2CYGA

Crystal structure at 1.45- resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
b'IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESGWPSAGGGAEASTSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQKAGGIEQNFGLFYPNKQPVYQISF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-1, 3-glucananse
molecule tags Hydrolase
publication title Crystal structure at 1.45-A resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
pubmed doi rcsb
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cygA00
1I1XA 1VFFA 3N13A 4KH2A 1TA3B 4MNJA 2XVGA 4B3LA 3ZSTA 4FK9A 1DEDA 4R27A 1TG7A 4UOZA 2Y5EA 1B30A 1WDQA 5M17A 5I24A 3WL0A 1MW2A 4CN4A 3MSGA 1BSIA 4PTWA 2CHNA 4X9YA 3CHFA 3GTNA 4W7VA 1KGWA 1AVAA 2VCAA 1E6RA 1W3KA 3VIMA 2WKGA 1NOFA 2VNCA 3U57A 1LL4A 1G94A 1GQJA 1EQCA 1ISXA 1UKTA 3ALGA 5IFTA 2BHYA 2G4FA 2J79A 4ZXLA 4LX4A 3ARZA 2XIIA 3ZJKA 1E4NA 1LQ0A 2ZE0A 3ZM8A 2OSXA 1KB3A 3GDBA 5ABGA 5A6SA 1BYAA 3WFLA 3GBEA 4GINA 2J4GA 3GH4A 1C92A 1EDTA 1JZ5A 3VTRA 1BYDA 3BSHA 3IAPA 4XZWA 2D22A 3W38A 5AC4A 2WNWA 3FXYA 1QW8A 2JFEX 4XUYA 2OWWA 1PEZA 1UKPA 1RPKA 4JKMA 5E0CA 1E6NA 1QBAA 1QW9A 4IM4A 1QNQA 2VL4A 5F7UA 4D6JA 1W1TA 1ISYA 4NSBA 1H4PA 1FH8A 3VNYA 1AQHA 1WE5A 2WPGA 3CIVA 2PC8A 3EDDA 4P8VA 5ECUA 2CBIA 3QHMA 3WF4A 4AWEA 5ABFA 1XCWA 1QNPA 5BWFA 3RM9A 2XTKA 4W7UA 4GO9A 2W62A 2VVSA 5AC5A 3WQ5A 2YIHA 3GXFA 1HVXA 1UUQA 1ZJBA 1XD0A 2E8ZA 1K9DA 4NZCA 5CQ1A 3EYPA 1IZKA 3PZNA 1XH0A 3K8LA 3FAXA 2WZHA 2PWGA 4F66A 1QI4A 1EO5A 5A94A 4U33A 2C7FA 2V3DA 1NARA 1DWFM 3GXMA 4AXNA 5A8PA 2J8GA 4GXPA 3AMLA 1ITXA 2E4TA 4AIUA 2XSBA 2WZIA 1OBAA 2WC4A 1MYRA 4F79A 3NIYA 1XCXA 4J3SA 2OWCA 5A3HA 3OB8A 1G5AA 2UY2A 1SFSA 3NSXA 5AY7A 1MXGA 1NOWA 2D20A 3VDAA 3ECQA 1P6WA 2AMGA 1HN1A 2PI6A 2WVVA 4UOJA 2CYGA 4DWSD 1ISZA 5DT5A 2MANA 2XUCA 4AZGA 2NT0A 4CVUA 5A8QA 1CWYA 1LF1A 2VX7A 1V0LA 4HA3A 3ZJ6A 3VGEA 1BYBA 2ZX8A 3WIJA 5FCZA 4YHEA 3EMQA 1Z32X 2WVVB 1Q6DA 3VMOA 5LA0A 4ZFMA 4M80A 3VD9A 4TVDA 3AJ7A 3ZOAA 2B31A 2ZXAA 1VIWA 4HPGA 1A3HA 4HTYA 2ZX9A 3SCNA 3ZT7A 2WSPA 2J7GA 1J0JA 1KBBA 4AZBA 3AHVA 3CZLA 5AYBA 3NSMA 2J25A 1EOKA 2EXOA 3PZMA 2IUZA 1W9VA 2EJ1A 4AZCB 2GDVA 3QOKA 2VCCA 5A6LA 3PZIA 3VGFA 1E1EA 1NWSA 2C8NA 4M8UA 3SCOA 1E73M 2G3IA 5CPQA 5CJ5A 2YLAA 2GK1B 1GVIA 3OZPA 1BQCA 1V02E 3ALFA 5BROA 1M04A 2JE8A 3AXXA 2J74A 4UNIA 1RP9A 3WD1A 2DH3A 4J3UA 5D9MA 3AIUA 1GQIA 2AOSA 1CDGA 4GI9A 2WVSA 3VDCA 4PTVA 1JYWA 4C7DA 2J7CA 2WW5A 4J7RA 2E9MA 1H0GA 1E15A 3BMVA 5E09A 1ZBWA 3A4XA 4UOQA 2WM0A 1M03A 1OT1A 2WKLA 5FD0A 2DIEA 3M46A 1C93A 1MW0A 3ZR6A 4MDPA 4CD5A 5CG0A 3WMCA 4AEFA 4AD4A 1J12A 1UD5A 1HIZA 1UQZA 4TOQA 1UWQA 2WLZA 2JF6A 3ARTA 1JFHA 4D71A 3PZQA 2E0PA 4YHGA 3BCDA 3CBWA 2BVDA 4GZIA 3TOPA 1ZJAA 1JI2A 2V3FA 5GNYA 4Z2JA 5A6BA 3ARWA 2EPMX 4MNKA 4DWSA 3PN8A 1TMQA 3VD7A 3WBAA 2WMHA 2VRQA 3VILA 3II1A 2ESCA 2V3GA 1WCGA 1E0WA 1V3LA 5FIPA 1W2VA 5LA2A 1X1NA 1XV8A 3AS0A 3EDJA 3UG5A 4PSRA 1MQRA 2X8RA 2D0GA 3CUIA 4AZ7A 1KXVA 3N12A 4DUVA 1Y7VA 2DPEA 1W32A 3NDZA 4PMOA 2GUYA 4AIEA 4MNMA 1QI3A 3WD2A 3WQ4A 1OSEA 3AIRA 1GORA 2WBGA 2UY3A 4PN2A 3AHXA 1CGUA 2CBJA 1HKJA 2CITA 3AQUA 2ZUNA 2VQTA 2VZUA 2VJXA 2EQDA 1JYNA 4WKAA 1E5JA 4C7GA 1WDRA 3RPMA 3UR8A 2VUYA 2BS9A 1YQ2A 1QNOA 3WNOA 1CXIA 1MWOA 2E8YA 3HJEA 2PB1A 4CGTA 1E56A 3N9KA 1CGYA 2AAAA 4CCEA 1UKQA 2W63A 3LPGA 3WUFA 1WZKA 1WZAA 1G0CA 1LL6A 4D6IA 1UD6A 1Q6FA 2O9TA 1CNVA 4NRSA 1AQMA 2XYLA 1GHRA 2GJXA 3ZT5A 3HMCA 1EXPA 3RMEA 2YDRA 2ZUUA 2CKSA 3BAJA 5BXRA 1BHGA 3A47A 4X0NA 4UFIA 3SCQA 1B2YA 4QLLA 4F8XA 4RE4A 4AD1A 3T0DA 4BZYA 3AIQA 2VI0A 3WQVA 2G3JA 4W87A 4YPJA 1E40A 4MAVA 4EAMA 3KL5A 5D8ZA 1WPCA 1UOKA 3WY1A 1V3MA 3AXHA 4P7NA 5ABHA 2OYKA 3BAYA 4AMCA 2VVNA 1W9DM 5DT7A 3RCNA 5HPCA 2VQUA 1XYZA 1ISWA 3MUY1 2QLYA 2DIJA 1DWIM 4UFMA 3VIPA 4H8UA 5BRQA 2W91A 1PIGA 1JL8A 3PBGA 2CESA 5A8NA 3F4VA 3T08A 1SMDA 2EEXA 2YBUA 3T09A 2X0HA 4UQEA 1CGWA 1TE1A 4JCLA 1HF6A 4PCTA 4TVCA 2G3NA 2DT2A 4E8DA 5AYIA 1E71M 3PTKA 2PF0A 1PX4A 3U7VA 4AZCA 5I23A 3I3EA 3CO4A 3CZKA 1J0HA 3W53A 1V3JA 1NWRA 7CGTA 2NW0A 1EQPA 5DF0A 1LWJA 2W66A 2XFRA 1V3HA 4XX6A 1JZ7A 1GOQA 4J3VA 1B3XA 1FP8A 4L4OA 2F61A 3J7HA 1HP5A 1E9LA 3A3HA 3DYOA 1FP9A 2GJPA 3VD4A 3M07A 5EMYA 1DWGM 4J3TA 1PZ3A 1VFUA 1UH3A 1W9XA 1H0IA 1B1YA 3WQ6A 1BTCA 2WMFA 4J27A 4PSPA 4M56A 4UFHA 3UEQA 3ZIZA 4MJ4A 5HOSA 1GOKA 1GONA 1V6UA 5A1AA 4CD8A 1E3ZA 1FHDA 1XYFA 2Y8KA 2CBVA 1C7SA 1UH4A 2VZSA 3VMPA 3ZMRA 2JF7A 2WVUA 3UETA 4UR9A 4DM1A 3VIKA 1CGVA 3B9DA 1FH7A 4K68A 5I2UA 1JXJA 2JIWA 1KBKA 1HJWA 1I75A 3CUGA 3AYSA 2X1IA 1DP0A 4W5ZA 1B31A 3MSDA 1JDCA 4KWUA 3PZVA 2HVMA 3CTTA 2ZUSA 3W26A 3RILA 4BS0A 1ZBVA 1BFNA 1CEOA 3ARPA 3QGVA 1H3GA 4P7LA 3PZ9A 2JEQA 1KQYA 1J0YA 2W4XA 1V0MA 1EIBA 1EHNA 1U30A 2GJRA 1R7AA 3BMWA 2V3EA 4OBRA 2ZOXA 4KMQA 1UD2A 2NT1A 3G6LA 3AMDA 2BHUA 2YA1A 4U31A 3VM7A 1JGIA 2F2HA 1B3VA 3PHAA 4ML4A 4GZEA 1OINA 3PTMA 2JALA 1J0ZA 1UWTA 4OBSA 2YKKA 2XM1A 1CXKA 2D3NA 3CPUA 4M24A 1KXTA 3APGA 2BFGA 1VB9A 4QAWA 3OIHA 4F9JA 2WHKA 2Y4SA 1HVQA 4WKFA 4U2ZA 3FY1A 3WH5A 2WCGA 3CHDA 2CXGA 2WMGA 3BLKA 5BXSA 2UY5A 1OT2A 5IHRA 2VURA 2DH2A 3AHTA 2WC3A 