2CYGA

Crystal structure at 1.45- resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESGWPSAGGGAEASTSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQKAGGIEQNFGLFYPNKQPVYQISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-1, 3-glucananse
publication title Crystal structure at 1.45-A resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
pubmed doi rcsb
molecule tags Hydrolase
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cygA00
4KGLA 2J7HA 5CSYA 3SUUA 2OYLA 5D9OA 3U5UA 2V3FA 1NQ6A 4HOXA 4CVUA 4JFTA 4DWSA 1VJSA 5GQBA 2EEXA 2Y24A 3QOKA 1MW2A 1J0KA 5CJ5A 4C7GA 5LA2A 4OOUA 1WB0A 3PZMA 2B31A 4OZOA 3OZPA 1V6VA 1B90A 2W67A 4MPKA 3ZMRA 2VRQA 5E0FA 1E1EA 2XFFA 3RM4A 3ZOAA 1M7XA 3WQ6A 1GPFA 2CCRA 2F2HA 1VIWA 3VX1A 2CIPA 2ZXBA 4W5ZA 1E4IA 1HP4A 1JZ7A 4OJYA 2GDUA 5I3DA 3VKKA 2YDQA 3MSGA 4UFLA 3WEOA 1NARA 2IXUA 2G8ZA 4PRWA 2VO5A 2AMGA 2YLLA 2E9MA 5A8PA 2BVTA 3CBWA 5KZ6A 2VC9A 2XUCA 1VBUA 3FY1A 3FW6A 4BQ3A 5M3WA 1HL8A 2BS9A 2DGAA 4H8VA 3WENA 1JZ8A 4JHZA 3DHUA 1JF6A 1J0ZA 3CHDA 1C8YA 2WANA 4FK9A 4QCFA 3VM7A 4EK7A 4W88A 2XFRA 4DUXA 4D6IA 4M29A 5CG0A 5LA1A 1QHZA 2QLYA 4UFMA 2J75A 2UY5A 5IDIA 3WUFA 3UR8A 4ATWA 1FH9A 2J62A 2E40A 1NOFA 4MNLA 2WCGA 5DT7A 1DTUA 3N9KA 1E73M 4QLKA 1OB0A 1V3IA 2XPKA 1X6LA 2X1IA 2WWDA 1CWYA 2J7BA 2J7DA 3EMZA 3TTSA 1WZMA 1E6QM 3ZQ9A 1JI1A 2TAAA 3E1F1 1VFMA 2CITA 3FHQA 1NWRA 5D8ZA 1KQYA 1I1WA 4XZBA 1V6YA 1FFRA 5A2AA 1G01A 1EDQA 3WF4A 3IJ9A 3BAYA 1OT1A 4LXFA 1FP9A 1KCKA 2JF7A 3WEMA 3EMQA 2EPOA 2PWGA 2VZTA 4HA4A 2JF6A 1DP0A 2BXZA 4CVWA 2CKSA 1H2JA 5HBFA 1UH4A 2CBIA 4D1IA 1C93A 3BAWA 3OLDA 1C8QA 3BC9A 3GYCA 2QMJA 3VVGA 3VNYA 4TXEA 3T2OA 2PBGA 3TOPA 3CHEA 4P7OA 1C91A 3AJ7A 3WKZA 4NF7A 2XG9A 2ZUSA 2V3GA 1MFUA 5D9MA 4HU8A 2ZXQA 2DQXA 3BCFA 3CO4A 3VPLA 1JL8A 8A3HA 3PTKA 2WWCA 1E0XA 3VGHA 3ARSA 4BQ5A 1IZJA 1UOKA 4M82A 1HKIA 1NWSA 1E6PA 1M03A 1OIFA 4NRRA 1JI2A 2XJ7A 1C7SA 3CH9A 3G6LA 2E3ZA 2OWWA 4FLQA 4TUFA 5CGTA 5EB8A 3WNKA 3WF2A 1PIFA 2J8GA 1PX4A 1KXHA 1JYVA 1UR2A 1V6XA 1D2KA 3T2PA 3GNRA 3WD3A 4J3SA 1NP2A 2BY3A 2GJRA 1GHRA 4GKLA 4W87A 1H1NA 1H11A 4JCMA 5A8MA 2W5FA 3SCWA 2DT1A 2X0HA 3JUGA 3MMUA 1GZJA 4AD1A 3ZJ7A 2WZEA 1Q6EA 3KWXA 5A6LA 2WAGA 1UZ4A 1HVQA 2EPKX 1BFNA 3A6OA 5I78A 1U2YA 4GO9A 2Y8VA 4D72A 1W1VA 1GVIA 3T0AA 2W62A 4LYRA 2WMJA 4W7VA 1HXJA 3VNZA 3PTMA 1DWIM 1OM0A 5HPCA 1BHGA 1LL7A 1M53A 4JKMA 1E0WA 3RM9A 3A4WA 1DHKA 1BLIA 1VFUA 1VFOA 5A8OA 5JIPA 1EHNA 5ABFA 1DWHM 1JAEA 1MQRA 4IISA 5BXRA 2G3MA 4GPNA 3EMCA 4J3XA 3U7VA 5A6AA 4ZE5A 1W1YA 1XYFA 1ZL1A 3K4DA 2YL9A 1DWAM 3SCQA 3CZKA 3WNNA 4UQAA 2VTFA 1B3XA 2XWDA 2PBOA 1TCMA 3EDDA 1HJXA 1OSEA 1AQMA 2CYGA 3BLKA 1KFWA 1TUXA 1CDGA 1UH2A 2XSAA 3M6DA 5A2CA 1UR9A 1XSJA 3HMCA 4PN2A 4D6HA 1NWUA 3VIPA 1E40A 1MVYA 2BHUA 4QLLA 4AD3A 4JZ5A 3DECA 4M81A 2VMFA 4B3KA 2F8QA 5LA0A 4GIAA 1WZAA 4BA0A 4ATDA 4YPJA 4MTVA 5I2UA 5E09A 1UQZA 2DT2A 4AMCA 1AQ0A 2BVDA 2WMIB 2QHAA 3NSMA 1US2A 2CESA 2D3NA 2J47A 2WHMA 3A47A 3RJXA 2NT1A 1XGZA 3AS1A 4NZCA 3WDQA 1E4LA 4UQBA 1B0IA 1VEMA 3F5JA 2ZX9A 1H3GA 3VOCA 1GJUA 1ISXA 3AYSA 2WSKA 1UWRA 5HXMA 3SCVA 3UESA 1LQ0A 1UHVA 1W1TA 2E0PA 2VJXA 4PYSA 3SCNA 2ZWYA 3QR3A 5CXPA 2WXDM 2A3HA 3T0BA 6A3HA 5IHRA 4CN1A 2VI0A 3WL0A 1XH0A 1X6NA 4U3CA 2QV4A 3AHYA 3PZTA 3WNPA 4H7VA 3IANA 3ZSTA 5F7UA 2VQUA 3BAXA 3BAKA 3AHTA 4ZE4A 5JIWA 1IV8A 3PZQA 5DEZA 1MQQA 4PTWA 4UZSA 3MKKA 1XD1A 3SCSA 4FF5A 3WH9A 3NYDA 4AZ7A 1LG2A 2D20A 5GNXA 2D1ZA 4JIEA 1UD3A 4F9JA 2DIJA 5I79A 1UH3A 3ZO9A 1V3LA 2BY2A 3K8KA 3VX0A 2OSXA 1ESWA 4WF7A 2FHBA 2XGBA 3ARXA 1NH6A 4KH2A 4Z2LA 5C8BB 1BF2A 2W63A 1MW1A 1MFVA 1YHTA 1PX3A 1JZ5A 4AC1X 4B9YA 1H4PA 3O9NA 3W4RA 4MJ2A 3AS3A 5CPQA 1JDDA 1V3KA 3UERA 4CN6A 4CD7A 2XM1A 5D9PA 4PMVA 1JYXA 2J25A 1VF8A 3PZVA 2UY3A 3VMOA 1E55A 1CECA 4AY1A 5BWFA 4GO8A 1ZU8A 2XVNA 2VURA 1G94A 2WVVB 3N11A 2WKGA 4JCLA 1W3HA 3L4XA 1GQIA 3WMBA 4PCSA 1EHAA 2VX7A 2VR5A 3NJ3A 4WKFA 3T08A 1VRXA 3NCOA 1PAMA 1B3WA 3DYPA 3PN8A 2O9PA 2WVTA 4Z2KA 1QI2A 1UWIA 2FDMA 1VEPA 3SCTA 3RJYA 1UR0A 4AZGA 1XCWA 4A4AA 4UQDA 3KL5A 1BTCA 3BAIA 1XSKA 2V38A 1BYBA 5M5DA 1VJZA 4GI9A 1ZB5A 4AZCA 2XM2A 4AZ5A 1UD2A 4CD6A 4LQ1A 2YDRA 1DWJM 1BYAA 3ZM8A 4B15A 5TD4A 4W93A 1OGSA 2VRKA 2VUYA 4PMXA 4BZYA 3VDHA 1E9LA 5M03A 2ZUWA 3QHNA 1JNEA 3SCOA 1E3XA 2Q8XA 1JYNA 2XVKA 3EBVA 3I3DA 1ISZA 5AY7A 1XSIA 2D0GA 3ZIZA 1CGVA 4RE2A 1Q4NX 3IJ8A 4KWUA 1TFVA 4RE4A 1PBGA 3GXMA 4UZUA 2Z1KA 1CXFA 3GTNA 5JBFA 5A6BD 3WQ4A 4MNJA 3ZJ6A 1EOKA 3W29A 4NSBA 3WL1A 1U33A 2J4GA 4OBSA 3NIYA 4GI8A 1UKSA 3SUWA 4BF7A 4MAVA 2V3EA 5EFDA 4U5KA 3FHAA 1V03A 3W27A 4U33A 1ZJAA 1K9DA 4HA3A 3UETA 4CCEA 3PZGA 1V0MA 1VEOA 3OGSA 4WK9A 2FGZA 1PPIA 1G1YA 4H8HA 4JL1A 3WD1A 3DC0A 5A2BA 1GQKA 2V3DA 4UCFA 2GUYA 2ZUUA 3VD9A 3AZTA 3L4VA 1KCLA 1XH1A 2WSPA 3WQVA 3I3EA 1HJSA 1O6IA 4CD4A 3T2QA 2Y8KA 1FHDA 1YQ2A 2D2OA 4MAZA 3GBEA 3AHVA 5DMYA 2BY0A 3CUHA 1MW0A 2ZX6A 5ABEA 3AZSA 2WLZA 3MUIA 2CHNA 1K9TA 1RD6A 1GHSA 3T0DA 3OA5A 1OGBA 1KXVA 1J18A 4JAWA 4V2XA 4AZ6A 4CKQA 4F66A 2J7EA 3RO8A 1SFSA 1A47A 2W4XA 4J27A 1QHPA 5AYBA 3WD2A 1GVYA 1QI4A 3W25A 1BGAA 3B9AA 2UWFA 