3GNDA

Crystal structure of e. coli lsrf in complex with ribulose-5-phosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
280
structure length
276
Chain Sequence
GKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVVRDQRYFSLATRIAAEMGAQIIKTYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Escherichia coli autoinducer-2 processing protein LsrF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Aldolase lsrF
total genus 91
structure length 276
sequence length 280
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gndA00
3W1QA 1FDYA 4TU1A 3NVTA 3PF3A 4KFPA 3S0CA 1EWDA 2Q8ZA 2NXGA 2HSAA 1S5TA 3QW4B 3NPUA 1GVRA 3JS3A 3I65A 3N9SA 3R89A 3UWZA 5AHEA 1AW5A 3NQDA 1SZEA 4JYEA 2V2HA 1I2OA 3LI0A 3HOJA 3GDKA 3TIMA 3NQFA 3Q37A 2JGYA 3UZ5A 3KOFA 4GNJA 5HWJA 4A29A 1H1YA 3IGSA 1V7YA 5U7SA 3K30A 5C6MA 1C29A 1U5JA 3UY8A 3C2VA 4MLJA 3MYPA 2QCFA 3PB0A 4WY0F 3QM3A 4N9BA 4MKNA 3GAKA 3KVLA 5DXXA 1PE1A 1YXCA 3LI1A 1VZWA 2O7QA 4O52A 4JNMA 5F4XA 4C1KA 1GG0A 1DORA 2QCNA 4WY0A 3NXFA 3HPSA 3SGZA 4W9TA 3O16A 3QPYA 3OVQA 1RPXA 3WK3A 1UASA 4M6QA 3CHVA 4LRTA 2VEIA 3BLFA 1YTEA 4ORMA 1TPDA 1GVQA 3LCIA 2V81A 5DY3A 4IMDA 5A8GA 3SSJA 5F2GA 8TIMA 3LM7A 4ZQOA 5DCDA 4WJEA 5HUOA 3ABSA 5FEXA 5HWMA 3G8EA 3FFSA 2KZHA 1K7XA 4CNNA 2PCQA 3G1FA 2ZRYA 4K36A 4ZQPA 3LRKA 3M43A 4O17A 3P80A 4E2DA 2WKJA 4RK8A 1SO3A 1EX5A 1YLVA 4MYXA 1H7RA 2EHHA 3S1XA 1R2TA 3IIXA 4PA8A 3BG9A 2QUTA 1OJXA 5EMUA 3R5EA 4LVBA 1Z44A 3EWYA 2Y63A 4O18A 3M47A 1IIGA 2RDUA 4XZ9A 4FIRA 1QPRA 3B03A 2V5LA 4FB7A 2CZFA 2VFHA 2ZZ6A 3M44A 4HIBA 4IPJA 3OIXA 2BWGA 3L2IA 3NM1A 1YDVA 1R47A 3G1XA 5BMWA 5SWUA 5F4WA 1F05A 1WA3A 5AC6A 2ZZ1A 2ZZ3A 1VHNA 4BI7A 4IMFA 4O54A 4FNQA 2RFGA 2TPSA 3N34A 2E09A 3LXAA 1TIMA 4RLIA 1VHCA 1KTBA 5CZTA 2B7QA 2E1DA 3F03K 1SR9A 3BV4A 2XN1A 4EF8A 3GXPA 5AHIA 1HFBA 5D2VA 1SO4A 3RNDA 3G24A 2C18A 1LORA 1OYCA 3DFSA 1NF7A 4M19A 3HQ1A 2F7FA 1YADA 4WOQA 2H3BA 1SFJA 1M7OA 3W70A 1TSIA 4HPJA 3BARA 3M5YA 4KFOA 4R34A 4O16A 3CIXA 4HNVA 2GUUA 3MI6A 3P61A 1L6SA 3TJLA 3KX6A 5AYYA 5J5RA 3HGSA 1XUUA 3FKRA 4WX2A 4JX6A 4PEKA 1VJIA 3R2GA 4MUZA 2PURA 4K37A 3LHUA 4IQLA 5F1UA 3OA3A 5K9CA 5DN1A 2VFFA 3IV3A 3W1LA 4NJHA 3L5AA 3LOTA 4IX2A 3LCLA 4ORIA 4EOUA 1VQTA 4MOZA 1YTDA 3KFTA 5E0KA 5EBUA 4LS2A 2E5BA 1UCWA 4NJKA 4ZQCA 2ABBA 3GKFA 3ABOA 4IGHA 3CQ0A 4NXSA 4QNEA 3W7HA 3DHDA 3WK2A 2DJXA 4X22A 3NPVA 3F1QA 2YDAA 1YXYA 3LBMA 4UTHA 3I68A 1N8FA 2FDSA 1GTHA 5D2TA 1O4UA 1OYAA 2OZ0A 3OHIA 4YWIA 3QRHA 5IM51 3EWUA 4EF9A 5HULA 1T8XA 2X1SA 5U4NA 4JX5A 3PM6A 3RFAA 1OHLA 2WSQA 3S8HA 2ZA2A 2GQAA 2Z0IA 4N4PA 3QQ0A 5K7JA 4LUIA 4BR1A 2A85A 1AG1O 3C3NA 1OX5A 1FBAA 4NJIA 3NQ2A 4AB4A 3GDMA 4BFAA 1PCWA 2AQWA 3DH7A 4ZQRA 1HO1A 1KM3A 1GTEA 3T40A 2ATSA 1VLIA 1FWNA 3M1ZA 1WOAA 5FF2A 4NZFA 4RJEA 3Q94A 2BSLA 1RZMA 3W7PA 1F2JA 4JR5A 2J9XA 3LCWA 1L9WA 4K38A 1W3IA 1AMKA 1TPUA 3PY2A 2E5CA 3C2EA 3G3MA 5DXYA 3W72A 3QSTA 3CLMA 2ZRWA 3BLEA 3G3DA 4NQ1A 4O57A 4ADSA 5H2ZA 5C54A 3VI2A 2X30A 3BVJA 1KA9F 4HNNA 1VGAA 2VFEA 3DFOA 1XBVA 4IPIA 2YFNA 3NQMA 1DJNA 1F76A 3UQNA 3EWZA 1GZGA 3SI9A 3L0NA 4CQAA 1LLWA 1SZFA 2HS6A 4UTIA 1MSSA 3UXDA 2VEPA 4JX4A 5CKSA 2J27A 3EXTA 5BMXA 2FPTA 3P62A 1SQ7A 1DVJA 3W2MA 3TUUA 5EYWA 2B4GA 5D2XA 3EB2A 2DZTA 1TO3A 4U28A 1I2RA 3UYCA 1J2WA 1O94A 4JTGA 1JQVA 1W5PA 1FX6A 3MW7A 2CLEA 1W8SA 3LHYA 1HO4A 3QZEA 4UTWA 4AHPA 1BTMA 3UWVA 3A24A 3DKJA 3F4NA 3DI1A 1X8FA 4UTJA 1QPQA 1SPQA 4DELA 1HL2A 1H61A 3ANYA 4QNWA 4QAIA 3B05A 3PG9A 2YYTA 4N9EA 3W76A 2NXIA 2NV1A 2WJZA 1F5ZA 2W6RA 3PB2A 3W7MA 3UD6A 4JTEA 4ZZ9A 1TV8A 2QDHA 3DI0A 1PCKA 1RVGA 2Z2UA 3B0PA 1OABA 4K39A 3W1PA 3N9RA 4N4QA 3MHFA 2OX1A 3KVMA 5MHBA 3W6YA 3GVGA 4LVAA 5LNRA 5LGXA 2ZYFA 3CWOX 3CWNA 5I3KA 1DQWA 4IX0A 2AAMA 2QCGA 2LLEA 1D3HA 2ZA1A 1OFAA 4IMGA 1A5BA 1OFQA 3MI2A 4LVFA 3NNTA 2NX1A 2OT0A 1QWGA 3LXBA 1WDWA 4R53A 1FY6A 4CNOA 1OX4A 2X16A 3EX6A 4MZ8A 4GWEA 3TC7A 3LHVA 3G1DA 1XM3A 1QDSA 1M7PA 1MEIA 3MP5A 1GG1A 3DAQA 3EX4A 3LCXA 4HSNA 4Y90A 1EPXA 1GQNA 1WYIA 4B5NA 3W2KA 4QITA 4CQ9A 3W7CA 5AHFA 3PBVA 1WV2A 1ZNNA 4OHQA 3GDLA 3EWXA 2B0MA 3GXTA 4YXGA 5D02A 1OFRA 2YCEA 1QOQA 2ZRXA 3PR2A 5D30A 1CW2A 3C0JA 1KFCA 3W2LA 5G4WA 3UWWA 5I3IA 4EWND 4O12A 1W0MA 3W86A 4QSHA 1KM0A 2JGQA 3TMQA 3C4UA 2DU2A 1MXSA 3W7IA 2W79A 4OWGA 1KBIA 2JBMA 1HUVA 4O19A 1KLZA 1IXQA 4ZQMA 2G5WA 3N2XA 3LHWA 1I45A 3SW6A 3NDOA 3W88A 4NNAA 3G0UA 1G7UA 3SR7A 3TE9A 2CW6A 3TSDA 1EP1A 2C6QA 3NQAA 4WUIA 2OT1A 4J9JA 5LNVA 4ZQNA 2WOQA 1XKYA 3QEZA 4CNPA 3NQGA 3TMLA 5FEZA 1LBLA 1PHWA 3GDRA 1W56A 2P0OA 4MYAA 1TPC1 5KZMA 3KVKA 3CB8A 1B9BA 1SW7A 4JDBA 3M5ZA 4RZ4A 5K4XA 2Y61A 4LRSA 2ALDA 1SO6A 3B0UX 4EIVA 2NV2A 1RV8A 3HPXA 3TC6A 2ZZ7A 1H5YA 4Y8FA 2ZRZA 1UB3A 3GNNA 4FX7A 4XQ6A 4Z1AA 4KKXA 3LV6A 1THFD 4FNPA 1IGSA 4M6PA 3L66A 4XUGA 3TV8A 3NO5A 3OVPA 3TFCA 3NQVA 5AC8A 4ALDA 1V5XA 2NLIA 3STEA 4BK9A 3S1VA 3M7WA 2ZQ0A 4Z08A 4DO6A 1LRNA 4AHOA 2JKPA 2GQ9A 3HG4A 5C2XA 2OMAA 1EP2A 3I7QA 4JY9A 3L5LA 1JCJA 1DQXA 1LTDA 4WXYA 5EY5A 1FXPA 4AH7A 2VKZG 2ZCGA 3HB9A 2WPBA 5GVJA 2EGZA 2NXHA 2QR6A 4Z1DA 1NVMA 3L0GA 2DZUA 3T78A 1JULA 4LUJA 1K8ZA 2PRHA 2VFIA 