3GNDA

Crystal structure of e. coli lsrf in complex with ribulose-5-phosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
280
structure length
276
Chain Sequence
b'GKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVVRDQRYFSLATRIAAEMGAQIIKTYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldolase lsrF
publication title The crystal structure of the Escherichia coli autoinducer-2 processing protein LsrF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 91
structure length 276
sequence length 280
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gndA00
1W5OA 4FNPA 4HNUA 2WNZA 1D9EA 5AHFA 2X2GA 1SZEA 4XZ9A 1G7VA 3C2EA 4EIVA 1K03A 2QF7A 3S1WA 3CT7A 2DZTA 4ZQMA 4N9DA 3TFXA 3UWVA 4OWGA 3DH7A 5CG7A 3S0CA 2YXGA 3D0CA 3PSVA 4AEOA 3B04A 4K36A 5AC6A 2Y85A 2QCEA 1SO4A 4FHAA 1ZNNA 1GOXA 4G1KA 4LVBA 4N2YA 3UD6A 1WBJA 3E96A 2RH9A 4JTJA 1QOQA 4JIPA 2VFIA 1OYBA 4GUJA 3BARA 1N8FA 3MO7A 2GJLA 3HPSA 3OG3A 4IUOA 3LHYA 3OVPA 4K8HA 1SFLA 5CSRA 2QCGA 4LWWA 3PBUA 3NQCA 1EUNA 1F73A 4FO4A 1BEUA 1SW0A 1ZCOA 3A22A 3LXAA 3SECA 2GUUA 1EX5A 3MUXA 1YXYA 4ONVA 3NVTA 3GKFA 1W1ZA 3O8AA 1LOQA 1L9WA 5C5YA 3TSBA 4RLIA 3QJAA 3NEVA 3RU6A 4JTEA 4N4PA 1VLWA 4PFMA 5DN1A 5CGQA 3PG9A 5K9CA 2ZZ5A 1JUKA 3LXBA 1H7RA 4ZQCA 3W7GA 1FWSA 4QITA 1S3HA 3P67A 1ICQA 2CLIA 1HO1A 2QKFA 5CPMA 5LKYA 1W5QA 5LNSA 3C6CA 3G3DA 1FXPA 4XKYA 2YSWA 3G0SA 3HMJG 1K8YA 1WA3A 3EXRA 4MZYA 5D04C 3A5VA 4UTUA 4O10A 1QPQA 3DZ1A 4H3DA 3IGXA 5HJLA 3P82A 1VH7A 2B7OA 4UFLA 1GZGA 1THFD 1WOAA 3UYCA 1SO6A 1H51A 3BLIA 1TQJA 2OX1A 4Z0SA 3TR2A 3BW4A 3KAOA 4XBSA 2CLEA 1BWKA 4DEFA 2QUVA 2ZRYA 3MYOA 1L6WA 3RFAA 5KTLA 2ZZ7A 5EY5A 1ICPA 5D33A 4QNWA 3W74A 2OJPA 2UV8G 8TIMA 1X8FA 1VJIA 2R14A 5CZJA 2Y61A 3KRZA 1P0KA 1ML1A 4GWEA 1L6YA 1GEQA 3PR2A 4JYDA 1DOSA 4IWWA 3R8RA 4BK9A 3PWAA 3DU0A 4RZ6A 2C3ZA 4X9SA 3VE9A 4GFSA 1JRCA 3EX2A 3PC0A 3QFEA 3KFTA 3NQGA 3GDMA 1XUUA 4NJGA 1FWTA 3W07A 3GDKA 4YWIA 3DHFA 5U7SA 4CNOA 2YW3A 3O63A 4M6PA 5LZLA 4WZHA 4PC8A 1CI1A 1Z41A 3EWXA 3HG2A 4M6QA 4A29A 5U4NA 3F1QA 3THQA 4TMCA 2JKPA 3C4UA 2WNQA 3NZRA 3INPA 5LGXA 5LNWA 2C1HA 1GYLA 1MXSA 1LZOA 2C19A 3NQ8A 1W5MA 4JTIA 4PCFA 2X1TA 3G18A 4YL2A 2P0OA 2ZTJA 3KOFA 5LNRA 4O0KA 1AW5A 2E6AA 2C15A 1WAUA 4Q33A 5CSSA 1C8VA 4OQVA 1QR7A 2NUWA 1TYGA 1KV8A 3KVKA 1S5WA 4AWTA 5BOOA 1R47A 1N7KA 4CCCA 4LW7A 1ZHAA 4YLWA 1IXPA 1QO5A 1G6CA 1UUMA 1OHLA 3FKKA 1YTEA 3UPBA 4RR4A 1TPWA 3A9IA 2HTMA 4Y6GA 1XUZA 3EWZA 5H2ZA 3F4WA 1H1YA 4RXGA 4JD4A 1XI3A 3QPYA 5HWNA 3W1TA 1ME9A 3STGA 4M7TA 1Z42A 4JS3A 3W70A 4ADTA 3L67A 3PB0A 4ML9A 3L5LA 2ZYFA 3O07A 3MW7A 2EF9A 1ZFJA 1SZFA 1WYIA 3PBVA 5E93A 4JTHA 1UB3A 3LRMA 1SO3A 5BMXA 2NXHA 4UMCA 4X22A 1ZY9A 2QEZA 2B4GA 4WXZA 3KVLA 2WQPA 2QCFA 4MYAA 4IOTA 1B9BA 2NUXA 2XN1A 4KFOA 4M6VA 2A21A 4WUIA 5DCEA 4HN4A 1KTNA 3W1UA 4I7VA 3W88A 4UFMA 3G22A 2VEPA 1SU5A 2J24A 1TJPA 3WJYA 2W0UA 3DKLA 4FNRA 2VEKA 1FCUA 4AHOA 3LCIA 5K3VA 4NT0A 3SR7A 2Q8ZA 4CLMA 1IIHA 5DXYA 1QNVA 4O14A 3JR2A 4AF0B 3TXZA 3GXNA 1TQXA 4YXGA 3G1VA 1KLYA 3C56A 3G0XA 3IGSA 1KTCA 3G1XA 5K9DA 2E5DA 3CIXA 3IVSA 5D2VA 1I2RA 4YCPA 1UCWA 1XKYA 3BVJA 3C61A 3ABQA 2Z6JA 5CZSA 1FWWA 2G96A 4I9AA 4JX4A 2V2CA 2VFHA 4HIBA 3NPWA 3LX9A 3S42A 4BWLA 3NQMA 3W1NA 5AN7A 2WSRA 4FNQA 1D3GA 1OX4A 4HKPA 5EKYA 4E0CA 5F2MA 5HR6A 5D03A 3NQEA 3HF3A 5I3IA 1QAPA 3G1DA 4MKNA 1DJNA 3UWZA 3C8FA 2H6RA 1AW2A 2F7FA 2J9ZA 2VEIA 4KFNA 5H91A 2GQ8A 3QH2A 1GVFA 5KZDA 2H8ZA 3N73A 3P74A 4O8RA 3EWBX 1K02A 2GPTA 3B4UA 4UTKA 1XCFA 1SR9A 3WK0A 3DGRA 3EX4A 1M7OA 2CLFA 4MZ1A 2WSYA 3O1NA 3TE9A 2QUUA 1NEYA 3W7CA 2VFGA 2CLOA 1KFJA 4R53A 3V1PA 3IIVA 4UTTC 5E0KA 3MYPA 3OHIA 4GXMA 1EIXA 4IX2A 3PY2A 2E6DA 4NJHA 3NYZA 1VHCA 2V2DA 4DO4A 4HSOA 4RXFA 4ALDA 1H7PA 1TIMA 2CZDA 1XBYA 4JY9A 1HO4A 1TPFA 4RX0A 4FIQA 1HFBA 2DZXA 1KM4A 2A6LA 2O7QA 1FX6A 1B3OA 2OT1A 2Y89A 3A23A 5KMYA 3M47A 1A5CA 1R30A 4RZ4A 4S2BA 3LLDA 3S6DA 1QPRA 3L0GA 3HIJA 3NGJA 4NJKA 3UWUA 5LNUA 3TCEA 3PS7A 4MOZA 3LHWA 1QWGA 2GVGA 3BK0A 1H61A 3UQNA 3P84A 4JDBA 4K38A 3JS3A 3QQ1A 3W1AA 3Q2DA 4CNNA 2JGYA 1FDZA 3B0UX 3DFPA 2B7NA 1ZAHA 3TROA 4YCOA 2P10A 4NNCA 5A5WA 3SSJA 1XXXA 1H62A 3CEUA 4RK8A 3C2OA 1WBHA 2QJHA 4UMAA 5EBUA 2NLIA 3IVUA 3N9SA 1FY6A 1F2JA 1GWJA 3BG3A 2Q3OA 2XFWA 1RQEA 3L5MA 2HS8A 1T0OA 3GZ3A 3TA6A 4N6EA 4O28A 2OCZA 1I4NA 1OFRA 1G4EA 1TPVA 4O4WA 3QMSA 1KM6A 1JR1A 2YPIA 4NU7A 2E5CA 3CLMA 4GC4A 2GJNA 2ZA3A 1DKWA 4XWUA 2ABBA 3NOEA 5ABTA 2VFEA 2JGQA 3IIZA 1YXCA 3GR7A 3DI1A 4JTTA 4FX6M 4S1FA 4BI5A 4WOQA 1IF2A 3E0IA 4K7YA 3VKJA 3PG8A 2FLIA 5SWUA 1OYCA 2VEMA 3O6CA 3SZ8A 1YTDA 3TQ0A 5FESA 4A2SA 3STFA 1H1ZA 1ZALA 1NF0A 1TRDA 3QPZA 1K7EA 2I1OA 4P61A 5KZEA 2HSAA 4O1CA 1LBFA 1LOLA 3UXDA 3STCA 3HGJA 4PEKA 2ATSA 1M5WA 3GXTA 3L65A 2X1RA 3LXCA 2ZRXA 3UY7A 2A7PA 4FXSA 4OU1A 2NUYA 3TJLA 3BGJA 2Y70A 2BLEA 1JVNA 4MY8A 2WV8A 2NXIA 1VHNA 1DHPA 3CC1A 2FB3A 5LHFA 2BXVA 5G2HA 1G69A 4UTLA 4DF2A 5KSWA 3LBMA 1YPIA 2NZLA 1LROA 1GJPA 4O53A 1QDSA 4DQWA 1P5BA 2ZA2A 3NPXA 3WJSA 3IIPA 3LHVA 1KM5A 3SFKA 2XN2A 4IGHA 4TO8A 3TIMA 3MP4A 5D2XA 5LGZA 4FNTA 3DFQA 5I3KA 1TCDA 4I7UA 3UPWA 4Z1AA 2ZTKA 4JTGA 