1QW8A

Crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNAMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 171
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qw8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qw8A02
2CPUA 4J3UA 1E1EA 2DPEA 3AZTA 5GNXA 3TTQA 1RPKA 1DWGM 2QPSA 1WKYA 4PUDA 4W8AA 1J0HA 4YPJA 1F4AA 1V02A 3BMWA 1V6XA 4PCSA 4DUVA 3ZSSA 5IFPA 1V02E 4J3WA 4OBSA 3CLWA 1UA7A 3WUGA 3L4VA 4AD3A 2XJ7A 5HDRA 1X6NA 3D4YA 5E6YA 1BFNA 1XCXA 1QVBA 4YHGA 3WDQA 3CHEA 1JDAA 2VRJA 2FE0A 4GINA 4BQ2A 3PTMA 5HBFA 7A3HA 2WZEA 1HKJA 2BVTA 1KGXA 1WZAA 2OWWA 3SCSA 3WY2A 3QGVA 1ECEA 2EAEA 1PS3A 2D23A 4CCDA 1HXJA 1JZ4A 1JZ5A 1WDQA 3WUEA 3TTOA 3SUWA 4ACZB 2RGLA 3AHXA 2EACA 4HOXA 3FN9A 1FP9A 3ARZA 3AHVA 1UKSA 1ZU8A 2NT0A 3VD3A 1L8NA 3MI6A 3HG2A 1W3HA 4CCEA 2PWFA 1C3FA 1LL6A 3WQWA 5A69A 5E0FA 1WZMA 2V38A 1UR4A 1UH2A 1JYNA 1W32A 2J8FA 4GZIA 3ZT6A 3GXIA 2BNJA 3AS3A 1V6VA 3HU7A 2BY1A 1EQPA 5IFTA 2XYLA 2VURA 4N42A 3ZIZA 3S5ZA 3CUIA 4AD5A 5JBEA 3KLLA 2GJXA 3B9EA 2X05A 3PN8A 3F5LA 1RH9A 3MO4A 5E1QA 4W5ZA 2YA1A 1PIGA 1OD0A 1H3GA 1JZ7A 2YOCA 5A8QA 3QHNA 2WMJA 1NH6A 4WK9A 2YBUA 4ZXOA 4F9JA 4UQBA 3WDRA 1CPUA 1QHZA 2ZX6A 1D3CA 3CPUA 4BF7A 1QBAA 2VCBA 1O7DC 4AYSA 3TA9A 3W82A 3MUIA 1YHTA 1GONA 1E0VA 3U57A 3W6MA 1UWQA 4FNQA 1Q6CA 3POCA 5CPTA 2DQXA 3WH6A 5LA0A 3CMJA 3ZJ6A 4AD0A 3CUGA 3PZNA 1BAGA 2IGTA 2DH2A 1W1VA 1NOWA 3AMGA 3K8KA 1W3JA 1ZBKA 2RGMA 1UWUA 4HA1A 4D6FA 1KTCA 1K9TA 5E9AA 3SEPA 3MKKA 3VGBA 4IPNB 3SCPA 4URIA 3OGSA 3VIIA 1PAMA 3VMPA 1MXDA 2BHUA 3BVTA 2PB1A 2VTFA 4PMUA 1OGSA 2WMGA 3AOFA 3PTQA 3ARRA 1E6SM 3VIPA 1D2KA 1FA2A 3WY4A 5F7UA 3VO0A 2YDRA 2ZUMA 3FXYA 3SCWA 4UFLA 4OKDA 4JFTA 1A47A 1EHAA 3PZTA 4FF5A 1WPCA 1XSKA 2XN1A 3WDHA 4AEEA 4H41A 3OZOA 1IV8A 1ZBCA 2DSKA 3BVUA 2VRKA 3EJPA 3RILA 4OUEA 2J7HA 2NSXA 2A3EA 4JCMA 1YQ2A 2WB5A 1W9BM 4ATWA 4W7WA 1O7AA 5BXRA 1OT1A 4PYSA 3QOMA 3BVWA 2WANA 4CVUA 3SIMA 3AXIA 2VQTA 1UG6A 1CDGA 2J7BA 4QP0A 3VGFA 4LQ1A 3LXAA 5BROA 3MSDA 4QAWA 1ODZA 4JAWA 3PZMA 5I24A 3IJ9A 3HG5A 3T09A 1QHPA 1BPLB 2E4TA 2XM2A 1RD6A 5D8ZA 1G01A 1ITCA 3T0AA 4BS0A 4PMQA 4JHZA 5I5RA 3TTYA 2G3NA 1NWUA 5CPQA 3AS1A 2JIEA 1OB0A 1RP9A 3OLIA 2GFTA 4JZ5A 2VR4A 3ARWA 2XFYA 4PMDA 4AY1A 5HOSA 1E4LA 3OIHA 2J74A 1KR1A 3CZKA 4J28A 4FLQA 4E2OA 2YL6A 2J7FA 2Y8KA 2A3CA 1NP0A 1ZJAA 3MSGA 3POHA 2F7QA 3RM9A 3VOCA 2FYVA 1JG9A 2VX4A 1HKKA 4MNJA 4D72A 3SUVA 2D24A 3ZMRA 3PZQA 4DM1A 1PEZA 3PZ9A 4LX4A 1AVAA 1QI4A 1J18A 2IXUA 4XX6A 2VO5A 4KRUA 7CGTA 1TA3B 2CHNA 5JIWA 2GJXB 2UY4A 2CBUA 1EH9A 4W7VA 1N82A 1OT2A 1V0MA 1FP8A 2D0GA 1ZJBA 1G9HA 1UKTA 1UKPA 4P7OA 3SUSA 4IISA 4CD6A 2WVUA 4J3XA 4A4AA 2VX5A 3LPPA 3MUAA 1R34A 2WC7A 1IZJA 2BXYA 1E6QM 2PC8A 3FY1A 4RL3A 1J0JA 2EPMX 1J0KA 4ACYA 1U33A 4UQ9A 5A1AA 2IUZA 2VQUA 1V3KA 5KEZA 4UOJA 4AD2A 3PZIA 1JF6A 3UR8A 2ZUSA 1J0IA 4LYQA 4AZCA 4DWSC 1EDGA 2BHZA 3BVVA 4PCTA 5AYIA 1J11A 4XUYA 1C7TA 3EMQA 5FCZA 3WY3A 4CVWA 3AXHA 1GOOA 3LXCA 3LXBA 1BGGA 3CIVA 5DT7A 4GZEA 3W26A 3CZSA 2Y8VA 3AXXA 1HIZA 3IAQA 2YIHA 5HNNA 1QHOA 4U5KA 1CGUA 1QI5A 3AIEA 1B31A 4E8CA 4AD1A 3WQ8A 3UEQA 3W27A 1ESWA 5M03A 2XN0A 1XYFA 1B30A 1BYBA 4GQRA 5A8NA 5E6ZA 4IUGA 1UASA 1Q6EA 3GH7A 3W53A 2ZXAA 2OYMA 4AISA 1BTCA 4PSPA 3DX0A 4U33A 1GORA 1R7AA 4DO6A 5DF0A 1Y7VA 4P7QA 3SUTA 3SUUA 2OLHA 3K46A 4N0RA 1MFVA 1QW9A 2ZXBA 1DWJM 2JEQA 2EJ1A 4NSBA 3A21A 2V3FA 3WMSA 5I79A 5M5DA 1ZB5A 2DT1A 3H55A 3QR3A 2A3HA 3EYPA 2ZX8A 1EIBA 3W25A 3ARTA 3AIWA 2J7EA 4CD8A 1VEOA 1VEPA 1JZ8A 5EB8A 4Z2JA 3B9DA 5FIPA 1HVQA 2XFFA 2YL8A 1OWQA 5A3HA 3PZVA 3NSXA 4E4PA 4HMEA 2EADA 1CYGA 2XTKA 3EMZA 4HMDA 3WQ4A 2V5CA 1BG9A 1W9DM 4MDPA 4V28A 1UR0A 3S5YA 2VCAA 2YL5A 2NT1A 2D73A 3DYPA 4DUWA 2Y5EA 3VD5A 2YKKA 1PBGA 3BXWA 1CENA 2WZIA 4TTUA 1U2YA 1ZS2A 2V3DA 2DDXA 2ZXQA 1JNDA 4WKFA 4JFWA 2WVSA 2EO7A 3BAWA 2XSAA 1MQRA 1G94A 2WMIA 4AMCA 3SCOA 4W5UA 2YL9A 3VGDA 5KZ6A 3A4WA 1HJVA 1G0CA 1GJUA 1E4NA 1TQVA 3AYSA 3CHCA 1HXKA 1LF1A 4UQDA 4OOUA 1MW0A 3WY1A 2VVNA 1XC6A 1G5AA 3GXDA 2ZX9A 2OW7A 1K9DA 3ZR6A 3OLGA 1VRXA 1CXLA 3FHQA 3WELA 1CIUA 4DO5A 3VMOA 4AXNA 1R85A 2QLYA 4M56A 1V0LA 4KGLA 3A47A 1U30A 1ODUA 2WM0A 3CC1A 1JAEA 2O92A 3BSHA 1NOFA 3SCQA 4JKKA 4FNUA 3WBEA 4UFHA 1XH1A 1H11A 4HPHA 1MW3A 1C92A 4F8XA 4KMQA 1QI0A 2F2HA 2F1AA 3WH5A 4AZCB 3VSTA 3RJYA 5A6MA 4DUXA 1BLIA 1B90A 3I3BA 2OYLA 4AMWA 3BUPA 3SCVA 3VIHA 3WUBA 1DWFM 1J12A 2EQDA 4MB1A 3PHAA 3WNLA 5AY7A 3WMBA 1L0PA 2CBIA 2GJPA 1NM9A 3D50A 4PRWA 4KRTA 3DDGA 2DT0A 4V27A 3MMDA 1ZL1A 1VJZA 3VUPA 3VD7A 1CGWA 4M29A 1KGWA 4RE2A 1TQWA 4B9YA 4KWUA 1VFMA 3CZEA 2WBKA 1EHNA 4XZBA 3VIGA 2WW5A 3MANA 2ZWYA 5BXTA 1DWAM 4MNKA 2DT2A 4NZCA 3G6LA 3W81A 3SCUA 3IK2A 5CGMA 3W38A 4MAZA 2CKRA 1UR1A 4TTGA 2QPUA 3O2LA 4EK7A 4PMNA 1FFRA 1UA3A 4W85A 4MDOA 3TP4A 3AZRA 3HZ3A 2PBOA 3DX3A 3B9AA 1J0YA 4HMCA 2ZUWA 2EPKX 3D3AA 3TOPA 1KWGA 4PSRA 3HMCA 1D7FA 1CXHA 1R33A 1H0GA 2J4GA 1GNXA 1QNRA 1P6WA 1R7OA 2CYGA 4B3KA 3GH5A 4M82A 4AZHA 3O6AA 2Y2WA 2V3EA 2GDVA 3ZO9A 1OINA 2WYSA 4XV0A 1E6RA 3N13A 4W89A 2WVVB 2VZTA 1CNVA 4DO4A 3BCFA 1TG7A 3DX4A 3BSGA 2VX6A 1LWHA 