3GNDA

Crystal structure of e. coli lsrf in complex with ribulose-5-phosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
280
structure length
276
Chain Sequence
GKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVVRDQRYFSLATRIAAEMGAQIIKTYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aldolase lsrF
publication title The crystal structure of the Escherichia coli autoinducer-2 processing protein LsrF.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 276
sequence length 280
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gndA00
1S5TA 1TTPA 5C54A 1U5JA 3P80A 4Q32A 1RQEA 3TAOA 5HMSA 4LRTA 2PC4A 2QJHA 3O1NA 3MP4A 2Y89A 3WJSA 3TJLA 1W56A 2PRHA 4UFKA 3STEA 4UTLA 2VELA 1SZEA 3LXAA 1A5CA 1JCLA 4N02A 3W2JA 3QMRA 1LP6A 1TV7A 2GVLA 3LTPA 1LZOA 1TJPA 3A24A 2QKFA 4FXSA 1F73A 2E1DA 2V5LA 3W1UA 3P84A 3NM3A 3HJZA 3Q37A 1GOXA 4NUWA 4LUJA 4LU0A 3UD6A 4XKYA 1I2PA 4UNLA 1VPXA 3I7SA 4A2SA 1JCNA 1K8ZA 2JGQA 4Z0JA 1GQNA 2WSRA 3UWUA 1HL2A 1W0MA 1QMLA 3KVJA 4FB7A 4WD0A 2FPVA 2ZZ7A 1TB3A 4HNNA 3DHFA 4AHOA 3BW4A 3GDKA 1Q6QA 1K02A 2A6NA 3C3NA 3RLUA 4IPIA 1TPH1 3TQ0A 5BNKA 2HS6A 2WQPA 3O63A 4DO4A 4TMBA 3QPZA 2Y62A 2ZA3A 2Q8ZA 4C1LA 3GDRA 2C18A 4E2BA 3NQGA 4LW7A 4MJMA 2NUXA 3ATYA 4JTFA 4I7VA 1LRTA 4N4QA 2GVGA 3G1VA 3L65A 1H51A 3G1XA 3W23A 2YYTA 3HPSA 3HGRA 3S5ZA 1G6CA 1OFBA 4DBDA 3A9IA 3NPUA 2CZDA 3A22A 3LRKA 4R7JA 4MZ1A 1FY6A 4M7SA 1J4EA 3LRLA 1OFRA 1T8XA 4IGHA 4JICA 1QR7A 2W79A 3BO9A 2NWSA 4YLWA 1LRQA 4RK8A 2VFDA 1E51A 1LCOA 4P2VA 5FEWA 2J6XA 5LNVA 2EKCA 1K3UA 3T78A 1R47A 1QOPA 4N9EA 4JX5A 3N2MA 2WNNA 4GC4A 4XBKA 2NV1A 2QUTA 4FIQA 1J5TA 2FPYA 4IUOA 4O28A 1I2RA 2J24A 3QC3A 1MO0A 4DF2A 1W3NA 2RHGA 5U4NA 3LTYA 3H53A 4A29A 5CZJA 5D2WA 5K9DA 1YLVA 1JRBA 3EX1A 4O10A 4OWGA 3ZS4A 5AHIA 4YMZA 2RDUA 5LNSA 4OBTA 1PV8A 3M41A 3S9YA 3PSVA 5F2IA 4BI6A 3GDLA 4I7UA 4PL2A 4EWND 4C1KA 3O6YX 4M6PA 2J9YA 4AAJA 4LRSA 3NQ7A 1EB3A 1MEIA 3PBVA 4LWWA 5AHFA 1BTMA 2TRSA 5A5WA 1SSDA 1WBJA 3FYPA 3TH6A 2TYSA 2FPTA 3O05A 1OFAA 1O94A 2H8XA 3GXNA 2A4AA 2JKPA 4HPXA 1JCYA 3P82A 3SR7A 3IEBA 1UCWA 1TSIA 3S8HA 2DZPA 3TE9A 2V30A 5D30A 2R94A 2FJKA 2QCEA 3M6YA 2X30A 3R89A 4ADUA 2OT1A 1OFQA 3TMLA 3LERA 3HIJA 1FCBA 3UNDA 1ME8A 5HULA 3PAJA 3LI0A 1DJNA 3MHGA 2A7RA 3P61A 5EPDA 1ME7A 5I3FA 1H1ZA 1VQTA 3N3MA 2ZZ3A 1G4PA 2BXVA 1OK4A 5FF7A 4UFHA 2ZZ6A 2Z2UA 3MJYA 4ZVJA 3W1LA 3M44A 3EX6A 4UTIA 1H5YA 1W1ZA 4YL2A 2TSYA 4TMCA 3C52A 3BG9A 3EX4A 1SZFA 1XBYA 3TC7A 2FIQA 3E12A 5F2MA 4WUIA 3DFOA 2Y7DA 3DHDA 2OCZA 1F76A 4N2YA 1GT8A 1VJIA 3W7PA 1KLZA 3NQVA 4NXSA 4PTNA 2XN2A 4N9DA 7TIMA 3CIWA 1KTBA 3H54A 4LT9A 1LOLA 3C2VA 3TIMA 1R2SA 3G1HA 4FNPA 4PCFA 3G1YA 4ZL1A 2CLOA 1DL3A 4Y8FA 2YW4A 3KVMA 1QPQA 3DFSA 4DELA 1LBLA 3LBMA 1NF7A 3FIGA 3NQ8A 1TTQA 1AW2A 3RNDA 5G2WA 1UUOA 3TQVA 3UWVA 4LS2A 3OIXA 2GUUA 5FEPA 3S0CA 1NF0A 4O1DA 3NYZA 2RDWA 1W31A 2NXIA 3P60A 3O15A 4Z1CA 4ZMGA 2ZRWA 4LVFA 1TPFA 3W73A 1XBXA 1G4EA 1GZGA 4M19A 3KAOA 2CU0A 3E02A 4NZJA 1QO2A 3L5MA 2P10A 1VYPX 2YCEA 1QDSA 3LCGA 1QO5A 4DPPA 3L21A 4H4IA 3ZWTA 3GAYA 1FUYA 1KFBA 1GTEA 1SSGA 3EX2A 4Y90A 3ZWSA 1N7KA 2VC6A 5DCBA 5I3HA 4AHQA 1JULA 1S5VA 2WSYA 3SW6A 1K7EA 4E2DA 3KXQA 4OE7A 3HGOA 4W9TA 3HPXA 3HBLA 3MYOA 3GR7A 4PFMA 4UUIA 3W1QA 3IVUA 3DFTA 3Q58A 1HO4A 2VEPA 4Z1AA 1RD5A 2ZRVA 3ANYA 3KRZA 1PS9A 4MY1A 1TTJA 3U8GA 1TCDA 4XUGA 3LLDA 1TMHA 3QSTA 3B0UX 3S1XA 3L67A 5DLCA 5DXXA 1JRCA 4WY0B 2NUWA 3TQKA 2YXGA 3PVFA 4NJGA 3UWWA 3FFSA 2YX0A 5LNWA 1X1ZA 5ABTA 4IMGA 4O19A 1BKSA 2AQWA 3NQMA 1DKWA 1F2JA 1W5OA 1K7XA 4I7WA 3MMTA 1Q3NA 1KFKA 4RR4A 1W8SA 5H91A 3GK0A 4PEKA 3SECA 2FQIA 3P74A 3GYEA 3FLUA 3ABQA 1D9EA 4CNOA 4H6KA 2VFIA 3NQFA 5C55A 5K9CA 1FDJA 4NU7A 5BRBA 1UJPA 3HGJA 3RFAA 1OYCA 2A0NA 2E6YA 3EWYA 5D32A 2X16A 3K30A 4CCDA 1JCJA 4FNQA 2QJGA 5DCEA 5DY2A 5HQEA 3EXRA 4O15A 1Q6LA 2DZSA 3LHUA 2V2HA 1K03A 1I8JA 3QEZA 2OT0A 4MUZA 4UC5A 5EA9A 2QCGA 4P61A 5AYYA 3W07A 2CLLA 3TUUA 5F4SA 3DENA 4JX6A 1LBFA 3OVPA 3DZ1A 2Q3OA 1IIGA 4IJBA 4L4MA 2WNQA 3GDMA 5K3VA 3G1DA 4AF0B 3MI3A 3LXBA 3DH7A 5BMWA 5D05A 2RDTA 3MBDA 4LNYA 1YTKA 5EY5A 1YDOA 3JS3A 4WJEA 3FS2A 3I68A 1BWKA 3TJXA 4QAIA 3E9AA 1H60A 3N9RA 2EAWA 3CQ0A 2EPHA 2FTPA 3PBUA 4O1CA 1FBAA 1FXPA 5CSRA 2Y85A 1XBZA 3LI1A 3LHVA 3CWOX 4XBSA 4FNRA 5D09A 3QQ0A 1WQ5A 5DBUA 4UMBA 2YSWA 3LCWA 2E5CA 4JTEA 5KMYA 4PC8A 4E38A 4IXHA 4JTLA 2VFFA 3U2OA 1ZJIA 2NWRA 4JY8A 3W7HA 5CSSA 5D02A 1PIIA 3WK0A 1QWGA 4O0KA 4O1AA 3NL5A 2CLHA 5K4XA 5T26A 1YDNA 1EEPA 1FCUA 3LV5A 1IXQA 1HG3A 2DZTA 4NXKA 4ICNA 2V8ZA 4H3DA 1OX5A 3LTSA 3WJYA 4JEQA 4MY8A 3DI0A 4JNMA 4A22A 1I4NA 3KVKA 2VKZG 3QSRA 3QW4B 5AHNA 3IIZA 3GZ3A 2CLMA 3EWBX 2E6DA 3P8IA 1LOQA 4L4LA 3UWZA 1KTNA 3CC1A 3PBYA 4N6FA 1PHQA 2YFNA 1O60A 3W88A 3OVRA 4XQ6A 1LRNA 1XUZA 4X9SA 1CI1A 4TX9A 1F05A 2VEKA 3QF0A 2ALDA 1CX9A 4GE8A 2CLKA 2AGKA 3C0JA 3W72A 1DOSA 2QAFA 1TRIA 3DKLA 1XKYA 3KRUA 3F4NA 4OGZA 3TA6A 4MPQA 4Z0SA 3W7GA 3G1AA 3HG4A 1FDZA 1MEHA 4LUIA 2ZRZA 3M0ZA 2RKXA 1AW5A 5DN1A 3LHYA 1X8FA 3NQEA 2G96A 5C5YA 1PE1A 5CZSA 3BV4A 3S5NA 1IGSA 1LORA 3L0NA 1SO5A 1QFEA 3M5YA 1OABA 4O17A 2WSQA 2NX9A 