2CU0A 4GE8A 5AFDA 3DZ1A 2P10A 1IF2A 4C1LA 1FCVA 4OGZA 2TYSA 1TV5A 3MP4A 4DF2A 2R14A 3NGJA 1BKSA 3FEMA 2E5DA 3TCEA 2GVGA 1X7FA 1TYGA 1BWLA 2WO5A 2Y6ZA 3UWYA 4RV8A 3SY5A 3RU6A 4M5PA 3B0VC 4I7UA 5TQLA 1FWSA 3B4UA 3P81A 5KITA 2CWNA 2Z6IA 5AOUA 4UFHA 2NX9A 3NQ8A 4UTTC 5KZEA 3T55A 1OFEA 3TXVA 5ABTA 3ATZA 4AXKA 4UMCA 3IRDA 3O6DA 4X2RA 4EVZA 1KLYA 3O1NA 1K8XA 2WSYA 4Q4KA 3W74A 1TV7A 3WJZA 2QJHA 3O07A 1PV8A 4S2BA 1QAPA 3TAOA 2QCEA 2QCDA 3E0IA 5HINA 2EF9A 4OV9A 3V1PA 5F4SA 3RK8A 4DPPA 3QPZA 1WBJA 4XKYB 5LNWA 4ONVA 1TTQA 1VPXA 4NZJA 3HO8A 1JVNA 4CCEA 1ZHAA 1BEUA 1JUEA 4HNUA 3MUXA 1QPOA 3GKAA 4O0ZA 3G18A 2GPTA 3OG3A 4U4MA 1UJPA 4UMBA 2QF7A 5CPLA 5G2WA 4LY8A 4HNTA 1ICPA 2FPYA 1I2NA 3B8DA 2B7NA 3W7GA 4TMCA 4CCDA 4MY1A 2YW3A 2C15A 3N3MA 1G4SA 4PFMA 3C2RA 1Z48A 5G2HA 5T26A 3R13A 5BOOA 1K02A 2Y7GA 4A2RA 3M0ZA 4PL1A 5A5WA 4N9CA 2JKAA 3BLIA 3NQEA 2E6YA 3UPBA 1S5VA 2BXVA 4Q32A 3HBLA 2Z1BA 2V9DA 1XBXA 5CPMA 3E49A 2YX0A 3USBA 2DZVA 1KFEA 3H53A 5K9XA 1WXJA 3ELFA 4O1DA 5E93A 2JK2A 3BGJA 3E02A 4I9AA 3M41A 4AAJA 3CM4A 2YSWA 4JDYA 3NL3A 3NEVA 1TTJA 1IXNA 3BPWA 1LOQA 2WV8A 3W7JA 1TPFA 3W2JA 3O6YX 1TCDA 1ME7A 1O95A 3WJXA 1OFOA 5TBOA 3BW2A 3TQ0A 2QCDB 1YDNA 4FNUA 1VYPX 4PC8A 5FI8A 4GUJA 3VE7A 4O15A 5DY2A 4UMAA 4JGDA 2FFCA 1YXDA 1N7KA 4P61A 3TFXA 3QMRA 4Y96A 5FF4A 3TNOA 1H7XA 1QR7A 3W1UA 4MIMA 3AJXA 1Z41A 4RXGA 1EB3A 4QIUA 3G1YA 5D38A 3A23A 1IIHA 3B04A 3EXRA 1W54A 1XCFA 1A53A 2PC4A 2TSYA 3N73A 4UUIA 1KW1A 4YLWA 3UXAA 3LX9A 5DELA 4KWWA 1ZAIA 2BTMA 1OK4A 3KRUA 2Z6JA 5IBXC 1LP6A 3TSMA 2V2CA 2A5HA 2E77A 1W5QA 4WZHA 3PUDA 3SZ8A 5HNRA 3TQVA 3DFPA 1AW2A 1JRBA 3HG5A 3O63A 1NF0A 1OX6A 3NAVA 1WAUA 5K9DA 1XI3A 1X6UA 4TIMA 5G2IA 5D04C 5HR6A 4O0KA 4IWWA 4JTTA 3IIOA 5J5DA 3EX1A 3FOKA 3TROA 1GWJA 1DJQA 3S9YA 1D3GA 5DBUA 2CLMA 1VYRA 3NOEA 1WBHA 3W1XA 1DKWA 4JIQA 1JR1A 1H1ZA 1LZOA 1QFEA 2IQTA 1XFBA 4JTLA 3V75A 3LLDA 4RKAA 4NXKA 1A50A 4JYDA 2YR1A 4MJZA 4POCA 2VOMA 4UFMA 2FQIA 2G95A 5LGZA 2X2GA 1OG0A 1YDOA 3EX2A 2WNZA 1KTNA 3IGUA 3FIGA 3P67A 3OEXA 2NUXA 2FPVA 1VCGA 3JRKA 3R8RA 4X3ZA 3W85A 4FF7A 2A21A 3TAKA 4NJJA 1F6KA 1X1ZA 3ZWSA 3QYQA 4NX5A 3UZJA 3GXNA 1QMLA 2R8WA 1K3UA 2E68A 1P0KA 1W1ZA 3OBKA 1VS1A 3ZFHA 2ZZ4A 4OU1A 3ABQA 1GVSA 1ONRA 3FLUA 2VEMA 2A2IA 4TMBA 3NQ6A 4JIPA 3I6RA 1FUYA 2XN0A 3KVJA 1ADOA 3L68A 4UTLA 1SZNA 5D32A 3W7NA 4WY0B 3W7OA 1ME9A 4JICA 4KFNA 4LTSA 2HTMA 1WOBA 2J6XA 4UCGA 1Q45A 4LW7A 4FX6M 1C9DA 1JCYA 4GC4A 3DBPA 3ZS4A 1ZAJA 3PWAA 1UUMA 3P60A 1E51A 2OCZA 2YW4A 4A22A 2I1OA 2QCMA 3S5ZA 3ZR4A 3BW3A 1A5AA 5FEWA 1EUNA 4Z1CA 3W2NA 1QO2A 3DFNA 3QW3A 3E96A 3EEGA 1T96A 1PS9A 4IMCA 4DXVA 4N6EA 4M6VA 1FDJA 3W3OA 3WJSA 5LNSA 2DZWA 1HG3A 1GT8A 3M5VA 1K03A 2UV8G 1IXOA 1JUKA 5G5IA 1FDZA 1YPFA 1KBJA 5LZLA 1K8YA 1EIXA 4K6AA 4XTDA 2R94A 5CSRA 2TMDA 3LB0A 1LRTA 3CT7A 4Y6GA 1LBMA 4PL2A 5C5YA 2I14A 1LOLA 5LHEA 2HMCA 1CI1A 1GVOA 2BZNA 3A9IA 2DZSA 4ADTA 3NZ1A 1GOXA 3RF9A 1TRDA 4LV9A 3P5YA 2NX3A 4QJ1A 3WJWA 1A5SA 3QFEA 2DJLA 1PL9A 1SSGA 3FJLA 1H7PA 3B06A 3MWAA 3JR2A 2A7PA 3FYPA 5CPNA 1DHPA 4E0CA 4ML9A 3PSWA 1W5MA 2QEZA 1MZHA 4K7VA 1LRQA 4DF0A 2ZTJA 1KM4A 1GPWA 3TW6A 5K2ZA 2QUUA 3G8RA 2YYUA 2F84A 1KFLA 4CLMA 5EKYA 4CCCA 3SJ3A 2PRLA 5K3VA 2C13A 3M6YA 3NQ7A 3MHGA 3F4WA 5LKYA 3O05A 4LS0A 4FNRA 5TIMA 1H51A 3MHUA 4IUOA 3LDVA 1OFDA 2OJPA 1JJKA 3M16A 4O14A 4BF9A 4BWLA 2ZZ5A 1NEYA 2WQPA 4LC6A 1H7NA 2Y89A 3NPXA 1LDCA 5I3FA 3HG3A 5FF0A 1ME8A 2ZA3A 3QH2A 1VCFA 1ZFJA 3THAA 3A21A 4X9SA 1SU5A 3D0CA 2A6LA 3IVSA 2B7PA 2AGKA 4PCFA 4WD0A 3LTPA 2BLEA 1W3TA 4LVDA 3W7RA 3S5NA 1SW0A 4YCPA 5KMYA 4GBUA 4UIOA 1K7FA 3QJAA 1Q3NA 5D33A 2NUYA 3EWBX 1KM6A 4A2SA 2GVLA 5F2MA 3U2OA 3HGRA 1ZCOA 2GOUA 3U8GA 5G1YA 1I8JA 4PTNA 3L5MA 1Q6LA 1AW1A 3MYOA 5CGQA 3DKLA 2YPIA 2ZRVA 3Q58A 4UR7A 4MFEA 4O4WA 3N14A 4O50A 4LOCA 3PBYA 1R2SA 1VH7A 3RLUA 3KRSA 3UPWA 3DENA 6TIMA 3E12A 2RHGA 3KRZA 1G4EA 4DEFA 5E1QA 3W7EA 1LROA 3C52A 3W7KA 4L4MA 1W31A 3ATYA 3EWWA 4AF0A 3UWUA 2GQ8A 2ABAA 3I7SA 3PVFA 3I7RA 3HGOA 2V30A 1Y0EA 4NJGA 1L6YA 3C56A 4PH6A 1F6PA 4UC5A 3TSBA 4AVFA 3IEBA 4CQ8A 1CX9A 3ABRA 3W07A 3GLCA 4RCXA 2DP3A 1IXPA 1H60A 1Q6OA 3GR8A 1NSJA 4JTUA 3FJ6A 1AK5A 1KFBA 1KM5A 5CG7A 5EL1A 3NL5A 4JXCA 4R7JA 2ISWA 3DU0A 2QKFA 3IGXA 1H62A 3LHTA 3BG3A 3FKKA 3C2OA 3P84A 3GDTA 3S5YA 3TK7A 3SECA 4Q33A 4NNCA 2VEKA 4OQVA 1EP3A 1UUOA 1KM1A 4RZ6A 4O10A 4K7YA 4RX0A 3G0XA 5D03A 1M5WA 1ICSA 3LCFA 1R30A 2YFOA 3W7QA 4DQWA 3IVUA 1GEQA 1G4PA 1Q6QA 1RQHA 3W73A 2CZDA 4AWSA 2Y88A 1QPNA 4UFJA 3NR0A 1SUXA 3MI3A 2EAWA 2ISSA 4GUIA 1FCQA 4O1CA 1KM2A 3HF3A 1XBYA 1JCMP 2H8ZA 4YCOA 3TDFA 1AL8A 3PC0A 3GZ3A 2QJGA 4N6FA 5K4ZA 3LV5A 5FEPA 1TPVA 4UTWC 2A4AA 3MMTA 1XXXA 2V2DA 1B4KA 3PAJA 1LYXA 2Y62A 2QJIA 5HWNA 2Y7DA 4D2JA 3IIVA 2QCHA 1U83A 4HT3A 2NWRA 4A21A 4FEZA 4RXFA 2Y85A 2E6AA 4IOTA 1SZGA 4QM1A 3VE9A 3DHFA 4UNKA 3P5ZA 5FF7A 3QQ1A 5AN7A 2WSRA 5DLCA 3M5XA 2YZRA 2J9YA 1JCNA 1RR2A 3BW4A 4TX9A 1R46A 2CZEA 3LRMA 4XTIA 2C0AA 3MJYA 1RQEA 4MZ1A 5HMSA 3W1AA 2CLLA 3G1VA 4XKYA 1UBSA 3WFAA 4S1FA 3W22A 4HKPA 1YYAA 4MFDA 1O5XA 1TB3A 2PE4A 2X1UA 4I7VA 3P7YA 2NWSA 1W3NA 1FCBA 3GYEA 3P8JA 