4CGTA

Deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
678
structure length
678
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPADAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 228
structure length 678
sequence length 678
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4cgtA01
4ZQKB 3ZMRA 2OZ4H 3HLAA 4E41A 4BFIA 4X0NA 2UWEB 1MUJA 4C57C 1SHMA 5LBSL 3TBVA 5C0ND 2WMIA 1BQHG 3LQAH 5C3TA 1FYTB 2AJUH 1SYVB 1QTYT 3NMEA 4JB9H 5ACLA 4LF3B 1AD9A 1OTSD 1GC1L 1T2QL 1MHCA 3QIBD 5GHWL 4AQ1B 3OLDA 4LCCC 4KV5F 1GZQB 3GSOA 1QNOA 2A3HA 5JW4Q 1CXFA 4FFYH 3O4LB 2UWEE 4PGDA 3QSKB 1CQYA 1A0QL 1DCLA 3HMWL 1YYML 4HSQA 2VZVA 1UZ4A 2VCCA 2R0KH 1FYTE 3LRSB 4YQXH 3A22A 2JJSC 3SGJA 1J0ZA 3ARDB 3FO0L 1OAKH 2C7UA 1Z9MA 1H49A 3HC0A 1DJSA 4YAQA 4LSSL 1JNNL 4FLSA 1BOYA 4F9PC 2EDHA 3ARSA 3O4LE 1FVEB 3S36H 1RHHB 3RVVD 3ZKND 4D0CB 5C0DB 1Y0LB 1N4XL 1IBGL 1PVHA 1HKJA 3ARTA 1QSZA 4H5SA 1RVFH 2W65B 3U2SA 1YMMA 4RISH 4YUEH 5JXEA 3TT3H 4MNLA 2YBRA 3UEQA 3UJTL 3EJQA 4P2QD 1LK3H 3U0PB 5BXPA 1U92A 2ZJSL 2B0SH 1HHGA 1S7SB 5B4MC 5E6ID 3D5HA 2EPKX 1XZ0A 4OM1H 2VLLA 4D6GA 4OCWL 2BNUB 4D0BA 1FFQA 2GT9A 4NCC1 4YHYB 3TCLB 1MCDA 1SEQL 3JV6B 3MCKB 4P3CL 4EDXB 2YD8A 2PWDA 4ONFH 1WV7T 3P40A 3TCXA 3U46B 3WEXB 1HN1A 5TE6L 1WTLA 2HYMA 2OLDA 2OW7A 3QHMA 1CWVA 5DHVH 1LVEA 2NXYB 43C9A 1NUDA 1EPFA 1TQVA 3QP3A 2G41A 1CGSH 3E6FB 3F62A 4JFQB 4WFHD 4S0SD 2PR4L 5B22A 1TIUA 2C3HA 4EDWH 2ADIA 4PMYA 3MMEA 5E00B 4U31A 5SWSD 4F58L 4XT1C 5ID1B 4TUFA 5TPWH 4PMZA 1QNPA 1YEHL 2YRPA 2G75A 4GS7B 2X1XR 4XZUB 5FF6B 5FIEA 5AZEL 1QW8A 4OCXH 4OLZL 2F58H 1ZK9A 3FONA 1NCWH 5D70L 5GGRA 2SEBB 1UJ3A 5JO5A 4G7YL 1FLRL 4PJXB 2HKHL 2VR4A 1QVBA 5EG6C 3MUHL 4K3GA 2V5YA 2XZZA 3FZUD 3IDNA 1A1NA 3IS1X 3U36A 1JDAA 1B3WA 1IGTB 1G0YR 4GZIA 1UR1A 4I5BB 5EZIL 3UTSD 1B30A 1X5XA 4U1MA 3VXQA 2IXVA 4FQIL 4E9LA 2BFVH 1TVBB 2YPKA 1SJHA 3X14B 5F6HJ 2VC2H 3QIUA 4K7FA 3F58L 3ULUF 2VDPH 4K3DL 4CUCA 4JZ5A 2CLRA 1Z3GH 3HFML 5TGBB 5C9JB 5JMRA 4PJXE 3T3PE 4MZ2A 4PV8B 3OKDA 1QFOA 2CLZA 1ZT1B 2DSZA 1LO0H 5D7IF 1O7SA 5GS2D 4DM1A 2XTJC 1NLDL 1H15A 4JY5H 3UBXA 2VR9A 5DO2D 1E28B 3VXMA 4LLQB 3BKJL 2YFNA 1INEL 5DQJB 3BCDA 3GH5A 3R0NA 3BAXA 3N15A 4G6AD 4LCYA 4WFED 4Z7UA 3LEXA 4NN6B 3IANA 1CDGA 4Z9KB 1F2XK 3TWCH 1V02E 3UP1A 3N1QC 2F7OA 1UWXH 3GXDA 2FR4B 2ORBH 4U1KA 4H8WH 4ESKA 3BP7B 5LXGH 4D8PA 3H3KA 1MRFH 4J3XA 2NY6C 4AMCA 4LPCA 2ZSVA 2DQJL 2PTTA 3TBWB 3HZ3A 3TH4T 5KZ6A 4CRPA 3IKKA 4NSKA 2VVSA 2DBJA 3IDMB 3TA3C 1LWHA 1CU4L 2YA0A 4UT7L 1HSBA 2GY5A 2VWEE 3HS0B 5IM7B 4P2RA 3L5HA 1IVLA 3RQ3A 2JB6A 3BUQA 5KSUB 3WS3A 2FSEA 3T1FB 4ORGA 3QHZH 1EX0A 3IDUA 2NTSP 4J3OC 5I0DA 2XHYA 4GKZB 1CBVL 3VA2C 2OBGA 3L7EA 1CTNA 1X7QA 5BCAA 3NFSH 1XIWC 2FX7L 3L1OL 1JDDA 2W59A 2RGLA 2GDVA 2NY2B 1NPUA 4RWYH 4D6CA 5LVEA 1F42A 1MFUA 1QNZL 5CINL 3WKZA 3ZIZA 1JZ8A 4M1CD 1EH9A 1J5OH 2VURA 1YZZA 3PL6D 4G80A 3MLTA 3MLXL 4HT1L 4PRWA 5DJCA 3DURA 1NGXB 4W7VA 3QXAA 2ZWZA 1B2WL 4LOUC 3D0LA 4RMQA 4WI5A 3ZKSD 4KUCF 3LCYA 1VA9A 4NKOB 1K4DA 2Z93A 3OXSA 4FNLH 2JF6A 5BZDB 1FFNA 3OKMB 2DSWA 3G04A 4UNUA 4DN3H 1MAJA 1ISYA 2GFBB 1UB5A 5IQ7H 3ULUL 5J9PB 1PW3A 4XMKH 4ZXOA 2QV2A 1LE9A 1J88A 1E4XI 2HTLD 4MD4B 1PEWA 1OAZH 4H8HA 4G5ZL 5EN2A 2D7TL 1OM0A 1N8ZB 4PJBF 4ZS7H 3VRIB 3MA7A 1CXLA 3P0YL 3MRCB 1W32A 5CHNA 1DLFL 1QYGH 2BXYA 3U48A 3V7AG 3SO3C 1CD1B 4LSTL 2P7TB 4XH2A 5CP7B 1XCTB 5I3DA 3RGHA 3N1FC 2F61A 1HVXA 2XPGA 1H3UA 3T4YA 3MROA 5F9WB 3JBG7 2Q7YB 4QHLA 3EMQA 3HI5H 1G7IA 3U0TA 1OP5H 4HKJA 2VAAB 3FFCD 3QNYA 1CLCA 1DUZB 1T1XB 3PP3K 3MLYH 2BNQA 4U1IA 2PTUA 5CKAA 5D7KE 1CBGA 2Y7QA 2EXWC 1U0QA 3A6CL 3VJ6B 1MCRA 2PYFB 4GKSA 5D6DA 1P4BH 5KJRL 2X4TA 3S6CA 2UZIH 2X9WA 1V0MA 5C8JB 4WLCA 2C3VA 2I9TB 4JO2L 3WSQL 2WWMC 4QLKA 4A3HA 3ZT6A 5IB3B 3CHFA 3THMH 1PFCA 5ISZB 2J7LA 1IRAY 2WMKA 3QZWA 4XC1H 4CN6A 1BZ7A 3VNZA 2HP4A 1G0CA 1FAIL 4UBDC 1E15A 2FH8A 2HT2C 4K2UL 5KSBF 1KBGH 4RE3A 5I1CL 3HG1A 5ADPL 3L3DA 4C56B 4GG6B 5MEPB 3KJ6L 1VFBB 4DW2H 2OK0H 4I9WE 1P4LB 3VXPB 1KGCD 4DZBA 4PJ9A 1JF1B 3FT2A 5HHMD 3WL9A 1N59B 2W9LA 4EE9A 2ADJB 4W81A 4WKAA 2BNRB 1F4WL 5ISZE 1DWJM 2DKMA 3AHVA 2KQNA 3B3IB 3OB0H 4CVXA 3DO7B 2LTQC 3QHTC 3NH7L 6FABH 3SOBL 2P5EA 4TVDA 4PYHA 4C56E 4GG6E 4JANA 3W24A 1RZFL 3NN8B 3G6LA 3SGJC 1QI0A 3QXDA 2WVTA 1BZQK 2Q6WB 3VWJA 2X4QA 4L9LA 1H3PH 2Q86B 3VFGL 3WLWD 1KYOJ 2EDFA 4KK9D 5C0AD 2WXDM 4ACYA 2BNRE 4HZ7A 2Y36H 3C08L 4HJGA 4OGXH 1SY6H 3H0TB 3ALGA 3L4YA 1V6XA 3QOMA 3S37X 1RZ8B 1T7YA 2YD4A 5FKYA 4TOYL 5D1ZD 4Y4HC 1NFIA 1MHHA 4MNGA 3DX9B 1DWFM 3IRZA 4TNVF 2ZSWB 2M1KA 3ROLA 3BQUA 2DI9A 5JXEC 5CJBA 1F4HA 2AXJA 2GTZA 3MRBB 3LKOB 4N90D 5DJZB 4S1SH 1RI8A 3DXAB 3Q1SH 2RBLA 1N3NB 2HH0H 5ALCL 1UXSB 3C2AL 3PWLA 5T1LB 3VSUA 2NNAB 2DQFB 2EC9U 2RGSA 5MENA 5A6KA 2C1PA 4Y7MA 3MSPA 4J28A 3OAZK 1SMOA 3QUZB 2H26B 4JHAL 1JWSB 2R1XA 3T0BA 3DPBA 1GCYA 4E4PA 5FL1A 3AREB 4UDTA 4Q6IB 2IADA 4JDVB 1U3HD 5DJXA 4KZEH 4P2OD 4D9RE 1AGEB 2ENSA 3K2UL 1UM5L 5DVMA 2A1WL 3DXAE 5JBEA 4I3SH 5GGUA 5BXFB 1FZOB 2LU7A 1W9VA 4BK5A 4BZ2H 1IC1A 3REWA 3W9DB 5BROA 5D9SA 1NUFA 3CSYA 3QR3A 