1US3A 4GIAA 1PJ9A 4UZSA 2BY0A 2VOTA 3CMGA 3VKKA 4JFWA 5EFDA 4ACYA 1BG4A 2V5DA 4P7QA 3RO8A 2XIBA 3EMZA 1VJZA 3M7SA 5IXEA 1MQQA 4PTXA 3VIGA 2J7EA 4AISA 3SUTA 1V0NA 3ZJ7A 2DSUA 2WC7A 1CGTA 1Q6EA 3U5YA 3CHCA 1XH1A 1CZ1A 4PMNA 4AEEA 1WO2A 2DSVA 4MAZA 2BVYA 2W92A 4MJ2A 5I3DA 1V02A 5GNZA 2VR4A 1JZ8A 2ZUVA 4GQRA 4BF7A 4PMZA 3F5LA 4C7FA 2VTFA 1E1FA 3KE0A 4AD0A 3L4YA 3AIWA 2WANA 4QFUA 2BY1A 1WP6A 1XSIA 1UZ1A 2Z1KA 3W82A 4J3XA 1JZ2A 2CCRA 1NOUA 2YOCA 3IJ9A 4U2YA 4WF7A 2VRJA 1X6NA 3BH4A 3A6OA 1E70M 3BC9A 3AISA 1R7OA 3CH9A 4B15A 5HXMA 1FFRA 3ARXA 4AY1A 1DHKA 2J75A 5D4YA 1CXFA 4KRTA 5A8OA 1OIMA 4JL2A 1UR8A 1C91A 3NUKA 2WMIB 4H7VA 4PMUA 3CZEA 5EB8A 4AW7A 3GNRA 1GQKA 4OZOA 2DT0A 3AI0A 4JFTA 3POHA 1CXLA 2A3CA 3FHQA 2EPOA 3K8MA 4OIFA 3KZSA 2XVPA 1K6AA 1HL9A 4JCMA 3HU7A 3VVGA 4GO8A 1CXEA 2WHLA 5A6AA 3LPFA 1JZ3A 5TD4A 1K9FA 1UA7A 1JD9A 2TAAA 3OGRA 3AZRA 5GQBA 1W1VA 1HKKA 1Q6CA 3BCFA 4KRUA 3VIJA 5E9AA 4P8XA 3THDA 3WH6A 1HX0A 3BAXA 2HISA 3OGVA 4H8HA 2WWCA 4DM2A 3VINA 2J7DA 3WSUA 2VZOA 1M7XA 5ABFB 3MO4A 1JZ6A 2Z1SA 1UYQA 2XVNA 5IFPA 4CN1A 4MADA 5I5RA 1WDPA 3VIIA 2JIEA 4N0RA 4A4AA 5A6JA 3WNNA 1W9BM 2C0HA 4AIOA 2PWEA 3UESA 1CXHA 1TZ7A 1JF6A 3VOCA 3SUVA 3WELA 1J0IA 1PX8A 1EDQA 4UQBA 1RH9A 4B16A 2PBGA 1G01A 2CNCA 3WBEA 4LYPA 1W9UA 5CGTA 4OOUA 2PWDA 1JYVA 5JIWA 1GCYA 3GNPA 4FMVA 3W0KA 1PZ2A 3THCA 3KL0A 3CLWA 2QMJA 4ZE4A 2DT1A 3DYPA 2V5CA 1D3CA 3NDYA 1U33A 1QNRA 2VX4A 3MUAA 3ZR5A 1IZJA 3WNLA 4R5EA 4QDMA 2QMKA 3IJ7A 1E6XM 3AMGA 1GZJA 1OIFA 4HP5A 3VX1A 4PMQA 3FN9A 1GNXA 5I0DA 2XPKA 4AD5A 1WZMA 3TTSA 1NP0A 3GNOA 2EPKX 2QPUA 4H2CA 1UKOA 2CHOA 3CGTA 5A95A 1ODUA 4AZ6A 5FL1A 2ZUTA 2WSKA 1C90A 5ABEA 3AMCA 5GNXA 1K9TA 2ZXBA 2J7FA 4EANA 4ACZB 2CBUA 1WAWA 1V6XA 2CERA 4HU8A 1VFMA 3CUHA 2WCSA 3WMSA 5I77A 1H09A 4H8VA 3T0BA 4E8CA 1ZL1A 1X6LA 2DDXA 3PZTA 1PAMA 1A47A 1KFWA 3VPLA 1HXJA 2BXZA 1L8NA 3PZGA 3MMUA 4OKDA 3W81A 2ZUMA 1VBRA 1BVNP 4WIWA 5DMYA 3WL1A 1C8QA 1E6SM 5CXPA 1SR0A 3K4AA 4P7OA 2CEQA 2XJ7A 1CBGA 1HJUA 1F4AA 4P8UA 4Y7EA 3VGGA 5CZKA 1JI1A 1HJVA 5C70A 3WH8A 4Z2KA 1V3IA 1JDDA 3W27A 2V38A 3NYDA 1H5VA 4A3HA 4CU6A 2D24A 3ZT6A 2WZEA 4JIEA 4M1RA 3UG4A 1CECA 3HN3A 3B9EA 2ZIDA 4HZ6A 2J8FA 2ZICA 3OG2A 4QP0A 5IHSA 4JKLA 1HT6A 4CUCA 5D9PA 1ESWA 1F4HA 4Z2GA 3VDBA 4MB4A 4UQAA 2GFTA 1OM0A 1W9PA 1UD3A 2G3MA 3IANA 2EPLX 3POCA 1UWRA 2W61A 2IXUA 3KWXA 2VR5A 4FLOA 4W85A 1UWSA 1C3FA 1YHTA 4KGJA 3SUUA 3T2OA 4CVWA 5BRPA 3OLIA 4JZ5A 4DWSB 3QHOA 6CGTA 2FHBA 4P8WA 4YN5A 2QV4A 5LYRA 1CGXA 4JAWA 2E9LA 3BAKA 2YA0A 1MVYA 3AHYA 3S2CA 4D1IA 2OSWA 2XVKA 3WF2A 2YBTA 1TVNA 1FA2A 1W1YA 4CN6A 4CU7A 3RJYA 4WSKA 4B9YA 5C8BB 1KQZA 4TTUA 5FKYA 1XC6A 4WLCA 3TA9A 1UD8A 1GPFA 1JZ4A 3RM4A 1QHPA 3WUEA 1GUVA 4GKLA 3VO0A 4MDOA 2XM2A 3WEZA 2XWEA 3WDJA 4BQ3A 4XV0A 1J01A 4ZENA 1TFVA 4S3KA 3WH9A 3ZQ9A 4TUFA 1W2PA 2WYSA 2YDSA 5M03A 1JXKA 3FHAA 2DGAA 1V6WA 1VRXA 4M82A 5JUVA 2DT3A 1NWUA 3G6MA 4ZE5A 3BSGA 3UERA 1BVZA 4HA1A 1Q4NX 4MB5A 1C8XA 2D0FA 2WMIA 5CLWA 2G41A 3U7BA 4TXEA 1PIFA 3K4DA 1V3KA 2D0HA 4NRRA 2X09A 4UTFA 4Q7NA 1OD0A 1UR9A 3WDRA 5JIPA 4W86A 3WDPP 1I1WA 4HOXA 1LLOA 1CPUA 1K9EA 5HPOA 3SUWA 1UD4A 1V6YA 2VZTA 3B8SA 4Z2HA 4PMXA 4ATLA 4RE3A 3IAQA 2VX6A 5A6KA 4BQ5A 1E6PA 1GJWA 4JFUA 2XFFA 4ZEPA 3WDIA 1GOWA 5KEZA 1N82A 1OGSA 3VGBA 5CGMA 3B9AA 4UFLA 5JBDA 1JIBA 2CIPA 1NWTA 2DSKA 5JBFA 2CETA 4PUEA 4LYRA 3O9NA 4BCEA 3RDKA 4AZHA 3W29A 2XG9A 2WK2A 4W89A 5A2CA 5IDIA 5DFAA 3RM8A 4CKQA 2W5FA 3FNDA 4RL3A 3VGHA 3OLEA 2WLYA 3WQWA 4PYSA 3N11A 2ZWZA 3AZTA 6A3HA 9CGTA 1E72M 4FLRA 4P7RA 1B0IA 3W37A 5E0FA 1E0XA 3ARRA 3GYCA 3NJ3A 3WNPA 3MS8A 7A3HA 1B3YA 4CD4A 5C71A 1ZBCA 4WK9A 1GOIA 1KXQA 2VT0A 3TTYA 4U5IA 1EO7A 5BCAA 4FF5A 3AS1A 1AMYA 3SCTA 1HKIA 4LPCA 5BXTA 2A3AA 2IXVA 1B3ZA 1FH9A 2FDMA 1UWIA 2UWFA 3VD3A 3AIBA 4OJYA 4X0VA 3RIKA 4AYSA 1GQLA 1UZ4A 4FLQA 4LGXA 2NSXA 3MV11 1AQ0A 2Y2WA 1C7TA 4LYQA 4B3KA 3L4ZA 5EBAA 1QNSA 1E4LA 1WZLA 1H2JA 4FLSA 3LMYA 2QPSA 2WXDM 3MKKA 5HNNA 1EGZA 4W88A 1MW3A 1QI0A 2WWDA 4WSJA 1E55A 3WNMA 4WJXA 5CPSA 1J18A 3N04A 1R85A 4V2XA 2RGMA 5CSUA 2D3LA 2FGLA 2BV9A 2WVTA 2EPNA 4PRWA 2J7BA 2FH6A 2A3HA 3FAWA 4D6CA 4DUXA 4EK7A 5E70A 3ZSSA 3VU2A 2ZXDA 1RD6A 5LA1A 4U5KA 3VIHA 1WNOA 1BGAA 3AMKA 3WD0A 1VJSA 4A3YA 1BYCA 3L4XA 2ZUWA 4GI8A 2GVYA 4D6HA 3L4UA 3NSNA 4NI3A 2J62A 4WKHA 1BLIA 3ARQA 3BAIA 3BAWA 1H11A 4CU8A 2WHMA 1W3LA 5HBFA 3TTOA 3ARVA 1H49A 1E6ZA 1TR1A 4E4PA 3I3BA 3CMJA 4JHZA 3QR3A 3SUSA 3AFBA 4OUEA 4D1JA 8A3HA 3GH5A 4KGLA 1TUXA 2FHFA 2A3BA 2E40A 3AZSA 1EA9C 4PEEA 4W8LA 2UY4A 5EFFA 1JYXA 4GZJA 3CHEA 2J7HA 4ACZA 1IV8A 5FL0A 1W3HA 2DSWA 4PMRA 1U2YA 4B9ZA 1JAEA 3VGDA 3OZOA 1J0KA 2E3ZA 3UCQA 4AZ5A 4J28A 2PWHA 3VNZA 1EHAA 2Q8XA 3WH7A 3ARSA 2BHZA 3TP4A 4JHOA 1KWGA 1MFUA 3F5KA 1VBUA 1QPKA 4BQ4A 3CZ8A 3N1AA 1FHLA 3QHNA 1UR1A 2YDQA 3OLGA 3VD5A 3AYRA 1HJXA 1IT0A 2JEPA 1GVYA 2E9BA 2BY2A 2YLLA 3OBAA 1MQPA 4MPKA 1EDGA 1VEMA 3DC0A 3A4AA 2DEPA 4OOZA 4ATWA 5DEZA 2WAGA 1BGGA 1W3JA 1ZB5A 1ODZA 3DYMA 1UQYA 2Y8VA 3T0AA 1GW1A 3GH7A 4MB3A 1JNDA 1BG9A 1TA3A 3WF3A 4Z2IA 1HP4A 2YL5A 5CSYA 3BXWA 3OLDA 2GK1A 3N15A 1VEOA 3WEMA 4CCDA 2WCAA 