3GNDA

Crystal structure of e. coli lsrf in complex with ribulose-5-phosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
280
structure length
276
Chain Sequence
GKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVVRDQRYFSLATRIAAEMGAQIIKTYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldolase lsrF
publication title The crystal structure of the Escherichia coli autoinducer-2 processing protein LsrF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 91
structure length 276
sequence length 280
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gndA00
1IXQA 2NZLA 4AF0A 2CU0A 2YGYA 5F4WA 1SR9A 2H8ZA 2E5BA 4HKPA 3W75A 2PC4A 1HG3A 2B7QA 1KM6A 3OA3A 1UCWA 4OE7A 1OYBA 3QJAA 2ZZ4A 4ADTA 2J9ZA 4E0CA 4UMCA 1LTDA 3BG3A 3W1PA 4FB7A 1V7YA 1F6KA 5AN7A 3OG3A 4NU7A 3LOTA 1ICPA 2CLOA 2E6DA 2Y70A 4WD0A 5I3KA 4LY8A 3EWUA 4UTLA 3UY7A 3HG2A 3LV5A 2DZUA 2NXIA 2ZZ6A 1ZY9A 2CLEA 3USBA 4Q4KA 3YPIA 2R91A 2QCEA 2JKPA 4ZQNA 3K30A 3W1RA 2AGKA 3RLVA 2E5DA 4FHAA 3ZR4A 1YPIA 2A7RA 1TCDA 4E2DA 2Q8ZA 1EWEA 4LNYA 1K8YA 2A6LA 2O7QA 2WJZA 1O5KA 1EPXA 2QJGA 2QKFA 4BFAA 1W56A 4UTKA 4XTIA 4DELA 3FYOA 4A29A 5DELA 1WOBA 3S42A 3S9YA 4JX5A 1DJQA 3W2JA 3CEUA 5K9XA 1FWRA 2QUUA 2BSLA 5F4XA 3TV8A 4CNNA 4RXFA 5LNRA 3PBYA 3P81A 3UZJA 1HL2A 3PVFA 3G1SA 5LNWA 2Y7FA 3LTSA 2YCEA 1YTEA 4ZQCA 1MEHA 1QDSA 1I8JA 4CLMA 4E38A 4MYXA 3CM4A 3A5FA 4DO6A 4UFMA 1Z48A 1IXPA 4ALDA 4JIQA 3QF0A 3T44A 1J2WA 2QDHA 4FXRA 5DN1A 3QQ1A 5AHFA 1FWTA 3LHVA 1TPDA 1TPVA 3W84A 3RLUA 3NAVA 1LYXA 2W0UA 2CLMA 1OFRA 1GEQA 4IGHA 4ZQMA 3NL3A 1I2QA 4K7VA 2WSQA 1X6UA 4P61A 4KFNA 1K7FA 3OVPA 3MHUA 1AG1O 1F76A 1W8SA 3HGOA 4YLWA 4XBKA 1ICSA 2RH9A 5L6UA 5HWNA 4N6EA 3M5ZA 3BLEA 3F03K 2E5CA 1QO5A 3C0JA 4MKNA 1B57A 1EA0A 2B4GA 1I2RA 1ZAJA 4HSOA 3IGSA 4DO5A 4NVTA 4B5NA 3GNDA 4IPIA 4TX9A 4UTIA 5D03A 4ORMA 4R7JA 5K9DA 3A23A 1GTHA 3VI2A 3QW3A 4DBDA 2C13A 1SZEA 3TSDA 1EP3A 2FIQA 1FCUA 3CU2A 1TQXA 5G1YA 5F1UA 5AHEA 4GXMA 3LI0A 2A7PA 3ATYA 3FYPA 1H60A 1SQ7A 3NL2A 1R2SA 4JX6A 4Z0JA 4MVAA 3HQ1A 5FF0A 4PCFA 1WXJA 4QM1A 5TBOA 5D2YA 2JBMA 2TSYA 3ATZA 1KBIA 3TW6A 1J4EA 1L9WA 3EX4A 3LLFA 3TSMA 1OX4B 3W76A 3W85A 3HMJG 1ME7A 1W5QA 2BTMA 1A53A 1R2RA 1QOPA 3NZ1A 3CIWA 2V2HA 3TE9A 3PSWA 2BLEA 2ZCGA 2E77A 3R12A 4RZ6A 3PR2A 4BI5A 4WY0F 4N2YA 1I45A 4CQAA 5D04C 2FFCA 3M6YA 3S1UA 5I3FA 4N4QA 3Q94A 5EPDA 4Z0SA 4AWSA 5KITA 1GYNA 2CLFA 3T4CA 1VH7A 3EKLA 4AAJA 3G0XA 4EIVA 3OBKA 4ZQPA 1KM0A 1SSGA 1R2TA 3ABQA 1KA9F 4HNVA 5K9CA 1Z44A 3FA5A 4P2VA 4LU0A 1B9BA 3PF3A 2V2DA 4W9TA 4UTWC 3B06A 4AXKA 1NEYA 1RR2A 3N2XA 5F1VA 1ZCOA 3A24A 1N8FA 3DHDA 4AWTA 1QO2A 2V5LA 1F6PA 2ALDA 4JYDA 3QH2A 1GVRA 4AVFA 2YYTA 2P10A 3MHGA 2P0OA 4EWND 1W5PA 2VKZG 3NQVA 1RV8A 1K7EA 3TR2A 4UUIA 2NX3A 4NX5A 4Y6GA 3TNOA 3R5EA 4UTUA 3LCGA 3I7SA 1BWKA 2Q3RA 2OMAA 1P1XA 1S3HA 3TX9A 4QQ3A 3KXQA 1TPB1 4ZVJA 3BLFA 3NQ7A 3P61A 2BWGA 1NVMA 1SUXA 4DEFA 5AHLA 4O15A 5HULA 5E1QA 2CLIA 1SO3A 2CZDA 4RCXA 2C1HA 4GUHA 3BG5A 3M5YA 4FX7A 1LOQA 3WJXA 1U83A 2X1SA 3IGUA 4KWVA 4JTFA 4KWWA 4O50A 3W71A 3HPSA 2PRLA 4G1KA 5IBXC 4MFEA 2DZPA 1JUKA 3DZ1A 3I65A 3BGGA 1WA3A 3H54A 3C61A 1DQWA 3QYQA 4L4MA 1QCWA 4NXSA 3FKKA 3W7PA 5FEPA 2A5HA 3O15A 1XCFA 1LRTA 4K8EA 3PB2A 3W1AA 3I7RA 5HINA 3DKJA 2PURA 3F4NA 5AHMA 3P80A 5GVJA 3LGEA 2ZYFA 1UB3A 3NQFA 3MI2A 3W1QA 4O0KA 4OWGA 4L4LA 1O95A 1I4NA 1VYRA 1OHLA 1YTKA 4HN4A 3B05A 3LV6A 1LORA 1G4EA 3RFAA 3N3MA 2QAPA 4C1LA 4AHPA 1OX4A 4GNJA 5DBTA 1Q45A 1LLZA 1IXOA 3NGJA 2H8XA 3QEZA 2RHGA 1VQTA 1TPUA 3A9IA 4UTJA 1FXQA 3L5AA 3ZFHA 4IXXA 4DF1A 5FF2A 5DXYA 1AL8A 1W54A 5U4NA 3BLIA 4IXHA 4H6KA 3G0SA 1N7KA 4NUWA 4FEZA 3QW4B 3LCXA 4Z1AA 4XTDA 2ISWA 1W5OA 3WJYA 3HBLA 1YLVA 1P0NA 3IV3A 4RK8A 2YFNA 4OHQA 3NQ2A 2J6XA 3PS7A 3G1HA 2NX9A 1F73A 2JGQA 3ZWSA 1TPC1 3D0CA 4K6AA 1JCLA 3SIZA 3NVTA 3W2KA 1KM2A 5HUPA 1KM5A 4IUOA 3SZ8A 1F05A 4H4IA 3M1ZA 2JGYA 2JKEA 2FPTA 3PBUA 3GXPA 4RKAA 2YFOA 4LS1A 5LHFA 1YXDA 3KVLA 3MI3A 3P5ZA 4GWEA 3NPVA 3B04A 4YXGA 3O16A 3MP3A 3LHUA 2NX1A 2ZBTA 3GDMA 3L0NA 3KRZA 1LP6A 5CPMA 3I6RA 2NUXA 1R30A 1VZWA 4JTLA 3KVJA 1DV7A 1OFAA 2Z2UA 3LHTA 3EX3A 6ALDA 2ABAA 2XFWA 1Y0EA 4NJIA 1TB3A 3DFOA 2VXNA 1HO1A 1IIHA 2CZFA 4MLRA 1VHCA 1G4PA 3GDTA 4GFSA 3TMLA 5D38A 4RJEA 1F74A 1IIGA 5CKSA 3NXFA 3TH6A 4MJZA 4D2JA 3R89A 5CSRA 3LCWA 3LDVA 3MP5A 1KTCA 1QR7A 3KFTA 2GPTA 4DPPA 1PL9A 1LCOA 1KLYA 3BPWA 3O8AA 4JN6A 3NM1A 3IGXA 2Y7DA 1I2NA 4S2CA 4Z08A 3WJZA 4AB4A 2J27A 2V30A 1SZFA 1K8XA 4IMEA 4NJKA 1DQXA 3S8HA 5D2TA 1HFBA 4BR1A 1A5CA 2A21A 3NQAA 1UUOA 2V81A 1H7XA 1OFPA 1YYAA 4A3UA 2QCFA 2QDGA 2CLLA 1LBFA 4YMZA 5LNUA 2WOQA 2P1FA 4LTSA 4HNTA 1FWNA 3BW4A 5D2WA 4QNEA 3PBWA 2WNQA 2W6RA 3UPBA 1LROA 5AHIA 3EX6A 4DPQA 3LX9A 2QR6A 5D30A 4UMAA 4WXYA 2CWNA 4Z1CA 3M7WA 1KM1A 2C19A 5BMWA 3O63A 1A5BA 4UTWA 3LBMA 1TO3A 4A22A 1G4TA 1EX5A 1LOLA 1S5WA 1TSIA 4M6PA 3PSVA 3C8FA 1YPFA 4WUIA 4QAIA 1YDOA 4XKYA 4JTSA 2VOMA 4POCA 3P67A 2H90A 3TUUA 5H2ZA 3CLMA 2DZWA 2ISSA 4CQ8A 2Z6JA 2NWRA 3G3DA 4HNUA 1ONRA 3BGJA 2W79A 4NJHA 4X3ZA 3FKRA 2A4AA 2FB3A 1QPRA 1VPXA 3NQDA 2HS8A 4JS3A 3E9AA 5I3GA 1MEWA 5LGZA 1ZJIA 4Y9AA 