3LN3A

Crystal structure of putative reductase (np_038806.2) from mus musculus at 1.18 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
319
structure length
291
Chain Sequence
b'QHCVLNDGHLIPALGFGTYPEVPSSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSIAGVVREDLFVTTKLWCTCFRPELVPALESLLQLDYVDLYIMHYPVPMSGDNDFPVNEQGSLLDTVDFCDTWERLEECDAGLVSIGVSNFNHRQLERILNPGLYPVCNQVECHLYLNQRLLDYCESDIVLVAYGALGTQRYEWVDQNSPVLLNDPVLCDVANRSPALIALRYLIQRGIVPLAQSFENEMRENLQVFGFQLSPEDMTLDGLNNFRYLPAEFLVDHPEYPFVEEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodiol dehydrogenase
publication title Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution
rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 86
structure length 291
sequence length 319
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ln3A00
3RX3A 3R58A 1QRQA 1XF0A 4JIHA 3R43A 2BP1A 3ONCA 2HE8A 3G5EA 4LBRA 1AZ2A 1S2CA 4DBUA 2FVLA 4FA3A 2VDGA 3H7RA 2WZTA 1K8CA 1A80A 3GHTA 1S2AA 5HA7A 2ACRA 4WDTA 1RALA 4YVPA 4ZFCA 4XVDA 1RY8A 2IPFA 2PDGA 2FZ8A 4GABA 4JTAA 3UGRA 3R8GA 1UR3M 3UZYA 4JQ2A 4JQ3A 4XK2A 1Q5MA 2A79A 3LUTA 3WBXA 3P2VA 1GVEA 2P5NA 3GHSA 2AGTA 5KETA 2HE5A 2PDFA 1S1RA 1EF3A 2CLPA 4IGSA 2IKIA 3KRBA 3DOPA 3CV7A 3BUVA 4QR6A 5LIXX 1ZSXA 3CMFA 2IS7A 4OTKA 3D3FA 2BGQA 1XGDA 3O3RA 3LZ3A 2IKJA 3BV7A 3UZZA 2ACUA 2PD5A 3BURA 3CV6A 4GACA 3ERPA 2C91A 3ONBA 1YNPA 4JQ4A 3EB4A 1AFSA 2HEJA 5LIKX 2I16A 3LEPA 4XAPA 4JTRA 4PUUA 2WZMA 2F2KA 1C9WA 3CASA 1MZRA 2PDQA 3UYIA 1XJBA 3G1RA 1ZQ5A 2PEVA 2HDJA 3COTA 3BCJA 2PDCA 4GQGA 5AZ1A 2PDJA 1M9HA 4I5XA 4GCAA 3MC5A 3WG6A 1EXBA 2PFHA 1Z9AA 5JH2A 4LAUA 2FGBA 5M2FX 1Z3NA 2ISFA 4PRRA 2DV0A 4HBKA 2FZDA 4DBWA 3FX4A 2I17A 2IQDA 1X96A 3V0TA 4PRTA 3R8HA 1RY0A 1VBJA 2NVDA 4H8NA 4XZHA 3GHUA 3LQGA 3RX4A 1US0A 2BGSA 2QXWA 2PDPA 4ASTA 1MRQA 5HNUA 1X97A 1ZUAX 2PDXA 1AZ1A 4WGHA 1YE6A 2PDNA 2DUXA 3M0IA 3UFYA 1PZ0A 3U2CA 1ZGDA 2PDUA 5LIWX 4JIRA 4XO7A 3C3UA 3H4GA 4XZIA 3LNMA 4JQ1A 3UP8A 1IEIA 1LQAA 4JIIX 4QXIA 3WCZA 1ADSA 3EB3A 3LBOA 2IKGA 4LB4A 3LQLA 3Q65A 3GUGA 2PDLA 4HMNA 2FZ9A 1AH4A 4EXAA 2INZA 4XVEA 3R94A 3M64A 3RX2A 3MB9A 2IPGA 3LZ5A 1YNQA 2HVNA 4JTQA 1LWIA 3LENA 2HVOA 3CAQA 2IPJA 5C7HA 3R7MA 2PDMA 3H7UA 1R38A 4F40A 4XZLX 4L1WA 4FZIA 4IJCA 2PDBA 1EKOA 1HW6A 1Z8AA 1T40A 1EL3A 1Q13A 4FALA 1YE4A 1IHIA 4WDUA 1PWMA 1SM9A 3CAVA 3UG8A 4WDXA 2PDIA 2ALRA 2IQ0A 5HNTA 1OG6A 4YU1A 1PZ1A 4H7CA 2PDYA 3Q67A 3N2TA 2F38A 3T42A 3UWEA 1Z89A 3LN3A 4LB3A 2J8TA 3NTYA 4PR4A 4YVVA 4YS1A 4JTDA 4RPQA 3DN5A 4LAZA 1AH3A 