1G7PA 1ZBCA 3QQ4B 5GS0L 2V5DA 1Z9LA 5IW6B 2EXWD 4NQSA 4XPAH 2QPUA 1HSAB 4QCFA 3AS2A 2PO6A 2HRPL 4UCFA 4GW4B 4D9QE 3OF6D 3GI8L 4WI9A 5HGBB 5ABDE 4N1CA 3HHRB 4PRDB 3BGFC 4QHMA 5DC4B 2V7HA 2XVKA 2E27H 4NKDB 1BM3H 1SYTA 3MLSH 3TYFB 2FE0A 5DRWA 3OHXA 3VMPA 4M61B 4XWGH 1I1FB 1OGBA 4KQ3L 4HWUA 4OIAA 3F5WB 3VGHA 2QV4A 3MLRL 4AM0B 3M7SA 4PB9L 1AGBA 2O5XL 1J0HA 3L5WA 3RAJL 1ITBB 4ODHL 3VXNB 3LKPB 3H9SA 4FXKB 1GOMA 3QIUC 3B9EA 2OTPA 4OAWB 1EJOL 3ZHDA 2CH8A 4F7EA 2VRAA 1UH2A 2WUCH 2R2EA 3S3PA 1T7WA 1S8DA 4JFDA 1CLOL 3QUMH 5AYBA 4DKFL 4GOSA 2XM1A 1EQCA 5CBAA 1VEPA 5DC9B 3VFTB 3NUKA 3O6AA 3NCFB 5HVGB 3QG6B 5GSVA 2H1PH 5DK2A 3TLRA 4YFLF 4AZBA 1RP8A 3PDGA 1J86A 1EBPA 1W0WB 4HU0A 1MWOA 4QYOB 5GJTL 4QHNA 3PWVA 2DMCA 3HZVB 1Q72H 1RIUH 1DUYB 2CDEA 3SBWA 1CR9H 1RUQH 2XZQL 4DCQB 1LP9B 1QWNA 1UWQA 3B9VA 3VXOB 3UTTB 2OL3B 4IUGA 3JTTB 4L8CA 4Y4HD 3IFPA 2VISB 3AMKA 3IJHB 5F8RC 4QRPA 3C5JA 5FCUL 5HYJB 4HA3A 3FB6A 4F33A 1L6ZA 3QYCA 2QKIA 1A2YB 15C8L 4N0FB 3GNRA 2AK4B 3QO1A 4XNZC 2CKNA 4PS4L 3RNQA 1LP9E 4GRLB 4NNYA 4CW1B 4KPHL 3UZVB 4NZFA 3P30H 5DFWH 3UTTE 4AC1X 1J1XH 5F97E 4JL1A 5F1OB 1YQVH 3SCMB 2VDLL 4GI6A 5HYJE 2J79A 2EKSA 5D7JB 2FO4B 3MJ9L 5ITBL 1TCMA 2WW5A 5IW3A 1OTTC 1PG7X 3T0XA 5FA3B 3VDHA 2AK4E 1E6OL 4HK3J 4Q9QL 3KYAA 3W0WB 4KDVA 4PJGA 4OLUL 1NARA 3DHPA 1L8NA 5I8KH 5EFIB 5FO7A 1P2CB 3S4SG 5DVNA 5DMKA 1YEIH 3RJYA 3ULVE 1CFQB 4HIHA 2NYYD 1IGJA 1W1TA 1XR8B 1BGGA 4H0HB 4B53A 3UJJL 4JFYA 3W0WE 1NDGA 1IAKA 2BDNL 1MFBH 4U1LB 3W11D 4LBEB 2WV3A 1FIEA 1KEMH 2R39A 2X09A 5LAXA 4RNRA 1PKQB 1GSMA 5E2WH 3OSKA 2HWZH 2FJFB 4GFTB 4WU7B 3UAJC 4BFBD 1LK2B 4F15C 3GMQB 3BX7C 3CLEH 3AS3A 2FD6H 2FX9L 2GY7B 4TSCH 5E8NA 5FD0A 2E40A 1T1YA 3EOAA 4FQXA 1AKJD 2XV6B 4PRIB 3LPWA 5DI8A 5GXBB 3EYUH 4Q7DA 5F7NC 1QNSA 3SDAB 1OSEA 2G5BB 1UWTA 2X1PA 3LMJH 4NM4L 1QFWL 5DMIH 5ACZB 3H9YA 2CKBH 1PKQE 4NQDA 2XIIA 1K2DA 2X2IA 1WIOA 3L4XA 1F6FB 2R0LH 2BSTB 5DHYB 4LEXH 5I15H 3ESUF 2HFEB 5E56A 2MOVA 4PG9A 4PRIE 2B4CC 1W9DM 3W38A 2AEWA 3IXAA 4KUZH 3AMDA 1IEAA 4I3RH 1BAFH 3G5ZB 1TZIA 5D1XD 3VFMA 1LEKA 1XF2B 4ONHB 3MOBH 4MX7A 3IDYB 1CZ8H 4R4FL 5CD3A 3VFWB 2V2WA 3OR6A 4V2BA 2TAAA 3ZKXC 5D4YA 4ZFOB 3LN5A 3KPMB 1GHFH 4RIRB 2VX7A 3VKKA 1LO3H 1NC4A 4JPIA 4Z0XB 1P7QB 2XVLA 1KTDA 1BVLB 3FHAA 4XXCA 1XMWA 2ZUUA 1XAUA 3RPIB 4JM2F 5D6DC 1CFVL 4LPUA 2WVSA 4JDTL 5T33L 3TT3L 4Y5VA 2ZICA 4ZOEA 1X44A 1U93A 3S96A 3GMLB 5L88H 4P5KB 4PUBL 1UKTA 1IARB 2VKWA 2B0SL 3BUYA 2OWXA 4XVTH 3VRLF 3WLBA 3GMMA 4Q9BA 4QCIA 3SGDI 3E2HB 1R87A 4W89A 1YJDC 3S37L 1G7HB 4J1UB 3B8SA 3CHCA 1MFEL 5IJKA 3MRHA 5EIIA 3EYSH 2MPAL 1R3HA 4UFIA 1B6DA 4ONFL 2VDRH 3BMWA 4PJ9C 3SUUA 4XXDA 3PGFH 4U0QB 5F1KC 3WQ6A 2EXYC 4FXGA 3RDTA 4JDZB 1BPLB 2UVEA 3L6FA 4RGNB 1FO0H 3WDQA 1CYGA 1OTTD 2CXKA 4MJ6A 4F7MA 4HWEH 1FP8A 2ESCA 1CXHA 4DFHA 1GQJA 1YDPA 3H9ZA 4AIEA 3B43A 4W87A 2KH2B 4ZO9A 4Z2GA 1CGSL 3QUYD 4K7PX 5BV7L 4Q2ZA 2HN7A 1IGFH 4K07A 4EDWL 4APQD 3KLHD 4TUKH 1MCSA 2DIAA 5SWZA 3MV11 3VWJC 3ZDZE 4L9LC 2MWCA 5CSGA 3BAIA 3GI9H 3SKMB 4LSUH 3WENA 3RTQB 4RGNE 1E0XA 5IVXA 1Q6DA 1HKLH 5CIPB 4OZIF 4PRHA 1EVTC 3H7LA 5INCA 4QFUA 1QSEA 3QGVA 1SJXA 2AJYH 3KLAB 3RNKA 1Q0YH 4P4KC 1G9NC 1KTLA 3ZJ6A 1LQSR 3BQUC 2ICEA 5LYRA 1LDPH 4G3YH 2YOCA 3N1GC 4PJ7A 3V9FA 3LEYH 4QKXB 3ZL4L 1HKIA 1U8OB 4AZCB 3NZHL 1S9YB 2EH7L 2WM0A 3QWOB 1AQKH 2BFVL 3KPPB 1F8TH 2GDUA 2BOBB 2VC2L 3ARBB 1A6WH 3UTPE 4ZYKA 1YUHB 1HH6B 5F9JB 3GIVB 3OXRB 1HKMA 1EGJH 3FFDB 1QOKA 1QRNB 5CJOL 3HNTL 5I16B 1LO0L 1L7TH 1J01A 3IJSB 4C59B 1EHLL 4X0KB 1UZ8A 2DQGL 1JMXA 1M03A 3GBNL 3IFLH 3UG5A 2GSGA 4G8FA 3RWEA 5IMMB 3L3JA 3BT2L 1K85A 3DI3B 4KJPC 5B38G 1UC6A 2ARJQ 3Q48A 1T7XA 4XPFH 1QRNE 4OT1H 1HDMA 1QA9B 5BOZG 3VW3L 1JTPA 2GK1A 4BUGA 3WD5H 4N0CD 4G9FA 4O9HL 2ORBL 1DP0A 2VERN 4H8WL 1JZ5A 1JP5A 3ULSB 4L8SB 3EMZA 1LG1A 5LXGL 3MRGB 4YPGA 1F13A 2V17H 2UZYB 3R4DA 4LSPL 1DE4B 2E8ZA 4AMKH 1BFNA 1J87A 5F89B 2X5PA 3VG0H 4PJ8A 1BVKA 4NN5B 1OW0A 3K4AA 3ELAT 5D7SH 1QO3A 1AP2B 1IKFL 2CBIA 1TQBB 3DECA 1I7ZB 1LL7A 1ZHNB 5ABFB 1U8QA 4QRRB 1UWEH 4OZHF 2AXGA 4AIZA 4DN4H 2IFFH 3QHZL 4UOQA 2YEZA 2R4SH 2L7JA 4MQ7B 3IAGC 5T5NG 4IRJD 5HD8C 3EJYC 4PGJA 3G6JB 4RMVA 3CO4A 1GGTA 3V5HA 1HHHB 2MFNA 4ZUUA 3NFSL 3V5DA 4P7NA 1PSKH 3RUGA 4EUPB 3KYNB 4DWSB 1S5IH 4ZXBC 1BYAA 3EOTH 1LNUB 5TH2A 4PJCF 4MMXC 4OCYH 3WYRA 4U5KA 3HE7A 4JGMA 1E5JA 1KJ3H 4IDJH 4P8UA 4PUDA 3KS0J 1MVUA 4QRRE 3O6FB 5I75C 3VOCA 1J5OL 3CMGA 3C5SA 1WTGT 3G6JE 4P59H 2EQDA 2FO1A 3SBWC 3HC3L 2EIZB 4G6MH 1WE5A 5HHNA 4NRXB 3PWPA 1C12B 1F3JA 1UD4A 2PW2B 4GRWB 4HIIA 3DBXB 4TNWK 4P4KD 1G7JA 4UT9H 5E1AA 2X7LB 3D4YA 1DVFD 4MJ5A 4PJ5A 4OD2A 4XMKL 3CUPB 1YA5A 4WO4B 1EO8H 2J8UF 1TR1A 5L7XH 1T7VA 3D25B 2P8PB 4Y16A 1OAZL 2JTDA 4OQ1A 4MNQB 2YMXL 4GRWE 3MV9D 4LLYB 2WW8A 3T1WA 1OOAA 1NMAL 2YD3A 1U8IB 1TUXA 4Z76A 1D9KB 1CFTB 4BKLA 3TJEL 5J13B 1XC6A 3MV8D 4NQEA 5L0QB 3AOFA 5JPMA 5C08B 5ICXB 3RM4A 3B5TA 4XPBH 1EEYA 3MRJB 4YHEA 3L3OA 1VCAA 4POZC 3DX8B 4R3SA 5H2BB 5FECB 1P53A 5FYJU 4NO5B 3DV6B 3PZNA 3CPUA 2W4XA 1NEZA 4TQEL 1MW1A 3HI5L 4ZODA 4KJPD 4MNQE 1SZNA 4RBPH 