2PDUA

Human aldose reductase mutant c303d complexed with idd393.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSDTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pduA00
1QRQA 4JTQA 1EL3A 3ONCA 4LAZA 4FAMA 2PDUA 1Z89A 4XZIA 1Z8AA 4I5XA 4PUWA 5AZ1A 1AH0A 1A80A 2I17A 1UR3M 4JTCA 1XF0A 2ACUA 1AFSA 5JH2A 3UYIA 1ZQ5A 4H7CA 1YNQA 4GACA 2F38A 4WDTA 2PDJA 2PDQA 3MB9A 3LQGA 4OTKA 4XZLX 3V0TA 4GIEA 3G5EA 3UGRA 1ZGDA 3O3RA 2IKJA 2J8TA 4XO6A 1AH3A 2AGTA 1J96A 2ACRA 2PDIA 4DZ5A 3UFYA 3N6QA 4LB3A 3RX4A 3LENA 3Q65A 1HQTA 2ALRA 4WDXA 4LBRA 2DUZA 3R8GA 1T41A 1PWMA 3GHSA 4FALA 2ISFA 3WBXA 2BGQA 4JQ4A 4WRHA 2A79A 3S3GA 2HEJA 1LQAA 1R38A 1Z3NA 3Q67A 1C9WA 1SM9A 4HMNA 2IKIA 4JQ2A 3V0SA 2PDWA 2PDBA 2DV0A 4GQGA 2PDGA 3CAVA 1AH4A 2PDHA 1QWKA 4IJRA 2PD5A 2HVNA 1AZ2A 1S1RA 4JIIX 4MHBA 2PZNA 2IS7A 1VP5A 3UZXA 2INZA 4XK2A 4EXBA 5JH1A 2IPJA 2DUXA 4JQAA 3GUGA 2PDNA 4JIHA 4XZHA 3FX4A 2IQDA 1AZ1A 3R6IA 2PDLA 1LWIA 4LBSA 4YU1A 2HE8A 4XZNX 1EF3A 3UZZA 2QXWA 3H7RA 3R58A 1YNPA 5LIYX 3ERPA 1GVEA 2PDMA 4XAPA 4EXAA 3BV7A 1JEZA 4JQ3A 2PDFA 4IJCA 3V36A 3NTYA 2R24A 3G1RA 4RPQA 2HE5A 2FZ8A 1VBJA 4YVVA 4HBKA 2PDCA 4XZMX 4ZFCA 3LN3A 5LIUX 1EKOA 4JQ1A 1RALA 3LBOA 3M64A 3CAQA 3QKZA 3C3UA 4GABA 1XGDA 4F40A 1S2CA 2F2KA 4PR4A 2NVCA 5M2FX 5KETA 2R9RA 1Q13A 1IEIA 3WBYA 3R43A 1PWLA 4YVPA 1OG6A 3RX2A 4H8NA 1PZ1A 2P5NA 1S2AA 1Q5MA 2FZ9A 5LIXX 4XO7A 4JTRA 4JTAA 3F7JA 3DN5A 3MC5A 4LAUA 3V35A 3WCZA 4PRTA 3GHTA 2PDXA 5LIWX 3H7UA 4ICCX 3LNMA 3CMFA 3DOPA 1RY8A 4GCAA 4PRRA 1YE4A 4WGHA 3N2TA 4FA3A 4XVEA 2HV5A 2WZMA 2INEA 1US0A 5AZ0A 2PFHA 3EB3A 2IKHA 3LUTA 3COTA 4QR6A 4G5DA 1IHIA 4DBUA 3M0IA 2PDPA 3T42A 3UP8A 3EB4A 3WG6A 2ACQA 3CV6A 4LB4A 4YVXA 2WZTA 1K8CA 4XVDA 4PUUA 3CV7A 3BCJA 2HDJA 3H4GA 1ADSA 3UZYA 1MZRA 5HNTA 3UWEA 4WDUA 4Q7BA 1FRBA 2CLPA 4DBSA 2FVLA 5HNUA 3M4HA 1RY0A 1YE6A 3O0KA 2IPFA 2IQ0A 3KRBA 4GQ0A 3R94A 1Z9AA 2BGSA 2FZDA 2HVOA 2PEVA 3LEPA 4L1WA 4PMJA 2IPWA 4Q3MA 1ZUAX 1EXBA 3V0UA 2PDKA 2I16A 3BURA 4GA8A 1XJBA 1PYFA 4QBXA 3LZ5A 2BP1A 1X96A 5DANA 3D3FA 3R7MA 1MRQA 5C7HA 2FZBA 4IGSA 4WEVX 2ACSA 3EAUA 5HA7A 2PD9A 3LD5A 3VXGA 4FZIA 2PF8A 3GHUA 4QXIA 3FJNA 3WBWA 4L1XA 2FGBA 3P2VA 3B3DA 3RX3A 4YS1A 1MI3A 3BUVA 1X98A 2IPGA 3LQLA 4NKCA 3UZWA 4JIRA 3U2CA 1PZ0A 1HW6A 1M9HA 4DBWA 3UG8A 2PDYA 3R8HA 3LZ3A 2VDGA 4JTDA 1S1PA 4WDWA 3ONBA 4ASTA 1X97A 4R9OA 2NVDA 1ZSXA 3GHRA 5LIKX 2C91A 4AUBA 1T40A 3CASA 2IKGA 4QX4A
chains in the Genus database with same CATH superfamily
3B0YA 3E2RA 4UMAA 1MMFA 4FHAA 5I23A 4KCUA 1TTJA 1GW9A 1PPIA 1XLJA 2Z25A 4RPPA 4ZQRA 3WMCA 3OW1A 3IS4A 3FVMA 5J8LA 1Q6RA 1TVPA 1MEIA 3ANVA 2VL4A 1V0NA 3NQBA 1W3IA 4HJWA 4RZ4A 3A6OA 3ZYZA 1QO2A 2JF7A 4K1WA 3CQJA 1V0MA 3UGRA 1EB3A 4F9JA 3TQPA 2Z4GA 3ANUA 3G1HA 2WSRA 3UJSA 3WUFA 1GOMA 1XQKA 3AU2A 8RUCA 3NZRA 4OOZA 4W8AA 3GC2A 4LB3A 1WDDA 5BRQA 5DT7A 5AVNA 5T8GA 1SO4A 3ZXWA 3RO8A 3O16A 3TIMA 4LUYA 1UZ4A 2DU2A 4CD6A 4C1KA 1BYDA 2QAPA 4M1BA 1BWKA 4QCFA 2ISFA 3UA4A 2ZA2A 4D71A 5AYBA 3TSBA 3MO4A 3VD9A 1LT7A 3CLWA 1UMLA 4WKFA 1Q2RA 1K9EA 1OZMA 3L0NA 5D9MA 4UCFA 3S4TA 1F6YA 3AHYA 4Q4KA 3CQ0A 5LGZA 2QVNA 3FDGA 3TV8A 2VC7A 4L4MA 2PF0A 4CN4A 4BR1A 3JVAA 4LUSB 1B30A 5C71A 1EUNA 4B9ZA 3M0HA 2PRMA 1PSCA 3VX0A 3M5YA 4NYYA 1G7VA 4JKKA 1T0OA 5DCDA 4D6GA 4QISA 2I56A 1QOQA 4TVDA 1C8YA 1DJYA 3WBEA 1VFSA 4E0CA 2RUSA 3N4AA 3G8RA 4RK8A 1JD7A 1EZWA 3LB0A 3DCPA 1J0ZA 5PTDA 1BTCA 1YNPA 4DVOA 3B8DA 4JFSA 2QLYA 4JNMA 3VOCA 1JPHA 1H61A 3FAWA 4YWIA 4MSSA 2PSNA 3OP2A 3N17A 4IIEA 3N9RA 2R91A 2V69A 5G2WA 3N19B 2ZX6A 1OJXA 4JIPA 3VIHA 4W4QA 3VUPA 3G1YA 1Q85A 3QV8A 3T0AA 5HJXA 1DJHA 4HK6A 3NQGA 3CB3A 4AD1A 3S1XA 1GVFA 5DMNA 1YX1A 3FOKA 3TCEA 5D9OA 2JIWA 3QKZA 3KTCA 4QLLA 1KTCA 4PR4A 2J88A 4HNTA 3I68A 1NFGA 1DJXA 1DXIA 2X1RA 3DYOA 3EDDA 1D3GA 3RR1A 2Q3OA 3QLDA 3QRHA 4XSMA 3EKLA 1DE5A 1OSEA 2V5DA 3TLLA 3AIEA 2NWSA 1UKPA 3A47A 1HGYA 4JTTA 4LV4A 1EJVC 3W0KA 4UB9A 4GJIA 3VDAA 2P8CA 2GDQA 4O1BA 4OV4A 4O1AA 3BXWA 3WCZA 3Q2DA 1XIJA 3BLKA 2QJIA 4PGLA 2OEKA 4NRSA 4LUIA 1RY8A 2VEGA 1ZAJA 2ZRWA 4CQ8A 3W23A 4O19A 3WQOA 4RV8A 4QIUA 2HBVA 2VQTA 1QPQA 2AQVA 3UR5A 3WBAA 2GSHA 5BCAA 2GFTA 4UTJA 2IKHA 1X6NA 4D8LA 2KZHA 3RU8X 2QGHA 4EF8A 4Z42C 5I6SA 2H90A 4NJGA 4C6BA 2P0OA 2J7HA 3SW6A 3E38A 1G94A 2GJPA 2QUUA 1F7BA 3OBEA 4KCVA 1GOIA 1XX1A 4GUGA 5U7SA 2H6RA 1DP0A 2QUVA 4MTVA 1TMHA 5LA1A 2HDJA 5D8ZA 5HDRA 5IOBA 1F3EA 4DI9A 4TV5A 1ME7A 4DWDA 5HNTA 4GVFA 2OLHA 3LHWA 4DAFA 5FCZA 4GFIA 3VGFA 4IX0A 1JD9A 1XUZA 3H2MA 1H2JA 3B03A 1HJWA 4YYFA 2FZDA 3I10A 4D6CA 1MSSA 1ONXA 1Z41A 3UGVA 1UWAA 2FJKA 2CBJA 2XM2A 1WXYA 1W3TA 3AHXA 4A6GA 4R7JA 1XXXA 1UR1A 1GJUA 1EO5A 3W22A 4JTHA 3H4XA 4IT1A 1IIGA 3MSYA 4C6CA 4RW3A 1OYCA 4L9YA 3M47A 3KL5A 4O10A 4R53A 1G1YA 1WX0A 1UR0A 1F3TA 5C2CA 2ACSA 2E7FA 4ONVA 5JXQA 2DFAA 4CLMA 1J01A 4UNIA 2Z24A 3F4NA 4Q8WA 4B4HA 1EFZA 4ZODA 3GD6A 5ECVA 1PO9A 4LT9A 4PB4A 3HFYA 2BASA 1QK2A 5CJNA 1CGTA 3G1XA 1VRDA 3NO1A 3W7QA 1OFAA 5F1VA 3WDPP 3U2CA 3GXFA 4HU3A 1HW6A 3VIIA 1IEWA 5E6ZA 3T0DA 1OFQA 1J0HA 4I3GA 3H2AA 4AQLA 4MB5A 4YPJA 