1V03A

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
487
structure length
487
Chain Sequence
IHRLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKGVEYYNKLIDLLLENGIEPYITIFHWDTPQALVEAYGGFLDERIIKDYTDFAKVCFEKFGKTVKNWLTFNDPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor milo
molecule tags Hydrolase
molecule keywords DHURRINASE
total genus 188
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v03A00
1LL6A 3BAIA 4P8UA 5HPOA 1P6WA 4MAZA 4K68A 2WVVB 3NDYA 5C70A 2WBGA 4CU6A 4PEEA 1ESWA 3ECQA 4QCEA 2FDMA 3AHXA 4PBGA 2ZXAA 3WEOA 1HIZA 1UR1A 1OWQA 1VF8A 4PMUA 2J7FA 3POHA 1JD7A 5FL0A 1V02A 1D2KA 1EXPA 4FLOA 4L4OA 1E0XA 4IISA 1E43A 1CEOA 1FA2A 3SCNA 4AZ6A 2BNJA 1ITXA 1US2A 1JI1A 3ZQ9A 2XVNA 1AQ0A 1TZ7A 1XH0A 4WIWA 2ZWZA 1KCLA 1RP8A 3VILA 4A3YA 1G94A 1OBAA 2WC4A 1HT6A 3KL3A 1XYZA 2PWGA 2G41A 4AC1X 1BSIA 1QI4A 4X9YA 4R27A 2OSWA 3WD3A 4MDOA 1H3GA 4AYSA 1FH7A 2X2YA 1HJVA 4NF7A 1BGAA 5EB8A 5CJ5A 4GIAA 1OD8A 1E72M 1QI3A 1EOMA 3PTKA 1B3VA 1CECA 1ODZA 2DT2A 5IFTA 3MUZ1 1JFXA 3MKKA 3HMCA 2BY3A 4EANA 3SCPA 3U5YA 3SURA 3M46A 1JI2A 1J01A 2YOCA 2VZTA 2VOTA 3L4TA 2WKLA 3WBAA 1C90A 2XUCA 5FIPA 4FLQA 4AIUA 4PMVA 3N13A 2J75A 1CWYA 4U3AA 3E1F1 3WMSA 3CZKA 3J7HA 1GVIA 5BXSA 5GPRA 2MANA 1OINA 2DSKA 3AIWA 1HP4A 1NP0A 4JCMA 1WB0A 2ZX9A 2YA2A 2XJ7A 1XRVA 3RM9A 4U5IA 3RM8A 4JCLA 3VNZA 3WQ8A 1UWIA 3MMWA 2VX4A 2FHBA 2VNCA 1E4MM 1EHAA 3VKKA 1UWTA 3VD4A 2WHLA 2ZX5A 5ABEA 2D1ZA 4LXFA 4L4PA 1HKKA 2WKGA 5ECUA 3II1A 3NSNA 1NH6A 3GM8A 5KEZA 1OB0A 2ZOXA 4F66A 3AHVA 3N12A 1G5AA 5I78A 1CXKA 1H09A 1XSJA 1BFNA 4PCSA 1EH9A 3T2QA 2E4TA 1HXJA 3AMCA 3DECA 3W81A 1B2YA 3GDBA 2WMIA 5CPQA 1C7TA 1E73M 1UR0A 4U2ZA 1M03A 4PSPA 2J79A 1R8LA 4D6HA 5BYWA 4AZGA 3IJ8A 4CD5A 3MMDA 1W9UA 3VM5A 3FXYA 1GNXA 3FAWA 1LJYA 3L4XA 2XVGA 1LL4A 1U2YA 1H5VA 1V0KA 4J28A 3KEHA 1JFHA 4AD2A 1EDGA 2PWHA 3NUKA 4RL3A 2DT3A 2WLYA 3BLKA 3WDJA 4OKDA 3PHAA 2BXZA 5AYBA 2EPMX 3VDBA 3VGGA 4LX4A 2CESA 3VO0A 5CGMA 1BVNP 5FL1A 1OIFA 3SUVA 3PZQA 1KFWA 4W7WA 2UY5A 2ZWYA 3PZNA 3HU7A 5F7UA 1JAEA 2DT1A 1R86A 3L4ZA 3MV01 4W5UA 1M01A 1M04A 1Q4NX 2A3CA 4N42A 2UY4A 1OM0A 8A3HA 3WF4A 1NM9A 3BAWA 3QOMA 4U2YA 1I75A 4KGJA 6TAAA 1JGIA 1KQYA 3VGDA 1AMYA 1TFVA 5DEZA 4D71A 3WH7A 1XH2A 5EMYA 4OOZA 5JBFA 1H0IA 2CNCA 1QHZA 2WYSA 4QCFA 2DH2A 2WMGA 2X0YA 3WMCA 1TE1A 1UG6A 4PTXA 2O9OA 5BRPA 2VMFA 2E40A 1RP9A 4CD4A 4MPKA 4HTYA 1BLIA 4MJ4A 1FP8A 3THDA 4JFSA 3CZEA 1QNPA 4AD3A 1XHGA 3WBEA 4AEEA 3VINA 3MUAA 2QLYA 1U33A 1EDTA 3AIRA 2CXGA 3VUPA 1OIMA 4CUCA 3WY1A 1TMQA 1UHVA 1UH2A 2JF6A 7TAAA 2W67A 3AS1A 1IV8A 1PJ9A 1FFRA 4W88A 4ZEPA 5D9PA 3VDHA 1J18A 3WDPP 2VI0A 3ZT6A 1G1YA 3CPUA 4MAVA 4FLRA 3VD3A 4GQRA 1V6UA 2VZSA 2C7FA 1E0VA 3BSHA 3TTYA 3GNOA 2WAGA 2DDXA 2QHAA 3K8LA 2VQUA 2J4GA 1TUXA 3ARUA 4YPJA 1E0WA 3WFZA 3ALFA 2G3IA 3WNOA 3GH5A 4CCEA 1JYVA 4PN2A 1BPLB 2OWWA 1QBBA 3OIHA 3WUBA 4CVUA 1XYFA 1JNDA 4AZHA 4D6CA 1W1TA 1H0GA 2DH3A 2VRQA 3B9EA 2BY0A 2HVMA 2XM2A 1VEPA 1Z32X 2A3HA 4AW7A 3NSXA 4J3TA 1HVQA 4WSKA 2E3ZA 1DWIM 3WD4A 1MXGA 3A4XA 4MNJA 2CYGA 1WZMA 2PF0A 1W9XA 3W4RA 1OT2A 4AZ7A 2WSKA 1MWOA 3BCFA 2PWDA 2E8ZA 3FNDA 4PTWA 4JIEA 1WDQA 1LG2A 1DEDA 1XD1A 3WDHA 1M7XA 5EFFA 3W53A 4UCFA 1J0YA 1GOOA 1QHOA 3VTRA 4AY1A 1K9FA 3WN6A 3UERA 1QPKA 1C8QA 1CXHA 1UD3A 4BCEA 4QAWA 3SCRA 2VURA 3PBGA 1UZ1A 2Z1KA 5JUVA 3B8SA 1VAHA 3VIIA 2EQDA 3ZSSA 2WVVA 3VD5A 3DYOA 3CGTA 4PYSA 4JKLA 1W9DM 1KXHA 3DHPA 3K4DA 1QW8A 3UG3A 1S46A 2FHFA 4S3JA 4F9JA 1E4NA 5BXRA 1KR0A 4M82A 4JL2A 1ECEA 4D6IA 2ZICA 1H11A 1LG1A 1CGVA 2BVTA 3S6TA 2YL5A 4UTFA 1VFOA 3OGSA 1BF2A 5M17A 3AHTA 2Y8KA 3DYMA 4IUGA 4AISA 3T08A 2YIHA 3CO4A 1JZ3A 3UEQA 4HOZA 4H2CA 4NZCA 3VIOA 4JL1A 4WJXA 4GZEA 3RM4A 1XV8A 3PZIA 1E1EA 2FH8A 1PEZA 2DGAA 4F79A 1W3JA 1ZBVA 4B9ZA 3WUEA 1CXEA 3G6MA 4HMCA 3SIMA 2WMHA 3CZGA 3EDFA 3VDCA 2O9RA 3LPOA 3RO8A 3A6OA 5FD0A 5LA2A 5CLWA 4WK9A 4PCTA 2W66A 4UNIA 2EO7A 5BXTA 5CZKA 3ZJ7A 1FOBA 1UR8A 3EMCA 3CUIA 3VGEA 1F4HA 3VIHA 2EXOA 2GJRA 4J3VA 3SCUA 3NIYA 3FN9A 6A3HA 4ZFMA 5HPCA 1VFUA 4TVCA 1CTNA 3DC0A 4PUDA 2XGIA 3F5LA 2QV4A 1EOKA 3LMYA 3AI0A 3BMVA 3RDKA 2JEQA 4FF5A 2G8ZA 2ZXQA 5A8NA 1MQRA 2OSXA 1NARA 3IJ9A 3T0BA 5CGTA 1VFMA 3SUTA 1WO2A 2J25A 2J7GA 4UOJA 1EQCA 4W8LA 1BTCA 1OSEA 4BQ2A 3SEPA 4Q22A 1FFQA 1V6VA 3OLEA 2EPOA 3WNPA 4JFTA 2JALA 3AFBA 1UWQA 2NSXA 3WEMA 3VD7A 5M5DA 3AMKA 2QF8A 1ZL1A 4KWUA 3W82A 2C0HA 1HN1A 2F8QA 2XFFA 3GNPA 3MSDA 1GOWA 1LQ0A 4LYQA 3AXXA 3K46A 2GUYA 4PMOA 3ZMRA 3F5JA 3W26A 4D72A 1QW9A 5I2UA 1W9VA 2RGMA 3CHFA 4QLJA 1GQIA 1L0PA 4H04A 1UWUA 3VIFA 3EYPA 2A3AA 1C8XA 2WW5A 1XCXA 4GZIA 1X1NA 3MUIA 1JDDA 1DWGM 2D3LA 2CITA 2YBUA 4AZ5A 4M29A 3FHAA 5CSYA 1R7AA 1YQ2A 4J3XA 1XD0A 1SR0A 4GKLA 1JZ8A 4KH2A 2J78A 1TCMA 7CGTA 5E0FA 2YL6A 1UUQA 4D6DA 2WPGA 5JIWA 1QVBA 1UH3A 4CGTA 4OBRA 2XIBA 1ISXA 1B31A 1SYTA 3AXIA 1VB9A 3N15A 1O6IA 2GJXA 2E8YA 2VCCA 1OCQA 3PTQA 4P7QA 1CLVA 1J0HA 3KWXA 5A2BA 1UWSA 1VEMA 2VJXA 1VBUA 3EBVA 5D8WA 4W8AA 3WQ4A 4ATWA 2J74A 1JZ2A 2XG9A 3WIJA 4UFIA 3L4VA 4ATDA 5A6LA 3SCSA 5HNNA 2X1IA 2G3MA 4W93A 4KRTA 1ZBKA 3GXMA 2QMJA 3SCTA 3WQVA 1JXKA 1QNQA 