4UFIA 2RH9A 2C16A 4FO4A 1A5CA 1TREA 1N55A 4RR4A 1DBTA 1L6WA 3KHJA 1B4EA 1I2PA 1ICQA 4GUGA 5FF3A 3S6DA 4FNTA 3PUOA 3TW7A 1VRDA 2FB3A 2DZPA 2ZDRA 3FA5A 4O13A 3LCGA 2A7RA 1PIIA 2ZZ2A 4H3DA 5HUPA 3C2FA 3BK0A 3BO9A 4N2YA 5LNUA 4NVTA 1WX0A 1XBZA 4H4IA 4AF0B 1VYSX 3PUEA 1T0OA 3C8FA 1JCXA 3W1RA 4ZMGA 3LHZA 4K8HA 4QQ3A 5DBTA 5HR7A 1S3HA 1G69A 4HN4A 1LOSA 4DBDA 2CLKA 1ZAHA 2O7SA 3W9ZA 4I7WA 3PBUA 4BI5A 4O1BA 1EA0A 4MPQA 3VCRA 1I2QA 2X1RA 5EA9A 1H63A 3L9CA 1OVDA 1O60A 4LU0A 3CC1A 3WK1A 3HMJG 3MO7A 2ZBTA 2PRMA 5KSWA 1GJPA 1LBFA 3TXZA 2QCLA 2FB2A 1P4CA 4O28A 2RDTA 2Q3OA 2GJLA 5D2WA 3UNDA 3NL2A 3W1TA 4O4VA 3NM3A 1EWEA 3NZRA 4UTTA 4LS1A 3KAOA 3VKJA 4OE7A 1ZENA 1M6JA 2H90A 4MVAA 3P74A 1JQXA 1YTKA 1FQ0A 3R12A 4DBEA 2YXGA 1F74A 3TA6A 2WNQA 1LM1A 4AMAA 3RLVA 2D73A 3EXSA 2VXNA 1P0NA 2B7OA 5CPOA 5HQEA 5DCEA 1C8VA 5I3GA 4IJBA 2ZRUA 4UTUA 1OYBA 1DOSA 2V0TA 1FWWA 3SIZA 1F7BA 1GYLA 1J4EA 4NX0A 3GNDA 1JRCA 5AC7A 5F2IA 1O5KA 5AHMA 1QNVA 3TU9A 1K7EA 2YGYA 3U6WA 3PS7A 4UFKA 3QMTA 1BWKA 2Y7FA 3STGA 3DGRA 1KFKA 1VLWA 2XN2A 4FNSA 1KV5A 1SFLA 3L21A 3M9YA 4JD4A 1GYNA 4WXZA 1QO5A 4R33A 3LERA 1H7WA 1TPEA 5LHFA 4M7TA 2V82A 4N02A 3AO0A 3MBDA 2V5BA 3MP3A 5F2LA 1TTPA 3Q2DA 1W5NA 3STFA 3A5FA 4ZVJA 2WNNA 2BX7A 2RDWA 3QF0A 5G1TA 7TIMA 4JEQA 2JKEA 1H50A 3H54A 5G4EA 2CLFA 3IVTA 2ATMA 3CEUA 3L67A 2ZTKA 2XFWA 4RZ5A 1SSDA 1VR6A 1W5OA 4JTIA 1XUZA 1D9EA 3W75A 4DO5A 3LTYA 2Q3RA 2FIQA 4G1KA 4NT0A 4AHQA 5BRBA 1I4NA 3S42A 3W2UA 4XBKA 3W23A 1OK6A 1LLZA 4E38A 3TX9A 4K8EA 3LRLA 3W7LA 3QMSA 3IIZA 4JTFA 3NPWA 2CLOA 4YMZA 1TQXA 5CSSA 1EEPA 3C6CA 3HIJA 5KTLA 3W84A 3FS2A 5H91A 2CLHA 3PG8A 4S2CA 3N19B 4JN6A 3LXCA 3HGJA 3DXIA 4JTKA 4Z1BA 3O8AA 4JTSA 2EKCA 5CZSA 1DL3A 1SW3A 3CTLA 4ICNA 1TMHA 3G1HA 5IBXA 1EUAA 2H8XA 4WQ6A 4ADUA 1JCLA 5EPDA 4LVGA 2A0NA 4M7SA 1H7OA 1TRIA 3GB6A 5BNKA 4FXRA 2QAFA 1L2UA 2DZXA 1P5BA 4GRSA 5D37A 4GUHA 4TO8A 2R91A 4IXHA 5D2YA 5D09A 1J5TA 4LWWA 3G1AA 4HPXA 1SO5A 2CZ5A 4NU7A 5DCBA 4LNYA 2Y70A 3CIWA 1FCUA 3S5OA 5AHLA 1R2RA 2C14A 3SFKA 1VCVA 1QCWA 3MBFA 4QISA 1WQ5A 5CZ0A 3O15A 4Y9AA 4MZYA 3VFLA 2VFGA 2GVJA 3CEPA 1NAL1 1PHQA 1TPWA 3GAYA 3PSVA 4Z0SA 3G0SA 5LSMA 2DORA 4P2VA 1ML1A 4E2BA 4WOZA 1KFJA 3FYOA 4FHAA 4O1AA 1JUBA 3NG3A 4FX8A 3S1WA 2V8ZA 3O06A 3TQKA 2ZFAA 3T7VA 2I9EA 3OVRA 1AL7A 2J9ZA 4A3UA 2C3ZA 4UNLA 2Q8LA 3L0KA 1TTIA 5AYXA 4O53A 4O8RA 1NFBA 1W37A 1QOPA 3DFQA 3YPIA 3N2MA 3L65A 4UFLA 4BWLC 4ZL1A 2QDGA 4UTMA 3LCHA 2VC6A 1S5WA 1HTIA 3IIPA 4KWVA 3TR2A 1OF8A 2H3DA 3WJYA 1G7VA 3RMJA 1TPH1 3CPRA 4IXXA 6ALDA 4XWUA 1F73A 2QUVA 1OFPA 4UR8A 2A6NA 3NL6A 3GIYA 4FXSA 5F1VA 1TPB1 2C1HA 4DF1A 3W87A 3GX9A 2HS8A 3TJXA 5I3JA 2E6DA 2FTPA 4OV4A 1GVFA 1MO0A 3LTSA 2X1TA 2TRSA 2G96A 4PODA 3C61A 5CZJA 2GJNA 1DV7A 2VELA 4TR9A 3NQCA 3BG5A 3HPZA 3W1NA 3TH6A 4AWTA 1B57A 1TQJA 2NZLA 1OF6A 3KXQA 2A1YA 1XDLA 3SGUA 4MJMA 5FESA 2Y7EA 3LBCA 4LC8A 3VNDA 1LCOA 4IMEA 4HHPA 2CLIA 1G6CA 2QAPA 4DO4A 1KTCA 1FWRA 3T4CA 1FWTA 1PVNA 3QSRA 3P82A 4GJ1A 1X1OA 3STCA 3INPA 3PBWA 2A7NA 3QC3A 4GUFA 5C55A 2G97A 2QCCA 3PULA 4YL2A 2RKXA 4NUWA 1FXQA 3H55A 3NYZA 1ZJIA 2J24A 3TKFA 3W1MA 4MY9A 3P8IA 1OX4B 4GXMA 2FLIA 3W7DA 4FIQA 4LV4A 1VC4A 1Q6RA 4MY8A 4O11A 1MEWA 2ISVA 1YPIA 2VENA 4N9DA 5I3HA 5KZDA 1XDMA 1P1XA 4JYFA 1RQBA 3CU2A 1RD5A 5L6UA 3DFTA 3ZWTA 4LT9A 4AWUA 3THQA 4NNBA 4DPQA 2C19A 5AYZA 4OBTA 3W71A 4BI6A 3T44A 4UXDA 2NUWA 1T99A 2VFDA 4AEOA 3HG2A 4JTHA 5D05A 3E9AA 1OFBA 3W83A 2E6FA 5AB3A 3GR7A 3EKLA 4HSOA 4UTKA 1B3OA 4OT7A 3WK0A 3NA8A 4Z0JA 5L9FA 2P1FA 4XBSA 3S1UA 3LGEA 3UWQA 3UY7A 1TJRA 4JTJA 5KINA 2H6RA 1TJPA 1ALDA 4H6KA 3EX3A 3BGGA 3G22A 3LLFA 1G67A 1XC4A 1G4TA 3EKZA 1MEHA 3A22A 2EPHA 2FJKA 5AHNA 5BW6A 1ZALA 3O6CA 4JY8A 1ZY9A 3A5VA 1XL9A 4JS3A 1KV8A 4GFSA 2W0UA 5HJLA 2CFFA 2J88A 3GK0A 1Z42A 4L4LA 4MLRA 3G1SA 3HJZA
chains in the Genus database with same CATH superfamily
2KAUC 4WSJA 3I3BA 1GQJA 3KW3A 2Q8ZA 2NXGA 2EXOA 3OTRA 2HSAA 1QHOA 2GL5A 4NAEA 1C7TA 1QNQA 3I65A 3R89A 3NQDA 4Q4SA 3HQPA 2V2HA 3HOJA 3B3DA 5I5RA 3PZNA 3TIMA 2QIIA 5GNYA 1XSJA 4LAOA 5AECA 3A4WA 3IGSA 3HU7A 4EX4A 1CIUA 5U7SA 4HB7A 5C6MA 3C2VA 3LPGA 4MLJA 2FZMA 4H2HA 3W6LA 4WY0F 4CD8A 1XYLA 3ZO9A 5FSEC 3ZR6A 1M68A 1TELA 3LI1A 3BOFA 2O7QA 2FMOA 3GC2A 1VBGA 1DORA 3QZ6A 4J7RA 2WHMA 4W9TA 3OVQA 3K46A 1RPXA 4WLCA 3AS2A 2WJEA 4ORMA 1TPDA 2DUZA 4AD5A 3H26A 2BVDA 5A8GA 4KERA 3S2MA 2J7GA 2E1WA 4AZ5A 2XH4A 4UZUA 3AUJA 5CH9A 1OZQA 3FFSA 1IT7A 1IE7C 2KZHA 4XAYA 4UNIA 3LGDA 1R87A 3LRKA 4KRTA 2VC9A 2OEMA 1Q6FA 1ELSA 1WXYA 3ITYA 4E2DA 2FHCA 4GIEA 3UCDA 4JQ3A 5FL1A 2VP8A 4MYXA 2WCAA 2EBNA 4HU8A 2I5IA 3IIXA 1TWDA 4E8GA 1OJXA 4LVBA 5LIUX 5C9RA 3N12A 4EP8C 3L12A 4LEFA 3ABXA 2H9AA 3TYAA 3VU2A 3RDKA 1LG1A 1QPRA 3BWWA 2V5LA 4HIBA 2EQDA 3CO4A 1Z9AA 3QR0A 1YDVA 4FOJA 2B81A 5BMWA 5F4WA 2DVXA 2ZZ3A 1TJ2A 4O54A 3LN3A 2J74A 3AXKA 3HA1A 2OGJA 1VHCA 2ADAA 5HPCA 4HTBA 1KWGA 5CZTA 2B7QA 4CD6A 3GXPA 5AHIA 3RNDA 1OYCA 1A0DA 3DFSA 3V4BA 1YADA 3MMUA 1SFJA 3FJ4A 3VNYA 2HPIA 3W70A 1TSIA 4HPJA 5D9NA 3BARA 3HJEA 1AJ0A 4WIWA 2VRKA 3DG3A 3VIMA 1AD4A 3BL3A 1W17A 2GUUA 4HYRA 4TTUA 3N13A 2HXTA 