1QW8A

Crystal structure of a family 51 alpha-l-arabinofuranosidase in complex with ara-alpha(1,3)-xyl
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNAMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-L-arabinofuranosidase
total genus 171
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qw8A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qw8A02
1UR0A 3PTKA 1Z32X 6CGTA 4L4OA 5JBFA 4CCEA 3B9AA 4GXPA 1UD8A 1OGGA 2VZUA 1UOKA 3N18A 1QW8A 4J3VA 1SYTA 2G41A 3SUSA 3PZ9A 5E0FA 4PSRA 3GXFA 4ACYA 2C0HA 5CPSA 4PUEA 4JL1A 3T09A 5M17A 1UA7A 5I6SA 3WD2A 5I79A 4H41A 1US2A 1M01A 3ARTA 6A3HA 4U3CA 3AHVA 3WDJA 3W6LA 4J3WA 1DTUA 5A6MA 3ZJ7A 1NM9A 1GOWA 3VGDA 3OLDA 4CN4A 3ZT5A 4A3HA 4QP0A 1UWSA 1MW1A 4RE2A 2XVKA 4OZOA 1KR1A 2ZXAA 2D1ZA 4DWSC 5CQ1A 4P8WA 3AIWA 2D0HA 2VURA 1TQVA 1W91A 1EH9A 2GVYA 1TQTA 4S3KA 4AISA 2VVNA 1J0ZA 3ZIZA 4Q22A 2BNJA 3M46A 4D6JA 3AHZA 3BUDA 1FP9A 2GFTA 5F7UA 4QFUA 1DWJM 1JXJA 3CHFA 3WN6A 2WZIA 3D3AA 1BVNP 3UG3A 5I23A 4BQ4A 4Z2JA 1JZ3A 1J0HA 1HKKA 3NUKA 3VSVA 2ZUNA 3K4DA 4DO5A 2D2OA 1E0VA 5DT7A 3D4ZA 4OOUA 4CD4A 2EO7A 4CKQA 4FNPA 4AMWA 1KGWA 2CEQA 5CG0A 1GVYA 1JF6A 4M56A 3CUJA 5EBAA 2ZUTA 3G6MA 3PBGA 3VDCA 3K46A 2VOTA 3WD4A 4N0RA 3BVTA 2WVSA 2PF0A 3BAXA 2G8ZA 1H0IA 2XGIA 3CUIA 3AICA 4CD5A 1WZAA 3L4ZA 3SCNA 1WKYA 5A3HA 2J7FA 3WUFA 2DQXA 2EJ1A 1KQZA 1VFFA 5AC4A 8CGTA 4RE4A 1XYFA 1TQWA 4N42A 3N15A 1W9XA 3WKZA 1HKJA 4UR9A 3MANA 4AEFA 2G3MA 5I78A 1MW3A 4H7VA 1F4AA 2OSXA 1PZ3A 3MU7A 4ACZA 1JF5A 5IFPA 2J7BA 4DO6A 4CD7A 2ZE0A 1EO7A 5GNZA 3B9EA 4FNSA 2V5DA 1E9LA 1KCLA 2VRKA 4JIEA 3S6TA 2WVUA 3F5KA 5AYBA 3II1A 3PZVA 2J8FA 2YBTA 4UFIA 1BF2A 2DIEA 1V0MA 1NARA 2D20A 5IDIA 1OIMA 1TMQA 3W53A 3FNDA 4D6GA 1ZJAA 4JZ5A 2JE8A 1NOUA 2EXOA 4GO9A 2BXZA 2GUYA 2J47A 5GNXA 1WDPA 3B9DA 5AC5A 3VIMA 3WF1A 4UQEA 3WUBA 1NQ6A 4AWEA 1NWUA 1TQUA 1H3GA 1UA3A 1NP0A 5LA2A 1HJWA 4AXNA 1C90A 1XH0A 3TOPA 3ARVA 2JIEA 2QMJA 4J3XA 4ML4A 1MW0A 4AZ6A 2EABA 3WFZA 3W0KA 4CVUA 3AZSA 4PMNA 1R85A 1UQZA 5EFFA 2VX5A 1V02A 3WUEA 3KE0A 1BQCA 2EPKX 3IK2A 2WVVA 4HMEA 3VIPA 4Y7EA 2BVDA 1UWTA 2HISA 1HL9A 1NWRA 2XJ7A 1W1YA 1CGVA 4B3KA 5LA1A 1KGXA 1B3XA 3MSDA 2BHUA 1TR1A 2G3JA 1V6YA 1DWHM 4AZ5A 2E4TA 3SUUA 2E8ZA 1CECA 4AW7A 4V2XA 5D4YA 3LRLA 1AMYA 5C71A 3VIKA 4U3AA 3WNLA 2XWDA 2VZTA 5IFTA 3CZJA 2HVMA 1MQQA 3ZQ9A 2F7OA 1QNQA 5DT5A 3DX2A 1V0LA 4AZBA 1H4PA 2BV9A 3EMCA 5BXPA 2WYSA 3WNMA 5D9PA 1JDDA 2FYVA 1TQSA 4MPKA 1JIBA 4YHEA 2OSYA 2IUZA 3SUTA 5I0DA 4BQ2A 2DSWA 4OKDA 4PMQA 4FLOA 1BFNA 3A24A 1R86A 4MAVA 3D5HA 1V3MA 2J7CA 2ZUWA 4MTVA 3AXHA 3THDA 4XX6A 2XPKA 1VEPA 3WL1A 1AQHA 3VU2A 5FL1A 2J75A 3U7BA 2Y24A 3K4AA 5A8MA 4QLJA 1LWHA 4UOZA 4AD2A 2YBUA 4W86A 1UZ4A 3NDZA 1PS3A 2XN1A 1QNPA 5ECUA 4FK9A 1OB0A 1HKMA 4MB4A 2QV4A 4HTYA 4W8AA 5C8BB 4E8DA 2WLYA 3BUPA 3RM9A 1KXVA 3RM4A 2OWCA 1XSKA 2CKRA 2WCSA 3TTYA 1ITCA 3MSGA 1JZ6A 4MDOA 2F1AA 2O92A 5BXSA 1E1FA 1W9VA 1QOXA 4AYGA 3FHAA 3KLKA 2DIJA 3ZR5A 3WDPP 4ZENA 1BLIA 3CLWA 4TX8A 2XVGA 1E6XM 4KRUA 3TA9A 3ARWA 3MUAA 1CENA 3SCPA 4UQDA 1XV8A 4UQCA 2WMFA 3QR3A 4W7WA 3MO4A 4UFLA 3GXNA 2J62A 3WDHA 3KL5A 1UD6A 2NT1A 3CUGA 5DFAA 4HA4A 2WKGA 2WMHA 1JG9A 3I3EA 4PMZA 2ZWZA 1W1TA 1IZKA 2XTKA 2A3BA 1CGYA 1OD8A 1RH9A 2PBOA 2DSKA 3FAWA 3SCSA 3VSUA 3GH5A 4W5ZA 2JALA 1QWNA 3WNOA 3NSNA 2WWCA 3AIRA 4XV0A 3OGSA 3DYMA 4OBRA 4AEEA 4A3YA 3TTOA 1BYDA 2WNWA 4F79A 5ABGA 2V3GA 1PIGA 4AD1A 1JFHA 4WSJA 1CLVA 3SUVA 5HPCA 3QHMA 4PBGA 2OWWA 4AY1A 3UERA 1R75A 4Z2HA 2WXDM 3OG2A 4EE9A 2WM0A 1LJYA 3VIIA 4EANA 3WQWA 5HOSA 2XIIA 4DUXA 1JDAA 4Q7NA 3AHYA 1YHTA 3A6OA 3RDKA 3RM8A 2D73A 2Z1SA 1KTBA 4HOXA 2Y4SA 1TA3A 2WKLA 1UD4A 1V3KA 3S2CA 1UWIA 1EDQA 1MXGA 2CHNA 3VD3A 1GOOA 4QLLA 2E9MA 1GZJA 1W3KA 1WNOA 2WBKA 4IISA 4XZBA 1KQYA 2BY0A 2YA2A 3ARSA 2WC7A 1K9TA 4UTFA 1JI2A 4QDMA 1E72M 1NWTA 1Q6FA 3OGRA 2VUYA 1QI5A 4AD5A 2ZICA 4MAZA 1NP2A 2ZWYA 3APGA 3G6LA 4UFHA 3N11A 5EB8A 1JYXA 4M29A 3FY1A 2DH3A 4AIUA 4DO4A 1VB9A 1LL4A 3HG4A 1E0WA 4HOZA 4DWSA 2YA0A 3A47A 1V3JA 3EMQA 1CZ1A 1CWYA 4U5IA 4ZXOA 1PPIA 4D1IA 1QPKA 4GI6A 3UG5A 3MMWA 4C7GA 4ZE5A 2XVLA 4TX6A 3A21A 2DSVA 3EDEA 3VGHA 1JL8A 2JEQA 3LRMA 2BVTA 4AZHA 3VMOA 3D51A 4PEEA 5FCZA 3TONA 3BSGA 1QNOA 3VX0A 3OB8A 3WMCA 4GI9A 4U2ZA 5DO8A 3GXTA 5CPQA 2WZEA 1GORA 2NT0A 1OT2A 1B0IA 2VC9A 3PN8A 1XGZA 1GW1A 4HPHA 1ISWA 4S3JA 1UD5A 4W7VA 1U30A 1J10A 3OA5A 3DECA 5EFDA 3ARYA 2X0YA 4F8XA 2XYLA 2J79A 4MJ4A 2XN0A 2VX6A 1KXHA 1V03A 2RGMA 2YDRA 1CGXA 1VENA 3THCA 1WZLA 4B15A 1PBGA 3A23A 2FHFA 3QOKA 1QBAA 1HL8A 2A3CA 5D9OA 2V38A 5FOOA 2AAAA 2CPUA 1VAHA 1MXDA 3WSUA 1SMDA 3ZSTA 3WQ4A 2J77A 1BGAA 1EO5A 5A6JA 2CIPA 2XN2A 3L4XA 5E1QA 1R34A 3WNKA 4CU8A 1TG7A 4AC1X 2WWDA 1G9HA 2WMIA 1XH2A 3F5LA 1CLXA 2YFNA 2O9PA 1R7OA 1D2KA 2TAAA 1JI1A 3IJ8A 1UKTA 4ZFMA 3T08A 3WY4A 4J27A 3DX1A 3QOMA 1OT1A 4B16A 4D6EA 3D50A 2YDSA 3T0DA 2F61A 3WEZA 1HXJA 3T2PA 4M82A 2BS9A 4D6FA 5A6AA 2VQTA 3PZQA 4D6DA 2CBUA 1M04A 3A4WA 1I1XA 2FHCA 5DF0A 3SEPA 4NZFA 1LG2A 4LYQA 4AD3A 3BLBA 1IT0A 3HU7A 1E4NA 2BHYA 1SZNA 3FN9A 1OWQA 1V6VA 1JZ4A 3GTNA 2E0PA 3WH8A 3BVWA 4MDPA 3VIFA 