2CYGA

Crystal structure at 1.45- resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
b'IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESGWPSAGGGAEASTSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQKAGGIEQNFGLFYPNKQPVYQISF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-1, 3-glucananse
publication title Crystal structure at 1.45-A resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
pubmed doi rcsb
molecule tags Hydrolase
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cygA00
3UG4A 5GNXA 4U31A 1CTNA 2XPKA 2X0HA 2OWCA 4B9ZA 1V3KA 2BVDA 3BCFA 1E6QM 4AWEA 4PCSA 4NRRA 4UFJA 1QBAA 5E6YA 3L4UA 5E0CA 1TR1A 2XSBA 1WDRA 2DSUA 2JF7A 3VDHA 1E4LA 5DF0A 3VIOA 1GHRA 4L4OA 2YL5A 4PBGA 2ZX8A 2AOSA 4H2CA 2WHMA 1ISZA 2XFYA 5BXRA 4MTVA 1GNXA 1NQ6A 2DT1A 3VNZA 1JZ2A 2E4TA 1H2JA 5I5RA 5M3WA 4JL1A 1DEDA 1XH0A 3BCDA 2WMGA 1PIGA 1DWAM 2PI6A 1KQYA 4MJ4A 3GH7A 1UHVA 2C0HA 3NSXA 3ZSTA 4HMDA 2BY1A 5IHSA 1E6XM 2VUYA 2Y8KA 2WVVB 1FFQA 1PEZA 4P7NA 1H41A 4X9YA 3SCNA 2W91A 4TVCA 3T0BA 2GK1A 1Z32X 1UH2A 5D8WA 4KWUA 4WJXA 5I6SA 4HOZA 1JFXA 3RM4A 1XYFA 3SUSA 4RE3A 4J3WA 3NUKA 3WQ4A 2V5DA 1GJUA 1GOMA 3SCWA 4CN4A 3SCSA 3WNKA 1PJ9A 3BSGA 3QHMA 3CO4A 1JDDA 4TX6A 3T09A 4CGTA 4AD5A 1NWSA 3IJ7A 1CGYA 4BCEA 4PSRA 4URIA 2WW5A 3MUZ1 4MAVA 4ZXOA 3WENA 1J10A 3VM5A 1J11A 4J3TA 5I24A 5FKYA 1NARA 1EHAA 2PWDA 3TONA 2J4GA 1BQCA 3TA9A 3WNOA 3KL5A 3PZMA 1ESWA 3QHOA 1JG9A 3G6MA 2YA1A 4F8XA 1F4AA 1W9XA 4X0VA 1E0XA 3WKZA 5A3HA 4PTWA 1VIWA 2G3MA 2CHNA 3VGFA 1BVNP 1CXEA 1FH9A 3AROA 3WF4A 4JCMA 3AIQA 3N17A 4NZCA 1KFWA 3FXYA 5BXPA 1KWKA 1TUXA 4ATLA 1HJXA 3M7SA 3MS8A 1JI2A 3RO8A 4FF5A 1M53A 1KWGA 3WF3A 1GPFA 2D20A 1ZBCA 1SMAA 2BVYA 1M01A 3A4AA 2J7EA 3PBGA 3ZJ7A 1M7XA 3PTMA 3ARWA 4DM2A 4AD0A 3QOKA 1NWUA 2V3FA 4R5EA 4PRWA 5HDRA 3VDBA 1UWUA 4LPCA 5D9NA 3WH6A 1E1FA 7CGTA 2XVLA 3VIJA 3WELA 2BHYA 3BAYA 5JBEA 1JDCA 3T0DA 3WDPP 3TTQA 1KBKA 1V0MA 3EDEA 2EJ1A 4CD6A 4W5ZA 1B1YA 1BG9A 1GORA 1G9HA 1OT1A 2E8YA 1UWIA 3CUIA 3MMUA 1WCGA 3WD0A 2FGZA 4PMDA 1TA3A 3WNPA 2CETA 2GK1B 1JYVA 4AD4A 1UR8A 4AIUA 2G3JA 2J7FA 1CENA 4ATWA 2XIIA 1PAMA 4J3VA 4RE4A 3T08A 2J7BA 1GVIA 5A8OA 3O9NA 1V6XA 3KWXA 3THDA 3HJEA 2WCAA 3SIMA 1EO5A 2OYMA 2WHKA 3VX0A 1HP5A 2YA0A 1QHOA 4AZGA 1JXKA 1CGWA 1Q6CA 3ARQA 1R85A 3LMYA 2XYLA 3FHQA 1DWIM 3WBAA 2CITA 1ZJBA 2QPUA 5D8ZA 5JUVA 3U5YA 1US2A 3SURA 1UQZA 4W84A 4AD3A 8CGTA 5A8NA 1A3HA 1W1VA 3PZIA 2GJPA 1H11A 3BAJA 3A6OA 4OZOA 3WUFA 2J7GA 5C70A 2GDVA 1EGZA 5HOSA 1ZJAA 3L2MA 3PZ9A 1I1WA 4GZJA 5EB8A 3WUGA 2GJXA 3OGRA 1MQRA 3VIKA 7A3HA 4W8AA 1NP0A 1SYTA 3K1DA 4M80A 3WNNA 1NM9A 2YOCA 5ECUA 2CPUA 2WCSA 3AQUA 1E5JA 1W2VA 4D1JA 3RIKA 2VCAA 4HMCA 3W26A 3UR7A 4IPLA 1K9TA 5BYWA 2VO5A 5I77A 4A3YA 2V3EA 3VIHA 1GOQA 1UH4A 2JIEA 3IAPA 1W32A 4WF7A 4OIFA 2DDXA 4QLLA 3VO0A 1C91A 3BAIA 4WKFA 5ABFA 4H8VA 3AFBA 4DUVA 1MFUA 2HISA 3AXHA 4W86A 3L4WA 3VD3A 2A3EA 5CXPA 2CBVA 4U3CA 1TFVA 4BF7A 2PBOA 5GQBA 1BYDA 1FH8A 4PMYA 4AEEA 4CCDA 1W3KA 2VT0A 2WVUA 3ZT6A 2EPMX 5HPCA 4ACZA 1E70M 1GQLA 4A4AA 2YA2A 2CBIA 3VU2A 4AMCA 4PUDA 1E1EA 4AISA 1TA3B 3QR3A 3B9EA 2EPLX 1J0HA 5HPOA 4GZEA 1Q6DA 2WWCA 1MQQA 3CHEA 3VIIA 5IFPA 2GJRA 1UA7A 4M1RA 3RPMA 4IISA 3CHCA 2OYLA 1DWHM 5IFTA 2JE8A 1D7FA 2O9RA 1E6NA 1OIMA 3VD5A 3WL1A 5CLWA 4CN6A 3W82A 2WYSA 3WEOA 3MV01 2W4XA 2VCCA 4WK9A 1XSIA 4TUFA 3WD2A 1CWYA 3WDQA 3GH4A 2D24A 4DWSD 1QOXA 1BTCA 2WLYA 1OGBA 2EPKX 2ZUWA 4QFUA 1KXTA 1R7OA 3WMBA 3LPPA 1XV8A 4B9YA 4JHOA 4U2ZA 2WCGA 3WQ8A 3WFZA 1R7AA 1G94A 1UG6A 2V5CA 3EMQA 4KH2A 3LPGA 5DMYA 2G3IA 1FFRA 3RMEA 4ATDA 1HKMA 2VZUA 5LA1A 2EQDA 1CXLA 1ECEA 1E4MM 1QNRA 2VZTA 2W61A 3AXXA 1G0CA 4N42A 4P8WA 1DTUA 2GJXB 1V03A 3K8KA 5GNZA 5DT7A 4M81A 3MKKA 4BA0A 1UR2A 5CSYA 4HPGA 4OUEA 2EPNA 3GXIA 4GO8A 4UZUA 1DP0A 2DEPA 4ZE5A 2WSPA 4B16A 4XB3A 2DQXA 1CXFA 3AICA 2EBNA 3BAXA 4DUWA 3AMKA 4Z2HA 4JAWA 4XV0A 1MW2A 5BRQA 4MNLA 1TVPA 4FLOA 4PMNA 1GONA 3QOMA 1PPIA 5CLTA 4RE2A 4YPJA 1W9DM 2O9OA 2XHYA 1TG7A 3PHAA 2XGBA 2VX7A 3E1F1 3BMWA 2DIJA 3WUBA 3OLIA 4HOWA 3MU7A 3LPOA 4PTXA 5E70A 1HJUA 3AYSA 4W7UA 5ABHA 1HVXA 3AJ7A 3ZT5A 1JI1A 4ACZB 4ZFMA 3T0AA 2XG9A 4D6IA 2ZXQA 3KL3A 1LWHA 1BPLB 2PWHA 4LYRA 1HKIA 4MPKA 5DT5A 4JHZA 4AZCA 1LG1A 3S2CA 3AHVA 3AHXA 1XSKA 3BGAA 1E6SM 1BVZA 4WSKA 2J8GA 2PWEA 4CVWA 2XVKA 2VMFA 3W4RA 1FA2A 1FHLA 1EHNA 1UKSA 2IUZA 4HA1A 3AOFA 5CPSA 2D0GA 3ZJ6A 1NH6A 4F66A 1TVNA 2QLYA 2YKKA 3ALFA 1UA3A 1ITXA 3VD7A 4TTGA 3IAQA 1BFNA 3K8LA 4EKJA 3OLGA 1EDQA 2D3NA 4J28A 1WPCA 1V3MA 4UOJA 1JZ5A 1E73M 1R87A 3APGA 5BCAA 1R86A 4KRTA 3AIWA 4Z2IA 1L8NA 3IJ8A 3F5JA 1HF6A 3VIPA 2DSVA 1B31A 1UWTA 3VINA 1LJYA 2OLHA 3PTKA 3THCA 4C7FA 1GOOA 3W0KA 1OM0A 4WIWA 3IK2A 1B2YA 2WVTA 3KZSA 5LA2A 3OGVA 5HNNA 1CGVA 3QGVA 1HJSA 3WH8A 3VGBA 1WB0A 5EMYA 4UFMA 3WF2A 1E3XA 2WANA 1UD8A 1D3CA 2QMJA 4M56A 3WQVA 3O6AA 1WZKA 1LL6A 3PZQA 2Y24A 1WZAA 3GNPA 3IANA 4W85A 1G5AA 4UOQA 4MNJA 2OSYA 3W25A 4DWSC 1S46A 1PZ3A 3GXFA 1QNPA 2ZX9A 3EDDA 3ZMRA 2XM1A 5I2UA 1US3A 4PTMA 1FH7A 2YDQA 2D0FA 1H49A 4AIOA 1E15A 2D1ZA 3GDBA 1BYAA 4QCEA 1B90A 4JFVA 1BGAA 3MSGA 4H7VA 3AIEA 