1O4UA 3W2KA 1SZGA 3M0ZA 1BTMA 3I68A 4ICNA 3CEPA 3ZFHA 3L9CA 4KFPA 1LORA 4Y8FA 2D73A 4FB7A 3UZJA 2JKEA 6TIMA 4U28A 3LV6A 2DORA 4WY0B 3PM6A 1M6JA 1M7PA 3N14A 2CZEA 2QCHA 3KVMA 2ZFAA 4N4QA 1DV7A 3GXPA 1QOPA 4OGZA 5AC7A 1OFPA 3RLVA 1OK4A 4N6FA 4O57A 1SO5A 2TSYA 4BI7A 2H8XA 3P8JA 2WO5A 3OIXA 3HOJA 1EP3A 2C13A 1LP6A 4XQ6A 5FF0A 3M6YA 2RFGA 3H53A 1VPXA 2I9EA 3W85A 1PCKA 3LOTA 1OX5A 5DCBA 1K3UA 3HPXA 2HS6A 2E5BA 3N19B 5F1VA 2ZRUA 3G1HA 2YR1A 1P0NA 1P1XA 4O52A 3BLEA 3CM4A 1GT8A 1LDCA 1AW1A 4QIUA 2CZFA 1AL7A 2ZZ2A 1DQXA 4DO6A 3GLCA 2YFOA 1W54A 3G0UA 4XTDA 1OFQA 3GKAA 1A5SA 2QJGA 1L2UA 1NSJA 1O5KA 3E12A 1C29A 2Z1BA 3OBKA 5C54A 1OF6A 1MEHA 5EL1A 3GDRA 2VXNA 3M5VA 4OHQA 3UWWA 4NJJA 2NV2A 2WPBA 3IIXA 4JX6A 2V81A 4AHQA 3BLFA 5HR7A 5D32A 3E49A 1VGAA 4JTKA 2V2HA 3W7PA 4OV9A 4L4MA 4O18A 3ZWTA 3LTPA 3SJ3A 1TMHA 4UNLA 1W56A 1MO0A 1O94A 1WQ5A 4LS1A 1G4TA 1U83A 3R12A 4KWVA 3M43A 2YX0A 3MP5A 1SSDA 3GNDA 3W23A 1G7UA 2V9DA 3A21A 1YDNA 1IXNA 4O19A 3W7LA 1F5ZA 1RVGA 4POCA 3UNDA 5FI8A 4E38A 4PTNA 3GYEA 3BGGA 4A2RA 1SW3A 4O11A 4PH6A 3LCLA 3MI6A 4DBDA 2JBMA 2Z6IA 1QFEA 1ALDA 4IMEA 3LERA 5BNKA 2VFFA 1MZHA 3FIGA 2ZRVA 3W7RA 3MHFA 4HPXA 4LVGA 3C52A 1PV8A 4JN6A 1IIGA 4LNYA 1ICSA 2BTMA 1WDWA 1X1OA 3S1UA 1U5JA 1FQ0A 2OT0A 3FEMA 2V5LA 1VYPX 4LOCA 4O50A 4M19A 1TREA 2KZHA 4ZVJA 2TRSA 3MWAA 1UASA 4NNAA 4K6AA 5IBXA 2PRMA 1NVMA 1LBLA 3TUUA 1XFBA 3CTLA 3KRSA 4IX0A 2FB2A 3W1LA 2VELA 5DBUA 1UUOA 2JK2A 1JRBA 2F84A 3FYOA 1Q6OA 4BF9A 3QW4B 2AAMA 2QAFA 3W84A 4FIRA 2QR6A 4IPJA 5D2YA 3WK1A 4E2BA 3W87A 2CLLA 2ZQ0A 4M5PA 2RKXA 3W86A 2EHHA 1IGSA 1TTPA 3W7HA 4HNNA 5EPDA 3M5ZA 3G1YA 3L0KA 1KV5A 1G4SA 2Y62A 2RDTA 3MHGA 3HG4A 4RCXA 1VR6A 5F2GA 2R91A 2Y7EA 1TRIA 3M9YA 5AFDA 2QCDB 2FPVA 4ADSA 3W3OA 3O05A 4IQLA 4ZQOA 2QCCA 2VENA 2GVJA 4NZFA 3W7MA 3NQDA 4NQ1A 5TIMA 3U6WA 1JULA 2J6XA 4NXSA 3FKRA 3W75A 1GVOA 1TPEA 3RLUA 1OFOA 2NXGA 3B05A 5I3HA 2ISWA 2PC4A 4ORMA 3GX9A 4L4LA 3W1XA 1KW1A 3I7QA 3P62A 5HMSA 1SW7A 3NDOA 1OG0A 2WSQA 3B03A 3P7YA 3NQFA 3O6DA 4DELA 3FA5A 3PB2A 5BMWA 4QM1A 5D09A 3L0NA 3S5OA 4JTLA 1LBMA 3SGUA 3FOKA 3GNNA 5CPNA 2Y6ZA 1H7WA 4AH7A 1WXJA 4NVTA 4J9JA 2ZA1A 4IXHA 4EF9A 1F6PA 3ZS4A 2OMAA 3TK7A 3O15A 4LV9A 4M7SA 2VOMA 1K7XA 3S1XA 3O06A 3Q94A 4MFDA 3PVFA 1SPQA 3LHTA 4DPQA 3SY5A 3N34A 4O12A 5DCDA 1FUYA 1T96A 3WJZA 2DZVA 3GVGA 2WNNA 2Y88A 3Q37A 2YZRA 4N02A 3C0JA 2GVLA 3LCHA 3O16A 3OA3A 1YDOA 3FS2A 3F4NA 1OFEA 3P61A 1EP2A 1GVSA 5G4EA 1ZJIA 4WY0A 2RDUA 4JXCA 1ZENA 4JYFA 3PAJA 1KA9F 1TPUA 3NR0A 2B7PA 1TO3A 3TJXA 2QAPA 4O4VA 1GVQA 4DF0A 2A7NA 3M5XA 2ZRWA 1B4EA 1I45A 3EEGA 4YMZA 2AQWA 4WD0A 2ZCGA 2EPHA 1ME8A 3NQAA 3NM1A 3HQ1A 3H55A 1VZWA 1KLZA 3MBFA 3HO8A 1BKSA 2ZDRA 3WFAA 3W7QA 1VCVA 3DBPA 2CW6A 5F4SA 3CPRA 2ZZ4A 1JQVA 3SGZA 3WJWA 4MJMA 5KITA 4MIMA 3WK2A 3HGRA 3GIYA 3I6RA 3TAOA 4UCGA 3DFSA 3TXVA 1FXQA 3NPUA 3EKLA 1RPXA 4Z1DA 4FF7A 1QPOA 3HB9A 3C2FA 4Q4KA 1CX9A 4A21A 4MLJA 1EUAA 2E6YA 2NWRA 1AMKA 5D2WA 3TQKA 2CZ5A 4CQ8A 3ANYA 4JYEA 1F76A 3T44A 5CPOA 1SUXA 4XKYB 1R2SA 3W83A 4LRSA 4IPIA 1PS9A 1HG3A 2NWSA 3ABSA 3O6YX 5A8GA 1R2RA 4N9BA 1P4CA 3EXTA 3U8GA 4GUHA 3PBYA 4QAIA 4O15A 4LUIA 1VCGA 5IM51 4MJZA 1MEWA 2TPSA 3HG5A 3T7VA 2DP3A 4TU1A 1EWDA 1AL8A 1OYAA 2C6QA 5DY2A 3S1VA 4DPPA 1J2WA 4GUIA 4UTHA 1IXOA 4EOUA 3W2JA 1VRDA 1YPFA 5KINA 3EWUA 3QMTA 4CQAA 1W3NA 2A5HA 3TC7A 4ZQPA 3TV8A 2CLKA 3G8EA 4JEQA 1V5XA 2FIQA 2YFNA 2DZWA 1BWLA 1TTIA 2CLMA 5G1YA 4PA8A 3B0VC 4BWLC 2Y7DA 1NFBA 3RMJA 3L5AA 5C2XA 1W3IA 3CB8A 1JJKA 3ABRA 4LS2A 1X6UA 2CWNA 3IVTA 1PHWA 3S9YA 2FTPA 5E1QA 4AHPA 3CWOX 1Q6QA 3QZEA 4O13A 5K4XA 2PURA 3HG3A 1J5TA 1XDMA 1Y0EA 3R2GA 2OZ0A 2PRLA 6ALDA 1XBXA 1OFDA 2I14A 1LCOA 1VC4A 3PUOA 2DJXA 2E68A 1SZNA 1FCBA 1FCVA 3LM7A 3W2NA 4JR5A 4N9EA 3LCXA 1FDJA 4U4MA 4UR8A 4CQ9A 4QSHA 3ELFA 3RNDA 3VNDA 4LRTA 3U2OA 1G67A 3IEBA 1W0MA 3LDVA 4ZL1A 3W76A 3W7IA 2YW4A 3OVRA 3S5NA 3W2MA 3TSMA 4JX5A 1I2PA 3QW3A 1GG0A 1LRQA 3TSDA 3DFNA 4Y9AA 3P60A 2NX3A 4UFJA 4IXXA 1SSGA 2TMDA 2B0MA 3TW6A 3G1AA 3SI9A 3QMRA 4NNBA 5HUOA 7TIMA 5EA9A 1XL9A 2QCDA 1B4KA 3NO5A 4GUFA 2V5BA 1HTIA 4JTSA 1FDYA 1NF7A 5AHLA 2A0NA 4GUGA 1YXDA 4QNEA 1A5BA 3GK0A 4O1DA 5G4WA 3W7KA 2ZZ6A 4WXYA 3STEA 4Z0JA 1GQNA 3S5ZA 3LGEA 1GTEA 4UIOA 1O95A 1UBSA 3HGSA 1WX0A 5HUPA 4FX7A 1LM1A 3AJXA 1F7BA 1I2OA 2GOUA 2J9YA 2RDWA 4LVAA 2DZSA 3I7SA 3MJYA 4R34A 4ADUA 4IMDA 3TNOA 3QF0A 2FFCA 3BV4A 5F2IA 1Q6RA 1KBIA 4O1AA 4UR7A 3TDFA 2A6NA 4HNVA 2Y7FA 4HT3A 3C2VA 3G1FA 1I2NA 3Q58A 4A22A 2QCMA 1TTQA 5DBTA 3NL3A 4XBKA 4NJIA 3A24A 4LVDA 4WY0F 5LSMA 3NXFA 2C16A 2YCEA 5I3GA 1R46A 3B06A 2QDGA 3VI2A 3T4CA 2J9XA 1GG1A 2E09A 4AF0A 3AO0A 1JCLA 2NX9A 3NQ2A 1T99A 4ZQRA 3FFSA 1YYAA 1TTJA 3T78A 1OX4B 5FEXA 4MUZA 4DO5A 4PL2A 3M1ZA 4IMCA 3W71A 5L9FA 2FJKA 5F4XA 2E77A 1TSIA 1AG1O 1IXQA 1W3TA 3RK8A 4XUGA 4ZZ9A 3GB6A 3TH6A 2FPTA 1YTKA 2J88A 4PODA 5HWMA 3UXAA 4WJEA 3KXQA 1H60A 1RZMA 4E2DA 2ZZ3A 3ATYA 4TX9A 4X2RA 2YDAA 1KM3A 4UFIA 1TPB1 4BR1A 1RV8A 3IV3A 4TIMA 1KFLA 2E6FA 1W5NA 5AHEA 3HBLA 3W2LA 3L21A 1VLIA 3BW3A 3DFTA 1KFBA 5AHMA 1XBZA 2EKCA 4UNKA 2DJLA 4RJEA 2ISSA 1X1ZA 2ZZ1A 3EB2A 2TYSA 