1EH9A 4LQ1A 5DO8A 1OD8A 3W6MA 3WD3A 4H41A 1QHZA 1R87A 1R86A 3SURA 2VO5A 3D5HA 2FHCA 1CENA 1LG1A 3CUFA 3GXIA 4N42A 2VX5A 3RJXA 2OLHA 1B3WA 4JKKA 1NQ6A 1J10A 3WEOA 1JAKA 3VIFA 4GQQA 3WDHA 3PTQA 5D9NA 1E5NA 4AD2A 5I6SA 5JBEA 5D9OA 3SEPA 3MUZ1 2BXYA 4UQDA 2DSZA 2YL9A 3T2PA 4HU0A 2J78A 3OGSA 3W6LA 4PMDA 3JUGA 3BGAA 4W84A 1GJUA 3WF1A 1PPIA 5A2BA 5A6BD 3UG3A 4NF7A 1KGUA 3L4TA 1ECEA 3SCPA 2VZVA 3SCWA 3GZAA 3GM8A 3O6AA 2XFYA 4CCCA 1J11A 1RP8A 3VDHA 3F5JA 3K1DA 4HMCA 3L2MA 2O9PA 1E6QM 3W24A 3KEHA 2OYLA 3WD4A 5CLTA 3UR7A 1DWJM 3A4WA 1LJYA 2XWDA 1GOOA 1E4MM 1W1PA 4IPNB 2WHJA 1Q6GA 1B9ZA 1MFVA 2W67A 3O2LA 4J3WA 3VUPA 1ISVA 1UHVA 1VEPA 4H04A 4W5UA 1H1NA 2WMJA 5A8MA 3W28A 3ZO9A 1DWAM 4DWSC 4CD6A 4LXFA 4PMVA 1LL7A 4D72A 3MU7A 4PCSA 3QOMA 2ZWYA 3ARUA 1HNYA 1SYTA 4HA4A 1L0PA 1M53A 4PTMA 1TCMA 4PMYA 2GDUA 1CLXA 8CGTA 1E4IA 1QHOA 2X05A 4UFJA 4W8BA 1XSKA 5E6YA 1XD1A 3CZGA 1HJSA 1FFQA 4W93A 1MXDA 3AS2A 3DHPA 2FH8A 1OWQA 2A3EA 3CZJA 1DTUA 3EDFA 1OB0A 3I3DA 1PBGA 4TVUA 2BVTA 2OSYA 5CPTA 1G1YA 1XRVA 3SCRA 1V03A 5A2AA 4XB3A 5D8WA 3BLPX 1HL8A 3VX0A 2EBNA 1XH2A 2XVLA 4UFKA 4PUDA 3LPOA 3WFZA 1XGZA 4AC1X 1ZBKA 4PBGA 1WB0A 3D3AA 2FGZA 1GOMA 3SCVA 1LWHA 3WMBA 1XHGA 3AROA 3EDEA 4W8AA 3GBDA 3WDQA 3TTQA 2GSJA 7TAAA 1R8LA 3FW6A 1NM9A 1VFOA 4IPLA 1BAGA 4EKJA 1E0VA 4URIA 1CLVA 4D6GA 1US2A 1QBBA 1UR4A 1LG2A 4HZ8A 2XHYA 1EOMA 3IJ8A 1E43A 4L4PA 4DUWA 2CKRA 3WENA 4M81A 1OGGA 1TVPA 1CIUA 2D1ZA 3N17A 1JF5A 3K8KA 1QI5A 3L4VA 4TX6A 3VIOA 4UQCA 4D6FA 4Z2LA 4HMEA 3WUGA 3N18A 2X0YA 4V27A 2YL6A 4IUGA 5FOOA 3M6DA 1E3XA 4EE9A 4F9DA 1SMAA 5M3WA 3W4RA 1GHSA 2ZX6A 2VC9A 4BQ2A 1MW1A 1B90A 2VCBA 4HZ7A 3TONA 3DECA 1OCQA 1XSJA 3WN6A 5BXPA 1JDAA 2XGIA 2GJXB 4CD7A 1KCKA 1PX3A 4GI6A 3CUJA 3ARYA 3WF0A 4GPNA 1DWHM 3VMNA 1VAHA 1VF8A 2ZX5A 3EMCA 3KL3A 1J9YA 4MTVA 2RGLA 1JD7A 2D2OA 2YJQA 4HPHA 2PBOA 1UR2A 1QI2A 2QF8A 2PWFA 1JG9A 3IK2A 1KR0A 1QOXA 1KGXA 2Y24A 3OA5A 4M29A 1S46A 4MNLA 1UG6A 3PZOA 1ZU8A 4QCEA 1H41A 4QLJA 1O7AA 2OYMA 5HDRA 4AD3A 1KWKA 5E6ZA 4D6DA 2D23A 1UH2A 1WKYA 1D7FA 2VMFA 3VM5A 4TTGA 3LPPA 2OWXA 1BPLB 3WUBA 4QLKA 5A69A 4HOWA 2X2YA 3PZUA 4XZBA 1V6VA 4HMDA 1NP2A 3K46A 4HOZA 3S6TA 1JFXA 2CPUA 3MANA 4RE2A 6TAAA 4IISA 5M5DA 3MUIA 4AZIA 2O92A 1ITCA 2O9RA 1C8YA 2DQXA 1WDSA 1UR0A 3ZJ8A 4QCFA 4W7WA 3W25A 3EDKA 2O9OA 5I78A 1G9HA 3AOFA 3WKZA 4JFSA 3MV01 4UZUA 3MMWA 1V0KA 1M01A 3MMDA 4U3CA 4D6EA 3L2LA 3SCSA 3SIMA 1HJQA 1KR1A 2J47A 3AIVA 1OGBA 3WQ8A 2XSAA 3NCOA 2ZXQA 1V08A 1HKMA 2BNJA 4UCFA 1QVBA 1W91A 5BYWA 3T2QA 2YA2A 3AXIA 2WBKA 2BY3A 3DHUA 4U3AA 3WNKA 1NH6A 4BA0A 1KXHA 3EBVA 3GXDA 4JFVA 4JL1A 1D2KA 2EO7A 3AIEA 1O6IA 2QHAA 4TX8A 4E2OA 5GPRA 1VENA 5KZ6A 4MB1A 2ZX7A 3E1F1 1JNEA 1UWUA 2F8QA 4Q22A 4S3JA 4ZXOA 2G8ZA 1CTNA 1CYGA 3AICA 4UQ9A 3U5UA 4ATDA 4V28A 1BF2A 1KCLA 2WB5A 2YL8A 3AS3A 1FOBA 1ZS2A 5I79A 2WMKA 2XGBA 2J77A 1UKSA 3AHZA 5A6MA 3L4WA 3SCUA 1UA3A 2VRKA
chains in the Genus database with same CATH superfamily
4F3HA 3N13A 1VFFA 2BODX 3G1VA 4H4IA 2GOKA 4H9MA 2OCZA 2Y7EA 4C5ZA 4K1WA 4LJ3A 1JQVA 2HE5A 3VOHA 3CO8A 3WL0A 4I3GA 1G4EA 4GJ1A 4PTWA 4PE8A 9XIMA 4D2JA 3W7CA 3SY5A 2DW7A 4DIAA 3W7RA 1E6RA 1FWJC 3VIMA 2A1YA 2WKGA 2VNCA 4ZXLA 4IIBA 2XIIA 3KWSA 3V5CA 3GDBA 5ABGA 1WKEA 1XPYA 3UR5A 3GBEA 2J4GA 4CQ9A 3VTRA 1IE7C 4XZWA 4V1XA 1QW8A 2JFEX 4XUYA 2OWWA 3GVRA 1LWIA 2YB4A 3GC4A 1UKPA 3S1UA 1M3UA 1ONEA 1AFSA 1QW9A 2PDNA 1X38A 4PL2A 2VL4A 3AO0A 4NSBA 3A23A 2YXOA 1BTMA 2WPGA 4PODA 3EDDA 3PUEA 2CBIA 3ITYA 2NQ5A 5HMEA 2BASA 1J2BA 5CEWA 2AAMA 3BPWA 3WLSA 2W62A 3VZZA 4HKPA 2J66A 4NZCA 4MJZA 2CLIA 3FAXA 1PDZA 2PWGA 3KOFA 4US5A 4U33A 1IXNA 2V3DA 1FWTA 3RX3A 2L5HA 5A8PA 3W01A 2J8GA 3N2XA 3RYSA 4QRNA 3LGEA 2J9XA 4C6NA 3C2EA 2XSBA 1V51A 3MP5A 1OBAA 2VENA 3A24A 4J3SA 1Q4WA 5A3HA 2X40A 1G5AA 2UY2A 4XZ9A 5G2HA 3LZ3A 1UUOA 4KFNA 2P53A 2C18A 2D20A 3C0SA 2AMGA 1HN1A 4BEQA 3GIPA 2CYGA 1ISZA 5I3JA 5KMYA 4CVUA 2NT0A 1CWYA 4BI5A 2Z0IA 1HGWA 2QUTA 3SGGA 3VGEA 3DBPA 2DZXA 1WOAA 5FCZA 4YHEA 3V5OA 5LA0A 3NM3A 1SM9A 3KVMA 3EZ4A 3VD9A 2B31A 1DXEA 1VIWA 3CNYA 4HTYA 3ZT7A 3SCNA 2BOFX 3UYIA 3DEQA 4S3AA 2J7GA 1KBBA 3CQHA 3FCPA 4XO7A 1JRCA 3N6HA 1DJZA 1PTAA 2J25A 1FWIC 4FNTA 1MZRA 3SECA 2Z2BA 3CQIA 3PZMA 3H2EA 2GDVA 3RLUA 5LNSA 4PFHA 3VGFA 4FB7A 4Z0SA 4G8TA 3B97A 3TZNA 5CJ5A 3PVFA 4PCPA 2AMXA 3K5XA 3BJFA 3W71A 2PRHA 3TQ0A 2GK1B 3OZPA 1JGMA 1BQCA 1V02E 2KZHA 3AXXA 1PHQA 1RP9A 2FJKA 3SFWA 4DPQA 4KKXA 1OX5A 5E9XA 5K2ZA 3TIMA 1I2NA 3IGSA 3LCIA 4GCXA 3BE7A 3VDCA 4PTVA 1S2AA 4X2PA 1SZEA 4JXCA 2PTYA 3W1QA 1SJAA 2DIEA 4MYXA 3ZR6A 4MDPA 4JHMA 5CG0A 2C15A 3KTXA 3H53A 3PJUA 2ANUA 4BF5A 1VCFA 2E67A 3HPZA 1ZCOA 1T96A 3CHVA 3C2YA 1EJXC 3LUTA 2ISFA 4NX5A 4D71A 4S38A 1R47A 1AW5A 4DO7A 5AKQA 3EWWA 5A6BA 1UP3A 2I56A 4Y8EA 4DWSA 3PN8A 3VD7A 2EGZA 3E6EA 1M7JA 2PD5A 3II1A 2JBMA 3UR2A 3REQB 3EOSA 4B5WA 2IQDA 4JTDA 3V0UA 1X1NA 3KCJA 2J6VA 3BK0A 3GR8A 4AY8A 4IICA 3T78A 4WOQA 2PDIA 3GS6A 3CL8A 4M1BA 3NDZA 1KM6A 2PDPA 1M7PA 3LQGA 3CL7A 3F1QA 4ROQA 1VC4A 3S1GA 4PN2A 3S1WA 2CBJA 2VC7A 5HUOA 3TSDA 1Q5MA 3UWYA 4IGSA 2ALDA 1TMHA 2BS9A 2AKMA 1MWOA 4PRTA 