2PDUA

Human aldose reductase mutant c303d complexed with idd393.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSDTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pduA00
3Q67A 4JQ3A 3B3DA 3UFYA 3FX4A 1FRBA 1S2CA 2IKHA 4JTDA 2FZ8A 3UG8A 1J96A 4JTCA 3O3RA 2IKIA 2J8TA 2IKGA 1HW6A 1ZUAX 4L1WA 4JTAA 3BCJA 3CAVA 1QRQA 1AH4A 4GACA 1AZ2A 4FA3A 5LIWX 3BURA 5M2FX 3UZXA 3LEPA 1PYFA 1LQAA 2HE5A 1ADSA 3RX3A 1IEIA 1S1PA 4XAPA 4XZHA 4XZMX 5C7HA 1Q5MA 3BV7A 3U2CA 4IGSA 1PZ0A 4JQ2A 2HDJA 1ZGDA 3DN5A 3R94A 4FZIA 3H4GA 4LAUA 2ACRA 1RY8A 2R9RA 2HE8A 1AH3A 4WEVX 3LBOA 2PEVA 4GABA 1T40A 2P5NA 1UR3M 2FZBA 4LBRA 2C91A 3LQGA 3V0TA 4JTQA 4DBSA 3WBYA 2PDJA 4JTRA 2ACQA 2PDHA 4QR6A 4Q3MA 4QXIA 3GUGA 4H8NA 4WDXA 1EF3A 1SM9A 2INEA 4ZFCA 3N6QA 2PDKA 3KRBA 2IPGA 2ISFA 1OG6A 1HQTA 2PDNA 4IJRA 1YNQA 4XVEA 3LZ5A 3CAQA 1S2AA 2PDGA 3LNMA 2PDXA 4GIEA 3CMFA 3ERPA 3LENA 4PUUA 3V35A 3V0SA 3EB3A 3UZYA 1EKOA 5LIKX 4WRHA 3G5EA 2PD9A 1Z89A 2ACSA 3LQLA 3CV6A 4H7CA 2PDIA 3RX2A 2PDFA 1PWLA 1MZRA 4XVDA 4JQAA 3LD5A 4G5DA 1RALA 1EXBA 1US0A 4R9OA 4GQ0A 2PDPA 3D3FA 4WGHA 1AFSA 2PZNA 3ONBA 3C3UA 3MC5A 3O0KA 1MRQA 3T42A 4LB3A 1A80A 2HVNA 3R8HA 2HVOA 2PDCA 4WDWA 3R6IA 5DANA 3GHTA 4PMJA 2PDMA 2HEJA 2BP1A 2DV0A 1S1RA 1GVEA 1Q13A 3R8GA 3BUVA 1M9HA 4XO6A 3WCZA 2PDUA 2DUXA 3EB4A 4QBXA 1AZ1A 3WG6A 2IPWA 3CASA 2I16A 1X96A 3LZ3A 2FGBA 2CLPA 1LWIA 1Z3NA 1YE4A 1PZ1A 2F2KA 4DBUA 4HBKA 1XJBA 1EL3A 3UWEA 4EXBA 2PDBA 4YVPA 4EXAA 3LN3A 3GHSA 5AZ0A 1K8CA 4JIRA 3COTA 4YS1A 2PDWA 4YVVA 4LB4A 2IQ0A 5JH2A 2BGSA 2I17A 1X98A 2IPFA 4FALA 2NVCA 4XZLX 2VDGA 4Q7BA 1JEZA 1IHIA 3NTYA 3LUTA 3EAUA 4YVXA 1X97A 4GCAA 3UZWA 5LIYX 2DUZA 4RPQA 1ZQ5A 1MI3A 3FJNA 4MHBA 5LIUX 4GA8A 4XZIA 2FVLA 3Q65A 3UP8A 1VBJA 2HV5A 4NKCA 4PR4A 4JIHA 3H7UA 1T41A 4DBWA 1PWMA 5LIXX 4JQ1A 3UZZA 3R43A 3UYIA 3P2VA 4F40A 2NVDA 4XZNX 1XF0A 5HNTA 3M0IA 4WDUA 5JH1A 4ICCX 3V36A 2PFHA 3M4HA 1R38A 3G1RA 3RX4A 2PDLA 1QWKA 3QKZA 3WBXA 3VXGA 1RY0A 1VP5A 3F7JA 2WZTA 2IKJA 3R58A 2IS7A 4XO7A 2QXWA 2IQDA 2PDQA 4LAZA 2INZA 4JQ4A 4LBSA 1C9WA 4ASTA 3ONCA 5KETA 4DZ5A 3DOPA 5AZ1A 2ACUA 5HNUA 2FZ9A 3S3GA 1YE6A 2AGTA 4JIIX 3UGRA 3MB9A 3H7RA 1ZSXA 4L1XA 4I5XA 3N2TA 2ALRA 2PF8A 4GQGA 3CV7A 4FAMA 2IPJA 2R24A 3GHUA 2FZDA 4XK2A 5HA7A 3R7MA 4PRRA 1Z8AA 4AUBA 4YU1A 4HMNA 2A79A 1Z9AA 3M64A 4IJCA 4PUWA 2PDYA 4OTKA 2BGQA 1YNPA 3GHRA 4PRTA 3V0UA 4WDTA 2F38A 1XGDA 1AH0A 2PD5A 4QX4A 3WBWA 2WZMA
chains in the Genus database with same CATH superfamily
4E6MA 4ZO7A 5D03A 3MMUA 3B3DA 4LUYA 3GVGA 1IV8A 3WMCA 3PB0A 1GYNA 4WLCA 4ZEPA 3NGFA 4UTHA 3KFTA 3O15A 5EPDA 1NWSA 3A4WA 4MJMA 5LXXA 2CXGA 2F84A 1XP3A 3I3BA 3EOEA 7TAAA 4FI4A 3RN6A 2Y2WA 3L2LA 3H4WA 1ADSA 3GY1A 4XIMA 4UQDA 4F3HA 1C7TA 3URQA 3R2GA 3T09A 5KZ6A 2YFNA 2E0PA 3R0KA 2W5FA 3KVLA 3W83A 1M7XA 4LT9A 1PKNA 4L6HA 2QJHA 3PUGA 3LU2A 1ZGDA 3AHZA 3DN5A 4J40A 4YHEA 3VZYA 5H8PA 1KWKA 1D3CA 3R94A 1WOAA 3H4GA 3M0JA 2J7BA 3LCFA 2Z1XA 3W07A 4M51A 2Q09A 1FOBA 1L6SA 4ILSA 1PKYA 2B0MA 1F3XA 3UA3A 3F5KA 4GWEA 2FHBA 3AU6A 1ICSA 2X42A 5I07A 1FWTA 5G5IA 4ACYA 5A6AA 3ZSTA 1Z44A 3DFSA 4NAFB 1VLWA 1NWTA 1UR2A 3L5LA 1B3WA 3EDDA 3ISIX 4H9ZA 1KGWA 1UP3A 1XYFA 1W9BM 1L6WA 4XUYA 3VOIA 4L64A 1QI0A 3NO1A 3FA5A 5BMXA 4U3AA 4ZFCA 5A6MA 4BF7A 1HN1A 2D24A 3RO6A 2VD9A 1OG6A 3B9OA 3LI0A 3G1FA 2CW6A 3NQDA 2L5HA 3PK7A 2B81A 1TTJA 4R5EA 1JCLA 1JYVA 4HNVA 1FWRA 1BWKA 1JJKA 4MUPA 1DWFM 3LHZA 2V8ZA 3NYDA 3USZA 3F2CA 4LCRA 1M41A 2ABAA 3CUJA 4XZBA 3ARTA 1HFBA 1VFOA 1TTIA 4Q4MA 2Z7GA 3L4VA 3HMCA 1N8FA 3PJUA 1XPYA 3CU2A 4I8YA 2GWNA 4JYDA 3NXLA 4PUEA 1QVBA 3BK0A 3F03K 3GU9A 1JZ2A 1K8YA 3VFCA 4C6QA 2FLIA 1WDRA 4RX0A 3LSCA 1KGXA 2DZXA 1BFNA 1ADDA 2J47A 4M6UA 1G7VA 1RLDA 1VLIA 3TW9A 4WDWA 3WIJA 3G24A 4MWAE 1QJWA 3LLFA 3VPLA 3N9KA 4G1NA 2VOTA 2BBFA 3W2LA 3REQA 1G69A 1RBLA 3GBDA 2CXEA 1MUCA 3SY8A 1KA9F 1E6NA 2VR4A 3WCZA 4CQDA 3OP2A 1TR1A 4KRZA 3BQ5A 5FI8A 4K8GA 1UKOA 5EBUA 4IIDA 3E74A 3HA1A 1U1HA 1QPOA 4IXXA 3TA9A 3THUA 4KGLA 1T0OA 1QK2A 4E2VA 4AYSA 1LL6A 4G7FA 4E8CA 5CZKA 4O0ZA 1MUMA 2E6AA 1EA9C 1CB7B 1O7AA 2WMKA 1QTWA 1BSLA 2VOMA 4DYKA 8CGTA 3W00A 4JFUA 2F2HA 1PKMA 2FDSA 3NQCA 3NPWA 1ZZMA 1C3FA 3QKEA 2AGKA 1LYXA 1E55A 1KBLA 2XZ9A 4FLQA 4QG8A 3TJ4A 1DJIA 2A1YA 3GVQA 4IFOA 4GCAA 3UZWA 3WLJA 4R9XA 5EU9A 2PRHA 3L5AA 2VUNA 4GY7A 1TPH1 3M0MA 3TTQA 3NOEA 4ALDA 3DKJA 4C1LA 3FJNA 3P67A 5AC6A 1W9UA 2Y24A 3A13A 4G56A 1KCLA 1F6KA 3E1F1 3C2RA 5ABGA 3PFRA 4MIMA 4JQ1A 3T81A 1UPPA 3W7DA 3GW0A 1R87A 4NZ3A 4D2JA 3O7UA 4Q4QA 4BEQA 3IANA 1KV5A 4EPEC 3M4HA 3M5YA 3CL7A 1F9CA 4NUWA 1POKA 5E9XA 2G8ZA 4ZO8A 3AS1A 3K1DA 5FCZA 3CUFA 3NQAA 3EWWA 2JF7A 4PSRA 3GXMA 3UZJA 3BZGA 4PSPA 3ONCA 4MPKA 1SFJA 4ACZA 2TMDA 4DO4A 3CHEA 1YTDA 4LJ3A 3DOPA 2YCLB 4C6JA 2ACUA 3GW3A 1W5MA 3M0KA 2CLIA 4O54A 3WLPA 4PB3A 2G4JA 2AGTA 3GBEA 3H7RA 1GOQA 1AW1A 3EX4A 1RVGA 4MUZA 3F4DA 4A29A 1SSDA 4NNAA 4BI6A 4I6VA 1PDYA 3WL1A 1M7JA 3NPUA 1LLWA 2FJKA 3KAOA 4LFYA 2AKZA 1JZ7A 3IV3A 4W7UA 3V75A 5C9UA 3MP3A 1I2NA 3E38A 4Y2WA 4W89A 3ITVA 3G18A 4KWUA 3NSNA 1SFLA 4US5D 2D3LA 4D9PA 