2PDUA

Human aldose reductase mutant c303d complexed with idd393.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSDTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pduA00
2PDJA 5LIYX 1XJBA 4GACA 2ALRA 2BGSA 1FRBA 1EXBA 3GHRA 5LIUX 3R8HA 4GA8A 3H4GA 2DUXA 4HBKA 4LBSA 4ASTA 3R94A 3N6QA 3V36A 1ZQ5A 1HW6A 2A79A 3V0TA 2PDMA 3R58A 5AZ1A 1UR3M 4MHBA 2HV5A 4XO6A 2PDNA 4PMJA 1MRQA 2INEA 1PZ1A 1S1PA 2NVCA 4PUWA 4YU1A 4JIRA 4XVEA 1Z9AA 4FAMA 2HVOA 3BURA 5M2FX 1AH4A 2PEVA 4JTCA 1JEZA 2HVNA 3BUVA 4WDTA 1AH3A 2INZA 1PWLA 3CASA 3R43A 1X98A 5LIKX 2HE5A 4F40A 4XO7A 5HA7A 3M4HA 1RY8A 1T41A 2IQ0A 3O0KA 2PDBA 4QX4A 4WEVX 4L1XA 4WDXA 1MI3A 4NKCA 3RX4A 3LENA 2FZDA 3CAQA 3GHUA 3R6IA 3UWEA 3UGRA 5HNUA 1EKOA 3ONBA 3VXGA 4RPQA 2PDLA 2FZBA 4FALA 4PUUA 4WRHA 2HDJA 2PDPA 3CMFA 3FJNA 3UZWA 4IJCA 3N2TA 2P5NA 3BCJA 4DZ5A 2J8TA 4LBRA 1R38A 2DUZA 2PZNA 1X96A 2PF8A 4FZIA 1SM9A 1QWKA 4L1WA 4DBUA 1S2CA 2HEJA 2IPJA 4XK2A 3CAVA 3Q65A 1EF3A 1Q13A 3WCZA 2C91A 4XAPA 3LEPA 3UG8A 1K8CA 1XGDA 3LQGA 2PDXA 4GQGA 2ACUA 3EB4A 3GHSA 4QXIA 3LNMA 2FZ8A 3QKZA 1Q5MA 3WG6A 1LQAA 2ISFA 1Z89A 2IKJA 3BV7A 2I16A 3UP8A 3V0SA 4G5DA 4DBWA 1J96A 3DOPA 2FGBA 3LD5A 4LAUA 3UFYA 2PDWA 4PRTA 2PDIA 3M64A 4JTAA 2PD5A 3V35A 1AZ2A 4XVDA 2I17A 2PFHA 1S2AA 4HMNA 3EB3A 4WDUA 4XZNX 2PDUA 1A80A 4YVVA 4PRRA 2IPWA 4GCAA 3U2CA 3GHTA 3MC5A 4XZMX 3MB9A 3G1RA 3M0IA 4LB3A 4ZFCA 4JTRA 4Q7BA 1GVEA 4YVXA 4ICCX 3CV6A 3G5EA 4JQAA 3LN3A 5LIXX 5C7HA 5DANA 2PD9A 1T40A 4JTQA 3R7MA 1PZ0A 3F7JA 2PDGA 3R8GA 2R24A 1ZSXA 1YNQA 5JH1A 1US0A 3LZ5A 2PDQA 4R9OA 1MZRA 1RALA 2FZ9A 2PDHA 3LQLA 4EXAA 4XZIA 1RY0A 1C9WA 2F2KA 3C3UA 1M9HA 3O3RA 1Z3NA 4H7CA 4AUBA 3ONCA 4JQ4A 4JTDA 2VDGA 2WZMA 2PDKA 1PWMA 2F38A 4XZLX 5HNTA 3COTA 3FX4A 2R9RA 1AH0A 4JQ2A 1LWIA 3UZZA 4JQ1A 2ACQA 2IQDA 3H7UA 4GIEA 1EL3A 3ERPA 3V0UA 4JQ3A 4JIIX 2IKGA 5KETA 1S1RA 4IJRA 4WGHA 1OG6A 2HE8A 4OTKA 2IPFA 4YS1A 1AFSA 3RX3A 2CLPA 2AGTA 2NVDA 4GQ0A 4GABA 1QRQA 1IHIA 2BGQA 3WBYA 3D3FA 1ADSA 4Q3MA 4LB4A 3UZYA 2BP1A 3RX2A 2WZTA 3WBXA 2PDYA 1ZUAX 1VBJA 3B3DA 2IKIA 2IKHA 4IGSA 4YVPA 4H8NA 1ZGDA 3GUGA 3T42A 4QR6A 3KRBA 3LUTA 4QBXA 3LBOA 1YE6A 1YE4A 2FVLA 3NTYA 4EXBA 1IEIA 1HQTA 3UZXA 4JIHA 1Z8AA 4DBSA 3P2VA 4I5XA 5AZ0A 1PYFA 2IS7A 4WDWA 1AZ1A 1VP5A 2QXWA 3CV7A 3EAUA 3UYIA 3S3GA 4LAZA 5LIWX 1YNPA 3DN5A 1X97A 4XZHA 3WBWA 2ACRA 3H7RA 4FA3A 3LZ3A 1XF0A 4PR4A 2ACSA 3Q67A 2PDFA 2IPGA 2DV0A 5JH2A 2PDCA
chains in the Genus database with same CATH superfamily
3VDGA 4IJBA 5C0QA 4ACZB 1XBYA 1OFBA 2ALRA 1RJRA 3CZJA 4RE3A 1IT7A 2WHLA 3MCOA 3PBGA 3CO4A 3KZSA 3MUAA 3ID7A 2BY3A 5HMSA 3H2NA 3GC4A 5ABGA 4R88A 3QOMA 3QFWA 3STFA 5LHFA 2A79A 1WCGA 3W83A 3W7OA 3V0TA 2G3MA 2O7QA 4XO6A 1UP0A 2TPSA 2EQDA 3S1VA 5DBTA 3C5QA 3WMLA 1SJDA 2NVCA 4E4FA 3QLDA 1TR1A 2E5BA 5I2UA 1GZJA 2HVOA 2O0TA 1RCXB 4QM1A 1W9XA 2MUCA 4IZGA 4IIDA 1UR1A 3NPUA 2C15A 3WNPA 1XICA 3ARWA 4LWWA 1GW9A 4K1GA 2HK1A 2OCZA 4HCLA 3WLLA 5D38A 2FPTA 3VIJA 2OPJA 6ENLA 4GQBA 4MPKA 1UP2A 4OT7A 2ZUTA 3WKZA 1HZYA 3WQGA 2AQVA 5C70A 1W0MA 3DI1A 4IXXA 1Q6GA 4PB5A 1W56A 5I06A 3ZJ6A 3TQKA 2YSWA 1QPKA 3CIWA 1OG0A 3LPPA 3RLUA 2WVUA 2DJXA 3RCYA 2CWXA 1JD9A 4M7TA 4QLKA 2NW0A 1AQHA 3TC7A 1XYLA 1GK8A 1Q3NA 2QUMA 3QXBA 2PDPA 1E1CB 4GNJA 3ZJ8A 3B04A 4MNMA 5C2XA 2WMHA 1OIFA 4DBDA 3E0LA 3OZMA 1BXBA 1K6AA 3MDUA 3WMCA 1E6PA 5CGTA 5EFDA 3VFLA 1T7LA 1CGYA 2R6OA 4QAIA 4HNTA 2CWNA 4DBUA 2BTMA 5BW6A 4E2OA 3GNRA 1KRMA 1P4CA 3JR2A 3QSTA 4HU3A 1QOXA 4H8UA 5CPLA 3E0VA 3AIUA 3CQJA 4H6EA 4H6KA 4UWMA 1RD5A 3PZOA 5I09A 3CWOX 2PDXA 2BODX 3OHIA 2QIIA 1PX8A 1WV2A 4PN2A 4Q8TA 1TRIA 1YEYA 2UY4A 1GHRA 3QHMA 3W86A 2ZUNA 5GPRA 3UXIA 3WQ4A 3DFTA 3I3EA 1U5VA 5CPMA 3TTQA 3L4ZA 1V6WA 5FEZA 2W5FA 2HNEA 4O8RA 3W38A 2VL4A 1SFSA 1TPC1 2I5GA 1TX2A 1CGWA 1GVRA 4UBPC 4HK6A 2WSRA 4CGTA 1XUZA 3B9OA 2WYSA 3UA4A 3WQ8A 3TJXA 4FI4A 2PWFA 3AHXA 2EPNA 5F2IA 3L5AA 2ODOA 3SCVA 1VIWA 2C7FA 3URBA 5CC5A 1A80A 3BG5A 3UJEA 1KBKA 4LTSA 1S38A 4XIMA 4IIGA 3G1YA 3U2CA 3GHTA 1V77A 3BC9A 4PMQA 2VURA 3ARYA 4K7YA 3W4RA 4WKHA 3G1RA 3LXBA 4E3TA 1BQGA 2EHHA 2Z1WA 4QHRA 5AHNA 1TTIA 5LIXX 1EPXA 5C7HA 4A05A 2PD9A 1CECA 4RLIA 1XH1A 3I68A 3O1NA 5EY5A 2AMXA 2Z28A 5E1QA 4Q8VA 1EWEA 4GVHA 2WCSA 1X7FA 3ZR6A 5K7JA 2GVJA 1WZLA 1RY0A 3WD1A 1L6YA 2ZX8A 2YFOA 1DQWA 3LTPA 4NT0A 1KFCA 1MQPA 1FDJA 4P61A 1IT0A 2QJIA 4MJZA 2V38A 1CW2A 4NVTA 1VS1A 1LF1A 4GVFA 3W28A 1VLWA 3DYMA 1PIGA 3I10A 3B8TA 3QPEA 4RJEA 1TV2A 3N4AA 4JNYA 3S2CA 2GQAA 1M7OA 1G7VA 3BAWA 4G8TA 4ERGA 3NQBA 3TTSA 4LH8A 4QITA 4IH3A 3S6DA 1G1YA 2FPVA 2O9OA 3SRFA 4ROPA 2R14A 3W53A 4RV8A 4WXYA 4O13A 3LMZA 2I7GA 4UQBA 5AKQA 5JMUA 4C60A 4QS5A 3SCWA 1SFLA 1XGZA 3N2MA 1U1HA 1FA2A 2QHAA 1UZ4A 2UY3A 4K8HA 1BD0A 1YDYA 2PCQA 2ZUMA 4JEQA 5IFPA 2YL6A 1QASA 1W1VA 1KR1A 3KCOA 1ADSA 4J3WA 4LB4A 3P81A 4XV0A 4XUGA 1XIBA 1B5TA 4EWJA 1DYSA 3D6NA 3QV7A 1XIMA 2HWGA 4NYUA 4PEEA 3VD3A 3IJ8A 4FXJA 4Y9AA 5EFFA 3EMCA 4ES4A 2IMRA 3VKCA 3A24A 3R0KA 3QZAA 1FWRA 3VGBA 1AJZA 5CAKA 3A4WA 2PRHA 3TAOA 3DERA 2WVSA 3PPHA 2ALDA 1LORA 2GK1A 3IJLA 4MMWA 3AISA 