2CYGA

Crystal structure at 1.45- resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELIPGSDLAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESGWPSAGGGAEASTSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQKAGGIEQNFGLFYPNKQPVYQISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure at 1.45-A resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords beta-1, 3-glucananse
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cygA00
3MS8A 1F4AA 4AD4A 4PMNA 1HN1A 3MV01 3CZGA 3GZAA 2B31A 3JUGA 5E6ZA 1Q4NX 1R86A 1M03A 3U5UA 1JF5A 1LL7A 4S3KA 3ZOAA 4CN6A 4F9DA 5IHSA 3UEQA 4CU7A 1DP0A 2PWGA 3ALFA 1TCMA 3SURA 3THDA 4P8XA 4AIUA 3LMYA 1W91A 1DHKA 3KWXA 3VD5A 1E6ZA 1XSJA 4D6IA 3VKKA 2PBGA 1OINA 3DHPA 1C7TA 4KWUA 4OBRA 2EPMX 1W3HA 2XSAA 3MSGA 2ZXAA 3F5KA 1CIUA 3ALGA 1WCGA 1E5JA 3RM4A 1H11A 1LL6A 3WH9A 3N15A 1C90A 4D6FA 2CHOA 2J78A 3APGA 4QDMA 4WSKA 3WF0A 4OKDA 4QAWA 3EMQA 3M46A 3ZSSA 2FH8A 2PC8A 1UWRA 3AHYA 3CPUA 5KZ6A 1CGWA 3PBGA 1CECA 1CPUA 4JFTA 3AHZA 2Z1SA 2JIWA 4LYPA 2BV9A 4Z2GA 3ZO9A 5JBDA 3TOPA 1LLOA 1OGGA 1XCWA 3A4WA 3VILA 2YOCA 2WVVB 3VIPA 4JKMA 1H0GA 1W1YA 1IT0A 3W0KA 1MQRA 5CZKA 3S6TA 3T09A 3SCQA 4W7WA 1Z32X 2UWFA 5DFAA 3VGFA 2XG9A 3WNOA 4TXEA 1E4MM 1LWHA 2DSWA 2NT1A 3ECQA 1U33A 3CZKA 2W61A 1OT2A 1MFVA 1CBGA 1ITXA 2RGMA 2VZOA 2X2YA 2CCRA 3GXDA 1VEPA 3ARRA 4ACZB 1BF2A 3NCOA 4ZE4A 4GI9A 1E0WA 1PIFA 2XTKA 5AC4A 4P8WA 4HU8A 2E0PA 1BLIA 1J0KA 1J10A 1WB0A 1TMQA 3NSMA 4AEEA 1K6AA 1V0LA 1XH0A 2W92A 2DT2A 5A6JA 1JZ2A 4EK7A 4UZSA 1UWQA 1J11A 5AC5A 2D0GA 2V3GA 3OGRA 1OB0A 2VNCA 4E4PA 3ARTA 2QV4A 2WCSA 4TTUA 3W81A 1NARA 3PZUA 4H2CA 2DT1A 1VJZA 1HVXA 5E0FA 1VRXA 1FP8A 1L0PA 4PCTA 4M24A 4Z2LA 3CUIA 3VD9A 1ITCA 1PJ9A 1V02E 2GK1A 1PBGA 5EB8A 3OIHA 3IAPA 1B9ZA 3AHTA 3OBAA 2NT0A 4OBSA 4ZE5A 2BS9A 2V38A 3AHXA 4OOZA 5DF0A 4XUYA 3WEZA 1GVYA 5BCAA 3T2QA 5KEZA 5A6BA 2VX6A 2CHNA 4TVCA 3NDZA 5A8PA 3CIVA 3N04A 4TVDA 1E73M 4NZCA 4AISA 4AZ6A 1OWQA 3ARXA 3N9KA 4U5IA 3OZPA 2XSBA 4GO9A 3PN8A 4X9YA 4D1JA 3WD0A 2X05A 4AYSA 4DM1A 2XIIA 4UFMA 5E6YA 2E3ZA 3EDFA 3ZJ6A 3LPOA 3VNZA 1CGTA 1E4LA 2YKKA 1HX0A 4CD5A 2BY3A 1NOUA 4MB5A 2CNCA 3WY1A 1KXTA 3AS0A 4WLCA 3WD4A 1H41A 1WE5A 2WMJA 5A6AA 3MU7A 3RMEA 4E8CA 4NSBA 1NQ6A 4NI3A 4B16A 1BTCA 3WD3A 3VDBA 2GJPA 3FN9A 1QBBA 4Z2KA 1KXHA 4WKAA 3KL3A 5I79A 4RE3A 3NUKA 2DDXA 3WF4A 2ZIDA 3AYSA 3SCNA 3SUSA 4UOJA 2Y24A 4HA3A 3CHFA 4JCLA 4MJ4A 2YA1A 1E6NA 4YHGA 2VQUA 2CBIA 1G01A 1UH4A 1KWKA 1W9VA 1GHSA 3L4YA 3BMVA 3IAQA 2WCAA 1XCXA 1V3LA 4WF7A 1JZ8A 1CLXA 1UD6A 1PAMA 3NIYA 2MANA 1O7AA 3WL1A 3CGTA 1I75A 3CMJA 3AROA 1J0YA 3RM8A 4CGTA 2A3CA 3MO4A 1FH7A 4LX4A 2EEXA 3DECA 3BH4A 3NDYA 3WQ6A 1C3FA 4OJYA 4PMUA 2QHAA 3QHOA 1X6NA 4E2OA 1ZL1A 2F61A 1E6RA 3WBEA 4D1IA 2ZXQA 1C93A 3N11A 5ABEA 3FAWA 5DEZA 4NRRA 3IJ7A 2ZX6A 1XRVA 3D3AA 2E40A 3HMCA 5HXMA 2VRJA 3B8SA 2D2OA 3AS1A 3CO4A 4UFLA 3ZJ7A 3AZRA 3TP4A 2DGAA 5CPSA 3DHUA 1E0VA 1K9EA 3GXMA 3VIFA 4IPNB 3ARPA 4V2XA 3EDEA 3RIKA 2X1IA 4MADA 1HJSA 2XIBA 3W28A 3MMDA 4HA1A 2VR4A 4UQBA 1W1PA 1SMDA 4HPHA 4N0RA 2XM2A 2XWEA 1O6IA 5LA0A 1B0IA 1BVNP 1JDCA 2XVNA 1ZBWA 3I3BA 2VJXA 4OOUA 5GNXA 3CLWA 1VF8A 1EHNA 3BXWA 5E9AA 4V27A 4ZXOA 4PMXA 2OYMA 3ZSTA 2G4FA 2QMKA 4H8HA 3CZLA 1OIFA 4HZ7A 3WSUA 1W9UA 1X1NA 3VX0A 1W1VA 1WZAA 2DSZA 2VR5A 3U7BA 3N18A 1GVIA 2W4XA 1AQ0A 1WDSA 3K1DA 4B3KA 1Q6GA 4GIAA 1VEOA 2VX7A 2J77A 6TAAA 2WMKA 1QVBA 4JKKA 3ZM8A 1B90A 1VBRA 3UESA 5A6MA 1JYNA 4BQ3A 3ARZA 1PX3A 4YHEA 1CWYA 3VOCA 3LPFA 5A8OA 2XGIA 3W24A 4AZHA 3D5HA 4MTVA 1M7XA 1H09A 2OWXA 1TA3A 5ABHA 1IZJA 2DT3A 5JUVA 1Q6CA 4R27A 3MSDA 5JIPA 4BZYA 3S2CA 5FOOA 2J8GA 2VMFA 4AC1X 3MMUA 3W25A 3MUZ1 1VFFA 3ARYA 1WZLA 1QI3A 3W6LA 4W88A 2ZX7A 1W9XA 1GOQA 4WSJA 2DIJA 5BXPA 5HDRA 6A3HA 4ATWA 2CYGA 2XFFA 3QOMA 4AZ7A 1E71M 2NSXA 1XYFA 2YL6A 1BQCA 1ZS2A 4PBGA 1C7SA 1K9FA 3A47A 2OYLA 4CUCA 4ATLA 1PX8A 4W7VA 4IUGA 5CLWA 1BSIA 2RGLA 4M82A 3FHQA 4P7RA 2GJXB 3GXIA 1RP9A 2WZIA 4DUVA 4UQEA 4M29A 2XFRA 1YQ2A 3WUFA 1FOBA 3POHA 1H3GA 3WF1A 2UY2A 3A4AA 5D9NA 1GQLA 4GQQA 3SUTA 3MMWA 1NWUA 1UKQA 4PTMA 4ATDA 3KEHA 1NOWA 3VD4A 4C7GA 1GOKA 1QHOA 4GQRA 1F4HA 3DYMA 4QFUA 3GNRA 1JL8A 4BQ2A 4F8XA 4LPCA 1MXDA 3M7SA 1JAKA 5A95A 3L2MA 4FLRA 4L4OA 1DWFM 1RPKA 1UR2A 3VMNA 5ABFA 3A3HA 2EJ1A 4AIEA 4PMOA 2OLHA 1BVZA 1ESWA 1H1NA 1SYTA 4HZ6A 4LYRA 5IFTA 1B3YA 1E1FA 4URIA 3WDIA 1B3VA 1FH8A 2PB1A 3ZT5A 4MDPA 3NYDA 3AMGA 4RE4A 2O9RA 4ACZA 1MQQA 1R8LA 1WP6A 2AAAA 1J0HA 3L4WA 4CD7A 1TZ7A 1SFSA 1V6UA 1ISYA 1X6LA 4UOZA 2GK1B 4P8UA 3WUBA 1MW0A 3WENA 1GPFA 1UZ1A 1VBUA 2CIPA 2ZXDA 3PZOA 2VX4A 1QW9A 3K8LA 1WDPA 3LPPA 3VM7A 1GOOA 2J7GA 2WHMA 1TA3B 2CBVA 1MQPA 4AY1A 1NH6A 2UY3A 4PMYA 3BLKA 3T2OA 1CDGA 3L4UA 3AZSA 3UG4A 2WSKA 3AQUA 1EGZA 4QP0A 2DQXA 4AZCA 5JBFA 3HU7A 4DWSA 2ZUNA 1CGUA 3PHAA 3IJ8A 4CN1A 2J7EA 2BXZA 3AICA 3N17A 3VIMA 3VMPA 5FL1A 1HNYA 7A3HA 3WQ8A 1ISVA 2A3HA 5I78A 4QCEA 1L8NA 3WL0A 3ZQ9A 1TUXA 2DSUA 2VO5A 4B9ZA 1E6QM 3W4RA 3SCRA 4CD4A 3O9NA 3EDJA 4V28A 5CSUA 1KXQA 4W84A 1KR0A 1CZ1A 2XVGA 1JNDA 2WVSA 4JIEA 4RE2A 4JL1A 5D9OA 1JFHA 1UKSA 4CD6A 1XD0A 1MWOA 