4ZENA 2HJPA 2QT3A 1EO5A 2H3DA 3IJDA 1BSIA 3SECA 1MW0A 3RM4A 6A3HA 1A3HA 3MMDA 2FTYA 3S6OA 2WSYA 5I3HA 1JCJA 3EPMA 2EPLX 4AWTA 4DBEA 3DGRA 5JXQA 4L1WA 5H8MA 3PZTA 4JPGA 1KXTA 5F2IA 4YL2A 3SURA 4X0NA 2YL5A 4DI8A 3PANA 2A4AA 3EOSA 1J4EA 1PYFA 1LQAA 1QHOA 8XIMA 4NY2A 3QC0A 5HMEA 2J62A 4XAYA 4DJFA 3G6MA 2C1GA 5A8NA 2VQUA 1ALDA 3OHIA 4CLMA 2CCRA 2O9OA 4GIAA 2G37A 2E8ZA 3UJ2A 4CNUA 4DQWA 3ICJA 5D32A 1XI3A 2VFFA 3K5XA 4XBKA 1GEQA 3WX7A 4Z08A 2HBVA 1S5NA 4UTTA 1O94A 4QJ3B 2DPEA 1XBYA 1NSJA 1W6TA 2GUUA 4NZFA 1TV7A 1OFRA 3SUTA 1UD4A 3H12A 3UJFA 3JU2A 3TYDA 3IUIA 2DQXA 3URBA 4AD1A 2NXIA 4U31A 3WDRA 4GY1A 2QZRA 1TVLA 2QKFA 5MKGA 4UTKA 4TOQA 1UWQA 4UQAA 3WNMA 1WZLA 4NI3A 3VGDA 1C7SA 3MSDA 1H09A 4DUXA 2QCDA 4IL2A 4GJIA 3TQKA 4WVXA 3VA8A 3TCEA 3T0BA 1FWSA 4JTIA 1WNOA 2WZEA 3LZ5A 4A6GA 2VGGA 1UWRA 1NFBA 3SUSA 3W1LA 1WAWA 3WLSA 4L4LA 1E1CB 1IZCA 3V1PA 3VYLA 2A6LA 2PWFA 2BOEX 1K02A 3UXKA 2R6OA 3EMZA 3VDGA 3UZYA 1F4AA 1GJWA 3CNYA 2V5CA 4O1EA 2PD9A 1AD1A 4QFUA 2JALA 3W26A 1UR0A 4D72A 3N2MA 3FXGA 5K3VA 1G7UA 3LHUA 3A3HA 2XPKA 2XFRA 3MJYA 2FDMA 2WK2A 3N17A 2A3BA 1V79A 1XX1A 2EAWA 3PUEA 3UBPC 1KXQA 3B4YA 2ZBTA 1AA1B 1O5RA 3PC0A 3A4JA 3GKAA 2CLLA 4O1BA 1R7OA 3KBWA 5PTDA 4Q32A 4V27A 2ZOXA 3KP1A 1SW7A 1XUUA 1TR9A 3HPFA 3O1NA 6ENLA 5FJPA 2YLAA 1RQEA 1PZ2A 1KFJA 5AYZA 4KCWA 2DV0A 2OQLA 2VC5A 4MB5A 3G8EA 3VIIA 1DXIA 3CQKA 2A3EA 4JAWA 5E0CA 1IQ8A 4LBUA 4A8LA 3BUVA 5JBFA 4EF8A 3GR4A 3I3EA 2EO7A 5E6YA 1EZWA 1O12A 3CTLA 3VKAA 3WG6A 3N18A 3LZ3A 4JX5A 2V63A 3ID7A 3AYVA 2DSWA 3W88A 5I09A 3DDMA 3FSUA 3FYPA 3I6TA 1DE6A 3W84A 2ZUUA 5BXSA 4Y9MA 4HK6A 3H70A 1V0MA 2J9YA 3KVKA 2V6AA 4HD5A 2GVJA 4OBSA 1GVOA 1GUVA 4XB3A 5A8QA 4CVUA 1W1PA 4LB4A 4AX7A 3ARVA 1CCWB 4GIYA 2ICSA 3WLRA 5HOSA 4NIRA 3K30A 5C9RA 1KLZA 1W37A 1JEZA 3UCCA 1E5NA 3CUHA 2VEMA 1TPFA 2B31A 1W9VA 3UVIA 4AF0B 2HK0A 4JNYA 2KX9A 2FTWA 4IH3A 4TTGA 3W2KA 4A4AA 4KEUA 2Y4SA 2OOGA 3FEQA 3R79A 3E0IA 1E6XM 1XPGA 3H2MA 3S9IA 4BQ4A 1GWJA 2I7GA 1M04A 1SYTA 1OVDA 3UY7A 3SADA 3T6CA 1JXJA 3G0SA 4LAKA 5DCBA 5FSEC 1VIZA 1E6QM 1EQPA 1U5HA 5J5RA 3E49A 5L9FA 1DJWA 1GPWA 4HK5A 3CK5A 1KFKA 3RO8A 3S5ZA 3MTWA 4NI8A 3HB9A 2WO5A 4ZB2A 1PSCA 5TNVA 3TSBA 1E4MM 1S5TA 4AFYA 5HBFA 3NJ3A 1C8VA 3BDKA 1JGIA 2JE8A 4U33A 1WDSA 5ABFA 3BMWA 2WHMA 1R3VA 4FNUA 2QUUA 2VP8A 4PMXA 3GNRA 1QPKA 4IMEA 1UPMB 3WQ4A 1B3VA 1UWSA 4NQ1A 1ZSXA 3CB3A 5JIWA 1TZ9A 4Y8FA 3W86A 1KGUA 4D6CA 2J6VA 2J7DA 1XGEA 1GKPA 1A5NC 4M19A 1JIBA 1BHGA 1P6CA 4HMNA 3PB2A 1W1A1 4ZXOA 2ZFAA 2J6XA 1D3GA 1M3UA 1HNYA 1PX4A 3NDOA 2R94A 1TA3B 4GNJA 3ECQA 1ICPA 3VCNA 1B3OA 3QW3A 1ZBCA 3GHRA 1UKTA 1YX1A 3RILA 2HXUA 4ADUA 3TQPA 1AH0A 1PTDA 1B57A 3NSMA 2IW0A 1HJSA 1TPUA 4OHQA 2A21A 3DG6A 1US2A 3EXTA 4ZCWA 3E2VA 1XHGA 4QSFA 5FAJA 1AQMA 1F07A 1X7FA 4NZ1A 2NQ9A 4M6PA 2EHHA 3BO9A 4KFNA 4GLEA 4GBDA 2PI6A 2OLSA 4IPJA 1W31A 4MKSA 4Q4KA 2OLHA 4S38A 2ZVRA 5A8PA 4JKMA 2O9PA 3W7NA 3N12A 3PG8A 2VWTA 3FVDA 1UH3A 4L4OA 3W1MA 4GG9A 2AL1A 3WUEA 3SQSA 3QSTA 1T6MA 3AOFA 3RX3A 1BWLA 2QR6A 4JEQA 2VI0A 4AHOA 2WZIA 4W84A 2PS2A 5C7HA 3HM7A 4JQ2A 4LUJA 1JUEA 3AYTA 1U5VA 2GK1B 2D2HA 3MBDA 4O8AA 4I7VA 4HU3A 3DKLA 1CLXA 4RCXA 5FJJA 1AK5A 3BOLA 1AH3A 1SGJA 5FD0A 2HPIA 4WEVX 4WGXA 3APYA 1T40A 4W5UA 3RAOA 1CXEA 1XRTA 3T7VA 4ENLA 1QI4A 4O4WA 4PMQA 4N9EA 4JN8A 1E3XA 4MADA 2AQVA 1LBFA 1W1YA 3U6WA 4LUIA 1BGGA 4PMDA 4DO6A 1OFDA 1P7TA 3WJSA 2PUZA 3B8SA 2IPGA 2QDGA 5AHMA 1AJZA 3RPDA 1XXXA 3FNDA 2VUYA 4X2RA 4M80A 3NO3A 2QVNA 2RGMA 4PMNA 4UOZA 3GDLA 1XBXA 4RW5A 5GPRA 5DMLA 1R2SA 3M07A 4JIPA 4AVFA 4HYVA 1KFBA 1GOIA 1XDLA 4KIRA 7REQB 4FXFA 1VFSA 1Z89A 5IDZA 1V5XA 4X9YA 3IK4A 1WDQA 2JKAA 2ZUTA 4PULA 3IUHA 1J0YA 5FF4A 1NARA 4LC6A 2V5BA 3AXMA 3W1UA 1EXBA 3PBVA 2QLYA 5AVHA 1V3IA 4H9VA 2HS6A 1EDTA 4MWAC 4PTDA 4I5RA 5DT5A 1GZ1A 3GH4A 3PP7A 1TWZA 3QY7A 3T07A 4ECLA 3TMQA 4IGMA 4J2MA 3HG3A 4M7TA 2PCQA 4L6DA 3CZ8A 2TODA 1CXFA 5DN1A 3V3WA 2NXHA 2PGFA 4M6VA 5BROA 5B7ZA 4A8NA 3U48A 1MNZA 4V1YA 4O53A 2BP1A 2VRJA 4EACA 5CAHA 3LPOA 1IE7C 1ESWA 1XYMA 4IG2A 1AL8A 4M0XA 4C5YA 1JPMA 1EO7A 4QRNA 1OT2A 3GG0A 3LK6A 3TEVA 3LXCA 1Q2RA 1XH1A 2BXYA 3EB4A 4QBXA 3VC6A 2PF0A 2J4GA 2VWSA 1V0KA 4LXFA 3Q94A 5EFFA 4BFAA 4RW3A 3GFZA 4QISA 3QV8A 1JI1A 2GGJA 3GIPA 4Q4PA 3IVTA 4F9JA 4CNOA 2E4TA 3L2IA 3AS3A 2B7NA 1EOMA 1TO3A 3MPGA 4XD6A 3HG4A 3P82A 4ICNA 4MNMA 1Q6GA 4FF7A 1WKYA 2DP3A 4IPNB 1S5VA 2OKOA 3PJTA 2Y5EA 1EIBA 4JTHA 4PBGA 3Q37A 4W88A 3CQIA 3KBJA 2GJXB 3FY1A 3EPNA 1X7IA 2WNQA 1KBKA 3OLGA 4M7SA 4H19A 4AEEA 3NVTA 1GONA 3QHMA 1P7TB 2VDGA 5G1MA 1GK8A 1KM2A 3KLKA 4B5NA 1QNOA 3SY1A 3PR2A 4EPBC 3GXDA 1MI3A 2V3GA 1SJDA 4F0KA 1K70A 4GQQA 2P0OA 3CT2A 1J9YA 2FVLA 1KXHA 2WLZA 4HZ6A 3NZGA 2H8ZA 3RYSA 1VPXA 1EBHA 4ZBCA 2J74A 4MB4A 1T41A 3QFEA 3AXHA 5U7SA 2PMQA 5HR7A 1IXNA 3AIUA 1DTUA 4XZNX 5D05A 4JTTA 4K8EA 1S2UA 2E09A 3KCLA 3EXSA 2VX7A 1EP2A 3LHVA 1I0DA 2YW3A 3P60A 3S2JA 1JZ4A 2VFEA 2F9RA 3IJQA 2QCNA 3TTEA 5CPMA 3GTHA 4F2BA 2IQDA 2PDQA 3P5YA 3MCOA 5HWMA 4IMDA 5A6KA 1ZJIA 2QCHA 4A3YA 1J01A 1Z6KA 3EWDA 3QR3A 3A5FA 3NUKA 4A05A 4J2PA 