4PEEA

Crystal structure of a bacterial fucosidase with inhibitor 1-phenyl-4-[(2s,3s,4r,5s)-3,4-dihydroxy-5-methylpyrrolidin-2-yl]triazole
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
445
structure length
445
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKGTKSIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 162
structure length 445
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4peeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4peeA01
5CGTA 3OZPA 1RPKA 4QLLA 3WBAA 5BRPA 1Z32X 2EABA 4AYSA 3J7HA 1HL8A 1QNRA 1CGUA 2VC9A 1CWYA 5KZ6A 1U30A 3BCDA 1KXHA 1KWGA 2G8ZA 3MSDA 4QP0A 1VEPA 2O9TA 3WL0A 4HA1A 1PIGA 1ZU8A 2GFTA 1JI2A 1ZJBA 2CXGA 4PMRA 3SUUA 4KMQA 1GVYA 4PEEA 2GSJA 1J18A 1ZB5A 5IFPA 1GORA 3DECA 3W81A 1GOWA 4J3TA 2VZVA 2JE8A 1BVZA 3AMDA 1LQ0A 1CIUA 3PZMA 1T0OA 1V0MA 1DWGM 2J25A 1FA2A 3LXBA 3BH4A 1UG6A 3KE0A 2XWDA 3FY1A 2VR4A 4R5EA 2VNCA 1GJUA 1KBKA 1VJSA 4FLSA 3JUGA 3ZJ6A 3A21A 2BY2A 1B9ZA 3WD1A 1WDQA 4M81A 3BUPA 5JIPA 1JG9A 2XVNA 4PTVA 2BVYA 1E5NA 1HL9A 1ISWA 4GO9A 2VI0A 2A3HA 4PUEA 2YDRA 2J7EA 1UWIA 2FDMA 4B15A 2OYMA 1WPCA 3BGAA 4WKHA 4BF7A 4MB5A 2NSXA 3W6MA 4FNPA 4U3CA 1WKYA 1GHRA 1H09A 3FAXA 1PIFA 2GVYA 2O9PA 3CZJA 2XVKA 4AZ7A 4DWSB 3KZSA 3VOCA 2ZUNA 2WK2A 5FKYA 5A69A 3D52A 5ECUA 3DHPA 2J8FA 3PBGA 4ZXLA 4MDPA 2J7CA 4UNIA 3PZIA 1TFVA 4W85A 1KBBA 5DT5A 2WC3A 4IM4A 1CXEA 1KQYA 2WCGA 5TD4A 4CN1A 4Q22A 3N17A 1PS3A 1DTUA 5E0FA 3WNLA 3HZ3A 3MMWA 1EXPA 1WB0A 3WD0A 1K9DA 1PBGA 1E1FA 1E3XA 2WLYA 2BS9A 4AYGA 2F61A 1NWUA 3ZJ8A 1B3WA 4IPLA 3UETA 2C8NA 3WSUA 2J78A 3AIBA 1DWAM 1QNSA 3ARVA 2W63A 1JF5A 3MU7A 4H04A 4PMNA 5GNXA 3WIJA 1EHAA 2GK1B 3ARPA 1W3LA 5I5RA 3AIQA 3LPOA 3VUPA 3SUTA 1XGZA 4V27A 4H8HA 3L4XA 4JFUA 1HJUA 1IT0A 4HTYA 2G3NA 4H8VA 4W5ZA 3LPGA 3WDHA 5I0DA 3ZIZA 4MB4A 1EO7A 4PMZA 1KTCA 1XSKA 3HG3A 3CUGA 3NDZA 3WKZA 3SCSA 1OB0A 2GJRA 1UD3A 1L0PA 3DX3A 2VX7A 4W7VA 1BVNP 1SZNA 4JFWA 3VMNA 4XZWA 4QFUA 1LLOA 1E9LA 5IXEA 2VZUA 3AZTA 3TOPA 1W1YA 3VX1A 2D0GA 1J9YA 1W1PA 3AFBA 1J01A 3DX4A 2DIEA 2O92A 4DWSC 1WE5A 4DUVA 3UEQA 1R33A 3A24A 1B0IA 2J8GA 2X2YA 5FOOA 1TA3B 1UWQA 3TTOA 4CN4A 4JL1A 1VRXA 4AD0A 4AY1A 3PZVA 1E4LA 1BG4A 4GXPA 3VGFA 1UWSA 3DYPA 3WD2A 2WMKA 3DDGA 4F66A 6TAAA 2CCRA 1R8LA 2XIIA 4QAWA 2EACA 4MADA 2EXOA 4QCFA 1V6YA 2WMIB 4MB3A 4NZCA 1IZKA 2E8ZA 1AQ0A 4U2YA 3ALGA 1J0HA 3MUZ1 1E6PA 4WIWA 2DH3A 3FXYA 3CGTA 4MAZA 1IV8A 1NOWA 1BYAA 3LX9A 3MMDA 3N12A 4PYSA 3H53A 2ZOXA 1MFUA 1GQKA 4D6HA 3SCQA 2VUYA 4HPGA 4WK9A 3MS8A 4AZ5A 4PMYA 1CLXA 3BXWA 1GPFA 1G5AA 3CHFA 1X1NA 1RD6A 1UH3A 2XN0A 2J7DA 3SCNA 3O2LA 4AMCA 2X2JA 1QW8A 1E4IA 4UZUA 1CBGA 3N9KA 3AJ7A 2WB5A 3WY2A 3I3DA 3B9EA 3SCRA 3BUDA 3VKKA 5D8ZA 3AXHA 1W9VA 5ABEA 4OOZA 4PBGA 4GPNA 1JD9A 3VGEA 2V5CA 4NRRA 4LPCA 2IUZA 3W24A 3MI6A 4LXFA 5CSUA 3ARXA 4BS0A 3GYCA 1MW3A 4UFLA 4MNJA 3GH5A 1QVBA 4FNRA 4PUDA 1JZ5A 2ZXDA 3MUAA 2BHZA 4J3VA 3PZ9A 1I75A 2J75A 2GUYA 4MNKA 1UA7A 5F7UA 4JFTA 6CGTA 3ZOAA 5A94A 3WDQA 2VRKA 4JKKA 3I3BA 5AYBA 2D73A 5GQBA 3KL0A 2O9RA 3SUWA 2WPGA 1VEOA 3A6OA 2JEPA 2XGBA 3VD9A 3VGBA 5CG0A 2YDSA 4WKAA 3EDDA 1OSEA 1UWRA 1Q6GA 4W84A 4Z2IA 3EDEA 3MUIA 4HA4A 1VBRA 5HDRA 4C7GA 2YFOA 1BGAA 2DDXA 1FOBA 2VURA 1JDCA 2DSKA 5HXMA 3IANA 2F7QA 1EHNA 1VIWA 2AMGA 1GZJA 1JYWA 4CVWA 4S3JA 5CQ1A 3PN8A 4PRWA 4N0RA 4IPNB 5I79A 3AIWA 5IFTA 1JGIA 1QNQA 4BCEA 2X0YA 3WH6A 5DMYA 1UKOA 5LA2A 1CXFA 1MW0A 1DWIM 2WLZA 1GQJA 2NW0A 3EJUA 3VIPA 1KGWA 1OM0A 5M5DA 1GOQA 1UUQA 3PTKA 3WUFA 2VCCA 3RM8A 3U5YA 3O6AA 4DWSD 3CZKA 1XV8A 1V6VA 5CPTA 1C8XA 4Z2LA 4HMDA 1GQIA 3HG5A 4JKLA 2CITA 1E6NA 3ZR5A 5DEZA 3VIKA 5BXSA 4J3XA 3NDYA 3N18A 2ZXAA 3K4DA 3VMPA 2FE0A 4UCFA 2ZWYA 5A8NA 3GXMA 3N04A 3GBEA 1GOMA 3SCTA 5DFAA 1RP8A 1QI3A 3GH4A 4B9YA 4AZCA 1QHPA 5A8OA 2X2IA 1WAWA 2D0HA 3TTQA 4PMQA 3MV11 2E9LA 4U5KA 1ODUA 1WO2A 3IGUA 3UG4A 1GNXA 3NJ3A 1PEZA 1PZ2A 2HVMA 3AMKA 1QW9A 1AQHA 3CBWA 3WEZA 1RH9A 3RPMA 1TVNA 1E0WA 5LA1A 4XV0A 4FK9A 1V3HA 1KR0A 4CU7A 1AQMA 1BAGA 1E6ZA 2EPNA 3VIFA 1KR1A 1SMDA 2BHUA 1ODZA 1V02E 3WF2A 4D6IA 4HZ7A 3UG3A 2CBIA 1V0LA 1O7AA 1CEOA 2CYGA 1C92A 1J0YA 2EQDA 5A1AA 5C8BB 1ZL1A 2Q8XA 4AD2A 2FHFA 1TUXA 2YLAA 3THDA 1TQUA 4GZIA 3A4AA 4ACYA 3W38A 3ZJ7A 4UZSA 4M82A 2FGLA 1BLIA 3BVTA 2XFRA 4PTWA 2QPUA 2DT3A 1KQZA 3LPFA 4TXEA 3B9AA 3WNOA 4WSKA 1GOKA 2YBTA 2XYLA 3VDCA 1I1XA 4CCCA 1JZ3A 3IJ8A 1HVQA 3ZT7A 3GBDA 2VL4A 3TONA 2ZE0A 2JF6A 3BLPX 1US2A 2D20A 1HJWA 4LGXA 3VD3A 3WD4A 4TTUA 1HJVA 4P8VA 5M3WA 1J12A 3VVGA 3RMEA 3CMJA 4H7VA 2DIJA 2VRQA 2DQXA 3AHTA 1WDSA 4YHEA 2CKSA 5DO8A 2G4FA 5GNYA 3VM5A 1W32A 1PJ9A 5FL0A 4BQ3A 2A3CA 2YDQA 2EO7A 3BSHA 2J7FA 1Q6EA 3CLWA 2XM2A 3OLIA 2ZUSA 4DM2A 1B30A 7TAAA 4BA0A 4U33A 1H3GA 1JZ8A 1JI1A 3CUFA 2E40A 2J4GA 3WQVA 1KXVA 3DDFA 4FNTA 1XH0A 5C70A 2WBKA 3T0DA 3K8MA 4V28A 3RM4A 1UD6A 1J0KA 2V3GA 3DC0A 1JZ7A 3VINA 3CHEA 3S5YA 5A8MA 4P7LA 3ZMRA 2CNCA 2ALWA 2G3IA 4K68A 3WEMA 1FH9A 4RE3A 3GNRA 3T08A 1B3YA 1W1TA 4H2CA 3D4ZA 4KGJA 3IAPA 2WCSA 4D72A 4YHGA 2WC4A 2F7RA 1R7OA 4GI9A 1XSIA 3ZR6A 1CGTA 1GVIA 3D51A 1C7SA 1E40A 3OLDA 5FIPA 1JFHA 1OBAA 3WQ6A 1DEDA 