1V03A

Crystal structure of the sorghum bicolor dhurrinase 1
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
487
structure length
487
Chain Sequence
IHRLSPWEIPRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKGVEYYNKLIDLLLENGIEPYITIFHWDTPQALVEAYGGFLDERIIKDYTDFAKVCFEKFGKTVKNWLTFNDPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHIDLSPNNSPVLNTDDAYASQETKGPDGNAIGPPTGNAWINMYPKGLHDILMTMKNKYGNPPMYITENGMGDIDKGDLPKPVALEDHTRLDYIQRHLSVLKQSIDLGADVRGYFAWSLLDNFEWSSGYTERFGIVYVDRENGCERTMKRSARWLQEFNGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DHURRINASE
publication title Structural Determinants of Substrate Specificity in Family 1 Beta-Glucosidases: Novel Insights from the Crystal Structure of Sorghum Dhurrinase-1, a Plant Beta-Glucosidase with Strict Specificity, in Complex with its Natural Substrate
pubmed doi rcsb
source organism Sorghum bicolor milo
total genus 188
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1v03A00
4OBSA 5AC4A 4MB5A 4YN5A 3SURA 4HZ7A 4MNKA 2J62A 4QLKA 4D6JA 1CPUA 3CUGA 4J28A 3E1F1 3W81A 2E8YA 3VUPA 3WD4A 1UOKA 3ZJKA 2WXDM 3A4XA 4FLSA 2WKGA 1N82A 3RCNA 4J3VA 1E71M 5BRPA 3DYMA 4CU7A 3RM4A 1PIGA 4WKHA 4IM4A 2BY0A 3MSGA 4CD4A 2VCBA 3CPUA 1AMYA 4Q22A 3W28A 1JXKA 2E9BA 2TAAA 2J7HA 3AIRA 5I77A 4AZCB 1UH4A 2XM1A 2WMIA 2JEQA 3ZSSA 1E1FA 4P8XA 5I5RA 2BHUA 4PMZA 4EKJA 4D6DA 4TX6A 1HKKA 3AIWA 2CERA 1E56A 3CGTA 4F9JA 1PJ9A 3N04A 3ZIZA 3SCOA 3EYPA 2C7FA 4M8UA 4Z2KA 2CBJA 1SFSA 1MW0A 3VMOA 3WH5A 1LF1A 1JG9A 1UHVA 1UWQA 2QF8A 2GDUA 1H2JA 5JBDA 2QPSA 1L8NA 4ZE4A 3W26A 1GHRA 4LYRA 3WDJA 4TVCA 3VNZA 4W5ZA 5EBAA 4WKAA 1JNDA 1UD6A 1UZ4A 1OB0A 5F7UA 3GTNA 5GNXA 3KEHA 4P7LA 2W62A 4D71A 1NWSA 3CZEA 1ZJAA 2WWDA 3HMCA 1P6WA 1PZ3A 5I3DA 1B3VA 5CJ5A 4QDMA 1V08A 4ZENA 1X6NA 2WVVB 1B9ZA 3ZM8A 1TMQA 5C70A 1W3JA 5IXEA 2AAAA 1CLVA 1CXFA 3WFZA 1S46A 1GZJA 1HJVA 1BVZA 1C8QA 5C71A 1GORA 2V3EA 2WHLA 3F4VA 5BROA 3WELA 1BLIA 1OT2A 1VFUA 5I24A 2J78A 4UFJA 1E0VA 2A3AA 1V03A 1B3WA 4OIFA 2J7CA 4JL1A 4NSBA 3WNKA 2EPKX 3PBGA 3RDKA 3CUFA 1CXIA 3AXIA 2VRJA 4W88A 2OYLA 1XV8A 2DPEA 1GCYA 1UKTA 2V38A 1HKMA 2VI0A 2FH8A 2ZUVA 4XV0A 2BY3A 1GQIA 4QCEA 3TTOA 3RMEA 4C7GA 3WEMA 1QI4A 1BAGA 1VEOA 3WFLA 4E8DA 1U2YA 2FHCA 4CCEA 4HMDA 4W84A 3WQ6A 3AROA 4PBGA 1C92A 3I3BA 3CLWA 1WCGA 4MDOA 1W9UA 1GONA 4B9YA 4GZIA 3VX0A 1JF6A 1E55A 1TG7A 3RJXA 1J0JA 2OSXA 3OGRA 3BAWA 2CHOA 1DTUA 1M04A 3EDKA 2YL9A 2PB1A 5A2CA 4ACZA 2FGLA 1R87A 4JKMA 3TA9A 3CHCA 6CGTA 3U7VA 3VNYA 3NCOA 3BAJA 2D0HA 5KEZA 3K8LA 1QNSA 2PI6A 2J8FA 3UETA 3ZJ7A 1E0XA 1DWHM 2VQTA 2PWEA 3CZKA 2OSWA 4QP0A 3BSHA 4W85A 1B1YA 1KCLA 4B15A 3VD4A 4MJ4A 2YIHA 3SUSA 1WZLA 1JD7A 2PWGA 2XWDA 1G9HA 3OZPA 3M46A 2GK1A 1JDCA 5BYWA 3U7BA 1G5AA 3PZNA 2YL8A 2A3HA 4AYSA 3GXFA 1Q6DA 1XH0A 2XVGA 3MU7A 1W3HA 2BNJA 1KBKA 4CVUA 1V0MA 4HOWA 5GPRA 2WWCA 5A8OA 4EK7A 2HISA 4CD6A 4UFHA 2XTKA 1CGVA 1LLOA 3T08A 3UR8A 2W66A 4MNMA 4JCMA 3EDEA 4ZE5A 1UQYA 4S3JA 1CXEA 1V3KA 1HF6A 2EPOA 2WMIB 3WF3A 2D1ZA 2J25A 4IUGA 2YBUA 3DYPA 1VB9A 2J47A 2BHZA 2G3IA 4W7WA 1JZ7A 3PTMA 2WHJA 4NI3A 1BPLB 3OB8A 2AMGA 1ITCA 3B9AA 4PMXA 4TXEA 1ISWA 2VURA 4MNLA 4NRRA 3W38A 2XVLA 1TR1A 4YPJA 4XB3A 1LL6A 2UY3A 2OYMA 3ARZA 3MANA 2WPGA 4PSPA 1QI0A 4UQDA 3AYRA 1J0KA 2F61A 2VRKA 2IUZA 2PBOA 3OLEA 4U31A 2WB5A 1C8YA 4AIOA 1KGXA 2O92A 2VX7A 4KGJA 1HT6A 2QLYA 2XVNA 2BVYA 1HJWA 4TX8A 2CESA 4D6GA 5EFFA 4D6IA 3W24A 4RL3A 2WC4A 2X09A 4HU0A 5CXPA 1UKPA 2WM0A 4Y7EA 3THDA 3W29A 4BF7A 1TZ7A 1QHPA 4R5EA 3WN6A 1VENA 3WNOA 3WD2A 3PZQA 2BVTA 1UD8A 1FOBA 2CBVA 8A3HA 2XPKA 2DIJA 2CETA 2WAGA 4L4OA 5E9AA 2GVYA 3FY1A 1W91A 4CKQA 4UQEA 4L4PA 1V3MA 5LYRA 3MS8A 2MANA 1KFWA 4AD4A 1PX4A 2WMHA 4AIEA 4TTUA 1W1PA 1V6WA 2VZUA 1GVYA 5CLTA 4AZCA 4ATWA 2V3FA 1XH2A 3CHDA 1WE5A 4MB3A 1QVBA 2WMFA 2CITA 1JZ2A 2XSBA 3TP4A 2D0FA 3OZOA 5FD0A 3ZT5A 4AZBA 5CGTA 1ISXA 1FH9A 2VX6A 1JI2A 4MB1A 3I3EA 4D6CA 1FP9A 1Q4NX 9CGTA 3CHFA 3SCUA 3VGHA 2VCAA 1VEPA 5GNZA 5CSUA 2VR5A 1QOXA 4MNJA 1XSKA 2D3LA 2YBTA 1J0YA 2OSYA 1HJUA 4M56A 1UR0A 3NSNA 3FHAA 1Q6CA 2WBKA 4CVWA 2GFTA 3WQWA 1ZS2A 4ACZB 4W8BA 1OSEA 1UR8A 4AC1X 3ARWA 2PC8A 2XJ7A 2WZHA 3N15A 5CQ1A 3WD1A 3KWXA 3NJ3A 1QI5A 4P7RA 1EHAA 1B3YA 1V02E 1OM0A 1CZ1A 4H8UA 1BYBA 3VIOA 3VPLA 4GZJA 4HMCA 2YA2A 1CECA 1BGGA 2GK1B 3ECQA 3L4YA 5CLWA 4C7FA 2PWFA 2Q8XA 2X2YA 4MB4A 4AD3A 1C90A 2EQDA 1VFFA 4UTFA 1EDTA 1Q6GA 2IXUA 1EGZA 5CPSA 2EO7A 4KGLA 3AXHA 2X8RA 3ZR5A 4DUVA 3L4WA 2ZWZA 2DT3A 4JCLA 2WC3A 3RPMA 2Y5EA 3CZ8A 4AZHA 5FCZA 1J0ZA 1ZJBA 3AHYA 3PZTA 7A3HA 1ZBCA 1C91A 3W82A 6A3HA 1EQCA 4CD8A 3AIVA 4YHEA 5A6LA 4MAZA 3B8SA 1UD5A 1E4LA 2ZOXA 2ZIDA 2XM2A 3WF1A 1XHGA 2W61A 3OA5A 1V6YA 2CKRA 2VCCA 7CGTA 3T2PA 4DM2A 2CPUA 2WW5A 5D9MA 1ODZA 1HJQA 5A2BA 1NP0A 2XWEA 3ARVA 1VRXA 2EPMX 1CGTA 1JDDA 2A3CA 2ZX8A 4HA4A 4V27A 2XFRA 2DGAA 2V3DA 4ZXOA 4JKLA 4TVUA 1HJSA 5HPOA 4FF5A 5D4YA 1WZKA 2PF0A 2WMJA 4U33A 1KQZA 4TVDA 2WVSA 2EPNA 2J8GA 3WF2A 4W8LA 1XD1A 1OT1A 1KXVA 2ZUTA 1E73M 5HOSA 4RE3A 5HDRA 1J0IA 1C8XA 2BV9A 1VJSA 4M1RA 5CG0A 1VF8A 5A6BD 3SCTA 2VC9A 3WUBA 1A3HA 1WAWA 3EMZA 4U3CA 2G4FA 1LJYA 4WJXA 3VDBA 2UWFA 2J7DA 4H8HA 1IV8A 3GBDA 2VZSA 