 3JV6B 4M4PA 2WHJA 5CMAB 3BSHA 2D7QA 4CN4A 1M4KA 1TQCB 3VIKA 1TQSA 5TPWH 4AZBA 3HFML 1ZGLP 1UWXH 5J11C 3GIZL 4X0KB 2V5DA 2NYYC 5T3XE 5CEZH 3TONA 1NGYA 3BN9D 2FJGA 4CADA 4L3ED 3VI4E 5MEQB 1S7QB 5GRJH 3B6SA 3RVXD 3O11B 2VTFA 1FL5B 2C1OA 3SDDD 1C1EL 2W65A 3LEVL 4UI2A 2GSGB 4K9EH 1M7DA 3DRTB 2WVUA 2EZ0D 1RMFH 5DMGC 1ADQH 1QBAA 4XNUH 5EO1A 1Q72H 1BBJA 1TLKA 4KTEL 4JJ5B 2QV4A 4X7TB 4JG1L 1OTUC 5EOQH 1YEJL 5EO9A 2WSKA 3MRBA 4OLVL 1KN4L 4AZIA 2AJ3B 5GS0L 2AKRA 4KVNL 2BJMH 2X4OA 1W1TA 4R0LA 5J13B 1OPGH 5A6BD 3QQ9C 4M03A 4IM4A 1INEH 4KMQA 4U6XA 3X11A 3TH2T 5C0ND 4MJ4A 1JWUB 5JPNA 3Q48A 2ICWA 4MDJB 3PZVA 4G8GD 2V6HA 2VJXA 4O5LL 1A6ZA 4K3EL 1TJGH 4DM1A 4GQQA 4LASH 4GW5A 1A6TB 4X99A 5B21A 5GSVA 3HE6C 3B4NA 2VE6A 1IL1B 3VXRA 4KRNA 2QKIA 5FGBA 2HRPH 3HG1E 5ECJE 1R5IA 1MW1A 1CXHA 2ZOKA 3SE8H 2XT1B 3UCQA 4H26B 3G9VA 1CFNB 1G1YA 3A0OA 5DJ8A 5CD3A 1TTFA 3ARBD 2XWJA 1JPGA 1E70M 2X2HA 3QOKA 3GNMH 4P8VA 1YYLL 3BKYH 2VLRD 3JUGA 3SUSA 5BOPA 4GG6F 1V3JA 2ADFH 1UQSA 2PO6D 4A2LA 1AO7D 4ZD3H 2QF8A 2XFRA 1CK0H 4D3CL 1LK3L 1R3KA 3DUSB 3QEUB 1OCQA 3P77B 1WBYB 5A1AA 1KCRH 1A6WL 3CFCL 1F4WL 1U8JB 1UWTA 2J79A 5L2KD 2EDFA 4MNJA 1D7FA 1FL3B 5T3ZE 1OAUH 3BLKA 4DN3L 2FZ3B 5H2BA 5C0BB 1BYBA 2EDWA 5I76B 2IBZY 1J88A 2X70B 1SZNA 2NNAB 4FMFA 4TOYH 2AQ2A 2PBGA 1N64L 2EDBA 4KAQL 5E00A 5FHAL 5KSAD 3ZE1F 2HISA 3O8XC 5GGTL 1DHKA 2VIRA 5BQ7A 3P30H 3SUUA 3BH8B 5DJ2A 2MHAA 3K1DA 4O2CA 3RJYA 2E27H 4NCDA 3SO3B 3RGVA 1H1NA 4I18A 4H8WC 5MHSD 3R0MA 5E4EC 5DK3A 4K7PL 2DKUA 2NPLX 4HWBH 5HI5D 1VAHA 2F8OA 4Q6IA 2IALA 2XIBA 3MNWA 4BYHA 2X9XA 4WFGD 4J3UA 1US3A 4HWUA 4ODTH 4PLJC 4OZGB 4R5EA 2Z91B 4CKQA 2XGBA 3U4EA 2D4DA 2D22A 4AZCA 1NLBH 4UOW1 4GXUN 4DVBB 5HHPA 4M7KL 1OW0A 3C5SB 2EH7L 3HI5L 3O6FA 4F66A 1BMGA 2HWZL 1YC8A 4GRLC 3QCVL 2IEPA 1B0WA 3W0WB 1GNXA 5I1HL 5LGHL 4FQQB 3TA3D 5D7JB 4LSQH 1H0GA 2IPUG 1NOWA 3WHE0 4P46C 2WLZA 1XIWD 4S1SH 4G8IA 3RWIB 4V1DB 2R4RL 2X4NB 5D9SB 4KZEH 1UA7A 5CJXC 3MRIB 1U8LA 1NFDF 3WFDL 4PTTA 4XP5H 2V2TB 3LMJL 3SKUD 2PYFA 1CI5A 5HHXL 4ZENA 2YDRA 2F7PA 5JOPD 4Z7UF 3K74B 1HNFA 1ZK9A 3JTTB 2X4QB 5HGDB 4C56A 2VERN 4U5KA 3TFKD 3CDGA 3Q0HA 3ZKMC 5HDQL 1QA9B 2B2XH 4AY1A 3EOBA 4WKAA 2MFNA 1YMME 3QJFB 2R0WL 4XC1L 4HK0B 5IMLB 1D9KD 1Y6MR 2AEPL 2R29L 5KOVC 1QKZL 1ZVSA 1FVDB 1XRVA 3KGRA 2VQUA 2ZPKH 5TDNB 1UCBL 2C4FT 1EDGA 2EYTB 1DBMH 2FH6A 4PP1D 3PGDA 4L3EA 1HJQA 2VITB 2VX7A 2DB8A 2EAEA 3LKPA 3SDDA 5IUSA 1OARL 2GJZB 5BOZG 1C7TA 4HA4A 3ELAT 4R3SA 3WFHA 3A6BH 2A0LC 4RNRA 5DD5L 2P5WD 2HJLB 1T1WB 4NWUH 1RUQL 2RFXA 1E28A 2X44D 5E08L 4ZXBD 4OSUH 1QW9A 3QHMA 3KWWB 5D1QD 4X9GA 2DQFB 5DI8A 3HB3D 2Q86B 