2J74A 1NWRA 3PZGA 4CCEA 2EJ1A 2XHYA 3RJXA 5HBFA 4D6EA 2IXVA 3VNYA 1DP0A 1UHVA 3WUBA 3AMGA 1H0GA 5BXRA 1QNPA 1NWSA 4JHZA 1V02A 1NH6A 4LQ1A 4P7RA 5JUVA 3D4YA 1VB9A 3OB8A 3EJSA 4ZXOA 3ZM8A 2WM0A 2FHBA 1KXTA 4UR9A 1EQPA 2WBGA 1AMYA 3AS0A 4J3SA 2PC8A 4NZFA 1J0IA 3DHUA 1R75A 2BHYA 2Y8VA 3NIYA 5FL1A 2VJXA 2OYLA 2XGIA 4OOUA 3LXCA 1CGXA 2Z1SA 1HX0A 3BSGA 4GIAA 2XVLA 3SURA 3LXAA 3AISA 2W92A 2YBUA 4F9DA 1HF6A 2BY1A 2BXYA 4JKMA 2ZX7A 3WY4A 5EFFA 2CIPA 4YN5A 2Y24A 2E4TA 3VU2A 1H0IA 1QI4A 4CCDA 3AMCA 4F79A 2PWDA 3G6MA 1W2VA 1MVYA 1H1NA 1NM9A 2WKGA 4CKQA 2D2OA 4AZCB 3TA9A 5D8WA 5M03A 5CGMA 4ZENA 3T2QA 1ISZA 1PZ3A 3BUIA 3VIOA 4PTMA 5LYRA 3DYOA 5BROA 4KRTA 3CHDA 1UR2A 3W26A 1IZJA 1QI0A 5EBAA 3L4TA 1UKQA 3L4WA 1VF8A 3A47A 3WMBA 4UOZA 3WUGA 1GOIA 2WSKA 2UY4A 1W3JA 2YA2A 1XCXA 3RDKA 1V3KA 2C0HA 3RILA 3U5UA 1CXKA 4JAWA 3K46A 1E1EA 3MMUA 5A6SA 1H49A 2CHNA 1CGVA 4FLQA 3WF0A 3AZRA 3UESA 1PX4A 1OD0A 1B3VA 5CPSA 1R87A 1PAMA 1I1WA 4HZ6A 3RO8A 3GXNA 1XSJA 1CPUA 4ZEPA 3QHOA 2PI6A 1UWUA 2VZOA 2E8YA 2X2HA 3LRKA 3ARWA 3WQ5A 4OUEA 2PB1A 4HOXA 1QOXA 4ACZA 4W86A 4LX4A 5A95A 4X9YA 2C7FA 1UD2A 5JBFA 1TZ7A 4KGLA 4BZYA 5HNNA 1M01A 1F4AA 3EMZA 4B3LA 1JNDA 2BY0A 2ZIDA 4LYPA 1WZMA 1W9PA 2W62A 4GQRA 1G1YA 4UQBA 1E3ZA 5I24A 3HN3A 1QHZA 1FFQA 4GKLA 1ISVA 3GH7A 1TCMA 4UOJA 2FH6A 3VD4A 3W28A 3KLLA 3VGHA 4Z2GA 4OBSA 1M53A 3BMWA 2EBNA 4P8WA 2YA1A 4F9JA 3WBEA 3WL1A 4AD1A 1V6WA 2YL5A 4EK7A 3F4VA 1YQ2A 2JEQA 4NRSA 4J7RA 1G94A 5E09A 1W9BM 4D1JA 1EGZA 1UH2A 2QHAA 2A3EA 3NSNA 2VQUA 3BVWA 2B31A 1KCLA 2VTFA 3VGDA 3SCOA 4NZJA 4CGTA 3D3AA 3ARSA 4W88A 4XUYA 4N42A 2X09A 1SMAA 5I23A 4QLJA 1UASA 4OBRA 2E0PA 2PWGA 3WNMA 4M24A 1ZJAA 1LG1A 1JZ6A 3F5JA 1CXLA 2ZXBA 1CDGA 3GXDA 2HISA 3N11A 3AS3A 3ZT5A 1E5JA 1JIBA 3T0BA 1V3MA 2EPOA 5JIWA 2UWFA 3OLGA 1A47A 3HU7A 3SUVA 1UR4A 1AVAA 1DHKA 3UR8A 2WMHA 2ZX5A 3CIVA 2EEXA 3E1F1 1R47A 4UQCA 3GXTA 1L8NA 5DF0A 3AHYA 3IJ9A 2ZUVA 1KGUA 1KTBA 2J47A 3BAWA 1J0JA 1NOUA 2WANA 1ZBKA 1CLVA 3IJ7A 5A3HA 2F2HA 1JF6A 1WP6A 1E0VA 1WZAA 4M56A 2ESCA 1W9UA 5A2BA 4X0NA 4CD5A 2QLYA 1UKSA 1LF1A 2ZUWA 1UOKA 1J0ZA 3OGVA 2V3EA 4WJXA 1BYCA 1TQWA 1KFWA 4UTFA 4ZE5A 3KEHA 2DEPA 1VFOA 4M8UA 2JIWA 3VNZA 4TVCA 4KWUA 2W91A 3THCA 3G6LA 4PMOA 4Z2JA 2NT1A 1M03A 1OINA 1HKIA 2OLHA 3VIHA 2EPLX 2YL6A 1E73M 3L2MA 1EQCA 5A6BA 4J3WA 5HPCA 2QMJA 3VO0A 3WH5A 1GJWA 5BRQA 4W8AA 5CLWA 3VDAA 1MFVA 1V3JA 4AMWA 1W9XA 3AS1A 3B9DA 3SEPA 3LRLA 1E6XM 3AYSA 4JZ5A 1HXJA 2D22A 4FLOA 2E9MA 4LYQA 1UQYA 3MANA 3GNOA 4HMCA 2F1AA 2GDVA 2XFFA 2JIEA 3BC9A 3AQUA 4FNSA 3WN6A 1H11A 3D50A 3WEOA 4D6GA 5CXPA 4GINA 3U7BA 3L4ZA 3AICA 1GQLA 1WDPA 5ABFA 3BVUA 4RE2A 3VSTA 4A3YA 1DWJM 1WNOA 4CU8A 4UQAA 1LG2A 5A8PA 2WMFA 4CD6A 2ZUTA 4W8LA 1GUVA 1OT1A 1UQZA 4IUGA 3A4WA 1FFRA 4TX8A 3VIMA 3WQ4A 4AISA 3BUBA 4PMDA 4XX6A 4TUFA 2IXUA 3MO4A 2QV4A 1U2YA 3VSVA 3EDJA 3NUKA 3TP4A 1KCKA 2UY5A 1ZBVA 4HP5A 4EE9A 1UZ4A 3PZUA 5IDIA 2O9OA 3SCPA 1D2KA 3VSUA 1B3XA 1CZ1A 3CZ8A 4D6CA 3A5VA 4PCSA 3GZAA 3AIRA 3HJEA 2AAAA 1SFSA 5JBDA 3PZNA 4U3AA 1Q4NX 3RJYA 4GQQA 1HXKA 1K9TA 4U31A 3SIMA 2V5DA 1H4PA 2CESA 4EAMA 2WHLA 2A3BA 3AIVA 3RM9A 1BGGA 2ZXQA 1OD8A 1LL4A 4CD8A 4U5IA 3ZQ9A 2VZSA 3OBAA 3WMSA 3FW6A 1V0KA 2GJXA 2OWWA 3VMOA 2V38A 1HKJA 2VCBA 2DH2A 4AMXA 4AC1X 1XH2A 3U7VA 5CZKA 1E0XA 3M6DA 4J28A 3UG5A 4Q7NA 3AHXA 5AY7A 5I3DA 3FAWA 3UERA 1CNVA 3DX0A 1B3ZA 3WDRA 5FCZA 1TVPA 2D0FA 4U2ZA 4BQ4A 3LMYA 3BVXA 4PMVA 3AIUA 2WVVA 5E6YA 5BWFA 1LL6A 4D6DA 1EH9A 4DUWA 2WC7A 1V0NA 2CBJA 2DSWA 4HA3A 1LWJA 2YFNA 3CV5A 1KWKA 1HN1A 5CJ5A 2WHMA 3W6LA 3ARUA 3WH9A 4L4PA 4UFHA 4J27A 4AD4A 3CUJA 1O7DC 2JF7A 2G41A 4GI6A 1E6SM 1JAKA 1W3KA 3QOMA 4BQ2A 1VFUA 5AC4A 1WDRA 5JBEA 5E0CA 3LPPA 2D3LA 1JAEA 7CGTA 1HIZA 2OWXA 1E55A 4P7QA 4E8CA 5HPOA 1K9FA 4GZJA 3FNDA 1K9EA 2RGMA 5AYIA 2AOSA 2XJ7A 1C91A 4CD7A 1MQPA 1ZBCA 2CERA 3OGSA 4W8BA 3VILA 1FH8A 3CPUA 3UCQA 3K8LA 1MWOA 4FF5A 3WQWA 1NOFA 4FNQA 2WW5A 1TQVA 4ATDA 2WVTA 1BG9A 2YOCA 2VVNA 2CHOA 4NSBA 1XRVA 1GCYA 2FH8A 1C8QA 1OGSA 3BAXA 3AOFA 3DX2A 2J62A 1QPKA 1W91A 1VBUA 2BNJA 2UY3A 3WDPP 1OGBA 3ALFA 3AROA 1JZ2A 3EYPA 1RP9A 3AHVA 1E6QM 2VX5A 3AS2A 2QMKA 2CEQA 4D1IA 2XN1A 1H41A 4URIA 5A6AA 3ZSTA 5ABHA 4HMEA 3FN9A 3AIEA 1TG7A 1VEMA 4FNUA 1QNOA 1ZBWA 2D1ZA 1UKTA 2G3JA 4JL2A 3HG2A 3AMLA 3BMVA 2DT0A 2XTKA 2J7BA 4H8UA 2XN2A 1GONA 3CZEA 1CGWA 4W93A 3RIKA 1Y7VA 2WKLA 1R86A 1SYTA 2W66A 2ZX6A 4UFJA 2Y5EA 1J10A 4HZ8A 5GNZA 2VX4A 1FP9A 1NP2A 4AXNA 1PPIA 3W82A 4MB1A 3IAQA 2WVSA 5ABFB 4UQEA 2OW6A 1VFMA 2CBUA 2JALA 2DSVA 1UR9A 4PMXA 1JL8A 2ZX9A 2CETA 4MNMA 4V2XA 3SCUA 3W25A 1J11A 1V3LA 2GJPA 1OWQA 4GI8A 1DWFM 4TVDA 3W29A 2PWFA 4B16A 4AWEA 2A3AA 1ECEA 3CHCA 1FHDA 1EDQA 3FHAA 3F5LA 2VX6A 1DWHM 3VGGA 1MQRA 3OG2A 5I2UA 3WDJA 2DGAA 4OGZA 4PSRA 4MJ4A 3VIGA 4C7DA 3AXXA 1HVXA 1EDTA 2EPMX 3NYDA 3BAKA 4AD5A 1QHOA 5ABGA 4W7WA 5E6ZA 1ITCA 3N1AA 5GPRA 3CZLA 2YKKA 3W37A 4MJ2A 1NQ6A 1U33A 4OZOA 4F8XA 4AZ6A 3GXPA 1G0CA 4AZHA 2WHJA 3NSXA 4P8UA 3VTRA 2OW7A 4OKDA 3MUY1 2ZUMA 2D24A 2GJXB 3WY1A 1E6RA 2DSUA 5KEZA 4ZFMA 4UFKA 1WZLA 2RGLA 1R85A 4QCEA 3DX1A 3EJRA 1C90A 4DO6A 