5A6KA 5AYIA 3POHA 2XIIA 3NDZA 5FOOA 1E0VA 1HKKA 2D22A 3WD4A 4H04A 3B9EA 3N13A 3GH5A 4LPCA 3MANA 4FMVA 4M8UA 3W37A 2ESCA 1UA3A 5FD0A 3GXFA 5E9AA 1PEZA 3CZLA 5FKYA 5GNZA 1V6WA 2VX4A 4W84A 3OG2A 1VB9A 1UKOA 3OLGA 1KWGA 1LWJA 4UR9A 2JIEA 3M46A 1WE5A 5I23A 5I0DA 4X0VA 1C8XA 3RPMA 1RP8A 2J77A 1CXIA 4QP0A 2YDSA 3OBAA 3W0KA 4KMQA 1RH9A 1W9UA 4BQ4A 4CGTA 3KE0A 1WNOA 4S3KA 4MDOA 1ITCA 2GJXA 4PEEA 5BRPA 1PX8A 4PSRA 2VVNA 3QOMA 1BVNP 1MQPA 2ZXDA 1W9PA 5EFFA 3CZGA 1B31A 4MB1A 4XZWA 4M80A 4GXPA 2Y5EA 4DWSB 3SCRA 4XB3A 1EO5A 2VOTA 3VDCA 1SYTA 5CSUA 3VIJA 4AYSA 3KEHA 5A69A 4Z2IA 2CBVA 4M1RA 4YN5A 2O9RA 1TVNA 2VX6A 3O6AA 2BNJA 5CLTA 4J3WA 2VT0A 1UKQA 3AXHA 2GFTA 4UNIA 4A3HA 2WK2A 2YBTA 3WFZA 4IPLA 1EH9A 4OUEA 4EE9A 3QHMA 3AS0A 5A1AA 1IT0A 2WB5A 2C7FA 3DYOA 2BY1A 4N0RA 3TTOA 1KXTA 4RE3A 5C70A 4PTVA 3W53A 2A3BA 3AMKA 5ABHA 1JDAA 2J7GA 3N1AA 5FCZA 1JXJA 1WZLA 4AEEA 2ZX5A 1B3YA 1QNRA 3ZJKA 2RGLA 4R27A 3OIHA 4XX6A 3B8SA 1H49A 3WDPP 3APGA 1CXLA 5LYRA 5ABGA 4WIWA 1B1YA 2J74A 4PUEA 4W8LA 3PZOA 1E5NA 1UWQA 2HISA 4CU6A 2VNCA 2X2YA 4PMZA 1G9HA 2DSVA 4D6GA 2XVPA 1UR8A 1XCXA 3BMVA 4W8AA 1CXHA 1BG4A 4HMCA 3WQ8A 1CXKA 1GW1A 1HKMA 1UG6A 1L8NA 3RMEA 4LYQA 1E72M 3VGDA 4PMOA 1EXPA 3AROA 2E8ZA 4YHEA 2XIBA 7TAAA 1R85A 3WD0A 3GDBA 1GOMA 1XYZA 1LLOA 1WPCA 1KBBA 7CGTA 1ZBKA 2HVMA 4QCEA 6TAAA 1TE1A 3K8LA 3THDA 3WIJA 3J7HA 2CERA 3WELA 4UQ9A 3VIHA 2WMFA 4HOZA 3ARZA 4L4OA 1W91A 1XRVA 1CNVA 2O92A 2WNWA 3VD3A 4MJ4A 3PHAA 5JBEA 2ZUMA 1MWOA 4UFJA 2ZX7A 3K4AA 3UR7A 3MUAA 2X0YA 5D9NA 4AXNA 3AISA 3PZIA 1RPKA 2VCAA 1HJQA 2YLAA 2J79A 1JAKA 4DUVA 4V28A 2F61A 1W1PA 3WDIA 1ODZA 2JEQA 1ODUA 5BXTA 1WAWA 1UWUA 5C71A 3AHZA 2V5DA 1GOIA 1W2VA 3WNOA 4PMDA 2UY4A 3AMDA 2G41A 3HU7A 3SCPA 1LJYA 1B2YA 1W9BM 3L2MA 5EBAA 1HL9A 4BS0A 5IFTA 5A95A 1NOUA 2YA0A 2DSKA 1GOQA 4P7NA 3WF1A 5D4YA 1V0LA 4KRTA 4ML4A 1WP6A 5E6ZA 4TTGA 2XSBA 3ARPA 3AICA 1H5VA 4ACYA 2QPUA 4HOWA 3VGEA 3N04A 4MNKA 2PB1A 2OYKA 2WZHA 2XWEA 5DO8A 2ZXAA 3MUZ1 1Q6CA 4F9DA 5HNNA 4M56A 4LGXA 3SUTA 1CGYA 3FAXA 2FHFA 5IXEA 4HA1A 3AMCA 3ALGA 1TA3A 3RDKA 2VVSA 1K9EA 2WC4A 2NSXA 3RILA 2WVVA 1S46A 2JALA 4J28A 3WQ5A 1E4MM 2ZICA 1LF1A 4QAWA 4OBRA 4PMNA 3S2CA 3CUGA 4MDPA 3PZUA 2WM0A 4JKLA 1J12A 2DT3A 1W9VA 4LYPA 1WDSA 2J7CA 4XV0A 4HU0A 3ZR5A 4PCTA 2A3EA 1UD4A 2EXOA 4OKDA 3VD5A 3CIVA 2NW0A 3WY1A 4E4PA 2FHCA 4HPGA 2G3NA 3GH7A 1OCQA 2Y2WA 1ISWA 3EDJA 1QVBA 2X8RA 2ZE0A 3CZEA 2FH6A 1EDTA 1J01A 2ZOXA 1OINA 2A3AA 1R86A 2WHLA 1U30A 3ZSSA 4YHGA 4CCCA 4A3YA 1H0IA 4IM4A 1J9YA 4W89A 3B9DA 1OGGA 1V0KA 3AMGA 1TR1A 2QMKA 3IAPA 4JL2A 2D3LA 4IPNB 5A6SA 3MMWA 3AXIA 1R87A 1D7FA 1J11A 1E15A 3K46A 3MU7A 3CMJA 2W61A 3TTYA 1JYWA 3AMLA 5D8WA 4ZXLA 4PTXA 3CUJA 3O2LA 3F5LA 1BQCA 1W3JA 3BMWA 3W6LA 4GINA 2YKKA 1MXGA 2EQDA 3A3HA 4AZHA 4UOQA 1SR0A 2EO7A 3AI0A 3ARTA 3WF0A 9CGTA 1B30A 2JE8A 3I3BA 1LWHA 2DSWA 1I1XA 1KGUA 1ZS2A 1ECEA 4PBGA 3WNLA 3PBGA 1V0NA 4S3JA 1QOXA 2AAAA 4DUWA 1G5AA 2G3JA 4U2YA 1JZ4A 1O7AA 1E6RA 1QW9A 2WCAA 3VMPA 3VU2A 1QI0A 3KZSA 3LPPA 4WSKA 4J3VA 1UA7A 1E6SM 2YBUA 1WDQA 3ALFA 1B3VA 1MW3A 2EPMX 2DSZA 4FLOA 1UUQA 1GQLA 1RP9A 1QPKA 2XFYA 4F79A 3IJ7A 1HN1A 2DH2A 1HKJA 1R8LA 1HX0A 3ZT5A 4MNMA 1ISYA 4W7UA 1W9DM 5CQ1A 4MB4A 3WFLA 2YJQA 2VQTA 4Y7EA 2PI6A 4GZIA 1UZ1A 3II1A 1E71M 1Y7VA 1CBGA 1QW8A 4NI3A 4GQRA 1KR1A 5A6BA 3ZR6A 4TX8A 3CUIA 1FHLA 2C0HA 1JDCA 2WKLA 4UTFA 1CGUA 2XTKA 1OD0A 1UQYA 5DT5A 4Z2HA 3MV11 4R5EA 2E9LA 3ZJ8A 2VCCA 4HP5A 1UKPA 1W3LA 3AIBA 3MSDA 2BHZA 2WW5A 1GCYA 3N12A 3TONA 3WBEA 3FAWA 3L4WA 4B16A 3ARVA 5I5RA 1MYRA 4FLRA 3OGRA 1A3HA 2CPUA 1DWFM 4ZFMA 2YOCA 2XVGA 3GXDA 2YL8A 4P8UA 4C7FA 4PTMA 4U3AA 1EDGA 3ZT7A 4CUCA 3TP4A 4OIFA 3WN6A 3LPOA 4GQQA 1EIBA 3CZ8A 1WKYA 1QI3A 3WSUA 3GM8A 4E8DA 3CGTA 1US3A 2GK1B 1N82A 1V3HA 1UR4A 4HMDA 1V02E 1FP8A 2CBUA 4AIUA 2GDVA 1UR1A 2EJ1A 1H0GA 4Z2GA 1UWTA 4UOJA 1BG9A 1ZJBA 3IAQA 4P7LA 6CGTA 2QF8A 4W7WA 2OSYA 2JIWA 3VM5A 2PWDA 4DWSD 5A8QA 1AQHA 4TTUA 4JFSA 1TVPA 1V6UA 3LMYA 3ZT6A 4D71A 3SCUA 3T09A 1UKTA 1KGXA 3CHCA 1KB3A 1TZ7A 3EDKA 1EOMA 4E8CA 4MB3A 5CZKA 3AIRA 1LG1A 1SMAA 3MMDA 4GZEA 2W91A 2VR4A 3WNMA 2CKRA 5DFAA 2E9BA 3GXIA 5E0CA 1J0YA 1HVXA 3ECQA 3VGGA 4EKJA 4B3LA 1QHOA 2JEPA 3W81A 2AOSA 1KR0A 4WKHA 4AW7A 8CGTA 4D6JA 2J7FA 1E5JA 4JFVA 2DH3A 5CPTA 1CLXA 2E4TA 1UYQA 2CNCA 3CPUA 3WDHA 1GQJA 4W85A 3L4TA 2BXYA 4P8VA 1F4AA 1BPLB 3KL3A 2WYSA 2XYLA 2W66A 4ACZB 1PZ2A 2OWXA 3WH7A 2OYMA 4AD0A 4HTYA 1JZ3A 5HOSA 1QBAA 1JG9A 2YIHA 2YA1A 1VAHA 3EYPA 3EDFA 3U57A 4WSJA 3S6TA 1BVZA 1QNOA 2ZX8A 2ZIDA 1LL6A 2DEPA 1QNQA 1E1FA 5FL1A 4MB5A 5HDRA 3N18A 2X09A 1GNXA 1HP5A 5A6JA 3UEQA 2X05A 1PJ9A 2WHKA 3CZJA 2VL4A 1XD0A 1E6ZA 3QGVA 1QI5A 1JZ6A 1NP0A 4AIOA 2OWCA 3HN3A 1XC6A 3BH4A 2DSUA 1W32A 1OT2A 1R7OA 2VZOA 3VTRA 4AISA 3AZRA 5I77A 2JFEX 1Q6GA 3U5YA 4BCEA 4GI6A 1NOWA 3VINA 3W24A 1C3FA 4L4PA 3TTQA 4TVDA 4B9ZA 1GUVA 1P6WA 1E6XM 3BLPX 1JF5A 4X0NA 2MANA 1EQCA 1AMYA 4QFUA 1HJUA 5CPSA 3LPFA 4N42A 1WCGA 2CEQA 2VZUA 2GSJA 1PZ3A 3WUBA 2PWFA 4AZIA 1VBRA 1V3MA 3FXYA 3THCA 4D6CA 3CMGA 4DWSC 3SUSA 3OLIA 3QHOA 4GZJA 4XUYA 3POCA 4Z2JA 4CCDA 3W28A 4CD8A 