1V03A

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
487
structure length
487
Chain Sequence
IHRLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKGVEYYNKLIDLLLENGIEPYITIFHWDTPQALVEAYGGFLDERIIKDYTDFAKVCFEKFGKTVKNWLTFNDPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DHURRINASE
publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor milo
molecule tags Hydrolase
total genus 188
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v03A00
1JAKA 1JDCA 1GQJA 3DHUA 3I3EA 5GNYA 3VIMA 3WH9A 3A4AA 2V3FA 1E0XA 5D8ZA 4HMCA 1GW1A 1E70M 1NP0A 4FLQA 2E40A 1JZ6A 2WMJA 3BAKA 5CGMA 1V3KA 4UZSA 4PTXA 1JDDA 3IK2A 5HDRA 1E40A 1ITCA 2W5FA 3KL5A 3MKKA 4GZEA 3ARTA 1HP5A 5BRQA 3B8SA 4Z2GA 4W84A 3VNZA 4BS0A 4JFVA 4W87A 1XH1A 4PBGA 4AD3A 1W9XA 5IDIA 3W82A 1HJQA 2PWGA 1ZBCA 4CUCA 3AFBA 1GQLA 3NDZA 4UCFA 3W4RA 1UR4A 3QHMA 1W1PA 3IAPA 1FP9A 2GK1A 1QNOA 4WJXA 1EDTA 2FGLA 1CLXA 2WKLA 4KWUA 4L4OA 3O9NA 4NSBA 5CG0A 1PX8A 2ZX7A 4M56A 5D9MA 3W24A 2YOCA 3WQ8A 1W2PA 3BCFA 3PZGA 4B16A 1UWSA 4WIWA 4HTYA 2VUYA 3IJ7A 2EJ1A 3ZJKA 1VEOA 2VC9A 1TG7A 3E1F1 3AS3A 3MUZ1 2BS9A 4TX6A 1OCQA 5D4YA 3WSUA 6A3HA 2WLZA 2BHZA 2VNCA 3A3HA 5AC5A 2J62A 3IJ8A 3VU2A 2DQXA 3MANA 4E8CA 2F8QA 2YJQA 4PTVA 3K8KA 1QHZA 2GJRA 1H2JA 2UWFA 1EO5A 4D71A 4Z2KA 5A2BA 4AMCA 3K46A 1UG6A 4PCSA 3AXHA 4D72A 2QLYA 1JGIA 2X2YA 1KQYA 1E0VA 4KH2A 2WZEA 2ZX9A 2BY2A 2WHKA 2NW0A 5A6SA 4CU8A 3VPLA 1ZJAA 1CENA 5CPQA 4CD4A 1B0IA 4PEEA 2EPKX 4N0RA 3SCSA 3L2LA 2CETA 1QPKA 1TA3A 1PBGA 1B31A 3FAWA 3N17A 3WD1A 5A8PA 2G3MA 3QHNA 5BXTA 1B3YA 3OLEA 1E6PA 3AXIA 5ECUA 3WH6A 1VFFA 4UZUA 1E4LA 2EO7A 3OZOA 1UD2A 2FHCA 4CD7A 2ESCA 1VFMA 3MUIA 2DSKA 1W2VA 3AS1A 1W9UA 3VIPA 1QI5A 1BHGA 4YHEA 1Q6CA 2OYKA 4H2CA 1CZ1A 2GJXB 3I3DA 1Q6FA 4D6EA 4JIEA 2OWWA 3ZOAA 4XB3A 2JF6A 4H8HA 1BQCA 4TTUA 2YLAA 1KXTA 1Q4NX 1XRVA 3CIVA 3OIHA 1ZBWA 3J7HA 1OB0A 2Q8XA 2GDUA 3FNDA 3GH4A 1W3JA 4GO9A 2G41A 2QF8A 4QCFA 5IHRA 2J8FA 2CBJA 3GZAA 2CPUA 1HIZA 4HPGA 3ARWA 3APGA 1V3IA 3ALFA 3AHZA 1UH4A 3A47A 3TTOA 1XCWA 1H49A 4UOJA 5GNZA 1BGAA 3FW6A 4YN5A 3WBEA 5BCAA 1G9HA 3ZT5A 5FIPA 4F79A 1CXKA 5FOOA 1BLIA 3VKKA 2V38A 1ESWA 3WBAA 3SUTA 3BAJA 3CZJA 2YL8A 4GINA 2DSVA 3FAXA 3CZ8A 3ZT6A 2WW5A 3PTMA 1UH2A 4CCCA 2HVMA 1US3A 1NOWA 4PUDA 4W7VA 3WNOA 1UD8A 3ALGA 1UR2A 1VRXA 5HOSA 2W4XA 1K9TA 2VVNA 1ZL1A 3VGFA 1BYBA 4PN2A 1OD8A 3AMDA 2YL5A 3SEPA 4WKAA 1L0PA 4OBSA 1JL8A 4ZXOA 3WFLA 3O2LA 1UKSA 1UD6A 3TTSA 5M03A 1ISZA 3W25A 1WKYA 3ZO9A 1UD4A 3KWXA 3GDBA 2IUZA 4ATLA 5CJ5A 3UG4A 2GJPA 3EDFA 3AIWA 1OSEA 1HP4A 1B3VA 3WD2A 1V08A 2HISA 1CWYA 4QLLA 4UFMA 3WL1A 5FL1A 2A3EA 3CLWA 3AXXA 2IXVA 4AWEA 3HU7A 2JALA 2VMFA 1V6YA 3PZQA 2EPMX 1CECA 1CLVA 1TVPA 4DUVA 4OZOA 3WQ6A 1KGUA 4ZFMA 1NWTA 2FH8A 3PTQA 1QHOA 1MFUA 2QHAA 1OBAA 1OT1A 5CZKA 1G0CA 4HZ8A 3UEQA 2E9BA 4NRSA 2XVKA 1KGWA 2CBIA 4QAWA 3W6LA 1IT0A 4B9YA 4V27A 5DO8A 3WF4A 3OBAA 1KCKA 1PJ9A 1HKKA 2QMJA 3ZSTA 5BWFA 1LWHA 5E09A 2ZUWA 4EK7A 4AZ5A 1GHSA 5M17A 4W89A 2MANA 2EPNA 2D3NA 3KL3A 3OB8A 4F8XA 3DC0A 2A3HA 4WK9A 2VZTA 1JZ8A 4QP0A 3D3AA 3GTNA 2A3BA 3RJXA 5ABEA 2ZUVA 4AXNA 4OIFA 4MDPA 3ZR5A 1H0GA 3L4WA 1WAWA 2WVTA 1VIWA 1W32A 3GNRA 3PZVA 3UG3A 3BCDA 4JHOA 4F9DA 4HU0A 3G6LA 4AY1A 3MMWA 4W86A 1XH0A 3CZKA 1NP2A 5JBFA 2FHBA 4NZCA 5AC4A 4B15A 1MXDA 1VEMA 1V0KA 2JEQA 3ARYA 3ARZA 4HOWA 4AEFA 1KFWA 1C7TA 2Y4SA 1X6NA 1TFVA 4CCDA 1W9BM 4JKKA 2BVDA 3T0DA 1GJWA 4GPNA 5A69A 2YBUA 2J7GA 3EDJA 1W9DM 3VMNA 4LYQA 4E8DA 3VD5A 3VGGA 1J0KA 3LPFA 4TX8A 3HJEA 2VR4A 1HVQA 4MNLA 3UCQA 3LPPA 2WXDM 4CGTA 1JI1A 5BRPA 1OM0A 3B9AA 1WCGA 2G8ZA 4UQBA 3LMYA 3NDYA 1JD9A 1V6UA 2W61A 4W8BA 1V02A 2J4GA 2FGZA 4IPNB 3CPUA 4P7QA 3VIKA 1UD5A 2BFGA 2DH2A 3WF0A 1V6XA 5EMYA 2WMHA 2CHOA 1C8XA 3WDQA 1FOBA 2ZX5A 3PZ9A 3WDJA 4JFWA 1BFNA 2VCBA 3N13A 2G4FA 1A3HA 4W93A 2DT0A 1J0ZA 3VD4A 3VINA 3VM7A 4ACYA 1CXHA 3SCQA 2PI6A 2Y2WA 5IHSA 4JZ5A 1DEDA 3SURA 3VD7A 5I0DA 1W3KA 4HA3A 3VGHA 1JYWA 2D0HA 4J3UA 1PIFA 3CO4A 3WH8A 4RE2A 2WBKA 3W81A 4U2YA 1L8NA 1PAMA 4OJYA 5A2AA 3L2MA 1H3GA 2JIWA 3WELA 4D6GA 3AICA 1E43A 5BXRA 7A3HA 4D6CA 1CGWA 4P8VA 2WK2A 3MUAA 3VD3A 3N1AA 3CUIA 2WMIA 1BYDA 4MJ2A 3OLGA 3FHQA 1KQZA 1PZ2A 2Y8KA 4HA4A 2UY2A 5EBAA 2V3GA 2OWXA 3OLIA 1R7OA 2X0YA 1WZAA 4W7WA 4C7DA 3RDKA 3WNLA 4PMVA 5IFTA 1B3ZA 1E6XM 4J3TA 1EDGA 2QV4A 1OD0A 2J7BA 2VRKA 4TXEA 1D7FA 1UD3A 2J7DA 2CKRA 1YQ2A 1QNPA 1VAHA 1V0MA 3U5UA 1E71M 3ZQ9A 1FH8A 1RP8A 3DHPA 4M24A 1G01A 4XUYA 3ARXA 1JXKA 1JFHA 4AYSA 2VRJA 2WC4A 3BLPX 3CZGA 5A8NA 1DHKA 2DGAA 3CTTA 2ZUMA 8A3HA 1B30A 1E55A 4AZCA 4MDOA 3MSGA 3PZTA 3WUGA 4J3VA 4FK9A 2WB5A 3CZEA 4MB4A 4AZ7A 3NYDA 4GI6A 9CGTA 1DP0A 5AYBA 4UOZA 4WSKA 5TD4A 1GORA 1EQCA 5KEZA 2QPUA 2NT0A 1FP8A 5D8WA 4B3KA 2VQTA 1ISVA 4ZEPA 2D0GA 3M46A 1K9DA 2O9RA 5BXSA 4U2ZA 3T0BA 4AEEA 1AQHA 2YA2A 4M80A 1XD0A 3CHDA 3CUFA 3VMOA 1HT6A 3B9EA 3GXFA 3MUY1 4U3AA 3VIIA 2WC3A 1H09A 3OGSA 1J11A 1UA7A 3MV01 2G3NA 4U5KA 3W6MA 3U5YA 4QCEA 1UR0A 4LXFA 5D9PA 1QI4A 5D9NA 1MQQA 3NUKA 4FMVA 2JEPA 1WP6A 2OSXA 4P7OA 1VJZA 5E6ZA 2UY4A 3I3BA 3UR7A 2VX4A 1UUQA 3RM4A 7TAAA 1Y7VA 1JZ7A 3AIQA 2XTKA 5DEZA 