3GDBA 3II1A 2WZIA 2VMFA 3ECQA 2XIBA 2VQTA 1WZKA 3QGVA 2BVDA 3TTSA 3CUIA 1UZ1A 2TAAA 2F1BA 4WSJA 1XYZA 1Q6DA 4E8DA 1JXJA 2WVVB 4R27A 3O9NA 5I77A 3WY3A 5M17A 3GXIA 5D9MA 3M7SA 4ML4A 1H5VA 2EADA 3K8KA 1JDDA 1H2JA 4QLKA 5BXTA 2NT0A 3MKKA 4AD3A 3N13A 3SUSA 3PTQA 2X8RA 5D9PA 1OCQA 1TQSA 1BPLB 4D71A 4PTXA 1JFXA 4MAVA 2XWEA 1HWWA 3POHA 1MW1A 3I3EA 4NXSA 5C71A 1W3HA 1JYXA 4E2OA 4FMVA 4Z2KA 1G9HA 2XM1A 1MXDA 4AEEA 2VRJA 2YL9A 1V6UA 1C7TA 4MNLA 2BVTA 3EDFA 1E71M 1MQQA 1D7FA 1B2YA 3BAYA 5BYWA 3D5HA 2YA0A 4EKJA 4QDMA 1JYNA 1GW1A 4CU6A 3DYMA 4P7NA 3OLEA 1XHGA 4Y7EA 3QHMA 4CUCA 4P8XA 1QWUA 4BQ5A 4XZBA 3ARTA 3AI0A 2UY2A 1K6AA 1QX1A 2XVPA 2XVGA 4W5UA 3AHZA 5D4YA 2FGZA 3UR7A 2W67A 3T2OA 2F8QA 5I78A 4M29A 4HOZA 2BFGA 4MPKA 1SR0A 3CZNA 4J3UA 1HJQA 2ZICA 2VCAA 1EDGA 1HKMA 1MYRA 4WF7A 2MANA 3T0AA 3VIIA 3CUHA 1UR0A 1D3CA 4A3HA 3EJTA 3BAIA 5LA0A 3EMCA 2CKRA 2J79A 4UFMA 5BXPA 4OJYA 4UQDA 2PF0A 3OGRA 2VZTA 1UKPA 4RL3A 1E15A 3ARRA 2F7OA 1BYBA 5IHSA 1B90A 3KLKA 1EIBA 1NP0A 5D9NA 3EJPA 5EFDA 4AZIA 2OWCA 1US3A 8A3HA 3WNKA 2WYSA 4PSPA 3AYRA 5DT7A 1YHTA 4KRUA 2OSYA 4KH2A 1UH4A 3A23A 2OSWA 4JIEA 1UYQA 4GO8A 1W2PA 1TMQA 3AXIA 1HP5A 2WXDM 4JHOA 3M07A 3WF1A 4DUXA 1CECA 5A6BD 1KXQA 3A4XA 4TX6A 1FP8A 2WVUA 4W89A 5I6SA 4E4PA 1XD0A 2XFYA 1HJXA 4A4AA 2YIHA 1C3FA 2PWEA 4L4OA 3BVVA 3EBVA 1CTNA 1LL7A 5A6MA 2CPUA 3APGA 3K4AA 1VJZA 2YJQA 5E1QA 2VR5A 2J77A 1V6XA 3WH8A 2DT1A 2BXZA 3GNPA 1C93A 4JCMA 1F4HA 3PZQA 3H55A 2XUCA 2XPKA 5IHRA 5FD0A 3K1DA 6A3HA 2WNWA 2EAEA 4CVUA 4NX0A 5D9OA 3VIJA 3S5ZA 3ZO9A 1P6WA 5CSYA 4UOQA 3WUEA 1XD1A 3L4YA 1OIMA 3BCFA 3PZTA 1CGYA 2WAGA 3WFZA 3WELA 1GHSA 3WFLA 2W61A 3L4VA 3F5KA 3SCWA 1UD8A 2W4XA 5A6KA 4ATWA 3GXFA 1FH7A 2DSZA 4HOWA 2J7GA 4S3KA 1CYGA 3GTNA 4AIUA 4B9ZA 2WCAA 1XC6A 2Z1KA 1WCGA 3W27A 1BSIA 1HKKA 2XSAA 1BF2A 4X0VA 3PHAA 1UA3A 1E4NA 7A3HA 2WWCA 2VOTA 1MXGA 4GZEA 8CGTA 4EANA 1VFFA 3CTTA 3MV01 2FHCA 2WWDA 4UFIA 4ATLA 1QI2A 3QR3A 1B31A 1UR8A 3WNNA 1KB3A 3ZJKA 2ZUUA 1S46A 4ZE4A 3BAJA 5AC5A 3WQ8A 2V3FA 1CXIA 1BHGA 4C7FA 3AZSA 1HNYA 3W53A 3VD5A 1QWNA 4XB3A 3HMCA 4AW7A 1N82A 3T2PA 3ARYA 4WKFA 4LYRA 3M46A 1JNEA 3VDHA 4CD4A 1M04A 2JFEX 3MSGA 3OIHA 4AIOA 2QPSA 1OGGA 2EPKX 1TQTA 3WH7A 4ACZB 2X0HA 1OT2A 4MTVA 2D23A 3OA5A 2ZWZA 4TVUA 3W0KA 3WNPA 5A6JA 4D6FA 2IGTA 4JFSA 2OSXA 1CXHA 1R34A 1E70M 4UQ9A 3CC1A 1FHLA 2VT0A 2XG9A 1MW2A 1G01A 3POCA 5E9AA 3ZT6A 1HT6A 3A3HA 1HJSA 3OZOA 4W7UA 1W9DM 3PZOA 3A22A 2X1IA 4AZGA 1GOOA 1M7XA 1V3IA 4AIEA 4B3KA 3WDIA 1TE1A 2ZX8A 4NF7A 1BYDA 5CPQA 4CN6A 3WENA 3T09A 2DPEA 3CMGA 3ZSSA 4NXKA 3VD7A 3WD3A 1BTCA 4D6JA 1VAHA 1A3HA 4DWSA 5A6LA 3L4UA 2E9BA 1O6IA 2D3NA 3CH9A 4H41A 3EMQA 4WLCA 1EOKA 3BUQA 4PCTA 1HTYA 2VVSA 3PTMA 3VDBA 4JCLA 2J7HA 1JDAA 3FHQA 3EJQA 2WHKA 2WMJA 3QHNA 4DO5A 4M1RA 3BLBA 1UR1A 4HU8A 3IK2A 4JFVA 5EMYA 1JD7A 1C8YA 4P7OA 2Y8KA 1PX3A 3KL5A 2CBVA 2G3MA 3VM7A 1EOMA 2YLLA 3EDKA 1ESWA 3GM8A 1E56A 1ZS2A 2DT2A 5CLTA 4IISA 1LWHA 1NARA 3B8SA 1E72M 4YPJA 3LRMA 4PN2A 2Y4SA 2XSBA 4NI3A 1NWTA 2GDUA 2PWHA 3WMCA 1UWTA 3U57A 1UD5A 2GK1A 1W1VA 5E70A 1XCWA 1HP4A 4HPHA 2YL8A 3N15A 2BV9A 1XYFA 2F7PA 4DM1A 3CZSA 1UD4A 1CENA 9CGTA 5A2CA 1LJYA 3BLKA 2BY3A 3VX0A 4PMUA 5A8QA 1JYVA 1TR1A 3HG4A 2W5FA 2WSPA 1V08A 5A2AA 1VENA 3QOKA 4TOQA 3NCOA 4FLRA 2PBOA 3ARZA 4TTGA 5EB8A 4Z2HA 1KGXA 3CZGA 1ISXA 3VPLA 3WF3A 1Q6FA 4RE4A 2WMGA 1R46A 1E43A 5BCAA 1ITXA 1EA9C 2PBGA 2Y2WA 3RCNA 3L2LA 3WF4A 1EO5A 1Q6CA 3ARQA 1BFNA 3S2CA 1R7AA 4AEFA 1TA3A 1JXKA 2OYKA 1QBBA 2F18A 2VO5A 1X6LA 2WZHA 3SCVA 3S6TA 1XH1A 5HOSA 2WZEA 1BQCA 3KWXA 4OIFA 4DO4A 1PX8A 3W4RA 1ISYA 3H54A 1OIFA 2X05A 1X6NA 2V3DA 3CO4A 1E4MM 1B1YA 2E3ZA 2WMIA 4MDOA 1QBAA 1QI5A 4M80A 3KL3A 3NSMA 1JZ4A 3TV8A 2QF8A 4AZBA 2FYVA 4W87A 4HU0A 3TTYA 1V03A
chains in the Genus database with same CATH superfamily
3HAEA 2ZDRA 5AC8A 3MA9H 5KBLA 4QRFA 5C8JA 1F3TA 3RFZA 3OZKA 3BEVB 3K4WA 4LESA 3SY8A 2OTUA 1QNRA 2PO6B 1CWYA 4Y2LA 3LGEA 1WISA 2HG5B 1ZJBA 3EYFB 1IEVA 5F2MA 2P76A 2Y7NA 5D1XC 5AAMA 3QSRA 1RPXA 1GOWA 1S9VA 5D70H 4IS6A 1ZA6B 5AVQB 4P4KA 4JD4A 5K39B 4AENA 5DGRA 2Y8UA 3QW9A 3MPGA 2BNRD 4LB8A 5IW6A 2QW5A 2IAMA 3LYEA 1OWRM 5ILTH 5EMJA 4G82A 5CKSA 4V2CB 2QCLA 3W6MA 4WU7A 3BG5A 4X0KA 4XXDA 5E99H 3NQ2A 4LCCA 4L3EE 3S1WA 3NPSB 5FCUH 1UEYA 2GFBA 3WJMA 3FB5A 4EN3D 1IT9H 3L5MA 2P3ZA 2Y3NA 1TFVA 4IMEA 3GBMH 2PO6C 4QHNB 5LNDA 4FOUA 4URTB 4KROB 5BVPH 1Q85A 1RUMH 4P3CH 4YGVA 5TD4A 2BVPB 1WV2A 5E0FA 5JYLA 2XX1A 4HIBA 1PBGA 1XR2A 2ARWA 1OGTA 3H2PA 4XPHH 2YXFA 3E5BA 4LVGA 1OCRB 3HG1B 1FV1A 2J78A 2AJVL 1QNSA 2W63A 5EBLB 3ARPA 5ACMA 2J8HA 3NK4A 4W68A 4G9FE 2BDQA 4B0MB 4AG0A 5I0DA 2VDMB 1J8HA 1XSKA 2YRLA 3IN2A 2EUVA 2JTDA 3NQDA 1OHQA 3I02A 4K94L 4FFVC 4Y4HA 5M95B 3DGGA 1BD0A 5A2LH 5IXEA 2VZUA 5E6IB 4E4UA 1CD1B 3CVIL 5IMLA 2PYEA 1LNUB 3URBA 3NPSC 4I2XA 4APXA 2RAGA 4G1MB 1A7QL 5L8LB 4KCWA 1NSNL 3WD2A 4JZJA 1CFNB 4TUOA 4PBDA 1OSZB 4KROC 4QAWA 2CA3A 2EVJA 3TO4A 1BZDA 4KRLB 1QSEE 4GBUA 4DF9A 3UD6A 3M9YA 4JQVC 1UBSA 3NCXA 1YNKL 3MROB 4JFEA 4LQFH 1QG3A 2OU4A 3ARFB 4F5CA 4Z0BH 1ZLWK 1OGAE 1PU0A 5LNRA 1ECZA 3MRJB 3DK2A 