3GNDA

Crystal structure of e. coli lsrf in complex with ribulose-5-phosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
280
structure length
276
Chain Sequence
GKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVVRDQRYFSLATRIAAEMGAQIIKTYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Escherichia coli autoinducer-2 processing protein LsrF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Aldolase lsrF
total genus 91
structure length 276
sequence length 280
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gndA00
5I3IA 2CLMA 1FDZA 4ZZ9A 1S5VA 3INPA 3TROA 1OX4B 1QMLA 1FWNA 2H3BA 2ATMA 4N2YA 4JTJA 5EBUA 1SFLA 3NQAA 3FKKA 3P62A 4JTFA 4S2CA 3DAQA 2QF7A 3W7LA 2DZPA 1H5YA 3C6CA 1U83A 3HG2A 4QIUA 3MBDA 5LGZA 3LTYA 1VQTA 3BGGA 4LVAA 2YW3A 5AHFA 1G7VA 2XN0A 5DLCA 4LV4A 3NEVA 5F2IA 3W2UA 2FB3A 3QC3A 3DU0A 2WKJA 4YMZA 5LNWA 2YSWA 4R34A 4NXSA 5FF3A 3EKZA 4ORIA 2J9XA 3QH2A 4S2BA 1LCOA 3IIVA 3SECA 4Y9AA 1T0OA 4ONVA 2ATSA 1QDSA 1JQVA 1IIHA 3S1UA 3KRUA 4CQ8A 4UFJA 1GJPA 4WJEA 4KWWA 2DZUA 5F2MA 1LOSA 2ZDRA 5A5WA 2C3ZA 3FFSA 2Z1BA 4R53A 1FCQA 3KRZA 3VCRA 2X1UA 1GT8A 3QSRA 5FI8A 5CSRA 3DI1A 2RDTA 3LB0A 3LRMA 3C2EA 2ZA3A 3CT7A 2CLHA 4AWTA 2Y85A 3T4CA 1XBVA 4UNKA 3NL6A 4E0CA 4OHQA 1YPIA 1YXCA 3RMJA 3HB9A 2QUVA 3LCWA 1W5MA 3LCFA 3L5AA 4HSNA 4L4MA 4M6VA 1ZAIA 3HJZA 4O1AA 1YYAA 5AYYA 4XBKA 2A21A 3WJWA 2GQAA 4K7VA 1KLYA 4BI7A 2YX0A 2Y7GA 2HMCA 3NQCA 4AH7A 4RX0A 4QQ3A 4FXSA 3TV8A 3FKRA 3KVLA 3B03A 2WJZA 2ZZ2A 3PM6A 2VENA 4EOUA 4JTIA 3W1QA 3LHYA 2YGYA 5EYWA 3A21A 3UXDA 2AAMA 5IBXC 1QWGA 3CLMA 4D2JA 3NQ8A 4NJJA 3A5FA 2FFCA 2Y6ZA 3M16A 3EWZA 2ZYFA 4MIMA 1TSIA 1F6KA 4JTTA 3N9SA 5DY2A 2E5BA 1FDJA 1H63A 3QPZA 2PE4A 2QJIA 1TREA 3UD6A 1LRTA 1LLZA 4CQAA 4UTMA 2VFIA 3GDLA 4I7VA 4N02A 3G1VA 3L5MA 3QF0A 1F05A 3W84A 1IF2A 3ANYA 2E09A 2CLKA 3IRDA 4RR4A 3FOKA 4OWGA 5D2XA 1HO4A 4O13A 2GQ9A 3GXNA 3MWAA 3CQ0A 3BG5A 4O52A 3CIXA 3W7NA 4A22A 5HWMA 2BLEA 3HGOA 4QM1A 5CPMA 2FPYA 4JS3A 2WQPA 4M7SA 3FIGA 1WOBA 1LRNA 2NV1A 2X1TA 5LNVA 3RU6A 1GZGA 3MI3A 4O4VA 2BZNA 4JN6A 3UNDA 5E93A 4XBSA 3KVMA 2V81A 3TNOA 3TFCA 4UMCA 1B4KA 3NQ6A 3L0GA 2A2IA 3SR7A 2QJGA 3GXTA 1UUOA 3U8GA 2ABBA 1OG0A 3PSWA 1OK6A 3LDVA 2PRHA 3ATZA 3RF9A 4DBEA 2C16A 3LCXA 4HKPA 1O5XA 1TQXA 3A22A 2A1YA 2DJLA 3W1TA 5D33A 4LVBA 1QPOA 1JCLA 4CLMA 4RKAA 1PL9A 4JYFA 4ADUA 1HG3A 4C1LA 3O63A 4O57A 2A4AA 3CM4A 2C0AA 4ALDA 4A3UA 1VRDA 2ISVA 3MW7A 5KZEA 3BLIA 3LI1A 4PODA 4GUHA 4XKYB 1TB3A 3RFAA 3PSVA 4DPPA 1H7XA 3QPYA 1IXOA 3HG4A 1L6WA 3GX9A 4ORMA 3MI6A 3NPVA 2JK2A 1FY6A 2QUUA 3OIXA 3JS3A 4OV4A 1PCWA 2UV8G 1AMKA 1Q6OA 3E9AA 2ZRUA 3S9YA 2BSLA 2HSAA 1GTHA 1FWSA 4OBTA 4LY8A 4XZ9A 3S5YA 3NQDA 5AHEA 4JGDA 3GDTA 5G1YA 2C13A 1I2OA 2ISWA 3L2IA 4ZVJA 4PCFA 3RLVA 4WOQA 1P0NA 1ZFJA 1HTIA 2FDSA 3GLCA 1F7BA 3H55A 4JIQA 3P74A 4XTDA 3AO0A 4QSHA 4M19A 4ZQCA 3I7RA 1UJPA 3K30A 3OA3A 1VS1A 1D3GA 1RR2A 3CWOX 3LHUA 5I3JA 5KZMA 3V1PA 4DXVA 3LBCA 4O1CA 4CNOA 5KMYA 3B0UX 3LI0A 1AW5A 1KFBA 5F2LA 5DELA 2ZA1A 3LV5A 2TPSA 4N6EA 4CNPA 3O6DA 4LU0A 3LXCA 3EX6A 3W7IA 1WAUA 2PRMA 5K9CA 1OFOA 2W79A 3KOFA 4LW7A 3GAKA 4IJBA 3P81A 3O05A 1TPH1 2Y7FA 1MEIA 4Q32A 4MY8A 1WBJA 1ME9A 1QPQA 3MBFA 2A7PA 1FXPA 3W22A 1WV2A 1WYIA 3W73A 4DPQA 3W1XA 3ZS4A 2E6FA 4WZHA 4POCA 3VE9A 4JTEA 3W75A 5LGXA 3EWWA 2CWNA 1GG0A 3NYZA 1RQHA 1U5JA 1G7UA 3I68A 2YXGA 4MZ1A 2ZA2A 1SW3A 4JTHA 3L21A 1X8FA 4JY8A 2BTMA 3G0XA 4O0ZA 4Z1CA 1W37A 3Q94A 4BFAA 5AFDA 3W86A 1OHLA 3UWZA 1TJPA 1CX9A 1VYPX 5C54A 4UFKA 5FEXA 4MY9A 4WXYA 1YADA 1XUUA 8TIMA 4DO4A 3TCEA 3DFNA 1K3UA 5SWUA 4LOCA 1W3TA 3UXAA 1JCJA 3DFSA 4HPJA 1OF8A 5DXXA 3LXAA 3W1PA 4DF2A 4TMCA 2B7PA 3TMQA 3NQ2A 1O4UA 3M41A 3W72A 4RLIA 5IM51 3GB6A 2YDAA 2VEKA 4J9JA 2GQ8A 3GK0A 4DO6A 3UWYA 3GR7A 4LNYA 2V8ZA 1YDOA 1KFEA 3EWYA 4IMEA 5CZSA 1IIGA 2B7NA 4W9TA 5HULA 3QQ0A 1AG1O 4BK9A 4NJIA 2VFDA 2Y7EA 3O6YX 1E51A 4LS1A 1XBZA 2DZXA 4N9DA 4AWUA 5F1UA 4DO5A 1SR9A 1OYCA 3DFOA 5CKSA 3A9IA 4MYXA 3G8EA 5D2YA 3BVJA 4YXGA 1EX5A 3GNNA 4HHPA 3N73A 4XTIA 3DHDA 2P10A 3MMTA 4JTGA 3W3OA 5I3GA 3P5YA 1QO5A 4UFIA 1VLIA 1ME8A 4RV8A 4EWND 3NNTA 5EA9A 1N8FA 1XBYA 3SSJA 1TYGA 3QM3A 5DCEA 2AQWA 2C19A 1Q3NA 1VHNA 2C6QA 3NOEA 4MPQA 1PHWA 2QCDA 4O11A 4U4MA 5TIMA 1H7OA 1C29A 3QZEA 1VYSX 5BRBA 1EPXA 1EP1A 5D2TA 3TAOA 3IIPA 4UTLA 3LGEA 1FWRA 4MY1A 4YCPA 4ZQRA 2OZ0A 2QAPA 3S8HA 1JCMP 4JTLA 4ML9A 4LWWA 3RNDA 3WJXA 1PIIA 4UUIA 3SZ8A 5L9FA 1K7FA 3EKLA 3TA6A 3W7JA 4LTSA 2EAWA 4O16A 4RZ6A 3FS2A 1G4TA 3IGXA 1J4EA 2ZTKA 4L4LA 4UTHA 4QAIA 3N2MA 3MJYA 3WJSA 2GPTA 3BG3A 1KFCA 3HO8A 4K39A 4LUIA 3HGSA 1TMHA 3TC6A 2XN2A 1ICQA 1TCDA 3TW7A 3NAVA 4UC5A 2G96A 2ZZ6A 4DF1A 1LRQA 2FPTA 4WY0B 1K8ZA 2GOUA 2R91A 3QW3A 3GVGA 4GC4A 1NVMA 3O6CA 3FYPA 3LRLA 3F4NA 2H8ZA 3QMTA 1G4EA 3W7PA 1TPDA 4FXRA 4NZJA 4G1KA 5F4SA 3W7KA 1ZAJA 4ZQNA 1VCGA 4O53A 1FXQA 1RPXA 3NQGA 4H3DA 4HSOA 3E0IA 5AYXA 3TMLA 4IX0A 2CLOA 2QUTA 5G2WA 2NXHA 2FIQA 4X3ZA 1R2RA 5K4ZA 1W31A 1VJIA 1ZJIA 2NXIA 3DGRA 3FLUA 3HOJA 3S1VA 1LORA 3LX9A 2YR1A 5LZLA 2J24A 2PRLA 1QFEA 3UWQA 2I1OA 5FF0A 4GUJA 2P0OA 2KZHA 3M7WA 4TIMA 1VCFA 3L5LA 