1V03A

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
487
structure length
487
Chain Sequence
b'IHRLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKGVEYYNKLIDLLLENGIEPYITIFHWDTPQALVEAYGGFLDERIIKDYTDFAKVCFEKFGKTVKNWLTFNDPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DHURRINASE
publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor milo
molecule tags Hydrolase
total genus 188
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v03A00
1SMAA 4M81A 2OSXA 2VTFA 1KCKA 4PBGA 2WHJA 3CLWA 3WDIA 4BQ3A 1UKQA 1JGIA 2BS9A 2CBJA 1XSKA 5FL1A 1QNPA 4B3LA 2OWWA 4W84A 1XD1A 2WCAA 3QHOA 5CSUA 1JZ5A 3ALFA 3AJ7A 3M7SA 1OM0A 2G4FA 4WSJA 3WH7A 4MB1A 1SR0A 2W62A 2YL8A 1NQ6A 5I3DA 1L8NA 3UG3A 1CGYA 4D6HA 1A3HA 2OSYA 4TXEA 4P7LA 3ZOAA 4DM2A 3TTYA 4AEFA 5D9OA 1I75A 1Y7VA 2WSPA 3EBVA 4H8HA 1KXHA 2WAGA 1UWQA 2IXVA 2XVNA 2NT1A 4WIWA 4KWUA 3VD3A 4FK9A 3SCQA 4GI6A 2C7FA 2BHYA 3CMJA 3CZEA 3WH9A 1W32A 1EA9C 3BSGA 1DWGM 1E6SM 2O9RA 4PMRA 3CGTA 1R7OA 3VUPA 2YA0A 1AVAA 2WXDM 5DO8A 1C8XA 4WJXA 5A2CA 4ZEPA 2XHYA 1E43A 4MB5A 2WLZA 2GVYA 2WZEA 1E4IA 4GQQA 1US2A 2J79A 4U3CA 3RILA 1W9DM 4WKAA 4YHGA 2Y8KA 3GTNA 3WIJA 3OLGA 2J77A 3O2LA 4TX8A 1E71M 1GHRA 3SCTA 1FFQA 4JFVA 5HBFA 2EEXA 4UFLA 4W5ZA 3VIHA 2A3CA 1X6LA 3MSGA 5BWFA 1FP8A 1RH9A 2DT2A 1JNDA 3AS3A 4Z2KA 4D6EA 2PWHA 4HA1A 5ECUA 1LLOA 4GINA 2WW5A 3N11A 3A3HA 1ZBVA 5CGMA 1QHZA 2WKGA 3A4AA 3AMGA 3VIOA 4ZE4A 1MW3A 4D6JA 3WDQA 2UY5A 5GPRA 2XUCA 1ISXA 4CU6A 3L4UA 1FP9A 3VKKA 2WM0A 1E56A 3VGGA 3F5KA 4X9YA 2WMGA 4MB3A 4D6GA 1J0ZA 1OT1A 5C71A 2Z1KA 1U33A 4UQBA 3K8LA 5ABGA 5A2BA 4HOXA 4UTFA 3NJ3A 2BVYA 2QMKA 5JBFA 1JYXA 2D2OA 2FGLA 2J4GA 3OGSA 2WSKA 1VIWA 1BPLB 2ZXBA 4P8WA 2VZVA 2CHNA 3AMCA 9CGTA 1WAWA 2NSXA 1WKYA 3ZO9A 4EKJA 2QLYA 3K8MA 4P7NA 3LPFA 2D0FA 3AS2A 2DDXA 4AD4A 4C7GA 3VDBA 2DT0A 1ZBKA 1UD2A 1E5JA 5A6SA 4CN6A 3CH9A 1MW1A 3IANA 1AQHA 1W3JA 1FH8A 1H0GA 1LWHA 3CTTA 3RPMA 2JF7A 3FY1A 3HU7A 1G9HA 2WHMA 4AZBA 3DYPA 2TAAA 3CZ8A 3O9NA 3MMWA 3B9EA 2XVKA 4D6CA 2D23A 4HZ7A 1EXPA 2FH8A 2DIEA 2G8ZA 1GQLA 3EMZA 1S46A 4V27A 1QHPA 2CERA 1QHOA 3EMQA 2QHAA 4FLOA 4W88A 2CETA 2OYMA 1R87A 4J3TA 5E6YA 3O6AA 3DYMA 1HJXA 4B9ZA 4U2YA 2XSAA 3AIVA 1PZ2A 4CGTA 3GNRA 4J3SA 1KXTA 2GJXA 1V02A 2ZICA 2WB5A 1XSIA 1BQCA 4GZIA 4KRUA 4P8VA 2PWEA 3LPOA 4P8XA 3ARUA 1LL7A 4NSBA 4OJYA 1VB9A 3PTQA 4OUEA 4MADA 5EBAA 4YPJA 5CPSA 2XGBA 1BG9A 1EO5A 2VZTA 2CIPA 2WLYA 4JFUA 3AMDA 4A3HA 4E4PA 4MAVA 1C91A 3WDPP 4W8AA 1ITCA 5JBEA 1EGZA 2DPEA 1OGSA 1XV8A 3W26A 3TTSA 1Q6FA 2WCGA 4TVUA 3SURA 4LGXA 1H3GA 3VX0A 1PX3A 1JXKA 3AIBA 3QOKA 1PBGA 1E6XM 5E6ZA 2E8YA 5GNZA 3AHXA 3L4VA 4PMNA 3PZIA 1BVZA 1NP0A 4HOZA 2G3JA 3HN3A 3WNOA 2YDRA 3NIYA 4P7RA 2FHFA 5LA1A 2EPLX 3AZSA 3VNZA 4AIOA 1NWTA 2ZUMA 3VGEA 7A3HA 3I3EA 5HNNA 5DT5A 1TA3A 2PWGA 1QNQA 1GQJA 2BV9A 4AD0A 2DGAA 1B9ZA 1WPCA 3ZJ7A 2PBGA 4JFWA 1CXFA 3BMWA 2VT0A 2DEPA 1XYZA 3GZAA 2CPUA 5M17A 1JL8A 4C7DA 5IFTA 1HT6A 2NW0A 4PMZA 3ARYA 3BGAA 1WZAA 5A69A 3WD2A 3MKKA 1CXLA 4PUDA 5CZKA 2Y24A 3QGVA 4RL3A 1W3LA 1J11A 1XSJA 4JHZA 4W89A 3L4TA 4QLLA 4CD7A 1AMYA 4UOJA 7TAAA 3CZKA 3WUFA 2J7GA 1B0IA 4BCEA 5A8OA 5FKYA 2WBGA 2VRKA 3SCVA 1NP2A 1Q6GA 4AYSA 4PN2A 3PHAA 4L4PA 1XRVA 4ZE5A 1HL9A 1QW8A 1R85A 4RE4A 3WNLA 4QDMA 5FD0A 4NF7A 5LA2A 4HU0A 1E55A 1VEPA 1YQ2A 1K9FA 1EQPA 1UA3A 2QPUA 1KR0A 1XCWA 2WKLA 1K9TA 1C8YA 1UOKA 5I78A 4FLQA 1HKKA 2PWDA 4MDPA 1KBBA 1CECA 1E70M 1N82A 3IAQA 2XWDA 4W7WA 3ZIZA 3AHYA 5LA0A 2XJ7A 2IXUA 3VIPA 5LYRA 1VAHA 3VPLA 2E40A 2AMGA 5A6MA 1H11A 1P6WA 3GXFA 3EDFA 1GVYA 1GOKA 1PPIA 4U33A 1Q4NX 1DWHM 1KQYA 1ODUA 3KL0A 1JXJA 1G01A 1GOMA 1QNOA 1NM9A 2WMHA 4PMUA 2YDSA 3MSDA 4UQAA 3WENA 1JAKA 4D6DA 2BY0A 4CKQA 3MANA 3NUKA 1VRXA 3AZTA 5BXSA 1QNRA 3TA9A 1V3JA 3VD4A 3N9KA 5D8WA 1EQCA 4V2XA 1UR9A 2WYSA 5CLWA 1ISWA 2GK1A 8CGTA 4Z2JA 1UD5A 4PTWA 4J3WA 1OWQA 3VIFA 3WH8A 1KR1A 1WZKA 3UETA 1JF5A 3CHDA 4YHEA 3W28A 1SFSA 1HJVA 1U2YA 2GSJA 3WKZA 4MNKA 4S3KA 3WF3A 4CD6A 2BY2A 1BAGA 3BAKA 4XUYA 3IJ8A 1M01A 1ZL1A 4JL1A 4OZOA 1KQZA 3RJYA 2CKRA 1UD6A 4U5KA 1G94A 3PZGA 3VIIA 4D6IA 4F66A 1GOQA 3ARXA 1UR0A 1EOKA 4XZBA 2Y5EA 1QOXA 3OLIA 3T0AA 3PZUA 4V28A 3BLKA 2QPSA 3CHEA 3S2CA 2YLLA 1W91A 1HJSA 5I23A 1CTNA 2EO7A 1J9YA 1UR2A 2CCRA 4AW7A 2BY3A 4AMCA 3AIQA 1DWAM 5TD4A 5GNXA 4J27A 4MNJA 3GYCA 5M5DA 2CXGA 1UD3A 1KFWA 5JUVA 2UWFA 3MUY1 3SUSA 5JIPA 2PF0A 1MVYA 3VIKA 1C93A 1OD0A 3CMGA 1W1PA 1DWJM 3NSXA 3W27A 1HX0A 3VVGA 5CLTA 1OIFA 4MDOA 1DWIM 3WQVA 5A95A 4PMVA 1V0KA 2VNCA 2YA1A 1LG1A 1JYNA 1V6UA 1XYFA 4JCLA 1HJWA 1AQMA 1JFXA 4HTYA 2RGMA 3W4RA 1UH3A 5IHSA 4U31A 2VL4A 1OD8A 1KGXA 1PX8A 3WF0A 2VCAA 4AISA 4QLJA 1E4MM 5BXPA 3WFZA 1KB3A 2XVPA 1BHGA 1H0IA 4GI9A 4Q22A 3VMNA 3TOPA 3T0BA 2D3LA 1LJYA 2V3FA 3PZNA 5CJ5A 2J7EA 2CBUA 1HKMA 2WVUA 5A8MA 1V02E 1IV8A 1UYQA 3WL1A 2BNJA 3ZR5A 4BQ4A 1OINA 4TTGA 2F2HA 1R8LA 3AYSA 3B9DA 4GPNA 5ABFB 3I3BA 3T2PA 4AZCB 1W1YA 4N42A 3CZJA 3KWXA 1E1EA 2WMJA 1Q6DA 1MQPA 3W29A 4P7OA 3AOFA 1PZ3A 6A3HA 5FL0A 3GXIA 1BTCA 2W61A 2UY4A 3SCNA 4LYPA 2D0HA 1OSEA 4E2OA 1CYGA 2EJ1A 3LPGA 5A8QA 1H41A 4ACZB 2ZXQA 3SCRA 1M53A 