2XG9A 1W9PA 1I1WA 1FHDA 2PWDA 1JFXA 2WMIB 5BYWA 3GNOA 3EJRA 1GQKA 2XSAA 3DX4A 4H8VA 5JBEA 5M03A 2CBIA 3WMBA 4GPNA 3HN3A 4JCLA 4CGTA 3ZO9A 4PN2A 1EXPA 3CO4A 5A6BA 2A3HA 4CVWA 3N13A 1HWWA 3WQ8A 1QVBA 1CXIA 4HP5A 4FLSA 1VFUA 1E3XA 2E9BA 3OLIA 5EMYA 1E4IA 1L8NA 2J4GA 3RCNA 1KXTA 2QLYA 3DYPA 2Y8VA 1CYGA 1HXKA 5CXPA 1WCGA 4HU0A 1WB0A 1GHRA 3H54A 4PUDA 1OGSA 1VBUA 3AXIA 3SCOA 5CSYA 3GXMA 3DX3A 2OSWA 1HP5A 4M80A 1CXKA 5A6LA 2JIWA 1JNEA 1UR9A 1QI0A 9CGTA 1BTCA 1MYRA 3LX9A 2ZXQA 3WF2A 1WDSA 3KWXA 3LPPA 1VRXA 1E6RA 3W82A 1BYCA 4P7RA 4PYSA 5HXMA 1ZL1A 3ZM8A 2Z1KA 1JAEA 2YOCA 5E6ZA 2F7QA 3BSHA 3HG3A 2NSXA 3QGVA 4MNMA 4BZYA 1WZKA 1QWUA 2E3ZA 3CUFA 3U7VA 3KL0A 3WEOA 1US3A 3A22A 3M07A 3MKKA 1LG1A 4PMUA 3F5JA 1G0CA 3ZJ8A 2X1IA 1UR4A 3MV01 4ZE4A 1FFRA 2UWFA 1N82A 3CMJA 3WH5A 2E8YA 2V3DA 3VD5A 3H53A 2XHYA 5GQBA 1Y7VA 2WMJA 2EBNA 3LXCA 1GUVA 3BVUA 2C7FA 3BVXA 6TAAA 2J74A 2X8RA 4GZEA 1HF6A 2WAGA 2VRQA 2OWXA 3FXYA 1WDRA 2YL6A 2V5CA 1CXEA 2VVSA 4JCMA 3AMLA 1I75A 5A69A 4JHOA 3U5UA 1XHGA 1GOQA 3VINA 1KB3A 4P7NA 1KCKA 5FIPA 4BS0A 1PZ2A 1LL6A 1HVQA 3N17A 1JXKA 1XH1A 4CN1A 1FP8A 4FNUA 4J3UA 1K9FA 2PC8A 2VZVA 2GJRA 3PTQA 1KBBA 4R27A 3VUPA 2QHAA 5A8NA 4W88A 3PZGA 1JYWA 1LL7A 4YPJA 1CGUA 1AQ0A 1J0IA 3GDBA 5E6YA 1C8QA 4JKMA 1WP6A 5A8OA 1B30A 4X0VA 1E4MM 1X1NA 1KR0A 4YHGA 2VQUA 4P7QA 2IXVA 4JFVA 2WCAA 3N12A 3CHEA 5ABEA 3NIYA 4IM4A 4CCCA 1WZMA 3WL0A 4UQAA 2QPUA 4PTXA 1HP4A 1EOKA 1JDCA 2ZX7A 1RP9A 3UESA 3VVGA 4PSPA 1WE5A 3RIKA 4MNLA 1JD7A 2W5FA 4AZIA 2EACA 3OZPA 4DM1A 3IJ9A 1GQJA 3FHQA 2PI6A 4UFJA 3OIHA 1ZBKA 2PWFA 3DDFA 3KL3A 1MVYA 3U5YA 1VEMA 3VGFA 4DWSB 4TVDA 3LPOA 4TVCA 1PJ9A 4OOZA 1L0PA 4ZXLA 1TCMA 3WD0A 5A95A 3BLKA 4XB3A 2W63A 4UZUA 3WFLA 3EYPA 1EGZA 3WQ5A 3NDYA 3AS0A 1PEZA 1W2VA 1TVPA 1E4LA 5CGTA 5I3DA 1RPKA 1DWGM 2GJPA 1H0GA 3N1AA 5BRPA 1ITXA 5I77A 3ZR6A 1GJWA 3CZLA 3WH7A 3AHTA 2BXYA 4WK9A 4NRRA 3VIJA 3WDQA 4HZ8A 4X0NA 1GVIA 3W38A 1TA3B 4PMVA 1R8LA 4D1JA 2X2HA 1O7AA 1G5AA 3CTTA 5BWFA 1GPFA 3K1DA 1EQCA 3AMCA 7CGTA 1O6IA 1V0NA 2DEPA 1D3CA 4GIAA 3DDGA 3QHOA 4F9JA 3GXPA 3WEMA 1MFUA 4GKLA 4AIOA 4J28A 1FH8A 5ABHA 2XM2A 4X9YA 3VO0A 4PTMA 1W3JA 1U33A 3AIEA 4EKJA 3WF4A 1JYVA 3KEHA 3IAQA 4V27A 3EDDA 4PTVA 1FH9A 1VFMA 4R5EA 2F7PA 5CPTA 4GQRA 1B31A 2DT2A 1HJUA 4TUFA 3O9NA 1UZ1A 3BCFA 2DSUA 2XWEA 3L4UA 3VGGA 2J7HA 1E5NA 1JGIA 5A6BD 1K9EA 1G94A 1HNYA 3RJYA 3L4VA 3ZMRA 2X2YA 2WZHA 2YA1A 3B8SA 3ARRA 4JL2A 1TFVA 4XZWA 3T2OA 1E40A 1TUXA 2JFEX 4AZCB 5A8PA 1V3IA 2XFYA 4KRTA 3ZOAA 3VGEA 4NZCA 4C7DA 2DT1A 1LQ0A 1QNRA 1J01A 1CGTA 1ODZA 3H55A 3MUZ1 1GOIA 2BVYA 2ZUMA 3WNNA 2CITA 3PTMA 1K9DA 1QX1A 1GNXA 3T0AA 1H2JA 2CKSA 3A4AA 3VKKA 2ALWA 1H5VA 1D7FA 1MW2A 3FAXA 3PZMA 2D0GA 1E5JA 3SIMA 4K68A 4NZJA 1GQLA 4W93A 2PWGA 1UWRA 2GK1A 4P8XA 4WKAA 4BQ5A 1C93A 2WHLA 2UY5A 2FH6A 4WJXA 4AIEA 1R33A 2FHBA 3VM7A 3CUHA 4BF7A 5CSUA 1BG9A 3VDBA 1DWFM 2V3EA 2JF6A 2EPNA 2J25A 2OLHA 1G1YA 1BYBA 1XD1A 4QCFA 5DEZA 1KXQA 3CGTA 1O7DC 4J7RA 1PIFA 4ATLA 4LGXA 4PMDA 4CN6A 1W3HA 4UQBA 3OGVA 1Q4NX 1GQIA 3CMGA 2QMKA 3MUIA 2B31A 1TE1A 3NJ3A 3WDIA 2D3NA 5HDRA 5HPOA 4PTWA 3BMVA 2BY3A 2Y8KA 4DUWA 2IGTA 1PX8A 2EEXA 1WO2A 3AI0A 5JIPA 4TTGA 2WBGA 4PRWA 3LXAA 1M03A 2WMKA 2WPGA 3AS3A 2D24A 4U33A 4ZEPA 5M5DA 1J18A 2W4XA 3DC0A 1OCQA 1RD6A 5AYIA 4Z2IA 5I5RA 5A8QA 1EIBA 1E6SM 2E9LA 1VJSA 1Q6GA 1WDQA 2DT0A 3EJTA 3A4XA 4W87A 3HJEA 1FA2A 1QI3A 2G4FA 2XSBA 3ECQA 1HX0A 1H49A 1UKOA 2UY4A 3GXDA 3VDHA 1E15A 3W25A 3ZJ6A 3VM5A 1DWIM 2VZOA 2DDXA 2WC3A 4YN5A 4LXFA 3BC9A 2OYKA 2NW0A 4CD6A 1C8XA 1E6PA 3BUQA 2WANA 2AMGA 4F66A 1QW9A 2VT0A 4GI8A 4M81A 3GXIA 1M7XA 2MANA 4GO8A 4MNKA 1HTYA 1W9BM 3NSXA 2CETA 2ESCA 1CIUA 4E2OA 4DM2A 4JHZA 1ISXA 1ESWA 4EK7A 2WVTA 3RILA 2CYGA 1E56A 1KTCA 1CBGA 3AIQA 4W85A 4RE3A 4AZCA 5FD0A 3DHPA 2F8QA 4CU6A 3AYSA 2ZOXA 4LX4A 1XCXA 2VL4A 4LYPA 2OW6A 1UYQA 3CZNA 3VIHA 1IZJA 3EJSA 2QPSA 2G3IA 2XUCA 5IHSA 1UKSA 3ZT6A 3JUGA 4NRSA 1BHGA 2Y2WA 4L4PA 1UWUA 4IPNB 1CEOA 4FMVA 3WY1A 2XFRA 3VX1A 3ARUA 2YKKA 3M6DA 2JEPA 3KLLA 3BH4A 1BYAA 1DEDA 4WKFA 2XM1A 1UR2A 3OLEA 1PX4A 3WENA 3NSMA 3SUWA 3CZKA 3VSTA 1UASA 4DUVA 5AY7A 3SURA 1U2YA 4HZ7A 4MB5A 1YQ2A 3CH9A 1JZ2A 1HJQA 2X0HA 3EDKA 4D6CA 1GCYA 3BAKA 2GDVA 2XVPA 4UOJA 2O9OA 1CTNA 2X05A 1V6WA 3O6AA 2J7EA 3ALGA 4H2CA 4BCEA 1P6WA 1VBRA 2E40A 3GZAA 3OBAA 4Z2KA 3W81A 4KH2A 4AZ7A 4AD0A 1XYZA 4FNRA 5LA0A 3M7SA 2GDUA 1C8YA 3BAWA 4UZSA 4TTUA 2VTFA 3SCRA 4PMRA 3VNZA 4JAWA 1ZBCA 4GQQA 1VJZA 4BQ3A 3DYOA 4LPCA 1H09A 3S5ZA 1NWSA 3GH7A 3GH4A 3VILA 5KZ6A 4OGZA 2YLAA 4CU7A 3S5YA 4D72A 5ABFA 4AMCA 3I3BA 1R7AA 1CGWA 2YLLA 2WSPA 2OYMA 2A3EA 1MFVA 1UH2A 2YL8A 4HMCA 4NX0A 1OM0A 2GJXB 1VFOA 1QI4A 1KFWA 4BA0A 4NF7A 3AFBA 4E4PA 3CHCA 2A3AA 3W6MA 3CC1A 2EQDA 2ZX9A 2CCRA 3DHUA 3BLPX 2VX4A 1F4HA 2ZUSA 4GZIA 1LWJA 4NXKA 4JKLA 5CJ5A 3ZT7A 3WIJA 2WHMA 3MUY1 4JFWA 3WNPA 3AISA 3AMGA 2F7RA 1H11A 2DSZA 2PBGA 2G3NA 4KGLA 1BSIA 1LF1A 1GOKA 1FOBA 2JF7A 2VX7A 2X2JA 4OBSA 1NH6A 1W9UA 1Q6CA 2W67A 2O9TA 3WY2A 2CHOA 2FE0A 2WK2A 3CHDA 3WUGA 3AJ7A 4WKHA 1A47A 3LPFA 2ZUUA 3VNYA 1DWAM 2IXUA 5CLTA 3BXWA 4GZJA 