4PEEA

Crystal structure of a bacterial fucosidase with inhibitor 1-phenyl-4-[(2s,3s,4r,5s)-3,4-dihydroxy-5-methylpyrrolidin-2-yl]triazole
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
445
structure length
445
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKGTKSIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 162
structure length 445
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4peeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4peeA01
4KMQA 2X8RA 1QHPA 1BFNA 1TG7A 3RILA 1NWSA 2V3EA 4PUEA 4ACYA 3DECA 8A3HA 2WC7A 1WZAA 1NWRA 1DWHM 3WSUA 1CGUA 2OW6A 2G8ZA 5M3WA 2DQXA 4D6JA 1TA3B 3WF1A 2XGIA 1C92A 1BG9A 4JHZA 3AZTA 5DMYA 3K4DA 1MXDA 3MI6A 4WKAA 3VMNA 1GOIA 4GKLA 1C7SA 4F8XA 5IFPA 1V0LA 4H04A 4CU7A 3KWXA 3VMOA 1W1TA 2JALA 1ODUA 2V3DA 2CBUA 5FIPA 3OLEA 2CKSA 3ARRA 1PS3A 2WC4A 3CHFA 3T2PA 4B15A 3GH5A 1UWRA 3PZVA 2VVNA 7TAAA 4DM2A 1CTNA 1G1YA 4D72A 1QW9A 1UD3A 1B90A 2GSJA 2UY2A 2YDRA 4WSJA 3AIUA 5DEZA 3WUFA 3ZMRA 2BV9A 2D1ZA 3VX1A 5I23A 3IANA 3SURA 3CMJA 3WF4A 4ZFMA 3PZOA 3NSXA 3H55A 1EHAA 2YLLA 3SEPA 1VBRA 5A94A 4L4OA 1WDQA 3KZSA 1DWAM 2WANA 3TTYA 3VD7A 4AD3A 4GIAA 1J12A 1HNYA 4W7UA 2ZE0A 2CXGA 3TTQA 4P8XA 1D2KA 2XSBA 4W87A 2EXOA 1TR1A 3I3EA 3THDA 3AJ7A 1JDCA 2A3BA 4CGTA 4B9YA 1E55A 1E6SM 1GONA 2J77A 4IISA 4V2XA 5DT7A 1HJWA 1KXQA 4X0NA 1A3HA 2WMHA 1C91A 2WAGA 3CZ8A 4E2OA 1PJ9A 3PZTA 2F1BA 4M56A 4N0RA 2WSKA 3D4YA 1KBBA 3DDFA 4JL2A 3WEZA 4CKQA 3L4WA 4CD7A 4D6GA 4MB3A 3WH5A 1OWQA 1UA7A 1KXTA 1JF5A 5C71A 4HPHA 3BLKA 3VGDA 5ABFB 3T0BA 4P7LA 1KWKA 3VIPA 1QI0A 5E0FA 3W28A 1ISYA 3N9KA 4BZYA 1JZ6A 2CBJA 3B9DA 3RIKA 4HMEA 3PN8A 4H8HA 4BQ5A 2JFEX 3WNPA 1HJQA 4CCDA 3CPUA 1KQYA 5A95A 5I24A 2WK2A 1VEPA 4M82A 4GZIA 3AMGA 4W5ZA 1QW8A 5CSYA 4P8WA 1HJXA 5DT5A 1WO2A 1NOFA 3T0AA 1JF6A 2G3NA 3HG5A 3WMSA 4PUDA 2YL5A 3GXDA 1QNPA 1CLVA 2YL9A 1J10A 3EDDA 2PWHA 4W7WA 2ZX8A 4J28A 3H54A 2CERA 2VR5A 1UKQA 3TTOA 1E6XM 4AWEA 4ACZB 4D71A 2XN1A 5A2BA 4CCCA 3ZQ9A 4JFWA 1UHVA 3POCA 4P7OA 3THCA 2C8NA 2WVTA 2VURA 1CBGA 3UR8A 4FNTA 1AMYA 3RM9A 4BQ2A 1UWSA 3UG3A 5A2CA 4X0VA 4KWUA 3S5YA 5M03A 3IAQA 5BXSA 5HPOA 3HU7A 3DX1A 3VGGA 5HXMA 3GNOA 3A3HA 1XH0A 1ZL1A 1WB0A 3ARYA 8CGTA 3J7HA 4X9YA 1UWQA 1IV8A 1J0KA 2F2HA 1WP6A 5AYBA 2NT0A 2WM0A 2WMFA 2YDSA 5LA2A 3EDJA 1W3HA 3OZPA 2YKKA 4DUXA 3A6OA 4D6FA 1X1NA 3BAYA 3A24A 1H1NA 2Z1KA 4UZSA 1SFSA 1BQCA 3GTNA 1W1VA 3K8MA 1XV8A 4PYSA 3PZNA 3AMKA 2CESA 2X0YA 3LPPA 3CHEA 1QHOA 2DDXA 5HPCA 2F7QA 3SUVA 3EJQA 5EB8A 3ZOAA 1K9DA 3WQVA 4URIA 3NSMA 1J0HA 2YA2A 4PRWA 3L4UA 4LQ1A 4LYRA 1R8LA 2F7OA 4P7QA 2DIJA 3CHCA 1L8NA 2DT2A 3PZQA 4Q7NA 5I0DA 4W8BA 1KR1A 1XC6A 3F5LA 1U30A 5TD4A 3ARVA 4JHOA 5EFFA 3WNMA 4OKDA 3HMCA 4F9JA 1UD5A 3AIRA 2CHNA 3WF3A 3ZSTA 3ALGA 4J27A 1WDRA 4YHGA 1W9PA 3EJTA 3SCUA 4P8VA 4WIWA 2GJRA 1H49A 2ZXQA 2DT0A 1IZJA 3WQ6A 3ARTA 4AZ6A 4GO9A 3VIIA 2VO5A 4HPGA 2E9MA 1UUQA 3W53A 4M80A 5ABHA 2J79A 1R47A 2W92A 4DUWA 4HZ7A 1KGUA 3BUQA 1M03A 1UKPA 3HJEA 1KTCA 1BSIA 2WLZA 1JD9A 1MW2A 2FHCA 3HN3A 3OGVA 5JIPA 1US3A 1R75A 5E6YA 1JFHA 5A69A 1CXEA 1XGZA 2D24A 1E3XA 4U3CA 1HJUA 1AQMA 4PMYA 3K8LA 1CPUA 4PMQA 3NJ3A 1P6WA 4CN4A 1E1FA 3PZIA 3A47A 1JIBA 3AIVA 1C93A 1OSEA 3ZJ7A 5FCZA 3U7VA 2WMJA 4MNMA 2WVVA 4R27A 2AAAA 1Q4NX 2CNCA 3GXMA 4UQAA 1ZS2A 1QHZA 3WMBA 2EABA 2O9OA 1B31A 2CBVA 2X2JA 3LX9A 3PZMA 1QPKA 3VIOA 1BYBA 1GNXA 3W27A 3WH8A 4CVUA 3GDBA 4QCFA 2CPUA 3ZT6A 4RL3A 5A8NA 2EPNA 1I1WA 1CXKA 4MNJA 1KFWA 4AD4A 2WC3A 3HG3A 3DYOA 1DHKA 4JFUA 4OGZA 1JZ5A 5I77A 1BLIA 2FHFA 2BVTA 1JNDA 4QLJA 3DX3A 1UD4A 2YJQA 1CLXA 3QHOA 2VVSA 2JEPA 3KL5A 2G4FA 1J11A 2DPEA 1I75A 3BXWA 2YDQA 1W2PA 2J78A 3CO4A 1HT6A 2X1IA 1PIFA 1JXKA 1WNOA 2EQDA 4PCTA 4AEFA 5CLWA 5C70A 2VZOA 2PBOA 1E4LA 4OOZA 3BMVA 4RE4A 5E70A 3BAJA 4XZBA 3VD9A 3GBEA 2BXYA 3II1A 4MNLA 4UNIA 4NZJA 3VINA 2CEQA 5CLTA 5JBEA 4BQ3A 5CXPA 4NRSA 3EMZA 2F18A 4HA4A 1GHRA 3AROA 3K4AA 1C8YA 3VSVA 1GQIA 1C3FA 3QHNA 3NYDA 4ATLA 1UH3A 3FW6A 2QHAA 3WH7A 4EK7A 2EAEA 1EIBA 1GOWA 3WNNA 1LG1A 1W3LA 1E56A 1BVNP 3RJYA 3SCOA 2FHBA 3CUJA 4Z2JA 5BXTA 3CZLA 3BLPX 1GQJA 3W38A 1RPKA 4W8AA 4PMRA 4Z2IA 3VKKA 4C7DA 1CXHA 3LPOA 1HJSA 1V3HA 1W9DM 3PBGA 2ZX6A 3VUPA 2J4GA 1UKSA 1RH9A 3WDPP 1G5AA 5FL1A 3TONA 4MJ2A 4PMZA 7A3HA 4B16A 5KEZA 2WKLA 2J7CA 2NSXA 4DM1A 1TQVA 2E8ZA 1N82A 3W29A 1LLOA 4AYSA 1ISZA 3BAXA 4U2YA 3BH4A 1EDTA 1E6RA 1BHGA 1EO7A 3L2LA 4QLKA 1VRXA 1UKOA 3W82A 1QI5A 2EPLX 4FLQA 2QV4A 3SCTA 3WL1A 1ITXA 4OBRA 3O9NA 1HIZA 5D9PA 2D22A 2HVMA 4YN5A 2E0PA 4HU8A 1ZJAA 2UWFA 5A8PA 1HX0A 1V6WA 2D20A 4ZENA 1KQZA 1US2A 4TXEA 3AICA 4LXFA 3WN6A 1JYWA 3MKKA 1WZLA 1JZ8A 4DWSD 1Q6GA 2RGLA 1JYXA 4MADA 4OBSA 1HL9A 1JI2A 3WDQA 1JAKA 5I3DA 2PWDA 2ZUVA 1H09A 4U33A 3MUY1 2E40A 1BGGA 3ZJKA 4AZ5A 2UY3A 4P7RA 2DH2A 3S5ZA 4FNPA 4TUFA 1ZBKA 1B2YA 3CTTA 4EE9A 2BFGA 4QCEA 2G41A 1LL4A 3A4XA 3CUGA 2PC8A 2J7BA 1EQCA 3WNKA 3AXHA 3A4AA 1M7XA 3APGA 4BCEA 4S3JA 3DHPA 4OIFA 1VEOA 1KGWA 3CZNA 4JFVA 3EDKA 2VQTA 4ZXLA 1E40A 1NM9A 1CDGA 1TQSA 1D3CA 3LXBA 1GZJA 1V3IA 1NH6A 3VGBA 2VRJA 4CD4A 1JYNA 3GXIA 4FNQA 1TA3A 2JEQA 2WVUA 4UFJA 