4M3PA 1JDDA 1MMFA 1PUDA 4ZOAA 1VJIA 2PURA 4K37A 1SJAA 5DO8A 1LT8A 3ARUA 1YE6A 5H8PA 3VNJA 3IV3A 2E9LA 3LCLA 4DIAA 3SCQA 1VENA 1E55A 4MOZA 4IH3A 4HD5A 5E0KA 5EBUA 4ZQCA 2ABBA 1OZMA 3IUIA 2PS2A 4IGHA 4NXSA 4AVNA 1GVIA 4QNEA 3WLRA 3WK2A 4FS9A 3TZFA 3KOZA 1UD6A 1N8FA 1O4UA 3PJUA 4HOXA 1S38A 3BE7A 4M1RA 2C79A 2Z24A 4JFTA 3VD3A 4UQAA 3KRBA 1JNDA 1T8XA 1ZSXA 3MSYA 3PM6A 4QLKA 3RFAA 2WSQA 3SN1A 1KBBA 3VK5A 5EMYA 1YBQB 2Z0IA 1ITCA 1V3LA 1Q13A 4HN8A 4JKLA 1EJ7L 4LYPA 5DFAA 1OX5A 1PCWA 4QGCA 2NT1A 3ABZA 2DEPA 3TA9A 3OLGA 1KM3A 1GTEA 3T40A 2ATSA 1VLIA 3M1ZA 5FF2A 4PUJA 4RJEA 5FCZA 4DUOA 1HJWA 2YZ5A 2WM0A 4W93A 5M03A 4JR5A 2J9XA 3MDUA 1S5NA 3VDHA 2XGZA 4K38A 5A8PA 3AS0A 4KCUA 4S39A 6CGTA 5HJXA 1TPUA 2E5CA 3W72A 2BXYA 4B3LA 3CLMA 3ISIX 1R38A 4HZ6A 3ARRA 4ADSA 5C54A 3CUXA 1VGAA 4IPIA 3UQNA 4RNIA 1B3WA 3PPFA 4NIRA 1LLWA 3OW1A 3TN3A 1Q63A 4UTIA 3UXDA 1FOBA 1MSSA 3NZPA 2J27A 5BMXA 6TAAA 3W2MA 2WSKA 2XIJA 4UQBA 3F7JA 3C0LA 4U28A 3CWHA 4XAFA 2SFPA 3UYCA 1O94A 4JTGA 5C9UA 1A47A 3WNMA 3MW7A 1C3FA 3LHYA 4Z42C 3N9KA 4JTDA 3ITTA 3WBEA 2Z7GA 1SPQA 4DELA 2YB1A 4PUMA 4QAIA 2DSWA 1ZJBA 3B9DA 4H9VA 2PPGA 3MVTA 4NZ3A 4N9EA 4PTMA 3VC5A 2NXIA 3ARTA 1F5ZA 1GJWA 6A3HA 5JXQA 4QE1A 4JTEA 4QEHA 1RVGA 4NZ4A 2Z2UA 5HK4A 5AYIA 3MHFA 1Z89A 1KCXA 4FOUA 2V3FA 4LVAA 3W6YA 4NAEB 2GSHA 2FFIA 1ESWA 4LCQA 2VX4A 1F3WA 1UP0A 2QVHA 5CCZA 4IX0A 5JMUA 2F6KA 7CGTA 3ARVA 2VDHA 3RCNA 4QJ5B 1K4HA 4H41A 1A5BA 3GVVA 2NX1A 2RUSA 3AZSA 3SIMA 1FY6A 2WMIB 1ZCCA 3TC7A 1XM3A 2EO7A 3WUFA 4CVUA 3EX4A 1GQKA 4RNHA 4YTQA 1BXBA 3W2KA 1IR2A 3OU8A 4BQ3A 1MFUA 2C71A 2O4QA 5I6SA 1GEHA 4NRRA 1I9CB 2ZRXA 3UJFA 2PLJA 1CW2A 4TVCA 1KFCA 1UMLA 4I9JA 4L65A 2VZOA 2D24A 4BKNA 4H6EA 4QSHA 4S23A 3CJPA 3TMQA 2DU2A 3ARSA 4GQRA 4Q4RA 3IANA 4XZLX 1KCLA 2W4XA 2OZTA 4UQDA 1GGOA 1I45A 1CXEA 1RD6A 2OPJA 4L56A 1VPYA 3VOCA 3NDOA 3CZ8A 3G0UA 4H2CA 2BHUA 3TE9A 4IG2B 4DX3A 3TSDA 2C6QA 2XGIA 1WKDA 4WUIA 4JQ1A 4ZQNA 4XD4A 3NQGA 1PHWA 2OX4A 4MDOA 1IWBA 2EG8A 4F9JA 3AALA 3VD4A 4DBSA 3CB3A 1G94A 1TPC1 1B9BA 2GK1B 3M5ZA 1FFRA 1ZJHA 2F38A 3B0UX 1VJZA 1H49A 2CESA 1VEPA 4JTRA 4O1FA 1H5YA 4Y8FA 2ZRZA 4XSMA 2DSUA 4M6PA 3L66A 3RIKA 1PTDA 4PRRA 3EDJA 5C71A 3NQVA 2DGAA 3MMDA 2NLIA 3STEA 4Z08A 2ZQ0A 2PD5A 2PBOA 2JKPA 1R3WA 2BGNE 3I7QA 4JY9A 4KCTA 4F0SA 4WXYA 1VB9A 3KHDA 3Q67A 4AH7A 3COTA 4A8IA 4EPBC 2VKZG 3HB9A 2EGZA 1ISZA 1NVMA 1MWOA 4WEVX 4LUJA 4D6HA 2PRHA 2CU0A 4REQB 3LYEA 2Z1XA 3B0YA 4OGZA 1SMAA 1FKWA 2TYSA 3CL8A 3SQSA 3MP4A 4XD5A 1LL7A 1CGUA 4MJ4A 4LBSA 2C8NA 4A4AA 1ADDA 1ZBKA 3FEMA 3OG2A 5CLWA 6PTDA 4S38A 2GOKA 4B2DD 1BWLA 3EOUA 4AXNA 1PKNA 3UJEA 4Q4PA 2I17A 3TCSA 1FHUA 4RV8A 5ABEA 1M03A 4LAZA 3CHDA 5C2CA 3JZUA 1FA2A 1XYAA 3OZMA 3NQ8A 3ICJA 4UTTC 4DBUA 4UMCA 4A3RA 3QGVA 4X2RA 4EVZA 1EO5A 1KLYA 3S6OA 1PDZA 1K8XA 5I7GA 1BYAA 3NVDA 3UVIA 4ROPA 1DTNA 3O07A 3KBMA 4CEXC 5HINA 2EF9A 3ZM8A 4NSBA 1WBJA 4XIAA 4ONVA 1TTQA 1CLVA 4NZJA 4XO6A 1BEUA 4BQ5A 4YYCA 3GC5A 4GO9A 2R1KA 3TWAA 3ZJ8A 4HNTA 2PLMA 1I2NA 2AL1A 3BMXA 3GTNA 3VIOA 1HGWA 2C15A 1G4SA 3IWPA 3QXBA 2Q71A 3WYZA 4A35A 3R13A 2WSPA 1DEDA 1Q5MA 1JPIA 1CNVA 1NDVA 2JKAA 5E6YA 1ZP4A 1BF6A 2BXVA 1E56A 4C7DA 3ITVA 3J7HA 3KL5A 1FWJC 3CS2A 1ZJAA 4G1NA 2V67A 3E49A 2YX0A 5K9XA 1WXJA 5E93A 3BGJA 4AAJA 5E9AA 1IXNA 3BPWA 4OJYA 3OGVA 4JCMA 4YWSA 1LOQA 2D20A 5G4HC 2OELA 5C8BB 2ZDSA 4HK5A 3EYPA 3O6YX 1ME7A 4NF7A 2ZXBA 4WSHA 4IFOA 3VX0A 3IV8A 3R94A 3FY1A 1YDNA 1FFQA 3RILA 4PB3A 5FI8A 4C7GA 2XFFA 3R58A 4O15A 5FSDC 2X7VA 1YXDA 4I5RA 5B7YA 5FF4A 3W1UA 1MW1A 4PCSA 1T5AA 3TONA 3A23A 3B04A 3DC0A 4M82A 4WR3A 1W54A 2YL6A 1E6ZA 2TSYA 4UUIA 3W6MA 2V63A 2DW7A 1TWWA 3S3GA 1KR0A 3DERA 1J2BA 3UXAA 4HTYA 3GFYA 4I5UA 3LX9A 4KWWA 2EEXA 3MO4A 1ZAIA 4NYUA 3UT0A 3TSMA 1F3TA 1A5UA 2A5HA 1DIKA 3A3WA 2WHJA 3DFPA 3HG5A 2POZA 3NAVA 3PJTA 5K9DA 4P8XA 4TIMA 5D04C 2DVTA 4KESA 3IIOA 3EDFA 1QVBA 1GWJA 3W28A 1BQGA 1DJQA 3S9YA 1KB3A 5DBUA 4CEUC 1VYRA 2JALA 1B5TA 1DKWA 1MQRA 3EOSA 2W67A 3NDZA 3IJQA 5EB8A 3QV9A 1P7TB 2VWTA 4NXKA 2AQVA 1A50A 3EOOA 3WL0A 4DNMA 2YR1A 3VGFA 4MJZA 4X0NA 3KOYA 1CLXA 3C0SA 3PZQA 4POCA 4F79A 3WQFA 2J25A 2IXUA 3H2FA 3EX2A 4GKLA 2NUXA 3T0CA 3F2DA 1JI2A 1KXQA 2OVLA 1UWTA 4NX5A 3A47A 3UVAA 4XSLA 2R8WA 4G6CA 2E68A 1W1ZA 1VS1A 1N8IA 2GSEA 2ZZ4A 3QYSA 1C7SA 2VEMA 1MUWA 3AISA 4HHHA 1LQAA 3LD5A 4MNLA 3V36A 3UESA 4BCEA 1MDLA 1C92A 1G5AA 1ADOA 5LIXX 1QHZA 1UD3A 3K8LA 5D32A 2WC4A 3MUZ1 3A12A 4JICA 3GHRA 5LIWX 1WOBA 1Q45A 4LW7A 4FX6M 2VVNA 1U1JA 3DBPA 3MV11 2Z00A 3H70A 4LFYA 4EXAA 3CMGA 4MADA 2VZSA 3P60A 2YW4A 4AZCB 1P6WA 1UR3M 2ZICA 4H6RA 1YBQA 3BV7A 5CSUA 5FJJA 1A5AA 5FJUA 1EGZA 2ZOXA 3WUEA 1QW9A 3VGEA 5BYWA 1ONXA 5F7UA 1RJRA 7ENLA 1TJ1A 5A94A 3W3OA 3RR4A 2UV8G 1VFMA 1JUKA 2ANUA 2WVTA 5G5IA 4I9MA 1AFSA 1ZBCA 1TUFA 4M0XA 1UYQA 5CSRA 1SMDA 2TMDA 1JDAA 3LB0A 3CT7A 4Y6GA 5E9XA 1U1UA 2DT2A 4ERIA 2I14A 3LGGA 2HMCA 4PMJA 3TYZA 2AKMA 2BZNA 2Z1WA 1E15A 1OCJA 1J18A 1GOXA 3SURA 1TRDA 4QJ1A 3WJWA 1A5SA 1RP9A 4NZCA 3GH7A 3FJLA 4Q22A 1EOMA 2DUXA 1J79A 3B06A 3JR2A 1M65A 4PTWA 5CPNA 4JTAA 2QEZA 1J11A 1XX1A 4GPNA 4K7VA 3M64A 3NCOA 1WDSA 