3BAKA 4CN1A 2DQXA 2DT2A 4F66A 2YDQA 2NSXA 3NSXA 3CBWA 1WZAA 3N13A 5A6AA 1JZ8A 1DWAM 3PZ9A 3DHUA 4GI6A 3L4XA 4JAWA 4UQCA 4P8WA 1BG9A 5DO8A 5A6BA 1EO7A 5HPCA 3W6MA 1GOIA 2XUCA 3ZT6A 4Z2JA 5FIPA 1GOWA 1AQHA 2VX4A 3ZR6A 4CN4A 2E4TA 1EXPA 4AY1A 4OUEA 1ECEA 5A8NA 2YKKA 3WNPA 3T2QA 3WKZA 5CGMA 4MJ2A 5A6SA 1HL9A 2J79A 2ZE0A 3I3DA 3W6LA 4J3WA 1HX0A 2J7GA 1TFVA 4XZWA 3CTTA 2BHYA 1Q6FA 1KQYA 3OLDA 1E6ZA 1ZBKA 5M5DA 1OCQA 1GNXA 5A2AA 2Y8VA 2XVKA 1GPFA 4QAWA 3AISA 3AMDA 7TAAA 2FDMA 3FW6A 3BXWA 4HOXA 3ZSTA 5BXPA 3VDCA 1VEMA 1UWRA 2G41A 3L2MA 3ZOAA 1H3GA 3W0KA 4WSKA 2XGIA 4KMQA 4M24A 1E6RA 3OG2A 2F2HA 1CGYA 1J10A 4Z2LA 3ARQA 2V3GA 4LGXA 1E1EA 1TVPA 4J3XA 3IAPA 5E6YA 4B3LA 4GINA 1H11A 3ARTA 1ODUA 1HIZA 1RP9A 4JFTA 2ZUSA 1GW1A 1FA2A 4KRTA 3WBAA 2ZWYA 3AHVA 4N42A 3MKKA 1J01A 4OOUA 2WBGA 1KBBA 3VU2A 1KXHA 5E09A 2D3NA 2VR4A 4ACYA 1PAMA 3VX1A 4X9YA 2O9PA 2FHBA 4P7QA 2DIEA 1UD3A 1XSIA 3KE0A 4DWSC 2ZUMA 2XGBA 1I1WA 4A4AA 1KWKA 1GUVA 1E6QM 4PMUA 1E72M 3OBAA 4PCTA 3SCSA 4J27A 1BYCA 1QNPA 4LYQA 2ZUUA 1F4AA 3ARSA 2Y8KA 2VJXA 3AI0A 1DEDA 3CZJA 1G01A 3VKKA 3T0AA 3KZSA 1FP8A 1FFQA 1H0GA 4BA0A 1W9XA 3POHA 4DM1A 4PN2A 3FAXA 1QHOA 2W91A 2CBUA 5FOOA 4UQBA 5I2UA 1CXKA 3A4WA 1H49A 1H09A 4A3HA 1QW8A 1JL8A 4K68A 1H4PA 1U33A 3N1AA 1HP4A 2A3BA 1JZ4A 3CO4A 4U3AA 1KR1A 3WSUA 3WH9A 2VZVA 1LWHA 3N9KA 1QPKA 3F5KA 1KXTA 4F79A 1PPIA 3B9EA 4AD0A 3K4AA 4TTGA 4Z2IA 4FK9A 2XVPA 1VJZA 2QV4A 3VD5A 4H8VA 2EBNA 2VX5A 3J7HA 4HA1A 4D6FA 1CEOA 1CIUA 1E9LA 2DT1A 1UR4A 2X1IA 4PTWA 1KWGA 1QBAA 2C0HA 2CCRA 3VTRA 4UOZA 1KGWA 5A6MA 1C93A 1JIBA 1UKOA 4CCCA 2ZUWA 4UNIA 5DMYA 3ZO9A 3A4AA 3IAQA 2ESCA 4OBRA 3EMCA 2J77A 2BY2A 4GQRA 3QOMA 1HKIA 5BXTA 1ZU8A 1G1YA 3LPPA 8CGTA 1KR0A 1L0PA 2DEPA 3NYDA 5DEZA 1XC6A 2D22A 4P8UA 1CLXA 1GVIA 1E6PA 1UWTA 4KH2A 4DWSD 4ATLA 2E9MA 2VNCA 2YJQA 1UWUA 1UZ1A 2WMGA 2WZEA 3WDHA 3QGVA 3T2OA 3UG3A 1V02A 2QPUA 3WNMA 4AZ7A 1W1YA 3IANA 5HXMA 1R7AA 3AZTA 1B3ZA 2VQUA 2DT0A 2XYLA 3RM9A 3GXMA 1HKJA 1OBAA 4CD5A 5GQBA 3RIKA 1UH2A 1EDGA 3SCVA 3VM7A 4DUXA 1CYGA 5FL0A 1OGSA 4AZIA 1NWUA 4JFSA 4E2OA 1C7TA 2E8ZA 2NT0A 2PWDA 4H2CA 4GI8A 3ZJ6A 3OIHA 2WHMA 3N17A 1OD8A 1WZMA 1BG4A 1CXLA 2E9LA 2JFEX 5E0CA 2YL5A 4N0RA 4OJYA 2X05A 4MPKA 3WIJA 3WQ5A 2XSAA 1MQPA 3SCWA 2GJXA 3MUAA 4AIUA 3AHZA 1K9DA 3EDDA 4CGTA 3WUGA 5ABGA 1LG1A 4JHZA 1R86A 1O7AA 1JI1A 4ML4A 2WHKA 2CKSA 1W1TA 5JBEA 3BC9A 1EIBA 4M81A 3WBEA 4RE2A 1W3LA 4IISA 3W27A 3SUWA 1V6XA 4KWUA 3KL3A 3GXDA 4Z2HA 2Y4SA 1KXQA 4D1IA 3WEOA 2WLYA 1E5NA 3OLIA 2JE8A 4W5UA 1IZKA 1SR0A 4PCSA 4URIA 2X0HA 3EDFA 1UR9A 2Z1SA 1TCMA 3II1A 2WSKA 4XX6A 4LX4A 1EA9C 1LG2A 3GM8A 4HMEA 1MXGA 4W89A 1OINA 4M29A 1QBBA 4AW7A 3CUHA 2V5CA 3PZGA 5IFTA 3UCQA 4F8XA 1C3FA 3VINA 2YLLA 3WDQA 3O2LA 3K8MA 3N18A 1K6AA 1AQMA 4BQ4A 3FXYA 3S2CA 4F9DA 3CUJA 3POCA 4MTVA 1JD9A 1BSIA 2YL6A 3MV11 1UR2A 2J7FA 5FKYA 2GSJA 4UQ9A 3ARYA 1YHTA 1ISYA 4A3YA 1H5VA 3SEPA 4GI9A 1LL7A 2Y2WA 1GOKA 1CGUA 2XFFA 3W25A 2QMKA 4BQ5A 1CNVA 1XCXA 4UQAA 4UFKA 4MDPA 3QHNA 1WB0A 6TAAA 3QHMA 5D8WA 5JBFA 2ZXAA 4CUCA 4PSRA 4AISA 1U30A 5A6JA 4EANA 2FGZA 3CUIA 3SCNA 4HTYA 2YOCA 1UD2A 3WNLA 5BWFA 5EB8A 4PMDA 4Z2GA 1B3XA 4UFMA 2D23A 3W4RA 2WVTA 3AMCA 3D5HA 1M7XA 5AYIA 3ZJ8A 4HU8A 1E4NA 1GQJA 2DDXA 2E0PA 2FH6A 4LQ1A 3M07A 3K8KA 4PMYA 5HNNA 1GQKA 1E6XM 3UERA 1OGBA 2RGMA 4WIWA 2IXVA 4PUEA 3SCQA 2VTFA 3WQ4A 4U5KA 4W7VA 3SCRA 1CTNA 3G6MA 1JNEA 5IHSA 4WKFA 1GQLA 4TOQA 2BXYA 5CPTA 5D8ZA 3WUFA 5E0FA 3HJEA 5CSYA 4E8CA 1Z32X 4PMQA 4W87A 1OIFA 1E15A 1WNOA 3AICA 2XIIA 2UY4A 1PZ2A 1US2A 3QHOA 5JUVA 1NOWA 1XYZA 4CU6A 5BXRA 1QI3A 4AEEA 1MXDA 1JZ6A 5EMYA 3NDZA 3PTQA 1VFMA 2X0YA 4QCFA 1RD6A 2YLAA 1G0CA 1V0LA 3MMWA 1FHLA 4JKKA 5I78A 3GXIA 2VZTA 4PMRA 3VD3A 3B9DA 5ABHA 1E0WA 2WVUA 4U5IA 4PYSA 1XSJA 4GIAA 3AIQA 2OYKA 1K9TA 4DWSB 4H7VA 1PEZA 1V3IA 3VOCA 1UA3A 1EO5A 3BCFA 1MWOA 5A69A 3AS3A 4KRUA 1AQ0A 1TVNA 4GKLA 1H0IA 3UG5A 1OGGA 2J75A 2BS9A 1EOMA 3RM8A 1KB3A 5D9PA 1SMDA 3VILA 1M03A 1W9DM 2XG9A 2WYSA 3UG4A 2JIEA 1RPKA 3WL0A 3AJ7A 1JDAA 1CGXA 5BCAA 1FHDA 2EXOA 4GPNA 4M80A 1EOKA 2GJXB 1UUQA 3BLKA 4FMVA 1EH9A 1QHZA 3TTQA 4AEFA 1TUXA 2BVDA 1FFRA 3AZRA 2W92A 1WDRA 2DSUA 5LA0A 1NM9A 1LQ0A 3N11A 1WDSA 1US3A 5LA1A 1B31A 1NWRA 2UY2A 5TD4A 1B90A 1MW3A 2WCGA 3U5YA 3WH6A 5FL1A 1EHNA 2YDRA 1E4IA 4OKDA 3LMYA 4IPLA 2A3EA 2W67A 3GYCA 3PZVA 3VO0A 1MW2A 1UYQA 1MVYA 4PMNA 4AZ6A 4BQ3A 4PMVA 3FHQA 3BLPX 3MO4A 5A8MA 4CU8A 3BH4A 3WF0A 5A1AA 2OWXA 2PWHA 3T09A 1ESWA 4AWEA 5M17A 3VD9A 5ABFB 2JIWA 1HVQA 3MUZ1 2G8ZA 3UR7A 4MADA 3AOFA 5D9NA 1I75A 1W9BM 1CDGA 1DP0A 3TTSA 2HVMA 1D2KA 2WNWA 3GBEA 3TTYA 4HP5A 2V5DA 3L4ZA 2WZIA 5IHRA 1H41A 3VD7A 3ALGA 4QLJA 3VIKA 3T0BA 1K9EA 5CZKA 2DH3A 3VM5A 5IFPA 1E5JA 1JYNA 1EDQA 4PRWA 3WQVA 1GJUA 3CZGA 1BGAA 2O9RA 2CXGA 4AD1A 1VBRA 4JZ5A 2WLZA 1MW1A 2GJRA 1V0NA 1A47A 4EAMA 1V3JA 3AMGA 1CWYA 1JYXA 5DT7A 3CMGA 3DC0A 1HNYA 4GQQA 3JUGA 1B2YA 2WSPA 4ZXLA 4UOQA 3EMQA 1J9YA 5BRQA 5A3HA 2QMJA 1UR1A 1OWQA 3HU7A 2G3JA 3VIJA 5GNYA 2J7EA 4BCEA 1ZL1A 3QOKA 1RP8A 4HZ8A 5M3WA 3VIPA 4RE4A 2D2OA 1CENA 3VGDA 1OD0A 1XCWA 2FHFA 5I6SA 3WUEA 4J7RA 1E40A 1WPCA 5I0DA 4CD7A 4PMOA 3BAIA 2Z1KA 4WLCA 1F4HA 3ARUA 4JFUA 