5GQBA 5JIWA 3GXFA 5IDIA 4KGJA 5HOSA 1M04A 2VJXA 3VD3A 2CBIA 5CPSA 3BAKA 3BVXA 2QMKA 4QFUA 4OZOA 2BHUA 4MJ4A 3M07A 3PZUA 3CV5A 1W9BM 1CIUA 1HF6A 5ABGA 3ZT5A 4PTWA 3WD1A 4A3YA 1JFXA 3FAWA 1LQ0A 3E1F1 2XPKA 5DFAA 1K9EA 1VJZA 4OJYA 2ZICA 4AMCA 1PX4A 3D4ZA 3LRMA 1BYAA 3WDHA 3L4TA 3NSNA 2XSAA 3CGTA 3VNYA 2WMGA 4ACZA 4PEEA 3MSDA 5CG0A 4ATDA 4MAVA 1G0CA 3OLGA 1QNSA 2BY0A 2PI6A 4OUEA 1JNEA 4H8UA 2W61A 2EPOA 5A6LA 2J7HA 4FK9A 2WNWA 1WDSA 1DEDA 4J3TA 3CZJA 2YL6A 1O6IA 3IJ8A 3BC9A 2D3NA 1HP5A 5E09A 4MTVA 1KTBA 4U5IA 1EOKA 4CU6A 4HU0A 3AQUA 2VNCA 5DO8A 3G6MA 1QNRA 1D7FA 2XFFA 4OOUA 3PZGA 2F7PA 1UR8A 1E5NA 3H53A 2FYVA 2FH8A 2GJXA 4JFSA 1ECEA 3SUWA 5D4YA 5D9OA 3SIMA 3WEOA 3AIEA 4W89A 1B3YA 3WD2A 1ZB5A 2O9TA 5KZ6A 1JYVA 4UOQA 1UWIA 2E8YA 6TAAA 3DX4A 4JCLA 4NF7A 5HBFA 1PZ2A 1W1PA 2IXVA 4DWSA 1PZ3A 1VEMA 3RO8A 3F5KA 3OLIA 4FNUA 3EBVA 1FFRA 3D3AA 3FN9A 5CPTA 1B1YA 1Y7VA 2WYSA 2EPKX 4AC1X 1QNOA 5A1AA 1MYRA 2EEXA 4H41A 4PMVA 4D6EA 3W81A 4W7VA 1XSIA 1ZBWA 1FHDA 3GNRA 3VVGA 4DWSB 4WJXA 3GH7A 2XVKA 1CGXA 4Z2GA 1AVAA 3BVUA 4JIEA 3WMCA 2YFOA 2O9PA 2WCSA 3S6TA 1LJYA 3D50A 3WKZA 4B3LA 2Y8VA 4HZ8A 1V6UA 1FA2A 3EDFA 2FDMA 2QPUA 3BUBA 2WZIA 4UFKA 1U33A 1E9LA 1TQUA 5JUVA 1LL7A 3WY4A 2D0HA 2IXUA 2ZX7A 1WKYA 4PMNA 4GI8A 3VDBA 1UD6A 2UY5A 1KGXA 2VOTA 1E3ZA 3U57A 1NP0A 4FLSA 4CU8A 3ECQA 4MB5A 2XYLA 2W62A 4J3SA 4NXKA 1HKKA 3VMPA 3BAWA 5E6ZA 1KR0A 3BGAA 3S2CA 1KWGA 4JL1A 3U7BA 5IFTA 1IZKA 1VFOA 1OD8A 3SUTA 5D9MA 2W5FA 3VIGA 2OSWA 3VIFA 4MAZA 1F4AA 1H41A 4TVCA 3D5HA 3AZRA 1Q6EA 4AZIA 2W63A 3SUSA 1TQTA 4LYQA 4PMDA 4U31A 4V27A 1E15A 3CZGA 1ZJBA 3AZSA 1MW3A 2WHKA 2QMJA 2GK1A 1BVZA 1HTYA 2V3FA 1K9FA 4S3KA 3CZSA 5A3HA 3L4ZA 2XG9A 3HZ3A 2X09A 3VIMA 3RPMA 3WNOA 4FF5A 2XTKA 4TTGA 3MS8A 5HNNA 2XVLA 1OD0A 3JUGA 1GVYA 1W1YA 3W0KA 3RJXA 4HP5A 4C7FA 5ECUA 1G94A 3GXPA 3AS1A 3GM8A 2VX7A 1B30A 1DWJM 1GJUA 2IGTA 5BCAA 1FH7A 3NIYA 2BHYA 1NP2A 3L4YA 1OGBA 5GNXA 4UQCA 3WF2A 3KE0A 4W93A 3MANA 1UA3A 1SR0A 1OIFA 2ZXDA 3VOCA 4TVDA 4M81A 1OT2A 3OGRA 2XVGA 4ZEPA 1E6PA 1X6LA 1MQRA 3WFLA 5ABFA 1UWUA 3KL3A 3DX2A 1V3KA 2BY3A 2F8QA 5BRQA 2O92A 4J3UA 1E4MM 4Q22A 5I78A 3FHAA 1GOQA 4GI6A 3MUAA 1CEOA 1WAWA 1OB0A 1ISXA 1ISWA 1QX1A 6CGTA 1V3LA 3OLDA 2FGLA 1ITCA 1EO5A 1CXFA 2CHOA 3N11A 3WY1A 3QR3A 4AY1A 3CLWA 3SCPA 2BS9A 3M46A 1EHNA 3AHVA 4MB4A 4AD2A 3QOMA 3ZT7A 4AXNA 1QWNA 3SCNA 4CD6A 4ATWA 3W6LA 4IUGA 2G3IA 2AOSA 1GQKA 2ZUSA 4JKKA 2ZWZA 4GINA 3TV8A 2J7FA 3FY1A 4QDMA 4J3WA 4KH2A 4U2ZA 2XM2A 2D0FA 3UESA 4ZE4A 2JE8A 3ZSSA 4KGLA 1VB9A 1VBUA 1JDAA 3UEQA 1E4NA 2CYGA 3I3BA 4AD1A 3BVVA 5LA0A 1XSKA 2E9BA 2DIEA 4AYGA 1XRVA 4GXPA 4UOZA 1UQYA 1MFVA 2WWCA 1UD2A 4D6HA 1Q6CA 3WFZA 2ZUMA 4QLLA 1DP0A 4MNKA 3FHQA 2J7EA 3AHYA 1T0OA 1GJWA 5I5RA 3VDHA 3VX0A 5E1QA 3GXTA 1ESWA 2VL4A 3VD5A 3EMCA 2WHJA 3VO0A 2CIPA 1TFVA 3CHDA 3T08A 1SYTA 3VM5A 5BXPA 5BXRA 1YQ2A 2BNJA 4XV0A 1VFMA 1KB3A 2F1AA 3AOFA 3MMDA 3LMYA 2WSPA 3N18A 2FH6A 4B9ZA 1ZBCA 2J8FA 1MXGA 5FL0A 1GOKA 3DC0A 3BUIA 4A3HA 1R7AA 1KCKA 3EJPA 1VIWA 4GZEA 3L2MA 4XX6A 1HVQA 3ZJ8A 4CUCA 4D6CA 4ZXOA 2CKRA 1O7DC 4HZ6A 2CITA 2X2HA 3EJRA 1R33A 4LGXA 5CPQA 3CUHA 3WUEA 1JZ2A 1W3KA 3N13A 2VX5A 2X2YA 1WPCA 2OYKA 2WZHA 5D8WA 1GOOA 5A6BA 3W6MA 4AZGA 1E6QM 3NDZA 1CGVA 2GDVA 2W66A 1WCGA 1UR1A 4BA0A 4GPNA 3IK2A 1DWGM 2J74A 3WH6A 1JG9A 4BS0A 2VQUA 1UR9A 1XH1A 2BY1A 3BVTA 2WCAA 1DWFM 2Z1SA 5I2UA 3TP4A 4GQQA 3WY3A 4UFLA 3BAIA 1R85A 5FOOA 4RE2A 1PBGA 1VAHA 1BG4A 4NZCA 2XVNA 3CUFA 1G01A 3UETA 1XYFA 3BUPA 2ZXBA 3WBAA 4NRRA 2OSYA 1HKMA 1V6XA 2BXZA 1BYCA 3N17A 4Y7EA 1B3VA 3UCQA 2ZUUA 1Q6FA 3MMWA 9CGTA 2CETA 1EXPA 2XGBA 3I3DA 1B3WA 4P8UA 3HG4A 5A6MA 1TQWA 2J62A 4DWSC 1K6AA 1E5JA 4D6IA 2EO7A 1PIGA 4PTMA 2JF6A 2XFRA 3AS0A 3CBWA 2FGZA 3L4XA 4AW7A 3AI0A 1BAGA 2EACA 3ARQA 1V0KA 5EMYA 3EDEA 2MANA 3SCRA 3L4VA 1UOKA 3T0DA 3WQWA 3WH9A 1MW1A 4CN6A 3FXYA 4PN2A 4TTUA 3KLKA 1J18A 4RE3A 2E4TA 2WVVB 2A3AA 2YOCA 1QWUA 1G9HA 3ARSA 4U5KA 2YIHA 1HXKA 2NT1A 4H8VA 2WMKA 2WCGA 1MFUA 3OBAA 4HMDA 1F4HA 1W9XA 1PX3A 2VCAA 1E70M 2VCBA 2W4XA 2D73A 3WD3A 1DWIM 2Q8XA 3AHXA 3GZAA 4AMXA 1MQQA 2WMIB 4B3KA 5A8MA 1CZ1A 1QBBA 3CC1A 4YHEA 3RM8A 4CN1A 3WIJA 5CGTA 1O7AA 1QNQA 3VM7A 3ARPA 1UKTA 3WUGA 1LG2A 2BHZA 2PB1A 1J0JA 4M8UA 5A6KA 4PMXA 3UERA 3T09A 1J0ZA 1GVIA 1GUVA 4F66A 3AS3A 5IHSA 3W24A 1E0WA 1XH2A 2OYLA 4PTVA 1JD7A 2J7GA 4UZUA 5C8BB 1H0GA 6A3HA 3PZ9A 1QI2A 4GQRA 3IJ7A 2OLHA 3VD4A 1UH4A 4UR9A 3ZR5A 4UFIA 3VIKA 1R46A 3GYCA 1EA9C 2OW7A 3AMLA 1RP9A 2V3GA 3OGSA 2ZIDA 2DT1A 3BUDA 2F61A 1HKJA 1B3XA 3CIVA 1K9TA 4H7VA 4F9DA 2OSXA 3EYPA 1UD8A 3ALFA 3WQ4A 5A6SA 3FAXA 1OIMA 1V0MA 4NSBA 2E9LA 2Y5EA 2QPSA 1JGIA 3MV11 2ZX9A 3WQ8A 2A3HA 2DSUA 3BCFA 4U3AA 1ISVA 4Z2KA 2PF0A 1JZ7A 2OWCA 2A3CA 3BLBA 1B0IA 3SCSA 2ZOXA 1H3GA 1UR0A 3VTRA 4PCSA 2DGAA 3LRLA 1CXLA 3EJUA 1TE1A 4W84A 1EQPA 4NZFA 1R87A 4KRUA 1VJSA 2WVSA 1YHTA 3T2QA 2VUYA 2VT0A 4AZCA 4ZE5A 2D23A 2WPGA 2XIBA 1WDPA 3EJSA 4IPLA 4J7RA 4BF7A 1SMDA 3WDRA 4HOZA 5I79A 1LF1A 1FP9A 3VIHA 1UR2A 1GPFA 5D9NA 1Z32X 2TAAA 5IXEA 4QAWA 4JKLA 3O2LA 4HOXA 1NQ6A 4AZCB 1UR4A 3ARXA 1OINA 3AHZA 4WF7A 