1QW8A

Crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNAMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-L-arabinofuranosidase
total genus 171
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qw8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qw8A02
2IUZA 4ZENA 1ZBKA 4D1JA 1C8YA 1KWKA 5CQ1A 2F61A 1HN1A 1ZB5A 2DT2A 2J7HA 1KXHA 1XHGA 3DC0A 1H4PA 1B3WA 4P8WA 4BS0A 1JZ2A 2W92A 3I3EA 4IPNB 1ITCA 4PSRA 4PTMA 3WNPA 1OBAA 4JZ5A 4NSBA 3AMGA 1V0NA 2O9OA 4FLQA 3CLWA 1JI2A 1UR1A 1E56A 4J3WA 3UESA 2VRQA 5JBFA 2Y5EA 1FFQA 1H09A 1J0KA 2XFRA 3BC9A 1ZJBA 3AHYA 2X0YA 1LWJA 4HU8A 3VU2A 3CZNA 5DEZA 3ALFA 3T08A 3AMKA 1KBBA 4DO6A 1Q6FA 1UYQA 3B9AA 2WLYA 4JKMA 3WUEA 4W84A 3VD7A 4PMOA 4RE4A 2WMHA 1UWQA 3IAQA 1E3XA 1OIFA 2FHBA 1QBAA 1WDSA 2IXVA 4TOQA 3VSUA 2OW6A 2JFEX 3AXXA 4MNJA 1B90A 3SCOA 4R27A 1PX3A 3VGDA 2GVYA 2XVGA 5M5DA 4ZXOA 2WZHA 1J0IA 3EDDA 3AHVA 2VZTA 1EXPA 5CGTA 4GXPA 1TCMA 1IV8A 3BCDA 1R47A 1UZ1A 3M7SA 1BPLB 3WDHA 1V6XA 1XCWA 3G6MA 3N1AA 5BCAA 3LPFA 1V03A 4PMNA 1KGXA 1VIWA 1J0HA 4K68A 3WQ4A 1FFRA 2DSKA 1CZ1A 3QR3A 3RM8A 1KQZA 2OYMA 4Z2LA 1Z32X 4UQAA 3EJSA 1ZL1A 3ARZA 1J0ZA 1VENA 1XYZA 3EMCA 5CGMA 3W25A 3O9NA 1GZJA 1CLXA 2G3JA 3ZT6A 1ODZA 3DX0A 3MUY1 2XSBA 3ALGA 4PTXA 4JHZA 1JZ5A 3WEOA 7TAAA 4B3LA 2BY0A 3W82A 2TAAA 1EA9C 4H7VA 5E1QA 2DH3A 3SCPA 4ML4A 2W66A 2WMFA 4CVUA 2F7RA 1M03A 3GXFA 3VIJA 3BUPA 2BVTA 5IHRA 2X2YA 1UA3A 2ZICA 1NWTA 2J75A 3AIQA 2EQDA 4B9ZA 4AZGA 1MW0A 3K4DA 4XX6A 5A8QA 3CUFA 1CGWA 2YDRA 3DX4A 3IK2A 1HIZA 2D3LA 2VZUA 1JFHA 3A23A 1JYVA 4UQBA 2XIBA 4EAMA 4AWEA 4QP0A 4DWSA 7CGTA 3N15A 1KTCA 4FMVA 3MUZ1 3CGTA 3VX1A 4UFKA 1UR9A 3VO0A 1AQMA 4F9JA 3N17A 3SUSA 4UFJA 2VX6A 2E8YA 3QHNA 1JZ7A 3AIVA 3AISA 5A2AA 1R34A 3LXBA 1SFSA 5DT5A 1UA7A 1BG4A 2E4TA 1UH3A 5CJ5A 3D52A 4E4PA 1RPKA 1ISXA 4MDPA 3AXHA 3WH5A 3AIWA 4U2YA 5I3DA 4S3JA 1H11A 3AS3A 1ISVA 1W1VA 1GJUA 2YFOA 1AVAA 3MS8A 3BMWA 3QGVA 5CSYA 5JUVA 2JALA 4U5KA 2JF7A 1BYDA 4QDMA 1H0GA 1I1WA 1RP9A 2CBIA 5CZKA 1DWAM 3VILA 1HT6A 4CGTA 1MW3A 1G0CA 5FL0A 5HNNA 5A6BD 3PZTA 1JYXA 1UD8A 4W5ZA 1XCXA 4QCEA 1Q6DA 5HBFA 1OSEA 1JI1A 3NSMA 2W61A 3UR8A 4FNTA 4PTVA 4UOJA 3WF1A 1SZNA 1HP4A 4AD4A 3U7BA 4AMWA 1ESWA 4ATDA 2V5DA 3AMCA 1GHRA 3WNLA 1R33A 1JXKA 1JNDA 4NRSA 2XVLA 3PZIA 3F5JA 3VIPA 5FIPA 1VF8A 1E6NA 4Z2KA 4UNIA 1GORA 1BQCA 3A22A 3WN6A 3WNOA 2DT3A 4HU0A 4WKAA 2PWGA 3SCTA 5BXPA 5D9OA 4HTYA 1FP8A 4XZBA 3W26A 1VBUA 3K4AA 4PMXA 4LPCA 1WDRA 3UG3A 1R85A 3WUFA 1GQKA 1XC6A 3LX9A 4W93A 3OA5A 5I78A 4HZ8A 2CERA 3IJ7A 1IZKA 3EDFA 5AC5A 1PX4A 1NARA 3VOCA 1JZ6A 1E0VA 5D8WA 3T0DA 4AZCB 1CXHA 4W7UA 2PF0A 2Y24A 3CUIA 1F4HA 3AMDA 4Z2HA 3RO8A 1J01A 3CTTA 1CXFA 2YDQA 3WH9A 1C8QA 1CYGA 1OD0A 5DMYA 1EGZA 2EXOA 2O9TA 1UWRA 4C7FA 5A6MA 4HMDA 1W1TA 4V27A 4BQ5A 1KGWA 2CESA 3KEHA 4FNQA 2WZIA 2VX4A 1BHGA 3OZOA 4AIEA 3BUIA 3VDBA 1E6ZA 2CBUA 4EANA 1NH6A 2J62A 4D6FA 2J8FA 2GJXB 2YL9A 4DWSD 1JDDA 3BSGA 3OLGA 3ARPA 5HPCA 1TE1A 4LYPA 4S3KA 1WO2A 3CUHA 2XN0A 5GNZA 4B3KA 2DSZA 4NZFA 2W5FA 3FHQA 4AD1A 1V08A 3D5HA 3WF2A 3GTNA 5EMYA 2V3EA 2XGIA 2XVNA 4KMQA 3RJXA 1VJZA 4X0NA 2VO5A 2VRJA 4GI9A 1W2VA 3TTSA 4CN1A 1W2PA 4JL1A 4JKLA 1GOKA 1GOWA 1BVNP 1CGXA 3UR7A 3T2OA 3WQ5A 1E3ZA 1NWRA 3W29A 3LXAA 1BYBA 1JL8A 2WC3A 3PTMA 3OGSA 2BY1A 2UY2A 2ZX8A 3WDPP 2XVKA 5GPRA 2YKKA 3VIGA 3WY1A 5JBDA 3PZQA 1HJWA 5I5RA 1QHOA 3A4XA 1R46A 1QNQA 1CBGA 4HZ7A 1HJQA 3EDKA 3SCVA 1WDPA 5IDIA 5M3WA 4CU7A 2WMIA 2XJ7A 2WPGA 1QNOA 3SIMA 4QLLA 1J9YA 1PS3A 1BYAA 3VIMA 3L4ZA 3W24A 1E72M 3VKKA 7A3HA 3U57A 4AY1A 3VNYA 1V3HA 1C93A 1VFMA 1H49A 3HG4A 1DTUA 2DEPA 3LRMA 1GVYA 5IHSA 2EPNA 3VGFA 1AQHA 4GPNA 2D1ZA 1HJVA 3VX0A 3ARWA 3GDBA 2JEQA 3CHFA 1EOKA 1ZBWA 2WANA 3BAIA 2O9RA 1UD3A 3FHAA 3N12A 4FNSA 4CKQA 4EKJA 5ABEA 2V3DA 3LPPA 2A3AA 4BQ4A 5DO8A 2WZEA 3UG5A 3AHXA 2NSXA 3EDJA 2F7PA 1ECEA 2BHYA 3CC1A 3HJEA 3WD4A 5HDRA 3LRLA 1P6WA 2OSWA 4NI3A 3SUUA 4NX0A 1W3HA 3FY1A 5I79A 3WEMA 2VZOA 2WKLA 4AW7A 2J25A 1OCQA 4GKLA 4KGLA 2Y8KA 4RE3A 4M24A 3II1A 1OIMA 4CCCA 3MV01 1XV8A 2VL4A 1V02E 1DWHM 3BLPX 3W53A 3VPLA 2JIWA 5I23A 4JFUA 1PIGA 3EYPA 4HOWA 3ZR6A 1XGZA 2ZX7A 1GNXA 1V0KA 3GBEA 2VR4A 5BRQA 2OYKA 4KRTA 2BVDA 4N42A 1UD2A 2Y2WA 4P7LA 1E71M 4UFHA 3BLKA 1JZ4A 1W1PA 4MJ2A 3THDA 3AICA 4URIA 3EJUA 1E6SM 1WCGA 4AC1X 4CN6A 2PWHA 4M56A 1US3A 2VCBA 5GNXA 1WZKA 3J7HA 1KXQA 2CBJA 2YL8A 1V3JA 3WH8A 1EQCA 1HJXA 3MKKA 4W88A 4AZ7A 3WD2A 5HXMA 1ISWA 1O7AA 1VBRA 3ARVA 4PMVA 3THCA 2F7OA 3PTQA 4LQ1A 5KZ6A 1AQ0A 2WLZA 4GIAA 4BQ2A 3IJ9A 4J7RA 2GJPA 3GNPA 2YBUA 3BCFA 4AMXA 2FE0A 1JYNA 3BUDA 1C8XA 1ZBVA 4UQ9A 3OGVA 1UOKA 4PCSA 1J10A 3VGEA 5M03A 2X2JA 1EDQA 3N11A 1UD4A 3WKZA 3L4UA 3M07A 5JIWA 4UR9A 2OWXA 3F4VA 3OLEA 1YQ2A 1ISZA 1VEOA 4Z2GA 1V3KA 1J11A 1WAWA 3SEPA 1PJ9A 1KR0A 3QHOA 2WHMA 5BXSA 4W8BA 3CMJA 5CLTA 3SURA 2CYGA 3K46A 3WMCA 1FH7A 3OG2A 1G01A 2AOSA 3GZAA 2AAAA 1HJUA 1CGVA 1TVNA 3WBAA 1PZ3A 1B3VA 2WWDA 3RDKA 1MWOA 5C71A 3BUQA 3SUWA 4CVWA 4CD6A 3NJ3A 3VTRA 1UWIA 2XGBA 2AMGA 4YHGA 3L4TA 3AXIA 2ZXBA 1SYTA 2J7FA 1EO7A 2JIEA 2YOCA 5AY7A 2VMFA 4WJXA 5CPSA 4XUYA 