4HZ6A 1XSJA 1V6XA 2VO5A 1JZ8A 1R47A 2O9RA 2WHKA 1E0XA 5IXEA 2ZXDA 2DPEA 2ZX6A 3GBEA 1B3ZA 1B1YA 1QHZA 1E73M 1KWKA 3OZOA 3WF3A 3I3DA 3WELA 1ZBVA 2X09A 1LLOA 2D3LA 1B90A 3NCOA 1BGGA 4TOQA 3W37A 5JIWA 3SCWA 4MADA 5LYRA 3MMUA 1FH7A 1C7TA 4U2YA 1A3HA 1PAMA 3RMEA 1HIZA 5A6SA 2XVNA 3MMDA 3LXBA 5BROA 4V28A 4PCTA 1OBAA 1B9ZA 3FW6A 5D8ZA 5TD4A 1HVXA 3RJXA 1CPUA 1UD3A 1EHAA 3AYRA 1VIWA 4OUEA 5E09A 4LYRA 4GINA 2YL9A 1CDGA 3LPGA 3J7HA 3AMDA 2VNCA 2W61A 3IGUA 2ZUVA 4DWSD 3UEQA 1B3WA 1MQRA 4Z2GA 4KWUA 4TVUA 3MI6A 1C3FA 1ZJBA 1SFSA 4EAMA 4HOWA 2GK1B 3D52A 1DP0A 5FL0A 3HG2A 3BVVA 2W66A 3L4WA 1W32A 2BHZA 1V6UA 1UG6A 5IHRA 4WSKA 4M24A 5DMYA 5M3WA 2W92A 1C91A 1RP8A 1T0OA 3ARXA 1W3LA 3BAYA 2WC4A 2XGBA 3EMZA 1OD0A 1X6LA 2W62A 2RGLA 2BFGA 4QCEA 1PX3A 3RO8A 3WD3A 1E6NA 3OLGA 3L4YA 4M1RA 4W5UA 3PZTA 5E0CA 1ISYA 1UH3A 2WLZA 1E3ZA 1HJVA 3BCDA 2VZSA 1E71M 5BRQA 4UCFA 1BPLB 5JUVA 2UY2A 1B2YA 3WH9A 4PMYA 1CXHA 2BY2A 1KBKA 3ARPA 2VCBA 4IUGA 3PZNA 3IANA 4CCDA 1VF8A 3SCUA 1G01A 3BAIA 1TVNA 2OW7A 5GNYA 4J3SA 4AMXA 3W29A 4JFSA 3WBAA 3VMNA 2EAEA 5CLWA 2FDMA 2PB1A 2Y5EA 3VTRA 3AZTA 1HT6A 4IPLA 3IJ7A 3CZGA 3VD9A 4PMOA 3L2LA 1XCWA 3MS8A 1EHNA 4W7UA 1X6NA 2WB5A 4B3LA 1OSEA 3VD7A 3AS2A 4HMDA 2CBJA 4AZGA 1ZBWA 3SCVA 4AYSA 3WF0A 2UY3A 3EJPA 5FKYA 1XD0A 5A6KA 1V0KA 1ZB5A 5I24A 2CBVA 4KGJA 3VGBA 3SCTA 4D6IA 1UR1A 2VR4A 1UKPA 4NSBA 3CZEA 2XIBA 1GOMA 5D9NA 2EADA 3GYCA 1JZ5A 2WW5A 1QI2A 1EDTA 3EDFA 3K8KA 3HMCA 1FHLA 4OJYA 3AOFA 1BVZA 2PWEA 5A2BA 4P7LA 1GONA 2CESA 1E55A 3L4TA 1SMAA 2V3FA 1OINA 4D6HA 1GHSA 1CXFA 1JNDA 2QF8A 1UQYA 3PZOA 3VOCA 3GNPA 3UG4A 1R46A 1ZU8A 5A1AA 2AOSA 1KWGA 4QLKA 4HA3A 2EPLX 2VCCA 2D22A 4ATWA 1XRVA 1W9DM 4P8UA 2ZX8A 2DGAA 4RL3A 4CUCA 2VI0A 2YJQA 1WPCA 3BMWA 3E1F1 3QHNA 1J0YA 4WLCA 4ATDA 3CZ8A 5D9MA 3T0BA 3A3HA 5GPRA 1UUQA 1H1NA 4OIFA 5E9AA 4U31A 1Q6EA 1IV8A 3W26A 5JBDA 3LRKA 1W1PA 5HBFA 4XUYA 1FFQA 4FNTA 3F4VA 1CNVA 4P7OA 3K8MA 4UFMA 3K8LA 3HZ3A 3PHAA 4W89A 3BGAA 1V02E 1EDGA 3AIUA 2X2IA 1QHOA 2CERA 1HJXA 1BG4A 4MB3A 2ZIDA 4Z2LA 5BCAA 1J0KA 3AMKA 1JZ7A 3W24A 4D71A 1WAWA 2VR5A 3AIBA 5KEZA 2WMGA 1V3LA 5E70A 5A94A 2OYLA 5A2AA 1NOFA 1C7SA 1QHPA 5A2CA 2FGLA 5HNNA 8A3HA 1GJUA 1MQPA 4FLQA 2GJXA 3LMYA 1E6QM 2J8GA 3MV11 3TP4A 1E6ZA 1H41A 3IAPA 1W1VA 3EBVA 1E43A 2VCAA 3WH6A 7TAAA 1C92A 3GM8A 3TV8A 4H8UA 3UR7A 1NOWA 1MWOA 1XC6A 1UKQA 1OGBA 1BAGA 3VD4A 4B9YA 2WSKA 4UOQA 4LQ1A 3T2QA 4JFUA 3ARZA 2C8NA 3BAJA 3WY3A 2WCGA 1UH4A 2VRJA 4JFTA 1HJSA 4JKKA 1ODUA 2WVVB 3WQ6A 1K6AA 4KMQA 1EOMA 3PZUA 3N04A 1M53A 4NXSA 3WMSA 1E1EA 2J7GA 1B3YA 2D0FA 1ISZA 3DX0A 3AXXA 3O2LA 3WDRA 5C70A 2EPOA 4W8BA 3HG5A 2DT3A 3VDAA 1JAKA 4TXEA 3CV5A 7A3HA 1ISVA 3CBWA 1UD2A 3AROA 3CIVA 1JD9A 3ZJKA 4PMXA 1J12A 4FNQA 1J11A 5BXRA 1JYNA 3AS1A 3U57A 4WIWA 2F2HA 3AQUA 3GNRA 2F18A 1ECEA 3UCQA 4H04A 3CPUA 3POCA 1UR8A 3CZSA 3N9KA 2VJXA 5CGMA 1HKIA 1QNSA 1V08A 3TTSA 5I2UA 4W84A 4FF5A 1J0JA 5D8WA 3NYDA 2FGZA 3ALFA 2YL5A 3VMPA 4F9DA 1HN1A 1B3VA 1AQMA 3D4YA 2GSJA 2BY1A 3BUBA 4PCSA 4C7FA 3EJQA 2Q8XA 1DHKA 2ZXBA 3SCQA 2CXGA 3POHA 2YDQA 4P8VA 3W4RA 4ACZB 4B9ZA 3A5VA 3VPLA 1XSIA 3ZSSA 1TZ7A 4MNJA 4HU8A 4M8UA 3WBEA 4UQ9A 2EPMX 3UETA 2WHJA 1AVAA 1OIFA 3EJUA 2W91A 4MJ2A 1QBBA 1J9YA 3W27A 1Q6DA 1R87A 2CNCA 5BXTA 4MB1A 4NI3A 1UHVA 3TTQA 2ZX5A 1S46A 2YFOA 3ARQA 3L2MA 4URIA 5CZKA 2DH2A 4UFKA 2VMFA 3WQVA 2XFFA 2PWHA 3VIGA 1KGUA 2D23A 3EDJA 3AIVA 5ABFB 2YIHA 1V3HA 4U5KA 4H8HA 3KZSA 4QAWA 1SR0A 4A4AA 1VEOA 1ZS2A 3AHXA 2J78A 3PZIA 3WD1A 1EQPA 3W28A 4CD8A 3BUIA 4W8LA 3RPMA 4UNIA 4HA1A 2FH8A 4WF7A 2J7DA 4J3TA 3VIOA 1E70M 1CXLA 3GBDA 1W2PA 2F1BA 4E8CA 3UR8A 4FLRA 4AD4A 3AZRA 1EA9C 1UWQA 4HPGA
chains in the Genus database with same CATH superfamily
1BGXL 3PTKA 4UQIM 5B8CA 3R25A 4FSAA 3GI9L 3FCTA 5IEHA 3QQ3B 5JHMA 2PETA 1W8SA 3CFJB 4GCAA 4TMPA 3FSAA 1K03A 3GC5A 4AF0B 1Z9PA 1PCWA 1K4CA 3H9SD 1AG6A 1NC2D 2VZUA 2CLZB 4F2MB 4JFPA 4JRXD 4YEEA 3KOZA 4KCTA 3WD5H 2HT2C 3OV6A 1FY6A 2R0ZH 3VNMA 4R90H 1PKOA 2AXGA 1BXAA 2G41A 1HHJB 4GNKB 4PSRA 4C83A 4KROB 3UWWA 4JM2A 3M45A 2BMKB 4JL1A 2I69A 3T09A 3IDGB 4TXVB 2VUNA 1KBVA 3P77B 4MIMA 4ZOBA 5I79A 3STEA 2CRIA 1OWWA 1EV2E 3A6CL 5EBGA 4AI7A 1M01A 3V9FA 3PJLA 1AJZA 3E2RA 4NWUL 3MCKA 2JJVA 3UCCA 3PWLA 1C1EH 5G2HA 3C0JA 3GJFH 3AHVA 3UZVA 2DF3A 4AAJA 1Y1UA 3BPNB 4G42B 4YZWA 3R5EA 3I84A 2YUWA 3ATAA 1FJ1A 4CJ1A 5SX4H 1EIXA 1NF0A 1NM9A 2Q02A 2V8ZA 1GOWA 3WG7B 2KPWA 4R7DA 2DYPB 3VGDA 3EWYA 3OP2A 2B5IC 1PY0A 1KFBA 4M19A 1MNSA 2K9FB 4NYYA 2BP1A 4OFIA 2ISWA 2GT9A 5DLML 4RE2A 5I0VA 2BBFA 3T3PE 1H15B 3MBEC 4EI6A 3VW3L 3LQLA 3RIFK 1KR1A 3ULUL 4PWGA 5CWSB 4CSZA 1XRFA 3LCWA 3T9PA 2XPGA 3O0FA 4ZFGH 4N0CD 1NM4A 5CLZA 2V9TA 4ZMXA 4JTEA 1NFKA 4WDWA 1IBZA 4OCMC 2OX4A 4Q2ZA 4YE4H 3CVBA 1H5BB 5E9DE 2DU2A 2BVQB 1HWGB 1TQVA 1NGWB 2WLMA 3AIWA 4IOFD 1A22B 1WGVA 1K8IA 2GVYA 1THAA 3TFBA 1HKLL 1NICA 5FM5M 4PRTA 1BW8A 3T1FB 4Z7OE 2X4SA 4DVBA 3AU0A 1F6YA 2VGBA 3EKGA 4FJYA 1J0ZA 2R56L 1M7JA 2DQEH 1OO2A 4Y5VA 1UM4H 1YSOA 3RWJB 2XRAH 3KHQA 4Q22A 1NIDA 1ALDA 1FE8L 4XZUB 1XGYH 3CLEH 2VDHA 3HFTA 4QROA 3A4EA 2XTJC 1QLRB 