4PEEA

Crystal structure of a bacterial fucosidase with inhibitor 1-phenyl-4-[(2s,3s,4r,5s)-3,4-dihydroxy-5-methylpyrrolidin-2-yl]triazole
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
445
structure length
445
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKGTKSIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 162
structure length 445
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4peeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4peeA01
4PMNA 1WKYA 2XPKA 1H5VA 1JIBA 3WNKA 1CENA 1W2PA 3RILA 5JIPA 3DX0A 2JFEX 2WKGA 2OLHA 1LL6A 3A23A 1NM9A 3CZSA 2ZOXA 3SCNA 2XSBA 1HP4A 4UFMA 3WF4A 4CCCA 3BVXA 2GK1B 1E40A 2FGZA 1L0PA 3ARTA 3W38A 1RP9A 3AYRA 3CUFA 1CXHA 3RJYA 3GXMA 1EA9C 2FHBA 2CYGA 1KWKA 1TA3B 3AMCA 1J11A 3NSNA 2J7GA 2D2OA 3N9KA 4PRWA 1NWUA 2F7RA 3N17A 3SUSA 3GM8A 3WEMA 4OOUA 4AD2A 3VGBA 4E4PA 4P8WA 2JF6A 1VJSA 4UTFA 5CLTA 1GCYA 3VMPA 4HOZA 3SCQA 4E8CA 6CGTA 3GBDA 3D3AA 3S2CA 5D8WA 4UOQA 1H09A 2WCSA 4X0VA 4AIOA 1CGUA 3WMBA 1TG7A 3WH7A 5DEZA 1C91A 1BYCA 2ZX6A 4JCLA 4UFJA 3H55A 2E0PA 2VZUA 5M03A 2A3EA 2V3EA 2XFYA 3AMGA 3OA5A 1PAMA 3VX1A 1CPUA 2VX5A 2BY0A 1OCQA 5CQ1A 1EO7A 3HMCA 1AQHA 1DP0A 4ATDA 3NUKA 3A47A 3RJXA 2YFOA 2J78A 3IJ8A 2BXZA 4HA3A 3CV5A 4RE2A 3PTKA 3WY2A 1WCGA 4D6FA 3VOCA 1UKPA 2WM0A 2VRKA 3F5LA 4AD0A 3W37A 4F9DA 1GORA 1NARA 1QHZA 1KGUA 1GQIA 1UG6A 2DSUA 2J75A 2VT0A 1UH3A 3QOMA 1QNOA 2DSKA 2OSWA 3ZQ9A 1PZ2A 5BROA 3CMJA 4B3KA 1CGVA 1UD5A 2WXDM 4H41A 4OUEA 1CXIA 2WZEA 5A2BA 3NJ3A 1CLXA 3SCUA 1SYTA 2RGLA 1GOMA 2QF8A 4N0RA 1QNPA 4UFLA 4UOZA 3DYMA 3UR7A 4KGJA 3CZGA 5CSUA 5IHSA 4MNJA 1UR1A 1J0HA 1RPKA 2WBKA 1WDSA 4JFSA 3BCDA 3BMVA 1UKSA 4P7QA 5LA1A 4AZCB 3EYPA 4ATLA 3RIKA 1XD1A 1MW3A 2GSJA 2VCAA 3AHZA 2E9MA 3AIEA 4DO6A 1R46A 4F9JA 3DHPA 4DM2A 1BSIA 2BHZA 3FAXA 3WUEA 1B30A 4UZUA 4N42A 4QP0A 3GH5A 2D1ZA 1JYNA 3CC1A 4PMRA 2J7DA 3AHTA 2VZVA 3VIHA 1QW8A 5A8OA 1HIZA 2JALA 4NXSA 3WH6A 2W66A 1B31A 1OD8A 1Q6DA 1B2YA 1LG2A 1CXEA 1E4NA 4MNLA 3VTRA 3ARZA 2EAEA 3T2OA 1ISWA 1E6XM 3OZOA 4NXKA 1IV8A 4Q7NA 3WF1A 4H04A 2GDVA 2WCGA 3RDKA 1IT0A 1C90A 1KXVA 1HKJA 3OZPA 3VGEA 4S3KA 3WIJA 4W85A 1EOKA 1QVBA 1EHAA 5AYBA 3LRKA 3BXWA 3AZTA 3AHXA 3CUHA 3WBEA 2WAGA 2XJ7A 2VQUA 3VIIA 1MFVA 4NRSA 4QDMA 3GNPA 1UASA 4D72A 1KXQA 2XVLA 2YDQA 4GQRA 4LXFA 2YOCA 4H7VA 3MSDA 3EMZA 4GZEA 2EADA 4FNSA 4V2XA 3QGVA 5JIWA 1VIWA 2V3FA 2ZUVA 3VKKA 1KQYA 3J7HA 1BHGA 4YHEA 3EBVA 4W8BA 1Q6FA 5D9MA 1CLVA 2E8YA 1TVNA 1JG9A 1MQQA 2XTKA 4EK7A 1D3CA 3FHQA 1WDQA 3WY3A 5I23A 4AMXA 2EXOA 3WNOA 3PZGA 5E9AA 3K1DA 2GJPA 1U33A 4M1RA 2DH2A 1GOWA 2G3MA 4D6DA 1LWJA 2J62A 4F8XA 2F2HA 2VCBA 2YL9A 5HPOA 4FNTA 1RH9A 4UFHA 2DH3A 1KBBA 2F7OA 4AXNA 5A6BA 1JDCA 3AQUA 1ISZA 1C93A 1C92A 1VFFA 2J7HA 1Z32X 5BRQA 2Y2WA 4C7DA 2YA0A 2WB5A 3AICA 1PX4A 5CLWA 2DSVA 3ARRA 4P7NA 5IFPA 3WDIA 1HKIA 2WHLA 3VM5A 5TD4A 2FE0A 3K8MA 4RL3A 2GJXB 4J27A 3L4VA 3IJ9A 3WSUA 1S46A 4MB4A 2VI0A 4DUWA 3LXCA 2VMFA 3MO4A 2VRQA 3VUPA 2CITA 2O9TA 2G3NA 3CZKA 3VM7A 2IXUA 1O7AA 4AC1X 1VEPA 4D1JA 1J0IA 5A6MA 1NWRA 1W3JA 3IAPA 3AIQA 2WC7A 2CIPA 2EJ1A 2WWCA 5A69A 2CBVA 1EGZA 5BXTA 3RM4A 4LGXA 5C8BB 1XV8A 4HPGA 1TQTA 3AFBA 3ZJKA 2A3CA 1NOUA 4ZFMA 2WW5A 4FLSA 2G8ZA 4FF5A 5CG0A 2MANA 3BAKA 3KEHA 4WKAA 5GNYA 1QBBA 3EDEA 2YDRA 3E1F1 1WP6A 1GJWA 4P7RA 4PMYA 1B3XA 1DTUA 3LX9A 2WANA 3AZRA 5BXPA 3CZ8A 4U33A 2XVGA 1MXDA 1C8QA 2CKRA 4UQDA 2Y8KA 1AVAA 1V0KA 2TAAA 1ZBWA 5IHRA 2OYMA 4HZ6A 4XB3A 4JKLA 1R7AA 2FGLA 1XSKA 2HVMA 4Q22A 1B3YA 4H8UA 3EJSA 3WQ6A 3VIPA 3N13A 4C7FA 2AOSA 3BUDA 3U5UA 1JZ5A 5GNXA 1QWNA 2IUZA 1XYZA 2X09A 3KL3A 4DO4A 4AD4A 5BRPA 3FN9A 3HZ3A 4B15A 2WLYA 2ZWZA 3VD7A 4MDPA 3WMCA 4AY1A 3WQ5A 2O9OA 3BVUA 1J0ZA 2FDMA 4GI9A 1DWFM 4AEEA 4R27A 2EABA 1QPKA 3U7BA 1PS3A 1FH8A 4NI3A 3ZJ7A 4JFUA 4AMWA 4OIFA 4P8VA 1QW9A 3IANA 3UCQA 4JCMA 2WLZA 3GXNA 2BY2A 2W67A 1E3ZA 3N18A 1DWHM 1B9ZA 1V03A 3W82A 1B3WA 3A6OA 4PN2A 5KZ6A 2OW7A 1F4HA 3FXYA 1WZLA 2A3BA 4HZ7A 1ZL1A 2ZXQA 3MUAA 3UG3A 3PZIA 2HISA 1ZJAA 4LPCA 2E8ZA 4OBSA 5GNZA 4V28A 3AMKA 3CUIA 2XHYA 3PZUA 1VEOA 4MB3A 3RM9A 1DHKA 4HMCA 2XFFA 2UWFA 1UWUA 2VX7A 2GK1A 4MAZA 2AAAA 3THDA 4PSRA 1HJUA 4URIA 4LYRA 1TA3A 5FOOA 3D4YA 1GOKA 1ZB5A 3DECA 4M24A 1V6XA 3RCNA 2BV9A 2J77A 3BLBA 1KR0A 3CHFA 3L4TA 1J0JA 5A8QA 2JEQA 5JBFA 1TFVA 5I0DA 1B90A 4A3YA 5LA0A 4IM4A 3AISA 4HMEA 3GXPA 2J79A 1E6NA 2UY3A 4PMVA 1HWWA 3ZIZA 4BQ3A 3NCOA 3BUIA 1UD3A 3PBGA 1AQMA 1UKOA 1V0LA 2YL5A 3KL5A 2XVPA 1V3HA 3CO4A 2YL6A 5HBFA 3CUGA 5I2UA 5LYRA 2FHCA 1GJUA 3BAWA 1J01A 1Q4NX 2CESA 1QBAA 3M46A 1E43A 1KQZA 1JDDA 4AZ7A 4PMQA 5C71A 4HU0A 4JZ5A 3HN3A 1KCKA 1QI0A 4WJXA 3T2QA 3VIJA 3S5YA 1HXJA 1JAKA 3WENA 4CD8A 2JF7A 1Q6CA 1LWHA 1TR1A 1JZ7A 1JGIA 2CPUA 2F61A 1ITCA 3SCVA 4V27A 4TVUA 2BY3A 2XVNA 1VB9A 5M17A 3VIGA 2ZX9A 3VMNA 3ZT6A 1EDQA 2XN1A 2D22A 3LPOA 2VCCA 2CBJA 4GZIA 3VINA 5A2AA 1UR9A 4KRTA 1KTCA 4FNRA 1E4MM 2C7FA 3GXTA 3MSGA 3VDHA 4PSPA 4HOWA 1W1TA 1CXKA 3CLWA 3UETA 2V5CA 2GJRA 3BMWA 5A8NA 4TTUA 1VJZA 3SCOA 4HA1A 4Z2KA 1BGAA 1BYAA 2XFRA 2Z1SA 3SCPA 1CGYA 1UQYA 1TE1A 3BVWA 2E9BA 4CGTA 3AI0A 3II1A 5D8ZA 