3AS2A 1IT0A 1H3GA 2FGLA 3CH9A 3GBEA 2CEQA 5HBFA 3MUAA 1CNVA 2AMGA 2C7FA 5JIPA 1ZB5A 1V02E 1VFUA 1HNYA 4A3HA 3WNMA 4R27A 5D9OA 4EE9A 4AZCB 7TAAA 5FOOA 1JIBA 4BQ5A 3ZQ9A 1XH1A 3N11A 4OJYA 1E0VA 2JIWA 2UY4A 4HTYA 1JZ4A 1CLXA 5I79A 1GUVA 1O6IA 1WAWA 3T2QA 2WMHA 4JIEA 1UYQA 2X8RA 3VDAA 2DGAA 1JZ3A 1MXDA 4MJ2A 1XSJA 3OG2A 3WUEA 4U5KA 9CGTA 3KEHA 3WN6A 4E8DA 4W89A 1V6UA 2YJQA 4D6DA 3CHDA 1Q4NX 1K9DA 2Y4SA 3AIUA 3FW6A 2NT0A 2ZUMA 4AZIA 1B3WA 4PMVA 1QI2A 2ZXAA 4TX8A 3RJYA 4PMOA 4CN1A 4D6CA 4W7VA 1A47A 2VL4A 4YHEA 1GW1A 1E6RA 3O2LA 2RGMA 1W1TA 3EMZA 2DH3A 2VURA 1C90A 1ISXA 2XJ7A 2XIBA 3OLEA 4Z2KA 4CU8A 3B8SA 4FMVA 1K9EA 4UFKA 5A6LA 1ZBKA 2DPEA 3VIMA 2Y2WA 5IHRA 1OB0A 2W67A 5CZKA 5AYIA 1AQ0A 1PX3A 4H8UA 5A2AA 1JAKA 1MW0A 1VFOA 4ZXLA 3MMDA 4E2OA 4AZ6A 1KGUA 2WMJA 2DH2A 3GZAA 1VRXA 1E0WA 5A6JA 3EYPA 1F4HA 3WMCA 1CXHA 2VC9A 1LF1A 1EIBA 1W2PA 4U2YA 3CZGA 1NP2A 2BHUA 3N18A 2CBJA 3NSNA 1VF8A 1JZ6A 2E8ZA 1JXJA 4HZ8A 5CG0A 3WF0A 2GDUA 2Z1SA 3PZVA 2BHZA 1LQ0A 1JAEA 3CBWA 1HN1A 1QI4A 3WDRA 5IDIA 1UD2A 3VD9A 2FHCA 4LYQA 2BNJA 4C7DA 3S6TA 3BXWA 1W9BM 1DWGM 4CUCA 5HXMA 2CBUA 1C3FA 5FL0A 3HN3A 1BF2A 2ZXBA 1CZ1A 1V3IA 3VIGA 4HP5A 3AMCA 4M8UA 1TCMA 1QW9A 2CKSA 2E9BA 3GH5A 4PUEA 1UZ1A 4H41A 1B3ZA 3FY1A 1J0KA 2UY5A 2CESA 3AS3A 3CUGA 3WSUA 3F5LA 3WH9A 4CU7A 2QF8A 3UEQA 1JF6A 1UKTA 2ZUSA 2ZIDA 4W93A 3GBDA 4DWSA 2ZUVA 2BS9A 1UR4A 1GQKA 1ZBVA 2DT0A 2RGLA 2W66A 4UR9A 2OWWA 1UD4A 2WKGA 2UY3A 2ZUUA 4D72A 3SCPA 5IXEA 4Y7EA 1JYXA 4B15A 2J7DA 4GXPA 1LLOA 1XYZA 4TTUA 4HU8A 3CZKA 2XVGA 3GM8A 3MUY1 4AZ7A 1HVQA 4U3AA 1B9ZA 3A3HA 4BQ4A 2DT3A 5A6AA 3K8MA 4D71A 3LPFA 1CGTA 1QPKA 3OZOA 1J01A 1ZU8A 4GPNA 5EFFA 3WEMA 1XHGA 3MO4A 3VPLA 3ARZA 4AXNA 4WSJA 1VFMA 4MAZA 2XSAA 1UD6A 1JYNA 4XZWA 5GPRA 2HVMA 4HOXA 5A2BA 1CIUA 4CU6A 2UWFA 2VZVA 2VX4A 5D9MA 1W9VA 4TVDA 1E3ZA 1KGWA 3SCUA 1E6PA 3POHA 3OB8A 2WVSA 3DYMA 5D4YA 4WLCA 5TD4A 2JFEX 4F9JA 1OBAA 2XUCA 3CTTA 1RH9A 4UOZA 2D3LA 2ZUNA 4CD4A 3WEZA 1AQHA 1UWSA 1TZ7A 2PWFA 4CVUA 5FL1A 4CD7A 3ARXA 3U5UA 3WF1A 5CGTA 3TOPA 3TTOA 1OGSA 2G4FA 2XWEA 1C7TA 3VDCA 2VQUA 1LL4A 3PTQA 5FD0A 2WC4A 1X6LA 4HA4A 6A3HA 4B3LA 4HZ7A 2TAAA 1QW8A 4S3JA 1C92A 1U2YA 1HL8A 2CNCA 2WZEA 5I3DA 1WNOA 1X6NA 3ECQA 2NW0A 1VFFA 5AY7A 1KXQA 1WO2A 3ARUA 3WQ5A 4PSPA 1C8QA 1WE5A 4UCFA 4HZ6A 4DUXA 1FHDA 5E6ZA 3UR8A 4DWSB 5CSUA 4LYPA 2F8QA 3CHFA 3AIBA 2YL6A 4K68A 2BXYA 1JYWA 1FP8A 1JGIA 2X1IA 3WBEA 3AMGA 3CZLA 4JL2A 2A3HA 4JFTA 1LG2A 1MXGA 1EO7A 2XTKA 5AYBA 1SR0A 2WZHA 2Z1KA 1B3VA 1IZJA 1MW3A 2EO7A 3BAWA 4J3UA 1ZS2A 1W3LA 4D6HA 1UD5A 2E9LA 5A6KA 1BLIA 3II1A 4XUYA 5I78A 1UD3A 3MUIA 5JBFA 2C8NA 2O92A 4XX6A 2VRKA 4UQCA 3VMPA 4JKMA 2BY3A 3WMSA 2VCBA 3RDKA 5E09A 3EMCA 3VTRA 2VR4A 4AZ5A 3MV11 3W28A 3M46A 1CXIA 4P7OA 2ZICA 4NSBA 4EK7A 3PZGA 3CPUA 3VM7A 3CZEA 1ODZA 2ZX6A 5E0FA 1AMYA 1ZBWA 3ARRA 2WLZA 3FNDA 4M82A 2D2OA 4E8CA 3POCA 3PZNA 1B3XA 3WQWA 3AIRA 4GQQA 1CGUA 1OCQA 5D9PA 4HA3A 4AW7A 1XCXA 4QLJA 1OIFA 4PCTA 1IZKA 1J0ZA 1EH9A 5ABFB 3UG5A 1EQPA 1RP9A 4ACYA 1OWQA 3OBAA 2DSZA 2XVPA 4MNMA 3VUPA 1Q6FA 2Q8XA 1E72M 2D23A 3WFLA 3N1AA 1CPUA 3N9KA 4J27A 6TAAA 4ML4A 4MB4A 2ZE0A 2DIEA 2J8FA 1XD1A 4J3SA 1W1PA 1V0NA 4KRUA 4LQ1A 2OSWA 2G41A 1W1YA 1GQIA 1QHPA 3OA5A 1OD8A 3AYRA 3GXDA 4AIEA 4PEEA 2OSXA 3SCVA 3W6MA 5I0DA 4V2XA 3K46A 4NRSA 1WDSA 1BYBA 3TTYA 1U33A 4WKAA 4QP0A 1GOKA 3J7HA 1M03A 5BWFA 3PZTA 3OLDA 1W9UA 2WVVA 1GHSA 1XCWA 3DC0A 1D2KA 4D6GA 4UFLA 2WXDM 4MDPA 2ESCA 1VB9A 3L4YA 5ABGA 1KCLA 2A3AA 4KGJA 2G3NA 3DYOA 1C8XA 4S3KA 3OGSA 1E56A 1I1XA 2X09A 4BS0A 4BZYA 2WWDA 2JEQA 4MB1A 4M29A 1E6ZA 3W29A 4OBSA 2VQTA 2FDMA 1JF5A 2QHAA 3DHUA 1BSIA 4AD1A 5A6SA 2ZX5A 2J78A 1HIZA 3ARPA 4NF7A 2PC8A 2CYGA 2CKRA 2VTFA 2D0HA 4PMZA 5GNYA 4Q7NA 1RD6A 3AHYA 4PTVA 2BY2A 3VOCA 1GZJA 1VEMA 1G1YA 1NWTA 1NOFA 4AYSA 4KGLA 2E9MA 2WKLA 2VZOA 8A3HA 1K6AA 4AZHA 4CKQA 4F9DA 1C8YA 2YBUA 3RM9A 1V3LA 2QV4A 3VILA 5CGMA 1OT2A 1V3HA 3BLKA 4IM4A 2V3DA 3CIVA 2WMFA 2YDRA 1JL8A 1PIFA 2VZSA 2W5FA 1B3YA 1VEOA 1EDGA 2WBKA 1UR1A 2JF6A 1GJWA 1HXJA 3PZOA 3AISA 1FOBA 1X1NA 2ZWYA 3EDFA 2VVNA 5EBAA 3MANA 2WNWA 3DYPA 3B9DA 3ZJKA 2WHJA 3VKKA 1WP6A 2AAAA 2J25A 1KQZA 2WK2A 2YLLA 2FHBA 3N12A 2BFGA 5KZ6A 3FN9A 3N15A 3WNLA 1IV8A 3VD4A 1ISVA 3BH4A 2A3BA 4NI3A 1JNDA 4H8HA 5E9AA 4J3XA 3ZSSA 3UG3A 3SEPA 2E0PA 3VMNA 1KGXA 1EXPA 2PWGA 3KL0A 4LGXA 4TVUA 4D6JA 3ZO9A 3SUWA 5CJ5A 4LX4A 1OINA 2EXOA 3CUJA 3A47A 1KCKA 3BSHA 2YIHA 2IXVA 4V27A 2IXUA 1QBBA 5JIWA 3HMCA 4UQAA 3FAWA 2XM2A 4QDMA 3W27A 2X0YA 3W37A 5C71A 1HJWA 1DWFM 1M04A 2J74A 3ZR6A 3RILA 1J0JA 4P7QA 5M03A 1UKPA 4MB3A 1OSEA 3U7VA 4P7RA 5C8BB 3WL0A 1C7SA 5AC5A 4Z2GA 2F61A 1E55A 2WMKA 1JZ8A 3NIYA 3WD1A 1CDGA 4CCCA 5A1AA 1V3JA 1W91A 1VAHA 1PX8A 4X0NA 4GIAA 3HU7A 3CZJA 2VNCA 5I23A 2QMKA 4UFIA 4IUGA 3L4XA 1UUQA 1OGGA 3SCRA 1V02A 2NSXA 1ZL1A 2YL8A 5JBDA 3GYCA 1E9LA 3NJ3A 1UWRA 1B30A 1KXVA 3W53A 5FIPA 1JD7A 3W6LA 2V38A 3RCNA 1QI0A 4FLSA 6CGTA 3WH7A 4TXEA 1ODUA 1V0KA 5BROA 3AHTA 1WZMA 3GXMA 3OIHA 2ZX7A 3AZTA 5A94A 2VVSA 2YLAA 1HJVA 1KR1A 2D22A 3WIJA 3B9AA 2WB5A 1UR0A 3CUHA 2XGIA 4TOQA 3CUFA 2ZUTA 1RP8A 1QVBA 