4YHEA 3AMDA 4AWEA 3WMCA 3EJTA 4U3CA 1WNOA 3VNYA 1Z32X 3OZPA 1JXJA 3AMKA 3AIQA 1HT6A 2PWDA 2ZICA 1DP0A 2CKSA 1TE1A 8CGTA 2FGLA 1TQUA 4UZUA 1OD8A 3ARYA 1E55A 1CXKA 3TV8A 4CUCA 1UYQA 1F4HA 1V03A 4ZENA 4W8BA 4GPNA 4QFUA 3VIKA 3OBAA 2VZVA 3RO8A 2EPLX 4H7VA 1E6PA 2OWXA 3BAKA 1VAHA 3K4AA 3L4XA 2A3BA 1JFHA 3BUDA 3A4XA 4FNTA 1SR0A 4GO9A 1GVIA 2DSUA 1HNYA 3EDFA 4PMZA 3KWXA 2EBNA 1UHVA 4F79A 1Q6DA 2D1ZA 3AS0A 2CHOA 1OM0A 4PTMA 4A3HA 4P7RA 3FHAA 3W24A 1OBAA 3WH8A 1KB3A 2WAGA 1H5VA 4XZWA 3BMVA 1W9VA 3M46A 4OGZA 1GVYA 3RJXA 1HL9A 1W9UA 1B3XA 4MAVA 1KQZA 3VNZA 2GVYA 3VIFA 2PWHA 5CLWA 3F5KA 5AC4A 2JE8A 4E8DA 1BQCA 4JL2A 1IT0A 2XWEA 1MW2A 3CHDA 3CUHA 3D5HA 2OW6A 1UD6A 4CU8A 2W5FA 1QI3A 4UQAA 1GOKA 2CBJA 3AJ7A 3T08A 4TOQA 3W6LA 3M6DA 5DMYA 5EMYA 3IGUA 2WC4A 3HJEA 1C8YA 1E71M 1W2VA 1SZNA 1HP4A 4MNMA 4MB5A 3I3EA 2C0HA 5A6AA 4PTWA 2D0HA 4PMYA 3S6TA 3WN6A 2FH8A 3HN3A 3WF4A 2X2IA 1OGGA 3RIKA 4P8UA 4TVCA 4OIFA 1UOKA 4QCEA 2GK1A 1WZLA 3AQUA 3A5VA 3ECQA 1M04A 5A6BD 1ITXA 3CMGA 2WSPA 4D1JA 3LX9A 4HTYA 2WXDM 3K8MA 1XGZA 1J0ZA 1W91A 2QF8A 1W9PA 3RCNA 3UESA 1SFSA 2JF7A 3CUJA 4M8UA 2BY2A 1KQYA 1E5NA 3TONA 2FGZA 2YLAA 1GW1A 1ZBWA 1MQPA 2XPKA 1NWSA 2FHFA 3JUGA 1V3JA 1M03A 2F8QA 3GDBA 3U5YA 4B9ZA 1C90A 5GPRA 2XFRA 4FLRA 4JFVA 2OYKA 1ISVA 2WHLA 4NF7A 3GTNA 1PJ9A 3CZLA 3WQ5A 4S3JA 2BFGA 4GO8A 1GJWA 2W62A 2YDSA 5HXMA 4NX0A 4S3KA 1JD7A 4PMRA 1AQ0A 3N11A 1GZJA 1TVPA 2BY0A 2WLYA 1HJXA 5ABFA 5M3WA 3BCDA 4PMXA 1LQ0A 2E40A 3HG4A 2XIIA 3WH7A 3WEOA 1QPKA 2XVKA 1CLXA 1VFFA 1XH2A 3VDAA 3ZSTA 2W67A 5BRPA 7TAAA 1E3ZA 3KL0A 1NQ6A 2E8ZA 3E1F1 3ZR5A 3BLKA 3U7BA 2IXVA 2VC9A 4AZ7A 2F18A 4UR9A 1VIWA 2AAAA 1UR8A 2JEPA 2VRQA 3CO4A 5EFDA 4AZGA 1JNEA 3UG5A 4U3AA 1HL8A 3DDFA 4CD4A 4D71A 1HJSA 1US2A 4HOWA 2E9LA 5A8MA 3L4TA 2XHYA 4RE4A 1GQKA 1SMDA 4PTXA 4CCCA 2WCGA 2XGIA 1HWWA 1E73M 1QWUA 1KXVA 4UFKA 1EDTA 3WD0A 3IJ8A 2UY5A 1HJQA 3EDEA 4L4OA 3WEZA 3ZJKA 3T2OA 4UFMA 3I3DA 1GOQA 1HX0A 2G8ZA 1GQIA 4TUFA 5BXPA 4JIEA 2VZUA 2VJXA 4UCFA 1JZ3A 1FHDA 1J10A 2NW0A 2DIEA 1E56A 2ZXDA 2V3GA 1V08A 3BC9A 2OSXA 3OB8A 3WFLA 5A94A 1KCKA 4NXKA 2CERA 4X0NA 3WL0A 3FAXA 4MJ4A 4Z2IA 1VBRA 1NARA 2J25A 1BGAA 1DTUA 2O9RA 3BAJA 3T2QA 1CLVA 3LMYA 1CEOA 1KXTA 2VR5A 3VDCA 3IJ7A 4LPCA 3H54A 4Y7EA 1W1YA 2YA0A 4AZ6A 1PX4A 1VFUA 3T0BA 3DYMA 3DX2A 1CECA 5DO8A 3ALGA 4JKMA 4QDMA 4U5IA 2OSYA 3WNKA 1VF8A 4WIWA 2O9PA 4CU6A 1V3IA 1WE5A 1CZ1A 3ARSA 2MANA 4EKJA 2XVLA 1QOXA 4NZJA 3ZT5A 4B15A 3WDPP 2Y4SA 3L2MA 4AIOA 5E09A 2D3NA 2Z1KA 2DSZA 3AS2A 3PZGA 4BQ3A 1E5JA 3WQVA 3OA5A 3NDYA 4MB3A 3N15A 2E0PA 3QOKA 3U5UA 3NSNA 1ZBVA 4AIEA 3T0DA 3WIJA 4OZOA 1JDDA 4GIAA 3GNPA 3DX1A 4AYGA 3VM7A 1TVNA 4QCFA 4H04A 2Y24A 2CETA 5JIPA 4ZFMA 4ACZA 3BLPX 4F9DA 3D51A 4HP5A 3N12A 3U7VA 4DWSD 2WBGA 3NUKA 2ZX7A 3GM8A 2WCAA 4CN6A 1GPFA 3WKZA 2G3JA 2PI6A 4BZYA 3LPOA 3MMWA 3L4WA 4GQQA 3WF3A 1V0KA 3W37A 1KBKA 2WZHA 3RMEA 4LYPA 2DSVA 2DGAA 2XVNA 1NWRA 4UFJA 4WJXA 4MTVA 1KXHA 4OBRA 2VVSA 4OJYA 1B3VA 2DH3A 4Z2KA 1UWSA 1TFVA 1XRVA 3A6OA 1PZ3A 1JF5A 1GQLA 1AQMA 1JGIA 3VIMA 2WWDA 8A3HA 3CGTA 1QW8A 1T0OA 3W0KA 4P8WA 3A23A 4W7UA 1R87A 4NI3A 3AICA 3N18A 1E3XA 2ALWA 1EDQA 4YN5A 4ZE4A 5HPCA 3VPLA 1BSIA 2X1IA 1PPIA 4PEEA 3MU7A 4TXEA 1B9ZA 4R27A 1UH4A 2EEXA 3GNOA 2HVMA 1EXPA 5A2CA 2XVGA 4WKHA 1Q6GA 4Z2LA 4AZ5A 5I0DA 3APGA 3FNDA 4BQ5A 4PTVA 1JIBA 5JBDA 1ISWA 2FHCA 4PBGA 1DWIM 1E4IA 2XG9A 3N9KA 4ATLA 5A6JA 5I6SA 4HPGA 4UTFA 1SMAA 3OGVA 1GOMA 1R47A 1PX3A 2D2OA 1HN1A 5D9MA 4J3SA 3WH9A 2XM1A 4JFSA 1E72M 1WCGA 3ZJ7A 1BYCA 1NP2A 1R75A 3QHMA 2W91A 1W3KA 3AHYA 3VIJA 2J79A 2G4FA 2WC3A 3THCA 3KL3A 3ALFA 4KH2A 3AROA 5CGTA 2DT3A 1OIMA 1BHGA 2F61A 2ZWZA 1JXKA 3AI0A 1E9LA 3KLKA 2E9BA 3CV5A 2OSWA 2X09A 4C7GA 3WNNA 5CG0A 2XVPA 5A95A 2XUCA 1QNQA 2PWGA 2D20A 4LYRA 3W28A 1UQZA 3VDBA 3IAPA 3CH9A 3UETA 3BLBA 4BQ4A 3PZUA 3VGEA 2CEQA 4ZXLA 5FL1A 1I75A 3BUIA 5ECUA 1CXEA 5CLTA 5AC5A 3DHPA 1MXGA 1VJSA 2YJQA 1DWHM 4M1RA 3THDA 4NRRA 5HPOA 1UKQA 1NOUA 4M80A 4CD7A 2VT0A 1E40A 2X2HA 2VI0A 5IHRA 2XN2A 2GJRA 4HZ6A 4B16A 2C7FA 4U31A 1WZKA 2WCSA 4RE3A 4AMXA 3CZGA 3KE0A 2DSWA 2VCCA 3CZ8A 5C70A 1HP5A 6A3HA 5CQ1A 1KXQA 3RM4A 4UNIA 3WNOA 2E3ZA 2ZUUA 2UY2A 4BA0A 3MMUA 2BVYA 1CXFA 3AIUA 4BCEA 1V6UA 2YLLA 2XGBA 1QWNA 5IDIA 1V3HA 4X0VA 2EPNA 4AIUA 1I1XA 3II1A 2FH6A 1SYTA 4MPKA 2W61A 4QLLA 2W63A 3EDKA 9CGTA 3ARPA 3LPGA 4HA4A 2ZX5A 4GI8A 5EBAA 3VKKA 3WL1A 1OCQA 1EQCA 3LRKA 1H41A 2ZUNA 1ISXA 4FK9A 4DWSA 4QLJA 3N04A 1ISZA 4F66A 2VL4A 3OG2A 2GUYA 4UOQA 4CU7A 2B31A 4TX8A 1G1YA 4NRSA 4WSKA 1BVZA 1KTBA 4TVUA 1JZ6A 2UWFA 2PWEA 2TAAA 1H4PA 2X0HA 2J7DA 5D8WA 3M07A 1JFXA 5FKYA 4C7DA 1XCWA 1EOMA 1S46A 1MVYA 4UZSA 1EGZA 2J77A 2CXGA 4JL1A 3WBAA 2YA2A 1B3YA 4M24A 1HKMA 3LRMA 2V5DA 5LA1A 1JYVA 3EMCA 1JI1A 3UERA 1TA3A 3VDHA 3VX1A 3VGGA 3WNPA 2JIWA 1CWYA 5GNYA 1V6YA 3L4ZA 5BWFA 5I78A 4HZ8A 3PBGA 5D9OA 3WDIA 5A8OA 1AQHA 1E0XA 2QMKA 1A3HA 3A3HA 1MFUA 1H0IA 2WMIB 4MJ2A 4J7RA 3WF0A 4EAMA 1UH3A 1UQYA 4PMOA 1HKIA 1FOBA 1QI2A 2VMFA 4W86A 2G41A 5CZKA 2J75A 1XD1A 1R8LA 3BGAA 1BVNP 1FHLA 2WMKA 3KEHA 1UR9A 3OLEA 