4LV4A 2FPYA 2W6RA 1E51A 3P5YA 4LTSA 5KZMA 4MYXA 3DHDA 3LB0A 4NXKA 3ZWSA 1K8XA 4FNUA 5FF4A 3W1MA 1SQ7A 3W1PA 3ZR4A 3QSRA 4LT9A 2V0TA 4QISA 4WQ6A 1TV5A 1PVNA 1VYRA 4JICA 1TPDA 3DENA 3GDTA 5G2IA 5K7JA 1KFEA 5FF3A 5BW6A 2PCQA 2H90A 3L66A 1JUEA 3N3MA 2QDHA 5G1TA 2BSLA 4QJ1A 1LRTA 1KM0A 2BX7A 3PBWA 4X3ZA 3T40A 3DI0A 3E9AA 3OVQA 3LHUA 2C14A 1RQHA 4Y96A 1KTBA 3G1SA 4JY8A 2ALDA 5LNVA 4LVFA 3DAQA 4AXKA 3I65A 2YGYA 3IIOA 4K7VA 1JQXA 4MVAA 2X30A 3VFLA 1W37A 4N9CA 1AK5A 1YADA 1I2QA 4HNTA 1FWRA 1TB3A 3P81A 4AAJA 1QO2A 3ATZA 3MHUA 1PCWA 3MMTA 1XDLA 1LLZA 2CLHA 2Q8LA 4AWUA 3TKFA 1PIIA 5DELA 4C1KA 2A7RA 3FLUA 5G5IA 3VE7A 4IJBA 1QPNA 3H54A 3LTYA 2BZNA 5J5RA 2WOQA 3W7NA 4NUWA 1TPC1 1A50A 1XBVA 4EWND 4Z1CA 2LLEA 2YYUA 1V7YA 4GNJA 3EWWA 1ZAJA 4UTMA 1H63A 4Z08A 1VYSX 5TQLA 1QMLA 4FEZA 4C1LA 1JCJA 3WJXA 5CZ0A 2GQ9A 5D05A 1WOBA 4MFEA 2DZPA 3R13A 3NQ7A 3JRKA 4KKXA 4TMBA 1OJXA 4HPJA 1OABA 3PSWA 4LY8A 4UFHA 3QEZA 3LI1A 3LRLA 4R7JA 3CIWA 2QJIA 3MP3A 3R5EA 4ORIA 1A53A 2BWGA 2G95A 4Z1BA 2QUTA 1FWNA 3LI0A 1VCFA 3GAYA 1DBTA 5AHNA 5FEWA 1KM2A 2Y7GA 3HPZA 4I7WA 1HUVA 2C18A 5F1UA 3NZ1A 5AYZA 3M44A 1O60A 5D30A 1Q3NA 2G5WA 2ZRZA 3P5ZA 4UTTA 3QQ0A 1TJRA 5FEZA 1DQWA 5T26A 3YPIA 3W73A 3KX6A 3CU2A 1S5VA 1FBAA 5F4WA 4NX0A 3NM3A 4D2JA 1EWEA 1T8XA 2EGZA 3IGUA 3QM3A 4GJ1A 1NAL1 5TBOA 3PUEA 1A5AA 3LTSA 4JDYA 3FJ6A 1H7XA 1H7NA 1KFKA 2DU2A 3UZ5A 1UJPA 1DORA 1VS1A 3G3MA 4O1BA 4EF8A 4RV8A 1PL9A 4JNMA 1TPH1 4GBUA 4MY1A 2FDSA 4CCEA 4HSNA 3DXIA 1EEPA 2FQIA 3MI3A 4LUJA 3NNTA 3TMQA 3W7JA 1FCQA 3LV5A 1HL2A 3BG9A 4O0ZA 1LOSA 1JCNA 3EX3A 4MY9A 5IBXC 4K8EA 3W72A 3LBCA 5HQEA 1QCWA 2EAWA 5G2WA 5AB3A 2PRHA 1LTDA 1RD5A 1H5YA 4CNPA 4UMBA 2G97A 3NPVA 4O17A 3GR8A 4HHPA 1LRNA 4TR9A 2VKZG 4LC8A 5HINA 3PUDA 1EPXA 2V82A 4CCDA 1GPWA 5LHEA 1PHQA 1L6SA 3LHZA 3C3NA 1ZAIA 4QQ3A 4BFAA 3SIZA 1EB3A 3NQVA 4K39A 3C2RA 1G4PA 2VFDA 3ABOA 3S8HA 3TC6A 1OK6A 4NX5A 3B0PA 2QCNA 4UTWA 3S5YA 2Y63A 1ONRA 1EP1A 3V75A 4R33A 4OBTA 2ZBTA 3W7EA 4H6KA 5MHBA 3FJLA 1F05A 1K7FA 2ABAA 1OFBA 1Z44A 3P80A 3TMLA 1I8JA 5I3FA 5AYXA 2RHGA 4AWSA 3EX6A 2VC6A 1B57A 4GE8A 1Q6LA 4UFKA 2IQTA 3T55A 3HJZA 5L6UA 4ZMGA 4MZ8A 4NZJA 1JCMP 4RZ5A 4H4IA 3W9ZA 1YLVA 5EMUA 3LRKA 3P8IA 1KBJA 2W79A 4LC6A 2YYTA 1XC4A 3UY8A 1J4EA 2CFFA 2A2IA 5D2TA 2X1UA 4FNSA 1H7OA 3QSTA 3MBDA 3GAKA 4LS0A 2ISVA 3CQ0A 4FXRA 5FEPA 2WJZA 3NG3A 1JCXA 1OFAA 2QCLA 3NL6A 3NA8A 1TV7A 3BG5A 2NX1A 4WX2A 2CU0A 4DF1A 3L2IA 1O5XA 5D38A 4MLRA 4GRSA 3PF3A 2R94A 1OF8A 4JTFA 5C55A 3W7OA 1F74A 5K9XA 4XTIA 5HULA 1S5TA 3TU9A 3TFCA 1Z48A 4AMAA 1CW2A 3LCWA 3G8RA 1JCYA 2V30A 2B7QA 4LU0A 4UTJA 3CWNA 4JTUA 2NV1A 3BO9A 4IMGA 3NL2A 5K4ZA 1H50A 4W9TA 5BRBA 3IRDA 5GVJA 4OT7A 2GQAA 3THAA 3N9RA 3MI2A 4A3UA 5HNRA 2ATMA 3R89A 3I7RA 1PE1A 2A85A 1GYNA 2X1SA 4DBEA 3EXSA 3LCFA 5DXXA 1F6KA 4UXDA 1YDVA 3NL5A 1TV8A 4WOZA 3UWYA 3TX9A 2A4AA 4Y90A 3NAVA 1W5PA 5I3JA 3G24A 4AVFA 2Z2UA 3TW7A 2H3DA 3N2XA 1D3HA 3L68A 4KWWA 1DVJA 2C0AA 5DY3A 1ME7A 5F2LA 5CKSA 4UTWC 3EX1A 3VCRA 5EYWA 2H3BA 4JIQA 2JKAA 1KM1A 4B5NA 3TAKA 3M7WA 3W7DA 1LLWA 4O16A 5CZTA 4FX8A 3BW2A 4P2VA 1C9DA 3CHVA 2P1FA 3LLFA 4IMFA 4DXVA 4K37A 3DKJA 4MPQA 4OV4A 3A5FA 3M41A 3QC3A 1WV2A 4UC5A 1Q45A 3WK3A 3QYQA 4S2CA 5K2ZA 4Q32A 3UWQA 1EA0A 3F03K 3K30A 4RKAA 4AB4A 5HWJA 1W8SA 3USBA 5AOUA 1KFCA 3W6YA 1MSSA 4JGDA 1X7FA 2O7SA 3KVJA 2E1DA 3OEXA 4EVZA 2DZUA 4BI6A 3W22A 2V8ZA 2PE4A 1RQBA 3N2MA 3LCGA 3SW6A 5J5DA 1K8ZA 2HMCA 3M5YA 5DLCA 1XM3A 3PULA 3BPWA 1GTHA 3KHJA 5FF7A 1DL3A 2Q3RA 2R8WA 3W1QA 1JUBA 1OVDA 1GVRA 3KRUA 2WKJA 4UUIA 1MEIA 5C6MA 2X16A 1LYXA 2J27A 5D02A 3B8DA 3GDLA 1VQTA 5AC8A 5FF2A 5CPLA 3TQVA 5AYYA 3NQ6A 3W1RA 3W2UA 4OE7A 4ZQNA 1RR2A 3RF9A 4PL1A 5D37A 2AGKA 3DFOA 3QRHA 1OX6A 1R2TA 1ADOA 3E02A 5AHIA 3FYPA 3HGOA 3M16A 3EWYA 4O54A 1SFJA 1DJQA 3EKZA 1N55A 2XN0A 2A1YA 4UTIA 2Z0IA 1W31A
chains in the Genus database with same CATH superfamily
1W5OA 4D6IA 4FNPA 4PE8A 3PZOA 4P7LA 1SZEA 3KDOA 2XYLA 3VILA 3M7SA 3C2EA 4EIVA 1XIGA 1FP9A 3BAWA 3AS2A 1Q2SA 1TMQA 4OWGA 3KBWA 3DH7A 5CG7A 3WDIA 3OYZA 4O8AA 3D0CA 2GWGA 3NYDA 5DQPA 4YYCA 5AC6A 1SO4A 2E28A 3CO8A 1ZNNA 1T8QA 4M56A 4LVBA 3V35A 1KCZA 3UD6A 1V93A 4LCSA 1SJBA 4JIPA 2PDQA 1ADSA 2VFIA 1N8FA 3MO7A 1S5NA 3OG3A 1JYWA 3LEPA 2O56A 1SFLA 3KTXA 1HJVA 2PEVA 3NQCA 2NQ9A 1EUNA 1F73A 4FO4A 2YJQA 4W89A 4PCTA 2GUUA 4B5WA 4L6HA 1Q6GA 3NVTA 2X05A 2VTFA 2WAGA 4RLIA 3QJAA 3RU6A 3W53A 3OBAA 3LXBA 2EPLX 1H7RA 3W7GA 4AIEA 1XYZA 2E9LA 1V0NA 4IP7A 1E0XA 3VGEA 3TR9A 2OSXA 5EMMA 5LNSA 3C6CA 3G3DA 2G4FA 4W5ZA 4DWSB 5D04C 3GNPA 3ONBA 1EL3A 1QPQA 1S1RA 3U5YA 4H3DA 5LA0A 3VMPA 2BY0A 3NDYA 3P82A 4F4RA 1PDYA 3HFTA 4OECA 1YMYA 4AZHA 1THFD 2FZ8A 1WOAA 1SO6A 3LNPA 2OX1A 1DJHA 3EPOA 3KAOA 4FLSA 3WEZA 2ZRYA 2ZZ7A 3I4KA 1PX3A 5D33A 4QNWA 2OJPA 1X8FA 2XISA 1IHIA 4R85A 1XYLA 2ZC1A 2Y61A 2WQDA 3WL0A 1KWGA 1JPKA 2HZGA 1JFHA 4JFTA 3EDFA 2WZTA 3VCCA 3PWAA 4B9YA 1PKMA 3DU0A 4RZ6A 3GTHA 1WDRA 1JRCA 3EX2A 3QFEA 3GDMA 4GY1A 1FWTA 2PDYA 3RLGA 3EA1A 3DHFA 3GBEA 4XBJA 2BBFA 3T2QA 2YW3A 3DYPA 2IPWA 3KOXA 4PC8A 3HG2A 4JIHA 2KX9A 5U4NA 3F1QA 3PPGA 4TMCA 1S1PA 4OFCA 