1EX5A 2NWSA 1DPMA 4J3XA 1D8WA 3K4WA 3WF1A 5HNUA 2A0NA 2I9EA 2Z2UA 1OZMA 4KGJA 1PV8A 1QAPA 1FWAC 5HK4A 4E2DA 5FEZA 4BK9A 4TMBA 2GVLA 3SUUA 3IGHX 1P48A 5D2XA 3VDAA 3RITA 2ALRA 3ES8A 3DFTA 4X61A 3O6CA 4P61A 3QYSA 5E0FA 3G1DA 4WQ6A 1VCGA 3ABZA 1RH9A 1V3JA 4H6EA 2WJFA 3R25A 5EKYA 3LV6A 4ZZ9A 4C5ZA 4O18A 4QDMA 1E6PA 2VURA 2WW5A 3VIKA 1XGDA 3HJEA 1HZYA 1G0CA 1QW7A 5EY5A 1K7XA 4DJEC 2PP3A 4FIRA 3ZWSA 3VCRA 1W1B1 2FH8A 1S3HA 2AQOA 5I79A 3T9PA 4HCLA 2NLYA 3YPIA 4IMAA 2E9BA 2ZDSA 3JS3A 4MFEA 3STGA 2XISA 2Z24A 3WDPP 4PMOA 1UJPA 1HJQA 2BWGA 3NWRA 4WZHA 3BCJA 3WFLA 5IBXC 1DHPA 2BODX 3BCFA 3UWUA 1V6VA 3P84A 4CNNA 3O6DA 1T7LA 2Y89A 3BWWA 1C8XA 1S1PA 3ARZA 3A9IA 3W7GA 4GC4A 4BQ2A 4R27A 1WDPA 3ZJ6A 4OJYA 4GZEA 4NAEB 4AX6A 2IXVA 5IOBA 3PSWA 2QHAA 2Q8ZA 4LX4A 4UNIA 1W3IA 3W81A 5K9DA 4GABA 3J7HA 4FNQA 3W53A 2WC3A 1V51A 3CBWA 4MTVA 1EFZA 2H3BA 1JCMP 4M56A 2ZUSA 1EJUC 1TREA 4UTJA 3KP0A 1Y65A 4WDXA 1Z32X 1JDAA 3W7QA 1DOSA 1FWFC 4HPGA 2PGEA 1UMLA 1E0TA 3MUIA 5DBTA 3NNTA 4DJFC 4GKLA 1DJQA 1ONWA 3R8RA 1YNQA 1JQXA 3N11A 2PE4A 4M82A 3W73A 3KS6A 4HCHA 1L8PA 4QNEA 5A5WA 4CU6A 2AMXA 2JBMA 3EBVA 5AYBA 2GQ3A 3W0KA 1EKOA 3N29A 1CBGA 1AQ0A 3SCUA 4GE8A 3IJ6A 1S2VA 1PKLA 3KS5A 1A4LA 1TPB1 3VOCA 3VIOA 1DL3A 4OQVA 4N9DA 3NXFA 1DXFA 3IJ9A 5AC4A 3BJTA 2EXOA 4CD8A 4NAFA 1V3HA 3SFKA 1Y7VA 3DFNA 3D3FA 4YHGA 3CL6A 4UBPC 3WUBA 1Q8AA 1BYBA 1E70M 3V5OA 3ZOAA 3M43A 2RUSA 3TJLA 2DSKA 1OJXA 2BHZA 1K77A 4CNSA 1A5BA 1GPFA 1OT1A 2WWCA 1QOQA 4RPPA 3RJXA 3STFA 4C6MA 3SUVA 1OZQA 2YA0A 5CJ5A 2NX3A 2GQ9A 4H41A 1PYMA 2FPVA 2WC4A 5REQA 1TELA 5LNRA 3IIZA 1Z42A 3VK5A 1J79A 3S6DA 2A2IA 3CPGA 3B8DA 5M3WA 3ZR4A 4ZSUA 2WVVA 3RLGA 5I3FA 5GNZA 4MB3A 1RJRA 1L9WA 2DT1A 2SFPA 3QFWA 4TX8A 2XINA 2GVYA 4GK8A 3OB8A 4JL1A 1GOOA 4UTWA 5KEZA 4AVOA 1MXSA 3AYRA 2E28A 3EX6A 1SO4A 5KSWA 2Q01A 1TZZA 2PC8A 2XN1A 2WCAA 2FZNA 4IM4A 4M1RA 3PBGA 4US6A 3ZZ1A 2VFDA 3LHWA 2J7CA 3UQNA 4LUTB 3N2OA 3S5OA 5CSUA 1P1MA 4MY8A 4IHCA 4OV9A 4PRWA 4MB1A 3UR8A 4RKAA 3SCNA 3CZGA 3NTYA 1VZWA 3EAUA 3REQB 1ZQ5A 4HHHA 3NZPA 3GYCA 2CIPA 2G97A 4DWSD 1OIMA 1VBJA 4Q7IA 3H54A 1XH0A 5EA9A 1SQ7A 3V4BA 2DU2A 1XIDA 3F5JA 1M03A 3HFYA 2IQTA 1VFMA 3P2VA 2NVDA 3MUY1 2O55A 1YTKA 4QLKA 2FTPA 1SPQA 3NDYA 4WDUA 1OFAA 2VT0A 2VZOA 3UR7A 3VNZA 2XFYA 4B3LA 4GPNA 1K4HA 2PDLA 4RLIA 2HZGA 3O05A 3WLMA 3OA5A 2BZNA 2W79A 3T2OA 4E3TA 4QCFA 2A6NA 1MYRA 4XO7A 1FH7A 4YYFA 1SUXA 3B8IA 4C6FA 3T8QA 2CZEA 2QPUA 3VE9A 2AL2A 3WNOA 1OADA 4AMAA 4PCTA 4N9CA 1XIMA 2QCGA 4X3ZA 3KRZA 1BYAA 4FR1A 5TQLA 2V2CA 2Y7GA 5CPTA 1FWBC 4TVDA 2V67A 2QIWA 4FF5A 3SZ8A 2Q3RA 4N2YA 4JZ5A 3BC9A 4L1XA 2EPKX 4UIOA 1R5YA 3CT7A 4FXJA 1Z8AA 1W1ZA 1F2JA 3LBCA 5ECVA 4ONVA 3GVWA 2YCEA 4WJXA 4UNKA 4O1DA 1UD3A 4FLRA 3DFYA 2GJNA 4MNJA 2BGQA 2G41A 3WUFA 2HISA 3G1HA 3O9NA 2ZUMA 4LAOA 3LDVA 4AZ6A 4XTDA 2ZZ3A 3C4UA 2OSWA 3KCJA 1FH9A 1R30A 4KS0A 3SQLA 1JPHA 1Q2SA 3B8VA 1DQWA 2KAUC 3T4CA 3P14A 2GVEA 2FZ8A 2BB0A 4DX3A 4Z2GA 3I6EA 1I9CB 3M0XA 3OZOA 4AD4A 4IX0A 4CN6A 3OEXA 2D2OA 1EGVA 1U22A 3WLNA 1IGWA 4X63A 4L56A 1MXGA 1U83A 5C2XA 5LIWX 1OYAA 4DYJA 3UZXA 4NVTA 1RUSA 3L66A 2CITA 3G1VA 5C54A 4P8VA 3ENLA 3S1UA 3F4VA 1TRDA 5T26A 5B7YA 4H6KA 4KBXA 1TPWA 3TWBA 4I5UA 3EOLA 4ML9A 1MUWA 1IIHA 4LPCA 1TKKA 5LGZA 1NWRA 5FJOA 2O56A 1Q7QA 5H8UA 5FEPA 4J9JA 4LYQA 4HPHA 1MZHA 2YOCA 1TUXA 1FWHC 1QUMA 8TIMA 2ON3A 4GISA 4O1AA 4NHVA 1DP0A 2CBJA 3HG2A 4K39A 4QG6A 2DJLA 1NP2A 5DCDA 1DWAM 1L8NA 1F7BA 1B2YA 3WLOA 3U4AA 2GL5A 1PHWA 1WXYA 3MCMA 2E8YA 4LU0A 2C91A 4DNHA 2VD8A 1A5MC 3EMCA 2PDHA 4QR6A 3QMSA 1SM9A 1VBRA 3W7CA 5CLTA 5K4ZA 2V3EA 3HGJA 2HCVA 3EKGA 3GIQA 1QBAA 4H2HA 5HAOA 3CHFA 3Q2DA 5KITA 4LEQA 3E0VA 2NV1A 1KRCC 4C60A 2Y5JA 1YDYA 5AYYA 4UQ9A 3WKZA 2FQIA 5A2CA 4B5XA 4HA4A 4B4HA 2OO0A 2GSEA 3RDKA 3MI3A 2QGYA 2R1MA 3IGSA 2J24A 5FACA 4HA0A 4L80A 3SO7A 4ZSTA 2EPHA 3L4XA 4S3JA 3HMJG 2VC6A 4GUFA 1E5JA 4OZOA 2ACSA 3VX0A 1K03A 3C52A 3O0FA 4AIOA 4DLMA 3M5XA 2QCFA 2PDIA 1Q4WA 1ZALA 2CHNA 1SZRA 3HPAA 1MZRA 2OYMA 3W76A 1PPIA 4GJJA 3EEZA 4GUHA 1US0A 3TLLA 3POCA 2R1LA 5DT7A 2G5WA 6XIAA 5D37A 4YWIA 4LCSA 1QNVA 5AFDA 3THCA 4PCSA 2W9MA 1J6PA 3APTA 1A80A 3H53A 4C6KA 1UBPC 1R9YA 1B0IA 4XISA 3KDNA 4XKMA 2PDMA 2Z27A 2NW0A 3WDHA 4L4MA 3UJRA 5B80A 3QQWA 2PP0A 1GJPA 1V6XA 3GG1A 1X39A 2NV9A 3PWAA 2F7FA 4C7DA 1RLCL 3WDQA 3N73A 1DWGM 1CXHA 1VJZA 4E8DA 3OYXA 3VC5A 2DUXA 2NX9A 1E9LA 1AZ1A 2I16A 1K1DA 1U30A 1Z3NA 4O15A 5EMYA 4TXEA 2F2KA 1TV3A 3PAOA 2X41A 1N8WA 4HNNA 1F3WA 1QHPA 9XIMA 3CV2A 1XC6A 4S3FA 4RNHA 1YPFA 4OVXA 3EDJA 4HKPA 3VDCA 4Z17A 1EPXA 1UR9A 1QPRA 3AC0A 4JIRA 3IJ7A 1R7AA 2YGYA 3VZZA 5JH2A 1V77A 2C0HA 4DEFA 1CYGA 4R7WA 3KL5A 3NA8A 4P8WA 5CJNA 4DHGA 3KEHA 2J7HA 3LPGA 5T8GA 4EVZA 2J27A 3G3DA 4K36A 3OODA 5F2LA 1YBQB 2C13A 2E5DA 3STPA 3M7WA 3UG3A 1Z69A 3G2GA 5E0KA 1H1NA 2Z25A 4CCDA 3M0LA 2O4MA 2F6UA 2QAPA 2ESCA 4ZOAA 3RLUA 1EBGA 2ONEA 3GDKA 3H7UA 4LS0A 1KFCA 4AY7A 3BMVA 2ZC1A 3IK2A 2X2YA 4B5VA 4C6NA 3WQOA 2PAJA 5I02A 4Z1AA 1CGYA 2ZRVA 1U1UA 3M0IA 1W9PA 3R0DA 3LCLA 1ZPTA 3AICA 4AYGA 1F6PA 5IM51 3L0KA 1P0NA 1R2RA 