2PDUA

Human aldose reductase mutant c303d complexed with idd393.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSDTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pduA00
2PDCA 1MZRA 4DBWA 2HV5A 3V0SA 1UR3M 3CAVA 3EAUA 1RY0A 3CAQA 1M9HA 5M2FX 1ZSXA 1R38A 2WZTA 4GA8A 4PMJA 4JQAA 2A79A 4G5DA 5LIWX 5HA7A 1X98A 3LBOA 3BUVA 4JIIX 2BGQA 3Q65A 2ISFA 4XZLX 3M4HA 3G1RA 2PDGA 4WDUA 5AZ1A 4PRRA 1PZ0A 1LQAA 3H7UA 3WBXA 2DV0A 2R9RA 4WDWA 4I5XA 1YNQA 4GABA 3GHRA 4ZFCA 3DOPA 3ERPA 1XF0A 2PD5A 3BCJA 3LD5A 3GHTA 4WDTA 3R43A 2NVCA 2PDYA 2IS7A 4EXBA 1A80A 5HNTA 2CLPA 1QWKA 1AH4A 3UFYA 3UZZA 3RX2A 3C3UA 2PDFA 3N2TA 3R8GA 5C7HA 4JQ4A 2IPFA 2PF8A 2PDBA 2PDJA 1MI3A 4XZIA 4WEVX 1VBJA 2F38A 2ACRA 3MC5A 2IPGA 3LENA 3N6QA 1EL3A 1PWMA 5LIUX 1AZ1A 4L1WA 4XO7A 4JTAA 1S2CA 1MRQA 4JIHA 4IJRA 1K8CA 1XJBA 4QX4A 3MB9A 1LWIA 4PUWA 1FRBA 2HVOA 2I16A 4JTRA 4H7CA 4XVEA 1Z3NA 3LZ5A 1AH0A 2IQDA 1AZ2A 2PDMA 3V35A 4RPQA 4FZIA 4JQ2A 1RY8A 4YVPA 4XO6A 1US0A 4WGHA 2IKHA 1JEZA 3B3DA 3ONBA 4IGSA 5HNUA 1IEIA 2BGSA 4XZMX 3LEPA 3EB4A 2WZMA 3UGRA 3CMFA 1YE4A 3CASA 4YVVA 3WG6A 1HW6A 4H8NA 4QBXA 3RX3A 5AZ0A 1J96A 2PEVA 1T41A 2PDLA 1HQTA 3FJNA 3QKZA 4YVXA 1ZQ5A 4Q7BA 2NVDA 2HEJA 4AUBA 3V36A 3LN3A 3FX4A 3R7MA 3R6IA 1EXBA 3GUGA 2FZ9A 1C9WA 4JTDA 5JH1A 3VXGA 3GHUA 2IQ0A 4GQGA 1AFSA 1Q5MA 2R24A 4WRHA 2PFHA 4LB3A 1GVEA 4GCAA 4QXIA 2PDHA 2F2KA 2FZBA 5JH2A 2PDPA 3O3RA 3LUTA 3P2VA 1T40A 5KETA 3UYIA 1VP5A 3LNMA 2IKGA 1IHIA 2PDQA 3LQLA 4ASTA 3H7RA 1PWLA 1X97A 4LAZA 2ACUA 2HVNA 2HE5A 3RX4A 1QRQA 2PD9A 3BV7A 1X96A 4IJCA 4PUUA 2VDGA 5DANA 4YS1A 3M0IA 1EKOA 4JQ3A 4LB4A 4MHBA 4FAMA 2IKIA 4HMNA 2PDNA 2PDUA 4XZNX 1SM9A 3H4GA 3D3FA 2IKJA 1YNPA 4EXAA 2HE8A 4JQ1A 2DUXA 5LIKX 5LIXX 1ZGDA 1S1PA 1Z89A 4XAPA 1AH3A 4LAUA 1PYFA 4L1XA 4GQ0A 1Z9AA 3UZYA 1ZUAX 2HDJA 4JTQA 2FGBA 1YE6A 2BP1A 1S2AA 2ACQA 3R94A 3R58A 3CV6A 4WDXA 3CV7A 2QXWA 3BURA 1Q13A 3KRBA 3ONCA 2ALRA 3M64A 3Q67A 4YU1A 4QR6A 2PDWA 3LZ3A 1EF3A 2INEA 2INZA 3F7JA 4LBSA 4GIEA 4LBRA 2P5NA 2DUZA 3V0UA 2PZNA 4XZHA 4GACA 3COTA 2I17A 4FALA 4FA3A 1XGDA 4NKCA 3S3GA 2PDIA 4OTKA 3G5EA 3GHSA 3T42A 3WCZA 3UP8A 4Q3MA 1ADSA 3UG8A 2J8TA 2FVLA 3UZWA 2IPWA 4JTCA 3WBYA 1OG6A 3EB3A 2IPJA 2PDXA 4HBKA 3DN5A 4JIRA 2FZ8A 4PRTA 1PZ1A 4ICCX 4XK2A 4F40A 4PR4A 4R9OA 3WBWA 3O0KA 5LIYX 2PDKA 4DZ5A 1Z8AA 3NTYA 3LQGA 4XVDA 3V0TA 2AGTA 3U2CA 4DBUA 1S1RA 1RALA 3R8HA 3UZXA 3UWEA 4DBSA 2ACSA 2FZDA 2C91A
chains in the Genus database with same CATH superfamily
2JKPA 1VS1A 3MSYA 3LU2A 4DBWA 2JIWA 1QR7A 2QVNA 3BLDA 3I3DA 3PTMA 3TZNA 3QFEA 3FSUA 3W6YA 2Y7GA 2CLKA 3L7RA 3V7PA 1X98A 1EYWA 2Z6IA 4JAWA 1W5OA 4MFDA 1M41A 2BY2A 2BHZA 3NM3A 3TH6A 4WXYA 1FA2A 5CC7A 2GVYA 2V69A 4A3YA 5GNXA 2WPGA 3H2OA 4IQDA 5EBUA 3O15A 1QNVA 3VX0A 3GG7A 3UWVA 1O66A 1QVBA 2YL5A 4QGCA 1XCXA 2ZC1A 1PX3A 4OOZA 1GT8A 1Q7ZA 2O7QA 2JKAA 3CJPA 5FA5A 1V0KA 2UY2A 1NWUA 3DHFA 3BLEA 4OBSA 4ZSTA 1QMLA 1MSSA 3HPFA 4P61A 4W89A 4D8AA 3W2MA 2DSVA 4ZSUA 3ZJ7A 2QIWA 3M0XA 3A3WA 1TWDA 3GXIA 4I9JA 4QG8A 4I7WA 3K8KA 3VD4A 1XDJA 4JNYA 1VBJA 3MBDA 3CPGA 3S9YA 4NG3A 2C15A 3ZR4A 2P50A 3AICA 3CHEA 4OT7A 4U33A 2E6YA 2PURA 3S5NA 1JPHA 2D3LA 1XLBA 3T0CA 3WLNA 4HOWA 4ZVJA 3KBVA 2YCLB 1B3YA 4CCEA 2QLYA 4LCQA 1XYAA 5HPCA 1K77A 1PTGA 3SI9A 1GPFA 1LWHA 4LANA 5AC4A 5F2LA 4C6OA 4XO6A 2VELA 4EKJA 4MB1A 1GOXA 5BMXA 4ZOAA 1MNZA 3LRKA 4F9JA 2OX1A 1H0GA 1HXJA 3LCHA 3N11A 3MP5A 3TCEA 1TV4A 5B7ZA 3W7LA 4JDBA 1NY1A 2GDQA 3KEHA 1OVDA 4L9YA 1KBIA 1PDZA 2ZWYA 1S46A 3VGDA 4IG2B 3H2FA 3EDDA 2FIQA 4XSLA 2HS8A 2VEPA 4QLLA 1THFD 3R12A 3WK1A 3VDHA 4JKMA 2WC4A 2GWGA 1IT8A 4FOJA 1OZMA 2OX4A 3W0KA 1A5MC 1EA9C 3SB0A 5A2CA 4QDPA 3ICJA 2R1LA 5FJPA 4MWAB 2BVWA 1KRCC 2I9EA 3XISA 2V5KA 1D2KA 1N7KA 3G8EA 3GFZA 3CYJA 3A24A 3TTSA 4DJED 4XAYA 2OYMA 3A21A 3BH4A 2J7HA 3GNDA 4ZGYA 3HMCA 2CITA 4DYKA 2WJZA 2JE8A 1XLCA 4GQGA 3WZ0E 4RDZA 4M19A 1NAL1 2IW0A 4JTSA 1E9ZB 4HU4A 1JGMA 4QXIA 4BHYA 4DXVA 2PP1A 2F2KA 3A47A 2PDPA 3AHXA 1HO4A 2OWWA 1IEXA 5LNVA 1REQB 1EOKA 4LAMA 4UFLA 3W7QA 2KAUC 3I4KA 1PUDA 4W7WA 3S5SA 1JNEA 4R53A 1X97A 1VQTA 3NA8A 3OQEA 2ACUA 4N9DA 1NIUA 4BI5A 5A6TC 1SQ7A 1H7OA 3D6NA 2PTYA 4PUUA 2O9OA 3UWUA 4G9PA 2CETA 5C9ZA 4F2TA 1F5ZA 1IYXA 4AD1A 3NJ3A 3BVJA 3VIGA 3CUHA 4FAMA 2Z27A 1L2QA 3MKVA 1YNPA 3S1XA 4PMZA 1AH3A 3NVDA 4MWAA 3SO7A 1PYFA 3FYOA 3TCSA 1Q4WA 1DIOA 1QI3A 4LVFA 1P0KA 2NX1A 3G2GA 3S9IA 2G3JA 3VCNA 4A3QA 3I3BA 4YYCA 1GVOA 3WLQA 3CIXA 5CPSA 4A29A 1BG9A 4LALA 3U2EA 1EC9A 3T6CA 3U48A 3II1A 2R91A 4C6JA 5DXXA 3N17A 3STPA 4L6DA 4O8AA 3TNBA 3CHDA 4MZYA 1EF3A 1BYDA 3CEPA 3WLMA 4ZQPA 1FXQA 1VC4A 1EYEA 1E1CB 1NTHA 2VGFA 5HMDA 1JQVA 1UG6A 1XGDA 5XIAA 7REQB 2ZKMX 3BICA 4GY1A 5E5CA 3AIBA 4O19A 5HANA 2NQLA 1D3GA 3PPGA 1ADSA 1N82A 3WBEA 2A3BA 3DIPA 4M82A 2BNJA 1OC6A 3W07A 1ODZA 2JEPA 1FWTA 4B2DD 2GUYA 1EUAA 3AHTA 2DW6A 5A6BD 2ZRXA 4Q4QA 4Q8QA 3VOCA 2FKPA 3IPWA 4B4FA 1JDEA 1EDTA 5CKSA 1DORA 2JGQA 4A21A 1K9TA 4NILA 1EWDA 3CXOA 4Q7IA 5D8ZA 1FCQA 1EO5A 3ZO9A 3S2NA 1U1HA 3VC5A 1XLJA 2O9PA 3APGA 2VEMA 3S9ZA 3OGSA 1QW7A 4WKHA 3CAQA 