3PN8A 3AFBA 3T0DA 1UD4A 3AS1A 3THCA 2YA0A 5E6ZA 3AS2A 1X6LA 2J7BA 3VIGA 4JIEA 2BFGA 1JAKA 4AZGA 1NARA 3SUVA 2D0GA 3U57A 1KGUA 3BGAA 3WD3A 2WC7A 1W9PA 5M03A 4E4PA 3VIIA 4GO8A 4EE9A 1ISVA 3QR3A 4HOZA 1DWJM 3WENA 2RGLA 2OLHA 1ZBVA 2XHYA 3WQ8A 2CNCA 3M6DA 1XYFA 3CZLA 1WDPA 5AYBA 4BQ2A 1IT0A 3WH7A 1XRVA 4XZBA 3OLGA 1XD0A 3A6OA 3AIEA 1BVNP 1QI2A 1UH3A 4AD2A 4OOZA 1XH1A 4CCDA 1PIFA 4U2YA 1GJWA 3GNPA 2PBGA 2D20A 3AIBA 2C8NA 3WNNA 5A94A 4TUFA 1CBGA 3AZSA 1BHGA 1E4MM 1VFOA 2O9OA 2ZXBA 3AQUA 1JFHA 1JF5A 4P7NA 2CYGA 3FN9A 3FAWA 4LYPA 4GZEA 3VIMA 3VDHA 4M82A 1W3KA 1UG6A 1V6UA 4UR9A 5ABEA 1EQPA 1Y7VA 1FH7A 1TA3A 3CHEA 4AXNA 4JHOA 3IK2A 1E6NA 1RH9A 2VRQA 3GDBA 3BCDA 3D3AA 3MMDA 2JF6A 1H1NA 2VT0A 3W53A 4PTMA 3APGA 1R7OA 4UZSA 3VGGA 3NIYA 1JZ5A 2EPLX 4PTXA 2OWCA 4H04A 1HP5A 3BMWA 1DWFM 3BSGA 4HZ6A 1E70M 5IDIA 3UEQA 4QFUA 5D9OA 4D72A 1DHKA 4BS0A 3F5LA 2JF7A 3A47A 3ZQ9A 4GO9A 3UESA 2ZX5A 3LPOA 1JAEA 2B31A 3GH4A 3K46A 1W32A 2WCAA 4UFIA 1V6VA 3CH9A 3EDJA 3ZT7A 4JL2A 4B16A 1MQRA 3RILA 3TOPA 4B9ZA 2CBIA 3L4UA 4DWSA 2GDVA 4MAVA 1W2PA 4FLRA 3IJ7A 1FH8A 5LA2A 3O9NA 5A8PA 4D6EA 5HBFA 3LPFA 4V2XA 3WD0A 3AMKA 3WMCA 1E3ZA 4UZUA 3PZMA 1MYRA 3KL0A 3RJYA 1HL8A 3O6AA 1UWSA 3FNDA 3ARXA 1VIWA 4P8VA 3F5JA 2Y24A 3AYSA 3SIMA 2ZXQA 2ZICA 5AC5A 2O9TA 3VMPA 1YQ2A 4X0VA 3VDAA 4J3TA 5A8QA 2VL4A 3AXXA 4QLLA 1V0KA 1V3LA 2ZX6A 3AHXA 1NQ6A 2G3NA 5AY7A 1BF2A 2EJ1A 3NUKA 3VIHA 1JYVA 1QNOA 1WO2A 3PTKA 5E70A 3VMNA 1W9VA 3N12A 1ZBWA 1V3HA 1JXJA 1JGIA 1C7SA 4BZYA 3ARPA 3BAXA 3WMBA 2JALA 2J74A 3W37A 2DH2A 2NT1A 5JIWA 1I1XA 1JYWA 1R85A 2E40A 4YHGA 2XFYA 4WK9A 3WL1A 1J11A 1B30A 1HN1A 2NW0A 4AZ5A 2YA1A 2VVNA 1JFXA 4X0NA 3M7SA 5ABFA 3PZIA 1B0IA 1ISZA 5DF0A 3OGVA 3ARRA 4W93A 3L4VA 1GOQA 4DUWA 2J4GA 1NOFA 5EFDA 4HPGA 3WMSA 4B3KA 1E3XA 1O6IA 3GNOA 2E3ZA 4PUDA 3DECA 2YDSA 3L2LA 4UCFA 3VVGA 3WF4A 4P7OA 5DT5A 1UA7A 2ZX7A 2DSKA 3PZUA 2JEPA 3RO8A 3S6TA 4V28A 3CIVA 4NRSA 4U2ZA 2CEQA 3MMUA 1J18A 4AMCA 2VO5A 4H41A 4PTVA 1ITXA 1VAHA 2GJPA 3U5UA 4CN6A 3VGEA 1LWJA 2VZOA 1IZJA 1Q6EA 1LL4A 3NDYA 1J12A 2WKLA 5I79A 2W63A 3GZAA 4W86A 3TONA 4NZCA 3GH7A 1NWTA 2GUYA 2WMKA 2DSVA 5A95A 1HXJA 1DWIM 1TA3B 3K1DA 1NOUA 3WEZA 2ZXDA 3GH5A 4D1JA 3WDRA 1W2VA 2G3MA 2VUYA 2AOSA 1NH6A 3LPGA 3VGBA 3A3HA 3SUUA 5KZ6A 4OZOA 3SUTA 4HPHA 4JFVA 1QNRA 4AD5A 4WF7A 5A6KA 2WVVA 1AVAA 2F8QA 1R8LA 3EBVA 1HVXA 1BYAA 4PEEA 3BAYA 1D7FA 1CXHA 3DHPA 1GHSA 3MUIA 1HJXA 1KCKA 4J3UA 1BTCA 3AMLA 3DYOA 1QNQA 1BYDA 3WDIA 1WDQA 3AIUA 2VMFA 1K9FA 3K4DA 1UKQA 1JZ3A 2DSWA 1E43A 2CHNA 3BMVA 3CMJA 3WDPP 2VOTA 3MV01 1OIMA 4XUYA 2XIBA 1GOOA 5JIPA 4ATDA 4GXPA 4Q7NA 2BY1A 1M53A 4W7UA 3MSDA 3ZMRA 1NP2A 2W5FA 3WY1A 1SMAA 1G94A 4UFLA 2EEXA 4LXFA 1W1VA 4JFWA 4D6HA 1ZB5A 3PHAA 4ZFMA 5CPQA 1J0HA 2CIPA 4LPCA 1BFNA 4J3SA 2VVSA 1CGWA 1UKSA 3VIFA 3VGFA 1PX3A 3NSMA 3IJ8A 1D3CA 4IPNB 4R27A 4S3KA 3AS0A 4W8AA 1GOMA 1DWGM 3G6LA 1X1NA 5C8BB 4ZEPA 4UOJA 1WKYA 3HN3A 1XGZA 2D24A 1MFUA 1QW9A 2WCSA 1UWIA 2OWWA 4WSJA 2UY5A 2WK2A 4HA3A 1VBUA 3GNRA 2ZX9A 2QHAA 3IJ9A 4FLQA 1MFVA 4FLOA 1M01A 3WH8A 2WANA 5I23A 4C7DA 1SYTA 3MUY1 1PBGA 2BXZA 4NF7A 2DSZA 3OGSA 1MQQA 1BQCA 3AHTA 5BXSA 5ECUA 1PX8A 3PZOA 2W4XA 3SCPA 3ALFA 1UQZA 2ZUNA 1E6SM 1TE1A 3KL5A 3L4TA 1WP6A 5DFAA
chains in the Genus database with same CATH superfamily
4OBSA 3THAA 4MB5A 1TJRA 3NQ6A 4DXXA 3DFQA 4J28A 3E1F1 5CKSA 4YWSA 1FTXA 2C19A 3WD4A 3S1VA 3A4XA 3LN3A 4CU7A 3RM4A 3B0YA 4NZ5A 2VCBA 4B5NA 2OVLA 5AHEA 1GEHA 1JXKA 5H8PA 2E9BA 5I77A 3QR0A 2XM1A 1ZPTA 2JEQA 1E1FA 3VZZA 4D8ZA 1A3XA 2J24A 4D6DA 2CERA 1F61A 1PJ9A 4Q4SA 3N04A 4GY1A 3EYPA 5C54A 3P5YA 1MW0A 5HNRA 1JG9A 2GDUA 4PTNA 5LIUX 5JBDA 2QPSA 1F3WA 1GHRA 1ZRQA 1QK0A 4JEQA 3LCXA 1JNDA 5F7UA 3IGXA 3GTNA 5GNXA 2W62A 2YDAA 3ITOA 1NWSA 3CZEA 1LRNA 2ZRVA 3NEHA 4RW3A 4RKAA 2O56A 3RCYA 1DORA 5EBUA 2YCIX 5BU6A 5I3DA 1W1IE 1ZCCA 3W83A 2GJLA 4G1KA 1S3HA 4QDMA 3GFYA 4ZENA 3ZM8A 3TOYA 1W37A 1PXGA 3VNIA 2AAAA 4UXDA 1GZJA 1HJVA 4OTKA 1BVZA 1ME8A 1TWIA 3PF3A 1BLIA 3UVIA 1TPUA 1RCQA 1VFUA 4CNNA 3QW3A 1OCNA 3HURA 1B3WA 3UWQA 4YVVA 3WNKA 1T5AA 1OF6A 2EPKX 4JN7A 2VFGA 4F2UA 2V38A 2I5QA 3AYTA 3NQBA 3R0DA 1YX1A 4QCEA 1EP2A 1MI3A 1BAGA 4WSHA 2IW0A 1TVLA 2FPVA 4E8DA 2FHCA 4W84A 1EJSC 5D2WA 3AXMA 4LUIA 4Q32A 3TCEA 3I3BA 1FWTA 4HMNA 1W9UA 3P74A 4FOUA 4GZIA 4Y6GA 1XQKA 3HV8A 4FXRA 3MP5A 1J0JA 4UB9A 1KRBC 3OGRA 3QMRA 3BAWA 3JW7A 1VFSA 3ABQA 3FVMA 3W7OA 3GSMA 4JKMA 3UXDA 3CHCA 6CGTA 1A53A 3U7VA 2D0HA 3GR7A 4G56A 2J8FA 1A5BA 3HGRA 5DLCA 3BSHA 5C7VA 4W85A 1EX5A 3M0IA 3QFWA 3TLQA 2PAJA 1WZLA 2PWGA 3BDKA 3OZPA 4U28A 2G95A 2YL8A 4C1NA 4X61A 1XH0A 3GHTA 2ZC1A 1HTIA 3TYUA 2J8TA 3IJLA 2D2JA 5H6HA 4HOWA 1XW8A 1ZNNA 1SPQA 4CD6A 3M5XA 4F40A 3D46A 3MQTA 4HSOA 3M0HA 4QDWA 2XTKA 3NTYA 1LLOA 4KEMA 3KWSA 3T08A 4ZQOA 2W66A 1ML1A 4ZTXA 3UQNA 4MNMA 3R8GA 3U2ZA 1FWCC 3LY0A 2Q3RA 4S3JA 1CXEA 2PDPA 1FUYA 3DKJA 4PUWA 1W1B1 2FVKA 3DYPA 1VB9A 1Q2RA 4M6VA 3OB8A 4AWUA 3B9AA 5DBTA 5EGRA 3P14A 2VURA 5I3JA 3B40A 1TR1A 4IL2A 4A8RA 9XIMA 3LCIA 2UY3A 5DCBA 2OYMA 3G0UA 2WPGA 4AEOA 3BQ6A 3G1FA 3AYRA 3D3FA 2WB5A 4UCGA 1C8YA 5HWNA 3NO5A 4DXKA 5C9ZA 1S5MA 2PP0A 2QLYA 3GKFA 1XIEA 4CEXC 1LM1A 4LS1A 