2IUZA 4TX8A 4MADA 4RE2A 1UD5A 4HOWA 4JFWA 3SUWA 5FCZA 1UKPA 3DYPA 1EIBA 4QLLA 1HF6A 2WM0A 2JF7A 4V28A 3M7SA 1UD2A 2EBNA 3WL0A 4BF7A 1ZJAA 2ZX6A 1K6AA 3BAXA 2DSUA 5D4YA 1PIGA 4D6JA 1JZ4A 3RPMA 4GI9A 3VNYA 4M80A 5A6KA 3MMUA 4TX6A 4TTGA 3AJ7A 1JYNA 3PZMA 3QHNA 3WUFA 4BA0A 3VIJA 2VX7A 2ZE0A 4U31A 2VZOA 3ARYA 4TTUA 1HJUA 1HL8A 1MVYA 1R7OA 2Y5EA 1MFUA 5A6JA 1FP9A 5EBAA 3VVGA 2V3GA 1SMDA 2ZX7A 1MQPA 3VIGA 3TA9A 4WKAA 1CGUA 4UFKA 4GINA 4M24A 2PC8A 4HMDA 2BY1A 1B30A 5JIPA 3ARZA 2IXVA 4BQ5A 1B3ZA 4YHGA 4QFUA 1JDCA 3WH6A 1WDSA 3I3EA 5IHRA 1J0KA 3AIUA 3WELA 4EE9A 4HZ8A 4AD5A 1E4IA 3EMZA 3GH4A 2O9TA 1CGWA 5A8OA 4FK9A 5E09A 2Q8XA 1X6LA 5BRQA 4W8BA 1ZB5A 2CHOA 3AMLA 1UD4A 2WC7A 5A8QA 5AC5A 2TAAA 1E6RA 1UH4A 2J77A 2WLZA 1QBAA 1WCGA 1GONA 3ARTA 4UZUA 4M1RA 1IZKA 2WVUA 1WZLA 2WMFA 1LF1A 2BFGA 5A8MA 5IFPA 1VRXA 3W6LA 3T09A 3SCQA 4LYPA 3MUY1 1MYRA 3A3HA 3WFLA 3CUJA 4P7OA 3OGVA 3PZGA 4MDPA 2VT0A 2VUYA 1OT1A 2WWDA 1PX4A 3CHDA 3MO4A 3GXFA 1UA7A 3CUHA 1QNOA 2D22A 2XVKA 2GSJA 2CBIA 4P8WA 2EEXA 1BYBA 1WNOA 3POCA 3WH5A 3GBDA 1K9EA 4AD0A 1VEOA 5DT7A 1GJUA 4JHZA 7A3HA 4JFVA 3WF2A 5C71A 2V3EA 2OWXA 1HKJA 1H4PA 1MFVA 1ZU8A 4GI8A 1GOMA 4WSJA 1H2JA 2QPSA 1CZ1A 3EDJA 3PZVA 3ZR5A 4HPHA 1KWGA 2WANA 1MW3A 4UR9A 1AQMA 4DWSC 5C8BB 3N17A 3ARWA 4PTVA 2WCSA 3WL1A 1ISVA 4FMVA 1F4AA 1E56A 1ZBCA 3ARSA 3U57A 2ZUWA 2D23A 2Y4SA 5BCAA 4HU0A 4DWSD 3IANA 4J27A 1B1YA 2CHNA 3T0AA 1GQLA 1W2PA 1GJWA 1Q6FA 3WQ5A 3AZTA 5LA0A 4N0RA 2GDVA 2Y2WA 2JIWA 3CTTA 4RE3A 5E6ZA 2OYLA 2OYMA 5LA1A 1AVAA 3QR3A 1NOWA 2VO5A 2CIPA 2X0HA 1HKIA 5A94A 2GDUA 5DF0A 2OWCA 4P7RA 3GYCA 5D8ZA 1JNEA 4AEFA 3WENA 2ZUUA 2WZEA 3FHQA 2C8NA 3JUGA 4V2XA 4OZOA 3OB8A 4D6GA 2NT0A 2YJQA 4BQ3A 4NRRA 5BROA 1Q6CA 4ZXOA 3QOKA 1KBBA 2YL9A 1B0IA 1J0JA 3AIBA 3THCA 3WQ6A 3WDRA 1PIFA 4XB3A 3TOPA 2J47A 1HJWA 1MW2A 3SUSA 1UKQA 1Q6EA 2YDRA 4UOQA 1JXJA 4OIFA 4EK7A 3RIKA 3U7BA 5E0CA 3A4WA 1ISYA 4IM4A 3VU2A 4AZCB 5I0DA 5IXEA 1KGUA 1WZAA 1CGYA 1XSIA 4TUFA 4ZXLA 4Z2IA 1MXDA 1V6WA 4UOZA 2CBUA 3QHMA 5HXMA 4V27A 1EDQA 1BAGA 1Q6DA 4W7UA 5AC4A 2DSWA 4MNKA 3WNLA 5I24A 1W3LA 3I3DA 3VIPA 2A3EA 2GK1A 3NJ3A 2WMJA 1O7AA 3G6LA 2Y24A 2X09A 3B9AA 4B9YA 4Z2GA 2V3DA 3VX1A 1C7SA 1IT0A 5HOSA 1A3HA 5CG0A 5HBFA 4DUWA 3O9NA 1GOKA 3FY1A 1ODUA 4EAMA 3VM7A 4URIA 1HX0A 2XTKA 1V3MA 2D24A 2VVNA 3OBAA 2WHKA 2GJPA 4HZ6A 4H7VA 4AIEA 2PB1A 1E6PA 1LL7A 3OLDA 3VX0A 3VMNA 4HPGA 3UR7A 1HJSA 3OLGA 5DT5A 1BG4A 1IZJA 2BXYA 4JFUA 2O9PA 3VPLA 5M3WA 3SUUA 4YN5A 2ZXBA 1GVYA 1DWJM 1CDGA 1GCYA 3T0DA 3BAYA 3BAKA 5CSUA 1MQQA 3N04A 1V3HA 1C91A 4TOQA 2GFTA 4CN4A 1J10A 3HJEA 1KCKA 1UR9A 1HVXA 2AOSA 2DT0A 4JAWA 4Y7EA 3A47A 1C92A 3VIKA 5D9OA 3N9KA 4KMQA 5A2AA 1HL9A 1V3IA 4H8UA 1RH9A 1QI0A 2XVLA 5EFDA 3CHEA 5DFAA 2EPNA 1V3LA 3AMDA 2VL4A 2JFEX 3OZPA 4TVUA 4MNMA 1QNSA 3AZRA 4PMDA 4MTVA 1BHGA 1H1NA 2VVSA 1E3XA 2OLHA 3W27A 4J3WA 1FH9A 1PZ2A 1US3A 1NWSA 4P7LA 2VZUA 4WLCA 1HP5A 3GZAA 3L2MA 3WEZA 4OOUA 1I1WA 1SMAA 1LWHA 4E8CA 2ZUVA 5JBEA 4AZCA 2D0GA 1PPIA 5KZ6A 1FHLA 2WMIB 1E3ZA 1QHPA 1GQKA 4XZBA 1E1FA 2OSYA 1CPUA 1VIWA 3BGAA 1WPCA 1EQPA 2YDQA 2FGLA 3UESA 3D3AA 3BH4A 1WZKA 3K8KA 1OD0A 4X0NA 1CXIA 4DWSB 2CETA 3WMBA 2WWCA 1CXFA 4KRUA 3NSMA 2VCAA 4B3KA 4DM1A 1CENA 4S3KA 5TD4A 3IJ7A 1WKYA 1V3JA 1KGXA 4LQ1A 1BYCA 3UCQA 2PI6A 4D1JA 1JL8A 2W91A 4PMNA 1GZJA 2VX6A 5JBDA 2EPLX 4BQ4A 2E0PA 4WKHA 1CIUA 1FHDA 2PBOA 5CLTA 2XVPA 3NCOA 3VIMA 8CGTA 2BVDA 4JHOA 3F4VA 2AMGA 5IDIA 3GTNA 2VRJA 3ZJKA 2CPUA 3VD9A 1MW1A 5CPTA 2BHYA 4CU8A 1PBGA 2W61A 1VFFA 2Y8VA 2CCRA 1ZBWA 1V0LA 3PZTA 4D1IA 4AD1A 2CBJA 2E9LA 3VMPA 3WF3A 1ISWA 3U5UA 1TVNA 5ABFB 1PZ3A 1XGZA 2FH6A 1B3YA 4R5EA 3UETA 3AXHA 3PN8A 3TONA 2NT1A 4XX6A 5A6SA 3AQUA 1E6ZA 1EHNA 3MS8A 3ALGA 2E9MA 3WUGA 3TP4A 3WNKA 2W5FA 2J7DA 2J8FA 1EO5A 1YHTA 4H41A 3ZM8A 1UKSA 3AIEA 4A3HA 4Z2LA 2WXDM 1NWRA 1TVPA 4CVWA 2NW0A 4OUEA 3ARRA 2ZX8A 1JG9A 4MJ2A 3ZOAA 3ZSTA 1J0IA 2ZUTA 3M6DA 5E6YA 1JF5A 1LLOA 5A6MA 1JDAA 1UR2A 3ARVA 1D7FA 3AIQA 1JZ5A 2G4FA 3N11A 1W1YA 3ZO9A 1NQ6A 4Z2KA 2JEPA 4ACZA 3CZJA 1V03A 2ZXDA 3W28A 1VJSA 4CD8A 3TTSA 4RE4A 1WE5A 4AWEA 4Z2JA 3M07A 1EA9C 1DWHM 3K1DA 1W9PA 1JAKA 1NP2A 3CHCA 2XWDA 2WNWA 3BXWA 4W89A 4CN1A 4LYRA 2PWFA 4BS0A 5IHSA 1WDRA 2WCAA 3OGRA 4M81A 1AQHA 1J11A 1V02E 4XV0A 4M8UA 9CGTA 4NI3A 3AYSA 2WC3A 4GO9A 2VTFA 4X0VA 4UFLA 1JIBA 1UD6A 5CPSA 3RILA 1K9TA 4UQ9A 2DSVA 3L2LA 1TA3A 1V6YA 3A4AA 1QNRA 3HN3A 4UQAA 3BC9A 1TG7A 4HMEA 2RGLA 4U33A 3CZ8A 6CGTA 2VQTA 3WD0A 2A3BA 4F8XA 1U30A 4M56A 4PRWA 2Z1SA 2DSZA 3WH8A 3MV11 1VBRA 2BV9A 1BYAA 1RPKA 5ABGA 1GOIA 1DWAM 1E4LA 1UQZA 3WDIA 3BLPX 3MU7A 4TVDA 4QDMA 3IAQA 2YL8A 3O6AA 1E5NA 2YDSA 1DTUA 4ZENA 1W9BM 4PMZA 2VR5A 1QI2A 3K8MA 2WK2A 2G3JA 4AIOA 3AZSA 4ACZB 3AOFA 3GXDA 1B9ZA 2QPUA 3CUGA 2J7CA 2J7EA 3RJXA 3ZT5A 4HA4A 3WD1A 4C7DA 2WVSA 2XPKA 3GNRA 1E40A 3WD2A 1GW1A 3WH9A 2WHJA 2PBGA 1E71M 4EKJA 1B3WA 4MNLA 1JYXA 4GZJA 3EDDA 1ISZA 2BS9A 4W86A 1E5JA 5I5RA 4W87A 4P7NA 1JD9A 3GXIA 3UR8A 1OGGA 5CQ1A 3T2OA 1UKTA 4GO8A 3ZT7A 1CXLA 1PX8A 2VX5A 1ZS2A 2UWFA 3TTOA 5BWFA 2YA0A 3WF1A 3F5KA 1UOKA 2WHMA 2BY2A 3CZLA 5BXPA 3EDKA 