2YDSA 5IEKA 1WBZA 4Y1AB 5DURD 1F6FB 2R0LH 3W6MA 5A6BA 5EB9A 3KLHC 1QR4A 5CIPH 5I24A 4QYOB 3IFLH 4Y4HC 1AGCB 1MWOA 3VD9A 1LO0H 5CWSA 1W9PA 4OOZA 5LAXB 2V38A 3KPRB 2BNJA 3VG0L 2Y24A 3AJ7A 4POUB 4K23H 5TQ0L 4MCZB 2F7QA 2IH3A 4U1MA 5FYJD 1VESA 1BD2E 1AKJB 3NGBB 5L7XL 4YC2B 5D7IF 1RH9A 3SDCC 1HKIA 2J75A 1EO8H 4PD4K 1NCAL 1FYTE 4I2XA 4QGYA 4WFHD 1LG1A 3CU7A 4G9DA 3SGJA 1LVEA 2J88H 3A67L 3LPWA 3SQOH 3PNWA 1EJ6A 3PDDA 1T0OA 1SBSL 2YPLE 3SCOA 1EEYB 1MNUH 4ZO9A 5EOCJ 3UEZA 2LAAA 3N1FC 5F8QC 4IRSA 2VDNL 5SWSB 2I25N 2VLRA 2AK4D 2R23A 3V6FB 4L9LC 1MLCB 5E6IB 5I1CH 1JBJA 2PO6A 5JLZB 4U3AA 1AO7A 2HT4D 1HYRC 2VDKL 3DURB 2VZOA 2NY4C 1QYGH 1EVTC 1NL0H 1IILE 3MJ7B 3RWFB 3TN0C 3ALGA 2HKFH 5K9QG 5DUML 1U6AH 4NKDA 1R75A 5A6KA 4GAFB 3II1A 1WTGT 1ZT4A 1MCOH 4IOFD 4MA3A 5F1NA 3GXFA 2W59A 3WD5H 2EKSA 1V02E 1JWMB 2WWMC 3BP7B 3TVMD 4QRPA 5F44A 1A0QH 4XBEH 3TZVC 3WV0A 2IAMC 3PWJA 4X8JA 3I2CH 5C0EB 3F7VA 1UC6A 4ODWB 2VXUH 1GOKA 5HYSA 1J1XH 2F5BH 5T1KD 1G7HA 2CDGB 2P47B 3QUYC 2J25A 2BOBB 3EHBD 2O93L 4APQA 4OGXL 1LO2H 4GAGL 2VDMH 4ZFMA 4V2CB 2JCCF 3QCTL 4X4YA 4L4VD 4Z7WF 2D73A 3DX9B 3OAZK 3CVHL 2GVYA 2PTTB 4XCFH 3WL9B 4GW1B 5IT2L 4LLMB 3QUXC 3C60B 4U2ZA 1DJSA 5ALCL 2NXZD 2AP2A 3KVQA 1VFAB 4MD4B 3I9GH 1F97A 1UH3A 4DOHE 1OCWH 4LSPL 4KKCC 3CUIA 5M03A 5ACMA 4YHZH 2OZ4A 4XT1C 1KNOA 1UWIA 1GHSA 5FDWB 3HCVB 1FFOA 4QOKE 4WFEE 5FO8A 4WO4C 1ZA3A 2JTDA 1XIWA 2IQ9L 3D69A 4QRSB 3UBXA 5L8LB 1IAOA 1YA5A 2UUDH 2HFGL 4CMHC 1GC1C 4AM0B 5ADOH 1W3HA 2UWEB 4O2EA 3PDOB 3GSVA 1F13A 5BVPH 3FB5B 5CJ5A 4KJPD 1PZ2A 2M8XA 2V7HB 1FLRH 1OAQH 2C3WA 3MGOB 1IC4L 2VXSL 2MKWA 1RIUL 1T1YB 1DLHA 2A9ML 1ZBWA 1I7ZA 4F57L 3OKEA 1D2KA 4H1LA 1D9KA 2CK0L 5DJYA 3QZWG 4PJIA 1MFEL 4TQEL 3WMCA 1T2QL 5DJCB 1S8DB 3B3IA 1OGBA 4ZO6A 3ZTJH 1UB6A 4EKXA 3VOCA 3WBEA 2DDQH 3AYSA 2V9TA 1JN6A 5FUCE 4YHMH 1OP9A 1KWKA 4D1IA 3LN5B 3LSOA 5CZKA 2CLZA 4DKFL 1WICA 4JY4B 4NBZB 1P7QD 4NO0D 2ZUMA 3MV01 4XXDA 3L3DA 5KSVA 5KZCB 4XWOD 1RJCA 1GZQB 2XWDA 3UJIL 2HP4A 1SJHB 1IGIL 5F8RC 1X5IA 1D6VH 1FRGL 4ZXLA 5E2TL 3WO3B 4ZXBA 3AHTA 1MLBA 2J6EL 5HHNA 5TDPB 3OXRA 3O4LB 2CJUH 4LEOA 4FHBD 4YJZL 3BWAB 3KPOB 3UTZA 4F15B 1MW2A 2VDQH 1EJOL 4JB9H 1KF9B 2D03H 1NPUA 2EO7A 1B0GB 1V3LA 3CPLB 2VDRH 3OKKB 5IBTL 3V6OE 3CFDB 4HSQA 4K3HA 4OZHB 3BXNA 3CLEL 4LARL 3L4YA 3H2WA 2IFFL 1E71M 4PJXE 3VWKB 2ALWA 4ERSH 1MUJB 3IANA 3EBAA 1ZLWK 1IAIL 3DGGB 4S2SA 3QHNA 3TO2B 1IEHA 2DYPB 4U0RC 4PJCB 4S1QL 1E4WH 3NCYP 1EEQA 3V5KA 1KYOJ 3DYPA 1WK0A 4NPYB 4S1DD 1E4NA 1LP9F 5DJAA 3MQIA 5DUPL 1HINH 4MX7B 1NCCL 5IMOA 3E8UL 1U8IA 3O3BB 3FQXB 3VINA 4M24A 1DWHM 5DRWB 3D1MC 5H94B 4W4OA 2F15A 