1RPXA 3GC4A 5FD0A 5A6JA 2EPHA 5ECUA 2V2HA 5D38A 2YCJA 3TZNA 3WNMA 5G4WA 4UXDA 3RM9A 2CHRA 5TIMA 4B3KA 1U1UA 4GH1A 2DH3A 1PJ9A 1W54A 1EA0A 1AH0A 1PTAA 1A80A 4S38A 1UKTA 2FTPA 2GJLA 2GL5A 2J27A 2WM0A 4H9VA 4PTXA 5JH2A 1JPKA 2JK2A 4RDZA 4Z08A 1W37A 5FJOA 4DJFD 3CQKA 4MKVA 3CZ8A 3VD7A 1ZRQA 4LS0A 4P7LA 3MUAA 4XZLX 3HG3A 5FKYA 4GLEA 3ES8A 3NOYA 4E4PA 3URQA 2AKMA 4I9TA 2ACRA 3E12A 3P0XA 2BXZA 2PP3A 1ZBKA 4LVBA 3D47A 3ARXA 1CGYA 5GJMA 1Y65A 2VENA 3DHDA 3NNTA 3VU2A 2FGZA 5M5DA 3TA6A 2ZX8A 5A6BA 1BLIA 2WHMA 3VC6A 2OQLA 1G0CA 3ZWTA 1K4HA 3GR8A 3GNOA 3PJUA 4JN8A 3TA9A 1PWMA 1G9HA 1H63A 2WC7A 3GHSA 4L61A 4ZQCA 3T2QA 3UWQA 6CGTA 1B1YA 3SZ8A 3HBLA 3CBWA 5IBXC 2X8RA 5T9CE 1R3VA 2VTFA 4FPSA 2BGQA 1P1MA 1FWRA 3ZJKA 1JNEA 3WF2A 1E4IA 4C5ZA 3XISA 3PFMA 1TWSA 1Z3NA 1F5ZA 3Q67A 1WV2A 2VCCA 4NF7A 5FOOA 3MANA 2DV0A 4EP8C 1UD6A 3DGBA 1DWIM 3RITA 2OFJA 1RHCA 1RXOB 3CMGA 1VGAA 3VNDA 3QBUA 1JPIA 4B5SA 2DEPA 1B90A 1UR8A 3JZEA 1M01A 2Y4SA 2Q02A 3L0GA 1JRCA 3UU0A 3LCXA 1A5MC 1E9IA 4IP7A 2OPJA 4RE4A 5I5RA 5JUVA 2EF9A 4WSHA 2CKRA 3LHVA 4Z1DA 3W83A 4LCRA 3ZMRA 2XGIA 4OKDA 1EBGA 3THUA 2GK1B 1JNDA 4DHGA 5JVLA 4H8UA 1PCKA 4F9DA 3SEPA 5CQ1A 1KTBA 4H2HA 3C8NA 1FP8A 2BXYA 3NVDA 4K7VA 3WEOA 4ZB5A 1KM2A 5HULA 3R58A 2UY4A 2J47A 4AEFA 4ZTYA 1H5YA 3QOKA 4LNYA 4HU0A 3BGJA 3CUJA 5HQEA 4XQ6A 2JALA 4UC5A 4MY8A 4PBFA 1XUUA 4HNCA 5A6AA 4CGTA 1FH7A 3UY7A 3W7JA 3QZAA 3WNKA 1SW7A 1QDSA 3DBNA 4LS1A 5A8PA 3S6TA 2RAGA 1VBJA 3KTSA 4W89A 4DN1A 2R14A 1GTHA 4NY2A 5I7GA 1AQHA 2PDCA 3AXMA 1CNVA 1CXLA 3QR1A 3ZT6A 4D6JA 1UC5A 1YHTA 3MSGA 4JL2A 4GI6A 1UWQA 1KB3A 1TE6A 2Z1BA 5HR6A 3PJTA 3LCHA 4DYJA 2CC0A 2GQ8A 1BRLA 3FFSA 3BW4A 3W1AA 2NXGA 1P7TB 1XBZA 2WSPA 4IX2A 4R3UA 1CCWB 1ONEA 4U10A 3BG5A 4I5UA 4HHLA 2DP3A 4TU1A 1UJQA 4UFIA 6A3HA 3QJAA 4PMNA 4F4RA 1QWGA 2H9AA 1VIZA 1U5VA 4XD5A 1CZ1A 5K4ZA 4W8BA 5D32A 2CETA 1J0IA 4BZYA 3BOXA 4MIMA 1MO0A 3EPOA 1B57A 3HN3A 5A5WA 3VDCA 3QLLA 4B15A 1V0KA 1R3YA 2GVLA 3LCLA 2PFHA 4LUTA 3IIVA 3WQFA 2BOEX 4ZZ9A 1WE5A 3OO2A 4FLOA 3DKLA 4H00A 2VMFA 3UP8A 3CV6A 3W1PA 4INFA 2DDXA 5LNUA 3E5BA 2VZSA 4LNCA 2QVHA 3ARPA 1QI2A 3NSXA 4NSBA 3BMVA 2BV9A 3IK2A 3KUMA 3UNDA 2CLPA 2I5QA 4I6KA 1E0WA 4KEZA 3ECQA 1MUWA 3GKFA 1QTWA 1WKEA 5A6TC 1S5VA 3WLIA 5LA2A 2VZTA 2R1KA 1IT7A 3VKCA 3LEPA 4E3TA 3M7WA 4WSKA 2Y1HA 2REQB 2Y8UA 3ZIZA 3LCIA 1GVRA 3M1ZA 5L9FA 3C2FA 2PMQA 2V0TA 1J5TA 1SMDA 1YIXA 1U22A 3PBGA 2P0IA 4S3GA 4DF2A 3MMUA 4GA8A 4ZO8A 2VVSA 1ITXA 4Q8PA 5AHFA 1XP3A 4BY3A 1OCQA 1TPB1 2Y61A 4AXKA 2LLEA 3TW9A 1TZ9A 1I2NA 4DF1A 3SUUA 1IXOA 4OWGA 3KHDA 3S2MA 5CSSA 4HZ8A 1HZYA 2WMIB 4IGSA 2Z6JA 2WVUA 1ZBVA 2X05A 2C14A 2H8ZA 2WMFA 3IJ9A 1V6VA 2Z29A 1N2VA 4QXIA 4KFNA 4OBRA 4AMCA 1PX8A 1UHVA 1A4MA 3A5VA 4L5ZA 1DJWA 1IZKA 2BODX 4I8YA 4NNAA 2YW3A 4KEMA 5EL1A 1BVZA 2WQPA 3FK4A 3W1TA 2OYKA 2CLEA 5AOUA 2WJDA 2VX7A 3BTNA 4Z0JA 3MSDA 4N0RA 1G7UA 4AHOA 1RQBA 3V16A 1GYNA 2AMGA 3TJLA 4GYFA 2JQXA 1PIIA 2XZ9A 3KOZA 4FAMA 2PDUA 5IM51 5KMYA 1XLCA 4MB3A 2QJGA 1ODUA 2OVLA 4I90A 3OYZA 2BHZA 3EYPA 1A5NC 4V33A 1X1NA 2VOTA 3BW3A 4HOZA 4Z2KA 4HPJA 2ATSA 5D2WA 3TYUA 4O52A 2XPKA 4Q4OA 4DZHA 1ZGDA 2HNHA 3WFZA 1HVQA 2RKXA 3IIPA 4HN8A 1ZFJA 1G5AA 2UZ9A 3NL3A 4HPXA 3HV8A 3LYEA 3TC6A 1M68A 4X63A 2D2OA 1R87A 1CDGA 5F7UA 3CB8A 2J8FA 3T08A 2Q8XA 3FGCB 5CG7A 2BGNE 4GGBA 2YW4A 3VDHA 3HPXA 1RSCA 3ZS4A 3DFPA 1CGVA 2XVKA 1QOPA 1EJXC 1CB7B 1HIZA 1XDLA 4O1EA 3PBMA 3QN3A 1RLDA 3U5UA 5I0DA 3WBXA 1TVLA 5G2IA 5D2TA 5A6SA 2UBPC 4XAFA 1R38A 1RJRA 2VCBA 2X7WA 4YTQA 1V3IA 2D24A 2D3LA 3QHNA 1BGGA 1X6LA 3VNLA 3PBUA 2HVNA 2VRKA 2Q71A 3VIMA 3GXMA 1JVNA 4D6FA 2VELA 2J24A 3P81A 2C15A 1HP4A 1P0NA 4AWEA 5EGRA 1B3XA 2R82A 4N6FA 5D9NA 1UWIA 5CC6A 5MF5A 2POZA 1ONRA 5DLCA 3LHUA 3P80A 5D37A 4DPPA 1OYBA 4H9TA 4S3FA 4AY8A 1NWRA 3AISA 3GLCA 2F6KA 3L67A 3EDEA 4WJXA 3WY1A 4Q4QA 3R89A 2QXWA 2F84A 3ZR4A 1MVYA 2VR5A 3PZIA 4WJEA 3QHOA 1EQCA 3QTGA 5FF7A 3TC3A 1ITQA 2DPEA 5C0QA 5EMKA 3QF0A 1MDLA 3BJTA 3RCNA 3R12A 5J04A 4MWAB 1XPYA 3FW6A 3W6MA 1W1A1 3WD3A 3R79A 3FA4A 2DSUA 1UH2A 1L2UA 5H91A 4KPLA 1DPMA 4AXNA 2DSZA 2WANA 4HBKA 4Q6JA 2CIPA 4A8LA 4IIGA 2WWCA 2QCLA 3SSZA 5IRPA 3WQ8A 2VRJA 2PCEA 3W6YA 5LZLA 5EYWA 3E0LA 2XH0A 3EOSA 5FJJA 4UQCA 1S2TA 2ZRXA 5M2FX 3L4UA 4BEQA 4R34A 1JXKA 4L64A 4AW7A 2CFFA 4O1FA 2E67A 2BS9A 1YDNA 2QPXA 3AI0A 2CLIA 3MUY1 1FVPA 3HGOA 4C6DA 2FTWA 2FKPA 3CZGA 3T78A 3CGTA 2W9MA 3UZJA 1C8VA 2OG9A 4Y9OA 1KTNA 2QDGA 3RM8A 2VEKA 1F9CA 1YBQB 1FKWA 3SIMA 1SO3A 1SQ7A 1NQKA 2Z2BA 2VKZG 3VAVA 1HL2A 3O9NA 1GUVA 3CTLA 1O7AA 3IUHA 2QDDA 3LLDA 2OODA 3KL0A 2CEQA 3B04A 1V3MA 3CMFA 1XDJA 3ITGA 8TIMA 1FH9A 4XVEA 2HV5A 3RRAA 3OTRA 2BBFA 1OCJA 2EXOA 5GVJA 4PCPA 4O4WA 3O63A 1LBFA 5AZ0A 3M0VA 2VP8A 2PP0A 4TTGA 4WJ8A 3MU7A 3OGRA 1LL6A 4A3YA 2YLLA 3S1GA 5I00A 1QFEA 3OHIA 2ZWZA 4KFOA 1OX4A 3EB4A 2ACQA 3CUFA 1V8EA 1K8CA 1QCWA 2OYLA 4CNOA 4A2SA 4E2VA 3DFQA 3ZLFA 1LZOA 5JBDA 2XWEA 3PBWA 4FO4A 1G69A 3VC5A 1FRBA 4WY0B 2PWEA 1HN1A 1N8IA 4CNPA 2YBVA 3CIWA 5IFPA 2P88A 4IMEA 2IQ0A 1ENUA 3MYPA 1EC7A 5D2VA 3APYA 5REQB 1T96A 4W88A 