1DQQA 4OFDA 2P45B 3MLYL 3MNWB 3VGAC 2UYLB 1ORSB 3CFKA 5I9QB 3CFJA 3PGCA 3I75A 1WAAE 5ID0B 4UIMA 4R97B 5C08E 5IHRA 2A6JB 1YNTA 4XNQA 3SURA 4HKZB 1JCKA 1P4BL 3GGWA 5DEFB 4JREC 3UX9B 4M4RA 4BQ2A 3QQ9D 4L4JA 3W81A 3SKOA 4KY1H 4EI6B 1W2PA 1DEEA 2DOCA 6CGTA 1LEIB 2I27N 4XC1L 1E6NA 2R1WB 3PIQB 4Z18A 4KKAD 5CWSB 2GJPA 1I9JH 1P9MA 3GHBL 4Y89A 4FQXC 1EHXA 2AK1L 1WUNT 4DEPC 2EYRA 5DVKA 3KPQA 4MA8H 3IETB 4C58B 3ZE0F 5KVDH 3BEWB 5HD8D 3IGAA 4WWID 2DH3A 5DFAA 4U1GB 2KL6A 4NJAL 3RGVD 3VRJA 5CCKH 3BKYH 1C3FA 4WWKA 3C6LD 5D6CA 4YX2H 1TDQA 5EBLB 3WF3A 1BWMA 3FOMB 4KHXL 6FABL 4ZXBD 4WHTB 3O45B 4PJAA 4X8JA 4HBCH 5I1HH 1WP6A 1MRCH 3MRFB 3CC5B 1NGYA 4PLNC 1RMFH 1CDJA 1Q9LA 3WIIH 1S78C 3V6BR 2EICA 2OTWA 1C5DA 2MJWA 1H3PL 1H9VA 3WN5A 5HI5D 3EYFB 2IMNA 4LGPB 5B39A 1E6PA 2Y36L 2BC4B 2PC8A 5JW4M 5I2IB 3T2PA 4P46D 1VF8A 3MLUH 1A7QH 4LLWB 3CZGA 1A6VH 1FFOA 3FT4A 3PHOA 5EUKB 5DQ9A 4NO3A 1NEZG 2F54B 4XXCC 4LQFL 4R9HA 2APWA 3S34H 2QLVB 1YPZF 1V6VA 3V79C 2FB4L 3HI1A 1QI2A 2BVDA 3GH4A 3B6SA 1FNEB 2K3TA 1II4E 4S1SL 4AK1A 5I1KL 2IH3A 2BVOA 2EADA 2HH0L 4L4TA 2VZTA 4L4VB 4QRUA 4NO0B 4NUJB 1V7ML 4X5WA 1LO5A 4OZFB 1EBAA 2AERT 1TFHA 1JNHA 4LHUA 4LLMB 5BZWB 3BSGA 2XN9B 5IJKC 2R0ZH 2F54E 5DD5L 2PBOA 5HDBE 4WNQB 2J4GA 5T1KA 4PRNA 1FNGB 4JM2D 4LMQI 1T4KA 4G6KH 4CMMA 3RDTC 5M7QA 3BH4A 3WIFB 2NY4C 4BH8B 4JPWH 1KT2B 1JGEA 1MCKA 2DQCH 4I3SL 4L4VE 2X41A 2F7QA 5BXRA 3V5KB 5KOVC 3GNMH 4KMTH 4BZ2L 4UQ2A 4Y8DC 2BVQB 2AXFB 1X4YA 2P47B 2NR6D 4AXNA 2FRGP 5IW1B 1XF3B 3RFZC 1ZXQA 4RFEB 4EVNA 3MRIB 5ITFB 2AV7A 1W0VB 3PZVA 3C9NA 2Z31A 3P9MA 2XFRA 4PGEA 1MF2H 2E27L 4UT6H 3DX2A 4KXZH 3T2QA 3I6LD 1YYLL 4PBVC 5J6HB 4N0YH 2R23B 4TVPH 4QCEA 3DYMA 3BIBX 3DVIA 5DK0A 1HHJA 5T3ZE 2OTUB 3BH9B 5FKPA 3X12A 1Z6JT 5F1IB 1NL0L 5EU4A 5MEQB 4NZUL 2XTLA 3GSVA 4MAYA 4A6YB 4NQCB 1NBYA 1I8KA 4PTVA 3QIWD 1CLZH 4OQTH 1IE5A 4M7LH 4K94H 2UY3A 1QUNA 4P9HH 4GH7B 4W7UA 4LCCB 2VDQL 3P4MB 3QEUB 2WUCL 4NKMB 3BXNB 5LKNA 3QUML 3L3GA 2H9GB 4M03A 3TJHC 1W3HA 5C0FB 3WXWH 5FA4A 3JTSB 3GMOB 4NPYA 5ERWA 4NQCE 3X3FH 1FGVL 2H1PL 2VL5B 4LHUG 1KCSL 1E3XA 1MFVA 1D5BB 5A2KH 2QQNH 2Y6SC 4JN2B 5I66B 3RL2A 3I9GL 4HX1B 1R47A 1RIUL 4TUOB 3RWDA 2ZX5A 2YPLB 4HMCA 3QPXH 3VXTB 1MFCH 5D2NC 4NZCA 2IAMA 1R6VA 3CSGA 1M05B 4AD0A 4LYQA 2ENYA 1J12A 2IPUK 4QOKA 2J2ZA 1TTUA 1P69B 4PJ8C 1KIUA 1XGPB 1AXSA 5BVJA 4LKXB 1U91A 1M7DB 4X4MA 2YPLE 3P4OA 4ODBD 1YQVL 2MTPA 3DUSA 4Z7OF 4ZMAT 5FOBB 2VDNH 2EPMX 1FZJA 5J6GA 2GK0B 4P3DB 3HE6A 4PJDF 4RMTA 1OGAB 4MCZB 1FL5A 3CZKA 1ED3A 2WCGA 3BPOB 2ATKB 4HPHA 5IBUG 5DUPH 3QWQB 3FO1A 4LCIL 5E7BA 3TPUB 6A3HA 5A16A 4YK4C 2FEEL 3V4PH 4HDIB 2DQEH 4XAKE 4DO4A 3HE7C 5M3WA 3MUZ1 5I8KL 4ZUVA 2ATPA 5T3XL 1U8JA 4PP2B 3KDMA 4JFVA 3CIQA 1W0YT 4GKNA 1B0WA 1HI6A 4FOMA 4HUNB 1OGAE 5D7IA 2P4AB 3TIDB 3H3PL 3QO0A 2E7CA 3HZMB 1V7NH 3MRKA 4YZFF 5TDNB 1QR1B 3FKUS 1MFBL 1V3LA 3U4BH 3MYJB 8FABB 7FABH 1MCJA 3F5JA 2KZWA 4KKCD 5DFVC 4HIEB 1U3YA 4FQQB 2FD6L 3LPPA 3NCYS 2WHKA 1VERA 3BJ91 3C60D 3HAEA 3QQNA 4G8EA 4Y16C 1NANH 1R5VA 5L2KA 3F5KA 1ZHKA 5KOMC 4HS6A 1G7MB 4P7OA 3ARXA 3O3BB 1YMHB 5EO1A 3LMJL 1RY7B 4Y2DD 4GW1B 2J77A 1M1SA 2CKBL 2VQ1A 1JGLH 4BJLA 1AQMA 1RZGA 1KGWA 4GUPA 1J8HD 3KPRD 1XGQA 3OKLA 1EOKA 1ZA3A 2R0LL 5GIRA 3MLZH 1U95A 5HBFA 1BJ1J 3V4VL 1H2JA 4JKPL 4B7IA 5EU6A 5CEYA 1XGZA 1AJ7H 2D9QB 5CEZE 1PLGH 1X5YA 5HHOD 2YA2A 4TTDD 1KTCA 2XTJB 3F12B 5FUOH 3SCSA 4KUZL 3VTRA 2NXZD 3G5XA 1NH6A 3N50A 2Z8VC 1UB6B 4I3RL 1IFHH 4GAYB 2XFXA 2N4IA 5D7LB 3NIDF 2APVA 4L8DA 4FFWD 4OJFH 3MOBL 3HUJF 3FL7A 4JZOA 2PBGA 1KC5L 3VI4E 1GHFL 3OWEA 2IQAB 5CMAA 4HUKB 1D5ZA 2HJKA 2OX5A 5K33A 4FQHA 3AMCA 5HY9B 1VRXA 4G42A 4O2EA 4B3KA 5IBTL 5JPNB 3WBAA 4HC1H 4ZSOA 2A6IB 2XTJE 2J74A 4TX6A 4E42A 3PWJB 3DDFA 4XI5C 5D7LE 2NY6B 1MCOH 1J0YA 3E3QC 4KRNA 4ZD3H 3BVVA 2ICCA 2OS7A 4EKJA 1J05B 1VBRA 4L9DA 4JFFA 4LEOA 1IMHC 1NM9A 1P9MC 3GMRB 2EDRA 3LPOA 1WBZB 2MCPL 1PS3A 5D8WA 5FYKU 4JEGB 3CLFL 4Z95L 3PN8A 2Q76A 3IKCA 5BQ7A 4GI8A 1D5IH 2J7GA 5EB8A 3MR9A 3O6ML 3MRQA 3GXMA 4WWKC 2EIBA 1XIWB 3ARGB 4XMLH 4J3SA 4D6DA 1RJLA 1VACA 4HA1A 3HMCA 4P9MH 2D7NA 1A3RL 3VXUA 1I1YA 4JFUA 35C8H 4PJBA 4B9YA 1G7LA 1RZ7L 5ICZB 5DJ6B 2G3MA 1IGFL 4QHKJ 1BIIA 3BWUC 5EBGA 3BAEH 4PLKD 1CVRA 3STZA 3WN5C 3M17A 3EMCA 4FTVD 3D6GA 4MB5A 4NQUA 1T1WA 1V05A 1FQ9C 2ZUNA 3MCLL 2FGWH 3NIGF 5BJTB 1NAML 5GRUH 4CJ0A 3D69B 4L5FL 2AJYL 2YL5A 4B41A 1QLRB 3CU1A 3FQRA 2XI9A 1IAOB 1RZJH 4QTIL 4E8CA 3DRQA 4MD0A 4MB3A 3RWCA 4ZAKC 4CD4A 3PABA 3OR7A 3DOSA 3RY4A 3LDBC 2VLJD 2XG5A 3AU1B 3V52H 2BCKA 3LEYL 4N8VG 1V08A 4JHOA 2IAND 1PZ5A 4Q9CA 5FYKE 4F3FA 3H6JA 4IS6A 5F7DB 3U7BA 5E5UB 1FPTH 1UXWA 4FQ2H 3HC4H 4PRBA 3O9WA 3QFJB 1F8TL 3WH6A 3N18A 5SX4I 1A47A 4ZOCA 4L3EB 3M8OH 2O9PA 1A6WL 1E9LA 2EYSB 3W2DL 1GRWA 4X7TA 5A6BA 1S7VB 1MI5B 2ICWB 3U30C 4OF0A 5TJWK 3SO3B 1HNYA 3DGGB 2APBA 5KSBA 5TF1L 3JUYA 3P9LA 4OGAC 1R5WB 4YBQD 3U79A 5K9OB 3L5XH 1NP0A 5M95B 2VZ1A 5DD0H 3QFJE 4DGVH 4L3EE 2FZ3A 1PG7H 4P3WA 1HH9A 1MI5E 1XR9A 3V2AR 3TT1H 4AG4L 5IJVA 3B5GA 2VSCA 2DQHH 1BD2D 4PMUA 3IDGA 4HIXH 1CN4A 4L29B 3ZKMC 1JPGB 