1QBBA 5A6LA 4K68A 2GSJA 3VILA 1W1TA 3SURA 3VSUA 4P7LA 2EXOA 3ARVA 4WF7A 1TZ7A 3WF2A 3AFBA 2HISA 1QNOA 5A8PA 2XWDA 1TCMA 1UD2A 3VGHA 1B3ZA 1W9XA 2WHJA 2WNWA 3GYCA 1CTNA 1WP6A 5BXSA 1J9YA 5ABGA 2F7PA 1Q6FA 4AEFA 2CIPA 4GKLA 5IHSA 3CHFA 3DC0A 3A4AA 1TUXA 4P8VA 3WNMA 2FHBA 3G6MA 3VSVA 4W93A 2CNCA 3ZT7A 3ZOAA 5GNZA 1M7XA 3VMNA 2QMJA 2VNCA 1XYZA 3AYRA 1LWJA 3WD2A 3VVGA 5CJ5A 2WK2A 1JD9A 2O9OA 2BHYA 1C91A 5D4YA 5FOOA 3ARXA 1UWTA 1CGYA 4PN2A 1JYWA 3K8LA 4FLSA 2BXZA 1B0IA 3AHTA 2F7OA 1UKOA 5CSUA 1ISYA 1GUVA 3W29A 2PBGA 1KGUA 3CUFA 2X2YA 4D1IA 1E15A 6CGTA 2QHAA 3WF1A 3EJRA 3M7SA 1IZKA 1TMQA 2CITA 4JCLA 1UZ4A 2ZIDA 2WMHA 2VOTA 1V0NA 4D6HA 2WVTA 2ZE0A 5BRQA 1W1PA 4IM4A 3K1DA 5A6SA 1E6NA 4CKQA 3MUZ1 2DEPA 3EDDA 5LYRA 1H09A 1HJWA 2DIJA 4AZIA 1UZ1A 3MUY1 2JALA 4J3TA 3BAIA 1US3A 1J01A 5JBFA 1DHKA 4MADA 1UR2A 3A24A 1MW1A 4A3YA 1E1FA 2WSKA 2Z1SA 4HOZA 3GXTA 1XSJA 4H8VA 1BYDA 2XIBA 3AISA 4OOZA 1UD5A 2X0YA 2ZOXA 5A2AA 3BAXA 5C8BB 4H8HA 3L4YA 1R86A 4W8LA 1BG4A 4AD4A 2OWCA 2ZUTA 2Q8XA 4WKAA 1JI2A 2D3LA 2VUYA 4UFIA 1V3LA 4DWSB 3WENA 4W88A 1X1NA 5LA2A 4GZJA 1EO7A 3VD4A 3ARUA 1DEDA 3RPMA 4QLKA 4EANA 1UUQA 2F7RA 3EBVA 2W4XA 3F5JA 5AYBA 3UG3A 3L4UA 1XH0A 1LJYA 3ARQA 4L4PA 1C7SA 3WD4A 1LG1A 3NJ3A 3SCTA 4CN1A 1Q4NX 4TVDA 4D6IA 1HVXA 3WSUA 2WPGA 3CZNA 5D9NA 5A6KA 3WFZA 4FNSA 1C8XA 3NDZA 1BYAA 2J62A 3L2LA 3VU2A 3OGRA 4GI9A 1FH7A 1RP8A 2YBTA 1WB0A 4IPLA 1CGTA 4D6CA 3OLDA 1PZ2A 2D22A 3AMCA 5BYWA 2J47A 1I1WA 4CN4A 2VX7A 5IXEA 2CBVA 1O6IA 1H49A 2WMFA 3K4DA 5ABEA 1HTYA 2AMGA 1KBBA 1H2JA 3AHZA 1HF6A 2EPOA 2WKGA 3EJQA 1NWTA 4FNPA 2WKLA 1K9FA 1R46A 2A3AA 1OSEA 3H53A 5I23A 1XHGA 2J7GA 1AMYA 1V3MA 3T2PA 3CBWA 3MS8A 3N17A 3WD3A 3AIRA 4J3VA 1GCYA 4FMVA 3FW6A 4W84A 4AW7A 4P8XA 1LLOA 3W4RA 2BY3A 2CCRA 3ZJ8A 3D52A 2D0FA 4CGTA 3AIVA 4M81A 3WD1A 3CZJA 1UWIA 5E0CA 4NZFA 1KFWA 2X8RA 1LG2A 4UQEA 3NCOA 5DT5A 1XD0A 3GXNA 4EE9A 1KR0A 4D6GA 5GQBA 4X9YA 3F4VA 5D9PA 5ABHA 3TTSA 3VM5A 2WHKA 3B8SA 3EJSA 4NXSA 1PX8A 1VENA 1QX1A 1CXIA 1JDCA 1E6ZA 2JF6A 3NIYA 3QHOA 3S2CA 6TAAA 4FNRA 3UG4A 3MV01 1LL7A 1HJUA 3GZAA 1XSIA 3J7HA 3GBEA 1GHRA 4UQCA 5A6BA 3BUQA 4HU0A 2WLZA 1E70M 4FLOA 3SCRA 4D6JA 1JZ2A 4B3LA 2XSBA 1B2YA 5I77A 4H2CA 1H1NA 3GXFA 2UY3A 4Q7NA 1LL4A 2GK1B 2YFNA 1GOWA 5DEZA 4HU8A 2YFOA 3GH4A 2G3IA 5E70A 1TQTA 1WDPA 1MQQA 2J8GA 4J27A 3LRLA 2CESA 4Q22A 1VB9A 5A2BA 1GHSA 4D6DA 3VIOA 4MB4A 2E9MA 1FFQA 3AMLA 4UOZA 1E0WA 3DHUA 3RDKA 3PTKA 4GI6A 1K6AA 1BF2A 3CTTA 1MYRA 2WVVA 3ZM8A 4W87A 4Z2HA 4TX6A 2WWCA 4PMVA 2J7CA 1M53A 3AIBA 5DFAA 1GQJA 1UD3A 2EABA 4XB3A 1WAWA 4P7NA 3VX0A 2ESCA 1E43A 1E6XM 3WQ6A 1JAKA 3A22A 1E4MM 1EA9C 5CXPA 3AZSA 1W3LA 3SCNA 1CGXA 4AC1X 4D6EA 1MWOA 4ML4A 3VD9A 4H8UA 4ZEPA 4MNLA 5ABFB 2F1BA 4C7FA 4WSJA 1C8QA 4DM2A 2W66A 3WEMA 1OIFA 1CBGA 1VFOA 2BS9A 4U2ZA 3BVXA 2GDUA 2C8NA 3PZOA 2AOSA 4HA3A 2E8YA 3KL5A 3WUFA 1TQSA 4LXFA 4ZE5A 4U2YA 4JHOA 3LPFA 3ZQ9A 1FH8A 1JL8A 1EOKA 3UR7A 1TR1A 2J78A 2O9TA 1V6WA 1EO5A 5CPSA 2VZSA 3KZSA 2G3MA 1UD8A 1UD4A 1QNSA 3FAWA 1XV8A 3RM8A 1KWKA 1PIFA 3GNRA 3GXPA 4PUEA 2BVDA 2BV9A 4JKLA 3GXMA 5EFFA 5M17A 1W2PA 5JUVA 1GOIA 1K9EA 3BUBA 5CSYA 2X2JA 1UWRA 1QNPA 4LGXA 3VINA 2FDMA 5I2UA 4ATDA 1WDRA 2PF0A 4R5EA 5C71A 3EJUA 2VZOA 3GBDA 2QV4A 1M01A 2JFEX 5BCAA 3O9NA 4AZBA 3VTRA 4GXPA 3BH4A 5FL0A 4V2XA 1VEMA 1X6LA 3EDJA 3NYDA 4HZ7A 1FH9A 1WDSA 5I3DA 1JYXA 1B3WA 3NSMA 3HG3A 5TD4A 3WDJA 4JFUA 3N1AA 1C93A 1VBUA 2WHMA 3DECA 4WLCA 4KGJA 4CD5A 1WO2A 2ZUVA 3BAYA 3DYOA 4Z2GA 2W92A 3UCQA 3IANA 1OGBA 2YDQA 3MV11 1CGVA 1KCLA 1B1YA 3D4ZA 5FD0A
chains in the Genus database with same CATH superfamily
1K4DB 1U8HA 4WTZG 1E5AA 1ONWA 3TTQA 4DRSA 1SFTA 1GKPA 3EWWA 1EX1A 3U9IA 1CQYA 4X99A 3WXWL 2V2HA 5LO7A 3TH3T 3CLWA 3NJXA 3MUJA 4ZFOA 3F65A 3LSOA 4AD3A 1M5WA 2AQWA 1C5CH 1G1OA 3NJJA 1YEJH 2VRJA 3B7YA 3SPCA 2PURA 4QE1A 5AWNL 1KGXA 3QGVA 3VJ6B 5BS0E 1BXVA 3L0KA 3C3NA 4PH8A 5IWLA 1PFOA 3WUEA 3TTOA 3AHVA 2MUCA 2NT0A 1N5AB 2PWFA 1C3FA 4LLUB 4CBZA 1SLXA 4RDYA 4P2QB 4MYPA 4XP1H 1T5XA 2WUBH 3QO1A 3MUHL 2I27N 1X7FA 4PLOB 3HU7A 5AW4B 4HF5H 4M8VA 3C60C 3B9EA 5E2TL 4XMUA 1JZ7A 6ALDA 1W0YT 3QZLA 2EKJA 3QAZB 2PTZA 1M6UA 1F4XH 1LOQA 4F9JA 1TZHB 1EQWA 3SO7A 5J6GA 2QNEA 3PFRA 3RIAK 3W82A 5I0YA 1L5GB 1INEL 3W6MA 2BX5A 4JTJA 5F93C 1QRKA 4NGHL 3CMJA 4KRPB 1IMHC 4WDXA 1M7PA 2DH2A 4IM8A 4L1DA 5JNYB 3K8KA 2PEVA 1VZWA 3EEZA 4JTCA 2I9UA 2V9QA 2ADJA 4O51B 3EYVA 3I6LD 1F45A 1CL7L 4FR6A 2ZNXA 4ZA0A 2W79A 4XNMB 5HHNB 2UWEE 3GO1L 3U2SA 2ITDA 5I5IA 2E9WA 1QO3B 4FF5A 3VC6A 5TFSH 1PO9A 3MVIA 1WOBA 3ATBA 4WR3A 4ODVL 4ZMAT 4PD4J 5F9OH 2I9EA 4OFCA 5CPMA 3O1NA 3ZU8A 2WANA 2HWGA 3NPXA 4W4OC 1DHPA 4IIBA 1DQDH 3UP1A 1IKFL 3M0KA 4M7KH 5D7IB 2GBVA 3L12A 5D7EA 4FA3A 1VADA 2PCYA 3EXRA 1QHPA 4XBGA 3HR6A 3T0AA 4FN0A 4GXVL 1CO1A 2B59A 1GJIA 3ATFA 2YLKA 5LHEA 1EB3A 1FL5B 5CCKH 1MFBH 3TYUA 1IT8A 3MX0A 4GKZA 4XP4L 3O11A 3RM9A 4I8DA 3VOCA 1KFEA 2NXIA 3SQOL 3C08H 5CJMA 2GWNA 2VX4A 3GMPA 2KZHA 5D1ZA 4RA3A 3OVQA 7CGTA 4I3SL 2PDJA 1RUKL 5CPOA 3KBJA 1AGCA 3W56A 3X1FA 5GSRB 4L6OA 3QW4B 1XYMA 1ZHLB 1SYSB 