2HS8A 1W5OA 3S5OA 4GFSA 5LNRA 4BR1A 3TIMA 4O17A 3RK8A 3UYCA 3SGUA 3T7VA 1GWJA 3BW3A 5LNUA 1KM6A 1DOSA 1MO0A 2E1DA 1SU5A 4MKNA 1ZCOA 3MUXA 4LS0A 3PB2A 3YPIA 3SGZA 5BW6A 2ZQ0A 1ZALA 5ABTA 2V2CA 4NNBA 5D04C 1H60A 1K8YA 1GVFA 4R7JA 1VC4A 5FF4A 1LOLA 5KTLA 1F2JA 4QISA 2VELA 1XDMA 1NF7A 3BW2A 3C2FA 3W70A 1JCXA 2DZWA 4QNEA 4JEQA 1SO3A 2C18A 3S1WA 2V2DA 4BWLA 4PFMA 4MLJA 1DVJA 5D09A 1SSDA 5DXYA 5HWJA 3ZWSA 1CI1A 3NGJA 1JUBA 5DY3A 1THFD 2NXGA 4N9EA 5H2ZA 3TU9A 1GTEA 2NV2A 4PTNA 3EB2A 1C9DA 4WY0A 1B57A 5GVJA 3O8AA 5I3KA 5A8GA 2H8XA 1LM1A 4HIBA 3EWXA 2Y63A 2QDHA 1XM3A 1PE1A 2FPVA 4FNSA 2H3DA 3MYOA 4LV9A 1DHPA 1SW0A 3CPRA 2RHGA 5MHBA 1XDLA 4JNMA 3LLDA 1W54A 3G8RA 4NNCA 1KLZA 2RH9A 5E0KA 3HG3A 4O28A 3W9ZA 2F7FA 4LRSA 2OJPA 4IPIA 1ZHAA 3W7QA 4NX5A 3GKFA 1A50A 3PF3A 2GUUA 5G1TA 2C14A 1ICPA 2FTPA 3W7HA 3MO7A 5AC6A 3O06A 1TPVA 3FJ6A 1H7RA 4O4WA 1LOQA 2VEIA 3P80A 3E02A 4TR9A 4UR7A 3F03K 4MFEA 3O07A 2W6RA 4AF0A 4MLRA 3WK2A 1I8JA 1NAL1 3EWUA 4MZ8A 3EX4A 5D02A 4I7WA 1KA9F 3HQ1A 4NXKA 1QCWA 2CZEA 2VXNA 3NZ1A 1R2TA 5C6MA 4AHOA 4H6KA 1OFEA 3KAOA 2E77A 1OF6A 2QCCA 4FIRA 2Y61A 1KBJA 1HFBA 3EXTA 3G1AA 1NFBA 3HF3A 4P2VA 3S42A 3UZ5A 2Y89A 4JX4A 3M43A 2ZBTA 2GJNA 1ONRA 2G97A 4UTJA 1S3HA 1GVSA 3NO5A 3G3MA 4U28A 4Y8FA 2JKAA 2PC4A 2QCDB 4PC8A 3EWBX 3IVSA 3PBVA 5EKYA 3EXSA 1RVGA 3R2GA 3V75A 3UZJA 1Q6LA 3GKAA 1H7PA 3IIXA 4K38A 2PURA 4Q4KA 3W2MA 1Q6RA 5D30A 2VOMA 2CZFA 2O7QA 3QRHA 2CLFA 3UY8A 4Z1AA 3P7YA 2ZZ3A 1D3HA 1VGAA 4BF9A 5C2XA 3T78A 3I7QA 1MEWA 2HTMA 1N55A 4OGZA 3P8JA 4LC6A 3LXBA 1RZMA 4Z1BA 3M9YA 3SW6A 3UWWA 3W1RA 1F5ZA 1LROA 4RZ5A 2Z0IA 4JX6A 4OV9A 1F74A 1KM2A 3G18A 4WY0F 3IEBA 2Q3OA 4MFDA 1FWWA 4S1FA 1ALDA 2D73A 3M44A 4IX2A 2GVLA 4XWUA 1OFAA 2X16A 3FA5A 1QNVA 3HGRA 5LSMA 4EF8A 3TQ0A 3KRSA 1Q45A 1V5XA 5G4EA 5CPNA 2OT0A 3IGUA 3CU2A 5D38A 5J5DA 1JUKA 4M5PA 2YYTA 1XKYA 3SIZA 1FCUA 3LRKA 2OX1A 3L9CA 4EF9A 5AB3A 3VE7A 2V0TA 4NT0A 4GRSA 3DHFA 1LBFA 5CZTA 1C8VA 1DV7A 5EPDA 5K2ZA 3CTLA 2VKZG 3PBYA 1GQNA 5HUPA 3C2VA 1X7FA 3N3MA 3I65A 2Y7DA 1EEPA 4Y96A 2A7NA 2OT1A 1W8SA 2E6YA 3W7EA 1EUAA 4PH6A 4QITA 3W88A 3P8IA 1FX6A 1TPC1 1LLWA 3LOTA 1L6SA 3STFA 4JX5A 1O60A 2X30A 4Z0JA 3R89A 4M6QA 2VFFA 2Q8ZA 1AW2A 1K03A 4A2SA 1TIMA 3MHFA 1J2WA 2A85A 4PEKA 1WX0A 4B5NA 4N9BA 3HG5A 1I2NA 2R8WA 4GNJA 1L6YA 4JDYA 1KM1A 1LP6A 4RZ4A 2ZTJA 3ZFHA 3QMRA 1FUYA 2QCMA 1OX5A 1S5TA 1I2PA 4NZFA 2B7OA 4AEOA 1H61A 1ZNNA 4ICNA 1Z41A 4ZQOA 5D2WA 4Q33A 1UASA 1LZOA 2E5CA 3G1DA 3G1YA 3PVFA 1XL9A 4Z1DA 3GYEA 3USBA 4N6FA 3M1ZA 1OFPA 2C15A 3QFEA 7TIMA 2RKXA 1K8XA 4MJZA 4MJMA 4JDBA 2F84A 2Y62A 3NPXA 2QCNA 3PUDA 3DZ1A 5AHIA 4IOTA 4E2DA 4FNTA 4LT9A 1G67A 4TMBA 5D03A 4UTTA 1BTMA 2A5HA 3C61A 1FCVA 1MXSA 4IXHA 3B0PA 1G4SA 3S1XA 3HIJA 1G6CA 3DKJA 3MP4A 3LHVA 1TTJA 2VFEA 3C2OA 1YTDA 4GUGA 5FEPA 3TX9A 3ZWTA 4DELA 4UTUA 5KSWA 4XKYA 3W1NA 2WSYA 2G5WA 4JTKA 1K02A 2J88A 4NJHA 1EWDA 1OVDA 6TIMA 1WXJA 3DKLA 1SO6A 4LUJA 4RJEA 3C3NA 3PBWA 4C1KA 2QCEA 4JTUA 4OT7A 3W7DA 3TJLA 3O15A 1SFJA 4N4PA 3L66A 4O1BA 3GR8A 3U2OA 1O95A 4NJGA 3MHUA 1SW7A 2A7RA 4UTWA 3W7RA 5TBOA 2DJXA 4KFPA 5AC7A 1RQBA 4UMBA 5D2VA 3TQVA 1T99A 2GVGA 1I2RA 4M6PA 3TE9A 5AHLA 2LLEA 3ABOA 3B4UA 2EGZA 1BEUA 1TRDA 2ZRZA 3B0VC 3UWUA 3HBLA 3M5XA 2DZTA 1HUVA 3N9RA 3LTPA 4NJKA 5FEZA 1VHCA 1Y0EA 4WQ6A 3EX2A 1YXYA 3ATYA 3TQKA 1F6PA 4PL1A 3W07A 1QPRA 3W7GA 2VEPA 2V5BA 4E38A 4NX0A 3LCIA 3NZRA 1M7PA 4GUIA 1AK5A 1W0MA 1WDWA 2WNQA 3GDKA 3P67A 2H6RA 3A24A 4LVFA 2CLEA 1FCBA 3BW4A 3W1UA 4OE7A 2X2GA 2QEZA 5C55A 1TO3A 5CSSA 3C4UA 5K9XA 1SZEA 2FQIA 1HO1A 2ZRVA 1XC4A 1SZGA 4AMAA 4HNTA 4WX2A 1GVQA 2J9YA 3L0NA 1KFJA 4UXDA 1JCYA 3THAA 1VR6A 5HUOA 3OBKA 4MOZA 3N14A 1YTEA 1OJXA 4YL2A 2I14A 1QO2A 2QKFA 5CGQA 1WQ5A 1IXQA 3WFAA 3HGJA 4X22A 1EP2A 2NUYA 2E5DA 1IXPA 2ZZ5A 3UY7A 2JKPA 3C0JA 3W7MA 3B06A 1TV5A 3OHIA 1ICSA 3LHZA 4KKXA 3CEUA 3O16A 3PB0A 2VC6A 1R46A 5G4WA 1Z44A 3T55A 5KITA 1X1ZA 3QQ1A 4AB4A 1VZWA 5LKYA 4NNAA 1KM4A 3TXZA 1BWKA 3NL3A 3W71A 4GE8A 4QJ1A 3H54A 2JKEA 4O14A 2HS6A 1VCVA 1H50A 3W2LA 2J6XA 3LBMA 3R13A 4CNNA 1KW1A 3CC1A 1TPUA 4CCCA 1EB3A 1PV8A 4HN4A 3DFTA 3BARA 4JD4A 1SSGA 1H62A 4M7TA 3IIOA 2YW4A 2BXVA 4E2BA 1WA3A 2G95A 2YZRA 4P61A 3G24A 4FIQA 4O18A 5DBUA 1KM0A 6ALDA 1JR1A 4A2RA 2BX7A 5H91A 3JRKA 4WUIA 1WBHA 4JR5A 3BLEA 3FJLA 3O1NA 1S5WA 5DN1A 2CU0A 4O15A 1O5KA 4LVGA 1W56A 1JCNA 4X2RA 5E1QA 3TDFA 3OEXA 3NQVA 3TR2A 4UMAA 3QMSA 3CWNA 1DJQA 2EHHA 1P1XA 3JR2A 1KFKA 4UFLA 5CPOA 2J27A 5HQEA 3UWVA 1J5TA 2VEMA 1JUEA 2GVJA 1X6UA 1DJNA 3IIZA 3TH6A 4O19A 3WJYA 2Q3RA 3NG3A 4JY9A 5F4WA 1EA0A 3MI2A 2V2HA 3TSMA 3A5VA 3PULA 4FO4A 3TJXA 2WPBA 3NM3A 4JXCA 4QNWA 3W6YA 1TTPA 1KTNA 4WD0A 2QCHA 4LC8A 3W85A 4UFHA 3TSDA 4UNLA 2TMDA 4FNRA 2ZZ7A 2X1SA 3NM1A 2WOQA 2QCLA 3NQFA 5HINA 4MZYA 4UTWC 3DXIA 2ZRXA 3NQMA 1M6JA 4IMDA 1MZHA 3G1XA 1SZNA 3G1HA 1IXNA 2V82A 4TX9A 3TKFA 1UBSA 2ZRWA 3NA8A 1GOXA 1KV5A 3C2RA 3S5ZA 1F73A 3NL5A 1TRIA 1JRBA 2QCGA 3IVUA 1XCFA 3DI0A 2YFNA 1OYAA 2EF9A 4O0KA 5F4XA 1EIXA 1EUNA 3OVPA 2NWSA 4FX8A 2FJKA 4IPJA 3HPZA 1EWEA 2AGKA 4HNUA 2ISSA 4UTIA 3STGA 2WNZA 2V5LA 4ZL1A 1SQ7A 3TXVA 