4CGTA

Deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
678
structure length
678
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPADAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 228
structure length 678
sequence length 678
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cgtA01
4EI5D 4KWUA 1KLUA 4HPOH 2ZOXA 5EPMA 3RILA 5TDNA 2IAND 3GMOA 5CD5D 1GQIA 3S9DB 3BLKA 1QR1A 2R1YB 3QNXB 3WD5H 1KJ3L 4MAUH 3EJSA 4BSJA 4KK9D 4OZFB 1HHHA 4Z7WA 1H09A 3F5LA 4B16A 3NOIA 4JFPB 5A2CA 2H3NA 2R0WH 4GAFB 3LAFA 3PIQA 4EI5A 4PJ7F 5ENWA 3GIVB 2OBGA 4I18C 1CDIA 3WS3B 4PJCF 4HWZA 3L5HA 1V02A 3FN9A 4TOYH 3P11L 4MDJA 5DJ0B 3M8OH 2FCBA 3ARBC 2V5RA 1D6EB 4LKCA 1U8KB 4PSRA 1CGSH 3GM0A 4V1DA 3X11A 2VWEE 4ODHL 1W9UA 5ELIA 3RVVC 5LWYH 1FAIH 5BJTB 2PUQT 1LNUA 3WS6A 1Z32X 1JGLH 4PS4H 4ODWA 5TD4A 3QCUL 4MX7B 3GNOA 1AHWC 2VXSL 3ARFC 1NUNB 4HC1H 3NBNA 2AEQL 1FGVL 2XV6B 1I7TB 3C5ZA 3TZVD 1BPVA 4UIMB 3RKDC 2A9MH 5IESH 3O8XB 4BSWB 4OFIA 2DQFB 5I2IB 5JBDA 3O41B 3GH5A 2APTA 1XAUA 3CNKA 4WFHD 4Y2OA 3U1SH 2AXGA 5B38B 3AIRA 4AZBA 3U9UB 3GFUA 5A69A 3PXHA 3EYUL 3FL7A 1AC6A 5GSVA 3IJSA 4KGLA 4ZPTB 4L4OA 4LGPB 1V3HA 4Y1AE 2DQIL 2YL6A 4P59L 1L9NA 3G9AB 3HI6L 4J2XA 5FIPA 5I15H 2XIDA 5KVMC 1ISVA 1ED3A 1FP9A 1CLYH 2DWEB 1E43A 4LCCA 3V5DB 4DWSB 5EUOB 4X4ME 1JGVL 4H5SA 3AFBA 3WNNA 1J1OH 5D72L 1W8OA 3O4OB 3UJTL 1IAMA 1PKQA 2D7QA 3O6KH 4Q9BA 1GGCL 1DSFL 4OF6A 2FO4B 4MXQC 2F74A 3UERA 4FHBD 2VLJA 3TO2B 5JXAL 2LU3A 4GRLD 5ICXB 4XMLL 3NCEB 2D7NA 1OTTC 3WN5C 1MFAH 3ARFA 1G9NL 1ACYH 4JFXA 5BCAA 1TVHA 1CGTA 2ADJA 1A3HA 3GBNH 1UM5H 3I75A 3U0WH 4W6WB 1FO0A 1UHVA 4JFFE 1YEGL 5EU5B 5IW3A 4XVTH 1ZVSA 2WUBH 3EJZC 1JN6B 5GSRB 3WNMA 2I25N 3VD7A 2XRAH 5CKGA 2I9TB 2HJKA 4Q9RH 4D0BB 2ESCA 3A6CL 3I6KB 4BSVB 3OWEA 3INUH 1JAEA 4O02H 1EK3A 4WUKL 2NCMA 2ZUQB 5D1XD 5GZNC 5C0DA 2DN7A 3CX5K 3VKKA 1UM4L 3SHSA 1FYTD 1F8TH 6A3HA 1S9XA 2V9TA 43CAA 1KLFA 3TOPA 5JMOC 1IGCH 1U8MB 1P1ZA 3GMMB 1A6UL 2NY4D 4U5KA 2J7LA 4ONGH 4YFLI 1IL1A 4P9HL 4RGNB 3ZE0F 1T6VN 1RIHH 3T4YB 3FAWA 5J6HB 2G9HA 3BGFC 4OF5A 3GMMA 5IJVB 2NY4C 4GS7B 4ZPVA 1UQSA 2FECL 2X4UA 4JY4A 5HVHC 5C7XL 1ZA3B 5I6SA 2CBIA 2YD4A 2WHMA 1GQLA 3H3PH 1OGAE 2GSIA 4M1CD 4XNUL 3K2UL 4CKQA 3KL5A 3EO1B 1HCFX 4BQ6A 2IXUA 3OLEA 5IJVA 1UZ6E 1F4XL 2WC3A 3JWOL 2OCFD 4FLSA 4OFYA 2EDEA 2X2HA 4LRIA 5F7EH 3MV8D 2E7MA 2VXUL 1FDLH 2MCPH 2AV1B 4UINH 1NAMB 1J8KA 3P9LB 4I48A 4XCCL 4AMKL 3WN5B 3FFCD 4EDWL 2DDQL 4HUVB 1EBAA 4NFDA 4J3UA 3UPAA 3Q0HA 3SKOA 3GSNA 5KTEH 5LQBL 4S1SH 3GKWL 1YUHA 1X6NA 2HT2C 3L3IB 1T22B 5FOJA 1FYTE 2P5EE 5E2UH 4FQHA 1B3ZA 4W7UA 3CIVA 5BVPH 1AD0B 1FL3B 4NBYB 2WHJA 4FFWD 1MWAB 3BCDA 3KLKA 1XGTB 3FB8A 4DJMA 1NARA 5E6ZA 3L3IA 2PWFA 3P30L 1KB5B 1ZGLA 1VFAB 5C6PB 2ZWLT 1JGLL 1F6FB 1DCLA 2YHGA 4QOKD 5F6IC 5JOEA 4XAWH 3LXAA 1BAFL 1XIWC 5F6HI 3SE9H 4HH8A 4FQIL 2XPGB 2CKNA 5DC0A 5BZWB 2CIIB 1JN6A 2A9ML 7CGTA 3SGJA 4GMTL 4OF0A 1N8ZA 1DQQB 3IU3B 5IF0B 4UOQA 1KGCE 4PLOB 4R9HA 1UJ3B 4LRIC 4NQVB 4K3JL 2FJHB 2FHCA 1HKKA 3V6FB 3RZCA 3OGSA 3D3VE 3RKPA 3FB5B 5A6JA 4QY8B 4F8XA 4X0NA 1DQQA 1W3KA 1NLBL 3B5GA 1LD9B 4FXKB 1BD2A 3GYCA 5CPQA 5DJ6B 5DJAA 1E6QM 5TJWK 4PJ5A 1EO7A 3DDFA 1FOBA 1U3HD 2BP3A 2CBUA 2WZPD 3CDFA 4HXBH 2WUCL 4FQXA 2QQNH 2ZSWB 3VXSB 4QHKJ 3VTRA 1OWQA 1CXIA 4NRXA 1HSAA 1UQYA 1VCAA 2FBOJ 1JPFA 2P5ED 1KXQA 4M03A 1NEUA 5DQ9A 1YDPB 1VEPA 1UKPA 2EPMX 4HS6B 3AXLB 4EQ2A 5ABDE 4QXTB 1GHFH 2M8XA 4F7MA 4OFKA 2J4GA 1KLGB 2CLVA 3BH9B 5FCUH 3RVVD 1U2YA 1WKYA 5DQDH 1JPFB 1U2CA 2PTVA 3QUYD 4GAGL 2WB5A 1KELH 5C1MB 3VIGA 3SQOL 3IFOA 3GK8L 3VRLF 5E8EB 3L1OL 4GG6A 1NAMA 4QCIA 5T1MB 2YL8A 3C8DA 3GBEA 3UJJH 4NZTH 5KG9B 1L7IL 4MJID 3PWVA 2NTFB 5DTFB 1EEYB 1YEFH 2ATPB 2OR9L 5CEZL 2UY4A 2WUBL 1U8OB 2DKSA 1BLNA 4GG6F 4W70A 4JO4H 3QHTC 2F7OA 1CFTA 2YMXH 4E8CA 4JVUA 1QHPA 1YYLH 1DQJB 4WGWB 4DFIA 1MWAH 2XG5A 3PTQA 3SCMD 3DSFH 3G5ZB 3HTLX 4FQXC 1XZ0A 2Z31D 5C8JB 4AZHA 2QADC 3AREB 4IOFC 1JNLL 4HGKC 4GI6A 3V6ZB 2E6JA 4GT7A 4HUWA 1AIFB 3HMXA 3BSZL 3BH4A 3WDRA 3LZFL 2V7NB 4XCFH 4X6EB 4Z2LA 1A6UH 4CMHC 2P8MB 2EDWA 3GSVB 3SDYL 3VXOA 3WD1A 4K2UL 3B2VL 1GSMA 4U49A 4IBLT 3LQAL 5JHDA 4N0RA 1B90A 4P23D 1QFWH 2CEQA 1IGIL 1TCRB 1XH2A 5C7XH 5DFVD 5I16B 4GG8A 3WFDH 2AERT 6TAAA 1FL6A 3BD4A 1IEAB 2UY2A 2WZHA 5JPNB 1BWWA 4KMLB 2NW3B 5B8CA 5D7SL 1PS3A 4YBLC 4F37K 4M9OA 2MCG1 1J88A 1ZJBA 3WL9B 2XKUA 2Q86B 4JZOA 3QCVH 3VNYA 4JKKA 4MJIA 3CMOH 3SDCC 4XVUD 1HSAB 1AQHA 4EE9A 4W87A 2VISB 5T1KA 1LMKA 3LKQB 3GEWB 1Q6FA 4UFJA 3MLZL 3VSUA 4K07A 3D3VA 4RIRB 4UTBL 4LHUA 1GOWA 5E00A 5EO1A 2A0LD 4JM4H 3PWPD 4KDVA 4Y4HC 1QNOA 2E6PA 2AQ2A 1OOAA 1IGJA 1RJZA 3P9MB 2YA1A 4O2EA 2JCCB 5DK0B 4JG1L 3ARGC 2A6DB 2X10A 4NHUA 2PC8A 5I77A 3QPXL 3S35L 1FP8A 4KV5E 4Q7DA 1MXDA 1GOIA 3VWJB 3BOVA 5DEFB 2PW2A 3ZQ9A 1W9XA 1CF8L 3NA9H 4K94L 3F7VA 1QO3B 1K6QL 3NN8B 3PL6A 4UDUB 2PYEA 3C9NB 5AAWA 1RZJL 4U6XA 3T04D 5I23A 1CD1B 1K9FA 2BVUA 1T1YB 3SCVA 3UR8A 4OIIL 4PJIB 4Z78B 3ARWA 4P2RA 1BG4A 3BKJH 4GMTH 4OD1L 1NFIB 4AISA 1BGXL 2X9YA 2EDQA 2D7MA 3STZA 4JFEE 1QKZL 1KENH 4K7FB 3PTMA 3ZOAA 1HF6A 