3IUHA 3VKJA 3ZJ7A 5LA1A 1RA5A 1HL2A 3HGJA 3TTOA 4JYEA 3BARA 3MCMA 3PZ9A 4KFNA 4HK7A 3BAXA 2OYLA 4PL1A 4CU7A 2CLEA 3GC5A 3P62A 1BWLA 3OGSA 5LIWX 3W73A 2C19A 3IGUA 3S46A 2PLMA 3JVAA 1H1NA 3U3HA 3TYAA 2BVWA 5D37A 1FFQA 2Q3OA 2PWHA 3R11A 4OUIA 3KZPA 4AD1A 1V02E 4A3UA 1NFBA 5JVLA 5LIYX 1W3HA 4GY7A 4Y8EA 3W7CA 5BWFA 1BRLA 4D8AA 3LOTA 5LA0A 2YCLA 3CHEA 3A64A 4MNKA 2O9RA 1W3IA 2DUXA 3C0LA 5JBFA 4HPGA 3WD4A 1HKJA 1ZQ5A 1PDZA 4WXZA 4FNPA 4QE5A 1Q6QA 1PKYA 5CQ1A 5ABFB 3GU1A 2P10A 1ME9A 2Y63A 3W1UA 1K8ZA 4S39A 4KEZA 4GGBA 3S6OA 1PZ1A 3BVJA 4WF7A 3VVGA 1A3HA 3VX1A 3TE9A 1GG0A 4FAMA 1VFMA 4ZQOA 3BURA 2H8XA 1WDQA 5M2FX 1GJWA 4DJEC 4A3QA 2ZZ5A 4Y2WA 3CASA 4FK9A 1EYWA 3O16A 1GTEA 3UD6A 2ZZ6A 1Q6RA 1FCVA 2QV4A 2ZADA 4IMFA 2W66A 3O7UA 1RY8A 1D8CA 2WCAA 4WSKA 4L1XA 4HOWA 4GMEA 1CEOA 4GH3A 1WKYA 3RX4A 4LF2A 1QFEA 5LGXA 3UGRA 3DGRA 2VX7A 3ZT7A 1EKOA 5CSYA 1PX3A 1CGTA 2X1RA 3ANUA 4JFWA 1UWQA 4ALDA 1LOLA 4PUUA 4F0MA 2Q71A 5CGQA 2XVNA 3B8WA 3L21A 3IUIA 2WC7A 1SUXA 1XLGA 2Y7GA 2EXOA 4HZ8A 4FOUA 3VIHA 4DZ5A 2WVVA 4OV9A 3OOQA 4LNCA 3W7QA 3E49A 3TU9A 1O5QA 1OFRA 3SAZA 1MFUA 1C3FA 2CXGA 3GIQA 3IVSA 3CQ0A 3DI0A 1IF2A 3ORWA 5G2WA 1JPMA 3T55A 4O50A 2XH4A 1R3QA 4PMRA 4B2DA 4R85A 2V5CA 1Q13A 2RGLA 2VMFA 2C91A 3CH0A 4MY9A 2BNJA 2WSPA 1R3VA 1LL7A 3M16A 3IV8A 1J0ZA 1B90A 3B8DA 3W1TA 4G6CA 1BWVA 1UIOA 1R3RA 2F8QA 3KL0A 1DE6A 4AYSA 1YNYA 4Z2GA 4RL3A 3UGVA 1A0EA 3WJXA 2WK2A 2E77A 2PRMA 2WMKA 4E4UA 4M82A 1RD6A 1VEPA 1QPOA 2V3DA 1FWHC 1K3UA 4KCUA 4D6EA 3NQMA 1J96A 2BOGX 1F3XA 1EQPA 3AFBA 2WVVB 1J5SA 3IV3A 4EKJA 3N1AA 2HRWA 1SFJA 3AWNA 1XP3A 3TDFA 4CD7A 3A4AA 3GE7A 3CK5A 1RJQA 4AY8A 3NQ2A 1DWIM 1Q65A 2AQOA 3SCNA 4HMNA 1V6UA 4K2SA 4RNJA 3SCUA 3TA6A 5ABTA 4ZE5A 3TCSA 5D02A 4BR1A 2DQWA 3C2EA 4XZMX 1ZHAA 2VFHA 1TSIA 3GU9A 2YZRA 3FYOA 3M0IA 1DV7A 2X1SA 1KCKA 2YXXA 4HTYA 3S5SA 3LHUA 1EB3A 3Q45A 4FSAA 3BG9A 4XD5A 3LN3A 3BLDA 3VE9A 2Z2BA 4JYFA 4Y7EA 2X42A 2WZIA 3R7MA 5J04A 3F7JA 5B7ZA 2C1IA 4MWAE 1FWTA 3PJTA 3IRDA 4A2SA 3WZ0E 3MKKA 4UZSA 5KSWA 3L23A 3V75A 4DO4A 3LHTA 4R9OA 1ZAIA 1RALA 3OB8A 1WQ5A 3TH6A 1VAHA 2FGLA 4GXWA 3M7SA 4PCNA 1W3LA 4P7NA 2QW5A 2J7GA 1FDYA 5AHLA 2ISDA 2EPKX 2PBGA 4NYYA 3H8AA 1E9ZB 5BCAA 1J0HA 3WENA 4R5EA 3DFHA 4BWLA 3ONCA 2JF7A 1TMQA 1NDVA 5I3JA 1SR9A 1HNYA 2PMQA 5B80A 3UCQA 4Q4PA 5FF7A 7TIMA 3H54A 3I4KA 5BXTA 1XV8A 2OOFA 2PS2A 4J3UA 3CL7A 3FNDA 1GYLA 3KRZA 4C6LA 1GGOA 3S9IA 1FCQA 1BKHA 1LUCA 5HXMA 1PTAA 4JQ1A 2A1YA 2V5DA 1E6QM 3WUBA 1AD4A 4UTLA 1HG3A 4QCEA 5AC5A 4DF2A 3XIMA 5MKGA 1TWDA 3VNDA 3EZ4A 3IJ9A 4AVNA 1AVAA 3FKKA 4DF0A 1UR4A 5MF5A 2AQWA 1WDDA 3RR4A 4RR4A 1V79A 3TXVA 2A3AA 3TNBA 2E8YA 4UFKA 4Q4KA 1WDWA 5F1UA 3T0AA 3HB9A 1S46A 4P5UA 1B3VA 3CTLA 1C8YA 4BQ2A 5FF2A 2PURA 3MSGA 2VNCA 4WZHA 1W5QA 3SSZA 3KX6A 4V2XA 1MFVA 1SSDA 3HPAA 3DXIA 3A22A 1E56A 2PDYA 1ZUAX 2J27A 3FSUA 4S3BA 1XS2A 2GGGA 1DVJA 3T42A 3NQGA 3E0FA 4XD4A 4QBXA 2JE8A 2VEMA 3UVIA 3IVUA 3MV11 1PSCA 1RQHA 2YGYA 3V1PA 3SGGA 1MUCA 3IGXA 3G1DA 3PK7A 3PM6A 2E6AA 4XG1A 5MKGB 1YBQA 2QJHA 1P5BA 2ONEA 2CCRA 1ME7A 2WSQA 3B9AA 1JRCA 3ICJA 2D23A 4EPEC 4H9ZA 2QDEA 3T4WA 3UYIA 2YLLA 1X8FA 1JCTA 1TVLA 5AYBA 3W3OA 4EPBC 1I2NA 3WELA 3BSHA 5I3GA 1YMYA 4FA3A 1FH8A 3WLKX 1GNXA 4DO7A 5IBXC 1ISWA 3LTSA 4ZFMA 2DZWA 2J75A 3VINA 2VZVA 1DIKA 3VCNA 1ONWA 3FSTA 1KXHA 2Y8UA 4V28A 2RDTA 1EP2A 5TBOA 1V0KA 4QEHA 4UQCA 3UPMA 3FLUA 4K6AA 3S47A 1Q7QA 2CU0A 1EIXA 4LCQA 1XLKA 3KTXA 7A3HA 4C6MA 3M5YA 4QNWA 4HN4A 1U5HA 4LBSA 3A13A 3B4UA 3R94A 3N6QA 5AVHA 3IIOA 3JZUA 1S2WA 3FXYA 1YBQB 3N6HA 3E2QA 4MY1A 2YDAA 1W9PA 3WF3A 1TWSA 3WQVA 4F8XA 1W9VA 3FV9A 2V5LA 2C79A 4ZXLA 1ZLPA 3DHUA 1LT7A 1KM2A 2ZWYA 1BYBA 1W1A1 2GOKA 2QJJA 3A3XA 3CZGA 1Z9AA 4FLRA 3K4WA 5I0DA 3LMYA 3N34A 2PEVA 6XIMA 1XR2A 1HL9A 1AQMA 3ZM8A 3L2LA 5I00A 1KV8A 5AOUA 2P53A 3FAXA 3M41A 2WVTA 1B3OA 1MQQA 4OECA 1ZS2A 3DBPA 4GFSA 1ITXA 1DKWA 2E6YA 3VUPA 3MS8A 4X60A 3H70A 2WHMA 1YX1A 2XIJA 2ZZ3A 3DESA 2RH9A 4E8CA 4YHEA 4PBFA 3C8FA 3LS9A 4IFOA 4ROQA 4UTIA 2VR5A 2OKOA 4PTWA 3G24A 5LZLA 4DQWA 1GCYA 3BCFA 3M1ZA 1ME8A 4POCA 4TU1A 4LOCA 1H4PA 2DVUA 2X7WA 2XIQA 2VEKA 3BWWA 4YWIA 1OC5A 3MMUA 3BCJA 2V3GA 4MDPA 1ZZMA 4C6KA 3THCA 3O05A 3H21A 2PZNA 4XAYA 4FZIA 3DENA 4EE9A 4HVXA 3V16A 2WOQA 4H01A 3PZIA 4CN6A 4TX8A 3CV2A 3UESA 1OVDA 5G5IA 2JF6A 2Q8ZA 2Y4SA 5H1WA 3UG8A 3LRKA 2HPMA 1JULA 3OBEA 4L9ZA 4C6QA 1AUSL 5L6UA 1B3ZA 1U1UA 2EG7A 3KOXA 2I5IA 3PZQA 1E0TA 1NOUA 1Q6EA 4MM1A 2XYLA 3L0GA 3UZJA 1CWYA 3WEZA 4HZMA 1GOMA 2WBKA 1GOIA 2G3NA 2YA1A 3S6TA 1W5PA 3O9NA 3UERA 4NF7A 1H62A 4DBWA 1UQYA 3EBVA 4CD5A 1HO4A 1M1BA 3DFNA 2Y62A 4S1FA 4DX3A 3NEVA 3M64A 1XLFA 3UF9A 4B3LA 2QPUA 2V3FA 1LBLA 4CNUA 3IJDA 1XLIA 2Z29A 1IWPA 2OU4A 1EPVA 2WMFA 3UETA 3EB3A 1W31A 1IXQA 2YB1A 1NDZA 4KIRA 4B91A 1QATA 1GOXA 4M8UA 3F5KA 5LKYA 1XYBA 1XHGA 1OFEA 1RCOB 3KL5A 3P6LA 4I5UA 3S4TA 1MNSA 3HOJA 5DANA 1T40A 2EPLX 3WDQA 2HTMA 3OG2A 5TNVA 1UMYA 4OU1A 3CIXA 1FP9A 3KHDA 4Z1CA 3NQ8A 3EPNA 1THFD 2CZ5A 3LZ5A 3R25A 4LS1A 3LX9A 3B05A 3U48A 4P2VA 2ZA1A 2RJGA 3MJMA 2Q02A 4GIRA 4LF1A 3UR2A 