1MWOA 2ZXDA 5FCZA 2WC3A 2X2YA 1E4NA 1MVYA 3U7BA 2QPSA 1VBUA 4BQ2A 1BYCA 3BLPX 2VOTA 4PN2A 3SCQA 1UR9A 4FK9A 3AMLA 4GO9A 1NOUA 2WHLA 4ZE4A 4D6EA 3W38A 4AC1X 3W81A 4DM1A 2ZWZA 3ZT7A 4GI9A 4PMXA 2O9PA 2XFRA 2DSWA 4F79A 1VEPA 5KEZA 4V28A 4JKLA 1JNEA 3A4XA 3ZOAA 5A8MA 2CHOA 3VGGA 3VX1A 3N04A 2WAGA 2J7CA 3DHPA 4PMQA 3ARTA 3WDJA 4CCEA 2FHFA 4OOZA 3WD4A 2YL9A 2CCRA 1CEOA 1CLVA 1JD9A 4UQDA 4D6FA 1KR0A 1MQPA 4PYSA 1CXKA 4FLRA 3VVGA 2WBGA 1BHGA 1RPKA 3UCQA 4GZIA 2VI0A 4PMRA 4GI6A 4EANA 5M5DA 5A8QA 2GSJA 3F5KA 3CGTA 2JEPA 1I75A 1EOKA 3CMGA 2O9TA 1V6WA 3NCOA 1EDTA 1QNSA 2GUYA 3ZR5A 4KMQA 4GINA 4JFWA 4W5UA 2JALA 1J12A 2VX5A 3PN8A 1TMQA 5A6BA 4RL3A 3UETA 1Q6GA 1BAGA 2WMIA 3TP4A 1EA9C 3L4VA 1UKOA 4BQ3A 4JKKA 3MSDA 3FAXA 3QHNA 4YN5A 4ZENA 3SUTA 4C7GA 1GOWA 1G01A 1HKKA 2FH6A 1K9FA 4UZSA 2PBGA 2WM0A 3AXIA 4MNKA 4XZBA 3SCOA 3VNYA 3WQ6A 1WDPA 5M17A 3NDZA 1DWJM 2G8ZA 3T2PA 2VX6A 1P6WA 3M07A 2J79A 3AS0A 1KB3A 4LXFA 4QAWA 4U33A 3JUGA 2XWDA 1WZLA 5CPQA 5BXSA 1BG4A 4E4PA 3RM8A 3I3EA 3ALGA 5EFDA 4CD5A 3VGDA 3VGEA 2OWXA 3N13A 2E3ZA 3UESA 5A69A 1QNOA 2W62A 5DFAA 1H0IA 2WC7A 1J0YA 2J47A 2GFTA 1QI5A 2PB1A 4CD8A 2BV9A 4MADA 1CGXA 1UWQA 3GNOA 3BAKA 1XC6A 4HU0A 2XVNA 3BC9A 3ZIZA 1DHKA 3ZJ8A 2BVTA 1W3JA 3AMDA 4FLQA 2Y8VA 1XRVA 1JFHA 3A4WA 2PF0A 4J7RA 1E40A 4L4PA 4UNIA 3VGHA 2J62A 1QNQA 1OD0A 1V0LA 1H09A 4P8VA 1EOMA 4W88A 2B31A 1U30A 3SCTA 2VR5A 5DEZA 2EEXA 1KXHA 3T2OA 1SMDA 4P8XA 3VIFA 1J9YA 1H4PA 1HP4A 4P8UA 1KBBA 4OBRA 1FP9A 2BXZA 2Y5EA 4MDOA 3EDJA 2YDSA 4HMEA 3AS1A 3CMJA 4PMUA 1V6YA 3MMWA 1VJZA 2UY2A 1Q6EA 3AI0A 1ISWA 5ABEA 5A95A 1AQMA 3GNRA 1JDAA 1XGZA 4AY1A 1GVYA 1PZ2A 1HJQA 3AHZA 2J77A 1LL7A 4H04A 4UQ9A 3TTSA 3W24A 5A6MA 5AC4A 3KE0A 2VRQA 1L0PA 1JZ7A 2WMIB 3GTNA 2CIPA 1NWRA 3ARYA 5LA0A 5A6BD 4Z2LA 2DSKA 1UQYA 1CECA 2VRJA 1B0IA 4EAMA 2VJXA 4YHGA 5A2CA 1H5VA 1YHTA 1HKJA 4UTFA 3IJ9A 3NYDA 1E4IA 2EPOA 2OYKA 1HL9A 1VENA 4GI8A 3EDKA 2A3CA 3WH5A 3NDYA 2ZOXA 1UKQA 5CPTA 5BRPA 1XD0A 2WPGA 4UQBA 5CQ1A 2F2HA 3WDIA 1LWJA 4HPHA 1PBGA 1H0GA 3DECA 3AIVA 3F4VA 4GKLA 4N0RA 2YBTA 4JCLA 3D5HA 4D1IA 3M6DA 3PZUA 2W92A 4B3KA 1UH3A 1N82A 4OOUA 5A8PA 2V3GA 4P7LA 1MYRA 1ITCA 3I3DA 1HT6A 1CYGA 4UFHA 3EBVA 1C93A 4JFUA 2WSKA 4UQEA 1E71M 1SFSA 1QHZA 4GQRA 2W63A 4OKDA 4ZEPA 3WDHA 1AVAA 1MFVA 4W8LA 5DO8A 4JFSA 1GQJA 2BY0A 1NOWA 3AZSA 1UOKA 2J75A 1VBRA 1EQCA 3WY1A 1J18A 3L4TA 1J0IA 1V08A 3RJXA 4MB5A 1GCYA 5LYRA 3K4DA 1R8LA 2CERA 2J7HA 1Y7VA 4AEFA 3ZM8A 4U5IA 1ISYA 3SUUA 4AZBA 1GOIA 4W7WA 3AZRA 4W87A 4WKHA 3D3AA 1BGGA 2E40A 2DT2A 1MW1A 2GVYA 4M24A 4QLKA 1HX0A 2MANA 1PX4A 2XFFA 1WKYA 3NSMA 4W8BA 3ARSA 3G6LA 1H1NA 1QI3A 4Q22A 4QCFA 3L2LA 2X05A 3CLWA 3FHAA 1TE1A 1E5NA 3ARVA 3CZ8A 3I3BA 1VJSA 1E43A 3L4ZA 3OZPA 1CBGA 3K4AA 1V6VA 1W9PA 4JZ5A 3VMOA 5BXTA 3BMVA 3UERA 2CXGA 5F7UA 1WDQA 1YQ2A 4Z2JA 1XH2A 1W3HA 2WZIA 3SUVA 1UZ4A 3U57A 3WD3A 2FH8A 4AD2A 4IPNB 2NT1A 1O7AA
chains in the Genus database with same CATH superfamily
4I9MA 1CTNA 3P93A 2XPKA 1G7UA 2OWCA 1X96A 3TU9A 2MNRA 3BCFA 4XZHA 4H19A 3HA1A 3EAUA 3L67A 4NRRA 4JIPA 3UWZA 2NWRA 1TR1A 4EVZA 3M0LA 1WDRA 2C91A 2DSUA 3VDHA 4LS0A 3STFA 3GR8A 4O0KA 2NV1A 4GBUA 3S4TA 1DPMA 4E4UA 3Q45A 3WJSA 1NQ6A 3VNZA 1A5AA 3BARA 3ITGA 2E4TA 3NL5A 5FJOA 5M3WA 1A5LC 1PIGA 2PLKA 4MJ4A 3TYEA 3NSXA 4LOCA 1RBLA 1IWAA 3ABQA 3KXQA 2BY1A 2QT3A 1E6XM 3R25A 1YXCA 4Q4QA 1ZGDA 2EG6A 2XH4A 4P7NA 1H41A 3SCNA 4QJ4B 1EFZA 2DZBA 3TLQA 4TVCA 3TSBA 3T0BA 3WLPA 2GK1A 1Z32X 4FXJA 2XINA 1A5BA 2PDGA 4NZ3A 3B3DA 4RE3A 4K1GA 4IPIA 3G1DA 3SCSA 1EKOA 1W8GA 1JDDA 4DXVA 1AZ1A 4REQB 1XKJA 4PSRA 4TIMA 4URIA 3MUZ1 5ECVA 4ZXOA 1AH3A 2O0TA 1A49A 1J11A 1VPXA 1EHAA 4KCUA 3PZMA 4B2DA 3UG8A 3QHOA 3WG6A 4HNVA 4F8XA 1RCQA 1W9XA 3SN4A 4X0VA 3BL3A 3APTA 5A3HA 4RX0A 3SDOA 4ADUA 4KF1A 2NXGA 3ATYA 2CHNA 3RLHA 3LV6A 4MWAC 3HPAA 1P0KA 4ZQPA 1RUSA 3IIXA 3FXYA 3NGJA 4O10A 4XZNX 1KWKA 1PKYA 3MHGA 3WF3A 3A4AA 3ITTA 3ZJ7A 3O07A 3EOUA 5HJLA 3MVIA 1KRAC 3QOKA 4R5EA 1TX0A 1X7IA 4AUBA 3E38A 2VR2A 1XBYA 1PTAA 1V77A 4Q8QA 5D09A 1UWUA 4FEZA 4LPCA 3WH6A 4Q7IA 4LBSA 4KPLA 3VIJA 3HO8A 2BHYA 1CI1A 5JBEA 2J9YA 4IPJA 1JDCA 3BLEA 3OQ8A 1S5VA 3EDEA 1EIXA 2EJ1A 4V1XA 1B1YA 2IW0A 3GXPA 3N34A 3RGTA 3MMUA 3A9BA 1WCGA 3KW3A 2FGZA 4X2PA 4PMDA 1TA3A 1CB7B 3WNPA 3EEGA 3MWCA 5C7VA 2PGWA 4NHVA 4HN8A 1K8XA 1CENA 3SGZA 3EX2A 4ATWA 4WRHA 1AW1A 1ICPA 1NDZA 1VIZA 2Q09A 2C15A 3NG3A 2ALRA 1VYPX 1V6XA 3HFYA 5C9RA 4PCFA 2WCAA 4PB4A 1EPVA 3L5LA 4NY2A 6ENLA 4JNZA 2YA0A 1JXKA 1CGWA 1UW9A 2Q01A 1VFHA 2Z1VA 3LMYA 3FHQA 1U5HA 1RALA 3MI6A 1ZJBA 3W87A 3UNDA 1US2A 3SURA 1UQZA 3MUCA 4GIYA 4N02A 3BAJA 2WKJA 3EX6A 5FAJA 5C70A 3GUGA 5HOSA 3G24A 2BB0A 7A3HA 4W8AA 5ECUA 2CPUA 3RIKA 2VCAA 4S3FA 3UR7A 4IPLA 5F4WA 3OZMA 4HB7A 4JR5A 1JGMA 1UH4A 3P7YA 2V82A 4NIRA 3VO0A 1C91A 2INFA 2TMDA 5ABFA 3QMTA 4MUPA 4LALA 1MFUA 2QCMA 3WBYA 1SZRA 1F3TA 2I56A 3L12A 4N9BA 2PBOA 1KM4A 2ON3A 1ITUA 1FH8A 1MUCA 3W02A 4XKMA 1W3KA 2VT0A 3G1XA 4YXGA 2WVUA 3ZT6A 2EPMX 4ACZA 3UYIA 1GQLA 2FPVA 1F7BA 4G1KA 2V63A 3B9EA 1MMFA 4LUIA 1J0HA 3T42A 3KHDA 1E0UA 4IFKB 1Q6DA 2E09A 2WWCA 3CHEA 4QDWA 