4PTWA 2FH6A 2B31A 2WVVA 3WF3A 4JFTA 2E9MA 4UQDA 4M8UA 2X09A 2FHFA 1O7AA 5CQ1A 3VGBA 1F4HA 4DUWA 4OOUA 4CVWA 3POCA 2XIBA 2AAAA 4J3WA 3VO0A 3K4DA 2WHLA 3IANA 1DWAM 1Q6DA 2JFEX 2V5DA 4W5UA 1NH6A 4UFHA 4XX6A 4PMZA 5CGTA 2PWEA 2DEPA 4WKFA 2VT0A 1WE5A 3S2CA 1CIUA 3DECA 2VQUA 1HL8A 2BVTA 2VZSA 1EGZA 1BSIA 3SCWA 3BC9A 3PN8A 4AIEA 3EMQA 1C8YA 3WDIA 1EA9C 4BQ2A 4PMDA 1W1TA 1VBRA 3W0KA 2WVUA 1US2A 1FH9A 3SUSA 4XV0A 3PBGA 1PX4A 5GQBA 2XG9A 1EXPA 5DT7A 5HPCA 1CXFA 3AYSA 4AISA 3VDAA 1UWIA 1KCLA 1QBAA 1ITXA 4P7RA 1MQRA 2FDMA 1HKJA 2ZUSA 4JAWA 4UQAA 3WDPP 3A4XA 2XVPA 3AROA 1HNYA 3N12A 5D9OA 4QLKA 3K4AA 1WZMA 2CXGA 5JBEA 3N04A 1A47A 1LF1A 1AQ0A 1ISXA 3CGTA 3L4XA 3WUEA 1C91A 3L4VA 1ODUA 3DYPA 5CLTA 4D1JA 5HBFA 4C7FA 2F2HA 4HPHA 2XFRA 5FD0A 2VZUA 1W3LA 3CUGA 1E1EA 3NSXA 4L4PA 1UQYA 2DPEA 1F4AA 3ZJ7A 4HMEA 1UKOA 3VNYA 4D6IA 3WQ4A 2WBGA 2DIJA 4A3YA 4CD5A 3L4UA 2DDXA 3M07A 4GZIA 3WH5A 3OA5A 2W63A 5A6BA 3VIOA 4ATWA 2O92A 1H41A 4GI8A 2J77A 2BXYA 4HP5A 1CTNA 1LL6A 1UOKA 1WDRA 3AZTA 4Y7EA 3BMWA 2YL6A 4W8AA 5A94A 4DWSC 1CXEA 1GQIA 4J3SA 5A6LA 3K8LA 1V3HA 2XM2A 4GQRA 4ML4A 2VZOA 1U30A 3W27A 1EO7A 4KGLA 4ACZB 1U2YA 2DT3A 1DTUA 4AZHA 4UFLA 1UYQA 1QHPA 2ZUUA 1BGGA 3FXYA 2YKKA 3T0AA 1M04A 3WD4A 1CGVA 1BG4A 3F4VA 3VM5A 2DT1A 5E70A 3RILA 2WC7A 1XSJA 3M6DA 1CDGA 1E6ZA 1NARA 2ZUNA 1V3LA 2YDRA 5I6SA 4S3KA 5CLWA 1HKMA 4LX4A 4IUGA 4IPLA 2WZIA 3ZJ6A 3WY1A 3VIFA 3FHAA 4Q7NA 2YBTA 2AMGA 2J25A 4TVCA 3AIUA 1JYVA 4GIAA 2C7FA 1QOXA 4MNMA 4HU8A 3PZOA 1W3HA 4AZBA 1GUVA 2XIIA 4K68A 1Z32X 2PWDA 1UR8A 1V6VA 4M81A 1G94A 1C3FA 3OGVA 4EANA 3AMLA 4PUEA 4W88A 2WLYA 1ODZA 1GOMA 3WF1A 3A4WA 3PZUA 1CBGA 4RE3A 1HXJA 1P6WA 2QPSA 1FH7A 5A8OA 4CU7A 1MWOA 3QHOA 3SCVA 3WL0A 4A4AA 4U33A 2VI0A 5I5RA 5KZ6A 4AZIA 3MS8A 5A3HA 2GJXA 2YA0A 1E4NA 4J28A 4WLCA 1N82A 2VX6A 2VTFA 1PIGA 5FCZA 1JYXA 2DSZA 4KRTA 4RL3A 5HNNA 1FHDA 2ZUTA 1M03A 4JL1A 1TCMA 4HOXA 3AJ7A 3WNMA 5ABFB 2BY3A 3BAWA 1PX3A 3CMGA 1JNEA 1E73M 2WVSA 1IZJA 3RJYA 5CSUA 4MTVA 1JIBA 1NQ6A 2WCAA 3ZT7A 1WZKA 2VOTA 1VEPA 3A6OA 4EKJA 2XGBA 3KE0A 1HVXA 1PZ3A 4HZ7A 4MNJA 3EDKA 2WSPA 3EMCA 1J18A 5JBDA 4AW7A 4PSPA 3VIHA 2J7CA 4B9ZA 1QI2A 2EBNA 1R87A 3WNPA 1UWUA 1J10A 2D23A 4MNKA 3QOMA 3LPGA 4A3HA 1XV8A 1OGGA 3AHTA 2A3AA 1J12A 4PMXA 3QGVA 1ZJBA 1AMYA 2J79A 3AIBA 3AISA 3GM8A 3EMZA 3II1A 3ARRA 5DMYA 2VX7A 2ZXAA 1VFOA 1H5VA 1I75A 3FY1A 3WENA 2DSWA 2J7EA 1XGZA 1E0WA 2NT1A 5I79A 5CSYA 3AHVA 4MB1A 1S46A 4TTGA 3THDA 3N11A 2G3IA 2NSXA 2XFFA 1C92A 3KL0A 5C8BB 4R5EA 4M1RA 1VJSA 1I1XA 4H8VA 2PF0A 1EHNA 1V03A 2CEQA 4GZJA 3AI0A 3F5KA 1WZLA 1LWJA 3SCPA 5JUVA 1LL7A 3WMBA 2EEXA 5I77A 4GXPA 4PCTA 5I23A 1J0IA 1KR1A 2VX5A 1E9LA 3GH5A 4DWSB 3WEOA 2EPOA 2VL4A 4JFUA 1E6NA 4V2XA 5E6YA 3ARPA 1BG9A 2J47A 1DWHM 5JIWA 1ISWA 1LL4A 5CXPA 3T2OA 3WMCA 1UKTA 3BMVA 4W5ZA 1VF8A 2X1IA 2EPLX 1SMDA 1CPUA 2J78A 3AHYA 1Q6EA 3VTRA 3WIJA 3HN3A 2E0PA 1CGYA 4UFIA 4FLOA 3TTYA 4P8UA 4HZ6A 5EFFA 1WO2A 3M7SA 4JKLA 3ZMRA 1JZ4A 2BV9A 1BVNP 3VDHA 4F66A 2XYLA 1UH3A 2GVYA 4AZGA 4CN1A 4NI3A 2WAGA 1EHAA 3WNKA 1SR0A 3BH4A 4AD4A 1C90A 4H8UA 3LPOA 4W7UA 1CGXA 1LLOA 3NCOA 1NM9A 1JZ5A 3T08A 3AMGA 1W1YA 1HJUA 3PZIA 4CD8A 5A95A 4LYRA 4Z2HA 1ZS2A 3JUGA 1VFUA 1U33A 1BVZA 4H04A 2PC8A 4UTFA 1EQPA 2BVYA 4OKDA 5A8QA 1CXIA 2YDSA 2Y5EA 2G3JA 3CUJA 2VO5A 3RIKA 1E5NA 3AOFA 3BAIA 4F9JA 1IZKA 1UR9A 3O6AA 2CCRA 1NWUA 2VCAA 2OYLA 3WQ5A 2ZE0A 2CKSA 1VENA 4D6FA 1BYCA 1GVIA 5GPRA 4E2OA 3WD3A 1WPCA 2D22A 3GXDA 4TUFA 4CCEA 1B9ZA 1UKPA 3WN6A 3WNNA 1XC6A 2WMGA 4DUXA 2X8RA 3N15A 2CERA 4UR9A 1UWTA 6CGTA 1JG9A 2WKGA 1NOUA 4BZYA 3L4YA 2AOSA 5E0CA 1GPFA 2OYMA 2YDQA 4J3XA 1HJWA 1LQ0A 3IAQA 2E8ZA 3ZR6A 3SCRA 1WNOA 4DWSD 1KXQA 3AZSA 4PTMA 1HX0A 1C93A 1LJYA 4JKMA 1G1YA 2X05A 3UETA 4CN4A 2XHYA 1ZBKA 2V5CA 4WKHA 4D6HA 5A8MA 5EFDA 3S6TA 1CXLA 1R86A 5I3DA 1VBUA 4PYSA 4DM2A 3K1DA 5C70A 1ISYA 1E15A 4AD2A 3SUVA 7CGTA 1W9VA 2ZWYA 1ZU8A 3AIVA 3POHA 1QW8A 4BQ5A 2CYGA 2XFYA 4QFUA 4LPCA 1KR0A 3VGEA 1GOWA 4X9YA 5LYRA 1V0LA 2UY5A 5I2UA 1H11A 4AD0A 1E3ZA 5AYIA 1MW1A 2CHNA 2WANA 2WM0A 1HJSA 3BSGA 3WFZA 3VVGA 3HMCA 2VCCA 4HMDA 1SYTA 3ZSSA 1TA3B 3TA9A 1EDQA 1IV8A 2QMKA 4FLRA 2E4TA 1B2YA 2ZICA 1HKIA 4QDMA 1AQMA 5I24A 1V3MA 3WKZA 2YIHA 2ZWZA 4P8WA 3VIGA 2D1ZA 4YPJA 3CH9A 3QOKA 1E72M 3PHAA 1B3XA 2ZOXA 1FHLA 2WCSA 2J7HA 1M53A 3GBEA 3T2QA 5FKYA 2W66A 2CNCA 1UWQA 1HN1A 1V6WA 1H1NA 5JIPA 2W62A 1QVBA 5BROA 1DWFM 3WH7A 3AIEA 2BY0A 3WDHA 2XVLA 3L4TA 2A3CA 2D0FA 2XM1A 3OLDA 3WD0A 1UQZA 3MU7A 1D3CA 2JE8A 1DWJM 2E9LA 3WF2A 5ABGA 4JCLA 2V3DA 3PZNA 1E6RA 3BAXA 1RD6A 4X0VA 3SCOA 1JAEA 2D20A 1UZ1A 3L4ZA 1FA2A 3WDRA 3RCNA 2XSAA 2ZXDA 4X0NA 4KRUA 2J74A 1XSKA 2WHJA 3AHXA 3CHFA 1DWGM 3TP4A 1QI3A 2D3LA 4JFSA 1E3XA 3U7BA 1W91A 1MW2A 2WCGA 1R8LA 3GBDA 2V3EA 3NIYA 1SFSA 1W9PA 3MMUA 3AMKA 1B1YA 4ATDA 4DM1A 4PMRA 4UQCA 4D1IA 5A6MA 2WWCA 1MYRA 1QNQA 2Y24A 2W91A 1HJVA 3DYMA 1XCXA 3VGDA 5AY7A 4PMYA 3W53A 1GOIA 2DIEA 1CYGA 2YL9A 1EH9A 3AQUA 2EQDA 5A1AA 5I78A 3N9KA 2WYSA 3GXIA 3ECQA 4WSJA 1I1WA 3ZIZA 2WSKA 4P7LA 3WQVA 2JIEA 4UQ9A 2W67A 4HOZA 3G6MA 3SCNA 2ZXQA 3GH7A 4C7GA 5HXMA 3FN9A 1BTCA 