4IPNB 3AHYA 4OBSA 4P8XA 5A69A 3AS3A 1QI5A 2DPEA 3VGHA 1HJXA 1NOFA 3I3BA 2DEPA 3N18A 1W2VA 2V5DA 1HNYA 1EO7A 3VDAA 4PMYA 2J62A 1CGXA 1KXVA 1XCWA 2DQXA 4WF7A 4ACYA 4P8VA 4CU7A 1J12A 3IAPA 1FH8A 1G01A 2D20A 1C3FA 1CLXA 3WSUA 3QHOA 4GI6A 1GQJA 3OLIA 3VGFA 4AD4A 3CBWA 4IPLA 3S2CA 4DUVA 1J9YA 2DIEA 3N1AA 1GOQA 4FLSA 4HZ7A 4J3SA 1B3XA 2D0FA 1OGBA 1W91A 2CERA 3KL5A 4HA3A 4W5ZA 1LWJA 2F2HA 2X05A 3ZIZA 2D3NA 4AXNA 1KGWA 2ZUNA 1KXQA 2V38A 3KL0A 5A8PA 2GVYA 4D6FA 4MB3A 1TR1A 1GHSA 2QMKA 5GNYA 4DWSA 1E6SM 1G0CA 4KGLA 4H8VA 2B31A 3PZ9A 1E6XM 1W1VA 3AISA 3TTQA 5A1AA 2CKRA 3W24A 1KBKA 2WB5A 1M53A 1VJZA 1JZ6A 4H8HA 2JIEA 2DIJA 4A4AA 2O92A 4BZYA 2WZHA 4ZE4A 1V6XA 2UY2A 1W1PA 1UKOA 2XGBA 1BGGA 4E8DA 2XIIA 1V08A 2J7BA 3K4AA 3VMOA 2W4XA 1UD8A 4PSRA 4MB5A 3GBEA 2YBTA 1PX3A 3W6MA 4E4PA 3UG5A 4B3LA 2X8RA 3AS2A 3IK2A 1JYWA 3L4WA 2D0HA 3CMGA 2YKKA 4Z2HA 1Y7VA 4QLKA 4CD6A 1E9LA 4UFJA 2VC9A 2WVTA 2ZIDA 1GUVA 3W29A 2E9BA 3AICA 3W25A 4PMQA 4HOXA 1ITCA 3KE0A 1CNVA 3L4UA 5GNXA 4JZ5A 4YHEA 2XYLA 4UQCA 2ZUSA 4U5KA 4UZSA 3AYRA 3EDEA 2BHZA 1NWTA 3W0KA 3LPFA 1BYDA 1I1XA 4GPNA 1J0ZA 1WAWA 4MB4A 3ARXA 4W84A 1E70M 4AMCA 3BMWA 2VR4A 4UFMA 5CXPA 5I23A 3NDZA 5ABFA 4HA1A 3PZUA 2WBKA 1XH1A 2W62A 1DWFM 5HDRA 3WNMA 4LPCA 3SCOA 2F61A 1E6NA 1NWUA 1H49A 5FOOA 2D2OA 1R85A 2XSAA 1W32A 1GPFA 1WP6A 4XZWA 5E9AA 3WQWA 5A3HA 2AAAA 1VENA 3WDQA 2EJ1A 5I6SA 4ML4A 3CUFA 3OA5A 3VGBA 4CN6A 4C7FA 3CLWA 4ATLA 3OZOA 3RMEA 3MSGA 4JKMA 2JE8A 2XHYA 1CGTA 2WCGA 3SCWA 4E2OA 4TXEA 4HU8A 5I3DA 1DP0A 1G9HA 2ESCA 2PWEA 5GQBA 4Q7NA 1MW0A 5A6BD 4HP5A 1QOXA 2VRKA 5DMYA 2VZVA 3CMJA 2YLAA 3O2LA 2YLLA 3AIVA 3WKZA 4J7RA 1BG9A 3RJYA 5LYRA 2W63A 4NSBA 3CIVA 4UQBA 4GXPA 4XUYA 4B16A 4AZIA 4B15A 1V0NA 5GNZA 1A47A 1E15A 3WNNA 2WSPA 4AZBA 1JZ7A 4DUXA 4F9DA 1L8NA 3D5HA 4DM2A 1DHKA 1HKMA 4ZE5A 2VCBA 2J7HA 1JF6A 3T2PA 1UYQA 3GH7A 2GK1B 4GQQA 1CYGA 4QP0A 1X6NA 1UQYA 1KWKA 1E6QM 2FHCA 3AMGA 3FW6A 4CD7A 1N82A 5M03A 3PZOA 5I79A 2XFYA 2W92A 1B90A 3U7VA 2HISA 1H41A 5E70A 1R87A 3LPGA 2YA1A 4W85A 5A6AA 4UQEA 3CH9A 2WZIA 4MB1A 1E55A 2J8GA 3FAXA 3BAJA 1UR4A 2XSBA 1C8YA 4NRSA 5A6BA 4D6EA 1PAMA 4PMXA 2BHUA 3MANA 5FKYA 3LPPA 2WMKA 3AHZA 4UFHA 1CBGA 5AYIA 3W37A 1KB3A 3OG2A 5I77A 4LGXA 3RCNA 2XFRA 1UZ4A 4C7GA 2EPKX 1TA3B 2V3FA 4J3UA 3ZJ8A 2CEQA 3KZSA 3BCDA 1UA3A 3APGA 2XWEA 3AS0A 1C93A 1GHRA 3QGVA 3UG4A 4JKKA 1K9DA 2BVYA 2CKSA 1HJQA 2UY3A 4PMRA 4CKQA 2GJXB 5D9NA 4OJYA 1OGSA 1WDPA 4UQDA 5ABHA 1KR1A 3ZR6A 1BQCA 5DO8A 5A95A 2V5CA 3NYDA 2IXUA 1BVZA 1RD6A 1NOUA 4W7VA 1XSKA 2OYKA 3ZJ6A 1SFSA 3BSGA 3WF0A 1XC6A 2XM1A 1GORA 4CCCA 4CCDA 4PUEA 2FGZA 2CBVA 3DHUA 3VOCA 4WKFA 1KQZA 3EMQA 1W3HA 3ARQA 1D3CA 3W38A 1ZJBA 1EGZA 3B9DA 1W3KA 3ARPA 4U3CA 1KXTA 3L4YA 3SCVA 5A2CA 3PTMA 1UWRA 1V3KA 5D9MA 1Q6GA 1V0MA 2G3NA 4PTMA 3AROA 5AY7A 2ZUMA
chains in the Genus database with same CATH superfamily
1LL6A 1BVWA 3T0CA 3BAIA 4P8UA 3M44A 5HPOA 2YPIA 4MAZA 3LRKA 4GIYA 3Q58A 4LVGA 1R3QA 2HCVA 3SN0A 4PEEA 1ESWA 2PDKA 1G4TA 1M68A 2ZXAA 4PBGA 4DLFA 4I3GA 1WA3A 1S38A 5G1TA 3L5MA 1OWQA 1VF8A 4G1NA 3F7JA 2Y61A 4PMUA 2Z7GA 4RE0A 3S1GA 2XIMA 1POJA 4IISA 4MGGA 1CEOA 1ENUA 4X63A 3NOEA 3HQPA 2BNJA 1JI1A 1L6GA 4Q8VA 4Z42C 2ZWZA 1YDYA 1RP8A 3VILA 3P2VA 1OBAA 1HT6A 3KL3A 2QUMA 3MZNA 4IGNA 2NX1A 3QMRA 4D2JA 3REQA 2XFWA 2QJNA 4X60A 4MDOA 4PTDA 1H3GA 1PKYA 4WR3A 1FH7A 2X2YA 3ABQA 4NF7A 2PGRA 1KBJA 4XAYA 2V5JA 1EOMA 1B3VA 2GSHA 2DT2A 2OT0A 5IFTA 4XZMX 1YLVA 2QCFA 4QG9A 4EANA 4QGCA 3SADA 3QFWA 1DV7A 3SCPA 4GFSA 3E49A 3SURA 4QXIA 2YOCA 1FCQA 1XLFA 5FIPA 2YFOA 4FLQA 1YKWA 4AIUA 2J75A 4QDPA 2GVGA 1CWYA 1FWHC 4U3AA 1MEHA 1B4EA 5CC7A 4FX6M 4GUIA 1FVPA 3QMTA 4RV8A 1N7KA 4KWWA 3DENA 3TYAA 2ZX9A 3A23A 1U5HA 1WB0A 3QPZA 1FY6A 2V68A 4U5IA 2EF9A 4H9YA 4MVAA 3VC5A 3U0HA 2R82A 4NAEA 3ANYA 1V7AA 1EHAA 3JU2A 3H54A 1K7FA 4MJMA 1GK8A 1UWTA 1PL9A 4NZ5A 2ZX5A 5ABEA 4OV9A 5GVJA 2D1ZA 3W1PA 5HJYA 1HKKA 2WKGA 3GX9A 3TU9A 3RUBL 2DZXA 3GVRA 4XBJA 3GM8A 1XJBA 1E9IA 1OB0A 4ECLA 3N12A 2FFCA 1G5AA 4WCJA 1CXKA 2HS6A 4US6A 4X61A 4C91A 1HXJA 1E0TA 3GDBA 4JTGA 2Q01A 3GIPA 1UR0A 3BURA 4AMAA 1M03A 5AN7A 3B8IA 1SPQA 3GDTA 5BYWA 4CD5A 3MMDA 1W9UA 3PC0A 3B8DA 1H63A 3FXYA 3L4XA 1LJYA 1Q65A 2INFA 2XVGA 3ONCA 1Z7AA 4JS3A 2PDLA 3WQEA 1TWSA 4IL2A 3H24A 3BLKA 5I3GA 3PHAA 2BXZA 2CESA 5CGMA 3VCNA 4HHMA 4GJJA 3SUVA 4JX4A 3FKKA 4DO7A 2CLOA 3QV6A 4Y8EA 1M01A 2A3CA 4UTJA 5FF3A 2UY4A 3HQNA 3OQ8A 3N29A 3OO2A 4R9XA 3O1NA 2ZZ3A 3T8QA 5C9ZA 3QOMA 2OCZA 2A1YA 1I75A 4KGJA 2OB3A 3VGDA 4GVGA 4GY7A 3N4EA 3FA5A 2X16A 3DAQA 4S38A 4PCNA 1H0IA 1ICQA 2WPBA 1QHZA 4JXCA 3QN3A 6TIMA 2X0YA 3WMCA 4PTXA 3HG4A 4Q8MA 1SW7A 2PA6A 1BLIA 1FP8A 3KZPA 4DO4A 2QUNA 4HNLA 4KCWA 3MUAA 4LVFA 3C3UA 3AIRA 1XL9A 5FEPA 1G69A 1AQFA 1OIMA 1UH2A 4GX8A 3DFOA 3VDHA 3GYEA 1KTCA 3QC0A 3CPUA 2C18A 3VD3A 3NQ2A 1UBSA 1V6UA 3U9IA 3C86A 1VCGA 5AVNA 3BSHA 3GNOA 1AG1O 3GO2A 3MB9A 1TUXA 3WFZA 3VDGA 5C9XA 3T8LA 4PN2A 3NOYA 3L0GA 3KVLA 4Q7BA 4IGMA 3VE9A 1W1TA 4KFNA 2XH7A 4J2MA 2XM2A 3T4WA 4IT1A 2PZ0A 2VHLA 3WQOA 4HMNA 1KBIA 2E3ZA 1DWIM 3R2GA 1VGAA 2I14A 4F0RA 3NQGA 1WZMA 