2X2YA 1GPOH 4AMCA 5C92A 5A2JH 1QI3A 2DTMH 4UILL 3MGTA 3L3GA 4R8WL 4NJAH 1IQDB 4U7MA 1RZ7H 3RM4A 1VGKB 4HFWB 5F6IB 2YZ1A 3V0VA 2BFVL 2AK4A 4AENB 4BSWB 4NZUL 1OP5H 3ESUF 3HG5A 1IV8A 2CIPA 2NY0B 4KFZC 3N50A 3C5ZB 1VPOL 3SGKC 3BUQA 1K9TA 2H2SC 1CR9H 2D24A 2VLMD 2QEJA 3HE6A 2APFA 4LMQE 3AM8A 2EEDA 5HHMD 5J6GB 1H0IA 4G43A 1A3HA 3BQUB 2Z8WC 4NOFA 1W3JA 3C2AL 2P8PB 1PG7W 3TVMA 3KLLA 5GJSL 5DK2B 1H3PH 2DGAA 3MV9E 3K8KA 4JN1H 2FYVA 3WLWD 5MEPA 3FCTA 5T1KA 5IMKA 4UDUB 1NDMB 2NW3B 1LK2A 3A4WA 3Q1SH 2YRPA 3WH5A 5E8EA 5I66A 2HRLA 3VM5A 1BTCA 5JQHC 3FRUA 4L4VA 4Z7OF 1WFUA 2Y2WA 1HJUA 1BIIA 1EERB 3S5LB 4F33A 2H9GB 3QWQB 1IC1A 1LWHA 3WEXA 4KK9D 4BZ2H 4Z2JA 2OJZH 4AY0A 1NJ9B 4JLRA 3QUZB 4F3FA 1DDHB 2WHMA 5SX5K 3NAAH 4XB7A 4MAYC 1D5ZA 5EZOH 3ZSSA 4NZRL 2AJUL 4KDTA 2VN7A 1LO3L 1AD9B 3RPIA 1IARB 3HI6H 3K8MA 3OXSA 5F1SA 1CQKA 4YZFF 1KCUL 3BLBA 3HR6A 4URIA 4RWYL 4PBWD 4XPFH 4HZ6A 3GH4A 4YXKH 5D6CA 5A2CA 1DVFC 4WF7A 4XHJD 4ZUWA 1J9YA 1B4JL 2ITDA 4ZQKA 5D7LB 4GIAA 4OOUA 5FUCC 1Y7VA 4FQLL 3IF1B 3AS0A 4KTYA 2GFBB 4XCNB 1Q6EA 4CVXB 4D0DB 1EZVY 3AI0A 2CLRA 2XN2A 2GIYA 4FG6C 4HUVB 4G80A 5FKYA 1ORSA 3VXSD 4RMWA 5CZXD 3BH9B 3WIHH 1QI4A 3WD3A 1KQYA 1L7IH 2DWEA 2Q6WB 5IVXB 4FQXC 4F7TA 3WFCL 2ZX8A 1K8IA 5HDBF 2ESCA 5EZJB 1NKOA 3H9SD 5GJTL 3CUPB 4OUUA 2Y5TA 3QCUH 3WO4C 4MHHI 5GGQH 3VJ6A 3DIFB 5ILTH 1BREA 2J7DA 2GAZB 4CVUA 3WQVA 4NO0A 1P7QA 3W26A 5TE7H 4I3SH 3VFGH 5B4MC 32C2B 3VIHA 2Y06L 2OXHA 1T1XB 3WQ4A 4R4FL 4GXVH 2YK1H 3UJJH 5KVFH 4HW6A 4YHNB 2Y25A 2CRYA 3MLTB 2HAZA 2P49B 1T2JA 1JNHB 4N5ED 1JWSB 1DL7H 4PTVA 3DV4B 3L4XA 4LGRB 2OW7A 4PGBA 4UB0L 3PQYE 1LWRA 2DSVA 3OGVA 3OG2A 4K2UH 4XVJL 4KKAD 3ZKNC 3BEWA 3FXYA 1A3RL 2NY6C 3MLUH 1CLOH 2G41A 2C3VB 5IWLA 1YEIH 5CPSA 4JFZL 4KRTA 5FM4A 3NCEB 5CEYA 2NY5C 5I30L 1CLXA 4G6FD 5JHDA 1HHIA 3MKKA 1EUTA 4KJQD 2IPKB 2XN0A 4MQ7B 5KAQG 1F8TL 1Q94B 4H20H 4KROD 1XGUA 1CDYA 4ELKA 3QUMA 4HF5H 3KPSE 1AQKL 1MCHA 2XRAL 3BPLC 4OCMC 1FZJB 1U8KA 1HSAB 4QF1B 4WUUD 4J23A 3MUAA 4IJ3B 5D5ME 3MV7D 1P1ZA 1J01A 4Y19E 3BO8B 2QPUA 2R2HB 2AABL 4PJHE 5I1AB 2Q76B 3AQUA 3ROOB 1UKQA 1EFQA 3GBML 1KB3A 1H3TA 1TNNA 3QEGH 3EYQD 3SJVA 1MIEL 3GSRB 4HS3A 4TUKH 4P2CG 2X7LB 2VCAA 4MA8H 3O9WD 4DKDC 4LPVA 2DT3A 3EUUA 4WWKB 2NZ9D 2FEDC 3QDGB 1CGSL 3V0WH 3BVTA 5B39A 4U1NA 4D6GA 4P2RD 5A3IC 3MRNA 3MACH 3ZTNH 4XXCA 1OSPL 4UFIA 3VI3E 4JO2H 3DX2A 1K4DA 1N6VA 5HSFA 4UAOB 1NGZA 3APGA 4LCUA 5JW4M 2GJ6B 2HN7A 1YPZE 1MI5B 3RNQA 1JGIA 4QNPF 1V6WA 3C8KA 3DETC 1DTUA 3MOBL 4AWEA 2BSSA 1SFSA 4HHAA 1F4XH 5B39G 3M8OH 4Y5XC 2J78A 1KC5L 1T1ZB 4LKCA 2QQNL 3LZFL 5IBLD 5ITBH 1JYWA 5ALBH 3BJLA 5FIPA 4L8SC 