1QW8A

Crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
497
structure length
497
Chain Sequence
b'KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNAMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 171
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qw8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qw8A02
3D51A 3VIMA 5GNYA 2ZXDA 1W9XA 4GIAA 1E6NA 2NT1A 1R33A 4RE2A 4D1JA 2VVSA 2WVVB 3U7VA 2W4XA 3H53A 1BYDA 1QNRA 2DEPA 3VX0A 3L4YA 3N13A 1MWOA 2JIEA 4HMEA 4UZSA 4HZ8A 1E70M 1OWQA 1T0OA 1PX4A 4AD5A 3A21A 5D4YA 3PZMA 3NDZA 3LRMA 2GSJA 3OGVA 5M3WA 4CU8A 5CQ1A 1MYRA 4DM1A 3H55A 5AYIA 4CUCA 3VIOA 2F61A 1VAHA 1GUVA 1XD1A 2DH3A 2QMKA 1B3WA 3ARWA 1X6NA 2PWDA 3AIEA 1E5JA 2J7GA 5CPTA 4J7RA 4TVUA 2YIHA 3OLGA 2OSYA 4NSBA 2WMFA 3B9AA 3WH9A 1ZBWA 1HJXA 2V38A 3OG2A 4D6HA 1E6PA 1FHLA 7CGTA 4M80A 4FMVA 3L4ZA 1ZB5A 2FH6A 4FNQA 3DDFA 3OLEA 2ZUWA 3AHXA 1DWAM 3BXWA 1GOOA 5C70A 1V0MA 1CGTA 1EGZA 4M81A 1GZJA 3ZR6A 4PUDA 3CMGA 5A69A 1JI1A 3RJXA 1UKOA 1RP9A 1LG1A 1UD2A 4ZE5A 1DWIM 2VCBA 2A3EA 5A94A 3K8MA 2YJQA 3ZIZA 1W3HA 5A6KA 2A3AA 3GXIA 3GH5A 4M56A 2WLYA 3EJTA 1J0JA 4OKDA 3WUFA 1RD6A 1B3VA 1KXTA 1OGSA 1TCMA 2FE0A 1PX3A 3NSXA 3KLKA 2YL9A 4H04A 2JIWA 4ML4A 3T2QA 3AHZA 2CERA 1JNEA 3WD4A 2CBVA 3EDDA 1BQCA 3BUDA 2V3DA 1JYNA 1SMAA 5FOOA 3CZGA 4IPLA 1G94A 4HU8A 2VO5A 2PWGA 2ZUVA 1CXLA 1HP4A 4HA3A 1KWKA 4MB1A 1K9FA 5IXEA 3U5YA 5DO8A 4WIWA 5CZKA 3ARXA 1US2A 3FNDA 1GQLA 1M01A 2ZE0A 1FH7A 4LYQA 1MFUA 3CO4A 1WE5A 1GOKA 2ZUTA 3F5JA 4MNJA 4OZOA 1MXGA 1NOWA 1JF5A 2CHOA 2G3IA 3CZJA 3WDPP 3OIHA 3UR7A 4Z2HA 2Y2WA 4CGTA 4P8XA 1LWHA 4CN4A 4OOZA 1QNPA 3CMJA 1GOWA 3WQ5A 3BVXA 1OSEA 4WLCA 5CGMA 1UKTA 1OINA 2V3FA 1VEOA 1VB9A 2WHJA 1U30A 3N12A 3VD5A 3T09A 1ODUA 5GPRA 5TD4A 1OGGA 4GZIA 4GO8A 3CIVA 3CHFA 3MKKA 2OSWA 3EDFA 3K1DA 3IJ7A 3I3DA 3WF1A 1JZ5A 1J18A 1A3HA 4AD0A 1OCQA 3FN9A 4UTFA 1LQ0A 1BG4A 4MNMA 3AXIA 4ATWA 3WDRA 1HIZA 3ZJ7A 2X2JA 1LG2A 1J0IA 3AIVA 1W2PA 2J78A 1PAMA 1QI2A 2XVPA 2Y8VA 3AMCA 7TAAA 1X6LA 3RILA 5AC5A 2E3ZA 5M17A 2BS9A 1EDGA 4PTVA 4S3KA 3BCFA 3ARZA 1OM0A 4W85A 2ZXBA 3N04A 1HL8A 1TQSA 3WF3A 1R8LA 8A3HA 4XZBA 3RDKA 1UD8A 1RPKA 3PZOA 2XVNA 3WMBA 2GJRA 3BSGA 5E9AA 2IXUA 4D72A 4UQEA 1E4IA 4UFHA 2VCAA 3G6LA 1BSIA 5D9PA 1GQIA 2WW5A 2C7FA 3GBEA 3FAWA 2J7BA 4LPCA 3GDBA 1UG6A 2CKRA 1GQJA 3AMDA 1JFXA 2WHMA 1JZ4A 4JKMA 2CYGA 3THDA 3VD7A 3WY3A 2EABA 4YHEA 1C7SA 3AIWA 4IISA 4NXSA 4NZCA 3WKZA 3TTSA 4QLLA 4DWSA 3WD2A 3AOFA 2QPSA 2QV4A 3UERA 1V6XA 3F5LA 4ACYA 5BROA 2E9MA 2CESA 4M82A 2WKLA 4QP0A 3WEZA 4AZGA 2VURA 1C8QA 3OLDA 1UR0A 4D6CA 4CD6A 3BUIA 4WK9A 2WWDA 2WC3A 2WCSA 4PYSA 4LYPA 4FLSA 2WM0A 2J7CA 1JDCA 1KBBA 1J10A 1LF1A 3VOCA 1M04A 4JZ5A 3SUVA 4MB3A 1KXQA 5M5DA 2CETA 1HJVA 1VBRA 1QHOA 1LL4A 4LYRA 4GPNA 1UWIA 1MQPA 2JE8A 2J7EA 5HBFA 5E70A 3RCNA 4PTWA 4F9JA 2EO7A 1H0GA 4JHZA 2CEQA 3NIYA 4N0RA 5DT5A 1W1PA 4QAWA 1GNXA 2BHZA 2WBKA 4B16A 1UWUA 3ZO9A 3OZPA 5FIPA 4JFSA 2BHUA 1PBGA 3FW6A 5I24A 4GI8A 1PEZA 3I3BA 2W63A 1C90A 3VGGA 4MNKA 4MJ4A 1H5VA 2F7QA 3DX3A 1H11A 2CITA 2VL4A 3BCDA 3WY1A 3ALGA 2PBOA 4KWUA 4U5IA 1BYAA 5A2CA 4AMCA 4HA4A 4BQ2A 3MO4A 1EQCA 2JEPA 2X1IA 1UWQA 4H41A 5EB8A 4WKAA 5E6YA 3BUPA 4DO4A 2GK1A 3PN8A 2XN1A 2XVGA 4AZ6A 2DGAA 3N11A 2VX4A 3D50A 4GI6A 3KZSA 4JFUA 3L2LA 1CGUA 4W93A 1G0CA 1NP2A 3CHDA 2CCRA 5CLTA 4QLJA 1O6IA 3M07A 2XVKA 1I75A 3HG5A 1GVIA 1MQQA 4Z2IA 1XHGA 2J75A 1J0KA 4C7FA 2GUYA 2ZWYA 2G8ZA 4JAWA 5E1QA 2RGMA 3SEPA 1OBAA 4M8UA 5KZ6A 1WCGA 3LXBA 1PIFA 1ISVA 5ABHA 3CZLA 3TOPA 3AMKA 4BS0A 3U7BA 4AIUA 2DT2A 2EADA 3WEOA 2J8FA 4TVCA 1Q6EA 2VRQA 4LX4A 3AXHA 4W87A 4MNLA 2Y24A 3VIJA 1P6WA 2TAAA 3A4AA 2C8NA 1B31A 1I1WA 3WNKA 3WY4A 1E1FA 4OBRA 3D3AA 1JYVA 1E55A 2W5FA 1IZKA 1JDAA 1FH9A 2X09A 2Y4SA 1DTUA 2ESCA 3WENA 3THCA 3W53A 2OSXA 4CVUA 1C8YA 1F4HA 5JBFA 1B9ZA 1CXIA 4DWSB 3PTQA 1QHZA 1Q6CA 2XSAA 3VIFA 4EK7A 4D6FA 2YL6A 3WMCA 3A3HA 3G6MA 4U31A 3TTOA 2DDXA 1E6QM 3U5UA 3WQ4A 3CUGA 2D0FA 3SUUA 3VX1A 3GXFA 4AYGA 3QHNA 3LRKA 1CGWA 5E6ZA 5D9OA 1EOMA 4UQDA 3WBAA 3M46A 4QCFA 5DEZA 4AZBA 3GH7A 2WSKA 3GXNA 3CHEA 4TTGA 3UG5A 5IHRA 1UD3A 4R27A 2DIEA 3VIGA 4FLQA 3VSTA 1UKQA 3N18A 2PB1A 1WPCA 4AD2A 2ALWA 2OYLA 4FLOA 1GPFA 5HXMA 4UFJA 1DWHM 2VCCA 1HWWA 3BVVA 4M29A 5JIWA 3E1F1 3BUQA 3W6MA 4GINA 2VTFA 4CCCA 3M7SA 3UETA 1W3KA 5FL0A 3WF0A 3CHCA 5A6SA 3SCQA 3WD0A 1HTYA 2XGIA 2YLLA 3T2OA 1KWGA 1JZ6A 4CN6A 1NOFA 1EQPA 3GXPA 2VI0A 3I3EA 9CGTA 1EOKA 2C0HA 4WSKA 5AY7A 1G01A 1EHNA 3L4TA 2EAEA 4P7RA 3HG3A 4JCLA 1QBBA 2VZVA 3WDIA 2VQUA 1HXKA 1AQ0A 1E3XA 2BVYA 4F66A 4J3XA 1UA7A 3RMEA 2J7HA 4TXEA 2GK1B 1UD4A 3ZSSA 2EPKX 3BAXA 3VGBA 4Q22A 4TTUA 2AOSA 1ZBKA 1PZ2A 1QX1A 1ZL1A 5IFTA 1EXPA 3BAJA 1VJSA 2GJPA 4EKJA 1BG9A 3VMPA 1R34A 1NARA 1QI4A 5ABGA 1I1XA 1K9EA 2WVTA 2DQXA 2IUZA 4P8WA 1W1TA 4J28A 1QI3A 5CG0A 2V5DA 1XH2A 2CPUA 5D9MA 1DEDA 1B3XA 4D1IA 5CLWA 4X0NA 2RGLA 4Q7NA 1GJUA 4KRUA 2GDVA 4UFLA 3BAYA 2B31A 4WJXA 1WDQA 1AVAA 3ZT6A 3UESA 1E73M 2PF0A 1UZ1A 1CIUA 1V03A 4FNTA 1CWYA 4CKQA 1JD9A 1JF6A 2IXVA 2X05A 3WNLA 1HF6A 4MPKA 3OGSA 3IJ9A 2VJXA 3ZT7A 