1WZKA 2J8FA 5A94A 4AD5A 5DF0A 1QNSA 1HIZA 1TG7A 1OIMA 2J78A 3VD4A 2DDXA 4PSPA 1HF6A 2GJXB 5E6YA 3F4VA 2CBJA 1GOKA 5HPOA 3ARYA 2WMIA 3UG5A 1IZKA 1UWSA 3WEZA 4MADA 2ZUTA 3AYRA 1BAGA 1UD5A 4JHOA 1CPUA 2PWEA 3LPGA 5JUVA 3BCDA 3WH8A 4AWEA 2BV9A 1VFFA 4K68A 1E4NA 5ECUA 4NRSA 2WHJA 1X1NA 2VX5A 3AHXA 2VCBA 3G6MA 1BYCA 1JD7A 1K9FA 1E70M 3GNOA 2XHYA 3WMCA 4HPHA 2W92A 1QBBA 3BSHA 4WLCA 4AIEA 1Q6DA 3RCNA 5A3HA 3HJEA 5IFPA 2D23A 2BHYA 3MS8A 4HZ8A 2OLHA 3SEPA 1PIGA 4URIA 4PMRA 4ZENA 3AXXA 2EBNA 2WCSA 2WMHA 1KXQA 2WMKA 5BCAA 1CTNA 1W3KA 3VD7A 4FLSA 4KGJA 1BSIA 3VIOA 4CD5A 2CHOA 3WMSA 1WO2A 3L4ZA 2OSWA 3OLEA 4D1JA 4HMEA 1WDRA 4AD2A 2DIEA 4PUDA 2NT0A 1CYGA 1AVAA 4JKKA 1CIUA 3WF3A 2O9OA 3UG4A 2YL5A 2XVLA 3WBAA 3BGAA 5BRQA 1C7TA 1V08A 5I24A 3SIMA 2UY2A 1KWKA 2WVUA 3AFBA 1CEOA 4P8WA 1OBAA 3K1DA 5AC5A 3GBDA 1GOWA 4KRUA 3IK2A 2GJPA 4ZEPA 2CXGA 2VZVA 1K6AA 4U5IA 2FH8A 3CHFA 4OOZA 5GPRA 3GNPA 2A3CA 1CZ1A 3BXWA 1GOOA 1M04A 1J0IA 4C7DA 3AIEA 3L4YA 2G4FA 4QDMA 2CETA 1JXKA 5AC4A 1XHGA 5BXSA 5E70A 4CN4A 4PMUA 2E8YA 2ZUVA 4JFWA 2YL6A 1B3ZA 1OD8A 3NDYA 4AEFA 5ABFB 1HNYA 1J10A 1E6NA 1JNDA 4PMQA 5BROA 4WJXA 4CU8A 4F8XA 1FH8A 2VZSA 3U7BA 4W86A 3DHPA 3A4AA 3NSNA 3BAJA 1V3JA 4EAMA 4UQCA 3ARRA 4Q7NA 2PC8A 1GONA 3W26A 3AIQA 4H41A 3M7SA 7A3HA 2DT0A 1JGIA 1JFXA 3ARQA 4RL3A 2ZWZA 4TX6A 5CLWA 2WBKA 2WZIA 4P7RA 3AS2A 3AOFA 2RGMA 3VMNA 1H09A 5CGMA 1J0JA 1KQZA 2GVYA 4TOQA 2WMGA 3OGVA 1CXEA 1D3CA 2G3IA 2O9TA 1W9XA 3AIUA 3L4UA 1XV8A 1Z32X 1H41A 5A8NA 2WLYA 3W6MA 3AIVA 3VDAA 3FNDA 1E3ZA 4X9YA 3N17A 5FIPA 4J3TA 3SUVA 3WDRA 1GORA 1R7AA 4U31A 1J0HA 3L2LA 3WUEA 3MUY1 4W8BA 3W38A 3WQWA 3VIMA 1JFHA 5KEZA 1LL4A 4J3UA 4M24A 2WC3A 3UCQA 1JZ2A 3D3AA 2Z1SA 1GJWA 4HZ7A 1ISVA 1F4HA 1NM9A 1VENA 5BXPA 1BGGA 4ZXOA 4UOZA 1SMDA 1QNPA 3OZOA 4WKAA 1CGWA 2IXVA 3VO0A 4UQEA 3FN9A 5M17A 3SURA 3ARWA 1UD8A 5JBDA 1XH2A 3VIIA 3AQUA 4AZBA 1KGWA 1DWGM 2C8NA 2D24A 3WH6A 2FGLA 1TA3B 4TVCA 1OWQA 2WVSA 3BSGA 2XGIA 3W82A 4AD4A 3A4XA 1Q6FA 1UD6A 3PTQA 3RIKA 3M07A 2WBGA 3VDBA 4V27A 3NUKA 4P8XA 2PF0A 4UFKA 3CTTA 3MO4A 1FFQA 3RM8A 3VUPA 1ZBWA 2D0HA 1TMQA 1W2PA 2IUZA 5I6SA 1NWTA 2Y4SA 1CLVA 3CUFA 1CENA 3GZAA 1EO7A 2GK1A 3GH4A 4HZ6A 4U2ZA 1MXDA 1EQPA 5A6MA 4D6FA 4D6EA 4W5UA 3F5KA 3ARUA 1CGTA 3VILA 3AIWA 4H2CA 1M01A 1HT6A 4J7RA 2PWHA 1CGXA 2DPEA 4QLJA 2EPLX 4E2OA 1JIBA 3VGFA 1V02A 1WDPA 2BFGA 3VIKA 1ZBCA 4IUGA 2QPSA 1B9ZA 3D5HA 4UFIA 1EA9C 5EMYA 4CU7A 4H8UA 3WH5A 3TA9A 2WPGA 2EPNA 3UG3A 2YA2A 4D6DA 1C90A 1KBKA 2ZUNA 4P7QA 3PZ9A 3WUGA 5BYWA 2V5CA 3PZNA 3VIFA 4TVUA 3DYMA 3OB8A 4JFUA 1E43A 5FL0A 4LX4A 1FA2A 4PMYA 3KL0A 3VIGA 5GNYA 1ZBVA 1EGZA 1DEDA 1HJWA 2BVYA 3CLWA 4DM2A 3MV01 4ATLA 1E56A 1BYDA 5IHSA 2VRJA 4DM1A 1C92A 4BQ2A 3WDJA 3NSXA 4UFHA 1ITXA 4Q22A 2WC7A 1JD9A 3VGBA 4EANA 1L0PA 1HJVA 3EDEA 3N15A 1FH7A 2D0FA 3K8MA 4ACZA 1G0CA 1I75A 1FOBA 4AZCB
chains in the Genus database with same CATH superfamily
3MI3A 4AY8A 4K6AA 2J7HA 5K4XA 2W9MA 2GOUA 3SUUA 1BWLA 1NQ6A 4HOXA 4GH3A 4IP4A 3GIYA 5GQBA 3S5ZA 3CAWA 4C7GA 3UJ2A 3M4HA 4RZ4A 5JQ9A 3ES8A 3DN5A 5AZ1A 2HROA 2YZ5A 3RM4A 1M7XA 3EPOA 3O0KA 1OJXA 2ZXBA 2R8WA 5I3DA 4TU1A 2YDQA 4L6HA 3WJYA 1VYRA 2DVUA 3WQEA 4UFLA 3R6IA 4GI4A 5KMYA 3H7RA 4MFEA 2Q3OA 4JGDA 2Y7GA 1T41A 2PLJA 2J9XA 1P43A 1A5OC 3A23A 1K7FA 1P1XA 2XUCA 4N2YA 4HYRA 4B5XA 3L65A 1S3TC 3QY8A 4H8VA 2BS9A 3FCPA 5M3WA 1J0ZA 5F2LA 4QCFA 5C6MA 2OT1A 1OC5A 4IMEA 2ZA1A 4D6IA 2E09A 3BLFA 4UNKA 1DHPA 1PDYA 3ZR4A 4G5DA 4UFMA 2J75A 4Z1AA 3UVIA 4DZAA 3O05A 4XTIA 4LT9A 4IQLA 4I6VA 1AD4A 1E9IA 2E40A 4MNLA 3WO8A 1WX0A 3PUOA 1V3IA 4JTDA 1XUZA 2X1IA 4LAZA 1CWYA 2J7BA 3EMZA 2GDQA 4LBRA 1Q7QA 3QTGA 1WZMA 1E6QM 2F7FA 2JQXA 1I0DA 3ISIX 1W3IA 3DX5A 3E2RA 5D8ZA 3MTWA 4O19A 3NGFA 4DELA 1LOSA 3IJ9A 3DFYA 3BAYA 1FP9A 1AW1A 1KCKA 2JF7A 2PWGA 1WKEA 4HA4A 2ZZ7A 2HBVA 1UH4A 2ZFAA 3KS6A 4D1IA 3GIQA 3OLDA 1C8QA 1OX5A 3BC9A 3NQ6A 2A85A 4V33A 4RV8A 4E4FA 3IACA 5CG7A 1W1B1 3WKZA 3H55A 4NF7A 3LHTA 3DUGA 2V3GA 3PM6A 3VPLA 2WWCA 1EBHA 4Q8UA 3VGHA 3ARSA 4Q6XA 1UOKA 2NLIA 1HKIA 3LTPA 3B8WA 4C1NA 1NWSA 1M03A 1OIFA 4EPKA 3RLVA 3PUDA 2XJ7A 3CH9A 2YYTA 5H8MA 5EB8A 4DPPA 3WF2A 4QRNA 1UR2A 1J5SA 4E5TA 3LTYA 4KEZA 3VOFA 5HNTA 4OFCA 2GJRA 4GKLA 1FWBC 4CNTA 1H1NA 1H11A 1AUSL 3PB0A 2X0HA 1GZJA 3ZJ7A 3EAUA 3ONBA 5A6LA 3MYPA 4XBSA 1N8WA 2BGQA 1UZ4A 4JTSA 4GO9A 2Y8VA 2G4JA 1CX9A 1GVIA 3GO2A 2V63A 3LERA 1OM0A 3TVAA 1XDLA 2YCKX 3SRKA 5TNVA 3CV1A 3RM9A 1F3WA 1MDLA 1W56A 1MNSA 1BLIA 1VFOA 1PSCA 3EKZA 4GHRA 3NWRA 4IISA 3REQB 3R7MA 2ISFA 4GPNA 3U7VA 4GE8A 3SN0A 1ADDA 1V77A 3K4DA 2CC0A 1DWAM 4I6KA 3K4WA 3CZKA 3WNNA 4GWEA 4UQAA 3VAVA 1TCMA 3EDDA 3HG4A 1GEQA 5C2CA 3W7EA 3CEUA 1AQMA 4ZQMA 1XIHA 1CDGA 3RUBL 2PP3A 1PYMA 3E6EA 3Q67A 3M0YA 3UJEA 3U2EA 1XISA 4JN6A 4DHGA 4QLLA 2R9RA 2V5KA 2DZXA 4FOJA 4B3KA 3UWEA 3L0NA 4MTVA 2BXVA 5E09A 1AQ0A 2DT2A 2AAMA 1TTPA 2BOGX 3ZYZA 5C7VA 2WZTA 1AFSA 1I2QA 3I7QA 1B0IA 3C52A 4ZODA 4JYFA 4XUGA 1IF2A 5IM51 3RR1A 5HXMA 4IFOA 1LQ0A 4PYSA 3DFPA 3QR3A 3L21A 3AAMA 1SU5A 2A3HA 3T0BA 6A3HA 3APYA 3I4EA 1KM6A 2VKZG 3H54A 1XH0A 3OIXA 4U3CA 1HO1A 1JJKA 