4PEEA

Crystal structure of a bacterial fucosidase with inhibitor 1-phenyl-4-[(2s,3s,4r,5s)-3,4-dihydroxy-5-methylpyrrolidin-2-yl]triazole
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
445
structure length
445
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKGTKSIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 162
structure length 445
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4peeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4peeA01
4W7UA 4GZJA 1TZ7A 3LRLA 3AOFA 1C8YA 1E15A 2J77A 3NDYA 4Y7EA 3VSTA 1QNQA 1CXFA 5EFFA 4AD5A 2J47A 4QCEA 1UKSA 3ZMRA 2O92A 4JL1A 5CGMA 2X2YA 1MW3A 4J3TA 4D6GA 2WNWA 1BHGA 1PBGA 4UFJA 2OYLA 1OB0A 2WC4A 3SIMA 1D3CA 1DEDA 3BSGA 1JD7A 4P8UA 1VEMA 3VMNA 2PB1A 5I24A 5JUVA 2C8NA 3K1DA 2XVPA 2ZUMA 3UG5A 1JIBA 1PX8A 2GVYA 3QHNA 1CLVA 1B0IA 1DP0A 1KWKA 3UR7A 3CZJA 3EDKA 3EJRA 2VZOA 1J11A 2ZUSA 4W7WA 3W4RA 2YFOA 1C8QA 1J0KA 4OJYA 5CXPA 5C70A 4DM2A 3WY2A 3W37A 3VGBA 3BVTA 1C92A 3TONA 3PZTA 1JXJA 1V6XA 3AIBA 4EANA 3GBDA 1G94A 3PTQA 2EBNA 4M82A 3WY3A 2VX6A 3IAQA 1E3ZA 4JKMA 3DYPA 1Q4NX 4AIEA 3TTSA 1SZNA 4P7QA 5FOOA 3ZR5A 1DWGM 2F18A 1GOOA 4AZBA 5A8OA 5BXSA 2IXVA 3OA5A 1R8LA 3CHDA 4B3LA 1IV8A 2DPEA 3AMLA 3BH4A 2A3EA 5IHRA 3M6DA 2XVKA 1UD8A 1W3KA 1W1VA 4W8LA 4H7VA 2JF7A 1GZJA 3L4UA 2O9OA 3W29A 1AQMA 3WQ6A 4ZXOA 2X2HA 1Q6EA 1WDQA 3CZGA 2V3DA 3A3HA 4JIEA 4HU8A 4UFLA 2WVVA 4BS0A 3VD9A 1R7AA 1NOUA 5E70A 1MQRA 1TVNA 3POHA 1QX1A 1CGVA 2WVVB 3CC1A 3BUBA 5DF0A 1CDGA 2QHAA 5A69A 1MW2A 2BHUA 4ZEPA 3WEOA 2WMFA 3BXWA 2D0GA 1E5NA 3AICA 2G4FA 4IPLA 3A22A 1OIFA 4UFIA 2BXZA 2C7FA 3MS8A 3WEMA 2YOCA 2XUCA 3CBWA 3HN3A 1YQ2A 2DT3A 2W91A 2GJXA 1J10A 2WAGA 5M17A 1UR1A 1W3HA 4RE2A 2ZUVA 5ABGA 2NW0A 5A95A 3OGRA 5E6YA 4E8CA 2IXUA 4D6CA 3ZT7A 1QHZA 2WANA 1H1NA 4BQ2A 1UQZA 4F8XA 4AC1X 3T0DA 1KQZA 5CLWA 1HKKA 5JBEA 1I1XA 1HJXA 4BZYA 1GVYA 1B31A 2DH3A 2D22A 1N82A 1MW0A 4JHOA 5M03A 3GXDA 5A8MA 5AYBA 5A6LA 2J7HA 3A4AA 3AZRA 3N11A 2Y4SA 3W25A 4XV0A 1M7XA 4A3HA 3BVVA 3GDBA 3BUQA 4MADA 3UG4A 1TQSA 4U2ZA 3WDHA 2WMJA 4UTFA 1BF2A 1JAKA 1IT0A 1E4IA 5D9PA 3IAPA 4OOZA 1KFWA 2F8QA 3WBAA 1VFUA 1JZ8A 1DWFM 1H41A 2VNCA 4B3KA 2VX5A 4XZBA 3FN9A 4M81A 4FNQA 4J3VA 2UY5A 2D0HA 3GXMA 1HT6A 4PCSA 1QHPA 3GXNA 3RDKA 3WMCA 4C7DA 4DO6A 4UR9A 1V0LA 1E6QM 2EPOA 3PTKA 2DSZA 3FAWA 3VIFA 4ZXLA 5A8NA 4CCEA 3ZJ6A 1NOFA 4ACYA 4AZCA 1UWUA 1IZJA 1TQTA 2E9MA 3CZ8A 2E0PA 2ZXQA 2CXGA 3GM8A 3BAIA 1A3HA 3MV01 3BMWA 4ATWA 1ISWA 6A3HA 2G41A 3W6MA 3L4TA 1NWSA 2ZICA 4MDPA 1QI3A 5GNYA 4Z2GA 3EJTA 2XHYA 2CITA 4KRUA 3N9KA 4PYSA 2X2JA 4AEEA 1JGIA 3VX1A 1E72M 1XHGA 1XGZA 4NXKA 3VX0A 2O9TA 1E73M 3EDEA 1R85A 1MFUA 4XUYA 2JALA 5CSUA 3AHVA 4CD4A 4PMQA 3AIUA 3EDDA 2XN2A 2YBTA 3GNRA 4OBSA 1BLIA 3F5KA 2F2HA 1MQPA 3GXIA 1MVYA 3S2CA 3ZT5A 2J74A 3RM4A 5JBFA 4DWSB 2IUZA 4JFVA 2J78A 1J12A 3WN6A 3II1A 2VI0A 1FHLA 1EXPA 2V5CA 1QNRA 4H8HA 1E55A 1AMYA 4GXPA 1VEPA 1BGAA 3KEHA 3WMSA 4M56A 4W93A 4DO4A 3VD3A 2WMIA 1QNSA 4JHZA 4ML4A 1SR0A 1VFOA 5BROA 1VJZA 5CSYA 1W9PA 3ALGA 3AQUA 1JD9A 2F7QA 5E0FA 1V02E 4JFWA 1VENA 4FF5A 4GI8A 1CXLA 2J79A 2YLLA 3GH7A 1UD3A 2D3LA 1V3LA 4GO8A 6CGTA 2WHKA 1U2YA 3GXTA 1UH2A 4AYGA 4FNSA 1BYAA 4DWSA 1EDTA 5DFAA 4DM1A 2EO7A 4W88A 5AYIA 1ISXA 4NRSA 3VTRA 1HF6A 2QLYA 3RM9A 5BWFA 1ECEA 1BG9A 4CKQA 5D4YA 2UY2A 2DDXA 2WMKA 2BVYA 4B9ZA 1E6RA 3WNOA 4Q7NA 1JDCA 4CD8A 1W9BM 5A2BA 1UWSA 1VAHA 3WUFA 3DDFA 1QW8A 1VBUA 1LWHA 2D20A 4N0RA 2UY4A 1JG9A 4W86A 2J62A 2XFRA 2VZSA 3O9NA 1E1FA 3W28A 3DX0A 1M01A 3WY4A 3VOCA 1W1YA 4GZIA 1W91A 2PBGA 3CV5A 2WWCA 2Y8KA 5BXRA 3BAWA 2VOTA 4CU7A 5LA0A 1XCWA 2QPUA 3OGSA 1J01A 4CD6A 3UERA 4GIAA 3AIEA 3LPOA 3WNKA 1K9FA 2WMGA 2DT2A 4CN1A 1PJ9A 5DO8A 2D0FA 3QHOA 2X09A 4PMYA 4ZE4A 4F9DA 4GI6A 2BVTA 5FL0A 4D1IA 1QI5A 4UZSA 4URIA 1JI1A 3AXHA 1LG2A 2WMIB 2YBUA 4LX4A 3WH9A 4N42A 3LXCA 3HG2A 1E0VA 3MO4A 4C7GA 1JYVA 3AFBA 1OGGA 1C93A 1MXGA 2JFEX 2EADA 3N12A 3CUGA 4W89A 3DHPA 3N17A 2GFTA 4QCFA 3W53A 2VRKA 3IJ9A 4JFTA 1UR2A 3AROA 2V3GA 3VM5A 2ZWYA 2GDVA 1FP9A 2WMHA 4E2OA 4D6IA 3NJ3A 4TX8A 4JCLA 4FNUA 2JE8A 4H8VA 4TTGA 2DSKA 1WE5A 2EXOA 3WDPP 3U57A 2VVNA 4PMNA 3ZIZA 1LQ0A 4AZGA 1WDRA 2XPKA 1HN1A 4AIUA 1W32A 1U30A 5IXEA 3NSMA 3DDGA 3IJ8A 4TOQA 3WDIA 3POCA 2J4GA 1JDAA 4A3YA 3VMPA 1HKIA 1O7AA 3CO4A 4UOJA 3EJUA 2OYMA 3RPMA 3UESA 1B30A 2UY3A 1B90A 2OSXA 1PPIA 2XM2A 4JFUA 1E5JA 2VCAA 2DSUA 1QI0A 3DYOA 4HOWA 2VO5A 4W87A 2X2IA 2J25A 3ALFA 5JBDA 1Q6DA 1W2VA 3UEQA 1CECA 1R34A 2VX4A 1BAGA 1UHVA 4OGZA 2AOSA 4PMVA 3HZ3A 2F7RA 1CBGA 3IJ7A 3TTYA 4PN2A 1WAWA 3MSGA 1KTCA 3LPGA 2WHLA 2OWXA 3VNZA 3WD2A 2ZOXA 2CBUA 3THCA 1ZJBA 1HL9A 3SCTA 5M3WA 4B9YA 4A4AA 3HU7A 3SUUA 1ZU8A 1VEOA 2GK1A 3GZAA 1GORA 2A3HA 3MU7A 4AZHA 3PBGA 5IDIA 1CGUA 1TVPA 1CEOA 1EOKA 2XSBA 1KBKA 1MFVA 1BPLB 3VDAA 5HPCA 1MWOA 4Z2IA 4ZE5A 4UZUA 1OT1A 1BQCA 1HJUA 3VDBA 1UD2A 3WNNA 3WDJA 1XSKA 1WCGA 3OG2A 2BXYA 5D9MA 3EJSA 4NZJA 1M53A 3DX4A 4AY1A 2J8FA 1V3HA 4CGTA 3PZIA 2ZX6A 2EPLX 3CMGA 4TUFA 3CUFA 1VFMA 3JUGA 1SMAA 3SUSA 3WDQA 3AIWA 1UUQA 3VIKA 2OWCA 1BVNP 4KRTA 3ARXA 2F1AA 4DUVA 3N04A 2XJ7A 1DHKA 