3EEGA 1ONWA 3UQNA 2OZ3A 3QR0A 4TX9A 3RO6A 4AH7A 3NCOA 1FDZA 1OFEA 2GGGA 2PDKA 3DFYA 1EGZA 4QAWA 2NQJA 3MTWA 4JYEA 2C79A 4GJ1A 3W2MA 3MHGA 3GTXA 2WNNA 3NIYA 4WD0A 3KDOA 3M16A 2OSWA 4EE9A 2CXGA 4F0MA 4GI9A 3VOIA 4WOQA 5HA7A 5C9WA 1E4MM 4S3EA 3GDTA 4ZVJA 2XJ7A 3THDA 1A53A 2Z1VA 3G0SA 4DRSA 3T4CA 1X7FA 4W86A 2PWUA 1PIGA 4LWWA 3GYCA 1FA2A 2X7VA 4YS1A 1J10A 4J3WA 3WJSA 4WHBA 4H3DA 2V5KA 2VM8A 1NM9A 4JIRA 2WCSA 3TDFA 3WLSA 3AAMA 4AF0A 4WLCA 2ZVRA 1CECA 2GJXB 3E2QA 3THCA 3O0FA 4GNKB 1Z42A 5JQ9A 4R27A 2GGEA 3AXKA 1BVWA 3VZZA 2CESA 3WUEA 3Q94A 3LDVA 1K7FA 1QMLA 1EEXA 1ME9A 3TW7A 2QYGA 4BQ3A 1JDFA 1PDYA 3IGSA 4A05A 1TPFA 1PHWA 2FH6A 3F4CA 1NELA 1TRDA 2QF8A 4A3QA 1TWIA 2PBOA 2ACUA 2YYTA 1CGXA 1TIWA 1A5KC 2XFYA 2BHYA 4QSHA 4E4FA 1LL7A 4FIQA 1ZALA 1AA1B 2NVAA 1KLZA 4X61A 1AL7A 4ADTA 4GY0A 4P8VA 4V27A 3JW7A 3SRDA 1THFD 3D0CA 2DVUA 4D8ZA 2W5FA 6PTDA 2BOGX 3N6QA 1HGWA 2VEPA 3R1ZA 3OLDA 2J6VA 3OYXA 3CAKA 4D1JA 4U4MA 3NPWA 3Q65A 1HQTA 3GNNA 3WD1A 3EOLA 3QFEA 4OU1A 3EXTA 2Z1SA 3HPFA 1T41A 3ALGA 3WLQA 3W73A 2GLKA 4XAZA 4L7ZA 4HZ7A 6XIMA 2ZBTA 3VFCA 2YX0A 1HJSA 1IGWA 3PPCA 2F2HA 2RH9A 3BARA 3WFAA 1CYGA 1I60A 1UROA 1UKQA 5DMYA 2ZRUA 4ML4A 4WRHA 3WD0A 3R5EA 3GC5A 3GNXA 1FTXA 3F4DA 4B9YA 3NZPA 2PUZA 3PZQA 4JX4A 1ZJAA 4S23A 2F7FA 4IIDA 5JIPA 3KOYA 5BOFA 4Y7EA 1ECQA 4JY8A 1XLEA 4IJRA 1NOFA 2O4MA 3DDMA 5CPOA 2CWNA 4AEEA 1S1RA 4JIIX 1H0GA 1OT1A 2GYIA 4L6HA 1E9LA 2CBVA 1TJ0A 2JGYA 4D6EA 4Q7IA 4JYFA 2INZA 3CT2A 3GX9A 3FS2A 2D20A 2XN0A 1LCOA 1PE1A 3FKRA 1YKWA 2A85A 4TO8A 1JQVA 1AZ1A 4X0VA 5FACA 3ZVHA 1EOMA 1ZJBA 1KV8A 4IG2B 2A21A 4BQ4A 2EPMX 4Z2IA 3DZ1A 2VFIA 5DEZA 2Y0FA 3CHFA 4J35A 4DBEA 5LIYX 2WVSA 1S2WA 1XYZA 3S5NA 3NL2A 4M19A 4ERAA 3IIXA 3RDKA 3U2ZA 1RBLA 3N3MA 3RCMA 1FQ0A 4X0NA 1KV5A 3OG2A 3IPWA 4RPQA 3EKZA 4YJ5A 1ODZA 4ZFCA 3AALA 3LXCA 1XQLA 5LIUX 3PY2A 4H9YA 1XBXA 5K4XA 3CAQA 3LHZA 1C8QA 4J40A 3WQ6A 4EAMA 4MFDA 2Y5EA 2J25A 4JCMA 1W1TA 1MDRA 1DEDA 3QFWA 3L2LA 3MBFA 5BW6A 3AXHA 1T6MA 2CW6A 2D0FA 3F2BA 8XIMA 3RX2A 1JZ8A 2P5NA 1YXDA 3DC8A 4JTUA 4KGLA 1YXCA 3TTYA 8XIAA 1IT8A 5EB8A 4NRRA 1FXQA 2G95A 5CZSA 1B9ZA 1AJZA 4BWLC 5FL1A 3VZXA 3W3OA 3BK0A 1KO0A 3A3HA 4ICMA 4WGHA 2WB5A 3HG5A 1LRTA 4MNKA 4FXJA 4J5NA 1HJUA 3DUGA 1M03A 5I3GA 1L8PA 1JCYA 2YCLB 1O68A 1DJGA 4F8XA 3TEVA 2WZMA 3HURA 4JCLA 3WN6A 3S42A 1YYAA 4UTWC 3T1GA 2PI6A 5LA0A 3FA3A 4KS0A 2AGKA 2YDRA 4JFUA 3VTRA 3PZMA 4YVXA 1EP3A 3VOHA 3H2FA 4US6A 4DUVA 3KTXA 3O07A 1UJPA 1XFBA 4MG4A 3WQ4A 3LI1A 1OGSA 2YL5A 3K2GA 5TNVA 2B7NA 3IJ8A 2A2IA 4B5WA 4YTRA 5AC5A 1O5RA 1M7XA 4I7UA 4NAFA 1B4KA 2HVOA 1R3RA 5A94A 3MVIA 5CLWA 2Y70A 4AIEA 2UWFA 3EWUA 5IDIA 4D8AA 4C7FA 2VOMA 3RLGA 4EX4A 1LORA 1VZWA 1J93A 5A6MA 3PUGA 3V0UA 5CBJA 1TA3B 1HFBA 4GX9A 3O2LA 4FF5A 3RLVA 4HOXA 3W7OA 2O55A 3LZ5A 1UZDA 1SZNA 3R11A 4DYEA 4PODA 3B0XA 4QE1A 1S5NA 1RBAA 2F8QA 3B4YA 3A4XA 1KGWA 1W5QA 3G3MA 3KX6A 4C90A 1SSGA 2CLLA 3GG1A 4DJED 1XYCA 3HTWA 4RDYA 1UW9A 3MSRA 2I1OA 3BICA 3PWGA 3M6DA 1V03A 5E93A 1PTGA 1QT1A 3O15A 1H7WA 1X98A 4E2BA 1CLKA 1NP0A 3UZWA 4PFHA 3KWXA 4WF7A 3KEHA 1HKKA 1H1ZA 3NXLA 2DSVA 3WL0A 3VNZA 3W76A 2J13A 1LG1A 2ZE3A 1FWHC 1E3XA 1D9EA 2NV1A 1PKLA 5ABEA 2L5HA 5IDZA 4EWJA 1QRQA 2XHYA 3BOLA 3ONCA 2W4XA 1XSIA 2R94A 1M7OA 3N2XA 5G4HC 3UR7A 3H53A 1TJPA 2JGQA 4PH6A 2ZZ7A 3RNDA 3GDRA 1OB0A 1BWVA 4MMWA 2XSAA 3WLJA 3EWDA 1ZQ5A 4Z2LA 1ISXA 3MKCA 4Q8TA 2Y89A 2F38A 4U31A 4IOTA 1QAPA 1ISVA 2J7GA 2GGIA 4UQ9A 3NEVA 1AH3A 2WC4A 3JS3A 4HYWA 5I09A 5HANA 3W26A 4FSAA 1O94A 2X41A 3UR8A 4B16A 1LYXA 1YRRA 3RX4A 5EY5A 4IP5A 4JD4A 5I07A 1XKYA 5HWJA 3DU0A 1V7AA 3W7LA 3GSMA 2JKAA 3TAKA 2HNEA 2DUZA 4F79A 3R8GA 3T07A 1GORA 3TTQA 1BQCA 4Q8OA 4IM4A 3REQA 4PCSA 1ICPA 2OSYA 3GTFA 1EJSC 5BOOA 4BI5A 2C1GA 3WF0A 2QGYA 2QJHA 5HXMA 1QW8A 3W37A 1UR9A 4PUDA 2XVGA 1SZGA 1JAEA 2V2DA 2WKGA 1BSIA 1E5JA 1P0KA 2WZEA 4CUCA 1IEQA 3U4AA 4ROPA 1QWKA 4HTBA 1D7KA 4M56A 3THAA 5M03A 1XD0A 3B8UA 4WKAA 2WW5A 2VYOA 3LM3A 1FWIC 5AC8A 2OKTA 1I8JA 5TAOA 1JZ4A 3GUGA 1QNQA 3MUZ1 4H19A 4A2RA 1OC5A 1GKRA 4JTSA 4E4UA 4NUWA 2WMKA 1UH4A 3D5HA 5EBAA 4UCGA 4WKHA 3E49A 3STGA 2I5IA 3UZZA 5H8PA 3BAIA 4YHEA 1OG0A 2QCCA 3D46A 4LQ1A 5DBTA 3VGDA 1GVEA 4EXAA 3LY0A 3P6LA 4PUEA 3QY8A 3BV7A 4YYCA 1OBAA 2R1PA 4CNSA 1VFLA 2BVDA 4JQ3A 5HPCA 3ZQ9A 4LVFA 2NSXA 2E5CA 1W9VA 4G56A 2FZ8A 1UP3A 4G1KA 1FXPA 3LGDA 3L2IA 3O7UA 1OFPA 1H7OA 4CN6A 5T26A 3DHUA 3VVGA 4IPJA 3CIVA 4LV9A 3DHFA 7CGTA 1I45A 5CC3A 1PCWA 2QQ6A 1R2SA 2RDXA 3S1UA 4W9TA 1BXNA 3TN6A 3SY8A 1R30A 4PBGA 4ADSA 3A21A 4O18A 3SCTA 2FMNA 2O7SA 4TX6A 4XISA 2DVXA 3FA5A 3CPGA 3AMDA 1QXLA 3CNYA 3C0QA 3K1DA 4DJEA 1RLCL 2W61A 3W7KA 1W1YA 3MC5A 2BOFX 4CEUC 4GINA 4HHPA 3WJXA 3A4AA 3MZNA 2CBIA 4KMQA 5I3IA 4ICCX 3DOPA 1VFUA 3IRSA 3OVGA 4UQAA 1KFBA 1B4EA 1BQGA 2D0GA 1UUOA 4HZ6A 1U5JA 2NXIA 4LBUA 4N7QA 2A3LA 1US0A 3EB3A 3WMBA 3TZFA 3W74A 1W3NA 3WQCA 2PDPA 4KT2A 2BY0A 3BAXA 1IXNA 5FF2A 1B3WA 1OFDA 1R9XA 3K13A 4AG0A 8A3HA 2Z28A 1VBUA 3MP5A 1TMLA 1W1PA 2Z00A 2PRLA 4E6MA 4V2XA 5RUBA 1A47A 1UOKA 2ZUTA 1E0VA 3N4FA 4FNQA 5AY7A 9XIAA 1QNRA 