2CYGA

Crystal structure at 1.45- resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESGWPSAGGGAEASTSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQKAGGIEQNFGLFYPNKQPVYQISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-1, 3-glucananse
publication title Crystal structure at 1.45-A resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
pubmed doi rcsb
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cygA00
5CZKA 3UETA 2X0HA 3CZ8A 3RMEA 2WMIA 2Y8VA 2VX5A 3ARVA 3PN8A 1PZ2A 5A69A 4YHGA 1KCKA 4M8UA 1HN1A 2WB5A 4GKLA 4PMQA 1ZS2A 1O6IA 3AIWA 1E6ZA 1FA2A 3WNKA 4P8UA 1R87A 5LA2A 3VDCA 3SUUA 2NT0A 3ZR6A 3SCVA 2WZHA 4LYQA 4ZENA 3T0BA 4C7GA 3VINA 3NYDA 4AZHA 1SMAA 2VRJA 3OLIA 3VVGA 3BAXA 5CXPA 2XVPA 1GVYA 5M5DA 1RP8A 3RM8A 3PTKA 3VGDA 1MYRA 2YA1A 1LJYA 5FKYA 1MQPA 4ZE4A 1KBKA 3AI0A 3BH4A 2GDUA 1KXHA 3AS3A 2ZXDA 2JE8A 2J7GA 1CGVA 1UKQA 3VIKA 3ZJ7A 4AEEA 2DSZA 3AICA 4HMEA 2ZE0A 3T2OA 5M17A 1KCLA 1A3HA 1RPKA 2VVSA 2YLAA 3HMCA 1QNSA 1QPKA 2QPUA 2VQUA 2Z1KA 2BY0A 2IXVA 3WL1A 1OSEA 4PCSA 4CKQA 2NT1A 2W92A 1PX3A 1B1YA 4TXEA 3ARRA 1Q4NX 2V5CA 1LG1A 1M7XA 3UG4A 4Z2IA 1B3YA 1CZ1A 2BHZA 2BVDA 2WVVA 3GXIA 4TVDA 1EGZA 1LL4A 2FH8A 3B9DA 1BF2A 1U33A 2E8ZA 2O9PA 3IANA 1K6AA 3S2CA 3WKZA 2IXUA 4HA3A 2JEQA 1R7OA 3MUIA 4W7WA 1QNRA 4DWSB 4NI3A 3A6OA 1B3ZA 2VUYA 2CYGA 1QNQA 2VO5A 4Z2JA 2VRQA 3ZT7A 5HOSA 3CZKA 1W9UA 3SUVA 4BZYA 1W9XA 3SCPA 1UHVA 1HX0A 2D23A 3VDBA 1H0IA 3UR8A 1ITXA 5CGTA 1UR2A 3W4RA 3W37A 1H49A 3E1F1 3KEHA 3L2MA 1UR1A 4EE9A 3OG2A 4PUEA 2YL6A 4XUYA 2FH6A 2CNCA 1J10A 1JAKA 1CLXA 3KE0A 1PIFA 4U3AA 3VDHA 5JIPA 2DIEA 1E6RA 4K68A 1EDQA 1E9LA 1E3XA 2CXGA 3SCSA 3CBWA 3CUGA 1VEOA 3OLEA 5GNYA 5I79A 3WELA 2ZUWA 1JYWA 3SCRA 1OGBA 2WC7A 2PWEA 3NJ3A 2ZUNA 1E15A 2OYMA 4AZCB 1JXKA 1W9BM 4EKJA 4CCDA 3AS0A 3MU7A 1JDDA 4PUDA 4PCTA 2E40A 1VRXA 1UWTA 4TUFA 1RP9A 3KL5A 3MUZ1 1QHOA 2GVYA 1BPLB 1EHNA 2OYLA 3T09A 1WDSA 3POHA 2XVLA 4AD0A 2XWDA 1J01A 3CMJA 3VIPA 1R86A 1J0HA 4AEFA 1BTCA 3U7VA 1DEDA 1BLIA 2WMHA 1LL7A 2QHAA 3N17A 1QBBA 4J3XA 2WCSA 2YL5A 3VNZA 1EQCA 3WY1A 4OBSA 1KQZA 1M04A 1UD3A 3CUJA 1KXVA 4HPHA 4JHZA 3ALFA 4BS0A 5A2BA 1VAHA 2W62A 5HBFA 2BNJA 4MJ2A 1E6QM 2VZUA 2V5DA 3ARTA 4BCEA 1UH4A 5LYRA 4ZFMA 3W6LA 1JD7A 5LA1A 1MFUA 4MNJA 3WF1A 5BXSA 2WMFA 3WDJA 2DGAA 1VJZA 3MV11 1UD2A 4AC1X 1GZJA 2CBUA 3PZ9A 3AS1A 3VIFA 1WZMA 1JZ7A 2O9OA 4PMOA 4CU8A 3VOCA 3TTOA 2WHMA 3RILA 4HA1A 1JAEA 7A3HA 1E1EA 1UYQA 4PMVA 1UH3A 1M03A 1XYZA 4UQ9A 5EFDA 2CHNA 1QW9A 4JKLA 3AXIA 4MAZA 1BG9A 1G0CA 5A8QA 4W85A 3A4WA 3VMOA 3AHZA 3ZM8A 3TP4A 1WDRA 4U5IA 2BV9A 4D72A 3ARYA 1R7AA 4HU0A 3ARXA 1H4PA 5CG0A 1C93A 5C71A 1E70M 2VL4A 2VZSA 3SCWA 3NDZA 3OBAA 2J77A 4WK9A 3AISA 4MDOA 2CBJA 8A3HA 1D2KA 1KGXA 4DWSD 2YOCA 2VR4A 4D6FA 5CGMA 3WNPA 1Y7VA 2GUYA 3BLKA 4AYSA 4WIWA 4MB3A 3VD5A 5M03A 4AIUA 1L8NA 2FHCA 2E9BA 5A94A 3FAWA 3LPOA 4UQCA 4ACZB 1GJWA 1D3CA 2BXYA 2WMIB 3ECQA 2WK2A 2Q8XA 3W6MA 1G01A 2YA2A 3B9EA 4D6EA 1E73M 4QCFA 3WIJA 7TAAA 4A3HA 2J25A 4JHOA 4GI6A 4AZ5A 5E0FA 3NCOA 1FH7A 2CHOA 3MSDA 3OIHA 3KL3A 3U57A 1OGGA 5BROA 5A8MA 1J0ZA 4CVUA 1HP5A 1EIBA 2CITA 5CPTA 3BMVA 5A8NA 1FFRA 3AMCA 4ATDA 1KQYA 5ABHA 3NSMA 1UR8A 1M53A 2EQDA 2Y24A 2WC3A 3WQ4A 3WQ6A 4P8WA 3UR7A 1Q6CA 1BGAA 3EDEA 1E1FA 1MQRA 3WQWA 1Z32X 3VDAA 1OT1A 2E0PA 4OJYA 2ZX5A 1ESWA 1UZ1A 3VGBA 1H11A 2FGLA 2GJXA 4H04A 3CZLA 3WNLA 3VIOA 1UA7A 2WVSA 2WBKA 1HJVA 4IM4A 4QCEA 1HVXA 1UA3A 1GHSA 2VOTA 1JDAA 3VILA 4W89A 2X09A 2VTFA 3ZQ9A 3KWXA 4PTWA 1TVPA 1GPFA 1FH8A 2O9RA 3W28A 1Q6DA 3AROA 2F8QA 3GBEA 1W9DM 4TX6A 1UKSA 1J0YA 3VPLA 2X05A 3BAIA 2AAAA 4E4PA 2DT0A 3GYCA 4GI8A 1GOMA 4KGLA 3ZT5A 2EBNA 2YJQA 3WF0A 1HKMA 4HOZA 3VGHA 1GOOA 4X9YA 2WVVB 1W3KA 3N9KA 4FLQA 3GXMA 5GPRA 3L2LA 3QGVA 3VM7A 4QP0A 1WZAA 3CLWA 3TTQA 2YIHA 4J3SA 1HP4A 4M81A 3FNDA 3D5HA 3F5LA 3SCQA 3VU2A 1CTNA 2DH2A 2XHYA 1UZ4A 2J75A 1G94A 4L4PA 3ARQA 1XCXA 2YKKA 4UCFA 1LG2A 2D22A 3AIRA 3EBVA 4CU6A 1E40A 3VTRA 3AXXA 5CPQA 3WEZA 4AZGA 1WP6A 3BC9A 2NSXA 1HXJA 3OGVA 3WD0A 1SFSA 4LXFA 4UOQA 5DT7A 1CWYA 1K9EA 2QPSA 4DUWA 2PI6A 1X6NA 1FH9A 2VT0A 4HZ8A 4HZ7A 1C90A 1U30A 3WD4A 4KRTA 5D9MA 2WHJA 4MB4A 3WH6A 4KMQA 5A2AA 1EDTA 1MW0A 3SUSA 2A3HA 3N12A 4S3KA 1X6LA 4H8HA 1Q6EA 3F5KA 1S46A 1GOQA 2VC9A 2VZOA 1CGUA 4W5ZA 3FAXA 3GXFA 4KH2A 3DYPA 5CLTA 3WEOA 4F9JA 4F66A 4JIEA 5I3DA 3JUGA 4BQ2A 4LYPA 2RGLA 1G5AA 2YL8A 2WHLA 4P7RA 3VGEA 2VNCA 2WAGA 4P8XA 2WC4A 1BYAA 2BY3A 3AMKA 1QI5A 5FCZA 1VIWA 4J3VA 3MKKA 3EMZA 1J11A 4QLLA 3K8KA 3RJYA 1V3MA 1BQCA 3T2QA 1VFOA 4JFVA 5IFPA 1AMYA 5KZ6A 1P6WA 2J7HA 3WN6A 1HNYA 2WSPA 2VZTA 3ZO9A 3VD9A 2AMGA 4AZ7A 4WLCA 2XWEA 3SCOA 1HKKA 5FL1A 1B9ZA 5FL0A 4DUXA 4GZEA 4W7VA 3THCA 1KB3A 4M80A 2WLYA 3K4DA 1NOWA 2VRKA 1ODUA 1D7FA 2ZOXA 1C7SA 1LWHA 2GJPA 5BWFA 5DO8A 4A4AA 3PZNA 3VMPA 4HU8A 1OGSA 1YQ2A 1EA9C 4W86A 3VMNA 2G8ZA 3WUFA 2BHUA 1TA3A 2A3AA 3K4AA 3N04A 2D0FA 1UQYA 3T2PA 2CBVA 4X0VA 3EMQA 5D9OA 1EO5A 1JYXA 4U2YA 2EPOA 3M7SA 3LPFA 2DT3A 4FLRA 1C8XA 3O6AA 1VFUA 4B16A 2D0GA 3AIUA 4H8UA 3CTTA 1CXLA 1TUXA 4UQAA 5AC5A 3L4TA 5A1AA 3AMGA 3W27A 5D9PA 4MTVA 