1QW8A

Crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNAMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 171
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qw8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qw8A02
4Y7EA 3A5VA 4IM4A 3LRMA 1L0PA 2VCAA 2HISA 3WN6A 1HP4A 3AMCA 3AS2A 5JBFA 5HXMA 1R85A 1UQZA 1WZMA 3APGA 3WBEA 3WNMA 3SUTA 5I3DA 2V3GA 1JDDA 4B15A 4N0RA 3CGTA 1HJUA 3AOFA 3AFBA 1U2YA 1GVIA 2GUYA 5A94A 1BQCA 1MQPA 2FGZA 4QLJA 3WD0A 1CLXA 2QF8A 4XUYA 4ZE5A 2WC3A 3BVVA 1UASA 3HG5A 4MPKA 3VD3A 2PWFA 2IGTA 3NDZA 6CGTA 3ZMRA 5I79A 2VR5A 4OKDA 1UHVA 4J3UA 1TVPA 1AQ0A 3CV5A 2YA2A 3GXTA 1FFQA 3CHCA 2FHBA 1W3KA 1FP9A 2PC8A 3NYDA 4FK9A 5A95A 4TUFA 2OYKA 3VIJA 8CGTA 3T0AA 2OWXA 3AMGA 3L4WA 4JZ5A 3VIMA 1FA2A 3AIRA 2E8ZA 4D6IA 2CNCA 3PTKA 4HMEA 5FOOA 4PBGA 3KLKA 3U5YA 1BF2A 4AZGA 4OOUA 2JIWA 4WSJA 4GQRA 3KL0A 3BMVA 1S46A 3EJUA 3CO4A 4IISA 4LYPA 1AVAA 1WP6A 1LWJA 1MVYA 1MFUA 2WHLA 1ZU8A 4AD1A 5CPSA 1BGGA 2XSAA 5I78A 1ISZA 2WMJA 1X6LA 1C8XA 1UR2A 2GJRA 4KWUA 2OW6A 1WZLA 4YPJA 1KFWA 1M04A 1HVXA 3CTTA 3PZGA 1HTYA 3BUPA 3WUGA 4CCEA 4CUCA 1TQVA 5D9OA 4L4OA 5D8ZA 3WIJA 1BYAA 2PBOA 3WD3A 2BS9A 2DSVA 3WH5A 4FNRA 3IAQA 1QX1A 2QMKA 7CGTA 5FL1A 1KGUA 1E43A 3ZIZA 1D3CA 2CHOA 1QOXA 3WFLA 1UR0A 4OUEA 2VZOA 4NZJA 1HJSA 1R7AA 1CYGA 2VTFA 4J3WA 3F4VA 2WMKA 3A6OA 3SCWA 2JEQA 2YLAA 3LX9A 2FE0A 3F5JA 1ZL1A 3PZQA 1FH7A 2W5FA 1V3MA 1VJZA 1KXHA 5EBAA 3DX4A 2ZICA 2OWCA 4D1JA 2PWGA 3IJ9A 1WE5A 4XZWA 5E0FA 1ZBKA 2O9OA 2WMIB 4AEFA 3BAJA 3EJQA 1QNRA 2RGLA 1PIFA 1KXQA 5A8MA 1K9EA 4F9JA 5BRPA 1EHAA 3RO8A 3OLDA 4PMQA 1XC6A 2JALA 1BHGA 5ABFB 1E6NA 3QGVA 2DH2A 3WF3A 4HOXA 1V3KA 3D4YA 2BY3A 2XPKA 4AZ7A 3PZTA 3AQUA 3WUFA 4D6CA 3BUQA 2WCGA 3A22A 3N04A 1EQCA 4AYSA 1EDTA 3L4UA 1E0XA 1UWQA 3HG4A 1W2VA 1JYXA 4LX4A 1G0CA 5HPOA 1KWKA 3VIOA 5ABHA 3EJTA 1EOMA 1JI2A 1LWHA 2XGBA 4MAZA 3MUZ1 4YN5A 2ZX8A 1E70M 5E09A 1BVNP 1MXGA 2J7DA 3K46A 1PZ3A 4B3LA 2WVUA 3ARYA 3OIHA 4GI6A 1QHOA 5DFAA 4W5UA 1P6WA 3CZGA 2J7BA 2VQUA 3WH9A 1Q6EA 1FOBA 5IDIA 2XFYA 3BCDA 3T0DA 3GXMA 1NOWA 1V6VA 3N13A 3AHVA 5DMYA 2XVPA 1TA3A 2A3CA 2QMJA 1J0KA 1H09A 2J4GA 4IUGA 2IUZA 2VI0A 1TVNA 1QBBA 4U5KA 2VUYA 1WCGA 2J8GA 1ECEA 4JFSA 3A23A 1V6WA 4R5EA 4UQEA 4P7RA 2J79A 3AHYA 3IGUA 4NXSA 1Q6CA 3TTSA 5I6SA 3WUBA 5GNYA 4QLLA 2YA0A 1E72M 2TAAA 2F61A 2J7FA 1E4IA 2ZX6A 1Y7VA 1QI2A 4M24A 4KGLA 2WBGA 1VFUA 1T0OA 1H0GA 1ZJBA 1UOKA 2D23A 1HKJA 3TP4A 4DWSA 3ZJ8A 1PX3A 2UWFA 3B9AA 4A3YA 4QLKA 3H54A 1OINA 1UR1A 4ACZB 3AHXA 3AS3A 4PTWA 3WQ8A 5ABGA 4CD4A 1BVZA 4ATLA 5FIPA 1C7SA 3WL0A 1CGYA 1H0IA 1H1NA 4PMRA 2J78A 4XX6A 2J7GA 5CGMA 2NSXA 2C8NA 2WBKA 3A4XA 3WMCA 1B30A 1W1VA 3WD2A 1SMAA 3WQ4A 1HX0A 5CSUA 4HZ8A 4K68A 5DO8A 1KTBA 2QHAA 3ARTA 1VJSA 4W85A 1F4HA 1HKKA 1TG7A 2E40A 1C90A 1WDRA 3QR3A 2D0HA 1VRXA 4BF7A 3ZOAA 3EMCA 5FL0A 4CD6A 5BROA 3RM9A 5CXPA 2G41A 4UTFA 1VBRA 5CJ5A 3WQ5A 3W4RA 5BXPA 3L2MA 4OBRA 1E1FA 2YDQA 3MU7A 1EQPA 1I75A 1UUQA 2ZUTA 4QCFA 5CLTA 3CUHA 2WLZA 7TAAA 4FLQA 4DWSC 2WYSA 5LA2A 4UQBA 3T2OA 5E1QA 1UWTA 1TZ7A 5GNZA 1O7AA 4R27A 3W53A 1EO7A 1E6RA 3MV11 1JG9A 9CGTA 4XV0A 4CGTA 4FMVA 3CH9A 3LPGA 2YOCA 1SR0A 2BFGA 1E73M 1W3HA 5JBEA 1E0VA 4J27A 3AMDA 2ZUSA 4JL1A 4UOZA 4H04A 4HU8A 2G3MA 3U7BA 3CHEA 2JE8A 3RIKA 2X1IA 3W29A 2JIEA 3N11A 3A4AA 5A2CA 4PRWA 2W61A 2WZHA 2GJXA 1QWUA 2RGMA 1JNEA 3NDYA 1UD8A 3N17A 1MW1A 1J0YA 2VZSA 2JFEX 3VIHA 1LL6A 3AXXA 4AIEA 4CD7A 1PAMA 4W8LA 4H2CA 1E5NA 4KRUA 4AC1X 1VFOA 3N1AA 2E9LA 3MMDA 2E8YA 1CXEA 2GK1B 1M01A 2VT0A 3KL3A 2CEQA 2ZOXA 4MDPA 3B8SA 3POCA 3ARSA 3CUGA 2CKSA 4J3SA 1MW0A 3EDEA 4DO6A 3GH4A 3IJ7A 2GSJA 4Z2KA 2VO5A 1JFXA 3D3AA 3WDQA 5A6BD 3BSHA 4WSKA 3WSUA 4LPCA 3AROA 2OWWA 3KEHA 2FYVA 5KEZA 3CZJA 3WY2A 4ZENA 4GIAA 1OBAA 1YHTA 1GCYA 2BHUA 1UYQA 2EEXA 3WY4A 4HA1A 2F18A 4B16A 2BNJA 4WKHA 1G01A 1JIBA 3VNYA 2VZTA 4DWSD 4Z2GA 3IK2A 3F5KA 3BAWA 4B9YA 2DIEA 1R87A 3LXBA 1JXKA 1K9TA 1C92A 3WKZA 1VEMA 1CXLA 1O6IA 3FXYA 2FDMA 4PUDA 3K4AA 1HNYA 1UKSA 1LLOA 3WH7A 3WDIA 1QNOA 2PBGA 1JF5A 3ZSTA 1GHSA 3ARZA 2V5CA 1R34A 5A6AA 2VOTA 1GOQA 3VD4A 1JDAA 4JCMA 2XG9A 3CMGA 2A3BA 4DM2A 3PZ9A 3DX1A 1KQYA 5AYIA 1V6XA 3OZOA 1PZ2A 3VMNA 2CETA 2VR4A 2J77A 3AIQA 2EAEA 3WNPA 6TAAA 5AC5A 1V0LA 4FNPA 2YDRA 1KXTA 1NARA 4EK7A 1KB3A 2NT0A 5I23A 1BAGA 2J7EA 4H41A 2D20A 3PZVA 1CTNA 1JFHA 3MV01 2VNCA 1TR1A 3WNOA 3BUIA 3DDFA 3A47A 2F7QA 1I1XA 3B9DA 4CN4A 3AXHA 3ZR5A 1Q6GA 3UCQA 3A3HA 3WBAA 4H8VA 1R7OA 1VEOA 1H3GA 3VGFA 4CU6A 1DWHM 4D6HA 1MXDA 1UH2A 1V02A 4UCFA 4QAWA 4U3AA 1GUVA 2F2HA 4AIUA 4U2YA 3LPFA 2XIIA 1C3FA 2XTKA 4AYGA 1K9DA 1PIGA 3OGVA 4DUXA 3AZTA 4HA4A 3VNZA 3WF2A 1W9VA 2CPUA 4NRSA 2WKGA 1ZBVA 1CXIA 1NWTA 3MS8A 3DYMA 1CIUA 2ZXAA 1ZB5A 3W6LA 3T09A 1W9PA 2A3EA 4YHEA 5I5RA 4RE4A 4KH2A 1XYFA 3W37A 2XN1A 1FHLA 4HPGA 2WK2A 4MNLA 3VD5A 2YFNA 1UWUA 5A8NA 4CVUA 1GPFA 1E0WA 2QPSA 1I1WA 4NSBA 5AYBA 2XIBA 3KZSA 2GFTA 3CHFA 3POHA 4LQ1A 3CZLA 5JUVA 1H4PA 4ATWA 3E1F1 2ZUVA 2JF7A 4MB5A 3AIEA 3FAWA 3ZR6A 1CXFA 4OOZA 2YL6A 2F7PA 1Z32X 1V6UA 3PTQA 4WKFA 2X09A 3WDJA 3UG4A 1GQKA 2EXOA 