2ACSA 1AH0A 4G5DA 5LIUX 3LD5A 3GHRA 1PYFA 4YVXA 2R9RA 1FRBA 2NVCA 1JEZA 3FJNA 3V0UA 4GIEA 3V36A 2IPWA 4WEVX 4DZ5A 3VXGA 4EXBA 1S1PA 4AUBA 1J96A 4WRHA 3B3DA 4XZMX 4JTCA 3V35A 4DBSA 2PZNA 2PD9A 5LIYX 3M4HA 2DUZA 3F7JA 4LBSA 4IJRA 2IKHA 4XZNX 2PF8A 3S3GA 1QWKA 1T41A 5AZ0A 4JQAA 4L1XA 1VP5A 4QBXA 3WBYA 4R9OA 2PDWA 1MI3A 4ICCX 1HQTA 3R6IA 2R24A 2FZBA 1X98A 4MHBA 2INEA 3QKZA 4FAMA 4GQ0A 4XO6A 3O0KA 5JH1A 2HV5A 4QX4A 3V0SA 2PDKA 2PDHA 1PWLA 4NKCA 3N6QA 4Q3MA 4PMJA 3WBWA 3UZXA 4GA8A 4PUWA 5DANA 3UZWA 4Q7BA 3EAUA 2ACQA 4WDWA
chains in the Genus database with same CATH superfamily
4W8LA 4ILSA 2QCMA 1TQXA 3GY1A 2WANA 2QUMA 2ANUA 2YYTA 4DO4A 3MVTA 2F84A 4U5KA 4MMWA 3ARSA 3PB2A 1H0GA 4F3HA 1QI4A 1RQEA 3VZZA 3GHTA 4MFDA 4ZQCA 3F5KA 3II1A 2MUCA 3I6EA 4GD0A 4Y6GA 3DG7A 4XVDA 4C6OA 3UR5A 4H6KA 4DWSB 3PVFA 2EGZA 4IG2A 2ZZ7A 1O7AA 4IFKA 2XYLA 5D9OA 1OIFA 5DELA 2Y1HA 2H9AA 1JCTA 1E55A 1A5MC 4IICA 1I0DA 2Q3OA 2AQVA 4HMDA 3QLLA 1XG3A 3PK7A 4H6RA 5E9AA 2YR1A 3WQEA 1MUCA 2FYMA 1UWIA 3WLRA 1OEPA 3K8MA 3DKJA 4E8CA 1FH9A 1YTKA 3ATYA 1XD0A 4QR6A 1H09A 1SSDA 3ZS4A 4IM4A 2V82A 4JEJA 2KZHA 3V5FA 2C13A 2VDIA 2AKZA 4AAJA 2ZZ2A 2E40A 3LB0A 3VK5A 5A5WA 3IJ9A 1VHCA 1WDSA 2QPXA 4HGXA 1MQQA 3R79A 3AROA 5DMMA 3MMUA 2FH6A 3BARA 1DIDA 1HKJA 4HPHA 3THAA 1NTHA 3GXDA 1A5AA 4HNOA 5DMNA 5G4HC 3I3EA 1GGOA 5I07A 3FYPA 1SZFA 3ARTA 3EDDA 3LEPA 5HDRA 1CB2A 2TAAA 3TLLA 4EOUA 2Y4SA 3UG3A 3VIHA 4JN7A 3CASA 1MZRA 1XJBA 2YKKA 1H11A 1TO3A 3MZ2A 2D0GA 3T8QA 3QPEA 4NRSA 4DWSD 2TSYA 2GJNA 2PDCA 3UY7A 3ITYA 4DB7A 4I5XA 3BLEA 4BQ4A 4M8UA 4LVAA 1Z3NA 1GKRA 2WCGA 3KBSA 4PRRA 4HBKA 2QPUA 4I3GA 1O5KA 3BMVA 1B31A 1I4NA 4MY9A 4X61A 4ES4A 1UQYA 3ARVA 3HJZA 4MDPA 3WUBA 4OUEA 2TRSA 4B3ZA 4YTUA 1X1ZA 4K1WA 3BO9A 2Y7FA 1PB0A 4CN1A 2XINA 1RPXA 2J66A 1LL4A 3W00A 4RW5A 5BWAA 1OWQA 2JEQA 3DGRA 1FWTA 2HXUA 3GXNA 4V1YA 4DO5A 4UTHA 4L7ZA 3KLKA 3UF9A 4AF0B 2J7GA 4IIFA 7CGTA 4ORMA 1XIIA 3MI3A 1XQKA 1JZ4A 3G1VA 4S3BA 1US2A 1L6WA 5H8PA 2WV8A 1WKEA 4ZQMA 4RLIA 4Z17A 2E0PA 1TYGA 1IYXA 1M03A 1VPXA 1JUBA 4GJ1A 2H6RA 4LJ3A 3R8RA 2P0IA 3DFPA 4B4FA 5A1AA 3LQLA 2XISA 1GZ1A 4NHVA 4JYFA 3C2FA 5A6BD 2WWDA 4DJDA 5CGTA 4EF8A 1B3VA 4A4AA 1RHCA 1YNQA 5A8GA 3WH7A 1QHZA 1EA9C 1E6XM 2BY0A 5HWJA 3KRSA 3H7UA 4XZLX 1BFNA 2JQXA 2J7DA 1WXZA 1MZHA 1TV2A 2DY3A 4M5PA 1BSLA 4CUCA 1R46A 2Q02A 1H1NA 5CCZA 4HNCA 2QCNA 4DEFA 1KM0A 3VIGA 4TVDA 1FKWA 4IGHA 1VFTA 1VQTA 7XIMA 1L2UA 4A2RA 2ALRA 3KOZA 5HNTA 4Q6JA 3LCGA 4ZR8A 1ZJBA 5GJMA 3V75A 4WHBA 3I3DA 5AB3A 1NP2A 3VIOA 1RP9A 