2C91A 4QE5A 3R0UA 1OSEA 3TW6A 1SFSA 2GGIA 1KFLA 4CLMA 1MUMA 3SADA 1IYXA 2PRLA 5K3VA 5HNNA 3NQ7A 3WDHA 2WPGA 5IFPA 1C93A 5TIMA 3SCPA 1H51A 1OY0A 1VPQA 4Q4MA 4GZIA 4O14A 4CUCA 3L4YA 4E4PA 1NEYA 3L2LA 1HXJA 1J9YA 2Y89A 1UOKA 4GX8A 1W9PA 3TNBA 2GVYA 5I3FA 1E70M 5FF0A 1ZFJA 2WXDM 3W29A 4WD0A 1F3EA 3LTPA 4LVDA 4YCPA 3VCCA 3VIHA 3GRIA 1Q3NA 1KM6A 3JZEA 5F2MA 3HGRA 1ZCOA 3S1GA 2R24A 1ODUA 4QEEA 2Y5JA 5M2FX 5CGQA 3ARQA 1J96A 3VOIA 3VIPA 4CN1A 4MFEA 2P5NA 1KC7A 1A3HA 4A3YA 4O50A 1DXEA 1J0KA 3PBYA 4QCEA 1R2SA 3KM8A 2R82A 3KRSA 4I6VA 2Z4GA 3WH7A 1G4EA 5CPTA 4UCFA 3W7EA 1LROA 3W7KA 1LQ2A 1W31A 1XIJA 3ATYA 4P8UA 2EPMX 2QDEA 2GQ8A 3I7SA 4I6KA 1UKQA 2VQUA 3PVFA 3I7RA 5HBFA 3KZPA 4NJGA 1L6YA 3C56A 1F6PA 3TSBA 3LPOA 3CHCA 1CX9A 3ABRA 1V4YA 1R3SA 3U2CA 3GR8A 1KRCC 1K9TA 5D8ZA 4LQ1A 1X97A 2QULA 4X0VA 5CG7A 4CNTA 3U3HA 5EL1A 3VINA 1E5JA 3M7SA 4X61A 1W2PA 4JXCA 3LU2A 4R7JA 1F8IA 2C1IA 1XQKA 3VPLA 4H00A 1VIWA 3DYOA 3WCZA 4YYFA 4BF7A 1W1YA 3C2OA 1UH4A 1G01A 2OGYA 1KR1A 3MU7A 4YS1A 4RZ6A 1GVEA 2XH2A 5CSYA 1W1VA 2FJUB 2VHLA 4E2VA 3N2TA 1GOQA 4GXPA 2PFHA 3W73A 5MF5A 1QPNA 4QFUA 5LIYX 1TZZA 3R25A 3VIGA 3MI3A 2EAWA 4GUIA 5FAGA 2JF6A 3HFTA 1XINA 1ISYA 4KGLA 2WVUA 5E70A 4AW7A 4YCOA 3SUWA 3TDFA 3H4GA 3LENA 1POJA 3WFLA 4CD5A 2PI6A 3MSRA 3LV5A 4DJDA 4XVEA 3MMTA 1LYXA 1A3WA 4PCPA 5HWNA 2Y7DA 1C8XA 1Q4NX 4J1OA 2NWRA 4GBDA 1A5LC 2IQ0A 1TE6A 4RXFA 2Y85A 4AUBA 2FZ8A 5C9XA 1WO2A 4RUBA 3NIYA 5ECUA 3ZJ6A 1R46A 3AIVA 3D3FA 3LRMA 3MJYA 4MZ1A 2CLLA 1M01A 3G1VA 1CEOA 3WFAA 5D9MA 2VCAA 3MUCA 4HKPA 2Y5EA 3P7YA 2D23A 2EG7A 1TUXA 1W3NA 5TF0A 3P8JA 3WENA 5GNXA 4W7WA 4MKSA 3U7VA 3VD9A 4RR4A 1L6WA 1ICQA 3DFHA 4GUGA 1OGSA 3S6DA 4J3SA 3PUOA 4R9XA 3U5YA 1GORA 2FB3A 5FJOA 1WZAA 2ZDRA 1E0TA 3VNZA 4V33A 2GGHA 2A7RA 5D4YA 2ZZ2A 3LG3A 4H3DA 4ROQA 3T2QA 1PZ0A 3C2FA 3V18A 3BK0A 5REQB 2YB4A 3QY8A 3BO9A 4N2YA 2VUNA 3SFWA 2V5KA 1JYXA 1VYSX 1W9XA 3PUEA 4GJJA 1QT1A 3LHZA 1NP2A 1QHPA 5DBTA 2GGEA 1LOSA 2QT3A 4DBDA 1O1ZA 2O9RA 1M41A 3E5PA 3W9ZA 3SRFA 4LUSB 1H63A 1K77A 1O60A 2BBFA 1OC5A 2GWNA 3CC1A 2J7HA 3HMJG 4WKHA 5KSWA 3RCYA 1GJPA 3MS8A 4XBJA 4OFCA 4IGNA 1V7AA 3CAWA 2RDTA 3T4WA 3DUGA 5TNVA 4AX6A 4O4VA 2QMKA 2I7GA 4D8AA 3ARWA 4IFRA 4F4RA 2VCCA 3BSHA 4C6NA 9CGTA 3WQPA 4O8AA 2BHZA 2YKKA 2XSBA 1F74A 2E28A 5B7ZA 3SRKA 4R3UA 3RJYA 1J0YA 2Y24A 3UJSA 2D73A 3FA4A 1VP5A 1P0NA 3S83A 1TKKA 3VX1A 2V69A 4JQ2A 2ACUA 3TOPA 5I3GA 3DCPA 4D6IA 3AYTA 4IISA 1XR2A 4PTVA 2ZRUA 4A05A 3FVMA 1OM0A 3SIZA 1X8CA 2PDIA 4PULA 1GYLA 2CYGA 3H7UA 4Y9PA 1K7EA 1S2WA 2PZ0A 1P6CA 2BS9A 3DGRA 2OWCA 3TLQA 1OC6A 2XN2A 3GIPA 3QR1A 1SFLA 3L21A 3M9YA 1JL8A 4GH1A 3AMCA 2BFGA 2IS7A 2V38A 1Q6CA 4R33A 4YVXA 1FHLA 3VM5A 1R9XA 2DSKA 4GGHA 4B5XA 3RM4A 5HOSA 1UKPA 5A8OA 1FTXA 3WQEA 4C6OA 4QAWA 1JFHA 3QF0A 5HATA 5G1TA 6REQA 3XISA 4JEQA 4HYVA 2CLFA 4PUEA 4QLJA 3CEUA 4OOZA 3CGTA 3L67A 2XFWA 2Z2AA 1FHVA 4LANA 2GGJA 2HCVA 2BHYA 4DO5A 2Q3RA 3WLIA 3CT2A 1A3XA 2BY1A 3W23A 3E0VA 1MDRA 4QHRA 3IIZA 1A4MA 3QGKC 1PB0A 1C8QA 3RXZA 1TQXA 5CSSA 3UXLA 3W84A 4LUTA 5I79A 2R1LA 4L6DA 4JN6A 3N19B 3WDPP 2QV4A 3T8LA 2AMXA 4JTSA 3GG8A 5CZSA 1DL3A 1SW3A 3CTLA 4KW2A 1IEXA 4UQ9A 1Q7MA 1A5NC 2H8XA 3EA1A 3WD1A 1PEZA 2A0NA 4QJ3B 1TRIA 2Z25A 3OPSA 2J79A 1BGGA 4RE4A 1I60A 2FGZA 3UZWA 2ZADA 2QLYA 4IXHA 4HA3A 1MFVA 1WNOA 5D09A 4LWWA 3PTKA 3WBYA 3WUBA 2CC0A 4DO7A 5DCBA 5BU6A 1XCWA 3UR2A 4LNYA 1EH9A 3CIWA 1V3JA 4IJCA 2C14A 3MBFA 2EPOA 5CZ0A 4MZYA 5CG0A 4IIHA 1TPWA 1UZ1A 3GAYA 4K1GA 3Q45A 4AWEA 1TCMA 5BU9A 1BHGA 2XM1A 1KFJA 4HPNA 4C6MA 4FHAA 1JDFA 1UR4A 5CAHA 1JZ4A 3QFWA 4Q8NA 5CQ1A 2YCKX 3OVRA 1AL7A 5DX7A 1HKVA 2RGMA 4ZO8A 1ZL1A 2DH2A 3RLHA 4G7EA 3N2MA 4UFLA 4MJ2A 1UHVA 1E3ZA 3RU8X 2ASHA 3EOEA 1S5WA 4GHRA 2MUCA 3WJYA 3AMGA 3UNTA 4WHBA 4XG1A 3NL6A 4FXSA 3EA3A 2C1HA 1GJUA 3T0DA 2E6DA 1UC4A 4OV4A 2TRSA 4S3BA 5GJMA 2WZMA 4EPEC 2GJNA 1DV7A 2VELA 2OZ3A 3W24A 4IPNB 3CH9A 3UR7A 3HPZA 1VBUA 4L64A 5HQMA 4TVUA 3U5UA 1TQJA 3RN6A 1XDLA 2XWDA 4FR1A 1J6OA 3VNDA 1UH3A 1DXIA 2Y8VA 1MNSA 1LCOA 1Q85A 5HDRA 4JL2A 4DAIA 2CLIA 1PWLA 4EACA 1I0BA 2X42A 3PTDA 3P82A 3WMBA 1B0IA 3FEQA 3INPA 3AHYA 2OR2A 5C55A 3WH5A 4J3VA 1EYEA 4GD0A 2JQXA 1XLLA 1FXQA 2FVMA 2PWGA 1ZJIA 4G7FA 4RW3A 4JAWA 3P8IA 1OX4B 4GXMA 3V3WA 3B8VA 3LMZA 4LV4A 1VC4A 2BOEX 4MY8A 4XVDA 3LBOA 2ISVA 4LX4A 2GDUA 4MB3A 3WQDA 3A9BA 5L6UA 1P1XA 3CU2A 1HNYA 1RD5A 3CUFA 4DUXA 4I5XA 3RMEA 3IK2A 3ZWTA 4H19A 5EFDA 1O1HA 3T44A 1XYMA 3WBAA 2XSXA 2V5JA 3S47A 3AS3A 1UKOA 1D8CA 4NHVA 4R9OA 2OSWA 4JEJA 3EKLA 4Q6JA 4PMDA 4ZB0A 6REQB 1B3OA 1XCXA 4OT7A 3SY8A 4Z0JA 3FVDA 3CYJA 5A8NA 3IAPA 4XBSA 3AXXA 3E2QA 1E1FA 1NDZA 2O4MA 1FKXA 1G67A 1G4TA 3UR8A 8RUCA 4CD7A 1XL9A 4JS3A 3NZGA 2J88A 3MKCA 3G1SA 3D46A 1FDYA 4TU1A 3I3EA 4GKTA 1Z6KA 3NO1A 3SUVA 3PBGA 3FNDA 1GVRA 3JS3A 2BODX 3LNPA 3PZUA 3WQCA 1SZEA 4QG8A 1I2OA 3VKCA 3Q37A 4EWJA 1J93A 4GNJA 3UA3A 1XQLA 4M29A 4U33A 3B9AA 1HP5A 4JZ5A 3WMCA 2BVTA 3QM3A 1JDEA 3BDKA 4ZFCA 1YNPA 4MKNA 4BZYA 3GAKA 5DXXA 2G37A 7REQB 1PE1A 1YXCA 4O52A 2OSYA 3DG7A 3NOYA 3SUTA 4C1KA 1GG0A 3QY6A 4C6CA 4WY0A 3FA3A 4PMNA 3SGZA 3KL3A 2OO6A 1W1PA 3CHVA 