2CYGA

Crystal structure at 1.45- resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESGWPSAGGGAEASTSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQKAGGIEQNFGLFYPNKQPVYQISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure at 1.45-A resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords beta-1, 3-glucananse
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cygA00
4M81A 5BYWA 4AZ6A 1BG9A 1K9TA 2GVYA 1GNXA 2BHYA 1NP0A 3ARTA 4CU6A 3WF0A 4TX6A 2XVKA 1JZ8A 1ISVA 1M01A 1QVBA 1E6SM 3ZT6A 3VIIA 3PZQA 2X05A 2IXVA 5HOSA 2YL5A 4WSKA 1VBUA 1JFXA 4PN2A 5CPQA 3GH5A 2V5DA 4PUEA 1W9UA 2NT0A 4TVDA 1RP9A 2E0PA 1G5AA 5D8WA 4B15A 3WD3A 4AD3A 1W3JA 2WB5A 1Q6CA 1EQCA 1UOKA 1Q6GA 2XVLA 3MUAA 1OIMA 1HP5A 2CCRA 3QR3A 2Z1SA 1NH6A 4P8VA 1Q4NX 2PI6A 3ZT5A 2CESA 4OUEA 5DT5A 3IAQA 4W8AA 2WSPA 2XG9A 1BLIA 1FHLA 4MB4A 2WWCA 3WUEA 2F8QA 1ISYA 4RE4A 3WBEA 1QNPA 2OYMA 3WFZA 4IM4A 2ZX5A 1E55A 3CTTA 2QMJA 5A6AA 1QBBA 1UZ4A 5D8ZA 3QHMA 4H41A 4UZUA 2W61A 2ZUUA 3PZMA 4AD5A 5A2CA 1C8QA 2PBOA 1E40A 1XH1A 4F8XA 4B16A 4ZE5A 4EE9A 2YA0A 3TTYA 4XZBA 4V28A 5A8PA 2XPKA 2WKLA 1MW1A 2E9BA 1ISZA 3VDAA 2CXGA 4PMQA 1JZ4A 1OWQA 1JL8A 5A6SA 3WD0A 3W38A 4UQCA 4ATWA 2A3EA 3NJ3A 4W5UA 4KWUA 3WQ6A 3AIEA 4CD5A 3VDCA 1UQZA 5KZ6A 3UESA 1VRXA 3D3AA 3A4XA 1VENA 1E0XA 1QI0A 1EGZA 3VUPA 2GK1A 4JL2A 2G3IA 3SURA 3RDKA 3AMGA 3T2PA 2DIJA 3MUY1 1MQQA 4ATDA 1R87A 4J3UA 5A2BA 1EDGA 2YL8A 1UH2A 3ZJKA 5AC4A 2VCBA 3IJ7A 3IK2A 2CHNA 1R85A 3CHDA 3OGSA 1E70M 4XB3A 1WO2A 1UKQA 4JFTA 2GJPA 2QLYA 2VRKA 3WDJA 1HJSA 2IUZA 5GNZA 1J0HA 1K9FA 1BYCA 4M56A 1C8XA 2PB1A 1B30A 1TG7A 3F5KA 4ACZB 3TTOA 4AIUA 3SCWA 2A3CA 1HKKA 1Q6EA 2EO7A 4U3CA 1BAGA 3VGEA 5DEZA 3WL0A 3W6MA 4GI9A 1WB0A 2W66A 4V27A 3SCNA 4BZYA 3S6TA 1ODZA 4LGXA 2ZUWA 1NOWA 2CHOA 2XSAA 4OIFA 4D6GA 5A8NA 4NSBA 1TCMA 5GQBA 1MWOA 1PAMA 3OLDA 3CMGA 1W1VA 3AOFA 3AYSA 5CLWA 3VMPA 2J7CA 1ITCA 3OGRA 1XRVA 4Z2JA 3GH4A 1U30A 3EDEA 4QAWA 3NCOA 4AEFA 7TAAA 3UETA 1K9EA 2WKGA 1J01A 2GDVA 2VX5A 2GJRA 4HU0A 4GO8A 2WXDM 1SYTA 4D6DA 2PWGA 3O6AA 2XUCA 2D0FA 4L4PA 1R7OA 3T0DA 4D1JA 3BH4A 3K46A 1RP8A 2F2HA 1JXJA 4JCLA 4D1IA 3WELA 3MKKA 2QF8A 1CEOA 5A95A 3N15A 2CBVA 1JIBA 3QOMA 1UUQA 2EBNA 4MNLA 1EXPA 2CBIA 3W82A 2OWWA 4A3HA 2VQUA 1KGUA 1HX0A 3LPFA 3FY1A 2DSKA 4Y7EA 1KWKA 4U2YA 2W5FA 2VX7A 4Z2LA 1B3YA 1W9XA 1ISXA 5M03A 5JIWA 3SCRA 3BAWA 4XUYA 4HP5A 2WC3A 2VC9A 1WDRA 3CUIA 4DWSC 5E9AA 3VGGA 1OCQA 4NRSA 3WQ4A 1MQRA 1UD5A 2BY0A 4GKLA 2JEQA 2WMGA 1V08A 5A6KA 3SCTA 1GOOA 1E6NA 5CZKA 2WCGA 3MANA 2GDUA 1GJWA 1VEOA 1UWQA 3GXMA 4WIWA 4BA0A 4PTXA 1NOUA 1JYNA 5D4YA 3WH7A 2WVTA 4PSPA 2ZUTA 3WNPA 4MAVA 1JG9A 4ZXOA 1E4IA 2D3NA 4HOWA 3POHA 2G3NA 1G9HA 4XZWA 1E43A 1OB0A 1E6ZA 1GQIA 3SUUA 4CD7A 3K4AA 2GK1B 5A69A 4MPKA 5BCAA 4BQ4A 3ARXA 3G6LA 3N12A 3T09A 4J3VA 1XH2A 2EPLX 2VX6A 4DUVA 5F7UA 1UD8A 2YBUA 4FMVA 2X2YA 4W7WA 3RM9A 2WVVA 3TP4A 4ACYA 4OKDA 3II1A 4PTVA 1CDGA 4IPNB 3AMDA 1TR1A 2D1ZA 4F9DA 3N18A 3I3BA 1GORA 1FH7A 3EBVA 2J77A 4KH2A 3POCA 4EAMA 2YJQA 3AFBA 1KWGA 1ZS2A 5BXPA 1UD6A 4J3SA 2JIEA 3AXXA 6A3HA 1BPLB 1ZBCA 3VX0A 4GI6A 3AIVA 1OD0A 4UFLA 1UH4A 3FHQA 1CLVA 4U3AA 4HOXA 5GNYA 5A8MA 3BC9A 1FP9A 1PJ9A 1F4AA 4LX4A 2JEPA 1J0JA 4P8WA 4D6FA 3VIOA 1LWJA 1E56A 3W25A 4HMCA 1CZ1A 1W9BM 3WMCA 3BCFA 3CPUA 4K68A 1J0YA 1JI1A 2ZUMA 4D6IA 5ABEA 1NP2A 4JZ5A 1KFWA 4B3KA 4HMEA 5CG0A 1ECEA 1KQZA 1HKMA 1KGXA 2DT1A 3WDHA 3SUTA 4C7GA 5A94A 3NSMA 3WF3A 2EJ1A 5A6BA 4UNIA 1JYVA 2VCAA 5A6JA 3GBEA 3DHPA 3U5YA 4N0RA 4GZJA 2V38A 2UY4A 3RIKA 4OJYA 4LYPA 3VDHA 5E09A 1XSJA 3CUGA 4ATLA 3MSGA 3EDFA 1OGGA 2J7DA 1V6UA 2WW5A 3D5HA 1B31A 1CXEA 1WZAA 4LYRA 4AC1X 4UCFA 5EFDA 2DH2A 3ZSSA 3GNOA 2XWDA 2WMKA 1E1FA 3EYPA 1CLXA 4CU8A 3LPPA 2DEPA 1GOQA 4GIAA 2WBGA 1EH9A 3EMCA 1G0CA 1CXHA 4D72A 4EANA 2XVPA 5I5RA 4B9YA 1BVNP 3GH7A 3WMBA 1H09A 2J25A 5GPRA 2OYLA 5BRQA 3GNRA 5AYBA 5I6SA 4HA4A 4FK9A 5ABGA 1KBBA 1NQ6A 1L0PA 1GQKA 1DWIM 1JAEA 2WHJA 1FH9A 3BXWA 3OGVA 3AMKA 1C93A 1GUVA 1PIFA 4JFWA 1XCWA 3RJXA 6CGTA 3NDZA 2CIPA 2PWEA 2E40A 4M1RA 2BNJA 1QW9A 3AIRA 2ZX9A 1H49A 3WUGA 2IXUA 4M80A 4HOZA 1DP0A 2DIEA 1HVQA 1LL6A 1IV8A 1UWSA 1QNRA 2VJXA 3AS2A 3AHTA 2WC7A 4AY1A 5HPCA 1WZMA 2UY2A 3SCPA 3T08A 3AXHA 1V3JA 5EFFA 4DUXA 2A3HA 3WY1A 1JZ2A 1E4LA 3E1F1 3VIFA 1C3FA 1JFHA 2NW0A 1TA3B 3VVGA 2XJ7A 2YOCA 3K8KA 3ARPA 1WCGA 2UY5A 5A6LA 1H4PA 3AS3A 5I3DA 1JGIA 3UEQA 4L4OA 1X6LA 3PTQA 1HJWA 1KB3A 1K9DA 2E9LA 3GDBA 1H11A 4JHOA 3QHNA 3GM8A 4J3TA 2XWEA 3VD9A 3UG5A 1QI2A 1UG6A 4WKHA 3ZJ7A 1AQMA 3RCNA 4TXEA 1CXIA 1UD2A 2YBTA 1JF6A 2VNCA 3L2LA 4TVUA 1FFRA 3AZRA 4ZFMA 1TUXA 1V6XA 2J7HA 3WD4A 3BGAA 1EHAA 1CTNA 1XYFA 2W4XA 2OLHA 3BLKA 1L8NA 1HF6A 1R7AA 1W3KA 4MAZA 1DWAM 4R5EA 3VKKA 1JZ3A 2ESCA 3SCVA 3W37A 1W32A 4X0VA 4TOQA 1UWRA 1PIGA 2BVDA 1GCYA 2E8ZA 1JDDA 1XD1A 4U2ZA 1SR0A 2X0YA 3WNOA 4AYSA 1W1YA 4J3XA 4DM2A 1JZ7A 1HXJA 1VJZA 3AXIA 3CUFA 2W67A 5IFPA 2MANA 2ZUVA 3DC0A 2W92A 3RMEA 3O9NA 1ITXA 4MB3A 4P7QA 2RGLA 4YHGA 4Z2KA 2BY3A 1I1WA 3ZSTA 5ABFB 3PZTA 3GXFA 1CXKA 3MO4A 3WQVA 3ZO9A 1ZJBA 1PZ2A 1KXQA 2DSWA 4UFIA 3IJ9A 2DT2A 