4HN8A 2EJAA 3NTYA 3TMQA 1I60A 4MWAA 5K3VA 1AH0A 4UFLA 2O7SA 3LD5A 3S46A 3SURA 1A47A 3AAMA 2PTXA 3KVLA 1EJ7L 5A6LA 1OCBA 3W7MA 3L4ZA 3HURA 4GH1A 4IXHA 2JBMA 1JCLA 1IQ8A 1A5BA 4E4FA 3SCNA 1QT1A 2PZNA 3WJYA 2O9OA 2C8NA 1K03A 1X8FA 2BOFX 1WB0A 3INPA 1UJQA 3MBDA 3VIJA 3AWOA 4LS2A 1RA0A 4O12A 1XM3A 2Y2WA 3QPZA 4HZ6A 3ITOA 4C6EA 2CBUA 1MI3A 1DIOA 3WEZA 2R24A 1ZRQA 3LERA 1XPGA 3N9SA 4HA1A 1EDQA 1LUCA 4X2RA 4DBEA 5K7JA 4UR7A 4GXPA 5C2GA 4TMBA 3IIZA 1UQZA 1XLHA 4C1LA 2PDKA 3A4WA 4Q8TA 2ZFAA 2XU2A 3EX6A 3WK3A 4S3GA 1K6AA 3GLCA 3XISA 4RDZA 3UZXA 1JDCA 1C92A 2C1IA 4JS3A 2GUBA 3DG3A 3IIOA 3EWXA 4POCA 5DANA 2WVUA 1UH4A 3K2GA 4WDWA 1EBHA 3G1YA 2XFWA 2HPIA 1ZBVA 3MUIA 4I90A 4Q8NA 1OZQA 4CCCA 3NQ2A 1AJZA 3ZYZA 2PSNA 1EX1A 2VMFA 3NCOA 2VDGA 1REQB 4Z2JA 2BLEA 3WDQA 2DZSA 3WO8A 3O15A 3RFAA 4GI4A 1Q6LA 5HA7A 3TN5A 3VCRA 3VMPA 4Z42C 3EEZA 1SMAA 4FLOA 4AWSA 1L8PA 3WQVA 3RM8A 3S1UA 2PDGA 1MEIA 2CNCA 1UR3M 3AYTA 1QTWA 2V2HA 2QF7A 3TW9A 4Z2LA 3NL2A 4EPEC 2YJQA 1G67A 1I2QA 4D6GA 2DIJA 2OFJA 3FJ4A 1UJPA 2L5HA 4DM2A 2CBVA 4HNUA 2RGLA 4PTWA 6REQA 4JYEA 4RNIA 3T4CA 1R3YA 1VRDA 3WEMA 3QRHA 3W88A 1JQVA 4NJHA 1IXOA 2Y7GA 2D2JA 4RNFA 3R89A 4PULA 5CPSA 5JBFA 2A7PA 4J5NA 3AUOA 4J3XA 2C14A 4ORIA 1XL9A 1G7VA 3IGXA 5LNWA 2X16A 3CMFA 1O12A 1AW1A 1E15A 3KZPA 1D7KA 3PJWA 1KR0A 1DP0A 1EGZA 4TV5A 3IJIA 4PCSA 2J75A 2WM0A 4YLWA 3DCPA 2D24A 4A29A 1C8QA 4O1DA 2E68A 1TVLA 4J3ZA 4PTVA 3VNDA 3HOJA 4IQJA 2OLHA 2Z0IA 1BRLA 1FUYA 1AFSA 4C1NB 1ZJAA 2YLLA 1XV8A 3NZPA 1W5MA 3UBPC 2VEGA 4RUBA 3S0CA 1E1CA 3OEXA 3WDRA 4PTMA 1DJWA 4UNLA 4PMRA 3PPFA 5AZ1A 1XCWA 3L7RA 2WJDA 1Y5VA 1EJUC 2QMKA 4AX7A 2Z27A 2GLKA 4U2YA 4WK9A 1UR2A 1EIBA 4IP5A 3F4VA 1GEQA 1HGYA 5A8PA 3AIWA 1MXGA 2IQDA 3WK2A 1OCNA 1VBUA 4RJEA 4PUKA 4F2UA 2B81A 5JXQA 2X1TA 4DELA 4XZ9A 4C6IA 4P7RA 3U48A 3NYDA 2OZ3A 3KDOA 2E5CA 3DEQA 3PBGA 2W62A 1SFSA 4DX3A 4P8UA 2I5QA 3G77A 1OFQA 4E4PA 2QCHA 1N8FA 3IIPA 1X97A 2XVNA 5EY5A 2RJGA 1UD6A 3M5VA 5K4ZA 3N9KA 5BU6A 2NT1A 3F4WA 2YZRA 3BGGA 5BOOA 2V81A 1OFEA 2GK1A 4O10A 3AMDA 2ZUTA 4GRSA 4ZO8A 4ZQPA 4Q4KA 1VPYA 2VENA 4OWGA 3UP8A 1IEIA 2ZE0A 4D2JA 1UD3A 4J2PA 5HANA 4TTUA 1M5WA 2G0WA 4FB7A 4BWLA 3GE7A 1D3GA 5HJXA 3MZNA 4C6KA 3EMCA 3M0MA 1GVFA 4FX6M 3NZRA 1JXKA 4RKAA 4AIUA 4RZ6A 1Z48A 4JFVA 4NYYA 3ZJ7A 1O95A 3L68A 2E5DA 3S1GA 4F40A 4C1KA 3R12A 3C6CA 1Z41A 4HD5A 2XHYA 1XDMA 2R91A 5E0KA 4QCFA 3MMWA 4PFMA 4XD5A 5CPOA 3PZTA 3T1GA 1MW2A 4DJFD 4E8DA 1ICQA 2ZA3A 4WDUA 4IH3A 4H9TA 1I2OA 4NUWA 3BW4A 1OG0A 3WLOA 3NURA 4KIRA 1YDVA 