3NZ1A 4FEZA 1SW0A 5I3KA 4AH7A 4NNAA 3UZJA 5HJLA 3LM7A 1LLZA 4AVFA 1W5MA 1O5XA 3TC6A 1B4KA 1GTHA 1VCVA 5AFDA 4Z08A 2QCMA 5G1YA 1QNVA 3NPXA 4WXZA 4O11A 2C16A 4JIQA 4NJHA 3B06A 3LLFA 4BI7A 4BFAA 4QNEA 5E93A 4UTUA 5HR6A 1H62A 1KFCA 1GPWA 3LDVA 3SJ3A 2BTMA 5LNRA 1T96A 2NXHA 2ZYFA 5GVJA 2A5HA 2A6LA 2B7QA 1SFLA 2NV2A 1RZMA 4WOQA 4JTKA 3QRHA 4FF7A 4O8RA 2BSLA 3S1UA 4NZFA 5EYWA 2Y6ZA 3TDFA 3DFNA 2GQAA 4O4VA 1OG0A 3U6WA 4K36A 4FNSA 1GEQA 2QCNA 2V2DA 2B7PA 4HHPA 2X2GA 3TSMA 4EF9A 3GKFA 4AWTA 3CPRA 4UR7A 1DHPA 2C1HA 2DZVA 4RZ6A 4MFDA 3Q2DA 2WJZA 4J9JA 2J9ZA 1R30A 1TIMA 4FO4A 5AHMA 2QDGA 1B4EA 2CW6A 5AYZA 1TV8A 3DBPA 3HQ1A 1KM0A 1A5AA 1OFEA 4IX2A 3IGXA 3M7WA 2QCCA 3LCXA 4CCCA 3W86A 1G4SA 2E5BA 2Y88A 1C8VA 1H7OA 4MY9A 2QR6A 8TIMA 3BG5A 5LGXA 4NX5A 4DEFA 4DO6A 3GAKA 3VE7A 2G95A 3USBA 5KSWA 1VCGA 1ALDA 4UIOA 1RPXA 3C6CA 2YPIA 2GQ9A 2OZ0A 3TXVA 1K8XA 1DJQA 3W3OA 3FOKA 4UTMA 3VI2A 3ATZA 3L66A 1Q6OA 3C2EA 4GWEA 3C56A 2JKEA 1KV8A 1VHNA 2BLEA 2ZFAA 1JUEA 4MOZA 5D03A 2WOQA 1VRDA 1GVRA 3OVQA 1F6PA 2ISSA 3JRKA 4JIPA 2V5BA 3IIOA 4O13A 1V5XA 4JN6A 4U28A 2OX1A 4X22A 3T55A 5D2VA 2X1SA 3QW3A 4JTSA 3S1VA 3P7YA 3RK8A 1KM6A 4K7YA 5G4EA 1P0NA 3P81A 2DZUA 1OYBA 3GIYA 1OYAA 1KW1A 4Z1DA 2HMCA 1CW2A 5G2IA 4O54A 4AHPA 4RV8A 3I65A 4GUGA 4D2JA 1YTEA 1JQXA 1TJRA 2QCDB 4HSOA 4JYEA 4ZZ9A 1MEWA 1H7XA 4LY8A 1F6KA 3G3MA 3NO5A 5KINA 4RZ4A 4OV9A 3ABOA 1TPEA 3L5LA 4GUHA 3FYOA 1EP1A 4DXVA 4IXXA 1FCVA 1A5BA 1HFBA 3EX3A 1VH7A 3F4WA 1VLWA 4WOZA 1X6UA 4O18A 2I9EA 2YDAA 2Y7GA 4DPQA 4BR1A 2A85A 2QEZA 3KFTA 2E09A 2E6AA 1EUNA 1XI3A 3GDTA 2C0AA 4NJKA 2ZZ4A 1X1OA 2ISWA 2QCHA 4TU1A 4PODA 1KBJA 3FJ6A 3G0SA 3UYCA 1FWTA 1G4TA 1T99A 1F5ZA 1Q6RA 2V9DA 3UWQA 4UTKA 3B03A 2Y7FA 3QZEA 2A7NA 1YXYA 1VHCA 1VR6A 3P5ZA 1JR1A 3JR2A 4WQ6A 4DF1A 3QM3A 1DQWA 1QPOA 2VEMA 2X1RA 5AYXA 3SI9A 1GG0A 4JYDA 2QUUA 5LZLA 4IWWA 3G0UA 3W7EA 1NEYA 2E5DA 2RFGA 3TXZA 1LDCA 5FF0A 2BZNA 2F7FA 5FF2A 2C19A 3STCA 3B0VC 3A5VA 3DKJA 3AO0A 2PURA 3BLEA 3S1WA 3W2LA 1XCFA 4XTIA 4AWUA 2V81A 3SFKA 2A21A 4O50A 3G1FA 5FEXA 4IQLA 4EF8A 4MLRA 3W87A 3QFEA 2B7NA 4YCOA 3IIPA 5J5DA 3WK1A 1TV5A 3KVLA 4LTSA 5C6MA 4JD4A 3GNNA 1M7PA 1BWLA 4O52A 2ZTJA 1KM5A 1ICSA 1KA9F 3PB2A 4O57A 5D33A 4WY0A 3P8JA 2GJLA 3LHZA 3NAVA 4MFEA 3GXPA 4S2CA 1NVMA 4AWSA 1KV5A 4HN4A 3PULA 4EVZA 3N19B 3DGRA 3NL2A 1PVNA 2H3DA 4LVGA 1TPB1 1W54A 1Z42A 3IVTA 3NM1A 3L68A 1OX4B 1GVFA 3W1XA 3P5YA 4R34A 3O06A 5EKYA 4K8EA 2HS8A 1OFPA 1AL8A 4NX0A 3LCIA 5CPOA 1ONRA 4O16A 3W7OA 1FQ0A 2PRMA 5TQLA 3P62A 2V0TA 3PF3A 2C15A 3CM4A 1EUAA 5E1QA 2HSAA 5E0KA 1PCKA 1SR9A 3LXCA 4GUIA 2Z1BA 1MZHA 4G1KA 3KHJA 2NX1A 4ALDA 4HKPA 4OV4A 1WOAA 1WA3A 5AC7A 4E0CA 2J88A 3THAA 1SO4A 4YWIA 5KZDA 3IV3A 3G18A 2B7OA 3FKRA 4N9BA 1KBIA 1JCMP 1W5NA 4ML9A 4LVDA 5DELA 1DORA 3NZRA 2ATMA 4UFIA 3O6DA 3PM6A 1L2UA 2WPBA 3TFCA 3G8RA 3M5XA 2H90A 2Z0IA 4JTIA 4AF0A 4JTUA 4UFMA 3CEPA 1AL7A 2EF9A 3KX6A 3R13A 3FKKA 5TIMA 2ZZ2A 2YFOA 5J5RA 3D0CA 1H7PA 1TQXA 5KITA 4ZQMA 2CLIA 1FWNA 1VYRA 2X1UA 4JTJA 5LKYA 3W83A 5FF4A 1EX5A 2JKAA 1FDYA 3WJZA 1GVQA 5A8GA 4HT3A 3W7CA 3UY8A 1ZENA 3BARA 4OU1A 4Z1BA 1VZWA 4IMDA 3G8EA 5CKSA 3UWYA 2NLIA 3DXIA 2CZ5A 2ZDRA 2YW3A 4GXMA 3A23A 3W7MA 2AAMA 4MIMA 3A21A 1GYNA 2UV8G 4AEOA 5AHLA 3STGA 4IOTA 1KFJA 4X3ZA 1KM1A 2DP3A 3N34A 4ZQOA 1WOBA 1YDVA 2BWGA 3SY5A 1ZFJA 4WZHA 5C2XA 3W70A 3EB2A 4K37A 4DF0A 3FA5A 3TNOA 1IXNA 4IMEA 4YXGA 1K7FA 2ZA2A 1FWRA 2D73A 3EXSA 4LC6A 4O12A 3NPWA 1LM1A 2H6RA 3DFQA 4UNKA 1A50A 1IXPA 1R2RA 3GR8A 1LTDA 4LVBA 1EWEA 1EIXA 1GWJA 4OHQA 4Y6GA 3G3DA 3PR2A 4MKNA 4KKXA 2DZWA 1MSSA 4OT7A 2R14A 2F84A 3B04A 4A3UA 3VFLA 1U83A 3L0GA 1OFDA 5HWJA 1R2TA 5FEZA 1ZAIA 5AN7A 3TSDA 1EA0A 2PRLA 5EMUA 3W22A 1YADA 4AMAA 3Q94A 1G7VA 2Z6JA 1KM4A 4M6VA 3C2RA 4LOCA 2E77A 3NPVA 3HG2A 2A7PA 5EBUA 3S42A 1H1YA 3O8AA 4HIBA 4GBUA 4ORMA 3NOEA 3LGEA 3N2XA 5IM51 1ZHAA 1OF6A 1UB3A 5LHFA 1SPQA 3ABSA 4YCPA 3HO8A 1C29A 5CGQA 4EOUA 1XL9A 1SFJA 1ADOA 2WKJA 3N9SA 3DI1A 1WXJA 3T4CA 3IIVA 3I7RA 1VLIA 4NNBA 2O7SA 2YZRA 5F1UA 3GXTA 1M5WA 2Q3RA 1ICPA 3P67A 1EP3A 3L9CA 1YYAA 3W1MA 4HSNA 4B5NA 3UXDA 1OX6A 1XDMA 3F1QA 3NDOA 4FX6M 3OG3A 3M5ZA 2VENA 4RXFA 3IGUA 5HWMA 3PC0A 2GPTA 4MZYA 2OJPA 2TPSA 3M1ZA 1ZAJA 4NQ1A 3C2FA 3AJXA 1LBMA 3SSJA 4LS1A 3KOFA 1Z41A 4PA8A 4JS3A 4LV4A 3OBKA 3W76A 3NQCA 4CNNA 4RZ5A 2ZRUA 1VC4A 5LSMA 3EWUA 5K9XA 1NSJA 4ZQPA 5LGZA 4POCA 3S5YA 3B8DA 1UBSA 3W2UA 4AXKA 4RX0A 1IF2A 2VFGA 3F03K 2I1OA 3W7DA 4CLMA 1W5PA 1L9WA 2ABAA 2Y63A 3MW7A 3T40A 4TR9A 1SO6A 1R46A 5HNRA 2ZA1A 5I3GA 4GNJA 1PL9A 2QDHA 5HINA 4ZQCA 4DQWA 1S3HA 2R91A 3PG9A 3V75A 6TIMA 2GQ8A 5AOUA 3GLCA 1SO3A 1W3IA 3IVSA 2Y61A 4RCXA 4GUFA 4N6EA 4DO5A 4LS0A 4Q4KA 1TPVA 2VFEA 5I3JA 5SWUA 4NT0A 3ELFA 4UCGA 3TW6A 2OMAA 4FIRA 2VOMA 3LX9A 2FLIA 3VKJA 4XTDA 4QM1A 4MZ8A 4R33A 1KM3A 3BLIA 4FX7A 4NVTA 3WJXA 2CLEA 6ALDA 3GKAA 5KTLA 3OEXA 3W7RA 3W7QA 5K7JA 1SW7A 4ONVA 1OF8A 3BPWA 1FX6A 2XN0A 2BX7A 3PBWA 4QJ1A 4JR5A 4FXRA 3MHUA 2V82A 2ZCGA 5L6UA 4ORIA 1LLWA 4XKYB 1G67A 2QF7A 4QNWA 2P1FA 4WX2A 1YXCA 3LCLA 1J2WA 2CZEA 4ZQRA 1WX0A 1TPDA 5HR7A 1X7FA 4UFJA 1RR2A 1GVOA 3A5FA 