3MYPA 1XI3A 3L68A 3W72A 3FOKA 2Y61A 3TC7A 5T26A 3ZWTA 5ABTA 2XN0A 2Y63A 5BW6A 4JDBA 3KVKA 2VFHA 2ZZ7A 4CCEA 4DF0A 1QNVA 5IBXA 4K8HA 4QITA 3A21A 2TMDA 1CW2A 3W3OA 1SO4A 1MXSA 3P5YA 3BW3A 1TIMA 3TXZA 2RKXA 4AH7A 3LXAA 2Y7GA 3LRMA 1WV2A 4LRSA 3LLDA 5G2HA 1VC4A 4KFOA 1F7BA 2X2GA 4CQ9A 2TPSA 3EEGA 1G67A 1GJPA 2ZTJA 1JCJA 4DF2A 1NF7A 4BI6A 5LNSA 1O94A 3RU6A 3S0CA 1G7UA 1XC4A 3CWNA 5HMSA 3DH7A 3NR0A 1DL3A 3DAQA 3TKFA 4JTHA 2WSYA 2C6QA 3PM6A 3G1VA 2J9YA 3N19B 4C1KA 2QUTA 1Q6OA 1KFLA 4PC8A 1QPQA 3UYCA 1OABA 2GVLA 5FF4A 1TTQA 3NL5A 2DJLA 4ZMGA 3TAKA 2ZRZA 3C56A 4IQLA 1GYLA 3E49A 4IMDA 3UWZA 1ZHAA 1JUEA 3R13A 3WK3A 3W7IA 3GKFA 3L21A 4O4WA 4X9SA 2ZA1A 1VYPX 2I14A 1VHNA 1RD5A 3IEBA 3S1WA 4N9CA 3PULA 5CZTA 4O12A 4FF7A 2V82A 3C4UA 4RXGA 3P82A 2DZSA 4O10A 3M5XA 3VNDA 4JXCA 5FI8A 5CPOA 4S1FA 2QAFA 3G0UA 2R94A 4FIQA 3TQVA 4Q33A 4RZ4A 4NNBA 4FNPA 1DVJA 3QFEA 2EAWA 2O7SA 5F2MA 3NM3A 4ZL1A 2C16A 4N02A 1Z41A 4UNKA 4GUGA 1OK6A 3Q58A 3MI6A 1LBMA 1K3UA 2B7PA 5G2IA 2CW6A 3C2VA 5AYZA 3TC6A 5HWMA 4PODA 1YXCA 1H50A 4UTTC 1MSSA 2QCLA 3TROA 3TQ0A 1TMHA 3ELFA 2Q3OA 4RR4A 1JQXA 3W2NA 1EUNA 2YXGA 5CG7A 4UMBA 1VCVA 3L5MA 4FO4A 5DCBA 2GQ9A 4YCPA 3UWQA 2A2IA 4XUGA 1WQ5A 1CX9A 1ME9A 4TMBA 5D05A 2RFGA 1XBXA 1G7VA 4UIOA 5LKYA 3HPZA 2NXHA 1GTEA 4AHQA 3LCIA 2ISVA 4ORIA 3L65A 4I7UA 4O19A 1AMKA 3CHVA 3VKJA 4MZYA 4HIBA 3UXAA 4K7YA 1ADOA 3M43A 3T7VA 3LM7A 3HO8A 3N73A 3PWAA 5DY2A 3TK7A 1PE1A 2NXGA 3NPUA 1VCFA 3KHJA 1B4KA 1H62A 5F2LA 3W7JA 2VC6A 3G8EA 1T96A 1EIXA 3V1PA 3W7QA 1DOSA 2ZQ0A 1XUZA 1V5XA 1SSDA 4ML9A 3N9RA 2ZZ5A 1O4UA 4O11A 2NV1A 2H3DA 3RNDA 2VELA 3WK0A 3GDKA 3R8RA 1OF6A 4JY8A 5DXXA 1JCNA 1KV5A 1ALDA 1XFBA 3C3NA 1ZALA 1TREA 1VCGA 4GBUA 3G1XA 1H1YA 1OJXA 1B3OA 3MYOA 5HNRA 3QMRA 1MO0A 1LZOA 3QPZA 2GQAA 2QEZA 2VEIA 3L5LA 4MFDA 5H91A 5J5RA 1QOQA 4Q32A 5G4EA 1VLWA 4Z1DA 3TQKA 4JTKA 3LCHA 4LT9A 1U5JA 3DFQA 1X7FA 4JNMA 4TIMA 2G97A 3AJXA 4O1DA 1X1OA 1PV8A 3GIYA 4NX0A 4BF9A 5KMYA 4I7VA 3THAA 4AMAA 1QAPA 1VS1A 4K38A 2DU2A 2UV8G 4TMCA 5D37A 2A6NA 1GOXA 4UR7A 4MJMA 1W31A 2ATSA 3O6YX 3P8JA 3C2FA 5G2WA 1KTNA 3CQ0A 1FDJA 1YTDA 2Y62A 3T40A 4WZHA 1LLWA 3MO7A 4I7WA 4FX6M 3GXTA 3LXBA 5HR7A 1D3HA 2Y85A 1OF8A 3W1XA 1FBAA 1TTPA 4AWUA 1OFOA 3W2LA 2A1YA 4UTHA 3NQ6A 3M47A 3DFSA 3MHFA 4EOUA 4ADUA 1TPEA 1PHWA 3EX2A 3ABSA 4JYEA 5LHEA 1FXPA 3MP4A 3WFAA 2ZRUA 2A7NA 1KW1A 3GX9A 1PS9A 4LUJA 3GR8A 5LSMA 3L0KA 1BKSA 2B0MA 1W3NA 1THFD 3LBCA 1GVFA 4NNCA 2J88A 3GVGA 4XZ9A 4JGDA 1XXXA 1OYCA 4LS2A 2GVJA 4ZQOA 3NQEA 4LC6A 4NQ1A 5AC7A 3SGUA 4NJGA 1AW5A 1SPQA 1HUVA 4WOQA 3IIPA 3HGSA 3MUXA 1D3GA 5EKYA 2VEMA 4IJBA 3TIMA 3MWAA 4R53A 2A0NA 1KFEA 4LC8A 3BK0A 1C9DA 4O1AA 1RQBA 3EX1A 2FJKA 3C2EA 1H7PA 5HJLA 3T55A 3P60A 5F2GA 2V8ZA 2ABBA 2X30A 3KOFA 3TSBA 2A85A 4OQVA 3TU9A 1FCBA 1D9EA 1H7NA 3S5NA 2J9XA 4PL2A 3HG3A 3LTPA 1GT8A 3P7YA 3PAJA 4N9DA 4FXSA 3S5ZA 3P84A 4WY0B 2DJXA 4JICA 1UUMA 3NQ8A 5A8GA 5CPNA 3U8GA 3BARA 2OX1A 4HPXA 4XKYB 2EPHA 3FJ6A 1FCQA 3GYEA 4MLJA 1GVQA 1BWLA 3DI0A 2ZTKA 2VENA 3G18A 4H3DA 5CZJA 1QFEA 3W22A 3NPWA 5E93A 1P0KA 2FQIA 1GG0A 4O53A 4UTTA 4CNPA 1O60A 3KX6A 2QCHA 3KVMA 5U7SA 3O07A 1A50A 1EEPA 5AC6A 3NYZA 5AC8A 3L66A 4FNTA 3PY2A 2EGZA 1G4SA 3DENA 1N55A 1XDLA 3IIZA 2HS6A 2VFEA 1K02A 4O0ZA 4JDYA 3FS2A 4DXVA 4WJEA 3C6CA 1H7WA 4FNSA 1VJIA 2H3BA 4QISA 1HO4A 1GG1A 5I3HA 4PL1A 3TXVA 3E02A 5BRBA 3DKLA 4LOCA 3UD6A 4JYFA 2BXVA 3SY5A 1T8XA 1C29A 3IIOA 1E51A 3QSRA 3TFCA 2ZZ3A 4O18A 1TJPA 4GRSA 3TDFA 1A5SA 3PUOA 4UFKA 2NUWA 3W23A 4RX0A 1XUUA 3GDLA 5HQEA 3LERA 1XBVA 2QCGA 3EWZA 2AQWA 4M7TA 4LW7A 4QIUA 4LS0A 4N9EA 2EF9A 1Q3NA 5I3IA 4HNNA 2V0TA 3CPRA 3DI1A 2VEPA 3N14A 3W7NA 4PH6A 1QMLA 1B4EA 2XN1A 3DBPA 1TTIA 3KRSA 5FF3A 1NFBA 2QJHA 5DLCA 1TRIA 4ZZ9A 3STEA 1UJPA 2G96A 2WQPA 2Z0IA 1H61A 4IMGA 3EB2A 2VFFA 3FJLA 1AL7A 5KSWA 3W1TA 3W83A 4MY1A 3GK0A 3ZS4A 5AB3A 1ZNNA 2X1TA 5C2XA 5IM51 1X1ZA 2HSAA 3S6DA 1GZGA 3W7HA 4E2BA 4UR8A 2PE4A 3TW7A 2YPIA 3GNNA 3LTYA 4WY0A 3VFLA 2YDAA 3LHYA 4FNQA 4RZ5A 3N9SA 2CZEA 1FCVA 1Q6RA 3P8IA 1ZAHA 3W1NA 3DXIA 5BOOA 3G3MA 5KZEA 2WSRA 1SW7A 5TIMA 3UXDA 2NV2A 2Y88A 3C2RA 1FQ0A 4A21A 2GQ8A 4DBEA 1H7OA 2YW3A 1RVGA 1W5MA 2OZ0A 1L6WA 3EXSA 5AFDA 5HUOA 4FIRA 2CZ5A 1XL9A 2R14A 4JY9A 5I3JA 1GWJA 5FEXA 3UWUA 4LUIA 3W87A 3FFSA 3W1MA 5K2ZA 3W73A 3DFPA 1LDCA 1VLIA 3VE9A 3NQGA 5K3VA 4MIMA 3O06A 3SSJA 2C14A 5TQLA 1EWDA 1F5ZA 3EWYA 1M6JA 4MY9A 1G69A 1WAUA 3QPYA 5AYXA 1L6SA 1WX0A 3WJWA 4RLIA 3VCRA 2ZRVA 2F84A 2NUYA 4O17A 4ADSA 4S2BA 3W70A 2QF7A 4DO4A 1SO5A 3M41A 4Z1BA 2WV8A 4QJ1A 4DQWA 1RQHA 3OVQA 3STCA 5C55A 4HPJA 4BK9A 4XWUA 1OFDA 3W2UA 4O4VA 4MYAA 1IXNA 4OV9A 2PRMA 5KZDA 1R47A 5BMXA 1NF0A 2JKAA 3RK8A 3C52A 2LLEA 3UPWA 5FEWA 1H51A 2NLIA 3HPXA 3V75A 3W7LA 3LCFA 3EWXA 4OGZA 3UNDA 3EXTA 1JULA 2RDUA 3G1AA 3ANYA 5D32A 4O14A 2YW4A 2DP3A 3LRKA 3NPXA 3SW6A 1M7OA 1K7XA 1W1ZA 2YZRA 1TPH1 1PHQA 1WBHA 1XKYA 4GE8A 4BWLC 1TV5A 4CCDA 3W86A 3TFXA 1TQJA 3W1LA 4XBSA 1KLZA 3G22A 3NG3A 1K03A 4NZFA 5L9FA 3IVUA 3NQMA 4X2RA 3KRUA 3N2MA 3STFA 1YDVA 5J5DA 1LM1A 1KM4A 4OBTA 2OJPA 4K37A 3HF3A 4I9AA 2NWSA 4ONVA 4OT7A 3PG9A 2QJIA 