4FHAA 3CIWA 1W3IA 3I7SA 3BK0A 1WOAA 3W2KA 4IXXA 1TQJA 2V9DA 1JQXA 1LDCA 4H4IA 1KM3A 4XQ6A 4IMCA 4ADSA 4O10A 1GPWA 1FWTA 2WSRA 3SI9A 4GJ1A 1RD5A 2RDWA 4O8RA 1H7NA 5C5YA 1SO5A 3SFKA 4O1DA 2E68A 1JRCA 2B7QA 3BO9A 1P5BA 1LBLA 1GYNA 3IVTA 2QCFA 2QJHA 3UPWA 3L68A 4PL2A 4YCOA 2CFFA 5G2IA 4N4QA 4K36A 2O7SA 4JIPA 3I6RA 3QJAA 3P84A 3KXQA 5AYZA 3WK3A 4PA8A 1GVOA 2ALDA 3DFPA 1FDYA 4AHQA 2ZFAA 1OFRA 5K7JA 2DZVA 1VH7A 2NWRA 3A23A 4YLWA 1O94A 1M7OA 2B4GA 3VNDA 3IGSA 2YCEA 4A29A 3PR2A 4Z08A 4RCXA 3PG8A 3D0CA 2BWGA 3CEPA 4CCEA 3S6DA 1CW2A 4WXZA 5FF2A 2JBMA 4FX7A 3NL2A 4NVTA 4HPXA 1OK4A 4LRTA 1G69A 1HL2A 3NQEA 2Z2UA 5D32A 3WK0A 4OU1A 2VFHA 1TTIA 1PCKA 3VKJA 1RV8A 2P1FA 2IQTA 3QYQA 1TPB1 5F2GA 5DCDA 1A5CA 2Q8LA 3PG9A 2A0NA 4K37A 2FLIA 1FQ0A 4UR8A 1FBAA 5T26A 2YYUA 1DBTA 1N7KA 1LBMA 3DBPA 3W23A 5LNSA 2DORA 3BPWA 1T8XA 5D37A 1L9WA 2TRSA 1GVRA 4NU7A 3STCA 3W2JA 4IWWA 1UUMA 2CW6A 4X9SA 5CG7A 3UPBA 3N34A 2RDUA 3OG3A 3TAKA 3CB8A 2NUXA 3G1SA 3M0ZA 3M6YA 4MVAA 2EKCA 3P5ZA 2YPIA 3LV6A 3VFLA 4A21A 1DQWA 2Z6IA 3PC0A 1OX4A 2B0MA 2NZLA 4I7UA 2CLIA 1GEQA 2WO5A 2X1RA 4GUFA 4TO8A 4JTSA 1QAPA 3ABRA 3PS7A 4UCGA 4JYDA 4CQ9A 1VPXA 5FESA 4ADTA 3L65A 3UQNA 3HPXA 2ZZ1A 3HPSA 3ABQA 2CZDA 1KBIA 1A53A 1YLVA 3M5ZA 1TPFA 4DQWA 1YPFA 5FEWA 1KFLA 3NPWA 4DEFA 5HR6A 3ZR4A 3KFTA 2XN1A 5IBXA 1ZENA 2Y70A 4UTKA 4TU1A 1P4CA 2QAFA 4CCDA 3WK1A 1KV8A 1OABA 1TTQA 3BG9A 5U7SA 3LM7A 2XFWA 3F4WA 3PY2A 5TQLA 3E12A 3W1MA 3LHWA 1H7WA 4R33A 5HR7A 1V7YA 2GJLA 3TUUA 1X1OA 3EEGA 3LCLA 1TV8A 2H90A 3DFQA 1H51A 1QOPA 4FX6M 1EP3A 1BWLA 4XUGA 5HJLA 4GBUA 4KWVA 1VYRA 1OFDA 3M47A 1IGSA 1NF0A 4AHPA 1H1YA 4Y90A 2A6LA 2DP3A 4GXMA 1H1ZA 5DBTA 3C52A 2NUWA 1TV7A 4RXGA 5HNRA 3GXPA 5LHFA 3LTSA 1AW1A 1KTCA 2ZRYA 4GWEA 5AHMA 2R94A 3B8DA 3M5VA 1OYBA 1ZY9A 3DENA 4HNNA 1VLWA 1W1ZA 4FB7A 2ZCGA 3LERA 1KTBA 1UB3A 4IUOA 5BMWA 1OFBA 4K7YA 3H53A 1SPQA 2E6AA 3B04A 3T44A 4EIVA 2RFGA 1JJKA 5AN7A 2VFGA 1XBXA 1PVNA 3NDOA 3IV3A 3TSBA 1SZFA 3EX3A 3FEMA 1G4PA 3G22A 3NR0A 2DU2A 1A5SA 1R2SA 3Q37A 4JYEA 2TYSA 1W5QA 4DBDA 2TSYA 5K9DA 2E6DA 5I3FA 2C1HA 3NPUA 4O12A 1B3OA 1XXXA 5FF7A 3PUEA 4DF0A 3PWAA 3BV4A 1I45A 2OCZA 4N9CA 4IMGA 5D05A 3QW4B 4IGHA 1ME7A 3R8RA 3SY5A 3S0CA 3NQ7A 1XI3A 3W87A 1TJRA 4KFNA 3VI2A 5DCBA 4AAJA 3KHJA 1YDVA 3BGJA 3Q58A 3MYPA 3W7OA 1XUZA 1L2UA 2CZ5A 4IQLA 1NSJA 4RXFA 1RQEA 5KZDA 4FNPA 4WOZA 3LHTA 3G0UA 5EL1A 1JULA 3NXFA 4FF7A 4AWSA 4ZQPA 2PCQA 5K4XA 3G3DA 4UTTC 3C56A 5CZJA 1DL3A 3CHVA 4NUWA 3HMJG 1LTDA 2NLIA 1T96A 3EXRA 1DORA 3LCGA 3STEA 5K3VA 3TK7A 3KVKA 3PUOA 1YDNA 3R5EA 4NQ1A 2FB2A 1K7XA 1DQXA 3B05A 2I9EA 3GAYA 5LHEA 3N2XA 1OFQA 3W1AA 5AHNA 3E96A 4FNUA 5AC8A 2NX9A 4O54A 3WJZA 3TC7A 2JGYA 4YWIA 3U6WA 3W83A 1I4NA 2QDGA 1QPNA 1YTKA 3MP3A 4MYAA 2Y88A 4BWLC 3R12A 4HNVA 3MP5A 4ZMGA 3RLUA 2WNNA 1UCWA 2EPHA 2Z6JA 4EVZA 1MEHA 3QEZA 5EY5A 4BI5A 1R30A 4MUZA 1ZAHA 3BLFA 1AL8A 1AL7A 1R47A 3FYOA 3L67A 2NX1A 4BI6A 5BNKA 1Z48A 4RK8A 2NX3A 3P82A 2ZZ4A 2QR6A 1BKSA 3C8FA 3G1FA 1KM5A 2R14A 4OQVA 3SJ3A 3GIYA 4FNQA 2YFOA 3P60A 1K7EA 3AJXA 3LLFA 1LYXA 4K8EA 3PAJA 3W76A 4KFOA 5I3HA 1QOQA 3ABSA 4JICA 2J9ZA 3OVRA 1JVNA 4UIOA 1ML1A 3W74A 1W5NA 1SUXA 1MSSA 4AF0B 5J5RA 1A5AA 3W7CA 4K8HA 1NEYA 1W3NA 3GZ3A 2WSQA 1DKWA 5BMXA 1B9BA 5EMUA 3NVTA 3G0SA 1SO4A 1Q6QA 3T40A 4K6AA 4ZQMA 3EX1A 5AOUA 5BOOA 1TPWA 4Y6GA 2V30A 1ADOA 3GNDA 3OVQA 3MHGA 3GDMA 1A5BA 3P61A 3ELFA 4UFMA 1W5PA 5G2HA 1F76A 3TW6A 3DH7A 4LVDA 2JGQA 2ABAA 3W2NA 3M5YA 1D9EA 2DZSA 1M5WA 3F1QA 5KINA 1PHQA 1P0KA 4AVFA 1QR7A 1I2QA 4FEZA 3L0KA 3E49A 3KX6A 4HT3A 3N19B 1GYLA 5F1VA 3LCHA 5HWNA 3QSTA 1TPEA 4I9AA 1Z42A 4IMFA 1PS9A 1GG1A 5G5IA 3TFXA 1YXDA 5CPLA 3GDRA 4LS2A 2CLLA 5HMSA 4AXKA 4O50A 2A6NA 3S5NA 3KVJA 1XFBA 3PBUA 3THQA 1OX6A 3W1LA 1B4EA 5U4NA 3Q2DA 5L6UA 2OMAA 4Z0SA 5CZ0A 2W0UA 2WV8A
chains in the Genus database with same CATH superfamily
1F4HA 2CLMA 1FDZA 5G4HC 4ZZ9A 3SCQA 1JIBA 5BROA 1EH9A 3TROA 4N2YA 5EBUA 2DFAA 3FKKA 3VAVA 5I3DA 2R1LA 1HJWA 4JTFA 3CAQA 2QF7A 3IJ6A 3FV9A 1H5YA 1JG9A 4BEUA 4Z2KA 4QIUA 3H6OA 5LGZA 3FSUA 3B3DA 5DT7A 1GEHA 2Y0FA 1TA3A 3E0FA 4UBPC 5AYIA 2XN0A 1ITQA 1UH2A 4Z2JA 5F2IA 2QW5A 3QC3A 4YMZA 3ARXA 4FLOA 3ANUA 3Q45A 1EFZA 3IIVA 5CBBA 1IWPA 3NSMA 1QDSA 2YBUA 1X7IA 5AVHA 1NQKA 1UYQA 3AMKA 4LB3A 1IT8A 1GJPA 2WVUA 4AVOA 3BSHA 2DZUA 1IZJA 1JXKA 3SCOA 2Z1BA 5E0FA 3QSRA 5CSRA 1ZU8A 1ITXA 4RE2A 2RGMA 3BOFA 3AFBA 1W3KA 7TAAA 3E2QA 5A8NA 2OYLA 3ZLFA 3O7UA 1O66A 1VFSA 4RZBA 2QIWA 3LCFA 2ZXAA 1PKYA 3NVDA 1ZAIA 3PNUA 5C7HA 4O1AA 2BVWA 1AQFA 1CGTA 1YYAA 4JQAA 2A21A 3WJWA 2GQAA 4K7VA 4KRUA 1UR0A 5JQ9A 4LUSB 5C8BB 2YX0A 3BZJA 4S3BA 4RX0A 3EA3A 4W87A 3ALFA 2PFHA 4G8TA 2C71A 3CQIA 4GISA 1IE7C 4XAPA 1R3WA 5EYWA 3A21A 2QT3A 4IGNA 2XM2A 4D2JA 3L4TA 4BCEA 4RW5A 1I9CB 3EWZA 1TSIA 3P0WA 4JTTA 4BZYA 3N9SA 3ICJA 3C0QA 2QJIA 2F9RA 4KCVA 4AD1A 4R88A 5FSEC 4HU4A 4UTMA 4CQAA 2VFIA 3GDLA 4QLJA 4YVPA 1E0XA 4I7VA 3R11A 3COTA 4GH3A 3W84A 2EG6A 2J7DA 3ANYA 2PDFA 3IRDA 1KBBA 3AU2A 4RR4A 1A5KC 1HO4A 3SCPA 3P93A 4O13A 3VDGA 4O52A 1GOMA 3CIXA 5HWMA 2NQLA 1W1IE 3FIGA 4KT2A 2X1TA 4IIFA 2BZNA 2JF7A 