2ACSA 3C4UA 1TFVA 5LNWA 2C1HA 5CC6A 1DQUA 1NTHA 3NQ8A 1W5MA 1TX0A 3RR4A 4AVNA 4WR3A 3ARSA 3PFMA 4ZGYA 3VIFA 2X1TA 1W1VA 3KOFA 2XFFA 1AW5A 2E6AA 4M6UA 1C8VA 3P2VA 4JTDA 2XVLA 4E8CA 1QR7A 1KV8A 4NASA 4HA4A 1S5WA 4C60A 1AD1A 3TWAA 3R7MA 3S2MA 1ZQ5A 2EPKX 1UUMA 1OHLA 2V3FA 1YTEA 1ZU8A 3IJ6A 1UP0A 1V0LA 4QSFA 4S3KA 3UCDA 5H2ZA 3AWNA 5BRQA 2Z7KA 1H1YA 1RD6A 3F4WA 4C65A 3BLKA 4UBPC 4TXEA 1Z42A 4KGLA 3L67A 2OQLA 3E0WA 2ZYFA 3CUZA 3BDKA 1IEXA 1J9YA 2VZUA 4YU1A 5E93A 4IFKA 1WDDA 1JPDX 4MYAA 2IQ0A 5JBEA 3S9IA 2VEPA 1B30A 1SU5A 1TJPA 1RY0A 2W0UA 2HXUA 1QUMA 4FNRA 1IWAA 1R6WA 5FJIA 7CGTA 2EQDA 2WJEA 2Q8ZA 4CLMA 4GQGA 1IIHA 1W3HA 1E1FA 4QDPA 3L7RA 5DXYA 3MSYA 1IEVA 1KLYA 3C56A 3TP4A 4A3RA 4IICA 3G1XA 4YCPA 3ITCA 1UCWA 3ARUA 4HU3A 2L5HA 1B90A 5CZSA 4I9AA 1OD8A 5EU9A 3S42A 5EFDA 3NQMA 2XPKA 1D3GA 5F2MA 2FHCA 1CGYA 2V69A 3UWZA 3LBOA 1YNPA 3C8FA 1B3YA 3T0AA 2WSKA 1SJDA 3AUOA 4KFNA 5H91A 4C6BA 3HQOA 3QH2A 3WF1A 4X0VA 4O8RA 1K02A 3ONCA 3HMCA 5HQLA 4KEZA 3WK0A 1V02E 2QF8A 3EX4A 4G56A 5DEZA 4LBSA 3WD1A 1NEYA 3U3HA 2CLOA 5FD0A 3R94A 4UTTC 4OVXA 3BAKA 3MYPA 2E0PA 1AFSA 1EIXA 4U2ZA 3RUBL 2GDUA 3NYZA 4GQ0A 3SQSA 3S2JA 4OTKA 1XBYA 3VZYA 3LNMA 2J66A 1JDFA 3WMLA 3ARYA 4GO8A 1JDEA 2DZXA 4Q4OA 4GVGA 1E6XM 2O7QA 3CHCA 1B3OA 2Y89A 3A23A 3SY8A 1XLEA 4IG2B 2W61A 3LLDA 5HNNA 2OEJA 4EANA 2E4TA 2DW6A 3NGJA 4DWSA 5A6AA 1MUMA 3TCEA 2GVGA 5GNYA 4JDBA 3JS3A 2XZ9A 4NZ1A 3B0UX 2G3MA 1YE4A 4AEEA 3GXFA 1DXEA 1ZAHA 3SQLA 4NNCA 5A5WA 3RMEA 1H62A 1FTXA 1W9BM 3C2OA 3TEVA 1WBHA 3CIVA 4HHMA 2QJHA 4UMAA 4BQ5A 3IVUA 1FY6A 4GXWA 3H2OA 3TONA 3N18A 2XZ7A 1NP2A 3N1AA 3TA6A 1I4NA 1G4EA 1VBUA 3PJTA 4PGLA 1OY0A 4HK6A 4XKMA 3AZSA 2ACRA 3CNYA 4GC4A 4UOJA 1CB7B 4LXFA 4PUJA 5ABTA 1S2WA 2PDNA 5M5DA 4OKDA 2BOGX 1OC7A 3GHTA 4QS5A 3II1A 2VEMA 1NWSA 2ZUMA 5LIYX 4PB5A 2OWWA 1M65A 4P61A 3GD6A 5KZEA 2GJXA 4PCSA 2GVYA 3GXTA 4KRTA 4RNFA 3GC2A 3E2QA 3DG7A 1FKXA 4EAMA 2ISDA 1PTGA 3KBSA 3TJLA 2Y70A 2BLEA 2PLMA 1WE5A 1IEWA 3HA1A 2NXIA 1DHPA 1CENA 3CC1A 3AS3A 5JVLA 3W4RA 4DF2A 1EZ2A 4QTGA 1YDYA 3UCQA 4AZGA 1UH3A 3ARWA 4O53A 4DQWA 1JF5A 3RILA 3KBVA 4ZTXA 4HU0A 3IJQA 3VD3A 1SMAA 2WLYA 3CXOA 4FNTA 5I3KA 3BSGA 4I7UA 4AW7A 2V5KA 1UG6A 4Q4SA 4JTGA 1O4UA 3W2KA 3WCZA 4A8LA 1V3MA 1A3WA 4ERAA 3CHEA 3I68A 4R3UA 3APYA 3ZT7A 1EKOA 3AXIA 1QNPA 1LORA 3BSMA 3KL0A 4P8XA 4Y8FA 1GQLA 2JKEA 4U28A 3LV6A 3PM6A 1M6JA 2BDQA 2QCHA 1XR2A 2XDFA 3H7VA 2OYKA 3VNYA 2FVKA 4L56A 4DZAA 3MZNA 1OFPA 4PMRA 3AIUA 4DN1A 4IH3A 1SO5A 4UOZA 3S47A 3P8JA 3ZJKA 5A8MA 3VNIA 4DUWA 1FHDA 3HOJA 4H00A 5DT5A 2WMJA 1LP6A 5FF0A 3C2YA 2J8TA 2VD8A 1ECEA 4AD0A 1LL6A 1PCKA 3GE7A 1XRTA 4KCWA 2HS6A 2E5BA 5FOOA 2FZMA 3G1HA 4UOQA 2XM1A 3CM4A 1GT8A 1HW6A 1FVPA 2X42A 2QV4A 1T6MA 2DT1A 3GLCA 2YFOA 2FFIA 1W54A 3G0UA 3SN0A 3BWWA 1L2UA 4AZIA 3QV7A 5EL1A 3GDRA 2VXNA 4H9VA 1QHOA 5HDRA 3UWWA 2OKTA 5MKGB 1EJXC 2A3AA 2V81A 4AHQA 4DAFA 1POKA 2C91A 3OIHA 4W8BA 1WPCA 3HV8A 1ZGDA 1TG7A 2A79A 2UY3A 4KCTA 4K2SA 1MXDA 1FWCC 2AQOA 4L4MA 4O18A 4GJIA 3ZWTA 4GVFA 1TMHA 4DWSD 1MO0A 1JD7A 3BMWA 1WQ5A 1ZCCA 3UG5A 3SUTA 4RUBA 4RL3A 3MP5A 3GNDA 2VMFA 1IXNA 1F5ZA 4A8IA 1RVGA 2A3LA 3UBPC 1KXVA 4IG2A 1FFRA 2Y8UA 1SW3A 3HM7A 4PH6A 4DBDA 5I03A 3W02A 2Z6IA 1ALDA 4IMEA 4UWMA 3EDDA 2ZRVA 4F79A 1XQKA 5D8ZA 2Y24A 4AY7A 2HVMA 1EQPA 3LENA 2D0GA 4LVGA 3Q67A 5CEWA 1DJGA 3NJ3A 4DNMA 3DDMA 2ZUSA 4XO6A 5BU6A 2V5LA 1VYPX 4O50A 1TREA 3IUDA 3ABZA 3MWAA 4NNAA 5BYWA 1LUCB 3UXKA 1LBLA 2IQDA 1KCXA 3W37A 4IX0A 3WSUA 2FB2A 2DW7A 4GI4A 2P5NA 1SJAA 1AH4A 1JRBA 3FYOA 4JIRA 2IXUA 4DLMA 4OOUA 4GQQA 1H3GA 2QAFA 4ILSA 3L4ZA 5D2YA 3W87A 4CEUC 4XX6A 1MNZA 2BOFX 1IGSA 3W7HA 5EPDA 5E09A 2PLCA 4HPGA 3RCMA 2ZUNA 3QKZA 3HG4A 1VR6A 3F4CA 2R91A 3CLWA 4H1ZA 2Y7EA 1TRIA 2QCDB 3H7UA 1UZHA 5CPSA 4NZFA 2WKLA 2P0IA 2J6XA 3FKRA 1XCWA 3I3EA 1C90A 1M01A 1OFOA 5E9AA 3UXLA 2NXGA 1ESWA 2VCCA 3B05A 4F0KA 4QE5A 3PBMA 4L4LA 3BOFA 4RE4A 3P7YA 1WUFA 3MB9A 5BMWA 2OB3A 3IV8A 2J75A 3EMCA 3S83A 1W9PA 2CZVA 4K68A 3SGUA 3FOKA 3ZYZA 5CPNA 2Y6ZA 3PNZA 3N12A 5I7GA 4YTQA 4JTRA 4LAZA 1U22A 1PYMA 4EF9A 1F6PA 1W3JA 1V03A 2OMAA 3TK7A 2UY5A 3D3FA 4LV9A 4M7SA 2YCKX 3GR4A 1A4MA 3SY5A 1FFQA 2PWFA 4IJCA 1VJZA 3RRAA 5DCDA 2PBGA 3TCSA 3TNBA 1XIJA 3BLOA 1V6XA 2YZRA 4IIEA 3G2GA 3C0JA 3ZMRA 3O16A 4HA3A 2I56A 1F3XA 1SJCA 5M2FX 3F4NA 1GVSA 3R8HA 3PJUA 5G4EA 4C6QA 2RDUA 4JYFA 1O7AA 3PAJA 1KA9F 3WQFA 3NO1A 4AYSA 2GSJA 4O4VA 4MNKA 4P7OA 1L0PA 1B31A 2CITA 2A7NA 2J7DA 3LG3A 2ZICA 1GZJA 1HP4A 2DSUA 2EPHA 1ME8A 3LY0A 3ITTA 4GC3A 4TUFA 3HQ1A 4DJEA 4F8XA 2YB4A 1AMYA 4MWAB 5HK4A 1BKSA 3L4UA 2G3NA 2CW6A 5F4SA 3CPRA 2WZEA 4HNLA 1JQVA 3KCLA 3HGRA 3I6RA 1PBGA 2VUNA 1FXQA 3NPUA 3EDKA 2JIWA 4FF7A 1QPOA 3HB9A 1PX4A 2BY3A 3C2FA 1CX9A 3P3BA 1UP2A 1XISA 2DGAA 3TQKA 1JXKA 3T44A 1DWFM 3GH7A 4K1GA 5TD4A 1SUXA 3PUGA 3HN3A 5MKGA 5I07A 1V3IA 1DE6A 3LA4A 2Y5JA 1P4CA 2J77A 4GUHA 1VIZA 2DFAA 1PUDA 5IM51 1Q6EA 1MEWA 2TPSA 4JQ3A 1OYAA 5DY2A 4DPPA 2NQLA 1J2WA 2ADAA 4EOUA 1YPFA 4X0NA 4GNVA 4CQAA 2A5HA 3TV8A 3HV9A 2E7FA 2CLKA 3S1GA 4JEQA 5GJMA 2EKGA 2DZWA 4H9TA 5IHRA 2VQTA 2DV0A 3M0MA 5C9UA 3DYOA 4Y9NA 1Q63A 