1EXPA 3BGAA 3SUUA 1US2A 3W4RA 3FW6A 4UQCA 4UQAA 5ABEA 1KB3A 3EJQA 4LYQA 1X1NA 2WZHA 1ZU8A 5CZKA 1JI2A 1BTCA 2VR4A 2PBOA 5FKYA 1BVZA 3NSMA 4JFTA 3POHA 2EO7A 1SR0A 1V3JA 3WEOA 1NP0A 1RP8A 2VX4A 3LPFA 2WMIA 5A2CA 1OWQA 4QCFA 4QLJA 3H54A 2VL4A 1HTYA 1R86A 4PCSA 2WHKA 3VD4A 3WELA 2DIEA 5M5DA 2C8NA 1FHLA 1OGBA 4TUFA 4PMZA 5E6YA 1JL8A 3WEZA 1QOXA 3WY4A 5M3WA 1C8XA 3ZJ6A 2QPUA 4JHOA 2ZX7A 4H2CA 2VX6A 1N82A 3ALGA 1QI3A 1E73M 2W63A 5CPTA 4NX0A 1H11A 3AS2A 4CD7A 4MB1A 4BA0A 3THCA 3BH4A 2J47A 1W9VA 3L4XA 3L4ZA 2UY4A 2F8QA 4U31A 4ATWA 5A8PA 3DX4A 1WAWA 1KXHA 4AZ6A 4C7GA 2JE8A 4CD4A 3FHAA 2Y24A 5D9NA 3WF0A 3AROA 4EANA 1FH7A 2WVVB 5ABFA 2J74A 2VR5A 1HJWA 1X6LA 3WD3A 1JFXA 3AIRA 1W1YA 4NZJA 1OSEA 3OB8A 3WH8A 1GPFA 2EBNA 3DX3A 4HA4A 3WL0A 1ODUA 1M53A 2O9RA 1E0XA 1XCXA 3CZNA 3EDFA 4EE9A 3AS3A 5F7UA 1CYGA 3ARYA 2PI6A 7A3HA 1H3GA 2QMKA 1JZ8A 3NSXA 3GTNA 4MJ4A 1EQPA 4M81A 4CD6A 1CXLA 3AMLA 1NWTA 3I3DA 4J7RA 1KTBA 3BVTA 2DT1A 1HL9A 4PMOA 1UHVA 3O2LA 1WNOA 1ODZA 3B9EA 6A3HA 3AIWA 4W7WA 5FL0A 3S6TA 4FLQA 1LF1A 5EFDA 5E1QA 5CSYA 1CGWA 4U2YA 3AIVA 2NT1A 2YLAA 4DWSA 6TAAA 1GW1A 4KRUA 3WDHA 1EQCA 4PTVA 5EBAA 3WNNA 2A3HA 4W8LA 4PCTA 4FMVA 1ESWA 3GXIA 5DT5A 4UZSA 3VIFA 3LPPA 1DWJM 3GDBA 3VNYA 4YPJA 1UUQA 2J7FA 1W1PA 5IFTA 1VFUA 1JNEA 2CNCA 4PTWA 5DMYA 2D3LA 4GPNA 3IK2A 3WD0A 1G5AA 1CEOA 5D9OA 3MV11 1OT1A 1GHRA 3QHOA 4FLOA 2FYVA 2YA2A 5AY7A 4XUYA 2WZIA 5IXEA 1UD4A 3APGA 4IPNB 3RO8A 1FHDA 5HDRA 3A5VA 3W27A 4DM1A 5D9PA 3WNMA 3WQVA 1TUXA 2PC8A 3DYPA 3NYDA 5BXSA 2FHFA 5I77A 2CBIA 3OIHA 3W29A 2WVTA 4X0NA 3WH5A 3AHYA 1WZMA 3SEPA 4TOQA 3VSTA 3PZNA 2GJXA 2FH6A 3B9AA 3AIBA 2VNCA 4D6EA 1CWYA 2XWEA 3PZOA 1H1NA 3BUBA 3LRLA 1F4AA 2BVDA 2VQTA 3I3EA 5KEZA 1H0GA 1FH9A 4HU8A 3LRMA 1HJSA 2PWDA 2OWXA 1NWSA 3DYOA 3WD2A 4WKHA 4GI8A 1GZJA 3VILA 4KH2A 3SUWA 3AS1A 1BGGA 1TQVA 2ALWA 2YLLA 3ZT5A 3ZJ8A 4W7UA 3BLPX 2XUCA 3HJEA 3OG2A 1GOOA 2WBGA 2W62A 5A3HA 1W3LA 3UEQA 1ISVA 3OGVA 4W84A 5I24A 3N15A 1E15A 1ITXA 3N04A 4MJ2A 1MYRA 2G4FA 3MUZ1 4UNIA 4XV0A 1E56A 1HVXA 1E5NA 4YN5A 2D0HA 1OIMA 3A21A 4HMDA 3K4AA 1W1VA 2W91A 2XM1A 4OOZA 3WY1A 4MPKA 3G6MA 4OJYA 2XSAA 1UYQA 2ZX5A 5A6BD 3BAJA 5BYWA 1E6QM 1UWRA 1W3KA 4ML4A 3N1AA 1WZKA 4LQ1A 1MQPA 3PN8A 3EDKA 3AIUA 3MV01 2X2YA 2J8GA 3PTMA 3WQWA 3WN6A 1UKQA 1DWGM 4MNMA 3BLKA 2WMHA 1GOIA 3BAIA 1MW1A 2YIHA 3KLKA 5E0FA 1V0MA 1EDTA 1LL4A 5E0CA 1ECEA 3D50A 5A6SA 3SURA 1I1WA 3F4VA 2YBUA 4QCEA 3DX2A 4TVCA 4OGZA 2NT0A 1GQKA 2CKSA 2E40A 4WKFA 2ZUMA 2XGIA 1G01A 5A1AA 2WNWA 3VGGA 3KLLA 2OW6A 2DGAA 4GKLA 1FP9A 1HF6A 1PX3A 1FOBA 3VDAA 2EPOA 3QR3A 4XX6A 3W6MA 3SCWA 4D6GA 5HXMA 1UWSA 4U2ZA 5A95A 3S5ZA 1LQ0A 1W9BM 4B9YA 4CKQA 3CHDA 1JZ4A 1K9TA 2FH8A 3CHEA 5FD0A 3IAQA 1V3MA 2PB1A 4ZXLA 3D4ZA 1FP8A 5A6KA 4CU7A 3N11A 1UR2A 4IUGA 4H8VA 1I1XA 3VGHA 1CECA 3AXIA 3MKKA 1PX8A 4WIWA 1V6WA 3W53A 1GQLA 2V38A 4B9ZA 5FCZA 1R85A 1JZ2A 2XYLA 3TP4A 4RE3A 4CVWA 3G6LA 4A3HA 1KBKA 1O7DC 3ARXA 3WH9A 4CD5A 2DEPA 3PZMA 1ZBVA 3MMUA 2EEXA 1HNYA 3CGTA 2J4GA 3GH7A 3PHAA 2F1BA 2ZE0A 1CGXA 1ZS2A 4W5UA 4L4OA 1E1EA 5EB8A 2F7PA 2V3GA 1KCLA 4BQ5A 3EJPA 2A3AA 3WQ4A 5DT7A 3TTYA 1E70M 2CBUA 4PEEA 3B8SA 3RM8A 5A6LA 2QHAA 3EJTA 3VD3A 4F79A 4ACZB 8CGTA 2GFTA 1CIUA 1WDPA 3LXBA 1XH0A 1BG9A 1UZ1A 2NSXA 3TOPA 1JFHA 2VZOA 4M80A 3VO0A 5JUVA 2Y8VA 1MXGA 1R47A 4D6HA 4B3LA 3OLIA 4XZBA 1VENA 3KWXA 1WZAA 1BQCA 2WMKA 1V08A 4LYPA 3DC0A 2VTFA 4UFKA 4PMUA 2X2HA 1W9XA 4GZJA 3VDCA 1VFMA 3W28A 4UCFA 2DSWA 3TV8A 2CXGA 1EH9A 3CZEA 2E9LA 3MUY1 3WDRA 4MTVA 3BC9A 3PZQA 4Z2HA 3BSGA 2X2JA 4PTMA 4D6JA 3T08A 4K68A 2YL8A 3O9NA 2AMGA 4U5KA 1G94A 3POCA 1UWTA 2IGTA 4GIAA 1OT2A 1W91A 1E4LA 1C7TA 4AZGA 1UOKA 4GXPA 3VX0A 3ZO9A 1W9UA 4AYSA 4P7LA 3SCSA 2F18A 1B0IA 1E5JA 4JKKA 2NW0A 1C3FA 1VBRA 3AZSA 4HPHA 3MMWA 3BAXA 4W93A 1W2VA 3VVGA 3SUTA 4D6IA 1UD8A 4KMQA 2WPGA 1CZ1A 1XSIA 1UR0A 4E8DA 1EHNA 4WSKA 3JUGA 4HTYA 3RMEA 2E3ZA 1IZJA 2WMGA 4FNUA 2DIJA 3SIMA 2ZUWA 1V3LA 4TTGA 1QHPA 1XCWA 5E09A 2Y5EA 3AOFA 1B1YA 1UKTA 2ZICA 2XGBA 1E3XA 3CUJA 1V6YA 1TVPA 3CHCA 1FFRA 3LMYA 2VOTA 1RD6A 3ZR5A 4PBGA 1H0IA 3T0AA 1JXKA 1QI5A 1BYBA 1XH2A 3GNRA 3UR8A 1UA3A 3VIOA 5BWFA 3VD9A 3VPLA 4TVDA 1B3ZA 1O6IA 2DT3A 2IXVA 3FY1A 1Q6EA 1E9LA 4AEFA 2EPLX 1JZ6A 2WSPA 1B3VA 1G0CA 2F7QA 5HNNA 5I3DA 4ZXOA 1JDAA 2ZX8A 1GHSA 1R87A 3HG2A 4WK9A 3VGFA 1JAEA 4NF7A 2WMJA 1PBGA 1EO5A 2VVNA 4LX4A 3MANA 4YHGA 1GVYA 3AYSA 2X0YA 1CBGA 3KE0A 3TTOA 4UOJA 1UR4A 3QOKA 3W25A 1VFOA 1H49A 1V6UA 1LG1A 4QLKA 2W4XA 1MVYA 5ABGA 1UR8A 2WVVA 4AD3A 3W24A 1HX0A 4L4PA 1E55A 3MUIA 3VIKA 2CETA 1ZBCA 3TTQA 2VZSA 2PF0A 3ALFA 4FNQA 1TCMA 4FLRA 1K6AA 3UESA 4JAWA 4CN1A 2G41A 4GINA 1L8NA 1OBAA 4Z2LA 3CZJA 4PUEA 2DQXA 1HT6A 3VDBA 1GNXA 1K9DA 4UQEA 1AMYA 5A94A 4Z2GA 3F5JA 1QNSA 5DF0A 1E4IA 4GO8A 1C7SA 1T0OA 5AC5A 2BHYA 2ZXBA 4MB5A 5BXRA 2W61A 1GVIA 5D4YA 1J0YA 1DWIM 2CHNA 4ZENA 1JI1A 4AZCA 3MS8A 5A8MA 2VRJA 4R5EA 2YKKA 1JZ3A 1HKMA 2QLYA 4W5ZA 1NH6A 4QAWA 1NP2A 1ISYA 4JKMA 5CPQA 3WUFA 4J28A 4ZE4A 1VF8A 3WMSA 3EDJA 3L4WA 3ZSTA 4BS0A 1E0VA 2J7CA 5HOSA 2QV4A 3BAYA 1VAHA 4WSJA 2VJXA 3A3HA 2YA1A 3GXDA 1MQRA 