2W9EH 5CJQL 3ITCA 2BZCA 3WTSA 4NEHB 3AM8A 3N9KA 3LNDA 3I3DA 2L7EA 5CGYD 4MMWA 3IN0A 3Q8EA 5BQ7B 1NCCL 3C5XA 5E6IC 4I88A 4GPNA 3GDMA 3HZYB 1WV7T 4BY3A 2JK5A 5GRJL 2P5EB 4KHTH 3FF7A 4XO6A 1Y0EA 1LE9B 3W7GA 3GH5A 1QVBA 5G1TA 5B38B 4OECA 4RFOH 1YMHB 3S3JA 2VLJA 4TRPL 2C18A 3PZ9A 1C29A 3K72A 4JJ5A 1UA7A 4K8HA 3TVMD 4MD0B 1OCJA 1DVZA 4XCCL 5L2KB 2O9RA 3VD9A 2GSIA 1RJYA 1OSEA 4YVPA 3IFNH 4KFNA 3P30L 4XH2A 4DVRH 5FM5O 2OXHB 1FCUA 5D7IA 3HC3L 5I79A 1XIWB 2GHZA 1L3NA 1SYSA 3WH6A 4MD5A 4Q8VA 3IMBA 1DWIM 1P4IH 2YOAA 4OI8A 4US5A 5BJTA 1RHHA 4NUPA 4V15A 1VSCA 1JRHI 3U5YA 3O2WL 2CDFB 3FV9A 1MCFA 5D7IF 4AIZA 2AMXA 2VIRA 4KCUA 2X1SA 1AY1H 2P45B 1MFEH 2OJEA 2YGVA 4KHXH 1U8PA 3EYVA 2FD6L 2GQAA 2DW5A 5D72L 5LQBH 4P61A 2V67A 4U5KA 2ZOLB 2XQYA 2PR4H 2X87A 3CLFH 1VCGA 2N01B 3L3KB 3BRGC 1L9PA 3IXAA 4RIRB 5GGSB 1V0LA 3O6CA 1RCQA 1J0YA 5I8EB 5C8BB 2QL1A 1XIWC 1YDPB 2REQA 3THDA 4AUBA 1ZKAA 3A4AA 3V4PL 1R9FA 4S2SB 2Y1YA 1IGSA 4OGXH 2XFRA 1JXDA 1T1YA 3WIFA 1OSPL 5CSRA 4G1EB 1WDAA 4YNYA 5CR8A 4G8IB 1WAAE 3IJYB 5EEVA 1L3WA 4X4ZA 2ASHA 5GNYA 4QRAA 4KDTA 4GEJA 5C0CB 1JN6B 1I8IA 1P7QB 3LQLA 5KANI 3Q1SH 4BSWB 3U82B 4LVNB 5IM51 2BNRE 3B83A 1KJ2L 4Q6JA 2R0LL 2OOGA 5ENWB 4CNIB 5LAXB 3C2FA 3QB7C 2CRZA 5MERA 4HNVA 4PEKA 2G3IA 4K68A 4KXBA 5SV3A 4W6WB 2WCSA 3MZTA 4Q8BA 3TBWB 2NUPB 1G43A 1UXWA 3N0AA 3D51A 1C7SA 2NY7L 4GRMB 3DJRA 3C2EA 3DXIA 1HKFA 1FXQA 3QNFA 3DX9A 1R2RA 4QITA 1LUCA 3DEQA 2VXUL 3V0JA 2W65B 4RMTA 1EPVA 5C54A 3OB8A 1FN4A 4PY7B 3ZM8A 3P82A 2VSCA 2H3KA 4IBLT 4BE5A 3QDMA 4WI2A 5AKRA 3MHZA 5I03A 2ATSA 1R9YA 1CGXA 1F02I 4LVNC 4BH7A 5KSUA 3EWYA 2Y88A 3TPUA 1VGEL 1OVDA 2GSHA 5EFFA 3SY0A 3OG3A 1WFNA 4CSZA 4XC3L 4U0RB 5ISZE 4Q6XA 5BWAA 2OS7A 3NYZA 3R0DA 5AZUA 4LAQL 2R0ZL 1QJWA 3MBED 4CKQA 3L9BA 3TKFA 4J1UA 4RX4D 1XGTB 3MZNA 2WBJA 1SUHA 1QI0A 2UUDK 5HVWA 4ABVA 2UY4A 5INDB 4HKBA 1E9PB 3TH6A 3CFKB 4JKPH 3BVNA 1NMAH 2GYIA 3P0XA 5JO5B 3UROR 3G1DA 3VI4A 4KH9A 2WLJA 2IQAA 4WJEA 2QUTA 3L5WA 1T66D 4IWWA 3D0VB 1ID2A 3QH3B 3QIWD 5TE7H 3TQKA 1F4AA 2CG9X 2NX1A 3UTTE 4LLYB 1MUCA 1E3ZA 2VWSA 2ZRXA 3HN3A 2R94A 2X1PA 3VI4F 4EUPG 3RWGA 3EOYG 2OCJA 4P8WA 1AHKA 1A6ZA 3BSZL 4Y8DC 3MCNA 2DWXA 4PJAB 4YR6B 2C9VA 3IACA 4OH2A 4OGQC 3VXUE 2HS6A 1WT5C 4XOBA 4MS6A 4PRPB 4EDWH 2PWGA 4KEVA 1JZ6A 5DK2B 4GG6E 3ULVH 2PETA 4HWBH 2W0PA 2E6PA 2EPOA 3REQB 4QY8B 2FEJA 2H3NB 4N87A 5GJMA 2G95A 2WMHA 3CIVA 3TDFA 4DKDC 3JWDH 1KTBA 3BAWA 3IPWA 2CPCA 2HRGA 1RV6X 3QJHB 2C14A 4DQOL 1TLKA 4WCJA 5U4NA 1DLFH 4JY4A 2VDLH 4U1KB 3QTGA 2N59A 5KYWA 1F3WA 1RQEA 3HQ1A 4OCRL 5D1XA 4QUOA 4QSFA 1E1CB 4KWUA 5C0JB 4XBGA 5E4AA 2EE6A 4Z2JA 4LAUA 4C6EA 4LU5L 4R8WH 2ZDSA 1M7DA 2R2BA 4F33A 3MWAA 5CF3A 3WH5A 3BARA 4O52A 4W8AA 3U2JA 2ZOTA 1AZCA 3U6RA 2UXFA 1G7MB 1VESA 4Y8FA 2YCJA 1GVOA 4L6DA 1UQSA 1POKA 4HPJA 4KCTA 3RVTC 5D2NA 1I2PA 3AICA 3FX4A 5HDQL 1FH5L 5TE6L 2NUTA 1UZ8B 2VSDA 1GUVA 2Q6ZA 4XPFL 1UQZA 2HG5A 4TX8A 2EDEA 4UTCA 4AL8L 1LO4H 2YWZA 1U2YA 2YQ3A 3OJ2C 2I56A 3PZUA 3KOZA 5IDIA 2JCWA 1CZ1A 3F7RA 2H41A 3WX7A 2H8PB 5C2UB 4H1LG 1WAUA 3LKNB 3R6IA 5I75B 1QATA 3HMWL 4F0LA 4MNHA 3OF6A 2JF1A 3EZ4A 4J28A 1BM7A 2F54A 1A1MB 3DPBA 4MAYB 4R7JA 4RJEA 3FSOA 3L1OL 2RUSA 3UH8A 3G6AB 4O02B 1WQVT 1S4IA 3B7UX 3L66A 4PMVA 2WKJA 4KJQC 3U36A 1TDQA 5AW7B 3HOJA 2OM5A 4XSLA 4NM8H 4R90H 2XQYK 2HWZL 3LOTA 3VXMA 2E59A 7CGTA 2H45A 5GRXG 2YUZA 3FNDA 2PEVA 2K8QA 3HG1A 4FO4A 5DELA 4W9FC 5B80A 2AK4E 4NAQA 1ETZA 3IWPA 2ZJSH 3A67H 2P88A 4TNFA 1QR4A 3S2AA 3Q44A 4NRZB 2VERN 1JUFB 5I75C 4YDIH 4OUUB 2CO6B 1JNLL 4HCFA 4XTRC 4XBSA 4PRTA 1XC4A 4KZCA 1ZT7B 4X60A 3GXUB 2MCAA 3QPYA 1OSYA 3MNVB 2PTYA 1LM1A 3WK1A 1QPKA 4MAYC 5CWSB 1IM9D 3VABA 1TWWA 3RU8X 2BODX 4LRNL 1TVLA 1TZOA 4G1MA 4E41A 2FYYB 4WENB 3MCLH 2BERA 3FN9A 3LS4H 4X4XA 4H20H 1OSZA 2G3JA 1V10A 3TV3L 3O2DA 2PDXA 1FQ9C 4LSDA 1MCQA 3F03K 5IB2B 5MP6L 4W93A 3LKSA 2DZPA 4NUGL 3INPA 4HQVA 1ZGLP 4AWUA 2FB3A 2Z93B 3MROA 2AQQA 1PPIA 2DQEL 2KC0A 1JCLA 1CFQB 2EVFA 1YHPA 3ABQA 4LFYA 5HMFA 1UM4H 3GW0A 2P8LB 3R0UA 3OG2A 5I2UA 2WJFA 3T6XA 3W07A 4OGZA 5IVXA 4WTZA 4PB4A 3TN0A 3CN0A 2VAAB 5BQ7A 4G6FB 5TFSL 1SLXA 1NQ6A 3L5JA 2NZIA 4QR6A 4GW1B 4F8XA 5B38A 1NBYA 4NUQA 4YTSA 2D24A 2HPMA 2ZVRA 1T80A 5IVXF 1KLGB 2VLMD 4UWMA 2BWGA 5F3FA 2CH8A 5CZRA 5L2KA 3IJSB 4S3FA 1KEGL 4DJDD 1PCKA 4N2IA 1A6TB 4QYOA 4AD3A 2RACA 3CSTA 1BWMA 2PP7A 4PD4K 3W0WE 1G9HA 4AEEA 3Q43A 2F6UA 3EH5B 2YL9A 3ORWA 1HEZB 4IMLA 3BG9A 2CDFA 1GC1C 4J8RA 5EFIA 3U1SL 3II2A 5JOFA 4TOYL 3MUGA 3MSRA 2QR0A 1TEGA 3R0KA 4JN8A 3CX2A 3TT3L 3LG3A 5E94A 4OFPA 2VC5A 1U42A 5JMUA 1MCCA 1XIFA 3CCHB 2F8QA 3ZVIA 2QHRL 3FU9A 3CZNA 3T8XB 4Q14A 2ZRVA 1HJQA 2Z8WC 4PU2A 1HKMA 4YHLL 2MANA 3TASA 1MG3C 5SWSB 2AJVH 3GKAA 2V9DA 3AXMA 3GWJA 3CVHB 3U46A 3EKCA 2J79A 4CDHA 5ACZA 2I5GA 5GGSA 4AY8A 5I8EA 4LMQI 5IHSA 1L9SA 4Q9RL 3P73B 5EFDA 2MCG1 1TG8A 1PDKB 4NDMB 1UH4A 4K94H 4XZUA 4Y9FA 4GO8A 1EJRC 2FWOB 1P0KA 4HZAA 3CVIH 4IBYA 2NX3A 3IGXA 4PJHA 1G0DA 1C3FA 1A7QH 4G8IA 3IJYA 3VUAA 1MNSA 1NSNH 4GACA 2J77A 1Q9LA 4DXKA 1JN6A 4V2BA 1EJXC 4WFHD 4B95C 3ZY7A 5EZLA 4MMYB 6A3HA 2EVHA 1F3DH 2X1RA 3NYKA 3O05A 