2WVUA 4CD6A 4APXB 4L2YA 3QAQA 1RKRA 3QQXA 2P24A 4AD2A 5LAPA 4DWSC 1UWGH 1U8MA 3IFOB 4O0QA 1S78C 3EMQA 3FA5A 1TIMA 4GACA 4HHHA 5BZZA 4XAGA 4JICA 2XJLA 5HYEA 3WHE1 3WEAA 3UW6A 2YIHA 4QYOA 4WEMB 3WO4C 5CJQH 4Z7VE 4G2AA 4PJCF 3AIEA 4XP6H 3UEQA 3QV7A 1OTSD 4UXDA 4GT7A 4FI8A 5KSVA 3OBEA 1RZGA 3B0VC 2ZXAA 4I4WB 2IS7A 2RHGA 1GSMA 4ONFL 3QQNA 1O7DE 4E68A 2W88A 1L7TH 3GKAA 2INZA 2A3HA 3TOYA 3U6XA 4AGNA 5T3ZD 5T1KB 3FZUD 4LLQA 1JZ8A 4UQIM 3K6OA 1BZ7B 1WHPA 3IJLA 3ILPA 1EZLA 4BA8A 4K23H 4U6XB 4MDPA 3KS5A 4NSKA 1NLBH 3E74A 3RL1A 1U3HB 3WLWD 5M1TA 4D3CL 3QY7A 4DUWA 2WWNA 4DESA 2WZIA 3C3UA 1DKWA 5HYJE 3TV3H 5C09B 3H21A 3NIDB 2VMJA 3QCVH 5E8EB 1OD9A 1SOXA 5IVXA 2HRPL 1I2OA 3SB0A 1HJVA 2P9RA 1MWAA 3PWUB 3LZ3A 2ZCLH 3K71B 4NJ9L 4N3TA 1TV3A 3QTPA 1W6WA 3UTSA 2NYYD 2FL5A 2VVNA 2CIKB 4PJ8A 2WNKA 2HS8A 4LSPH 5C92A 3TEZA 5I06A 4B53A 5LWYH 2EDTA 2HKAA 4M56A 4DZ5A 1U30A 1UGKA 3FFOA 1F8TH 2PGWA 2WAQA 3BFQG 3QJZA 3RTQC 2DQWA 4PGZA 3FOMA 2XZCH 4LF2A 2YD8A 4F8XA 1ZLWK 1RU9L 3ULVE 2O6EA 4HUWA 3G1VA 4AGQA 1XAUA 5AW3B 1FBIH 2REQB 4XMPL 2WXQA 3MMDA 1P5VB 3PWVB 1VJZA 1RK1A 5JDJA 3UCDA 2J4WH 5JH2A 2D7MA 4Q2ZB 2R2HB 1GK8A 3REQB 4KUCF 1TPWA 2D4DA 5EORL 5AKQA 3CK5A 4YL2A 4F2ME 2H0JA 4RNHA 2FO4B 1ZT1B 3T9WA 2RFXB 7ODCA 3M6YA 4M82A 3TH6A 4W6YB 5ENWB 1AIFA 4Y16B 2GI7A 4GQ9L 3RVUD 1ORQA 5HDBE 4A6YB 1OOAA 2XRAH 3PJXA 5FYJD 4MA8L 5HDLA 1E5BA 1N8OE 2VN7A 7REQB 4CSPA 4KQ3L 5IRPA 3VFWA 3IDMA 3N43B 3VXNB 4FG0A 4ETYA 4W8BA 4LHUD 3RVXC 2JF1A 1USZA 3DGCR 2OWXA 3ULSA 4KTEL 3EJYC 4WXYA 5KETA 4LASL 2YKLL 4MVAA 3FB7B 1NCIA 3PAZA 1IUZA 5AAMC 1Z44A 1OCWL 3UDWA 1DDHB 5DVKA 3FONB 1F73A 2WMPA 3ABLB 1OX4B 3GMRA 1KF9B 1FZJB 1JK9B 4MHHI 1FFNB 2OK0H 2OW6A 1UMLA 4RQQB 3L3OA 3S96B 3TEWA 4R85A 4MB5A 1KFBA 2PLMA 4LOUD 1J8HD 2Y5SA 4PLNC 5DRCA 1SJXA 1EGMA 1FE8L 1CUOA 1WZLA 1DLHA 1IU1A 4NO2B 4HSQA 2EPHA 3LI1A 4KWWA 5HWNA 1JPKA 4WI7A 1HXMB 4ZSUA 1D6EA 2YPIA 1Z3GL 1FZOA 5IBTL 32C2A 4MKMA 1I2RA 4I5RA 1M2OA 3B5GA 3T65A 4WKZA 3WFCL 3M1BA 2R1YA 5I18L 3I2CL 4DZHA 4O8AA 3D2UB 3TNNA 4HCDA 1ED3B 2KHAA 3CWOX 3AU2A 2E7HA 3K30A 1TITA 4LEQA 3M7OA 4ZQPA 4KHXL 1BQGA 3APDA 2ALAA 2MQCA 4AC4A 2C13A 1D7CA 5HXMA 4PMRA 1R5VB 1HJXA 1PDYA 4NO0A 4NUQA 4OV6F 4FFYA 1GYMA 5D7SH 1RZJH 5T1MA 2X2UA 3WTVA 4BKSC 3HLAA 4EOWL 4LLDB 4WO4D 3KL0A 1ADWA 3B0XA 4ZW7A 1BQSA 3EOBB 4NP7A 3NBNA 1TO4A 1UWXK 1WD8A 3EIFA 2VAAA 2GK0B 3DI3B 1IL1A 2A9NH 3N85H 3CLEH 3NL2A 1MEHA 1S1RA 2ZWNA 4WUUA 4UT9L 1SPQA 5T1JA 5FSEC 4LSVH 2X3CA 3QP3A 3K6SB 2ZC1A 2P1YA 3IPBA 2ZXDA 2UV8G 3THAA 1KCKA 1G4PA 3OXRA 4I7VA 4TOYH 1QASA 1ZSHA 3N6YA 1YEGL 4H5SA 2B08A 2FLMA 4O18A 4M8QA 4NM4H 5F7WC 2FMOA 3HE7C 4FIRA 3HFTA 2EILB 1C5DB 5IMLA 3H2QA 2O9PA 2GJ6A 1A5MC 4NZJA 2QPXA 3C61A 4G59C 3QH2A 3SHSA 4N6RA 2BCKB 2G2RB 2QQNL 2E0PA 4C1NA 1YYLH 4OD2A 3SQLA 1YEDA 2F53E 3MUUA 4DKDC 4K1GA 4QCFA 5D02A 3HFML 3KNBA 4OJEH 1S7RB 1GY1A 1M1XB 1A3XA 1HOEA 1C08A 4AC2A 3G5VA 4QHNB 3G0UA 1NFKA 4GY4A 5FW6A 3P8JA 1PZCA 1V51A 3V16A 3F7VB 4OJYA 4KK6C 4FABL 2DH3A 1GG1A 2RMNA 4BK8A 2WYTA 1QLEB 3UZEA 1TTCA 4A1RA 4MFDA 2YPVL 1EHKB 1FC2D 3AICA 4C6PA 3KHQA 3GBLA 1LM1A 4AQAB 3OZMA 5J4MA 5U7SA 1Q0EA 4NLHA 2X70A 3U9PH 2VFHA 5DO2C 3B8DA 3QZEA 3LEYL 3APGA 3FNDA 2P48B 2HRLA 3M7FB 5D8JL 5E5RB 1TJ0A 1XG3A 3EH4B 5CBJA 4YXHH 5MKGB 1HN1A 4K7YA 5LHFA 1YEHH 1NP2A 4TSAH 7PCYA 3CBJB 4L64A 1BD2D 2ZCHL 2QUUA 1RZKH 2X10A 1PAZA 5MENA 1M9SA 2GYSA 4WTQA 1GZ1A 2R9HD 2FBJH 3KLKA 4MZ2A 3S4TA 1U91B 2ZUXA 2G96A 2AZAA 2E09A 3IN2A 1S3KH 5AHFA 1XLEA 2VLLA 1EBAA 4GRLA 2JV6A 4B2DD 1XF2B 5ACMA 3TZNA 4GKTA 4TLKA 2BS71 1W31A 1CLYL 4I5XA 3L1OL 4JREB 3THDA 3USZA 4P46A 3GGWA 2MNRA 1ML1A 4B16A 4U31A 4N9BA 4H01A 2EYSA 2OLSA 2AV1A 2JIXD 4OGXL 3TW6A 2A6KB 4RGOH 4RRPA 3WQPA 4AUJA 4DCQA 3AIUA 1E9QB 4AIUA 3A4EA 4X0VA 3TBBA 2NQ9A 4ACTA 4HVBA 1SYTA 3UTZA 2D9QB 1Y5WA 4WJEA 1JHKH 3ARPA 1OABA 4DEUA 4C90A 1TVHB 4GK8A 1AQKH 1QSVA 2DWEA 3DKJA 1E7UA 1MDTA 2EIKB 2W0KA 2FDBP 2H0PA 4TX8A 4YAQA 3O6ML 3TBYA 3D18B 3OKYA 4YCPA 1TTQA 1KKRA 4DZIA 1MF2H 4KX8A 2HJLB 1Q9LA 1US0A 1W80A 4K3DL 5DLLA 4E9RA 4YDNA 3HG1D 4BSVB 2R0ZL 2ADIA 4OLVH 3TO4C 4XVUD 3LGGA 5DMIH 1F3DH 4KNTA 2GIYA 5GNYA 3ZHKA 4Q4EA 4C6FA 4GBXA 4MKTA 3ULUC 3BGJA 4CC0A 3VAVA 3WD5H 4UT6H 4K1WA 4CQ8A 5F2LA 3CS2A 4OCLC 2GSHA 4YHMH 2BP0A 1ENUA 3M0XA 4MLIA 3IRDA 1O7SA 3M43A 3LEPA 1RVFL 1TJIH 1ZOXA 2DZAA 2Q3OA 4HXBL 1DSWA 3QZOA 3VRJB 3L45A 3QI9A 5IB5A 4NZ5A 1PYWB 1W9XA 4G43B 4AEFA 5KYNA 2A85A 3IK4A 1VYRA 2FHBA 3TBSB 3D85A 5BO0D 4U1GC 4OGYH 1LWJA 4TULL 4BWLA 5C9WA 1QFUL 2I69A 5IMOA 1B0IA 3S5OA 2G5BA 3L23A 5HHXL 6FABH 3ZW3A 4A7TA 2CITA 4WI5A 2WJ5A 2BRRL 1LUCA 3UQNA 5CAYB 4O9HL 2QKFA 4YVPA 3ITGA 3EDDA 2HVNA 1J8KA 1FRBA 4F0KA 2Q7AA 5HQEA 1SDAB 4H0HB 2FJHA 4XXWC 1J01A 5JBFA 4PJGB 3DMMC 3V0SA 5DYOB 1JRHL 3A24A 1ACYH 2JI3A 2CCWA 4HOZA 1U8PA 2WTPA 4H8VA 3H7BA 1QDSA 1J5HA 4FTVE 4OOZA 1YNYA 3EBAA 4Y4FA 4XCYA 2V5MA 4W9LC 2ZUTA 2ZRWA 3CHRA 4UFIA 1IFHH 2BSLA 3MKCA 4DWSB 3SPVA 5HGDB 4GZJA 4YFLF 1A6VH 3CH8A 5FM5O 3QIUD 2VMCA 4KEMA 5KVGH 3VKJA 4OLYL 1OAXL 3V9EA 3KR3H 2DORA 3NJLA 4X9GA 4QD2E 