4QP0A 3K8MA 1J0IA 3ZSTA 5TD4A 3CUJA 4DUXA 2JEPA 1LL6A 5A6AA 1E4MM 1HVXA 3H53A 1F4HA 4PTXA 3F5JA 2Y2WA 2OSYA 5ABHA 1GHSA 1GOIA 5ABFA 1WNOA 4D6FA 1FH7A 2F61A 4DO5A 1HNYA 1QWNA 2A3CA 4S3JA 2PWFA 3SUWA 2D24A 4AD4A 3WD1A 1EH9A 2QMJA 3PN8A 4J28A 3AS1A 5D9NA 3W0KA 2ESCA 4U3AA 4F66A 1H3GA 1OIMA 4AD0A 4GKLA 4PMXA 3ARVA 1K9EA 1KWGA 4AMCA 4BA0A 1FOBA 3K4DA 1XD0A 2WCAA 3PZNA 4TVDA 4P8VA 3VGHA 1YHTA 4Z2JA 2Y24A 1V3IA 4PRWA 3ZR6A 3WF1A 2ZUUA 4UQCA 4M80A 4P8XA 3EBVA 3DX3A 2NT1A 2J7DA 2WSPA 3DECA 1W9DM 2DSWA 3ZJKA 1CPUA 1BGGA 1JFXA 3AHTA 2XWDA 2J7CA 2OW7A 1TQVA 1E0WA 1CXEA 2EPNA 1W3JA 1RD6A 4XX6A 2D73A 2VR5A 5GNZA 3FNDA 2WYSA 2WC3A 1TG7A 5E6ZA 2NT0A 1OCQA 3BCFA 5IFTA 3I3DA 1GCYA 2FGZA 5E1QA 1JF6A 1JZ5A 5A6MA 3MUZ1 4UOQA 3WBEA 2Z1SA 1GW1A 1I75A 1WZMA 2BFGA 3AISA 3AXXA 4QFUA 1L8NA 4M8UA 5FCZA 3VU2A 1GQLA 3WNMA 5E0CA 2VR4A 1O6IA 3KE0A 1GONA 3HMCA 3ZQ9A 4YN5A 3U7VA 2DEPA 5HOSA 3D50A 1V0NA 1UA3A 4H04A 3LX9A 1VBRA 1BYCA 1BYBA 1CYGA 1V03A 2VZVA 3A24A 4PTWA 4ZFMA 1TCMA 4OBRA 3WDRA 5HBFA 4PEEA 1NP2A 3FHAA 1DWHM 4P7LA 4UQBA 2XIIA 3VIHA 1R46A 1MXDA 1X1NA 1EQPA 1HVQA 1UWQA 2YJQA 1XYZA 1CGXA 3DHUA 5A8QA 2ZE0A 3F4VA 1NH6A 4X0VA 3S5YA 4HZ6A 4PMZA 2YDRA 9CGTA 1SMDA 4M29A 1LJYA 3EMZA 2WZEA 1OT2A 3NIYA 2QV4A 2W63A 3ZSSA 1V3KA 1U33A 4BCEA 2C0HA 4W84A 1J0YA 3K8KA 3SCRA 4U3CA 4TTUA 1AVAA 3W6LA 3VMOA 1E6NA 4W7VA 3WF3A 4Z2LA 5ABEA 1H09A 5A2AA 3OLEA 1ZL1A 3PZMA 4K68A 1CTNA 3KL3A 3VINA 3AYRA 2XIBA 1M04A 2X8RA 4AZIA 2AAAA 4D72A 1O7DC 5KZ6A 1QNPA 4QLKA 2WWDA 3OBAA 4KH2A 3L2MA 1VB9A 3VD7A 1UR8A 2XYLA 3TP4A 3WD4A 4WKAA 5FKYA 2XGIA 2ZWZA 2BVDA 1PIFA 1UKOA 4J3UA 4MPKA 1QWUA 5LA1A 4OZOA 4AISA 2D2OA 3LRKA 3OIHA 3U5UA 5A1AA 2BY0A 2WKGA 2WC7A 2E9BA 3BVXA 4U33A 3NSXA 3THDA 1H0GA 1R75A 5CG0A 3GH5A 1GQJA 2NSXA 3EMQA 1L0PA 1ZB5A 4OUEA 2OSWA 4HZ8A 3CZNA 3M07A 2JIEA 2O9PA 4U31A 3VDCA 3PZUA 3CH9A 2WLYA 8CGTA 3RIKA 4WKFA 5DMYA 3BMVA 3AMKA 4QLJA 3WD3A 4MJ4A 5EFDA 2G3IA 1KGXA 3N18A 1HJSA 4V2XA 3AZSA 2OWWA 3VD5A 1GOKA 5A6SA 1JZ2A 2J75A 1HP5A 4MNLA 4W85A 1EIBA 4RL3A 2XVGA 4NRRA 3ZO9A 3VIPA 2B31A 1KXHA 2QMKA 4PBGA 2CKRA 2V3EA 3OLIA 1V6UA 3RJXA 1GJWA 2XWEA 2JIWA 2E9LA 5C8BB 2PI6A 2E3ZA 1FH9A 1XSIA 3U7BA 4AEFA 4AZ5A 1EHNA 1J18A 3VD4A 3ARWA 1B3YA 1WZLA 1EO7A 4DWSC 1WPCA 2J7FA 2VT0A 1FP8A 2GJXB 4MB5A 4XZWA 2WCGA 2YDSA 5D8ZA 1JI2A 4RE4A 3WELA 5IFPA 2D3NA 3A21A 1US3A 4UFMA 3SCNA 1G0CA 1B3WA 1JYNA 1ZBVA 1BTCA 1QBBA 5AC4A 2WZIA 2CCRA 1GQIA 2BHZA 3CIVA 3CGTA 4MNKA 2ZXAA 4HPHA 1KB3A 4NZCA 5KEZA 4CVUA 4W5ZA 3WQWA 1WDSA 1TA3A 1XH2A 4AW7A 3PZOA 2ZX9A 1G1YA 1TQWA 4YHGA 4FLOA 3PZQA 5CJ5A 1QHOA 2E4TA 4U5KA 3IK2A 1E4LA 4W5UA 4AZ6A 1XV8A 4PCTA 3W27A 5CZKA 4U2YA 4Q22A 1EDQA 4HA4A 2FE0A 1CGWA 3NDZA 4HA3A 3HG5A 2DT1A 4PSPA 1E40A 4NF7A 3N15A 3AJ7A 1BYDA 4NI3A 2VTFA 4MB3A 3WL1A 2RGLA 4JAWA 3MUAA 5A8PA 5HNNA 4GZEA 4M1RA 3T2QA 2F7OA 3AYSA 1I1WA 3K8LA 4P7RA 1JZ7A 3PHAA 4C7FA 1HP4A 3MANA 3WH6A 4UCFA 4OOUA 3OLDA 4AXNA 1RP8A 3TA9A 5FD0A 5GPRA 5JIPA 2DSVA 1JXKA 2OYKA 3OB8A 4JFSA 3SCVA 2OLHA 2XN0A 5LA2A 2HVMA 1B2YA 3GYCA 4D1JA 3NUKA 1HKMA 4PUDA 7A3HA 3BC9A 1B3VA 2VX7A 4FK9A 4S3KA 1S46A 4WF7A 1CENA 3L2LA 2DH2A 3W38A 3CZSA 1ESWA 4TX6A 1UG6A 2Z1KA 2YIHA 4XB3A 5A6BA 3LMYA 4LYPA 1EGZA 1E1EA 1EO5A 3N13A 1TE1A 2D1ZA 2FH6A 3SUVA 3RO8A 1KXVA 3D4YA 3VGEA 1PAMA 4FLRA 1HJVA 3VVGA 4F9JA 3ZM8A 1Q6GA 2ZIDA 2QPSA 5AC5A 1MYRA 3GXPA 1OM0A 2PBOA 4TVUA 4HA1A 3ARUA 4WJXA 1VF8A 5AY7A 3SCQA 1UASA 3D51A 2VQUA 3VM7A 3VIGA 4B15A 3VDHA 1H49A 2EACA 2EJ1A 2CEQA 3S6TA 2WVSA 3MV11 4FNTA 4BQ4A 1GQKA 3CUHA 2E8ZA 4X9YA 4LYRA 4HMEA 4MAVA 3LRMA 2RGMA 1W3LA 3TTOA 4LXFA 4AMXA 2FGLA 1KTBA 2WVTA 3WIJA 1PIGA 2WVUA 1UZ1A 2CNCA 4PMRA 4KGJA 4DUWA 1V6WA 4ZENA 4J3WA 1HXKA 1QNOA 3WF4A 5I3DA 1J9YA 1X6LA 3U5YA 4AYSA 5I2UA 4H41A 3WUGA 1JL8A 2ZUTA 3G6LA 4WSKA 2HISA 3A4XA 1BSIA 4HMCA 1EOMA 3PZ9A 1KGWA 3HG3A 1DWIM 2WB5A 3H54A 3WH5A 1E71M 4H8UA 5I23A 1H2JA 4FNPA 8A3HA 4UFKA 2YL9A 1QW9A 5ABFB 4LPCA 4BF7A 1UH3A 1ZS2A 1LL7A 3T2OA 3VIJA 2XN1A 2YA1A 2XG9A 3A23A 1R86A 1FFQA 3ARRA 4D6HA 3CLWA 1JNDA 5A2CA 1WB0A 2ZX7A 1W9UA 4EE9A 3WUEA 3WD0A 1SYTA 3ARQA 3APGA 1KXQA 1VRXA 1LF1A 1HTYA 2XGBA 4NZFA 3H55A 2J7GA 4LYQA 2D23A 3BCDA 3VKKA 2WM0A 3I3EA 2WW5A 3KLKA 3GXFA 1HKJA 5CPTA 5A6JA 3MUY1 3VIIA 2GDUA 3T09A 4MNJA 1Q6FA 1QBAA 2CPUA 3WH8A 1IZKA 1K9DA 3AS0A 3B8SA 3CHCA 4L4PA 4D6EA 1ZBWA 3HG4A 1HL8A 1E70M 3VGDA 2ZUNA 3ZOAA 2W92A 3KLLA 2XFFA 1QI2A 1XH1A 3AIRA 3WNPA 2VRQA 2YLAA 3EDJA 1LG1A 3UR8A 1UYQA 2JF6A 2WHMA 4ATDA 1CXKA 3A5VA 1NM9A 3IGUA 2V38A 2W66A 2IGTA 3HJEA 2GK1B 4AD3A 3VILA 1NP0A 1E6SM 1NWTA 1UKPA 3KL5A 3BVWA 4MTVA 4PTMA 2V3FA 3OZPA 2GJRA 3PTMA 1Y7VA 4HP5A 4QLLA 4CN6A 1V6VA 4D6JA 4ACZA 1WZAA 3ARTA 1WO2A 1ITCA 3GNPA 4E4PA 3BAYA 2XTKA 1XH0A 1OGBA 4MAZA 2MANA 2PF0A 3LPFA 2VUYA 3J7HA 3MMDA 2W62A 1JFHA 1G9HA 1HJQA 1FFRA 1QPKA 5JIWA 2G3JA 1D7FA 1W1TA 2ZXBA 5HPOA 4ATLA 4FLQA 1CXIA 3TOPA 3AMGA 3WFLA 1UQYA 3SCUA 3T0BA 1OINA 2WBGA 3QHMA 4D71A 1CWYA 3K46A 5CPQA 2YL6A 1B1YA 3QGVA 2X0HA 3WQ4A 4GPNA 1JYWA 4CU8A 3WEZA 3T2PA 4NXSA 1LLOA 1H5VA 4AZCB 1UZ4A 2G3MA 3SUTA 2VJXA 5I79A 3WF0A 4WK9A 