1M03A 5HINA 2E1DA 1LOQA 1LQ0A 2OB3A 4DJDC 1E1CA 2AQOA 2EPLX 3SGUA 5JXQA 1H1ZA 2DSWA 4GRSA 3VPLA 3BTNA 3NO3A 2DU2A 1SUXA 3Q65A 4MY8A 5FACA 2H8ZA 4FF5A 5AHNA 3IIPA 3C5QA 4UNLA 5FF7A 3WBXA 2W67A 2VKZG 1FQ0A 1VJZA 4IGMA 3B9OA 2CIPA 1MDRA 3LI1A 3CWHA 1U83A 3B4UA 4QJ5B 1P7TA 3W28A 3SZ8A 2YBUA 4EXBA 4NSBA 2ZRVA 1NP0A 1FCVA 2Q6ZA 1U30A 1E3ZA 4FNSA 4GD0A 4HN4A 4E2VA 3PC0A 4J5NA 5HWMA 2OKOA 2OQYA 1Q6GA 2XFRA 1UWIA 3W70A 2UV8G 1J9YA 3P67A 3HG3A 4GUJA 2RDWA 4O1FA 1UIPA 5H8MA 4AZHA 2VWSA 2CHRA 1CLVA 4TO8A 4KEMA 1MVYA 3SY8A 3E74A 3HG2A 2E67A 4H41A 5F1VA 6TAAA 2IPGA 4GC3A 1EL3A 2X1UA 4Y8FA 3ZR5A 4TOQA 1EJWC 4LUTA 3FJLA 1XYMA 4J27A 4GCXA 2R1KA 4JIHA 3NQ7A 4NX0A 4PUWA 1FRBA 2VFHA 3T07A 2XH2A 2HVOA 5FJOA 1PE1A 3AIVA 4H7CA 3SUTA 1EJ7L 4IGNA 1V6XA 4M81A 1OFBA 4O10A 2PLMA 4XAGA 4A2SA 1NVMA 5ECUA 3V3WA 1ONXA 1MQPA 4JQ2A 2R82A 5JBFA 3UY8A 1Y7VA 1MW1A 1UPMB 4LVBA 1E6XM 1IEWA 3KVJA 4EXQA 4I7UA 2VEGA 9RUBA 1KM3A 4ZO7A 4ADSA 2YYTA 3UG5A 1VJSA 1TMQA 2ONEA 1T8XA 1FWJC 2RAGA 3TUUA 5HNUA 4CD8A 2XWDA 3N73A 4AXNA 4X3ZA 1XL9A 3C6CA 1XKYA 4IIGA 1W31A 1WKFA 4Z2KA 2C1HA 3M0YA 1G4TA 3V5OA 3B8VA 4KCTA 3GDKA 5F2IA 3WKZA 3OO2A 4G7EB 1WB0A 3M5XA 2WC7A 4JNZA 3L21A 5CXPA 3TAKA 1RD6A 5T26A 2VRKA 3FJNA 1OD0A 1Q63A 3GXMA 3RFAA 2WOQA 4D6FA 1POJA 3UZ5A 3MDWA 4NYYA 3ALFA 1TELA 4XWUA 1I0DA 5FJUA 4LFYA 2OWXA 1CEOA 3M16A 5C6MA 2W62A 1XBZA 3MUXA 5B7YA 2AGKA 1XDMA 1KKOA 3WL1A 4OVXA 4RE2A 3POCA 3AU2A 1QO2A 3MI3A 3WUEA 1Y5XA 2QS8A 3LRLA 1AFSA 4XKYA 5I5RA 1CCWB 4KWSA 2Y5JA 1ISZA 4O4VA 2FZBA 1YADA 1S2VA 3MSRA 3RHGA 3R8RA 5I79A 1VB9A 1AL7A 1OYCA 1AMYA 1S2UA 4EAMA 1K6AA 1OJXA 1A49A 3WNPA 3GXTA 5CG0A 4B5NA 1DWHM 4JX5A 2WLYA 1E40A 3PBGA 2EAWA 2HE5A 4K1WA 3FSTA 3UY7A 1EC7A 4ZQRA 4EWND 3BAXA 4LB4A 4MHBA 1B5TA 4ZB2A 2PGFA 3D3FA 3GDMA 3AC0A 3IK2A 4W4QA 2WNZA 4EXAA 2GJNA 4U5KA 1DJYA 2QQ6A 1TUXA 3ZVHA 1CGVA 2ATSA 2YW3A 1J10A 4QM1A 5JMUA 1ZCOA 3A4WA 4GQ0A 2XUCA 2GQ9A 2HDJA 4JZ5A 1JYNA 2NV2A 1A3WA 3RLGA 1KV5A 1HGYA 3CV6A 4E4UA 4JYEA 3MYOA 4UBPC 3DGBA 3O9NA 3W1XA 1EFZA 2X16A 3NQ2A 4MIMA 4ZFMA 4C6PA 3V1PA 2ESCA 1XUUA 3EKLA 4JFTA 3FS2A 4ONVA 5FJRA 3RJXA 3SY1A 4XZHA 1WYIA 1CI1A 4DJDA 3O63A 1XXXA 4FALA 3CH9A 1PL9A 1CXKA 3Q58A 4MKSA 5CSYA 5HR6A 2J9XA 3HPAA 1KRBC 1JYXA 3W1RA 3T42A 4YMZA 4QE4A 1X38A 3AXHA 5G2HA 1XIGA 2CYGA 2Z1VA 4MTVA 1TVPA 3W83A 5HDRA 4EPDC 3W1PA 3ARWA 3EWXA 4UFHA 3FYPA 4JIRA 5I0DA 8CGTA 1F9CA 3CS2A 5FF0A 1GZ1A 2BLEA 2TSYA 4C6CA 4BF7A 4R9OA 3FHAA 1YX1A 2CESA 4WKAA 5E09A 3WBWA 3W1UA 2VGIA 3TFXA 5K9XA 2Z1XA 3ALGA 1XGEA 1RJQA 3RK8A 3HTWA 4Q8WA 3NZ1A 3ZXWA 4DBUA 3I6TA 2CXGA 4Y6GA 1UKTA 3LHWA 5AHEA 1A5AA 2Z2BA 3FDGA 1XG3A 2VENA 1G0CA 5AHIA 3CV2A 3N3MA 1WDSA 2A79A 2VNCA 1YRRA 3CHVA 1EPVA 4ES4A 3FYYA 1ZS2A 1XIMA 3WH7A 2ICSA 2XFYA 4JTLA 3H4XA 1DXIA 5CPLA 5A8QA 1WAWA 3BUVA 2DORA 1XFCA 2GVJA 2J75A 5FD0A 3E5BA 1BVWA 1YTDA 4IUOA 1TPFA 4IICA 1XPGA 2ZX7A 4RZ5A 1A0CA 1BXCA 4GY7A 1BG4A 2F8QA 3W7EA 5EMJA 2PWVA 1W1B1 2YFNA 1QXLA 2BV9A 4C1NB 3F4NA 1V6WA 4LEFA 2YB4A 3GHTA 3RIKA 2PDYA 1GOIA 4X2PA 3LHUA 3NEVA 5IOBA 1W1A1 4N9CA 3UR2A 1MNSA 1F07A 4HTBA 4JFVA 3PAOA 4DWSC 1H62A 3VE9A 4M1RA 3VKDA 4LUYA 4WZHA 3WH6A 2FGZA 3RX2A 3U5YA 3N13A 1YXDA 2A7RA 2YDQA 4A3HA 3OP2A 3OLGA 2GLKA 1QBAA 2EBNA 1GORA 4AF0B 1ECEA 1JNDA 1U1UA 2YKKA 3NGFA 3GDBA 3GZ3A 1SJBA 4WCJA 5BOEA 4BQ4A 2A2IA 2RFGA 3KZPA 3UG4A 4CCZA 2DSZA 3KLLA 2J77A 1VR6A 2A5HA 3UJEA 4DYJA 2VR5A 4HPXA 4LNYA 4NIRA 1DQXA 3LENA 1PWMA 5TF0A 4UR8A 3A5FA 5CGMA 2F6XA 3PZTA 3VTRA 4ZE4A 1S2CA 1RUSA 3WFAA 1I4NA 1UOZA 4GH3A 2NT0A 2VR4A 3L5AA 1EJTC 3BOFA 1PZ2A 4JXCA 2QW5A 3WLTA 1ISWA 5HNNA 2X09A 2O92A 3GG0A 4DAFA 1VFTA 2X42A 2IQDA 4HHMA 4C1NA 3TYAA 3DAQA 4RW3A 1VPXA 3BW2A 3ARYA 3WNOA 1NWSA 3K46A 1J11A 3AXMA 1EDQA 3FNDA 3H2NA 3H24A 4WGHA 1QATA 3HQPA 2DVUA 3OVQA 4IGSA 2VC5A 4X61A 2PU0A 4U3AA 1XBXA 1J0ZA 5AYIA 2J7CA 3GRIA 4DM2A 3R0DA 5IHSA 3DESA 1UW9A 1C8XA 3LEPA 2I57A 2GUBA 1JCXA 3GR4A 4J1OA 1YE4A 2HWGA 2ISVA 4S3AA 1UWUA 3G1SA 2XN2A 2GJLA 1RBAA 1FDZA 4U31A 5A8OA 3NZGA 2NUWA 2JIEA 5AZ0A 1XH2A 3VNZA 4L80A 1ZB5A 1WCGA 1ITCA 1A47A 3VNKA 1JG9A 1FVPA 1UYQA 5HR7A 2J7DA 3BSGA 4V1XA 2NX3A 3CZJA 3WQ5A 3BAWA 1ZQ5A 1W9UA 4RJEA 2G97A 5CZJA 3FX4A 5D04C 3UWWA 3KFTA 1D7KA 4D6GA 2D20A 1E70M 4K37A 4JR5A 2XH0A 3VXGA 4C6DA 3VIOA 3B9EA 1SVDA 1WV2A 2CC0A 3QMTA 1ODUA 3HO8A 3FEQA 3OA3A 2X1IA 5E0FA 3DFTA 3PBVA 2H3DA 3ABOA 3RPTA 3E5PA 4ZBCA 3WLHA 2C18A 4ASTA 2PDQA 4CVWA 2RKXA 2XU2A 3IJ9A 4Y90A 5E6ZA 5A2BA 3AZTA 3MTWA 3WLSA 3W9ZA 1HJUA 1Q6QA 5EY5A 3GR8A 4LVAA 3V16A 5CLTA 3UJFA 3QZ6A 4LCSA 3VIJA 1GQLA 1A3HA 3U2OA 2B31A 1CGXA 1J0IA 3MO7A 3U9IA 4K2SA 1W9DM 1CB7B 1BYAA 1Z89A 1TVNA 4GQRA 1Z41A 3EX4A 3RR1A 4A4AA 1VLIA 4P7OA 2B7NA 5KMYA 5CSUA 4U10A 1UWAA 3BZJA 2YL6A 3L5LA 2PA6A 1DJIA 2FHFA 5FEZA 3FKKA 4DY1A 3QFWA 3NOYA 4AHPA 3B03A 2GJPA 2PC4A 4N4QA 4PH6A 2XTKA 1V79A 4RNJA 1R46A 2PC8A 3MUY1 3DZ1A 3M5VA 4INFA 4AISA 1E4LA 3TJXA 3TYDA 4HGXA 1C92A 5DY3A 3R0UA 5DCDA 4MGGA 3W7DA 5G4WA 6TIMA 4H2HA 3C0QA 3MS8A 4UQBA 2JALA 2IPJA 4O28A 3L9CA 4UOZA 3VNYA 1UZ1A 3DUGA 4KPLA 3S5OA 