3CZKA 4LPCA 3RCNA 3W37A 1QI3A 2VCCA 4WKHA 2BY2A 5FKYA 4HA3A 2CCRA 2VZVA 3A21A 1BF2A 4WSKA 4QP0A 4FMVA 3DDGA 4PMOA 1OGGA 3NCOA 3GXNA 1JDDA 4HMCA 3OIHA 4D1JA 3WUBA 3VGEA 4PSRA 1V6YA 2WHLA 1LL6A 2D2OA 3VSUA 1TUXA 3A23A 3PTKA 1HJVA 4CCEA 1J0IA 3N15A 1H5VA 5CJ5A 1OT1A 3M6DA 1E71M 1HN1A 1GQLA 4AMWA 1MQPA 2GUYA 1EDGA 3DX0A 3KL0A 3ZIZA 1HKIA 1H11A 4W5UA 1JI1A 1UH2A 4UCFA 1CNVA 1MWOA 1H4PA 3ZR6A 4DO6A 1LWJA 3CMGA 2WKGA 4LYPA 1Q6DA 3WF0A 2ZUNA 2DSZA 2WBKA 3G6LA 4YPJA 4E8CA 1GOMA 2GDUA 1SMAA 1TMQA 3NDYA 3HG2A 1U2YA 4HOWA 1W2VA 2WZEA 2W91A 1XCXA 2EJ1A 2WB5A 1KCLA 1W9VA 3AMCA 1BPLB 2XFYA 3KLLA 2G3JA 3SCQA 1B3ZA 3AHTA 5D8ZA 1OBAA 2XIIA 5AYIA 2QF8A 5E9AA 3WY2A 4WLCA 1ODZA 2XVPA 1OCQA 3QHMA 1NARA 5I6SA 3LPFA 4UQDA 5A6BD 3VGHA 1WZMA 3DYPA 1QBAA 5AY7A 3DHUA 2JIWA 4AZHA 5BROA 1E43A 4GZJA 3AIWA 4KRTA 4W86A 1R7OA 3MUZ1 2J7DA 3U5UA 3F4VA 1CENA 4V28A 3B9AA 3VDCA 3LXAA 4AZBA 1JL8A 5CSUA 2ZUTA 5A6JA 2V38A 3UR7A 2Y2WA 2WLYA 2A3EA 2HISA 3GH4A 2ESCA 4MDOA 1EOMA 2EBNA 3CZEA 3RM4A 1V3MA 2PWFA 2XHYA 3WEMA 1E6NA 4R5EA 4UTFA 2VZTA 4FNRA 4E4PA 2YBUA 4GO8A 3M7SA 1DTUA 1FOBA 3IGUA 4DUVA 1I1XA 2Y24A 1UASA 3ZJ6A 5JBFA 4Z2HA 3ZO9A 5AC4A 1UQZA 2JIEA 2YA0A 1CGTA 3O6AA 4NX0A 3DYMA 2WW5A 5CZKA 3WENA 4F79A 4AD0A 1QI4A 2V5CA 3MV01 4JFTA 2DT3A 1XCWA 1FP8A 1ZBVA 4ML4A 1FFQA 4W8LA 2DSWA 3AIBA 1C8XA 3RMEA 4CVWA 3IAPA 5AC5A 2RGMA 5EFDA 2WHMA 2ALWA 4WKFA 1BGAA 4D6DA 1XSJA 4HA1A 3WDIA 4M1RA 1NOUA 2VZSA 4Z2LA 2PWGA 3OA5A 1E1EA 4CD5A 5HDRA 3LPGA 3MSGA 5LYRA 2NW0A 1QOXA 2YFNA 4AIEA 3B8SA 4TOQA 2FE0A 2VZUA 3PHAA 2XWDA 1W9UA 4TX6A 1UZ1A 3OB8A 3CUIA 1E73M 3VILA 1XD1A 1MW0A 1MVYA 4IM4A 2OWWA 2X0HA 2VRQA 3VU2A 1GORA 4TVUA 1V08A 1TCMA 2AMGA 1E4IA 3AXXA 2J47A 2OYMA 1V0NA 3VPLA 5A8OA 3ARUA 1CGWA 2OWXA 4M24A 2VMFA 2GJPA 2YBTA 1UG6A 4NXSA 1E0VA 4TX8A 3D51A 1C90A 2VC9A 4HTYA 3VDAA 4C7GA 1PAMA 4P7NA 1VFFA 2UY4A 3WNLA 3A22A 3K1DA 1SZNA 1V02A 3RDKA 2O9RA 2ZUWA 1S46A 4PSPA 5M5DA 5DF0A 2J25A 5BRPA 3AMDA 3QOKA 3N04A 4N42A 5CGMA 2XWEA 3WDJA 1M53A 3CH9A 3SCWA 5E0CA 3WD0A 4DO4A 1CECA 1NWTA 2DSVA 3EMQA 2VX6A 3LRKA 4E8DA 4FLRA 1V03A 4UFHA 1WZKA 2J8GA 3POHA 3GNPA 1X6NA 1J9YA 3B9EA 1LWHA 4DO5A 3T2OA 5A8QA 4WK9A 3PTMA 4EAMA 5LA1A 2G3MA 1UWTA 4MPKA 2ZWYA 5BYWA 1TZ7A 4GI9A 2DH3A 4W88A 1OM0A 5GPRA 4D1IA 3WELA 2E3ZA 3FNDA 1RD6A 2ZX5A 3TTSA 4H2CA 1JAEA 3MMUA 1J0YA 1OGSA 1TVPA 4AISA 4J3XA 2VI0A 1B9ZA 1HL8A 4JCMA 2EADA 2Y4SA 2XM1A 4PBGA 3UG5A 5A6AA 1AQ0A 3N12A 2WMIA 1H2JA 1FH9A 3BCDA 1AQHA 3LXCA 3K46A 1WE5A 3WBEA 3NUKA 5F7UA 1UYQA 3QGVA 4AIOA 1CYGA 2EPMX 1XHGA 2VTFA 5FD0A 1TVNA 4A4AA 1CGYA 3D52A 4UFMA 1KXHA 3VIJA 4NI3A 1VENA 3AS2A 1R34A 1QVBA 4JKMA 3BSGA 1HP4A 1V3JA 2IUZA 4AEEA 4EANA 2C7FA 4JAWA 1M01A 3SCVA 3W4RA 4MDPA 4FNSA 2QLYA 4UQBA 4AZ7A 3AFBA 5M17A 3OZOA 3A4WA 4UQ9A 1BTCA 3GBDA 1BYDA 1IT0A 5A2AA 2V5DA 3U5YA 1W3JA 5BWFA 4MB1A 1E72M 4UQEA 3IJ9A 1PX8A 3BVWA 1FH8A 1EDQA 3TA9A 1V02E 3ARWA 4PTXA 4XUYA 2X2IA 1W32A 1FHLA 1W91A 1PEZA 3AYSA 1V6VA 4J3VA 2GFTA 3AYRA 2XUCA 1HXJA 2PBGA 5IHRA 2WWDA 3PTQA 1VF8A 3BSHA 4UOJA 3AISA 5JBDA 2JF7A 2GK1B 5GNYA 1NWUA 1GW1A 1EH9A 3MO4A 3TOPA 2D0GA 4AD5A 1JZ3A 2ZXAA 4JZ5A 3A5VA 2F7RA 1XYZA 1CWYA 3VSTA 1EGZA 4M29A 2VRKA 3VNZA 2X05A 1E0XA 2WBGA 1RP8A 1VFUA 3UG4A 1GHSA 3W26A 2D3LA 4BQ4A 3MU7A 5GNZA 2VX4A 3AIQA 5EBAA 1HVXA 1CXIA 2C0HA 7CGTA 2BVDA 3SUUA 3WL0A 3ARZA 1UZ4A 1HWWA 1KBKA 2GJXB 2BVYA 3W25A 2XN2A 2XN0A 4L4PA 4PMUA 5CQ1A 3BMWA 2YLAA 1R86A 2PWEA 2Y8KA 3WD4A 1C7TA 2B31A 1A47A 1ZU8A 2DSKA 3KEHA 2YA1A 1KXVA 3OG2A 4XB3A 2WXDM 1GCYA 4IPNB 1XD0A 2XJ7A 2VR4A 4LX4A 1L0PA 3WQ5A 1J01A 3ZM8A 3MUIA 1PPIA 4FLOA 2GVYA 2DEPA 4AIUA 3F5JA 4EKJA 4W85A 4XZWA 2W67A 4K68A 3K8KA 4CD8A 3AXIA 3VGFA 1E6ZA 1C8QA 1H0IA 3N1AA 1JZ4A 2YL8A 1JXJA 2J75A 5ABEA 1NOWA
chains in the Genus database with same CATH superfamily
1ID5I 1JSYA 3S2AA 3IJQA 3M0VA 2NY5C 3U2SA 1Z41A 4MZRA 1YY9C 1KFCA 2Z7KA 2CKBL 2HT4D 3VE7A 4PUEA 3S46A 4MD5A 4ZUTA 3DECA 1KF9B 4GHRA 4NC1E 4K8RL 4E0CA 3F6JA 5C0DA 3N2TA 4LRIC 5AZ1A 1O5QA 2OW6A 1C8PA 4LEEA 1K7EA 2B7DT 3IDYC 5M3WA 2JIXB 3QZWB 2P48B 3UO1L 1CI1A 4Z1CA 1P1XA 2VR9A 2XGIA 3CG8A 1EXHA 1C92A 4M43H 4QOKE 3WE6A 5HNUA 2FZ3A 4JHZA 4QRAA 1VD6A 4J4PD 1NAKH 3QUMB 4B7LA 1F6KA 2AKRA 2YN5A 4BCXA 2J72A 4ZO8A 1GOIA 4YHNA 3F7LA 4BRJA 4GKLA 3ULVD 2QQLL 4DZ5A 4CU7A 4F2FA 4H04A 1OKEA 5ETUB 3Q9PA 4O52A 3QHFH 2V3DA 4I9JA 3U2ZA 3QDJB 3VXTB 3LKRA 2K6WA 3OLEA 3HHRB 5JHDB 3IPFA 1Q66A 4WUIA 4GAGL 3ALPA 5IOBA 1F3JA 1QBLL 3UC0L 1D9KB 2GGGA 1YUKB 1CU4L 4ONFL 1XIDA 3RURA 1A3XA 4B15A 1KJMA 1UWRA 2YDAA 1U8MB 1WFJA 4M5SA 2FVKA 4QHLB 5IVXA 4NHCH 4XP5H 7TAAA 4J6RH 4GAYB 1F7BA 1G1YA 4XWUA 2QIWA 3WBWA 3LBOA 3MBXH 2UY2A 3VXME 3DVGB 4WSJA 1BGXL 1QAWA 3NQVA 1JPGA 4LRTA 2XV2A 1E9QA 4JDTH 4PJAA 3WUFA 3WLTA 4LCQA 1X5AA 4P57A 3WK0A 3OU8A 3NMEA 4JFXB 4QT5B 3PJUA 5DQDH 3K4WA 3WF4A 2RCSH 3CMJA 3EJZC 3QRBA 5DLLA 2REQB 1T4KB 2G60L 3MBWB 3AY4A 2V69A 3V4VB 4QSHA 3N40P 3PF2A 3MA9L 1XAUA 1EHAA 3DTDA 3ZUCA 2YLLA 3NSCA 4HHMA 3QUYC 3K71B 1D5IH 3BWAB 2CLPA 1EFZA 1FWXA 3FB8B 4HU2A 3FN0H 5CO1A 2GQ9A 3D69B 2XC8A 1GTNA 5A94A 3KDMB 2Z1BA 