5A8PA 1TQVA 2HT2D 5FGRA 1DWFM 4HMEA 3QI9C 4IHOA 4F9PC 2IXUA 4XCCL 1K9DA 2APVA 4UIMB 2BNUA 2DD8H 1K6QL 1L7TL 1W72B 1I1AC 1OGTA 1EPFA 4UFLA 3V5HA 4I1NB 5JOEA 4FNPA 4M5YL 4F7CB 5DMIL 2EDKA 5IB3B 3I6LE 2DIJA 1G84A 3O3DB 2PW1B 4OF8A 5FUZL 2P45B 3GIVB 4YDLB 4CMMA 3UG5A 5KZ6A 1ZLSL 4R90H 4M43H 3MLWH 5DA0B 4F7PB 5EC2B 5BS0E 1TMCB 3GZAA 1EOMA 4BQCA 1HKMA 2YPVL 4YE4H 2FJGB 1T6WA 1F02I 3QR3A 1MXDA 4ZFGH 4ACZB 3VFTB 4H8HA 3WY3A 4LRIA 4X9YA 3QHOA 3SCWA 2W65B 3FQTA 1A9EB 4JRXD 3GNOA 1SQ2N 1XGZA 1KELH 3IDJA 4Y16B 3AFBA 3DVGB 3FO9A 3GO1H 3H9SA 5CSZA 5BRZB 1F90L 2OL3B 3T0EB 5EO1B 1KFAH 2V3EA 3LKSA 1F4YL 3L95A 4OIBA 5C2UB 4G8GE 3VG9C 3MRBB 1WZAA 5A16B 1UYWH 5JHLL 1UR1A 4LHUG 4PJ8C 5GZOD 3V5DB 3EJJX 5KSBF 4NI3A 5JPNB 4MA7H 1XR9A 4G6JL 5GRUH 2QLVB 4PV9B 2ICWB 3N9KA 5L6YH 3LB6C 3GKWL 2JJSA 1A6ZB 5H35A 1PQZA 3JWDL 1Z9OA 1JUFA 1NAKH 1SY6A 4GXUM 4NN7C 4CRPA 4WW1A 3T3PE 2VE6B 1YY8B 2OSLA 3VXRB 1KPRB 5I73C 3MRCA 2AJXH 2VLRE 3MRFB 4DZBA 5JUEH 1R5IB 4C7FA 3N18A 2AI0H 3S98A 5BVJB 3QRFM 3BHBB 2YD8A 2R1YB 3IJYB 4BZ1H 4EK7A 2WINA 3OQ3B 2X4PA 1AC0A 3G5ZA 5CGYD 5CD3B 3AFLA 3MSPA 1XCWA 1MCSA 2XWJB 1W2PA 4GQ9H 5C07E 5L2KE 3A23A 1DP0A 4QLJA 3QDJD 1AR1C 2QSCL 4CBPA 3AZTA 4IMKA 3AXLA 1A5FH 1FCGA 5KVEH 4UBDD 3MROA 2WWDA 5DJ0A 3WUZA 1UQSB 4S3KA 4HPOL 4ZPVA 1R3KB 3MV7A 2VZUA 2B20A 2HH0L 4O2FA 1QHZA 1UEYA 4XTRC 5EU5B 4LP4A 4V28A 1BQHA 4LGSB 4OM1L 5I9QB 4OD3L 4P59L 3S88L 4RGND 5DEZA 4F9LA 3VFSA 5JPMB 5H2BB 4YDVA 3O9WA 5MHSE 2ADIA 3WIFA 4QP0A 5C3TA 3NFNA 3VXTB 1D6EB 1IAIM 4XPTL 3TM6A 1FL6A 1NDGB 4WFGE 3U7WL 1HVQA 3CMGA 5EWIH 5DJ2B 4M6NL 1XD1A 2RBLA 4AXNA 1IZJA 4U5IA 1QFHA 4HIIB 3NA4A 3UXFA 3THCA 4GSDH 1A2YA 4DW2H 1BQHG 1NBVH 3VXUD 4DEPB 5D2LE 25C8L 3FW6A 2IALB 4M6OH 3MNWB 1NWUA 2ZX5A 3FT2B 5ICXA 3F7RA 4I77L 3PUCA 3WN5C 2X42A 3JWOL 1FNAA 4CW1A 1FHDA 1N3NA 4QLRA 1DCLA 2AXFA 1MHHA 4AZCB 3L9RA 4WI9A 2DBJA 5HHPB 4P2QA 2VDLH 3QO1A 5JOPE 1ED3A 2CHNA 3MRGA 1I9IH 3FQWA 4WW2B 2CLVA 1H0DB 3ZJ6A 1FIGL 4FLQA 2H3NB 3EZJB 4FZ8L 3VGAB 3GI9L 2VRQA 5M5DA 5EZLA 4G8IB 2OP4H 3GHEL 4NSBA 2XGIA 3Q6GL 3MBXL 1U8LB 2DL9A 5E7FA 1KJMA 4ELMF 1NARA 5SV4A 3MXVH 4C56B 4MQSB 4H88L 3LV3A 1JGEA 4GOSA 2YD1A 4J3XA 5TFSH 1PFCA 4AH2A 1H11A 2OWWA 1DQJA 3CPUA 3QHZL 3QJHB 4B9ZA 5FB8B 4GKSA 4P5TB 1LEKA 4NKIH 1ES0B 2AK1H 4PIRF 5I1KL 3ARDA 3MV8D 2P5WE 4H7VA 4U0QB 4KH2A 4JPKL 1N26A 3PGDB 4OFIA 4GRWB 4MAYA 1P4IH 3X3FH 3R0NA 1UJ3C 2Y8VA 4ZSOB 4BJLA 1DUYB 2YL9A 3UDWA 3W6LA 4JRXA 3EIFA 4PJFB 2I60L 4R3SB 1G9NC 4U1KA 2WMFA 2NXYB 2W0LA 2EDYA 4AD4A 2YFNA 3P0YL 1I8KA 4PTUB 2AV1A 1E28B 3RDTC 1IC5H 3MBED 1OD7A 1YHTA 4ATWA 2VXVH 2HTKD 1HSBB 1MFBH 