1T0OA 3BAJA 3WY1A 3O2LA 3NYDA 1NWUA 3G6MA 3MI6A 4GQQA 1E3XA 1M03A 2VURA 3IANA 2DT0A 2DIEA 2F7PA 3KWXA 1UR0A 1H4PA 3WQVA 3OGVA 4P7OA 1ODZA 3AS2A 5FIPA 3MSDA 5A6BD 4BQ3A 2WK2A 3T0AA 5A94A 2WKLA 4MB4A 3FW6A 1NWRA 2WXDM 4ACZB 1P6WA 1PZ3A 1UH4A 3L4YA 1MW1A 5A3HA 2BS9A 3GBEA 4MB1A 2O9RA 3SCOA 1W9VA 2AMGA 3W24A 5D8WA 5HDRA 4OKDA 4MJ2A 3AMCA 1B9ZA 1MQQA 1CNVA 3QOKA 2W67A 1GOWA 2ZUWA 1X6NA 1F4AA 1OSEA 5DEZA 4B16A 3WMBA 4CVWA 1BG4A 1G5AA 4NX0A 2E8YA 1KBBA 1V08A 1ITXA 3WUBA 5CLTA 2V5DA 3I3BA 3LPPA 2YA2A 3GH4A 3WQ5A 2WLZA 1TUXA 4CU6A 1WDPA 3EDFA 2BY3A 2VQTA 1CZ1A 2TAAA 4GO9A 2FYVA 1JF5A 4EK7A 1KGUA 3O6AA 3ECQA 4AWEA 2CESA 1BVZA 2PWHA 3ARPA 3M46A 4UQDA 2BNJA 2CHNA 3WNLA 2VVSA 5A6KA 5GQBA 5GNXA 1V02A 4J3XA 2VRJA 3K4AA 1H0IA 4PMOA 4KWUA 2J7BA 2WPGA 2WZHA 1UKQA 1V0MA 5I0DA 3AIVA 4NSBA 3MUIA 4Z2HA 1J0ZA 4YHEA 2DQXA 4YPJA 2E40A 2YKKA 1C90A 4HMDA 4FNRA 1UD4A 2BV9A 1C91A 4BQ5A 1E6PA 4AD1A 3SCPA 2XVLA 4PTVA 3W81A 3BUIA 1PX3A 2YL5A 5DT7A 1R33A 5BXTA 5D9OA 4H2CA 4V27A 1V3MA 3VIOA 2DIJA 4PUEA 3WSUA 1XD1A 3DX1A 5BYWA 1PX4A 1CIUA 1E4NA 3EMCA 5F7UA 4U5IA 4JKKA 4UFHA 1E0XA 1B3ZA 3LXBA 2EEXA 1EHAA 4TVCA 3NCOA 4TXEA 4JCMA 1GVIA 3L4VA 1NQ6A 1UWRA 4AMWA 3BUPA 1DWJM 3PZVA 3B9EA 2W5FA 2JEQA 3AHYA 1K9TA 2X1IA 2OW6A 1C7SA 2ALWA 3VGFA 4WKHA 2YA0A 3CPUA 2CYGA 4JKLA 4CD7A 3L4WA 2CIPA 3WKZA 1ODUA 2XFYA 4HU0A 2ZX5A 2GUYA 2EPKX 2UWFA 3WL0A 4R5EA 3BLKA 3AZTA 4FLSA 4UQ9A 3WF2A 3A4WA 3GNOA 1RPKA 2W61A 2Y5EA 3L4ZA 4M24A 5M5DA 5E9AA 3TTQA 4IM4A 3FHQA 4W8AA 1K6AA 3QOMA 2WSKA 1G01A 2XM1A 1QVBA 1JAEA 1KQYA 1TA3B 3AXIA 2A3AA 4CD5A 4JZ5A 4CCDA 1A47A 4QAWA 1E9LA 4UQEA 2DGAA 2CHOA 3EJQA 3M7SA 1ZBKA 3UETA 2CERA 2WBKA 3AS3A 4MNMA 2EABA 1GJUA 1HXJA 3B9DA 3W82A 5ECUA 1GOQA 4KGLA 3CUIA 1CGYA 7TAAA 4EAMA 3BLPX 4OIFA 3BLBA 4J7RA 2EQDA 3EYPA 3RILA 1FA2A 4LGXA 5CPSA 3A6OA 1ZBCA 4AIOA 1OD0A 2Y8VA 3N1AA 5BRQA 1E6ZA 3DYMA 1V6YA 1WKYA 2GSJA 1OGSA 2EAEA 3VSVA 5I5RA 4GQRA 3S5ZA 4J27A 1WZKA 2VCCA 1E6XM 1W2PA 4P8WA 1UOKA 1RP9A 1XCXA 1FHDA 5IHSA 1JDDA 1V0KA 5DT5A 2VZTA 1CLXA 1JNEA 3BAXA 2VC9A 1Q6CA 3DX2A 3W26A 1BFNA 3ARSA 2X05A 3VGGA 2FDMA 3ZJ7A 1HIZA 2GJPA 3QR3A 1J0JA 1UR4A 2XSAA 4QDMA 4HOXA 2VZUA 3RJYA 4CN4A 4AD2A 1Z32X 4DWSD 1KR1A 2VL4A 1QOXA 3CHFA 3AI0A 5I77A 3BGAA 3NSNA 1C8XA 2PWGA 3D4ZA 1R47A 3EJPA 3CMJA 4RE3A 1PEZA 4WSJA 5HXMA 4F79A 1WP6A 3VUPA 3SEPA 1XYFA 3ZT6A 4HOZA 1NOWA 5BCAA 3UCQA 2QF8A 1W1PA 1ZJAA 1V3JA 4R27A 4P7NA 2PC8A 1TFVA 1GUVA 4WIWA 2FHCA 5I6SA 1PS3A 2YL8A 4HZ7A 2BHYA 1SFSA 3F5LA 1ISVA 4IUGA 3MMUA 3VSUA 1EDGA 3BUDA 5CQ1A 2G8ZA 1GOMA 4JL2A 1AQ0A 6TAAA 4AZ7A 2J7EA 3AMDA 2FH8A 1J0HA 3BVUA 1XSJA 1KXTA 1UKTA 1OBAA 1VFFA 4CUCA 4HPGA 1ISYA 2J8GA 3KZSA 3VO0A 1US2A 1VJSA 2CBJA 3SCWA 4UNIA 1C3FA 1KCLA 1E43A 1CXHA 2ZXDA 7CGTA 2X0YA 5EBAA 1KR0A 3VNYA 4X0NA 1CGTA 3KL0A 1UD5A 5I78A 3RMEA 3CZKA 3VIMA 1XRVA 3WH7A 2XVNA 1GNXA 3LXAA 5C71A 3WFZA 1D2KA 3L4XA 2WCSA 1TMQA 3CTTA 4WLCA 3BSHA 4PSRA 3CHEA 2A3BA 1NARA 3D3AA 3RM8A 1EA9C 2EPMX 2ZX8A 1RH9A 3WQ8A 1VIWA 1R7OA 2FHBA 2CETA 1E56A 1UR9A 2YFNA 1JZ4A 4V28A 3RCNA 3TV8A 1FH8A 5BXPA 3ZJ8A 1XC6A 1OD8A 3CZLA 3MMWA 1UD6A 3UG3A 3DC0A 4EKJA 1JYXA 3WENA 4J3SA 5CGTA 4IISA 4E8DA 5EB8A 1HX0A 1HJWA 1GHRA 2BY2A 4CCCA 3ARZA 3A47A 4PMUA 4LQ1A 3CZEA 2PWDA 3PZGA 4W8BA 1B3XA 5FL1A 1TQUA 4UQAA 2VCBA 2Q8XA 3VPLA 3D5HA 2BY1A 4IPNB 1DTUA 1HWWA 1PZ2A 4UOZA 1UA7A 1TR1A 4PMDA 1JZ6A 1AQHA 5E09A 3FY1A 2W4XA 4GI9A 1GPFA 1LL4A 3T08A 2CBIA 4D6DA 3SURA 1OWQA 2F1BA 4HTYA 2CBVA 2YDQA 4FMVA 3FXYA 3B9AA 3OLGA 1R87A 1JZ3A 3MKKA 3AHZA 1C7TA 3D52A 1H11A 2VMFA 1UWTA 3AIQA 4Z2KA 3E1F1 2WHJA 4GINA 1DWAM 1EQCA 1W9XA 3OZOA 2PWEA 1QI4A 2FHFA 4L4OA 2CKSA 1ISZA 3ARYA 5LYRA 3AHXA 3FAXA 3BAKA 1UWIA 4MDOA 1LWJA 5EMYA 1KCKA 3SCSA 3GTNA 4KMQA 2G3NA 5BRPA
chains in the Genus database with same CATH superfamily
4JM2F 4XZ4A 1WITA 5F96H 1TIMA 5BZAA 4JPKH 3DRQA 4U05A 1RHFA 4Y7EA 3QB7C 4J6IA 2I9EA 4ZBJA 3NDYA 3E9AA 2HT2C 3TWBA 3V4PL 1IEVA 1R5YA 2X7LA 5F2FA 3DK0A 2AK4E 1QKZH 2IDSA 5EUKB 3O63A 1KACB 3X14A 1UKSA 4ACTA 4XKYB 4ROQA 4G9PA 3QQNA 2KZWA 5C2BL 1F2JA 1XR2A 1UXMA 4JL1A 5ISZB 2HXTA 1IGWA 3E74A 4E4FA 4X8JB 1PZCA 3WIHH 1MW3A 3C6LB 4QYAA 1BHGA 5E5CA 5AYXA 4X63A 1WAAF 4ZW3A 1PBGA 3EX3A 1YEHH 1QW7A 4I3RL 3R13A 4JG1H 1QQDB 3BP5B 3DGGB 2YUWA 4XBKA 5B3JF 3HHSB 4L61A 4OF0A 2WC4A 1I9EA 2JELL 4M1DH 2WSRA 1HINL 1DEDA 2VFHA 1U3HA 1JWMA 3V79C 3F05A 4ETQA 4R8WH 1UACL 3EGJA 4FQIH 1TTPA 5I24A 3N1MC 3BJFA 1P7KB 1NC4D 1I1AB 1RAKA 1GAFH 3UG5A 1KLUA 5F71A 1JIBA 5IBLC 3Q5TA 3FYPA 5C2XA 1NOLA 5IESL 1I8IA 3HI6L 3Q3GA 1S5MA 4ZX3A 1YC7A 4IG2A 2G60H 4IQLA 3UR7A 1N0LA 3DTUB 1INEH 3EJRA 3F58L 4TN9A 2E27H 3CHOA 3S8WA 3MR9B 4OGAD 3L3DA 4JFDE 4NDMA 4LHQB 5JNYB 4REQB 3N41B 4W7WA 3U83A 5JOEA 2YFOA 3N41F 2EP6A 4Q2ZB 5DD6B 1O1ZA 1V8EA 2EIKB 1K4DA 4HXBL 1A7BA 3VFLA 1URIA 4Q4OA 2PC4A 5FA4B 6TIMA 2R23B 2X3AA 2GI0A 3BUYA 4Q4PA 3WY2A 5IVNA 5DY3A 4G7YH 4LSRH 2V9DA 4LWWA 2DJLA 3IDXL 5DWUL 3CWNA 4WOQA 3P4MA 4XXDA 1C92A 3PZTA 4YL9A 3U82B 2P8BA 3NXFA 4Z77B 2B20A 1KM0A 1GTHA 5HUPA 4ADJA 5J8OA 3O3RA 2D7TH 4JRXA 4WUUE 4QG8A 1YMMB 3GBDA 1G94A 