1XLCA 3VM7A 3S5SA 1JL8A 1CIUA 3RJYA 4J28A 2PWDA 4A3RA 1GZJA 3TFXA 4QDPA 4NYYA 4WXZA 2PRLA 1PEZA 3W9ZA 2OEJA 4RNFA 3MA8A 4C6EA 1TMHA 4CVWA 3PUOA 4DZ5A 3TC3A 5CPNA 4NG3A 1S46A 1KM0A 4C1NA 1Q6DA 1ECEA 4K6AA 3N15A 1REQB 4QGCA 2XVNA 1KTBA 4XAGA 2V2DA 4QE5A 2Z1VA 3GH7A 3HQNA 4LVGA 1CW2A 4FNRA 1HL2A 1VCVA 3W74A 4H8UA 2HVMA 1A5UA 1OD0A 2Y70A 1D7FA 4DJDD 3QQ1A 4UUIA 3GWQA 3WQDA 2C15A 4HIBA 5D2TA 3BSHA 4O0KA 5CG7A 3V0UA 5K7JA 3EX2A 2DH2A 3WFAA 3WN6A 5ABHA 4QLJA 4L1GA 3UFYA 4GOAA 2QDEA 2I1OA 2OB3A 1HKJA 1UH4A 2J9ZA 4CD4A 1FUYA 1HKMA 3HG5A 2IKIA 3OVGA 3PNZA 2X1UA 3VOGA 4V2XA 1E0VA 1V93A 2KZHA 2IKGA 4NF7A 3GNPA 3QOKA 1QMLA 1PL9A 3L65A 1W1VA 1EHAA 5E70A 1VHNA 2EBNA 1FWGC 3NQ8A 3L0GA 4EP8C 4Z2HA 3THQA 5AKQA 4LY4A 5KZDA 1EJSC 1OF6A 1PIFA 3I4KA 2XWDA 1GQNA 4G2DA 4DZAA 2VGIA 4AMCA 4JBRA 4CNPA 2WHJA 3WY1A 2OT1A 1K6AA 1GVYA 1W5PA 4IGSA 4PBEA 1PZ0A 1X8CA 2DUAA 1GVFA 4XBSA 4NU7A 2HNHA 3AS0A 3O63A 3PBWA 1HKIA 2JEQA 4N6FA 4O14A 3FDKA 2OEKA 3OGRA 3CTTA 3P74A 1JZ6A 2XFFA 4KCTA 3T08A 4C7GA 1UR3M 3D0CA 4S1FA 1CEOA 2NUXA 4JOMA 2Q8LA 1V7YA 2VKZG 4JX6A 1IF2A 1QCWA 2PWUA 3O06A 3V0TA 4RL3A 1V6WA 3D47A 1PX3A 2WMFA 2E6YA 1PCWA 1YNYA 1XDMA 4GVIA 5E5CA 1EF3A 4WD0A 1TUFA 1QNPA 2INEA 4DWSB 3AMCA 1F74A 1IWAA 1XIGA 3VGHA 1B31A 3LM7A 4DUWA 2ISFA 2D2GA 4GKTA 1XLHA 3EWXA 3HO8A 2WNWA 4LTSA 4U28A 2Z00A 1NOFA 3GTNA 3CAQA 3ATZA 4IXHA 2AAAA 4CUCA 1N7KA 4GIEA 5D9OA 1MSSA 4GX8A 5HR6A 5EMUA 1TX0A 4BHYA 3MKKA 4WJEA 3B8TA 4PBFA 4GNVA 3T05A 4ZQMA 1B4EA 3LTSA 1WP6A 2QJIA 4G8TA 2GGIA 3WENA 1O6IA 2FJUB 4IZGA 4H8VA 1WAUA 3GFYA 3LGEA 1TX2A 1M65A 5LXEA 1DXEA 1X8FA 3UW6A 4L9YA 2VQTA 2Z6JA 1X1OA 1YMYA 2I5QA 3WEMA 5EFDA 4MJ2A 1X6LA 3FSTA 4U2ZA 2WCGA 4TX6A 4DAFA 2OTDA 2P8CA 3FFSA 4DF2A 3T2PA 1P6BA 5AHFA 1RK6A 4B3KA 3QTPA 1DIEA 4QE1A 1S2TA 1XCXA 3USBA 3IGXA 1HO1A 4JTGA 3RG6A 6XIMA 3TN3A 3VD5A 3WMBA 3PTKA 4DELA 3WLQA 1EJTC 4HA1A 4QJ4B 3PN8A 1IXPA 3S2NA 3MMTA 1QO2A 3KM8A 1DE5A 2J77A 5HNRA 1BXBA 4JTLA 2W4XA 5AC7A 2FGBA 2CLPA 4V33A 1WX0A 2W66A 3OGVA 5A8OA 2AOSA 4ERIA 3QOMA 3KBNA 3WH9A 3CIVA 4U3CA 3B40A 3MJMA 4DN1A 3FK4A 3C2YA 3PBYA 5FKYA 6PTDA 4W8AA 1R85A 5G1YA 4MM1A 4WF7A 3MUXA 4XKYA 2CLEA 4N4QA 3ITTA 3W7LA 5GNXA 4GBUA 2Y8VA 4D6EA 4V1XA 1Q3NA 2PU0A 2BTMA 4K37A 1XV8A 2PSNA 1KFWA 2YFOA 3QF0A 1N82A 1ZY9A 1RR2A 3PZGA 2ZE3A 2GDVA 1HP4A 3VE7A 4YYCA 5BRQA 1QBBA 3PZIA 4ERAA 1W8SA 2J88A 2LLEA 3A3WA 4K8HA 1JG9A 3MS8A 1B9ZA 3FJ6A 3UP8A 4A35A 2HV5A 3QV6A 4E8GA 1E0XA 1WYIA 2VL4A 4A8IA 2PBOA 4I6KA 4HQVA 3SRKA 4DBWA 5JQ9A 5AN7A 2X2GA 4QE4A 2AMGA 1V02E 2YYTA 3S47A 4F9DA 3ELFA 3RX4A 3TKFA 3V7PA 3LCXA 3BLDA 3SDOA 1EC9A 2I5IA 4EWND 2FMOA 3F7JA 3ANUA 3QZEA 3W02A 3UVAA 1OF8A 3AQUA 2EPNA 5DCEA 2OOFA 4JYFA 4LH8A 1DVJA 4M1BA 1W8GA 1QNQA 3WQGA 3WLLA 3KOYA 1ISWA 4ZR8A 4KWWA 4MLJA 4TX9A 1XYCA 1ME9A 1TJ1A 4K68A 3S3GA 2ATSA 1YDNA 3N2CA 2GSHA 1YE6A 3B0PA 4UTFA 4PTXA 2ODOA 3W1NA 3BGGA 1JDDA 4J3WA 3E3HA 4ML4A 2OVLA 2BDQA 4R88A 2PF8A 3SFWA 5HUPA 3INPA 1KKRA 4DJED 1IEXA 3GXFA 3FDGA 4W86A 3WDJA 3MQTA 4DUOA 2E67A 3C2EA 5CG0A 2PTWA 1K6WA 5CLWA 3TFCA 1KTNA 1WKDA 3AIBA 2QW5A 4JFVA 3MI2A 3DXIA 1NVMA 4S3GA 3R1ZA 1DJYA 2C3ZA 2DJXA 1WCGA 4BI5A 1EJXC 1IXQA 2CU0A 3WF4A 1LLZA 3GC5A 2WZMA 3R11A 3NR0A 2YDQA 4GVFA 3GVVA 1Q6LA 3SEPA 2ZTJA 2Y85A 2Z1SA 4NASA 4PTMA 4XSLA 2VDIA 4H00A 2NT0A 3QW4B 3ITYA 2W92A 5LNVA 4XKYB 3UZ5A 4H9XA 3WD0A 1WDWA 1G9HA 2QJNA 2WM1A 4DPPA 2OWXA 4FA3A 1UKQA 1CT5A 2P3EA 2CWNA 4OECA 3OHMB 1KWGA 2C14A 1OCBA 2YCIX 1KRMA 4PTNA 3IAQA 1YPXA 5HJYA 4O19A 4PZVA 3KXQA 2HDJA 1W17A 3C0QA 1G01A 1T5AA 3F2DA 5I06A 4RJEA 4Z1DA 2J66A 3M0VA 2HROA 4Q4SA 1XIBA 5MF5A 1EQCA 5GJPA 1HP5A 3CQHA 4KWOA 3LG3A 2WSRA 4AZ7A 3H7VA 4DXXA 3PZQA 3KOFA 4Z2JA 2RDUA 4DJFD 4QAWA 2OELA 3HPXA 5A6BD 3W23A 1DWJM 1A3WA 4WY0B 4URIA 1H3GA 3A21A 3SCPA 4F48A 4PA8A 4JNZA 2Q71A 5G2HA 3NG3A 1EC8A 2ZADA 4QXIA 3WFZA 4NNBA 4CD5A 4JDBA 4PC8A 3SRFA 4XD3A 1J0IA 1EDQA 1DYSA 2YW4A 3HF3A 5D4YA 3OBKA 1B1YA 1LG1A 3TCSA 5KZEA 2JEPA 3C8NA 4JY9A 4HTBA 4X9SA 1Q6RA 4REQA 3W6MA 5TF0A 5FJTA 3W3OA 4CU7A 4Z0SA 1UHVA 1XD1A 1NFPA 2VEFA 1VRXA 1P1XA 4MKVA 4KFPA 3B06A 1LUCB 1FY6A 3WSUA 2ZIDA 4WRHA 3UG5A 3UPMA 2BG5A 1L2QA 3G5EA 3T55A 3IVUA 2VO5A 3TIMA 2JGQA 1JCYA 2CNCA 2WZHA 4AXNA 3N6JA 3HV9A 2PDFA 4RDZA 3DENA 3M9YA 4WJ8A 4XVDA 4JQAA 3NL2A 3ITGA 4F0RA 3VNKA 1KKOA 1RZMA 1CGTA 2JKEA 2XM2A 3BLIA 3G0XA 4KERA 4XAFA 1CENA 2NSOA 3B0YA 2ZUVA 3O0KA 1MRQA 4S39A 1L6FA 4LB3A 4K38A 1OC5A 3EWUA 2B7OA 3AXIA 3CJPA 4D8ZA 1GT8A 2P76A 3NURA 3GHTA 2J79A 1NIUA 1XLGA 1P0KA 4PCFA 3L21A 2QF8A 4GHRA 2DIEA 2VEIA 3SGUA 3FOKA 1VRDA 2E40A 2VTFA 1M9HA 3SCRA 3DC0A 3VNMA 2WKLA 3WLKX 4X0VA 3EA2A 4XV0A 3ABQA 2PA6A 1X96A 1UWAA 3THAA 1RJQA 3EZ4A 3BG5A 5JU6A 2I56A 4DO7A 4AC7C 2C79A 3SCQA 1RHCA 3FGCB 1DJGA 1MQPA 4HBKA 4IT1A 2MNRA 2XN2A 2PZ0A 3JZEA 3N3TA 5F1VA 2X0YA 5TAOA 3QZ6A 4O0QA 2XSAA 4YVPA 4TVCA 3TH6A 3I68A 4L5ZA 4HYRA 1K8CA 3NDZA 1WXZA 2O0TA 1IWBA 3LPFA 3TAKA 1IXOA 1VENA 1YPIA 3LI1A 4NL1A 5HNNA 3VD7A 3UXDA 2RJGA 2RKXA 2I17A 3U9IA 1UP2A 1J8VA 4LRTA 3URAA 5E6ZA 3E5BA 4UQBA 1GG1A 1KBIA 