3OWRA 4U6XA 3V0FA 4AVJA 1E4HA 4DZHA 3OZ9H 4JO2H 5B3JF 3D69B 4MJID 1TJ2A 1IAIM 2AK4E 1FTXA 3NO5A 1P9MC 2WWMD 1JJUA 4KKBD 2OMVB 3L48A 4HXAL 5EZLB 1DWJM 1A7QL 4UNLA 4J3OH 3AG1B 2R83A 4PJ7A 2IBZY 1EHXA 4YL9A 2VDML 2J8TA 4GQPH 3HPJB 1GVFA 3W2NA 2X9ZA 2WZIA 1JK8B 1NPNA 1QMUA 3O3UN 4MJ5A 1HJCA 5FEWA 5DMKB 2AEPH 1TR7A 1X5JA 3BN9C 2YN5A 3BD4A 4Z7QF 5FKAA 4FYQA 4I0PC 4FDWA 3VSVA 2JKEA 3MV8E 3LKNB 3P3UA 4MA1C 1A5FL 3QEUB 5AAWC 4MQ7A 3N9GH 2HMID 3W9EA 4YLWA 3PNRB 5KVFE 3VXNB 2ZJSH 1OW0C 3LJ3A 3B8VA 4NEHB 3B7RL 3N1QC 1DLFL 4CKQA 3ARDC 3RVWD 1OARL 1NCCH 4U6YA 1QPPA 1TQXA 4FFYL 1E5UI 4MAYC 4M56A 2NXHA 1CWVA 1AXTL 2ITCB 4FQJH 4QRRB 1OF6A 2OJ1A 2AL1A 3CUJA 3KCJA 4PL2A 1W0WB 3F8UB 1S5WA 3AY2A 3IDXH 1KJVB 3QSKB 3VDCA 2NY4D 4O28A 1FE8H 4AVNA 2VOTA 4GLRI 3SPCA 3ISRA 2Q3XA 3ARBD 4NNYA 2Q8AL 4WI7A 2WVSA 3WD4A 5MF5A 3QJTB 5CP7B 4NZUL 5C07B 5SX5H 3EJZD 1EJVC 5E24E 2K0RA 3SDCA 2EC8A 4OZFB 3KS6A 5D96C 4QRRE 5L6YL 4HWEH 5FAJA 5K39A 4ODSL 2JB6B 1S5TA 2WJZA 1T0NA 4CEXC 1YN6B 3GMPA 3N42B 2V2CA 1TJXA 4ODHL 4S1DD 3GNNA 3TYFB 1WLHA 4DTGH 2R94A 3QNZB 3T9WA 3NQIA 4OD2B 2BC4A 4AHPA 4RX0A 2EJ1A 1R17A 2XA8H 1OGAA 5D9SA 3X1EA 4CNSA 3GU1A 1W72L 4DJDC 1JVKA 3NIDE 1WITA 2M83A 2CHWA 2IOMA 3HHSA 2VGIA 4YS1A 1LTDA 4TUOA 3FB8B 4JN2A 3W2UA 1W9XA 4Y2OB 4JTQA 1XR8A 3TFXA 3ZWTA 2XV2A 4HV8B 1MCJA 5GIRB 2BS8A 2KYIA 4WI2A 1HKJA 1J93A 2I60H 2PCXA 2ZUXA 4AEFA 4XE0A 4GAGL 3MANA 1R24B 1WHOA 1VZIA 4NPYA 3SKJL 3ZE2F 4K8GA 1MW3A 1G7LB 5I78A 1UEYA 3D0VA 3E9UA 3OKMA 4UB0H 4ABWA 1EB3A 1LEGA 3AT0A 3IV8A 1MCOL 1AS7A 3Q8BA 1NEZB 5ABDE 4WFFE 4KZEL 1IM3B 4NHCH 2EIEA 4FQLH 1HILB 4DO6A 2CC0A 2P7TA 1QNZH 4IGBC 2VN5A 4CNOA 3CAWA 5GNZA 3LHWA 3KD4A 4FNSA 5D7IB 3IVKA 1FVCB 4PJ8B 3I6RA 2VDLH 2MCG1 2WVUA 2OMTA 1XIWC 2QCMA 3II1A 3MLRH 1A7RL 3RNQA 1ZGDA 3MJYA 3PZVA 4CBZA 1DSWA 4X2RA 3GMOA 4L4VE 5I15L 4WGXA 5C0CB 1XR8B 3P2DA 3KS0J 4U0RB 5MEQA 1J8SA 1JQXA 1OX4B 4R5TA 1V0MA 3QUHA 5CINL 5KJ7E 1K8XA 3K2UH 1CF1A 1HXMA 3KPMA 5IDIA 1H6FA 5SX5K 1V93A 3W1XA 1TMQA 3S1WA 2UYLB 2FWLB 3FNDA 5I71B 4D6GA 2WBJC 4I4WB 2VLJE 4LFYA 1NMAH 4JZ5A 5AOKA 1NOUA 3C60D 4GO9A 5F1UA 2BXVA 4LUSB 4RETB 5E1AB 3B9DA 4HK6A 1TTCA 4HKBB 3UQNA 5EUOF 5AC5A 2W88A 4OFVA 2HJFA 3EYFB 4FEZA 1FBIL 1KTDA 3VXTA 2EG7A 4RXGA 1EYWA 2H6PB 2QDDA 2PFHA 1FNFA 5I6MA 2JQZA 1ZFJA 1CYXA 2A38A 4HFUH 4WI5A 3GMLA 1IGYB 1J4EA 1YA5A 2ROYA 5I3GA 5GRWA 8XIAA 2ZKYA 1D6VH 1XH0A 1JHTB 1TPUA 4XZ4A 1VP5A 3TE9A 3H26A 3HNSH 1IM9D 5INCA 4WGWB 5KSBF 2CLHA 3E6HA 4G11A 2ITCA 2VN3A 4WWNA 3STLA 4QRRA 3DFSA 2EABA 3KM8A 2ZOWA 2FB2A 2GGIA 3DI3B 4R90L 1O7SA 1PLCA 1RR2A 4XAKD 5EFFA 4PRHD 1GGCH 5F7DB 3QV7A 1ODAA 3B6SB 4ABQA 1BQCA 1G1CA 1T99A 3V6OE 2A6IA 4XN4A 3LRSA 3IK2A 2VMCA 4LASH 1JV2B 3G6JE 4HMEA 1EWHA 3VFSA 3N25A 3T8MA 4YWSA 1TPXC 4N22A 3PTDA 4O13A 5J5RA 2NY4B 2XQ0A 2WCPA 3UZEC 2BVDA 4Q7BA 3VSQA 3CL8A 4WJEA 1U5VA 2W27A 2EDEA 3U4BH 1NWRA 2D31A 4HUMB 3BQVA 3H8NA 4Y5YC 4A6YB 2XJ7A 4B3KA 4N9CA 5LA1A 1MFDL 2R4SL 5EC1A 3SB3A 2IKJA 3AXKA 3ELFA 1U8PA 3P9WB 5CEZL 3BRDA 3DGBA 3EX4A 3MSDA 4X4XB 1NMBH 3H42L 4U4IA 2BHUA 1TR1A 1FBIH 4U6VL 2EGZA 4Y9CA 1E51A 2G3JA 3HJZA 4J35A 4AEOA 5JLZA 4PVMA 4LLMA 1MCEA 3OKEB 5I8KL 2Z1BA 3C8NA 2HKFH 1FGVH 2CKBL 1F4XH 2A9CA 2Z4GA 4V2XA 3GHEH 5I3IA 3LRLA 3NPZB 2P5ED 4HDIB 1F45A 3EX2A 3EJYD 4CLMA 1XR2A 1DE5A 1DV7A 3QEQD 2O4EA 2LAGB 3M0IA 3MR9B 4OF6A 5CJOL 1K1DA 3SQSA 5IFTA 1LEKB 2DJ4A 4X7TA 3VWJD 3HG1B 4UWMA 1JZIA 2NNCA 2VCOA 4DN3L 3CZJA 3OR7B 3L3OB 1A3LH 4HIEA 1QNQA 4HPOL 2NUTB 3WD5L 3GUWA 5SWUA 1V0LA 4TNFA 4N8VB 3WIHH 1H4PA 2ZXWB 3D0AA 2O55A 2YD4A 2A1YA 3MUUA 5BXPA 3IIZA 2APVA 2XXMB 5D1QE 5JHDD 1U8PB 1FWCC 3QC3A 3MJMA 4RZBA 5D9PA 5EU5B 2QGYA 1A4JB 2FYVA 1B2WH 1F74A 3SSGA 3FA5A 2ZSWA 4LNYA 3VRIB 4XO5A 1LLZA 4KKCC 3BESR 4YNYB 1XSOA 1ZP4A 2DSWA 2KS0A 4FLOA 1TF4A 5L9DL 1DQMH 2VLJB 3UTSD 4V15A 3A24A 4BM7A 1V3MA 3MVSA 1X5GA 2ZUWA 3S3JA 1Z7JA 3AXHA 1WBJA 3ZVHB 3WLNA 1SW7A 2FPYA 3GRIA 3PHSA 4UB0L 1KN4H 2Y5QA 2P1FA 4LAZA 4DXKA 4C4KO 3VU2A 5FL1A 3DFYA 3F7LA 2QCEA 5F2IA 3U7BA 4X8CA 3BI9X 4U1SA 1S9YA 4PJHF 1IEAA 5I9QB 3UDWC 5A3IC 1LWHA 1S7WB 3KGSA 1ZJHA 3ARBC 1Y07A 3NZSA 2RHGA 3QV8A 4YE0A 3UNTA 4P2YA 5EOCJ 3PP7A 5D09A 1R3HB 1V7MH 4HS6A 5DRNB 3NDZA 2NY5H 3DSFL 5D7IA 1PS3A 2HRHA 3IVKB 2XN1A 3LZQA 1QNPA 4XP5L 5DJCA 3AWOA 3PNUA 1MIML 3QG6A 1YEFH 5D30A 3BO8A 1BM7A 1MCPL 2DQHH 2QV4A 2UZYA 4WEUD 4KKAD 3IS4A 5C55A 2H6PA 2Z1XA 3N40F 4E8DA 3ZIZA 4WV1B 3HGOA 1A2YB 5HYQB 2ISSA 3RM9A 3S37H 1ONRA 5D2NA 1VLWA 1O94A 1Q7MA 2VL5A 2GOUA 1EUAA 2OWCA 4WU7A 1XEUA 3ABSA 4YHZL 3C2OA 2EYTA 3B2XA 4PRDB 4HEPG 2WCSA 3QEGL 4I48B 1XIHA 3SGJA 4PMEA 4XD6A 3TTYA 2VC2L 3PAVA 2ZCZA 3W7EA 4IIHA 2UYLA 3FCUB 2XZCL 1TTPA 4ZB0A 5BXSA 1AS8A 1LORA 4XMLL 3AAZA 4XRCA 2EVIA 2DICA 1G4TA 1K4HA 4XZLX 3P4LA 2DKUA 1QOXA 4PZVA 4S3FA 1N64L 1TKWB 2BOBA 3FHAA 3KLKA 1RLDA 3HMJG 3VGAB 4IRJB 3T0EB 2DIJA 2P80D 5C0BA 3ZR5A 4OZFG 4BZ1L 4MKTA 4L0YA 3UCRA 5LDUA 4UR7A 4OSUL 3P0VL 2XVGA 4IP5A 1HINH 4UXDA 2R9RA 2Z35A 3V6ZA 1DQML 4K3EH 3L12A 4GIYA 3ARWA 3SCPA 4Y4HC 4EZKA 4MUPA 1ZK5A 2UZPA 2ISDA 4XZ9A 2GHWB 4OUUB 4UMCA 5CJMA 