3A22A 1M7PA 1EP3A 4LJ3A 3ABSA 4RZBA 4F40A 1JCLA 1CXFA 4PR4A 2GFTA 3OJGA 5HQEA 3RR4A 4QLJA 4C5YA 1KR1A 4GIYA 2DDXA 5LNWA 5LIYX 5IM51 5IXEA 4GE8A 1Q6LA 1LRTA 4FLSA 1J79A 4DWSA 4HSNA 3QZEA 4NI3A 3GW0A 4E5TA 4ATWA 4O13A 4HNNA 2E5CA 1SR9A 3NQMA 1O12A 1DV7A 4M6UA 3MHUA 3GDTA 3S4TA 5BMWA 2WZTA 3NL5A 1SW0A 1UD6A 1KM6A 4TVUA 3Q45A 2YPIA 4UB9A 2AOSA 2E4TA 3BSHA 2ZUNA 1V02A 3WQGA 4CU6A 1KM1A 3FN9A 1OK6A 1ZBKA 2HK1A 3S47A 1QT1A 1TFVA 2BGQA 3PZGA 4N4PA 1C9DA 4GUFA 1W5PA 2WKLA 4N42A 2YXXA 1LLOA 4NAFB 4WF7A 3NQDA 4HPNA 2QCMA 2W27A 3TN4A 2OOFA 1W2VA 2ZRYA 8TIMA 4ZL1A 4HHPA 4F66A 3E0LA 3ZJ8A 2RH9A 2VFDA 3LD5A 1RJPA 2Y8KA 5F1UA 5CPNA 1C7SA 2ALDA 1VFFA 5PTDA 3C8FA 4WDTA 2NVCA 2IS7A 1ZAJA 3OYZA 2CLEA 4B3LA 4X60A 1PV8A 1LT7A 1OB0A 4TX9A 2FDSA 3P14A 4AX7A 3M41A 2P76A 4WR3A 3SQMA 1W6TA 1TIWA 1KRAC 4H9VA 2EO7A 1JAKA 4W93A 2E7FA 3WMBA 3GAKA 3IS4A 2OR2A 4CD6A 1R3TA 4UNIA 2H9AA 4F3HA 1E5JA 1TJ2A 3TW7A 3N4AA 1K8ZA 2DQXA 5D2WA 2HROA 3CGTA 4I6VA 4LRTA 4O1EA 1QPQA 1KXHA 4XO7A 1J6PA 2WJDA 1U5VA 1JD9A 2I56A 1EZWA 1BXNA 2YJQA 5HATA 4HD5A 1KFKA 5IHRA 3MB9A 1N2VA 8XIMA 3RMJA 4S1FA 3E2QA 2R6OA 3HV8A 1V93A 5FEPA 2J88A 4U4MA 3B0VC 2A3HA 3W22A 1TMHA 2FTPA 2G3FA 2Y5SA 2ZZ5A 4M1BA 3VGBA 4K6AA 2YSWA 4RXFA 5FF3A 4JTJA 1RK5A 2BHUA 3L4ZA 1C90A 1KXTA 3EWCA 3GSMA 2HS6A 4C6QA 1RVGA 3P7YA 1JZ2A 3PM6A 3C2VA 4MNJA 3RLUA 3TW6A 2PI6A 5AY7A 3IJ8A 2YDRA 3R4IA 4B5SA 4GO9A 2VR2A 2DSUA 3PZNA 4PFHA 4GFSA 3URBA 3SCQA 3ARSA 2BGSA 4RV8A 4CNUA 5ENLA 2QVHA 3REQB 2NXHA 4IJBA 4UFJA 3T08A 4AZ6A 1K4HA 1H63A 4P8WA 4HMCA 1KBBA 3GK0A 4NZ1A 3N04A 3B8WA 2BFGA 1W3TA 3CQJA 2BZNA 1KFWA 2RJGA 1B90A 5I06A 4YVXA 2WC3A 1DHPA 2A7PA 1UMLA 1G7UA 2VZVA 2TRSA 3C0LA 1W54A 3BE7A 3H2AA 5BCAA 1FHUA 2YL9A 4HOXA 2G0WA 3H2MA 1BF2A 3U7VA 1O1HA 2PU1A 3CWNA 2PRMA 3ZIZA 3QJAA 1B0IA 5H6HA 4G7FA 3FAXA 5TIMA 4HYWA 1FP8A 5DQPA 1H50A 3QPYA 4GCAA 2J6VA 3B40A 3LM3A 3T7VA 2KZHA 3GVGA 1SZRA 2QYGA 1R47A 3L4XA 1V3IA 3UYIA 3N6JA 3I6RA 3VAVA 1H7RA 3OBEA 2NQHA 2V5DA 2JFEX 4EOUA 2HBXA 1TUFA 1ICQA 4QSHA 3OVPA 2VM8A 1I1WA 4LAZA 1VCGA 1OGSA 1VGAA 4Q32A 4K39A 1QW9A 1QRQA 3W1LA 2PD9A 3P8JA 3OU8A 2AMGA 3NG3A 2OQLA 1HL8A 3L23A 1DEDA 3IUHA 1PDYA 2Y0FA 1IXNA 3AWOA 3G18A 4B5XA 2GGIA 3JZEA 2RGLA 4S3FA 4BR1A 2WXDM 4REQA 4PMVA 1GZGA 2ZICA 4Z2HA 1R30A 3STGA 1IGWA 1M04A 3NYZA 3NAVA 1HJSA 3FAWA 2PS2A 5AC5A 4QFUA 4UQCA 4I5UA 1MXDA 4BF9A 2WPBA 1FY6A 3PR2A 2QXWA 4PMYA 2FVKA 5EGRA 3L2MA 4P8UA 3R5EA 1HKKA 3CZLA 3EOEA 5T9BG 1QI0A 3GBDA 3ZS4A 3M07A 4WY0A 3KRZA 4HIBA 2W79A 3C8NA 1JZ3A 4NQ1A 1W3KA 3KP0A 4NAEB 2MNRA 2CBIA 2W92A 4Q4RA 4DPQA 3TVAA 1IWBA 3GU1A 5IFPA 2VDIA 1KLYA 2Z00A 3EWWA 4JD4A 1Z44A 3UWZA 3PN8A 4AFYA 4LS0A 2IPWA 4QNEA 2PAJA 3EB3A 3TDFA 2OTDA 3MZ2A 3TYBA 3WQVA 3EX6A 5I3JA 1AJZA 1V03A 2J66A 2FZ8A 3FV9A 3B04A 3PZIA 3FIGA 1EDGA 1KV8A 3TJLA 1KRMA 4C7DA 2Z1SA 3N1AA 4Q4SA 2XDFA 3CHFA 1TPH1 4DBDA 3WQPA 4OWGA 4DZ5A 4GX8A 3QLDA 1DOSA 4O1DA 4IFRA 1RJRA 1M7XA 1R3VA 2YZ5A 5GJNA 1EXPA 4C5ZA 5REQB 2OT0A 3T4WA 4PC8A 3R8HA 3UZXA 4DBSA 1OGGA 4CQAA 3GD6A 1N8IA 3AIEA 2WMJA 3BJSA 2DIEA 1BRLB 4JYFA 1PEZA 2E5BA 3QYSA 5FJIA 1O1ZA 3PUOA 4NAEA 3UNTA 2PWGA 1WXYA 3K5XA 1R9ZA 4G6CA 1G7VA 4KWUA 2C3ZA 2VC9A 1JPMA 4M51A 3AYTA 4FK9A 4PB5A 3C0JA 1AODA 2ISFA 4JN7A 4H9XA 4LYPA 2UY5A 4DWDA 4GPNA 3A13A 1P48A 1PZ0A 1ZTVA 3VMOA 1BGGA 1L6GA 3E0VA 1BEUA 3K1DA 4UCFA 4XIAA 2QCFA 3HV9A 1WKDA 2XPKA 4K1GA 1H61A 1G9HA 3CLWA 3LYEA 5MHBA 2I5QA 2FJUB 3I6EA 3FGCA 3H55A 4HK7A 1LP6A 5AVHA 1LROA 1JJKA 4KS0A 3PWGA 1NJJA 3GXDA 4W8AA 4H9MA 1WDRA 4N9EA 3VX1A 3TR9A 1LTDA 1XBYA 1A5UA 4R5EA 3E1F1 4HHLA 1NWTA 1VZWA 4BWLC 4HQVA 1UKSA 5C7HA 3K4DA 3GE7A 1XV8A 4H7VA 3H70A 1R0MA 3KTCA 4KFOA 3LM7A 1H7PA 4RZ4A 4E3VA 1BRLA 4ORIA 4RDVA 3QR1A 2W91A 2CFFA 1MO0A 5MKGA 1ZZMA 4I6KA 3H54A 3N12A 1B3XA 1MW2A 4JHOA 4GBDA 3SQLA 1WZLA 3TSDA 3W1QA 1NFPA 2A6LA 5AHFA 4YPJA 3ITCA 3MSGA 2VZOA 3LB0A 3M5YA 3AHZA 3VIKA 1BPLB 3AHYA 4PN2A 1VPQA 3MA8A 3SCNA 4QNWA 2QCCA 1KCZA 4FNUA 2ZCGA 4XUYA 4W84A 5DMMA 1DBTA 2QGHA 4RUBA 2NLYA 1U5HA 1AZ2A 2PDMA 5HAOA 4NZ3A 3BAKA 3HFYA 1S3HA 4ZR8A 1US0A 1QOQA 4AG0A 3UXDA 3B0UX 2PGWA 3RO8A 1JZ8A 3DC0A 4QCFA 3SUVA 4O16A 4PBFA 1S5MA 3W37A 1F3TA 1UR8A 4S23A 2AQWA 1ONRA 5BWAA 1QASA 3KW3A 2BOEX 2E0PA 3P3BA 2WZMA 5DLCA 1HT6A 4ZXOA 4RDYA 3F2DA 1I2QA 2ZUVA 1AD1A 1LRQA 3HPZA 1NDWA 2PB1A 4C6MA 3WEZA 4V1YA 2PWEA 4M5PA 3QHOA 2VWTA 2G37A 1JULA 5CZTA 5AFDA 2PLKA 3TX9A 4JOMA 4PSRA 4GXWA 4PZVA 1W8GA 5DMYA 3AS1A 4OE7A 2CLLA 1QI4A 1HTIA 2HEJA 3W7IA 2PZ0A 5A6KA 4AD5A 1TTPA 2GQ8A 3FY1A 4JBRA 1C9WA 3K4AA 4UQ9A 1V3LA 2GSHA 4J2MA 2V67A 3T2QA 2PCEA 1XH1A 1GEQA 1IEQA 1VBGA 3T0DA 3TV8A 4KMQA 2YOCA 1B9ZA 1TV8A 4Z1AA 4RV3A 1NEYA 1FWGC 5HXMA 4Y9OA 1HVXA 3EBVA 4GNKB 1OFRA 1XRVA 3SW6A 3WNNA 3OODA 2G41A 3LUTA 5CPTA 3ZWTA 5KETA 1PTDA 1LLWA 3QHMA 2NXIA 1G5AA 4NZFA 4B5TA 1XR2A 1PWLA 2ZZ6A 5CAKA 4J3WA 1AQMA 1D7FA 4C90A 2X0SA 3SEPA 4LF1A 4BQ2A 1ZJBA 1T99A 1JXKA 3S5ZA 3ELFA 2CXEA 1EKOA 1R3RA 3O2LA 1CTNA 3W88A 1YPFA 2XWEA 5LGZA 4PMDA 4F0KA 3BL3A 4US5D 3M6DA 3KOWA 4MYAA 5IDZA 3HB9A 3PTQA 4GHRA 1EJXC 3ANUA 