1UGNA 2XXMB 3BZDA 4PEEA 2Z31C 2VLKB 3TF7C 1G9ML 5AD0A 2EH8L 1N5AA 3CJJA 1FNLA 3KWWA 3ESVF 1K5NB 2XWJA 1QNQA 1MXDA 2V17L 2WZEA 3VGFA 3HLAB 1ITXA 4E41B 5I71B 4BFIB 4HV8A 5HI4D 3I6GA 2WQ8A 1MUJB 1T0PB 3MLWH 4M7KH 5HVHC 1ES0A 1WWBX 5LJYH 1CFSA 3TBVB 3K7UA 4MAYC 2C0HA 2DLGA 2WMIB 1S7WB 4P7RA 4UV4H 3QEGL 2KKQA 2YHGA 3OZ9H 4XNYH 5KVMC 1V0KA 2VLKE 4HEPG 4DN4L 2XN1A 5EU5A 2IFFL 1AD9B 1Q1JL 5IUSA 2Y2WA 5L9DL 4OFYA 2X9XA 3T0ED 1JXKA 2ZX8A 5ICYA 4NSBA 3B2UC 3IXTA 4TUJA 4ZO6A 5I74C 3GSOB 3QDMA 4E41E 2ZUXA 4P7LA 1QKZH 5EZJA 1FP5A 4FQCL 4PGDB 2YPVL 2I25N 4YBHA 3EOTL 2PI6A 5EIVA 5BMFH 4M24A 3QFDA 1I9RH 4AYSA 3EJSA 3CMJA 4IDJL 1GOWA 2WSKA 3D85D 3UETA 1MRDL 1GGIH 1KJ2L 4YFEA 5IGXH 4M81A 2OM5A 4Q74A 3N04A 3GSNL 2CIKA 3HC0B 4YAQB 1OL0A 1BFVH 3DX6A 3AZRA 5HGGS 2CPUA 1X5AA 3W0KA 3KR3H 3JWOC 3KGRA 1HHKA 2LU3A 3LV3A 4G6ML 5F1SA 3RVTC 4KK8C 3SDYH 2UWEA 4LPXA 4ELMF 4QNPE 4JR9H 1CICC 2KPNA 5HYEA 4MD5A 2ADFH 3MGTA 3MJ9A 1RV6X 2IAMC 3GHEH 5I30H 1AFVH 2LAGB 1H4PA 1FC1A 1FL3B 4V1DD 4H5SB 1ONQB 4ZAKD 3U2SB 1E0VA 4WTZG 2YBRB 4KI5E 2I26N 1FDLH 1U92B 1HHGB 2ITDA 2R8SH 3WD0A 1XZ0B 4WUUD 4DGYH 3CHEA 2VLLB 3QHOA 1FBIH 4F37F 1BYCA 3VIJA 2OYKA 1NCBH 4D0BB 5C0RL 4CKQA 1R7OA 5KANI 2GT9B 4LU5H 2HVMA 1NLBH 2J6EL 3U83A 2XT1B 1I3RA 5D8ZA 1HP4A 5HYSA 4Z5RA 3AS1A 4MHHG 2OR9H 3HE6C 4OGAD 4XPBL 3UTQA 2J47A 43C9B 1JJUA 2BZDA 2I9LA 3MGOA 4UOJA 2GITA 1A7OL 4XP9H 2NX5A 1OM3H 1FCCA 3BGMA 2DS4A 2P24A 3M07A 3ULUC 4K3EH 2ESVA 12E8L 1J11A 4XVSL 4K7PY 2ADIB 5EUOF 1CPUA 3MMEB 1UH4A 4U2ZA 2W65A 1JPST 1G5AA 5A8QA 2GJ6D 4RGOH 3ZKMD 4S10A 3NFPA 1DQJA 4OIIH 1HWGB 5DZNA 1RPKA 2G75B 4Y4KA 2IMMA 1A14H 4FNPA 2BS9A 4Y5XA 3FONB 2NT0A 3GKWH 5EO0A 1UJ3B 3VWKC 3TEUA 1CDCA 4Q22A 5M94B 4CADA 3IDNB 1A1NB 3WFEH 3U36B 1I4FA 4H1LA 1JVKA 2A73A 4LCWD 4QXTA 1XGYL 4Z0BL 4FXLA 4LGRB 2GQHA 4U1MB 4R2GD 1VIWA 2VCAA 4P2YA 1GYAA 4D1IA 1HQRA 1SJHB 2YPKB 1S7XB 5BS0D 3QIUB 4K7FB 5KVDL 4EK7A 4C55A 2CLRB 5CCKL 5CGYD 3RM8A 2XYCA 3PV7A 1NFDF 4HLJA 5JBDA 2CLZB 2EDLA 4HBCL 5I1HL 2FGLA 1VDGA 1ACZA 1Y6NR 3Q3GA 5CZVH 3K81A 5FV2A 1RMFL 4XZUA 5BYWA 5LA0A 1E6JH 1H15B 3UBXB 3AC0A 2VO5A 1MLBB 1S9VA 4Q0XL 4UOW1 25C8L 4PB0H 1TPXC 3EAKA 1U8MA 1JDCA 1RH9A 1A5FH 3RVTD 4LCYB 3PXJA 4M6MH 5E4EC 3TN0B 3MLUL 3LEXB 1C16A 1CICD 2NY0D 3KS0H 4H2CA 3CK0L 4M8UA 3DYOA 4GJTB 3K3QA 1INDH 2XY1A 2OL3H 5FB8A 4U1KB 4EOWH 3GEWB 1OQOA 4OOZA 1BP3B 2XVPA 4D8PB 1V0LA 4FNUA 3LKSA 4U1NA 3VXME 3WJLC 2ZSVB 1CF8H 5E8PA 4QXUL 3ZSSA 1ZL1A 4HUVA 2VXSL 4UUJA 4NSKB 3ZYIA 4Y8AA 4Y5YC 2UY6A 3K1KC 4P2RB 4EBQH 2R0ZL 3RRQA 2JB6B 4XP5H 5DFTA 4ML4A 3WS3B 1E6QM 3IGUA 4ORGB 4OLWH 2HVKA 5EBAA 3IJ7A 2OJZH 3WXVH 4OSUL 4IJ3C 2HA1A 1GOKA 4YGVA 3IU4L 1BF2A 3L7EB 1X7QB 4KMLB 4DZ8A 3ULVH 3FO2B 3L3HB 5JW3L 5DQJA 4N8PA 4EXKA 4KMTL 3U4AA 1DBAH 4AMWA 4KMQA 4P2RE 4MJIB 2H41A 1JV5A 3H53A 2DJ4A 4AW7A 4URIA 2K9UA 1KJMA 4GI9A 4G80B 3MLTB 3BO8A 3DETC 1LWRA 4YO0A 5DJCB 3DURB 1Z0NA 3QXAB 2A3BA 2E7BA 3TBWA 2QADB 2AGJL 4GBXA 1BFOA 1K4DB 2YZ1A 3JV5A 2Z93B 3OXSB 3VWKD 4F7TA 1IILE 3ZT5A 1FFNB 4JO1H 3DARA 3EOBA 4TVPL 1LD9A 3G04B 3AIUA 1BX2A 3HS0A 4F15B 2H2PC 4MJIE 3KPSD 3MYZA 3I84A 2VC9A 1UB5B 2N1KA 1I7TA 2EDKA 4OD3H 4ODTL 4KRLB 1LE9B 3SKJH 4AEIH 5EBMA 1KGUA 4Y1AD 2CUMA 4C83A 1QFUH 2ICWJ 1OARH 2DRUA 5EN2B 1CLZL 3O9WC 1EFQA 4Z8FH 3EJZC 4FQJH 5GS0C 3MA7B 2FYYA 1OWWA 3FN0L 4HPOL 2F8QA 1KTRL 3MJ7A 5CHNB 2EDXA 1MAML 4CN4A 4XH2B 3G6DL 1I1AD 1D6EA 4CGTA 5D8JL 1AO7D 1MH5A 3WXWL 3ALPA 5ENWB 5F3BA 1LGVA 2XPGB 5DD3H 1UYWH 3MROB 5IR1A 3A3HA 1EV2E 1OVZA 1G7IB 4XP1H 3U0TB 3QCUH 2QQNL 2NT1A 3WFBH 4HKJB 5BRZA 2BFGA 3QNYB 4H04A 2PW1B 4MDJB 5E99L 5E2UL 5F7LB 2BNQB 3OKMA 4U1IB 4XHJC 4LSVH 5FYLE 2AQ2A 3RZCB 4AT6A 1HHIA 2CBVA 4M56A 5IHUH 2GFBA 3ZKXB 5J9PA 4FK9A 2WBJD 3QPXL 4MHHI 4U7MA 1CFNA 4GKSB 5E8OA 4LDEB 1K9FA 1BF8A 1KFAH 2C3VB 1T0MA 3BD3A 5C07D 1ZGLM 1N8ZA 4JY6A 4J23A 3VRIA 4BM7A 4X7CC 2JJTA 3ARRA 4IRZH 3QZWB 3GSUA 2BNQE 1XSIA 4OZIA 2D7QA 1BZ7B 1NOWA 4IHOB 1CD1A 4N8CH 3ALWA 3QI9C 1XH0A 2VT0A 4I48A 3HG1B 4WFFD 4J8RA 2HVJA 4OZ4A 4UTFA 3WL1A 5A2AA 3MANA 4DZBB 4PJ9B 3O2WH 3PP3H 3AFBA 4JL2A 2PYED 3E8UH 1GOOA 1DUZA 3VFVB 5HTSA 5KVFH 4I1NB 5EPMA 4CVXB 1Z0MA 2B31A 4TRPH 4YIQA 1VGEH 3D39D 1TQCB 2P5EB 4KJYA 1TVPA 4AENA 2RCSH 3V4PL 3HG1E 2DQEL 4F7CA 2JK5A 1BHGA 5GRVL 3QXDB 2EE3A 3VWJB 2X4QB 4L9LB 4XWOD 1SFSA 3THDA 4N1EA 4C4KT 2DJUA 5F9OH 1T83C 4HJGB 3VH8A 4Z7QE 1N26A 2B1AH 4G8GD 3BKML 1V7NL 4M5ZH 1GGCH 2ZCHL 3FY1A 4PMRA 1UACH 4PY7A 4JLRA 2P5EE 2HLFD 3U4BL 2YUZA 1NFIB 1TE1A 1MHHB 4MNGB 2H2PD 1GHRA 3BISA 2FH6A 3ROLB 3BQUB 4NT6A 4R4NC 4HFUL 4RX4A 2YXMA 1JF1A 4KGJA 2ADJA 5I1GH 4P99A 3PV6A 3PWLB 1L7IL 3FQUA 4EJ1C 4HK0A 5M03A 5MENB 2GJRA 2C1PB 4WEMB 1O5DT 2ERJC 4JQVA 4MNGE 1BBJB 4WW2F 1JFQH 1JGLL 3NGBC 2R1XB 2D4FA 4UDTB 3L3KB 3A67H 3V0AC 2BHYA 1EA9C 2IADB 3ARDC 4FFVC 5DJXB 3CUJA 3QDJD 3WQ5A 2OXGA 4PYGA 5JBFA 2QMJA 1TZHB 2YN5A 1AJ7L 3IAQA 4KK5D 5GGUB 4HCRH 3WHE0 5MI0B 1KR1A 4N0UB 5FUOL 4OZHA 4IM4A 2X70A 1RIHH 4UB0H 3REWB 1RFDH 5MENE 1IFHL 5D9SB 4XHJD 3CSYB 4UAOB 4KC3B 2P49B 5F96H 1G7PB 3NFNA 1VESA 