4YIQA 2EBNA 4X80H 4WI2A 5C0IB 1WQ5A 3NFSL 3PP3K 4AHQA 4MJHA 3ZE2F 2VX6A 1Z9MA 1GKPA 1ECZA 2NLJA 4LCIL 4MXVF 4M5YL 4M9PA 5HGAA 1IR2A 2YB1A 1J5DA 1GGBH 4ZYKA 4ZS7H 2YSWA 5HHXL 1Q4NX 2P45B 3BKJL 5IBUG 3TTSA 4ODXA 4ALAC 4P4KB 4OV4A 3QW9A 3DKLA 3H7UA 4RDYA 1IKNA 5EF2A 1NLDL 1XQKA 1G7IB 3A3YB 3V4BA 2Z92A 4AZBA 1ZPLA 2EG7A 4OCWH 5IB3B 3UTQA 5A8OA 3U46B 1Q66A 4P4KA 2G4JA 2IXVA 4ETYA 2V2CA 5KANI 1IE7C 3OA5A 1P1MA 2FT8A 1R0AH 3OVGA 4B3LA 2EYTA 3QUGA 3VFRB 2YZRA 2MOQA 2PCYA 2AKRB 1E9QB 5DZPA 3QIUD 3BH4A 2DPEA 4O17A 4NWTH 5IHRA 1ZWIA 1MI5E 3LGGA 2IWGA 1UUSA 1M9WA 3V52L 2W6RA 4OR1A 3CFEA 1LYXA 4KW2A 5IEHA 4LSPH 2CKNA 2GBTA 4OFVA 3ATBA 1ZGDA 1NINA 4GNVA 5DHVH 3OKLB 5HGDB 5KSUB 1GTNA 5U4NA 1A9BA 1AFVL 1J1XL 2AJVL 1E4HA 4M7LL 2O9OA 3W29A 1ZSXA 3BO9A 3S3SA 1Q6EA 1SJMA 1XR9B 5JMRA 3K6NA 3HMWL 1WDQA 2WSYA 4L4VD 4HJ1A 2ZFAA 3ZE0B 3PP4L 3A3HA 4JIEA 1R19A 4WW2C 3O6LL 2R91A 3OKNA 4K7YA 2X89A 3IETA 3U2IA 5IEHB 1GC1H 3GZOA 2BOLA 4IS6B 5F1IB 1PL9A 4NCC1 1DQTA 4LBSA 5DQJA 2OR8A 1HQ4B 1NOUA 4LANA 1UJ3C 5CILL 4Y9AA 1MQRA 5F7EL 1YY9D 2KZKA 1JHTA 3PAVA 3POHA 1QX1A 3C5ZD 4LMQI 4NQXB 3IGKA 4JG0L 4EJ1C 1HDMA 1U92B 5DXWA 5I1GL 5BOEA 4S1DD 1NBYA 1EBAA 2K3HA 4YXKH 2HWZL 3S36L 2RH0A 2VUKA 2XZQL 1IEHA 3NCMA 2TRYA 4G8GA 3H2EA 4B5XA 2AQSA 2J4WL 3HMXL 4F1ZA 5AB3A 4GFSA 1MWAB 3OKOA 4K23H 3W0WD 1R17A 1NCCL 2WKJA 3LCFA 4IPLA 1VGEL 5AZ0A 4MTMA 4C83B 3TLLA 4E42A 1SDDA 2BXZA 3T4WA 2OCCB 4YXKL 1C9WA 1N55A 1EFZA 1ZWIB 2JI2A 2R4RH 5JHMA 3IJSA 3BGJA 2PURA 4YHNA 3SN4A 1K6QH 3GG8A 1NBVH 4PFMA 2MWCA 4I85A 2Y7SA 4WV1A 1DVTA 1QUNA 3DJRA 1TEGA 4TTDD 5GRVL 2AXWA 2C3ZA 4FP8H 5IVXB 1DJSA 3PBUA 5HYIA 1SJDA 2IGLA 3C2EA 1OGTA 1W0MA 4GIPD 3TZNA 1WK0A 1UR1A 1W3HA 5XIMA 2GC4C 4ISVB 5HY9B 5D1XA 1B2WL 1ORQB 5JHBA 5DD5L 4IL0A 2BNQE 3BP4A 3CXDH 5AW5B 3TPUB 4ZMPA 4A2DA 1R5VB 3O4LE 4NZUH 3TU6A 3GBNH 4P99A 3QV7A 4E8CA 2ARJQ 4KZDH 3UAJD 3ZT7A 4JRYD 4ELMA 5CFAA 5L2JB 3MNVA 2Z1PA 2Z2UA 2WANA 4J8RA 5E6UB 3WAJA 5T3XH 4LHUB 1H1NA 2VMCA 4AC1X 4BKNA 4BQ2A 4M1GH 4F8XA 1SW0A 4PLKD 5CLWA 3ESNA 1UP2A 3BMXA 1AGFB 1KN4L 4PJDA 3QPXL 4G8EA 1HI6A 4H26A 4NQCD 5DD0H 3ME0A 2D22A 1N82A 1UM6L 1VFHA 4XXDB 3GXDA 5CKAA 3G5WA 4WI3A 4XAKD 5DO2D 5TE7H 3GFYA 1F4XH 1LEGA 4O9HH 4CMMA 5IHUL 5AYBA 2B16A 2Y4SA 1G6RH 5AUMA 3LDBC 5AL0A 3ERPA 5M7QA 3CX2A 3MLPA 4W68A 4EX4A 3DFPA 3STPA 4LBEB 2FX9H 3DBXA 1IC7L 3BVVA 3KGTA 3BUQA 3IDGA 4K07A 4U2ZA 5GRUL 3NPXA 4MADA 3NPZB 1YY8A 1BF2A 2KPNA 2M8XA 4K7PY 5C6PB 4WQOA 2L7UA 3T6QC 4PJIB 5LZLA 4L9LB 2PP0A 4BF5A 3PWNA 3QHZH 1UEYA 5CJXC 4GABA 1FNSL 3TCLB 4OZIA 1A5NC 3SDXE 5I1LA 3WBAA 1PLAA 5D7IE 4DZAA 1EZWA 4MXWL 3NL5A 2PTUA 4LOFA 4NZ8A 3S0CA 4EAYA 3W39A 2PF8A 3RL1A 5BWAA 1JZ8A 1I1AC 4NQVB 1OK0A 1H41A 2CM6A 3TYDA 5JXED 3KXQA 3V10A 5E2VH 1O94A 2CO3A 1U8MA 5AD0A 1H7NA 1D9KC 1MFBH 2D7OA 3FN9A 2AANA 4FQQA 4FNQA 4KXZI 5TDPA 3U2CA 3SQRA 2ZP9A 5DMMA 2D0HA 4LB8A 4C6KA 1GKEA 4KKNA 4QWWC 5JZ7C 4URKA 2DWSA 4QRBA 4UC5A 3TWAA 2DP3A 1QMUA 5F3HB 3WMCA 3GDMA 2WB1A 1YN6A 3TFCA 3GDLA 2C34A 4NQSB 5CS7A 2OG9A 2OQJA 1AH0A 3QPEA 5HD8C 2Z31D 5JHLA 1RULH 2VXTH 5MEOA 3LLFA 4GY0A 4E9QA 3H7BB 1J96A 1E6QM 4R5VA 2AQ1A 4UTIA 3GUTA 1OQOA 2DSZA 4XNYH 3UF9A 3VXUD 1RY7B 3BOXA 4Y16C 5F3FA 3VIFA 1TIUA 3DIFB 3IJEA 3RVWD 3ZDZF 2QCMA 4CCEA 3G9AB 3DXAB 1TPC1 1B4EA 4AZCA 1XBZA 5FYJH 1NICA 1W72A 1L6WA 1P0EA 3BZGA 4L9DA 3WBYA 1FX6A 2G3XA 4LRIA 2ZXQA 2CXGA 3FONB 3L3OB 4MLRA 1OPOA 5CN1A 3MV01 4ATWA 4U1NA 4N9OB 1QWHA 5KYUB 4BUHA 2PDGA 4OZGA 4X98A 3L4TA 4YHOH 4MDPA 1SY6L 2PTTA 4O2EA 4P59H 1XEDA 2G3ZA 2QQLH 5JO5B 1O9VA 4DPAX 2CITA 2XHYA 3P9WB 2VM4A 3JTSB 3V4UH 1MRCL 3GDKA 1Z5HA 3BW9A 4DGYH 1DQQA 2X2JA 5IJVB 1JZJA 3I85A 1W17A 3WLLA 25C8L 1E72M 1FL5B 1XGZA 1RPXA 3IU3A 1KFAH 3ULAB 2JK5A 4NXKA 4D9LL 2R82A 1ME8A 1OV8A 4DEFA 4AL8L 1O60A 5CZTA 1NDGA 4ODVH 3CS2A 1TTQA 2CUMA 4KVCH 3HAEG 3EDEA 1R85A 1E6OH 1MFUA 4JO3L 5KVDE 1SDYA 4C4KT 3EFDH 2CLFA 4HN4A 5GGSY 1JHKH 4IIQA 5I19H 4WDXA 4ODTH 4NOFA 1MFMA 2YPLA 4Z0BH 3HG1E 3CAQA 3T9WA 4IU2B 4B60A 5MHSE 5SX4I 1Q1JL 1UUOA 4PJ8D 3RWJA 4BCXA 3HOGA 2IMMA 2EAWA 2C1HA 1TQCC 1KLYA 5C2CA 1R3SA 4K4KA 3BWUC 3NG5A 2IQAB 4F58H 5CU9A 1X97A 2IUZA 3BLOA 4MASA 2Q87A 3LY0A 1ZLUH 1W6WA 1BFTA 2IFGA 5H8DA 1RURL 4I48A 3WFHB 4P2VA 1YZZA 1QLEH 2YD5A 4P2RA 5EO9B 5I66A 3OTRA 1QNRA 2K6WA 3FF7A 1DQML 4OZFG 5TH2B 4IMCA 3LKQB 3S35X 4DEPB 3W1UA 3RWEA 4WI0B 1HQTA 1RUAL 4LB4A 4L4JA 1X7QA 2ZAGA 3TL5A 1BGAA 3FDWA 3PDDA 3LS5L 1NCGA 3KEHA 4OUIA 4XZLX 2YEVB 3GKWL 4YWIA 1MHPL 1E9PB 5HMFA 1GR7A 1OW0C 2XWZA 4PJ9C 2LLEA 1JPEA 1VFOA 2P48B 2Y72A 1FBAA 1OZUA 2JI1A 4AGLA 4AQZA 1D5ZA 5SWZA 2F7QA 2FWOA 4U1JB 4UU9B 4UV7H 3SRHA 4AK2A 2NY4D 4JHWL 3UABA 2P9RA 4HPJA 5DK2A 3U0HA 2DBLH 1AC6A 4PN6A 4RZ6A 4DKDC 3KBVA 4X5XB 2E09A 3LTYA 5ID0B 2NZ1A 3GH7A 2WHVA 2D3LA 3RVXD 4FZIA 1BD2E 3VG0L 3WO8A 3WXVH 2WHKA 4HQVA 1DL7H 1H8NA 1U2YA 2X44D 2HRWA 1SLVA 1PSCA 1XC4A 3ITLA 3W70A 3IMUA 3UJFA 3GXTA 3SZ8A 4FNSA 1U83A 4DWSA 2A6DA 1J79A 1EDTA 1W8SA 4H8NA 4JR5A 2XV0A 4XBEH 3C09B 4P2RE 2YSSA 3P9LA 1X6UA 4CDHA 1CDCA 3PQYB 3SHSA 3CLEH 1BVWA 1ECEA 2D31B 1HF6A 1PYMA 1QJWA 2YYTA 2Q8BH 