3ARPA 3M07A 1UH2A 4TVUA 3ZMRA 5A6BA 1WZKA 4URIA 5HPOA 1ISYA 5JBDA 3WDPP 1EXPA 4PSRA 3CHEA 2XVGA 3TTYA 3DC0A 4LQ1A 2DEPA 4MDPA 3EDJA 1JZ3A 2W91A 1NOUA 3IK2A 4M29A 4D6DA 4H41A 3ARZA 4ML4A 5IHSA 5E6ZA 4IISA 5EFFA 1UWUA 4HZ6A 3O2LA 3WFLA 4J28A 4B9YA 3WBEA 1E56A 4FLSA 3WD3A 1NARA 1GORA 4PBGA 5ABEA 2VQTA 2F61A 3W26A 3W82A 3LMYA 2C7FA 3OA5A 5GNZA 2W67A 3AHTA 3RCNA 4GZJA 4XV0A 4D6JA 3WQ5A 1XH0A 2C8NA 2WYSA 3WL0A 2DQXA 1H1NA 3FHQA 3DECA 4CGTA 4ATLA 1K9DA 5E0CA 1CXHA 5D4YA 3WDQA 4AIEA 5BXTA 1JF5A 2W63A 4JFWA 4MNMA 4AD3A 5DF0A 1GQLA 2YLLA 4X0NA 1J18A 5BXPA 3BMWA 3EDFA 4UTFA 2GK1B 4UZUA 4MJ4A 4UFHA 1V0MA 1JNDA 1QI0A 1JL8A 5E6YA 4C7FA 1PJ9A 3CZEA 2YA0A 2ZX7A 1XD0A 1JZ8A 2WZIA 1KBBA 5GNXA 4ZXOA 4UZSA 5A95A 4WKFA 7CGTA 3BAJA 3GDBA 1DWIM 5EB8A 3KL0A 3SCTA 3RM4A 5BRQA 3QOMA 4DM1A 4D71A 2CKSA 4P7LA 4RE3A 3MMUA 3NDYA 6A3HA 5IXEA 2J74A 1HJSA 4UOJA 3VIGA 1GVIA 3T0DA 1ISVA 1ISXA 4IUGA 1C8YA 5DMYA 5AYBA 1UR9A 3WH8A 2W4XA 3WMCA 1XSKA 4UFJA 4TTGA 2WBGA 1QNOA 4WKHA 2OYKA 4F79A 4F8XA 8CGTA 1WDQA 1HF6A 4BQ5A 3KZSA 4UQBA 1IT0A 4CCCA 3GZAA 4UR9A 3WNMA 2OWCA 1V3HA 1H2JA 2OSWA 1F4AA 2PWGA 3D3AA 3GNRA 4NRRA 2BXZA 4QLJA 4MB1A 2YDSA 3VD3A 4GO9A 1JFHA 4JCLA 5A3HA 4LGXA 1FP9A 1JIBA 3AIBA 1OB0A 1TVNA 1KXQA 4YN5A 1AQHA 5JBEA 2D2OA 3PZUA 1EHAA 2XSAA 3J7HA 4KWUA 4Z2LA 3WSUA 5FOOA 1NOFA 1JNEA 4W88A 4B3KA 4MAVA 3G6MA 3NIYA 3W24A 3FHAA 1HT6A 1NWSA 2D24A 4AD1A 2XIIA 1U2YA 1JYVA 2DIJA 1EO7A 4WSJA 3WDIA 4AD5A 1XC6A 4BF7A 4F9DA 4W93A 3L4XA 1UD6A 3AJ7A 2ZXQA 4E8CA 4MNKA 2CIPA 1UWIA 3PZVA 4AIOA 2CEQA 4FLOA 3ZIZA 1H41A 2OSXA 2VVNA 3ZJKA 2XFFA 1BVNP 3RO8A 2J47A 1NQ6A 2CESA 5AC4A 1N82A 4OKDA 5A6LA 2A3EA 1WNOA 5ABFB 1V3KA 3BLPX 4U31A 4XZWA 2WCGA 4GXPA 2DSUA 1AQ0A 2PB1A 2WXDM 3WF3A 2E4TA 4D1IA 2XG9A 5D8ZA 4Z2HA 3CGTA 1JI1A 1W3HA 4P8VA 1W1TA 1V6VA 4NF7A 3NSNA 1R8LA 1ZB5A 1E0VA 2PF0A 4CD6A 3N13A 3GM8A 4W8LA 3WBAA 1JGIA 3SEPA 2J78A 2FHFA 3G6LA 4W8BA 4YHEA 1W2PA 4JAWA 5CQ1A 1IZJA 3TOPA 4U3CA 1W91A 4PMRA 3VD7A 3DYOA 1ZBKA 1V6YA 1F4HA 1B30A 2ZUVA 1B3WA 3PTQA 2DSKA 2Y8KA 5JIWA 5A6KA 2E9MA 4OOZA 3U5UA 2ZWZA 3AMLA 4AMCA 3AS2A 2BY2A 3MMDA 2G41A 3MO4A 3L4ZA 3IAPA 1OCQA 4NSBA 1K9TA 4J27A 4M56A 3AMDA 5HPCA 1CXIA 2TAAA 2JF7A 3CHFA 3HJEA 1W3LA 2J7CA 1W9PA 1UWRA 3S6TA 3W53A 5BCAA 1HJUA 3TTSA 1TA3B 3FXYA 2UY3A 2XIBA 1CGTA 1WZLA 2UWFA 4CN4A 2JEPA 2D3LA 5HDRA 4HMDA 4S3JA 2DSVA 3BXWA 2DSWA 3F4VA 1JFXA 5HNNA 3W38A 4J3TA 1JDCA 2G3NA 1B90A 4JL1A 4M1RA 4PRWA 3BAWA 3W0KA 3UESA 1DTUA 1TFVA 2J7EA 4U2ZA 1ZBWA 2CKRA 2VCCA 4D1JA 2DT1A 1QOXA 3CIVA 3VIMA 1OWQA 1XGZA 5I6SA 3IJ9A 1E0XA 2WHKA 3FN9A 3SCNA 1QHZA 1X1NA 2EPLX 3WNOA 3W25A 3AZSA 1JZ2A 3VIIA 5DT5A 3I3EA 2V3GA 3IJ7A 2PC8A 1Q6GA 4R27A 2X8RA 2YBTA 1AVAA 1E6PA 2G4FA 2CCRA 1XSJA 5DFAA 3K8LA 2UY5A 1JZ5A 1PEZA 2CPUA 3F5JA 4EAMA 2OWXA 1NWTA 1E71M 1DWFM 4JKKA 3ARSA 1WAWA 1W3JA 2HISA 3ZT6A 2YDQA 3PZOA 3B8SA 3WNNA 4JFSA 1WPCA 1PAMA 4WKAA 1WCGA 3QHNA 4JFTA 1W32A 4ACYA 1PIGA 1AQMA 4JCMA 3GH4A 3PZIA 1BYDA 3VNYA 3AZTA 1IZKA 2X1IA 1XV8A 4HPGA 4MNLA 1J0IA 1C8QA 2JFEX 1J9YA 2G3MA 2E3ZA 2WZEA 2WMGA 2WNWA 2IUZA 1VBRA 2EEXA 4PMYA 1ZJAA 4OZOA 1FHDA 1CGXA 1E43A 4UOZA 4LX4A 1UG6A 2DPEA 1ISZA 1LQ0A 1UOKA 1GOKA 1WKYA 1QI3A 3A4AA 3WMSA 3UEQA 1ECEA 4CD5A 3GTNA 1TMQA 2VX4A 1XD1A 4D6GA 1QBAA 1W9VA 1BHGA 1NH6A 2A3CA 2WW5A 1W1PA 1VFFA 4AZBA 1G9HA 1E4MM 5BYWA 1OINA 4RE4A 3VKKA 1UR4A 3ZSTA 1VEPA 3A4XA 1CXEA 2XGBA 4KGJA 2D0HA 3PZGA 4J3UA 4HMCA 4P7NA 1UD5A 2D3NA 1UWSA 1VJSA 1OT2A 4D6HA 3AHVA 5JBFA 5KEZA 1QHPA 3K8MA 1UKOA 1JF6A 2ZWYA 3VIJA 3AIVA 3CMGA 4V27A 3HU7A 5A6JA 4BQ4A 2BY1A 5I24A 1JD9A 1H0GA 3GNOA 2WVTA 1E6NA 2QV4A 2ZX8A 2VCBA 2WKLA 3K46A 3WH7A 1R85A 1E55A 1TE1A 2Z1SA 3II1A 3SCUA 2E8YA 2ZUMA 5D9NA 4D6IA 1J0KA 4W87A 1US3A 1SYTA 1JI2A 2GFTA 1DWHM 1XH2A 4GINA 4HA4A 4N0RA 1KR0A 1UR0A 4ZEPA 1JG9A 2EO7A 1VFMA 2FDMA 1C91A 3MANA 4ACZA 4OIFA 2VJXA 4FK9A 4D6CA 3N15A 1OD0A 1B3VA 1KGWA 4GO8A 4PTVA 1CXFA 1VEMA 1UD4A 1V0NA 1RH9A 1VF8A 4PMZA 3RPMA 1ISWA 3AXHA 1GQIA 1RD6A 3WUEA 2OSYA 3PHAA 1TG7A 1VB9A 4OBRA 1BG4A 5A6BD 2OLHA 1FHLA 3T0AA 3CHDA 2B31A 2BVYA 5M3WA 1A47A 2QMJA 2Y4SA 1CXKA 2BS9A 2XM1A 3VGFA 2EJ1A 3GH5A 5E09A 5A2CA 4PMDA 3MUAA 3EDDA 1TZ7A 1CGYA 2WWDA 4UFKA 5AYIA 2DH3A 1ITCA 2AOSA 3VX0A 4TTUA 3SUTA 4CUCA 1FOBA 1GONA 1LLOA 1H5VA 1TR1A 2JALA 2FHBA 2UY2A 4GQQA 1ZJBA 5E9AA 3WF4A 2ZIDA 1G1YA 3ARWA 3W81A 1VBUA 2JF6A 1WB0A 2ZUUA 3WQ8A 2WLZA 5ABGA 3N1AA 4P7QA 1NWRA 3L4WA 1V3JA 4GZIA 5EBAA 5CJ5A 3K1DA 3OZPA 3DHPA 3QHOA 4TOQA 1FFQA 2A3BA 3UERA 1XRVA 4OUEA 2EXOA 5CPSA 3LPPA 4LYRA 4GQRA 5BXRA 2CETA 5FIPA 2J79A 4ZE5A 1EH9A 4KRUA 1CYGA 4C7DA 5IHRA 2Y2WA 3APGA 1KFWA 1XHGA 1UUQA 2XVKA 3WENA 3EYPA 4AZIA 4M24A 2VX7A 1V0LA 2WVUA 1WO2A 1DWGM 1KWKA 4DWSC 3THDA 4FF5A 2JIEA 2V38A 1CLVA 2RGMA 4CVWA 1BVZA 3MSGA 4AY1A 2GJRA 5I5RA 2D1ZA 1DHKA 1MXDA 2W66A 3CUHA 3DYMA 4Z2GA 3EDKA 3VIHA 4HOWA 3WEMA 3BSHA 3GXDA 1I1XA 1QI4A 1YHTA 2XSBA 1FP8A 1WE5A 3OLGA 4EANA 2XGIA 4J3WA 3QHMA 3I3BA 3WDRA 4Q22A 1GNXA 3RM9A 4AD4A 2ZX9A 1EOMA 3QOKA 2WM0A 3MV01 3UCQA 3WUGA 3CHCA 1DWAM 3ZJ8A 3AFBA 5LA0A 1GHRA 1OBAA 3B9AA 4QDMA 4AXNA 