1QW8A

Crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNAMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 171
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qw8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qw8A02
3WDRA 2FH8A 3N12A 1N82A 2IUZA 1EO5A 5E70A 2VVNA 2WHJA 4HMCA 5LYRA 3T0AA 1QPKA 5BXPA 3MO4A 4P8VA 2A3BA 3LPGA 2D2OA 3A22A 2WAGA 5LA0A 3MSDA 2BFGA 4P8UA 1RP9A 1D3CA 4LYPA 2WHLA 1CECA 4XB3A 2QPSA 4EANA 5I2UA 3BVVA 2Z1KA 4S3KA 2WCAA 4WKFA 1KFWA 4V27A 1VRXA 3WUGA 3UG4A 1UQYA 2IXVA 4D6DA 3W29A 4EK7A 3KL0A 5DT7A 1JNEA 2DT2A 3DYPA 3ZJKA 2QLYA 1DWGM 3L4ZA 1E9LA 4CCCA 4UOZA 3ARPA 3H55A 4DWSA 1CGTA 2VX7A 3GNRA 2GJXB 4AISA 1IZKA 1OSEA 4B3KA 4DUVA 3WBEA 1TQUA 2HISA 2WKGA 3DHUA 3VDBA 1M7XA 1W3HA 4TX6A 2X2YA 3VUPA 2WZEA 2CETA 3VGGA 3AHYA 4FLRA 4AZCA 2E8YA 3IGUA 3VM5A 4NSBA 1KGUA 3AZSA 1LL6A 5HDRA 1E5NA 1QNPA 1V08A 2EPOA 3GBDA 1E6SM 3VU2A 3VO0A 5F7UA 1A3HA 4GXPA 1D7FA 1IT0A 1VFUA 4JIEA 3CZGA 1UH2A 7CGTA 1UD3A 5IDIA 2G3JA 1UZ1A 4KGLA 2OSWA 1CDGA 3VDAA 3DX3A 1WZLA 4D6IA 2ZWYA 4GIAA 3S5ZA 4MB4A 5A69A 5A94A 3W0KA 4CKQA 5CQ1A 2DQXA 3CV5A 1W2PA 2Z1SA 2ZX5A 3MMWA 3PZMA 8CGTA 5HPOA 3MU7A 3WY3A 1CLXA 4BZYA 1K9FA 4WSJA 2BHYA 1E0WA 1XD1A 1E6XM 2CIPA 3THDA 1CLVA 4UFKA 3WBAA 4K68A 4AZHA 1HN1A 3PN8A 1W91A 2GK1A 2WHMA 2XJ7A 3K8LA 1NH6A 3WH9A 4MTVA 2YIHA 1H3GA 4UQBA 2XM2A 2G4FA 4EE9A 2FE0A 4ACZA 1S46A 2PBGA 4PMQA 2XVPA 4JCLA 1OD0A 5FL1A 3SCPA 4BS0A 4L4OA 5BCAA 1NM9A 2G3NA 3BSHA 1QNOA 2X05A 4DO4A 4U2ZA 4AWEA 5BXSA 3CUJA 4AW7A 3GYCA 4MB5A 5ABFA 3WIJA 2X1IA 4IM4A 3UEQA 2DT3A 4R27A 1KCKA 3SCNA 4P7RA 1VFMA 3A4XA 3N04A 2J8GA 3AMKA 1ZBKA 3W38A 1VEOA 3SUVA 5E09A 1PBGA 1GZJA 1K6AA 4J3SA 3RCNA 4FK9A 4MNLA 1GJUA 1W9BM 4M29A 3VIMA 4CUCA 1ZJAA 4DO5A 1NWUA 5JUVA 3BUPA 4M82A 1HJSA 3WDQA 3WDIA 1W3JA 1C90A 3GH4A 1WDQA 3QOKA 1HIZA 2DSUA 3BSGA 4ML4A 1UR9A 5CSUA 4H04A 1UWRA 2EABA 3L4XA 3HG4A 3WDPP 2EQDA 1H5VA 2DIJA 1KGXA 4RE4A 3OGVA 1XC6A 1EQPA 3CZKA 1V6WA 5A6SA 2VR4A 2Y24A 4JKKA 1BGAA 2YOCA 2GDUA 3CPUA 2CHNA 2WC7A 2FHBA 5A1AA 1UASA 4B3LA 4HPHA 5M5DA 4J27A 2CESA 1CZ1A 1KXTA 1VBUA 3M7SA 5IFPA 3EDKA 1TUXA 1TG7A 1C91A 1EQCA 3WF0A 1LG2A 4U2YA 3BAYA 1UR0A 4UFLA 2G3IA 2A3CA 1TQVA 3D5HA 1JL8A 1KBBA 3VDCA 4PMRA 2VZTA 4B15A 3GXFA 3NDYA 2C7FA 4HU8A 1JXJA 1QWUA 1B3VA 2X0YA 3AS2A 3NSXA 2E8ZA 3GNOA 2O9RA 3ARUA 5A6BD 4KMQA 3VTRA 5DMYA 4PTXA 3SCVA 5ECUA 5D9OA 2V5CA 3PZOA 4PSRA 2V38A 4PMYA 4P7OA 1BG9A 2DSVA 4KWUA 5A6BA 1OB0A 1JZ6A 2VZUA 3MS8A 4PMDA 4LXFA 3EJUA 4FNSA 3I3EA 3BUQA 1Q6FA 2J8FA 3WF2A 1PS3A 1TVNA 3VKKA 3WUBA 4N0RA 4P8XA 1FH7A 3BCFA 4GINA 2J77A 2WCGA 2EXOA 5IXEA 4NZCA 3AICA 3VX0A 3CZ8A 2DT1A 1JZ5A 3A6OA 1FH9A 4WJXA 3G6MA 1QI2A 2J75A 1EDQA 1G01A 4P8WA 3AXHA 3UERA 1BYBA 4MDOA 5GNYA 2DIEA 1C8QA 4UCFA 5CPTA 4W93A 4IPNB 4LGXA 4MB1A 2JFEX 5DT5A 4WIWA 1E71M 1PZ2A 3CZLA 1W9DM 1WZMA 2WMJA 4X0VA 2X8RA 4UQDA 5JIWA 1ESWA 2YFNA 1JZ2A 3WH8A 2EPKX 2BY1A 1VBRA 2V3EA 1W9VA 2IGTA 3L4WA 2ZE0A 2AOSA 3HG5A 4PTVA 1ODUA 4CVUA 3PZVA 1B2YA 1CXLA 2PWEA 1B9ZA 1E6ZA 2WM0A 4FMVA 3MSGA 4C7GA 1GONA 5C70A 4PBGA 4W5UA 3DDFA 2YLLA 3A21A 4LPCA 3N1AA 5A6MA 2BY0A 3AIUA 4TX8A 4M80A 4HOZA 3AZTA 4UFMA 1CXIA 1UR2A 2XGBA 3BAJA 3VPLA 3B9DA 4AY1A 4DM2A 4QAWA 4Z2HA 1ISYA 4UZUA 5I5RA 2OW6A 3W26A 4U31A 1E0VA 1V0LA 1TMQA 1PX8A 1H49A 1DHKA 1W1YA 1XSKA 1SR0A 3D3AA 3O2LA 4ZE4A 2Y4SA 3WDJA 5D9MA 2OYKA 1JDCA 4QDMA 2BY2A 4FLQA 3VX1A 1WDRA 3U5UA 1PX3A 5CPSA 2G8ZA 4XZBA 2PWGA 1NOUA 4E8DA 5A8MA 4Q22A 3CTTA 1C8YA 1UH4A 4UFHA 3AMCA 1CPUA 3GXDA 1MQQA 3SCUA 4J3TA 3WQWA 4BF7A 2EJ1A 3ARSA 4W8LA 2VNCA 1V03A 1WP6A 3WQ5A 1MFVA 4OOUA 4AZIA 1ITCA 1CGWA 2V3GA 5M03A 3VD9A 2WB5A 4A4AA 2XWEA 1XYZA 3BLBA 4FF5A 3FXYA 3W53A 3OLEA 3HZ3A 5FOOA 2J7BA 4GO8A 7TAAA 3QGVA 4PEEA 4RE3A 5EMYA 1UKQA 4HPGA 4GI8A 4CN4A 3VMOA 3VD4A 4GI9A 1K9EA 3FW6A 5A2CA 3D4ZA 2W66A 5GPRA 2WVUA 1FFQA 1TA3A 3VIJA 3F4VA 1KQYA 4AMCA 3ZO9A 4S3JA 1HVXA 4CCEA 1KXQA 1V0NA 3D51A 1SYTA 1ZB5A 2YDQA 3WH7A 2JEQA 5CLWA 1OGGA 1KR0A 3FN9A 3J7HA 4JKMA 1V3HA 4A3YA 4FNUA 4ATDA 3N13A 1H4PA 3UG3A 1CNVA 2YBTA 2ZUWA 4AMWA 2OYMA 1UWQA 2PC8A 2XHYA 1AQHA 4CD4A 1E6PA 3W81A 3WEMA 4XZWA 8A3HA 5CGMA 5A6AA 5D4YA 4MDPA 4C7FA 4AZ6A 4PN2A 5I77A 3L4UA 4URIA 5EBAA 3VVGA 4TOQA 3GH5A 3B9AA 2BY3A 3DYMA 4CU6A 3EJRA 2WWDA 5A8QA 1M04A 3EDEA 3GM8A 1UZ4A 3WNKA 5LA2A 4AEEA 4QCFA 1V6VA 4V2XA 3WQ8A 1FOBA 3OIHA 1JZ3A 1EDTA 3B8SA 3PZ9A 1WZKA 1ISWA 1MFUA 4W84A 3RILA 2J79A 1GQKA 3BAWA 3AMDA 2GDVA 3BUDA 3BMVA 3GXIA 1OBAA 4BCEA 2XWDA 4AYSA 4LYRA 2X2IA 2XM1A 5EB8A 1WDSA 4PCSA 1GW1A 3DDGA 4OJYA 4CU8A 1EIBA 2Y8KA 1GOQA 3D4YA 2VURA 3AOFA 3CMGA 1UUQA 4AEFA 1CBGA 3VD3A 3AIBA 3BLKA 1Y7VA 4IISA 1BF2A 1NWSA 1HKMA 2D73A 1JXKA 1XRVA 3SCWA 1ZL1A 3BLPX 1XH1A 1GPFA 2J47A 3WQ6A 3PTKA 3UETA 1ZU8A 4ZXOA 2XVGA 3ZSSA 3VIOA 1EXPA 2J62A 1V3LA 1VENA 2YL8A 4BQ2A 3ECQA 3EMZA 1OGBA 1X6NA 3MMUA 1W1PA 4P7QA 3VGDA 4MAZA 1FP9A 3CC1A 3SUTA 1H1NA 1LLOA 1WDPA 4BQ3A 5LA1A 4JFUA 1ZBVA 2VX5A 4QLLA 1MVYA 1VJZA 2ZUVA 5E9AA 2F7QA 1L0PA 1DWIM 1GOWA 4PMVA 4AMXA 2J7DA 2TAAA 2ZUUA 3W6MA 3VIIA 3AIRA 3UESA 3CMJA 4B9YA 