4LRTA 1IWPA 3BC9A 3BAWA 4DYKA 2V81A 4ZO9A 4B5VA 1MQQA 4V1YA 8XIMA 1Q8JA 5DY3A 1XGZA 2UY3A 4DJFD 8TIMA 4ZQOA 3KOWA 2G41A 4WJEA 3ABSA 2CHNA 3WLOA 1BVNP 3IARA 3G8EA 1K7XA 1PAMA 3RHGA 3VC6A 1XICA 2DY3A 2VNCA 3BSMA 3IJ8A 4CU6A 4XZHA 2RAGA 1V08A 5DT7A 4P7OA 2QYGA 1PKYA 2Z1KA 2WKJA 2WANA 1W3KA 4Q8WA 4NILA 1EOKA 4PTXA 1EX5A 1YLVA 3MTWA 4L9YA 4UOJA 4DLMA 3BG9A 2QUTA 3AOFA 3H22A 3P3BA 4C6LA 1PZ2A 1J01A 1YIXA 5HNTA 2Y63A 4U10A 4O18A 1YW1A 2RDUA 5I77A 4XZ9A 1I0DA 4FIRA 3B03A 2ZZ6A 4IPJA 2QXWA 4FLOA 1TZ9A 3OIXA 1UH2A 3L2IA 3DIPA 3K2GA 3CQIA 1F05A 3WLPA 3R43A 5AC6A 2ZZ1A 1VHNA 4BI7A 1ZZMA 4ICMA 4IMFA 1GZ1A 4FNQA 1RPKA 2RFGA 1X6NA 2AGTA 3LXAA 4RLIA 1X1NA 2E1DA 3BCDA 2FZNA 2CPUA 1SGJA 4EKJA 3R4IA 1SO4A 3IACA 1KBLA 1LORA 4BQ2A 1NF7A 4WOQA 3ZJKA 2Q09A 3PHAA 3M5YA 4KFOA 4R34A 4DJFA 4GLEA 3VILA 2FGBA 4HNVA 3P61A 3VKAA 3TJLA 4AEEA 5AYYA 3VIIA 3HGSA 1XUUA 3W38A 3FKRA 2BVYA 3TYCA 3BJSA 4LGXA 4MUZA 3LHUA 3WD2A 2DIEA 1U5VA 2VFFA 4NJHA 3L5AA 3LOTA 4IX2A 3WZ0E 3P93A 3UXKA 1YTDA 3U9IA 2W9MA 1UCWA 4NJKA 4A3HA 2Q01A 3MCMA 1CB2A 5IDZA 1S1PA 3MUIA 1L6GA 1OC7A 3NPVA 3F1QA 3PUGA 1J0HA 4DWSA 3I68A 3VKKA 2FDSA 1GTHA 1OYAA 3GDBA 2OZ0A 1ODZA 1ZBWA 3HQNA 2Y4SA 1K9DA 1JXJA 1EJVC 1F6YA 5HULA 5DF0A 1BXCA 3UG3A 1C9WA 1OHLA 4AZIA 2VEFA 2DPEA 4X60A 2ODOA 4QDPA 1QW8A 5K7JA 3S9ZA 4NJIA 3NQ2A 2XINA 4TV5A 3GDMA 4AB4A 2YXXA 3DH7A 1T40A 1BLIA 3LK6A 3PZOA 1X6LA 3AHTA 4J4KA 3Q94A 3BTNA 2X1IA 3LCWA 5FJIA 1W3IA 4URIA 3C2EA 3G3MA 5DXYA 4UOQA 3WQ6A 3OGRA 3NXLA 1B2YA 4YTSA 4PMXA 3VI2A 1JZ2A 2DQWA 4HNNA 3DFOA 2YFNA 4TX6A 1XJBA 4CQAA 3L0NA 1XLDA 3VUPA 4QLLA 4PBGA 5CKSA 3UG5A 2F9RA 4PE8A 1SQ7A 4GK8A 3IK4A 1U30A 5D2XA 2DZTA 4F0HA 3M0IA 2INEA 1ADSA 1T41A 4ERAA 1W5PA 1P1MA 1FX6A 2CLEA 1W8SA 3VDAA 1HO4A 3MA8A 3QZEA 4AHPA 1K4GA 4Q8OA 3A3HA 3TYDA 3UWVA 4E8CA 5CEWA 3NZQA 4UTJA 1QPQA 4AIUA 3MJMA 1H61A 3ANYA 3VA8A 1PO9A 2DSVA 3RRAA 2INZA 1NQ6A 2PTDA 2W6RA 3W7MA 1YX1A 3F4CA 4HOWA 1TV8A 1W1IE 4JOMA 1H41A 1PCKA 3GNRA 3KE0A 3WF1A 3W1PA 5BXSA 4N4QA 4KIRA 5MHBA 1BYDA 1CWYA 4CGTA 1MUCA 4HA0A 3CWNA 5I3KA 2AAMA 1D3HA 4ZENA 4KRZA 4Y9MA 3AC0A 1X39A 1OFAA 1E72M 1E5NA 4LVFA 3JUGA 1PYMA 1WDWA 3LXBA 4R53A 1HJXA 3AIRA 4MZ8A 1X98A 3LHVA 1TMLA 3MP5A 1GG1A 3DAQA 1GUVA 1XG4A 3AIQA 4Y90A 4PMRA 4RDYA 3WNPA 1EDTA 3CUHA 1JPMA 1QBBA 3PBVA 1TX0A 3GXTA 4YXGA 5D02A 4IUGA 3CZLA 4FMVA 3UETA 4MWAC 2XSAA 2I57A 3LQLA 3WQGA 5G4WA 3B8SA 4MM1A 3OQ8A 4NYYA 2D0GA 1E6RA 5LXXA 3FHQA 3GSMA 3AHXA 1XPGA 3CAKA 4XK2A 4XO7A 4GA8A 4ZQMA 2J62A 3SW6A 3W88A 4C6KA 1G7UA 2OO0A 3P0WA 3CMJA 3QOKA 1JCTA 3KTSA 2CW6A 3OP2A 2OT1A 4AZGA 4J9JA 1VBRA 1GNXA 4MNJA 1LBLA 3GDRA 1W56A 1HJVA 4ZTYA 4GFIA 5GJNA 3AZRA 4MYAA 2F2HA 1E6SM 5KZMA 3I6EA 3CB8A 5K4XA 5HPOA 3AS1A 2FGLA 4IIDA 3W02A 1RV8A 2PTXA 4JIEA 1W3JA 3TC6A 3EEZA 4BQ4A 1U1HA 3WMSA 1UWIA 1UB3A 1R8LA 4FX7A 3BMVA 3ZT6A 3URQA 3LV6A 4UTFA 1B30A 1THFD 4FNPA 1C8YA 1MVYA 3DGBA 4FXFA 3NO5A 3OVPA 1V3IA 3TV8A 4G2DA 2W27A 3RX4A 2XU2A 4ALDA 5BXPA 4GC3A 3S6TA 4DO6A 4AHOA 5C2XA 3H2MA 1EP2A 4QE4A 2PBGA 1LTDA 4MGGA 5EY5A 3GVQA 1QTWA 4E5TA 1HIZA 2ZCGA 5EMLA 4Q8VA 1OGBA 5GVJA 3K8KA 3PZGA 4Z1DA 8CGTA 4TTGA 3L0GA 3B4YA 2DZUA 3Q65A 3T78A 1JULA 1ZQ5A 2XIMA 3L4VA 5AFDA 3DZ1A 1VEOA 4RE2A 4BJHA 2X05A 2P10A 5I00A 4HCLA 4R7WA 4XX6A 3WELA 3NGJA 3FAXA 1EXBA 4GNKB 1J8VA 1ZS2A 2E5DA 3TCEA 3L4TA 2NLYA 1GOMA 1BAGA 4H8UA 4CQDA 2HV5A 2VUYA 3RU6A 4M5PA 4LBUA 3FSUA 1Z32X 4I7UA 5TQLA 2CWNA 4HQVA 3POCA 3I3DA 4UFHA 3ID7A 3T55A 3RPTA 3DECA 5ABTA 4AXKA 2WMHA 3O1NA 3L4WA 2YXOA 4J2PA 2F8QA 2J8FA 4Q4KA 1J0JA 3W74A 2QJHA 4S2BA 4AC7C 4Z2JA 3FV9A 3WDJA 3UEQA 3CYVA 4ICCX 4DPPA 3WO8A 5DT5A 4XKYB 5LNWA 2XM2A 1ZHAA 5JUVA 4HNUA 1HVXA 1WZMA 3SUSA 2CBUA 3TTQA 3GKAA 5C9WA 5CBBA 4U4MA 1UJPA 4UMBA 3RG6A 2VR2A 1DIEA 1JEZA 1ICPA 2PDWA 3G1RA 2J75A 4TMCA 4PFMA 3C2RA 1Z48A 1CYGA 3SN4A 3GQYA 5BOOA 2Y7GA 1XH2A 3AHVA 3N18A 3MUAA 2ZXDA 1TV4A 2OWWA 3UPBA 2VO5A 1S5VA 4I90A 3SCUA 4Q32A 4Z2LA 3HBLA 1RVKA 1S3TC 2Z1BA 1UA3A 1JG9A 1GCYA 5I03A 2W92A 2DZVA 1KFEA 3GNOA 3H53A 1MZRA 4I9AA 3CM4A 4F0MA 5CLTA 3PWIA 2EPLX 3NEVA 2P3ZA 1Y7VA 2E9MA 2ZIDA 2XISA 4MB1A 3FW6A 4NAFA 3WJXA 2PGWA 2DDXA 1UWRA 1VYPX 4AMCA 1M53A 4GUJA 2QF8A 5J04A 4JGDA 2FFCA 4P61A 3QMRA 2D69A 4D6JA 4MIMA 4J3XA 3W81A 1Z41A 3AYVA 4RXGA 1BYCA 4C7FA 3G1YA 1Z69A 1IIHA 1W2VA 4XZWA 3EXRA 3ZVIA 1KXHA 1VEMA 1B3XA 3N73A 3OIHA 3RM9A 5BRQA 2FZDA 2PP0A 3LQGA 5DMNA 4F0RA 3PZIA 4GY0A 3KRUA 5T8GA 2PU1A 5IBXC 1EJSC 1EC9A 3H2NA 4MNMA 2V2CA 4CD4A 4H9UA 3CZGA 1QRQA 3SZ8A 4C65A 3O7UA 2ON3A 3O63A 1WDRA 1OX6A 4P8VA 1XI3A 4AVOA 2PWVA 1DWJM 3KCOA 4YNGA 3KTCA 4O0KA 1FVPA 5G2IA 4YVVA 2WNWA 4G8TA 3R1ZA 3ZVHA 1R6WA 1D3GA 1CECA 3V0TA 2Z1SA 3T07A 2PGFA 1XRFA 1XFBA 2ZUMA 4RKAA 3LLDA 3R0KA 3ONBA 1GOKA 2VC7A 1W3HA 5HANA 4UFMA 2G95A 5LGZA 3GBEA 2X2GA 1C91A 3BCFA 2WNZA 1KTNA 3IGUA 3FIGA 2XH7A 1B3VA 3R8RA 4X3ZA 4FF7A 1EJRC 1FWHC 3WDQA 3QYQA 3L7RA 3GXNA 2A3BA 2IMRA 1CT5A 3VUSA 1K3UA 1HJQA 4K1WA 1P0KA 1VFOA 4DJFC 4L5ZA 3ZFHA 4D1JA 3CV6A 3NGFA 3AMKA 1BG9A 1ONRA 2DIJA 3ABQA 1W9DM 2GFTA 2A2IA 1KGWA 1XPYA 1TV3A 1AZ2A 3KVJA 1T6MA 3APYA 5JBFA 3L68A 3NO3A 3VMNA 