4X0NA 1UWUA 1E6PA 1PX8A 1V03A 1DWHM 5I78A 4AD0A 1HJUA 1MXDA 4JCMA 4W84A 3SCQA 1O6IA 1PPIA 3N13A 5CSYA 3FAWA 1MFVA 1GZJA 2VURA 4J28A 3A6OA 4HU8A 1MVYA 2X09A 1B0IA 4GO9A 4WKAA 2E3ZA 1UR9A 3L4YA 2PC8A 2ZXDA 1B90A 1W91A 4CCCA 3K4DA 3ZR6A 1CGWA 5CPSA 3FHAA 4M82A 4WSJA 4PMXA 3I3EA 1UWTA 2J79A 3AIWA 2WBKA 4D71A 3CIVA 1G94A 3LPOA 1NOFA 2O9OA 1MYRA 1WDPA 2FH6A 3VIKA 3T2QA 4OZOA 3RILA 4PCSA 4GZIA 4CN1A 1EIBA 2Q8XA 1VB9A 3EMZA 1QHOA 3M46A 4CCEA 1B3VA 5EBAA 2EPKX 1JYWA 1Q6DA 3WD2A 2G41A 7CGTA 1FA2A 3HN3A 1GQLA 4D6EA 2XVNA 1FOBA 3HJEA 1NWSA 1WPCA 1ZBWA 3VPLA 5IDIA 3MMDA 4TX8A 4UQBA 1JZ6A 2WHLA 4JAWA 3DHUA 2RGMA 4PMOA 5LA1A 4KRUA 2VOTA 3N1AA 8A3HA 2DSUA 1B9ZA 1DHKA 3ARSA 1X1NA 3ARYA 3UG4A 4QCEA 4W7VA 4J7RA 3GTNA 3OLEA 1H0IA 2ZXQA 1VBRA 4UQ9A 4TTUA 3MMWA 3AYRA 2J7GA 3MUIA 3WNLA 1G1YA 4U5IA 3KL5A 4W89A 2WVSA 3PTKA 5ECUA 3VGBA 2JE8A 1E0VA 3CBWA 1XV8A 4KRTA 2Y2WA 3OBAA 4PYSA 1GOIA 1XSKA 2HISA 2AAAA 1XHGA 3MU7A 2Y8VA 1CENA 4Q7NA 1UA3A 1C91A 1PX4A 3AZSA 3W24A 1AQ0A 3GZAA 2VRQA 2Y24A 3LMYA 1X6NA 2J7FA 4N42A 1JYXA 2OWCA 2WZIA 1XYZA 3W4RA 4UTFA 2WMIB 5I79A 2EPMX 1O7AA 4W5ZA 4X9YA 4PMYA 2WCSA 1QI5A 1QNQA 3M7SA 4WJXA 5IHSA 1XGZA 1ZL1A 1UKTA 5E70A 2PF0A 2VVNA 5E0FA 2G3JA 4PMDA 5I23A 1HJXA 2WLZA 4P7RA 4DWSB 2W63A 3N11A 3KL0A 3THDA 2YDRA 2EPOA 4PCTA 4AISA 3BMWA 3RM4A 2YL9A 3KWXA 4GINA 2BXZA 4H04A 1EOKA 5D9OA 3A47A 1LG2A 1W2PA 1C8YA 3VX1A 4QLKA 4MDOA 1Y7VA 4C7DA 2VZUA 4RL3A 2WCAA 5FOOA 1C7TA 3CH9A 2DPEA 1OM0A 4WLCA 3ARUA 1HVXA 1DWFM 2XIBA 2XYLA 4HZ6A 5A8QA 3ZQ9A 1US3A 3WNNA 2FGLA 4PEEA 3WFLA 1DEDA 1JAKA 4OBRA 1UH3A 2A3BA 1V6YA 1JD7A 4W85A 3T2OA 4D6CA 4PSRA 3MV01 3OZPA 3IAPA 3L4XA 4Z2IA 3WL1A 2V5CA 1CECA 2TAAA 1RH9A 3PZOA 4RE2A 5HDRA 1J0ZA 4JKMA 3OG2A 3U7VA 2WANA 2ZIDA 3SCOA 1XD0A 1LQ0A 1C90A 3CZJA 5FL0A 1KXHA 1CBGA 2VQTA 3AIUA 1TE1A 2CBJA 3ZMRA 3VIPA 3KL3A 1RPKA 3CHCA 1BTCA 1ZU8A 4HTYA 3AHXA 3HMCA 2ZX8A 1IT0A 2GFTA 3VIGA 2YLLA 4UQEA 1LJYA 5AY7A 2YL6A 4ZXLA 1E6XM 4QLLA 2J8GA 2E8YA 4MTVA 3ARVA 4AZHA 1E73M 1LG1A 3B9DA 2WLYA 1UKSA 2D3LA 3AMCA 1GQJA 2V3EA 1NWRA 1R86A 2WMIA 3L4UA 1XCXA 5C8BB 4PBGA 4W8BA 1HP4A 2YA2A 1QPKA 2XM2A 4W86A 1E71M 2G4FA 1ISWA 3VOCA 5CLTA 3BLPX 1ESWA 2FGZA 4W87A 2XFRA 5E6YA 3WF4A 2XM1A 3NYDA 3I3DA 2FDMA 2Z1KA 1E9LA 1C92A 2O9PA 1GW1A 3W26A 3AS1A 2J4GA 3APGA 3PZGA 4OBSA 2WAGA 1NARA 4JFUA 1TVPA 4KMQA 1GOMA 4NZCA 4CKQA 1QHPA 2BY2A 2J74A 2OSXA 2VMFA 5FD0A 7A3HA 1VEMA 4E8DA 4LQ1A 4Q22A 1XSIA 3L4TA 4FLQA 1BSIA 3WNMA 5IHRA 1JF5A 4A3YA 4H8HA 2DT3A 4PTMA 3OA5A 5FL1A 1E0WA 3WH8A 1EO5A 1B2YA 1NM9A 1OT2A 3FAXA 4RE3A 1CGVA 3PN8A 5D9MA 4F66A 5E0CA 1VFUA 3L4VA 2CEQA 2OWXA 1EHNA 2VZSA 2X1IA 3ZT7A 1E6RA 4GI8A 5CGMA 1S46A 4AIOA 1KXTA 4D6HA 1IZJA 2AMGA 4UFKA 1HL8A 2VCCA 3DYOA 1W3LA 4H2CA 1CXLA 1ODUA 5EB8A 1FFQA 3DYPA 3CZEA 1TFVA 3UG3A 3WEMA 1U33A 1HKIA 3AJ7A 4WK9A 1E3XA 5D9NA 2DDXA 1BYDA 5ABFA 3NIYA 2C7FA 2DT0A 2GSJA 3VTRA 1HIZA 1EOMA 2C8NA 4EK7A 1N82A 3QHOA 2XFYA 1LF1A 4W7UA 3N9KA 4ZENA 1J0IA 1KR1A 4H8VA 3TTQA 1V6WA 1US2A 2D2OA 3K8MA 2VO5A 4P7NA 1D7FA 2UWFA 4BF7A 3PHAA 4GQRA 4F9JA 2BHZA 2D0GA 1BG4A 3SCSA 2F61A 2GUYA 1B3XA 3THCA 3VINA 3RM8A 1GVYA 3MV11 2FHFA 3WDRA 3CO4A 1BYBA 5A6MA 3GBDA 1BFNA 1H3GA 1I75A 4UFHA 3AIBA 2EXOA 1GVIA 1TZ7A 1AMYA 1SFSA 3AROA 3UERA 1FH8A 1V0KA 1VAHA 2PWDA 2XTKA 2BVYA 4FLOA 2WMJA 1OIFA 3WH6A 4FLSA 2PWFA 1GJUA 1DWGM 1BGAA 3ZJ6A 2O9TA 3ALGA 1H41A 1QOXA 1V3MA 1UYQA 2HVMA 3VD3A 4AD4A 4AZ7A 1JDCA 3MSDA 1V02A 4JKLA 3RPMA 3CLWA 2V3GA 3SUVA 1BVZA 4J27A 1LLOA 4UOZA 3GXDA 3IANA 1TVNA 3A3HA 4P8UA 1WNOA 4QP0A 1E5JA 3OLIA 1VIWA 1V0LA 1BYAA 2D20A 3CZKA 2WSKA 2XVGA 3CUJA 4J3WA 1E3ZA 4JHZA 1LL7A 5CQ1A 3N17A 8CGTA 5A6BD 1HNYA 5HXMA 5M5DA 4BQ3A 4U33A 4DM1A 4IISA 3GYCA 4QDMA 5C70A 1UR4A 4P8XA 1VFMA 2VZOA 4KGJA 1ZBKA 4ZE4A 1UD3A 3TTSA 2XSBA 1MXGA 2ZX7A 4W8LA 3UR8A 3W29A 1UD4A 3O2LA 1OBAA 1J9YA 3DYMA 3GNPA 5DO8A 2ZE0A 3TOPA 2BVTA 3SUSA 2QPUA 3WQ8A 1NWUA 1WZKA 1GOWA 1UR1A 4OOUA 4E4PA 4PMZA 3A4WA 3BAYA 3AHVA 4CN6A 3TA9A 4S3KA 1CGYA 3AHZA 1J10A 3AQUA 3T0AA 3VGHA 3AI0A 1GHSA 4CGTA 3GXIA 4HPHA 3AS0A 2JIWA 3NDYA 4NI3A 2WNWA 2J8FA 1D2KA 3MUZ1 1A3HA 3DECA 1JNDA 3AIQA 3WIJA 1WZLA 1W2VA 1I1XA 4M29A 4M8UA 3WNKA 3VMOA 1W1PA 1HJVA 1OGSA 4AD2A 1J0KA 4BQ5A 4HA3A 5C71A 4HMDA 4M24A 1WKYA 1K6AA 4MADA 4Z2GA 2ZX6A 3AISA 3EDKA 3W6LA 1BHGA 1ZBVA 3BAKA 4PTWA 4UFMA 4B9ZA 3RO8A 5JUVA 3VD5A 3WENA 3G6MA 4HA1A 5HNNA 1EDTA 1V3LA 1W9DM 1H1NA 3EDJA 2YKKA 4PMNA 2JFEX 1H2JA 3VILA 4IUGA 1KCLA 4UZSA 4PMRA 4UR9A 4AZ5A 1CXFA 1V6VA 4XV0A 3RJYA 4A4AA 1OGBA 2YIHA 3M07A 3WQ5A 3WEOA 4B3LA 3WEZA 2OSWA 2VVSA 2XHYA 2CKSA 1TA3A 3PBGA 2XGBA 1M53A 2A3AA 4P7LA 4DWSA 5E6ZA 1JDAA 2V3DA 2C0HA 3U7BA 5DT7A 3K8LA 4PRWA 4JFSA 2E4TA 3VMNA 2Y4SA 4WKFA 4BQ2A 2D23A 3LPGA 1AVAA 4CCDA 1CPUA 2CYGA 2O92A 4BCEA 4TVCA 2FHBA 3PZUA 3WF2A 5JIPA 5LA0A 1UQYA 4CN4A 3FN9A 4Z2HA 1R8LA 1J11A 1UZ1A 3BMVA 5FCZA 5I24A 1QI3A 2DGAA 5A3HA 4MJ2A 2NT1A 1AQHA 3WBAA 3F5JA 1XC6A 3VU2A 1FHDA 1V3IA 3VO0A 1PZ3A 4S3JA 3BAXA 1CYGA 5BXSA 2BY1A 1F4HA 1QNOA 2WC4A 3CUHA 3BAIA 2YA1A 1BGGA 3WN6A 1GONA 1UWIA 3PTMA 4AXNA 1V3KA 3B9AA 