3BW2A 3F4WA 2HMCA 2X1UA 1IF2A 1L6YA 4N9BA 4BI7A 1SFLA 1UASA 4LVFA 4GUIA 2G95A 5D02A 4QNWA 4PEKA 4O1CA 1FWSA 3B0VC 1FDZA 1KTBA 3S5YA 4EF8A 1ZENA 1JJKA 3E0IA 3M9YA 3W74A 3DFTA 3WK1A 4HHPA 1GVOA 1PCKA 2Y7EA 2ZRXA 3NNTA 2ZA3A 1YDNA 4LWWA 1MZHA 3T78A 1I2OA 3GR7A 1W0MA 5FESA 2EHHA 1FX6A 1AW2A 3PUDA 2QCDA 2WO5A 2RDWA 4K39A 1PVNA 3B0PA 3W07A 1OX6A 2V5BA 3B4UA 1KFCA 3EWBX 2WKJA 5KTLA 2CLKA 1GQNA 5EYWA 1TRDA 2ZFAA 4LVBA 4M7SA 2C0AA 3UZ5A 3G8RA 3Q37A 3CIXA 1S5TA 4ICNA 4MOZA 1JCXA 1PIIA 3HIJA 4O16A 3LCLA 3OEXA 2XN2A 4NT0A 2V2CA 2GUUA 1BEUA 1L2UA 3QZEA 4PFMA 3TMQA 3DFNA 4TU1A 5CZ0A 4LV9A 5C5YA 4MUZA 3L9CA 1RQEA 5A5WA 3BO9A 5CSSA 1TPWA 4GJ1A 1EP1A 4QSHA 5G5IA 3PBVA 5EL1A 2G5WA 4UTMA 3CWOX 1W3TA 3B8DA 3SR7A 2QCMA 1J5TA 4JTGA 5F2IA 4ZQRA 3W1UA 2RDTA 2X1RA 1UBSA 2FDSA 2GJLA 4LVAA 4M6VA 2FPVA 3OVRA 4JTUA 5HWJA 2E6YA 2X16A 8TIMA 3RMJA 2FPYA 3RF9A 4LVDA 1AK5A 4KKXA 3S1XA 2ZDRA 2VEKA 3L0GA 3SECA 4O8RA 3GAYA 3QC3A 1LBLA 2KZHA 1GVSA 3E96A 4MY8A 2OT0A 3CB8A 1H63A 5AOUA 4A2SA 4M6QA 4NJJA 1Q6QA 1JRBA 4LRTA 3G1DA 4JR5A 2E68A 2FTPA 3QMSA 3CTLA 2ZA2A 3KAOA 1S5VA 7TIMA 2GVGA 2JK2A 3S1VA 4UNLA 2J24A 4JTJA 3HG5A 5AHNA 2B7NA 5HR6A 4PA8A 4AHOA 4TR9A 1KV8A 1SZGA 3NA8A 1FDYA 1K8ZA 5LGXA 3L2IA 3MW7A 3E12A 2YX0A 4TO8A 3O1NA 1A5AA 1KFBA 3LXCA 3OIXA 3U6WA 3MBDA 3FIGA 5E0KA 4MZ1A 4R34A 4EF9A 2TRSA 1DBTA 4RV8A 4JX4A 5MHBA 2FB2A 3HG4A 3W7EA 1CI1A 3W7DA 5C54A 1C8VA 3BG9A 2QUVA 3H53A 5D2XA 4UFJA 5DY3A 2ZRYA 3W7KA 3UQNA 2ZRWA 1HTIA 1OVDA 4UFLA 1OYAA 1XBYA 5AYYA 3EWWA 4O54A 4A2RA 3VE7A 2E1DA 3DU0A 4IX0A 4YL2A 6TIMA 1OG0A 2OT1A 2EKCA 3U2OA 3HGJA 3GLCA 2E6AA 5F4SA 1SW3A 4JIPA 4KFPA 3WJSA 4OV4A 4CNOA 3HJZA 4UFHA 1TV7A 2TYSA 3FEMA 1P4CA 4CCCA 4AEOA 3HB9A 1XBZA 1SO6A 3MJYA 4NZJA 5D09A 1NSJA 1YADA 2Z6IA 3LI1A 3MMTA 3PC0A 1KBJA 3CC1A 1SFJA 1KFKA 1EB3A 3QRHA 2WNZA 3W7MA 1X8FA 3OHIA 2ZZ1A 1OFQA 4IWWA 3QM3A 1ZAIA 3W6YA 4Y8FA 3MBFA 2AAMA 3HGRA 4BWLA 3B03A 4Y96A 3G1YA 3EKZA 1P5BA 2I1OA 3NQCA 3NDOA 2FLIA 2GOUA 3SI9A 3W7OA 2QCCA 1XDMA 4IMFA 4JD4A 2WNNA 3G24A 3HOJA 1JR1A 1O5XA 2DZXA 3A5VA 3JRKA 4J9JA 2R8WA 4GC4A 2B7OA 3W2MA 3CEPA 1TYGA 1JQVA 2Q8LA 3PUEA 2F7FA 3I7QA 3JS3A 3N34A 3L67A 1PCWA 1JCMP 1W37A 5D2VA 4FNUA 1SW0A 3R2GA 3LHZA 3QQ0A 3DGRA 2DZVA 5EBUA 2YYUA 5CPLA 3NZRA 4NXKA 1NAL1 3BVJA 3THQA 1H1ZA 3LB0A 5BNKA 4FX8A 4UXDA 3SFKA 2VFIA 3NEVA 1WOAA 4JTTA 3GXNA 4O1BA 4UCGA 1OX5A 3GAKA 1DKWA 2VFGA 5EMUA 1MEIA 5SWUA 3JR2A 4YCOA 3W88A 3M0ZA 1SZNA 4U28A 4HSNA 5LNVA 2Y89A 1H7RA 3W7CA 1SU5A 4K36A 3TJLA 3H55A 5D33A 4N6FA 4AF0B 1KM3A 3FLUA 1XM3A 2DZTA 4O52A 3INPA 2WPBA 3O6CA 1G6CA 4GUJA 4WXZA 1Z42A 1BTMA 4LVGA 1TPFA 3DHFA 3IIVA 3M16A 4WQ6A 2C3ZA 3GKAA 1QPNA 1FY6A 1FUYA 4XQ6A 3WK2A 1KFJA 3Q2DA 2PRHA 3AO0A 1EUAA 3M5VA 4IOTA 2YR1A 1LOSA 4UC5A 4GUFA 3P62A 3B0UX 2HTMA 3STGA 3PG8A 1DHPA 5LZLA 4WX2A 2GJNA 2QCNA 1QWGA 5G4WA 2BZNA 3NO5A 3NOEA 2CLHA 2V9DA 4EVZA 3GDRA 1M7PA 5DBUA 1I2PA 1LRQA 1ME8A 3W7RA 4YWIA 1FWWA 1RZMA 3LHWA 3TAOA 1DORA 2H6RA 3IRDA 3M44A 1OK4A 3TA6A 3S5OA 1JCYA 1RPXA 4M5PA 1W5NA 4JEQA 1Q6LA 5DCEA 1F2JA 3W9ZA 5K7JA 4LV4A 2Y6ZA 4O28A 1DJNA 1VR6A 3F1QA 3BV4A 4O57A 4WOZA 3GB6A 5EA9A 1TV8A 1JUBA 4PTNA 5DCDA 1AW1A 4Y90A 1WDWA 1ICQA 5CZSA 3ABRA 2BX7A 1R46A 1H5YA 2PCQA 3QMTA 3QSTA 1T0OA 5KINA 5K4ZA 4IPJA 4FNRA 3TJXA 3GZ3A 1VRDA 3EXRA 3IVTA 4N4PA 2ZZ2A 4HT3A 4OU1A 3UWWA 5CGQA 3NL6A 3I68A 4M19A 1M5WA 4JTIA 3UWYA 1LRNA 3A22A 2IQTA 3IIXA 3SGZA 1WYIA 5G1TA 1OFEA 1TJRA 1YXYA 3UY8A 1IGSA 2D73A 2CFFA 3PB0A 5FEZA 4MZ8A 2QCDB 1WBJA 5C6MA 3TCEA 1GPWA 1VGAA 2DORA 2C18A 3O05A 1EP2A 3IVSA 4MPQA 1JVNA 3ABOA 2OCZA 2YSWA 3P74A 1ZFJA 5FF7A 4NNAA 4JTEA 3W7GA 5EY5A 1TTJA 4X22A 4UFIA 2E6FA 3UWVA 4O13A 4IX2A 3O6DA 1W3IA 1ML1A 1VYSX 1OFBA 2E09A 2ATMA 5KZMA 5K4XA 4IMCA 4R33A 2I9EA 3G1FA 3CT7A 4U4MA 3LRLA 1T99A 3SJ3A 1JRCA 2C15A 2Z1BA 3C2OA 1QPOA 2VFDA
chains in the Genus database with same CATH superfamily
2WANA 1IXQA 4AF0A 1MUCA 2YGYA 4DJFD 5F4WA 1EOMA 2E5BA 1QW9A 3W75A 2A3AA 1HG3A 4LAKA 2B7QA 3HQPA 3VD3A 2ZUUA 2G3IA 2X2YA 3T2PA 4UMCA 4GIRA 4WR3A 3BG3A 3WMBA 1PX8A 5XIMA 4NU7A 4JFSA 1ZL1A 2CLOA 3LLXA 3GG8A 2NV9A 4OBRA 4DWSA 3EWUA 3IJ7A 1PSCA 3FCPA 3GBEA 1ZY9A 2IS7A 2R91A 1UD3A 2XFFA 4PMOA 4Q4SA 2IPFA 3GHUA 1WO2A 1K8YA 3OO2A 4XG1A 1AH0A 4DJED 2C71A 2QKFA 2BBFA 4MM1A 4WSJA 3EOOA 3FYOA 3LPGA 3PJWA 5DELA 4ZE4A 3UCCA 3U5UA 3W2JA 5K9XA 4CNNA 4RXFA 3N25A 2I16A 4W93A 2ACQA 1RCOB 2MANA 3UYIA 3WQWA 1X38A 2Y7FA 1Q4WA 3W29A 1YTEA 2G0WA 3KS5A 3NXLA 1DXFA 3EZ4A 4LAZA 6REQA 4QP0A 2QDHA 4KETA 5DN1A 3RCMA 1A0CA 2AL2A 1A5OC 4V33A 1IZJA 1P43A 3C3UA 3EEZA 1WDQA 2GUYA 1J0JA 4IGHA 5TNVA 3SO7A 3I3BA 1I2QA 1X6UA 1YRRA 1K7FA 4P5UA 3KP1A 3T6CA 3F5LA 3MHUA 1AG1O 1F76A 4ZFCA 1XLAA 4YLWA 4AD2A 2RH9A 4QAWA 4TV5A 1J8VA 2WKGA 3BLEA 2E5CA 1QO5A 4MKNA 1B57A 1EA0A 1ZBCA 3TN5A 1I2RA 1ZAJA 5ABGA 2Y5EA 3PANA 2GGHA 3GNDA 4IPIA 3I3DA 2Y1HA 4AY1A 4AMCA 3NJ3A 5I03A 3A23A 2W61A 1HGYA 3QW3A 3WLPA 1J10A 1HKMA 3N6JA 1VF8A 2C13A 1P7TB 1DJZA 3LUTA 4D8LA 3TSDA 1TUFA 1EZ2A 2DVXA 2FIQA 3CU2A 2PWGA 3WQDA 6XIAA 5F1UA 2A7PA 3ATYA 1UR9A 2PDNA 1V3KA 3FYPA 1XIDA 1SQ7A 3OJGA 4MVAA 