1S46A 5D8ZA 5DO8A 3TTQA 2CEQA 1C92A 1GNXA 4F9JA 5D4YA 1OSEA 4ZEPA 3THCA 2WMGA 4AEFA 1EH9A 4MDOA 4A3YA 5D9PA 1I1XA 1GQJA 3L4TA 4MB4A 4OZOA 3SCSA 5GPRA 2CBUA 2WBKA 5HNNA 4HZ8A 5A6BD 2E9MA 1DTUA 1SMAA 1BAGA 1JZ7A 1JYXA 4IISA 1YHTA 4JKLA 1ISZA 1UR0A 3WNLA 3WF3A 2CXGA 1A47A 1R87A 4AZGA 4D6GA 3L4VA 1NWSA 3WNKA 2YBTA 2J7HA 3T0DA 4PTVA 1EA9C 2VQTA 1JZ5A 2WPGA 3EDKA 4MNLA 1UR9A 5BXRA 2ZWYA 4AZ5A 1HKKA 2PI6A 1Q6DA 4D6HA 1JD9A 2D3LA 1FHLA 1QNSA 3VGHA 1V03A 3OA5A 3VM5A 4P8VA 3G6LA 1D7FA 4AD2A 1OD0A 2WKLA 2F2HA 1B31A 1GQIA 1UQYA 4JFUA 2BY0A 3TONA 5DT7A 3VINA 2WLYA 4AW7A 3CH9A 2JF6A 4PTXA 3AMKA 1JYWA 1V08A 1GQKA 1KR1A 1KFWA 2WMFA 4UQCA 1EO5A 2BFGA 2ZICA 1ODUA 2VOTA 5BROA 3LPGA 1EQCA 4L4PA 2W5FA 2XYLA 3ARSA 3NSXA 1CGYA 2ZXBA 1W3KA 4AIOA 2WXDM 1UD2A 1XSKA 1Q6FA 3RJYA 3PZTA 2D20A 1V6VA 1GORA 1GOIA 4QLLA 3AMCA 3WQ4A 2BY2A 1M04A 3VPLA 1U30A 4TOQA 3WNMA 4H8UA 1QNRA 2XM1A 2ZUWA 4WK9A 3W38A 3IK2A 3AXHA 2JF7A 1OM0A 1XC6A 3O6AA 1WNOA 5C8BB 4FK9A 1RH9A 2WC4A 3M6DA 2D3NA 1BFNA 2YA2A 2J75A 3RCNA 4LYQA 2YDRA 2GDVA 1UG6A 2WKGA 3WDQA 4HMCA 2BY1A 2ZUMA 3VDAA 3BAJA 3CZ8A 4W87A 1DEDA 4C7FA 3WQWA 4KRUA 3WH6A 1E6SM 4JHOA 1C91A 5AYBA 3HN3A 2W66A 1JGIA 2NW0A 4AMCA 4B9YA 4GPNA 4D72A 4EKJA 4P7LA 5AY7A 2YJQA 3VIJA 2EBNA 2VTFA 4E8DA 3FXYA 1QI2A 3QHNA 4JAWA 1CTNA 1E9LA 1CXLA 3A4XA 4J3VA 3MUAA 5HPCA 1QBAA 3ZMRA 3GBDA 3BCDA 5A2BA 2WAGA 4QLJA 1EDQA 2WVUA 4DUWA 4H7VA 4HOXA 5A6SA 1UYQA 1XSIA 5LA1A 3AIVA 1GOWA 1OGBA 2XJ7A 4KRTA 4XB3A 3K46A 2BHUA 4BF7A 3WDJA 4DWSB 1KQZA 3SUVA 3WH8A 2QMJA 3SCUA 2VL4A 1FFRA 2CKRA 1PZ3A 4CD8A 1OD8A 2Y8VA 1M01A 3CMGA 3VIOA 4XZBA 3PZMA 5HPOA 2WANA 1US2A 3K8KA 1HF6A 2VZSA 3EDDA 4CCEA 1WKYA 2AMGA 2WSPA 2D22A 5BYWA 1DWHM 4HPGA 1E6PA 4QLKA 2O9PA 4FMVA 1WZKA 5ABFB 3WEMA 1UOKA 5IHRA 1FH9A 1V3HA 1W9BM 3WMSA 2VUYA 1ECEA 3GNPA 2O9TA 1J01A 5A8NA 2GUYA 3UCQA 3WUGA 5C71A 4WKHA 1K9DA 2X0YA 3WDHA 1GJWA 2EPLX 1GCYA 5EMYA 1NP0A 4XV0A 4TTGA 2D0HA 2GFTA 2PWDA 5HOSA 2W62A 4PCSA 3L4XA 2ESCA 4W85A 3CTTA 3SCOA 4AD1A 5I24A 2QF8A 1UZ4A 5ABGA 1E55A 4YN5A 1UKOA 2X09A 1GW1A 4UFJA 4ZFMA 2Y5EA 4P7NA 1QNOA 1QI0A 4CN4A 3T0BA 1PEZA 2CPUA 3SUUA 1XH1A 3I3EA 2GDUA 1J0ZA 1FHDA 1H2JA 5A8MA 3KL5A 1UWIA 2CBJA 4UQDA 3CHEA 4UQAA 1PX4A 2WHLA 4N42A 3AFBA 5LYRA 2DT0A 1Q6EA 4PTWA 1HJQA 2TAAA 2DH2A 3AIRA 3SCWA 2OWCA 1BPLB 1HJVA 2Q8XA 4CU8A 1JDDA 4P7OA 4J3SA 4LXFA 3B9DA 1ZJBA 3CUGA 4JL2A 1QI5A 5FD0A 1V0KA 3FHAA 3SEPA 2D24A 1W3LA 1HL8A 1TVNA 1MXGA 3W29A 4HOZA 1G0CA 2VT0A 3VNYA 3AXIA 1AQHA 1OGSA 4BQ5A 1JXJA 5I5RA 1KCKA 4KGLA 1JDAA 2PBOA 2YBUA 2WB5A 1RD6A 1HKJA 4W8AA 4LGXA 3CUFA 4UFIA 4U5KA 2ZUSA 4ZENA 2CERA 1QNPA 3EYPA 4WIWA 1SR0A 1JAEA 3W26A 1ZU8A 4Z2JA 5A6LA 5BXTA 5E0CA 4UCFA 1B3ZA 2WMIA 3PTMA 1GHRA 3AIBA 3POCA 5CGMA 1NOFA 4S3JA 3AMLA 4GZJA 3WNNA 1JZ4A 2IUZA 1ZJAA 2BVDA 2BHZA 1JXKA 2YL8A 2WNWA 3CHCA 1LQ0A 2IXUA 2BVYA 4FLOA 1TVPA 3PZNA 2XPKA 1WO2A 1UA7A 4DM2A 4W7UA 1J12A 8A3HA 3TTYA 5CG0A 1Y7VA 1NWRA 3U7VA 1KBBA 1EHAA 3PTQA 4MB3A 5D8WA 3OLDA 4J28A 3BAIA 1BYAA 1UD3A 1AMYA 1J0IA 3UG5A 3GH5A 1B30A 1AQMA 3OZOA 2G41A 2XVLA 2ZUTA 5I3DA 1WDRA 3NJ3A 1GOMA 2E8YA 2X0HA 3WQ5A 1WDQA 3BCFA 3II1A 4PMVA 5IDIA 5A94A 3DYOA 1W3JA 2EO7A 2CITA 3W27A 1KGUA 2WM0A 4IM4A 3VX1A 4IPLA 2UY5A 1LF1A 1EOKA 1HKIA 1TE1A 1C8XA 3W6MA 3SCVA 1E4NA 2FGLA 4XZWA 1W2VA 3VGDA 5I6SA 2VI0A 2Y4SA 1VB9A 2OSWA 1W2PA 2VX5A 3WNPA 4JHZA 1ODZA 3FAXA 3VVGA 3WIJA 5D9MA 5ECUA 4UOQA 1V3IA 1CENA 1H0IA 1EIBA 1WAWA 3SUWA 3WKZA 4U3CA 2OWWA 3A6OA 1HXJA 4JCMA 3AS2A 2VCBA 4GKLA 3WN6A 2XHYA 4JFSA 3VIIA 1JG9A 1EO7A 2FGZA 2GJXA 1E43A 1VENA 3DYPA 2YA0A 1E3XA 4AZCB 1W1TA 1CGVA 2J25A 4MB1A 3SCTA 1XYZA 3ARQA 5CXPA 5M3WA 4U2YA 2VC9A 4ML4A 4J3TA 4GI6A 1ISXA 3T0AA 2YL5A 2WHJA 4M8UA 1G1YA 1JD7A 4AZBA 2YLAA 3WBAA 3VO0A 4Z2HA 1EDGA 3ZT7A 5M5DA 3T2PA 3L2LA 1H4PA 2WLZA 2GSJA 1E56A 2XGBA 4CCCA 3VMOA 4MNMA 4EANA 1UH3A 3L4ZA 4UQ9A 1GJUA 2V5CA 1KXVA 1GUVA 2EQDA 4FLQA 3RDKA 2WVTA 2DH3A 4B15A 1E5NA 4U33A 5EBAA 2ZUUA 5TD4A 4AD3A 4EAMA 1ZBKA 1KQYA 3GH4A 3AISA 1E6XM 4LQ1A 4PMDA 3BSGA 3OGSA 1G9HA 2BXYA 2J47A 4D6DA 3UETA 2FHFA 3KL0A 1EDTA 4D71A 2J7FA 3OGVA 1XH2A 3AOFA 4AZIA 1TG7A 1UHVA 2J62A 1EOMA 3WMBA 3GYCA 4HTYA 3TA9A 4AD0A 3ARUA 2VRKA 1R7AA 5JIWA 1B3XA 3UERA 3WD1A 1VIWA 2ZUVA 1LWJA 3GNOA 4H04A 2WZHA 2V5DA 3GM8A 4PMQA 4PUEA 1KB3A 1XHGA 4GZIA 1GZJA 1KGXA 4MAVA 2J74A 5CJ5A 1VFUA 3OG2A 4CKQA 4XX6A 1LJYA 5GNZA 2BVTA 1PZ2A 1UR8A 1NM9A 1BYBA 2VRQA 1CNVA 5JBEA 4UFKA 3CHDA 5C70A 1FFQA 2WW5A 5CGTA 3MUIA 2ZOXA 3UR8A 1I1WA 1MW1A 2XVPA 4WKFA 1UD4A 5A6KA 5FIPA 1XGZA 1HL9A 2E9LA 3KZSA 1JFXA 2E9BA 3PZQA 1QW8A 1QI4A 3FW6A 1V6YA 4J3UA 4J3XA 3BAYA 1UWSA 3VD3A 3AMDA 5BRPA 3B9EA 1CEOA 2QPUA 3I3DA 1CXIA 4UZUA 4BS0A 4M80A 3RPMA 2YLLA 2BNJA 4HU0A 3AIWA 2CESA 3WD2A 1N82A 1PIGA 1VFMA 2VCCA 3EMCA 3PZVA 3TTOA 4F66A 1VAHA 1MW3A 3HJEA 3AYRA 4JFWA 1UKPA 3AIUA 4X0NA 2C8NA 2ZX5A 1HP5A 4YPJA 4OIFA 2JEPA 2HISA 3G6MA 2DPEA 5I2UA 2YDQA 5GQBA 1BG9A 3WFZA 2GJRA 1FA2A 2G3NA 4J27A 2WZEA 3MUY1 1KBKA 4Q7NA 3O2LA 3VUPA 4Y7EA 1OT1A 1NWTA 4RL3A 1TFVA 3WF2A 2OYKA 4A4AA 1VJSA 2GVYA 3CUJA 3FNDA 3N12A 3W82A 3BLPX 