3E96A 4NZ5A 4CGTA 2PDJA 1TE6A 1O60A 3S2NA 3QY8A 2W63A 4RPQA 3QV7A 3GRIA 1WZAA 1G0CA 3GNXA 3KM8A 4LY4A 1IXOA 4D6IA 4YVXA 3RR4A 4D8ZA 1V77A 1V8EA 4DO6A 1LYXA 3RMEA 2YDRA 5LNWA 3UG8A 3PNUA 1R9ZA 1FWFC 1BHGA 1SO4A 1B2YA 3TQKA 1ZALA 1T40A 3IVUA 3RR1A 2G3JA 1E40A 4PB3A 1WPCA 3GG8A 3WY1A 3AU2A 3VNKA 3OODA 4ZSTA 4AMCA 2VVNA 1RVGA 3EA3A 4C6CA 1QFEA 1A49A 4KPLA 1XYZA 3MUY1 1Y5XA 1DORA 4CNTA 5BRQA 1PIGA 1JL8A 2KX9A 3I7QA 3E5PA 4GHRA 4FIRA 4K8HA 2VP8A 1SMDA 2EEXA 1OC6A 1TPC1 3T09A 4EPDC 2H3BA 1TE1A 4JCLA 2FVLA 4LNCA 4PCTA 2G3NA 1UZHA 3PTKA 1PX4A 1KD0A 3DHFA 4AZCA 2C71A 3CO4A 1J0HA 3QZEA 5H8UA 2NW0A 1EQPA 4ONVA 4J4KA 1VPQA 4NYYA 5IOBA 2ASHA 3M0YA 1I60A 4XX6A 4JTQA 1OFOA 3E49A 1NELA 1E9LA 4IPJA 2GJPA 1SFJA 4HNVA 1OJXA 4RCXA 3M07A 4F0HA 1DWGM 1EZ2A 1VFUA 3NZQA 1H0IA 4M56A 3UEQA 4MZYA 1GONA 3TN4A 1FHDA 2IPWA 4IMFA 2O4MA 2YW3A 2CBVA 3VMPA 2VZSA 3P84A 3ZMRA 2JF7A 2FVMA 1L2UA 3F4WA 3GG0A 5T91A 1VYPX 2HNHA 4DM1A 4OT7A 2YFOA 4C6BA 1DTNA 4FP1A 1KBKA 5FEZA 2EJAA 4GVIA 1TJRA 4DJDA 3AYSA 4TV6A 1DP0A 4W5ZA 2HVOA 3Q94A 3PZVA 3W7NA 1SO6A 3W26A 4NAEA 4B4HA 3RILA 3TN5A 3IJLA 3C0LA 1BFNA 1CEOA 4JQ4A 2H6RA 3DIPA 5BW6A 4XUGA 4P7LA 3PZ9A 3BW4A 2J27A 1KQYA 1J0YA 2IPJA 2WSQA 2P8BA 5DY3A 1U30A 2Q09A 4ADUA 5CZTA 1UPMB 1HKVA 2ZOXA 4A21A 2QDGA 2NT1A 5C9RA 4PRRA 3KOZA 2BGNE 2YA1A 4U31A 1FXQA 2G37A 2QIWA 2F2HA 1WBHA 1B3VA 3PTMA 1J0ZA 3DFHA 2XM1A 4JX5A 1AD1A 1ME9A 4YWIA 2V63A 3APGA 1OFPA 4LEFA 2R1MA 2P1FA 3QY7A 1OCBA 1I0DA 4U2ZA 5HAOA 3CHDA 2WMGA 4GD0A 3BLKA 4S3FA 5IHRA 2DH2A 3AHTA 2QCHA 3WQCA 1US3A 4GIAA 1DV7A 3VKKA 4JNMA 3CS2A 3M7SA 3BLDA 5IXEA 2F84A 4AISA 5XINA 3SUTA 4WD0A 1V0NA 3ZJ7A 4NIRA 4MKSA 1XH1A 4Q8UA 2QAPA 3W7GA 5I3DA 4ICNA 5GNZA 1TRDA 1SQ7A 2W3ZA 2XH4A 4GQRA 2NUXA 4C7FA 3GU9A 3UJ2A 3AIWA 3R11A 4E6MA 1VHNA 4J3XA 4FXRA 3UXAA 3C3NA 4WF7A 5D32A 3BC9A 4B15A 4P61A 3S6DA 4ZSUA 1FFRA 1DHKA 2A21A 2J75A 3NG3A 1HL2A 2NUWA 4JL2A 5XIAA 3NQ2A 2YSWA 1L9WA 2WMIB 4E2DA 1XUZA 3CZEA 5EKYA 1V7AA 3GNRA 1GQKA 2Q3RA 3AI0A 2EKCA 4O15A 2OOGA 2PODA 1IEXA 3P3BA 2A3CA 3P74A 4C1KA 1P0EA 4GBDA 4JCMA 4O1FA 4FOKA 5A6AA 5TD4A 1LLZA 1UA7A 4B3ZA 2BTMA 4RKAA 1K4GA 4OTKA 1E9ZB 1EGMA 4KRUA 3EOLA 4XVEA 1EKOA 2F6UA 4ASTA 2VEIA 4KF1A 1ME8A 4IP4A 1XLIA 1IEWA 4I8DA 4KFPA 4XSMA 3GQYA 1J79A 2HK0A 2VZOA 1M7XA 5ABFB 2XVNA 2OLAA 4X2RA 2VOMA 4QEEA 5I5RA 2V2HA 4QIUA 3EA1A 1ZCCA 4N0RA 1T7LA 4DBDA 2QCEA 1KFKA 4GGBA 2PDGA 4AY7A 1RXOB 3NQCA 1YTDA 1GW9A 1PX8A 3TYZA 3UVAA 4UQBA 2GDQA 4LANA 4Q4OA 5CBIA 1Z3NA 4XZHA 3WBEA 2EG6A 4OOUA 1DJHA 4DBUA 3B9OA 3WLKX 3PTDA 4ML9A 1J4EA 2R1LA 2HXUA 1W31A 3QZAA 4Y9MA 3E2RA 3HG3A 3L0NA 4FMVA 3W0KA 1TWZA 4E5TA 2QMJA 2DFAA 2DT1A 2V5CA 2VWTA 4KEUA 4NAEB 1QNRA 1YBQA 2HTMA 3MJMA 4R5EA 2QMKA 3IJ7A 3VA8A 1H7NA 3AMGA 5DMLA 2J13A 3HV9A 4IH3A 1TWSA 3FN9A 5I0DA 4JBRA 2XPKA 3W7JA 4C6KA 1W3NA 1WZMA 1NP0A 4Z08A 3M5XA 3CGTA 5CG7A 2Q02A 1K9TA 3LENA 2QCLA 2G50A 4XZNX 2V82A 3PPCA 1XLAA 3R79A 5I3FA 2H3DA 4IQDA 2CERA 3KOXA 3WMSA 3LXAA 1H09A 1A53A 4AC7C 4E8CA 1ZL1A 3ATYA 1Y8BA 4IQEA 3PZTA 3I6TA 4H8NA 1XS2A 1W1IE 4GG9A 4O50A 1VFLA 3IV3A 4BHYA 5AHNA 3BOXA 1L8NA 3MMUA 2ZUMA 4ZGYA 2GVEA 5DMYA 1C8QA 3C2RA 1K7FA 3GG1A 4NKCA 1SR0A 1GT8A 4ZCWA 3QYSA 3KRZA 4AIBA 1GTHA 3PC0A 5G1TA 4KCWA 1FKWA 2FGBA 5AN7A 3NGFA 1JI1A 2Z00A 3OZYA 3UXKA 4Z2KA 1V3IA 3W27A 3H2MA 3F2DA 1TMLA 2GQ8A 4GNVA 5BNKA 1NDZA 1G4TA 3UG4A 4K7VA 2CLFA 1CECA 4H9UA 3CMFA 3B9EA 2ZIDA 2J8FA 4CQBA 4RZBA 3T8LA 3BMXA 1IEQA 2GFTA 3FK4A 3OZMA 3A64A 3VNIA 2G3MA 2EPLX 4FF7A 3SADA 3RX4A 1OY0A 4JNYA 1C3FA 4R7OA 1YHTA 5C9ZA 4ZZ9A 4KGJA 3ORWA 5LIXX 3KBNA 3CEUA 3QHOA 2VFHA 4LUYA 3PUOA 2QV4A 5HQMA 4RDVA 2E9LA 2Y5SA 5JXQA 1MRQA 3BL3A 1I9CB 3LBCA 1GOXA 1W1B1 3MP3A 4WGXA 3LI0A 4CN6A 4B9YA 5C8BB 1KRCC 2PU0A 2PDWA 5HMFA 1TV7A 4WLCA 3KLLA 1GPFA 2DQWA 4J1OA 2Z24A 3WUEA 4O1BA 4M5PA 5FF0A 3WEZA 2FPTA 5AHLA 1XLMA 4BQ3A 1TPFA 4O52A 4QISA 4FXSA 4ICCX 4C65A 4S3BA 1LUCB 1E9IA 1L8PA 1W2PA 1ZHAA 4V1YA 5M03A 3RU6A 1JXKA 4JDYA 2DGAA 3B40A 1V6WA 5JUVA 3WBWA 3G6MA 4ZE5A 3F4NA 4DJEA 4JOMA 1ADSA 3CT2A 4LW7A 2INFA 1Q4NX 4HA1A 4MB5A 2WMIA 2G41A 3U7BA 1OC5A 3W7QA 1ZTVA 2ZA3A 4BWLA 2VDHA 2J9YA 1QTWA 4ZODA 3WDRA 3WDPP 1KFEA 3W1NA 4NILA 5I03A 4AXKA 4PMXA 3DDMA 3IAQA 2UV8G 3PBVA 1GJWA 4E0CA 1DJIA 2XFFA 3W2LA 4ZEPA 3WDIA 1XWYA 1GOWA 1KTBA 1FDZA 4WCJA 2JK2A 4IMEA 4MMWA 4ZB5A 5JBDA 3MSRA 1NWTA 3T6CA 5KINA 4PUEA 3UZXA 3O9NA 1B3OA 4AZHA 2XG9A 2WK2A 3TKFA 1KM3A 2I5QA 4EX4A 4CKQA 3QFWA 2PGWA 8RUCA 4FXJA 3W86A 2OEKA 2WLYA 4HCHA 1XR2A 3H4XA 3N11A 4PUNA 2FZDA 1E72M 4P7RA 1FCBA 7A3HA 4NAFA 1B3YA 1OABA 4MIMA 3R7MA 3MT1A 1YRRA 1AUSL 4WK9A 1GOIA 4BEUA 1KXQA 3R0KA 2QQ6A 4U5IA 2QJGA 4FF5A 1Z8AA 3AS1A 1QJWA 3C8FA 4A8NA 2PZ0A 1HKIA 3FEMA 3Q37A 4Q4RA 4M7TA 4GYFA 1XYAA 3GR4A 4LWWA 2RKXA 4X0VA 4FLQA 5FEXA 1AQ0A 5D05A 4B3KA 5EBAA 1TV2A 3N34A 4IFKA 1EWEA 4IP5A 4YCOA 4L4MA 1QNVA 3V18A 4I5XA 3GX9A 1RCOB 2QPSA 2WXDM 5HNNA 1EGZA 5JQ9A 5CPSA 3ES7A 3N04A 4IQLA 2IQTA 2D3LA 4MWAA 2WVTA 3SJ3A 2J7BA 5E1QA 3FAWA 4LCQA 3U0HA 3QJAA 2I5IA 4M6UA 3ZSSA 4JY8A 3KBMA 3GU2A 1IQ8A 4U5KA 4D9PA 1YXYA 1BYCA 1W37A 5AYZA 1TTQA 3HIJA 