1RCXB 1M01A 3JR2A 1Z9AA 3UZYA 8RUCA 3BLLA 4GVFA 4E3TA 1IEVA 5L6UA 1TV5A 1OIMA 3N25A 5E0CA 3SJNA 3WJWA 4WDXA 2UZ9A 3N34A 5A8NA 1NARA 3QQ1A 4LU0A 3NXLA 3R0KA 3O6YX 3LNPA 1XC4A 1B3OA 1ME9A 1V6UA 3W82A 1DP0A 2HBVA 3A23A 1YPXA 2XH4A 4RK8A 3QHNA 4UTTC 3DXIA 4N6FA 1F3WA 4GI6A 4XD4A 3TSBA 5DFAA 1PPIA 3NQ6A 3COTA 2O55A 3FJ6A 3UXKA 5H1WA 3RUBL 3KM8A 4AU0A 3ITOA 3BG3A 3UP8A 2FVLA 2GK1B 3HQNA 4AY7A 2VVSA 2DZTA 3RMEA 3N2BA 4M6VA 3SRHA 3WH9A 4ICNA 3LDVA 4PCPA 4IMDA 2V3EA 3I65A 1TCDA 4MDOA 3A4XA 4X22A 1XPYA 4IIHA 4TIMA 1CXEA 4IX2A 5EBAA 3QBUA 3UA3A 2QIIA 2WHJA 4UCGA 3WD3A 1OFEA 3ZOAA 2OCZA 1PJ9A 2YBVA 3HJEA 1Z8AA 3OZYA 4AZCA 2C6QA 2D69A 4PUJA 1M5WA 3NNTA 4J3TA 5I3HA 3UESA 3V0TA 3LBCA 1O68A 4J35A 3GM8A 1OADA 2NUYA 4CNPA 3NIYA 2ACSA 2C91A 4BWLA 4GVGA 4UR9A 4ILSA 1K70A 1RY0A 4JQAA 3AO0A 8XIAA 2BBFA 4QEHA 3QC0A 1UA7A 4EX4A 3NURA 1V08A 2J47A 4DJFC 1GVQA 3PTKA 1YTKA 3LBOA 3H53A 3PANA 4L5ZA 3IGUA 1I45A 4J40A 3B97A 3QZAA 2DZPA 3OHMB 2PDGA 1XUZA 2IMRA 1YYAA 2GK1A 3G22A 1E0XA 1OBAA 4WDWA 4MY9A 3KOZA 2JEQA 4ZFCA 1JXJA 3TYEA 4AEOA 1ZAIA 3E0IA 3VD3A 4HU3A 4D1IA 1J5SA 1YIXA 5FL0A 3SUSA 4CQ8A 3VM7A 3W7PA 3URQA 3UR7A 4C6BA 5HMSA 4DJFD 4DYEA 3CQ0A 4IMCA 2WB5A 1YBQA 5D30A 2I7GA 3EX1A 1OGBA 2GGJA 1GVRA 2H6RA 4AVOA 4W8BA 5U4NA 3W72A 3QOMA 1YW1A 3KVKA 4WJXA 4YYFA 2DY3A 1V5XA 2NV9A 2Y4SA 1GNXA 5JIWA 2OLAA 4G1KA 3LSCA 3MUAA 3N2TA 1TRIA 1KW1A 1RQBA 5HMFA 2H3BA 3UCCA 1F6YA 4MPQA 5G5IA 3UNDA 4IZGA 2GOKA 3VZZA 2HTMA 3S2MA 1C29A 1WP6A 4OIFA 1EHAA 3N4EA 1TIMA 3WF3A 5CBIA 3N2CA 3KL5A 5E1QA 4JEQA 3TU9A 3N6QA 3WMLA 2GGGA 3VIMA 5BU9A 1AZ1A 3BLIA 1WPCA 1H2JA 2DIKA 4XD5A 3K13A 3CH0A 4QX4A 3B9DA 3M5ZA 1ICSA 4PTDA 3OZPA 2TAAA 4JDYA 3B0YA 4JTRA 3GFYA 1K7XA 1BKSA 3IWPA 2XHYA 4EPKA 3ZQ9A 3GXFA 4CEUC 1TWWA 4B9YA 1FH8A 3B8DA 2V3DA 4XAFA 1BHGA 1ZP4A 1XDLA 2JF7A 1Q2RA 4D6JA 4BEQA 2PTDA 4QCEA 1DJXA 2DZSA 2OODA 1M68A 2V68A 1BF6A 1SZGA 3MVTA 3NSXA 5D33A 2DW7A 4Q4PA 2XN0A 1I2RA 3L4VA 1QO5A 3WLOA 2VRJA 3NDOA 3QSRA 4QP0A 2ZXDA 1Y5VA 1A4MA 1LUCB 6CGTA 4HPGA 4HSOA 4D71A 1W56A 3QMRA 3OTRA 3GNPA 3CUXA 4AXKA 3RPMA 3GY1A 1KBJA 3BK0A 1HQTA 4Y9AA 4NZJA 4HU8A 1SGJA 3TJIA 8A3HA 5KZ6A 2WZEA 3ZFHA 2HSAA 5EL1A 1KCXA 2GJXA 3FXGA 4H6QA 2J7GA 1I8JA 3IEBA 3F1QA 3WFZA 1F4HA 1EXBA 2OPJA 3AUJA 3HMJG 4QE5A 5BXSA 9XIAA 3GTHA 4FXSA 2WM1A 3LGGA 3NSNA 3CU2A 3NL6A 3MV11 3ZZ1A 1YDVA 3WNKA 1OX4B 3HG5A 3KAOA 3W81A 4MVAA 2PFHA 4URIA 3CUGA 3RITA 1R3WA 3KHJA 3DYOA 2Z26A 4KF1A 3TN3A 3P2VA 2XVNA 1T40A 4UTTA 4BQ3A 4B4HA 1W1ZA 4FI4A 2VX5A 5HUPA 3WDRA 2VOTA 4B3KA 1IR2A 1L9WA 2E1WA 3FVMA 4K36A 4IPNB 4WHBA 1MUCA 1X96A 3GC4A 3V4BA 2Z25A 1DPMA 1DJNA 1QPOA 4CLMA 1GYNA 3F4VA 4PCTA 1TWSA 2Q02A 2HE8A 1BD0A 4L4MA 3UZJA 3LHVA 2FHCA 4LAUA 3BSMA 1ISYA 4YTQA 2EG8A 5D37A 4AB4A 1TJ0A 1ZUAX 3QQWA 3I4EA 3T55A 3UBPC 3H21A 1VBUA 1X7FA 4UZUA 1SO6A 1JPDX 3HGRA 3QR0A 1NDZA 2VFFA 2Y24A 2C7FA 2G4JA 4R7OA 4AZ7A 1OX4A 3WLPA 2HNEA 4UWMA 3TMQA 2PE4A 4WUIA 4QQ3A 3OIXA 3OYXA 4JGDA 2BASA 2INZA 1KGUA 2UBPC 3FDKA 1PIGA 5KZDA 1M65A 4CU7A 4FOKA 2PZNA 1ELSA 2ASHA 3A9BA 1QI2A 2WZHA 3AYRA 3TTOA 1UJPA 3S3GA 1G4PA 1UBSA 1VIWA 1XKJA 1BTMA 1RK6A 1K4GA 3G0XA 4DEFA 1R3QA 4RLIA 3NXFA 4CCDA 3LI0A 1XBVA 2XH7A 1Q6EA 4XG1A 1O5XA 4JTUA 2ZZ1A 3PP7A 1HKVA 2YLAA 4QDMA 5I09A 5AN7A 3E49A 3QM3A 3S6DA 5E6YA 1GZJA 2R14A 1V3HA 2NV1A 2QCDB 1X1NA 3BMWA 2OWCA 4NI8A 4H8HA 3U2CA 3K4WA 4FLRA 3H12A 3DFOA 5I02A 4TR9A 2G95A 4UIOA 2Y1HA 4GO8A 1P6BA 4Y9PA 3EMCA 1SW7A 2VC6A 4IF2A 1AA1B 1NOUA 2BY0A 2W61A 5DMLA 2AL2A 3LXCA 4D9PA 5F7UA 3B9NA 5L9FA 3SBFA 4DHGA 4UUIA 1FOBA 5EU9A 1T96A 2Q8LA 3G0SA 3PB2A 5XIMA 4LH8A 2P53A 3AMCA 5HWJA 2C13A 4LGXA 4ORMA 2YW4A 4GYFA 5K2ZA 3KL3A 4UOQA 3V1HA 3RU6A 5BYWA 4GABA 1LORA 2REQB 3B06A 4DNHA 3GTFA 2W5FA 1ADOA 4GUIA 5KZMA 1VH7A 2DZWA 2Y85A 4GVIA 2DIJA 2FTWA 3CQKA 2WVVB 2P88A 1UH4A 2A3LA 2TPSA 1ME7A 1L6FA 5D9PA 1KLZA 2FZNA 3KWSA 4R33A 1TVLA 5A6LA 3DHPA 4FX6M 4PCSA 2ZZ7A 4L9ZA 1V0MA 1TJRA 4J4KA 1Q66A 5GJPA 2AQVA 5T8GA 1VRDA 3TP4A 2VUNA 2DH2A 4NL1A 2WMFA 2QDGA 2PDBA 4MNMA 2PDJA 1B4KA 3PTDA 1E4IA 5LSMA 1MFUA 1CXIA 2YDAA 3LG3A 1FCBA 1TWZA 5LIUX 3PBUA 1JRCA 1GOKA 4GIAA 1MRQA 1P4CA 1UP0A 3ZM8A 3CTLA 2VI0A 2VXNA 3CQHA 3GIQA 1VCVA 1LWIA 4E0CA 2ZUTA 2QUUA 1C7TA 1R6WA 3ENLA 3ZLFA 2REQA 3O8AA 4I3GA 4S2CA 1E9LA 1XIFA 4XVEA 1IT7A 4CVUA 1Q4NX 2C16A 1VIZA 5C2CA 5TQLA 4XD3A 1JUEA 1BWLA 3ITVA 4Z2LA 2GJRA 2WVVA 4RPQA 1VYRA 4E38A 1TPC1 1UC5A 3UR8A 3IJDA 4GISA 2PODA 3MU7A 1TTIA 3VVGA 1PKMA 1QTWA 4LUJA 2BGNE 2QJGA 3SFWA 4G56A 2EKCA 3KBJA 4OBTA 3TTYA 4CNSA 2CBUA 1MYRA 1KTCA 2HVMA 3H2CA 1ZU8A 3WNLA 3AMKA 3QLLA 4HT3A 3QTGA 2W4XA 3L65A 3QEZA 4GINA 5CH9A 1H49A 5FSDC 2OSWA 5CC3A 1PSCA 3N19B 2NXGA 1ENUA 2X7VA 1MUWA 2WMIB 1MEIA 4NF7A 3BO9A 3CZEA 3O16A 2ZA3A 2QUMA 3M0VA 3VI2A 1J96A 1RA0A 4PFMA 3QGVA 1F3EA 2POZA 4DLFA 3STCA 3P61A 4FEZA 1TPUA 2CZFA 4JL1A 3L67A 1NFGA 1XSIA 3WF0A 1XP3A 2WQDA 1V3JA 1J0HA 4QTGA 4S3DA 3ZSSA 3AZSA 3SJ3A 4EACA 3TMLA 4ATDA 1FX6A 3ARRA 1WXZA 4F0RA 2XFFA 4BKNA 3MCMA 3QYQA 4QJ3B 3DFSA 3CZKA 2Z2UA 4FSAA 4LRSA 5BU6A 3CMGA 3O05A 1J5TA 