1OD8A 3CMJA 3ARRA 2WPGA 3VD4A 1LL4A 3QGVA 4E2OA 5I77A 5KEZA 2BXYA 4AMCA 3IJ8A 5DMYA 3WD1A 1JD9A 4AZCB 2B31A 3KEHA 1V3HA 5JBDA 1W1TA 1PEZA 3NSXA 2ZOXA 1KXVA 3BCDA 2NSXA 5BXRA 1LWHA 3KZSA 5IFTA 2V3FA 3FW6A 3N04A 4JIEA 4MB5A 4CD8A 1CNVA 1WAWA 5AC5A 1KCKA 3W28A 1JI2A 4MNKA 3W0KA 4QCFA 2D0HA 4LYQA 4HPGA 2J47A 2WVVB 3W81A 5CPTA 3BSHA 3K1DA 4DWSD 1OT1A 4H7VA 2CPUA 1MQPA 4GZEA 4LPCA 2CITA 1B3WA 1EO7A 5BROA 4W93A 2DH3A 1E6QM 1IZKA 1WDSA 5D9PA 2ZXBA 1QNSA 3WKZA 4CVWA 2O9RA 1SMDA 5M17A 2J62A 1XH0A 1FP8A 1M03A 1UR8A 1KR0A 4AZCA 3VD7A 3WMSA 5A8OA 1KBKA 2OSYA 1BQCA 4FF5A 5ABHA 1P6WA 3CGTA 2JALA 5A2AA 1C7SA 5CGTA 1VFOA 4H8UA 2GJXB 2WMHA 4ACZA 4YHEA 1GPFA 5EMYA 2DSVA 3B8SA 4IPLA 3ECQA 3OIHA 3EDDA 3SCUA 2DQXA 3UCQA 1UKPA 3WUBA 3NSNA 2ZWYA 3OB8A 3PZ9A 2VUYA 4GQQA 5BXTA 1WE5A 1VF8A 1WP6A 3ZIZA 2VI0A 2PWHA 1KQYA 2QHAA 1QW8A 2CKRA 3SEPA 2WZEA 4OOZA 4YN5A 5BRPA 3WQWA 1ZJAA 3VGDA 1WDQA 2ZUNA 3MS8A 5A1AA 2J7EA 2Y8KA 5CJ5A 4CVUA 2VT0A 4EKJA 3AZTA 1HN1A 3M6DA 3AMLA 3FNDA 2X8RA 2WM0A 4UOJA 3PZNA 1E4MM 1QI4A 2JF7A 4CUCA 1TMQA 3MMUA 2W91A 5CXPA 3ARZA 2WVUA 1KGWA 1J18A 1G01A 5BWFA 2QPSA 5FIPA 5JBFA 1JZ5A 2XGIA 1J12A 3CHFA 2PBGA 3WDIA 4GPNA 1H5VA 4CD4A 1H0GA 2J7BA 3JUGA 4URIA 1EA9C 1ZB5A 4MB1A 5GNXA 4QFUA 1HJQA 2E9MA 2QMKA 2VRJA 3BSGA 2WHMA 3W27A 4TTGA 1W3HA 4UQAA 3CZ8A 2CBUA 4AZGA 5DFAA 2XIIA 3NUKA 1CGTA 4MNMA 4HZ7A 2CERA 3J7HA 5I0DA 1HKJA 4CD6A 3SIMA 3VGFA 3VM7A 5JBEA 3WF1A 1SMAA 1UR0A 3UR7A 4W88A 2VTFA 1E15A 4JKKA 2WZHA 4UQDA 3QOKA 3WH9A 2WK2A 3EMQA 4F79A 3VDBA 3CHEA 2VX4A 3SUWA 3A4AA 3VNZA 4AEEA 1V02E 2EPNA 4AZBA 5LA2A 3ARWA 2ZXAA 1YQ2A 1V0NA 1EDQA 1UHVA 2QV4A 3VIHA 4TUFA 2WWDA 2W62A 3ZR5A 1CGUA 3OZOA 2BS9A 1QBAA 1E5NA 3WDPP 4P7OA 4LXFA 4XX6A 2DSZA 1Z32X 1EQPA 1Q6FA 2GJXA 3ALFA 3AICA 5M3WA 4FLRA 1MW0A 4AW7A 2D22A 1RD6A 2BFGA 1W9PA 1GOKA 3W53A 1DTUA 4BS0A 3T0BA 2FHCA 2YDSA 1UR2A 2YLAA 2X0HA 5HPOA 3AHYA 4JFVA 4AIEA 2JF6A 1GHRA 3B9EA 3KE0A 2UY3A 3ARQA 4JL1A 1MW3A 2WYSA 3VIMA 2VZVA 1CWYA 3FXYA 2J78A 3VNYA 2ZUSA 3F5LA 3CZGA 4AZIA 3L4ZA 5CSUA 1OINA 1B3ZA 1PX3A 4KGLA 2CETA 5LYRA 1VFFA 2EQDA 3CZLA 1JNEA 6TAAA 1A47A 3VM5A 1QHZA 2EEXA 1MFUA 4YPJA 3S2CA 3WUFA 1MW2A 2AOSA 2ZICA 2VR4A 4GXPA 2VL4A 4PMVA 4AD1A 5HBFA 3WDQA 1D3CA 1NWTA 1W9VA 4MNJA 2CNCA 1E4NA 2WMFA 3U57A 4C7FA 2J75A 2FH8A 3PZIA 2Y5EA 4HZ8A 3VIJA 2BHUA 4PMUA 5FKYA 5I2UA 5IXEA 3U5UA 5TD4A 2ZWZA 2G3MA 2OYKA 4MDPA 3WH5A 1YHTA 5AYIA 1PBGA 1BF2A 3OLGA 3ZM8A 4WF7A 2YDQA 4D6JA 2VZTA 3L2MA 1OSEA 2VR5A 1VEPA 1DWJM 3WSUA 3ZJ8A 3TONA 3L4WA 1UA7A 3HU7A 1VJSA 2D24A 4V2XA 1E1EA 4DUWA 1JXKA 2G8ZA 4ML4A 4UOQA 1HT6A 2XFFA 1E72M 3PZVA 1CGXA 1V0MA 4UFJA 2BV9A 1M04A 3BAJA 1CIUA 4NRRA 5DF0A 1M7XA 4CU7A 4ZEPA 1HL9A 4U5KA 1U2YA 4R27A 2WHKA 4U31A 4NF7A 1B1YA 4QLJA 3F4VA 4MJ4A 4PUDA 9CGTA 1UKOA 3ZOAA 4E8CA 4AWEA
chains in the Genus database with same CATH superfamily
1PHQA 4MFEA 1BG9A 1K9TA 1X1OA 4DO5A 3PPCA 4Q33A 4Q8PA 3A4JA 4IFOA 3STEA 5XIAA 1GNXA 1M6JA 3DFOA 1NP0A 1PTDA 4O8AA 4XVEA 1IHIA 3WJWA 4MKVA 1ISVA 1M01A 1E6SM 4HK5A 4C6MA 2X05A 2GJLA 3BOFA 4PN2A 4F48A 3GH5A 3BANA 3RXZA 1EJUC 1M3UA 4NILA 1F76A 3GR4A 4FX8A 3NM1A 3HV9A 1YTKA 3MVIA 1OG0A 4BEQA 5HWNA 4AD3A 3V0TA 2WB5A 2P76A 2XINA 1OC6A 1EQCA 3MUAA 1OIMA 4NXSA 5G4WA 3N6HA 1GWJA 4J2MA 2E6FA 4P8VA 2PI6A 5MKGA 3IAQA 4JYFA 3STPA 3A13A 2XG9A 2SFPA 3WJXA 3FYYA 5CGQA 3WFZA 1FVPA 3VA8A 1UP2A 2ZX5A 4LCSA 3H7VA 1GK8A 3RF9A 2PDXA 2QMJA 3WLRA 3MCMA 1UZ4A 4H6QA 1Z41A 3PSWA 4UZUA 2ZUUA 4AD5A 1YX1A 4PUUA 4JTEA 2DZTA 3TTYA 2VKZG 2WKLA 3TQKA 4C6QA 2PDIA 4LUIA 3VDAA 2PP1A 1EJXC 4H4IA 2NVCA 2A3EA 3HPXA 3NQBA 1XIIA 4W5UA 1LUCA 1MDRA 4ZB2A 3VDCA 5KZ6A 1GKPA 3I7SA 1NEYA 1E0XA 3U8GA 1DJQA 5I3HA 3VNDA 2GK1A 4P61A 2REQA 2G3IA 3SURA 2V63A 3FA5A 2PTZA 3AMGA 2Y1HA 3K2GA 1MQQA 4L7ZA 3F4CA 2OOFA 4ZTYA 1NDYA 1UH2A 3IV8A 5FA5A 2VCBA 4DZIA 4GVHA 2WM1A 1BXCA 3CHDA 4XB3A 3MHUA 1TWWA 3RYSA 3BE7A 3AYVA 2VRKA 3F2DA 4DX3A 5GNZA 3P0WA 3P61A 2P1FA 1B30A 1MNZA 1ZFJA 4BFAA 1Z42A 4AIUA 3SCWA 2DUXA 1XDLA 4QG8A 3CMFA 4OUIA 1AW1A 3G1RA 1TMHA 3VGEA 4CQCA 3W6MA 3M0ZA 1Z44A 1WB0A 2HXTA 2W66A 4BZYA 3ZWTA 4YNGA 5IDZA 1ODZA 1EWEA 8XIAA 4LGXA 3I7QA 1NOWA 3L2IA 1ZQ5A 4JIPA 5A8NA 3RMJA 3T6CA 4DJED 4JTHA 2YZ5A 3AYSA 4DXKA 2XDFA 3OGRA 4PCFA 2VFDA 3W23A 1DYSA 2A3LA 1CI1A 4GIRA 2RDWA 3W3OA 3SI9A 2VX5A 1PUDA 1FDYA 3WQPA 4NJGA 2TODA 4IJRA 2D0FA 4L1WA 4L4PA 4L9YA 3BH4A 3K46A 1RP8A 4JCLA 1JXJA 4D1IA 5M2FX 3FXGA 2Y70A 1ZUAX 5A95A 3N15A 3HJZA 1UBPC 4C6LA 3GC2A 4LVDA 1UUQA 4MNLA 1TJ2A 4XTIA 4JTDA 4B5SA 3M7WA 3LG3A 2G3FA 3GHSA 3U9IA 4IIGA 5FF4A 4LVGA 2Z2BA 4OTKA 1KWKA 4YLWA 3W07A 1B3YA 1XISA 1V79A 4HP5A 4WVXA 1PVNA 3ABSA 4GJIA 4MY8A 4DWSC 1U5HA 3ITTA 1I9CB 3E5BA 4YU1A 4NRSA 1MQRA 1UD5A 2BY0A 4GKLA 2JEQA 3S5YA 1S2UA 3LCIA 1I2RA 3SCTA 3S42A 3WJSA 3EPOA 1B9BA 3ITXA 1Q13A 1K3UA 1JYNA 3MVTA 4PSPA 3TK7A 4K7VA 4CLMA 3H54A 1JG9A 4QHRA 2QW5A 2EGZA 3P60A 2G3NA 1E43A 1OB0A 4NJKA 2P88A 4O4VA 2E25A 2HRWA 2P50A 2Y5JA 2WZTA 4BQ4A 4J3VA 1PL9A 2VX6A 2IKGA 4FI4A 4TX9A 3RPDA 5F7UA 4ZL1A 4WGXA 4AYGA 3ABQA 4IL2A 2QUTA 4W7WA 1V4YA 3CL6A 3TP4A 3F2CA 