2PA6A 3GR7A 1KFCA 1UASA 4H1ZA 2ZXQA 3FDKA 3W81A 5IFTA 1RD6A 3VKJA 3HG4A 3NM3A 1DWGM 2PEVA 1YPIA 3QY6A 4ZGYA 4LY8A 3RFAA 1UMYA 3U5YA 3BG3A 2XH7A 4MADA 4UQDA 1ZB5A 3E9AA 4TTUA 3S1WA 4GYPA 1ELSA 4LGXA 4MB4A 1A0CA 5FAJA 4F3HA 4NJHA 3MI3A 4F66A 4W87A 4QBXA 4D9PA 2P1FA 3FN9A 4BKNA 1FKXA 1IE7C 4KH2A 4LC8A 1WYIA 1RBOB 2XG9A 1TO3A 4IGNA 1MRQA 4RE3A 4F2UA 1MXGA 4W7WA 1F8MA 2GVYA 3EAUA 1T8QA 3VXGA 1U33A 4LC6A 4BS0A 2PBGA 2OZ0A 3GHUA 3ABQA 3FJNA 1QI0A 3WBWA 2FGBA 4OHQA 3VM5A 4W84A 4XZBA 3URNA 3NVTA 3TTOA 4KQNA 1VC4A 1ALDA 3P3BA 2TPSA 5C9RA 4LAOA 4GQRA 4J1OA 2QCHA 4WIWA 3PTQA 3RF9A 1T8XA 2J6XA 1PIFA 3GVRA 1WQ5A 3N14A 3W38A 1XD1A 3QV6A 4M81A 1XDMA 3LRKA 1SW3A 3RPMA 1ZL1A 5JMUA 4ATLA 1XYMA 5FJIA 3W02A 3R4IA 5AC7A 1K02A 2R6OA 1ZJHA 4C1NB 2BY3A 2A3AA 3W1UA 1IXPA 3ZT7A 4AZCA 4DUOA 3AS2A 3GS6A 3QMRA 1E3ZA 4EIVA 3AJXA 4K7YA 4GFSA 5EKYA 2YZ5A 3T0CA 4C6PA 5JU6A 4XZIA 3RRXA 4MUPA 4ZB0A 4XTDA 3TYBA 2XZ7A 3W85A 3U3HA 4LSBA 5B7ZA 1W31A 3PNZA 4QEHA 3P5YA 5A8MA 2F6XA 3VKAA 1OK4A 1CPUA 1GJWA 3C2EA 2VZUA 4IPIA 3O3RA 5FEPA 4EXQA 1FUYA 1KKOA 1J96A 4DZ5A 3NA8A 4LYKA 5D03A 2NQZA 1CXIA 4IFKA 4HOWA 3IIZA 1CGUA 3KHJA 1MYRA 4PBEA 3Q37A 4WDXA 3NO3A 2XIOA 2GJRA 4L6DA 1NU5A 3W7PA 1W5PA 1OD8A 2VX4A 1FOBA 1E0TA 1C93A 2FJUB 4MFEA 4PMYA 3H70A 1OIFA 2VNCA 2X2YA 1ZJIA 3NQCA 2G97A 1VHNA 5C7VA 3WLKX 1FWWA 1KRBC 1OFRA 1EJUC 3WLMA 4MWAC 3W27A 3MMTA 2W79A 3CT7A 4NJKA 4KBXA 4R33A 5DF0A 1A3XA 4DM2A 2ZUWA 4PMQA 3W87A 2X1IA 1MEWA 3UZXA 1V51A 3T55A 2V3FA 2WQDA 3KS6A 3NQVA 2QJNA 4JIHA 1EDQA 5K9DA 2KAUC 4JNYA 4C5YA 4NZJA 1BVNP 1HP5A 1EO7A 3P93A 1NP2A 1QI3A 2NW0A 2VZOA 1XKJA 2Y62A 1G4TA 4FLQA 1Q7ZA 3HB9A 2V63A 1TPVA 3EDKA 1X8CA 4AISA 5FEZA 2ZX5A 3HG2A 3EMZA 3IV8A 2Y5SA 4DJDC 3KBJA 2OO0A 4EF9A 4CD4A 4IICA 2H9AB 3W2KA 5DCEA 3W82A 1W3KA 1V6UA 4UOZA 3MWAA 3J7HA 1G67A 5KSWA 1GGOA 3EX2A 4KGJA 1UCWA 2XVNA 1KRCC 3BAWA 4RL3A 1XLHA 3V5FA 2QCMA 2DY3A 3L23A 4FB7A 1DXEA 3AZTA 5C8BB 3EWBX 2ZC1A 1J9YA 1E6SM 4C60A 2F2KA 4I8DA 4N9CA 3FLUA 1BF2A 3PWAA 1XI3A 4LUTB 4Y9NA 3RJXA 3RM4A 1QBAA 3B05A 4EOUA 1QBBA 2HVMA 2ISWA 3SQMA 1OG6A 1YPFA 3QQ1A 4ERGA 4AIUA 2ISVA 3CZKA 4IMDA 1F6PA 1YTEA 4LAUA 1J2WA 4WY0F 4ZOBA 1SO6A 3SUWA 3FHQA 4JX5A 1KM5A 2V5BA 1OGBA 5DBUA 3I6EA 5LIWX 3H7UA 4QNEA 4IH3A 3I65A 3G22A 3TJIA 3S9YA 4QAIA 2AOSA 4PRRA 1MWOA 1YE4A 2ZUMA 3UVAA 3DGRA 5CJMA 4B5VA 4L4PA 3WLHA 5A3HA 5GPRA 2UV8G 1G01A 2XIJA 3TJXA 4H6QA 4O15A 5A8NA 4EVZA 2INEA 4DWSC 1JI1A 1J0YA 4GNJA 4Q4RA 3EA3A 1KBJA 4M51A 4PMUA 4MJ2A 1GOOA 2EAWA 3H2NA 3VIGA 3S46A 5ABGA 1UR4A 1VS1A 4HN4A 4NASA 4AY7A 3B8VA 2YIHA 2DJLA 4WVXA 1ECEA 3WZ0E 5HOSA 4Y9PA 3NDOA 3UWEA 3RIKA 4XIAA 3PSWA 1GPWA 4JFVA 1JCMP 1G6CA 1XGEA 6TAAA 4Q4SA 1XISA 3VGBA 4EPKA 3N15A 4NZ1A 4GVHA 2HS6A 3RCYA 2IPWA 2PTZA 2ZUSA 2O9PA 5E09A 3AU6A 2DIJA 4ORMA 1S5MA 1UIPA 3EZ4A 4J3TA 2CLMA 2DZBA 1X96A 4NNCA 3D3FA 3H4WA 1NFPA 3QMTA 2NWRA 2WAGA 2W62A 1DQUA 1TZ7A 4NL1A 4DO6A 1CXFA 2BHUA 4UR7A 2DT2A 4IWWA 3AMGA 3UR2A 2CKSA 4ZMGA 3I4KA 3DFOA 1TV4A 4NP7A 1GG0A 4HK5A 3ISIX 1R7OA 3WQWA 2INFA 4U3AA 2DZAA 3PNUA 4XZ9A 3UT0A 4P7NA 4UNLA 4HNUA 3CJPA 1NWUA 1OT2A 2CBUA 1F3WA 5GNYA 2VCAA 2IPGA 4KEVA 3LQLA 4B3LA 2TYSA 3CEUA 3GM8A 1YXYA 4MPQA 3W7RA 4NKCA 1QNPA 2E77A 4PUKA 3UVIA 3TE9A 1JGIA 3E96A 1DWFM 4CN1A 1YEYA 4C6JA 6REQA 3PUDA 3LZ3A 1TPDA 5C70A 2J4GA 2NUWA 4W5UA 4NXSA 1SFTA 1L9WA 2VEMA 3WX7A 1FWDC 3W88A 4ASTA 2A0NA 3O05A 1OX6A 4AUBA 3NUKA 3SN0A 5AHEA 2EG8A 3H55A 1KM1A 2XIMA 3MUIA 2QHAA 4DXXA 5E9AA 2HXUA 2G3IA 3LSBA 3NPXA 4R7OA 2J7BA 2I17A 3BLIA 3N13A 1K6WA 3L12A 1HKJA 5E6YA 1AFSA 1XV8A 1XG3A 5AYXA 3UWZA 5H2ZA 1PKMA 3C0JA 4H7CA 1W56A 3VD4A 4PMZA 1V3HA 5I24A 4WDTA 4UFLA 3M0YA 2VGBA 3B9AA 4WSJA 3GVQA 3C5QA 4RDWA 1XHGA 4E2OA 3N29A 5H1WA 3OA3A 2J8TA 1PL9A 3W25A 2FQIA 1OY0A 9RUBA 1OC7A 3I3BA 4Y8FA 3UFYA 1GHRA 4IQJA 1F74A 1JDAA 1VBGA 3KZSA 4UWMA 2DZWA 5HMSA 2WSYA 3A12A 1BTMA 5A95A 3Q58A 1JPDX 1DL3A 2ICSA 4HP5A 2O9RA 3M0XA 1RAKA 3O6CA 5HATA 3UNTA 3BQ6A 2ZZ1A 4C6KA 2VRQA 3BJSA 2XDFA 1TPC1 3KCJA 1SW0A 1EWEA 3GB6A 4AX6A 4BF5A 2D2GA 3PB2A 4JQ2A 1BF6A 4LAMA 5KINA 4HZMA 4D6HA 2OGJA 3IUIA 2CYGA 1OC6A 3PTKA 2OELA 4AZGA 1XIIA 2C3ZA 4FX6M 3WJWA 4MHBA 1VLIA 1S39A 4ZBCA 5DMLA 3LHYA 1MEHA 1GYLA 5CJ5A 5HJYA 5HPOA 3IV3A 4NAEA 4NIRA 4D6IA 4IGMA 2Z7KA 5C2GA 1TX0A 4Q8VA 1AUSL 2PDLA 3VM7A 2QS8A 1LWIA 2XFRA 1TVNA 4G7EA 4NHVA 4FMVA 1E6PA 1YNYA 1RA0A 3KM8A 4OFCA 3TMQA 4HNVA 1QPRA 4GXMA 5CXPA 1WOAA 7A3HA 1TR1A 2P10A 3S6OA 4S3AA 1TV8A 3L4YA 5M1TA 3L4ZA 3P5ZA 3CL6A 3OB8A 3LPGA 4J2MA 4NT0A 4E2DA 2WLYA 1QVBA 1ME8A 3VK5A 1LP6A 2DZPA 4IJCA 1U2YA 3BANA 1EDTA 3SCNA 4B5XA 4IIBA 3M0MA 3VCCA 1L2QA 2QV5A 3V1HA 2ISSA 1FWGC 1LWHA 3CL8A 3GNDA 2E5DA 3VOFA 4JN6A 4JQ1A 3PZUA 3M64A 1HT6A 3ZLGA 1ZAHA 3IUDA 1XLKA 4BF7A 5BXRA 4LVGA 2PODA 2VC5A 3NG3A 1P0DA 4QDWA 2EO7A 3P14A 2GWGA 1JUEA 3WBYA 3EEZA 1PWLA 1RA5A 3LK6A 4P5UA 3LTPA 2XINA 5EFDA 1QU4A 1W5MA 4LXFA 5CEWA 3LV5A 4QJ1A 3LPOA 1N8WA 2QCEA 2QUTA 1X1ZA 4HHMA 2X0SA 1AVAA 4QS5A 2WV8A 3RJYA 3ENLA 3F2DA 2V67A 2ZX7A 3ME3A 1EYEA 3CMJA 1K77A 3BDKA 3LNMA 1NSJA 1NWSA 