2FHFA 5I2UA 2XJ7A 3F4VA 4AZCB 2V3GA 2WC4A 1V02A 2WMJA 3DYOA 3MUAA 4PSRA 1LJYA 5CSYA 1ESWA 1GONA 1Q4NX 3RM9A 2PI6A 3OB8A 1L8NA 3WDHA 1UASA 3A5VA 3BLKA 4FK9A 4BQ4A 2F7PA 1QOXA 1W9VA 2GFTA 1JD7A 3ARRA 3AQUA 3PHAA 2WKGA 3S5YA 2BV9A 3K4DA 1JZ8A 4UZUA 1SMDA 1V3IA 2PWEA 1V3KA 7A3HA 3TA9A 5LYRA 1QNSA 3A22A 1JZ7A 1GOMA 3HMCA 3AIBA 4NRSA 1H09A 3EJQA 4HPHA 4KGLA 3B9EA 3T0BA 2ZICA 2XIBA 2CIPA 4W89A 1H0IA 4KMQA 4ATLA 2VX5A 1HNYA 4D6JA 1D3CA 4FNPA 3GNOA 1E72M 2F1BA 4CVWA 1QBAA 1W9UA 3WQWA 3ZM8A 3DYPA 1WNOA 3WQ8A 2YKKA 5C71A 1VFUA 5LA2A 2J74A 3W82A 4FNRA 3AXXA 4HOZA 1XSIA 3QHMA 3AI0A 2XM1A 1RP8A 2UY2A 2F7RA 3ARUA 4JL2A 4WF7A 5I23A 5CSUA 4MB5A 3PZUA 3AICA 3WDJA 1IT0A 5CPQA 3GBDA 3KE0A 2W62A 3PZVA 2G4FA 2DSWA 2XWEA 2VX7A 1B30A 2X0YA 1XD0A 5DT7A 1BAGA 3ARPA 4TUFA 4J3WA 4AC1X 3AJ7A 3CUHA 3VM7A 4HZ7A 1W9BM 3BSHA 2XGBA 1JXJA 2OW6A 2V5CA 4KGJA 3WH7A 4J3SA 4MJ2A 1CXFA 3CH9A 4PUEA 1A47A 1UYQA 3L4VA 4J3VA 6TAAA 3CZ8A 4E8DA 1CXHA 2UWFA 1KQZA 5CGTA 2XWDA 3LPGA 3VVGA 4AD1A 3VSVA 4UNIA 1UKPA 3POCA 1V3HA 3K46A 1CENA 1E0XA 2Q8XA 1KXVA 4HMDA 1XSKA 2O92A 1UQZA 2FHBA 3M6DA 2O9PA 4N42A 2J7FA 4CU6A 5JIPA 1BTCA 1V0NA 3VDAA 3VM5A 2XYLA 5GQBA 2YA1A 2BFGA 1KFWA 2DSUA 1R7AA 5BRPA 4ZE4A 4AIEA 4W7WA 1E0VA 5A1AA 2F18A 2V3EA 5M03A 2AMGA 4JCMA 1H41A 2YL5A 4HOWA 3N15A 5A6BD 2EPLX 2VR4A 2O9TA 1C91A 3WH5A 5AYBA 4BQ5A 3OLIA 3CZEA 4CD4A 4CN1A 1TG7A 2BNJA 4LGXA 5A8PA 4H8HA 3CC1A 1LL6A 1TFVA 1QPKA 5AC4A 1VBUA 2YDRA 1UZ4A 3IK2A 3GH4A 4TOQA 1CPUA 2JFEX 2VZSA 5FD0A 1SFSA 3KEHA 5I78A 3SCUA 3W81A 3EDEA 3N1AA 4CCEA 1CGYA 2WZIA 2E8YA 5F7UA 3QHOA 2J47A 3IAQA 3PBGA 2E8ZA 3EJRA 3O9NA 4HTYA 3T0AA 3ARSA 5BXPA 2QLYA 4QFUA 3VU2A 4CD7A 4NRRA 3MMWA 4PBGA 3ARTA 3EBVA 1VFOA 3PZNA 2WCGA 1H2JA 4RE3A 3DX0A 4H2CA 3SURA 3UCQA 4GXPA 4WSJA 2G3MA 4XUYA 3SCNA 3PZ9A 3FXYA 1BVNP 3AS0A 3MUZ1 1BF2A 3CGTA 2WXDM 3WL0A 1BYBA 3LMYA 3K8KA 2WMKA 1UD6A 2CBUA 2DT1A 3O2LA 2VZOA 5I79A 1RH9A 2YLAA 3ZJKA 3AHYA 1SYTA 1TA3A 2D24A 3N9KA 2UY5A 2WMHA 4PN2A 5LA1A 2D0HA 4P8VA 1G5AA 1TQVA 4LQ1A 3VIKA 3IANA 3RO8A 1KXHA 3EYPA 3WF4A 2YFNA 3CZNA 4UCFA 3DC0A 4FNSA 4HP5A 1V0LA 4PMNA 4ACZA 2FYVA 1E9LA 1CDGA 1L0PA 1FOBA 2O9OA 2QHAA 3WD1A 2GVYA 3BAKA 4UFMA 3SUSA 5ABFA 4OIFA 4DUXA 1XC6A 1NWUA 4P8UA 2E9LA 1WB0A 1KR0A 3A24A 1R85A 2DT0A 1BFNA 1TQTA 4PEEA 2BHYA 1BYCA 5I6SA 2D0GA 3AS1A 4AWEA 1QW8A 3GTNA 3ZR5A 1OB0A 8CGTA 2XG9A 2DSZA 1MW0A 3DHUA 3SUTA 4PMXA 3WFZA 4F9DA 4Z2LA 2ZXQA 4BCEA 4MDPA 1OT1A 5HPOA 3QOKA 5EBAA 1TZ7A 2E4TA 4CU7A 4XV0A 4AY1A 2ZXAA 2YBUA 2ZX6A 5DMYA 1WZAA 4AMXA 4AMWA 2AAAA 1G9HA 4W88A 1E5NA 3VNYA 4QDMA 1HJQA 2A3BA 4BA0A 1O7DC 2WNWA 5A8OA 4H8VA 2VNCA 1QW9A 4R5EA 3KL5A 1MQRA 2J77A 5JBDA 3AROA 4LXFA 2X0HA 3HG4A 1FH8A 1HVQA 5I3DA 2JF7A 2QMJA 3WL1A 3VGEA 3MUIA 3SCPA 4PMUA 3B8SA 3TTYA 2J79A 2YDQA 1JZ2A 1CLXA 4OOUA 4OBSA 1UWSA 1VF8A 4B9YA 4C7DA 2XN2A 4FLRA 3WH6A 5A6MA 2F1AA 1M53A 3IGUA 1R47A 1E40A 2JF6A 2DSVA 1E0WA 4A3HA 2PBGA 4V2XA 4AEEA 4PTMA 1XCWA 3WQ6A 4HPGA 1AQHA 5A8QA 2GJXA 1M03A 1Q6FA 1ZJAA 3DYMA 4HU0A 1WP6A 1IZJA 5DFAA 1J11A 3D4ZA 1K9DA 4AZCA 3SIMA 2UY3A 2NW0A 1E4LA 3GYCA 1BGGA 3WELA 3T08A 1IV8A 2CKSA 5E0CA 5JUVA 1EHAA 2YL8A 1UQYA 1JIBA 1LL7A 1TE1A 1XYFA 3AMLA 3VGHA 1UR8A 2XVLA 4NI3A 1VFMA 1OIFA 4DUVA 1R75A 2BVTA 1OD0A 1JL8A 2WYSA 2XTKA 1GOQA 4P7NA 3MS8A 3UR8A 3TV8A 3LXCA 1NWSA 3HN3A 5D8WA 3K4AA 3AZRA 4PMVA 3FHQA 4QLKA 3VDBA 5KEZA 2EJ1A 3S2CA 4QCEA 3WH8A 1TA3B 4EE9A 2YFOA 3QOMA 1ZS2A 4W7UA 3LX9A 2OYKA 2VZTA 4A3YA 3MSDA 3MV01 3AZTA 1R46A 2J25A 4HOXA 1J0HA 1EA9C 1B1YA 4JKLA 4WKFA 1JDDA 1TUXA 1CXEA 4UQCA 4UQAA 4JL1A 1GJWA 3NJ3A 5EFDA 4ACZB 3HG2A 1ODZA 3WD3A 3AS3A 2CBIA 5ABFB 2Z1SA 1J0ZA 2VVNA 1QWUA 3BVUA 3PZTA 2CHNA 2WHKA 1HT6A 3BC9A 4KRTA 4X0VA 3ZOAA 5GNXA 4TX8A 1W9DM 3GNRA 4B15A 2DPEA 5GNZA 1WZLA 1C7TA 6A3HA 5E0FA 5IDIA 1UR2A 5CXPA 3POHA 5CPSA 2YBTA 1OIMA 4X9YA 4NZFA 4IPNB 2D23A 3ZSTA 4W8BA 4U3CA 4P7QA 2EPNA 3WN6A 1MXDA 4MAVA 4PCTA 5A2BA 2A3HA 1CZ1A 3NSNA 1KGWA 2PC8A 3T2PA 3LXAA 3B9DA 1Z32X 5A95A 5A3HA 3II1A 4W5UA 5CJ5A 2Z1KA 4AZHA 2WZEA 4EAMA 2J4GA 1XYZA 3WUEA 2WWCA 4Z2KA 2DSKA 1GVYA 4D6EA 3KWXA 1GHSA 1BLIA 1U2YA 3UEQA 1YQ2A 4UQ9A 2VUYA 4JKKA 4DM2A 5IFPA 2Y8KA 1QNOA 2WLZA 2DT3A 1MW3A 3W24A 3GXMA 3W4RA 1CLVA 2ZOXA 1DP0A 4MTVA 4Z2JA 3DDGA 1BPLB 1CXKA 3F5KA 3EMCA 5BXSA 1EH9A 1WAWA 3VO0A 4JHOA 1GOIA 2GJXB 1B3YA 2XFYA 3HU7A 1FP9A 1W2VA 4AIOA 4NF7A 2D3LA 3WQVA 1V3JA 3D52A 1HL9A 3HJEA 1BGAA 2VOTA 2D3NA 3ALFA 1WZMA 5A8MA 3VINA 1AMYA 1PS3A 3T0DA 1E4MM 4DO6A 1WKYA 4A4AA 2G3JA 4YPJA 1V6YA 3AIUA 1NP0A 1V6UA 1ISXA 1UR1A 3FAXA 3CLWA 3W37A 4JIEA 3BAIA 1UH2A 1R86A 4GO9A 1B90A 4UOJA 3VIHA 1V0KA 4D6IA 1ISWA 1UA3A 3BGAA 1MVYA 3DX4A 2WBGA 2EACA 3AFBA 3BMVA 3CUFA 2F8QA 2WANA 1V6WA 3W38A 3SCTA 2X2HA 4UR9A 1E1EA 2EEXA 5HDRA 2VX6A 1MW2A 2XFRA 5I5RA 1DWJM 2FDMA 2BY0A 2XM2A 3VD3A 2X8RA 2HISA 3K8LA 1QI5A 5HNNA 2ZIDA 1JAKA 1HKMA 1CGVA 1UH3A 1TVPA 1Q6DA 2YOCA 3UG3A 1R7OA 1UUQA 3N17A 4XB3A 4K68A 4AZ5A 4ATDA 4C7GA 3NCOA 2EPMX 1J12A 3SCRA 3S6TA 5BRQA 1UR9A 2QPUA 4DWSD 2HVMA 3QR3A 1U33A 3D5HA 1LLOA 1GQKA 5FKYA 3NYDA 1UWTA 3HZ3A 4V27A 1XH0A 