2KQMA 1HL9A 1LNUA 4N0UE 1HNGA 3RWCA 4DWSD 5FYJE 3TNNB 4MMXC 2Y4SA 2FBOJ 1PYWA 1P2CA 3ARZA 4NKOA 4CVZB 3VRIA 1NGPL 3PP4L 2ADGA 4QFUA 2KH2B 2GY7B 4FQ2L 1V7NH 4WFHE 5BXFB 3BUTA 1EFXA 2NY7L 4J6RH 3B9VA 3TGXA 4H8VA 2SEBA 1VHPA 4U1MB 2J5LB 4XRCA 4Z77A 1JD9A 2GK1A 3L1OH 3MJ9A 3HG2A 2NTSP 2Z31C 3OAUH 3BMVA 1YZZA 3ZJKA 4YX2L 4W81A 3RKDD 3CHCA 5KSAC 2X09A 3ZDYE 4ZUUA 3ARPA 4G9DB 4N42A 2YD6A 5LA0A 1TFHA 4FTVA 1AFVL 3BGAA 3PNWB 1JI1A 5E94B 5GSRB 1HHJA 1GPFA 1OWQA 2KDGA 3OB0K 1XSIA 3FB8A 3PHAA 3CHEA 1J5OH 1KOAA 3U36B 3MSDA 1X44A 2VC2L 5I1DA 4IRSB 4KJYA 3VDCA 2BK8A 1WFNA 1S9WA 4OCRH 3SKJL 1JGLL 1KIRA 3AROA 3DTXB 5IHLB 1KYOK 3GHBL 4KDVA 5DJXA 1A7RH 3NACL 4MZ2A 3U1SH 3QIBC 4PY8J 2WUBH 1T2XA 3O45B 5BXPA 5I74B 4PSPA 2AS5M 2XTJC 2VLLB 4PRDA 4JN2A 5IV2A 2EDHA 1ZT4B 4MNQD 3DSFL 3TA3C 5ABFB 3UJTL 1U8PB 4NQDA 4L4VE 1UWGH 4NZJA 4QRPB 3BPNB 1UZ8A 2G3JA 8A3HA 3BESR 4HEPG 4PGZA 3PWJB 4TSCL 2LFGA 5CAYB 4KK5D 4GG6A 3F7VB 2YEZA 4GZJA 3WF2A 4RX4D 4YDIH 1H41A 2YC1A 1MIMH 1LEIB 1EGZA 2IFGA 3MNZB 4PB0H 4APQB 3O2WH 4LVNB 3ZE0F 3U46A 5E0QA 1EO7A 3WUEA 4C57C 2YKLH 3VXUA 3PF2A 5BV7H 1WIUA 2GKIA 3ZYIA 3VW3H 5A6JA 5KW9L 3NH7H 3G6JF 2HKHH 1IJ9A 3AREC 2EEAA 2WW5A 3EDEA 5MENB 5T33L 3FAWA 1VCAA 1KTKE 4Z7QF 2GK2A 2H45A 3E3QE 4UTAL 2B4CC 2M1KA 4TVSa 3GH5A 1CLZH 3VIGA 2I07A 1KNOB 1MFDL 3OJDA 3PGCB 4PJ7E 1SEBB 1FFOB 5D1ZD 3P4OB 3CSPA 3DVIA 3RP1A 4RGOH 1BZ9B 1QOXA 3KPQB 1ZA3B 2BC4A 3GBNH 1CBVH 3L3KB 1DN0B 1IAOB 4Z2HA 3NFPA 1YECL 4JFED 1IM3A 4YGVA 5EU3B 2AGJL 3IB4A 5D1QC 1TXKA 3HB3C 2QSVA 4OV5B 3HZMA 2ZG3A 3VX1A 1W9UA 3NCOA 5A2FA 3L3OB 2VSCA 4OLUH 5DRXB 5SV3A 4ONFL 1UD6A 1I4FA 1G0YR 1G5AA 1R3JA 1QLRB 5SWZD 2LTQB 4XCYA 3OKEB 3ALWA 5DJYB 4D6JA 4Q9RH 5FV1L 4ESKA 4Y4FA 3INUL 3MV8A 4P57A 2A6DA 1UB6B 1NFDA 5GNYA 3ARGC 5DHYA 5I78A 1JN6B 3AMDA 3LQMA 1C12A 4KY1L 2FJFA 4POZC 5DVOA 4JHWL 1QLFB 2BVPA 3T2OA 4XXDB 1O7AA 2AEWA 5I15H 2DQCH 1XF4A 3MREB 3KYNA 5MP6H 2COQA 1KCVL 5C09B 4YHYB 1N0LA 3KDMA 4UQ3B 4RFEB 3EW3B 1PBYA 3IGUA 3HMXA 1X7QA 2WKGA 4KZDH 4HXBH 4HPGA 2ZE0A 4MA1C 4OLXH 4NHUA 2FECL 3JTSA 4EI5A 5IGXL 1MFVA 1BVLA 5E4IA 4LEOB 1RZKH 2A73A 3RZWA 1CE6A 1IQWH 4NJ9H 1JDAA 3UTZB 1Z32X 4R27A 4QEGA 4KQ3H 3H42H 1TETH 4XX6A 3OZ9L 4U7KA 1QNOA 3SUVA 3TF7C 1UR2A 4IRZH 1T83A 4L5FL 1HCFX 1JHTA 3OR6B 1N6UA 2BOCA 2F54E 4X4ME 1CICA 1A4JA 4B50A 5JW5B 1J0JA 2N4IA 4NUJA 5BJTB 2JJWA 5ABGA 1DQLL 4DZ8A 5C0JA 1YJDC 5DRZA 2GCYA 4K8RD 4U1JB 4Z2GA 1M7IB 1H3GA 1E6JH 3OLDA 5IMOB 1MJ7L 1P53A 4U1LA 1CXKA 3KYKL 3EHBC 4G8FB 1PX4A 2YD2A 3U4BL 1G6VK 2A77H 2MCPH 3ZL4L 2VLME 4YDKL 2DPEA 4UR9A 2J3SA 5HHME 1GXEA 3MGTB 4ZUVA 3RX8A 2UYLA 2ORBL 