1M6JA 1TPC1 4GFSA 4WY0F 3CT7A 4KWVA 2GVJA 1L6WA 3W84A 5KZMA 1QOQA 3R12A 1XUUA 3HG3A 3NEVA 1VGAA 3BVJA 4LC8A 3HOJA 3W2KA 2NZLA 1TPWA 4GRSA 3B0PA 3DAQA 1WYIA 3RF9A 3FJLA 4N9CA 5FI8A 4O1BA 1GYLA 1GVSA 3MI6A 1T0OA 2G5WA 4K39A 1S5WA 3THQA 5F1VA 1FWWA 3QH2A 3W71A 2Y70A 2A2IA 1B57A 3SGUA 1JQVA 1Z48A 4RXGA 1C9DA 3NNTA 3WK2A 4JDBA 3VNDA 1KTCA 4RKAA 2DJXA 2NUYA 4XWUA 1HO1A 3NQ6A 4O0ZA 2CZFA 1M7OA 1OK6A 1H61A 4O14A 1XFBA 3GVGA 3W7NA 2R8WA 3KRSA 5HUPA 3QYQA 5BOOA 3TV8A 3W7LA 1TRDA 2H3BA 4PL1A 4UTJA 2LLEA 5K2ZA 5G4WA 1NFBA 1AW1A 2QCDA 3C2OA 3EWZA 3G24A 3GB6A 2Z6IA 3CB8A 4UXDA 2YR1A 4JXCA 4MYAA 3C4UA 4IMCA 4JGDA 4M5PA 2TMDA 4FNTA 1O5KA 1GJPA 1TO3A 2CLFA 1H50A 3H55A 4UTWC 1H7RA 1EPXA 3TK7A 3HF3A 5BMXA 1LYXA 3HGSA 3C8FA 1MXSA 1Y0EA 4CCEA 1DBTA 4Q33A 4CNPA 5G1TA 4HNUA 1VYSX 4U4MA 4UFLA 2DORA 1K8YA 3E49A 2QUVA 4XZ9A 5D04C 3MO7A 1Z44A 1ZALA 1FWSA 3SZ8A 3DFPA 3RMJA 1AK5A 1WV2A 3O16A 1RVGA 3IIXA 5K4ZA 4DBEA 5LNUA 1XBVA 2ZRYA 3PY2A 1KFLA 1QPNA 2FB3A 3NL3A 1I2NA 1N55A 5L9FA 3R8RA 4CQ9A 3HB9A 2QCLA 5D2YA 3LHWA 5DCDA 1A53A 1H7NA 2ZBTA 3NQ2A 3MHFA 3OHIA 3UPBA 5AB3A 2DZXA 3MP5A 3EWXA 2C13A 3N14A 2XN1A 3BLFA 4HPJA 4I9AA 3NG3A 3RU6A 5DY3A 5CPNA 2IQTA 3NA8A 3G1SA 2J9XA 4QIUA 3ABRA 1JJKA 5AC6A 2Q8LA 3V1PA 5LHEA 1W5QA 3UZ5A 4A2RA 1B3OA 2ATSA 5H2ZA 3CHVA 1PHWA 3LBCA 3MBFA 1A5SA 1SZGA 5AC8A 4OQVA 1XM3A 2I14A 2X1TA 4UTWA 1UUMA 2VEIA 3I6RA 4MYXA 4UR8A 4M6QA 1IXOA 3QQ1A 1IIHA 1HUVA 5BW6A 4K7VA 1RQBA 3B05A 5DBTA 2DJLA 1H63A 2QCFA 5D38A 3W75A 1YPFA 1YXDA 2Y7EA 3STFA 2JBMA 3UY7A 3IRDA 2YYUA 1OX4A 1DV7A 4JTTA 5F2LA 3GX9A 4O4WA 4BF9A 1P0KA 1N8FA 1AG1O 2CWNA 4FNUA 1LOSA 1PCWA 3NVTA 3W2NA 5D2TA 1LROA 3TMQA 2KZHA 4MJZA 4NJIA 1JUKA 1ZNNA 1SU5A 3ZFHA 3W1PA 5D37A 4JDYA 2EGZA 5U7SA 2YGYA 3S5OA 3WK3A 2E6FA 2QAPA 3LOTA 3PSWA 3BGGA 4JYFA 2VFHA 1BEUA 3NL6A 2B0MA 3E0IA 3CEUA 4QSHA 1I2OA 3UQNA 2E68A 1JUBA 4TO8A 3W85A 3W7IA 4K38A 2XFWA 3BW2A 4BWLC 2ZQ0A 4LVAA 3E96A 2W0UA 3I7QA 4MLJA 3YPIA 3IGSA 3O6CA 2WO5A 4FX8A 3PUEA 4ADSA 3NQDA 5KZEA 1KFEA 1GG1A 4IX0A 3TROA 1I2QA 4HNVA 1FXQA 5F2GA 1ICQA 1W3TA 3TX9A 3TKFA 4NNCA 5MHBA 3NGJA 4N4PA 2V2CA 2FDSA 2VXNA 3CU2A 3SGZA 2RH9A 3R5EA 3S6DA 1ME9A 3EXTA 3G0XA 3LHTA 3W74A 1RQHA 3W1TA 2G97A 3BK0A 3G22A 5I3IA 3FEMA 1XXXA 3DU0A 1SW3A 3PB0A 4CQAA 2FB2A 1VCFA 3EKZA 3LRMA 2C3ZA 1DVJA 1L6SA 1P4CA 3L2IA 3MI2A 3B4UA 1OJXA 3INPA 3LB0A 1ZCOA 4UMAA 3NR0A 1QPRA 1EWDA 3UXAA 4BWLA 1EP2A 3VCRA 2A1YA 1H7WA 2PE4A 3HG5A 4X2RA 3QPYA 3QJAA 5DXYA 4TIMA 4M7TA 3QMTA 5CPLA 3GNDA 3W2MA 4KWWA 4FHAA 3LCHA 5F4XA 1FCQA 1G69A 1O4UA 1AMKA 1D3HA 3MWAA 3R2GA 4O53A 1W37A 3CWNA 4HNTA 3BG3A 2NX3A 5F4WA 3TFXA 4GUJA 4IPJA 4RLIA 1HTIA 3PWAA 4JX4A 2CFFA 4UTHA 3M43A 3MP3A 1THFD 4QITA 3PG8A 3C61A 4S2BA 4KFPA 2GOUA 2NXGA 1KLYA 2W6RA 3SIZA 2ABBA 2JK2A 1YTDA 3W6YA 3OA3A 3PUDA 3WFAA 4MVAA 4Y96A 4JTGA 3HMJG 1I45A 4UTTC 1SQ7A 3BGJA 3W1NA 1G7UA 5IBXC 1TYGA 2ZRXA 3CTLA 5FESA 2GJNA 1JCXA 2WNZA 3RLVA 3M47A 4RJEA 5FF3A 3EKLA 2O7QA 5G2HA 4GJ1A 2ZZ1A 3TR2A 1SZNA 3EEGA 2ZTKA 3PS7A 1P5BA 1D3GA 3M16A 1ZAHA 2ZZ5A 3MYPA 2JGYA 4Y9AA 5D2XA 2P0OA 1WBHA 4AB4A 1NAL1 5CZ0A 3TSBA 5CPMA 3UPWA 4QQ3A 1DQXA 4A21A 3BW3A 1L6YA 4WXYA 4JY9A 1OFOA 1QAPA 4BK9A 2B4GA 5CG7A 3M5VA 3L5AA 3HPZA 3T7VA 1F74A 3T44A 1VS1A 1F7BA 4K8HA 1KM2A 2J27A 3WJWA 1WDWA 1RV8A 1Q45A 2C14A 3TAKA 4KFNA 3M9YA 1JVNA 1OVDA 3L0KA 4LV9A 4KFOA 4PH6A 4NJJA 1YPIA 5G5IA 3W1AA 4UMCA 3W1RA 5AHEA 3W7JA 2DU2A 4K6AA 1TQJA 3N73A 2H8ZA 3W7KA 4QISA 1ZY9A 4CQ8A 1XDLA 2C6QA 2WV8A 1XC4A 3NXFA 5TBOA 1UASA 4S1FA 1P1XA 2HTMA 1TTIA 4UTTA 3TU9A 4ADTA 1OHLA 4ZQNA 5IBXA 1SUXA 5CZTA 5HWNA 1ML1A 3CIXA 3LV6A 1TREA 4BI5A 4JTHA 3NQAA 1B9BA 2FFCA 4R53A 1WAUA 4EIVA 3O07A 3ZR4A 3MUXA 1V7YA 3LCFA 3QMSA 3VE9A 2ISVA 2QJIA 3CLMA 3PUOA 1TPUA 1QCWA 5EL1A 2EHHA 3W9ZA 5HUOA 4IMFA 3EWWA 3TW7A 3TCEA 1O95A 2PCQA
chains in the Genus database with same CATH superfamily
1J2BA 1TTPA 1U5JA 5HMSA 1H3GA 4X60A 3OHMB 5FJTA 3K2GA 1DXEA 4QEHA 2VELA 3QKZA 1SZEA 5C7VA 3CHEA 3WQ6A 1LP6A 2I9UA 4FXSA 3Q37A 4LUJA 1DIEA 3GM8A 4PE8A 3E2QA 1VPXA 3P2VA 4EPKA 2CHNA 2ISFA 3LGGA 4M24A 3QBUA 1IWPA 2FPVA 3NYDA 4N7QA 1X8CA 2VX6A 3BW4A 2FZ9A 1K02A 3T9PA 3OPSA 3GC4A 3VO0A 5REQA 1SVDA 3DHPA 4DO4A 1ITQA 1I6NA 3GDRA 4F0HA 3N12A 4YIWA 4LW7A 2NUXA 3ATYA 4JTFA 4N4QA 2H9AA 1V0MA 1E0VA 2GVGA 3G1VA 3G1XA 3W23A 1A5OC 2YYTA 3HPSA 1V0NA 1V02E 3S5ZA 4UR9A 3LRKA 4BEQA 2QDEA 2XH7A 1T8XA 4HQVA 1XGEA 1UD3A 2W79A 2VT0A 4YLWA 2VFDA 1BWVA 4P2VA 2J6XA 3E6EA 1WZKA 1K3UA 1R47A 1QOPA 1M53A 2TAAA 4XBKA 2Z1XA 4OJYA 4K3ZA 2FPYA 4IUOA 4FOKA 3DERA 2J24A 5LXEA 2DQXA 5J8LA 1MO0A 5U4NA 5D2WA 1JRBA 2IXUA 4OFCA 3EX1A 1OT1A 2FZMA 4J3XA 4YMZA 3MKVA 3M41A 2XWEA 3KZSA 4BI6A 3GH7A 4I7UA 3Q65A 4PL2A 4EWND 4C1KA 4M6PA 3GFXA 2HVOA 2J9YA 4AAJA 4LRSA 4MMWA 5DFAA 2TRSA 5A5WA 4KRTA 3FYPA 1MDRA 2CBVA 3O05A 1EH9A 1O94A 2H8XA 2XZ7A 1X98A 4Z2LA 3P82A 3IEBA 1UCWA 1QNQA 1MWOA 2DZPA 5A6AA 1XG3A 5D9PA 2XM1A 2J8TA 1KGXA 1W9VA 4UOJA 3HIJA 1ME8A 3MHGA 1UWUA 4Q7NA 2DZBA 1DXFA 1H1ZA 1UMLA 1K9TA 5FSDC 2WAGA 3LPFA 1MUWA 1JL8A 1Q8AA 3UW6A 4DZHA 4ZVJA 5C7HA 4FALA 1H5YA 1B30A 1UWAA 1SZFA 