4WSJA 2XHYA 3UT0A 1XLAA 3BAYA 2VVSA 1QI5A 4CCEA 5FOOA 4S2BA 3VMPA 3WH7A 4EAYA 4E4UA 3CUGA 2GLKA 4FMVA 1YTEA 1A5KC 5T9BG 5C2GA 3VVGA 4LGXA 1VHCA 2W67A 1A5SA 2Y7FA 3L4TA 4JIHA 2ZXAA 3I10A 5MKGB 2QUTA 1UR4A 4JS3A 1VR6A 5LIXX 1A5OC 2INFA 1LUCA 1XW8A 2WNZA 3GG7A 2Z4GA 3OVQA 3S5NA 3W7PA 1BKSA 4D71A 1REQA 2CKSA 4QNWA 1Q7MA 3E0FA 3M41A 3PPCA 4U4MA 3B0VC 1Y8BA 2G95A 2XZ7A 2PB1A 3W28A 1VP5A 1OX5A 3MYPA 4CN1A 1FHDA 3L23A 4JFTA 1E1CA 5HJXA 3ARPA 3WNKA 4HNOA 1MFUA 1AMKA 3BCDA 1E6RA 1RJPA 3U5UA 3K8MA 3AZTA 4PUNA 4GI4A 2J8FA 1FWIC 2QEZA 3K8KA 5AZ1A 3WQFA 3MP5A 1EJ7L 5BXPA 5E93A 1O68A 1XBZA 1O5XA 1V08A 3DI1A 1I0BA 2AQWA 1PAMA 4NILA 3CV7A 5C55A 4XK2A 3R7MA 3AS2A 2QMKA 4ZOEA 4KT2A 3KOWA 1TMQA 1WQ5A 2WMIA 4FS9A 3W2NA 1LOQA 4FXSA 4MY9A 1WPCA 2GOUA 1AJ0A 4PUWA 1BYDA 4H7ZA 3PJXA 1JD7A 1TJ2A 3NVDA 3A23A 3NO5A 2P10A 1C90A 4RDWA 1LL7A 4EF9A 4F4RA 3KLLA 3RMEA 3WQPA 2UV8G 1ZAIA 3H2AA 3QVQA 3RU6A 4LVFA 2JFEX 4PH6A 1OEPA 2VFIA 1K9FA 3LS9A 1GYMA 4LAMA 1LROA 4YCPA 1SW3A 5FF2A 4C6CA 1R9ZA 5H6HA 4FLOA 2CLKA 4O50A 1D9EA 2CZVA 5D2YA 4ZXLA 4D1IA 3IJLA 1W32A 1AH4A 1XYZA 4OWGA 3N4EA 5FEXA 1QNSA 1K7EA 2A3AA 4EOUA 4IUOA 2XH0A 4GFSA 4UR9A 3GXPA 5D8WA 1AQHA 3A12A 4B5SA 3LMYA 4XAPA 2V3FA 4IIEA 2OZ0A 1CGUA 1UJQA 5E09A 1D7KA 4RZ4A 4CQAA 1AODA 1OGBA 3W71A 2XJ7A 3SIZA 1XH2A 2RDXA 3WMSA 2AKMA 1H7NA 4NNCA 1TTPA 3MSYA 1ZCOA 3VKDA 4WSHA 1VGAA 1BGAA 1V3MA 1W3TA 3HZ3A 3NSXA 1LBLA 2YZRA 1JNEA 1CGXA 1Z7AA 1A5CA 1F8IA 4JTQA 2WANA 1RCOB 2PDJA 2O7SA 2ACQA 4JEJA 4UWMA 4NZ4A 3WK1A 2C1HA 3GUWA 5AHIA 5C8BB 4HMDA 2QVHA 4ZFMA 2EKCA 3BOFA 3EB2A 1VJIA 1JUBA 3SJNA 2YB4A 1P0BA 1OCQA 3U4FA 1XKJA 4UTUA 1ZB5A 2X16A 4J27A 3H26A 2ZICA 2ZUNA 4TQTA 4UTMA 4PUUA 1XIIA 3VNDA 1JZ8A 1GEHA 1XSIA 2HWGA 4FSAA 1ZJAA 5I3DA 5LNWA 5G4HC 1NDVA 3BAXA 2NXGA 3AIWA 4AAJA 2VZUA 1W9XA 2V30A 5L6UA 3FYOA 5J8LA 3RF9A 3AXKA 1UA7A 3DECA 1SJBA 1DV7A 4DIAA 3WLHA 2V9DA 1JCTA 2NQ5A 3KTCA 1V0LA 1GHSA 2Y88A 1SO3A 4PMUA 4FO4A 2PZNA 4H9UA 3B4UA 4LV4A 1UZDA 1RVKA 2GGEA 3GXIA 1EJWC 5F4XA 3ZLHA 3KX6A 3VIFA 3MVTA 1GKRA 2WBKA 1EH9A 3QV7A 4AC1X 2HVNA 3PZOA 1L6YA 3DHDA 4ZB5A 2GOKA 4HB7A 4HHPA 3GNXA 2ZVIA 3IRSA 3CLWA 1QI3A 3N19B 3DI0A 4H8HA 3HU7A 3VD3A 4B92A 1A0DA 1OX4A 4DLFA 2DW7A 3HGRA 3SCSA 3QY6A 1TSIA 1XCWA 2WYSA 3IJ8A 3ZLFA 4HA3A 1PUDA 1VPQA 3ZSSA 1TA3A 3DG3A 1DQUA 3MYOA 3GS6A 4Z1CA 3CASA 1WO2A 1KBJA 1FFRA 1PJ9A 4PYSA 1BVWA 1C8QA 2BVTA 2WXDM 2ZWZA 1LLOA 2E9LA 2POTA 3NQ7A 1G4EA 2FIQA 1OCNA 1EIXA 3H2FA 4QS6A 9CGTA 3MI6A 1P5BA 2VCCA 4GCXA 1VFFA 5LKYA 1DJNA 4BQ3A 3RGTA 5CZSA 2D69A 1FXQA 4ZTXA 1RQBA 1X1NA 2WKJA 2WVSA 3QC3A 2NWRA 3SIMA 4QDWA 2NVCA 4YMZA 1EUNA 3O16A 3TU9A 1SO5A 4C6BA 2JKPA 1PIIA 3ZMRA 5K9CA 4NXSA 2VXNA 4FP1A 3TYUA 2WMGA 2DUZA 4KFOA 4Q22A 1KB3A 3CO4A 4W87A 2EQDA 3BL3A 2GK1A 3S1VA 3ZR5A 2VHLA 4M3PA 4LVBA 4B5WA 1XLKA 2QQ6A 3VCCA 4GVHA 4AZHA 3A24A 3N6HA 3JZUA 1PWMA 3UYIA 2ZRYA 1ZFJA 1ONXA 4CQ9A 3W6LA 4JN7A 5H1WA 2XH2A 3VAVA 3V36A 3CPUA 4A2RA 5BCAA 1R38A 2Z26A 3QKZA 5FA5A 5AVNA 4NT0A 1QFEA 3SCOA 2WOQA 2YBVA 2H90A 3R58A 4IGNA 3TTOA 4HNUA 4U5IA 2R91A 3TWAA 1C9WA 3WQEA 8A3HA 3NQVA 3RCYA 1EA0A 3W4RA 4DJDC 1AG1O 5CZTA 7REQA 1E4IA 1R46A 5BWFA 5FSDC 2DT2A 4BCEA 1ZRQA 5DMNA 2CEQA 2HSAA 2Z28A 3QMRA 1NP0A 3WUGA 3WJZA 3KOXA 4I5XA 3BLFA 3P62A 3BSMA 1EHNA 3WH8A 4RV3A 1R86A 1ZENA 4JFWA 3WBAA 1X6UA 1NDYA 3GHUA 5HA7A 4NJJA 2I5GA 3OZMA 4QLLA 3KTXA 3V1HA 1H5VA 3KW3A 4NJGA 1TIWA 3NEHA 3N13A 1G4SA 2ZRUA 1YNPA 1Q6FA 1TV5A 5REQB 1FTXA 3QHNA 4AWUA 3G1YA 1E1FA 1HIZA 1BYCA 1Q6QA 4X22A 2XIMA 1YYAA 3RU8X 4C91A 5FESA 3NZ1A 2XWEA 4DB7A 1TPEA 4DYEA 4AEFA 1ME7A 5EYWA 1O5QA 2Y8KA 2J8TA 2B7PA 3WF2A 2FGZA 1SR9A 3TTYA 4PUDA 1IT8A 3U3HA 3CAVA 3QV9A 2CBUA 2WKGA 3CZKA 3PY2A 3VKCA 2Y62A 1PTGA 2W6RA 4IPIA 2ZXBA 1UUMA 2BY1A 5BU9A 1H7XA 4JHZA 4WIWA 1IZKA 3CAKA 4WHBA 5ENLA 1U1JA 6REQA 2ABBA 4WY0A 2QDDA 2HE5A 3IJIA 1U5JA 3Q58A 1JXKA 3WJYA 3VNJA 4PCNA 5D02A 3H2EA 3P81A 2YBTA 1Q5MA 1HG3A 3W75A 5D33A 2WMJA 2ALDA 4O1CA 2G3JA 2EG6A 3S6TA 2AAMA 1LRNA 4FZIA 4E2OA 2HPMA 1RCXB 3BQ6A 3QY8A 2Y61A 3H24A 1FCQA 4ORIA 1V6YA 3IARA 1SZGA 3W7HA 3VIGA 2ZX8A 4HNTA 4AG0A 2PTXA 1GOXA 1IR1A 5HMDA 2WNNA 4EE9A 1TTQA 2XUCA 2XH4A 2RAGA 2TSYA 5I2UA 3WD2A 3MZNA 5I6SA 3ZJ8A 2W91A 2GJXA 1FCVA 4PE8A 4M29A 3WQVA 1QI2A 4R85A 1G4TA 3AJXA 5CXPA 3N6QA 4CNTA 1AQFA 1THFD 4Q8PA 3ZLGA 1B54A 1XLMA 2G50A 1QOXA 2CKRA 2QJJA 3LB0A 3STEA 3E6EA 4NX5A 2C19A 3UNDA 4YPJA 3LNPA 4N42A 1W3KA 3XINA 3ES7A 5HJLA 3EA1A 1QR7A 2B7QA 5JVLA 1S2AA 4S2CA 1FHVA 3OYZA 1A5AA 1E51A 5C70A 2V82A 2DT0A 4UFMA 1J0JA 3RPTA 3WELA 4PB5A 2D0FA 1TCMA 3HBLA 1OCJA 1KRBC 1D2KA 3C56A 3RMJA 4ZOCA 3H55A 1HL9A 1EB3A 2XU2A 3FLUA 3R12A 3LD5A 3NQGA 1H0IA 1J11A 3VIPA 2Q3OA 3WQWA 1YHTA 3BGJA 4QIUA 2PDPA 1CXIA 1HTIA 1F76A 2YA1A 3TOYA 3PPHA 3PPGA 1E0UA 3HIJA 1OHLA 2G3NA 3AXXA 4IJBA 4WCJA 4ZQRA 1XFBA 3EWCA 4HU4A 2OEMA 4Q8TA 2QIIA 5FF7A 1H0GA 4OKDA 1E73M 1NOWA 2C7FA 4NJIA 3B05A 3QGKC 2ZX9A 1FHLA 2FMNA 3CPRA 4J4KA 3OIXA 3TJXA 4MF4A 1H61A 3GE7A 5BU6A 1HX0A 2E68A 1XG4A 3LX9A 1TWSA 2DW6A 1YE4A 3KVJA 3DH7A 5JBEA 5AY7A 1H7WA 4PTWA 