5EDXA 5D4YA 1ZT7B 1CBVH 2UY2A 1E6RA 4H44C 4ILDA 3M4HA 2WUCL 3GK0A 4HUXA 3K1KC 2FLRT 5ETUB 1YNTF 2AJ3B 1JPHA 5DHXB 1CLCA 4IHOB 3ABSA 5D1QC 2AERT 3L9RA 4HLJA 3OM3B 4NHUB 1EJVC 1ZHBA 1KYOK 4HAFA 3UZQA 2I9LA 3L1OH 1UWSA 2NTSP 1YPXA 5I06A 4NQEA 2GITA 5BRZA 1LWHA 5HDWA 4BELD 1I8AA 3GS7A 3PWPA 2X38A 3DJSA 3IJHA 4RDQF 4DFHA 5B3NA 2EUXA 3BCJA 3URBA 3QCTL 4H25B 2P8CA 1I7ZB 1AGEA 5DD1H 1E1FA 2R69L 2VEPA 3M17B 4J3OG 1U8IA 2NY2C 1FN4A 5D7JB 3TNOA 2YKLH 3O9WC 2OLAA 4JQAA 3UY7A 1PYWB 3CV5A 3KR3L 2Q8AH 5BXRA 2E6AA 5LBSA 2WY3B 5CC3A 5BUAA 2GYSA 3C0LA 3PP4H 1JCMP 2XN9B 3TBWA 4QHKJ 1CLZL 5MEPB 1KPRA 3HLAB 5F7NC 43C9A 1UIOA 3QFEA 4HHMA 3IDUA 1ZP4A 4H20H 1U1JA 3UERA 4GIAA 1T6BX 5D5ME 4C1KA 4ZQKA 3KGRA 2ZXGA 1BMGA 1F6AA 3ETSA 3MRNA 1RBLA 3AIEA 4AQEB 1X5AA 5SWZB 3G3MA 2EINB 1VACB 2R2CA 3CN2A 2N0KA 4S3FA 2QADD 4NG3A 1RBAA 5DK2B 2APBA 1ITUA 1M4KA 5LBVA 1FDJA 3GBNL 4MJID 1WXJA 2GFBB 2QPXA 3MT1A 2BP0B 3AY4A 2DORA 4PMYA 5E93A 1FH5L 5C07E 4GAFB 4F9DA 3VTAA 2QDDA 4XO6A 3GC2A 4S2BA 4OZFA 1OIOA 4XNYL 5FL0A 4UZSA 3MXWL 4IFRA 3WK0A 4JZJB 4R83A 1OPGH 5F0MB 4NJHA 5E51A 5FFLA 4BK5A 1R2RA 1AXIB 3LXCA 1TE6A 2Q71A 3WLSA 1UENA 2P24B 4KRPB 4NQED 5DJ0A 3TBSB 3FK4A 2ZCKL 4JDVA 2JFEX 3LCXA 2R2BA 5FKPA 1A7RL 3BVDB 3DKHA 4TUUA 4Q4SA 4ORMA 3G6JF 4YHIB 5SWZD 1EJRC 2VRKA 3IFLH 3AZUA 3IU4H 4FGMA 4JFTA 5FJIA 1HJVA 3UMTA 1LK3H 2G30A 3DSFH 2ZQ0A 1OYAA 3VQ1C 1DJQA 2ZKHH 3QJTB 3NJJA 4IKIA 2WMHA 3GTVA 3EX6A 4F2UA 1NKRA 2AVGA 1D2OA 1OCWH 2OZ4L 4HCDA 4RJEA 1JXDA 3RU6A 4IJRA 4KXCA 4XSMA 3UWVA 4ZPVB 2CRIA 3ULSA 1PVNA 3TLQA 4H8VA 4Z7NE 1YPZF 2CUIA 3QO1A 1RZKC 3S6CA 4YTTA 3CASA 4Y19A 2P5EA 5D2TA 1J5OL 4PMNA 4PTNA 3ZIZA 4YEFA 3W02A 2ZYHA 3T0XA 5KSAD 2XPKA 3UYPA 1HN1A 1NJ9B 2WWNA 3STZB 2O5ZL 5FUCC 3KYKL 1QYGH 1C12A 4R4BA 1U30A 3C0SA 2CGRL 1RQBA 2GGHA 4A05A 3SKJH 2OJEA 1A0DA 5HI5C 1LP9F 1P5VA 1S2UA 4TOQA 4RVBA 3CDCA 3QT2A 1XBDA 3MACH 3Q2NA 4MSSA 1XBRA 3DMMC 1RZIB 2J72A 4PGEB 1NPJA 3LSCA 2ETWA 2BOFX 4A3YA 3MV9D 1QRNB 1XLEA 3GHBH 3SCMB 1PQZA 3VMPA 4ZXBD 3CO4A 2ADIB 4KUZL 4UOJA 4FXJA 3U4EA 1Z7JA 3H2NA 1FBIL 1LO3H 5FEZA 4XO4A 3VKJA 1G9NC 3KJ6L 4W70A 3S2AA 4B5EA 3QJZA 4ACPA 1NA8A 1B30A 4YSAA 2P5EE 4PFEA 2ZXWB 2UY3A 1AI1L 3QRHA 4M4RB 5I6OA 1L6YA 2DQ6A 5F1OB 2WZPA 4O11A 4MKSA 3W23A 4FTVB 2DB8A 3K80A 4LU5H 3QYNA 1GCFA 1ASQA 4LLUA 4MJJA 2BWQA 4O02B 4XODA 3U0PB 1YEKH 4U1IA 3WJJA 1E5JA 4L9ZA 3FZUD 1IEBA 3KPSA 4OU3A 3TWCL 3DRTA 2EZ0C 1KJVA 3DYOA 4LPUA 5G4MA 4DI8A 4HOWA 4XMTA 3KOFA 1T1YB 4L1TA 1EHKB 4KQ4L 1CI1A 1OT4A 1MUMA 3QUYB 1XAKA 1U8JB 3NIFE 2YC1A 4OCNC 3LEXA 1QSEE 3UO1H 1CECA 2BSCA 2R14A 1IFGA 2VX4A 4XIMA 2PW2A 3G1XA 1D7KA 2GI7A 1BOGA 1YDOA 3HS0B 4L8BA 4ZSOB 1JTOA 1AZ1A 3E2SA 3MFFB 4WJG3 4JPVL 4ZUUA 3RRQA 2EDTA 2EIDA 3QHTC 3QEQA 4RZCB 4AGQA 3RG1C 4HEMA 3KHJA 3TW9A 3LKSB 5DS1A 1W72H 4TLKA 1R0AL 3IRPX 2V4LA 5F7DB 3N2XA 4Y90A 2RH9A 2WZMA 2NY3B 4I0PA 3MSGA 1ICTA 1U8LB 4L4VB 5K1JA 4PUKA 1JVNA 1SJBA 4NC2B 3FYEB 3LVEA 4I7VA 4OJFL 1F13A 2IF7A 3VNZA 1MIEL 2EDWA 3FZUC 4LSVL 4XWOC 3NCXA 3T55A 3MX0B 4FTVE 1HL9A 5DJYA 5M3WA 3OF6A 3Q43A 4A4AA 4PRNA 5MERA 2BSDA 1VEOA 3A6CH 5L8KB 2VDKB 5DUML 4AZHA 1S7SB 1OHQA 2OK0H 3I02B 3MA8A 5HYJB 2G75A 4U1LA 3VNDA 1BXAA 1EOKA 3IIOA 1KNOA 3MUXA 2XSBA 1KBKA 3WQGA 1DLFH 1RXLA 1QPPA 2X4QB 1DQVA 4OFKA 4PJXA 2VC2H 3MA7A 4ES8A 1CGSH 1FKXA 1CFVL 3VDAA 1I4FA 3BW9B 1M7IA 1MWOA 4YLQT 3JV4A 4JTKA 3LTPA 5L2JA 5IZ7A 1BXUA 2WYIA 4Z7VF 5FYJU 3VDBA 1MCHA 3WNNA 1XSKA 2WP3T 1RY8A 3N4EA 1LQSR 2C4XA 4O5LL 4L6OA 4XP6H 4OVUA 3I68A 2FO1A 3JVAA 1ITBB 2Y1YA 3EJSA 4MD4B 1KPVB 3X3GH 4M03A 3WS6C 5I15H 1QOKA 4U6VL 4E9SA 3F83A 4X9HA 4KMTL 4NN5B 5AVTB 4AY1A 6XIMA 5AOKA 3MN8A 3NQKA 4GUPA 4PS7A 4PJEB 3TN0C 3DXAA 2HPOA 4TUFA 1T89A 4H01A 1WFIA 3LN4A 3N34A 3W2JA 1TJ1A 4US5A 1PG7W 1SMAA 1PKOA 3I6SA 5DRNA 5T33H 4AWUA 3QIBD 4W9TA 5DJXB 1U3ZA 4FQXB 5HHME 5BNKA 1H5BC 3SZ6A 1S7RA 2V7NA 1GZPA 3R8HA 2CGYA 2PP3A 1NFIB 2F5AL 3T8XB 1A5OC 1K70A 2PGEA 4Z42C 4YZFF 5EG6C 1WT5A 2VM8A 1DBTA 4WWPA 1NIDA 5CN2A 4APXB 2VDKH 5H37A 3TO2A 3ULUL 3CQHA 4XD3A 1EVTC 1U93A 3N04A 4U3SB 2XJ7A 1DHKA 4PH6A 1NC4A 3VNKA 1EGJL 3ZUNC 4B3ZA 4NM4H 4G3YH 4DUXA 4RMUA 2CWNA 4XZNX 1JGDA 5F6IC 4XOAA 1LGVA 4X6DB 3ROOA 3O6KH 3M0YA 3ULVH 3P4NB 3OPZH 3JT2A 5L4MA 4DPQA 1A7OH 1XFPA 1HVXA 1KXTB 2O6EA 3H53A 3PL6B 4PRHE 4Q8UA 4GIRA 4KZCA 2WQSA 2Y89A 8TIMA 4FXKC 4ODTL 3H3KA 4NIYE 4Y2DA 4IPPA 3W7OA 2IBGA 2V68A 3VAEA 4HKZA 4S1QH 5ABFA 2RTTA 3KFTA 3FXGA 2LVEA 2LV4A 3QCTH 2NXGA 3G2GA 2H5UA 3I2CH 5F0LB 2PCFA 2INEA 1HQ4A 1ZVSB 2FSEB 1B54A 4M7SA 1QWNA 3U4KA 3LYEA 3NQ2A 1QDSA 2OYPA 4FR1A 4HNCA 4Z7WA 2G60L 3BQUC 2NQZA 5I8EB 4XVSH 4Y5VC 4LEBA 3AM8A 3R58A 3C9NA 2D24A 2XPYA 3ARBA 5FA3B 3SUWA 4P46B 4JIHA 4UAOC 2G50A 2QMJA 1SEBA 3RY6A 3PN8A 3MO1A 1ZTXL 5D71H 4NO2A 2MEJB 5DYOA 3H8AA 3MMEB 4JE0A 3L6FA 1VHPA 2M1KA 4ZRGA 5IVXE 4HIEB 3W2DL 5BV7B 2XCMC 5C0FA 2BSLA 2ESCA 3LM7A 3MZ2A 4PP1C 2NNFA 1OIMA 4U6HA 4OU1A 4AD0A 5F4WA 1HE7A 2AW2A 3F65A 3ARVA 3M88A 4FXLA 1A6WH 3FQNA 1XTMA 3SDAD 4XUGA 3VD1A 1KWGA 2XBTA 4WHTB 1DQJA 4AMCA 4C57C 3LNDA 4MNGB 3K4DA 3PZNA 3UA3A 3TLRA 4TVDA 4PUNA 