2VVSA 1NQ6A 2CXGA 5CPQA 2F7OA 1J18A 3SCVA 3SCRA 3CLWA 3SIMA 1GNXA 2X2IA 2O9PA 1DHKA 1NOUA 3H53A 1E5JA 3AMKA 1MFVA 2CKRA 2CHNA 3LPOA 3NJ3A 3RMEA 1B90A 1QI4A 4AZIA 1H5VA 2ZWZA 4M81A 5FKYA 2EPKX 4HU0A 3PBGA 4AZCA 2XUCA 5I24A 4MB4A 3VIGA 3AZSA 1HXKA 2VRKA 1TE1A 2C0HA 1LJYA 2VX5A 3K8MA 2EO7A 5EMYA 5IFPA 3WDHA 1OCQA 1W1YA 3OA5A 1VB9A 4D6DA 4RE2A 4ZXOA 5E9AA 2JEPA 2EBNA 3CUJA 3WELA 1J12A 2BXZA 4UZUA 3WNNA 2CBVA 5C70A 2WMFA 3WH8A 2ZXBA 1E9LA 1V0NA 4ZFMA 1B2YA 1JAKA 1HVQA 2DEPA 2WC4A 1QI0A 1GOOA 2ZIDA 1K9FA 5DT7A 1CGWA 3VKKA 4U33A 4FNSA 3VOCA 1RD6A 4RL3A 3GTNA 2VX6A 3SCNA 3ZT5A 4A4AA 2VMFA 1KCKA 3TA9A 1BTCA 1XSKA 2XN0A 3L2LA 4UQCA 3CZEA 1EH9A 1FHDA 4GKLA 4P7OA 1V03A 2WC7A 5ECUA 1OIFA 1TUXA 1GVYA 1JZ6A 4ZEPA 1W3JA 3ZM8A 2J7CA 1ZS2A 1SYTA 2EACA 2WANA 3D4ZA 3SUWA 1QI5A 4IPLA 1W9XA 3CZNA 3ARRA 1KR1A 2X8RA 3WD4A 5A8QA 1JYWA 1VAHA 1PEZA 1CGVA 4WIWA 4KMQA 1D2KA 3WEOA 3VDCA 3IJ8A 1U30A 3WF4A 3ARQA 3RCNA 1XSJA 3VSVA 4BA0A 2W4XA 3K4DA 3NSNA 2X2YA 2F8QA 4W89A 4Q22A 1VENA 1EDGA 5IXEA 1OIMA 1XD0A 3MO4A 1CEOA 2YDSA 3ARWA 3RJXA 4MB3A 5ABEA 1VFFA 1W2PA 3S5ZA 2CESA 1UR4A 4PTXA 1EDQA 2D22A 4X0NA 1J0ZA 4BCEA 1E71M 1UWRA 3VILA 1Q6FA 2W66A 1E3ZA 5BCAA 4J3VA 1MW2A 1GOIA 5LYRA 1R75A 4PUEA 1B3ZA 3GZAA 4TOQA 3GM8A 4MAVA 4F79A 4PTMA 4AEEA 2DSWA 4AZ6A 2YBUA 4GO9A 5A1AA 1LG2A 4UFJA 3BXWA 4OJYA 2XVKA 4KRTA 3WFZA 1WZAA 2PI6A 1GW1A 3CZ8A 1JAEA 2WNWA 1UKTA 3BVTA 1ZBWA 3M46A 1NWRA 2DIJA 1MQRA 3EMQA 3GDBA 4JHOA 1FH9A 1DWAM 4P8UA 3KL5A 2PWDA 1C91A 3FW6A 1X1NA 3W26A 1W9DM 1XH0A 4GZJA 2PB1A 3BCFA 3VMOA 2YLLA 3FHQA 2WPGA 3VD9A 3SCPA 3DYOA 2WSPA 3W6MA 4PMVA 1E56A 3AS0A 1UKPA 2XYLA 3GNOA 2XN2A 1IV8A 4UZSA 1BFNA 2YL9A 2DGAA 3RPMA 3L4YA 1NH6A 1XSIA 4CCDA 3PZMA 3RDKA 1CENA 1CGXA 1Q4NX 4W87A 4LYQA 2BVDA 3DHUA 2BXYA 4TTUA 1KQZA 3HN3A 3VTRA 3L4VA 5C8BB 3CUFA 3L4XA 1OB0A 1WNOA 3T2PA 4DUVA 5E70A 1NWUA 4CD8A 3PN8A 1B0IA 1V08A 3DDGA 3OZPA 1OGSA 1MYRA 1JYNA 3MKKA 2W91A 4UFKA 2DPEA 3GYCA 2GK1A 1BYCA 2BV9A 4M8UA 3LPPA 3GBDA 3VVGA 2WHJA 1UZ1A 1ISWA 1E6QM 1ISYA 4GQQA 2MANA 4J28A 2WZIA 1XYZA 4UOQA 5D8WA 2VQTA 3SCQA 2CBUA 4TVUA 1JZ8A 3OLEA 1E6XM 4PN2A 1RPKA 1QNQA 3CUIA 2FH8A 1G94A 3THDA 1JZ7A 1J0JA 4BQ4A 2E9BA 4W7VA 3BAYA 2ESCA 4GI8A 2Y4SA 2WHMA 3FY1A 1O7DC 4UOJA 1SZNA 2WVVA 1CWYA 4AD4A 4BZYA 1CGTA 1V0KA 1J9YA 2F7RA 4HOZA 1QHPA 4D1IA 4PEEA 4AD0A 1UKQA 2WCSA 3SCOA 1L8NA 4AZBA 4OIFA 4AMXA 4JAWA 2YL8A 3UR8A 4NRRA 1BYDA 2VL4A 1NP2A 5JIWA 2DSUA 3PZOA 1E4LA 3W27A 4PCSA 5HOSA 4UQAA 1RP8A 2XHYA 3VX0A 4P7LA 3ARUA 2W67A 2Z1KA 3BUBA 2VCBA 3CPUA 2WZEA 2DSKA 1XHGA 5F7UA 2PWEA 4JKLA 2ZX7A 3BC9A 1GQJA 5E6YA 3WUEA 1TA3B 3I3EA 2XM2A 1JI1A 1IZKA 3GH7A 2CYGA 4CD5A 1KBKA 3KWXA 2OSXA 1UH4A 3L4TA 4NX0A 1KCLA 2CCRA 3EDFA 3NCOA 4LGXA 4XZBA 4JL2A 4CU8A 1WDSA 1JGIA 3M7SA 4DO4A 3ALFA 2WW5A 1WZKA 2UY4A 3BAIA 4F9DA 3ARXA 1AQHA 2V3DA 4E8CA 3N15A 4NF7A 3LXCA 3AIUA 3VDBA 1UZ4A 1QW8A 4GZEA 1EOKA 5EFFA 3OB8A 1E55A 1W32A 1PJ9A 1Q6DA 2D0GA 1UD4A 4DWSB 2UY3A 1PPIA 1BPLB 3DECA 1IZJA 1HJWA 5HBFA 5BXRA 3FN9A 3OG2A 1B31A 3VM5A 2EPNA 4TVDA 4CN1A 1KBBA 5DEZA 2FHFA 2QPUA 1V3IA 1UD5A 2EPLX 4AISA 3O2LA 1CNVA 2GDVA 5EFDA 2Y8KA 1LF1A 4GO8A 2CERA 4PTVA 1BLIA 3SUUA 3GXNA 4NI3A 1GOMA 1LQ0A 4C7FA 1CGUA 2EJ1A 4GXPA 3SCSA 3SUSA 4RE3A 1HP5A 2WWCA 3O9NA 2X2HA 2D0FA 3T0BA 4BQ5A 1UA3A 4Z2HA 1W1TA 3WMSA 2X0HA 4H8HA 1V02E 1TFVA 5D9NA 4AMCA 4FNUA 1HN1A 3ZSSA 4DUWA 2ZX5A 2ZUUA 5A6MA 1OD0A 3RILA 2V5DA 3RM8A 3ALGA 1A47A 2Q8XA 2Z1SA 2VCCA 1UQYA 1US3A 1E6PA 4Z2JA 3BAKA 1W1PA 1TQWA 4HZ6A 4XB3A 3VUPA 3G6MA 3WNKA 3TTQA 4HP5A 1SFSA 1K6AA 3GNPA 4MNJA 4P8VA 3HU7A 1W91A 2AAAA 1JF6A 2VRJA 2O9TA 3RM4A 1HJVA 1WAWA 4C7DA 3ARVA 1VEPA 1G1YA 3THCA 3UERA 1B3YA 4AMWA 5CQ1A 3LRKA 4ZXLA 3RJYA 1H49A 2WMGA 5GNXA 3WENA 3FHAA 1UH3A 2BY1A 1H41A 4P7QA 4V28A 3VDAA 1DTUA 3BSGA 8A3HA 1JZ5A 2G8ZA 3MUAA 2ZUNA 2DT2A 1JZ2A 3CHDA 1DWFM 2E9MA 1HKMA 5IHSA 3OGRA 4EAMA 4PMXA 4F8XA 1U33A 1F4AA 2O9RA 3GXFA 5HPCA 2A3AA 3F5LA 4U2ZA 3O6AA 1CLVA 4TX6A 2Y2WA 2WM0A 4M56A 1WKYA 1CBGA 3BAXA 4UFMA 2O92A 2GJXB 2J62A 2DSZA 2Y24A 3GBEA 2Y5EA 3VSTA 3NSXA 1KGWA 5CLWA 4M29A 4P8WA 5JIPA 4PMNA 2VC9A 3MSGA 4V27A 3OLGA 1US2A 3MUY1 4P8XA 1OT2A 1V3LA 2NT1A 1B1YA 4N42A 3BVUA 1R46A 2AOSA 4GPNA 2VX4A 3U7VA 3VIPA 1HL9A 1JNDA 1GQIA 1JL8A 1UD6A 3S2CA 4ZE4A 3CC1A 1LL7A 4QCEA 3CIVA 4ACYA 3VD7A 4JFWA 2X0YA 2PWHA 3N9KA 1X6NA 2OSYA 3EJSA 2OW7A 4W8AA 1PX4A 3WH6A 4BS0A 3VIFA 1B3WA 2WMIA 4ML4A 1V3JA 2BVYA 1CXHA 1HT6A 2XVNA 1GHRA 4UFLA 4F66A 5M03A 3QHNA 4C7GA 2XSBA 5BYWA 3AS1A 4D6FA 4WK9A 3H55A 3OGSA 1A3HA 5BRQA 1M03A 2E4TA 5ABFA 1DWIM 1QWNA 2XGIA 3WNLA 3BVWA 2D2OA 4FLSA 4JFUA 3WEMA 4E8DA 1R33A 2ALWA 1KWGA 4JFTA 1E4NA 2G3NA 4AZHA 5GPRA 3VM7A 3BH4A 1UR9A 1DP0A 4WLCA 3DX2A 3AZRA 1E15A 1UKOA 5A8OA 5I0DA 1EIBA 3AICA 1QNSA 2J74A 1WDPA 1HIZA 2UY5A 2ZE0A 1HJQA 3UEQA 4PMYA 4M1RA 2C7FA 2BY0A 3EJRA 4FLOA 3U57A 5KZ6A 3UG5A 1BG4A 5AC4A 5CZKA 1KXVA 2E0PA 2UY2A 4FNTA 4V2XA 3AYSA 1KR0A 4NZFA 2YIHA 3SEPA 3ARPA 3WQWA 1CDGA 2D3LA 4MB1A 5D4YA 1J0IA 4QP0A 3GNRA 4P7NA 4CVWA 4PSPA 2OYLA 1B9ZA 4WF7A 1OD8A 1UR8A 3IAPA 