4LASH 4F57H 4NQSB 1SM3H 4OFKA 3ZYOA 2Z8SA 4EI5A 2PO6B 3AZSA 3BYTA 3LKOA 4D6FA 4PJCA 4J7RA 2CLVA 3CH9A 1N3NA 4Y4KC 1KENH 1HQ4A 1WIUA 2OCFD 3BE1H 4HA4A 2JALA 1P6WA 4QHMB 4XUYA 5T1LA 2V7HB 1QVOA 4N0UE 4JHWL 2NNAA 4Y5XC 1X5LA 5DRWB 3OHXB 2Q8BH 1V3MA 1DWAM 2FATH 4YHYC 1V3IA 2X8RA 3QUZA 4ZD3L 3QI9D 2I5YL 4JHZA 3UDWA 4Y19D 4U3XA 5F7MC 2RIKA 1NEUA 3EFFA 4KHTL 4WTWA 4KZDH 3L5WB 2NXYC 3MODL 4NN7B 4AZ5A 3K4ZA 2YKKA 1N2RA 2KQMA 1HE7A 3H9SB 2EO9A 1Q9WA 1UR9A 3QNXA 4F7EB 1D5IL 2BJML 2R2EB 3W9DA 1ODUA 4NDMB 1S8DB 2J8UA 1WICA 4XMLL 3VFNB 3CSBA 4OUEA 3GJFH 5CBAB 5ALBH 1MFNA 2QSCH 3AXIA 4NOBA 1KWGA 1J1PL 35C8L 4JRXA 43CAA 1J1OH 3IDJA 1CGXA 5GSVB 1FNSH 5HGBA 3VFPA 3D87B 3WUZA 3KVQA 7A3HA 1XGUA 1K6QL 3F6LA 4TVPD 4PRDA 1UENA 5DTFA 2WBKA 5I75B 3H9SE 1RP9A 3BAEL 1EZVX 3PWVB 4QHNB 4DAGH 4OF6A 3MBEB 2AEPH 2CBUA 4HH9A 3RHWK 1U2CA 3LHPL 1NANI 4W8BA 3QUXB 3GSQA 2CDEB 4LPVA 1I1FA 5A2JH 1I75A 1NBQA 4Y4FA 2F74A 3F5WA 4L8CB 4B3LA 3GO1H 4QRPB 3C5JB 1RUPL 1FYTD 2CIIA 4GRWH 2LAAA 1GVIA 3FB6B 2AEQH 1DQLL 3HA0A 4F33B 4P7QA 2BVEA 1TZGH 1D6VH 4HTYA 1DWHM 1NCDH 4ZO8A 1T20A 3FXYA 2QKIB 4XB7A 4G6JH 3QO1B 5BV7C 1JL8A 2QSVA 4AD4A 3RNQB 4UV7H 3O4LD 4FQ2L 4NJ9H 4X9IA 3M8OL 1DQMH 3D2UA 1ACYL 5IMLA 4QRPE 4NWUH 3ARVA 3QG6A 3B9AA 3BLKA 3LZFH 1PD6A 4KVNL 3ARDD 2EKSB 5A8OA 1N64L 2OWCA 2EDEA 3LVEA 4QYOA 4NP4L 4X5LA 4OFPA 2BVYA 3WUWA 4WKHA 2UY5A 4FMVA 3OKOA 4JG1H 2QQLL 3G6AA 5A6SA 3L5XL 3MSGA 3H3BC 4DCQA 1N6QL 4DGVL 4WHDA 4PJGB 4YJZL 3BVUA 2VWEC 4W70A 1BJ1H 3DDGA 5FO7B 3VGAB 5JLZA 3TT1L 4FMFA 1CE1H 1B1YA 5GGVL 4HIHB 1AE6L 1IGJB 4PLJD 1QI4A 4KRPC 5DT7A 3QNZA 3OKKA 3HJEA 2AABH 4ATDA 3AFLA 1KIQA 4JFYB 4JFHE 1V03A 3ROOA 5E95B 1NDGB 1IAKB 4GBXC 4JREB 2O5ZH 4QRSA 4TSAL 4IOFD 3QUMA 5LGHH 5LAXB 4PJGE 4RNRB 3G08B 5JIHA 2YA1A 3SCMA 2QL1A 4ONGH 1BQLH 3FJTA 4AJ0A 4TYUA 1PX4A 5E8NB 3MLWL 5D7JA 2VX4A 3QEQA 1T1YB 3EOAB 2YLAA 5AYUH 2YRLA 4FQXB 2NXYD 4UV4L 1VFUA 4DEPB 5GZND 1E1FA 4ZUTA 4J4PD 5FA3A 2CRMA 3OZ9L 2F5AL 3H8NA 3W0WA 1T22A 1YPZA 1BECA 4LNVA 2HG5A 4MS8D 3TNNA 4O2FA 4U6VH 3GXNA 4NHCH 1T2JA 4NQDB 3OG4B 1RU9H 1JNDA 1P2CA 1BBDL 5DLMH 1T0NB 3GBMH 2X4UA 5HYIA 1WDPA 2WMFA 2G3IA 3M46A 3HMXL 1Q6GA 3LB6C 5BMFL 4PG9B 5CFHA 3ME0A 3IXAB 5EC2A 1QBLL 5TE7H 1GGIL 1TZIB 1RZJC 2R2BB 3VFMB 1LEKB 4LGSB 2Q8AH 4MX7B 3RX5A 1BFVL 4NQDE 5E2TH 5CD3B 4G9DA 1LK2A 2V2WB 3OR6B 5F88A 2GJZA 5F7UA 1B3XA 1NC4B 4JPIB 2ZXDA 1A7RH 4JR9L 1KTDB 2W07A 5L8JB 1BFTA 2ADFL 1DFBL 4K8RL 5A2BA 3GHEL 1VENA 2BY3A 4Y5VB 1EXPA 5I0ZA 4LXFA 1U93B 3ZJKA 3S96B 2JJTC 2CRYA 1FDLL 2PF0A 3BUYB 4JJHA 5JHLH 1WZ1L 2VMFA 3WLBB 3TNMA 3GMMB 4DGYL 5BXSA 4QCIB 4I77H 2EO1A 3DGCR 1UR0A 4EN3A 3GXFA 1UCBL 4LU5L 1DBJL 1PIGA 1NLBL 1HILB 2R56L 3MRHB 4OZFH 1R3HB 1VPOH 3GFUA 3SCVA 5GS1B 4X6DB 1ZLUK 4XXDB 4FXGB 3UZQA 2OR9L 1Q8MA 3L6FB 2NY4B 1OWRM 1VKXA 4MJ6B 4F7MB 3OGSA 1YDPB 5CZXD 2CGRH 1A6PA 1JRHL 5CS7A 5H94A 3VFSA 4MA1C 2QQKH 5KBNC 5D9MA 2ZXQA 4Q2ZB 2F5BH 2HN7B 3BVWA 5DURB 3BGAA 3FTGB 5SWZB 2PB1A 4X6DE 1OPGL 3FN9A 4XP6H 2L4OA 4S1QL 1OB1A 5T3ZH 5BW7A 3ISWA 4RGOL 2ICES 4P5KA 4PRHB 4WU5A 1RZIA 3KLDA 1N82A 5INCB 3CVIL 2CCRA 3WFLA 4UMGA 1TJIL 1NGQH 3RNKB 3LRMA 1TMQA 4M7ZC 4FZ8L 1KTLB 4HG4J 5DUBA 3OLGA 3VD3A 1DL7H 2ICEB 5SWZE 3TONA 4MAUL 4PJ7B 2NW3A 2R2CA 1M4KA 3KNBA 4OD1L 4FQLH 5HHVH 7TAAA 1S3KH 2VZSA 2C7FA 5LWYL 4PRHE 1YEEH 4UFKA 3ARFA 4YXHH 2ZNWA 4O2CA 1QSEE 2D7OA 1WAWA 1GZPA 2NY2D 1SBBA 3DMMA 4ZYKB 3RM9A 4JQVC 2AMGA 3QJFA 1I7RB 3WDHA 4K9EL 5HI3D 1GJUA 4JFTA 3AZTA 3WELA 3MGAA 1XYZA 4PJ7E 1Q9OA 4F79A 4IISA 4XX6A 3RTQA 1UZ8B 3S5LA 3ZO0A 4GZEA 4KJQD 1KJVA 2VUOA 2XSAA 4GG8A 1B4JH 8A3HA 2Z8RA 2GSGB 4G8FB 3RWEB 3TH2T 3L3JB 2AW2A 1CLYH 4PFEA 4XTRC 4U1SA 1IL1A 1YN7B 4PJDA 4ODWA 1O6IA 5J3HD 5EOQH 5GNZA 3C09B 3QCVL 1Z9SA 4J2XA 1CWYA 1HDMB 4M6ML 2GK1B 1B90A 3U7WH 5I6XB 5IFTA 3T2OA 2NY5L 1UZ6E 2J8HA 4G9FB 1INDL 1A7PH 3O2DA 4GSDH 4M29A 2Q1EA 3D51A 4ZUSA 3K1DA 3O3DA 3QPQC 3KPPA 3AS0A 3UTSB 4YPGB 3O8XA 5MEOA 1KCRH 3AMLA 4K55A 3L4VA 3AHXA 5BRQA 4ORZC 5F9JA 3QUZC 4PJ8B 3OGCA 3GRWH 5D7KD 2Z9TA 4M1RA 1BVKB 3UDWC 2YSSA 2ZG1A 2Y06H 4KK6C 2IH1A 1QO3B 4M48H 5J89A 1FH5H 1HINH 2FJHA 5JHDA 5C09A 4EBQL 4G9FE 1U8QB 4LARL 4XP5L 2ZIDA 1WBXA 4AWEA 4AIZB 2AXGB 2YEZB 4XRCB 4V28A 3VE0B 2OJZL 1YY8A 2HJFA 1NAMA 3V5HB 1ZT7A 5IHSA 1EDQA 4OM0H 3BRFA 2VCBA 4ZUUB 3V5DB 2DL9A 4PTTA 4UQ3A 2XWTB 2JKXA 1JZ7A 3RUGB 3T8XA 2X4OA 2B1HH 2HT3C 4B15A 1WWWX 3K2MC 4YK4B 5TH2B 2JF1A 4HAFA 3HE7B 5H35A 4I9WD 1F5WA 3K0WA 4XCCH 1MVUB 1GAFH 4X6EA 1REIA 4MXQC 3MJGX 3RWIB 3GNOA 3ECBA 5DGRA 5ISZD 3C5SB 3RPKA 3BH8A 1DE4A 1I8LA 2CMRH 5A8NA 5HHNB 2YR3A 3MI6A 3PWPB 1F3JB 3RUGE 4X0VA 4Y4FC 4HIIB 4C56D 1QRKA 1QFHA 1G7JB 1IEHA 3IDXL 2K7PA 4G7VH 5E1AB 3JV4B 3HUJA 3WHE1 4Q6YA 1AXTH 4NFCA 4KI1A 5TE4H 4PMOA 1ISVA 4YHGA 4MJ5B 1E43A 4PD4K 4PJ5B 4OD2B 4TVUA 3B4NA 4MXVE 2XA8H 2BNRD 4AEIL 5HVWA 5KSAA 2WLZA 3WUGA 2OQJA 4JAMA 5DUML 1QFUL 1OARL 3CZSA 4HP5A 5HBBA 4YHNA 5CEZH 4OCRH 3MRDA 3PWPE 4Z8FL 4FQJL 1ADQH 5FUCC 5ESQA 4Z76B 4BKLB 4PIRF 1OWQA 4YXLL 4AL8L 5JPMB 4PMNA 4PJ5E 1EEYB 3L3OB 3D3VA 4R3SB 1UYWL 