1TR1A 4H8HA 1NP2A 3AMLA 3TTYA 1QI3A 5I24A 1R8LA 1EDGA 2CPUA 1K9TA 3CHDA 4AD4A 2JF7A 3POHA 3WUEA 4D1JA 4D6EA 1HF6A 3N9KA 2FGLA 2PWFA 1H2JA 3SEPA 5AYBA 2DSWA 3AIWA 2XUCA 1PJ9A 2QMKA 2BHZA 1GUVA 3ARZA 1HJVA 2JALA 3VGEA 1KGWA 3L4YA 5D9NA 1US3A 1J0IA 2V3DA 3VIGA 3IAPA 3ARXA 4NRSA 2WC4A 4AD3A 1O7AA 3AYSA 5E0FA 2WBGA 1X6LA 2FHCA 2WVVB 3WUFA 3OGRA 4UFIA 1GHRA 3QOMA 4UTFA 1B3XA 2YBUA 4UQAA 1LL7A 3CZJA 3ARYA 2DSKA 4XV0A 5AC4A 3F5KA 5BXRA 1E15A 2J7CA 2CYGA 2FHFA 3AHTA 1GOMA 2WW5A 3ARQA 4CN6A 5BYWA 4UQEA 3O6AA 4UZSA 3SUSA 4FNQA 3VNYA 4HTYA 2E9MA 4PMZA 4LYQA 1E56A 4ZEPA 1BYDA 4AIUA 2VL4A 3TV8A 2EADA 1H41A 2VI0A 3TTOA 5BRQA 2YL5A 3O9NA 1WO2A 3PZGA 3GZAA 4HZ7A 1MXGA 1Q6EA 3EBVA 3NUKA 1JZ4A 4UOJA 3VMNA 4UNIA 2ZX6A 3KL5A 4AIEA 1H11A 1E1FA 3A4AA 2J25A 1FFRA 4DUWA 2XSBA 2ALWA 2WKLA 3SIMA 2EACA 1BTCA 2Q8XA 4Z2KA 5CXPA 3T08A 2VUYA 1PX4A 2WZIA 1J0JA 4UOQA 4GQRA 3CGTA 2W63A 1E4LA 2XGIA 3PZQA 4HZ6A 2YL9A 4W5ZA 3ZMRA 4PMOA 4X0NA 2CXGA 4TXEA 5AC5A 1BVZA 4HA3A 4D72A 1QNRA 4H41A 1JDDA 1EOKA 2XSAA 1W9UA 1WCGA 2YA2A 1RD6A 1P6WA 2WMIA 4F9JA 4WLCA 2ZOXA 3A3HA 5BWFA 1E4IA 1MW2A 2FGZA 5BROA 4QLJA 3AHZA 4Q7NA 4FNTA 2VOTA 1UWIA 3DYOA 1JAEA 5CGTA 2GJRA 1ISVA 1HP5A 4MPKA 3QR3A 1E3XA 3DHPA 1W3LA 2CKSA 2X2JA 1OT2A 4JAWA 2UWFA 1J01A 1U30A 3VDHA 3WF3A 3LXAA 3A47A 2D1ZA 4B9ZA 2NSXA 1W32A 2OLHA 4AD0A 4HOXA 3H53A 1C7TA 2OWXA 3LMYA 4U3CA 4NRRA 7A3HA 2EEXA 3SCQA 1QOXA 4PTMA 4W85A 4GKLA 1UD6A 2FDMA 1UD4A 4W7WA 1LG1A 3EDFA 1C93A 3KLLA 3HU7A 2D22A 3MUY1 1TQTA 3IJ8A 2X09A 2DSZA 4B16A 3BCDA 1E72M 1Z32X 1CWYA 2JIEA 3GH7A 5A95A 1GORA 3VIHA 3WMSA 2PBOA 1IZJA 1BYAA 3OB8A 5M17A 1B31A 1R87A 4PMUA 2NW0A 2X2HA 1GVYA 1V3KA 2XFFA 1VJSA 2J78A 4CD6A 4CD8A 2J7GA 1UR8A 2J4GA 3SUUA 5IHSA 4M56A 4DWSB 2C8NA 2OW7A 1C8XA 2VX4A 4Z2IA 3F5LA 2VMFA 2ZXQA 2QMJA 3T2PA 3GBEA 1WNOA 2CHOA 4CCDA 3TTQA 1V3MA 1D2KA 1E3ZA 1R7AA 1RP8A 4AZCB 3ZM8A 1JAKA 3IAQA 1JZ7A 1FP8A 1SFSA 4U3AA 2W5FA 3RJXA 1FH8A 3S6TA 2CBJA 1HJXA 2VQTA 1WAWA 5FIPA 3LPFA 4JZ5A 1LL4A 2XN0A 3BUIA 4Z2JA 4WSKA 2ZXAA 4ZE5A 1HKIA 1UWTA 3QHMA 3N18A 1MYRA 4TVCA 1B90A 2FH6A 1U33A 3LXBA 4W7UA 1UA3A 1R7OA 1JD9A 1L8NA 1OIFA 4FLSA 3ALGA 1SMAA 3MUAA 3W6LA 2RGMA 2EPNA 2B31A 2XIIA 2WLZA 1CYGA 1CIUA 5CSYA 1J11A 4Z2GA 1OCQA 1GHSA 3CHCA 3BVXA 5I0DA 2VRQA 4HU0A 3VSVA 2GK1B 2F1BA 1CEOA 3CUHA 4TTGA 2Y5EA 4JFSA 3PTQA 1JYNA 1XSJA 1PPIA 4ACZB 2HVMA 3OA5A 2W4XA 2VZSA 4GI6A 1W1VA 3FHAA 3NCOA 2FYVA 3LXCA 3EDDA 3VGBA 4MB3A 2WVSA 3KL3A 3JUGA 4LQ1A 1VEMA 4D71A 3TA9A 4OKDA 3E1F1 1AQ0A 1R86A 5ABFB 2IXUA 3M46A 3SCTA 1JNDA 5FL0A 4JL2A 3G6LA 2GJPA 1XV8A 5ABEA 2WBKA 2X0HA 1UWSA 5E1QA 1GQLA 2WC3A 5BRPA 3HG3A 1MQPA 1T0OA 1XCXA 3ZR5A 1LWHA 2D3LA 5E6YA 2YA0A 1NP0A 3EJSA 1JF5A 3VM7A 3BVWA 2RGLA 2F2HA 4JKLA 2NT1A 1U2YA 2D20A 1JYWA 1Q6DA 2WVTA 2PB1A 1FHDA 3WMBA 3SCSA 2VT0A 2PF0A 3BAXA 3BH4A 3RO8A 3FY1A 2XN1A 2XIBA 1Q4NX 3BUBA 1VFFA 2OWCA 3EJTA 4J3VA 4CVWA 1NOWA 1OM0A 3UG5A 1US2A 2XVKA 3DECA 4AZGA 3RM4A 5A2AA 2OSYA 1M03A 3AROA 2VX6A 2JIWA 4DUXA 3L2LA 1V6UA 4BA0A 3LX9A 2CITA 1OINA 2GJXA 3BC9A 4OIFA 1E40A 2CCRA 3ARTA 4QCEA 1E5JA 3ZT7A 1ODZA 1TE1A 3FHQA 3VD5A 3TP4A 5E6ZA 2VZVA 5IFTA 1JFXA 2D0GA 3U5YA 1QI0A 3S2CA 1UR1A 3SCOA 1UKOA 1NWTA 4ZENA 2AMGA 1O7DC 1B1YA 1ZS2A 1HX0A 3OLDA 4HA1A 3RM9A 4E2OA 3N11A 1QVBA 1KB3A 1KCLA 4MJ4A 2UY3A 4JFVA 1E70M 3OZPA 1UOKA 3IJ9A 3MUZ1 1QI5A 4J28A 5TD4A 2A3AA 4L4PA 3KLKA 5CG0A 3PZUA 5A8OA 2VZOA 5A2BA 5KEZA 2ZXDA 2VTFA 4D1IA 1DWHM 1E4MM 3SUWA 1BPLB 1RH9A 1V0MA 4F9DA 1NOFA 2WMGA 1PZ3A 1B30A 4ATLA 1CXHA 1FHLA 4F66A 3MV11 3WN6A 2ZWZA 2VVSA 1E0XA 4M24A 3AI0A 2XFYA 1WZAA 1PIGA 3VSUA 4ZFMA 2YDRA 4AYGA 2OSXA 3T2QA 1UG6A 3A23A 5KZ6A 3WH5A 1SZNA 3OLGA 3WQ4A 2ESCA 1M01A 2UY2A 1H0GA 4YPJA 5I78A 4A3HA 4EKJA 1W9XA 4OBRA 5A3HA 1ZJBA 2WSKA 1FA2A 2O9OA 1J0HA 4OUEA 3MI6A 4TVDA 1OWQA 3I3DA 1B3WA 4W7VA 1BQCA 5FKYA 1XH0A 1CXKA 1TFVA 3S5YA 3W37A 1DWJM 2CBVA 1NQ6A 1GJWA 5A6JA 5CZKA 4V28A 2EO7A 4PYSA 3BXWA 4NZFA 1HTYA 3DC0A 2F61A 4MJ2A 4PTWA 3BVTA 2YA1A 3AXIA 1NWRA 2F7OA 5JBEA 2D0FA 3CZNA 2PWDA 3WKZA 4IUGA 3AQUA 1CXEA 5DO8A 3WEOA 3KEHA 2XTKA 5I3DA 3TTSA 9CGTA 1SMDA 1JYXA 5A8PA 1V02E 5E0CA 1QWNA 1HVQA 1MWOA 2VC9A 4TTUA 1XH2A 1A47A 4JL1A 3U7BA 2YLAA 2EBNA 1F4HA 1UD2A 1E1EA 1XHGA 6TAAA 3OZOA 3U57A 4X9YA 1TVPA 1I1WA 3GXPA 3SCRA 3AZRA 4PRWA 3RMEA 2CBUA 2BVDA 4W89A 1JYVA 1JG9A 1MW0A 1J12A 4N42A 2Y2WA 2O92A 3IANA 5I6SA 2A3HA 1JI1A 2Y8VA 3SURA 3DX0A 1C7SA 1WKYA 5IHRA 4OZOA 2WWCA 3PZIA 4MADA 4GZIA 2XG9A 4FLOA 1E43A 1VB9A 3AYRA 3VIPA 4JCMA 3WEZA 5FCZA 2EPMX 5HNNA 1R75A 3AFBA 5A6LA 3LRMA 3AHXA 4PUEA 4M1RA 1JI2A 3L4TA 2J7HA 5FD0A 2D0HA 4PCTA 1LQ0A 1UKPA 2QHAA 1V3IA 3AMGA 1EGZA 1C92A 1HWWA 3ZT6A 3F5JA 4C7DA 4DWSD 1G1YA 3WY1A 1HL8A 1KXVA 3ARRA 4UQCA 2QV4A 4Z2LA 2BNJA 2BHUA 5M3WA 3NIYA 1QI4A 4U5KA 5CPQA 1ECEA 3AS1A 3K8MA 1CTNA 4WF7A 4YHGA 3VD7A 2YL6A 1MQRA 4Y7EA 4PMXA 3WSUA 3CIVA 3LRKA 3CZSA 2CBIA 3WL1A 2W61A 1V0KA 3CHEA 3EYPA 2YFOA 2VCCA 4AD1A 1J9YA 1DWAM 1EH9A 3NSMA 3WY2A 1MXDA 2MANA 1UKSA 4HMEA 1WE5A 2D3NA 5D8ZA 1ZBCA 1JF6A 2WCSA 1LJYA 3CBWA 1TA3B 2XN2A 1G5AA 