1LL7A 2D73A 1V0NA 1NOWA 1QNRA 1UQZA 1UA7A 3PZVA 3L4YA 1WDRA 4HZ8A 2XM2A 5EMYA 3VSUA 1MW0A 3WF2A 2Z1KA 3AXHA 1UH2A 1LJYA 2D20A 4OBRA 8A3HA 1G9HA 5DFAA 4M82A 4TX8A 3U57A 1CNVA 1AQ0A 3VGDA 1OB0A 4CUCA 1QNQA 3D51A 2EPKX 1PEZA 4MADA 4EKJA 4DO5A 2UY2A 3CTTA 3T0BA 2D24A 3AS0A 3ECQA 3CZLA 3O6AA 4M29A 4GO9A 2J7BA 5AYIA 4PMDA 3NDZA 3WFLA 1V02E 2WWDA 3M7SA 2DSZA 3KZSA 3M07A 3QHMA 1Q6GA 1I75A 3D52A 3WDJA 1CDGA 5CJ5A 5A6JA 2XIBA 3CH9A 1XRVA 2UY5A 3ARSA 4P7OA 1E6PA 3A24A 2VZTA 1BG4A 2E4TA 4OKDA 2PWFA 3W0KA 5CXPA 1UWQA 4CCDA 4JL1A 2BY1A 1QI4A 1HJQA 3ARVA 2YFNA 3FNDA 2ZXAA 3EMCA 1HP5A 3H53A 2WMIB 5BCAA 4TXEA 2ZUTA 1JF6A 2WK2A 4DWSD 2GDUA 3W81A 2O92A 4JIEA 2DDXA 2VO5A 2BVYA 2OWWA 4D71A 1EOMA 1MFUA 2OYKA 3AXXA 1PPIA 3BSHA 1MW2A 3ZMRA 3VMOA 3ZOAA 4EAMA 3W26A 2EPNA 1LLOA 2OSYA 1QI2A 3OGSA 1FFQA 4W89A 3B9DA 4ZE5A 2V5DA 1TMQA 1GOQA 4Z2IA 1TQSA 5ABFB 4J3WA 1HXKA 5HPCA 1R34A 3BVVA 3A22A 2DT0A 2ESCA 4XZWA 3U5YA 3F5KA 2C0HA 2X05A 1SMAA 1ZJBA 1C8YA 1M7XA 1QX1A 3ARQA 2ZIDA 2GVYA 3A4AA 4JFWA 2YDSA 4IPLA 1BYDA 3IGUA 3LXAA 1BAGA 4W88A 2XIIA 2PBGA 4KWUA 2G3IA 1D7FA 4PYSA 2OSXA 1UD2A 1DWAM 2VC9A 1UH4A 2CCRA 3WD1A 1BF2A 2ZUNA 4NZFA 2D0FA 4E2OA 1A47A 4WLCA 3TONA 5E6ZA 4MDOA 1P6WA 4CN6A 3OLDA 1XD0A 1NQ6A 1OINA 4AZ5A 1E1FA 1UWIA 4DWSB 5AC4A 1BLIA 4QFUA 5EFFA 1K9FA 1VRXA 3WUBA 3DX1A 7CGTA 2WHMA 1E72M 9CGTA 3AJ7A 1OGGA 5JBEA 1HL8A 3I3BA 3WFZA 2JEPA 3WQ8A 1J0KA 1W9PA 1R7OA 4W8AA 1JF5A 5GQBA 3GXFA 2BNJA 2OYLA 1EDGA 5ABHA 4DWSC 2RGMA 1SMDA 3MU7A 3K8LA 4RE4A 2B31A 4D6CA 3ZSSA 1XSJA 2BXYA 3GYCA 2PWGA 1OIFA 3HG3A 4J3TA 4M8UA 1E6SM 2EPMX 1KGWA 1CGTA 3QHNA 1V02A 4DUXA 2QPSA 4NZCA 3T09A 4BQ4A 4M56A 4CN4A 5ECUA 4MAVA 2X2IA 4H8HA 2X1IA 3VSVA 4J3SA 4HP5A 1W32A 2CEQA 5E70A 3T0DA 1JNDA 4FK9A 2J8FA 4ACYA 4HOXA 1HVQA 1R8LA 3T2PA 4W87A 4Y7EA 3VU2A 5I78A 1J9YA 3NIYA 5C70A 1XGZA 3AHVA 4D1IA 4CVUA 3CMGA 1BFNA 2EACA 3WF3A 4WF7A 1YHTA 3ARWA 3ARUA 1SZNA 1E6RA 3ZM8A 1M04A 3K4DA 1TQWA 1ISXA 2QMJA 4GQQA 3CPUA 3MI6A 3ZT7A 1J18A 1YQ2A 2W5FA 2W92A 2Y4SA 3SCTA 4ACZA 4B16A 1TZ7A 3A4XA 2X0HA 4BQ2A 5DO8A 3D5HA 1KFWA 4AZIA 2BHUA 3OLGA 4A4AA 3BCFA 4CCEA 2D3NA 4BF7A 3BUQA 1PJ9A 2PWEA 1CXFA 3AMDA 5CGTA 3EMQA 3L2MA 1M01A 3WNPA 3PZTA 3GZAA 4S3JA 4NSBA 3UG4A 3N12A 2WKLA 3WBAA 4AMCA 3SUVA 1QHOA 1H4PA 1E6ZA 1K9EA 4AW7A 1VBUA 4JHZA 1M03A 3WD4A 1KXTA 1J12A 3EDDA 1U2YA 2WVSA 4PUDA 1TQUA 5JBDA 4NRRA 4GI6A 2CERA 3GH4A 2YJQA 4AYGA 5LA2A 4CU8A 1V6VA 4X9YA 3VIMA 4AD1A 3DDFA 1OGSA 1H41A 1PIGA 2GUYA 1IZKA 2VVSA 1FA2A 3DHUA 1WB0A 1CTNA 4TX6A 5GPRA 1JYWA 1OD0A 3HG5A 3IJ7A 3TTSA 2CHOA 2WMFA 4J3VA 2J7EA 3LPGA 3L2LA 1V3IA 1WO2A 2WYSA 4AIUA 2WSKA 1QWUA 1MWOA 2JIEA 2WVUA 4PTXA 2BFGA 1XYFA 4BZYA 4CU6A 2F1AA 3GBEA 2Q8XA 3M6DA 1XHGA 2WC3A 1UD6A 1R75A 3SCRA 3UG5A 1J10A 4AZHA 3W6LA 3HU7A 3TA9A 3CBWA 2ZUUA 4J3XA 1W9DM 2G3JA 4FNPA 3WKZA 3ZR6A 3WL1A 1HN1A 4QLLA 4W86A 1EIBA 1XC6A 1JYVA 1E0WA 1R33A 1DEDA 3L4UA 1JD9A 4PMXA 1NOFA 4U5IA 5CPSA 2ZUSA 1A3HA 2D23A 3PTQA 5I5RA 4MNKA 3U7VA 5A6AA 2ZWYA 3DDGA 4W7VA 3RPMA 1HJVA 2VURA 1OM0A 1JXJA 3HG4A 1KWGA 3OGRA 4UQBA 4P8XA 1GQJA 3GNOA 4AIEA 2PWHA 3K46A 7TAAA 2O9PA 2ZXDA 3OBAA 2EQDA 4J3UA 4BCEA 2DT2A 4U3CA 1BPLB 3MMDA 1E71M 2VUYA 5I6SA 1D2KA 1X6NA 3BUPA 1HJXA 1KR1A 1U30A 1JD7A 3EJRA 2WHJA 2XN2A 4UFIA 2WCAA 3UERA 3WDPP 1KGXA 2XVKA 4IISA 4AISA 4Z2JA 1WE5A 1Y7VA 5FL1A 4AZBA 4KGLA 4ZEPA 3OLEA 1JYXA 3ARPA 4F66A 4JL2A 3VNZA 3WNLA 3WDQA 4UQ9A 1G1YA 1UZ4A 2XN0A 1SFSA 2X8RA 5IDIA 1BVNP 4OZOA 2XWDA 1XH1A 3VD5A 1WPCA 1US3A 2JIWA 2D0GA 2WC4A 4U3AA 4DUVA 1PIFA 1V3KA 1PZ3A 2DPEA 3CIVA 4JFVA 4AWEA 1VEMA 3K8KA 3FAWA 2YBTA 5CGMA 2J25A 1GONA 2XG9A 3EJUA 1ZBKA 4P8UA 4UR9A 2BS9A 3WUGA 3KL0A 5FIPA 4AD5A 1HKKA 2OWCA 1W3HA 3A4WA 1GUVA 1H2JA 2BVTA 3PZ9A 3NDYA 5I79A 2V3DA
chains in the Genus database with same CATH superfamily
2VC2L 3HBPA 5I1KH 1RZQA 3DX0A 2NY0B 4F3FB 3J07A 4L65A 1JOIA 1K2DA 3SCNA 3DUSB 3WF4A 4XAPA 5KBLA 3FFCA 3S2JA 3P2TA 1KUMA 4XISA 4RDYA 3NG3A 4HK0B 4KKLC 2FHBA 3AMCA 5IHUH 5IB4A 1DBML 3AT0A 3EFOB 3FQ4A 1RHFA 1SZGA 5AW7B 3WEMA 4AD2A 1J7VR 4E4PA 2R23B 1A3QA 3O0RH 1HH9A 1GCYA 1CK0L 1AY1H 2VXUL 5CCJA 5EUKB 4UM9A 1L5GA 2ZKHH 3LNMA 4BHUA 1A5SA 2WCSA 2AVFA 1CF1A 4LOUD 3CSTA 3V4PA 4LL9A 4RKAA 3ATAA 3T8XB 4APXA 5B1KA 4UTIA 3B7SA 3QCVL 4JPWL 4N0YH 4OCYH 2VX5A 5A7BA 1EO7A 1Z6JT 1D5RA 3H23A 3JVGC 2LAGB 1UKPA 1SDAB 4BWUA 4Q33A 2MHAA 1GQIA 2DD8L 5I17B 3WIFA 3KMDA 1T8XA 3QNFA 3C6CA 5F97E 1ADOA 2OSWA 4G8FB 2V37A 3CMJA 1JCMP 2WZEA 2AP2A 4PGJA 1O1HA 1CLXA 5JU6A 2QF8A 4AM0A 3NCXA 1AIFA 4P2QB 3TLLA 3BQUA 3NJIA 1INDL 3W2LA 3TBTA 1M71A 3ARFC 3CO8A 5A2LH 35C8H 3LIUA 4JQIL 4QO1B 2XICA 2NX5A 2RAGA 4LSRH 4OLWH 2BHZA 4ONHA 4MA8L 4NGHH 2ZRZA 4C6PA 3V5DA 3CN1A 1XL9A 1MCRA 5JHLA 1JK9A 2VDRH 2HTMA 3KAOA 3WH6A 5JQHC 4IX0A 2TPSA 4PRTA 2VLRB 1LG2A 1Q3NA 1F11B 5CBAB 5CLYA 5HR7A 2I07A 3IRSA 4NHUB 4PJDA 1IAKB 4O1DA 1KYUA 3DFYA 3I6TA 1HKJA 5C6MA 3NACL 5DMKA 3S0CA 1FTXA 4F37F 2B1HH 4LPWA 4ZZFA 2I24N 1S5IH 3RJDA 4G7EB 2DW7A 4GBUA 3FUDA 2VQUA 4U1LB 7TIMA 4F20A 2G2NA 1BQSA 2JKLA 4MCYB 3UTZB 3CVHH 3QNZA 3SDCA 1U8PB 4NL1A 2ZUVA 3P11H 