4GX9A 4DBDA 3QEZA 3PZTA 3S1UA 2I9EA 5F7UA 1M1BA 5MHBA 1XP3A 3BGGA 3BAXA 1IEWA 3PZQA 5DEZA 4DJDA 5CZJA 4XTDA 1XD1A 4Z1CA 4IQJA 4JNYA 3WH9A 3VNIA 5AOUA 1I4NA 3U0HA 1O68A 3QW4B 2D1ZA 3S9YA 1UD3A 3TLQA 4M5PA 4HPXA 4BFAA 3MO7A 1GG0A 1UH3A 5EBUA 4Q4QA 3FDGA 3ZZ1A 5FF3A 4AHQA 1IXQA 2XGBA 3ARXA 1MMFA 3RU6A 3UWQA 4JTAA 2DZUA 3I65A 1BF2A 1MFVA 1PX3A 3I4KA 4J5NA 4I8DA 1XLLA 5C9ZA 1JDDA 4ZVJA 5FSEC 2J88A 1J4EA 2E28A 2J25A 1VF8A 3PPGA 2P5NA 1CECA 2B4GA 3N34A 1CI1A 2WVVB 1KTNA 4WR3A 3UP8A 3C2VA 3N11A 3WMBA 3BG9A 4PCSA 3MVTA 3NJ3A 1TIMA 4QNWA 4O13A 1PAMA 1B3WA 3PN8A 3TAOA 2WVTA 5LIWX 1UWIA 1WUFA 3SCTA 4GYKA 1OC6A 3RJYA 4A35A 1XCWA 2QEZA 3KBVA 4A4AA 4B5NA 3LQGA 2V38A 3FA3A 1BYBA 2PWUA 4GI9A 3BJSA 2X1SA 1F8IA 3EPMA 5JMUA 3CPRA 3VDHA 1VHCA 4UCGA 3QGKC 1JYNA 4B2DA 1J6OA 3EBVA 2NVAA 5AY7A 3UYCA 2BTMA 5G2WA 2DUAA 3V5OA 3ITVA 3K13A 1Q4NX 5I07A 1A53A 3ITXA 1TFVA 3V4BA 2Z1KA 3M0VA 4O4VA 3WQ4A 4WSHA 4IG2A 1U33A 4PBEA 2J4GA 1S1RA 4ZQOA 1XYAA 4K7YA 4BF7A 1TB3A 5EFDA 4U5KA 1QASA 4Q8OA 1TJ0A 1RLDA 4WOQA 2B81A 3W27A 3C61A 3S1XA 3WQGA 3EPNA 4O1AA 1PPIA 1G1YA 4JL1A 3WD1A 4DF0A 2J6XA 3DBPA 3NL2A 4FZIA 1LWIA 1KLYA 5I3JA 3I3EA 4GG9A 1TRIA 4KBXA 4S3DA 3TWAA 4CD4A 1YQ2A 3AJXA 1RY0A 3KP1A 3GKFA 4MYXA 2R1MA 4ICMA 3USZA 3O7UA 5ABEA 2WLZA 1O95A 3NQEA 5IBXC 1K1DA 3MUIA 3HV9A 1K9TA 1XLCA 1GHSA 2CZFA 4MF4A 4NI8A 3EB2A 1ADOA 4GIEA 4JAWA 4V2XA 1QO5A 1AL8A 1Q66A 5LIUX 4NAEB 4DO4A 3WD2A 1BGAA 3OVGA 3QQ1A 3POHA 4MSSA 1ML1A 3SQLA 4JBRA 1UB3A 3OVPA 2HXTA 3WD4A 2E25A 3N13A 4H9ZA 1O5KA 1F2JA 4MLJA 3BGJA 1UA3A 2VWTA 2GWGA 3N19B 5E9AA 3WYZA 1GT8A 1RJQA 3G5EA 2AQOA 1XBYA 3CMFA 3V1HA 5J8LA 1WE5A 2AKZA 1LRTA 4IP7A 1VS1A 1XLEA 1S2WA 3ZS4A 4K3ZA 4QP0A 1Y65A 5BRBA 2RDTA 4LS1A 4PEKA 1W9UA 2A5HA 2Q02A 2PZ0A 3I7RA 5BRPA 1PX8A 3ANUA 3QOMA 1I2NA 1W9PA 2FIQA 3CZGA 3M1ZA 4MB1A 2KAUC 2OPJA 4XZWA 1F3XA 1OY0A 3WLOA 4DWSB 4L61A 5C55A 3VIJA 3LBMA 4Z2IA 5A69A 3G0SA 3NG3A 2R1PA 1A4LA 2O9RA 4NILA 2VX6A 4X22A 3LBCA 4MWAA 5CLTA 2UV8G 1UKQA 3WFZA 1E9ZB 3TW7A 1TTJA 3PS7A 1EH9A 4G8TA 3NR0A 3QHMA 3M0XA 3AS0A 3S42A 2C7FA 1RBOB 3BPWA 3KTSA 4XVEA 3HPZA 2IPGA 3HF3A 2A3BA 2OGJA 4UTKA 2C16A 5ABHA 2J66A 4FR1A 1WZLA 1ZGDA 4FXJA 4AEEA 2ZX5A 1B3YA 3ZJKA 1Y5WA 3LM3A 1K77A 2P3ZA 3QQ0A 1O60A 3SI9A 3HB9A 3DAQA 2D2JA 2QNEA 4AVFA 5ABGA 4WIWA 5KITA 1JDFA 2NQJA 2NZLA 2J74A 3V7PA 1HQTA 4CU6A 2VNCA 2X2GA 2OJPA 3JU2A 4D6GA 2XVPA 1XCXA 1EPVA 1JDEA 1CXHA 1TPEA 1I8JA 1C29A 3MPGA 1KRAC 4PMOA 1ALDA 2PZNA 1PTDA 3AROA 5FJJA 3GDBA 1GOMA 5LHFA 2HVMA 1EJ7L 3RYSA 1XWYA 1TE1A 1ZRQA 3THDA 3WIJA 1S5TA 3J7HA 1H7RA 3F4WA 2UBPC 5FEZA 3TJ4A 2QXWA 1XRVA 1CNVA 2WNWA 4CQBA 3KBNA 1BF6A 1R3SA 1SSGA 4H19A 3LN3A 2VGGA 2V82A 4H6KA 2ZUMA 3RF9A 1MWOA 3TYZA 4UFJA 3P5YA 2Z7GA 1OZQA 4IWWA 1EJRC 2PGFA 2FTYA 4I7WA 4Q8WA 2Z2UA 3P14A 3AISA 2KZHA 1KO0A 2FB2A 4JIIX 1PYFA 3U2ZA 2ZYFA 1EF2A 3OJGA 3TW6A 4OTKA 2NXGA 4MJMA 5C71A 3B8DA 2J6VA 3H7UA 1GOIA 3AU6A 4K1GA 4JIPA 1W2VA 1QPNA 6REQB 2A2IA 3HU7A 3R79A 5FF0A 3KVLA 2INEA 3ABZA 1XJBA 2WJEA 5BU9A 5I3IA 2E6FA 4HSOA 1KM5A 3CASA 2YCJA 3RHGA 5C9RA 2CZDA 4RNJA 4TTGA 3KVMA 2VOMA 3TNOA 4L9XA 3D46A 1H5VA 4ACYA 2PGEA 1F8MA 1QU4A 2OYKA 4EWND 2DZTA 2PODA 1GG1A 2ZXAA 3T55A 4KCVA 4F9DA 4HMNA 3URQA 2Y70A 2J9ZA 3ZWSA 5CAKA 1X7IA 1Q6LA 1XYLA 1CGYA 3GVQA 3SUTA 4HA1A 2RKXA 2WC4A 3RILA 1S46A 3QLLA 1KA9F 2ZICA 4OBRA 1O1HA 1SZFA 1OYBA 1TUFA 3PZUA 1ZP3A 5CJMA 1YW1A 1TTQA 4FIRA 4O11A 3LENA 5HR7A 3TSDA 1DJQA 3T78A 1UD4A 4O12A 3WY1A 4E4PA 5G5IA 2QUUA 4HPGA 4O14A 3EGJA 3GH7A 1NU5A 1FWAC 2Y2WA 4TMBA 1XC4A 1YXDA 2X8RA 3V0UA 1FCUA 2A3AA 1U30A 3LHZA 4ADSA 4H4IA 3ZSSA 1TWIA 5HR6A 3H23A 4JYDA 2Z27A 4RW5A 4E38A 1OC7A 3NA8A 2Y88A 4GK8A 4M1BA 3H2CA 3GFXA 4IPNB 4UB9A 1EPXA 3KOWA 3AXIA 3K46A 4HHMA 5DY2A 1JYWA 4ZQCA 3RX3A 3DHDA 3N4FA 4CLMA 5LGZA 3C8NA 4TMCA 3O2LA 2WO5A 3LY0A 2PDJA 2R1KA 1W3JA 4RZ6A 2PRLA 3MBFA 4GINA 4KFPA 3IWPA 3AUJA 4UOQA 4WX2A 4CQ8A 4L64A 3ARTA 3UGVA 2PD5A 4AIBA 1LM1A 5IOBA 1TX0A 3I3BA 2NUXA 2R1NA 4MUZA 2C1GA 3PBGA 1V0NA 2AAAA 5BOOA 1E6RA 2FZMA 3VMPA 3NAVA 3KZSA 4J3VA 5HULA 1KM4A 2YBUA 3ALFA 1B3VA 1IR2A 9XIAA 2J24A 4F48A 4LANA 5LNVA 3IIVA 1GQLA 1WUEA 4F79A 1A4MA 2DH2A 1HKJA 5KZEA 4MNMA 3GAKA 5CQ1A 3ZXWA 1KM1A 4XZHA 4GZIA 1UZ1A 3II1A 3N4AA 4B3ZA 1OK4A 3GHSA 4IIDA 5A6BA 2PDMA 3K30A 2XTKA 3W2LA 3R8RA 2RFGA 4Z2HA 4L56A 5EKYA 1H63A 4DJEC 4YCOA 4H7CA 5CC6A 5LZLA 2VCCA 4HP5A 3QPEA 3AIBA 1XG3A 3T42A 4A3QA 2WW5A 1GCYA 2NX9A 1ENUA 3WBEA 3FAWA 2FPTA 4B16A 5DCEA 3T0CA 4MHBA 3KCOA 4ZFMA 3LX9A 4CQAA 1S2AA 2PU1A 4LUTA 5TQLA 4IJCA 4XSLA 5A6TC 1P0KA 1LQ2A 5FF2A 2AGTA 4IUOA 3CZ8A 4C6LA 1QI3A 3KW3A 3R58A 4AB4A 2E6YA 2QUTA 4E8DA 1US3A 3V3WA 2HDJA 1K03A 4OECA 3P61A 3W7MA 3L0KA 1XICA 3EWBX 4GUHA 5HJYA 3TA6A 1P7TA 1SQ7A 3KLKA 1ZJBA 1C9DA 1A0CA 3GR8A 2J9YA 1PKNA 3GU2A 2JIWA 3OU8A 5A8QA 1W5PA 2OKTA 1GVEA 1M65A 3GVRA 4ZOCA 3SCUA 1XW8A 1UKTA 1EOMA 1DOSA 1HUVA 1K8ZA 1YE6A 2ICSA 4PMJA 1LOQA 3QBUA 5F4XA 2ZZ6A 3EXRA 4WJ8A 2CKRA 5DFAA 1JCLA 1F3TA 1O12A 3FGCB 4KESA 1K3UA 1SZRA 1SM9A 3EOEA 3LRLA 4LU0A 1UPMB 2IKGA 3GDRA 8CGTA 3S1VA 3KOZA 3S3GA 2NLYA 4JFVA 4F2BA 