4WKAA 3W25A 3VIIA 2V3FA 3KE0A 2BY2A 3GXDA 4UFHA 1HWWA 1NWSA 3UR7A 2D3NA 1LL4A 1EXPA 3NSMA 4M80A 4UR9A 4KGJA 4PYSA 3LRLA 2FGLA 3ZJKA 1V3HA 1NOFA 5A6KA 4CN6A 2VJXA 3G6LA 3HG3A 3D51A 3WY3A 5I2UA 1JXJA 3EDKA 2F1AA 3A24A 4UNIA 5M17A 2XVLA 4X0VA 3K8LA 3MANA 4AXNA 3WDRA 2ZXQA 2WKLA 2WB5A 3J7HA 2D24A 1CPUA 4TXEA 3VIKA 2OYMA 3TTOA 1EA9C 1JDCA 1W9BM 3VPLA 1ODZA 2J7HA 4HA3A 4ACZA 2J25A 1TQTA 2VX7A 4AY1A 2YL5A 3EDDA 1VF8A 4TVCA 3HG2A 5GQBA 1C7TA 4Q7NA 4TTGA 3W38A 3PTMA 4W8BA 1JD9A 4HTYA 4AWEA 1FH8A 2CBJA 4W88A 5A3HA 4TX8A 2D73A 2A3HA 1ITCA 4PMUA 3EBVA 3VGBA 5HDRA 3GXPA 1AQMA 2G3JA 3HZ3A 4BQ3A 3VDHA 2G4FA 4D6EA 4OZOA 4M82A 3D52A 2VRQA 3WF1A 2DT1A 3WEZA 4EKJA 2BHYA 1GOKA 4D72A 4A3HA 1XCWA 4W5ZA 2FH6A 1MQQA 2W63A 4AZ5A 5JBDA 4AD5A 3ZQ9A 4D71A 1CECA 1E6ZA 2EABA 1UD3A 4JKMA 1QPKA 5IFTA 1PS3A 2YKKA 3EMZA 4HZ7A 3EDJA 3KLLA 1XV8A 3QHMA 2WMHA 1E4MM 1H2JA 1TCMA 4HMCA 3AIVA 3UG3A 4AZCB 3WY1A 4AW7A 2WAGA 1HJXA 3K1DA 4CKQA 3TV8A 3MI6A 2YJQA 5I77A 5M5DA 1QHZA 3U5UA 5BXSA 3D5HA 4AIOA 4MTVA 2X05A 1VBUA 1UWSA 3LXAA 1OGBA 1VIWA 1UA7A 4LXFA 2BVTA 1EHNA 3FNDA 3PZNA 5LA1A 2YA1A 1C8YA 4IPNB 2VZVA 2WXDM 1M7XA 4MJ4A 5E0CA 3ZT6A 1E40A 5TD4A 4CU7A 3W28A 5BXTA 3AHZA 2DDXA 2DT0A 1C93A 3EJPA 5A6BA 1W3LA 3VX1A 4H7VA 3VGGA 3S5YA 3W0KA 3DX3A 1V6YA 1UG6A 6A3HA 1W9UA 5DT5A 4NZCA 1WPCA 3D50A 4MNMA 4CCCA 5A6LA 1HKIA 2DQXA 2XFRA 2WVTA 3AHTA 2VVNA 2WSKA 2ZUMA 1R47A 1WDQA 1J11A 2CITA 1RH9A 1BG9A 3NUKA 3AJ7A 3DX0A 1XCXA 1FFRA 4JCLA 1PBGA 2EQDA 3VGEA 3BVXA 4HPHA 3VU2A 3W24A 4E4PA 3CBWA 4JKKA 3W82A 2J47A 5CGTA 3VGHA 3MMUA 3GH5A 1TQUA 3AIBA 4MADA 4UQ9A 2CIPA 1GJUA 3BLBA 1ISXA 4YHGA 2WWDA 3SCUA 2XM1A 5HNNA 3WQ6A 2YFOA 1QNPA 1NP0A 1QI3A 4B3KA 4X9YA 3VO0A 4PCTA 3ZO9A 2QV4A 1OWQA 1DWGM 1MW3A 4PSRA 5FD0A 4S3KA 3WF0A 5AY7A 4W7WA 3DHPA 2QLYA 1B3VA 1CZ1A 3PZUA 4BQ2A 3SURA 4WJXA 3PZIA 4U3CA 3AI0A 1E1EA 3N12A 1G9HA 3T08A 4UFIA 3A21A 2EADA 1B3XA 3EYPA 4DM1A 7A3HA 5D9PA 1OT1A 3T2QA 2GJPA 2IXUA 3BLPX 1QBAA 1WO2A 3QOMA 2EPOA 2XJ7A 3BGAA 2YBTA 1GQLA 3VSUA 1JZ3A 2OSWA 2E3ZA 2XVGA 4FF5A 4U31A 4D6GA 4UQDA 2ZUWA 2B31A 1XD1A 1GONA 1JD7A 1HF6A 1N82A 3I3DA 5CPTA 2BHZA 1E6SM 3BUDA 3I3BA 3AMLA 4H8UA 3VINA 1MWOA 3A4WA 2OLHA 1OGGA 3UESA 1OM0A 2AMGA 2J75A 3CZSA 3ECQA 1FP8A 1LG1A 3IANA 5BWFA 1JYVA 4B9ZA 3WD1A 3M6DA 5IHRA 4FLRA 2FHCA 5A2AA 1ZBCA 2ZX9A 1GOWA 3QHOA 4GZIA 3UETA 4J3TA 1J0HA 1KTCA 3FAXA 3GXIA 3AISA 2J8FA 3ZJ6A 1QW9A 1ZJAA 1H11A 2V38A 4J7RA 2ZWYA 1C8QA 3MMWA 1KGXA 4EANA 5FCZA 4W84A 3QOKA 4L4PA 4DO5A 4W86A 3OLIA 4PMZA 3N18A 2GDUA 2XWDA 4MNKA 3DC0A 3CZKA 4J3XA 4JFVA 1BYBA 1AMYA 2ZXDA 4U5IA 2WVSA 3L4ZA 1XRVA 4NXKA 3MUIA 3ZT7A 3CMJA 2DH3A 4PMOA 2VURA 3TTYA 1ISVA 1BSIA 5M3WA 4D6JA 5A8PA 2XFFA 3HMCA 2NW0A 3BMWA 1XH1A 2W92A 4E2OA 4GINA 3WL1A 4PMDA 4OBSA 4QDMA 4URIA 2WVVB 1NM9A 5E6ZA 4HOWA 4OGZA 1BGAA 4HMDA 1TQSA 1PX8A 5A6JA 4MDOA 2XWEA 3TONA 4JIEA 5EB8A 5C71A 2X2JA 2WLYA 3JUGA 1E3XA 3LMYA 3AXIA 5A6SA 1J10A 4W7UA 1GJWA 2VZUA 1ESWA 2CBIA 3SUVA 3K8KA 4W93A 4Z2IA 3S6TA 3WQVA 3PHAA 2DT3A 5LA0A 2F1BA 1ODUA 1SMDA 1ITXA 4S3JA 3II1A 3NIYA 2GVYA 2PF0A 1EGZA 4JHZA 1JZ4A 2G3IA 3OBAA 2WHKA 2W62A 4MJ2A 2Y8VA 2JF6A 3VMPA 1OSEA 3B9EA 4Z2LA 1YQ2A 2V3EA 4LYRA 3W81A 3BLKA 1DWJM 4GI9A 2HVMA 1IT0A 1XGZA 1M53A 1GZJA 1TMQA 3WMBA 1V0MA 1XH2A 1VFMA 5CG0A 1RP9A 1WB0A 1QVBA 2D1ZA 3DYPA 4AD2A 1DEDA 1G5AA 3SCTA 3MSDA 1HL8A 3HJEA 4QFUA 4EE9A 4AD3A 3VGDA 3WDPP 1UD2A 3AYRA 1R86A 2IXVA 1J01A 5DF0A 1EO5A 3M07A 1CXKA 3ZJ7A 5CSYA 2EPMX 1UWIA 4FNQA 5A69A 3AIWA 2WCAA 3TOPA 5A2BA 4ATDA 1GORA 1R8LA 5D9MA 1D7FA 1HXJA
chains in the Genus database with same CATH superfamily
1PY0A 5F72S 1HP4A 1M1BA 1HIML 1UQZA 1H7WA 4HWBL 4Z7NE 3WTXA 1QOPA 4NZ8A 3FT3B 4CILA 2MRYA 2VISB 5A94A 4RCXA 4ZE5A 5C08A 4PRIB 1MAJA 4GEIA 4X98A 4H3DA 1TWWA 5J56B 4XG1A 2JGYA 3C5QA 1OYAA 2CLVA 3ZGIA 2VDHA 2XACC 4YWIA 3BQ5A 4F58H 4BXVA 3KXFE 2HRPH 1IGMH 3T6CA 1CD0A 4FOKA 1QSFB 1MI5D 1MHHB 5DZ9A 1O0VA 4MMWA 1X6LA 4HPYL 2VDRH 4JN6A 1M04A 3TNNB 1HVXA 1VFLA 1KFLA 1HTYA 2VLLB 3WUGA 1TQVA 2EINB 1BYAA 5ITBH 2LU4A 4TNFA 3MBED 3EZ8A 4XAKD 3KPMB 2VL5B 1JPSL 4MBOA 2HP4A 2VGIA 3IFOB 5I16B 2HZHA 3GMOA 5LNDA 3TA4D 1VJZA 1FY6A 1NMAH 4TQTA 3CSYB 4QRTA 1H9VA 4RNRB 1SJDA 1TYGA 4JIIX 3BJFA 3LQLA 3QI9B 4XVTH 2G60L 2WIIB 1JXDA 5DFWH 2JALA 3BGGA 5BVPL 1DJWA 3KXFA 5ABFB 3MRJA 5IJCC 3FYYA 4OBTA 2XTJD 2A1WL 4ZJ9A 3U6XA 3W74A 4R7VA 2V17L 3LHAA 1XIFA 4NQCE 3P9MA 3NWRA 3MLRL 1AGCA 4QRUA 1LYQA 2RCSH 3BP5B 4WHTB 3ZLQC 4CDHA 4DN4L 3DG7A 2FJHA 35C8H 3H85A 1JWMA 4D8LA 5EOCH 1KIQA 4B9CA 5I3IA 3FQXB 5DRWB 3OIHA 3STBA 3TN5A 2OOGA 5CN2A 1BMZA 1VBJA 4XAFA 3BP6A 3GXMA 1BD2D 1G7JA 4M00A 4U1MB 5IHHA 3CSTA 5CZVH 1VACB 1S2VA 1X7QB 4TQHA 2XVBA 5EULV 1ZTXE 2VUYA 4BKLA 4EACA 5I3GA 1DTNA 3L16A 3IDXH 3SDAD 4TVPL 2RAGA 1QUNB 4M43H 2QADC 1EPXA 5IW1A 1JNNH 2WLIB 1DBJH 1GZHA 2J2ZA 2BGNE 4DFIA 4YDIH 4ZW7A 3L65A 5H8UA 3JV4B 4PS4H 2PLMA 4OIBA 5K59F 1NJ9A 4Y5VA 2CO3A 3MZNA 1H1NA 4PMRA 1F3RB 1VRDA 4QHKJ 1MZZA 4MKMA 2MJWA 3GUTA 3B0YA 4K68A 2Q2EB 2QHAA 3ARTA 1EC7A 1FG2A 5ITFB 4P3WA 1SW7A 5BRZE 4B5EA 4ODUA 