2GDUA 4EP8C 2QCCA 1AD1A 3TZFA 3A12A 3M47A 3CB3A 4PB3A 1C8VA 2BY1A 1W5MA 1YPFA 3Q58A 3RR1A 4JTDA 2HROA 2VDGA 2EF9A 1RLDA 3C2FA 5C9WA 5F4WA 3MMTA 4IMAA 2JGQA 2WKJA 1A0CA 2GVYA 3VKDA 3GO2A 3EGJA 3G1FA 4LAKA 3SW6A 2AKMA 1W54A 4DYJA 4GZIA 4YTUA 8CGTA 3CL8A 3V0UA 1C8QA 2J24A 1L9WA 3SO7A 3E9AA 1V7AA 3WQ5A 4AVOA 3WF0A 1K1DA 3N11A 2NT1A 3UPBA 4KWSA 1OD8A 5JIWA 1G67A 1YQ2A 3FAWA 3R2GA 1FWCC 4LY4A 1AL7A 3UZYA 4FLOA 1W3TA 1MEWA 3E0IA 3RX2A 4DELA 1F76A 2G8ZA 5BU9A 3GBDA 1E6XM 2YL9A 1T5AA 1VFUA 3VKKA 1E40A 1R9YA 1PBGA 3GUGA 3TYZA 3LG3A 2X7VA 3GNDA 5I5RA 3ZS4A 1YE6A 1QBBA 3BAKA 4F2BA 3PBVA 3CHDA 4AVFA 3AJXA 4I5XA 4WJXA 1VCVA 3B03A 1AZ1A 4KPLA 3WSUA 3GR7A 3B9DA 2GQ9A 4DJDC 3P5YA 4QCFA 1PKNA 5CPQA 3TUUA 8TIMA 1QTWA 3QRHA 3OEXA 2TSYA 5D9OA 1G7UA 1W91A 1OFDA 2A2IA 2BY0A 5DT5A 3SSJA 1CLVA 5JH2A 2WM1A 1EOKA 3CHCA 2FJKA 2YIHA 2QCLA 3HJEA 4JCLA 4JFUA 4B5WA 2FTPA 2NZLA 4IQLA 3G1SA 1LRNA 1SZRA 3QLLA 4L65A 4JPGA 1GZ1A 3JS3A 1WKFA 3BJSA 4OJYA 3N15A 1LJYA 3VNKA 3GYEA 4IFKA 1V02A 2W63A 1SO5A 3TSDA 2A3CA 3FA4A 4LU0A 1VHNA 3C56A 5ABEA 1IXPA 1OX4B 2OEMA 4PMJA 3II1A 4HCDA 6REQB 1ZALA 4Z1AA 4O1DA 1MVYA 1CB2A 1K02A 4B3KA 3W7DA 4P7LA 1D9EA 4Q4SA 3P5ZA 3WLQA 1XCXA 3HGOA 2MNRA 1PWLA 4OFCA 1E0WA 2UY5A 5LIKX 3PPGA 1MW3A 2PWEA 4WSHA 4XO7A 4M1RA 3L7RA 3RPTA 3S42A 1W37A 3PHAA 2NQHA 4BY3A 4EVZA 4IPJA 1XISA 4QX4A 3VDHA 1GJUA 2Y8KA 3ITOA 3S83A 4BKNA 1UR2A 1E70M 3AXKA 4C5YA 1CXEA 3ARPA 4OE7A 2WSYA 4PTXA 3NXFA 1WXZA 4PBGA 5I02A 4MKNA 1X1OA 4K8GA 3GW0A 1OB0A 1Z41A 4B5UA 2CLHA 2V0TA 2B0MA 3S5YA 4EF8A 4E8GA 4MAZA 2A85A 5AY7A 2NV9A 2XN0A 1I2QA 1BTCA 3M5VA 3CTTA 3N73A 3UYCA 1UWIA 4QROA 4J7RA 4PL2A 4ZODA 1OK4A 2E9LA 2QJGA 4L1WA 5L9FA 3I7SA 4TVUA 2XINA 3E38A 3RMEA 2XN2A 3CUHA 3WCZA 3G0SA 3VABA 2Y5JA 4E2VA 4GJ1A 2DGAA 5A2AA 4GQGA 3SQMA 7PTDA 3QV8A 2EPHA 1NF7A 4CEXC 5CPTA 4DJFC 4B2DD 2YFNA 2D2OA 4ADTA 4IF2A 1E4LA 2VQUA 1XLJA 3PWAA 3UP8A 5BXPA 1NU5A 3FOKA 5ECVA 2TMDA 4AFYA 4DEFA 3W23A 1E73M 2FPYA 5HQMA 3LD5A 3VA8A 5E0KA 5IOBA 1YDNA 4NAFB 3TQVA 3SFWA 1G4EA 3VIFA 5BNKA 1KLZA 4WDUA 2CLIA 2ZRVA 1O60A 2RGMA 4MUPA 5AN7A 3L66A 4AD0A 3W2KA 3NSXA 3K46A 5F1VA 2WANA 2OLSA 3UNDA 4RXGA 2BXVA 2OGJA 2CC0A 1P0NA 2Y7DA 4OV4A 5AHIA 2C71A 4P7QA 2HBXA 4WK9A 1KM5A 1VHCA 2VEPA 1NOWA 2WHKA 3GXPA 3AUOA 1ZSXA 1E71M 4CVUA 3RYSA 2D1ZA 4M6VA 3KVLA 4NASA 1CXFA 4FS9A 3GB6A 3NO1A 2PDHA 4HYRA 1F73A 4JS3A 2XH0A 3WH8A 3OZOA 4MWAA 3NL5A 2ZVIA 4QSHA 1LCOA 3SCOA 3MA8A 4JTHA 7ENLA 4OUEA 4DJDA 4UOQA 1ONRA 1TUFA 4G7EB 3GZAA 1MW1A 4UZUA 2PTYA 3T81A 3DEQA 4NUWA 1BEUA 2Z1SA 5I3KA 4KBXA 1ITCA 3GD6A 1XQLA 2CBJA 5EBUA 2VWTA 3VD4A 3MJYA 4I3GA 3CBWA 4GIEA 1X39A 2PODA 5LNUA 4M1BA 1XIEA 3TFCA 1SZEA 1P0KA 4AY1A 3BW4A 1GQJA 3O63A 4UQAA 4FIRA 3LRMA 3CH9A 3KWSA 3RJYA 3CHVA 3VIPA 1AFSA 4GQ0A 5HWMA 3AMKA 2OQHA 4NILA 1VYRA 4MWAB 5DY3A 3WD0A 2ZYFA 4IP4A 3H2MA 1XXXA 2YCIX 1MW2A 4D2JA 1KTNA 2ZDRA 3GDLA 1L2QA 4L6HA 1GTHA 5A6SA 3I3BA 3DFQA 5TQLA 4FO4A 4GI9A 4O11A 3RGTA 4AU0A 4L6OA 3P8IA 2F7FA 2Y6ZA 1EH9A 1DIDA 4MOZA 1TV7A 3DG6A 1XQKA 3M43A 5IDIA 5HNRA 1CBGA 1UH2A 4PTDA 3QMSA 4O1FA 2J7EA 5T26A 4ECLA 4LX4A 1BPLB 1UZDA 3PUGA 2RFGA 3T09A 3TN3A 4JTIA 5DELA 1OYBA 2ACRA 2GYIA 3IIZA 3LU2A 1BWKA 1S5MA 4U4MA 3UNTA 4A22A 1RHCA 3ITLA 3HA1A 1QNPA 1FWIC 4RUBA 1T6MA 3DU0A 3I6EA 2P3ZA 4GOAA 3VDAA 2J7HA 3W7KA 4LNYA 4N02A 3RHGA 3SURA 3VIGA 4W7UA 2DZAA 2P50A 1KRAC 1GVQA 3GU2A 1S3HA 3ABRA 2GL5A 2CIPA 4BCEA 5BWAA 3WK3A 4US6A 1F3WA 2EJ1A 2VC5A 1AMYA 3DHFA 1P6BA 2AMGA 3DECA 1MDLA 1QOQA 2OEJA 3W22A 3KRUA 1Y5WA 2OT0A 3LXCA 3GTFA 1XLLA 3RCNA 4BQ5A 3BLKA 4US5A 1TCMA 3RLVA 4NZJA 5HOSA 1RVGA 1NF0A 2DSZA 1FBAA 4K3ZA 1G4TA 4W89A 4QP0A 4M0XA 2POZA 4HOZA 2Z2AA 1EIBA 2X40A 1AK5A 2A6NA 2VDIA 4DJFA 1ZCCA 4LVFA 1VFSA 2G96A 2FMNA 1JEZA 1NWSA 1ZP4A 2Y89A 1K9FA 3LHZA 3LRLA 2INZA 1M5WA 3GQYA 3VD7A 4GINA 4OGZA 1N2VA 4U5IA 4RE2A 2BBFA 1TV3A 4UTKA 2PU1A 1I1XA 1ZBWA 1QPNA 5FIPA 1XRTA 1ONXA 5FJUA 5F2GA 3NEHA 3W7EA 5BOEA 2RDWA 5FSEC 2GVGA 4HPNA 3SFKA 1W1PA 4QS6A 4DY1A 5A2BA 2FZBA 5DMLA 3QVQA 1MEIA 3G22A 3BG3A 3N2XA 1HKWA 2C13A 1UKQA 3S1XA 4JNMA 1V3LA 1HKIA 3N12A 2E7FA 3CUIA 2A3EA 2Q6ZA 1MSSA 3TP4A 2PC4A 2Z1XA 4F9DA 5C8BB 3NYDA 2Y88A 4K36A 3T44A 2VFEA 1V0NA 5FL1A 3O6AA 4GXPA 1R38A 1OEPA 5A5WA 2VRJA 1EFZA 4DN1A 3WDHA 2VOMA 3R10A 3W1PA 3O6CA 4LUTB 2OYKA 3CC1A 4NXSA 1VFFA 5H2ZA 1JZ6A 3POCA 3TYEA 4EXQA 3WQEA 1L6FA 2C6QA 1PJ9A 1TB3A 4C6JA 1HJXA 1MMFA 4KETA 1ODUA 2I16A 2BXYA 2DU2A 2P3EA 3TMLA 4M80A 5HWJA 4H19A 1GONA 3RFAA 1AMKA 2ZRZA 2QAPA 1QK0A 3ARZA 2DJLA 4DXXA 4GPNA 4LAUA 1KFEA 3UFYA 3OPSA 1NFGA 1DJWA 1BXNA 3H2CA 1JPKA 3C0SA 5H91A 1M7PA 3ZSSA 4PZVA 4TXEA 1TJ1A 1R0MA 1X7IA 8RUCA 2UV8G 3VD5A 3NSMA 5BYWA 1NARA 1JUKA 1G9HA 1M7XA 5JQ9A 2I1OA 1XYCA 2FHFA 3P0XA 5D03A 2ZXQA 4Y8FA 4GVIA 1P7TB 3KW3A 3VM5A 4K37A 4ZO9A 1EDQA 3M44A 4H4IA 4IG2B 1OFPA 1WZKA 1LRQA 3IS4A 4HHPA 4R53A 2ZX7A 3KOZA 5HQEA 1A50A 4F4RA 3R8GA 4M6UA 4PMDA 5I24A 5AC6A 4R34A 4AF0B 5HQLA 1UD3A 4HGXA 5LNWA 4Q8WA 1OJXA 1N8IA 5DCEA 2WZEA 2H8ZA 3OW1A 1TPWA 1MDRA 3UXLA 4PSRA 4GIAA 3SGUA 2WZHA 1QCWA 2YL5A 