2PDYA 3BV4A 5EPDA 3N2TA 1CWYA 4UMAA 1SO3A 5LA1A 2H3BA 1JZ2A 3OJGA 4IG2B 2ZA2A 4JZ5A 2OCZA 4IFKB 4G5DA 3W7JA 3L23A 2H9AB 3N13A 2R1NA 2WHJA 1JEZA 3C2VA 4HHLA 1FQ0A 3RILA 1VLIA 3OGSA 2DW6A 2V5KA 1QI2A 2A85A 2AKMA 1R9ZA 4JBRA 4HT3A 4WRHA 4M24A 1B3XA 4IPPA 3KHDA 4K7VA 1RCOB 3UWZA 3RCYA 3NQAA 1DXFA 1UH3A 1PHQA 4Y9OA 1KCXA 3MV11 3RO6A 4WJEA 5FJOA 4TV6A 5I3GA 3ZFHA 4DUVA 4C7GA 3MUZ1 1QK2A 3ZLFA 5D8WA 1HKWA 3MBFA 1J4EA 2CHOA 1Y8BA 4K38A 1POKA 3MKKA 1FWEC 3QC3A 1IR2A 4IFRA 1K3UA 1O1ZA 3E6EA 4K6AA 4D6FA 2AGKA 3QV9A 5IBXA 1X98A 3V5CA 5CSRA 1Q3NA 1UPPA 1WAUA 2JKEA 4EX4A 5DCDA 3B05A 4UFHA 4JFWA 3ISIX 1C8XA 4C5ZA 4IL2A 3H6OA 5I3FA 4MNLA 1N82A 3H23A 1FOBA 3W29A 1VFMA 7PTDA 2WLYA 3QR3A 3WLIA 3E1F1 3R58A 1N55A 3U5UA 2E1DA 4W85A 4O54A 4BFAA 2BP1A 3MWCA 2HE8A 3Q4DA 3TE9A 5I2UA 3T40A 5HBFA 4LVGA 3QR0A 2OT1A 3GZ3A 1WYIA 4PGLA 1TE6A 5LNRA 2PWUA 2EPKX 3GS6A 5CBIA 2UBPC 1NDYA 2R1KA 3SRHA 2BHZA 4AD0A 1N8IA 1K1DA 3C2YA 4WXYA 4QLLA 1LF1A 3RAOA 3RYSA 4JIQA 1V6XA 1OSEA 1W2PA 2VM8A 2OZ8A 4JTAA 1JFHA 1XUZA 1EOMA 2VXNA 3H53A 3CO8A 4V28A 3W7EA 5LGZA 3FXGA 4M56A 3FY1A 2A79A 1RZMA 1JL8A 2B4GA 3WNMA 5CC3A 4CD7A 1TPDA 4FHAA 1GVSA 4CU8A 4A8IA 5FF4A 1EOKA 3BMXA 3OIHA 1HKVA 2O92A 4P8VA 3IVUA 4B3KA 2CZFA 3QZEA 2OLSA 2AL1A 1EUAA 1W9UA 1PTAA 3DFTA 1OY0A 3WD3A 4ZE5A 4V2XA 4GYJA 1S2WA 1SJAA 3CUXA 3O3RA 4AVNA 3DENA 2G95A 3TJ4A 5E09A 1XYCA 4L61A 4ZXLA 2VFIA 1FFRA 3WQ4A 4JTHA 4GGHA 3LXAA 3IUHA 3FK4A 3M07A 1Q6CA 4JXCA 3FOKA 4AY1A 1DE6A 5AYZA 5LIKX 1XWYA 5ECUA 4KKXA 1J01A 1B9BA 3BLLA 2DPEA 5IDIA 3WN6A 1LBLA 3EKLA 1RK5A 4TOQA 3GIYA 4IWWA 4JDYA 2PEVA 2JE8A 4HNLA 1XRSA 4ICMA 3NG3A 3MA8A 3ABQA 5HPOA 1XBZA 3KVMA 5T26A 5DMLA 3GDKA 2P0OA 2WHLA 4KCWA 3RMJA 3H2NA 3PG8A 4IZGA 1VGAA 3CZJA 3I7QA 3RU8X 4XG1A 2Y85A 2VT0A 5J04A 4CNPA 2WWCA 4H9YA 1BQGA 3VMNA 4CN6A 1VBJA 4ADSA 1TTJA 5KZ6A 2WC4A 4C6CA 3G1AA 3DYOA 1RVGA 3W70A 3M0ZA 4GUJA 1KCKA 2PP3A 2NQZA 1UBPC 4O16A 4NF7A 2NW0A 1ZUAX 2PDXA 5C71A 2O9PA 3GH7A 3LYEA 5FKYA 1MFVA 1NOUA 2GFTA 4GJIA 4BY3A 5C70A 3BLPX 4N6EA 3NGFA 3K13A 2VZSA 4XO7A 1B3WA 3KOXA 3VCNA 3THDA 1OX6A 3QY6A 3W7QA 1U5HA 3WD4A 5HJYA 1G01A 2GWGA 5AC8A 4GVIA 3NA8A 2H90A 1G0CA 4Q22A 1BAGA 1C9DA 4LW7A 3W1QA 4LNCA 3T2OA 3DC0A 2OB3A 3GAYA 3QYQA 2G3MA 3C2OA 1R9YA 3VGHA 3ZR5A 3LENA 4AFYA 1LUCB 1CLKA 3QFEA 3W25A 1R7OA 4WKAA 1WP6A 2PDBA 1RQBA 3F5JA 3JRKA 3U2OA 4PZVA 4XZBA 4GC3A 4WX2A 4HNVA 3P8IA 4PH6A 2PCEA 3GO2A 3GDMA 3C8NA 5DFAA 4QHRA 5FF3A 3C2RA 4PMQA 1PCWA 2RJHA 3DX5A 4HU4A 4PL2A 2A6NA 1ZAIA 2Q6ZA 4LY4A 2WCSA 1WXJA 