2JCWA 3QXTA 1NDVA 4MQ7B 3W23A 5I5MA 5CJ5A 1JNHB 3EYVA 5CLTA 1Z5YD 5DSCA 2AJVL 3B9VA 3BRFA 3VRLE 1UWTA 5E2WH 4AEHH 3CLEH 1JG9A 1K8DB 5TQ0H 4YNYA 4UT9A 1XZ0B 3IEBA 2PE4A 1GVEA 2P48B 2OL3B 3MRHB 5D7LD 4QWWD 3CNKA 3JSSA 4DP0X 3D4GA 3T8QA 1EEZB 4NPYB 3N11A 1T83A 3PP7A 2PZNA 4YHYB 1OQOA 2RGMA 4KEUA 5L4MA 2X89A 4L8CB 5HUPA 2JFEX 4EXAA 4EPSA 1PAMA 3LNHA 3VXOA 4EUPA 2VC5A 5KYXB 3N1AA 4OECA 3WO4C 1X5XA 3QEQD 2MPVA 5LKNA 3MLVL 3Q7JA 1XR2A 4LSDA 3TT1H 7FABH 4NQCB 4B92A 3W7IA 1W54A 2HFGL 3MZTA 3IJ7A 4BI5A 3VH8B 5ADPH 5L88L 3IFNL 3PG2A 3LRHA 3GI9L 2JJTC 4ZFQA 1U2CA 4P4KD 2OU4A 4TOYH 3WY4A 1KLGA 4JPWL 1ZCRA 2NLYA 1CURA 2DN7A 2XY2A 4I88A 2NX9A 1P84K 1K9TA 3LQGA 4PUDA 1KBWA 1HNYA 4US6A 3NGBB 1GKEA 3N44B 2D7NA 2RJHA 2C7UA 3DX1A 1BQLL 2G5UA 1N67A 4N2EA 3S96B 1WFMA 1GGIH 3BZ4A 5LNWA 3ARDB 1Z9SB 1HKLL 1NSNL 2PTVA 1Q6OA 2H1LM 3D2TA 3U7WL 2XGZA 3ES6B 1IEVA 2JKRM 5B38G 4IQJA 3APCA 4HKJA 1Q6GA 2YPVA 5I6MA 4LF3A 1H3GA 2GTQA 4NQTA 1U8JA 4HU2A 5GGRB 4U2YA 3ISWA 3IDUA 1PIGA 1O12A 2PCYA 3L9RA 3VNZA 1Q66A 3ZPDA 1E0TA 4E41B 1R5IA 2VENA 3RFZB 4FX7A 1RIHH 1R9ZA 3ZE1F 1IGFH 1NL0L 3W37A 2X1RA 1ZHBA 1C29A 1EMTL 4HH8A 2PDIA 1XLKA 3O6KH 5CP3A 5E9DA 1UWUA 4CVUA 4A37A 1TTJA 2B16A 4LEEA 3T2NL 1IVTA 4TXVB 2YCLA 3CU2A 3POHA 4LQ1A 3ROLA 2AKRB 1EX5A 4KFMA 4AIZA 3ZR6A 4NKIH 4UILL 1W16A 1V6UA 2H0JA 3BPOC 4NL1A 4Q4SA 2HX7A 4IWWA 2CXGA 4RGND 3BXNB 4LNRA 1FFNB 4EN3B 3RXZA 2X4OB 1F58H 2IPTH 5MKGB 4F7EA 4LSVH 4A22A 4B3VA 3QK0A 1T5XA 4AZCA 4R4NC 1A2YA 2FEDD 3G5XA 4UT9L 3VFUA 2MFNA 3STEA 3HI5L 2PCXA 3S5LB 3OG6B 4ZXOA 2HTLD 2JEPA 1E27A 1IM9A 2BXZA 4UZUA 1KCSL 4LW7A 2FJUB 1E9LA 4ZYKA 1V0NA 4N2DA 4HSAC 1T7ZA 4QYOA 4RAUB 2D7TH 4F2UA 3VI3B 2VLME 3S5OA 1WYJA 5DDHA 4PJXF 3FOLB 1WFIA 4R7DA 1U6AH 4OCLC 4QRSB 2G75B 4S2SA 3RRXA 3ML8A 2DLFL 5I71C 3SHSA 1A6UH 4QT5A 4AX3A 1Q1JL 1YXCA 3MXVL 4QRNA 2P50A 3V0UA 1O7DE 4LCVA 3E8UL 4DFHA 2XPYA 2YD8A 4OZFB 3IJ8A 2CKNA 2C5DC 1LXMA 1XSJA 3MRFA 2CSPA 2QJDA 4F0LA 2Q01A 4QXTB 1VFFA 2B1HL 4PTXA 4O2EA 5AKRA 1NC2D 3VILA 2A6IB 3KYAA 3L0GA 3OBKA 4PUEA 4L8DB 3WO8A 1HAUA 5KSBA 5A1AA 2VABB 3BOXA 4EIZC 4ERGA 2O72A 1Q9WA 1QSEE 2ZYSA 4AVOA 5T1KD 3ME3A 4F0HA 4KMLB 4XN2A 4ZUSA 3LKRA 3RB5A 1IXOA 4RSVA 4GZJA 5LBSL 1DQJB 2OP4L 2R23B 3SCPA 3QQ4B 1I1AB 2V82A 5JXEA 1TT6A 4RMQA 4RBPK 3IDIB 2KZHA 3O2VL 4DJFD 4MGXA 4JQXC 3RUGB 2X1UA 4F7MA 4N2AA 4UM9D 3D18A 1D5RA 3LKNB 2VMEA 2YPVL 1TJPA 3EZ4A 5F96L 2AQQA 4UXDA 1DLFL 1RZKC 1NIBA 4P04A 5XIMA 1VH7A 2WD0A 3MBDA 5U7SA 5I8KL 1W3NA 4LRNH 3B9OA 1P5UB 5SWSD 4DZIA 4XVUC 4KJPD 2GTWB 3VE7A 3I9PA 2X44D 3W0WD 2WYIA 4DP1X 2E7DA 3GR4A 1J0JA 4ROPA 3NZ8A 3BAYA 3AM8A 5DRNB 1T89C 2MTAA 1SFDA 3ATBA 3V10A 2Y7MA 3SDCB 2ZONA 4AI7A 4X63A 2GABA 2FQFA 4AD4A 1J9YA 3G0XA 4PEEA 4Y1TA 5JOFA 3O15A 2DWEB 5CD5C 3SGKC 2OMVB 3BGFC 2WGXA 4XNUH 4JDYA 4JFXB 4EO5A 4TTDC 1JGUH 4G7YL 1PTZA 3PHQB 1L0XA 5AW7B 4OGQC 4HFWB 3RF9A 1RZJL 3QKZA 4CD5A 3KWXA 2BSTA 4U6XA 5CBJA 5E1AA 4LP5A 3DGGB 4DO4A 3ALFA 5B22A 2WW5A 5FYJH 1ZLPA 2QKIA 4FQIH 5HYFA 1SDDB 2ZAIA 1E3FA 3ANUA 1OP9A 4PG2C 4DYEA 3V0WL 5ABAA 1UZ4A 1IWBA 1EFZA 2K7PA 4ODWA 1WYIA 4XZNX 1ICQA 2AP2A 2DQUH 5KSVB 3RITA 1QACA 1UD4A 2HPTA 3C6SA 2Z31A 3OG2A 1B31A 2CR3A 3U46A 3GZOA 2BVEA 1PLGL 3QUKA 2FHFA 3TYAA 1QZ1A 4PTVA 1BLIA 1XH3B 3SUUA 3T55A 4CC0A 1CGUA 4A29A 2WWCA 3EX1A 4CC4C 4NO0A 1T22A 1QSEB 2UZXA 3FYPA 1VDGA 4P23D 4AMCA 1DZBA 3NCBB 3G2GA 3IM1A 2ZCGA 2K4WA 5J11C 4OFQA 1XL9A 3LYEA 2A0LC 4I1PA 1ZY9A 5CMAB 1D7BA 5BMXA 1DJQA 1QT1A 1M42A 2VDML 4BCYA 3NBNA 1XLBA 1OAQL 3MRNB 5CBAB 3LUTA 1UH3A 1JZ5A 2DT2A 2ENQA 3ABZA 1PWMA 4LLVA 1J1OH 4L29B 4H2HA 4LEFA 3TNMA 5EU5A 1AODA 1UOLA 1SFHA 2IGFH 4M29A 1SGJA 3B7YA 2VM3A 3PWNA 1GC1L 3BVUA 3MACL 3QC6X 4PJDA 3ANYA 3OHXA 1QWGA 1MCWW 3GG0A 3HCVA 1TQCC 1XTMA 3OKKA 2XN9E 2BSEA 4HG4K 4ML4A 1A3QA 4KNSA 2BNQA 4C7GA 4KW2A 4JY5L 4B9GA 4ZX5A 3QUXA 2PGWA 4HUMB 3HE6A 2CKBH 4WRLA 3OTRA 4JFTA 2ZKYA 4FERA 3WYRA 2WXRA 3VXUA 3QO1A 4B9PA 2KS0A 4XCYA 4H26B 5AZEH 1AO7E 3L3KA 3ZYZA 4MD5B 3C5ZA 4QY8A 1X97A 1MJJB 4B91A 5CP7A 2HQAA 1GKQA 4JAMB 1MHEB 3GMQB 3FCPA 3QV8A 5JTWA 2D3LA 5SV3A 1UR8A 5D93C 1NAMH 4HIPA 4AW4A 4TNVK 3KE0A 4KQ3H 4M4PA 4YYCA 4LLMB 4HYRA 3FA3A 4Q2ZB 4AG0A 4LSQH 5FYKE 4TUKH 1XGQB 3X3GH 4KGJA 2AQWA 3AWNA 5BZXA 3VOHA 4JYEA 4PJ9C 4ICWA 2FD6H 1OWRM 4OFVA 4I89A 2WKLA 2NNAB 4YHNA 4M6OL 1CPUA 3QORD 3V0IA 1GTNA 4ACZA 5TF1L 4JJ5A 2I17A 1ZD6A 2ZCHH 3FCSB 1KIRA 1AO7A 2DV0A 1JD9A 1KCVL 4UQ2A 4W88A 1UIOA 5A3HA 2AL2A 4WY7H 3APDA 4LAQL 1MEWA 4BE5A 2NY7H 4PLOB 3UJIH 3ONBA 3CXDL 4XHJC 3ME0A 1ZHKA 1GGUA 4JG1L 2DQGH 4TSBL 3H1ZA 4W9FC 2GFBA 3EMZA 4FCHA 3PGCA 4HHPA 1Y6NR 4L8SA 1ZSHA 3JWNH 4MCZB 3M1ZA 3AUJA 1I3RA 2FX7L 3EOYG 3CXOA 4PLJC 5REQB 1E5BA 4Y2NA 3QLLA 1XX1A 1TIUA 1QPPA 3ULVL 2FQIA 3FB5B 2XN9B 4E0RB 5D9SB 1YMHA 2WHVA 2H8XA 3QXDB 4NQVB 2VLRA 4XB8A 5A6BA 3VACA 1X44A 3DX3A 1JGVH 2I5IA 3D50A 1XGUA 2NY2C 1ZAJA 5F97E 1ACXA 3TU6A 3LYRA 2ODHA 3IS0X 1I8LC 4OTKA 3BJLA 1NFAA 2HS6A 1PBGA 2KUTA 3SOTA 1A9BB 3BVXA 2JKAA 4HUWB 3VU2A 2FNWA 5DVLA 3VGHA 3SY0A 1XM3A 3FYIB 5FYJD 2WWDA 3QJFB 3WEAA 5KJRL 