1MUMA 2GQAA 5G2HA 5D02A 3CPUA 3TSBA 4JQ4A 2WNNA 4W85A 3L4TA 2CLOA 3KLLA 4PC8A 4Q32A 1PZ2A 4RX0A 5D03A 4JNMA 4WQ6A 2OYMA 3F7JA 4MLRA 1JZ3A 5HOSA 1QBAA 1Q7ZA 3W2MA 1K7EA 2YA1A 1VAHA 2GUUA 3RO6A 2DW6A 2XIQA 1XRSA 4YS1A 3IVTA 1LRQA 4NZFA 4Y8EA 3N18A 2NQ5A 2VP8A 1V51A 3UEQA 1ELSA 3G18A 3M41A 4ROQA 3ZLGA 4NHVA 2R6OA 4QDPA 2P50A 3VFCA 1W1IE 2OZ0A 1MNZA 1XIDA 2FDSA 3GTHA 4C6KA 4JOMA 2OWCA 3REQA 3VTRA 4AISA 2JFEX 1NOWA 2QVHA 5KSWA 4GISA 3C0LA 4XZ9A 3ZFHA 2R82A 1C3FA 4N9EA 3TTQA 4TVDA 1H7NA 1P6WA 1E6XM 3M0MA 1TV5A 3OTRA 2MANA 1M68A 4G7EA 3QZ6A 1XRFA 4DX3A 1GEHA 3DH7A 1BRLB 3FA4A 3FS2A 2HV5A 4RDWA 1ECQA 3LK6A 1BKHA 1I0BA 2OODA 1HGWA 3SN4A 1SGJA 2PLKA 3THCA 2NXIA 3U2CA 4D6CA 3B3DA 1K4GA 3EWXA 3OLIA 3M0ZA 1XLKA 3EB3A 3UGRA 5HQLA 4Z2JA 4CCDA 1ONEA 1WZKA 4LAOA 5A94A 4Q8QA 1NTHA 5DF0A 2ZC1A 1RZMA 3C0QA 1OIMA 3TN5A 1TQXA 2DDXA 4HSHA 3Q94A 4JDBA 4LC6A 3UR5A 1AH3A 3TCSA 3WEZA 1A5CA 2PDKA 3F1QA 4JHOA 1CPUA 4FHAA 1XLBA 3WH8A 4AWEA 3NGJA 5C5YA 3UXLA 1VFFA 4O8RA 4FX6M 4HZMA 2WHJA 2VX5A 3AHXA 1JD7A 1K9FA 3GVGA 1E70M 5E1QA 1O5XA 2XHYA 3WMCA 3N2TA 4AIEA 1FCVA 4R88A 2GQ3A 3UY8A 4C90A 3ICJA 4WY0B 1IXPA 2TYSA 1H60A 4HZ8A 4C6QA 2OLHA 1GZGA 3SEPA 1J2BA 3O6YX 4AMAA 1OYAA 2EPHA 4U10A 1W3KA 3PSWA 3Q2DA 4KGJA 1G4SA 4CD5A 2CHOA 2OSWA 2C71A 3CQIA 4LNCA 1LT7A 4D1JA 4C6DA 3DHFA 3L67A 1CYGA 3LHVA 1XCFA 3HTWA 2XVLA 5BRQA 1N55A 1FXQA 1KRMA 2VDGA 5G4EA 3SIMA 3UCDA 3N3TA 2UY2A 1KWKA 5MKGB 3AFBA 4R7WA 3K1DA 4AUBA 4HBKA 1SJCA 2Z6JA 3S2JA 3IK2A 2VXNA 5XIAA 5K2ZA 1VPYA 1RXOB 2Y61A 1XDJA 2JGYA 1POJA 1M04A 1ONRA 1J0IA 4C65A 1SVDA 4H01A 5BXSA 4CN4A 1UMYA 2YL6A 1OD8A 1JNDA 1E6NA 4DYKA 2HSAA 3IGXA 4RPQA 1I6NA 4F8XA 2VZSA 3U7BA 4W86A 5HMEA 1Z3NA 4PODA 2CWNA 3BAJA 1V3JA 4F0MA 4EAMA 1XG4A 4X2RA 2ZA2A 3BURA 4RNHA 4IIHA 3NL6A 1DJIA 3KHDA 1KW1A 1LLWA 2POZA 4JTCA 7A3HA 2JKPA 3TE9A 1TMLA 4A29A 2Z28A 1JFXA 3SY1A 4QG8A 1KLZA 3N6HA 4TX6A 2WBKA 4HQVA 5E5CA 5AHFA 5K4ZA 3VMNA 1H09A 2GVYA 1D3CA 2G3IA 4RDYA 3W7RA 3MVIA 1L9WA 3LMZA 4XZLX 3W7HA 1H41A 1NY1A 1XKYA 3JRKA 4O53A 4F0LA 3SY8A 4Q4KA 3VDAA 3FNDA 1QWKA 3N17A 5FIPA 3ATYA 4S38A 3RPTA 4LTSA 3SUVA 3RX2A 3EWYA 3R11A 3DENA 4R7OA 3L2LA 1YXCA 4K37A 1TZZA 4I9MA 1GZ1A 3GG1A 4CEXC 3GHTA 4F2UA 1JFHA 1W5OA 4M24A 5TBOA 1JZ2A 3IIOA 4PTNA 2V5JA 1GJWA 4DI8A 1B9BA 1C8VA 4I8YA 1BGGA 1KM0A 5BNKA 3OZOA 4H9TA 4WKAA 3OYZA 4YVVA 1TWZA 2H3BA 3VE9A 3AQUA 2D24A 3DI0A 3Q58A 3UU0A 2VEMA 1S5WA 3BSGA 1H51A 4AD4A 3MKVA 3PTQA 3RIKA 3MWCA 1RUSA 4P8XA 2PF0A 4UFKA 4GABA 3CTTA 2PTXA 1W2PA 1YNQA 3AC0A 2Y4SA 1CLVA 2G37A 1LZOA 3CUFA 2PTWA 1R2TA 3DERA 1M3UA 4DZ5A 5HK4A 3W83A 1MUWA 3PSVA 3V75A 3ZVHB 2VGFA 3ARUA 1CGTA 2CHRA 3EEZA 2ZZ2A 1HTIA 4E2VA 1HT6A 2PWHA 1CGXA 4QITA 4QLJA 4E2OA 3I6TA 1V02A 2VYOA 1NDYA 3ORWA 2BFGA 3EA3A 3LYEA 2V5LA 3SR7A 3FVMA 4H1ZA 3EX4A 4UFIA 1R9XA 4QSFA 1EA9C 5EMYA 4GXMA 3KZPA 1UCWA 4H8UA 3MCMA 1ZNNA 3TA9A 4XD3A 2H9AB 8XIMA 3MBDA 4K36A 3C3NA 4B2DD 3GC4A 1C90A 3GFYA 2HNHA 3HZ3A 1YNPA 3UNDA 3WUGA 2V5CA 1K8YA 1X96A 3VIFA 2PSNA 4DO6A 1FA2A 3TZNA 3E38A 3VIGA 1ZBVA 4WGHA 1EGZA 4WVXA 1DEDA 4IJBA 1NF0A 1LLZA 3E0VA 1G6CA 2YGYA 1P0BA 2PDNA 3BQ5A 3ELFA 4IQEA 3DFOA 3FYYA 5C2XA 4DM1A 3LLXA 1F6PA 1C92A 3NSXA 4A22A 1ITXA 2QAPA 2WC7A 3TC6A 2VDHA 3R4IA 1JD9A 2BBFA 4EANA 1L0PA 1LUCA 4OGZA 5CBIA 3W76A 1FH7A 3K8MA 4S39A 1IT8A 1F73A 4MIMA 2QDGA 3G8EA 4GC4A 4NX5A 4YTTA 5BMWA 3SW6A 4JFTA 4DWSA 2QDEA 2EEXA 4AY7A 2Y24A 1XLFA 1MW2A 3F2CA 1P0NA 3VOGA 4LAMA 1YNYA 2B31A 4OZOA 1EC9A 4NAFA 3PFMA 3OZPA 2PGRA 1VJIA 4MPKA 3NO1A 2OXNA 1FHUA 4FX7A 1FWHC 4LH8A 4I3GA 4LFYA 1GPFA 2CCRA 2F2HA 4W5ZA 1E4IA 3EX3A 3VKKA 4LCSA 1DJNA 1KV8A 2EG6A 3WEOA 4B5WA 1NARA 2IXUA 4XZIA 4M6VA 2GJLA 4GFSA 1T96A 4GYFA 4L65A 2BVTA 3M47A 1FKWA 4XK2A 5KZ6A 5A8GA 3BWWA 3FY1A 4BQ3A 4XIMA 3NZGA 4GRSA 4IPJA 1JZ8A 4JHZA 3CHDA 3VM7A 3F2DA 4HNOA 3A12A 4W88A 4JYEA 2QUMA 3TR2A 3SFKA 1B5TA 1FWJC 2QLYA 1O5QA 2UY5A 5F4SA 4B5SA 1AJZA 3UW6A 1A3XA 3C56A 2J62A 1NOFA 1E73M 4XD4A 2XPKA 1IGSA 1ZQ5A 2J7DA 1UR3M 3BG3A 2V67A 2HS6A 3ZQ9A 3KBJA 8XIAA 4UXDA 2TAAA 3Q4DA 3WJXA 4X60A 3VZZA 1LORA 1KQYA 3R1ZA 4IPIA 4XZBA 1G01A 2OX4A 4YVXA 4LXFA 1OHLA 2OEJA 1DP0A 2BXZA 4CVWA 2CKSA 3VKJA 3IVSA 2A21A 4MWAD 1TYGA 3UJFA 1Q65A 1W31A 3T2OA 2PBGA 3TOPA 1C91A 3NOEA 4AF0A 1G69A 1MFUA 4HU8A 3TK7A 3CO4A 4ASTA 1QWGA 4I5RA 3LI0A 5G2IA 2HE8A 4BQ5A 4A2RA 3HPSA 4ZQNA 3N9RA 3B04A 3RNDA 4FLQA 4GNKB 4Q33A 3R13A 1XIFA 2XN1A 3IPWA 1PIFA 3WJSA 4GBDA 4RCXA 2QUNA 1D2KA 3T2PA 3GNRA 4M7SA 3IRDA 1Z41A 2ONEA 1W37A 1JUKA 4IXXA 4HN8A 2GZXA 4W87A 1A5NC 1OZMA 4O0KA 3SCWA 2DT1A 3TQVA 4I90A 3VI2A 2VENA 5C54A 5AZ0A 1HVQA 3O6DA 4A3RA 2DP3A 1OVDA 1DQXA 3T0AA 2W62A 4LYRA 1HXJA 3VNZA 1LYXA 3PTMA 3N2BA 1DWIM 5HPCA 1LL7A 4JKMA 1KKRA 4KW2A 3A4WA 4HNUA 5A8OA 1AMKA 3P3BA 5ABFA 3RK8A 1DWHM 3ABXA 3L7RA 5BXRA 5LKYA 1PKLA 5U7SA 3HPXA 3N6JA 4QR6A 2QPXA 3W75A 4J3XA 4A2SA 4AEOA 2E6DA 3TJXA 2P10A 1PKYA 1ZL1A 3SCQA 1AODA 4FNTA 4FS9A 1B3XA 1UZHA 4RPPA 3W1RA 2FFCA 2OQYA 1BXBA 4M6QA 1SFJA 2FZ8A 3BLKA 2Z25A 4MUPA 2XSAA 2PE4A 3R0KA 1OFAA 1UR9A 4BI5A 4PN2A 4D6HA 4XAGA 4KIRA 1E40A 3R12A 3BW4A 4AD3A 4L6OA 