1XBYA 1POKA 1YMYA 5XIMA 2O55A 4C6MA 4IUGA 3DHDA 3TR9A 1F76A 1KLZA 4NXSA 4PTNA 4GIEA 1J9YA 5GPRA 3K1DA 4G56A 2BVTA 4HPNA 4LT9A 1W3JA 3UU0A 3C2VA 4F2BA 1KFWA 2HPMA 1R2SA 3G1HA 4JQ4A 4FNPA 4ZL1A 3G1YA 3UWEA 1DL3A 4LAOA 3KVMA 2GFTA 3RCMA 1EJRC 3RU8X 3VOHA 3DFSA 1LBLA 2HXUA 3WZ0E 1KB3A 5EFDA 3NQ8A 5ABFA 3RNDA 4QHRA 4B5TA 3OIXA 1QHZA 3BZGA 4HMCA 3P0WA 1NF0A 4OBSA 3NYZA 3P60A 2YA0A 3O15A 2DUXA 3AHTA 4C7FA 3W73A 1XBXA 4GQBA 4A3YA 2GL5A 2F6KA 3E02A 1QDSA 4E8GA 4KQNA 1XP3A 1EJUC 1FUYA 4PTMA 4C6NA 3GHUA 4WF7A 3A3WA 2IMRA 3DX5A 3E0LA 5FJRA 4RNJA 3R4IA 3EA1A 4CQBA 2NQ9A 3KXQA 4XSLA 3ENLA 2WC4A 5H8MA 3QFWA 3LNPA 1WDPA 1W17A 3TNBA 3GR7A 2YCJA 4UUIA 2EO7A 3IVUA 3DFTA 3Q58A 2DVXA 4C7DA 4Z1AA 4NSBA 3GH4A 3KRZA 2FJUB 1PS9A 3U8GA 1HKIA 4XUGA 3RCNA 2C71A 2ZC8A 4W4QA 2CKSA 1WNOA 3QSTA 3B0UX 1JCTA 3L67A 2R1PA 5HPCA 4G6CA 2D1ZA 1VAHA 5HPOA 3WLOA 5ABTA 5HMFA 2DSKA 1C8XA 5I7GA 1H0GA 4LAKA 3GWQA 1PSCA 2DSUA 3MO4A 2AAAA 3OQ8A 5BCAA 3VD7A 1UIOA 4MSSA 4PMRA 5M1TA 5LIKX 2YJQA 1DJXA 3GYEA 4IFKB 3BC9A 3FLUA 2C1GA 3ZLHA 3NQFA 3QN3A 1UKTA 5C55A 5K9CA 1GQJA 5BRBA 4V1XA 2A0NA 2E6YA 1JEZA 2XIJA 5D32A 3U5YA 2CXGA 5DCEA 3EDDA 3WLKX 2Y24A 3FHAA 4ZXLA 4UC5A 2WMJA 5EA9A 5E6ZA 4P61A 1V51A 3W07A 3EOEA 4KEUA 3TUUA 1QW9A 3VGFA 1UPPA 2W9MA 2WNQA 4TQTA 5BMWA 4Z2GA 3DYPA 3MMDA 4GGHA 1AZ1A 2FH8A 1YDOA 4HA1A 1RK6A 3PPHA 2EPOA 4MNLA 1H60A 4LUYA 2EAWA 1FBAA 4GC3A 3AUJA 3CT2A 4L65A 3BSMA 3LHVA 4XD3A 5D09A 5DBUA 2E5CA 2J6VA 1Q6CA 3U2OA 4JY8A 3EPMA 1WCGA 3FSTA 3AHVA 3W7HA 4ZO7A 2PDGA 1FWDC 1PIIA 1OEPA 1RP9A 3KTCA 2NT1A 4O0KA 4O1AA 2PPGA 2CLHA 1B1YA 1A5UA 2OB3A 3L7RA 3LV5A 1IXQA 3MA8A 1NQKA 4LGXA 4ICNA 3QV9A 1OX5A 3RX2A 2QHAA 1F9CA 3AMDA 5DT7A 3WJYA 1B2YA 2VOTA 5A2AA 1WPCA 4HOZA 5TNVA 2CLPA 2QPUA 3IIZA 2CLMA 4M1BA 5FD0A 1JZ4A 3PBYA 3BMWA 1UC5A 1PHQA 1DJHA 4B15A 1O60A 4P8XA 1LRNA 4RDWA 3WQWA 3QF0A 3U5UA 1OGBA 2ALDA 4LAUA 1CX9A 4I90A 4F2TA 3LUTA 2QAFA 4JFTA 4OGZA 1SYTA 3GU2A 1XRSA 1MEHA 3ZM8A 1AW5A 3C86A 3LHYA 1X8FA 3NQEA 3E1F1 3S5NA 4GABA 3AIBA 1QTWA 3D47A 1J79A 3JUGA 3UZZA 1TWDA 4FOJA 4X0VA 5D9OA 3M64A 1KCXA 3N3TA 3AZTA 3HPFA 2PWDA 2ZXDA 3WLTA 4H9MA 1LLZA 1W5MA 2WM0A 1B4KA 1GTHA 3KEHA 5G1YA 4S3CA 1R9YA 4JIQA 5HK4A 2PDNA 4QNEA 3ZZ1A 4UTUA 1RD6A 5HR6A 1FVPA 1V93A 2ZC1A 4HK7A 1XIDA 4U3AA 2ZYFA 5GVJA 4RE0A 3CUGA 4C1NB 2FZNA 1NOUA 3KL0A 1EX1A 2BSLA 3S1UA 3RLGA 4OOZA 2YL9A 2P53A 2Y6ZA 3ZSSA 1KBKA 3THDA 1Q85A 4P7QA 3U6WA 1SJDA 1JAEA 1UR2A 2XFFA 1GEQA 2WHMA 2B7PA 1NP2A 4EF9A 3CPRA 4WJ8A 3DC0A 3B40A 4QR6A 2O9TA 2C1HA 1BG9A 1F3XA 3VGGA 4GHRA 1KNWA 4MFDA 3KWSA 3K1GA 1CXKA 1TIMA 3VGDA 1SGJA 4PEEA 1HGYA 3F5JA 4FLSA 1XPYA 4AX6A 1DJGA 1WDQA 5EBAA 1KM0A 3IJ7A 3IGXA 3SUUA 2QCCA 3LCXA 3URAA 4JKLA 2UY4A 1C8VA 1H7OA 4IGNA 4MY9A 1AJZA 1YE6A 3ITTA 2R6OA 3I6EA 2D69A 3BG5A 4NX5A 2ZWYA 4AZHA 3I10A 3PZNA 3VPLA 3WQ8A 3UP8A 1UP3A 2ZE3A 5E09A 1VCGA 1ALDA 1TVLA 4UIOA 3C6CA 3CAWA 3W3OA 3FOKA 4UTMA 2IQ0A 2QMJA 1E1EA 3RIKA 3L66A 4CQDA 4AVNA 1V02A 1NP0A 3C56A 3BWWA 1XRFA 1Z7AA 1I60A 3GDBA 1KV8A 1FHLA 2ZFAA 1JUEA 3BGAA 4MGGA 1VRDA 4OVXA 1AZ2A 1QPKA 2ISSA 1VPYA 2HK0A 4XO7A 3FYYA 1XLLA 5JQ9A 2YL6A 3TYBA 3I3EA 4EACA 3CYVA 1GGOA 2OX1A 4XZHA 3QW3A 2L5HA 3S1VA 1E6RA 2HVNA 3B0YA 3MY9A 4RZBA 3SJNA 2X42A 3DIPA 1Y7VA 4K7YA 1P0NA 4RE2A 5I0DA 1OYAA 2HMCA 2YBTA 4M56A 3VINA 1QNOA 4RV8A 3GTFA 4QDPA 2P88A 2IKHA 1V7AA 1YTEA 2ZUTA 1N82A 4LY8A 2VNCA 3ABOA 3L5LA 4GUHA 3UERA 1XSJA 1XCXA 3F4DA 1O66A 4DXVA 2YL8A 3AMLA 1A5BA 1LWJA 3B0XA 4F40A 3F4WA 1UP0A 4WOZA 3BQ6A 2HNHA 4DYEA 2XUCA 2E6AA 1EUNA 1CPUA 3IJ9A 4EPEC 4NHVA 4JL1A 3WNKA 2ISWA 2QCHA 1KBJA 4DO7A 4C6QA 1Q6RA 5BROA 4RDYA 2Y7FA 4NAFA 4I8DA 4XAFA 1YXYA 3O2LA 4HN8A 5CAHA 1MYRA 3QM3A 4E3TA 3S2MA 1ZBVA 2X1RA 2VEMA 1Q7MA 4WDXA 4J3SA 4GNVA 3W7EA 3TXZA 5FF0A 3B0VC 4MDPA 2F7FA 5FF2A 2C19A 3WDRA 3A5VA 4W8LA 3S1WA 2POTA 3W2LA 1BKHA 2ZOXA 4O1FA 2V81A 2YBUA 3JW7A 3THUA 1C7TA 3OVGA 3QFEA 3HM7A 1GOOA 4ZB2A 1L8NA 3BJSA 3KVLA 4JNYA 1V0KA 1AH0A 4O57A 2OQHA 1MRAA 1Q8JA 4WHBA 1EQPA 4V15A 3LHZA 1VF8A 3AYRA 3MTWA 4S2CA 1LL7A 1NVMA 3CL7A 4AWSA 2WMFA 1KRAC 4HN4A 3AWOA 3DGRA 2YCLB 3NL2A 1TPB1 1Z42A 3IVTA 3NM1A 4FPSA 3POCA 3W1XA 3PWIA 4QFUA 4R34A 4K8EA 1POJA 1TJ2A 5CBIA 3C3UA 1ONRA 3W82A 4XAZA 3P62A 4EXQA 2C15A 3DG3A 5E1QA 2HSAA 2NVCA 1US3A 1LJYA 1MZHA 4L61A 3KHJA 3K5XA 1H09A 2E0PA 5AC7A 2F6XA 3THAA 2R24A 4CU6A 2RDXA 4N9BA 1JCMP 3WDQA 1DORA 4KRZA 4HYVA 2Z26A 3PM6A 2FH6A 3RPDA 2ZDSA 3WLLA 4R7OA 5E6YA 5C9ZA 1W2PA 3BAJA 3M5XA 2EG8A 2H90A 4AF0A 3VVGA 4H01A 2FHFA 4GIRA 4L9XA 3QGAC 4J40A 2EF9A 3U9IA 3KX6A 4PCPA 1SR0A 5J5RA 3U0HA 1KXVA 5LKYA 2MUCA 3WJZA 3IJLA 2JEPA 4HT3A 1ZENA 4Z1BA 3KCJA 3KS6A 4Q4OA 4E4UA 3UWYA 2J8FA 4WDTA 5HBFA 4KCVA 4HNCA 2YW3A 2OO6A 4GXMA 1JXJA 3SCSA 3NFUA 4MIMA 1CLVA 1R3TA 1B0IA 2UV8G 4AEOA 3PZMA 3STGA 5DMLA 3LN3A 5JUVA 3VOIA 2BWGA 3SY5A 1ZFJA 5C2XA 4HZ6A 4ZB0A 2W92A 3WD3A 3W70A 4TTUA 2WHJA 1FWJC 1K7FA 2ZA2A 2VZSA 1OCJA 1MQPA 1NWSA 3GC2A 3LENA 3NPWA 2H6RA 1EGZA 4LVBA 3AS2A 2R1KA 2ZUWA 2VCAA 3G3DA 2BY1A 3WF0A 2DZWA 4H41A 1Q6FA 1ISYA 3BV7A 1H11A 2POZA 1Q13A 4JHMA 4OT7A 2FHCA 3KOWA 3B04A 4DLFA 2OVLA 