2JF6A 4HSHA 3TW6A 1O1ZA 2YLLA 3W70A 4XSMA 3RK8A 3MBFA 1FP9A 4DAIA 1HGYA 2GUYA 2HXTA 4PODA 5K4XA 2C8NA 5H91A 2PDWA 2O7QA 4LSBA 3HFTA 4PN2A 1IT0A 2X7WA 4IX2A 6TAAA 2QYGA 4JX4A 4UZSA 4CEXC 4GGBA 3LCGA 3PZUA 4I9TA 5ABFB 5CBBA 1TWDA 3L7RA 2OG9A 2P1FA 3N9SA 5I00A 1UYQA 8XIAA 4IISA 4XZLX 2FB2A 4BWLA 1XGZA 2RDWA 4PFMA 1MRAA 1BVNP 3OTRA 2YDSA 4RPQA 1X38A 1H1YA 2EG8A 3C2FA 1C91A 1WDDA 3G0UA 3MVIA 4I9AA 4OIFA 1E6ZA 3TUUA 1RV8A 4NAEA 3Q65A 1BXNA 2YL6A 3DHPA 4MWAD 3MZ2A 1KD0A 3PG9A 4YN5A 1DHKA 2WLYA 1JI2A 2QCLA 3MWAA 3FS2A 3RHGA 3KL0A 2DZSA 5HINA 3S46A 3NOYA 1JYNA 3MUCA 2UY2A 3H2CA 1HVQA 3C3NA 4Y6GA 1OGGA 3DIPA 2BASA 5KTLA 2UY4A 2I14A 4PFHA 3E2SA 3NM3A 4JD4A 1RY0A 3CC1A 4HGXA 3W22A 1R6WA 4MNKA 3NYZA 1LG2A 3R5EA 1ISYA 3I65A 2BOFX 3SQMA 4LBSA 3FIGA 3O2LA 2Z2BA 4J3ZA 3UYCA 5AOUA 2WMHA 4HZMA 2PCEA 3QM3A 4KEMA 2VENA 3HOJA 1MEHA 3PAJA 2EGZA 4Q8NA 1QK0A 1EZ2A 3QPEA 2V81A 4MZYA 5TBOA 3W7KA 3BG3A 1ITQA 3OQ8A 1GNXA 5TD4A 3T4WA 2DVTA 2OWCA 4I9JA 2NSXA 2HK1A 4PRRA 3VMOA 1EEXA 2F8QA 1XDJA 1KM4A 4YU1A 4HHLA 1YKWA 1L6GA 4UFIA 3KZPA 3LRKA 4HU8A 3M64A 1HJVA 3MDWA 3G1AA 4YXGA 1PE1A 1NELA 2DY3A 2GFTA 5DMMA 3C0JA 1FWDC 3UXLA 3VI2A 2XVKA 2X1IA 4OOZA 2PD5A 2ZDRA 3LRMA 4EIVA 2A85A 3Q67A 3DHFA 2G3FA 3WH6A 3MKCA 1F6YA 3L4YA 4JKKA 4A21A 1AW5A 3W1QA 1OWQA 3ZYZA 1OK4A 3O3RA 4OU1A 3CGTA 3CS2A 1VYPX 4H1ZA 1JPDX 3GR7A 1DTNA 3GB6A 3ABRA 2XSBA 1V03A 3AIVA 1IR2A 1ISXA 3T8LA 4QQ3A 1DWIM 2BNJA 1EX1A 1RK5A 3TA6A 2VZVA 2QS8A 5A6SA 3UJEA 3S1XA 2O92A 2YDRA 1SJAA 5IFTA 3RNDA 5I3IA 1H7OA 4WXYA 1MQRA 1TWIA 3WDIA 4B5UA 1BG4A 4DWDA 1VFHA 1UOKA 1UASA 3W7OA 3U2CA 1JFXA 1F73A 4R3UA 3UNTA 3E2RA 5G2WA 1NF7A 4AIUA 1Z48A 3HGOA 3W85A 4XQ6A 4I7WA 3N9RA 4E4FA 1UBSA 3EX1A 2BVWA 1NDZA 3LBOA 2PEVA 5J04A 3B97A 3CMJA 4LBRA 4GH3A 4F79A 4JFSA 4KWVA 3ITLA 3UPBA 1MW1A 3GAYA 4JTFA 4RUBA 4AZGA 3CQJA 4GZJA 4KF1A 4H8NA 3GUGA 4HTYA 2GWGA 4KKXA 5FEWA 3F4NA 4RNIA 1O60A 4LQ1A 3SRDA 3SAZA 2ZA3A 4YTQA 1T8XA 4G7EB 3OG2A 5LNUA 1HQTA 5I24A 4IJRA 1K9EA 2OPJA 3MHGA 4FOKA 1OGSA 3RPMA 4LF1A 1R47A 3WJXA 4JIQA 3M1ZA 2DSUA 4Y9NA 3ZS4A 1KC7A 5CC3A 3LCIA 1VCFA 1HKVA 3LNMA 4JTSA 4AIEA 2J75A 4UFLA 3IPWA 4M5PA 3GSMA 2P0IA 1OC7A 2W27A 1YRRA 3HURA 4W9TA 1DIKA 1YW1A 1Y0EA 2V5JA 3GTIA 3DYMA 4UMAA 2E77A 2OODA 3F5LA 5D04C 3RX2A 3H2OA 1N2VA 2BY3A 4EX4A 4O17A 1Q6EA 1VH7A 2VZTA 1NFGA 3GXTA 3IRDA 3OA3A 2VEPA 3OW1A 2TAAA 4A8RA 1GW1A 4R9OA 1ECQA 3MMWA 2OR2A 3AFBA 1E4LA 3QTGA 5M5DA 3R0UA 3QHOA 2PGWA 1MXDA 2P53A 3QPYA 1TE6A 4UMCA 2DZAA 4OBTA 3UG4A 4Y9PA 1G4PA 1KQZA 4KRUA 4U5KA 1CLKA 2D20A 1BTCA 2NT1A 4OV4A 3M0ZA 4JHOA 4PGLA 4GUGA 4XZWA 1AW2A 3CZJA 3W1AA 1H51A 4EK7A 3CHVA 2C18A 3OBAA 3MSRA 3LYEA 3LHYA 4A3QA 4Q8QA 4REQB 4LV9A 3OVPA 4KEZA 1QASA 5XIAA 3OJGA 1FDZA 3KDOA 4ROPA 6TIMA 2ZKMX 2CZ5A 1ITUA 3D5HA 1I2OA 3IIXA 5BOEA 1V8EA 3K46A 1IZJA 2IMRA 2DIJA 4PEKA 4IOTA 1ZJBA 2OWWA 1SU5A 4FNPA 4C90A 4C6OA 4MGGA 1EWDA 7TIMA 3TK7A 5C5YA 3ITXA 4KMQA 1BPLB 5GJNA 1CGVA 4DI9A 2ZZ4A 4DM1A 4EXBA 1LT7A 4CD7A 4O8RA 3GHSA 5D9MA 3C61A 3KBVA 3EDKA 4FB7A 4JKLA 3LOTA 1GQJA 4MJZA 2BGSA 3MCNA 1JCNA 3OLEA 2I57A 3ZJKA 3UR5A 1AMYA 2DZUA 2I9UA 3CLMA 2YXGA 3TYZA 1P4CA 4GD0A 3AZRA 2OYLA 3JW7A 4GXPA 3UA4A 3LUTA 4YVXA 4O52A 5LA1A 4DF1A 5EL1A 5HQMA 2OX4A 2PPGA 1H5YA 1KM3A 3U2EA 2C6QA 4YIWA 2DIKA 1V6TA 1ZS2A 2D0HA 4UNLA 1JAKA 3QR1A 2VGFA 2HS8A 2PODA 2XYLA 3W7MA 4IMGA 3W7RA 2R14A 4AXKA 4ICCX 4NYUA 3WBEA 2Y0FA 5CJMA 3WBXA 3OPSA 3SGZA 1M5WA 2WZTA 4WOZA 3FJ4A 2PLMA 2QXWA 5CBIA 1P0EA 3B8WA 2J25A 1K8ZA 4N6EA 2JIEA 4WR3A 3TXVA 3TR2A 2QV5A 2DH3A 4TO8A 3PM6A 2V5DA 5CH9A 2CPUA 4QS5A 5HPOA 4NP7A 2BY0A 4ZO6A 4FHAA 1HVXA 1GOKA 4GFIA 3L67A 4DPQA 3ZJ7A 1XRFA 1IIGA 2O4QA 1Q63A 5CQ1A 2PLJA 3C5QA 2CYGA 2FHFA 1XRSA 2NX1A 3OG3A 4XIAA 1OYCA 1HGWA 3TVAA 4WK9A 1L0PA 1B90A 2NQHA 1TV8A 3WQ6A 2VRKA 1Z9AA 3VIHA 4IJCA 2OMAA 1UD2A 4MSSA 1FWNA 2OGJA 1G5AA 1KW1A 1PB0A 5FIPA 1KFLA 4M24A 3WBWA 1MDLA 4NRSA 3DZ1A 1EGZA 1ZLPA 5HMSA 1QOPA 4UFJA 3BSGA 3DBPA 4AISA 4PTVA 3PVFA 3EWYA 3KWSA 4IPLA 4ORMA 2CHOA 4JTDA 1QU4A 2CETA 2PBGA 1ZAJA 3U2ZA 2ZZ7A 1GJUA 4Z2LA 4JTCA 3ZT6A 1WBHA 1W3JA 2A3HA 1UWTA 1F3EA 2E6FA 1KTCA 4FNSA 4JTAA 4DBDA 1QRQA 4D6GA 4L61A 3G1XA 2XVGA 3ALFA 2G3MA 3LEPA 5T9CE 3DFOA 3M6DA 4HN4A 4BR1A 1T96A 2PURA 1H2JA 1KCKA 1MWOA 4BS0A 2D3NA 2YB1A 3POHA 1XYBA 4XZHA 1AUSL 1K7FA 1NY1A 2YR1A 5D8ZA 1E9IA 2ZZ5A 3CO8A 3FAXA 1QNRA 2FFIA 3TSDA 4IGHA 3WNNA 3ZIZA 1RY8A 1JYWA 2HE8A 3TQ0A 3PF3A 1W3HA 1BTMA 3M47A 3QQ0A 3ITOA 4PUJA 1JULA 3SM0A 3G8RA 3VD9A 1WA3A 5M03A 3RUBL 1SR0A 3GKFA 3UPWA 1YBQA 4H3DA 3WMLA 3UESA 3TDFA 3LQGA 3PHAA 3CIWA 2X1TA 3CHDA 2ISWA 1MO0A 4NZCA 2ZXQA 2VR2A 5C7VA 4Q8WA 3R10A 2NUWA 2ZA1A 3CYJA 3ITCA 3M5VA 2F61A 1UC4A 4ZODA 2ZWYA 3QZAA 4HMCA 2WPBA 4E4PA 1A50A 3Q45A 3LLDA 2TPSA 3N14A 2XIOA 3ZVHA 1XWYA 3UXIA 2WVVB 2PDXA 1FFQA 5F2MA 2VZSA 4PMYA 1TG7A 3PPFA 3RIKA 5BXTA 3AZSA 1J2WA 3EB3A 2PGRA 4D6HA 2X1RA 1C8YA 4A3HA 3S83A 5LNSA 3SBFA 5F7UA 3BICA 3T0AA 4MLRA 2FHCA 4U10A 2X8RA 5ABEA 4K1WA 4LEFA 4H6QA 1UZHA 5A6TC 3EDEA 1QO5A 2UBPC 4IG2B 4GGHA 5DXXA 4BF9A 2YSWA 4WKAA 