1JD7A 1CENA 8A3HA 1UASA 2XG9A 1GVIA 2G4FA 1CGUA 1LWHA 4LXFA 4F8XA 2PWEA 1DEDA 4DWSC 2ZX5A 1G9HA 2VJXA 1W9DM 1GOIA 2HISA 4MPKA 3BGAA 4HA3A 1TQTA 1Q6GA 1BYCA 1HF6A 3DDFA 5E0CA 1VB9A 1E6XM 3CZSA 4PSPA 3CUJA 3NSNA 2QLYA 4FK9A 1VJSA 4UZSA 3CZGA 1BTCA 1W32A 1US2A 2OLHA 3GNOA 4BA0A 1A47A 1V6WA 3A3HA 3VUPA 1QWNA 1TQSA 5CLWA 1E1FA 2DH2A 2CETA 4OIFA 3S5ZA 2Z1KA 5A6AA 1CTNA 3VSVA 5DT7A 5A94A 2VNCA 1QI3A 1QI2A 3HMCA 4B15A 3A5VA 4UQDA 2J7GA 4UTFA 1JZ8A 5BWFA 2A3CA 2Y8VA 2VX5A 1D7FA 4CD4A 1N82A 2CBVA 2ZOXA 4IUGA 5BXTA 4LGXA 5A95A 3BAYA 3AHTA 1UKSA 4F79A 3WH7A 3WL1A 4MJ4A 2E9LA 2GDUA 5E0FA 2J7DA 5I24A 1UUQA 3WD0A 3LRKA 1KQYA 3W6LA 1JFXA 2FGZA 4H41A 2D3NA 4DUXA 3L4XA 2XYLA 4MAZA 2DT1A 5ABGA 2WSKA 3CHCA 3GNRA 1CXIA 2VT0A 5BROA 2EJ1A 3UEQA 4D6EA 5AC4A 3ZOAA 4DO4A 1U33A 4PMDA 2NW0A 3EMQA 2Q8XA 4C7DA 1QW9A 4DUVA 2XN1A 4P7NA 3NUKA 1UKPA 3ARSA 4E8CA 1MW1A 3M46A 1KCKA 3W4RA 4ZE5A 1WPCA 3ARTA 3VVGA 3WDIA 3WNMA 3KZSA 4HOXA 3MV11 2W63A 3H53A 3VIIA 5EFFA 2V5CA 1UHVA 3AQUA 1VFFA 4L4PA 2CPUA 2WC7A 3K1DA 4NZJA 3TOPA 2BY2A 2GDVA 1BFNA 1PX8A 1M53A 2D20A 3AIRA 2WVUA 3PZOA 1QNSA 1YHTA 1UWSA 3VIHA 5E09A 1DP0A 3WQ8A 3BH4A 1NOUA 3KLLA 1DHKA 3L2MA 4D6DA 2B31A 4TTGA 3NSXA 4WLCA 4V2XA 1D3CA 1K9EA 2DGAA 3I3DA 4V28A 3PN8A 3WDQA 3D51A 1C92A 2FH8A 1GW1A 1UQYA 3CZEA 3ARYA 1KBKA 3BVVA 4F66A 3OZPA 5ABFB 5BXRA 3A4AA 1UWTA 1E70M 1HKKA 4TVDA 2C0HA 2ZUUA 4PMUA 1TQWA 2PBOA 4AEFA 1H5VA 1Q6CA 2XFFA 2OW7A 4DWSB 3QOMA 1JF6A 3WL0A 1CWYA 1JDCA 3O2LA 3MUIA 3MSGA 2CITA 3UG4A 4FNUA 2V3FA 2G41A 1WZMA 1R7OA 2HVMA 1HVQA 4JAWA 2WHLA 4UFLA 5ABFA 3L4YA 3A4WA 4AZIA 1EHAA 1E6QM 3RM9A 5HOSA 3E1F1 2G3NA 2F1BA 4W8AA 4EK7A 1CLVA 2E3ZA 3H54A 3ZIZA 1JDAA 1FA2A 2VCAA 5E9AA 3ARUA 4OGZA 2CKSA 2RGMA 5E70A 2EPKX 1G94A 3OIHA 3CIVA 1UKQA 3VD3A 3DX1A 4XB3A 2C8NA 2W67A 1Y7VA 1LL7A 3IAPA 3IANA 1C7TA 1X6LA 2XN2A 5I2UA 3GXMA 1V6UA 4LX4A 2VR5A 2WBKA 5A8OA 4QCFA 3DYOA 4OZOA 4AD0A 2WCGA 2YFNA 3VMNA 1B3ZA 1OM0A 3NCOA 3FNDA 4OOUA 1DWIM 2WAGA 4MNMA 4D6CA 4XV0A 3MMUA 4PCTA 2VQTA 1E0XA 5M17A 1EIBA 2OYLA 4J3SA 4B9YA 2O9PA 1QNPA 3ZMRA 2ZE0A 1UH4A 1UD6A 1JAKA 3WDRA 3VGBA 2GSJA 1MFVA 3W27A 2YA2A 1E4MM 2WHKA 1JIBA 4Q22A 1QW8A 4GI6A 1E6PA 2WHJA 4UOQA 1R8LA 2X2HA 2XVPA 3K8LA 2EABA 3A24A 4PMZA 1WZAA 3VNZA 4N0RA 5F7UA 1CXEA 4P7QA 4D1IA 4W85A 3U5YA 3T0BA 2GK1B 3VSTA 2D0GA 2J7EA 3AROA 1EDGA 1EOMA 1E0WA 1QI0A 3AS0A 3KWXA 3VM5A 2YJQA 1TMQA 1BVZA 3WFZA 4RE2A 4ZE4A 1C3FA 1LL4A 2UWFA 2D0HA 3WMBA 3AZSA 5LYRA 3TTQA 2EAEA 4OKDA 1UR8A 4WSJA 2V38A 3UETA 4A3HA 1TQUA 3FXYA 5A2BA 4W89A 5A8NA 2QMJA 3BUBA 2XWEA 4A4AA 1LLOA 3HU7A 1D2KA 4MB1A 3AOFA 4WK9A 3KL5A 4J3UA 4ACYA 1EH9A 2ZXDA 2MANA 4M80A 5BRPA 1W9UA 1HWWA 4A3YA 4FF5A 3PHAA 1ITXA 4H04A 1OGSA 1KFWA 4HPHA 1M04A 3F5LA 4QLJA 1HVXA 1OINA 5D8ZA 4X0VA 3PZNA 4J3XA 5D4YA 4C7GA 1OGGA 2ZUMA 3BXWA 3AHZA 2J8GA 2D73A 1PPIA 1V3LA 4AYGA 3DX3A 3PZ9A 5DFAA 2DT0A 5E6ZA 1OWQA 3VDAA 4JIEA 2CCRA 3WNNA 1GCYA 1OGBA 2VCCA 1EHNA 3BVTA 4YPJA 4GO8A 4PMQA 1K9FA 4H2CA 4J28A 1MXGA 1V3IA 2ZWYA 1BGAA 2WW5A 4U31A 4Z2IA 3QHMA 4HA1A 2VVNA 1GONA 4JKKA 1V0MA 4GQQA 1FHLA 4TUFA 4FLRA 2YLAA 1BG9A 2QPSA 1UH2A 3GXNA 4CN4A 4GZIA 2XSAA 5FL1A 4TVUA 1GQIA 3VINA 2BV9A 2VZSA 6A3HA 2BHZA 2E9MA 3RPMA 3WELA 1V0LA 1HX0A 2DIEA 3WY3A 1B0IA 4RL3A 2NT0A 4B16A 2YA0A 3A47A 2VRKA 4ZXLA 3GH7A 1L0PA 2BHUA 5AYBA 4ACZA 1MQPA 1JAEA 1H41A 3MUAA 4KH2A 2X1IA 4P8VA 2EACA 1UR0A 3WEZA 1GPFA 3CV5A 3ZJ6A 4QAWA 5AYIA 2NT1A 2DIJA 1QI4A 2WK2A 1NWUA 1CPUA 1UKOA 1MQQA 2J77A 1LQ0A 1ZU8A 2EO7A 1XYFA 3EMZA 1B2YA 2WSPA 5CPQA 4NF7A 1Q6EA 1VRXA 3BAXA 4HMCA 3LXCA 1CIUA 3WNKA 2VUYA 5DF0A 4DM1A 2WB5A 1QOXA 1LG1A 3SUVA 3HZ3A 4TTUA 4KGJA 1JF5A 1H2JA 1KR1A 2CNCA 3VIKA 1E4LA 3DYMA 2QHAA 5A3HA 4AEEA 1S46A 1XSKA 4HMEA 4H8UA 1B31A 4AD5A 5A6BA 5LA1A 2YA1A 2VQUA 1W9XA 1MFUA 1EDTA 5A6KA 2VTFA 1RH9A 4TX8A 1TQVA 4QLKA 2X05A 3G6LA 3ZT5A 1DWJM 3OLIA 4W8LA 2BVYA 4JCMA 3WUBA 1WP6A 4ZFMA 3VGGA 4DO5A 1E4NA 2J4GA 5FOOA 5E6YA 2YBTA 1C91A 3BVXA 3GXPA 2D0FA 3ZSSA 2BXZA 1GQJA 1LJYA 2J79A 3W6MA 3CO4A 5IFPA 2XUCA 4AIUA 1HKMA 3VGHA 2DSWA 3GXDA 3H55A 1GOOA 5D9NA 1TZ7A 4M81A 5C8BB 3CZLA 1E1EA 1HKJA 4GI8A 1M01A 3ZJ7A 5CXPA 1AMYA 2VC9A 1CXKA 4BCEA 1LG2A 1MYRA 1XSIA 1QX1A 3SCRA 3W28A 2PWFA 3ZT7A 3F5KA 4TXEA 4PMYA 2WKGA 4DUWA 4WSKA 1MQRA 2DDXA 2EBNA 2PI6A 1FOBA 1CDGA 1TVPA 2PWDA 4D71A 4JFTA 1E5NA 1WDQA 1B30A 3PZMA 1WB0A 3L4WA 3QOKA 4CU6A 1TFVA 2EPOA 5ECUA 1WKYA 2D22A 2D2OA 4MAVA 1MW2A 4J3TA 4ATWA 2YLLA 2CHOA 4U5IA 4CUCA 1HJSA 3CPUA 3VD4A 3VD9A 2FHCA 3BVUA 4Z2JA 3W0KA 1XRVA 3WBEA 3WD3A 1JGIA 1HL8A 2WC4A 2WM0A 2J7CA 1W9PA 2WXDM 4LYRA 4MB5A 3N18A 1HTYA 3D4ZA 1ZJAA 2WMKA 3TTYA 1OT1A 1ISYA 1UQZA 3S5YA 3SCNA 3T2QA 1QWUA 4WKFA 3CZ8A 3ZJ8A 1DWGM 2FH6A 3KL3A 1U30A 3WH6A 5TD4A 1W3JA 3RCNA 2E9BA 4NZCA 4AMCA 1XD1A 5EBAA 4UOZA 1NWSA 3ZO9A 2WNWA 1TG7A 2ZX6A 2ZX9A 6CGTA 3CZKA 3WQVA 2E8ZA 1LF1A 2WMJA 4PRWA 1RP8A 2W4XA 2CXGA 4JL2A 2UY5A 2YL6A 3A21A 3D3AA 1KXVA 9CGTA 4PYSA 3MI6A 4GZEA 1FH9A 3M6DA 3KE0A 1IT0A 2X8RA 4NXSA 4JFWA 1IZJA 3VDHA 2RGLA 3D4YA 4WF7A 1W91A 4W87A 2WWCA 2GUYA 4W5UA 4WIWA 5A6SA 