4XTRD 4U7KA 5F7EH 5C9KA 1C12A 2UY7A 2QSQA 3WFBL 4TXEA 1DQQB 4JZJA 4LSVL 3CFKB 2XN0A 1MXGA 3CFJB 3PGCB 3I75B 4X9GA 3KZSA 3PWNA 4D9RD 1MNUL 3WEOA 3DXAD 4UINL 4LNRA 1YNTB 1ZLVK 4XNQB 4YR6A 5L2JA 3GGWB 1R3IH 4PMDA 5ECUA 4ZENA 5JXAL 1MJUH 1MVYA 3CDGA 5CD5C 2VABA 3SKOB 2UY2A 4Z7VB 3BUTA 3SCMC 4IRZL 4BQBA 3F7VA 4V2XA 3IU3B 3ARED 5E09A 3HCVA 5ANMA 5CPQA 1RUAH 1DQTA 1I7UB 3NJ3A 4N8CL 1W9PA 5D7JC 5C08A 4MCYA 3HB3D 4ZFFB 1KJ2A 4D9QD 2O61A 1E4MM 4PBXA 3GSNA 4AD5A 4CU6A 2EYRB 4XCFH 3H7BA 3ILQD 3KPQB 1LILA 3QHFL 3IGAB 1N0XH 1XFPA 3WNMA 1US3A 2NY3C 3VRJB 3AB0B 2GUOA 4Z7VE 5F9AC 4WWKB 5D6CB 4P23A 3LS5H 3G9VA 3E3QE 3KLLA 1U41A 1RUKH 5AZ2L 4TRPL 1CE6A 1N7MH 1VGEL 2FBJL 4YWGL 1ZVHA 4PJAB 4WUKL 2EKJA 4X8JB 1MCQA 2VL4A 3MJ8A 2DM4A 2OYPA 1NGYB 1A7BA 4EUPG 1SQ2N 2OTWB 1C5DB 2ZKHL 3SDCA 3WN5B 4MXQD 1F58H 5B39B 3IT8D 5EU3A 2GKIA 2J6EA 2B1AL 5FYKH 3SCOA 1D2KA 4M5ZL 1GGCL 2R1WA 2F8OA 3PHOB 1FFOB 3FT4B 5E2VH 5DQ9B 1HNFA 4OCMC 4PJAE 4Y0GA 4NO3B 4S3JA 1BYBA 2EZ0C 4HLZH 3TBYA 5EZOH 2Y5EA 2XWBB 3HI1B 3SDAC 3B6SB 2N7BA 5EWIL 2BVOB 4L4TB 4PTUA 1A8JH 4QRUB 4TN9A 1LO5B 1WEJH 1CG9A 4EN3C 1JNHB 3LRKA 3O45A 4OV5A 2X89A 2DQTH 3TGXA 2XA3A 4D72A 1JFQL 3U30B 5T1KB 1JHLH 4HQQH 1VGKA 1WFTA 1E4XH 2Q7NA 4CMMB 4WGVB 1E4KA 1PPIA 3U5YA 2CRZA 1JGEB 2X0HA 1A64A 1OAXL 4L4TE 1GUVA 2OSXA 2BC4A 1JNEA 4HHAA 2P5WA 5FK9A 2XFYA 5HPMA 3UTTD 4UQ2B 2BVTA 4LLWA 4P8XA 3LMYA 1VSCA 1RFDL 2YD9A 1A6ZA 5HYQB 2X05A 5F96L 5C2BH 5HYJD 4TNVK 1GNXA 4LASL 3KXFA 4HK3N 4QXGL 1YY9C 1DR9A 3V4UH 1MY5A 4MNJA 1EAPA 2AK4D 2AV7B 1KENL 3C9NB 2Z31B 3P9MB 2MQ3A 1RULL 4AMXA 4RCAA 4ENEC 4NZTL 4PGEB 3HRZA 4GRLD 4K3JH 1CENA 4X80L 2IJ0C 5H37H 2G60H 1JWUA 2Q8BL 3T0WA 2XN9A 1DTUA 2FATL 3BZFA 5DK0B 1HHJB 1VADA 3LSOA 4KV5E 4LYRA 3ULVD 1IAIH 5HVHB 5EU4B 4ELMA 3GXTA 1X5JA 1F45A 1GIGH 2G9HA 4BH8A 1U6AH 5A3HA 1NBYB 1I8KB 4KZDL 1KT2A 5FGRA 3ARFC 4GXVL 2ZCKH 4KROD 5JNYA 4IMKA 2HMIC 4M93B 4P2OB 3DMMC 4OTXH 1RAMA 5T1DL 4XB3A 1ZWIA 1KB5L 1P7KA 2EDYA 1JPTL 4HJJH 4XAWH 3OG2A 1I9EA 3CDFA 2BY0A 3L3GB 5I24A 4IIQA 1C5CH 5DWUH 4HZ6A 1JGUH 5FA4B 2QSCL 3OPZH 4P5TA 3RTQC 1J1OL 4NPYB 5ERWB 5IVZA 4TVSa 5GZOD 3MRIA 1Q0XL 1LO2H 5GS3A 5FHAH 5ITFA 1KCUH 1XT5A 4TTUA 1S9WA 4S3KA 1WFUA 5K9KA 4HEME 3RL2B 1WWCA 4Q7NA 5J6HA 3C8DA 1DSFH 4OLYH 1OCWL 3U6RA 2ZUQB 4ZFGL 5IFAH 3RVUD 5F1IA 2R9HD 3ETBF 3RWDB 3RIAF 5C6TH 2GUYA 4N5EC 3SPVA 5T1MA 3CHDA 1W1VA 3GO1L 2IAMB 4PRID 2YD1A 5EUOA 1BIHA 5E0CA 2AEQL 3SDAD 3R06A 5MP6L 1TZGL 4U6XA 3ARBC 3IRPX 3O8XC 4CCDA 3RWGA 4CVWA 1L0YA 4G6JL 1KLUA 1F6AA 2VXTL 1NQ6A 2FJGA 3WEZA 1AXSB 5C86A 5BVJB 3NABH 5IT2H 1FH9A 4ERSL 1U91B 3E1F1 2HT4D 4MTVA 3P4OB 1GJWA 3M1BA 4JKKA 4NWUL 5IWLA 1I3GL 4OZFG 2H3NA 2NY7H 1JK8A 3LZFL 1FZJB 4MDIA 5J6GB 1NMBL 1KXQA 3O2VL 4YXKL 4JN2A 3VCLA 4EZMA 1KELL 2J8GA 1FL5B 1S7TA 5ILTL 1ED3B 5IEHA 3SE3C 1C1EH 2XWDA 1H0DA 3S7GA 4R8WL 5A16B 3OJVC 3BUBA 4X4ME 1P7QD 4ALAH 3FRPG 2MCG1 1NWSA 2YPLA 3AM8A 4ZUVB 3N9GL 5KVGH 1OSZB 1U8JB 3FHQA 4BQ5A 3RP1A 1CE1L 1NFDA 4GKNB 5E2JA 3TO2A 4ODUB 2AJ3A 3RY5A 1U3JA 5D7IB 3QO0B 1I8LC 2D0GA 2A3CA 3MRKB 3JZ7A 4Q58C 5IB4B 3T09A 2O9OA 1H3WM 3MOQA 4LKXA 3ULUE 1BVZA 2H32B 1TQBC 1OD9A 5FYJL 1GORA 2Z92B 3HPLA 4I18A 3WFCH 4RGND 3O81A 3HAEB 5E9DD 2C4XA 5D7IE 5KSAC 4G8EB 3BP5A 2D03H 1IV8A 2DYPD 4TPRL 2HMID 2GHWB 5I17A 5L2KB 1ZHKB 3DTXB 4HS6B 3I3DA 4U6TA 4DWSC 4S2SA 4U6VL 4NHCL 2VQ1B 1RZGB 1MCLA 4GUPB 4OJYA 2IPTH 5CJQH 4IOIA 1XGQB 3OKLB 3SE8H 2J7BA 1ZA3B 5GIRB 1U95B 3S88H 2QLYA 1G9MC 5I5RA 4EIZC 5EU6B 5CEYB 4JN1H 4D0DA 5IF0A 4JFEA 3CFEA 1ZTXH 3IAPA 2EAEA 5B21A 5L2KE 5TE7L 3G5XB 5KVEH 1TJGL 2ADGA 4PJIF 3UTPD 1NAKH 4YBLC 3T2NL 1QW9A 5AG8A 1AD0A 4DK6A 2Q8AL 1TPXB 4JZJC 4JZOB 5T5FH 4O02H 1YEKL 2JELH 4XMPH 5CMAB 1JTOA 4B0MM 1D5ZB 1A7RL 3EO1A 1DBMH 2HJKB 5EU6E 4FQHB 3MTRA 4WO4C 4B50A 3TM6A 2DM3A 4G42B 4O2EB 4BSVA 5C0JA 4KTYA 4RRPA 1HT6A 4E42B 3CH1A 3ARBD 1G7MA 2H6PA 5DS8B 3LKNA 4AZIA 2NSXA 3DX4A 2V2TA 5CUSH 1AKJB 5JHLL 4I0PA 1QRND 2ALWA 3N1PC 3RA7H 4JFFB 4LEOB 5AC4A 3D4ZA 2AI0H 4D1JA 1DBBH 1LEGB 4MVBC 2FL5A 2DAVA 1J9CT 2XN2A 1QFWM 5IB5A 2V7NA 4YHZH 4JZNA 3V6OA 5LA1A 1IKNA 3QCTL 2WC7A 2Q76B 3IKCB 5BQ7B 3MR9B 3MRQB 1WLHA 2WANA 4Q9RL 3A4WA 4OZGF 4P23C 1RURL 2VXUH 1RJLB 1VACB 1AHWA 3VXUB 9CGTA 2DT0A 2CGRL 4DO6A 4JFFE 2GI7A 4PJBB 4R97C 4N9GB 3WDRA 1JAKA 1J0KA 1G7LB 2AOSA 3TZVA 1PZ3A 4YHMH 4YEEA 1BIIB 3UTZA 3QWRD 1UM4H 1F02I 2C3XA 3SDCC 3STZB 3RL1A 3TVMA 3M17B 3VIHA 5C0CA 1EZVY 1T1WB 1IGMH 2C9AA 4WF7A 3BW9B 1U36A 1AGFA 4QGTA 2BP3A 3V6ZB 3VXUE 1XSKA 4PJBE 1ZANH 1JTTA 3I3EA 5I79A 1NGQL 2BK8A 3VIPA 4P8WA 3UYPA 4D2NA 3DRQB 5FM4A 4HUXA 1UA6L 3RWCB 3UMTA 4QRRD 1DL7L 3PABB 3OR7B 2EC8A 3MU7A 4U1JA 3I50L 3V95A 2BCKB 3EOYG 4FQLL 5DMGC 3MV7A 1W91A 3FQXA 1PZ5B 4P57A 4U1GC 5JDSA 4F3FB 1Z5LA 3WFDL 4IS6B 4OUOA 2F1BA 2NCMA 4UFJA 1YEEL 2D0HA 1UXWB 3O0RH 4LSQL 4PRBB 3ARGA 4ODVL 5DZOA 3O9WB 5CJ5A 2WYSA 4AH2A 3FT3B 1K9TA 4DWSD 1ORQB 3A6BL 4LVOC 5DZLA 4X7TB 5F7KC 3T0VA 1UD6A 4LYPA 2PWEA 5DJDA 2WUBH 2NZ9D 1RZKL 4RAUA 3SDXF 1R86A 4QHKI 5DJ6A 2JIXA 5ICZA 3V0WH 3QDAA 3O6FD 5FYLH 2YD5A 4PBGA 