4JN6A 4YS1A 1XRVA 2FTWA 3TNOA 4XO7A 8CGTA 3DUGA 3L0GA 4KCWA 3TJ4A 2QJGA 5TNVA 4OIFA 4GD0A 3WLRA 4O8AA 3REQB 1OK6A 2PRHA 3CAVA 1RCXB 1ZP3A 4DBEA 3TP4A 2C16A 2HISA 3LCXA 4HKPA 2X0YA 1T5AA 1TQXA 3MDUA 4LAUA 4AX7A 4C6FA 5A8QA 4CLMA 3UZYA 3EDKA 5CXPA 1WB0A 2WMIB 1XC6A 4XZMX 3BANA 4ALDA 1SJBA 4A3UA 1VRDA 4LEFA 3MW7A 1ZLPA 3BLIA 3LI1A 4PODA 4GUHA 1RJQA 3PSVA 4JKLA 3WFLA 5D8ZA 1E4NA 2QZRA 1E9YB 3QPYA 3GX9A 3RDKA 1V3LA 4IL2A 2OSWA 2JK2A 1ODUA 4JKKA 2DT1A 2J77A 4J3SA 4GX9A 1Q6OA 4HCHA 2BSLA 2HSAA 1GTHA 3VC5A 3VILA 2XPKA 2Q01A 3ITCA 4E3TA 3NQDA 2PSNA 4ZVJA 4I6KA 4PCFA 3RLVA 4WOQA 4HA1A 3GLCA 3U3HA 4J35A 4CNSA 5BWFA 3N4FA 2FYMA 4ZQCA 3I7RA 1UJPA 3K30A 1D3GA 2HVOA 4V15A 4JIEA 5A6LA 4W7WA 4RE0A 4DXVA 4EK7A 1P6WA 3S83A 3TWBA 2YA2A 5F2LA 3M46A 4CVUA 5CH9A 1EXBA 1ZUAX 2DPEA 3LV5A 1MRQA 4CNPA 3O6DA 1GZ1A 3NTYA 1WAUA 2X1IA 3KOFA 4UOJA 3UNTA 4LW7A 1Z9AA 3VM7A 3OP2A 1TPH1 4JIIX 1E0UA 2A7PA 1JAKA 1WYIA 1LF1A 2OZ8A 3NZPA 4MM1A 1OG6A 3CQKA 3N6HA 2F6UA 1XLDA 3KRBA 1U5JA 2PTXA 1G7UA 3I68A 3NYZA 4TVUA 2ZA2A 1SW3A 1X8FA 1P7TB 1RPKA 4HMCA 3SRDA 3G0XA 4O0ZA 4Z1CA 3DYMA 4HZ8A 1PJ9A 7A3HA 1S39A 4R27A 2PEVA 4BFAA 5D9PA 1R3YA 1T7LA 1HVXA 5FEXA 1Z89A 3WBWA 3P2VA 5ABHA 4DO4A 3DFNA 3VMNA 3LQGA 1A5NC 3UXAA 1Q2SA 3PAOA 3MS8A 5EMLA 2D22A 3W1PA 3GO2A 2F61A 3L4ZA 4D6FA 2B7PA 4W85A 3TMQA 4PMNA 2AQVA 2GQ8A 4DO6A 4ZTYA 1ZJBA 1KFEA 1UD6A 2B7NA 5HULA 4U3CA 4L6OA 1M1BA 4LS1A 2X41A 2DZXA 1TWIA 1A4MA 4MF4A 1R3QA 1JZ7A 5D2YA 2ZUWA 2PDMA 1EX5A 2G50A 1H41A 4XB3A 5I77A 4UFIA 4NI3A 4NILA 5GQBA 1ME8A 5LIKX 4EWND 3NNTA 5EA9A 1N8FA 1R9XA 4H7ZA 1TYGA 3IK2A 4F2BA 4LNCA 3UCCA 3KOZA 3PZIA 7CGTA 4GI6A 2C19A 4MPQA 1PHWA 3CT2A 2QCDA 4D6IA 1OINA 5CAKA 1VYSX 3PNZA 3IIPA 3LGEA 1FWRA 1HF6A 4ZQRA 3WQPA 3S8HA 1JCMP 1K9EA 3KBSA 1PIIA 5L9FA 1K7FA 1FVPA 4F0RA 1ISXA 1I0BA 2PU0A 1BRLA 1J0KA 4DM1A 5IOBA 3MCOA 1B9ZA 2FZ9A 2XSBA 1XIHA 2CBUA 4PR4A 5HJXA 4XBJA 1H3GA 3N2MA 5HMFA 5H8UA 1X6NA 2Y8UA 2GK1B 3HGSA 3AHXA 3EB3A 4NRRA 3TC6A 4W84A 2INZA 3U2CA 4QE1A 2VCCA 3GVGA 3O6CA 1P0DA 1DWFM 1PX3A 3QMTA 3W7PA 2Y8KA 1HVQA 4HZMA 3SY1A 3BMXA 3LPFA 3FHQA 3WLPA 4E6MA 3Q67A 1FXQA 1XLJA 3AICA 4HSOA 3E0IA 3JUGA 1W1A1 4IX0A 3TMLA 2QUTA 2FZNA 5M5DA 1GK8A 1BYAA 2UBPC 3DGRA 3HOJA 3PZVA 4Z2HA 2HPMA 4P8VA 1W6TA 3VIOA 3M0VA 4J3TA 1BXCA 2YR1A 1IT7A 2ZX6A 4E3VA 4AZGA 2CHRA 3ORWA 1FFQA 2I1OA 4NP7A 5FF0A 2P0OA 2KZHA 3M7WA 1VCFA 1J2BA 5LNRA 3K4AA 1WDSA 2AMXA 4BR1A 2BV9A 4LBSA 3HFYA 3AS3A 2NVDA 2PLKA 3H2NA 4J40A 1QXLA 2PGEA 4YWSA 1ZJAA 1MO0A 2E1DA 2GGGA 3GH4A 3UJSA 1SU5A 4MKNA 2PI6A 1ZCOA 2ZQ0A 5HANA 2V63A 1PUDA 1K8YA 4R7JA 4V33A 4QX4A 5FF4A 4WVXA 1J6PA 4QISA 4PUNA 5C71A 3R10A 3WF1A 1GVIA 3W70A 1Q6EA 4JEQA 1GPFA 4MLJA 5HWJA 3NGJA 1JUBA 4KETA 1Y5XA 2D2HA 1GQIA 5H2ZA 3TU9A 1GTEA 2NV2A 4DBWA 1B57A 1J0ZA 4G1NA 2H8XA 3SQLA 4NHVA 3GUWA 3EWXA 3ZT7A 1E43A 3H2CA 3U7VA 1DHPA 1ITUA 4AY1A 3G8RA 4NNCA 1O12A 3PFMA 4LRSA 3KDNA 3BAIA 1UC4A 1F6YA 1GUVA 2GYIA 2ZUUA 1QNOA 3W7QA 1TV2A 4RNJA 4NX5A 3GKFA 1FHDA 7PTDA 4FR1A 4H8VA 3GXFA 3MO7A 3C86A 1TPVA 3VIJA 3FJ6A 4ZTXA 2NT0A 1GCYA 1PZ3A 3O07A 1NAL1 3VOIA 4FI4A 5D02A 4ATLA 3BAJA 3SCTA 3V16A 1V4YA 1W9VA 5C6MA 1Q6CA 3GVRA 3M0MA 5M1TA 2VEGA 3FJNA 3KTXA 3KAOA 3NURA 1AQ0A 1UWTA 2QCCA 2Y61A 3S42A 4JX4A 4HYVA 3M64A 5DEZA 3SQMA 4UTJA 3DGBA 3NO5A 1TA3B 5BXTA 4R5EA 2GOKA 4Y8FA 3UJRA 1XKJA 4A8RA 2QCDB 1C3FA 1KFWA 3B8VA 1SJAA 3TN6A 3IPWA 4F9DA 5I2UA 2E8YA 3EB4A 4LBUA 3IIXA 4QE5A 4Q4KA 4EE9A 4IUGA 1Q6RA 2VOMA 3DC0A 1F61A 2CZFA 3VX0A 2VX6A 1FFRA 4H9TA 3QRHA 2DIKA 2CLFA 4Z1AA 1V6TA 3G5EA 2ZZ3A 1VGAA 1AJ0A 4PZVA 3M0HA 2YXXA 1NWRA 2DSUA 3LXBA 4BF7A 1MRAA 1RJPA 3SW6A 1UH3A 6PTDA 1LROA 3ZSSA 2Z0IA 1RBLA 3G18A 2Q3OA 4S1FA 3M44A 1OFAA 1V0MA 3WMSA 3CTTA 3HGRA 4A3HA 4EF8A 5CPNA 1K77A 1ZBKA 4FF5A 5EMYA 1SM9A 2WHKA 3IGUA 1CENA 4Q8OA 2YYTA 3UA3A 1AQHA 3L9CA 4P5UA 5AB3A 1DTNA 3VE7A 2Y5SA 1CXEA 2CZVA 1F3EA 2I9UA 3VMOA 1LQAA 1E0WA 3KL0A 1JFXA 3CTLA 2VKZG 3UP8A 4RNFA 5H1WA 1U1UA 3GUGA 3I65A 1EEPA 5CZKA 3WDHA 4IHCA 3GHUA 1IWBA 4F0KA 4K1GA 2VM8A 3R1ZA 3TZFA 2WCAA 1FX6A 4R9XA 1LLWA 1HNYA 5XINA 3STFA 4NAFA 1CBGA 3PJWA 2X30A 2DSVA 3VUPA 2Z1XA 2Z7KA 4PMJA 4S3FA 2VFFA 2Q8ZA 1TIMA 2BXYA 4PEKA 4B5NA 3HG5A 1V6UA 2W27A 3VKBA 1L6YA 4GIYA 4RZ4A 1P48A 2VD9A 1EHNA 1FUYA 4AXNA 2QGHA 4HA4A 3NQBA 5EMMA 1P6CA 1I2PA 4S3AA 3H4WA 4PMZA 1WKDA 1ZBWA 4ICNA 1Q13A 2WLYA 3S5SA 4Q7BA 4A6GA 3S1GA 3KOXA 1RHCA 4AMCA 3V1HA 2E5CA 2QDDA 4N6FA 3M1ZA 4RE4A 3M4HA 4C6CA 2VURA 3N17A 2FHBA 2VD8A 1BGAA 5AHIA 4IOTA 4AY7A 3B8IA 3L23A 2D1ZA 4TMBA 5D03A 4MWAA 3C61A 1FCVA 4P7OA 1XHGA 1C7SA 1G4SA 1UKPA 3RAOA 1G6CA 1HKVA 4AWEA 4CCZA 2OGJA 3MP4A 5FEPA 2CEQA 1KBKA 3WH8A 3W1NA 2WSYA 1MMFA 3AS0A 1L8NA 2NLYA 4JTKA 4B16A 1Y5WA 1EWDA 1W9XA 6TIMA 1TR9A 4AZ7A 1SO6A 3HQPA 5E5CA 3ZJ8A 4OT7A 3O15A 3FYYA 4N4PA 2Q02A 3L66A 2PD9A 2DH2A 1TX0A 2J79A 3CZGA 4FLQA 5TBOA 3WF3A 1ZP4A 2PZ0A 1KGUA 3ARYA 3BLPX 3T09A 1VBUA 1XRTA 4M6PA 5AHLA 1A4LA 3ABOA 3A4AA 3B4UA 2EGZA 1OWQA 2ZOXA 4WJ8A 5GJPA 3B0VC 2GJPA 1CLVA 4XZNX 3M5XA 2P5NA 3N9RA 5DO8A 1MUMA 1WXYA 3FVMA 1VHCA 5FJRA 1WUEA 1JDDA 2VR5A 1GKRA 4PL1A 3W7GA 