4ZBCA 5FF0A 3URAA 4PCFA 5FSEC 5TBOA 3OOQA 1ONXA 5D2YA 5DMNA 5ABHA 4I5XA 1OX4B 3W76A 3W85A 1N82A 3VD7A 3HMJG 4JKLA 3ARRA 4F2TA 2BTMA 4XD5A 1K9TA 1GW9A 3CIWA 5M03A 2V2HA 4US6A 2BLEA 2ZCGA 4W8BA 1ZBVA 4G9PA 3R12A 3TTQA 4RZ6A 3QV7A 1U5VA 4BI5A 1XLLA 1ZLPA 4BJHA 1CXKA 1SMAA 2NQ9A 1I45A 5D04C 1PYFA 3TR9A 3CMJA 1MYRA 5I77A 1DWAM 4ZSUA 1AD4A 3P93A 3UZWA 4GCXA 4OVXA 5JH2A 1LJYA 2ZUMA 3EKLA 4AAJA 4F0SA 3OB8A 3DYPA 1R2TA 1C8QA 4DJEA 3ABQA 1KA9F 1RCQA 2AKMA 3AIVA 4NRRA 3VM7A 5K9CA 3LD5A 4H2HA 5HATA 2NQJA 1WAWA 1NEYA 1RR2A 1VP5A 3E38A 4KMQA 4YVVA 1W3HA 4AD5A 1BWVA 1E56A 2ASHA 4UZSA 1ISVA 2P0OA 4EWND 3NQVA 1OD0A 2NX3A 4KIRA 3C5QA 5I09A 2GVEA 2OMAA 1P1XA 3TX9A 1JZ5A 3UJRA 3EPNA 4AY8A 1JDEA 4L9YA 4R85A 1W1B1 2BWGA 3TZFA 4O15A 5FJOA 1TJ0A 3BSMA 2CZDA 2C1HA 2E28A 2PGWA 4JTFA 1WNOA 1E5JA 1X96A 4NZ4A 1OY0A 5A6AA 3JZUA 1NFPA 2VM8A 3VKDA 3IRSA 1DQWA 3ITVA 2A5HA 4DHGA 3O15A 1P7TA 3W1AA 3DKJA 2NVCA 3QY8A 4UB9A 1BXNA 3UVIA 2W3ZA 3P80A 5GVJA 1FH7A 3NO3A 3MI2A 3S2NA 2Q01A 3W1QA 4O0KA 1LLOA 1O95A 4CCZA 2VZOA 2ISFA 3B9AA 1YTKA 4HN4A 1VD6A 1HGWA 1LORA 4XUYA 1G4EA 1JYNA 1W91A 2QAPA 4AHPA 1OX4A 2POTA 5C71A 2E8ZA 4GNJA 5DBTA 1IXOA 1VQTA 4KCUA 3NSNA 4UTJA 1ESWA 1K6AA 3CHDA 4W5ZA 4EWJA 1AL8A 1W54A 5U4NA 4IG2B 2GSEA 4FEZA 1GPFA 4Z1AA 4XTDA 2Z1VA 3ICJA 4JN8A 4PCSA 2W5FA 1I9CB 2G3NA 3NQ2A 1JZ8A 5B7ZA 2J6XA 3BLOA 3PS7A 2NX9A 3UG8A 1F73A 3VPLA 3RR1A 3SIZA 4W89A 2DUXA 1GGOA 3I4KA 1AJZA 4IUOA 3SZ8A 4E2VA 5FAJA 3M1ZA 4CVWA 2JKEA 4WSKA 1UWAA 2UY5A 1EFZA 3KVLA 3P5ZA 3NPVA 5M2FX 4YXGA 3MP3A 2NX1A 1ITQA 1GQKA 2F9RA 2J8GA 1XR2A 3RIKA 4QJ3B 3KCOA 1LP6A 1S2CA 4FOUA 4ERGA 4EAYA 1FOBA 2IKHA 1VZWA 2W66A 4JTLA 3KVJA 1AFSA 3LHTA 2ZUTA 4NAEB 2E7FA 3EX3A 3P0XA 2J4GA 2DSKA 1IIHA 3PFMA 1G4PA 4FP1A 8XIMA 1IIGA 5CKSA 2FGBA 3NXFA 1XYCA 3B4YA 4H04A 1KWKA 1HNYA 2VUNA 2WVVB 5CCZA 2GPTA 4JL1A 4RDVA 1KLYA 2WZIA 4HHMA 1GKRA 1YBQA 2L5HA 1Q66A 3SQLA 4JN6A 4C5YA 3PZQA 4JTQA 3DUGA 1AH4A 1XCXA 3APGA 3IGXA 3H23A 2Y7DA 1I2NA 3WJZA 2V30A 1U1UA 3KOZA 1H0GA 5A8NA 2V81A 1OFPA 1YYAA 3LZ5A 2QV4A 4FPSA 1FWNA 2VRKA 2HVOA 3BWWA 5A95A 4AZCB 3DYMA 2WNQA 4KH2A 3Q4DA 4WKAA 2Z4GA 5AHIA 3EX6A 3E74A 2DEPA 1E70M 1HJQA 4Z1CA 4A35A 1KM1A 4EPKA 1A5BA 3WF0A 3UJSA 4AEEA 3EB4A 4UTWA 1E3ZA 5C7HA 5B80A 1LOLA 4HA4A 4KF1A 4M6PA 1R9ZA 2ZIDA 4QAIA 5BWAA 4NAFB 1V6WA 4KRUA 3P67A 2H90A 4U5KA 3TUUA 1SM9A 2ISSA 4LX4A 3CMFA 4IIGA 4YHEA 3EA2A 1IQ8A 3EDDA 1ONRA 3BGJA 4CN6A 4HMDA 3AS0A 1PDYA 1WCGA 3NQDA 3UWEA 1KWGA 5I3GA 1UR8A 3WNMA 5CAHA 4GJJA 1EGVA 1ZJIA 4Y9AA 1XI3A 3VMNA 4GKTA 3FOKA 1RA5A 2C1GA 2QZRA 2YXXA 2Y63A 4JDBA 3BANA 2BXYA 3KVKA 1J6OA 2VFHA 2OB3A 2QHAA 4DF0A 5ENLA 1MVYA 4FOJA 1MDRA 4QITA 2TMDA 3HZ3A 4DYKA 1JPHA 4G56A 1BRLB 3N3TA 3BW3A 2VMFA 4AH7A 3PN8A 3LXAA 2D24A 2Y7GA 3WDPP 4LRSA 4NAEA 1JEZA 2W27A 1HN1A 1VC4A 3UCQA 1F7BA 2X2GA 3WN6A 5EGRA 1GJPA 3KOYA 3GE7A 2GGJA 1JCJA 2UY3A 5LNSA 3CUFA 1T8QA 5IDZA 2WVVA 2HNEA 3DAQA 3EDEA 3FY1A 7REQB 3G1VA 5C7VA 4M29A 3GFYA 3VILA 1QPQA 3UYCA 1OABA 2GVLA 5FF4A 2IMRA 2OSWA 1E6QM 4Z2IA 4ZEPA 2DJLA 4ZMGA 2HVMA 3S6TA 1EF3A 1TE6A 3IUIA 3U2ZA 3E49A 2R1PA 1MFUA 1ZHAA 3HMCA 3R13A 2PP0A 1WKEA 4O4WA 3LN3A 1BD0A 4X9SA 2Y2WA 5LIWX 3W37A 2ZA1A 4D1JA 4S3JA 1JDFA 3GW3A 3BAXA 5CZTA 3UZXA 3WBAA 4O12A 3P82A 2DSVA 4O10A 4JXCA 5CPOA 4S3DA 5H8PA 1YE4A 2R94A 3LSCA 4J4KA 1RK5A 4GIYA 8RUCA 4P7OA 3EMCA 3QFEA 2EAWA 1TWDA 3SCOA 1DJYA 4EPDC 4N02A 4QXIA 3Q58A 3MI6A 4EPEC 1K3UA 5FSDC 2CW6A 1MW0A 5HWMA 4PODA 3VOGA 3HA1A 3SUTA 4UTTC 5G4HC 5BU9A 1KXHA 4NAFA 1BYDA 4DJDC 2WKLA 3L4TA 4GCAA 4JFWA 1JYWA 1FH9A 1PTAA 1S38A 2Q3OA 4RR4A 3AOFA 3W2NA 2FJUB 1JCTA 1B3VA 1UWRA 1VCVA 3FN9A 4HZ6A 1WQ5A 1ME9A 4IF2A 3DG6A 4X9YA 1G7VA 4F0MA 5LKYA 3HPZA 4DBSA 4ORIA 3L65A 3WQEA 4G7FA 3CHVA 4MZYA 1T41A 4GX9A 3EDKA 4PMUA 1HKVA 3T7VA 3N73A 1BRLA 3NPUA 3M0YA 3KHJA 1E0VA 4HP5A 1XRVA 4Q8UA 3FW6A 1GVEA 1KBBA 1LT7A 1XUZA 1XLJA 4AIBA 1HIZA 3N9RA 2ZZ5A 3TTEA 4O11A 2H3DA 4EKJA 1KNWA 3RNDA 3R8RA 4IISA 2DW6A 5DXXA 1HT6A 5MF5A 1NARA 7REQA 1Z3NA 5EMLA 1XFBA 4GNVA 3G1XA 2ESCA 3UR7A 4L4OA 3D3FA 3QMRA 1UZHA 1TWZA 2VEIA 3L5LA 5H91A 1L8PA 5J5RA 4H8NA 5G4EA 3LCHA 4LT9A 3ISIX 3AJXA 1R8LA 3JW7A 3GIYA 4NX0A 2VNCA 3THAA 4AMAA 3O9NA 1UUQA 4K38A 2W91A 1UKPA 2J79A 3NZGA 2EG6A 4PULA 1OC7A 3VK5A 4QE1A 1W31A 2ATSA 3O6YX 1VB9A 4PCPA 3GH5A 3CQ0A 1UWQA 1YTDA 2Y62A 4GYKA 4XO6A 6PTDA 3WH9A 3MVIA 4RE2A 1PTGA 3G6MA 3GXTA 4FX6M 1D3HA 3NIYA 4WDXA 1FBAA 1TTPA 4AWUA 1NELA 2A1YA 4KCWA 1RJQA 2CCRA 3M47A 2PD5A 4EOUA 1XWYA 4ADUA 3M0IA 1TPEA 2DSWA 3ABSA 4JYEA 5LHEA 3MP4A 2HK0A 3UR8A 2A7NA 2VDIA 3GNXA 3F2BA 3GTHA 1K4HA 1UBPC 4PB5A 1BKSA 1W3NA 1YW1A 5JIPA 2YIHA 4LC6A 3WIJA 4DM2A 2OO6A 3QHMA 4D6JA 1HUVA 3APTA 1U22A 4JNYA 1XLGA 4WOQA 1YNPA 2PMQA 3HGSA 3F4CA 1D3GA 4H7CA 4IJBA 1K4GA 3H7VA 2PBOA 4S38A 1KFEA 5I07A 1KCXA 3H7UA 3BK0A 4O1AA 4UZUA 2FJKA 3V0TA 2CBVA 3P60A 3LQGA 1GOOA 5JVLA 1B9ZA 1D9EA 1VPYA 2V5JA 3GH4A 3HG3A 3LTPA 1GT8A 4WKFA 3RUBL 2PGEA 2FH6A 2PWHA 3P84A 1BPLB 2DJXA 1UUMA 3NQ8A 5A8GA 1JYXA 5CPNA 1MQPA 2OX1A 2BOFX 3VKAA 1BWLA 4JTRA 4W8AA 3WH8A 1Q5MA 4IL2A 3HV8A 2OELA 3MPGA 1GG0A 4H9TA 1Q7MA 