4I8DA 2Z9TA 4U6VH 4N85A 2BIIA 4KDTC 4KH9A 2J1XA 5FOBA 2OLDA 4UFLA 5HMDA 2AEQL 2FX9L 2E6QA 3GXNA 4U0RC 5FWQA 4AFYA 4MZRA 2W0PA 3WDHA 2JKIS 2NT1A 3INOA 4IGSA 5REQB 3TR2A 2OELA 4G6JL 4FXGA 4Q8UA 3BJLA 3NSYA 1GH7A 3MGTA 4FQIH 2OKOA 2XZ7A 3GDTA 5DFAA 3WUWG 4N2IA 1LE9A 3C2AL 3HV8A 5I76A 1C9DA 4PMZA 4HHMA 4DJEA 2ZWZA 5C0NC 1DTNA 3HAEA 3WQCA 5DVKA 3QPXL 3B0YA 3IIXA 1F2QA 3ENEA 4JW3A 5D5ME 2A9AA 1CGYA 1OD8A 5IB1B 1P1XA 1RH9A 4OW6A 4L56A 3E38A 1NJ9A 2DSKA 5I1JH 1QDSA 3NQGA 3SE9L 3GH5A 4UMGA 1PU0A 1QWNA 5GRVK 4TQ8A 1Q63A 1UBSA 4TUOB 1WDAA 2FVKA 1JPEA 4XAFA 3P54A 4YDNA 2W3ZA 32C2B 2DJXA 1XF2A 2ASHA 2WBJD 3OGSA 4UIMA 2G0LA 3UWZA 5C8JA 3ZXAC 1JTOA 1NMBL 4YHYC 4GY4A 3BO9A 4A8NA 3MLWL 1MRFH 4F9LA 4F79A 2H5UA 4P4RB 4NUJB 4IBZA 3PABB 3C6CA 4EI5A 3GG7A 2C1HA 1M2VA 1VACA 2B4CC 5D7HA 5BS0B 1CLVA 2VXSL 3KLHC 3QHZH 1TXKA 2Z7YA 2Z91B 2CDEB 4PJGE 2UBPC 4JRXA 4ZMOA 5FO8B 4AY1A 2E9GA 4WUKH 2WXDM 4NVTA 2IXQB 1QTPA 4DRSA 4EMZA 4JQXC 3N42F 2AI0H 3BEWB 5H4ZA 2QS8A 1LJYA 2X6MA 2ZCKH 3RPIA 2ENQA 2F6KA 2VFGA 4N24A 4N8CH 1O5PA 1IGCH 1KIPA 1C12B 2NW2B 2E7DA 3GMOB 3BKYH 5DQ9A 3SDDD 5IREA 3KR3H 3WFEL 1NKRA 2XIIA 3LI0A 4AVFA 3VWJA 3BP7B 4B9GA 2I56A 4W4QA 5EZJA 4QO1B 1FWBC 4Q7NA 4HJEA 4KK6C 4Y9AA 4NENB 4J6IA 3AB0B 3SBQA 2Y5TA 3VXUD 4Y9MA 3A6OA 3MLYL 2D73A 1KTBA 3NL3A 4HOXA 4LUTB 3HE7C 4OCWL 2HA1A 3GJEB 3GS4A 1JV5A 1G1KA 1V3KA 2V17L 2Z64C 3SKNA 4FOMA 4FADA 3BRFA 1RAKA 1EDQA 1QFHA 2CHNA 1UC6A 3MXVH 4W9ZA 4AM0Q 1GOOA 1GZJA 1GA2A 1U4EA 2WBKA 4ANKA 1KEGL 1MZRA 1KQYA 3MXWH 2FX7H 3FT3B 5FKAB 2I57A 4XVTL 1A6AB 3ZO0A 1K9TA 2OOGA 3QYSA 4Y9PA 3SQMA 3LZRA 4QTGA 5HYSA 1UJQA 5HHPB 4H9UA 4QDMA 1MI3A 3TJEL 2EH7H 2J8UF 4XWOD 5GGVL 1NWTA 3TSDA 1RZ8A 2R69H 4C6DA 5IZ7A 4DELA 1MUCA 4TSAH 1MFBH 2ZRXA 3GJFB 1QI5A 3L5IA 4DEUA 3F85A 1Z3NA 3TNMB 4TIMA 1QLFA 1UZ6E 4M7TA 3P30L 3HQPA 3GI9H 4Z7VE 2KZBA 5JZ7D 5IHUL 3MCKB 3APGA 3G6LA 3M7FB 3IJLA 3N11A 2ICEB 4KRLB 1IU1A 1CDYA 3HS8A 3C2VA 4WVXA 4U0QB 4UM8A 4XZMX 4BFJA 1XGTA 4HHAA 3KUMA 4AV5A 1B0GA 1UENA 2DH3A 2OMNA 3FY1A 4RLIA 3IN0A 1LL4A 5TQLA 1PD6A 4TMBA 5HQLA 4PR5A 3S46A 1AD0B 4K4KA 2A2QT 4HYTB 3U0TB 2Y7EA 3QQDA 1V3JA 3QFEA 4IRZA 1A7OH 2IDQA 1NGPL 1MCBA 2E56A 3LCLA 3HPLA 5DEFA 3GSUB 4G7VL 4ATTA 3CMFA 4MY8A 1PZDA 1ZHNB 2XQYA 4KO6A 2P8LA 3CYJA 1DXFA 3U7YL 2DY2A 4G9FB 2ALRA 2XPGB 3BDYH 1QPKA 4LCCB 4GI6A 4RFOL 2FLBT 1H7RA 3IMSA 3CHRA 4WTZA 4G8GE 4PBXA 4FG4A 4P46C 1QHQA 4V2BA 2A9NL 2BIHA 3RX7A 5H37A 5FESA 4OLYH 1BLNB 1RK0A 5ICZB 1JCKA 3MACL 2HUHA 3BSZH 1MAKA 2VMJA 4AUUA 3D51A 1OFQA 4PEEA 1XFBA 3HZVA 4Q7DA 4AZHA 4V1DD 1LO2L 5FCZA 3UBXG 3RWGB 3SZKC 1AQFA 4J5NA 2WTRA 3AAMA 5CSSA 4HSCX 3NG5A 3VX0A 3H24A 3ZRCC 3OB8A 5U4NA 3BKJH 3RX3A 1RSYA 4FFYH 5CPQA 1ND0B 2ARJA 3MBED 3TW6A 2D7TH 4MYPA 4OU3A 1MMFA 2TYSA 4Q52A 3QDMB 4Y1AA 3W7CA 5JW5B 1GORA 3WG6A 2NT0A 1E8WA 3KPLB 4HCFA 4XAWL 5LIYX 4G9FA 1PLGH 5EZPA 1AHWC 4CSTA 2CZDA 5ANME 1SDYA 3UJIL 1ISWA 1R2TA 3GSRB 3HPJA 1OF2B 2WGNB 4QEHA 2ADJA 5F9OL 2F8XC 3TPUB 1NCIA 3QE5A 3B7UX 1JNLL 4LL9A 1F3DJ 1TJGH 3DECA 5DT1H 3ULUC 5PTDA 4JDEA 4B5VA 5EEUA 1YEGL 1UUNA 3ARYA 1N3NA 1NDZA 4YC2B 2NY0C 4G9FD 5F8QC 3VAEA 5FYJL 4MJ4A 3O15A 2XN0A 1KXHA 3TW9A 2XTJD 4BFKA 3B0VC 2A74B 1HYSD 4OIIL 2CW6A 1DQQA 5HP5A 5LXGH 1VENA 4F7MB 2WJFA 1WZLA 2J72A 4C65A 2R91A 5IEKA 4O58H 2IPKB 4LC6A 2VR8A 3ULVH 1JHTA 2CUHA 3FTUA 2FHFA 2EKGA 3CFDB 4GT7A 4WFED 2A3CA 4OUIA 1WX0A 3WGVB 1SMDA 3ZSTA 2J77A 3L8QA 5AW5B 1VYSX 1QK0A 1ZT4B 4FP8L 1DOSA 2C71A 5A6JA 5I6PA 1XGUA 1I9CB 1VCAA 2FBJL 2XN2A 3BN3B 1A5FH 4JGNA 4FQQB 4UDUA 4ECLA 2OXHB 5J6SA 1H7NA 5E8DL 4YHKL 4CU8A 5FA3B 1G9HA 3CJPA 1AO7E 1DVFB 4NQDB 1TJGL 4E0CA 3F4WA 1CLXA 4K7PX 3FFOA 2HMIC 3T6WA 2O9PA 4JM2C 1D2KA 3HUJF 5T1KA 3IIVA 3MSPA 4WDUA 1UKTA 3O6FC 1YMME 5DYFA 3T2NL 4NI8A 4J27A 4P2QD 3AU1B 4ESKA 1L7IH 4AVOA 3DVFA 1DJSA 5BU9A 2VL5B 4LSBA 2QGBA 1OT1A 3VA2C 4U1MA 2YCJA 1ICSA 3KCOA 4DBDA 4XAKE 5LBSH 1E4XL 2HLFD 4BDVA 2PCFB 3NEVA 7REQB 4F2BA 3T2PA 1QBLH 1I1AD 1KBGL 1CFBA 1WAPA 2Z0BA 4PTNA 4D9PA 1PSKH 4W68A 3HE6A 4CRPA 1VR6A 1TVHB 4LPUA 5A6AA 4EF3A 4WKZA 4US5A 1N64H 2N0MA 2O5XH 4ODXA 4XNZC 1Q9KB 3QUYB 5LNEA 1LO4H 2FDSA 3PZQA 1M04A 3ROOA 4RGNC 4AQOA 3A4WA 4NAEA 5HMFA 2YO3A 1I1XA 4OKVB 3W7IA 5E5MB 1D3GA 1T96A 4JRWA 1TETH 5TF1H 1VYPX 2D7OA 4JVUA 1GTEA 2F68X 5DCCA 4YN3A 1RJLA 5GRUH 5HYJA 2A6KA 4FG6C 1AHKA 2WD0A 1IT0A 5D1XE 2I9UA 1UWEL 4MFEA 1JRCA 4JM2F 4FQ2H 1TPH1 2YLHA 1TREA 1K5NA 3P73B 4NCDA 1O12A 3ESUF 1YRKA 1AQDA 3U36B 5I3FA 3QJOA 5H94B 5TJWK 1T20A 4IU2A 2PDJA 5AOLA 2XG9A 4DO7A 1GW0A 1AGBA 1PYWA 4G8GD 2FTPA 4C91A 3GNOA 4H01A 3SPJA 1UP0A 4H8VA 2WYZA 3SDDC 3B8UA 3KAOA 4PTTB 4AWJC 1S2VA 1OE2A 1T1YB 3ORWA 4CGTA 4HSOA 4KWSA 2YWYA 2CBPA 4KK6D 5FEXA 3ROLB 3EJJX 3HUJA 4M3KB 3GB6A 4WWID 1KCRL 2K4WA 2V8LA 2XX0A 2HJKB 3SDDA 1REQB 4ODTL 2RUSA 3QO0A 4KJPD 3SKOB 2R1PA 2BP8A 1R3LB 1XGQA 3UTTA 3SDAA 5IJBC 2J8UE 1GXEA 1MEWA 2A3HA 3IGXA 3CCHB 1GGBH 2AJ3A 1YDOA 3N13A 2NR6C 4GVIA 3MA9L 4IGBD 1RKRA 1RZKL 4XZNX 5FJTA 2BVOA 2FJFB 1HIML 4RX4A 4FLSA 2Q1EA 4TQTA 3TC7A 3NP4A 3WS6A 3MCOA 3L9EA 3OLIA 4JZJA 4LL1A 2GB2A 4LVEA 