1V6TA 2VURA 1OGSA 3GIQA 1R2TA 4QTGA 1TA3A 5EMUA 1YADA 1FFRA 4UWMA 3MQTA 1G7VA 1HQTA 2E67A 1QUMA 3B97A 4FMVA 4NAEA 4HIBA 3N2XA 1ZHAA 3ITGA 1OF6A 1F3EA 1PKYA 4D8LA 1US0A 1E6NA 2EQDA 5LHFA 1QNPA 1EC7A 2AKMA 2HCVA 4YCPA 1C29A 2WYSA 3T81A 2OSYA 3EA3A 4U2ZA 4XVDA 3L4TA 2BG5A 3T4CA 2ZVRA 2CIPA 3WLPA 2O7SA 3N6QA 1ICPA 3CHFA 1EP3A 3UJSA 3W1MA 4HSNA 2VZTA 3CK5A 3UXDA 4F0LA 3NDOA 2VUYA 5E9AA 2V67A 4P8UA 4KRUA 2GPTA 2ICSA 4AC1X 3P6LA 1ZAJA 1L8PA 3OZOA 4H9TA 2W66A 1VBGA 4NQ1A 2WJEA 3OOQA 2PI6A 1XWYA 3WLNA 1ISZA 3VDGA 4HMNA 3W76A 4JIIX 3M0IA 4Q3MA 1IEVA 3BDKA 1VC4A 4LY4A 5LSMA 3EWUA 4GVGA 4ZQPA 3WEOA 3VU2A 3S3GA 5I78A 2CXEA 4POCA 5M3WA 3B8DA 2Z1WA 1JAKA 2VC7A 1CXLA 1GOIA 3CZJA 4L9ZA 4XAGA 4PTXA 3KWXA 1K77A 2ABAA 1VIZA 3NUKA 1EYEA 2X41A 4IP4A 3DHUA 5I3GA 5E0FA 3CGTA 1WUFA 4OOUA 3QGKC 4F79A 2R91A 1H2JA 1YNPA 6TIMA 1R9ZA 3WFZA 3IS4A 3GIPA 2CETA 9XIMA 1NFPA 4H8HA 5DQPA 2X05A 1KBBA 3ELFA 3MUZ1 4CEXC 4X2PA 4WKHA 2G41A 3XIMA 1EDQA 4PYSA 3ZJ8A 2HQAA 4TX6A 4MZ8A 4R33A 3BLIA 4NVTA 4FX7A 2CLEA 4EAYA 3WQDA 2XVGA 6CGTA 3LU2A 3BPWA 1E73M 2BX7A 3KOXA 5A8PA 4LFYA 5JMUA 4QJ1A 1B3VA 4ZTXA 4JR5A 3MHUA 2ZCGA 4LBSA 4UQBA 5C71A 4E2OA 2QF7A 4QNWA 3VOJA 1A47A 3NJ3A 5IHRA 5HR7A 1VD6A 3HPAA 1M6JA 1TPC1 4QE1A 4KWVA 1R9XA 1L6WA 1E56A 1LL4A 2BHZA 7A3HA 3OP2A 1B9ZA 5I6SA 4GRSA 3I6TA 5C9RA 1GHRA 3RF9A 3FJLA 5FI8A 1BAGA 1J0ZA 3MI6A 5LYRA 3THQA 4BA0A 1P48A 1S5WA 2XWDA 3H22A 2A2IA 3SGUA 4ZFMA 1CNVA 1JDEA 1WAWA 3GRIA 4RXGA 1NDYA 3WK2A 2BHUA 3BOFA 1O6IA 2PBGA 2NUYA 5CG0A 4XWUA 1HO1A 4YTSA 3NQ6A 1R38A 1B54A 2CZFA 4HTYA 3VILA 3E3HA 1PTDA 4LNCA 3GVGA 2A3BA 3QXBA 4QJ3B 5HUPA 3TV8A 2BS9A 1OIFA 3H4XA 1TWWA 1TRDA 1LUCA 2FMNA 4EX4A 5G4WA 1ZL1A 1KRCC 2QCDA 3G24A 3GB6A 4JXCA 4M5PA 4FNTA 3SFWA 1O5KA 1GW1A 3J7HA 1TO3A 5C9UA 1ODZA 1MDLA 3Q45A 1LYXA 3C8FA 1MXSA 2YDSA 5DF0A 5BXPA 5G1TA 3ANVA 4AU0A 1JDDA 4UFLA 3PTQA 3U7VA 3SZ8A 1LL6A 3IAQA 3R7MA 4I3GA 1AK5A 3FNDA 1WV2A 3O16A 1U5VA 2P3ZA 2G50A 1ECEA 4LEFA 1UD4A 5LNUA 2VRKA 1A5MC 1G94A 3ITLA 2GGEA 3NL3A 1YRRA 1PKMA 4C6IA 3QY7A 4IIFA 5D2YA 1DWGM 3LHWA 3FVMA 3T08A 3NQ2A 2VDHA 2Z4GA 2DGAA 3MP5A 2XN1A 3DUGA 3VD3A 3NG3A 3AIUA 3NA8A 2J9XA 4QIUA 4KIRA 5AC6A 2Q8LA 4NI3A 4A2RA 5H2ZA 5JBFA 4M29A 1XM3A 2BASA 4GH1A 4A8IA 4U5IA 4UTWA 1UUMA 2VEIA 3KUMA 4XX6A 3G6LA 4IF2A 4AXNA 2OGJA 4K7VA 1P7TA 1G5AA 3M0JA 4BQ4A 2AL2B 1YXDA 9RUBA 1YE4A 4M1RA 1QW8A 4HCHA 3CZKA 1UZHA 1PDZA 1PX3A 4MKSA 3UPMA 4CQCA 1AG1O 1V03A 3GVWA 3DFYA 3T0AA 3WH9A 3WUGA 2XFYA 4ZOCA 3TMQA 2PDJA 3GFZA 1ZNNA 2DIEA 3VZXA 1CB2A 3W1PA 1E5JA 3EB3A 5U7SA 4RNHA 3UT0A 4ROPA 5M03A 1ZBKA 3BGGA 4A3HA 3FXYA 2PDPA 3CEUA 4R9OA 3VKAA 1NU5A 5HJYA 5DMNA 1ADDA 7REQA 2XFWA 5HMDA 1VP5A 4KCTA 4LVAA 3E96A 2W0UA 1A49A 1PZ0A 1OCQA 4HTBA 4ADSA 3GYCA 3NQDA 5KZEA 1Y5XA 5A3HA 3MUCA 4DB7A 2PDKA 3OA5A 1E6QM 3BAKA 2O9OA 3TX9A 3CL6A 4GFIA 1W1TA 2V2CA 1ZP4A 1MNZA 2FDSA 2VXNA 1NWUA 3SGZA 7CGTA 3HN3A 3S6DA 3O6AA 3TTQA 1FWFC 3W1TA 2VX5A 1TX0A 5I3IA 4H04A 2OTDA 4MADA 3EPNA 2XIOA 5JVLA 1SW3A 1XIBA 5ABHA 3VMPA 1C90A 5FKYA 1VCFA 3LRMA 5FSEC 1JD9A 3A64A 3KOYA 1J18A 1P4CA 1UIPA 1DTNA 4LB4A 2FFIA 1JPDX 4ZE5A 3MI2A 3B4UA 1OJXA 3INPA 4G8TA 5IOBA 4I9TA 5IFTA 1R6WA 4AZ6A 1U1JA 3NR0A 3OU8A 3ARRA 2PE4A 3NZQA 3HA1A 1E6XM 3VNLA 2D3LA 1JPKA 1VEMA 2OPJA 3QMTA 4GH3A 3W2MA 4GINA 1A4LA 1FCQA 1O4UA 1AMKA 4ZO6A 1EBGA 1NJJA 1W37A 3VKBA 1E6ZA 3A4JA 4D6EA 4HNTA 2O92A 1B3YA 2NX3A 3PK7A 4ENLA 1CXIA 1IT0A 1SM9A 1W3HA 3PWAA 2ANUA 3M43A 4EE9A 2XGBA 4QITA 3PG8A 1EKOA 3LG3A 1K70A 5A69A 3I3BA 1MFUA 1KLYA 2W6RA 3SIZA 2J7EA 4CGTA 3WENA 3B8WA 2AGTA 3UZYA 1QNSA 4MVAA 4Y96A 2QMKA 1SQ7A 4AW7A 2Z1KA 2VD8A 3FSUA 5FESA 2GJNA 3M47A 3CO8A 4GJ1A 8XIAA 1NH6A 3TR2A 3ARZA 4CVUA 1DPMA 1DJYA 1I9CB 1VFHA 4PUDA 3ZLGA 1ZAHA 2ZWZA 2ZZ5A 4IMAA 4FA3A 2JGYA 3OG2A 2AMGA 4CN4A 3UPWA 4UNIA 4PULA 5FAGA 3STPA 1L6YA 4G7EA 5KZ6A 1B5TA 2B4GA 2VZOA 1F74A 1F7BA 4I8YA 4K8HA 3SCVA 2J27A 3AAMA 3WJWA 1WDWA 4OIFA 3UA4A 3NSNA 4CNTA 3ZSTA 1N8IA 2PP1A 1JVNA 4PH6A 3NEHA 1CDGA 4K6AA 4QISA 1DTUA 4CQ8A 1XDLA 2WZEA 2ZKMX 1UASA 1P1XA 2BGSA 2ACRA 4UTTA 2WC3A 4ADTA 1OHLA 5IBXA 5CZTA 5HWNA 5HMEA 2FFCA 3CO4A 5CJ5A 3VZZA 4GCAA 2VWSA 4REQA 3LCFA 1JPIA 2QJIA 3CLMA 1A5KC 3PUOA 1TPUA 3RJYA 2BY0A 4Q4MA 1UR1A 3TCEA 4IIEA 4ATDA 3CUIA 2PCQA 3KDNA 1MUMA 1JGIA 2W27A 4D6HA 4F9JA 3P80A 1CLXA 3TAOA 4LRTA 4ICCX 1NDWA 3WJSA 2Q6ZA 4JIEA 4UFKA 3STEA 1HJWA 3RITA 2WXDM 3LXAA 1VBHA 4N02A 3AYSA 3W2JA 4PUEA 3LTPA 3A24A 3S2LA 3EOUA 3W1UA 3P84A 3HJZA 2FZDA 4J3VA 3QVQA 4A2SA 1E70M 3TC3A 1JCNA 2JGQA 3L4UA 4OTKA 1JYNA 1GQNA 3PZQA 3UWUA 1HL2A 3OIHA 3SUWA 1QMLA 1LWHA 3MC5A 3QHNA 4JFSA 1NELA 2ZZ7A 1TB3A 5JBEA 3DHFA 4AHOA 1IV8A 3DESA 3GW3A 2UY2A 1Q6QA 5CPSA 1JD7A 5A6JA 1UR8A 3K13A 5CBBA 4XBJA 4M6UA 1V3KA 5BNKA 3NSMA 2PTZA 4TMBA 4ACYA 3H4GA 2Y62A 3ZR6A 2XISA 2Q8ZA 4E2BA 2G3IA 3CZGA 3NQGA 4MJMA 1H51A 4LBUA 4F3HA 4AX7A 3NPUA 4M7SA 3LRLA 4L1WA 1V77A 3QOKA 4IGHA 4MNJA 1VFOA 3URQA 3N6JA 4DUOA 5LNVA 4N9EA 3N2MA 1YQ2A 1JI1A 1S5MA 2WNNA 2PLKA 2NV1A 4HA4A 1ZRQA 3K46A 1I2RA 4NKCA 3LTYA 3H53A 2ISDA 1Q6EA 4ERGA 4OWGA 3W37A 3ZS4A 5AHIA 4PB3A 4IGMA 5F2IA 