2XFRA 3ZT7A 1TUXA 1W9VA 3ARWA 1ISZA 1W9BM 1NWUA 2DT3A 4FLRA 1BF2A 1HVXA 2VZSA 4PMOA 4FF5A 5BYWA 1VFUA 3UR7A 4LQ1A 3MV01 2J7HA 5A8PA 1OB0A 4H8VA 5CSYA 3SCWA 3W25A 4OIFA 3AMKA 1B3ZA 2W91A 4S3JA 2HISA 2QV4A 1G0CA 2QF8A 3T2QA 2CKSA 2XYLA 2ZUSA 1CEOA 1W2VA 3NSNA 1V0MA 1HNYA 4KMQA 3W24A 4JKLA 1UZ4A 1MFVA 3L4XA 4WK9A 2JEPA 1E73M 2J78A 1QW9A 3FW6A 1RD6A 4PCSA 2WMIA 1H09A 1MWOA 4J3XA 5HXMA 5I77A 1ISVA 2ZIDA 3MV11 4OOZA 5HPCA 2FDMA 2CYGA 2YBUA 2E3ZA 3AZRA 1C7SA 1VJZA 4AXNA 4P7QA 3T09A 1ECEA 2OWCA 3VIGA 1H2JA 3GBEA 2BVDA 2WHKA 5CPTA 2XSBA 4W7VA 2J7DA 1OIMA 3POHA 2YIHA 1O6IA 4AIUA 1C90A 3SIMA 6CGTA 1E40A 2DSZA 3T08A 1NH6A 5E09A 1FH9A 4H04A 2WBKA 5EFFA 1ZJAA 2VQTA 2V5DA 3UERA 1JYVA 3SUWA 4F79A 2YJQA 1MXGA 3VGDA 4QFUA 5EFDA 4Z2HA 3A6OA 3FXYA 3G6LA 1TCMA 1VEMA 3KEHA 1J0HA 1HIZA 1JNEA 1UG6A 3AIRA 1MQQA 3AS1A 4A4AA 3L4YA 3PZOA 3QHNA 3OB8A 2XG9A 4W86A 1WO2A 1CXEA 3WQ5A 1V03A 3PZVA 1NOUA 3WUBA 1V6WA 3DYOA 4Z2GA 4M8UA 3K4AA 3VGFA 2J47A 2FGZA 5EB8A 4W7UA 4B16A 1LL4A 2DH3A 3FHQA 4ATDA 4TUFA 2VOTA 1M03A 4HU8A 4PMXA 4E8DA 2XTKA 5AC5A 4PRWA 2CEQA 1W2PA 1CLXA 2X0YA 3AYRA 3CBWA 1FH7A 4UNIA 1TE1A 1UR1A 2XVGA 1VFFA 4J7RA 1UD8A 5HPOA 4GQRA 4MJ2A 2W4XA 1JIBA 3WY1A 4HZ8A 4PMYA 2A3AA 1HJQA 1KBKA 2YDQA 4PSRA 1J0JA 1HL8A 4AZHA 2EPKX 3SUVA 4PUEA 1UQZA 4URIA 3RMEA 1ODZA 1TMQA 1FA2A 1JD9A 1WDPA 2RGLA 3IJ7A 1XCXA 5EMYA 1CXKA 1KGWA 2DQXA 2WMKA 5E0CA 4UOQA 4DWSC 2J75A 3ZSSA 4D1IA 3U57A 4EK7A 4AC1X 2PC8A 4GIAA 1JZ8A 1J12A 1LQ0A 1BGGA 4PCTA 3WN6A 4H8UA 4WKHA 3VDHA 2EPOA 1TR1A 5E70A 1O7AA 3TTQA 2OYLA 3G6MA 3L2MA 2WWCA 3CUFA 1UR4A 2ZUTA 2F8QA 4AD5A 2WVVB 1ZJBA 1BYCA 3D5HA 2V3GA 3GM8A 1LF1A 1J0IA 4LYRA 3UG5A 1E6NA 1J01A 2BY1A 4KGJA 5E0FA 3OZPA 4F9DA 5JIWA 3WFLA 3QR3A 1CPUA 1BYDA 1HKJA 2E9BA 3GH5A 5D8ZA 2GUYA 3WNMA 4BQ2A 4HA4A 3UESA 2YL5A 3PTMA 2XIIA 5IDIA 5A2AA 4DWSB 4GZJA 3ZJKA 1QI2A 1W1VA 2W67A 4CU8A 4OBRA 1CGXA 5JBDA 4JHOA 1B3VA 1EDQA 3U7VA 3AXHA 4JL2A 2YL9A 3B9AA 2ZXDA 1M7XA 1V3MA 3ARQA 3F5LA 4H7VA 2OSWA 1UWTA 2FHCA 3KZSA 3CZGA 1EOMA 1VF8A 1H1NA 3VGHA 1GOOA 1BVNP 4UQDA 3RDKA 2EPNA 4HMCA 2VJXA 4PSPA 4CVUA 4ZXOA 1C92A 8A3HA 1WP6A 2J8GA 3JUGA 1EHNA 1IT0A 1EIBA 5A3HA 1CGTA 4J3VA 2WANA 4FMVA 3QOMA 3OGVA 1QVBA 2EBNA 5ABEA 3MMDA 1LWJA 5C8BB 1V3IA 2D20A 3KL5A 3WDJA 2XGIA 2VZOA 3W53A 1UWSA 1TZ7A 4PMDA 1BYAA 1IZJA 1R7AA 1CLVA 1JD7A 2ZX8A 2EPMX 3NYDA 3L4WA 1MW2A 1JG9A 3B8SA 1UHVA 4UZSA 2JALA 3VIJA 4L4OA 1X6NA 2FH6A 4WKFA 3CUJA 5BROA 4BZYA 5ABHA 4CUCA 1BG4A 4IPNB 3FAXA 2NT0A 2V38A 3N17A 4D1JA 3PZMA 4UZUA 3WQ8A 2WC4A 5AYBA 3GH7A 1JAEA 3N18A 3OGRA 1D2KA 3CHFA 2G3IA 1HXJA 3HMCA 5AC4A 4MJ4A 3D3AA 3MUZ1 4AZ6A 2CBIA 5DFAA 1C8QA 4NRSA 3VMPA 1GJUA 1AQ0A 3PN8A 4AIEA 1XH2A 2OWXA 3I3DA 1UWUA 4K68A 2GJXB 3NDYA 4TOQA 3SCUA 2YBTA 4Q7NA 1E6QM 2MANA 2VC9A 4WLCA 3AXXA 5DEZA 3SCSA 1E3ZA 4IPLA 5A6AA 3A47A 4UFMA 4GO9A 2X05A 1PIFA 2O9TA 3WMBA 1PAMA 5BRQA 3BH4A 3THDA 4UQCA 3VU2A 3OIHA 1D3CA 1Q6EA 1J0KA 1B3XA 1CXIA 3AHZA 4JKKA 2XWEA 3AFBA 1GCYA 1NOFA 1GUVA 2V3DA 3OA5A 5A6BD 1OGBA 3WSUA 1UKOA 2EQDA 3WNKA 4JZ5A 4IISA 1CGUA 1GOIA 3E1F1 3AROA 3ARRA 4U3AA 2O9PA 1H5VA 4JKMA 3VOCA 1UZ1A 1M04A 2ZE0A 3K8KA 4HPGA 1VBUA 4HPHA 1J0YA 1TVNA 2ZUWA 1JFHA 3MUAA 4AD3A 3EDDA 1V6XA 4R5EA 1CBGA 1JDAA 1XHGA 4ZENA 4PTVA 1E72M 2X2YA 5C70A 1GPFA 1B90A 4D71A 3WEOA 1CXHA 4W8LA 4BS0A 2E8ZA 1TA3B 1HJUA 4NRRA 1NOWA 3AXIA 3UCQA 3K4DA 2PB1A 4HMDA 2WNWA 4CCDA 1UKTA 5BXRA 4UFJA 2JIWA 5KEZA 3RM4A 3WQ4A 5GNYA 2XIBA 1UKPA 5CG0A 1E5NA 3MS8A 1GQIA 2JF6A 2C8NA 3WUGA 1MQRA 1CIUA 3ARPA 3WBEA 3CZLA 3L2LA 1G5AA 1RP9A 2CESA 1FOBA 4CVWA 2E0PA 5CPQA 4LYQA 5BRPA 2ZUUA 3ZJ6A 4TVCA 3WQWA 4EE9A 4JFTA 1C7TA 1HF6A 4FLSA 1CNVA 4B3KA 2XPKA 4GO8A 2BHZA 3GXDA 2ESCA 2V3EA 4XZWA 2PBOA 2DSUA 2BXYA 4AZ5A 4UCFA 2WVSA 1CENA 3CUGA 3ARTA 4MAZA 2X1IA 3T0DA 4F8XA 2UY2A 1K9EA 4DUWA 2W5FA 1H49A 2VX6A 4QCEA 1VEOA 4HA3A 3DC0A 3ALGA 1FHDA 3UR8A 1BLIA 2JE8A 3WEMA 3VGBA 1DWFM 3W0KA 4AY1A 1PEZA 3BAXA 4DWSD 2YLAA 1E4LA 1JDCA 1QBBA 1QI5A 2VCCA 5I6SA 3VD9A 3EMCA 1F4AA 3VDAA 3HJEA 3EYPA 3MU7A 4PTXA 4CD4A 3PZ9A 4HP5A 1E1FA 5I24A 2YKKA 3CUHA 3VILA 7CGTA 2W92A 3S6TA 4D6FA 2CITA 4N0RA 3WELA 3IJ9A 3WH6A 3WQ6A 1ZU8A 1HP4A 3VDCA 4BF7A 5HOSA 4YN5A 1JYWA 3A4WA 1PX4A 1E6PA 1W1TA 2CNCA 2BVTA 1JI1A 3WDHA 1FHLA 2A3BA 3UG4A 4UR9A 4CN4A 2CHOA 2VCBA 3M46A 1GONA 2DSWA 3W37A 4CCEA 2WVTA 1F4HA 3VX1A 3VNYA 4M29A 2GK1B 3AS0A 1RPKA 1A47A 5D4YA 3WUEA 2GJRA 3APGA 3QHMA 1B30A 1GJWA 3GXMA 4PTMA 3K46A 4IUGA 4A3YA 2JEQA 3ZM8A 1JI2A 2ZX7A 1KXVA 1D7FA 3BAIA 4M56A 4PMQA 2WVVA 2GJPA 4MNLA 2D0GA 3ZMRA 3FNDA 5M3WA 3BCFA 1MYRA 1H4PA 1XC6A 5D9MA 5A6JA 2ZOXA 1V08A 2Y8VA 3W6MA 4AWEA 3SUUA 1HN1A 2D22A 3N1AA 4H41A 3N12A 1JDDA 1GZJA 4X0NA 4DWSA 3BAJA 1CGWA 2WHLA 3DHUA 4AZGA 2DIJA 1GNXA 2J25A 4B15A 2E9LA 3WMCA 3AHVA 4UOZA 1BGAA 3PZTA 1KWGA 1E0VA 2W63A 1W9PA 1V6VA 2GFTA 4LX4A 4PYSA 5A1AA 1Z32X 4RE3A 3RIKA 3PBGA 3KL3A 3MO4A 1WE5A 2VVSA 3CIVA 1GHSA 3IK2A 4QP0A 4M24A 4MB4A 4GXPA 1E0XA 4Y7EA 4DUVA 3GNPA 2X09A 3N04A 5I79A 4BA0A 2XFFA 4Z2LA 4JCMA 4PEEA 3NDZA 4CN1A 1X1NA 2PWFA 1ZS2A 2G3MA 5IHRA 2FHBA 3WD1A 2VMFA 4P8UA 4WSKA 3W38A 