1T8QA 1IWAA 3L4UA 4S39A 3BV7A 3GE7A 3NSNA 2ZRXA 2J62A 1VRDA 4WKHA 1BLIA 2RFGA 3TNOA 3M0XA 3WQDA 4CU8A 3M41A 2WHMA 4N2YA 1SO5A 3TTOA 1YDOA 5CPLA 4E4PA 1TR1A 1X7IA 3KDOA 3R1ZA 5F1VA 4OUEA 2CLHA 1XINA 5AVHA 1NY1A 4GC3A 1TUXA 3TZFA 3VOFA 1RQHA 4GUFA 1SGJA 3N2TA 2UY4A 2Y62A 1QMLA 1JYXA 4FX6M 3UJRA 3BDKA 2J7HA 1ITUA 1IR1A 3C2FA 5DCDA 2A4AA 4KEZA 1W3HA 2QEZA 1VR6A 3GC5A 1YDVA 3ID7A 3M6YA 5FF7A 2PWHA 3T55A 2Q8XA 3WH7A 1F6YA 1H7WA 3BUVA 3D46A 1KWGA 1EP1A 1A5LC 3M0ZA 1TTPA 2QPXA 3R89A 1FHLA 3DFYA 4UMAA 2PTZA 3G1AA 2YDQA 3NQ8A 1HJXA 4O4VA 4ZMGA 2BY2A 2YLLA 3OBAA 1MQPA 3ITOA 3W2UA 3BG3A 1VEMA 1EIXA 4JN8A 2DEPA 2PU1A 1OG6A 1KLZA 4WZHA 2DJXA 2CZVA 2OR2A 3W83A 4TX9A 1W3JA 1ZPTA 1UQYA 1RY8A 4JNZA 3UZZA 3G1SA 1JCLA 2R1NA 3P81A 4YYFA 3LRMA 1T99A 2FMOA 3QEZA 4H9XA 4GOAA 3WEMA 3WBYA 3SSZA 3OU8A 1IT7A 3GWQA 1EJWC 4H41A 1DQUA 1ICSA 1TJ2A 4EVZA 3D5HA 3ABSA 1LG1A 4CQAA 3CUFA 1EJVC 2GVJA 3G2GA 3ZVHA 1B3WA 1PE1A 4JYEA 4PTNA 1J10A 3WEOA 3WDHA 4GQQA 3W00A 4AAJA 2W27A 1PDYA 2VFDA 2DZPA 2PDUA 5I6SA 1IHIA 4BF9A 4O53A 4UQDA 2DSZA 2ISDA 3T2PA 4RNIA 3TH6A 2J78A 4PMDA 1D3HA 2I16A 5H2ZA 3WLNA 3XIMA 3KHJA 5A2BA 3RG6A 1VLIA 3L67A 1K1DA 5HMDA 4DNMA 4E4UA 4QM1A 3LU2A 3UXIA 1GEQA 3NA8A 3P67A 4R7WA 1KCZA 4LU0A 1QU4A 3H2CA 4CNNA 2V2CA 3ZZ1A 3TEVA 4IPNB 1Q6GA 5BOFA 1B9ZA 2W67A 4LAOA 4J3WA 1VEPA 3B8VA 4H04A 4W5UA 2Z27A 4TO8A 4CD6A 4LXFA 1LL7A 3K30A 3QOMA 1SYTA 3TTEA 2OG9A 1C9DA 1GZGA 1GKQA 1L0PA 1MMFA 3BLEA 5B7YA 1PKLA 3P80A 4XAGA 2I9EA 8CGTA 3SR7A 1QHOA 1PUDA 1ZJHA 3M44A 2RDTA 2JKAA 2PLJA 2QCCA 1XD1A 2V6AA 5H8MA 1FFQA 1T0OA 4MY1A 4J3ZA 3GVQA 1FTXA 1VBGA 2TODA 1MSSA 5TQLA 4TVUA 1PBGA 4KT2A 4EXAA 4KEMA 2SFPA 2PEVA 1PB0A 2XINA 1XRVA 3STPA 3WLIA 5A2AA 4XB3A 5D8WA 3BLPX 3VX0A 2NQJA 4HB7A 2CZ5A 2EBNA 2ZDSA 1XH2A 4PUDA 3LPOA 4DB7A 1XGZA 3M0VA 1TPDA 5T26A 3CEPA 2RDXA 1L6SA 3TE9A 3S9IA 2FGZA 4RR4A 3EX1A 4O0KA 3B8TA 1W56A 3W7LA 4LY8A 3TTQA 3PBMA 2GSJA 4WXZA 1NM9A 3O16A 1VFOA 4LALA 1BAGA 4FZIA 4URIA 3F03K 5T9BG 3UFYA 2E1WA 3NPXA 3IJ8A 4HHHA 1E43A 4R85A 1BRLA 3ABRA 3V0TA 1YADA 1ZP4A 2D1ZA 3N17A 4HMNA 1KA9F 3K8KA 1QI5A 4Y8FA 3TJLA 3L4VA 2QCGA 4TX6A 3HFTA 3NL6A 1ONXA 1EF2A 2ISSA 4HMEA 1LZOA 4S3GA 3H8AA 4IUGA 1KKRA 3M6DA 3U2ZA 3MDUA 2HV5A 2D2GA 4F9DA 2HS8A 5M3WA 3W4RA 1GHSA 3ISIX 2ZX6A 3Q67A 3PS7A 1ZRQA 2VCBA 4NZJA 1H51A 3RRAA 3WN6A 2XGIA 2NZLA 1H61A 5HWNA 1KCKA 1PX3A 4YVPA 3ARYA 3WF0A 4HGXA 2YZ5A 1VAHA 4FOUA 2ZX5A 2OXNA 1JD7A 2HXTA 2PWFA 5IM51 2NX9A 3IK2A 2Y24A 3GDRA 1PS9A 4MNLA 1FWWA 1UG6A 3FIGA 1ZUAX 1H41A 3L5AA 4A8RA 3IUHA 3RLGA 1O7AA 2OYMA 3HZ3A 1K8ZA 2F7FA 1WKYA 5TNVA 4Z42C 4Y96A 4LC6A 1D7FA 2VMFA 3UD6A 3G1HA 1S2CA 3LS9A 4B5UA 4Q8QA 4QQ3A 3LPPA 2O55A 3QGAC 3WUBA 3GK0A 5A69A 4QGCA 1YE6A 3NDOA 5F4XA 4WOZA 4HOZA 4MWAC 3QTPA 4RE2A 1JFXA 2YR1A 5M5DA 3EPNA 1ITCA 3DAQA 2DQXA 3HA1A 1JCMP 1IXPA 1HFBA 1YPIA 2O9OA 3DU0A 3OA3A 3UNTA 3PBUA 3MA8A 3S6OA 4UZUA 3MMDA 5REQB 1F9CA 1ONRA 1WYIA 3L23A 3H6OA 1KR1A 2FQIA 2CLKA 1OGBA 3A9BA 1UMYA 3HM7A 5EY5A 2XSAA 2OELA 2ZXQA 5CPNA 2V9DA 3KCOA 4UCFA 5BYWA 2YA2A 4KS0A 3VNMA 3S9YA 3P14A 4HHMA 1TPVA 4JL1A 1KBLA 5C54A 1D2KA 3DG3A 2QHAA 4HBKA 3U2CA 2RUSA 5CPOA 3LHVA 5KZ6A 1R5YA 2ZX7A 1JNEA 3QQ0A 1UWUA 4GY1A 2F8QA 5HINA 4Q22A 1CTNA 4B5XA 1SFTA 1XLGA 3LV5A 1G7UA 4NVTA 3U5UA 1BF2A 1LOLA 2A0NA 4E4FA 2WB5A 1FOBA 4RNHA 4EPEC 3QN3A 4RV3A 1XLHA 5I79A 5A6MA 1YDNA 3P60A 3SCUA 1UA3A 1YE4A 4RV8A 2GJLA 1RVKA 5AHFA 2DIKA 1I1XA 1TA3B 1W5NA 1FUYA 2PE4A 1J96A 1EJTC 2O0TA 4JTLA 4B3LA 1XYLA 2Y5EA 1B30A 1WDQA 3EX3A 1MW2A 4CN4A 4UTHA 3MSGA 1BSIA 3HGOA 5G2IA 3D6NA 1P0BA 4C5YA 1HTIA 1W3KA 4L9ZA 3FYOA 1GQJA 1EQCA 4KETA 2BHYA 2J79A 2HBVA 3ARZA 2ZE0A 2PP3A 1POKA 2ISWA 3WFLA 1JZ5A 2QCFA 3LXCA 3IAPA 4C1NA 2WNWA 1V4YA 3UWZA 1F3WA 3VABA 1E6NA 4ADTA 2FFCA 1GEHA 4IM4A 1QNQA 3NZPA 1IIHA 1KBJA 2ONEA 1H4PA 5EA9A 2PC8A 1SZGA 3AJXA 3HQOA 5ECUA 4M6VA 3QHMA 4HSHA 3MCMA 4LV4A 1TRIA 4JTKA 3WF4A 2WQPA 3SJNA 4S2BA 4UNLA 1QNPA 5BWFA 5I06A 2ZBTA 3HG4A 3NFUA 3Q4DA 2VVSA 1X39A 3GXFA 1HVXA 1YPFA 1ZJBA 4GE8A 2PMQA 1R30A 3E2VA 3KBJA 5DY2A 2ZQ0A 4FNSA 4KBXA 4F66A 5EL1A 4QR6A 1PIIA 1DXFA 3L68A 4XKYB 1NARA 1DWFM 3SN1A 4E8GA 3M43A 1O12A 3ELFA 4A2SA 4H6RA 2F38A 2WZIA 3IIXA 1MYRA 4F79A 3NIYA 1J6OA 1Q2RA 3YPIA 3QTGA 1SW3A 4DZ5A 3OB8A 1PYFA 1SFSA 1GYMA 3NSXA 5AECA 1NQKA 2V5BA 5AY7A 1PV8A 1P6WA 1QPNA 2HK1A 1UJQA 3HGJA 4UOJA 4L4LA 5CGQA 3IJDA 3S2MA 1GWJA 3KVJA 2MANA 1DL3A 3M0IA 4CCZA 2VX7A 4HA3A 3EWCA 1WQ5A 3WIJA 1XKYA 3EMQA 3UYCA 3W84A 4O1AA 4KEVA 2FPYA 3FGCA 3K13A 4MFEA 4ZFMA 4J9JA 3EOOA 2NVDA 3V3WA 3CASA 3ICJA 4TVDA 4H6KA 3W23A 3ZOAA 3VCNA 1OEPA 5B80A 3UZWA 1GYLA 4DHGA 4MM1A 3NSMA 1TQXA 2PGFA 2VELA 1EOKA 2IUZA 3TVAA 3OVRA 2NWSA 5C55A 2C19A 2VCCA 1KFCA 1FWRA 2C8NA 4M8UA 1B54A 2G3IA 2J8TA 4QS6A 4JYDA 4YTUA 3VFCA 5HR7A 2AL2A 1HW6A 1K8XA 2TSYA 2GGEA 3NPUA 3ALFA 5HJYA 3UPMA 2JE8A 2ABBA 5JVLA 1TV5A 4GY7A 3O06A 1MDRA 4J3UA 5D9MA 3AIUA 2H9AB 3GDKA 2YXGA 1HGYA 3WK0A 1JYWA 4C7DA 2J7CA 4XKYA 1KCXA 2I1OA 4V15A 2JKPA 3QV6A 1M5WA 5E09A 2Y7DA 4UOQA 4RLIA 3E0LA 4ZO6A 3I7RA 4CD5A 3JZEA 3A4JA 3B8IA 1UD5A 3IK4A 1MNSA 1Z89A 5IRPA 2WLZA 