3O63A 7REQA 1IZCA 1GNXA 3W76A 4AYGA 3B9DA 2VELA 4S3AA 3IJDA 1ZS2A 5I03A 3TYBA 3A24A 4GY0A 3NZQA 5K2ZA 4DZHA 1IXQA 2QJJA 1I2RA 1QU4A 4LAZA 1E70M 2A3BA 3TTQA 5C2XA 1BF2A 3BZGA 1TTPA 1O1HA 2R9RA 5GNXA 1JZ6A 2DP3A 4MB3A 3USZA 1P6CA 3PBUA 3FJNA 1P1XA 3SCVA 3DIPA 4U5IA 1S5WA 2DZWA 4HHPA 2FLIA 6REQB 1CNVA 4G2DA 4DZ5A 3EOSA 3N17A 2D2HA 5I0DA 4OHQA 3P62A 1V03A 3L65A 4QROA 1VC4A 3RLGA 1EPVA 1W1A1 1JZ8A 3W7KA 4AISA 3LRLA 1ONWA 1RJQA 4GK8A 3E0WA 4F0SA 4JHOA 1I6NA 3F4DA 4IMGA 1UIPA 4ZOEA 2E8YA 1H63A 4L1XA 3WNNA 4AHQA 3G8EA 1JGMA 2POTA 4DXXA 1W9VA 2IQTA 1E9IA 2ZRXA 2HPMA 1CXFA 3EDFA 1BRLB 4FAMA 3B8TA 3R11A 3W6YA 1K9EA 3MP5A 5BMWA 4D8ZA 3CJPA 2G4JA 1V3KA 3HV8A 2PU0A 1WUFA 3PWAA 2VVSA 4Q4OA 3GB6A 3P80A 4GIRA 2BFGA 3ZMRA 4NKCA 3CIXA 1E1CB 1QNOA 4UCFA 4H3DA 4GQQA 2E28A 2C0AA 4JCLA 1DIEA 3BG3A 3EAUA 1KTCA 2XH7A 3M1ZA 3HMJG 3KM8A 1R2TA 4DJDC 5EMYA 3E2VA 2W79A 1V8EA 3JW7A 4GLEA 1OC7A 5E0FA 3B0UX 4CU6A 2WZTA 1XX1A 4S3FA 3QQ0A 1FX6A 4NXKA 1OD8A 5CGQA 1F3WA 1LBMA 2QLYA 3VO0A 1KQYA 2QDEA 2RFGA 4E3TA 4PBGA 2NV2A 1P6WA 3BSGA 4GWEA 2DJLA 2PRMA 1HKMA 3DI0A 4Y8EA 1HL9A 2J4GA 3W22A 3R13A 1YYAA 2BDQA 3GKAA 4DZIA 3VIIA 4E6MA 8TIMA 3ARWA 1A5NC 2CZVA 2QS8A 2E67A 2OVLA 3VNKA 2OQHA 4UTIA 3RMEA 4GUFA 1UWSA 2AGTA 1P0EA 1S1RA 1ZCCA 3SCWA 1E6ZA 2Y7EA 2GK1B 4J3WA 2DSUA 1QO5A 4Q8PA 4E3VA 4CU7A 2ZWZA 3AXHA 3BUVA 4MWAC 5F4SA 4WF7A 1LJYA 3DZ1A 3ITLA 1KBKA 3G0SA 2Y8VA 1JFXA 4AW7A 4O11A 3W1PA 2P10A 4LXFA 4PMVA 2IKJA 1TPVA 5FEWA 2NXIA 4M6QA 2WQDA 3PM6A 5LXEA 4AWEA 1EBGA 1NQ6A 1QOXA 4G7EB 5I79A 3W2NA 4S3CA 5I6SA 1M7XA 2HXTA 2C91A 3LHTA 3KCJA 1SFTA 3AXXA 1J0IA 3PWGA 3BG5A 1JPMA 1V93A 3NOEA 4M19A 1OT2A 4UOJA 3GDTA 4XSMA 3W1MA 4AD3A 5I09A 4NRRA 2VEPA 4MB1A 1AMKA 3UYIA 4W7WA 4D9PA 4B4HA 4CQ8A 2CPUA 3QHOA 1V0LA 4U31A 1V0NA 4CD8A 4I6KA 1WCGA 3TN4A 3QR1A 1N8WA 4JCMA 4LAOA 5CC5A 3Q37A 3F4NA 2ZBTA 4FS9A 3NVTA 3ZSTA 4OZOA 3CWHA 3WQ5A 3W1UA 3SCTA 2GVLA 4HHMA 4MZ1A 2QCEA 3W2MA 1R0MA 3ZT5A 4TX8A 3TTOA 1C7SA 4OFCA 3KTSA 2PTYA 2J6XA 5CPQA 2GOUA 1YTDA 1YXYA 1RR2A 4H19A 1XH1A 3IUDA 3L2MA 3QYSA 1CDGA 5TD4A 2Q8ZA 1FWGC 4OBRA 4YL2A 2YZ5A 3H22A 4UC5A 3ENLA 2I9EA 1IWAA 2FHFA 5BCAA 1UKPA 1U5JA 1E43A 1VFLA 3H4GA 4B92A 2VR4A 3KOYA 1O5QA 2CXGA 4QSHA 2X0HA 3ARZA 4JTTA 1UA7A 4EACA 1UBSA 1ADSA 3DGBA 1O66A 5G1YA 2ZADA 4Z2KA 1PDZA 1QBBA 4A21A 4YNGA 5BROA 1UWAA 3RRAA 3SY5A 3RJXA 1P4CA 5ECVA 3RO8A 2VC5A 4H4IA 2PWHA 3BG9A 3UERA 4FXJA 3ZLHA 1K4HA 4FO4A 3GDLA 1RAKA 1T8QA 3AMKA 3FLUA 4PSPA 1ZY9A 5G2IA 2XSAA 4KWVA 4S23A 3DFNA 3SFWA 4ZFMA 1POJA 