1OK6A 3WO4B 3PV6B 1IBGL 5IQ9A 5HPMB 1IQ8A 1C8XA 4ZTYA 1BYAA 2HKHL 3MLVL 3NDZE 3BWWA 1RP8A 4N86A 4Z7UF 1PZ1A 5JXEA 4ICNA 3U4BL 3U0HA 5FW8A 1JPHA 1P7BA 1K9FA 1XCTA 3H53A 3DGGB 3MA7B 1RHHB 4U1JB 1OM9A 4YIQB 5KYUA 4I7WA 4UT7H 1Z9LA 2MPAL 5DU7A 5AFDA 5FM8A 4Z77A 1EX0A 1IBDA 2W94A 4KPHH 4DERA 3UJJL 2VDNH 1EAQA 3QRFM 1SJEA 4M93C 2VZ1A 4PJ7B 1VENA 1CGSH 3WE1A 2XN9D 3UC2A 2Q10A 1B0WA 1HJUA 1KCSH 3MLYL 4BXVA 4FLOA 1ROWA 2VSCA 3O0RH 5KBMA 3A9IA 1JWMA 4PYHA 1OD7A 4FJYA 5LGHL 1MUMA 1ILSA 3LY6A 4KKBD 3NZSA 3RE0A 1KGIA 2JLPA 3AG1B 3TR2A 4DP7X 1FNSH 1VGEL 3ZTNL 4ODHL 1MYRA 2B5IC 2PXYA 5IHZA 3WEXA 3MBEC 3AIBA 1NAMH 1X7QA 1GQJA 4M1GL 3P81A 3KDNA 2Z29A 1XVSA 3NZ8A 1M42A 2HVJB 4C47A 1U1UA 3CAKA 1EA9C 3RTQB 2YZ1A 3MNZA 4NYLA 3EYOA 1H1ZA 1S2EA 1OEZW 5C0RH 1BIHA 4HUUB 2R0KL 2A2IA 3VFVA 2CKBL 3BVXA 2GDUA 1HL2A 4O4WA 4JHMA 1YN6B 3V0FA 2N56A 5KYWA 4LU5H 5H37H 2Y2TA 3QIWD 2XZZA 1MEXH 4LS0A 2ZYRA 2R29A 1P4BL 3GKFA 4M7JL 1I8LA 3TGXA 3ESUF 4JPVH 1EP2A 1RERA 3RPIB 1IBHA 2F8IA 1KWKA 1MRCH 4U1KB 1TZIB 1NICA 2BVDA 4QWWD 2BV9A 5G2WA 5JPNA 1QR4A 1GOIA 1U8NA 4L4JA 4XH2A 1E1CB 2H2SD 3L7FA 4GNVA 4HS3A 1DBJL 4YHOH 5T1LA 1M01A 1EJOH 1EXUB 3TN0D 2HSAA 3T77A 1OSZB 2I56A 1S9VA 5BZDB 5DA4A 2EYTA 1AJ0A 1YDYA 3ZUCA 3I9GH 4UUIA 2DJUA 1B3OA 2W92A 4OJDH 3KAAA 2V2XB 3D4ZA 1F3XA 5E4EC 4E38A 3O3UN 1EA0A 4ZAKA 1RUPH 2WLMA 2YAQA 5HGAA 3V4VL 2DDQH 1H1YA 3QPXL 3C2VA 2NTFA 3FN0L 4PCSA 4RJEA 4MDIB 2X9YA 4OV9A 4LLMB 5DMKB 4YHGA 2F15A 2Z6FA 4UYQA 5E4OA 1NDMA 4XD6A 4ZDHB 2AVFA 4NNAA 5JU6A 3LLFA 2NZLA 4CCDA 3VFMB 4XPGH 4JFDE 1RUAL 1XKJA 1QACA 2H3NB 1MJ7L 5D5MF 3MI6A 4Z7IA 2VDRB 5A69A 3T78A 2WB7A 3RYSA 5I74C 5EFIB 1ANUA 4U1SB 1UH2A 4N90E 3BP7B 4GZIA 2IAND 3AS3A 3GAKA 4N42A 2Z1PA 3GZ3A 2NY0D 2D3JA 2BVOB 4QLRA 1TTUA 4OCNC 1TRIA 4JY4B 4Y9OA 1IGJA 2FLRT 2AV7B 3RKDC 3WDRA 4X4MA 2IWGA 5CS7A 1H51A 4FG6C 2JKNA 2A7RA 4R2GB 1O1ZA 3TA9A 2OJEA 3N06B 2B15A 1XDTT 1Q6CA 3U1PA 4LRSA 5BU6A 3W6YA 5LAXB 2B0SH 1J93A 3M1CA 5HI4C 3LKNB 1ZHBB 3VOJA 3KJ6H 3FN3A 1N8ZA 5KVEE 3GHUA 1LGVA 4GGHA 3QORA 3PXHA 3UAJC 4GABA 4HH8A 2R15A 5F7UA 4O17A 1KULA 4XE0A 4R96A 4PH6A 4WJ5B 2CDGA 5ESAA 2UVEA 3H42L 5I1KH 3CFCH 3UR5A 4QAIA 1FO0H 5I6LA 4YXLL 2AEQL 3EJPA 4MY1A 3MR9B 2J7HA 4X7TB 1ZRQA 1BZOA 2XKUA 5DHYB 4M8RA 4NWTH 4YX2L 3RJQB 3BVWA 1P0KA 4WCYL 1JGLL 3WKMH 2AMUA 3CFDA 4JNYA 4NO5A 3QDMB 1GIGL 3UVAA 5LNEA 4O1DA 4XO3A 4K8RL 4Q8OA 4WHYH 4WNSA 3V6ZB 3OAUL 3BZDA 1A9BB 5MHBA 4G1EB 2AC0A 5I6OA 4N2BA 2HS6A 3KGRA 43CAA 1WQVT 4DJDD 4V1YA 5EUKA 2JIEA 2ZP9A 2D03L 2Y23A 1BD0A 1NIFA 4X2UA 4KRNA 4NP4H 3MXVL 4I0PB 3LOWA 3SOBL 3OQEA 4RAHA 1I8JA 1DVYA 5JA9A 3BIKB 4PJCB 3CVBA 1S9XA 4F2BA 4LHJB 3ZMRA 2I5IA 1LD9A 5KANG 5ISZD 3HE7B 1CFVH 2VDPL 5CD3A 5T9CE 5JIWA 1OAUL 4YDVA 2COVD 2NX3A 5CEZD 4F2UA 4ZPVA 5TGBB 4AHOA 2BP3A 1N0XH 5IROA 5CBEB 1SGKA 4EVZA 1UKPA 3G5XA 3KPMA 4H8WL 3P93A 3QZBA 4KJYB 3WFBH 1H0DA 1QLRB 2XPGA 3O45B 1E6QM 3QXBA 3EF7A 3HHRB 3WTSA 5D1QC 2V5SA 2VW7A 5AHEA 5AYIA 2H1PL 4F7KA 1YADA 1SOKA 4HALA 3HC3L 1BZ9A 4OQVA 3MNMA 2RKXA 3W1AA 2PABA 2W0FA 3L9EA 2IGFL 2DWDB 3GUTB 4DOHE 4U5KA 3L3HB 2ROYA 4W81A 3P2VA 4AD1A 5EBMB 3NN8A 1KLFA 3ARDD 2XN0A 1B30A 2JI2A 3C0QA 3EB3A 2R0LH 2X7LA 1AL7A 4G5ZH 3J07A 3RWIA 1WUFA 1R7AA 1JWUB 2Q2EB 3VFUA 1MFVA 4O4YL 1KB5B 2ZXBA 3E0GA 4KWOA 4LGPB 1H9VA 2EP6A 3NK4A 5I79A 4IJCA 3SRDA 5I1HL 4UQ3A 4XZ9A 2VC6A 1MEIA 5FIPA 1XYBA 4G7VL 1OWQA 1CCZA 3ALPA 1AD9A 3CH0A 5DUBB 4X7EC 5J8OA 1UR0A 4OGQC 5SWSA 1CB2A 2QSCL 1VZHA 1OP9A 3KPTA 3KWTA 2JB6B 1T1XA 3UZQA 2DLTA 3T1WA 2P0OA 3EOYG 3KX6A 4PJ9A 3I50H 1TSHA 5EO1B 4UMCA 4FQCH 5GJSL 3R6IA 1KMGA 5FWQA 3ZR6A 1MH5B 3ONBA 2VFGA 3D09A 1CIUA 3WJWA 3VMOA 3BL3A 4XTRD 1A6TB 2OZTA 2Y63A 1I3UA 1YE4A 4Y1AA 2JKJA 1FYTA 2KDGA 2DZTA 3ZQWA 4FKEA 3L9BA 1JK8A 35C8H 1UPMB 1GWJA 3ZKQD 4Y5VC 3C87A 5GGRA 3VIHA 3FO0H 25C8H 4NZTL 4I3GA 1LNUB 2PTTA 3FGCB 3SN1A 3QISA 4X2RA 4BZ2A 4OZ4B 1IBFA 2I16A 2BC4B 4HJWA 3V0GA 1VFBA 4DAGH 4RIRB 2EDYA 3EYSH 4GLRI 4ZS7L 2YAMA 2HKFL 2YR3A 5DCEA 3STZA 3MXWL 4I5BA 1Z66A 3TO4B 5IJVB 2XA8H 3W81A 1XLBA 3LQZB 4WHTA 3ZL4H 4G1NA 3GHPA 3VXME 1SR9A 5C0JA 2VLRB 5BMFH 2IH1A 3Q0HA 4P59H 3KLAB 1WDAA 4IMLB 1I0BA 4TN9A 3V2AR 4ZFZB 4H6QA 3PL6A 1JN6A 3IVTA 1J05B 5CO1A 4UTWC 4IMDA 1R0MA 3F83A 1Q0YH 2Y2WA 3O6AA 1XLDA 1XISA 3D9AH 3DSNB 5HDQH 1IEWA 3O2WH 1DR9A 2P45B 3O4LB 5DD6A 1MHHA 2P5EB 2CZNA 4U1NB 3GI8H 3HUJE 1NCAH 3LYRA 3GK0A 1DP0A 1YPIA 2QSQA 1DQVA 3KLHC 4CNIA 1U8IB 2GEQA 1Z1WA 1E55A 1BDYA 4GW1B 4QFUA 2M1KA 4GUIA 4KKCC 5B1JA 3RI5F 4PJAA 1JFHA 5TDNB 4U1GB 1SR0A 5E4AA 1XGQB 3MJ6A 4B5WA 2BMKB 3NOIA 1QKZH 2Q2LA 3TBWB 4WAFA 3R7MA 4JJOA 1BBJA 1B3XA 2OKOA 4PR4A 5CZTA 1MCJA 4Y16C 5F7NC 3SY8A 2ADAA 4YBQC 1JHTB 1L0YA 4LP4A 1UD6A 3OJDB 1CZ8L 3DMMB 2XWCA 2A7PA 2J13A 4M02A 4H4IA 5KMYA 1XLFA 1BCIA 3EO1A 2WC4A 3HJEA 4NQED 4IHOA 5GRXG 3ZL1A 4OF8A 4XTDA 2CALA 5F1OB 4DP4X 2F8XC 4PRAB 1R3KB 1LK3L 5C0EA 3CUZA 5HK4A 5DD1H 1FN4B 4UU9A 2E27L 2WPBA 4V1DE 3KPRD 5I1CL 2CPCA 3RCNA 3P6LA 3NCMA 4MJ5B 3F2LA 1MFEH 4URTB 1KQYA 1HG3A 1BZDA 4OF0A 3BGGA 1ZBWA 4Y90A 2ACUA 2HH0H 3OHMB 4LLVB 4AL8H 