4QRTB 4UANA 4DKFL 1UZHA 3S8FB 3HMXA 1OFOA 4U0RC 5FYLL 4I8DA 3A67H 4GX9A 4PRAB 5DHDA 5E9AA 2VSDA 3S37H 2DH2A 4XNAA 1GOWA 5H8DA 2O72A 4PL1A 2GGGA 1Y5XA 4F8XA 2QSCH 2Y6SC 1RH9A 3S9DB 5BZZA 1AIZA 4YXLH 3S2LA 1BBJA 3AJXA 2RDXA 1DIOA 1ZXQA 4TQEH 3OPSA 2L0DA 1DJQA 2DSVA 4NZ4A 2BOFX 1JGDB 4HVXA 3MCKA 4PG2C 4G8AC 2VMFA 1S3TC 2O9TA 5JR1L 2BX5A 3UTOA 2FRGP 3EFDH 2IPKB 3N9GH 4FFWC 3UTSB 2EJ1A 5F6IB 3DI2B 4S1FA 3KD4A 2XZ7A 4N9OB 3QUXA 1K7FA 2ODIA 4QI3A 1EO8L 3OVPA 3O9WD 1FNGB 4LLMB 1FZMA 5C0IB 3BAKA 3VXTB 4WJKB 4JJHA 3TDFA 3EDEA 2YDRA 3SN0A 3G6JA 5EBMB 4JQ4A 2WANA 1ONWA 1J05A 1C8QA 4S1SH 1TJPA 3QIWB 4EVNA 4JFDB 3NIFE 4YDVB 1M7IA 3HS0B 1JHKH 5G2WA 1DZBA 4YDKL 1T6WA 4JKLA 3HI5H 1QZ1A 4BEIA 5IBTH 3RDTC 1V6TA 3EH2A 1MO0A 1XR9A 4FE9A 2BSRA 4P5TA 3OBEA 1A9EA 4XAWH 5ANMB 4P8QA 4YSUA 3NVDA 1QFWI 2EYRB 3F4WA 1GYCA 2IO5A 3KS6A 2PMQA 1VERA 5CCHE 2HZGA 3LHTA 4DBWA 2HSIA 1QPKA 5D1QB 4BSWA 4KVNH 3LNHA 1EFXA 2GOUA 1PS3A 2ABAA 1MI5B 4L8CB 2Y7OA 2FDBP 3UZJA 4C1NB 1HUVA 4W6YB 3PWUA 5FDWB 4YIQA 4NILA 1RJQA 3N55A 1B3WA 4PN2A 1XGUA 2K8MA 3TBSA 2D4DA 5FUCE 4NRYB 5HYFA 3IDUA 5E5UB 4EIGB 2HJLB 4MJIE 2CUMA 2BMBA 1S9YA 1P9MA 4HS3B 5IHBA 3ZKND 2XPZA 3TK7A 4W9ZA 4G9DA 2P9RA 4WTQA 2PFHA 5DUJA 3G5XA 5FF0A 4AHOA 1J9RA 4WUUA 1Q1JH 2F74A 2X4TB 3OEXA 3GNMH 5CP3H 2AFNA 5IFJB 2J79A 4YH6A 4AE1A 4PMVA 2HH0L 2YXOA 1L2QA 1Q9WB 1RD5A 4O4YL 1V3HA 4RNHA 5JPMA 2QKIB 2HRPH 2OULB 1GJUA 3NZRA 1UGKA 1NDMA 3RPIB 4AMKH 3MA8A 3C2AH 4JNZA 1HHJB 2ATSA 1PD0A 1F6PA 3N14A 5JLZA 1LNUB 3IJSA 2JF7A 3EYFA 1CI5A 2BOBA 4V27A 1VB9A 4QITA 1S7QB 1RK1A 2KS0A 3FFSA 5GJMA 3S5OA 4N0FB 3LZFH 2A6DB 4BZ1A 5EBUA 2NNAA 3CFCH 1OSPH 3U7WH 1PDKA 1UA6L 3B3IB 4DEFA 1QBLH 3LRSA 3C08L 4GIEA 3ZIMA 3IJYB 1WBYB 2OL3A 1V3JA 3TJPA 3VQLA 3WEOA 3CFEB 3RFZC 2ADAA 1NC2B 3PF2A 5IEKA 3EJYC 4G70B 5DZ9A 1PVHA 1A4LA 3EYSH 2V6HA 4L29A 2QSVA 1K1DA 2KQMA 5GGQL 3GIYA 2H2PD 4HT1L 3MBEA 3BX7C 4L3ED 2ED9A 3ALGA 1QSEE 1T1ZA 4JFPB 3QPYA 5BQ7B 1J88A 2VDKH 2P5WE 5CZXC 2UZ9A 3BH4A 4PJ6A 2NCMA 3QCTL 5A8PA 3DX4A 3VRJB 3FHAA 2R1NA 5E6IA 3KYKH 1ZANH 4C6DA 4Q6JA 1KN2H 2J9YA 5JNYB 4NOBA 3DX3A 1ODUA 4X5WA 3VRIB 2DQ6A 5D32A 4ZTPL 2PDBA 5REQA 5DHYB 1YE6A 1IBYA 1VD6A 1OYCA 4U49A 4QWWC 3CK0L 3CLMA 1ICTA 6A3HA 4QEHA 1DR9A 2YJLA 3QQ9D 4MDIB 1NFGA 2VEGA 3NFSH 1KLUB 3OQRA 4FI4A 4PN6A 5AHIA 2BLEA 3FNKA 3P77B 5LGJB 3GSRB 4F7PB 3RUGA 1AOZA 5DT5A 1OP3K 2E9IA 2F8VA 3CEPA 2FTAA 4WAFA 1IEIA 3D6NA 4OFDA 3LN4B 2VDLL 3LEVL 3X12B 4NVTA 1ONRA 1AC0A 4LVOC 1E4KC 1IAIH 2BVOA 5SX4H 3EOOA 5D9PA 4H1LH 4JQ3A 4WTZG 1QPNA 1QRQA 1PQZB 2FMOA 1AS7A 1UZ8A 2ZC1A 3W74A 1SGKA 2WVTA 3N85H 2H8XA 3PWPB 1YUHB 4R7JA 1TPB1 2GJXA 5I1IL 1AW1A 1J9TA 3PGCB 5IJVA 1ELSA 3UOAB 4DIAA 3G0XA 4H7CA 1MHEA 4R4FH 5L2KB 2D7TH 4I2XA 3BQUC 1INQA 4QY8B 5I8OH 1CI1A 3ZJ8A 3VDGA 1WAEA 5CD5C 4XP9L 4HBCL 1D5XA 3N25A 3MHGA 1YTKA 2YOAA 3QW9A 2V2XA 1WFOA 4GY0A 5JYMA 3IDGB 2VDLB 4P2OA 1RZIB 2PRLA 1VACA 4BUGA 7PAZA 4OOZA 3WY1A 4MPKA 2XSAA 4UAOB 4DEPC 3KWWA 2GJJA 4PJ7E 5AVVB 3BKYL 4P57A 4N2IA 4NHCL 3RI5K 3IS0X 5TGBA 4MNMA 3TJIA 3ZDYE 1L2UA 3DUUB 2Q2EB 5AECA 1IYXA 3QO0B 2M83A 4XNQA 1T3FA 1UCBL 2C1HA 2AXGB 1FPTL 2ZWLT 4PW4A 3W23A 1A5NC 1JHLH 3GHBH 3BKJH 1FWXA 3DJTA 3JT0A 3ILEA 1EZLA 3OG4B 5IUSA 3X13A 1QHQA 1A7PH 4Z18A 4YGVA 5BOZG 4JBSA 1F1DA 4FQXB 4KIEA 1BXAA 4PJAB 1P7BA 5DK2A 2Q1EA 5A6KA 2YX0A 2FUTA 1XLFA 4D9LL 1ZPTA 1FGVH 4DK5A 5IVXA 5LNRA 1KBKA 3WH9A 2OS7A 3IKCB 5IBLC 4KPHL 4M8QA 3HI6L 4IZGA 3QDGD 1A14H 4TPRH 1MFAH 1OE2A 2IXQA 3MTWA 3Q65A 1ILSA 3TSBA 3K2UL 2QJMA 2VFGA 4JO4H 3WZ0E 4RRPA 3HFYA 5AOIA 5CC7A 3A4DA 3VO0A 4NJIA 2VXQL 3FZUC 3KWXA 1XGTA 4KHXL 3COTA 2VTFA 4GZJA 4P9HC 1MEHA 3AG3B 2IIJA 3KHJA 2GCYA 1R5VB 4JO2L 4IOFC 3UF9A 5CBBA 1F3JB 1NSNH 1ECYA 2WSRA 3NIGF 7PTDA 5DTFB 4ELMB 1P7TA 3DV6A 5EN2A 3SQBA 1KGCE 1UXMA 4WWKB 3S2AA 1PY4A 4XK2A 2Y8UA 4P7LA 4MWFB 3RTQA 2K7PA 4MSWA 2NW0A 4XCYA 2FATH 4LPUA 4WO4D 2CLMA 1LQ2A 1LYQA 3R8QA 4K2UH 1HGYA 5EU6E 2FZBA 3OR6B 3WEBA 5DR5H 4NQVA 4RK8A 3UABA 3SIMA 2ZP8A 2Q6ZA 1D5MA 1SEQH 1XCWA 3NQ8A 1FVDB 2IS7A 1TVPA 3DMMC 2Z1VA 1XYAA 1U6AH 2SEBB 4Y0GA 1TNNA 3SYOA 4HIPA 1Z42A 4FRWA 1G0CA 1NDZA 4TXVB 3BEWA 1SVZA 4GXVL 3QULA 3TFCA 1X1OA 3KRBA 2CU0A 3H4HA 3TTOA 1F3DJ 1TU2A 4K8GA 4W1TA 2D3VA 3PHQB 4BE5A 3IIPA 1N4XL 1B0GB 3VH8B 1ZKAA 3LQZB 1E55A 4OZIB 2UUDH 4MG4A 1P9MC 5C07B 3IDYB 3V6ZA 4S3EA 2VL5A 5GS1B 2YAPA 5FCUL 2HVJA 1GKRA 2WYIA 4ODWA 43C9B 2P28B 2X88A 3FH8A 3F5JA 3M0ZA 1JNHA 1E4IA 1GK8A 3SY0A 1CC3A 3MRRB 4WI7A 2Q3RA 1AXTL 1EPVA 1J0YA 2BNRE 3OMAB 4Y6GA 1HKMA 4QAWA 3DGGA 5EWIL 1E0VA 3DC8A 4KDWA 1XIMA 5JPMC 3T8LA 3S96B 2XM2A 2MPAH 4X4MA 1P6FA 5HI4C 2D20A 4N1EA 1G9HA 1QKZH 3C5QA 3LNPA 4PH6A 3PVFA 4DO5A 1D6VL 4D3CL 5JIMA 3KCJA 3BIKA 1GW9A 1DQML 3WHE0 4DP5X 4PMDA 1BAFL 5HA7A 4B9FA 5I8EB 4M6OL 2QUNA 2XIBA 4M1GH 3WFAA 3MRLB 3TIDA 2E4TA 3W0KA 2BY1A 5I66A 2E3VA 3RL2A 3BRGC 5C08D 2BOCA 1HEZA 3E6FB 1AO7B 3FNDA 4DJFA 3G5ZB 5G5DB 2MWCA 4FLHA 2XWBA 4GKTA 2H0EA 4JIEA 1T4KA 4XZMX 1XAKA 2F54A 1Z3NA 3NJVA 3ZDZE 4NQQA 4LCWD 4XI5C 4X3ZA 5BOOA 3CSYB 1D8WA 3FCUB 2P8PB 1XMEB 5I00A 3MBEC 1TWDA 4L4LA 4K94C 2RB8A 