4LVFA 1P6FA 3VO0A 1SLXA 4EQ2A 3NPWA 2HE8A 4YHMH 3KPRA 3QZOA 1VP5A 3TTEA 5C09D 3V1HA 1L5GA 3ORJA 3S8FB 2GQHA 4IEFA 1UG9A 3QG6A 4JPVL 3W7PA 2MQCA 3FFCE 3ZE0B 2ZP8A 4DM1A 2WLMA 2Y69B 1FLRL 3VYPA 4L23A 2NY6B 1UROA 2YBTA 4NHUB 1SJEB 2D2JA 1QUPA 2OZ8A 4FI4A 5F1KC 4UQDA 1KJ3L 3TW7A 4O00A 3MQTA 1OSPH 4OT7A 1GMIA 3I3DA 1E6SM 4GQ9H 2Y36L 3EOAA 3KGUA 5T1LD 3C61A 1C12A 4K8RC 4KZEH 1FV1A 3UWEA 5DD5H 3QHOA 3S3PA 1YPZE 2OXNA 4GZIA 4M7JH 3KHOA 4OAWA 3ZJ6A 2VE6B 4LEBA 2ZWYA 4CBZA 4NS0A 4LVHB 3OLIA 1QR7A 3LN3A 1INQB 4TUOA 3QIWA 3TN6A 4GNKB 5I0ZA 3KYNA 1R19A 4KTDL 1AMYA 4HGWA 3WTVA 2A6NA 1EK3A 1JRHL 3MJ6A 4EI5D 2O5YL 3T40A 4IS6A 1FAIL 1UZGA 4WO4C 3H3PH 4GY4A 4WEBL 2ZJSH 4IU3B 2R0ZL 5IB2B 3UTZA 1AHKA 3WL1A 5L6UA 3HG0A 4N28A 1Q4WA 2VOMA 5JYMA 3EWDA 3A3XA 3LKOA 1DQXA 5C71A 3VTTA 3G5ZB 4UQ3A 2ED9A 5FCUH 2KLTA 1ZK9A 3BKML 1J10A 4W7UA 4NN6B 4IPJA 2CZNA 1ESWA 1RUQL 2V8LA 1YPZA 3S6TA 4PRAA 2F1BA 1SMDA 4F27A 4QXIA 2NR6D 3NA9L 1EPFA 4MWAD 4OSUL 2AK4D 2XXCB 3WJJC 2ZNWA 1OSEA 3T6ZA 4DI8A 1OGPA 4QXVA 3T9WA 3W81A 3HKZA 1QATA 4HNOA 3R0DA 2YXMA 2PYEA 1V0MA 5EU4A 3SY6A 2Y07L 1A53A 4XH2B 4D2JA 3DURA 4ORGB 4YHPB 4JM2F 2RJGA 3KZPA 2OLAA 2ZTBA 3TSBA 3M07A 5KJ7E 3TT3L 1CXKA 3DJ9A 4S1SL 4V1YA 5C0AE 1DVQA 1HGWA 1W0MA 1SEQL 2WCAA 4PJ7E 4ZQKA 3TOPA 4ATDA 5I1AA 4XBGB 1D7FA 3SZ8A 5HJ3B 4X9IA 1BJ1J 3FS9A 2OJZH 4AUJA 3P14A 3PIQA 1ONXA 3FFCB 3VH8G 4LKCA 1LORA 5I3DA 4HPOH 4N0RA 1DUZA 2IPWA 3BO9A 3RL1B 3P2BA 2NQJA 2W8CA 5ADOL 5DQDH 3OWRA 1DLHA 1N8ZB 2APTA 2DRUA 3NYZA 1BOGB 2BZ7A 4OFDA 3HB3B 1BJ8A 3PV6B 1FWDC 1SR9A 2P10A 3O0LA 4LHJB 4B3EA 4FQXB 2VLKD 3C8HA 4UTTC 1P6CA 1JCTA 4S10A 2FVMA 1PD6A 4HUXA 3F2BA 2CNCA 1YXDA 1KN4H 4XZHA 4WJ5A 2QIWA 3QKEA 1UWYA 1WS7A 3CAKA 4ZR8A 1IGIL 2FX8H 5EIQA 1S46A 5DK2A 1LWJA 3HAEH 5D2LA 2OZ4H 3T07A 1PW3A 12E8H 4F9LA 5C0QA 5KVDH 3WO3B 4HUUB 3VOGA 4WFFE 1F6KA 1IT9H 2WQRA 1T4KA 2EDKA 3O16A 2WQPA 5D9OA 1EEPA 1I4FA 4L4VE 1LE9A 2C4XA 1EAPA 1W2KT 2PUQT 1I1YB 1GZGA 5I15L 4ONOA 1QOXA 1LO5A 4JVUA 4NZJA 3GMLA 1FHVA 3KRZA 3WEXA 2J6WA 3WLBA 3RBGA 1FL5B 3D2UB 3SFWA 2G30A 3LMJL 4QLRA 3WJXA 3L7EB 2PWGA 1CICA 1QRQA 3QAZC 4A2DA 2PR4H 1ZBKA 1LEIB 4RE0A 4PP2B 2DDQH 4OJDH 5I07A 3PB2A 1JE6A 4OFYD 2JB5H 5JQ6L 4LU5H 3RO8A 2NXGA 3S2JA 1JQXA 1P7TA 5E5CA 3LKQA 4G1MA 5ESVA 1A02N 4DTGH 3IJEA 5HHOE 4P3CH 5F1NA 3R10A 3UJJH 2MCPH 4OF0A 3BP4B 5B8CA 2W9DL 1DIOA 4RJEA 4L4VA 2J7DA 4BWLA 3V7AG 1ZT4A 5KETA 1WCBA 4M7LL 1HEJC 4LRIA 5C0GA 2J7BA 2QGDA 2GGGA 5C0AB 1U8CB 3UBXB 1NCOA 1F3JB 3MR9A 4YJ5A 2BSDA 2FDBP 3S5LG 4OIIH 5CKGA 3QJRB 2WBJD 1SYVA 3I9GL 4P2OA 3D48R 2A77L 4NXSA 1QO3A 4YIWA 3NQGA 3F58L 2ADJA 1XMWA 4K3GA 2IQ9L 4N2MA 1RY8A 3SDDB 2QLVB 2VSDA 1HKFA 3AG2B 5GZND 3EPOA 2ZQ0A 4KUCF 4GAGL 3PRZA 4ERSH 3FQ1A 1MFCL 2FB3A 1KZYA 4HHAB 2ALRA 4BFFA 3VWJA 2XNAB 3M47A 1CF1A 1I8JA 3Q45A 5J1AB 3O2DH 4JZJB 1B30A 5ID1A 1J93A 1TVBB 3ZZ1A 3S34H 1M7PA 5DO8A 2AJXH 3MLPA 3SBWC 1HKKA 2H47C 5EF2A 2E40A 3ABOA 1YLBB 2D0HA 4AWUA 2PR9A 5FL0A 4IOIB 5IMMB 3CC5A 2YDQA 3VG0H 3BUYA 3HE7A 4L9XA 3T04D 1U8IA 1NC4A 5GNZA 5C9WA 1DXEA 3PDOA 3DGRA 3KYMB 5CILH 4GBXC 4N24A 3VB8A 1EHKB 4V11A 3W5MA 1E0VA 5D4IA 4DN3H 2RFXB 1A3XA 1JNJA 3SN6N 2EXYC 3W29A 2ZCKH 3BQ6A 4N87A 1DL7H 2X4RB 3NDYA 4RR4A 4U1JB 1RAMA 4U6TA 4K2UH 5B38B 1Q8JA 5DA4A 2PCEA 2DF3A 1Y5XA 1E5NA 2A9DA 4XVSL 4M19A 1M01A 2WV8A 3CWGA 3WLWD 2P24A 2ZOXA 3DHJA 4NNXA 5HHOB 2ZKHH 1NFIB 2P28B 5E6IC 2EO9A 2BOEX 1E8YA 3B2PA 4ZB5A 3LHVA 5TQ2H 3B8TA 1KENH 2BWDA 3RTQD 2QQQA 4N6FA 2LR4A 4Y4FB 2DM3A 4JFYB 4C1NA 3W9ZA 1S3RA 1S5VA 4OGXH 3ZDXF 5DMMA 2IANB 2YAQA 3FCTA 1JXKA 4TN9A 1VEMA 2ED8A 2AXFB 5T3ZE 1SF3A 3CFQA 1OM3L 4OJFH 3S1VA 3LHZA 4R4BA 3ONCA 1X4ZA 1YYCA 4PJFE 4Q9BA 4YZWA 1PZ2A 4OLYH 1PSCA 5IIEB 1WISA 4O58H 3C8NA 3G1RA 4OZHA 2Z1BA 1Z9MA 2CO7A 3SZKC 1QBMH 4H41A 4XN4A 2XDHA 3E02A 2I9TA 3FN0H 5LAPA 3A47A 1MHPL 3FO2B 4F93B 5JHLA 3A3HA 1R7OA 3Q2DA 1OCJA 1DWHM 3JWOH 4RCAA 1PU0A 3IXTB 4YOKA 4W81A 4FL4B 4GRLC 1U4FA 1AZ1A 2VUNA 3SDYH 1AC0A 3I6GA 3U9PH 4HKXA 3MAWA 4C83B 4IT1A 2IPKA 5CJOL 1KDJA 3WQEA 2E9WA 5IHUH 4JREC 1HZLA 2MOGA 1QPQA 2Y7QB 3LGEA 1I4NA 4KH9A 4GPVA 4IGBC 3B9KC 2ACQA 3WCZA 1GQKA 2YBRB 4UCGA 1YDNA 1TTAA 5C0DA 1AD9A 1PKQE 1CK0L 3CLWA 4PB3A 2J4WL 1X1ZA 3JWDC 3LZNA 2DZWA 4NT6A 5CCKL 1H5VA 4IOFD 4OM1H 2GVJA 4OZ4A 3QS2A 2PO6A 5I24A 1CR9H 1WSST 2J88H 5LBGA 2JGQA 3OVPA 3WDHA 5I8EA 4YE4H 4ERAA 1QLEL 3ES8A 4NYUA 2Q9OA 3JV5A 3CSBA 3IVKA 4M5SA 1TTRA 3WGUB 3LN5B 1BQRA 5AW4B 3JZYA 4PRBA 2XZCL 4MASA 3GBNH 5GZOC 3WHXB 1BVKA 4JFQB 2P8BA 4M1CD 2NQCA 5E5LA 4WKZB 4XMPH 3PFMA 1MCEA 1TR7A 2V2TB 4WFGD 3H3BC 4PJBA 4LY4A 3UZ5A 3G5EA 4ZEPA 3QUZC 3QIUD 1VRSA 2J7CA 4GKZA 1GW9A 4FA3A 3CZNA 2B0MA 4BA0A 1ED3A 1NF0A 4J9JA 4PJFB 4ZMNA 5JW3L 3T3MB 3ELAT 1EDGA 5F6HI 1XD0A 2CU0A 3HC4L 1YNKH 5ICUA 4Y5YA 4XISA 1D5XB 2HFEB 1OJXA 3TVMB 4JHWH 5H94A 1B3ZA 4QHRA 2PW1A 2DAVA 3H4XA 3NFPB 1S7RB 1MNUL 4LF2A 4P59H 1G1KA 4LVNB 4OJYA 4KRTA 1ASOA 1F2JA 4QRRE 1ORSA 2DQFA 1FH9A 4FGMA 2GOUA 3NH7L 1DQIA 2OMZA 5CEZD 1QRNB 4D0DB 3NN8A 4HKZA 3FUKA 3DH7A 5E9XA 3EGSA 5HTSA 2YL9A 3SQMA 6REQB 1RZPA 3H23A 