1Q5MA 3DU0A 3WQWA 2PWDA 4WQ6A 3DI1A 3GKAA 1GVYA 1E43A 3O3RA 3G8RA 5SWUA 2J78A 3WF1A 3KXQA 2ZE0A 4UQEA 1SPQA 2OT1A 3SCVA 3WLRA 3PPHA 3ZSTA 4NNBA 4KIRA 1X1ZA 1AD4A 4KW2A 3S1VA 1WNOA 2DZAA 1KTNA 1OABA 1QNQA 3WD0A 2VEFA 3MJYA 2J9ZA 4ZMGA 2J25A 1A5CA 3OPSA 4MF4A 2WMIA 1RLCL 5DANA 3WO8A 2P10A 4Q8PA 4UXDA 3O6DA 1L2UA 4HMNA 2QMKA 3KDOA 2IKJA 2X05A 4ZQCA 2Y62A 3AIWA 4ALDA 1WKYA 1JGIA 4YJ5A 4GX9A 3C4UA 4A2RA 5FAJA 3MKKA 3ABZA 5DMNA 1IZCA 4DF2A 1W0MA 1BQGA 4TXEA 4EPEC 3CZGA 2VCCA 2JBMA 1QU4A 4LAOA 1A5OC 1A5BA 2L5HA 1WXJA 2GDUA 3ONCA 4GMEA 3G1AA 4QR6A 2Q01A 3WL0A 4PYSA 4X0VA 1KM2A 4JPGA 4JX6A 4LBRA 1KB3A 5J04A 3MZNA 3NQVA 2VGBA 4UTIA 3IIOA 1AW5A 5BRQA 1JQXA 3MO4A 1XIDA 1ADDA 3WQ8A 5CZSA 2ABAA 4M56A 3GHSA 4E6MA 2ZQ0A 2WJFA 2YCJA 3O6AA 1DL3A 5HWNA 3CNYA 3TC7A 4JTCA 3VIHA 3LGDA 1LOSA 4KCVA 4OGZA 3I3EA 4FXRA 1YNYA 5C70A 1VJIA 1T5AA 4JEJA 1CXHA 4QRNA 3VDCA 3NWRA 3PZVA 2J27A 4KEVA 2CZ5A 5IFTA 1E5NA 4MKNA 4KRUA 2BB0A 3AFBA 1CWYA 2VEKA 3E2RA 2OQHA 4X2RA 3F4DA 1RBLA 1JUKA 3W27A 3DHDA 1AMKA 1DTUA 3BOLA 5FEXA 1ZAHA 1UR3M 4PBEA 2R1MA 1R5YA 4GA8A 4WVXA 3P8IA 2EPHA 4HSHA 1I9CB 2OSYA 5C55A 3MWAA 2WBKA 4XUGA 5EFDA 1WX0A 1TR1A 2ZX9A 2XGBA 4WSHA 4NZCA 3GS6A 4AX6A 3TQVA 3VFLA 4Z2JA 4N7QA 3T9PA 4IGHA 4LUSB 2G96A 5F4WA 5H8PA 2CKRA 5E9XA 4J3XA 1FWWA 1OCJA 1QK0A 3BMVA 4ZTXA 1O4UA 1WOBA 3QV9A 3EYPA 3ES8A 4FOUA 2Y8UA 2FTYA 3ERPA 3S5YA 2ZFAA 2E6FA 4P2VA 5I07A 3FJ4A 4DJEC 3EXSA 2ATMA 2BG5A 4E8GA 1HKIA 3F4WA 2XIJA 2EJAA 1TA3B 4NX5A 1S5TA 2VCAA 5EA9A 3VNDA 3PB0A 2E6AA 2ZX6A 3UFYA 2VUYA 5I3GA 3UZZA 4AYSA 3C3UA 1PCKA 1FBAA 1XX1A 5D4YA 1QHZA 1Q7MA 2C71A 4A8LA 1TPWA 2YCLA 2HXTA 3IGSA 4J7RA 4R7WA 1B31A 2XGZA 1R3YA 3WJZA 5I3DA 3AJXA 1DQUA 1BYCA 1GHSA 1P5BA 3BGGA 3N2XA 4EANA 5E9AA 4BQ5A 3TLQA 3MC5A 4NZ4A 1FWCC 3D0CA 3HU7A 3CHCA 2QJIA 3SN4A 4XTDA 5G1TA 1OT1A 2WZIA 3VZYA 2BY3A 2XYLA 4PA8A 1VFMA 3WUBA 4I90A 1AG1O 3MPGA 4LW7A 2ZVIA 4MWAE 3KLKA 4CD4A 4TX8A 3JVAA 1Z3NA 4U2YA 4ZODA 2Z7KA 4IG2A 3GDLA 3U2ZA 4MJMA 4FP1A 4C1LA 4F2UA 1UC4A 2HCVA 3JU2A 3RRXA 3RILA 3F2BA 1QI5A 2DJXA 5BXTA 3GIYA 3ONBA 2J24A 4YCOA 5JUVA 3LCLA 1V6VA 4AHQA 4QJ1A 3MANA 3KWXA 2V3GA 2HMCA 1N55A 1W9VA 3DECA 1PAMA 5C54A 3BW4A 1SSDA 4EK7A 4RNHA 5JBDA 3W71A 1RZMA 3WF4A 4LTSA 3WG6A 2EHHA 3B8SA 1DYSA 3POHA 4ZZ9A 1Z42A 1PX4A 3I7RA 4K7VA 1DJQA 2TYSA 4QG6A 1YHTA 1Q6CA 3MUCA 1KNWA 1K9DA 4S38A 1REQA 4Q7BA 5ABGA 5F4XA 4JN8A 5BRBA 2AL1A 5C5YA 4R85A 3R7MA 1W5MA 2WCSA 5LNUA 3VIFA 3SGZA 2Z4GA 4O0KA 3EA1A 3VMNA 4ACYA 4JTDA 2PRHA 1W3HA 3TAOA 2G8ZA 2YCEA 2IQ0A 2QPUA 2PWUA 1RCOB 1X7IA 3GZAA 3CZ8A 2BVTA 4UTMA 1FWHC 1O5QA 2Q8XA 4BA0A 4Q8MA 3WENA 1LYXA 2FFIA 5HJXA 3K1GA 5ECVA 4MADA 3VNJA 3F03K 4JKKA 1L6WA 4WKFA 1Q8AA 3EOOA 1H41A 4B90A 3LNMA 4L64A 3TR2A 3OB8A 4AD4A 5IDIA 1UUMA 3SCSA 6XIAA 2HNHA 3RX4A 3IJ7A 1MDLA 3AIUA 2V2DA 3PK7A 3SR7A 4J9JA 4GOAA 3T81A 4YS1A 3SDOA 3UF9A 3M0KA 3ID7A 1EJUC 5CSRA 1SJCA 1MXGA 1G4EA 4L1GA 3PZQA 3VIIA 1GHRA 1EH9A 2EKGA 4CQ9A 1E1EA 5LNSA 3HPXA 4GVHA 5FCZA 2CLMA 4XBKA 7REQA 4DBEA 3H6OA 3UGVA 2OGYA 4JTQA 4OQVA 5D05A 2QCGA 1YE6A 4U2ZA 1UQZA 4TMBA 4ICMA 4AHOA 4A3RA 3C2YA 3EWYA 3F5LA 2VX4A 3Q94A 4HNUA 3IJIA 3LZ3A 3SSZA 1RHCA 2V81A 1QNOA 2E5DA 1WO2A 1C8YA 3WQEA 1TQXA 3L12A 2Y2WA 2E77A 2G3MA 4MOZA 3PAJA 5AKQA 2YBTA 5HK4A 7CGTA 1P6CA 4IXXA 3WD2A 4MPKA 4KBXA 4GC4A 3WDJA 4PODA 1KCLA 3LRMA 2CLHA 3P81A 3GFXA 3GQYA 1UCWA 3PG9A 3UZWA 3CIWA 5CJMA 5HOSA 4P8VA 3LCFA 1IIGA 3TZFA 1Z32X 4J28A 2VC7A 3TSMA 1VHNA 1XYCA 2WKJA 2FFCA 2OU4A 2ZYFA 3ABRA 4DJEA 3THAA 1OFPA 3VOHA 5D09A 3SCRA 2DEPA 3B0XA 3MV01 2PDKA 3OEXA 3LLXA 4O18A 4Q8NA 1DXEA 1QW8A 3CUFA 3NPXA 1Q3NA 1Z69A 4ROQA 1N8WA 3TQ0A 1IZJA 4Q4KA 4WY0F 1W5NA 1ZSXA 3GKFA 2VEIA 4L4LA 4IISA 3VOFA 2BVDA 2OG9A 4LQ1A 2E9MA 4JTIA 2POTA 1NF7A 1PVNA 1I2NA 3D47A 4XZLX 4IFOA 4RZ6A 4O17A 6PTDA 5AZ1A 4OV9A 1U2YA 5C9WA 3A12A 4IMGA 2CEQA 3SUWA 3PFMA 3QSTA 3H4WA 3GHRA 5TBOA 4F2BA 3EWBX 4GXMA 1BAGA 3DC8A 4DF0A 4WSKA 1XC6A 3KS6A 1I2PA 4GYKA 1GEHA 1SFJA 2D2GA 1DHKA 1QNSA 4S3JA 2P1FA 1VEMA 4C7GA 4LUIA 1DTNA 3AHVA 2CLPA 2ZA2A 3K8LA 2GGHA 1SJDA 1WBJA 2XSAA 4Y2WA 3QY7A 5JIPA 1E6PA 3B4YA 3NPWA 2QV5A 3PNZA 4F0SA 5DBTA 4I7VA 2OYLA 1A5LC 3VM5A 4Z0SA 4S3KA 3GU9A 1RQEA 1C91A 1JVNA 1CGUA 3TQKA 3D46A 2WSPA 3AJ7A 4UFKA 3RLVA 2Y6ZA 3R13A 5AYZA 4CNNA 1DJZA 3W7RA 3N18A 5C2XA 4Z2IA 4KWWA 4C6LA 4V15A 1TV3A 5BXPA 3V18A 5LKYA 1NDYA 1DJGA 1ZP3A 3CM4A 1XQKA 4ERIA 4L1WA 1PKNA 4DPPA 3PJUA 2AAMA 2VFIA 4ZOEA 4D72A 5M03A 4B2DA 3MUZ1 7PTDA 4AWTA 3A9IA 4DO6A 1F3XA 1FXPA 1E0VA 3VGFA 1P6WA 3H2EA 1XCFA 3LBMA 4JTGA 2ZRZA 5A6BA 4O8RA 2ZX5A 5RUBA 4UOJA 3XINA 3BG9A 4G7EA 1B2YA 2QJMA 1A0DA 2ZX8A 4HNOA 1E0WA 3R1ZA 4ZQOA 6REQB 2CHOA 3TA9A 1XQLA 3NDYA 5K9DA 2Q8ZA 1W8SA 2IKHA 1EP2A 3BLFA 3KCOA 3I68A 1XINA 1YLVA 5U7SA 2BHYA 3OG3A 3LX9A 3U57A 2E40A 1V51A 3PUGA 2WHMA 1K6WA 4GZIA 4XBJA 4DAIA 2B7PA 2CBVA 1S5VA 4IOTA 2VT0A 1TZ9A 1M7OA 3A4JA 3CASA 3LPPA 2OJPA 1JI1A 1GONA 4H1ZA 2WAGA 3TE9A 4LAKA 1JRBA 1R3SA 4DM1A 2WM0A 4H8UA 1FWNA 1F2JA 2WMGA 2OVLA 4EVZA 1HN1A 2PDLA 4OZOA 2CLIA 4O12A 3W84A 2D22A 5DN1A 4HU0A 