5IFPA 2AQVA 8RUCA 2OYLA 1F6YA 3BW3A 5IFTA 1D7FA 2J6XA 4LS2A 3VD5A 5CLWA 4JIHA 4CN6A 1KFLA 2Y61A 3W82A 2WYSA 4AC7C 1LYXA 4IGNA 5XIMA 4HNUA 2VCCA 1XSIA 4TUFA 3SRKA 4NI8A 2X30A 5TIMA 4Z1CA 3I10A 3S5OA 1H51A 1QXLA 1EF2A 1SZEA 2ZVRA 5T91A 4KW2A 3KRSA 3LPPA 1FWTA 4JHOA 1DJQA 4YJ5A 1R7AA 4LU0A 4S3GA 1G94A 3QKEA 5TBOA 2V5CA 4KH2A 1Y65A 5DMYA 1XIHA 3RMEA 1OFRA 5HWNA 2VZUA 3GU9A 2EQDA 1CXLA 1TR9A 3BICA 2DW7A 2VZTA 3SB0A 3RCYA 5DT7A 1IR2A 1IIGA 1UR2A 1S2WA 3GXIA 4UZUA 2V81A 3TLLA 5K7JA 3TROA 1FWRA 2Y7FA 1CXFA 1KC7A 2F7FA 1KBJA 2EBNA 1WXYA 2R91A 2QIIA 4Z2HA 1FDYA 1MW2A 5BRQA 2FZ8A 2GQ8A 4RW5A 3ABZA 4R85A 4Q8PA 4RE2A 4YVXA 2O9OA 2XGBA 2DIJA 4UTUA 3C4UA 2BGSA 3MU7A 3LPOA 4PTXA 1WYIA 2NUXA 1UOZA 3M5ZA 4OQVA 2XZ9A 3P2VA 3RN6A 3GIPA 4MG4A 4DF2A 1XJBA 3BW4A 2NWSA 4GZ7A 3LY0A 3RLVA 2PWHA 1A3XA 3OVQA 1M3UA 3NVDA 4YWSA 3S5NA 3WQOA 3S2CA 3C2YA 3I65A 2IKGA 1I2RA 3W72A 2QAFA 1BVZA 4WSKA 4FAMA 1OC7A 2IS7A 1FA2A 3UW6A 1GKRA 1EHNA 2ZRYA 4HA1A 4DO7A 2A3LA 2V2DA 2ZZ5A 1GVEA 1NH6A 5DLCA 5KETA 1TVNA 4F3HA 2YKKA 3ALFA 2CLPA 1JCTA 3OJGA 1IEIA 1UC4A 3CWOX 3D6NA 1RBOB 4HPNA 2EJAA 2B0MA 3BOLA 2PGFA 4J28A 3C2RA 4LAMA 2GSHA 4RXGA 4XSLA 4JQ2A 3TYCA 4FXRA 5T26A 1E73M 2YFNA 2E25A 4LTSA 3DEQA 3VOJA 4Z2IA 1L8NA 3IJ8A 3KVMA 2X1UA 4JTSA 4UMCA 4H6QA 4GJJA 3UZ5A 2OLHA 3PTKA 3IK4A 3P61A 4DXXA 1XXXA 2IKIA 5D2XA 1F3WA 3IK2A 5CJMA 1W8SA 1R9YA 4KRZA 4KEUA 1PDYA 1RCXB 3WF2A 1E3XA 2WZTA 4IJRA 2QMJA 4ADSA 2E6DA 1PYFA 3WQVA 2TYSA 1FCUA 3FV9A 5TF0A 3LI1A 1WZAA 3GNPA 4W85A 4CQDA 4G6CA 1M7PA 1D9EA 1TJRA 1MDRA 2OSYA 3R5EA 1YKWA 2WQPA 1YDVA 3O0FA 1QNPA 2ZX9A 4WY0A 4PTDA 1IGSA 3TAKA 1ALDA 3NQVA 1UZHA 1XLMA 3LG3A 4PTMA 2D0FA 4J4KA 2TODA 3OVPA 5C2GA 1A5KC 1E15A 3R0KA 3UJSA 3ZR4A 4AEOA 2YZ5A 3DN5A 3ZZ1A 1YBQA 2OB3A 4YVVA 3QGAC 1RJRA 1J93A 4QTGA 1GJPA 5HBFA 3PNZA 3F2BA 3PFMA 2AMGA 1ZB5A 4ZTYA 4QE5A 1VFUA 3D47A 4X60A 2BGNE 1HNYA 4A3HA 2VGBA 3TWBA 2EG8A 3LBCA 1TKKA 2F6KA 2YW3A 7TAAA 4WJEA 4O1BA 4UTMA 4GUGA 2YDAA 1FWJC 3TFCA 4ZBCA 5JH1A 1L9WA 4C6EA 1DIKA 1WAWA 4A3RA 4JIEA 2X8RA 5DXXA 1JZ3A 1MXDA 1XSJA 3WUEA 2ONEA 3KEHA 3WN6A 4W89A 1I9CB 2BGQA 3FW6A 1Z42A 2NT0A 3URAA 4AZIA 4PMVA 4TX8A 4MPQA 4PCPA 3MJMA 5CC7A 1E6RA 2VURA 1K8YA 3QC3A 5BOEA 2XJ7A 1ZUAX 5G4WA 2XIBA 2PDMA 3IVTA 4Z2KA 5ENLA 4UFKA 3LGEA 3FVDA 1LZOA 4MLJA 4XAZA 3S1UA 2F2KA 1PX3A 4H8UA 5A2AA 3EXRA 1KGUA 5AZ0A 3GZAA 4QSHA 2E68A 4Z17A 4INFA 1LF1A 3GG1A 5CZTA 5K9XA 4PB3A 1V51A 4XAPA 2OCZA 1DIOA 1SQ7A 2E8ZA 1JXJA 4HNCA 1F8MA 3TE9A 1R30A 2BHZA 1LQ0A 3EWBX 4PEKA 3CBWA 3TUUA 3TQ0A 1U1UA 3VD9A 1BWKA 1TVLA 4LYQA 2I14A 1GKPA 1WKFA 4FIRA 4O14A 2DZTA 5HXMA 2CBUA 4JGDA 4LNYA 2E6FA 1YNQA 5CBJA 5G4HC 1BXNA 3STCA 4O18A 4C6KA 1XPYA 4YYFA 4QG8A 1R38A 1V3IA 3GIYA 1RBAA 4HP5A 4RDWA 2W3ZA 3NO5A 4Y9NA 4M8UA 3EPOA 4ZSTA 4PUEA 4NQ1A 1RY0A 1F8IA 1E9YB 3WSUA 3T78A 4CU7A 3DENA 3GD6A 5JU6A 4W93A 1YE6A 2BS9A 9XIMA 1GQKA 2DT0A 2WKGA 2UY3A 4GYPC 5AN7A 3IGXA 4UBPC 4L9XA 3OA3A 2J66A 4B15A 2J7DA 4GXPA 3UPBA 1YXYA 2W27A 2XVGA 4QIUA 1REQA 2B81A 3KBSA 3W86A 4Q8MA 1HVQA 4XO6A 1T40A 4JTJA 1LDCA 4GY7A 4D71A 3LPFA 2CZ5A 4FS9A 3T4CA 4GPNA 3RO6A 2HS6A 4AXNA 3CB3A 3TAOA 2QF7A 2PS2A 1JCMP 1JYNA 3ZWSA 1ZALA 5A2BA 5CG7A 2C14A 5MHBA 3LTPA 3MB9A 3BK0A 2DORA 3FX4A 5D4YA 4I6KA 4LB3A 1PSCA 3KAOA 5TD4A 4F9JA 3CTTA 1GKQA 2Y85A 3M0KA 1RH9A 1XLAA 3OZYA 4Q8VA 1D3GA 4CD4A 3IJLA 4M6QA 4O1FA 2FB3A 5FL1A 1W5PA 3WF1A 1OFEA 3NTYA 3N4EA 3E02A 3W1NA 1Q63A 2XWEA 3AU2A 1XYLA 1LLZA 1C7TA 3N6HA 4AQLA 2P3EA 3ITLA 1TYGA 4KWWA 1X6LA 4HA4A 3BJSA 4O0QA 3R12A 3MY9A 2WZEA 2G5WA 1GYMA 1IR1A 3ECQA 4NJHA 4XVDA 1B3OA 3CQKA 3UXAA 4RKAA 3C5QA 4UCFA 1SGJA 4HZ6A 2PZ0A 2CHRA 1TPH1 4LYPA 2F8QA 3CHFA 2FZDA 2EPHA 1JYWA 1FP8A 4GQGA 1JGIA 3WBEA 1D8CA 3M0YA 3IJQA 4L6OA 5D03A 3LCWA 4JFTA 2NVAA 5AYBA 3LI0A 1H7RA 2Z1KA 2WZHA 1OK6A 4L1XA 3LLDA 4NZ4A 5T8GA 4I7VA 2E9LA 1BLIA 4OE7A 5I3IA 4XUYA 5I78A 1YIXA 1UD3A 3OU8A 4POCA 4LC6A 4JKMA 2BY3A 3WMSA 3PS7A 2VCBA 5KZEA 1RAKA 4AZ5A 1EP2A 1CXIA 4FO4A 4P7OA 2ZICA 1S3HA 1VKFA 4EK7A 1P0DA 1EX1A 1Y5WA 3VM7A 2X16A 1ODZA 1QPOA 2BOEX 4E2BA 2UBPC 1UPMB 1DQWA 4M82A 4E8CA 3POCA 4BKNA 2VC7A 2QJJA 3QZEA 3BGJA 1CGUA 5EL1A 3RMJA 3EWUA 3W2JA 3TNBA 3VOGA 4AW7A 4DN1A 2BTMA 1LBFA 1IZKA 1J0ZA 1SU5A 5ABFB 1H62A 2DJXA 5HMSA 4GX9A 2GUUA 2WJEA 2OZTA 3M5YA 4MNMA 1TWDA 1XLHA 3VUPA 4UTKA 2D23A 7REQA 1VH7A 3N1AA 3QQ0A 3STEA 1CPUA 1DTNA 3N9KA 6TAAA 3LXCA 4MB4A 2REQA 2HWGA 2ZE0A 2DIEA 1PUDA 2NSOA 2J8FA 1J96A 3TCSA 3FFSA 3ABOA 4LCSA 4RNHA 5DRCA 1GQIA 3OA5A 1OD8A 5DELA 2X42A 2Y88A 1SSDA 4PEEA 2E6YA 3O8AA 4JTQA 4O1CA 3HB9A 4A22A 1W31A 4O13A 4L7ZA 4M0XA 3KRBA 3KUMA 1EZ2A 3J7HA 3PZTA 3H54A 1VFSA 3DC0A 3LHZA 1RVKA 3VOHA 1YTKA 3R6IA 3DIPA 2H9AB 4KGJA 1R3WA 3IIVA 1DQUA 4DXKA 1C8XA 4S3KA 2ZZ4A 1I1XA 1X1ZA 3TDFA 4WOQA 2JEQA 3KBJA 4MB1A 4QISA 2E6AA 1Y0EA 1AJZA 4ORMA 2VQTA 1DXFA 3NQDA 4YVPA 5A6SA 3GX9A 2XIJA 3IVUA 2NUYA 4PMZA 1GPWA 3N9SA 3U2CA 4O1DA 3UBPC 3MSYA 1G1YA 1JCLA 1NWTA 1NOFA 2VM8A 3EXSA 2RFGA 3URNA 3TNOA 4AZHA 8XIAA 2ZCGA 4F9DA 2OG9A 3RM9A 3Q65A 3CS2A 4ZMGA 5CGMA 1V3HA 2O7QA 5G1TA 1D7KA 3PUDA 1EJUC 2QUTA 2YDRA 3S2NA 