3VIPA 1XCXA 1O7AA 1GORA 3ARQA 5HPCA 2VQTA 2G41A 2D2OA 3FY1A 3PTKA 3VDHA 4DWSC 4F8XA 4L4PA 3L4WA 2XUCA 1J0YA 3RPMA 3H54A 3GM8A 2WVSA 2W61A 3CUIA 4UOZA 2WVUA 1C8XA 2OWCA 4PMQA 3CZKA 4DUWA 1S46A 3LPPA 3CUJA 3J7HA 3BUBA 3DHPA 4HA1A 1W3JA 4U5KA 3WEMA 4PMRA 3BLPX 2BXZA 3VILA 1GW1A 2VRKA 2WAGA 3TTQA 5ECUA 4CCDA 4V28A 4GQQA 3CBWA 3A4WA 1XSJA 5A6LA 1NOUA 2WSPA 4GZJA 1KCLA 3CZSA 3MUY1 5BXRA 2WMGA 1ISYA 5A2AA 1EO7A 1E15A 3VD9A 1C3FA 1ECEA 1BHGA 2WMIA 4IUGA 4ZEPA 3LPOA 4B9ZA 4W8LA 1W32A 1E43A 3LPFA 3TP4A 4U2YA 1KGXA 1AQMA 1KTCA 1D7FA 1XH1A 3GZAA 1EDQA 3MMUA 4UFIA 4URIA 4GKLA 1JI2A 1HP5A 3AHVA 2WCAA 3BH4A 6CGTA 2VMFA 2E9BA 4F79A 3L4UA 1GHRA 4MDOA 2F7OA 2D73A 3GXTA 1H3GA 3SCSA 4GZEA 5BCAA 3VKKA 3PZGA 4AEFA 2DH2A 1E4NA 3WDQA 3CPUA 4RL3A 3MV11 1W9PA 2NT0A 3MANA 4UOQA 4W7VA 3IJ8A 4NX0A 2BY2A 3A6OA 2O9RA 5IHSA 1B0IA 4H7VA 4J3TA 1JG9A 3JUGA 3SCOA 2G3NA 2IGTA 2W92A 3KLLA 3W28A 2CBJA 3IAPA 4AD3A 2ZX8A 1R87A 1TVNA 1CGXA 1E6ZA 3DECA 3VTRA 3ZT5A 1UD5A 3BVTA 3WNNA 4OGZA 4W5ZA 2W91A 2XN0A 2ZUSA 2OW7A 3OA5A 2XPKA 4NZJA 2WHLA 4M1RA 4XZWA 1UOKA 2BVDA 3A4XA 1UWRA 1ZBCA 2E0PA 3AYSA 1Q6GA 4J27A 4TVDA 5BXTA 1V6VA 1YHTA 5BYWA 1J9YA 2BXYA 3ARYA 3BMWA 3RJYA 4M24A 1UHVA 1D2KA 1FP8A 1HKIA 3W0KA 4HMCA 5D9NA 2WPGA 1OT2A 2ZX7A 2BY1A 5A8NA 4ZFMA 3D4YA 5I77A 1JYXA 4B3KA 2X2YA 1JGIA 3VGDA 1ISZA 4PSPA 1UR4A 1SZNA 4GI9A 1QWNA 3W27A 5DF0A 2EXOA 1DHKA 3AZSA 2PWFA 4L4OA 1JAEA 1KTBA 2ZWZA 3L4XA 4U33A 4FNUA 1JNDA 5LA0A 4E2OA 3ZMRA 3DX2A 4CD5A 4EANA 4PTXA 2OYMA 3ARVA 1HXJA 1CBGA 3VUPA 1ITXA 1KCKA 1PPIA 2ZUMA 3AYRA 1DWGM 1V3MA 3WFLA 3KL3A 2E40A 1C93A 2GDUA 3TONA 3OZOA 1NWTA 4D6GA 1J01A 1OGBA 3W26A 1FA2A 1HJUA 1PX8A 3WUGA 3NSMA 2W67A 2WMIB 1VRXA 2D20A 4PMYA 3EDJA 1HJSA 3OGRA 3EDKA 3MI6A 2UY4A 1NH6A 2F2HA 3VPLA 1UH4A 1EDTA 1ZU8A 5HOSA 1C92A 1H49A 4GQRA 4MB4A 5FCZA 3PTMA 4IM4A 1VFFA 4JFWA 3VDCA 3VNZA 1E6SM 4UFKA 4MAZA 1PIGA 3GNPA 2WZHA 4AXNA 3AIRA 1BVZA 2VC9A 3PZQA 2DIJA 4W84A 3PZIA 4OJYA 3W29A 1MW1A 1TQUA 2VRJA 1HX0A 1KQYA 1E3ZA 2ZUUA 3APGA 4NXKA 3W6LA 5D8ZA 3MSGA 2CNCA 1TR1A 3EMZA 3SCWA 5A6BA 2A3CA 4AISA 4DO5A 4CD8A 4D71A 4JFVA 1HKKA 4YHGA 1G1YA 3BAWA 3QGVA 4WKHA 4Y7EA 3NUKA 2MANA 1VJZA 3WNOA 1TMQA 4W8AA 2YA2A 1WO2A 1WZKA 1JFHA 2WK2A 3WNPA 2J7DA 4ZENA 4AYSA 1KB3A 1KGUA 2JALA 1FFRA 1K6AA 2JEQA 1QI0A 3AIQA 2X2IA 3CV5A 1E6RA 2WVVA 1NWRA 4E4PA 3SUWA 1WDSA 1EIBA 1QVBA 3WNMA 1KBKA 2NSXA 2FGLA 1V02E 3WSUA 2FHCA 2FH8A 2J62A 3EJUA 1NM9A 1CYGA 4U2ZA 1PZ3A 4PRWA 4MADA 1EO5A 4E8CA 2XIIA 2BY3A 3BVWA 2YDSA 4OUEA 1HJWA 3EJSA 4W86A 3CTTA 4H8UA 2QF8A 4AD4A 2XFFA 4UQBA 4KH2A 1VEMA 1VENA 3WUBA 1N82A 3WMSA 1ZJBA 3LRLA 1VIWA 1WDRA 1HN1A 1JXKA 2WC7A 2J8GA 1GCYA 3U57A 3A47A 3GXDA 2YA0A 3OBAA 4P7LA 1ZBVA 1W3LA 4BZYA 1B3ZA 1HKJA 3AS2A 1V08A 3RIKA 1LWJA 4ZXOA 3MU7A 1B2YA 3NDYA 1W1VA 3BLBA 1QHPA 2D22A 5I0DA 2EQDA 4YN5A 1WDPA 1TQWA 3VMOA 2ZUNA 3DX1A 2D1ZA 1QNQA 4FF5A 4HZ6A 3ZJ6A 5A6AA 1H1NA 1PJ9A 1V3LA 2XHYA 4Z2GA 4PMDA 2XSBA 4P7OA 4ZXLA 4AZ7A 2WB5A 1K9TA 4J3UA 3KL0A 2PWHA 5C8BB 3AHTA 4AZIA 5JBEA 1Y7VA 3WY2A 1E6XM 3ZQ9A 2VT0A 2VR5A 4B3LA 3FHAA 5FL1A 1FHDA 2ZX9A 1M7XA 1JZ3A 1CECA 1OD8A 3VSUA 3WBEA 1CNVA 3A23A 4PMOA 3SCVA 5EMYA 1CTNA 4PCSA 3RM4A 3AISA 3VD4A 2VZUA 1UKSA 3VIIA 4XX6A 3RM8A 3AMGA 1XRVA 1E56A 1W91A 3EJPA 1KR1A 3UG4A 4JFTA 1ITCA 3WF2A 5BWFA 3L2MA 5ABEA 4TX6A 5EFFA 3ZJ8A 2OWXA 1US3A 5E09A 2OLHA 4D6DA 3S5ZA 1JYWA 2FGZA 3WIJA 1XV8A 5A6JA 4BF7A 1FFQA 1E71M 1H4PA 3O6AA 2W66A 4U3AA 3ECQA 3MMDA 3EMQA 2OWWA 1SR0A 2CXGA 1VEPA 2EPOA 4AW7A 4PMZA 1DWFM 4BQ3A 2ZX5A 1X1NA 4RE4A 1CEOA 3VGFA 1F4AA 2Y5EA 3VMNA 3W25A 2EBNA 1HVXA 1W1YA 1MFVA 1XGZA 4S3JA 1NQ6A
chains in the Genus database with same CATH superfamily
4NC1E 2VITA 2GJ6E 3V9CA 3HMWL 2OTUA 2W4XA 4BK4A 1DJSA 5AW9B 1NU5A 2YQ2A 1R4XA 4FX5A 5I6NA 1PLAA 4NNAA 2F61A 5ESQA 5F7LB 3BV7A 4E42A 2HV5A 3PXLA 4RPQA 1T2QH 4TVUA 1BOGA 3TFBA 4OCSH 4XBGB 5IW1A 1A1NB 3BESR 3P80A 5T3XL 3WKYA 2WKOF 4M43H 4CDGC 1W3TA 1XGPB 3FO0H 1FO0H 3TN0A 2QYGA 1DE4B 1IU1A 3KVMA 2ERJB 3F6JA 2VCBA 3FVDA 4K9JA 1YECL 3MXVL 4PBXA 3AREA 1RZ7L 3D25A 5A3ID 2A3AA 3MQIA 2O7QA 1TV2A 3NSXA 4L37A 4M4PA 1LP9B 2RALA 1AP2A 1F6KA 4GE8A 1OTUD 3T6ZA 3I74A 1REQA 3HE6B 4XWUA 3NCJH 2QDHA 3MUHL 4XAWH 1W5QA 2Z1VA 5E6RB 2WBXA 1S7WB 2NXYD 3CVBA 4QO1A 5FOOA 2WQUA 4S11A 1NTHA 5IMLB 3QPKA 1HP4A 1F4WH 4Z1BA 1K9FA 3UMNA 3GNNA 1M01A 2DFAA 3MR9B 3UAAA 3CO4A 2QQLH 2IMNA 4JIQA 3FOMB 1NOWA 2G3IA 4Z2HA 3OHIA 4X6DF 1TWSA 3VAEA 2LT9A 4ELKB 3VSQA 3LKPB 2NMSA 2BVQB 1A9BA 3IVKB 7PAZA 3QEGH 3QXDB 3HZYB 5HJ3B 1ZSDB 1TRDA 5HWNA 3CFJA 3RHGA 1NEUA 4HG4J 3GGWB 1IL1A 2KZHA 2H9AB 3EB3A 3O0FA 4KKBD 4PJ9B 5CJ8A 2ZRZA 8FABA 15C8L 3RL1B 1EANA 5LIKX 5C3LD 1WISA 2NNFA 4M62H 4FQIL 2EEAA 2XY2A 1HL8A 3W7CA 2GTZB 2PRHA 3SSGA 3PZOA 1SDDB 3T0EE 2GJRA 4QY8B 1WIPA 5F4SA 2I60L 3CN1A 2XN9E 3FQTA 4YHZH 3Q0HA 4CNUA 1CGSL 1IO4C 4IEFA 3KW7A 3USZA 4NUJB 1O9VA 2B0MA 3QSKB 4OTKA 1WC7B 1E9QA 3KPPA 4U6XB 3G5XA 4KPHL 4M1BA 1IWAA 1U58A 3KCOA 3MLRH 3UAFA 5F21B 4D6CA 1TZAA 3U7YH 4XHJC 4FQ2H 4PYSA 1TO4A 1BREA 4PB0L 4H8WC 1YMME 1GRWA 1P5BA 2PDXA 4K38A 