2F8QA 5FPIA 4FHKA 2UX6A 3TN3A 1KCWA 1RJCA 4FMFA 3IDYC 3NIFE 3K81A 3KJ4C 2MEJB 2K4WA 2HLAA 4IMCA 1ETZA 2YXVA 1BFOA 1XQ4A 2OMYB 5FO7A 4RZCA 4AM0B 1X5XA 3PQYB 4X5QA 4U4MA 5JOFB 3FQWA 2ZYHA 2ICEC 3TWAA 1KG0B 2W67A 4G80A 2QQ6A 2EZ0D 3MYZA 1QHQA 3E1F1 4AT6A 4JEGB 4M93B 1FWWA 2Y0SA 5KSAC 3RCMA 3U1SL 3FUIA 1US2A 3MKVA 1OO2A 1GQKA 4IX2A 2FPTA 1F2QA 2KERA 1NCUA 3P67A 3MA9L 2WINB 2CO2A 4KW2A 4L4OA 1N7ML 4Z7QE 1EEPA 1U8QB 2OQYA 1U8LA 4EQ3A 3L1FA 1KN4L 5C0AB 3R8BB 1IAII 4K0OA 3QLLA 2XPYA 3PHOB 1KENH 4GFIA 4XNZC 2B5IB 3LDBC 3JUZA 3VA8A 2UUDH 4GAYB 3MBEB 4Z2IA 5T5FH 3GB7A 2QXWA 1BGAA 2CM6A 3O6KH 4G8AC 2YS4A 4AQEB 1LE5A 4EIGB 4JN1L 4EIBA 4NRZB 3KRZA 1XCQB 2YA0A 1S5VA 1C9WA 2UXGA 4BFIB 2EECA 1A5CA 1DEEB 3C2YA 1I53A 5AB2A 4E0RB 1V3IA 4HH9B 1D3GA 2YUZA 4QRPE 3ZT5A 3AUVA 5E09A 2TSAA 3THQA 1LEIA 3AGVA 4C6OA 3U5UA 4KIRA 3W7GA 5DVMA 2OMUA 4Y7MA 3LYEA 1K7EA 3VH8A 4JTLA 1A0QL 3EW3B 4QRQA 4ZNEE 4LCWB 5DWUL 2WBGA 5F3HA 4FI6A 3FO9B 3MMWA 2MWCA 5CMAA 3BYTA 2R51A 1G4TA 1CLKA 1KNOB 4M6NH 5EC1A 5ICZB 1K7FA 3S35H 1UWSA 4E42B 4JAMA 5C0BD 4JW3A 4FNLL 3N6JA 3RR4A 3W0KA 1U3JA 2VXUH 1X98A 5DJXA 4HUKB 4ATTA 3SDYL 3EO9H 3QYQA 3HV8A 1EGJL 2QCMA 3A6BH 5E4EB 4JO2H 1VGKB 3GR4A 5KG9A 3FCBA 3NSFA 2VLKA 2XWBB 3C5ZD 1U83A 1FWFC 2Z93B 5IKCA 1VS1A 5D7LA 3AALA 2ZYIA 2XUWA 1W3KA 1OAKL 2NY7L 3G6DL 3V75A 4DQWA 3T4YB 1NEZA 3AROA 2YEQA 4RAVA 5IB4B 4K15A 1GOFA 1FDZA 4M51A 5FV1L 5AVZB 4LVGA 2X09A 1H6EA 4CDGC 3HTWA 3VDBA 3CH9A 2CEQA 3B2UC 1ECZA 5I74B 1JGEA 3AU6A 3S1VA 3NL3A 3NM3A 3SW6A 1NUGA 3PLYA 3UZ5A 1CB7B 5REQB 5IHRA 1YEIL 2XN2A 4NT6A 4JD4A 1DVFC 1P0DA 4OJCA 1CFTA 1O12A 4KDTA 5DD3L 2BNRD 1YEKL 1CXFA 5LGJB 4LYKA 4XTIA 4LNCA 2FQIA 1A6UL 2J6VA 3N4EA 2C6QA 4D94A 4U1IA 3MRMA 1EVTC 4HA4A 3CFTA 5TE7H 4GI8A 1JV5A 4MTMA 4IU3B 1VFHA 5CEXA 1ISXA 4ORZC 3B37A 3O4OC 4HKJB 3LSCA 1YLVA 1KTBA 3F12A 2IPWA 4LLYA 4LL9A 3OYZA 3VXRE 3RX4A 2FAUA 4HWNA 3TN6A 2PW1B 1XCWA 4G5DA 5JQ9A 4JREC 1MVYA 1EGZA 1P69B 4RE0A 1A6PA 2RIKA 4IGMA 4XD5A 3EMCA 4WW2A 1ND0B 5A43C 4ZB2A 4HEPG 2IPFA 3D39B 4N20A 2NZ1A 5D9OA 1O95A 1E67A 3ZDYE 4HT1L 1MFUA 3CMOL 4J7RA 3VRLF 4TVPE 4PRIB 1AR2A 2VL5B 3N4AA 3WFHA 5CZKA 2OXNA 3STGA 1FA4A 3WN5A 5EZOH 5EZJA 2QJJA 3TC3A 1QRND 3D25B 1W1TA 3SURA 3LKRA 4ENED 2BM3A 2INFA 2G9HA 1HGYA 5E5CA 1SHXA 3HI5H 3VGHA 1B3ZA 1MCHA 2KPNA 4MDJB 2EAWA 4XMLL 3NSJA 1NBYA 1K02A 3A4AA 5IM51 2PCXA 3O8XA 4LE8A 1BFVH 5JH1A 2AK1H 2OL3L 2HDJA 3HZVA 5I1EL 4J9JA 3MJ9H 2DN7A 2CW6A 4Y4KA 4TNGA 2F7OA 1PKLA 3CUFA 1F8IA 3V6OA 5DZNA 3QUYA 2FDSA 3MHGA 4D8OA 2WHVA 1NBQA 1K4GA 4OZIE 3VQ1C 3M1OA 4O02B 1F4YH 3TM6A 4DKFH 3NZHH 3PJSA 3FB8A 1DHKA 1UR2A 3FUMA 2JTYA 5KS9A 2TYSA 1R24A 3ZDZF 4DJFC 1EFXD 4XC1H 5D1QB 1TWDA 3ZTCC 3RLHA 3GNML 4L3CB 4YVXA 3L0NA 2OXHB 5BV7L 4JDZB 4BUQA 4W88A 4KJQD 5LA2A 2RD0A 2W8CA 4FYQA 4EANA 3B9KD 4WI0B 4QQ3A 3Q13A 3RNKA 3ZKMC 4ZO7A 3ARQA 3Q5YA 3KXFD 4PBDA 3GIVA 1ZY9A 5ESVB 4MSWB 2ICWJ 4JBSA 1BJMA 4B6ZA 1W72H 3LNEA 3D3VD 5FUZL 1P4LA 2DQDH 4HDIA 1YEEH 5K9KB 4XXCA 2Z00A 1RQBA 1R46A 3DHDA 3N17A 3AIRA 1YNTA 5K3VA 4FMVA 5D6CB 4RDVA 5EZIL 4PJ5E 4PJEE 1PZ5B 1WWBX 4P5MB 2AVGA 3FS2A 3WD1A 4EDWH 3EBIA 1INDL 1CT8A 1KCUL 4UQEA 3NTCL 1LG2A 3ZHDA 1JBJA 1KR0A 4LF3B 5FSDC 2ESVD 5K9JL 3UBFA 2CUMA 4XCNA 2VZ3A 3U36B 5E2JA 2OJZH 4C4KT 2DM4A 3IMTA 5IBXA 4UMGA 1GHRA 3VB9A 4U4BA 2F54A 4EDXB 2OAAA 2A1WH 1GYAA 4Q9QH 2AK4A 4Q7NA 2IADB 3UZXA 2WV8A 2IALB 4N9OB 4AMKH 4X9BA 3X12B 1BAFH 1S9WA 5IMKA 4HHLA 2B81A 3PGDB 3ZZLA 3VIOA 4AHQA 1R0AL 3LKSA 4A7VA 1DO5A 2PRMA 1KGCD 1WFOA 3ZKND 5I7GA 4MZIA 2F58H 1IEHA 3TC7A 1E0OB 4P2OA 3S83A 3PSVA 1HHIB 1A1MB 2NUTA 5MEOB 1NBVH 9XIAA 2EABA 4GUHA 3BE7A 3CDCA 1YDPB 4P2QE 5AKRA 4N8PA 5CXPA 2K1MA 5I1GH 1PDKB 3U7WL 4DIAA 4JJ5B 4YNGA 2QKIB 4ZT1A 1RUQH 3O6CA 4Y5VB 5TF1H 2W9DL 4G8GA 2NY1D 3CVHB 2DZSA 4YWGL 4RFOH 1IAKA 3ARGA 4BQBA 1OC7A 4X5PA 2VDLH 3RJDA 2D3VA 2J72A 4QTGA 3PNUA 4U2YA 1IC7L 4LW7A 2GAZB 3HNSL 2ZRZA 3MRLA 2E6DA 2J88A 5FOJA 4WZHA 1I8KB 1AG0A 4L9LB 5ETUB 5KVFH 1R5WB 2ZSVA 2YCLA 4MX7A 4MF4A 4PUEA 5K9DA 2EDHA 5M17A 5E51A 3FQXB 2Q7YA 1XLAA 1JCNA 5D7JB 2N1KA 2PF0A 4L4MA 3EJUA 2O5YL 1N2RB 5D5MB 2EDKA 4BHUI 1RD5A 3DXAA 4G6CA 3IBEA 4G6JL 3NSMA 4AUUA 4JFUA 1EEUA 2BOCA 1B57A 3LB0A 4CD5A 2ZUVA 1AXTL 1J5IA 2LE9A 4D2NA 1FHVA 2GVJA 5ICYA 2Z2AA 2BZDA 2XX0A 4PJFA 4MS6A 5FD0A 4FOMA 1DIDA 4LANA 4FI4A 1A4LA 3Q37A 3S5LG 4W8AA 1V02A 1A5FH 2J2ZB 2OFQA 4PV8B 3KCWA 1CX9A 3S88H 5D7IE 3LCGA 2WZ5A 2EE2A 4AV4A 4GRWB 4BQ2A 3THMH 1DQDL 1UEYA 2BSRB 1XBRA 2PE4A 5I2IB 5DRNA 4JFPB 2XY1A 1EKOA 4ACZB 4KMLB 1GGBH 3W1PA 4JNZA 3M0VA 1SJAA 5TPWH 1EJRC 1W3HA 4CCEA 3BP4A 1I9IH 1YQVL 4XP5L 3LZNA 3AY4C 2YW4A 2WIIA 3FS9A 2J8FA 3OGOE 2VWEE 4JZOB 5HHQA 1F3JB 1QA9A 4WIQA 1LK2A 5FYKU 4AD5A 4N8VG 4CQCA 1GZQB 4O8RA 5D1ZD 2A9DA 3MJMA 2QZ5A 1QVOB 4GVGA 2K6YA 3OKNB 4EPKA 1OF6A 4HJEA 4XAKE 4KKLD 3S5LB 2I5YL 3W9DB 3C5JB 5BJTA 4TV6A 1X4XA 3M5YA 5LNUA 1J1XL 3HRPA 3VW3H 5ENLA 4IBWA 4KK8D 1K2DA 1MRDH 3GHTA 5SWZA 3P11L 4YHIA 5CP7A 3WLBB 5DTFB 1WTGT 4NQSB 2YAOA 3ZMEA 4DVOA 3IDYB 5DC0A 4N25A 2AQSA 3KJ4B 4N0FA 2C3GA 3PYCA 3SCWA 