1RP8A 1GW1A 1W1A1 3W7OA 1E9IA 4KFNA 3EDKA 3UP8A 4UCGA 4UZSA 2XVLA 2Q8XA 1VBHA 4GC4A 4L4OA 2WCSA 3LSCA 3BQ6A 3ZS4A 2VWSA 4DYJA 1UUMA 1E51A 2OCZA 4A22A 2A3LA 2I1OA 3S5ZA 3IJ7A 2X0YA 2GDVA 1Y8BA 4ZSUA 4F2BA 5FEWA 3W2NA 3S2NA 4ZE4A 1XISA 1WPCA 1XLBA 4IMCA 1V6XA 3GU1A 1UWSA 1D7FA 2YCJA 2DZWA 5GPRA 1F07A 1YQ2A 2VL4A 1OCNA 1F4AA 1Q4WA 1YPFA 4DJEC 3VDBA 1EIXA 2E40A 4H9XA 1LRTA 3WF2A 1U2YA 1W32A 2VZTA 4GISA 4ZOBA 5LHEA 1CI1A 4ZSTA 4L80A 2REQA 5GQBA 4S3KA 1KKRA 3P5YA 2NX3A 3S46A 3MT1A 2DJLA 1V8EA 4FLQA 4M56A 4E6MA 2A7PA 1FWAC 4ML9A 4KWSA 3PSWA 1W5MA 3C2YA 1PX4A 1MZHA 3ERPA 4MWAB 4ZOEA 2ZTJA 1KM4A 3WQOA 1UKSA 3OZYA 2QUUA 3ORWA 2YYUA 1NELA 3MZNA 3EMZA 3I6TA 1PKLA 3EBVA 3WLMA 4E8DA 1HW6A 1HJUA 1U33A 2CIPA 1EJWC 3MHGA 1SVDA 1EF2A 2HROA 1AD1A 4AIBA 3LDVA 4L7ZA 4BF9A 1EQPA 2ZZ5A 1BVWA 3B9OA 2WQPA 4LC6A 3AXIA 3WLNA 5AZ1A 1LDCA 3HG3A 2CLPA 3KL0A 2W5FA 3FAWA 5DMLA 3A21A 1HKMA 2PMQA 4X9SA 1SU5A 3IVSA 1EKOA 4JFVA 4QBXA 1Z8AA 2XJ7A 3W7RA 5KMYA 2DT0A 4GBUA 1XYZA 2NUYA 1MRQA 3ZQ9A 3CQJA 1R7OA 3GR4A 4GZJA 1DP0A 2GOUA 4LJ3A 3SEPA 3L5MA 1Q6LA 1V6WA 1R85A 3MYOA 4DY1A 4PRTA 2YPIA 3C8NA 1CTNA 1XSKA 1E0XA 4O4WA 4JIHA 4D8LA 2FHFA 2IXVA 3UPWA 3E12A 1QNPA 3KRZA 1S2VA 4L4MA 2YA0A 1B3ZA 3GW0A 4IHCA 2I9UA 2ABAA 3V16A 2OLHA 1EDGA 2YCLA 3E2VA 3ZLGA 4DI9A 3IEBA 4CQ8A 1A4LA 2GYIA 3CIVA 5A2AA 1OD0A 1IXPA 2WVVA 5REQA 1H60A 4IG2A 3AICA 1Q7ZA 3WQ4A 2DVUA 3ARYA 1KFBA 2BVWA 1FWEC 1KM5A 1RY8A 3WEOA 1QNSA 3DU0A 1WXZA 1H62A 3BG3A 3FKKA 4IIGA 1NFGA 3VIKA 2PUZA 2VEKA 4H1ZA 1EP3A 3FCPA 4Q3MA 2P88A 4O10A 3ALGA 1NWTA 1ICSA 1UBPC 3AYSA 1R30A 2YFOA 3SCRA 1GEQA 3WD3A 4OOUA 3R8HA 2CZDA 4OBSA 4LY4A 3V0UA 2ISSA 1KM2A 3HF3A 2WCGA 1JCMP 1ZGDA 4JHZA 2I16A 3EGJA 2OKTA 1V3MA 2D1ZA 3TZNA 1QWKA 2PDHA 2QJGA 4KRUA 4ZODA 5K4ZA 4MAVA 4UTWC 2A4AA 1DIOA 3PAJA 2QJIA 2WZIA 2WKGA 3IIVA 2P76A 3CLWA 4Q6XA 4A21A 4FEZA 4GY1A 2R6OA 1F8MA 1YRRA 2VZVA 1B31A 1XGEA 1BTCA 4AG0A 4UNKA 5FF7A 5AN7A 2WSRA 3M5XA 2YZRA 4DXKA 1JCNA 2O9PA 4TX9A 5MKGA 2CZEA 2ACSA 1JPKA 3NQBA 1KRBC 3QV8A 3W22A 1YYAA 2CWXA 5H8UA 3SB0A 1REQB 1NARA 4HCHA 4AX7A 2C16A 4MWAD 4P7LA 2HBXA 1N55A 2BP1A 3GVWA 1B4EA 1SR0A 3VKBA 2V5DA 4FNTA 2YCIX 2DZPA 3H2AA 3FA5A 3T81A 4MTVA 2AKZA 3G5EA 4MHBA 2XFYA 3D47A 1TR1A 2QUNA 1E1CB 1DJXA 4NVTA 4AF0B 1QI2A 1V03A 1V6TA 2CITA 2OXNA 1TMQA 3HMCA 4ZMGA 1BSIA 2I5GA 1EL3A 4QQ3A 3VNIA 3BCJA 1ZAHA 4S3CA 3O9NA 5XIAA 5DMYA 1CXLA 4BI5A 1EA0A 3VCRA 3KP1A 1I2QA 5EA9A 3L9CA 4O1EA 4F2TA 4CCZA 2PRMA 4DWSD 1LBFA 3PZTA 3KEHA 2QCLA 1RH9A 3TN5A 5D2WA 2FZ9A 4PTDA 3UNDA 5C9ZA 1R0MA 2L5HA 3N6QA 4HCDA 3GXMA 1W1B1 2J7DA 3GG7A 5ABFA 1LL4A 3P74A 1YTKA 3R12A 3O0FA 1PTAA 2VMFA 3WQWA 3TA6A 3VOHA 3KDNA 1LM1A 1QOXA 4MNKA 1I1WA 3PNZA 3EXSA 5HJYA 3CHEA 3CHFA 4I3GA 3NTYA 1CGWA 1WUEA 4X9YA 5DCEA 1KXVA 4EXQA 1C8VA 3UF9A 1R7AA 5T9BG 4KEVA 4L1GA 1B90A 3B9EA 1OYBA 4YHEA 2XH0A 5BXTA 1DOSA 1FWWA 3MKKA 3P6LA 4NX0A 2G3JA 4KF1A 5BWFA 5AC7A 5C70A 1O5KA 4BEUA 1WKEA 5AHMA 1JZ8A 1QNVA 3TU9A 2CHRA 2WHKA 3SUUA 2YGYA 3U6WA 1LQ0A 4F40A 3WSUA 3CH0A 3QMTA 1VLWA 1KV5A 3WNNA 2QHAA 4WXZA 4GZEA 1O5RA 1H7WA 4GQGA 1RSCA 4M7TA 4C6IA 3WMLA 1KGUA 3MP3A 1ZLPA 3NEHA 1I75A 3PFMA 3A5FA 1XLIA 4ZVJA 4ECLA 3H54A 5G4EA 3QC0A 3IVTA 2PC8A 2ZTKA 2XIOA 3ZJ7A 2PCEA 4J3WA 3SCSA 2QPSA 2G50A 1XUZA 1D9EA 1P7TA 3S42A 1EGMA 2Q02A 2QVNA 3ZVHB 2DH3A 4W8AA 3W7LA 1FP8A 3NPWA 4XZMX 2YL9A 4DRSA 5KETA 3UJ2A 2PDJA 2ZE0A 5H91A 3PG8A 3EPOA 1RCOB 1FHDA 3F2CA 4GABA 4W86A 2ZUWA 3LZ3A 2PDGA 3O8AA 4P5UA 1UR1A 1IT0A 1DJHA 4ICNA 1TMHA 4GACA 4JHOA 1EUAA 2INFA 1JCLA 1VJSA 1BWVA 2VYOA 4CQCA 1FWCC 2YDRA 4JHMA 1LWJA 4REQA 4TO8A 2R91A 5D2YA 4Q8TA 2XDFA 1EC7A 3AIBA 4HPXA 4AU0A 2CZ5A 5IHSA 4NU7A 7PTDA 1OT1A 4A8NA 4DNHA 1QI0A 3CUGA 3TTEA 1R2RA 1UG6A 1K9EA 3SFKA 1WQ5A 3O15A 1AJZA 3VFLA 2VFGA 1NAL1 2CBJA 1PHQA 3PSVA 3G0SA 4KEUA 4W7UA 5LSMA 2CCRA 2DORA 2G8ZA 2PA6A 1IZJA 4PMZA 3ARPA 3PZMA 4GGBA 4O1AA 1RBOB 3AQUA 2WZEA 3TQKA 2ZFAA 3T7VA 3VCNA 3PJWA 2REQB 1D7KA 2J9ZA 3A64A 4A3UA 2C3ZA 4UNLA 2HJPA 3UBPC 3GNXA 5ECVA 1QPKA 4HHMA 4I8YA 1QOPA 3DFQA 1A80A 3EKGA 4UTMA 2VCBA 3LCHA 3IIPA 3TR2A 1HTIA 1OD8A 1OF8A 1QXLA 1TPH1 5C0QA 4IXXA 1R3YA 3IPWA 3XIMA 2OOFA 2QUVA 1OFPA 1JDCA 2A6NA 2WJFA 1YNQA 9RUBA 1O6IA 4FK9A 1EZWA 3TJIA 1F61A 3VGDA 3D6NA 4GG9A 5I3JA 4Z1YA 2R9RA 2XTKA 4MPKA 3LTSA 2X1TA 2NQLA 4RDVA 4GMEA 2ZC8A 4J2MA 2X41A 1V02A 2J7CA 2CXGA 1V51A 2A1YA 5CJNA 2Y7EA 3LBCA 4ZR8A 1Q66A 4IMEA 1W3LA 4HHPA 4NP7A 3M0HA 3BAYA 1G6CA 2Y5SA 5CC7A 4DO4A 1KTCA 2Z2BA 3W27A 1FWTA 2IPWA 1ITQA 3JW7A 1KQYA 2A7NA 4TQTA 3CK5A 3M07A 3PULA 4YL2A 2J24A 3TKFA 2GUBA 3C86A 3ZSTA 1H09A 2FLIA 3BJFA 3DOPA 4GQBA 2PD9A 1X96A 1MEWA 2VENA 2CNCA 2CERA 1E4IA 5C7VA 3CL7A 3DFTA 3ZSSA 2NW0A 1J5SA 1OCQA 4NNBA 4OBTA 3W71A 2NUWA 4AEOA 3UGVA 4ZCWA 3E9AA 2FH8A 3W83A 4PMQA 3A3XA 4H8HA 4RV3A 1R3VA 3GR7A 2IKIA 4HSOA 3GHUA 1CGTA 2VZUA 3WK0A 5L9FA 2WWDA 1IV8A 3S1UA 3W26A 1NWRA 3BXWA 1TJRA 4GIAA 1YMYA 4AEFA 3T08A 4P8WA 2NT0A 1EA9C 1XC4A 3EKZA 4MWAE 3A22A 2BMBA 1M9HA 4H7CA 2PWDA 4GFSA 1Z42A 4L4LA 4C91A 3HJZA 3BZJA 3NVTA 1EX1A 3S0CA 4AD1A 3ZLHA 3N4FA 2PDQA 1DQUA 3CBWA 2O9OA 1NU5A 