1Y5XA 1XPYA 3PB0A 5EFFA 4QE1A 4MY1A 3W24A 4RL3A 6ENLA 3W01A 2X09A 3GXNA 4R7OA 4ORMA 5CXPA 2V9DA 2WM0A 3IVUA 4JTAA 1I6NA 1WKFA 3MBDA 1ZQ5A 3CPGA 4M6PA 3TW9A 2HVOA 3WNOA 4G2DA 3BVJA 2E5CA 1SVDA 3W7RA 4QJ3B 5I06A 4YJ5A 5FJRA 3AUOA 2XPKA 2DIJA 2WAGA 5E9AA 3TA6A 4M6UA 5AHMA 3TKFA 2QEZA 3O6CA 3G5EA 2ZADA 2MANA 1KFWA 2TSYA 4YU1A 3V75A 4AD4A 1K8XA 5D2YA 1W1PA 4Q4OA 1KCZA 2V82A 3M43A 3ZLFA 1AUSL 1QPQA 3S9ZA 3CHDA 1WE5A 2WMFA 4QE4A 2CITA 1W5QA 1VRDA 3DGRA 2YB4A 3EWCA 1JI2A 4MB1A 1FP9A 1SZNA 3TJIA 3P81A 3RHGA 5AVNA 5GNZA 2CLLA 3MKCA 3CAKA 4H01A 1XSKA 2D3LA 4HNVA 1UR0A 4JD4A 3NSNA 4LOCA 5DCEA 1Q6CA 1H7XA 4GHRA 1ZS2A 1R3QA 2UV8G 5LNVA 1RXOB 3NQEA 3T05A 2E6YA 4BF5A 1XBVA 3QLLA 5CPOA 3DENA 2EGZA 4L1GA 5BU9A 2XJ7A 5CQ1A 4P7RA 3AAMA 1EHAA 4EF8A 1V02E 5CZTA 4UMCA 3BURA 1OM0A 1CZ1A 3P61A 4F2TA 4H8UA 3UWUA 1R2SA 4GZJA 2YA2A 2EKCA 2ISVA 3F4WA 3C3UA 3LOTA 4AVNA 4C1NB 4AD3A 2H3DA 3ZYZA 1DV7A 1GWJA 3CQIA 4JTHA 4EXQA 1LYXA 2IXUA 3K4WA 4CNTA 4XAPA 3BZGA 2QCLA 4WRHA 3L4WA 5D2TA 1EGVA 2A2IA 3LERA 5CPNA 3DI0A 5IBXA 4JCLA 3SQLA 2Y5EA 3UA4A 4XD5A 4K8HA 4BR1A 4AH7A 3O06A 4ZQCA 4N9EA 3N9SA 1FWRA 1OABA 4YHEA 5I09A 1PKLA 1LROA 1XM3A 3LHYA 2XM2A 4XISA 2HXTA 1YPIA 1HZYA 1XHGA 3UXIA 3GZ3A 1SQ7A 1SFLA 2VCCA 7CGTA 3T2PA 1Q6QA 4Z1CA 4JTJA 3OU8A 5D9MA 1ODZA 1HJQA 1VRXA 4Q3MA 1JDDA 2A3CA 2ZX8A 4V27A 2XFRA 2R1PA 2V3DA 4NYUA 2R1NA 1AFSA 3B8WA 4A29A 1KO0A 1HJSA 5HPOA 4ROQA 2WMJA 3RK8A 1KQZA 1PHWA 4NNBA 2WVSA 3TWBA 3WF2A 4WY0F 1KXVA 4RE3A 3E2QA 1C8XA 4C6JA 5CG0A 5A6BD 3TWAA 3LSCA 4L9XA 1IXNA 1OG0A 1WAWA 3C0JA 1LJYA 2W3ZA 3Q37A 3W73A 2J7DA 4MKSA 1IV8A 1KV8A 4IMGA 3TYCA 1IIHA 4S23A 2YDQA 4IXHA 2NSXA 3CBWA 2CWXA 3DHUA 4GH1A 5I3HA 4UQCA 3UPBA 5H1WA 3JRKA 1IR2A 3EX3A 3W6MA 4TQTA 3ZT6A 3NWRA 1GOWA 3DU0A 5CCZA 3W7JA 1U1UA 3E9AA 4AVOA 5A8NA 3QZEA 4F3HA 2WM1A 1EWEA 3WNPA 4FXSA 1Q7MA 4PUNA 1HL9A 1PWMA 2J79A 5F1VA 1XP3A 4LALA 4YL2A 1XX1A 1TFVA 3H8AA 1XC4A 4J9JA 2BHYA 1Q2SA 5D03A 4XZIA 3EOSA 1E6ZA 1AD4A 3T81A 1ZBKA 4MHBA 4IOTA 3L67A 4IT1A 2J6XA 2Y8VA 4MG4A 1PTAA 4QAWA 3CASA 3AMDA 1KBJA 2QCHA 1EJUC 3B9OA 5GVJA 3ZSTA 1TPH1 1VEMA 1I0BA 3CHVA 4G5DA 4GA8A 3P82A 4TU1A 1SO5A 2FZBA 3WLRA 1CX9A 4HGXA 3QSTA 4ZSTA 3E5PA 1J10A 4GUFA 4LGXA 1WXZA 1AH3A 4BI7A 3BG9A 3TMQA 3W7NA 5K4ZA 5LHFA 3DUGA 5AN7A 3IIXA 4JFTA 1GW1A 3MI3A 3I10A 3AHVA 2WBGA 1QU4A 2QV5A 3KXQA 1YEYA 2DORA 4FNTA 2E5BA 4RXFA 3S2JA 1XSIA 3MUCA 3UNTA 3CMFA 3UXAA 3N34A 1I2RA 4XZNX 2Z28A 4KFOA 2XGBA 3C0LA 4I9MA 4XAZA 2YZ5A 1YW1A 4A4AA 1KWKA 1GUVA 4K37A 4PMUA 1RV8A 2V0TA 3SCSA 1XQLA 1QNPA 1R3WA 2NQ5A 4A21A 4FPSA 5HA7A 4F48A 4HNOA 2VJXA 2XH7A 1G01A 4H1ZA 4ZOAA 5C5YA 3PJUA 1VCVA 4LS0A 4LB4A 2W91A 1GVRA 3BOLA 2XISA 1AL8A 3EXSA 1H49A 3QMSA 2PE4A 3BV4A 5C9XA 2JKPA 3C86A 3IGSA 3O07A 1EC7A 1LDCA 1NJJA 1HP4A 2XIQA 3CO4A 4U3AA 1EF3A 1KD0A 3S6OA 1TPWA 4E4FA 3LSBA 1LWHA 5LIXX 3NG3A 4HYRA 2V69A 4AD0A 2R6OA 3K4AA 4Q4PA 4HPJA 4JTKA 3CPRA 1L6YA 3B8VA 2V2CA 5K7JA 1SO4A 5JMUA 1OG6A 2VM8A 4GJIA 2YXOA 1W5MA 2X1IA 3FS2A 5D09A 1FCUA 4PTWA 2C0HA 2CCRA 1VS1A 3B8UA 1F8IA 4HCDA 1C93A 5A6MA 3R10A 1YADA 4MFEA 4JX6A 4M1BA 4XBSA 3A4AA 2E7FA 4IXXA 1EP3A 2J77A 1TWDA 4JPGA 2GL5A 1HKIA 4KCTA 2PCQA 1ZU8A 3LPPA 8CGTA 1WUFA 1KR0A 4DI9A 1XC6A 2D22A 1UMYA 2G37A 4P8UA 4YS1A 4DWSD 4ATLA 2X7VA 5EMJA 2E9MA 5DRCA 2WMGA 1UZ1A 4FB7A 2YBVA 3URQA 1FVPA 3WDHA 4YNGA 1R47A 1XDJA 3R8RA 3WNMA 1EPXA 3SY1A 3IANA 4JIIX 5HXMA 3M9YA 3S0CA 2DT0A 2PTDA 3GXMA 1YIXA 1OBAA 4LAOA 5GQBA 1UH2A 4NZ3A 1EDGA 5EPDA 1CYGA 2PC4A 5FL0A 1OGSA 4AZIA 4GUGA 4ZQMA 1V79A 3OIHA 4AY8A 4PODA 1WZMA 4WUIA 1WYIA 4E8GA 1IWAA 4EOUA 4ZQPA 4N0RA 2OQYA 3HPXA 2V67A 3AHZA 3DIPA 3EDDA 4GBUA 2Q09A 4CGTA 4XIAA 1O7AA 3EA3A 1L2QA 3BC9A 1EIBA 2F7FA 2I9UA 3TK7A 1AH4A 5SWUA 3SDOA 4DNHA 3WBEA 4RE2A 1W3LA 4ZOBA 4YTTA 4F0RA 2R1LA 4KWUA 4WGHA 4TV6A 3GXDA 4TO8A 2Y4SA 2X42A 3B06A 3GFZA 4FX6M 1UR9A 2Z1SA 1TCMA 3II1A 2EHHA 4LX4A 2XZ7A 3SSZA 1QWGA 4HMEA 3BLLA 4HIBA 2G96A 3CC1A 4QTGA 3TROA 5CJMA 3UCQA 1C3FA 4PFMA 3VINA 2BWGA 1OC5A 1J8VA 3CV7A 3WJYA 3N18A 3HTWA 1AQMA 1YKWA 1JD9A 2YL6A 2GSJA 1RUSA 2Q6ZA 4MVAA 1H5VA 4GI9A 1TMHA 3ENLA 3NPVA 1QT1A 3GTIA 3FSTA 2XFFA 3GTHA 4KQNA 2VFIA 4BQ5A 1XCXA 3KHJA 4MDPA 2AQVA 1UOZA 6TAAA 2FFCA 1UZDA 3C2EA 5D8WA 3QPYA 3W87A 4JTFA 2P3ZA 4PSRA 4AISA 1U30A 3DFNA 3CUIA 3LI0A 1WAUA 4GQBA 1OF8A 2D23A 3D5HA 1M7XA 1HGWA 4B90A 4LQ1A 2DDXA 3I6EA 2OZ0A 1NDVA 2C16A 3UERA 1R3TA 4PUEA 5D02A 3NQFA 3B0PA 2VTFA 4NIRA 1RPXA 4YTRA 5FA5A 1CTNA 2QYGA 3G6MA 3GO2A 1GQLA 1XIBA 5AVHA 1THFD 4K1GA 3MT1A 3WUFA 3HJEA 3AICA 2CZDA 2UY4A 1PZ2A 4JTRA 1XYZA 1XIDA 2R8WA 3LCGA 1JZ6A 2ZTKA 3NDZA 3G3MA 1VFMA 2X0YA 3IPWA 3HPFA 2YLAA 4XTIA 2CZVA 3FDKA 4OGZA 2Z1XA 3IARA 2VEFA 3GW3A 3GLCA 4MJMA 1X8FA 2Y1HA 5ABHA 3F4NA 1ADSA 2WVUA 4U5IA 3FLUA 1TTIA 4H6RA 4OHQA 1XLLA 4H7VA 3ZZ1A 3TTEA 1PB0A 1UA3A 1EO5A 1AZ1A 3VNLA 5D2VA 4ALDA 3QKEA 3M44A 3CQHA 1OGGA 1ONWA 2BS9A 1EOMA 4DBSA 5D9PA 1SMDA 5JQ9A 3W6YA 4TMCA 2QCDB 3T4WA 2JIEA 1TKKA 3QYQA 4Q4KA 1XRSA 4GPNA 3A4JA 1OX4A 1PTDA 4ZMGA 3LHZA 3BLKA 4EPBC 4IGHA 2GOKA 3TTQA 5G1TA 1TUXA 4AEFA 4HHMA 2BVDA 2BMBA 4DJEC 2XH4A 4NQ1A 1S38A 3BG3A 4F0SA 3GDTA 2DSUA 5DMMA 2QULA 4DELA 2Z0IA 4NJJA 