3QKZA 3AU0A 4XZ9A 1IF2A 3DI0A 3P9LA 4KDTA 3T0WA 1UEYA 3RTQC 4YJ5A 4PW3A 2AEPL 1B0GB 4M48H 4X99B 4ZOEA 3C0JA 1HNYA 4OUIA 1DVQA 4KZ0A 3DOSB 1KM6A 1G7JB 3TBWB 3LY6A 2EF9A 1KTLA 4HJ0D 2WSDA 3UTSA 2CLVB 1NCWH 3KLHC 5L8JB 4KCWA 4W87A 1ZTXE 4EDWL 4FP8H 3U6XS 1N5AB 5T5FL 3I3EA 3GAYA 3AJ7A 5DJ6A 4BRVA 2A3BA 4UTHA 3CLFL 4JTHA 3K0YA 4GRSA 4MXVF 1ZK5A 4HCRH 3DHMA 3IU3B 1KXTB 4B9YA 1E6SM 2YYUA 4GW5A 4HH9B 4PUUA 4AI7A 3C8DA 5IQ7L 3L0NA 2WJ5A 3NPSB 1Q72H 1K4DB 2VAAB 2YEVB 3GMQB 3UC0H 2FR4B 1K02A 3L0GA 3TROA 2CKNA 2HKHH 1XBRA 1VP5A 4EE2A 3JV6B 2F1BA 5J6GB 2A0LC 3HLKA 3P69A 3DX9A 4PWGA 2ACQA 2NLIA 3P81A 2I9LA 2QPDB 5HJGA 3ITOA 3HR5A 4AUYA 2EE6A 2WINB 1NCAL 3FU7B 5HHQB 5B7ZA 3RWHB 4MJIE 1KJVB 1QNZH 1YLVA 4CKQA 3W7CA 4M6UA 1P4IL 1QHQA 3GK8L 3STGA 1FIGL 4JJ5B 2YZ5A 1TJGL 2DBLL 4HD5A 3UTZB 4PLOB 4JFEE 4LVHB 43CAB 4E9SA 1OWQA 5HHMB 5D7HA 4K8HA 4RNIA 1TYEB 3SYAA 3IRCA 4LVNC 1ET7A 2UXVA 2GBUA 4H00A 4QO1B 4PRHD 3SHSA 3HW7A 3VGDA 3USZA 2EH8L 1ERNA 1N8ZB 1WTGT 4A1RA 1MFBH 1UWAA 1W3IA 3T4YB 4ZDHB 3FB6A 1S2VA 4UXDA 2WB7A 3VIPA 3NH7H 4H13C 5T3ZE 1NSNH 3EZ4A 1I4FA 1OD7A 1NKOA 2OMAA 3N55A 1EPFA 4UTBH 1ISYA 3FEQA 3N9KA 4N02A 4BZYA 4CNSA 4EVNA 3CFIC 4LLMA 5J6SA 4I9WE 2GAZB 4HMEA 1JCJA 3PN8A 4LDOB 4H8HA 1BMZA 2B0SL 1AFSA 1FHUA 4NAFA 4BQ5A 1NDGB 1QKZH 2FSEA 3H7BA 3KHOA 3O6MH 2WLIA 4U6HA 4CCDA 5M2FX 4GJTB 1WCBA 5CIPB 4IS6B 5I1JL 5ICZB 1JV5A 2WIIA 5BS0B 3NQFA 3M16A 4LEOA 2ISFA 3AWFA 3EYUH 2PO6D 1ZLVK 5IUCA 2P49B 4D0DB 4AVJA 1VEPA 2NQJA 4M82A 4DPQA 2Y5TA 3DROB 3AMGA 2FWOA 2OZ4H 1Q9LA 2GCYB 3LCWA 3NO5A 4YXLL 2WXGA 4OZGF 4A67A 3BX7C 5ALCL 2NW3A 3W2DH 1W3TA 1NICA 3CHPA 2F53B 5DD5H 4PUDA 3HRZA 1A4KA 2G5BA 3MROB 4MSWB 3GXDA 1QLRA 1HSBB 4PRNB 5KYWA 5GJSL 5DZNA 5F71A 1ZLDA 1CLVA 2YL9A 3MVIA 2ZUXA 5DJDA 2I7OA 5L4IA 3G0XA 4JHMA 5FJPA 3QG6A 3APDA 1UM6H 3TNMA 1A7NL 4X7DC 1MY5A 2Z31C 1URZA 3KPRA 3W22A 4GVFA 4U7KA 4B5EA 4DW2H 1YAIA 3AXKA 1OHQA 3HC0B 1JK8A 4IHBA 3SRFA 2XN1A 2XWRA 1E7UA 4M6NH 1KYAA 3ZQ9A 4JFWA 4PG9A 1XF2B 4IQDA 5JOFA 3POCA 4G70B 4L56A 3LZOA 4OT1L 3UGUA 3HLAB 2WVTA 4QF1B 1S39A 1H8SA 3BVNB 3N50A 1CBGA 1SO3A 2VURA 3KRSA 3NZ1A 1WFTA 1FKWA 4FNTA 3RWGB 1RLCL 4XNAA 3AYTA 4FTDA 2PNDA 2AEQH 1AG1O 1IM9A 4NC0B 1KJ3H 2CO2A 5A2CA 2GC4C 3WFHB 2ZZ1A 3RAOA 3UVAA 4DXKA 2G37A 4IRSB 4JVPA 4QT5A 4JO1L 1YMHB 5GGRA 3SPVB 4US6A 4NYLA 5C6MA 1TKWA 2V17H 4M4PA 3VFGH 4Q9RH 5BXSA 2C1OA 5HPOA 3NGBC 3VGGA 4EN3A 3CH1A 3B2VH 1WB0A 1HI6A 1BBJB 4WHYH 3UYRL 1TV8A 3GU2A 1NVMA 1IV8A 2XICA 3APMA 4LU0A 4BSVA 2IFFL 1ZPTA 4XMLH 5CCZA 4DBSA 2O6DA 1EO8L 2WM0A 4PJBE 1I9JL 5LA2A 3S9IA 3LOWA 4Y4KB 5J06A 1JUEA 1Q7ZA 1QPNA 1W3HA 2VP8A 3S6OA 3SZ8A 5EC1A 2JMRA 4NBYB 3NXFA 3EWZA 1M6UA 4AL8L 4D6FA 5BW7C 4IQLA 1D8CA 1X1NA 1YEDB 3DXAE 2EDFA 3F03K 3DEQA 1Q6LA 3DIVA 2R29L 3CDCA 4UZSA 3VFCA 1KV3A 4WJEA 3P84A 4RAHA 2HG5B 5E4EB 3HAEH 3K8MA 2VERA 5DHVA 1FORL 5IM7B 2IPKB 3PZNA 2P4AB 3BD3A 3FH7A 4IOSA 4L3CB 2X0YA 2EIJB 1JHLL 1ZRQA 1QHOA 5FB8B 5F2MA 1U95B 1KIUB 1X5KA 4ODHL 5HPCA 4D3CH 2RACA 4D9QE 3QWQB 2WB1A 3GMPA 1IGMH 2V8MA 4IIQB 3VE9A 3ULUH 3FSZA 1MH5B 2Z65C 4JTEA 2EVJA 1XLHA 3S88H 1W80A 5C0JA 3GNNA 2WLJA 4U1JB 4J5NA 1CT5A 4ZFGH 1W1A1 1I53A 1HHKB 5D7JB 4LYRA 4BFKA 1G7PB 2YD2A 1ADDA 4M7TA 4WDIB 2EC8A 5C0NC 4HS3A 2FGBA 1BJ1H 2UXGA 2HJFB 1CLZH 1Z69A 3MBEB 2DI8A 2VABA 3ISRA 3O4LD 5HDBE 4PG2A 1M7PA 2APVA 4HAKA 4TNFA 5I0DA 1YXYA 4W8BA 1L0QA 3SIZA 4JDZA 1L6PA 2HWGA 1LP9E 4ENEC 3F5LA 3F12A 4H9TA 3B2VL 1KFAL 1NBVL 3DX7B 3UYIA 4OFYD 1JNHA 3SDCB 3WLRA 1XI3A 3G5ZA 3PB2A 5IB2B 1R6VA 5EFFA 4NGHH 3FCSA 4NIYE 3HMCA 4YWIA 1LTDA 4OZIA 5IJVA 3MNWB 3AIRA 3C3UA 3W23A 2CHNA 3GTVA 1HESA 1GYUA 1UM4L 4PJ9B 5CSZB 5BQDA 2EGZA 2WQDA 4FXSA 1SM9A 4EVZA 4J27A 1J8HD 4HN8A 5C3IA 3KDOA 1TR7A 4LBUA 2P8CA 3FYEB 5GRUH 3RG1C 2DLEA 3KBFA 3I9IA 4JDZB 5HUPA 1GZHC 1QFUL 2UYLA 1JHLH 3QGKC 4HPXA 4LVBA 3WQ6A 3WLWD 3M7WA 2J43A 4MS8D 4AZ6A 1XGYL 1D8WA 2OP4H 1KDIA 1CYXA 1KUMA 3O3BA 4PMUA 1RJQA 5F1VA 3VIIA 1KBLA 2NY6B 35C8L 4N2DA 4HSQA 1G67A 2E9MA 1CFBA 4O4YL 5AOLA 2BIPA 3ATYA 4BCYA 3W53A 1UBPC 1LK2A 2YBGA 3PWPD 4FG4A 4NFCA 4FI7A 2HX8A 2F53E 5FO8B 2GK2A 4WY7L 1UC4A 2MOGA 3NA9H 4IOFC 3PP4H 4Y16D 1M03A 1UKPA 3J27A 1RI8A 2KZBA 4KROC 3SJ3A 3S37X 1LVEA 2K8MA 1KCUH 1BVKA 4GAFB 3KPMA 4NNCA 1T5WA 2LU7A 3M88A 3FLUA 4XAZA 5EIQA 1JCXA 5JW4M 3EOAA 3H2EA 3QPXH 5T1MB 3OGVA 5D70H 3D3VA 5ESVB 4HMNA 4UNLA 1R3SA 3CQKA 1OCNA 2Y89A 3ZS4A 4AVOA 5KUMA 2P42B 4JQ2A 1H8NA 3RWIB 2E9JA 3OAZK 4JPQA 3U0PB 3WAKA 2DWEA 1QA9A 1HJUA 3S5NA 2VXQA 4IGSA 4LF2A 4TN9A 3VU1A 3W74A 1TJGH 2ENQA 5C8JB 2ID5A 2AKRB 3IMTA 3GMRA 5CKAA 1WAPA 5JHAA 5E7BA 1QFWH 3IJDA 3LMZA 5FO8A 5CGBA 2WO5A 2GSMB 2AEOA 5GS0H 4LNRB 3WXWH 1F6AA 1GOGA 3RX7A 3AIVA 2R69A 3RVVD 2AXFA 4MDIB 4C4UA 4YHZL 1DOSA 3C2SA 2OLSA 5D2XA 5F1KC 4JE4B 2WZMA 3MN8A 1QG3A 3K0WA 1XGRB 4LCRA 2BVPA 3RCMA 2H0JA 1GCFA 2GITA 2RDUA 2EDKA 2E5DA 2C5DC 1DZ0A 2V8ZA 3USBA 3V35A 1J9RA 5ES4B 3IPWA 1EBHA 3ERXA 1MAMH 4XBPA 1RK6A 1FH2A 3LJ3A 1JTPA 3VWKA 4OFQA 2DLFL 4MNMA 2WVVA 4TR9A 2GGJA 1CICD 2AAAA 2AJZA 4RX4A 1RUSA 3V7AE 2CNCA 1A3RL 3GXMA 4HF5H 1IWAA 1A66A 1S9XB 4UQAA 