1N8FA 1YNKH 4L4VA 2WAGA 4PJHF 3WFLA 4C6JA 4MA8L 2ACRA 1LYQA 2O6EA 1IC7L 1VFHA 4ROQA 1J87A 1WCGA 2OQJB 5AVVB 5CJQH 1MFMA 3QIBD 2VGLM 1YMYA 4TN9A 2NUPA 3P4LA 4X6DE 3MI2A 5AC5A 4OZGE 4I7UA 5DA4A 1NCCH 4F7MB 4O17A 2HVOA 1QWNA 5GRJH 3G3DA 4ACZB 4MA3B 4PY7A 4XNXL 1URIA 4TVUA 1WKEA 3TNBA 4TRPH 3WHE0 4QXTA 3ZT6A 2QQKL 4N9GB 4ZMNA 3Q48A 4JHAL 3MT1A 1RZKL 4AZGA 4U1NB 4PUUA 4XCCH 3MAWA 5DVNA 1TPXB 1TV2A 3VCRA 3VNJA 1VDGA 3P30H 4ODWB 5DURB 4LGRB 3ANYA 2QAPA 1VAHA 2XKNB 3O0LA 3M41A 1IT7A 5INCB 2PD9A 3HC3H 1VPYA 3FHQA 4JANA 1ZNNA 4J3OF 3C60A 1UR1A 4HU8A 2ZSWB 3T77B 1E9PA 5CPOA 4C91A 1AOZA 4BKTC 3KL5A 2ISSA 3CFKA 3O2WH 3GM8A 1R3IL 1TB3A 4PV1C 5XIAA 3L9EA 4JG5A 1W1VA 5B1AB 1HP4A 3SIKA 2DAVA 2FD6H 3QH3A 5HGBB 4W9DC 5F3BA 4YFLI 5D72H 3ULVD 1L6YA 3BLKA 2CCWA 1ROWA 4LLYA 3KBWA 3HG4A 4WU5A 1QBML 4IQEA 1TPXC 3F83A 4Z2HA 1ZVSB 3CZGA 3GNDA 5F9AC 1A25A 2GW5A 3JTTB 2YXWA 5SWQA 2PRHA 3L2LA 1I8JA 4PJAA 4WI9A 5BV7B 2XZQL 4E6MA 3F00A 3F4DA 2WZHA 3WGVB 3RVUC 4FS0A 1A1OA 3IDYC 1UZ6E 3V4PH 2V5SA 3SZ6A 2P7TB 4EACA 5I8OL 3L1EA 3VFSA 3RITA 3ALXA 1O7DE 2CE6A 2Z1XA 1YPZB 4PJAF 2NY2D 1OSPH 1OTUD 3C09B 1D5BB 2UWEB 1HL8A 1ZP4A 5JW4N 2IPFA 4MY8A 5ICYB 3MSDA 5J1AB 3L13A 5KN5A 5T91A 3QJHA 5EF1A 2GCYA 1H3PL 2VXVL 4UBDC 1AR1D 4ONOA 2BTMA 2AXGA 2XXFA 4J3TA 1E3FA 4ZZ9A 1KJ2H 2GY5A 5D1QB 4PV8A 3VFUB 1E9QB 3W7PA 2CBTA 2R0LH 3M44A 4JUTA 1UG6A 3WQCA 3OVQA 1W1A1 5BV7C 2K70A 1G0YR 2JIXA 5EY5A 3BUPA 2OO0A 3GRWA 3B34A 3ATBA 4E0CA 2NSXA 2NY7H 4KITB 1LOSA 4LARL 5DHYA 4P99A 3TOYA 2GVYA 3SE3C 2O9PA 1G7MA 1HINL 3N29A 5FKYA 3S5LG 5GISL 3WHXA 2IOMA 5ECUA 5F9WB 2VXUH 3C09C 4L61A 4DN3L 2OR8A 4UNIA 3H3PL 1XPGA 4QIUA 3T55A 3TBTB 1KTKE 2E68A 1I1CA 4FB7A 4MLJA 1CXEA 4S23A 4CN1A 4OF6A 2DB8A 3KZPA 3B2VL 4I87A 3RDTB 2YD3A 4XN9A 4XK2A 2CJUL 3FQYA 4K0OA 5D1QC 1VGEH 4XC3H 1OHLA 3UZZA 3VUPA 4Z77A 2W81C 4NZTL 2WWKO 1ZVHA 4HG4K 3VFPB 4NN6B 4F7CB 4LAQH 2R0ZH 3W71A 1D5MB 2H8PA 1ZALA 2CZEA 1BJ1H 5FK9B 1OB0A 3LKNA 12E8L 3LGDA 4XZWA 2FQIA 5CILL 3PGFL 1LQAA 4IL2A 1DQJB 3BO9A 2C7UA 3TJHD 4HUXB 1B0IA 1A1MA 5F9WC 4GJTB 3V4UL 4IUOA 2WN3A 3HGOA 4O02A 4F66A 3FOMB 1I8AA 3FB8B 3L65A 5L0QB 4Q9BA 3ET9F 3RDTC 4AC7C 3FT3B 4M7SA 4QSHA 1G9NC 3ALGA 3HAEB 5C8JB 1I2NA 5CD3A 4JQXC 3RFZB 4GXMA 2OTUB 2I14A 5DVOA 3NAAL 5C0AD 3BSZH 3IU3B 5I5JA 2E7MA 4NN6C 4FEZA 3H1ZA 3AY4C 3BXWA 3N9RA 3IE4A 1VBHA 2VEGA 1E4IA 3EEGA 1U8LA 3SCRA 1S9VB 1JUFA 4IS6B 4OUUA 2CO6A 4OOZA 3QJUB 1BKSA 4P4KB 1ZT7A 3EO1A 5AG8A 1NANI 2X4RA 2DVUA 3MNVA 1ZPTA 3CFQA 5CWSA 3ELFA 1JZ5A 4LS2A 4K1WA 4QROA 5IW6B 3SE9L 2IAMB 5BZAA 1W5NA 2FYYA 1YMMB 4MNKA 4BI5A 5TF1L 5F7UA 1I0BA 4B97A 5L0QC 4HCRL 4X0KB 4EWJA 3TTEA 4XXDB 4LCCB 1XL9A 1K8XA 4DQOH 2GFBB 4I1PA 3A6OA 5IB2A 3FB5B 3VGBA 3P81A 3RFZC 1H8NA 3GNNA 1NF7A 5HDRA 4C7GA 2Z93A 4C54A 4OCRH 5F8QC 3OOQA 3Q01A 1H62A 1UXLA 4TUJB 4LASL 4PRWA 3ZW3A 2G3FA 4LU5H 1JGIA 3ILPA 4ASTA 2VISB 3AT8A 1SJAA 5AAMC 1CXFA 4YDNA 2P8LA 3QKZA 3LRGA 1FV1B 4MNQA 4P4KC 2QPDB 5I6OA 3SY6A 2YRBA 2DLTA 1QO3A 4LAJH 4X3ZA 4QIRA 2BOEX 2DQ6A 4JKLA 2CITA 3B43A 1E5BA 4TLSA 4GW1A 4E9SA 4DPBX 3IGLA 3B8UA 4UCFA 3I02B 4PRBA 2W1NA 3WN5A 4N2OA 5HDQH 5HATA 1FH5H 4GY4A 5TE6H 4LCCC 1G6RL 2PYEB 4I2XB 4WZHA 3L17A 4XPFH 1KLGA 1AZUA 1M6OA 3UG4A 4APXB 1TQXA 3I6EA 4D8LA 4LCVA 3M0VA 4AL8H 1TVNA 2QVNA 4JZJB 1UOLA 5EMKA 2GI0A 4TUOB 2KMWA 3W7HA 3IJSA 2APWA 1FZJA 5CHNA 3QQ4A 3TO4B 1KR1A 3PWGA 4HJEA 3IIOA 1SQ7A 1ZL1A 2QV5A 1TQUA 2AQRA 5A5WA 1TX2A 3QIUD 4JFEB 4OCSL 4INFA 4B5TA 2GTQA 1KQZA 3OA3A 4WSKA 2VUOA 3HMWH 5IJVB 1I1XA 2VENA 4LSVL 3UJJL 3GHEL 4XBEL 4N2AA 2D20A 3S6CA 5AYZA 4JM4L 3OBEA 1TV8A 3MV8D 3WD4A 2OZ3A 3M7OA 3L1OH 3TC6A 5FV2A 1E51A 1P4LB 2DW7A 4KX7A 1EGJL 2YDQA 3HB3B 5JH1A 3OMZA 1W8SA 3B2DC 1I3VA 2BGSA 1CD9B 2VELA 1EFZA 2B15A 3D33A 3TA6A 1UJ3C 4TUKL 2HWZH 4PRNA 5GJSL 1PCXA 4BWLA 4JZJC 3S47A 2VP8A 4PCYA 3GRBA 3K72B 4JJ5B 1MAML 3TO4C 2NQDA 1E6OL 2UV8G 4G80B 3FT4A 2FZ9A 2PPEA 1OTSD 3SO3B 3M0MA 2Y22A 1ET7A 2ZZ6A 3NP4A 3ZE2E 4UTMA 4IHCA 4NJAL 2IBGA 1JNLH 2J74A 4CCEA 1MVUA 2IXVA 1DP0A 2JI2A 5D7IB 3OMAB 1LROA 4EXQA 4JHZA 8TIMA 4AHOA 3AVEA 1KA9F 1SYSB 3AM8C 4YFDB 4LRNH 2V5MA 1S39A 4EBQL 5BJTB 4H83A 3QPKA 3HB3C 5I6MA 3PNZA 4K7PL 4OOUA 1K72A 1PE1A 3TV3H 1Q94B 5E2WL 4P5KA 4AIZB 5MP6H 2ZX7A 3UJTL 4MMYA 2JMRA 4NUGH 5BU9A 4G8TA 2OJEB 3EYVB 4GMEA 3STCA 3G6MA 1W2VA 3KM8A 2DQEH 4P23C 1T5KA 4HWEL 2YUXA 4AMAA 1BYOA 1WOAA 1ISZA 5CJNA 4O1FA 3N55A 3SO3C 1UWAA 2OQJA 4HIIA 3WTVA 1VF8A 2E67A 1PLGL 4U05A 1W3JA 1NELA 4MGXA 3TUUA 1W16A 1TV3A 2O5YL 3IXAB 1EHKB 5CPSA 3VXTA 9XIAA 4OD1L 5DC9B 5TFSH 1V7YA 2REQB 2XH0A 1MELA 2DYPD 1N10A 1ZPUA 4ACZA 4MA3A 2XQ0A 1T1YB 2PP8A 4C55A 3C56A 4BFEA 3WIFB 4NWUL 1QFEA 4Y16A 2ZIDA 4LLVA 2W62A 3SBFA 1HZLA 4UQBA 5I24A 4NKCA 4YNYB 1B2WL 4U1NA 4AUJA 5BOJA 3WBEA 4F4RA 4M6PA 4X9IA 3TLLA 1I8IB 4J7RA 4YSQA 1KEGH 1QRKA 1X7QA 4YLCA 3Q9QA 5AZ0A 3UG8A 3BVWA 1UCBL 4L3ED 4N42A 2EE2A 5K7JA 1J9QA 4M24A 4JVUA 4N2LA 4PC8A 3F62A 3ZHKA 1CXLA 4W9HC 5TBOA 1SJDA 5HY9B 4FFYA 4IRSD 4PI0A 5EU7E 3CL6A 3FJNA 4UIOA 2J8TA 4X22A 3KDPB 5BUPA 4U1HA 3U1SH 4TOYH 1JF6A 3DX9B 3F85A 2ESCA 4CD5A 