3IJYA 4YHPB 3PABA 1YEEL 5KINA 4PJEE 4ERSL 3HB3C 5ITBH 1F6LL 2INEA 2KAUC 2WOYA 5AKTA 2G3XA 5JH2A 1FL3A 5J0BA 3EA1A 3DYPA 1ZP3A 7TIMA 1W3TA 2D03L 5D1XB 4O0KA 3TQKA 1P7QD 1HXKA 2JKAA 4HU0A 3MRCA 4HPOH 3WIIH 5I1LB 1OAQH 5L4MA 4HLZG 1DN0B 1WB0A 3KH4A 2OX1A 4C6OA 2I16A 4HQQL 3QDMA 4Y1AB 5DUPL 2B08A 2QSCH 3MREA 4YDKH 5JZ7C 3KPRE 3ULUF 3BOXA 4LARL 4GG6E 1VBUA 4UBPC 3AXIA 1S3KL 3KYAA 3T0XA 4AX3A 2NY7L 2RFXA 4HIPA 3SO5A 1NDWA 4UR8A 1ORSA 5CSYA 3SCOA 1YNTB 2BIQA 1I1FB 3GXMA 4Z3FA 4IMDA 4C1NA 2W9EL 1WWBX 2XACC 1QTSA 3MV7A 1IC4L 2FB4L 3WXWL 3LB0A 4O10A 3UJFA 4M80A 4UIKH 3ZE0E 3BP5A 1JNEA 2IDFA 3GUTA 2Q10A 4YIWA 5G2IA 1QI0A 9CGTA 1XKJA 1BQHB 4WO4A 2IH3B 2W81C 1MYRA 1ONEA 3HURA 2OJEA 2XWJA 2Z0IA 1UTDA 3A13A 3QMSA 4BFEA 1MHPL 2BS71 2R2EA 3V10A 5B4MC 2QUVA 3OOQA 3C9NB 4YS4A 1QQDB 2P5NA 3U79A 1CBVH 1JR1A 2AL2B 4FZIA 3TSBA 1EMTL 2YXMA 3CVHA 4OUUA 2X2UA 4ZUSB 3CQJA 5FO7B 2WSYA 3ZM8A 2Z1KA 1YC8A 1E7VA 3GSQB 5CSRA 2YKLH 3L5AA 4JKPH 5E6ZA 2B7OA 1FCCA 4YYFA 3HG3A 2WN3A 4QOKB 4DPQA 2HZGA 1S3RA 1MLBA 1HS6A 1TSRA 3NDZE 2VP8A 4P5MB 5ESVA 1AFSA 3IGSA 1JMZA 2CE6A 1AR1D 4Z7UA 5AHIA 1BM3L 4Z7IA 3UABA 1WKDA 4MCZA 1JCJA 1PE1A 3FTGB 3BLLA 2CCVA 3CPGA 1YNLH 1AD0A 1TJMA 2FIKB 3C0QA 3FQWA 3RTLA 1OZQA 2IH8A 1F3JA 2E1DA 3CUFA 5EIIA 4O2EB 3GHUA 5EY5A 1KM2A 3HC0B 1BMWA 4GE8A 3W2LA 3BVNA 4LVOB 3RO6A 1AXSB 2O6CA 3BVDB 4H4NA 6FABL 1LG1A 2W79A 3NCXA 1UQSB 4M9PA 1AGDB 2NLJB 5ISZE 2VN6A 4AB4A 4OQTL 5LGKA 1ZALA 1BV8A 1IF2A 2X1IA 4H0IA 4ASTA 2HLAB 4QOKA 4Z7QE 1XUZA 4XN7A 4L4JA 4JN8A 1NCJA 3VXTB 2C4FT 1H62A 3H53A 4MNQD 3JWNE 4GBXA 5GQBA 3LNPA 3UA3A 1ZEAL 3A0OA 3P9MB 1IC1A 4PGBA 3AUWB 3LXCA 4ZQKB 3VVVA 4BHUI 5T3XE 1L5GB 1GUVA 2EBNA 4N4PA 4WDTA 3FU3A 1II4E 1AZ2A 5CAKA 4Z78A 1JNNH 1RIUL 2A3TA 3O45B 4YHOL 4CQCA 3MV9D 1FIGL 1PDZA 2VE6A 2VRQA 2APFA 2BSBA 3FGCA 4TUJB 1E8YA 4HWBL 4DPRA 1KB5H 1KFAH 4HISA 2VW4A 1R0AL 1NL0L 3OKMB 4XBMA 4XMLH 2BTMA 4YBLB 3RRAA 3P2BA 1GSMA 5C9RA 1Q90A 3IDMA 1I75A 1BD0A 2V7NA 4PRBB 2NVDA 4JTDA 1KULA 5I6XB 3L7EA 3JV6B 4Q8MA 4QE5A 3ME3A 1XHGA 5EU6D 2CO2A 3NFSH 3ABZA 1GOQA 1SEBA 3O6FB 2PW1A 1YTKA 4OBTA 3QSTA 2MOVA 3F7PC 4PRPE 5DK0A 3X3GH 2VLKD 1KCKA 1UM6H 1USQA 5F7NC 3RGTA 5BS0D 4WGHA 4LVOC 3OKNA 5HJ3B 1LL6A 3P0GB 2IPTL 1TZ8A 4LP4A 4BBWA 4MS8D 1PY9A 5KYUA 3FQXA 4HMNA 4NAQA 1HVQA 3N17A 3O6FD 1JXKA 1IB5A 1LK2B 5FO8A 4LEFA 1XH1A 1FP8A 4NHCL 1GYWA 1NKGA 3SKMB 4B7LA 1UCWA 1K9FA 4HNUA 4ZB5A 3K6DA 3FRPA 2GJRA 3SO3C 3EKZA 4JY9A 4XP1H 2X1RA 4AEIL 1CW2A 5DWPA 4JIIX 1KBBA 3D0VB 3QR1A 4LCWB 5HDQL 3H2NA 3MX0A 3LCHA 4O18A 3BV7A 4Y6GA 4Z3HA 5IVZB 4N8UA 3VFVB 5JIDA 3VUPA 3QIUB 1JYWA 3PZGA 4E2DA 4A6YL 3S1UA 2DIBA 1ZVSA 1SZGA 1CGUA 4J2PA 1J0IA 3MV9B 4OFKA 1P1ZA 2ZNXA 2FR4B 2DQWA 1F3RB 2HFEA 3GS0A 4LP5A 1GY2A 4I77H 4RAHA 4S2SB 3UJRA 1RJZB 4KKRA 4CCZA 1B9KA 3QZOA 4KDVA 4AY7A 1E4MM 4MNHA 5F3FA 1TTGA 1TZHA 1X1NA 2IGLA 1KR0A 4E6MA 2R29A 1MDTA 1L4IA 2VQUA 1C5CH 2IXVA 1WDWA 3JV4B 9XIMA 5KSUA 4D9QD 1T66D 1ZTXH 3APYA 3MZ2A 3M86A 3T4AA 3IXTA 3PPSA 2E27H 3G5YA 2QJDA 3NIYA 3C08H 4K9JA 4IM4A 1ASOA 3W7DA 1R19A 4MQTB 2QFRA 4OJFL 3ESOA 1WEJL 1A7RH 4XGZB 1WZMA 1CL7L 3TCEA 4B5TA 2HX7A 2QPUA 1SY6A 4GOAA 4MM1A 1RBLA 1AHWA 1RP9A 4AZ8A 4XPBL 4ZAKA 5ES4B 2Q8BL 5IR1A 4YDZA 4MNLA 1X7TA 3BUYA 1Z6KA 5B39G 4AU0A 2Q8AH 4WY0B 4QD2E 3HHMA 4AK1A 2YSSA 1J05B 3QDGB 3FHQA 4KRPB 5C9JB 4F7CA 1Z9NA 4EN3B 1IFHL 5FF6B 2V5BA 3VXOB 1CICD 4I5UA 4KJPC 1CT5A 1FHGA 3DDFA 3KL3A 2OZ3A 2XWXA 1RZPA 5J9PB 3TYZA 1HO4A 3GMLB 4L4VA 3VGFA 2NSOA 4HFWB 3L9YA 1TVBB 4PJ9A 2VEKA 4N6FA 5LNRA 3LPOA 1I3RB 4G6MH 3RR1A 4NZ1A 3S0CA 5CIPB 1KPVA 4QGTA 1LWIA 3SOBH 4OOZA 4AWSA 3T0WA 3TYGH 4IU2B 1ND0A 3EBAA 2QKIC 5HVWA 2X7VA 4JE0A 3BLKA 4AGQA 4MF4A 3C09C 3WD0A 4Q4QA 1YN7B 3NCEB 4M93C 2Y85A 3RWJA 3OEXA 2ED8A 1E9OB 1FFNB 1IGCL 1KOAA 3NDYA 2V82A 3AS0A 4QJ5B 1UB5A 1XIEA 4HKZA 3NVTA 1PEZA 3LEXB 4WV1A 1MEXH 1W2VA 3NXLA 1E0TA 1FN4B 4AJ0A 1QPNA 1TVPA 4AXKA 5I3DA 5DMIH 5E2VH 1RPKA 5C3TA 2UXFA 5EOQL 4LPTA 3G1VA 4Y1TA 2GJPA 1H0GA 4N2OA 2Y89A 4HLJA 2YARA 1BXVA 1GAFH 3B8DA 4NKCA 3KYMA 5BRPA 3CIWA 5I77A 4ZD3H 3VQLA 1LL1A 1S2UA 3NJJA 2PDUA 3DV6A 4YBQD 4S3AA 3GO1H 1MCIA 3PBWA 3O9WA 4PGEB 5F71A 2QIIA 1SOQA 3HVNA 2PDPA 4GY0A 3BUTA 1F58H 3CX5J 4ZGYA 3AHTA 7XIMA 1KENH 1S7RA 3S9IA 2IANB 3AVEA 2RJMA 5PCYA 3CWOX 3BZJA 4OWGA 4K2UH 3WDQA 5IV2B 1Q9WA 4PH8A 2CIIA 4IBYA 4KJQD 2QHRL 3MFFB 3QIBC 5L4JA 1R8LA 1HI6A 5EU7C 5CJXA 2Y9RT 4X5WB 2X6CA 3FPYA 5EULV 2J13A 5I74C 5C3IA 1TE6A 3PDOA 1A25A 5B3SB 3CSYA 5BWFA 2YGOA 3K1DA 4Y1SA 1PKQB 1JPSH 2R15A 3JWNC 3PAOA 3GLDA 3QRGH 3HLAB 1KB9K 4PJHA 4BH8B 1O6IA 1V0NA 1YMMD 4IPIA 3NABH 4FQ1L 3RY6C 1XZWA 3QUXB 4WQ6A 4GXFA 2K4AA 4UINH 1HZYA 3QHOA 4F9JA 3L95B 1A49A 1BBDH 3PHQB 1DQWA 2AK1L 4U1LA 1AGCA 2MQCA 2B16A 4GKLA 4ZS6C 2FZDA 2ICEC 3ESVF 1X9RA 3QZLA 5HHQA 1YYCA 4XP4H 1V79A 3QZ6A 1PKYA 2HVBA 5FOJA 4DUOA 3UJIH 5ABHA 3HE7D 2R2CA 3ATBA 3VFMA 4BFOA 4HNCA 3OPZL 1QR7A 1M2VB 3TO4D 1JZGA 4U49A 2UUDH 1XCTA 3OHXB 1M65A 4AWUA 4M7ZC 3Q06A 3ZHDA 4LLDB 2YUXA 4EKJA 4UTJA 2O1AA 3WF4A 2VQ4A 5F7HA 1JYVA 3KEHA 4Z8FL 3SJVD 4PJ9D 3PBMA 3R1GH 1GCFA 