2C0HA 2WMFA 4ATWA 4NI3A 1HKIA 5DT7A 3FAWA 3VMOA 1FFRA 4C7FA 5A94A 1V3HA 1JF6A 3SCOA 5BCAA 1QI4A 1WZLA 3TONA 1IZKA 4XX6A 4NZCA 4ZFMA 3PTKA 1DTUA 1CWYA 1CDGA 3BCDA 4GI8A 4KH2A 2A3HA 4HOWA 3GH4A 4MNMA 1UD4A 2Z1SA 3WDRA 3AISA 4DM1A 4F9JA 3BMVA 1E3XA 1WDSA 2V5CA 1W3KA 3VTRA 1LL6A 1JZ7A 1NWRA 3WH5A 4TVDA 3MUIA 3AIUA 1DP0A 5DF0A 5I0DA 1V0LA 1VFOA 1QNSA 1E9LA 5FCZA 3VD7A 1QI0A 4E8CA 1VFMA 3BC9A 3NSMA 1Q6CA 1WCGA 3LMYA 3ZT6A 4ACYA 4CD8A 3DECA 1UQYA 5IFPA 1G1YA 1ESWA 3WNPA 5AY7A 1GQKA 4AZ7A 1OBAA 4ML4A 4D72A 1B3YA 1B31A 2VI0A 2UY3A 3AHTA 2WCSA 1BSIA 4W87A 1VBRA 2WC3A 3RO8A 3T2OA 2OLHA 4MTVA 1NWSA 5D9NA 2YL6A 3BXWA 1E15A 1K9DA 3AMLA 1JZ4A 2VQUA 1JZ3A 2JIEA 1W9XA 1B3WA 3EDJA 3TTOA 2VRJA 1XGZA 3ZJ8A 4Z2IA 4AD1A 4KGLA 1SMDA 2VX7A 1JZ2A 1UR8A 1OT2A 5IXEA 3J7HA 2GDUA 1GVIA 3VD5A 5BXTA 2J8FA 4AD2A 4UFKA 2WMIB 5D9PA 4CD5A 3IAPA 3FHAA 3VM5A 5A8NA 4JIEA 3ZSTA 1KXQA 2F61A 3NCOA 3GBDA 1QPKA 5FIPA 2WC7A 3EDEA 1ISYA 2O9OA 2J7FA 2OYKA 2DSKA 1DEDA 1MXDA 1UWRA 2D1ZA 3BAWA 3FN9A 1OCQA 4EAMA 3OZOA 6TAAA 1EO7A 4J28A 1V6YA 4M1RA 3U5UA 1MFUA 4WF7A 3KE0A 4QLKA 3WF2A 4HMEA 2QMJA 2PI6A 2Y4SA 2DSVA 1GORA 4QCFA 4MPKA 3M6DA 2DT1A 2J7BA 1K6AA 4U2ZA 2BFGA 2WWDA 3OG2A 3WD4A 3CO4A 3WF1A 5E9AA 3W81A 5GQBA 1U30A 1ITXA 3SEPA 2J62A 2CBVA 1MW0A 4OKDA 3II1A 1I1WA 2VZUA 1QBAA 3W6LA 5F7UA 3K1DA 3VO0A 1E6RA 3TP4A 1J10A 5CXPA 4X0VA 1E4NA 4OBSA 1SYTA 1W9UA 2G41A 4JAWA 3VM7A 1BYBA 1DHKA 1PIGA 3CHCA 1QI3A 3F4VA 4GZEA 3VIMA 5AYIA 1CGVA 5CGTA 2ZX6A 1C3FA 3M07A 1I1XA 5ABFA 2BHUA 5I5RA 1WDRA 3U5YA 4AZCA 3ZT5A 4ATLA 1R86A 2BXZA 4M82A 2ZUVA 3RJXA 5DMYA 1HVQA 4OOUA 1V3KA 3WBAA 4IM4A 1ZBWA 1V0NA 2VR5A 3ARSA 1GW1A 2J74A 2Q8XA 1WNOA 1UH4A 4J3UA 2Y2WA 3AI0A 2VO5A 2XVLA 2VURA 2AAAA 4UQ9A 4TX6A 2AOSA 2YA2A 3AIWA 3BAYA 4HZ6A 4UFIA 4ACZA 3CPUA 1ZBCA 1TFVA 3ARVA 2W66A 4DUXA 1WZMA 1OGGA 1UUQA 3BLPX 2IUZA 3ECQA 4XV0A 3AQUA 2ZWYA 1US3A 3CUIA 1E0WA 5HDRA 1J18A 4LPCA 1KGUA 1HP5A 2VR4A 1EDGA 1ZB5A 3WF4A 3F5JA 2XFYA 1XH0A 1UH2A 2D24A 3GNOA 3SUTA 4CCCA 4JFSA 1VJSA 1UKSA 2J7CA 5I2UA 3WEZA 1JZ6A 1PJ9A 3PZQA 1W3HA 4M80A 4UQEA 1EDTA 3DHPA 3THCA 2X8RA 2WK2A 3WL0A 3RM8A 2ZXAA 2VX4A 4R27A 4BQ5A 5A6LA 2E9MA 2ZWZA 3GDBA 4UFHA 4W8BA 3MMUA 1WB0A 2WZIA 3ZQ9A 1B2YA 3ZR6A 3N15A 4AEEA 1EHAA 3LPPA 2D3NA 1GOWA 1BFNA 3EDKA 2VVNA 4TTUA 2O92A 4W5UA 2WZHA 3OLDA 4AZIA 4W93A 2B31A 3AIEA 2G3NA 1L0PA 1VENA 2EXOA 5A6KA 3SCPA 1TG7A 1NARA 1EH9A 2VRQA 2VX5A 5M03A 3N13A 3POCA 3U7BA 3OBAA 3WNNA 2XM2A 2ZX5A 3A4XA 3RCNA 1E6ZA 1UWIA 3ARZA 3BSHA 3WD0A 1YHTA 2JFEX 3WD3A 1UA7A 4EANA 2ZUNA 5CQ1A 1TVPA 2HVMA 4XB3A 4KRTA 2E4TA 4H2CA 3UEQA 3OLEA 4U5IA 3WMSA 2WPGA 4QAWA 3RM9A 4GKLA 1WDQA 1XD0A 5FOOA 3L4ZA 1KCLA 4LXFA 2A3EA 4RE2A 2X0HA 1XH1A 1B1YA 1CZ1A 2XM1A 2YOCA 5A6BA 5KZ6A 3W82A 4W85A 2VUYA 1RP8A 2ZX9A 1V3LA 3AICA 4B9YA 4ZXLA 2DH2A 1LG2A 4CU7A 3VINA 2GDVA 1KWKA
chains in the Genus database with same CATH superfamily
4JY8A 5AYZA 1KCKA 3QV8A 5J5RA 2WHJA 3CLWA 4BQ3A 1UKQA 1JGIA 3PUOA 4MWAE 5CJNA 1W8GA 1ONWA 2RJHA 3JZEA 1XD1A 5AHFA 4QTGA 4Q8PA 3QHOA 2PD5A 3PVFA 3UQNA 4XAPA 1LRNA 3UYIA 1PYFA 1AW1A 1NQ6A 5I3DA 2WOQA 3UG3A 2PRLA 1F3EA 4TMBA 1A3HA 3F4WA 4P7LA 3ZOAA 2CHRA 3DX5A 1UC5A 2FIQA 2WSPA 3PY2A 4H8HA 1KXHA 1UWQA 3DKJA 1OX5A 4E5TA 3SCQA 3U2ZA 4Z1AA 1LCOA 3ZWTA 4GG9A 1RK5A 3REQB 1EA9C 1DWGM 1E6SM 2O9RA 4NZ5A 1R7OA 3G8RA 5G1MA 4REQA 5I06A 5DO8A 4ICNA 4ZOEA 3SZ8A 2J79A 4LAZA 1MZRA 4WKAA 1RBAA 4YHGA 1T40A 2J77A 1ECQA 5FF2A 4TX8A 1E71M 3M5YA 1FFQA 4JICA 4LAOA 3WLNA 3LGGA 4DJEC 5DCEA 2TRSA 3VIHA 2C1IA 1X6LA 3OVQA 3B0VC 4GE8A 3LCHA 2Z6IA 2A21A 4MYXA 2GGJA 3NZGA 4FO4A 1ZCOA 3IUHA 1LLOA 4GINA 2WW5A 3F4CA 3N11A 1ZBVA 5CGMA 3U8GA 1V93A 4ZE4A 3CB8A 4X60A 1M65A 3SGZA 3W7LA 2UY5A 3BZJA 4Z1YA 2FZDA 1TWDA 2XUCA 5HATA 4B5SA 4GYKA 4NZJA 3L4UA 4EPEC 4FPSA 3RR4A 3BOLA 4CLMA 1G67A 1E56A 3VFLA 4MB3A 3PAOA 1J0ZA 1S38A 1U33A 1R9XA 3PBUA 2FB2A 4UQBA 5A2BA 2GVEA 1YIXA 2DVUA 1SR9A 1JYXA 3PR2A 1IF2A 3FEQA 3OGSA 1VIWA 4LT9A 3MI3A 2VZVA 4NYUA 3LMZA 2Q01A 1IXQA 3O8AA 3QSTA 2QLYA 2XH0A 3L9CA 3AS2A 4AD4A 2E6FA 2OVLA 1IR2A 3UJSA 1JQVA 1E5JA 1G4EA 3CH9A 1QTWA 4JIQA 5BOOA 4FNRA 1MW1A 3IANA 4QR6A 5F2GA 1W3JA 1FH8A 2QUVA 1H0GA 3F03K 3CTTA 3RPMA 2QCEA 3FY1A 5CEWA 2TAAA 1ZJIA 1QW7A 4S3FA 2XVKA 3N29A 4HZ7A 2OG9A 1Z48A 5FSEC 1J6PA 2CERA 1O68A 4FLOA 3UR2A 1F3TA 1JEZA 2CETA 4MMWA 2OYMA 3QN3A 4J3TA 3UPWA 3C4UA 4NJGA 3DYMA 1HJXA 4X22A 4B9ZA 3N6JA 4J3SA 1PZ1A 3GVRA 3DGBA 3RU6A 2WB5A 2Y62A 2OLSA 4S1FA 3M0KA 1OX6A 1YDYA 4AB4A 1LM1A 2PWEA 1E1CA 1ZALA 3LHYA 2WM1A 3AU2A 4OUIA 2G3FA 4NSBA 4G7EA 3PTQA 4OUEA 3WLJA 4MADA 2DUZA 5CPSA 1D7KA 2XGBA 4NX0A 4BR1A 1EO5A 3DUGA 3NPVA 4XKYA 2CIPA 5IM51 3G1FA 3QPZA 3HPAA 1M9HA 1OCJA 2HNEA 4GFSA 3WLTA 1XV8A 3KRUA 4TVUA 3SURA 3I7RA 4UMAA 2E8YA 3GKFA 3QW4B 3G0UA 4IMGA 4PMNA 3PZIA 2H8XA 4PB5A 4HOZA 2G3JA 2FHFA 4L7ZA 3BOFA 3H6OA 3AZSA 4NKCA 4AIOA 1XYAA 3MO7A 3VGEA 3ANVA 7A3HA 3LB0A 2PWGA 4LYKA 4N6EA 4Q8WA 2DGAA 4FOUA 3R7MA 2B7QA 2PBGA 3E0WA 1CXFA 3BMWA 5LNUA 1XYZA 1JL8A 4OV4A 4PMZA 3ARYA 3S5OA 3BGAA 4DY1A 3ZLFA 5DN1A 3QMRA 2YX0A 4DZ5A 1XDLA 2XISA 3IGUA 5LIXX 4W89A 