3FDGA 4FOJA 3K1DA 4C6BA 3CHFA 5EU9A 3RRXA 3VZZA 1NVMA 1XLHA 5HPOA 2R1MA 1A3XA 3WUFA 3OA5A 3MQTA 5AC4A 1UC5A 2FLIA 2O55A 4F0RA 2IQDA 5DRCA 4G1KA 3W2UA 3NJ3A 1K8YA 4QFUA 3KVKA 2YBVA 4C7GA 3QY8A 4WGHA 2PUZA 4N4QA 1R2SA 4TTUA 4ZTXA 4JZ5A 4UR8A 4DI8A 1WDPA 3AYSA 4PCSA 3WNLA 4NZ1A 4CD8A 2RKXA 4V33A 1UWSA 3BSMA 4LUIA 4YLWA 1GOKA 1EZ2A 4H7ZA 4FR6A 3W1RA 2TRSA 3CUFA 2KX9A 1OD0A 3RJXA 3MVTA 3FXGA 2YA2A 5HJLA 1V0LA 1EWDA 3JW7A 1JZ4A 4WSJA 2UY2A 3WBXA 3WLJA 4A8LA 2ZIDA 3MSYA 2NQLA 2OELA 2OODA 3EWXA 3LB0A 5D4YA 5HMEA 4HT3A 1LP6A 4LUSA 2Z00A 4Z2KA 2YOCA 5CGMA 1MW0A 1I4NA 1YE4A 4RDWA 1PIFA 2GSHA 1JCMP 1JF6A 5GQBA 1B9ZA 4GG9A 4NJHA 2GUYA 2D22A 3GXDA 1PYFA 2BB0A 1Q6FA 1VP5A 4P7RA 1ENUA 1JYWA 3FGCA 2CLFA 1HJWA 1Y7VA 3GDRA 3ATZA 1UWTA 4KQNA 5DT7A 3AC0A 4IX0A 1Q7MA 1X97A 4AZ5A 4I5RA 4CN1A 4JCMA 4QIUA 1SW0A 4DWSC 3S1GA 5ECUA 3MCNA 3GVQA 1E4IA 4KCVA 4PMUA 3GG0A 1H2JA 5CEWA 4LUSB 2ZRYA 1NAL1 1FH7A 2KAUC 4L4LA 3XISA 1F3EA 4PB4A 4AB4A 4PSPA 3W7HA 2QGYA 2B81A 3CQHA 5JU6A 1IGSA 5AZ1A 2DVXA 2VENA 4GCXA 1DEDA 1EA0A 4BEUA 1WXYA 4RNIA 1VR6A 3O8AA 3FGCB 4K38A 2NVAA 1UD2A 1QBAA 1B57A 3H2EA 4MY8A 4PUWA 2CLKA 1ZBKA 4KKXA 3RM8A 2WLZA 3BLOA 5IM51 1U2YA 1UA3A 1EX5A 1QW8A 2VELA 3CS2A 1KFLA 2VRQA 3EKLA 5E93A 3UY7A 3OU8A 8A3HA 4GVGA 1TTJA 3FN9A 3MP4A 1V3IA 3VC6A 3R0DA 2NWRA 3BMVA 4RE4A 4ZO6A 4CNTA 3ME3A 1O1ZA 5CBBA 4IUOA 1N8FA 4KFPA 1K8XA 3EWBX 3CAQA 1H51A 4PUJA 3ONBA 3QFEA 3W82A 3KBSA 4C6DA 4C65A 2VFFA 5F4XA 4FALA 5JBDA 3VGEA 1OGGA 3WFAA 2HDJA 1G94A 2DW7A 1NIUA 4YIWA 4QGCA 1WKDA 1QNSA 1VFLA 3UBPC 2OZ0A 2DSUA 3BLEA 5GNXA 2G3FA 4AWUA 1Q8AA 2XJ7A 3AU2A 1U22A 4NJJA 5U4NA 2HEJA 1YXDA 4H6RA 1B54A 3Q65A 5FF3A 3HFTA 1XBVA 1PS9A 3O06A 5E5CA 2V6AA 1W9DM 3NZGA 4A29A 4JL1A 3FW6A 3VD9A 1ISXA 4IWWA 2C14A 2FZNA 4OWGA 4ATWA 5H8PA 2Y85A 1EX1A 3LPFA 3TK7A 4UR7A 5DXYA 2C0AA 3LNMA 2YZ5A 1O6IA 3H26A 4HHLA 4L6DA 1UUMA 4DF1A 3KVMA 3S9YA 4Q4RA 7CGTA 1A5NC 1QWGA 1RBLA 4D71A 3W2JA 5H6HA 2Z4GA 4NRSA 4QQ3A 3W2NA 4FX8A 3TYUA 5A3HA 3PBMA 1HGWA 3B9NA 4IGNA 1BSLA 2G4FA 4DUWA 4HNLA 5BU6A 4S3FA 4JDYA 3GK0A 1PKLA 2PDWA 4PRTA 2O9TA 3ABXA 3R12A 4JTAA 5H8UA 4ZOCA 4UTHA 3GG1A 3EA1A 2I17A 4WY0B 5E09A 4J27A 2E8ZA 1S2AA 1CENA 5FI8A 3VTRA 1EA9C 4ZQCA 3OBAA 1XPGA 4JAWA 3LHWA 3PF3A 4W87A 3LTYA 1PCWA 4DYEA 4M5PA 2QT3A 1VCGA 4D6IA 4IMCA 4AZBA 5G2IA 1HTIA 2ATSA 4HNNA 3LLXA 1EGVA 2ZX6A 1PCKA 4REQA 4UNIA 4C6PA 4MPQA 4UTTC 1E3XA 4WIWA 5I79A 3WUEA 1KM6A 3GZ3A 4JTUA 5IXEA 4UTWA 5EL1A 1BHGA 3MHUA 4O28A 3TFXA 3NQCA 1HFBA 2CPUA 4CNOA 4NJIA 1V03A 1FH9A 2P8CA 3ZT5A 2VCCA 4QG8A 3C4UA 1NELA 3LYEA 3D46A 4XZIA 3WEMA 1HIZA 3BGGA 3L2IA 2F2KA 4MB3A 1AA1B 4E6MA 3KOFA 2HVMA 1C7TA 3O15A 3GRIA 3O3RA 1TV8A 4DNHA 4MKVA 4UFLA 3LNPA 1JUEA 2VCAA 3CWHA 4YYFA 4HZ6A 2BLEA 2H3DA 5FJTA 1T8XA 3S5ZA 1WAWA 5FAGA 4Q22A 4D6FA 5I3FA 4CNNA 1GOOA 2HZGA 4DWSA 4LXFA 4MWAD 3BMXA 4REQB 4DAIA 3UJSA 4KRUA 2QMJA 1OIMA 4DJDD 4Z1YA 2XH7A 2E5DA 3H7UA 2BOEX 4MZYA 4I8YA 3BOFA 3L5MA 2VC6A 3LGDA 3VMOA 4BS0A 4C1NB 4A3YA 1W8GA 5G2HA 2HE8A 3NL3A 3QTGA 1JZ8A 3NWRA 4GYKA 1QO2A 4Z17A 2NVDA 1AW5A 3CQIA 1QRQA 4L4PA 3FDKA 2FDMA 3W2LA 1UH3A 1LT8A 4Q3MA 3B8VA 5DN1A 1J12A 1EZWA 5I6SA 2Y5SA 4UTUA 3W1LA 1Z6KA 5BMWA 3DKJA 5CAHA 4NY2A 3SBFA 2KZHA 1ZY9A 1R3TA 2X09A 2WKGA 3P82A 2NSXA 4IGSA 4CVWA 3CUXA 4GI4A 1FY6A 4Q6XA 5CPOA 5HPCA 1RCQA 5M17A 4F2TA 2FVLA 1N82A 3H22A 2J77A 1DXIA 5HJYA 1VJZA 1ZBCA 5CC7A 4EXBA 3RG6A 3TMQA 2QF7A 1ESWA 3MWCA 3GNPA 1AODA 1UKOA 3L0NA 3MU7A 2W0UA 3BAJA 4U10A 3AUJA 5EBAA 2QXWA 4IHCA 2VZOA 3EOLA 3T0CA 2Y7EA 3QH2A 2JKEA 3WK2A 4KESA 3W85A 3N4EA 4J3ZA 2J7FA 7REQA 3M5XA 1H5VA 2DQXA 5I03A 1ZJIA 3S5NA 2J13A 1POJA 4X0VA 3ARUA 1C91A 4O16A 4CCEA 3HO8A 2NQZA 3BSGA 4OVXA 4AHOA 3PVFA 4B90A 1V6VA 3OVGA 1BG4A 1GYNA 5EKYA 2GGHA 4RW3A 4J3XA 4QISA 4O4VA 3CGTA 4QE1A 1FOBA 3T0DA 4JOMA 4ASTA 4C91A 2AL2A 3OLIA 3F2CA 4JX6A 1UPPA 4S3GA 1E72M 2YBTA 3BMWA 3LSBA 1FXPA 2C8NA 1XLBA 2NX3A 3QSRA 3GR8A 4LSBA 4XTIA 2D0FA 1UHVA 3QF0A 4N9CA 2CKSA 4TQTA 3REQA 1R5YA 2YW3A 4IX2A 3D47A 1GVIA 2D3LA 2DT2A 3EWWA 3KTCA 4BQ3A 3V1HA 3DHPA 4US5D 1CXHA 1P6WA 2XIIA 2XGBA 3WUGA 4IQEA 1PZ2A 3CYJA 3SN0A 1H0GA 4GISA 1JFXA 4DJFD 3R5EA 5A6LA 4IIEA 3WLSA 3PG8A 5C9XA 2ZRWA 4TOQA 4GHRA 1DQXA 1BVZA 4Q33A 1P43A 4EIVA 4N9DA 1D8WA 2VTFA 3UWVA 1XC6A 1XKJA 4KEVA 2OSWA 4NIRA 4S3JA 2FVMA 3T2PA 1HUVA 1UJQA 5IFTA 4ZSTA 4JFSA 2Q01A 1NFPA 5I3HA 1OZQA 4FNUA 3TROA 4AWEA 1FWWA 5JXQA 1WZAA 4V27A 1KM4A 4WX2A 4UTTA 3FJNA 3HG5A 4XSMA 4TR9A 4RKAA 1LQ2A 1K9EA 3RNDA 3K13A 1OF6A 2J8TA 1CPUA 3G6MA 3PULA 1T96A 4XAZA 1N7KA 2Z1BA 4IIBA 1XLEA 3WF1A 1FWJC 3FS2A 3N4FA 2HXTA 3LEPA 1S5NA 3V3WA 4LEQA 1RUSA 5HULA 3ZVHB 3GXMA 3IIPA 3NL6A 3I7QA 2D3NA 3S8HA 4QSFA 4C6NA 3KS6A 1TPVA 1Z89A 4O14A 4PTMA 3VPLA 2R82A 3C2RA 2PGWA 1KBIA 4M81A 3EDFA 3T1GA 1WO2A 5IDZA 1B0IA 2Q8XA 3R0UA 4MADA 1L2UA 2DZPA 3IPWA 3O6YX 4PMVA 3N25A 3W7PA 3UVAA 4R7JA 1JR1A 3GTHA 3LV5A 4FXSA 3V35A 3VMNA 1AZ2A 5D9MA 1J11A 3AIRA 2J25A 2NXHA 1KTBA 1SJCA 4AIOA 3WLPA 3KUMA 3MWAA 3K4DA 3EMZA 1HKVA 3THQA 2A7RA 2PTZA 4ACZA 1HX0A 4X9YA 1R86A 2FHBA 