3PQYA 4PTVA 3MODL 4IKNA 4Z7QB 2WQXA 3KVLA 2W9DH 3MV8A 3J8F7 3R4DA 4NQQA 4WI9A 1JZHA 3HAEG 3MRPB 4FL4C 3GIPA 4TQEL 3WKMH 3GO1L 3QM3A 3KBPA 3S5NA 3B40A 3LZOA 1ZZMA 4HWUA 4RNRB 4W9FC 1LE5A 2F7PA 3M16A 1KT2B 5F1VA 4NKOA 3H4HA 1DVUA 5FJRA 1RUML 3VWKC 3V0JA 4DP2X 4YHYB 1PS9A 4PUKA 1IQDB 1JUFB 1ZK9A 1CLOL 4JYEA 2KZ1B 2HPTA 2XV6B 2QBWA 2EXYC 4HXBL 2Y7MA 4PJBF 5DS8B 5BMFH 3WLWC 1G6RB 4D3CH 3H6OA 4NQEA 1TPB1 1E4KC 1BJ1J 2D7MA 2DN7A 4FEMA 4I5XA 3H23A 2OOFA 3I02B 2XWEA 3IEBA 1AI1H 4ZBJA 2A21A 4I5BB 3WZ0E 4GNVA 1O9VA 3LGDA 3FUDA 4F57L 3CU7A 2P48B 4PP2B 5FJOA 1MIMH 1ED3B 2AV7A 5A6BD 2GGJA 3L3DB 1HNYA 1T6BX 4H8PA 4O1BA 1C16A 1TSHA 1ASQA 3MNDA 4LAQL 3SDDB 1PUDA 1NPUA 2G95A 3CFUA 1HG3A 3UG8A 3W1QA 4HU4A 3HRZA 2PD5A 5D1ZI 4M1BA 3QULB 4NWUH 5F0PB 4YGVA 4BZ2A 3DURB 1N18A 1KCUL 1M3JA 2CPCA 2RD0A 2BOBB 1KCSH 4OZHF 1MNNA 3H2EA 4OAWB 4H1LA 1VBJA 1TUXA 5A8PA 5HBBA 5HI5C 5ENWB 2PZ0A 4KRTA 4MDIB 2WAQA 4QRQB 4TRPL 2X4QB 3MRNA 4NZCA 4AMAA 4C7DA 2DT1A 3O2WL 3LEPA 1C08A 1SJEB 3CAFA 4J3BA 1P0BA 1TRIA 5JHLH 3PUOA 3LMJL 4XBPA 1SXBA 1UWXH 3PNWB 4GG6B 3PVFA 4ERIA 5E8OB 3H55A 3MUZ1 1GQNA 4NRZB 6PAZA 3LZLA 2H9AB 4G7EA 3WNNA 1K70A 2RJGA 1R3IL 5E6IB 1K9DA 3W7NA 1SW0A 1QX1A 5A43C 4OJAA 1GNXA 3NG3A 3FU8A 1H2JA 2ZNWA 4GIPD 4LRIA 1SYVA 2CKSA 1ZTXE 3L5XH 3DA0A 2NXZD 5DXWA 4JFPB 4PJ5A 2J6EH 4A8IA 4E2BA 3FAXA 2A0LC 2OTUB 4U7MA 1USZA 2OYPA 2PF6A 1A3RL 3B5HA 4HBCL 5DGQA 3ZUCA 2W61A 3SIMA 4K68A 4QTHB 2XWZA 4B5EA 1GQLA 3P69A 3FT0A 4W93A 1IAOB 2BNQD 5DMJB 5KVFH 5LVEA 1XISA 1HQTA 4KTEL 1AP2A 1BMGA 4XWGL 4BHYA 1Q1JH 4P8XA 4GS7C 4IRJC 3GTTA 5DRWB 3T0EC 2WGXA 4H9MA 4UIOA 1M1BA 2J27A 1SN5A 1FV1A 2ITDA 5DJ0B 1IBGL 2VLJD 4NUJA 1Y6KR 3QH3B 4YVNA 2YXFA 4XPAH 3DXAB 3DXIA 2AABH 5TDOA 4NO0D 4TNWK 1FDZA 1R33A 2FHBA 3S3GA 4BF7A 1T1ZB 3EGSB 5CSUA 5CZVL 2IPTH 3L0KA 1J8HA 4PYHA 1UM4L 1YEDA 1YDPB 1I7RA 5CN2A 2OLHA 1FSKC 3GR4A 1A6VL 1FRGH 5AWNL 5I6XC 1BYBA 3HMXL 5HSFA 1E5CA 3OBEA 5HWMA 4BFBD 4ERAA 3SY6A 2K9UA 1D9KC 3CGTA 2OMUB 3OTTA 3QORB 4P2AA 3A67L 4NPKA 5IM7B 3LH8A 1Q0EA 1MFEL 4QF1A 1A6ZA 3ZL2A 4QGYA 1DLHA 2X16A 3SN0A 4B5SA 4I9WE 2DS4A 5MEOA 3HMWH 3DOPA 5C09D 1QVOB 1WISA 5HUPA 3QNZA 1XWVA 1XLIA 4RLDA 4HDIA 5DJYA 3QS3A 2A6NA 2MMXA 4JHMA 4LDEB 1D8CA 3TYCA 3SDYL 5E51A 2JLPA 1TELA 4JFEE 1MCPH 3BSZA 3HUJE 2E7HA 2D3NA 1W16A 2ZWNA 5HDRA 5TGBA 3WDIA 2ICWI 4L8CA 3LCXA 4PTWA 1KBIA 1UWXK 1AHWB 2BY3A 1CBVL 5HHOE 2Y8KA 4AGLA 2CZVA 2G60H 2IGTA 1DN2A 2XCMC 3Q05A 3QCTL 2XY2A 4O1CA 1WO2A 4C6BA 1R6VA 2XFWA 5BMWA 3QRLA 4EE2A 3U46B 2TODA 4PH6A 4PRWA 4ENZA 1T04A 4PJIF 1A4JA 2D24A 2HE8A 3V5DB 1NCUA 1YXYA 4XAPA 3I9PA 5ECVA 2FYYB 4EXQA 2W4XA 1OB1B 1ETZB 2VLKA 3FXIC 4N0UE 5D4QA 1EIBA 1OALA 3HCVA 5I5RA 5KVEL 5LGJA 1VJSA 5DXXA 2B20A 3W22A 3AT9A 1UXSA 2HG5B 2WLHA 4GQ9L 1WDQA 2WKOA 1V5JA 2Z31A 3X1FA 3EJTA 4CSPA 1HHHB 4IOSD 3A4XA 5F7EL 1QI3A 2QCDA 3MCYA 2UVEA 2G4FA 2XSBA 2GJ6D 3ECQA 3KLAB 2VR3A 4XNUH 2F15A 2D7PA 4Q8OA 5CJQL 3FEQA 3GXDA 3VDHA 4KRMB 1P9MA 3R19A 3W25A 4BI6A 3O0KA 5MERB 4HCLA 4JR9L 4XNAA 4D1JA 1P7QA 1DWIM 2CJUH 3BIBX 3L1OH 2VZOA 1EGVA 3LN3A 5I1LA 3L16A 2WC3A 3TAOA 3BC9A 5E6SB 2OYKA 4KHXL 4BFGA 2AGKA 2WJ5A 4IXHA 1I8UA 4CD6A 1E6PA 9XIAA 2WANA 5DJCB 4YZFE 5A2LH 2AMGA 4HUWA 5FF4A 4LUTA 4WKXA 4GBXD 3FU7B 4TN9A 3WO8A 3RAJL 3S35L 3L3IB 4RMVA 1QW9A 5DD3H 3TO4C 5A2KH 3KBJA 4M81A 2XTLA 5DA4A 5JPNA 3GXIA 4Y5XC 4YHNA 3RY6A 2NTFA 4GO8A 1OP3K 3HGJA 2IKGA 3OAUL 3LG3A 1HTYA 1MCSA 1SYVB 1W8EA 1UACH 2CETA 3L2NA 2GQHA 4FRWA 3X1NA 3TF4A 3UNDA 4AUYA 1QO2A 4HN8A 1ITUA 4F2EA 4F5CE 3D0CA 2QSVA 3PUUA 4TNVF 1TWIA 3QC0A 1DYSA 3SI9A 1E72M 4IMEA 2LW3A 5CBEA 3MRNB 3RILA 4B50A 3BURA 4ZPTB 4MMYA 4ZMWA 5SWZB 3L3JA 1CBGA 1R5VA 5D2LB 5FF3A 2A7BA 2A73B 3GJFK 2IMMA 1NEPA 3CMOL 2CJSA 3CUPB 1CFQB 2QSCL 2IPGA 4WZHA 4RE3A 5T5NF 4AZCA 3NJGA 3D12B 1JZFA 3RIAK 1PHWA 1YMYA 3H9SA 4IS6B 1CD9B 4IRZH 1H7XA 1C29A 3KW8A 4JIHA 4OVUA 2CJUL 2EXYD 1L7IL 4CU6A 5BXFB 4O02A 2F8QA 2ZOXA 2GIXA 1SHWA 3AYSA 3HZMA 4M5ZH 5DQDL 3OGOE 4LNVA 3CZNA 4FHAA 5KAQG 3DGGB 4WENB 5F9AC 5LN8A 3EJSA 1EJWC 4GC3A 2G3IA 2PZNA 4R7DB 2P0IA 1T21B 4WTWA 3RAOA 2HVKB 2L3BA 1UKSA 1OEZW 4GW5B 1OK4A 1CFSB 3JUGA 4NRSA 2CO1A 1BHGA 1ROWA 2DTML 5KN5B 1XBDA 2C9QA 1A6AA 1CR9H 1XCQB 3VI3F 1QFOA 3MDUA 4H25A 2D4DA 3WY1A 1MRDH 4DPAX 2XFRA 3VX1A 3BVNB 3WAKA 4AH7A 3M6DA 2JEPA 4LH8A 2XI9A 5IB4A 2ZP8A 1DEDA 2VLRA 2XM1A 1GG1A 4IGMA 4YCOA 3CN2A 4A63A 4NN7C 4AQZA 2IS7A 1IBGH 3SUWA 2BB0A 5FIEA 3MV7D 1IQDA 1JUFA 3VSTA 3ZTJG 4BYHA 4OV5B 2VKZG 2YQBA 1I4FB 2BVEA 1LXMA 3JZYA 3L6FA 4GFTB 3ZZSA 4DUVA 4IHCA 4HGMA 5AY7A 5HVHB 4X4XA 2F1EA 4DEPC 3HHSB 2PDLA 3TA3D 2VGGA 3SURA 5A8NA 1U8IA 3IN2A 1YJDL 3WHE0 1CE1L 2FO4A 4TVPE 5T5FL 2FMOA 1FL3B 4JRFA 3MBFA 3V1HA 1IGIL 1Q0XL 3GKFA 2CZEA 1BZ7B 4PJAB 4RGMC 3TBWA 3M6YA 3U9PH 3R2GA 3SW6A 5K9JL 2XVPA 3B3IA 2Q87A 4X7TB 1NGXA 3AG4B 4IRSC 4YMPA 3O6AA 4EIBA 1TQBC 3B4UA 2MQGA 4H2CA 4BCEA 4Q6KA 2H3XC 3NABL 4FQ1H 3MRKB 2R2EB 4Z2KA 3AM8A 4AZ7A 4AD0A 4NAFA 1TIUA 3NOEA 4I88A 2OZNA 3FULA 3M1CA 3HCVB 4MFHA 3BP6B 4YDLC 3TIEA 5LA0A 1WUZA 2PN5A 5FK9B 3PUEA 4IQJA 5BJTB 2VDNH 1QTWA 3T65A 