1R85A 1J10A 5C8BB 2AAAA 2VCAA 5D8WA 2WMKA 1QBBA 1GCYA 3H54A 1LF1A 3LPPA 4QLKA 1M53A 1OT1A 4AIOA 3WNLA 5GNXA 3W27A 2F7PA 3U7VA 4GPNA 2JE8A 1OIMA 2QPUA 4WKHA 3GXNA 3VSTA 2D23A 4MNKA 5CJ5A 3CUIA 1H09A 3APGA 5HOSA 3WENA 4R5EA 5JIPA 5I23A 3VIKA 1E6RA 2VR5A 1B0IA 4HZ8A 3PBGA 4IPLA 4AD5A 4QP0A 4BQ4A 4CD7A 1CGXA 2CERA 5A6KA 3A5VA 1UD8A 3QHNA 3WD4A 4XUYA 2UY4A 1O6IA 2F1AA 1BG4A 4W87A 4W88A 1QBAA 1C3FA 2GFTA 2WNWA 4GQQA 1DTUA 1X1NA 1NARA 1HJQA 3WQVA 6CGTA 1W2VA 3VIFA 2WYSA 2ZUNA 2XVLA 5I79A 3ARWA 1V6XA 4YHEA 1F4AA 3NDZA 1TQSA 3M07A 5EFFA 1V6YA 1JZ8A 2XVNA 2XYLA 3AHVA 3VINA 2WMHA 1EHNA 3CZEA 5AYIA 3WF4A 3WD0A 3BVUA 4CD5A 1YHTA 3ALFA 3LPOA 3CH9A 2BVTA 4HA4A 3KE0A 4J3UA 1KWGA 2BVYA 3EMQA 3W24A 3W4RA 4GZEA 3WF1A 4W8BA 3VILA 4ACYA 3T0BA 3M6DA 1HL9A 4HP5A 1BAGA 2WANA 4DWSC 3A4WA 2F8QA 3L4VA 2O9PA 3MKKA 1QW8A 4UFJA 2VJXA 3HN3A 4KGJA 4P7LA 3W28A 2ZX7A 3EMCA 1R47A 2CKRA 3K1DA 1GOOA 2JF6A 3ZIZA 3GXTA 1XSIA 1BYCA 2J7EA 3CO4A 3ZJ6A 3MANA 3WELA 2PWHA 2WLYA 3AIEA 1GVIA 5HXMA 1MW3A 3PHAA 4CU7A 2VO5A 1G94A 3ZOAA 4NI3A 4P7NA 3CUFA 3K46A 3DX4A 1V3JA 2WPGA 3D52A 2WZHA 2ZXBA 1GQIA 3K4AA 1CGVA 3UR7A 3NYDA 4D6GA 2G41A 4NZJA 3PTMA 1OD8A 1EOMA 2E40A 1R33A 1W3KA 4FNRA 3AISA 2F18A 1GOKA 4TVUA 2W91A 4JFWA 3N15A 2V3FA 4UQ9A 2VCBA 4HOWA 1AMYA 3AJ7A 4JHOA 4OBSA 1VEPA 4H8UA 1DP0A 4NXKA 4YN5A 1J0YA 1UKTA 2F7RA 1BGGA 3EDJA 3WDHA 4AD2A 1HXKA 5JBDA 2DH2A 1E4NA 1W1TA 3AS3A 4D6FA 1LWJA 1Q6GA 2E0PA 3WNMA 2D24A 1XCWA 2V5DA 3T2OA 4TUFA 4PUDA 3BMWA 1JIBA 1YQ2A 3I3BA 4D6CA 1HNYA 1GOIA 3N17A 1ITXA 2BXZA 3VOCA 2W67A 3WFLA 1Q6CA 5AY7A 4M81A 4CN1A 3ZJ7A 2YDSA 1BVNP 4M8UA 1VAHA 3WD3A 4RE2A 1KTBA 1DEDA 3MUIA 3VGFA 3AS0A 3WFZA 1H0IA 1W9PA 3BGAA 1R34A 1KBKA 1JDAA 1UH3A 2XFRA 2JEPA 1PEZA 2J74A 4D6JA 2J7FA 5ABHA 5BXTA 1ISXA 3UR8A 2CNCA 2GUYA 5GQBA 1E73M 3AXXA 3RPMA 1JFHA 2UY5A 1J0KA 1TCMA 2ZUMA 3RM8A 1PAMA 4PSPA 2DPEA 5HBFA 3FAWA 1QHZA 1WPCA 2VRJA 1DWFM 1PIFA 5DFAA 1ZBWA 3A24A 1I75A 3GDBA 1VIWA 2O9TA 2E9BA 5A8NA 4H8VA 4H2CA 1HKKA 1QW9A 4E8CA 1UWUA 1KWKA 2BS9A 1HJUA 3RDKA 1EO7A 2DH3A 3ZQ9A 3FAXA 4ZXLA 2BV9A 5EFDA 4U33A 2WSPA 4EAMA 1V02A 4FNPA 1BLIA 4AC1X 1BHGA 3KZSA 2GSJA 3TOPA 3AIQA 4JHZA 2E4TA 3WNOA 2G3MA 1G0CA 3D50A 2NT0A 4OGZA 1XYFA 3BAIA 2DDXA 1EA9C 1ISZA 3T09A 1G9HA 3EJQA 1VF8A 2ZICA 3WD1A 2VRKA 4KRUA 3CHFA 4F8XA 4DO6A 3FNDA 2BXYA 1UQZA 2WMFA 2WMIB 3GNPA 1K9DA 3OGSA 4WKAA 3MMDA 3ARVA 2ZUTA 1HP4A 1KXHA 4DM1A 3W82A 1WB0A 1AQMA 4NF7A 2OYLA 4GO9A 3HJEA 2QF8A 1E6QM 4W8AA 2DGAA 4RL3A 3AIVA 3CLWA 2A3EA 3B9EA 1HKJA 3ZR6A 1QNSA 1UHVA 2WK2A 3VGHA 1OGSA 3BAKA 3POCA 2ZIDA 1B3ZA 4WK9A 3HG2A 3RJYA 3EJPA 1JD7A 3OBAA 1QHPA 3THCA 2WVVA 1QHOA 2W62A 2ZX8A 1BSIA 4XX6A 2E3ZA 1CENA 3WD2A 1EHAA 2WXDM 4MAVA 3K4DA 3OLIA 4BQ5A 3T0DA 1CGUA 3CUGA 3KWXA 4OOZA 4KH2A 4H7VA 3ZSTA 3TONA 2GVYA 1TQWA 3UCQA 4MNJA 4E4PA 5CLTA 4MNMA 2YKKA 1I1XA 5GNZA 4AZBA 1UD5A 3DX1A 2W92A 3GXMA 3ZT5A 1HT6A 5DEZA 3K8KA 1VFOA 5DF0A 2ZUSA 3ZJ8A 1AVAA 1QX1A 2C0HA 3RIKA 3MV01 1CXFA 1KTCA 1KQZA 1J0ZA 2DT0A 4LX4A 1E55A 1JGIA 3VMPA 2DEPA 1IV8A 4CGTA 1R46A 2CEQA 3II1A 1TZ7A 1XGZA 3VNZA 1CGYA 4KRTA 2E9LA 1HJWA 2VQUA 1GQJA 1UR4A 5JBFA 4F79A 3PZNA 3IK2A 2WHKA 3HMCA 4QFUA 1MW1A 1E6NA 3WH6A 4NX0A 4AXNA 4NXSA 4U5IA 4W86A 2ZX9A 4JFTA 2YJQA 3IJ7A 1GNXA 6A3HA 4AZ7A 1UA7A 3WY4A 3WL0A 3PZTA 1BFNA 4J3XA 2XPKA 3WNPA 1RPKA 4AZ5A 1J18A 3DX2A 3WNNA 4ATWA 2EAEA 1QNQA 4J3WA 1XD0A 3NJ3A 5C71A 5D9PA 5ABGA 4UR9A 3OG2A 3NSNA 4D6HA 1B3YA 3GTNA 3LRLA 1UYQA 2EPLX 2PI6A 3QHOA 2OWWA 3WMCA 1KR1A 5HPCA 3W25A 4HMDA 4GZJA 3L2MA 4J7RA 1HXJA 4PMNA
chains in the Genus database with same CATH superfamily
3BSZL 3NBNA 2R8SH 4L0PB 5FYKE 2QKIB 2HX8A 3ZKNC 1JXFA 4IMEA 3CK0L 4GUIA 4IOFD 2OI9B 4P5KA 1W6TA 2ATKB 1QA9B 1JJKA 3QC3A 4WVRA 4EANA 1ND0B 3BVVA 2X6CA 3BPLC 2FQEA 2J66A 4S3KA 2WINA 1UZ8B 1YYAA 4K5MA 2VC5A 3IIXA 5FGBA 1M57B 1MCEA 1IAOB 2CM6A 1W0VA 2MPVA 3NCBB 5J12C 3O8XB 4NKDB 4HNCA 5CEZE 5E9NA 3HB3B 2GJXB 1IAIH 1TQUA 3NFUA 1DE4A 3S5LA 3VDBA 1M7XA 3KBJA 3ZUCA 3S98A 2QDVA 2E8YA 1RURL 3L45A 2JIXD 4BKLB 3QIWB 4EI5B 4ELKB 4HF5H 5GGRB 3QDGA 4RGND 2KT6A 4TV6A 5IDIA 2OSWA 4AJYV 4M1CC 3S5ZA 1XBRA 1ZAIA 2IJ0C 3ZKQD 1HFUA 2PC4A 4PJBE 3FZUD 2AGKA 1G7QA 3BUYB 2DICA 5REQA 3R7QA 3PDOA 1RZGB 4OZIB 4BZYA 3MBWA 1RK5A 4XHJD 3C09C 1MIEL 5FF7A 3HBLA 2XJ7A 1EPXA 1UMLA 2G4FA 1TCRB 1UUOA 2ZCGA 3L48A 4ABUA 2XVPA 3MRPA 4Q14A 4KJYB 3AUVA 4HKJB 2ATAA 1NTHA 1FNGA 3BZDA 3RIFK 2KC0A 4BWTA 4LEOA 2J3SA 3SN6N 3CFBB 3N04A 5T1KD 4JHAL 3CXHJ 5FA5A 1KTLA 4XMXA 3RUGA 4ANVA 3AAMA 1YPZF 3JV5A 3GRWA 4YYFA 4TSCL 4FQXB 1ZJAA 4DO5A 5F1IB 2JSFA 1AO7A 3U0WL 1HIZA 4ZFOA 2APXA 1N7MH 2X44D 3IE4A 2DIJA 4RDYA 5DVPA 1DJWA 4YOKA 1XC6A 5F0MB 2VLJE 2EE3A 2NWSA 3RUBL 4PS4H 4V2BA 5AW3B 4NQXA 4ANUA 2E6FA 5EU3A 5A1AA 2INZA 3WQEA 2CESA 3F7KA 4WEBH 2NNXA 3LKSA 5B7FA 2X4QA 4J12A 1TEGA 1PQZB 2JKAA 5G5DA 5DEGA 4GVHA 1VPQA 4ONFH 2DEYX 2Y5QA 2HTKC 3KW8A 4DN3H 4XWUA 2JTYA 1A0EA 1NFIB 3ABRA 1U36A 4YMPA 5L9FA 1OARL 2G5WA 5IVNA 4Q52A 2PDXA 1JRCA 3QK0A 4XBJA 2VZUA 3WD5H 1AKJB 5IMLA 4TVPE 2ODOA 1TVNA 4YNGA 1XIFA 3AT9A 