4GCAA 4GW4A 3VE0A 3CFEB 3PZMA 3FSWA 3L4CA 1XKYA 4KCUA 1N64H 5JHLL 3HN3A 1QPRA 3L4VA 5C8BB 3QHZL 3T2PA 1D6EA 4YPGB 1RULH 1SBSL 1H6TA 4AQZA 3MLXL 4JFFA 4Q8NA 1S3HA 3BZFB 3KM1A 3LPPA 3GBDA 4G1KA 2R8SH 4E38A 4XP6L 1A8ZA 4PYHA 2NUTB 1FI8C 3SCQA 4W4NA 4V1DE 4TV6A 1E6XM 4QRRA 1AQFA 1UM6H 1YDVA 1BM3L 4MSSA 4JEGB 5F3HB 3ATFA 2BLEA 1VGEH 4O18A 1KRCC 5L4FA 2EDHA 5E6UB 2KKQA 5HY9A 5D1XD 3CFBB 3GC2A 1IAOB 2WVVA 5A2IH 1F4WL 4HX1B 3Q0HA 5HHVL 3QPQD 4XI5D 4H8WL 3VFRA 5EOCJ 1D3GA 4NRRA 4KTYA 1J9CT 4U0RB 2ZOLA 1I9JL 4JX0A 3EWXA 5DMKB 1HH9B 4RA3A 2VCBA 3T0VA 1XGRB 5DMLA 3BC9A 1AZ2A 4BDVA 2XWXA 4PHZA 3EEZA 4HLEA 3O6DA 5CJXC 4AM0Q 4QYAA 4XCEA 1KBKA 4A1RA 1KCLA 2QDDA 5ID0A 2H1PH 4Q9QL 3H70A 5T26A 2BG5A 3IE9A 5IR1A 2KDYA 5JO5B 1AQHA 2R4RH 5EB9A 4J6RH 3N15A 2A1YA 4W9JC 2B7PA 4Q33A 4V1DA 4N9DA 3LSBA 1MQKL 4GZEA 3I2CH 3O6LH 4PJGA 1LLZA 5GS0H 1BPLB 4F2BA 1QSFE 4HYVA 4NZTH 3K6IA 4GUPB 3CUXA 4AISA 1VFBB 1HHKA 2GDVA 3C3NA 2CERA 3HZMB 3NCMA 3N0AA 3KPSD 5HR7A 4XP9H 3FT3A 3WMSA 2GEQA 2VISA 4JUSA 3LHPL 1F73A 1UENA 3RY6A 3Q05A 1A47A 4PRIA 3SW6A 1UQYA 4OLXH 5KZDA 3VTAA 1A0DA 1TPEA 3GNPA 4UR8A 1R24B 4G6MH 4Y16C 5BQ7B 3A6BH 5HVHB 3HU7A 4UV7L 2C1OB 1JRCA 4JFED 2FATH 3UXDA 1HJVA 1BLNB 3UERA 3QPYA 3LRKA 4AENB 1WBXB 2CBOA 3N6QA 3VDAA 4PJ6A 2J57A 3ZQXA 2E5BA 2EYTA 3I6EA 1YEJL 4HIBA 2O9RA 4JQ2A 2PDWA 4LLWB 4NC0B 3TNNA 1DBBH 2O92A 1QNIA 1A50A 4WHYH 5FYJU 2E27H 3NSXA 3VSTA 2ESVA 1P53A 1I53A 1ZGLA 3KPMA 2VL5A 2OULB 3U7VA 3OP2A 4XP4H 1VHNA 1TJHL 4JM4L 2GBUA 4LMQE 5I16A 3W2JA 1LL7A 4N2GA 4FA6A 2R6OA 2PP7A 4BS0A 3T44A 1WA2X 3CSYA 5DELA 3PTDA 3HPLA 1MIML 1R5VB 4RNRA 3ULUE 1YJDL 3QI9A 3X17A 2JELH 2WIIA 4DLFA 3MT1A 3VYNA 5CD3B 1JHKH 1EGJH 3H55A 3R25A 4L6OA 1A3HA 5ABFA 1Q85A 3LDVA 1HE8A 3BVWA 3LS5L 4W9HC 1GKRA 1A5KC 2WXQA 5D5MB 2MHAB 1WGVA 4ZVJA 4BA8A 4YQXL 3CT7A 3AZRA 1UKOA 4DXKA 3C4UA 4P2CG 2HLAA 1E4WL 3BP5A 4WHTA 5ESQB 3FQXA 5DRWA 1KR0A 5C6PB 3WTYA 2QVFB 4AXWB 2BP5M 3P62A 3GNRA 4MFDA 2HSAA 3RX8A 5J7CC 4GIYA 3MREB 4U1MA 5F1VA 5KZCB 3RLGA 1IIHA 1LL4A 4OFPA 3DARA 1V3HA 1MCJA 5B39G 5AALA 3N14A 4DNHA 3GJFK 1T8XA 1QUNA 3TQ0A 3MANA 4P4RB 1M2VB 2VR6A 4FQQB 3EUUA 2GHWB 1ZAIA 1GGCH 2PRHA 3EOBB 1JDCA 1SZEA 3KRSA 2VX7A 2WUCH 4GRWF 2YL5A 4LGPB 1IB5A 1LNUB 3TA3B 1GWJA 3MC5A 1ZDSA 5HMEA 3GRBA 3QPEA 3GDRA 3CD4A 3NAAH 4D9RE 4ADTA 3BSZA 3K6SA 4LH8A 1ITCA 4PMUA 4D9QD 1VQTA 3K3QA 4P2QE 3HZ3A 4NO2B 3N25A 3D52A 2VRQA 3X13B 3WEZA 2PDBA 1URZA 1XCWA 3ILDA 1OGTA 5JBDA 4ILDA 5ITFA 2DZVA 3SGJA 3H2AA 3TH3T 3F7VB 4MQ7A 4JKMA 4HN4A 2Y7DA 1JNHA 2WQAA 3VC5A 1H2JA 4Z78A 4XC3L 2ZBTA 1DANU 1G7LB 4E9SA 4S1FA 3VG9B 3CVIL 3WFDH 3LSOB 4MMYB 2F74B 5D7SH 1L7IH 2BVUA 1XQ4A 1K8DA 3O0RL 1BP3B 2YJQA 5I77A 3QWOB 2OL3A 3MYPA 2KPNA 4C5ZA 3BH8B 2QZ5A 2WXDM 1TV8A 1EEZA 1FH5L 1M6OB 3QRGH 2LW3A 3VX1A 3S5YA 3CFJB 4JJOA 1OP3K 4L8CA 2XTLA 2WTPA 2DJ4A 1Z89A 1DVUA 3H0TB 2OT0A 1KYDA 5KYXA 4Q0XH 3GF8A 1EJ6A 5IJKA 4NZUL 4NIYE 3LV5A 4L3CB 2EKJA 2HAZA 3QFWA 4F3HA 2V81A 4NQCA 1LYXA 4GRMB 3WEBA 3VGEA 4X80H 2DS4A 3VH8A 2E7LA 4XX5A 2BZCA 3A3WA 3SO5A 3W1LA 2HFFB 3QUYB 4ICMA 2FECI 1MNNA 1FORH 1S4IA 4B7IA 3B2UD 3WQ6A 1TV2A 5DO2D 1NP0A 3PP3H 4OJCA 1K02A 4DRSA 2DWSA 3ZO0A 4GA8A 3UGRA 3R18A 5AVUB 1NGQL 3B06A 5C0EB 2H26A 2WN3A 5GS0D 4L7ZA 4E41E 1S5IL 1K03A 4NP4H 5IVOA 3U2CA 3GVWA 4PUNA 1T7WA 1D8CA 4NCC1 3FQTB 1KYAA 2XJ7A 1VPXA 3WQDA 5I66B 2YD4A 5FEXA 1W5MA 5EWIL 4L8BB 4I18B 4K94H 5IB1B 1Q9KA 2J3SA 3UBXG 1N82A 3QBUA 1T1YB 3IS4A 3S96A 2AV7B 3I68A 3FPYA 1IJNA 4XXWA 3ARDA 1Z9SA 2ZX9A 4MOZA 3ULUL 2V0AA 3ES6A 4RISH 4L9LB 2N0KA 4K07A 3V7AE 4INFA 1C8QA 1MPAL 4P2QB 1M4KA 3MUGA 2N1KA 3DFTA 5GGRA 1FGNL 1DBAH 5D1ZC 1I7UB 2ZXDA 5BRZA 1W0YT 3CS2A 5F70A 2XG4B 5SX5H 3RFZA 3EGXB 1BSIA 3LAFA 3JZEA 3Q5OA 3BSZL 1XH1A 5CF3A 3VI3E 4E2OA 5E2TH 1S38A 4JM2D 5C2UB 4HGKC 1MCKA 2DV6A 2AKRA 1BGAA 2J9XA 3EYUL 2OV0A 5FAGA 1WQ5A 3CZFB 4KKQA 2VYOA 3T42A 3M1CA 4YSCA 1F00I 5H8DA 2Y5JA 2O7QA 1FFNA 2B7NA 2WYHA 5I1CH 4BYHA 3VOFA 4AGNA 2X4OA 4N2BA 5K2ZA 3W7KA 2EZ0D 2E5EA 3B0PA 5IJDC 4KTEH 3EWCA 5C9KA 1Q2SA 1JZ4A 4X4XB 4CA4A 3DDMA 2C19A 2OL3L 3ARBC 4L1SA 1SGKA 1C5DB 5KSAA 1M57B 3DROA 2O26U 2V2CA 1TPFA 3TYDA 1H3PH 4RAUA 5TE7H 3GHEH 4IRSC 3R8HA 3VI3A 2WZPD 3KH3A 3ZBMA 4FA7B 3FOLA 5GS1A 1X6UA 3HM7A 3DG3A 1KB9J 4IFKB 2IPGA 4QRSA 2EG8A 2G75A 2AAVA 4X3ZA 3WN6A 3QEHB 2OX5B 2AV1B 3SPJA 1DFBL 3APGA 1H8LA 4Y4KD 3I7QA 5J8LA 1SXAA 3MTRA 3WS6C 2Y2YA 3RUGE 1U2YA 3M45A 5FUOH 1BQCA 4OZFA 4JBRA 3US9A 3VD3A 3L3OC 4IGHA 4X6CF 1OYCA 5I8OH 3K2UH 4ANWA 3VWKC 1FP9A 2MKWA 5A95A 5AVTB 3VIJA 2A6IA 5I1DB 4YHKL 2KYIA 3H42L 1ZTXL 4L8DA 1TTQA 5I1KL 1PL3A 4JZNB 1TX2A 1Z48A 4JO2L 4AZGA 3MO7A 4OOUA 1YY8B 2GJ6B 1TEYA 1UB6B 2WHLA 1XW8A 4N68A 5CPSA 4H00A 5H1WA 1WZLA 3JTBA 3RNKB 1DQJA 2ZWSA 1U5VA 4ADJA 3QQ4A 1AH0A 3QFEA 2BS9A 3IDIA 2XRAH 1FYTE 3QUMB 3IKCB 3RUGA 3ZIZA 2GGIA 3FJ6A 4PJ5D 2CHOA 3HA1A 1A6PA 1UR0A 3LKNA 5E4EB 2Y1VA 1MRDL 2JQZA 1CVRA 3CDZA 4QHNB 3DX4A 3X3FH 4KZ0A 2DJMA 3DTUB 3D69A 1KA9F 5E0FA 2CK2A 2YZ5A 3THML 3ZKXC 4XOCA 5CKAA 2WO4A 1V6TA 4ZAKD 3PC0A 3U7YH 2GTWA 1S9VB 5L4JA 1FN4B 