3U5YA 1SMAA 1C8YA 4F8QA 2EDYA 4XSLA 3QY6A 3IE9A 4D0DA 1KBVA 4PJXB 5KVDL 4MY9A 5JOPD 3DFNA 1XL6A 5E6IC 3V6FB 4FDWA 2G3IA 3GK8H 2VUNA 2AJXL 2TRYA 1BF2A 4MKSA 4MKTA 4S3DA 1KCXA 1A47A 2NY7L 4X6CF 4FA8A 1VDGA 3QPXH 1N6VA 5BOEA 4PV8B 4JHMA 4R4NC 4DWSB 2X3AA 4HUWA 5EF0A 3KPSE 1CD1B 3DHMA 3UBXI 1S5TA 4TM9A 5JBEA 3UJEA 4ODUA 1KIUA 4UNUA 1PTDA 3IF1A 3WCZA 2OXHB 2JI1A 4J4PC 4NQXA 2N0KA 4K71C 4TQPA 3KVPA 4WY0F 3DUGA 3FGCA 1LQAA 4PWEA 4F2TA 3C86A 1SQMA 3ETSA 2VDRB 2BJML 4NHVA 2PPCA 1MF2L 1KIRB 2BXYA 1P4BL 4GYKA 1NFDE 3SPCA 4EI5B 5AZ2H 5DS8A 3QHNA 2VQ1B 2C1IA 3QZWA 4BQ4A 3M7WA 4GRLA 1Z9AA 1UT2A 3MJ8A 1F3EA 4QHRA 5BO1L 4HOXA 4XVSL 3MDUA 1U4EA 3WQPA 4PGCA 5FO9B 4OLVL 3M0IA 2HT2C 4LYKA 3ZM8A 15C8H 1TQWA 5I82A 1ISXA 4KKRA 3EWZA 1BIIA 2KLSA 2PXYA 3T6ZA 3CPUA 3MI6A 1KGYE 3TJLA 3Q6FB 4NERA 4Y9PA 4B16A 3KBJA 1TZ7A 4XPAL 2Z8VC 3TJEH 3D5HA 1YYML 1KKOA 3S6DA 3CXFA 1P5VB 5DMMA 3BUQA 1URIA 1DQJA 4R7NB 4AU0A 4H9VA 4F7TB 1H4PA 1E6ZA 1SJBA 4LEQA 4XO5A 4JFYA 4UQIM 2EDRA 1HI6B 1CD8A 4TQIA 1W16A 3LB6C 2PETA 1JNLH 4GJ1A 3TYFA 4WI6A 2DZVA 4P2OC 2Y9RT 4HDIB 2GUYA 3FFCE 4N5EC 5GSVB 3OV6A 2DMKA 1N8ZB 4NP7A 4CMMA 5CSZA 3SDXA 4V33A 3LTYA 3GJFA 1BXCA 1MCWW 2PO6D 1UJPA 1UYWL 4E9RA 4IGBA 4YBLB 3BWSA 1Q72L 3LVTA 4IL2A 3T05A 4N86A 5LQBH 2Z92A 3HKZA 1PKNA 3CQQA 4K3JH 4KWOA 1RUMH 1ODAA 1QVOB 4J3XA 1YLBB 4QHMB 3FO1B 4W86A 4PMXA 2AANA 3NL3A 3O6FD 4OV5A 1OADA 1ET8A 3MV7D 2JCWA 4GKZB 3FFDB 2ZWYA 2VZ3A 3ELQA 4FMKA 3RPMA 5L0QC 4FG6C 3U0PA 4IPIA 2GEEA 3F04A 1G9MC 1V7NL 3TVMB 3PHSA 3LEXA 3ITYA 4IOTA 5KSVA 4NFCA 5I6SA 2WBJB 3QBUA 5IW6A 3UERA 1XLBA 3VKCA 1WE5A 2WCPA 1YPIA 4Y19D 4KKQA 2HWGA 2X0SA 2ZYRA 5DURD 2XN0A 1QQDB 5HPMA 1BREA 2PC4A 5FJPA 4D0CB 1PVNA 4N9DA 2XVBA 4WGKA 1XGPB 1UEMA 4HF5H 1ZWIA 3HE6B 4IIQB 3AB0B 5E1GA 2GABA 5KVEH 4HU3A 4QDWA 1JR1A 3IDMA 2Y62A 1WBHA 2NX5E 2IGFL 1RQ5A 1Y0LB 2Z7ZA 3LYRA 1Y1DA 2I5YL 4CCCA 4Y5VA 4DO7A 4ZNEA 2RDWA 3G8EA 4G9FE 3RJYA 5I02A 1OM3L 2ZOLA 3NFPA 2H4EA 3VFUB 1IFGA 5E9DA 3O6KL 3DERA 2JF6A 4MYWB 4Z1DA 4PJDE 3SCQA 4E8CA 4MAYB 3O05A 3OJDB 3BK0A 3UJIL 1DKWA 3G5VA 1B3JA 4N8CL 2WWKT 5DEZA 1C91A 3BDKA 4JDBA 5I1AA 2L5HA 1VLWA 5T8IA 2D7PA 1NCHA 3N0AA 1OTSC 1F3RB 4G1NA 2FB2A 4XZLX 3B1TA 1JPEA 3H21A 1VBGA 4IFKA 3A47A 1U3HB 3IJ8A 4JX4A 2XJLA 3C6SB 4RE2A 5GISL 2QCCA 1IQ8A 3OTRA 1IEBA 3IETB 2X16A 3PP7A 3PV7A 5EULV 2OI9B 4LL4A 3Q06A 3H2PA 1CE6B 4JHWH 4HSAC 3SIKA 1AZBA 4X42A 1XWVA 1LO5B 3BAEH 5A2BA 1BF6A 5D9SA 1SRDA 1TF4A 3VE0B 1UENA 4MSSA 1SUXA 4DAFA 2PLMA 3MV8A 3FC8A 2PURA 2CLHA 3T0EA 4NX5A 2PABA 5IM51 4WFGD 1E2ZA 5ID1B 1PSKH 1HDMB 5I73B 5EY5A 3MRQA 3L6FB 4WK4B 1S7VB 4NCC1 3WLBA 4B5VA 3K80A 1AD0B 5EFIA 4AWTA 4DM2A 2HRLA 3R94A 4EPBC 1TQCB 4FFTA 1IGML 3ZE2F 5F1VA 3UBPC 2ZSVA 2ZZ3A 3ZLFA 2R2HA 4M7KH 1U4FA 1URLA 3FKUS 3G6JE 3WAJA 2IH9A 5AB1A 5I1HL 3GKFA 1NAL1 1QK2A 2Y7QB 4O12A 1KXVA 1XLDA 3WIJA 2P8MB 2G50A 3HIZA 3CU2A 4OFQA 1X7IA 3TC3A 3TQVA 1OAXL 1CB7B 2WSDA 4HHPA 2IDTA 3LS5H 3C0LA 4N2KA 4CNNA 3GRGA 4JB9L 2LU3A 3DNKA 2EUWA 4XTDA 2E47A 1T03H 4MUZA 3J7HA 2OQJB 4GGBA 2HKHL 1N64L 3HGSA 1BVKA 1RJZB 1VPOL 2ITCA 1QTPA 4ABVA 4DJFC 1HHGA 3HN8A 1LWJA 4JX6A 2PPEA 3PS7A 1TQBB 1NAMA 5L7XH 3VAEA 1G6CA 4MASA 4AEHL 4KQNA 4PHXA 2GK2A 3SKMA 3BVNA 2VABB 4S1QH 2WAHA 3BKML 3ARRA 4UNKA 4MJZA 1JWUA 1ITUA 3U2SB 2BZNA 4GJJA 1PZ1A 4C6IA 5E00B 3AAZB 3M6YA 1QOPA 4JVUA 3VM7A 1MEXL 1IJNA 4JG1H 5DXWA 1A3RL 4WUUE 4F7EB 3HCVA 4IJTA 5F3HA 1RIHH 1EGZA 1VS1A 1MUCA 4LGXA 5C8BB 2W0FA 4IU3A 3TT1H 4HPGA 3VFMA 5TH2B 2W0UA 2EEBA 3SQOH 2P7TB 4FLSA 3WLWD 3MACH 4LP5A 2JKXA 1WC7B 2QCEA 5IRPA 5FFLA 3FYEB 2BB0A 3TNMA 1UM4L 3E9AA 1WQ5A 1BX2B 1C5DA 3F4DA 5E2UH 4OGYL 4LUIA 4YSTA 3LTVA 2QCGA 3MLUH 4IIEA 4V1YA 2EPHA 2YXVA 4PH8A 3SDDA 1RU9L 5TNVA 3BUDA 1JZ5A 5GNXA 4AMAA 4LT9A 5FK9B 1MAKA 1YTDA 1YSOA 3PIQA 1EPXA 3QAZC 1WT5A 2NUTA 4HYTB 4HNUA 2XH2A 2MJWA 2EDQA 1CCWB 1Z9NA 5EB9A 3QUZB 4N02A 4U1HA 4IRJA 1ZIBA 2XETA 3GI9L 3ARBA 2QGYA 2W67A 4DXVA 5IQLA 1XCQB 2PXYC 1ZRQA 3MNWA 3TBYA 3P0VH 5IR1B 4KKLD 4PRHB 1H7NA 3MUAA 3FB7B 4K9EL 3R6IA 3CL6A 3PZIA 3OKKB 4A66A 3BE1L 1JDFA 2YR1A 3K81A 3RM9A 4HMCA 5J6GA 4JZJC 4K4KA 2IMMA 2YEVB 2HJKB 3V7MA 4O54A 5I3FA 3AABA 4AXWB 4N85A 2D9QB 3QR0A 3UJSA 1FL3B 5E5LA 1R3WA 5ECVA 4Z0BL 3P14A 2EIJB 4LU5L 2VJ8A 3KW7A 4CQDA 4P23B 3NPZB 4HMEA 3BHBB 3M44A 3MV9B 2QVKA 4FP8H 1UD3A 5CZ0A 5B21A 2OXNA 4TRPH 3QA3B 1N10A 4OFYA 5LHEA 4MQTB 2ICEA 1N6QL 4IGBC 4IPPA 5IOPA 2FWOB 1O0VA 4JZ5A 2PDPA 1KCKA 3O8XA 3SO3B 3AXLB 3RUGE 1FCQA 1AJZA 3CSGA 5M17A 3VMNA 3VD7A 3UY8A 4QHUA 1ZK9A 3KGRA 2BP8B 3GMRB 3N1QC 4G8IB 2ENSA 4KK5C 3IU3A 3U1PA 3WNIA 2EIBA 3SQMA 3QHFH 1ZAIA 2YPLA 1YDYA 4JKWA 3ARFD 5SWSD 1CGYA 3BGAA 3U4BH 4AV5A 1F6YA 2GJ6A 3EJQA 1X1NA 2WZHA 4MKVA 3PPGA 2VR4A 1C1EL 1OLLA 4QE5A 4JFTA 2W60B 1RP8A 3NDOA 2PGEA 3EO0A 3PAZA 2JTYA 3CEUA 1AE6H 5FA3A 1TZGH 4KRPD 2X4QA 4HSHA 1QOXA 5T1KD 5DJXA 4WUIA 5T1DH 1MFCL 2N7SA 5AVUB 4I2XE 3JTTB 5CPTA 4GVIA 4MXWH 3DFTA 4N1CA 4N26A 4Q7DA 3TCLA 3HBZA 1W9VA 3VZXA 4U31A 4ATWA 1TVLA 4XN5A 1NCTA 4JY8A 4DJEA 2GQAA 3F83A 4EI6A 1JFXA 3AIRA 1NCAL 3C8KA 4UIMA 1EUUA 1XCXA 4EE9A 3T65B 