1JWMB 2OX5A 1IFHH 2CO6B 1EXUB 4QRPB 3NSNA 1EJOL 5A6BD 4PJDE 4PJEE 5E2VL 3NH7H 2B1HL 2W66A 4EN3D 4YBHA 3GMQA 1NLBH 2H41A 3I6LE 1G01A 2YIHA 4TUKH 2IPUK 1BGAA 1R87A 2GT9B 4QRSB 2YZ8A 3D69A 1J1PL 1A7PL 1UACH 4ZYKB 4IRJC 3G5YA 5HGBB 4NQCE 1BGGA 3KGRA 2WVVA 5CZKA 2BNRE 1T21A 3QJHA 4L8SC 3ARDD 3SE8L 3PF2A 1WZMA 5IFTA 4EAMA 2APBA 4EN3A 3QH3B 1QSEE 2FEDC 3O45B 2EZ0D 3BDXA 1G7HA 1NFDA 4UDTA 3K8MA 1K9DA 4PMRA 3NCJL 1GHFL 4PY7B 4FNTA 3RL2B 4U1IB 3RWJB 3FB7B 5JPNA 5DMGD 3PQYB 4UUJB 2GJRA 2VURA 4XRCB 4CVUA 2WVTA 5DSCB 3BAIA 4GAGH 4LDEB 5ETUB 3OKLB 4JB9L 1AY1L 3W4RA 2NPLX 3MPCA 4XBEL 3S36L 4FP8L 2QSCH 4NFCA 1E4NA 1XF5B 4UQ2B 2HFFA 4UUJA 4JFEB 4C7FA 1WZ1L 2GY5A 3ABZA 5ESAA 3VRJA 3O2WL 4MNGE 5TE4L 4YBQD 1BECA 1Q9OB 4P3DB 3ZKMD 4H8HA 4DCQA 3AIWA 5E1QA 5LBSL 3JUZA 1FV1A 1VPOL 3ALPA 4WHDA 3G9VA 5MEPB 5HYJB 2UVFA 1UA7A 3AXXA 3LKNA 4BYHA 3SGKA 4PMYA 1PEZA 1JNLH 1HEZA 4PJFE 5AYUL 3PZUA 5C0BD 2OZ4A 5KW9L 5FO7A 3N11A 4M43L 2ZE0A 2R1WB 3RJYA 4AT6B 4X0KA 3MREB 2I60L 4OKVA 3GBDA 3B2VH 4H41A 4YHPB 3QEGL 4OF8A 2YD5A 3BE1L 3HPLB 1LO2H 4P4KB 1PIFA 3ULVD 1QEWB 5E94A 5FUCE 5TFSL 5SWZB 3DRTB 4D0DA 1KCVL 2HT4C 2VJXA 4E2OA 1MELA 4P2OD 1CFNB 5KAQG 2CJUL 5JHDE 1M7DA 2E9BA 4OQTL 2IBZY 2CR6A 1QI3A 4ZUSB 2UWEA 4BH8A 3P77A 3WXWH 2FGWH 1I8LA 2D03L 2IALA 3PGDB 5EOCH 3O6FB 1R5WB 1FJ1A 4MQ7A 3S36X 1UB6A 1G7JB 5E9AA 3CMOL 3AM8C 4NO3A 4YPGB 2EH8H 1C5DB 3CXHK 1FL5A 1UCBL 1X4YA 2FATH 1FLRH 4ATDA 1G7HB 4XPBL 4MLIA 4HUUB 3UTSA 3DBXB 1ZTXH 5D2LE 1KB3A 2X05A 4MADA 4NM8H 5DJ2A 4FTVA 1C5DA 3OGRA 1MFCH 1G7QA 1G7IB 2F58L 2NW2A 2OSLA 3C6LC 3GSWB 5F7LB 3IANA 4JAWA 2YPLB 5DSCA 3LRKA 3NTCH 1VGKB 3SKUD 1EO8H 3V7MA 4KFZC 5JORB 2XVLA 5DJ2B 5JOPD 3TBWA 3WO4C 2JELH 3B5TA 4ACZA 2QLYA 3FNDA 4V2BA 2VR9A 4JFSA 3WEZA 4L4TE 1A5FH 1VERA 4I1NB 3ELAT 1K9EA 2BOCA 4AZGA 4I13B 1NOUA 1I8IB 5F7DB 4HK3N 3DVFA 4MX7A 4TYUA 1I9IL 4MJ6B 1NBZA 3BYTA 1SY6L 4HCRL 4CKVX 4HX1A 2YD2A 4LVNB 5I2IA 2V5TA 2Y25A 2R39A 3WFBL 4Y2DB 4ISVA 5HHMD 3SCMB 3O41A 4D3CL 2XFFA 2XTJE 2B4CH 1CICA 3PDOA 3C5SA 1Z9MA 5HHOB 1JFQL 1ETZA 1U3HA 5MEOB 1K9TA 1GZJA 1UEYA 2HYMA 3OXSB 4R26H 4K3GA 3G6AA 4KJWC 1ETZB 4Z2GA 1MJ7L 3TCLA 1NLDL 4MXWL 3T2NH 1IVLA 5JDSA 1Q72L 5BS0A 1RY7B 5F89B 1MRDL 1OAXL 4GW4A 2DM7A 4Q6YA 1FLTX 5ACMA 4R27A 2CRZA 2YRPA 3VXPB 4PTTA 1QSEA 4UV7H 1AY1H 1H9VA 1FFOB 4X9IA 4Y4FB 1DUYA 3VX1A 1GGTA 4YIQA 1BM3H 3F8UB 3TO2A 3OGCB 4FP8H 1QOXA 4R90H 3W24A 2X4PA 4NUJA 1DBAH 2ZUUA 3GMLA 5FUCC 4WW2A 5IBLD 3OGCA 5HYSG 1C8QA 2GEEA 3VOCA 1UA6L 4FABL 1VFMA 2QQQA 3BPNC 4M56A 4NUJB 2G2RB 1Q9KB 4FTVD 5HHME 2I5YH 4RFEB 5IIEB 1W1VA 4OLUL 1UWRA 5E95B 2COQA 1WK0A 3DOSA 4H25A 3OKKB 4Z5RB 2HJKB 1LE9B 5KW9H 4DZ8A 1TPXB 3RM9A 2Q7YB 4JO1L 5T1DH 3AI0A 1KNOA 3QQ3B 5ICZB 1NAKL 4AENA 1R3IL 4UQ3A 3KPPA 5ISZA 1CLZH 3DMMD 4FQ2H 2C8NA 3VIHA 1RZ8A 5IVZA 5FKYA 1KFAL 1YMHA 3GRWL 2YBTA 4KI5F 3M17A 5DEGA 2DPEA 3WBEA 3FO9A 1BQHB 3RHWF 3RM8A 1R6VA 2APFA 3WF0A 4D6HA 3MCKB 3AISA 3O6FC 5K9JH 2J7FA 2VLKD 5JQHC 1N2RB 3UG5A 5DRZA 3SCMA 1VAHA 3H6JA 3IFLH 4OCNC 2FB4L 1TZGL 5C0AE 2Z91B 4MMZC 4OIAA 1S8DA 2VLRD 1U41A 5BQ7B 3QXAA 5E1AA 5HYSA 2F61A 5M03A 5LCVH 3GI9L 4R2GD 4R0LA 1A6WL 4H8WC 1DWHM 4D9QD 5IOPA 3MJ8B 3ZR5A 3DX7A 1KTRL 3PZ9A 4GUPA 4LDLB 2VXSH 4R8WH 3RGVD 4KJYB 2FLRT 5MHSE 3AXHA 3RAJH 5IEHA 3CVHB 3KNBB 4FOMA 1OINA 1MFCL 5FYJH 2R2EB 2J79A 4KTEL 3EJQA 3KXFD 3EFFB 3HC0A 5E8DL 2R23B 1EHLH 2IWGA 3QUMA 4TNWK 2DWEA 1RP9A 5I1DA 4JL2A 4MWFA 3L3KA 2B2XH 1Y6NR 5F1NA 1G6RH 2XWTB 2C4FT 4ZAKA 4QYOB 2LVCA 5B21A 1T2QL 5IB5B 3BVWA 1N64L 5I15L 3QUMB 1BSIA 4OTXL 4CVXB 1XGTA 3FB8B 2QADD 3KPQA 1KTDA 3SCMC 1HXMA 1MFUA 2ZOKA 4JFUA 3ARDB 2DLIA 4TRPL 4HWBH 3UG4A 1ZVHA 2CKBB 4DW2H 4HCRH 5D70H 5K33A 5BZWA 4PJCB 4RMTA 1F3JB 4L4PA 1RZKC 3QXDA 4YQXH 3VXSE 2XWEA 2BJML 2EDNA 3JSSA 3LKSA 3LN5B 4M4PA 1G9NC 3QIWC 3WEXB 1J8HE 1JPGA 2Q20A 4K3EL 1TJHL 2XXMB 3I2CL 1KNOB 3QQ3A 1ZLSH 1B6UA 4AW7A 4FMFA 1GOQA 3AGVA 2ZCLL 2R2HA 1BD2B 3IVKA 1H3WM 1ZB5A 4OCSL 3M17B 3R4DA 3WIIH 2YFOA 5CG0A 4NZUH 2BY0A 3T0EB 4Y4FC 2PTTA 1NGXB 3TBYB 4QLJA 1U8IA 5BXRA 4Z7UE 2HVKA 4ZSOB 3ECBA 2C3XA 2O92A 5D6CB 4GBXD 3WBAA 2ESVB 1BZ7B 4LP5A 5C3TA 5JW4M 5I9QB 5DHVB 1OCWH 12E8H 1T7XA 4Z7NF 1U30A 3W11C 3VU2A 4D2NA 4Q74A 1CIUA 1AR1C 4MZ2A 5GGRA 2O9OA 3QUXD 3E3QC 5ESVB 4ETQA 4PGEA 3SDDA 3U79A 2ZCKH 3MLVL 3B6SB 1BZ9B 1BFOA 4OLVH 3DX7B 3SUVA 3D39E 5E6IC 4DWSD 2I27N 5KS9A 3UTQA 7TAAA 2J3SA 3MBED 5E9DB 2VLJE 3VFOB 3BT2L 2WZIA 35C8L 3L4UA 5IKCB 3AY4A 5D93B 1G6RA 2DQJH 4MD5B 2RGSA 2AJ3B 5C07E 5A6SA 2VLRE 4JFWA 3MSPA 4GAYA 4P2CG 3VFPA 3BVUA 1FP5A 2YPLD 5EZLA 1XSJA 3QWOA 3H3PL 3ZO9A 1JWSA 4H2CA 4L5FH 4YWGH 5F1NB 4MD5A 3ARTA 3X3FH 5HDBE 4YPJA 1PG7L 2VX7A 5IMLB 5A3HA 3IDJA 4YDVB 4DO5A 2OJZL 2V6HA 2EO1A 4WY7L 4NOFA 3GRWH 5MENA 4I2XA 3T0XA 4KAQH 5A2AA 3QUZB 4NO2B 4CD5A 4GXPA 5T33L 4Q6IB 4F7EA 4O00A 1FNAA 1HHIB 3ALFA 3MUHL 5CLTA 1G1CA 5LQBH 5JXAH 3QRGH 2Y07L 1C92A 3VX0A 3QI9A 1U8NA 4YO0B 3W5MA 4BQ5A 1J9CT 4OQ1A 1TENA 4HOWA 4X6CF 1A64A 1GOFA 4G6KH 2VN4A 4PR5B 1M7IB 4B53A 1G9NH 4C4KO 3DI2B 3ULUL 1IAIH 4LKCB 4YHZH 5F1IB 