4JZ5A 3HJZA 3GG0A 4M81A 2F8QA 3S8HA 1XS2A 5LA0A 4GIAA 1WZAA 3UG8A 1KFBA 5I2UA 3MW7A 2J47A 2WHMA 2BLEA 3A47A 2B7PA 4NASA 2ZRUA 1SFLA 4GJ1A 3RJXA 1U22A 2XZ7A 3WDQA 2XGZA 3VOJA 4UQBA 1IWAA 3TROA 1H3GA 4O17A 3HURA 4M6UA 5XINA 4ZGYA 1UWRA 3SCVA 5CZSA 4S3EA 2VJXA 2E0PA 2P53A 3SCNA 5I03A 2ZWYA 5CXPA 4AAJA 2WXDM 4ZCWA 3LNMA 4UTWA 1AL7A 5IHRA 3B0YA 2IKIA 3AU2A 1X6NA 2QV4A 4B5TA 4DO7A 3EA2A 1ZY9A 4K8HA 1DIDA 2OGYA 2V6AA 2Z0IA 3AHTA 1IEQA 3KTCA 5JIWA 4NYYA 1FQ0A 4RE0A 4PTWA 3LCWA 3SCSA 1GQNA 5HQMA 1P0EA 2IPFA 1U1UA 5TF0A 4AZ7A 1LG2A 2POTA 3BZJA 4DY1A 2D20A 3O3RA 2BP1A 4AFYA 4HNTA 4H00A 3ZO9A 4W4QA 1KFKA 2BY2A 3K8KA 3VX0A 3QSRA 2FHBA 1W3NA 3S47A 3TUUA 2FVLA 1NH6A 3P0XA 4Z2LA 4S3CA 3IJ6A 2W63A 2QCMA 1J93A 2PWVA 1YHTA 7REQA 1JZ5A 2C1HA 4AC1X 4O0ZA 3CO8A 3TJLA 3W4RA 2Y0FA 3AS3A 5CPQA 1SZNA 1Q6OA 3UERA 2AQVA 3E3HA 4XZNX 3UZYA 4CD7A 3S1GA 3BK0A 2HEJA 1W54A 3B0PA 1E55A 7XIMA 2XVNA 3B9NA 3GDKA 1G94A 4MKSA 3W1PA 4RLIA 4ZSUA 4HU4A 4NNCA 3T6CA 4WKFA 2P76A 3T08A 1XYMA 3R94A 2IQTA 2FMOA 3IGUA 5EMLA 4Z2KA 1QI2A 4J4KA 4AZGA 3UT0A 1FWGC 1OX4B 3KL5A 5HA7A 3QY7A 4DBUA 2QCGA 2YBVA 3BAIA 5DCDA 4Z0SA 2E5CA 5CGQA 1ZB5A 3AALA 4J35A 4AZCA 1UD2A 2BGSA 3NDOA 1JRBA 2YDRA 2GGGA 4B15A 3BLEA 1J5TA 4W93A 1OGSA 1XIMA 4PMXA 1KBLA 4LSBA 4BZYA 5M03A 1JNEA 2YR1A 1E3XA 2Q8XA 3V0TA 1ZCCA 3I3DA 4D8LA 1PE1A 3ZIZA 4RE2A 1HFBA 4UNLA 3GXMA 3CIWA 1CXFA 3GTNA 4ZFCA 3NQFA 5A6BD 2XZ9A 3FGCA 3ZJ6A 4NSBA 4RR4A 4AWSA 1RBAA 3QZAA 4HYWA 1EWEA 3NM1A 3UA4A 4GI8A 1UKSA 1HW6A 4GKTA 4MAVA 1Y5VA 5K3VA 2V3EA 1CB7B 1MI3A 4U33A 1GW9A 3P5ZA 2A1YA 2YCLA 1FWRA 3S5OA 3OGSA 1YMYA 4XBJA 1E1CB 2V3DA 2ZUUA 3VD9A 1IZCA 3L4VA 1KCLA 4ZTYA 2XN0A 2I5IA 3ZLFA 1FHDA 1PCWA 3AHVA 2BY0A 3N2MA 3GHUA 3LU2A 2ZX6A 3VKAA 3EXSA 3TJIA 1S5MA 3BVJA 2CHNA 4A8RA 1RD6A 1IYXA 5HINA 2REQB 1ZENA 1B4KA 5FA5A 3TV8A 2FQIA 1OCJA 5J5RA 1FWSA 3FEQA 2ZZ5A 2D2HA 4F66A 3URAA 5HANA 3ZVIA 1A47A 4YYFA 1QHPA 3I7SA 5AYBA 1GVYA 1OF8A 4G9PA 1EL3A 1IIHA 2UWFA 4WGXA 5AYIA 3TYAA 3G77A 3IUHA 2XIIA 2NV9A 1HKKA 1XBXA 3B9EA 2I14A 3GH5A 1IEIA 3A3XA 4FMVA 3W37A 1JULA 1R46A 4L4LA 4GY1A 1TX2A 5FD0A 5GNZA 5FKYA 2VX4A 2VFHA 5EL1A 3OG2A 1GOXA 4DAIA 5EPDA 5G4WA 1UKOA 3B8TA 3B8VA 3OLGA 4PUKA 1FHVA 4XO7A 5LNUA 1LWJA 2E6AA 4M6PA 5I0DA 3TOYA 1C8XA 3I10A 5LGXA 1RP8A 3FV9A 4L4MA 1CXIA 3KWSA 4QM1A 4MY9A 3OBAA 4GGHA 3O0FA 3SQSA 3TIMA 2F6KA 1WNOA 3OO2A 4S3KA 2VVNA 5HAOA 1BVNP 2WKJA 1RBLA 3D0CA 1V8EA 3TYEA 1B31A 5CZTA 1EP1A 4M51A 1A0EA 4GXPA 2Y5EA 1MDRA 3N25A 1A5MC 3SCRA 3VDCA 4FXSA 4GJJA 2NX1A 3KEHA 2CBVA 4BJHA 5H91A 5EY5A 1P4CA 1TKKA 1TVNA 3WLKX 4BF9A 3UZWA 3IRSA 4J3WA 4G7FA 1JRCA 1J79A 2VT0A 3W6YA 2Y7FA 2WK2A 2YBTA 4JIQA 1EX5A 4OUEA 1JEZA 4EE9A 1IT0A 1EYEA 2WB5A 4LAKA 1OG6A 3DYOA 4A6GA 5F1VA 5C70A 3AMKA 1FKXA 3N1AA 4C6OA 5FCZA 2A7NA 5DX7A 3PC0A 1JXJA 1EFZA 1N2VA 2Z7KA 3C2RA 4QQUA 2RGLA 3O06A 3GKAA 3WDPP 1XRTA 1R3VA 1R3YA 5LYRA 3UWUA 1DBTA 1B1YA 1R5YA 4PUEA 5LNSA 3FVDA 2VC5A 3A5VA 2HISA 2FJKA 1P6CA 2X2YA 4PMZA 1G9HA 3BMVA 2F84A 2HVOA 2YDAA 3PANA 1DJXA 1EGMA 1L8NA 4LYQA 2H3DA 3VGDA 5PTDA 1O4UA 4P2VA 1R85A 3WD0A 1GVSA 3MA8A 4FNRA 3W73A 2YCIX 3CIXA 1ZBKA 2QCHA 3K8LA 1IXNA 4MKVA 3C0JA 3LEPA 5LSMA 3HO8A 2CERA 3L2IA 3G2GA 2DVXA 3VIHA 2WMFA 4JQ3A 2F6XA 1D8CA 4L4OA 4QBXA 1W91A 2O92A 3KXQA 3FSTA 4MJ4A 3PHAA 5JBEA 4DJFC 2VD8A 4KERA 3YPIA 3CL8A 2VFFA 4PZVA 3T7VA 3STFA 4AXNA 4D9PA 2A79A 3PZIA 3LZ3A 1HJQA 2YLAA 2F38A 3LDVA 4Q8MA 4YVPA 3W22A 4V28A 1TV7A 2ZRVA 1KCXA 3FFSA 1ODZA 2VFEA 4LVBA 2JEQA 1WAWA 2BVWA 1UWUA 4H8NA 1ZZMA 3UCCA 5FEPA 3WNOA 3BJFA 3VNMA 3AMDA 5AYYA 4JTGA 2ZTJA 3WG6A 5EBAA 4I7VA 1HL9A 6PTDA 5CZ0A 3CQHA 1NOUA 2Q09A 2DSKA 2VFGA 2HTMA 4C5ZA 1GOQA 3HG3A 3SFWA 3OQEA 4DLFA 1V0LA 1SSDA 4KRTA 1GKRA 1WP6A 3QV6A 5EMJA 2XSBA 2VUNA 3ARPA 3AICA 1IGWA 2WV8A 3GNDA 1QAPA 4HOWA 4JTHA 4GZ7A 4O1EA 2WZHA 3MUZ1 1XLJA 2NV1A 4YWIA 4OV4A 5U4NA 2XINA 1I2RA 3VXGA 3MDWA 4HHHA 3AMCA 2CLLA 3RDKA 4LEQA 3PB2A 1J2WA 3C3UA 1SO6A 1P48A 4PMNA 1L6SA 4XAPA 3CUGA 4A05A 5CPLA 2WM0A 4Y96A 3E02A 2PDCA 3C2FA 3ITTA 2DT3A 1P1MA 1KFJA 5EMMA 2QCEA 3M6YA 3H2EA 4K39A 2HBXA 2EXOA 4OKDA 3VD5A 3QR0A 3ITOA 2OZTA 2NW0A 4PA8A 2R91A 2FHCA 3ZVHA 1T7LA 4UUIA 1OCQA 4ERIA 4QROA 2ZE0A 2FH6A 2A6LA 2WM1A 3DI1A 3NO3A 1J01A 2WHLA 3LRMA 4IM4A 3BV4A 1OGGA 4FO4A 3AMGA 3IAPA 3S0CA 1UC5A 3H4WA 3GZ3A 3TX9A 3SY5A 4AX7A 2DIKA 4EVZA 3MMWA 2O7QA 1FWTA 3MU7A 3CMJA 3EOSA 2VWSA 4ZXLA 5IBXA 4PTXA 1RSCA 5LHEA 1W3TA 3FKRA 3MZNA 3PJTA 3E0LA 5LIYX 3PTDA 4A21A 3QR1A 1XIJA 1MXGA 4AZHA 4EAYA 1XBZA 4MOZA 3WF0A 3MP3A 2HRWA 3IUIA 4S3FA 1I1XA 1KGUA 1ECEA 3VNLA 1IE7C 1H7XA 2PLMA 4U2YA 1O7AA 4G6CA 2PDPA 3VU2A 1WOBA 3LPPA 4WSKA 3TN4A 2X0SA 1E6SM 2QULA 2Y7EA 1RLCL 4IXHA 1PZ0A 4FLOA 1UUQA 2CZVA 2E5DA 2DZBA 4JTLA 2XFYA 5FJOA 4IIFA 4S23A 1MUCA 4I5XA 4TIMA 3ZT5A 1LQAA 1W9DM 4IQDA 4MB4A 3H2MA 3VYLA 1VFHA 4Y7EA 4HHLA 3CEPA 1JQVA 4LY4A 1QW8A 4GQRA 4QEHA 4US6A 1I2PA 1JDCA 2WKLA 4UTFA 3ANYA 1CGUA 1OD0A 3CYVA 5DT5A 4R5EA 2E9LA 3ZJ8A 5CH9A 1XX1A 3AO0A 1UKPA 6TIMA 2QDHA 1W3LA 3MSDA 1E51A 1UBPC 1WXZA 2HS8A 3FEMA 3BANA 3N12A 4GVFA 3CHVA 3L4WA 3PWGA 1TPDA 4FLRA 