2GIXA 2GJ6D 4H6KA 4OCYH 1PUDA 4XE5B 3A9IA 4BK4A 1L3WA 1X5YA 3QR1A 5ICYB 2CDGA 1ZS2A 2ZCLL 1QHZA 3CMFA 4ICCX 1R9ZA 4GYPA 3G6JE 5I2IB 2AXFB 4MDIA 1H60A 4JIPA 3G1HA 3LPWA 5AUMA 2CBVA 4ANVA 4MRBA 3ZR5A 1TITA 5LIKX 3E3QE 4N2LA 3WKQA 3RLHA 3NZ8A 4OFVA 2F5BH 2PYEE 3GDBA 3GZPA 4JPKL 4CVUA 3GJEA 3FUHA 3ZT6A 4ZQKA 3T1FA 3K71A 5DJ8A 5F4WA 3O1NA 2DZSA 3WUWA 1CL7I 4H8WC 1G7QB 2OTDA 1CXKA 4HUUA 2RDXA 4MNJA 2PTUA 2Q7YB 5KZMA 1NA8A 1LEGA 3BQ5A 4E5TA 1KFWA 5HAOA 1JDFA 1FFNB 3WUZA 3TV3H 5D37A 4DZIA 3TXAA 4HJWA 1UVQA 4OGZA 1G7PA 1RSYA 5KBKA 3PGCA 4MA8L 2R8SL 1ADOA 1WA2X 3KZPA 3BFQG 3O3DA 1G1KA 1MJ8L 2XPYA 4I85A 4MXWL 5EFIA 3VXUE 3PWPA 2FECI 4J1UB 4FQHA 2APBA 3UPRA 1JNDA 2RTTA 1EJOH 2VLKB 3DX3A 1XLIA 3VXQA 4YHLH 2JCCF 4KJQD 2Z0IA 4WJ8A 1UD4A 2BP8B 1JRBA 2F19L 5FJIA 4P2OA 1A1MB 1CDBA 1P6FA 2JKXA 5C9ZA 3EH4B 5KTLA 1YMME 1FZOA 1SJAA 2HBXA 1AYRA 4ONHB 3FO9A 4W9KC 4WI4A 2DPEA 1S7VA 3K81A 4I5XA 4EUPG 1INDH 4W6WB 4UT9L 2YDQA 2L7QA 1U1UA 3T4CA 5IWLC 4KIRA 1JXKA 4PCTA 4F8PA 5JO5A 4GG9A 7TIMA 2PGEA 1KPVB 5C70A 5CLWA 1ZLSL 2PBOA 2QDVA 4K94L 2EECA 2HKFL 4JFOA 2C19A 3EJYD 1KCBA 4LLWA 2CO3A 4RRPA 3BMVA 2NUTB 5DVMA 1LOSA 4YXKL 3GSVB 1RUAH 1LD9A 2HRPL 3QCTH 1GA2A 1ZLPA 4PH6A 3W7JA 4PJCA 2JCCB 1H15B 3PSVA 1FGVL 2G9KA 3D08A 3MV9A 4G6AD 1TV5A 3KMDA 4Y5XA 3GBEA 4BYHA 2WZ6A 5IB1B 4ALAL 3FUNA 5BMFL 4KDTC 4B95C 3LHYA 4GH7B 3KPOA 2WNNA 3MA7B 3GG1A 2CEQA 3LMJL 2CJSA 2NQ9A 4HWZA 3EOLA 2R0ZL 4U1HB 2GGHA 1EZLA 4OV4A 4NRSA 3VXUD 3NJFA 1G0XA 2B77A 3EMZA 2F18A 2ILLA 5ALBL 1FNAA 3GXUB 5T5FH 3VSVA 1TX2A 1GQIA 1THFD 5J1TC 3EOAB 3QHNA 4ZPTB 1A3ZA 4ATLA 1JCTA 3ALWA 1NC4B 3QCUL 3ECBA 1UH3A 3FW6A 3JWDL 4NWUL 4X6DF 5B38B 3S88L 2EAEA 1GOWA 3WNNA 2FWOB 1UP3A 2NY3D 1W3LA 3QUYA 4YHPB 4HPJA 1BVNP 4L64A 3RJYA 1XPGA 3MRRA 1PG7W 2P76A 3S2JA 2CUAA 1WYJA 2J6WA 4L1HA 3IJIA 3REVA 4RV3A 1EEZA 2HTKC 4GAJH 5ESQA 3NQGA 2FPYA 3SR7A 4N87A 3PPFA 1ETZA 1OWRM 4LE8A 1A6VL 1BFVH 3W38A 3RFAA 3CEPA 4PMRA 4GKZA 2GSGA 2DUZA 1M9SA 1W0WB 3ZTDC 5KYYB 3BZ5A 2PE4A 4I0KA 4FTVA 1LQ2A 1W1ZA 4L1DA 1S1PA 1V3HA 2YPVA 1W9DM 3ULAB 2V7HB 1EVTC 5HVFB 3L23A 3PBGA 1JRHI 3V4UH 3VUPA 5K9QI 4G1EB 1UKSA 3RBSA 2WJEA 4H9UA 4GBUA 1A9BA 4ODUA 3SOBL 3UYPB 3L67A 1EA0A 1AXTH 5AW8B 5KEZA 5CGYD 1YTKA 2NSXA 4GUPB 4EJ1C 1KA9F 4MFDA 1OEZW 4ZS6D 3DGDA 2E8ZA 1RMFL 1TZIA 4LS1A 1OT4A 1ZS8B 3F7JA 4KERA 1XF4A 4AYSA 6A3HA 4X99A 1XB3A 1S7XA 1MCOH 4G8GB 3U4KA 2EUXA 1G4EA 1UB3A 3ABSA 1AZCA 3GG7A 2VUOA 3BH4A 4X98B 1E6RA 1KBJA 4DCQA 5BUGA 1JPTL 5ENLA 2BSTB 1MCPL 2YWZA 3L2LA 1ULVA 1X5HA 4P4RB 4Z7WB 3BSMA 4QLKA 4LAJH 4BKLB 3UD6A 1UKOA 4AXWB 1IGYA 2J9XA 3W83A 3TBTA 5E2VH 5FKAA 4X0KA 3UAJA 5BPPA 2JBMA 4IX2A 1QI5A 4AJWA 1E27B 2MCPH 3VFPA 3ZKNC 2EPLX 1L7IH 2QV4A 4Z9KB 3R7MA 1QOQA 3PAYA 1UCBL 2YAMA 4OBRA 4N2BA 4FA8A 1ITXA 3VNDA 1A6PA 4X6BB 3EYUL 5D9PA 5AZ2L 2YXFA 2HVMA 3T0EE 1SXSA 5GZND 2PYEB 4GRLB 5EEXA 3VAVA 4JFDE 2DFAA 1ZJAA 3GSRA 1MFCH 2JKPA 5A8PA 2E77A 3EYQD 5D55A 5F9WC 4Q8OA 3UO1H 4ZENA 3SY1A 5E1IA 1AE6L 1JYWA 2CZFA 3MKKA 2NUPA 1WZLA 5H4YA 2BIMA 3AWEA 1Q6GA 2CIIB 3DFOA 2BHFA 1HL9A 5IMKA 1JI2A 2C1PB 3B7YA 4TSCL 3ZDYB 5F3BA 3WLKX 3TBVA 4NX5A 4CA4A 3Q48A 1DXEA 4JTLA 3BEVB 3C09B 3MUY1 1H09A 3LS9A 1ICQA 5LNUA 2GIMA 5IT2H 1BGGA 3AREB 3BWUF 4YFLI 4JIRA 3ZJKA 4JM2F 1YEHH 4EWND 1A8JH 4P8QA 5FO2A 4C6MA 3AT8A 4FNLL 5FECA 4DO7A 3OKOB 2R82A 1E0TA 3QS2A 4FNPA 5HYEA 3GWQA 2ITDA 4IP4A 4O1EA 1ZBKA 4NQXB 1K03A 2YRZA 1F8MA 3WO4B 5LHFA 3IVSA 1W8EA 3V6FB 4GUOA 3WMCA 1VCGA 3L8QA 3V0VB 1HKLH 5KAQF 2VC6A 5DBTA 3NRQA 1ADSA 3H9YA 3VXOA 4OD3H 2ZC1A 2A79A 5DJ0A 3T6CA 1BQLL 4A04A 1BFOB 4GKTA 5DHYB 4TQIA 1XIMA 1U8JB 3O2DH 5DHEA 3E0WA 3QEGL 5LB1A 2SODB 4XCNA 1PKLA 2EICA 2R2EB 3KOWA 3PB0A 5C6WH 1QNVA 1OE3A 4S3JA 1TQCB 4ZA0A 3LD8B 4GXFA 4G8GD 4O58L 5IEHB 2CO4A 3BFOA 1KGWA 4JPVH 4JFVA 4P9MH 4QRSB 3NR0A 1GTFA 4Y4HC 1H8LA 1AH3A 5ANME 1V93A 3B0PA 5GRJH 1NBYA 4V1DB 2IQAA 4CC4A 1I8IA 2GK0B 4GQGA 4OLYL 1FYTB 1TQSA 3QNXA 3LXBA 3NIFE 4GQ9L 1KIQA 4HEPG 4Z1PA 4AUBA 2R4SH 3UFIA 1XIBA 3BP7B 2ZZUT 4Z7VF 5DMGD 2JB5H 4M93C 3ARDB 1OARH 2IH1B 2FX8L 1S9KC 5JQ6H 1TE6A 5J12C 4OUUA 1TQBC 3W7DA 2R56H 4CD4A 1QTYT 4ORGB 4IFKB 3V4LA 4OFYA 4FQJH 4YHPA 2HRGA 1NIAA 1T7YA 1FWAC 5JIWA 2YGQA 3FJTA 1A5LC 4HETA 4NM8H 2V9DA 3U36A 3JU2A 2IEPA 2J3SA 2NY2B 2X4QA 4L23A 4JZOB 2F5BL 3DJSA 3TH3T 3QK0A 3ABQA 3C5QA 2QMKA 2CK0L 4NG3A 1AD0B 3WJJA 1QFHA 2GSGB 3PAJA 3M07A 3Q45A 2J1WA 1F3XA 4RGOH 5FOBB 4LSUH 1IL1B 3F7YB 5D4IA 43C9A 3PZUA 2BX7A 4N9CA 5CZTA 2DJ4A 1HQ4A 2VXNA 1IEBB 3ETBJ 4F5CA 3T3MF 3VTAA 3VXMB 4DJMA 3S1VA 3KYNA 1R9YA 1GC1C 2C13A 4TNVK 5JXEA 1MCHA 1UPPA 3VG9C 2BNQA 3MCMA 1ZV2A 1HEHC 5HJ3A 1F6YA 1U1HA 2AEWA 3RAJL 3ZT5A 4I7WA 3ZHDA 2EC9T 3OJVC 3QSKB 3WIHA 1CFTA 4NEHB 5T5FA 4OHQA 3RWCA 4A3YA 2CHDA 4R0LB 5DUPH 2ATKB 2P5ED 5HHNA 1IWPA 1VJZA 5G2WA 4F0RA 3W87A 4K3EL 2Q02A 2NXYB 1K8CA 1RUMH 2MQCA 1PX4A 4H4NA 2HYMA 4XC1H 3TIMA 1M68A 1AD0A 2VL5A 1VPOL 4NLAA 1BYAA 2GG1A 2Q2EB 5AFAA 3TN4A 2DW6A 3JTBA 1TQBB 4FFZA 5FSDC 2DQGH 4L1TA 3VXNA 5BMXA 3JZEA 3TYCA 2WXHA 4JTCA 5CBAB 2YCEA 1BCIA 4YEFA 2B0SH 2GTWA 2UVEA 4X6DB 4PEKA 2Y06H 