4CU6A 8CGTA 5I0DA 5CQ1A 2PF0A 4KH2A 5CPQA 1R85A 2J79A 3WQVA 1MYRA 3F5LA 4U3AA 3AJ7A 3TTSA 4D6EA 2WYSA 4HOWA 4HMEA 4BQ4A 2WWDA 4PSPA 3PZ9A 4X0VA 3PZGA 2ZWZA 3M07A 4GXPA 1JI1A 3NSNA 1HJWA 2VVSA 4GZEA 1V3MA 1UWUA 1J0JA 3GBEA 3SIMA 1XD1A 4W93A 4PSRA 1CYGA 5M03A 5BRQA 3DC0A 1HVQA 1ZBVA 3MKKA 4OUEA 1E0XA 2J7BA 4M56A 4D6CA 2VZVA 3VU2A 4W8BA 3BSHA 3BGAA 2WC7A 2IXVA 1BHGA 2VZTA 1CXEA 4P7QA 3GDBA 4U31A 3WH5A 3W53A 4JFVA 2C7FA 1JNEA 1VEMA 1E70M 1K9TA 4M81A 2V3FA 2O9OA 1U2YA 2OSXA 4W86A 9CGTA 1IV8A 3WH7A 3AI0A 2D0FA 3GTNA 3BMWA 3W37A 2G3IA 2JE8A 3AIQA 3ZJ8A 1V0MA 4PN2A 5FKYA 2V3DA 3FY1A 2FH6A 2WC3A 4ACYA 3BC9A 1BG4A 4NRSA 5E70A 1AVAA 2J7CA 4WJXA 2WMIB 4J7RA 3OLGA 1W9PA 3RO8A 4AWEA 3MANA 1LG1A 2ZE0A 3QR3A 3J7HA 4TVUA 1V6XA 3VGBA 4W8LA 3GXFA 3UR7A 1HJXA 5A69A 2ZX8A 4BA0A 1RP8A 1A3HA 3ZR5A 1H49A 3EMZA 4MAZA 3MV11 4PUDA 3WEOA 3BAXA 3ARVA 4PMRA 4PRWA 1E3ZA 1JYVA 4CCDA 1KWGA 3CUHA 1BGAA 5A3HA 1BYDA 4J3WA 3PZIA 1VFOA 1UQZA 2E8ZA 3WMCA 1G5AA 2G3JA 3PTKA 1CLVA 2WMHA 3QOKA 5M17A 3WDPP 1XV8A 2F8QA 2XWDA 4GINA 2A3BA 2HVMA 2V3EA 5IXEA 1G94A 1HJUA 4DUXA 1H5VA 3WDRA 4Z2IA 3AXXA 1QHZA 1JZ6A 1CXHA 2Y8KA 2WCGA 3U5YA 5A1AA 2DIEA 1HT6A 2Y2WA 5CSYA 1LL4A 3AIEA 3WELA 3VIHA 2W67A 3VIKA 3ZT6A 3VDCA 2VZUA 2WWCA 5A2AA 4TX8A 3WFLA 2PWEA 1W32A 4ZXLA 1OBAA 1ZBCA 3OLEA 3VIGA 5HBFA 5EFDA 2J7DA 1IZKA 5I23A 2WK2A 1R7OA 1ISWA 1E72M 5A8QA 1UUQA 1UD8A 4UTFA 1MW2A 4W89A 2A3AA 2YIHA 4EE9A 4D6JA 4R5EA 1FP9A 2VURA 3OLIA 4CVWA 2J8FA 1NP2A 3U57A 1HKMA 1KCLA 2D23A 3B9AA 1KGWA 3K8MA 1BYCA 3UG3A 4Q22A 2JEQA 2EPKX 2EPNA 3BAKA 2D1ZA 2FHCA 5FL0A 3AZTA 3K4AA 3N1AA 1JZ3A 2G3MA 2W91A 2WVVA 4UR9A 1E15A 1CXKA 3T08A 1OCQA 3E1F1 2YL9A 4MPKA 1JF6A 1V3JA 5I77A 5E09A 4PYSA 1C8QA 5IFPA 3GH7A 4NF7A 2QPSA 1EQPA 1UR1A 2BHYA 1D3CA 1J18A 4AXNA 2O92A 1DWAM 4JZ5A 5FCZA 1DWGM 4K68A 6CGTA 2VVNA 2J4GA 2PWFA 1B3WA 1P6WA 3KE0A 2WBGA 4HA4A 2DSVA 4PMZA 1V02A 4W5ZA 4FLSA 2ZX9A 4GI8A 3WUEA 2X8RA 4C7DA 4MNJA 1BGGA 1EXPA 3RM9A 4CVUA 4UFHA 2JALA 1ZB5A 1JIBA 1QNQA 2EPOA 3IJ9A 1QPKA 3CZJA 5DT5A 2Z1KA 1HP4A 1V6WA 1B2YA 2E4TA 2QLYA 1V0NA 3ZIZA 1C8YA 2WHKA 2W63A 3QHMA 1CXFA 1HIZA 3ZJKA 5F7UA 1UA3A 1V3KA 2UY4A 4UNIA 3VDHA 4A3HA 1DWJM 4H41A 3RILA 4BCEA 2DSKA 1M53A 1DWIM 2AOSA 3AS3A 1QOXA 3OB8A 2JFEX 4KGJA 1UKTA 1MFUA 3SCPA 2FDMA 4GO8A 4MJ2A 2OSYA 1E1EA 2XFYA 5GNYA 4KMQA 1J9YA 3BAWA 4PEEA 5BWFA 4DWSD 2A3EA 3K4DA 3ARWA 1WZMA 4QCFA 1B1YA 3N13A 5CPTA 2XVKA 1OIMA 4TX6A 2C0HA 4F79A 5LA2A 1MVYA 1WPCA 3VGEA 3AHVA 4W5UA 1UD5A 4HMDA 4B3LA 1GONA 1QHPA 5EFFA 1JI2A 1US3A 7CGTA 3EBVA 1E40A 3CZEA 3RJXA 1TR1A 1UWTA 3ZR6A 5A2CA 4HP5A 4H8VA 4M1RA 1W9DM 3CBWA 1UR4A 1E4IA 2EXOA 3QGVA 5DMYA 2CKSA 2G8ZA 5CLTA 2XUCA 3VTRA 2CETA 2DEPA 2JIEA 4TUFA 3F5JA 4DWSC 4MNKA 2YDSA 1D2KA 5BXSA 3VGGA 1PPIA 1UH2A 2FHBA 2VCAA 1CGXA 4FF5A 7TAAA 5AYIA 2PWHA 3VD7A 4AD5A 3IANA 1LG2A 4U2ZA 3F4VA
chains in the Genus database with same CATH superfamily
4MIMA 4TU1A 5FJUA 2PDCA 3E5PA 3AC0A 3KRUA 3KS5A 2B31A 2O7SA 2HSAA 1XLGA 3M0ZA 5AZ0A 4CN6A 5IHSA 2IKIA 3SZ8A 1DP0A 1ZRQA 1TMLA 3SN0A 3THDA 2ZA3A 3FSTA 2G97A 4FAMA 3VD5A 1E6ZA 1HO4A 1PTAA 4KEVA 4C1LA 1TTPA 3VKKA 1C7TA 1W3HA 2XN1A 1WCGA 5IBXA 1LL6A 5I02A 3R10A 2V67A 4CQAA 3UWYA 4P2VA 3W72A 5DN1A 4O0KA 2J78A 4WSKA 4Q4KA 4G2DA 4QAWA 9XIMA 3QBUA 2GGGA 4YCPA 3I6TA 3PP7A 4HK7A 5KMYA 3AHYA 3H2OA 5KZ6A 1CGWA 3PR2A 2FTWA 3CQHA 2FMNA 5KZMA 2JIWA 2FB3A 2BV9A 4O19A 4RDZA 1E9IA 3TOPA 2PDXA 1XCWA 4NIRA 5T26A 1TR9A 3W71A 3T05A 4JKMA 2NZLA 1W1YA 1MQRA 3LHYA 2PDBA 3T09A 3SCQA 2Y5SA 4HHPA 2ZE3A 4EACA 2DJLA 5DFAA 3BOXA 4ORMA 2L5HA 1E4MM 2JKAA 2PURA 3OVRA 1MFVA 3LCLA 1CBGA 4POCA 2X2YA 1O5QA 3GXDA 3ARRA 4K36A 2ISWA 3ONCA 4XIMA 1WKDA 2Q09A 2XTKA 3W00A 4P8WA 4PGLA 2Y89A 1J0KA 3C56A 5JH2A 4AEEA 1V0LA 1XH0A 2OT1A 1T8XA 2NX1A 5U7SA 3OIXA 4EK7A 3UY8A 5AC5A 1OB0A 4E4PA 3ARTA 4TTUA 2DUAA 3PULA 3W7DA 1S5MA 1LOQA 4M24A 4NX0A 6ALDA 1RVGA 1PJ9A 4G1NA 1TUFA 1PBGA 5HMSA 5H91A 1H7RA 2WJZA 5EB8A 1CI1A 4MPQA 4AWSA 1BWLA 3OBAA 2NT0A 4ZE5A 4S39A 2VHLA 3AUJA 3U2OA 4IXHA 3RPTA 3WLLA 3M5YA 5CG7A 4DX3A 4H9VA 3ID7A 3WEZA 1V8EA 5BW6A 2I14A 5BCAA 2ZZ5A 3T2QA 5A6BA 4QTGA 5CZTA 5EMJA 4MUZA 3N04A 4M6UA 4M6PA 1E73M 3YPIA 1XIEA 4AZ6A 1OWQA 4U5IA 3N9KA 2XSBA 4RNHA 4GO9A 2VEFA 4O1EA 2PE4A 1Q13A 2X05A 1FCVA 4AYSA 2E3ZA 5LXEA 3PSVA 1XLJA 3LPOA 3VNZA 4BEQA 4NZ1A 1HX0A 5G2WA 5CCZA 4CD5A 1GKQA 1JQXA 4MOZA 3M9YA 4A21A 1H41A 1WE5A 2WMJA 3RN6A 1UBSA 4DF0A 2J88A 4ICNA 3MU7A 2OVLA 5KZEA 4B16A 3W1QA 4IPIA 3LG3A 1ICSA 3E0IA 3WD3A 2ZZ1A 3V5FA 3W7CA 4Z2KA 1KXHA 2AGTA 4WKAA 1PYMA 3TYCA 3GUWA 3BV4A 3AYSA 5JVLA 1XFBA 3DIPA 4HA3A 3CHFA 4O14A 4MJ4A 2PDJA 1X7IA 5G1MA 1AW2A 4LS2A 4YLWA 5CPOA 3MSYA 3ZYZA 1W9VA 1GHSA 3L4YA 2A7RA 1NTHA 4MY8A 3BWWA 4PUNA 1VC4A 1V7YA 4FALA 3SN1A 2A3CA 1JUKA 3S5ZA 1XUUA 4FNPA 4IT1A 1C3FA 4PMUA 2QHAA 3QW4B 1RSCA 4E2OA 2OODA 4LV9A 1E6RA 3Q58A 3LK6A 3THAA 1K70A 3H2FA 3FOKA 2I5GA 4KCVA 3FAWA 3BTNA 3IJ7A 2ZX6A 1B57A 3HMCA 1TV3A 4S3EA 3HB9A 5FEWA 1XGEA 2D2OA 2YB1A 3K4WA 3GR7A 3AZRA 3TP4A 1RJQA 1OZMA 2DGAA 3DHUA 5JQ9A 1E51A 4JTRA 1E0TA 3CAVA 3ARPA 1XPYA 4ZL1A 1ZP4A 