1P2CB 5M5DA 3EKCA 2OGJA 3UXKA 2X6BA 4GX9A 4ZQNA 1EFXB 4PTWA 2X89D 1HQRA 2VDMB 4N0RA 4M8QA 1CFQA 3KHJA 5D7LB 1Y18B 1JNNH 3STBA 3PAZA 5BUPA 1AFVH 4AX3A 4AIZB 4AYEC 1BYOA 3T4YB 1IM9B 3N6JA 3WY1A 5D7SL 3SDOA 4OFQA 1A7PL 2DZEA 4GGBA 1VGKB 5DJCB 1YPFA 2A3TA 1D9EA 4A2RA 4CMHB 3QDHA 2XVGA 3EBIA 5T9CE 2XPGA 3SDAA 3C6LB 4QSFA 2DQFA 1HO4A 1MCJA 5T5NG 4KXAA 5ELIA 1CDJA 2VM4A 4H1LH 5TK4A 4MQXC 5IVXA 1MCKA 3PABB 1BXNA 1KFAH 4IS6B 1PIFA 4PBDA 1O95A 1UB6B 1UJ3B 4KUCD 1Q6EA 5IM51 5B39A 1FPTL 2LAAA 1A5FH 3CFDB 5FO9B 3CJJA 1DTUA 3M7FB 2AGTA 3I9AA 4HJWA 2PR9A 3QJHB 4XX1E 3VU1A 1T80A 3VXRE 4X4MA 3PTQA 3CUXA 3NN8B 5HHNA 1E9PA 2XZQH 5EIQA 4QKTA 1PYWB 3BP7A 2ADGA 5IOBA 2KLRA 3K80A 1A0QH 1Q9WA 5CJNA 3NBNA 3M46A 2YEQA 2F5AL 4TQ8A 5CZTA 2IDSA 2Z64C 2R4RL 4YQXL 3GDTA 2OEKA 5E4IA 1UKQA 2PB1A 1WPCA 1I7RB 3QRFM 4QHLA 1SGKA 3MNVB 4FLOA 5EU5B 1A5NC 1X8CA 2CLFA 3BKYL 3QZWB 4GINA 4P4RB 4GRMB 4DGIL 2YLLA 3T2OA 1YZZA 4UNUA 4K15A 2XWTB 3JVAA 5ANMB 5EU7C 4ZPTB 4OQTH 1G01A 3L4TA 3VKBA 1AXSB 1K3IA 5HHXL 1MLCA 4F66A 3CWGA 3HNVL 1VCGA 1A5OC 2G96A 1FRGH 1GHFH 4JPKL 2EDOA 3Q58A 2ORBL 2FIKA 4OE7A 5FYJD 1U91B 2J1XA 5EOCJ 2YD8A 1NARA 1KBIA 1EB3A 2FZDA 3HQOA 2F54A 2DQXA 4YVXA 5JO5A 1DO5A 43CAA 2XTJE 4X5XB 1KGCE 4US5A 4B6ZA 1A66A 4LEOB 5I66A 4PG2C 3TYCA 1I7UB 5DEGA 3IS1X 1XG3A 3ILPB 3ZE1F 4K8EA 3DAQA 1PKNA 2XIOA 1BM7A 3QNFA 1PKQA 1Q4NX 3OB8A 1F1AA 5E99L 1HHIA 5DJ2A 3MREB 1Y8BA 1VGAA 1CE6A 4GBXB 4KDVA 3PHAA 3OAUL 1LRTA 3NEXA 1Q0YL 4BFEA 2UYLB 1ZLUK 1AJ2A 5KWYC 5A2JH 3HS0C 3V0AC 3QY7A 4C4KO 1UFGA 1C9WA 2KPWA 4HPHA 2VDQL 5GGSB 1R3HB 3RWDA 4YIQA 4UNKA 3O4LE 4NT6A 3GRWL 5BMXA 5I30L 4WFHE 1OARL 5C0RL 2ZXCA 3FQRB 1R24A 1F6LL 2FZ8A 2DYSB 4MGGA 4OI8A 1TTPA 2EICA 4PJIF 1YQVH 3GJFA 1UOLA 4CQDA 5EORL 3UZ5A 2UY2A 1IKNC 5BWAA 4NJHA 1MQ8A 2H6RA 1ORSA 1QRND 3BLIA 1RA0A 2DZXA 6TIMA 1XDJA 1OVZA 5K9OB 1MH5A 2OPJA 4HZ7A 3QYCA 4L1DA 1ZRUA 1NCDL 5JQIB 1SXCA 3ZTDC 2BIOA 4Y4FA 5EZLA 3VSVA 5D1QE 4PYHA 1KIRA 2AGJH 4WNQB 4O8AA 3TYEA 3ZUNC 3L16A 1UQZA 1BD2B 2DEWX 1NDTA 1O9WA 4KJWC 1DUZA 4HZLB 4ZX3A 2VXTH 4TUKL 4RW5A 4FG6D 3QUMB 1THAA 4I9JA 1R7AA 4PRIE 5AVQB 1X98A 4APQA 5C86A 3QUXA 2PXYC 4I13B 1VFHA 2VR4A 3ITXA 4WFFE 3CZEA 4CD4A 3FU9A 4IHOB 1II4E 4WDXA 3TN5A 3FTGA 4HH9A 3R6IA 4K23L 5EN2A 5AC4A 3KLHD 2YDRA 4MJIB 1PKOA 2HVKB 4JICA 3FB5B 4NPYB 5IKCA 3S5LA 1CGYA 3KPRD 3IAQA 4HTYA 1P7HL 1DLHA 2QJJA 4QUOA 3QC6X 4HUUB 1NWPA 5IMKB 2ZQ0A 4WR3A 2E6YA 1K03A 4QRPA 2G3ZA 3GB6A 1A9EA 2CBUA 5FYJU 1ADQH 4WJ8A 4P57A 4X5PA 2IOIA 3RDJA 2UY5A 3QUYB 4LCIL 4NAJA 1CT8B 3OWEA 4LQ1A 3UJEA 3EYPA 4IOTA 4FNSA 1KO0A 2L7UA 3UFYA 4I0PC 4HZAA 5I19L 1OSZB 4ONGL 1ZHBA 3D39D 3VXMB 4XVSL 3AS1A 4OT1L 1HZHH 2XG9A 4E2DA 3M1ZA 3QXTA 2VN5A 4FXKC 3CO8A 4U1MA 1SXAA 1BX2B 1VF5C 1OTSD 3D2UD 2E4TA 1IFHH 1QG3A 4AY1A 2R0WL 2YBUA 3GBML 1I0BA 5FKAB 1VKXA 4AJVA 4XZIA 3DBSA 1QFHA 4UUJB 5KBKA 2XQYA 1MQRA 4JZOA 2FVMA 2EKCA 3APDA 1Q90A 4PMUA 4BH8B 4XVDA 3ALWA 1VF8A 4D8ZA 2A6LA 3O45A 1F18A 4HPNA 5C3IA 2POTA 4AWTA 2OXNA 3MOBH 4LOEA 4Q8WA 4Y9EA 4Z7VB 4H9MA 4NRZA 4GS7B 4I48B 3D4ZA 3DMMB 4JFOB 3HPJB 3T8QA 1KRMA 1N12A 3FS2A 3CXHJ 1IGCL 2WXKA 1KB5H 5C0IA 1CU4H 3KPQA 4J3OD 2Q6WB 1UR8A 1B2WH 2XVLA 5E00B 3QPQC 1OIFA 2Z7UA 4NAEA 4XPBL 1WV2A 4HJSA 1L6YA 3CBRA 4M1CC 4GKSB 1FKXA 5HYIA 4F2FA 4LNRA 3ARFB 2E9IA 5EG6C 1TENA 4O52A 1FZMA 1XKJA 5T1MB 1J7VR 3RA7L 1ID2A 3QVAA 3MP3A 4NJ9H 3TN0D 4DKEL 4A3YA 1J0HA 3I84A 3GMMB 4JL1A 2B4CH 1ZA6A 5EFDA 1T21B 2DWYA 2P28B 3HG2A 1F8IA 1TWIA 3L5WB 4BH7B 1KJ3L 4P5TD 4BRVA 1Z9SA 1DANT 5IW6A 2XHNA 1A0DA 1W9DM 3GNRA 3F8UB 3VOFA 3GI8L 3BE1L 3V6OE 1N6QL 2APWA 4ODSH 3GMNB 4Z7WA 3SN6N 3QG7H 4DP1X 4YXKL 3MA9L 4E5XG 4G1EA 4I0KA 1A53A 3N19B 3GPSA 3FSWA 3QZMA 3ZZ1A 2ZCHL 4PFHA 3S4SB 1QNVA 2HJPA 4PRHA 3A6CL 5MENB 3X13A 2VDLL 1SN2A 3N41F 1CI5A 3EUUA 3GYEA 3SIZA 1SJCA 4P46D 2YMOA 4A1RA 1WA2X 1VCVA 3JZEA 4S3BA 3UBHA 3GNMH 1S5TA 3C2YA 2CBMA 2GJXB 3ULVC 4RAUA 4Q4EA 2D3LA 2VR8A 4HHLA 1A4LA 3HJEA 2I5YL 2D3NA 3NTCL 4N9GB 3VINA 2YX0A 4RZKA 2XC8A 3TBSB 2PLCA 2REQB 1BZDA 2G50A 1WKFA 3SB3A 3B8UA 4G56A 4HNLA 3EGXA 1U95A 3OC5A 5AAPA 2VSMB 5FO2A 1CCWB 2EZ0D 4XUGA 2BP0A 1CF8L 2JLLA 2XXCB 2WTRB 5ADPH 4LUSB 4YS4A 3BPCB 2CLIA 3F7JA 1MCLA 3G1RA 1H6UA 2WV3A 4YWSA 4N2YA 4J5VA 1AI1H 4TS6A 2CNZA 3UH8A 4XD4A 3NCCB 1LLOA 3RZCC 4OM0L 2ZQKA 4MS8C 3ARQA 1OF0A 4P2OB 4Z7OE 3JWNE 1JWSB 4PY8I 4ZXBA 1RFDL 3TR2A 1EX1A 3I6KA 5D32A 1C8XA 3GSNL 2NY4C 5HSFA 3VNDA 3B03A 3QEQB 3NOIA 4U5KA 3ENLA 2VC5A 2VSDA 1LEKA 1UZ8B 3WN5A 2P52A 4PCNA 3QK0A 1R3YA 3ZTEA 2I85A 3WBYA 1FZKB 1U5HA 4XAZA 1YEHL 1OANA 5FK9A 3T81A 3WHE0 2BIMA 4IGBB 3LGDA 4G7EB 1KCUL 4LSRL 2V7HB 3FU8A 1E6JL 1IC7H 2F84A 5I1JL 4H25A 3CQQA 1GTNA 3GTVA 4AZUA 5TQ2H 1E27B 3RNDA 5EEXA 4XRCB 3RGVD 2C1IA 3E6EA 4GMEA 4XP6H 3SDAD 1L9WA 1QNZH 2Z0IA 3MXWH 2X28A 1OG6A 3T77A 5CZSA 2DWDB 4GH7B 4Y16A 4NX0A 5D2NA 2O9RA 3QIWB 3SCOA 1MRCH 2YD4A 3BVTA 2C16A 2I07B 4P9HL 2RJMA 1X9UA 2KKQA 4HXAH 4ATTA 4DO7A 1EAJA 1SJHB 5ADOL 2Q7YA 5IB4A 4FOUA 3UPMA 1I1YA 4WY0A 1IC4L 1UA6H 2JB6B 1BJMA 3L17A 3W0KA 1IQDA 2ODIA 2ENYA 1CTMA 1INEL 2XINA 3SRDA 