3NCYP 1LK2B 3ARED 3EYOB 3OAUH 1AGCB 4V1DB 3X11B 1VADA 1GGUA 2AJYL 3RGVA 3AY4C 2YC1B 1YEGH 2DYPB 1QVOB 4U6VL 1CN4A 3P0YH 1U3YA 2B7DT 4C55A 4WDIA 4XZWA 1EGJA 3VIFA 4IIQB 2OSXA 3MKKA 5HHXH 2VUOA 5GGVL 4FNQA 3DXAB 1MJJB 4UT7L 4I9WE 1JGEB 2OLDA 3INUL 2YKLL 4HIJB 4TUJB 1IC1A 4FZEL 4ZUWA 3RJDA 2E9MA 3M1BA 2XFXB 5E00B 5EO1B 2B2XL 3QHFH 4ALAH 5CD3B 1NGWB 3QQNA 5J12B 1IGCL 4XTRC 4O2EB 3JV6A 4PGEB 2PO6A 4GI8A 1OARH 1QYGH 1MFVA 4NX0A 5EC1A 3MACL 5F7UA 2H9GA 5E9DA 1YJDH 2DSVA 5KSAB 4JDVB 1A0QL 3MLRL 4L3ED 3BVNA 2WW8A 4RBPH 3RWIB 1RIVH 2EXWD 3BDBA 4K71B 1UZ4A 3EHBD 4GKOA 4DW2L 3KPSE 4GRLC 1A7NH 1AMYA 1XR9A 1TA3A 2Z1KA 1EPFA 3TESA 4ZXLA 4NC0B 2O5YL 3QUZC 5IQ9B 4XPTL 5T3ZL 4Q6IC 5E2TL 5EB9A 3ULVL 1LP9A 2IG2L 4QHLB 3L4TA 2FYYB 3WLWD 4AYGA 3HHRB 3GSXA 5HJ3A 4XX1G 1KIQA 5GGTH 1H0GA 1GGIL 4S2SB 2XIBA 3MXWH 4TVUA 4MCZA 3FO0H 2DDQH 4MCYA 2NLJB 2WXDM 1FFNB 4BF7A 2VO5A 3AIBA 3WFHA 4OZGE 2OYPA 4PJHE 3NSXA 4HJJL 4OLWH 2CCRA 1HTYA 2YD8A 4MXQD 3AREA 4GQ9L 2V2TA 3O6FD 5KEZA 2WKGA 5JW4R 2X4TB 3TPUB 1NANH 2A6JB 2NLJA 1TZHA 5C0FB 3U4BL 3SJVD 5BVJA 12E8L 1V03A 1MWAL 4ZFZB 3U4EB 2CHNA 1P7KB 3ZDXF 1WAAE 1VBRA 1S9WB 4P3CH 1T80A 1UKTA 1IM9A 4Z18A 2X4TA 4KRUA 1Z9SA 4S1QL 5CP7A 4YXHH 1FBIH 3FFDA 4ZO7A 3CZEA 4MDPA 1WPCA 4WW1B 4M6NH 4XNZC 2JF6A 3SO3B 2MKWA 3O3DB 5F71A 3O4LE 3BN9D 1LO4H 2JIEA 3UC0L 4ACYA 2DTMH 5GRVL 2Y72A 4DZBA 3CZFA 2IANA 4X4XA 1EV2E 1VEMA 1YEEL 2CK0H 3CD4A 4OM1H 2OK0L 2F1AA 1UXWB 3WFDL 3N18A 1WCGA 3RZCD 1WFUA 2Q6WA 5T5FL 3TZVC 4R4FH 2EICA 5JR1L 3KJ6L 4OOUA 3EGSA 1MUJB 3II1A 2GJ6D 4ODTL 1YPZF 1F13A 3DRQA 3FT2A 3JTSB 1S7RA 3DMMB 4HPGA 1J0YA 3EDJA 2UUDH 1MHHB 3QCVL 2WUCH 1GOMA 2ADIA 4AK1A 5I17A 5EU3B 2R8SL 4P8UA 4ZSOE 1PZ2A 3LMYA 4I9WD 1WGOA 1SEBA 1ZHKB 3IU4L 3P73B 5BZDB 1Y18A 4MTVA 5T5NG 3JWNC 4YZFF 3GMRB 3IDNA 1UWTA 3LKRB 1MHHA 2B5IB 3G6LA 3ZM8A 2DD8H 3HNVH 4L4TB 5C8BB 3JVGC 1XR9B 4RMRA 5SWSD 2FSEB 4A3HA 1Q6GA 1E55A 2QSVA 1CTOA 4G6KL 5DZNA 1OPGH 3L5XH 5JLZB 5L8KB 3AQUA 3MCG1 1XF1A 5J7CC 1AD0A 5HJ3B 3GUTB 4Z77B 4EXKA 3MSDA 4L3EB 3O4LB 3S6TA 3DUHA 1CFNA 1L7IH 2HJFB 3TJEH 5EDXA 5CD5C 1R24B 2Y5TB 4RNRA 5I8KL 4ZS6C 2E8ZA 3GNPA 2RQ8A 1WFNA 3P77B 1HP4A 3WIHA 1Q8MA 1ZT7A 1ZSDA 5D2NB 4Z76B 3MV8A 3BKCH 1JWUB 3L9RB 1H3XA 4OD1H 1FH9A 1I1AA 4KQ3H 3NUKA 2VX6A 4OZHB 1TZHB 4H8WL 5C9KA 4CD8A 4YUEL 2YKLH 3DSFL 4LPCA 1NCCL 3HR5A 2IGFL 3X14A 3DURA 1OSEA 2A3HA 4FF5A 2VDLL 1S9WA 3BZFA 3GDBA 2B1HH 1HNYA 3G5YB 4PV8B 4HFUL 1W3JA 3ARRA 3O81A 4U6HA 4XCFL 4QRPD 4NKIH 5DJAB 4G7VH 3G6JF 1QRNA 5D7IF 4OZIB 3RDTD 4I3GA 4PREA 1KPUB 4O2FA 2BVEA 4URTB 2Z9TA 3MRBB 2F7QA 2YSSB 5FYLL 4U7KA 1HKFA 3QUKB 1X5HA 1S7VA 4MQTB 1RIVL 2MSPA 3WD0A 1QRNB 3QG7L 3RX7A 3U5YA 2R0ZH 2AP2A 1NDGB 4PD4K 4PTUB 1AQMA 4CMMB 4BELD 3BQUC 2A83A 3TT1H 4F9DA 1TFVA 5IW6B 3QR3A 1XF5A 2ZG1A 4FNLH 4N9GB 3I6GA 5EZIL 1V6YA 3DJ9A 3W6LA 4EUPB 1XD1A 3GMPB 3MXWL 1KJMB 1KEML 1LK3H 1E6SM 5L8LB 3GSOB 5FM4A 2OZ4H 3V0VB 1KT2A 4H1LB 4PRAA 4ZOCA 5BZDA 1A6AA 4LSUL 1KGWA 3RTQB 2NY2C 4Z95H 4UOW1 5CJXA 1J9YA 5F88A 1HL8A 4M62H 1GZQA 2N56A 3BC9A 3MTRA 4XPAH 1A1OB 2WHKA 1SHMA 4MSWA 1QPPA 3D39D 4DM2A 2EBNA 4HAGA 3IDMB 2JB6A 3N0PB 1XZ0B 2E27L 4UNUA 5C8JA 3NIYA 3NCYS 5DYOA 2VZSA 2FZ3A 4TNWF 3AS3A 1CGUA 5AUMA 4YFLF 2D23A 3BHBB 4CNIB 3MRQA 3ARBA 2XN2A 1AJ7L 5IGXH 5TDOB 3BKJL 2YUZA 2F54E 2GDVA 4LU5L 1A6TB 1ZWIB 4OI9A 2ZUYA 1LO4L 1E4MM 4JJHA 3FAXA 2FD6L 1R7AA 1GOGA 2V17H 3GMOB 4D6FA 1HWGB 3NH7L 1YEEH 1KN2L 2CK0L 3NFNB 3U2SA 3QNXA 5IK3B 3RPIA 4M93C 1B3VA 3MNVA 3IETB 1KG0A 1CZ1A 1F45A 2ESVD 4L29B 3BSGA 5LG1A 4HP5A 5FA3B 1S7SA 1C12B 3QA3B 4AD3A 2HKHH 1UCTA 3HC3L 4X6DF 4Y16A 4IMKA 5I73C 4HKJA 2J4WL 5IEKA 3PIQB 4EI5B 2Z8VC 3FO2B 3RDTB 4URIA 2QKIA 1CVSC 3MLUH 3C60D 2EH8L 3PL6C 2F8QA 2OSLB 1ZEAL 2NYYD 4M5YL 2CSPA 1NOFA 4S1DC 4XZUA 2OWCA 3BUIA 4XWOD 2KPNA 2DLFL 3KPPB 1T2XA 2UZIL 4QHNA 1T04B 2FEDD 3DX6A 3NIFF 5D93C 2GI7A 5IM7A 5DJZA 5JMRA 1ULVA 2XPKA 4G8EB 4HUMB 3NA4A 1QSFD 2IFFL 5IFHL 5D5ME 5IBTL 4F9PC 4DO4A 5DLMH 4P57A 1HP5A 4QHNB 2PR4H 4WTXA 1MFDL 1V6WA 1BBJB 5DRZB 3O2LA 3RX5A 3FMGL 3MI6A 4JPWH 4OOZA 4XWGH 4HX1B 5GHWH 4NQTA 1DEDA 2ZCHH 2FX9L 1IC7L 4LRNL 4KQ3L 3OKEA 4QNPF 1G7MB 3BEWA 4ENED 1N3NB 2V9RA 1AXTH 2IGFH 4P9MH 4CBPA 2HFEA 1P5VA 4Y4KC 1DUZA 3RVXD 1QLFA 4QP0A 3C6LB 2PF6A 5CMAA 1PKOA 4HLZH 3IGAA 3RL1B 1EHNA 4XVSH 1ZS8B 4CD7A 2XM2A 1XGRA 4MNKA 5C0GA 3TCLB 3WKZA 3BP7B 4S1RH 3WIFA 4V27A 4GQQA 3BRDA 2G3IA 5B38G 5C07B 1G9ML 4JCLA 3AHXA 3GGWB 1XSIA 4AH2A 3K3QA 3RDTC 5FB8B 3OG4B 3GNRA 2RJMA 3CPLB 5DJCA 1U8QB 1ZLUK 4NQXB 4WUUA 1KJVA 2VAJA 3AOFA 1CWVA 2N1KA 3RWJA 4FNLL 4ML4A 1EHXA 3BAYA 4LSPL 1EUUA 2DI8A 1QR1B 1A1NA 1SVZA 4ZXOA 1RUKH 1S5IH 2X1IA 2VZTA 4LPTA 2OXHA 3K8LA 1RJYB 1JNJA 1KEMH 1S7QB 3TPKA 3D0LB 4NN7C 3HS0B 5EU6B 2AV7A 3WQ4A 2IBGA 5KOVC 2EDRA 3NAAH 4BSVA 4LBEA 1V3LA 4HC1L 4JQVA 3DO3A 1S3KL 4Y4KA 1MVYA 2L7UA 1DVFD 1IGYA 3H9SE 2DJSA 1N7ML 3F7QA 2ADFH 3IFNL 1T04A 3CDGB 3BN3B 1YQ2A 3U7AA 5ABGA 2BOBA 3V5HA 3W81A 2E3VA 2A9NH 2I5YL 3RWGB 1FPTH 3FHQA 2LE9A 4MNQA 3PZVA 2F53D 3KDMB 4LSVL 5IW1A 4G8GE 5GQBA 3MBXH 2DQIH 4Z2JA 