3EDEA 4Q8MA 1ONRA 1MSSA 2F6XA 5EKYA 5FF7A 3W28A 4GYKA 5C5YA 3OVQA 4UQBA 1SMDA 4EAYA 5HNRA 3LERA 2XVNA 3F2CA 1OFBA 2VJXA 4OOUA 5GNXA 4A3RA 2D2HA 5E9AA 4PMXA 3ZSTA 3G0SA 1A80A 1B4KA 3QW3A 4HZ7A 3WSUA 1W9UA 3N4EA 4LNCA 1W1VA 4LY4A 3K1DA 3TFCA 1Q6GA 1ITQA 3IUIA 1GW9A 4IG2A 3ISIX 1MEWA 3W76A 6TAAA 2WMKA 4JQ2A 2ICSA 1U5HA 1B90A 1VBRA 3M44A 3UESA 1EB3A 3PJUA 2CZ5A 4OTKA 5A8OA 4D8AA 4AFYA 1XLAA 2OWXA 1TA3A 2HROA 1G4PA 5ABHA 4HN4A 3GDTA 1Q6CA 1PV8A 3NOYA 4DO6A 3L5LA 3S2CA 1R9XA 4H01A 4PCPA 1OJXA 4GCAA 2J8GA 4AC1X 4D9PA 2G5WA 2POZA 1XXXA 3MA8A 3W6LA 3NO1A 4AF0A 1RBAA 2OZ8A 1W9XA 1GOQA 4IJBA 1KM4A 4ATWA 2A85A 3FYOA 1E71M 4PBGA 3LQGA 2OYLA 2W27A 4LV4A 4CUCA 1PX8A 1OFQA 4Y90A 5CLWA 3V7PA 1BSIA 3TJIA 1E1CB 4GBDA 3CWHA 2OG9A 4DUVA 1EJUC 1KM6A 2PTXA 2R91A 3PBVA 2V82A 4GY1A 3WUFA 1FOBA 5AECA 5D9NA 3A4AA 3E02A 4WDTA 1GQLA 4GQQA 1K1DA 2I5IA 3SY8A 4M1BA 3F4CA 4C7GA 3O16A 3JVAA 4F8XA 4LPCA 1MXDA 4HNCA 5A95A 5AC6A 1DWFM 1RPKA 4PFMA 2EJ1A 3NQVA 1GG1A 4AIEA 1OZQA 4DI9A 1NJJA 1ZZMA 2EKGA 1H1NA 2QGYA 2ZC8A 3HGOA 6XIAA 3Q2DA 1ONEA 2P1FA 3WDIA 2NX9A 5FJOA 1VQTA 3C2EA 3RU8X 2POTA 2PB1A 4MDPA 3NYDA 3PPCA 3PB0A 1FKXA 4ACZA 4XO7A 3O15A 1SFSA 4LVGA 4NJIA 1V6UA 1XW8A 3NQ2A 3WENA 3ZR4A 1QRQA 1O60A 4H9XA 5LNWA 3PZOA 2VX4A 3TQKA 1GOOA 3T55A 1QR7A 2UY3A 3CU2A 3QY6A 3T2OA 1OC6A 4EVZA 1YNPA 3ABQA 1EGZA 4IP5A 4QP0A 4JR5A 4XKYB 5JBFA 4FPSA 3L68A 5AHIA 3PHAA 3IJ8A 1DYSA 4YYFA 2BXZA 3AICA 1HG3A 1WXYA 3VIMA 4DAFA 3MI2A 3WQ8A 2ZRUA 1VJIA 4JYDA 2XH0A 3OYZA 5DBTA 3Q65A 3NG3A 2JBMA 5FJIA 3CB8A 2Z26A 4JNZA 3G1YA 1KXQA 1F05A 5C0QA 4RE2A 2WVSA 5AC7A 1BEUA 4O12A 4WX2A 1JJKA 5D9OA 3FGCA 3KHJA 3NM1A 2CEQA 1K7FA 4ILSA 4F9JA 5D4YA 3THCA 1EH9A 4MDOA 1JCTA 1LTDA 3UJRA 1GQJA 4AWUA 2V2CA 4OZOA 4Y9OA 2Z2UA 1ECQA 2PAJA 5A6BD 3MCMA 2QJIA 1SMAA 2ZC1A 4DJFC 3WK1A 1KRMA 1XM3A 1UR0A 3WNLA 4UTUA 1R87A 2YBTA 2J9XA 1JZ5A 2WPGA 4DBUA 2QDEA 2QAPA 1UR9A 5BXRA 5BRBA 1EC7A 3A3WA 4ICCX 4AZ5A 1HKKA 5DQPA 3W87A 1UC4A 1OYCA 1XDMA 4OE7A 4P61A 2HS6A 3ITVA 2J66A 4N7QA 3AJXA 1D7FA 5KSWA 1AODA 1YDVA 1GQIA 1UQYA 2GLKA 1S5VA 3EEZA 4LVBA 4I8YA 4AW7A 5F2LA 2DORA 3EX6A 1C29A 3TNBA 4I90A 2X0SA 3E0VA 3RNDA 5D2TA 1VCFA 1ZPTA 1KFWA 4UQCA 3HM7A 3DG7A 4O57A 1Q5MA 4XD3A 4V33A 1DJYA 2D73A 5BROA 2IQDA 2XYLA 3E49A 3CIXA 1XCFA 2FQIA 1W31A 1XSKA 2OO6A 1Q6FA 2R9RA 3B8IA 3PZTA 1V6VA 4UTKA 2BY2A 4ZVJA 1U30A 3VPLA 3WNMA 3GDMA 2ZUWA 4WK9A 1PL9A 3AXHA 1IXQA 4FK9A 4YVXA 6REQB 3P8IA 3S8HA 1IWPA 2E25A 2VEIA 1Q6QA 4RW5A 4NJHA 3E2VA 1TJ0A 5HUOA 1IR1A 2YDRA 3CEUA 2FZBA 2ZBTA 3BLFA 4OV9A 1EUAA 2BWGA 4LVAA 2HTMA 1TWWA 2QDHA 4W87A 2PCQA 4JQ1A 4C7FA 1CT5A 3LHUA 1LOSA 4Z08A 1C91A 3GIPA 1G67A 2NW0A 3RLVA 4B9YA 4GPNA 4D72A 5C9XA 4EKJA 3TIMA 2YJQA 4EXAA 1TPH1 5IBXC 4OVXA 1P1XA 4JAWA 4JIRA 2FFCA 3JZEA 4J3VA 3H6OA 5HPCA 4O8RA 1FXPA 3ES7A 3WK2A 1KBIA 1TREA 1O1ZA 3TEVA 1VYPX 3CUXA 4L5ZA 1H7WA 1X39A 3MHFA 3BDKA 5C9ZA 1YDOA 3UD6A 2BBFA 1JCLA 3WX7A 1OGBA 5LGXA 4DN1A 4K8HA 1RBOB 4NKCA 3BJFA 3OZMA 2OEJA 4BF7A 4DBSA 2EPHA 4IGMA 4Q8OA 3IJQA 1W1ZA 1J96A 3VOIA 3WH8A 3A3XA 1DKWA 3W7HA 1M01A 1P4CA 5I03A 3G3DA 3CV7A 2WANA 4FXSA 1US2A 3KRSA 3ITCA 3W1TA 3EDDA 4NZJA 4GLEA 1ADDA 2AMGA 1IT7A 3MT1A 1IF2A 2D22A 9XIAA 1SO3A 2G95A 3O05A 3BVJA 4GYPA 2O9PA 1G7UA 3QH2A 4FMVA 1WZKA 1RA0A 5ABFB 1FH9A 1V3HA 4RW3A 2EAWA 3H4XA 1MEHA 4EPBC 3TYBA 4CQ8A 3QTGA 3KM8A 1GCYA 3LUTA 3NOEA 1FXQA 2GFTA 5HINA 3W1NA 2QF8A 3O8AA 4B3ZA 1T7LA 4UFJA 2Y5EA 3KCLA 1QI0A 4Y9NA 2GDUA 1BXNA 3C8FA 3L0GA 4UQDA 4XZIA 2PDWA 4H83A 3R94A 1EPXA 4N42A 1KFKA 4ES4A 2XU2A 4UNLA 3U9IA 3RRAA 3AIRA 3SCWA 3ES8A 3CYVA 2V9DA 5F2MA 1JDDA 3SGZA 2UBPC 5TAOA 3UBPC 3SI9A 3R8GA 4FNRA 1YMYA 3CEPA 4UCGA 2D24A 3P80A 1W3LA 1PS9A 2YCLA 3O6DA 4HOZA 2VT0A 3VNYA 3WQOA 4ZQMA 4J9JA 5I5RA 1SU5A 4XBKA 4KGLA 1JDAA 2PBOA 4GGHA 1KFEA 4NYYA 1RD5A 2WB5A 2OLAA 1RD6A 2GJNA 3P2VA 4ZENA 4DPPA 2QV5A 1XG4A 3G22A 4JEJA 2QT3A 1SR0A 4RR4A 3G1RA 1X1ZA 1JAEA 4GQ0A 3EB2A 3D3FA 4UCFA 2WMIA 4ERGA 3MBDA 4QROA 1VFTA 4LC6A 2ZADA 4GMEA 4S3JA 3AMLA 2XGZA 1JZ4A 4PTNA 3G1AA 1OFEA 3PANA 1RUSA 5F1VA 2F2KA 2IXUA 4NNCA 2BVYA 1WO2A 3I4KA 1J12A 4QSFA 3S9ZA 4LEFA 3LGGA 1KBLA 1MZHA 2TRSA 4ASTA 4EPKA 4PH6A 1XLFA 1BYAA 4DZIA 1UD3A 1J0IA 4ZQPA 3SRKA 3JRKA 4FXJA 3W7NA 3HQ1A 1FTXA 1AQMA 1TE6A 3OZOA 3R6IA 4IZGA 4XZHA 4Z1DA 4J2PA 2Y1HA 2WV8A 3EOSA 3NJ3A 1YDYA 3BZJA 4XG1A 1GOMA 1FWFC 1S3HA 4PMVA 3M5ZA 1W3JA 3HV8A 1R3TA 4E3TA 1PKNA 2B0MA 3M6YA 4MWAB 4IPLA 2UY5A 4DZ5A 2FGLA 4XZWA 5I6SA 5D2YA 1ML1A 3AU2A 1W2PA 2VX5A 4JHZA 2GGIA 3QYQA 3VOGA 3WIJA 5EMUA 5CC6A 4UOQA 1XWYA 3H54A 4LU0A 3MKCA 1M7JA 3GAYA 1CENA 4Y6GA 1U5JA 3W1XA 1H0IA 1EIBA 1WAWA 1UROA 3WKZA 3IS4A 2OWWA 4H8NA 4JCMA 1D3HA 3WN6A 2VCBA 3STGA 2QIWA 3ABOA 2FGZA 3PK7A 3TKFA 4WHBA 3RUBL 1YYAA 2YA0A 2GVJA 2ZRWA 1X8CA 1G4SA 3F7JA 3S1UA 1XIGA 2AL1A 4F2UA 1W1TA 2OJPA 2J25A 4PODA 4MB1A 5T9BG 4DO7A 4E38A 2X42A 2QCGA 4QE1A 1DJXA 1VLWA 1ISXA 4PL2A 5PTDA 4M8UA 4WOQA 1ZCOA 1EDGA 1WXJA 1EKOA 1W3NA 2Z2AA 1EEPA 4WDWA 1H4PA 3MI6A 1L2UA 4AH7A 3SDOA 1YW1A 3FX4A 4EANA 1OG0A 4LB3A 2WVTA 2DH3A 4U33A 4EF9A 5LNRA 3AISA 4GFIA 1N8WA 1G9HA 