4Y5VC 3GLZA 3SE4A 1EJXC 3AMLA 4DGUA 4W9HC 2P1FA 3EA3A 5AVRB 3TX9A 3VXOA 1RSFA 4AQZA 4Q97A 4GS7B 3LGDA 1FWNA 2NT1A 1QU4A 3EOLA 3UG8A 4FQQA 2V63A 3LCYA 2OLAA 4P5UA 1XFPA 4NAJA 2HLEB 1QFWM 1SJEA 2YBRA 5AOMA 3LPPA 3UJTL 3ZRFC 3CYVA 2POZA 4KKCC 1A9BA 3FT3A 1QFPA 1R4XA 1FRBA 1T5WA 4MFHA 3MRKB 1P43A 5FUCC 1KCZA 4LPXA 2WIMA 2ADYA 5KYNA 4HCRH 4Y2NA 1URZA 5E23A 2CLPA 2YMXH 3GFUA 2PC8A 4M6NH 2AQRA 1ZT1A 4KETA 2BIQA 3OIHA 2BCKA 4FF7A 3PAOA 2A7BA 4ZL1A 4D8OA 1YQVL 3B2VL 4J3OG 1MQKL 2GW5A 2OGJA 4UTAA 2A6LA 4LEOA 5F9WC 2JV6A 4A3QA 2YK1H 4S3CA 2RDUA 1LRTA 4GG6A 1ZLEA 1GZJA 2ALWA 2D03H 4LDEB 4F2FA 2PP3A 3P4NB 1VKXB 2DM2A 5KN5B 2R29A 4W84A 4LQFH 3BT2L 3N04A 1G9NL 2ZA3A 2H90A 2V7NB 4WRHA 1Q6QA 1MCKA 4HWEH 6PCYA 2YPVH 1O5KA 1FHGA 2C3GA 4RNRB 1A0QL 4N0CD 1UVQA 1NCOA 4LDOB 3X1GA 2BRRH 3LCLA 3PTMA 5FIEA 3ULSA 1UKQA 3BLKA 4PULA 3BZFA 1MW1A 1WITA 5IJCC 5IMOA 1N2VA 3CN2A 3E38A 1WOBA 4LVDA 5F7AA 1KXVC 5CEZL 4Y4HD 1LOQA 3BOLA 4G6AC 3VFOB 2I27N 3IN2A 1OT4A 3W6MA 1M7DA 4AB4A 2DWEB 5E7BA 3T1WA 4F9PA 1E0UA 2VZ1A 1LQ0A 1GCFA 3F1QA 5M2FX 1K9TA 4DN3L 1RZGA 4BEQA 2WJ5A 2FPTA 2AABH 4XC1H 4EWJA 2V7HB 3TO4A 4CADB 4YNGA 4GUFA 2MEJB 3MLYH 4DGYH 5HHQB 5CZVL 2Z24A 3AT9A 1S9KC 4PJBA 4CD5A 4JRLA 3M88A 2W27A 2EEXA 3MROA 3LKPA 1NBCA 3CFJA 2CR3A 3RF9A 4GPVA 4Y2OA 2ICCA 4JN2A 2A3AA 3NJHA 4PEEA 1FAKT 3TBVB 3NCWA 1W0YT 1F3DH 4NKQB 5E0KA 4ZSOB 4KS0A 1L6XA 4GP8B 4WFFE 3O9WB 3GUTB 2E67A 1KJ3L 4X99A 1VC4A 2V69A 5FV1L 4G6JH 3R0UA 3Q2LA 4W9GC 2VMCA 1FO0B 2R8SH 2FL5B 5T5NG 4OB5L 3MGTB 2QZQA 4EUPG 3O4LB 3N44F 5INDA 3GD1C 5F9AC 1CQYA 3P0YL 4XNZB 2ISSA 4IGNA 3NEOA 5I26A 4GIAA 4X4ME 2NX3A 2CGZA 4IL0A 1X5HA 4K7VA 5GJSH 2F18A 4RDWA 3QNYA 4FGMA 2DL2A 4LCCB 5F44A 3F58L 4X8JB 2AK1L 3VVGA 3AACA 5K3VA 1ZVSB 3V18A 1IZJA 3R5EA 1EFQA 1IM9D 2FSDA 5CN2A 3KS5A 4DN4L 3IFPB 4L4TD 3SDDC 3LDVA 1E8ZA 2WYZA 3MNMA 3L5WB 1QI5A 5JVLA 3HBQA 1FLRH 5CZXD 4BELD 4CEXC 1WT5C 4H2HA 3PUGA 3QEUB 1R87A 3HG2A 2AAMA 4OJFH 1T1YA 1IL1B 4IRJC 2D9CA 2ZUQC 3J27A 1T83C 2F54E 3ARBC 4DK6A 1OCOB 3LTSA 2P49B 2WD0A 3QZAA 1V6UA 3G6AB 3GBMH 2XZCH 3I50L 2GC4C 4EOUA 4WI5A 1WEJL 1T6VN 4I9WE 6PAZA 4Q6KA 1UJ3B 2C4FU 2HUEA 2VDQH 4TV3A 5A94A 3GC5A 1QNSA 2A2QT 4N2BA 3MJ7A 1I8IB 3R89A 3OKDA 2YD1A 1C7SA 4XPBL 4DJDD 4BCZA 5ICYA 4MB5A 5BXRA 1CE1L 3E2QA 5KS9B 3GC3A 2UWEF 2RFXA 2WNZA 3MY9A 3RITA 2GHWB 4R96A 1GZPA 4Y7MA 3FQRA 3SYAA 2V17H 4M7LH 3EYOB 3AITA 4L1LA 4QSHA 4HB7A 5KSBF 1RV8A 1G1CA 4QNPF 2ICEC 1F8TH 1F07A 1OB0A 2J8HA 3O8XC 4MQXC 3PG8A 3ZQXA 1VYSX 5HP5A 2YSSA 1I7RA 4DN1A 3TN0A 4YHYC 2FVKA 4PZVA 2A6JB 2G5BB 5EU9A 2JIXA 3MRMB 4DBSA 3CXDH 2YSTA 3S5LB 2Y3NA 3TH6A 4KTDL 5JHBA 2YCLB 3TC7A 2EDTA 5C0FB 3LEPA 2PWFA 5BOFA 4RFEB 5AW6B 1HP5A 2ISDA 4L3EB 4MNGB 4GRWH 1CFNB 1PKQE 4HHLA 2UYLA 1MJ7H 1JV5B 5HJDA 3B0VC 3BGGA 1MFUA 2CIKA 4OF0A 4MCZA 1R3JB 2ZZ6A 3GQYA 1NCWH 2Y7NA 4G9FD 2Z1WA 4XWGL 4O2CB 1ZHBB 4W89A 4LLUB 1VZGA 3LMJL 2NW2A 3OF6A 4R34A 3UCCA 1SF3A 1B5TA 3O63A 1H6FA 1EHXA 1EGVA 1MIEH 2B2XH 1EZUA 3EJJX 4N22A 4IP4A 4XAFA 1PEWA 1OE3A 3HV8A 4DJEC 4OLYH 4JFEB 3HPFA 4LL1A 2A9NL 1NIFA 2L7QA 3IJIA 4GD0A 3WTVA 3L3OB 1S5VA 1SQ2N 4LSQH 4LBEA 5D2NA 3SE4C 3SDXE 4HUNB 2FECI 2H45A 4Y9EA 3AJ7A 4Z7OF 2BFVL 1OK6A 2YHGA 4K7PH 5KG9B 1F02I 3V4VB 5JHAA 5H94B 4KNQA 1YECH 4MLSA 1OE1A 5C3LD 4LRTA 3MZTA 1AZCA 4XBEL 3DA0A 3RK8A 5HJBA 1XZ0A 3ESVF 3C0SA 1YZZA 4DCQA 5F1UA 1XCTA 3E0LA 4YSQA 4KH9A 1ZAJA 2CEQA 3S35X 3T2PA 2CZDA 5MENA 1LO0L 4L6OA 1KENL 3AHVA 1S7TA 4HWBL 2UX6A 1JK8A 1EBAA 1I1AD 4IMKA 5IQOA 1E6RA 4DW2L 1SOSA 4IICA 4H5SA 1D9KB 3G1VA 3SCTA 5EIIA 4XVOA 2H1XA 1XYMA 1ZHAA 4F0MA 4BK5A 3MKVA 3BCFA 3ZZQA 4YHZH 3EMQA 5CGTA 3W7HA 4BBWA 1AP2A 4S0HA 3GI8L 1CLOH 3KYNA 5I71C 1AFVH 1PV8A 2QEJA 1PCXA 2CERA 1A80A 5LA2A 3QUYA 4CU8A 2L8AA 1DBBL 5DRWB 1W72A 5I16A 3EWUA 1IZKA 3BH8B 3RCYA 4GRMB 2JGQA 4ZNEE 1T2QH 4Z3HA 4B5WA 3DMMD 1NBZB 4P04A 4DTGH 4HV8B 3L2LA 5D37A 4B96A 4LEFA 2BP3A 5E9DE 1HXMB 3OMZA 4IW4C 3KLAA 3CV6A 3LKQA 4H8WH 1I1YA 3H7UA 3QXAB 4W70A 3AXKA 2X1QA 5EOCL 5E4AA 1EIBA 4HHAA 1N12A 1HU8A 4KCVA 2G4GA 2VHLA 4I1PA 3IIZA 2ZDRA 1NLDL 1YNTB 3WO4B 2VURA 2XA3A 3PL6D 4JYDA 3OGRA 1EX5A 4P8XA 1I9JL 3O3EB 2ZXDA 1O5XA 1MHCA 4ZX6A 3HRPA 4YHOL 5DC0A 3BUPA 3VW3L 3NEXA 4IU2B 4QBXA 2XVKA 5G4EA 3TWYA 4Z2JA 1OEZW 4GFTB 3TO4C 4JS7A 4ADUA 4HG4J 4JPSA 3MTRA 3F01A 1RH8A 1MI3A 2X30A 5J11B 3WUWG 1CF8H 3UPRB 3RY6A 1JWMB 4HFUH 1OPGL 3UXDA 4JY6A 1UZ6E 1PZ3A 3MJWA 1GONA 1GYNA 4A3RA 3MV8E 1SOKA 4LSTL 2BS9A 1SHSA 4F2MB 3T0EE 3A4WA 2BVTA 3NVTA 2NY2C 4E41A 4Q7IA 1P1VA 4EE2A 1JTPA 4JAMA 5D7HA 5DJDB 4G43A 3B83A 2XHNA 5E6UB 1FFNA 1EA9C 2QV5A 4YHLL 5CWSA 3N17A 5C0AB 1LT8A 1W5MA 4HNOA 5HJ3B 3FTGA 3D3AA 2IPWA 4UOQA 3UAJA 5KOVC 2VUKA 3WH7A 1FZKA 1FWTA 2GT9A 4XI5D 4NJJA 1YN6A 3PUCA 1MFBL 1ZCOA 2HG5B 2GHZA 3KPNA 3JZYA 3GDCA 8FABB 3R79A 1LO2H 4ZFGL 1GS7A 3CBRA 2X38A 5DQDH 2BXZA 3W3OA 1CFQA 2XFWA 4AV0A 2JK5A 2QDHA 2HFGH 3MP3A 4ATTA 1GS8A 1ADDA 2OKTA 3GR4A 3LZOA 2DSUA 2Z4QA 4PJEF 4ZQRA 4J8QA 3NFNB 4NJ9H 5EO9A 1XFCA 4E9WA 4PIBA 4KBXA 1FFOB 3K6SA 4YSDA 2APTA 5K9OA 4ZMNA 1WBZB 2D2JA 2Z2AA 3VUSA 1GGCH 4UT6A 3T6VA 3DRQB 