4CNUA 4O53A 1JDCA 3NDYA 5TAOA 1P48A 1EEPA 3NYZA 3L66A 3CHCA 5AYBA 1FP9A 1XDLA 1EGZA 1K02A 3FS2A 4DXVA 3WY1A 5M5DA 3LU2A 3U4AA 4C6PA 1JZ6A 2PBGA 3RAOA 4AD4A 4PL1A 3TXVA 1CXLA 3VIJA 4YWSA 3UD6A 2VCCA 3KW3A 1KRBC 3SY5A 4LYRA 3WF4A 2ZZ3A 1UW9A 1E0UA 1TJPA 1R0MA 1A5SA 2CKSA 2WJEA 4UFKA 3GC2A 3TCSA 3W23A 1XUUA 4FR6A 3ID7A 3AXKA 5HQEA 3LERA 4M7TA 4LW7A 4QIUA 4IT1A 4F4RA 3AAMA 2ZWYA 4K8GA 2GGEA 6XIMA 4NHVA 2YDSA 2PLMA 2D2OA 3OP2A 5H8UA 4PN2A 4BQ3A 4GY1A 3SN0A 5CZKA 2QJHA 5DLCA 4ZZ9A 2JEPA 3STEA 4I9JA 1UJPA 2G96A 1DWJM 4NZ3A 3TYZA 2X05A 3SCSA 1PAMA 3UA4A 2QULA 1AL7A 1EPVA 5LXEA 5C9XA 2J75A 1B3YA 1MQRA 1R5YA 2VD9A 2X1TA 5IM51 2ZC1A 2HSAA 2Z28A 2X42A 1FKXA 2V3DA 3I10A 3FVDA 3DFYA 4UR8A 2YPIA 3N11A 3QV8A 3GO2A 1UKQA 3LHYA 4FNQA 3GTFA 1Z69A 3L12A 1DE6A 1W2VA 3DXIA 2OGYA 4LCRA 1QJWA 1SW7A 3UXDA 2YZ5A 2I56A 1OQFA 2C8NA 4GH1A 4DBEA 1P1MA 2I5GA 3MSYA 3PZMA 3O3RA 1QK0A 5AFDA 2BASA 4FIRA 2CZ5A 2R14A 4JY9A 3AQUA 3UWUA 3IK2A 3GU9A 3W87A 3FFSA 2XZ9A 4UQ9A 3VE9A 5K3VA 4JEJA 3CWHA 3T81A 3GG1A 3QPYA 3N13A 5AYXA 4ZXOA 1XPYA 5LA1A 4C7FA 2ZRVA 3ARWA 4DO4A 3M41A 8XIAA 1XV8A 3OVQA 1GKQA 1P0BA 4HPJA 4UOZA 1S39A 1OFDA 2VEGA 4NI8A 4TVUA 1NTHA 2PRMA 5KZDA 5BMXA 4H9VA 3UPWA 5CEWA 4G7EA 5FEWA 4ZSTA 3ERPA 1QRQA 3B8WA 3W7LA 1C92A 4OGZA 1ZS2A 1REQB 3R6IA 1J0KA 1JULA 2RDUA 3ANYA 3IAPA 4O14A 2INZA 1SR0A 3OBAA 2XSXA 3FAXA 4HHHA 4H9XA 1WBHA 3LG3A 5DO8A 4B9ZA 1FVPA 4ENLA 3OODA 5JMUA 3TOPA 1Z89A 4KS0A 4XBSA 3WO8A 2QLYA 5L9FA 4GQ0A 4HA0A 5AC4A 4W7UA 3V5OA 4A8LA 1YDVA 5J5DA 3EDJA 4K68A 2D0HA 4OBTA 2WM1A 2J62A 3RMEA 5J04A 3KS6A 4OT7A 3PG9A 3WD1A 2QJIA 3F4WA 4WGXA 5DMMA 1IF2A 1B30A 3H2EA 4LVFA 4GUIA 3WDHA 4JIIX 5T9BG 3CGTA 3VIKA 4R9XA 4KBXA 4G2DA 1HJSA 1XYMA 2YJQA 3EPOA 3TYDA 1OWQA 3Q67A 4O1CA 1FWSA 5IHSA 3B0VC 1FDZA 1QHOA 3S5YA 5BXSA 1GQLA 1JJKA 3E0IA 3W74A 3WSUA 2QT3A 4IP7A 1PCKA 2G3MA 2XFRA 5D9OA 4Z2GA 1M9HA 4LWWA 2OEJA 1MZHA 3L4UA 1QPKA 4NG3A 2EHHA 5FCZA 3S83A 4K39A 1PVNA 5CPQA 3B0PA 3W07A 4QBXA 1WZKA 3ARYA 2UY4A 3H8AA 1UH4A 2AGTA 3B0XA 2CLKA 3PPCA 2ZFAA 4LVBA 3W25A 3GVQA 3GFXA 1NOWA 4M8UA 1FH8A 4RDWA 4P8WA 2WHLA 3IS4A 2PB1A 4KRTA 4PFMA 3BJSA 2BGSA 3KBJA 5C5YA 1J79A 2WNWA 2P8BA 1Y8BA 2WW5A 4UQCA 1K8CA 1W3JA 3BSGA 3VABA 1PZ3A 4Z2KA 2CWXA 4KW2A 1XHGA 1KCZA 4M1RA 4AIEA 5C0QA 3CWOX 1J5TA 3EOUA 1DWGM 2RDTA 4A3YA 1F4AA 1X1NA 4U33A 4D6IA 2BVDA 4M6VA 1NWSA 3CLWA 4JTUA 3BLKA 5HWJA 2E6YA 2HBXA 8TIMA 4W86A 1BG9A 4ROQA 1AK5A 4KKXA 1OIFA 4N42A 3ARVA 4QE4A 4Z2LA 3A3HA 3EGJA 1REQA 2JEQA 3L0GA 4NI3A 3GAYA 3QC3A 1V3HA 3VYLA 4I9TA 2IQDA 3URNA 3T1GA 5AOUA 1KB3A 3A9BA 4NJJA 2JE8A 4RW3A 2FTPA 3QGAC 4HGXA 3VIHA 7TIMA 2DIJA 4UNLA 4JTJA 1C8YA 3HTWA 4AZGA 1C9WA 4PA8A 3NSMA 3AS1A 3NA8A 1XIFA 4JQ2A 3MW7A 1A5AA 2O4QA 2BY2A 2QDDA 4X0NA 4F66A 3S1GA 4EF9A 5IHRA 4LH8A 1V08A 3W7EA 2QJNA 2WBKA 4DLMA 2IKGA 1V8EA 1U5HA 3UERA 3BG9A 3H53A 2ZADA 3OLDA 4IUGA 1HTIA 1OVDA 1U30A 1ONEA 1OYAA 3EWWA 2I7GA 4L61A 4GI6A 2E1DA 4DXXA 3P3BA 4B9YA 3SCPA 3ZSSA 6TIMA 4HU0A 3QBUA 4JIPA 3CAQA 5MKGB 1OM0A 4XVEA 3HJZA 3HB9A 3TN4A 3MJYA 5D09A 1BVNP 1NSJA 1Y5XA 2Z6IA 1I6NA 4JQ3A 1SFJA 4AD3A 3A4JA 2J25A 2WNZA 1QNSA 1X8FA 5FJPA 3OHIA 1VFLA 5A6LA 5DX7A 3KUMA 4Y8FA 3W6YA 3VFCA 1VFTA 3MUCA 1S1PA 3G1YA 3DC0A 3WBYA 1AD1A 1XPGA 3SI9A 1B54A 3M4HA 1RBLA 2YCKX 3LA4A 4J9JA 3MY9A 2R8WA 2XH4A 4GC4A 3CEPA 4QS5A 2PDMA 1JQVA 3PUEA 1MDLA 3JS3A 3L67A 1PCWA 4GVIA 1HF6A 2ZWZA 2CITA 2BY3A 1F8MA 2VX6A 2W67A 5LYRA 2X41A 1PDZA 5CPLA 3NZRA 2TODA 1H1ZA 3UJ2A 4BCEA 3AFBA 2XPKA 3SFKA 2VFIA 3NEVA 5HNNA 4PBEA 3QZ6A 1RK6A 4FI4A 1OC6A 3M0LA 1H09A 2J7HA 2VFGA 3NGFA 4AIUA 2FKPA 1E6SM 1SZNA 4U28A 3KRBA 4HMNA 1J9YA 2J7EA 1A49A 3TJLA 3C8NA 3H55A 5D33A 1KM3A 2C91A 1XM3A 2EBNA 4L4PA 4WXZA 5A2BA 4FALA 2MNRA 3DHFA 3IIVA 1E6PA 4WQ6A 3S6OA 1FUYA 4NY2A 3WK2A 1KFJA 3AO0A 3WELA 1EUAA 5BXPA 1EBGA 1FHDA 1YMYA 3HV9A 2YL6A 3B0UX 5GNZA 3QV9A 2ZOXA 1PXGA 5LZLA 4WX2A 2G50A 4H1ZA 1AA1B 4CN1A 1E5NA 4HMEA 3TTSA 1XKJA 3MT1A 3NOEA 3BMXA 5MKGA 2XUCA 3KL0A 5BYWA 3OQEA 3W7RA 1IT7A 3H2CA 3TAOA 4Q7BA 3TA6A 4AVOA 1QI4A 4M5PA 3M0KA 4Q8PA 3W9ZA 3WUEA 5K7JA 4ZODA 1TWWA 3B9DA 1M7JA 4GIAA 1VBJA 2D3NA 3JUGA 4J2PA 2FGLA 4PTVA 3QQWA 1TV8A 5DCDA 1AW1A 4Y90A 2WZHA 4A4AA 3LBOA 3ARQA 4LYPA 1XGEA 1ISXA 2FYMA 3HPFA 4IPJA 3TJXA 3EA3A 3VNJA 1K1DA 2NT1A 3G1RA 1WP6A 4N4PA 4HT3A 1XIJA 1PB0A 3NL6A 2O9RA 1Q6DA 3S2JA 1Z32X 2ZC8A 1TWIA 2OEKA 3P14A 4M19A 1M5WA 3IIXA 4X0VA 1TJRA 4V27A 4P7LA 1YXYA 3R10A 1PWMA 1RBOB 4KRZA 3WX7A 2CFFA 2OPJA 1D7FA 5I78A 3LYEA 5FEZA 5C6MA 3OBEA 3TCEA 3QR3A 1VGAA 3O05A 4XD6A 4MPQA 3BZGA 2OCZA 2YSWA 5FF7A 3W7GA 1TWSA 3VNZA 4AUBA 1TTJA 1KRMA 3K4DA 3UWVA 4C90A 5DRCA 1VYSX 1MWOA 1OFBA 5CLWA 2E0PA 4E4FA 1W1PA 1Q6CA 3CT7A 4U4MA 3LRLA 1T99A 3A64A 1TX2A 3WD4A 3C2OA 1LUCB 1GVYA 1QPOA 4HTYA 2VFDA 3PZGA 2CHOA 2C79A 1SR9A 2O56A 3K8KA 2XVNA 2PC4A 2G3FA 3IJLA 4YHGA 4OE7A 1P6CA 3QJAA 1VFUA 4ADTA 4E0CA 4JBRA 3ZJ7A 1TMQA 1V7YA 1F6KA 2Z1KA 3SQSA 1JF5A 3LOTA 3LMZA 4WD0A 2VR5A 3QC0A 5I3KA 4LY8A 1F3WA 4UTLA 1EKOA 4B5XA 2XWDA 2JIWA 4ZQNA 2JKPA 2OSXA 3PZVA 2AGKA 2E5DA 4FHAA 4TQTA 1OCJA 1YPIA 2J7BA 1TCDA 1X6NA 1M1BA 