3AZRA 3AMLA 3ZQ9A 3GXTA 3U7VA 2OWWA 3VD5A 1CGYA 3MU7A 2ZUVA 1V3MA 2F2HA 1V02A 4FNRA 1O6IA 5IFTA 2GK1A 2QV4A 2ZUTA 4LYQA 3NDZA 1U2YA 3DECA 2ZIDA 3BAKA 1A3HA 4PBGA 3POCA 4Q7NA 4OBRA 1BGGA 3WY4A 4FLSA 4HZ6A 3GBDA 2O92A 1E15A 4PUEA 1W3LA 1PAMA 3N04A 2BFGA 4AZHA 5LA0A 4CCDA 1CGTA 3BMVA 4JFVA 1XH0A 3CH9A 4JCLA 4UZUA 2W62A 3N13A 2IGTA 1KTBA 1TA3B 1JZ3A 1J0JA 2J7BA 1BF2A 2DSVA 2GJXA 3AIUA 1H0IA 2BY3A 5CG0A 2F8QA 3N9KA 3DYPA 4PMRA 2FHFA 1G1YA 4AZCA 4D6GA 1G5AA 4U33A 3OBAA 5CSUA 1EO5A 2WVVA 1VEMA 4UQCA 3WQWA 4HA4A 2OSXA 1PEZA 1NP2A 2BNJA 1M7XA 2G3IA 4NRRA 1GJWA 3DHPA 2DPEA 4J27A 3PZGA 3CZJA 1MVYA 3ARQA 3GYCA 1JG9A 2PC8A 1VAHA 1E55A 4TVCA 2J78A 3CHDA 2WCAA 3L2LA 4CD5A 2XM2A 2EPMX 3OLDA 3ARXA 1E4IA 3GM8A 2OSYA 3EJRA 4YHEA 1WE5A 3WY2A 2XTKA 3MMDA 3FN9A 1FH8A 5A2CA 3W38A 3I3BA 1GUVA 1VFOA 2FDMA 4GZJA 2J47A 2W91A 3UCQA 1ODUA 4OOZA 3A6OA 3BAJA 3RILA 4X9YA 1L8NA 1XSJA 4AIOA 4MNKA 4ACZB 1J0YA 2G3MA 2UY3A 3EJPA 3DHUA 1GOMA 1QI5A 5C70A 5A6LA 8CGTA 5I0DA 1B3YA 4MTVA 1GHSA 4ZEPA 3SCQA 4M8UA 1KGUA 1CXLA 5CPTA 4MNLA 4OBSA 3MANA 3RJYA 2VURA 2F18A 1TA3A 5KEZA 2UY4A 3ECQA 2GJRA 3AFBA 3POHA 3SCUA 2JE8A 3WD1A 3DDGA 1SR0A 1KWGA 2CKRA 5A69A 2ZXAA 3FW6A 1GOQA 1NM9A 3ZSTA 2ZUNA 4AYSA 1PBGA 4BF7A 1X6NA 4IISA 5A8PA 1VEPA 3AYRA 1QHPA 3UERA 1B3XA 3AIEA 2J74A 4P8XA 4CD8A 4OJYA 1HNYA 3HN3A 4W7WA 1MXDA 2CIPA 1H1NA 3WF0A 1FP9A 4W86A 1WNOA 3AS1A 4CU8A 3CUGA 3MO4A 2C7FA 2PB1A 1QBBA 1W9VA 1LL6A 1GQLA 3WUGA 2EADA 5A1AA 3EJQA 3WF3A 1UWUA 3BLBA 2F1AA 3CBWA 2WVSA 3SUTA 4PEEA 1QVBA 4FNPA 3WDJA 5A8MA 1QPKA 1TUXA 4U2ZA 1R7AA 2XM1A 1J12A 4M82A 2OWCA 3WIJA 2QF8A 2ALWA 1CECA 3B8SA 4AZ5A 1ZS2A 4AZBA 2E0PA 1BAGA 4ATLA 2X0HA 1UR2A 4PTWA 4UCFA 2VOTA 3WQ6A 1FHDA 2CEQA 3PZUA 1KXTA 3GH5A 3SCWA 1J18A 3S6TA 1UKTA 3BVWA 3NDYA 4U3CA 2YIHA 2XIIA 3APGA 5GNYA 4GQRA 2A3HA 3PBGA 3AJ7A 1JYWA 1QNRA 1HXJA 4F9DA 2PBGA 4KWUA 3MMWA 4AXNA 1E43A 1OD8A 3LPOA 2XPKA 2WBGA 3K8KA 3W81A 3WENA 4W7VA 3TA9A 4AISA 5FCZA 4J3VA 2YDSA 2BS9A 5D9PA 2Z1SA 1K6AA 1EQPA 1OB0A 1I75A 4AD2A 4L4OA 2Y4SA 1BLIA 4PUDA 1V6YA 3TONA 3U5UA 4BQ3A 1TR1A 5JBEA 1UZ4A 3CHEA 1E73M 4H8HA 3L4VA 3OB8A 2DQXA 3RM4A 3RMEA 2WVTA 2G8ZA 1B9ZA 1ZBCA 5I77A 1K9TA 3EBVA 3T09A 5EFDA 1C7SA 4HOZA 3HG2A 4MB3A 1CNVA 3RIKA 2WVVB 5I6SA 1E40A 4UFIA 3GXIA 2WYSA 3EJTA 4FLOA 2GFTA 3ZM8A 3VMPA 3BSHA 1W9BM 2VI0A 2XHYA 4D6IA 3O6AA 2DSUA 4NXKA 4D6JA 4P7OA 1K9DA 4UFMA 5EB8A 3W37A 3IGUA 3WF4A 3WSUA 1T0OA 1R75A 2ZUWA 4CCEA 1UR4A 5BYWA 2ESCA 2CHNA 1HP5A 3AI0A 4M29A 2E40A 4IPLA 5ABHA 4M1RA 5FD0A 4XZWA 4R5EA 3TTOA 4CD7A 2FYVA 3TV8A 4KRUA 1E9LA 3IJ8A 4AD3A 2XFYA 3AZTA 1O7DC 2A3EA 4YN5A 1E6RA 1UD5A 4D6HA 5LA2A 1PZ2A 1CEOA 2QPUA 2ZUSA 5HPOA 3AIBA 3JUGA 4MB4A 3WMSA 4Y7EA 1NOFA 3HG3A 2WMGA 5FKYA 4P7RA 3VMOA 3KL0A 1PIFA 3BAWA 1V6VA 6TAAA 5IXEA 1XH2A 3S2CA 3ZJKA 4GO9A 1OT2A 2WCSA 2VX7A 3AS2A 3DX2A 1HKIA 2WMIB 3ZR5A 4D72A 1QHZA 4HP5A 3CMGA 2F7QA 3GH4A 1Q4NX 3TP4A 3LMYA 1NQ6A 2BXYA 1W1YA 1RD6A 4QFUA 2ZXQA 1F4AA 1I1XA 1R86A 2D23A 2JEPA 3WFLA 1XH1A 4DM2A 1KB3A 2XWDA 4TX6A 2QMKA 1C90A 3AYSA 4JHOA 3VIFA 1WZLA 4BZYA 5A6JA 3VM7A 1JXJA 3OGRA 2EPLX 3B9DA 1KCLA 1B1YA 1VFUA 1X1NA 2VVSA 3FAXA 3K8MA 3LPGA 3VDCA 2A3BA 4E8DA 4EE9A 3NIYA 3EDEA 1SMDA 2X2IA 1R87A 3FAWA 1H3GA 2EEXA 3T2PA 4UQEA 2X09A 1JD9A 1UG6A 5D9MA 4WKHA 2ZWZA 1JNEA 2V3GA 4OUEA 2D24A 3VIOA 1SMAA 3PZVA 1XD0A 3B9EA 3PTKA 3KLKA 4E2OA 4AZ6A 3T0AA 1W3KA 2VZVA 4MADA 4GINA 4IM4A 1HXKA 3MSDA 2JF6A 4JFSA 5GQBA 2YL5A 4PN2A 3SCSA 1HL9A 4U3AA 2IXUA 2FGLA 1DWFM 1NP0A 4HPGA 4H8VA 4P8UA 5JIPA 4MDOA 3HG5A 1E5JA 1BSIA 3ARRA 3NYDA 1NOWA 3D50A
chains in the Genus database with same CATH superfamily
5MEOB 3CNYA 4YTQA 3EOAA 3LMJH 4B9PA 5FDWB 1GTFA 4D1JA 1KM1A 3BP5B 2R0WH 4N8CH 4AQAB 3NZGA 4ZX3A 2NZ1A 5BNXD 5G4HC 1R0MA 1S5WA 1OY3B 1WAPA 5CQ1A 3WFEL 4UTLA 3BKJH 1C16B 4R4BA 1S7RA 3DTDA 2KKQA 4PU2A 1FG9C 4F7MA 5ALCH 4HNUA 4YVXA 3VI4A 3WKPA 2IGLA 1XHGA 1OVZA 4TLSA 1BQLL 4X6FA 4ZO9A 4P8WA 4NZUH 3OAYH 4Y6GA 3U8GA 4ZXBB 1US0A 2W92A 1U92A 4UDTA 1AH1A 1ITCA 4PSRA 4PTMA 4CQAA 2ZXEB 1XF5B 1G9NC 2FZDA 2CKNA 2AK1L 4B9IA 1BA9A 3NEOA 4Y9BA 5D1XE 3WIHL 1FJ1B 1R3IL 5IESH 1TRDA 2QYGA 3FKKA 1FDLH 4PGEB 3PBMA 1XJBA 3MV8E 4JO4H 3ZE0F 1QSED 3CLWA 2Y72A 2GBVA 4J4PD 3ZDXF 1Q2RA 3QEGH 2V2DA 2L5HA 1B2WL 2JKLA 1TZIB 2HXTA 3QUMB 5L88H 1YTDA 4Z7IA 4HHHA 4W9CC 2C1IA 1UG9A 5JPNC 2ZZ1A 5K4XA 4YSTA 1D6VL 3ARGB 4WNQB 1ZJBA 2YAHA 4S1QH 1K7EA 2XWBA 5I15L 2B0SL 5TQ2H 1LWJA 3STEA 1WHOA 2NVDA 4ZOEA 4NDMA 3HQ1A 4DK6A 3PUGA 5AYQA 4PVNA 2HAZA 2W9EL 4DT2A 3RRXA 2V2TA 1UIPA 2H3XC 3GHBL 4DO6A 3RU8H 3AM8C 3FQNA 3T6XA 1LWIA 3ZZ1A 1GYWA 3GO1L 1PTDA 1NCBL 2KBGA 4Y5VB 3WFDH 1UYQA 4Q4RA 2QQNL 1MEIA 1YBQA 4PMOA 1C5BH 1IGIH 4YHOH 2A7RA 2TRSA 4BEIA 5LNVA 1ZHAA 5B1JA 1P84J 1ZTMA 1DN2A 4ZUWB 4V1DB 5CGYC 1J96A 4XB7A 1OIFA 3LS4H 1EJWC 1R2TA 1UT9A 1WDSA 1MHHA 1RUPL 3V0EA 4JY9A 3VSUA 2C1OB 1T04B 2HJKA 3AU1A 1UATA 3CSFA 4RETB 2VW6A 2O6PA 1MRDL 1OGPA 1X8FA 2BRRH 2MCPL 4ZMOA 2O61B 4NNBA 4OAWB 3SCOA 3F8UB 4AG4H 1AR2A 1QD0A 3P2DA 3UDWA 3I4EA 3BWSA 2WQRA 3I9PA 1HCZA 2MOGA 2GVYA 3DUSB 