2BXYA 4MLRA 3OPSA 3TW9A 4WGHA 1XH2A 3AOFA 4IL2A 2HPMA 3GNNA 1TG7A 1UHVA 3C3NA 3W75A 1KKRA 3GYCA 3TA9A 2BOGX 4KT2A 1SW0A 1NFPA 2W6RA 3NZRA 2ZUVA 2WZHA 2E09A 3GIQA 3DOPA 5JXQA 4PMQA 2VWTA 4ZB2A 1GZJA 2AKZA 3OHMB 4MAVA 4GUJA 5CJ5A 4LANA 1IEQA 1ZSXA 1JDFA 1PZ2A 5CAKA 5DXYA 2VRQA 3W84A 5JBEA 1IIGA 3CHDA 4WDUA 2NVDA 3TC7A 3O6YX 3B9OA 4LTSA 1AJ2A 5CGTA 3UR8A 3QC3A 4AXKA 1P0KA 4WKFA 5A6KA 3EZ4A 2A79A 5FIPA 3HPSA 5F2IA 2E9BA 3EX4A 4OQVA 3KTSA 3WLTA 1V6YA 3E12A 3LCIA 3M0MA 3MPGA 3VD3A 3PTDA 3AMDA 4E4UA 5BRPA 1P43A 3V3WA 1OX4A 3SQLA 4LW7A 4S38A 4GK8A 4BS0A 4LAOA 3P84A 5LKYA 3RPMA 1GVFA 4BKNA 3O0FA 1XP3A 3AIWA 1GKPA 3T42A 4ERIA 3WD2A 1N82A 2GWGA 1XYBA 3NQEA 1RPXA 3G77A 1MO0A 3AYRA 4JFWA 4HSNA 1MNSA 2FZNA 3W6YA 1EYWA 1A5LC 4RJEA 1Q4WA 2P0IA 3TC6A 1TV5A 3WFZA 2GJRA 1YE4A 4J27A 2WNZA 1KBKA 3TMLA 7PTDA 1NWTA 2CC0A 3ANYA 3TTEA 2FTPA 2NQLA 1OFRA 3NNTA 4LF2A 1F74A 1PZ0A 3ZLHA 1B3OA 4LRTA 1XLMA 3CUJA 3KRBA 4Q8PA 2QDDA 8CGTA 5I0DA 1LBLA 5C7HA 3AYTA 1MYRA 3R4IA 2ZDSA 3F5LA 4Q8VA 3AJ7A 3TTSA 5F4WA 3VC6A 4LSBA 4BEUA 2WYSA 4S1FA 3GTIA 3B8DA 2PRLA 3NL5A 3PZGA 1JI1A 1HJWA 1FQ0A 1M5WA 3GXPA 4GZEA 1D8CA 3Q94A 1V3MA 2QUVA 4W93A 1CYGA 3L65A 1HVQA 2J7BA 7XIMA 4FHAA 3BGAA 4P7QA 3OZYA 5JMUA 4ZR8A 1SFTA 3W53A 3GRIA 3E9AA 4WEVX 1T41A 3ABSA 1KM0A 1QDSA 3QEZA 2C7FA 3E0WA 3EKZA 1VEMA 1K9TA 1LCOA 2GGEA 1U2YA 2BLEA 2OSXA 1IV8A 3AI0A 2D0FA 3GTNA 4WUIA 3BMWA 3AUOA 5FKYA 3TYZA 3C0LA 4LUIA 3FY1A 3H12A 2YCIX 1PKMA 1R46A 3LM7A 2IMRA 2RUSA 3N73A 3W2NA 3TA6A 1AVAA 3DXIA 1X7FA 4LUTB 1MNZA 4J7RA 4RNJA 3IVUA 4I8DA 1H1YA 2BODX 3RO8A 2Z1BA 1QATA 3MANA 1LG1A 3J7HA 1EIXA 5AHNA 5CPNA 2ZX8A 3UF9A 3GE7A 2X7WA 3E5BA 2VKZG 3WEOA 4YVVA 3UXKA 6ENLA 3BUVA 2ISDA 4HNLA 1BGAA 2ACUA 5A3HA 2C71A 1VFOA 1G5AA 3PTKA 2WMHA 4JEQA 5EU9A 2OEMA 2F8QA 2XWDA 3KVJA 4IGSA 2V3EA 3QVQA 1DTNA 3NZGA 5BNKA 3EOEA 1MUCA 1A50A 2Y8KA 3LSCA 5I00A 4A3UA 2QEZA 2VC7A 2QVHA 3VIHA 1Q45A 2CLOA 3TX9A 1YPXA 3O7UA 3B06A 5B7ZA 5A2AA 3EX2A 2YSWA 3R8HA 2B81A 3G18A 4B90A 2QCNA 1OBAA 1ZBCA 2Z2BA 5JH1A 3LNPA 3QZAA 1IZKA 2NUXA 2MNRA 2YCLB 1XRSA 1E72M 3DH7A 1UUQA 3UPBA 2QJHA 1NDWA 2A3AA 2YIHA 2IKJA 4EE9A 3KW3A 2VURA 3T4CA 4Q33A 1V77A 3OLIA 4CVWA 1R3YA 2Y88A 4Y2WA 3LXBA 1WUEA 3U57A 4ADTA 1UJPA 2DQWA 4NXSA 4Q8WA 2D23A 3B9AA 4I9AA 3V36A 3BAKA 2A5HA 3SW6A 3AXMA 2FHCA 5FL0A 3N1AA 2G3MA 4M6VA 2HV5A 5IDZA 1N8FA 2PDQA 4YTUA 1E15A 1AA1B 1OCQA 3NDOA 3S1XA 3P61A 4KCTA 2BGNE 1ALDA 1JF6A 4PYSA 1QK0A 1C8QA 2IW0A 3V1HA 3TWBA 1Q6OA 4XWUA 5C7VA 1QOQA 4NASA 4K39A 3GH7A 4IFRA 3BCJA 3I7SA 1UR1A 2GZXA 2BHYA 4PA8A 1D3CA 3MKVA 2AAMA 4XD6A 5BOOA 1K02A 4UTMA 4JZ5A 1KC7A 3CYJA 1DWGM 3GKAA 4GC3A 1OY0A 4UBPC 4G5DA 4K68A 2VVNA 3WYZA 6CGTA 3DX5A 2J4GA 2QUNA 1S5WA 3KE0A 3NQ6A 5BWAA 4MNJA 2BGSA 3K30A 4Y8FA 5FJTA 1EXPA 2ASHA 4CVUA 1US0A 3WJSA 2XISA 3KOWA 2XIJA 1ZB5A 1QPKA 1Q8AA 1PDYA 1R9ZA 1M1BA 5HULA 4UR8A 2WHKA 4XZ9A 3QY7A 2NXHA 3LBMA 3QHMA 1AJZA 4QDWA 1DJZA 4AY8A 3SY5A 1DXEA 4AVOA 3UCDA 4RNIA 1QOXA 3EWBX 3E96A 4C65A 2HZGA 4BK9A 1MFUA 2FDMA 4R7JA 3Q45A 2XFYA 1E1EA 5GNYA 4PEEA 1P1MA 1WOBA 1VR6A 3ITGA 1TZZA 5EBUA 4JTFA 2PU0A 1O12A 1OIMA 3CWOX 4MWAE 4TX6A 3UWWA 2C0HA 5LA2A 1QHPA 3AO0A 4GYPC 1E40A 1S3TC 2NQHA 1W37A 1TR1A 3QJAA 4Z1YA 1ONWA 3V0TA 3H4WA 1YNYA 1I2PA 1GTEA 2WSRA 4M1RA 3MO7A 5DMYA 3ITLA 2XUCA 2GUBA 2JIEA 4QJ4B 4GCXA 4WSHA 4WY0B 5BXSA 1PPIA 2VCAA 3FKKA 3OO2A 2PWHA 4Z0SA 1LG2A 3MS8A 1HN1A 1Q4NX 4A29A 3U5UA 1JF5A 2Z1VA 2VDGA 4E5TA 3UNDA 3HURA 2WSYA 3SURA 4P8XA 1DHPA 5CJMA 4EX4A 1DHKA 4HKPA 4XVEA 4C60A 4LJ3A 4R9XA 5HNUA 1XSJA 2PBGA 3DHPA 4K38A 2INFA 2EPMX 4Q4SA 3RM4A 1H11A 1M68A 1EX5A 4B92A 4D6FA 4B5XA 3E6EA 4QDMA 4ZB0A 3EKGA 3TMQA 1XBXA 1NU5A 3M46A 3OA3A 1FX6A 2YCJA 3RRXA 4P5UA 1WUFA 2PC8A 4YWIA 3N9SA 4JICA 1ITUA 4PUWA 4KFPA 4LYPA 2QJJA 4XD4A 1YPFA 4QS5A 1XIIA 2IQ0A 4J35A 4DPQA 3A4WA 3VILA 4JN8A 2WVVB 4E2BA 1W17A 1H0GA 3SFKA 4KWSA 4XSLA 4DZAA 4Q4RA 2UWFA 2XG9A 3WNOA 1F76A 1U33A 3CZKA 1LRTA 1ITXA 2RGMA 3FEQA 4QM1A 3KOYA 3RFAA 2V68A 2GQ3A 3UPMA 3HQOA 1XIFA 5AC4A 4Z42C 1J10A 1WB0A 3BPWA 3CWNA 1K6AA 1DJNA 2W92A 5A6JA 5HNTA 5ABTA 4UZSA 1UWQA 2E1WA 2V3GA 4FNSA 2OXNA 3LCXA 1W56A 4L7ZA 3W81A 2PLCA 4AWTA 1VJZA 2RKXA 1HVXA 5SWUA 1FP8A 2WQDA 1L0PA 2R8WA 1Z48A 4Z2LA 3TCEA 3RPDA 1ITCA 2GK1A 3O06A 3CB3A 3ENLA 1FCQA 2C6QA 3GTHA 1TV8A 2BS9A 1TTQA 1RBLA 1D3GA 3W73A 2V38A 3AHXA 5DF0A 2O4QA 5I09A 3IGXA 3O0KA 1PHQA 4TVCA 4TVDA 3W70A 3I65A 4NZCA 4AISA 3ARXA 4LCQA 4L56A 5I7GA 2Q8LA 3PN8A 1FY6A 4D1JA 1ME7A 2BGQA 3ERPA 3DGRA 3WD0A 3HPZA 2HK1A 3T8LA 4DAIA 5E6YA 3BARA 2QCCA 4HSOA 4JY8A 1CGTA 1M9HA 2YKKA 4H9UA 4FIRA 2BY3A 4IX0A 3VI2A 3WY1A 1P7TB 3KBMA 5A6AA 2R1KA 3RMEA 4E8CA 3TWAA 1BXCA 2DZUA 3STPA 1BTCA 1NQKA 3FN9A 5CC7A 3NFUA 4F48A 1H7XA 1KFLA 1S1RA 1OFAA 2C19A 2DZSA 3WF4A 3GFYA 2OLSA 1R3VA 4KFOA 4XKYA 4E4FA 4YHGA 4RK8A 2VQUA 2EGZA 4HMNA 4HNOA 1UH4A 2G4JA 5D02A 3IAQA 2VWSA 2WCAA 5G2IA 1XCXA 4TQTA 1OFDA 1CLXA 3K2GA 2AL2B 1S5TA 5C2GA 3WLQA 3HG3A 2NQJA 1K4GA 1I75A 3LA4A 3F2DA 4XO6A 3AROA 3RM8A 3CPGA 1X6UA 3WK3A 4DHGA 3TDFA 3IRDA 1I4NA 2ZTJA 1ZAIA 4HB7A 4L6HA 2GL5A 1X6NA 2G0WA 1IE7C 