1ZMYA 3TMQA 2PC4A 1UJQA 4NC0B 5HVHC 3OKLA 1RAKA 3WDHA 4JOMA 2YEVB 5EBGA 3RB5A 4OU1A 4XWUA 1HKLH 2PCQA 1T1YB 2ICEB 5IVXF 3LEXB 4R2GC 4N8VB 2XTLA 2OMZB 4NAEB 2H32B 1DL7L 3VFTA 5ERWB 5KSAB 4JIPA 1CDGA 3DJRA 2G50A 3KCJA 2OTWB 1SY6A 3G08B 2CJUL 3LY0A 1P7QB 2YXOA 2AEPH 2J6EL 1BPLB 2XM2A 1J7VR 2QF7A 4HU3A 4MCYA 2X89D 1JFQH 4TYUA 3WFEH 1SJVA 3NVQA 3AS1A 4ELMF 2QEZA 3ARWA 1ZKAA 1W5MA 1UGNA 1MAMH 3CJPA 3DARA 4XBEL 4XNZB 4NM8L 3KTXA 3LDBB 3B7RL 3Q9PA 2A3CA 1DSFH 2H0EA 1V7AA 1LT8A 1KPUA 5C09E 1BQLL 1OTSC 1YEFL 2UXFA 2J8UE 4R90H 1KO0A 3LGDA 3MA8A 4KRUA 3KWWA 1TA3B 4L4VE 3EUUA 2WW8A 3W5NA 2QULA 3UTSD 2I5QA 4P2AA 4PJ8D 4Y1SA 3VXSA 5BW7A 1JPGB 4GVIA 2VQ4A 1LRQA 3LPPA 2BXYA 5DJZB 2YUVA 4P2CG 3FZUC 2E4FA 3HMJG 3JV4A 3HAEH 1JF6A 5CBAB 4FO4A 3OAZH 3W75A 4L2LA 1EDGA 2BHZA 3NH7H 4LLWB 2XTJD 4PJHF 1S7UB 1O5XA 1D6VH 2NY5H 4F5CE 1MCOL 3UGXA 4I0PC 1IR2A 2VE6A 5AZ0A 3FJTA 3JTTA 4FX5A 3KYNA 3ZTJH 4JTQA 1CD1B 1HQRA 2ED7A 4E8CA 5TQ0H 3QJHA 1PTAA 1AY1H 2HZGA 3KGTA 1EJWC 5LXXA 4Y2OB 2V69A 3LI0A 3KP1A 1H60A 3W2JA 1SUJA 4KUZH 5C2BL 4DK6A 4XISA 1Q0XL 1BTCA 5EOQH 4JGJA 5D55A 1AZVA 4JE0A 1WCQA 1T5AA 3UXFA 5IFHH 2EJ1A 3W1MA 1PY9A 4LUTA 2R8WA 4EX4A 5AW1B 3H55A 3IJHB 5DJCA 2AQRA 4CW1B 3ARTA 2C16A 3BKCH 1LOSA 4GUJA 2XFFA 1N19A 1Q9WB 4N2DA 3HURA 1RIUL 3C8HA 1FFPB 4RWHA 1QO2A 2Z35A 1EUAA 5EF0A 1SXSA 2Y5EA 2H26A 3OR6B 3BXWA 4V15A 4MQXC 4DJEA 1JNDA 4F48A 2FUQA 1QZ1A 4ERGA 5E1HB 2O4EA 5E0QA 1E8XA 4W5UA 3MGOA 1V77A 4RKAA 1KIPB 4EI6B 3K74B 1ME8A 3SCMA 1K8YA 1JQXA 5JW3H 1DVFB 5D1ZI 1EEZA 5SX5K 2WLKA 1JTTA 4AEIH 4F1SA 3E02A 3OU8A 1QBMH 4WOZA 1NOFA 2R1XA 4HQQH 3ARFD 2H8ZA 1XH1A 5I8CB 3S1GA 2EDMA 4H00A 2GQ8A 1X96A 4AZCB 3HHMA 2DKUA 4CQDA 1BLIA 1TIUA 5HI5D 2BWIA 3SCVA 3N2OA 3O4OB 3AXMA 3D69B 3HI6H 5L9DL 3OPZL 3LTPA 3P30H 3MV8A 1FXPA 4KRTA 4FZEH 4TSBL 5EMMA 2Y89A 1KGWA 3M88A 2YD1A 5IM7A 4S2SA 4YDKH 1YNLH 2G5WA 3BDYL 3CLFL 1DVQA 1Z69A 1WCBA 3FTVA 2WKOF 2BOEX 4R7NA 4XX1E 2V2TA 1UA3A 2PFHA 2Y3AA 3IIZA 1LLWA 2QJIA 4RW5A 4GW4B 1TQBC 4FFTA 2J4GA 4WNQA 1Z0MA 4QHRA 1GYLA 4FQJL 2TMDA 4KXZI 4PS3A 4QNWA 4KZDH 3GDKA 5T33H 3ZVIA 1LWHA 4FRWA 3MGAA 4LFHG 1HT6A 4LOUC 2WBXA 4FQIH 4NKIL 2AXWA 5E8DH 3EH3B 1W0VB 4NO0D 4FZ8L 1A5UA 4UOW0 1B5TA 1T8XA 1TPEA 1SYVB 3O15A 2YD6A 3AITA 4ZENA 1XAKA 2BOBA 1J8RA 1S5NA 3IU3B 5HNUA 3CBKB 4EF3A 2ZNWA 3N9SA 4WSGA 2VXVH 1AZRA 2VXQA 2FB3A 1G9MC 4KKZA 4HIJB 1CE1L 3DIFA 1S7TA 3FHAA 1QSFD 3WH8A 4E5XA 2G60L 2WSYA 4JRXA 3VI4F 1W9VA 1A4BA 3NYZA 2Q8AL 2K0RA 4HG4J 1ADQL 2UX7A 2GVYA 2CH8A 4MD5B 4WUUD 1PGRB 4PGEB 2JB5L 4HK0B 3WYRA 5I16B 4E0CA 1RPQA 3H4WA 4LVFA 3AXLB 2DYPD 2BDNH 2CZ5A 1KRAC 1E6JL 5EMYA 1I1FB 3ASNB 3WQDA 1OTUD 3DV4B 5FHAH 1IGFH 2HUHA 2J5LB 1BXXA 3IF1A 3QXWA 1HUVA 1MNNA 1D9KA 4K9JA 4WO4C 3T81A 5JPMC 2C4FU 3LKPA 1F07A 2GK1A 2GJ6D 1TETH 1M04A 3N1PC 4R3SA 4HSAC 5BVJA 3H2OA 2A6LA 4F2TA 5IESL 4X0KA 2FJKA 4PG2A 2JF7A 1PG7W 4MGGA 5D30A 3QWNA 1HK6A 1ASPA 4AWJC 2VDQB 1VKXB 1PKQA 2OLDA 3X13A 5I8OH 4BINA 4ORIA 2HP4A 4D7PA 3UZYA 5EF1A 2BO0A 2BSCA 4S3JA 3MOQA 4N0UA 1DE4A 3OSKA 1E8WA 1UP0A 1JD7A 1YDNA 3VD0A 1A7NH 4Z7AA 5EC2B 1X4ZA 2FTAA 5JHDA 3MNDA 4YN3A 3SQBB 1FL3B 3GHEL 4BFKA 1XH2A 1BEYL 4DN4L 2LABA 5GS1C 1DLFL 1E3ZA 2YXGA 5CP3H 3W7OA 1JV2A 4UR9A 1UR8A 3UO1L 4L29A 3KYMA 2FGBA 5K39A 4UM9A 1BBDL 1S8DA 1UCBH 3FFDA 1TCRA 1IM3B 3FT2B 1BKHA 2ZD0A 4DGYL 2BIQA 2X4RB 3C56A 1RBLA 3GMLB 4N28A 3UD6A 1OY3B 4GSRA 4JANB 1AE6L 4UWQB 3Q9QA 3LZOA 3CAVA 4C57C 2XNAA 3ASWA 5ID1A 1FNGB 5MEND 1AKJA 1QOKA 3MV9E 5A94A 1O7VA 2MJWA 5F1IA 3BO8B 4DO7A 1CLVA 2WCPA 3INOA 4E9WA 4Z95H 3OJ2C 4GRLD 3Q2VA 3IJ7A 4Q9RH 3T6QC 2P5NA 4CNSA 1F1GA 3IRPX 4S23A 4AZ6A 3LZFH 3QJXA 4R4FH 2PTDA 2GQ9A 2CLZB 4P46D 4HN8A 5I3JA 2BZNA 1BM3H 4ZSTA 4XCEB 4AIOA 3GTXA 4OJFL 3SO3C 1WAUA 4XPHL 4RX0A 2EIBA 2QVKA 1RSFA 3MTRA 1NAKH 1T7LA 2O1AA 3NUKA 4XC3L 4GD0A 5ADOL 3LPOA 4X80H 3WF3A 3W9EB 3MNWA 1RIHL 1YNPA 2PMZA 1MFCL 3SB3A 4KWSA 3NSCA 3FTGB 4HU2A 4M7TA 1AHMA 3EOLA 1EJVC 3UJIL 5G2NA 3K2GA 3NFNA 4X6CA 4QQUA 3X3GL 4TO8A 3QC0A 4TM9A 4KZ0A 4GBXD 1BSIA 1PPIA 3DX7B 3EG9B 5CIPH 4OLXH 2QS8A 4IKNA 4OD1L 2HVMA 1WS7A 1EXPA 5A2CA 3VFNB 2LLLA 1V6TA 2JQMA 5ACZA 1BQUA 2NNAA 1HYSD 5I6SA 2Y3NA 3S36H 3OGVA 2CKBA 4F57H 3IGAA 4F0MA 3ZJ7A 3WFDL 3P9MA 3JVGC 3GG1A 5DHVA 4XI5D 1EEXA 3QI9D 1TV8A 1P9MA 1NEYA 4KJWD 2ZWZA 1KIRB 5MEPB 2YD2A 1UZ8B 3D85D 3NWRA 1B4KA 4WK2B 3QQDB 4UNLA 2F74B 4BFGA 1Q94B 5ANMB 3W1QA 3BLBA 4XVUC 5CLTA 4OGYL 2PF8A 4O2CA 2DOCA 2VABA 3ZFHA 1A9EA 5HJDA 1ZDSA 1NGQL 5JR1H 4FQQA 2WNGA 6FABL 2FEDC 5ES4B 3CZGA 3NVDA 5C70A 2XBTA 6A3HA 1FLRH 4MHHG 3UBXG 2X4UA 3E6HB 5C6MA 4Y89A 5KJRL 3D06A 5IDIA 1FZMB 1KTNA 3LPGA 1MCPL 1OCQA 3GD6A 4UC5A 5D2TA 3N04A 4EVNB 3OG2A 4Y4FD 5CR8A 2GUYA 4MGXA 1G1YA 4A8RA 2ONEA 2Q01A 4WUKL 3CK0L 2FEJA 1JZ6A 5CJXA 1IFHL 1JFXA 3W76A 4YLBA 3PUCA 4H1LG 1I4NA 4ZUVA 1SW3A 1O5QA 2VUNA 1T21B 3ETBF 5ICUA 4JL1A 2LLEA 4U1HA 5LA1A 2WWKO 2VM9A 3HPZA 2VYOA 4HHGA 2FB4L 1WAAA 4HZ8A 4TSCL 1ONQA 3ZBMA 5HVHB 5FA4A 5EDXA 1E5CA 1ZEAH 5JXED 4DZ8A 1L9WA 1UR3M 2IFFH 3MRJA 4K94L 3UBXB 3OAYK 2PP9A 3NOEA 3BWZA 1BVNP 