2V3EA 4BA0A 4AW7A 2GJXB 5D8WA 2WMJA 4OOUA 4PMUA 4WF7A 5CLWA 1MVYA 4P7OA 4IPNB 2ZXBA 1E0WA 3AOFA 3CH9A 3VD4A 1BFNA 3A3HA 4E2OA 1HKJA 2G3IA 3BSGA 1NM9A 2F2HA 2EPNA 4PMNA 1O7AA 3IJ8A 5I77A 5JUVA 3UG3A 3BAYA 1XH1A 4QAWA 3U7BA 3MMWA 4CN1A 1V3LA 1MW3A 2WANA 2ESCA 3AHXA 1B3XA 1KXTA 3NSXA 4UFMA 1HL9A 1V02A 2VZVA 1IV8A 5F7UA 5AY7A 3TONA 1MXGA 5C8BB 4AZ6A 5HXMA 5FD0A 3L4VA 2OWWA 2PBOA 1EQPA 2XYLA 2C0HA 3AYRA 4PMXA 4LPCA 2MANA 2O92A 1MFVA 2QMKA 4U33A 4UFIA 3CUIA 1HIZA 1CPUA 1XCWA 1V3IA 1MW2A 2DT2A 3AQUA 1SR0A 4TVCA 1UKTA 5DEZA 4Z2KA 1NWUA 1TCMA 3LPGA 1CENA 2V3DA 4CCEA 1L0PA 3BAKA 1ZBVA 3HN3A 1E72M 2QF8A 3ALGA 3L4UA 5A6SA 2FGZA 3NUKA 2WPGA 1CDGA 1MQQA 1OM0A 2WMKA 1JXJA 1LWJA 3WUBA 3GNPA 4MADA 2VR5A 1ZBCA 2XFYA 1QVBA 1H3GA 4JKMA 4DM2A 1CECA 1QI2A 4U5KA 1B2YA 3CO4A 1V6WA 2ZUTA 2ZICA 1JYNA 4B9ZA 4WSKA 4EK7A 1B0IA 1UQZA 1HJWA 5I2UA 2W5FA 1C7TA 4AISA 4GPNA 4JL2A 4UQDA 4BQ3A 3N11A 4CD7A 3BGAA 2GDVA 1E4LA 1LF1A 2J8GA 1C3FA 1E4IA 3WF2A 4CU7A 1K9FA 3PZTA 5I78A 1GJUA 3PTMA 6CGTA 1KWGA 5IFTA 4TX8A 2PWFA 1V6UA 1W2VA 4FMVA 3AZRA 2WKGA 2BVTA 1MWOA 3CZJA 3AHYA 4DWSA 1DP0A 2GSJA 3OB8A 3MUY1 2J62A 3M6DA 4XB3A 4YPJA 1UWQA 4Q7NA 1V6XA 1BYBA 2ZXAA 5I0DA 5A8OA 5EMYA 2VCAA 4V28A 3VUPA 2ZX6A 3WD1A 1GOIA 4QFUA 4RE2A 1V0KA 3SURA 5A8PA 2J8FA 1UD8A 3SUWA 2O9TA 1US2A 1ZU8A 3VX1A 2GK1A 1GW1A 1PX8A 1QNPA 2DDXA 1E6SM 1PX4A 3FY1A 3RJXA 2PBGA 4PSPA 5E70A 1PBGA 1GUVA 1I75A 4A3YA 2EPMX 6TAAA 1BGGA 1XYFA 1VENA 1UKPA 2XM2A 1E4NA 1NP2A 1GCYA 4JZ5A 2YBUA 3CZGA 4GIAA 1KGUA 4AZCA 3VM5A 4AD2A 3GH7A 3WFZA 1Q6FA 1V03A 2BHYA 3OZOA 4CN6A 3VO0A 3T08A 3WD2A 1V08A 1GQJA 3OGRA 5GQBA 2YDRA 1PPIA 4GI9A 2E9LA 3ZJ6A 3AIEA 4ATWA 4UFLA 1KR1A 4R5EA 5CSYA 5A6AA 3GBDA 4B15A 2Y5EA 4PN2A 4W7UA 4UQEA 4W84A 1JZ6A 5ECUA 2XPKA 4MB5A 2J7FA 4RL3A 4NZCA 4ZXLA 3POCA 1EDGA 3WMBA 3ARUA 2PWHA 3BCDA 2EPKX 3DHUA 1HVQA 2X0YA 2X2YA 1M01A 4HP5A 5TD4A 3PZQA 4HOXA 4H2CA 1V02E 1XSIA 2VURA 4J7RA 3ZOAA 3O9NA 1ZL1A 4XX6A 2VI0A 1BYCA 5BRPA 2D20A 4QLKA 1GQKA 2XTKA 4V2XA 1LL6A 1BSIA 2J4GA 3EMCA 3SIMA 5A6MA 1HL8A 3OGSA 4PYSA 1CGWA 1DWJM 2CERA 3L4YA 4UNIA 1MW1A 3VGGA 1ODZA 3WH9A 1E3ZA 3TA9A 1OD8A 3M46A 2UY4A 1JZ4A 3RIKA 4W8AA 4L4OA 5CSUA 4B3LA 3AYSA 3ZSSA 4PTMA 3I3DA 1EOKA 3RDKA 2J7BA 4E8DA 1J12A 1B31A 3A47A 4XZBA 3ZR5A 1GOWA 1PZ3A 2JIWA 2WSKA 1WDPA 1HJQA 1HKIA 4PTXA 1E5JA 5ABFA 1H09A 2BFGA 3PZMA 1W1VA 2G3JA 2YL9A 4JFUA 3WDHA 3W29A 5I23A 2V3FA 2VX6A 4IPLA 4HTYA 1CIUA 4AWEA 3U5YA 2XVNA 1NP0A 4CD4A 1BAGA 2HVMA 1E6XM 1I1WA 1W1YA 3AIQA 3UG5A 9CGTA 1HJXA 3PBGA 4WJXA 3N18A 2QLYA 2W61A 3FW6A 2NW0A 4DUVA 3IAQA 3WQVA 2PWDA 5C70A 1CEOA 4N42A 2XFRA 3WH5A 1E5NA 4CD8A 3BCFA 4Y7EA 1OIMA 1J0JA 3CPUA 3OLDA 3MS8A 4NRSA 4H7VA 2ZUSA 1OIFA 2XJ7A 1QW8A 5IDIA 4M82A 4PEEA 4H8VA 4W5UA 3QR3A 1CBGA 2XUCA 2VMFA 2WWCA 2CBIA 2J7DA 1C92A 4MPKA 1SMDA 3CUFA 2WCAA 1CNVA
chains in the Genus database with same CATH superfamily
5CZKA 2J66A 3DBPA 1Z69A 2TRSA 1TWWA 1S2WA 3ARVA 4XIMA 3P0WA 3PN8A 1PZ2A 4M8UA 4PMQA 1O6IA 2PZ0A 4IIHA 2DORA 3T6CA 5LA2A 1Z7AA 3PJWA 3SUUA 2PC4A 1LWIA 4QE1A 3SCVA 4RX0A 3WBYA 3HPZA 3T0BA 4JD4A 3QQ1A 4GXWA 4AZHA 2J9YA 4ZQMA 1SMAA 1S1PA 4KF1A 1OFDA 2BGNE 1GVYA 3TYDA 1OX4A 4HYRA 4E3VA 3VGDA 1FXPA 1ZSXA 2YA1A 1MQPA 2XISA 3AI0A 2GDUA 3AS3A 2ZXDA 4QXIA 1SJAA 3ZWSA 1O1ZA 1XFCA 3OVPA 3ZJ7A 2TSYA 3DHDA 3WJXA 2E6AA 4IIFA 5M17A 1KCLA 3E0WA 4LAMA 5AN7A 4DZIA 3MO7A 1QPKA 2Z1KA 4O1AA 1REQA 3E38A 3R13A 1EGVA 2NT1A 3W74A 1PX3A 3C0SA 3ARRA 1Q4NX 3UF9A 1M7XA 4FOKA 1ADSA 5JVLA 1H7RA 1CZ1A 2PRLA 3C8NA 2BVDA 2WVVA 3KTSA 3TEVA 1IIHA 2FH8A 2IPWA 2O9PA 3WKZA 3VKBA 2IXUA 2JEQA 3GZ3A 1R7OA 1UBPC 4W7WA 1M7JA 2Y0FA 2BOEX 3O7UA 2ABBA 3A6OA 4GABA 1XIEA 4K8GA 2CYGA 2HK0A 3LCLA 2VO5A 3TROA 2DVUA 3NURA 3LDVA 2VRQA 1EA0A 3I4EA 3D3FA 4DUOA 8TIMA 1RY0A 4IGMA 1W9UA 3PULA 1TV3A 1IXQA 3GB6A 1HX0A 2CZ5A 4R3UA 1YBQB 2BP1A 1SJCA 1ITXA 5CGTA 3GIYA 2VD9A 3LSBA 4GY0A 3VNDA 1ZJIA 2G97A 5LHEA 3OG2A 1H7XA 1JQVA 3H2AA 4PUEA 3PC0A 2YL6A 4NT0A 3C2VA 4O57A 2HCVA 1SFLA 2X7WA 1KCZA 3WLOA 3TR2A 2CXGA 3CBWA 1VEOA 4PRRA 5I79A 2A7NA 3VXGA 3N6JA 4R33A 2E5DA 2VWTA 4LS2A 3BG5A 4D8AA 1JXKA 1W9BM 1OQFA 4LYKA 4CCDA 2POTA 1JDDA 5HAOA 3KHJA 4PUDA 3EEZA 1VRXA 1UWTA 4EOUA 3E0LA 2A6NA 2GGJA 4B2DD 1QPRA 3POHA 3LX9A 4BJHA 3CMJA 5T9BG 1UC5A 3U7VA 3MCNA 1OX5A 1PKYA 3WO8A 1BLIA 4JS3A 2QUNA 1LL7A 3FYOA 3R79A 4QG6A 4J3XA 4MSSA 2AGTA 4OBSA 5CEWA 1KQZA 1GYNA 1XPYA 1UD3A 1KXVA 4HPHA 3ALFA 4L9XA 4Q4RA 1W1ZA 4BS0A 2W62A 2QCNA 1F6PA 7PTDA 1Q2RA 1NFPA 1LUCA 3EOSA 4JTIA 1LBLA 1UH4A 2OKOA 3FYPA 1Q65A 4ZFMA 4K8HA 9XIAA 3M64A 5AOUA 1X7FA 1MEIA 4LV9A 3W2KA 2NUWA 3GFYA 1GZJA 3AS1A 1PHQA 2Y70A 3B05A 3VIFA 3CC1A 2O9OA 3TTOA 4AIBA 3EKGA 2P76A 5ABTA 1F9CA 4XSMA 1XS2A 3V5FA 4Z42C 2E5BA 4UQ9A 3UZ5A 2NX1A 2PWVA 2HK1A 4MAZA 3FIGA 1BG9A 1F73A 4WRHA 3P0XA 4O4WA 1H7PA 1R2RA 3LZ3A 4XISA 4HHMA 4Q6XA 1TYGA 1YKWA 1R7AA 4ROQA 4E0CA 1KM0A 4DXKA 5CG0A 2EPHA 3G2GA 4P5UA 3TYCA 2VL4A 3PF3A 3TYBA 1X1OA 2GSEA 2P0OA 2PDJA 4J9JA 2NQ9A 3EA3A 3PUDA 2HBVA 2DUZA 3W2LA 2VR4A 5CGMA 4AY8A 2GUYA 2NX9A 3BLKA 4MB3A 1SW3A 3KBNA 3H2CA 5LNUA 3A3WA 