1UD4A 3UEQA 4L56A 3T2QA 4NQ1A 4F66A 2XM2A 4D6HA 4F0KA 4KWOA 2ESCA 1TFVA 1IV8A 1VPXA 1A53A 1B3XA 3LCXA 2RAGA 1AW1A 1EEPA 4TX6A 2V8ZA 3BW2A 3H4WA 4DPPA 3DC0A 2PDQA 4PUKA 3NGFA 1RXOB 4ZB5A 3M9YA 1FFRA 4GZ7A 1R9ZA 4C6FA 1UMLA 1VCFA 4YNGA 4H9UA 1FCUA 3ITVA 2XVGA 1M53A 1QHZA 2WB5A 3EWZA 3MDWA 3MYPA 3LPOA 4HPJA 4CLMA 2BVDA 4PUMA 3FEMA 5M1TA 4ATLA 4A35A 8XIAA 3DFSA 2QDGA 5HANA 2NUWA 1PWMA 4JKLA 4D6JA 5FJIA 4S3EA 2CHRA 3G3MA 1FWSA 3QM3A 3L9CA 2CEQA 4FXRA 4Y96A 4KW2A 3ZQ9A 4JTFA 1Q66A 3GFZA 1QXLA 2JIEA 6TAAA 5FF0A 3IRSA 5REQA 3GC2A 2FHCA 1DWFM 3ZIZA 1S1RA 2NQ5A 1JZ7A 1LBFA 4WD0A 1HP4A 3S1UA 4ORMA 3FFSA 3LHYA 3GXIA 5HBFA 4I7UA 4AHQA 2V67A 3VFCA 5E6YA 1E5NA 3FYYA 2YYUA 3BLFA 1X6LA 1UQZA 2ANUA 4IPNB 2PPGA 1E1CA 1SMDA 1VFHA 2QZRA 1ITQA 3SRDA 4W8AA 4C90A 1TA3A 2REQB 3CB8A 1W2PA 5BROA 2BHUA 4QAWA 3VE7A 2DH2A 5CSUA 2CLOA 3EXSA 4W9TA 9XIMA 2XUCA 2PP1A 1HT6A 5A6BA 3LBOA 2DZSA 3ZYZA 2WJDA 4WKAA 1TQXA 2A7PA 5GJMA 1IEIA 3CYVA 2XFFA 3DBNA 3N29A 3NNTA 5REQB 4Y90A 1VJIA 4ZL1A 4H2CA 3GH7A 3VOGA 3ZSTA 2ZUSA 2VRKA 4FIQA 2PWVA 4ZCWA 4P7OA 3M0YA 4IOTA 2NQ9A 2WO5A 1FX6A 5D2TA 3BQ6A 3BO9A 1JIBA 4TO8A 1HO1A 3F1QA 4HP5A 2V68A 1Z42A 2EPOA 3AS3A 3RM9A 1CLXA 4TVDA 3WLIA 4GGHA 4NI3A 2HJPA 4X0NA 3E96A 1BG9A 1TA3B 3KHJA 3NXLA 1UR0A 2EG6A 4K68A 3WH5A 3QW4B 5D04C 1RZMA 1EJXC 3DYOA 3W6LA 3KP0A 3S9ZA 2DY3A 1TTPA 1XG4A 2FJUB 4PUNA 5LIUX 3K8MA 3CPGA 2OVLA 3MVIA 1DXFA 3T7VA 5A1AA 1BTMA 4HBKA 1YIXA 4LS2A 1S39A 2VO5A 3ZOAA 4FMVA 3HIJA 3AIBA 3PFMA 4DO6A 2Z7GA 3N9KA 2O9PA 3N14A 2QUNA 3CZKA 1MRQA 1XSJA 2WMGA 1EO5A 2CETA 1ECQA 2BOFX 3THUA 1DL3A 1HXJA 1LL4A 3MSRA 1OQFA 2IXUA 1A5AA 4RDVA 3MUY1 4HA0A 3JUGA 3NSNA 3GKFA 5D9PA 2XIOA 4JTCA 3GTIA 3NPWA 3R43A 4IL0A 5FSDC 1TIWA 2X2YA 3UWUA 1Q8JA 1LM1A 4PGLA 3F4WA 2D2HA 1VFOA 1VIZA 3GYCA 1Z48A 3PPFA 3QGVA 3HN3A 1KFJA 1MI3A 1R3YA 1W3JA 4JN6A 3UPWA 3DIPA 4JDBA 1IIHA 3JZEA 3C8NA 2FZDA 1RJPA 1BYDA 3U7VA 2QQ6A 3W7NA 3HQ1A 3DUGA 1QJWA 1QI2A 3EWUA 1YRRA 1VZWA 2XM1A 2XISA 4XWUA 1CNVA 4IJCA 2E4TA 4M51A 2J7CA 2VGFA 2XFYA 3FK4A 3W2MA 4GYJA 3GG8A 4L9XA 1E4NA 1R7AA 2PLCA 1I75A 2WBGA 1T99A 1ICSA 3NVDA 4ZOEA 5C54A 1H7NA 3STEA 1QWKA 2XH2A 1K03A 3PB0A 2E6DA 3CAVA 4XAPA 4LYPA 4KEMA 4UCGA 2EAWA 4GUJA 4OBSA 3U57A 4H9YA 1UW9A 1JDCA 3G18A 2DIEA 3WG6A 4ZENA 4X63A 3RN6A 1LTDA 4QJ3B 2BV9A 2JIWA 5DO8A 3K8KA 4H8VA 3SZ8A 3CZEA 1RQEA 1OX6A 3KFTA 3RLGA 2J74A 4GX8A 3KBNA 3DOPA 1I60A 1A5OC 5T9CE 2J8FA 4BA0A 4IP5A 1DP0A 3ECQA 3KLLA 4H9TA 1TPB1 1EJ7L 3A47A 5CJMA 5MHBA 4KGLA 1W1YA 1W9UA 1F61A 3DYPA 1EBHA 2DH3A 4B9YA 4DXVA 3UWWA 3OGVA 2AAMA 5KZ6A 3WLTA 1IR1A 3VK5A 4R27A 4KF1A 1A5BA 5C5YA 3FJ4A 2VCBA 3UA3A 6XIAA 5LXXA 2Y2WA 4Z2IA 1OFAA 2BHYA 1D3HA 3S1WA 3F03K 3G5EA 1KW1A 1EHAA 3T4CA 3EB2A 4OQVA 2BXZA 5GNZA 3W29A 1Q85A 3VNLA 4EPDC 2VEGA 3PY2A 2WMIA 3GVWA 4KIEA 1LRTA 1SMAA 3V7PA 1TPH1 2W27A 1SYTA 2A3HA 5ABFA 2IXVA 5D09A 3M0ZA 1RK5A 1EJRC 1K9DA 4O0ZA 3IACA 3SECA 4BWLC 1C9WA 4FXFA 3AS2A 4MZ8A 4ICMA 1JVNA 1UD6A 4YJ5A 3DHDA 3C3NA 3OYZA 2QJMA 5TF0A 1JQVA 2GGJA 4P8WA 4HA4A 3U5YA 4N9BA 4JQ4A 1Q7ZA 2OKTA 4E4PA 4DPQA 4UQ9A 2WJZA 3EOUA 3BE7A 4C1LA 4O1CA 2A5HA 5KITA 4PMZA 2PTXA 2ISWA 4JQ2A 4ADUA 3ZXWA 2WQPA 1XLAA 5A6TC 3KBWA 3E5BA 5BXSA 4PULA 4EK7A 1GVYA 2EO7A 3UXAA 1OZMA 4LRSA 5EMJA 4DM2A 3F4NA 4IFRA 2WMIB 3WQ6A 5CJ5A 1UKTA 2IKGA 3DFPA 1NDYA 1LLOA 3IJIA 4IJRA 4KT2A 3QEZA 4LT9A 4DWSD 1ICPA 1S5TA 5A8GA 1F6YA 4EOUA 5C9RA 1US2A 3G77A 3BJFA 3AZSA 5XINA 4FF7A 3E3HA 3R89A 1BAGA 4F48A 5C71A 5A69A 1MRAA 2YDRA 1E4MM 5HR6A 2C3ZA 3I65A 4GZJA 4AZCB 5A8OA 2RUSA 3BGAA 1DJHA 2X0HA 2DSWA 3AHZA 1E6RA 3W07A 4YVPA 4D6GA 5CC6A 2Z0IA 3VCRA 2YLAA 3L0KA 2WC4A 1QHPA 4ZO8A 2PE4A 3UQNA 3CZLA 1OY0A 3ARTA 4O12A 3BW3A 4GI8A 4K7VA 4Q4OA 2YDQA 5CZSA 5GNYA 3TJIA 5AZ0A 3PBWA 4QQUA 3QV9A 3HG2A 3QPYA 4FPSA 3NZQA 2ON3A 1KCLA 1R2RA 3S3GA 4Q7NA 4PTNA 4XBJA 5RUBA 3QOKA 4XZHA 1PO9A 3ZLFA 1OX5A 4KGJA 4M6PA 1R47A 4GUHA 4X61A 3CEPA 4DZHA 2UBPC 3LZ3A 3E6EA 4R3UA 4PR4A 2PTWA 1GWJA 1BKSA 4WJEA 2DV0A 2DZXA 1AL8A 2VVNA 4HK5A 1MO0A 1Q6LA 2VI0A 5K9DA 1PYMA 2J62A 1B2YA 3UR7A 4HPHA 3WNKA 3LCFA 1IEQA 3LM7A 2CLMA 1OFOA 3RO8A 1MQRA 4GA8A 3OIXA 5SWUA 4BF7A 4GLEA 1ZCOA 3T05A 3GDMA 5BOFA 1KTCA 1EDTA 2QF8A 4J3SA 2G4JA 4W86A 3TNOA 1I0BA 2R1NA 4LCRA 5LHEA 4MGGA 3TONA 3OZPA 2ZQ0A 3FKRA 4O17A 5HUOA 1XC4A 3WEOA 1AQFA 4Z2HA 3OVPA 4LCSA 1TZ7A 1XCFA 3AHVA 1H0IA 2E3ZA 1F05A 1OCJA 4WDTA 3MBDA 4U31A 4NP7A 4LVAA 4RPPA 5FA5A 1X98A 7XIMA 4PYSA 5A8MA 1B1YA 3A3WA 2CNCA 3ES8A 3ITGA 1OT1A 4UCFA 4CQDA 2QAFA 5CSRA 1T41A 1XI3A 3CJPA 2X8RA 4M29A 2GOUA 3MO4A 4HIBA 4L64A 3HMJG 1V0MA 4FEZA 4X2PA 5DCBA 1H7XA 2PWUA 2VR2A 1F07A 4MB5A 1TE6A 4LC8A 3KDNA 1H50A 3MTWA 1HVXA 1PAMA 4Y9OA 2YB4A 1E55A 3C2VA 1ZP3A 1HJSA 3ISIX 3RCMA 2YCJA 4O0KA 4PMYA 3NO5A 4AEOA 1YXCA 1TQJA 1DWHM 1OHLA 4C6EA 3ALGA 1XDJA 2PAJA 4O54A 4L5ZA 3GNXA 4W5UA 3RAOA 1MZHA 4KFOA 4JNZA 3N2TA 1QNRA 2P5NA 3WX7A 4TV5A 3GW3A 1NP2A 2F2HA 4NG3A 1W32A 3T0TA 1VYPX 1QDSA 2YA0A 2BASA 3CLWA 1V08A 1FUYA 4FP1A 4XK2A 3W7IA 5AHFA 1M68A 2VVSA 4JTJA 4EWND 4ZSUA 1EGMA 2ZTJA 2F6XA 1RSCA 3AU6A 