4OBSA 4E38A 3M07A 4WKHA 3LCIA 1W0MA 1WDWA 2WNQA 4PRTA 3L12A 4YTSA 3P67A 2V3EA 1RBOB 2CLEA 3SCRA 3RX4A 2X2GA 1CGUA 4XD6A 4LCRA 1MFUA 1M53A 4WX2A 3L0NA 1KFJA 1JCYA 5HUOA 3ZT6A 3OBKA 3ARTA 3EDFA 1QO2A 1WQ5A 1IXQA 4LBRA 4X22A 2E5DA 4HHMA 1E72M 3KHDA 3ZVIA 2ZUNA 3VA8A 3OHIA 3TYAA 2JEPA 3UZXA 3VIMA 4GKLA 5KITA 1X1ZA 1O7AA 3SRKA 2FVMA 4DJFA 3GM8A 2YOCA 4NNAA 1KM4A 2FFIA 1BWKA 3TXZA 4KMQA 4PTMA 2HS6A 3A64A 4HNCA 1H50A 4B90A 2H9AA 5IFTA 1R8LA 2J6XA 3R13A 4CCCA 3H26A 3UGRA 4DRSA 1GHRA 4MAZA 4CN6A 2BXVA 2NSXA 5CPSA 2G95A 2YZRA 4O18A 1XSIA 1TJ1A 1IEWA 1R85A 5DBUA 1JR1A 3NIYA 5ABFA 4DWSA 1WBHA 3BSMA 3VC6A 2GGJA 5GPRA 1AJZA 3WLTA 1GOOA 4XZHA 1YIXA 2UY5A 1XIFA 3NQVA 7XIMA 4UMAA 4JTQA 3KEHA 1TE1A 1Q7ZA 1A0EA 1P1XA 1OC6A 4EXAA 4N42A 4LUSA 1TFVA 2WHJA 5FD0A 1X6UA 1NM9A 4O19A 2Q3RA 3DYPA 2L5HA 4M6UA 5TAOA 3VX1A 3MI2A 3A5VA 4FO4A 3IK4A 3FVDA 3S2MA 3NM3A 4QNWA 4J3UA 3W6YA 1QBAA 5A6MA 1MDLA 4LC8A 1X6LA 4UFHA 3TSDA 3QVQA 1RJRA 3F4VA 3NM1A 5HINA 3SBFA 3WUGA 3EEZA 3K5XA 4UTWC 3DXIA 1MZHA 2OWXA 4TX9A 1UBSA 2ZRWA 4HU0A 4WSJA 3RM8A 3UG4A 4WCJA 2BGNE 3E2SA 3TC3A 3C2RA 3EZ4A 1T6MA 4NIRA 1TRIA 3KS6A 3LQLA 1PB0A 1OT2A 3IVUA 4I9TA 2G37A 3TOPA 2EF9A 8RUCA 5FAJA 1EUNA 3BLDA 2DSZA 2OGYA 4FX8A 3AXXA 3BQ6A 3HPZA 3L4YA 4DYEA 3AC0A 1PKMA 1AD1A 4TOQA 2V5LA 1SQ7A 5ABFB 2VGBA 5C70A 3BK0A 5M3WA 1FWBC 4ZCWA 3WZ0E 2E7FA 1OT1A 4IMCA 3VDBA 4H7VA 4ZOEA 5FIPA 1R0MA 1RD5A 1D3CA 2QMJA 4AY8A 1SO5A 2H9AB 2Z1VA 1AUSL 2W66A 1LBLA 1GYNA 2QJHA 2GVYA 4ZODA 1N8WA 1E6RA 5G2IA 2J74A 3UXLA 2C7FA 2VX5A 4K36A 3WQ5A 1ZBCA 5CCZA 1I6NA 4H6RA 1DE6A 4H6QA 1SJDA 2MUCA 5A6SA 3POHA 5DMLA 1U30A 1PDZA 1UKTA 3ERPA 3WNNA 4KIEA 1O94A 3GVWA 1BKHA 4JN7A 1QNPA 4C65A 3E0LA 3IWPA 5I03A 5LIYX 2Y24A 3SUUA 3V4BA 4RCXA 3PG8A 4G7EA 4KEZA 2OSXA 3CEPA 4CCEA 4Y9OA 1CW2A 4WXZA 4FX7A 4F2UA 2R82A 3VNJA 4HPXA 2NV9A 1OK4A 1G69A 4NYUA 1HL2A 3RITA 1J10A 1CXHA 4OU1A 2VFHA 4PCTA 2PCEA 1PCKA 1H4PA 3MUIA 2P1FA 2IQTA 5CC7A 5DCDA 2Q8LA 4IQJA 3PG9A 2XHYA 4JHOA 1XPGA 3OOQA 3ONCA 2YYUA 3G2GA 4OJYA 2DORA 1T8XA 3CHFA 1BRLB 2OZTA 4QR6A 1FKXA 1JPIA 3W2JA 2GDUA 3FGCB 4CQCA 4IPLA 3OG3A 3TAKA 4M82A 3M0ZA 2V5DA 2EKCA 3CHEA 4US6A 2WKLA 2Z6IA 1OX4A 2B0MA 3AMDA 4U3AA 4I7UA 1GEQA 2PDBA 1KNWA 4H9MA 3L65A 3UQNA 3HPXA 4UWMA 3MCNA 1DE5A 4W4QA 3M5ZA 2GFTA 3RLHA 3A13A 1K9TA 1W9PA 1M65A 4ZSUA 2XN1A 5XIAA 1ZENA 3GDBA 2X8RA 1XIGA 4NG3A 1P4CA 1R9ZA 4CCDA 1KCKA 1KV8A 2C91A 1TTQA 1WCGA 3GYCA 4DB7A 1BYDA 3LM7A 3GNPA 3PZTA 3MB9A 5FACA 3VK5A 3LHWA 3WLKX 3BLKA 4U33A 3H8AA 1JZ2A 1QOPA 1V79A 5HJLA 9XIAA 4ROQA 2PWGA 4JHMA 4JQ3A 4KWVA 4AC7C 3MSDA 1OFDA 1IGSA 1GHSA 5FA5A 1POKA 4D6JA 4GGBA 1RP9A 1H1ZA 1QPKA 2NUWA 1TV7A 4B5UA 3GH5A 3ABZA 3WMCA 2RUSA 5HNRA 5LHFA 2D23A 3LTSA 1KTCA 3IGHX 1GW1A 3VOFA 2R94A 4DJFC 3B8DA 1OYBA 1ZY9A 3DENA 1QATA 2Q8XA 4K3ZA 4XD3A 4P8XA 5BMWA 2W5FA 2OQYA 3H53A 2QNEA 3T44A 2RFGA 3VUSA 4AIOA 4QCFA 4BHYA 4HHHA 2PTDA 1PVNA 3EX3A 1CPUA 3NR0A 2YDSA 4C5YA 2QIIA 4US5A 5K9DA 5EMJA 1M68A 2E6DA 1X96A 2GJRA 1AD4A 5A2AA 3C0LA 4O12A 1B3OA 3DN5A 2DT0A 3CYJA 4FSAA 1D7FA 3QW4B 4IGHA 1E56A 1ME7A 4H19A 4L6DA 5LXXA 5CLWA 3W87A 3DG3A 4KFNA 1Z3NA 1R9YA 2PPGA 5DCBA 3HN3A 3VIFA 1V3HA 1L2UA 3H2MA 2CZ5A 2UWFA 5KZDA 3C3UA 3LHTA 3F2BA 3NXFA 2VR2A 2WKGA 2HK0A 2PCQA 2ZX9A 3C56A 1DL3A 3HMJG 3POCA 3BCFA 1VF8A 4WHBA 2HVMA 3VOHA 3RR1A 4KPLA 4IQDA 4AZCB 1EJUC 1ODZA 2FB2A 4Q8MA 4GYFA 3BZGA 4FZIA 3GXDA 2I9EA 5LHEA 3W1AA 5AHNA 4FNUA 4KWOA 2NX9A 4O54A 5DMMA 4Q8PA 3WJZA 2DVTA 3A4JA 3MP3A 2J47A 4MYAA 4YJ5A 5AECA 3MP5A 4ZMGA 2VEFA 2VJXA 3R0DA 3UJFA 4Q4RA 3QLLA 2J8GA 4NZCA 3UG3A 4PUDA 4U10A 3CMFA 3QEZA 4BI6A 3L67A 3QBUA 4ILSA 3B8UA 3WL1A 3EPOA 2R14A 4M24A 4JQ1A 4FNQA 3K4WA 4AEFA 3GQYA 4QG6A 2WPGA 2EBNA 4K8EA 3PAJA 3W76A 1JYVA 3LM3A 3AJ7A 3UXIA 2A3AA 5KEZA 1A5LC 1Q6FA 4E2OA 5DT5A 1ML1A 1W5NA 3CHCA 1MSSA 3WYZA 1S2TA 1A5AA 4CU7A 1NEYA 2ZX7A 3WKZA 1LWHA 3IAQA 1WUFA 3NVTA 3G0SA 2PDKA 4ZQMA 3EX1A 4FAMA 4IF2A 1J01A 3LMZA 5J04A 1ADOA 3B8TA 4J3XA 2A3BA 3FHAA 4AX6A 3G6LA 4H9ZA 2V5JA 4BS0A 3OZMA 1UBPC 3QFWA 1WDPA 2DT2A 4GFIA 4EX4A 1XFCA 3UJ2A 5AY7A 4QDWA 3LZ3A 3NWRA 1D9EA 2EJAA 2DZSA 1M5WA 3F1QA 1PHQA 1P0KA 4AVFA 3FN9A 4V1XA 3MZ2A 8A3HA 1B3VA 3N19B 1IR2A 3SEPA 1DIEA 3LCHA 5HWNA 3DOPA 1TPEA 1Z42A 1YXDA 4LYRA 5CPLA 4L7ZA 3GDRA 5CPQA 2WJEA 4KS0A 2FZ8A 1E3XA 5JU6A 5BXPA 3VKDA 1OX6A 4QROA 2ADAA 4Z0SA 5CZ0A 3ZJ7A 2W0UA 2WV8A 4O1EA 1NDWA 1LUCB 3ZQ9A 4ZE4A 3TJIA 2H3BA 4JTJA 3K8KA 2ODOA 1H0IA 2XU2A 3DAQA 4B2DA 1F3WA 1NDYA 2DZPA 1YMYA 3CUFA 2MNRA 4GXWA 5AVNA 3FXGA 2E8ZA 1D2KA 2O4MA 2YW3A 5AHFA 4UZSA 4LV4A 3NEVA 3W2UA 3SRFA 3DU0A 3BJTA 4QHRA 2IQ0A 1W17A 2DZAA 4HYWA 4K8GA 4ORIA 1WDDA 1LCOA 3FCPA 4H7CA 2V3DA 3U4FA 3GXIA 1T0OA 4ONVA 4WJXA 1TZ9A 1JQVA 3LZ5A 1IIHA 3QTPA 4DJDA 1OD0A 3AIUA 4UFJA 5HOSA 4WJEA 5F2MA 4JHZA 3WDQA 2C3ZA 4RNHA 3FFSA 4JOMA 4R53A 1J0IA 3KRZA 2X1UA 4C6PA 1Q4NX 3CZ8A 4PMOA 4PUJA 5E09A 3LRMA 1K8CA 4KRTA 3CUJA 3CT7A 2CLHA 1KD0A 4J7RA 3NL6A 1NDZA 4M8UA 1PKLA 1YXCA 3LYEA 4J5NA 3LCWA 1W5MA 4US5D 4HSNA 1XV8A 4M6VA 4XD5A 5I07A 5AYYA 1GKPA 1NOWA 1FWFC 4XBKA 1EJTC 4HOWA 3I6EA 1KLYA 3TTQA 1XQKA 4C5ZA 