1S5TA 3NPUA 3CUZA 3QTGA 3UWZA 1XLMA 5DRIA 3K4AA 1SJBA 4JYEA 1RBLA 3GDKA 3OHMB 3NQFA 4M80A 3F5JA 2JGYA 5EMMA 3KOFA 4YTTA 1H1YA 3CQHA 3K30A 3QN3A 1BFNA 1U5JA 3UY8A 1YE4A 3MMWA 3MYPA 3RO6A 3PB0A 2ZE3A 4N9BA 3KVLA 1VZWA 3PTQA 4L9XA 5F4XA 5FKYA 2QCNA 3HPSA 2DT1A 4M6QA 1UD4A 5KEZA 1Q7QA 1XIIA 2YJQA 3MANA 1FH9A 1K8CA 4XZNX 2VEIA 3BLFA 4DHGA 2J7FA 2NQ5A 3KTXA 4IMDA 4HOZA 5HMFA 5F2GA 3LM7A 5HUOA 2ZVIA 3PANA 1US3A 5FEXA 5HWMA 3PPGA 1UZHA 4M8UA 1PYFA 4A8RA 3G1FA 4W8BA 2OSXA 2HE8A 3T9PA 3TJ4A 3M43A 4AY8A 1TWSA 4F0KA 4RK8A 4GI9A 2QV5A 1H7RA 2EHHA 3S1XA 4CQBA 5BZAA 4PA8A 1ENUA 4W5UA 5EMUA 3R5EA 1Z44A 3WF4A 4C1NB 4HK6A 4DI8A 4J27A 3M47A 1IIGA 5DMMA 4LBRA 2CZFA 3M44A 3KZSA 2GZXA 4KBXA 2BWGA 3NM1A 4K8GA 4C6BA 5CGTA 4WSKA 1R47A 3G1XA 5SWUA 1W8GA 2Y0FA 4YTRA 1F4HA 4R5EA 1E6PA 5C2GA 4EXBA 4Y8EA 2E09A 4AQLA 1KTBA 5JIWA 3GXDA 1GOOA 2AAAA 3F03K 3BV4A 3BLDA 4EF8A 3FDKA 3H2OA 5FAJA 4IL0A 3VVGA 2F7FA 5D9PA 4TX8A 2H3BA 2VD8A 1M7OA 2XWEA 1W6TA 3MCOA 3L4XA 2QPUA 3N2BA 1H1NA 2C0HA 3N2OA 3KX6A 5J5RA 3AXMA 3W01A 1BVZA 4PEKA 1XDJA 3LMYA 1CB7B 3C0QA 5K9CA 3RUBL 3UWEA 4DWSB 3WY1A 3T42A 4M1BA 3E6EA 3W1LA 4EOUA 1TE1A 3IS4A 3KFTA 4LS2A 2E5BA 2WMGA 1E9ZB 3U0HA 3ABOA 1HGYA 2X09A 3CQ0A 1US0A 2J47A 3DHDA 1M1BA 2X0SA 2PDXA 2UZ9A 2YDAA 1LJYA 1YXYA 3LBMA 4UTHA 1EJUC 1S1RA 1Q6GA 3VAVA 5D2TA 1LF1A 2I56A 4YWIA 1VFUA 4FI4A 3QRHA 5IM51 5D8WA 4EF9A 2X1SA 4JX5A 1UC5A 2HNEA 3MVIA 2ZA2A 1E0WA 3CZJA 3MV01 1EIBA 4N4PA 1JZ3A 3QQ0A 3RGTA 5CJMA 2D3NA 3PZ9A 2A85A 4KPLA 4GYFA 1U22A 2AL2A 2ZWYA 2AQWA 3HTWA 3ZT7A 5A95A 4JCLA 3KOXA 4S3DA 5ABHA 1FWNA 1WOAA 4OECA 4LAUA 5I06A 1RCQA 3SCWA 3DYPA 1W1TA 2BGSA 4WJ8A 4JQ4A 2Z28A 1AMKA 2NQJA 3PY2A 1GZJA 4GIYA 3LA4A 4F9DA 4LB4A 1VAHA 3CAQA 2ZUUA 2ZRWA 3BLEA 1NWSA 1XIHA 4IQDA 5JBDA 4NQ1A 1OQFA 2XG9A 1GOIA 5H2ZA 3MCNA 2X30A 3BVJA 3SJNA 1KA9F 2GLKA 4GX9A 1FWFC 3MSGA 3VD5A 4S3AA 3NQMA 1DJNA 1GZGA 1AQFA 4HNOA 3SRHA 4I9TA 2HS6A 1HZYA 2FPTA 2WB5A 3P62A 2PP1A 1DVJA 3TUUA 3GUWA 5EYWA 1OEPA 4KS0A 1JF6A 1XP3A 4XAGA 1HL9A 1QASA 2X40A 5XINA 3SCVA 1J2WA 2P0IA 1JQVA 1XW8A 2GWGA 4PRWA 1QJWA 4ES4A 4UTWA 1GW9A 3Q4DA 2VM8A 3NSMA 4S3JA 1BTMA 4IF2A 3DKJA 4HMEA 2J77A 4MMWA 1X8FA 3H7VA 1JGMA 1R3RA 1HL2A 4LAMA 4IM4A 4QNWA 2FH6A 1US2A 3B05A 3PG9A 2YYTA 3W76A 3N4AA 2WJZA 1TWIA 4WJXA 3PB2A 2A3AA 2XUCA 3LNMA 3UD6A 4ZZ9A 1QATA 3DI0A 1XIBA 1NY1A 1OABA 4KIEA 1E6XM 3N9RA 3GFZA 7XIMA 5HXMA 1WZLA 3KVMA 3GVGA 2MANA 3A4JA 2Z29A 5LNRA 1KQZA 2ZYFA 3EB4A 3SCNA 3WLTA 2LLEA 2ZA1A 2PGEA 3V7PA 3N17A 5JBEA 1RALA 2OT0A 1QWGA 4B9ZA 5HA7A 5A6LA 4DJED 1OX4A 2F6UA 2XZ9A 4GWEA 4MUPA 3G1DA 3U2EA 1QDSA 2NV9A 4B9YA 1MEIA 3GH4A 4QJ4B 3WDRA 3LCXA 3CTTA 4GZ7A 1EPXA 4IPPA 5E0FA 3ITGA 1WYIA 2PDMA 5AHFA 3TYEA 1WV2A 1ZNNA 4OHQA 2DZAA 3EWXA 2B0MA 2YCEA 2VGBA 3GIQA 5D30A 3C0JA 1XC6A 1K70A 4GJIA 1V02E 1TVLA 1NOUA 3UWWA 5I3IA 4O12A 3W86A 5DQPA 1R3QA 2ACRA 2JGQA 2DZBA 3U4FA 3RAOA 3C4UA 3NSXA 1MXSA 5A3HA 3PPCA 1XLCA 2W79A 3IGHX 3U48A 1KBIA 2JBMA 3H24A 4O19A 2YDSA 1IXQA 4LH8A 2VRQA 3SR7A 1JPHA 2G4JA 4ILSA 5LNVA 4FALA 5FJPA 2WOQA 1XKYA 4CNPA 3TMLA 3DEQA 5FEZA 3GWQA 4JBRA 3M0KA 3EA2A 2P0OA 2W61A 3K8MA 1FH7A 3KVKA 1OINA 2Y61A 4LRSA 2ZX6A 3HPXA 4V15A 2ZZ7A 1XD1A 4FA3A 4XQ6A 4Z1AA 4B3KA 2GSJA 5CC3A 1IGSA 3BZGA 2VC5A 4XUGA 4Q8QA 5FJRA 2WZHA 3TFCA 5AC4A 4PYSA 5AC8A 1ZBVA 1OT2A 1KXTA 1GQIA 3S1VA 3WH9A 1ISWA 1K6AA 1E1CA 1DYSA 3L5LA 1FXPA 4RE3A 2TODA 4LYQA 1OIMA 2J6VA 1Y65A 2WPBA 3RRXA 2NXHA 4XD3A 2QR6A 3VM7A 2Y8KA 2YDQA 4US5A 3OLDA 2VFIA 4PMVA 4GE8A 2D2GA 2PTZA 4GYKA 3GZAA 4EANA 1CGVA 4C1LA 4B5TA 1FCVA 3WD0A 5C7HA 2J4GA 1TV5A 4DF2A 1AZ1A 3QKEA 1BKSA 2QPXA 3AWNA 1TYGA 2WO5A 3VOGA 3DBNA 2Y6ZA 3UWYA 3SY5A 3TR9A 3BICA 2OYKA 4O0QA 3LPPA 4HP5A 1GHSA 3B4UA 3N6HA 2BNJA 1XH1A 2Z6IA 4Q7IA 1M04A 4E4UA 1OFEA 4GXWA 5GJPA 3WNLA 1DWGM 5A2CA 3O6DA 2KX9A 3M0XA 2WSYA 1RBAA 1TV7A 1IHIA 1PV8A 2RGLA 2QCEA 3E0IA 4OV9A 1FH8A 4JKMA 4GOAA 2O92A 2FTWA 5FA5A 4ATLA 4OUEA 2IKJA 2VX5A 1E6QM 2PDNA 2WVVB 3CASA 3MUXA 4K68A 1DE5A 1KRMA 5EMKA 2OKOA 1QPOA 3ZIZA 4O0ZA 3TYBA 4D1IA 3UXIA 3OLIA 3UYIA 5CPLA 5G2WA 5CC6A 2QGYA 2FPYA 1ISXA 1LWHA 3U7BA 1IT8A 2B7NA 3W7GA 2YW3A 3KS6A 4KT2A 2BASA 1UPPA 5T26A 1K02A 1KCZA 4A2RA 3LZ5A 3GTXA 4IQJA 2PZNA 1GKQA 4N9CA 3BLIA 2YBUA 3NQEA 2WC7A 1QNRA 3LEPA 5CPMA 3USBA 3BANA 3ELFA 4O1DA 2JK2A 3E02A 2YSWA 4GI8A 4ZFMA 2FDMA 2WV8A 3ANVA 4C6JA 1TCDA 3UW6A 2DIKA 3MY9A 3BW2A 4ZB2A 3TQ0A 2QCDB 3N15A 5IOBA 4FNUA 2E7FA 5E0CA 4PC8A 2NSOA 5I07A 3STPA 4UMAA 1EXPA 1N7KA 3TFXA 3VDGA 4Y96A 3TNOA 1QR7A 1RA0A 3WLSA 2V3DA 4ZO6A 4C1NA 2G4FA 3AJXA 4M24A 4WK9A 4QIUA 3TLLA 4Z2GA 3HM7A 1O5QA 4AIEA 1PJ9A 1HQTA 4PMOA 1RCXB 3BAIA 1XCFA 1OB0A 1A53A 2PC4A 4F8XA 1KW1A 4YLWA 2YA1A 4PBEA 2PWFA 3RLGA 1K9FA 5DELA 3T6CA 1RJQA 2YOCA 5A2BA 2D0HA 1OK4A 1WZKA 2Z6JA 4KWOA 4GNVA 4IICA 1W9VA 1W5QA 3MPGA 3EWCA 4WZHA 4H7VA 3REQB 4DWSC 5HNRA 4DB7A 1AW2A 1MRAA 1X38A 1U5HA 1WAUA 2VI0A 3OOQA 4V28A 4IWWA 4AZ7A 4V2XA 3EX1A 4GVHA 1FWGC 4L1WA 3TROA 1K1DA 4DJDC 3APGA 2VURA 3VOFA 3NOEA 1WBHA 3M4HA 3OBAA 1LZOA 4NI3A 1QFEA 2IQTA 5I24A 4JTLA 3POHA 1LL6A 2D2HA 3HQOA 3XINA 4ZA0A 3L4UA 3RJXA