2Y0FA 1F3XA 1TPC1 2NX1A 4O0QA 3AMDA 2D1ZA 4O1CA 5BZAA 4MWAE 4F9DA 3N18A 5LKYA 3I3BA 1SZRA 2OU4A 1NF0A 2P8CA 2V68A 1UUMA 3AXKA 1XWYA 2J27A 2C15A 3V4BA 3ANVA 3AFBA 1ZNNA 1KWGA 3PSVA 3HPAA 4GH3A 3S9YA 4IG2A 4J3SA 1W17A 2FB3A 6A3HA 2DUZA 3UPMA 3UF9A 4Y9OA 1BPLB 1AZ2A 1F74A 3TFCA 1W3IA 1DQWA 3AIVA 1G7UA 4HJFA 4UFLA 4GUIA 4U3AA 4HB7A 5GNYA 5A8MA 2QDHA 3PNUA 4DBSA 1FP9A 2AKMA 3LGEA 4P8WA 3CPRA 3BLEA 4LW7A 4Z1AA 4HJWA 3PWGA 1W9BM 3CPUA 1J0YA 4O1DA 2RFGA 3R0UA 1KFWA 4B3KA 3EPNA 3QSTA 4K3ZA 3LD5A 4I5RA 1VGAA 4RK8A 2FTPA 3NSMA 3N14A 2QJNA 1KM6A 1H1ZA 5ENLA 3U3HA 5A6JA 4ZBCA 3GVQA 4YCOA 2WJZA 3TMLA 4GZJA 4LYPA 3VDHA 5D02A 1VD6A 3CUGA 4ATLA 4KCTA 3FCPA 4J35A 6XIMA 3D5HA 4GI4A 4B2DA 4X61A 2FLIA 4XWUA 3IS4A 4DYEA 4EACA 1JCXA 1PDYA 2WMKA 1E1FA 5G1YA 3PNZA 1Y65A 3PK7A 4V15A 1EH9A 4A3RA 1G0CA 2VDIA 4ICCX 4A3QA 4WX2A 3PTDA 5DXYA 3CIXA 1XYCA 3CASA 6XIAA 5BRQA 3GNRA 2B7NA 1UP0A 3NDOA 5I6SA 1GVEA 1WKDA 1KBBA 2I14A 3U6WA 1JAEA 5C5YA 3BXWA 2OJPA 5I3JA 1PE1A 2V0TA 2CIPA 3WFAA 3UXAA 4EOUA 3WUGA 3W7MA 1EWDA 2QDEA 2DIEA 1LL6A 1IV8A 4WQ6A 1SVDA 2QJGA 3AHTA 3TN3A 1TTJA 4TMCA 1IWAA 3AXHA 3HQNA 1BXBA 2A3HA 5D33A 1C3FA 4R3UA 4XD6A 3EB2A 4L6HA 4MIMA 4G1NA 3LHYA 2P10A 2XJ7A 2YOCA 4ZOAA 3K8KA 3P14A 1EBGA 2UY5A 5A6LA 1H4PA 2IKHA 5BRBA 4L4OA 3UPWA 2OODA 1Z69A 2YXXA 2V2CA 3DC8A 3QHNA 2Y7FA 1W56A 3LBMA 2A4AA 1K7EA 1TMLA 2R6OA 3BG5A 4Z17A 1J6PA 1UD2A 2EHHA 2AGKA 1B54A 3QGKC 3AZRA 1TUXA 2J7HA 3WLIA 3GXPA 4QX4A 4ROPA 4OECA 4YVPA 5C2CA 3MCNA 4FR6A 2W4XA 1QWGA 4GRSA 4MAZA 1JZ3A 1W32A 4TOQA 3KZPA 1S5VA 4US5D 1TUFA 3WLNA 1XFCA 2BVDA 3GHUA 2VC6A 1XL9A 3S47A 1XD1A 4GCXA 2Y62A 3WNOA 2D73A 1JZ7A 1VJZA 5IM51 1PYFA 4ZZ9A 4IFKB 3UQNA 4O54A 4KWSA 1XF0A 5JH2A 5TIMA 4S39A 4HA0A 4FSAA 2RGLA 3NPUA 2PRLA 4YHGA 3AALA 4GIYA 4H2HA 1IE7C 3WBWA 3GXFA 1F3WA 3MO4A 3FDKA 1OYAA 4NZ4A 3WQVA 3ZO9A 1PO9A 1ZJBA 1KXQA 2FIQA 3IJ9A 4Q8QA 3QSRA 3CHVA 4GYFA 4H7CA 1IYXA 3L7RA 3SCQA 1O6IA 3E6EA 3N13A 1YNQA 1GZJA 4UXDA 1F05A 3VC5A 3TLQA 1MVYA 1O5KA 2QJIA 3I68A 1ZP3A 3TOYA 1B90A 5TF0A 3K4DA 3ZR6A 1CGWA 5CPSA 3FHAA 2QEZA 1NSJA 3CWOX 3RPTA 3LV5A 2NQZA 2WBKA 5AN7A 2Z1VA 3CIVA 1G94A 2FB2A 1SPQA 3LPOA 4RDWA 4C1NB 5G1TA 4RZBA 3W87A 3NG3A 3V36A 1XYMA 1SO3A 3R43A 4PCSA 2E6AA 1NY1A 3QGAC 1A0DA 2CLPA 3DFTA 1RQBA 1B3VA 5EBAA 3L68A 3GC5A 1JYWA 2QYGA 3WD2A 1FA2A 1FUYA 1GQLA 4GNJA 3DOPA 2QKFA 1ONWA 4NHVA 1FOBA 2ABAA 1ZBWA 4TX8A 1W5NA 4UQBA 2PEVA 1JDEA 3UZXA 4I9TA 1JVNA 3T0TA 4UMCA 1KTBA 5RUBA 3NPXA 4PMOA 1XLLA 5BWAA 2VOTA 4PB5A 3CPGA 1XYBA 3LERA 1X1NA 4HU3A 3UG4A 4PB3A 2PU0A 1VBRA 5HAOA 4UQ9A 4I9AA 3AYRA 4IIBA 3OOQA 1T41A 4W89A 1PSCA 2CC0A 5D37A 1A4LA 2WVSA 2NX9A 5KZMA 2DZAA 4YTSA 1YPFA 1YE6A 3VABA 4IFKA 7TIMA 1TIWA 1X98A 1LORA 4M6VA 5G2HA 1CENA 4INFA 3AZSA 1AQ0A 3DG7A 3LMYA 4WZHA 4GABA 4H9XA 4N42A 1TSIA 1Z7AA 3IEBA 3W4RA 3MCOA 2WMIB 1O7AA 3R11A 3W2NA 2R91A 2WCSA 1QI5A 2HK1A 1EZWA 1XGZA 1UKTA 5E70A 3SRDA 1L6YA 3T42A 2HCVA 1HJXA 4P7RA 1ADOA 1Y5WA 2DJLA 3N11A 4XO6A 4KT2A 4PCTA 1IGWA 1LWIA 4K6AA 4H9TA 3P93A 1EOKA 3JVAA 3VX1A 4QLKA 1W5MA 3G8RA 1C7TA 3BLIA 1DWFM 3UT0A 3C0QA 3W1LA 4PEEA 1TV8A 3EX3A 2RDTA 2A3BA 4GUJA 5FSEC 1V6YA 5KITA 4IPIA 3KHJA 2R14A 3IAPA 4Z2IA 1ENUA 3WL1A 4HNTA 4UTMA 1CECA 4DPQA 3R0DA 1RH9A 2HWGA 1OC5A 2FKPA 2E28A 2VEKA 2ZC1A 4GUFA 2ZIDA 3HV8A 1A5UA 1UROA 1GVOA 1M5WA 5AFDA 3O6DA 1KXHA 2VQTA 3AIUA 2JKAA 1OY0A 4XIAA 3D0CA 3W1QA 1IT0A 1ONXA 3VIGA 3GK0A 2GVLA 2ZKMX 4BJHA 5DCDA 1UCWA 3RCYA 1YBQB 4ZXLA 3STFA 3ARVA 3B0YA 2R94A 1E73M 1XKYA 4MFDA 2WLYA 1ZCCA 3CQHA 3W7PA 1NWRA 1R86A 2WMIA 3UWYA 4W8BA 1QPKA 4W86A 2QJJA 2G4FA 4O14A 3F4NA 5CLTA 3S83A 4W87A 2XFRA 2XM1A 3STGA 1ZJIA 2Z1KA 3NZGA 4DF1A 1E9LA 1C92A 2B4GA 8TIMA 1L6FA 1DJYA 3W26A 1TZZA 5LNVA 5CJMA 2PU1A 3GU9A 1L2QA 3MB9A 2OEKA 4DJDA 4JFUA 5AZ0A 4CKQA 1A5KC 1QHPA 3TSDA 1ZLPA 4DB7A 4FZIA 5CPOA 4UTHA 4Z1BA 4Q22A 4UIOA 1XSIA 3WNMA 5IHRA 1FCQA 1XQLA 1Q7MA 4H8HA 2DT3A 4FALA 1WDDA 3OA5A 1OHLA 4OBTA 1W5OA 3UXLA 1SSGA 4NI8A 1XKJA 1UJQA 3NXFA 2V5BA 3OP2A 1CGVA 3W75A 3R89A 1AH3A 4TQTA 4B4HA 1XRTA 1ADDA 4A8RA 3NA8A 4IF2A 2VZSA 4V1YA 1ZHAA 1XX1A 1S46A 1D3GA 1OX5A 4K1GA 3NEHA 3P8JA 2X0SA 4UFKA 4FXSA 2CXEA 5HR6A 1CXLA 2V5KA 1V77A 5D2WA 3LI0A 1FFQA 1SO5A 3DYPA 4BEUA 3HPZA 1HKIA 4AVOA 3AJ7A 1E3XA 3MDWA 5D9NA 5CC3A 3UJ2A 3PY2A 1BYDA 4O4WA 3QKZA 4QS6A 1IIGA 2C7FA 3SGZA 1E0UA 1H7OA 1O94A 1EJRC 3OVRA 1EOMA 2HMCA 4EK7A 3QHOA 4L9XA 1YBQA 2XFYA 3LTSA 4W7UA 3BL3A 4H01A 1U5JA 5D32A 3N25A 2E6YA 3W70A 4X2PA 1LQAA 1F8IA 4GWEA 3O15A 3H2FA 4F9JA 2GSEA 1LP6A 4Q8TA 2IPJA 3MP4A 2C6QA 3KOFA 2WPBA 2EAWA 1H3GA 1K4HA 3AIBA 2EXOA 3UERA 4CNOA 2P53A 4WJ8A 1FH8A 3CNYA 4UMBA 5G1MA 2PWDA 2BVYA 4HT3A 2PDJA 5EPDA 3MYPA 4JQ1A 3WH6A 2PWFA 4DBUA 1DWGM 3TW9A 1BGAA 3ZJ6A 3ALGA 1H41A 3CV1A 3SO7A 3G1AA 4AD4A 4AZ7A 1KKRA 3NQEA 4CQBA 4YWSA 1FWDC 1SO6A 7XIMA 4WDTA 1R9YA 4R88A 3BLOA 3O0FA 1FWIC 4Q6JA 8CGTA 3N17A 5HXMA 5M5DA 2OLSA 4U33A 4UR8A 3TN5A 4GBUA 3ENLA 1TREA 3IJDA 5K4ZA 4ZE4A 2QAPA 3TWBA 1MXGA 3ONCA 4W8LA 3UR8A 3O2LA 4BF9A 2NV1A 2BVTA 5AZ1A 3SUSA 3WQ8A 1GOWA 4UUIA 1UR1A 2PODA 4ZB5A 3AHVA 2GVEA 