5IDZA 4AY1A 2VWSA 1S3TC 5C2XA 2O9RA 2VR2A 4LS2A 1PHWA 1XWYA 1QW9A 1FH9A 4HZ6A 3A9BA 4C90A 2QJNA 3FSTA 1OZMA 1HJSA 1J5TA 3R2GA 1Y0EA 2E68A 1SZNA 3LM7A 5I77A 3BGAA 3V0SA 3LCXA 1FDJA 1FHUA 1DJYA 1WXZA 1G94A 4QX4A 1J0HA 4MKVA 3NURA 1V3JA 3ELFA 2PDXA 1G67A 1GVIA 3E1F1 2PGEA 1HKWA 4GQBA 4PUDA 3W7IA 4FA3A 4UZUA 3GIPA 3W27A 3RR1A 3L12A 3SCNA 4KRUA 4LBRA 1NJJA 4Y9AA 5BWAA 4RV3A 1SSGA 2TMDA 2Z1KA 2CBIA 4F0LA 1J96A 2QCDA 4M1BA 1UR3M 3QYSA 2ZX9A 1NF7A 4B90A 5AHLA 5C71A 4QNEA 2CHRA 1B9ZA 4BQ2A 4O1DA 1EO7A 3TC3A 3K13A 5G4WA 4S39A 4DWSC 4WXYA 3WUEA 2FH6A 3VD9A 1GQNA 4CD8A 3LGEA 3CHFA 4UIOA 1UBSA 5HUPA 1P1MA 5CAKA 3AJXA 1WP6A 2DZAA 4NKCA 2RDWA 1TELA 2DZSA 3KLKA 1M68A 4R34A 2JE8A 4IMDA 1E4MM 5F2IA 2WPGA 1Q6RA 5A6LA 2JEPA 4UR7A 4UQAA 1FWDC 3G1FA 3T1GA 1VFUA 3ZZ1A 5DBTA 4XBKA 3S4TA 2QIWA 4F0SA 3H4GA 5LSMA 5I3GA 1R46A 2QDGA 4QLKA 2GK1B 5I6SA 2E09A 2C71A 2NX9A 1T99A 1AQHA 1ZL1A 3FFSA 4S3FA 1IT0A 1ZBVA 3MU7A 4CD5A 4O0QA 4ZXOA 3T78A 3RJXA 4DO5A 1TE1A 3W71A 2FJKA 2E77A 1CEOA 2ZIDA 4PUMA 3VCNA 4XUGA 1AQFA 4DJED 1YTKA 1A5LC 4HMCA 5M03A 4C6DA 3H2AA 2HNEA 4I8DA 2P3ZA 4E2DA 4NILA 3D6NA 4WGHA 4H19A 1TPB1 2P3EA 1NQKA 2AMXA 2DQXA 3IV3A 4WK9A 5AHEA 3R8GA 4MWAA 3RRXA 1BD0A 1UPMB 1BHGA 2DJLA 1PIGA 5HATA 2VX7A 4RJEA 3S9ZA 2ISSA 1X1ZA 3NOYA 2ZZ1A 4YNGA 3M6DA 4LV4A 3WFLA 3TWBA 4RNIA 3GH5A 3DHUA 2CBUA 2HBVA 1VBJA 3DFHA 3UPMA 2FZBA 4MB4A 5XINA 3ZWSA 2QIIA 3W1MA 1SQ7A 2H9AB 3W1PA 4AX6A 4QISA 4L7ZA 3PWGA 3BCDA 4JKKA 3A3HA 3SUVA 2RDXA 3GDTA 3OO2A 2PDLA 4IPNB 5BW6A 1MWOA 2H90A 2V67A 1EF3A 2CHNA 4X3ZA 3T40A 1CGUA 3BLDA 1E73M 2ALDA 3WG6A 4LVFA 4AXKA 2Q01A 4N42A 4ZOEA 3F7JA 1YADA 1OGSA 4GBDA 1TB3A 3P81A 1CXKA 1TV3A 2GJRA 2GSEA 3CV2A 5H8MA 4HB7A 3SBFA 1XDLA 2Q8LA 4AWUA 3QHMA 5AVNA 4AD1A 2A7RA 5G5IA 3U7BA 3TN6A 4WDWA 3CL6A 1QPNA 3H54A 5ABFB 2X41A 3GFZA 1R9XA 5J5RA 5CLTA 4H2HA 1A50A 1XBVA 1JPHA 1V7YA 4KQNA 2XSBA 8CGTA 4ZENA 3EKGA 3PBGA 4I5RA 1DXFA 3E2SA 3EWWA 3N4FA 1H63A 1O5RA 1VYSX 2X40A 1YBQB 1MFVA 3FDGA 3AYRA 3ZIZA 4MFEA 2F6KA 2DZPA 3GQYA 5C2GA 5A6BA 3R13A 1T41A 3NQ7A 1NOFA 1B3VA 1EGZA 4TMBA 4GX8A 5JU6A 2R1LA 1J0YA 2CESA 4UFHA 1W1YA 3CIWA 2G95A 1FWNA 3VIHA 1SMDA 3RX2A 3GAYA 4E4UA 3QZ6A 4I7WA 4DI8A 1Q7QA 4FP1A 4V15A 5JIPA 5T26A 3S5SA 3IJIA 3GC4A 3YPIA 4PTVA 1MQPA 3ES7A 3TW9A 1S5VA 3FN9A 1U1HA 2FTWA 3WBEA 2CETA 4NX0A 4C6OA 4GJ1A 2BHUA 4WGXA 4A8RA 1A5AA 2Z1VA 1H7XA 2DU2A 1NWRA 3PTKA 4O1BA 1HX0A 1PL9A 1EO5A 3VU2A 2BXYA 3HQNA 2IPGA 4HSNA 4RDVA 2VHLA 3VZXA 3B8SA 4V1YA 3TMQA 2F8QA 1QASA 3W7JA 4XAFA 3ITGA 1LOSA 4H8VA 4XV0A 1CLXA 1VEPA 3ENLA 3R11A 4K8EA 3W00A 3W72A 4PTDA 3N4AA 1QT1A 1ECQA 4CNPA 3CZLA 3NPVA 4GZ7A 4ICMA 2VKZG 4LC8A 3PUDA 1EPXA 4XZWA 2DVXA 4CCDA 3NCOA 1XC6A 3MC5A 2GK1A 1UR1A 1L6SA 4QQ3A 2D2HA 4RW3A 1KRBC 1EB3A 3NQVA 3GVWA 3FAXA 3LPOA 4XD4A 2A3EA 4R5EA 2VFDA 3ABOA 3T07A 2Y5EA 1GGOA 1OK6A 3CYVA 4FK9A 4GABA 4NX5A 3QVQA 4EXBA 1IZKA 2I5IA 1U5VA 4J2MA 3S5YA 1W91A 5JMUA 4OBTA 4HYVA 2XHYA 4HYRA 1RY8A 1EHAA 4PUWA 3V5OA 2FTYA 4IGNA 3TTEA 1QBBA 4FR6A 3ITVA 4X61A 4P8UA 3A3XA 4ZR8A 4AZCB 2AKZA 1Q6LA 4UFKA 2IQTA 3HJZA 3SUWA 4ZMGA 1CPUA 2WMHA 4C1NB 5KETA 4AFYA 4JTCA 2DH2A 1KBJA 3UJSA 3CZJA 4ZB0A 4L1GA 2DH3A 4XVEA 4LC6A 3UY8A 2GUBA 4RE0A 5D2TA 1KQZA 1PIFA 3OHMB 2O9OA 2DT2A 3CQ0A 4FXRA 3IS4A 1JAKA 3ARRA 2O55A 2QPSA 3EA3A 3BG5A 2NX1A 3L2IA 3M0LA 4GRSA 3K4DA 4JTFA 1BTCA 5C55A 3W7OA 5TNVA 5K9XA 1ITXA 5CC7A 1DJIA 3LCWA 1CNVA 1JCYA 2B7QA 4JFSA 1H0IA 3CAWA 2VJXA 3KDNA 3NL2A 5K4ZA 2XVNA 5BRBA 1DP0A 4Q4MA 3RG6A 4OT7A 3THAA 5HA7A 3B8WA 4QJ3B 1GOKA 3KRBA 2ATMA 4YVXA 3UG4A 1XSIA 1UWQA 4UXDA 1FWIC 1YDVA 4WOZA 1JNDA 1J0ZA 3VIOA 4I3GA 4Y90A 3NAVA 4AVFA 3TW7A 1D3HA 5CBJA 5DY3A 4DJEC 2BODX 4UZSA 2NT0A 4UTWC 4HCHA 4ZOBA 4H2CA 5ABFA 4GD0A 5A6BD 3TAKA 3M7WA 3RLHA 4V33A 3W7DA 4FX8A 3BW2A 4QROA 1EXPA 3CHVA 3WLLA 3G77A 4IMFA 4DXVA 3TJ4A 2VZTA 4A6GA 3A5FA 3QC3A 2ZXAA 3QYQA 3CPGA 1YBQA 3BMVA 4LX4A 1FWFC 3F03K 4PMUA 4RKAA 3H24A 4J1OA 3USBA 1KFCA 3TTOA 4NAFB 3J7HA 4JGDA 1X7FA 2C79A 4RE3A 4LF2A 2E1DA 1RBAA 4EVZA 2DZUA 3N2MA 1UZ4A 4JIEA 4KWUA 4MTVA 3H26A 4EPBC 3SW6A 1K8ZA 3JZUA 3VAVA 4EXAA 1L8NA 2Q3RA 2R8WA 5FJOA 5HMEA 1OVDA 4UTFA 4S38A 1BYDA 3KRUA 3BLPX 1MEIA 3STPA 1XLJA 1BSIA 3WDJA 5E9XA 3V18A 2J27A 5AY7A 3B8DA 3VUSA 5AC8A 5CPLA 5GQBA 4FOUA 3TQVA 3WELA 3W2UA 4OE7A 3U7VA 2WHLA 1RR2A 3RITA 4IL0A 5D37A 4REQB 3CAQA 2OO0A 4JQ2A 1OX6A 4IPPA 2GGEA 3FYPA 4J2PA 3HGOA 1PEZA 4C7DA 3U2CA 1T5AA 1ODUA 2XN0A 4PN2A 2AGTA 2X7WA 3IUHA 4FALA 2YBTA 4HNUA 3GY1A 2X2GA 2O4QA 2GJPA 1G7VA 2WJDA 3ARZA 3CT7A 2OR2A 4ZQMA 1XHGA 4N9DA 2VRKA 3UWVA 2OOFA 3S0CA 5CBBA 3B04A 2QCEA 1DE5A 4CD6A 3RO8A 2E25A 1XPYA 3VX0A 1LQAA 4N2YA 1WBJA 3TOYA 2RH9A 1AJZA 2UBPC 2G37A 4JTJA 4LF1A 4FSAA 4GUJA 3AZRA 3QZAA 1K9DA 1BVZA 5CSRA 2QCGA 3PBUA 5BXSA 3EWDA 3A4JA 1ZCOA 3ANUA 1EX5A 3P14A 1HN1A 3ORWA 2WCAA 3N11A 4GG9A 4L61A 3GKFA 3O8AA 3WIJA 1LOQA 3TOPA 1GHSA 1M1BA 3NEVA 1V3LA 2IMRA 4Q4PA 2TODA 3RX3A 1RCQA 4CNSA 4QITA 2XIQA 2QKFA 1HO1A 5JXQA 1PWMA 4AD4A 2P50A 1OIMA 1WA3A 4BQ4A 3VVGA 4DO7A 4C1NA 4DUXA 2OGYA 2OTDA 2PDGA 3DZ1A 4NHVA 3GZAA 1RA0A 5HJLA 1BF2A 4ICCX 3VKBA 