1BXNA 1AMYA 3TW6A 3LBMA 3CZKA 2FFIA 1W31A 4BCEA 5A8OA 5FKYA 4NP7A 2FZMA 3HV8A 3PG8A 2VRKA 2PTWA 3PTDA 1A4LA 5C2XA 3NTYA 1Q6GA 1TVLA 3UGVA 1XRVA 4ZE5A 2Y1HA 1PYMA 3WNLA 4QDMA 1XLBA 2AGTA 4HU0A 3CXOA 3CASA 1Q66A 1WOBA 1XCWA 3PBVA 4BI7A 3W7QA 1K9TA 3R8GA 2I1OA 1HKKA 2PWDA 1VLIA 4MDPA 1CECA 3CUZA 3E0FA 4GJIA 1RBOB 3UWQA 4ZR8A 3ZIZA 2NUWA 3IRDA 2J24A 5BNKA 4A2RA 3V5CA 1VPQA 3T6CA 3WG6A 3MYOA 4B5VA 2ZZ7A 3NOYA 2V5JA 3HJZA 3PSVA 5LIKX 1GVYA 1RVKA 1PPIA 1XKJA 1DWHM 4IJCA 2OU4A 3W23A 1QNOA 4IIHA 1NM9A 4PMUA 1ME7A 2YDSA 3MSDA 4UQAA 2ANUA 1VRDA 2BY0A 1DQUA 5B7YA 5BXSA 3GC2A 1QNRA 3VD4A 1MI3A 1EQCA 1XDMA 2V63A 5AKQA 3GG7A 2WYSA 4Z2JA 1RQBA 1WZKA 3H8AA 1JF5A 1EA0A 1SFSA 3B0UX 3U48A 3UPMA 2ZTKA 4S3KA 3WF3A 2DORA 1O5QA 3BWWA 3GUWA 3RGTA 1SJDA 4JL1A 3VIIA 3RJYA 4U5KA 3PZGA 1W1B1 4O0QA 4A8NA 1EOKA 1ZCCA 2I5QA 3HGJA 4RXGA 4HHLA 2FMOA 2Y5EA 1QOXA 3OLIA 1IEWA 1RCOB 5CJMA 3PBMA 4IZGA 4OVXA 2OPJA 1NDZA 2YLLA 1W91A 1DYSA 1HJSA 1CTNA 1UR2A 2AQVA 2CCRA 3TFXA 3RCYA 2ISFA 3MSYA 1DWAM 1W5PA 5TD4A 3NQ6A 3GNXA 3GDKA 3FVDA 3SUSA 2QIWA 1C93A 2YXXA 2A79A 1W1PA 3W27A 1XG4A 4LUSA 2OO0A 3ISIX 4MDOA 1H60A 4QSFA 3WQVA 2IS7A 3ENLA 3DN5A 1XLEA 1HQTA 1R0MA 3S2JA 3GTIA 3W7GA 3HMJG 1JFXA 2OZTA 1UH3A 3B9NA 4U31A 2VL4A 1KGXA 1PX8A 2A2IA 4QG9A 4IQLA 4DNHA 5HMEA 5BXPA 3WFZA 2XVPA 4Q22A 1TZ9A 3ZR4A 4FNSA 2V3FA 3FA5A 4DBWA 3GVGA 2J7EA 5CJ5A 2CU0A 5A8MA 1MEHA 1V02E 3BLIA 1IV8A 1F73A 3CQKA 3PC0A 4KCUA 2IPGA 4DAIA 2V9DA 3Q2DA 4R9XA 4GPNA 1G6CA 5ABFB 2VEMA 3I3BA 3T2PA 2VR2A 1J5TA 5G1YA 4E0CA 1Q6DA 2HQAA 2EAWA 3RXZA 3W29A 5K9XA 4P7OA 3WK1A 5FL0A 3EOUA 1WAUA 1BTCA 1T99A 2UY4A 2V30A 2GQAA 2XZ9A 1LRTA 1V6TA 1Y5XA 3RFAA 3V36A 1CYGA 2ZZ2A 3M5VA 2H90A 3SBFA 4DPPA 2YW3A 1EC9A 1BF2A 2OZ0A 4PMOA 1UZDA 5G2WA 4C6CA 3MV01 1S2TA 1XIHA 3F1QA 5A8PA 1F76A 1OB0A 3W25A 5CC3A 2X0SA 4GJ1A 2VGGA 6REQA 4L65A 1F3WA 1P0EA 1OADA 4HNLA 3T2QA 3O07A 3NQ7A 1V0MA 2PA6A 2HPMA 4KMQA 3W24A 4GXMA 4HYVA 3HF3A 1MFVA 2IQTA 4WK9A 1Q45A 2J78A 3FW6A 5I07A 1RD6A 1N2VA 1DQXA 2WMIA 4CEXC 5HXMA 1IXOA 5I77A 2QQ6A 2Z29A 4CNTA 3MV11 1UPPA 2FDMA 4IIBA 4QG8A 2HPIA 5MHBA 1A49A 3TOYA 5CPOA 1FCUA 1KLYA 3T09A 4KBXA 1H2JA 2BDQA 2WHKA 1MMFA 1IXNA 1HFBA 4GJJA 4MWAD 3SIMA 6CGTA 1E40A 4X2RA 3TA6A 5E09A 3UXAA 4EACA 1ZJAA 3BGJA 2YJQA 1G4TA 2GDQA 4QFUA 4Z2HA 3A6OA 4QJ1A 1VEMA 3P62A 1HIZA 1JNEA 3WLRA 1GK8A 4UWMA 4AX6A 2OQLA 3MKCA 3ITYA 3LCIA 3AS1A 3IIVA 3L4YA 3PZOA 1OHLA 4DO6A 2NQHA 2XG9A 1CXEA 5D04C 1TTIA 3WUBA 2J47A 3KVMA 3BANA 3D3FA 4W7UA 3EWCA 1LL4A 4JQ2A 4KEMA 3FHQA 4TUFA 2XTKA 3O0KA 3QW3A 1F6YA 2YBVA 4PC8A 4HPXA 5DMMA 1CLXA 1U22A 1EFZA 2X0YA 4K7YA 3FK4A 3CBWA 1FH7A 1TE1A 1TJ2A 4XAZA 4IP5A 3W1QA 1X38A 2CLPA 1VFFA 4J7RA 4DJDD 4ZODA 3TE9A 4QS6A 3GR8A 4GQGA 2A3AA 4FXSA 3IGXA 1ICQA 3WMLA 2YCJA 4AZHA 1BSLA 1X8CA 1UQZA 1VQTA 4XK2A 5TIMA 3RMEA 5CH9A 2ZZ5A 3BPWA 3H2MA 1Q2RA 3GU1A 3QGAC 4L9YA 2RFGA 4EXQA 1SUXA 4S2CA 1KGWA 2DQXA 5E0CA 5C54A 4D1IA 4EK7A 4MYAA 4GBDA 4REQB 4FXJA 3Q67A 4PCTA 4UTMA 1ZAJA 2VD8A 4H8UA 2PP1A 4WKHA 3VDHA 4KIEA 2EPOA 2V0TA 5E70A 4I6VA 4UB9A 4XZLX 4JX5A 2XZ7A 1SU5A 3L2MA 1JPHA 3LLDA 3QR0A 3SRDA 5I00A 5I3FA 3BGGA 5EMJA 4AD5A 1XLMA 4BHYA 5FJIA 2WQDA 2BG5A 3D5HA 4LYRA 4NQ1A 1ONXA 4IUOA 3W7IA 4KGJA 3S46A 3U6WA 3TYBA 1DTNA 1ITUA 3GH5A 4Q8OA 2OKTA 4BQ2A 1J96A 4LTSA 3UESA 3E96A 4US6A 1OK4A 5TQLA 2W67A 2HS6A 3S2MA 1CGXA 2X1UA 5DBTA 1UUOA 3A12A 1TV7A 5J8LA 3B9AA 2ZXDA 1M7XA 5FJRA 1GQNA 1V3MA 3ARQA 1UWTA 3S4TA 3KZSA 3CZGA 1EOMA 1W1A1 1GOOA 2Y7DA 4O1FA 3CYJA 1SZEA 1AK5A 1BVNP 2EPNA 1SM9A 1A3XA 4F0LA 2EG7A 4HMCA 3GIPA 3P61A 4LC8A 1JJKA 5H8UA 1WP6A 3M5ZA 1A5SA 1K7EA 1IT0A 5FAGA 4J3VA 3PPFA 5E9XA 4GRSA 1QVBA 3M0IA 2Q02A 3LCFA 1I4NA 1XUZA 1LWJA 2G0WA 4MWAC 3CMFA 3WDJA 1TQXA 2VZOA 3W53A 4PTNA 4FAMA 2A1YA 4ZQMA 1BYAA 1JQXA 1CLVA 2HS8A 2BOFX 2EPMX 4UTWA 3B8SA 1DHPA 1UHVA 3LYEA 5LIWX 2QDEA 4UZSA 4LVAA 1X6NA 4BZYA 4HN8A 4PODA 5ABHA 1I45A 3IVTA 3V7PA 4KFNA 4H7ZA 4IPNB 3CQHA 2NT0A 2V38A 4W4QA 1MEWA 3G8EA 4RNHA 2O55A 2BLEA 4K36A 3W2MA 4JTFA 2OX4A 2Y7FA 2HBXA 2WC4A 4O8AA 5AYBA 2X1TA 3CQIA 3OGRA 1TKKA 1D2KA 1LQ2A 3RR1A 5AC4A 2BSLA 3D3AA 4MJ4A 1XPGA 3VKBA 2CBIA 4YNGA 3TJ4A 1S5VA 1AQ0A 1A80A 3LCXA 1L2QA 4HT3A 1FCVA 4H6QA 3DAQA 1OEPA 5F4WA 4K68A 4EWJA 3PSWA 4TOQA 4C6QA 3QV6A 4Q7NA 2VC9A 4WLCA 4GLEA 3QEZA 5DEZA 2CLFA 1E3ZA 3UD6A 1E1CB 4UFMA 4GO9A 2X05A 1PIFA 2O9TA 1EJVC 3VUSA 1XL9A 1XG3A 4G7EB 3OZMA 3BH4A 1SJBA 3OIHA 1BWLA 3P0WA 2GQ3A 1FDJA 5FJTA 3N25A 4JKKA 2XWEA 4XKYB 3P8JA 3W1NA 4L6OA 5A6BD 1OGBA 4QDWA 2PLJA 4UTUA 4IISA 3NXFA 4PFHA 3GNDA 4Q4MA 3ARRA 2ZYFA 3PS7A 1TSIA 1H5VA 3VCRA 5HR7A 1M04A 4JIRA 4ERAA 2IPJA 2QCLA 3K8KA 4GACA 3QYSA 2ZUWA 3EDDA 3NAVA 4QNWA 4HBKA 1XLLA 4R5EA 2VEIA 1JDAA 1KTCA 2FQIA 4LB4A 4PTVA 2RUSA 3LTPA 2ZZ3A 1VD6A 1CXHA 2OGJA 5FF7A 3VNIA 4BS0A 4RR4A 2VM8A 2QS8A 4JTHA 3AUOA 4JTIA 1BXBA 1NOWA 3UCQA 2PB1A 2X7VA 2WNWA 5BXRA 4HNUA 4UFJA 1ELSA 4LRTA 5LGXA 2X42A 5BU9A 2V82A 4Q4QA 4BJHA 1E5NA 3M0LA 5H8PA 3NQEA 4LY8A 3SRFA 3LV5A 2GUBA 4C6IA 1P1XA 4WHBA 5CPQA 1K8XA 5BRPA 3ZJ6A 3BARA 3CLMA 4EE9A 4WR3A 4J1OA 2V3EA 4G1KA 3QY8A 4UCFA 1CENA 1H1ZA 