3TA9A 3W1TA 3AHZA 1OABA 2YX0A 3T0AA 3E0VA 5CC6A 2ZE3A 4HCLA 4B5WA 2WJEA 5K9CA 3Q2DA 4DAFA 1H62A 1W2VA 4PH6A 3WNKA 1F61A 1VYSX 4BQ5A 4RKAA 5C71A 2GL5A 3MJYA 3IACA 3SN1A 5XINA 1MMFA 1VCGA 4MADA 3IJIA 2WKJA 3V0SA 4C5YA 4OWGA 1Y5VA 1P48A 3W1PA 2GPTA 3JZEA 1BHGA 4UTLA 4F0HA 1ZBVA 3P82A 4PTWA 4ORMA 4B9ZA 3R8HA 2E67A 2HBXA 5JUVA 3VD5A 3P7YA 4HA1A 2R1LA 2I16A 1D9EA 3L5MA 3L9CA 4DF2A 1T6MA 3VILA 2QCDA 1B5TA 1M7OA 2CZDA 1JRBA 4XK2A 1IR1A 2FTWA 1BKHA 4UR9A 3RJYA 2YIHA 2XISA 1AK5A 4LAOA 3WQ5A 4B3LA 3QMTA 2P0IA 2OKTA 2CKSA 1TA3A 4XZIA 2A3AA 4KCVA 1H7NA 4RE0A 4DWSA 2P8BA 4FF7A 5E6ZA 1JDAA 3A12A 2X2GA 2C0HA 4AMAA 4S3BA 3ES8A 2D23A 3MBDA 3MSYA 1AVAA 1O4UA 4LVAA 1W1B1 2JK2A 2O92A 4TVCA 3KBNA 4HBKA 2FHBA 3PZUA 1J2BA 4CN4A 3FN9A 2PDWA 5I24A 3KDOA 2ISFA 4B90A 2RUSA 1S5TA 2NT1A 2CLLA 3CEPA 3W72A 3OVQA 5K9DA 1XC6A 2ZVIA 4S2CA 3TYBA 1IXNA 3GKAA 3TTEA 3FJNA 3EXRA 2WC4A 3BAIA 2YA1A 1BGGA 4B5XA 1QUMA 4LALA 5LGXA 4K8EA 2ANUA 2FGBA 1UPPA 4AXNA 1V3KA 1OD8A 4GC3A 3UXDA 1KRMA 3B97A 2A2IA 2DFAA 2WPGA 4AWTA 4W9TA 4ZO9A 4L65A 1XUZA 2CU0A 1XIBA 5DN1A 3IJ8A 5GJPA 1ZAJA 4F4RA 5F1VA 1W1TA 4LNYA 4DJDD 3NSXA 6REQB 1XBYA 2ZOXA 3WK0A 1TJRA 1LQ2A 2O4QA 3CXOA 1LWHA 3PBWA 1N55A 4E3VA 2V3FA 4JIEA 5CBIA 2X7VA 1EP2A 1UPMB 1CNVA 1WAWA 2P3ZA 3VUSA 5CZJA 4DI8A 1JI2A 3PPHA 5TQLA 5KSWA 2D0HA 1ALDA 1R3QA 1DJHA 4HPGA 5CPTA 4QG6A 2QPXA 1UMYA 5FEPA 2WNNA 3UWVA 3JS3A 2CITA 4NQ1A 1EO7A 5BROA 3THAA 3Q65A 3CIWA 4EX4A 1WDSA 3TJIA 3EKZA 4MG4A 2ZXBA 4FOJA 4CEUC 4ONVA 4CVWA 2HTMA 2O9RA 3V1PA 1SMDA 5M17A 3UY7A 2J62A 1XBXA 4N6EA 4L61A 1FP8A 3UR5A 3MYOA 3TFXA 3EEGA 3PP7A 2TPSA 5FF3A 1I8JA 2RKXA 3N2OA 3VD7A 3URNA 1BQCA 5T26A 1P6WA 3EA3A 3CGTA 1R2RA 3FSTA 1C7SA 5CGTA 1VFOA 1FRBA 3E9AA 1KBLA 1GJPA 2WMHA 2VD8A 4KIRA 3B8SA 5HULA 3IUHA 4U28A 3WUBA 1UKPA 3PZ9A 5AHNA 3KFTA 2VUYA 3V18A 4Q8VA 5BXTA 2BP1A 1DXIA 4S3EA 3S8HA 5D2VA 2Z1WA 1KQYA 1WOAA 1PS9A 2QHAA 3D3FA 2CKRA 1I2OA 3TE9A 1FWAC 1PKNA 5BRPA 3WQWA 1HO1A 2EPHA 3VGDA 1IXOA 2ZUNA 3NAVA 2VGIA 2NWRA 5DBTA 3URBA 2Y8KA 4AIBA 5F4WA 1BTMA 1TWDA 2PUZA 3PZNA 1EYWA 3PB2A 1TMQA 1MUMA 4FOUA 1X7FA 1JZ5A 3WDIA 3CHFA 2B7QA 4ASTA 2AGTA 1E51A 4WY0B 1H0GA 2J7BA 4MB1A 3GG0A 1FX6A 2E9MA 3BSGA 4LS1A 1W3HA 4UQAA 5DMMA 2PF8A 5DFAA 4DJEA 3R0KA 1HKJA 2OMAA 1ZCOA 4ZQNA 2OO6A 3SIMA 3VGFA 4DBEA 5JBEA 3WF1A 2PP0A 3G0XA 1SMAA 1UR0A 4HD5A 4JR5A 4JKKA 2FPVA 4UQDA 2WK2A 4LB4A 3T81A 1IWPA 3E49A 3SUWA 5CCZA 2XH2A 2POTA 3VNZA 3F03K 4CNNA 4AZBA 2GJNA 3Q58A 1VCVA 4GH1A 2ZXAA 1GTHA 3UWUA 2GLKA 2AL2A 1POJA 4MPQA 1FWNA 5AC8A 2QV4A 5F1UA 4TUFA 2PS2A 1J93A 2BS9A 5HQMA 2DY3A 3LN3A 3GHRA 4XKMA 3E2RA 4LXFA 1XXXA 3W88A 1Q6FA 4IQDA 5M3WA 1IZCA 5HMDA 4HHHA 1RXOB 1RD6A 1SJBA 2BASA 3L0GA 3DKJA 1FWSA 3T0BA 4IMGA 5KETA 5AHIA 4XVDA 4JFVA 2VDHA 1ONEA 1RZMA 4O53A 5FJPA 4N9BA 4JL1A 3E0LA 2J78A 3CZGA 3NQDA 5CSUA 1OINA 3LHVA 5REQB 4KGLA 3EX1A 2PCQA 3N2XA 3QBUA 2EQDA 5I00A 1KC7A 3CZLA 3C0JA 3F2BA 1ELSA 5F2LA 3C4UA 1YE4A 1BD0A 4LWWA 1F3EA 3WBYA 3WQOA 4XSLA 4XKYB 2AOSA 2HXUA 3P2VA 4X3ZA 3W2KA 3O07A 4GXPA 1QRQA 1PKMA 4PMVA 1I2PA 1CLKA 2JGYA 5LHEA 1PTAA 3WDQA 2D2GA 1XLAA 1VQTA 2ATSA 2FH8A 4IXHA 2BHUA 2VFIA 4PMUA 4TIMA 5IXEA 2DVTA 4C6PA 4FNTA 1R30A 4K8GA 2MNRA 3USBA 3L2MA 1OSEA 4DELA 4RXFA 3N4AA 4IH3A 1QFEA 1I60A 3WQCA 1FWTA 3L4WA 1Q7ZA 5D05A 1UA7A 2EKCA 2CZEA 3HU7A 1FWHC 1E1EA 3QJAA 4DUWA 1UMLA 3W86A 4UOQA 4H9UA 1I0DA 4NYYA 1E9YB 3N2CA 1V0MA 4UFJA 2BV9A 3TVAA 2ZDRA 4R34A 3H2AA 4ML9A 4PE8A 1CIUA 3TDFA 3W7HA 3DU0A 4NRRA 3KVMA 3KCLA 2OT0A 4JTGA 4R27A 4JN6A 2VXNA 3G18A 1WAUA 1TPWA 3F4VA 2GQAA 3PS7A 4GC4A 5C7VA 4M81A 4GYPC 1J6OA 3CQKA 1GYLA 1JQVA 3GDRA 1BEUA 8RUCA 1H7XA 3RLHA 2V6AA 3ARTA 4CU6A 1LM1A 1A5MC 1JZ8A 3SN0A 3ID7A 1KRCC 3AU2A 3PZQA 3QH2A 2NV9A 5HOSA 2YL5A 3BJTA 4G7EB 4GXMA 1J4EA 4S3GA 4O1FA 1KM2A 1SUXA 2A21A 2FVKA 4PUEA 1XRSA 1OZMA 4B3ZA 1W9UA 4HCDA 1YKWA 1RP9A 2F38A 3R1ZA 4NASA 3WJYA 2E0PA 2YCLA 3WD3A 4IFRA 3JW7A 1OCNA 1W3JA 3TJ4A 2FMNA 4M7TA 1UOKA 2JKPA 2ZZ4A 5A6TC 4K2SA 2G95A 5EKYA 1NH6A 1DQUA 3MKVA 1SZEA 4W8AA 2H3BA 2HE5A 4MB4A 3QPEA 4AWSA 2OYMA 4IM4A 4FXFA 3P8IA 1NJJA 3CTTA 4JIRA 3NQCA 4JTLA 1QAPA 2DQWA 5D8ZA 3LDVA 4CNUA 3QHMA 2JQXA 2Q02A 2C18A 1KA9F 3A21A 1C8QA 4G8TA 2EJAA 1W6TA 4IQLA 4ECLA 4IPPA 4F8XA 1S39A 4EE9A 4NX5A 4XZBA 1JR1A 4OU1A 3B0VC 4ROQA 1ISZA 4PMQA 1OWQA 1VLIA 4C65A 5A6SA 3ISIX 2V2HA 4UQCA 4R9XA 3NJ3A 4KWUA 1CT5A 3PBVA 3WMLA 1VRXA 4WD0A 5HNUA 3IRDA 4NL1A 3IRSA 4NX0A 4JL2A 4WY0F 3UZZA 4X63A 3T2PA 1OF8A 2DZWA 2DIJA 3MUY1 4IGSA 4J3UA 1Q6QA 1GZ1A 5A2BA 1EDGA 2YL8A 5LZLA 1W1ZA 3ZJKA 1AUSL 3IK2A 1R85A 3H7UA 1C8VA 4JYEA 3OGSA 3MZNA 3DHDA 4JQAA 3VCNA 2GJPA 1P7TB 3WDJA 1XDMA 3GDLA 2BODX 2AAMA 1K9FA 1BYCA 4AX6A 2NVAA 1MUCA 1C8XA 3F5KA 2ZCGA 4HNNA 3TTOA 3N2MA 4G7FA 3VOHA 3L21A 2A3CA 3CU2A 1OFBA 4ZCWA 1JJKA 1BAGA 3WL0A 3WLPA 4GI9A 2J8TA 3W7GA 1OYBA 3LTPA 3IIVA 1RY8A 2C1GA 2OG9A 2CHOA 1XUUA 4RX0A 1TCMA 3BCJA 5GQBA 1PZ0A 5EY5A 3W00A 5DCBA 3CMGA 3KVLA 3VMPA 2J7CA 1ITCA 5T8GA 4Q4OA 4Z2JA 1F6KA 3EDEA 4QAWA 1G67A 2NXGA 5BW6A 1KFLA 4RZ4A 5EMLA 4HU0A 2PWGA 4TU1A 3KTXA 2GGHA 1LBMA 2OXNA 5GJMA 