4UFLA 4P5UA 5FIPA 1Y8BA 4NZCA 3TTQA 1IEQA 3BW4A 1BWKA 2BVTA 5ECUA 1V6UA 3RFAA 1XIIA 5KTLA 4A3HA 4PYSA 2WNWA 3W74A 2UV8G 1VJIA 3QGAC 1MUWA 2W63A 3K8MA 2FYMA 4GH1A 3K5XA 1L6YA 3PR2A 3A4AA 3W01A 3GU9A 2WK2A 3VZZA 2PGRA 4GOAA 3Q45A 2HK1A 4GFSA 1QW8A 1MDRA 4S3AA 1QU4A 1HJUA 3E6EA 1XUUA 3MCOA 3SEPA 3B8UA 3WBWA 4YWIA 2HEJA 3NQBA 3M64A 5U7SA 4CNOA 3SCOA 3N2TA 2XH2A 1TCMA 2QPXA 1CI1A 3VKDA 1DTUA 4B15A 1ZPTA 4A29A 2JKPA 2WWDA 5A2CA 4HPNA 3NZRA 4MM1A 3INPA 3F5LA 3SN1A 1UKTA 1I0BA 2I57A 2ACQA 5LGXA 4MWAC 3UA3A 1AVAA 1DWJM 3BAJA 3WLOA 4JTIA 3G18A 4JTAA 4YL2A 2ZTJA 1NFGA 1TA3B 3PAOA 2NVCA 5CSSA 4PULA 1ZJBA 5A69A 1MVYA 5I2UA 3KVKA 2VD9A 1ADDA 1ZHAA 3WNMA 3SSZA 1E0UA 1E1CB 3AFBA 1EC8A 2HQAA 3LN3A 2P76A 2WM0A 3A9IA 4W93A 2VVSA 4ENLA 2HTMA 1J0KA 4NAFA 3UGRA 1TJ0A 1JG9A 3MCNA 4IIHA 3WQ6A 4RXGA 1XI3A 2X09A 4AMCA 4Z2GA 2R1PA 3W70A 4ML9A 1ZFJA 4Y7EA 1SO3A 1E71M 1V02A 2PA6A 2JFEX 5GJNA 3SURA 4LAKA 4WXZA 2BB0A 4H41A 3UR5A 2A21A 4WUIA 4HN4A 3MUAA 4UFMA 4HNCA 1E9ZB 3G22A 2J24A 4PRRA 1E4IA 4DZ5A 3WJYA 2EG8A 4B4HA 3N6QA 2VEKA 5K3VA 1VFLA 3TN4A 3GWQA 3AXHA 1W8GA 3SR7A 4XZHA 3WQVA 2PAJA 1JF6A 4DBWA 3BZJA 3M0VA 2WBGA 2XJ7A 2UY2A 4YXGA 4M1RA 1XRVA 1J0JA 1MW0A 1KTCA 1DWHM 1WUEA 4TVDA 3BVJA 4WDUA 4RNHA 3VPLA 1LG2A 5AC4A 2V2CA 2GFTA 4HIBA 3NPWA 1REQB 2GOKA 3W1NA 1BQCA 3AAMA 4FNQA 5MF5A 1OX4A 4BHYA 1UQYA 4HBKA 5HR6A 5D03A 3CUFA 3NQEA 2VYOA 1QAPA 1UKQA 3G1DA 1U1UA 4K3ZA 4U10A 3AMDA 1Q5MA 2E9BA 1AW2A 2F7FA 1UZ1A 2VEIA 2GQ8A 4B5UA 2H8ZA 3N73A 2GPTA 1X1NA 2YL9A 2VGBA 3K8LA 4Q8PA 3VIMA 1BKHA 4RW5A 1SR9A 3WNPA 3OBEA 3GHUA 5CZKA 1V3HA 1M7OA 3BAIA 3EYPA 1AD4A 1KFJA 4R53A 3V1PA 2RJHA 3WQDA 3OHIA 4JCMA 4IX2A 5A8NA 1E6NA 4JQ4A 4GYPC 3LMZA 2V2DA 3C3UA 3UVIA 2AQVA 1WKFA 1TIMA 1HKJA 2CZDA 5G4HC 3CUIA 3EB3A 1UKSA 3IUIA 1G0CA 1KM4A 1C8QA 3QGVA 2OFJA 3M47A 1R30A 4RZ4A 4S2BA 3S6DA 1QPRA 3L0GA 3UWUA 4YTRA 3PS7A 4MOZA 1YQ2A 3FXYA 4ACZB 3BK0A 3Q4DA 3WD3A 3W1AA 3FJNA 1QI3A 3IAPA 1GW1A 3DFPA 4Q8UA 5ABEA 3TROA 4URIA 3ZLGA 4J27A 5E0CA 1IGWA 5I5RA 4RK8A 1GWJA 4CU7A 3BG3A 3JVAA 4JFVA 6PTDA 1RQEA 3GZ3A 2YXXA 5EMKA 4N6EA 2OCZA 5C9XA 3F2DA 2G3IA 2DUAA 1UROA 1UW9A 5FL1A 1KM6A 1EJUC 3NFUA 3IRSA 3SRDA 1B3XA 1NQ6A 3AROA 2VFEA 2Z28A 4QG9A 1E72M 5CH9A 3GR7A 2BNJA 3CB3A 4HN8A 3E0IA 4K7YA 2X8RA 2FLIA 3DC8A 2V5DA 3BZGA 3O6CA 3SZ8A 5FESA 2YA0A 4I9TA 4A2SA 5CSUA 3DBNA 1TRDA 3QPZA 3RCYA 1K7EA 3SRKA 4O1CA 1LBFA 2PDCA 1F3TA 2ACUA 4NP7A 1QVBA 4L6DA 3UY7A 4QDMA 2PDBA 4FXSA 2NUYA 4MY8A 1EXBA 2GGJA 2BXVA 1F4AA 5CSYA 1YKWA 1YPIA 2NZLA 1GJPA 1GW9A 2WMKA 2ZA2A 1YIXA 2OWXA 3LHVA 2Z24A 5IOBA 3SFKA 3BOLA 3MP4A 5D2XA 4ZTYA 3NGFA 3DFQA 2DUXA 3UPWA 4Z1AA 1MUCA 1SZGA 3UR7A 1B2YA 3KTCA 3MY9A 1BTMA 4D8AA 1JZ7A 1A5OC 4GZIA 3M4HA 1E70M 2PSNA 3L9CA 1Q4WA 3ZM8A 2BVYA 5AYIA 3SGGA 5EMJA 1KWKA 2QJMA 3UZJA 4BKNA 3T2OA 4WEVX 4B5TA 1OB0A 3WF2A 4G7EA 3AIQA 2D20A 3CTTA 3NO3A 4N4QA 4PZVA 1FHVA 4GYKA 3UR8A 3V3WA 4ZCWA 5AC7A 2XIMA 4F0HA 4J7RA 3PZMA 3PFRA 3UGVA 1LJYA 1EP3A 1V6TA 4MUPA 1E3ZA 2RFGA 1BRLB 3H53A 3W85A 1OX5A 3CAKA 3KP0A 1K3UA 4B5SA 5GJPA 1RP9A 5F1VA 4O52A 2INEA 3B4YA 3BJTA 1NDYA 4QIUA 2CZFA 3QLLA 2ZZ2A 1TWDA 4HQVA 2PWHA 2PF0A 4XTDA 1HJQA 2QJGA 3FCPA 1VFTA 1O5KA 1C29A 4KWOA 2C1GA 4JAWA 3MUCA 1Q13A 5C54A 1R85A 2I5QA 1M03A 3B40A 4OHQA 3XINA 5H1WA 4NJJA 2NV2A 3IJLA 2REQA 3T05A 3VGDA 1JAEA 5D32A 1Z8AA 3E49A 4MG4A 1VFHA 4JTKA 1GCYA 1KR0A 2VQUA 4HCDA 4OV9A 5C9RA 5CPQA 3LTPA 3PNUA 2X7VA 3SCTA 4F2BA 3RM4A 1W56A 2PTYA 1O94A 4W8AA 1FKWA 3WQ8A 2Y5SA 2GYIA 3W23A 1G7UA 1UD2A 2V9DA 1LQ0A 1YDNA 2XIIA 3OODA 5FJUA 1UZDA 4IFOA 4WJXA 3ZOAA 2YOCA 4U3AA 2F61A 3AISA 2IKGA 2YBVA 3S3GA 3M0YA 1CGXA 4EPKA 2GQ3A 3LCLA 8XIMA 1QFEA 2GGIA 5DF0A 3BURA 4ACZA 3G6LA 1C92A 3ZQ9A 3FIGA 1IE7C 4Q6JA 2WVTA 4HPXA 5I78A 1PV8A 2B31A 4H8NA 1IIGA 4LNYA 3TYZA 1ICSA 1P0DA 4P7NA 3A4XA 1U5JA 2PDWA 1FQ0A 2OSYA 3CQKA 1HZYA 4D6HA 4ZVJA 2KZHA 3N9KA 4Y2WA 3ZXWA 4K6AA 5IBXA 2VC9A 1QI5A 1NH6A 4PUUA 3IAQA 4KEUA 4CNTA 3PZUA 3B0YA 3W1LA 4QCFA 2VELA 1H2JA 4DZHA 1E5NA 3DFYA 3BCFA 2F84A 3WY1A 3WF3A 2CBVA 1YHTA 2JF7A 4LH8A 3RU8X 4F9DA 3AZTA 3QW4B 4FIRA 1VD6A 4IPJA 3IJ9A 2HPIA 4E2BA 2W9MA 5HPOA 2VC5A 2PC8A 2EHHA 1BPLB 1TTPA 4QXIA 4HNNA 5AZ1A 3M5ZA 2X0HA 4RPQA 3QV9A 2WC4A 3PZIA 4L5ZA 2CIPA 4W7WA 2QVNA 4R7OA 3M9YA 5AFDA 1IZCA 2NQHA 2FPVA 4ZQOA 4NQ1A 2XIJA 2E40A 5TIMA 4LALA 3W75A 1GVOA 1RAKA 2PD9A 1N82A 2OZ8A 5I3HA 2ISWA 1SYTA 4ORMA 2BHZA 3MV11 4US6A 3GX9A 3WQ5A 3W1XA 3K2GA 3P62A 1SW7A 3NDOA 3B3DA 4FS9A 4CVUA 4AD2A 1VBGA 1OG0A 3URQA 3FA5A 5DO8A 3NSNA 4QM1A 1EGVA 1JZ4A 3EPMA 5D09A 3OGSA 1LBMA 3GNNA 4EK7A 4H01A 1H7WA 3WENA 1UR0A 4AH7A 1WXJA 4WSJA 3M0HA 1ISVA 3ARVA 1KXHA 4NVTA 4J9JA 2ZA1A 2WC3A 3O06A 3B8IA 2HXTA 2ZUUA 3PVFA 3RCNA 4GHRA 4B2DD 1CLVA 2PWUA 3GXMA 1JFXA 5I23A 3VOJA 3WJZA 2DZVA 1XG3A 3W81A 1RP8A 3AMCA 3OGVA 3Q37A 4N02A 4BA0A 3LCHA 1I0DA 1YDOA 4MNJA 2QDDA 3FS2A 2VRQA 4DJDA 1CDGA 2PCEA 1VKFA 4YHGA 3AHYA 2B7PA 4HMDA 2ISFA 3TJXA 5LXXA 4QS6A 3O0KA 1X98A 2E9MA 4R9OA 3OLGA 1UKPA 4GA8A 4HOZA 1F3WA 2ZRWA 1B4EA 4RPPA 4YMZA 2D69A 2AAAA 1BRLA 3H55A 1KLZA 3MBFA 1V0KA 4IGMA 4HP5A 3HO8A 2ZDRA 5BXPA 