1Q5MA 5KJ4A 4NQDE 1GKQA 2ISSA 3WK3A 3CGTA 3VNYA 1RUQH 1GVQA 2WMGA 4BDVA 2J4WH 2JB5L 4PEEA 3ULVE 1UZHA 2B14A 1MDLA 4PFMA 3TJXA 1H3WM 3U0TB 1EZVX 1QNSA 1RZIA 4MAVA 5I3HA 2XFXA 4QHUA 3I68A 4EPEC 4HU3A 2QT3A 2IQ9L 1FLRL 3I2CH 5A6LA 2OZ4L 4Z7QE 3ANVA 3M5ZA 2E27L 2AAMA 4YHYC 1F02I 4F91B 3WLMA 3I75A 2XZ7A 1KPUB 5DWPA 1GK8A 4A8IA 4JG0H 3E2QA 4PRHB 5F88B 4IQEA 2ICSA 5LHEA 4IRSA 5GGRB 2VDOH 2KH2B 2CO7B 3IJ8A 4DBDA 2NWSA 4W4OA 4EACA 5CBBA 4XP1H 4DGYL 4U5IA 2VN6A 4HQQL 4N0YL 4HU0A 4HFUH 5BUAA 3QDGB 3QPXL 2VNCA 3AQUA 4K7PX 3KLHD 5F6IB 1D7FA 1QNRA 2A7PA 1I1YB 3KXFE 4Q6JA 3HHMA 1WIUA 3BIBX 3U0TA 1EPVA 1AZNA 1SOSA 1W5QA 4XOCA 1WBZA 5L2JA 5HHPA 4QS6A 3FCSB 5LXXA 3RAJH 1KBVA 3H53A 3MRMB 1G6VK 4D8PB 3AG4B 4WO4B 2VN7A 2FYVA 1ZLUH 2QAPA 1KJVA 4PJ5A 3QCVH 2MCMA 2FH8A 2XQ0A 3E8UH 4XZNX 1RUML 1Q4WA 4IXXA 5LQBH 5EN2B 4YGVB 4K5MA 1MSPA 1E5UI 2CLZA 4JZNB 4HN4A 3WLQA 3ICJA 3WEOA 3WXWL 3WJSA 4KXCA 3EOBB 3DKLA 4A6YA 1B3YA 2GFBB 4PBXA 1CQYA 3GG0A 5HMDA 3RU6A 5H37G 2FT7A 2O9TA 1ETB1 3V16A 1NGPH 3DTXA 4AENB 2E8YA 3QLLA 1NFDF 3FO9B 1LL1A 2Z64C 4YSEA 1IIIA 1ZA6B 1SW0A 1KFAH 5EOTB 4TOYH 3KBNA 3P9MA 5KW9L 5G1YA 3F5KA 3OLIA 2LAAA 3LH2L 2WO2B 1QMLA 1L7IL 4FNUA 3ESUF 1U4EA 4EUPA 4IGHA 2QR6A 2X9WA 3HAEB 5TGBA 1M3JA 2I17A 3N44F 2X10A 1COBA 5HP5A 3DK0A 1X5GA 1Y7VA 4NRZA 1KCWA 2BRRH 1O68A 2VM9A 4OD2B 3IETA 3P6LA 4RAUA 2XN9E 3S8WA 2ZJSH 3F12B 1FVPA 2C9UA 4K8RH 3OYZA 3F04A 3T0XA 4H41A 3W81A 4ZNEA 4NNAA 3TYDA 4D6EA 2Q76B 1FDJA 1ZBWA 2UY7A 1G6CA 3VNJA 3KJ6L 3QFGA 2Q1EA 4Y2OB 3QJXA 3GNRA 3RG6A 3WQPA 3VVGA 2ESVB 4OGXH 3V7MA 4F0KA 3GH7A 4FI4A 2XVKA 5KVFH 1QFEA 3FV9A 3GQYA 3CVHB 4AIZA 4FLHA 4MXVE 1AVAA 2VQ4A 1KPRB 1SYVB 3ATBA 3PBVA 2CAKA 1OEPA 1UATA 3NFNA 5DRWA 3TV3L 1SFLA 3PUDA 4IT1A 2DAVA 2O9PA 3BP5A 2CZNA 3EHBC 4BZ1A 2GVJA 1DQVA 1NIEA 4TNWF 4XMVA 2VWEC 4PUWA 3GD6A 1UQSA 4B3LA 3FUIA 2Y8VA 4HZ8A 1J79A 1DCLA 4Z77B 3ZL2A 3KPRB 1KBPA 2VR3A 3KYNB 2ZCHL 2ISVA 2QPUA 2Y6TE 3BUBA 3KHJA 1PZCA 4P2OC 5FR3A 4TVPL 1U33A 4MNHB 3CCHA 4APXB 4JM0A 1HQRA 4LUSB 1X5FA 4JFQA 1BDYA 5HVGB 3VFTB 3RYSA 3NQKA 4JM2D 3K72B 5BRBA 2H32B 1LL7A 2XBDA 1A6WH 2AQNA 2VH5L 1FWBC 3M8OH 1R5WB 2NY6D 3HKFA 4O54A 2OMVA 5DURD 4YGAB 3VDBA 3UPMA 1IKNC 1KGXA 4W9IC 3IDXH 2UV3A 1O6SA 1H7OA 3AQDA 1I6NA 5F3FA 4MA7L 3RL2B 2YD8A 5FWRA 4IIHA 1ORSB 5LAXA 1XP3A 9XIAA 3TW7A 3GFUA 2XKUA 3I6KA 1VCBC 2IXQA 5AUMB 1QRQA 2XYLA 5H8PA 4DZBB 1U0QA 1UZGA 3VMPA 3KWWB 2BMKB 3BAWA 4IP5A 4C6FA 1TJIL 1OAZH 5EIIG 3FRUA 3NJNA 5DJCB 1WZ1H 3BGAA 4OLZH 1KWGA 4GJIA 4JL1A 3T05A 1WUNT 3GUTB 1FY6A 4PV8A 4UAOB 3B8TA 1S7QB 4C56E 1P7QD 2YSSB 4L0PB 4L8CB 3CBKB 1PHWA 5FAAA 1JGDB 1TJHL 3Q2NA 5MEOA 3BQUD 1S8DA 5KJ7E 3EA3A 5EGRA 1ZWIB 2C1HA 2GQ3A 2AQSA 3VIGA 4BZ1H 4S10A 4UIMB 4E41A 1EFXD 1MPAL 1R9XA 4Q7BA 4ZUUB 1F4AA 3E8VA 1Z3NA 4Y9AA 1S78C 5GGTA 4PGBB 3V6OE 3D5HA 5D1XB 3TPUA 3AZRA 2NZIA 4HISA 2Z93B 3TA3C 4FKEA 2W63A 3CEUA 4AZIA 5FYLL 3FJLA 2BIIA 1TQTA 3ROLA 4JY4A 3OVRA 3B8VA 3FQ2A 3QUZD 4RIRB 3H2MA 3H3KA 4N8VA 2ZRYA 4V27A 2ABBA 2FMOA 1ZJBA 4O8AA 5D1ZA 5HHOD 4K07A 4KUCF 1F61A 4UNTA 4MGXA 3UACA 2KT6A 3M41A 1K9FA 3OKDA 3FU0A 1T83C 3KS5A 3CZSA 4S3KA 3L4ZA 4KVPA 1IXQA 4DEWA 3ML8A 4LKXB 3H4WA 1CBVL 4W70A 5HGHB 2YXGA 5I00A 1QTSA 4XNMB 2Z28A 3L3IB 3HTWA 2ZNXA 1VGAA 3W9EB 5JO5B 3RVUD 1J2BA 4L1XA 4YGVA 4K6AA 3I84A 2QSCL 3EPMA 2CBQA 4XKYB 1RK5A 1VR6A 4PPTA 1ES0B 3WEXB 1H5BC 5B3SB 3NZ8B 1I1CA 2JCCA 3TYGL 1FQ0A 3E6HB 5DUBB 2K3TA 4KO6A 1OAKH 2EKSB 4HP5A 3RJXA 4C7FA 3ITVA 3AS1A 1E5ZA 2OXGA 5A3ID 3JRKA 1B30A 1JNJA 4WI3A 1DWJM 1J9QA 1GJUA 4H6EA 2Z4QB 2ICEB 1I60A 3QG7L 2TPSA 2EINB 4BH8B 2BOBA 5LKNA 3ULUE 3NIYA 4BKNA 3NFSL 3L4YA 3P80A 4JKPL 1OGBA 1BJMA 2P7TB 2WWMC 3A3XA 3ARGB 4WGVB 2G5RA 1RPXA 5JA9A 5DRCA 4OJFH 1IYXA 1WA1X 2W9LA 3OB0K 5DANA 4DF1A 1FZJA 3DETC 4NERA 4X9GA 1H6TA 5FYJD 1SR0A 5F44A 1UYWH 3ZTNL 1FKXA 3X1EA 3A6BL 4TVDA 3ULVH 4QXIA 4RW3A 3NSDA 3O4LA 4GFIA 4M81A 3MBFA 2V5MA 1GXEA 1OT2A 2PDCA 3OGRA 1ED3B 2YD6A 2XVGA 1PDYA 2HH0L 2BP8A 3SCMA 2NMSA 2R2EA 1W37A 4GW1A 1UWUA 1PZBA 4WUUA 4D2NA 2ATPB 3GS0A 4B9KC 2OXGB 3BSZA 4H8WL 2VGBA 3DX2A 4LCUA 2BY3A 3MACH 4FIQA 3SZKC 3ZTEA 4J3UA 1T2JA 4BE6A 2O92A 4HUXA 4Y2DC 1E4MM 4LLMB 1MRQA 3LGGA 4X2RA 4DT2A 3NOEA 4PJIF 2YQ2A 1FWSA 3FHAA 5KVEL 3VWJC 2NV1A 4R2GB 2ZOKA 4R3UA 3ZYJA 3MUAA 3WQVA 3UWWA 3GHRA 3PY9A 1RJZA 1QX1A 4QRUB 3P2BA 2ITFA 4LCWD 3KTSA 3C5SA 4PJHB 4NL1A 5HQLA 2NVAA 5ESVA 3N11A 2DMHA 4KK9C 3WLJA 2NUWA 1DLHA 4AY1A 3TYFA 3REWA 1KFGA 3DSNA 1MVUB 1RIVL 3S35L 4D0CB 1ZHAA 4PP1C 5IB1A 4HOMA 1F4WL 2W9DL 2EVGA 1PXGA 5LIUX 1EHNA 4RWHA 1ONWA 1XQKA 4AWJC 1Z7JA 3C0LA 1ZS8A 4EDXB 4I8DA 1Q2SA 5LBVA 3ZZQA 3SCNA 1FHVA 1RLBA 4HFUL 1GIGL 1D5ZA 3NIDE 4JFZH 4M6OL 3T6WA 4KFMA 1AIZA 5IB5A 1AW1A 3ARDC 1XBXA 1QPOA 1NGYA 4IUGA 4ZTOL 5JW3H 2ZUSA 2P5PA 4LWWA 4GMTL 5FOBA 1XLKA 4PLJC 1WEJL 5AYTA 2H26B 1K3UA 3KAAA 1OF2A 3PM6A 2R23A 3C6LD 4UV4L 1XB8A 3HS0A 1ITQA 2A4EA 3W7EA 2CPCA 1FTXA 4MCMA 2GITB 4OLVL 4U2ZA 2D0FA 5TE4L 4L18A 2Z1WA 4AEOA 1TIWA 2WGNB 3ZSSA 1AHMA 4XTDA 2G0LA 4R96A 1VBUA 1JDAA 3P9WB 1EEZB 4E9LA 3MMEA 2BK8A 3BVNA 4OF7A 2IDCA 3UEQA 2J73A 2MPVA 