3TT3H 2QLYA 2V3EA 2XIJA 1BYCA 3CPGA 4G9FD 4UTFA 2B9AA 5CJMA 1FN4B 3KOXA 3T6WA 2QHRH 2WBWB 4WJKB 4KDTC 3LZRA 4YHLH 1MY5A 1YDNA 1YLVA 3KM1A 5D93B 3OVGA 1KJVB 1Z9MA 3K81A 4JBSA 5ABDE 3OJVC 2VL5A 5KSUB 3TPUB 3RK8A 4W9EC 2BM3A 3SY0B 4IIFA 3LRLA 4Q9RH 3T65A 2ZKXA 2V9RA 15C8L 2V8MA 4HMCA 2YMXL 3OR7A 5DLLA 1PLCA 3SRFA 2WBJB 1P9MA 5CXPA 1K3UA 1YPZA 3NCBB 3E3QE 3NCFB 5BS0D 5EPDA 2NSQA 3KPSE 3E0LA 5ABFA 3BVUA 2DORA 4L8SA 1D5BA 2UWEA 1LG2A 1FPTL 4HKBB 4QXUL 3BESR 2MCPL 5A6TC 5J1AA 3A4WA 1OGAD 4IOSD 4F9LC 1SMOA 3LDVA 3ID7A 3VZYA 2P5WE 1SO3A 3HUJA 1TPB1 2IQAB 4CC1A 5LGYA 2RAMA 3CB3A 5KW9L 1N4XL 3T6CA 3L5WB 3SCPA 2F8VA 1XX9C 1EGVA 3LEXA 3A5VA 2W5PA 1G5GA 3VFUA 2GGJA 2UWEF 2MQGA 5D93C 1N26A 2V5DA 4E9RA 4MA8H 1QW7A 1IC7H 4U5IA 2H2PC 1DR9A 3HUJF 3FW6A 3RWGB 3CTLA 1A6ZB 2VCBA 3U7VA 1T96A 5CZKA 3OQ3B 3FCGA 3A4FA 1HWGB 3IPFA 2G2PA 3ELQA 2WBJC 3DI0A 3SB3A 1ZP3A 5JR1L 3H9HB 1TZHB 4ZFCA 3MI3A 2FO1A 4XNXH 3UJ2A 4HBKA 3SQOL 1ONRA 3NSFA 1H6UA 3RDTA 4P06A 3OVPA 3CDGA 2YAQA 2OTDA 2QQKH 3QQ9C 1JAEA 4EMZA 2X12A 5DCEA 4JHAH 1RZKH 4UM9D 2OX5B 4JQXA 1F5WA 4FX5A 4S2BA 1CGSL 4DWDA 4Q0XL 2IDFA 4IJTA 2GTZA 1GGUA 2DUZA 3VILA 3CPUA 4JY4B 3QVAA 1NOFA 1P43A 3AY4A 1D5MA 5KYWB 3BWAA 1Z42A 2VWEE 3NJFA 2IGLA 3DZ1A 5FK9A 3HVNA 2YOCA 4APQA 4UINL 1C9WA 4XBGB 4X6CB 3QWRA 1O94A 1C8QA 4V1DE 3T0TA 2PODA 3D2TA 4A6GA 2B0MA 4PW4A 2CM6A 2GC7C 3CAQA 2YRZA 4IMDA 2BNJA 1DQJA 3WDPP 2R2BB 4F33B 3WTWA 4HUXA 2VZ3A 2CEQA 3ZDYE 1KFEA 1R3IH 3ZSTA 1II4E 4FG4A 1DZBA 3U6RB 3FOMA 2EXYD 3UDWA 2CAKA 4LS1A 2XTKA 4RZ4A 4TF4A 2A0LC 1NGWA 1UQSB 1A4MA 1AI1L 2XN9E 3FT1A 5D2NB 4UTJA 5MHBA 3CN2A 1QBMH 2J7LA 3QFGA 4NHUA 2NUTB 4RNJA 2CBUA 2JALA 4PMXA 3N4EA 3GAKA 4JG9A 2Y0SA 3CBKB 4I4WA 4AY0A 3LHTA 3IU3A 4MY9A 4ES4A 1GW6A 2E6DA 5KJRL 2FDSA 1GTNA 1HDMA 2HVNA 4PWFA 3MRDB 3VH8B 4BH8A 2XZQH 4YK4B 1CLOL 3VIGA 5ABTA 1OQXA 2VCOA 3S96A 1QHOA 3F1QA 4MUZA 1S7SA 2DQCL 5I8OH 1QSFB 5IUSA 4O1AA 1UWGL 3OC8A 3QXAA 3NSXA 4Y4KB 4XX1G 4WI6A 5KEZA 4D9QD 4LB3A 4MNHB 4FF7A 1YMMA 3F4CA 3UZXA 1R85A 4QCEA 4G7YL 3CS2A 5U7SA 4KUCF 3C5ZD 2F54B 3QGVA 2JKIS 3DPBB 4LAOA 2O6PA 2TAAA 4FA7B 4HPOL 5D2NC 1H3PH 3MQTA 3KLSA 3C6EA 2VXVH 3U36B 1IFGA 5I6LA 5LGZA 4J2MA 4X7CC 1EEPA 1ETJA 3JSSA 5JOPD 4L05A 2BW4A 1JDDA 1J5IA 1EDYA 2XWRA 1IIHA 1FAIL 4TUJA 3VXMB 4DGIL 2VISA 2YBRA 2YD4A 4YK4C 4Z2KA 4NPJA 3FQXB 4N5UA 1Y6KR 1ETZB 4LARH 1U3HA 1UCWA 1AD1A 2A6DB 3D09A 3ESVF 4HVBA 4F7PA 1HINH 4MRBA 2X0SA 5GISH 5ENLA 4UTWC 1SHMA 1WXYA 3NXLA 2INFA 1V27A 4Y4KC 4DN3H 4P7NA 1IEHA 3H3PH 3JTSB 3GD6A 3HE6D 4RETB 5ISZD 4NO2B 4HPXA 4XHJD 3PU7A 4OVUA 1UXSA 2XACC 4JO8A 2OOFA 3B2VH 2A6JB 3PXLA 1UJ3A 4EZKA 5K2ZA 2CJUH 4E41B 3VCNA 4MCNA 2I24N 5KMYA 1FF5A 2J24A 1ZUAX 4CJ0A 4MYPA 4X4XB 3B9OA 2N4IA 4R0LA 1KV3A 1KJ3L 4XWOD 4NZTH 3LKSB 1J96A 2XZ7A 4A8RA 3V6OE 5CZXD 2K6WA 5BS0E 1FCGA 3IUHA 2EH7L 12E8H 2Q02A 1ZHNA 4KX9A 1ULVA 2OSWA 2R69A 3EWDA 5IJVA 5CILH 5JOEA 1BD2E 3PGFH 2HTLD 1UWEL 3UTTD 4JDZB 4GNKB 2PPGA 5B1BB 4YJZL 3ASWA 4Q9QL 3V4UH 5IVXB 5AKQA 3TN0B 1Q9WA 2C3WA 3KCJA 1V6XA 1OE2A 2ICWI 1P4LA 4UTBA 4IT1A 3B1TA 3X14B 4HEMA 3HJZA 4TYUA 3VXUD 3GLZA 4Y1AA 3TWYA 1TJ1A 1NBYB 2Q1EA 4PWHA 2UY7A 4WXYA 3SRKA 1H7WA 1FH7A 4NZ4A 4P23A 3NAAH 3RGBA 3M6YA 2ODHA 2DZXA 1E50A 1E4XI 4G80A 4E3TA 1KLFB 4BFJA 1UR8A 1S46A 3QZLA 3BAJA 2YD0A 4WTQA 3WQPA 1HNYA 3UYIA 5D1ZD 3GJEA 4U0QB 1WCBA 3IU4L 4GUQA 4QYOB 5FM8A 1J1OL 1M6JA 1JWMA 2X0HA 4AVOA 5A6JA 3TN0C 1I0DA 3SE9H 1VIZA 4GVIA 3MXVL 1UUOA 1XINA 3GT6A 5TF1H 5CGBA 1DL7L 3E6EA 4KERA 4HCRH 4UMSA 2OCFD 4IMLB 2YC1A 2CBPA 1JK9A 1Q94A 2Z4QA 2UZPA 4J8RB 5EFIB 3VWJD 1PKQE 5JOFB 3MUGB 1KBLA 5CPQA 2QR0B 4RLDA 3ZSSA 2WXIA 1D7DA 3DETC 4KRPB 5E94B 4DWSA 2J27A 3CH9A 4LASH 5FGRA 2HROA 4ORGA 4R85A 4Z7OF 3A13A 4Y1TA 4P2RA 3RX5A 3QHNA 2VDRB 1FNEB 4DBSA 3ZE1F 2Q6WA 4GT7A 4LRTA 2EYTA 4LBUA 3U46B 1R1CA 5ACZB 2FT8A 1F6AA 4P05A 5AL8A 1B9BA 1VLXA 1UD5A 1ZK5A 1OZTG 1Z6JT 2Y61A 1MCNA 2OQLA 4PYHA 4XZUB 4GAAA 1MCKA 3BVDB 4X9GA 1G6RH 3KPPA 1U8JB 2DU2A 4PJHB 4JREB 1GZQB 4P5UA 4HCHA 1DCLA 1FKXA 1BJ8A 3S3DB 1Q9LB 4KRPC 2ZG2A 1XG4A 1N0LA 3PHSA 2J9ZA 2LW3A 1TA3A 5EZLB 3V1HA 2F18A 5SX4H 1N5YL 3S6TA 1UM6L 4L4VB 4JYFA 1YW1A 4OCSH 1NC4A 3MQIA 1A5KC 4D9QE 4DBUA 5DMJB 2P10A 4M80A 5AOIA 4JBRA 3GU2A 2FJGA 3P0VL 5HY9A 4LSVH 4HU0A 3UJJH 3GHEH 3JYBA 4XBEH 3V0VA 3WBAA 1YRKA 4LAZA 4JM4H 1Z32X 4LJ3A 2GUBA 4XMTA 4DIXA 1BZ9B 2IDCA 4GLEA 1U30A 3KLDA 4GOAA 1LRNA 5JOPE 1UGNA 1EGJH 3PDOB 2AK4D 2JKRM 4F9LA 1TJMA 4RMRA 3W81A 3EPMA 3WBWA 4JREC 2Z0UA 3EZJB 2JE8A 4TUKH 3GSOA 1LQ0A 4YSAA 5GJSH 1T0OA 1V0MA 3SDDA 1VFSA 2ON3A 1L6XA 9XIMA 1QOPA 3FY1A 4QXTB 1MAMH 4N86A 1OZQA 2EXSA 1E6OH 2BOCB 4BGDA 5C3TA 1KJVA 4OGAC 3HTWA 2VMCA 3RLUA 5JYMA 3BGAA 3MP3A 4MB5A 3UGUA 3QRLA 4OLZL 3W2KA 4U3CA 4NJAH 2JTYA 1A0CA 3TZFA 4M3PA 3CZJA 2WK2A 4C6CA 3DHDA 3LS9A 3NIGE 3AGVA 4Q7IA 3IPBA 4HEPA 3RPIA 2YO3A 5LXVA 4JANB 3C60B 1AGEA 3TA3A 1TSIA 2X7LB 4EBQH 3GS7A 4Q22A 3QCVL 3D30A 1EXPA 3COOA 4K7PH 1ZCOA 5TGBA 2F61A 3S36X 5E2WH 3NJHA 3GUGA 3FCBA 4NG3A 3UJTH 3EJZD 3AW5A 5D7LA 1XGZA 1N0XL 3AO0A 5F3BB 3OTRA 4HTYA 3H2OA 1F05A 2G3NA 4W5ZA 4KTYA 