4P7NA 1CEOA 1B90A 5A6BD 5CPTA 1GHRA 3EDDA 1GOQA 1KWGA 1QW9A 4LGXA 4MB3A 4PRWA 3SCTA 3VX0A 4IM4A 2DSUA 1EIBA 1YHTA 2D2OA 2XSBA 3NJ3A 4U31A 5FL0A 4D6DA 4CN6A 4W8LA 4GQQA 2OSWA 3OZPA 2VURA 4J27A 1C8QA 2XJ7A 1GONA 2OWCA 1KBKA 4Q22A 3MV11 1J9YA 1E1FA 4LQ1A 4PMNA 5DF0A 1GNXA 2Y8VA 2WWDA 3KZSA 3UR8A 4B3LA 1GVYA 3ZM8A 3T09A 2PWFA 3DYOA 3PZMA 4GO8A 5E9AA 1TVNA 3WMSA 1NOFA 1OT2A 2XWEA 3UESA 2D24A 2C0HA 5LA0A 5A2CA 4M82A 1BF2A 1PEZA 2OSYA 3BAYA 2XVGA 1HL9A 3CMJA 3GYCA 4FLSA 4JCMA 1RPKA 1TUXA 1KBBA 3EDEA 1W1VA 3U7VA 3F5LA 5IXEA 3EBVA 1JI2A 4M29A 4KMQA 3VIJA 2WPGA 1BAGA 1QI0A 4GKLA 4ZENA 3W29A 2YA1A 2RGLA 1WDQA 3TONA 3MO4A 4MJ4A 4UFJA 3CHCA 4OUEA 2BHUA 1DWIM 4P8XA 5LA1A 4ACZA 1JD7A 1RP9A 3AYRA 1QBBA 2WNWA 4WF7A 1GQKA 4UOQA 2PWHA 1RH9A 1JF6A 1XD1A 3K8MA 1GZJA 2CIPA 4R27A 3ARVA 1FFQA 3VUPA 4NRRA 1M01A 1OIMA 1JDAA 3WUBA 3VX1A 5BYWA 4IISA 4AC1X 3ARQA 1ECEA 3MSDA 3T2PA 4UNIA 2J75A 3GNPA 1XH2A 5A6JA 3RMEA 2XVNA 3CHEA 4AIUA 1MFVA 1KWKA 1XHGA 1O6IA 1E6QM 3SIMA 4AD5A 1BYAA 1JF5A 4CVUA 1JZ3A 4QLJA 4MAVA 2JF7A 1Q6GA 5M3WA 4AD1A 2EXOA 5C71A 1TMQA 1V02E 1AVAA 4N42A 2ZXBA 4Z2LA 5M5DA 1HF6A 1TR1A 2VRQA 4RE4A 1XYZA 3ARSA 3UG5A 4AIOA 1MVYA 4BQ3A 2GUYA 1B3WA 2O9TA 1H0IA 2X0HA 3RM9A 5IFPA 4MPKA 1J0YA 2BNJA 2Z1SA 3CBWA 2W92A 3RPMA 3WEZA 2TAAA 1X1NA 2J8GA 1K6AA 1VB9A 1ZBVA 2VJXA 1JXJA 3SCUA 4BCEA 1X6LA 1V3JA 3RM8A 3W28A 3ZJ8A 1E4IA 4D6JA 2PBGA 3ARUA 4FF5A 6TAAA 3U57A 1KB3A 3BLKA 2WMKA 2VVSA 1HJXA 4ZXLA 4KGJA 1J0JA 3VOCA 2WMIB 1BPLB 4TVDA 3AZRA 1QNRA 1QNSA 4PMQA 1MXGA 5BXPA 2CESA 2XUCA 2C8NA 2OLHA 2DT2A 1WB0A 3EYPA 4J7RA 1UR1A 1LG2A 2PB1A 4UFKA 5ABFA 4HA1A 1GOKA 5A6AA 3OG2A 2E3ZA 3AS0A 1XYFA 1J01A 4CKQA 1MQPA 2BXZA 2VZVA 1J0HA 2XWDA 3NSMA 2WHMA 3D5HA 1OGBA 3F5JA 1TE1A 1G5AA 1GJUA 2BHYA 3MMDA 3VDBA 1KGXA 4PMOA 5CPSA 2GFTA 2VR5A 2BY1A 3BSHA 4TVUA 1E56A 1MW3A 3RO8A 1CGTA 4AZCB 2PBOA 1KXVA 3NSNA 5ABHA 2XPKA 3VDCA 4EE9A 1UKQA 1JNDA 2RGMA 1E5JA 2GDVA 3IJ9A 1M7XA 3CUHA 1GOOA 3WQWA 3AIRA 2XGIA 3B9DA 4PMUA 3SUUA 2J7FA 1H4PA 2IXUA 4LYPA 4EAMA 4XZBA 3AMCA 4GI9A 5HPOA 1PPIA 2UY3A 3GXMA 4BQ4A 1XSIA 4MAZA 1OGSA 2GSJA 1GCYA 1E4MM 3VILA 4U3CA 1E6SM 4BA0A 3VD9A 1WDSA 2Z1KA 1OINA 1JFXA 4Z2JA 1NWRA 3GNOA 4Z2IA 1SMAA 1UHVA 4MADA 3WUFA 2O9PA 5EB8A 4JHZA 1MW0A 4YHGA 3W37A 1WDPA 4ZE5A 4PSRA 4V28A 1EOKA 4TOQA 1UA3A 4UQEA 2ZX6A 1OWQA 3WEMA 4W85A 1CNVA 3UERA 1V0NA 3VMPA 3W38A 5DT5A 4CU6A 4U5IA 4DWSA 4NF7A 4E4PA 3THCA 1CGUA 8CGTA 3TTQA 2WVVB 1UZ4A 2GK1B 3W26A 4MB5A 4H41A 3N18A 2CITA 4OOZA 2CBVA 1NWSA 4OBRA 1LG1A 3KEHA 1KXHA 2ZX8A 3BXWA 4XZWA 3QR3A 3PTKA 2E8YA 2CBUA 3AS2A 5E0FA 1UWRA 1EOMA 1ZB5A 2ZIDA 2YLLA 1D2KA 4JL2A 5F7UA 2DH3A 3OGRA 1TZ7A 3SUWA 5A6KA 1R85A 3TOPA 2WZHA 4AZ6A 2O9OA 1OIFA 4URIA 5GNXA 5LA2A 4BF7A 4S3JA 1FFRA 1JYNA 2WMFA 1K9EA 1JZ2A 1C7SA 2F61A 3BGAA 4ZE4A 1K9FA 1R7AA 5DFAA 4H7VA 3CZLA 4CD6A
chains in the Genus database with same CATH superfamily
4GYJA 1JDCA 4MKSA 3G0SA 3IIVA 3IUDA 3K30A 5GNYA 1FXPA 3G3MA 3WH9A 3TROA 5AHLA 4F0MA 1E0XA 4HMCA 1T41A 1SU5A 5CGMA 5AYXA 5F4WA 3A12A 1GZGA 4UZSA 4LBRA 3AO0A 2ON3A 4B4HA 3IK2A 2QR6A 1E40A 3QV9A 1ITCA 4IJRA 1F73A 1HP5A 3BLDA 3MDWA 4W84A 3VNZA 3T55A 4JFVA 1EYEA 1W9XA 5IDIA 2PWGA 1M1BA 1LLWA 1KC7A 2HVNA 2NLIA 4PB5A 1GQLA 1IWAA 1UR4A 1W1PA 4KPLA 3LHVA 2R94A 5DLCA 1CLXA 4KWUA 3O9NA 1H50A 1VBJA 5KETA 4QRNA 3NQFA 5D9MA 5FI8A 1JQXA 4B16A 9XIMA 1EF2A 1UWSA 4WIWA 3S5YA 4HTYA 1VCGA 2GVJA 2VUYA 4DBEA 5KZMA 2EJ1A 2XFWA 3W7CA 2VC9A 3E1F1 2Z4GA 1S5VA 3B8WA 4TX6A 5D4YA 5E1QA 2BHZA 3UQNA 3H6OA 5AC5A 1EWEA 2J62A 3G1XA 3WLRA 3SQLA 2DQXA 4WUIA 4PTVA 2GSHA 1W56A 5MKGA 4I5XA 5CPNA 3BJSA 4L64A 4Q8UA 1EO5A 3U9IA 2J27A 2DQWA 2GGJA 2FPTA 4EWJA 3E0LA 1JGIA 3RR1A 4N7QA 2WZEA 1S39A 2BY2A 1TPDA 4IX0A 1OFRA 5D32A 2WHKA 3WJYA 5A6SA 4QBXA 4CD4A 1B0IA 3TIMA 2EPKX 4QIUA 3L2LA 5K7JA 4HYRA 1PBGA 7ENLA 1D3GA 1SPQA 3FAWA 3N17A 1P7TA 2J9XA 1GVRA 3OLEA 1E6PA 3AXIA 5ECUA 1G7VA 5HMFA 5LNRA 4UZUA 2EO7A 4H1ZA 2FYMA 3RR4A 3R2GA 1V8EA 4H8NA 4U10A 2ZRVA 2DSKA 3ABRA 1PV8A 1W9UA 4YMZA 3VIPA 1ZUAX 1QI5A 4A3QA 1B9BA 1EBHA 4D6EA 2JF6A 2FFCA 1BQCA 1KXTA 1ZJIA 1ZBWA 2Q8XA 2GDUA 1EEXA 4GO9A 4YIWA 3MB9A 5HANA 2AL2A 1YE4A 3APGA 3HJZA 4O1FA 4ADTA 2QCNA 3LCIA 4AIBA 1BGAA 3KP1A 2ODOA 1WXYA 1VD6A 3QMSA 3ABXA 1VZWA 2V38A 3SUTA 4Q4KA 4I6KA 3CZJA 2WJZA 4GINA 2Z00A 3S0CA 2FZ8A 1UH2A 1JQVA 1O12A 2UV8G 3QGAC 1VRXA 3Q2DA 3B8IA 3VGFA 4AH7A 4D8ZA 5FJJA 2WQPA 3TMLA 4OBSA 3L65A 2NV9A 3WFLA 4F0LA 3TTSA 1ISZA 3ZO9A 4CQ8A 1Q3NA 4NIRA 2IUZA 2FTPA 3AIWA 3P7YA 3B9NA 1OSEA 1D9EA 1ZPTA 1V08A 3AUJA 5FEZA 4S38A 1OF6A 3ANUA 3HU7A 2VMFA 3NQDA 2VEMA 3PZQA 4NZ4A 1K02A 1CECA 2QUVA 3W2UA 1TVPA 3GVGA 1XBVA 4ZFMA 2FH8A 4DXVA 1IHIA 4WJ8A 1KCXA 1QHOA 1MFUA 1OT1A 2XIQA 4D8LA 2XVKA 1MSSA 3C0SA 2Y7GA 3W6LA 5SWUA 3LG3A 4V27A 4G2DA 1FWGC 4I7WA 4H9MA 2A1YA 1KCKA 1KKRA 3TKFA 4I7VA 4AZ5A 5M17A 2VYOA 2OQHA 3OZMA 4F2BA 3OB8A 3D0CA 4F8XA 1OFAA 1J5TA 3DZ1A 4OUIA 3TC6A 5CC7A 4NJJA 1HGWA 4ZA0A 2HBXA 2FZMA 2A3BA 3RJXA 4AXNA 4OIFA 3ZR5A 1H0GA 1WAWA 5D38A 2HXTA 4GQ0A 3TYZA 4HU0A 3G6LA 3W01A 3MWCA 4YYCA 3MJYA 1LUCB 2QCCA 4NZCA 4GGHA 2PP3A 