3W7QA 1UD6A 3D3AA 5KITA 3QC0A 3DFSA 3EKLA 4Z1DA 5AYBA 4Q4KA 4U5IA 1ZBWA 4PRTA 4MLJA 1P6WA 4L1XA 4AVOA 4I6KA 3IARA 3XIMA 4XZIA 3ANYA 1CT5A 3O3RA 3CUGA 3GHSA 4JTQA 4HMEA 1J6PA 1WDSA 4H9XA 5LIKX 3ABXA 3QKEA 5BROA 3GRIA 4DM2A 1PS9A 1HG3A 1LLOA 2NWSA 4IISA 5KZ6A 3MDUA 4JL2A 3EXTA 3U8GA 2J47A 3PBYA 4QAIA 4O15A 4MJZA 3ICJA 3T7VA 2CLPA 2DP3A 1KXQA 3ZO9A 4PMDA 4UTHA 1IXOA 3W2JA 2FKPA 1BXCA 3KP1A 5KINA 1UC4A 2ZXBA 3QMTA 1ZP3A 3TC7A 4ZQPA 7ODCA 1EA9C 1MDLA 3G8EA 4JZ5A 2WZIA 3TLLA 1QWKA 4AC7C 4Q4RA 5BRPA 2JALA 2XIOA 4GIEA 2BASA 2YFNA 1RXOB 1BWLA 3HURA 3B0VC 3WQOA 4NSBA 1RUSA 5HPCA 1GOIA 1W3IA 1JJKA 3ABRA 4KF1A 1ZP4A 2QMKA 4ZFMA 3GM8A 3CWOX 5D9NA 4OUEA 3TQPA 2I14A 4GZEA 3NXLA 3V4BA 1VC4A 3IJ8A 2DJXA 4C7GA 2YCJA 4HOXA 3OB8A 4UR8A 3DG3A 3WX7A 3WLPA 3ITLA 4LPCA 3P0XA 4LRTA 3UZYA 1EH9A 1WDPA 1BF6A 2F6UA 4XAZA 1ZLPA 3KW3A 2Z2AA 4JX5A 4PMVA 4IIFA 4IXXA 3B9NA 3TW6A 2VVNA 3G1AA 2PP0A 5HUOA 3W25A 1TVNA 1X97A 3BANA 1B3ZA 3M0IA 2VX4A 4GUFA 4JTSA 4QHRA 1A5BA 1K8CA 1O1HA 3CZ8A 1TMLA 1UR9A 3STEA 4Z0JA 1YRRA 3S5ZA 2GDQA 1O95A 3HTWA 4S23A 2HE8A 1X7IA 1F7BA 3H23A 5FKYA 1PZ1A 4NIRA 4NZ3A 1A0EA 3URAA 2GOUA 3MJYA 4E8DA 4IIDA 4AC1X 4ADUA 3SIMA 4PSRA 3SM0A 3TDFA 4HT3A 2Y2WA 4E3VA 4ROQA 3VNJA 3OVGA 1XLDA 1R3RA 5T8GA 4CEXC 2C16A 3EOOA 3VI2A 1W2PA 2Z4GA 4E6MA 2J9XA 5CLWA 1XX1A 2XGIA 4AF0A 2J7GA 1JCLA 1H5VA 4KIEA 3NQ2A 4EKJA 4MUZA 4PL2A 5HJXA 5L9FA 1Y65A 2OZ3A 1IT7A 1IXQA 1W3TA 3RK8A 5C8BB 3CPUA 4XIAA 3GB6A 3PTQA 3TZNA 4GJJA 3TH6A 1LL7A 1XIMA 3DX5A 3UXAA 4HZ7A 4XIMA 1IYXA 1WZAA 1BLIA 3KXQA 1XQLA 1XLAA 4TX9A 3MJMA 1VAHA 1XGEA 3VGHA 3TJIA 4BR1A 3ZSTA 3SRFA 3VDCA 4E2OA 4TIMA 3UP8A 2PLJA 1W5NA 1FWBC 3HBLA 5FCZA 7A3HA 2XFYA 1VLIA 3GIQA 1AJ2A 3BW3A 3MKVA 1KFBA 5AHMA 1XBZA 2EKCA 4UNKA 2V3GA 3EB2A 4QJ5B 3E0VA 2G50A 4AEFA 2Q02A 2W6RA 1E51A 4GCAA 1GKQA 3MMWA 4MYXA 2WYSA 5CXPA 4DJFD 1W1PA 3WQ4A 3QSRA 4LT9A 4WQ6A 2PP3A 3AJ7A 1ITQA 3GSMA 1DIDA 1OCQA 1KR1A 1EJRC 5G2IA 1KFEA 1W1TA 2PCQA 3WH8A 2QDHA 3FVDA 4JFUA 3SN4A 4QJ1A 3BOXA 3LQLA 3W28A 2KAUC 2V63A 3QV6A 3OVQA 2C14A 5A8OA 4PUEA 1X39A 1KTBA 4JY8A 5D9PA 5LNVA 2YCIX 3WLKX 3MCMA 3DAQA 2YGYA 1E5JA 4K7VA 1JQXA 2X30A 3MVTA 2PODA 4I9MA 4N9CA 1WB0A 1I2QA 1MI3A 4WLCA 1DPMA 4HNTA 4L1WA 1QO2A 4XG1A 1LLZA 2GZXA 1BXBA 2CLHA 5TAOA 4MGGA 2WB5A 2NVDA 1UOKA 2PI6A 3SB0A 1UP3A 4JQ1A 2RGMA 2WOQA 1F8MA 1TPC1 3PPHA 4NUWA 4EWND 1M53A 4AISA 3AIRA 1OEPA 3C86A 1ZZMA 1ZAJA 1P7TB 4Z08A 3C8NA 1Q4NX 5TQLA 4C1LA 3WJXA 1RJRA 3WBAA 3KZPA 1NIUA 4GX9A 3WO8A 2GJXB 5C70A 2Z00A 4HPJA 1OABA 1XD0A 1HVQA 1SZRA 1I60A 3QEZA 4DRSA 3LRLA 3OYXA 3MP3A 1OGBA 3R5EA 4ORIA 4S3DA 5AHNA 5FEWA 4H6EA 1QW7A 3HPZA 1V6VA 2WCSA 2G8ZA 1P6CA 5D30A 1TJRA 2MUCA 3NWRA 2YXOA 3T8QA 3CU2A 3V16A 5M17A 3WMSA 3IK2A 2OLSA 4D2JA 1EWEA 1R87A 2EGZA 1XLHA 3EBVA 3PUEA 2NVAA 1KFKA 2UY4A 1DORA 1W9XA 3UR2A 1BAGA 4YTSA 1TPH1 4MJ2A 3I3BA 1XF0A 1HL8A 2GDVA 3VD4A 3WD2A 1EJ7L 1OBAA 4AD5A 2CKRA 1YNQA 4LUJA 4LYQA 4TX8A 3FA4A 4D1JA 1HL2A 1U1JA 3BG9A 3E0LA 4MB5A 1JCNA 5IBXC 2X0SA 4IZGA 3U4AA 1QCWA 2EAWA 4J28A 1CXFA 1LTDA 2FMNA 1QATA 3B9DA 4LSBA 4UMBA 4HHPA 3EAUA 3MTWA 3UA4A 2V82A 2PD5A 1M7JA 3UU0A 4TV6A 1PHQA 3AICA 3VGGA 3C3NA 1ZAIA 4C7FA 3SIZA 3MPGA 1E9YB 1E9LA 1X6NA 4WJ8A 3TC6A 3GU2A 3RDKA 3S2LA 2QCNA 4Y9MA 1JZ2A 5REQB 1LG1A 5CPTA 3V75A 3AYVA 1PX8A 4R33A 2DSZA 4JPGA 1PO9A 2ON3A 3FJLA 4MSSA 1K7FA 1M7XA 3EOLA 3Q65A 1A5UA 3T0CA 4PMXA 2ABAA 1OFBA 5JBFA 5HJYA 1Z44A 1CXEA 2AL2B 4AWSA 3EX6A 2RGLA 5L6UA 1Z7AA 4JQAA 1JCMP 4RZ5A 3BXWA 4NZ5A 2V38A 2MNRA 3LRKA 1GOWA 2PWDA 4WCJA 3BH4A 3IGHX 4MJ4A 4FNSA 5I3DA 4X63A 3KS5A 3MBDA 4ZSUA 4ZXLA 2V5CA 2WJZA 3GDBA 1GZ1A 1DWAM 3RJYA 2QCLA 1OCNA 3LSBA 2CU0A 2VDIA 3PF3A 2R94A 2DSWA 4H7CA 1RCXB 4H9MA 3TFCA 1Z48A 5C7VA 4QQUA 3GO2A 3G8RA 1PZ3A 3AHTA 2OZTA 4LU0A 2HWGA 4DYJA 1VP5A 1MQRA 4JTUA 3GW3A 2NV1A 2PUZA 3TZFA 3VYLA 2YZ5A 1DIEA 1H50A 4TTGA 4W9TA 1J10A 1DIKA 1KCKA 2V68A 3N6JA 5BWFA 4PB4A 1NU5A 2X1IA 3WLTA 4RNJA 4DBEA 3EXSA 1W9DM 3UFYA 1ELSA 2Y8VA 3TYDA 3WBXA 3TX9A 4N7QA 4M29A 4PMZA 2Z2UA 3N2XA 4Q8MA 1DVJA 2PP1A 3BQ5A 5F2LA 2QDEA 1NY1A 5EYWA 1WZMA 4JIQA 1US3A 4IQJA 2I9UA 2XVKA 1E6PA 3LYEA 2R1MA 1LLWA 5CZTA 4YS1A 3LLFA 4MPQA 4OV4A 2Q6ZA 1XIBA 1P7TA 1WV2A 4S2CA 1KC7A 1UWIA 2BY1A 4Q32A 4AB4A 3FV9A 4Y9PA 1W8SA 3KCJA 2VOTA 5AOUA 3W6YA 1MSSA 4RDWA 3MO4A 3DEQA 2O7SA 4BQ3A 1MW1A 3KVJA 4A3YA 3OEXA 3P93A 4B3ZA 5E6YA 5FJTA 3U48A 2PE4A 4W4QA 1RQBA 4DJFC 3N2BA 2Z29A 3CMGA 5J5DA 4AUBA 2YL6A 4C6MA 3MQTA 5FF7A 1JUBA 1EDQA 2DVUA 4Q8OA 4C5ZA 2X16A 1LYXA 1VQTA 2V5JA 3W1RA 3PJXA 4ZQNA 3FDKA 4ZSTA 2XVPA 2AGKA 1ONEA 1CYGA 3QRHA 1JCTA 1R2TA 5RUBA 4XVDA 3E02A 3QY8A 3GNOA 3JW7A 1DJQA 3EKZA 4GI9A 4W7VA 3AS1A 4HNOA 4UTIA 2SFPA 2WHKA 1D9EA 5AHFA 4UR9A 1F8IA 3WLNA 4GFIA 1FWGC 3TFXA 4WF7A 1LT7A 3PSVA 3W26A 1DYSA 2OLHA 3W24A 3DUGA 4JNYA 1XG4A 4FHAA 5A6SA 1JEZA 1GOXA 4OBRA 3WDRA 1W1IE 3WQGA 1LF1A 2XM2A 4XISA 3E96A 2J8GA 3UT0A 1QOQA 3SCUA 2OYLA 2JIEA 1FP8A 4QBXA 1OYBA 4D72A 4UNIA 1V7AA 3BARA 1JD9A 4ZOCA 2GJLA 4IUOA 4BEUA 3PZVA 2DT3A 4LWWA 1UJQA 1BYBA 1BEUA 3A22A 1ZBCA 3SECA 4NZ4A 3MUXA 1YXYA 4ONVA 5REQA 4GGHA 1W1ZA 1TVLA 4IP5A 