2JK2A 1A3HA 2CPUA 1DWFM 2XVGA 4L9YA 4IX2A 4C7FA 2EF9A 4B4FA 5MF5A 3B97A 3ZT7A 1GPWA 1REQB 4OIFA 1A5LC 1ITUA 3D47A 6ENLA 1L6FA 3G1FA 1N82A 4X63A 1V3HA 1UR4A 3GTIA 4HMDA 3N6QA 4AIUA 3KRUA 3AXKA 1F9CA 4O52A 4RZ5A 1UWTA 3W87A 4AHOA 3CNYA 1OFPA 1QMLA 3W2UA 5GJPA 3KRZA 4P7LA 1RK6A 4US5A 3G22A 2PWDA 4DWSD 4EWJA 1YTKA 4JFSA 3LMYA 2JKEA 3S2MA 2FJUB 4D71A 1G4PA 5REQB 2BGNE 5B80A 3G0UA 5CZKA 5D32A 4H9XA 3USBA 3MMDA 4GZEA 2W91A 3WNMA 4IFKA 1US0A 2I56A 1EUAA 2DZVA 2E9BA 3GXIA 3GHRA 3PBUA 4FALA 4QE4A 3VOHA 2Z29A 3UXAA 4NKCA 3C2YA 4B3LA 3SRFA 2O0TA 3OG3A 1NEYA 4KF1A 4O28A 4AW7A 4J3ZA 4UR8A 4D6JA 2J7FA 2OG9A 3L5AA 1E5JA 4HNLA 1CLXA 1TWSA 1UYQA 3WDHA 1GQJA 1KCZA 2BXYA 3PG9A 1BPLB 2PAJA 1WV2A 9XIMA 1TIWA 4ACZB 4QIUA 3OW1A 3WH7A 4HA0A 3STEA 6XIMA 4KPLA 1KM2A 1L8PA 3EYPA 3SGUA 1Z6KA 4WSJA 1NAL1 5DBTA 3TC7A 4GX8A 3GS6A 2OO6A 4Y90A 4JTRA 1BVZA 1QNOA 1YPFA 2ZIDA 2ZX8A 1QNQA 1X1ZA 5FL1A 5HDRA 1RR2A 1F5ZA 2X09A 1SJDA 1HP5A 3P7YA 1PJ9A 3DFTA 2VL4A 1XD0A 1E6ZA 3QGVA 4GCAA 1QI5A 2FVMA 3QQWA 1JZ6A 5H8PA 4PUNA 3T1GA 4AIOA 2INZA 4ZR8A 3HN3A 1M7JA 1SO4A 2QT3A 2GJNA 5I77A 1TJ2A 3ABOA 3UWZA 2PTZA 4GI6A 4BCEA 1IIGA 3QV9A 2GSHA 3W24A 4L9ZA 3ME3A 3LCFA 1IWPA 1UP3A 3LZ5A 4GJIA 1H7PA 2ABAA 4KWOA 1W6TA 5DRIA 1A80A 4QFUA 3GG7A 3NPXA 4C6JA 4N42A 1WCGA 1ZPTA 2VZUA 4LUSA 4OHQA 3T4CA 4F2TA 2PWFA 2GVGA 3T05A 3LSCA 2QZRA 4AZIA 1V3MA 3FXYA 1IEVA 1UJQA 3UY7A 3CMGA 4IMAA 4XUYA 1V5XA 3HM7A 3IJDA 2NQ9A 5KZMA 3WX7A 4CD8A 2AL2B 4Q7IA 2J8FA 1S5VA 3GNXA 4YL2A 3W01A 1QNSA 5CAHA 1TG7A 5I7GA 4KCTA 1AK5A 4O18A 1HF6A 4EPDC 1GVQA 2CBJA 3W02A 3WBWA 3UG5A 3FX4A 5KTLA 5K9DA 4JY8A 3AUOA 1UWSA 4MADA 3CT7A 2ZUTA 3AYRA 3T44A 3VZXA 4WY0F 2PWEA 3LPGA 5JUVA 5AYXA 3N2CA 3BCDA 3H2OA 1N7KA 4K68A 3ITGA 1E4NA 5J04A 4NRSA 3G1XA 4JTEA 4NJIA 3G6MA 1BYCA 3EB4A 4NIRA 3F4NA 5DQPA 2ANUA 1QBBA 4WD0A 3VKDA 1DIOA 3EKLA 3EWDA 5T8GA 1GKQA 5A3HA 1RV8A 3PBWA 1M7PA 4ZB0A 3H21A 1NFBA 2V69A 3NO5A 1PIGA 4PMRA 4ZENA 2WMHA 4O57A 1CTNA 3LHYA 3VC6A 4C60A 3WMSA 1WO2A 3OLEA 4JXCA 4B5VA 3QFWA 4ONVA 1WDRA 4JHMA 4GMEA 4AD2A 1EEXA 2NVCA 5L9FA 1BQGA 1U1HA 4GUGA 2NT0A 1AVAA 3WF3A 1CIUA 5FJUA 1OCNA 3UG4A 3VNDA 3TW9A 3BGAA 1C7TA 4Q6JA 2ZRXA 1CEOA 1GOWA 4KRUA 1QR7A 2DJLA 4ZEPA 2CXGA 4U5IA 1K6AA 3W00A 1FWFC 3LLDA 4OOZA 2X7VA 5DBUA 3WQPA 5AVHA 2W27A 3DG3A 3TMQA 1QPRA 1U1JA 2G3FA 3AIEA 2BWGA 4CNOA 4QDMA 2HJPA 3IIPA 4GQ0A 4O1CA 5AC4A 1XHGA 1TRDA 2GQ8A 5E70A 1OCBA 4GUFA 5AC7A 1PL9A 1HKWA 1B3ZA 3NDYA 2VEGA 4PMQA 3S5YA 2QGYA 4GIRA 4CU8A 1FH8A 1T0OA 5HWJA 1KFLA 1DJHA 3PULA 3NSNA 2QJNA 2PU0A 3RLHA 1LBLA 4ROPA 1XDMA 4UQCA 1KNWA 2ZDRA 3V1PA 4DJEA 1ZTVA 3LG3A 1GTHA 1GVFA 4H41A 5CSRA 3M7SA 1LOLA 1FBAA 1W17A 4JTIA 4BEUA 4DN1A 2ABBA 5CGMA 1KQZA 2E68A 1R3RA 3OHIA 4EIVA 2WMGA 4JN7A 3AIUA 4ERGA 1XV8A 3KBMA 3NQVA 2XH2A 5A8NA 2WLYA 3W6MA 1S38A 4GACA 3M43A 2YB1A 5D09A 1LROA 2EG7A 5K7JA 2HMCA 3C8FA 4U31A 3HFTA 4W8BA 3LV5A 1OABA 1XUUA 4C6NA 4PE8A 3Q65A 2GGIA 2R94A 3WK2A 1EJVC 4J3UA 2WC3A 4DBEA 3C0SA 3BCJA 3UXKA 3LI1A 1KFCA 2ZQ0A 2Y85A 1VENA 3RITA 2OCZA 4M19A 1QNPA 2PS2A 2PP1A 1P0DA 2PRHA 1TPFA 1ZAJA 4TQTA 4REQA 3DXIA 1KGWA 1RQHA 1DWGM 3WH6A 1OWQA 2V5BA 3W82A 3BDKA 2Q3RA 1BWKA 3M07A 4WHBA 3QXBA 4H6RA 3NUKA 4IT1A 3U48A 3BG5A 1QFEA 2Y89A 4IL0A 1TMQA 2IUZA 5I6SA 3Q45A 1NWTA 1QDSA 2WQDA 3N2OA 3MSRA 1CENA 1MEIA 1EO7A 2GK1A 3CAVA 4GNJA 3GH4A 4LCRA 4HZ6A 1OEPA 3NQ7A 4AYGA 1MXDA 1EQPA 4NZ5A 4GCXA 4D6EA 3A22A 4HTBA 1UW9A 3VILA 3AIWA 1I2OA 2DPEA 3LHWA 5H1WA 4LVGA 2REQA 1EA0A 2Q71A 1ZBCA 4LUIA 4IUGA 3GX9A 3K2GA 1BEUA 4U28A 5HNRA 1EF3A 2QPSA 1R3WA 1W1A1 2IKHA 4Q4MA 1G7VA 4JTUA 4AG0A 2ZRZA 2AMXA 5G4HC 3NXFA 4CU7A 3G8RA 1H61A 2FKPA 5FJRA 3WH5A 2EPNA 1KBKA 3GSMA 2ZUNA 1WDDA 4IX0A 5BYWA 4LEFA 1TPH1 1GVRA 3W2JA 3PZNA 5AYZA 5D04C 4F0SA 1XFBA 4MJZA 4JY9A 4DUOA 5GNYA 2IKJA 1HJWA 5CC7A 4DM2A 4QNEA 4NJKA 3IGHX 1BYDA 5E0KA 2GWNA 4QE5A 1UASA 4MKNA 3ITYA 4WXYA 1M7OA 4B5UA 7TIMA 2HPIA 3U4AA 2ZDSA 4FI4A 2BODX 1XGEA 3G1AA 1EJUC 3DFHA 1UWAA 3N15A 2GGHA 1FOBA 1VKFA 4KGLA 3IJLA 1OG0A 5CSYA 2OYLA 4DXXA 4HD5A 5LNWA 4CVUA 4ILSA 3ES7A 5M2FX 3LB0A 4FPSA 1JPIA 2AGKA 1V7AA 5BW6A 5LA2A 4OOUA 2Z1XA 1BVWA 3OEXA 4S2CA 5F2GA 1GK8A 1SPQA 2W67A 4Z0JA 3DOPA 1PZ1A 1E1EA 1T40A 1VFLA 2XFFA 5E0FA 4JEJA 2NX3A 2CIPA 4OJYA 2GDUA 5D30A 4JTJA 4R85A 2R1LA 3C86A 3A3WA 1V4YA 2CLPA 1M6JA 4PRWA 3TMLA 1V79A 2V9DA 4HN4A 2NQHA 2XIJA 2FTWA 2OLAA 3DGRA 4BWLA 3OPSA 3A9IA 5LIXX 2E9MA 4ZQPA 3E2SA 3CBWA 2WNQA 5AHLA 4FOUA 1HL8A 1WQ5A 2DGAA 4HB7A 4NG3A 3CK5A 3DHUA 4FK9A 1Q63A 4N6FA 4EK7A 3DC8A 2TMDA 2XFRA 4DUXA 2PDFA 3G24A 4M29A 1TJ1A 3T9PA 4PRRA 3DFQA 5CG0A 2Q6ZA 4IMCA 3LCHA 5LA1A 1QHZA 2CZ5A 1YIXA 5IDIA 3KOXA 3AXMA 3GDLA 3UR8A 1FXPA 2OFJA 3D6NA 2WCGA 2QUVA 3W70A 3MY9A 1DTUA 4QLKA 3GD6A 3MKCA 4O15A 3CL6A 1PUDA 2XISA 3OP2A 1PIIA 4RXFA 1JI1A 3E1F1 1VFMA 2CITA 3FHQA 3HG2A 1NWRA 3GC2A 3BZGA 3GVWA 3TC3A 1I1WA 5A2AA 1EDQA 3WF4A 3B03A 1WBHA 1OT1A 2EPOA 2NQZA 5AECA 3W86A 5F1UA 1FWNA 1H2JA 1C93A 3BAWA 2G97A 3NEHA 3H4GA 2ASHA 3GYCA 4Q8NA 2J13A 3KOFA 2CLHA 4TXEA 5LXXA 1CT5A 4P7OA 3AJ7A 3PJXA 2XG9A 2ZUSA 3QYSA 5D9MA 4WUIA 1U5JA 1XXXA 