3MU7A 1EPVA 1EYEA 4HJFA 5CZJA 4O12A 1XLIA 4Y9OA 1J12A 4POCA 1F4HA 3TNBA 1CNVA 3T40A 3DESA 1W2VA 1IEWA 5KINA 1X1ZA 5CSRA 1O5KA 3HQPA 5BYWA 3N4AA 3ZVIA 5I5RA 3BV4A 4W4QA 1M01A 4H7VA 1VQTA 3FYYA 4LS1A 4RZ5A 4P7NA 5DXYA 1QW9A 2WVUA 4MJ4A 1IT7A 3B9EA 1CLVA 1GVEA 1UUOA 2JIWA 1W1TA 2QPSA 1FCBA 1CXKA 7A3HA 5CCZA 4C1KA 1A0EA 2EF9A 5DLCA 2R1KA 5A94A 2A3LA 3ARSA 3IWPA 1JCXA 2GZXA 1O66A 2HNEA 4FIQA 4HPJA 3DAQA 3CAWA 3H6OA 4LVAA 2PU1A 1KNWA 3FEMA 5DF0A 3BXWA 3LM3A 5EMMA 1SSGA 2GUBA 3NQ2A 3VGBA 1HJWA 3P7YA 3DG7A 1TJPA 3SGGA 2QNEA 1JF6A 1K3UA 4EXAA 1LF1A 3R4IA 1H7PA 1WV2A 2XIJA 1JR1A 4F66A 4TUFA 2R1NA 3UEQA 4UR8A 1UD8A 2E5BA 5F4SA 3VKJA 3GO2A 4C6LA 3PTQA 3ARWA 1Y5WA 4ZQCA 1TQXA 3M7SA 5DFAA 4P5UA 4LC8A 4W7WA 1FXPA 5BOFA 7ODCA 4QJ1A 2WJDA 2BS9A 3FXYA 4AW7A 2J78A 3AO0A 1AD4A 5IBXA 5LIYX 1TPC1 3E0WA 3WQ5A 1K4GA 1EWEA 4B9YA 2CHRA 2FH6A 1ISVA 1UR8A 3ZVHB 5ABTA 4XZIA 3DBNA 3WO8A 4M6QA 4GXWA 1PVNA 3GDTA 1OC6A 4NKCA 5F1UA 4ATWA 3PFMA 2VC9A 1KRAC 2OSXA 3UZZA 3C6CA 3I6RA 4DUVA 5IHRA 5I3KA 1XF0A 3E12A 1VKFA 1I4NA 5CGMA 3TW7A 2YCJA 2ATMA 6ALDA 1XISA 4UOQA 3BAKA 1EUAA 3G77A 1GOWA 2DGAA 2OJPA 3LGDA 7PTDA 3W37A 3APGA 5LHFA 3WD1A 2DSZA 4JQ4A 4DWSA 1TQJA 1QATA 1ZNNA 2E9MA 2GJPA 3RLVA 2ZA2A 3QJAA 1XD0A 1IEQA 4L7ZA 3VTRA 3SY5A 4H9TA 3EWBX 5BZAA 3WJWA 1Q85A 1I6NA 4GYPA 2VM8A 3BLLA 1QW8A 5AHEA 4PUMA 3C0LA 1LTDA 4UCGA 5XINA 1EC7A 4EANA 1KCXA 1B9BA 3MB9A 4AH7A 2WHLA 3W2UA 4QAIA 4GQRA 4GY0A 5LSMA 3N2TA 3FCPA 1B3YA 4FAMA 1GVQA 4LCQA 1QPNA 3PNUA 4PMVA 3MKVA 3O6YX 4RDYA 4MY1A 5G2IA 4TU1A 4IMCA 1BD0A 4W8BA 3NAVA 4UTLA 1Q45A 3NGJA 1DJZA 2J7EA 3L2MA 2PDYA 4RXGA 3F1QA 5CAKA 3EYPA 2VYOA 2G4FA 3MHFA 1UIOA 3LXAA 2YDAA 3UWVA 1I1WA 3SN1A 1RA5A 2OQHA 4JQ3A 1C92A 5HUOA 1UG6A 3EXRA 5J5DA 3B03A 3KHJA 3R13A 1UD5A 4H01A 3TROA 1X6NA 1FWWA 1VPYA 4N0RA 1L2UA 1V3LA 3VGFA 4JR5A 1JGMA 2NV2A 1HW6A 3U5YA 3SW6A 3NFUA 1WOBA 3BLPX 2TRSA 3P6LA 2FVMA 3NQFA 2FVKA 5CC7A 2Z29A 3K13A 1GTEA 4MAZA 2XN0A 2VDHA 4O57A 1V02A 4C65A 4MDOA 4LNYA 4JTKA 1XBVA 2Q02A 4AWSA 4U2YA 1IEIA 3NEVA 5DQPA 4AIBA 2RJHA 2X05A 5I3GA 3UGVA 4ZOBA 3OO2A 2HMCA 1TVNA 2Q8XA 5AHLA 2ACRA 4TIMA 3VD4A 1GQLA 2E5CA 3PTDA 1XIHA 3PSVA 3NZQA 1MVYA 1QPQA 1BAGA 3XISA 4AWEA 4LUSB 5IDIA 1J2BA 4Z1YA 5CGTA 3QXBA 2VX5A 3TZNA 3M0HA 4W85A 2YPIA 1OFBA 4Y7EA 2ZUWA 2FKPA 2XIBA 2CLOA 3L9CA 1E56A 3BARA 3WLIA 2C16A 2D22A 1JNDA 3KVMA 2XVPA 4HOXA 1W0MA 1F3TA 4B2DD 4GYFA 3I7RA 1S38A 2CLHA 4AZCB 4IF2A 4V15A 5A3HA 4RDVA 1ITCA 1NU5A 3KZSA 1R3RA 3MP4A 2RGLA 5DBUA 2W61A 3LY0A 1UP0A 2MUCA 5U4NA 4C6IA 5D2VA 4EWJA 3H2NA 4LY8A 1LWJA 3HPZA 4CGTA 5DY2A 3QRHA 5A2BA 4AZBA 4O1FA 1S2WA 3UERA 1R9XA 3W2MA 2PDGA 1W5OA 2D2JA 1EP1A 1XYAA 1TVPA 3V35A 5AC5A 1I60A 4IPPA 1R0MA 4IIFA 3EKLA 3N4FA 4O10A 1ZJHA 2BHUA 1HL8A 3UWWA 4I7UA 3K8LA 1XLDA 5CBJA 2DZPA 3FN9A 2X1SA 1PWLA 1WZKA 2ZRXA 1NM9A 4GI9A 5EMLA 3JUGA 1DWHM 4J7RA 3AISA 1JPKA 3HTWA 3TXZA 1BQGA 1RALA 2Z0IA 3PULA 3A9BA 4Q7NA 3GNOA 4JN6A 4Y96A 5CEWA 1MEWA 2OSYA 1JVNA 5BMWA 4WY0F 2TYSA 1GVIA 3ONBA 4CCCA 4MYAA 3VUSA 2VCAA 2QUNA 5C71A 3W2JA 3T42A 2ADAA 3R8HA 2OQYA 1W1IE 3VX1A 4IP5A 1UKPA 3QSRA 4HZ8A 1NWUA 4Q8MA 2QV4A 1IYXA 3QGVA 4QQUA 2DVXA 1TV4A 2WC7A 3CM4A 1NQ6A 4IWWA 4HN8A 4HOZA 2QPXA 3TLQA 3MSGA 2ISDA 3BAWA 5HXMA 3UWZA 4JTJA 1FWEC 4UMBA 4AQLA 1ZP3A 2WCSA 4CEUC 4KETA 1LORA 1I75A 2QCCA 3ARRA 2Z1BA 2OZ3A 2JGYA 3U7VA 4UQEA 3QMTA 4QTGA 3A22A 2C0AA 5D30A 1V4YA 4JYEA 3COTA 4CN4A 2BOGX 2DZBA 1XYLA 5GQBA 4CQBA 3AJ7A 1JYXA 3S1WA 2PRMA 2A3CA 3VABA 2Y5SA 3CH9A 1RBAA 2IPFA 1SW0A 3ZR6A 3DUGA 3K4AA 3E2QA 4H6RA 4HJWA 3KBSA 4Q7BA 4RV8A 4A3UA 3M6YA 3FHQA 2XTKA 4WOQA 1X97A 4K1GA 3TN6A 4Y90A 2GGHA 2BX7A 3DFHA 6CGTA 3T2QA 3SJ3A 3LRLA 1Q65A 5EMJA 1DIDA 4QSHA 4PR4A 5FL0A 4BF5A 4ADTA 2DSVA 4WX2A 1YADA 2VELA 4JTUA 5CSSA 2WHKA 3VFLA 1H50A 3DU0A 3AMGA 1NAL1 2PWHA 1OINA 4RE2A 3G1RA 3PZVA 5FJIA 5DELA 4UB9A 4DJEA 3AU2A 2ISSA 2J7FA 4NX0A 1XG3A 1G67A 3CIXA 1CI1A 4C7FA 4XWUA 1TE1A 2CLFA 2PTZA 3ARQA 1I2RA 4FXRA 1M68A 2OT0A 4OBRA 1FKXA 2EKGA 2YYUA 3FAWA 2WWDA 3GNDA 4MAVA 1O4UA 3LGGA 1LBMA 3GDRA 1O95A 3TV8A 1H41A 4BA0A 2XGIA 2CWXA 2FFCA 2DORA 4A2SA 1ZHAA 2J9XA 4KCVA 2ASHA 2IPJA 3SI9A 3MANA 2P88A 5C9WA 4CKQA 1UA3A 1OSEA 3GX9A 2YL8A 5HULA 3DYOA 4LVDA 3CUIA 2J13A 1JRBA 4RZBA 4HVXA 3HGSA 1V6UA 1W3NA 3MUAA 1A5LC 3L12A 3DC8A 4QX4A 3O07A 5DMYA 2ZXDA 5LA0A 4ZL1A 1SFTA 2BVYA 3DFQA 4IL0A 4P7QA 3FX4A 1YEYA 3GTFA 1TFVA 4F0HA 4GRSA 1JPIA 4X60A 3UG8A 4JNMA 1M7PA 1JDCA 4IQLA 4RZ6A 2GDUA 3E0LA 2CC0A 1E9YB 3WD4A 3II1A 4GUJA 4GACA 3P8IA 4EPDC 2GYIA 1ME8A 1BEUA 3TOPA 1EDGA 3VUPA 1OK6A 1V0NA 3KBMA 3BPWA 2REQA 4YJ5A 1ODZA 9RUBA 3UWQA 3KE0A 3FKKA 4KRTA 4UFHA 3AALA 3BG9A 2RH9A 4DO5A 3ZT5A 3TQVA 2Y1HA 4L65A 4LOCA 3Q4DA 3VNLA 3VGEA 3VNIA 3W29A 5HMFA 3A5VA 3W38A 5I23A 1XICA 4Q6XA 4DXKA 3DERA 3VOHA 1ZBVA 2P5NA 3S4TA 4HP5A 2FZBA 1H49A 1KO0A 4FLSA 4KESA 2YKKA 4O11A 1W9DM 4LRSA 4DBSA 1DQXA 3LLXA 9XIAA 4WSKA 1XS2A 3ZO9A 2D23A 3NQBA 1CPUA 3SUWA 2NZLA 3ORWA 5G4EA 2E1WA 1OD8A 1GVSA 2GJRA 2NLIA 1ODUA 1QHZA 5IRPA 3KRBA 1FX6A 2OLAA 5BWAA 2YZ5A 4Q6JA 3TYBA 3KOZA 