1A5UA 4GH1A 3ARTA 4I7WA 4DJFA 1JFHA 2CWNA 4GZIA 1JI2A 3E12A 3G8EA 3P7YA 3USBA 5AHIA 2C3ZA 3W2MA 4MNKA 2QNEA 3KP1A 3WBAA 4QTGA 2NV9A 2ESCA 3OP2A 2HSAA 5FIPA 1W2VA 5D37A 4IMDA 4DWDA 5LA2A 3ZYZA 4YTQA 4O0ZA 5HJXA 3UG5A 1MQRA 3W72A 3QZ6A 4Y9AA 2O4QA 4JTFA 4K3ZA 4K7YA 4JTIA 1OSEA 3AIRA 3GR7A 1GORA 3UT0A 2GPTA 3TC6A 2ZUNA 2VQTA 2VJXA 3KBSA 1US0A 1JPKA 3UGVA 3NEVA 1QK0A 2EQDA 1JYNA 3QKEA 4JTTA 1OF8A 2R9RA 1NVMA 4WEVX 5DXXA 4YTRA 1JCXA 1UOZA 5FA5A 4CQ8A 3WNOA 4WDXA 1U83A 1CGYA 4IHCA 2AAAA 3SRFA 1UKQA 3PFRA 4XAFA 3VNJA 5I02A 2FTYA 4JIHA 3LPGA 4FS9A 5D2TA 1WZKA 3DFNA 2BB0A 5D2WA 1LL6A 1LT8A 3QV8A 1JDFA 1UD6A 1QW7A 1QPOA 4E2VA 1DJYA 2GJXA 3SO7A 3ZT5A 1EXPA 2CKSA 4Y9PA 1P6BA 3A47A 4GISA 4X0NA 3SCQA 3CYJA 4GH3A 2VI0A 3WQVA 3W7PA 4W87A 4A3UA 2AQOA 4EAMA 3D0CA 1PHWA 3KL5A 3LTSA 4UTJA 3AXHA 1OK4A 3ERPA 2OYKA 2V69A 2G96A 3L5LA 5H6HA 1NFPA 5HPCA 2VQUA 4DZHA 1F74A 4GNKB 1ISWA 4U4MA 1RAKA 2Y8UA 4UFMA 1DWIM 4XIAA 1AW2A 2OVLA 3LV6A 1MEHA 3PBGA 1EC9A 2G0WA 3E0WA 2Z2UA 3F4VA 2C1GA 4WR3A 1OC7A 2OT0A 5KZEA 2NLYA 3TK7A 2TRSA 4LBRA 2QUMA 4JIQA 3UJSA 5RUBA 1TO3A 3V36A 1FBAA 1UR3M 1CGWA 4M0XA 4RW3A 4TVCA 4OV9A 4K39A 1FWHC 3ONCA 5CBJA 2DT2A 1DOSA 4JTGA 3U8GA 4A05A 4LUJA 5I23A 4E3TA 1NWRA 2QJMA 4L9YA 3WJZA 7CGTA 4F0RA 5DF0A 1Q85A 1OADA 1V3HA 1JZ7A 1GOQA 4HK5A 4XWUA 1FVPA 3M0MA 1FP8A 4L4OA 4LT9A 3J7HA 1HP5A 3T1GA 2GQAA 2O7QA 3H4GA 4J3TA 4A2RA 1B1YA 1BTCA 4UFHA 1GOKA 1V6UA 5A1AA 1XIFA 4CD8A 4GVHA 1AW1A 2Y8KA 4YCPA 1C7SA 1UH4A 1XJBA 2WVUA 1ECQA 1RUSA 3HJZA 3OW1A 4UR9A 4O12A 3B9DA 1FH7A 2WJEA 5DRCA 1OFQA 4ZOCA 2JIWA 2E5BA 2VUNA 4HN8A 3MBFA 1HJWA 4Y2WA 1LORA 4DF1A 5BOEA 1EXBA 2P3ZA 4KWUA 3UWVA 3KS6A 3IIZA 2FMNA 1LRQA 1XFCA 1AK5A 2QR6A 2ZUSA 3C8NA 4AB4A 1Q7ZA 1RCXB 1ZBVA 4KFOA 3ARPA 1X1OA 4HVXA 1H3GA 3MHGA 1XYMA 2W4XA 2PSNA 5C2GA 1R2RA 1XQLA 4I9JA 2QF7A 2FJUB 2E6FA 2WO5A 3NQFA 2QJNA 2CLOA 2ATSA 2HS6A 4LUTB 3E38A 4IG2B 7ENLA 1UD2A 4WDWA 1EL3A 4B5TA 1LTDA 2Q8LA 3AMDA 3G0SA 2J6XA 1JGIA 4UB9A 3UNDA 4OU1A 4ML4A 5HWJA 2VWSA 4OBSA 3BGGA 4C1LA 1UROA 4OWGA 2AGKA 3I10A 4HQVA 4DX3A 1BRLB 1CB2A 2PC4A 3QW4B 1EX1A 2Y4SA 3R0UA 4WKFA 4HPNA 2ZA1A 3DBNA 1G67A 4ZQCA 3SFKA 2WC3A 3MCOA 1IIGA 1DQWA 4UZSA 2YW4A 3CMGA 4JFWA 5EFDA 3NQ6A 1IEIA 3FA3A 1WDDA 3FJLA 3SN0A 4R3UA 1M9HA 1ZNNA 4ORMA 3VIGA 2DSUA 3UGRA 2BP1A 3TQPA 1BD0A 3CWHA 3U5YA 3QY6A 4WX2A 5LGZA 2BVYA 3KOYA 1H7OA 1RZMA 4CNPA 1SU5A 1YW1A 5EMUA 5T8GA 1D8WA 4PMZA 4XIMA 2PCQA 3F5LA 2VTFA 3OQEA 2PRLA 2XGZA 4LUIA 2WANA 4XZIA 4QFUA 1XLDA 1ZP3A 3EXSA 4K8EA 2Z1KA 1NF7A 3IPWA 2OZ3A 4FEZA 4GJIA 2WNZA 1X7FA 3BH4A 3A6OA 1E70M 2NQLA 4KESA 4AMAA 1CXFA 4ZOEA 4L80A 5JH2A 1A5NC 5E0KA 2XH2A 1UR8A 1Z42A 2WPBA 5DRIA 4H7VA 4PMUA 5AC6A 2VHLA 3MC5A 3MCNA 3C2OA 2GGGA 5AVNA 3UPWA 4O57A 1FY6A 2EPOA 5TBOA 1SFLA 4JTAA 1K6AA 3E2SA 5T9CE 3OO2A 3VVGA 5JU6A 2Y63A 4HU3A 3LPFA 1N7KA 1JD9A 5EPDA 4DVOA 3AZRA 5GQBA 4QJ5B 1QWKA 1ICQA 3CAWA 3VIJA 5E9AA 4P8XA 3L2IA 3PSWA 1O5RA 4Z1YA 4O8RA 3TFCA 4H8HA 3CT7A 4DM2A 4L9XA 3WSUA 3M47A 3W7MA 5PTDA 3W1MA 2QJIA 1V5XA 2Z1SA 4CN1A 6ENLA 1WDPA 3UBPC 3UWQA 3W1XA 1R0MA 2OX1A 3LRKA 3KVKA 5A6JA 4LV9A 2PWEA 1XIMA 3U4AA 3AYTA 1DQXA 4LVBA 3UESA 4I6KA 5CJMA 5SWUA 1CXHA 3P8JA 1P7TA 3WELA 2A3LA 1RH9A 4BFAA 4B16A 2PBGA 1I2OA 4TMCA 4V33A 3IIOA 4LYPA 5CGTA 3CUZA 3R8RA 4JX6A 3W1PA 3W73A 3S1XA 2PDYA 1JPIA 4LF2A 1GCYA 3GNPA 1XLCA 2BSLA 6REQA 1PZ1A 3V4BA 2XFWA 1PZ2A 4IX2A 4NXSA 4AX7A 3THCA 2UBPC 4DO5A 1OF6A 5DMNA 1D3CA 3BURA 4H2HA 3DFQA 2DW6A 2YB1A 1OG0A 2PTXA 3ZR5A 1LRTA 3URQA 1KM5A 1E6XM 1F2JA 3UY7A 2NV2A 2PWUA 3BICA 2OZ8A 1T8XA 4H2CA 5A6TC 5A95A 1ODUA 2DV0A 4XO6A 5FL1A 2ZUTA 2OU4A 3AMCA 5CC3A 3WLPA 1SZFA 4PA8A 4HIBA 2CBUA 5LNUA 3CUHA 1E1CA 3CQJA 1KFBA 3GB6A 5BWAA 3OVQA 3T0BA 4A6GA 1KFWA 3KP0A 3VPLA 1HXJA 4JDBA 2OQYA 3PPGA 3O3RA 3TSBA 4NJKA 3WLOA 4N9EA 1VBRA 1BVNP 3DX5A 4HCDA 5DLCA 5D02A 2BVWA 3EB2A 3K4AA 4GUGA 3PK7A 1RQBA 3P62A 1HJUA 3W74A 4GVFA 1K02A 2VEKA 4DZIA 4QJ4B 3GSMA 3THQA 3VGGA 1KV5A 4A3RA 3QMTA 1HJVA 1EEPA 1JDDA 2ACUA 2V38A 5A8GA 1AZ2A 2REQA 3USZA 2WZEA 3FEQA 4GX9A 1Q6OA 2E68A 3HN3A 3FKKA 2RDWA 3OG2A 3E02A 4QP0A 5IHSA 1H50A 1KV8A 4JKLA 4CUCA 2R94A 2NVAA 5D9PA 1F4HA 2Y70A 1GQNA 4MB4A 5CSSA 3GXTA 1FWSA 1ICPA 2C6QA 4DI8A 3STEA 1XQKA 3H4WA 1QOPA 1UWRA 3TA6A 3KWXA 4W85A 2OTDA 4LF1A 3SUUA 1M7OA 2QULA 4CVWA 5AYXA 3OLIA 4JZ5A 1Z41A 1K8YA 3C61A 3UW6A 4GFSA 2FHBA 4YN5A 1THFD 4ROPA 5LYRA 2AL1A 4JAWA 1KTNA 3PJXA 3NZRA 2OSWA 2XVKA 2W9MA 3WF2A 3Q58A 3T81A 2YBTA 3KW3A 4RNJA 1I0BA 1FA2A 2X2GA 3ZR4A 1KQZA 4UTUA 4F4RA 1XC6A 4JQAA 3I4KA 5KTLA 4K1GA 3GTXA 3LHYA 3GW3A 4NNCA 5I3HA 4RNFA 3VO0A 4IGHA 5CZ0A 4MDOA 1I2QA 2PGRA 3NL2A 4WDTA 5IBXA 4G7EA 4NZ3A 1S5MA 3L12A 3M0LA 6XIMA 1ZAIA 4JTHA 4ZENA 1TFVA 3MPGA 3ZQ9A 4TUFA 2WYSA 5EGRA 3FHAA 1XIJA 1TSIA 4O1EA 2DT3A 3O63A 3BSGA 3WFAA 4Q4SA 3UERA 3B06A 1TPWA 4CNSA 1B4KA 2D0FA 1RJPA 1OFEA 4TMBA 3CU2A 5BMXA 5U4NA 1PIFA 3K4DA 3P0XA 7REQA 1V3KA 1GG0A 4NRRA 3ITLA 2OB3A 4W86A 3BJTA 2X7VA 3HG2A 3MI6A 4HOXA 1K9EA 1W54A 1P0DA 1V6YA 1EJUC 2VZTA 3WBXA 4N7QA 4MY8A 3MYPA 2VX6A 3LM7A 1NDYA 1P6CA 4NJGA 1CX9A 1S2WA 5KEZA 1N82A 4JIRA 