1BBJA 5I8EB 3F7YB 5F6IB 3D39B 1Q94A 5MEND 3ILQC 2ICWI 4JM2F 2C1OB 1SYSB 4TNVF 4PJEF 4PJDF 2G4FA 3IS1X 3D25A 5ESVA 4ETQB 1BVLA 1TIUA 4KHTL 4D9RE 3PTKA 1DWGM 2YA0A 4FQ1H 2YDSA 1MCKA 3VMOA 1Q94B 1SY6H 5E0FA 1QPXA 2X9XA 3QUML 2HG5A 1KXVA 3AHZA 1MH5B 2WMPA 4GLRH 1T1XB 3VFOA 4ZPTA 3SGJC 1TJGL 2P7TA 4OAWB 3FOLA 3C6LA 1JYVA 1G6RB 4D3CH 1FNSH 1XF3A 4RZCA 4WWKD 4CCEA 1H3PH 4ZE4A 2VZVA 2AABL 2UWEB 3MV7D 4N8VB 2VDOL 4WNQB 3E2HB 3GXFA 5C0GB 3JTTB 4JIEA 4LSRH 4TOQA 4PV9A 4J1UA 1FJ1B 2E0PA 1I1YA 1XGQA 4C56A 3L6FA 2FJFB 3R06A 1WWWX 1PLGH 1T22A 5H35A 4KRTA 3B3IA 5I74C 5HSFA 4WU7B 3EJTA 1OP3H 3DYMA 2RAMA 4PMXA 5JIKA 3GBML 1U3JA 2IAMC 2Q76A 1R7OA 3AHVA 3ECQA 1UR4A 1MHPH 2A3BA 2CK2A 3VIKA 2Y36H 3CPLA 4N5UA 2D9QB 3FT3A 3L6FB 3R06B 5GXBB 2C1PB 2UY6A 3VFTB 4RX4D 2V2XA 3QUZA 4NO2A 3A6CH 3T3ME 2X4SA 2YR3A 3HZMB 3J8F7 3C5ZD 2G41A 2YPLA 5BO1L 3ARGD 4LCUA 3RJXA 1OVZA 4AEIL 4AD4A 1F8TL 2K7PA 2DQUH 1TVBA 4M5ZH 3HI1A 4M8VA 1JZ4A 3IU3A 4GKZA 1CL7H 1JNDA 1G6RL 3BDYH 1JPTH 1Q0XH 3PXJA 4KRPC 4M61A 5DI8B 5HDLA 2IADB 4AEEA 1KXVC 2UVEA 4N9OB 2QL1A 4UZGA 4B9YA 1HHKA 3QUYB 5HHPA 1VADB 3VRIB 1YMMA 1U9KA 3U46B 4XVUC 3TNMB 4OZ4B 3OA5A 5IHRA 3CH9A 4E41B 5GZOD 2WMIA 4POZC 3MA9L 1FZKB 4N1HB 4U6YB 2DB8A 2O9RA 4HWUA 3W9DA 4U3AA 3S4SA 5M17A 1I1FA 5JZ7C 5AZ2H 2EYSA 2IH3A 2FR4B 1I3RA 2XN9D 1A7OL 1AKJB 1UM6H 3S5LB 3UO1H 4ETYA 2R2HB 3TGXA 4V2XA 3N50A 4ZQKB 15C8H 4M29A 3JWDH 3AJ7A 4LNRB 4UIKH 4L4VD 1WSST 3A6OA 1I8KB 5GJSL 3VGGA 5IFAL 1HL9A 3MMEA 4PJCE 1TJHH 3H9SD 3MRPA 4W4OC 5HHOA 1YYMH 1U3HB 5I1LB 4S1RL 4WV1B 5AC5A 2OL3H 1QFWI 3UTTB 4HMCA 1BVLB 4KK5C 4JFOB 1MRFH 4M48H 4OLEA 4KY1H 3A47A 2D22A 4X9GA 4XNZB 4F79A 2BVTA 4KUZL 1CLCA 1QACA 2XFYA 2GUYA 3UMTA 3UTTA 1WCBB 3OL2A 2AS5M 4MYWB 2H2PD 4G8IB 1EFXD 2IQAA 2ZSVB 1I7RA 5FHAH 2YN5A 1B0RB 5DVNA 4JFHE 1U58A 1DDHA 1Z6JT 1A6WH 3ALXA 4EUPH 3AMLA 3QDJD 3TO4C 2GIYA 4M1DL 3ZDXE 3UBXI 1OL0A 2GHWB 5ICYB 2BNUA 2XACC 5A3ID 5D71L 4APQA 2EE2A 3VMPA 1RI8A 2CKBL 2KH2B 5FYJL 4WHYG 3NMEA 3PWJA 35C8H 4QDMA 2YS4A 3ZR6A 3EOTH 1J8HA 3HPJA 1ZBKA 2VABA 3BH8B 3PHAA 1KXTB 1U6AL 4NUGH 4XHJD 3KPRE 4UZUA 4BCEA 2ZICA 2CDFB 2VLKA 4YAQB 2J1KA 4HZLB 3HI1B 4XXDA 5CCKH 4PMDA 3PP3K 5JO5B 3MV9B 4WTWA 4E42A 4XNQB 1KXTA 4PMQA 2VL4A 3VXUE 4EBQL 1T4KA 4MNQE 1IM9B 5F9OL 1NMCC 1T0NB 3F5WA 4KHTH 1B0WA 5DEGB 4FQ1L 1I1CA 1M1SA 5E8PB 3W9EB 5BOZG 2WMIB 1WICA 3H55A 1R0AH 2BY1A 4JGUA 2ZXQA 3WH6A 5A40E 5EZOL 2PWHA 2FX8L 3W9DB 3RVWC 4F9LA 2FDBP 1G7LA 3DROA 3R0NA 9CGTA 5F21B 3V0WL 1LD9A 5I74B 3E0GA 2I26N 2GTWB 2VISA 4JHWH 4U1SB 2XN9B 1O5DT 3WY1A 5ESQA 4W68A 5A16A 2X8RA 5LA0A 1AFVL 4I3RL 4QCFA 5HNNA 1OTTD 4N0YL 4NJAH 5J8OA 4OZIE 3GRWA 4TXEA 5D9NA 1TDQA 2DI9A 1S7UB 3ROOB 3WY2A 4UFMA 3L3JB 4QRRA 1UD4A 4JZNB 3HN3A 1H5BB 4X5LA 2PW2B 3AB0B 3BO8A 4ZG1A 1XGYH 1IAKB 1T5XA 1WCBA 1NAMH 2EKJA 4FFWC 3X13A 4DGIH 3AXIA 2QHRL 3IDNB 1I3VA 2Z35B 4FZEH 4OI8A 4P2RB 5BXTA 1T7ZA 4G5ZL 3RCNA 1C16A 4EJ1C 2ATKA 3ZMRA 3BDYL 3LZFH 4OCLC 3MLWH 4B3LA 4HMEA 3AU1B 1F58L 3VGHA 2C26A 3NZHH 1Q6DA 3BEVB 4NZRL 4LFHD 1HKLL 2ATKB 1H3UA 4PJ5D 4F8TA 4M1GH 4GXUM 4AL8L 1HXMB 3LQAH 1NGYB 1EEUA 2ITDA 1FCGA 5GNZA 4NO0B 5FO9B 2YBRA 3FQUA 1XGZA 2NY6D 3CSPA 2VLLB 5DVLA 3VFSB 1AXIB 4YWGL 5L9DH 4WU5B 4MCYB 1ZE3C 1J0ZA 4RBPK 2X6MA 5FO9A 1RJLB 3VDBA 3A67H 3IAPA 1W9VA 5D7IB 1KJ2A 4I0PC 2CMRH 4QRTB 2JIXB 2Q8XA 4Z0XA 3QPQD 4PMVA 3MGTA 3GSUB 2BFVH 1HSBB 1FFPB 3BW9B 4M48L 2CESA 4RMUA 1Q6CA 4JKMA 5F1SA 1CPUA 5HI3C 1U93A 4PLNC 1RD6A 1GOKA 1TTUA 2YSSA 3H0TB 5L7XH 2XZAH 4JM4L 3PZNA 1XEDA 2BNRB 2ZJSL 1R33A 2F19L 4TVPE 5H2BB 3PWNA 2KBGA 1LWHA 1E56A 3MODL 3WD3A 2FBJH 1X6LA 2R0LL 1I85A 4XP4H 1GJWA 2UWFA 2QPSA 1FAIL 4DCQB 4J23A 4JLRB 4OCYH 1E6XM 1SJXA 5AYIA 2EDYA 1FBIL 3P0YL 4BH7B 2CDEB 4QRUA 5SX5K 4EI5C 1UXWA 3ROOA 4UAOC 4HZAA 4RAHA 5KOMC 2VX5A 3VI4E 2JB5L 1NC2A 2ED7A 4F15C 3B5HA 1RJZB 5BV7C 3MV01 4YHKH 2MNUA 2A38A 3BRFA 5E2VH 2YA2A 4NQCB 4O58L 4QF1A 2CYGA 4JHAH 1N6QL 3WO4B 4MDIA 2CUHA 3VXQA 1BHGA 3FFCE 2HISA 2DQDL 5C6TH 5EO9B 5FUOH 2JB6B 1XV8A 4NSBA 4Y5VA 3QG6A 2JJSC 4PUBL 4IPLA 3D48R 3OIHA 5KSUA 1WTLA 1UWUA 3A0OA 3QULA 1F02I 2YWYA 1T03H 1TQCB 2FX8H 4I0PB 1QWNA 5J4MA 3IDYC 1GC1L 4MQ7B 1C08B 4LCWB 4P4RB 1CXLA 2DQCL 2PN5A 3VG9C 4JHWL 2YEZA 1GPOL 2ZG2A 3O6MH 4ACPA 3OKOA 4JB9H 3MNVB 3WF2A 3GSRB 3SPVB 3F5JA 1UFUA 1DQDH 3FO0L 1BF8A 1I1AB 5FA3A 2QSCL 3R8QA 3DI3B 5TDNB 2MHAB 4OZHA 3VXRB 3TJEL 4PMUA 3I6LD 4Y16B 3HMCA 4AIOA 1CD8A 2C3HA 3HR5B 3X14B 1PKQE 3GZKA 5AZEH 3BSHA 3CC1A 2A6KB 2H2SD 5JORA 4U1JB 3H0TA 4Z7WB 4PY7A 1H15A 3VJ6B 4BM7A 3D18B 4LVHC 1NC4A 2FIKA 1NCUA 3K4DA 4TTDD 3GXNA 5JIPA 2ITCA 5ID0A 5BXSA 1CFVL 3OKLA 3OB0K 2A6KA 3U7BA 1G94A 4Y5VC 3V4VL 2R29H 1QHOA 3L3GB 1X44A 2W0KA 4AM0A 3D18A 1WWBX 4HDIA 4FN0A 4MDJB 2DIBA 5SWQB 4RA0C 3LRHA 1BIHA 3MLWL 1F58H 4ZXBC 1HIZA 1YEKL 3CVIH 3NACH 3QDGA 5GRJH 5ESAB 4YHNA 1TNNA 5ACZA 1M05B 5ALCL 5DFAA 2ENYA 5GNYA 2A83B 1R3HA 4HDIB 4R7NB 4Q9QL 4JY6B 2BVYA 4A2MA 5KSAA 4P5MB 1SMDA 4P2OB 1P9MC 3CVHL 3HZVB 3C60B 3MRGB 4Y1AD 5ECUA 1NMAL 3SO5A 2VC2H 5SWZD 3LRMA 1M05A 4B3KA 4ONHB 5FM8A 