2PF0A 4ZOAA 4LB4A 2QYGA 4Z1DA 2ZZ7A 1MWOA 4LUTB 2E8ZA 2BODX 1LG2A 2JKPA 1DEDA 3WDHA 3W53A 1WUEA 1M1BA 2VGGA 3VTRA 1REQB 5F4SA 3VAVA 4TV5A 4GK8A 1QPKA 2VYOA 1VHNA 1UD3A 2W3ZA 2VURA 3VC6A 1UZ1A 2Z1KA 1OF6A 1EF2A 2QJHA 4GIRA 3G1DA 1TWZA 3UZYA 3VIIA 2BVWA 4C1NB 2AL2A 3CGTA 4QS6A 3DHPA 3UG3A 3KLLA 2FHFA 3I4KA 1LLZA 1E4NA 5BXRA 1KR0A 4D6IA 1DVJA 4PR4A 3QV9A 1VFOA 2HDJA 2Y8KA 3DYMA 4AISA 2YIHA 2J66A 1GVQA 1PDYA 4JQ3A 4HOZA 1WXZA 3ATYA 3TMQA 3BW3A 2W0UA 4WJXA 4GZEA 4ZMGA 1XV8A 3PZIA 1KTBA 4OTKA 8XIAA 3QYSA 4FNUA 3REQB 1I0DA 4B9ZA 1CXEA 4IPJA 4AF0B 3CAWA 5AOUA 3UFYA 2XN0A 4DI9A 3LPOA 3EX6A 5LA2A 1NDYA 4WK9A 4PCTA 1P5BA 4UNIA 2EO7A 1PKNA 5CZKA 3FKRA 3UY8A 1XINA 3EMCA 3VGEA 4IZGA 3C4UA 1GZ1A 4F2TA 4I7VA 1TPH1 6A3HA 3OYZA 3W71A 5HPCA 3RX2A 3DC0A 4ZO7A 3UBPC 4Y8FA 1EOKA 3AI0A 3CPRA 2JEQA 2PCQA 4FF5A 3DBPA 1O5RA 3IGXA 2OSXA 3A3WA 3V0UA 5J8LA 1TIWA 2OVLA 4H7CA 2G97A 2PE4A 4LC6A 2J7GA 3NTYA 4UOJA 4W8LA 4BQ2A 4PCPA 3LV5A 1JDFA 1FFQA 1R6WA 2TODA 1KLZA 1IXPA 1LRQA 3OLEA 2EPOA 3WNPA 4POCA 4FHAA 4TV6A 1LLWA 3MI2A 4DBDA 1XDMA 3VD7A 5M5DA 3AMKA 1WUFA 4JTJA 2PDJA 2F8QA 3GNPA 2XFFA 3MSDA 4Y9AA 4D8LA 1QTWA 1LQ0A 4LYQA 4FIRA 2ZQ0A 1WV2A 2QCCA 4DEFA 4E4FA 4PMOA 3ZMRA 3TJIA 5ECVA 2OEMA 2OKTA 4CNTA 1FCVA 1L6YA 3USBA 3TLLA 3ICJA 1V5XA 1UWUA 2X40A 3FJLA 1TQJA 1X1NA 2CLKA 4DJDA 4S2BA 1VD6A 4H9VA 4LS2A 4EVZA 2J9XA 4C6QA 3B8VA 1AK5A 4J3ZA 2GJNA 1YQ2A 3FK4A 3HFYA 3DFQA 4GKLA 2J78A 2YL6A 4UC5A 3R94A 2OODA 2RAGA 4S3DA 1YNPA 3AXIA 3M0IA 3E5PA 2Y5SA 1FRBA 1FWTA 1J0HA 4F0HA 5A2BA 4LRSA 1YRRA 2BG5A 1P0NA 1QT1A 1Q6LA 1EJSC 1WDDA 4UFIA 2P0IA 1LBFA 3TYCA 2QT3A 3L4VA 4ATDA 4UTWC 5A6LA 1BSLA 1QPQA 4WVXA 2VC7A 2X1IA 2G3MA 3PWAA 3GXMA 3SCTA 3T4CA 3WQVA 3LG3A 3UZ5A 2PD5A 1W5MA 3H4GA 5FCZA 4RE2A 3IPWA 1GW9A 1HF6A 5LIUX 3TVAA 4JTDA 3WL0A 3TZNA 3TH6A 9XIMA 1EP3A 2ZX6A 5D4YA 3H4WA 4GQGA 1DOSA 5A6KA 4B5XA 3CMFA 3XIMA 4G9PA 2DZUA 3QHNA 1HO1A 3WUFA 3UWUA 3N4FA 3NPVA 2C1IA 2VX7A 2ZE0A 4Q8UA 1EIXA 3SDOA 3Q65A 3OODA 5G2HA 2PDXA 3P14A 3VIGA 3WLIA 5G5IA 3TA9A 5DELA 2IKJA 4UFKA 2PC8A 4I6KA 2I5GA 2BY1A 5JIPA 3WJYA 1A5CA 4MY9A 2HS8A 4HCDA 4GCAA 1B3ZA 1XF0A 4AC7C 1JDCA 5I07A 2C15A 4JTUA 3EGJA 4PB4A 4WZHA 2ZADA 4GXMA 3AIUA 3QSRA 3WELA 4EE9A 5MKGA 3EMZA 2O9TA 5D2TA 5E09A 2Q8XA 3A5FA 4H9MA 1ZB5A 2CW6A 3GDKA 3AMLA 2WC7A 5AC5A 4GZ7A 4PEKA 2TAAA 1YE6A 3B8TA 1E6RA 5EMMA 5BOEA 1LOLA 4RDVA 3WLPA 4NJGA 3R12A 1WCGA 1DJGA 3CWHA 1EKOA 1YX1A 1IZKA 2PS2A 4GISA 2WVUA 2WMFA 3NZQA 3WMLA 7XIMA 6REQB 1PZ1A 3W6LA 3T09A 3SCQA 1W3IA 4LYPA 1MYRA 3TFCA 3A3HA 1S3HA 4PUMA 2X42A 4MDPA 2OKOA 2VUYA 3WFAA 2HQAA 1GG1A 3MO4A 3GXFA 1AH4A 1PZ0A 3L68A 4CNUA 2CBIA 4IP5A 3PJUA 1BYBA 3URBA 1WNOA 4RV3A 3WH5A 4E2DA 2I7GA 4UNKA 2F2KA 2NX3A 5DT7A 3RLVA 1GJUA 3WLKX 7A3HA 1YW1A 5I3JA 3URAA 4AEOA 4WDXA 4PCFA 2OWXA 1PYMA 3UZWA 1XXXA 4C5ZA 1H4PA 1MFVA 4GC3A 2C91A 1H2JA 4Z0JA 3UNDA 1VS1A 1ZY9A 5HANA 4HPHA 3CIXA 4O0QA 3ELFA 1W5NA 4UR9A 2FZMA 5L9FA 3H2EA 4DWSC 4DXXA 2WCSA 3OU8A 3PBMA 4H9XA 4FMVA 3PPHA 3A24A 1GQNA 1XG3A 1LRNA 1DJZA 4V33A 5CSRA 1EA0A 1PWMA 2POTA 3QBUA 2E6DA 3LI1A 5K7JA 1GJWA 3WQ5A 4KESA 4DAFA 3AZTA 2JIWA 1JCYA 3CV1A 2X0HA 1HKIA 4P7RA 3FHQA 3T6CA 4OZOA 2NT0A 2ZTKA 5BROA 3E0IA 2XIJA 5FJJA 1XYMA 3QOKA 1K8CA 4NXKA 1B0IA 4Z1YA 2Q3RA 4QX4A 4XB3A 1A53A 4DZIA 3SUSA 4IFKB 2V69A 1GVOA 3INPA 4EK7A 3GD6A 1VBHA 3WLMA 3HPXA 5EU9A 2NZLA 1XSIA 3LHZA 1V6WA 4NU7A 4A2RA 3QHMA 5F2MA 2HE8A 4XKMA 1EGVA 4W7UA 1QJWA 2DSWA 4LNCA 1W3LA 4LV9A 3UT0A 3VIPA 1MDLA 5DXYA 2YDAA 3B0PA 2WMJA 4M7TA 3VX1A 3SO7A 3R10A 1IR1A 4LV4A 1JEZA 4PFMA 4ICCX 1XUZA 5CG0A 2ZRWA 4MWAC 1AD1A 1ODUA 4EAMA 1ICSA 3MDWA 1LCOA 3EOEA 2V63A 5HAOA 1HX0A 3W7PA 2VVNA 5T8GA 5DMNA 2R1NA 4H7VA 3TW6A 2PB1A 4FF7A 1E6PA 2OQLA 1FDZA 3DHFA 5LNWA 4HPGA 2CLPA 3PS7A 1TUFA 1Q7QA 3T44A 3MP5A 4PODA 1CDGA 1LRTA 1Z42A 3T0DA 5CSUA 3AXKA 2HZGA 4GUGA 4TOQA 3PFRA 2GZXA 1PIIA 3BCJA 3EWWA 3LXAA 4ERIA 4HJWA 1C92A 1EL3A 1P6CA 2XSXA 3N2BA 4M51A 3N9KA 5A2AA 2G95A 4OWGA 5DFAA 1GOXA 3P80A 3OP2A 1I9CB 1V3LA 4UMAA 2JFEX 2PDHA 1UROA 2A7RA 4G1KA 3QR0A 4O19A 1BHGA 1H1NA 3D0CA 1TQXA 2GVJA 3W27A 4J3WA 1JJKA 4R88A 4GCXA 4DPPA 1ONRA 2PURA 4F2BA 4BR1A 3L2MA 5TQLA 3WEZA 4NX5A 1LWHA 1ZJHA 3A22A 3IJ6A 5JBEA 4AZCA 1ZUAX 2VFEA 2BXVA 1SR9A 4K8GA 1F6PA 4L1XA 4P5UA 4GYKA 2E1DA 3NM1A 3QW4B 1XGDA 4GE8A 2HWGA 2YDQA 3QQ0A 1EC9A 1EUAA 1OFEA 4LAMA 4A3RA 3B8UA 3D3AA 3BH4A 3H2NA 3K8KA 4X0NA 3PNZA 1QASA 2PDPA 3LZ5A 5FESA 4ZB5A 1TMHA 4MPQA 2IW0A 4I5RA 1W31A 1XIJA 3HURA 1R9YA 1XLEA 4ZQMA 4GVIA 2Y0FA 3YPIA 3H2MA 3T1GA 3GW3A 1IQ8A 3UCQA 2PI6A 2R1PA 1JL8A 5I3FA 3UJEA 2VX6A 3NNTA 4YTRA 4NNBA 1UJPA 4GJ1A 3VIMA 4S39A 3DFHA 1ZENA 4LBRA 5IDIA 2E6AA 3DHDA 3PBVA 5FA5A 2CPUA 3VD9A 1MW1A 3P8IA 1TV2A 2BHYA 4NX0A 3VKBA 1NAL1 3UXLA 1OEPA 5BU9A 5LHEA 5LIWX 1G7VA 1JUBA 2ACSA 2QCHA 3E96A 1ZBWA 4LF2A 3LCFA 2QDGA 2NQ5A 1TZZA 4FNTA 1ISWA 1KM3A 3U5UA 4DB7A 4FZIA 5ABFB 3L21A 3T07A 2PLJA 3IGUA 1XLMA 1B3YA 2QJJA 1OFAA 3WK3A 4O11A 3AXHA 1OZMA 4ZQRA 4ORMA 3AQUA 4BF5A 1E6ZA 4N7QA 2TRSA 4LNYA 5G1YA 2PMQA 3AUJA 3THQA 3WNKA 2W5FA 5HMDA 3RGTA 1MNZA 4H41A 1KCXA 3LERA 4HNNA 