2Q8ZA 1EWEA 3MC5A 3DHPA 4ACYA 3RILA 4BF7A 1EYEA 2WJZA 2QJGA 3TWBA 4F79A 4H8HA 1OG6A 1W56A 4AX6A 4UTKA 4PUJA 4ZENA 2E9BA 4ILSA 1QI2A 4DELA 3S9YA 1KXQA 1FWRA 1PEZA 3AMLA 2BDQA 4H7VA 1POKA 1PKMA 2YKKA 3PBYA 4J3SA 3PVFA 2GDUA 1DJWA 2YCEA 1V0MA 4ZQCA 2IPGA 1E0TA 4CLMA 4E38A 4MYXA 2JF6A 4DXKA 1KBKA 3A5FA 4UFMA 2QNEA 4Y9PA 3WUGA 3MV01 1IXPA 4JIQA 3QF0A 1TV3A 3QQ1A 3LHVA 1TPVA 5DF0A 3NAVA 1LYXA 2W0UA 3TC3A 4I5UA 5GJNA 2RJHA 1XYAA 4H6RA 3SUVA 3NL3A 4K7VA 2WSQA 2EQDA 2JALA 3OVPA 1CGWA 1NWUA 2VZVA 2ZX8A 1ICSA 2Y8VA 3F03K 1MMFA 2PC8A 3KTCA 4P7QA 1ADSA 5D9MA 1AMYA 2B4GA 1GQJA 2QV5A 2QQ6A 4C7DA 4DO5A 4AY7A 3PZOA 4UTIA 4B5VA 4OJYA 2ZXQA 1C3FA 2XIMA 3CPGA 2J8FA 1ODUA 3WNKA 1R3SA 1M04A 1W9PA 3ANVA 1TCMA 3M0VA 3MSGA 3VNMA 5AHEA 3LI0A 1H60A 3QOKA 3NL2A 4D71A 4JX6A 4Z0JA 3AMCA 4HZ7A 4Y9MA 3F5KA 3BH4A 4ZO9A 5HANA 2TSYA 2PTXA 3TW6A 3EX4A 4GABA 4DUVA 1PO9A 3TSMA 3AUOA 5E70A 1AVAA 3WUBA 4HSHA 4KEZA 3A4XA 1TV2A 3VKKA 1A53A 1D2KA 3NZ1A 2UZ9A 1LQ0A 3PSWA 2J7DA 4HMCA 1QNOA 3V36A 3PR2A 1A0EA 3NFUA 4JAWA 4CNTA 2PDXA 4TX6A 1CTNA 2FFCA 2FVMA 2JFEX 3GM8A 1RLCL 4AWSA 2E9LA 1B0IA 3CK5A 5BU6A 5CQ1A 1GYNA 1Z9AA 4W8LA 4DN1A 3S4TA 1VH7A 3OBKA 1KM0A 1SSGA 1QOXA 4FLOA 4EAMA 4HNVA 3CHEA 1FWFC 3PF3A 3AIQA 3N2XA 2AOSA 5BCAA 2V5LA 1AH3A 2PSNA 2ALDA 2GL5A 4GXPA 4AVFA 2YYTA 3TR2A 4FAMA 1XLFA 3LSBA 1QI0A 2WWDA 1BWKA 4Q8OA 2Q3RA 1K9FA 2QDEA 2XWEA 2Y0FA 4TVCA 1SUXA 3CZJA 1J11A 4DZHA 1XIEA 5HULA 2CLIA 4GUHA 3M5YA 5JXQA 3TYBA 2WVSA 2FZBA 4KWVA 5F7UA 2Z25A 1L6GA 4G1KA 2DW7A 2X1IA 4MFEA 4CU7A 1Q7QA 2DV0A 4H9UA 3BGGA 3H54A 1PPIA 3B9NA 5CH9A 1EJ7L 3CZKA 4LCQA 4M6UA 3WLNA 3PNZA 4NXSA 5FEPA 1BYBA 4HB7A 3L2LA 4MDPA 1L8NA 4K8EA 5HINA 3O2LA 2PURA 5C2CA 5ECVA 5AHMA 3CQHA 1OEPA 4XX6A 1XX1A 3AYVA 3WLRA 1NY1A 3B05A 4YJ5A 1Y5VA 1Q45A 2H8XA 3QEZA 3VNYA 1V6YA 1TPUA 1TV4A 3L5AA 4D6DA 2BS9A 1US2A 2NVDA 1UHVA 4PMXA 4GG9A 2OLSA 1N7KA 2FH8A 4NP7A 1TVLA 3LCXA 2ODOA 1KO0A 2ISWA 5AYIA 3VD9A 3LGDA 1GOWA 1W5OA 3WJYA 3HBLA 1QNRA 1PKLA 2YFNA 3W26A 2ZUVA 3TP4A 3WBXA 1FWHC 3VZXA 3K8MA 4K6AA 2BY1A 2QJJA 4F9JA 1F05A 2WM0A 4GOAA 1Y7VA 3U57A 2ZVIA 3CQIA 2VGFA 3EKGA 2FPTA 3PBUA 4RKAA 2HDJA 1J18A 3T2OA 4ZOBA 3LEPA 2A3LA 3LHUA 3N29A 2V3EA 2ZBTA 4TTUA 3N18A 1EBHA 5DANA 3AC0A 1HW6A 3ZJKA 3N15A 2FVKA 3CUXA 2ABAA 4NJIA 1TB3A 2VXNA 4MLRA 1VHCA 2HPIA 3RPMA 2F6KA 4RJEA 1FWJC 2EG8A 2XM2A 2EPMX 5A94A 3LCWA 1IZKA 1XYBA 8CGTA 1QR7A 3RJXA 1VIWA 4S3GA 4JKMA 3WF2A 2ANUA 5EBAA 3PWGA 4BQ2A 4D9PA 4QDMA 2GGGA 4ZA0A 4DWDA 2DDXA 1ZCCA 2A3EA 5A6JA 4AB4A 3M6DA 1GKPA 1YX1A 5D9PA 4IMEA 1ENUA 3K1GA 3M64A 4Q8NA 4JFTA 4W7VA 5D2TA 3TNBA 3P0WA 4Z2HA 5PTDA 1CDGA 4K2SA 1P6WA 1H7XA 3RHGA 4QJ4B 4JFVA 3WBEA 2QDGA 1LBFA 4H9MA 5RUBA 2P1FA 3EAUA 4LTSA 4FA3A 1CGVA 2OWWA 1UA3A 2MUCA 4PMZA 3N2BA 3PBWA 1QASA 4E6MA 4FMVA 3AIUA 1HKWA 1U2YA 1A5MC 3LX9A 2QR6A 4QRNA 3IJDA 4GO8A 4CD4A 5ABFA 2C19A 1UWSA 2YL5A 3LBMA 1TO3A 2F8QA 4OOUA 3PSVA 4IFOA 3Q45A 3C8FA 1YPFA 4GHRA 1S5MA 2VZUA 3A13A 3CLMA 2DZWA 4IL0A 4CQ8A 2Z6JA 1OGGA 3RLGA 3PNUA 2W79A 3H24A 4J3XA 3OZMA 1JZ4A 3N2OA 1TFVA 1H5VA 1J96A 4Z42C 5LGZA 2OZTA 1WKDA 3L68A 3UR2A 2QYGA 2XN0A 2YCLB 3CZ8A 2V6AA 2PU0A 1IWAA 2NQZA 1ZB5A 1CWYA 4Y7EA 4A6GA 4GZ7A 1QNVA 5IBXA 3IANA 4XAGA 4K8HA 3A21A 2DGAA 3W3OA 1ZP4A 1SO4A 1MXSA 3LRMA 1YKWA 5G2HA 4MMWA 2Z7KA 3C0SA 4RNIA 4CQ9A 4M24A 2TPSA 4J35A 1R3QA 2ZTJA 2BOGX 4PMDA 2VDGA 1NF7A 4BI6A 4TTGA 1SZRA 3S0CA 3V0SA 1G7UA 5A6KA 3TKFA 1W9DM 4UQDA 5HJXA 1X97A 2WSYA 2C6QA 2QUTA 1Q6OA 3ARPA 1KFLA 3CAKA 1J0IA 2HISA 3KBMA 3PJTA 3TVAA 2RGLA 2VZTA 4DBUA 1DJHA 3UCDA 1KGUA 3T9PA 3PFRA 5CBIA 1OCQA 1JUEA 3AI0A 4LF1A 3WK3A 3W7IA 1E3XA 3GTXA 2PDGA 3NVDA 4MPKA 5REQA 4PSRA 2I14A 4CN4A 3QHNA 1VHNA 3F2DA 1RD5A 3KOWA 3S1WA 4N9CA 2J78A 4CQCA 2WYSA 4FF7A 4RXGA 5HAOA 4UQBA 1OCBA 4S1FA 2QGYA 4Q4MA 2QAFA 2V67A 4J27A 4Q33A 1E6XM 1XLEA 2O7SA 3NM3A 2VC5A 2XU2A 1Z41A 1OK6A 1K9EA 1W9UA 4J3VA 3BICA 3L4WA 1H50A 4MG4A 2VO5A 1IEWA 1HZYA 5H8MA 4V2XA 4B15A 4JZ5A 2EJ1A 3VIIA 4FSAA 2PDUA 3CMGA 3LPFA 3U7BA 1EIBA 3GTNA 5AZ1A 2YXGA 1TZ7A 4YCPA 1F9CA 4TMBA 5D05A 1XBXA 4MWAD 5CPSA 4UIOA 1GTEA 3WG6A 2YCLA 4AHQA 1EEXA 3LCIA 4OFCA 2QIIA 2A3HA 4O19A 1AMKA 4IZGA 4UOJA 1G9HA 3KTSA 1ADOA 1WZLA 1JIBA 1YQ2A 3LM7A 3HO8A 3XIMA 4MWAB 3TK7A 2NXGA 1CXHA 2RGMA 1VCFA 1H62A 3W7JA 3CZLA 2VC6A 4Q4RA 1T96A 4Q6XA 3W7QA 1L0PA 3V1PA 2ACRA 4MKSA 4H2CA 1AQ0A 1DOSA 2ZQ0A 3QLLA 4LCSA 1W9BM 1VFHA 4UBPC 1O4UA 3R4IA 2OYKA 2ZKMX 3ZT5A 3GDKA 5A6TC 5HXMA 4J7RA 4Z1YA 4HU3A 2WMIB 1ZALA 1XD0A 3DESA 3AICA 3HM7A 1H1YA 2GGIA 2PLCA 1OJXA 1B3OA 3ES8A 1E9ZB 1VEMA 1WZMA 2G41A 2GQAA 4MFDA 3B9OA 4ZFMA 4QGCA 4NKCA 1QOQA 2O9OA 4Z1DA 1JGMA 4JTKA 5CC3A 1BYCA 4TIMA 2G97A 3APYA 2E3ZA 1UIOA 1FWBC 1X1OA 1PV8A 1JZ7A 2Z7GA 1TA3B 5KMYA 4I7VA 2WPGA 4WVXA 2PZNA 1IZCA 5DT5A 4YTTA 1QAPA 1QW8A 1VS1A 4TOQA 2UV8G 2YCJA 5LIUX 4XZLX 5D37A 1ZPTA 1U1JA 4BKNA 4MKVA 4KQNA 2A6NA 1GOXA 4JTCA 4UR7A 4MDOA 1BF2A 1MUMA 4QG9A 3V3WA 3VU2A 4RDZA 4WZHA 2OSYA 5HR7A 3WDIA 1OF8A 3KDNA 4QFUA 1BKHA 4UTHA 3NQ6A 1O6IA 4OKDA 3N12A 2BNJA 3RPTA 4AFYA 3EX2A 3WFAA 2PI6A 3OZYA 1JG9A 2XGBA 1KW1A 3S2CA 3FK4A 3GR8A 3PTDA 