3AFBA 2GZXA 1RR2A 1F8IA 4W8LA 5FIPA 3SY1A 4K1GA 3IJQA 4PRWA 2J7EA 4G5DA 1J8VA 3KXQA 4A22A 4PTNA 1UKSA 1Q6CA 3W01A 7PTDA 9CGTA 3P84A 4DAIA 3S5SA 3POCA 3LBMA 3WD2A 1C92A 4OBSA 3VPLA 1E6NA 4GUHA 3N2BA 4F0RA 4US5D 3WSUA 1W9UA 5G1MA 4GZ7A 4DBSA 4HMEA 4C6OA 3UXAA 3M4HA 1JL8A 2DIEA 1JZ6A 1U5HA 4L4LA 3KRBA 5A8OA 5CPNA 3KRUA 1NARA 2WKJA 4O4VA 1QHPA 4L1WA 1TZZA 1HKWA 3FSTA 1E56A 1KA9F 4JTJA 1AJ2A 4KW2A 4GC4A 2I16A 4AF0B 1CXKA 3CHDA 1A5BA 5TQLA 1IWPA 4ZL1A 4GGHA 1H7NA 4NX5A 3S83A 1DIEA 3LPFA 3QW3A 3AZRA 1VJZA 4NZFA 3UESA 1GOQA 3R25A 4GKLA 4WEVX 2WHJA 3N3TA 3RUBL 1RQEA 4I7WA 3UERA 1CX9A 4L6OA 4GMEA 1JF5A 4RNFA 5CPSA 3VD5A 4O0KA 2ZZ5A 4L1XA 3D3AA 2G3JA 4S3KA 2DSKA 4R85A 4PB5A 6XIAA 1AK5A 4Q4MA 4S3DA 3ZJ6A 3NQ7A 2J74A 3DX5A 1E9ZB 4UMCA 4NZ5A 2GGJA 2YR1A 1PZ0A 4FNTA 1C3FA 3CL7A 5K7JA 1NEYA 3WEZA 2YCKX 1CTNA 3B9EA 3FJLA 1SZRA 4GH3A 2E9BA 1TUFA 3BZJA 4RKAA 4WDWA 3CS2A 4CCZA 3VIFA 1Q6GA 3VZYA 2CWXA 4DNHA 2X40A 3BW2A 4OGZA 3W75A 2WSKA 2Q6ZA 3TJ4A 4N2YA 1XYBA 1NF7A 2YFOA 2J75A 4XIMA 5I3KA 1YLVA 3BAYA 4O17A 3V5CA 5BROA 1B3YA 2AL1A 4Q7NA 2VDIA 1AQMA 2BNJA 1NOWA 3K1GA 1JXJA 4WOZA 3W72A 3LBCA 4YCPA 1HKMA 1DTUA 2G3NA 4GUIA 2JF6A 1IT0A 1BG9A 3PG9A 1S38A 4NVTA 3M0JA 4GIEA 4AIOA 3G5EA 3CV2A 4BQ2A 3L21A 1O5QA 1DJQA 1I1XA 3OU8A 5GJNA 2A1YA 2V5LA 2XGBA 3ABXA 4CQ9A 2YJQA 1JYVA 4J3SA 2QULA 4AWTA 2QCDA 1OADA 1MW0A 1Z32X 3NQAA 2ZIDA 1LLZA 1K8XA 5G1YA 3TN3A 1OIMA 2ZXDA 4ICNA 4LBRA 3S2LA 5FJTA 4A8NA 2HPIA 3UWWA 3UXLA 1UQYA 5GJPA 2YA0A 3L5MA 5AHNA 5LXEA 3PP7A 1GONA 5HWMA 3S8HA 3ZVHB 3DAQA 3HMCA 4UQEA 5T9BG 5GQBA 2HEJA 1BG4A 2J7CA 5B7YA 1OYAA 4L1GA 1ZU8A 5FESA 1SM9A 3RLUA 4HMNA 5XINA 3PUEA 2PAJA 2EPOA 2XVPA 1ZENA 1V79A 3GY1A 3T81A 1VFFA 2FB2A 5HR7A 2XIIA 8CGTA 3PBYA 3AZSA 3CWNA 3OVQA 1UH3A 2XH2A 1FP9A 5AKQA 4H01A 2WSQA 3TCSA 3UY8A 2E8YA 2WO5A 3B8TA 3CK5A 4W93A 3QM3A 1R3TA 3OLGA 2EPNA 2FDSA 1XGZA 4GPNA 3TMLA 3W70A 4GZEA 3EMQA 4FK9A 1R3SA 3R6IA 4K6AA 3P60A 4UR9A 1VFOA 3TYDA 2VGGA 2YSWA 3UPMA 3PHAA 2HE8A 4ZQOA 2P3ZA 4IUOA 4FEZA 3VNYA 3GK0A 3M9YA 4M7TA 4CNTA 4CCCA 3T7VA 4BA0A 3DYPA 1TJRA 3T9PA 1BHGA 5CSRA 5KZDA 5FEWA 3ABSA 3JRKA 4QDMA 1E40A 4HYVA 2PDFA 1Y5WA 2G8ZA 1E4NA 2HE5A 4UTUA 1BFNA 2ZUVA 2JIEA 4TOQA 2FYMA 1M53A 4HPNA 1EF2A 1M3UA 2ZA1A 3KCLA 2C13A 4YNGA 3URBA 3G18A 4JNZA 1KBIA 3H6OA 3PVFA 3VNMA 3C3UA 2E6YA 1LRNA 2NUYA 4TV6A 3ICJA 4B90A 4RXFA 3O06A 3W1RA 3ITOA 5AC6A 1GHSA 1RK5A 1B2YA 1RQHA 4LTSA 1KCZA 4CD5A 1T99A 3KVJA 3AIUA 3LTSA 4PA8A 2PGFA 3PPGA 2BVTA 4AD2A 3WDQA 3ITXA 1LTDA 1ICQA 5LHFA 1VCFA 2FZ9A 4QSFA 4JTRA 3U6WA 5C55A 2DUAA 4PSRA 2HWGA 1KM4A 4X9SA 4EKJA 4GUJA 4PSPA 3MJYA 2PDXA 1GEQA 3C2RA 5U4NA 4AYSA 3TH6A 3PPFA 2XTKA 4IP4A 3U9IA 4NAFB 3KCOA 4KKXA 5FF0A 4BHYA 3LERA 5TF0A 4HVXA 1XS2A 4O54A 3NQFA 2NXHA 1TSIA 1YPXA 2FZNA 4GUFA 3VGGA 2DW7A 1AMKA 5IHRA 1JCXA 4KWWA 2X09A 4UFKA 2YDQA 3WNPA 1DIOA 3T42A 2X1SA 3M7SA 2TODA 4S1FA 1MNZA 2DT0A 4LB4A 4RNHA 5BMXA 5LXXA 1ZS2A 2J62A 1SFSA 3N12A 3A4JA 3H4GA 1ADSA 2C0HA 3WNLA 4DZAA 4LALA 3S47A 4WDUA 3T8QA 1KM0A 3GZ3A 1XH2A 3PUOA 4GZIA 1Y5VA 2B81A 3AC0A 3N6JA 1EJTC 3TUUA 1VFMA 1UD4A 3CQIA 1VD6A 5D2YA 2YBUA 3R94A 1XCXA 2PB1A 5I78A 2WMJA 4MAVA 4MLRA 3WNNA 2D22A 4IISA 2P8BA 3LCFA 1W2VA 3GUWA 4JEQA 2WZIA 3C0SA 2J7DA 4B5NA 3YPIA 3IWPA 3UCQA 4N9EA 3LLXA 1H5VA 2YA1A 4J3XA 3VUSA 1HNYA 3W7HA 4PL2A 3IACA 2VFDA 2ZA3A 3F1QA 4BI7A 3SDOA 3MA8A 1EQPA 4JHMA 5D4YA 4DEFA 3ABZA 3NURA 1OQFA 1FWSA 3G77A 2HXTA 3B9OA 4ZO9A 5C9XA 2W92A 2R1NA 7REQB 2ATMA 1KCXA 2WZHA 3DKJA 2AQOA 2BXVA 2NLYA 2WKLA 3ARYA 4EAYA 3SI9A 2NV2A 4Z2JA 3MJMA 2DZUA 3INPA 1OABA 3R0KA 2DJXA 4CD7A 2ZRYA 3CU2A 1UD2A 1JZ5A 4H9ZA 4DBWA 3SUTA 4O0ZA 3R8HA 1IWAA 3W1XA 5GNZA 1NDWA 3SGGA 2V30A 4HNOA 4EWND 5EMYA 1EGVA 5E1QA 4V1YA 4PFMA 4E8GA 3QZEA 3S5ZA 1PZ2A 4D2JA 2AL2A 4K39A 2CLHA 1S3HA 3U8GA 2TSYA 4JTGA 3W2NA 4FNSA 4ES4A 3HMJG 1A5CA 4GY7A 4REQB 3KOWA 1IR1A 3ANYA 1Z8AA 1XRFA 2A3EA 2Y88A 3ARVA 4H4IA 3SBFA 3REQB 1HVXA 3LI0A 5BRPA 1JFXA 3IK4A 5A2AA 4H7ZA 3GG7A 4YIWA 3OBAA 3SN4A 4U33A 2Y7DA 1LOSA 2HROA 5CC5A 5CGMA 5A2BA 4PUMA 2B0MA 4GWEA 3BMXA 1TPEA 1E55A 5L6UA 3BQ5A 4IFOA 1RK6A 3RXZA 3ARRA 1FCUA 2DT1A 3CHEA 1SVDA 2Z6IA 6TIMA 4PTVA 3RAOA 3URAA 3S5OA 4IXXA 3WDRA 1J5SA 1F4AA 2VUYA 4QFUA 1KGXA 3S2JA 5H6HA 3DBPA 3WFLA 1NFBA 1H60A 4PUJA 3F4VA 2IQTA 3PJWA 5FSDC 2QUMA 3UA3A 3TNOA 1JPMA 2OSXA 3NM1A 1TQJA 3HO8A 3ARZA 2MUCA 4JTLA 5FF3A 2V3EA 5REQA 3SGZA 1X38A 3K8LA 5ENLA 5D9PA 3CUIA 3LCGA 2PDWA 2PDBA 4IPNB 3C4UA 2XWDA 2PDGA 4HD5A 1IF2A 2ABAA 2ZKMX 1SZFA 5A69A 4O8RA 2O92A 2QNEA 3JR2A 2OGYA 3L4WA 1K03A 3B9NA 1LM1A 4G9PA 3FY1A 2XH4A 4IQEA 3GZAA 1XH1A 3R13A 3GFXA 4HK7A 5CBBA 4XK2A 4A4AA 1FCQA 2FIQA 1RJPA 3HJEA 4F2TA 4E8DA 2PDNA 1WKDA 4MNMA 2I14A 1UUQA 3P62A 3C6CA 1V02A 1XCWA 1E0UA 1VFTA 3JZUA 2ZXAA 3QKEA 4LBSA 3QEZA 4PB3A 3W28A 1OWQA 3SRKA 3CHVA 4YU1A 2PCQA 3P8JA 4HGXA 1QHOA 2GDVA 4EPBC 3MZ2A 3THQA 4QG9A 4XAPA 1GZ1A 3BJFA 4U2YA 1G4PA 3K4AA 2TAAA 1H11A 1SFLA 4QEEA 1IXQA 4JXCA 2G50A 2E3ZA 3KLLA 1EPXA 3ZZ1A 3WF4A 3PFRA 2CNCA 1YW1A 2ASHA 4DJFA 5CPTA 1UWRA 4YVVA 3B0UX 5MKGA 