1FQ0A 4OV4A 3F7JA 1W3IA 1B3YA 5D32A 4N9DA 3EZ4A 4C6FA 3IWPA 4WXZA 4NT0A 3CIXA 3WFAA 3ISIX 1EYEA 3GHRA 4RZ5A 2WNWA 3KOWA 3B9DA 3P0XA 3VKKA 3G0XA 4QGCA 1QJWA 1KQZA 2J25A 3PBMA 1FCBA 1C9WA 1OJXA 5KZ6A 2PDFA 3GNNA 4IL0A 3FSTA 3FN9A 3HQOA 4OGZA 3R58A 3C0JA 4L61A 3Q58A 1ISVA 3PNUA 2Y70A 1ONEA 1JNDA 4AVOA 2DP3A 2GLKA 3ZSSA 2R8WA 1FXQA 4LGXA 4DB7A 1KBIA 2BMBA 3I7QA 4D6JA 4JN6A 4FHAA 3ZO9A 1DORA 1H50A 1TWIA 3GR7A 1OINA 5CJ5A 3FS2A 3A47A 1KCKA 1EYWA 3BSHA 2IXVA 5BNKA 4UNKA 1KRMA 5JIWA 3W27A 1HG3A 1WBHA 4DYEA 4FPSA 4Y9OA 5HULA 5C71A 1M04A 2J74A 2I17A 1UBPC 3O63A 4P7QA 2Z28A 5M03A 1OSEA 1V8EA 2YCLA 1C7SA 4P61A 3R7MA 4UTJA 1GW9A 2F61A 4JN8A 1MZRA 3O05A 1JEZA 3NIYA 3WD1A 2A7NA 2C6QA 1VAHA 2FTWA 2VOMA 4F2UA 3E0FA 4B5VA 4GIAA 4A05A 3CZJA 1F6KA 3SJNA 1F3XA 4PBFA 4Y6GA 1AA1B 1ZL1A 4NAEB 4NJKA 3W7JA 3FDGA 2AQWA 1E9LA 4LYKA 4RE0A 1KXVA 3VUSA 5I09A 3W53A 1KTNA 4LAKA 4R9OA 3W6LA 1PIIA 2R9RA 1QI0A 2UV8G 3IUHA 1T96A 1UZDA 3S1GA 3AWOA 1V0KA 2BZNA 3AHTA 1WZMA 2FJKA 3GXMA 3NPXA 2OLAA 5C9UA 2QCNA 3AZTA 3T4WA 2AGKA 2X7VA 3G2GA 3WIJA 1EJXC 4DYJA 2OVLA 3CUFA 1RP8A 5FCZA 3CHVA 2WC3A 2Z2UA 4F0SA 2R1MA 2QPSA 1L2QA 1VFTA 4XVEA 3SCQA 1UR9A 1KFJA 4GO9A 2Z1WA 3NQAA 2OQHA 2C0AA 1I2NA 2QVNA 4D6EA 1A80A 3W81A 2BX7A 4DM1A 4JIRA 4GI9A 1YXDA 4HNOA 2HE8A 3CH0A 3G5EA 2ATSA 2VEGA 4V28A 4JKLA 2QCEA 4E2DA 5CZJA 3G3MA 3NGFA 2PMQA 2HBVA 3NQ8A 1FTXA 2CHOA 4O52A 4RZ6A 3VX1A 3P67A 3A5VA 3VNLA 4UTWC 2CU0A 4RJEA 4AMAA 1RV8A 1WXJA 2P3ZA 2FHFA 5I3GA 2CCRA 1CEOA 4JN7A 4O16A 3K5XA 3D0CA 3A3XA 2A85A 2NQ9A 4DJDC 4MYXA 2VI0A 2OOGA 3IIPA 4H6KA 3IGUA 5E93A 3TSMA 2JEPA 1VHNA 2C1GA 2X1TA 1EOKA 3R89A 4A6GA 1EDTA 1QNSA 2GUYA 3ZR5A 5CZ0A 2AL2A 4KMQA 1R9XA 1A5MC 3OEXA 2JALA 2VX5A 3GXNA 4I5RA 1YNYA 3NL2A 5FF0A 4RUBA 3ABXA 3HZ3A 1XYMA 1EA9C 3B4UA 1ZY9A 3UWYA 3CK5A 1Q2SA 3QHNA 2HE5A 2V9DA 3HG5A 4R34A 2FH6A 3H6OA 2VGFA 4GXMA 4UR7A 4YMZA 3PBYA 1R3RA 4XZBA 3VNYA 3WQ6A 2VYOA 3NDZA 3T55A 1P6WA 1V6TA 3P74A 2AKMA 3AS0A 1YDOA 4NNAA 4JX4A 3TX9A 3W7HA 5CPQA 1U83A 1BG4A 1OFPA 1AJ0A 2ZZ3A 3H21A 2DZXA 5EFDA 4CD5A 3UP8A 3VGDA 1YPXA 3LTYA 3N13A 1NU5A 5FJIA 1QNOA 2NZLA 4HT3A 2OPJA 2INZA 4PUUA 1EF3A 2GFTA 1BRLA 2GSEA 4CD8A 3W22A 3GR4A 4DIAA 1CGXA 3GNOA 1SW3A 3BAKA 3N6JA 1FX6A 1Z89A 1QT1A 2NLYA 4K36A 3ZIZA 3ZJ8A 1MUMA 4Q32A 3ZLFA 4FLQA 1JFHA 4HK6A 4ROPA 4IFOA 3LX9A 2PF0A 2VC6A 2FFCA 4UC5A 4UNIA 2ACUA 2J62A 4LCRA 4W88A 2B31A 4K8EA 2VR5A 5DEZA 4P8XA 1TPDA 4YTQA 1HP4A 5I7GA 4U10A 3VK5A 3LA4A 5FI8A 5FESA 2YDSA 4AB4A 5AB3A 3DFPA 3AS1A 4PMUA 1QPRA 3MMWA 2QAPA 2HROA 2UY2A 3E6EA 1FKWA 1REQB 1TPB1 2Y7DA 4DNHA 2VFFA 3UGVA 1AQMA 3EX1A 1T8QA 1XGZA 1GVYA 1VFLA 1OX6A 3AHZA 2J77A 4H04A 2ZDRA 5A6MA 1B4EA 4NL1A 1QO2A 2D69A 3GTNA 5E1QA 4US5A 1NWRA 4LVBA 4B92A 4Z2LA 2P76A 4GHRA 2ZZ1A 4HGXA 2VJXA 5A2CA 1JUEA 4BI5A 3FA4A 2OODA 4UTFA 1UBSA 3NYDA 1XIDA 2OYKA 1HL9A 1VENA 1DJHA 2B7OA 2A3CA 4I9JA 4HHPA 1JPHA 2ZOXA 4JHMA 5CPTA 3OQEA 2PUZA 2W9MA 4UQBA 2H90A 1TIWA 2Z4GA 1XG3A 3HIJA 1PBGA 1ECQA 3RU8X 1H0GA 4HSNA 1F2JA 3PUEA 4FOKA 2W92A 1UH3A 4JBRA 4OOUA 1SUXA 1MYRA 3I3DA 1HT6A 2AL1A 1S39A 4HNTA 4WXYA 2BOFX 2WSKA 1E71M 1SFSA 2W63A 4MKSA 2QJIA 1LM1A 1PCKA 1JDEA 1GQJA 4U28A 4LY4A 2F6XA 5DCDA 1UOKA 1MI3A 3S3GA 4WR3A 2ZQ0A 1IZCA 2HK0A 3AYVA 4FX6M 2B7NA 3GB6A 4PH6A 3T44A 2GOKA 3K4DA 2AGTA 4IGHA 1Y7VA 2BASA 4AEFA 1I0BA 3MTWA 4Z08A 3WK3A 3AZRA 3W83A 3VOIA 2GVYA 4M24A 4MWAD 4QLKA 1HX0A 1XLDA 4MLRA 4H9TA 4W8BA 1WDDA 3TJIA 4WQ6A 1ZAJA 1U22A 1TMHA 1TE1A 1L8PA 3ARVA 4O54A 1NIUA 1CBGA 3NDOA 3PR2A 3BMVA 1WDQA 4IPPA 4S3CA 2O7SA 2OEJA 4MKVA 3QR1A 2OEMA 2EAWA 2NT1A 3LGGA 4HNLA 1G67A 3GG0A 3WBWA 4F0HA 2ISWA 3NPVA 4NP7A 1XIJA 5MKGB 1V3KA 3C3NA 5IRPA 2CLEA 3O1NA 1E6QM 1GTEA 3E2QA 3M64A 3EPMA 2NV9A 4JNMA 3VOFA 2F9RA 1QBAA 2Y7EA 2OKTA 4QHRA 3DU0A 1JVNA 3GDMA 2XSBA 2POZA 2JF7A 3DAQA 1GHRA 2H6RA 3HOJA 4NAFA 4PBGA 1Z44A 4H2CA 3QTGA 2WJDA 2XFYA 5BXRA 1GNXA 3UWQA 4C6LA 4NYUA 9RUBA 2NXIA 1H5YA 2C79A 4JL1A 5TNVA 3BCDA 2WMGA 4F0KA 3WLRA 4J1OA 3QY6A 3QTPA 1QWKA 2CZFA 4RW3A 3G0SA 5IHSA 4B5WA 1X38A 1SJDA 2O4QA 4XTIA 3A5FA 4X9YA 3G0UA 3PY2A 3LRKA 2QDGA 1CW2A 4O8RA 1OCBA 3RM4A 2B7PA 1QR7A 2XIMA 5HUPA 1US0A 2V5DA 3G1VA 3EKZA 3LK6A 3WJWA 3QHMA 1RLCL 3CO4A 4K1WA 4CGTA 2FIQA 2E1DA 4HK5A 5IOBA 3A13A 3NO3A 1TJPA 3VZYA 4LVGA 3WCZA 4UCGA 3VM5A 3KM8A 5I24A 3WQEA 5DRIA 3TONA 3SRHA 1ESWA 3MP4A 2NQ5A 3GY1A 3CU2A 4JEJA 3B03A 1JG9A 1U1HA 1F4AA 4FB7A 2XH7A 5CJNA 3WKZA 1W5NA 1QNVA 4PTWA 2PP3A 1H7OA 1VIWA 2G3MA 4NKCA 4AH7A 3LN3A 3H2FA 4JOMA 1YTDA 3EKGA 2PP0A 2X7WA 4JCMA 3R11A 3N17A 1KFWA 5BXPA 4ATLA 3S9IA 1EEXA 1FCVA 1JI2A 3RO8A 4ZQRA 4JEQA 4E4FA 1SMAA 3RRXA 3RF9A 4KS0A 1WV2A 3PBGA 3TMQA 1XBZA 3WK1A 5HQMA 1TX2A 2KX9A 3PTMA 4JXCA 1RR2A 4AD0A 1GVQA 5LNSA 2PD9A 2V3FA 3L5MA 4KIRA 2X40A 4PRWA 5HDRA 4MYAA 4QSFA 1AFSA 2HTMA 1HO4A 3T8QA 1E1FA 7CGTA 3KTSA 3CQHA 3WELA 5C9XA 3BAYA 1BKSA 3CUZA 3E12A 3T0DA 3WLTA 1V0MA 2I9EA 3UY7A 1ME9A 2PDQA 4IQDA 4C91A 2BODX 3B05A 3NQEA 1GORA 1G9HA 1OT1A 1UWIA 2EKGA 3CUIA 4MKNA 2ZBTA 3WD0A 2NX1A 3GKFA 2QS8A 2WM1A 2ZRZA 4NJIA 1UR8A 2G3JA 3AJXA 3EKLA 4ALDA 3S47A 2WSRA 3T08A 3IJIA 