5F7LB 1PCSA 4LOCA 2O6FA 4JTGA 2HFEB 4ZFFB 4DIXA 3CX5K 1MQKH 1SGJA 4Z76A 2WNWA 3HMWH 2FTWA 4H9TA 5DT1L 4NKMB 3OKDA 3QIUC 1BVNT 2BB0A 3MRCB 1UXSA 2QPFA 3G1AA 3AAZA 3SDXA 1RALA 2XZQL 3HV9A 1CBJA 1V4YA 1CK0L 1QSEA 3P9LB 2BHYA 4H1LB 3HC2A 3OMIB 4OF7A 4G7EA 4YSRA 1R3QA 3N73A 1TMLA 3L68A 3WF1A 1TMQA 4MNQE 3X11A 4MASA 4PLJC 3HR5A 1GZHA 1ZXQA 2VDKH 5FEWA 1H09A 1UT1A 3GFXA 2RH0A 1B3IA 3BAIA 4RAUB 4B9GA 3VYNA 3MLZL 2C9XA 1MW1A 4ANXA 4WEVX 2PXYD 1E1FA 1VPYA 4UTAA 3T3PF 4LALA 3GXTA 5GXBB 3SGDI 2DQHH 1SMOA 3QA3A 4U7MA 1F05A 1DYSA 4R83A 1RPUA 4NOBA 3OG3A 5IQLA 4ISVB 4RMSA 4P9ML 2CGRL 2ILLA 3WENA 3H0TB 5C7XL 3ARUA 3BPNC 3TN5A 2Q1EA 3VFRA 3IAGC 1AXIB 2EG6A 2AGKA 4BSJA 1ICSA 3W2UA 3AREA 3CSTA 3V5FA 2OA9A 4HISA 3AFLA 2ZKHL 5BYWA 2CBVA 2XGZA 4QXUH 1L4IA 2B8OT 5B1AB 5D72L 3V5OA 1RFDL 2WKGA 3EJQA 4R8WH 3QFDA 1S5IL 5GRUL 4B7LA 1SSDA 3RNQA 3IJIA 3O3EB 3QULB 3DVNA 2GOKA 5IB3B 4UIKL 5FK9B 1SN0A 1I8IB 4M81A 4PJIA 4LSUL 1YMYA 1DQMH 3IETB 2ZXEB 1RZMA 3GSXB 4AZ8A 2V37A 2IDSA 5F6HJ 3TX4A 3D0LB 2JF6A 4LHUG 1GPOH 4IIQC 3J7HA 4HCHA 3CXHJ 4C54A 4AB4A 4ZAKD 5I77A 3UL4A 1KLGA 1YSOA 3WXVH 3QIWC 3V1HA 4A67A 5DEZA 2XLLA 1P7KB 3DCPA 1Q72L 1OADA 2Q7NA 5CKGA 1FHGA 2V7HA 3TN4A 1JOIA 3QZNA 5FJRA 4X5XA 5IQ7H 4CQ9A 1OYBA 3NR0A 2P8MB 4YTUA 3D6NA 1M53A 2TRHA 4DGUA 3W0WA 1XDJA 2P3ZA 1KCRL 4YS4A 5F72S 3TN0C 4ZUSB 2GW5A 1T04A 3NOYA 3M41A 4PTTB 4E6MA 1W3LA 1AGFB 1RZPA 5D05A 4AM0Q 1XINA 4C7FA 4OB5H 3ELQA 1SJBA 3PWNB 3URBA 4YYFA 4LHUB 2ICES 4HYWA 3EAKA 2E8YA 4MQ7A 3ROLB 1EHXA 1WA1X 4YL9A 2Y7QA 2QSTA 2HPTA 5F3BA 1NDWA 3MWCA 3CX2A 3VXQA 1RHCA 2AJ3B 2CO7B 3OR7B 4QNEA 5IEKA 5CPSA 1QWHA 4KX7A 2CLRA 2VZSA 4LVDA 1QNSA 3SSJA 5JO5A 4JCWA 1U3NA 1FV1B 1HC1A 4AC7C 1KJ2A 3VOGA 1TQBB 5EFFA 1K9EA 2CMRL 5TQ2L 3HPFA 3JWOL 5HMDA 3QORD 5BCAA 3DETC 1TV5A 3K6FA 3XISA 5FL0A 1VEMA 4P0DA 2QKIC 3W2DL 1ZTXL 4WLCA 3KPNA 4KGJA 1RJPA 4HIHB 3W7MA 3LMJL 3BAYA 4Z2GA 4JY5H 1J8HB 2NY0C 3R94A 2BK8A 3LQLA 1AFVL 4FXGC 3N4FA 5ITFB 4IOSA 3L3JA 4J3UA 5JW5A 4MA7L 5GNXA 1SHMA 2HG0A 1RPKA 4HN4A 4QJ3B 4H44C 12E8L 3MN8A 4ZQKB 1JNJA 3LNFA 1AI1H 5IR1B 2A0LC 3BPOC 2Z1BA 4L9LC 3SBPA 3NCYS 4ELDA 1OAQH 2EDXA 3SJNA 5T9BG 3SE6A 2WZEA 2O5ZH 1SO3A 4I88A 3C75A 2ZSWA 4GAGH 5D7JC 4WENB 5KYXA 4MY8A 3L1EA 5TDPB 4BF5A 1LL6A 2OCZA 2B4CH 3V0WH 4UTBH 3QFWA 3NEVA 2RAGA 3QHFL 3J27A 4PC8A 2X6UA 2DQIH 4D8LA 2BNJA 2XDFA 1KZYA 2BY1A 2R8SH 3ZIZA 6PTDA 3CSPA 4ZMVA 2X05A 4YDZA 3PN8A 1JPSL 5G2IA 1F56A 3GSOB 5J1AA 2FECL 2YOCA 4JHAH 4C6DA 1T66C 1RZFH 1ZAGA 3WLTA 4CC4A 4WO4B 2DMBA 2E7DA 3RZWA 5JPMB 3ULVH 3N1FC 5IROD 5D96B 2XXFA 3U0TB 1I85C 1KJ3H 3MBXL 1M7OA 3QM3A 1OXYA 2WZAA 1J9CT 2UZYA 1W1VA 1U22A 3GF8A 1NOWA 3TJHC 4GY1A 4OTXH 3M4HA 1KEGL 3SE8H 4DWDA 2FZ3B 4DJDC 3TTEA 2HSIA 2YK1H 1UEMA 4MXQD 4PM1A 5F7KC 2QQLL 4KTYA 3VIPA 1FL6A 3T07A 5L7XH 2FT8A 4ELMB 3JV6B 3O6LL 3QDGD 4NUGL 5I1JL 1ELSA 2YSSB 1HHGB 4OECA 1TIWA 1FORH 4FFWD 2H1XA 4XNDA 3LHYA 2OR2A 2Y72A 3KS6A 2VLJE 4LVOC 2JELH 5I1IH 5AB9A 5GS1B 2WB5A 4JN2B 2RDXA 2G3XA 1SVCP 3QSTA 2VMEA 4G7SB 4LJ3A 4MUZA 3IPFA 4LK4A 3HIZA 2VQTA 3SJVA 4QP0A 1F41A 4LESA 4X98A 1MCWW 1T99A 2GY7B 3HC0A 4K2UH 1AH1A 3SGKC 4Z5RB 3P2TA 1AO7D 1JJKA 2ZBTA 2FWUA 4URKA 2OQJA 4PJHB 2R0WH 3RIFF 4O1EA 3PC0A 2VDOL 4QR6A 4G9DB 1W0WA 3H2AA 1A14L 3B2VH 1NP0A 1ZJAA 4KOBA 2EH8H 1CI1A 2FGWL 2I7GA 2GG1A 3GTIA 1DBTA 4HJFA 4MNJA 4WV1B 5FGSA 1DVSA 5GRYA 3NCCB 1HWHB 2GJXB 4PJ9D 3C2EA 4G3YL 5KTEH 4W7VA 4HFUL 3ZXWA 1V0MA 1ZJBA 4ZS6D 3LN4B 5EYWA 5CILH 4Z0BL 3QKZA 5I3IA 4L8SA 2DF3A 3SO3B 4K36A 4GKOA 2VUOA 4DAIA 2VQUA 4Y1AD 1V3KA 3HW7A 4LYQA 1FYTD 2FEEL 3GC2A 4FOJA 5LDUA 1J11A 2E59A 2KC0A 2AQ3A 4N68A 2VQ1A 1MI5E 3WGUB 2VRAA 1WGVA 2NVCA 3GVGA 3LXBA 3ECBB 2YWYA 1RZ8A 3PHQA 1HZLA 1BD2B 3OEXA 5T1DL 2BSEA 2LU3A 4V2CB 3L8QA 2X0SA 2HJKB 4QE5A 3ZR4A 4KU1A 5F7FA 1XF1A 4KK5D 4LTSA 2WV3A 3APMA 1XX1A 3LZPA 3DXIA 3CL8A 3E2VA 1Z42A 4QTIH 3TEXA 5IK3A 3ULUE 1OARH 1HHJB 1DBKH 4J6IA 1J79A 2Y1VA 2JIXB 3PL6D 3HCVB 2V3FA 2JSFA 2WQUA 4Q8TA 2P5EE 1WOAA 1GYVA 2J7EA 1VEPA 4ECLA 4JIRA 5DJ6B 5KUMA 5BXFA 4UM8A 5GRZA 3CWHA 3HBQA 1J5OH 3FQ1A 2XTKA 5BO1H 1TQCC 5FAAA 1W9DM 1FIGH 3T8XA 4ZD3L 4NQXB 1FP5A 3TPKA 2D73A 4P2RA 3GZQA 3DVGA 3QRBA 2YKKA 4QHPA 3RGBA 1O68A 1YIXA 4D0BA 3IVSA 1IWAA 2FVKA 3RAJH 3TC6A 3MFFA 1NGYA 3G5WA 1GJUA 1E4NA 3MC5A 1CR9H 3R4IA 1Y8BA 1BRLA 2A79A 3SO5A 1S7SB 3DV6A 1W1A1 4AXNA 3QDJA 3BICA 3CC1A 4N1CA 2V9TA 4RGND 3SCQA 1EGJA 1A25A 5J6HB 5FM5M 4BWWA 3AT8A 4O2FB 2F2HA 1MFMA 4JZJC 5H94B 1ZTVA 3CIXA 4OZFA 2OYLA 3PY2A 1DWFM 2EQDA 3AQZA 1WFNA 4XBJA 3UOAB 2CBIA 3NXFA 4DBWA 3DX5A 4F27A 1KYUA 1TQWA 4QRRA 1DPMA 4F7TB 2CC0A 2YO3A 4GFSA 4FFZA 1RCYA 1I7RA 2Z8VC 4BH8A 3LCWA 2EC9U 15C8H 1MHEA 4BQ6A 3O2LA 4ZMZA 4R26L 4G9FA 1U95A 3CHPA 1KFAL 3FQTA 1KWGA 5B80A 4OCYL 3RWHA 1WWAX 3HPJB 1GNXA 3N55A 1P6WA 5CN2A 1OFOA 2GDVA 4M43H 2B9BA 2KI6A 1OINA 3CASA 2DUZA 2A3LA 1OP5H 3PNWA 1KPRB 3FCSB 4G1KA 4KJPC 1X5JA 4Y19A 2GGGA 1VD6A 2DW5A 4KBXA 1FUNA 4YHEA 1VPXA 3TKFA 4G7QB 1AHKA 1A4KB 4RMRA 3H4GA 1CDBA 4IRZH 3M0IA 1CXKA 4H8PA 1MPAL 1OGTA 5IVZA 4Z3EA 3FJ4A 2X6CA 3QIUB 4H7VA