4QJ5B 3LBOA 3BLDA 3EMCA 4AWUA 2VT0A 4AZHA 1Y5XA 4BI6A 5A1AA 2D2JA 3TQKA 5CC7A 3PZNA 2NQ5A 4HA4A 5KETA 1R3QA 3GKAA 3I3EA 3W7NA 2WOQA 4WGXA 1Q6LA 4BQ5A 1O1ZA 3CH0A 1VAHA 4N6EA 1XINA 1D8CA 1Q5MA 3NFUA 1QI5A 4J4KA 4OIFA 2OWWA 2ZQ0A 2BWGA 2W3ZA 3F7JA 2NT0A 5AHMA 4Y9MA 3EXRA 3CIXA 4CU8A 1YDVA 2VO5A 3AHVA 5AN7A 3H23A 2NX1A 1TTPA 4GCAA 3W71A 1UUMA 1Z6KA 1KR1A 3ZJ7A 1RCOB 3AMLA 3N2TA 4PN2A 4O1DA 4FS9A 1VBHA 4S2BA 2E40A 3ZLHA 4KRTA 3NQ2A 5HMFA 3K8MA 1EJRC 2D0HA 4QR6A 4DBUA 2RDTA 1US2A 3CV1A 1Q63A 3H54A 4ZTXA 3VKBA 4GNVA 3G3DA 2B7QA 4RZ5A 3GBDA 4Q22A 1EX5A 3VDGA 2QV4A 4XVDA 3WH9A 3CPUA 4JTKA 3GAYA 4O11A 2A3BA 1KBLA 2E8ZA 2PRHA 3QV7A 3UZYA 2JKEA 4GOAA 1WAWA 4QLJA 1MZRA 4IIHA 1XLIA 4Q7BA 3SRFA 4AY1A 2VHLA 3SUSA 1ZTVA 3VFLA 1YE6A 1VKFA 2QPUA 3VX1A 2W91A 4GQ0A 3TLQA 3B0PA 5DFAA 4AHPA 4M24A 3N9KA 3ELFA 1QNVA 2PWHA 1DKWA 2CHOA 3H7VA 4HU8A 4EPEC 4LFYA 5G4EA 4MDOA 1WA3A 1H7PA 3GNPA 1CB2A 3EA1A 4ZSUA 3HGJA 2I9UA 2E1WA 4XKYA 1ZY9A 1C8XA 3LHTA 4LRSA 2OX1A 2CITA 4P8UA 3U4FA 3A24A 4KWUA 3BZGA 1J0KA 1FCVA 4QE5A 3BG9A 5EMMA 2WJEA 1V3JA 3BVJA 3ZR5A 2OQYA 3KRSA 1HKVA 1WOBA 3CUXA 4MJZA 2NUXA 3NSMA 5XIMA 2PC8A 3DEQA 4GO8A 3W1NA 1FWJC 3BO9A 3V4BA 2WK2A 4EANA 4AAJA 2OCZA 1TMQA 3VCNA 2WWDA 1FWCC 1Q7MA 2QF7A 1PX3A 2ALDA 5TBOA 4JAWA 4JIQA 3VILA 4X2PA 2Z1WA 4HTYA 4JTDA 1H51A 1CXHA 1EC8A 4XD6A 4IFKB 4HYRA 4JGDA 2Z26A 4CQBA 2VFHA 4RX0A 3GHRA 1X39A 1GEHA 1A0EA 4NZ4A 3VIKA 3WH6A 2D3NA 4ZOAA 3KOFA 5F2IA 2BZNA 1P4CA 1LBLA 5E9XA 2YDSA 5BU9A 3I7SA 1TIMA 5HINA 4J7RA 4KWVA 1BWLA 3ALFA 2PDJA 4DY1A 3SR7A 3V0TA 1C29A 4FXRA 3W7GA 1Z48A 2YCLA 4OQVA 4S3CA 1RP9A 4H6KA 3G8EA 5CH9A 4QG6A 4JX6A 1FX6A 4XUYA 1UBSA 3GIQA 2QIIA 2P3EA 5HUOA 2XN1A 3VI2A 4C65A 2A6NA 1WP6A 4FNRA 2QR6A 3HJZA 2ALRA 3PAOA 3Q4DA 4MLJA 3V7PA 3R0UA 1R3WA 3UXDA 1OCBA 3S2NA 3G1VA 2XGZA 1RCQA 1UA7A 5DY2A 1TWZA 1ZLPA 3W7DA 2OO6A 3VD3A 3SB0A 2XIQA 5HAOA 2FHBA 3KP0A 2ZUUA 4LH8A 4LVAA 1U30A 1KWGA 1ICSA 2BSLA 1Z44A 3JUGA 5D30A 3ITCA 1EEPA 3T2OA 3NOEA 3RR4A 3CAVA 4O28A 2GUYA 2D2HA 3G6LA 4PL1A 3LS9A 4LUJA 2E9MA 4QLKA 4FIRA 4GO9A 3AUOA 4GVGA 5F4SA 2BX7A 2EG7A 3CXOA 4S3BA 1W3JA 3IJ7A 1BKSA 3CM4A 1UR2A 1TX2A 1LRQA 1VB9A 4M6UA 1AQFA 4XZHA 1KRMA 4I7VA 1K4GA 2VUNA 4FXFA 3GXTA 3TYCA 2GOUA 3E0IA 5LGXA 1H50A 1W17A 1Q8JA 1TPWA 3H7RA 3AXXA 2ZUNA 1VEMA 2EQDA 1JDCA 1Q6QA 3RLHA 3GE7A 3R2GA 1C90A 1D2KA 1Q4WA 3TR2A 3QOMA 3MS8A 3RN6A 4ZQPA 4ZO6A 3LXAA 4N9BA 3II1A 3R0DA 3AS0A 4QQ3A 1XW8A 2CPUA 4O14A 1ESWA 2GVGA 3VNIA 4PMRA 4LU0A 3QH2A 4P8WA 3P61A 1UWTA 1SPQA 4K37A 2W66A 4XD3A 2WC3A 1Y7VA 2GJNA 2WBKA 1RALA 4AZ6A 1E6RA 4DWSB 5ABFA 3EX1A 4XSLA 5D05A 4O57A 4AC7C 2WLZA 1UA3A 2RDWA 3STFA 2XFFA 4NZ3A 1F05A 4JTIA 3E02A 5DN1A 3NQEA 3UCDA 3GR4A 4GIYA 4XBKA 2OJPA 1BEUA 4UUIA 3KVLA 4D72A 1Y8BA 2PZ0A 3W00A 2OLSA 2WYSA 7XIMA 1BAGA 1SZEA 5AHLA 4O50A 3V35A 1N82A 4DB7A 4K2SA 3L4VA 3UZ5A 1GTEA 2OT0A 2OXNA 4D6DA 4J3ZA 2DQXA 3C3NA 5CCZA 4F0HA 1SR0A 3IGUA 2ANUA 1ZZMA 1JCLA 4PMOA 1JRBA 3NWRA 4DZIA 1ZBCA 4MUZA 3SIZA 2VD8A 1F2JA 1PBGA 4CEXC 2XSXA 1RP8A 2WCGA 4AMAA 4Y96A 4RJEA 3QC0A 3V1PA 1TRIA 2O7QA 5K9XA 3WF1A 2O0TA 3W1QA 4YTUA 5XIAA 3LLFA 2D69A 4E3VA 2E5BA 3NL5A 1W1VA 3V3WA 1WPCA 2E25A 2X0YA 4B5TA 3E2SA 1QI4A 2Q3RA 3L5LA 2BGSA 3F2CA 4XB3A 4WK9A 3N2MA 5A6BD 3FHAA 2PLCA 5LNRA 4AZBA 2VI0A 2VZVA 3WQEA 1OVDA 4QM1A 4XUGA 3LOTA 3H12A 3G1DA 1XJBA 1KBBA 4C6IA 5BXPA 3DH7A 4IPLA 2Y63A 4LYPA 3WELA 2GSEA 4HCLA 3UEQA 4JKMA 6REQB 2RGLA 1P0EA 4ZSTA 1X7IA 1W32A 1O1HA 3PR2A 3TFCA 4CU7A 4M5PA 3ZFHA 1Q65A 4MYAA 1T7LA 1H1YA 4S3JA 1QATA 3V75A 3MKKA 1MXDA 4FZIA 4JR5A 4MGGA 4C6NA 4F0LA 3S0CA 1UKOA 3OHMB 5EMLA 1H0IA 3AYRA 1ZP4A 2B7OA 3CZEA 1XPGA 3N18A 4ZXOA 3ZM8A 5I3JA 4IMCA 4ZOEA 1HL9A 1JCJA 3ZSSA 3EWZA 3L66A 1AW1A 2YA2A 1J12A 3HA1A 5LKYA 3HV9A 3TWAA 3KBSA 1W5NA 4FLRA 3GU9A 4JYDA 1UP0A 4KEUA 3PTMA 3K8KA 2Y8KA 4HQVA 3ONBA 5F4WA 4AD4A 4ZB2A 2H3DA 4J9JA 4WUIA 4RE0A 5AECA 3GVWA 3ZOAA 2SFPA 4ZENA 3UXIA 4GC3A 1ITUA 2YL9A 4MY1A 4QX4A 2WNQA 5CZ0A 3T6CA 3GDBA 1VHCA 4QITA 1Z89A 1J0JA 5AZ1A 1O66A 1PKYA 3ITVA 3CAWA 4LVDA 1TCMA 3WLRA 1HJXA 3EWWA 1VLWA 3UWUA 1DYSA 1GK8A 2XVLA 2QIWA 2V5JA 3U7VA 2HRWA 3BOFA 3AOFA 3LQGA 3CYJA 1JG9A 2OEMA 2FB3A 3FEQA 2FFIA 4IMFA 4R88A 2YXGA 2CZVA 3M5ZA 3ITYA 2AGTA 3SCQA 1REQB 3W24A 3WO8A 1OM0A 2Q8LA 3UG3A 1PAMA 2DZSA 3VIOA 3BLFA 4XV0A 4G1NA 4JTEA 1WZKA 4ZOCA 2QMKA 2VVNA 4NAEB 2FDMA 2A6LA 3H26A 1AMYA 1BXCA 1Q7QA 1MQQA 1OCNA 2PWVA 3ARSA 1R2TA 2QDEA 4J27A 5MHBA 4LCQA 1UYQA 4G7EB 3UPBA 2J9XA 3FYYA 4CD8A 1AD4A 1R2RA 3IGHX 3N6HA 4PCNA 1GG1A 4Z2GA 2Y7GA 4UTMA 3MCOA 4GQGA 4OOUA 1L6SA 1P0BA 3F5KA 2PDHA 4KRZA 2GWNA 1I9CB 1LUCB 3GG0A 1AZ2A 3CUGA 2YXOA 2X16A 4CQDA 2UY2A 1D7FA 1HO4A 4ZEPA 3Q45A 4HKPA 1XIMA 4QS6A 3HU7A 3QXBA 5JH1A 1TFVA 1LBMA 3EX3A 3CLMA 3FKKA 3EXSA 2AAAA 2YYUA 1E4LA 2IQDA 1IIHA 7ODCA 1KXHA 1WCGA 3SAZA 4NJJA 3KP1A 4MNLA 1EF3A 4M6VA 4WR3A 3ZSTA 2V8ZA 3GTHA 1ISZA 1QPNA 1R86A 3BPWA 1MRAA 1GZGA 1BYBA 2VX5A 2Z0IA 1W9PA 3W86A 5B80A 1IEVA 3FJ4A 1WAUA 4XKMA 5EBUA 3F4WA 3G1RA 4DELA 4C1NA 1VF8A 2VFFA 1V0LA 3NAVA 3T8LA 3DFNA 4AVNA 