5KS9E 4NO2B 1J05A 4NZCA 1WFUA 3QC6X 3AICA 4JS3A 2P49B 1HHJB 1G01A 2E7LA 4UV4L 1RJZB 1PL9A 2CLIA 3KGTA 4HPJA 1PZ2A 2O7SA 1RMFL 2NY6B 5E5CA 2J88H 2XBZA 1WZMA 1O1ZA 3Q6GL 5JIWA 4TNVF 3NOIA 1S7WB 3CD4A 5CAKA 2F9BT 5DVOA 1FUNA 2DWYA 2XUWA 4PTVA 3LJ3A 5AVYB 1B9ZA 1KCRL 4QBXA 4HISA 2CPCA 1U6AH 4PBGA 3ZTDC 2YCIX 1P1XA 1D5XA 5FI8A 4JTLA 3E02A 3EUUA 1YSOA 1HOCA 1KJVA 3L3GB 2V5LA 4ZT1A 1CXIA 1VIZA 4HVBA 4DM2A 3II2A 4AT6A 3ESMA 1SZRA 4XNQB 2WPBA 1V0LA 1HINH 5EUKA 4GRSA 2R27A 4QCIA 5F1UA 4NNXB 1SR0A 3C6LD 1VBJA 3OKOA 3NGFA 2R82A 4GY0A 3G77A 3AMCA 3VOGA 3SCUA 3CNYA 1QO2A 4ETQA 2FECL 1SXAA 3F62A 1OFQA 4K3JH 4OUOA 1KJ2A 3CZFA 1WP6A 3WQ5A 5M03A 2DZBA 4NQDA 5GSVA 3S3GA 1VGEL 3JV6B 3G04B 5GZOD 4DXKA 1M71B 1T04B 4XODA 3FQ1A 2RJHA 1J2BA 5GS1B 2IPJA 4NP4H 2WSYA 3W5NA 4L6OA 1KULA 2VDGA 2EGZA 3VIJA 1YNLH 1ZAHA 4OFKA 3T4AB 1KXQA 1IL1B 1OSPL 4PJ9C 1M68A 4PJCA 3S8FB 3DU0A 4H4NA 5DVMA 4ZX5A 3VAEA 3L1OH 3G7TA 3JT2A 3O6FB 2ICEA 4PH8A 3O15A 1I2OA 3DOHA 4H44C 4YGVB 3WMQA 3N3TA 1YJDC 5KUKA 1I7RA 4H2AA 1E5ZA 4MNHA 3HC4H 3W81A 4BH7A 5F7MC 4M19A 4Y9AA 1AGCA 3DZ1A 4JFFA 3KLSA 1YEGH 5I1LA 4QHKJ 2YD7A 4IJCA 5MKGA 2YUWA 4Y5VC 4N2YA 1Q4WA 4JTCA 3EJRA 3IDMA 5CBBA 1UZ4A 5LA2A 4ZL1A 1RIHH 3GTTA 3UO1H 5BOPA 3E8UL 2X1QA 2BVOA 5JDSA 1KTRL 4QT5A 3CPRA 1YMMD 4FIRA 3AY2A 2DZWA 1NBYB 4YHML 4MGGA 1UM6L 4PCSA 5C08E 5EU4B 2Z27A 2WTRB 4PI0A 2I17A 4YHKL 5EKYA 1NGZA 2Y8KA 1AODA 4YIWA 2D73A 1HKLH 1JXKA 2ICWJ 2XIJA 1ZL1A 2KLSA 1XRVA 3WHXA 1QASA 3BRGC 1CB4A 3NJVA 1HK6A 3NJMA 4XP1L 3IJIA 3PAUA 3VCRA 3QEHA 5TDPB 3IVKB 4RFOH 1NQBA 4NYYA 3VGDA 1BFTA 1UOZA 2AZAA 3RPIB 2Y6SD 1KFAL 1AG0A 3PVFA 4PYGA 3I6TA 1ML1A 4XZUB 3JWNH 4M5ZL 2XV2A 5DBTA 3QI9B 5JPMA 4JDEA 2J7DA 2CLZB 3SCMB 3WE1A 3U46B 5FYJL 2YEQA 3O11A 4Q8BA 4JG0L 2ICSA 1DN0B 2PXYD 4AE0A 4Z3TA 3RX7A 4M5SA 2B1AH 3TCLA 2P4AB 5J04A 3VGEA 4JIHA 2BOBB 4X6BA 2O6PA 4Z3FA 2DJ4A 3OG6B 4NP9A 2X1RA 5DVLA 5E0FA 2GT9A 4DAIA 5LNGA 5I1AA 3CZJA 2CLRB 3QUMH 4XV0A 1NTDA 3EHBD 3I6LE 3WZ0E 1CU4H 1HCFX 4UNVA 2ZWKA 4WU5B 1PKYA 5C0GA 4B9JA 1V5JA 3FPXA 4HK0B 1VESA 4Y2DB 5ETUA 3V0JA 4TO8A 3B8WA 5FGSA 2K3HA 1IM3D 4L8CB 3V9CA 2DM4A 1D9EA 3BGMB 3LB0A 1DO5A 3TZFA 3B8DA 3SIMA 2V8LA 4R97B 4CSSA 3R2GA 1V54B 4DTGL 3IMBA 4Y9GA 4R4NC 3KPRD 5AZ2H 2MQ0A 4Z3IA 3W1QA 4YHPB 5T3XD 1YUHA 4K94H 3F04A 1XWYA 4HA3A 1DVYA 4GNJA 4GXFA 1YZZA 2YA2A 1T4KA 3Q94A 5I07A 1JGEB 1KXVC 5F88A 1RULL 3AHZA 4Q7NA 4LAOA 1TQXA 1KDIA 7FABH 4G6FD 5AHIA 1XP3A 2EAWA 3B5TA 4ZUSA 3NQFA 3LXAA 3OR7B 3K6OA 4GAFB 1WICA 2XLLA 3H53A 2OWXA 5DC0A 5I15H 1FPTH 5EO1B 5HJ3A 5KSBF 5MEQA 1C93A 3KLLA 5DGRA 4XVSL 2VLKE 4K07A 2NQJA 4P49A 5CIPA 3ERXA 2BSED 1R87A 1ONXA 4CD6A 4CD8A 1UR8A 4JZNA 5C0EB 3RYMA 4Z2IA 1B0RA 2IPWA 1NCDH 2BSCA 4H5SB 1M6OB 4PJDB 3ZM8A 4LMQI 1JZ7A 4ROQA 4O14A 1F3DH 1A3ZA 3HI1A 2W5FA 3S3JA 3D09A 1GGBL 4IDJL 4TNGA 2IQ9H 1FWJC 2YPVA 5L4JA 2ZXAA 1S7VB 4X4MA 2LFGA 3RN6A 1U33A 5D2WA 3FT2A 1BBDL 4P3DA 2P7TA 4FLSA 1NCHA 1CT8B 3MRRB 3HBPA 5ANMA 2J24A 2EDRA 1JNJA 4PJAB 5TPWL 5DHMC 1MDRA 5ECVA 3MVSA 3QUYD 3OKNA 3L1GA 1G6CA 3AXKA 4LP8A 5F9JA 5C09D 2F1BA 4MYXA 4GXVH 1YECH 3BD5A 4NHCH 1Q8JA 1T21A 4UOW1 2VABB 4JFEE 1TSHA 4MIMA 1GVSA 3EZ4A 3L0KA 1R86A 4F7MA 5D30A 3SE9L 5FL0A 2WZMA 4IXXA 1GC1C 2IBZY 3BP4B 5I66A 1SLVA 4YO0A 3WLNA 5E6YA 1Q72L 5IB3A 3T6ZA 4RFNC 3R89A 3SZKC 3PS6A 4HETA 3E2HC 1HHGA 1FORL 1J5HA 3EJJX 4X4YB 4Z8FH 2BODX 3VNIA 1HHIB 2AABL 4Y16A 2PF0A 4MJIB 5LG1A 1FDZA 4WW1A 5M95B 4B3ZA 2XN1A 4IRZL 4CVWA 3HB3D 2KX9A 3ELAT 3WFCH 3SQOH 1LYXA 3P62A 2PW1A 2AGTA 1TSRA 1EXHA 3QIWD 2O4MA 4EI5D 3QCTL 2J6EL 2YD6A 4WV1C 2D0GA 1IKFH 3UBXG 4TSBL 4MWAA 1B1YA 4QRPE 3X1NA 1DBAL 3VD2A 5TD4A 3RVUC 5A8OA 2HUHA 4K9EL 1YEWA 5KEZA 2Q8BH 3TJEH 1X5KA 1E4MM 1GJPA 5I74C 1KV5A 3SJVB 4LU5H 1CXHA 3TH4T 3H9SA 5JXQA 4S3FA 4Q8NA 5KYXB 1IMHC 1WWCA 3VU1A 1U4EA 3T78A 5EF0A 4PJXB 2PCFA 4Q9BA 5L88L 1J0HA 2E7DA 4ODBD 2BTMA 2XTLA 4OSUL 3TZVB 3NJKA 3UA3A 1PJWA 4FRWA 1NPJA 2G9HA 3RPBA 3N9GL 1P0SE 1H8SA 4KEVA 3RUGF 2MNUA 5FEZA 3PPFA 4NJ9H 1YYLL 3WKZA 1PTAA 3ZMNA 1IC4H 3K3QA 4BWUA 4C55A 3FDGA 4NKIH 2XTKA 3LEVL 4MMXA 2Q3RA 3QV7A 1N64H 3T7VA 4GRWH 1J8HA 3D3VB 2H6RA 3U4FA 3BICA 4LHUA 2EBNA 5EUOB 3ZYIA 4L8BB 2CXKA 1HHHA 3N43B 2QUMA 3DURB 3VOFA 3SCRA 1KACB 2Y2WA 4UTAH 1U8KB 2CMRL 4RSYA 4WDIA 1NLDL 4ZUWB 2H32B 4UYPA 1VB9A 1FVDA 4JCMA 5CEWA 1KCSH 3UZEC 3VWKC 3S3DB 4TQEH 3MLTA 3AHXA 3K2KA 4DYKA 3FN0L 1ZWIB 5KVFL 1Q9KA 1UKPA 3NAVA 2BCKB 1HWWA 3NPXA 1DJZA 5E99L 3ARRA 1DR9A 1BTMA 1LTDA 3D7PA 3RBGA 2Q1EA 3P77B 3AS1A 3ETSA 4PIRF 3GTXA 2CJUL 1MQRA 3EX2A 4AXKA 4FOMA 3C61A 4NL1A 3WL1A 4KERA 2YFOA 4LUIA 4KKLC 5HTSA 5DUMH 2MHAB 2VEKA 4TSAH 2NQHA 5DO2D 4IBVA 5I8CA 3TSMA 2XN2A 1B3JA 4AM0B 1U3YA 5BV7B 5D8WA 4U1GB 3LPPA 1BSLA 2I9LB 1KCVH 2YCLB 1WUFA 5HOSA 4B53A 4FFWD 4Y1AA 3CH0A 3DAQA 5B1JA 3MJ7B 4CBPA 5CJOL 3QJXA 4CC4A 2D2GA 1J8KA 4YMZA 2PR4L 1WHOA 3BLIA 1QBAA 2WNWA 4XNYH 4I0PB 4H9YA 1HNFA 2B16A 2Y1YA 4KQ0A 3NDZA 1QRNB 3MMEA 4R90H 5F3HB 3NG5A 2LU5A 2X4NA 3PUUA 2BNQD 5DMGC 3BLFA 4BI7A 2BVEA 1G4SA 4KJPD 1CL7L 4PUJA 3SDXF 5D70L 3FU7A 4IMFA 3STZB 