1SUXA 1VEMA 2OOFA 1PTDA 4MWAE 3VZYA 5DT5A 2YA2A 2PDIA 1P7TB 3PPHA 2PTDA 1UWUA 1PXGA 1O94A 1LOSA 1RPKA 3T0AA 3C4UA 3MV01 4UTTA 1Q6GA 4DXVA 1BG4A 4ZOBA 4CQAA 4GXWA 3TZNA 1JPKA 3EXRA 1BXCA 1WV2A 3BVJA 3OLDA 3URQA 1YADA 1FWBC 3O8AA 3L21A 1I0BA 3EKGA 1V02A 3QW4B 1OADA 4YMZA 1PYFA 1FRBA 1WZMA 3OOQA 2ESCA 2YA1A 1V7YA 3WY1A 4FIRA 1J0JA 2OYMA 4NIRA 4GKTA 4IIDA 3VPLA 4EXBA 3OG2A 3B3DA 4NJGA 1D8CA 2XIIA 3N4EA 1HUVA 3AS0A 3HFYA 1XCXA 3W07A 1OF6A 5ABHA 3LM3A 4CCZA 2YOCA 4WSHA 4XD3A 1MUWA 1QWKA 3CUJA 1XLIA 3MHFA 4QDWA 3LHVA 1U2YA 4XTIA 1BSIA 3CUIA 2CW6A 1LQ0A 2FZBA 5C0QA 4K68A 2BB0A 2ZTKA 2A4AA 4FF7A 4MYXA 4H9VA 3A22A 1ZALA 1VHNA 2NSOA 3E5PA 2JFEX 2XIOA 2C15A 4LUIA 3IV8A 2GGJA 1XPYA 2XM2A 4TVCA 3KL5A 2HROA 1U30A 4N2YA 1XXXA 5A95A 1T6MA 3BH4A 4BWLC 1WNOA 4QP0A 3MMTA 5IM51 4OECA 2RDTA 3PZ9A 2PWGA 3B40A 4HQVA 2X1RA 4YPJA 1TVPA 2E1WA 1HN1A 2QUVA 4DO7A 1WE5A 2X1IA 4I7VA 4ZGYA 4MNMA 4CQ9A 3WH5A 1QR7A 1WDRA 4Q8UA 5ABFA 2GQ9A 1OVDA 5D33A 4PMDA 3UPMA 1PO9A 2HBVA 1GTEA 3S6OA 1TV3A 5D9NA 3NGJA 5CSSA 4Q6XA 3A9IA 2BV9A 2WZEA 4JTEA 3KP1A 4HN4A 2DIKA 3TA6A 4TIMA 3A5VA 1KFJA 3RDKA 4K39A 1W5QA 5A94A 3AWNA 3P2VA 4IIGA 1K9DA 1AG1O 3M44A 1EP2A 1LL7A 2WBGA 4Q8QA 1UMYA 3LHWA 3DI1A 3TN6A 1NIUA 3CC1A 3FJLA 3DYMA 4IGSA 4UBPC 1QVBA 3NDYA 1LORA 3ECQA 3I10A 1VIZA 3GNRA 4QLJA 4B16A 5JBDA 1DJZA 4EIVA 1FWSA 2ZX6A 3UPBA 5HNNA 1MYRA 1XP3A 1ZENA 2V5LA 4RDWA 3PANA 3AC0A 3GAKA 4JTJA 3RGTA 5D37A 3W2KA 4DM1A 1AVAA 1DWHM 2XSBA 1V3HA 1ME8A 4QG9A 3FA4A 1XIGA 3CQJA 3U57A 1FCQA 1S39A 4XKYB 4CNNA 1PUDA 3S5SA 3ANUA 3LK6A 2GVJA 1RBLA 1VLWA 2ASHA 4HMCA 2BMBA 4HOZA 1IEVA 2CZEA 2I16A 3ZJ6A 4F2BA 3E0FA 3OVGA 2WZMA 4W9TA 3OHIA 4J3VA 1XDLA 1YIXA 3UWVA 2CLMA 3VC6A 1AK5A 2D1ZA 2O56A 4NJIA 4PMZA 3VGDA 4DJEC 1LRNA 3COTA 1M9HA 3SGGA 4DYJA 3UD6A 2ZZ4A 1XBVA 4I5UA 3WG6A 1IT7A 5IBXC 1XLGA 4KWSA 3AJXA 5M2FX 7REQB 2E5BA 1KRBC 4ERGA 2ZRZA 2ISFA 1TJRA 2WVVA 3B0VC 3NPWA 5C9RA 1P48A 1R3TA 3UWUA 2I56A 3GBEA 3VINA 1JYWA 4FXRA 2Z7KA 4XX6A 3W75A 1K6WA 3MP3A 1H2JA 3W02A 3DFQA 3GWQA 3BTNA 5E5CA 3I4KA 1MW1A 1US0A 2P50A 3B0XA 1PKLA 4GO8A 3OG3A 3GKFA 2PDPA 5K9XA 3APYA 4XBSA 3W71A 3IUIA 1E73M 1LLWA 3CAKA 3S1XA 3BQ6A 1ZPTA 2Q3RA 4R34A 3DFYA 3BANA 2QNEA 5LKYA 3LNMA 3S9ZA 3GNDA 3H2OA 3VILA 4FPSA 2YW3A 2ABAA 4GZIA 2YDQA 3TXZA 4HCLA 4XAZA 3AHTA 4JD4A 2DT2A 4GY7A 3LPOA 3N9RA 3QMTA 4XD6A 1OABA 3L4TA 3WUEA 3PN8A 2Y24A 1KNWA 3MYOA 1EQPA 4BI7A 4L9YA 2GUYA 2CXEA 1QPNA 3R94A 4UOQA 3C8FA 3LZ5A 3SI9A 1NVMA 1GOQA 4HPJA 1GORA 2YLAA 1CIUA 4PB5A 1K7FA 2CLIA 2W9MA 