3HNTL 4I9WD 3SCMD 1NCCL 1FWXA 1YC7A 1OK4A 1DL3A 4UTJA 3VUSA 1MFAL 3US1A 5LGHL 3SE8L 3SDCA 2H32A 4KKNA 2JKNA 3GSOB 5IOKA 4Z1PA 1QR1B 5ABHA 2XGBA 2FIKB 3GB7B 4KUCD 2DWEA 2RH0A 2OMVA 1MCOH 2WVUA 4IMKC 4ZB2A 1JVLA 4FFZH 4K3JL 5D6DC 5F7KC 4JFXA 5HHPB 3R0KA 3LN4B 1Q6EA 1N68A 3PHQA 2XVPA 2IFFL 4HFWA 4O15A 2IUZA 4MXWH 2EH8L 2AFNA 4H9VA 3DGGA 1T0PB 3IGUA 1Q6CA 4JLRB 4HUVB 1ZXKA 1YRKA 3PGFL 1RZQA 1Y7VA 4AM0B 4DQOH 1INDL 4HCFA 1H0GA 3BUTA 4EDWL 5KSVA 1SY6A 3U1PA 2H90A 5FI8A 4MHHG 2HX8A 2AANA 2K6ZA 2VM9A 3GS4A 2C3HA 5I74B 1OT4A 3ABGA 3UTQB 2FAUA 5FHBH 1MJ8L 3W83A 4HWNA 1ADOA 4MJIB 5CSUA 1KTBA 1QSEA 4PJEB 2HCZX 2AKMA 1VRXA 4OTXH 2VXTL 2HWGA 4MZ8A 3OQ3B 4IBSA 3RM9A 4JW3A 5BXPA 4AK1A 1RIVH 5CMAA 1MNSA 3UZQB 1YAZA 2PP0A 5I75B 1Z0MA 3NIGF 2YW4A 3BFOA 1FYTB 1AGEB 3T2OA 3MRNA 5CBAA 1TZGH 2Z1PA 3WE6B 2I07B 3NEOA 1TEFA 4APXB 2CRMA 1Y6KR 4HJ1A 4JO5A 4XVOA 2VIRA 1AKJB 1S9YB 4GAAA 5K3VA 2IW0A 2APBA 1DE4B 3BRDA 2GJZB 2X6MA 1UP2A 3U7BA 3CHEA 2OK0L 1XISA 1C16B 3NSDA 3QJXA 1YYLL 4E42B 1RMFL 3S48A 1GPWA 1MREL 4DEUA 2QJIA 2FNBA 1UIPA 3ZYOA 2VT0A 3K81A 4L56A 2H4EA 4H0HB 2ACUA 1TPWA 5T8IA 4N20A 4AJWA 1XSOA 3B7RL 4KERA 3WDQA 1M68A 4JPKH 2ITCB 5TDNB 1MCSA 3UP1A 3UYRH 3GIPA 3DBPA 3R94A 2EEXA 2X2UA 4J1UB 4GSXA 2WGNB 4DWSD 5ABTA 1XR8B 2G3FA 1E42A 1TZOA 2BJMH 1R87A 3OJ2C 2DLIA 1CXLA 1XCFA 4WR3A 4RK8A 4H26A 5B3JE 2E7BA 5E4IA 3ZSTA 1BV8A 4MD5A 4F0KA 5C2CA 3MC0A 4DM2A 3FT2B 3PZ9A 2GSGB 3RU8L 4JAMA 1MHEA 3GMQA 4Y1AB 1TZHB 2C3ZA 4FNPA 5C5YA 3ZTDC 4EK7A 4O1FA 4KDTA 1XBVA 2CHZA 1TCRB 1XGQA 1A7OL 4FRWA 3VYLA 2NY3D 3QYCA 5JHAA 4KO9A 2BS8A 1EJWC 1VZGA 4UCFA 3MOBL 2I7GA 3Q44A 3BN3B 3B0UX 3A67H 4OGAC 1SY6L 4Q4OA 3VZXA 3NQAA 4HA0A 3OGVA 2NNAA 1GMEA 4HNVA 4ZQNA 5EZJA 3MS8A 3LTYA 1MOEA 3GFYA 4RE4A 3SPIA 3CFTA 4DEPB 2J27A 4RMRA 1OX6A 4UTCA 3F6JA 3VFPB 2R0LL 1PIIA 3TJEL 2QPSA 1I1WA 3SE6A 2XIBA 4JRFA 3CHFA 3FKRA 1J5HA 1X5YA 5AC6A 3UBGA 2JF7A 3GC4A 4YHLL 1Q5MA 2YAMA 3WDJA 3QEGH 4XPFL 3VXRD 4JPSA 4DOHE 3QCTH 4UTBH 3SIMA 3MTXA 1DHKA 1YNYA 1EZVY 1JUBA 4KZDL 2R9HC 4DAGL 4LU0A 1T20B 4LEXH 3M7FB 2C0HA 2QNEA 4MCZA 5F7DA 3T4AB 3AWFA 4A7GF 3UWVA 3P11H 5REQA 3W1XA 1VCVA 2EBNA 2ZF8A 2MIZA 4LSSL 3FB5A 2XN9A 5C70A 5D9SA 4E0RA 3ZE0E 1YAIA 2WC4A 3QXDA 4NQVA 1RZFH 2QCMA 3US0A 4A2HA 3GNMH 1P0BA 4RL3A 2XYCA 1RCXB 4FPSA 5C0CB 4NHCH 3Q9QA 4QPEA 3IWPA 4CNPA 5FF3A 4XAYA 4UDUB 1YDYA 4XPTH 2X1OA 4HQQH 1ZS2A 4F7CB 2EACA 4XZ9A 3UO8B 1W9XA 3ARRA 2X5PA 1A9BA 4KKCC 4HUWA 3FU7A 3W7HA 2X0VA 1DIKA 4DBDA 4DAIA 3XINA 2IFGA 2F8QA 4NJ9L 2X9ZA 4AVJA 1MXSA 1JV2B 3MO4A 3ARWA 3QJFA 1QFWM 5ABEA 3LGDA 3GG8A 4KFZC 1Y8BA 3NFNA 3RGVB 2EHHA 1UWRA 1G43A 1Q6FA 4JQVA 2CLLA 4J3VA 1F76A 1PEWA 4F4RA 3GM8A 4PTMA 4Y19B 1HHJB 5MHSD 1LG2A 4UFJA 1SVBA 4OV6F 3MGOB 1UM4H 4LOCA 4ZXBD 4NHUA 1SJEA 4WJEA 4GJJA 5GGVL 3EYSH 3AWOA 2UUDK 5FEWA 2PB1A 3SQOH 3T1FB 4ZUVB 1LZOA 2DGAA 3P4LA 2OMUA 3RPMA 3HN8A 3U2OA 3SYQA 5E1GA 1CGXA 1IFGA 1FCVA 2VE6A 1UUMA 3RHWF 5C0JB 3S35L 3WIHH 3MBXH 1V08A 5DEGB 5GISL 2QHRH 1WG3A 3Q67A 1XF3B 1A1NB 5A2KH 2GK1A 4DOHB 4BSWB 3GHPA 3GTXA 2CHRA 1XIWD 2DTMH 4KXBA 3TEVA 3OLEA 4LSRH 2E7MA 4IJBA 4IU3A 4B9FA 1CC3A 4QITA 4N8CH 3FTSA 5FR3A 4WY0A 1SZNA 4YLQT 2F7RA 2A7RA 4HOZA 4FQLL 2VDKB 4HYWA 4BH7B 5TK2A 2ITDB 3HUJF 3PWLB 2F8XC 1E4LA 2EYRB 4L1XA 4PCSA 3C6LB 4XNYL 1HEZB 4UNUA 2XSXA 2WZEA 1XHGA 5GIRB 4XNMA 4LOUD 1RZGB 3I3EA 3GH7A 3VOIA 4K5OA 2AVFA 1MWAH 2G5BB 5TGBB 1XYBA 4IBYA 2PTWA 4XO9A 3UZZA 4XCCL 4XH2A 4F40A 3E5PA 1IRAY 2GWGA 4ORGA 4IJRA 1DORA 4YHPA 1E55A 1C08B 5DUBB 1J7VR 2D0GA 2PLJA 2X0SA 2HT4D 1NF7A 2YO3A 1KW1A 5B21A 5DCBA 3TYCA 4XBGA 1V3IA 4ANKA 1EDHA 1XCTA 5HJ3A 3CG8A 4FXLA 2A9CA 1S5HB 1X5KA 2CC0A 2CFFA 3JXAA 2A4ZA 5EEYA 3SN1A 3FFCA 1A3LH 3BPLB 3BV4A 2D0FA 4LVOB 4KJQD 1UA3A 2QV5A 2O5ZL 1V02E 3RL1A 1GGOA 2HWZH 4FNUA 3EPMA 5ICXB 1N8ZA 4ANXA 4MS8D 1BOGA 2WW8A 3ALGA 2BIIA 3LEVH 2DQHH 2Z1SA 5F7LB 4LFHD 3PV6A 3MCYA 4FQXA 1Z7AA 4Z3IA 2WJZA 4N8PA 5EF0A 3CAQA 3KPTA 3ZX1A 1OB1A 1RUPH 3RIAF 4XO5A 5FYKL 4BWWA 3B3IB 3C0QA 3QXWA 3CQPA 4RWYL 3W70A 1JZ2A 4PH6A 4G70B 5I73C 1YTEA 3UZYA 1KFEA 3LV6A 3UD6A 2OFJA 1UURA 4U2ZA 4JGMA 4HUUA 1WKYA 3OG4B 4RFEA 2CZFA 4POYA 4GYFA 2GJXB 3QCUL 1MJ7H 1TPXC 3B8YA 5B39B 4HBCH 4YZFF 4PUUA 1NLDH 1I1YA 2QFPA 3HS9A 1TJGH 1A0QL 1FL5A 3D2UA 1XF0A 4EXPX 5DVKA 1UPPA 1E0UA 1ZEAH 5DK0B 5ICYB 1JERA 4PJIF 3N9KA 3RN6A 3N41B 1LP9B 1LEIA 1HT6A 2XVNA 3C86A 4PP2A 3BJTA 2XH4A 1MRAA 4K38A 4A2GA 4OJAA 1CCWB 3OGSA 2E4TA 4LK4A 3RJOA 4JY8A 4OW6A 3SD5A 2VDLB 4Q6XA 3BH4A 3WD5L 2VR9A 5C3IA 5K5YA 2BVPB 4MAYD 4LS2A 4N9GB 2ISDA 4HXBH 3R2GA 2JKXA 3WFEH 2CJUL 4FLOA 5IFAH 3AYSA 4GIEA 2AF2A 2BMBA 4CBPA 3H2EA 2IG2L 3IAPA 5C0AA 1U8CA 5L2KD 3UBXA 4PJ7A 1UFGA 1F3JA 5AVHA 4Q8TA 3LRLA 2ZOKB 2CHXA 3C52A 3LM3A 2QPEB 5F7FA 2R0KH 1ZPTA 3HURA 1Q6QA 1RFDH 3LIZA 1PFOA 3ZIYA 1N8WA 1JXJA 1NGPH 2E6QA 3SPVB 4MY9A 1GEQA 1A5AA 4N90E 4JDZB 3SDDA 2Y89A 4TXEA 1E9QB 4JGDA 4MZ2A 5DMNA 3KBFA 4AY1A 4HA3A 3B34A 5GQBA 4PV1C 1CF8H 3PAJA 4HHAA 2VH5H 3HGJA 1KT2B 3LCFA 5BV7C 2GQAA 5J1AA 3DFNA 5FOBB 2EUZA 1YA5A 4JZJA 1TVBA 4GRSA 1QA9B 2PF8A 