2C18A 2QDGA 5ABEA 2GQ9A 4NRRA 3T81A 1XRVA 4AVNA 4RLIA 3D3AA 4J4KA 2OKOA 5HXMA 3LMZA 4DBDA 2KX9A 3ZJ7A 5CAHA 4BHYA 3QXBA 5CPSA 3GO2A 5BU6A 5BOFA 3GXMA 3VIFA 5DMMA 5DY3A 3UW6A 4BI6A 4V2XA 1HJSA 2TSYA 3SM0A 4HA1A 1F07A 5D09A 4WCJA 1OF8A 3R7MA 4WD0A 2PLJA 4HPHA 3NEHA 2XWEA 4LBSA 3EWCA 1O6IA 4YTRA 3GG1A 1Z69A 3I3BA 1OABA 3EA2A 4QE4A 4GQBA 3UWZA 3M4HA 4V27A 1QOPA 4ZXOA 1P48A 2G4FA 2ATSA 4H8HA 4QRNA 3QV8A 1OIFA 3PG9A 1DOSA 4Q4QA 3ZS4A 5DLCA 2GUUA 4TR9A 2EG6A 5AC8A 2VR5A 4DF2A 1GVIA 2IKGA 1AQ0A 4J3ZA 1I6NA 4GIAA 5C55A 1VEOA 4L9XA 2VX7A 2J77A 5XIMA 2XIMA 1GGOA 1JPDX 5A6MA 1N7KA 3OVGA 3ARZA 3PUEA 4YHEA 3RITA 2XGIA 4AZHA 1N2VA 5DCDA 2HVOA 3D5HA 1M7XA 2RH9A 4HNNA 2J13A 4HK6A 1FWNA 3W7PA 3LX9A 5JUVA 2CWNA 2FVKA 3TN4A 2A3LA 2V6AA 3CV1A 2X7VA 3PWGA 3W25A 5FF3A 4PUKA 4HCDA 1V93A 2F6UA 1M3UA 3ARYA 4LCSA 1QI3A 2OKTA 4ZOEA 2DIJA 4IMDA 2PDFA 2QXWA 5HDRA 3LGDA 1L9WA 5C54A 4M5PA 2NSXA 2YL6A 3MHGA 1C7SA 3BQ5A 4C1NB 4ATLA 1JPHA 4W7VA 3DENA 2RGLA 4M82A 4TIMA 3USZA 1RP9A 3OYXA 1AH3A 4IGHA 4JTJA 4QBXA 4GX8A 1AH0A 3BQ6A 1NFGA 3PY2A 4PCNA 2XFRA 3DEQA 3WF1A 2PTDA 3KBWA 4JN6A 1NWUA 4ATDA 3C2OA 3NM3A 1NOWA 3VD4A 4PL1A 1FWBC 1GOKA 1D9EA 3DYMA 3P93A 1SW3A 3V4BA 4BQ2A 2DZTA 4R88A 3M7SA 1JAKA 4BI7A 4G8TA 3L2MA 2DZPA 2XN2A 1EZ2A 5ABFA 3VMNA 2Y63A 1F2JA 1BXBA 4IPJA 3VCCA 4EWND 1JCNA 4Q8QA 1J2WA 1S39A 3NQBA 3KBJA 4H9TA 2OLHA 4IIHA 3PJTA 5AB3A 5D38A 3GDLA 4HZ6A 5D2XA 5IFTA 2P10A 3HGRA 5LHFA 4URIA 3H53A 4XQ6A 1EC8A 1FH8A 3LS9A 3BLLA 4WR3A 2NQ5A 3VNKA 4H6KA 3DFYA 3M47A 3ZT5A 1EPVA 3UT0A 3AMGA 1R8LA 2AAAA 4ZCWA 4LCRA 1J0HA 2Z27A 3BE7A 4Y8EA 4JYFA 4UOZA 3TYAA 3C0SA 1H7OA 2OOFA 1LYXA 3B0YA 3EPOA 1EP1A 2ZXDA 4K37A 3K8LA 5AYZA 1XJBA 3VM7A 2CBVA 1MQPA 3DI1A 5HQEA 1NH6A 4GZ7A 1RQEA 5J5RA 3LRKA 4F0MA 3LD5A 1DV7A 3ITTA 5D2WA 3CXOA 2YR1A 1R2RA 3FJLA 1TJRA 3UWQA 3TU9A 2DQXA 1DJQA 3DCPA 5HMEA 4I5UA 4K8EA 4BI5A 4XAGA 4H6QA 1XLCA 1KM1A 3LHWA 3N17A 1R3SA 2WPBA 1HL2A 1TRDA 1R47A 7A3HA 2X2GA 1ISVA 2A3HA 3GDKA 4GVHA 2PWVA 1TUXA 3CAKA 2DSUA 2VO5A 5I3JA 3E0FA 4B9ZA 1E6QM 2Y6ZA 3O9NA 4A22A 2SFPA 1VFSA 1EWEA 4JIEA 1JNDA 2Q01A 3PS7A 3P14A 3HGJA 2YYTA 1UKSA 4FF7A 3P7YA 5D8ZA 4INFA 1C92A 1A5BA 3NVDA 4L1WA 3K13A 1OX6A 2PA6A 1U1HA 3GNDA 4MUPA 4AEFA 4QITA 4LRSA 1KRAC 4MB4A 3SCSA 2IPFA 2GDQA 3TROA 2WBKA 3IGHX 1BRLA 1FWTA 2GSEA 3SECA 1DTUA 1JZ7A 4IISA 3NQAA 4HHMA 2CXGA 2PD5A 3L4VA 3UGVA 2VYOA 2ZCGA 1ZCCA 1EA9C 5AHEA 4MNLA 2PCEA 2Z6JA 1QW7A 4HYVA 2ZRVA 1UJQA 1JD9A 2D3LA 4DIAA 2HK0A 5CPMA 2ZZ7A 4F3HA 1FVPA 3VGHA 3B04A 3OA5A 3VM5A 4Q32A 4P8VA 1OD0A 1B31A 4WY0A 5C6MA 3TONA 1TVLA 5F2GA 3HGSA 2WLYA 1O5XA 3I4EA 3C2FA 2OU4A 4GQGA 4LAUA 3EEGA 1EZWA 4LBUA 1V08A 1KR1A 1EO5A 2BFGA 1A0DA 1ZENA 1DJGA 1EQCA 3ARSA 3S5YA 3NSXA 1A49A 1CGYA 2WXDM 3GVWA 1UD2A 1ZAHA 4K6AA 9RUBA 4DJEA 2D20A 2GQAA 4NZFA 1GOIA 4QLLA 3I68A 3WQ4A 2GOKA 3GY1A 1DIOA 2CZDA 3W7LA 3W38A 3QQ0A 1WNOA 5C8BB 4UTTA 4US5D 3M6DA 8TIMA 2D3NA 1BFNA 3GHRA 2YA2A 2Y70A 2J75A 4N4QA 4JYEA 1VBJA 1UG6A 2WKGA 3WDQA 1AJ0A 3GVQA 1L6FA 4HMCA 2BZNA 3VDAA 1FUYA 3BAJA 3CZ8A 1DEDA 3LI0A 1JRBA 4MZYA 4CLMA 1E6SM 5T8GA 1ELSA 3HN3A 4FOKA 3RR1A 1DE6A 2DW6A 2Z28A 3VIJA 1WXZA 2VTFA 3P67A 2YCEA 2ZYFA 4MSSA 3CL8A 3CV6A 1E9LA 4AAJA 1CXLA 1HGWA 5CPLA 4JTKA 3E2RA 4JQ3A 1G4TA 5DY2A 5FAGA 3ZMRA 3BCDA 1OYAA 3V0UA 1MXSA 3RLGA 4ZQNA 1W5QA 2WVUA 2VFIA 4HOXA 3CC1A 3O07A 3KOZA 5HATA 1VLIA 4IMGA 3AIVA 1GOWA 1LOLA 2XJ7A 2PU1A 4IQLA 1CCWB 3TNOA 3AWNA 1JUBA 4XB3A 3K46A 4DWSB 2P53A 3WDJA 3T40A 3SUVA 5HUPA 4E3VA 1TX0A 3SQMA 4L9ZA 2QMJA 5G4WA 3GK0A 1AW5A 1FFRA 4UTIA 2X1UA 1OD8A 3ZXWA 2Y8VA 3CMGA 5HPOA 2PGWA 4LAMA 2ZRXA 2DZVA 1WKYA 2B7NA 4CCEA 4OGZA 1GJPA 5BYWA 2PDGA 3BK0A 1E6PA 4QLKA 2GVGA 2ON3A 3GHUA 4ZZ9A 1PO9A 5IHRA 3QM3A 4HHLA 5DELA 3IIXA 3L21A 3QKEA 1J01A 3UCQA 3P5YA 1FWWA 4ZOAA 4DJED 1K9DA 1G7VA 2DW7A 2EPLX 5IM51 1NP0A 4TTGA 2D0HA 1VIZA 3FIGA 5HOSA 4PCSA 3L4XA 1SPQA 5H2ZA 2I1OA 1GW1A 3IEBA 3K1GA 4GC4A 4P7NA 3BSMA 3QRHA 1JQVA 1SJAA 1WYIA 3T0BA 1PEZA 2CPUA 3JS3A 1T40A 1J0ZA 1FHDA 5A8MA 2EHHA 3CMFA 3R12A 2CBJA 2R1PA 3CH0A 4E6MA 2OGJA 1NDVA 3U3HA 3WLJA 4O0QA 3N2XA 1PX4A 4GKTA 2WHLA 4NT0A 3UR5A 3AFBA 2ISFA 4DB7A 4IMEA 1YTDA 4QX4A 1CW2A 1Q6EA 1X96A 2BDQA 2DH2A 3P62A 2C3ZA 4CU8A 4P7OA 4S3FA 4J3SA 3B9DA 3IIPA 4AIBA 4GJ1A 5FD0A 3W2KA 4JTHA 1K4HA 3SEPA 3R43A 3N6QA 4HQVA 4QISA 3W29A 3H8AA 2PZNA 1OGSA 2CLKA 1JXJA 3TAOA 1KCKA 4G6CA 1JPMA 1RHCA 1UP3A 4JPGA 2YW4A 2KAUC 4LBRA 1VZWA 2V5BA 3FK4A 4U5KA 2REQB 3IVTA 1L6GA 3A5VA 2OO0A 1GVEA 4XAFA 3T1GA 5A6LA 4IIGA 4HNUA 3DFTA 3NQDA 4YMZA 4KWWA 3HV9A 1TX2A 1VBGA 4F40A 3POCA 3S4TA 4GZJA 4ZA0A 3U2CA 3WNNA 2QJNA 3ABZA 1BWVA 4I5XA 2IUZA 2E67A 1TYGA 2YL8A 3EWWA 3A24A 2OX4A 4GNKB 7ODCA 4BWLC 1EJTC 1UA7A 4W7UA 2YX0A 4OU1A 5EY5A 4HPNA 3MSRA 4V1YA 5CG0A 1Y7VA 4C1NA 1NWRA 5G4EA 2WNQA 1W5NA 3PTQA 1EHAA 1I60A 2PWUA 5AYXA 4HBKA 5LIYX 1FCUA 3QV9A 1AMYA 3H7UA 4HA0A 1EF3A 4K8GA 5CZ0A 4Q8TA 4IQEA 4Q3MA 3RHGA 4L6OA 2G41A 2QW5A 1WDRA 1DIEA 5L6UA 1JRCA 5K7JA 2H8XA 2PC4A 3II1A 5IDIA 2CITA 1KGUA 3KBSA 2VGIA 2WM0A 5DMLA 1UIPA 2ZZ2A 2H9AB 1V6TA 4QHRA 3DKLA 3SCVA 1KV5A 1VBHA 