2ALDA 3O9NA 1JPMA 2PGRA 3NR0A 2GDQA 3A12A 3U0HA 4KWSA 1QHOA 4WDXA 2QCFA 3ARQA 4IT1A 1R85A 3MVTA 1DWIM 2WZMA 4UNLA 5T9CE 5GVJA 4B4FA 1Q66A 2CITA 5ABTA 1O5KA 4NNCA 4FNTA 5LIYX 1A3HA 4MF4A 2GJPA 1H11A 4GIRA 3B8IA 3M5VA 4OZOA 3N2OA 2GDVA 1EGZA 4E5TA 4ICNA 3BVJA 2W0UA 4RZBA 4K2SA 2KZHA 1NP0A 1SYTA 3WNNA 2YOCA 4JTTA 2WCSA 3E96A 2VFIA 3AQUA 3MZ2A 5AKQA 4HMCA 3DI1A 3W26A 3W7RA 3KZPA 1G69A 4RNIA 5BYWA 1R46A 1W37A 1RQEA 2G0WA 3GVRA 1IXNA 3IAPA 1IEQA 1W32A 1OC6A 5CGQA 3GO2A 1OG6A 2E67A 2HISA 3AXHA 3E9AA 1VC4A 1BKHA 2A3EA 3E5BA 5CXPA 5LXXA 2CBVA 4U3CA 1KM5A 4YCOA 3UQNA 3Q67A 1EJTC 1JPIA 2VFGA 1JUBA 2VEKA 1B57A 3DFOA 4AEEA 4CCDA 3KCLA 3MCOA 5HPCA 3S0CA 4N4QA 3P84A 4Y2WA 4A4AA 2NQLA 3QC0A 3GZ3A 5HAOA 4PUDA 1E1EA 1N8WA 1SJCA 4RK8A 4AISA 1QASA 4GD0A 2Q6ZA 3VIIA 2A4AA 2Z2AA 4IISA 3RG6A 2OZ3A 3CHCA 1DWHM 1OIMA 2VFEA 3WL1A 1EL3A 4Q6XA 3UR2A 3MV01 2W4XA 3QV7A 2XGZA 3GHTA 4RPPA 3GH4A 2CFFA 4XO7A 2AL2B 4IQLA 4ZB2A 1OGBA 2ZZ6A 4LW7A 1GGOA 5K4XA 3H2MA 1KTCA 1XV8A 3CM4A 2R1PA 4U2ZA 1DKWA 2Y0FA 5AZ1A 2DJLA 1RQBA 3EMQA 1A4MA 2RUSA 2G3IA 3MDWA 1XLJA 3P81A 1K8ZA 1HKMA 1E4MM 1QNRA 1JQVA 3W7MA 1P0EA 4Y96A 3FLUA 2W61A 3S1WA 4N42A 4P8WA 2GJXB 5GNZA 4XBJA 4C1NA 2ANUA 5CSYA 3LV5A 2DEPA 1SPQA 1KFCA 4XB3A 4RXFA 2DQXA 1UB3A 3AICA 1R2SA 7PTDA 3ONBA 4CEXC 3GDRA 4PMNA 1GONA 1IIHA 3QOMA 4JQ3A 1PPIA 3KOXA 4EWJA 4Q3MA 3TR2A 4WDWA 1W9DM 1TG7A 4HCHA 2VX7A 3E1F1 3RAOA 1MRAA 3WUBA 3LZ5A 1ZAIA 4HOWA 3E0WA 3H53A 4D8ZA 3EA1A 1PHQA 4HJFA 4W7UA 1PYMA 3AJ7A 4XBKA 1JI1A 1Q4WA 2WNZA 3QZAA 4DF1A 4JS3A 3T0AA 2XG9A 3DFHA 3KL3A 3BLDA 1LWHA 5EBUA 3ZVHA 4MPKA 5DT5A 4JHZA 4AZCA 3MJYA 3AHVA 4AY7A 4MWAB 3THUA 1XSKA 3BGAA 4DWDA 3PBWA 1R3TA 1ZHAA 3IIZA 3TN3A 3R8RA 1UKSA 3PUOA 2Z7GA 5LSMA 5CPSA 3LSBA 3ZJ6A 4F66A 4Y90A 2PU1A 2D2JA 3BZGA 1UA3A 3IEBA 3UGRA 4TTGA 3IAQA 3K8LA 3OLGA 5DCBA 3GWQA 1BWLA 2DVTA 3V1HA 2J13A 4BJHA 5SWUA 3APGA 2F38A 3T07A 1R86A 5BCAA 3AIWA 1RSCA 1ZAHA 2Z7KA 3SN0A 1RQHA 3VIPA 2DSVA 1J8VA 5DX7A 1J6OA 2PZNA 5IM51 1UWTA 1I6NA 1LJYA 4C7FA 5K2ZA 3CPRA 2I16A 3W0KA 1ICQA 5HNNA 1CGVA 3DFQA 3QGVA 4FP1A 1IXQA 5AYYA 1U5VA 4RCXA 1UD8A 1D3CA 1UPPA 3CQJA 4QNWA 3O6AA 1W3NA 3PZQA 2YXOA 3FA5A 4NXKA 3MT1A 4UOQA 3UWEA 3UCDA 1YEYA 5F4XA 1AZ2A 3B4YA 1S46A 4ZCWA 2XM1A 1UP3A 4IMGA 4WDUA 2OOFA 2YDQA 1H49A 1B9BA 2GVLA 1Q8AA 1XDJA 3GDBA 4HYVA 3UWUA 4QCEA 3B8DA 3MSGA 1OZMA 4H7VA 3SQMA 1EA0A 3AS2A 1H3GA 3PB2A 3T40A 3MUAA 1UUMA 3RLGA 2TSYA 2C7FA 5JIPA 2HVOA 2OX1A 4LVFA 4JX5A 3T81A 4CNUA 3WNMA 4R7OA 3ANUA 4EE9A 3W07A 5G2WA 1ZCOA 3TW6A 1AW2A 1RY8A 3R79A 1EZWA 3N11A 1K7XA 1QU4A 5DY3A 4S1FA 1EBHA 2JIWA 2UY4A 4HTYA 2PE4A 3APYA 4LUTA 1JZ4A 6REQA 3T2QA 4AG0A 4PCNA 1S2TA 1UYQA 3VDAA 1TCDA 3GE7A 4HZMA 2DGAA 4WUIA 4LV9A 3OG2A 4E3TA 5DN1A 3E2SA 3MHFA 3NQBA 4F48A 2FKPA 4G7EB 4K7YA 4U5KA 2YJQA 1KD0A 3QEZA 4D6DA 1Q4NX 1HQTA 1K9DA 2Y4SA 2ZZ2A 3PAJA 4LEFA 1X97A 3CC1A 1J4EA 2ZUMA 3FOKA 2VEMA 3ANVA 4W7VA 2VL4A 4LUYA 3O2LA 3MBDA 1W1TA 3EMZA 1DJIA 3GG8A 1NDVA 2GL5A 3UXIA 4GLEA 3W7PA 4ZOBA 1YLVA 5A6LA 4J40A 2DZVA 2Y2WA 1K4GA 2W67A 5AYIA 2WNQA 2V69A 2NVCA 4IJCA 4HSOA 2XU2A 1VFOA 3H2OA 1VRXA 5LNRA 4GBDA 3UR5A 4LH8A 3WMCA 2DUZA 5FF4A 4LAOA 3JS3A 2BOGX 2DZUA 4GNJA 2FZMA 1F6PA 5HMFA 4QAIA 2CBJA 1Q2RA 1JZ6A 4YIWA 3W1UA 4H7CA 2Z1SA 1V4YA 7ENLA 1KM6A 1DJNA 2WJFA 3VABA 4HN4A 2BNJA 3S6TA 3RFAA 1W3TA 1W9BM 4S2BA 3HN3A 3NXFA 1OYCA 3C2VA 3I6EA 3W1LA 2ZXBA 3EWCA 3W9ZA 1TPWA 4HPXA 4H41A 1B3ZA 2UY5A 4AWSA 3GVGA 1M7JA 3W1XA 2QF8A 3GC4A 2Z29A 3UEQA 4IMCA 1UKTA 2ZUSA 1XQLA 3FDKA 3TW7A 2L5HA 3GBDA 4DWSA 1ZBVA 1BTMA 2RGLA 1R3VA 4ENLA 3BG5A 4I5UA 1WXZA 2Z2BA 2OLSA 3LHUA 4IF2A 1HFBA 4GG9A 4IQJA 3SCPA 3O16A 2PDLA 5AFDA 1UP2A 2Z0IA 2V5LA 4C6BA 1TPFA 4D8AA 3VFCA 1LRNA 3GM8A 4BQ4A 4MZ8A 3TQVA 4Q4MA 3AO0A 3KS5A 1DV7A 1N8IA 3K8MA 1QPKA 1QWGA 3QXBA 1ZU8A 4Q4KA 1TELA 3UJ2A 3WEMA 3MO4A 3ARZA 3M0JA 2IKJA 4WSJA 4KCWA 3MI2A 4ZVJA 3MDUA 4M7SA 4UTTA 3PJWA 3TYUA 5GPRA 4HOXA 1CIUA 8TIMA 3KBWA 3HBLA 1W9VA 3OP2A 4TVDA 3OB8A 2WVSA 3LENA 2JFEX 3GK0A 3L0KA 5J04A 1T5AA 4HNNA 2XUCA 1ONRA 3IS4A 1NFBA 2D3LA 3N9RA 4QNEA 1AQHA 1UWSA 3PC0A 1TZ7A 3PSVA 4CD7A 2GWNA 3NOEA 1LOSA 3IV3A 3UJEA 3TTOA 1OGSA 1Q5MA 4GCAA 3VDCA 1O1ZA 5K4ZA 1OX4A 1LL4A 1VZWA 1A5CA 5G1MA 5FD0A 4B3LA 1EC9A 1MEIA 4ICCX 4S3JA 1ITQA 2CNCA 2PDKA 5I3DA 5BOFA 2V2CA 4QBXA 1AG1O 4J2PA 1IHIA 2NW0A 3ITCA 2R1NA 5AY7A 1WO2A 1OFBA 4M6UA 3ARUA 4XQ6A 4M6VA 1C8QA 1WE5A 1XYAA 3TV8A 3EOLA 3TCEA 4DUXA 1FHDA 5CSUA 3UR8A 3B9NA 3L21A 3SQLA 1FRBA 2VC5A 1XISA 2BDQA 5G2HA 3KCJA 3LCIA 3AMGA 4EAYA 2OELA 3M47A 3NQCA 2A3HA 1G4TA 3LLXA 1LG2A 3OVRA 1XC4A 1EO7A 2XTKA 4AX7A 4XAYA 3B0YA 4UMAA 1MW3A 2V68A 3BAWA 3RK8A 1W3LA 3KX6A 2I5QA 1CT5A 2O92A 3ANYA 4XX6A 4I9TA 4UQCA 3VMPA 1OABA 1E9ZB 1AJ2A 2VP8A 5E09A 1XGDA 3VTRA 3MV11 4JQAA 1J2WA 4UTIA 3ABSA 3GTIA 3PZGA 3CPUA 2OZ8A 2QUMA 4XWUA 2ZX6A 1AMYA 4EF9A 3R1ZA 4TMBA 2QUNA 3LHYA 5LNUA 1R0MA 5AC7A 3WQWA 2Y5SA 5LGXA 1OCQA 5D9PA 4LNCA 4GC4A 3C2FA 5D2WA 5TAOA 2KAUC 4FNQA 2ASHA 3E0IA 1HGWA 4GQ0A 4ACYA 3DC8A 3TQKA 2DSZA 2XVPA 4G2DA 4OWGA 1Q6FA 2Q8XA 3WFLA 4J27A 3M0VA 3QPEA 4ZL1A 3MBFA 1AD1A 4J3SA 1KLYA 