2X1IA 3T0DA 2VXNA 1WQ5A 4F8XA 3QBUA 3VKCA 2TSYA 1K9EA 3UGRA 4QCEA 3NQCA 3KVJA 4HA3A 4UXDA 3DC0A 5HA7A 2CC0A 3B03A 3TX9A 3TN3A 1RALA 3BJTA 3G22A 1DWFM 4PRRA 3W0KA 3IV8A 1TMHA 2ZADA 6XIAA 3M6YA 4GH3A 1JDCA 2VCCA 3TN6A 3VD9A 3EMCA 1F4AA 5HMSA 3EYPA 5HQMA 5LKYA 3PZ9A 3VILA 7CGTA 5L9FA 3I4KA 3B04A 3HFYA 2HRWA 3ONCA 5AOUA 1YADA 4QDPA 2HTMA 4Z0SA 1HP4A 4YN5A 3T05A 2QW5A 1DIKA 3G18A 3DGRA 1WDWA 4S3GA 2PDNA 4Z1CA 2A3BA 3UG4A 3UZYA 2X16A 1O1HA 2CHOA 3W37A 2WVTA 3H26A 4M29A 4UC5A 1RPKA 1MRQA 1QASA 4K38A 4FALA 3WUEA 3VCNA 2QAPA 3U2OA 2JK2A 3GXMA 3V16A 4QNEA 4A3YA 1PXGA 1IT8A 4G8TA 4DJFA 3G1HA 4PMQA 4MNLA 4DZAA 2D0GA 3EWDA 3MWAA 2Y61A 3URQA 5LNSA 4KCVA 5XINA 4R7WA 3FX4A 3UY7A 2D22A 4FSAA 4TV5A 2ONEA 4K8GA 1JDDA 1DXIA 4X0NA 4NVTA 4HSOA 2WHLA 3ELFA 2E9LA 1TIMA 3RMJA 3VNKA 2W63A 4LX4A 1Z32X 3BW4A 3UA3A 2CZ5A 4L61A 3RIKA 4JIIX 1TWSA 3GFYA 4AHOA 3MO4A 3GQYA 3CIVA 4LBSA 4QP0A 3GFXA 4LUSB 4M24A 1UIOA 4GXPA 5DMLA 4QAIA 1E0XA 4DUVA 3GNPA 2X09A 1GVOA 3GLCA 4M7SA 1TPFA 4XTIA 3NA8A 4PEEA 3NDZA 3TLQA 5F1UA 1X1NA 3R1ZA 2G3MA 5IHRA 2FHBA 4NL1A 2R6OA 3IUDA 3LLXA 1FXPA 4WSKA 4GQ0A 2VKZG 2WMFA 3MI6A 1EZ2A 4YL2A 3EWZA 1XLCA 3GWQA 1OCNA 1MUWA 4C7FA 1XI3A 1V3HA 2E1DA 3QY6A 1QOQA 1JF6A 2PDKA 3T9PA 4TX9A 3KBMA 2O4MA 1IZKA 4XX6A 4NZCA 4AMAA 6ALDA 1DXEA 4Z17A 2Q3OA 1P0DA 4ZB5A 3FOKA 4KH2A 5GJNA 2D73A 4NY2A 3GH4A 3KAOA 1KKOA 4MNMA 3RF9A 1TPC1 5JH2A 1VFHA 1PCWA 1YW1A 4HD5A 4I8DA 3WDRA 3G0XA 4R53A 5MF5A 2QDDA 3B8IA 2PDYA 1Q6LA 2BZNA 4LS2A 2V5CA 1LL6A 4FX7A 1RSCA 3AIUA 1DP0A 5DF0A 3MCNA 3ME3A 2IQDA 1QNSA 5AHLA 5FCZA 3BC9A 2RAGA 4CD8A 2FLIA 1AA1B 3R8RA 1ESWA 3WNPA 4R33A 5AY7A 4NXKA 3E2QA 1GQKA 5CSRA 4BK9A 3CEPA 4GNVA 3S47A 4ML4A 1B31A 1TR9A 4GHRA 3N2OA 2PODA 5D2VA 3KBWA 4Z0JA 1TPVA 3WJSA 2WC3A 1EJXC 1AW5A 3RO8A 2OLHA 3N6HA 5D9NA 4LS1A 4HVXA 1U5HA 1E15A 1R9ZA 1Z69A 3F4DA 6REQB 1EWDA 1W9XA 1A0EA 4E4UA 1B3WA 3S83A 3NOEA 1HKWA 1KM1A 3NURA 4KGLA 5LSMA 4PUKA 5LGZA 5T26A 1T5AA 1XYCA 3J7HA 3H21A 2GDUA 2ZDSA 4JNMA 1GVIA 3R2GA 4BI6A 4IG2A 1GKPA 1LLWA 3VD5A 2O4QA 3GDRA 3I7SA 1QATA 4UTTA 2WMIB 3FFSA 3KOYA 2QYGA 3IAPA 4ERIA 4JDBA 2RDTA 2J9XA 3ZSTA 4GVIA 5C55A 3V0UA 4O0KA 4TQTA 1J8VA 3WK0A 1GTHA 1VHNA 2DSKA 4OFCA 4DO7A 3E9AA 3UNTA 3C61A 1UWRA 2P8BA 4EAMA 4EP8C 2PRHA 1ADOA 3G3DA 3KHDA 1EO7A 3TYDA 1V6YA 2CLMA 2DZTA 4HMEA 3SI9A 2QMJA 2BTMA 3FYYA 3W22A 4U10A 1XUUA 2ZRYA 1I60A 4FF7A 1XDJA 3M6DA 4MPKA 2J7BA 3A23A 3WF1A 2AQWA 1P5BA 1TCDA 4K8EA 2Y0FA 5D38A 1QXLA 3NVTA 3LENA 3UU0A 3II1A 4IIEA 2VZUA 4QQ3A 1TWZA 4XSMA 2XH7A 3DHFA 4DRSA 3MBFA 5CSSA 5F7UA 3NO1A 3UXIA 1KCZA 3BUVA 3K1DA 4GYFA 4J4KA 3GY1A 1MEIA 2ZCGA 1EP3A 3VYLA 2R94A 2E28A 1E4NA 1IIGA 4RE0A 2G41A 2NWRA 1OC6A 1EKOA 4X61A 1UP3A 4FIQA 2R8WA 4GZEA 3VIMA 3USBA 5C9ZA 1POJA 1CGVA 2YXOA 2WSRA 5I5RA 1AFSA 1R86A 4M82A 4FI4A 4O50A 3KHJA 4YIWA 1V3KA 5HNRA 2PRMA 4RK8A 1ZBWA 2C91A 3ARSA 1GW1A 4DWDA 3CJPA 3NQDA 4CCZA 2Y2WA 2GVLA 2VO5A 2TYSA 2XVLA 5KZDA 1TELA 4DQWA 4NYYA 1AQFA 3P60A 2DP3A 2YA2A 6ENLA 3BAYA 4ACZA 3CPUA 3FXGA 5B7ZA 1TFVA 3RPDA 3ARVA 2E5CA 1WZMA 3BLPX 1OC7A 4XV0A 5H8MA 3W84A 3CUIA 4MVAA 5HDRA 2YCLB 3L68A 4GIYA 4FXRA 1XH0A 1EBHA 3R5EA 4O12A 3OJGA 4ONVA 3PJXA 4AHPA 3AXKA 3VOIA 5EYWA 3XISA 4S3AA 2AAMA 2Z27A 1JZ6A 1SSGA 3NM1A 2XIOA 4UQEA 2GSHA 3Q65A 3RX2A 2FPYA 2I16A 2VC7A 4R27A 4BQ5A 3S0CA 4UFHA 4Y9OA 5LNVA 4A21A 2WZIA 3C2YA 1B2YA 5GVJA 3CWNA 3C8FA 2VVNA 1Y0EA 2NXHA 4TTUA 4OHQA 3T55A 4EF9A 2O92A 4US5D 2DV0A 5M2FX 2WZHA 4AZIA 2Y89A 4W93A 3T4WA 1L0PA 5A6KA 2ASHA 5K3VA 2QUUA 1TG7A 1XRFA 2X7WA 1EH9A 3N13A 3U7BA 3RCNA 3M0YA 1E6ZA 5E93A 4DLMA 1YHTA 1GOXA 3UPBA 4D8LA 1E9YB 3LQGA 3OHIA 1NFGA 4QE5A 3MCOA 1B1YA 2GQ8A 2OEKA 3R25A 3LS9A 1FWSA 1RP8A 2ZX9A 1V3LA 4NI8A 4B9YA 4DVOA 1QK0A 1OG6A 1KWKA 1SMAA 2JKEA 4M81A 2OSXA 5D2TA 4PBGA 3WDIA 1O4UA 3VOGA 2WSYA 4H9MA 3URNA 2R9RA 1QNPA 1TIWA 1YE4A 3O6YX 1SW3A 4MUZA 3NQMA 4WSHA 3ALFA 1YNQA 3HPFA 3M7SA 2R1NA 1KRMA 1SR0A 4N7QA 2W62A 5AC6A 2YL8A 1EC7A 1L8NA 1B57A 4TXEA 2GSEA 4WVXA 2HROA 3GW3A 2IXVA 1IEIA 4GI6A 3CMJA 1FWHC 4WUIA 1W37A 3B0PA 4PMRA 3SY5A 2ALRA 3HPZA 3OYZA 1R6WA 2D2HA 2WXDM 4WJXA 4CNNA 1E43A 2WLZA 2GVYA 4JYDA 2YYTA 1US2A 1XLKA 3JU2A 1W9DM 4FNTA 3R58A 5DANA 1R3QA 1GVSA 1PHQA 5EBUA 4INFA 1GHRA 1OJXA 4JFVA 6XIMA 5G2HA 3UWEA 3DC8A 2C14A 4W5ZA 2A3CA 2ATMA 4H9XA 3AS3A 4D6EA 2PWHA 1XS2A 5ECUA 3M16A 4V15A 4ZOAA 3NZQA 3A3HA 1QHZA 2WKGA 3A4AA 3AMGA 3VIOA 2Y7GA 3W7JA 1WV2A 4ENLA 3EWXA 8RUCA 2E6AA 3SY8A 1WUEA 5GPRA 1XRTA 3IIPA 5E0KA 1VLWA 4NNCA 1A5OC 1BQGA 3VNMA 3KBJA 3STGA 4C6OA 5FEZA 1RD5A 2REQA 3LTYA 1TPEA 3VGGA 2CLLA 2H3BA 3F5KA 4X9YA 3ZVIA 3MP5A 1I8JA 3NL5A 4S38A 2VENA 4I7WA 2QAFA 4PBFA 2QKFA 2VP8A 5ABGA 1P4CA 4HOXA 4S3CA 4UTFA 3N2TA 3NJ3A 2VDHA 1ZQ5A 1DE6A 2D2OA 4ADTA 4HSHA 1ADSA 2WSKA 4D8AA 1BPLB 1IR1A 4P8WA 4G5DA 2DZUA 5AC7A 3BJSA 2I9EA 1WAWA 3HA1A 1WKYA 1B9BA 4KF1A 3UR5A 2X40A 2D0FA 3VDBA 2YZRA 3IGHX 3B3DA 3W87A 3P93A 1AQHA 5JH1A 1I2RA 1EL3A 2DZWA 3FKRA 1G9HA 2V5KA 3W2UA 1WXYA 4YVXA 3MMWA 3B9EA 4D6CA 2D23A 2FH8A 3K1GA 4BY3A 3LZ3A 2PCQA 1GQLA 4V27A 1QHPA 4ZMGA 1QHOA 3EMQA 1N8IA 4W88A 3STFA 1D3GA 5E6YA 