4NQQA 5CFHA 2FMNA 3M6YA 3AG2B 3S2JA 3TDFA 5F6HI 4WKZA 4L1GA 1CDCA 3GTVA 4TRPH 3OZLA 4YNGA 2ZFAA 3LNIA 3TA3D 2LU7A 2XGZA 4UTHA 3J2PA 1CFSB 4MA1C 4L48A 4PJ9B 5D09A 2OM5A 4FLHA 4CSSA 4K3DH 3WDHA 1MO0A 3CVHH 4YDNA 5CJOH 2BODX 3G6MA 5CC5A 3KPMA 2OO0A 1YRKA 1YTKA 4UILH 3C9NB 3TBVA 4Q6XA 4R2GC 1FYHB 2M26A 4TRPL 5F0LB 4O54A 4YSEA 5IJVA 4HK7A 3F7QA 3C5SB 1FZKB 2E76C 2YPVA 1CZ1A 3QR3A 4PULA 4XCEB 1OHLA 4DVRL 4IG2B 1KG0B 5JOPE 3ENEA 3GVGA 2O93L 4NAFB 3EJSA 3INUH 3K6FA 3T78A 4YO0A 5L8JB 5IQLA 2H2PD 2Z7WA 4KKBC 3L13A 3T4AC 1JUFA 4NKQB 1G84A 1P7QB 4U6YA 4FR6A 4QM1A 3OG4B 4OFYA 2E9JA 5B22A 2UY6A 4JG0L 2OYPA 3D85A 2G3JA 2ED9A 2GEQA 1FNLA 1OCBA 3CIXA 4XBGB 1UP2A 3R4DA 3DX0A 4X63A 5BV7L 2WBJB 4IP5A 2PABA 4PTXA 2XN9B 1V51A 4FD0A 1B3IA 4Q9BA 3PPHA 4XSLA 1NIFA 1W0WB 5D70L 4I5XA 3W82A 3UQNA 4PIBA 2HFEA 4NJ9H 3ZYZA 4YGAB 2G60L 1T4WA 1JUKA 2OTDA 2F54A 4QROA 1PDYA 1A0QL 4JIPA 1AKJB 1QFUL 2DH3A 5E1QA 4ML4A 4HJWA 3HOGA 3HB3C 3L3HB 2VDNL 3U9PH 2F7RA 1M03A 1BPVA 3L12A 1UCWA 2DJXA 1O75A 3KOFA 3LVEA 1CLOH 1WT5C 5CZXD 1YMMB 5EN2B 4X6CE 3GINA 3ZWSA 4YLCA 1ZT4A 4YZFE 5C6PB 5DDHB 5IESL 5EEZA 4LS0A 2JKWA 3ZIYA 3FJLA 5KVFE 3K4DA 5IUCA 5I6KA 3IGXA 5A8QA 3CUFA 4YHZL 5KSBA 2FTWA 2GY5A 2H6RA 1BQLH 3S3GA 1MEXH 4NM8H 1RJYB 3X3FL 5GGVL 3KLDA 3SO3B 1LE5B 5TFSL 3SGJA 3CFBB 3IK2A 2IH1A 2WUBH 4HK6A 3D25B 4P2RB 1C5DA 1OHQA 1QSFE 3P0YH 5E94A 4TV6A 1JFHA 3DPDA 3UABA 4Y9MA 3UPMA 4YHML 2R91A 3SDXB 4Q6IB 1N6QL 1EPVA 4HCRL 3V6FB 1NAKL 4H8WL 4EAMA 2WZMA 4ZQMA 4AWEA 4QP0A 3AAZB 2I07B 3BFOA 2K3HA 1BJ8A 4Y4FB 4F37K 2Q7YB 1D6EA 1LBMA 2FB4H 1AQDA 1RK5A 3N15A 2NNAA 1AC0A 1ALDA 5IMOA 4X5LA 1KTCA 4U4BA 1EBGA 3QRLA 2FPVA 4RBPH 3M1BA 4LHQB 4B9FA 3MUZ1 5A94A 3PTDA 4PI0A 5GGUA 1T3FA 1N6QH 4OLEA 1Q7MA 3TA3C 5I00A 4K5MA 2AQPA 5EO0B 4FFWD 4HB7A 1KRMA 1UOVA 2X70A 4CILA 2XWJB 2ASHA 4UNTA 1OG6A 2F7FA 4UFJA 3IE9A 2AP2A 2E8YA 3P4MB 3T2NL 5TFSH 3ZYJA 2E7FA 4F40A 3AISA 3BOXA 3GYEA 1VJIA 2PO6D 3O6FC 4YVPA 2YEVB 1BEYH 3LKRB 1ETZB 3LXBA 3L0NA 1Z9SB 3L1FA 3WCYA 4RK8A 4GSXA 4NJHA 3FUEA 5D2LF 3A3XA 1IGFH 4UM9B 1JWMB 1CFSA 1UH3A 3FSTA 5J57B 4AY8A 3TJ4A 1CT5A 2KDGA 3GMMB 4GAYB 3BEWA 1ISXA 3MRHA 4KJWD 4P23C 4LFYA 4XO7A 4PB0L 3IMSA 4G6AD 3U2ZA 1SGJA 3U30B 2H2PC 4HIHB 5G2NA 5B4MC 2HLAA 3QZAA 3AS3A 1CGSH 43C9A 2FTPA 2Z31A 1M42A 3C08L 4B7LA 4QISA 4R53A 3W1AA 4FAMA 2HMIC 3HZVB 4OCMC 4FXJA 2YFOA 2K8MA 2HTKD 4M43H 3JTSA 3DUUA 3DIVA 3OKYA 2WSRA 5GRXG 3BMWA 4R3SB 4WWPA 3EFFA 3HN8A 3QRBA 4HNVA 5JUVA 1V7NL 4U5KA 4BBWA 6REQA 2ZCHL 3DDMA 4AGPA 3T42A 4GRWF 1BYDA 2CIIA 5D7HA 4KFZC 1H0GA 4Q4MA 3COTA 1X5HA 5CZKA 1XZWA 5ERWA 4FZIA 1MHEA 5L6UA 3FQNB 1DWAM 3BT2H 4ZMGA 1HT6A 4PJ8B 4HPXA 2HWZL 3CHSA 1G0CA 3M1CA 5HNNA 1U8CB 3GHBH 3ZQWA 4P2RE 3LZQA 1JYXA 4G42B 3O2WH 3PGCB 3K1KC 3QIBA 1DDTA 1NUNB 3W70A 1DIEA 4K1WA 5JORB 1JI1A 3ZZLA 3T0EC 3SDXF 1S38A 4DZ5A 4G7SB 5KVGH 4NASA 2CR0A 2P76A 2PDCA 2FGWL 3VFCA 3VK5A 2FATL 3WF1A 5FECB 1SZNA 3GLZA 1HP4A 3SECA 1TTCA 2BIMA 2J5LC 3DLQR 3I2CL 4H0LC 1BYPA 5E94B 3RTQA 4AMWA 3EX6A 4ZPVA 4EZKA 3AMCA 3L3KB 4KNQA 1GHRA 3QHOA 1EFXA 1EWEA 3QXTA 2Z8WC 1L7IL 3WNLA 3QM3A 1JNDA 3B8WA 1Z9OA 5DMLA 1UXMA 3WIHH 4MQXD 3F2LA 4OF3A 1U92B 4UDTB 4OJCA 2QZ5A 3W5NA 1U8JA 1QUMA 2R23B 1QW7A 4KKPA 2HPTA 4B5XA 2W88A 3O3AB 4I48B 1KTDB 1G1OA 2H9GB 2ED6A 5ES4B 1TPFA 2PPGA 1DJQA 2BMBA 3F5JA 3SGKC 2P5EE 3K13A 3B5HA 4GSRA 5LDSA 2KX9A 2NY3B 4GSDL 5LNGA 1YNYA 3IUHA 4UNIA 4XTRD 1EAJA 3QIWC 4PHZA 4ZT1A 3A22A 5ENLA 3WN6A 4APQB 3DG3A 3K91A 2XJKA 3KNBB 3ZRSA 2DYPB 2BDNH 2R0WL 4PD4K 4HU0A 4Y5YA 1FNAA 3JV6B 4EI6A 1ZDQA 4UTAH 1E8WA 3QRFM 1I8JA 3QHZH 4GQ0A 4GS7B 3X3GL 2UV3A 3IT8D 4ZYKB 3KPPA 3NDYE 4F3FA 1TTQA 1FP8A 2ENJA 3SQOL 2HTMA 3O2DH 3EPNA 1NCDL 3TJHD 4YDLB 4PMXA 1CT8A 3HZKA 3WTTA 1WDRA 1NCBH 2DV6A 5HI4C 1A1OA 4M7LH 4PJBF 1M7OA 2W79A 1ZLUK 3V5HA 2PP3A 1F11B 4IGBD 3WUFA 2LU4A 3O8XD 4H9XA 2I25N 1G7HA 1XC6A 2KYIA 3IJ6A 2WBXA 3V0VB 5C3IA 5HYEA 1TFPA 3CFUA 1OF6A 4LALA 2YCEA 2ZOKB 4HZ8A 4HHLA 3SFWA 1PX4A 3L9RA 4O16A 1JZ6A 1WQ5A 1MPAL 1HZYA 5D8WA 4YCOA 3AFLA 3VXMB 1NMAH 2XICA 3MCKB 4IKNA 4FFYL 3CUIA 4QHLA 3OZMA 1LUCB 1Z5HA 5EF2A 3HKZA 3G1FA 1J01A 1JHLH 3TYGL 5BZWA 1MJ8H 3H9SE 5LIUX 1LZOA 1CXFA 2R7EB 4HIEB 4LKCB 5GJTH 1WWCA 3T0WA 4AK1A 4AV0A 4ODWB 4A35A 4N0UE 1YUKB 4RR4A 3QPXL 4M1GL 1H7NA 5DMYA 1W6WA 5DEFA 1HJBC 1AXIB 2RH9A 4YE4H 3SPGA 1OQFA 4YHPB 2O9TA 1AFVL 4PRDB 4UYQA 5HHMD 3FU6A 4C58B 2ATAA 4R7WA 3QUXB 3S6OA 1UWRA 3FLUA 4FERA 4ES8A 1M65A 3R25A 2PXYB 5CMAB 1W1TA 4GLEA 1KGWA 3NQAA 2CESA 1O6TA 3KEHA 4NN6C 2I5IA 1E4XL 5IK3B 1BHGA 3VFWA 4KIEA 4TPRH 1WUFA 3BL3A 3BPNB 2IMRA 2V82A 3MUUA 1XYCA 2VP8A 1MH5A 2J8UB 4AVFA 3NACH 2HBVA 5DCEA 3M16A 1AW2A 3ULUF 4DJEA 3DENA 4AT6B 2J8FA 3RLGA 3LV6A 4HFUH 3HE6D 3R0UA 2XI9A 1LE9A 1GMIA 1AI1H 3ARDB 4XNQB 3CUZA 2LQRA 3C5ZB 4DWSD 2VLRB 3L3JB 3U0PA 1ADOA 5HPCA 2DWDB 4LYPA 5TDNA 4EOWH 4Y1AE 5DC4B 5DZJA 2UXVA 4ZW8A 2Y6ZA 2AERT 5HYQA 1XGEA 4DNMA 4MQXC 2NUPB 3GIZL 3MLVH 5GNZA 1H8SA 2VAAA 4FABL 3UY7A 3HLAA 4JRXD 3NFPB 2DSZA 3QKZA 1SY6H 3FO1A 4FQCH 1KM6A 3PUOA 1H9VA 3S3DB 3MN8A 2PZNA 3CC5A 3D5HA 