2Y4SA 5D2VA 2OZ3A 4RX0A 3THQA 4PB5A 1TELA 1V3IA 2PF8A 1JCJA 3SUWA 3LTPA 4HN8A 1HXJA 1SJCA 3URBA 1P0DA 3AS2A 4XAYA 1E43A 1VENA 3PUOA 1DIDA 3JZUA 2I9UA 4AZCB 3TE9A 1B4EA 2R94A 4U2YA 1SSGA 1UCWA 2VC9A 4FNUA 4GI6A 2V81A 4X61A 3T0AA 3UZZA 3UNTA 1OFPA 2YL5A 1Q2RA 1SZNA 1JD7A 1F61A 3OP2A 3T2PA 4EF8A 2GSJA 3VA8A 2V5KA 2XGBA 4X63A 5FSEC 1VRDA 4N9EA 1TPDA 3VMOA 4XZLX 4F0RA 1GJUA 3UZYA 4FLQA 5AHMA 2PODA 2ZUUA 4AD3A 4EAMA 1KQYA 3R2GA 1DQXA 1X1OA 3S2NA 4LQ1A 4PMDA 4D6DA 1EDTA 2QQ6A 5BMXA 1IYXA 1JCXA 2J62A 4RDWA 3WMBA 3M0KA 4REQA 3ARUA 2VRKA 1FWDC 1B3XA 4O11A 1E9YB 3TXZA 1VFHA 5CC3A 3U4AA 3GNOA 2V5DA 1A5SA 4PUEA 1XHGA 2P5NA 1VFUA 2PLMA 1RLCL 5GNZA 1EJSC 3N3MA 3NQ7A 1UR8A 1IXPA 2X1TA 3UP8A 1TJPA 1LUCB 1B9BA 1YBQB 4IG2B 4DWDA 4QEHA 4PEKA 5C70A 3WLSA 5HMDA 2ZOXA 3KZPA 1O94A 1QMLA 2ZRZA 1MW1A 3QPYA 2G37A 1CB7B 1EJ7L 2PTWA 2FYMA 1YDNA 3MB9A 2ZVIA 4JNYA 3TJLA 3N34A 3QFWA 3TH6A 4KRZA 1WX0A 3MMTA 2ATMA 4XTIA 1XS2A 3NPVA 1Q66A 3SJNA 3AYVA 1HZYA 2C91A 2Z7GA 5DCEA 1HTIA 3IWPA 1DORA 1R3WA 4Q4PA 1UKPA 3D6NA 2NXGA 4X0NA 3KFTA 2C8NA 3DG3A 2ZX5A 2JEPA 1KFCA 3G6MA 2Z00A 3M0HA 3T6CA 2YDQA 2E1DA 3W01A 4QDPA 1Y0EA 3USBA 3L5AA 2OQLA 4Q7NA 3O2LA 4JTIA 2PMQA 1OYBA 4Y7EA 3CAQA 2I7GA 1AG1O 3LCWA 1OT1A 4MF4A 1TFVA 3FA4A 1GEHA 1BSLA 3WF2A 2XH7A 4MLJA 4O1BA 2XINA 2OYKA 4A4AA 4DLMA 3LTSA 4F0SA 2NLYA 4H00A 3N12A 3W82A 3BLPX 4MKNA 4DYKA 5EYWA 4KH2A 4JIIX 1PB0A 1KW1A 4KIEA 1Q8JA 3WQGA 2XZ7A 3UZ5A 1XKJA 4HOWA 5HJLA 2WWDA 3PZ9A 3N2OA 3HG2A 4ZQRA 2PDYA 1LRQA 4GISA 4JTCA 1LP6A 5C9UA 3TV8A 3RYSA 3INPA 1WV2A 2PDKA 3W7JA 3DC0A 1OCBA 3DAQA 1KKOA 4DLFA 3MKKA 4OUEA 1E0XA 4L1XA 1NF0A 3M0IA 1K8CA 1DJHA 4RE0A 4D6CA 2E68A 4W8BA 1VPYA 3UZWA 3NQGA 5H8UA 3FXGA 2WC7A 1BHGA 2VZTA 3H2NA 2NUYA 2Y61A 3WH5A 1SW7A 3QPEA 4A8IA 4JFVA 3OBKA 4JIHA 1RCXB 1BQGA 1DBTA 3UZJA 9CGTA 3UYIA 4MZ1A 5CEWA 4X60A 2G3IA 3STEA 3ZJ8A 1V0MA 4BFAA 5CSRA 1LM1A 2WJFA 3SGUA 1S2WA 2FH6A 3XIMA 4IICA 2V0TA 5J8LA 1XQKA 4FSAA 3WFAA 4NRSA 2WMIB 4IQDA 3OLGA 1W9PA 4AWEA 2ZE0A 5GJNA 4JN7A 5DXXA 2PDIA 2PTYA 3GXFA 3AALA 3L9CA 3UR7A 5A69A 1Z44A 4O1CA 4X2PA 3ZR5A 3UG8A 4PUDA 3BAXA 4LC8A 1GVQA 3GC5A 4PRWA 4IMCA 1UR3M 3VOJA 3ABRA 3WQEA 4PE8A 4QJ3B 3IIOA 3WMCA 2O0TA 3WJXA 1NAL1 3Q4DA 3VCRA 1KBJA 3GYEA 1YPIA 1YKWA 3VOFA 4ROQA 2OB3A 4GINA 5IXEA 5D30A 1U22A 1U5VA 3BW2A 1QHZA 4NUWA 2WCGA 3U5YA 4HCLA 3L0NA 1LL4A 1C9DA 3P3BA 3W74A 3GW0A 4IH3A 1O66A 3NQMA 2W67A 3VIKA 3TYDA 2VZUA 1DQUA 3S83A 3CQ0A 3TZNA 4O0ZA 3DU0A 3WFLA 2ZVRA 4X3ZA 4RZ6A 3HBLA 3VIGA 4IFKA 3IJIA 1Z8AA 1I45A 5HBFA 4CQCA 1J4EA 3QMTA 2WK2A 1R7OA 1L6WA 3FKRA 3E74A 2A6LA 3QMRA 2TODA 3NPWA 4QEEA 3M0XA 4W89A 4D6JA 2QCHA 2OT0A 4DO4A 1X98A 1HKMA 4RZBA 1KCLA 4YJ5A 3FFSA 2JEQA 2EPKX 1IHIA 2YFOA 3C6CA 4DJFD 4C6EA 3C2RA 4G1KA 3AZTA 3W85A 3HA1A 3LENA 2W91A 2WVVA 1T8QA 4G7EA 3KS6A 5AVHA 3WLNA 4R7OA 1VD6A 4LS1A 4UTWC 2ODOA 4A35A 2DVUA 2Z0IA 3O63A 3HG5A 1EBGA 4NF7A 1IGWA 3ZFHA 1UPMB 4JTTA 4FB7A 2H3BA 3V18A 3PC0A 1F6YA 4AXNA 3TOYA 1DWAM 1UP0A 3LTYA 2DIKA 5FCZA 2ZZ4A 1XUZA 2OOGA 3G0UA 1SO6A 4C6CA 4ENLA 3NA8A 3QF0A 4JTEA 3LY0A 1QNVA 4HA4A 3RK8A 3NZQA 1RR2A 4UUIA 3WUEA 3JR2A 1GVSA 3RM9A 4N4PA 1TWZA 3NYZA 3OU8A 3SN4A 4HTBA 2JALA 2EPOA 3IJ9A 4YYCA 2J6VA 3CZJA 1BRLB 3G1HA 1ZAJA 4DXXA 5LNUA 1T6MA 4NHVA 1V0NA 5HANA 3ZIZA 2BASA 1C8YA 4QR6A 1RK5A 3PSWA 4BF9A 3VCNA 2OELA 2RFGA 2R82A 1WBJA 3LHVA 1XYCA 1J6OA 2A21A 4H41A 4OECA 3RXZA 1DWIM 1YX1A 4IXXA 3W7IA 1F3XA 1UKTA 3SCPA 4C1KA 3GKFA 4GO8A 5AHLA 4MJ2A 3BAWA 5XIAA 3LEPA 3LN3A 4Z1CA 4DWSD 2ZZ3A 1WZMA 3ARWA 1TV7A 3GW3A 2DVTA 3V1PA 3VGEA 2Z4GA 3NL6A 2WSQA 4D8ZA 3N29A 2HVNA 1UWTA 3ZR6A 5A2CA 2REQA 3E0LA 3IJLA 1E4IA 1LT7A 2FPYA 2G8ZA 1KTNA 3VTRA 4TUFA 3ANVA 1KM2A 3TN5A 4DWSC 2PS2A 3CO8A 4IFKB 4YIWA 3VGGA 3QKZA 4FF5A 3W2JA 5ENLA 1L2QA 1TTJA 3VD7A 3IANA 1UC5A 3EPMA 3KP0A 4LFYA 3PFRA 3MV01 3CZGA 3GZAA 1LBMA 5D37A 5DCBA 1R86A 1M03A 4NL1A 4S3KA 4YTTA 4K3ZA 1AZ1A 3B40A 1W3TA 3BICA 1QJWA 3LLXA 1TCMA 1W91A 3KWXA 1ONXA 3GVRA 3IACA 1A0CA 4MFDA 3V5OA 2DJXA 3CQIA 3O1NA 1Z41A 3R58A 3GU9A 4IF2A 4O1AA 3MSGA 2ZXAA 3F5KA 1CIUA 4J1OA 2Y85A 3ALGA 4H9YA 1TV2A 1E5JA 3N15A 1FDZA 3WLMA 1C90A 2CHOA 1WOAA 2CLPA 4K7VA 5BZAA 3ZSSA 2FH8A 4JTSA 2IKHA 3BW3A 4GXMA 3C0QA 1CPUA 2Z1SA 4I7UA 1KM3A 1MDLA 4Z2GA 3OTRA 1PXGA 6REQA 2OQHA 3WLOA 3M16A 3ZZ1A 4NNAA 2ACQA 1VS1A 2X41A 4XAZA 3W0KA 1IT0A 1KNWA 4W7WA 3PPHA 1MRQA 1L6YA 1Z32X 4JXCA 1LWHA 2DSWA 4DJEC 4O52A 1GYLA 2NT1A 1TB3A 4ZO8A 2W61A 5E93A 2VZOA 1VEPA 4ACZB 3NCOA 4ZE4A 4DZHA 1E0WA 2PRHA 1PIFA 2I17A 3DDMA 3UU0A 1P6BA 2X1RA 4HU8A 4A8RA 1TMQA 3C2YA 4ONVA 3W7GA 1KRCC 1JZ2A 4IIFA 1JR1A 4XSMA 1S2TA 4RDVA 1J11A 2YXOA 2A7PA 1TIMA 5K9DA 3UVAA 2VNCA 1XG3A 2WCSA 2HE8A 2DT1A 5IRPA 3UR2A 1IIHA 1VRXA 3GU2A 4PCTA 3DFHA 3RCMA 3VD9A 1TWDA 5DRIA 3BJTA 3LM3A 1V02E 4B5SA 1PTDA 3QQ1A 3B4UA 3C52A 4KPLA 4PR4A 3IARA 4HJFA 2INEA 4AG0A 3EGJA 4PB4A 3NL3A 3AHTA 4OBSA 2Y5JA 5I3IA 1R2TA 3WMLA 3SRFA 1OX5A 4ZGYA 4O17A 4O54A 4XUYA 5BU9A 3K5XA 2OEKA 5KEZA 1JPIA 2CHNA 3NDZA 3CIVA 3IIVA 3GXNA 2XIQA 3OZPA 4IJCA 4QNEA 1REQB 1H51A 3G24A 2CLIA 5HJYA 4XZMX 4RDYA 1GWJA 3QTPA 