1R87A 2ALDA 3O6AA 4WJ8A 1W5QA 4U2YA 2XSAA 3W7RA 3GNRA 1KXTA 3O63A 1Z6KA 2ZRXA 4KW2A 1XSIA 4M6PA 2G97A 2C19A 4NZFA 3WLLA 2I57A 1NELA 3FJNA 4JQ1A 4ZVJA 1WKDA 3TAKA 4HCDA 1LL7A 1IE7C 3DBPA 4PUWA 5EBAA 1S3TC 4O4VA 3S5SA 1G7UA 4BEUA 1HL2A 4GY0A 2DZPA 3AMDA 3NL3A 4E4PA 4KERA 3PULA 4WQ6A 3ATZA 1AH0A 1ITCA 4F0KA 1EGZA 1OGSA 1XP3A 2FTPA 3UWZA 1B5TA 3G2GA 2WCGA 1UWAA 4LGXA 2NQZA 1H3GA 5D33A 1QRQA 3VX0A 1PX3A 1JXKA 4PZVA 3LERA 1UJQA 3SRHA 1E6XM 4O15A 1G4SA 3AHXA 1TJPA 1R2TA 3KFTA 2WKJA 3MVTA 1KRAC 3WNOA 3GU2A 2EPLX 2PDXA 3N9SA 3LGDA 4UTJA 5HQLA 1TA3A 3WCZA 4DHGA 1AH4A 1VHCA 2V5LA 1QNQA 1GQJA 1WPCA 1VYRA 2CFFA 1KM5A 4ZQNA 2VEKA 4ZOCA 2VT0A 2VC6A 3GZAA 1LT7A 1JR1A 3DG6A 4IP7A 5G1TA 5JVLA 4ZTYA 1H7XA 3OP2A 1CXLA 5CZKA 3TMLA 5FESA 1W1ZA 1VJIA 5A6TC 4R34A 3BK0A 3WUFA 2J7GA 3VE7A 1B0IA 3C2RA 1TV5A 3SCVA 1HZYA 1GEHA 4JQ4A 3N9RA 4AYSA 4PN2A 4L4PA 4PBEA 3WQGA 5J04A 4NF7A 5LA2A 1E55A 1WA3A 3S3GA 1YQ2A 4EOUA 3BLDA 4C5YA 5ABTA 2CLHA 4GYJA 3LRLA 1KR0A 4JTAA 1X1ZA 3C8NA 1AMKA 2D2JA 3Q58A 4FNQA 3PWGA 3IAQA 4I6KA 2XWDA 4W7WA 5HMDA 3WLPA 2VEPA 3VIPA 4E6MA 4I8YA 5LYRA 4KEZA 2WQPA 4WOZA 3NQVA 1FQ0A 1H11A 1M1BA 4XZIA 3GHRA 2PFHA 3EDFA 3KRSA 4M19A 2HWGA 3SJNA 1Q4NX 1KQYA 3KL0A 2CLIA 2C16A 1D3HA 2WMHA 1XICA 2IPFA 3HPXA 5CZJA 1FKWA 4CKQA 2KX9A 4U4MA 3MANA 3AZTA 4FX6M 2GYIA 1V3JA 2NV1A 3REQA 3U0HA 3W7HA 4LW7A 3TNBA 1H50A 1UR9A 1KFJA 3D0CA 1ISWA 4GC4A 3PJTA 4PTWA 3STPA 4J3WA 2X1SA 1KR1A 3CHDA 2XGZA 3W28A 1Q8JA 4FA3A 1E0UA 1HJVA 2GSJA 3WKZA 4GD0A 2PF8A 2XU2A 1G4PA 1BAGA 1X97A 3MCMA 1T96A 2NXGA 1AH3A 1QPRA 1GEQA 4OZOA 4F66A 1GOQA 4QJ5B 1QPNA 4AC7C 4IG2B 3IARA 2F38A 2F6UA 3PZUA 5D05A 3BLKA 3H24A 2QPSA 3CHEA 4KQNA 3S2CA 3M0HA 4AW7A 3B8VA 4HU3A 2BY3A 4EPKA 2PUZA 5GNXA 3GYCA 1TJRA 4TMCA 2CXGA 5DY3A 1KFWA 3EWBX 3MUY1 4Q8QA 3HQOA 1MVYA 1IGSA 1TRIA 2QPXA 3E74A 3R12A 2OTDA 3ITTA 4R7JA 4Y9PA 4HNOA 1OIFA 1RBLA 1DWIM 5A95A 3URBA 2INEA 4DJEA 2VNCA 4O8RA 1LG1A 1JYNA 1XPYA 3CPRA 1V6UA 4JCLA 1HJWA 2GGEA 2ICSA 1PO9A 4Q8UA 3EPMA 2HK0A 1OD8A 4DLFA 1KM0A 3TUUA 4PB4A 4DF1A 2OT1A 4AISA 3AAMA 1E4MM 1KB3A 3JS3A 1O5KA 3E02A 4IWWA 1LJYA 3PZNA 4E3VA 4Y8FA 5A5WA 2BP1A 2PS2A 1V5XA 2WVUA 1S5MA 4ZQRA 1GVEA 1UYQA 3WL1A 3LSCA 4L64A 5F4SA 2B4GA 2ZBTA 3W74A 4ZB2A 3W2KA 2I17A 3B9DA 3MMTA 3C2OA 1DXFA 1W1YA 3VNJA 4AH7A 3FKKA 3THQA 3KWXA 2NZLA 3LOTA 1EB3A 2ATSA 4N9EA 5T9CE 2YW4A 4C6KA 6A3HA 4XD4A 4FEZA 1Q4WA 3SCNA 3H2AA 3JVAA 4HKPA 4LAUA 4HHHA 2EJ1A 3LPGA 5A8QA 1TPB1 4LCRA 2OQHA 1H41A 4M5PA 4ACZB 1EBGA 1W0MA 1NIUA 1W9VA 2RDWA 1ISZA 1W9BM 1NWUA 1OFBA 4FLRA 2CLOA 1LQAA 3QMSA 1VFUA 3ZVHA 4IIFA 5ECVA 2C18A 5I3IA 2J7HA 4LS0A 1J6OA 3AMKA 1T0OA 4S3JA 3A3XA 1G0CA 1XIEA 2V69A 4F48A 1XYLA 3NSNA 1O1ZA 3FCPA 1UZ4A 4H4IA 3U9IA 4PCSA 3KCLA 2FVMA 3L21A 4L9ZA 1H09A 4J3XA 1DORA 1IWPA 2ZIDA 3VABA 3W7DA 4OOZA 1KFLA 5C9RA 2CYGA 5DRCA 1H51A 1VJZA 5CGQA 4P7QA 4PL1A 2P0OA 2V8ZA 1ECEA 3R0KA 4WEVX 3K2GA 3EX6A 3TN5A 2OKOA 4WY0A 2FKPA 1XINA 5CPTA 4GISA 1OIMA 1EJTC 3KS5A 2YIHA 1C90A 3P6LA 4CQBA 1FH9A 3STCA 4I3GA 1RA0A 4HHPA 1MXGA 3TTEA 5EFDA 2ISDA 3FXYA 4JYFA 5F1VA 4XKMA 2Z26A 3AIRA 3T0CA 3TFCA 3PPGA 3GZ3A 1X6UA 1I2QA 4F2BA 2PE4A 5HJXA 3QHNA 1F2JA 1AZ2A 1WO2A 1M5WA 1OG0A 4AXKA 1Q63A 2FZBA 3WQ5A 4GUFA 1V03A 3ZYZA 3GUGA 2BGSA 3DYOA 1DJXA 4M6VA 1RJQA 3PG9A 3ERPA 4DELA 1XM3A 2DH3A 3O0FA 2GLKA 1M03A 2ZZ1A 4G2DA 4PMXA 1C29A 1YNYA 4PRWA 1LLZA 4Q8TA 4HK5A 2BWGA 2ZTJA 3Q45A 4JEQA 5C9UA 1HGWA 5HPOA 1UD8A 2C13A 4GQRA 4M3PA 2ZRZA 2WNNA 3MDUA 4FX8A 4P5UA 1QU4A 1SPQA 3WY1A 4HZ8A 4PMYA 1KBKA 2YDQA 4PSRA 2P8CA 1JUKA 1TREA 1WXJA 4POCA 1EYEA 1S1RA 1FA2A 1JD9A 3LHTA 5BZAA 4LV9A 3IJ7A 3ITXA 4IQEA 1XCXA 2GWNA 2WMKA 3UZWA 2XSXA 1GGOA 4DWSC 3RYSA 1VPYA 1GZGA 5DBUA 4FS9A 4MF4A 1LQ0A 3EXRA 7PTDA 1NDYA 1EC8A 3W1MA 1XBXA 1TR1A 1GG1A 1PZ0A 4WDTA 2OEMA 4KKXA 4LEFA 2W79A 2P1FA 1JUBA 2WVVB 4UNLA 3RU8X 2DY3A 1ZJBA 4HGXA 3UG5A 5AC8A 2Z00A 4A3RA 2HCVA 4F9DA 3TV8A 3WFLA 3QR3A 1DJGA 3R89A 3RLUA 3CT7A 5DCBA 4YTUA 3V3WA 5A2AA 4DWSB 3ZJKA 1W1VA 4DZHA 4CU8A 2QF7A 3DFYA 3EKGA 1ZP3A 5U4NA 2YL9A 4GIEA 4MUPA 2RHGA 1SO3A 3F5LA 1O5XA 5K4ZA 3VAVA 2WZTA 1H1NA 4S3EA 3BG5A 3TC3A 3RDKA 5B80A 1PVNA 1FDZA 3GXNA 1VCVA 1S5TA 5HWNA 1OY0A 2PTYA 1Z7AA 1K7FA 4WRHA 3OHMB 3KCOA 3GYEA 5A3HA 3HPSA 4XD5A 3W72A 3QOMA 5HULA 1YXCA 1SO6A 3W73A 1PE1A 2ZVIA 1V3IA 1S5WA 3A4JA 2D20A 4ZO7A 3KL5A 2XGIA 1UWSA 1TZ7A 1DQWA 5T8GA 1R7AA 3S5YA 1T8QA 2FFCA 4L4OA 5BROA 2E25A 4CUCA 1H63A 2IKHA 3D46A 3DHDA 1UBSA 2DZAA 1QT1A 2HDJA 4HB7A 2PPGA 3N18A 3CHFA 2Z24A 2OELA 1GKRA 4L6DA 2VDIA 1RLDA 4BF5A 1GJUA 5REQB 4LC6A 2J6VA 1XH2A 4QGCA 5DLCA 3R13A 3I3DA 4EXAA 1OABA 3N2XA 4GI4A 3O7UA 1S3HA 2MANA 3AXXA 2GGIA 1M6JA 5A6AA 4QRNA 3W71A 4FIRA 5HUOA 3WMBA 4X9SA 3ICJA 2ZFAA 5F4XA 3DI1A 1TB3A 4HPJA 2SFPA 4UQCA 4FNPA 4DZIA 1EX5A 4O18A 4O1BA 1B3XA 1R3RA 4G7FA 5AZ0A 4CNOA 3AHZA 3AFBA 4B5TA 3OA5A 3EPNA 1VP5A 1DJHA 3DU0A 1UKOA 2EQDA 4JZ5A 1GOIA 3CL7A 3DFHA 3AROA 4NXSA 2O9PA 3DENA 4JKMA 2VWSA 4WXZA 3BMXA 1PIIA 1VBUA 3RLGA 4HPHA 1TVNA 1JFHA 4F2UA 2E09A 1NY1A 1Y65A 2R1KA 1CBGA 2ZA1A 2V5BA 1E72M 3PBWA 4NJHA 4D71A 4DXKA 4W8LA 3TQVA 