1E9IA 2R2HB 2AANA 1WA2X 4HWEH 4PMZA 4J3OC 3NBNA 4WU5B 4NQCD 5HI5C 1PLGH 3MYPA 4YGAB 1ILUA 1AW1A 5SWQB 1DJGA 5AEAA 5ERWB 4LSTL 4ZQPA 4A6YL 2O5YH 4ABWA 2QJJA 1YTDA 4X4YB 1UWQA 4OD1H 4MBOA 3P54A 1A1OB 4QTIL 1Q2RA 3C60C 3H9HA 1ERNA 1TZHA 2MJWA 2CHWA 4A04A 1PY9A 3VFSB 1AQ0A 3KGUA 4R4NC 4NWUH 5IJCC 2EF9A 4L6HA 1B2WH 3PS7A 4JS7A 5DJDB 2OX5A 2ACSA 5DU7A 2OZ4L 4GAYA 4ZAKD 3W0WD 4D6HA 2FLRT 5KN5B 4WK9A 1FVPA 2GCYB 4AMCA 1UCBH 2XSXA 3NJGA 5IGXL 3GFZA 2AXGB 2AQNA 2Y69B 4PV8B 1CDHA 4XR8C 4F0HA 1KFLA 1A6WL 1SQ2N 4C1KA 4X6CA 3TAOA 2ALDA 1ONEA 5CSUA 2JIXB 3EGSA 1FTXA 1TZAA 4PUDA 1XT5A 3CC5B 2EDNA 9RUBA 3FUDA 3KW8A 1O95A 3QLDA 4YBQD 4YL4A 5IBUG 3SOTA 3HR6A 4JKKA 5DHYB 5MKGA 5F7WC 4BINA 4X6CF 3WHXB 2P43B 3DJSA 1PZSA 4Y5YA 5FECA 4XODA 3ETBJ 3RTQA 4HA4A 4IDJL 5EZIL 4KY1L 2BPBA 3QZNA 3A3XA 3GR7A 1VIWA 5DGQA 2TRSA 2AQTA 1ECQA 1GQJA 3MRDA 5HJLA 3VH8A 2R1NA 3BD5A 2OZTA 3VUSA 1UUQA 3D0AA 1L2UA 4DO7A 4IGSA 1MCHA 4KFMA 4A2MA 4Z77B 15C8H 3WI9A 3I9GL 2YMXH 3BW4A 4F27A 2YR1A 3PP7A 1P69B 1QSFA 4J3XA 3CUXA 4UTWA 4H9VA 3N04A 4Y4KA 1CT5A 3GH4A 2EXWC 1QHPA 2SFPA 1MJ8L 1FPTH 4QXUH 1LHZA 4BRJA 2MCPH 2ENQA 4NJHA 2C7UB 5JQ6L 4BBWA 3PP3K 2WNKA 5KW9H 1N4XH 1NGQL 2EECA 4FJ6A 5A6IA 1E6ZA 7ENLA 2EPNA 3VIFA 5FM5M 4IOFC 2BX7A 3H7BA 1HCFX 1CZ8L 4OFVA 3HGRA 4UZSA 5CD3B 3W3BA 2RDTA 4KO9A 2NMSA 5GJPA 1R9ZA 1FBIL 3FQXA 3BLPX 4RDQG 4PMJA 2ZCGA 5M3WA 2BVWA 2A6DA 1FY6A 3BTNA 1GH7A 1U8LB 4LU0A 5K1NA 5JR1H 1PJ9A 2DBLL 3JTSA 4Y6GA 3EO1B 2J7FA 2IDQA 4BFOA 2XM2A 2IWGA 3SQOH 2X4RB 2ZUSA 4NO2A 4XCYA 3TU6A 3W3OA 2A6JA 5AHIA 2Z7GA 4FNTA 3W7OA 3VFNA 3DC0A 2EC9T 3CHEA 5A8MA 1TOXA 2J1XA 1CGSH 1UTDA 4N9OB 4Q0XH 1W1TA 1VHNA 5T9CE 1FWDC 4D72A 2BOFX 1XR8A 4GI4A 3HRZB 4K9EC 3K6DA 1SN5A 4AITA 1AXIB 3W85A 4JTHA 3B97A 4UINH 3N41F 5ECGA 4LFHD 3QJTB 5HNRA 1VHCA 5TE4L 4MFEA 3ILPB 4ZXOA 4EZMA 1KXTA 2DKSA 1DQVA 4JDZA 1S8DB 3ULUF 2OMWA 4MNQB 3M5VA 3W72A 1QO3B 2ZTJA 1HX0A 3STBA 3X14A 3P40A 2JQAA 4MS8C 3DFQA 3NTCL 5MHSD 4DXVA 3VU2A 5FM4A 1AI1H 1ME8A 4BKSC 3KBEA 4NQCE 4PRBB 3E12A 3WN5B 3BGJA 3V5HA 2O61A 3FDGA 3QY6A 4PUNA 2K9UA 4H26B 3BUIA 4YDZA 5K9OB 3BPLB 5BROA 1M6OB 4KRTA 3HRZC 4FG6D 5KJRH 2WSKA 1KLFA 4O57A 1NTDA 4BR1A 5IG7A 3FQ1A 4O0KA 2LR4A 1FZJB 1YYLL 5CHNB 3QQ4B 1CLOH 4ZQMA 4BWWA 2DKMA 4ZEPA 2DQCH 1UWUA 1UWGH 4CVXB 1AC6A 2NLJA 4B53A 1BIIB 3UWEA 1H8LA 1XUUA 4GFIA 2ESVB 4KKAC 1RJCA 4G7YH 4CQAA 1TREA 3RTLA 4D8AA 2AEQL 4DSYA 4O2CB 3STLA 3VGHA 2ZZ4A 3U2IA 3ZTJG 3AG3B 2XSKA 4HPOH 3G3LA 2X4OB 3F4VA 3WN5C 3CH8A 4NO5A 3KYKL 1TTPA 4PS8A 3ZGIA 3BPLC 3SCOA 2BGNE 5HD8D 3CDCA 4PRNB 3BWWA 1FAIH 1NCTA 4G1NA 3BP7A 1W1ZA 1JV5A 4DGIH 3AACA 1FNEA 3EADA 4C1NB 5FGCB 3FT4B 4LP8A 2PZNA 3DTDA 4FULA 3M0IA 3MBDA 4QJ1A 5DD3L 3P77A 4OZHA 3W7KA 4EVNB 4MXQC 4MCZA 1MVUB 2F2HA 2XHNA 1SXCA 2Y2TA 1XF5B 1UKSA 1LF1A 3VZXA 3NQMA 4XPGL 4Y5VB 4QAMB 3W00A 4ALAL 4PJDE 4HIEA 1OG6A 1TZIA 1XLIA 4E0RB 1U8JA 1E8YA 5E5LA 4Y9BA 1GZQA 2AMUA 5PCYA 1OINA 2F6KA 4OZHF 3Q2VA 2YL6A 4JRXE 4OWGA 1JUKA 4MNGA 2XG4A 2XH2A 3S2MA 4J3WA 1A9EA 4P5KB 4ANWA 5CEYB 4ZMZA 1Q66A 1KJ3H 4KK5D 3ES6B 3EH1A 2WZPA 4BWLC 4OCLC 4R9XA 5RUBA 2D22A 4FLOA 4QJ4B 4XVEA 2DL9A 2NY0D 3KS0H 1OM9A 3AQUA 2EH7H 3WLHA 1OZUA 2VFIA 4M5YL 1RL1A 1UWEH 2NR6C 4KK9D 4HIIB 4V33A 5I71B 5C2GA 4POZC 2DWSA 3ZWTA 5A8PA 4Q9QH 1BZ9A 5HI3C 4AWJC 5EC1B 3RPKA 4Y5VC 3VXTB 1XIMA 5CS7A 2ZA2A 3PDOA 3MO4A 3EDJA 5GRWA 4QRRE 4UMAA 2I32A 4Y7MA 1ZOXA 2Z1BA 5AAWC 1XMEB 3A9BA 3VSUA 2JSFA 2NZ1A 3D3VA 3DESA 2PDMA 1VRDA 4Y16B 2PTXA 4LLVB 3W9ZA 3WKPA 2A3BA 5FYJU 1DV7A 3AIVA 1TX0A 2BOCA 4YFLF 5JHMA 4OCYL 3GAYA 1R17A 4GO6B 3B4UA 3G08A 4ZNCD 4AC1X 5K59F 4ADIA 3WFAA 3WIHL 3LHVA 2FO4A 1X7QB 1R30A 4JE4B 3MHUA 5AY7A 5EYWA 4QXIA 4Y9PA 3UERA 1Z5YD 5FCZA 3IU4H 4Q4KA 1YECL 4KXZH 3EIFA 4QE4A 2GOUA 3AIUA 5I71C 1J1OH 3SGUA 1IU1A 3IDYB 2EDYA 1CR9L 2X7LA 3ARUA 3V4VB 2PCYA 3MXVH 4XMWA 4I9JA 2JF7A 3UTPD 5CSSA 1W0VA 1DL7H 1E7UA 1JAKA 3LA4A 3LPPA 4P5TB 3TXZA 2F08A 1OHZA 3ZFHA 3RE0A 2HA1A 3SB0A 3OKNA 1A5MC 4GBXD 3HIJA 5SWZE 4PB5A 4U1HB 1L6ZA 5LXXA 3UPCA 4Y16C 4Z1AA 3OGSA 2JJUA 5FOBB 2V9UA 2PDIA 3DVIA 2R2HA 1A7PL 4BV1A 3BOFA 1BBJA 3NJLA 2FJFB 1UPMB 3FEQA 2QIIA 2C13A 2VVNA 1D6EB 5ESVA 2Y89A 3PXJA 3LUTA 4XVTL 3UJRA 5ERWA 4MZIA 2QUUA 1BMWA 3CO8A 3EYPA 2VL5B 5MHSE 3T0XA 2VX5A 4X4YA 2NNAA 3DUHA 3PPEA 4NCC1 4HMEA 4X8XA 3T65B 1ZBWA 3JT0A 3W2UA 1UKTA 2D1ZA 2AL2B 3TH4T 3WFDL 2WKLA 3OR7B 3RHWF 4P5TC 3LHUA 1FP9A 5ABFB 4L8SB 2K1MA 43C9B 3PANA 2XZAL 5E0QA 5DJDA 2GJPA 1B4EA 1KCBA 1OFOA 2GSEA 4B2DD 3HUJB 3V9FA 4EN2A 2Q8BL 4LLUA 1N5YH 4XNAA 3LHPL 4IQLA 1UM6H 3LEXB 3T3PE 1X9UA 5M1TA 3SKUD 1T41A 3CHVA 4O8RA 3HPAA 3P0VH 5FDYA 4N4PA 1O66A 4U1JB 3CC5A 2CM5A 2MHAA 1GT8A 4PJXE 5B39A 1P7BA 2KBGA 4MSWA 2VQTA 3OAUL 1WZKA 2YGPA 4GUGA 5F7BA 1P9MC 1UZ1A 4JEGB 4HPNA 1HH9A 4FHBD 3L3OA 3O9NA 4L8SC 3K0YA 5DMLA 3M7SA 2DJMA 4C59B 1QNZL 2G97A 1R6VA 4PGZA 4PVBA 4JFHD 3WUZA 4XD4A 3CDGB 2CLMA 4JGNA 3BD4A 3NJXA 3M86A 3TWBA 3EWUA 4A37A 3HS8A 3IVSA 1HI6A 2GTZB 1C7TA 4OLZH 1TR9A 2QPEB 2GBTA 2YW4A 2APVA 5J12B 2WWNA 4QDMA 1JYNA 3BWAB 4ZGYA 3ITYA 4APQB 3TCXA 4BF5A 1QWUA 4ZRGA 1KRAC 