2E27L 1VDGA 3ZE1F 3GHUA 1OAUL 1MVFA 3HZKA 3QISA 3OAWA 3BLLA 1BYCA 3VKBA 2Q6ZA 3OKEB 5BOEA 4L4TB 3FF7A 4CU7A 2CA4A 4I2XE 5KG9A 4XPAL 2BLEA 3FU0A 2ZCLH 4ADIA 1BBJB 2HRWA 3F7LA 1JPFB 2RAMA 1EOMA 3CAQA 3RLGA 3OVGA 3MWAA 1G7IB 4FNRA 3AISA 1RALA 3OF6D 1FKWA 2IMRA 5HHME 5LXVA 2DZUA 1UYWL 4LF3A 3MCMA 1KTJA 5CCZA 1K5NA 4JHOA 4W9IC 4WFHE 1HSBB 2BC4A 3FMGL 4NN6B 4BK4A 1FI8C 1HXKA 1XLGA 3QQWA 2OQJA 3P3RA 2FTYA 1PKQE 4PRRA 3BGFC 2C9RA 3LS5L 4ONHB 4QYAA 2VQ1B 1F0LA 2F6UA 2AEPL 4UT7H 3ARBB 4PJGA 4B4HA 3NTCL 4JEJA 2GWGA 1A5FH 2WYIA 4JLRB 4F9PA 5DRWA 4ZFQA 4KZ0A 3ZJ7A 3ZLQC 2Q8ZA 3M0HA 3MUIA 1X96A 1M1SA 3PUDA 1L3WA 2GQHA 5GRVL 3BO8B 5AVXB 2ID5A 3ZDYE 4KVPA 3MBEB 3KPPA 5CEZH 4L8SC 1W72A 1WA3A 4UWQB 1NAMH 1QPPA 4Y4HC 1AGEB 3VD1A 1SZFA 2F6KA 3D1MC 2ARJQ 3TCSA 2DWDA 1I75A 3MYJA 2FPVA 3P3SA 2O9TA 4ZB0A 1PTDA 4H2CA 3VXRB 1P5BA 4HAGA 4NYLB 1QUNB 2D3VA 1EGJA 3CB8A 4JCWA 2NTFB 1UWFA 4EAMA 3QC5X 1BHGA 4OE7A 4U0RC 4ZBJA 4KETA 4XX1E 3QI9D 5T5FH 3ZQXA 3UJTH 2P5WE 2IADA 1SYSB 1FCGA 2K9UA 1AH3A 4FXGC 1HP4A 1FQ0A 1O5KA 3G1AA 3W82A 4NIRA 4PFEA 4C47A 4NQDD 3WLQA 3HE6A 2YBRA 3D07A 1KPRA 3R1GL 4OZ4A 1XCFA 2FEEL 3O3AB 3PWNA 2JJTC 5CN2A 1U22A 1CD1A 2WK2A 5E8NA 2J1YA 3QJFB 5L2KA 3V5KA 1PG7L 5JHBA 2YLHA 2PRMA 4NQCA 3K4DA 2OV0A 3D2UB 4X9HA 4ALAC 3CHPA 4AQ8C 2PCQA 2P8PB 1JUBA 3CS2A 4PQXA 3V4VH 4Y2DD 3UZYA 2PP3A 3NJGA 5DD6B 2FB4L 3KPNB 4FQCH 1KFKA 2JKRM 4WFFD 1YMHA 3LTSA 1O5XA 1QFPA 5DK2B 1ZLWH 5JIIA 5LKNA 1HJWA 2EO9A 1QEWA 3WH6A 4MCYA 3CMOH 5C1MB 3QQ4A 3IJ7A 2WIIB 4HGKC 1PKMA 3VKJA 1DJSA 3WY4A 3OVUB 1GZ1A 1A6VH 3TIMA 2IQAB 4ZQNA 1I85C 2N0MA 1L0YA 1I9CB 4LPXA 1QNQA 4JNYA 1XD0A 3CHVA 1J1OL 4QAMB 5D9PA 1YC7A 1AMKA 4AH2A 1UYQA 4TVPH 5DJ0A 2ICWB 1KN2H 5DHVA 3MUUA 4NLHA 5GGTA 4KNTA 3D69B 3MPGA 3RGTA 1FX6A 1BD2E 3L3KA 2WAGA 3TBYA 3JWOC 2PF8A 3U7YH 3CHRA 4XCFH 1MAJA 2Z1KA 1DBML 4H9XA 5LWYH 1KFWA 4V27A 4DPRA 3WJYA 5LXXA 4JM4H 4R7WA 4Q2ZB 2H2SD 4Y9NA 4ZTXA 1JNEA 3WIIL 4LSPH 4YSPA 1GGCH 4DJDA 3D4CA 5IQMA 4PJXF 1DSFL 4RUBA 2O4QA 1A3LH 4OZHA 4HK6A 2IH8A 2VLRE 1RUKH 5D1XB 1KGUA 4DGVL 3C9NA 1XLJA 4RDQG 2R15A 4YGAB 1LO5A 3CQ0A 3G9AB 4JRXD 2JIXA 4NPYA 4GUGA 3REQB 3QG6B 5A69A 3UWQA 3FUDA 3EOLA 4LV4A 4O5LL 5C07A 2WBXA 3WY3A 1YDPA 3WGUB 2EUZA 1AA1B 3SDAC 3X1EA 2GK1A 2DUZA 1PZDA 3PWLB 4EE9A 3ISIX 3WNJA 4BFAA 3N43F 1OD0A 3HAEG 2G3NA 2C3ZA 1EFZA 3CUJA 4AW7A 3BWSA 4YX2H 1R3YA 1H15A 2KL6A 4IM4A 3TPUB 2DT3A 4LTSA 3VRIA 2HWGA 1PBGA 5T1KA 4J3SA 3TBCA 4R9XA 4MJID 4UDUA 1EJOL 4OF8A 3WDQA 1EP3A 4POYA 4U3SB 1AMXA 1AD9B 2EABA 4HUKB 3DGRA 1OC5A 3U4BH 2C9PA 2PPGA 1Q1JH 5A6SA 4FXKC 2VR4A 4QDGA 4QTGA 4KKXA 5C7XL 5M5DA 3B04A 2ZTJA 3MFFB 5JQIB 1KM6A 1A1NA 1TUXA 3U0TA 2P0OA 1F1DA 2Z4QA 5HVHB 3UYPB 3NGJA 1YJDH 1MCLA 2A3CA 5I17B 4IEFB 3SJVD 3VTAA 2W79A 3R06A 2E8ZA 3ARUA 5A6BD 4PTXA 2V5CA 4UM8B 2ESVE 4EXBA 3A0OA 4PB3A 4OD3L 4PMYA 1O95A 1BVNT 2D31A 3I3EA 1W5NA 4YHZH 3U9UA 2J8FA 3KS5A 1SHXA 3GS7A 4UANA 4LDOB 3X11B 4H20H 3TZVD 3RZCA 1ONEA 3FFCB 4PHXA 4WJXA 4RZCA 1AP2B 4M7SA 4Q97A 1M05A 4WQ6A 3PFMA 4LEXH 5I3JA 3O2VH 2OO0A 3FEQA 4MMWA 5GZND 3ARDB 2JB5L 3CYVA 4WOQA 4HHAB 4HNNA 2WNZA 4UTBL 1I0DA 3WJZA 3KPLB 1JZ2A 3OKLA 2XRAL 4LASL 1LO4H 3V0FA 3SADA 2AERT 2RHEA 5FW8A 3D3VD 5TE4L 2R7EA 1NGWA 3OV6A 5C2UB 4DJED 4MA8H 3RZWA 3VCCA 2Q2LA 5HAOA 3NQCA 1URZA 1URLA 1VFLA 4WI4A 2PUZA 4P2QB 4P2OC 2R56L 5EMMA 1NWPA 2Z6JA 1DQJB 3Q6FA 2FR4A 3R8RA 3TXZA 4UFMA 3N3EA 5A2FA 3X3FH 2OODA 1CJYA 1L3NA 3MHGA 4QAWA 5C0AE 3X2QB 1ZV5A 4QXTB 2HJPA 4F8TA 1P7TA 5D1ZI 2F19H 3QV6A 3K2MC 4D0BA 1NMCB 4AQZA 5BW7A 2Y4SA 4LGSB 2OYKA 2GGGA 3APYA 3KVMA 1F8MA 4EPSA 1NANH 3C6LA 3W7LA 4DBUA 1A7PH 4DLFA 2HRPH 4BH8B 4A04A 1KPVB 5EEZA 1TYRA 5FAJA 1FGVH 3X1FA 1KV7A 4Z5RB 1VR6A 5HJLA 1AR1C 6PAZA 4H01A 4RSVA 4LIQL 2Y63A 1UXLA 4QRSB 4YVPA 3VSQA 4PEEA 4OJAA 2OJEA 5GZOA 3VD4A 1AANA 3GXUB 1R5IB 3S8WA 4LLUB 2C26A 4RZKA 1JPSH 1P4BL 4JO5A 3FB6B 1GG1A 4R5XA 3Q3GB 3GG8A 3P02A 4HNLA 4E2VA 1N59B 2GVGA 1ZB5A 1ZAGA 3LDBB 3FCBA 6FABL 4WEUD 3FN9A 1E8ZA 5F2LA 1W5MA 1PFOA 4LVNB 4MAYC 3V5OA 4FNUA 3SYAA 1NDTA 2UZXB 4QXUH 5F96H 4NG3A 1AQHA 2GGHA 1XF3A 4I0PD 4TULL 2FJHA 1QLFB 2EHHA 3G1XA 1QRND 4PB9H 5EEXA 3BWUF 1DVZA 1CLKA 1H7WA 4JY6A 1TJIL 1M04A 3QZWG 1OCOB 1OC7A 4U1IA 1BZ7B 2BDNH 1EDTA 1EF3A 3WLBB 4DKTA 4WJG3 2C6QA 3KPSE 4H8WL 4EDXB 4O58H 5CBAB 2J79A 3BOLA 1J8HD 5T5NF 1TMCB 1YMMA 1AHWB 3T1FA 4BFJA 2X9XA 1WDSA 3Q8FA 3MRLA 1IGWA 3D8MA 3AYTA 2BP8A 3U8GA 3I10A 3NGBC 4AL8L 3M0MA 2MOQA 4L4TD 2ZWNA 2IALA 2QCCA 1Y7VA 3ELFA 2O30A 2Z2BA 1MHHA 5F7LB 2HG5B 4F2FA 2KI6A 3O6LL 3RF9A 4ZFGH 1PIIA 3P69A 2OFJA 4X22A 1KFCA 2WXLA 3ULUF 3C60D 1UADC 3HVNA 2R69H 3O4LE 4DGWC 1MVYA 1UC6A 5AC6A 2F7QA 3DFQA 1GOWA 1T5WA 2AI0H 3QDJA 4L8DB 1JJUA 1B4TA 1UB6B 4FQ2L 5CC6A 3ARBD 5AOIA 3L7EA 5A2LH 5B1KA 4K2UH 1DVUA 2XKSA 4X9BA 3L4CA 3L4YA 2R0KL 5T1MA 2YGQA 1WFTA 1UWEL 4OHQA 2DLHA 3MWCA 1GC1H 4INFA 1XIHA 1UACL 3MBED 4DKFL 4LCWA 1WCBA 1QR1B 3MRHB 3R19A 5CP7A 4CN6A 3TM6A 2R2HA 1WBYB 3D85B 4X7DC 1GGUA 1ENUA 1SO4A 5CC3A 1I3GH 1RQHA 5BRQA 2YL5A 3KTXA 2F58L 2E7FA 4FZEH 4HZ7A 2V7NB 3ENEA 4M93C 1INEL 