3VGBA 3GHRA 3FYPA 2DZWA 4MGGA 2E6AA 5JBFA 3EOEA 3KBWA 3EX6A 3RDKA 2WM1A 3ZLHA 5KETA 3M64A 3LTPA 3EX2A 4RZ6A 1UBSA 2W5FA 3NQ7A 3G5EA 4GY0A 4M3PA 2ZZ6A 5GJPA 1X8FA 1UW9A 3OLEA 3EKZA 2ZWZA 1X96A 3KDNA 3AZTA 4NASA 4HHLA 3GW0A 5E0FA 5EU9A 3NJ3A 3WNPA 3MS8A 2XIJA 3CTLA 4REQA 5C71A 1AA1B 4XSLA 1P0NA 2V81A 3H21A 3JRKA 2G95A 3MZNA 2HVNA 1U22A 2VT0A 2NQZA 2E25A 3CB8A 3FFSA 1VYRA 1AMYA 3P82A 3SCTA 4BKNA 2IXVA 1XX1A 5BU9A 1FH9A 1UWIA 2UWFA 4DO4A 4OJYA 1GQLA 2NSXA 2Y2WA 4MWAB 4R88A 4LYQA 1QNSA 1BWKA 1WZLA 4FLSA 4HSOA 1RJQA 4W88A 2G4JA 2WWDA 3UWWA 1PKMA 1E55A 4JPGA 3V75A 3WNMA 5MHBA 5KSWA 4ZTYA 2G97A 4V2XA 3STFA 2FGLA 2BV9A 4PRWA 4D6CA 4DUXA 5E70A 4HYVA 1R9XA 1V7YA 2ZXDA 1O5KA 4ZL1A 1WNOA 1BGAA 1P5BA 3AMKA 4Y6GA 3W1AA 3WD0A 1FHUA 4Q4QA 3IACA 4GI8A 2ZUWA 2GVYA 4D6HA 4K8GA 3BOLA 1U1JA 2VR2A 3ARQA 3MQTA 3BAIA 2DU2A 3BAWA 3KXQA 4D8AA 2QIIA 2FDSA 4Q4KA 1EEXA 1QR7A 4WXYA 4H3DA 1UB3A 1H49A 1DIKA 1YXDA 3SRHA 3I3BA 4JHZA 3BWWA 3GDLA 2BZNA 3GH5A 1DPMA 4UC5A 4KWVA 4W8LA 4ADSA 3ZVHB 4ACZA 3MMTA 4ZQOA 1NFBA 1IV8A 5FL0A 4Q32A 4ZA0A 4GUIA 1U2YA 3DENA 4XTDA 3OZOA 4ECLA 4JD4A 4J28A 3GNNA 3IARA 4L6OA 3ARSA 4QHRA 1VBUA 2W0UA 1VBHA 4NL1A 5A5WA 1KM4A 3DI0A 4I9MA 1TX0A 3VD5A 1GVYA 5LHEA 1A5SA 4MPKA 1EDGA 3DC0A 2OJPA 2ZRUA 3A4AA 5FACA 2OPJA 4IFKB 3R6IA 4J2PA 3VNLA 3ITCA 2D73A 1QDSA 1EC8A 3JW7A 4LVDA 3MP4A 3PPFA 1KRAC 1ZAJA 1JNDA 3RO6A 4I7VA 3WF3A 2WZTA 1JCJA 5CSYA 4JTCA 2F6XA 2ZDRA 3ME3A 3EXRA 4AU0A 3NPVA 1EH9A 3GHUA 3SSJA 3TLQA 4ILSA 5DO8A 3TN6A 3U6WA 3CWOX 3W6MA 3WD3A 3GYEA 1QHZA 1AZ1A 1R87A 2NVCA 3TU9A 5KZDA 2OQLA 1R3QA 1RLCL 2C79A 1N55A 3LQLA 3PULA 1R46A 3ANVA 1W0MA 3RJXA 2OLHA 6ALDA 1YDYA 4JKKA 3UA4A 1TWIA 5D03A 4JX4A 1JAKA 4FOJA 3VIFA 3EWUA 1VJIA 2GYIA 2PS2A 3NVDA 3IUIA 3V5FA 3AC0A 4UMBA 2DZBA 3OQ8A 1XLLA 1ITQA 2ABAA 3W6LA 3P2VA 3WF1A 1DVJA 4PZVA 3MVTA 1PPIA 4UNKA 4W4QA 3UCDA 3VE7A 3UG3A 4NF7A 1C29A 1ECEA 2QGYA 4C90A 1IEVA 2VZVA 3RLHA 3QLLA 1A4LA 2VFGA 3K1DA 2E5DA 3CM4A 1XRTA 4JQ1A 3KCLA 1O95A 5MKGA 2VM8A 2Y0FA 3W24A 1RD5A 1BEUA 3LD5A 4LVAA 3TW7A 2BXVA 3A4WA 3RGTA 2GSEA 1TPUA 1LJYA 2IS7A 3WCZA 1W1PA 2GUUA 3VAVA 3MI2A 1DXIA 4RZ5A 1MFVA 1UHVA 4XISA 1QO2A 1H1NA 4GIRA 3W28A 3S4TA 4DWSC 4DELA 3IGXA 4PMVA 3MU7A 1TPB1 2PLMA 7ODCA 1B5TA 4HK7A 2QKFA 1TREA 1P43A 1M53A 1EUAA 3PANA 4W8BA 1VP5A 1XSKA 2VD8A 3CZGA 3TR2A 3CQKA 3DHPA 2B7PA 2FH8A 1SW0A 1NSJA 1LDCA 1OWQA 1R6WA 2OOFA 3H22A 3QXBA 3Q2DA 2OSYA 5CPTA 3NZ1A 5GJMA 4PH6A 2GUBA 4DJDC 1R2TA 4EPKA 1HL8A 2G3FA 4AWTA 2PPGA 1G69A 2V2DA 1F8MA 4Q6JA 2XVLA 5E5CA 4DYKA 4MG4A 1F6PA 3VUSA 1A3XA 5EMLA 4PBGA 1T5AA 1WB0A 4UTKA 1Q7MA 4DAFA 1XHGA 3AROA 3WDQA 4DQWA 3H2AA 3W70A 1R8LA 3FW6A 2VEMA 5AZ1A 2BG5A 4IPLA 4DN1A 2Q71A 2NQ9A 1E0VA 2B4GA 1Q6LA 3RF9A 2R6OA 1RHCA 1UR4A 2DP3A 2E5CA 1EOMA 3TXZA 1WV2A 2NUYA 4DUWA 2CKRA 1XXXA 1JCNA 1OGGA 1QPRA 3DFTA 4KIRA 4XD4A 2DVTA 3QYQA 3CL6A 3VIOA 3N18A 5MKGB 4V27A 4NG3A 2QUNA 1LOSA 3ES8A 3UWUA 5D2XA 1PO9A 4Q3MA 5D2VA 3TONA 4HZ7A 4BQ2A 2NX3A 3QW3A 1OCQA 1FCVA 4XBSA 5BXPA 1JDAA 4RPPA 1XIIA 4CD7A 1QCWA 4GI6A 3CUJA 2YCIX 1DWHM 1JUEA 5FJJA 3MKCA 3SGZA 4UTIA 4GJJA 2PBOA 5TF0A 1QI2A 4BR1A 1JG9A 3TXVA 3THAA 2PDLA 1QOXA 1KW1A 5F4SA 2X1SA 5D30A 4QLJA 2ZZ5A 3DUGA 5E6ZA 2PCEA 4O19A 1UH2A 3M5VA 2C91A 3NWRA 3VM5A 2HPIA 4TTGA 4ZO7A 3LCGA 1RLDA 4QLKA 5C6MA 2NX1A 4HOWA 4QITA 3GUWA 4ZQRA 3THUA 3EOUA 4DF0A 4HMDA 4CQDA 4GBUA 3LHUA 3S6TA 4N9DA 1U1HA 4IISA 2PURA 3MUIA 4AZIA 2CLEA 1C8YA 1KRBC 3PM6A 4QCFA 3GIYA 3EDKA 4HPJA 3GIQA 3TOYA 5LIWX 2EKGA 3G1RA 3AOFA 4XZLX 1GYNA 1HQTA 3MMWA 1M01A 1PWMA 3L2LA 3MVIA 2J47A 2A7NA 3AIVA 4C6LA 3WQ8A 2CLLA 2OMAA 4FA3A 1S3HA 2BMBA 1V08A 3N9RA 1QVBA 1S2TA 3BLFA 3AXIA 2WBKA 4DBSA 3B0UX 4GMEA 2CXEA 3P61A 1KXHA 1WDWA 3EBVA 4NHVA 4Q7IA 4NP7A 1ADOA 1O6IA 1R2SA 3LNMA 5C7VA 3FSTA 4E2OA 1VENA 1UZDA 4LAKA 4C60A 3NGJA 4G1NA 2ZRZA 3SI9A 4FAMA 2G8ZA 4QE5A 1EYWA 3AICA 5AZ0A 5BOOA 4L61A 2QCMA 3N4EA 1KM2A 3RX2A 3ZWSA 2NV1A 4AVOA 1S1RA 4PR4A 4B92A 1ZS2A 2WMKA 2J77A 2Y61A 3PF3A 3S47A 2YZRA 1HO1A 4HNCA 1YPXA 2XVGA 2ALRA 1BWLA 4GX8A 2J9ZA 3Q65A 3ZSTA 1DEDA 3WQPA 2XZ7A 5M17A 4L7ZA 2XU2A 4G1KA 4X9YA 5D2YA 4W7VA 5M1TA 1AVAA 2VCAA 4FNUA 4N4QA 3TW9A 1NOFA 1G94A 4B91A 4C91A 3VKAA 3ALGA 5IFTA 2G4FA 1LQ0A 2OSXA 1OX6A 3VC6A 5A6SA 1BYAA 5F2IA 1C92A 1EDTA 3NQAA 2A7PA 5LGXA 5AHMA 5REQA 3APTA 2JQXA 3MW7A 1OFRA 3W38A 2NWRA 2CWXA 1RPKA 3EWBX 1QBAA 1FDJA 4GRSA 3C0JA 4DUOA 4NZ4A 5F7UA 1W1TA 4QS5A 1ISYA 4GNJA 4NZFA 3VNYA 1AQHA 1WE5A 1WXJA 1K70A 2DVUA 1VLWA 2VDGA 4AWEA 4IJCA 5ABFA 1XCFA 4HPXA 4KCTA 3RM9A 2XTKA 3V16A 1GK8A 4GQBA 3DERA 3RCMA 2FVKA 5AC5A 2YIHA 3KHDA 1UUQA 1XD0A 5BMWA 3RITA 1NF0A 2E8ZA 3NVTA 4FHAA 3WQGA 1ZLPA 5CQ1A 3FVDA 3EYPA 3PZNA 1XH0A 1KBIA 3LMZA 3HMJG 3QM3A 1QI4A 1EO5A 1DYSA 5A94A 5C5YA 3T0TA 2C7FA 3LHWA 3GXMA 4AXNA 4GXPA 2ACSA 4UUIA 1ITXA 1POJA 2E4TA 3LYEA 5GVJA 4UBPC 4WDUA 2WC4A 4FALA 4JN7A 2GVLA 1XCXA 4GVGA 2ZRVA 2INZA 2QDHA 3KOWA 4ZO8A 3L0KA 1DJWA 3QKZA 4DJED 1IR2A 4NJJA 4DEFA 1FQ0A 4CEXC 2PI6A 3O8AA 5EYWA 1QRQA 3GVGA 3K2GA 4AZGA 6TIMA 2DJLA 1LF1A 3NEHA 4AG0A 1ZY9A 1KM1A 3R2GA 3NO1A 3ZJ6A 4HCLA 4KWWA 