4S39A 3RG6A 3O6CA 5LZLA 4GJ1A 3CV1A 1TX2A 1K70A 2Y7EA 4IL2A 5A94A 5CKSA 1B57A 3FAWA 4UQCA 3CAQA 1QK2A 2WMIB 2IPGA 2OEMA 2ASHA 5HMSA 4NHVA 3B9EA 4DXVA 4DF2A 2CU0A 1XIHA 3CT7A 2J25A 4JHOA 4GI6A 1RZMA 2CHOA 3MSDA 1HUVA 4I3GA 3VNLA 3ANVA 3OZYA 2OZ8A 3W7GA 5E1QA 4M7SA 4LEQA 3SGUA 1UPMB 2C6QA 1WQ5A 1FWCC 3AMCA 1IIGA 5C9XA 1KQYA 3E12A 2FVKA 2EQDA 4MY9A 1Q6CA 3R5EA 1E1FA 3VDAA 2O7SA 2CC0A 1XYAA 4OJYA 4TQTA 5EYWA 3TAOA 2YB1A 2VELA 4ZO9A 2DZBA 3BLFA 3MHFA 2FGLA 2GJXA 4H04A 2CLMA 4L1XA 3UPWA 4QCEA 1GHSA 1EJ7L 4W89A 2X09A 4B90A 4PUUA 4JNMA 1FH8A 1VBJA 1ZRQA 3KCOA 1VYRA 4FSAA 2V67A 1W9DM 1JJKA 1UKSA 4RZ4A 1DJQA 4L1WA 4GI8A 3C4UA 1A0DA 2NZLA 4KETA 3WF0A 3DKLA 1EWDA 3CASA 1JQXA 3N9KA 3QGVA 4PCPA 3TTQA 3E2SA 4EF8A 1HP4A 4M81A 3FNDA 3D5HA 3L0KA 3DENA 3ABRA 3RPTA 2XN1A 3C3NA 3SZ8A 1JGMA 3KBJA 3EOLA 3V1HA 5HQLA 1LG2A 2D22A 4H9TA 1E40A 4Q4QA 5MKGA 5M2FX 3BG9A 3VOHA 4Q8WA 3I68A 1HXJA 3OGVA 2NV2A 4UOQA 5DT7A 1CWYA 1K9EA 2PI6A 3R94A 3ERPA 2AAMA 4HZ7A 3V18A 3WD4A 4QJ4B 2QUVA 3TYZA 4DQWA 3SUSA 4PC8A 3N12A 3T40A 3T42A 3NVDA 4FR1A 4B92A 3F5KA 1S46A 4HYVA 2BGSA 1EC8A 2VC9A 4W5ZA 2J13A 4ZMGA 3DYPA 4Q3MA 5CLTA 4F9JA 4HGXA 1VCGA 3L68A 1LZOA 2RGLA 2IKGA 1K03A 4LUSB 3VGEA 2WC4A 3OG3A 3GG1A 3LS9A 5FCZA 3EMZA 3HB9A 3UYCA 1V3MA 3QC3A 1W5QA 4CLMA 1EB3A 3LOTA 4K7YA 4RXGA 3VCNA 2GSHA 2WSPA 1Z89A 2J9ZA 1KBIA 4WOZA 3LCHA 4LRSA 2EAWA 1HKKA 3JR2A 1TQJA 1LBMA 3WK2A 4GZEA 4W7VA 3MUCA 1NOWA 1ODUA 1GZGA 1WXYA 1LWHA 1NF7A 2GJPA 3GXNA 2GUUA 4JN8A 1A5SA 5DO8A 4A4AA 2W27A 2VEGA 3FYYA 1EA9C 4W86A 1RHCA 3W75A 4BI7A 2A3AA 4IQEA 2D0FA 5D9OA 5F2MA 1A3XA 4MLRA 3M7SA 1AD4A 3CIXA 4UC5A 1C8XA 3O6AA 4B16A 2D0GA 1UZDA 4O1CA 1TQXA 4FA3A 3TUUA 1V5XA 5AC5A 4XUGA 3L4TA 2FFCA 5HULA 2GVEA 5A1AA 3WQOA 4O13A 2YCLB 4LF1A 2ZRUA 3NQ2A 1UH2A 3W7LA 1GTHA 4LC6A 5HPOA 1LYXA 4GUFA 2J27A 2PGRA 1EXPA 2V5BA 3GDKA 1R3RA 3TTYA 4LQ1A 3HPSA 2DEPA 3U4FA 1US0A 1Q6RA 1XUUA 1NOUA 3QKEA 1KM5A 5C2GA 2Z26A 3UPBA 4JQ2A 3OBKA 4F0SA 4H41A 4ML4A 2HSAA 4UMAA 3FGCB 3WFLA 3QV8A 1QK0A 1DQUA 3W1XA 1S2AA 2VQTA 4LAOA 1OZQA 3AHTA 3QMTA 1EYEA 4RW5A 4D6JA 5CPLA 2DQXA 1H1NA 1JUBA 4IMCA 1JPKA 2GGHA 3BOFA 4KIEA 1JRBA 1QFEA 4TX9A 3E5PA 4N9EA 3BMWA 1J2WA 2VD8A 1G6CA 4UTFA 3WLLA 4PBEA 4UZUA 3MYPA 4MJ4A 4PL1A 1QI0A 2WV8A 5LSMA 4RW3A 3WLTA 3L9CA 5E6YA 1HO4A 8XIMA 1MUCA 2YA0A 1XD0A 2E28A 2WZIA 3BLEA 3LGEA 3L7RA 5HR7A 4ORIA 2E6DA 4HSHA 4WKFA 4CQDA 4A8LA 1ELSA 3AUJA 1FCQA 3KL0A 5D32A 3RM4A 2XH2A 4DM1A 3UCDA 4D71A 1EBGA 3WLJA 2H8XA 2VDIA 3KRZA 4UOJA 1GVIA 3M0XA 4IUGA 1FWSA 1C8YA 5DMYA 1QATA 3DESA 5D2YA 4WKHA 3NGJA 3LTSA 3S47A 4F8XA 2QCMA 4DJED 8CGTA 2X7VA 1OABA 1XJBA 4UQBA 4CCCA 4UR9A 1V3HA 1GQNA 2OQLA 2F2KA 1OG0A 3GNRA 5BMXA 2PF8A 4NRRA 3UWEA 2YDSA 5H8MA 3VD3A 4LUIA 1ECQA 3UGRA 4A05A 5AHMA 1J8VA 4U4MA 4YN5A 3AYTA 1AQHA 4Z2LA 3Q4DA 1Q66A 3T4WA 2R8WA 3HJZA 4DF0A 1E1CA 1NWSA 1GVRA 5CBJA 5AVNA 2DIJA 1EO7A 2ZTJA 4JIPA 1TJRA 4BF7A 4W93A 1XWYA 1UD6A 5REQA 2CIPA 1UWIA 4QBXA 2ICSA 4AIOA 2PD9A 1F3XA 2OB3A 2FTPA 2CLIA 2VVNA 3RO8A 4Z0SA 4KWSA 3TSBA 5H8PA 2XIQA 3QW3A 4HIBA 2WZTA 1Q8AA 3I7RA 3DFNA 4F2UA 1UMLA 4U31A 4EPDC 3C2OA 1A0EA 3QMSA 2X30A 3VC6A 4D1IA 4KWVA 3GFZA 4PTNA 3IRSA 3GNNA 1JI1A 1QOQA 3V5CA 1V6VA 4FAMA 3FCPA 1F8MA 1Y5VA 2O55A 1EUAA 4MPQA 3ICJA 3PK7A 2FHFA 4LRTA 1W2PA 1YPIA 4QSHA 3NTYA 1F74A 5CQ1A 2P10A 3VD7A 1T8XA 3IIOA 3C3UA 1B30A 1B4EA 3VOGA 1U1HA 3PTQA 1GVOA 2E9MA 4OOZA 4MYXA 4EXQA 4IGHA 3UJRA 4L5ZA 3MO4A 4DBDA 3IAPA 3B0VC 4NSBA 1AW2A 1K9TA 1NFGA 2NLYA 3W86A 1XRFA 3CHFA 2J7CA 3RX3A 4AMAA 2OELA 1KBJA 1HJUA 2UY3A 2XIBA 5KITA 1X8FA 4CN4A 2UWFA 4HMDA 4RPQA 3JS3A 3DAQA 4NZJA 1MMFA 4P2VA 3GY1A 1JDCA 1K7EA 4GC3A 4I6VA 4PRWA 1DXIA 3LRMA 3ABXA 1EX1A 1ZBWA 2Z1XA 3NDOA 1IE7C 3B0PA 4L61A 3VIMA 3BLDA 3IJ9A 3CM4A 4HZMA 3SCNA 1QHZA 3EGJA 3VIIA 4KCUA 3N4EA 3V35A 3IJ7A 4K38A 4WQ6A 3L5LA 3O6DA 1BEUA 1TR9A 2CCRA 1RXOB 3WCZA 4C6OA 3P60A 4P61A 4EAMA 3WQGA 1E71M 2QDEA 1DWFM 4NXSA 3MKVA 1R30A 2YDQA 3B4UA 2CLPA 2Z2BA 1WPCA 4IMGA 4DPPA 5CCZA 4FNPA 3W71A 3QHNA 3KP0A 4GY1A 3QV6A 3LI0A 4A35A 3I7QA 5BMWA 1NJJA 4I8YA 1IZKA 4Y6GA 3SRKA 1KFLA 1VFSA 4Z1CA 1J0IA 4EWJA 2H3BA 1P0NA 2ZZ3A 1ICQA 3N2BA 3DBNA 4Q8UA 1XLBA 4C6IA 1NDVA 1TJ0A 2Z6IA 1IYXA 2DPEA 1ISZA 3IS4A 4JTTA 1DJYA 3MP5A 4OV9A 3B0UX 1YLVA 2HE8A 1ECEA 1GEQA 3GTNA 3URAA 3PWAA 1OJXA 4POCA 1YXYA 4YS1A 2X42A 2WW5A 1TO3A 3W7MA 1QNVA 1OINA 4Q8QA 2FVMA 3A4XA 2D0HA 4AC7C 3W76A 2HPIA 3BO9A 1FWNA 4HMCA 4JDBA 3W84A 4P7NA 4C6KA 3TE9A 4CNSA 4C1NA 4PCNA 4ZCWA 4D6HA 3UA3A 2CLHA 2OFJA 1M68A 2UBPC 3VIJA 3KOXA 1EXBA 5LGXA 3O06A 1QO2A 4NAFA 4ERGA 4JTHA 5BW6A 4J4KA 5I24A 5HNTA 1TTJA 3MZ2A 2ZX8A 2BSLA 5HNUA 3K46A 3WH7A 2Z1SA 3II1A 3SCUA 5DQPA 4D6IA 3MJMA 2HNEA 3URQA 3PSVA 1TTQA 4GINA 4FOUA 1SO6A 4HA4A 3GAKA 2TMDA 1EJSC 1VFMA 3R4IA 1C91A 2WSYA 3OEXA 4ACZA 1WAUA 2NVCA 3KAOA 1B3VA 1KGWA 1VEMA 4X2RA 3VZZA 1V0NA 1KFKA 3GX9A 3A13A 1OZMA 1PDYA 3IJQA 3G1FA 1GQIA 1KM1A 2X1TA 2VDHA 3BOLA 1TG7A 3PHAA 4QRNA 3LTPA 4FX7A 3HA1A 2B31A 5M3WA 2QV5A 2QJNA 2BS9A 1BXCA 3U9IA 4ZFCA 3NPWA 1YXCA 5E09A 3R11A 4QEHA 3CQ0A 4L56A 3DZ1A 2P3EA 1POKA 3CMFA 