4FR1A 3HM7A 4H3DA 2G41A 2JKAA 3XISA 2XFWA 5AECA 5M2FX 1QHPA 1ZJIA 3C61A 3TJLA 1P43A 2O4MA 3CUXA 4QS5A 2OSXA 5I0DA 4NRSA 1BYBA 1P7TA 1WAUA 1AL8A 3NQGA 1GOKA 5CC3A 1QOPA 2OGYA 1W9UA 4JD4A 1ADOA 5HWMA 3GFZA 4K8GA 4MDPA 3VI2A 5ABGA 4HU4A 1CCWB 4CQ8A 3KHJA 2G3NA 3DYOA 1RPXA 3W7QA 4BS0A 2Q8LA 2V8ZA 4DO5A 1DVJA 1ZJHA 2FDMA 1JF5A 2RDXA 1BSIA 4AD1A 5HNUA 5FEXA 4Z1DA 3ARPA 2CYGA 2D0HA 4ES4A 4EPKA 3QF0A 5GNYA 4Z42C 3CL8A 4PTVA 2BY2A 1GZJA 5CC5A 4CEUC 1LT7A 4Q8OA 2VEFA 4KGLA 4C1NB 2GJNA 4OVXA 2VZOA 8A3HA 1K6AA 6XIAA 2YBUA 3I6RA 3A24A 2ZVIA 5JMUA 2QV4A 3VILA 5FF3A 1OT2A 4IM4A 4EXBA 4GACA 5LIWX 2DZAA 2ISSA 2V3DA 4NZJA 2EGZA 1X39A 4JYEA 1LQAA 3OPSA 2VZSA 2W5FA 2HBXA 4BEUA 4OT7A 2NX9A 3TZFA 2HCVA 2WBKA 1UR1A 2PSNA 4GFIA 1KO0A 2BVWA 4JY9A 4H6EA 3IV8A 3PJTA 5HJXA 1FOBA 3FK4A 2IPJA 2WV8A 3B04A 1V79A 5EBAA 3IUDA 2A21A 2CLOA 1NDYA 3SO7A 4CQCA 3VNDA 2WHJA 2CLLA 1H7NA 1WP6A 4HIBA 2GYIA 1KNWA 4NZ1A 3PWGA 2FHBA 3FEMA 3M0IA 3WLQA 2BFGA 4DJDD 1O5QA 1Z6KA 4O57A 1TMLA 4EPDC 1IV8A 2A3BA 5AC8A 3TYDA 4IX0A 2XDFA 5E9AA 4J3XA 1F73A 2PTZA 3ZVHB 3M0MA 1XIGA 3U4FA 2YGYA 2PWGA 1XIFA 1R3SA 3REQA 5C55A 3ZYZA 1ICSA 3PG8A 5U4NA 1KKRA 5EGRA 3MYPA 3H7VA 4LX4A 1E9IA 3CUJA 5KZDA 3KTCA 4AU0A 1SO5A 4MM1A 1DYSA 4KESA 3LM7A 3AXMA 2IXUA 3TN6A 4UQAA 3FAWA 4A21A 3MCNA 2XM2A 4RDVA 3W37A 1O68A 1HJWA 3H2AA 3MI3A 1BXCA 3ZR6A 3CV2A 4GABA 3U7VA 3TEVA 4Z2GA 3ZXWA 4QDPA 1YE4A 5LZLA 1LROA 1TWZA 2WMKA 3LBOA 2XZ7A 1CDGA 5A1AA 3EB3A 1V3JA 4X0NA 2SFPA 4HYWA 4N9CA 3GIQA 2Y6ZA 3NQ2A 2VNCA 5I02A 3N25A 4IUGA 1VPYA 3L4XA 1UUQA 3N19B 4BI6A 3B0VC 2QJNA 1EP3A 4PB5A 2H8ZA 1F07A 3MSRA 3QY8A 2JQXA 5CPNA 5JBDA 3R13A 3PSWA 3P8JA 2A0NA 1B30A 1XLBA 3CASA 2LLEA 3W2KA 2JGQA 2XISA 3T7VA 2GQ3A 1JD7A 3CPGA 3DKLA 2V38A 3SR7A 4L64A 4D8LA 1ODUA 4WJ8A 3WLSA 3OIHA 1TRDA 3JRKA 3V0TA 3DGBA 1ZENA 1YADA 3VCNA 2FVLA 1Q6RA 3PUGA 3B9AA 2WB5A 2XH0A 1UR0A 3CUHA 2XGIA 2ZRUA 4TOQA 2JBMA 3ZS4A 2ZXDA 3V36A 2OTDA 1E4NA 4JY8A 2QCDA 1VBUA 3BLPX 5TQLA 1TTPA 1AODA 1A5OC 2PCQA 4S23A 1RK5A 1QRQA 2WHLA 3OTRA 5E9XA 3GS6A 3DERA 3W38A 3EPNA 5A8GA 1E51A 1VRDA 3ZT7A 4IWWA 1DJYA 4IMDA 4DJFA 2DSWA 2RJHA 4IHCA 3UWWA 3NM1A 2PLCA 4KIEA 4RV3A 2A79A 1XBXA 2OT0A 3PVFA 4RZ4A 3HMJG 3VGGA 1P6BA 3N04A 4QEEA 3LS9A 1EGMA 2J7CA 2HNEA 3WDJA 5AHEA 3BJTA 4OOZA 2YL9A 4KQNA 4ORIA 4FNRA 4U4MA 2VD8A 4Q4RA 3A4JA 4ZB5A 4PYSA 1CXKA 1XRTA 4FLRA 1LORA 4F0RA 4IQEA 2WBGA 2YXXA 3FVMA 4LSBA 3W7IA 1ZRQA 3UCQA 3A22A 3C2EA 4JQ4A 9XIAA 4EANA 4YWIA 5M5DA 5A8QA 3F5KA 4XSMA 1LRQA 3PB0A 3BMXA 1UR3M 1JCNA 1K77A 1WDWA 3CMGA 4CNSA 4D9PA 3BPWA 4BR1A 1H1ZA 3BLOA 4JFWA 1ZP4A 1GVOA 3JW7A 2YBVA 3FKRA 3PN8A 3FEQA 5A6BA 1Q6GA 4AHQA 4WY0F 1V5XA 3UXLA 1P6CA 1UKOA 1PTDA 1XF0A 4B2DD 1MSSA 1P1MA 5FAGA 1G01A 1HKKA 2WM0A 3AXIA 3HPFA 5CPOA 4MNKA 3SCOA 2E7FA 4MWAE 3PANA 3M07A 4DF0A 4ZO6A 2E77A 4IIEA 3RYSA 3EA2A 4U33A 3JUGA 2XWDA 5BZAA 4QJ3B 5BXSA 4JTLA 4E4PA 3I3EA 1A0DA 2CZDA 5MF5A 4FXFA 3LD5A 2YFOA 4DHGA 2E3ZA 2NV2A 6PTDA 3W1QA 3UXDA 2W62A 5DFAA 2WC7A 1J0YA 1EGVA 2ZRVA 4X22A 3TWAA 4JYFA 2J47A 2PODA 3C2OA 1W1B1 3KOFA 2FJUB 4MADA 1P48A 4N6FA 4C6PA 3FJ6A 3LTSA 4HU0A 3BC9A 4FF7A 3SY5A 4KETA 3IJ6A 1DHKA 2BVTA 3FSUA 3UVIA 2Y8VA 4JTGA 3OBKA 2GQ9A 4AF0A 2PDCA 4L4PA 3DESA 4PRTA 4NXSA 4AWUA 1QNQA 3QY7A 1EOMA 2FMOA 2EEXA 1UIPA 3T2OA 1J9YA 1H4PA 3BO9A 4JTIA 3VKJA 4DNMA 4M1BA 1KBBA 2GWGA 1HGYA 2BXZA 2Y5EA 3EDJA 3U3HA 3G22A 1UP0A 4MZYA 3KS6A 3TXVA 3AI0A 1K7EA 2YYTA 5A95A 2OQLA 3DFTA 3GNRA 4A8IA 1JDAA 1HJQA 1R47A 2X0SA 1PO9A 3KDOA 4UQ9A 2BG5A 1EC8A 3W24A 3GAYA 4Y9AA 5AC4A 3KE0A 2WMIB 4JX6A 5A6BD 3SW6A 4A2RA 4O12A 6XIMA 2VRJA 1FWWA 5L6UA 1OEPA 3IJ9A 1BQGA 2VUNA 3QSTA 1E4IA 3JU2A 3RX4A 3EDKA 4AYGA 3O6DA 3G1FA 3W7OA 1PZ0A 1EJWC 2RDTA 5BRPA 4BFAA 1E1CB 5JVLA 1LWJA 4HPHA 3DECA 4DLFA 4GKLA 1TV8A 3ITOA 1OQFA 4JCLA 3Q37A 1PDZA 3PZUA 4B3KA 1TZZA 1N82A 1XRSA 3M0ZA 4DJEA 3B0PA 4K37A 1LT8A 4UQEA 3BCJA 4I6VA 3K30A 1OX4B 4OKDA 3WDHA 5CC6A 2Y63A 3GQYA 5DO8A 4R7WA 3G1RA 3B8UA 1I8JA 3VKCA 2GVGA 5B7YA 1VBRA 4R7JA 3AALA 1J18A 4X2RA 3L4TA 5F2IA 1V08A 4AFYA 3VA8A 3QV6A 1GCYA 3UNTA 5FSEC 1R8LA 2J7HA 1OK4A 3ZM8A 4U5IA 1ISYA 4NUWA 1ME8A 4LANA 1KM1A 4GYJA 4BI7A 4W87A 1BGGA 2DT2A 2OO0A 2VHLA 2XFFA 4FNPA 5CAKA 3ARSA 1K3UA 1ZZMA 3G6LA 1QI3A 4QCFA 2DZWA 2X05A 4OUIA 2V67A 3CZ8A 3I3BA 2IKHA 1VJSA 4HHLA 3NXLA 3W85A 4REQA 3OZPA 5LHEA 1RD5A 3G1HA 3K4AA 4JZ5A 3VMOA 3MA8A 1YQ2A 1W3HA 2WZIA 1UZ4A 4KEVA 3U57A 3WD3A 4CNOA 2FH8A 1DJWA 4AY8A 4IPNB 3ES8A 2YXGA 3HQPA 4EWND 3KRZA 1JCXA 4GVHA 3PPFA 2BVDA 5XIAA 4IGMA 2Z27A 3VC5A 3WQCA 1NQKA 4ZO9A 3PTDA 4H9MA 4O1AA 3F4WA 5E6YA 3L4UA 1GT8A 2PDJA 4CCZA 1E4LA 5DF0A 3V1PA 3G8RA 2YL5A 1YDYA 2AOSA 4JIQA 4ZODA 3L5AA 1FWEC 2WHMA 2ZE3A 1J2BA 4QEHA 5BMWA 4MTVA 2NLIA 3GTXA 3TYAA 5J8LA 1ADSA 1H2JA 4GYKA 1DXEA 1XH0A 1DWAM 1Q7QA 4HA0A 1KQYA 3ZFHA 1IEVA 3M4HA 1S5MA 4XTDA 2BP1A 3GVVA 3C0SA 4HMDA 2Y8KA 1IXPA 1MXSA 3SGGA 1QCWA 3W1MA 3UD6A 3NM3A 2WO5A 3TIMA 3OG3A 4RR4A 5D8WA 1PZ1A 4YTTA 5I6SA 4S3BA 4LUSA 2Y1HA 1XYFA 4G1NA 3TXZA 3SUSA 1O4UA 2OJPA 3SAZA 3WK2A 3VNJA 1FWAC 4QQ3A 1GOMA 3SCWA 3WNKA 5LIUX 1PJ9A 3TKFA 4TX6A 1T41A 