3L0KA 1T5AA 2HE8A 4F8XA 2GJPA 4XZ9A 4JGDA 1OYCA 2GVJA 1V6TA 4NQ1A 1TG7A 5AC7A 3SGUA 1AW5A 3WL0A 3H2MA 4TX8A 1ZUAX 4CQDA 1NWTA 2ADAA 3MWAA 4R53A 4MWAA 4LC8A 2J7CA 1FHVA 1RQBA 2IW0A 3BLLA 5G1MA 1A80A 1H7PA 5HJLA 3ABZA 4ZB5A 3T55A 1D3CA 3LPOA 5EFFA 3WD3A 2ABBA 2A85A 3TN3A 4OQVA 1ZQ5A 4PRRA 1FCBA 1MXGA 2VCAA 4LUSA 4JHOA 4PL2A 2FFIA 3EB3A 4B5TA 3P7YA 4FXSA 1F4HA 1BGGA 2YA0A 3U8GA 5D4YA 4XKYB 2EPHA 3FJ6A 1FCQA 3OQ8A 2ZTKA 3BAYA 3WH6A 2PTDA 5CSUA 3OTRA 1DQUA 3VIPA 1FFQA 2Z27A 1P0KA 1CLKA 3R1ZA 2FQIA 5FJRA 1O60A 1A50A 1S2WA 1A5UA 1TA3A 3UT0A 3PY2A 1N55A 4OZOA 2VFEA 3L4VA 1XD1A 3C6CA 1H7WA 4H9YA 2P8CA 1VJIA 1HO4A 3REQB 1D8CA 5I3HA 1K6WA 3E02A 3DKLA 2RJGA 3K4AA 4E8DA 3QSRA 3DX5A 3TFCA 3MU7A 1C7SA 3AWNA 3TDFA 1UC5A 2NUWA 4RX0A 4DLFA 3UXIA 5HNUA 4QJ5B 3UETA 1C91A 2PWUA 4WJ8A 1XBVA 4GY7A 2QCGA 5HPCA 5AVHA 4Q8VA 3CZEA 4YTUA 2EF9A 3ZVIA 3CV2A 5I3IA 2G37A 3CUHA 4IJCA 2VEPA 3N14A 1XIGA 4GKLA 1QMLA 1NOFA 2XN1A 2AAAA 3MJMA 2PF0A 2R24A 2PDPA 1J5SA 3SY1A 1NFBA 1S1RA 3QY7A 1JXKA 4JOMA 4K3ZA 1M03A 1CECA 1QBAA 2VUYA 2EPNA 3T0DA 1E0XA 1XW8A 3FAWA 2QS8A 1MRQA 4R7WA 3BMWA 3W1TA 3G77A 3GWQA 3F7JA 4MY1A 4HA1A 3B8TA 2PDYA 5I23A 3EA1A 1X1ZA 3R94A 4GZEA 3S6DA 1GZGA 3W7HA 3MDWA 2Q6ZA 3TW7A 1IEVA 4IIDA 3VFLA 1NDZA 1FCVA 4W88A 2XH2A 5CGTA 3P8IA 5TD4A 5AC5A 3PUGA 4GVHA 3FSUA 4GY0A 1EJVC 3CNYA 2ISDA 4GACA 1VFMA 1BXBA 3OIHA 3N9KA 1H7OA 2YW3A 1RVGA 3R11A 4EPBC 2PTWA 3M0HA 5HUOA 2XGZA 1XC6A 1XL9A 5I3JA 1GWJA 1R3WA 4OBSA 5A8PA 1B31A 4G6CA 4RE4A 5EU9A 1VLIA 4HD5A 4AZ7A 1O1ZA 3NQGA 3HJEA 4MIMA 2PDFA 3O06A 4I6VA 3WQ6A 1EWDA 1F5ZA 1M6JA 3CO4A 3REQA 3IARA 2C1IA 3CV7A 3A47A 4FXFA 4H01A 1OIMA 1EJRC 3WJWA 2WBGA 3ZJ8A 1W1YA 2QF7A 2I9UA 4Z1BA 1EF2A 2WV8A 4QJ1A 1RQHA 4Y8EA 5C55A 4WDWA 3WLMA 2WLYA 3C0LA 2UWFA 4REQA 4XWUA 3W2UA 1FWIC 3OZPA 4L5ZA 4CGTA 4MAZA 4OV9A 1QW7A 3R8HA 3PJXA 2JKAA 3CT2A 5I24A 3C52A 1DP0A 1ZSXA 3GD6A 3U7VA 1H51A 4KEVA 3V35A 3N4EA 3CB3A 5KETA 3WUFA 4M82A 3VM5A 5HJYA 1VIZA 1VRXA 3IGHX 2PA6A 5B7YA 5I7GA 4S3AA 4MGGA 1H4PA 3NPXA 1B3XA 1BF6A 1M7OA 5EB8A 5LIYX 4CD7A 1JF6A 1PHQA 4BWLC 1JPIA 3DBNA 2DVUA 1VPQA 1EXPA 3PJUA 4QX4A 3W1LA 3CHFA 1MW2A 1KLZA 3G22A 1K03A 4JIRA 4MJ4A 8A3HA 2DH2A 5BXTA 3IVUA 3NQMA 1ZJHA 1K70A 1LM1A 1I75A 1KM4A 2AMGA 3PZTA 4RUBA 3HF3A 1SVDA 3I3EA 1RH9A 2HMCA 4QSFA 4ZO7A 2X1UA 1L6YA 4N9BA 3RO8A 3N6QA 4BI7A 1SFLA 2G95A 5D02A 7XIMA 4QNWA 2Z00A 2J47A 1H2JA 4AD1A 1DIKA 4NZCA 1TJ1A 1BSLA 4HHPA 3GG7A 1GVOA 1IT0A 2DQWA 2Y7EA 1LQAA 2OX4A 5C70A 3W82A 4QS6A 1NH6A 1I0DA 4D1IA 3BTNA 2FHFA 4L56A 2QCDA 3AXXA 4JIHA 1JZ3A 1VEOA 2YBVA 2WKJA 3IJ6A 5EYWA 1OGBA 2C0AA 1F3TA 4MUPA 3V5FA 3G8RA 4Q7NA 3VXGA 4MSSA 1US3A 3KL5A 4ICNA 4MOZA 3MKCA 1JCXA 1PIIA 4L1XA 3OEXA 1UD4A 2V2CA 3WNOA 2GUUA 4XO7A 1EDQA 1L2UA 1BYAA 1EGMA 4LV9A 3PPGA 3L9CA 3D3AA 5A5WA 2PU1A 4WSHA 3NDZA 5CSSA 4BA0A 5HK4A 2OG9A 2G5WA 1ITCA 1J0YA 4PE8A 1KQYA 1W3TA 2QCMA 1P6BA 2NVAA 2FDSA 2GJLA 4DJFA 3OVRA 3HURA 1R3TA 2FPYA 3RITA 4LVDA 4XSLA 3PZ9A 3B8SA 4GYPA 4NRSA 3SECA 4Q7IA 4O8RA 3PTQA 4RDYA 2NQHA 3VUSA 3V16A 1LBLA 4XZIA 4QE5A 1GHSA 3T0TA 3CV6A 4PMQA 5A6BD 2CERA 3GHTA 1QHPA 2Q8XA 3G1DA 4JR5A 5I79A 3VNLA 2ZA2A 3ZT7A 2GVGA 4ATDA 3FJ4A 4E3VA 1H41A 5AHNA 4N7QA 2EO7A 4DUOA 3GVVA 3KHDA 2YX0A 2PDBA 3QR0A 1GHRA 6ENLA 3OIXA 3U6WA 3FIGA 4MZ1A 5EFDA 4S3CA 2PUZA 2EPOA 4R34A 3PZIA 2G4FA 1DBTA 4RV8A 4HNOA 3TYEA 4Q4QA 4ASTA 1CI1A 5C54A 4LAOA 1KD0A 1E43A 2VC9A 4GX8A 2QUVA 5D2XA 5DY3A 2ZRYA 2PCEA 3UQNA 5XINA 5GPRA 4F2UA 4O54A 3SM0A 3DU0A 3ZM8A 1S2UA 3S46A 2OR2A 4LSBA 2OT1A 3HGJA 5F4SA 3WJSA 3FGCB 3FEQA 3URBA 4UFHA 2WMGA 1TV7A 4CCCA 1P4CA 1KKOA 3W02A 1XBZA 3ARXA 1SO6A 3SRKA 3KL3A 2Z24A 3RX2A 5AZ0A 1KFKA 1EB3A 3W7MA 2PF8A 4Y9NA 5E5CA 3UEQA 2HJPA 3M46A 3MV11 3QM3A 2ACSA 5CPTA 5JU6A 3MUZ1 3HGRA 1QT1A 4RNHA 4Y96A 3EKZA 2PDHA 4DWSC 3NDOA 2FLIA 3W7OA 1XDMA 3G24A 3BCDA 3TJ4A 2DZXA 1JNDA 3KLLA 4C1NB 3W2MA 3HPAA 2Q8LA 2F7FA 1G01A 1W37A 5D2VA 1PTDA 4INFA 4FNUA 2DZVA 3CAWA 3VOJA 4PR4A 1BFNA 1A5NC 3C0QA 3LB0A 3CL6A 3AZTA 3RR4A 2E67A 1H11A 3CQJA 3GXNA 4O1BA 1E9IA 4UCGA 1IV8A 3AXMA 4GXWA 4Y9OA 3GU1A 2XVLA 5A2AA 1XQLA 1OX5A 2Z29A 3TJIA 1IYXA 1XYLA 3FHQA 3LZ3A 1MEIA 5SWUA 1YDYA 2A79A 3M0ZA 3LGGA 2Y89A 4PEEA 2I5QA 2BMBA 2XIBA 2CBJA 4K36A 1VBGA 1EQPA 2IXVA 2IKJA 4YIWA 4N6FA 1Q65A 3FLUA 2ZX6A 2DZTA 4W4QA 3INPA 3O6CA 1Z42A 4H6EA 1M3UA 1BTMA 2OU4A 1TPFA 3II1A 2C3ZA 5BOEA 1QPNA 3WF3A 5A2CA 1CCWB 3K5XA 2NT0A 4WHBA 1EDTA 2WXDM 1S5NA 1R86A 2I5IA 2YR1A 1LOSA 4UC5A 1JD7A 3B8UA 3P62A 3VGFA 3VZZA 1EJSC 2O92A 2HXTA 2QVHA 4RV3A 2Y4SA 2V9DA 1M7PA 1TIWA 3TWAA 3FGCA 4IP5A 2V68A 2G3JA 2H6RA 3M44A 4TV6A 4LUTB 3S5OA 1W5NA 1F2JA 2PWVA 1V0NA 1MI3A 4LV4A 5IFPA 7TAAA 1O5RA 1A3WA 4O28A 1DJNA 1W6TA 3GB6A 4C6OA 4CD8A 4ICMA 1ICQA 1CXEA 1XDJA 1M68A 3ABRA 3IJIA 3TTOA 5FJIA 3UU0A 3GVWA 1T0OA 2OQHA 5GNXA 4MWAE 1AJ2A 5K4ZA 4FNRA 3GZ3A 3Q65A 1VRDA 3EXRA 3IVTA 3OA5A 4C1NA 1G0CA 4A3HA 1U33A 4PSPA 2VX5A 2IKIA 2ZZ2A 3CH9A 3UWWA 4PYSA 1XLDA 3A22A 5G1TA 1OFEA 2WVTA 3UY8A 3MUY1 2D73A 4AC7C 4IG2A 4CQBA 4LYQA 1WBJA 1NOUA 4D8AA 2AQVA 4PBGA 4DJEC 2DORA 2C18A 4F48A 1JVNA 3GXFA 4IM4A 1JNEA 4KT2A 