1FCUA 3ARYA 1EC8A 1V7YA 3IGSA 4QHRA 1NDZA 3VK5A 1XLIA 1XIBA 1O68A 1TFVA 3W7EA 3WMLA 1W9BM 2ATMA 4IPIA 3NPWA 4JKKA 4YL2A 3T0DA 1GJWA 3HPFA 3UCDA 3AXMA 1W9DM 4E8DA 3VD5A 1TIMA 4NG3A 5KZEA 1J0KA 4LEFA 3HJEA 4MSSA 1UUMA 4ZB0A 1A5CA 3SR7A 1HVQA 1PKLA 2ZADA 4Z0SA 1TPH1 4CGTA 3WLJA 1OM0A 4JIHA 1M9HA 2RDTA 2Y70A 5LKYA 4IICA 1MUMA 4JNMA 3LMYA 1OQFA 1TTPA 1V6UA 4IPNB 3TZNA 3QV8A 3FA3A 1DQUA 2X41A 2OX1A 2WMHA 3CS2A 4CLMA 2POTA 3DXIA 3QY7A 5XIMA 3GVVA 4M6UA 3PZ9A 4BFAA 1BFNA 4FNTA 1XIDA 4RPQA 4W93A 1MMFA 1ITUA 2BXVA 3RLGA 4P5UA 3M0LA 1N8FA 4XO7A 1G4PA 4DNMA 3SY5A 4JZ5A 4RJEA 5FSEC 3H24A 5HULA 1JYWA 3T42A 1FX6A 4J3UA 3CO4A 3WH8A 1LUCA 3C2RA 1PAMA 4LALA 3WELA 1DJZA 5FJUA 3EA3A 2QAFA 1FXQA 3N1AA 1ZAHA 3CUIA 2WMIA 3M0MA 1BYDA 1ZLPA 2QULA 4Y96A 3QQWA 5XIAA 5I7GA 3R0UA 3G3DA 4ICCX 3OLIA 1R7OA 2FKPA 1WZAA 3RDKA 1RVGA 3CEUA 3WNLA 5IFTA 2KAUC 1E6XM 4J3TA 2HPIA 3SN1A 1OD0A 1D7FA 4A35A 2OVLA 1V5XA 3EOEA 1YQ2A 1MRQA 2FZBA 1SR9A 4Z17A 4DZIA 2RUSA 4FNUA 4DNHA 3THUA 3ZQ9A 1RP8A 6ENLA 4XUYA 1VPXA 4GCXA 3TNOA 3NL3A 1FKWA 3FCPA 4Y6GA 3CZGA 1XLKA 4O14A 8A3HA 2ZZ5A 3EWCA 3DHDA 4MDOA 1R38A 3T4WA 4J3VA 1W1B1 8XIMA 2EG7A 1KBJA 5K9DA 5REQB 4FOJA 3NYDA 1QU4A 3IEBA 1K8CA 3RPDA 3EX3A 1RR2A 5HNRA 1BKHA 3QMRA 1EQCA 2PU0A 4JY9A 4YTSA 5CGQA 3UWWA 5D8WA 1TV4A 1FTXA 3QY6A 2D0GA 1TPFA 3EZ4A 2IMRA 5BXSA 3T0BA 5F4XA 2BX7A 3CYJA 3CHDA 3VMOA 4YS1A 1PS9A 4EXQA 2QJHA 1J11A 1UA7A 3GDKA 1UR0A 5HINA 5AKQA 1SM9A 3GFZA 3CQ0A 1GG0A 4PCNA 3WO8A 4AY8A 1ZJHA 4TIMA 4FMVA 4P7OA 2OSXA 3O07A 4IMFA 2FZDA 3SN4A 2UY4A 3APYA 3UR7A 1KFEA 1WOAA 3RM4A 4AWUA 3JZUA 3RFAA 3N2CA 1HZYA 3GDMA 2FGBA 4PTWA 2B31A 1U5VA 2E9MA 4H2HA 4QEHA 1AD4A 3PB0A 2C16A 3POCA 4DX3A 3U2CA 3O6CA 3H21A 3IANA 4US6A 2ZE3A 2V5DA 2PDNA 2ISFA 4UFHA 3URAA 2DEPA 4WKFA 2NZLA 2VQUA 2Q71A 1HL8A 3GR4A 2YYTA 4S23A 3BC9A 1JUKA 4JIIX 5CAHA 3ZVHB 3M5ZA 4Q3MA 3K1GA 2AGTA 4HJFA 4AY7A 4JBRA 3UCCA 4NY2A 1UBPC 2IQ0A 1EXPA 3AYSA 4AISA 4A6GA 3GW3A 3VDAA 4QISA 1ITXA 1QPOA 4I8DA 1MQRA 1XGEA 4JAWA 3A4XA 1HNYA 1H51A 4I9TA 4NZJA 1O1ZA 2XIMA 1LOLA 1WZMA 4LY4A 3N04A 1A47A 3F4DA 5HNTA 1AQ0A 3L4XA 5G2IA 5I03A 1UCWA 1HTIA 5HBFA 4C7FA 2F9RA 2PWVA 3AJXA 1S5WA 3C2YA 4H7CA 2Z7GA 4WVXA 1MUCA 4L4PA 1TQJA 1UQYA 1F4AA 4HMEA 3JW7A 3OVPA 1ALDA 3E0VA 4CD5A 4XTDA 5KMYA 3NL6A 3KZPA 3VIOA 4ATWA 2O92A 2BXYA 2OT1A 4HP5A 1LL6A 4MHBA 3VA8A 1TPWA 3AZTA 3A9IA 4N9CA 3DOPA 2E09A 4J3SA 3LOTA 4O50A 6ALDA 6XIMA 3RU6A 1WOBA 4LAOA 4AZHA 3ZVHA 5IBXC 3MI3A 3NZPA 4UFLA 1UYQA 2ZUUA 4QROA 3FXYA 3W1PA 2YKKA 3T0AA 4F0KA 1M04A 3SQSA 3WD4A 1UZDA 1CGVA 3OVGA 3Q67A 5FEXA 3F4VA 3RILA 1EC9A 1CDGA 1E6ZA 2ZUNA 1V3LA 1Q6OA 4IUGA 4IPLA 1DJWA 1YXYA 4Q7NA 1TKKA 2YBTA 2I1OA 4IIFA 1E1CA 1XLGA 3R79A 3IACA 3G1SA 2G97A 2YXGA 3N2XA 3MQTA 4AZBA 4IP7A 2PDJA 4PL2A 3TR2A 1J5SA 4PUEA 1X7IA 2WLYA 3LGDA 3WF1A 3PZUA 1JDEA 4Y9MA 3LUTA 1HXJA 1KFKA 3VUSA 4FXRA 3P74A 3SECA 1PKYA 1MWOA 2TRSA 4K37A 4EP8C 2J88A 4U33A 3GIQA 3MS8A 5A3HA 4N4PA 3USZA 2PFHA 2GJXA 2X2GA 3ONCA 2ZFAA 5M1TA 4WLCA 1YPXA 4DO6A 1LT8A 1N82A 2QEZA 2VTFA 3W74A 4RL3A 3GIYA 3NOEA 4DZAA 3ABOA 2FPYA 4HOXA 2ZZ6A 3ZWTA 2P3ZA 3BAWA 1JNEA 1E73M 1IZJA 4MTVA 4GUJA 1EYWA 2WCAA 3OZYA 3ZT7A 1WZKA 4DJFD 4PMJA 3TYEA 1PZ3A 4DJDA 4CEUC 1YE6A 4IIBA 3RAOA 3K2GA 4IQEA 3EMCA 2ADAA 2J7CA 2V0TA 3WNPA 1EA0A 3E49A 3QOMA 1S2VA 1SFJA 3W2NA 4S3FA 2I5IA 3AHTA 1YTEA 2A3AA 5MHBA 1AMYA 3KDNA 4Q4SA 3ITGA 4JTIA 1E0UA 3ARRA 4R85A 1Y65A 4LYKA 2Y6ZA 2ZXAA 3LM3A 4AU0A 4KCWA 3FY1A 5AHNA 4Q4OA 2VGIA 3AHVA 4MB1A 1S46A 5KITA 1BWKA 4CNOA 3GTIA 3THDA 2A3LA 2XFFA 5DCDA 3KL0A 2HBVA 3SQMA 1EJSC 3B8DA 4HHPA 5AYZA 2ONEA 5EMLA 2PP1A 1XFBA 1EHNA 2CEQA 1AL7A 1ZENA 3W3OA 4A05A 1QDSA 3F5KA 4F0SA 1WZLA 3SCPA 4GI4A 5JXQA 3WMBA 2C3ZA 4PCTA 3GYEA 4ZCWA 4B91A 4BEUA 1W37A 4Z1DA 1XPYA 1HKWA 1KRAC 1DWHM 2GWGA 3H7RA 2QCHA 1LL4A 3R8RA 3BMVA 2X1IA 3STEA 1SMDA 4C6FA 1X6UA 1CPUA 4GJIA 1Q6EA 5C7HA 3WIJA 3LTYA 2XH0A 1RBOB 4S3DA 3TTYA 3EB3A 5LZLA 5EFFA 1WO2A 4I9MA 4LVFA 2PODA 2OR2A 3C3NA 4F66A 3O16A 4GD0A 4JN6A 2FVMA 3CASA 1R47A 2OOGA 4TMCA 4NI3A 3UVIA 3WNKA 3LCGA 1XLMA 3EWYA 3LPOA 3LS9A 5I3HA 3P61A 4O1EA 2ZRXA 1LLOA 3NCOA 1NM9A 1JZ5A 6XIAA 1PTDA 2V8ZA 4GYKA 2NQLA 3A5FA 4NX0A 1VFUA 5LNSA 4H04A 4UTFA 1EQPA 1WAUA 1A5AA 2F7FA 1LRTA 3RIKA 3ZVIA 4N9DA 3AOFA 4ADUA 4TR9A 2PGRA 1NWUA 1NJJA 1VENA 3LHUA 1GVIA 3R6IA 1F6YA 1WPCA 2D22A 4H9YA 3W75A 4CCEA 3N15A 2GPTA 3PAOA 4KIEA 6CGTA 1JG9A 2WKGA 3SW6A 1BXNA 3UZXA 4WJEA 3KBVA 4QSHA 4LBUA 3SCRA 1MEHA 1KXQA 4HB7A 4PTMA 1C93A 3B0PA 4JKMA 3QXBA 5A8MA 3S6TA 5I3DA 3G1HA 4DM2A 1WBHA 3K1DA 1OVDA 1YEYA 2YCEA 1W9VA 3AYTA 3CWNA 2CZVA 4DO4A 1OYAA 4HCLA 4OBTA 2HROA 2WOQA 3CH0A 1MUWA 2CYGA 2G4JA 1AW2A 3T07A 3VGEA 4NXKA 3DIPA 1GOWA 2A4AA 1IT8A 2PCQA 4GWEA 2IQTA 1V0LA 1H11A 1F7BA 4XBKA 1E3ZA 4QTGA 2CHNA 1POJA 3NEHA 2XDFA 3HMCA 2VCCA 3TYCA 1SYTA 4N9BA 3TA9A 1IV8A 3FSUA 2ZRZA 4ZSUA 3N9SA 1M5WA 4HBKA 5CH9A 1AQMA 1XW8A 4P8WA 5AVHA 3BOXA 1KCZA 4WDXA 1WXJA 4J3ZA 4YPJA 1TJ1A 3M0JA 2ZOXA 3BG5A 2O55A 1EFZA 3QM3A 5FKYA 4O10A 3XIMA 1JRCA 1AD1A 2CNCA 4PUWA 4ZO7A 3WLSA 3GAYA 2W62A 1QVBA 3VZYA 4KW2A 4H9TA 3STGA 1A0DA 