1US3A 5LA1A 1DOSA 1XLJA 1Y0EA 1NWRA 5TD4A 1B90A 1AODA 2WCGA 3WH6A 2FLIA 3QW4B 2HZGA 1EHNA 1K8YA 4OKDA 3BGGA 4IPLA 1SJBA 2A3EA 2W67A 3PZVA 3VO0A 1MRAA 4PMVA 1LUCA 5FEZA 2HJPA 3LRKA 4C5ZA 4FAMA 3WF0A 3S5OA 1LWIA 1EUNA 5L9FA 1JCNA 4I5UA 3VNKA 1K03A 4ZQNA 2I56A 1R6WA 5HJXA 3VD9A 4J35A 1HVQA 2G8ZA 4WDUA 1W9BM 4GFIA 1CDGA 1Q6LA 1EC9A 4AQLA 1ONRA 5BW6A 3TTYA 2VUNA 2V5DA 1XS2A 4GMEA 1M9HA 2C18A 4YTQA 3QQ1A 3QH2A 1J96A 3T0BA 1TTQA 1K9EA 2PDUA 3ONCA 1WKEA 1HKVA 1A5NC 2OKOA 4Q8PA 1R3RA 3WQVA 1GJUA 4OV9A 5I3FA 1O68A 1BGAA 3CZGA 3RG6A 1F73A 3LDVA 2DU2A 3PSWA 3AMGA 4F0HA 3CMGA 1HNYA 3JUGA 5ENLA 1A0CA 4ILSA 1B2YA 4I9JA 4QSHA 5BRQA 1P6CA 2HNHA 3RUBL 2NVDA 2CC0A 5A3HA 3THQA 4XZ9A 2H90A 1Q8JA 2G3JA 3G1AA 3VIJA 3FFSA 5GNYA 3NFUA 2J7EA 1AW2A 3IGHX 3LCWA 4HZ8A 4GQGA 4RE4A 1A0EA 2GGHA 2D2OA 4NU7A 3E2SA 3VGDA 4IPPA 1OD0A 2FIQA 2G4JA 1OFAA 3Q65A 1Q66A 4WLCA 3E38A 3UPWA 4NJIA 4HSHA 1MNZA 1NFPA 1VH7A 1KRAC 4GVHA 4PBEA 1VYPX 3AFBA 1UD4A 3RLVA 3LHVA 4HNCA 4S2BA 4BWLC 4R53A 4ZB5A 5E6ZA 3VCRA 5EMUA 2A1YA 4V15A 4EPEC 1GEQA 5EU9A 3SGZA 4KWSA 1KBLA 4N2YA 4E4PA 4LEQA 3CWHA 2QCMA 1XBXA 4HJWA 2YCLA 1SW0A 3FJ6A 3W1XA 2XHYA 3M6DA 4M3PA 4E3VA 1S2UA 5AYBA 4NZ4A 2PRMA 4O0QA 3OLGA 1UH3A 4OOZA 3OVQA 3PJXA 3RLHA 1GJWA 3H6OA 1TTJA 1YNQA 2C8NA 3PNZA 5FJUA 1MDRA 4H83A 2ZXBA 3H55A 5EYWA 3STPA 5I3IA 3RFAA 2ATSA 3K13A 2H9AA 1OX4B 1W3KA 2WV8A 3HV9A 4K7VA 2PEVA 3TN5A 3BWWA 4Q7BA 3OTRA 4GVIA 4O1CA 5KZDA 3IK4A 1TA3A 4JHOA 1SW7A 1JCTA 1E9YB 3GDBA 4NY2A 2VT0A 3BCJA 3ABRA 2J6VA 3APGA 1EJWC 4J4KA 3H2NA 3ABOA 4ZB2A 4I9TA 4PTXA 1A5SA 2OWCA 1J5TA 2I16A 2QVNA 4NAFA 1EEPA 4H2HA 2Q8LA 4DPQA 4GYPC 4GZ7A 4JR5A 1K3UA 1OFQA 3P80A 5DMLA 1E70M 4IP4A 5KTLA 3V16A 4EXAA 2D2HA 1DHKA 4UMBA 2JF7A 3EWWA 3LK6A 3HQ1A 3UESA 4LC8A 4Q7IA 1IEIA 3QC3A 9XIAA 3SECA 1SJAA 3LCLA 4GNVA 1GTHA 2B31A 3GH4A 4UFIA 4X3ZA 3ZT7A 2NV2A 4JL2A 3AYVA 3T9PA 3UZ5A 1H51A 1KTCA 1MQRA 3L4UA 2ZZ1A 4GC3A 5A8PA 3V4BA 3LPFA 2AKZA 4V2XA 3CUZA 4GK8A 5CAKA 2CLEA 3WD0A 5KZMA 3W76A 4UZUA 3TFXA 2IKGA 1C29A 2NUWA 1MYRA 4MGGA 2DVUA 2RAGA 1HL8A 1UMLA 4N7QA 3ARXA 2OQLA 3WLPA 4LS2A 4IQLA 3SIMA 2ZXQA 4JIRA 4PUJA 3QEZA 3T6CA 2ZICA 1REQA 4RXGA 3TJXA 5G4EA 3FX4A 4HYVA 3UJRA 3AXXA 1RCXB 1V3LA 3AHXA 1NQ6A 3KVLA 3UNDA 1BF2A 1CCWB 2DUXA 1F76A 3NPXA 3BLEA 1ZBWA 3N19B 5DX7A 1UJQA 2G3FA 1JXJA 4UMAA 4US5A 1JGIA 1C7SA 3EPMA 3TAOA 2V81A 3WMBA 2JALA 2RUSA 4A8LA 2YR1A 1ME7A 1I1XA 2HPMA 2FZMA 3GNXA 3RRAA 4PMJA 4WK9A 1EC8A 3EKZA 3MWAA 4OUIA 4B5VA 4PB4A 2VVNA 4X0NA 1BRLA 3L0KA 1EJXC 1B0IA 1ISZA 5DF0A 2P1FA 3L4VA 1JRBA 2J4GA 4ONVA 2YCLB 2GVGA 3LHTA 2YDSA 3L2LA 4UCFA 3E2VA 3QRHA 4K38A 2QGHA 2ISFA 1GQNA 4Y9OA 4ZFCA 3NA8A 3W1TA 1UUOA 1ZAHA 4GC4A 2OFJA 2DSKA 2OGYA 2Z7KA 4AFYA 1E1CB 4V28A 4QEEA 1QCWA 3ABZA 3WQFA 3UWZA 4IMEA 2HVNA 1ITXA 1VAHA 4A3UA 3U5UA 1NELA 2VZOA 1H7WA 2H9AB 4IFOA 3GDMA 1J12A 3UD6A 4W86A 4XSMA 4XQ6A 1NWTA 2GUYA 7TIMA 3TH6A 1AJ2A 2WMKA 1UPMB 5EA9A 1HXJA 4RNJA 1MEHA 1TA3B 1VD6A 1Z41A 1QNVA 3K1DA 3WEZA 2ZXDA 3WDRA 3ITXA 2G3MA 1YYAA 2ICSA 3K2GA 1VP5A 2VUYA 4PE8A 3VA8A 4HA0A 3SUUA 4JHMA 5F2IA 4OZOA 3SUTA 3N2OA 4AD5A 5A6KA 3KHDA 5CJNA 3BAYA 4NAFB 4K1WA 1D7FA 4DBUA 1GHSA 4I90A 4LT9A 3RXZA 1BTCA 1VCGA 1WDDA 2OO6A 1WQ5A 3WDIA 4NX0A 1PDYA 4S39A 3PWAA 3A9BA 4EPKA 2AQWA 1JZ3A 4S2CA 1EFZA 2DSWA 2O4MA 3M64A 3MV01 1P0EA 1RR2A 1JPKA 4O1FA 1OIMA 1EGMA 5GJNA 2YW3A 1UIOA 2ABAA 1JVNA 1M53A 1NU5A 1XISA 3W7HA 3GXPA 3QV9A 4R7JA 4DPPA 4UFLA 2EEXA 4LH8A 5I00A 2V5LA 4FSAA 1WUEA 3JZEA 3PHAA 3OHIA 4ZFMA 3ANUA 1IXOA 1J0HA 4E2DA 1CGWA 1LBLA 5DMNA 3W1QA 1LLZA 1MZRA 2ZDRA 3SSJA 3AS0A 2Z2AA 5HMSA 2XZ9A 1TREA 4UBPC 3BG5A 3HN3A 3GR8A 2UBPC 4I3GA 2WJZA 2WK2A 1IEXA 2ZX9A 5C9RA 1KCXA 2PS2A 3CJPA 4FLOA 3G1RA 5CC7A 9RUBA 3OGSA 3G0SA 1UC5A 3ALFA 4GGBA 2Z1WA 2ZUNA 3EAUA 4L6DA 3KL5A 1W17A 4E4UA 3L4TA 1ALDA 3I4EA 1WP6A 3QC0A 5DFAA 4XD4A 3DGBA 3H2EA 1Q6OA 5TNVA 2BDQA 1QMLA 4MNKA 4IWWA 2OMAA 4D6JA 2HROA 3CUGA 1QXLA 1GW9A 2A7PA 2VFDA 2OZ3A 2WKGA 4JTCA 4GLEA 1FX6A 3E0IA 1TX0A 3KOXA 4DJFA 4WKHA 4IM4A 1TWZA 1AMYA 4KRZA 1ZZMA 1KKRA 2TAAA 3IEBA 1UH4A 5U7SA 3KS5A 2JGQA 3ZSSA 5I5RA 2NX3A 4EKJA 1XKYA 3S4TA 2PSNA 1E56A 2X2GA 3ITTA 3HF3A 3S83A 3ZIZA 3SCOA 3SM0A 4EAYA 3TYZA 1SFSA 1LF1A 1UHVA 1UWQA 2QF8A 1H2JA 3M0JA 4ZE4A 1HW6A 3TNBA 3H2MA 2XIOA 3WDJA 5B7ZA 2OLSA 3NPWA 5EBAA 1H61A 1OADA 5FJJA 1TO3A 4QR6A 4GJJA 4F0KA 2WZMA 1IT7A 3LA4A 2WQDA 4AIBA 2PCEA 1K7XA 3HMCA 3CEUA 1TB3A 1O5RA 1P6WA 1B9BA 1PZ3A 1B3VA 4JXCA 3HPZA 3ITLA 1TWWA 4S38A 5LGXA 5C70A 3N25A 4DJDD 4L1XA 4ERIA 4FALA 3WFZA 1CLVA 2BXVA 4MLRA 4UTKA 1TJ2A 5C71A 1F74A 1GORA 3VCNA 2WHLA 3W84A 2QJIA 3F4VA 5BROA 3HG4A 2GVEA 4IIGA 3CQKA 4K36A 1I45A 1U83A 3JU2A 4IMCA 4MSSA 4OIFA 2J7CA 3FCPA 1X97A 3CL7A 2EAWA 3TNOA 1XDLA 2OYLA 1CXIA 2VRJA 2DPEA 1I2QA 4NXKA 1ME9A 2VI0A 2ZUVA 4XV0A 4GGHA 2BY3A 5HQEA 4C7GA 1JR1A 1PHQA 2PGWA 1VEOA 4FXFA 3UR2A 3C4UA 1U2YA 3V3WA 1PV8A 1DIKA 4DX3A 5KZEA 7REQA 1Y8BA 4B9YA 1VC4A 3VX0A 4HSNA 2OT0A 3RJXA 4J2PA 3O8AA 4PCPA 4GY7A 5J5DA 2ABBA 4YCOA 1M04A 2ZVRA 1WDWA 4ADSA 3W7KA 4DO4A 2QJJA 3HA1A 1QNSA 3ZJ7A 1E0XA 2CLKA 2VQTA 4KEUA 2PWEA 1BXNA 3CZKA 2OSWA 1X7IA 1KCLA 3DAQA 3G1YA 4B15A 3VD4A 5FJPA 5I7GA 