2W07A 4ZODA 1IIKA 1LYQA 2ZSWA 3OHXC 4JUSA 5IHZB 1O1ZA 4I9JA 4M19A 3S2NA 3MGOB 2XGIA 2FLMA 3QIUA 1AG6A 3RJXA 4NHVA 4X0NA 2VE6A 3G6DL 2ALRA 4UB0L 2Z4QA 1MRFH 2NY2B 4JM4H 3WLBA 4HIBA 5A7BA 1W2PA 2VLRD 3TT1L 4C83B 4JL1A 4IS6A 1P2CB 3REQA 3V0TA 3QB7C 3BLDA 3FHEA 3RUBL 3OPZL 2I27N 5K9QI 3B40A 3KXFB 3QJUB 4DEPB 3BOFA 3EKLA 3MW7A 1QR7A 5FF4A 1BVNP 3VI3B 2HRPH 3NFSL 5T1KD 1CGXA 2FIKA 2PCXA 3ZQXA 3STPA 1X5LA 1TPC1 4MA7H 2INEA 1CLKA 5AW2B 1MDTA 4X4ZA 1S7RB 4EIBA 2AVFA 1B57A 1EVUA 3VW3L 3IVSA 3SPHA 4E9WA 3QPEA 1QMUA 3CQPA 4QO1A 5ITFA 1L3NA 4XN5A 4Y2LA 3V6FA 1EEYB 3GO1H 1FLRL 4KTEL 2C4FT 3OGSA 4CEUC 2ZX8A 2DFAA 4POCA 3WY1A 4J2MA 1ADDA 4YXKH 1DQQB 4RFEB 1LCOA 3Q2NA 3H56A 3VXSB 4AVKA 2VR3A 3ZWTA 6FABH 5FF7A 1DJGA 3E8UL 3MOAL 3MXVL 4BGLA 4PS4L 1A7QH 5DLMH 5T5NG 1UJPA 2G75B 1EJOL 3HVDA 2JLLA 4ZO7A 1AG0A 1KIUB 3GW0A 5GS1B 2C9VA 5DGQA 3KR3H 4U10A 3WJXA 3BKML 1EEXA 1WDPA 3SCVA 5CH9A 4Z3GA 3F2DA 2YGNA 1SGKA 5AYUL 3NH7L 2LV4A 4NRXB 3KVDD 4NP4L 5C0RH 4NJKA 4RDQF 3LLFA 1J1XL 3QYMA 4GRLA 1QNOA 3M5ZA 1XC4A 5DFWH 7PTDA 1AHWB 4BK5C 1RLWA 1J9YA 1PS3A 1F07A 2NY2D 1YO4A 4HU3A 1SEQH 1I7TA 3JTBA 2VR9A 1BX2B 5FYLD 2VFGA 4PY7B 2WXLA 2G37A 3KRBA 3MRFA 1UWYA 3C6LB 4PN6A 2CLKA 4QS5A 1JV5B 2BSCA 3CQJA 3BD4A 2V9RA 3FPXA 3NWRA 1D5ZA 3RYSA 2DEPA 3GDMA 2XYCA 1G7JA 1LROA 3TAKA 4NO3A 2VXNA 1RL1A 1T96A 1IC1A 2R29A 1NEZA 2VDML 3O8XA 1HJVA 2BOCA 3ARWA 4MD4B 4TVSa 5C08A 1JPMA 1CS6A 5AFDA 1XF0A 4YDKL 2CXKA 5FO9B 3NVQA 1P6FA 4LLDA 1DOSA 1HQ4B 2XC8A 3KDMA 3UXAA 1FN4B 1UM6H 3IU4L 3JBG7 3GS0A 4GLRI 1ZLSH 1D3HA 3KS6A 1BOYA 4N68A 3CQFA 3RX5A 1WF5A 2FT6A 4L5ZA 3LQZA 3FHAA 4O9HH 4P61A 4FNSA 4WW2C 1RZIA 4EKJA 3H4HA 4NN5C 5ICYA 4PR5B 2BLFA 4LLUA 2V5SA 1PCKA 1XLKA 1ZLUH 3FO2B 3MRNA 5DO8A 3QPYA 3UG5A 4NFBA 2RFGA 2YAEA 3NK3A 4PRAA 4L6HA 4ONHB 5E8NB 2DBJA 1ORQA 1IBFA 3EDJA 3PJSA 1QO5A 2PFHA 2YD7A 4M3HA 2JKJA 5ENWA 1IIIA 5AEAA 5IJBC 3V6OC 2PTWA 3F04A 5DRNA 1DEEB 3CC1A 3EG9A 3D0LA 3HJEA 4WWID 4XO5A 1R0AL 3FUJA 4C6PA 3KPRA 3QIUB 3FFCA 3QXWA 1KRAC 5CSSA 4P2AA 3KBJA 4NI3A 3PK7A 4P2QE 3C2YA 4GQGA 5KYWA 3AWGA 3L3DA 3FY1A 3OGCB 2WKLA 2FBJH 4RMTA 1ZPLA 4KDTA 4PB4A 4PM1A 4NPKA 3EKGA 4D9LH 2WZTA 4LGSB 1Y8BA 3QI9D 2WNNA 4GKLA 1VKXA 3EX1A 3RUGE 4A2MA 4JJOA 3RU6A 4DP1X 3NIDE 2X4SA 4Z0XB 5B39G 2Y61A 2PURA 1TPUA 3II1A 2O5ZL 3H2AA 1K5NB 4K8RH 4XGZB 1S5MA 3GIZH 3V9CA 1EUTA 1YEFH 3SD5A 1DUZB 5F96L 3SGJC 1T0MB 5DHEA 4J4KA 5IFHL 1XV8A 5IBTL 2HS8A 4PGDB 1WFIA 2VL4A 2XPYA 1L6SA 3QPQC 4ZSTA 3ATBA 3MCG1 4OV6F 3UJSA 1DWHM 1S8DA 2C3XA 2DQHL 4NQXB 4Y5YC 5KSVB 4XBSA 5BU6A 3W53A 1L9NA 5EBLB 5GS0H 2E4FA 2X4RA 4QJ3B 2A6NA 5F7BA 3TBTB 1DBAL 2JVUA 5I23A 3AQXA 1OGTA 3V18A 1DQLL 1RUKL 5KS9F 3ID7A 3AUOA 1GZQA 2HG0A 3EB4A 1ND0B 4NO0B 1WIPA 5AVYB 1SOSA 4H6EA 4UTKA 4MCYB 3D87B 4YHIA 1QFOA 2ZX7A 2CWRA 4XNUL 2X87A 4UM9D 2ZSVB 5JA9A 1SJHA 2C14A 4IT1A 2VR4A 1RZ7H 4MJHA 4Y4HA 3PJWA 5CG7A 3UTZA 1KZQA 4Y16A 1PAZA 2Q5BA 3UZVA 1WCBB 1E5ZA 1YEEL 5D33A 3I6GB 3BLKA 1SXBA 3D12B 4NT6A 4D3CH 2J24A 3CPGA 4F0KA 1W1PA 5G2HA 2IWFA 2R4RH 1F2QA 4N90D 3RLHA 3I74A 4F8TA 3C6CA 3LB6D 4F8PA 4AC1X 4DKTA 4ENEC 3TNOA 4I6KA 1USQA 1PHWA 3S83A 1RMFH 2JB6A 4DQOH 5C08E 2AI0L 3GKWL 3J7HA 4GPVA 4UINH 5EZJB 1YPFA 2O4QA 3K6SA 4EF9A 4ZB0A 5D1ZB 2A1WH 3TVMC 2HV5A 1M05A 2YL8A 2CCWA 5CEXB 1LQ2A 5EMKA 4Q8TA 3MKKA 2OOFA 3F4WA 1JMXA 3EA1A 5K1JA 5EGRA 1EAPA 3QIBC 1MCWW 5HXMA 3S6CA 1ISWA 1VBRA 2QJGA 3UZZA 1A3QA 2OMVA 4LL4A 1KPRB 4FCAA 1KPUA 2ANUA 5F9AC 1XLAA 3W2DH 4AYID 2X4UB 5KZ6A 3ONCA 4WO4C 3LTSA 3KYOB 4OJEH 4GIAA 5D70H 5KZMA 1N4XL 2KERA 2ICCA 5FF6A 2ZTKA 4HYTB 3RL2B 1YYAA 3NO1A 4NSKA 2EDHA 1H5BB 3ARBA 1ODAA 3ABKB 2X7LA 3BCFA 3BSZH 1IKNC 1Q94A 3DXAA 3O2DL 3OR6A 4JEGB 1Z9LA 1BF5A 3S8FB 3T1FA 1UZ8A 5T33L 3BZGA 1UOKA 1NF0A 4OLVL 1L6FA 1J10A 2PR4H 4PCSA 2HPIA 1N9PA 1NIUA 3VGEA 3EYUL 1RHHB 5DXYA 2WLKA 1EDQA 5EMMA 1FVEA 3GMQB 2UYLA 3L4UA 4P2QA 5AZEH 5FHAL 1YY8A 5B7YA 5JIWA 4FQQA 3F4VA 4HT1H 3NQVA 1YQ2A 3OLEA 4PH8A 4G8GA 2IQ9H 4JPVL 1G6VK 4K3ZA 1WTGT 2VIRA 1G9NL 4GMTL 3LEXB 8FABB 1ZXQA 4XD5A 3TFKC 4LRIA 3UPAA 2XTSA 5IW1B 1TSRA 3GZQA 4NUGH 3B2UC 3NFUA 4ZAKB 2GJJA 4G1EB 3LKOA 4Z23A 3P9WB 4GMEA 3F7VA 3CL7A 3LAFA 3DFPA 3UR5A 3C8KA 3OHXA 5HK4A 1K8XA 4P3CH 4AG0A 4W8BA 3SDXE 3CMJA 2X10A 4IOIB 3SURA 2HDJA 5IBLC 3T0EE 3K46A 4R83A 1FH7A 2AOSA 3GZAA 3GUTB 3MRQA 5EORH 2AAAA 3B3BA 4GD0A 2ODOA 5CPMA 2JB5H 2JJSC 4KW2A 4KZDH 3PFQA 1HJUA 3GHTA 2AJUL 5KVGL 1TVBA 2EO1A 1HH6A 4MZIA 2HT2D 4N2OA 4BE6A 3S6DA 4LSPL 3TLLA 3I6GA 4CD6A 3RVVC 5CN3A 5D1QE 4IU2A 5HDOA 5IR1B 1K3UA 1QFEA 5DANA 2BGQA 2Z2UA 4TM9A 5BMFH 4HCDA 3SW6A 4FEMA 3U6RA 1IM9A 4YHGA 4BCYA 1CL7H 4PJGA 1A5SA 4KEMA 4IM8A 2B7QA 4HUWB 3UACA 4PYGA 2JIEA 5EZLA 5KBDA 3GI9L 2YOCA 3ASWA 4Z6AT 4XUYA 1S7TB 1NDZA 1Z5LB 3VG0H 1UASA 3HURA 2QUUA 3GSRA 4X4KA 3AU6A 5DC0A 3MA9H 1UZGA 2YRPA 1CGUA 3PUUA 4BXSV 2J27A 5D2LE 4X7CC 4YBLB 4J40A 4LXFA 2EG6A 1IQ8A 2QJNA 2N0KA 4QTGA 4L4TE 4LOEA 4ELKB 3O9WB 2J56A 4Q9CA 2HRWA 4HSHA 4AWSA 1CBVL 5I8OH 4QXTA 1YX1A 3ESOA 3GSXA 2APTA 1U91B 2HISA 3RX2A 1LE9B 2HKAA 3PF3A 2EDMA 3RL2A 3ALXA 2UZIL 4PRHE 4L9LA 