4R34A 4N2YA 5HJLA 4RDWA 3ZWSA 2OZ3A 1RSCA 1IWPA 4H2CA 4ERAA 4NJGA 3PZUA 1EB3A 2XJ7A 2DZXA 1IE7C 3RAOA 1I1XA 1WZAA 2F61A 4V28A 3E12A 2CZDA 2D3NA 2WCGA 4HNTA 5AC6A 4LB3A 3DG3A 2X2GA 2J7BA 2R1PA 3B8TA 2F9RA 3W4RA 3ZMRA 4KH2A 3LS9A 1O95A 3DFQA 4NUWA 3OGRA 2PPGA 2VCBA 3EX3A 1XLIA 4Z1CA 2Z2AA 3VNMA 1CIUA 2QF8A 3XIMA 4AY1A 2GDVA 4MKVA 3TN5A 3FXYA 3FA4A 1SZNA 2ANUA 2Y89A 4M6QA 4K3ZA 1UZDA 4EWJA 2BS9A 3DBNA 2PWHA 4J3SA 2PDUA 3DX5A 4XZNX 1QHOA 3AMLA 3RF9A 1UUQA 1ZGDA 2O9TA 3LV5A 2V5BA 4HB7A 1EQPA 4ML9A 1JYVA 2V2CA 3LLDA 1IF2A 3AXXA 1CPUA 1EX5A 1XLFA 2TODA 3R89A 1U1JA 3PG8A 1RBOB 4GY0A 4AMCA 4DZHA 2D0GA 3TIMA 2Y88A 1GWJA 2ALRA 2WJEA 3SY5A 3M64A 5LXEA 1GKQA 3RM8A 5A6JA 1S5WA 1WOAA 1XLGA 1S3TC 1CLKA 1K7EA 2QUTA 4KETA 4AIBA 3E3HA 1CECA 4UTHA 2VDHA 2XFWA 3BZGA 1FWIC 2QAPA 1LOLA 3PUEA 2FJKA 3WMCA 2PLCA 1KXVA 1DWJM 1E9YB 3UG8A 4O0QA 3TJ4A 2FLIA 4FO4A 1SU5A 1X6LA 3C52A 4DX3A 5LA0A 4HBKA 3QGAC 2I9UA 5D9NA 3SECA 2QDEA 4TTUA 4PRTA 3GVQA 1QWGA 5BNKA 2ZUUA 4CQCA 2J4GA 4QIUA 2O7SA 3V5FA 1QUMA 1LCOA 3LPOA 3LCXA 3EOSA 4QE1A 3WN6A 4L7ZA 4GKTA 4O1BA 5I78A 2IQTA 1RXOB 2G4FA 1XRSA 3NQ8A 4K8EA 3DYPA 1F61A 3CEUA 1E56A 3S1WA 4QLKA 4FF7A 3B05A 3IVUA 4IPPA 5LA1A 3U0HA 4XIMA 5B80A 3HZ3A 3G6MA 4OUIA 2EGZA 3S46A 2NQJA 4A35A 2UY4A 3KVLA 4AMAA 4JS3A 3DERA 5M2FX 4AD0A 3O1NA 2HPMA 3F4CA 3TWAA 3VKJA 3KOFA 3CL6A 4G2DA 4DNMA 1L6YA 2A1YA 3A3HA 4DZAA 1H1YA 2A21A 2O4MA 1XW8A 4HZ7A 4FXJA 1JD7A 2VFGA 4TX6A 4ACZB 1XLKA 4W87A 1LQAA 3NDZA 2XIQA 4AF0A 5H2ZA 4J3UA 2RGMA 3APYA 1W17A 3GUWA 2OZ8A 3EWUA 1H5YA 3BCJA 5EKYA 4KRTA 3N9SA 2XINA 3OHIA 1A80A 1CNVA 1OWQA 1WUEA 2BXVA 4ZE5A 4IL2A 3EXRA 3VGEA 2PDFA 3BG5A 2V38A 1IXQA 5C2GA 5FSEC 1Q65A 2UY3A 2DVXA 2WHKA 1QJWA 2PF8A 1KWKA 2CZEA 3QOKA 3GNNA 4XKMA 4BJHA 2Z7GA 1W5QA 1SSGA 4M80A 4BCEA 4Z0JA 4CN1A 1CZ1A 1FTXA 1UD4A 4L56A 2J74A 2F38A 3TXVA 2I5IA 2ACRA 4GQBA 2EPMX 1GPWA 1VBRA 4HOZA 3I7QA 3P0WA 4JY8A 5I6SA 4H01A 1AW1A 3U8GA 3TTQA 2Z1KA 3LCWA 3PJXA 4ZA0A 2QMJA 3DKLA 2I16A 2F84A 3PZMA 5EMKA 5GVJA 1DKWA 3TK7A 1RA5A 4KEZA 4MWAD 3UW6A 1Y5WA 3PF3A 1AQHA 4P5UA 1V3KA 2C1IA 2PTWA 4DO7A 2YX0A 1NWRA 1YDYA 3UPBA 2C8NA 3WH8A 2NWSA 4ZQMA 4QDWA 4W9TA 2WVUA 3HFTA 3PSVA 4OBRA 3ARPA 1KFCA 4DO4A 3GH4A 3S1UA 1GQKA 3VDAA 2P0OA 1RAKA 4PBGA 2YDSA 4OFCA 2WANA 4TVDA 3KBNA 3MMTA 4W5UA 3M0JA 1UWRA 3H23A 2YXOA 1EBHA 2QUVA 1P0EA 1FP9A 3TTEA 1EWEA 2G50A 6ALDA 1W3NA 4D6DA 2YFOA 3GBEA 4DUWA 1Q85A 5D2YA 1NH6A 1PB0A 1JIBA 5E0KA 1G69A 1ICPA 2ZOXA 3C0SA 3OBAA 4H9YA 1LG1A 5AYYA 4AZ5A 5KSWA 1QBBA 1R2RA 4IQEA 1HX0A 4UTJA 2ODOA 4ZXLA 3BPWA 3W2KA 5E93A 4WRHA 2ZUWA 2FZMA 1FHLA 3ORWA 3WBAA 1Q6DA 3KP1A 4QROA 3G6LA 1FHDA 4GI4A 3RO6A 3USZA 3RGTA 3S6OA 1VF8A 2DQWA 4MMWA 4D6CA 1TPB1 2QEZA 3T2OA 1VP5A 2V8ZA 4UMBA 1WKEA 3IJ6A 1H1NA 2D0FA 1QOPA 1IHIA 1KQYA 3LQLA 3U6WA 4Q8OA 2OO6A 3BWWA 2V82A 1V02E 4HCHA 1O5RA 1TWIA 4LS2A 3MBFA 3JZUA 3BV7A 2BMBA 3PPFA 5EFFA 1OEPA 1TSIA 4JHZA 2ZTJA 1UB3A 1R2TA 1V7YA 1H09A 2WV8A 1Y8BA 3LTSA 4RCXA 3T2PA 2IKIA 4E8DA 3G1YA 4TU1A 1W9BM 1C3FA 4HK5A 3GG1A 3ISIX 2FMOA 1F76A 3KVMA 2OSXA 4JNMA 4L4PA 3L68A 1LQ2A 5AOUA 1PYMA 1TRDA 1EJRC 2C79A 2Y8VA 3OIHA 1SO3A 3QR3A 5DRIA 4C60A 4B3ZA 3ARQA 3MW7A 4LVDA 4ZO6A 2ACQA 1EEXA 4IP7A 1WZKA 2VZTA 4WOQA 4LYQA 3N14A 4H6EA 3IJQA 3CB3A 1LL4A 2F6KA 2PDWA 1AJ0A 4YU1A 1OC7A 5I03A 4F4RA 3F7JA 4DUOA 1FWEC 2X8RA 4GUGA 1PHWA 4F8XA 3M0ZA 2Z1WA 5CJ5A 3W7CA 1ZFJA 4AQLA 1RP9A 3W38A 4KQNA 4H4IA 4PMNA 3UT0A 3BAJA 4PB3A 1RVKA 1TKKA 2FHBA 4M8UA 3UERA 2I5GA 1OINA 5F2MA 4C6FA 3GNRA 1UWSA 4PUKA 4XZBA 3V75A 4O14A 3LK6A 3NM1A 4G8TA 3BARA 4B91A 4NRRA 2GVGA 2VL4A 4GGHA 4F0MA 4LY8A 3K30A 5M1TA 1GOOA 2DP3A 3AS2A 3SIZA 3OZOA 4QS6A 1T6MA 4M0XA 1YTEA 3UD6A 2YIHA 1VEPA 3HN3A 1ISXA 3OZMA 4L65A 2GZXA 1QNRA 1T7LA 4E4PA 3W26A 1AUSL 4HK6A 3QTPA 2CHNA 1DWGM 3OOQA 5KITA 1B4EA 1GOWA 3P60A 5LGXA 4JL2A 4C6NA 3GDRA 4CD7A 1SR0A 1GJWA 2AGTA 3P84A 1RALA 2C0AA 2OKTA 1QFEA 4NAFA 4IPIA 5C0QA 1LBMA 3DFHA 1ONEA 1B3ZA 2FH6A 1MZRA 3W73A 3V0SA 4RE3A 4Z42C 4HA1A 3UXLA 1H51A 4XX6A 2V0TA 4LXFA 5LIWX 4WOZA 2RDXA 2GOUA 4YTTA 2ZUSA 4B5WA 4LVGA 3EEGA 5A8GA 1G6CA 2BY1A 1UQYA 2V2HA 2X2YA 3G1RA 4BY3A 5CZ0A 3WQFA 1IT0A 3RDKA 1GVIA 2DT2A 3H7UA 5T91A 2PWFA 1AQFA 3MJMA 4I5XA 1YNQA 3T05A 1EGVA 2QZRA 3ATZA 5A8MA 3NYDA 5JQ9A 4RE0A 1BGAA 4XZWA 3HPSA 5EMUA 3IUDA 4UQAA 3NL2A 3P5YA 4BEUA 5JBEA 3UWYA 3FLUA 2QHAA 1I6NA 1OT2A 1O60A 2OFJA 2ZXAA 5BXRA 3EKGA 5AC7A 4R3UA 1V0LA 1HJWA 2XZ9A 4W7UA 1MRAA 4DXKA 3LMYA 3R8GA 1UD8A 5GNYA 3W24A 3P5ZA 3T0BA 1EF2A 4GH1A 4XQ6A 3L4YA 1R9XA 1ZJIA 1UKPA 4YXGA 3AQUA 3RG6A 4FIRA 2WNNA 4XZIA 1EPXA 1SZEA 4NXSA 1HFBA 1ZRQA 2Z29A 3BAIA 1P0NA 3I10A 1P7TB 1UP2A 3TQPA 1JDCA 3LGEA 4GYJA 2NUXA 1FWSA 4UMCA 1TV7A 3A3XA 3CO8A 1F8IA 1VHCA 2V5CA 2BVYA 2ABBA 1OCNA 1X6NA 4HTYA 3REQA 7TAAA 1W1VA 3O06A 1F6PA 3LY0A 3W1TA 3BMXA 2JKEA 3L0KA 1ITUA 3NZQA 1SJAA 1XM3A 3TNOA 4JFWA 1ZCCA 3MHGA 3MT1A 3ARTA 4CGTA 4LUTB 3NSMA 4KWVA 1PHQA 2VO5A 1RH9A 1XGZA 4M6PA 4AW7A 4I8YA 3EKZA 4KESA 3M43A 3HOJA 4Q8UA 2RDUA 4H04A 2O56A 3CC1A 1A5SA 2EJ1A 5I00A 2H90A 2GQAA 3IUIA 