3OO2A 4W8AA 2HMCA 3NQCA 1EC8A 4AH7A 2BHZA 2I56A 4QQ3A 5FL0A 1DJZA 3DCPA 1GQKA 1V03A 2WCGA 3KVLA 2WJZA 4AYSA 2BG5A 1E4LA 4D71A 4EOUA 3W1QA 1VFOA 1B54A 3QZAA 2YKKA 2I17A 4CUCA 3JVAA 3CLMA 4NL1A 4NJJA 3UESA 3FAWA 2XZ7A 4I8YA 2HROA 4MIMA 1FDJA 1H63A 1E70M 3AHTA 4XIAA 1TELA 4JL1A 2WNWA 3G1VA 3C0SA 1JYXA 4HPHA 5H8MA 2E09A 3A9BA 4YIWA 2NSOA 3WSUA 2CWXA 5D2XA 4ZE5A 3LG3A 1BVZA 3WQWA 2VC5A 2O9PA 2BLEA 3HGOA 1GOWA 2WQPA 4M7SA 1YQ2A 1LRNA 4ICCX 5LNVA 2XISA 3CV2A 3TR9A 3BOLA 4HZ6A 4ZO8A 3GC4A 3UNDA 1Q2RA 1UMYA 4XBSA 2V81A 3WEOA 3NQ6A 3SR7A 1ZGDA 1XYMA 3WDIA 2OQHA 4A4AA 3D6NA 1UQYA 4GQQA 1DWHM 3KLKA 3PSWA 3TQPA 3ARSA 3LBOA 3S6OA 3VGGA 1F9CA 2IXVA 3WBYA 1P43A 2A1YA 3H70A 3GTHA 3SCVA 4HGXA 1HG3A 4O57A 4XAFA 2DSKA 1KCZA 3CM4A 2C0AA 2DQXA 4H1ZA 2ISVA 3Q4DA 1VIWA 4MNJA 5KZEA 5BRPA 3LGDA 2IPGA 1FHLA 1AZ1A 4EAYA 4XKYB 4WDUA 4TVCA 1TB3A 3OODA 3GFZA 4DPPA 3MTWA 3WQFA 1H7XA 1L6WA 4ORMA 3VYLA 1DJHA 2PLCA 1FY6A 3OIXA 3UBPC 4OV4A 1HGYA 1VP5A 1TV4A 3T0TA 3MKKA 2BMBA 2ZRUA 3S9YA 4JBRA 3NZQA 4OBTA 2A79A 4LJ3A 3WD4A 2XH2A 3S5YA 2FMOA 2QV4A 5AHEA 1XINA 1ZQ5A 3WCZA 2C13A 1J9YA 2Q09A 3GC5A 1AFSA 4WR3A 1HTIA 1BVNP 1F7BA 2WBGA 3AOFA 4JIQA 3SCNA 2OB3A 2CYGA 1HQTA 2YCLB 3AO0A 4LY4A 3PANA 1YDYA 3MU7A 2NQHA 1C93A 3U48A 4MB4A 1FTXA 3LBCA 5KMYA 4XUYA 3LI0A 1R5YA 1AW5A 5HNTA 3FA4A 3CUZA 4ZFMA 1QHPA 4KCUA 2Y5EA 2PRMA 5K9CA 1OD8A 3GAKA 4IJBA 2IXUA 1MEIA 2GSEA 3E0WA 4W5UA 1WBJA 1US2A 4B9YA 3WX7A 3W73A 3AZTA 3ZS4A 2G4JA 1R7AA 2E6FA 1SJCA 1P1MA 5FKYA 4POCA 3EWWA 3QPEA 4JTHA 3SIMA 4I5UA 1W37A 4F48A 1TUFA 4E4UA 2DUXA 3O0FA 4S38A 3WEZA 3A4XA 3MJMA 1UR9A 1VYPX 3LA4A 4WXYA 2Q71A 1YADA 8TIMA 2PUZA 3GG7A 3PWGA 4IICA 3BCDA 5EB8A 3DFSA 4LUYA 5DXXA 3MUAA 3LXAA 4PCPA 2WW5A 3H2OA 2W3ZA 4K2SA 4M1RA 5HNUA 2Z2BA 4H41A 2XGZA 3NQ2A 2NQ5A 1O4UA 5IM51 1J5SA 4J9JA 4LNYA 3EWYA 4IMEA 4DBUA 4LXFA 5CZSA 4MWAB 1K6AA 3HQOA 1CECA 4AWUA 4XG1A 3NSNA 2KAUC 3GD6A 4DO5A 5M17A 1AZ2A 3J7HA 4AFYA 1O5QA 5GJNA 4MYXA 3QV9A 4YXGA 2P76A 4L1WA 2XIQA 3MMTA 3W3OA 5I3GA 3V0UA 3V0TA 2Z1SA 1ZBVA 1WZKA 4RV8A 1KKOA 1M7JA 4ZO6A 3N18A 4I9MA 3SSJA 2WMHA 2WLZA 3QM3A 5DCEA 4DZHA 2AQWA 2D2GA 3PTKA 1VHNA 4PBEA 2C6QA 2WC7A 3NOEA 2OWCA 4H00A 4U4MA 3BC9A 2P88A 2CKSA 1RLCL 3FEQA 4M80A 2XJ7A 2X7VA 3TAOA 1IEVA 3OHMB 4UTLA 4MY1A 4YCPA 3CZKA 3GFYA 3R0KA 4CD8A 4GYJA 4ML9A 4GNKB 3WJXA 3EKLA 3W7JA 4O16A 4RZ6A 1CB2A 3FS2A 1J4EA 1U1JA 4NSBA 1UR2A 4V1YA 1H1NA 4DWSD 5T9BG 1WO2A 3OW1A 3MJYA 3WJSA 1KFCA 3HO8A 3CASA 4K39A 3CH9A 3OYZA 1TMHA 1ICQA 5I24A 4GK8A 4I9JA 1US0A 4UC5A 2ZZ6A 4F0SA 1UD5A 1A3XA 1LRQA 3H24A 3T42A 2GOUA 4DN1A 7ODCA 3M0KA 4QLKA 3AUJA 4NZJA 1E1EA 2E1WA 4FXRA 5CJNA 1F3TA 3LS9A 3W7KA 1ZAJA 5AZ1A 3VXGA 5TF0A 4GINA 3RRAA 4O53A 3V0SA 3N2OA 2VGFA 4HU3A 3NQGA 4AU0A 2O9OA 5AYXA 2ZE3A 4PMYA 2CLOA 1IV8A 2NXHA 2FIQA 2G3FA 1HKIA 1PZ2A 4PB3A 1V6WA 3TYEA 3OG2A 1LORA 1UWUA 2DY3A 4AISA 5FJJA 3L2LA 3UWQA 3PZ9A 1KR0A 3T8QA 4XAYA 3S5OA 4GFSA 1BSIA 1N8IA 3TIMA 2X2YA 3SGUA 3T7VA 1KM6A 3VGDA 4Q8VA 1XLAA 1ZRQA 3MUXA 1E0VA 3K2GA 3GC2A 4QSFA 5BW6A 1DXFA 1VC4A 3L4VA 2O92A 3WQOA 4C6LA 3T1GA 5KTLA 4FMVA 3FJ4A 1F2JA 4NI8A 3C2FA 3UCDA 3SCUA 4QNEA 4FP1A 1SO3A 2C18A 3S1WA 2V2DA 3TCSA 1X1NA 3UEQA 3RPMA 4S3DA 3WBEA 5D09A 3HV8A 3ZWSA 2W91A 1TWWA 2GJXB 4F0MA 1JYWA 4PGLA 1GJWA 4PTNA 4EKJA 1X97A 1C9DA 4WY0A 4E2VA 3CHDA 1L6FA 3AISA 3QKEA 1U2YA 2V3FA 1FWDC 4HIBA 3VD9A 3BDKA 4EANA 4W5ZA 2Y63A 1PE1A 1ZL1A 2FPVA 2H3DA 3MYOA 3NJ3A 4FNSA 4LV9A 1E4IA 1HGWA 3JW7A 1NWSA 4BJHA 1XDLA 3OTRA 2RH9A 5E0KA 3W9ZA 2F7FA 1EL3A 1UQZA 1TVLA 3WQ6A 3PPGA 4YYFA 1ZHAA 4ZOAA 4ATDA 1PZ0A 1ICPA 4B5TA 5AC6A 1H7RA 4O4WA 1JGIA 2VEIA 3SAZA 4HVXA 2WJFA 3AS1A 1EPVA 4MFEA 3E2RA 3WK2A 3BQ5A 2HBVA 4YN5A 4MZ8A 3VZZA 3EX4A 4L4OA 1CNVA 2WSKA 3LUTA 1L0PA 8XIAA 2XIBA 7REQA 3NZ1A 2DDXA 4HTYA 3WG6A 4CD4A 3VTRA 1Z69A 4H6KA 2XYLA 4FIRA 1KBJA 1HFBA 5JVLA 3EXTA 4P2VA 3AROA 5MF5A 3UZ5A 2FH6A 2INFA 3M43A 2ZBTA 5GNYA 3QGAC 2PWHA 3M0JA 2CETA 1JNDA 3DIPA 1IEXA 4U28A 3GNOA 5EKYA 1RVGA 4HBKA 1GVYA 3UZJA 1XS2A 2WANA 1H7PA 3GKAA 1LWJA 2PURA 1GORA 3EOEA 1CEOA 2P50A 2Y2WA 1E4MM 3H2FA 1CTNA 1W1YA 1ADSA 4DYJA 3SADA 3P8JA 4LC6A 3SGGA 3B40A 5I78A 1G5AA 1XLEA 2BP1A 4Z1BA 3UWWA 3W1RA 4ZOBA 1WZMA 4JX6A 3SCSA 5JH1A 4IX2A 2WYSA 3VNYA 2YDQA 1QNVA 2IKGA 4MAVA 3SUWA 4GQBA 3AZSA 1V5XA 2VI0A 4LF1A 2GGIA 2J66A 1G0CA 3PJXA 3WQDA 1XLCA 2WMJA 5J5DA 3R6IA 1JUKA 2VDGA 3SIZA 3VKKA 3T6CA 1EZ2A 4FXFA 3OGSA 4XVEA 4NT0A 5AC4A 3DHFA 4OUIA 4PMQA 2J7GA 4GC3A 2CIPA 4K1WA 3IAPA 3EGJA 3UVAA 3PBYA 3B4YA 3N2BA 2A7NA 2OT1A 4N7QA 1DWGM 1W8SA 3VZXA 1X8CA 3MVTA 3H7UA 1EUAA 4QITA 1XWYA 4G6CA 3W88A 3P8IA 5MKGB 1POJA 2OLHA 1AMYA 3B9DA 1NOUA 3R89A 4NAEA 4PMDA 1FH9A 4A2SA 2PU1A 3OYXA 1J2WA 4Q6XA 3MCMA 1WX0A 5HMEA 5HXMA 4JDYA 4AD0A 2PDQA 3QMRA 3OZYA 3ZZ1A 2WM0A 2B7OA 4AEOA 1H61A 3PZQA 1Z41A 2V6AA 2PGRA 4H2HA 1DXIA 1OY0A 2RJHA 5HPCA 4MWAC 3G1DA 3PVFA 3GYEA 4JIRA 4K68A 3QV7A 3PP7A 1XGDA 2RKXA 2VX7A 4MJMA 3UVIA 1OQFA 2VYOA 2F84A 3NPXA 4WIWA 4GLEA 3PUDA 2DW6A 2YCKX 4B3KA 4FNTA 2BOGX 1MXSA 4IXHA 1XRSA 3HIJA 1UWRA 4R9OA 4GYPA 3LSCA 3DKJA 5ECUA 3LHVA 1TTJA 4UTUA 1YTDA 1W91A 