3ML9A 1S7UB 1SXCA 5I3GA 4JFSA 4S23A 4AENB 4J4PD 1VCAA 5I3IA 3WBDA 2J73A 3GMLB 4Z7WB 3TCXA 4NKMB 3ZLHA 4UM8A 3N42B 1OZUA 4PE8A 2WTOA 4GUIA 1WXZA 2L3BA 3GIVA 3TT3H 5C6TH 3VTAA 3GBNH 4PJ9B 3LN5A 1A5UA 1BWVA 3CC1A 1SN0A 1KCRL 4FZ8H 3EADA 3VXMA 3HZVA 3OA3A 1OD8A 3IBEA 3SRFA 4IBVA 3HKFA 4PBFA 2Q02A 1UW9A 4DZBB 4TR9A 4JFXB 3WF1A 2WCGA 3US9A 4ZNCD 3N4AA 4XVUC 1Q1PA 5DI8A 4U1JB 3OZPA 3VGEA 1RZ7H 2VENA 1QVBA 1OTTC 1E9ZB 4EQ2A 3MOAH 1R9FA 3TN0C 3LKNB 4OD3L 4UYQA 3VNLA 1MFVA 2PDWA 1G4RA 1FL5B 4IMDA 4G42B 4G8GA 4GZEA 2BDNH 4V2XA 2UY6B 1OD7A 3DBXB 5BZAA 2BSTA 3Q2NA 4IIBA 4ZTEA 4XD3A 2X0VA 4NQSB 3H2CA 1IC7L 1WDQA 3E0FA 4FFYL 3IFOB 2V2WB 4F9LA 3LB6D 1G43A 4UTBA 1ME8A 1O6SA 3QZBA 4NQDD 1JNJA 4LVGA 2J62A 3RX4A 1A7RH 2YL9A 4YFLF 4OJEH 4R33A 4N5ED 2DH3A 3FOKA 4PFEA 1UR3M 4RMSA 1VFFA 5C2BL 4Z0XB 2XXFA 5ADOH 3DI3B 5CC5A 4P99A 2F84A 4YJ5A 3QPQD 3H56A 1WTGT 4EIUA 3HHSA 2OR9L 3VM5A 2FE0A 4K23H 1J93A 2ZTKA 1MCDA 1KNOA 2K0RA 4FQ2H 1NC4D 2VRQA 3DJSA 4ZXBD 4UZGA 1O75A 4JG0H 1W3JA 3WTTA 3RJOA 4PP2A 5KVFL 2NSOA 2AJ3B 1TQTA 1SW7A 1T8QA 2HS8A 1EJRC 5D2NC 1Z48A 1PHWA 3SDCC 2EE3A 2VQ4A 5DVPA 1QEWB 2XVGA 2MNWA 4QRPD 2V33A 2XTJE 4AKPA 5ESAB 5F3FA 1NU5A 5LLIC 3GY1A 2HVMA 1MH5A 4F33A 4J8RA 3LM3A 2AOSA 3ALXA 5GZNA 4TUKL 3QJUB 4FYSA 2VFDA 2FLRT 3Q4DA 5FHBH 4D2JA 4OF8A 4FQ1H 2A6NA 3FU8A 2JLPA 2YPLE 3QG7L 4F91B 1XH3B 3CIWA 4XVJH 2FNWA 2QTEA 2HFTA 2F6AA 2EABA 1QRKA 1L9WA 3NK3A 2GJ6E 1TJRA 4IMKC 3VXGA 1E3ZA 4OIIL 5AVXB 3VGAB 3TZNA 1SMOA 2BVQB 3Q9PA 1ZL1A 5IT2L 5I76A 5CN3A 2HISA 1R0AL 1AKJD 4CNPA 1AGCA 4BK5C 3WKML 3QUXC 4DZIA 1KB5A 1NJ9A 3PZUA 3W1LA 3DVNA 1VEOA 3UBXG 4U3HA 2QSQA 3MXWH 2CBMA 1CL7L 2QELA 3B8YA 1Z89A 2CJUL 4OLXL 1FNSH 2NW3A 4GFXA 1FWSA 1NMCC 1GVOA 3QUYC 1ZEAH 3CHFA 2JEQA 4B9IA 1TFVA 4IMLB 4AUUA 1G69A 1YPZB 3AISA 4ZYKA 1OGTA 5TBOA 5FYJL 5FAAA 3KCWA 5D2LA 4PD4J 2XVPA 3KS0J 2YL6A 5DQJB 4G6KL 2VDOH 4P5TC 1GAFH 2RA1A 1S4IA 1KQZA 1N5AB 3O6FB 3HJZA 4G11A 3MV7B 1MRFH 3HN3A 2O61B 1Z9PA 3VIJA 1UPMB 5D5MA 5FF6A 2B0SH 4XVTH 2LVCA 3WMQA 4HA0A 1YC8A 5I1KL 4FFZH 1TTRA 3OAZK 1RSCA 4WDIA 5E2WL 3KGTA 3VDHA 3N43F 3UETA 4HUKB 3CLFL 1VJZA 4ML9A 2Z64C 3VXRB 4HJEA 4L9LA 5DURB 2B0MA 3AI0A 4G83A 5IHUL 3X11A 3X2QB 4XD4A 4AVIA 1E9IA 2CHDA 1N0LB 4WK2B 1YEKL 1ZK5A 3EO9H 1ICQA 3O0RL 4KU1A 4J5VA 3FSOA 1AY1L 4TUJB 2EO7A 5HUOA 4RGNE 3LPFA 1HH6B 2WLIB 4G7RB 5HVGB 3VD4A 1EUAA 1XXDC 5J04A 1ZPLA 2J57A 1JL8A 5GSRB 3RY6C 1SY6A 5BQDA 4GG6E 3CDFA 2ZX7A 3QXTA 4K6AA 4N0YL 1BEYH 5HNTA 4YZWA 2HTLC 4CD7A 2F8QA 3DK0A 3QFDA 4AL8H 3H2QA 5J8OA 5GHWH 5FYJU 1TPFA 3PHOA 1MEIA 5DMGC 2Z8WC 2X6CA 2OXGB 3MBFA 4JREC 4A21A 1W1A1 1W5PA 1R3VA 2DQJH 4J7RA 4ZOAA 3B7TA 1ODZA 3HNSL 4W7WA 3S9ZA 4AEOA 5JA8B 4YR6A 4U2YA 1Q6RA 3EKCA 2VDGA 2LHAA 4B2DD 1ITQA 4PCTA 3W5NA 1DJHA 2Y22A 4KNSA 1RUKH 2I16A 4G7YH 3FQNA 3GLDA 1VFHA 3ANUA 4CNIA 4PTWA 3M4HA 4LW7A 2W81C 4OLWL 4BKNA 3GW0A 1TPH1 2NY1C 3WO8A 4NGHL 5T1JA 2A5UA 4FLOA 2P5EA 5IXEA 5IGXH 2VDRL 4EP8C 5FEPA 5MHSE 3SRDA 5LDUA 3Q13A 5K59E 2VSKB 1KW1A 3RKPA 5FM8A 3W57A 4PJBE 4OV4A 2XWEA 4MXQD 4M19A 3BUBA 1S5IL 3IXAB 1ZLWH 4X5XA 3S48A 3NQ2A 1XEUA 5K9QG 1EEQA 3PSWA 1WFIA 2ATPB 3P11L 2BCMA 2FB4H 3OGVA 4LVBA 5I24A 5CJNA 3A67L 4HYWA 1L9QA 5F1NB 1E5NA 1Y8BA 4NNYB 3S37L 5ETUA 2D69A 3ESMA 1RR2A 4LVFA 2ZOUA 4KROC 1UYQA 4X6DF 1E6QM 3RN6A 2W9DL 4WEVX 1MQPA 3PN8A 1G6RA 4YXLL 3SZ8A 4OF3A 4TQEL 4PVNA 1LRQA 2ZRUA 3C56A 1I1WA 5U7SA 5DJ0B 1TWWA 1L3WA 2J6XA 2E75C 5C8JB 2GTWB 3O4OC 3CVHB 2IEPA 2DGAA 4RWHA 1XDMA 4A3UA 5JORA 3EFDL 3N9GL 4D6GA 4ANKA 2Y89A 3SY5A 4EZKA 4I88A 5A95A 4H88L 2XWTA 4HJ1A 2BOEX 3GSQB 3CC5A 3INUH 4GNKB 3PABB 1H8NA 5CC3A 1UR2A 3EGSA 4JE0A 3X3GH 4Y9OA 4F9LC 4M1CC 3W53A 5HI5C 2B7OA 4B9ZA 2ZZ7A 4CVWA 4YC2C 4KKXA 4S1SL 2E6QA 2J44A 4FMFA 1LRNA 4BI7A 1HNYA 3P4MA 5E24E 3SGDH 3HUJB 4DBUA 2QBWA 1ZSXA 4NSKB 3HI5L 4LEBA 4LV4A 5IBTL 3CL8A 1E30A 3S9IA 2XU9A 2A9CA 2XPYA 1NKGA 3CAVA 3MRFB 3QG6B 3RGVD 4XAWL 4RVBA 1MHHA 3HR5A 3NR0A 3LXBA 4RETB 2VAJA 2ZXCA 2FZ8A 1WISA 3KPQA 2OTWB 5I1CH 3W1MA 1E7VA 4B3LA 4KVNL 2NX9A 3DC0A 1W9XA 4J3ZA 1LP9B 2VD9A 2Y1HA 5AB9A 4BH7A 3ZMEA 4PTMA 1JE6A 2F6XA 4CCZA 5EOTA 5I2IA 3VOFA 3BZEB 1CD9B 1KTDA 5DCCA 1C3FA 3D09A 3MCG1 1XJBA 2XGZA 3TXAA 1ZTVA 4WSKA 4LAKA 5HQMA 3NJKA 3UDWA 2UVFA 5B1BB 5H91A 1LK2A 1CFTA 1WIPA 3CUJA 1BQGA 5GZNC 4A8IA 3BV4A 4JTFA 3LH2H 5C7ZA 2X7LB 4PCKA 5E8PB 1U8MA 1AG6A 2HRPL 1SUJA 1JDAA 1UB3A 2YEZB 3VGFA 2WMJA 4AMKL 5ES4B 2VVNA 4WTWA 2XQYG 4OLEA 4MLJA 4OFCA 2WXKA 4GAGH 3QOKA 1TEFA 2E1DA 1FDJA 1WWAX 4BZ1H 5ABGA 1LP6A 3PUUA 4MMWA 1OF2A 5DLCA 1V8HA 1U5HA 2ERJB 1EJUC 5K9QI 1OBAA 3QDMA 3LZFL 3GB6A 2HLAA 1EBGA 5D05A 1EAJA 2QJHA 5C0EA 5I1DB 1OSPL 2GITB 4E0RB 2EECA 3TIMA 3RTQC 1W6LA 3NCMA 1UOZA 3PUEA 4K94H 3W7IA 2OFQA 1OFEA 4L56A 3LOWA 4BS0A 3EDJA 5HOSA 5D2NE 2VJXA 3EYSL 4J40A 1QNRA 4MJID 3M5XA 4KTEL 5BU6A 2X2UA 2BXVA 2OCJA 1XB3A 4N0UB 2ZUXA 1NFPA 2GK0B 1U3NA 4KXDA 2VDKL 3O7UA 4YNYA 2IAMA 3VFWB 5JPNA 5LIUX 2YDAA 1R38A 2DMHA 3CVCA 1QO3A 3SIZA 1ZANL 1YEDA 3TR9A 1KN2L 5C9RA 2UY5A 3KBVA 4P7OA 3FCSA 5BV7H 1THFD 4XMLL 5MENE 4U1GB 5T1KB 5EBLB 1HESA 2QGCA 1JF6A 