4B0MM 5JDSA 4GI9A 5F7BA 4FLHA 4EVNA 2EXOA 2FYYA 4ZSOA 3LQAC 4O14A 3HAEG 2X4RA 4D8PA 5I6KA 4LS2A 5B4MC 1A7OL 3U4EB 4KI5F 2G97A 5DJDB 2GQAA 3OJDB 3UYIA 2QIIA 5AHNA 1GC1H 1BIHA 1RUML 1EWEA 2PPDA 5DHDA 3WFLA 2H1PL 1EP3A 5HHOD 5C0FA 2BC4A 3WGVB 4H2AA 2JKRM 5FYKL 2C3WA 2JCCA 1NH6A 2J66A 5BNKA 4U3XA 2X1SA 4JFWA 4RGND 1HSBB 4UFKA 4IBVA 4CMMB 1N4XL 4N6EA 5D2LB 4MFEA 3PZQA 2BSSB 2DIJA 2PS2A 4JVWA 3EYQD 2QUUA 3GSWA 4JHWH 1KQYA 1QQDA 5DFWH 2Z34A 3APGA 1YPZF 1Q2SA 2CNCA 2WWMD 1TR1A 3SO5A 4X0KB 5DFVD 1AO7B 4FHKA 4CD8A 1NOLA 5AOJA 1E7VA 3T3PE 2F54D 4M6AA 3MLVH 2GSGB 3SKMA 2WK2A 3SPGA 2QPEB 1B54A 4XK2A 2P24A 4LP4A 4PJFE 2OTWB 4RFEA 5H35A 3FYOA 5LXXA 3QRGL 3SUWA 5KANG 2FNWA 3RDTD 1L7IH 4JIIX 4WW2F 3SBFA 2ZTJA 3K72B 3KPSE 2D03H 3GTFA 1B9BA 4XG1A 1HCYA 3QWRA 1F45A 4I4WA 1A7NL 3QFJA 4XC3H 3I10A 2YARA 3GS4A 1BVWA 4OCMC 4JFYB 3FTXA 1VENA 3C2OA 4CVXA 4HS3B 3HPLB 3KLQA 3U57A 3LN4A 3P2VA 3K5XA 1YAZA 1ZBVA 1QVOB 4FOJA 2HLAA 4PUBH 1DBAH 3QJFB 5I8KL 5I0DA 4WUUA 4PGCA 3Q8CA 3DVIA 5SWQA 4IBZA 2JMRA 5ITBH 1J5TA 1QNQA 2IKIA 1DUYA 5DD5H 4XCEB 2FJSA 1SM9A 1FORL 4XVUD 3PJXA 1W72A 2FWSA 3SE4C 3WFHA 3P82A 4JE0A 3VSUA 3SCVA 3RM4A 5CP7B 3QJSB 4A2MA 3CX5J 3G1DA 2O1AA 3EJZC 5BPPA 1JULA 4Z0BL 5KZCB 2SFPA 3B7RL 2L7EA 3TWCH 2HROA 2OMYA 2BPBA 1GKPA 3L1EA 1X4ZA 3EMQA 1PKYA 3E3QC 4M61B 1S7XB 2OLDA 1X9RA 4YGVA 3CU7A 2SODB 4B27A 4WJEA 2YRLA 2V81A 2ZZ2A 2PYEE 4XN7A 3GTXA 5E1AA 2OCCB 3RIAK 5HYQB 1IGJB 4MTMA 4R2GB 5HGDB 1MWOA 5EWIH 4JDZA 5F0MB 4AG0A 3A21A 3P4NB 5D4YA 3LRMA 3HA1A 3P3UA 3QZAA 5ALBL 3SY6A 3AXMA 4APQD 1YA5A 3QUXD 1DQVA 1FWEC 5B7YA 4D6HA 5KYYA 1DBJL 3EBGA 5DJ6A 4XTRD 4M7SA 2GKIA 2ZUWA 1Z8AA 3U9PL 1AC6A 4OLUH 1KN4L 3NQMA 4JNYA 1FZJA 4NC0B 3W7MA 2BS71 2ENSA 3VFMA 3TBTB 1S2CA 4HYVA 3N85L 3KPOA 1MJJB 3VFGH 3P0YH 3BKJL 3BI9X 1IAOA 2WLYA 3SO3C 4QDWA 1PU0A 4XBPA 1ITQA 2XTLA 4JY6A 2JIWA 4F3FA 3S37L 4QXIA 4PY7B 3T2QA 1NDGA 2CERA 4X7SL 3OYXA 2GK0A 2CBVA 5FEBA 2X44D 1SMAA 2ZD0A 4M7KL 1CBJA 4DYJA 2CLOA 2IH3B 4JANB 5IDZA 1XBXA 3B6SA 3EFFA 4BYHA 5IXEA 2XUWA 2CR3A 5CINH 3ARXA 3WS6C 1RVFL 2C1PA 4ZBJA 4XAYA 3S97C 4YO0A 2FO8A 4CA4A 2ZC8A 2XG5A 4ZZ9A 3IIXA 2OO0A 4GO6B 2ITCA 5GJTH 3HS8A 3M41A 2EH7H 4HWBL 4CGUB 1E4WL 3LRHA 2AXGB 5DZPA 2XWXA 4Q4KA 3LNFA 4TSBL 1TKWA 2WHJA 1XWVA 1NMCC 3EWXA 1XR9B 4E9XA 3IM1A 3CIVA 3BH9B 3MKKA 4FQXA 3SE8H 1Y5VA 2IAND 2XQBL 1LQ0A 2WSYA 4ATWA 3QQ3B 4UTUA 2IKHA 2P5EB 3N14A 1KTRL 1L9NA 2CWXA 5IQLA 1MQKL 1LTDA 4KDTA 4WI5A 3NCMA 2B3IA 2O61A 4BXVA 3CQIA 4TQHA 1QFWH 2A6JA 3VXOB 2JQAA 1T1ZA 3QQ4A 4Y5YC 4QLLA 3UXAA 5FW7A 1U8HA 3AYVA 3ATAA 4H7CA 3G3LA 5KBPA 3U6XS 1IGYB 5FI8A 3CAKA 2FEDD 3L0NA 2Z31A 2O93L 2O6FA 1WCBA 1CLOL 1IT9H 1ET5A 1KXQA 2GG1A 1B4EA 2FJFA 3AM8A 3BPOB 2JXMB 1MQPA 5ILTL 4FQLH 3HV9A 2EO7A 1LEIB 4F2ME 4L3EB 5C7VA 1QSFD 4K1GA 4DXVA 5I24A 2J6VA 5J6HA 2W63A 2XSKA 3PSWA 3WTTA 5IT2H 2CCWA 3ALGA 1FCQA 1CW2A 2B1AH 1Z5LB 2OCJA 1HIML 5HQLA 2LU3A 4XNXL 3BUPA 3NQKA 4OLZH 3KWWA 4GUCA 4WO4C 5JYLA 3C6CA 2C4XA 4KBXA 1PDZA 5FSDC 2ZYFA 2YHGA 3NABH 1W8NA 4PRHD 1WAPA 1QWKA 2D3VA 4QLJA 1P1ZB 4WI7A 2J75A 2UWEF 3O6LL 4UT6L 2GSHA 4XMPL 5HDWA 3MV9B 2RGMA 4HIEA 5J6GA 1JWMA 2EIDA 5C07B 1ZXKA 4YXLH 3O2WL 1JGEB 4XP1L 3U7AA 3AB0B 4O11A 1OTTD 4WV1A 2P8PA 3H9SE 1F90H 1XGTA 4S2BA 3MA8A 4M8VA 4ODBD 1T66D 3BZEA 1T0PB 1AG6A 4WI4A 4MJJA 3G04A 1QPQA 3ZQXA 4HIHA 3D6GA 4NQEA 4G8EB 5JIMA 5HNTA 4K3ZA 4ASTA 1QFWI 2VQ1A 3VXUB 4FFYL 3MCNA 4UQDA 3TT3L 4AZBA 1E5UI 3GXNA 4PJCB 4ACTA 3LHAA 3EH5B 4J12A 4Q7IA 4K7YA 5EU7E 4C6JA 2ZG3A 4O1EA 4UFJA 3P54A 4NJJA 4XKYA 3FJTA 5EO1B 2BRRH 4JM2D 3O3DA 1KM1A 3BUYA 1MUJB 2VDLB 3I3EA 4U6VH 4ZXBD 4WSKA 1KFEA 2WQPA 2BVOA 3FGCB 1MF2L 1UM6L 2Q1EA 1E3XA 4KKCC 5AB9A 5JOPD 5FGRA 3KCPB 3LKSA 4Q22A 1H62A 5F9JA 2WNQA 5DRWA 1J05B 1RUQL 1NFDA 3QORB 4H1ZA 2XBTA 2IUZA 4IBWA 3H2MA 1J9QA 4N2NA 3SDCB 1W1TA 1M5WA 3RRAA 1QI3A 2V5DA 3N9GH 1IGFL 4BELD 4D3CH 2YS4A 3QPXL 1EHXA 2XZZA 4M3PA 1AVAA 1KGJA 3B2MA 3W7DA 4YBQD 4MKSA 2X1UA 4H0IA 3DGDA 2HZGA 2J27A 4NRXB 4QF1A 4V1YA 3KP1A 2XZCL 4HSQA 4L4VA 4XT1C 2VJXA 5EFIB 4KROC 4I90A 3G1HA 1EJOL 3RQ3A 2V3GA 3E2RA 2BNRB 4TMPA 1ESWA 4GXVH 4BKLA 3LLXA 2OJEB 5J1AA 4OJEH 1E6OH 2OR9H 1PD1A 2VLKA 5C0BA 4CBZA 3L48A 3ZMEA 1HILA 1B4TA 1A3XA 2PPGA 1V3IA 4ZNEA 4ZMTA 1GK8A 4YE0A 5K5YA 1UXWA 3T0BA 3NCFB 3GSNB 4D6JA 5CBIA 3O0KA 4NUQA 3ZM8A 3EO9L 5KINA 1KJ2A 1WNOA 3NIGF 4KKQA 5B7FA 5BS0B 4TULL 4FNRA 5D72H 5DZJA 3QHMA 3B2UD 4MDIA 1NC2D 4KU1A 1QMUA 2PMQA 2EHHA 4IFKA 4L1XA 3ARUA 3GMOA 1LP6A 5G5IA 2PF8A 1JOIA 2Z6FA 3UAJA 4F48A 4KY1L 3AG4B 4M7JH 3HKZA 3PZVA 4W68A 3F7QA 2KX9A 2F0CA 1B30A 2PDHA 1M71B 2E6FA 3G9VA 4LEFA 1Q72H 2IBGA 1A0CA 1VGEL 3QWOB 3AU2A 3ABQA 1IMHC 3COOA 3KXFE 1V54B 4MJ2A 2A9AA 3LD8C 3H7BB 1AYRA 3EBHA 4RAVB 3BP6A 2J8UA 4KRPD 3VK5A 1KLFA 3UR5A 2YD9A 3I6LD 3OPZL 2Q8XA 1AAJA 4N22A 3O3AB 1UROA 4CU6A 1NF0A 1RMFL 4DZBB 4ZTOH 1UT9A 2NQHA 3TASA 5FW8A 1LVEA 4ZW5A 1KV5A 4ZS6C 4JJOA 3BSMA 1NCAH 5F4XA 4HSAC 4HOWA 2PU1A 1CICC 1DJYA 1J9TA 2WMPB 4O02A 1YEFL 3T1FA 1VADB 4CQ9A 3LV3A 4JR9H 3RG1C 4KNSA 4RVBA 4C58B 1TQXA 5FD0A 5T5FH 2NX3A 3WKNA 2VGIA 2OKMA 