4O15A 1YXCA 2XH7A 3U0HA 3ZS4A 7XIMA 2BY0A 3THAA 3L4TA 2PDCA 3B0VC 2YZRA 3MU7A 4PR4A 3GSMA 3HPSA 3PZNA 4X61A 1XDJA 4J40A 4X0VA 1XRTA 3L4ZA 2CU0A 1CLKA 2C0AA 4KRUA 3R89A 2WHJA 3MBFA 2DFAA 3ICJA 4IL0A 1DWGM 3U7BA 1K6WA 1MNSA 1MW2A 2WCGA 3GBDA 4LT9A 2V3EA 3NIYA 2ISVA 2ZKMX 1SFSA 3MMUA 3AMKA 3NQ8A 3LXBA 3O15A 4NP7A 3RPTA 2OX4A 4C6NA 3MYOA 1MYRA 2PA6A 1T99A 4A2RA 2SFPA 1TPEA 3FFSA 1P48A 3W83A 4V15A 4PULA 2VFFA 5CJNA 1GOIA 2P88A 4X2RA 3A5VA 5HQEA 5LIYX 4NXSA 2Z6IA 5A1AA 1Q8AA 3NQGA 2C1HA 4R88A 4H6QA 2WSKA 4LY8A 2OGYA 2OPJA 3H55A 1L6FA 5G2HA 1F3XA 3BLOA 4M5PA 3VNKA 5BW6A 1JRBA 2YXOA 3T9PA 3LNPA 1VPYA 4C7GA 2E25A 1KM4A 3KVMA 4MUZA 4K1GA 5C9XA 1B90A 4O1DA 5CPTA 3VZZA 1XYMA 4LUYA 4UTKA 1XI3A 1SJAA 1QW9A 1RCXB 4O1AA 4AX7A 3RK8A 4PGLA 3M5YA 4D6DA 2YYUA 2VUNA 4GQQA 3CK5A 3TMQA 1QAPA 2H3BA 2XJ7A 1RCOB 1MNZA 2Y63A 3HOJA 3E6EA 3VCRA 4Q22A 1F05A 4B5UA 5JH1A 3QN3A 5BNKA 1GNXA 3B8TA 3FVMA 1FQ0A 3KCLA 3GXTA 1GVYA 5LIXX 2V2DA 3P6LA 5T91A 2PWFA 4GO8A 3WMSA 2XWEA 1NDYA 1FCQA 5LA0A 3G5EA 4ECLA 1KNWA 2HJPA 3UJ2A 4M82A 4O19A 4KWWA 1T5AA 2XVGA 2VDHA 3FEQA 4FHAA 4Y9PA 3LDVA 1KBBA 1VLWA 3NQVA 2OEKA 3BK0A 1O60A 1BAGA 1EJ7L 2BVWA 2DVUA 4LF1A 4ZENA 3CPGA 2DW6A 4KFOA 3MO4A 1Q85A 4BWLC 1P43A 2RH9A 4O18A 4OUEA 1DWIM 1YLVA 4QG9A 5LA1A 4FX7A 4ACZA 1OFEA 4H00A 1I9CB 1IXOA 4ZOCA 1QBBA 2WNWA 2YFNA 3FYPA 2Z1XA 2VELA 3GKFA 5HJLA 4E0CA 4UOQA 2PWHA 3W7MA 3MI6A 3WJXA 3H2NA 2CIPA 4R27A 1FFQA 2JBMA 3VUPA 1M01A 1RLDA 1OIMA 1JDAA 4LVAA 3W7PA 4IISA 4ROQA 4C1KA 3TJXA 1XH2A 2GVEA 4MM1A 1GKRA 1E6QM 4LB3A 4AD5A 1BYAA 1I2OA 3U2EA 2GOUA 4QX4A 3W7QA 3ATYA 1W8SA 2EXOA 3GIPA 5C71A 1SO4A 1QJWA 5C54A 1TMQA 2FJUB 4AB4A 2DP3A 2OLAA 4G6CA 5M5DA 1HF6A 4RE4A 2E6FA 3LXCA 3UG5A 4AIOA 2Y88A 1MEWA 2X0HA 4DQWA 1A3XA 4XKYA 2BNJA 4JTDA 3RPMA 3EX4A 3QFEA 3WEZA 3MW7A 4BY3A 1X1NA 1ZBVA 2R1PA 2ZA2A 5BOEA 1LQAA 1X6LA 2E1DA 1YBQB 3W28A 2EGZA 3ARUA 3UY7A 3N19B 3BLKA 3OU8A 4GIYA 2VVSA 3NO3A 3IJIA 2BG5A 3M0IA 3VOCA 1X39A 1QNSA 2NQJA 2CESA 4JIRA 2OLHA 2DT2A 1WB0A 2WSYA 1U22A 2IKHA 4LAMA 1LG2A 4UFKA 3DERA 2OXNA 4HA1A 5ABFA 3PWAA 5A6AA 3VCCA 2QPXA 4DF0A 1XYFA 1J01A 3FGCB 3HB9A 4JQ4A 3E3HA 2IPFA 5DXYA 3VOHA 2VZVA 4LAUA 2XN0A 5ABTA 2D2JA 2PDYA 5LIWX 4MLJA 1GJUA 5I3FA 2Q01A 3Q4DA 2BOEX 5CPSA 2GFTA 2QUUA 3IV8A 2BY1A 4FZIA 4K6AA 2VDIA 4PUNA 2J6VA 2OZTA 3QBUA 2RGMA 2HZGA 1E5JA 2GDVA 1W3TA 1M7XA 3CUHA 1GOOA 4ZQMA 3GNNA 1Q7QA 1I2PA 3AIRA 2XGIA 4ZL1A 3SUUA 5EGRA 3N34A 2ISDA 3SGUA 2IXUA 1PTAA 2PTZA 2Y7FA 4XZBA 1ZZMA 2UY3A 2ZVIA 4NHVA 1TSIA 2ZDSA 5G1YA 2ZRUA 1E6SM 2QV5A 4ZQRA 1WDSA 2Z1KA 2G50A 4S2BA 1XKYA 1ZALA 1NQKA 2GJLA 4Z2JA 2OEMA 3KRBA 4QJ3B 4C6KA 1YPIA 3GU1A 3WUFA 2O9PA 4YHGA 3W37A 3H8AA 2FVKA 3HFTA 3ITTA 1EOKA 4TOQA 2ZX6A 2OT0A 1K7FA 1CNVA 4LB4A 3UERA 3NGFA 3VMPA 4IQDA 3B04A 3UNTA 4NILA 3W38A 2YCIX 5DT5A 3CQKA 4DWSA 4E4PA 2WVVB 3EX2A 1UZ4A 3C2OA 4ZQCA 3SRHA 2GK1B 3O3RA 3W26A 2CITA 1K1DA 4NJKA 3L2IA 1F5ZA 1OADA 2X0SA 1GEHA 1KXHA 4NL1A 5E0FA 3NL5A 1EPXA 3BOFA 2QCFA 3C52A 1GTEA 4O13A 4K7YA 5H8UA 1E9IA 2QJGA 3BE7A 2DH3A 1PWMA 1IWBA 5A6KA 2O9OA 1OIFA 3W86A 5LA2A 4S3JA 1JYNA 1C7SA 1K9FA 1W1A1 3E9AA 3M0KA 3AWNA 3CZLA 1UIPA 1DORA 3DHUA 2E5DA 3I3EA 3VIMA 2V3FA 1DJQA 3BO9A 3CAKA 3LBCA 1GW1A 1NP0A 1VFSA 3BAKA 2INZA 1V3KA 1JPMA 4LVGA 4MKVA 4RR4A 4L4MA 2VXNA 1JDDA 1OFPA 3FIGA 5HDRA 4LBSA 4EPEC 1XIFA 3EPMA 4GNVA 1EJTC 5AHIA 4E2DA 1F8IA 4BS0A 1GW9A 3BG3A 4AD3A 3K13A 3HQOA 3W82A 3MY9A 4E8GA 1F07A 4UCFA 1SQ7A 3IAPA 1FWBC 5D2XA 5CBJA 2GK1A 2XIOA 4JEJA 3PR2A 1I45A 4ML9A 1EDTA 3F2CA 4KEMA 4XZMX 3CTLA 3LCFA 2ZX7A 4M56A 4F0HA 2YOCA 1W2PA 3BCFA 4IXHA 3N25A 3W1LA 4G7EA 4JICA 3IUIA 1F76A 4HHMA 1VEOA 5JMUA 1YRRA 4EPKA 3MUZ1 2CXEA 4OT7A 2R6OA 5BOFA 3WSUA 3HURA 1S1PA 1XJBA 3A3HA 4FP1A 3CIWA 1XX1A 3IJ8A 2ZZ7A 3VU2A 3TK7A 1R3TA 3MANA 1P0NA 4E8CA 3S9IA 4NJHA 2F8QA 3CL7A 5DELA 1QHZA 3N4AA 2PEVA 4HPXA 2VEKA 4D71A 1OC5A 3AXHA 1AW5A 3EWUA 4D72A 3GDLA 3TC7A 2DUAA 4GLEA 2KZHA 1XICA 1E0VA 2ZX9A 2PZNA 1P1XA 2E1WA 2XU2A 3PAJA 2WNQA 2ZCGA 1QTWA 2NW0A 4CU8A 1ZJAA 1CENA 4PEEA 3LU2A 5U4NA 3WLTA 3N29A 3SCSA 2Y89A 4O53A 4WEVX 1XYCA 3BG9A 3IJQA 1FWCC 3KS6A 1GYMA 3BURA 2IQDA 2DVTA 3BVJA 3DG7A 3S3GA 4XBSA 3OZOA 5EMKA 4W4QA 4CD7A 1VFMA 4RUBA 5LIUX 3CWOX 1NELA 3WQGA 4YHEA 2ZZ1A 7ODCA 1RSCA 1Q6CA 3AWOA 2OYKA 4B5VA 1AG1O 2OZ3A 2CLLA 5FSDC 3I3DA 4OV4A 1FWNA 3CQHA 2OWWA 3ZOAA 2ACQA 4WXYA 2IKIA 4TTUA 3TXVA 3OIHA 4EIVA 3IGUA 4UTIA 3NYZA 3W2LA 2G41A 4L61A 2OLSA 4RLIA 1AJZA 2J8FA 1ELSA 1H1YA 2GYIA 3WK0A 4HPGA 3SRFA 3R25A 1VKFA 3AHZA 4M7TA 3V7PA 1H49A 3OYZA 5GNZA 5HMSA 4YXGA 3MP4A 4YN5A 2I5GA 5CBIA 1TV2A 1S2WA 2WSQA 1G9HA 3ZT5A 4JX5A 4LFYA 1KBLA 3EOSA 2ICSA 4F79A 1CXKA 3GDTA 4UTJA 1BLIA 1LYXA 3WBAA 3BAJA 3FAXA 3ZT6A 1L6SA 2WW5A 5I07A 1US3A 2HQAA 3KW3A 2POZA 1NOWA 4JQ3A 3KUMA 4W7VA 3IVUA 1UD8A 3WNOA 3FDKA 5D02A 1K9TA 2WPBA 1ZL1A 1BYBA 3SI9A 4PN2A 4ZOEA 4DYJA 5C9UA 2YL5A 4WKAA 3GY1A 3TYAA 1XQLA 3EGJA 4KWOA 2WKJA 1NDVA 5M03A 4O17A 1NY1A 3HG5A 1WKYA 1OZMA 2G95A 3GDBA 3KWXA 1A80A 5CJ5A 3UG4A 2GJPA 4LS0A 3EB4A 3P0WA 3DESA 3NXFA 3WD2A 2B4GA 5IOBA 2HISA 4Q32A 1KTNA 6REQA 3VNJA 2A3EA 