3BQ5A 3SUTA 4BI6A 3FHQA 3QBUA 1BGGA 1VH7A 3H23A 2FFIA 3QKZA 3QMTA 1UWUA 1HJVA 5I7GA 1LOQA 3U0HA 1QUMA 2ZXDA 1FHVA 1GJPA 3FJ6A 1JQXA 1JFHA 3GIYA 3W1XA 3T8LA 3ZVIA 2IKJA 1TX0A 4O52A 1G5AA 1OINA 1OM0A 3NURA 3CAKA 4UR9A 4L61A 1RA0A 1H5YA 3TV8A 3HGSA 2BVYA 1QK2A 4GYPA 1CIUA 3ZZ1A 4LRTA 3H12A 4B92A 2B7NA 3TLQA 2PGFA 4GQQA 3AWOA 4Z2JA 1EUAA 4G9PA 1IEXA 4ZOAA 4Z42C 2OWXA 3TN4A 1GUVA 1P0DA 1NH6A 4PMNA 1XYZA 4XQ6A 4HU0A 1KBLA 3LSCA 2PDUA 1JAEA 1GKQA 4Q4QA 1R30A 3HURA 1TV4A 3VOFA 2Z6JA 3MC5A 4F0SA 3L68A 1J6OA 1JGIA 3I3DA 3A9IA 1DJGA 1EJVC 2O4MA 1EC7A 3WIJA 3U2ZA 2I14A 3KVJA 3RK8A 2WNZA 2OOGA 1PB0A 4CQ8A 5EGRA 3MPGA 1YNQA 3T6CA 4BHYA 4LUYA 1UD5A 3F4VA 3GR4A 3VC5A 4RDZA 2E40A 3U2EA 4C6IA 4GUIA 3ELFA 3LQLA 3WK1A 2OZ3A 3PNUA 4GQRA 1PUDA 4QG9A 3AALA 3VIKA 6A3HA 3EWYA 1XL9A 3GVGA 3DCPA 4Q7IA 1LOSA 1GZGA 3BXWA 3P8JA 4GWEA 1O12A 2QDHA 3VU2A 2RDXA 3GM8A 4AXKA 4JIQA 2W4XA 1E0XA 4MJ2A 4MIMA 2PDKA 4HMEA 4JKMA 3U4AA 2OEKA 1NY1A 4NZFA 3VO0A 1VC4A 3VGDA 3KM8A 1W1IE 1OGBA 3PAOA 1ZL1A 2BZNA 4E2BA 4IIFA 4BF5A 4NAEA 3PJXA 1E6SM 5C2CA 3NDYA 5DMNA 1D3CA 1I8JA 2QULA 1E9YB 1XRSA 3SUSA 2IW0A 3MZNA 4NRRA 3CPRA 4YS1A 1J4EA 1E6ZA 1O5KA 2CLPA 2WC3A 1WUEA 2A0NA 2HPIA 3G8EA 5HMFA 1XSKA 3VDCA 2BGQA 2O4QA 1RR2A 5AYZA 3IK2A 4HQVA 1A3WA 4NNAA 3SQLA 1EO7A 2ISSA 3MSDA 1PHWA 3QR3A 1TJRA 5DXXA 3UJ2A 4LV4A 3TW9A 1VBJA 3SCRA 2ABAA 4H8NA 3NO3A 2CZEA 2PA6A 4DZAA 3GKAA 4RZ6A 5D2XA 4J40A 2WNNA 3ZR4A 5GVJA 4TV6A 3F4CA 4NAEB 2OX1A 4H9VA 4UIOA 3C2OA 1D2KA 2J9XA 2EPMX 4A8NA 1HKKA 4AH7A 5A6BD 4I6VA 9RUBA 1J10A 4UOJA 1VFTA 3PTDA 4LV9A 4KWWA 4DBEA 3L67A 4YCPA 3M0HA 5AHMA 2OYMA 3K4AA 4L4MA 3C86A 5CJNA 1E6NA 1NQ6A 2ZZ4A 1P0EA 3UZ5A 5CPNA 4AWSA 1V51A 3Q67A 1JYVA 4JY8A 3M0LA 3NG3A 3P60A 9XIAA 1YTDA 1UUOA 1VBGA 4CCCA 1C9DA 4JGDA 1PDYA 5C9UA 1MNZA 4RK8A 3ARQA 4UMAA 3QC3A 3U7BA 4J5NA 1R7OA 4HYVA 3W0KA 2ZC8A 4RX0A 3V36A 1R2TA 2MANA 3PNZA 4FX7A 1SZNA 4I6KA 1AJ0A 2INEA 4UOZA 4NZCA 1X38A 1KLYA 4F0HA 4QRNA 4M7SA 2ZCGA 1DOSA 2PZ0A 1F4HA 4P8UA 4S3DA 2G50A 2OR2A 4XISA 4MNJA 3DKLA 3UR8A 4TMCA 3IIXA 4H9MA 1XINA 5CLWA 3B06A 1YKWA 3APGA 4JHOA 4F40A 3HG4A 1A5CA 3GDTA 3YPIA 1VRXA 4H2HA 2PDBA 4YTRA 5HUPA 3NAVA 3TQ0A 1DHKA 4W7VA 4R33A 2NV2A 4WJ8A 5EA9A 3UY8A 3W72A 4W4QA 5HNUA 5BMXA 3E2SA 3MANA 4LVBA 4XZ9A 4RPQA 1NDWA 4ZQMA 3GS6A 2INFA 4D72A 2JK2A 1XG3A 5I3DA 1KWKA 1WOBA 1JYNA 4CQ9A 3W7RA 4QJ4B 2BVTA 4XTDA 2QUUA 2EG8A 1EBGA 2VD8A 2D24A 1JNEA 4AG0A 4Q8QA 4AISA 5CZJA 2WNWA 2RDUA 3DX5A 3AZRA 3A23A 5EMUA 5FKYA 4PCFA 4HNVA 3MW7A 2YKKA 2XPKA 3GNOA 2VYOA 3TJLA 1TWZA 1YTKA 3WJWA 3IARA 1UOKA 2OGYA 3K2GA 4S38A 2BY2A 3NA8A 5JUVA 1DJXA 1YLVA 5C6MA 4AEFA 4MNLA 1PPIA 3OBKA 3ARVA 1RPXA 5CCZA 1HL8A 1IWAA 2EKCA 3ARRA 4HNOA 3VYLA 1XLCA 1UWAA 3V0SA 3OODA 1BF6A 1EC9A 2Y1HA 2OG9A 1ISYA 1SZFA 5J5RA 4QE4A 1DJNA 4LVGA 1ZNNA 1R3SA 3GAYA 3WF2A 1K7XA 4DLFA 3DH7A 3LCIA 1KBBA 5D2WA 2P88A 4GX9A 2PFHA 1B4EA 2Y0FA 1A5MC 4PRRA 2IPWA 3PANA 4GCAA 5HAOA 1EJWC 3G8RA 2DZVA 3GSMA 3KEHA 2XFWA 3H24A 4ZQNA 3W37A 2BX7A 2X0SA 3E2RA 4JTRA 2XHYA 4LYRA 4EX4A 3CIVA 3RLHA 1BFNA 3WMSA 1QU4A 4S3AA 3TAKA 1XX1A 2QDDA 1VPQA 3CL6A 3IIVA 3WH9A 1FKWA 4UFJA 1J2WA 3EEZA 1LQ0A 2ZICA 4ZEPA 2WWDA 4ZQRA 1WKEA 1M3UA 1JPHA 3SADA 1EDGA 1SJAA 1QT1A 4MWAC 3V18A 4JYDA 2AKZA 2YYTA 3QGKC 1FVPA 2DORA 1DWJM 9CGTA 4UTJA 3TWAA 1OX4A 2GQ8A 3TYBA 6REQA 2ZE0A 1WB0A 1GQNA 4UMBA 4A3HA 3C3UA 3K5XA 3ZFHA 1M9HA 4U33A 3K8LA 2A7NA 4H7CA 4G1NA 3VOCA 3MI3A 2Z2UA 1C29A 3PWIA 2WZMA 5U7SA 2C16A 4LGXA 1XDLA 2VJXA 1FHUA 1Q2SA 4HNCA 1J2BA 1M03A 2YR1A 3CUJA 1IEVA 3N9RA 3W76A 3RIKA 2ZC1A 5EMKA 3TN6A 1LWIA 2JKPA 3M0KA 3UZZA 4B5NA 5CG7A 1D7FA 1C90A 3NDOA 4N6EA 3IVTA 4MYAA 3PJUA 3OA3A 2ZX9A 3AHYA 3POHA 3NQAA 2WPGA 4ZO7A 3MUCA 3MP3A 1IZKA 5KZDA 5LNSA 1VRDA 4OTKA 4N6FA 1ZBVA 3V5CA 1TZ9A 2JQXA 2B7OA 1F2JA 5EMYA 4HKPA 3FA5A 4KMQA 1E51A 3WBYA 3BTNA 1IWBA 2GDVA 2CHNA 1JRBA 4JEJA 5K4ZA 5I78A 4CQAA 4NZ4A 1TV5A 1OBAA 1W3NA 2R8WA 2DPEA 2WZTA 4PMXA 1J18A 1C8XA 1SW3A 3O6DA 4XBSA 4J35A 4MVAA 3VDBA 3HM7A 3WF4A 1TTQA 2NLIA 3MI2A 1GEQA 1H1ZA 1Y65A 1Y5VA 3QC0A 1J0YA 4ERAA 2XG9A 3M5ZA 4PC8A 3FVDA 1NP0A 2IS7A 2VD9A 1R87A 3EPOA 4KRZA 4W7WA 1QPQA 4WVXA 3A3HA 2VFDA 5CH9A 3MT1A 1GHSA 2G3JA 2GJLA 3G1VA 1U30A 3EX6A 4ZTYA 4RZBA 5LA2A 1TUXA 2DUAA 1F3TA 3LPGA 1CGXA 2I57A 4X3ZA 1S2TA 1I2RA 1XH2A 2DP3A 1KFKA 2ACSA 1BXCA 6ALDA 2IPGA 4X22A 3TIMA 1I1WA 4NAFA 3W1MA 4HSHA 1UBSA 1U5JA 2Y7FA 2QCFA 7TAAA 1EXBA 1A4MA 3PWGA 2DT3A 2ZZ7A 1D7KA 5ENLA 4MUZA 3R8HA 1TJ0A 3FJLA 3UR5A 2NSOA 3PG9A 2XVPA 2FH6A 1H3GA 5FEPA 3SRKA 5G4WA 1A5UA 1HW6A 3L4YA 2JEQA 3H4XA 1ISVA 3NPVA 4MHBA 1RLCL 3MMWA 1P48A 5AVNA 1W1B1 3LDVA 1UKSA 2EJAA 1L8PA 3KCLA 2F61A 1WYIA 1OCNA 4J9JA 4JBRA 1LBMA 4NXKA 3M6DA 1BSIA 2R1KA 1DJZA 4XVEA 3WFZA 3WL0A 1XFCA 4JICA 3VCCA 4GZEA 1F9CA 3T2OA 4JTSA 4IP7A 2Z1VA 3T0BA 3HV8A 4DUOA 1O68A 3OVQA 3AZTA 5K3VA 4EF9A 1LWHA 5HA7A 4AX6A 4Y9MA 5A6AA 3M4HA 4G7EA 3UW6A 4AZIA 4U3CA 2VHLA 5G4HC 3HG3A 3BLIA 1QPRA 3I6TA 3JRKA 2NQJA 4NKCA 5LNRA 4AY7A 2VX4A 5AC8A 2E25A 1G0CA 4ZE4A 4ZVJA 3QQWA 3GHUA 1F74A 2FGZA 5FAJA 