2CH8A 1HH6B 4X9BA 4N5ED 5EU4B 3S42A 3WJJC 2QLYA 5EUOF 3EG9B 3QWRD 3LCYA 3QFJD 4JFXA 5C0QA 2QUMA 5ICUA 4AL8H 1AE6H 1A3RH 1T89C 4J6IA 2FPTA 3FONA 5JUEL 1H60A 4ADJA 2VC2H 3U0WL 3ZKXB 3WO8A 1TA3A 3FFCD 3QV7A 4ZTEA 5AHEA 4KI1A 1G5AA 5CGBA 1S5VA 4PRPE 3GTHA 4ACZA 4JBSA 1A7RL 2QHAA 4U1KB 3VKDA 2DTMH 4DAGH 4UILL 3BDBA 5KVGE 3H26A 4FJ6A 4N2DA 1CC3A 1MLBB 4K94L 5AZEH 2BSRB 1GGCL 3SUTA 2DY2A 4RBPH 5CH9A 3STFA 1D3HA 5HPOA 4GLEA 3N4AA 3UTZA 4CU7A 4QE1A 3U1PA 2AS5M 2A83A 1D7BA 4AMXA 4OI7A 3BN9C 2CUHA 1VA9A 4OD2A 1Z9AA 3V0SA 1RD5A 2VXNA 3PJSB 2J77A 1NGWA 4G6FB 3EX1A 1FH8A 3HZMB 5FFGA 3BT2H 2A74A 3O6FB 5K1NA 1KZQA 5CPLA 2P53A 4PJAE 4PJ7A 3RVUD 4JQ2A 3IN0A 3ATDA 1QD0A 4S1QL 1M53A 1YAIA 3MWAA 3T0TA 1SZGA 2PBGA 1H1YA 1HQ4B 5HJBA 4X6CF 3W7LA 1FO0A 3D48R 2YLHA 5EF3A 1IQWH 2YD1A 4AXWA 2VUKA 1RUAH 1WVZA 4DOHB 1ZT7A 3WBXA 5F9AC 4Y1AE 3BURA 2R0ZL 1NUFA 4U05A 2WYSA 3SDDA 5DEFA 3R5EA 3UU0A 4HYRA 1KJMB 3K4AA 2OODA 3QR2A 1NCCL 4NC2B 5EBLB 5C9ZA 5JPMC 3S2CA 3OKOA 3DI3B 4ZFCA 3TJPA 2CLKA 4RZCB 2C3XA 5DMMA 5HDQL 2YPIA 5CZVL 2BCKA 5ABFB 5L6YL 4DJDC 2J44A 1TX0A 2EYSB 1S5IL 2NTSP 4B15A 1MI5A 2G5RA 2VB5A 4HIXL 1MFDL 3VVWA 3SGDH 1LWRA 1ZS8B 2M2DA 4PCTA 4UTWC 5DYFA 4DEPC 3C5ZA 2EG8A 2OMXB 3ABGA 4QLRA 1CZ8L 1LXMA 1CBVH 1DSFL 3WUEA 1VLIA 4UQ9A 1THCA 3MX0B 1WFIA 2I5IA 2VEPA 3M47A 1TLKA 2AQSA 1EH9A 2R14A 4GYPA 2XFYA 3VFWA 2A6KB 1Z3NA 3OX8A 2QT6A 3WKML 2YXOA 3ALFA 4FQXD 4J3ZA 2DMBA 2GUUA 1CD0A 3ISWA 5GGUA 4XO7A 2HRPL 1KCVL 4GW1A 1D6VL 3WEAA 2BNQD 3SECA 5MP6L 2H6PB 3VFVA 5ANHA 3RX8A 2QDVA 2NLJA 1QCWA 4FA3A 3BGAA 1T99A 2WBGA 3E0LA 1XBZA 3KM8A 4Y9NA 2MIZA 4G7VH 4FXLA 1TQJA 5I5RA 2FDMA 5ICYA 3VD3A 2KZ1B 3IJYB 1JAKA 4C6CA 4JTEA 3FTUA 4P2QB 5L4MA 5FC9A 3IEAA 4HGXA 2LVEA 3CH0A 5KVEL 2EPMX 1J12A 2MCAA 3SQOL 1M6OB 2RKXA 3P2BA 2ADAA 3FZUC 4KZDL 3SKNB 3KJ6L 2G75A 4G1MA 5D7JA 2VW7A 3WS3A 2BCMA 4ZYKB 1OPGH 1UXLA 2F8OA 4XNBA 4Y9PA 3TWYA 2Z31D 3LGGA 4IMDA 3CUIA 4B53A 5KSBB 3MP5A 1TYRA 4AYFB 4WUIA 1V4YA 3CZUB 3LPPA 1R9YA 1JWUB 4ADUA 3HC0B 1RZKL 2N3JA 3CH8A 5L7XL 4FIRA 1FL6B 4PJ5A 4LKCB 2HKAA 2AZAA 1DEEA 5I1GH 4H1LA 1TVBB 4G80A 3F6IA 3OR6A 3H70A 1KEML 3SGDI 7PCYA 3IRDA 2P3YA 1KTCA 4PB5A 4K7VA 1PZ5B 4KW2A 5ESAA 2X4OB 5MI0B 4AMKH 4LSUH 3ECUA 4PV8A 4X8JA 2HN7B 4F79A 2YCKX 2OQJA 3OG3A 4RDBA 3GXTA 4ZMNA 3E74A 2NW2B 1YDOA 1H3GA 1IGTB 1HHGA 4GSDH 4Y19A 3IVTA 2DW7A 2NT0A 1RA5A 4PJXA 3VXPB 3ZIYA 4OT7A 3MBEC 1I1CA 2PYFA 5CJMA 4J3TA 5SWSE 3KM2A 2O4EA 3PPEA 5EEZA 3DECA 1QBLH 2WY3B 4C1NB 1UGKA 3RKDD 3VFNB 4J27A 3PL6A 4WGWB 5KG9B 2H32H 5BYWA 2O5ZL 4DK5A 4QITA 4OSUL 2BOCA 4HMCA 3UP6A 2DZTA 1NC4D 3ZKND 4NQED 1VPYA 4B3KA 3S1XA 2K9UA 3IXTB 3ZLQC 5EU6B 3VFRB 1HHHB 3F7VA 1ONWA 3FH8A 3K2KA 1P9MA 3U30C 2OMZA 4OQTA 1JNDA 2WJZA 1J9SA 1WFMA 3ZDZF 4Z1CA 5AYTA 1W0VA 4X80H 4M02A 5DVNA 1JUEA 3DX8A 3GC2A 5CD5D 3VWKB 1VACA 5GS2D 3IKCA 4NP4H 4ENEC 1MSPA 3IYLW 5T26A 1FA2A 3WUGA 2D20A 3O6KL 2GHWB 4A68A 3BWZA 4X5WA 2WOQA 4NASA 4GQRA 4JTCA 3NA9L 5C0AE 1FFOB 3P3TA 1MCPL 1E6SM 4LS0A 1XLLA 1PNDA 2WNZA 4HEMA 2Q6ZA 5DJAA 3E2HC 2G30A 4OZHE 1C29A 3FS9A 5A6BA 1OF2A 4AGOA 4QT5A 5AAMC 1H3VA 1JFHA 5KS9B 3IETA 1TPXC 5JPNA 4GMSH 5INDB 1PD6A 4OLVL 1LT7A 4E4PA 4E5XB 3WBWA 3WUWA 1QXLA 1EIBA 1XF5B 2LVCA 3RWJB 3V0JA 5CWSB 3EJUA 4FOMA 1FSKB 4L4VD 5EA9A 1CYGA 2LU5A 3EWZA 1B6UA 1I9JH 4Y2WA 2BY3A 4OUEA 1E8XA 4FF9A 3CMOL 4K1WA 1LD9B 2N4IA 2OA9A 2XFFA 4EJ1C 4YL9A 1N82A 1HH9A 5C9KA 5JIKA 4YHLL 2VLKD 3ICJA 4O4WA 3QYQA 3H9YA 4FQ1L 3R7MA 2XWJB 1W3LA 2YEZA 3PULA 3V5KA 1F4XH 3MRLA 4XOBA 1PO9A 3RIKA 3HVDA 1VZIA 2D22A 1X1OA 3VDGA 5IESL 2ZUNA 4WI0B 1J1XH 1E42A 4MD0B 3CQHA 2OXGB 1XL6A 3W7KA 3LZPA 4O9HH 4ZXLA 3IGHX 4GY0A 3AHTA 4IIQB 1T2JA 5TK2A 5DD0L 2X6VA 4X8XA 3JV6B 3E3QE 3CLMA 3UAJD 5GGRY 4JFFD 3AMGA 1W91A 3BWUC 4W9ZA 1KR1A 3UG4A 4JFTA 1PUDA 3TFCA 2C1OB 3WF2A 2ZCLL 2CD0A 1IAIL 3EZJB 4XBEH 4UIKH 4BF7A 2R1YB 3MMEB 4PE8A 4NO3A 2CXGA 2FECL 3MZ2A 3TV3L 5HHVL 4MQ7B 3P81A 2OQHA 5DDHB 2Y5EA 4UB0L 1MFVA 1FFNB 1YEGL 3DOSA 4XR8C 2GWGA 4QBXA 1E0OB 1R33A 1PJWA 5D7IB 3W9EA 5CM1A 1J5OL 1B4LA 4GRWH 4EPBC 4Y90A 3U2ZA 5BZAA 4HZ8A 1XHHA 1E70M 5DMIL 3MRQB 5CQ1A 1MYRA 2XT1B 3WBDA 3TK7A 1XD1A 4Y8AA 4XBMA 2FAUA 1BP3B 4F8QA 3VXNB 1G4MA 2VOMA 4LUTB 1E5JA 2VW4A 3BAEL 3WFBL 3O6MH 5D1ZC 4EI5C 4OGYH 1EBGA 3NPXA 3KRUA 5IJBC 3EFDH 1ADQA 2OB3A 4AQ8C 3ATFA 4ZFOA 1WYIA 5CS7A 1QLEB 3MO7A 4N2HA 1RZGA 3KRSA 3OC8A 5E4EC 4FZEH 3ECBA 1YEKL 3V5CA 4OZIE 1D6EA 4BRJA 4CNIB 3OMAB 3F4WA 3EXSA 2MCG1 5M94B 2NXGA 3JTBA 2CXEA 2QJHA 1BMGA 1GTHA 5D6DA 4WDIA 2VLME 3MCLL 4JFZH 1OAQL 5EBWA 3SCMB 3GHBH 3SGKA 4UM9A 1UADC 3U4KA 3CDGB 3CSYA 1YNTA 2L8AA 3VAVA 3QV8A 4PJGF 1W0YT 5JU6A 3H7VA 2YPLE 3B05A 4L0YA 3I9GH 4LLWA 3DX6A 1MXGA 1HI6B 3QLLA 5EBGA 1RZ8A 2LFEA 2Y5TA 2P43B 4H4IA 1AD9A 3EX3A 3W9DB 3AY4A 2FR4A 4O1CA 5G4WA 2HFGL 2JTYA 3BVXA 1HXMA 4RIRA 1S9XB 4G6ML 3LHVA 3B7UX 1OGGA 2J6EH 4QYOB 4IRSA 4OV5B 3DROA 4AD0A 3M8OH 1RJYA 4DYKA 2YQBA 1LEGB 3G5VB 3IK4A 1KB5A 3P77A 1LG2A 1F8MA 4HLJA 2VDPH 2HFTA 4RLDA 3E6HB 5LXVA 4G3YH 3SQBA 1BEYL 2NY6D 3B2VH 2PGRA 2ARWA 2XVNA 2BWGA 5CC7A 4UQEA 2ISSA 2AJUH 