2SFPA 4PB5A 3DOPA 3O6YX 4DIAA 3MUIA 3WBWA 5D8ZA 1BLIA 4N42A 5AHFA 3PBVA 4LWWA 1BF2A 3VIPA 4U33A 3VAVA 4GX8A 1SSDA 4E5TA 1D3CA 5A8MA 2I56A 3U7BA 2JKPA 4HPXA 2QPXA 4FI4A 1KWKA 1UH3A 2DFAA 3UZXA 4RPQA 4AD5A 3BCFA 3QPEA 2FJKA 2IPGA 2QCEA 3M6YA 1GKRA 1GPFA 4ADUA 4KWUA 1GZ1A 3WLJA 3T8LA 3UNDA 5HULA 3PAJA 3AI0A 5I3FA 4K68A 4JHOA 3SCQA 1G4PA 2J77A 4UFHA 4QG6A 3GC5A 4E4PA 2ZZ6A 3WLRA 3EX6A 1W1ZA 2WCAA 4YL2A 3FX4A 3TC7A 3EX4A 5HAOA 2FIQA 6REQA 3MUAA 1E0TA 3RRXA 1RJQA 3PTDA 3NQVA 1C7SA 3W4RA 5J04A 3N4FA 5CGMA 4J3ZA 3VKKA 3UNTA 1E9LA 4GI4A 3UJFA 1LOLA 2CPUA 2PDWA 3PNUA 1R0MA 3AALA 4Y8FA 1JNEA 2HROA 4GI6A 4L64A 3U2CA 2IW0A 3LBMA 4LCRA 2V5CA 3T2OA 3WIJA 1K9DA 1KR1A 3FIGA 1W2VA 1AW2A 1XSKA 3TQVA 3PANA 2GUUA 3DG7A 5FEPA 3SRHA 1ZZMA 3AHZA 4MWAE 2WWCA 4O1DA 4HPGA 3D3FA 3KBVA 2BGQA 3HMCA 1PO9A 4Z1CA 4YN5A 1XLDA 1G4EA 4LUSA 3VIHA 1GZGA 4GK8A 3TN6A 3KAOA 1H0IA 1TE1A 1VYPX 4XG1A 3LCGA 4KCUA 1QO5A 3GAYA 5EMMA 3UJRA 3ARXA 4Q4RA 4Y90A 3ZWSA 2BVDA 1N7KA 2RGLA 3HTWA 3UR5A 1A3XA 5I3HA 4HA3A 1RBAA 8CGTA 1KGUA 2WSYA 1K7EA 2XDFA 3GTIA 3IJIA 2J62A 1BHGA 4C6PA 3SIMA 3HGOA 4W9TA 1U1UA 3HPXA 4E3VA 3F7JA 1V6UA 3W1QA 4ILSA 4HPHA 4BHYA 4FXFA 2D2OA 3VDAA 4I5UA 4AZGA 1U5HA 1TCDA 5FL0A 2BV9A 5CCZA 3NGFA 1S2AA 3C8NA 3DCPA 2GUYA 3GE7A 4IICA 3UR2A 4AZ7A 3TYDA 2IKGA 5DLCA 5DXXA 2GYIA 2PWEA 2V6AA 2ACQA 1Q4WA 2YX0A 1FWAC 2X2YA 1V3LA 2P8BA 1X1ZA 4KGJA 3W6LA 2FDMA 2XJ7A 3VUSA 2ZIDA 4PUMA 2AQWA 1YDYA 4DYJA 4B3KA 3NQMA 1DKWA 1F2JA 1W5OA 1K7XA 5JIPA 4UOQA 1KFKA 3AMCA 4RR4A 1VBRA 4H9VA 5H91A 2D3NA 1C92A 4BEUA 2PDCA 4PEKA 3SECA 1W1IE 3DG6A 1RPKA 2W3ZA 4Q8OA 3S6OA 4NU7A 1I0BA 1BSIA 3RFAA 1OYCA 3MU7A 3UYIA 3EWYA 3GHRA 2X16A 3K30A 4P8WA 4FNQA 5DY2A 2DW6A 3FEQA 4EANA 3A4AA 4O15A 4F66A 1Q6LA 2V2HA 1XLCA 1I8JA 3QEZA 4GYPA 2HEJA 4MUZA 3UA3A 2VEFA 2NVDA 2CLLA 4D6GA 1XS2A 4JX6A 3RUBL 3CXOA 2EEXA 3OLEA 4IJBA 3BAIA 3RPMA 3GDMA 5K3VA 3G1DA 1OQFA 3FAWA 1Q7QA 5D05A 4MAVA 3MBDA 1QHOA 1YTKA 2X7WA 2QUMA 3JS3A 3FS2A 1BWKA 1AVAA 4GZ7A 1UKOA 4LUTB 4XV0A 3H2NA 2OZTA 5CSRA 1QOXA 1XBZA 3CUXA 3LI1A 3SCWA 3CWOX 3QQ0A 4R85A 5CPTA 4NP7A 5KMYA 4PC8A 4E38A 3AIQA 3WBYA 4IXHA 4DJFC 5CC3A 2OODA 2ZXQA 1CGYA 2HJPA 1XC6A 3GU1A 5CSSA 1DE5A 1TV2A 3WK0A 1QWGA 2QJNA 2OGYA 3NL5A 3UEQA 4URIA 5T26A 9XIAA 1YDNA 1V6VA 1EEPA 1FCUA 1QHPA 1HG3A 4DWSA 1GOWA 2VL4A 1C8YA 2W61A 4S3FA 3GW0A 1F07A 4KT2A 3KVKA 2VKZG 2CYGA 1M3UA 3QW4B 3DBNA 2Z7KA 2O9RA 2I57A 3P8IA 3IARA 2OYMA 4CU7A 3CC1A 3D46A 1Z89A 1RALA 3IAPA 3QGVA 3CAKA 1XUZA 4X9SA 1CI1A 4TX9A 5A95A 1F05A 2VEKA 3MV01 4QE4A 2UBPC 3C0JA 2DVTA 1XKYA 3F4NA 3V5FA 3EYPA 4U5KA 2XU2A 4MPQA 4Z0SA 1UP2A 1CGXA 3HV9A 4YYFA 2NW0A 3KCLA 1PTAA 2BFGA 4UQ9A 5C5YA 1PE1A 5CZSA 3ITYA 4A8NA 3BV4A 1IGSA 3GXMA 1SO5A 1QFEA 1BRLA 3FAXA 3GY1A 3E38A 4O17A 2WSQA 3N1AA 4FEZA 4HZ7A 4NNAA 3UZJA 5FJPA 3WG6A 3A9BA 3PPCA 4ML4A 4PMOA 3MSRA 1O5XA 3IWPA 4Y9OA 3TC6A 5AFDA 1TG7A 4H6EA 1QNVA 2FGLA 4BI7A 3VIFA 1Q2RA 3CIVA 1H62A 4I6VA 3WBEA 5JH2A 2BTMA 1XGZA 1TJ1A 2VTFA 4OZOA 3S2JA 3NCOA 1BSLA 2XSAA 5I3DA 2A6LA 3VK5A 4AYGA 3M7SA 1YX1A 3COTA 4CUCA 4WOQA 3QRHA 2VR2A 3LA4A 4D6DA 3AUOA 4PR4A 1W6TA 1C8QA 2PDUA 4NZFA 2YZ5A 5EYWA 2FGZA 4M81A 2IPJA 5CLTA 3DFNA 5E9XA 1BFNA 1EJ7L 3IGHX 4O4VA 1OG0A 2VHLA 1XH1A 2QDDA 1JG9A 1RH9A 4M82A 4H7VA 3WUBA 1XINA 2A3LA 4Z2HA 3VC6A 3GXIA 2V5JA 1OT2A 3TZNA 2XIMA 2DZVA 3Q2DA 4NZ3A 2WJZA 2J9ZA 1R30A 4FO4A 4HZMA 4W7VA 3LEPA 3IUHA 2JALA 2QDGA 1X96A 2CW6A 3S4TA 2OG9A 1V08A 3DBPA 3HQ1A 8A3HA 1RP8A 2ESCA 4B2DA 5I07A 2G37A 1G4SA 2E5BA 3VNKA 3M0KA 1W3KA 2PDHA 3WH8A 1AUSL 1OC5A 1J93A 3WNNA 1GUVA 4I5XA 3GAKA 5CC5A 1WKYA 5BRQA 4J2MA 2G95A 4S3KA 3USBA 3PZ9A 2WHKA 2YPIA 3N2OA 2GQ9A 2OZ0A 3UZWA 3H2EA 3LSCA 1KC7A 3ATZA 1Q6OA 3M0YA 3C2EA 1RBOB 2BB0A 1A3HA 4DYKA 3NO1A 2BLEA 4MOZA 3RYSA 1E4MM 3JRKA 4E8CA 5BXRA 2F8QA 3HZ3A 4RW5A 4JN6A 1K6AA 3T55A 4W5ZA 3KP1A 1BYAA 1NWTA 2Z7GA 2VGIA 1DYSA 4JTSA 3WBAA 4DVOA 3P7YA 3RK8A 3SRFA 3P81A 2DZUA 1EC8A 1OYBA 3GIYA 1CT5A 1TZ9A 4H83A 4LCSA 3I65A 3CV6A 4US6A 1TJRA 4HSOA 4Q7IA 4ZZ9A 1MEWA 3H7VA 1LQ2A 4XUYA 1V4YA 3LMZA 1LG2A 5KINA 4QCFA 4S39A 3FYOA 1VRXA 5XIAA 1EP1A 5AKQA 1FCVA 1P6BA 5FOOA 1H1NA 1HFBA 5IFPA 1VH7A 4O18A 5IXEA 4J5NA 4BQ2A 2I9EA 4W87A 1UR0A 2VX7A 3KFTA 4YHGA 1XI3A 3GDTA 3WF3A 4NJKA 4V33A 2PFHA 4TU1A 3G0SA 3M6DA 1XFCA 1T99A 2VYOA 1K9EA 4HMDA 1MUCA 5HATA 3UWQA 1MQRA 2FMOA 5CPQA 4UTKA 3O9NA 4DM1A 2QV4A 2A7NA 1JXKA 2WMIA 1UA3A 4L56A 3P5ZA 1JDAA 4M3PA 1IZJA 1JR1A 3TTOA 3JR2A 5MKGB 1UHVA 1QPOA 3SI9A 4IJRA 5JH1A 1QWKA 4IG2A 2VVNA 4ZCWA 3AU6A 2JF7A 3DKJA 1FOBA 3G6MA 2OOFA 3KCOA 3BCDA 2A21A 3G1FA 5FEXA 4IQLA 3ZR5A 4MLRA 1QI5A 3LK6A 2B7NA 2QIIA 2WVVB 5J5DA 3F2BA 4HJWA 1TV5A 4LTSA 1XG4A 3GNNA 4AC7C 1M7PA 1BWLA 2ZTJA 4CD5A 3MMWA 1YIXA 1KA9F 2JFEX 1PIFA 3PB2A 2ZX8A 5D33A 5LIYX 4WY0A 5GJPA 4Q7BA 3VOFA 4MWAA 3SUSA 1J0YA 3GXPA 1HJSA 4JNZA 3TQPA 1KXHA 5EFFA 3V7PA 4KWSA 1JFXA 3PULA 1E15A 2A3CA 4EVZA 4HCLA 1PVNA 1Z8AA 1OX4B 1GVFA 5HA7A 5ECVA 1FH7A 1YEYA 4LH8A 3P5YA 2Y2WA 1UW9A 3WNOA 3CZLA 5HNUA 2HS8A 4MAZA 3N13A 3LCIA 3W7OA 1UBPC 4XD5A 3E5PA 2GDVA 3PF3A 4FK9A 1JIBA 1NDVA 5E0KA 1QI0A 4HP5A 