2CH8A 3H0TB 4MNGB 2NR6D 1T04A 1HP4A 4KK8D 1U2YA 1GCYA 1A6AA 3UTTD 5D7IA 3W4RA 1HOCB 1YEJH 4W6WB 1KN4H 5GS0H 4AMXA 1A1MA 4RCAA 3MJ8A 3EDJA 4PRPB 1HIZA 4UU9B 3HE6B 1E5JA 3GMRA 5A8NA 3J7HA 1KLGA 1U3HD 3TO4D 3BE1L 3D18B 5DC0A 1V7ML 4MNQA 5DDHA 5DFVD 5HYJA 4O5LH 3WH7A 1Z3GL 4K3EH 4DFIA 1XZ0B 4QRRD 2OYMA 3E3QC 1AIFB 4RX4A 5MEPB 2B1AL 3SKMA 1DWAM 5E8OB 4DCQA 5IMKB 1G7IB 1TCMA 1E27A 1XFPA 4LSSL 5GRWA 3S35L 1ZEAH 5ECUA 4KJPC 3CUGA 2FDMA 5GS1A 4M62L 2ZWLT 5E8EB 5I66B 1PZ3A 1P5VA 2Y23A 3SDXF 2YUXA 4OZGF 4GJTB 4WUKL 3Q6FA 2WCAA 4F33B 5IR1A 5EOCL 5EU6D 2EIEA 4MNHA 3WIIH 5FYKL 3DOSA 1S7UB 3AZRA 3EAKA 1YYLH 2ICES 2ZXQA 5DYOA 3MZGB 5CKAA 5E03A 5IW1A 1D5ZB 3D85B 2CIKB 3HC3H 4LKXB 1LK3H 2DM7A 1F45A 3CFCH 1S7SA 1F4WH 4DTGH 4XWOC 5D1ZA 1UOKA 3O8XB 1F00I 4Z7WA 3ZHKA 3ZIZA 4WGWB 4MGXA 4XP4L 5D6CB 2BY0A 3HPLA 4RMUA 1V5JA 3VXSE 1TZHB 3FQUB 4DN3H 5CHNB 3IFPA 1JDDA 4ZQKB 5E4EB 4JFEA 1KN2H 4H8WH 2Y1VA 3ZLQC 4W6YB 1N64H 3VXME 4LCYA 5FHAH 1BJ8A 4XI5D 1FBIL 3FKUS 4HA1A 1JHKH 3ZE2E 3RJXA 4NN5B 1Q9LA 1JNLL 1VADB 3PTMA 5I79A 3VXPA 4AK1A 2E0PA 5GGVY 5L0QC 3A47A 3LQZB 4PRHA 3AIQA 3MLVH 4O02L 1TJIH 3QUML 2W60A 2BXYA 2QADB 2VSDA 4GRLB 3DXAB 1W1PA 1QBML 4PV8B 4GLRH 1KBGL 3U9PH 1BGAA 3GDBA 1KJ2A 1ONQA 3THML 5I16A 3OKOB 2Y5TB 4GKZA 4P5MA 2BRRL 2FD6L 4HS6B 5KS9E 3B43A 1MRFH 4RAVB 5T3XH 2UZIL 1ZWIB 1E0WA 4M7KH 1OAXH 3WKMH 4NKQB 2EH7H 3HI5H 4P23C 4UOQA 2HWZH 1OWWA 4E0RA 3QCVH 1GQIA 1QFOA 5I1HH 3ZT7A 4YHIB 3WS6C 2FGWL 1QI5A 2PN5A 4LNRA 4IDJL 2G60L 3SCUA 1DBKL 4GMSH 3PHOA 3AMGA 1YQVL 1JXJA 5F89A 1HH6A 1EHXA 3LMJH 3GMQA 2F74A 3IJHB 3FFDA 3KXFA 5GGVH 1BFVH 1UZ1A 3MLSL 4PRID 1BGGA 1ISYA 3O2VL 5GS2D 3BEWB 2HG5A 2Z92B 2G2RA 5HDQH 1U91A 2V2WA 5L8JB 3J8F7 3ZMRA 4FQCL 1F11A 4ZE4A 2A83B 3CH1B 4WUUE 1FGVH 3PWLA 5CEYB 3ET9F 4ZS7L 2PYEA 3UX9B 2P7TA 1HHIB 5JHDB 2AEPH 2ICEA 2IADA 2R29H 3TA9A 2JF7A 1YDPA 1AXTL 1QKZH 3ULUE 3L3HB 2MJWA 3ALXA 1XGUB 4RMQA 5E2WH 4TUFA 4ELKB 3T0XA 3CZLA 2X4TA 1FNLA 3I50L 4JHAL 3GBDA 1QSEE 4WY7L 5IVNA 4X98A 4HZLA 4Y89A 3FFCD 3EJZD 2YPKA 3M7SA 1DLFH 1QNRA 4Y4HB 3W28A 1TVHA 3RWGB 5HJ3A 1P84J 3QPQC 1SVCP 2CRMA 5J1AA 5E08H 4P2RE 5F7FA 1DWGM 4YFEA 4W87A 3UTTA 4MQXD 3SJVB 1IGYB 1LP9A 5H37G 5FAAA 3FQRA 1YEKH 2W0KA 4QHLA 1S7RB 3BUIA 4OCNC 3S4SA 4W89A 1MWAB 4DGVL 3RUGB 2A1WL 3SDCB 3U7VA 2V9RA 3SCQA 1U3HA 3TO4A 1RZIA 5B39B 3O6LL 4KHTH 4TTGA 5INCA 3BKJH 1NUGA 2NT0A 2ZUUA 5LCVL 5B38A 4JZNA 4QRRA 4I0PD 1K4DB 5GQBA 3DX4A 3RZCC 3U9UA 1WIOA 4UTBL 4G7YH 1AP2A 2OSWA 5DD1H 1VSCA 4JPIA 3EO9H 5EBLA 4LCUB 3S4SG 3H7LA 1VEMA 1LD9A 3QFJE 3VD4A 4U1HA 4RRPG 3SDYL 3CCHA 3RVUD 3UTSD 4GLRI 5JTWA 2NY4B 2BSSB 4HHAB 