1CO1A 4F2BA 4UOJA 3VXRD 3FRUB 1E90A 4UT9A 4AIEA 4F7PA 5GJMA 2C1GA 3A4AA 1JPEA 3ABXA 1IM3A 1FNSH 2A3LA 4JBSA 5KVDE 4IRJC 2BZ7A 1G9MH 2E47A 1BTCA 4RV8A 4G9FB 2FDSA 3GMLB 1J0JA 4U1LA 2ZXWB 4PH6A 3SBFA 3IVSA 3KPRA 4ZZKA 1GYNA 4XNDA 1XT5A 4H41A 1T83C 3GO1H 4FG0A 2UUDH 1Q5MA 1RD6A 2WMIA 2Z24A 4KK8D 1AZNA 1UPMB 1BIIB 3ZL4H 3M5VA 4QLJA 5I8EB 1PU0A 2VOTA 1W17A 1A6TB 1JAEA 2GKIA 2A85A 3CH1B 4KAQL 2AXGA 3UC0H 1CLOL 4HKZB 4OFVA 3A47A 3FDWA 4P3CH 2ZQKA 4NJGA 3NEXA 3W1XA 3BQUC 3GG7A 1TQTA 3QFJB 2TSAA 3ULUD 2X09A 2J6EA 4N8PA 4N2LA 2B4GA 1CWYA 4FYQA 3S47A 3SGZA 2JIEA 4UOW0 1SUXA 1U8LB 3JU2A 3U4EA 1VJSA 2J78A 3GSUB 4JN8A 3H8AA 1W56A 1WFMA 1EV2E 3GBEA 4CCDA 3BLEA 1V79A 1EJTC 4AWJC 4LC6A 1BYNA 1JAKA 2R1YA 4ZQOA 4GUPB 5K9QI 3BP6A 3OJGA 2DQMA 1LQBC 1WAWA 5HI4D 4EF3A 1Y1DA 4IG2A 2H1PH 3W6YA 3GK8L 3HRZC 5IMKA 1X6UA 1N8OE 1Q9OB 4N8CH 4GGBA 4UF7C 4YL4A 3U4AA 4JKWA 5IJDC 1CYGA 2K9FB 3RJOA 2OGYA 3V6ZB 2PTXA 4YPGA 3CUHA 3QUYA 1U8CA 2C3VA 5I6KA 4UTMA 1ONWA 5C09A 2R23B 1F58L 2WVSA 4NRXB 3Q8EA 3S37L 1IFGA 1UM5L 4R3UA 4K3EL 2DTML 4U4BA 2Z34A 2QKIA 3BVNB 1LWHA 3G8RA 2ATKA 1QA9A 3BVWA 3O06A 1ND0A 4QRUB 4F37K 3RGVC 5IGXH 2PB1A 1B54A 3PS7A 4WEEA 1WOAA 3FY1A 1BGXL 1NDMB 1IAOA 3NWRA 3O8XA 4NKDA 3ZLGA 1M03A 4XSLA 4KXZI 2GJXA 5D1XD 2E59A 1Q38A 4OIFA 1HKVA 4OZHF 1PW3A 3WLWD 3TP4A 2FZDA 1JFXA 1MCFA 1UR1A 4BKLA 3QIWA 4URKA 1UKOA 4HCHA 4EI5A 3S3BB 4ELKA 2ZXGA 5CZJA 5DS8B 1QP1A 5C86A 1ZHKB 5DTFB 4J28A 1S1PA 4B0MB 1OCWL 3Q2WA 4L6DA 4FE9A 1YTEA 3BUYA 4XNUL 2BRRL 1RZGA 4OZIA 3LHPH 5CU5A 2BIMA 2VVSA 4DEPC 2OR8A 4X8XA 4M24A 2XFYA 1BFVH 1XG4A 2IOMA 3PPEA 3VG0L 1KEGH 3WO8A 1TCRA 4KJYA 3NCJH 4HKJA 1FA2A 2C3WA 4JYEA 2Y85A 5EIIG 3L2IA 2Y5TB 2HT2C 4F5CA 3CFBA 4KXAA 2W81C 2OEJA 2Z0IA 2FO1A 4GVFA 1BW8A 3AXLB 3W72A 3BXWA 1UVQB 3W70A 2AK1L 5BJTB 3ABLB 4F7TB 5F1IA 2W9MA 3TURA 3FPYA 1CXEA 2OTPA 9CGTA 3UIYA 1XXXA 3QPEA 4HYVA 3G22A 5CJXC 1V02E 1HDMB 1A3XA 5J8LA 1XH2A 4KFPA 2B1HL 3LDVA 5MERB 3OZOA 3MXWL 4PRWA 2KHAA 4W89A 1JYVA 1J12A 3HS0C 2AS5M 1F73A 1PQZA 2QTEA 4OFCA 4OZOA 4I77L 1PCXA 4FLOA 1E43A 1L8PA 1CVRA 4C4KT 2OMAA 1UFGA 3EKGA 2FRGP 1LQ0A 3LQMA 3IRZA 1NFIA 3F5JA 3KYMB 1AJ7H 1V7ML 3MFGB 4DJDD 5HWJA 1BXAA 3WY1A 1DJYA 3TYDA 2QV4A 3IXTB 5M3WA 3NIYA 1AKJA 2YAQA 1OKEA 3O3DA 3FFCD 3K8MA 5DFVD 4NO2A 3CHQA 1AG1O 4DELA 3WSUA 5DANA 4DGIL 3CHEA 1VFHA 1HHJA 3ARDD 1DQUA 1EH9A 2JKTM 1THCA 2PTDA 5JOPD 3DJZA 4FA8A 5C3TA 3MAWA 3M0IA 1LJYA 3H42H 3JUZA 1DSWA 2IAMB 1AQFA 5C07D 1SM3H 1KGCE 1N68A 2Y25A 4Y9CA 1S7WA 3AG1B 4IKIA 1L7TH 2Y2TA 5C92A 4J5NA 3U7VA 5CJ5A 5T8IA 3IARA 3O6MH 5I71C 4HC1L 5DQPA 3WENA 2GG1A 1E6RA 4P2QD 4AD5A 3UJJL 3GIVB 1EC9A 2K1MA 4AUJA 4NU7A 3GB7B 3THMH 1TTPA 2R1WB 3L3GA 4MKMA 1VLXA 2XVLA 1ZEAL 4XNQA 4YHEA 2J9ZA 3U30B 2B4CH 1GT8A 5FEPA 3HLAB 5AYIA 2VDMH 4NNXA 3PWPB 3LS9A 1G0XA 2ADFH 3AREC 3N6QA 2BNQA 2BVYA 5GRJH 5I19L 3RY6A 5LIYX 1X97A 1HI6B 3H2CA 1IBBA 5DMKB 4IMDA 4QIUA 5BOFA 4POUB 3S5SA 3K7UA 4ALAH 3GTVA 1GOGA 2ZX7A 4ZAKB 4OJEH 1FWDC 2H41A 2BOEX 4RZBA 4GSXA 2XH0A 3JV6A 5F89B 3G04A 3P30L 3MANA 1M71A 1T04A 2IANB 5GS1A 3WJXA 4FI8A 2BVQB 5I0WA 2LLEA 3H2PA 3UZZA 3DX4A 3NEHA 2ZC8A 4QRTB 3FC8A 2E9WA 3S3SA 1OCBA 4YSDA 5KN5B 3PP3H 1W2KT 2IQ0A 4MQTB 2K78A 3T4AA 1ZVYA 3DCPA 2HLEB 1IL1A 3N2BA 2VXVL 3EGDA 3OF6A 4G3YL 2WWMD 4FEMA 5GGQH 4DVRL 3FTYA 2VC6A 3O0RL 3Q05A 4YGVA 5HHVH 3DFSA 3P0WA 1JGDA 4Y88A 3RZCD 1DQLH 2LQRA 3SDDC 1LWJA 3EBIA 5EDSA 1GIGL 3PLYA 5B3NA 3IIPA 4KIRA 3W7RA 4FQ1H 2CHZA 1AJZA 3RX9A 3MHFA 3V4UL 3JWOH 1N18A 1T20B 2N1KA 4GG6B 3IN0A 1VCVA 2CJSA 1F4WL 3RTQB 4NNBA 4IHOA 2DMBA 1J0KA 1D5MB 2QGCA 3DI1A 1W1B1 5AVUB 5EU4A 2CA3A 3NVQA 3A24A 3RRXA 1PZCA 4LVHB 1HKKA 2VXTH 4D7PA 3SDCD 2ZP8A 1R3IH 2F5BL 5IW3A 5E2TH 4UMSA 4G80B 3U9WA 5TDPA 5KSAB 3IVKA 2GSJA 1QKZH 4HHHA 5FYLE 4JHZA 5HI3C 3D50A 3OHXB 1XAKA 5E4OA 5C7ZA 3RPIA 1IWBA 5SV4A 1XLBA 3ALPA 4XZUA 1OQFA 1MO0A 3BOXA 4JUTA 3MO1B 1IBGH 2BXYA 2WMFA 3QI9A 2CLZA 3SCMA 2GAZB 1RHFA 3U46A 3BIAX 3SDXA 1Y0EA 1YY9D 4LW7A 1KXHA 3LZQA 1HL5A 1NCTA 3GSWB 3I2CL 5D1ZC 1UXSB 1OZUA 4YDIH 4W8AA 4UIKH 1DN0A 2JI2A 4OLUL 4K3HA 4GCAA 3B9EA 2JJSC 4XVJH 1XDLA 2XYCA 1A7NH 5IHUL 2BOBA 3NA9L 5FYJD 3FRPB 5J57B 1RUSA 4WI8A 1H5BC 3OBAA 5E9XA 1OABA 3IJEB 2CLRA 1UOWA 2XSXA 5EBWB 3OSKA 1O9VA 3D85D 4M8RA 1CGUA 2JCCE 1CDBA 2OBGA 1GTNA 5F7YC 1IKOP 1YEIL 4QEHA 5TIMA 4MNMA 1I1XA 4XN9A 4WU5A 2BZDA 1HCYA 4KKBD 2OO6A 2R29L 4XP9H 5D7KD 2DW6A 4HK0A 2CQVA 4I13B 4WTXA 1LEGB 1QX1A 3GMNB 4Y2DA 4DWDA 1YBQB 1ODAA 4IGHA 3W7HA 2DT0A 4L80A 1BVKB 1I9JL 2ZRUA 3BJFA 1E4XL 4L8CA 4IIHA 2B20A 3BGMA 1IFRA 3B0PA 1S2TA 4ZMWA 1DL3A 3IK2A 4G9FD 3S83A 5D2NB 5E24E 3B0VC 4YSQA 4JJ5B 3C3UA 1HAUA 1UA7A 1G6RH 4TMCA 2WUBH 5EB9A 5JHLA 2FTWA 4YHPA 1WA2X 2G0KA 4F8LA 3MT1A 3TYCA 4F2UA 2Z00A 1XL6A 5GGVH 2JMRA 2ZF8A 3KCOA 2H8PB 1JGEA 2EPLX 2FIKB 1NINA 4LKXB 3V0IA 4HH8A 1OM3L 3FQUB 3CLFH 1H3XA 4GGHA 1CR9L 5DRXB 4ANWA 1ROCA 4H0LC 1XAUA 4M3KB 4WI9A 3OR7A 5I26A 3A22A 1BX2B 5ADPL 4LYPA 2XIDA 5EO1A 4XB3A 1YNYA 4KX8A 2XA3A 4NKOB 4ZTEA 4YUEL 4DIAA 3T04D 3F58L 4KDTA 4XRCA 12E8H 5IIEB 1XQLA 5DXXA 