4FNPA 4XG1A 1BYBA 2ZX8A 2VC5A 3GKFA 1Z32X 2WVVB 1Q6DA 4M80A 4I9TA 3PJTA 1BKSA 2ZXAA 4HPGA 1A3HA 1BWVA 2WSPA 3O1NA 2ZZ4A 1J0JA 2ACQA 4J2MA 1XKJA 4GIEA 2TMDA 5AYBA 4L6DA 3DFOA 4I6VA 2NXHA 4F2UA 2EJ1A 4L5ZA 4AZCB 3ZLGA 3VKCA 3QOKA 3IV8A 2JKEA 3PBYA 1E1EA 3T42A 2NSOA 1H60A 3SCOA 3VZXA 5CPQA 1WKFA 4XKMA 3CYVA 2J88A 5I3KA 3A3WA 3NNTA 4J5NA 4L65A 2J74A 2Z6IA 3LG3A 2FZBA 2FZNA 4YXGA 1C9WA 1GQIA 4GWEA 5C2CA 3PG8A 3OVPA 1CDGA 1TELA 5FJIA 1HO4A 2RJGA 5J04A 3RPTA 4J7RA 5FESA 1F3XA 2E9MA 7TIMA 3EWZA 1ZBWA 1WXZA 4N6EA 1M03A 1OT1A 1FCQA 5FD0A 3S46A 1C93A 4MKVA 3SAZA 3U3HA 4NU7A 3WMCA 4AEFA 3MZ2A 5FF2A 3NQBA 1J12A 4GFIA 1HUVA 4PBEA 1HIZA 1UQZA 4TOQA 4IXXA 1UWQA 4RDZA 2JF6A 4S3CA 3WO8A 3PZQA 2VGFA 4HNUA 1KLYA 4PEKA 3BCDA 3CBWA 2WJDA 2BVDA 4C6MA 3TOPA 2P10A 1ZJAA 1XIGA 4Z2JA 4C6DA 3ARWA 3B0VC 4GI4A 5FJRA 5CZSA 2V5KA 3VILA 2V3GA 1E0WA 3G0XA 2OZTA 1E0TA 1H1ZA 1XV8A 3AS0A 3W76A 4PSRA 4PUUA 2D0GA 3CUIA 4AZ7A 1KXVA 3N12A 4DUVA 3IS4A 4PMOA 3BG5A 3WD2A 3WQ4A 3ZXWA 3JR2A 4LBSA 4YU1A 3G1XA 1X6UA 4DYEA 1MUWA 3LEPA 1BXBA 2WBGA 1WXYA 1TR9A 3AHXA 1UPPA 2XH0A 4HYWA 1J5SA 8XIAA 3W7HA 2EG7A 2CITA 3AQUA 3OYXA 4WJEA 4HNNA 1E5JA 2CZFA 3H7VA 4EF8A 3RPMA 3UR8A 2E6DA 3S0CA 1QNOA 1CXIA 2E8YA 3HQ1A 2PB1A 5AFDA 4UXDA 3NTYA 3FOKA 3PR2A 4LB3A 4UWMA 4QJ3B 2VGBA 2WZMA 3U4FA 2FPVA 4ZVJA 4BI7A 3U2EA 1Q6FA 3W2KA 1AQMA 2V30A 2XYLA 4K2SA 1GHRA 1H7RA 3GHTA 4EF9A 3QSRA 2ZUUA 2PD9A 5BXRA 1XLBA 4UFIA 3DGRA 2ZRWA 3DCPA 3LDVA 4F8XA 3N2CA 3BTNA 2GVGA 4RE4A 4AD1A 2OO0A 4BZYA 3B04A 4YPJA 5D8ZA 4JIPA 4DBEA 1CT5A 1H62A 2BGSA 3EAUA 3BAYA 1FXPA 3RN6A 4HHPA 1W9DM 3WLHA 2Z28A 1K8CA 2QLYA 2DIJA 4QQUA 4DJFC 1MZHA 3VIPA 4RDWA 4H8UA 2W91A 2CESA 2F2KA 4IUOA 5A8NA 2YBUA 1S1PA 4IIEA 1O94A 3WLMA 3L65A 2X0HA 1MEIA 4UQEA 2DORA 3GLCA 3R5EA 3B3DA 4RJEA 1QK2A 4K37A 3C3UA 4I9AA 1F6KA 3U7VA 5HNRA 3I3EA 1AJZA 3CZKA 1A80A 3W53A 1FDYA 1OK6A 2XN1A 2C1IA 2W66A 3TX9A 2XFRA 5DBTA 4KERA 3UPBA 4J3VA 3KZPA 2F61A 5F4WA 3CUXA 4JQ2A 3LERA 1W3IA 2E09A 1TV8A 2CLMA 1PZ3A 1W9XA 3R25A 2Y1HA 4J27A 3ZIZA 4DBWA 4MJ4A 4IFOA 1XP3A 4M6PA 3OEXA 1XYFA 4PC8A 3KLKA 1Q3NA 3F2CA 3VI2A 3FJNA 4K68A 3WG6A 4HT3A 1PKNA 5I2UA 1R3VA 4IGNA 3IJ6A 1JXJA 1Q45A 3NZGA 3PWIA 2NLIA 4UTMA 2I14A 3CUGA 2TPSA 3LY0A 1R3WA 4HZMA 1B31A 1SSDA 2ZZ2A 3R8GA 3FS2A 3CTTA 4EXBA 4BS0A 1DE6A 3VKBA 3N73A 4A29A 3QGVA 3WJYA 3C2VA 2JEQA 2VDIA 1K6WA 1EIBA 3DN5A 1EHNA 1Z48A 1F5ZA 4QXIA 1R7AA 2V3EA 5XIMA 3WLQA 4KMQA 2B7NA 4GUJA 1QUMA 3G6LA 4Q8WA 2BHUA 1TTIA 3VM7A 2IPGA 3PHAA 4GZEA 1VCGA 4IGMA 4L1WA 2QV5A 1OINA 2JALA 2YKKA 1BQGA 1UP2A 5L6UA 4UTLA 1MDLA 1CXKA 2PDHA 3CPUA 2P76A 2PZNA 2BFGA 4DLMA 5MF5A 1VB9A 4QAWA 3OIHA 2WKJA 3ITVA 4H6EA 2WHKA 4JTUA 2XZ9A 3WH5A 2WCGA 3CC1A 4C6PA 2DY3A 2Y7FA 1VYSX 5BXSA 2A6NA 1UBPC 3QBUA 4XZMX 4B2DA 4JEJA 4PUJA 2BY0A 2VOTA 2E7FA 4MY9A 1VZWA 3ZVIA 3WQFA 4ACYA 1DJXA 2RH9A 3TCSA 2V5LA 1BG4A 1TB3A 2V5DA 4ZO9A 2OZ0A 1ZZMA 2XIBA 3P5ZA 3EMZA 1VJZA 4YNGA 3CIXA 3W1UA 2Q8ZA 4PTXA 3I6EA 2J7EA 3NQDA 2WC7A 3TAKA 1CZ1A 4PMNA 5FEPA 2C14A 2YCLA 4MAZA 5CKSA 2W92A 3NPWA 4MJ2A 3TYDA 2H9AA 3RK8A 2VR4A 3LM3A 1LUCA 1OX4B 3MBDA 1EGVA 1VPYA 3BO9A 3L4YA 2QT3A 2BY1A 4MF4A 1WP6A 2QW5A 3H12A 1UZ1A 2CCRA 4FXFA 1NOUA 4U2YA 3GFXA 2VRJA 1X6NA 2PDQA 5D09A 4C6JA 4AVNA 3RHGA 3AISA 1R7OA 5HXMA 3D3FA 2QJJA 3MY9A 3ARXA 4AY1A 1H1YA 2IPFA 3KX6A 4KRTA 5A8OA 3LOTA 3TYBA 1OIMA 3O7UA 4O17A 1MUMA 1C91A 2X1UA 3OHIA 2YCEA 5H8PA 1TYGA 5EB8A 1WA3A 4AW7A 2ZADA 2DT0A 4JFTA 2FTPA 2PLKA 2YDAA 5FI8A 2VGIA 3FHQA 1M41A 3IRDA 3LCWA 3RUBL 2ZYFA 3KZSA 3R58A 3E0VA 4DI9A 3HU7A 4IP7A 3KTSA 1CXEA 2WHLA 5F2LA 1JZ3A 2WV8A 1K9FA 3C5QA 1T41A 1NDWA 3QMRA 2TAAA 4O1DA 3OGRA 5DCEA 5BU6A 3S5OA 1JPMA 1Q6CA 4HU4A 4XAYA 4R9XA 1M68A 3THDA 3WH6A 4GXMA 3BAXA 3OGVA 4DRSA 4XQ6A 5I3IA 2J7DA 3BJSA 4OFCA 2V67A 2E6YA 3MO4A 1JZ6A 4P5UA 5IFPA 4MADA 1GZ1A 1W5PA 1TX2A 3R43A 3TYAA 5I09A 2JIEA 4O1CA 4LS0A 1XYBA 3WNNA 1P4CA 1W9BM 4AIOA 2A7RA 1HKWA 1VBJA 1LLWA 4PTDA 1LROA 2HMCA 2QDDA 1MXSA 1PL9A 1TZ7A 3CV7A 3E3HA 3VOCA 1XC4A 3SUVA 1J0IA 2DZSA 1YX1A 4QE1A 4S1FA 2WNQA 5AC8A 4X61A 3SQSA 1G01A 2PWDA 3INPA 3LLDA 3UJFA 1JYVA 3TV8A 5JIWA 3XINA 1EX5A 3C6CA 4FNRA 1AG1O 1SZRA 2GQ9A 2P5NA 3KL0A 3CLWA 3A3XA 4L6HA 4ZE4A 2QYGA 1U33A 1GVRA 2VX4A 2GGHA 1HZYA 3I7SA 3MUAA 4R53A 1BSLA 1Y0EA 4QE4A 4QDMA 4MHBA 4JTRA 3UY8A 1GZJA 1XIEA 2A2IA 2F9RA 1GNXA 3LZ5A 3WX7A 5FJOA 3TTSA 3S2LA 3GNOA 2EPKX 3FYYA 1UKOA 3HB9A 3TJ4A 4HJFA 4IF2A 4AZ6A 3P0WA 2GGIA 3VOIA 5DCBA 1EBHA 5ABEA 2HJPA 2QAFA 3IIPA 5IDZA 2J7FA 3B0YA 4UCGA 2PGEA 1WAWA 1V6XA 5CJNA 4INFA 4C6EA 3TYUA 4XBKA 5I77A 1DIDA 1WAUA 2GOUA 3C4UA 4NAFB 1NFGA 5K9XA 1X6LA 1SPQA 3LK6A 3VOGA 1TVLA 2DDXA 1YIXA 1PAMA 3FJ4A 3V1HA 5AHEA 2Z4GA 4WJ8A 3FSUA 4ICMA 3E0FA 4O11A 1MI3A 3L0GA 3O05A 3PZGA 3PNZA 1IWPA 3O15A 3W81A 3F2BA 3N2MA 2YYUA 4WIWA 3ONBA 3WL1A 7PTDA 5CXPA 3ZS4A 4P7OA 1TKKA 1SZNA 2CEQA 2XJ7A 4QG8A 5LIUX 1S2UA 2QCDA 5LNVA 1FWEC 3T05A 4Y7EA 1OFDA 5CZKA 5GJNA 4JN6A 5C70A 2Q01A 1W3TA 1H5VA 1EWDA 2QCNA 4CQCA 4H00A 1Q13A 1JPDX 3M4HA 4MKNA 1RA0A 4QNWA 2D24A 4JIEA 5EMMA 6REQB 4ALDA 3JS3A 4LAUA 2DZUA 4HZ6A 3LLFA 2ZICA 2OFJA