4IIBA 4DJDD 3DFPA 2WQPA 4GI8A 1XLMA 5A6AA 4OKDA 1M6JA 3URAA 1UR2A 3DHUA 3VINA 3TOYA 1TX2A 1OCQA 4IWWA 1OC5A 1F7BA 3QKZA 4EP8C 3ZT7A 4CN6A 1IQ8A 4D2JA 4JFUA 4W8LA 3IIZA 4MJ4A 3W76A 4FPSA 2ISDA 4MUZA 1GQNA 2YA1A 3KE0A 4AWEA 3EA2A 3C2RA 3GC2A 1FKWA 4MAZA 1Y65A 5DELA 4GZEA 4Q33A 4JKLA 5LYRA 3CL8A 1FFRA 3FOKA 3QVQA 1E71M 2J9YA 4Q4MA 4LX4A 1SZFA 4RR4A 4F0LA 1JZ6A 1UD5A 3PBYA 5BOOA 1I2OA 3KHDA 3ATYA 1VD6A 3AYVA 3DENA 4F0HA 4PMRA 1XLLA 2YLLA 2A3AA 4NZ5A 3KCJA 3WH5A 4GZJA 4K8HA 2EF9A 3AXIA 4YWIA 4K68A 3G1DA 4O50A 1TX0A 3WJXA 4KGLA 3HGSA 4L6HA 1TPVA 1KM5A 2WLZA 5AECA 1GKPA 2I14A 4HCDA 4IJCA 4K8GA 1K7FA 4HNLA 1E72M 3VOIA 3HURA 4XKYB 3GWQA 1DJHA 4F79A 1J0YA 2PP3A 1HO1A 4ZO9A 3C61A 5LIXX 2DUXA 5LIKX 1O6IA 1GYMA 4ZOCA 4Z1BA 1HNYA 2WNQA 4OECA 4ML4A 2I1OA 1PO9A 4IHCA 2WMKA 5H91A 3THUA 5ABFB 1S2AA 4S3GA 4B15A 5I7GA 3LCGA 3R94A 3G1VA 3R58A 3KL0A 2BOGX 1LL7A 2CU0A 3WDPP 3M1ZA 2Y7FA 4Q6JA 4CQDA 2B7QA 3EZ4A 1ZENA 2ZVRA 4XISA 3P62A 4Y9MA 4EAYA 3BLKA 4LBSA 4DXXA 4Q8TA 4AAJA 4ATLA 2CERA 1W1YA 3CIVA 3QPZA 1Z7AA 1EO7A 3ZVHB 3SGGA 4NJIA 1GJPA 1R7AA 2CKSA 1J0JA 1OHLA 4QS5A 3ZT5A 4Y96A 3BGAA 3GU2A 3K8MA 4IPLA 4PMUA 5D38A 3Q4DA 3VUPA 2J62A 3OQ8A 1MEHA 4MNKA 4O1CA 3S0CA 5REQA 4H9ZA 1JI2A 2J8TA 1XLHA 2JQXA 3WK3A 4CCCA 4KFNA 4QISA 4GNVA 1I75A 3VIPA 3CWOX 3WDIA 1CGWA 4ENLA 2PDXA 3FFSA 3ARUA 3NUKA 1X6UA 1QPKA 3CLMA 4Q4OA 4ZTYA 1PZ1A 2VZSA 4LCRA 3RU8X 1XYZA 5I3FA 4S2BA 4XZ9A 3UPWA 3GVWA 2RUSA 3ARXA 4O1AA 3N6HA 3O0KA 2ZZ3A 4FIQA 5ABFA 4ZCWA 1J0KA 1TJPA 3TXZA 2YL8A 2QUNA 4Z2GA 1J2WA 1MUMA 2XIMA 3VO0A 4AZIA 4HJWA 1QAPA 2NQ9A 3PHAA 1UASA 4LPCA 3N2OA 1UOKA 2IUZA 3CAVA 3M47A 5A95A 4JIPA 1B54A 3EOLA 5A94A 1HL2A 3QY8A 4HZ6A 2OELA 4QG9A 1I60A 5J8LA 5A2AA 3G3DA 5G1MA 4JIQA 4GIRA 3OLDA 1V6YA 1HZYA 1XWYA 3GXPA 4PTXA 1X8CA 4WDUA 3W25A 1HKWA 3ES7A 2GWNA 5HNRA 3CYVA 1U33A 4FMVA 1NDVA 4L9XA 1ZHAA 4W5ZA 4FX7A 3ITGA 1ZBVA 4KCUA 3BJTA 3SRKA 3VA8A 3WK2A 2HJPA 2AMXA 1Q2SA 4GLEA 1KWGA 1W3IA 2Q09A 3EMZA 1BVZA 3FA5A 1UJQA 4ERGA 4C65A 7ENLA 1UA3A 3M0HA 3SRFA 1UIOA 1JDDA 1L8NA 3FEMA 1B57A 1BTCA 1GQJA 1D8CA 2A3EA 3BGJA 2FMNA 1L6SA 1NM9A 1EIXA 5FOOA 5C9UA 2E8ZA 1B9BA 5FIPA 4JTAA 5FESA 3P6LA 1XD0A 3DFNA 3NGJA 1FWBC 1P1MA 2FB2A 3D3AA 4GJIA 5C8BB 1JZ4A 2QV4A 3WNMA 3R11A 4GBUA 3AI0A 1GOQA 1NU5A 4V33A 4MFEA 5G4HC 4CNTA 1Z6KA 5D2XA 4KERA 3VDGA 3NQGA 2C14A 4YLWA 3S2JA 2HRWA 3CPRA 3V35A 3PZOA 1ALDA 5J5RA 4B92A 3IANA 3GAYA 4ZEPA 3MP4A 3THCA 5DO8A 1GVFA 4F9DA 1QCWA 3AMGA 2BDQA 3G1HA 3SCWA 4KEUA 1KM4A 5A69A 2EG6A 5K3VA 2DT0A 3QW4B 3STEA 5BW6A 5EYWA 4XZMX 5EB8A 3MI6A 1K02A 4EPBC 2FDMA 3UGRA 3VC6A 3KCLA 1Q7QA 2PUZA 3NO1A 4H9TA 3OLIA 2V3FA 3C3NA 4QSFA 5HUOA 2PEVA 1OFDA 3IACA 4RL3A 2P8CA 1TPEA 2AAAA 4LYRA 4JHMA 2MUCA 1LLZA 1MFVA 3ITYA 3EEZA 4D6HA 4C1KA 3UJRA 1P43A 3EPMA 5ABEA 1ISVA 3W1AA 4PL2A 3V36A 4GUHA 5BRPA 2V63A 5FL1A 2WK2A 2O9RA 4YN5A 3PUDA 5G2IA 2DGAA 4TTGA 1DWIM 1TE6A 3M7WA 3AISA 4DI8A 1M53A 2DZUA 3MQTA 4DB7A 2VGGA 2VURA 3TA6A 5KINA 2CBJA 1SMDA 3EXTA 4PMQA 2X7WA 4BF5A 1CLXA 4NYUA 4W86A 3WK0A 4AIEA 3L0NA 2R24A 3IK4A 1OCBA 3G1XA 4DWSD 1GVEA 2PDHA 3SM0A 4LNCA 5D2TA 4AC1X 1CENA 3SIMA 2WSYA 3P74A 2YB1A 4I5RA 3ZT6A 3SCOA 3OVRA 2GUUA 1H4PA 3BW3A 1F73A 3T4CA 3H7RA 3RRAA 4LC6A 4E8CA 3Q37A 1R87A 4PTVA 1WZMA 4M3PA 4A8IA 5AHMA 1CT5A 4EE9A 3HGOA 3AIRA 4O0ZA 1E9IA 1KR0A 1XIHA 1W1TA 4AD3A 1GVSA 4LBUA 3VNLA 2D0HA 2PDNA 1GG1A 2Z6JA 1SM9A 1GTHA 3OLEA 5GJMA 3BAYA 4XAPA 1QHPA 3TOPA 3WQ4A 1QDSA 1WDPA 3AU6A 3QPEA 4H19A 3QF0A 2ZZ2A 2Z28A 2BP1A 3W53A 1JAEA 1RLDA 3WFLA 2J8FA 3BCDA 4IM4A 1R85A 1Q13A 2CCRA 3PJWA 3NZPA 4MUPA 3QV6A 3HG4A 1Z48A 3B9AA 1IV8A 3QV7A 4JN6A 3T78A 4OHQA 1OX5A 3MYPA 3M7SA 1TZZA 4KT2A 4GIEA 2R94A 3FCPA 1FWFC 3L5MA 4PE8A 2DUZA 1LT8A 2ISWA 1B3WA 4JYDA 3G1FA 1VAHA 4P7LA 1E1FA 4E2BA 3N29A 2PMQA 1ZJAA 5GPRA 4NKCA 2ZUMA 3LHYA 1W37A 4LYKA 3G5EA 5JU6A 1YEYA 3WMSA 5AB3A 3W7MA 3MKCA 4O15A 1FWRA 3TC3A 1KGXA 3VOJA 3QC3A 5A5WA 1KO0A 4GXPA 4L4OA 1HJQA 3TWBA 1B30A 2W0UA 4M29A 2XVPA 4GZ7A 3S6TA 5LNRA 3M46A 3SN0A 3RN6A 1NQKA 2XIIA 3R2GA 1TQJA 3QW3A 1HIZA 2R1NA 2X0HA 4NY2A 4JTFA 9XIMA 1CW2A 4MDPA 3OG2A 3PPCA 4XVDA 3W7KA 4O4WA 4RKAA 1KXQA 4KIEA 1S1RA 1E15A 4IIDA 2YA0A 1KTBA 1TREA 3LPGA 2QPSA 3RCNA 2DFAA 2PDCA 4AZGA 3JUGA 4N6EA 2HV5A 1AL8A 1C93A 2WNWA 2JK2A 3W75A 4HPHA 1QOXA 3HGJA 1R8LA 3GO2A 3UR5A 1MEWA 1XLDA 2Y61A 3PY2A 5H8UA 1KA9F 4H7ZA 3WY1A 1HG3A 2EG7A 1LF1A 1AJ2A 3SFKA 1DJWA 4PUMA 3CTTA 2XISA 1RR2A 3M4HA 4RW5A 5D32A 4DWSB 3HJZA 3W7OA 1KM0A 3CUIA 3K2GA 4US5A 3IVSA 4XV0A 1PTAA 3ANVA 3VU2A 2DPEA 3E6EA 1IXPA 3IJLA 4HP5A 1K9FA 1PIFA 3Q2DA 4MNLA 2WHLA 1SO5A 2PD5A 5C71A 3WD4A 3KBMA 2GVEA 2FPYA 5I3IA 4PL1A 4AD2A 2EPKX 3UJSA 3PZ9A 3WQCA 4NNAA 1W3LA 1VENA 3JS3A 1SO4A 3W00A 1QPNA 2F6UA 1W3JA 3WLIA 2D1ZA 4W7VA 1J4EA 3W2NA 2RJHA 3QQ0A 5D8WA 2PBOA 1R9YA 5TD4A 1XRFA 1TB3A 4UTFA 4Q22A 3MWCA 1GQIA 1CDGA 1VFOA 2J7EA 1IGSA 4TQTA 1GTEA 3PBWA 4Z17A 4P7QA 1BWKA 2OOGA 1JDAA 2XIBA 4AVNA 4LT9A 2D2JA 3NVTA 4YL2A 2QJJA 4YNGA 1E4NA 2A4AA 4H6RA 2P3EA 3UVIA 3IVTA 1G94A 3DEQA 2CLFA 3G77A 2E68A 1UKOA 