4MZ3A 3SDAA 1HH9B 5CBAB 4U1MB 1TA3B 1RV6X 3LRSB 1HEZB 1ISYA 5K9OA 4NDMA 4OD2B 1KT2B 4H1LA 5EZIH 3RTQA 1TPXC 3BLPX 2BMKA 5LYRA 5J11B 1KJ2H 5EOCL 3JV4B 4GXUN 1D5MA 3FY1A 1RFDH 5C0BB 5F1KC 4Z2HA 4G42B 3CZLA 4XC3L 5GGSB 3JXAA 5HPOA 3ZJ6A 3RWHB 4XB8A 1UCBH 1CK0L 5KTEL 4DK3A 5KZCB 2ZNXA 3ZYJA 4HUXB 5I6XB 5IDIA 4OZHF 4P2YA 3VE0B 3F58L 4YH6A 4HV8A 5E2UL 4JQIH 3NCBB 4NXSA 1GVYA 2ZUXA 4AY0A 3O6FA 4WW2B 4NFBA 2CLRA 2WANA 2NX5E 2XZQH 4LLWB 1A3QA 1GHRA 1B4JH 5FOBA 1UWEH 4DEPC 1K4DA 2Z92B 4TUOA 1JI2A 4XAWL 2O93L 3WQ5A 5FECB 3A21A 2LTQC 4WHCA 5SX4I 2XICA 3CFDB 3RU8H 1A5FL 3HI5H 1PX8A 1T7YA 1RJYA 4H25B 3QZWA 1FO0B 5I30H 2JB5H 1TCMA 3TT3H 1WDRA 4WW2F 2LQRA 3TFKC 3CFBA 2UY7A 3SGEH 1ZBWA 2VR4A 5HGAB 3V7AE 5D1XB 2XXCB 1FG2A 4CVZA 1FO0L 2N4IA 1KN2H 4LAJH 4PJ8D 4H1LG 2CDGB 4HFUH 3M07A 4L1HA 1H8OA 1XGUB 2EEDA 1XD0A 3HG1B 3CDGA 1ODZA 1S7TB 3K7UA 2WBWB 2UWEF 1U3ZA 1GGYA 3RA7H 4XZUB 5HBBA 5DR5H 4G9FA 4GRWF 1MRCH 1T6WA 4YDLB 4ZD3H 3CH1B 1U8PA 3I85A 1CQKA 1DE4A 2I07A 5F3BA 1OAUL 2H2SC 4QGYA 4P5MA 3F7YA 1ZEAH 1XCWA 4LSTL 2P47B 4RE2A 5IXEA 1GC1H 3QNZB 2BCKA 3RZCC 4UOJA 4MA7H 1DBKH 1R34A 4JFDE 1XH0A 1Q72H 2FSEA 3CZ8A 5DQDL 3MROB 5HI4C 5A2KH 1UQSB 2X4UB 4JY4B 1XIWB 4HJ0D 1YECH 2DSWA 3MRJA 3GK8H 3CTTA 2XVPA 5MEOA 2A77L 5JHDD 5HTSA 4YXKH 3AAZA 2SEBB 3UJJL 4FZ8L 3ZKMC 2QQLL 3U36B 4LX4A 2ZX6A 1KPRB 4NRYB 4KVNL 4D9LH 2XTJD 3OHXA 4HIHB 4JO4L 5FYLE 3T0EC 2EKSB 3BZ4A 3FZUD 4J8RB 1XGQB 4C56B 1JK8B 2WC4A 4XAKD 5CMAB 4GW4B 4L9LC 3IT8D 1RZGB 2VDRH 4NRYA 1VSCA 2PO6D 1I8MB 1UXSA 5CSZB 4ZOBA 3FT3B 5EBAA 2VZ1A 4HWBA 1BVZA 5K9QG 5FIEA 1QBLL 3TO4A 1NM9A 2BNRD 5C07A 1INQB 5EU4A 1AJ7H 5IGXL 3OXRA 1XH1A 3TA3D 2R69L 1U8QA 1R3IH 2DF3A 4MD0A 3SE4A 1J0HA 3QZWB 2IUZA 5IR1B 3THDA 3FTGB 5I66A 4QXWA 4IRJD 1LJYA 3NCFB 4LLQA 1IGTB 3OB0H 5EOQL 3WDQA 4CVWA 5K9KB 1FNEB 5F72S 3KPRB 3RDKA 1VFOA 1OSZA 5JOFA 5FL1A 4K7PH 5GGRY 1N8ZB 1QG3A 3C5JA 3TNMA 4WF7A 5AYBA 1FN4B 1MJUL 3WO3B 4HU0A 2IH1A 2J4WH 5FGBC 3ZJ8A 4NKDB 1KXQE 5JBEA 1HJXA 3RZCB 1JV5A 4BQ9A 3FB5A 1WAAF 3D50A 2CIKB 1GQKA 4PTVA 4HKZA 3V6BR 2AEIT 3KLSA 3TONA 2HVKB 1KJMA 1FN4A 4MJ2A 3ZSSA 4GQRA 3KLHC 1BZ7A 1I8KA 3WUZA 3TEUA 4NQSB 1GJUA 2X89D 1IARB 3G6MA 3MLZH 5TF0A 4AZCA 4WTZA 1S9XB 5T3XH 4L4VA 1H11A 1ZAGA 1P84J 4JY5L 1N59A 1N7MH 2WK2A 4JG1H 3WF1A 1FRGH 3FRPA 1IL1B 1WWAX 4YGAB 2DICA 4ERSL 3RWFB 2BSRA 1CDGA 5E8NA 5AG8A 3KWWB 3A4AA 3EBAA 1YMMD 1ZHBA 2LU7A 3E6HB 4NBZB 4X4YB 4PEEA 3SKJL 2BXZA 4RAUA 4XZBA 4XWGL 1B0RA 4HEPG 2EH7L 3K74B 3HI5L 4I8DA 4KJYA 4GG6B 4NRSA 1QBBA 4NN7B 3AMDA 2GSIB 1BGXH 3RPMA 1NCTA 1BIIB 3VXRE 2FYVA 1IFHL 4HWBL 2VIRA 3ARGA 4YDVA 3ULSA 4PTMA 4JHBA 2OMBA 2AV1A 2W9LA 3VWKC 3RO8A 1H0DA 3RPIB 4HK0B 5E9DE 4R4ND 4BQ8A 4YQXL 5DMJB 1JRHH 4P7LA 3L3KB 4RGND 3KPMA 1TJGH 1D6VL 2J8HA 3AB0C 1OM3H 2HLAA 1RULL 3QA3A 2AJSL 3OX8B 1GHSA 1HXJA 3CUGA 1WCQA 5JDJA 3GIZL 1RK0A 4D1JA 5CHNB 1NBVH 3D85D 2AW2A 4LLDB 4PTXA 3QFJD 3CXHJ 3S5LG 1J1PH 4OUUB 1MRCL 5FFLA 3NPSC 3VFNB 4PUEA 5F7KC 3CXDL 1TQSA 5H37G 3VFTA 5JXED 5GRZA 2DQTH 1L7TH 3A22A 3HA0A 3U0PA 2UYLB 5CHNA 4ZNEE 3GB7B 4Z8FH 4PJDA 4PJEA 1DBKL 2P8LB 3WS3A 4MJIE 1UYWH 2X4OB 3FQRB 2Q3AA 5IHSA 4FG6C 4IOIA 4GO6B 4L4JA 1L6XA 4UQ9A 3LOWA 2Z31C 3EO0B 3EYVA 3MOAL 3H42L 3DYPA 2ORBH 4PG9B 1BBDH 4OT1L 1UZ8A 5A1AA 3MUJA 4X5XB 4IRJA 1YMMB 1E4JA 4AEIH 4HBQA 4KI5D 4ZO6A 5C09D 4PJGB 4Q0XH 5ILTH 4D9LL 3LX9A 3EJYC 3VWKA 1MCIA 3W2DH 2BVPA 1AQ0A 2NY1D 2RCSH 3F12B 4P2QE 5JA8B 2ZXDA 1E0WA 5GRXG 2E8YA 4XB3A 3D87B 2CRIA 1UEMA 2HTKC 2AJXH 1CZ8L 1AQKL 5EMYA 3L5WB 4HW6A 4LHUB 3E6FA 3U5UA 1WFTA 5GSVB 2BSRB 3W39B 4N8VG 1XF4B 3Q5OA 1A7QL 3DX8A 3IB4A 3VWJD 5E2WH 1UR2A 4L5FL 4W6XB 1J05A 4HS8H 2YJQA 1UWQA 2W63A 3BP5A 3RL1A 5L0QC 1MCQA 5TE6H 3QP3A 2YRZA 1JZ6A 3RWCB 4AYFA 3PGCB 1B4RA 3QEUA 4CN4A 1QSZA 3QEQE 5DVOA 1GH7A 3ARZA 4WRLA 3VFMA 1P53A 4KY1L 4QWWD 3RWCA 3NPSB 3QIWD 3VFPB 2ZUQC 1NUFA 3LN9A 5JHLL 3AC0A 1J1XH 4X98A 4DOHE 1KCVH 1SMOA 3QRGL 5F7WC 1BQSA 3CFCL 5IHUL 3HFMH 3TO4D 3W0KA 1MJUH 2GSGB 1T66D 2J8GA 2V2WA 1FNSL 3VI4F 4WUUD 4XC1L 4PG2C 4BZYA 1OW0C 4ODSL 2VDKH 1A1NB 1ITCA 1FE8L 3ZYOA 1TVHB 1QFOA 3DVNA 1HOCA 3TZVA 3QCTL 3V9FA 5JPMB 4XCYB 5SWSA 2J7GA 4M7LT 2JIXD 3ZT6A 5C0RL 1ZGLB 2AAVA 2ICEB 4NO5B 4WVRA 2ED8A 3M6DA 5A94A 2OR7A 1MHPL 1ISXA 3ZDYE 3AIEA 3BLBA 1RJLA 4JCMA 3RIAK 3WMBA 3K1DA 4JKPL 1NWSA 2IJ0C 1T83A 1ZTXL 3OKMB 1HQ4A 2V5MA 5JPMA 4YAQA 1U8NB 4YO0A 5HHVH 4HZLA 5GGVH 3L2LA 5JO5A 3HE6D 1BEYL 4MHHI 1SBBA 4DUWA 1A3LH 3CO4A 3VILA 3U0TA 3WFEL 4G3YL 1JXJA 2M26A 4ESKA 3V7AG 4KDTC 4PG9A 3GSVA 3A4XA 4DUXA 3N12A 1NWTA 5HGGS 1X1NA 4N0UA 5TPWL 4PBWD 5JHDB 1JPTL 1Q0XL 2OI9B 3ZZ1A 4TSAH 2IANB 4X4XB 1U8HA 2XQYG 4WDIB 3BKMH 3EJRA 4PRNB 2ZWZA 4JFYB 4FQCL 4JO3H 2UZXB 3UTTE 1YC7A 3VNZA 5AWNL 4XBPA 2G60H 1U8JA 1D5BA 3NYDA 4XH2B 2FHBA 4QRUB 4NQCD 4YHOL 2XFXA 4YHYB 4KRNA 5C0AD 3V5KB 4YC2C 1FVDB 1PZ3A 1NP2A 3PGFH 5KN5B 1NGWA 3RVUC 3CFJB 2DLHA 1C8YA 4JHOA 1KTCA 3IDXL 1MFEH 1ZHLA 2VITA 4D8PB 4P2QA 1KTBA 1UWGL 3T77B 1VFUA 2R56H 4GH7B 4JZNA 3P9LA 4I48B 3CGTA 5D5MF 4MD4A 1LO3L 4IHOA 4QCIB 4XMKL 4XNXH 3P4OA 5KZ6A 