4B91A 4NZ5A 2Z1BA 2GDQA 2C7FA 4PZVA 4HKPA 4OV4A 5TD4A 5CSUA 1RJPA 1SMDA 2J25A 1WOAA 2DH3A 4A3QA 4E0CA 4YWIA 1VFSA 4PMNA 4B9YA 3AU2A 4JFWA 4DJEA 4V2XA 4IP7A 3G18A 3AFBA 1IHIA 3RM8A 1KBIA 3BLLA 3BCJA 4ML9A 4LALA 3NZRA 2ATMA 2BOGX 1YBQA 2WPBA 1O1ZA 4V1YA 2Z0IA 3RM9A 4JTUA 4UFMA 4I9MA 1WZLA 1XSIA 2RGMA 2IQDA 1FWEC 1GW9A 1C3FA 3FKKA 1TR1A 1UD6A 3GHSA 2ZZ2A 1FRBA 2Z1SA 5C2CA 1W9UA 1TQXA 5KITA 4ZQMA 1FWNA 1VYRA 4DWSC 3W83A 1XYBA 1HJVA 5DX7A 5XINA 1GVQA 3ES8A 5A8GA 3W7CA 3UY8A 2HPIA 3BARA 3IJDA 1VZWA 2EKGA 2J66A 1UQZA 1UKSA 5DRCA 2CZ5A 1RK5A 2ZDRA 2PEVA 4XAPA 2XVNA 3EDFA 1H41A 3N18A 1UR4A 2GJXB 3AIVA 2VX4A 3QZAA 4IOTA 1KFJA 4X3ZA 4PMZA 2DP3A 3CL8A 1GNXA 1WOBA 2WJDA 4WEVX 2WJFA 1RJRA 1EF2A 3N17A 2JQXA 1BQCA 1BG4A 3PJTA 3TNOA 3URNA 4YXGA 1W9BM 4XKMA 3SN1A 4AD3A 3EXSA 1MW1A 1C9WA 4YHEA 1TJ0A 2DDXA 4ES4A 4UNKA 4S3GA 1A50A 3GR8A 3OBEA 1EWEA 1EIXA 1GWJA 1PZ2A 3H2FA 1EHAA 4KH2A 4A35A 4JN7A 3PR2A 1QVBA 1ZU8A 4MKNA 4UQEA 4E2VA 2GSJA 5DRIA 1M03A 3WY1A 3BAWA 6TAAA 1EYWA 2IKIA 1CXHA 2F84A 4A3UA 5I00A 3OZPA 3L0GA 1OFDA 2GWGA 3V36A 3B9AA 3WLSA 1VEOA 2PP0A 3SY8A 5LIWX 4HCDA 1P1MA 1H1YA 1WDSA 4L7ZA 2FHBA 3LGEA 3NOEA 1XJBA 1UB3A 4X63A 1J5SA 1SPQA 3HO8A 2BY3A 3PHAA 3AMGA 1XL9A 1SFJA 1MXDA 3V3WA 5I24A 1ADOA 2WKJA 3CPUA 1AA1B 3N9SA 3DI1A 1WXJA 4HMEA 1J0IA 1VLIA 5F1UA 2Q3RA 1CZ1A 3H2MA 1NIUA 3XISA 1DWFM 3P67A 3L9CA 1YYAA 2A3AA 3MT1A 4O1EA 3BLPX 3V0SA 1RVKA 4AD4A 2VENA 3M0LA 3PC0A 2Z00A 1OZQA 3C2FA 2OSWA 3AJXA 2OLSA 2FVKA 3A3XA 2Z29A 3MKCA 1ZP3A 3KOFA 4PA8A 4AIEA 1QI3A 3OLGA 4JS3A 3NQCA 4CNNA 3N2TA 4YNGA 3HQNA 3QV6A 4Y9MA 1EA9C 3OB8A 5CJMA 3N11A 1NDZA 3F03K 3CWHA 3IK4A 3W7DA 3R6IA 4CLMA 2X0YA 2REQB 1R46A 4GNJA 4KW2A 1PL9A 2QDHA 2VR5A 4ZQCA 4DWSD 4DQWA 2J47A 1A80A 2OFJA 2EPNA 3V75A 1OY0A 1MXGA 1SO3A 3CUJA 2Y61A 4GUFA 3UR8A 2WBGA 4Q4KA 2GGHA 5I3JA 2XH4A 4UCGA 2OMAA 4FIRA 3WYZA 3LX9A 2Q8XA 3PZIA 3VKJA 4XTDA 4QM1A 1FWGC 1KM3A 3WJXA 4ACZA 3CQJA 3GKAA 2YL5A 2PTXA 4OUIA 5FJJA 5H8UA 3OEXA 3W7QA 4A8LA 1SW7A 3BXWA 3CZEA 2HE5A 3GNXA 2X8RA 3PBWA 5A8QA 2PWVA 2V82A 3O0KA 4C65A 1LLWA 1UYQA 1DWAM 1MW2A 2P1FA 1J2WA 2CZEA 2FTWA 1WX0A 1TPDA 1X7FA 4B16A 5A6KA 1RR2A 3A5FA 1VPQA 4WY0F 1E1CA 1VBJA 3W84A 3ZJ7A 2ZUNA 1QOQA 1XUUA 2EG7A 1DXIA 3V35A 4LC8A 4LJ3A 4HU0A 2NZLA 1TPWA 3QTPA 1WYIA 2GK1A 4N9CA 1QBBA 4O1BA 4DUXA 5FACA 2C91A 1KR0A 2EG6A 1TWIA 1T0OA 4K39A 3U57A 5REQB 3AYTA 1LG1A 3V5OA 1JF5A 4FLOA 1JQVA 4WGHA 2R1NA 1Z48A 1TKKA 1RAKA 1DWHM 1XLJA 1ONXA 3UXLA 5HANA 2H9AB 2DJXA 3F2DA 3AS3A 3FA4A 4O0ZA 1H61A 4O14A 3L23A 3KRSA 4NY2A 3QYQA 3W38A 2D23A 4M80A 4PL1A 3N6HA 2LLEA 5K2ZA 4LAMA 4Q22A 1AW1A 4EPBC 1UMYA 3C2OA 4L1XA 2Z6IA 3MSDA 4UXDA 3C4UA 4IMCA 3V4BA 4KEZA 2E1WA 4JAWA 1M7JA 3H21A 3H55A 2VD9A 1H7RA 1BYDA 5BMXA 1EPVA 5H1WA 5LA1A 2R9RA 3WQGA 4H9YA 3AXKA 3ZXWA 4UOZA 4Q6XA 1P0EA 4TUFA 2Z27A 3E49A 2QUVA 1AQHA 1FHVA 4H8VA 3DFPA 3TJ4A 4DRSA 2WVSA 6XIMA 3PFMA 4W93A 1MFVA 2BNJA 1UR9A 2ZRYA 4Y9PA 1D7FA 4CD8A 1OG6A 2FB3A 2OZ8A 3IK2A 5I06A 3F4CA 1I2NA 4UQAA 5B80A 3B9EA 4B2DD 4MNMA 1XIEA 3SEPA 2D0HA 3TOYA 5DCDA 1H7NA 4Y8EA 3OHIA 1UQYA 5AB3A 2G0WA 2XVLA 1HP5A 3VM5A 3GVVA 3SB0A 4JN8A 3R0KA 3WMBA 2WNWA 3G1SA 4HU8A 1J0KA 2PC8A 3RN6A 3LM3A 3MBFA 3KS5A 1SZGA 3N15A 5AC8A 4R9XA 2G8ZA 1QNRA 2I14A 4GIYA 2Z25A 4RE3A 4DI8A 2J7HA 1BQGA 3OW1A 4MYXA 4FLQA 1IXOA 3N4AA 3M0VA 2JIWA 1GQIA 2DJLA 1H63A 3IRSA 5D4YA 3SCUA 3H24A 3W75A 4DJEC 4L6OA 1DV7A 4JTTA 3GX9A 5FJUA 4BF9A 1N8FA 3BZJA 2EXOA 1DJZA 3FJ4A 2BY2A 4B5XA 5ABFB 4U2YA 1PCWA 1LROA 2KZHA 4MJZA 3GTNA 1S2CA 4GA8A 2E6FA 3LOTA 3PSWA 1BEUA 3E0IA 4GKTA 3VGEA 1PX4A 1FA2A 1JUBA 3W7IA 2WLZA 1HJXA 4CCZA 3O3RA 4PCSA 4EK7A 1DWJM 4BWLC 2ZQ0A 4KETA 1W9DM 4HHHA 2Q71A 4G2DA 3O6CA 2WO5A 2D0GA 3KBWA 1REQA 1BGGA 1BF6A 5I5RA 3CQHA 1W3TA 1CENA 3AMKA 5MHBA 2VMFA 1BD0A 3WBXA 1K9FA 3DYMA 1TVNA 4MB1A 1CXFA 4JEJA 4J3WA 1ME9A 2DVUA 3G0XA 3LHTA 3W74A 3CNYA 3G22A 3ALFA 1XXXA 2PBOA 3DU0A 3PB0A 4C7GA 3CYJA 4CQAA 3NVDA 3EKZA 2PDQA 5A1AA 1DVJA 1L6SA 3UCDA 4C5YA 5HJXA 3ITVA 1XIIA 3T1GA 3UCQA 3VD5A 2VM8A 2EJAA 4UMAA 2HWGA 2PAJA 3AWNA 1HGWA 1WP6A 2AOSA 2GUBA 3RJXA 1EP2A 3VCRA 4FP1A 4BKNA 5IDZA 5BU9A 4X2RA 5AC4A 5DXYA 3WMLA 4TIMA 4CD6A 4M7TA 1X1NA 4MM1A 4DBSA 4F0MA 3AICA 4FXJA 4MWAD 3S9IA 1D3HA 4R5EA 1D7KA 3UVAA 3WLHA 2HDJA 5F4WA 2VRQA 1PX8A 2C0HA 3EZ4A 2CFFA 4C90A 8XIMA 1CEOA 3OJGA 1T6MA 1UD8A 4S2BA 3DC8A 2GOUA 1S2WA 4QDMA 1YTDA 4JBRA 3W6YA 3OA3A 3PUDA 4IQDA 3R8GA 1TMLA 5H8PA 4JTGA 1I45A 3BTNA 4AD1A 2OQLA 4FR1A 1E0WA 4PMYA 1JCXA 2WNZA 3RLVA 5FF3A 3EKLA 3RXZA 5G2HA 2PDMA 2ZZ1A 1NY1A 4DJED 1KCZA 2ZTKA 2PD9A 3PS7A 3PPGA 1W9PA 4IPPA 3IANA 5GNYA 3M16A 2QLYA 3MYPA 2PMQA 1WBHA 2Y8VA 3R8HA 3OQEA 3GG1A 4AB4A 1NAL1 5CZ0A 3TSBA 1M04A 4D1JA 4A21A 3BW3A 3SO7A 1CBGA 5F7UA 1QAPA 4ZE4A 4BK9A 1IR2A 5CG7A 3HPZA 3T7VA 3WN6A 1R8LA 2E28A 1KM2A 4I6KA 2HZGA 5I23A 1ZB5A 4F48A 4P7RA 1XLAA 5AZ1A 3WQOA 3E0FA 1ENUA 3EDEA 3M9YA 4MUPA 1OVDA 3L0KA 5G5IA 4KFOA 3VCNA 4Z2KA 3MS8A 4W89A 4QLJA 4GY7A 1ZY9A 2E9LA 1HL8A 1AQFA 1BXNA 3LV6A 4XZLX 3RO8A 4JTHA 1BVWA 3NQAA 1A0CA 2WPGA 3SQLA 3U3HA 4AFYA 2WBKA 3O07A 2W5FA 3MUXA 3QMSA 2CHOA 