4Y5VA 5TJWK 4B9KC 5IB5B 4LPCA 3QWQB 5AC8A 2CKRA 3V36A 1JFXA 4NZTH 5BRZB 5I8CB 1KB9J 1IIHA 4HIIA 2IVFC 3QCTH 3T0VA 1RAKA 1C9DA 2QCEA 1IBDA 1V6XA 3VW3H 1AQFA 3V6ZA 3FJNA 2E27H 5GS0H 4AZGA 2D2HA 3ITTA 5DURB 3ZHDA 4TUUA 5KYWB 4RBPK 3QP3A 5I1LA 1L9PA 3PPSA 2Y6SD 2TRYA 4P2RA 2CO2A 2K1MA 1CR9H 4JNXA 4J9JA 3B1UA 3V18A 4EZKA 1MWAH 1FGVH 1F6AB 1YTKA 4Q8MA 5I1CL 4E36A 2WBKA 1BEXA 1ZHLB 1F8TL 5DVLA 2OLSA 1S3KL 4LPXA 5FO8A 1EO8H 3KYKL 3GSUA 5CEZE 4ZMVA 3ULUD 4UTJA 4KWUA 3CDZB 4LIQE 3TW6A 2HH0H 1MI5D 3F85A 3QIUC 4K3DL 1XZ0B 1AH0A 4YDJA 2ITDA 2OP4L 1WA0X 3GJEB 4DO4A 2JGYA 4OJDH 3ELQA 1AD4A 2MH4A 3EIFA 2VUOA 3CE1A 4TX9A 3HRZC 4KTDH 1JCMP 3C5ZD 4DJFD 5J8OA 1TJHL 4PYGA 1A4JA 3QLDA 4JDBA 1AQKL 1PSKL 3TT1H 1MQQA 5E9DB 1KELL 3QJZA 3TLRA 4Z7AA 2IQ0A 2WIIB 2NX5D 3KHDA 1TYJA 1WA1X 1CDBA 3KM1A 2F2KA 2WV8A 3WL9B 1NAMA 4PJEF 1N26A 2XZAH 4AX6A 2BK8A 1GYWA 4YAQA 3ULSA 5DSCA 4FX6M 2OR7A 3PPHA 4A8RA 4PRDB 5SWZE 3EHBC 3PHQB 1MUCA 5D2WA 3ILDA 4PA8A 3EGSB 1XF0A 5CBEB 3BISA 3BEVA 4TSAH 3QHNA 1U8MA 2X4PA 3NPSC 4MPQA 1P6CA 3ZE0B 2PCPA 1LILA 1YE4A 1EAQA 5IHRA 3EW3B 1RU9L 3EYUH 3QDMA 5F96L 3GSXA 3W7HA 2KQNA 2P8MB 4NHCL 5SV3A 3LDBB 4G42A 1YYLL 1L6XA 4IMLA 2WZMA 5JIWA 3ARED 3GWJA 1BWMA 5AKTA 5F7DB 5KUMA 5D4JA 1JJUA 2GIXA 3MLWL 2XGIA 2FO4B 3LS5H 4XBJA 5LNDA 5D7JD 4ZUUB 4UIOA 1MVFA 3RX3A 2Z1XA 1J1OL 1DQML 3UTTB 1HXKA 3ZZLA 5J5EA 1YC7A 2J7HA 3Q3GA 5A2KH 1DL7L 4JJHA 3PK7A 3CSTA 5FJOA 3WTWA 4TQTA 4QXTB 3IACA 3RWHB 1Y0EA 3P0VH 1EXPA 1VJSA 4PJ5D 2ACRA 4ZFGH 4YBLB 2DQCH 3MA7A 3CV1A 3M1BB 2GJLA 5LGHH 2IWGA 1I1AC 2NPLX 5D9MA 3WLWD 4FDWA 3UBXA 4R0LA 1FCBA 4KRUA 4MAYB 4ONFL 7REQB 1LNUA 3HMWH 3BP5A 4H2HA 1V03A 5PTDA 2L7QA 1IWBA 3ARGA 3WQFA 4CBPA 4L4TA 3TEVA 1P7TB 3B37A 3VVVA 4Y19D 1L8NA 4M6ML 1XCFA 2F7PA 2B8OT 1Q3NA 3GSMA 4QHMB 2GFTA 1MG2C 5T3XH 4P23A 2RR3A 4L0PB 3IWUA 3O7UA 3AC0A 2IAMC 2NUWA 1N68A 1NGYB 4F7TA 3AIBA 4G1KA 4GUGA 4KGLA 1NAMH 3GO1L 1YECH 3MXVH 2IPGA 1L6SA 3PL6D 3FPXA 3UYCA 1AL7A 2GPZA 1WBXB 4LE8A 4F2EA 1Q8MA 4KUZH 3UZQB 3UAEA 4IDJL 3S1GA 2UZIL 5F8QC 1WH0A 1YSOA 1P4UA 5AOKA 3U0PB 2YD0A 4J1OA 5JA8B 5MEPB 5KSAA 1G84A 3LNIA 3N91A 5DI8A 4LCRA 1KDIA 2DY3A 2FATL 3ITOA 3ARPA 2NYYD 4J3WA 4IL2A 2M83A 4XD6A 4QEEA 1CIDA 1WT5A 1SW0A 4JRYA 4KZEL 4R7NA 3NZSA 3FQXB 2LU7A 3MRJA 1YNPA 3GAKA 3X1EA 3NZ8A 3URQA 5FO7B 2ZDSA 5C1MB 4HLZG 5T3ZE 2UXGA 3M6DA 3A9IA 4WKZB 5E8OA 5FEZA 4ZI8A 2QADC 5GGVY 4DPAX 1XPYA 3QEZA 4JCMA 2XIQA 5A6BD 1R5VB 5F9WC 5HBBA 4MJ5B 4OKVA 5HDBB 1TSHA 3QE5A 1S7TB 4HT1L 3IK2A 1X8FA 2JFEX 3AABA 1XVSA 4U6HA 3FJ6A 4FEZA 3L7FA 3DHDA 2E8YA 4G5ZH 1CGSH 2UZYA 4ELMF 3QT2A 4PJDB 5DTFB 3ARTA 3PZNA 3KBEA 3FTVA 1MCDA 3QQDB 1MHCA 3DA0A 4KPHH 4S39A 5F88B 1PDKA 2X38A 3FXYA 2KLTA 5FCUH 3PPFA 5B3SB 3MUZ1 4LS1A 3K91A 1K5NB 1ZT1A 4N8VG 4PB0H 2VZOA 1JPDX 3ZJKA 4QHKI 4R85A 1VPXA 4KV5E 4EI6B 5FDWB 4E8GA 1JK8B 4K7FA 3VCCA 4PJBE 1WG3A 1ZVHA 1F3TA 4NQVB 2GVYA 1OX6A 5DJXA 4UFMA 3OZLA 4HKJB 1XC6A 1MCBA 4NPKA 5EUKB 1QR1A 1XGRB 4NENA 3K5RA 1A5CA 5DS8B 2Z2UA 3ELAT 4I89A 3BH8B 1WF5A 1C16B 4WGVB 3NG5A 2DDQH 3MGOB 1YLVA 4NN5C 2F6AA 1XLFA 1GTEA 1ADWA 2WNWA 4IIZA 1DVTA 2PETA 3GLDA 4D9RD 3SGGA 4Y96A 2OKOA 5KSWA 1HVQA 1TQCC 4GUQA 4Y5XB 4E38A 4MMXC 2CDFB 3TTYA 1ZP4A 3MHZA 4H19A 3F12B 2HX8A 3FUMA 1UWSA 4C7DA 2NQ3A 2DIKA 3X11B 4OI9A 2E4FA 3VI4B 3S36L 2XXMB 3STZA 4LC6A 5A8QA 1ZT4A 2R82A 3V10A 4US5D 4NQQA 4KQ3L 3OKEB 2AK4B 1N7KA 1FPTH 1XLMA 3KH4A 1NGPL 3C60C 4XPFL 5TF1L 4BWTA 4H26B 4F91B 5GISH 4X99A 3VGHA 3CN2A 1FC1A 4RK8A 3SJVA 4MZ8A 3VNLA 1T7VA 3VFOA 3NZHH 3PAVA 4CJ1A 4FMFA 1C8PA 2ZKYA 2VSKB 2WJDA 3VA8A 2VFEA 4HCRL 3UBXI 2BOEX 4P05A 1OY3B 3RTQB 1YEWA 2EJ1A 2IXQB 2F5AH 3HCVA 1UWAA 3VXSE 3QOMA 3VTAA 4ECNA 3BPNB 1CJYA 1EA9C 4YQXH 1PGRB 4UQCA 3FMGL 1DVYA 3R06B 3ILQC 1ODZA 5CPMA 4TLKA 3BKYH 4HSNA 3M64A 3PZTA 3WLJA 4IX0A 4U0RB 4NP7A 1OT4A 4GB9A 3HNTL 4DGIH 3UA4A 1PTZA 3LERA 6A3HA 4NZUL 5CZXC 5CXPA 3TL5A 1KNWA 2X1XR 4OZGE 4HSHA 4S3EA 4LC8A 1URLA 3DTUB 4BFNA 3F03K 1A21A 4P8QA 1XZWA 3US0A 1CZ1A 3NSNA 1YJDC 5D1XA 3LXAA 5F1IA 3OSVA 3FT2B 3MPGA 4O12A 3K6SA 2R1NA 3DIFA 4NVTA 2JFCA 4IRJC 2OX5B 1TTIA 2H26B 4YR6A 3P5ZA 1SXNA 4EXBA 5J13C 1WX0A 1QNOA 4JY4B 1UM4L 1ZA3B 1CXKA 4YK4B 1WAWA 4Y4FD 3D69B 4I6VA 4IG2B 5K2ZA 4U1JB 5AW3B 2F8VA 3F5WA 5CEYA 4IRSD 4JREC 3C2AL 3DI2B 5AW2B 2F7FA 1NEZA 1V6YA 1DJZA 1UCTA 4HBCL 3VYPA 3DJSA 1ECYA 3RGTA 1R9FA 2CAKA 5LWYL 1R86A 4P5KB 5E99H 4ESKA 4UBDC 4JO5A 1MVYA 3DX4A 3DERA 1BVOA 3CH1A 3OR7A 4XNQA 5J3HC 2EE0A 4X3ZA 4QE5A 3OAUH 1SR9A 1M2OA 1M7JA 2V69A 1DBML 3VI3F 4PU2A 2ZXEB 4ZZFA 3CDYA 4MKNA 3QFDB 1UCBH 4X4XB 1K8ZA 2IH1A 4UDUB 1CGVA 4XCYA 2Z91B 1N9PA 3OPUA 3ZDXE 2VDQH 5G5DB 2VIRB 4AZ5A 2IIJA 5TBOA 2QQKL 5DUBA 5CGQA 5E5UB 1OARH 4JZJC 5C0RH 3GU9A 3MJMA 1FA4A 2F58H 4UU9A 1FCUA 2G41A 4QRPD 2VXQH 2O6PA 3DLQR 3T44A 4K8GA 2A9ML 5EORH 4WHDA 4CL7A 1KYAA 1I8MA 5F89B 4PMQA 1R3WA 4GW4B 4ETQB 2F9BT 2X40A 4TR9A 4HPYH 1ENUA 5AVSB 3BLPX 4KO7A 2W38A 3MYJB 2ESVA 2QPFA 3JS3A 2VABB 5A6LA 4HKZA 1DVZA 4YVVA 3WFDH 1GYAA 3LS4L 4PL2A 2QCNA 4IICA 1NCDH 2AJYL 1W32A 4U2YA 4L5FL 5I6LA 3RWFB 4W81A 1UUNA 