3OW1A 2DH3A 1ITCA 2AOSA 1R3VA 3VX0A 1YDVA 4CUCA 1FOBA 5DBUA 1GONA 1OC5A 1LLOA 1L6WA 4HN8A 2PUZA 2E77A 1H5VA 2HE5A 1TR1A 2FHBA 3CUXA 4GQQA 1JCYA 1E0TA 4IICA 4O0KA 3KHDA 3N1AA 4P7QA 3H21A 1SU5A 4GZIA 4DBUA 3THAA 5FF0A 1FFQA 3UERA 3G1HA 4DB7A 4OUEA 3V0UA 1AMKA 1RLDA 4GQRA 5BXRA 4WVXA 2P0IA 4US5D 1W31A 4KRUA 3PNUA 1CYGA 1VFHA 4GVFA 3W70A 4YTTA 3APTA 1KFWA 1XHGA 1Q7ZA 3MKCA 3WENA 1R9ZA 4GY7A 5FJTA 1UJQA 4LOCA 1RJRA 4IFRA 3K13A 1LROA 2V38A 1CLVA 4CEUC 4CVWA 3TK7A 1TTIA 4HJWA 5D04C 5DY2A 2CXEA 3QLDA 1TMHA 3S46A 2NLIA 1K4GA 3GVWA 4Z2GA 5EMKA 4R7WA 3EDKA 3WEMA 1I1XA 2A4AA 4XO6A 4J3WA 3PS7A 1EOMA 2R9RA 3MV01 2GUBA 2OOGA 3ZJ8A 5LA0A 1GHRA 3MBDA 3B9AA 4KERA 1V79A 5D8WA 3LYEA 2QS8A 4PMUA 1EJXC 4OOUA 3GTFA 4B5UA 3GR7A 2FZ8A 4GMEA 4H6RA 3N14A 1MVYA 3ZYZA 1K8YA 2FYMA 3MHUA 3CH9A 3P6LA 4HU4A 3E0VA 3UNTA 1HKJA 3H12A 3TQVA 2ZBTA 1TZZA 3DFSA 1V7AA 1T7LA 4AWUA 3U6WA 2PRMA 4JN6A 3UWUA 3BAYA 1XH1A 3WQFA 3U7BA 5KTLA 1KM3A 1V3LA 3AHXA 3NSXA 1B3XA 3VKCA 4E4UA 2X1RA 5AY7A 3GHTA 1MXGA 4KFNA 5CSSA 2A5HA 4IPIA 3PFRA 2DVXA 3C2RA 2Q09A 3UVAA 2ANUA 1GOXA 4GUGA 2MANA 3LEPA 1TPEA 4A8RA 4U33A 4ERAA 1SO5A 1IT8A 1MW2A 3TCSA 1SR0A 4E2VA 4TIMA 1PIIA 1UKTA 3PB2A 3W1QA 1RSCA 4D8ZA 3BAKA 4AXKA 2JK2A 4O11A 1E72M 3MDUA 3WLQA 2WMKA 1JXJA 5EMMA 4MADA 2VR5A 3NL3A 5LNRA 1QVBA 1LORA 3FJ6A 1SZNA 2ZKMX 2GJLA 2ZZ2A 4IT1A 1N8FA 4JKMA 4DM2A 3W87A 2FTYA 3WK3A 1QI2A 2CWXA 5LNSA 1O5KA 1EPXA 1B2YA 4KFOA 5JXQA 2ZUTA 4DO6A 4WSKA 3B40A 2GQAA 2QVNA 4PGLA 4PB3A 4AISA 4JL2A 5KZEA 1I2QA 1IXPA 3W2NA 7REQB 3KDOA 3B97A 3BGAA 2GDVA 3UJ2A 4QS6A 1C3FA 1E4IA 1XYCA 3FJLA 4ADSA 3LU2A 3M0IA 4RZ6A 5I78A 3PJTA 3M0HA 3DGBA 1KWGA 3STEA 3H7VA 2PWFA 3VABA 1B4KA 2WQPA 2BOGX 4C1LA 4HQVA 2WKGA 4IIBA 1Z42A 3CAKA 2VFEA 3CZJA 2QCLA 1I0DA 2ZYFA 3OB8A 3L23A 4DBSA 4H6KA 2OZ0A 3UQNA 4XB3A 3NZRA 2NUXA 3PJXA 1V6XA 2ZXAA 3HQNA 4CNNA 4IPPA 4RUBA 1PB0A 1W37A 3WZ0E 4V28A 1P6CA 3EKZA 4O4VA 1FHVA 1NDYA 4JNZA 4US6A 5A8PA 2J8FA 1UD8A 1OK6A 5T91A 2GK1A 3M0YA 1PX8A 2DDXA 1PX4A 3FY1A 3HGJA 4LAKA 3BARA 4WGXA 1NVMA 1GJPA 2EPMX 2NX3A 3QSRA 6TAAA 3TSMA 4PCFA 1EJTC 2XM2A 3S4TA 3RHGA 1GCYA 2PGWA 2YBUA 2B7QA 3CZGA 3ZLFA 2G96A 3VM5A 3FEQA 4INFA 3GH7A 3UBPC 4GI9A 4ATWA 5TIMA 5I00A 3VOJA 3DFTA 5CSYA 4LVAA 3UNDA 3U48A 1JZ6A 1DQWA 4QDWA 3VFLA 5I06A 3I6RA 5ECUA 1TB3A 1WKFA 3GW0A 1V6TA 4ZXLA 3G1SA 1EDGA 3H2FA 3WMBA 3ARUA 3BCDA 1HVQA 2X2YA 4L9YA 3S9YA 3KTXA 4NKCA 5TD4A 1XGEA 1EKOA 4H2CA 3CWHA 2ZRVA 3ZS4A 1XSIA 4V33A 3ZOAA 1EL3A 1ZNNA 4HCHA 3URNA 1XBZA 4Y9PA 2D20A 2IKHA 2QDDA 1XUZA 1LL6A 2J4GA 2ZA1A 1S2CA 2XZ9A 5A6MA 1HL8A 2BWGA 3KOYA 1XL9A 3TN5A 3VGGA 4BK9A 4JTUA 2YX0A 2UY4A 4ZB0A 3RIKA 1YADA 1EEPA 4JIQA 4ML9A 3ES7A 5KZMA 2GVGA 3I3DA 4EXAA 3RDKA 3MC5A 2PCEA 2VFFA 2VUNA 3ZR5A 1PZ3A 1TWSA 3NNTA 4IHCA 4S3EA 4O17A 4PTXA 3DFQA 4HT3A 3GUGA 3KVJA 3N6QA 4DI8A 3W1AA 4JFUA 2AL2B 1G4TA 4IPLA 3T78A 2I5QA 1IWAA 1NP0A 1TV2A 4CD4A 2HVMA 1OC6A 1N55A 3AIQA 3UG5A 3V3WA 3UYIA 3N9RA 2IPJA 3HFTA 3FW6A 1F6YA 4GH3A 2YW3A 5C70A 2XFRA 2IQ0A 1E5NA 4CD8A 2ISSA 3IGXA 1AK5A 3CPUA 1MXSA 4NZ3A 4A8IA 4FNQA 2ZUSA 3I10A 4PEEA 1P43A 3BSMA 2XUCA 2WWCA 1E9YB 4FO4A 1C92A 1SMDA 1UUMA 3U0HA 3S5OA 1CNVA 1Z8AA 2X0HA 3RMEA 2WMIA 2Y8VA 4GQ0A 1BKSA 1EP1A 3QM3A 5L9FA 4YHGA 1KCKA 5DMNA 2WB5A 1WBJA 1ZS2A 3AIWA 1E6ZA 4P8UA 4Q4SA 3VDCA 4DZAA 1JR1A 1XLLA 3LCGA 4L4LA 1ZUAX 5IDZA 4ASTA 4J35A 2WZHA 3OBEA 1XIFA 3H4GA 3NFUA 4ZENA 2I9UA 1MUWA 2PDLA 3FLUA 3VINA 4RZBA 4R9XA 1S2UA 2DZVA 3ZFHA 2VRJA 4ZTXA 4Z0JA 3NGFA 1XBYA 1M6JA 5F2LA 1RP8A 5DCDA 3G22A 5FKYA 1QTWA 1FTXA 3LRKA 3BH4A 3LBCA 1EF2A 3OVQA 2JE8A 3R6IA 3PM6A 4QGCA 1XF0A 3VIKA 1K02A 3KS6A 2QIWA 3V0SA 3O07A 3R10A 2BBFA 4YYFA 4I8DA 1RPKA 1W5NA 2QPUA 2VQUA 3IIPA 2IXVA 3WL1A 1XLMA 3O16A 4CKQA 1RR2A 3GG0A 3NQDA 3GYEA 5HQEA 4TXEA 1U22A 3HZ3A 1YPFA 1SGJA 4M6UA 2V5CA 2ZADA 4QJ1A 1FWEC 4Z2IA 1H1ZA 3EAUA 2BHZA 2F6KA 1BXBA 3GXIA 4TVDA 3R8HA 1EGZA 3QY7A 1LL4A 1OY0A 3EX1A 3LNPA 5F2IA 3MUIA 2GGIA 3W88A 4O0ZA 1XLFA 2QPXA 1EF3A 3QGAC 3LCXA 3WBWA 4Z2JA 3ZT7A 3G1VA 3TN3A 3ANYA 1IT7A 4FIRA 5D05A 3GC2A 1UHVA 3CL7A 3VDBA 2HTMA 2YZRA 4L6DA 1H0IA 4PR4A 4J5NA 4F40A 2C91A 1UR2A 1JULA 3W4RA 3B8VA 2JBMA 3V5OA 1SZGA 2FZNA 1UR1A 1VPYA 2O7QA 3N2MA 1TSIA 3G5EA 4WY0A 4XK2A 4DO5A 3TKFA 1JAKA 1FCVA 4U3AA 2DIEA 4O14A 1EDQA 1E9LA 1E3XA 3SCSA 3OLEA 3WELA 2ZUWA 1JYWA 3TN4A 1XLEA 2YXOA 2OQHA 3YPIA 1TREA 4A21A 4PCTA 3B8DA 2UV8G 3HV8A 2V0TA 1RP9A 4MWAB 4LUSA 1BPLB 1EZWA 4PUJA 3IVSA 3W3OA 1YW1A 2XVLA 3QJAA 2GLKA 4WCJA 4MLJA 2XWDA 3VIPA 1X96A 3S9ZA 3C6CA 2R94A 4CQCA 1K4HA 4AEFA 5AHLA 3L0GA 2P88A 1DEDA 5M1TA 2WMHA 2QHAA 1QBBA 3GHSA 1LQ2A 2B81A 3DH7A 7ENLA 3PAOA 1DJNA 3WY1A 1G69A 3N2OA 4DBEA 2RDUA 1DQXA 1GTEA 4NZ1A 4JHZA 1XR2A 3KM8A 5HBFA 4MIMA 4LBRA 3ZVIA 4MJ2A 3U2CA 1F61A 4EWND 3KVKA 3K5XA 1ZAHA 1PTGA 3BLLA 3UJFA 3WF1A 5BXSA 3WDJA 4ALDA 4Q8VA 4Q4OA 4JX5A 4CU8A 3TW6A 4S38A 3VFCA 3DFOA 1E1EA 3CWOX 5T9CE 4GBDA 2SFPA 1Q4WA 3MA8A 1UH3A 3Q2DA 4J40A 1G4PA 1MDLA 5MF5A 1OC7A 2PGEA 4LW7A 3WLRA 3TP4A 4U5IA 3TX9A 1TWIA 3ARYA 3ARXA 3DKJA 1X97A 4RNJA 1EJUC 1H4PA 4HNOA 4B5TA 1CB7B 4XD4A 5C71A 