1T7WA 2W88A 4E9RA 1MY7A 3IRCA 5EU4A 4X6EB 3VGHA 4DZ8B 1NJJA 5C0BA 5T8IA 5D37A 4NRZB 3C75A 4HH9B 1RUQH 4KV5E 2XV2A 4GOSA 3L3JB 4UTAL 1C5BH 3T3MF 3NRPA 5DMLA 1E0UA 4JDYA 2J7DA 1G7IA 5FM5M 4Z1CA 1A6ZB 1RUKL 1X5XA 1AO7B 2F53B 5DVOA 2ABBA 4QQUA 3DECA 1A8JH 5FM5O 4A3UA 3V6OA 3EHBB 1CVSC 3UTTA 2P0OA 3RVUC 3O6CA 4E4UA 1SSGA 2AABL 4F37F 4BEQA 1AD9A 3TJIA 4WHDA 2NV9A 2ZC8A 4KJWD 1SYVA 4JRXE 1DBML 3RZCD 1TQVA 2MTAA 1URLA 3TZVD 1QUNB 2JQMA 4PJEE 1VPQA 4F7PB 2HT2D 2EPNA 4XX6A 1RD6A 1T8XA 4C6PA 1NTDA 3ZL2A 4R4FH 5EU3A 1SYVB 5FYLL 2VR5A 5CEZE 3QF0A 3RMJA 2AABH 5GNZA 1GXEA 1AD9B 3RTQC 2WYSA 5JHAA 2WC3A 3FNDA 4YSUA 1MSPA 2A9MH 1LDCA 2PDHA 4O2FB 3O11A 2FGZA 2YPKA 4YSCA 2IFFL 3LHPH 4Z76A 1A2YA 4LGXA 2OJPA 1BM3L 1T3FB 5I3IA 1FI8C 2DQHH 3AU1B 1RFDH 2HUEA 1QKZL 2FQIA 4MZ3A 3CT7A 4NJGA 3VXRD 1GW1A 2Z1SA 3PY2A 3WBEA 1WZMA 4KH9A 2C79A 3OG4B 5K39B 4AZ8B 3AISA 3D39E 3AXXA 4JPIB 4MA8L 5AOIA 3ZDZE 4Q8PA 5FGBA 5AC8A 3N29A 1BZ9B 4Q6YA 2AJSL 2PCQA 3KVLA 1O6IA 2YGOA 5D7SL 1ZAGA 4Y7OC 1GONA 2VKWA 3D25B 2NX5A 4TSBL 6PAZA 1VFLA 3N9RA 1YIXA 2GQ9A 3QQ9D 4HZ1A 4TXVB 3W0WA 2KDGA 4JQIL 1UM4L 1AANA 3K5SA 1OYCA 3LX9A 3LZNA 3QQ3A 1BYBA 1CYGA 1V03A 4AXKA 3CYVA 1VYSX 4ZXBB 1DHPA 2AK1H 5F0PB 3NQ6A 4PTWA 4X6BB 4YHYC 1TCMA 3ZHKA 1R5IA 4ZD3L 4RFNB 3DHJA 4GX8A 3HZMB 1P5UC 2QW5A 3IJYB 1HSBA 2E9JA 5AYUH 1O1HA 1IUZA 4CC0A 1U5HA 5FI8A 5IB5A 1DWHM 1CD9B 5MF5A 1UZ8B 1EZLA 1QABA 1SMOA 1EUUA 1MREL 4M00A 4P7LA 1L6SA 4UQBA 2FZMA 3TE9A 3V8CA 1EJOH 1TZ9A 1ZGLP 4KXBA 3PABA 3MQTA 4XTRD 4AYID 2CR0A 5BJTB 3PPEA 3OKEA 1QZ1A 3UJIH 3P0XA 3LN4B 4O51A 4OTXH 1HILB 2XWBB 3C6CA 1M7DA 3FCSA 2YYUA 1ZIAA 5I8KL 2J7LA 2BP3A 5D7HA 3DHUA 3ABLB 3MUJA 4HU2A 4DN3H 3D2UB 4YK4B 4L4TE 3MKVA 4YHMH 4LB3A 5HVHB 3LB0A 4X0VA 4Z7VA 3IBOA 4HQQL 3V9FA 1T96A 1SMDA 4JM2D 2Y5TA 4WDTA 4HJ0D 4LEOB 1SXNA 5IB2B 1OT2A 2PP9A 3NJLA 3ULVD 4HHHA 1H5BB 5DUJA 5ECJE 2DD8L 2PRHA 4LAKA 5I00A 1Z0NA 2A9NL 4DF9A 2AGTA 5K7JA 5E08L 3SGEI 5E8EB 4YFLF 3B2MA 2D2HA 4B5ZA 4D0BA 1RUPL 4P59L 4XWOD 4GI4A 3LV3B 4Y89A 3S3PA 2C0HA 1WCBA 4BCEA 3FO1B 5HHOB 3R4RA 2DZWA 4GFIA 3LZRA 4YJZL 1QSFE 2BOEX 3K8KA 3QM3A 1P1XA 3H6AA 4TTUA 5T9CE 2BVWA 1HNGA 3TT1L 3NTYA 1IFRA 5DJYB 3C8FA 4AYBA 1FJ1B 2P5PA 5DZ9A 5I1CH 3O0KA 4W7VA 2ISDA 5DZAA 4HPOL 2B3RA 4WCYH 1DJNA 1H09A 1HGWA 5B1BB 1NEZB 4WKZB 1Q72H 1M3IA 4A8NA 1ERNA 3MNWB 3RFAA 3CVBA 1EMTH 1XCQB 3KL3A 1N3NB 1SQ2N 3BX7C 4XO5A 3VFVB 3IGAA 4WWKA 4EI0A 1X39A 3IJIA 3D5OF 5HYQB 4Y9CA 4N2AA 1FNLA 3DIDA 4L8DA 1VBHA 1XIEA 3FU3A 4U3XA 3GLEA 2C1PB 3VXNB 4Y19B 4QLKA 3H4FA 4WW2B 2WWDA 3DBNA 2JIXB 4QGYA 1CCWB 4IL2A 4J2XA 4BEIA 4MBRA 2BZCA 2MOVA 1FWXA 3PP3H 4PR5B 4QPEA 1K1DA 1T99A 3BG3A 3L81A 3WD4A 1A4BA 1G87A 4CU7A 1T4WA 2ZWZA 2XGIA 2ZZ6A 1H6UA 4I0PB 1LDPH 4J3UA 1VGKA 4DKFL 5I19L 1UKOA 4MPKA 5ICXB 1VKFA 3NIFB 3LS5H 4Z3JA 4UDTB 4WRHA 1B0RA 2YGYA 3LRGA 2OXHB 5LO7A 5A1AA 4HGXA 4PUJA 3TVMC 2EECA 4WTZA 2EIMB 3FGCB 4XAWH 4M3JA 2E9BA 2A0NA 3M0MA 3IFOA 2KUTA 5EA0L 4ZMAT 3WS3B 4PJAE 4BWLC 3DRQB 1T04B 3S9DB 3R79A 1H0GA 4FC3E 2ADIA 4Q4MA 1WCQA 3MLTB 4QRRB 4O8AA 4IGBD 1I3GL 1T20B 3CVIL 3MV7B 1PQZB 1U8QA 3BE7A 2NSXA 5D38A 1E5AA 4JKNA 4F33A 1XI3A 1KKOA 3UTSD 2Y85A 3DSNB 1L0PA 3RAJL 5FFGA 3EF7A 4DOHE 6ENLA 1ZB5A 4OUEA 4G6JH 1UYWL 4AVNA 2EYSA 1VKXA 3DVGB 3VB9A 4NNBA 1V7ML 4IJBA 4LU5L 2GSIB 1DIKA 3CAVA 5D5MF 2RBLA 2CIIB 2A99A 5D5MB 1BEYL 1PBYA 3E6HA 3J07A 3QFDB 4YFLI 2WLYA 1KJ2A 4MNGE 5DMYA 4WKFA 3HCVA 3FMGH 1CI3M 5EL1A 4MNQB 5J5EA 2ARWA 3QC5X 5FJOA 4DGIH 5F8RC 4ZQKB 2I5YH 5EFDA 3NAAL 3TYFA 2G3IA 1CB2A 1FYHB 1L7TL 3MRRA 2OMNA 3UGRA 1I4NA 1EEZB 1OSYA 1WFTA 4GVGA 4PRHA 4OLYL 4KVPA 3AITA 3CN3A 5GGSA 2J75A 2JH2A 5CEYB 4Q6IA 3M0IA 3SDAB 5CJNA 2QVKA 4MWAA 1QUMA 3GMQA 3KYMB 3ZO9A 1HESA 2XXCB 3GTXA 4ALAL 4ZTXA 1C12B 2GIYA 1C9DA 3H7VA 1BVLB 1DUYA 5F89B 4NAEA 1FL3B 4UWMA 4DAIA 3G6JE 4X0KA 3I6LE 1WTLA 2JIWA 1LUCA 3L67A 4MCNA 1IGCL 2CHZA 2PI6A 1LO2H 1NCHA 2I5QA 3QUXA 5IHWA 4TUJA 1L0YA 3FL7A 3FUJA 4WNQA 5B22A 3QJVB 4BQ8A 2WWMC 2NXZD 1J18A 5LNGA 2XBDA 2Q2EB 5D1ZA 2J88H 1Y5XA 1S8DB 5H35A 2H8ZA 3IEBA 3SDOA 3MRCB 1WZLA 1JZGA 5MENB 4L4TA 2HVKA 3D18A 3R0DA 1RLCL 1EANA 3FJ4A 4DWSC 2JGYA 4WWKD 2BFVH 1NU5A 2PS2A 4PGCA 1FP8A 4XZWA 1CD0A 5IMKA 2X1QA 1SOQA 4KNQA 4BZ1H 5TQ2L 4EIZC 2BM3A 4I5UA 5E6RB 2CW6A 4XD4A 5DC2A 2I60L 4NM8L 3AREC 3WELA 3QZLA 1ZTVA 2D3NA 4YPGB 5CIPA 2WXJA 4DEWA 4LL4A 1NDYA 4UFMA 1G0CA 1PTGA 4OB5L 5F21B 1ZBVA 2J8UF 4LV4A 1L8PA 5E4AA 1QBBA 5ECVA 2J8UB 4K3JH 6REQA 2X30A 1F6AB 5AC4A 3NURA 3KVPA 1T03H 4AM0B 3CGTA 2FUTA 5AW7B 3I74A 4K5MA 1KB3A 4A22A 4J1UB 2DQFB 1KN4H 2WW8A 1ECYA 3MRPB 3URQA 1WDSA 2FB4H 1U8HA 1UT9A 3Q6FB 2WOQA 1XPGA 4LOUC 2H1PL 4IBLT 2DMKA 4GVHA 1TQWA 1RVKA 2QDGA 5JLZB 4N2IA 1DUZA 3GSNH 2EC8A 5B1KA 2DZSA 4GKTA 1OTUD 4U5KA 1ZS8B 2DUXA 1J48A 3FCTB 1GKRA 2J9YA 1AGEB 3O6FA 4M5ZH 1GQNA 3BEWB 4H1LH 1KM5A 2FX9L 5GRUH 5C7XH 2ZDSA 3W27A 5CZKA 4FFYH 2RDWA 5IRPA 1OD9A 4FZEL 1EDQA 2PSNA 2TRHA 5E8DL 4K7PX 1PNCA 4IMLB 1IGIL 1OCRB 4NC1E 2UWEE 4NHUA 1XINA 3MVIA 5MHSD 2GGEA 2C19A 2X0WA 3DX6B 1L9PA 5JMOC 4ODHL 1SR9A 4N2YA 4ONHB 5AW9B 1AH1A 4PRTA 4RE0A 5D2WA 