5AOUA 1OCNA 4D9PA 4AVFA 2JALA 4N4QA 1YMYA 2Q3OA 4GC4A 3N2OA 1CLVA 4Q8TA 1KGUA 1H5YA 3K5XA 4ZQPA 1I60A 4PL1A 1RD5A 3CAWA 3I10A 1OBAA 5CZKA 4HZ8A 3NQ2A 3UEQA 2E9BA 2G0WA 3NQEA 3WLNA 1R2RA 4QAWA 4B9YA 1PJ9A 1VFTA 4Q6XA 2B81A 5T8GA 5E09A 2GGEA 1GHSA 3PF3A 4IIHA 4F2UA 4OU1A 4KWSA 2MANA 2EPNA 5JVLA 1QPQA 2D3NA 3DC0A 2A3HA 2VZTA 3TJ4A 4YYFA 3D3AA 3GTNA 1EX5A 2PURA 5ABEA 3APTA 4LS2A 1ECQA 3P82A 1VIWA 1W32A 5CZSA 3GNRA 3U8GA 3PZVA 3UG3A 3GR7A 1G4TA 4JHOA 1YIXA 1ZAJA 2VWSA 4W86A 2PLKA 1ME7A 3CZKA 5J5DA 1JCJA 1PKNA 1OC7A 2FHBA 5HQMA 1TWZA 3CUZA 3S47A 4O57A 4O8RA 1QR7A 2ZYFA 4HOWA 4AEFA 1JCMP 4NAEA 1UW9A 2AAMA 1C7TA 2Y4SA 3WLPA 3G1YA 1X98A 1X6NA 4CCDA 4R3UA 1SJDA 3O8AA 4IIEA 3NGJA 4LAZA 3PC0A 1TX2A 1OC6A 3QSTA 1K7XA 3RMJA 4HVXA 1X96A 2RJHA 3VGGA 4TX8A 2NLYA 1TV5A 2VR4A 2TODA 2REQB 1DYSA 3LPPA 1JI1A 1OCBA 3TNBA 4S3EA 3SY1A 5HQLA 2VGGA 3DN5A 3GWQA 4LUSB 2QUMA 4W8BA 4L9XA 1V02A 4PB4A 3KRZA 3CPUA 4RNFA 4CNNA 1UD5A 2BFGA 5EMYA 5CZ0A 1C8XA 1XLFA 1FWHC 3KAOA 3WDQA 1C9WA 4MZ8A 4LRSA 2ZX5A 4DJEA 4JFWA 4MWAC 3N13A 2G4FA 4GA8A 3HIJA 1J0ZA 3VD4A 4UR7A 2WJEA 4XG1A 4LUIA 2AKZA 2VD8A 3WYZA 4JYFA 3SCQA 2PI6A 4HA3A 4BR1A 2D0HA 4S2CA 3NL2A 5AN7A 4OJYA 3L2MA 2VENA 2JIWA 3VKBA 1VRDA 3L21A 4O28A 3W7OA 1CGWA 2GL5A 4GQGA 3VD3A 3MUAA 1OX4B 4B5WA 1H7XA 4LTSA 3FSTA 2AMXA 2UY2A 3S9ZA 5EBAA 3IIOA 3W1UA 1GGOA 3VNDA 3GNXA 4C7DA 3W76A 3GRIA 1I2NA 3UYCA 2QV4A 4J9JA 1X1OA 2W27A 3LENA 4R9XA 3V18A 1UD3A 2REQA 2CKRA 3E0FA 4ZSTA 1QNPA 4Z1BA 1EL3A 1E71M 3DHPA 3LEPA 4M24A 3UXAA 5CBBA 1OABA 3REQA 3EKLA 2VRJA 3PBMA 2CLEA 4QGCA 3TFXA 1PXGA 1XL9A 2NWRA 2ZUMA 1XIIA 3PZTA 3BUVA 3WUGA 1KRCC 4UUIA 1MRAA 3LQGA 2XGZA 3CZEA 4FR6A 2C13A 4DBSA 4AZ7A 2XSXA 1DP0A 2C71A 4DY1A 3D3FA 3DC8A 1AODA 4UOZA 5TD4A 1GORA 1KW1A 2QPUA 4MY9A 1D3HA 3FV9A 3LSBA 3WFAA 2Q09A 4Y90A 3M46A 2O9RA 2ALDA 3P5YA 4U2ZA 5FF4A 3TQKA 1RALA 1AQHA 2RDWA 2YA2A 4M80A 3ISIX 1TR9A 4KERA 4AG0A 3GXFA 4ZB5A 3IS4A 2WC3A 3OGSA 1PWLA 1RPXA 3ABSA 2G3NA 4U5KA 3W6MA 4HNTA 2PDUA 1QI4A 1EC7A 3E2RA 4WY0B 3DFNA 5I3IA 3NUKA 1Q13A 3ELFA 3WQPA 4C65A 1Z42A 2H6RA 2VX4A 1W54A 3V3WA 7TAAA 1P0BA 1L8PA 1H7PA 2ABBA 3PPFA 3HGJA 3I65A 5DEZA 3Q37A 2DZUA 4GBDA 2H3DA 4PUMA 3WF3A 4R7OA 4M8UA 1ENUA 4XK2A 3HA1A 3R1ZA 4JDYA 3P81A 3ITYA 4QE4A 1YW1A 2AAAA 3K4DA 1DWAM 2JFEX 5FEPA 3OVRA 4W5UA 5C9WA 3AU6A 5AHFA 4XX6A 2PWEA 4KQNA 4Q4RA 1QK0A 3DECA 2DVXA 5I06A 1FKXA 1IGSA 2BVTA 1EGZA 2VZSA 4JN8A 4E3TA 3SCWA 4GNJA 4AIEA 3EMQA 3JS3A 3NQBA 1RJQA 3W0KA 4LUTA 3CQIA 1FHUA 4DELA 3FDGA 2X1TA 1C29A 1X97A 1CXFA 4GXMA 4GCAA 1UWIA 1OK6A 1KCLA 1QBAA 3N6JA 1GEQA 4P7RA 2GGIA 3LRKA 1OX6A 3F2DA 4MWAB 1HKJA 1DIKA 3GK0A 3P62A 5D9OA 3K4AA 1UR3M 3UP8A 4GOAA 1ODUA 4QM1A 1I0DA 2YCJA 2VFHA 3U2ZA 2F2HA 3PTDA 2XFRA 2C19A 5FD0A 2VZUA 4JTEA 4WY0A 4B5NA 3NSXA 3R11A 4RV8A 3ZJ7A 4EX4A 4QJ1A 1EUNA 2QCLA 3W7GA 4CNTA 5FESA 2V68A 1NFPA 3L4UA 2W63A 5A6BA 3UU0A 2H9AB 4BI7A 1QWGA 4GI8A 2BZNA 1CTNA 3T8LA 1LP6A 3EB2A 1UB3A 3MZNA 1WDRA 3CM4A 1K7EA 4Y7EA 2OG9A 3M9YA 4G5DA 2YL6A 5A94A 1I0BA 2BGQA 4DB7A 1GQIA 5A6LA 1V3HA 3GNDA 4GVGA 3W27A 4KGLA 4H9ZA 3VXGA 2DT3A 3A3WA 4XKMA 3R4IA 1E9ZB 4XAPA 1BG4A 3CV7A 1VFHA 5G5IA 3AU2A 5E70A 4UTTC 1EBGA 3QKZA 1PSCA 5CLWA 1HKMA 4MWAA 3E38A 5LXXA 2PDBA 3DFQA 1K3UA 4XD5A 3FHAA 3URNA 3CQJA 4B3ZA 1LRQA 3RX2A 2J25A 1JYVA 2PS2A 2HE8A 4W9TA 3M1ZA 1DVJA 5DRIA 1QOXA 4MNMA 3W2MA 3IARA 3QC0A 3T8QA 4AUBA 3AXKA 1BSLA 1W3HA 3H4WA 1HQTA 1P5BA 3CV2A 3URQA 1Z32X 1IIHA 5D30A 1GPWA 4R7WA 5G4WA 1B54A 1UR8A 4KCTA 1V6VA 4M81A 4DWDA 1G94A 4E2BA 4LAKA 1ZCCA 1DJIA 3GG7A 3G8RA 4W88A 4LF2A 1TJ0A 3P8JA 4GBUA 3A4WA 4MFDA 4FPSA 1MDLA 4GNKB 4WQ6A 1P6WA 2QPSA 2VGBA 1FH7A 5A8OA 2D2HA 2HE5A 3ENLA 3QHOA 4UNKA 4YU1A 3WL0A 1EZWA 4Y8FA 3TVAA 1XBZA 2VFIA 5KZ6A 2C15A 4GVHA 2OCZA 2WJFA 3WJSA 1YDYA 2CC0A 4J28A 3D47A 3GFYA 1IR1A 3MTWA 4AWTA 1QOPA 4L5ZA 5FCZA 1RBLA 1JYXA 3S1GA 5HNNA 3W85A 3E0WA 1M03A 4ERGA 1R9ZA 4O16A 1XWYA 1TCMA 3AJ7A 1PHQA 2E6DA 4HN4A 1JUEA 2BY3A 4K39A 4I3GA 4JIQA 3LLDA 3QGKC 4JDBA 1EGMA 1PB0A 2VOTA 1VEPA 3A6OA 1HVXA 3V5CA 4RCXA 5BMXA 3VKAA 7PTDA 4HZ7A 4MNJA 2A6NA 2W6RA 2WSPA 3GW0A 1DE5A 1B4EA 1MEIA 5TBOA 4QJ4B 4ZVJA 1CCWB 1V93A 3TW9A 4OHQA 3AYVA 1QI2A 2GDQA 1EJRC 1R9YA 4FF7A 2HEJA 3WLQA 2HWGA 4MNKA 3N4FA 3LPGA 3EA1A 1XV8A 4QAIA 1WKDA 3H54A 5D2WA 1GT8A 2MNRA 4PMXA 4EXBA 3GM8A 3EMZA 1S5TA 1Y8BA 3B0YA 5DMYA 2VX7A 4O11A 1QUMA 1H5VA 2E28A 4FNSA 1IXQA 2DSWA 3GU9A 1E0WA 5CSYA 4ZO8A 1AA1B 1WKEA 3NQMA 2HV5A 5LXEA 1B5TA 4XZHA 1DTNA 1CB2A 5C8BB 1FDYA 1FUYA 1KV8A 2Z1WA 4M1RA 3DFHA 1VJSA 3I7SA 3HV9A 2DUXA 1A5MC 1DJNA 4GZJA 1QPRA 2PZ0A 3AI0A 3P8IA 5HMDA 5EMJA 1QWKA 2QDEA 4GXPA 5I23A 2C79A 3O1NA 4V1YA 2GOKA 2VX5A 2X42A 3PWIA 3WEOA 4YCPA 1E6NA 3ARPA 3MA8A 1XLAA 3H2OA 5BZAA 4QXIA 4A3RA 2GQ9A 3K4WA 3TZFA 4MG4A 1ONRA 1CW2A 2QUNA 4GABA 4HK7A 3VTRA 4BI5A 2E0PA 1CGYA 4DAFA 4FLOA 3C5QA 2PDXA 1WV2A 1JZ4A 3TC3A 2BV9A 2XYLA 3HG4A 1NVMA 2GVYA 4EF8A 5HNUA 1M7JA 4AZGA 3UA4A 1OF8A 2WAGA 1SR0A 3BH4A 4EPDC 3O6YX 3GXPA 3QSRA 3WBYA 3LCWA 3GVWA 4LU0A 3UWVA 5A95A 1ZS2A 2Y85A 1U33A 2QVHA 4K38A 4XISA 4N6FA 4CNSA 1CXIA 2Y5EA 3CUJA 