3OVRA 4HA3A 1V4YA 3WQGA 2POTA 3PJXA 5IBXA 3S5YA 3TFXA 5AYIA 1WKFA 1GVIA 1XYLA 2GQ9A 1JZ3A 2CLKA 2H8XA 3NQ8A 2EHHA 3NXFA 2YXXA 2V81A 4GYJA 2PTWA 4H83A 4WX2A 4BF9A 1E70M 4M6PA 2C6QA 2A7NA 1KFEA 1NDZA 3L4TA 2JEQA 4TIMA 4XWUA 4PZVA 3AIVA 3WLPA 1BSLA 1I0BA 2A3HA 4YL2A 7ENLA 4FR1A 4JKLA 4UTHA 3EB2A 2XM1A 1YADA 2A7RA 3DYMA 4HB7A 4R5EA 4QJ3B 2OKOA 3ID7A 3NZGA 3LMYA 2ZX9A 3H22A 5C6MA 1LOLA 1W8SA 4DLMA 1VYSX 3NQMA 5KZMA 1HG3A 4OUIA 3NQ6A 3W7EA 1L6WA 1KBKA 4GY1A 3TNBA 1L6GA 5GNXA 3HOJA 3CHCA 3TTEA 3WJYA 2FFCA 1H3GA 3S9ZA 3H2CA 1WDWA 4LPCA 4IQLA 3B40A 3C8FA 1FHUA 4QCEA 1C7SA 3CV7A 3BCJA 2ONEA 2J66A 4GVIA 4M29A 1NQ6A 3CUZA 4QRNA 3WQVA 1E51A 3B8WA 1CI1A 3VGEA 5CAKA 1DOSA 1GZJA 1K70A 4J28A 2IPFA 1TV7A 1Z9AA 2RDUA 3P67A 1Q6DA 4GXPA 2Q8ZA 3BC9A 3WF3A 1JDDA 3BLLA 1XLFA 1SJDA 3S9IA 3AIQA 4AYGA 3SCVA 1GQIA 2XSBA 1V6TA 1CEOA 4HA0A 3U2OA 4RE2A 5D09A 1XBVA 3GRIA 4GHRA 4Y6GA 3M41A 5DANA 1XIFA 3NGFA 3BLEA 1M7JA 4A3RA 2DZVA 1HXJA 1KXVA 3W1LA 3IJDA 3MUXA 2FZBA 3M46A 3N4EA 1MUMA 5J5DA 4EACA 5BYWA 1HKIA 2Z2UA 4L56A 2Y7EA 1V6XA 4TVUA 1GQNA 5CSUA 4ML9A 4NILA 3VNKA 4JS3A 4AZ5A 4AD3A 5JIWA 1MQPA 2CERA 4DO7A 1XG4A 4FR6A 3KBWA 5CKSA 3AUJA 1WBHA 3OEXA 2EBNA 3VOJA 2V5CA 2P50A 1I2RA 3UG8A 2VR2A 4H41A 4G2DA 3VMNA 1TV2A 3TXZA 5KEZA 1JZ7A 2QCDB 4LOCA 4QDPA 3SJNA 4MF4A 1LROA 2ZOXA 4O1CA 2WXDM 3WH8A 5BXTA 1BGAA 1XIGA 3CASA 3TTSA 1Q45A 1EP2A 4Q8UA 2HPMA 1WDRA 2QKFA 2J9ZA 3GDMA 3DERA 1KR0A 3I6TA 4OT7A 1TPUA 2DQWA 3UYIA 1EC9A 3M6YA 1JF6A 3HQNA 2QJMA 1E1CA 4Y9AA 2XFWA 4RW5A 4GG9A 3QV9A 3TKFA 3VDBA 1GYMA 3DC0A 4IL2A 3GXPA 2G4JA 2RJGA 1KLYA 2NQHA 3UETA 4AFYA 3BV4A 1V93A 3GAKA 2GQ3A 5E70A 2EKGA 1DORA 5M3WA 2J7FA 2GDUA 3OIXA 5FF4A 3MT1A 3OQ8A 1W1B1 3ZT5A 4ZCWA 3W2LA 1V6WA 4UFJA 1HO1A 3O1NA 4Q33A 2W67A 5HUPA 4HPHA 3G2GA 2PU0A 2AQWA 3SURA 2FZMA 4ZFMA 4HU4A 1P6BA 1SMAA 1QOXA 1AODA 4G7FA 5C5YA 3E3HA 5KTLA 2X1TA 1XSJA 3WLOA 4IUGA 2EPLX 4A29A 3O6YX 2QZRA 3MP4A 3S3GA 1XC4A 4S39A 4YXGA 2FPVA 1VJSA 1PB0A 1R6WA 1R8LA 2PTYA 1TWWA 4GK8A 4UMBA 3IIOA 1O4UA 3KBMA 2B7PA 3FJ6A 4CU6A 2OMAA 2QW5A 1E73M 4DJEC 4FLSA 3WH5A 4FOKA 5CPMA 1DJIA 2AAMA 1OD0A 1WUEA 4MJ4A 3TYEA 1DXFA 2WHKA 4JQAA 5D8WA 4UOJA 1OHLA 4AZ7A 3PZOA 1M65A 4LAKA 3AIRA 5EU9A 1POJA 4LJ3A 1L8NA 4BK9A 5I77A 1JYXA 1JULA 3B9DA 3SFWA 4GISA 3GIYA 3L7RA 1WO2A 4TVCA 1MW2A 2DH2A 2ZE0A 2JEPA 4UFMA 2J8GA 2WMHA 2ZDSA 1XLAA 1MUCA 5H8MA 1V3LA 2PDMA 3G0UA 5LNVA 1FWEC 5I3FA 2OU4A 3MBDA 2HISA 4ADUA 3SECA 1GOKA 1B9BA 1JEZA 5JBEA 3U0HA 3QYQA 2IUZA 4K38A 1JJKA 4RR4A 4S2CA 3VABA 1HJQA 3E74A 1E1FA 4G6CA 1YMYA 2VC9A 2R24A 4ACZA 3WK3A 2Q09A 2BDQA 4GD0A 4XG1A 4C7GA 5DRIA 3HQ1A 1GKPA 1EKOA 3KBNA 4PMXA 1A4LA 4GABA 3LSCA 1NH6A 3WK2A 5SWUA 1S2CA 1J18A 3SN1A 2OYMA 1CLVA 4IPPA 2NVCA 2HK0A 4PULA 4GYPC 4M8UA 3T09A 3W2JA 4L4OA 1Q13A 4W7UA 1C7TA 3MHFA 1KFJA 3V18A 1K9TA 1GQJA 3AWNA 1MZHA 2VXNA 5LNSA 4YVPA 3V5OA 3CEPA 2CXEA 3VOGA 2NLIA 4U5IA 2I57A 4H7VA 4O16A 2TRSA 3WUGA 1X6UA 4KFPA 1J4EA 4P7RA 3GW0A 1M41A 2NQ9A 3QTPA 3HGRA 3GHTA 4C6MA 1IEXA 3CH9A 1V08A 4MZ1A 1P5BA 2OOFA 3E0FA 4LYQA 4R9XA 3SGUA 3B4UA 3DI1A 2Z27A 3VE9A 2I7GA 2OWCA 3BE7A 5D02A 1S46A 4O12A 3GVVA 3L2MA 2X2GA 5KITA 2VGIA 3P7YA 3SCRA 4LEQA 3EDJA 2YCIX 3M0IA 2G41A 3MY9A 3WL1A 1UBPC 3NYDA 4NZCA 1VENA 4QGCA 1DV7A 3PPHA 2V6AA 3QPEA 2WPGA 4O8AA 5EMJA 3PZGA 1EJ7L 5HBFA 4XAGA 1W3LA 2WVVA 3IGXA 2Z2AA 4XTIA 1CT5A 3TN5A 1XIBA 1KM6A 1M1BA 1LOQA 2VEIA 1RZMA 1S5WA 3SCSA 1RY0A 4OJYA 4WZHA 4XZWA 1RH9A 4HNLA 2YPIA 1TPH1 3LX9A 3NDZA 3CZJA 3L4XA 3AROA 3LV6A 2FLIA 1QNSA 4DM1A 3FYPA 1A0DA 3UWVA 1PTDA 1VPYA 2ZADA 1KQYA 2OLAA 2CZ5A 1EJWC 3BURA 3FYOA 5BZAA 3HFTA 1M04A 1UPPA 2W0UA 1JZ2A 5E0KA 2EJAA 3R7MA 3TU9A 3SCPA 3RPDA 2JE8A 5C7HA 3IJIA 3N2OA 3NZQA 3GDLA 1DHKA 2AL2B 3TOPA 4P61A 3GO2A 3OQEA 4HCDA 1SSDA 5DO8A 2BTMA 2HMCA 2CZFA 4LRTA 3MV01 5F2MA 3OZOA 3N11A 2QDHA 2QMJA 3W84A 4HPGA 5DT5A 2C8NA 2G4FA 1ZBWA 3HPZA 1GVOA 3EWXA 1HTIA 3GH5A 4AWSA 4GIRA 2PS2A 1FDYA 1SUXA 3CZLA 1B31A 4LF1A 2Y7FA 1E6ZA 4JN7A 1QUMA 1OX5A 4KETA 4FX7A 4B3ZA 1PYMA 3USZA 4RNJA 1OK6A 1S1PA 4F48A 2Y6ZA 4XD4A 2WVTA 4IL0A 2DT3A 3NEHA 5AVHA 2C91A 1UD5A 5J5RA 3GU2A 2FMOA 5DCBA 5M17A 4Q4PA 3BH4A 2ZZ2A 1EIBA 2ABBA 2GOKA 4I5XA 4X60A 5BOEA 2HK1A 1RCXB 1VH7A 1BRLB 4C7DA 1FWBC 3GXIA 3JU2A 3IVTA 4NU7A 4DPQA 1ZCCA 1YNQA 4L9XA 1F73A 1WKYA 2BVYA 2PDQA 3MB9A 1BKHA 4MYXA 3CTTA 2IKJA 3QW4B 2E6AA 3QZ6A 3T0TA 1ZHAA 4NX0A 1VCVA 1CXEA 2PWFA 2PDIA 3P82A 1N55A 1A5OC 3R10A 2NV9A 4G8TA 2ISDA 3M0LA 4FNUA 3OZMA 1E0XA 1QPOA 2PLKA 3E1F1 1KD0A 1M5WA 4P7OA 1QASA 1S3TC 5C9ZA 4GQBA 3OLEA 4IJBA 3FCPA 4UTIA 3GH7A 2YL6A 2G3MA 3M44A 1KKRA 1LLWA 5CZKA 3WQ5A 3RU6A 4FF7A 1VPQA 4N9DA 4E8CA 3GTNA 1J11A 2ZCGA 4P2VA 3W6LA 4J3UA 2HCVA 3WH7A 5D04C 4MNJA 4HNNA 3ZR6A 1N7KA 3GYEA 4U2ZA 2WNZA 3G24A 4KIEA 2IKIA 3ITTA 3KBVA 3PS7A 3WLNA 1GT8A 2DZTA 1R7AA 2O56A 2VGFA 3IVSA 1VIWA 2PD5A 3BAJA 1S2VA 5DX7A 3K46A 4NYUA 4NI3A 2PZNA 1UD8A 1B3ZA 4M0XA 1RVKA 1LF1A 1VP5A 4RV3A 3RMEA 5F4XA 3WENA 2X42A 3T2PA 4YN5A 2R1MA 4JY9A 4MWAE 2DUXA 3B97A 3ORWA 3QQWA 1BXBA 1QNOA 1Q8AA 4FXSA 3L9CA 