2PP0A 1XSIA 3EWDA 4ENLA 2BSLA 3A21A 3PS7A 4LJ3A 4NX0A 4DXKA 2OWCA 1M7JA 3PZGA 4M24A 3AJ7A 1GPFA 4UB9A 2GLKA 2JGYA 3N04A 1SGJA 3TXZA 1LG2A 1KA9F 4AZ7A 1S2UA 3THAA 2GUBA 5TIMA 1W6TA 1JGMA 2FTYA 3UJFA 1G4SA 2PWGA 1BGAA 3IEBA 4FX6M 2J4GA 3W88A 3T8QA 4LBRA 4BZYA 2BG5A 3EDEA 4LQ1A 4AD5A 3WLOA 4KEUA 3PZNA 1J0IA 1XM3A 4ILSA 2HS6A 4HTBA 4M6QA 3PC0A 3EDDA 3NZRA 1ZJAA 4L7ZA 2IPJA 1YXYA 4WGXA 1CX9A 1UJPA 2B7QA 2GK1B 3NUKA 4Q4MA 1UPMB 5M03A 1X6UA 4GH1A 1J9YA 4MJMA 3MUIA 5T8GA 2FZMA 3CUZA 4IPLA 4JHZA 2E28A 3GHSA 4MZ1A 1Q5MA 4O1AA 4XZBA 3D3AA 4GXMA 4ONVA 4DHGA 4AQLA 1FKXA 2VC9A 1RVKA 3W1AA 3ITYA 4X2RA 3BV7A 2E0PA 4Q8MA 1KCXA 3TLLA 1U83A 4S23A 3ANYA 4I8DA 4O8AA 1SFTA 3G1XA 2V30A 4JXCA 2W91A 1O66A 2AAAA 3RRAA 2NT0A 4LS0A 3W24A 1C7SA 2BDQA 1DQUA 2G97A 1PTDA 1BRLB 2YCLB 1ZJHA 4XZNX 5AYIA 3HGRA 4PEKA 3HQNA 4PBEA 1V8EA 1TMLA 2P0IA 1VF8A 4MKSA 3QHNA 3N2OA 2ABBA 2QJNA 3WBAA 4IXHA 4YMZA 2XVLA 2PCEA 1TPFA 1CLKA 3CV6A 2FH8A 3C61A 4JQAA 2Y8VA 3VNYA 3RITA 1UP3A 2V5JA 2ZWZA 5DRIA 4EPKA 1VB9A 1OK6A 1HKMA 1EJTC 1PZ0A 1UKPA 2NUYA 4W85A 1TRDA 4W88A 1KGWA 3NOEA 3LCLA 4MTVA 1F4AA 3WJYA 1ML1A 3HQPA 4AZ6A 1QVBA 3KBJA 4NJGA 3R13A 1DJQA 3W74A 3DG3A 3SR7A 1UASA 1GPWA 1Q4NX 4YYCA 1VBHA 3UCDA 3U8GA 3N3MA 3WK0A 4B5TA 3TTEA 4H3DA 3G1AA 5BOOA 3TEVA 4AAJA 4JTKA 1WUFA 3B0XA 4IMDA 3O07A 3UT0A 3MUZ1 4ZB2A 5KZEA 4IIHA 4L80A 3C0QA 3WDRA 2XWDA 1R9XA 4IMGA 3SJ3A 5AHEA 4IL2A 4GC3A 3KOYA 3FX4A 3KLKA 1I0DA 2QPXA 2A4AA 4GK8A 3USBA 2Z25A 2PF0A 3O0FA 4D6DA 4JQ3A 4ZB0A 4F9JA 1XYFA 4YPJA 4ZZ9A 3U9IA 1W5OA 4LUJA 3SM0A 3WH6A 4D9PA 4O53A 3CQKA 1E0UA 3OGRA 1M04A 1TE1A 4V1YA 2OQLA 1R6WA 2BGNE 4DAFA 1Y0EA 3VGGA 2TODA 3MO7A 4IUGA 3WQPA 2CLLA 1J01A 3TKFA 4O1BA 4NHVA 4XD3A 4GO8A 1MYRA 1JCYA 1IZCA 5FJJA 2DZUA 3NQ7A 2IKHA 3BLPX 2WHJA 2G5WA 6TIMA 1U33A 2E09A 3VNJA 1KGXA 3PSVA 2GJNA 1NWUA 1UCWA 2VFGA 5CZ0A 4UC5A 1VYSX 4CCDA 4LUTA 4KRTA 1JZ2A 4JIHA 3VX0A 2HCVA 3DFOA 2G3IA 1WOAA 2YPIA 4CNPA 5E6ZA 1EP3A 4IPPA 1OSEA 2QCEA 3QGAC 1E15A 2XTKA 3WJSA 5J5DA 3A6OA 1KM3A 3QYSA 2VX6A 3OZYA 3ZT6A 2W62A 3WBEA 2XSAA 4UQDA 1PE1A 1JF5A 3G1HA 1JJKA 2ZX5A 1IE7C 4AC7C 3NFUA 1GT8A 4B5XA 4DRSA 3WNOA 4MF4A 1EOMA 4J1OA 1P1MA 4IT1A 1FWNA 3IAQA 1KXTA 2X05A 1P6CA 1QI4A 4DNMA 3PTMA 3UJRA 1IEWA 3ARXA 1KO0A 3VOJA 4Z0JA 3TTYA 2D0GA 5K4XA 2X16A 3QQ1A 1P0BA 2PDMA 1XD1A 4FLSA 1NOFA 3FCPA 3RXZA 1P7TA 3BGJA 1H09A 4KERA 2NXGA 3NZ1A 2R91A 1A4LA 4IG2A 3QW3A 3W01A 5ABHA 3L4WA 2XSBA 5K9XA 1I45A 2H9AA 4Q6JA 2PBOA 3AMLA 2DIJA 4AIUA 4AF0A 4GFIA 5FJOA 2GWNA 3MKCA 1AH4A 2EBNA 3NQVA 1UR9A 2HVNA 3SQSA 5K9CA 2WJEA 1N8WA 2P1FA 2HE5A 3GTXA 1HJUA 2ASHA 4GBUA 1TKKA 3FHAA 7ODCA 1LUCB 4DJEA 3CT7A 2BS9A 1JI1A 1A5LC 3TA9A 2VEFA 3BOXA 1O5RA 3B0UX 1NTHA 1XIIA 2J8GA 4G56A 3MI6A 1FWBC 2EKGA 3UWEA 2J7BA 3UXKA 2PB1A 2GZXA 1O7AA 3GH4A 1SQ7A 5AYXA 3VXGA 5K2ZA 3TJ4A 4N7QA 4Z0SA 3P61A 3B40A 2ATMA 2H9AB 3UU0A 3QY7A 3RU6A 3TX9A 4AW7A 3SDOA 4LYKA 2OMAA 5FL0A 3GTNA 4Z1BA 2DDXA 2PLJA 2DUZA 4PCTA 4NL1A 4O10A 4S3CA 3ABZA 4C7FA 3UG4A 1X1ZA 1QMLA 2ISVA 2E1WA 2JBMA 2C0HA 4OBTA 1EF3A 4ADSA 1JNDA 2ZBTA 4E38A 4RCXA 5EMMA 4C7DA 3KCJA 2WLYA 4OZOA 1XCWA 2VX5A 1XGDA 3KXQA 2A6LA 1K4HA 2NX9A 2X30A 3IJ7A 1WAUA 3LLFA 5A8NA 5CBJA 4QXIA 3ABOA 1ALDA 3L65A 2FZ8A 3H6OA 4FR1A 4V1XA 1NJJA 3PZUA 1Z44A 1RV8A 3BZJA 4IGHA 2PLKA 5HATA 3EA3A 1E0VA 3NQEA 1O94A 1TJPA 2VGGA 3W81A 4ACYA 2ZE3A 1KQZA 4WQ6A 3VNMA 1ZAJA 3NIYA 3N2BA 4MFEA 3NR0A 3VNIA 3B0VC 1OCQA 1LZOA 2X1IA 3R4IA 1KC7A 3AAMA 4EANA 4ZR8A 3W1QA 3THDA 4BI5A 1ZJBA 3M46A 1QHOA 3TC6A 3CU2A 4PUEA 4FHAA 2CYGA 3VILA 4O1EA 3CO8A 4Z2LA 1JI2A 4Q8PA 1XGEA 1DPMA 1Y5XA 8XIMA 4N4PA 3WMBA 3BK0A 4FB7A 3OO2A 3PZTA 3UWZA 4B4FA 3SY1A 3NQ6A 4PFMA 5E0CA 3MB9A 5A6MA 4PRWA 4UTWC 1CXLA 4XIAA 3KOWA 1GVEA 4ZXOA 4MLRA 2W67A 4P8VA 4IQJA 1GYMA 1H63A 1VBUA 4LFYA 5G1YA 2W61A 4B15A 4CQCA 3GX9A 1S5VA 4JTQA 2DEPA 4XX6A 2H6RA 1JCNA 5AFDA 1JCLA 2ZA3A 1TPEA 4OHQA 3EMQA 3E0WA 1WBHA 3CM4A 4B4HA 2FVKA 4GYFA 1FHLA 2J6XA 1WXJA 3ABQA 1QI3A 1VJSA 4AZHA 4WLCA 4INFA 5TD4A 1VKFA 4IICA 4AUBA 4BEQA 3Q94A 3WLHA 1KKOA 5M5DA 1EQCA 3CXOA 4YN5A 1JAKA 3QN3A 2ZTKA 1SSGA 2ZZ2A 3MHGA 3TVAA 5KZMA 1ICQA 2V2DA 1NEYA 1LYXA 2V82A 5HINA 1EXPA 3E12A 3QQ0A 1FDZA 1GKPA 4AXNA 2PGEA 1ZFJA 3W26A 1BYCA 4DWDA 5KETA 1KXVA 3TYCA 2NWSA 4RNHA 1OG6A 1DTUA 3AI0A 2IPFA 5DMYA 3B8IA 3AICA 2YX0A 2QGHA 1IXNA 2QS8A 2GPTA 4MG4A 1IYXA 3NL2A 3R79A 2R94A 3KBMA 4GE8A 4HA1A 1CTNA 5FEWA 3OG3A 5FCZA 3AXMA 3HPFA 1TPUA 1TCDA 1DJIA 2DIKA 3NM3A 4JY9A 5F7UA 1V3JA 2V9DA 4JIPA 5LYRA 1PKMA 2B7PA 4HHHA 5EB8A 1SO4A 3ZWSA 4PE8A 4GY1A 1OABA 1VENA 3QY6A 2F84A 2F6KA 2CBIA 3I7RA 1FWAC 2BFGA 3PZVA 2ZXAA 1UBPC 1ZRQA 1RAKA 3W00A 3ES7A 1Q45A 3F2BA 2GQ3A 3HV9A 2ZA2A 1K7FA 1SU5A 2SFPA 3DN5A 2OO0A 3W7MA 4MFDA 3H7RA 3QPZA 3GXTA 1XF0A 3LXAA 3V5OA 2V81A 1LG1A 4C5ZA 2QMKA 2WM0A 1XRFA 4CEUC 4WY0A 3MUXA 3ZWTA 3ALFA 3B0YA 5IBXA 3AHTA 3GHRA 1QNOA 2IQTA 1AJ2A 2FMOA 1I2OA 4JFTA 4LANA 4UQEA 1XIGA 3H4GA 3ANVA 1VGAA 2I5QA 4WKFA 2O56A 4DIAA 3VI2A 4C1KA 2D20A 1CT5A 3CLMA 1PV8A 2HV5A 3W7LA 3EYPA 2ZFAA 1NSJA 1FWFC 3SCQA 1MWOA 