2G0WA 4QQ3A 3SUSA 4TR9A 1JD7A 2GK1A 3YPIA 4K2SA 5DXXA 3KVKA 3SFKA 1EZWA 3KTCA 2A3HA 4ZO7A 5C0QA 3H70A 3SRKA 2XVGA 3BLDA 3NZQA 1DJWA 4CVUA 3W71A 1XG3A 2CLFA 4EK7A 2ZVIA 5TIMA 3E2RA 3WLKX 3MC5A 2CZEA 2PP3A 4H9ZA 1ZCOA 4UFHA 3ITCA 6PTDA 4NL1A 2NWSA 4IQDA 3M5YA 4ORIA 2QNEA 3WF3A 2EKGA 2W6RA 4O8AA 1CB7B 1VBGA 5J8LA 4MF4A 5EY5A 2Z26A 2WKJA 1K6WA 2CLMA 2G3IA 4W7WA 3PTMA 4ZB0A 1Q4WA 2O55A 2O7SA 2H8ZA 4A3QA 4Q8QA 1X38A 4JTDA 4XB3A 2WJFA 4ROPA 1QI0A 3EOLA 2V5KA 1YPFA 1G7VA 1AJ0A 3A23A 2PBOA 1DJHA 1KGXA 4O16A 1Z8AA 3PBWA 1S2AA 1NDYA 3CO8A 1MEIA 1OK4A 1D7KA 4L9YA 4JX5A 2BVYA 4TX8A 1NY1A 4JIQA 1DIEA 5KMYA 2OPJA 4DBDA 4Z0SA 5IOBA 2WC4A 4GE8A 2DZUA 2NQ9A 4HU0A 5HAOA 1UKPA 3N2BA 3S2NA 3BUVA 1Q6RA 1H7RA 1FY6A 1TZ7A 4MJZA 4LVAA 1XICA 3PZQA 3NDOA 5I07A 4MUZA 1ICSA 4UTWA 2CETA 1QWKA 3FY1A 1W91A 4CKQA 4UQEA 4L4PA 1OFRA 1SU5A 3R79A 3M47A 1DL3A 2VC5A 1DXFA 1PX4A 4AIEA 4TTUA 3VKDA 3W3OA 2PFHA 2V63A 4AZCA 4ATWA 3BANA 2PDJA 3RNDA 3GG1A 4MB3A 4LJ3A 3XISA 3VKJA 2UZ9A 3UCCA 2AKMA 3OZOA 3ZT5A 5CGTA 1WA3A 2CLOA 3I3EA 7REQB 3TXVA 1N8WA 1VEPA 1DHPA 3V0UA 3O3RA 1PL9A 3QXBA 4Y90A 2YBTA 2OSYA 3ZFHA 1HJUA 4M56A 1AQFA 3GIQA 1Z42A 3LZ3A 2GFTA 3ITVA 4JS3A 4INFA 4W8BA 3QMTA 4HTBA 3ARWA 3KTXA 4RV8A 5GJPA 2O7QA 4DRSA 4Z1AA 4GRSA 5AHLA 5LNUA 3GX9A 2WZHA 3HJZA 3WD1A 3KWXA 2BZNA 4GWEA 1CT5A 5B7YA 4Q8UA 4J3ZA 1QI5A 4FF7A 4HU4A 1O5KA 3G1VA 3PBYA 3QF0A 4JQAA 3SN1A 2OTDA 1BYBA 5IM51 4MFDA 5XIAA 4HMCA 1CECA 2J27A 2GK1B 3VOFA 4C7FA 2NZLA 2Q8XA 4FNUA 3ATYA 1OZQA 1WBHA 2ZZ7A 1VFFA 3EWUA 4UTFA 3BK0A 1Q6GA 5REQA 3CYJA 3GNNA 5CPSA 2EO7A 3BW4A 3AXHA 2X8RA 3ZR5A 4DUVA 2PGEA 2PUZA 3VKAA 3TZFA 2P5NA 3G18A 4RPQA 3WCZA 1U1JA 2Z25A 3F4CA 4HKPA 3HQOA 1PZ1A 4CQDA 5E1QA 1ZBCA 2JK2A 3LXCA 6A3HA 3AIVA 1XIIA 3CAWA 3TQPA 1E4LA 2ZIDA 3Q4DA 3E0WA 1O95A 2YCKX 3FV9A 3OA5A 2CKRA 3GAKA 4UTLA 4DM2A 2CPUA 1P5BA 1NP0A 4LCRA 5D32A 4HA4A 2ZKMX 3E0FA 2DGAA 4ZXOA 4JKLA 2A3LA 4U33A 4TVDA 2VFHA 2J8GA 5HOSA 2Y7FA 1J0IA 1Y5WA 2BV9A 1VJSA 4M1RA 3KRBA 4S3AA 2JKAA 3H7VA 3SCTA 1U5VA 1XIGA 1UB3A 3P93A 1P43A 4QM1A 6TIMA 3KCOA 3O6YX 5C6MA 2VZSA 4CN1A 2DT2A 2FJKA 4F66A 5A6AA 1DWAM 3S1UA 3PZ9A 3CM4A 4GI6A 3OVRA 4PA8A 4P8WA 5DO8A 5A6BA 3H2AA 1TYGA 4MYAA 5D38A 4CN4A 2E4TA 1TRIA 1EXPA 3LV6A 4AY1A 3I6RA 2IKHA 4V33A 3TX9A 4DVOA 3G1DA 4GX8A 3RMJA 3T2QA 5CGMA 1US0A 3W7GA 2AMXA 2ZC8A 4XZWA 2HE8A 4DY1A 3SBFA 4UTUA 1TV5A 5JH1A 1R9YA 1KQYA 3TC7A 4C6NA 3OLDA 3UP8A 1J4EA 3R0KA 2E09A 4X2PA 1ZENA 2E5DA 2XVKA 3PPCA 7TAAA 2IQDA 1UZHA 2FDMA 1YMYA 3FW6A 5C2XA 2QT3A 1UWRA 2G41A 3KOYA 1DJNA 1I2PA 1ZJIA 4LBRA 2XDFA 1F07A 4KMQA 4HN8A 3GC2A 4B91A 5HNTA 3O0FA 3S3GA 3W2MA 1WXYA 4IIDA 4DYKA 3ARQA 1VJIA 3ZWSA 1B4KA 1TVPA 2PLKA 1H11A 2JBMA 4IPJA 1VZWA 1XLIA 4XKYA 2QJNA 3T42A 1EJTC 2ZWYA 5CPMA 5I03A 3BLFA 4QXIA 1UIPA 3W2UA 4M51A 3VU2A 3RCMA 1KXHA 1JULA 2VR4A 3LM7A 1TMLA 3M41A 3KX6A 2ACRA 1SGJA 1IR1A 3NGFA 2FHBA 3MVIA 4P7QA 2DIEA 1UD3A 2FZ8A 4NILA 3A21A 1QK2A 1A5CA 3LGDA 1DJZA 4DWSC 2XH2A 5REQB 2RDWA 3V0TA 3VI2A 1PKMA 1I1WA 4I7UA 2Z27A 1JDFA 4O54A 1G4PA 1QATA 4J27A 1HO1A 4Q8TA 4FNQA 3EGJA 2Y8KA 1VKFA 1NFGA 3AI0A 3N4FA 4IUOA 3WK1A 1U22A 2Y88A 1FP8A 4BA0A 3FEMA 3FK4A 4PN2A 1QHOA 3MJYA 3NL5A 4XZMX 3IJDA 5FOOA 3IUIA 4UQBA 5I2UA 3KBSA 1M7PA 3IGUA 4WOZA 2CXEA 5DN1A 4CLMA 4KWOA 1QW8A 1PWLA 1DYSA 2PWVA 4DI8A 2YCEA 2A3BA 1KRCC 1AH0A 1KTNA 3WSUA 2VZVA 2D2GA 1QPKA 3N9KA 4CNOA 1KXTA 1PPIA 1K7FA 1KM2A 3NZPA 4JTLA 2QV4A 3AC0A 4R34A 4H8VA 1P0DA 4K3ZA 2VX5A 1CEOA 1VBHA 2DT1A 1S2TA 2GDQA 1XKJA 3ICJA 1V8EA 1QBAA 3VTRA 4UOZA 5HMDA 3CEPA 1KGWA 1UKOA 3TYEA 5DMYA 2DFAA 4EP8C 4OBRA 1XL9A 3M1ZA 3G8EA 2BY2A 3QOMA 3BV7A 3TSBA 5BXTA 4EACA 3UWVA 2C0AA 1WOBA 1VPXA 5F1UA 5DEZA 1CLXA 4YTUA 1LORA 1GVIA 2JGYA 2X16A 2DZBA 1DQXA 2YJQA 1UWUA 3SQMA 3P3BA 3QY6A 3RRXA 3B05A 3T2OA 4LRTA 2QPUA 4AZ7A 2NUYA 2A79A 1FHVA 1R7AA 2I57A 3AZTA 1B3ZA 2YB1A 4RK8A 3EEGA 2XYLA 3RX4A 3FKRA 4IX0A 3VKBA 1HKJA 2Y0FA 3UXLA 3VFLA 3LCFA 5F2LA 4GISA 1LZOA 2XIMA 2R91A 2W79A 3TEVA 4Z1YA 4JFSA 3S8HA 1KFBA 1C7TA 1BQGA 3SW6A 4GI8A 3WQOA 1JCJA 1MUCA 4XSLA 4LF1A 1KM1A 1BG4A 2F6XA 1KM0A 3CL6A 3LHWA 3WQ5A 3WIJA 3MUXA 1XIJA 4XKYB 2GJXA 2IQ0A 3MUAA 4AIUA 1K9DA 1GVFA 1K8ZA 4S3FA 1NIUA 2EG6A 5J04A 1LG1A 1F9CA 3UFYA 4JDYA 2FPYA 4RNFA 1W5OA 2WHKA 3G3DA 1W1TA 5JBEA 2HS6A 2L5HA 4M81A 3W27A 4I8DA 4ZVJA 3KL3A 2XN2A 5LIYX 1F5ZA 3GYEA 3R94A 2QS8A 4D1IA 1TE6A 2HNEA 3OLIA 2X0HA 2QQ6A 3GS6A 5AC7A 4B5SA 3PB2A 4GVFA 4LBSA 4XX6A 4RDVA 4CQ8A 1EUAA 3R89A 4H9XA 4AHPA 4M29A 1UCWA 4I9AA 1NSJA 3CUHA 2V5CA 4WXYA 3KAOA 1GKPA 4JN6A 2PZNA 2ACUA 2YLLA 2PD9A 4FO4A 2W9MA 2GPTA 2PGRA 4GG9A 2HRWA 3H2CA 2DZSA 1EJRC 3UJSA 4F9DA 4MTVA 1TPC1 1BSIA 3LU2A 3MV11 2J7FA 4AY7A 3GU1A 4UQ9A 4A3YA 3S6DA 4S3EA 4NAEB 1LL7A 3P2VA 1GOKA 4GQ0A 4NXSA 4ICMA 2PMQA 4UQAA 3C2FA 5FSDC 4NZFA 2PZ0A 1Q63A 1WB0A 3QHMA 2RDTA 5AC8A 5JBFA 3XIMA 1Z69A 4OU1A 4C1LA 5JH2A 5A6JA 4A3RA 3SCNA 4IGMA 3NQVA 4HTYA 4Q8OA 3CV1A 1KM6A 1FWGC 4PMDA 3C3NA 3R11A 3I6TA 3W4RA 3AMCA 3B04A 5MKGA 4GUJA 5AYIA 4DB7A 3ZJ8A 4HU8A 3W1PA 1ZP3A 1ZAIA 1PDZA 4MY8A 1G4SA 4BFAA 1XBYA 3BL3A 1E6XM 3LCHA 2IKIA 3LMZA 2F9RA 1UROA 3LM3A 3WZ0E 3H53A 4U5KA 4W7VA 2DV0A 5G4WA 2BOFX 3I7RA 