5KSWA 1TJ0A 4XKYA 2AAAA 2BOFX 5A1AA 1KBLA 2G5WA 5IFPA 3N1AA 1K02A 2J88A 4NJHA 2WVVA 3PJUA 1WXJA 1FWHC 3I4EA 4P7RA 1IEQA 4LUJA 2AGTA 5DRIA 3W7DA 4QBXA 1SFJA 4O1BA 3GR8A 3R43A 4GQRA 4JTAA 3EOOA 4HMNA 2DJXA 1JDAA 4UMBA 2XVNA 5D2VA 3TQVA 2EQDA 2GVGA 3B0XA 2LLEA 5CC3A 2REQB 1BEUA 1TRDA 2HDJA 3VDHA 3WLHA 1B90A 3UWUA 4B91A 3BICA 2FHCA 2XGBA 1BXBA 2DZTA 3HPAA 1BYCA 1HUVA 1V3JA 1JI2A 1NU5A 4FOUA 4NZ5A 4XSLA 5FEZA 3CAKA 4DXKA 1V51A 3K1DA 1YXYA 3TQKA 1QPRA 1KGWA 3RRXA 4GIAA 1M7PA 3H4XA 4GUIA 5B7ZA 1XIDA 5A94A 1L8PA 3KWXA 3UGVA 3A24A 4LVFA 1FCBA 3W1UA 1KRAC 2QEZA 1TO3A 1XH1A 2XTKA 4X0NA 3SN4A 3UXKA 2QQ6A 1HO1A 4AMAA 2WAGA 4S3JA 5LIUX 4UXDA 2PDHA 3ARVA 1ONXA 4QFUA 2ESCA 1OJXA 1VD6A 3OLEA 4CD7A 1BSLA 3PTMA 3WQEA 5CGQA 3WFAA 4Q7IA 3WDRA 1F8IA 2JE8A 3UY7A 3DX5A 4EPBC 1KXHA 1W9BM 1ISWA 1JGMA 1TV5A 1ICSA 3LNPA 4EPEC 3M0IA 5G4WA 4Z2IA 3VGFA 4MNKA 3QQ1A 3APGA 1OADA 2QS8A 1ZTVA 3DEQA 2GWGA 1VZWA 4CU8A 2PGFA 5LKYA 3W71A 2E9BA 4QJ1A 2JKEA 3UF9A 4IP5A 1VCVA 2PWUA 2XVPA 4CNNA 3ZT5A 1TPUA 2PDNA 1PV8A 3BARA 4JD4A 1SSGA 4B5XA 6CGTA 4M7TA 1JEZA 3IIOA 2YW4A 3VOGA 1WA3A 2WB5A 4Q8QA 3G24A 2PDJA 2PDIA 4FIQA 4P8UA 4DJFD 3VNKA 3ES7A 3KOYA 4GOAA 1EGMA 1MVYA 2QHAA 1Q5MA 3FJLA 3O1NA 4L9XA 1PWMA 3VD4A 4AZBA 3PJTA 5EGRA 1ECEA 4GO9A 1W56A 1Y7VA 1JCNA 2VL4A 3TDFA 4HNLA 1ITCA 3CWNA 1EF2A 1AH4A 1RUSA 1YNYA 3KZPA 1ONEA 4MWAE 1KFKA 2CC0A 5CPOA 3V18A 2J27A 3F5KA 1US3A 1MFVA 3WEMA 4LAZA 3O3RA 3IIZA 3NO1A 3GNRA 1LQ2A 5E0CA 4A8LA 1KRCC 3NG3A 2J7BA 5CJ5A 1B1YA 3TSMA 4C6DA 4NAEB 3WD2A 1K9DA 1I1WA 2F2HA 3G1RA 4KGJA 2ZZ7A 3PTQA 4HA3A 3NQFA 1M41A 3U5UA 2ZRXA 1M6JA 3G1XA 1SZNA 4OOUA 2DT3A 3S2NA 3TKFA 1GOXA 5REQB 1XGEA 3NL5A 3R8GA 1QT1A 1JRBA 3MMDA 4O0KA 2J78A 1QBBA 2FJKA 1EWEA 2AGKA 4HNUA 4UTIA 1O1ZA 2WNZA 3LN3A 4ZL1A 1VEOA 3AIWA 3EKGA 2XVGA 1DWAM 4DBSA 3MV01 1PTGA 2B81A 1BGGA 1IYXA 4NASA 4ASTA 1WOAA 1QUMA 2PF0A 1C8QA 2V9DA 1LDCA 2E9LA 4H4IA 3TNBA 4O10A 1GPWA 4MHBA 2P8BA 3SI9A 3SRHA 2ZKMX 1CLKA 4GJ1A 1UC5A 3VPLA 1E6XM 4O1DA 2E68A 3AXIA 3BO9A 2EKGA 1J79A 1XF0A 2QCFA 3D3FA 3ARWA 2O7SA 4JIPA 3P84A 3RU8X 2EG8A 4TUFA 3BJFA 4L56A 2ALDA 1FDYA 4AHQA 3PUGA 3EBVA 1E1FA 1MW2A 4HK7A 2NWRA 1VH7A 3A23A 3IGSA 2WWCA 1H49A 4A29A 2QMKA 4IFRA 5A69A 1S5MA 1GQJA 2Z26A 4H6EA 3K46A 3TEVA 3B9AA 4M81A 3NL2A 1UWQA 4NVTA 3KP0A 4GYPC 3NQEA 2XWDA 3R7MA 2A3HA 3BOXA 4WKAA 2WM1A 5I0DA 2WMGA 4YVXA 2A0NA 2ACSA 3EMZA 2WZIA 4DYKA 2FLIA 4IGSA 3WBXA 4W7UA 4ZA0A 2DVXA 3FAXA 1FQ0A 3MKCA 4UR8A 5HATA 5T26A 1N7KA 2GQ3A 1L2QA 4DWSC 4HNOA 2Q6ZA 5D37A 3TONA 5E70A 1UIOA 3WNMA 3STCA 4X9SA 5CG7A 3QXBA 2RDUA 2NUXA 1J96A 4PFHA 1KRMA 3VFLA 4A21A 3PC0A 1SMAA 2CLIA 2WO5A 3GW3A 1A0CA 2HPIA 1QAPA 3ABRA 4TVDA 4I90A 3KWSA 4UCGA 4CQ9A 3FNDA 5FESA 4FPSA 3WUBA 4ADTA 4M0XA 3UW6A 1QJWA 4FLSA 3EWDA 3WQCA 3LPOA 2IS7A 1YLVA 4TXEA 5JMUA 4Q3MA 4C60A 5ECVA 5FEWA 1G94A 3BE7A 3NPWA 1TVPA 3ZR4A 3P3BA 5IBXA 1DJWA 3SURA 1HJVA 2RJGA 5CC5A 2VC9A 9RUBA 4DNHA 5E9XA 1OABA 3WUEA 3VFCA 4HOZA 4C6IA 5BWAA 2XFWA 3PY2A 1Q65A 2C1IA 3KBVA 4EPKA 3OGVA 5I23A 2IPFA 1KRBC 5A6AA 2GJLA 2VZVA 1X1OA 3QC0A 2GGHA 3LCLA 3V5FA 1UOKA 3DFQA 5CJMA 1B30A 2XUCA 1BWLA 1YKWA 1Z8AA 4GBUA 3VD5A 2OEMA 3CYVA 2BY1A 2EXOA 3CS2A 5I09A 1XLIA 1R3RA 2F38A 2R6OA 4HJFA 3C52A 3LY0A 1CGVA 4YHEA 2INEA 1S2WA 3UA4A 3AIQA 4RXGA 5HBFA 4J4KA 3OPSA 3TVAA 3ZYZA 3ENLA 2OG9A 5AHMA 5CAHA 3MY9A 3M5VA 1ZPTA 4HNNA 1VLWA 4FB7A 5CGMA 2ACRA 4GA8A 1GW9A 4Q8WA 2JIWA 3WH7A 2CHOA 4ERIA 2ONEA 3B04A 4EIVA 1XLHA 4MB3A 2VFGA 4N0RA 1H11A 2G3IA 2VCBA 3CIVA 3ITTA 3NFUA 5BU6A 1Q8AA 2PC8A 3G22A 1A5SA 3N2TA 1JF5A 1XYFA 2RGLA 3QQWA 4ZFCA 3NPUA 1E5NA 2V67A 2IMRA 3PUEA 4R7OA 5CLTA 3HQNA 4Z1YA 3BV4A 2XFYA 3ARQA 4F0LA 3R8RA 2P0IA 3L2MA 4C7FA 1KXVA 2JQXA 3MYPA 2AOSA 1O5RA 4JKMA 4IQLA 3MSYA 4QDPA 2D20A 4FNPA 1UWIA 2CLPA 1JULA 4FF7A 2VWSA 4GVFA 1DPMA 2HXUA 3S4TA 4NUWA 2OO0A 2NQZA 1T96A 3CUXA 3LCGA 3STEA 3KVKA 1DEDA 1WZAA 3R5EA 3ZLGA 3NYDA 1MQPA 2XH7A 3QGVA 1K7XA 3BAYA 4ENLA 1TWSA 3K8MA 3C5QA 4C1NA 3GAYA 1MWOA 4TTUA 3E96A 3EDEA 3TC7A 3CAWA 1RK6A 4C1NB 3WH5A 1A5OC 4Q4PA 3R12A 3TW9A 2VNCA 4LCQA 2EPHA 3SO7A 2BS9A 3GHRA 4EVZA 2E40A 2J4GA 5EY5A 1PX8A 3MT1A 1R30A 4MUZA 4IT1A 1ZAHA 1NWUA 3KDOA 2ICSA 5HDRA 5BNKA 1PIGA 4RK8A 2PP0A 3E6EA 3P82A 3WMBA 1XD0A 3NXLA 2QR6A 3G1FA 2QDEA 1UZ4A 3AWNA 2UZ9A 3SJ3A 2YFOA 3QLDA 4AG0A 3BGAA 3THDA 3LLFA 2BY3A 5I3HA 1V93A 3BWWA 2GUYA 2PB1A 4Q4MA 3ABSA 2J9ZA 3MANA 1UKSA 4B4HA 3W74A 4GQ0A 5HQLA 5D4YA 1OIMA 4GCAA 3WD0A 2XH4A 4YVVA 3GU2A 3GIQA 3GVVA 4YPJA 3EDDA 3GZ3A 4IFKA 5I79A 1DKWA 1B9BA 6REQB 3T40A 4IIHA 2G41A 5BOOA 3N4AA 2V30A 1HKJA 1E55A 1KXTA 4D8AA 3I3BA 4UFMA 3F2DA 1W5PA 1XJBA 1XIJA 2PTYA 3TW6A 3DH7A 3N6JA 2GK1A 3W2NA 2PP3A 3M5YA 4P8WA 3LPPA 2B31A 4KBXA 1F3XA 5BYWA 4FEZA 3L0KA 1YX1A 3KX6A 3S9ZA 2E9MA 4HT3A 3PZNA 2EPOA 3QSTA 3DECA 5E6YA 4LAMA 3U2EA 4DZ5A 2CLLA 5HMSA 4AXKA 4O50A 2A6NA 1UR3M 1EIBA 5FCZA 3S5NA 4C6JA 2RDXA 2C79A 3H12A 3VD3A 4MGGA 1XLMA 1FWIC 1I75A 4A35A 1Q6LA 3IUHA 3ITGA 1RAKA 5I3IA 2OELA 3INPA 3VNIA 1VPYA 1QMLA 1UZHA 2ATMA 1Q7MA 3NQAA 4JIHA 1E6SM 3EPMA 3W7LA 3IS4A 5HQMA 5AZ0A 1UHVA 2JALA 3DYOA 