2DKUA 1U8QB 3O2DA 2QHLA 3OR6B 3VI4B 5C0EA 1X7FA 3QDJD 1CGTA 4AISA 1OSEA 4YEFA 1HGYA 4H5SA 1M6OA 2NZ9C 4L3EB 3AHYA 2CDFB 4PJDA 1A6ZB 3MCYA 2DQIL 1ETB1 1ZPTA 2RDWA 3E74A 5AHFA 3H70A 3IRSA 4JHBA 1S7VA 4ZX4A 2ZWYA 3H12A 4LQFL 3RY4A 4JRXA 3GG1A 3SODB 1UM4L 4GH1A 2BSTB 1W2PA 1GYLA 3V0UA 1CT8A 3MRRA 1BZEA 1WDWA 4LCWD 2CIPA 3MV9B 3PN8A 5BZXA 2R4RH 3WH9A 2XM2A 2XWBB 1EJWC 2WNKA 2VABA 4XMKL 5AVRB 5I30H 3HG1B 4K8RH 2X05A 4U2ZA 3S35L 1TTBA 3GYCA 1IRAY 4NUMA 1JUEA 1VFMA 4YQXL 4X63A 3BP4A 1DYZA 2CUAA 4P4KB 4AI7A 1AFVL 2WWNA 3X17A 4X4YA 3OC5A 1JPGB 1SFLA 1HHIA 3BUPA 4J1OA 4MJIA 1SLUA 4B5UA 4H04A 5EORL 4UNTA 4MASA 2WXKA 4ZNEA 1SYVB 4EZJA 3D18B 4O19A 5T8GA 1Z9SB 3BE1H 5DLML 3F7YB 4U1HB 4H6RA 1EZWA 4YS1A 4FN0A 1GTEA 2YN5A 1C91A 1Z5LB 4FFZL 3BAYA 4KOCA 2GABA 3SJVA 1QWUA 2V2WB 4L0ZA 4OZIF 3NSXA 4G1MB 3SPHA 2OCZA 4IK6A 4FI7A 1D5BB 1XLHA 3NIDE 1KY6A 4HHMA 5A6BA 4LDLB 1ZANH 3B97A 4GUCA 3T0XA 4PJXA 2Q7NA 3WF2A 1JXGA 2J8UB 3BCFA 3BJTA 1BZQK 1EZLA 4MHHG 5H2BB 3L54A 3ESOA 3CZ8A 4KZEL 1CE6B 1G0YR 3W74A 5E8OB 3TZVA 1BYBA 4OZFB 4FXJA 4Q74A 5CPTA 1ZLSH 3TNMB 2ON3A 5AW9B 5DT5A 3OAUH 1RZKC 2RKXA 1NC2B 3PPSA 4JQIL 4QO1B 2WMJA 5GZNA 3NPSC 5E23A 1I60A 5F6IB 5IJVB 3N85H 2H3BA 2I5YL 3DX7B 1AQDB 2YQGA 4F7EB 3D3VA 2XIMA 3E2SA 5BMXA 4DJEA 1MF2H 5EUOA 5C70A 4L8BA 4XZNX 3DURA 1USZA 3N3MA 1W8SA 2EYTB 4XMVA 1NDVA 1UATA 1U8KA 2H32A 1T2JA 2WO5A 4JFYB 5E2WL 1SQMA 5HQMA 1ZWIA 3D2TA 4TNWK 2IPTH 3QKZA 4NDMA 2YD4A 1JDCA 2BCKA 5JOEA 1U3HB 3O8XD 3FTWA 4E8DA 3HFYA 2EJ1A 4XE5B 4PJFE 4LT9A 4H7ZA 4AIZB 5I7GA 2POTA 4UTJA 3P77A 2XWEA 4TQHA 5FGRA 2PLMA 1FAKT 1YY8B 2MSPA 1FVPA 5L8LB 1IFHL 5KVDH 2IAMD 2MHAA 3SKJL 3D4ZA 2WP3O 2BIIA 3NR0A 4RISL 3V0WL 3D0CA 4AM0A 3KLHD 4I18B 2YBVA 2B2XL 4GG6F 1IBYA 2I9LA 4MA1C 3MLYH 2YCLA 2AQPA 5C6TH 4JKMA 4GJ1A 1TMHA 3LN3A 3MJ7A 1D9KC 3UXFA 4HBQA 4MDJB 5FJIA 4XPHL 1UWQA 2NW2B 1F5ZA 4JDBA 3B9OA 4HWEH 2J56A 3PGDB 5CGMA 2QJMA 4MDPA 3D25B 3T8XB 3LB6C 4I0PA 4K73A 4IGBB 4QNEA 3VI3E 2G96A 1FG2B 4TL4A 1I0BA 5FEWA 3PWPD 1QRNA 5F3HA 4FNLL 3US1A 4FQXD 4WWKC 1V6VA 3K81A 5HI5D 4W84A 3HOJA 3U36B 1AW5A 1EBAA 2YPLB 3GXIA 4ZAKD 4KEUA 3OC8A 3STZA 1NC4B 4M3JA 3RWDB 1BV8A 5F2FA 1YEKL 1GYVA 2IAND 3CFIC 3CMGA 3WO3B 3AIBA 5B39B 3Q43A 3OKEA 4L4TA 2ODIA 1EMTH 4Z0SA 2J47A 2CUIA 2D03H 3IWPA 1U41A 2A6DB 1JPMA 1BBJA 1MFBL 1PWMA 1PAZA 2H0FA 1JPFA 3SUTA 3W22A 1G7IA 4QLWA 5LA1A 3P3BA 3DWTA 5TAOA 1SFDA 2ZWSA 4A6GA 2BOGX 3N6HA 3C60A 1HQ4B 3OJDB 4JD4A 1U6AL 4PWGA 1AKJD 5J7CC 4HUWB 4AD4A 5HHOB 4D6EA 1OPGH 3QEGL 2E7CA 2ISSA 1PV8A 4ONHA 1MRDH 2VQ1A 2FEDD 3D06A 5HYSG 1YEFH 3BX7C 2QSCL 3ARBA 3B8VA 4NLAA 1A80A 4IMKC 1VZWA 1DL7H 4JLRA 1HH6B 3TC9A 1TVHB 2QUTA 1KTKE 4AD3A 2NY6D 4UFIA 1FGNH 4DJFD 2V9UA 5FDYA 5IQNA 2B08A 4OM1L 2Z9TA 4UQEA 3LKRA 3BO8A 5E2UH 3RI5F 3MBEA 1QRKA 4V15A 3MJ9L 3GMOB 2XWRA 3O9NA 2LU7A 2WD0A 3SRDA 4M6PA 4HGXA 4N4QA 1ETA1 3VMNA 4UNIA 1P48A 2V8MA 1P84K 2R0ZL 1H11A 3VXRA 2CHWA 5E6RB 4NYLA 4NILA 1QUNA 1LHZA 2TMDA 3TYAA 3NAAH 5KSAD 1F61A 3QGAC 2NTFA 2IDCA 3OJMB 4Z2KA 3PQYB 3GHBH 3LH2L 2WZIA 4N6RB 2GQ3A 4OTKA 4HZ6A 1QFEA 4E0RB 4MYWB 2QQQA 3CV7A 4JG5A 2NR6D 4GQ0A 2C1OB 1SYSA 1E4IA 4XIAA 2E25A 4XAZA 4BBWA 2W65B 1E5CA 3CM4A 2AZUA 5LN4A 4NAQA 1LP9E 1ZPUA 2X4UB 4GD0A 4TV3A 3O3AA 2IDQA 2VKZG 1W32A 2O5YH 2XZCL 3QJFA 2F8XC 3PWIA 2ZONA 1UJ3A 2O5NA 3KXFE 2J8OA 1BQHB 1FNAA 4F8NA 1LRTA 4QE1A 3KVKA 4YHIB 3WL9B 4DBWA 3DRQB 2V2HA 3QQ3B 3PJXA 4LAUA 4AYEC 3WMSA 1NCIA 4ONVA 5FM5M 2XFFA 4HLZG 2P8PA 1WXJA 5IHSA 4M56A 1C8XA 3O6FD 4IMCA 2CHOA 3IDJB 3URQA 2CO4A 1U91B 4DF9A 5DD6A 3KPNA 4HFUH 4XCYB 3IFLH 2EE2A 3QCUL 3QYMA 3L5JA 5AWNH 5FYKH 5DK2A 3S5LG 3B3IB 3GUWA 5FSEC 4X9IA 1E9IA 2BWGA 3CQJA 4HBCL 1CQYA 1L8NA 1V8HA 1OK0A 3CSBA 2WIIA 4AEHH 4J2QA 3QUHA 2L0DA 4UINL 5BZZA 4E3TA 2R94A 2GTZB 2B31A 4HCLA 3RWEA 2QZRA 3UFYA 2KZKA 2IQAA 1D6EA 2CH8A 4ICCX 5IZ7A 2HS6A 5BS0B 3NCOA 4N9GB 2QQKH 2ICWA 3TA3B 5D1QC 2CIIB 2UXTA 1U5HA 2COQA 3D69A 2WBKA 2H2PD 2J20A 5BRPA 5IB4B 2RDUA 3D0VB 1ECZA 3MRGB 5D1QE 4AK1A 2R0WL 3KLQA 2A79A 4X2RA 1R24B 1VKXB 3BUBA 5B7YA 4Q2ZA 1PNDA 1PSCA 4F8QA 3BSZA 4XAGA 3AUWB 1J9CT 1MCWW 4O8RA 2JIWA 3SCMD 4L3ED 2X4PB 3LHTA 2B81A 4QCEA 5FM8A 4PJDF 5JO5B 4RLIA 5D1XA 3QGKC 2EC9T 3N55A 3U5YA 5EU6B 3OVPA 3HE7C 2AMGA 1NFDE 1HX0A 1JF1A 1KM2A 3FTZA 2Z2UA 2A4ZA 3C87A 1V5XA 3OZPA 2YAOA 3REQA 3QG6A 2I85A 3KHQA 2QJGA 4D1IA 4M43H 4TLUA 2YAFA 2CBMA 2FT7A 2JKEA 2BCMA 5G55A 4PJAF 4JFQB 3A12A 4M6QA 3GKWL 3CQQA 2Q71A 3CSGA 3TU9A 1FYHB 6ENLA 1EEQA 5TDNB 5F7AA 2FBJL 4YDVB 4ZOBA 5I5MA 4OGAD 4OV4A 4JTKA 1IEXA 1QFUH 3HG1D 3PWLA 5FKPB 1QSZA 4EKJA 1BQGA 1W9XA 1ZJBA 5ELIA 1TSIA 2D7NA 1Q6RA 3FYYA 1TWWA 3TPUA 2AJVH 4P4KD 4IQLA 3MSPA 2CBVA 3COOA 4HKXB 5IWLC 1CDYA 4Z7NB 2GVEA 1CICC 2NQ3A 3RWCB 1A3RH 3B56A 1NWRA 2DQHH 1LDSA 5IW1B 4XSMA 4TX9A 1VPYA 4YSRA 5HDWA 3B4UA 1KCWA 5E8DL 1RQEA 4AGOA 2IPFA 4U3SA 5A8PA 3T3MB 1AD9A 4DGYH 3IU3B 1OGAB 1SDAB 1P0BA 1RUML 1XTMA 2NY3B 4LY8A 4LSRL 1O9ZA 3MFFA 1E27B 4AG4H 4Q6KA 4ZD3H 5IB1B 2EC8A 2W3ZA 2BJMH 5IQOA 3UYPA 1JNHB 4PRPE 5I17A 1RPUA 3RQ3A 2GQ8A 2PCPB 3DGCR 2GWNA 