4TOQA 2ZTJA 5E0FA 3R8HA 5CSYA 3GQYA 4PMQA 1OIFA 1US2A 5AB3A 4CU6A 4AEEA 1MXDA 1DTNA 4IIEA 1XUZA 2OZ8A 4JQ2A 3GHUA 3PTQA 4Q8WA 3LQLA 2ZRWA 2E77A 1FHLA 1R5YA 2IPGA 2OXNA 4QG9A 2AL2B 2VZTA 4PMRA 4PH6A 3B9DA 1TELA 1E0WA 1TTPA 4N9DA 2HBVA 1RD5A 1XSJA 4UNLA 2OYKA 4DWSB 1V3IA 3VOCA 1Z44A 2NXGA 3MI6A 2C1HA 2PD5A 4IG2B 1TV7A 3AS3A 1TVNA 2IMRA 2GQAA 2J75A 4JYFA 3MCMA 2X1TA 3EOUA 4AMAA 3K30A 2WYSA 3UG4A 1RPKA 3WL0A 3AJ7A 3HOJA 1JDAA 4PRRA 5BCAA 4P5UA 4ZOCA 2GJXB 3JZUA 1QPNA 1I9CB 2FFIA 5G2HA 4I7WA 1L6SA 1HG3A 1FFRA 1JJKA 1EX1A 1F8MA 4EIVA 4IQEA 2W92A 3T78A 4AUBA 1R9ZA 1WDRA 2GWGA 1V77A 3OJGA 2EF9A 2VHLA 2OEMA 3H4WA 1B31A 4HNUA 2OLAA 1MRQA 3E5BA 4YYCA 5FL1A 2YDRA 1E4IA 3V1PA 4EXBA 3GYCA 1MW2A 2ZZ2A 5H8UA 4BQ3A 3WJZA 1Q7QA 1Q45A 2H6RA 3W85A 4C65A 1VHNA 3SRFA 3R12A 5A1AA 5XIMA 5L6UA 3BJTA 3KLKA 3A3XA 4AWEA 3IIZA 4Y9AA 1VHCA 3UR7A 2ZA3A 5J5RA 4LVFA 4G9PA 3BLOA 4GXMA 1D2KA 2QW5A 2WNWA 4HP5A 1W56A 1GK8A 3UZZA 5IHRA 1OCJA 1ZP4A 3PPHA 4HN4A 3V0SA 5CZKA 4ZODA 1E5JA 3HG2A 2OKTA 3RU8X 4PTDA 2O9RA 2CXGA 2BG5A 4N4QA 3GUGA 2GJRA 4RX0A 1Q7ZA 4PC8A 1A47A 3PBUA 2R24A 3DC0A 3TU9A 4GQQA 1N2VA 5T91A 2WSPA 4ZXLA 3FYYA 3OIXA 1B54A 2V6AA 4G7FA 1ZTVA 1UP0A 3NXLA 1PO9A 2QMJA 1UR1A 3MKVA 3UZJA 2ZRYA 1ADDA 1CI1A 3LYEA 3HG5A 1G7UA 3V18A 4D9PA 3WLMA 1K4HA 3VIPA 3VC6A 4XK2A 5K3VA 1LOQA 1SJCA 1XGDA 5I6SA 4K7YA 1RSCA 4OBTA 2Z1KA 1IYXA 4MYXA 4RZ4A 1F4HA 1VYSX 2NVAA 3S2MA 2WJEA 5DANA 3GRIA 3PN8A 3MJMA 3ZWTA 3T0DA 1FWSA 3AS1A 2HBXA 3L5MA 1XGEA 4JNMA 4UIOA 4DAIA 2J7BA 3L2IA 4JIEA 2BFGA 4AZGA 3LRLA 3SUVA 2VKZG 4O12A 1KGUA 1T8QA 1WXJA 2WNQA 2WC7A 3GU9A 1UBPC 1W9PA 5M03A 1ISVA 3MZ2A 5T8GA 1ZBVA 3TN6A 2PU0A 3WQ8A 2CNCA 3WK2A 4Q8NA 3CZLA 1WDPA 1IT0A 3WH7A 3UYIA 1IEQA 3A6OA 1DJXA 3ZVHA 1IGWA 4AD2A 1XH1A 4C6OA 4DF1A 4U2YA 3GNPA 1KM4A 1WKDA 3QZAA 2PDIA 5A94A 5JU6A 4TUFA 1CBGA 4LVBA 1W6TA 4UTTA 3APTA 4P7NA 2WOQA 4LYPA 1UC4A 5I02A 1RHCA 1UG6A 2GGEA 3KP1A 2PDNA 3G2GA 2V5BA 1Y7VA 3L66A 1FH7A 3VDGA 3JS3A 3WJWA 3IK2A 1E6NA 3IUDA 2JQXA 3GG7A 3GWQA 4Q8MA 1C8VA 1RH9A 3BCDA 3MMDA 5FESA 1J2WA 3W53A 5K9DA 4HYWA 4AF0B 4UZSA 5DXYA 3IRSA 2EPLX 1T0OA 4H04A 1HP5A 4C6CA 4O18A 2QGYA 1DWFM 5IDIA 1XLHA 4LEFA 1A5MC 5D05A 1PTGA 4GO9A 3UY8A 2GQ8A 5HR7A 2Y5SA 1EF2A 1QFEA 4Z1DA 1F3EA 3A5VA 4K6AA 2WCAA 1V6VA 3N2MA 1JPHA 3N3MA 4IICA 3TOPA 3GVVA 2GDVA 4MAVA 1W2PA 1P0NA 3GNDA 5LA2A 3S9IA 3QTGA 5HBFA 3W70A 3IV3A 4LY8A 5A8GA 1TRDA 3M0YA 5HQMA 3PULA 2FB3A 2R94A 3RJYA 3FNDA 2P8CA 4XAYA 3F5JA 3CV2A 2O9TA 1FWAC 1P1XA 3VMPA 5D04C 1K02A 1YQ2A 3GR4A 4X0VA 1XLKA 1QUMA 3LTYA 1RK5A 1V0KA 4WOQA 2G3NA 2FDSA 5AY7A 3U6WA 1WO2A 3G77A 5IBXC 2E67A 3VMNA 5BMXA 1W9VA 4NJGA 1EWDA 1TCDA 3ARPA 2DVTA 2CFFA 2I9EA 4LRSA 4ML9A 1JYWA 1R85A 4O10A 1H50A 4PULA 2E40A 1QASA 3O0KA 2Z1VA 3RLUA 4B2DD 2XFYA 3WL1A 1B30A 4QX4A 4LVDA 4C5YA 4KS0A 4QROA 1JFXA 4YVPA 5ABFA 2R82A 4QG8A 3LD5A 4XD3A 4W93A 1Z89A 3E6EA 2RH9A 1NOFA 3TR2A 2E28A 4HPGA 5EFDA 1ZGDA 3LGEA 3GIYA 5FEPA 4B3KA 2DZXA 3SY8A 1E3XA 1O6IA 2VD8A 3LLXA 2E3ZA 4PUDA 2XN0A 1AZ2A 3THUA 1M6JA 3RX3A 4C6QA 3MMTA 1M7JA 3RYSA 4LANA 4KETA 4HHLA 1KV5A 5DT5A 1UA7A 2NLYA 3B0VC 5BOEA 3PZUA 4LV4A 3RO8A 5JVLA 4JNYA 3CIVA 3WJXA 4XBKA 3MMUA 4EPDC 4O53A 1J18A 4RE0A 4AMCA 4PTVA 2WQPA 4JDBA 1S1RA 1EEXA 4YIWA 2OX1A 4OE7A 3NDYA 3N3TA 2W63A 3CQJA 3GZAA 4JTIA 3EX2A 3TONA 3LX9A 2CLIA 5HR6A 1X1OA 2C13A 3EEZA 5BOOA 4NI8A 5D37A 3DXIA 4EWJA 2BOEX 1RBLA 3W7MA 4JTQA 1NH6A 3LPGA 4KCUA 1DE6A 3SRDA 2A6NA 1N8FA 4Y8EA 1QNRA 2A21A 5AOUA 4WF7A 2F8QA 1HVXA 1BYAA 4MWAA 2VFFA 5CEWA 3MB9A 2ATMA 3DHPA 4J3UA 3AMLA 7XIMA 1LBMA 3R5EA 3DYOA 1QNQA 4E2VA 5T26A 5F2MA 1TPB1 1FKWA 3NVTA 4O28A 2Q8ZA 4JOMA 3BMVA 1R46A 2CHNA 5HK4A 2VOTA 3S42A 3CXOA 2XIBA 1GOOA 4JTTA 4JY8A 4D8AA 5JIPA 1B4EA 4GXPA 1FWDC 1D3GA 3V1HA 4LY4A 2GYIA 5ABTA 1SMAA 1G94A 1O1ZA 2E6FA 5EL1A 1O5XA 4JFWA 4IFRA 4D6HA 3T07A 2I1OA 5CPQA 4LPCA 4J3SA 4DZIA 3PY2A 3RX2A 4FR1A 4LV9A 3Q58A 3FJLA 3NOEA 3W86A 3E96A 4R27A 4W8AA 1DWGM 1O66A 5G2IA 1PYMA 4ZEPA 3AO0A 1WKYA 1WX0A 1MFUA 3T4CA 5JXQA 4B4FA 2QHAA 3IJ9A 3KTSA 3ZLHA 4ZA0A 3R4IA 4A8IA 3NO1A 1VFTA 4L80A 4NF7A 2DSZA 1BQCA 5BXSA 3I68A 2W4XA 3SCPA 1ZHAA 4A05A 4L1WA 3IACA 4CNPA 4YYFA 3L5AA 2OODA 3DERA 1M5WA 3E74A 3QY7A 4HZ7A 3M4HA 1X39A 3CK5A 2OG9A 4ZO6A 3VUPA 1XG4A 4DN1A 1UOKA 3APYA 2WXDM 4FLSA 4WDWA 1F3TA 4O4VA 3GK0A 5BRPA 3SADA 2VP8A 6REQA 8TIMA 3CPUA 4HPXA 3RR1A 2VWSA 4Q22A 3W28A 2QDEA 1BXCA 2WMIA 1PKNA 4PMZA 4TX9A 1RLCL 3P7YA 5TF0A 3RN6A 1HKKA 3AIWA 3CGTA 4F9JA 3EB2A 4O17A 2C7FA 4EWND 4GABA 1NFBA 2QDGA 3W72A 3SN4A 3O05A 3VMOA 4Q6JA 2VC6A 4CNUA 2GGJA 4M7TA 2PRHA 2Y61A 3W26A 4GBDA 3VNZA 2V8ZA 4W5ZA 5CBJA 4WHBA 1UD6A 2GGIA 2A6LA 4GCXA 1TQXA 5M1TA 4R9OA 3KEHA 4P7LA 3LXAA 3HGOA 4E38A 4QJ4B 2RDXA 4D71A 1EKOA 2WWDA 3KW3A 1KLZA 1K1DA 1TV8A 3R58A 3MY9A 2VEPA 2REQA 2TPSA 3VFCA 4DHGA 3E0LA 3LBOA 4QIUA 2GGGA 1V08A 3VE9A 1X6NA 1B9ZA 1KM5A 1W3JA 3UF9A 4ZSUA 5IXEA 3MVTA 3NYZA 1CXFA 3N6HA 4IHCA 5BRBA 1S46A 1FWWA 1S5WA 1XR2A 1QDSA 1VIZA 4FXJA 3WQEA 4FR6A 3OEXA 4UWMA 1OT2A 3U8GA 3HFYA 4OV4A 3DCPA 5I24A 3MYPA 3PFMA 2A3AA 4JL1A 3P5ZA 3PBGA 3MHGA 3KBNA 3LTSA 4DJDA 3CUFA 3AXIA 2PDYA 4W88A 4JY9A 2FMOA 2QCGA 1UKTA 3AWNA 