4QRRD 1IAKA 5JLZA 4I3RH 4HK3J 2ZG3A 5DUPL 4ZTPH 1ZT1A 4EDXB 4Z8FL 3DX2A 4KDTA 4J4PD 2YPKB 1X5FA 1NLDH 1KTLB 4X8JA 2WPGA 2CUMA 1H3VA 1UYWL 3QG6B 4NN5B 2VXTL 3CK0L 1CFTB 1K8IA 3LPWA 3IFPB 3PZMA 3TH3T 2Q8BL 3LEXB 5GZND 4CMHB 5CPTA 3MOAH 3IXAB 4NM4H 1WDPA 3KPSD 3OJMB 3S98A 5A8NA 3LXBA 1OD9A 1CE6A 4MJ5A 4BQ2A 4MHHG 1BFSA 4QLRA 4CUCA 2P1YA 2QJDA 4G5ZH 4YXHL 5IMKB 1E3XA 2YEZB 2ZPKH 5JNYA 2AEQH 3OKOB 1RPKA 2VRJA 3MV9D 3MV11 3L3OB 1JGUH 1FZMA 5HHPB 3MFFA 2F5BL 1SEQL 4ZS7H 2Y06L 4Q2ZB 4Y8AA 4DFHA 3EOTL 3WNPA 1UJ3A 4F7TA 5CQ1A 4U0RC 2MJWA 1TCRA 1FIGH 4D9RD 1PZ5A 1U6AH 4NUGL 2AXFA 2E5EA 3IDIB 4QOKB 3MRBA 2D3LA 4KTDL 1C91A 1NBYA 2JIXA 1ZLUH 3O8XC 4WFFD 2F8OA 4UT9H 3TN0C 4X0VA 3QDMD 4TVPH 2GCYB 2X1QA 4NQDB 5AAMA 1M7XA 4GAJH 5DK2A 4TUFA 2ICWB 3PL6D 3OGVA 2E6QA 1INEL 2VAAA 3R1GH 3WQVA 5L2JA 3MNWA 1UR8A 3EOBA 1CLZL 5BRZB 1HIMH 3ZTNL 3VXMD 3WCYA 1AXSA 5T3XD 4LXFA 4IRSA 4QTIH 3T0ED 4XBPB 3Q2CA 1XF2A 3V95A 3U9PH 2CQVA 3BGMA 4U1LA 4ZTOL 3C8KB 4MNMA 4L3EE 4NNXB 5HVWA 2DKUA 5GRYA 4GXVH 4WSKA 3NDZA 1T0MA 1DWIM 2W62A 4G8GB 4P2OA 4XC1H 3MANA 1I7ZB 2F19H 4KKAD 3U4AA 2VDKL 5D1ZB 3I3DA 4JGJA 4WFGE 1WZAA 4YGVB 2FBJL 3UTTD 1WWCA 3VD4A 4Z2KA 3HU7A 4XVTL 2WWDA 3FT4B 1EAJA 3WEOA 4M7JH 4N0YH 4NJAL 2J74A 4UB0H 1YNKH 2IPTH 1EEYA 1WO2A 3HE7C 5D1ZA 3C5SB 4R8WL 2C7UA 3OSKA 3UEQA 4BFIB 1HKIA 1T1ZB 4W8AA 1WJ3A 5ICYA 1KQZA 1T1YA 2NSXA 3RAJL 3W28A 5KVFH 4YXLH 3MRLB 5DRXB 2HKFL 2OW6A 3G6AB 4KMQA 2G3MA 3TJHD 2OI9C 2EDFA 1Z9OA 5CIPB 2VL5A 4G3YH 5EO9A 5GS0L 4G80A 3EYSH 1W0WB 3EJUA 3NCOA 3VXRD 2VSDA 1DWFM 2V7NA 4OCXL 5KSBF 4IDLA 4F2MB 4PSPA 3RIFF 3OZPA 3G6JE 3U2SB 4N1EA 3ZTJH 1QNZH 2DQHL 1X7QA 5FOBB 4P8WA 4PUBH 4LLUA 4LASH 5D70L 1DLFH 2MWCA 3BISA 1T03L 2W60A 1FH5L 4PY8J 2X4NB 2ARWA 1FL6B 5DC9B 3K4ZA 3Q3GB 4L9LB 1L8NA 1U92B 3HUJF 3UZEA 4W81A 3ZE1E 4U1SA 3VFGH 3A67L 4OFVA 1ZLVH 1GPOH 5CEZD 1VBUA 4GRWB 3TTSA 4AMWA 4CDHA 1NMBL 1S7VB 4CD6A 3Q3GA 1NC4B 2JALA 4JANB 3EYFB 3SQBA 4FNUA 4WK9A 5IB1B 1CXHA 5HI5D 4IRSB 4OSUH 1L0YA 4PP2B 1VGKA 4AENB 2WSPA 2Z93A 2ERJB 1E28B 3I02A 3EYQD 4X6BA 1CU4H 3BAKA 2LV4A 3TBWB 5ADPL 3D2UD 1IT9H 2ZJSH 1ZA6A 3IDGA 1NCAL 2XOTA 3BMWA 3MRFA 1EZVX 2DL2A 1BMGA 3N9GH 1E5JA 3KS0J 1R5IA 3PABB 4U31A 4ZFOB 1X9QA 5GISH 4UIMA 2GAZB 2PWEA 2PW1B 3V4VH 4C57C 1RURH 3BKYH 5DEFA 5MHSD 4OCYL 1N2RA 3G08B 3TWCL 2X40A 1JRHI 2PYEB 3C9NA 5FO7B 5M94B 4TTGA 4HFWA 1ONQB 1YEKH 3BUTA 3CVIL 3QXTA 4RL3A 2W38A 1CBGA 4U33A 1T7VA 4XAKE 4R7DA 3VXUD 2Y06H 5I1AA 3LB6D 2DQJL 4LNVA 3QAZB 3EDKA 2FD6H 1E6RA 2EYRB 4N68A 2YD1A 1NGYA 2VC2L 3OJDA 2BMKB 3OHXB 4HIHA 4OLZL 2YBRB 4KXZH 1B88A 1K8DB 1W0WA 3ZHKA 1FYTA 1WC7A 1CGWA 4YZFE 4TVPL 3PWUA 3D6GA 3K4AA 1AH1A 3MJ7B 4P3WA 4PGBA 5INDA 1MCPL 4X7SH 5E6IA 3W6MA 1ORSB 5ABHA 5DJCB 5T1KD 1NCBH 5F93C 2HJLB 2XKNB 2FDMA 2QHLA 5IV2B 3VRLE 1P5UA 2X44D 5F7HA 2X4RA 3DNKA 4F8QA 4PGBB 2RB8A 3O6AA 3WE6A 2F8VA 4ZXBD 3L4WA 5HYIA 4ZTOH 1B3JA 1CLOL 4IJ3B 5DGRA 4Z7WF 2X2JA 4GG6E 4JFVA 3TTQA 5ABFA 3OR7B 3ULUE 3ZIZA 5FCZA 3MGOB 5HVGB 4DAGH 4G43A 1CGYA 5F7NC 1Y6KR 3W38A 4LLQB 4X9BA 1WBYB 3G04B 4KK6C 5EUKB 1O7DC 3KYOA 1AE6H 5IFHH 5GSRA 1NGQH 3LKSB 3EMQA 1W9PA 1HHHB 3VUPA 1XSKA 3SBWA 3CFBB 4M7JL 2YXMA 1IAII 2VDPL 4MA1C 3RI5K 2OR9H 2IPTL 1DZBA 3HLAB 3AZSA 1CVRA 3I3BA 3NIGE 4XGZB 1GW1A 2BNQE 3MNZB 4OBSA 4FXGA 4RRPA 1FHLA 1XGUA 4HZ6A 2BOCB 2JJSA 3TIEB 5B39B 5CXPA 2RBLA 4W88A 4GMSL 1ZA6B 3GJFB 5DF0A 4FQJL 4PJ5E 4LYPA 3D39A 4FXGB 4OZFG 4P57B 3DPBA 4LGRB 1YMME 3PE9A 5FV2A 3RPKA 1H5VA 1KN4L 1HZHL 4Y2DA 5LAXB 4OCXH 4A3YA 2IPUG 4XMPH 2H6PA 3EFDH 3AICA 3RA7L 1GC1C 4HJGB 3CUPA 3SCQA 3DVGB 4JG0L 4Y5YA 3SDYH 5DT1L 1MH5A 1QI4A 3VCLB 5FD0A 1EOMA 1UENA 2O61A 3W25A 4ATLA 1BQCA 4BA8A 1G7MA 3BEWB 1NMAH 2LTQB 4AG4H 1QNPA 1E4XH 1D5ZB 5HHOE 1QEWA 5E94B 4LSTH 5DO8A 2X0YA 1AO7E 5FV1L 3BUDA 4TPRH 3ZL4L 4Q9CA 4QHMA 5DFVC 5GGUA 2K3TA 3CX5J 5GS1A 5IKCA 4JFZL 3D5HA 3HNSH 1E72M 3DXAE 1E71M 4XPTH 3GJEA 2YBUA 2EXWC 1J87A 1I3GH 2W0LA 1D5ZA 1WVZA 1KPRA 1ZS8A 1C5CH 4KZDH 2XJ7A 4G6JH 3GSNB 5GGTA 3PBGA 2ARJB 1S5IL 2C4XA 5E6IB 3FN0H 1UD6A 4JO2L 3SEPA 1SJHB 3L7FB 1JYWA 1GRWA 1W2KT 2HLAB 5IMLA 3N1FC 1CK0H 5C6WH 1JTOA 2XVKA 1NJ9A 3MUIA 4RAVB 2FX7H 4CAGA 1S3KH 5FB8A 4GRLA 1CU4L 4UZSA 1GAFL 5FDWB 2RGMA 1SJHA 1NCAH 3F58H 5IMMB 5DUBA 4ZAKB 1S9VA 2BC4A 2XI9A 3ZKNC 3G5XB 2BSSB 2AQ3A 1ZLVK 3GB7A 4QRPE 4JM2B 5HPMA 3LEVH 5HHQA 1TQVA 3TM6A 5FDWA 1HN1A 2EPOA 1QSFA 4LLMB 1JYXA 1QQDA 1UWEL 2M2DA 3PNWB 5A8QA 1B30A 1W72H 5EO0B 5CZVL 4CU8A 1LE9A 4H26B 4A6YB 2QTEA 1FYHB 3RY4A 4S11A 4PYGA 1NSNL 1VEOA 1QI0A 1F3JA 1EFXB 1MIMH 1L0PA 4BQ4A 1I9EA 3AREC 2K1MA 4EKJA 2KQMA 1ADQL 3UDWA 1ODUA 3OV6A 2E9JA 1OLZA 3APGA 4H04A 1FCCA 4LKXB 4Y8DC 3TBVB 4C54A 4U4BA 2AJVL 1ORQB 1A4KB 3OBAA 4K7PL 3RVUD 3SY0A 1GZPB 5HDOA 4GBXA 4Q58C 1JZ7A 1MCWW 2TAAA 1F4WH 4CADA 5I8EA 5J1TC 1JD7A 5ANMB 2BSTA 3OG6B 4LKXA 1MCPH 4X7SL 4P46C 5IVXF 1A7PH 1UACL 1CR9L 1J7VR 2YK1H 3SKNB 4AZCB 2J8UB 2BHYA 1CGVA 2AAAA 2XT1B 3UTSD 3I9GH 1ZLWH 3SE8H 3QT2A 3BP5B 5KSAD 3F65A 1S5HA 2WWMD 3G6DL 4MA8L 1QNQA 3GNMH 1G5AA 2IEPA 5CGTA 5A2FA 4C56D 4D6CA 