2VZSA 2NV1A 1VD6A 2JGQA 1JDEA 4DXXA 1MSSA 1S3TC 1D2KA 2J88A 2CZVA 1KGXA 2Q71A 3P8JA 3FGCA 1FRBA 4D6FA 1OCJA 2V2DA 4HNLA 1Y7VA 5FEXA 3SB0A 1MRQA 4YJ5A 4MM1A 4K1WA 4REQB 1RLCL 3T4CA 3TAKA 2FHCA 5AVHA 1A5KC 1KV8A 2E9BA 5I03A 1SO4A 3LPOA 4KCTA 1GJWA 5F1VA 1PWLA 2WK2A 2Q8XA 3W6MA 1G67A 1M1BA 4D6EA 2V6AA 4QCFA 1LRNA 5HQMA 3XINA 4X22A 1KO0A 5E0FA 3OOQA 1YPXA 3KL3A 5LIYX 1FWIC 3F2BA 5GJNA 4OQVA 1J0ZA 1KRAC 1I2OA 4CVUA 1HP5A 1UMYA 3M41A 3BMVA 3OPSA 2RJGA 3R2GA 2YCEA 2OGJA 1CX9A 3CHVA 1IEIA 2G0WA 1GYMA 1M53A 5G5IA 3WQ4A 3UR7A 3EDEA 3V4BA 1MQRA 2TPSA 2OOFA 4JQ4A 4IG2B 1J5TA 2E0PA 1L6GA 2ZX5A 1UZ1A 3BWWA 3VGBA 5MHBA 4K36A 1JEZA 3GAYA 4GBUA 1QMLA 2GL5A 4ROPA 2XU2A 2ZFAA 3CZLA 3BLIA 1HJVA 2ZC1A 4JPGA 3KDNA 3ZQ9A 3O63A 1TVPA 3IV8A 5FAJA 3TYEA 3NQMA 3W28A 1Q6DA 3GVGA 2F8QA 3GBEA 4TX6A 3VPLA 2X05A 3VNIA 1ICSA 1UOZA 3BAIA 2AAAA 4KEVA 3BG3A 5FACA 4CNPA 2O4QA 3PANA 3LBOA 4KGLA 3ZT5A 2EBNA 2J6XA 4PUWA 2F6UA 1GOOA 3GXMA 3AWOA 5GPRA 4QP0A 1WZAA 3UXDA 4J3SA 4MUZA 5CJMA 4GHRA 3S5NA 1TPUA 3VU2A 2QUMA 1TWZA 3TZFA 1CTNA 2XHYA 4IF2A 1UZ4A 1G94A 1AODA 2YKKA 1RQEA 3JW7A 4C6QA 4ICNA 2DQWA 3H6OA 1DXEA 4CU6A 4G9PA 3DI1A 3AXXA 3M44A 3WEZA 4AZGA 1O1HA 3WD0A 2Z2UA 4JTKA 4DUWA 4WX2A 4WDWA 1FH9A 4HZ8A 3D46A 1XGDA 4QQUA 4O52A 2WNQA 2AQOA 4GXMA 4KRTA 5D9MA 1UBSA 4MB4A 4XZIA 3FA4A 1EDTA 1THFD 2AMXA 2QULA 2A3HA 2ZZ4A 3IIXA 3GRIA 1X6LA 4TMCA 1DJGA 1GOQA 5C54A 2VFDA 3GXPA 3U4AA 3WEOA 3LMZA 4IFOA 4M7TA 4JIEA 4F66A 1F6KA 3RU6A 5I3DA 3XISA 4BQ2A 4LYPA 3KWSA 1R3QA 4LVGA 2WHLA 3WLSA 3SN0A 4IXXA 4P7RA 3UXLA 4P8XA 3ITVA 4JOMA 1IZCA 2BY3A 4PA8A 4JX6A 3W7QA 2BLEA 1QI5A 4J3VA 3UD6A 1J11A 4WDXA 2BG5A 3FDKA 3K8KA 5G2HA 3T2QA 2VKZG 1VFOA 5IFPA 1AMYA 5KZ6A 2J7HA 2ZZ6A 4H9YA 1HNYA 1FXQA 3ZO9A 4GYKA 3VD9A 3S1VA 2AMGA 1MI3A 4GACA 3EXRA 2POZA 3SQMA 2XWEA 4GG9A 4LCSA 4AWSA 3SCOA 1FQ0A 4GYPC 5FL1A 1B9ZA 5C0QA 4DUXA 4G2DA 3BK0A 5I3HA 1JRCA 2WLYA 2ZOXA 1C7SA 2OX4A 2VWSA 5EMJA 5BWFA 2E1WA 2EG7A 4MF4A 3G3MA 3VMPA 1TTPA 1XLIA 4HSNA 4HNNA 3VMNA 3C56A 3CQHA 3LV5A 1ADOA 4Y8FA 2G8ZA 3CLMA 2VEMA 3F2DA 3GVVA 3K4AA 1K7FA 1A5BA 2CBVA 3EMQA 3PBMA 3QH2A 4FLRA 3PJUA 3W7RA 3QTPA 3BW3A 2QXWA 4HNUA 3S1WA 4C6EA 4WXZA 1TUXA 4UQAA 3SJNA 3M0KA 3W27A 3ARPA 4TVUA 5A6BA 1WZKA 3HM7A 1OYCA 3GD6A 3WDPP 4NG3A 4OECA 3RN6A 3CHEA 4LB4A 2XVGA 1XIDA 1HW6A 2PGFA 1M41A 3HPXA 6REQB 2F6XA 1XRTA 3IK2A 4NL1A 2XGZA 4HZ6A 4LCRA 4WUIA 2CFFA 4WEVX 4B9YA 3CXOA 3WBEA 4GQBA 1WBHA 2DV0A 2YXXA 4C6JA 1NARA 1GORA 4PBGA 3GDTA 3W26A 1XDJA 3OA5A 4ZQNA 3RCNA 4GZJA 3QR0A 4C60A 4XV0A 5HK4A 3W83A 3QYQA 3WQ5A 2WYSA 4UNKA 3HGRA 5FF4A 2Y7FA 2NVAA 3IIVA 3BGJA 3FHQA 5E0CA 1I4NA 1VRDA 5HR6A 3F7JA 2QCCA 4HCDA 1JF5A 2W63A 4AD3A 3P80A 4IIGA 4DELA 2HNHA 1JNDA 2YFOA 5G4WA 1PJ9A 3CZEA 3NQAA 1JZ8A 1KBBA 5GNXA 4UZSA 3CB8A 4DYJA 2PCQA 4FXSA 3BAJA 1YDYA 3GDBA 4NJIA 4R7OA 5EB8A 4AVFA 3SCTA 3SRHA 3W2JA 2HDJA 1PKMA 1HFBA 3NDYA 3PBVA 4Y2WA 6A3HA 3SSZA 1QCWA 5EL1A 1MEWA 4L4MA 3VIGA 2C1GA 1ISVA 1ISXA 3VAVA 3UWVA 4AUBA 1J6OA 1UR9A 3WMCA 1XSKA 2WBGA 3NZQA 2JKAA 4F79A 1XBVA 1VCFA 1KLZA 1HF6A 3GS6A 3KZSA 3H7UA 1PUDA 1IT0A 3N2XA 3GZAA 2OU4A 1H2JA 2OSWA 4BWLC 2RKXA 2LLEA 2BXZA 4Q4MA 3VZYA 3GC5A 4YTRA 5K9CA 3MT1A 1OB0A 1KXQA 2D2OA 3PZUA 1EHAA 2XSAA 4GYPA 4KWUA 3WSUA 3INPA 3VE9A 1JNEA 4W88A 3HPFA 1RCQA 4M19A 2DZXA 4B3KA 3PTDA 1OFQA 3G6MA 4BI6A 3W24A 3FHAA 3MJYA 1HT6A 2XIIA 2WNNA 3T8QA 3TC3A 1UP3A 3HV9A 4E8CA 5H2ZA 4MNKA 3PZVA 1NAL1 3DN5A 3LN3A 3RO6A 3ZIZA 2OSXA 1R2TA 2XFFA 1BVNP 3E96A 2J47A 1NQ6A 4LUJA 2HXTA 2CESA 4RLIA 2XZ7A 3P61A 5ABFB 5FJUA 3W1MA 2DZUA 2WCGA 1WV2A 2DSUA 2PB1A 2E4TA 4HPJA 2XG9A 3BPWA 5D8ZA 4Z2HA 2DZAA 3RRAA 1DIEA 1W3HA 4C6NA 4P8VA 3TVAA 3KCJA 3LTYA 3N13A 1FHUA 4YIWA 5K3VA 1NF0A 2J78A 3Q45A 2Z1WA 3LRLA 4JY8A 4UMCA 4W8BA 2BODX 2Z27A 4YHEA 3EXSA 1IZJA 4U3CA 4PMRA 2QCDA 1V6YA 2ZUVA 5FAGA 1YX1A 2Y8KA 5K7JA 5JIWA 5A6KA 1G4SA 1D8WA 2ZWZA 3NYZA 3MP3A 1AA1B 3AS2A 4AX6A 3C5QA 3MMDA 4EIVA 6XIMA 2Y5JA 3MP4A 2V5JA 2Y62A 4UTHA 1UASA 1OCQA 4RKAA 4EVZA 2ZE3A 3Q58A 2PP1A 3GVQA 4M56A 3AMDA 4O54A 2TAAA 4HMNA 2FZ9A 2JF7A 3DDMA 4I90A 2HS8A 3ZR4A 3S6TA 4RCXA 4BKNA 5I02A 4FI4A 1CGTA 4Q32A 4UIOA 1PE1A 3TMLA 2DSVA 4UBPC 4XQ6A 1FDYA 3CV6A 5E93A 3ZLGA 4J3TA 4JL1A 4M1RA 3BAWA 3SI9A 3TR9A 3MSYA 3W0KA 1KRCC 2ZVIA 1DTUA 4JEJA 1TFVA 1Q13A 2C19A 1H63A 2CKRA 1TCDA 2VCCA 4D1JA 2ZQ0A 1QOXA 1XGZA 4XAGA 2WHKA 1VJIA 2REQB 3FN9A 3PAJA 4N9CA 3WK1A 2A85A 3B8IA 3WNOA 2H3DA 4MFDA 5DT5A 4WD0A 2PC8A 1REQB 2FPTA 4R27A 2X8RA 4RDWA 1D3HA 1TV5A 3UPMA 4BWLA 5DFAA 5U4NA 5C2CA 4DBWA 1OK4A 1JZ5A 1PEZA 2H90A 3NO1A 4M0XA 2DIKA 2VEFA 2WM1A 3ZT6A 3PZOA 3TA6A 3AYVA 1M65A 1PCWA 1WCGA 1ZENA 1X6UA 3WJSA 1ZCCA 4S23A 1I2NA 3VNYA 1JCJA 4ZQCA 2X1IA 1XV8A 5FI8A 3ITXA 3VOIA 2I5IA 4UTUA 1VHCA 2J6VA 3EB3A 2WZEA 2HS6A 4PE8A 2CLKA 1TPC1 1RBAA 1YNYA 1E43A 3NO3A 4LX4A 1UG6A 1LQAA 4RDZA 3F4DA 1LQ0A 1UOKA 4CQAA 1GOKA 1WKYA 1AH4A 2QCGA 3V75A 2FZMA 3C61A 3TNOA 3VK5A 5B7ZA 3DXIA 1BHGA 3NOYA 3M5VA 2Z1VA 4IIEA 1G9HA 4G7EB 5BYWA 2A7PA 4JN7A 3ZSTA 4RPPA 3S2LA 1H60A 3PNZA 3RX4A 4QJ3B 3E0FA 4H6EA 2DVTA 4Z08A 3TWBA 2D3NA 1HTIA 2ACRA 