4AU0A 3GRIA 3OLDA 2EJ1A 1JF5A 1TPDA 1DJXA 1SVDA 2HTMA 1W3LA 4ZQPA 2DZVA 2XG9A 4H4IA 5K2ZA 1NH6A 5JMUA 1VAHA 1EJRC 1J18A 3CMFA 4GI8A 5EGRA 1ONRA 1SFSA 4HSOA 3N34A 3FVMA 1BF2A 2BV9A 3AHXA 1RQHA 2NUYA 4F2UA 1UZ1A 4IIGA 1FP8A 4G6CA 4K2SA 3WL0A 4KWSA 2YCLA 1J10A 4RR4A 4PMZA 1TCDA 2BSLA 2OYKA 1SZEA 2BFGA 3W6YA 2FYMA 4OT7A 4GIRA 5HDRA 1VC4A 1FBAA 1UC5A 4N4PA 3F4CA 5HANA 3SN0A 3KRUA 4IIBA 1VJSA 1UW9A 2CFFA 3WH5A 3AYSA 1MMFA 3VDHA 2H9AA 2QUMA 4ZB0A 4CCZA 1S5MA 1LOLA 4I90A 4DXVA 3R6IA 3VMNA 1MW3A 5HQLA 3WEZA 4HZ7A 4E38A 1PDZA 1H11A 2XDFA 2HEJA 4W8LA 1YQ2A 1HT6A 3F4WA 3S2MA 3V5FA 4MWAA 4O16A 3R8GA 4H83A 1TWWA 2UY3A 7CGTA 3LPPA 3T1GA 1TJ0A 5BRBA 4JGDA 1VEOA 5T91A 5HWNA 3UETA 3BZJA 2DT3A 5I78A 4P7OA 2X0SA 4H9MA 3GFXA 5D9PA 7ENLA 4AB4A 5CGQA 4IQEA 4F0SA 1XLBA 3D3AA 2B4GA 3W1XA 4E3VA 5I3JA 3QBUA 4NJKA 4AZ5A 3TTSA 1XUZA 1XJBA 4ADSA 4FX7A 5KZMA 1GCYA 1LM1A 3P0XA 4AD3A 5FF3A 2JQXA 2OXNA 4HNCA 3DYPA 3EGJA 3IVSA 5AZ0A 4YTUA 3QYQA 3QGAC 3W1RA 1SO6A 2VVNA 3DFPA 1FDJA 2IQ0A 4ZQNA 3HQ1A 5CPOA 3QLDA 3L5MA 2R82A 3VIJA 1XSKA 3U0HA 3CWHA 3M0YA 2XSXA 3BAJA 1E71M 4AZIA 3QLLA 3BJFA 1BVZA 4M8UA 3GC2A 4DZHA 1HJUA 2VFHA 4OUEA 2ZX7A 1GQKA 3TN5A 3K4DA 3FKRA 2VC7A 3S8HA 4L9ZA 1V7AA 1HXJA 4Q4OA 1EYWA 2WSKA 3NL6A 2X40A 4GX9A 1JDFA 1BKHA 3BMXA 3W1TA 4QEHA 5SWUA 1TPVA 3LSBA 3VOFA 5FL1A 1B4KA 4GO8A 5JH1A 3H4XA 2QCDB 3OGSA 2G0WA 3P3BA 5C0QA 3LTYA 3T0DA 3OZPA 4J1OA 5H2ZA 2VMFA 3S0CA 1C93A 3MUZ1 2X0HA 1OABA 3CYVA 4LAZA 2WQDA 1XCFA 2OO6A 2V2HA 3P5ZA 3B0UX 1G6CA 1EP3A 2W0UA 2O9TA 4LUTA 1OB0A 4ROQA 4ZO9A 1XQKA 4OGZA 1ZBWA 1VFUA 4MYXA 4FNTA 2GDQA 3NZRA 3RM9A 4BJHA 1M1BA 4JIIX 3GZ3A 1PO9A 4Z42C 4GYPC 4JL2A 4R33A 1FQ0A 2BXZA 2D0GA 4WUIA 2R24A 3UJSA 2BLEA 4J3VA 3F2BA 3T0TA 3FA4A 2A79A 2DVUA 3W25A 4HMEA 4ZQOA 1XQLA 3BLKA 1ZAHA 5LZLA 2RHGA 1HO4A 1W2PA 4OTKA 1KM6A 3RRAA 3A6OA 4G9PA 4J5NA 5C6MA 3OVRA 1LT8A 3DCPA 2VR5A 3P0WA 5XIMA 4H2CA 4PCPA 4Q4RA 3WF0A 4ATLA 2CBVA 1SZNA 1FVPA 3GU2A 4MVAA 4IICA 1S2CA 4HYWA 4EKJA 1J96A 2P50A 3CQ0A 4KIEA 4HOWA 3L4UA 4FX8A 1GG0A 2OFJA 1TB3A 3BJSA 3WNLA 3EDFA 1AZ2A 5BW6A 3V16A 4MZ8A 2VRQA 3BURA 4B3ZA 4HK7A 1WZMA 3IS4A 3C86A 4P8UA 2VX4A 4JCLA 3DEQA 3OLIA 1OY0A 4XG1A 4JXCA 1VBHA 4AD5A 4S3AA 3U7BA 3ZWTA 2WSPA 3GIYA 3HQOA 3BV7A 2W62A 1XLJA 4L6OA 4LALA 3AIRA 5DRCA 5E1QA 1ZU8A 1NOUA 3U8GA 3CHCA 4P7LA 4OE7A 4AZCA 4ERGA 1UR1A 1JQVA 3TONA 5TIMA 4YCOA 1ONEA 1D3HA 3E5PA 4FOUA 1OFOA 4NXKA 2YA2A 2DEPA 3OIHA 1VFLA 1KFEA 1NTHA 3URNA 1HJXA 3L0NA 3U57A 2WSQA 5A1AA 3OZYA 3ZM8A 1VFTA 2WB5A 4US5A 3GR8A 3MT1A 3A64A 1U33A 3W7JA 3BVJA 4I9MA 1AJ2A 4Z0JA 2EPOA 4UQCA 3XIMA 4B91A 1PXGA 3W1PA 2WJZA 1K8XA 2GQAA 3UXAA 2W3ZA 1PZ3A 1YLVA 1O1HA 1A0CA 3E02A 3FA3A 4PL1A 5M17A 3IACA 3LV5A 3CWOX 4S3BA 2WQPA 4XVEA 2E7FA 2ZQ0A 1QXLA 3PJWA 1LL4A 2E3ZA 3VOJA 4UTIA 5JUVA 3AMDA 1DORA 1CGWA 5HWJA 4AEOA 3V0SA 1VYRA 3EOUA 3N04A 4NRRA 5DY3A 2V5LA 3I3DA 4K3ZA 3VZXA 2RFGA 3JR2A 3LXBA 1EEPA 1TIMA 2E6DA 3BGAA 3FGCA 2XH7A 3G1SA 3LCHA 1JZ5A 5LHEA 1WB0A 4R53A 3QN3A 2UY5A 5GNYA 3B8UA 5A6JA 1AVAA 1SMDA 3RR4A 4GQ0A 4PL2A 1EF2A 1M6JA 4WGHA 2QMJA 1KV8A 4JCMA 4UC5A 2V3DA 2GPTA 2V5KA 1BF6A 3AUOA 2WAGA 3C3UA 4MG4A 3CMGA 1FA2A 3TN4A 3IIVA 2O9RA 2PDCA 3PWGA 1P6WA 1LOSA 5K9XA 1FH8A 3W82A 4H9YA 1EOKA 4D6DA 2VCBA 2YL9A 5A8MA 3VIMA 1MDRA 4F2TA 5I77A 4GI6A 3EA3A 3GVRA 3WEOA 4B4FA 4C6DA 1JRCA 1J6OA 1R3QA 2NQLA 4XO6A 3FJLA 3TMLA 4LYKA 5BNKA 3T44A 2PDUA 2V69A 3VM5A 1GVRA 3S2CA 2IPWA 4S23A 4TMCA 3VKKA 3A4XA 4DM2A 3QR0A 1JUKA 1UB3A 3NM1A 2VGBA 3NIYA 1XINA 2XM1A 3SSZA 2OKTA 4B15A 1XIEA 3TP4A 4RNJA 4GYJA 4Y8EA 1EL3A 2DFAA 4MFDA 4HU0A 5A69A 1I2QA 1I1XA 1J5SA 2DZWA 3UWEA 3I7QA 4AD2A 4Z1BA 2PDBA 5AYIA 4E0CA 3M44A 5DEZA 3DX5A 4CU8A 3LN3A 2HRWA 3HV8A 1ML1A 3EMQA 1H60A 3AWNA 4YS1A 1GTHA 2Y63A 3EWZA 1EJVC 1H7RA 2J7GA 2Q6ZA 1DIOA 4HNLA 4AY1A 1I2PA 3ARYA 3CXOA 4QHRA 4BKNA 6REQB 4B5TA 3MY9A 2DQWA 5CC5A 1IHIA 1C9DA 3A47A 3GG8A 1ENUA 1HKKA 2WVTA 1KCZA 1JD9A 2E1DA 3AMLA 3I4EA 1TJRA 2WJEA 2QF7A 3T0CA 3TSMA 1F8MA 1W54A 4MHBA 3MO4A 4DVOA 1SZFA 3UR2A 3AHTA 1WUEA 4P7RA 3W72A 5A8GA 2PTDA 3LBMA 2F6KA 3AIQA 3H8AA 3LMZA 1GOMA 2Z2AA 3JVAA 2GQ8A 1P0DA 3ZT7A 1WXJA 4F40A 3GH5A 3GZAA 3GD6A 1FKWA 4Q8VA 5LYRA 3BLEA 1CWYA 1E4NA 2DDXA 1TMLA 1LP6A 2FPYA 2GSJA 2WV8A 3WK3A 1ICQA 4DY1A 4D6JA 4RK8A 3VXGA 3S9ZA 3A3XA 1QT1A 1KQYA 5CPQA 1TRIA 4TV6A 3WZ0E 3BTNA 3VILA 2QGHA 3NCOA 4NZ5A 2MANA 2CESA 4J3TA 1YXYA 1KR1A 1MQQA 1PIGA 4F0MA 3BW2A 4GO9A 2FZMA 2ZZ1A 4XZ9A 1RBOB 1XM3A 4HHMA 1A4MA 2FZ9A 2C1IA 3TC6A 4GZ7A 2E25A 4GXMA 3MV01 1R3YA 2XGBA 2XIIA 4R7OA 1CXLA 3UGRA 3LHTA 2BHYA 3GM8A 1OX6A 5FJRA 4IFKB 4GQGA 3WYZA 3O6AA 2CERA 2Y6ZA 3IAPA 2YCKX 3LTPA 1VS1A 4UXDA 1K9DA 2Y7EA 1NQKA 4TTUA 1F05A 3WD3A 1E9ZB 3LA4A 1RPKA 4GMEA 1MEIA 4MNLA 2RDTA 3AWOA 2W63A 4WDTA 1N8IA 2PLCA 3NQMA 1U2YA 4QCEA 1KXVA 3ANYA 1Q7ZA 3FW6A 1PHQA 3SR7A 4A22A 1JFHA 2YX0A 2QCEA 4QP0A 5AYXA 1XLEA 4QEEA 3KRSA 1XSJA 2POZA 4X2PA 3VNYA 1W91A 3U2OA 3IIOA 5D38A 2ZE0A 2QDHA 5CKSA 2ZZ6A 1BRLA 1ZUAX 1Q66A 4D8LA 3WNPA 2NVAA 4QITA 3RLHA 1UMYA 2CZFA 4PMRA 5M2FX 4MDPA 4GINA </