2HSAA 2F7FA 4M29A 1ZTVA 3WFAA 4ENLA 2X2YA 4QJ3B 4MTVA 1B1YA 1NF7A 3ZIZA 1MNSA 1T40A 5FJIA 3NQCA 4DI9A 3GVQA 3SCOA 3QJAA 1SO5A 5FJPA 2NX1A 1V77A 4NZCA 4RDYA 5A2AA 3EPMA 3W37A 1JD9A 5TQLA 4L56A 3K8KA 2QIIA 3TTYA 2C19A 3RU6A 3KVKA 3RIKA 2VJXA 2OZTA 4O8RA 5FJTA 3BJTA 3P61A 5AN7A 3CTLA 3WD0A 4YVVA 4GXMA 4MJZA 2G3JA 4MOZA 3ANYA 1SVDA 1XKYA 4A2SA 3TYAA 3TKFA 4YVXA 2A0NA 2QCGA 1O5RA 1KXVA 4LOCA 3L12A 4GIEA 3TC6A 4J40A 3KL0A 3TONA 1C8VA 1ZP3A 4WY0A 3WLHA 1EJXC 1OFAA 4HJFA 3LCXA 3NQDA 5DCEA 4BQ5A 4EF9A 1KQZA 3RLVA 3CQ0A 5KZDA 2V69A 4TX6A 1NARA 3PG9A 1W9XA 3L66A 1BTMA 1PKMA 2Z6IA 4L6DA 2ZICA 4LANA 1W1ZA 1VKFA 1KTBA 3E2QA 3SY8A 4AVFA 1AQ0A 2E6AA 1GW9A 4IIEA 4BS0A 2E3ZA 3CH9A 3GVRA 4PB3A 4AIOA 2WZHA 2PDHA 3IV3A 4G9PA 4YHGA 5C55A 1XSIA 4Q3MA 3K4DA 3NOYA 2Y0FA 2Y88A 3CLMA 3W7PA 4A3HA 4ACYA 4RE0A 2ACQA 3A47A 1RJPA 4FOJA 4K2SA 4PCPA 1SO6A 1H5YA 1KLYA 1CECA 2WSYA 5CG7A 1KM4A 2BODX 4AD4A 1VFSA 4GVFA 4P7NA 4B90A 5IDZA 7A3HA 3L4VA 3QVQA 2FMNA 1HJXA 2I7GA 5BU9A 3EXSA 1UZDA 1W9BM 2XFYA 1W0MA 3TWAA 2DQWA 5FEXA 2CESA 1H7RA 3LHZA 1UD4A 2B7OA 4UNIA 3NJ3A 1H50A 4MF4A 1O60A 4JTUA 2A7NA 3W0KA 2WPBA 4CQDA 3GIQA 3NUKA 3EXTA 4DWSA 1WQ5A 1Q5MA 1Q63A 2ATSA 1NJJA 2V3GA 5EA9A 3T4WA 1ISYA 2G97A 3CV2A 1XLLA 3CS2A 2FZNA 4GHRA 4GCXA 3WNKA 1GT8A 3SUVA 2GSEA 1K7EA 5HQLA 2IXUA 3TDFA 1OM0A 1J0KA 1TREA 2VKZG 3ZSSA 4X0VA 5GPRA 3ZR4A 1QJWA 3N12A 1KBLA 3W85A 1W31A 4FLSA 3ES7A 3AZTA 3FW6A 1RV8A 4GVHA 1R86A 3B4UA 1L0PA 3LDVA 5FEZA 4S3JA 5K4XA 4ZOCA 1U22A 1B3YA 4GFSA 3LZ3A 4X63A 4C60A 1A5CA 4HYRA 3SN0A 5AHEA 3URBA 1WKFA 3CV6A 3K1DA 3ONBA 3AJ7A 3P7YA 5LNVA 3UG4A 3V5OA 1B3ZA 4CQCA 3E74A 4BKNA 1RD6A 2Y89A 1R87A 2DZXA 1LG1A 4F9JA 2ODOA 4KEMA 4GO9A 1WPCA 2Z1KA 3ABOA 1TJ2A 1TPC1 2YDRA 5D2VA 1J11A 3NZ1A 3BXWA 5A6BA 3A3HA 5CZTA 1GOKA 4NX5A 3FEQA 1OB0A 4AY8A 3UEQA 1S2VA 2PRLA 1JNDA 2RDUA 1KM6A 3E96A 2OXNA 5HMEA 3FEMA 1DKWA 4IIHA 3SUWA 2QJIA 3GU1A 4C6JA 1Q7MA 3KOWA 1AD1A 4LFYA 1ZZMA 4I6VA 4W89A 4W84A 3N2XA 2OX1A 1J12A 5A8QA 1CZ1A 3PZNA 2QGHA 3W1TA 2CLLA 4JFUA 1YLVA 1HIZA 3HJEA 3PUOA 4GH3A 2F6KA 4ZVJA 2WO5A 1QNPA 3P8JA 1PJ9A 1AZ1A 3SRKA 1NWTA 1KBIA 4I7WA 2XH0A 3RLHA 1TRDA 3SN4A 3V16A 3E2SA 4PUMA 4JIPA 1DQXA 2PDUA 3IWPA 4HA0A 1IEWA 5EFDA 2QCDA 3G6LA 4WOQA 3TW7A 4J7RA 2GYIA 2CLKA 2FTPA 3VFLA 1UP0A 4P8WA 4LB4A 3PWIA 2WC7A 5F7UA 2D3LA 1ODZA 1ML1A 3FA5A 3VOIA 4WQ6A 3FDGA 4AWTA 2ZUMA 1D3HA 3TR2A 3BW2A 2IPGA 6XIMA 1XI3A 1G4TA 1BLIA 1BWKA 4Z2HA 1TSIA 3FIGA 1XR2A 4AZ5A 4CEUC 3GQYA 4ERIA 3W1LA 1UR1A 4ADTA 2BXVA 3UYCA 1PX4A 3TMLA 