2IQ0A 5HBFA 3UG4A 4O13A 3O6DA 1ML1A 1PWLA 1DWFM 1JXJA 4R33A 3RJYA 4XD4A 2XYLA 4HZMA 3RCNA 3G6LA 3F2CA 3QYSA 1GQIA 2NZLA 5H6HA 4V1YA 4PTDA 2WLZA 2H8ZA 4HKPA 2D2JA 4BZYA 3J7HA 1KM6A 1UIPA 3W38A 1UCWA 3AJ7A 1OYBA 1A3HA 2J9ZA 1VEPA 3O6AA 5AN7A 4DZAA 3VMOA 4HYVA 2Y70A 1XSIA 2NLYA 5C9ZA 1LWHA 1XLKA 1I0BA 3GHSA 1ODZA 2NXIA 4CEXC 2ZZ6A 4Q4KA 2P5NA 3YPIA 2QCEA 5A6MA 2WMJA 3RLVA 4J40A 1UC4A 2A7RA 1OINA 4XZWA 3CXOA 4LNYA 2A6LA 3KTXA 4XAPA 3IPWA 1NDVA 2BXZA 3QOMA 1O5KA 3KEHA 2DFAA 1HL8A 1LL7A 2F2HA 4XTIA 4QLLA 3S42A 3SADA 4JX5A 3G2GA 5I00A 2BSLA 3TV8A 3U5YA 5LNRA 3R58A 1FRBA 3UZJA 3SUUA 1RY8A 4B5SA 3BE7A 4EP8C 1UKOA 3LTSA 4S39A 4RE0A 1E1FA 1MEHA 1QDSA 1DWHM 3CM4A 4DO6A 4AZCA 3WMLA 4ALDA 2FZDA 3T44A 1UWIA 4YU1A 5AHFA 2PWFA 4KGLA 1ZJBA 3RLUA 4C6LA 1S2VA 4I5RA 4ZQMA 2VHLA 4P61A 4KFNA 2CLPA 1W8SA 3HGOA 1IR1A 2BVYA 2DSUA 5HWNA 4B4FA 4N6EA 4RPQA 3M5ZA 3S5SA 3MUIA 3MSRA 2WC3A 3C0JA 2IPWA 5FAGA 3DYOA 2VDHA 3QR1A 4HSOA 1SJCA 4PTWA 4NVTA 3WCZA 4BQ4A 4TX9A 4KGJA 3BDKA 3PK7A 3N17A 1TELA 5E09A 1YIXA 1EP3A 1FCUA 1UYQA 4M81A 1N8WA 4ERAA 4GXMA 2EPLX 5IRPA 1FHLA 1FKWA 1WXJA 4R9OA 2P53A 3ATZA 4FXJA 4RL3A 3FHAA 1J4EA 1POJA 4Z2JA 3SRFA 1ME7A 4U3CA 3KBNA 1R2RA 1QOPA 3VVGA 3H26A 3H2OA 3WNNA 3TE9A 3QGKC 1V51A 4WLCA 1RHCA 3QPEA 4F2BA 5CBBA 3TLQA 4BS0A 5M1TA 2ZUNA 3FYYA 1OC5A 1LF1A 3ITLA 3W81A 1EXBA 3S1UA 2PP3A 1V77A 4N4QA 3SCVA 4Z0SA 3GNPA 1BVWA 3QKZA 2CLFA 3UW6A 4LY4A 4C6EA 4C6MA 2CIPA 1SFTA 1JD9A 1E55A 1AUSL 3MSDA 2X7WA 1Z44A 3FA5A 4P2VA 2V2DA 4W9TA 4UTWC 3B06A 1EO5A 4AXKA 1X98A 3LPPA 4NL1A 5F1VA 3A24A 1N8FA 1UQYA 3DHDA 4AWTA 1QO2A 4ZOCA 4ATWA 3SCTA 1GVRA 1W5PA 2VKZG 1K7EA 3ZQ9A 4UUIA 4NX5A 4ZE5A 3TNOA 3R5EA 4GQGA 2XIQA 3LCGA 3I7SA 4HPHA 3DCPA 1S3HA 3LNPA 4QQ3A 4GQRA 3SAZA 2XDFA 1TPB1 4ZVJA 3P61A 4DEFA 1E9YB 4QCFA 3N04A 2CXEA 4JHMA 5E1QA 1SO3A 1WPCA 4RCXA 2PFHA 3WJXA 1IWBA 4LEQA 1OBAA 4NSBA 5FD0A 1JUKA 3DZ1A 3I65A 4HK7A 1WA3A 4FK9A 3WQGA 1IEXA 4HNCA 5HA7A 1QCWA 3FKKA 1IHIA 3F4VA 3U3HA 1XCFA 1LRTA 2Y8KA 3PB2A 3I7RA 5HPOA 3CYVA 3PTMA 1VAHA 3LGEA 4GYJA 2EEXA 2WSPA 4K1GA 2EKGA 5C9WA 4L4LA 1XRSA 3I4EA 4HCDA 1I4NA 1OHLA 1DXIA 4DRSA 3LV6A 4GVFA 3WEOA 2BGNE 1LLZA 1JL8A 3A9IA 3ZFHA 3H7RA 1LWIA 4IXXA 4DUXA 4O1FA 4AZ6A 5DXYA 2O9TA 3BLIA 2XISA 3G0SA 4V28A 3POHA 3QW4B 3GVRA 3ITTA 3O0KA 1P0NA 3IV3A 4RK8A 3WQFA 2ZUWA 2PTYA 3OU8A 3G1HA 4PUDA 1V6XA 3RO6A 1MNSA 1WDSA 3S2MA 3ZWSA 2OLAA 1TPC1 4KWSA 2YLAA 3NVTA 3W2KA 1KM2A 5HUPA 1RD6A 3BQ5A 3FV9A 4KWUA 3BC9A 4H4IA 4AIOA 2JGYA 1UA7A 2YFOA 1YXDA 2EPKX 4GWEA 2PS2A 3AMDA 5A8QA 3UG5A 1YNYA 4GVGA 3GDMA 1W3KA 2UY2A 2F2KA 2CZVA 1GORA 5CPMA 3I6RA 1TX0A 2NUXA 1XLIA 1DV7A 3SIMA 1OFAA 4M3PA 2Z2UA 1PIFA 4HN8A 3N6HA 2XFWA 1S3TC 1XSJA 2R1KA 4IPLA 3WLIA 3GDTA 1F74A 1SJAA 4MJZA 3N4AA 5BRPA 4D2JA 2YCIX 5BXRA 4NASA 1XLMA 3LDVA 3MP5A 4XKMA 4DPPA 1EA9C 2DVTA 4BY3A 3MZNA 4XB3A 3O8AA 2OXNA 3VNIA 3VTRA 4JNZA 2G8ZA 2YB1A 1VBRA 3AIWA 4OOZA 3B3DA 3WLKX 1Q2SA 4L80A 4S2CA 4Z08A 2XJ7A 3DC8A 1NIUA 1SZFA 4NJKA 1E40A 3RXZA 1HFBA 4HCHA 4BR1A 1A5CA 1UUOA 4AU0A 3GG0A 4A3UA 2QCFA 2CLLA 4YMZA 2WOQA 3WQOA 4MTVA 5FOOA 4FOKA 3BW4A 4GLEA 5D2WA 3CO8A 4W87A 2W6RA 3VDBA 4C6CA 2O55A 4M0XA 3AISA 1LROA 4DPQA 5C8BB 3WDRA 5D30A 2FMOA 4UMAA 2CWNA 5BMWA 3O63A 2DZAA 5C9UA 1JI1A 1S5WA 1TSIA 4AZ5A 1YDOA 3B40A 1O1HA 2BHUA 1JAEA 1EX1A 4POCA 4IGMA 5H2ZA 3HQNA 3AZSA 2FZMA 3QTGA 1Q7ZA 3B8VA 3G3DA 4HNUA 2YDRA 4PMVA 2OFJA 2A4AA 2FB3A 2ZXBA 5E0CA 4B3LA 3R0KA 2HS8A 4OUIA 5KEZA 1MEWA 5A1AA 2DUZA 4D8ZA 1V02A 4ERIA 5E9XA 2Y61A 5ABTA 2BB0A 4ZR8A 3LY0A 2ZZ7A 4CCEA 1BHGA 4ZXLA 1DIDA 4D6HA 2DPEA 2XGIA 1MRAA 1GNXA 3TXZA 4W84A 1UH2A 3WLQA 4PBFA 3LLDA 4DI9A 1ZRQA 4TXEA 1R3YA 4KFOA 4JKKA 3EEGA 1G67A 4KESA 4DF2A 1O94A 3RU6A 1P0DA 3V0UA 5HMSA 1DL3A 3AALA 4A3RA 3PM6A 4C1KA 3T07A 3ITOA 2EJAA 1EC7A 1TTQA 3MDUA 2PLKA 3NL5A 1Y65A 1WDPA 4DNHA 3W6MA 3WEZA 3TAKA 2ZRZA 4IQLA 1BQGA 1H1NA 2X0YA 4F0LA 4IMDA 3UWZA 3A4AA 3GKFA 1ADDA 1XLBA 3SURA 2GLKA 3WL1A 3W27A 1VYPX 2V3GA 4H19A 2Q71A 4JIEA 2F6XA 2VZSA 1G5AA 3A3XA 4XAZA 1R87A 4GFIA 1O66A 4LFYA 2WJFA 1WUFA 2YLLA 1Z7AA 3KBWA 2Z1XA 1E0WA 3MANA 3G0UA 4C6BA 1B5TA 4FIQA 1V3IA 3E5BA 1XF0A 2IPJA 2VQTA 3VOFA 5F2MA 2C16A 4UNKA 3KE0A 3W4RA 3KZSA 3PWIA 2B7PA 3C2VA 4CD6A 1QU4A 4XIAA 3BXWA 1YXCA 3XISA 4YVPA 2QCLA 1VBUA 3TQ0A 1TMHA 2DY3A 5T9CE 3ELFA 7A3HA 2XSAA 1TZZA 3N1AA 5CG7A 2BP1A 1CNVA 3L5MA 4FO4A 2QUMA 5M17A 3SRHA 2A2IA 1ELSA 4XUGA 4QTGA 1B3WA 3WLJA 1CX9A 3CL7A 2RFGA 4YTQA 3EMQA 2CKRA 2ISVA 1JPMA 2XVGA 3R25A 2Y24A 4Q8TA 3OHMB 3VKJA 4AZBA 4CUCA 4HIBA 3UXAA 4K7YA 2D0FA 3ZT6A 3UG3A 1PE1A 2FZ8A 1B4KA 1MW3A 3G8EA 1ZU8A 3RPDA 3BSHA 5IDIA 1NU5A 4NIRA 2D22A 3GYCA 2VELA 3WK0A 1CBGA 5JBFA 3EBVA 2XIIA 3D6NA 1RSCA 1J2BA 1JCNA 1KV5A 1AZ2A 1EL3A 1TREA 2PPGA 4R7OA 4GK8A 2WAGA 4DJDD 2AKZA 3H21A 1FWGC 3LM3A 3MCNA 3MYOA 5HNRA 1GJUA 1LZOA 3QPZA 4A8RA 3ME3A 3A6OA 1CEOA 1T6MA 5BOFA 1VLWA 4ZB0A 4Q8WA 2PLJA 4LANA 4UWMA 3DFQA 4JNMA 4O1DA 3IJ9A 4PGLA 4DAFA 2P88A 2X0HA 2DU2A 4WDUA 1HX0A 1EJWC 3QHOA 5GNYA 1OCNA 3AIBA 2OO0A 3C2FA 1PJ9A 4F9DA 4RE3A 5EMYA 2ZUSA 4HK6A 3W24A 1LLWA 2Y85A 3WLOA 5DQPA 3THUA 1OFOA