3ZM8A 1JCLA 4UBPC 3DI1A 4A3HA 4Z2LA 7PTDA 4O52A 1NF0A 3RPDA 3W07A 1QFEA 4OUEA 3E0WA 3H7VA 1DXIA 3RO6A 2ZRXA 2Z1VA 4F48A 1D7FA 1JZ5A 4L61A 3ZVIA 1V03A 2ZXDA 4E38A 5F2IA 2XN1A 1VJSA 4CD8A 2XH0A 1EA9C 4D9PA 2ICSA 1JAKA 2P1FA 2OLSA 3OBEA 3RNDA 5IHSA 4Q4QA 1AQHA 4PUKA 1W8SA 2AL1A 2CU0A 2WC3A 3I7QA 5I3IA 2VTFA 1ME7A 1UD6A 4L1WA 5HUPA 1TB3A 3HN3A 1DJIA 1GZGA 4HNOA 3ISIX 4DZAA 1M65A 1EFZA 2HPIA 2XIQA 3WD0A 1WBHA 2DJXA 3PSVA 4F8XA 2I5QA 4PRWA 3WH8A 3MV11 2P0OA 3S5NA 1BYAA 3KUMA 1UQZA 3BLPX 4QEEA 3MU7A 4QDMA 3SFKA 3GG0A 2RJGA 1E5NA 3KRUA 1T6MA 4NZJA 3MHUA 3VUSA 4R9OA 5HMEA 4ZENA 4FS9A 4EPEC 2VELA 1QI2A 4MYXA 3MY9A 4N2YA 2WK2A 3HGOA 4S2CA 1KA9F 2G3JA 2HXUA 3M43A 3AOFA 3QH2A 3GXDA 4EPDC 2J9YA 3OG3A 4PB3A 1OADA 1A49A 4HA4A 3MHGA 3WD1A 2WVSA 3DH7A 2XPKA 1KM4A 3LGEA 3GNRA 1E40A 1UP3A 4DJDD 5HQMA 1SZNA 2QV5A 4NI8A 1QXLA 1K70A 4EKJA 4MNLA 4FOJA 1JYXA 2ISDA 4P7NA 3M9YA 3UR8A 1OGGA 5G2IA 1UKTA 2PDUA 3VZYA 1BWLA 1CXLA 3OA3A 2VX5A 3LK6A 2YA0A 4CNSA 5HULA 2HRWA 2PTXA 4KCVA 5BXPA 1KC7A 4IPNB 5A69A 3FA4A 1VFLA 1QI5A 2DVTA 4ZFCA 2PDBA 4XSMA 4ZB0A 5FEXA 1W2VA 3KCOA 3VDAA 3C0JA 3P74A 3D47A 2DQXA 2E5DA 3QZAA 4WF7A 2PC4A 1J12A 3MUCA 4DF2A 4EF9A 3TE9A 1G01A 3PPCA 1C3FA 3WSUA 3QHOA 4YL2A 1PXGA 4GI6A 3TAOA 1GQJA 1TPEA 1F74A 1TPFA 4E2BA 4DWDA 3LM3A 4DUVA 1GOQA 5A8GA 4J3SA 1IT8A 4HSHA 3S1VA 3FSTA 4ZGYA 3GNXA 4PUNA 4W5ZA 1IWBA 4Q4OA 1XBVA 3E12A 3R5EA 2Q8ZA 1TR1A 3UWVA 1XS2A 3CJPA 3MPGA 2WNNA 1E6SM 1YIXA 2V30A 5AZ0A 3ZLFA 1TELA 2B31A 1QU4A 3AISA 2CKRA 4DJFD 1E1CB 3W84A 2BOFX 3LCGA 4H8HA 2JIEA 2O56A 2DIJA 5FAJA 2ZRVA 3IS4A 1F5ZA 2HVNA 2WZHA 4KERA 3D3FA 3EKZA 2XGBA 5CC5A 1V08A 3ID7A 4J4KA 3G0UA 3LCXA 3OVGA 2ACUA 4MZ1A 4XBSA 1W17A 2DW7A 4Q6JA 3IK2A 1FHVA 4QLKA 4HN8A 5KMYA 2V5BA 1I8JA 2WVTA 4EXQA 2KX9A 4XKYB 3E0LA 3PUOA 3W29A 3AICA 3W25A 4Q6XA 5AFDA 1ITCA 3KE0A 1CNVA 1A4LA 4YHEA 1RJPA 2XYLA 2Y1HA 4FXJA 3NXLA 1X96A 4U5KA 3QY6A 3B03A 3TQ0A 4LWWA 3AYRA 2B7OA 3LPFA 3W76A 1I1XA 3GC5A 3ARXA 3N9SA 3S0CA 1OK4A 5JH1A 4UFMA 1IEQA 5ABFA 4JN7A 4E2VA 2WBKA 1XH1A 1N2VA 3KOXA 5HQLA 3UG8A 1F2JA 3GY1A 2B0MA 2GQ8A 1E6NA 1OK6A 2OZ3A 1R85A 2XSAA 3QTGA 1Y65A 3N73A 2NXHA 4JPGA 2WNZA 3WDQA 4O1EA 5I6SA 4R7OA 3CUFA 3R7MA 3E2VA 3QQWA 1I60A 1R30A 4C7FA 3BJSA 3OZOA 3RMEA 2JE8A 4FNQA 1OC6A 4FOKA 2PGFA 1AZ1A 3D46A 4KCTA 4E2OA 1YMYA 3W7MA 2ON3A 2VZVA 3CMJA 3HPSA 3O2LA 3NEVA 2GQ3A 1AH0A 4JYFA 2C13A 4YJ5A 3WKZA 2YCIX 4Q33A 3LOTA 1BEUA 3V4BA 1Q6RA 3I10A 4O1DA 2PDGA 2HK1A 1XUUA 1VR6A 4B15A 1J2WA 2WSPA 3W2KA 4DUXA 3D5HA 3FYPA 1DHKA 4RZ4A 3ITXA 3PP7A 2NWSA 1O95A 1XYCA 3FSUA 4K7VA 3LHYA 4IPPA 2PODA 1X6NA 1KWKA 3W01A 3W70A 4GYFA 1SJCA 4GUHA 3LHUA 4CD7A 1PDZA 2H3BA 3GW0A 4Q8PA 3A12A 2YA1A 4MB1A 2A3LA 5EPDA 2OQYA 4PMXA 5FJRA 4FNSA 2BHUA 5D04C 2YZRA 3ABSA 2ZCGA 1RHCA 4CNOA 2INZA 3CUXA 5KTLA 4NAEB 2YCKX 4UTWA 2WKJA 4DBWA 5I06A 1KB3A 3OG2A 4LGXA 4C7GA 4JX5A 3BWWA 1FXQA 3P81A 1YDNA 4O1AA 2V3FA 4LVBA 3BCDA 3BZGA 3APGA 3AS0A 1MEIA 1PCKA 3G8EA 3AALA 4JKKA 2PDMA 3MYOA 3B05A 3TWAA 2GJXB 4OJYA 5ABHA 1W3TA 1ZQ5A 2DJLA 5DO8A 2V5CA 1S5WA 1O5XA 2IXUA 4YVXA 4I7WA 1WOAA 4W7VA 2FPTA 3NZ1A 3WF0A 2XM1A 4OV4A 4WUIA 4RR4A 1GORA 3CYVA 2Q02A 4GIEA 4MKVA 4CCDA 2OPJA 2VC5A 1ME9A 1KQZA 1PTAA 1ZJBA 5B7YA 4XAZA 1UP0A 1KXTA 4FIQA 3URNA 4OVXA 5A2CA 4B5WA 3ZZ1A 3W9ZA 5AY7A 2QUUA 1I4NA 2CZFA 3DESA 3P5YA 1XIMA 4QDWA 1PSCA 4O10A 1P6WA 1D8WA 1J6PA 5C70A 3VOJA 4FX7A 5BOOA 2EG7A 4QCEA 3TA6A 4P2VA 2ZDRA 3R0KA 2FDMA 3AHXA 3UA4A 3PSWA 2VC6A 1UR1A 3SRFA 5HJXA 3EX1A 3BMXA 3BTNA 4KS0A 1I2NA 3POHA 4K38A 1D2KA 3HG3A 4FLOA 1I2OA 3A9IA 4L4OA 4XTDA 1E0XA 2IPFA 1E43A 3VNDA 2W79A 1FA2A 3KLKA 3OHIA 3GTFA 1KRCC 2XVNA 1XH0A 3LLDA 4DJFC 4MWAD 1G94A 2WC4A 3LBMA 2GGJA 4ZQOA 5AKQA 3TWBA 3CL6A 3DC8A 3CQ0A 1WBJA 1BGAA 4F0MA 3WBWA 1Z48A 1OD8A 1E72M 3R25A 1QI3A 1ODZA 3IRSA 3SFWA 2EKGA 3BLEA 2NQZA 2OO6A 2QULA 3EWBX 4G8TA 4GXWA 5FEWA 2YFNA 1W5OA 4PGLA 3U5YA 1OY0A 1P7TB 1US0A 3M46A 1J01A 4MF4A 3L4TA 3WBAA 3I7SA 1NF7A 3KTXA 4O1BA 3N13A 1EP2A 5DANA 3E1F1 1XIFA 4UTKA 1OJXA 3J7HA 4J9JA 4K2SA 4ONVA 1W56A 2DU2A 3O16A 5BXSA 5GPRA 1OINA 2DSKA 1R5YA 3JR2A 3IVUA 5B80A 3AIWA 3I6RA 4JCMA 2F38A 2XJ7A 5HR7A 4IICA 4JCLA 3VNZA 3BQ5A 2VX4A 2QCLA 1S1RA 1UW9A 2YCEA 4IMFA 1IIHA 2VNCA 1E4MM 3DEQA 3VKKA 1JCNA 3W73A 3W2MA 5DLCA 4L4PA 1Q6QA 5ECUA 4IIFA 4ZQNA 4LF1A 5KEZA 4ZOCA 4XISA 3AHVA 1MUWA 4LY4A 2ISWA 1H09A 3MHFA 1XSJA 1AA1B 3T2QA 2E4TA 4O15A 1K02A 3DDMA 3TN4A 1B2YA 2ZC8A 2EG8A 2WMIA 4AVOA 4QIUA 2AQWA 3UW6A 4U2ZA 1S39A 5BMWA 3G24A 5D37A 4PSPA 4ILSA 3SQLA 1XGEA 4LOCA 4AZGA 3ITVA 4UR8A 1GNXA 2X0SA 4RW5A 4QJ5B 1DQWA 2XH2A 1U2YA 4JEQA 5E9XA 4Q4PA 3KEHA 1BKHA 3KOZA 3BVJA 3NUKA 2Q3OA 4RL3A 3NFUA 3M16A 3VFLA 3GNNA 3WDJA 3GR7A 1KW1A 3H7RA 4LX4A 4DQWA 2BGNE 3CHVA 4WQ6A 1MUCA 3S3GA 1KFWA 3F1QA 5D30A 2CWNA 2UY5A 1FHUA 4LB3A 3HU7A 4WGHA 1JAEA 1M6JA 2FIQA 3L4ZA 1SJAA 1MZHA 4W5UA 1XLKA 1OFBA 3B3DA 5DBTA 5D05A 4PL1A 8A3HA 3WF4A 1NM9A 4MMWA 2QF7A 4ZSUA 1GGOA 1Y5XA 5DXXA 6TAAA 4CEUC 1KQYA 3LZ3A 4RKAA 4KF1A 2A0NA 3C52A 3ZYZA 5DEZA 2A7PA 4RZBA 5EMYA 3LQLA 5JBFA 3R0DA 3WLRA 3N6QA 2X30A 2WYSA 3CEPA 4BY3A 