3NIGF 3DXAE 3DFTA 5TPWH 1XDJA 3ULVE 1XQLA 1A6AB 1SXCA 3A0OA 4P2RD 2AEIT 2F58L 4C56D 4C6QA 1NEZG 1KN2L 3PNWA 4HLEA 1Y0EA 3AU2A 3NSNA 2VLJE 2IPKB 1UUNA 4IHOB 1W32A 3V7MA 1XLCA 1F1GA 3D09A 3GNOA 9XIMA 1A47A 1HKFA 3V4VB 2ZG2A 3IGHX 1QWNA 3RAJL 1E1FA 2ZCGA 2DH2A 1B4RA 5BZAA 1DSFH 3UADA 2CETA 2R2EB 1HQRA 2Q2LA 1QTPA 5JUEH 1R6VA 2Z1KA 5E23A 1E6OL 2JCCA 2AJXL 2BP5M 1FE8L 3BWUF 3HR5B 4UT9L 3VSVA 5ISZB 3OAZH 3NM1A 2R1YA 1QI3A 2NTSP 3CBKB 1JGUH 2D03L 3A5VA 5IMKB 2R29L 1C1EH 4JPKH 4LIQL 3H7VA 5CCGE 1JZ8A 2J7GA 4UTFA 3EJZD 4AYDC 4YZWA 4YFEA 4DKEH 3BLLA 4LT9A 3BO9A 4OFYD 5IB4B 2XV6B 3VD2A 2OU4A 3OG3A 1FL6A 1ML0A 1PFOA 4C4KO 5I8CA 2BIIA 4JS7A 3WAJA 1P43A 2A3CA 2X7VA 3DBXB 3DFSA 5IG7B 2CSPA 1RH8A 3WXWH 2CBVA 1U3HB 2VX5A 4DZIA 3VFGL 1RIVL 1AGFA 1CJYA 1EMTH 4X6CF 4IUGA 4LGXA 5A95A 5F1OB 3AHTA 4LTSA 4UV4H 2GFBA 2PETA 4MDIB 3WL1A 3MAWA 1LM1A 3Q8AA 3RXZA 2NUTB 2GTQA 4XCNA 3GEFA 2VXUH 3KBHE 3BH8A 1JXFA 1O1HA 5D2TA 1BMWA 4CNTA 3HHMA 1ERNA 4M8QA 4ZS7H 5BW7A 3F7VB 5J11C 1KQYA 1YXDA 5JH2A 4HU4A 4N9BA 1OP4A 2BDQA 5PAZA 1ZSDA 2YCJA 1EWDA 3MUGB 4QRPD 5F2FA 4JQ2A 2LAAA 1FY6A 2OZ0A 3WQOA 4QYAA 3W11D 4JKPH 4D0CA 1RXOB 2XYLA 2VDNH 4MHHG 2DT1A 1TFHA 3D39B 4WJEA 2WSKA 4N1HB 5E9XA 5TDNB 4UNVA 1X5XA 1XIGA 3UTOA 3O4LB 1SN5A 4KDTC 5CP7B 5GGVY 4PRPB 2HJKB 3AU1B 2VXTL 4N9OB 5EB9A 4ZMXA 1W1A1 4APQA 1ZTVA 5BROA 3RB5A 4P57A 1B4KA 3N6JA 5B80A 2B1AL 3ZOAA 4GAGH 4LGPB 4H25A 3QAQA 1XYLA 5J0BA 5LBVA 5AW1B 1OTUD 1W0YT 3BSZA 4KMTH 3VXNA 4PJIF 2HJPA 2HKFH 4TTDC 3BPCB 1FNGB 2ZTJA 3EMQA 4JPGA 1S9YB 2NW0A 1BVWA 3HGJA 5I76B 3SPVB 5I16B 4LPUA 2PTTB 3ETBJ 5CIPB 1KYOJ 5TF0A 3WUWG 5T1KB 3Q9PA 3PXJA 1N68A 3HG1E 5EIIB 5TE6L 1NICA 3SSGA 3T8VA 1CB7B 1PU0A 2J6XA 1OX4A 2PLKA 4QAIA 3ZMEA 2GGGA 3MO7A 5DJDB 4C91A 3W4RA 2COVD 2YZ5A 3H9YA 3X14A 2A9CA 3U4BL 3ARTA 3V0UA 1JVNA 4FI8A 4F8NA 4DAIA 4AZ8A 1VFTA 2DB8A 2J13A 3R4IA 3Q2LA 5M7QA 4HOXA 2W3ZA 3D8MA 2W63A 1AD1A 3QQ1A 4EXKA 5AVNA 5IW1A 4XAWH 3AQUA 2FZ9A 2IANB 3EUDA 1P5VB 1MREL 2HE8A 5FIEA 1EEZA 2ZP0T 5H35A 4PH6A 4QT5B 3ZW3A 3O16A 3QZNA 3RF9A 1A3RH 2R69H 1SBSH 3NSDA 3W2MA 1IB5A 2A73B 4LVHB 5I19L 3LZRA 1AJ2A 4JDZA 4S3AA 4TV5A 1BFNA 3S48A 2GTWA 1M53A 4GH7B 3P0VH 4JFQB 3O0FA 5IHBA 1MDAA 1ME8A 1NL0L 4QXVA 5I6MA 3OZYA 4QRTB 5CPLA 5E09A 2ORBL 2VEGA 1AR1D 4F1SA 4EXAA 3WQ8A 2XZ7A 5I1CH 2F0CA 3LIZL 1PZ5A 1XIWC 4PJCA 2WWKO 5C6TH 1FDZA 1NOUA 1INQA 3OG6B 3NSXA 2VMCA 2JWYA 3CFJB 3CC5B 4PG9B 5EEYA 3K0YA 1W37A 3KPLA 2NVCA 1IGIL 3EB2A 1D3CA 3NYZA 3OB0H 1F1DA 4QKXB 5CEYA 5L7XH 1KYDA 1ZANH 1K8IA 1SBBA 4MMXC 4NKMA 5F7DA 2V5RA 1TTBA 3OKDA 2J8UF 3ZUCA 4JFXA 5DHDA 3MNZB 3VXQB 2HKHL 2FTYA 1UQYA 3D4GA 4G7RB 4RMUA 4QTIL 5IMLA 4JTJA 2OZNA 3T1FB 1XGTB 2H0FA 4ZFOA 2XXGA 4JDZB 5IQ7L 5IWLC 3RX7A 5LWYH 1PV8A 2B0SH 2PDNA 4F66A 1OT4A 3MNMA 2QKIB 3VRIB 1DSYA 3MRLA 2OX5B 1SVZA 3GS7A 5ABFB 3RDTA 3A4AA 1YMME 5E5LA 5JHLL 1JF1B 2Y7GA 3REWA 2SEBB 3OKNB 1B2WH 1HKKA 1AGEB 4L5FE 4Q33A 2HJLB 2ZUUA 3M47A 3MKVA 1LD9B 2CDEA 4OVXA 5B3JF 1Q6CA 2X9WA 2XFFA 2VXTH 3TMLA 3EBAA 5ISZE 4IIQB 1W8GA 1ZAHA 3Q1EA 4F93B 4B5EA 1CWYA 5HGHA 3WJLC 3O2LA 4XCFL 4GKZB 4LVOB 2ICEB 3LN4A 4WHYH 2WHVA 1OTUC 3REVB 3IJHB 3IARA 4NENA 7PAZA 4PRDA 5J11B 2YD1A 2V3FA 1H50A 4HVXA 4MXVF 3W2NA 2OMTA 5IHUL 1JRHL 4XRCB 2AQWA 5XIAA 4N0FB 1SSDA 1R7OA 2DMGA 1THFD 4JDEA 2VISA 3SYAA 5LQBL 3FU7B 3V36A 1FAKT 2FIKB 2R1LA 4JAWA 2Y9RT 3GSVB 1CZ8H 3O6FB 4I8YA 1KO0A 4UFLA 1PS9A 3UWYA 5ABFA 3P4OA 2YW3A 4XNZC 3A4WA 4E38A 1XFBA 5JPMC 4AWUA 4J6IA 1KKOA 4TO8A 2O61A 3M7FB 5ABTA 4GKNB 1U3HC 1E6QM 3KEDA 1DFXA 4XP9L 3FT4B 3MCNA 2F1BA 1XF1A 4Z7NE 1XR9A 4EZJA 5K9JH 1X7SA 2OSLA 4ORGA 3Q01A 4IRJD 3SY0B 4URKA 3ZIZA 3M0VA 4ADTA 3CFMA 3N41F 3OXRA 4HPOL 5FYLE 3I50L 3RZCC 1K4GA 2Y7NA 3B9KB 1N0LA 3MV7B 3QJXA 4OGZA 2ONEA 5E70A 5IJCC 2EPKX 2ZWSA 3RKDC 3ZPDA 4F2MB 4FULA 4ZMLA 4XP9H 1IAIH 3CH1B 3F62A 15C8L 4UCGA 4K1GA 3IVTA 3EZ8A 1G7JB 3KVQA 2X3CA 1N5AB 4GBUA 4GEIA 3I65A 4NN7C 3RGTA 4XB3A 1BZEA 1REIA 1E5AA 2Y1VA 1CZ8L 4J12A 4KEVA 3W22A 2P44B 4YYCA 4IL0A 4XZUB 3THMH 1PZ5B 2Y06L 4PJCB 4C6NA 1OAKH 3BH8B 4DCQA 1Y7VA 2VEMA 1CQKA 1G0YR 1P53A 5F1IB 2EH8L 4KX8A 4DJMA 1DE4B 4NJAL 4K94C 3LD8C 1DBTA 3G24A 5C0BB 4DGIH 4UNKA 3WK0A 4AD0A 3F65A 3NEXA 4KRPB 4XSMA 5TPWL 2EUWA 2VFDA 3SB3A 4HK3J 4OTKA 4P59L 3AREC 5EOCJ 1MI3A 1NKOA 2VJ8A 3VMNA 4P3DB 3QLDA 1AIFA 1VADA 1B3ZA 4LLUB 2ERJB 3D05A 1OM0A 3FNDA 5EZIH 1N8IA 3NQ2A 3SQSA 4M7ZC 1DWIM 4LC6A 2EILB 4IDLA 4D6CA 4XVSL 1Q9KB 3H9SB 1EFQA 3MJ8B 4PLNC 3EWUA 4BEUA 4LPTA 4XNZB 3S1UA 3RTQB 5I1IH 4J3SA 3T4YB 2EG8A 5EEUA 1R3HA 3DFOA 1EEYA 4KMLB 4ZTEA 5FLUA 1TJ1A 2NLIA 4MHBA 1PZCA 2O9PA 1QNPA 4MHHI 2ZE0A 2JKSA 3GS4A 1UD6A 1JAKA 5SV3A 4YK4C 4PR5A 4OFQA 1TQXA 4ZR8A 3ZE1E 1T1YB 4US6A 4BSVA 3GMRB 1RZKC 3U3HA 5T5FH 3DFYA 3DARA 3B37A 4ERSH 3MRLB 1YLBB 2WHJA 3D2TA 1QXLA 4RRPG 2A3TA 4P4KB 1R8LA 3CFDA 4OKVB 5D32A 1OAJA 1UB5B 4Z3TA 2ORBH 4QRNA 4UAOC 5FV1L 3VXMD 5ALBL 1JPFA 2G9KA 5ANMA 5F7UA 2RJHA 5DRWA 1HOCA 2DZXA 2R2HB 4NZRH 3FEQA 2INFA 4B9GA 1ZV9A 2DEYX 2FVNA 4R2GB 2XHNA 5D4QA 5LAXA 3U6XS 3U5YA 3PWUB 4FADA 1AE6H 1QLRB 4AM0Q 