2FH8A 3B97A 4FOJA 4FEZA 3RMEA 3WEMA 4H4IA 1YRRA 3JVAA 2I5IA 3AROA 2J9YA 1C92A 3MCNA 1QOQA 5MF5A 4XVDA 3B0UX 3OYZA 5AFDA 2ZRXA 4MDOA 3K5XA 3N6JA 3UXKA 5RUBA 4GNJA 4WGXA 1FWFC 3KP0A 2NV1A 2E6DA 3FJ4A 2XSXA 1D3HA 3VE7A 3EKLA 2ZRUA 1DTUA 3EDKA 5E5CA 4CQCA 1L8PA 5A2CA 4ACZA 2FGLA 4O1AA 2WPBA 3VNYA 3BAJA 3C52A 5KEZA 4L4LA 3K8LA 1B5TA 3NZRA 3MP4A 1DWHM 1YE4A 4HZMA 3CWNA 2YZRA 3H4XA 3FGCA 1YDYA 4Q33A 4NZ1A 2YPIA 3MO7A 4HJFA 4HK6A 3K1GA 4LYKA 3CLMA 2ZRZA 4E3TA 1OY0A 1G9HA 3M46A 4O0ZA 4H19A 1JDCA 3U7BA 1G5AA 1R9XA 4AYSA 1DIDA 2TODA 3MU7A 5LZLA 3PUOA 2BNJA 2IPWA 5B80A 2WWCA 3QPZA 3V5CA 5A8OA 2BB0A 1SFJA 8XIAA 1XDMA 4QAIA 1ZALA 3EDEA 3NEVA 3S5NA 2EPOA 4KCWA 1HF6A 2WMIB 2KAUC 1FKXA 2D1ZA 2J25A 4IUGA 4W4QA 3MZNA 1JZ7A 3ORWA 3TR9A 4NI3A 2G50A 1YDOA 2QKFA 1ITCA 4H9VA 3LLFA 4MNLA 3W38A 4DBEA 3DH7A 1EXBA 1LL6A 2NSOA 4WXZA 5AYXA 4UQDA 3KVMA 1J0KA 2F61A 1XBZA 4U31A 3W00A 4A2SA 5AZ1A 2ODOA 3FA3A 5D33A 2VX7A 2X30A 1HJWA 2CESA 4D6GA 1TIMA 3LI1A 3KUMA 1EYEA 3ITYA 1H5YA 2REQB 1AW5A 2VDHA 4R9XA 5FF7A 2PDCA 3M0MA 1A5UA 1FXPA 2NX9A 4Y7EA 3THDA 1Z9AA 2V2HA 4N6EA 3WN6A 3CB8A 3CB3A 4I8YA 2RFGA 4IJCA 5HATA 2YFOA 4XO7A 4KWWA 1FOBA 2CBVA 2JKEA 3VXGA 3UVAA 8A3HA 4L4OA 2GVYA 1QR7A 3QV7A 3QSRA 1V3MA 3NURA 4MM1A 1UW9A 1UJPA 3MS8A 3SZ8A 3CIXA 2IKJA 4WR3A 1V6WA 2VZUA 3EPOA 3W1NA 2ZZ3A 3QGAC 1XH2A 1QVBA 4GOAA 3WQDA 3M0KA 2XSBA 4DF0A 2D0FA 5FD0A 4AZBA 4IP5A 1XLBA 5DCDA 4PBFA 1FDJA 3DI1A 3CHFA 3VGHA 1XUUA 2VCAA 5CSUA 3VYLA 2VR5A 3VAVA 2I14A 2Y7GA 1SFTA 4MNJA 4DNMA 2ALRA 1J0YA 2HEJA 3FHAA 2VDGA 2WBKA 1YE6A 4ACZB 3CAVA 1OSEA 1UR8A 3GXTA 2PURA 2GWNA 4S3GA 3A12A 2PC8A 1NVMA 1VCFA 1UUMA 3KFTA 5C9UA 2GSHA 2WSYA 3C2YA 3FGCB 1TPEA 3QN3A 4P61A 5PTDA 1XIMA 5M2FX 1LRTA 1NAL1 1R2RA 3GD6A 3ECQA 1S2VA 2PWFA 3F03K 5AC6A 1ITUA 2X2YA 4DQWA 2YFNA 4QBXA 2EQDA 1I2OA 1EDTA 1SUXA 1RY0A 4DUOA 4CQ9A 4KGLA 3W74A 1FWEC 1TUFA 3TYDA 4LC6A 2HK0A 2ZWZA 2WC3A 3CZ8A 4AZHA 5FCZA 3F2BA 4DZ5A 2PDLA 3DDMA 1ONEA 3PZTA 4MKNA 1C91A 3W82A 5H91A 4IF2A 5K9XA 3B8SA 1V93A 1LT7A 4KF1A 2ZOXA 5FI8A 3WF1A 3L21A 3RITA 2W61A 1HO4A 3KCLA 2WW5A 3TVAA 3FA5A 5A2BA 2EPMX 1XYLA 4HVXA 3PBVA 2ACSA 3SO7A 4TVUA 1TV2A 4JIHA 4FF5A 1POKA 4X2RA 1T8XA 5D4YA 1WZKA 1YDVA 1YNYA 1X6UA 1V6TA 3P60A 1T40A 4H3DA 2EPNA 4W8LA 1XD1A 3DOPA 1QRQA 2ZUTA 1E73M 2BP1A 3UWYA 2PP1A 1EZ2A 3IIOA 1XXXA 1VF8A 4B4HA 3WUBA 1ELSA 4XAGA 6ALDA 1P48A 3PG8A 4WJXA 4KW2A 2ZZ6A 4FIRA 3BAKA 3GKAA 2DQXA 4HCHA 3RR4A 1SJDA 3N13A 1WZAA 1JZ8A 3S1WA 2VGGA 1YXDA 4B92A 2INEA 4M5PA 3HPSA 3GDKA 5FIPA 1RLDA 4QNEA 1AQHA 2VX4A 4V1YA 2Z2BA 4AG0A 3ZR6A 4OUEA 1ECEA 2ALDA 2QIWA 3PPGA 4MKVA 2YKKA 2PTZA 1XI3A 1A4LA 2FTYA 4MJ2A 5A6SA 2ZE0A 1RVGA 4J3WA 1HX0A 3ATZA 4ERGA 2J7GA 3CTTA 2NXIA 3USZA 3M0ZA 1Q6FA 2VEIA 3LGGA 4WVXA 5CAHA 5FEWA 1GNXA 1V4YA 3TQVA 4PRTA 4HNTA 1RJPA 1OFEA 3KS6A 4FOKA 2TYSA 3LENA 2AQOA 5HULA 2B0MA 4Y9PA 4HT3A 4HOXA 3AJXA 5H2ZA 4KBXA 4HNLA 3ZOAA 3L2MA 1H3GA 3PUGA 3W0KA 1GVOA 4IZGA 5HWJA 4WSKA 5T9BG 2NUXA 4LUSA 4M24A 3OG2A 2F2HA 4REQA 4UTJA 1CGYA 3DEQA 1NF0A 2ISSA 4C6DA 1E1EA 2ISDA 1N8IA 4GINA 5DY2A 1MDLA 2NX1A 4GVGA 1ODUA 1HIZA 1S5VA 4KERA 5E9XA 2E1WA 1FA2A 3BMXA 4H9TA 2C1GA 1J01A 1YNPA 1S2CA 3EWBX 1KBBA 3ANYA 2VEKA 1OYBA 3KOFA 5E09A 2D3NA 3D6NA 3TYBA 4K8GA 1PAMA 1UP2A 5BMWA 4X9YA 2O9PA 4MPQA 4IP7A 3KE0A 1J2BA 2QUMA 1YPXA 2Y85A 2ZUMA 1P7TA 4JTUA 4G1NA 3DFTA 2P8BA 1MXSA 2OGJA 4ENLA 1E72M 3OBAA 4PCTA 1EPVA 5CZSA 4L65A 2ZUUA 4J1OA 2PTWA 4S3BA 1F4AA 5TBOA 2ZYFA 4H00A 7ENLA 1R3VA 1TV3A 2B7NA 1FFQA 3GTXA 4MUPA 2WO5A 4AAJA 3ES8A 1CXKA 1TZ9A 2PA6A 1H09A 1TZZA 4A3HA 1VYRA 1JL8A 2E25A 1H4PA 1DVJA 1K70A 3N1AA 4M6QA 1XRTA 1JZ4A 4N9BA 5CBIA 3W7QA 5CZJA 3WH9A 2QJMA 3MBFA 3U3HA 1BXBA 1LQAA 4FK9A 4ZZ9A 3JR2A 1VJZA 4A22A 1RALA 3B0XA 1QW7A 3VD5A 1GG0A 2EBNA 3J7HA 3WMLA 2GQ3A 3ABXA 2QAPA 3LNPA 2X1UA 1UR4A 4Z08A 2BODX 3NM1A 2J66A 3QLDA 4A35A 2QJGA 3KVJA 4CCCA 4Z17A 3IJ6A 4UNIA 1TX2A 3REQA 1JCYA 1PCWA 3IAQA 1FHUA 3W7EA 2WNNA 3IRDA 4GQRA 3N73A 1A5LC 3DX5A 1M65A 2EJAA 1G1YA 1LUCB 1L0PA 2F84A 2DEPA 4I5RA 1XFBA 3O7UA 4KH2A 1E6PA 2MNRA 1HFBA 1A3WA 3DFYA 5KETA 1RA5A 3B4YA 3QGVA 1ENUA 3UYCA 2P3EA 1V02A 4CQBA 4IJBA 4GIYA 4WJ8A 1KFJA 2VQUA 4J5NA 4B5XA 2AL1A 1XLAA 2YXGA 3WJSA 3ZLGA 3RM9A 1W3TA 4RDYA 3VOHA 4CD5A 3O1NA 4AU0A 4DLMA 3RIKA 1LTDA 1VBJA 4LUSB 2HXUA 4DUXA 1GOXA 3KOZA 4REQB 2PWDA 2HWGA 3EWYA 3ZJ6A 2OOFA 2WHMA 3N17A 1TJ0A 1YTDA 3W1LA 1OD8A 1W0MA 3LQGA 3MWCA 3FIGA 2E9LA 3MSRA 2YL5A 1BVWA 2Z24A 1ZSXA 2X05A 1MQPA 5EMMA 1FCVA 1KFEA 4JHZA 3NQ2A 3L23A 1JI1A 4F0MA 4IL0A 1MNSA 2CKSA 1TQJA 1OX5A 1A5OC 3R25A 3TN3A 4IISA 2Y62A 4YLWA 1KRMA 2Y5JA 4LUJA 4OT7A 4Z2HA 1IGSA 3MHUA 4GD0A 3WEOA 2WLYA 1DJQA 1GTEA 1JDEA 1P7TB 4W5UA 2JE8A 2NQLA 1GZGA 1IZKA 1SR0A 4PCSA 3EDFA 3GB6A 2W0UA 2WSKA 4GKTA 3E49A 3U0HA 1BWVA 3GM8A 1MXGA 3QV8A 1OINA 4D2JA 1QBBA 3VKCA 4AW7A 4MIMA 2PDGA 2HMCA 3ME3A 1F2JA 1Q13A 5AYZA 3RPDA 1TR9A 3N4EA 1K6AA 4IMFA 2VOMA 4BQ4A 3FXYA 4DF2A 3POCA 3XINA 1UR2A 5FKYA 3ARYA 1L6WA 1ISYA 1YHTA 3PBMA 4R85A 5CGQA 3SEPA 1QPRA 2YCJA 4PB3A 1CNVA 1RQEA 3UW6A 1XYMA 2DUAA 3CL8A 3W7IA 4Y2WA 2ZXAA 3V7PA 3A9IA 4CUCA 1G67A 2J88A 3PFRA 1I0DA 4EANA 3WBWA 4DYEA 1R2TA 5A6TC 3NQCA