1JZ5A 2B0MA 4LF2A 1D3HA 4DELA 1K8CA 1XJBA 3UVAA 2PTXA 2BWGA 1MXSA 4FNPA 2WSRA 3LCIA 3VGHA 2D2HA 3GXNA 1ZNNA 1LUCA 4R7JA 3VNIA 3LZ5A 4YCPA 3MUIA 1YPIA 3VOGA 3BDKA 3PWAA 3U4AA 2H9AB 1PKYA 2BODX 3W23A 3BQ6A 2GSJA 2ZADA 5F2GA 1W1PA 3LHZA 1V77A 1YKWA 4JX4A 1L8PA 1NP2A 4ZQNA 3H26A 2XVKA 7XIMA 3W6LA 1UMYA 1UR0A 5LA2A 1K1DA 1GJUA 3BV4A 1EC8A 3MMUA 3STFA 2AKZA 4DUVA 1FH9A 2XN1A 4HYVA 1E3XA 4H8NA 4UFMA 4D1JA 2VD8A 3GB6A 3NQFA 1POKA 2P0IA 4CUCA 4Y8EA 4RNFA 3GC5A 3DDMA 2Z0IA 1U5JA 2W9MA 1H0IA 2DVTA 3USBA 1M3UA 1ML1A 7ODCA 2B7OA 4EF8A 3GNXA 2NVDA 3AALA 4RXGA 3KOXA 5CPMA 1JPKA 4DZIA 4JCLA 2FZ9A 1H7WA 4DJFA 3MVIA 4AEFA 1E73M 4PB4A 2FH8A 3EDFA 4AC7C 1Q6RA 2NQZA 2QAFA 3OA5A 4L61A 4U3CA 1BLIA 3DYMA 3WSUA 5HJYA 3VE7A 5DF0A 3W2JA 2PTZA 5DT5A 1VFHA 3WIJA 3ABXA 5K9CA 4AEEA 5G1YA 3DH7A 3P80A 3F2CA 3N4FA 2IXUA 3APTA 3CUZA 4KGJA 4E2OA 1CYGA 1FHVA 2IKGA 3GNOA 4HNCA 1XIIA 3KRUA 3M6YA 4A8NA 3VCCA 1DIDA 1TJ1A 3L4UA 2VDGA 2GL5A 1R86A 4YWSA 3MP3A 4X9YA 5D9MA 2HISA 3W87A 4MY1A 3QGKC 5DCEA 1ZL1A 1M1BA 2D24A 2NX9A 2VRQA 4QJ4B 4JQ1A 1EA0A 1A5NC 1SYTA 4PULA 5DBUA 2H8XA 3N2MA 4QITA 1NOWA 4Q8VA 1XSKA 3W85A 1FKXA 3MMDA 3E96A 3KBSA 3ZR6A 4IQJA 1CX9A 3IRSA 2INFA 3CK5A 1A3XA 3CV7A 2XIOA 2BX7A 3W86A 2VMFA 2E9BA 2B4GA 5CC5A 3S42A 5CLWA 2ZA1A 1AW2A 1KFJA 3Q67A 1A4LA 3MY9A 5K4XA 4REQB 3KBWA 2E3ZA 4WLCA 4O57A 5DY2A 1KBLA 2WCAA 3V0UA 1IWAA 3W1NA 1A5KC 1OSEA 4QHRA 1TTQA 1UR1A 4YTUA 1VLWA 2SFPA 2PF0A 3P82A 4MB5A 4JIEA 2QCDA 4A8RA 5F4SA 2OXNA 3RPDA 4DVOA 5TAOA 1ZPTA 2D2OA 5C9RA 3EX2A 1FFQA 1IZKA 3TFCA 3EWZA 4PEEA 3E0FA 2EPOA 4I9AA 4DQWA 2GQ3A 3IGHX 3NCOA 4WY0B 3TLLA 3CQIA 1OK4A 5ABTA 2CLOA 2D73A 2QR6A 4XTIA 4HNVA 4NT0A 4V27A 3W3OA 4IMFA 4JFSA 2ZE3A 5CBJA 1S5NA 3NQBA 1E0UA 5I77A 1J12A 1RPKA 3NTYA 1SFSA 2HK0A 1TZ7A 3T0AA 3WEMA 1NF0A 1OF6A 3E9AA 2UWFA 4XD6A 1F4AA 3PFRA 3MSDA 1H3GA 2FZDA 3ZYZA 2GYIA 1HP4A 1G1YA 5CGTA 3WLLA 3E38A 1GGOA 2PSNA 4BZYA 1F8MA 3HM7A 1XCWA 2B81A 4KFPA 2A85A 4HPJA 1ITQA 1XYBA 1TMLA 1BKHA 3TONA 5HA7A 3U5UA 4C91A 4S3CA 3ITTA 4FNRA 2PP0A 4PCNA 2NT1A 5HMEA 2FQIA 3ITXA 4D6IA 3ZVIA 2QKFA 3C86A 3GH5A 1KD0A 1VPYA 4Z08A 1IXOA 3JW7A 4UTKA 2XVGA 1H7NA 1RV8A 2NVAA 1EP1A 4AYGA 2E6DA 2X1SA 3DOPA 1JF5A 4HA4A 4N02A 1XF0A 1GW9A 3GVVA 4LWWA 5HQMA 5DXYA 1F05A 4NASA 3R43A 2Y63A 4N9BA 3LOTA 5HNTA 1OG0A 4JTTA 5EMYA 2X41A 4YHGA 3HQ1A 2QCLA 1W9XA 1QWKA 4LSBA 1FWDC 3GH7A 4IIFA 2Y70A 4DN1A 2WW5A 1WA3A 1HJVA 1XI3A 3E2SA 3ABQA 2WSKA 1MMFA 3LLFA 3TW9A 5EPDA 2QJNA 4NNCA 1UP3A 2IPFA 4QQUA 3WDQA 2OGJA 3B8IA 3T8QA 1K9EA 4RE4A 5FEWA 3FK4A 4MG4A 4US6A 5XINA 2OLHA 5BROA 1UZHA 1WDWA 2ZRUA 5HBFA 3AOFA 1BFNA 3HA1A 4J3VA 1VYSX 2DSKA 1P1XA 3FGCB 3I7SA 3JRKA 3A6OA 1VFUA 5EMMA 4C6EA 2A7NA 2J79A 3S83A 2QJHA 1X1OA 2YXGA 1ZBCA 5TNVA 1US3A 4GGBA 4HCLA 1Q45A 4KRZA 1XRTA 2VHLA 3AAMA 4UZSA 1TR9A 2FVMA 3DG7A 4H9UA 1XIJA 1ZLPA 1JCYA 4JICA 1EQCA 3C2EA 4WK9A 1YXCA 5MKGB 1E4MM 4O11A 1BSLA 4FZIA 2HQAA 3VKBA 3MHFA 4NRSA 3AS0A 1JF6A 1RY8A 4FNTA 1H5VA 4HMDA 4IMAA 1WUFA 5FF2A 4OOUA 5FJJA 3WX7A 2ZXBA 3C2OA 1BVNP 4Y7EA 2YYUA 4O53A 3WYZA 1RQHA 1OF8A 4FR1A 3CB8A 1D9EA 1JR1A 2CPUA 3EPOA 2VD9A 3EB4A 4NJKA 3WUGA 4AWUA 1NQ6A 2J13A 4P7NA 3HIJA 3VK5A 2CWXA 4WSJA 4MJ2A 1HW6A 5A6MA 2P8BA 2JGYA 4NJJA 4MZ8A 4YTRA 1UUOA 3LXBA 3LTYA 2AKMA 2NQ5A 3EB2A 4LS1A 1UH2A 1P0DA 1JFXA 1DWFM 4AUBA 5CQ1A 4GWEA 2J8GA 3LN3A 1JUBA 4E4FA 4PTMA 1PKLA 4AIOA 1XHGA 4Z1DA 3R6IA 3QKEA 3MMWA 5KZEA 3KZSA 4P7RA 4JTHA 3CAKA 3TROA 3QRHA 3PULA 5CPQA 1V4YA 2WBGA 1UROA 3S2CA 3UWQA 4ZENA 3KTXA 4POCA 1QNPA 2XM1A 3W6MA 3NQCA 2FPTA 2RHGA 3L2IA 4FNQA 1EUNA 3VYLA 3EDKA 4UMAA 4IP5A 3W1MA 3PVFA 1LBLA 1CB2A 3RNDA 6XIMA 1I0BA 5AVNA 4ADUA 3GR7A 3M44A 4U5IA 4YIWA 1J01A 3WUFA 4M24A 3VKAA 1K8YA 2O4QA 3WDHA 3T40A 4K7YA 3EDEA 3ZLGA 3VD5A 1YXYA 2OYKA 6A3HA 1HP5A 4PUDA 1MW3A 1KGWA 4FLQA 3CAWA 5A8PA 4JQ3A 3UYCA 4LY4A 1A0EA 2HZGA 2NWRA 1GW1A 1MW0A 4KCWA 1JCNA 1SFLA 3LERA 1WAUA 4MSSA 5D9OA 1HUVA 3O0FA 3ANYA 1TV2A 1L0PA 3W7HA 2BOFX 2QDHA 1EJSC 1XIBA 1JPIA 3A4AA 4MLJA 3MCOA 2XSBA 1XLAA 1NOFA 5FAGA 2F7FA 2CZVA 1TE1A 4WD0A 4F48A 3GYCA 1RCQA 5D03A 4RPPA 3FVDA 4UNKA 1LRNA 4WXZA 3PBMA 2INEA 3GTIA 4OV4A 2P5NA 4LV4A 3A64A 1XS2A 4C6IA 4GACA 3T1GA 4MJZA 3UU0A 3AIQA 4R9XA 2XGIA 3BANA 1O7AA 4G1NA 5BWFA 4S3BA 1M7JA 1GCYA 4UTWC 3WCZA 3H22A 4HKPA 5A3HA 4QAIA 4EF9A 2OEJA 2JF6A 3MI2A 1UBPC 4C6KA 4DO5A 3QXBA 3DN5A 3LSBA 2X1TA 3QH2A 2IXVA 1F6KA 4X9SA 4MB4A 1JCTA 1V6TA 2Z1BA 4FHAA 3H8AA 3RCMA 5DCBA 1EEPA 2DH3A 5MF5A 2PCQA 1J2BA 4R88A 3LTPA 1PBGA 3N9RA 4Q7NA 5AYBA 3LQGA 4PCFA 4LUSA 1E6ZA 2E28A 4GG9A 1W2PA 2OZTA 3SRDA 1G01A 3WELA 1ME8A 2ZWZA 4GI9A 4PUNA 3IAPA 2QF7A 1EGMA 3KS5A 3GVRA 3EAUA 3SSJA 1M9HA 3NPUA 3N15A 3RCYA 4A6GA 4BK9A 2YA2A 3NOEA 1ECQA 3BJFA 1P0BA 1PS9A 1HKMA 3NL3A 5C7VA 3TC6A 2DUAA 2EXOA 4ECLA 1WDQA 3UEQA 4D8ZA 1TA3A 3SCUA 4P8XA 4AZCB 1EBGA 1VEOA 1S2TA 1PX8A 1BWVA 1H60A 4RX0A 4PRRA 1GUVA 3FKRA 1DE6A 2E25A 2DV0A 3AUOA 1ZJHA 3WQOA 4ADTA 3KX6A 3D5HA 2BXYA 1JCJA 1OYAA 3UCDA 5J5DA 2VYOA 4W88A 3WEOA 3OBKA 2BSLA 4L6OA 1LJYA 3GW3A 4IFKB 4PTWA 4HJFA 4ZB5A 3SCPA