4OUUB 3MY9A 3ZL4L 4YS1A 1PY4A 1BZ7B 2YXOA 5GXBB 1JN6A 1R5YA 3RCYA 4HCDA 3ZWTA 1HH6B 1QP1A 4ICXA 1A6VL 4IOIA 1P4CA 5IMMA 3PWPD 1XBYA 1GIGL 3O0KA 3M0ZA 5CWSB 1XV8A 2IMRA 2WMHA 3PJWA 2GGJA 2V6HA 4RIRB 1AI1H 2UV3A 4QJ4B 2R1PA 1EHLL 4M7KH 5F7EL 4R88A 1KM5A 3S5NA 4L1TA 2JNZA 1ZFJA 3SQSA 3KYMA 4LOEA 3P4NB 3PHOA 1S9XB 4RETB 2DD8L 2IANE 4XNXL 4PTTB 2PPCA 4KWOA 3FNDA 1NDYA 4MJ4A 3WLPA 1K6WA 4MXVE 3AHZA 5JMOC 4NQXA 5FPIA 2V5YA 4U1JA 5DT5A 2NXIA 5B38A 3ZMNA 1B5TA 3WLNA 2K70A 2OA9A 4G5ZL 5AB3A 1P0DA 3V0GA 3GHBH 3HV8A 4ONVA 5HHOA 5DMIH 2EQDA 1NFIA 1O95A 4IG2B 5DBTA 1IF2A 4P5TD 4AGPA 5AKQA 5CEZH 4YR6B 4X6DF 4Y4FA 2ICSA 1WFNA 3FVMA 4JFYA 1IXNA 5ICZB 2YMOA 4S3KA 5AY7A 1SHSA 3DIFA 3LPWA 3KYKH 4AMKH 5TNVA 5CM1A 1A14H 1E6OH 3M0LA 4GQPH 3LZFL 2FWLB 1GY2A 5D9PA 1RJYB 2AXFA 4XO6A 5E0QA 3NG5A 4W6WB 1AS8A 2EC9T 1DVFB 3ARGD 5D96B 1DVTA 2NXZB 1L9NA 4QDWA 5IIEA 3R19A 3RVUC 2OLHA 3TZVD 1YADA 3H7RA 5D33A 1YKWA 1QO2A 4MMXC 1P0SE 4AOFA 1GYWA 2EDDA 3F6LA 1WV7T 1F6AB 4IUOA 3OZYA 5KUMA 1LO0H 2IXQB 1GAFH 3KP1A 3MHGA 3QOKA 4QXUH 1QBLH 3KPLB 5JIIA 1BGXL 2QL1A 1YUHB 5F1OB 3IXTA 3TLLA 3VRJB 2B0SH 5JOPE 4NXKA 5I1EH 3MUIA 3W7NA 2CHDA 3FUMA 4DVRL 1TQBB 1E9IA 3D08A 2Y7LA 3QCVH 4HJJH 5IEKB 1T5AA 4C83A 3BFWA 4RX4A 5KTLA 2Y7QA 2Q76B 4GGHA 3W9EB 3JQOB 2XWEA 1RIUL 4MG4A 2YBRA 3GQFA 1IL1A 4DIAA 1L9WA 2LHAA 2VSCA 3PL6B 3PHAA 5MEOB 4OCYL 4Y9MA 4Y4HD 2OOFA 3VGAC 2PF0A 4JHZA 3T3ME 1J8SA 1D7DA 4J6IA 5I1IH 3B9EA 3LNDA 4U1GC 4LYRA 2FZMA 1M53A 4Z9KB 3LN5A 2D1ZA 4OM0L 4M7ZB 5AZUA 3HJEA 2R0WH 4JFDE 1IKOP 4JFQA 2NY0C 4GQGA 4WKZA 4PJ8B 4K8GA 2X12A 2V2TA 2VDPB 2EVJA 1QRNE 5AYQA 1UEYA 2V9TA 1TUPA 4L9ZA 1LUCB 2Z2UA 3CH0A 3CGTA 4JDBA 4LOVA 4MZ3A 4UTUA 3N55A 5EZIL 4H6QA 3PQYD 4LRTA 5HBBA 2VDNL 3E74A 4PJFA 4QTGA 5AAWC 3UIZA 4KF1A 1O4UA 1REQB 3LH9A 4XHQA 3H7UA 4N1CA 1D5XA 3P0GB 3QW4B 5AW5B 2HFEA 3TVMA 1ZWIB 32C2B 2UWEF 3GM0A 4YE0A 4FFTA 5FOOA 3NFPA 1S7RA 5C9ZA 1ANUA 3BHBB 4O4YL 2HFTA 4N0FB 3ATZA 4UT6H 1YSOA 2PTDA 4X5XB 1QRNA 4D0DA 5IB4A 1G4PA 3TESA 2RIKA 3USBA 1IMHC 5KAQG 3NZPA 2XWBB 6REQA 2DSVA 5D71L 4JMXA 3SSJA 2F58L 3CFEA 3VU1A 1F07A 1S3TC 1ZT7B 4KK6C 1K8CA 4P8QA 1KY7A 3BW9A 1SM3H 2HN7B 4U4BA 3PF2A 2FE0A 4YPGA 3AUWB 1E9YB 1V3MA 1FDJA 1MCHA 1X7IA 3Q1SH 4C6JA 5IBUB 1NA8A 1ICTA 4IJ3C 3V4PA 3RRQA 2FL5B 1VSCA 4X60A 5XIAA 2PXYB 3AREA 3LRSB 1PKQA 4E9RA 2Q10A 2NUTA 2JCCF 2E1WA 4F0SA 2BX7A 5LHDA 2FFCA 2C3GA 1UM5H 2I7SA 2XQYG 3TBBA 3AQUA 1LRTA 4O8AA 3OKEA 3FL7A 4YH6A 4DP6X 3P74A 3C87A 3I10A 1GVRA 1IAOA 1QFEA 4HX1A 1RY7B 2DQCL 1M71B 3WFBL 3WJLC 2YPIA 1P6WA 3DVIA 4JFDB 1J96A 5DMKA 1IARB 4IF2A 4J2MA 1OOAA 1XGRA 4LCYB 2REQB 4RX0A 2C1GA 1UGKA 3QP3A 2AERT 4Y6GA 5KBKA 4UNTA 4Y8AA 5JO5A 5EUOF 4I48B 4I3RL 4L3AA 3QDGE 2F61A 1WOAA 2CBTA 3TCSA 3WK2A 3U6RB 1OQFA 4MKVA 3ZJ8A 4PW9A 5C7HA 3QFJD 4CD4A 4GUPA 2EDFA 1VFBA 2VLJD 2QQ6A 2Y1HA 2J78A 1UOZA 4KPHL 2YPLE 3O05A 3FJLA 1QW7A 2PDFA 3HZMA 2XUWA 1AA1B 4YGVB 5T3ZL 1AG0A 3A12A 5DZAA 3NCYS 4H1LH 2AMXA 4XAWH 3ECUA 3N1MC 4QGYA 3TQPA 4H9TA 4L0ZA 1IX2A 4UZGA 1QAWA 3KGTA 5BROA 4HZAA 1FXQA 5DQ9B 1R24A 3MU7A 5BQ7A 4R85A 2C1OA 2Z00A 4QCFA 1I7RB 1DIEA 1GJIA 3PNUA 1BLNA 4UQBA 4AENA 1WBXA 1ZPUA 1CLKA 2Y6ZA 3PG8A 3EXJA 4M93C 4IIGA 3SGDI 1EFQA 2QADD 1U8NB 3RNQB 1W3HA 3C2EA 3RDTC 5KW9H 5D5ME 5AZ2L 4CCZA 2Q3RA 5LN4A 3TPKA 2F7IA 1LOLA 3SQBA 2W61A 1M3JA 3VFLA 2NOYA 1PZ5B 3KS0J 3N43B 4P0DA 3VIHA 2K7QA 3N34A 3IDNB 2DQJH 3SIKA 4GYPC 1NICA 3K4ZA 3T1GA 5CEXB 2CNZA 1T8QA 4NO3A 4J3SA 1S1RA 4P5UA 2M26A 4IBZA 1SOXA 3V4PL 3WMLA 1QAPA 3Q8FA 1MFDH 4R34A 3TN3A 4PCPA 1EP3A 1A5UA 5D2TA 4JFZH 1HNGA 3HNVH 5CD3A 1FL6B 1PYWB 1RZKH 2LE9A 4Z7AA 3IK2A 1YMME 4EIBA 4YX2H 1H5BC 5E00B 2MHAA 4GG6B 2DM4A 3AUVA 4G7FA 5D1QB 3SE4C 3KJ6H 3UXFA 5LB1A 4ML9A 2CXEA 1N55A 2P44B 1WKEA 3VJ6B 3FC8A 4HCRH 3QDGB 1SHMA 1E9OB 4IKKA 4PQXA 5ESQA 5AYIA 5GSRB 1UADC 1IE4A 3AIQA 4AXWA 2HKFL 4PEKA 4AYEC 3L08A 2TMDA 5D7HA 4O8RA 1QSFA 1MHHA 2WXJA 5KN5B 5F7YC 4ENZA 2W27A 1JFHA 3MV01 2ZADA 2VNCA 1XYMA 5I0VA 2YPLB 5DZPA 2VLLA 3CK5A 4B6ZA 3FUEA 3EFDL 4CU6A 3KTSA 5ACLA 3S2LA 4P4RA 1M2VA 4X6EB 4FQQA 2X88A 4PJHE 3UH8A 3IUDA 2YAOA 4EF8A 4DUXA 5DLML 1U83A 3EOBA 3IFOA 1F4YH 2VR3A 3KGRA 2I1OA 3W56A 1LNUA 1FHLA 3TA3A 1UCWA 1BMWA 3KWVA 1U3YA 4N2HA 4DERA 1KACB 5EMJA 4NSBA 3IIZA 4OCNC 4DZBB 3FAWA 3BJ91 1CXFA 3X13A 1Z32X 1VLIA 1S2EA 3OMNB 4TQIA 5E1HB 1WFJA 3SZ6A 3TH4T 3H7VA 2SODB 1CLYH 3F7VA 2R83A 3MRQB 3AMKA 1B90A 4OD2B 4U1IB 1G7LA 4FYRA 1SVZA 3I7RA 1FWRA 5H8PA 1NCWL 1SHWA 3LSOA 4MMYA 1OOWA 2ZZ4A 2F74A 4Z7QF 1N2RB 2FGWL 4OZIE 1W1YA 2QCCA 1IEQA 3RLUA 1TR9A 1L4IA 3N85L 3NESA 1KV8A 3QWOA 4U1NB 1VACA 2ZUQB 3BH8A 3WH8A 3CBRA 1X7QA 2P88A 2QYGA 1HVQA 1IBHA 4IMDA 1M6OA 3AG4B 1K9FA 3WNJA 3HI6H 3GZKA 1AZRA 2Y5TB 5FO8B 3CFJA 4LLUB 1KCKA 3VVVA 2WLIA 3H0TA 4JIHA 4JRXE 1UFUA 2IH9A 1YMMB 3VNLA 4WSHA 4LB4A 4BKNA 3JV4A 3L1EA 3O45B 4L3CA 2B1AL 2DIAA 1WK0A 3ESPA 4GRMA 3AAZB 1POKA 3KDNA 3J2PA 4RZBA 4KMQA 4Q9RL 3VDCA 1AG6A 2NXYC 4DZ5A 4ZMWA 2EVGA 3WXVH 4X61A 3LQAL 4QM1A 3K4DA 4LUJA 2HFFA 3QUYA 4W89A 5D30A 1E8ZA 3FBKA 1TZAA 1Z5LB 3IGLA 3RWDB 4EKXA