1V77A 4B4FA 5HWNA 4F9JA 4NJIA 1D8WA 3G0XA 3LSCA 3DKJA 2ZE0A 5FJIA 5I09A 3PPCA 3TSDA 3HQPA 4E2OA 3HM7A 3UXLA 3GXDA 1XQKA 4FEZA 2TYSA 4TUFA 3UWYA 1UKPA 3SFKA 1A5OC 3WN6A 4DUXA 2CERA 3R13A 4IGMA 1ONXA 4UR9A 3UZZA 4DZ5A 1XG4A 2BB0A 8XIAA 3SSJA 3GHRA 1NOUA 4BZYA 1DPMA 3CT2A 5E0CA 3VCNA 4J3XA 4C6EA 1A5KC 3IVSA 2ZA3A 3JU2A 4MYXA 4KCUA 5E93A 3UFYA 2PU1A 3ZLFA 4DWSD 5CPMA 1HX0A 3COTA 3DG3A 1G1YA 1SSGA 2ZC8A 2X05A 3UETA 2XHYA 4H01A 4WKHA 2V5CA 2O7QA 4Y8EA 5DBTA 3ITLA 1XIJA 5EFDA 1R86A 2IPGA 2W3ZA 4HSOA 1DL3A 4ZTYA 3TOYA 2PLMA 1Q6LA 2EG8A 2XH4A 5AB3A 1GG1A 3IK4A 5MKGB 2ZBTA 3G1VA 4BI6A 1DIDA 3UT0A 3S5NA 1X7FA 1EGVA 2FVLA 2J8TA 2FLIA 1G7UA 1MXSA 1RXOB 3H2FA 3W02A 4U28A 3FLUA 4A3UA 4DRSA 5LYRA 4B5XA 1DXFA 2UY5A 5I2UA 3W1RA 2NX3A 5AYIA 1TO3A 3MDUA 2NXGA 2WM0A 5F2MA 3BSGA 1F8MA 4O4WA 3ZSSA 2L5HA 4XD3A 1WUFA 2QMKA 2ZICA 4XSMA 4YVVA 4HCHA 3OQEA 3RG6A 1P7TB 3MP5A 1S2AA 1XCFA 4O4VA 1JVNA 3N6HA 1V3MA 2QIWA 3HMJG 2D1ZA 3CH9A 5LNVA 3F4CA 4L9YA 3W7JA 4I8YA 1YNYA 4GACA 1M53A 3N2TA 2XZ7A 3GBEA 4DF1A 4QITA 1S2UA 1TV7A 4OTKA 1DXIA 3EXTA 3B06A 2JQXA 2PDHA 1F6KA 4N2YA 5BROA 3UXIA 4Q7IA 4HQVA 1R30A 1XBYA 2QF7A 2NVDA 3B05A 3F03K 2XVLA 4DZHA 4MVAA 2D0FA 4TV6A 2XM1A 4RXGA 2X1UA 1LDCA 1D3CA 2AL2B 1DWJM 2E9LA 3JR2A 2PRHA 3BAXA 1RD6A 1H1ZA 4ZODA 3L5MA 5CPLA 4X0NA 4JTRA 3QLDA 4B2DA 4TQTA 1XYLA 4HNOA 4E4FA 1W3IA 1E3XA 3STCA 3CL8A 1ZGDA 1B1YA 5FEWA 1NFGA 4UQCA 3VC5A 2VOMA 3CMFA 4Q8OA 1AZ2A 1UJPA 3VOJA 4LCRA 2WWCA 4NZ1A 1OY0A 3DYMA 3W7NA 2QNEA 5EU9A 3VGDA 4PMYA 4KBXA 4R7JA 3AQUA 1EH9A 1BTMA 3BZJA 5A8GA 2BOGX 1M65A 3LYEA 2WYSA 3ECQA 1RK6A 2BASA 4P7LA 4FB7A 3WQVA 3ZR4A 1O5KA 1RQBA 1LT7A 3DI1A 2W67A 2R14A 3OP2A 3EA2A 2ZXQA 1L2UA 5HXMA 4P7NA 1EP3A 1Y5WA 1GHRA 1LBFA 3RGTA 1KWGA 4LGXA 4POCA 4PRWA 4K36A 3XINA 2VC5A 1TWIA 3FXGA 3DENA 2V5JA 2BOFX 4FALA 2D2OA 3LNMA 4ORMA 3UXDA 2Y5SA 2OSWA 4WOQA 3IIPA 4JX4A 3NURA 2OWCA 3TWBA 2CZEA 1VYRA 4LQ1A 4A8IA 2EPHA 3KZSA 3UR8A 4WDWA 4Q8PA 2Z24A 1TVNA 1Z69A 4G1KA 1NOFA 1RJPA 2HS8A 1DJGA 1JJKA 1HW6A 1PEZA 2OSYA 4KKXA 4GHRA 1QW7A 3CMJA 3OIXA 4JCMA 4GUIA 2E68A 1W1VA 3TQ0A 3U7VA 4JTGA 1JI2A 3WQOA 3S4TA 4Z1AA 3W29A 5BU6A 5HJXA 1CX9A 4UFJA 4P8XA 2ZZ2A 2XN2A 1BQGA 1OFBA 2ATSA 1HL2A 4GIEA 4GKTA 4A21A 3W1TA 4NRRA 4N9EA 1U1UA 4KS0A 3LZ3A 4IMCA 3MCNA 1W1IE 2VP8A 3WZ0E 5A6JA 5K2ZA 1IWPA 3A22A 1KWKA 5HWMA 4S3BA 4JTKA 3S2NA 2E77A 1ITQA 2W0UA 1JF5A 4CVUA 1VBGA 2DW7A 4QS5A 3DFYA 3LTPA 4NASA 5M3WA 3RN6A 4NX5A 4QDWA 4YLWA 4AD1A 3PWGA 1B3OA 1EX1A 3UA3A 4GG9A 2JKPA 2XISA 2RDXA 1KFJA 1A5UA 3QKEA 3PG8A 4A8RA 4Z2LA 2ZXBA 1XYZA 1XUUA 3P3BA 4BQ3A 1P0EA 1B3WA 2O9TA 3W7KA 4JGDA 1H0IA 5IFPA 3BJFA 4MPKA 4E38A 4ZB2A 1UPPA 2VEPA 3CBWA 4UTMA 3R7MA 2Y7EA 3WQFA 3N73A 3PPHA 1W5OA 1Q66A 1K6AA 1VB9A 1JXJA 2AQWA 1Y5XA 2FMOA 1V3JA 3QPEA 2VFEA 4AFYA 1SW7A 2FMNA 4HPNA 2ZQ0A 1QATA 4FF5A 1KB3A 4E2VA 2BGNE 2WMKA 5C2CA 4PTNA 4ZXLA 2DZPA 1J0JA 1G4SA 1S38A 4YTTA 2WMIB 1TTQA 3AZRA 5KZDA 3MSYA 1N8WA 4XD4A 2DORA 3GZ3A 5H1WA 2YX0A 4JR5A 1PE1A 2OELA 4KRZA 2ZTJA 2PB1A 4C90A 4K7VA 3CL6A 3W70A 3M0ZA 3OEXA 4WD0A 1XS2A 3OODA 1GVEA 3T78A 1XLEA 4H9UA 3B4UA 4CKQA 3SADA 2YBVA 1OFOA 3PUGA 2BXZA 2V6AA 4KFPA 4H6KA 4ENLA 2XWDA 3NSMA 5C2XA 9RUBA 3S1VA 2H8ZA 4PBEA 4C91A 3KOWA 4PMOA 2INEA 4ORIA 4JTLA 1E56A 1XUZA 3CAQA 3RO8A 3LN3A 1R2TA 5ABHA 1UPMB 3VDCA 1QT1A 4KCVA 4EE9A 1UKQA 1JNDA 3TUUA 1JULA 3IJ9A 3WQWA 4PMUA 3B9DA 4L6HA 4Q8NA 2J7FA 4LYPA 1U5HA 1AQFA 3H53A 3AMCA 3PBWA 4IF2A 5HPOA 1PPIA 2GSJA 1E4MM 3N14A 2FPVA 2ZZ4A 1JPKA 3VD9A 5BRBA 4R33A 1Q2RA 2C14A 4E4UA 2GQ8A 2X7VA 4Z2IA 3RCYA 1UHVA 3N4EA 3EWWA 3EX1A 3DFOA 3MYPA 5EB8A 4JHZA 4Q6JA 2BODX 1WDPA 4ZE5A 4PSRA 3GG1A 4V28A 3FYYA 4A8LA 4XBJA 2JK2A 4O12A 4U5IA 1CGUA 1WX0A 3ABZA 2NQ9A 2F2KA 4MB5A 4H41A 3N18A 4OOZA 2OO6A 4OBRA 1YNPA 3PBVA 3KEHA 3KVKA 2OU4A 1SJBA 5CKSA 3IRDA 4L9ZA 1UWRA 1J6OA 2OOFA 1VYSX 3RHGA 2ZIDA 3USBA 2YLLA 5HR7A 2IKJA 4IFKA 5F7UA 3L0KA 3UWEA 4GYPA 3NZ1A 3OGRA 3T40A 1NDWA 4NZFA 3T6CA 3B40A 2VEGA 3SB0A 5BMWA 3BARA 3H2CA 4URIA 5GNXA 1AZ1A 1FFRA 4IFRA 1YDNA 3BGAA 4DJDC 5DFAA 3FEMA 4JXCA 3FKRA 1PYFA 2R24A 4CD6A 4UTHA 1JAKA 3TV8A 3ZZ1A 3A4AA 5HAOA 1T6MA 3GHTA 2FB3A 3KOXA 3HV8A 3UR5A 5D8ZA 2YCLB 1E70M 4FLQA 3TN3A 2E40A 4LJ3A 1KM1A 3C2VA 1AJ2A 2PTWA 4IHCA 3M0XA 4O1CA 4PTXA 5EBUA 3MVIA 4Q8MA 1GVFA 2W5FA 3RLHA 3G2GA 2W79A 1KFLA 3NWRA 4PODA 5BRQA 1FWTA 3B8SA 4X2PA 4HNNA 3NM1A 3SJ3A 2PUZA 5DANA 1XH1A 3HO8A 4ZQNA 1KLYA 2OKTA 1ZBCA 1ME8A 1RV8A 3B8UA 5F2GA 3LHZA 5AHMA 1VJIA 3W4RA 3QHMA 3N3TA 3TAOA 1T40A 5K4ZA 4U4MA 4L65A 1QNOA 3ZXWA 4L4OA 1JDFA 3W6YA 1OHLA 5TNVA 3PJWA 3PZGA 3HPXA 4XAYA 2EF9A 4UMCA 1GK8A 3IJ7A 4QR6A 1YDVA 2P0OA 1OCQA 1ONEA 4QEEA 4YTRA 1P0DA 2WLZA 1OJXA 3C56A 4L6DA 2R1MA 3TR9A 4FXJA 1S2TA 3M47A 2NQZA 2YJQA 3K8KA 4UC5A 3Q45A 1Q2SA 1SZGA 2PDFA 2UWFA 5H2ZA 1JCLA 5A2BA 5CC6A 4HU3A 4AMCA 4XUGA 4IG2B 2X1RA 7TIMA 2YCLA 3B9OA 1TZ9A 4KEVA 3LZ5A 1EIXA 1UIOA 1YPFA 1E1CB 3VPLA 3CLMA 5CPQA 2ZTKA 4ERIA 1RCQA 4L1XA 1GKPA 4N0RA 3VOFA 2CETA 1BWLA 1TA3A 1IEXA 1ZQ5A 1VPQA 2DU2A 4MPQA 2BWGA 5A8PA 4I5RA 3QHNA 2OKOA 2YZ5A 5BXTA 1B3YA 3IVTA 3H26A 3NG3A 1VFFA 3CWHA 