3LMJH 1P69B 2A0LD 3BAWA 3O41B 4H0LC 4JMNA 4NYLB 1JWMA 4YDMA 4APXB 5GZOA 1X9QA 2ZF9A 4QEGA 3MUGA 4JAWA 4JTLA 3V0SA 4CKVX 3T6QC 1QNZL 4GQQA 1LDCA 3MACH 4R5VA 5DD6B 4GUGA 1BVKB 4DESA 5G5DA 3U2OA 3V4BA 5BMXA 4BQ3A 1GOFA 3EZ8A 4Z7OF 3I75B 3PBVA 3VTMA 3ULVF 3NQ6A 1H09A 4JG1H 1IT9H 1EWEA 1NWSA 3GH4A 3NP3A 4OGZA 4Z7VA 1Q1JL 2YLAA 1NDMA 5TE4L 3S5YA 1CE6B 3WIAA 4E9TA 3MX0B 4NSKB 2ZTKA 3FOKA 5FCUL 1R3VA 1IKNA 2TSAA 4ZNEE 5T9BG 6ENLA 1MZHA 3FO1A 3L54A 4WEBH 2YLLA 4C47A 1O60A 3EB4A 1S7RB 3QDJD 4JTKA 3ES6B 3EBIA 5FYLH 1MFVA 1UH2A 3NK4A 5EHFA 4CMMB 2A83A 3ZL1A 1FWXA 1EF2A 4GVFA 2GW5A 1H3PL 4KU1A 4L5FH 4F7TB 4I7WA 3VFMB 4KEZA 3LY6A 1FO0B 1RK7A 4IIDA 3NTCL 1WTLA 1KFWA 4FXKB 2JV6A 1FWEC 1F7BA 4HZAA 2YD2A 3PK7A 4K7YA 3ZFHA 4JHAL 4N5EC 3ZY7A 2DAVA 1GKEA 1U8OB 2GBVA 2A3AA 2GL5A 4X4YB 5IP4A 4O0ZA 4DYKA 5IM51 5I15H 4F58H 2O5ZH 1SZFA 1A5OC 1FNLA 5F8RC 4V1DA 3IIPA 2EYTB 3QH3A 1OSPL 3WMQA 2VR7A 4F2UA 2Q7YB 4PJBE 5KBPA 4EIVA 1CQYA 1KYDA 1Q9OB 2NY3D 3DMMB 4NXKA 3GBMH 1CLYL 4PVNA 1BJMA 3LHPL 1V7NL 1LQBC 3T71A 1BPVA 1R3WA 4EWND 1IEIA 3N0AA 3ZT7A 2Q71A 3BRGC 2XA3A 1ADWA 1GIGH 2AXHA 3MUY1 3WNPA 1QR1B 1RVKA 3AISA 1TB3A 2CO4A 1QD0A 4EUPB 1H11A 5EZOH 4ETQA 4NPYB 1JVNA 3B9KB 4PG2C 3WTTA 5HHVH 2DSZA 4N4QA 3JWDH 1J5OH 1GOKA 3CHXA 2A9MH 3GIZL 3HVDA 4Q14A 5D4JA 3V6ZB 4BEIA 4DI8A 3BK0A 3FV9A 1R4XA 2DEYX 3RU8H 1U8OA 3OMZA 4XZIA 3WMLA 3OKYA 3SGJC 1I3RA 1TVBA 1IE4A 4PJ9B 4KBPA 3MCNA 3QQNA 4OBSA 3UJJL 1NH6A 4UMAA 4LCYA 2W67A 5H8PA 3L6FB 1S7XB 2E9JA 2RB8A 2WK2A 1OCWL 3CU1A 4OF8A 3WUGA 2IWGA 4RNFA 1A47A 4J1OA 4A04A 1VPQA 4B97A 1SXCA 2HAZA 2ZUUA 1WIUA 3VCLA 1UB5B 5I66B 2X2GA 4M7SA 4JANA 1ML0A 4XCNA 3UJTH 4AL8C 5TF0A 5BW7A 4MXQC 1NOAA 4GZJA 2Z8RA 1N6UA 3HA0A 1JZ8A 4L6HA 4YXHL 2WHKA 2SODB 3ZGHA 5IXEA 5J3HC 2DZXA 4ZXBD 4WJ5A 1B3ZA 3JV4A 3IDNB 3FT4B 5MKGA 4NM8L 4ZMTA 4IJTA 1SSDA 3WELA 1EUNA 2X09A 4BKSC 1LLOA 1OJXA 4L9LA 2Q6ZA 2XZQH 1YX1A 2AQ1A 4F15B 3SCWA 2R1KA 3OVQA 4HS6B 5DRNA 1A66A 1PSCA 3ECUA 2LU5A 4FABL 1FCBA 3K6FA 1C7TA 2MCMA 5LXEA 4PWKA 3T65B 1A3HA 4H20H 3RMEA 1DYZA 1LT8A 3MMDA 1N8ZB 3LXBA 5GGSB 3LH9A 3OHXC 4OGAD 4ENLA 2WWOA 1J5DA 4YTTA 1I9RL 4TVSa 4UDTB 2VHLA 1JUKA 1EEUA 5LG1A 5IEKB 3GFUA 1EAQA 2PTUA 3EW3B 3OZMA 4WJKB 4ZB2A 3JWDL 3HC0A 4LLAA 1BREA 2YQGA 1LK3H 1J5OL 4TMCA 2O26U 3QW9A 3IMBA 2Q2LA 1G0XA 1CN4A 4GH3A 1OIOA 2ZZ5A 3W7JA 4KI5E 1RXLA 1T22A 2APTA 1H8LA 2EDXA 3EG9B 5TFSL 4X63A 2Y06H 1YBQA 3EOAB 3UTZB 3TJPA 1QCWA 5ICYA 4YSCA 1RQ5A 2P42B 3H0TB 4P3CH 2TMDA 3NQAA 3ZN6A 5EUKA 5GGRY 3QQXA 5E09A 3DIPA 1YCSA 2PR4H 1LOQA 4LYRA 3O0RH 4OD3H 4KRNA 4HXAH 4JPSA 5E6ID 3BDBA 3GG1A 2GABA 4YUEH 2VXUL 2EE0A 3QDJE 3E74A 1ONWA 4XVDA 4Z0SA 3ZXWA 2O5ZL 3EWZA 4NFBA 5DDHA 3ZBMA 5E56A 3AMDA 4XOBA 4GVHA 3WLTA 2Y6SC 1Q66A 3V75A 2JJSC 4RRPM 4PJDF 1XO8A 3D09A 1IWBA 3M7WA 2XRAL 1E6JL 4H00A 2XTJE 2F8VA 2V5LA 4Y8FA 5D71L 5DBTA 4BGDA 1Y18A 2GQAA 3MI6A 4ALAC 1N0XL 3X3GL 3TS8A 5KANI 3FH7A 4QEEA 4LLMB 1CYWA 4WUUD 1B4LA 1JK8A 1MCLA 1T2JA 3EH1A 3QDMD 4PRAB 4WVRA 5FYLD 5KJ4A 2GK1B 3H8AA 3LZFL 1I0DA 1BAFH 4C1NB 4CVXA 3ZDXF 5AD0A 4AGNA 4WTXA 3R0DA 1TMCB 5HWNA 3ARGA 3US0A 2H32H 4IDLA 3R79A 3ZYJA 4C56D 1ME8A 2F74B 2J55A 4JAMB 3VFUB 3WE6B 1ZLPA 3SYAA 4BXVA 3FYPA 3C6LA 1Q13A 2NSMA 4BCYA 1QOQA 4XMKH 1SDAB 1DQDL 1WFUA 3F00A 4PJ9C 4JB9H 3ATDA 3U0TA 2CXEA 2Z7GA 3NYZA 4C6EA 5M3WA 1T1WA 3DSFH 2IEPA 5D7IF 1SO4A 2ZVIA 4KFOA 4I77L 4LRTA 4PY8J 1J9RA 2JJUA 1BXNA 5AVVB 2CIIB 2BZ7A 2GUUA 1NDGA 4XC3L 4G56A 4WR3A 2XGBA 1RMFL 5CGBA 4IBUA 1ML1A 5DHVB 5MEOB 4IRSA 3VWKD 3WXWH 4JLRB 4M8RA 1OP5H 4FALA 4GJIA 4AEIH 3DESA 4TTDD 3RO8A 1KA9F 2JQAA 3L4CA 4XBJA 4KDWA 2WNQA 1Z2KA 5HAOA 3WD3A 3WLWD 1E6NA 2AVFA 4NBYB 3U6XA 4Y4KB 3PZTA 1A14H 2MCPL 2PRMA 2HJKA 1REQA 5EN2A 3K72A 1F42A 3AJXA 3N6HA 3M17A 1ISYA 1UH3A 4ICCX 1JQVA 4APQA 3LA4A 3MI3A 4L1XA 4PBWD 1IEBB 4IKIA 5IOPA 5BRQA 2NZ1A 4O19A 1I9IH 3DX6A 5DFVC 2I17A 1BPLB 2XH7A 1B2YA 2J9XA 3EXRA 1CXHA 1A0QH 4XN8A 5EBWA 4CGUB 3LS4L 2GSGB 2GLKA 4IUGA 3RMJA 1GG0A 3DROA 3QIWA 4YFLF 3IANA 3IRDA 3JVAA 4UTBL 2PUQT 4WNSA 5KG9B 4O5LH 3X1BA 2ZZ4A 3BAIA 3GJEA 3H2QA 3NA4A 3P9LA 4LMQE 1JV5B 4AYDC 1F18A 2WP3T 4JQIH 3FA4A 1YLBB 4FR1A 5ENLA 4AMXA 4KK9C 2AV1B 3L5WB 3DU0A 1A7NL 1A6PA 2C9PA 4JFSA 1JULA 1SVZA 2C1GA 1DJWA 4MD0B 3CASA 5MEQB 1UCTA 5CLWA 4H13C 3MI2A 3IDIB 1O6TA 4YOKA 2V68A 3OVRA 2J1KA 1G6RA 4S0HA 3LGGA 4L61A 2C3WA 4GYFA 4GXVH 1IMHC 3CH8A 4XP9H 5EPMB 5LBVA 1QATA 3MLUL 3RFZA 1TPFA 4UIKL 1HT6A 3QUXD 3ZKNC 1QMLA 1US0A 3WJSA 5F2GA 2FEDD 2VMDA 1GMIA 3DV6B 3LCGA 1G1OA 3MS8A 4YDIH 3IPFA 1EHNA 4DYJA 4Q8WA 3CSTA 3QEGH 3GMNA 4WV1C 4AX7A 3U30C 3S8GB 1SFLA 3P3RA 4KY1L 1AACA 1JWSB 4ZSOB 3S3PA 2FRGP 3OKDB 4W4NA 2ZUQB 2IH3A 12E8L 2WIMA 4LSVL 1SXAA 3L9BA 3JWNG 5D6DC 1I1AB 3CFEA 5GS1A 5IVNA 5E9DB 4MJMA 1EXHA 1GY1A 1CI1A 3W39B 1LOSA 4HF5L 3SZ6A 3AS2A 1AKJA 4Z7WF 5ELIA 3RBGA 1Q72L 3M0MA 3G2GA 4CEUC 3MP3A 2WOBA 1N8IA 4ZBCA 4N90D 3LQZA 5HHNB 4F1ZA 4XO3A 4A29A 1T6VN 2GTZB 3FMGL 2OMUA 4Q4IA 3EJPA 3THMH 1YNLL 3E8VA 1CI5A 2ATAA 1U3HD 3V36A 3RL2A 2JFCA 4WU5B 1XIIA 3LS5H 2YRPA 5C9XA 4L9DA 5CGYD 4IRJD 3T0ED 4Z0JA