5LGYA 5HJBA 2J7HA 4ZS6C 3DENA 4PCTA 3WE6B 3AMGA 2V5RA 1EGZA 2YZ1A 3ILQC 4UT6H 3S42A 4NHCL 1FWFC 4UM8A 2OOGA 1OCJA 1N0LB 3N6YA 4P5TB 3VB9A 3E0IA 2ATPB 3CVHL 1MI3A 1AW2A 1KBVA 3X11A 4MHBA 3H3PH 4YHGA 4N9CA 3UJ2A 5GGUB 4LAZA 4IGNA 1BJ1J 3EYPA 1Q9LB 3FFCA 3EGXB 3FTVA 3IIVA 5AVZB 1AP2A 4BRJA 3WY2A 1NC2D 5JIHA 6ALDA 1I3RB 1MCQA 1RH8A 3LHWA 5D8ZA 1S78D 3HI5H 3ARDA 5FYLH 4HHAA 5K4ZA 5J4MA 4HXAH 1F1GA 1LF1A 3KPLA 4N2DA 3F8UB 3WFCL 5FPIA 2F7PA 1OIMA 1ILSA 5JMUA 2RR3A 3UNDA 4ZUUA 3MA8A 4E9VA 3JR2A 4S3EA 4CD7A 3WS6C 5EUOF 1O5PA 3F4CA 1H19A 1UD8A 4P2QA 3RIFF 4XUYA 1D7BA 3QHZH 4NOFA 1P4IL 1QACA 3O9WC 3WSQH 4W9JC 5LIKX 1PVNA 3GHEH 3ABSA 1J1XH 5BO1L 4QXTA 4FQIH 5C2GA 2X38A 2VDPL 2IKHA 4IIQB 1U3HD 3EOTH 4GZEA 5KZMA 4DCQB 4BH8A 1KPVA 4FOKA 5A43C 1VFTA 4JDYA 1VPOH 4Z5RA 4YFLF 1Y8BA 4JR9H 2B77A 1XSIA 4MXWL 1S5TA 1NIBA 2PWHA 4S2BA 4QRSA 2DQWA 3SRHA 4HEPA 4HQQH 3ZOAA 4MX7B 4P7NA 2BIPA 3KH3A 2WZHA 1R5IA 4LLUA 3C2AH 4M1DH 4QXGL 5HUOA 3AY4C 4XI5C 1MRCH 3KBPA 5I3IA 3FB6A 4I7UA 4A6YH 3Q3GA 1N64L 2YD9A 4GK8A 3C3NA 1RZIB 1N59A 1EUNA 4PCPA 2ABAA 4RAHA 5FGCB 4WWOA 2A0LD 4FXTA 4KWSA 4LCCC 3C0SA 1MNZA 3E9TA 1J7VR 2Z65C 3C2FA 1BGGA 4LBEB 5LGJA 1X5FA 2VD8A 2XPYA 2UZXA 1IC5L 4V1YA 4EOWL 1XF0A 1Q6GA 3G1FA 4IGBD 3QRFM 1RCXB 2EKGA 3QORB 4PUDA 3UX9B 5I0VA 2ZCKH 4TQEL 1WIUA 4YVVA 2XWCA 2P8MB 2CU9A 3ES6B 3SO3C 1FWXA 2UWEE 4GQZA 1BZ7A 3WLBA 4I3SH 4O4YL 2YPLD 1RY7B 4EDXA 2V9QA 3NRQA 5CBAA 3LMZA 2AANA 3EIFA 1Z1WA 2C15A 4HJEA 4U6TA 2DZAA 1NC4D 4J3OD 1QUMA 4N22A 3GBNL 2UY5A 4N3UA 1AHWA 5HBFA 4PP1C 2Y62A 1G1KA 5DFAA 4LMQE 2JCWA 4S1FA 4CEXC 4LARL 4XPGH 2Y36H 1Q9WB 2HG5A 1HJUA 4MYPA 3TJ4A 3C2OA 1DV7A 3SDCA 4UR7A 4LESA 3PAVA 3QJQB 4KY1H 2E4TA 4GUQA 3TWCH 1FHVA 2WQSA 4KPLA 4M48H 5EC1B 4QHPA 1FXPA 2EJAA 1XBXA 3UFIA 3AWNA 3EOEA 5HGHB 3GIZH 1CDUA 1D3HA 1OY0A 4WKAA 5KBLA 5HHOD 5HVWA 4L8DA 3LEPA 3S5OA 3F00A 2H6PB 4S11A 1UB6A 4TQ8A 3GC5A 2VERN 1DLHB 3AIVA 3ZHNA 3ULSB 3Q2NA 1XRTA 1HKJA 1FG9C 4B9CA 3CVBA 1T41A 2F84A 2FB2A 2NY2C 2DVXA 1IUZA 4WK9A 4GJTB 4JG1H 3TN4A 2ONEA 2W62A 4L3CB 1BSIA 2E3ZA 2Y5SA 3BDKA 4A7UA 1OFPA 2Z35B 3LH9A 4I87A 4M7LH 1QR1A 4M5TA 3MRHA 1ZLEA 1WBYA 4YSAA 1YXCA 3D85A 2VEIA 2QGHA 4KT2A 5GNZA 1UD5A 5DURB 1F9CA 1MAMH 2ETWA 1JGVH 1U95B 3MCG1 4KXBA 4MF4A 2V7NA 3LCWA 2ALAA 4PP2B 1E55A 3VQ2C 3FRUA 4QISA 5JPNC 2HFTA 1NCJA 3OVRA 5CZVH 5LO7A 4F91B 2AEQH 3FTXA 4RRPA 3V0HA 1BZOA 1H3TA 1E4HA 1KM0A 4WWID 2XDFA 4JIIX 1S7QB 1OP5K 3G0SA 3NG3A 1N5AB 4G9FA 1F90L 3GMLA 5E95B 4HN4A 4LCRA 4B27A 5ICXB 5FUZH 3P1VA 3CWNA 5IOBA 3UWWA 4D6HA 4LLVB 1VD6A 1BIIA 1JBJA 2FCBA 2C91A 4KI5C 5I8EA 4DSYA 5C9RA 5DU7A 1A6TA 1BAFH 2HE8A 3CH1A 1HZKA 4HKZA 1R4XA 3UZXA 3WJJA 2P80D 3MV8B 1DJGA 2ZSVB 4M0XA 5LQBL 4UQ3B 4FAAB 1QW7A 1X7IA 1KJ3H 1XXFC 3QR2A 5ESAB 3QFJA 2VB5A 2NY0B 3V5HB 1QFWH 3UG4A 4D6DA 4NNCA 4N90E 5DT7A 2ENSA 1U8LA 1J9QA 2B8OT 3ZDZB 3GSUA 1RZKH 1DWGM 4HAKA 4D9QE 4PMEA 5T91A 3IMVA 3U2ZA 3QULB 1IWPA 1ZRUA 1Y0LB 1XYMA 4NSBA 4GUPA 5C0NC 1QNPA 4NWTL 1JDFA 3GBDA 2AJUL 3BKCH 1VFUA 2ZOLB 1GYCA 1F6YA 7CGTA 1UPPA 2G3JA 3B3DA 1JEZA 4PBXA 3W0KA 3GSRB 3KAOA 1VBGA 5IM7B 1Q9OA 2RMNA 1RXOB 1FZMB 1G7VA 4XBEL 5LN8A 2LV4A 4JVUA 1XD1A 5DBUA 3V6ZA 3PM6A 1TTFA 3WQGA 2Y7SA 1M7UA 4LL9A 5BS0D 2HPMA 1OCCB 4LY4A 3IRPX 3KEDA 3FO9B 3SPCA 1H3PL 5CD3A 5HQLA 3CSYB 2R23A 3SCPA 2WXOA 4MNQB 4GW5B 1QNOA 4BSJA 4NRXA 4XVTL 2WJZA 3C2VA 5HJGA 1LQAA 5D7EA 4WNQA 3VH8B 3UEQA 2PP8A 4X8CA 4YZFF 3BVNA 4I3RH 4LP5A 4TR9A 1YPXA 5AKQA 3DPBB 3T40A 4EQ3A 2HTLD 4FAMA 5CILH 4DEWA 4QRUA 5AW7B 3H21A 5FJTA 3VIMA 3UACA 3FBQA 4AGQA 1IWAA 3CFDB 1NDMA 1IEBB 4MOZA 3EX3A 5CSUA 1QAWA 4KXZH 3EG9B 3CEUA 3BPOC 3QLDA 3C5QA 3NO1A 2YB1A 1DQVA 1S7RB 3CZKA 5EU6D 3JVGC 1HE7A 2WC7A 3MBXH 4RRPM 2F7FA 3DFYA 1AD4A 5DS8A 3NEVA 1HL2A 1TG7A 1ZHKA 4IRZA 5DTFA 2EC9U 3JSSA 4C6OA 1Y6NR 3LAFA 3HS9A 3VDCA 2VXSL 2VZTA 3GR7A 3HVDA 5LBSH 3GXFA 1SW7A 4HU8A 3MLUH 3D2UD 4YDJB 1BQ5A 1F86A 4K6AA 1E30A 3TESA 3DRTB 3TTEA 2OMWB 5D9OA 4ILSA 4MRBA 1F00I 2NW3B 3IB4A 4JO8A 2V38A 5JYLA 3UPWA 1N26A 2CO7B 3RX8A 5GJSL 3K4ZA 3SRFA 1E1CB 3RDTC 4KTYA 3L67A 3F6LA 3IKKA 3QAQA 2NMSA 2XI9A 1J96A 2VOMA 2J44A 1MFCL 2Y5TA 2KYIA 4WUUB 2G2PA 3LBMA 3UBHA 4OZGE 2VLLB 3ARFB 1IJ9A 1UVQA 1VP5A 5BJTA 2Y9RT 3TLRA 4R7JA 3W01A 4YHOL 3IDIB 4F7TA 5DWUL 4I9TA 1OGAD 4XBGB 4CVUA 1A3LL 3PZVA 1HDMA 2IDFA 5CM1A 1NIDA 4WI3A 5ISZB 4FA3A 4P8QA 5MERA 3N34A 1MCOH 1DZBA 2IMNA 2NOYA 4B9IA 3QZPA 1GRWA 3C5XA 3LYRA 1ZVHA 1M7JA 2H0JA 2IPUK 3ABMB 1L6GA 3H2WA 3MDJA 3BI9X 1XLEA 5ITBL 5H4YA 3G9VA 1F07A 3TJXA 3NZGA 2P8BA 5IB2B 1DKWA 3RWIB 5JOFB 4DAFA 1UZ8A 3K0YA 1LE9B 3KYMA 4P5TD 2VNCA 2EECA 1ML0A 3SYPA 3IXTA 4LOFA 7REQB 2V3GA 3DOIA 2Y88A 1TJGH 4XD3A 3OP2A 3W53A 3SOBL 5JW4Q 2PO6C 3QGVA 3PP4H 3MBDA 5GGRA 1IBDA 1INDL 2X9YA 2IXQB 1EEPA 2EDWA 2IAMA 3EYVB 3H2QA 1BD0A 4AMCA 1MLBB 1QATA 3HUJB 3D51A 3GMQB 2IAAC 1J5DA 4EN3B 4HWUA 1XIDA 5D4IA 3E0FA 4X9SA 3N13A 2HVNA 3GIVA 4N0FB 2QGBA 4OU1A 4QQ3A 4DP7X 2EXYC 4Y5YC 2V6AA 3CB3A 2QNEA 2CLKA 3GB7A 3U2CA 2R1WA 4B0MM 3L4UA 4R9OA 3PREA 3SY5A 3EWZA 3VVGA 3LD5A 3R8QA 1EEUA 5HGBB 2BY3A