3OOQA 5I2UA 5MKGB 1OGGA 1O5KA 3KL3A 3WQDA 4LEFA 2O9TA 3RYSA 1E72M 4WCJA 3AMCA 3AIWA 3NYZA 4PCFA 4YTSA 3WLTA 1IZCA 1W1IE 2C71A 4OUEA 4XZNX 5FJRA 1NOUA 2CCRA 4QTGA 3QSTA 1K3UA 4I6VA 2WHLA 5E0FA 1VPXA 1Q2SA 2XIBA 1GNXA 1P43A 3LMZA 4DO5A 5IXEA 1FY6A 2PC4A 4GXWA 3C52A 2YB1A 4LUSA 5F1UA 1P6CA 1LT8A 4PEEA 1BYCA 2VX6A 2VEFA 3EWCA 1LQ0A 4X22A 5IHSA 4H6RA 1ISWA 3ARQA 3EDFA 4XZMX 3WJZA 3BGAA 3BAKA 4HSOA 3H24A 3A64A 1DWHM 6ALDA 5FJPA 2PGRA 4JTFA 4AX7A 1W0MA 3U48A 1E15A 3SQSA 4HMCA 4QHRA 1OF6A 1GQKA 1IEIA 3CPRA 3OA5A 3K5XA 2B4GA 5DXXA 3K4DA 4M7SA 2YZRA 2PPGA 1S2AA 1SFJA 1YDOA 1K1DA 1I0DA 4PRTA 4IF2A 3SRHA 3DFSA 3STEA 2FH8A 2YL8A 2EEXA 2F9RA 4D1IA 1KWKA 4TMCA 3UJEA 4ZE5A 4C1LA 1OZQA 1TWDA 3C86A 1F76A 1PXGA 1GW1A 1EPVA 1FWTA 3QGVA 3OBKA 4Q8MA 1WDSA 1H41A 2NX3A 5DY3A 4PMVA 3W9ZA 2DIKA 3LUTA 3COTA 1IHIA 3NPVA 1UZ1A 1DQXA 2F61A 5CPQA 4NQ1A 3KVMA 3WDJA 3GFZA 4X3ZA 5LYRA 3WKZA 4XKYB 5CPLA 1N8FA 3MI6A 2BVWA 4PYSA 1O95A 2WMGA 3SJ3A 3F5JA 4AU0A 3N1AA 1FCBA 4AC1X 3PZ9A 4GI4A 1F61A 5HNUA 1U1JA 3FAXA 3SUVA 4AEOA 4K8HA 5BXSA 3B8IA 4B4FA 3KOXA 3TROA 4BCEA 4NXKA 1GOXA 2A5HA 1W8GA 4HT3A 4MVAA 4QNWA 2VWSA 3HGSA 3BSMA 1G4SA 3VKKA 1FH8A 1ML1A 1NJJA 4AB4A 3QY7A 3G0XA 3W53A 2H3BA 5FA5A 3NPUA 3U57A 3MW7A 3LGEA 2I9EA 3O6DA 2A4AA 3DECA 3AQUA 1IGSA 3IARA 1UB3A 1UC4A 1JCNA 2XUCA 3AYTA 3WK0A 1EWDA 1XLDA 1W2PA 4I9AA 2PD9A 4HHHA 4Y2WA 3N34A 1OFOA 1E5NA 3G1SA 4BWLA 2FVMA 2DSWA 4Q32A 2OR2A 3PN8A 3A4WA 3RX3A 3LM7A 1MI3A 2V3DA 4ENLA 1FHLA 1A5LC 5I06A 3XIMA 1WZAA 2CZEA 1D3HA 1YTKA 1E1EA 5BMWA 2WM1A 3PSVA 4H04A 5KZEA 3IJ6A 3R8RA 4UTWA 3UPWA 5CG0A 3FXYA 2G5WA 1G4EA 3ARWA 2VDGA 3MCNA 1AQ0A 1O5XA 2HZGA 1F6KA 2YCEA 1EOKA 2GSJA 3DFTA 3FSUA 1PHQA 1V6YA 2JFEX 5DXYA 4B92A 1ZSXA 1SO5A 5LIKX 1XRVA 4V1XA 1WDQA 1XIHA 2NT1A 2VWTA 1CGWA 3HPAA 3MI2A 4O13A 5HNNA 1I2PA 4QQUA 4YLWA 5FL0A 2CHNA 4PUWA 3CO4A 4L65A 2G96A 1MNSA 4JTCA 5K3VA 3AHZA 1JQXA 4Q6XA 3ZO9A 1M7PA 3TQVA 1HL8A 4FOJA 4B2DD 1JUKA 3VIJA 3FEMA 1EZ2A 1JDEA 1R46A 4OTKA 5FSEC 4A8IA 4MB1A 4CCDA 3W4RA 1PX4A 3AYSA 3T05A 1VBRA 1IWBA 3C0LA 2OTDA 3S1VA 1C9DA 2J79A 2G37A 2PTXA 1LWJA 4Q8NA 4UTTA 2UY3A 3QVQA 4P8XA 3KZPA 3UBPC 3OODA 5ABHA 3K4WA 2ADAA 4UTTC 1IYXA 3OZYA 4GE8A 2R1LA 2VD9A 1W9BM 1Q66A 1EIXA 1SYTA 1IZJA 2ZC8A 3N73A 2VDHA 4PE8A 2C18A 1GKQA 5FI8A 4FALA 2DORA 4BJHA 3SQLA 4FI4A 4UIOA 3O8AA 3DI0A 2PE4A 4JQ4A 4O53A 1H62A 3UJFA 1LQAA 4OECA 3TOYA 4WQ6A 4Z1YA 1ZP3A 1JAKA 1OX4B 4E5TA 5DMMA 1L6YA 2YOCA 4GI8A 1XLLA 3ZJ8A 4ERIA 1AW5A 2HTMA 1AH4A 3MMWA 4UOQA 4H9MA 1XIDA 1XYFA 1NF0A 1CIUA 1BPLB 2YGYA 4MKNA 3M0ZA 1PVNA 3RGTA 2Y5JA 3P8IA 4ILSA 5CGTA 4EK7A 4UTLA 3T4WA 4POCA 1TJ1A 7TIMA 3DG3A 2VURA 1UP2A 1BYAA 4URIA 1HX0A 3VMOA 1K9DA 4HSNA 3NGJA 1H1NA 3PG8A 1W3HA 4MAZA 1ZNNA 2DZXA 7REQA 3BGGA 5ABFB 2YDAA 5FEXA 5A2CA 2V3GA 4KCTA 1HUVA 1GPFA 4JHZA 3NDYA 3GXNA 3LPPA 3HF3A 3NZ1A 1K7XA 4Z17A 3DXIA 1EYWA 4PTMA 4HA1A 3MVTA 1UZHA 1X8FA 4TXEA 1Q6EA 3I6RA 4X9YA 1M6JA 1Q3NA 3GVGA 2VFGA 4DNMA 1K6AA 3E5PA 3GNRA 3M07A 2A7PA 3WMLA 4LF2A 1EA9C 3F03K 1F4HA 3TK7A 5FAGA 4GQQA 1NTHA 1R5YA 3STPA 4AIBA 4GCXA 3LN3A 3IEBA 4LX4A 3I7RA 1E6XM 3VIPA 4ZE4A 2CU0A 2V68A 2GK1A 3TYZA 1XGDA 4REQA 4F40A 5KZ6A 1AL8A 3HQOA 3SCWA 3KVKA 5TD4A 1F3XA 3KWSA 2Q01A 3A9BA 5HMEA 1UPMB 5DRCA 1JFHA 2WNWA 4GBUA 3VCRA 1W9XA 4TUFA 2OOGA 4AD0A 1E71M 2FPYA 3E0VA 2EJ1A 3NSNA 1TQXA 3C2YA 2O4QA 4Z0SA 4HSHA 3WNOA 3CC1A 1FDJA 1TYGA 5LIXX 4XO7A 3GQYA 2EG6A 4CQCA 3GDKA 3ARUA 1PUDA 4F0SA 1S2UA 4W7VA 1XLGA 3AWOA 4I5RA 4R7WA 5K9CA 1A5SA 4XX6A 3N9SA 3EKGA 2C0AA 4ZXLA 2ZVIA 4EPDC 2IXUA 4QP0A 3BSHA 3MWCA 3I4EA 4X2RA 1KFLA 5D2XA 4B91A 1Q4NX 4BFAA 1O6IA 3TYAA 1DWJM 3TVAA 4XBJA 5DELA 1WZMA 1P7TA 3AO0A 4K68A 2TMDA 3WK1A 4YTTA 1B3OA 2G0WA 3QQ0A 1Z69A 1O12A 1R47A 3ATZA 4MKSA 2KX9A 4JBRA 1C91A 1NY1A 2NZLA 5C54A 1R85A 3MMDA 4A35A 1LG2A 4I9JA 2XN2A 4WXYA 3DHPA 3M0KA 3PB0A 3A9IA 2NQLA 3ATYA 3H8AA 7TAAA 2FVLA 4OV9A 1TCDA 1O60A 3SFKA 3A3XA 3C2VA 1A3WA 4IQDA 5CAHA 2BY2A 4B2DA 3PZVA 3W29A 2ODOA 4LS2A 1XBYA 1K8YA 3U7BA 1NVMA 4A3UA 1GCYA 2Y85A 4PMJA 4GJJA 3AMKA 1GVSA 1ZUAX 1EP1A 2PU1A 3D6NA 3UG4A 5EA9A 4JIEA 4PEKA 2IW0A 3T40A 1BD0A 4QJ4B 1J6PA 2OEJA 4QROA 1EBHA 2P53A 5LSMA 3E0WA 2BP1A 2ZTJA 2GPTA 1LQ2A 4IZGA 1R9YA 2OQHA 3FNDA 1E43A 2VR4A 4MWAD 2ESCA 1MFVA 1KC7A 2Y2WA 1VEPA 3W2UA 5C2XA 5C9UA 4J2PA 1SJCA 3G6MA 3VNJA 2D23A 1F07A 4UBPC 4AD5A 1H7RA 2WJZA 2QT3A 1RVGA 2REQA 3BUVA 1FFQA 1ADDA 5I02A 3SM0A 3BCDA 2ON3A 3UW6A 4WXZA 3APTA 2WPBA 4FP1A 2QAFA 2GVJA 3VA8A 3MYOA 1SU5A 5LHEA 2W27A 3LGGA 3USBA 3UG5A 3B06A 3FVDA 1TV5A 3CWOX 1X97A 2WMIA 4DJDD 3IRDA 4RCXA 4C6LA 2IKGA 3QPZA 1TG7A 4JTQA 1EL3A 4LAZA 4UTFA 2EKCA 3XINA 2VC6A 2WBGA 2WCAA 1XF0A 1GJPA 2GVEA 3SY5A 4N4PA 2YBTA 1W9DM 3ZVIA 2ZRZA 3DESA 2VFEA 1TUXA 3LCWA 1JR1A 3QYSA 4YCOA 4LYRA 1JYNA 3EX6A 4KWSA 4H8HA 4OBTA 5AFDA 3GWQA 1LJYA 4DXVA 4US5A 1ZPTA 5I79A 3PBVA 4HMDA 2Z1KA 1KFWA 4C6FA 2MANA 3P0WA 3BLOA 1EX1A 3LENA 2J77A 4ZR8A 1RD5A 3ZWSA 3W7CA 3FXGA 4JL1A 1W5OA 4ACYA 3LNPA 1UQZA 4GX8A 3PWIA 1UOZA 3NR0A 4H6EA 3MV11 1WNOA 1YQ2A 3IJLA 3WIJA 3W1MA 4M80A