4AD5A 4GH3A 3WJYA 3VXGA 4BCEA 1Z41A 3M5XA 1MEHA 1MRQA 1FWBC 2OO6A 2ZA1A 1V7YA 2WW5A 3M6YA 3WENA 1U1JA 4J3TA 4DQWA 1KCZA 5FKYA 2J24A 2PWDA 1BQCA 3KL5A 2NX3A 4XD6A 4L6HA 2ZA2A 2ZTJA 4BHYA 2V30A 3EB2A 3G6MA 3VZXA 4Q4SA 4AX6A 2VENA 1S2AA 4GA8A 3URBA 4XD3A 2PTXA 1E0XA 4GIEA 3DFNA 3V5FA 5C2CA 1DIEA 4G5DA 2AAMA 5BW6A 1BVNP 1F3EA 5FJPA 2QJGA 5I00A 1CXEA 3I4KA 3AIQA 3OYXA 1S2CA 3LB0A 2Z25A 3DI0A 1HJXA 1UIOA 2VWTA 3MS8A 4I3GA 4FF5A 1M53A 4GUJA 1S5TA 1GPFA 1HTIA 2D20A 1ZBCA 2VDGA 3GC5A 4Q8TA 3DXIA 2J7EA 3NZPA 3ARWA 4DM2A 1NWUA 1TJ0A 4ZO8A 3B8VA 1CB2A 4L4LA 3NOYA 2WJZA 1RA0A 1HKVA 3NFUA 3BGGA 3WDPP 3TTQA 1KBKA 4CD6A 4W5ZA 4CLMA 1JDFA 4F40A 4C1KA 1BG9A 2E8YA 4OU1A 3D3FA 4S3AA 3PBUA 3LYEA 3CIWA 1XG4A 3B06A 2QIWA 4DBSA 2GK1B 5HNRA 1EPXA 2HMCA 2FTYA 5E5CA 3JZEA 4AIUA 2J7FA 5D2TA 3KVKA 2PDPA 2XIIA 3V5OA 3MQTA 4J3VA 4B5UA 4L65A 3WJXA 2J7BA 5A8OA 1LUCA 2A5HA 4V1YA 2QCCA 3THDA 2VXNA 1EO5A 4JTRA 5AYZA 4HU3A 2OYMA 1MUWA 2WHKA 4ZQMA 2GZXA 1HP5A 5CSSA 4ZA0A 4AZGA 1Q6CA 5LXEA 4WVXA 3AUJA 1GG0A 3OHIA 4X9SA 3L7RA 4PE8A 1IYXA 3QLDA 3QJAA 2ZFAA 2QPUA 4H7ZA 5D8ZA 3U5YA 4ASTA 4NJGA 2ISVA 4PUNA 5A8NA 1W1VA 1SO6A 1ME7A 3CNYA 3PZIA 5GJNA 3QN3A 3WUFA 2J7GA 1ZJAA 4GZJA 3KLLA 2PWVA 3VIKA 1PL9A 3K1DA 4M80A 1NM9A 3CEUA 4R3UA 3LRLA 3RUBL 3LZ3A 4EPBC 2Z26A 4YNGA 2VO5A 5I77A 4XIMA 3VIHA 5F2MA 5RUBA 1GOQA 2JIEA 4OIFA 1QPNA 1QW7A 4QLLA 2A7RA 2P1FA 3BAIA 1EJRC 3SM0A 4DUVA 1SM9A 2PTYA 3L4WA 3VD3A 4FX8A 3CQIA 1WUEA 3LCXA 3FYOA 3IRDA 4BF7A 3UZYA 4LC8A 1PB0A 3PAOA 2VDIA 4O17A 5AHIA 4PR4A 1OF6A 4PMYA 5D05A 1TE6A 1E70M 3NQ7A 4FNUA 3VKBA 3VU2A 4AMCA 4IIHA 1TA3B 3C8NA 1OCNA 3UFYA 5HPOA 4YTUA 1UA7A 3RPMA 3VZZA 5FF7A 1TTJA 3EWDA 4M5PA 4LV4A 2O9RA 1Z8AA 3GNDA 3ITXA 3VC6A 3U2EA 4H8NA 4WK9A 1VCGA 4IFRA 4O50A 3WDQA 2WOQA 3S42A 2QJHA 3WLJA 2D24A 1QOXA 1TSIA 2EPKX 3NNTA 2NUWA 2ZUWA 4QFUA 3QYQA 1KXTA 3WMBA 4GUHA 1XICA 3W70A 4B9YA 2WCGA 4RLIA 3WQ8A 3BG3A 3WFZA 2R1KA 1ZQ5A 4K3ZA 2R6OA 1EUNA 2Z00A 3GLCA 4ATDA 4N2YA 1JJKA 3QRHA 5DBUA 1V03A 1V7AA 3LCLA 3UPMA 4M81A 4LS1A 4OUEA 4HPGA 3MO7A 2EPNA 4NU7A 3IACA 4Z0JA 4AVNA 2WSPA 4B16A 1HL2A 2IPWA 3BAXA 5XINA 4DUWA 3AMKA 4JAWA 4IICA 2E28A 3BDKA 2HXTA 3KVJA 1QPQA 4IP5A 5CLTA 1XUZA 4YPJA 2QW5A 2G50A 2RDWA 2XHYA 4WCJA 2PTWA 3BMWA 1TV3A 3N3MA 4B5XA 2ZKMX 3WYZA 3HURA 1NVMA 4V15A 4KWOA 1W54A 4H01A 3WLOA 5FEPA 3AYSA 3AWNA 5ABHA 3PK7A 3ZT5A 5FJJA 3V18A 1FHUA 4ACZB 4ZFMA 5LNVA 3C8FA 3WLNA 1XBVA 4MFEA 3N2TA 4DYKA 1FWSA 4LYRA 1SFTA 3STGA 4FOUA 3AHXA 4WHBA 3PWAA 1XYBA 2CXEA 3HFTA 2J8GA 2PWEA 4XKYA 3O06A 3M7WA 1N7KA 3AOFA 3DZ1A 4M51A 3FGCA 5DXYA 3P8IA 4H9XA 4RDZA 1SZFA 5AHLA 2QLYA 1ITXA 1P1XA 1S1PA 2IPGA 1XX1A 2DZSA 3PBVA 1EDQA 4LCQA 2D3NA 3P60A 4DZIA 4UOJA 1JZ5A 3OVGA 4C6JA 1XW8A 4H83A 3Q2DA 1YTEA 3SADA 3E3HA 5C5YA 3P62A 3W2NA 5EYWA 1LLWA 2PDYA 3F5JA 4DX3A 5I3FA 1HF6A 1FY6A 3KOZA 1B31A 3HF3A 2YB1A 2CZEA 1GOOA 2C1IA 1B2YA 3MYOA 2WVTA 3VDGA 3KZSA 5LA2A 3V0UA 3OGVA 3W23A 1HJSA 3WZ0E 5LHFA 1WB0A 3P5ZA 5EMYA 1A5SA 2FB2A 3OOQA 4UFMA 4S38A 1NELA 2ZC8A 2WANA 1H61A 4ZZ9A 3QFEA 3S2MA 1WZKA 2B4GA 3GYEA 2I1OA 2VEPA 1FUYA 2Y24A 1KLZA 1G5AA 6TIMA 5LKYA 1VS1A 4DWSC 1J6PA 1PWLA 3EDDA 3ZMRA 1SW0A 5I2UA 2ICSA 1US3A 4GXWA 4O11A 1FH7A 3PPGA 4UUIA 1HW6A 1JCYA 4YLWA 3FKKA 1B90A 4JFVA 3QSRA 1BGAA 3W2UA 3UZXA 1J5SA 3AIEA 4K6AA 1IT0A 3GBEA 2E5DA 3JR2A 2ABAA 1V02E 3QW4B 1FBAA 4EXAA 4R27A 2GOUA 1OADA 4UTTC 5FOOA 1JIBA 3ZQ9A 3FCPA 4OJYA 1EJVC 4GUFA 2F6UA 3HJZA 4YS1A 1CLXA 2HS8A 1O6IA 1RA5A 5CPMA 4O53A 3L9CA 3H70A 3WX7A 3QV9A 4MJ2A 4Q8UA 2YYUA 5H6HA 2AKZA 4GYFA 1V6UA 2ZYFA 3CHDA 1MNZA 1P0BA 4B5TA 2OFJA 2QXWA 3FYYA 1UMLA 1B3WA 1QI2A 3LUTA 4LRSA 3H26A 1A47A 4YHEA 1GW1A 1MNSA 4NZ5A 2DH3A 1C90A 1ISXA 4ROQA 3P0WA 3QQWA 3GVWA 1S5NA 4JTAA 3QPYA 3OLEA 3B8SA 4FMVA 3HPXA 1K9EA 2YZRA 3BE7A 1CLKA 1ZBKA 3BOFA 1PXGA 1AQ0A 3NZQA 1JAKA 1MW0A 4E2OA 3MMDA 1L6FA 1LWIA 1TV5A 2DH2A 4GRSA 4X3ZA 2GGGA 1W6TA 1W2PA 4U2YA 3O3RA 4WY0B 3F03K 4KCTA 3NEVA 3N18A 1VF8A 3QPZA 4QG6A 1IEXA 2QQ6A 5CG0A 3UU0A 1SSGA 3R4IA 1YBQB 3LMZA 1JAEA 1XI3A 4XZLX 3WDRA 3HQNA 4Q6JA 4XAGA 2FHCA 4C7DA 3DG3A 4K38A 1FWFC 1PKNA 1GZGA 1DWGM 1QATA 2OEKA 4JTCA 1EEPA 2VGGA 4ONVA 1BF2A 4FR6A 1CZ1A 2PGEA 4HMNA 4J3ZA 4KBXA 4ADTA 3VIGA 3GDKA 3TSDA 1AD4A 1EB3A 1FHVA 1QW9A 4LUSB 5F2GA 3VNMA 3L0NA 5H8UA 1L6SA 3GH5A 1W5QA 3FY1A 3AS3A 3F5LA 3QMSA 3WH9A 3R43A 1OHLA 4IIDA 1VP5A 1Q7MA 2ZUVA 1UR4A 2OWWA 4QM1A 3EWWA 1Q45A 3G1AA 4WGXA 3DX5A 3N4FA 4MFDA 4P5UA 4D72A 3MKVA 3PG9A 1T7LA 5IXEA 3I68A 4Y7EA 3TQPA 1JYXA 4GNKB 4QG9A 1LLOA 3GFYA 3BANA 4TTUA 5REQA 4HU8A 1IE7C 5CEWA 1X1OA 4AZ7A 2YPIA 1UWAA 1X8CA 5A6AA 4MJZA 3K13A 1CGTA 3VPLA 4A2SA 4PUKA 2PCEA 2ZA3A 1VFMA 4MAZA 1R6WA 1UD6A 4XZWA 2P10A 3BQ5A 4CU6A 2VZVA 5D9MA 1P5BA 1KGWA 4GE8A 3SCUA 1FWNA 4ILSA 3ABRA 4OTKA 1BSLA 3DYMA 5H8PA 4WLCA 5GJMA 6ALDA 1OBAA 5DMLA 1W1IE 1E0TA 1DXIA 2OGJA 4AXKA 1XP3A 2VKZG 4LF1A 2Y7GA 4IUOA 3NYZA 3ARXA 3U5UA 1C29A 1KRBC 1VJIA 1MO0A 4IGSA 3W7EA 4O15A 3W1PA 1XIBA 4K8HA 2XH2A 1BVWA 4IIGA 2VQUA 3PTQA 4L4MA 5EMMA 6A3HA 5KMYA 2TAAA 2ZZ7A 1U2YA 1HL8A 2HJPA 3SZ8A 3L23A 4MJMA 1WKDA 3T0CA 1X6NA 1UMYA