5M94B 5KITA 3BVVA 3QDHA 4JRFA 4KJWD 3JUZA 3GY1A 5D2LE 2NXGA 4HNLA 4TV6A 2GABA 3UXIA 4KV5F 4P2QD 2X4NB 1DQDL 4O2CA 4NKIL 3VCLA 4KKZA 4HLEA 1I3UA 1EJ7L 4UOZA 1LK3H 4AH2B 1QR1B 1UQYA 1UD2A 3VFVA 2A6JB 3C60C 4DVRH 1Q6CA 2VEMA 5HYQA 5E03A 4QLLA 2XLLA 2HWZH 2ALAA 2P8LB 3FHQA 4JG1L 1S9YA 1SZRA 3CDGA 4DI9A 2O61B 2X44D 3BJ91 1B3IA 1RZPA 4V33A 5I74B 4FG0A 2NUXA 3VDHA 1MRCH 4XBGB 3H6JA 1IZCA 5E1QA 1OSPL 3GJFK 1ESWA 2H8PB 2YWYA 3EMCA 1LWRA 2R1YB 4KFOA 2WHJA 1NUGA 3QIBD 3SE6A 4LGRB 3TYEA 3BH9B 3QDMB 3D2UA 4R3SB 3E80A 3PDOA 3QZNA 4MDJB 3T08A 1T21A 3BI9X 3VM5A 5F72S 1U2HA 4LP4A 4AK1A 1SYTA 2AF2A 3KZ8A 4OI8A 4K0OA 4B9GA 4XV0A 2ZKXA 4ZSOA 2AQ2A 3QFJA 4OLEA 2I56A 2QCDA 4P4KC 3GHEL 3K2MC 4GSDL 3UXAA 1BOYA 5GSRB 3N18A 3RVWD 2Z25A 4GNVA 2VLKA 4JRXB 1MUJA 1YEGL 5EU7C 4JN1H 5IEKB 1PB0A 3W2JA 2OPCA 4OGYL 1QOKA 2J8FA 3PWLB 4JMNA 2Q7NA 2WZ5A 2RQEA 5LXGH 3ORWA 4NJAL 1VLIA 4OLWL 5FL0A 3SO7A 3WIHH 2KPNA 4LGPB 4RLDA 5D7IE 3IV8A 2WM1A 3BUIA 3DHFA 4A3HA 3RFRA 1KCKA 5J11B 4L0YA 3C60B 4HWBL 4FP1A 3MCOA 2ZWSA 1E4WL 3CFCH 5EU3A 2DS4A 4JGDA 1MIMH 3L2MA 3IGLA 5IMKB 3RQ3A 3E0IA 1ACZA 2K1MA 1A6UH 4DGWC 1LUCB 4LCIL 4ZXOA 4KQ0A 2R83A 1YKWA 2CKRA 3HUJB 1S7SB 3GO1H 5B1CA 1O95A 2CITA 4Y0GA 2X2HA 3WIIH 1G6RH 1AQKL 5FEPA 1B57A 3GIQA 5D7IB 1JZ2A 2J44A 5L6YL 4OJCA 2WUBH 4M7ZC 2XH7A 1JRHH 2VXQH 1V54B 2IANB 3QZLA 3WFCL 4QAIA 4DNMA 2LOEA 5D8WA 1X7QA 4J3ZA 4Q8BA 1L0XA 5MERB 4CNIB 3FBKA 3INUH 1U92B 3OAYK 1OPGH 4JDEA 3WJMB 5C9RA 1OQFA 3E2VA 4JZOA 1Q38A 3GUWA 1U6AH 2DY3A 3FPYA 4IBSA 5D6DA 1N19A 5JZ7D 2P1FA 5FGBC 3F58L 2IW0A 3DG3A 1Z44A 1EHLH 2WBJB 3I02B 4E5XB 1OLLA 3KLAA 4BA0A 2HSAA 2OLAA 4KEVA 1XTLA 2JK5B 2J8TA 1BFOA 1ZGLM 2EYTA 4HUKB 3OMAB 4QSFA 5EMMA 4DBEA 1FVCA 4P0DA 4PJGA 1JG9A 3JWNC 1IU1A 3CUPB 1CX9A 3E5BA 1UR9A 1KM4A 5EU9A 2BY1A 4HHGA 1NANH 4MAYA 2WCAA 4Y9MA 3CFKA 3R0DA 1D2PA 5I2UA 4P2RE 3WIAA 1GAFL 5DEFB 3IEAA 1ILSA 35C8H 1QYGL 4WU7B 5CZXC 5IIEB 4KU1A 5E9DE 5LXGL 1N8IA 3H12A 3BAIA 3KPSA 3PHQA 4PTUB 5MKGA 1MRFL 3QJQB 5MEND 2NLYA 1FAKT 1VAHA 5GGSA 4US5A 1TX0A 2CH8A 3NT0A 1NCGA 4JQIA 4TULL 1NQKA 1UJQA 5GS1B 4K9JA 1M1XA 4WEVX 1Z66A 1O5PA 3O6FA 4ZXBC 2Q10A 1KIRA 1G01A 1TPB1 5AB3A 2WO3B 2ZSWB 3K6SB 4WWKD 3G08A 4HZLA 3N5AA 4QRTB 1W8OA 4OLXH 4TNWK 1QSVA 4IRSC 3OA3A 1AO7D 3SGDH 2VMJA 2YCIX 3TWAA 2DQEH 1BYCA 1CCWB 1B3VA 3UCQA 4KXDA 4GSXA 2ZUUA 1F13A 1PQZA 2FEDC 5J12B 1OOAA 5AHFA 1H1ZA 1F3DJ 5ABDE 5KVDL 3FYYA 3N6JA 4H8NA 2KLTA 5DQJB 3I3DA 4ZS7H 3DGBA 2OMNA 3HC3H 3ZDZE 4AQ8C 4LP5A 4EF3A 1B3WA 3I50H 4P8UA 5A6MA 4KZEH 2VLRE 1TQWA 4JO1H 3DUUA 4J3OC 5J7CC 3UR2A 2TMDA 4K5LA 1ZTMA 2GSIB 2PDBA 3DC8A 4HIJA 2JB6B 2F74B 2NLJA 4J8QA 4KQ3H 5LBSH 1I0DA 3CBWA 3UYRH 2VFFA 4P9HC 5CEYB 4JPVL 2ZSWA 1NC4D 1YAZA 4XAKD 4J2XA 1MNUH 4EPSA 2Y2YA 1A49A 2VDOB 1V0KA 4AX7A 1ZY9A 3HGRA 5BW7A 3EDEA 2QGHA 4QISA 1DSFH 2MANA 1A4JB 5HTSA 5IROC 5B3NA 4UT6A 12E8L 1HNGA 3WTUA 3CTLA 3OMIB 3G22A 3UZXA 1XCFA 3ILPA 1GH7A 3K4ZA 3NZHL 2F9RA 1PAZA 3LKPA 4CN6A 4LF3A 1BVNT 4PV8B 1VPYA 3L66A 1Q6QA 1GS7A 3HM7A 2P47B 4NI8A 3C8KA 1KC5L 4QCIA 1KM1A 4X50A 4CMMA 4HFWA 5KJRL 2NRDA 1B0GA 4MJ5B 3D1MC 5ACMA 2VLJB 2YOCA 3NZRA 3M0XA 4WZHA 2NQ5A 1QWUA 2EDHA 1AHWA 2AJUH 1G9HA 4MDJA 4HJJH 1RSFA 4U05A 3ZR4A 5D72H 5D1ZI 4OWGA 4XG1A 1VACA 4MMWA 1G5GA 2XG4A 3NQ2A 3SDXE 1HXKA 3P4NA 4XISA 1MJ8H 2X3AA 3MPGA 3UBGA 2CA4A 3UP8A 2AXJA 2WMKA 2ED8A 4WSGA 3TX9A 1OQOA 1MFUA 3E9TA 3NO3A 2DTSA 1ZSHA 2ZCHH 2VISA 4ZFGL 3PWLA 4KRMB 5I16A 4RSVA 2K0RA 4V1DE 3MJYA 3M5YA 1EP1A 1G7QA 1I8JA 2I5YH 3UJJL 1DWIM 1HL2A 2Q8XA 4N8VG 3AQYA 3C4UA 2YUXA 4PJ5E 4FFWD 5CWSB 3BZGA 4UOW1 2JSFA 4UM8B 4MJ5A 3TC9A 1MEXL 4A2RA 5EUKB 4H3DA 3W5NA 2E6PA 3RCYA 4D3CL 1CZ1A 3C5ZC 1OSYA 4XMKH 5KVGH 2SFPA 4WIQA 1Q6OA 4YHEA 1TB3A 3KDPB 3RM8A 2LLLA 2YPVH 1E6JL 4ZXBB 2BO0A 2HFEA 1O7AA 2E7FA 2RAMA 1MFBL 5DUMH 1E51A 2BVEA 1U1JA 1SN0A 3CN1A 3UGXA 4M3PA 3OZ9L 4I5RA 2LFEA 1HOCB 1NBCA 4LIQE 4MHHG 2FD6L 2UYLB 2OULB 1J0JA 1I8KA 3JVFC 4X5XA 5F21B 2GVEA 2Z6IA 3I9GH 1AXSA 2QFRA 5DD6B 4GMEA 3IAGC 5EBMA 2WLHA 3ZDXF 1N0LB 3DX8A 4G6JH 1GVIA 4HDIB 1PZAA 3EYSH 4POYA 3AS3A 2PP9A 3MRMA 3V9FA 4OAWA 1E0WA 2VKXA 5D5MA 2OYLA 5AYQA 3WD5L 3GBML 1JD7A 4M02A 2R91A 2B4CL 2OMWB 4UZUA 3EX3A 3FUEA 3I2CL 1OAYH 4MWAE 5E08L 3PZ9A 3EFDH 1NGZB 3BMXA 4L9LC 4A8RA 4J3OH 1RALA 3L9BA 2PU1A 3QNXB 3SGUA 3VD4A 1UH4A 3QNZB 1DJXA 3DV4A 4PS4H 3FRPG 4JG0L 3U6RA 3UTQB 4YLQT 1UWFA 3CHOA 5IBUB 3GSXB 4H26A 3W3BA 1J1OL 1EHKB 1HH6B 3K6IA 4PJ7B 5JIKA 2VXTL 1VFHA 3LY0A 4NFBA 2YPLE 3DX7A 3LZ3A 4HCDA 5C1MB 3FPXA 5I6PA 1RJLB 1RP9A 4KWWA 3HV8A 2R1PA 3MOBL 4YXLH 3TAKA 4WHBA 3UA3A 4F5CE 2D9CA 1HKJA 4N0FB 1GYAA 3CIVA 3MOQA 1RK1A 2BW4A 1H3XA 2NR6A 2UWEB 4QTGA 2OSXA 3WXVL 2PXYA 4BJHA 1H3UA 1TZ8A 3ALFA 5BV7L 5T9CE 1OAUH 1RUPL 5KVFL 5MHSE 3FAXA 5A6SA 4G7YH 4NSBA 2DLGA 5FA5A 4J2MA 2CDEB 3TA3A 3GDRA 1JGIA 2X4TB 1Y07A 2OZ4A 4DKTA 3HZMB 3WQ8A 4PJDF 3L7EA 2Y36L 4F7CB 1MCNA 1D7CA 2NQZA 1CG9A 4JS3A 4GSDH 4XSLA 1SJDA 3WKPA 3BVJA 3N4FA 5AKVA 1Q7QA 4AXKA 2Z8VC 3OWRA 3ZIMA 3EJUA 2FYYB 2XG9A 3KRZA 1SY6H 2F6KA 1U8QA 4H0IA 1DZBA 1XB6A 1R87A 1NEZG 3WIIL 5AECA 4UU9A 1IC7H 