5C0QA 4QCFA 5C5YA 2F7FA 4RNIA 1TE1A 2O9OA 1A5AA 2VMFA 4C6DA 3THDA 3CZEA 4RK8A 1QNPA 4AD3A 4JQ2A 3GKFA 4QROA 3GFYA 1J93A 1EDTA 5FI8A 2F6KA 2KZHA 4HZMA 2CXGA 4NJJA 3TFXA 4CUCA 2PSNA 3B97A 3W7QA 1VJIA 2JF6A 7TAAA 1PJ9A 1FFRA 4FO4A 5D9PA 1J18A 3WDPP 5LNRA 4MAVA 3MP4A 4L9ZA 5EL1A 3Q67A 1UC5A 3L2IA 3GXNA 5DQPA 3TTYA 2WAGA 3SY8A 3LLXA 2DDXA 4DAIA 3QYQA 3H23A 4QNEA 4FXRA 3RCYA 1P1XA 1Q63A 3HB9A 3DN5A 3ARUA 2RDWA 1DQUA 4K8HA 1F3XA 3RYSA 4EWND 2G3IA 4CCEA 4Q8QA 2PLMA 4BF9A 1EWEA 1BPLB 4Z1BA 4DPQA 2OMAA 3DFYA 1DORA 1DJYA 3NA8A 5EGRA 1XISA 3GZ3A 3B9OA 3N2MA 2E1WA 3C0LA 2VRQA 4X2PA 1Z32X 3NSXA 1HVQA 4J3TA 4FEZA 3TJLA 3C2FA 1MXGA 2QR6A 3A4XA 4MNJA 2CYGA 1W9XA 2FYMA 2QCDB 3W4RA 4AZ7A 1Y5WA 3BCFA 4M6UA 2MNRA 4JIEA 4AXKA 2RDXA 3R1ZA 4NT0A 1GOOA 2JKEA 1QHOA 3MVIA 3WZ0E 3UERA 1P43A 3M47A 1CXHA 1PV8A 4BCEA 3GR4A 4QAWA 5LIKX 2WZMA 2HE5A 1EP1A 2X1UA 3B8SA 2VENA 3PY2A 1KFKA 2WVVA 1WOBA 5CCZA 1LBLA 3KTCA 4PYSA 4UTHA 4JKLA 3O8AA 2AKMA 1QW8A 3BG5A 3BG9A 1S46A 5D2WA 2NLYA 1H11A 5FF0A 3AXMA 1CGVA 2FTPA 2YSWA 3S6TA 4UTFA 4QAIA 5DBUA 5HINA 3K30A 3AHTA 3N6HA 2DQWA 1JZ3A 1C29A 3BSMA 4NZCA 3IGSA 3RM4A 2FH8A 1PEZA 2WQPA 4F79A 3TCSA 1NQKA 1ZP3A 1RBOB 5CZ0A 4NZFA 1EPVA 4DXKA 2IQ0A 4TQTA 3NVDA 4HCHA 2O9RA 4Q32A 3Q94A 1LORA 1Q8JA 5CLWA 1XIHA 2HNEA 1N8WA 3WQPA 1P0KA 4AX7A 3FLUA 4GHRA 1K7XA 1F4HA 1S2AA 4GQBA 1F61A 3VIHA 2EXOA 3CEUA 3THUA 1A80A 1KRAC 5SWUA 1CTNA 1WKFA 4PUDA 3AC0A 1JPDX 3LMYA 2NLIA 3BMVA 5T26A 4KIRA 2QCMA 1XKYA 4GMEA 2PDCA 1W5QA 3T0BA 1EPXA 3SUTA 3K1GA 3C61A 1B57A 2J25A 1RQHA 1JPKA 3TUUA 1EQCA 2BOEX 3V5OA 4Q22A 4JTRA 3WYZA 1LDCA 3KCJA 3UY7A 1EBGA 2ZZ2A 4OBTA 3TC3A 2NSXA 3WLHA 3NURA 3WEMA 4H19A 3GTIA 3G1RA 1EWDA 3W82A 1OFDA 2XH4A 4AHPA 4K1WA 4A6GA 3IK4A 1VFTA 3HQ1A 5CJMA 1AFSA 3AXXA 3K46A 2GUYA 1J4EA 3RR4A 3W26A 2PTWA 2P53A 1DIOA 4JOMA 2RGMA 3VIFA 4B92A 4JDBA 1C8XA 2WW5A 3MUIA 1JDDA 4O14A 3LCHA 1DWGM 1M3UA 2D3LA 3OZYA 1QAPA 4M29A 2V82A 1F8IA 1R7AA 4KEMA 3LCIA 2PEVA 4N9BA 2A4AA 4C6CA 1UZDA 4KH2A 1D7KA 1TCMA 7CGTA 1E1CA 3VNMA 4JHMA 1AW2A 1ONWA 3UU0A 1ZGDA 5JIWA 3GG8A 3SIZA 2XIBA 1ISXA 2QIWA 2ZBTA 2GJXA 3MCOA 3QLDA 1Z41A 3W88A 3KWXA 3PAOA 1A5KC 1VBUA 3PG8A 1VQTA 2PZNA 3U48A 4FNPA 3WQ4A 4ATWA 3F2DA 3R79A 1Z44A 2YB4A 1S5TA 3NEHA 3M41A 3E5BA 4CNNA 4O13A 2HVOA 3NQ8A 3GHSA 5EA9A 3CNYA 2CZDA 2IUZA 3MJYA 4TX8A 3S1WA 4JFWA 1UKPA 4JTAA 3F4CA 2I17A 2WM0A 2JF7A 1UD2A 2EBNA 5J04A 3N19B 4D6JA 1RY0A 4M80A 3EOSA 3MMUA 3TXVA 4M6PA 4NZ3A 3WJWA 5CBBA 3TKFA 7ENLA 5BW6A 4BA0A 5C55A 3VIJA 2J6XA 4TTUA 2VEKA 3OVQA 3W1TA 4BHYA 1EB3A 4IH3A 4HNCA 4H3DA 5AYYA 3UZXA 3VYLA 5EBAA 3VVGA 2CXEA 1SMDA 4L1GA 1FBAA 3MQTA 4FI4A 3CQKA 3P62A 4A2SA 4NJIA 3E02A 2IQDA 1RR2A 1ZALA 2PU1A 3AU2A 4TMCA 5FJIA 4BQ5A 4Z1AA 3NPWA 3WH6A 1Q7MA 2WOQA 1FKXA 1WDSA 3IIOA 1R47A 2ADAA 2JK2A 2EGZA 1RJQA 4AD5A 3S2NA 4N02A 1ADSA 4UTUA 3G22A 5A8OA 4NG3A 2YYUA 1HFBA 2BOGX 4JYDA 3FEMA 1MRQA 1FDYA 4W8BA 5CC3A 2CHOA 1RCQA 3MCNA 1RCXB 3LD5A 3EWXA 5KINA 1VPXA 3HMJG 2WLZA 4UZUA 3PTDA 4GH1A 2BFGA 2PGWA 5IFPA 2HEJA 3CB8A 2I57A 3W75A 1VRXA 2GPTA 3GDLA 1YPFA 2PFHA 3LGGA 3CUJA 4GY1A 4MFDA 4RLIA 3NPUA 4IMCA 4XSLA 3PPGA 1A5SA 1O68A 4RDZA 3D6NA 3EKGA 1UA7A 3CUHA 1BWVA 1QNOA 2XVKA 4P8WA 3NQ6A 5I02A 4IPIA 4QJ4B 7TIMA 1V7YA 1MI3A 2Z0IA 4L80A 4PBFA 3NGJA 2FB3A 3W85A 3GBDA 3GFXA 1VEOA 1QUMA 1H7NA 1A0EA 3GS6A 2ACRA 3GR8A 4WX2A 4ZODA 2YW4A 2V3EA 4HYWA 1H61A 3L5AA 1HKVA 3GTHA 2PGEA 2QCGA 4JIRA 2HK0A 3BGJA 1FWWA 3QKEA 1OFPA 1CZ1A 2YR1A 2HMCA 1EYWA 4JN8A 3ZR5A 1KWGA 2WANA 3SQMA 1VCFA 4MSSA 2ASHA 4ICNA 4HA0A 4GYPC 1ISVA 3M0LA 4PRTA 1O5QA 1RV8A 1WYIA 4RJEA 3U57A 2ZUWA 2JKAA 3E6EA 4PUJA 4HHLA 4IGHA 1PO9A 4DWSD 2P10A 4J27A 3T0AA 3BLDA 1L9WA 1VP5A 2Y63A 4HNVA 1IGWA 2GDVA 2OYLA 2OYMA 3N14A 5LA1A 1F8MA 1NOWA 2VO5A 4HNUA 1EJXC 2GDUA 3V1PA 3GYCA 1JNEA 3WENA 5JQ9A 3OB8A 4D6GA 4BQ3A 1XYAA 1HZYA 1Q6CA 3QZ6A 4G6CA 3W7GA 1BTMA 1D3HA 2J47A 2G4JA 2CLIA 4ZQPA 2I9UA 1UKQA 1Q6EA 1RY8A 2YDRA 1JXJA 3RIKA 3U7BA 2I9EA 5EMLA 5I0DA 4P61A 3P82A 2ONEA 4TUFA 5E5CA 1YBQB 4A35A 5CPLA 1SGJA 2CBUA 5HXMA 1YTEA 1O66A 4JICA 1Y5VA 3L0KA 1MSSA 4WGXA 2WV8A 1Q6DA 5AC4A 3WNLA 4KETA 1T8XA 1QK2A 2NVDA 3NJ3A 4B5SA 2ISVA 4Z2GA 2V3DA 1C7SA 1TRIA 4R53A 1KRBC 2V2HA 1OCNA 3DCPA 4JTQA 5D03A 3VM7A 5C2XA 1V3MA 1K6WA 2D24A 4JNMA 3LMZA 3BPWA 3LXCA 4HZ6A 4N9EA 3W7HA 4AIEA 2QAPA 3OLDA 1FWAC 1HJSA 3LNMA 2PRLA 4AH7A 3GG1A 2H8XA 4QE4A 1IZJA 4JFUA 2O9PA 3VPLA 3TYUA 1Z69A 4JQAA 2ZXBA 4YN5A 4B4HA 3STEA 4I5XA 2Y7GA 1DWJM 1GCYA 3BLOA 1JQXA 2HTMA 4AG0A 3MDUA 1X7FA 5CZJA 4YIWA 3HG2A 3M0JA 1HVXA 1ZTVA 2AOSA 2GGIA 3EEZA 1F6KA 4H00A 2A6LA 5D9OA 4NAFB 3VKDA 2QPXA 3TOYA 2VFGA 4O4VA 5EFDA 3CHEA 3VZXA 2NXIA 4GNVA 1W1B1 3AMDA 4XZLX 3TIMA 4E3VA 1QNSA 1UUMA 3H2OA 2VVSA 3W1LA 1E3XA 5JVLA 4ZOEA 4GVFA 1Q13A 4FSAA 1FH9A 3RX3A 4WLCA 1HP5A 3G1XA 4OOUA 3LQGA 3T42A 2X1SA 2ZUVA 4I6VA 3NQDA 1TPB1 3BG3A 5AHEA 3W7EA 4JX6A 5KZ6A 1K7EA 3ENLA 3M5XA 4BWLC 3WCZA 1QHPA 1GQKA 3W87A 2OSYA 4GACA 4BI5A 3ERPA 1EQPA 1TJ1A 5DMLA 2OFJA 1WZKA 1OD0A 5G1MA 1B54A 3LRLA 5BWAA 2REQA 3M0VA 2Z00A 2R6OA 3ABZA 2OTDA 3T0TA 4DX3A 4KRUA 1E9YB 2VD8A 