2GGGA 1TPWA 5JBFA 2I7GA 1UKOA 5FF7A 4HHLA 4V27A 4CEXC 1V77A 3ZZ1A 5A6JA 5K4XA 2BY1A 3TN6A 5D37A 3W6YA 1E6NA 4GIEA 2WKLA 3CL6A 1R85A 1TE1A 3LD5A 4IXHA 4I9MA 2E8YA 4Q7IA 2OQYA 3LHYA 4YCPA 5CG7A 1U5VA 4W87A 1ITUA 1SYTA 1KTCA 4DJEC 5K9XA 5HMFA 1JG9A 3S5SA 4WHBA 1FWHC 3L0NA 5T26A 2YCJA 1QWGA 3CV2A 3O3RA 5CC3A 3R0UA 4NZ4A 3S3GA 2WQDA 2WOQA 4PMZA 1ISWA 1SW0A 1RD6A 4KRZA 2OSYA 4OBRA 1BG4A 5A6BD 4L80A 1O68A 1FHLA 3T0AA 3CHDA 3DGRA 2VDGA 2CLEA 2HROA 3FA3A 2QMJA 5HWJA 1TV8A 4LWWA 5A2CA 2Q3OA 3W73A 3UGVA 1CGYA 2WWDA 3WLKX 4ERIA 4H83A 2E25A 3S83A 4UXDA 3EKLA 1ZJBA 3WF4A 3UFYA 1G1YA 3NOEA 2JF6A 2R1MA 1SFJA 3PBWA 3PWIA 3MVTA 2ZUUA 1UWAA 2WLZA 1NWRA 1V3JA 5DLCA 5CJ5A 3K1DA 3OZPA 3CWNA 3KLLA 3PPCA 4ZR8A 4PODA 3LLXA 4TOQA 3W85A 3NQ6A 3LENA 4S3DA 1FWGC 5CPSA 3LPPA 3QN3A 4F0KA 2XINA 1TV7A 1XIIA 1Y5WA 3BUVA 3GUWA 4BI5A 4DZHA 2Y89A 3NPUA 3C2FA 5IHRA 4QTGA 3ABQA 3APGA 1BD0A 1XIBA 2XVKA 1YTDA 3G24A 1UPPA 1WO2A 1FWAC 1XKJA 3MPGA 3SDOA 3THDA 4FF5A 3QGKC 1SJDA 4JBRA 1Q85A 3W2UA 4PUNA 1K8ZA 4QIUA 4C6PA 1TJ1A 2VXNA 3K1GA 4IX2A 4ZGYA 4QR6A 1EEXA 2E6FA 4K8EA 3TFXA 1W8SA 4MVAA 2D1ZA 3MCMA 1BKHA 3CIWA 3VIHA 3CEUA 3BSHA 1YHTA 1WE5A 3H54A 2XGIA 2DW6A 2J8TA 1EJVC 4Q22A 4XZLX 3A4JA 3G3DA 2ZX9A 3W01A 4F0MA 5CPNA 2R24A 3WFAA 1L6YA 4LS1A 1OVDA 3E5BA 1XYBA 4HD5A 3AFBA 1OBAA 4QDMA 3ZVHB 3W7NA 4AW7A 3G1AA 2GJXB 2WMJA 4QG9A 3EWCA 3LLFA 3BTNA 5CZJA 2OG9A 5JH2A 3VNKA 2QIIA 4P7OA 1VC4A 4AU0A 3N3MA 1E0WA 2R1KA 3A3HA 4LB3A 1ME7A 6ALDA 4DLFA 3M4HA 2G3IA 1MO0A 3BSGA 1MDRA 4IMDA 3EX6A 4MWAC 3KZPA 3OU8A 4GJJA 4QDPA 1S39A 1POJA 2GPTA 5I77A 5JUVA 3UG3A 3MTWA 4WOQA 2ISFA 4CN1A 1FUYA 4S2BA 3S1XA 1MW3A 1LP6A 2FIQA 2WANA 4CNTA 4UFMA 2ISWA 2Y1HA 3PP7A 1V02A 2VZVA 1IV8A 3TONA 3LI1A 3KX6A 3A5VA 5FD0A 1TRDA 3L4VA 4B4HA 2PBOA 1EQPA 4DJEA 2HQAA 3AYRA 5CZTA 1GGOA 1LRTA 2O92A 4NNAA 1MFVA 1A4LA 1W8GA 4GVIA 3LCIA 4XZNX 3FSTA 1V3IA 1H7NA 3GLCA 4BHYA 2DT2A 4TVCA 5EKYA 2QJMA 4Z2KA 5PTDA 1NWUA 3GE7A 1FWFC 2Z4GA 3LPGA 3WX7A 1CENA 2V69A 4Y90A 3SY8A 4CCEA 1XPGA 2CHRA 3HN3A 3NUKA 4GYJA 3NWRA 2PDNA 2Q01A 1LWJA 3RLUA 5E9XA 4OT7A 3WUBA 4RDVA 5XIAA 1C9DA 1WDWA 3G1DA 3NQ8A 3W07A 3SN4A 2Y61A 4AWTA 2E7FA 2O0TA 5XIMA 3L5MA 4N4PA 1V6WA 3H4XA 4UB9A 1OYAA 5HA7A 3BQ6A 1IGSA 1C7TA 4KEZA 1YMYA 4N7QA 3NPXA 1S2VA 2BX7A 3RR4A 4CD7A 4A29A 3UCCA 2HV5A 4OGZA 1M7PA 2YYTA 1M7OA 2FLIA 4JTCA 4H4IA 2BXVA 2QNEA 1GJUA 3CH0A 4EPBC 4O50A 4C5ZA 5IFTA 3USBA 3KP1A 1R3TA 4FF7A 3IPWA 3P74A 3O8AA 3AZRA 2BVTA 4X60A 1ZLPA 1UUOA 5E5CA 2GSJA 3ELFA 3MUY1 3VNMA 1RQHA 4ZQRA 4FIQA 2IQDA 1BYBA 2E6YA 5A8OA 3BL3A 2VCAA 5KMYA 3E2VA 3U2ZA 3ITOA 3THUA 4GK8A 1V0KA 2O9TA 1US2A 1OG6A 2FDSA 1XIMA 4I5XA 4LSBA 4UTMA 4GFSA 1QNPA 1EC7A 2WNZA 1DIOA 1NDWA 2Q8LA 1NP2A 1QO5A 4UMBA 4YVPA 3MQTA 4AD2A 1Q6FA 4CN6A 3VCCA 2QGYA 1SM9A 3T08A 4NY2A 1GQJA 3AIEA 1OF6A 3W02A 4R5EA 5A6AA 3B06A 2PDYA 4MWAA 2Y5EA 4PN2A 4UQEA 4W84A 3CPRA 3G1RA 4LJ3A 5HUOA 1Z41A 2J7FA 4NIRA 4UTLA 5CC5A 3STCA 4QISA 3DHUA 2X0YA 4ZODA 1GVEA 3B4YA 3AO0A 3T1GA 4LVBA 5CZ0A 4EAYA 2WKJA 4FXJA 4YL2A 3PZQA 4HOXA 1V02E 4L9ZA 4J7RA 3FX4A 1XKYA 3O9NA 4DLMA 1ZL1A 2BASA 5HWMA 2VI0A 3SGGA 1BYCA 4H2HA 5BRPA 2BVWA 1ZAIA 4N9BA 2XTKA 5C9WA 4JTFA 4NX0A 1TWDA 1P1XA 5BOEA 3SIMA 2I1OA 3OGSA 4R85A 1MW1A 2XN0A 1Q8JA 1NEYA 4EPKA 1ODZA 1WKDA 1OD8A 3M46A 9XIMA 4DNMA 4QX4A 1M3UA 3AYSA 3ZSSA 1A80A 5LXEA 4CNUA 2DY3A 3EPOA 3VDGA 4FP1A 2FMOA 2J7BA 3A47A 3QFWA 1C9WA 2VC7A 4KWWA 5FSEC 3N73A 2H8ZA 4JTAA 8RUCA 2Q8ZA 2A7RA 1W1VA 2G3JA 5A6TC 3WDHA 1BVWA 2PLKA 1F07A 3W29A 3LSCA 3AJXA 3OHMB 1FWRA 4FNRA 3KCLA 5FSDC 1CIUA 4HBKA 3U5YA 2XVNA 1BAGA 1E6XM 1BXNA 4CQBA 3N18A 4DUVA 3IAQA 3WQVA 4RNFA 2PWDA 3W2MA 3N19B 3WH5A 2W79A 4HN4A 5DBTA 2ISDA 2VGBA 1J0JA 3OLDA 2QQ6A 5C9RA 3QKZA 4HHHA 3UWWA 1OIFA 2XJ7A 1QW8A 4M82A 1XM3A 3KTCA 3OYZA 1CBGA 2PMQA 2VMFA 2RDXA 4UWMA 4XAYA 2G50A 3HQOA 1E1CB 2WCAA 4ZO7A 3HIJA 3UETA 2NQHA 1XYLA 5FEZA 1MNZA 1TX0A 5IOBA 1J96A 4HK5A 3GG8A 1OADA 3NZPA 3LXBA 5REQB 4C6BA 1KFJA 1W5OA 4S3FA 3TTEA 4H6QA 2DU2A 2NT0A 3TXZA 3S8HA 2D2GA 3GTXA 1M9HA 1OFAA 4LYQA 4C7GA 3NYDA 3MHGA 3BAXA 5CXPA 5I3KA 1YXDA 1L2UA 2QVHA 5M5DA 3RM8A 3SJ3A 3BMXA 1SZFA 4ZE4A 1KBKA 1G7VA 1KXHA 3MI3A 1IEVA 4IG2A 2J7GA 1UKQA 2AQWA 3CT2A 5HNRA 4AF0B 4GOAA 5DXXA 4AEEA 3ATYA 2XIJA 4ZTYA 3RYSA 3N6HA 4N2YA 3T2OA 3NM3A 3TWAA 4LC8A 2ZDSA 2VGGA 3HMCA 1QNSA 1UW9A 2FJUB 4MWAE 2RUSA 4M1BA 4JQ1A 2JGYA 4C91A 1JCMP 5D2XA 3UG4A 1B3YA 2VGFA 1TVLA 3W7KA 1W54A 3RNDA 3B9DA 1BF2A 2OLSA 3H2NA 1U33A 3W1PA 3IANA 1K6AA 1PXGA 3RF9A 3S2CA 4I9JA 3E02A 1CLKA 4K37A 1KFEA 3TXVA 2HWGA 4ZQPA 4DWSB 3USZA 5KZDA 2W3ZA 4UUIA 4GRSA 1X7IA 5HOSA 3CZKA 3SUVA 4BZYA 2V82A 1TJ2A 2RH9A 3F03K 3PBYA 4X3ZA 2D23A 3MMTA 1KBLA 4ZA0A 1IR2A 4US5A 1O4UA 3E1F1 1FWJC 3KEHA 2IKIA 3MDWA 1ONXA 1K8XA 1ONEA 4XUYA 1CLXA 3KE0A 1PIFA 3VDHA 2OCZA 3CYVA 3DOPA 4K68A 4XVDA 1A5CA 3CUGA 2QF7A 1TZ9A 1OGBA 4AY7A 2VYOA 2A1YA 3NJ3A 3LUTA 2DUAA 3S2NA 3NVTA 1C8VA 1E15A 1FVPA 2JKPA 1WUEA 4EKJA 3B9NA 2PRHA 3UJSA 1QJWA 3NAVA 3AS0A 4ORMA 1NTHA 1YTEA 3CNYA 1YTKA 2E40A 1HKWA 2EG6A 5GVJA 3KL5A 3ISIX 2C15A 3CV7A 3UG8A 3MUZ1 5DELA 