1UD2A 2ESCA 4PZVA 1RHCA 3B03A 5CPOA 3MUIA 1W2VA 3S8HA 3WBXA 3KS5A 4AQLA 2PP0A 4FNRA 4H2CA 3T4CA 1CZ1A 1T7LA 2GJXB 4X9SA 1KRMA 1Q6FA 4J5NA 5CCZA 2WM1A 4XB3A 2JGYA 3N2BA 1JPIA 1XRVA 3J7HA 1OB0A 3ABQA 1DE6A 3FNDA 5CJMA 1RA0A 5HATA 4DYKA 4JYEA 5IHRA 1LCOA 3GZAA 1HIZA 1RVKA 1NFBA 3UZ5A 4AXKA 1Q5MA 1PYMA 1Z44A 1PCWA 3TTOA 3V4BA 3E2VA 3FW6A 3VYLA 2UZ9A 3JVAA 4JTSA 1XINA 5FIPA 3MUCA 4IG2A 2OZ0A 2ZDRA 2WNNA 3VKKA 4DPQA 4QQ3A 1YX1A 1OEPA 2QW5A 4NZ3A 3P84A 3DFPA 3PTMA 4GY1A 3EKGA 4CCCA 2Z0IA 3EEZA 2BP1A 3PK7A 3KFTA 4PUDA 1UR2A 4QQUA 5CC5A 2W4XA 4S1FA 4MWAD 2VVNA 4XZ9A 4WZHA 5B7YA 1OD8A 3AMDA 5L6UA 2AKMA 5CC3A 3SEPA 1L0PA 3EOLA 2Z25A 5AZ1A 2J13A 2YW3A 1JL8A 3CV6A 3O2LA 2C1IA 1UKSA 3MKCA 4UR8A 1R9XA 4ATLA 3R0DA 4ZR8A 4Q4QA 1NF7A 1HP4A 1CWYA 4DJFA 1XR2A 2ZVRA 1G67A 1KM6A 4UFMA 3RX3A 4RNJA 1IEWA 3F7JA 4MY8A 3WLOA 1V6YA 5JH2A 4HGXA 1XRSA 3DGBA 2EPMX 4L80A 4S39A 1Q7ZA 1TWSA 2ISWA 3WK3A 4OZOA 5LIKX 1NWTA 1P1MA 3DHFA 5C0QA 3PTQA 5FF2A 2GGGA 3DFTA 3KBMA 5TIMA 5G1MA 2FQIA 4NRSA 2IPWA 3BCJA 1KGWA 4REQA 1IYXA 1KM0A 3C2FA 3TYUA 3MPGA 2OTDA 3BLLA 2QCDA 5DO8A 3WF4A 3OBAA 3BOLA 3FKKA 5D2VA 2QMJA 3VKCA 3GVQA 1VLIA 3KHJA 4KEZA 4FO4A 1VBHA 5I00A 4W89A 1XLCA 4GMEA 2V2HA 3R8HA 2PWUA 3R0KA 4MYAA 4WK9A 4QP0A 2QUTA 4FIRA 3GE7A 2CWNA 2ZUVA 1V6TA 2E7FA 4GYFA 1FRBA 3HG3A 3IIXA 4LC6A 2WVTA 3M44A 3QPYA 5DCEA 3E2QA 4F9DA 3GDRA 3V36A 4AY1A 3MMWA 1XH0A 1MXDA 1VEMA 2Z27A 3DEQA 1V0KA 4IH3A 1QO5A 3OA3A 1AK5A 1XLLA 2JEQA 1T0OA 3ARZA 4RPPA 3STPA 1KFWA 2HXUA 3DH7A 4DUOA 5G2WA 3RRAA 3S9YA 4HNVA 2FFIA 4WY0F 2BVDA 4IL2A 1TUFA 2PLCA 4IGSA 3VC6A 1SZEA 2EHHA 2J7GA 1LLZA 1AJ0A 1A4MA 3A3XA 3E02A 3SSZA 2OGJA 3TU9A 4PCFA 4AF0B 2I14A 4XIMA 5C2GA 2WXDM 1LOQA 3LQLA 5BRPA 3B9AA 1L2QA 3M5XA 1M6JA 4Y2WA 4NNCA 3W72A 3M7WA 5A6TC 5HMEA 4JTQA 1O5RA 2X1SA 2J4GA 2FGZA 3QR0A 2C1GA 2QKFA 2AQOA 2DH2A 2UBPC 3L5AA 3D46A 3OW1A 1XLHA 1FCVA 1FOBA 4IMGA 5F1UA 2VCBA 2HDJA 3R94A 1X8FA 3L12A 2DZSA 3UD6A 1BRLA 3VINA 3M0VA 3VM7A 3P5ZA 4GGBA 4YTQA 4G56A 2Y2WA 1DEDA 3S1UA 3R43A 5HR6A 1JR1A 5J5RA 3VD7A 5I0DA 3LRLA 3UPBA 4LEQA 1EP1A 1PIFA 5JU6A 2GVGA 3VE9A 4LS1A 2Q8LA 1L8NA 4Q4PA 3EOUA 5A2AA 1SZNA 1YXDA 3B4YA 4D6GA 1VYPX 1E43A 1X8CA 2J9ZA 5BXRA 7A3HA 1O5QA 2WK2A 3BSMA 4MJ2A 3UJRA 5BWAA 1PDZA 1KQZA 1PZ2A 3N6QA 2PDQA 2V3GA 1S5NA 5FJRA 3UZWA 1TX0A 2OWXA 1RLCL 2R1LA 4W7WA 2A21A 1B3ZA 4PUUA 3UGRA 4AF0A 2QJMA 1I6NA 2VRKA 4TXEA 2J7DA 1R0MA 2I9EA 3ORWA 3KTSA 3NQAA 3R10A 4UTWA 1ZTVA 1V0MA 3U5UA 1FH8A 1G01A 3GO2A 2Y7DA 3FS2A 3ARXA 3A13A 4AYSA 5AC8A 1UBSA 2WC4A 3BLPX 3S2JA 2DGAA 4JTAA 1B30A 4AZCA 3MSGA 3AALA 2WB5A 2Y8UA 5K4XA 4BHYA 3GKAA 4MB4A 4GI6A 9CGTA 4K8GA 3KXQA 4ASTA 1ICSA 1UUOA 3W22A 2ACUA 4BK9A 4WSKA 4PB3A 1A5NC 5KEZA 2NT0A 1FP8A 1ZCOA 4B3KA 2VQTA 4UXDA 1K77A 1ISVA 1SZFA 4ZEPA 2QJJA 1GOXA 1IQ8A 1FWJC 4HK6A 1XD0A 3V5FA 3CC1A 3CUFA 2OQYA 3W1NA 4HSNA 1HT6A 3B9EA 3MUY1 2F6UA 4U3AA 1G69A 3KX6A 1H09A 2CZDA 3ATZA 2QQ6A 3MV01 1R3RA 3U5YA 4QCEA 4TV5A 1J4EA 2W9MA 1TPC1 1MQQA 1Q7MA 3HGSA 3L68A 4UNLA 4TU1A 2JEPA 5I3JA 1FWFC 4MKNA 5K9CA 1VJZA 3G24A 5E6ZA 2CLPA 3I3BA 4C6BA 3JZEA 1Y7VA 4UIOA 3AIQA 1K4GA 2FH6A 3NZRA 2QAPA 4ZGYA 4JFTA 4UQDA 1POKA 3BLIA 3QF0A 1O7AA 1PZ0A 3VGBA 5LNUA 1FY6A 2V69A 3TFCA 4L4LA 2XIBA 4J3WA 3VO0A 2WHLA 3CPRA 1ZFJA 3M4HA 1NH6A 5CGTA 2YR1A 3NVDA 1K70A 1R3WA 3SBFA 4HCDA 3PN8A 3MI2A 1XLBA 3LXAA 4ZMGA 3GG0A 1C8YA 1Q8JA 1TTJA 1EA9C 4RW5A 4BQ2A 1VBRA 3QLLA 2C18A 1FH9A 3SUSA 4XQ6A 3TE9A 3W84A 1EJXC 1PX4A 2XG9A 5DT7A 5HPCA 3TCEA 4WXZA 4YVXA 3UGVA 3S42A 1RA5A 3TWAA 3UVAA 3V0SA 2FDMA 2ZUSA 4UQAA 2XVPA 3OYXA 3NTYA 3N12A 3NDOA 1S3TC 1O1HA 4QLKA 1W5QA 5TQLA 3FJ4A 1ISXA 3CGTA 3WUEA 1C91A 1V7AA 2PD9A 5CAKA 4DBDA 3NNTA 3DYPA 4D1JA 3DGRA 2G3FA 2O0TA 4WHBA 3RITA 5PTDA 1VCFA 2G37A 4RZ5A 1YADA 2XH2A 5XINA 3EXRA 3NPVA 3UR2A 1UKOA 3VNYA 5IM51 4MMWA 2GVLA 4GE8A 2DIJA 3KCJA 2WZMA 4GZIA 3WH5A 3GC5A 4B2DD 2PDIA 4LV4A 1H41A 2J77A 1KM5A 1SO5A 4GK8A 1LBLA 1AH3A 1UOKA 4PRTA 1WUEA 4L6OA 3DAQA 3V5OA 2Q3RA 3UXKA 1H61A 2DIKA 1NF0A 3F1QA 3QV6A 4DWSC 4MFEA 1CXEA 2V5KA 2FB2A 4Y9AA 4Q8VA 4ML4A 2XM2A 4GQRA 1U30A 2VZOA 4ACZB 1EF3A 4ADSA 5E0KA 1U2YA 1DTUA 1OCJA 3TSMA 1QHPA 1BGGA 3OO2A 2NXIA 1TZZA 4FAMA 2Q8ZA 4ZQOA 2VM8A 1XM3A 3LI0A 3WBWA 2DT1A 3QVQA 2WC7A 1XSJA 3M6DA 3NEVA 1J8VA 1NARA 3IPWA 3A4JA 1QOQA 2YDRA 5I6SA 4UB9A 2PDPA 4S3KA 5ECVA 2VEIA 4UMAA 1R3SA 5EL1A 3UZJA 1H7RA 5HJYA 3KOZA 2H90A 3TYBA 4DLMA 3ZJ6A 3GLCA 4AHOA 2AMGA 4TVCA 4YCOA 3AIUA 4GIAA 3Q58A 4L56A 3EKZA 3PZOA 1DQWA 4PE8A 4TMBA 3KRUA 4AHQA 1GUVA 2RFGA 3HZ3A 4K8EA 3KWSA 2PWDA 2Z6JA 1C3FA 3TN4A 4Z1YA 1M7OA 1TJ2A 4EANA 3LD5A 3AMLA 2GJNA 3L0NA 2XN1A 1ODZA 1GOMA 3ITXA 2WV8A 5EYWA 2NQHA 4XKYB 1CBGA 5LGXA 3WK1A 4JQ1A 1PZ1A 4CU7A 3TSBA 3MC5A 1H7OA 3HF3A 4A4AA 4NAFB 3PULA 2YA0A 4FXSA 4JTUA 3W87A 4F3HA 3LBMA 3H7UA 3UPWA 2V9DA 1EXBA 1PIGA 1JPHA 4N02A 3OBEA 2V30A 2ZUTA 5TF0A 4JL1A 2RKXA 2V63A 3LHTA 3LLFA 5ABFB 1L6WA 1PX3A 3CMGA 4WGXA 2I5QA 3RJYA 2PC4A 4WX2A 5CSUA 1JIBA 1NQ6A 1KA9F 4JD4A 4EKJA 1WDDA 3KE0A 3QRHA 1LWIA 3QH2A 3CV1A 1J18A 3GTXA 1JUBA 3VIHA 2QS8A 1OYBA 1KLZA 2BTMA 4C6LA 4B9ZA 4EF9A 2EBNA