1L9WA 5HMDA 4CQBA 2PWEA 3TSBA 5C5YA 3L4WA 1S38A 2BY2A 2VCBA 4N4PA 2GUYA 1VLWA 4PFMA 5DN1A 5CGQA 3PG9A 4C6KA 1S39A 2BOEX 4P7QA 1JUKA 1V8EA 4ECLA 1U2YA 1OCBA 5BOEA 3FEQA 3WDPP 2Q09A 4I90A 1S3HA 2AL2A 3P67A 2C0HA 3HQPA 1ICQA 2CLIA 5LKYA 4XKYA 2YSWA 3G0SA 3R43A 4MZYA 1HT6A 4KETA 3MT1A 3H4WA 4UTUA 1VIWA 3R79A 5BCAA 5T9CE 2B7OA 2QNEA 3BLIA 4IM4A 1TQJA 5ABGA 3TR2A 4XBSA 4GVHA 1BGAA 2CLEA 4DEFA 2QUVA 3MYOA 1L6WA 5BOFA 3AIEA 1ICPA 2J13A 8TIMA 4MHBA 3L2MA 3FGCA 3KRZA 1V77A 4GWEA 4JYDA 1GEQA 4IWWA 1C91A 3R8RA 3CYJA 4O1EA 4PBFA 3AXMA 2C3ZA 4LBUA 4JIIX 1EF2A 2G0WA 3NQGA 1XLGA 4NJGA 3S2CA 1JDCA 3WNOA 1TWWA 3W07A 4E8GA 1UR2A 3O63A 4WZHA 3UESA 3V5CA 2VP8A 4IIGA 4YWSA 4C5YA 5I00A 3UEQA 3EWXA 1QRQA 3O0FA 3DG6A 3MKKA 3THQA 3OQEA 3RYSA 3THCA 2WNQA 1O12A 3GU1A 5DMYA 3APTA 1CXLA 3HZ3A 1LZOA 2C19A 1KRAC 3G6MA 5LXEA 2J7BA 2XUCA 1HXJA 1F9CA 2C15A 1WAUA 4Q33A 1AZ2A 3QY6A 4OQVA 1OIFA 4NI3A 1TYGA 1EZWA 5BOOA 3RM8A 1R47A 5C2CA 4CCCA 1VENA 3A3WA 2D2GA 5C9WA 4KW2A 1G6CA 3DOPA 2W3ZA 3A13A 3UPBA 4NRSA 1TPWA 3OU8A 3THDA 3TTYA 2CWXA 4AZ6A 1E56A 3AXKA 4Y6GA 1XUZA 3EWZA 1WNOA 4FOKA 5I0DA 2OODA 1MRAA 3QPYA 5HWNA 1ME9A 4QLLA 3O9NA 4M7TA 3QY7A 2NSXA 3NVDA 4GZJA 3L5LA 3O07A 3MW7A 1SZFA 1P48A 1WYIA 3VNLA 3LM3A 1UB3A 4IP4A 3OZYA 3LRMA 4F2TA 5BMXA 3WZ0E 2NXHA 1ZY9A 2B4GA 3W6LA 3SQMA 7PTDA 3MUZ1 4LQ1A 2WQPA 2QCFA 3K4WA 4IOTA 2NUXA 4M6VA 1E3XA 2XN1A 5DCEA 2J7FA 2ZWYA 3W1UA 3VIKA 5EMLA 3LSCA 3CUHA 3DKLA 1Y5XA 1QI0A 4FF5A 2DSVA 3MDWA 1KCLA 2BGQA 2IKIA 1QNVA 1A5NC 3JR2A 3GXNA 4UQEA 1WKYA 4BZYA 3G1VA 3IGSA 2ZVIA 1UHVA 4U31A 4D6FA 5K9DA 3N29A 1YPXA 1I2RA 5D2VA 5B7YA 2VT0A 2Z6JA 3URBA 1FWWA 2OX4A 2G96A 4JX4A 4OUIA 2VFHA 1YEYA 4CUCA 2X0YA 3A47A 3LX9A 1XP3A 1ZSXA 5BXRA 2OWCA 2ZOXA 3LZ3A 3OG2A 4K1WA 3RX4A 1DJNA 2P88A 1S46A 3DIPA 3QR0A 1RJQA 3VKAA 1AH3A 1EIBA 1XGDA 3P74A 4UTKA 3B4UA 3EWBX 1XCFA 3WYZA 4ZB5A 2HK0A 4D6CA 1K9EA 3DGRA 1RJPA 3W82A 2CLFA 3N13A 3O1NA 5D9OA 2QUUA 3MS8A 2A3CA 2VFGA 2BP1A 4DYKA 3N15A 4G7FA 4Q22A 4A4AA 4EAYA 4GXMA 2E6DA 1VHCA 3RM9A 5A6TC 4HSOA 1H7PA 4CD4A 3OOQA 4YTTA 4RX0A 4RDZA 2X2YA 3DECA 1UWRA 3H2CA 1FX6A 2OT1A 1JYNA 5KMYA 3XISA 1A5CA 3KWXA 2YDQA 4BS0A 1A80A 3WBYA 2C1IA 3HIJA 4NJKA 4QP0A 5LNUA 2VR4A 3TYEA 1QWGA 3UQNA 1H61A 4K38A 3QQ1A 3LPPA 1JGMA 2XINA 1OSEA 3Q2DA 1FH7A 3FNDA 1HKVA 1T40A 2B7NA 3AQUA 1NWTA 3VOGA 1BYCA 1IV8A 4FZIA 3SSJA 4LJ3A 4KPLA 3CEUA 2CERA 3AHZA 2ZUVA 9XIAA 5GPRA 2NLIA 1PPIA 3N9SA 1ONXA 4MDPA 1EQCA 5GNXA 2XFWA 2IKJA 3ZR5A 3MZ2A 5CG0A 1PKLA 3B97A 4GVIA 4L4PA 2ZXQA 1OFRA 1BVWA 3SO7A 3QMSA 1J2BA 1EBGA 1JR1A 2YPIA 2GJNA 2ZA3A 3CV6A 2GLKA 2ABBA 2FZDA 3CZGA 5HNTA 3DI1A 4LFYA 4V1XA 3ID7A 4FX6M 4S1FA 4BI5A 4WOQA 4EP8C 4HD5A 4GK8A 4NG3A 4H6RA 5JIWA 1OYCA 3FX4A 4AY8A 3TQ0A 2J4GA 1XIFA 3STFA 5CGMA 1ZALA 1JZ5A 4CVWA 1UIOA 2I1OA 2O9TA 1HP5A 4C6CA 2HSAA 1LOLA 3UXDA 5CC5A 3STCA 2ATSA 2ZRXA 3KWSA 3AU6A 3VTRA 1HKIA 4FLQA 1TX2A 1JVNA 3R0DA 2WV8A 1DJZA 3LQGA 3OLDA 4LYKA 2FB3A 1QBAA 5G2HA 4LEQA 1G69A 4LY4A 4UTLA 1KQYA 5KSWA 3LBMA 1E9IA 1J6OA 1ODZA 2WHMA 1DJXA 1LROA 3VD5A 1J12A 1QDSA 5A8QA 4AX7A 1CBGA 3NPXA 3AUJA 4IGHA 3V1HA 4TO8A 5JUVA 3NTYA 4L65A 2WXDM 5LGZA 4W85A 3O2LA 1K6WA 1R0MA 1VFFA 5C0QA 3M0ZA 3UZZA 1JNEA 3JUGA 4INFA 1VPQA 1FHLA 1KBBA 3ZFHA 4KFPA 2D73A 5A8PA 1TZ7A 3CL8A 3T8LA 3ARPA 2DORA 1CGTA 3BCJA 4HJFA 3TVAA 3GW0A 1M7PA 1C3FA 3GHRA 4GQRA 3A12A 3ECQA 2VI0A 2VURA 1ISWA 1F61A 2INFA 3F5JA 1DV7A 4Q7NA 4GI8A 1QOPA 4M0XA 5CCZA 1YE6A 4OGZA 3RLVA 1OK4A 4N6FA 4CQCA 2TSYA 4BI7A 2PS2A 3BL3A 2WO5A 1E4LA 3KM8A 1NWUA 4U3CA 2XFRA 2C13A 3K4AA 2CPUA 1VPXA 4LB4A 3CAVA 3LOTA 5DCBA 3HPXA 3FVMA 3VM5A 4GI6A 3GG7A 4LYPA 2EEXA 4JBRA 2ZRUA 1GQKA 2YR1A 2FVLA 5CC3A 4U33A 1TKKA 5BU9A 3BLEA 1AW1A 3UXIA 1QTWA 5LIWX 3OLIA 2G3JA 1OFQA 3GKAA 2PDUA 4RZBA 1NSJA 1XH1A 3WUGA 1ZJAA 1J0IA 1HKMA 2Z1BA 3UWEA 3C0LA 3OBKA 5LA1A 4IGSA 1BSLA 1GQJA 1OF6A 4WVXA 3M5VA 2F9RA 5EMYA 1W6TA 3FY1A 4JX6A 4IHCA 2NV9A 3H7RA 5HR7A 1VGAA 2POTA 4PBEA 4G2DA 2Y8KA 1QK0A 3VDAA 3SJ3A 4UNLA 3GG8A 3VABA 4LS1A 1U83A 3R12A 3M43A 2YX0A 4WKAA 1SSDA 4X2PA 1B5TA 1GVEA 2CCRA 4CCZA 4O19A 3W7LA 2WMIB 4WKFA 5FI8A 4C6FA 4FI4A 4YYFA 3BGGA 3MSRA 3IJDA 1BGGA 2BG5A 2Q71A 3L4XA 3ZT5A 3N6HA 1MZHA 1JDDA 4G1NA 1UH4A 3EOUA 3C52A 4UQDA 2BTMA 4PBGA 5DX7A 1XRFA 2OYMA 2OT0A 3R58A 4M19A 2XH7A 4A35A 4IQDA 1M41A 5E70A 3CZKA 3MMDA 5HBFA 3CQHA 4XD5A 1NVMA 3TUUA 3T0BA 3CTLA 3KRSA 1AODA 5E0FA 5DBUA 1UUOA 1R8LA 2JK2A 3TYAA 1C7SA 4Z2JA 3CL7A 3ZT6A 5XIMA 2ALRA 4BF9A 4W88A 4Z2KA 2ZUWA 4IF2A 3W84A 2QR6A 4G8TA 1JPIA 3WK1A 1LT8A 4V2XA 2ZQ0A 4B3KA 2RKXA 2FHFA 1NFPA 1OM0A 3NUKA 3EDEA 3JZEA 1AZ1A 2Y62A 2RDTA 1K9FA 1QK2A 5F2GA 2W4XA 1GJWA 1X8CA 4HOWA 4ADSA 2VGIA 1CB2A 3O05A 1E6QM 1V0MA 2QCCA 3TYCA 3U6WA 1JULA 1TPEA 3RLUA 2YLLA 4MMWA 2PC4A 2YLAA 1KW1A 3I7QA 5HMSA 3KCOA 5DMMA 3URNA 3B03A 3O6DA 3PB2A 4XSLA 4DY1A 1ISYA 4HU8A 7REQA 3S5OA 4LCQA 2RJGA 1G01A 2VO5A 1BWVA 1MW2A 1VJSA 1GUVA 5H8UA 4IXHA 1KBKA 3GVRA 3O15A 2VOMA 4L9ZA 1K7XA 1WDQA 1C93A 3S1XA 1L2QA 4L4OA 4MFDA 1SPQA 3NZGA 1UR4A 4JKLA 3N34A 3VFCA 1FUYA 1T96A 2WANA 3GVGA 2WNNA 1XDJA 4GPNA 2PDIA 2GVLA 1QHPA