4UQ2A 2X4UB 3TN0B 1SBSH 1FQ9C 2MWCA 2Z8RA 5EU6A 5CZXC 4Y8AA 3TT3L 4PY7B 5CSUA 5T5NF 2DT1A 3CIQA 3HUJE 5C9JB 4JFYA 3NCMA 3BAXA 4DUXA 4K71C 3U0TA 2FSEA 5B38G 2VDNH 2F2HA 3AISA 3D0LA 3I6KB 3TC9A 3AU1A 2IAMB 2XZZA 3CZEA 2VDKH 3ZT5A 1GQKA 3RAJL 4PJ5D 3V5HB 4KKBC 4LCWD 5DEFA 4Z78A 3B2VL 1UD5A 3QUYB 3OR7A 4E5XA 2GYSA 3RWHB 2UWEF 4FNUA 1RQ5A 4IS6A 3VRLE 1RZGB 4LYPA 2CDFB 4JGUA 5D9OA 1HXKA 2VL5A 2P48B 4B0MM 1SY6L 2A6JA 1NAMA 4CUCA 4P2OD 3WQ5A 4I48B 4JRXE 3T0VA 4TTUA 4OV6F 1HTYA 1KT2B 1U93A 4MSWB 4AEIL 3SCMC 2F8XC 1KLUA 2AJYH 3EDKA 4LHUB 2H32A 1DBAL 4GAGH 1UWUA 4G6KH 3QCTH 2OTUB 3VPLA 4LBEA 3CVHH 3DI3B 3FQTB 4HWZA 4R6UA 4A6YA 1E0VA 3OKLB 4WO4B 1HH9B 2CBJA 3FO9B 5TE4L 2DQHL 4WHYH 5ALCH 3PIQB 3CX5J 1OAZH 2YA1A 5GIRB 2XA3A 4PJ9C 3LKSB 3QFDB 1LO4H 3L95B 3TBWB 4CMHB 5I6XC 2WIMA 4LSPH 3RBSA 4X7SH 2H8PB 4TUOB 1GC1H 4JGJA 3TT1L 5DZLA 3DHMA 3FO2A 4NYLA 3AZSA 1L8NA 1G7JA 4M9PA 3ULUC 4WVRA 1BLNA 4WI5A 2IQ9H 3WH9A 4LVHC 4LQ1A 3ZKXC 2AMGA 2AEQL 2HFGH 3MRRA 1N6QH 5CJOL 3CLFL 1ZLUH 4D9RD 4TRPL 5GGSA 3IU3A 4PRIA 3MS8A 4HKBA 3FQNA 1ZHKA 5IVZB 3A4XA 4WTWA 5F7DA 4PJCF 1CGYA 3QDJE 3LEXA 3TV3L 1IC4H 4OZFA 1C5CL 2JLLA 2NZ9C 2VXSH 5DT5A 2CRIA 4YR6B 2A9MH 2DLGA 2YSSA 4F57H 4JDVB 4TQEH 1T2QH 3IGAA 4OKVB 3PV6B 3G5ZB 5K59F 1BD2B 3A6CL 4KQ4L 4PJGB 2PXYD 2J7LA 5C0AD 3LY6A 4M1GL 4DKFH 4KRPC 4RGNE 5KANG 1FYTB 3AXLB 2FLRT 2CKSA 5HYFA 4PGEA 2R8SL 3WE6B 2W91A 3VDAA 3UJIH 4Y2DC 1PJ9A 3RY5A 1ZJBA 1H2JA 1IGIH 5AD0B 2YJQA 4XAKD 2QBWA 1L9NA 4ETYA 1FRGH 5B22A 4OKDA 5E2TH 3IETA 5IKCA 1BQHB 2J6EH 5EBMA 3GXIA 1OB1A 1W8NA 4NRYA 3VFSB 5I1LA 3WEMA 1AGFA 2BSTB 3GI8L 4ZFOA 3VFNB 1AHWC 1HKJA 1JGVL 4Q22A 3VXUE 4BH7A 1C8QA 5IFHH 3ULVL 4WIQA 3WIFB 3NFNB 4R26L 4ODXB 5HGBB 1FL6B 4Z8FH 2XZAL 3CLEH 2WBJA 3WNMA 3RTQD 1HKKA 3D39D 3UYOD 2O5XH 3ZE1E 2FEEI 2PR4L 3OLGA 4OCSL 1BQUA 4JY6A 3MODL 5AYQA 4PTXA 4I0PA 1A2YB 3I3EA 4F8TA 1EBAA 4PRNA 2E7HA 3IXAA 4D71A 5ICXB 2O9RA 1N7ML 4PPTA 2E9IA 5FO7B 2G75B 4CW1B 5IQ7L 2GITB 4Z7NF 2JEQA 1H5BC 1E4KC 1N3NB 2HJKA 5CUSL 5INDA 3UTSA 1MHHB 4KKLD 3MUZ1 4RQQA 1LL4A 4K94L 5DO2D 4HIJB 4GINA 4UILH 3UETA 2RHEA 4J1UA 4R8WH 5I17B 5DFAA 2X8RA 3VFWB 3MRGB 3FQWB 4UT6L 3LRMA 4AL8L 2B0SL 1OSZA 1NBYB 3HS0A 3PL6D 1I8LC 1PX3A 4UOW0 3SE9H 3AYRA 3BAEL 1Y6NR 3DYOA 5EZLB 3KYOA 3KL0A 1G9MC 1OGGA 4V27A 1VPOH 3PWPA 2L7UA 1M6OA 4OFDA 1DE4A 1HIMH 4DOHB 1QNZL 3IDIA 4Y5VA 4AIOA 3P4MB 4FNSA 1KXTA 3MV8E 3Q5OA 7TAAA 3M07A 4BCEA 3IFOA 2KKQA 4QOKB 4JY5L 5GZOC 4OF7A 1JGEB 1CFTA 2J8HA 4Z7UE 4MB4A 1MQKH 3C2AH 1Q9OA 5EU4A 3MJ9L 3CXDL 3FJTA 4RISL 5GJSH 3CFBB 5A2KH 4GKSB 1HX0A 3FONA 4POYA 1ORQB 1J8KA 4TULL 4HV8A 3ARDB 