4B3KA 4Y9PA 2DZAA 1TJ0A 4E8GA 1BYCA 1VFHA 4IMDA 4IP4A 3TJXA 1GZJA 5JBDA 3H70A 3O6YX 2E0PA 1SZEA 4WKHA 1CIUA 1FHDA 2I16A 3L7RA 2FMOA 2Y89A 4B4FA 1LT8A 3F4VA 3GTNA 1LOQA 1W5PA 5CPTA 4CU8A 1JR1A 4OQVA 3VOFA 2HBXA 1I2PA 3MA8A 1VFFA 4O53A 4OT7A 1V0LA 4D1IA 1S1PA 4Q8WA 2FDSA 1NSJA 1XLBA 2ZRYA 3VMPA 3QGAC 1TO3A 4QJ1A 3URQA 1XGZA 4HK6A 1TV5A 4IQEA 1R9XA 3BLIA 1V79A 3TONA 4XX6A 5FEZA 3SI9A 3WG6A 5A6SA 3TK7A 1X1ZA 2QJMA 3T81A 4ALDA 1NU5A 2VOMA 3W1AA 1UKSA 1VPYA 2WXDM 1FCBA 4L4MA 3W2UA 4CVWA 1PHWA 1EJTC 2JGQA 4XK2A 3ZOAA 5JH2A 3IIZA 4A8RA 2ZUTA 1RA5A 3IV8A 1JPHA 2GOKA 4XD3A 1BXCA 1JDAA 1DJQA 3SY5A 1UR2A 5LHFA 2O4QA 1TJPA 4GWEA 1OCBA 2F6UA 2RHGA 1IEIA 4R7WA 1FWIC 4RE4A 3TNOA 1T99A 1SVDA 4LSBA 1W9PA 4ZBCA 3CHCA 4F3HA 1EJRC 1FWGC 2AAMA 1VFSA 1W37A 3K2GA 4W89A 4CN1A 1F3TA 1Q45A 4LYRA 4NUWA 3VNLA 4BS0A 2R94A 1LP6A 2PPGA 2WCAA 5DRIA 1DJNA 2QUVA 2RFGA 3BE7A 1V02E 4QQ3A 3KVJA 3MSRA 1UBPC 3P60A 4NI3A 3F2CA 3MYPA 4MJZA 4X0VA 4UFLA 4DF0A 1YXDA 4HYRA 4DNHA 4HSOA 2NUYA 3HGJA 3LHTA 2AMXA 1V6YA 3A4AA 3KOYA 2F6XA 1SW3A 1TG7A 3RLHA 3ES8A 2VUNA 2PLKA 4U33A 1FWBC 4HT3A 4OU1A 2VQTA 3SN4A 4QG6A 6ENLA 1P48A 4KWSA 3BJFA 2Z1SA 2Y7EA 2BV9A 4GH3A 1HTIA 4MG4A 5ABGA 3M5VA 1VC4A 1LROA 5G4WA 1DWAM 1E4LA 4WXZA 1JRCA 3WDIA 5LKYA 1ADDA 4WDWA 3LENA 1M7OA 3O6AA 2WO5A 2YDSA 3W00A 1TPWA 3ITYA 1DIEA 3UWEA 5CJNA 1AL7A 1JDEA 3K8MA 4M0XA 3AZSA 3FVDA 1SM9A 3WLOA 1X7IA 3S83A 3G1YA 1VH7A 2J7EA 4J40A 3ZT5A 4DXVA 4XO6A 3GAKA 1S2UA 3FS2A 3PJTA 3ATZA 3L66A 3CASA 1K8YA 2PBGA 4GZJA 3EDDA 4IQLA 2ZTJA 1P4CA 3EB4A 4MKNA 3GXIA 3CPGA 2A2IA 1FQ0A 2J27A 4H83A 3A64A 1ZLPA 5EYWA 1QATA 3WF1A 3F5KA 1UOKA 3VNKA 3UWWA 5MKGB 1ONEA 3EDKA 4OBSA 3AHYA 3AS3A 3XISA 1KKOA 2QIIA 1KFCA 2R8WA 2DPEA 2W6RA 1HJXA 1NOFA 3EPNA 2NQ9A 1KD0A 1HNYA 3ITGA 3G18A 4OGZA 3H12A 4PMYA 5TBOA 1QNVA 1KXVA 3UYIA 1KRMA 5K4XA 5KZMA 3UJRA 1VHCA 1EEPA 3TXZA 1WAUA 3B06A 4ACYA 1LT7A 2BSLA 4YTTA 3B40A 4XVDA 1J96A 4AD4A 4IPLA 3S2CA 1IEVA 2C16A 1IF2A 4M3PA 1R3VA 2DIEA 3W7LA 1WKDA 1B3XA 4MUPA 2D0FA 2PP1A 2YBVA 2PRHA 2NQHA 3E38A 4G7EA 4HA3A 5DCEA 2F2HA 2X05A 4RZ5A 1K1DA 3ZIZA 3CO8A 2D3NA 4AXNA 4RZ6A 2VWSA 2ZUNA 2V38A 3TSDA 3KL0A 2GVYA 4D6FA 4D8ZA 3S5YA 1G67A 1XCFA 3G77A 3BW4A 3CAVA 3SRKA 3H6OA 3M0ZA 2R1KA 1XX1A 3VE7A 3PZ9A 1O12A 1W1VA 1JPIA 3TTQA 1XIIA 3W24A 1KBKA 3FCPA 1M53A 4HU4A 4GUJA 1VJZA 1ADOA 3M1ZA 4G7FA 1SFTA 4A4AA 4BZYA 1W1PA 1UKOA 4CNPA 1BGGA 2XIIA 4DJED 3K4AA 4QQUA 2QVHA 3ZWSA 2B7NA 4E4PA 3TX9A 4HTBA 2X8RA 1JYWA 1HG3A 1Y7VA 2PD9A 2WSYA 2NXGA 3S5SA 3APTA 4UFJA 3CYJA 2Y8UA 3MBFA 3WQFA 3PBWA 2FZNA 2E67A 3W7DA 4HOXA 4DNMA 2HNHA 1UR3M 2D2HA 4JZ5A 5E0KA 4UQCA 1W3NA 2G96A 3A5VA 3GU9A 2ZUSA 4AAJA 1WQ5A 3C2VA 1AW5A 3GUWA 1WX0A 3W0KA 4GPNA 1J0ZA 3O6CA 4MB4A 4XD6A 2Z1XA 1E70M 3BMWA 1L6WA 3NDZA 4RDYA 1S5VA 5RUBA 1XG4A 4LEQA 1XR2A 3LRMA 3KTSA 4GABA 1NWUA 4Y96A 3QZEA 2DV0A 1YE4A 1W32A 5E9AA 2VGBA 1VENA 5I03A 3VGBA 4CN6A 3BGGA 4LAUA 2Y6ZA 1XLLA 3LS9A 5FF2A 1CGTA 1HL2A 3SCWA 5I3DA 1G9HA 2YW3A 2R9RA 4Q7NA 3L5LA 1MW0A 5A6BD 4HP5A 5AC8A 5DMYA 3ZWTA 3UJSA 2YCLA 2YLAA 2YLLA 2R24A 3BZJA 4KWVA 2GSEA 4JTKA 3W02A 3LB0A 4J7RA 1BG9A 1DJXA 1R0MA 1I6NA 4LEFA 2VEPA 3BANA 1TWIA 1Y8BA 4DVOA 2R14A 3AUOA 4AZIA 4AB4A 3CU2A 3C0SA 3FGCA 1E15A 3NL3A 3HV9A 2DZSA 4ZE5A 4LVDA 3C2OA 1A0DA 4GNKB 1OG0A 3MWAA 3SGGA 3UJ2A 1FWCC 3WLLA 4MZ8A 5HWNA 3V5CA 1ITUA 1JF6A 1YDVA 3T2PA 3SR7A 2GK1B 1CYGA 2C1HA 1ZCCA 4QP0A 1UQYA 4FR6A 3GE7A 4H8NA 4Z08A 3PWGA 4CLMA 3AMGA 5M03A 1N82A 3GVQA 3GHUA 3PZOA 1B90A 3U7VA 2HISA 2ZC1A 1R87A 3K5XA 4XZ9A 4IG2A 3LPGA 2C0AA 4ADTA 1ZHAA 4UQEA 3CH9A 4WDTA 2QJGA 1E55A 3LXBA 3BAJA 1UR4A 2XSBA 4NRSA 5BRBA 4D6EA 3KFTA 9XIAA 3MANA 2H3DA 2OELA 4UFHA 3LPPA 4O50A 4TO8A 1O5KA 3U6WA 3ONBA 3QV7A 1YNQA 4LALA 3R58A 4INFA 1TWDA 2XFRA 1QWGA 2EPKX 5KZEA 1TA3B 4J3UA 5CC6A 4OUIA 3KDOA 2EKCA 1GHRA 4NILA 3UG4A 3EX2A 5DCBA 1RBAA 2GYIA 1ZZMA 4ZSTA 3V0TA 3GVGA 2OX1A 3A4JA 5D9NA 3T78A 3EOUA 4UQDA 1H7OA 1OGSA 1S2CA 1WDPA 1ZP4A 1KR1A 3PK7A 2KAUC 4YTQA 3KRBA 4IX2A 3BO9A 3DU0A 1VZWA 3CT7A 1QMLA 1BVZA 1RD6A 4O8RA 2OYKA 1SFSA 3CV6A 4HBKA 3ZS4A 4CCCA 4PUEA 3VOCA 2WSRA 3EMQA 1W3HA 4YS1A 3B9DA 4QBXA 3ARPA 4U3CA 4HNTA 3KBSA 3L4YA 3TEVA 4LBSA 4IG2B 3SCVA 3G1AA 3DKJA 1V3KA 1V0MA 4LW7A 1DE5A 2FVMA 3AROA 2ZUMA 3G1VA 4XKYA 1J79A 3BARA 4QSHA 1BQGA 4K68A 1A5LC 3QPYA 4XO7A 2ZVIA 2WVVB 3GUGA 1O1ZA 3UXIA 2IKIA 3WEOA 4A05A 1HIZA 1UB3A 4LANA 1PS9A 1N55A 3CUZA 4NP7A 3H53A 1JD7A 4H01A 5FL0A 3N2TA 1V02A 3C0QA 5E93A 3SAZA 3SCNA 4MWAB 1ITXA 2CLEA 3QSTA 1TZ7A 4WIWA 4M5PA 2VDHA 3GWQA 1KCLA 3HPFA 2WNQA 4A3YA 3GXTA 1XYZA 2PWGA 2G41A 4AFYA 4AC1X 1BSIA 4NNCA 1QI4A 4X9YA 2Y88A 3W6YA 4R27A 2OSWA 3WD3A 4A29A 4US5D 4AYSA 2RUSA 4L6HA 1TV8A 4FOUA 4HB7A 4GIAA 4X3ZA 2Y70A 2ZVRA 1TR9A 3CIWA 3PTKA 1YEYA 1CECA 2CZVA 3MUZ1 3MKKA 3HMCA 1J2BA 3P61A 3ABOA 3S1UA 1IWAA 2VOTA 4M6QA 2WKLA 1FCUA 5EMUA 1C90A 2XUCA 1XRFA 1FWJC 4PMVA 5TF0A 1NEYA 4JTIA 3WMSA 4I7UA 2WSQA 1H50A 1R3WA 3WLSA 3HZ3A 4OE7A 1GVIA 5IBXC 2MANA 2QCEA 2QDEA 2PP0A 6PTDA 2H8ZA 3MMTA 1HP4A 2VFHA 1UC4A 1XRVA 1FWSA 3BOXA 2DZBA 3H7UA 3MMWA 4F0KA 2FHBA 4S3CA 4YYCA 