1NFIB 4J12A 3T2QA 1A5BA 3QV8A 4ZE5A 3MQIA 1NL0L 2WPGA 2WXRA 2R23B 4WWID 3DLQR 1WDPA 3SKJL 1RZJC 4JJOA 2J27A 4G7EA 4O4VA 4QR6A 3FC8A 2YEZA 2N01B 4IPLA 4ASTA 2PR9A 3O81A 4BF7A 5EBGA 3A12A 3CFCL 1XLLA 1A5UA 1U8HB 4IGBA 5FO9B 5IB3A 2IADB 3R12A 3WDRA 4DX3A 3MGAA 2IJ0C 1SJEB 2V2CA 4XO8A 1LF1A 1NFDA 3D46A 3BZFA 1BZ9B 1EHLL 3VIHA 2TRHA 4DSYA 5DA4A 3JYCA 5IUSA 4KAQL 5LLIC 3KBEA 1P6BA 1G7IB 2CRZA 5D9NA 1Z32X 2PCFB 1KPUA 2Q5BA 3KM1A 3D05A 3PGCB 1UB5A 1NGXA 2AMXA 1AD1A 4HUVB 3QFEA 4WKZA 4GKNB 3UTOA 1FP5A 4Z7NF 2Q2LA 4F93B 3REQB 1OG0A 4AZCB 2CALA 5CJQH 4HIIA 2BC4B 1OINA 4UMCA 5SWSD 4AC4A 3LHPH 4WHCA 2NV2A 4YHYB 5CCKL 3AHZA 1XIWC 3TPKA 3KPQA 3UJ2A 3ZZLA 2QL1A 4HWUA 1H1YA 1S4IA 3VFOA 1IGIL 1S5HB 2PYEA 1QI3A 4BFBD 4FMKA 5DWUH 2VCCA 4HU4A 2GYSA 3BYYA 4UINH 5LO7A 5FKYA 4PVMA 4MCZA 4BBWA 2G5WA 4HSOA 1WOAA 5HDBF 3QDMA 1WBXA 1MEWA 1S9XA 4M1CD 3UWQA 1DFBH 5HDQH 1CW2A 1I2RA 4LQFH 4HK7A 2HVJB 3OR7A 4FEMA 1IGTA 4C1NA 4NQVA 5J6HA 3P54A 4XOAA 5D1XA 3TPUB 4A7GA 4HBCH 4EIUA 3AYVA 2C71A 3C2RA 3NCOA 2Q7AA 2NR6D 4G6KL 4FJYA 4RDZA 3NSYA 4L4TE 3WUBA 5C9JA 3VGEA 4Z3HA 4HK0A 5EMJA 4F48A 1NDMB 3ABKB 4P06A 2DVUA 2ZOTA 3SDAC 2VFIA 1Q0YH 3VFNB 3KX6A 5ANMB 2QDDA 4PMJA 4RSYA 1L7TL 3EYOB 3MKGA 1EP2A 3MJ7B 3A23A 5IBLC 3K5RA 1W3NA 3A64A 4CCEA 4ZGYA 1I82A 3DX9B 1H5VA 3N15A 4OZ4B 3VKCA 5CJNA 4LAMA 3M6DA 2NY2D 4G71B 4LOUD 2E46A 4RGND 1FCVA 2VMCA 2VMEA 2CMRL 3QZOA 3RDJA 2Z92A 4MCYA 3WTVA 4IIGA 1PZ5B 1JFQH 2J8UB 1LRNA 4DJFC 2IF7A 1BWLA 3G0UA 1G9NH 1HFBA 1OP3H 1RV6X 4L9LA 3ZJAA 2CXEA 2V7NA 3V0SA 4NCDA 3L12A 3PIQA 1E4JA 5CJMA 4HJGA 4H26B 5TJWK 3TNNB 4Z3JA 3RGVA 5E24E 5RUBA 1RCYA 4PV9A 3TFCA 3TO2A 3ZDZF 1O5DT 4AEIL 2QQNL 4HEMA 1M04A 3ZR6A 3FO0L 3HPSA 3FK4A 1YY8A 3KOXA 4C5YA 4DO6A 1PYWB 3BLLA 4YWSA 3IRZA 3CMGA 5I1IL 4D0BA 3AADB 1TF4A 2AJYH 4IOIA 3GJFA 3CN4A 3W7OA 3MSRA 4MDRA 4LYPA 3WF0A 2ACUA 3QEHA 3NZHH 4LEQA 2C3XA 2J1YA 1JCYA 5E5UB 1UUOA 1BWVA 5EBUA 2NY1C 1CBVH 2ZZ2A 4OIIL 1UWGH 1TVHB 3BP5B 2HA1A 4PGDA 5E6SB 5AENA 1SVDA 4JEQA 1SMAA 4HJ1A 1VFBB 4NOFA 4PBVC 3VXRA 3FOMA 3O07A 2NUTA 3LQAC 4QWWC 1OZUA 2F15A 5CBJA 3BL3A 1BRLA 3HG2A 5C3TA 1UJPA 4HWBA 4JNZA 1SJVA 4AW4A 2AJUL 2UVFA 4JHBA 2R56L 2XZAL 4IRSD 4ZW6A 1W2VA 1M1SA 2W91A 1XCXA 2YMXL 4M1GH 4MJHA 2EJ1A 3CCHB 4PV9B 5HYSB 2BNRD 1R6WA 5CBIA 1U3HB 3IEBA 4OZGB 4XXDB 5IMOB 4F8NA 2PDGA 1BPLB 4M7KL 4NQCA 2XFYA 4WJ5B 4H8QA 5E6UB 4I9AA 4O1BA 1B3ZA 5AWNH 3RUBL 5D8ZA 3GBNL 4GW4A 4ZTEA 3P93A 4YJZL 5DS8A 1EGJL 2AGJH 3ARGC 4KO5A 3QM3A 4R34A 1GKRA 5AYIA 3UZZA 5CZXD 5AYXA 3UNTA 3PUOA 4KHTL 3CSYA 1MREL 2XVPA 5AW5B 4G42B 3V3WA 1QUPA 1T22B 2E9WA 2GC7C 3BWZA 3LPFA 3HQNA 3T4WA 4JUTA 5FW6A 3HG1B 1I9RH 3DYPA 4A2DA 2WXQA 3VK5A 3APTA 2WXIA 3AREC 1WSST 4J4KA 5DDHA 1AQKH 3NK3A 4JM2B 2JIWA 3TOYA 4NJJA 2XZZA 1YNKH 2I7GA 4JR5A 3B0UX 2VJ0A 1U93A 4LBRA 5AW4B 2EVHA 3WLHA 3AIWA 2QQNH 4XMLL 4JRXE 2MPAH 5I66A 2OT0A 4W86A 4R5TA 4AQAA 1LGVA 4HJEA 5T1KA 2HFGL 5I6MA 4G6CA 5HULA 1NGYB 3CM4A 3PWNB 1CENA 1JHTB 5B4MC 3C3NA 3VDCA 3F4WA 3LXAA 1C5CL 3VE0B 3QEZA 1A7PH 4JTDA 3EGXA 1K7XA 4D8ZA 2RHGA 4AZBA 3FN0L 4LRIA 4JY4B 2N4IA 5IROD 1A5CA 1D6EB 3SDOA 4LDCA 5EUOF 3U2EA 4XAFA 2NTFB 3IXTB 2WLYA 3K2IA 2OODA 3A3WA 2HISA 5T3XH 2NX3A 2JTYA 4F1SA 3GH4A 2ESCA 4MDOA 1JP5A 3ESMA 2NTSP 1QRNB 4G5AA 4XZ4A 4LVHC 2CXKA 3S4TA 1QLEH 4IGBD 4Y5VB 2J6VA 1V3MA 1V79A 1ASPA 1RIVH 1LEGB 3C2OA 1U3ZA 3H2CA 3PBWA 1AO7A 2J56A 2PU0A 1E9QB 4MG4A 1PWLA 4U1LB 1K6QH 2X4NA 3M7FB 4YHLL 1A7RL 4D2JA 3JSSA 4JJ5A 5D7LB 2XG4B 2AKZA 3QXBA 1F3DH 1TPUA 4YVVA 4YDJA 1DTUA 2YW3A 3VRLE 4ENLA 4ELME 1I1XA 3RLUA 1LILA 3FQTA 5C08A 4A38A 1OLZA 2FMNA 4MJIA 5EZJA 1Z6JT 3P11L 3RVWC 2V6AA 4Z2HA 3JWNH 3LN9A 3E6HA 1KIUA 4TRPL 2EAWA 2R24A 4P4KD 1JNNH 4XNXL 2X53A 5FJTA 4NX0A 3SKOB 3I6GB 2H45A 5CZKA 3FUDA 3WENA 4AV0A 5E94B 3D7PA 1DANU 4O2EB 5D09A 2AK1H 3F3HA 3EH5B 3DZ1A 3JS3A 1QPXA 2DQDH 3V95A 5CCJA 4XWGH 3RITA 1SUHA 1KEML 2AJXH 4XBEH 3MUGB 5F0JB 1FNEB 2VKZG 2IGFH 3B83A 2NZ9D 4NUJB 1ZBVA 1FFQA 2MJWA 4F15C 5C0CB 5HI3D 2D31B 1V7NH 2WIIB 1C8XA 3OAYH 5FV2A 4IOTA 5F7BA 3IAPA 4AH7A 4WW1A 5C55A 4BEUA 2ALWA 3S3PA 1V55B 3TWYA 1A2YB 3VGAB 1BYNA 2DQ6A 3LKQA 3V4BA 4KAQH 2DDQH 3VXUB 1DVFB 1XM3A 5L6UA 3UMNA 2I26N 5JZ7C 4PU2A 1U8PB 3DX8B 4CD5A 1QO3A 1MHHB 5A2FA 3LPGA 3ASOB 3PJLA 5AYUH 1KLUA 2W0KA 3HR5B 3EPNA 4MSWA 4PB9H 3MSGA 4ORIA 1AHWC 4Y9EA 2ADYA 1SBBA 1OK4A 2LGNA 1WUFA 2FZDA 2NOYA 2NW0A 3S2LA 1E8ZA 1QOXA 1FNEA 5HMSA 2YFNA 1DE5A 2Y25A 5J13C 5KZCD 3KYMB 3UDWC 1A3QA 3VXSE 4ZB0A 1DDHA 3E49A 1DBJH 2W60B 1MJJA 4OZHE 1IQWL 4XZMX 3OX8A 3SPJA 4R9HA 3NVQA 4JTKA 2IKGA 4N20A 5EZIL 1W9UA 2KPWA 4PM1A 4TX6A 1OTUC 5D2LB 1D5MB 3CAWA 1SO5A 1J5SA 4M51A 3GMLB 5ICUA 3OQEA 4L4LA 5I6NA 1DXIA 3RWDA 1E73M 3VYLA 2Y1HA 1MW0A 1KYDA 5GJMA 2HFTA 1YLBB 1PV8A 5E6ID 4NPJA 1OGTA 1OJXA 2VRQA 4AIZB 3DI2B 4QRNA 4EVNB 2XZQL 4IMFA 4RDQF 3QY6A 1A0DA 3OP2A 1TCMA 4Y8AA 1N7KA 1E4IA 1PCWA 4F3FA 1PCXA 3GU1A 1A65A 2DW5A 2OYMA 1I8IB 3IMBA 3UJIH 4H7CA 1OALA 2WBJA 3FMGL 3I02A 4M03A 1DDHB 4L29B 2R0KL 4QHPA 2YPVL 1MELA 4KK6C 1EP3A 1T22A 4MKMA 4PCYA 1CGWA 1ZE3C 3O8AA 3FT4B 3QEQD 2VMFA 1UIOA 5T1LA