2E8ZA 2FYMA 2HV5A 1TA3B 1Q8AA 4IQDA 4PUJA 4NRRA 4NAEB 4HMDA 3PANA 1K6WA 1A4MA 4H19A 4CCDA 3TYZA 3GRIA 3TSMA 4DBUA 4ML9A 2A3LA 2YPIA 5CG0A 3BE7A 3H12A 1MQRA 3ARPA 4S2BA 3WBEA 4EPBC 3NEHA 1XF0A 3QVQA 4GUHA 1FOBA 3M1ZA 1MZHA 4ZQCA 3VOFA 1VR6A 2QJMA 3M5XA 2Y63A 2ZUUA 1IXPA 4JFTA 1EXBA 1UZHA 3SFKA 3ITLA 4GO8A 2BHZA 1XX1A 2ESCA 4XZWA 2VC5A 2DSUA 2BXYA 2PGWA 4DJFD 4ZO6A 1BD0A 1SW7A 2PWUA 1XLHA 1TJ0A 4DUWA 2W5FA 4XIMA 4NUWA 4LVDA 2VX6A 3L12A 1VEOA 4WOQA 2F6XA 3LHUA 2P10A 3ALGA 1FHDA 2JE8A 3VGBA 4AY1A 1PEZA 1OQFA 4R88A 1DL3A 2YLAA 2DJXA 1QBBA 1QI5A 1R46A 3BL3A 4C6JA 3ORWA 3TMQA 3EXSA 4JIHA 2PZNA 5K2ZA 2YKKA 3CUHA 1LBLA 4DF0A 3M41A 2NVDA 1YLVA 3IIZA 4ADSA 4N0RA 1EP2A 3FDKA 3WELA 3WH6A 3H4XA 3VDCA 5HOSA 1JYWA 3QGKC 3VKAA 1FWCC 1J93A 4F0HA 3R0DA 4ZQPA 2CNCA 2QCDA 3WDHA 4N4QA 1W5NA 3CAQA 3OBEA 2C0AA 2QCCA 4UR9A 2VCBA 2ACRA 2QCHA 1GONA 2DSWA 3S5NA 3NPXA 2OT0A 2ZZ6A 3VX1A 4GGHA 3KP1A 3RRAA 1PB0A 1US0A 5HMFA 1OZQA 3AS0A 4H9ZA 1F61A 1F3XA 3XIMA 5D4YA 4GQBA 4XG1A 3DDMA 4PCNA 1KV5A 3APGA 2DU2A 3AALA 1B30A 4O14A 4PTMA 3ZM8A 5I09A 2GJPA 3W7MA 1FWNA 3LHZA 5I3JA 3ZMRA 2I5IA 3BCFA 3C0JA 4E2VA 4S3DA 4LUJA 3LQLA 1SJCA 3ITVA 5A6JA 5CBJA 4YWSA 2Y8VA 2FJKA 3SUUA 3SGGA 3N12A 3UF9A 1FWRA 3PWIA 4HJFA 5BU6A 4UR7A 4PCFA 4RDYA 4B3ZA 2DIJA 4B15A 4UOZA 3WMCA 1BGAA 3UZZA 3PZTA 1KWGA 1E0VA 2GFTA 3G0SA 4PYSA 4AF0B 1WXZA 4RE3A 5C9WA 3PK7A 3A21A 2VFGA 3PBGA 4G6CA 2NX9A 3LBCA 3KL3A 4H83A 1WE5A 3OVPA 1GHSA 1YXDA 1UASA 1IZCA 1DPMA 3SECA 5I79A 3WJYA 4BA0A 2XFFA 1HTIA 4Z2LA 1C8VA 1I2NA 1SSDA 3UWWA 4RPPA 4Q7IA 4C6DA 3LRMA 4JTGA 1AD1A 2ZKMX 4YVPA 3FAWA 9RUBA 2QDHA 4XBJA 2PDCA 3UXKA 3HOJA 7ODCA 4ZOBA 4GVFA 1D8WA 1FBAA 1QI4A 3V0TA 3BW2A 1WZLA 3OYXA 5CBIA 4GMEA 4EVZA 4ZFMA 3ZLGA 2J8TA 1A5UA 1DTUA 1N55A 4AWUA 1PS9A 1CDGA 4GI8A 4CNUA 2A3HA 4HOWA 4UIOA 3B06A 4HNVA 2O7SA 1W8SA 3LLFA 3DFSA 3EZ4A 1NAL1 4J2PA 4RZ5A 1WDSA 4MIMA 5HJYA 1W3KA 1P7TA 3HBLA 4MLRA 3WH5A 2J27A 4O1EA 3WX7A 5CBBA 1CCWB 5I0DA 3F2BA 1VFOA 2QVHA 4LF1A 4F0SA 5D09A 1E9LA 3VD7A 3VZXA 1QI0A 4MWAA 3T78A 4O57A 3QYQA 3LMYA 3ZT6A 2L5HA 3DECA 2EPHA 1UQYA 5IFPA 4WGXA 2Z0IA 5IRPA 4HZMA 1AJ2A 2VEFA 4IGSA 5EL1A 3GDTA 3G5EA 3AHTA 2WCSA 4MSSA 2NVAA 3ZVHB 4LAKA 4WCJA 3T2OA 1KBLA 4MTVA 4O28A 4WJEA 2YL6A 5I3HA 3BXWA 2PDFA 4EWND 4UBPC 2VQUA 3TCEA 4OBTA 1ZY9A 3TTOA 2VRJA 3QJAA 3M64A 1XGZA 3ZJ8A 3G77A 4AD1A 1SMDA 2W6RA 4FR1A 2VX7A 1UR8A 1OT2A 3S6OA 5IXEA 3EEZA 5IBXC 5BXTA 3TXZA 3WBWA 2JKPA 4NAFA 2B7OA 4J2MA 3EB2A 4GY1A 4JIEA 1AJZA 3E12A 4RLIA 4LJ3A 2I5GA 3EDEA 2Z6JA 3QZ6A 1FWAC 3CV7A 1J4EA 1X39A 1MXDA 2WJZA 3FN9A 1OCQA 4WY0B 3OZOA 2FVKA 3NZ1A 6TAAA 3HM7A 4M1RA 4LFYA 3K13A 3KE0A 4K6AA 5AHMA 1GORA 5BWAA 3TEVA 1K6AA 2BFGA 2WWDA 3OG2A 3WD4A 3ABSA 5E9AA 2INZA 3W81A 1U30A 2XN2A 1NF0A 1ITXA 2CBVA 2HSAA 5T9BG 4RW3A 3IVSA 4XZHA 1EIXA 1YXYA 3IJDA 3A5VA 4PTDA 1KM2A 1J79A 4TIMA 1QBAA 4XSLA 5FSDC 2E1WA 3QV7A 5HWJA 1DJYA 5DMNA 4L1WA 4GCXA 3TP4A 4ES4A 2FZNA 1J10A 4X0VA 4HPNA 5K9CA 3ID7A 1DJWA 1DV7A 3W9ZA 3U3HA 4H9TA 5DXXA 2XN0A 1DHKA 2WO5A 2QZRA 3GO2A 5HINA 1R9YA 4LANA 3DH7A 5CGTA 1C3FA 3M07A 3KS6A 5KINA 1I1XA 2BHUA 4IFRA 3E2SA 2Y8UA 5EMKA 2NLIA 2ZUVA 3IJ6A 3NM3A 3RITA 1TWIA 4IM4A 1V0NA 2VR5A 1NTHA 2Z1WA 2PLCA 2J74A 2XH2A 2EG6A 1WNOA 1G7VA 2R24A 1DJZA 4JIPA 2B7PA 4JTRA 1LWIA 2FPVA 4L6HA 4TX6A 3E0IA 3FA4A 3AIWA 4UFIA 4K1WA 3SN0A 3QFWA 1OGGA 3G1DA 2IUZA 2VFDA 3ECQA 4V1YA 2FZ9A 1L8PA 2XDFA 2NV9A 1P48A 4M6UA 4GA8A 4JTCA 4B5UA 3GU9A 1R38A 2XFYA 5KMYA 2D24A 3GNOA 5CG7A 4CCCA 4H9VA 2Y7EA 1RXOB 5D30A 2IKIA 4UTIA 5I2UA 3WEZA 1UR3M 1PJ9A 3PZQA 2A85A 1W3HA 4M80A 1QFEA 3THCA 2X8RA 3HO8A 4IXXA 3FVMA 3NQBA 3RM8A 4NG3A 5A6LA 1BWVA 1JPDX 1TQJA 5JQ9A 1H7NA 3N19B 3ZQ9A 3ZR6A 3N15A 1EHAA 4GBUA 3EDKA 1BFNA 3RX3A 2GVJA 2GGGA 4IX2A 3OLDA 2H9AB 1CB2A 3AIEA 1VENA 3C2FA 4GZ7A 3SCPA 4GWEA 1GVRA 1NARA 5D2WA 1O66A 5M03A 2ZX5A 4O53A 3L67A 4LUYA 2PU1A 3VCCA 3W1PA 3IV3A 4ZCWA 3THUA 2J9YA 2A6LA 3ARZA 1W1IE 2JFEX 3WD3A 1MRAA 3NL2A 2ZUNA 2HVMA 1FRBA 4XB3A 3QQ1A 5CAKA 3UEQA 3OLEA 3PWAA 4QAWA 4EX4A 1WDQA 4UMCA 3L4ZA 5D37A 1KCLA 4LXFA 4HNNA 1V8EA 4KWSA 5HR6A 1CZ1A 5A6BA 3ANYA 3R4IA 4HMNA 2VUYA 3OVRA 4ZXLA 2RH9A 4CU7A 4Q8MA 3DXIA 2NQ9A 3UY8A 3GHSA 3N4AA 1UC4A 2QUMA 4A05A 4S23A 1QUMA 2BS9A 2CBJA 1XSKA 4B3LA 2WCAA 2ODOA 2YYUA 5CSUA 3T42A 3VC5A 1Z3NA 1JZ5A 4X63A 4DO5A 3GC4A 3AJ7A 4UTKA 3W75A 2EJAA 3N6QA 2G4FA 3WH7A 4AVNA 2PURA 4P2VA 2YCKX 4C6FA 1CGYA 3L0GA 1UROA 4F2TA 1XQLA 3ANUA 3LSBA 1VCFA 3APTA 3G1XA 5D9OA 2W9MA 4NU7A 1Y7VA 3LHVA 1IEQA 1A3WA 2XVNA 4RV8A 4WIWA 4HA0A 4KWUA 3VD3A 4FK9A 2C7FA 4S3BA 3WH9A 1W32A 4KFOA 5HNUA 4WXYA 4H3DA 3I10A 4I9AA 3LRKA 3SJ3A 2YA0A 3G24A 2PZ0A 1AVAA 1T41A 1C8XA 2VHLA 5A2CA 4EXBA 2WZEA 4C60A 7REQA 4GQQA 4U3CA 3RILA 3DFNA 1QWKA 1VZWA 2Y8KA 3GTNA 3IIOA 3PB2A 3COTA 1AZ1A 1XGDA 1VH7A 1KCXA 5HBFA 4UFLA 4LBUA 4E2DA 4H01A 3MSGA 5H91A 4MHBA 4AUBA 1FP8A 1RH9A 2DT2A 1JNDA 4HA1A 1J5SA 5HJLA 3OEXA 2CLEA 1VFSA 2WNQA 5GJPA 2RKXA 1QO2A 4JGDA 1JPIA 4Q6JA 4Q6XA 3WQFA 2BBFA 2NQ5A 2G50A 3NQFA 1GWJA 4AY7A 5DQPA 3C2EA 3EA1A 1R47A 1BVWA 1I6NA 2QCGA 4NJJA 3G1YA 4CU6A 1U1UA 2HMCA 2KZHA 