5CPMA 5HUOA 1HGYA 1QK0A 1GTHA 3SGZA 1UASA 3M6YA 1NH6A 1QPRA 1RUSA 3E2QA 4IJRA 3A21A 1OC5A 2ZOXA 4F66A 1SO5A 4MY8A 5HJLA 2CZEA 1BFNA 1REQA 4LH8A 4D8AA 1LBMA 3DECA 3W81A 3O0KA 3GG7A 1SZGA 3RR1A 1F73A 5CPQA 1C7TA 1E73M 3IVTA 1R3RA 4EX4A 5CZTA 1RAKA 5I3HA 3SGUA 1SFJA 3IJ8A 4JY9A 1L6FA 2V6AA 3VM5A 4REQB 4GYPA 4A8NA 4FX8A 4MIMA 3LNPA 4MYAA 4J1OA 2DVUA 4YVPA 2DT3A 2PDQA 4OKDA 5EBUA 3VDBA 3VGGA 3VO0A 1BVNP 1U1HA 1S5MA 3PZQA 4NNAA 1RQBA 3PZNA 4QEHA 1G4SA 5CH9A 1OFQA 1IGSA 2DT1A 1R86A 2HROA 4XIMA 1M04A 4TX9A 2V5LA 1DIDA 3NQCA 2BB0A 2RDTA 4N42A 3TN3A 2Z1WA 1OM0A 1HW6A 4HK5A 2OXNA 4FP1A 3TC6A 2E77A 3BAWA 2NQJA 2B7PA 4NHVA 2W9MA 3T05A 5AVHA 4U2YA 3HPZA 5EKYA 1VBGA 3R6IA 1AMYA 1H5YA 4Q8NA 4DJEC 1GVFA 3WH7A 1NFBA 1EJUC 1XH2A 4XAFA 2C14A 4OOZA 3WBYA 5KSWA 2DIKA 2CNCA 2WMGA 4UMCA 3V7PA 4L64A 5JMUA 2E40A 1TPC1 3GC4A 4MPKA 5IRPA 4HTYA 3IWPA 4MJ4A 4UUIA 4JFSA 1XHGA 5D38A 1GWJA 3V1HA 3VINA 4C6LA 4IWWA 3G1SA 2QLYA 1CB7B 1U33A 1A4MA 4F4RA 3TAKA 3VUPA 1P0EA 4ZB2A 1UHVA 4BKNA 3I6TA 1RQEA 1P0BA 3AS1A 1IV8A 4W88A 1NDWA 4RNHA 3EWYA 4FLRA 2GQ9A 4W4QA 4MWAE 4GQRA 4UB9A 1JUEA 2VZSA 3FXGA 3STPA 5DCDA 2QHAA 4C6NA 3LYEA 3K8LA 1TKKA 2VQUA 2J4GA 4UTTA 2P8CA 4US5A 4YPJA 3ALFA 2BGQA 3WNOA 3GH5A 1R2SA 1JYVA 4FR1A 2OWWA 2HBVA 3IJDA 1QBBA 2F9RA 2BASA 3U2EA 1BRLB 4CVUA 1XDLA 1XYFA 5HMSA 4AZHA 4D6CA 4DYJA 2DH3A 2EJAA 4NL1A 2BY0A 1H1ZA 4E5TA 2A3HA 4JTFA 4AW7A 5C7HA 5FJOA 1KLYA 4HK7A 3WD4A 1QOQA 4PZVA 2G3FA 3KS6A 2WSKA 3UXDA 3FNDA 4PTWA 5H91A 4IQDA 1XD1A 3TDFA 3NO3A 1LWIA 1M7PA 1Q6OA 3NQ7A 5J5RA 3HO8A 3DXIA 3WN6A 3FA3A 3BV4A 2BLEA 3S5ZA 4Q8OA 1VAHA 1XBYA 4O1FA 3ZSSA 2GGGA 2PU0A 3B0UX 2E5CA 4S3JA 2BDQA 4F9JA 3HG5A 1H7WA 4JL2A 3RG6A 2ZICA 4G5DA 2ALDA 2VR2A 2VEIA 2BVTA 2Q71A 3SN1A 2ODOA 4AX6A 1H7PA 3W7IA 3OGSA 4IUGA 3T08A 4H2CA 3QPEA 1E9ZB 1E1EA 2DGAA 3W2NA 1GTEA 4JNZA 1W3JA 2Q09A 4HMCA 4XBKA 3ZLHA 4K8EA 2QUTA 2X7WA 3NZRA 1N8FA 3P5ZA 5TIMA 3A6OA 5FD0A 2DUZA 2ABBA 2PWVA 3QTPA 1H1YA 4FAMA 4H1ZA 1TTQA 3VOHA 4N9DA 5BXTA 2Z4GA 2C3ZA 2V67A 2ZFAA 3PG9A 2GJRA 1IIGA 3KBNA 1XDJA 3NIYA 4GRSA 3RMJA 3FN9A 3FEQA 4ZFMA 3Q4DA 4F2UA 5L6UA 2NUWA 4PUWA 3VKAA 3AWOA 3F5LA 2QV4A 4HHPA 2XDFA 3LEPA 3KXQA 1EC7A 3RDKA 2VEMA 2ZXQA 5A8NA 3GFZA 5F1UA 4ZO9A 1MQRA 4I9AA 3IJ9A 4GUFA 4AY7A 1SJDA 1WO2A 4QITA 3I7RA 3AJXA 3UXAA 1OSEA 3SEPA 3HOJA 2WJDA 3WX7A 5H8MA 2YGYA 3RF9A 4JFTA 3TZFA 3HA1A 3SSZA 2OO0A 1UWQA 2B81A 1NTHA 4KQNA 2Z6IA 4PULA 2QF8A 1ZL1A 2J6VA 2C0HA 1HN1A 1GOWA 3P3BA 2A85A 5AB3A 1G6CA 3UNTA 4JY8A 4UWMA 3F5JA 4D72A 3G1FA 4QLJA 1GQIA 2X1TA 1L0PA 3OEXA 4K7YA 1GT8A 1TV3A 3EOLA 3EYPA 2VGFA 2VM8A 2A3AA 1OX5A 3UZJA 1NDZA 2CITA 1TV7A 3DX5A 2YBUA 2PLCA 1KM5A 4UTTC 3QEZA 1PUDA 4J3XA 1XD0A 1SR0A 4UIOA 2Q6ZA 2NQLA 5E0FA 4D6DA 2WPGA 4R7JA 2GUUA 1FWEC 2EHHA 4OBRA 4I9MA 1B31A 1SYTA 2P3EA 4IIHA 3N15A 3QRHA 1O6IA 4JIPA 4JTHA 2E8YA 5HA7A 4GNJA 5D33A 1OCQA 2ZZ5A 3RLGA 4P7QA 1CLVA 3KRZA 1UWSA 1VEMA 4AUBA 3FJNA 1BXBA 1YNYA 2J74A 1JZ2A 3U2OA 4TIMA 2XG9A 3WIJA 2NWRA 2O7QA 1NELA 3SCSA 2OZTA 1RPXA 4LCSA 1JXKA 4DJDC 1QNQA 1X98A 3W1QA 3PULA 4Z0SA 2HJPA 4MADA 1UD5A 4HOWA 2C79A 4V28A 1ZJAA 4C6OA 1K6AA 3BAXA 1GKQA 1PIGA 4E6MA 1JZ4A 4GI9A 4S3EA 3WJXA 5H8UA 3EWZA 4PRRA 4TX6A 3P0XA 3AJ7A 4TTGA 2RJHA 3UJFA 2BWGA 4IIEA 4GD0A 5K2ZA 3F4NA 2INEA 3ARYA 5AYZA 1R7OA 2Z6JA 5AHIA 2V3GA 4CQDA 3UR2A 3S2LA 5I09A 5GJPA 3B4YA 4WKAA 2OX4A 1CGUA 3DG3A 4GINA 4HMDA 1B30A 4O57A 3NL5A 3ARZA 3UCDA 3CB3A 5JU6A 4DO6A 2FTWA 4YHGA 3BLLA 4JTCA 4QFUA 2OOFA 4C65A 4S3AA 1MEWA 2WJFA 2DUAA 1MUMA 3F4WA 3NGFA 3MWCA 1I45A 4S3FA 1J0KA 2FKPA 4JN6A 4NASA 1E4IA 1P1MA 1EYEA 1V8EA 2Z26A 1CGWA 1ZSXA 3MI6A 4WY0F 5BRQA 3RHGA 2PF8A 3B4UA 1QR7A 4GKTA 1Y0EA 1M5WA 3VOIA 5A8QA 3EXRA 4OFCA 1Q85A 2VFDA 3ZFHA 4ROPA 2RDUA 1QBAA 3ZVHB 4M1RA 1LF1A 1A5MC 2Z1BA 1EF3A 3STGA 1TMLA 4Z17A 4BJHA 3V3WA 1QPNA 4IMAA 4C6MA 5CSSA 3N3TA 4LFYA 3CHDA 3C56A 2GLKA 3I68A 3UWQA 1QO2A 1X39A 5EMJA 2QCDA 2D22A 3P84A 4GGBA 4WHBA 3W86A 3EXSA 5AYXA 1XFCA 1KM2A 4O4WA 4Q8TA 4UTMA 2C6QA 3W7NA 4JHZA 1GVSA 4IMGA 1CLKA 3WQGA 3TYBA 1HKJA 3CAQA 1W1IE 2IKGA 3R43A 4GI8A 1GOMA 2AL2B 3SW6A 3PZVA 5IM51 1XLGA 3W7RA 1JGMA 4ZTXA 1LUCB 1W8GA 3VABA 1AQMA 2WJEA 1OC7A 3WLQA 3N17A 1TTPA 3S9ZA 3ARWA 3QW3A 4A3UA 1E56A 2BMBA 1ZBCA 5DMMA 3ARSA 4M1BA 3ZR4A 2D23A 6XIAA 2VFIA 4BEUA 4ZR8A 1AODA 4X9SA 3G3DA 1Q2SA 2CHNA 1Q6FA 3HGRA 5CKSA 5LA0A 1K8ZA 4ZO6A 4N0RA 4QS5A 4RE3A 5E6ZA 2CIPA 5IDZA 5A94A 3S1XA 5D8ZA 1D9EA 2YCJA 3L65A 4AEFA 2CHRA 2ZUUA 1RLCL 3IIPA 3P93A 1IZCA 1TREA 2C8NA 3JUGA 4V2XA 4C6KA 4NRRA 1KFJA 1R3YA 3N2XA 4WRHA 2GL5A 3ES7A 1J0JA 3THCA 3WQ6A 3E2SA 2ALRA 4H9ZA 1MW2A 3TQVA 3JVAA 4UOQA 1K3UA 4A3QA 4OIFA 5G4HC 5E0CA 1ISYA 4IM4A 2NSOA 3VU2A 5IXEA 4KKXA 4Z2IA 4KIEA 1UJQA 4UOZA 2NV1A 1XIGA 1ZAIA 4LUIA 4V27A 1EDQA 4MNKA 1ECQA 4DRSA 4EF8A 5F1VA 1MXSA 2Y85A 3M0YA 1F05A 3ORWA 2DZVA 3B0YA 4XG1A 3R8RA 2O0TA 3VA8A 2Y24A 2X09A 4GLEA 3B9AA 1IT0A 5HOSA 1A3HA 2PTDA 1UMYA 1WKEA 1EGMA 3OJGA 5HBFA 4DUWA 2ZA1A 3AAMA 1THFD 1P0DA 1YPXA 3AO0A 1SW0A 3KOFA 3RPTA 4URIA 1G7UA 1BD0A 2WHKA 4HGXA 1LL7A 1XLHA 5JXQA 4E0CA 4PL2A 1X38A 4YVVA 1BG4A 2BXYA