3G2GA 1H50A 3D46A 1J79A 1NOUA 1YXCA 5HQLA 3AS0A 4WLCA 3WD4A 2F7FA 3SBFA 3H7VA 1NQ6A 3DBPA 4NI3A 3F4WA 2V2DA 2D2JA 1QBBA 1XKYA 2W0UA 3WLPA 2DZWA 1HKVA 3MTWA 3QN3A 3WQPA 2DDXA 4YWSA 5K4ZA 1VH7A 3SCNA 3SUSA 4UOJA 4JCLA 1XISA 2YA1A 3TLLA 4JX6A 1JVNA 2CBIA 3FA3A 3BG3A 3BMVA 1FRBA 3EOOA 2YDAA 1R30A 1PCWA 3W7QA 1JZ8A 4B2DA 3A5FA 2E28A 1PAMA 1O7AA 3WL1A 3CL6A 3M64A 3P0XA 3Q67A 3AU6A 3W7OA 4CGTA 3BGGA 3EWXA 2VFDA 4IOTA 1FH7A 4LX4A 2EEXA 1UBPC 1K8XA 1PDZA 3BH4A 3NDYA 3WQ6A 2YW3A 2W3ZA 3QHOA 4NYUA 5JU6A 4GH3A 2PGFA 1C93A 2ZXQA 3N11A 1RQBA 4PRRA 2QJGA 5K2ZA 5DEZA 3CO4A 1ADOA 2NLIA 4GWEA 3TYUA 1XYAA 3VZXA 4JIQA 2C1HA 3I6RA 5FEPA 3E2QA 3FVMA 4IPNB 1XLDA 1XIHA 4N9DA 2X1IA 3U4FA 5H6HA 4AX7A 3MMDA 3NTYA 4IQJA 1TPB1 2Q8ZA 1W1PA 1EF2A 1W8GA 2XM2A 5LA0A 3GR4A 1JDCA 1ZBWA 5CBIA 3MWAA 3A12A 3CLWA 1VF8A 1EHNA 4PRTA 4FZIA 2OYMA 2QMKA 4F0LA 3GX9A 2BSLA 4WVXA 4BF5A 3GTFA 3IV8A 1WZAA 1XIJA 2BTMA 3N18A 2W4XA 4IFOA 1RY8A 1ZJHA 1QVBA 1V51A 4JKKA 2VEPA 3ZM8A 2G50A 4S3AA 4DF1A 1CWYA 3VOCA 3LPFA 4NAEB 3IV3A 4A2SA 2OTDA 3VC5A 3U0HA 1H09A 3PPFA 5CGQA 3NGJA 1IZJA 4R27A 1K77A 3QLLA 5I3HA 3VZZA 2RDTA 5LZLA 4BZYA 3KWSA 2Z25A 5FOOA 3BURA 2J6XA 3L0KA 1SFLA 5DANA 2FLIA 3U2EA 3MUZ1 1EP2A 4L64A 1WZLA 3HQNA 4N9CA 4W88A 2ZX7A 4V15A 3PB2A 4WSJA 2Q3OA 3NGFA 2CZEA 6A3HA 1EX1A 4ECLA 2GJLA 5FJRA 2XFFA 4Q4OA 4AZ7A 1M65A 4KFNA 4XBSA 1BQCA 1ZS2A 2QYGA 1K9FA 3A47A 3RMJA 4ZSUA 4IUGA 1YNQA 3FHQA 4O16A 4O53A 2F9RA 3GXIA 1R2SA 3KBVA 3MJYA 3A9IA 1DPMA 2VC6A 3POHA 1H3GA 2UY2A 4EPDC 3SUTA 3MMWA 3OOQA 4AX6A 3KEHA 2H8ZA 1LDCA 1QHOA 4GQRA 1F4HA 4QFUA 3GNRA 4L1GA 2Q3RA 4QNWA 1PYFA 2FIQA 1LROA 1TQXA 3GVVA 3PNZA 4L4OA 1FBAA 5FA5A 4NZ5A 3SQSA 4MVAA 1BVZA 2A6NA 1SYTA 2E6DA 3SRHA 1B3YA 1E1FA 4GNVA 1PE1A 1B54A 2EKCA 1R9YA 2QAFA 4AY7A 3A64A 2VGBA 2UV8G 2O9RA 2F6KA 1WKEA 4PMJA 1MQQA 1N55A 1LQAA 3L4WA 4JS3A 3KTXA 1X6LA 1F8MA 5HJXA 1J8VA 4P8UA 3WUBA 1MW0A 1S2VA 1GPFA 2YBVA 4UMBA 5HAOA 1WDPA 3DHDA 3LPPA 1TSIA 1GPWA 2J7GA 2WHMA 3HOJA 2E77A 4I6VA 4I9TA 4PMYA 3BLKA 4I6KA 5MKGB 3UG4A 4O4VA 1NIUA 5B7YA 3PJWA 4OFCA 1NVMA 1Z3NA 2HNEA 4CN1A 4K7YA 4GFSA 2J7EA 4C6NA 4D2JA 1W6TA 2PPGA 3VMPA 1PTGA 1RK6A 1EP3A 4WJ8A 1L8NA 1FDYA 1LWIA 1JGMA 3TSBA 3VXGA 2NQZA 3C61A 1ZJIA 4XAPA 3W4RA 2BXVA 4M7TA 3EDJA 5CSUA 1KR0A 4O13A 5C9RA 2XVGA 3VKJA 4GJIA 3SB0A 3A22A 1QPRA 2G96A 4JL1A 3SADA 1JFHA 4CD6A 2NX3A 2Z7KA 1XD0A 1MWOA 1S46A 4K1WA 3TTQA 5FF2A 3LU2A 1WDDA 3N2MA 3VYLA 1OSEA 1KO0A 4X22A 4ZEPA 3E38A 2WMGA 2HQAA 4A3YA 1VHNA 3BW4A 5D9PA 1I1XA 5I3KA 4ZFCA 1QUMA 3L4TA 4GBUA 1Q7ZA 3S3GA 5GPRA 3T0CA 3URQA 3GSMA 2E9MA 1V7AA 4O8AA 1I2RA 5AN7A 4ML9A 3WF3A 2J27A 4DUOA 2ISVA 3WNKA 1Q6RA 4PTVA 2PGRA 2JGQA 4C6BA 1ZUAX 3EDKA 2C1GA 2IQTA 1TPEA 2ZWYA 3MQTA 2PI6A 1Q6DA 4D6HA 5CZJA 2DU2A 2PTZA 4FOUA 3L2IA 1QNSA 1TZ9A 3EWDA 3VZYA 3G6LA 3SFWA 3DFSA 4FXFA 4GE8A 2GQ8A 4JFUA 2JK2A 3MP5A 4G7FA 1TQJA 1KLYA 4A6GA 4Q6XA 3VINA 2H6RA 1W8SA 3KVMA 1W5PA 2ABBA 4GVGA 4HSHA 3S1GA 3AMKA 5M2FX 1JYWA 2HWGA 3BV7A 4NZ4A 1SSDA 1EGMA 2ZICA 1FWGC 1ODUA 2VOTA 3LB0A 2ABAA 1NDYA 3OHIA 2CZVA 2W5FA 2QCMA 1OC5A 1W3KA 3MI3A 1JDEA 3RJYA 1QO5A 2WNNA 1GORA 1OFOA 3AMCA 4OBTA 3CL7A 4TOQA 4H8UA 1QNRA 2XM1A 3D47A 4MKVA 4FNQA 5CH9A 3IK2A 4YTQA 1OM0A 4MWAA 2H3DA 2OGYA 2PDPA 3RCNA 4LYQA 4ALDA 2GDVA 1RCQA 4ZQOA 3R0DA 5E5CA 2BY1A 4MWAD 1R0MA 4GYJA 3TUUA 4Y96A 2X16A 2YFNA 3WQWA 3ATYA 4KRUA 4US6A 3WH6A 5LXXA 1XF0A 2W66A 1JGIA 4AMCA 2NV2A 2Z24A 2PP3A 3H24A 4P7LA 3DFOA 5AY7A 4GIYA 2EBNA 4LS0A 2FZ8A 1CTNA 3A4XA 1KCZA 3MUAA 4MM1A 3GBDA 1OEPA 2WAGA 2VDIA 4QLJA 1EDQA 1CB2A 2JQXA 4HYRA 4DUWA 5C9WA 1PSCA 5A6SA 2X1SA 3G1DA 1SM9A 2PFHA 3QY8A 2HXUA 1S1PA 1A4LA 2J9YA 4QIUA 4FOJA 4I9JA 3SRDA 4JD4A 1TJ2A 1A5AA 3M43A 1REQA 3IRSA 4XZNX 4ZSTA 2P8BA 1ZTVA 4XZBA 3PZMA 4H9ZA 3L7RA 3EX1A 4JTLA 1IEVA 1QT1A 1ZALA 5GVJA 1BVWA 3S1WA 4HPGA 3EXRA 2ZFAA 1QPNA 3WJWA 3WEMA 1UB3A 3FV9A 1W9BM 1ENUA 4IIEA 3WMSA 4GNJA 2O9TA 1DJWA 5A8NA 2GUYA 4NAEA 1M6JA 4M7SA 5HWJA 3WUGA 1EBHA 2Y7FA 2CWXA 2GGHA 5C71A 2E7FA 1K3UA 4UWMA 2OX1A 4XTDA 2V30A 1GYMA 4QJ1A 5EMYA 3GG0A 4XV0A 1AZ2A 2PWDA 3OG3A 2W62A 3KX6A 4IMAA 4W85A 1F7BA 2ESCA 4AD1A 3CTTA 5I24A 3MYOA 3FDKA 5ABGA 4JTUA 1YLVA 5HWMA 1UKOA 4ZFMA 1RQHA 4E8GA 1QNOA 2VDHA 2E5DA 1KTCA 4AMAA 3QC0A 3AXKA 4I9MA 3KL5A 4C6LA 4U4MA 1UWIA 3CHEA 4UQAA 4C5ZA 2FPTA 4GG9A 2QZRA 3NQFA 4Y9AA 1QU4A 1QASA 4AVFA 5LYRA 2DT0A 4PTWA 2TAAA 1Z89A 2OWCA 1HJVA 1XR2A 2BB0A 4S3CA 1PWMA 4LXFA 1ZJBA 3VKAA 3CUGA 2ZZ6A 1QI5A 1ZQ5A 3UA3A 3FHAA 3G1FA 4GVIA 4EPEC 1TWSA 1HL8A 1TVNA 3F4NA 1PUDA 1I2OA 5AKQA 3QR0A 3AXIA 4R34A 1AQHA 4BQ5A 4J40A 4GIEA 3KDNA 1YEYA 3KTCA 2YBUA 4C6KA 3KAOA 1HKJA 2XH4A 3CUFA 4UFIA 3T7VA 1PZ1A 2FZDA 5EPDA 3W1RA 2CERA 3TFXA 4I7VA 1FDJA 4KWOA 1F6KA 3BLDA 5A8GA 4DYJA 5BXTA 3ITXA 4CNNA 4G7EB 4DBWA 5KTLA 3GFXA 2CLEA 2HNHA 1Y8BA 3PM6A 5BOEA 3FJNA 3EPNA 3DKJA 2VC5A 1QXLA 3NO3A 2WNWA 3CHCA 3UPWA 1LQ0A 1P5BA 3GC4A 2R14A 1TVPA 3P82A 4DM2A 3ZVHA 5FAJA 4DO5A 2NV9A 1TPFA 3TTYA 3S46A 1KBBA 4MB3A 4GYFA 4J28A 3BAIA 1K8YA 3CAWA 3G1SA 3RX4A 3V35A 3FA5A 2I57A 3PJXA 3GH5A 3UG5A 1EUNA 4R33A 2VOMA 3I7RA 2HCVA 4GUHA