4G6CA 1EP1A 1V7YA 2OELA 2F2HA 2HPMA 2QF8A 3C2EA 1LTDA 4IIDA 2Z2UA 1P6BA 3GD6A 5DQPA 4RZ6A 3QC0A 2VFGA 4AC7C 1MXSA 1FWFC 1WUEA 2CBIA 4A3HA 3ZLHA 2VQUA 1HX0A 1GEQA 4M3PA 2J6XA 4LRTA 3QMSA 1RA5A 4U2YA 3KS5A 1XLBA 4V1XA 1W9XA 2ZZ5A 4QAIA 2B7PA 4C60A 3IUDA 4RNFA 2VC9A 1WDRA 3CUIA 4BKNA 4ZO8A 4WOZA 1OCQA 3I10A 4JXCA 2WMGA 1V08A 1GOOA 1XLDA 1ZAIA 2C3ZA 3SFKA 1SJCA 1FTXA 4NZFA 1VEOA 4WIWA 1TPDA 2DZVA 5JQ9A 4Q6XA 3BGGA 1CB2A 1LYXA 5FAGA 3VZXA 3DCPA 2HPIA 1RK6A 2D3NA 3TIMA 1DJGA 3POHA 3S9IA 3SRHA 3TAOA 1E6ZA 1P0KA 4MWAB 1GQIA 3NO3A 4CD7A 5A69A 3W02A 3G6LA 3SGGA 3T09A 1XH2A 1X38A 3LLFA 4IT1A 1UD8A 1JDFA 1IT7A 5CH9A 5D2XA 4EAYA 4MLRA 1KRBC 3RM9A 2WVVA 3SGUA 4OKDA 3LBOA 4AVNA 3FA4A 2VDGA 3HGJA 4O10A 2J77A 4KH2A 3POCA 3UZYA 4H1ZA 3LU2A 2YJQA 4QSFA 1JPHA 1ZS2A 1UD6A 3AXXA 3NL6A 3NYZA 3DIPA 3H4XA 3VX0A 4GI6A 3YPIA 1UH4A 3LX9A 1K7XA 3NQFA 2PTXA 4NYUA 3ABXA 1PJ9A 1F4AA 3CQJA 2ZTJA 4D6FA 4YJ5A 1J96A 3ITOA 4YWIA 3VIOA 1LWJA 4GXWA 4FR1A 4HMCA 1CZ1A 4JX5A 4Q4SA 2G96A 3ITGA 4HPNA 1NVMA 5ABEA 2FPYA 3S46A 3T4CA 4HMEA 4F3HA 1ECEA 4FAMA 1TR9A 3W1NA 3IIZA 2FZBA 3SUTA 4C7GA 5A6BA 4UNIA 1JYVA 2VCAA 3PBYA 2X40A 2V38A 3W7NA 4EF9A 3DG6A 4QXIA 3H7RA 2Y7EA 1VFLA 3OG3A 1AG1O 3EDFA 4IIEA 5BMXA 3ZWSA 1B31A 1IEXA 1PYMA 3CT2A 4QQ3A 2Y63A 1VS1A 1DL3A 4QS5A 3OEXA 1BKSA 4LAKA 4CU8A 1EC8A 4L1GA 2DEPA 2PDQA 3GZ3A 2XGZA 4M51A 4EIVA 2E1DA 3EKLA 1OX4A 4D72A 1D3HA 4YL2A 2YXOA 2XVPA 4E5TA 1GOXA 1X97A 1V6TA 5HUOA 4H6RA 4PTNA 1R0MA 2J25A 4Z1CA 4UB9A 2OYLA 1ITQA 1F5ZA 3P84A 1NQ6A 4NZ5A 1GQKA 3PPGA 3KLKA 2YCKX 3DESA 4QGCA 3L0NA 4PA8A 3TNBA 4JFWA 1PIFA 1XCWA 3O6YX 1AZ1A 5D2TA 3S3GA 2NV2A 4MGGA 3PUGA 2E40A 2CLOA 1XLHA 3SDOA 4NAFB 1RJPA 3AIRA 1EX1A 3VFCA 1S2VA 4OGZA 4HOZA 1DP0A 5CPLA 1D8WA 2GGGA 1UOZA 1UWSA 2VJXA 4F0LA 1SW0A 2UZ9A 4E4FA 2WC7A 1SW3A 4AY1A 1RA0A 4Q4KA 1E1CB 2AQOA 1JZ2A 4AAJA 1E4LA 3VIFA 1JFHA 1S38A 3PBUA 1TA3B 3VVGA 1KV8A 4NT0A 3LNMA 4BI6A 4RCXA 3OBEA 1LLZA 3IGSA 5I3DA 3QVQA 1JGIA 1YDOA 1K9DA 4LTSA 3LEPA 4KFNA 1U1UA 2OQLA 3SQLA 3QR1A 3GM8A 2FFIA 4RNHA 3UG5A 2NUYA 4WKHA 3CUXA 1AQMA 3C61A 4G5DA 3RCNA 5LIYX 2WJDA 3ZR4A 2YBTA 3M4HA 1TJ0A 3BGAA 2FJUB 1EHAA 1CTNA 2BZNA 4Y9NA 1DWAM 1WDWA 5E9XA 3SCVA 4X0VA 4N02A 5C2GA 3CO8A 1KLZA 1PIGA 4FNSA 1OFOA 4MKNA 1UBSA 1LRNA 1DBTA 1WXZA 3GFYA 3FEMA 4AYSA 5IBXC 2QCNA 5JXQA 1HXJA 2E6DA 5LNWA 3CS2A 2MANA 2ZUVA 1TPFA 2PDHA 2QCEA 1Z8AA 3QZ6A 1EX5A 4H00A 4Z2KA 1I1WA 4ICNA 3ZSTA 2PDPA 5ABFB 3RFAA 4EVZA 1CXKA 2B7OA 2DSWA 1XLEA 4X0NA 1KV5A 3IARA 1UWUA 1E6PA 4IPJA 1PX8A 1DWHM 5I78A 1HJUA 2FVMA 1MXDA 4JCMA 4LNCA 1FCBA 4QM1A 1AA1B 4DLFA 3G5EA 2WNQA 3FAWA 2VURA 4DJEC 4J28A 1XDJA 2Z24A 4NXKA 2X09A 2F6XA 5CC7A 3UYCA 5FESA 5HQEA 4Y96A 2ZXDA 1W91A 4CCCA 2F2KA 3NQ6A 4UNKA 4M82A 2CLFA 2J79A 1YMYA 5REQA 4IQJA 4KCWA 1G69A 1FKXA 3PR2A 4ZSUA 2P3EA 1NOFA 3V1HA 1WDPA 3G1HA 3T2QA 1NFGA 2G37A 3KTSA 1I2QA 4H8NA 2Q8XA 4GX9A 1XIHA 5J8LA 3W01A 3B9NA 3FGCB 4D6EA 3UVAA 4HNUA 3IV3A 1RK5A 2TRSA 5IDIA 3MMDA 5CBJA 2WHLA 5MF5A 3TQVA 2RGMA 3NVDA 5LA1A 4KRUA 4QTGA 3THUA 3N1AA 4DIAA 8A3HA 1XBVA 3ARSA 4S3CA 1OADA 4W7VA 4NNCA 4J7RA 3UXKA 3OLEA 1KCZA 1RBLA 4UTKA 2ZXQA 3B0PA 1ZALA 4TTUA 3MMWA 1ECQA 4Q7BA 4R7OA 4D8ZA 3UZ5A 4U5IA 4GNVA 2O7SA 1DXEA 2RJGA 5ECUA 4DJDC 1QNVA 2JE8A 5FEZA 5CAHA 4C6KA 1FDZA 1GOIA 2HISA 4MOZA 3TA6A 1QTWA 1EBHA 2WV8A 5BU6A 3QQ0A 2Y8VA 4EF8A 1PX4A 4E0CA 3MO7A 1G6CA 2Z6JA 1X6NA 4Y8EA 2XIOA 1OG6A 1JYXA 2DIKA 1IXQA 5HMEA 1TYGA 4W5ZA 2GOKA 1AW2A 5CKSA 1QNQA 1HTIA 5AHEA 3M7SA 2W79A 5IHSA 4HNOA 1XLMA 1ZL1A 5DANA 2G3JA 4C6EA 4IMCA 3GR7A 4LAUA 3THDA 1ICSA 3BDKA 1TE6A 2YL9A 2IMRA 2ISWA 5EU9A 3KWXA 3ITVA 3P0XA 4H04A 1OFQA 3OW1A 4XG1A 4DO6A 4MDOA 1Y7VA 4C7DA 3LSBA 5F4XA 4RL3A 3WYZA 3CH9A 4G9PA 2DPEA 3W7QA 3WCZA 1HVXA 5CBBA 2XIBA 3S5NA 3EX6A 3WNNA 1DJXA 3I6TA 4XBKA 3W1UA 1DEDA 1JAKA 4OBRA 1UH3A 4QE5A 4LJ3A 3GTFA 1ZGDA 3MWCA 1JD7A 5C9XA 1JUKA 2TYSA 3MV01 3OZPA 2I9EA 2QF7A 2V5CA 3TYCA 3HG5A 2TAAA 3PZOA 4HMNA 3BLLA 3CWHA 2WANA 4IICA 1RVKA 4XAPA 1TELA 3GQYA 3U2OA 3SCOA 5FL0A 3CZJA 3K5XA 3RLUA 2E5CA 5AVHA 2F6UA 3KL3A 3ME3A 4EPBC 4JIIX 3AHXA 3C3UA 4DLMA 4LEQA 4XZNX 2GFTA 5DXXA 4LRSA 2A5HA 2PDNA 2YLLA 4UQEA 3SY5A 2ZA1A 3VNJA 3TJXA 4OT7A 3BJSA 3R4IA 1E6XM 3MHGA 4MZYA 4QLLA 4MTVA 4AZHA 3LHUA 1QPRA 5E0KA 4ZA0A 3UJRA 2D3LA 4QNWA 3AMCA 1QOQA 1GQJA 3KCOA 2V3EA 3IGUA 3L4UA 2XN2A 3GHTA 4LAMA 3I65A 3LXCA 2XM2A 1E71M 3DGBA 3KVKA 1DXFA 3BUVA 3OU8A 4HKPA 4NZ1A 5E6YA 4Q7IA 3PM6A 2FDMA 3MKCA 2GDQA 4LVBA 1TRDA 5EMMA 2O9PA 1GW1A 2ZZ6A 2J4GA 3EOOA 4OBSA 4KWOA 2WO5A 3HG2A 4KMQA 1GOMA 4XKYA 2Q8ZA 5FD0A 7A3HA 3EWWA 3LXBA 1UZHA 3OZYA 4S1FA 4FLQA 4NAEB 1JF5A 1NFBA 4A3YA 2FTYA 3E02A 2IS7A 4R7JA 3W9ZA 5LIWX 3R13A 4C6CA 5FL1A 2ZZ1A 4Z0SA 1E0WA 1KO0A 2XSXA 1EO5A 1NM9A 1O5RA 3FAXA 4RE3A 3WLJA 3O7UA 1F2JA 5LXXA 5D9MA 3H70A 4AEOA 4O17A 4FNUA 3L4VA 2OWXA 1EHNA 2X1IA 3ZT7A 4KEMA 1E6RA 4F2BA 1SZGA 4MJMA 4I6KA 3V3WA 1Y0EA 3ABOA 1HL8A 3G77A 1V8EA 1QPNA 4JY9A 5LIUX 3FKRA 4GUHA 1ODUA 3DUGA 1FXPA 3H26A 5ABFA 2PGFA 1FHUA 3PJUA 1J5SA 5CG7A 3VTRA 1HIZA 4PFMA 3AAMA 3UP8A 4P5UA 4YXGA 5KZDA 3L5LA 1J0IA 