5F7NC 2OWCA 5AWNL 1CVRA 3EYVA 5C3LD 5IVXF 5E1HB 3T65A 5D2NE 2GJRA 3WL0A 2V5TA 2L7JA 3ZYJA 4MCYA 4MAYB 3SDAC 4P7OA 3MXWH 4D1JA 3KPMA 1T89A 4NC1C 4WI8A 1T0PB 5J56B 3VU2A 1RHFA 3HZYB 3K4AA 2Y36H 1BVNP 2OM5A 3FN0H 3PXHA 3BAKA 4LEXH 5JXAH 1R7OA 1RPQA 1DVFB 4MVBC 5E5MB 3S34L 3HMWL 4OB5L 1C08A 1IT9L 2AV1B 1MCIA 4QWWD 3LPGA 1HQ4A 1QUNA 3TYFA 2BCKA 2VQTA 1BFTA 1IGTA 2AJUH 1Z6JT 1LNUB 2H26B 1LO3H 4FA8A 3QDAA 3C09C 4WENB 3S3PA 1BFSA 1KCUH 4R97C 4YH6A 4NKOB 1MHEB 4W8AA 4RWYH 3RY6C 3CFKA 3VWJD 3WCYA 4ONGL 4NBYB 5JXED 1FG2A 1EFXB 4URTB 1C93A 4NRRA 1UR8A 3TH4T 3NCCB 4FQXB 4FQLH 4B7LA 5EUOF 4NQED 2MSPA 3PTQA 1MCRA 4XRCB 4EDXB 3WO4B 4LVOB 2GK1B 5C9KA 4RDQF 2WNWA 3BUYB 2DWDB 4LSTL 3VXNA 2ARJQ 4DK3A 5M7QA 3JVGA 5E7BA 5IROC 5FKAB 1T7YA 1FAIL 5D7IE 3WL1A 4D9QD 1FE8L 5DS8A 5KSBA 5F6HI 3MRKA 4Z2KA 3U5YA 4PGDB 4LIQE 4PG9A 4FTVB 3WY2A 4NO3B 1YN7A 3WFCH 3DVNA 3BJ91 3CFEA 1XCTA 2I9TA 2PXYA 5C0AA 1RUAL 4OQTA 4D0BB 4LPWA 4AIXA 5DO8A 1C5BL 1G7MA 2EPOA 3GXNA 1K3IA 4MNQE 2AXGB 4L3CA 1NGWA 1B2WH 1ZANL 3BZFA 3TCLB 1S9WB 3FRPA 2O5ZH 3MZTA 2VABA 1PG7X 1JTPA 2Y06H 4NXKA 2C5DC 3ECBA 4R4FH 4RWHA 1BSIA 2NY6B 1FFPA 3LQAL 4YAQB 2BSRA 1PLGL 2N7BA 5E1AA 5KG9A 3S3JA 2GW5A 3LS5L 3PZUA 4HT1L 4W4NA 4MJIB 4TN9A 3LD8C 4G9FE 4AEHL 3TCXA 3RIFF 1MRCL 3NZ8A 4PG2C 2I9LB 3ES6A 4NQDB 4UB0H 1S5IH 1OGSA 1BHGA 1UZ8B 4XVJH 2WV3A 3PHSA 4ZO8A 1L6XA 4GG6B 1A3RH 2ESVD 2YEZB 1UKSA 1VKXA 2X0YA 3BPLB 2YC1B 3I02B 3O3EA 5AZEL 1G6RA 3RTQA 5HBFA 4JFZH 3VFUA 1ETZB 4U3XA 3X13A 1GHFL 3GEWB 4YIQA 5I30H 3A5VA 4NZTL 1UM6L 2J8UB 2HVKA 2Z93B 3F7YA 4TUJA 3U46B 4Q9CA 2RGSA 3U57A 1F8TH 3MV9B 2JCCE 4XH2A 5HYQA 3HZ3A 3W11D 1MSPA 4GI8A 4HGKC 3NZHL 2V5CA 1AQKH 3ZM8A 3D50A 4OCXL 1MQPA 3B8SA 3O41B 2EE2A 1BBDL 4JQVC 1ZGLB 2OK0H 4QTHA 3HMXL 3GSNB 1U92A 3I6GB 3UZQA 4RAHA 5BMFL 1Z2KA 4NQTA 3RRQA 5DHVH 4M8QA 1NEZG 3IDNA 1OP3H 5T1LB 1DEEA 1FPTL 1DN2A 1QFWH 3NN8A 1MIEH 4HXAL 1MFNA 5D2NC 3RI5F 5SWZE 3CDYA 2OI9C 3NFPB 2DH2A 3MBEC 3QGVA 1BFOA 3DMMD 5JMOC 1ACZA 1KJVA 2ZJSH 3SE4A 1A1NB 4UT9H 3S8WA 3A21A 3WSQL 2M2DA 1ZT7A 1CGSH 1F6AA 2CRZA 3QHFH 4HJJL 3V8CA 3HZMB 3UPRB 1IGCL 4IRJC 1XGRA 1GOMA 5HI3C 1W0VB 3S37X 2OSXA 1I4FB 1MY7A 4RL3A 2RIKA 4NM4L 5F3HB 4Z9KB 4XCYB 4W8BA 4YPGA 5DJDA 4HC1A 1MJUH 5I2UA 4Y4FB 3AXHA 5IB2A 3IJ8A 4MAZA 1WSST 1CWVA 1NFDB 4OLZL 4L8SB 5J4MA 2EEXA 2I26N 5DHYB 4ELMA 3QI9B 2J2ZA 4ACYA 1C12B 4LFHD 4B53A 3F12A 1BF8A 1WZMA 2DI9A 1DQDL 3MOBH 4NZDA 1I1AB 3BKCL 3D0VA 4MAVA 2C1PA 1XF4B 2CKNA 1EMTL 1KC5H 3DRQA 3EOTL 1BVKB 1GUVA 3AS1A 2PCPA 5E6ZA 1X7QB 4JO4L 2VI0A 3L5JA 1CS6A 5AG8A 1VBUA 4EI5B 1CFBA 1MCLA 4PMUA 2VISA 2BHUA 2A73B 1L7TH