4UR7A 2GVYA 1H1YA 1EHNA 3T09A 1HL2A 4X9SA 1J01A 3UA4A 3M0ZA 2XH7A 1W5PA 1J0HA 4K2SA 3EEGA 3SRFA 2A0NA 1HO1A 3EOUA 2PODA 1FWDC 3N17A 2ATMA 3UJEA 4DVOA 3VNZA 3FVMA 3IJ6A 2G4JA 1FCUA 3M0MA 1VH7A 3H24A 3CUJA 4WGHA 1H51A 3QBUA 1HKVA 1VAHA 4BEUA 3M1ZA 3IVTA 1E6QM 2VZUA 4XSLA 2V5DA 1EWEA 3LA4A 2ZDRA 1PTAA 3ARTA 4BCEA 2QJJA 1NQKA 2J24A 4ZSUA 5LYRA 3W6LA 1JD7A 1MFUA 4MNJA 3H55A 2WMFA 3FS2A 2DGAA 4JQAA 1VJZA 2PLCA 2PDMA 1FBAA 2CBUA 3PZ9A 3DERA 4PMOA 3VOCA 4UCGA 1BF6A 2WHMA 3RILA 2FPVA 4HA1A 1UYQA 3ITYA 2Y63A 4Y96A 4AAJA 1M03A 2I17A 3P5YA 1Y5XA 4NJHA 1XYZA 5EFDA 2CHNA 1QW9A 1P48A 3LHWA 1G0CA 4UTWC 4DF1A 4V1YA 1GVSA 4O8RA 5AYXA 3R25A 4C1NB 1GPWA 2BV9A 1K6WA 2PDWA 3LQGA 1C93A 4NILA 3NDZA 6REQA 1ME9A 2J77A 3MBFA 4NAFB 4MDOA 2CBJA 8A3HA 1RPXA 1YRRA 3RLHA 2YOCA 3Q37A 1F76A 3WNPA 4O53A 3UZYA 4MY1A 4WIWA 2H6RA 4AYSA 4AYGA 3LM3A 5M03A 4G56A 1SZRA 1UIOA 4AIUA 1BTMA 1L8NA 1R5YA 2V2CA 1XLCA 1EYWA 3NR0A 4ACZB 2YDAA 1D3CA 4M6QA 3L65A 2BXYA 3ECQA 3MZNA 1G01A 1O94A 2B0MA 2YA2A 4YU1A 3WIJA 2ATSA 3EWUA 7TAAA 2Z7GA 4C5YA 2YW4A 1A53A 5BROA 5FEPA 5A8MA 1ZALA 4LAZA 1JUEA 2YR1A 1EIBA 1AFSA 1T99A 1AUSL 4JTQA 4F2TA 2CITA 3E0IA 5CPTA 1Z44A 3TFCA 4ATDA 4ZO6A 5ABHA 1UR8A 2Y24A 2WC3A 4WJ8A 2C1HA 4MWAD 1R6WA 3HO8A 2ZC8A 1BGAA 3WQWA 1J2BA 1T40A 1Z32X 1OT1A 1DXFA 4YNGA 1ESWA 3GO2A 1H11A 4XKYA 3M16A 4XD5A 4FNTA 3UWYA 3WNLA 2P53A 4Y9NA 4IM4A 3EWDA 2GGEA 2VOTA 2QAFA 4AFYA 2VTFA 3A21A 3KWXA 2PP0A 4PTWA 4TO8A 2YYUA 3DX5A 2OT1A 3FJNA 1MUMA 4H1ZA 4WDTA 2NUYA 3NM1A 1J0YA 1XQKA 1ZP4A 3H26A 5JMUA 4DJFD 3GYCA 1GOMA 1HKMA 5CSRA 3VGHA 4DIAA 4LFYA 1ICPA 3EX4A 3I6EA 5G2IA 3TIMA 3VM7A 3CLWA 4QQ3A 5FEWA 2YIHA 2PAJA 1AH0A 3SCQA 2P3ZA 5EA9A 2DH2A 3K2GA 2J75A 2ON3A 4HNCA 3ITLA 5J5RA 3WQPA 2IMRA 1O66A 3C0QA 4Q8TA 3EBVA 2INZA 4HK6A 3VTRA 3U2OA 5CPQA 4IP7A 3QQ0A 2NSXA 4HHPA 1DKWA 4I5UA 4LXFA 2QPSA 1X6NA 2VT0A 3ITCA 9RUBA 4DJDD 3QXBA 2EJAA 3OQ8A 3WH6A 5A2AA 1XLGA 4UTWA 4N02A 4XWUA 4H8HA 4JXCA 1KRBC 4DO4A 3OP2A 1T96A 2VZOA 2G95A 3QC0A 1RK6A 2GQ3A 1D9EA 3FAXA 2Q6ZA 4KH2A 1PVNA 2CLOA 5DANA 3JUGA 3QW4B 4M6VA 5T8GA 1RQBA 3W1UA 1EFZA 4LUTB 3H2OA 3Q65A 2DZSA 4M5PA 2WAGA 1A5NC 4PTDA 2GZXA 1VIWA 3GKAA 1IF2A 3MKKA 3SQSA 1FWBC 4QROA 1OCNA 3HF3A 4E2DA 4IWWA 1ZZMA 5TQLA 3ME3A 3IV3A 4JFVA 5CAHA 2PU1A 1NDZA 3BICA 3WN6A 2DZTA 3GU2A 4OTKA 4GUJA 1JVNA 4RZ5A 4S3GA 1MEHA 1EUNA 5HANA 2D2HA 4BFAA 4NZFA 4H01A 3M9YA 1D7FA 4UNLA 3CUZA 2P5NA 2I16A 1VFLA 3A5FA 3PZNA 1QPNA 4HU8A 1OGSA 1AG1O 4DYEA 5I3IA 2F84A 3KRBA 3WJYA 3WUFA 1E51A 4H9MA 2BHUA 4MKVA 4YVVA 3N04A 4K7VA 2X0SA 1UQYA 4X0VA 5F2GA 4NUWA 4XIAA 5AHNA 5CGQA 1OFEA 4U2YA 2EPOA 2D2JA 3JVAA 3LPFA 2DT3A 1RA0A 1LLWA 2VOMA 4LY4A 4IJBA 4XVEA 5C2XA 4GX9A 1VBGA 1DHPA 2NWRA 3FDGA 4RR4A 3AMGA 1FKWA 3W7HA 5D9PA 4MTVA 3ZMRA 1DYSA 4URIA 5JBDA 2OR2A 4FB7A 2REQA 4FX6M 3W7PA 3UXKA 1PKNA 1GEHA 1DORA 3EDJA 1JZ3A 1KD0A 4IMEA 3QY8A 4KPLA 4JIRA 4KIRA 3TLQA 4IISA 1W17A 1UWUA 4YTQA 4DPQA 5BRBA 4H7CA 1O5XA 3TC7A 2GVLA 3CYJA 1E56A 5D2VA 3WD3A 1KKRA 1Z6KA 1X98A 4JDYA 2F61A 3OIXA 3W82A 1QR7A 3CQIA 4AHOA 5GNZA 2W67A 1H50A 1OX6A 4KKXA 2C8NA 4H7ZA 4YCOA 1QOPA 3ENLA 1BQGA 4CGTA 1F8IA 1CXHA 4XAZA 1L9WA 3WDQA 4AIEA 3TDFA 4WSHA 3GWQA 4JTJA 1GZ1A 3GHUA 3SIZA 1J18A 5BXPA 3EDFA 3QYSA 4NP7A 1UROA 2GK1B 2OO6A 4UFHA 3T8LA 5CBIA 1V0MA 2Q3RA 4HKPA 2F7FA 3NEVA 2OZTA 2PD5A 4IGNA 2Y7DA 2VEIA 5G1MA 2X1SA 2ZX7A 3EPNA 4ZXOA 1K1DA 1DIKA 4LBSA 7CGTA 1ZFJA 2OZ3A 3QOMA 2CZDA 2BZNA 3IUDA 4P7LA 4RE3A 3I4KA 4G7EA 1S5VA 5IXEA 2J74A 1R2SA 1LM1A 4HB7A 2CZFA 3T0DA 3C86A 3WH8A 5LNWA 2DZWA 2DJLA 2I14A 2WJZA 4UFJA 4TTGA 1XW8A 1A49A 4S1FA 3UXAA 1WDQA 3BANA 3GDRA 4BQ5A 5C6MA 1S5TA 1GWJA 5TAOA 3WNMA 1RA5A 2OWCA 1XLHA 1F4AA 1ONRA 2PWGA 3D3AA 1WOAA 2VM8A 5FJRA 3EZ4A 3RPDA 3QFEA 5H8UA 1DE5A 1JFHA 3P82A 4LGXA 1FP9A 3OODA 1JIBA 1XINA 3TH6A 1TVNA 4A2RA 3R0KA 2EG8A 5JBEA 3VKAA 3J7HA 1KFBA 5FOOA 3NQFA 4IJCA 3EWXA 4MAVA 3NIYA 2C3ZA 4JNYA 1EP3A 1U2YA 4O0QA 3BE7A 1JYVA 4OHQA 3ATZA 2G37A 4CCZA 1Z9AA 4F9DA 4IIDA 3D0CA 3AJ7A 3RRXA 1VFTA 2IPFA 4KEMA 2CEQA 3BZGA 1H41A 3ABSA 1R3SA 4KQNA 4QS5A 3ZJKA 4C6CA 1HGYA 3THQA 3G8RA 4N4QA 1PWMA 1N82A 2OXNA 5A6LA 4MZ8A 4HVXA 1B54A 4XZWA 1SO3A 3FA5A 3DFPA 4LCQA 1CB2A 3R89A 3IWPA 3PUEA 1PHWA 1RBLA 1W1TA 4NF7A 3NSNA 1R8LA 2PF0A 4ILSA 4CD6A 3GM8A 1LDCA 4W8LA 3WBAA 1F2JA 8XIAA 4C90A 3SEPA 3BV7A 3GHRA 4Q4PA 1DPMA 4W4QA 4JAWA 4EPEC 5TF0A 1W91A 1SSDA 5D33A 3DYOA 3MSRA 4IP4A 1ML1A 1B3WA 3DU0A 3GU9A 1XXXA 3F4NA 3IJLA 3U5UA 5DMMA 5FA5A 3SRDA 3SQLA 4AMCA 4C6MA 1QXLA 2BY2A 3P8IA 4LBUA 1P1MA 2G41A 2HVNA 2HJPA 5EMUA 1A50A 2V81A 5HPCA 1I60A 3HJEA 5F1UA 4YLWA 1DE6A 1W3LA 4RNIA 4F4RA 1VYPX 2PDXA 1UWRA 4XTDA 3R12A 3P81A 4XZHA 3W53A 1LCOA 1BRLB 5BCAA 3TTSA 1TA3B 3FXYA 4GISA 3R1ZA 4LT9A 1WZLA 1YBQA 2YSWA 2WSQA 1UCWA 2JEPA 1I45A 1XP3A 2D3LA 1J4EA 3BXWA 2DSWA 3AXMA 1G7UA 5HNNA 3W38A 4E2BA 2G3NA 4I6KA 1KTBA 4JYEA 2J7EA 4U2ZA 3ZVHA 4HSOA 3RGTA 2DT1A 1CCWB 4Q8PA 3CIVA 3TQ0A 3CEPA 5I6SA 1E0XA 4LV4A 4FX8A 1HZYA 1X1NA 2EPLX 4F3HA 3AZSA 3E6EA 4BY3A 1QAPA 3W1LA 1VYSX 1Q6GA 3CQKA 4ZVJA 2PDHA 4QSFA 2ALDA 3PG9A 2YBTA 1AVAA 1E6PA