3SQSA 2QCDB 3T8QA 3LM7A 4H8VA 2D2OA 3K8MA 4EPKA 4P7NA 3Q67A 3T0CA 1D7FA 2FZ8A 1TPVA 3UNDA 3C86A 4BF7A 4GQRA 3IVTA 1BG4A 2GUYA 1RV8A 4J3ZA 5FSDC 3UYIA 3VINA 1ITUA 5FEXA 3RCMA 4KERA 2ZC8A 3E5PA 3CO4A 1BYBA 3PC0A 5A6MA 4FIQA 4UFHA 4RDYA 4LUTA 4QROA 1JPKA 1F7BA 4XISA 1GJUA 4DNMA 1VFHA 3QR0A 2O9TA 1S5NA 1V3MA 4ZR8A 1W5QA 2I5QA 1JDCA 1V02A 4KCUA 3RPMA 3CLWA 2V3GA 4M5PA 4J27A 5BOEA 1SGJA 3IANA 3GXTA 3VYLA 3E3HA 3FS2A 2FZNA 1DKWA 3OLIA 1VIWA 1AJ2A 1V0LA 3UWQA 2XVGA 3UR2A 5CQ1A 4BQ3A 4IISA 3GYCA 3RNDA 4C1NA 4QDMA 1UR4A 3RX3A 4JTAA 1T7LA 2HEJA 4P8XA 4KGJA 3VAVA 4QEHA 3MY9A 3A64A 5HANA 1SJDA 2I5IA 3CYJA 4RDVA 3NWRA 4DEFA 2CLEA 3W29A 3CB8A 3VNLA 1DV7A 1M68A 4KESA 2ZE0A 2VENA 5I7GA 5DELA 2QPUA 1X7IA 1WZKA 4YTTA 2OGYA 4EXQA 4E4PA 4QDWA 3BAYA 4RDZA 3B4UA 1YLVA 4S3KA 5AHMA 1GHSA 4LF2A 3NDYA 1LROA 2OKOA 3GAKA 3GSMA 1A3HA 1MDLA 2D2JA 1PKLA 2HS6A 1WZLA 1P4CA 4M8UA 2PWUA 3TW6A 4PL1A 1HJVA 1N8IA 1DIOA 3T55A 4HU4A 4HMDA 1ZPTA 4KWVA 4PB4A 1AQFA 1AH0A 1Z9AA 1WKYA 4Z2GA 2QCFA 3AISA 3PUEA 1OYCA 3W84A 5M1TA 1V3LA 1Q3NA 3TC7A 4I7UA 2VD9A 2YKKA 3IK4A 1H2JA 2Q01A 2J24A 4S23A 1SR9A 2V81A 1TQJA 3C2VA 3RUBL 4PMRA 3OVPA 1WUFA 4ILSA 1XC4A 2Z1BA 4REQB 2FZ9A 3SBFA 1IT8A 1VH7A 2BTMA 3PBGA 1SFTA 2XN1A 2ZRXA 2WJFA 4F0MA 2E4TA 2Y4SA 1DQXA 2PGRA 1VP5A 1CPUA 4CCDA 4ORIA 4JNZA 2FZMA 4BCEA 4IJBA 2PRMA 4N6FA 4Y9AA 4RV3A 1UQYA 1QASA 1R8LA 4I5UA 1QI3A 1A3WA 2E5BA 3M0LA 1K1DA 3WLSA 1Q6LA 3VU2A 1V3IA 3F7JA 4JD4A 3GUGA 5LIXX 4LUSB 3KBSA 3BAXA 1QNOA 1S3TC 4ZO7A 4QRNA 3WN6A 3NNTA 3IGHX 3PTMA 1UWIA 3G1SA 3ARRA 3M47A 1LL4A 3QGVA 4GKTA 4MF4A 1NDVA 3GDTA 4GHRA 2BXYA 3ATZA 3S9ZA 4AMCA 3H23A 4JQ4A 4AZCB 1H7RA 5AOUA 3O1NA 3H21A 2HNEA 3GRIA 3DI0A 3KEHA 1IXPA 2AKZA 7REQB 3SZ8A 1PEZA 2QQ6A 3PVFA 3TNOA 3BCDA 3KZSA 5IFTA 2Y6ZA 3QTGA 3GR8A 4CD8A 3REQA 5H8PA 3DAQA 3LHTA 3W28A 3URAA 3G2GA 4MNKA 3W0KA 4E3TA 3LRMA 2E77A 2J47A 2WVVB 3W81A 4N9CA 1C9WA 3BSHA 3TX9A 3K1DA 5C9ZA 3COTA 1K77A 3NGFA 1ICQA 1EL3A 4H7VA 3BW4A 2CPUA 4S2BA 1MQPA 4GZEA 1UB3A 3VKJA 4LPCA 3LM3A 1B3WA 4W93A 4PGLA 1E6QM 3H2OA 1IZKA 5LXEA 4F0RA 5HNTA 1ICPA 5CPMA 4N7QA 1YTDA 4JDBA 4A05A 3QW3A 3WKZA 4K39A 4HK6A 2C91A 1YDYA 3SRFA 3IGXA 3W2UA 1OEPA 5I09A 1UR8A 3ITCA 1EJSC 5ABHA 2R1MA 4D9PA 1WQ5A 1A0EA 1JCYA 3GIYA 4MZ1A 4LSBA 4YHEA 2GVJA 3ZFHA 5EMYA 2DSVA 3KRZA 3ECQA 3OIHA 3SJNA 3SCUA 3NSNA 4XZHA 3EKGA 4AY7A 5C55A 1RVGA 2XIMA 4GQQA 4H19A 3CC1A 4LUSA 2H3DA 1VF8A 4DZAA 3ZIZA 2VI0A 1QT1A 4LV9A 3SEPA 1BWVA 1E1CA 4A3UA 2BOGX 2C16A 1ZJAA 2A7NA 1WDQA 2VGBA 1ZAHA 1XBZA 3SSJA 4EKJA 3PB0A 4MYAA 3HO8A 3NQ7A 3GG1A 3GWQA 1TRIA 3M6DA 2PGEA 3QLLA 1OK4A 4IMFA 3FNDA 2X8RA 2QDGA 4UOJA 1E4MM 4XO7A 2JF7A 4CUCA 3MMUA 5CXPA 2WVUA 1KGWA 1G01A 5C2XA 5AVNA 1ZB5A 1KKOA 3LCGA 3WQGA 4BWLC 4QISA 2QMKA 3VZZA 3QYQA 5C0QA 3W27A 3C56A 5HINA 3M5VA 3CZ8A 2CBUA 3S1GA 4AZGA 4MNMA 1EEXA 4HZ7A 2Z1XA 3A22A 3W1RA 4PTDA 2PAJA 4LYKA 5BNKA 3UR7A 3ZVHA 1KTNA 3M0JA 4LV4A 3V5CA 3WH9A 1A3XA 2E68A 2VX4A 1CB7B 4AEEA 5LA2A 1YDNA 1LLWA 4FXRA 3WX7A 3ARWA 1EF2A 2PD5A 3TSBA 1AFSA 1EPVA 1V0NA 5EBUA 3G1DA 4Q3MA 3QY7A 1SJAA 1UZDA 4HTBA 3N9SA 1EJWC 4LEFA 4DYKA 3WDPP 4XX6A 4LU0A 1EQPA 4AW7A 2D22A 4H83A 4WDUA 3ES7A 2YB4A 1W9PA 2R1NA 5AC7A 4HIBA 1XIEA 4Q8UA 4UTIA 5DMLA 4RV8A 3AHYA 4AIEA 1OZQA 4IMAA 3R8RA 4HYRA 3S4TA 1GHRA 3CTLA 3B9EA 3IVUA 1YW1A 3ONBA 2UY3A 4ZQMA 3HQ1A 3B0UX 4J4KA 3UU0A 1MW3A 3TAKA 3VIMA 4P2VA 1M7PA 1CWYA 3FXYA 3F5LA 4RJEA 3MBFA 3QV6A 3S5ZA 2C13A 2DP3A 2OLAA 3DEQA 5LYRA 1V5XA 2Y8UA 2X30A 2QAFA 3VM5A 1QHZA 2YCLB 1MW2A 1DIKA 3A5FA 5K2ZA 2ZICA 4GYKA 4I8DA 3NVTA 1VPQA 4DY1A 3NL3A 1JULA 4HN4A 4E4UA 5HBFA 2RDXA 1D3CA 2ZZ7A 2X1SA 1E4NA 3LZ3A 4C7FA 2J75A 3PZIA 4HN8A 2GSHA 5B7ZA 4MDPA 1S2CA 3E2VA 1YHTA 5AYIA 1PBGA 3DI1A 1U1HA 3OLGA 3ZM8A 4WF7A 5FACA 3TN4A 2VZTA 2ZRUA 2PTYA 3EWUA 1VEPA 1DWJM 2A85A 3U4AA 2BGSA 4V2XA 1NTHA 2L5HA 1JXKA 4ML4A 3TCSA 4PODA 5A8GA 4GNKB 3IJQA 3CAKA 3HPFA 3BAJA 4EPDC 3P74A 3VCRA 3HBLA 4O52A 1W5PA 2Q8LA 5DF0A 1Q65A 1M7XA 2VM8A 1PCWA 4CU7A 4ZEPA 1HL9A 1U2YA 3PFRA 2HZGA 1Q6RA 9CGTA 3RR1A 1UKOA 1SO4A 3CQ0A 5BYWA 4A29A 4AZ6A 4I7WA 4EXAA 3FV9A 2GVYA 3DFHA 4KW2A 1P1XA 2BHYA 3HM7A 1KNWA 5K7JA 2PDMA 3M41A 4TX6A 2XVKA 1QVBA 4JOMA 2IXVA 1I2NA 2AQWA 4WSKA 1VBUA 4QE1A 2V5DA 2X7WA 4B5NA 3QM3A 1S2AA 1K8ZA 1AJ0A 2NT0A 3QV7A 2ZFAA 4GISA 4TVDA 4ZTXA 1G5AA 4B15A 4GVFA 1VZWA 1HP5A 3PANA 2CCRA 5F2MA 3QR3A 2Z1SA 1R46A 3R58A 2CESA 4OUEA 5DT5A 3K13A 2WSPA 2PLMA 3B3DA 4KF1A 2R1KA 4F0SA 2WWCA 4UMAA 3WUEA 1X8CA 1ISYA 4WHBA 1QNPA 2PDUA 3MA8A 4GY1A 4DPPA 1E55A 1QBBA 6TIMA 4GX8A 4H41A 4L5ZA 1R3WA 5A2CA 2VEGA 2OFJA 2PBOA 3NTYA 4IGNA 3GTHA 4NJJA 4ZE5A 3BW2A 5A8PA 2XPKA 3UWEA 2E9BA 2HDJA 2FYMA 1TV7A 3WD0A 3W38A 2WOQA 1EEPA 4ATWA 3BARA 3AIEA 5FJRA 3NQVA 1UQZA 4YS1A 3D3AA 3A4XA 1VENA 5BOFA 2NUWA 4HHPA 1EGZA 3UXIA 3VFLA 3Q4DA 2E5DA 4ATDA 1L6WA 4PZVA 3M6YA 2QUMA 3B9OA 3WLQA 3K1GA 3IJ7A 3NEVA 3U4FA 2GQ8A 2XH7A 1ZY9A 1E70M 1WO2A 4US6A 1UKQA 3LRKA 3BJFA 2NXHA 5ABTA 1SZNA 2IUZA 4OV4A 4QDPA 2RHGA 4Q8NA 4O15A 4M56A 2PB1A 1WXYA 3DG3A 4FIRA 4ACZB 1V93A 4HQVA 4ZOBA 3CV7A 4WY0A 3GU1A 3KS6A 1NF7A 