1XW8A 4E3TA 5MEND 4YCPA 5DFVC 1QI0A 2CRMA 3AS0A 2BASA 4PJ9C 4BV1A 3GLCA 3T0CA 2C9AA 3FTXA 1MREH 1U8LB 2D7PA 1JFQH 5DRIA 4IRSA 4GKSB 2YJQA 4MMXB 3V0WL 3TO2A 4F91B 2CNZA 1BVZA 4ZE4A 2O0TA 4A2RA 2WPBA 5DK0B 3H4GA 5I71C 1CR9L 4HC1H 2CKBH 4YHNA 3LA4A 3B9OA 4I88A 3M5YA 3W1NA 5DUBB 5T1DH 3Q05A 1LO2H 4OKDA 3MC5A 2V38A 4WSJA 3OVPA 3WBXA 2YMTA 1EDHA 4L5FL 5E08L 4I0PD 1P0KA 2QMJA 5EPDA 1OP5K 3II3A 2IV9A 2BM3A 3P73B 1A9BB 5DK3A 4KCTA 4LASL 3UP8A 5C9RA 2XX0A 4ZJ9A 3HU7A 1JRHI 1D2KA 4MB1A 4ORIA 3W9ZA 4Z78A 4GQ9H 4AYBA 3QIWA 1QKZL 3GTTA 3HE7C 5F4SA 3BSZL 3VXSA 2I9EA 1RZPA 2P8MB 2IQAA 1QRND 1DVZA 4M7SA 1H19A 3ISWA 1P1ZB 3DI0A 2ZXDA 3TZNA 5J3HD 3US1A 4MCZB 4B96A 3DSFL 5DS2A 1NCNA 4QHKI 5BRPA 1VZWA 2BS71 1FCBA 1A02N 3ARED 4Q6JA 2OCFD 4EIGB 5IEKA 2D7MA 2AKMA 1T2JA 1PZ0A 1FBAA 4YL2A 4XN2A 1KFWA 1XISA 3LKSB 1XLLA 4HPHA 4OGXH 3S36H 2OJEA 5FYJE 5TQ0L 4EKXA 4LGRB 2WJ5A 1OF2B 3SE9L 5DXXA 4QLJA 5ERWB 2NY6B 3DURA 3EF4A 1OINA 3G6JA 4BXVA 4X0VA 5L0QC 5D4YA 4C7GA 3O06A 4O28A 2E75C 1QVOA 1S6NA 3DO4A 3FDWA 4IBQA 1MG3C 4IMLA 1V3LA 4P46C 2K6WA 3VFMA 3X1FA 4AYGA 3JW7A 1QACA 4AF0B 3PGDB 2EXYC 4LYKA 3QUXD 4UDUB 5HPMA 3P3UA 4PJBB 2VWSA 3F3HA 3TXZA 3RVUC 4MNGE 1CDYA 3BE1L 1GQNA 2DZTA 3LTPA 4FX7A 1A6UH 1GCYA 1IEBA 5HJBA 2GTZA 2NWSA 3NCBB 4KPHL 4P5MB 3CHQA 4KNUA 5EOCH 4U3HA 1GYMA 3HNSH 5AOLA 3D2UD 1YTEA 2A5UA 4MJJA 5DO2D 2IPUG 3GX9A 4J28A 4L0ZA 2Z1PA 2IPJA 3ARBD 4HWBH 3QJZA 2ZOLA 3R18A 4RA0C 3DXAD 2YOAA 3QHMA 3THUA 4NNCA 4WZHA 2ATKB 1NANH 1V0MA 3LM7A 3QUXA 4LCUA 2E27H 4GQQA 4YNYA 2OPJA 4JX4A 5C3TA 1OM9A 4GY0A 3NQKA 3GUWA 5DUPH 3TEVA 2OLSA 1NTHA 4TUFA 2DQGL 1EGVA 2YLAA 1BG9A 2PYFB 3E0VA 3IBOA 3CPLB 1YDYA 1UH2A 3I68A 3JV4B 2IADA 2B7DT 2FL5A 4L18A 3DVNB 4A22A 3FMGL 3PS6A 4C65A 3EYQC 1MCOL 3ELAT 4GYBA 3HW7A 1GQIA 2CWXA 4P5RA 2Z00A 4PODA 1FCCA 3U0WH 4O17A 6A3HA 3QCUL 4XNBA 4F0HA 1X5GA 1LTXA 3WELA 1HX0A 4HJ0C 4AIXA 4F9LA 1SR9A 1BM7A 2NT0A 2WN3A 2YA0A 4FNLH 5D7LB 4P5KB 1GGBL 2V5TA 3GZPA 2EYSB 2V7HB 3LN4B 4U1HB 5DCCA 1JHTA 2ZOLB 4AC2A 3WBDA 4ZXLA 4OH2A 3WJLA 1OZMA 3CN2A 3B1TA 1MQPA 3B8DA 4LKXA 4M7KH 2G0LA 4LANA 3W1PA 1T2QH 1B5TA 1O5KA 5CZXC 1H41A 1NCOA 3EOAB 5DMGD 3MUAA 1ILUA 2WTRB 2XRAH 3AWOA 4FR1A 1LE5A 1S7SA 3PHOA 5DMIH 3HLAB 2OEJA 4Y0GA 3BP7A 4ODTL 3FRUA 3OJ2C 3ML9A 3CV5A 1SFLA 3QEZA 3WEZA 4QAWA 3FQUB 2DQTL 4FQJL 3RLSA 1RSYA 3VKJA 3SBWC 4XXWC 3SDCD 4S3EA 4HBQA 5AYIA 2NT1A 5J3HC 1IUZA 1N7KA 1K72A 3QDME 4HEPG 3RVXC 4WNSA 4RNFA 5I66A 1VS1A 3IKCB 4WW2B 1ZLWK 5BMWA 3GSXB 3HV9A 4L8BB 1W1B1 3T05A 5KAQG 1JNJA 4QRRB 3F5WB 5EU5B 1YN6A 4BELD 1UZ8B 3RGVC 3FYOA 1FGNL 5BUAA 2R56L 3N06B 2VUOA 3JZ7A 4JREC 5MKGB 3PLYA 1J8HB 2ZF8A 3ARFB 2W59A 3FUKA 5EOTA 3STLA 5BVJA 3GSRB 4NGHL 1E3FA 4L4JA 5I73C 4UZGA 3U9IA 2EE9A 1A6UL 4HAGA 3BZ4A 4I7ZC 1OGAD 1D5MA 3BE1H 4Y88A 5AKRA 3V0AC 3IFOA 4N1EA 4H1LB 3UBFA 4AVIA 5C6WH 1B2YA 1PFCA 2WSPA 1V7ML 3L16A 4YBLC 1UB6B 4NF7A 4N3UA 5TIMA 3JWDL 4IKLA 1BZOA 4LHUA 4PREB 5D7IE 2GYIA 1Q3NA 3W9DB 2I57A 1EJTC 5D7SH 2Z4TA 1POJA 4U28A 1B0RB 1BCIA 4QO1B 1W6LA 2QADD 4P8QA 2YGQA 5DZAA 1I9CB 4PMJA 3WS3A 2VUYA 3C6LC 2PRLA 1DVFA 1UM4L 4H00A 4LBSA 2H32A 4I18B 4PJXF 4Z0BL 3RWJB 1I2QA 3RPIB 2LGNA 5ID1A 1Z5YD 3IE4A 1LEGB 1UPPA 4JYEA 1KTDA 5JIIA 1HYRC 4TTUA 1CFMA 2VQ1A 4O5LL 3FU5A 1TR9A 4POZD 3BDKA 3MKGA 1E4LA 3DYMA 3JYBA 4WZ9A 1G9NH 3AREA 4GMTH 4C6OA 5A3HA 4HMEA 4J35A 4HIJB 5FWRA 4AYFA 4S2SA 3CQHA 4YVNA 4L8DB 4Q8NA 3PQYE 2YEZB 2X16A 2AJVH 4X0KB 5ECGA 1IYXA 3QYSA 3WMPA 5G1TA 1MY5A 3MLRL 5A2LH 5JO5B 3UZEA 4JEJA 5D7JC 1LWRA 1PY0A 2EIBA 4HKPA 5F1UA 2H8PB 2X9YA 5F0MB 1EDTA 1A1NA 3CTLA 1OADA 1TZHB 2VFFA 1FRGH 2DM3A 4MYPA 3RUGB 1F00I 4NWTL 5AOJA 5GGTH 4UOW1 4BHUI 1PO9A 1RK0B 4QLKA 4G11A 2X05A 4XOEA 1ADSA 4KWSA 3GKFA 4N9GA 3SZ8A 4FB7A 3DOSA 5CEZH 1GOHA 1P6AB 5DD5H 4C6CA 1OVDA 1Q2SA 4BWLC 3T6VA 4P2QB 1AO7E 1E4NA 5DJ6B 4NHUB 4HYVA 2Z28A 3KS5A 4JFFB 1TZ9A 1T0MA 2EZ0C 1J5OH 4JGNA 3BE7A 1XX1A 5C6TL 4ML9A 2YBTA 3WIIH 2A74A 2F7IA 2HJFA 2HRPL 2X1OA 3NFSH 3OKMB 4PJFB 3SDDA 3ZK0A 1C91A 2GIYA 4HZ1A 2OSLB 4HGWB 5ECJE 2CA3A 1A5MC 1YA5A 3CAWA 5SWQB 3QIUD 1G6RB 5J1AA 3V5KB 2KI6A 4N2NA 1CO1A 2WZ6A 4GKOA 4JFFE 4XNXL 1HKMA 3G6JB 4NJIA 3AG3B 4NKOA 3GXDA 4NUWA 4AQ8C 3H55A 1H5BC 3MHZA 1SBSL 1JGLL 2GSMB 4ETYA 3EUUA 3FH7A 4WI3A 1H3VA 3I85A 4JFHD 2ISWA 3ITGA 2CRYA 1RJCA 3CZLA 1E1EA 1A3XA 3SJNA 4QQUA 4IK7A 4R7NB 5JHDD 1V79A 4WO4B 4FL4C 1TSIA 2VC9A 1QWHA 3MYPA 5F3BB 3PQYA 5JLZB 4IKJA 1QX1A 1TJPA 5LIKX 3BX7C 4GXVH 4KRZA 3ZT7A 3MWCA 1FV1A 1XKJA 2PDHA 3F5KA 2W9LA 3MLYH 2XH0A 3WO8A 3H6JA 4WSKA 4DX3A 3HFTA 3DTXB 4CMHB 2EBNA 1H8NA 2A77H 5J4MA 2SFPA 3LEPA 1DBAH 1TVPA 1A5BA 1DDHA 3R10A 3TGXA 4D71A 2HEJA 5EOCL 1NC4B 3WJYA 3MLSL 4JMNA 3HJZA 4P2CG 3L4WA 4YOKA 3WO4C 3QOKA 3LCGA 4GC4A 3WKYA 5B8CA 3C6LD 1V10A 5FF3A 3N44B 2IOIA 1WS7A 5HI4D 1WKYA 4ANWA 2CLMA 4MY8A 4DI9A 2V63A 2MFNA 3DK0A 3MUJA 3N1QC 3PIQA 5L2KA 1KTRL 4NN6B 4R2GD 2CHOA 2WV8A 3HS9A 2CXEA 3DN5A 2WWMC 1K8DA 3ZKMC 2ITEA 5HMFA 4MD4A 2X6CA 3MJ7B 4AE1A 1WZ1L 3APDA 3N4AA 4FXSA 3CFJA 5CZ0A 1PYFA 1XZ0B 1S9VB 3DX7A 4UXDA 3IRZA 3QV9A 3MUGA 4PQXA 