4EAMA 2YW4A 2WJFA 2ZXBA 2HQAA 3W71A 1CCWB 4D8ZA 2V5KA 3TOYA 2HSAA 4GJIA 4IMEA 3HU7A 5FD0A 1XIFA 5FESA 1UOZA 3SY8A 2XZ7A 3EWCA 4XD6A 4XKYA 3D5HA 3SIMA 3G3DA 4NI8A 2GWGA 2X41A 1VQTA 3SN1A 5C7VA 1C93A 2J79A 1PHQA 2Z27A 1O5XA 5AB3A 2DZBA 4QEEA 3WQOA 2FB3A 4IQDA 2G37A 3PTQA 1X1NA 4OKDA 1B31A 1ZU8A 1TREA 2VP8A 3KAOA 5EPDA 3W9ZA 4C1NA 5D05A 5DCDA 3TWBA 4LEFA 3CMFA 3S2MA 1FCBA 2BHZA 5CKSA 3QTPA 4A6GA 4TVCA 1BF2A 1JDFA 3CNYA 1M01A 1P1XA 2VGIA 4U3AA 4ORIA 4MAVA 4CUCA 3GWQA 2GGEA 1KRBC 1M41A 2YL8A 3SUVA 1FWGC 2E6FA 2J88A 4JL2A 2RJHA 3ZMRA 1V4YA 1JDEA 3GH5A 4HOXA 1Q4WA 4AD3A 3G2GA 4HSOA 4XKYB 3UG5A 5XIAA 1K8CA 3NYZA 4H83A 3WN6A 1XKYA 2WCGA 3WLRA 2GFTA 1E9LA 3W25A 3EB4A 4JN8A 5F4SA 2GVEA 2E9BA 2L5HA 3WO8A 1UB3A 3LV6A 3SI9A 2WV8A 1UH4A 5A94A 1KBJA 5D32A 1FHDA 5A8QA 2BMBA 4R7OA 3G0XA 2D69A 3KP1A 3E2VA 1NWRA 4OIFA 4QLJA 4CCZA 3P14A 1X8CA 4NU7A 1WNOA 1QW7A 2PDIA 1YW1A 3BH4A 2CERA 1MXGA 1SO6A 3T9PA 1ELSA 1H7WA 1V6TA 5FJRA 3NDZA 2VT0A 2NXIA 1UZHA 1KQYA 2QLYA 4IFKB 1SJBA 1KRCC 4AX7A 4E5TA 3N6JA 4TUFA 4MLJA 3RPMA 1E9IA 4YVXA 3AOFA 5A6KA 4ICCX 4CU8A 3UG3A 3RILA 5CBIA 2B31A 1XWYA 3AQUA 3LI0A 4QJ1A 3LCWA 4ML9A 1OT2A 1CI1A 1R85A 2FTWA 2OTDA 3N3TA 3BANA 1PVNA 1YPIA 5C55A 1S3TC 5BZAA 1XYMA 4Q32A 1AG1O 1US0A 4GUFA 1L8NA 5TAOA 1QAPA 1NQKA 1A5KC 3RM4A 1HF6A 2TAAA 4RE0A 3LBCA 2J7DA 1G6CA 1Q2RA 1IIGA 1J93A 1Z3NA 4PFHA 4FNSA 1K9TA 2YBUA 1JD7A 1PEZA 2VC7A 3MHFA 3LI1A 2V63A 3NGJA 2CBVA 3HPSA 1SVDA 1TMHA 3KL3A 2W3ZA 3M07A 2HMCA 3AS1A 2F38A 2OT1A 2V69A 3OP2A 3LY0A 4EAYA 4H1ZA 3WQDA 3AMDA 3B8SA 2DW6A 3AXIA 1EL3A 3T78A 2TYSA 3IJQA 3OTRA 3TN5A 2HK0A 4AEEA 3QKEA 2DSKA 3RX3A 1RH9A 4E2DA 2A3LA 2DSVA 4GKTA 4KH2A 2ZUVA 5A6JA 3MBFA 2XU2A 5LNVA 1IHIA 4N9EA 4G7FA 3SJNA 4HYWA 3KS5A 3OYXA 1KB3A 3T07A 3BICA 5G1TA 3QHOA 3ZJKA 3AYRA 3W02A 3GVVA 3QZ6A 3S2LA 3GUWA 4GD0A 4PH6A 4B5SA 3STGA 1B9BA 3KRBA 1W17A 1Z69A 3RPDA 1TYGA 4Y9PA 3P3BA 2QPSA 1F6PA 4LY8A 3CMGA 1K70A 4HU8A 2QYGA 2PTDA 4L4OA 3LBMA 3ZVHA 4DBSA 3KRSA 3P7YA 1TPDA 1L0PA 2Y5EA 5E9AA 1FQ0A 4GJJA 4F2UA 4YCOA 1F7BA 1V7YA 2F6UA 3DAQA 5D8WA 4H00A 1MUWA 1F8IA 1A5SA 3EKZA 1TWWA 4LAZA 3HFYA 4NX5A 3IANA 3HZ3A 2J78A 2JFEX 1DBTA 1DJYA 4BQ4A 3ITTA 1A47A 4ZGYA 1RPKA 1YDOA 3HPZA 3SGZA 5CG0A 3WQFA 4CQBA 5FJPA 5DEZA 2QKFA 4AHPA 3IUDA 4QDWA 5F2LA 4AIBA 3WFLA 3CV1A 5DBUA 3VAVA 1H7RA 1D3GA 1Q6CA 1XPYA 1XJBA 3BCDA 4A8RA 2V2HA 3C0JA 1SPQA 2OLHA 3OIHA 3STPA 2BGSA 1S5WA 1XUUA 5DMMA 3RO6A 1QI0A 1KXQA 4H8HA 3BAYA 3N18A 3W7JA 4PMOA 3URNA 4JTTA 3LM3A 4EACA 1Y8BA 2VQTA 2VOTA 5G4EA 5HR7A 1V93A 1YPXA 1YYAA 4LC6A 3AIWA 3PJWA 4UFIA 1WBJA 1UR3M 1R8LA 1ITUA 3HJZA 3HTWA 3NM1A 1ADDA 1CB7B 2AOSA 2YDSA 4HPXA 4YU1A 3PFRA 4JHMA 2Z7KA 3LGEA 4JIRA 3A5VA 2C1HA 3CMJA 1W2VA 3WJZA 1O95A 3WQCA 5DQPA 1TWIA 4XAGA 3BUVA 1UROA 4FF5A 3A5FA 3KBVA 1AH3A 3ATYA 5IRPA 1LL6A 4LAMA 1CDGA 3BOLA 1OYCA 1ZAHA 1EF2A 3TZNA 3A4XA 1XDMA 2WNQA 2FB2A 3ENLA 1JUBA 4D6CA 3H7VA 3QMRA 3MKVA 4K39A 4J2PA 5LSMA 2X2GA 3QZEA 3L4TA 1DWGM 3M0JA 1JCJA 4N0RA 3AXHA 2CITA 1WPCA 3H55A 1ZTVA 4W93A 3VIIA 1E5JA 1JDDA 1KKRA 3CPUA 3V5FA 4DJED 2PDLA 4K1WA 1UG6A 5HNNA 4DUVA 3PTKA 3I6RA 5FF4A 2JEPA 4WY0F 2QCHA 1BYAA 5AC7A 1A0DA 1GW1A 3PUDA 5HWNA 1DWAM 2DFAA 5E0FA 1OCBA 4HD5A 3OLEA 5BXRA 1NM9A 4ICNA 4E3VA 4P8XA 1FXQA 2PWDA 1K6WA 4M56A 2PF8A 1LLZA 4BJHA 1JXKA 4JFVA 3U6WA 1PL9A 1FTXA 2QVHA 2ZRXA 4N42A 4AMCA 4HA3A 1IT8A 4H04A 3EDJA 1J79A 2REQA 3CAWA 4ZBCA 1AQ0A 2CHOA 1DE5A 1VEOA 3B8UA 4NZ5A 4KS0A 1VPYA 1CYGA 4PODA 5HK4A 4YXGA 4JN7A 3LGGA 1LQAA 1VLIA 4R9XA 4O15A 3W75A 4WOQA 1IXOA 1PZ3A 1OYAA 4ERIA 5D2YA 1WZMA 4J3TA 5CSSA 1VEMA 3BPWA 4BI7A 4NNBA 1JG9A 3NOYA 3E5PA 3CWNA 4PCPA 2NV1A 3GBEA 1HGYA 2ZZ1A 3F4DA 3IGSA 3NVTA 4JKKA 4DI9A 4U2YA 4AD2A 3UWYA 4YTQA 3K1GA 3M0VA 1K7EA 4QDPA 2DVTA 2X1UA 2V5BA 4JD4A 2VKZG 2WKLA 4B9ZA 1GOWA 4QDMA 3VIMA 4IM4A 1MUMA 5D2VA 5CC3A 1PXGA 1KCZA 3P67A 3PN8A 4LB3A 2PSNA 3MYOA 1UUQA 3I4EA 4BK9A 1TVNA 1KFBA 5E70A 5A95A 1KD0A 3H2FA 3Q2DA 3S5OA 4JR5A 1V3HA 4I9MA 5JH1A 4YTSA 1ZENA 1KM1A 3IWPA 4GI6A 1TR9A 4LPCA 5D33A 4U2ZA 3VKBA 4EXAA 4WCJA 3BDKA 2BWGA 3VUSA 4H7VA 4ML4A 1R3WA 1E43A 3ITCA 4H41A 4LYQA 3TR2A 1G01A 3ZO9A 3WLNA 2CZFA 1QNVA 4HN8A 4QTGA 5DX7A 1H11A 4MB4A 2PP3A 4PA8A 3C2YA 4FNTA 2QIWA 4RZ4A 1UYQA 5I77A 1J8VA 4O18A 4XZLX 3IJ6A 4B3ZA 2R9RA 1AH0A 1IQ8A 2X1TA 4KCTA 2QV5A 1FP8A 4M3PA 3GFXA 1J6PA 2GDQA 3KDOA 2C18A 2V3EA 2QUVA 2VZUA 4NNCA 3ZLHA 1XIHA 3GY1A 3VOIA 2I9UA 3LCGA 1JZ3A 4XSLA 3R8RA 2NUXA 4UNKA 3GIPA 1W9BM 1SR0A 4DUXA 1EEXA 3WDPP 2Z6IA 1J0JA 1UIPA 2BP1A 4GUGA 4CNSA 5GJNA 3PP7A 2XDFA 4AWTA 2XFRA 3WD3A 3M6YA 3P80A 1ZGDA 1NWTA 4QR6A 4HHMA 3AS0A 1B4KA 1TO3A 1R46A 4A21A 4LAOA 1SO3A 3APTA 3M0MA 5KEZA 4JX5A 4I9TA 3S2JA 2QCMA 1KGUA 3P2VA 5LXEA 4URIA 4O19A 2VFIA 2FYMA 2Z24A 1TG7A 2ADAA 1V6XA 4XZWA 3EAUA 5EMLA 5EYWA 1V5XA 3LA4A 1YNPA 2H3BA 1GQLA 1ADOA 3AMGA 3GG7A 5I07A 3MV01 4UMCA 3VKAA 4LBUA 3H2OA 3W7GA 2J9ZA 3N13A 5AYYA 4JIEA 2X0YA 2QCGA 5G1MA 2PDCA 2Q8LA 3P84A 1LROA 1O4UA 5KINA 3EXTA 2V2CA 3W6YA 4QNEA 4ZMGA 4ZQPA 2I56A 2PRLA 1OWQA 1PX4A 2YCEA 3R58A 2WWCA 3AO0A