4WKFA 2XM1A 1A6VH 5E8NB 3QDGD 1HYSC 1E4KA 5TQ2H 5T3XL 3TH4T 4PJFB 1G0DA 4U0QB 3E6HA 4O4YH 4X4YA 3B6SA 2Y6SC 2ATPA 3TYFA 4JVWA 1QA9A 5DZLA 5IBUG 2WBKA 3GSNH 5CJQH 43C9A 3SN6N 2X9WA 5C0IB 2NTSP 1ROWA 4MAYC 1I1YB 4XNYH 4FLOA 3UDWC 1XIWD 3P40A 4Z7VF 3RVWD 3GSXB 3B4NA 3REVA 3LS4H 4PJHB 1F4HA 4RAVA 1SMAA 1JZ8A 1H0DB 4GRLB 2HH0L 2HLFD 3T1WA 1VHPA 3KXFE 2DMKA 2V2XB 1H3GA 4L8CB 1ZS2A 4W93A 3O11B 5D1XA 4RFNC 4PPTA 4IM4A 3WDJA 4EXPX 4J3WA 1TVDA 1T4KB 4PJ9C 2EDKA 3U6RA 1HQ4B 1I9RH 4NNYB 1JZ2A 1JRHL 2FL5A 1OD7A 2A3EA 1VFAA 4U2YA 2W9EH 5IFJA 4PTWA 1HJVA 3BAWA 5GJTH 4ZDHB 5DJ0A 4GS7C 1OM3L 2UYLA 4XMPL 1HKMA 1W2VA 1WBXA 1YJDC 5IBUB 3VVGA 4NT6B 3K2MC 1MHEB 4R0LC 3EJJX 2X4OA 4RCAA 5IFJB 5TDPB 1AGBB 1X5LA 1PYWB 4OZGF 3PHOA 3VXMA 4ODWB 2PYEE 3BPCB 1J18A 4HIXL 4M1CC 3WIHH 4OCWH 3T0EA 5TFSH 1OGTA 4KU1A 2F7PA 2G5RA 1QSFE 4PLKD 1AKJA 5IFPA 1XYZA 4LEXL 1KWKA 1R3LA 3ZDZF 1EXPA 1UVQB 3RWDB 4P4KC 3RX8A 3LKQA 4PB0H 1RZKH 2QR0A 5KS9F 1IRAY 4OGXL 5HD8C 2EPNA 3IAGC 5D7KD 5D9SB 5E08L 5DHYB 3IJSB 5KN5A 4ZAKC 2WINA 1EQPA 5B8CC 4JFOA 3X13B 2EDJA 1BZ9A 4HWEL 3MO4A 3EUUA 4IDJL 4H1LH 4N90E 5CD3A 4L8BA 2XWJA 1J12A 1MCNA 1LE5A 4PJFA 2ZOLA 3PP4H 4PRPA 5ABEA 5HBFA 2APWA 5IROC 4DVBA 2ADGB 4NO0D 2R1XB 1UWXH 1DVFB 3HC0B 4I3SH 1QLEH 4L4TA 5AD0A 4GAYB 2EC8A 1IC5H 1OF2A 4UT6H 2ZOLB 5F96H 4W7VA 4OGAD 1C90A 4IPNB 4QYOA 4YJZL 2X5PA 4JREC 3WFCH 4PJGF 4WI2A 4I18A 4F7PA 3BX7C 3QRFM 4RE4A 4KK5D 4IS6A 5JXEC 1I85C 3W26A 3F7PC 3WJJC 2GSGA 4Z2IA 4P2RD 4NC1C 1KYOJ 4J7RA 1LP9B 5J13C 5CEYB 1J1OL 3HE7B 5E6ID 3O11A 5E4EB 4EKXA 2NR6C 3O6KL 2VKWA 1JUFA 1DSFH 2NY0B 4PJIE 4ZYKA 4UTAL 5JOFB 3DETD 3HB3D 3CFCH 5D7KE 1D6VH 1INDH 2HKHL 5CSGA 4JFPA 1NBVL 3TC9A 2IH1B 4AQ1B 1RJCA 2JTDA 3IDIA 5GRUL 4LHUG 5GZOC 2BHZA 3EDDA 4XNMB 3MLUL 3PZGA 3B9VA 4U6HB 4NWTH 43CAB 5TDPA 1L7TL 3HG1D 4G6ML 5BVJB 2J88L 3F5WB 4YR6B 3U4EA 3PHQA 3G6DH 2J7BA 4FLQA 3GNML 4F37F 1RUQL 4NQSA 4ZFFB 1N4XL 4LIQL 1AP2A 2DLFH 5L2JB 1GPFA 1LQ0A 1TQCC 4HPYL 2J75A 1G7LB 1RZJC 1K85A 1BLIA 2J8FA 4QWWC 5B8CB 3IS0X 2ESVA 3D85B 1MREL 1KUMA 1NAML 4DGIL 3WL9A 3OF6D 2B0SL 1UWXK 3RP1A 5IBTH 2ZZUT 4O02L 4CMMA 5ESQB 1YEIH 1Q9OA 1PW3A 4K8RD 4FQLH 1AGEA 5LVEA 5FGCE 1NGZA 4S0SD 2IC2A 5DMKB 4EVNB 4UMGA 1HE7A 3MRNB 2KL6A 3LS4L 1K5NB 2C5DC 3W2DL 1MCRA 2IAMD 4RIRA 1VFFA 4HIEB 2XGBA 4K3DL 1HKLH 2AK4A 5CGYD 3KR3L 3TNNB 4PJBA 3ZSTA 2XVGA 2VMFA 3BVNB 4LVHB 2CNCA 1IEBA 5I73B 4L8DB 1BOYA 3L3DB 3MREA 4YHOH 3ME0A 4DOHB 5E09A 1XCQB 4OF7A 2A73B 3T2PA 1YUHB 3UBXA 2W9EL 1GJIA 5MI0B 5EUOA 2JEQA 1NQBA 3PL6B 5HGHA 1EGZA 1QOKA 3H53A 4JO1H 5T1DL 1SYVA 3LKPA 3OX8A 5TE6L 2VL5B 4KI5C 4BUGA 3AU1A 4QHLA 1CFSA 2CBVA 5F7EL 4NRZB 4FQ2L 1M04A 5F97E 4OUUA 3NFPA 3WYRA 1J0KA 3C87A 1KC5L 3SGKC 3BZEB 3HUJE 1OAKH 3MX0A 2YUVA 1P4BH 3MRQB 1G9MH 4ZUSA 3ARFB 3HG3A 4M6AA 2XPGA 4PLJC 3FQUB 2Y9RT 5L7XL 1RMFL 2WQRA 3UPRA 2VXTH 2P44B 1YY9D 4XPFH 5KSAC 2UV3A 4DTGL 3IFLL 3N1MC 1N82A 2GT9A 4LPYA 1ZVSB 1ZT7B 5IK3A 4PYHA 1B0GA 5LA2A 5HGBA 2NQCA 2R0LH 4XP4L 3UPRB 1JWUA 3L9RA 1Z3GH 5EBMB 3H7BB 5D8JL 2YD7A 4UNIA 5DJ6A 1DVFC 3QH3A 4KJPD 1OIMA 2QF8A 1E4WH 3FO2A 3RDTA 1I8LC 4PYSA 1T3FB 1JNHA 3VWKD 5F3HA 2F5BH 4N0CC 1BOGA 4ZS7L 3FB7A 2NXZB 5C09A 1UB5A 3LEYL 5IT2L 4RGOH 1PAMA 3Q48A 1U8MA 4LF3A 4DKAA 2VAAB 2WBJD 1UT9A 1KPUA 4O2FB 2XSAA 2Z93B 4AIZA 5BRZA 4RSVA 3BXWA 3Q1SH 4A6YH 1QSVA 3AXLA 4NJ9H 1AD9B 4JHAL 1IQWH 1NGZB 5FYKU 4F7MB 4H20H 2G9HB 1CE1L 5CUSL 3M7SA 1IAIM 3MRNA 3W82A 1NBZB 3S37H 4Y19B 2V3EA 3BUPA 3PGCA 3S5ZA 4Z7UB 1P2CB 4HH9A 3I6GB 1FNGB 3UG3A 4RRPG 4YE4H 4NQDE 4DO6A 4OD2A 4RDQG 4EUPA 1CICB 3PDOB 2ZXAA 3GMPA 1GONA 1V5JA 4BQCA 5DD1H 4LP4A 3PGFL 4JZJC 2GJ6E 2AXJA 2R4RH 1MQPA 4GXVL 5E5MB 4Z7UF 4OJFL 4KZEH 2XZCL 3IDXH 2FYYA 3HR6A 5F8QC 1DN0B 3LHPL 4X0KB 1KCKA 3KYMA 1IV8A 3SQOH 3PZOA 3M45A 2YL5A 2PWGA 4HQQH 2C7FA 3UBXG 4AZIA 1MFNA 1PLGL 2AK4E 3V4PH 2ZX7A 4OCSH 2J88H 2VRKA 4HV8B 2HRPL 3FQXB 1A7RL 4F58H 3JUGA 2DYPD 5CEZH 1RUQH 1YPZA 4N8CL 5F9JB 1E0VA 2IXVA 3MLXL 1DUYB 1G0YR 2B8OT 2H8PB 3VXOB 4M7ZC 2R4SH 5KVFL 3CZJA 3BGFB 2YMXL 3S34H 5GPRA 2YWZA 4UU9B 2EDXA 1Q1JH 1CFQA 3WKMH 1QFHA 4I4WB 4YHEA 4FQLL 1EVTC 3P0GB 2DQUL 4M5ZL 2VDQH 2JJVA 4KROD 1AGDA 3MSGA 1Q9KA 4NNPL 1OAQL 5K59F 4JZOB 3IETA 4PRDA 2CRYA 3CSGA 3QWQB 4ELMB 3ETBF 4PRNA 1S46A 1FC2D 4K2UH 5C2UB 2DQHH 3T3PF 2NW2B 3NFSH 2DLEA 5I0ZA 3GI8L 5BXPA 4BFBD 4M80A 1FIGL 2AEPL 1IGIH 5I1GH 4PUDA 4J3SA 2DBLH 3JVGA 1U95B 4U1GC 3TBSB 4AM0B 5B39A 5I18H 1KB5H 1E73M 15C8L 2EE6A 3T65A 4ELMF 3X3FL 4LGXA 4QRQA 2LABA 3OPZH 3ZJ7A 3V8OA 2MQ3A 1A6PA 4FQPA 5IFAH 1Q4NX 2IPKB 1PGRB 3DGGB 3IAQA 3WD5L 2VT0A 3WL0A 4F66A 5EU6D 1ZT4A 1SJEA 2IF7A 1H8SA 4Z7UA 5EUOE 1I8IA 1OAKL 1JGDB 4PRIA 4PP1C 1K4CB 3ET9F 2Q8AH 2N7AA 1A6AB 2Z91A 3HAEB 1F6AB 3GSQB 4M7LL 4RFOL 2GK0B 5LGHL 1MAJA 5CSBA 4MLSA 4XPFL 4NZFA 4OZHE 1PX3A 1E6PA 1WAWA 3MJ8A 2QSQA 4R5EA 2NTFA 4J12A 3WLBA 1ONQA 3QIBC 5I75C 3OKNA 4QFUA 5GGUB 4J8RA 5GS1B 5BV7L 8A3HA 4U6VH 1KGUA 2R2EA 4ZFGL 5FXCH 3AS2A 3QCUH 2MPAL 3D9AH 3CDCA 3RFZC 1Q9LB 5IP4A 5CSZA 5D71H 2J8UE 1E15A 1CYGA 4U05A 4GW5B 4XCEA 2H32B 