5KSBB 1E4KC 4DVRH 3P9LB 4APQB 2RHEA 4JPVL 4WJXA 1B3JA 1UUQA 1K9DA 2CD0A 3FAWA 5FDWB 3HNSH 2ZUVA 2J7FA 4XB8A 2B4CH 2FZ3B 2O5YL 4HGWA 3QQ3A 4R6UA 2W60A 2CITA 1SVZA 1UR2A 1HH9B 1XR9B 2GJXA 1NC2A 1F4XH 1S5HA 5IJVB 3B9KA 1MJ7H 3IDGB 5KSBE 4WO4D 3LKRA 1A7PL 4GSDL 8CGTA 4ZE4A 1NGZA 5AD0B 2JB5L 3LY6A 4OGZA 1N5AB 3MMDA 1QZ1A 4MNQD 5HJ3B 3KWWB 1JFXA 4JHBA 1WITA 2XWJB 4L3EA 1T1ZA 1D9KD 2VUYA 4HV8B 5DJ0A 3I6GB 3MS8A 3B9DA 1ES0B 3DGGA 4M48L 1CFSB 3CV5A 3S5ZA 4D6JA 4YDVA 5C6PB 2Y07H 4TSBL 1YJDH 2D4DA 4KTEH 4IMKC 1MFDH 3A5VA 5GNYA 5EU5B 3MXVH 4YFDB 3EBAA 3ABZA 1XGTA 2PWHA 4JFZH 5F70A 3W39A 5ICYB 3IXTB 4TUJB 2VKXA 3DVGA 3S6TA 4OM0L 3QDMB 2OJEA 1U3ZA 2FWOA 1HEZA 2W92A 5EZJB 2W9DH 4J12A 1QWUA 3IFNH 2B1HL 1ODZA 5DDHB 3LEVL 4P5TC 1OP5K 1BGAA 4UQCA 5K93A 4WW2A 2FYVA 4QTHA 3C5ZA 2FECI 2A6KA 2XIDA 1FHLA 3RWFA 1UVQA 3U7YL 3KJ4C 4HXBH 4FN0A 2CIKB 2XTKA 1K5NA 3DX6B 3WN6A 3QDME 1OD8A 2CMRL 1HHKB 3LV3B 5KZCB 2UWFA 4UTBH 1T03L 4RSVA 5A6AA 3VIKA 2FDMA 4MJ4A 3A4XA 4MD5B 3MGTB 1S7WA 5DVLA 1HIMH 4G7VL 4HLZG 3ZQ9A 5GNXA 1AXTL 2XXCB 2A83A 1G9NH 1M7IA 1MVFA 4ZDHA 2XA8L 3ZDYF 2ITDB 5JUEH 1MWAH 2MMXA 1FV1A 4CNIA 3IJ8A 1HJXA 3QULA 3K46A 1TG7A 1ADQL 2MQCA 2ERJB 2WNWA 4WI2A 1NDMB 3NGBB 1KF9B 1H3TA 1I3RB 3VXSA 1R3KA 5HYSB 4Z5RB 3OB0K 5C0GA 1UT9A 2ZPKH 1GOIA 4F9DA 2VXQH 3UTQB 2VR5A 2WHLA 2I9LB 3MGOB 3VMNA 2GITB 4X9BA 3MC0A 1G0XA 1PY9A 3V0VA 2NX5B 5F7EL 3SJVA 3BGMB 4FABL 2P24B 4F9JA 2F54D 2ESVB 3AM8C 3NACH 2X2JA 3STLB 3BN9C 3KL3A 4JGJA 1FL3A 1ONQA 3QRGH 5CSZB 4YHLH 1UD5A 5HSFA 3NFPB 1BOGA 1DQJB 3NCOA 4L4VD 4Y4KB 4AEEA 4FFZH 4NO0D 4QWWD 1R7AA 4G8IA 1R3IL 4XCEA 4HZAA 1AI1H 1WZAA 1MJUL 1GOHA 1SYSB 4Y5XB 2NX5E 3CCHA 4WEUD 5EO0B 5E7FA 5H37G 2ESVE 3SUWA 2FIRT 4CADB 3HMXA 4DKEL 4PPTA 1PX8A 1I4FB 4H1LB 2A73B 4QXTB 2IBZX 3RIKA 4ZE5A 1QR4A 2F8XC 1QLFA 3U0WL 2MKWA 3O6LL 3BPOC 4XPHH 4UNVA 4M4PA 4WJ5A 4XCFL 1HQRB 5FUZH 3EJJX 1E73M 2Z35A 1KPVA 1PAMA 2BX5A 3C6SB 2JF7A 2HKFL 2VE6A 5T3ZD 3TO4A 1O0VA 3VGEA 4G6FB 5EDXA 3EYOA 1RUKL 5E03A 4ELKA 3MXWH 5KG9A 4NM8H 3P11H 5B3JF 3UYRL 1H5BA 1FGNL 2A9MH 2MQ0A 3Q3GB 4YHKL 2Y5TA 5E6ZA 1DQDL 2ZOKA 3VXRA 5KW9H 3O6KL 3B2VH 4XNXL 3EJUA 4P4RB 1F58L 5L8KB 1S9VB 2IFGA 2F19L 2OMBA 3NZ8A 3MLPA 4E2OA 1U8MB 3EFDL 5SV4A 4KTDL 4POUB 1C08A 1C16B 5F7FA 3QJHA 5E2VL 2C4FT 1H3VA 1KXTA 1XV8A 4NQCD 1S7UA 2Y25A 2APFA 1YNKL 2YD7A 2CK0L 5FB8B 4NIKB 3BEVB 4CD8A 2CUHA 1CS6A 1W3JA 3ARZA 1S7XA 1FSKC 5J1TC 3LKSB 5E1QA 4U1NB 4IRSA 1LO4H 2ZWLT 4MQSB 5CGTA 5E8PB 1ZGLP 4I0PC 5BV7B 1LJYA 3U1SH 5IVOA 4HUVB 1T3FB 4UUJB 5AUMA 5GGTH 5HDOA 3UJIL 1WEJL 5IVNA 4KDWA 4AZGA 2VLME 2DQTL 4M8VA 1JHLL 4JVWA 2DM7A 2HVKB 1IKNC 1E4XL 4JKWA 2V3DA 2XKSA 4YGVB 4DZ8B 1MLBA 3BPNB 1JGDA 3HZYA 4CU8A 1AHWC 5IHZA 3MACH 3TN0A 2LE9A 2DGAA 1XCXA 1BEYL 1K8IB 1MCFA 1JV5B 3TZVC 1DANT 1FORH 1KN4L 4CL7A 4NF7A 5E24E 5GGQH 1KJMB 4H41A 2E6QA 1FNAA 1WWAX 1Q94A 3IDIA 3RJQB 3V4UL 3TVMC 3QUKA 4XC3H 3NTCH 5FIPA 3BO8B 2DDXA 1IC5H 4YO0B 4KRPB 4OLVL 2JCCF 1PDKA 5B4MD 2PWFA 3AIQA 2PNDA 1IM9A 2VAJA 1NWTA 2BSRA 4GBXB 1A9BA 1BFOB 4K3JL 4MA7H 1WDSA 1QOXA 4F7TB 1T04A 4XAKD 4LK4A 4PTMA 3EOBB 1LD9B 4RGMB 4HUWA 1BX2B 4AZ7A 2IBBA 1R75A 4W4NA 3SDDA 4AD1A 2PXYA 1I7TB 2YUVA 1B0GA 5DQDH 5JW5A 3LX9A 1TVDA 4OV6F 2UUDK 4U33A 2MNUA 1OGAD 2MHAA 4H88L 1GIGL 3RWJA 5EBMB 1U6AL 4DFIA 1VAHA 4C83B 4B16A 3FO2A 3L3HA 3UC0H 2VDOH 4JM2B 3ARGC 1B0IA 5JQ6H 4AIUA 4O51A 1CLXA 1M6OA 4R0LA 4FNQA 1BFSA 2FYYB 3FRUA 1R3JA 4OTXL 1A7NH 3MJ7B 1U8PB 4YDKH 4MJIA 3F7QA 1S9XA 4RDQG 5EULV 3IK2A 4O58L 1D6EB 1E4WL 3ZHLA 5DWUL 4NNPL 1MH5B 4NZDA 1JGUL 4DTGL 1JYNA 5F3BB 1FN4A 3OPZL 1M71A 3PQYA 5IR1B 1LO2L 4LLDA 5FHAL 4PMXA 3DRTA 2F53A 1ROWA 2M8XA 1OLZA 3UPAA 5TD4A 5BRZB 2XGBA 1SBSH 2DDQH 2WWDA 5IK3A 3AISA 4XPTL 4AT6B 1GVYA 1HHIB 3UBXG 1GGBH 3VRLE 3L4TA 3AHTA 4ODXA 4NYLA 2RAMA 2AJXL 3B9KC 4MB4A 4GW5A 4U0RB 5CEZD 4C7GA 1YEGH 1CFNB 2ICWI 4LP5A 5E8OB 1T0MB 4MA3A 1A3HA 4JY6B 2J5LC 5BRZE 4LAJH 2W0PA 3GSUB 1R5IA 4AY1A 4OZIB 4Z7UF 1A9EA 2IQ9H 4AEHH 3RI5K 2DT3A 4WHCA 2CNCA 5IT2L 4NKQB 2D7PA 5A3IC 4EKXA 4I48B 1U8LA 4J8RB 5ENWA 2HVJB 2M26A 4OZ4B 4JFPA 1XGRB 2XTJD 4ZTOH 4DO5A 1EFXA 4IPNB 5D7LD 3U5UA 4LFHG 2YN3A 2PW1A 4MDJA 5EPMB 3RZCA 4OZIE 1C1EL 5DT1L 4XBPA 4YIQB 4KJYB 3WIHA 2GW5A 4AENB 3SCTA 4MA1B 3BLBA 3AI0A 3EYVB 3FB7A 1IAII 4DOHB 4F7CB 4WW2C 2JK5B 3S35H 4J3WA 4M9PA 1FH8A 5DJ2B 4L3AA 2QEJA 4JJ5A 4L3CA 5I19H 2NY6D 4ZTPH 2FLRT 3VH8B 5DJAA 1TETH 4GLRI 2IXUA 5I71C 3AXXA 3DHMA 4PRPA 4XZBA 5I8CB 4IHOA 3O3EA 3BIKA 4PY7B 3TA3D 4JLRB 1QPXA 4KVCH 4M7ZB 1PZ2A 4DOHE 2HFGH 4NT6B 4HWBL 3OLEA 2O26U 4ZPTA 3MRMA 1GH7A 3APGA 1MQKL 3HR6A 1R34A 3PV6B 2DQIL 1IZJA 1XIWD 4PYSA 3VFVA 3FQUB 2VRJA 4W86A 3HG2A 4MQXC 4HK0B 3S36X 3M6DA 3SGEH 3SCUA 1JGVL 3VI3F 2DQXA 3LIZL 1CDHA 4UQBA 2ED9A 5CJQL 2YDQA 3OZPA 3DSFH 4OI9A 4KI5C 5C0BA 5LCVH 3S88L 5FYKD 5I18H 2ZCLL 1TTFA 1E40A 5C0IA 4LOUD 5D2LF 2VH5L 1N0LA 4OZHB 2X70B 2ZX7A 5KVEL 3QDGA 1IEBB 2I60H 3KYOA 3NFNB 5D71H 4ZO7A 1HVQA 4LLAA 4O02L 5GRJL 3EDKA 2ID5A 4X4XB 2JELL 4XMPL 4EI5B 5D96C 3KL0A 3JWDH 4L8BB 4PJCB 2CLVB 3FB5A 1HQ4B 