1TJRA 2DQXA 2ZXQA 5DANA 3PTKA 1E0XA 1GGOA 2NWRA 3FJ4A 3KRBA 1O5RA 1T5AA 2MUCA 2G96A 3KBSA 3VCCA 4FOKA 1E6PA 3DIPA 4N7QA 1JI2A 4G1NA 3PAOA 2E3ZA 4N6EA 5CGTA 4PBFA 3LUTA 3RFAA 3AYVA 4Y9NA 2DZWA 2J8GA 1PX4A 1KXHA 3CXOA 1V6XA 1TPC1 3KDNA 3WD3A 2ZTKA 4J3SA 3RLUA 1Y5XA 2BY3A 3LA4A 1GHRA 3MI2A 3P8JA 5A8MA 4KWVA 1UROA 3JUGA 4EPEC 2WZEA 1CCWB 3WQCA 3W71A 1AH0A 2EAWA 2CFFA 2WAGA 1BFNA 3A6OA 1ZAIA 4D72A 1W1VA 2I57A 4W7VA 1M5WA 1XFCA 2Z00A 3PR2A 1UMLA 3W7LA 3G3MA 4C1KA 2HVNA 1M53A 3G1DA 4BI6A 1DHKA 3MMTA 1RA5A 3QKZA 4H83A 1EHNA 1YDOA 4O10A 1MQRA 1Q6RA 2HQAA 1I60A 2G3MA 1V7YA 4B91A 2X1TA 5A6AA 4EF9A 2Y62A 4ZE5A 4JTTA 5J5DA 1XYFA 1KKOA 3GXPA 4R33A 4EOUA 1EXBA 4XQ6A 5IDZA 2VTFA 4R53A 3CLMA 3WLNA 2FB3A 3CT2A 4HGXA 2CYGA 3BO9A 1KFWA 1TUXA 4FSAA 2GLKA 5T91A 1H62A 4L1GA 5XIMA 3CB8A 1A5AA 1QJWA 5A2CA 3HMCA 1QPOA 3B8IA 3VIPA 2BHUA 3HQPA 3GU9A 1PCKA 1S2VA 2A0NA 4FNSA 4BY3A 3S5SA 3EEGA 4BA0A 5I3KA 4A8NA 4C91A 1UQZA 3PUGA 3NSMA 2CESA 4GD0A 1WYIA 3CH0A 5BU6A 1XGZA 3AS1A 4NZCA 5ENLA 1E4LA 1JPKA 4M3PA 3A64A 3F5JA 2CWXA 3VOCA 1TV3A 1ISXA 4KT2A 4RK8A 2G50A 3W84A 1IXOA 2YCEA 3ABRA 2YXOA 4B92A 3HQOA 4PFHA 4UTIA 2XIOA 1S2TA 1TPUA 2BSLA 3FIGA 1YKWA 4X3ZA 1EC7A 3V36A 3WK0A 4CN1A 1TZ9A 4J9JA 4I5UA 1NDVA 3RCYA 3VKCA 3ABQA 1X7FA 3TKFA 2P8BA 4GUIA 4S1FA 2XH0A 2VQUA 1DL3A 3SN1A 1IV8A 3EWUA 2OOFA 3ITCA 4UZSA 3PBYA 4FF5A 1H1ZA 1O1ZA 3NFUA 4OUIA 2QYGA 2CW6A 5CKSA 3PPFA 4RNIA 2GUBA 3E2VA 4PCNA 2PC4A 4ZO7A 4F9JA 2ISSA 3T8LA 5I79A 4NL1A 4J2PA 4CEUC 1MZHA 3UFYA 3KP0A 5DRCA 1V3LA 2IQDA 2OSXA 3S9ZA 1YTEA 2GVEA 5DMNA 2W79A 3TXZA 1MW1A 2DZAA 4B9YA 2HNEA 4MJ2A 1RCQA 1YADA 1WOAA 4CN6A 4JTKA 2XM1A 4DF1A 3NL3A 1EBGA 1QCWA 5BOEA 2UY3A 4C1LA 5FJTA 4AY1A 1VP5A 3M0KA 1HGYA 2FZDA 2XH7A 4GO8A 5C9XA 1ZU8A 3HIJA 3MT1A 2V2DA 2WKGA 3UZ5A 1GQIA 1EHAA 3LSBA 2VR5A 5I06A 4NZ4A 1VRXA 2QW5A 3G3DA 1K7XA 3DYPA 4I9AA 4IHCA 3B40A 2O9PA 4RUBA 3O8AA 4JTQA 2FDMA 1VEPA 4EACA 2ACRA 3GVVA 2YXGA 1EEPA 4UQDA 1WXJA 4HNCA 1Q8JA 4QGCA 3S6OA 1YLVA 2CLKA 1XSKA 2ZBTA 5M5DA 1VJZA 1FDYA 2PP0A 4AZ5A 4ADTA 4CD6A 4LQ1A 1FCBA 4NVTA 1W8GA 4RJEA 4KEUA 5M1TA 2VUYA 3MJMA 1HKVA 1FCQA 1E9LA 4JICA 4WJEA 3W1XA 5C2GA 3QHNA 1F61A 3PVFA 2TRSA 2D69A 1AW2A 1CGVA 4JQAA 5I3FA 5LNRA 4H3DA 4KWUA 4RE4A 1PBGA 3MI6A 5D2WA 3K1GA 4MNJA 3WL1A 2GL5A 2DFAA 4LJ3A 2XDFA 3KCLA 3PG8A 3QPZA 2XSXA 3NTYA 3NIYA 5JH2A 5EYWA 4AQLA 4S2BA 1J8VA 4LYKA 4YTSA 1WAUA 3FHAA 4PRTA 4DXVA 1ZJAA 1K9DA 4HA3A 3UETA 3PZGA 1V0MA 1S3HA 3IIZA 4H8HA 3NQCA 3DC0A 3MP5A 5A2BA 1GQKA 2L5HA 4UCFA 3AZTA 1K8CA 2DZPA 3WLMA 3U9IA 2WSPA 4E6MA 3U2OA 1Z7AA 1AW5A 4NNAA 4MYAA 3ZLHA 2DJXA 2BB0A 3T2QA 3VCNA 3L0GA 1X6UA 3GBEA 1YBQB 3CWNA 1MW0A 3AZSA 1XYBA 1CLKA 3GQYA 3C4UA 3CWOX 1WA3A 3GXNA 4IMGA 3WFAA 3UJSA 3NPWA 1OGBA 5HWNA 1KXVA 1J18A 2A7PA 2J7EA 4J27A 4DYEA 3W25A 1QI4A 1PB0A 3B9AA 5FF4A 1JPDX 4US5D 4FNPA 3SIZA 5A6KA 1A0DA 3NDZA 5FOOA 4BHYA 2D22A 1N8IA 4HK5A 5HJLA 5FEXA 4KFOA 5GJNA 3MANA 2V81A 2ESCA 1OFRA 4KS0A 4DO5A 1PEZA 4WCJA 4WDXA 3UF9A 3F03K 3GYEA 2F2KA 4PB5A 1NSJA 1VB9A 2X1RA 3KVKA 3S46A 1TQJA 4UR9A 4LUTB 4AVOA 3WLLA 2JIEA 3M46A 2C91A 4NY2A 5I23A 2FZBA 3DDMA 3TZFA 1KTBA 2J77A 1DXFA 1GYNA 1TV4A 2QJMA 5A5WA 2AL2A 4NZ3A 4KMQA 1RH9A 4K2SA 4BQ4A 5FACA 2NXHA 1BTMA 3DBNA 3W72A 1ITCA 4PEEA 1NDWA 4JQ2A 1PWLA 4F3HA 2ZXDA 5B7YA 5EFFA 1DJWA 4CQ9A 2A7RA 1P7TB 3HQ1A 4M80A 3WK3A 4UC5A 3UPMA 4QE1A 4XB3A 1EO5A 1VGAA 2VOTA 5CSUA 3R8GA 1DORA 1F74A 4YN5A 5AHMA 2BNJA 1VRDA 3MB9A 3AXHA 4UNIA 4Y9OA 4A3HA 4C6IA 1MO0A 3KAOA 3DKJA 1RK5A 5A1AA 2PF8A 3BUVA 3EX2A 1W5MA 2BY1A 2OR2A 4N0RA 4KRZA 3TTOA 1RCXB 1XL9A 5CJNA 2X16A 3B0XA 3TQ0A 2W3ZA 5CC3A 3GC5A 5CPNA 3WBXA 4OBTA 3QRHA 1R3QA 1QNRA 4CCZA 4MG4A 3G1YA 4R27A 2PUZA 3OIHA 3BLDA 1W5NA 3SSZA 4LS2A 2IPWA 4XX6A 5BZAA 3B8SA 1H49A 3APGA 3E9AA 1CXLA 1VBJA 2C3ZA 3JS3A 1E5NA 4Z08A 2O56A 1NJJA 4W8AA 5JXQA 2FZ9A 4HMCA 3WQ8A 4R7JA 1HKMA 2HE5A 4HNVA 7PTDA 1K02A 3RMEA 1E72M 1EXPA 2E8ZA 4YHEA 2XIBA 7TAAA 2WSRA 1XYZA 1WPCA 3EWZA 4H2HA 4EP8C 4A8LA 2YW3A 3WLHA 6TAAA 1JCJA 2IS7A 2QIWA 3WELA 2C19A 3BICA 4HOZA 1D8WA 3ARZA 4BWLC 3NXLA 1Q13A 3VD3A 2O55A 3EOUA 4LRSA 2PDGA 1VFTA 5K9XA 5DXXA 1SJBA 1TO3A 4PB4A 3LM7A 3K4AA 4MM1A 3RN6A 4DEFA 3MUAA 3DEQA 2X0YA 4UR7A 1Z42A 4G7EB 3STGA 3HQNA 1JAKA 4KWSA 2PDIA 2F61A 1W1PA 1Q8AA 3W7QA 2ATMA 3W7IA 2NWSA 3CAQA 5BXTA 3DESA 3AHZA 3WLIA 4PMDA 2UY4A 2O4QA 3CB3A 1RA0A 1LJYA 1MXSA 1B2YA 1JGMA 3L2MA 3RRAA 2OB3A 3EZ4A 2P1FA 3EX1A 3K5XA 5AN7A 4P7NA 3KUMA 3WF1A 3OOQA 4GY0A 5D4YA 4LNYA 3QV7A 2IQ0A 4MZ1A 5E6ZA 2V2HA 4L5ZA 2QPUA 1XM3A 3O63A 4MNKA 4G2DA 3RGTA 2XWEA 3BJTA 4NJGA 3MWAA 4AU0A 1WKFA 2BOEX 1DE6A 1Q6CA 5HNNA 1UBSA 1NF7A 2VHLA 3HMJG 1R38A 1JR1A 1M9HA 3FAXA 3O16A 2FHFA 5IXEA 5E9XA 1B3OA 4GFIA 3ALGA 3KHJA 2VVSA 2NVDA 1YDYA 2NSXA 2WVVA 4J28A 3SGGA 1E4MM 1LF1A 3JZEA 4QAWA 4R3UA 3W1UA 3GW0A 3S2CA 1Z69A 4PUJA 3IGSA 2Z4GA 5HJXA 3WLQA 3GE7A 4LYPA 4DJED 4HU0A 3ZR5A 2A3EA 4XKYB 3CIVA 3Q37A 5BOFA 3N9SA 3F4DA 3GWQA 3VOIA 3OBKA 1EZ2A 2ZVRA 1QVBA 2YFOA 3CZEA 4ES4A 2ZOXA 1R86A 3TQPA 3DG6A 2NSOA 3B06A 4YHGA 4A3YA 1H0IA 1J9YA 4W89A 1V0KA 1TR1A 2X42A 2ZKMX <