3MJ8B 1BZEA 1HFBA 4W9JC 2VM3A 3QCVH 1XIHA 1HESA 5BUGA 2ICWJ 2ZICA 4Y89A 2WJ5A 1U3ZA 1EAPA 3H85A 3X1NA 4PWKA 3BDBA 3T6VA 1NGWB 1H5BA 2YXGA 1R3YA 1N0XH 5LWYL 3UWVA 1DBAL 3EJPA 4B90A 2CCLA 2ENPA 4LKXA 4KRUA 3HMXA 2CQVA 4NHUB 3C0SA 5AVUB 4I4WB 4WGXA 4N8VG 4LSTH 1HDMB 4A6YH 4W89A 5J12C 4RLIA 3IJIA 2XFYA 1KPVA 4BH8B 4APQC 1G7PA 4QTIH 3S96B 4C5ZA 3O2VL 1XLMA 4NJ9L 1OT4A 2IO5A 3CDYA 2ZTBA 4IMGA 2HT3D 1S7SB 5F89A 2R2CA 2EAEA 3VIJA 2Y25A 2R9HD 4UUIA 3QXAB 3QUHA 3PZTA 4HHMA 4IH3A 1GHSA 3RZCC 5DJZB 4M1DL 1IBFA 3UDWC 2E1WA 4ODTL 3L68A 4S3KA 2OZ4H 2Y7FA 3GTNA 4ICNA 3ETBF 4FAAB 1XIIA 1NFIB 5GJTL 3HRZA 2FHCA 4MCMA 3WNNA 3ZJKA 4M1CD 5IGXH 2JNZA 3JWNG 4CQBA 1PWMA 1A6WH 1NKRA 4AW7A 4JTAA 3UTPE 1M04A 2YARA 5LN4A 4AIOA 1S3RA 2QPSA 3L3HB 1OGGA 2ZCKL 3LV5A 4AGMA 3VK5A 2YBRB 4DKTA 1S8DA 5DRZB 4Y2NA 1JHLL 1QSVA 4QHKI 3CC1A 3BUTA 4ZSUA 4MPQA 5E9AA 3VB9A 4W7UA 2AV7B 1U3HB 3S35L 3QAZB 3IXTA 4QHPA 2OV0A 4F7PB 1RJLA 3M8OL 1Z8AA 4IDJH 5EZIH 1MUWA 5D4IA 4KY1H 1Q1JL 5HYJD 4HHPA 3IBOA 3BWUC 3PJNA 4ZQTA 3U0HA 4AZ8B 3KOWA 1UXSB 4H26A 4G11A 5K4ZA 5K9OA 4Y9GA 4LBEA 3FFSA 1UJ3B 3D4CA 4JPQA 3KHOA 1OK8A 3KPSD 4A7QA 3HG0A 4GRWF 3LCIA 1MWAL 1JPTL 4JPWL 2DLIA 3EA2A 4R0LB 1K03A 1VPXA 4EF3A 1QAPA 3I9GH 1CD0A 4XRCA 4S0SD 2P5WD 4KMTL 2DT2A 3Q8AA 1NARA 1YNTA 1VERA 3TW9A 3UBGA 1S5WA 1UWTA 1JRCA 3GYRA 4CVXA 4GLRH 1B4RA 3WJSA 2PUQT 1ZHNB 2BV9A 2GQHA 4F8NA 1BIIA 4ZX6A 4LL4A 1BQLL 4WK2B 5DJ2B 5A2CA 2ESVA 1LJYA 1MJ8H 1U3HC 4XC1L 3QAZC 5CBJA 4O2CA 5JQ6H 4HH9B 1E2ZA 5EN3A 3IT8D 3WU1A 4NKQB 4LSSL 1YNTF 1Q9WB 2X4OA 5I1EL 1NGQH 3ARGB 2I60L 3DVGA 1A1NB 2CZDA 1TYJA 2PF6A 1M7OA 4IZGA 2VO5A 1CZ8H 4XVOA 1EIXA 4Y1AB 1EYEA 3HQPA 4PUKA 1BWKA 1UGKA 3DFSA 2V3DA 4KAQL 1UWYA 3NQVA 1YTEA 2UY7B 3TJXA 1E27B 3NSMA 1OQOA 4R0LC 4P23B 4MSSA 4W87A 4C1NA 1FBIH 5DO2C 2J2ZA 4AX6A 4QLLA 3G0UA 4XTIA 3EUUA 5IHZA 3RGVB 2NR6A 2OXNA 4YN3A 4EVNA 1JTOA 4GIOA 4Z1YA 3N1GC 2P24A 2DBLH 3EX1A 2X42A 4B5XA 1LP9E 1M56B 3GJEB 1WCBB 1XF5A 1XB3A 4G6AC 4PEEA 4ZUSB 1J18A 4JFHE 3BN9C 3X1EA 4Y5VA 3P0YL 4JG1L 1JWMB 2O7QA 3NURA 5AAWA 4E0RA 3SKJL 2K7QA 4TLTA 4KPHL 3ARGC 4V1DD 4N0CC 1KBKA 1MDRA 1QPPA 2BY2A 4Z7OB 2YAEA 3YPIA 2YC1B 1JK9B 2Z4QB 5CEYA 2YDRA 2J7EA 3ES6A 3ZE1B 2HMCA 1WPCA 1PG7L 2Y6TE 4WKHA 4GW4A 4WTZG 3MX0A 2Z31C 3LCLA 4DWSB 5L8KB 3GLAA 1SY6L 2H2SC 3DHPA 2CDEA 3UWQA 1OAUL 3M5XA 5TE4H 3JBG7 2J7CA 2XN9D 4ORGB 3IIZA 2CA4A 4HSOA 5E51A 3RGVC 2YCEA 1KBBA 4IRZL 4P2RB 4JIRA 4XO8A 1M3UA 4KXDA 4IM4A 1IC5L 5E24E 2Q6WB 5ADPL 2J66A 2EYTB 5EC1A 4FI4A 4FP8L 2H6UA 2WLYA 1F6AB 2VKWA 2DI9A 2B20A 3NTCH 1V7ML 5D03A 1PKOA 5GNXA 2RMNA 1SM3L 2BOLA 5GSRA 1E5ZA 5EEXA 5KETA 1R0MA 4V27A 1TNNA 3KTXA 3L7FB 2IG2L 4QHUB 3H23A 3CUGA 2BP1A 4LSPL 4X63A 1MJJA 3SCSA 3KPPB 1OAXL 2VX7A 1ITBB 1BQ5A 5LIWX 2KKQA 1QBLL 5C9UA 4JXCA 1H1YA 1KM0A 5DN1A 5HJXA 1J9YA 1J01A 4DWSC 1YYLH 1WE5A 4LTSA 1Y5WA 4QWWD 1N0LB 1TA3B 4AD0A 2V4LA 4M7KL 3VGFA 4BHUI 1NC4B 4NAMA 1NDWA 2JGYA 3V4VA 2FJGB 1WDDA 4J6RL 5HJBA 4GVHA 2FB2A 3V79C 3WYRA 5DX7A 3MUZ1 3F2BA 3V0VB 2EIBA 2C9XA 4QGYA 1P0EA 2AEQH 2G50A 4P5TA 3SSZA 1BYAA 1AZNA 5EIVA 3KYKH 2YGOA 3N19B 3NDYE 1CICA 5FOBA 3V10A 3I6GA 3RB5A 3BUDA 3ZJAA 1FX6A 4WRHA 3GSOB 4JJHA 2FJFA 1TF4A 3BI9X 3SDDB 2PDWA 5B1CA 3JWOC 1D6EA 4LPCA 2IUZA 3ZYZA 4QQUA 5F7DB 4Y4FD 4YLWA 1CDBA 5BW6A 4H1ZA 2ZXDA 2B7OA 4FPSA 1WKFA 3UJSA 1ZJIA 3ILDA 1QWHA 5DD3H 1KLYA 3G3MA 2P1YA 2QJNA 2D73A 3QQ1A 2AL2A 4KEZA 5HYJE 1XLEA 3S48A 3EDDA 4XPGH 4A3RA 5E9NA 3RPIB 3LCHA 4ALAH 3CHQA 1SOSA 1AGEB 3TA3B 4QG8A 1H3XA 43C9A 4R7WA 3W7MA 4HPYL 4NZDA 3NP3A 1FO0B 4XP9L 1BD2D 5TGBB 1R3RA 3MV9A 4OI9A 3BE7A 2ZONA 1YO4A 4DH2A 4MA1B 3SDDC 1MRQA 4WQOA 1BEUA 3O6AA 5D7LB 2B4CC 3ZDZF 4NO0D 1W17A 1J5SA 1XZ0B 3CU1A 1JR1A 1PS9A 1KEML 4M5YH 1XEUA 4Y2DA 4NC0B 4U1JA 1MI5D 1OAJA 1WO2A 3VFGL 4K4KA 2PGEA 5C3LD 2WQWA 3CUPB 2XJKA 5LA1A 3C6CA 2Y36L 3C61A 1VA9A 1V3HA 1HW6A 2X89A 3TA3C 3QUZA 4GKOA 1O7AA 2CYGA 1EVUA 4Y9CA 4E9WA 1F42A 2KERA 2VFDA 3LBOA 2CJSA 3OPUA 1MEWA 5C5YA 1HHHA 4ADGA 4OCYH 3NJJA 4MA1C 1G7UA 1GOKA 5LBGA 4H40A 1HGYA 3USBA 4GAYB 2ZBTA 1LLZA 2R0KL 1N6QL 3NIFE 3WIHH 3NQ8A 4KZDL 2OELA 1PVNA 2UZIL 1HJVA 4E38A 1Z69A 3UA4A 3VWKA 1YECH 4B9FA 3QXWA 2V81A 3VE0A 2GABA 3P3BA 3OLIA 2X6CA 1CR9H 1Q90A 3MJ8A 5DRCA 3IM1A 4YXGA 3EGSB 3QEQD 1ND0B 5GS0L 3OKMA 2XFGB 1TO4A 4B9IA 3RZCA 4RE3A 3WFHA 5MKGB 3JQOB 1U8MA 4FXRA 2FJSA 1N18A 4C4KO 4Y5YB 5FECB 1XSIA 2IXQB 4S1FA 1CGTA 3RTQB 4BFFA 1A7PH 2IMNA 3BYTA 2E6YA 2EJ1A 3X1BA 5EDSA 1OAYL 5D2WA 2X4UA 2IOOA 4LQ1A 4XVTH 3GGWA 4OZFH 2EZ0C 2MTAA 4HCIA 4P3DB 5FPIA 3BZEB 2HKAA 5HQEA 1E6JL 2FT6A 4QG6A 4NJKA 1TETL 3AB0B 5F7FA 2CNZA 1RY8A 2XIMA 3LXCA 3QPQC 3HHRB 3NTYA 1Y1DA 4H8PA 5IBTL 4I7VA 4F8LA 3WFDH 2ZG1A 5C08D 5AVZB 4DBEA 4QM1A 4F79A 1XRFA 2BLFA 2YXMA 1IILE 1J2WA 1H1NA 3WLLA 1EFXD 5DJZA 3TA9A 2I26N 4LEBA 2XZAH 4H8WL 4ZENA 4DZIA 1UW9A 1KW1A 4Y5YC 3W26A 3A5FA 1FNGB 2N0MA 3O0FA 4NU7A 3RTQC 1NFIA 3THQA 1U8IB 2Q8BH 4AV4A 3LHPH 4CJ1A 5HUPA 2XBZA 3KPMB 1GEHA 3H7BB 5EC2B 1BXCA 3TGXA 2I7SA 1SF5A 2WLLA 1PHWA 2X2HA 4OQTA 3L3HA 3AU6A 3WJJC 4WJG3 3BWUF 5DHVH 5J04A 2F1EA 3AB0C 3ZZLA 2I17A