4DNMA 3TIMA 3VKKA 3W00A 2WM0A 2VGIA 3CWHA 2P3EA 5LXEA 2WMGA 4D6GA 5C71A 3ATYA 1RQHA 1W5MA 4IOTA 2HNHA 1F9CA 3K8LA 5JBFA 2Y70A 1XFCA 1Q65A 3TROA 2J4GA 3UFYA 1GYLA 4LBRA 2ZXBA 8XIMA 3LBOA 1KRBC 2CHNA 3AMCA 9CGTA 3N14A 2NSXA 3V1HA 4XZNX 2YGYA 3K8MA 4P7NA 1DOSA 1JCJA 1YNPA 1OC5A 3LPFA 3FJ4A 3P7YA 3HG2A 2FMNA 4C7GA 2W0UA 1VIZA 5A6SA 4PUUA 3C6CA 6PTDA 4AU0A 2WHMA 3W88A 2H3DA 3CZ8A 3O9NA 3V1PA 2D69A 4RNIA 4AWSA 1CLKA 5FJOA 3EMZA 1S46A 2HXTA 5I3KA 2QVNA 3EOEA 4B4FA 3BLLA 3ITGA 3U2EA 2YDAA 2OB3A 2Q8LA 4O16A 3OODA 1TUFA 4OT7A 2GJXA 3EGJA 1V02A 4R85A 5H1WA 4IGHA 1BQCA 3CIWA 4GZIA 3XINA 2QCDB 4KRUA 3LPOA 2XIJA 3WQCA 1K4GA 3IVUA 4OJYA 1VB9A 1RLCL 4LV4A 2EKCA 4GYPA 2C6QA 4YPJA 4IL2A 2HEJA 2VZTA 3TJXA 5TBOA 1QPOA 2YCLA 4H2HA 1LDCA 2WLYA 3QRHA 4DI9A 4MAVA 3LTSA 3WDPP 3W1RA 4W8AA 2DPEA 4B2DA 3TTSA 2H8ZA 3EB3A 3KVLA 1Q6FA 4HQVA 3VI2A 4A3QA 1JVNA 1JRBA 4BWLA 5GNZA 3OU8A 1BKSA 3L4VA 5F2MA 4D8ZA 3KOZA 1FX6A 3HN3A 1KM6A 3NIYA 5LA1A 2RJGA 3VNZA 1L6SA 3O06A 3I3EA 1BWKA 1XLFA 2C79A 5HNNA 4FOKA 5DT5A 1HO4A 2G37A 2BV9A 4AD0A 3HV9A 3MTWA 1A5CA 1ADDA 2QJJA 1KM4A 5D2XA 4JFWA 4K2SA 4RDVA 3EA3A 3KP0A 2CPUA 4C7DA 1IT7A 2NW0A 1ALDA 1WZAA 4YJ5A 5I02A 5A69A 3WBXA 3MKKA 4PUDA 3QGVA 2GJNA 1W3LA 1CW2A 1J11A 1KBJA 3MA8A 2BASA 3L4TA 1SFLA 1TPH1 3E38A 4CD7A 3L2IA 5FJUA 5L6UA 2WZMA 3EWWA 4JNYA 1TPUA 2EGZA 4IT1A 5HAOA 3GTHA 2WBGA 2INFA 3TC6A 4Q4KA 4I5UA 4JN8A 4BF9A 3HQ1A 3MHFA 3ZZ1A 3BDKA 1QW8A 1VEPA 1X8FA 1L6YA 1BEUA 1EQPA 1UA3A 2QPUA 1WKFA 3TQ0A 3W07A 3HGOA 2WKLA 1A5AA 2HE5A 5I78A 4FLQA 1R3TA 1E70M 3F2CA 1N82A 4UTHA 4DB7A 3AHYA 1MUMA 1QOPA 2IXUA 2QJHA 2XJ7A 4UUIA 2VFIA 4XAFA 3VPLA 3ZFHA 2PCEA 2AMGA 1EZWA 1P7TB 1P6WA 4PUMA 3QR1A 1GOKA 1KKRA 1ODUA 1JPKA 4NZ4A 2W3ZA 4MWAB 1GOMA 2PD9A 1TPDA 1JAKA 4D6DA 4DJDC 3NUKA 3BLOA 2XN1A 1R3YA 1RY0A 4DJED 3TA9A 3E3HA 4KPLA 3H7UA 1VPXA 3NFUA 1EJRC 2GK1A 1UD5A 1Y5WA 4N02A 1OWQA 1W54A 4O13A 1SGJA 2P0IA 4YHEA 5K4XA 1VYPX 2Z1VA 4U28A 3VOJA 1U2YA 4CD6A 2BY2A 2B0MA 4NILA 4CNSA 1M01A 2PSNA 1ZL1A 2PDGA 1J2WA 3OO2A 2CKRA 1UD6A 2QGHA 3P84A 4XZ9A 1RY8A 3RLHA 3LXCA 4XZBA 1JCYA 4DYKA 4F40A 3C56A 4NAFB 4V28A 3NDOA 2FTYA 3WLIA 3WLKX 4ZTXA 4YTTA 4O54A 3L5LA 4CQCA 4HCHA 3CAVA 4K37A 1PWLA 2EO7A 3WJXA 4KRZA 2MNRA 2QULA 1Y5VA 1A5BA 3UJ2A 4J27A 2R91A 4QEHA 3O6DA 1WBJA 3L65A 5JUVA 1BRLA 3B4YA 2PF0A 3VIKA 1OD0A 3B4UA 3VZZA 1DWJM 3NSXA 1U1JA 3QZAA 5C7VA 2A0NA 3T8QA 4KFPA 4IMCA 3LK6A 2BX7A 1V0KA 2YA1A 3LM3A 4JY9A 4DBDA 3CK5A 3T40A 4PB3A 1AQMA 1YYAA 4E3TA 4HTYA 3EOSA 3KTSA 1JCTA 4QJ3B 2RGMA 3W4RA 3DBNA 1PV8A 3MWCA 4XO7A 1VFLA 3DFQA 2ABBA 5EGRA 1Q13A 4DX3A 3R11A 2YR1A 3WF0A 2VCAA 1PTAA 4QLJA 1MDLA 2CW6A 2AL2A 1BHGA 1H0IA 4GCAA 3R79A 1O60A 2D3LA 3TYAA 2CZFA 1JCNA 2CBUA 3B40A 1HKMA 1Q3NA 3P82A 3TJLA 4RUBA 1UPMB 2BGQA 1ZLPA 1YE6A 4K7VA 4BQ4A 2FVLA 1OINA 4TTGA 4PE8A 4JTDA 3AYSA 3I65A 5FACA 3LI0A 2FB3A 1POKA 4N42A 4US5A 3IJIA 4XAYA 1UP2A 2WMJA 4GFIA 1MUCA 1YX1A 2F2KA 2VOMA 2OODA 4Q32A 3VE9A 3OOQA 4UR8A 3AOFA 1PZ3A 4LY4A 5C5YA 2QJNA 1A5LC 2W61A 2GZXA 2F84A 1NJJA 2J9ZA 2PDWA 1YDNA 3HB9A 4KWVA 4OE7A 2OOFA 2ZC8A 3PJWA 2DT3A 1HVXA 2VZSA 4H7CA 3W01A 4LQ1A 2ISWA 4QBXA 1RQEA 3SSZA 4Y6GA 4YTSA 3M0VA 3NQ8A 4E2BA 3SCWA 5CSYA 1PUDA 4JR5A 3IGSA 1B3ZA 1RUSA 4PCPA 4CQDA 3PFRA 4WZHA 2CKSA 3UA4A 1CEOA 1W2VA 2ZRWA 3JZUA 4PH6A 5KSWA 4YS1A 4JKLA 3LCWA 5AZ1A 3LI1A 1YMYA 4IXHA 1GJPA 3DKLA 3UBPC 3IACA 1MWOA 3E0LA 4JYEA 1QMLA 1ISVA 3TR2A 4MJZA 3GVWA 4F3HA 2VFEA 2YBUA 2E3ZA 3QF0A 1XBYA 3UP8A 5T91A 2OWCA 2AQOA 3VIGA 5H6HA 1UB3A 2R1PA 3GBEA 2I7GA 4W7VA 2J7DA 3POHA 4JTSA 1X7FA 4JXCA 1ZZMA 1NH6A 3QY7A 4H04A 1QPQA 5EFFA 3T81A 3UERA 4OQVA 1JYVA 1KO0A 3H2OA 4ZQOA 3ITOA 3NYZA 2JGYA 1J0HA 1ZP4A 1UG6A 2VELA 2YFNA 3CQ0A 3HG4A 1EUNA 4ILSA 1MQQA 2IKJA 2CWXA 4OGZA 4Y9AA 4W86A 5K9DA 3PZVA 3VXGA 3L0KA 1NOUA 3E5PA 1V6WA 4Z2GA 4M8UA 1XYMA 1Z89A 4LSBA 4B16A 4MZ1A 2BODX 2VOTA 3ABQA 2VGBA 4ROQA 3GFZA 1I2OA 4O4WA 4E8DA 3SQMA 3R6IA 2CEQA 3WQOA 1W2PA 3NPWA 1YPFA 3D47A 3UT0A 4UNIA 1UR1A 5AECA 2XVGA 3RUBL 3UCDA 1N8FA 3RK8A 5BMXA 4MJ2A 2W4XA 1JIBA 4IJRA 5IDZA 4RV3A 1HJQA 1HL8A 2EPKX 4GUGA 3VNLA 4OTKA 4URIA 2ACSA 2QUTA 4Q4SA 4A29A 1W56A 3NL6A 3DCPA 3N2MA 1Q6QA 4UOQA 2J75A 2KAUC 2PC8A 3ZXWA 1JZ8A 5AHIA 4YTQA 1J12A 1SO5A 4W9TA 1BGGA 3MC5A 2Q09A 3ONBA 1QCWA 1T8XA 2PP3A 4PULA 2GJLA 7REQB 3VOHA 2OYLA 3S1VA 3HG5A 1U1HA 3A22A 2V2CA 2ZUTA 3VK5A 4KCWA 4Q8NA 4J3ZA 1KFKA 3LN3A 4ORMA 5G2IA 1BYCA 5EMLA 4RZ6A 3GM8A 1LF1A 1J0IA 3PF3A 1K77A 3HQPA 3IJQA 2BY1A 4GGBA 2E67A 4H6KA 5E0FA 3OZPA 2E9BA 2GUYA 3SQSA 4M51A 4HA4A 2YL5A 3EWYA 3PTMA 2A7PA 5IDIA 4KWOA 1QI2A 2R1LA 2X2GA 3N4EA 4LCSA 4JHOA 1KFEA 1VCGA 1EDQA 2BGNE 4ZO8A 3U7VA 3E0VA 4JL2A 2ZRVA 4V1XA 2YXGA 2B7NA 4H7VA 2OSWA 2FHCA 1XIDA 1VF8A 3A9BA 4NIRA 4YU1A 5FJPA 3VGHA 3QTPA 3UCCA 5JMUA 2DZXA 4UQDA 1YTDA 5I3GA 4KESA 4CVUA 4ZXOA 3JUGA 1EIBA 1CGTA 4KEVA 1TJ1A 2WANA 4FMVA 3OGVA 1OFPA 3DIPA 3DG7A 2VGFA 5ABEA 1F8MA 1RZMA 3MMDA 3LDVA 3W1XA 3SR7A 3AUJA 3S2LA 1H7PA 3DERA 1FY6A 1Q7QA 4PMDA 2VWTA 3FYPA 3WLMA 1JD7A 2ZX8A 1MW2A 4WGHA 1GPWA 3RHGA 2E5BA 1JUEA 3W2LA 5AB3A 3FAXA 1RHCA 4AIBA 3W1LA 3QLLA