2UVFA 1DLHA 4E0RA 3QFJD 1QVOB 1UM6H 4OZHE 3D50A 3KPLA 3C60B 3WMCA 3OX8A 1MI5D 3PE9A 3N0PB 5AWNH 2JE8A 4F2MA 1BBJA 3QG7H 4TX8A 2IBGA 1F6LL 2DI8A 3L3KA 1LLOA 4BQ8A 4MGXA 1AR1C 4R90L 3RA7L 3QZWG 3HU7A 3CZFA 2AI0L 5JZ7C 1TZHA 3EFFB 4PJCE 5JOFA 3KPRB 3SQOL 1N2RB 3RIFF 5HXMA 2XQBL 1Q9WB 4N0UA 1RHFA 5EO9B 2W1NA 3QNXB 1UD3A 5D1QA 5CILH 4OI8A 4M80A 3PWUA 4QY8A 1CECA 2J8UB 2FNBA 3TO4C 1EGZA 4K8RC 4K71C 4RL3A 3WQWA 3SCRA 1MCBA 3EYQC 2D73A 4JRXB 43CAB 3IDJB 5ABHA 4HS8H 5CBEB 1H5BC 4C7FA 1NCCH 3WSUA 3VFPB 3UR8A 4OBRA 3KPRE 1XGUB 1T21A 2VLKD 5DTFB 4YHML 1AH1A 4RFOH 1UM4L 2BVPB 2WWMD 4PREA 5EBWA 4YDIL 2BNJA 2R0WH 4HH9B 4UTAH 1UJ3C 3DHJA 1IGML 3GSQB 4E41D 2XIBA 3OAUL 5CEXA 2J8UE 3NA9H 5DF0A 3KPOA 4UBDD 2HT2D 4Y4FB 1KUMA 2F74B 4WI8A 3MA9H 1MFAH 3CUGA 3PZMA 1ZANL 4JRXE 3MUGA 2FX8H 5AC5A 3HN3A 1WZKA 2CIIB 2HTKC 4JPKL 3S2CA 4TOQA 1U8KA 3MQIA 1T20B 4IRSC 4QRQA 1G6RL 4NDMA 4AD2A 1MCPL 5ESVA 2Y8KA 3O0RL 5CKGA 4CU7A 4MQXD 3VFNA 3MRNA 4P8VA 3UBXI 3EGSA 1GOGA 3D2UB 5IMLB 3DV4A 1EDTA 3Q6GH 3WD3A 1NSNH 3C8KB 4I2XB 4M7JH 5F7WC 5TDPA 1P4IH 3QXUA 3V0WL 4KI5D 1FAKT 2AKRA 1T66C 1CL7H 3TV3L 3U4EA 2QPSA 1CCZA 1HIZA 3MBEA 2VN7A 1FVCB 3WUWB 3Q0HA 2OXHA 2DSVA 3OKOB 2LFGA 3QUXA 3G6AB 2F9BT 5I1IL 1NOFA 1JPFA 3TN0C 2A0LC 1MPAL 3HNSL 1OF2A 6TAAA 5IESL 2EXOA 2B4CL 5FUCE 4NQVA 5JLZB 1TJHH 4I2XE 3FQNA 4OKVA 1YMMD 5JXED 4JRYA 2W9EH 4M43H 5LBSH 3SY0A 1MJ7L 4FG6C 3KHQA 3QNZB 1E0OB 3OKKB 5KTEH 1KIQB 2WVVA 1KB5A 3ROOB 4WI7A 2CJUL 4I4WB 2VZUA 4QRSB 3QUMB 1T2QH 5GHWH 1CGYA 2P44B 3ZE0E 3GJFA 4FA8A 4AZ6A 2AJVH 2X9YA 2PXYC 5EORH 3GH7A 1A0QH 2OYMA 3HMWH 1YYMH 3QEQB 4M02A 1GQIA 1LL6A 2Y07L 3INUL 4UNIA 4ZUTB 4H0GA 1T22B 1YPZB 5J11B 1L0QA 3MXVL 1A6UH 4HUUA 4NKIL 1KR0A 2HG5B 3TNNB 4O2FB 3BN3B 2NY3B 4M5YL 4LSSH 1JNNH 1T5WA 1OT2A 4URTB 3VU2A 1OTUC 3WJJA 2NY5C 4PTWA 5IBLC 3EJRA 3OIHA 5JW4N 1C92A 3EYQD 2X4UB 3IFNL 1QLEH 3JV0A 3QEQE 4X6FA 3STBA 1N4XH 1IBGH 5D72L 1CGVA 2IUZA 4RBPK 3WE6A 3IYLW 1TFVA 5EC2B 1CVSC 1YPZE 2QADC 1FZKA 4OB5H 3PTKA 3CVHL 4HXBL 2ZJSH 3MRPA 3QEHA 2WB5A 4H7VA 3GM8A 3G08A 1E3ZA 2OZ4L 4G9DB 2WHMA 4JFOA 3CXDH 5F88B 2GJZB 3PHQA 4DUXA 1SEQH 4P3CH 1FHGA 4GAJH 2HTKD 4B5EA 1HIML 3LQAL 5JOPD 4B9ZA 2AJUL 5SX5K 5HOSA 5TE6H 3QIUD 4JB9L 4QEGA 1VFAA 3TNMB 1Y18B 3TIEA 1MWAL 3OB8A 4FFYL 1T0NA 4JO4H 4EN3B 2PR4H 5L6YH 4NFDA 4XNMB 1OP9A 3WMSA 3MO1A 3T4AA 5EZLA 1CNVA 1H8NA 1HCFX 1P5UA 4F58H 2R0KL 4YQXL 2FCBA 1WB0A 2ZPKL 3SCNA 1PBYA 1OAKL 2R2BA 3KYKH 3MFGB 3LH2H 1VKXB 3VXMD 2VLRA 3DC0A 3BC9A 5SX4H 2CUIA 5AZEH 3RZCC 1QSFA 1JUFA 1BGXH 4PJFF 2H2SC 5D70H 5T3XE 3SE9H 4G7YH 5H94B 5D9OA 3VFSB 3S36L 4X99A 2HKHH 3CFDA 3O41A 4NC0B 5C92A 2AJSH 2WIIA 2DPEA 3MNVA 1RVFL 1OB1B 5EZIH 4RISL 4YUEL 1LK3L 2DKUA 1W72H 2HLAA 3RZWA 4JGUA 1E72M 2DLHA 5DRXA 1KLFA 4WU5B 1RZIB 2CKBB 4H26A 4HKXA 5FDYA 4OM1L 4K3DH 4F37K 1AI1L 3NSXA 4O5LH 1WT5A 1ZLUH 3QIBA 4P2RD 1HILA 2H45A 5DUBB 2N56A 3B8YA 4LFHD 4WDIB 1B31A 3PNWA 5GS1A 1URLA 4X6DA 3KEHA 2NW3B 5DGQA 3KNBB 4EXPX 4GIAA 4X6BA 4UIKH 2FHCA 4RMUA 1T0OA 2EE9A 3ARFB 5DA0B 4GZJA 4O2CB 1GZPB 1KCKA 4JVUA 1TQCC 3DMMB 3BKJH 2AJZA 1I9IH 3NIFF 3QJFB 2P8LA 5MHSE 3WDJA 3FTGA 3FO9A 3MXWL 1Q9OB 5LQBH 1PQZA 4JFWA 3S5LB 3MSDA 5TPWL 1KJVB 4GG8B 1QP1A 1EHNA 2DLIA 2QADD 3EUUA 2G2RA 3B2VL 5I8EA 4OCXL 4P2QA 2F58L 4U1SB 3BD5A 1IL1B 1NCWL 4PJDB 3UAJD 2DQJH 4ODWB 4N5UA 4F80A 5IMKA 5E6IA 1RK1A 3CFBA 1CU4H 4GAGH 4UT7H 3QXWA 4HJ0C 4P2CG 1UWRA 3MBXH 1EO7A 3JWOH 5A8PA 2D1ZA 5IBUB 4Z7OE 4ZUSB 2E0PA 2FEDC 2WC4A 3O3DB 4JKMA 3ZDXF 3O8XB 5MEOB 3O11A 2VDPL 2BMKA 2CO6B 5FYLD 4PJDE 3L1OH 1Z3GL 1LO4L 3GM0A 4BH7A 3CFIC 1JZ4A 3EDJA 5J06A 3OGCB 1I7RA 3LQZA 2YSSB 2C1OA 5GGTL 2IH1B 5IB2A 2FJHB 5JHDB 4GMTH 5C09B 3WKMH 1WBXB 4WIQA 5F1NA 2E6JA 5SWSA 5MI0C 1E1EA 3Q6FA 4AISA 4HT1H 1YY8B 1WBYA 2HJFB 4HF5H 3NDYA 4JY5L 1NAMB 4XGZA 3T0DA 5D1QC 1LE5A 1ZT7B 1E56A 1YN7A 2BNQD 1WCBB 4BZ1H 4UAOC 1B2WH 1AIFA 4PTTB 3LPFA 4UQ3B 5KEZA 2H2SD 4DKAA 2VDMH 3N06B 3T8XB 2DT2A 2X4OB 4YZFE 4MNKA 2PO6C 3BAJA 5H35B 5JHDE 1KPUB 4Z7WF 5C09E 3TWCL 3U7AA 3ULUH 1C93A 3AICA 5GQBA 2NY0B 4C54A 1UG6A 4X6EB 3ECBB 3UTSA 2GFTA 3N17A 3K8LA 1MRFL 3BH8B 1MCNA 2LVCA 4G5ZH 2D7TH 4UOZA 5IB1A 5D93B 1UQSA 3D52A 2AEIT 1U58B 3P0YH 1XSJA 2EBNA 2WBGA 3HG1D 4PJIA 1DLFH 2IG2H 3T3MF 1UWGH 4K68A 3HUJB 4LSTH 4WEBH 5AAWA 2CESA 2NY1C 3EJPA 4NN7C 4PJ9D 1W3KA 4Z77A 2EEDA 2EXYD 5DQDL 2HFFA 4XRCA 5IVXF 3VE0A 5KSAB 1KV3A 2OQJB 4JAMB 5EOCJ 2CHNA 4YHNB 2XWTA 3HAEH 1OAQH 3MRDB 2P5ED 4KU1A 5T5NF 3P3YA 1A7NL 5ESQB 2XZAH 4RWYL 3NIDE 4YDKL 4XCYA 3VSTA 3HUJE 1EXUA 4BSJA 2BHZA 4YH6A 3ZR5A 5INDA 5FKAB 3VWJD 4E5XA 2E7MA 3A6CH 1I3UA 3NSNA 3MBEC 5E6YA 3D3VB 3RWIA 5F6IC 3F65A 4M6NH 3QUXC 4JKLA 4ZPVA 4JO2H 3WSQH 5GRVK 3MKKA 3N11A 4YBLB 1SBSL 4FNLL 2DDQL 5J1SC 3KPTA 4JZJB 4LLUA 3CC1A 4OZGA 3BQUD 3JV4A 3NAAH 4K2UH 4ZOAA 4DN3L 1GGBL 5E8DH 3PWNB 4JIEA 5IQ7L 3O3AA 4LNRB 3D3VE 4GQ9H 4YR6B 5L2JB 1X6LA 2CYGA 2FEDD 2MSPA 4JVPA 1ZT4A 3UPRA 2BOCA 3EZJB 3CDGB 2VABB 5MEND 4ZS7L 4OF3A 1R85A 2VZOA 1MSPA 3F7VB 3PDDA 1LF1A 3NH7H 3HCVB 5ANMB 1QYGL 2QTEA 4AEHL 3BZEA 3VNYA 4MCYB