5D1QB 4JEGB 4P0DA 3QJHB 3PWUB 3WN6A 1RHFA 4PTTB 4X99B 4UILL 4G6FD 3KE0A 3AHTA 4Y4HD 5CKAA 4JPVL 2P8MA 4BKLA 3T4AA 3MRMA 4PV8A 3FXYA 4J6RL 4ZUVB 4L29A 1MVUA 1KB9J 3PWPE 4O51B 4TUOB 2GCYA 4AH2B 2I24N 5FECA 3BJ91 1HX0A 3WEMA 3GMLB 1A9BB 2FRGP 2OTUB 3W29A 4DN3H 2NNAA 3CFDA 5F9OH 4KROB 1N5YL 1JGIA 4Q22A 3ZJKA 5FM5O 1F4YH 2GITA 1MVUB 3MLRH 1OAUH 4KK8C 2XGIA 2G2RA 4LASL 2OJEA 1QTYT 4JRYB 3OKDA 1R0AL 2ALWA 2HA1A 4LLYB 5D7JC 3GIVA 1PX4A 1CLOH 3BGMB 4U1LB 5GNXA 1OWWA 3TBSA 3NCCB 4M6OH 3HG1A 4YFEA 5EU6A 2J77A 3KXFB 4P23C 5EN2B 3BXNB 4JQXA 4WKHA 5C0AB 3FRUA 2D0HA 4OLYH 1BG9A 4UV4L 3D3VB 4LCWD 2EEBA 1LQSR 1YY9C 3S36H 3UTSE 4D6DA 5LGJB 3DUSB 5EIVA 2NT0A 1AFVH 1DBBH 5DVMA 5FYJU 1LNUB 2QQLH 3V5HB 5DHVA 1R5VB 5E24E 2P48B 3MRPB 2VKXA 4RMQA 4R2GB 4HIIB 4L9DA 1OT2A 1QLRA 4F9LC 2E9IA 5I1LA 5LGJA 1PD6A 1YNLH 4I5BB 5DRXA 3A5VA 4NHCL 3SUUA 1ZHBB 3NPZB 2IMMA 1N3NA 2GK1B 3QDMB 1R3JB 2ZKHH 5K93A 4HIIA 1YEJH 1V7NL 2J7HA 4CCCA 1YY8A 4ORZC 5DYOB 1GVIA 4OLXL 1XRVA 1FGNL 3QIUD 2FZ3B 1ADQA 3U36A 1QBLH 4M8UA 3KPLB 4M43H 1R3JA 5TE7L 3S97C 2XN9E 3RI5F 3NJ3A 4WFHE 4JPIA 2BXYA 2JK5B 2NX5D 3F7RA 3LSOB 6CGTA 3GXTA 3O2DA 4NZRH 3QJFB 4R96B 2F2HA 1R5WA 3VD9A 3KPRD 5CGYC 4DWSA 4PCTA 4NYLA 5EULV 4OKDA 4CD4A 1X7QB 4LHQB 5EWIL 4WGVB 4GO8A 1PG7X 4O2CA 4QLKA 1E6OL 5EOQH 2OK0H 2DBLL 1VGEH 4LLDA 3NFNA 4PJHA 2OXGA 4XI5D 5I1DB 4BZ1L 5T5FH 4PRBA 5SV4A 2WW5A 4WUUB 5EPMB 4FTVB 5IWLA 4PGCA 1PG7W 3GSWA 4O51A 5DA4A 5LKNA 2E4TA 4JFXB 1U8LB 3THCA 4LARH 2NNAB 5DHXB 2Y5EA 1VJZA 2ADJB 1MCLA 4AMKH 3PDDA 4X9FA 4P23B 2YLLA 4Y1AA 4EDWH 5KANI 1BZQK 4PGCB 3WJJA 4KKAC 3G5XA 3DTXA 4PP2A 3EDEA 4H8UA 1E6JH 1BQHG 1AGCA 2DKMA 2R0KL 5I75B 1GAFH 1K3ZA 2EIZA 1SJVA 1US2A 1F97A 5EZJA 4YDIL 2OR8A 4GKZB 2DYPA 3SDCD 1V7ML 1KCLA 4AD5A 4PJGA 5EORH 3MLYL 1CLVA 3WENA 1U8KA 1PPIA 4HPHA 1CEOA 3VH8B 3MODH 4NBXB 1IQDA 2CHOA 1NGQL 3EO9L 1T89A 3DROB 2OS7A 2BK8A 4HKZB 5IHLB 4OZ4A 3DUSA 5C08B 2GTWA 4ZFGH 4X83A 2MPAH 1QW9A 1IBGL 2NR6D 4FQIH 3TN0D 1WUNT 1MHCA 4AMXA 4K8RL 5DGQA 5D7IE 3T0DA 3SGDI 4V1DE 1T5WA 3VI3F 2DQFA 2VDML 4GBXB 4YLQT 5C08A 2HFTA 5J6HA 4XP5H 3IXTB 3L3HA 1CG9B 5C2BL 4N42A 2O5XL 5HHMB 2MKLC 1LG2A 3D3AA 4GOSA 1WBZB 1HHJA 5DS8B 3WLWC 5CILL 2I9LA 2XYCA 2J8UA 4J6RH 5GGRB 3FOMB 4D71A 2QMKA 4YHLH 1HZHH 1KN4H 1MPAL 3BWUC 1WP6A 1LG1A 4NZCA 4DVBB 4UQBA 2X42A 3GIZH 5D7JB 3LD8B 1FORL 2DL9A 1N5YH 4KQ4H 4JFDB 3ARSA 3SBWC 1A02N 2FJFA 3BIKB 1MLCB 5F1OB 1GCYA 2HMID 5J06A 1YN7A 3WHXB 1HXYB 2R0ZL 4H0HB 4ZUTA 5C0CE 3SKOB 3PN8A 1ZMYA 3KYKH 3WE6B 1OGBA 2EDTA 1MJ7H 1KEGH 3MV8E 3FO1B 2CKRA 4OUOA 1OGAB 4KRPB 4XCYA 5SWSB 1A47A 2PXYB 1XR8B 5ADOH 4UV7L 5IIEA 2Y8KA 3SUWA 4OLYL 3H42H 4GKNB 4NKMB 5HGDB 3FO1A 3L1OH 3OMZA 3SDXE 3TV3L 3HG1E 1OGAA 3DO7B 1S7QA 1MWOA 4EEEA 4R90L 1UH3A 5H8DA 3ROLB 1S7WA 4ZFZA 3BH8A 4Y7EA 4Q6IA 1XHGA 2EXYD 3GH4A 1V3KA 3U0TB 2WP3T 5KVDH 3TYGH 1NC2D 4FRWA 5BOPA 2VRQA 1WDSA 3BJLA 2VQ1B 4N0UB 1S7WB 2JEPA 5DD0L 5FKPB 1WBXB 1A2YB 2NY5L 4AQOA 5BRQA 1CDUA 3OJ2C 2VCAA 3EYVB 4F33B 5F1IA 3RWGA 3V6FA 2Q7NA 4DKDC 4S10A 4WV1C 2FR4A 1ITXA 3KWXA 4Z7QE 1RHHB 3SDDD 1PYWA 3D85A 1MAKA 2LAGB 5E56A 3VXMB 4PBGA 3L4ZA 4NGHL 2EO9A 4U3CA 1RIUL 4Z7VB 2OTPA 2WC7A 4XH2A 1S8DB 4LVOC 3MRKA 4KMTH 4I0CC 1BJ8A 2ZSWA 3VXSA 1ZHNB 3S5YA 1MXGA 2H1PH 3JUYA 2NY7H 2V17L 3MJGX 2WM0A 1QI5A 1JIBA 2XUCA 1EA9C 1S7RB 3DMMA 5D8ZA 4HKXA 3KVQA 3UPCA 3MLSH 2BY3A 5ITBL 4PJXF 4QHMB 5D7SH 5EFFA 3WDIA 5BS0D 3ULUD 1Y18B 1S7XB 4BK5A 4MAVA 2FB4H 4ELKB 2R23A 3WSQH 2VE6A 3O3BB 1JDCA 1CIDA 3GBNL 1DL7L 4UAOB 1BD2E 1LE5B 4QEGA 2NY3C 1HYSD 4DWHA 1S7XA 4MA8H 1SYVB 3LKPB 4FXLA 3MO1A 3VGBA 2Q76B 1QSEB 1E70M 1BLNB 1CXEA 4J28A 1OAZH 2YUWA 3GXPA 2V5SA 4UTBH 2WBGA 1FFOA 3MJ9H 4DGYH 4YIQB 2UZIH 3PJSA 3SIMA 5DXWA 3WUEA 4GINA 1DLHA 3OG2A 1YQVH 3HPJB 4I3SL 3VD3A 3WFEH 3VW3H 4LAQL 1WQVT 5K9QI 2RFXA 4UBDD 1EEQA 3QEHA 4JGMA 1IC5L 4GBXC 4L3AA 4XNYL 1FA2A 2V7HB 3N1GC 4K94H 3ZE2E 1JMXA 3NABH 2HVJA 1K6QH 3N1PC 5EO0A 5CEYA 4M61B 2J5LB 4XI5C 5DI8A 5JIHA 4X6FB 4E41D 2YXFA 2L0DA 4K8RH 3O3AA 3LV3A 5GHWL 1B0GB 4OIIH 3UTOA 4ODVH 4DGVL 1BPLB 4XHJC 2H45A 3OKYA 2VQ1A 4O5LL 1KENL 3IVKB 3W0WB 2O5XH 5J1AB 3NIFE 2NZIA 1FO0H 2XA3A 1DANU 5D5MB 3MXVH 2VSCA 1W0VA 2QMJA 3S7GA 1MPAH 4FXKA 3EJYD 3GHBL 1D5IH 1HSBA 4LL9A 1I1AC 4CADB 2NZ9C 1F4XH 4MB1A 4J3TA 5DR5L 3R8BB 1CECA 3HC4H 1K2DB 3IKCA 3MMEB 1LO0H 1AGFA 1Y0LB 4HT1L 3VIPA 4KK9C 3ZKND 3LQMA 4MJIB 1A1MA 1HJUA 4MGXA 2XHYA 4HA4A 4XCCH 3VO0A 5D7LA 3MS8A 3DV6B 5H2BA 4N9GA 2H2PC 2CO7B 2D31A 3CZFB 5FL0A 5CJBA 4FG6D 3RIKA 1LL6A 1BFOB 1Y0LA 5K59E 1H49A 4G7YL 4HPYH 1OQOA 4LEXH 1E6NA 3OAYK 3FQWA 3HZKB 2WWCA 5C71A 2YD6A 2P42B 2Q8BH 1MREH 3L7EA 5J1SC 4NHUB 4PRHA 2OYLA 1RUKL 4HLJA 4NM4L 4ELKA 1KCSH 4P2QB 4N5ED 3RGHA 4WO4C 1S78C 3C2AL 2OWXA 1DFBH 4NZJA 4YXKL 3BQUA 4QLLA 4MNHA 2AQ1A 5IMOB 3U48A 1JWSB 5K9OB 2Y2WA 1ZJAA 1MCOL 3WNOA 2LAAA 3EFFA 4OLVL 1J8HD 3L3DA 3KL0A 1J0IA 7A3HA 5ERWA 1SEQH 5IQ7H 1VPOH 1XMWA 2VDRL 3GMNA 4CNIA 1R86A 2RIKA 3LEXA 2XYLA 3MZGB 2NXYB 1UQZA 1HYRC 1JF5A 4F7EB 1UR9A 2IMNA 2VXVH 3QIWB 4XP6H 4NNYA 3QI9B 1OAYL 3BZEA 1J10A