3OBKA 1Q6EA 1XICA 1R2SA 1UIPA 5DEZA 2DW7A 5G2WA 4V27A 3RAOA 1VRDA 1J5TA 4OIFA 2W3ZA 4R33A 3OLDA 1ONRA 3OO2A 4POCA 4PFHA 3AOFA 3VCCA 5CLWA 3CAWA 1XRVA 3W74A 2QGHA 3GH4A 5I07A 3T4WA 1U30A 3NCOA 4AEFA 7TAAA 3UETA 1K9EA 2WKGA 1J01A 2GDVA 3ITLA 3E2SA 4US5A 1DIEA 3WBXA 4GO8A 1SYTA 3O6AA 2XUCA 4HNCA 1YDVA 2ATMA 4E2BA 4N4PA 1R7OA 6ENLA 3WELA 3EWYA 1CEOA 3FVMA 4RR4A 1LT8A 3QOMA 1X39A 4YYCA 1TPB1 1B4EA 3PWIA 1EXPA 3VNMA 3WG6A 3W82A 3LPFA 4DN1A 1M7JA 4DUOA 4Y9MA 1QJWA 4L1XA 4L56A 2W5FA 4IGHA 4Z2LA 1R3SA 5JIWA 3SCRA 4XUYA 2WC3A 2YCIX 2R82A 5E9AA 4AHPA 3DERA 4TV6A 5XIMA 4AWUA 3SY1A 1J8VA 4MMWA 4IG2B 3QW4B 1GJWA 1UWQA 1ZTVA 3GXMA 4BA0A 1E9ZB 4JY8A 4C91A 5C9WA 4RW3A 5D4YA 4G2DA 1KBIA 1VPYA 3RRAA 4A21A 3WNPA 4AFYA 4HOWA 4KFOA 4DZHA 2F6KA 2QUNA 1G4SA 1G9HA 1I6NA 1A5NC 1RBAA 4Q32A 2JGQA 2UV8G 3K4AA 1JPMA 1SFLA 4MPKA 2V82A 1F3TA 5BCAA 2AQVA 1OCBA 3ARXA 2XZ7A 3N12A 2I17A 4B91A 9RUBA 4ADTA 3F4WA 2RH9A 4PR4A 1IEQA 1S5MA 1H7WA 2J9YA 4FX6M 3AJXA 1TV4A 3II1A 4PUMA 1XIMA 4KEZA 1CDGA 5JMUA 3Q37A 1TR1A 1ZSXA 1GORA 1V51A 4LB3A 4JDYA 4X22A 3DENA 1KW1A 2NXIA 1VBGA 3U0HA 1B3OA 3H4WA 4KS0A 1PDZA 3TC3A 5BXPA 4WJEA 4K38A 1EB3A 1RPXA 3FHQA 1CLVA 4HOXA 3DBPA 4TO8A 3H6OA 1GGOA 3PULA 3BC9A 4NNBA 3FYOA 4JTKA 3W76A 4D8AA 4JS3A 1PWLA 3PF3A 4FX7A 2JEPA 3GIQA 1J0JA 1XQKA 3GNDA 2F9RA 4RXGA 2OPJA 3W25A 2C79A 3L23A 4K68A 2NX3A 2ZUMA 4GA8A 3FX4A 4JZ5A 1TWIA 4CQAA 2Y88A 4MUPA 5T91A 1YTEA 3RU8X 5A94A 3WF3A 3S1VA 4DBWA 1EP3A 1JCTA 4A35A 3MC5A 4G7EA 1A50A 4JGDA 2ADAA 4Y9PA 4N0RA 1AJZA 3FA3A 3KUMA 1S1PA 1XFBA 3EB3A 3WK1A 2ZA2A 2J7DA 2G5WA 1CXEA 1TV5A 1FWJC 4PEKA 2DH2A 3GNOA 2PDYA 2VFFA 4RUBA 4XIMA 2FFCA 1Q63A 3CAVA 1CLXA 4GIAA 2KX9A 2NWSA 1CXHA 4EANA 3GVWA 2DVUA 4NKCA 1BVNP 3GH7A 2DV0A 3WMBA 4JNYA 1DTNA 3GDMA 3I7RA 3CJPA 5GPRA 2YZRA 3QQWA 2X41A 1PKYA 4HA4A 4FK9A 4B4FA 3LV6A 1DWIM 3M0YA 2WHJA 5JH1A 1FH9A 3WK2A 1GUVA 3URQA 3SAZA 5AECA 3RJXA 2VGFA 1NU5A 2PWEA 5AYYA 1O68A 3GKFA 4M1RA 4M7SA 2BNJA 4IIHA 1QW9A 2ZX9A 5E93A 1RCOB 3NQGA 3STCA 8XIMA 2IXUA 4M80A 1PCKA 1HVQA 4M6PA 4O1EA 1QNRA 5D38A 1EUAA 3AS2A 1W3NA 1HZYA 1GQNA 4LBSA 1REQB 1WZMA 3SB0A 3RLVA 3SCPA 3T08A 4Q8MA 4M0XA 5EFFA 4DUXA 3WY1A 4TV5A 3E1F1 2NW0A 4G56A 1RSCA 2PA6A 3GLCA 3S5OA 4GQGA 4A2SA 3PAOA 1TPEA 1L6SA 3O06A 1WCGA 1VPXA 3GFXA 1LZOA 3BG3A 1KB3A 5AYZA 1FWCC 3KM8A 3GNNA 2E9LA 3GDBA 1H11A 4JHOA 2VR2A 3LS9A 1K7FA 1TX2A 3D6NA 2WQDA 4ZODA 1ME7A 3T07A 1UG6A 9XIMA 1QO2A 3S2NA 4ZQPA 3USZA 3D46A 2A7RA 1U22A 1JF6A 2R8WA 2VNCA 2NLYA 3WD4A 2QUUA 2P5NA 1A5AA 1FDJA 1XYFA 2UBPC 4UWMA 2OLHA 3BLKA 4J9JA 2KAUC 1HF6A 1R7AA 1W3KA 4MYXA 4R5EA 3GE7A 3VKKA 4J1OA 2BWGA 2ESCA 4PUWA 2PPGA 3OTRA 1K02A 4HVXA 4OHQA 2E8ZA 3MMTA 3RX4A 1M9HA 3MHFA 4J3XA 3IIOA 4ZVJA 3TU9A 4JIQA 1ITXA 3BV7A 1HL2A 4P7QA 4C1KA 4PBFA 5EYWA 4LVFA 2OTDA 2BY3A 2C14A 5GJNA 3G0UA 4UC5A 5AHFA 3VZYA 4EPEC 5J5DA 3PUDA 1RHCA 1PZ2A 4F0KA 3BQ5A 2DT2A 4LOCA 1V03A 4JN8A 4AD0A 5HNRA 1N7KA 5CSYA 1MFVA 4HU8A 1POKA 4UR7A 1B0IA 1REQA 1AODA 3B05A 1UR9A 3L4YA 5I03A 2NQHA 2P0OA 3UPBA 3W7OA 3KBMA 1XG4A 2VYOA 4WSJA 1EPXA 4PMXA 5HMFA 3LUTA 1WKEA 4QQUA 4D71A 1P5BA 5CEWA 3WQEA 3S6DA 3SR7A 1GG0A 2O9OA 1MYRA 3LQLA 4GVGA 1IWBA 3B4YA 4JTTA 1SFJA 3VE9A 5U7SA 1QHOA 3M46A 3QKEA 4DVOA 4WUIA 3CWNA 2ZZ3A 1Q6DA 2G41A 3MI3A 7CGTA 1P0BA 4C6JA 1F9CA 2PSNA 1F07A 1A0CA 4C6FA 1T8XA 3HJEA 2PDFA 3QYSA 2PZ0A 4KBXA 3VPLA 5I3GA 2NQ9A 2VOMA 1JZ6A 3W7KA 5FJTA 3SM0A 4IMEA 2Z0IA 5HQLA 1UW9A 3DBNA 2H90A 1EYEA 5D2YA 1DHKA 4ZQCA 2VWSA 4QCEA 1H0IA 3E12A 4KWWA 4JN7A 3WNLA 3NOYA 4Z1DA 3AWNA 2CZFA 3PTKA 3AYTA 4C6OA 4ZQOA 1Q66A 4WDXA 1XV8A 4KRTA 2Y2WA 3OBAA 3U2ZA 3VDGA 1QO5A 1A5LC 1QOPA 2PD9A 3HG3A 2DZXA 2WZMA 1J79A 4WRHA 1XR2A 3M64A 1UA3A 1C91A 3W24A 2PE4A 4O28A 3UJSA 2Y24A 5JU6A 2GZXA 4FPSA 2OWCA 1XYZA 4UTFA 2EPMX 2YDAA 3SECA 4X9YA 2VP8A 1EC9A 4WJXA 4DJFC 3F1QA 1R3RA 1O66A 5D03A 4GGHA 4PMDA 3FLUA 2WLZA 4KIEA 3VNKA 2YDRA 2EPOA 2GGEA 2ASHA 4IP7A 1HFBA 3BMWA 3DN5A 1KD0A 4GINA 5IBXA 2BXZA 1LOQA 3UG8A 5HK4A 1YPXA 5D9OA 1SSDA 2QVNA 3KOWA 2YW3A 1XLFA 4F40A 2WCAA 3HGSA 5FOOA 1KBJA 2IQ0A 2Y7DA 1OM0A 3ARUA 1EC7A 3KVJA 2YGYA 4HZ6A 5A8QA 3G3MA 1US3A 3WFLA 1K8CA 3B8VA 1Q4WA 4DXVA 4W85A 4D6CA 5KTLA 4PSRA 3L4XA 1ZJHA 4I7VA 5LHFA 4OV9A 1FQ0A 5HDRA 1J0ZA 1L8PA 3W1XA 1B57A 1HW6A 4FP1A 4QJ5B 4TR9A 1EKOA 3LGDA 2YSWA 1C90A 5AC6A 3OHMB 4MZ8A 2BGQA 2CBJA 3ZMRA 3MI6A 1RPKA 3CHCA 1BTCA 3O8AA 1YXYA 4DZ5A 6REQA 5DCEA 2MUCA 3GX9A 3P5YA 4RW5A 1FWRA 2E8YA 3RN6A 3B9DA 4IX2A 2PDBA 3AO0A 1VYRA 1DJZA 1AMKA 4M19A 4PCPA 1IEIA 2YA2A 3H55A 1ESWA 4NZJA 1R2TA 2FGZA 1R6WA 4GBDA 3GY1A 5DRCA 3PZGA 4LUTB 2WAGA 3EX2A 1NARA 7PTDA 4KKXA 4NZCA 4XQ6A 4GY7A 4JICA 2OSXA 2BY2A 2J74A 4WEVX 4XSMA 4XZMX 2VMFA 3NGJA 4E8DA 2QZRA 4LQ1A 3RO6A 3CK5A 3W7CA 3TH6A 3NL5A 1RAKA 3ZLFA 3R25A 1VC4A 3NURA 3E0FA 2BDQA 4G1KA 2Z4GA 3BLFA 3DFQA 4CCZA 3PN8A 5K9XA 1UJPA 3T05A 4F66A 1QXLA 1OQFA 5CZSA 1ME9A 1UWAA 4HYVA 5E0CA 3W7DA 3ICJA 3GW0A 2CEQA 2Z7KA 2DW6A 5CGMA 4LS0A 4AIOA 4D6HA 3ERPA 2GGJA 1IZJA 2AMGA 2I56A 2O7QA 3AWOA 3S2JA 3DYOA 4H2CA 1JCLA 1S3HA 5EB8A 1MZRA 3CZEA 4Q8WA 1TFVA 3UG3A