3VE9A 2I5IA 4FLRA 3VIJA 2P0IA 2EHHA 4IMFA 3TW7A 4E8DA 1UZ4A 3UG5A 1XCWA 2X40A 1S5TA 5C54A 1M01A 1EJVC 1E71M 4Q32A 1RQEA 4LXFA 1PTGA 3FGCA 1CYGA 2QJHA 2Y89A 3VKCA 2OO0A 4YVPA 3TJLA 1HKMA 4ZBCA 1XW8A 1ADSA 4UTLA 4H2HA 1PBGA 1JCLA 4A8RA 4WR3A 2CCRA 3QMRA 3MSYA 4QJ5B 5I02A 1TV7A 2GVLA 4CN1A 1TJPA 2OWCA 2PDYA 2QKFA 1F73A 3NM3A 1GCYA 4DLMA 4NUWA 4LU0A 3UD6A 2BOFX 2XTKA 1VB9A 4XKYA 4UNLA 3ARQA 4WDWA 5DT5A 2B31A 2QVHA 2AQVA 2V5KA 1W0MA 3KVJA 5FA5A 4HYWA 1QI2A 4WD0A 1EQCA 1Q6DA 3FXGA 3MZNA 2Y1HA 3PPFA 2A6NA 2Z2BA 3C3NA 1P0BA 2A3HA 3TQ0A 2HS6A 1M9HA 2QF8A 3O63A 4P7LA 2ZA3A 4C6EA 2OWXA 1WKFA 2C18A 4A05A 3TYCA 5IRPA 2OKOA 2Q01A 1LRTA 4I7VA 3QLDA 1UUQA 3H12A 1E6SM 3HGRA 1OFBA 2VVSA 5MF5A 3A9IA 4IL0A 3UG4A 3A22A 4GG9A 3KHDA 4R7JA 1FY6A 3WELA 1OFRA 3M0HA 2HNEA 4K1WA 3MDWA 3NWRA 4JICA 3ZT7A 2AQOA 3BO9A 2VC9A 3OGRA 4NYUA 2PA6A 1Y65A 1LCOA 5BXSA 2EKCA 4KERA 1FHDA 4J2PA 4JX5A 1BVZA 3UJ2A 4JTAA 3EAUA 1Q63A 2NLYA 2WSKA 1J5TA 4FIQA 1S5NA 3TONA 5GJMA 1W3NA 2RHGA 4A29A 5K9DA 1YLVA 4U10A 3QR3A 4Q8WA 4YJ5A 2RDUA 4OBTA 1PV8A 4LAZA 3GDLA 2G3FA 4JQ3A 3OBAA 3D5HA 4DBWA 1EB3A 5C9WA 4UTFA 1WB0A 2QULA 4J35A 2C1IA 3EOOA 2FPTA 1T8QA 4AEEA 1OFAA 2QV5A 3GXNA 1FWIC 1FWCC 4DXXA 3TE9A 2V30A 3F4VA 2R94A 2OKTA 4YWSA 3KL3A 1GOQA 3WX7A 3R89A 4P8VA 3VOGA 2OT1A 1OFQA 3LERA 2QJJA 4CNUA 4AISA 3LI0A 1XYMA 2A7RA 1ME7A 3H7RA 1VQTA 3N3MA 4C91A 2BXVA 3VNJA 4QEEA 5FF7A 4WSKA 5D8WA 2Z2UA 3MJYA 3JZEA 5EMJA 3T42A 3VMOA 3W1LA 2RUSA 2TSYA 3WSUA 3C52A 3B8UA 2D2HA 4FAMA 4N2YA 1GT8A 1VJIA 3W7PA 3W6MA 3VNZA 1SFTA 2XN2A 3A13A 3CIWA 3S9ZA 4MTVA 1KTBA 1WXZA 3H54A 3TIMA 5AVHA 3CH9A 1HVQA 4PUNA 2OSXA 2YW4A 1XLHA 5HQMA 1Q2SA 1NQ6A 2WZIA 3BANA 3AC0A 1TTQA 2PTDA 5G2WA 5CJNA 4LS2A 3N25A 5EU9A 3S0CA 3T6CA 3LD5A 1VFUA 1W31A 1ISWA 3CZ8A 1VFLA 2FTYA 4ZMGA 2ZRWA 1TPFA 1WZMA 1E3ZA 3LLXA 4HU4A 4M19A 3P14A 5A8NA 4NZJA 2P10A 4NAFB 4IQJA 3GUWA 4DPPA 3H6OA 5KEZA 3W29A 1KFBA 1H5VA 1GTEA 1SSGA 3EX2A 3TN5A 4IGSA 3DECA 2Q02A 3GO2A 2VC6A 5M17A 1Q7ZA 2Y4SA 4QSFA 1S5VA 2BP1A 1JGMA 1UD2A 4E2DA 4OE7A 4UCFA 2D0FA 3GHTA 3UG8A 3VFCA 1XYFA 3MYOA 1M65A 4PFMA 3B4YA 1QT1A 1RD5A 2NSOA 1ZLPA 1IZCA 2DT1A 4NRRA 1JDFA 5AY7A 1OCBA 1PKNA 3GUGA 1RLDA 1P6WA 3NTYA 3S2NA 2WSPA 3TQKA 3PVFA 4IISA 4NJGA 4GXWA 5DO8A 3OYXA 3UWWA 3FFSA 2F38A 5E5CA 4IM4A 1KGWA 4PTVA 4O19A 3H70A 4YYCA 3TZFA 3ARVA 4WRHA 4Z2IA 4D6FA 1XISA 1BTCA 1Q3NA 3AHXA 3MMTA 4UZUA 3GK0A 4JQAA 3ZVHB 2FQIA 3P74A 1JPHA 3WQFA 3ABQA 1D9EA 4CNOA 1FDJA 1GZJA 2ZVIA 1E43A 1J01A 2AMXA 3B3DA 4CCDA 2QJGA 4PMUA 5HQEA 1F6YA 2FVMA 3S2CA 4PGLA 2WKLA 1HJQA 4J3TA 3ARSA 4QS5A 5BOEA 4S3DA 1IT7A 1S1RA 2VGBA 5AYYA 4JPGA 4B5SA 2X1IA 4AF0B 4DXKA 3DH7A 1RCQA 3KOZA 1UKQA 3PP7A 4LNYA 1QW7A 4PMQA 3TYUA 3E9AA 4IPLA 3N9RA 3CQ0A 4MB4A 4QLLA 3VX1A 3O0FA 3PBUA 2PCEA 4U31A 1YW1A 4IJCA 2Y85A 4PTDA 4AZCA 3VMNA 3ZJKA 3QR0A 1WQ5A 3BMXA 4UMBA 4XIMA 3AIRA 2YSWA 3QR1A 4AZ5A 3ORWA 4JTEA 4R3UA 3L4VA 4PMJA 4JTLA 2VFFA 1ZJIA 2OOGA 3BICA 2NWRA 2OEJA 1EHNA 5D02A 1UD5A 1IZKA 4L4PA 4ZOBA 2UZ9A 2GVEA 2QXWA 5K4XA 1VFMA 1RY0A 6PTDA 2PDFA 2DZTA 2QUNA 4H3DA 3TCSA 3A47A 5D9MA 1S38A 4H00A 1EEXA 2OQYA 4NZ1A 4JEQA 3MANA 4PUKA 4JNMA 4A22A 1I4NA 4K8GA 3QSRA 2NQLA 3HQPA 3GZ3A 2E6DA 1LOQA 1UWIA 1R3VA 2ZX7A 2YXOA 1KD0A 1KTNA 3WD0A 4AD2A 1GKQA 2WCGA 2YFNA 3W88A 4RNFA 3OVRA 4Q8TA 1LT8A 2TODA 1RHCA 1E5NA 4PCNA 1R3QA 3TN4A 4GYKA 3R94A 1EJSC 1XPGA 3U2EA 3KRUA 1TA3B 3KBNA 3BMVA 3TA6A 3W7GA 3G1AA 1FDZA 4DNHA 3VD9A 2RKXA 2B81A 4NAEB 3W27A 2REQA 1NWRA 2PLMA 3GU9A 3F2CA 1LORA 3L0NA 2GGGA 2OEKA 4MNKA 2BVWA 1UOZA 3M5YA 4BJHA 2NX9A 3VIMA 4NIRA 3HJEA 3BH4A 1IT8A 4AVFA 3ES7A 1VCVA 2YIHA 1JZ6A 3W28A 4S3AA 1OZMA 2WWDA 3H2CA 3B06A 3LLFA 4BFAA 5E93A 1KFCA 2F2HA 3W02A 1CWYA 1V3HA 5CQ1A 5LNRA 2EBNA 3ISIX 3TTYA 3CV2A 2A5HA 2B7QA 3ARTA 4F0SA 1TWSA 3WD2A 4FF7A 4OKDA 3SGGA 2W62A 5CSYA 1AH3A 5IDIA 3TDFA 2GQAA 2GWNA 1Q4NX 4C60A 2G4JA 1J12A 2V2DA 3TSMA 4F0RA 2Y5EA 3GKFA 4AWTA 3ZO9A 4UR7A 4HD5A 2NVAA 1OGGA 4B4HA 1XRVA 2F6UA 3UXKA 4GZEA 4RZ6A 1VJSA 1AH4A 4A4AA 2JEQA 1XLEA 4QLKA 4E4FA 3AXXA 1B4EA 3UJEA 4AD0A 5AYZA 1TV8A 1OFEA 1KCLA 3JZUA 3QHOA 3M7WA 3APTA 4QCEA 2Y88A 5HNNA 1D8WA 1V8EA 3AZSA 8TIMA 3NO3A 1MW3A 1K4GA 4DO6A 4BF5A 1A5LC 3VE7A 7ENLA 2WZHA 4YVVA 3QV7A 1RPXA 3U48A 1UH4A 2O4MA 3TXVA 3VI2A 1XLFA 1SJBA 2BGNE 2I5QA 1KXQA 4MPKA 1ESWA 1SZRA 3DDMA 4PCTA 3TYEA 1SFSA 2JKEA 2XG9A 1TZ7A 2BHYA 2GLKA 2WOQA 4H2CA 1GVRA 1HKKA 1F6PA 1AFSA 3H7UA 4JIPA 1ITUA 1EOKA 3IIOA 4O13A 1J0JA 1V5XA 3UGVA 3WLQA 4U28A 4X22A 3C0LA 2QGHA 2X1SA 1ZJBA 3NZPA 3WF2A 1I75A 4HA0A 2I17A 2RAGA 4BZYA 3IJ6A 5A6SA 4ZB5A 4YTTA 1PUDA 2XSXA 5G4EA 1IEWA 3AXHA 3ZT5A 5ENLA 4KCWA 1W1PA 3WMSA 1W32A 1GKPA 1GYMA 4O54A 1XQLA 3APYA 1LUCB 4GUGA 4WSHA 4D2JA 3WO8A 1JQXA 3WH5A 2QCDB 9CGTA 4CVWA 1X6NA 1YNQA 3NO5A 2CEQA 4GMEA 1P43A 4OV9A 1TPEA 2GJPA 1MVYA 2GSEA 1JFHA 3T2PA 1Q65A 4CEUC 2CITA 3RG6A 1UWSA 1P0DA 4UZSA 3WQVA 1XICA 3VIIA 2VJXA 1OADA 1X6UA 5LIXX 2INZA 4QG9A 2YDAA 2Y7GA 3VUPA 1H4PA 2QEZA 1EZWA 1GJUA 3SQMA 3W0KA 2GZXA 2ZZ4A 3BJTA 2CBJA 1V3IA 3KLLA 4ZEPA 3NDZA 1F5ZA 2OX4A 2V9DA 1XYZA 4H8UA 1CECA 1R3WA 4X9YA 1V6YA