3NABH 1RUSA 2DDXA 3WK0A 3U46B 3NFSL 5EU3A 3NQKA 3VFGH 4BXVA 5CZRA 2J2ZB 4XVEA 2YWZA 1EIXA 1KM4A 1K4DB 3RGTA 3PJUA 1WYJA 5EV7A 3QHTC 2VDKB 4LASH 2AKRA 3V3WA 1ML0A 2JKTM 3GTVA 4LNVA 3ZE1B 2N1KA 5HPCA 4RAVB 3H70A 4ADJA 3KBMA 3VSQA 3ARQA 1ES0B 5IESH 3UPCA 1B9KA 2C3WA 3S8GB 3P3BA 3CUPB 2H32A 1IAIL 1BAGA 1F0LA 2VC9A 1S8DA 1OV8A 4NZFA 2D0FA 4AUJA 4Y4FB 3N85L 2ZSWA 4EUPA 1MCHA 4CDHA 2GIMA 3DIFB 1K6QH 5DMLA 3RPTA 2TMDA 3OHXA 4QFUA 4XBMA 3WUBA 9CGTA 5M7QA 3V0VA 4JMXA 1YJDL 1QSED 1YDPB 2YYUA 3EA1A 4W8AA 1IVTA 4P4KA 2P5WD 2D7TL 3ME0A 5I8OL 1PG7H 5D6CA 4GH3A 3T3MF 1ML1A 3KYAA 2YAFA 2PWGA 5IEHB 5D7IB 1OIFA 1RK5A 1ORSA 5AB3A 2YQ2A 4ZFZA 1FVCB 1AHWA 4Z7NB 3WJXA 4ASTA 3KDMA 3V5FA 1A0EA 4H1LB 4LCUA 3FSUA 3UCDA 1MOEA 1P7QA 4ACYA 2IFFH 3QEQB 1L7TH 3O2DH 3VU2A 4JTJA 4CVUA 3ELFA 5I6XB 3ECBB 3FTXA 1AZ2A 1TZIA 3K4DA 1I4FB 5C9JA 4WZ9A 3ZT7A 1D3HA 1OTUD 3RLSA 2W5FA 3Q43A 4A7QA 3EWYA 1G9MH 1XF2A 4ICCX 4IRSA 1JHLL 2BBFA 3BKJL 3GMOB 4HKXB 3WFHB 1N26A 1JCXA 3YPIA 4E42B 1KEMH 2KZHA 4E41E 3PWJB 2JQMA 1OF6A 5G2NA 2Z0UA 4H13C 3C12A 4J35A 4BZ2H 1THCA 1JHTA 2NRDA 1FGVL 2UXGA 2J13A 2C9SA 5A43C 3QYSA 2A7NA 4Y4HB 5JXAH 1MWOA 4GRLC 1USQA 3WL9B 5HGBA 2Q8XA 4DESA 4OBTA 3X1BA 3CQHA 1D8CA 1WRFA 1A14L 4A67A 3T3PF 4HKBA 3L9CA 3W6LA 3AG4B 1MFAL 4KERA 4ONGH 1DJIA 4Y16B 5AQ0A 2Y7DA 2XTLA 4KWWA 4NUMA 1WWWX 2KMWA 2QDVA 1Q2SA 1OM0A 1U0QA 4HOMA 1T5KA 3UAFA 5I19H 3FH5A 2OMVA 1K4CA 3NJMA 4NZRH 4A2FA 3GEFA 1NSNL 3FJ6A 4X7FC 4FERA 4Z7AA 3FO9A 3WDPP 3JVFC 4IBSA 3WQGA 4ZEPA 1QK0A 3ZE0B 3D6GA 3VFVA 3PJLA 4HIEB 3VB9A 2FATL 5AZ0A 4NZ5A 4K2UL 1US3A 1WA3A 4WY7H 4KJWC 3ZTJH 2ZG3A 2B9AA 5DR5L 3VXSA 3LZ3A 1S7SB 1KG0B 1DEEA 3FAWA 1SEQL 4MA7H 5CGMA 2J25A 1AGDA 5M1TA 3KWUA 2GQHA 4LNRB 1O1ZA 3AGVA 4UR9A 4F8PA 1TNMA 4TQHA 4GW4B 3EJPA 4MQXD 4LF3A 5I79A 1XGRA 2V3DA 1U6AL 1F4WH 1GTHA 1C8PA 1BOGA 3WNKA 1W2PA 3NTCH 1JUFB 4L18A 1JZEA 1MAMH 2E5CA 4JXCA 5CZJA 3BRFA 3BVXA 5AKTA 4BKTC 4LHUB 3URBA 3QFGA 4PTUA 3GXMA 1UB5B 4A39A 4MD4A 4K37A 1I0BA 1TA3B 3VXME 3WTSA 1EVUA 1AL8A 1NEZG 1F4XL 3IJ6A 1IM9B 2XBDA 4L4TB 3T1GA 4QOKA 1KTRL 1VRDA 4PGBA 4IMEA 1FWCC 2O56A 1UQSB 1BG1A 3RZCB 1S9XB 4UFJA 2E0PA 1PS9A 3BPLB 4JJ5A 3D85A 5M03A 2VDOB 3UDWC 4HJIA 4HIXL 3LKSA 1JEZA 1AQHA 4G8GE 4OCRL 4HGWA 1AD9A 4CL7A 4GSDH 1TZHA 3WEXB 3SAZA 1WCGA 3RI5F 5A6IA 4AD0A 2KKQA 4HETA 1UG6A 4YTUA 1KGCD 4CEUC 2C9XA 4Z77A 1QNOA 2DSKA 2MPAL 3IDIA 2UY7A 2G9HA 3HFML 5IBUG 3NJNA 4YLBA 2R2BA 5CILH 1ZLVH 3IGKA 4X7CC 3M7FB 5C55A 5EU6D 2RGLA 4N0RA 3FCBA 3H9SA 2BOLA 4RNFA 4UOZA 3QJFA 5CBEB 1ZT4B 3CZGA 2ZRYA 2H6RA 2Z31A 1WDSA 1QUNB 4ISVB 3NIDB 1TSRA 3WE6A 3GO1H 1LO3H 1CDJA 4M1GL 3NOIA 1Q0XL 3VB8A 1J48A 4Q4SA 4HKJA 5CO1A 3WQFA 1J2WA 4KEMA 2Y6SD 1MRDH 5ACMA 5B3JE 4IKLA 1YN7B 1SHMA 2JALA 5CJXA 2QCMA 3U1SL 4F0SA 1IKFH 3E6HB 4B9KC 4FG2A 4Z78B 4O02A 2MCPH 2H9AA 3PJNA 4HALA 3FJTA 1EOKA 2NX1A 2WOQA 4UDTB 3BXWA 4DP9X 4GMSH 2AV7B 3Q58A 5IVXE 2IAMC 4FFWD 5KYXB 5C0DA 3F7JA 1IIKA 2BNRD 2KZKA 4NO2A 2XVLA 3NEEA 3GK8L 3MCOA 3FT0A 2ESVA 4GSXA 3F8UB 5CG7A 4IK7A 3U36B 3QPXL 4KFPA 4L37A 5BW6A 2IPUG 1EZSA 1OK4A 1KIQA 4AMXA 2ZTJA 1RUPH 4LRIA 3K1DA 4XAGA 1M05B 4NAFA 3T0EC 2QDEA 4D6DA 4FQLH 4N1HB 1Q0YH 3RDTD 5F88A 2OKOA 2OMTB 4DZ5A 1ZHKA 2P5PA 3FB6A 5AZ2L 4YTSA 5I7GA 2XU2A 1XG4A 2C18A 5LNUA 3LQAC 1KYOJ 4HD9A 1XXFC 2P45B 3H9YA 1FQ9C 1X8FA 3ABRA 5CNHA 3P3TA 5F0MB 5MI0C 3SKUD 2QT6A 4BFFA 2JB5H 4CW1A 2A3CA 1X7QB 4PJHA 2G8ZA 4ORIA 5D2LE 2P80D 4PS4H 3OHXC 2TYSA 3OJVC 1YRKA 2R59A 3P0GB 1DVJA 2KZWA 3BI9X 3IUHA 2EYTA 1CB2A 1AR2A 5DEFA 1MUJA 2HWZH 2WO4A 3LB0A 4P4KC 3QPEA 5D5ME 2TAAA 3KS0H 1RZJC 1FO0L 1PWMA 2FLIA 2E59A 1L6ZA 5IHRA 2OYMA 5FLVA 3ZW3A 4WV1A 1XSKA 4MVAA 3JQOB 4EF8A 4QRRA 1KCBA 4JFOA 1AHWC 5JOFA 3I6LE 1XLHA 3G5YB 1DJGA 4JY4A 4XMWA 4JR5A 4B15A 3W1PA 3KPSD 4LLQA 4EDWH 5LNDA 4OUOA 4QS5A 5DSCB 4GACA 4MJ6B 1RULH 4ZGYA 1G7QA 3IXTA 4Z7QE 3UCQA 2R69H 3ZDXB 4I48B 4YTTA 3N18A 1TWIA 4K3JL 3UXLA 1GJPA 3A6OA 3TEZA 3EYUH 4OECA 3KYOA 3Q45A 2NXZC 3HTWA 2DM4A 3MXVL 3V10A 4OVUA 3REWB 3JV6B 1EEZA 1ZJAA 2YUWA 2YQ3A 3CT7A 4V28A 2QVMA 4IRSC 1XC4A 5INCA 1BA9A 1DHKA 1T0MA 4HJ0C 3NURA 3LAFA 2ATAA 1XXXA 1LBLA 4AQOA 3L16A 4K3EH 3R0NA 4KJQC 1BFOB 3DECA 1UXLA 1XLGA 2BSED 2V9UA 3ZLQC 3UZQB 1B90A 5GGTH 4IM4A 3EJYD 3RVTC 4C90A 4GKNA 3L0NA 1UKOA 4WGVB 3CO4A 3NQDA 3CUGA 5I2UA 1YEFH 4PS8A 5CEXB 2DV0A 1P0SE 3QYCA 4WTZA 1EGJH 5LBSA 5IUCA 5JHDA 1P7KA 3T2QA 3PL6B 2D2GA 1TQXA 5KVEL 1U58A 3C09C 4TX9A 3PM6A 5CJOH 1Z5LB 2CBJA 5A2AA 3DX6B 4JANB 1NGXA 3FFCD 3NN8A 3TGXA 2OG9A 2GGEA 4TTUA 4Q6IB 2P5EE 4QWWD 4OCNC 3SCPA 4GMTH 1IQDA 3B2MA 5LIYX 2H3DA 4H4NA 3R7MA 1U8KA 4UM9D 1ZU8A 1HKWA 5HATA 4HFWB 2I9EA 3W2MA 1AQ8A 4YVPA 4XBPA 4XMXA 1KFCA 1S7WB 4I9XA 3DG3A 2WN3A 1Q8AA 1HKVA 3WELA 3CWGA 4U6HA 1FHLA 1N18A 4KV5F 3N2OA 3WY4A 2ZXEB 2Z7KA 4NNPH 4H2CA 4BF9A 1E73M 5FX3A 1EUNA 4TNEA 3HIJA 3FIGA 4PBVC 4XVUD 3VD0A 4ES4A 3UL4A 5AC8A 1U22A 5CHNB 4C7GA 1ZCRA 5KZCD 4NZJA 2QJIA 2XTJC 5AFAA 2AEOA 5L2JA 1HEJC 2J20A 4HC1A 3BAEL 3NSXA 2OA9A 4MJ4A 2OMUA 4KFNA 4PMOA 3BQUD 5IB2B 3PAUA 4CJ0A 5E1QA 4IIZA 1P69B 2DJLA 5BVJB 5CD5D 2QR0A 3ROOA 4HN8A