4CN4A 1OCJA 3MBDA 4E4FA 1VQTA 4HCDA 4GIEA 4AZIA 4MTVA 4LVAA 4AZ6A 1YE6A 3ZOAA 1CGXA 1CGYA 2GWNA 1E5JA 2WKJA 3MKVA 5LNWA 1A5UA 4DLFA 4NXSA 3U5YA 3DDMA 1TZ7A 2ZXQA 1EZWA 1G01A 2ATSA 3A6OA 4X2PA 3S1UA 1LL4A 4GO8A 4BY3A 3KRUA 4PRWA 4KWWA 1LOSA 5A5WA 3EWCA 2DW7A 3VIHA 1Z7AA 1UUQA 2V68A 4JFUA 3SDOA 5JUVA 3O9NA 1PYFA 1GT8A 5FI8A 3DG6A 2XVKA 2RDTA 1E6QM 1PIFA 1XLFA 4I6VA 2ZA3A 3QN3A 1P7TA 2QJJA 4AWTA 2AL2B 2Y85A 3T4CA 1EBGA 1XBVA 2D24A 3KL3A 4E0CA 1TVNA 3HB9A 4C90A 3P6LA 2QUVA 2ZX8A 3P14A 1V02A 1ZS2A 4UCFA 4ZR8A 3HJZA 1CWYA 4R85A 2YCIX 3HA1A 3NGFA 4M29A 3L4UA 1LL7A 1V0NA 4RPQA 1N82A 2GDQA 4H8UA 3TV8A 1LWIA 3GIPA 4L61A 2ZZ2A 2OQLA 1W1VA 3LD5A 3T8LA 4L4PA 3I3EA 2WC3A 4JTIA 2YJQA 4R7WA 1EQCA 3UXDA 2WMKA 5LA1A 4IMAA 1VRXA 4BKNA 3M16A 1XLLA 2ZYFA 2GGEA 1F6KA 3QTGA 5DY2A 1J11A 4XK2A 1TMQA 1LG1A 4DI8A 3UD6A 2PP1A 1LLZA 2YL8A 3KP1A 3L5MA 3QF0A 2CKRA 1VFHA 1SFTA 1R3SA 1Q6DA 5RUBA 1IF2A 2CLKA 1JPDX 3FOKA 4OWGA 2GQ9A 3A3HA 3MWAA 3CQ0A 3BG5A 5T8GA 1QI0A 3K4DA 4JS3A 3ZMRA 3R79A 2BGSA 2I16A 1IHIA 3MI3A 4IFOA 4O4VA 3GZAA 3ZXWA 3CNYA 5E93A 1XYLA 2J13A 4MDOA 2DUZA 4UMCA 1B4KA 1QK2A 4HMDA 2A2IA 2NVAA 4NY2A 3I4KA 3GXTA 1UUOA 3AYSA 3U8GA 2ABBA 1OG0A 5A2CA 5IXEA 3LDVA 1GJUA 2C1GA 3PTDA 3RF9A 1MW0A 3QZ6A 1JYNA 1O5XA 3A22A 3W1TA 4P7NA 5D33A 1JCLA 4ADUA 2CBJA 4C1LA 5REQA 2A4AA 3ZLHA 3ES8A 3W01A 3PN8A 4PBGA 3TA9A 2WQDA 1FWGC 3RFAA 1EDTA 3WLMA 1XW8A 4L5ZA 1D8CA 4S3KA 1HIZA 2Z4GA 3UG8A 2V3GA 5CG0A 2ZX5A 1IXOA 2OSYA 4D1IA 1FOBA 3MI6A 3APTA 3NPVA 3S46A 2QUUA 3JS3A 1XYAA 1PCWA 2UV8G 1QW9A 1AMKA 3BJSA 1GZJA 1FWSA 1GKQA 4PSPA 4Q4OA 4LY8A 4XZ9A 5JBFA 3N3TA 1B2YA 4JGDA 2UY2A 3ARRA 5G1YA 3RHGA 1I2OA 2ISWA 2PLMA 3EPNA 3SY8A 4GI8A 1EO5A 1O1HA 3M0LA 4LQ1A 4AC1X 4M19A 4W86A 4XX6A 2NVCA 2WBKA 3OA3A 2VVNA 1ISZA 1L6GA 1TIWA 4MG4A 4DJDD 2QPSA 1S38A 5I3JA 4O1CA 4CNOA 3B0UX 3BAWA 2ZA1A 4GI4A 3CMJA 3D46A 3EX6A 3W7IA 3IV8A 1OFOA 2HWGA 3P81A 4J28A 4ECLA 2Y7FA 4Y7EA 4PB5A 4MY8A 3PFRA 1ME9A 2FGBA 1KB3A 1YBQA 3RUBL 3AUOA 2X05A 3W1XA 3MSGA 3O2LA 4X61A 4ZBCA 4RE3A 5DRCA 3W75A 1RQHA 3U4AA 2ISFA 3L21A 2G3JA 2PD5A 2BTMA 4JPGA 1UJQA 3VZYA 3ZJKA 4A8IA 3OBAA 3Q94A 3WLIA 5AFDA 5I7GA 3W86A 1OHLA 4IGMA 3WO8A 1CX9A 4UTFA 3CV6A 5C54A 1QHOA 4GXPA 4UFKA 4MY9A 1XUUA 2I57A 1V02E 4MUPA 3TCEA 4EXQA 3W38A 1XX1A 1K3UA 4HYRA 3KCJA 2PWEA 4LOCA 1JCJA 4GG9A 4HPJA 3W26A 4MJ4A 2O9TA 5C0QA 9XIMA 2VZOA 4IL0A 5HPOA 4DF2A 3HFTA 3CJPA 3URAA 1SZRA 3SUSA 3M41A 4RLIA 2YDAA 2VEKA 3GK0A 3UWYA 3GR7A 2PLJA 4XKMA 3QV8A 1PBGA 1IIGA 4W9TA 2WMFA 4Z17A 2F2KA 3QQ0A 1AG1O 1BQGA 4NJIA 3O6YX 1E51A 1E9IA 1XBZA 4N9DA 3VKCA 3S2JA 4UR9A 1EQPA 1XYCA 3DFOA 4O0QA 4KESA 3BVJA 5B80A 3GNNA 1YPXA 3RX2A 4HHPA 3N73A 1K6WA 3MUZ1 4ZXLA 4JTGA 4PCNA 3P5YA 1VLIA 2F6XA 1W3LA 3MQTA 5BOEA 1GYMA 3EYPA 1XBYA 2DQWA 4B15A 1E15A 4O11A 4UZUA 3JU2A 1H7OA 1C29A 1EX1A 4D72A 4XSMA 5D2TA 2OZ0A 2QAPA 4JTLA 4D9PA 3CO4A 4ZEPA 1AODA 4LWWA 3SZ8A 3VIKA 3TWAA 3AYRA 1C7TA 4LTSA 2O0TA 1QW7A 5H8PA 2RAGA 1G4TA 2YCJA 1R38A 2ALRA 1KQZA 4L4LA 1MXGA 1JD9A 5BRQA 2GPTA 3WD3A 4EWJA 4DAFA 3LSBA 4GJJA 4U5KA 3U57A 1HJSA 3NAVA 2FJUB 1NFGA 4Y2WA 4JFVA 4DF1A 4NF7A 4B3ZA 1W8GA 2FPTA 4WY0B 1XH0A 4QCEA 3QW3A 4GC4A 1G4EA 3UERA 1TPDA 4QE4A 4G1KA 4ZQNA 4G2DA 1QNQA 4JNZA 3S3GA 2QJMA 2R1MA 1WPCA 1KC7A 2SFPA 1UD8A 3CK5A 3FA3A 4X3ZA 2ON3A 1VJIA 1FP8A 2J25A 1XD1A 3AWOA 3S1VA 3T08A 1JDCA 5LZLA 4WDWA 2J24A 1QFEA 3AQUA 4GUJA 2HS8A 1W5OA 4E8GA 4Z2GA 3R94A 1A5MC 4H83A 4O17A 3RK8A 3UYCA 3AS2A 1GWJA 4CNTA 5LNUA 1WXZA 4Q8NA 4YYCA 1S5NA 4LS0A 3PB2A 1B5TA 4KF1A 5ABTA 1ZALA 4NNBA 5D04C 1H60A 4GVIA 3WIJA 1C92A 1LOLA 4M51A 2YBTA 5D8WA 3BW2A 3WNPA 2WWDA 3EOLA 1A3HA 1JCXA 4C6KA 4WLCA 1I60A 1QI2A 1DVJA 1SSDA 1XYBA 1BYBA 2ZVIA 2OO6A 5I06A 4N9EA 2WZHA 3URBA 2EPNA 1VEPA 2YB4A 2OZ3A 4H8NA 4FK9A 3KCOA 3O8AA 3GXMA 4GY7A 3TTSA 5A8GA 2AMGA 1HJUA 1M03A 1SMDA 2ZICA 4EPDC 5MHBA 4JNMA 3LLDA 3M6DA 3HG3A 4O28A 5A6BD 2BHYA 3W37A 4D1JA 2OJPA 1QI5A 3MSRA 2YZ5A 4IPIA 1SVDA 3CUIA 1A50A 1C9WA 1RBAA 5G1TA 4IM4A 2FTPA 3W7HA 2REQA 1CXKA 3E02A 4HPGA 3F03K 3AIRA 4L9ZA 4GZJA 2W6RA 4AF0A 1I8JA 3EWUA 1KA9F 8XIMA 1S2AA 1CB7B 2VXNA 1NH6A 3AALA 1R2TA 4AD2A 9CGTA 4AHOA 2QPXA 4LYPA 4DJEA 3THUA 3PPCA 3LMYA 3CUHA 3RIKA 2E77A 3WL0A 2IUZA 3G1AA 3HF3A 1NFBA 4MADA 2Y89A 1VFLA 4AZHA 2XIJA 1S2CA 5C9XA 2GJNA 2G97A 1S3HA 2PWVA 3G3MA 4YTTA 4BQ3A 3UJEA 2JKAA 1LLOA 3EWBX 3IVSA 4QTGA 3KM8A 1JPKA 4LUTB 3R2GA 1V3IA 3V75A 4JTCA 2GL5A 3W2MA 4TX8A 1RY8A 2FVKA 4ES4A 4W8LA 3UY8A 3P7YA 1D3HA 4BF9A 5C2XA 5CBJA 1M3UA 4LALA 1N55A 4OGZA 1OCBA 4X60A 1RK5A 2PDPA 2PBOA 3M9YA 4RZ5A 3SN0A 4WY0F 1KM2A 4Y9NA 2GSHA 4OKDA 1V77A 4XWUA 2X16A 3FA5A 1FWCC 4QG9A 5LSMA 3TQ0A 4W8BA 3KRSA 3VU2A 4IQEA 2BODX 2HE5A 1OZQA 4AZCA 4M5PA 4S3EA 1FCUA 1ZZMA 5HNNA 3I6TA 2OX1A 4EF9A 3KLLA 1XPYA 1HN1A 4F2TA 3EOUA 4GRSA 3EA1A 3IACA 3PWIA 1C8VA 3RG6A 1J93A 1LT8A 2Z24A 2PS2A 1GQNA 1QASA 1T41A 5HUPA 1X7FA 4MB1A 3TLQA 1IQ8A 3O6AA 2Y7DA 4Y96A 4XZWA 1S1RA 2E6YA 1DQUA 1UMLA 1TPC1 4LEQA 1K9FA 2WCSA 3LOTA 4GY0A 1L6SA 4JX5A 2IKHA 1EOMA 3AZRA 5JH2A 5CSUA 5I5RA 2TODA 3OZPA 1AW2A 2YL5A 3MHFA 2A85A 3UFYA 1S2VA 3R58A