3TEYA 4MB3A 1BYDA 1T6VN 3RKDC 4GFTB 4EEEA 1SZRA 1W6TA 1HU8A 3OR7A 1ULVA 3JWOC 4YGAB 5CC6A 3N9SA 3QWRD 3W6YA 2XETA 4D9LH 3NZQA 2DKSA 2BW5A 2ZA1A 5HNNA 1TETL 3CQIA 2WBXA 3FB7B 1P6AB 2MCPL 3KCPB 3K91A 4KZDL 5E2UL 5BRBA 3HV8A 4TUKL 4QXWA 3RFZA 3NCJL 5KW9H 4QS6A 1CFQB 5E2WL 2V9TA 4NQEB 2NX9A 1NEPA 2ZWKA 2XYCA 2YCIX 5F9OH 4OZHF 4OF3A 1RR2A 4M61B 1T6MA 4G8FB 4XWUA 4AVOA 4H0GA 1U58B 3FO2A 4QHNB 3PHAA 4XXWC 4D7BA 3UTOA 5D1QB 1JPIA 1PCWA 4IHCA 4UCGA 4NKIL 1EJ7L 4J39A 4NNYA 1S3TC 4UTWA 2UZXA 1VFTA 3WH6A 3DFSA 3CV6A 2KI6A 3V4VL 4HWEL 5CINH 4AXNA 3TA9A 4XNZB 5GSRB 1XO8A 5CEZD 1FQ0A 3R6IA 3RHWF 5J0BA 5I02A 1DVZA 3HFML 3HTWA 1S2AA 3SW6A 5EU9A 3RPTA 4ZSOE 2LTQB 5BW7A 1H63A 3OB8A 2OYKA 4CKVX 4WY0B 3BT0A 2XN0A 4KKXA 5GGTL 1HKMA 1OSPH 7A3HA 1TDQA 4MUPA 4G7EB 2VX7A 4XVDA 1F6PA 4S3KA 1X9RA 2OL3H 1S46A 2QR0B 4YOKA 3H3PL 1UQSB 2XTJC 5ID0A 1JEZA 3DO7B 1CENA 1SY6H 3L2LA 4XB8A 1AW1A 2FTYA 3PUCA 5I2IB 1IKFH 1MFAH 3HFMH 4F15C 4ZI8A 2VL5B 3MGTB 3S96A 4PTTB 2P47B 1A5BA 1QOPA 4XRCB 4GC3A 4Z7VE 4YDIL 2BGSA 5HAOA 2ROYA 1IT9H 1M2VB 3VE0A 5BU9A 5A6BA 3CBKB 3LMYA 5LXEA 3EPMA 3DH7A 4JANB 4WTXA 4RFOL 3CEPA 4ELKA 4AFYA 1U3HD 1Y0LA 4GG6A 1A65A 4XP1L 3PB0A 2ATKA 3TBTA 4PJ9B 5CSZB 4FRWA 1BXNA 1MRQA 3IKCA 1ZLPA 1UJQA 3QO0A 3O07A 3RO8A 1TXKA 2C1OA 3L5WB 3U2OA 3D4YA 2C13A 4HNOA 1QFWM 4BIKA 2HVJA 2XPGA 5GJPA 3ZBMA 3V0VA 2N01B 3L2IA 2QPSA 3WKML 1GS7A 5I1HL 4NQDA 4LVNB 3O2WL 4YSTA 5L2KA 2PO6A 2R1YA 3O45A 4HA1A 4RA0C 2G9HB 5AZEL 3AWGA 5IKCB 4P2QB 4F58L 1NY1A 1R0MA 3W2LA 1IGSA 1Z6KA 4QHUA 4E0CA 1WWWX 1FYTE 3D51A 3UO1L 2NY1D 1I2PA 3EOOA 1FVCB 4PLKC 2CEQA 4P04A 4UB0H 1CF8H 2WVSA 3FQTB 2I7SA 1XGTB 4G7YL 4HSAC 1Y1UA 4LSRL 1XXFC 4A2FA 4BBWA 4NGHH 5HPMA 4N22A 4MWAB 4HMEA 4OZGB 1I1YA 3NEEA 1OHLA 3G6DH 1YY8B 1B0WA 1EJ6A 2I32A 4P2OB 5C0BE 4G9DA 4O1DA 5DC9B 4WHCA 3MSYA 5AVQB 3LIUA 5CD3A 3KBFA 1FF5A 4I0CC 3K74B 2VDLL 1UZ1A 2XFWA 2XFGB 5AUMB 5D33A 3AUWB 3UYIA 1X4ZA 1UM5H 4WXZA 5JR1H 4PB5A 5HJGA 4NN6C 2FNWA 1DLHB 2CALA 4LNCA 4W9FC 2OV0A 5TE4H 2CZFA 4NBYB 5MI0C 4HJEA 4CSPA 1VCAA 1BQHB 5F9JB 1QNOA 2BOBA 2BINA 4OUOA 4XZMX 4YBQD 1S5IH 3L0KA 1CTOA 3BWSA 1J9YA 4O18A 2DQDL 5F3HA 3VFOA 1ASOA 3U5YA 4N0FA 1I2QA 4Y19E 3DZ1A 4UBDC 1CK0L 1CFMA 3KPTA 2V5BA 4K2UL 4LASL 5SWZE 4P5TA 1P48A 1T20A 3MV7A 4RRPA 3TH4T 4I9XA 1A1MA 3QNZB 4HMCA 1S7WB 1EOMA 3IJQA 1FGNH 4UMGA 1MHEA 3HAEB 3GUTB 1H3WM 1DWIM 1X98A 3AGWA 3T3ME 3RWGB 2O6CA 3QWQB 4ANKA 3TBYB 3WH5A 4MA3A 2PPCA 3JYCA 1E71M 3WIFA 5DJDB 4UDTA 4AV4A 1KN2H 4FNPA 1H2JA 1K5NA 3EXRA 4FJZA 4OOUA 2UZPA 2YL9A 5CP3H 2GGGA 3F7JA 2WQWA 3PBMA 1D6EA 3RNDA 3RCMA 4EUPA 1ZS2A 2Z7GA 3GB7A 5E9DA 3OB0H 2YZ5A 3AYVA 3TNBA 3IDGB 4F5CE 1PKYA 1WLHA 2V5MA 1N59A 3TN0A 5IWLA 1NUGA 4Y1AA 4HJJL 1SFLA 1TPUA 4HAGA 4RX0A 2O1AA 5HVHC 2GCYA 1EJXC 3IFLL 3IU4L 3VFMB 1JNDA 4Y96A 4D6HA 4Z2GA 3KLHD 1SO3A 3H2OA 5FJTA 4N2NA 2ZUQB 4L8DB 2P10A 1K2DB 1BGXH 3F6JA 2XJLA 1KFBA 4QXGH 3WUEA 1ZLVH 1T66C 4ZOCA 4PCKA 1G7PB 3VNJA 1UC5A 2WLIA 3UPBA 2E7HA 5DUMH 1ZVYA 1QOQA 1KXQA 1MRFH 1VZIA 1KIUA 3MLVH 3WV0A 1JUBA 3CUPA 4O02L 3MV9E 3CN1A 4WI6A 4ANUA 3U4FA 5D72H 2J6XA 1OP9A 1NANI 4NZFA 5HDQH 4WKXA 4WJ8A 5KOMC 3OW1A 1SHXA 3OZMA 4QTHA 1VR6A 1DVYA 3CH1A 3TZVC 5I1AB 3UZVB 3R1GL 1DVUA 2WM0A 3I3EA 4KDTA 4Y0GA 3TV3L 1A9BB 3V6ZA 3L95A 2B08A 3WD5L 1ONWA 5A6JA 3MUY1 3GUGA 3RWDA 1IQDA 2XA3A 1ZFJA 3MV8A 4A67A 2CPUA 5KTEL 5IY5B 1EF3A 4TR9A 3EIFA 1Z3NA 4G1EB 2ZYRA 1MSSA 3DI3B 4K7PH 1XG3A 1L7IH 1PSKL 3ASNB 2CK2A 3UA4A 3WG6A 2IW0A 1A6AA 5LUMA 4Z9KB 1I1AD 1U6AL 3ARGC 1ROWA 3QYCA 4RMBA 5D7EA 5KTEH 3LHAA 3H42L 5FAAA 2C18A 5I1JH 2ZUNA 2DQJH 1XCTA 3ZOAA 3GI9L 1M7OA 2JB5H 4G9FB 3KGSA 5C07A 4KUCD 1OFAA 3MO7A 3SBFA 1W5PA 4TMBA 2OTUA 3PNWA 4GXMA 5G4EA 1U8NA 5ADOL 4GIEA 2A9ML 2DWDA 4IRSB 3ENEA 4ODXB 4ESKA 4QT5A 4GXFA 1TZGL 1OADA 2OX1A 2VDLB 3CXFA 3RWHB 4ICWA 3ZKMC 4DZ8A 1ZDSA 5ISZE 2VDML 2DJXA 5CR1A 2FZ9A 1R9ZA 4E8GA 3EDJA 2CAKA 5MP6H 3OHXA 1FFNB 3ZFHA 2QELA 1UOWA 3PABB 3V7AE 2EE6A 3AYTA 3IJSB 3KPRA 3CBRA 3FQNB 5HJXA 3BQUA 1CXKA 1E8WA 2ZKWA 3A5VA 5LGXA 1PZAA 4U4MA 4RDWA 3OKNB 1MI5B 3NFPA 5DK0A 2V38A 4XMZA 3IVUA 3DV4B 2XTSA 1WIOA 4PS8A 3RZWA 2EDFA 5FK9A 3VFPA 4WJ5B 2R1KA 3TQPA 4D8AA 2GK1B 4YDJA 2V9UA 1WBZA 3QIUC 2IANB 5ESAB 1JZDC 3PF2A 4BV1A 5C6WH 2O7SA 2B7NA 5HGDA 3MWAA 1A7NL 3TVMA 3GSXB 3QQ3B 4YNGA 3VFPB 3B37A 4Q74A 1I7TB 2UUDK 1NBYB 1T80A 5D30A 2O26U 1T4KB 1WA2X 2Y7DA 3S46A 1BECA 1A1OB 4HPOH 4M1BA 3WTUA 3GU1A 4GP5B 4FKHA 1TVBB 1SVBA 4PTMA 1FZKA 4KTEL 4ALAH 3GLDA 1GTEA 1P43A 4A8LA 3B9VA 3SY6A 4IS6A 5F1IA 1Y7VA 1QD0A 1I8IB 4GUOA 4N6FA 3IETB 1JWUA 1A6WL 1DN0B 1L4IA 4QLLA 4LLMA 2V8ZA 1I7TA 3PWIA 4D6JA 3NEOA 2V5RA 3US9A 2MQCA 3RJOA 1R9FA 4E4PA 1SM3H 3BAYA 3LGDA 4XO9A 3JVGC 3LH8A 2XTKA 4XBJA 4JM2A 5HGHA 1GW9A 1W5MA 1D6VL 4FOUA 1WD8A 1OSPL 2PF0A 5FK9B 1R6WA 3FT3A 2OZNA 5MI0B 3JTTA 4IBZA 4PEKA 5HQEA 2VXNA 1UB6B 3PDGA 2NV2A 3U2SB 3HZVA 1US0A 1FFRA 1NOAA 5EY5A 2AXJA 5B21A 4O4WA 3BQUB 4PJFB 4FQXA 3FOKA 4JTTA 4NJ9H 5JIWA 3CMOH 3FJLA 2GG1A 5JHDD 1D7FA 1W1TA 1J2BA 1TTCA 3N42B 3EXLA 1EPVA 5J57B 1G9ML 3BWAB 4JRXB 3WFLA 3EYOA 3VAVA 3BVNA 3HIJA 