4Z2JA 1XRVA 3ZS4A 4ZSOE 3DIPA 3EH2A 1I4FA 3GIQA 3B2PA 1JV5A 4N6RA 4DQAA 2FX8H 4H40A 4OVUA 1WC7A 5CCKL 3FO0L 2WXDM 1KCXA 1HEZB 4LYRA 4IOSA 2VDLH 4QIUA 1UMYA 1TJMA 2VWEC 3VFMB 1CDBA 1AZ2A 3EZ4A 3FU8A 4P4KA 3ZDZF 4O1AA 5I75B 4LE8A 1UWGH 4CRPA 2EIJB 4YHKH 3LRGA 3TTYA 3PJXA 1AQKL 1A4MA 4HS3B 4FKEA 1UQZA 3U2SB 2X6UA 3Q2WA 4MDJA 5D6CB 3OAUL 2WLLA 5I1AA 1FWIC 3MVTA 3SCNA 3T2QA 1QKZH 2LW3A 1DVQA 3D46A 1QWGA 4JANA 4OCRL 5FR3A 1ZAJA 1AACA 1RZKH 4O9HL 3KHJA 1NFDF 3QSTA 1U30A 2OMNA 3RUGA 1H3UA 4UV7H 5E00B 1V5XA 4AMCA 2E9BA 4NC2B 3L1EA 2Y7OA 2IH3B 4JHAL 5EUOF 1HL2A 4BF9A 5EBAA 1KCUL 2Y36H 1NLBH 3NQDA 4OD3H 3ZO9A 2OXNA 2V17H 1TG7A 4BH8B 1EJVC 4B92A 2NY0B 1OF0A 3SE3C 4KO7A 5DWPA 3QIUC 4N87A 1GYNA 1AJ7L 1R5YA 2B4CL 1AD4A 1TPWA 3QYQA 3LIZH 3NSYA 3CFBA 1HH6B 2EIDA 4ZZKA 2E8ZA 5GGQL 1JUEA 1LF1A 1DSFL 1YAIA 1ONEA 2C16A 2DMBA 4PRWA 3N85H 4B6ZA 4ALDA 2W4XA 2YCLB 5TNVA 3AVEA 2UY5A 4AL8H 2R39A 2YL6A 2CIIB 3D3AA 1KXVA 3LQAH 9CGTA 2CCLA 2VXQH 3PWPE 5F9WB 2X6MA 1FH9A 2EHHA 4Y9EA 1YQVH 2CK0H 2Z4QB 5GSVB 1JPKA 2ADIA 2ESVB 3L5XL 4WAFA 2X8RA 3R58A 3FTSA 4JFWA 5I1HL 4LUYA 4YDJB 3G1AA 5IB3B 2H6OA 2UZIH 2X1RA 2R2BA 2AV1B 1TJRA 4FHAA 3S36X 4W87A 3CB3A 2GUYA 1QNZH 3FA4A 3H9HA 5C0RL 4LRIC 4NQTA 4WIWA 1XF4B 3AW5A 4H01A 2YAOA 2I7OA 3QORA 2NSQA 4N4YB 5FA3B 3PY2A 4ICXA 3OTTA 1XLFA 3U7VA 2J1WA 5DJ2A 5IM51 2OWWA 1QOQA 2ZUVA 2HN7A 2YAQA 1NOLA 2F2HA 3QUKA 2ACQA 4FNRA 1HHJB 1KJMA 5IVXA 1AH4A 1WA2X 4OQTA 3HR6A 1PKNA 1XGUB 1KJ3L 2H8PA 1QAWA 4NNPL 4XCYA 2EDKA 3LV3B 1A6ZB 1EJ8A 3H22A 3ITLA 5E4EC 4LCCA 4Z9KB 2OKOA 3NDZA 1EF2A 2G30A 1MFAH 2X4QB 1U2YA 2ESVA 4N2FA 2O7QA 1UXWA 1GW6A 3W1ZA 5C2CA 4KFNA 2Y5QA 4CSTA 3PAJA 3NPUA 4OHQA 1MIEH 4ODVL 4WEBH 5DMJB 3LCFA 5CPOA 3WY4A 5T3XL 4TX9A 1KIUA 1KN4L 2F6AA 3E0LA 3PXLA 1IL1B 3DKLA 1U3JA 4PUEA 5FV2A 5F2MA 2J6WA 3W0WE 5GISH 4O1FA 3NCMA 5GS0C 1JNHB 4WWKB 5JPNA 4IU3A 1T41A 2JCCB 5KSAB 3PSWA 3BMVA 4JFVA 5HI3C 3SQLA 1XH0A 3KPRE 1N8OE 3MZGB 4MNQA 3ESVF 3QHFL 4MJIA 5FFOA 3WS3B 3GMPA 1H1YA 1LT8A 3E0FA 1JZ3A 4G1NA 1J0JA 2J7BA 4NUJA 2XNAA 3C8DA 2KS0A 1OM3L 2GJXA 5J12C 3AIUA 3O8XC 1D8WA 1MZRA 2F8QA 3W86A 5FGRA 1F5WA 1SXSA 1P4UA 4WI4A 4WI2A 1QP1A 2D7NA 4UIOA 1JWUB 3PULA 3MWAA 3KCPB 4EZLA 4R5XA 3BHBB 4XR8C 4RZ5A 2PYFA 1IL1A 4XB8A 1L3WA 3HAEA 1T20A 3MLVL 2CLHA 3V52L 2Y5JA 4GIYA 4BRJA 2EDLA 1FLTX 3IBEA 5CBEB 1IM3B 5GZOD 1MJUL 1RIUH 3UD6A 4UQCA 3WQWA 3BW9B 2H0JA 4FYRA 4LLDB 4ELMF 1AR1B 3GMLB 4DH2A 4PVBA 3CWNA 3QXAB 3WG7B 1M7XA 3G77A 3S37H 1GJWA 4AGNA 5HSFA 1OC7A 1A5FH 1BBDL 1EXGA 3DHPA 4JFXB 5BUGA 3QYNA 5CZTA 2DPEA 3ATAA 1RK0A 3TC3A 5AAMC 2Y6TE 3WUZA 3OBKA 4UR7A 5FJJA 3CH1A 1TJGL 3GFXA 3QFDB 3WN5A 4OUUB 3NXFA 4LUSB 1MAMH 3ARGA 5HGBA 1MFEH 4N20A 1JPFB 3QQNA 3RA7H 3IEBA 2OZ4H 2DYPA 4AE0A 4KF1A 2B5IB 4YSSA 3GYCA 3UP1A 2PC8A 3K0WA 3LSOA 4XKYA 5KS9A 4PJGE 3D9AL 5FK9A 1BWWA 2FIRT 3ITTA 2J78A 3CXFA 1EHXA 4PUBL 4I5UA 3UCRA 4TLKA 1A6WH 5HGAA 1T5WA 3T1GA 4FX8A 1TVHA 1MCIA 5GRVK 2CU0A 4B5NA 3GJEB 3OLDA 3QFJD 3HPAA 3OJGA 4NC1C 4R33A 3KXFE 3GSNH 2GITB 1UJ3B 1CLOL 3MRQB 1MLBB 1E4IA 1X4YA 4QAMB 1GPWA 1YXYA 5GSRB 1M2VB 3TC6A 1BBJA 2I56A 3F2BA 2OSYA 4OZFG 4BF5A 4KKNA 2DJ4A 1GAFL 3EJRA 1MJ7H 3WY2A 4L1BA 2MNRA 1Q9WB 3CFQA 4ADSA 1JXGA 1YN7B 4WGWB 3B03A 4JFPA 2W8CA 4OSUL 3W9DA 4AGOA 4PJ8D 1EPXA 3VCCA 3M1OA 1NGYA 3M41A 2VDOL 3T4YA 1GUVA 1LTDA 3CT2A 3QC3A 4QXGH 2A4CA 2NQDA 2WMPB 4LCWE 5KSAA 3GU9A 2C91A 1AYOA 2J47A 1KV3A 3TTEA 1HZKA 3DUHA 4C47A 2W91A 4Z78B 3IWPA 3SGGA 3DWTA 3FCTA 2I9TA 3HGOA 4Y89A 4JEQA 3O6DA 3QQ9D 3VCLA 1U8CA 5J13C 1G4TA 4RX4A 4AIOA 4LB4A 4MNKA 4NO0D 4ACZB 2AJSL 5LXGL 1T66D 1YY9D 4HUCA 4LSTL 5DS8B 2UY3A 3IXTA 3DHUA 2UYLB 5IQ9A 5JUEL 4R4NC 4U1MA 2PE4A 4B5VA 1WV2A 2EKSB 3SJVA 4EF3A 4ZEPA 5I2IA 4NZ8A 4A7GA 4ELKA 3NZ8A 3H70A 4GA8A 4C1LA 1U36A 2C3HA 1RSCA 1HNFA 4AZUA 5KETA 3L5HA 1R30A 4DCQB 3S5LB 3RJYA 1AMXA 4TNWK 4OQ1A 1H6TA 3GWJA 1A3RL 2P49B 3B43A 1GT8A 5KEZA 5C09A 2IXQA 4PGBB 2UY4A 3TXVA 5BO1L 4ZUVA 1DVFC 2NY4D 1WA3A 3RX4A 4JM2C 3UWVA 4I3SH 5A69A 2ZXAA 1OQXA 2WBJA 4X7SL 4Q8WA 3ZSTA 2BNRD 1O4UA 1M05B 1CVSC 1OD7A 1UJ3C 1PBGA 3VXOA 3FU0A 4UTIA 1X6NA 4GS7C 3NT0A 4IISA 5LLIC 5A8PA 3WNIA 1O68A 3AYRA 3SAZA 4DETA 3AIEA 1S5HA 1JZHA 3QDAA 4N0UB 1NCIA 1JCXA 1J8VA 1VSCA 3S5SA 4N90E 1WYIA 1NBVL 5A6TC 4NNYA 3P14A 3NCXA 3N3MA 3S5LG 5D2WA 5HMDA 4P2QD 4Q4EA 3X12B 4FQHA 4QWWC 2QFRA 4FQ2L 1CICC 1QASA 2CIPA 3ES8A 3W1XA 3WF0A 4DJED 2IWEA 1T4KB 2CRIA 3FN3A 1Q6OA 2TSYA 2JJVA 1C5BL 1XHHA 4YHOL 3AS1A 4BFIB 3Q58A 2ATKA 2PP7A 1E4JA 5FEZA 1TTFA 3PDGA 4WEEA 3KPMB 1SW7A 4M6AA 1VZGA 4ODXB 1QBBA 4XCCL 1B0GB 1GQLA 2O6CA 2W9EH 4PJHF 2HFFB 3EJQA 3PJNA 5A1AA 2KQMA 4Z1DA 1O7VA 2F1AA 5FX3A 1Q45A 1T5KA 4QQ3A 1M9HA 3HC0B 1RPQA 3W2DL 2DUZA 2XBDA 2A2QT 1FFOB 1TENA 1SJBA 5IBXC 3E6EA 4RZCB 1NWPA 2NW2B 2ZJSL 3LEXA 3A6BL 3HRZA 3NGBC 3I6KA 3SGDH 3C08H 3WDJA 1TWZA 2F6XA 4K7YA 4X8JB 2WP3O 5BZWB 4EN3B 4A7VA 4QE4A 5FUOH 1DVSA 1JDEA 3HI6L 4LF3A 1F6LL 1E9QB 1VACB 4L9LB 4UT6L 5JPMB 4H0GA 5GRWA 2QF8A 4PJ8C 1AKJD 1A4JB 1W72H 1DBJL 2FB2A 4XKMA 4QLRA 1ZJIA 1TMCB 1KCRH 1A3LH 1AXTH 2HT3D 3WQCA