3VRJB 2XH0A 5TE4L 1YEEL 2XPYA 1Q6RA 3BH4A 4MBOA 2OTPA 1NMBL 3LNDA 5CCZA 4BWLA 4P5RA 3H2OA 2BX5A 2AJZB 3D0LB 1A4CA 3CPUA 3ONBA 2Q86B 1VR6A 3B34A 2GVEA 5BVJA 3E5PA 4TUOA 2J5WA 3AGVA 2MNUA 2Y23A 1CGXA 1E6ZA 2CE6A 2X4TA 3WNNA 4PHZA 2XN0A 1PHQA 4NZJA 4FR1A 4XZWA 1GVFA 5C6PB 4ZUTA 3IDYC 1YHTA 2EG7A 4ZJ9A 3QKEA 3RJYA 5A8GA 3ZL4L 2MCMA 3F2LA 3NJGA 3CPLA 3D3VB 2KBGA 4TLUA 1OSPL 2BASA 5GGQL 5I1EH 5C8JA 1XXFC 3G5ZA 5TE6L 1E4HA 1JAEA 2DQHL 1KKRA 3D0VA 5LAPA 2EP6A 3D39E 3L3OA 3TYFA 3QDMD 5EOQL 4AG4H 4R7VA 2Q01A 2EINB 3NTYA 4Y9CA 5MHSD 4JNMA 5I19H 4ONGH 2ZUMA 5GRXG 4XE5B 1V3MA 5DGRA 4PP1D 4PLJD 4XVSH 2GDUA 3HB3D 4OT1H 1UXSA 3S4TA 2W67A 3C8NA 2WMIB 2WZ5A 1FLRL 1UH4A 1G7JA 4ZUSA 1N5AB 5C7HA 3T8XA 2DF3A 2NY5H 2R0WH 3FFDB 3VDCA 3K71A 3HPAA 4AXNA 2P4AB 3AIRA 4U1NA 3W2LA 1ZV5A 1BWVA 1IAKB 4PREA 1YRKA 1IF2A 1E65A 3EMZA 3R1GL 3QDJE 1TVHB 3MLUH 3QNZA 4OU1A 4ZMOA 3BXNB 4PCFA 1XYBA 5C9XA 5C9UA 4AX7A 1CLYH 2WXPA 4TV3A 2NSXA 5AVNA 4RRPM 4WI9A 2Y3NA 1KM6A 2JJVA 3WSUA 5AFDA 2FH8A 2DQGH 3FULA 5CJOL 4ODHL 2J62A 1NM9A 3ARGD 4Y2OA 3QUZA 3CFKB 3EYVA 1PZ3A 3MBWB 3MY9A 1LDPH 4Q9QH 4HKXB 1TT6A 4H8UA 2ZVRA 4XPBH 3GD1C 4C6EA 5F7MC 3VYLA 3T07A 3VOIA 3LK6A 3U4BH 5D9SA 2Q02A 1HN1A 2BX7A 1LYQA 1KIUB 4UQ2A 4P23D 1EWHA 3RA7H 3ESVF 4PRBA 1JRBA 3TCEA 2ZJSL 4NBYB 3EOBB 2BIIA 2HX9A 3QH3B 2GY5A 4WNSA 4P4KA 4FF5A 4HZ6A 3DX5A 3QFEA 4Z2GA 4P7OA 4OU3A 2HVOA 2I9LB 3UPRA 4WOZA 2UBPC 3GI8H 3BE1H 1Y7VA 1EZSA 1ICQA 5F1NB 4YXKH 1ZUAX 3C52A 5KSAD 1JZ3A 3MA9H 4EQ2A 4PCYA 3WBEA 1QSEA 1ZLSL 4PCSA 1QT1A 1B0GB 1NBYB 2NQJA 4LEQA 3OKKB 1NPUA 3EJPA 3UVIA 2OLAA 3W11C 5BWFA 4QRNA 5H91A 4AHQA 3L6FB 5AG9A 5DK0A 4RPPA 1JDFA 4GRSA 1SUJA 4EZMA 1FFQA 7FABL 3IKKA 3LEXB 3M0ZA 1OCRB 4XHQA 4JRYD 3QEUB 4FTDA 1L6GA 2ZA3A 4TQPA 1OFRA 4IMEA 4F8TA 3X3FH 1DJNA 5GNYA 2J56A 2NY7L 4KHXL 2PFHA 2FPVA 2QJGA 3QIBA 5T5FA 4Q4IA 2DEPA 4ORZC 4OF5A 5EIIG 3UMTA 3PREA 3OGVA 3HZVB 4X7EC 4DCQB 3LKOA 4YVPA 3VIOA 2Z93B 5IFHL 4LCYA 1DQIA 5BZWB 2OSYA 1VKFA 3BOLA 3FJLA 3DDFA 2ZSWA 5E2UH 4OUOA 1DWAM 5I76A 4JTIA 4Y16D 5I7GA 3VYOA 1MG3C 5LKYA 4LK4A 5D37A 1XINA 4XH2B 5DHVA 4N1EA 5KTLA 3VGAC 4AY8A 5FUZH 2YJQA 2VQ4A 3A13A 2B7DT 5IHZA 4TRPL 4N8PA 2JJWA 3W73A 1GKQA 3UGRA 2IDQA 1QLRB 5BOJA 3OPSA 1KXTA 5A3IC 2Z29A 3VXQA 3SZKC 4EXPX 2NTFA 5C2UB 3BUDA 4MNGA 5K9JH 2XV0A 1QLEL 5I1HH 1FI8C 1OTUC 2FT7A 4MMWA 3QQ9D 3KPLA 1E2ZA 2V7NA 3G08B 1NY1A 3N6QA 1XUZA 3STEA 1SJMA 4Z7IA 3W7JA 2NXYC 1X39A 3UDWA 3FNDA 4TNWF 3VCLA 1EERB 1QFPA 1DBKH 4DHLA 5K39B 1MFUA 4Z7UE 4W9IC 3ULVF 4OZOA 3NCYP 3ZHLA 1YEHH 4IGSA 4F8NA 2Y2WA 3QO0B 3ESNA 5EEUA 1Z7AA 4CN4A 4R26H 3U1SL 4AQZA 4F9PA 1W15A 4HJTA 4O2EB 3L67A 3V52L 2ICEC 2OZ3A 4AYDC 1E6JH 4AV5A 1IVLA 4FC3E 3EJJX 3P8JA 5GRVL 3T09A 2R23A 3M0LA 4AVIA 5ENLA 5I1JH 2FL5A 1I2NA 2LR4A 3FIGA 3H24A 2N7AA 4DELA 3VQMA 1X1ZA 5GSVA 1KC5L 2FJGB 1FG2B 5FF6B 3TIMA 5K93A 3GS7A 2HPMA 2I69A 4MXQD 1T1YB 2RACA 5M17A 4KKBC 1HXYA 4F0KA 5IUSA 1YEIL 1WIOA 4RESB 4UFHA 5FSEC 3TBYB 3CM4A 1NFBA 5ADOH 1KNOA 3IFOA 3WAKA 4GG9A 2ZDRA 3AIWA 1OP3H 3B0XA 3N2BA 1IC4H 3GSRB 3SJVD 4HEPG 4OLWL 4KKXA 4NAFA 1SJXA 2QQNL 1FF5A 2BOBA 2Q2EB 1R9XA 1XXXA 2W88A 5CUSL 2VLLB 2CBPA 4RFNC 3CASA 2J7CA 2H6UA 1BRLA 4AZ8B 3VOCA 1M04A 3MTXA 3T0XA 5FEPA 4IYKA 4PGDB 3SOBL 2Y72A 3L9EA 2DUZA 5DHVH 5KTEL 3RCNA 1QOKA 3CYVA 1ZXQA 3S35X 2Z0BA 4MNQE 5HHOE 2CEQA 3NIYA 1KD0A 4GACA 3ZO9A 3KJ4B 4FTVB 4C47A 1POJA 1TZOA 1ZVSA 3FW6A 3VA6A 5D93C 1C90A 5XIAA 4JHUA 4WUUD 4MS6A 2H1PH 4GT0A 1SLWA 2QVMA 3ZLFA 1CWVA 3MHFA 4RCXA 5AAWC 4JLRB 3C56A 3QC0A 3EJCA 5AB1A 4MWAB 1NBZB 2V2HA 4HU4A 3U2JA 5F2IA 4XVOA 2AW2A 3AWGA 1N4XH 4XOEA 2DGAA 1G6CA 3QBUA 2EIEA 5FF2A 3ILEA 4QOKB 2H0JA 5D1XD 1DIEA 3CL7A 2A4EA 4E4FA 2Z6JA 4IDLA 2AK1L 1X7QB 2INEA 4M8UA 5E8EB 1L6ZA 4BS0A 4BZ2L 3QUHA 4JY5L 5DUML 4I8DA 2JKJA 3RN6A 4PWGA 2TAAA 3TUUA 4H88L 1O0VA 3S8HA 1KTDA 3F05A 4RMQA 4HK3J 4D2JA 2Q8ZA 3W72A 2Y6ZA 2BFVL 1C8YA 4MMZB 1FP5A 1A7NH 3QF0A 4QLWA 1Q6CA 4TUJA 4A7GA 3KLAB 1OYAA 1A1NA 3G6MA 3RUGA 2BMKB 2DQEL 1GW6A 3WQ4A 3G24A 3JV0A 4LOUD 4GNVA 5F70A 3II2A 4PJHB 1DE4A 3KBMA 3C6EA 4DLFA 1E8ZA 3EX2A 4DVOA 4TVPD 1Z9NA 4PI0A 1GZHA 1IEBB 3UOAB 3SGJA 4K3GA 3MNDA 4OUUA 5KN5A 4AF0B 4GA8A 3BUQA 5IFAL 3OAZH 1K8IB 3ASWA 4CCCA 3HE6A 4NQDA 1D7DA 2Q2LA 4HHHA 3UZVB 2XX0A 1S5WA 2XFXA 1S7WA 3K1GA 1X6UA 3URBA 1KLZA 4S3GA 4E2BA 4MCZB 1FORH 9CGTA 4A3RA 1Q2RA 5HA7A 3GHEL 5F2LA 5KW9L 3MR9A 2F5BL 4ZODA 4I5RA 2HKFH 5BQ7B 3VB8A 4X4KA 4Z0BH 5CD3B 3X2QB 2NY1B 3W56A 2GJPA 3FU7A 3DURB 2BVQA 2V0TA 1ZALA 5DA4A 2ZA2A 4PRRA 4LDOB 4PN6A 5IJVB 2OZ0A 3QXDA 4IIGA 3HZYA 5CG0A 5EC1A 5HJ3A 5CLWA 4G7FA 1J8HB 4Q7NA 3O8AA 3ZE2B 5C0DA 3FB6A 2PUQT 4FXFA 4MA1B 3ASNB 3IN2A 3V0EA 3UZJA 1OGAB 4NJGA 2ZC1A 3THAA 3U83A 2H32A 1ZGLM 2GTZA 4HETA 3HA0A 4INFA 5FHBL 3A5VA 1P4BL 4WSGA 2QKIC 4FX7A 2X2UA 3M5VA 4KBPA 3LV6A 5HK4A 1DBJH 2NQCA 4NYLA 1G4SA 4AQLA 4IXXA 2Z4GA 4RGMB 2C3HA 4LLYB 4ZQCA 2INFA 2A0NA 3TEWA 4N20A 2X1PA 2F6KA 5LYRA 3T65B 1VCAA 3A22A 3N85H 3BGFB 4U6XA 5IB1A 3LIZH 3B9EA 2ZICA 3BGMB 3BDYH 3VZZA 4KMQA 4ATLA 4WD0A 1MDAA 5KVMC 1JXGA 1SEBB 1F00I 3W57A 4Z78A 1MZRA