5I3JA 3E8VA 3T0BA 4PJEA 4WIQA 2YD2A 1OINA 3T4AA 1ZE3C 1U8NB 3SDDD 4MWAC 2OGJA 3K46A 3VKAA 2EKGA 3ZGHA 2YL6A 4JQ3A 4Y9PA 3OD3A 4AQ8C 4M5ZL 3I6TA 3L23A 1EJOL 5ITBH 4AKQA 2R23A 3LHWA 4ZBCA 5DEFA 4E5XA 5IROC 4LCWB 5H8PA 4A55A 4LCWD 5I79A 3WF0A 1VZHA 5F97E 2R4SL 3VXOA 2OZ3A 1WA1X 3OV6A 4NRZA 1QR4A 5J11B 4HHWA 3G6MA 5C0IA 3HUJB 3QCUL 3MA7B 2PPEA 4G1EA 3VQ2C 1M03A 3BEVB 3Q9QA 3H3PH 4HDIB 3MP3A 1E9OB 1S7TA 1ZD6A 1M7UA 1OAQH 1DXFA 3LKPA 2BSSA 3IANA 3QRLA 2WMPB 4MXQD 1A0EA 4DBWA 4MMZB 3QDJE 2MCG1 1AW5A 1E9IA 3MCLH 1UMYA 2Y7NA 2H2SD 3D4GA 4L8SB 1ZGLM 1UR0A 1IX2A 2JCCE 3ARFD 5E8DH 2QULA 3TFBA 3QDAA 2DQTL 3L6FB 4FP1A 4PJDE 4F7EB 2OA9A 3AS2A 1SEBB 2FATH 1N59B 3K0YA 4KKCD 1AG0A 3TN0B 1UCTA 5DD6A 5EBMA 4RFNC 3MSDA 3BPNB 4LF1A 2H6PA 3ARGA 2Z2BA 4IBVA 2CBPA 2NYYC 3AB0C 4HYTB 4I1PA 3H8NA 3I9AA 1NWRA 4ACZB 3CLEL 3BURA 3FUHA 3OZ9H 3NQVA 1PTAA 1UH4A 1MW1A 4CQ9A 3ZE1B 5A2KH 3FXIC 4A7GA 3PAZA 1W9VA 1W5QA 3H7LA 5FF6B 3W24A 5KW9L 1DQDH 3SPJA 2FJHA 4MJ2A 2EG6A 1X7FA 3HPLA 3AMCA 3B06A 1A6PA 3VRIB 4OCSH 2WWKT 1XYFA 1JWMB 3FIGA 1MQQA 2J55A 4Y1AB 1KFJA 2VDOB 3N0AA 3DFHA 2UYLB 2NY1C 4JM4L 4L1DA 2HK1A 2AAVA 3MVSA 3VFSA 5DEZA 2MQ0A 1TUFA 2ED9A 3MUUA 3K6FA 5DRWB 4ENEC 4M3KB 4MSWA 5DD1L 1IEBB 3DVNB 4FN0A 3DV6A 3D69B 3SN0A 1N0XH 1FWNA 5ISZA 1K3UA 3RF9A 4LLUB 4O02A 5CBEB 5HR6A 2BIMA 5KVEH 2E8YA 1VHCA 2IKHA 3MRGA 4OCYH 4GYBA 1KLGA 4L4MA 1I9RH 1BM7A 1HH6B 1S5VA 1R3JB 4HK0A 3WUBA 2FBRA 2V5DA 3RWGA 3V5DA 3WE6A 4K39A 1QSZA 4PLJC 1KGCD 5HWMA 1TUXA 3H6OA 3N2BA 5DUBB 1AQKL 1BZ8A 3HFYA 2FVKA 4HCLA 4LPYA 3RNKA 2IO5A 4PGEA 4YTSA 1A4KB 3VFUB 2P0IA 1HYSC 4C6NA 3WUWA 2BSTA 2BVQB 2V17H 4AWEA 2YXFA 2J13A 5G5DA 2FZDA 3KDMA 1J1XH 4ZR8A 5C2BH 4FA3A 3B5GA 3ARPA 3V0GA 5E6IB 3WNLA 5E6ID 2ZT9C 5DLCA 4HHPA 5GNXA 2VDOH 3BOFA 1V02A 4Z0JA 2QCHA 1GGOA 3K4AA 3I02A 1O66A 5FYKH 1G7JB 3ITOA 2ILLA 4PMOA 2HRGA 2ODHA 3QNYA 5IMOB 1R3VA 3ZE1E 2WPGA 1ZHLB 3X17A 4G83A 1GT8A 2JF1A 1YSOA 4J3OC 1WAAA 2W0KA 1OP5K 4HUNB 4JGDA 4YHEA 4E2DA 4EOWL 3JWNG 2CXKA 4Y2WA 3OJ2C 1HHIA 3MOBL 1TJIH 3R7MA 4QF1B 1RZJL 1RVGA 2VKZG 5CSZA 5FSDC 1A3RL 3BKYH 4BK4A 3FVDA 3UBXA 2NCEA 3R0KA 4OFCA 5GGUB 2P46B 5FDWB 3SPCA 1C5CL 2I24N 3TZVB 5TFSH 1E6PA 4UV4H 1XF1A 3GIYA 3LA4A 3MWCA 2V2TB 5LXXA 1NKGA 3XISA 4P2YA 3DFTA 1G7MA 5AG9A 3GHSA 1FZOB 1CX9A 3CCHA 5EO0B 4XB7A 3SE3C 2X3CA 3IPEA 1EUTA 1RJCA 1P9MA 4PRPB 2Z7ZA 4LNVA 3X1BA 2NUTB 1R33A 2X89D 4L8BB 1CQYA 1R24A 2RFXB 3D8MA 3MC0A 4ZSOA 5GHWL 1ME9A 1LO5B 2IWKA 2RFGA 1IGJA 3VIOA 4JN1H 2F53D 3SODB 3KHOA 4W9GC 1PLGL 1R30A 2NSMA 1PGRB 3L5WA 5FCUH 2VW7A 1M6JA 5BYWA 2DLFH 4QM1A 4MAYB 1E4NA 2R1MA 2R24A 3QMTA 2ZNXA 3UYOD 5KVGL 1RA0A 1ICSA 2BZDA 2BX7A 1QNZL 1Z48A 2GL5A 3G18A 4QNWA 4GX9A 2PDNA 5T1MA 5J6GB 5F1KC 2FGWL 1E0XA 2A21A 1GZ1A 1O6SA 5INCB 2DLHA 4TVCA 3MRIB 1BKSA 4YCPA 4M4PA 4NP9A 4QRTA 2FQFA 5EDSA 2VFGA 3KTSA 1OB1A 4H6EA 3WQFA 5REQA 2VLLB 5EZIH 1GVIA 3V35A 4TULL 5J6HB 2OMXB 2CFFA 4FQXC 1RJQA 4N2KA 4Q9QH 3GW3A 5IJKA 1DWJM 2PTYA 3DO7A 1FUYA 1KPRB 4F2BA 5CWSB 4S3DA 1YDNA 2JEQA 1K9TA 3NTCH 1OX4B 2X1IA 1S78C 4W81A 2H3BA 4GQ0A 1BF6A 2ALWA 2Z4TA 2ZP8A 3VGFA 1YEFH 3SPVA 4KKZA 4GVFA 2I5GA 4OFYA 1G7LA 3BPLB 5IW1A 4E5TA 3SPGA 1U6AH 3E9UA 1PE1A 3WXVL 4AIZA 1NC2B 2AJZB 3M17A 4TNFA 1FWGC 5KVDL 3EJZD 4XCCL 4H1LA 3RWFB 2ONEA 4IIDA 5KS9E 1MRDL 4WHYH 2ZX5A 1T7XA 4YFEA 2A4ZA 1AHMA 1YE4A 3KH4A 3INOA 3PWPB 4N20A 1WZ1L 2DZXA 2EPKX 4S3AA 1ICPA 3UYPB 3WL0A 4IUOA 3RP1A 3MCG1 2GSEA 3C5SB 3GSWB 2DL2A 4YDLB 2KAUC 1K8IA 1OL0A 1T21B 2Y06L 4TUOB 4ZFOA 3F6LA 4KRNA 2ZRUA 4FLSA 3MCOA 4HUXB 5IR1A 3WF2A 3CXHJ 1ORSB 4OD2A 2DYRB 4S1RL 3DIPA 3GNOA 1WICA 3MYJB 2FL5B 1CE6A 4R7DB 3CPLA 4DVBB 5AYUL 3BGMB 3PGDB 5E9AA 4XQ6A 3GY1A 2VEMA 2A6DB 3LCHA 3AVEA 3MV8D 5I5IA 3JWNH 2BP5M 1GGBL 3ABGA 1UADC 5JLZA 2WSKA 4TNVF 3JWNC 3QOMA 5D7JD 4LOCA 1I53A 1MI3A 3FA5A 2YBRB 1JAEA 1EC7A 2BMKB 3QG7L 3OKYA 3AXIA 3HB9A 3GHUA 3U79A 3PV7A 4DGVH 4JICA 5EMKA 2WZPD 4ZQMA 4JZ5A 2UXFA 5HYSB 3UTSE 3UNDA 1EGJH 3VRJB 4C56D 5IQMA 4QAWA 1XT5A 3LKOA 2DMHA 1AS8A 1K3IA 3BE1H 1HIML 5DHVB 2OSLA 5EBLB 5C0CE 3HS0C 2EXYD 5AB0A 3K2MC 2GDQA 3KM8A 2IALA 4JG5A 2HPIA 3BEWA 3EJQA 3ANVA 1WVZA 2ZWLT 2IH1A 3O3BA 3P3RA 1U1HA 5KUKA 2NVAA 1GC1C 4UQ2B 3STLB 2W38A 4GY4A 4Z78B 4TPRL 2CERA 4I5BA 1U8KB 3NEVA 4HYWA 4MNMA 4QG6A 3ZHLA 3T42A 2DEYX 3GIVA 1NUNB 3NQ7A 3RKPA 3ITXA 1UTDA 1JK9B 4X7CC 5EIVA 4CC4A 4UTBH 3W82A 5ECUA 1F41A 4KGLA 1X38A 4YSSA 2CLKA 4NI6A 2HVKB 3HM7A 4QEEA 2OMUB 3MRHA 4OIFA 1OTUC 1BBJA 2B5IB 4KY1L 5GZOD 1S2CA 3EYPA 1UCBL 4FQHA 2FZ8A 4N28A 4PRDB 3A6OA 1ZBCA 4OVVA 1M71A 1U5JA 2ZWNA 2Y8VA 4YXLH 1KM1A 3ZDXF 3FSUA 5BRQA 3SKUD 3DYMA 2UY6B 1FCCA 1R3IL 1PG7X 3NYKA 4MVBC 1KOAA 2DDQH 1V6YA 1XIHA 3B8VA 1PMYA 1OXYA 1OGSA 2EAEA 4KJQC 4ZX4A 1RZFH 1YPZA 4GQRA 4I18B 4OLWL 5I5RA 4YDVA 3SY1A 1DQIA 3HR5A 2UXTA 4HIIB 4MNHB 3NJIA 6FABH 1UOKA 4KKBC 1RP9A 4MNQE 3R8BB 5EEZA 2NCMA 3BXNA 5EIIA 5F6HJ 1FHDA 4MCZA 4L05A 3PHQA 5E56A 5IHZB 3L5XL 1VLIA 2BNRE 5FO7B 3RWCA 2OGYA 3N4FA 2H41A 1CE6B 1J9RA 4XH2B 5AL8A 5BZDA 4BRVA 1C5BL 1O75A 1IGYA 3R19A 3BAXA 4R2GD 4G6CA 5SWSB 2GUOB 3BIAX 2V2XA 2X4NA 3DX2A