2YL9A 5LZLA 1XW8A 1NFGA 3N1AA 3QZAA 4N0RA 3AO0A 3EWBX 3XINA 3KVJA 4XAFA 4WDXA 1DHKA 2CWNA 1QI3A 2XM1A 4GUIA 2D23A 3CWNA 4JKKA 3PZGA 4HP5A 3GXMA 5M5DA 2F9RA 3T6CA 4JAWA 3CHFA 3T42A 2P3EA 4PMNA 5ABFB 4N9EA 4LB3A 2PRHA 5G1TA 1E9ZB 3E0VA 2ZX5A 4PR4A 3WF0A 5G2HA 1W1TA 3PZMA 5E0CA 1FDYA 1AH3A 4GQRA 4QLKA 4GJJA 5LIUX 3MUXA 3HPAA 1EC8A 1RUSA 1NQKA 1A5SA 1AL7A 3AHVA 3VFCA 2NVCA 2QUTA 2ZRWA 1QFEA 3ZM8A 3BOLA 4Q8VA 3T08A 1SMDA 3GTNA 5I7GA 3V36A 1IEXA 2E4TA 2VDHA 3OBAA 4BHYA 2A3CA 2DIEA 4YXGA 3P14A 4OKDA 3AU6A 4JL1A 4LS1A 1VS1A 1IT0A 4URIA 3VZXA 2ZUVA 1FVPA 4Y2WA 3WQWA 7ODCA 1SQ7A 1UD2A 1EDGA 3OGRA 4EAMA 2FB3A 3ZJ8A 4Y9MA 2DGAA 4AHPA 5I24A 1LL6A 2IW0A 3N2OA 4UTUA 2BWGA 4AG0A 4DZAA 4QAWA 1OC6A 2G3FA 4AIBA 3CYJA 1F74A 3NPXA 2X8RA 5EMMA 1PE1A 2PODA 4B5TA 1JXJA 4I9TA 5CXPA 4EWJA 4BI5A 5A6KA 3BLFA 1FWJC 4HCDA 4F0KA 4N7QA 4P2VA 2Z2BA 2LLEA 3W3OA 6TIMA 4C6BA 4O15A 1W5PA 3MUCA 5MF5A 4C65A 4CD4A 1Z44A 1LLOA 5RUBA 1ECQA 1EWDA 3OPSA 1XGZA 3PF3A 3U8GA 4HU0A 4AH7A 4H83A 2OO6A 2REQA 4AZHA 1V0KA 2GGEA 4LVBA 3UXKA 3SCRA 4XQ6A 2Y5EA 1IE7C 4GIYA 4WOZA 3AISA 5T9CE 1PBGA 1I45A 5BMXA 3VTRA 3TFXA 2Y7DA 4NILA 2WVVB 3E49A 4R7JA 4JX4A 1J0HA 3HPFA 4J35A 3N6HA 4O0QA 3MTWA 4LSBA 2WM1A 4QM1A 2Y8KA 1REQA 3GYCA 3RM9A 2WSRA 4H8VA 2IPFA 1UUOA 4D6CA 1B3OA 2NX9A 1KCZA 4HPGA 1J2WA 2DT0A 3SO7A 2EKGA 2J9XA 4PUJA 4E2OA 1JAKA 3LUTA 4UTTC 1GUVA 2YYUA 2OELA 3BLDA 4L4LA 8XIMA 1DL3A 1LROA 4N9BA 1M1BA 5D2YA 3AYSA 2GJLA 4RPPA 3IACA 1UKTA 3S47A 1Y7VA 1FP8A 3P0WA 4JTSA 5IOBA 1UC5A 3FVMA 3N3MA 2YL8A 1E71M 3V4BA 3TCSA 3U5YA 4FP1A 3WF3A 5CSUA 1XGDA 2BTMA 1KWKA 5DX7A 1UUQA 5FEPA 3H24A 5LHFA 3L2LA 3DDMA 2YCKX 1DQWA 4NT0A 3ZWTA 1RVKA 3ARXA 1RLCL 4J27A 3GM8A 2QCLA 2PD5A 5CAKA 4GACA 1ZU8A 3MVIA 2PAJA 5GVJA 4KFPA 4HK6A 3UXAA 4NAFA 2R6OA 3SRDA 4D1IA 3W6LA 1C9WA 3W01A 5FL1A 4ROQA 4M80A 3UXIA 1H41A 1ZQ5A 4OOUA 3GVWA 3MHGA 4H6QA 3UWYA 2YFOA 3S5YA 5JH2A 1A3XA 5EL1A 2GQ8A 2P53A 1R7AA 2VWTA 2QGYA 3ID7A 3LX9A 1NP0A 3YPIA 3WDPP 1FH7A 1HJSA 5BW6A 4Y96A 2BOEX 1ITQA 2VZTA 2ZRYA 1KWGA 1I2PA 1DVJA 2HZGA 3AU2A 3WMCA 1YRRA 3W4RA 2J24A 2DZTA 2GGHA 1YKWA 5M17A 4DJED 4H8NA 4RE4A 3BLKA 4C6FA 4EPBC 3PB0A 3KRZA 1KCLA 1E4LA 1Q2RA 3W6MA 3B8WA 1A5KC 4QJ1A 2AMGA 3LXCA 4DJFA 2XDFA 1OX5A 3SR7A 2VRKA 1EGMA 2J25A 3GBDA 4WY0B 3BAWA 2V9DA 9RUBA 1EP1A 2VZUA 4NJKA 2QJGA 2WZIA 4PTXA 4WIWA 1V7AA 4KWWA 3SAZA 4HYWA 2PTZA 3KWSA 3BMWA 3PP7A 5CZJA 3WCZA 5A6SA 3EB3A 2XVPA 3R1ZA 3QV6A 2QR6A 1BGAA 4GYPA 1SO4A 3NSMA 5FESA 5HR6A 4HZ8A 1J10A 8RUCA 4M7TA 3TXVA 5D04C 3V3WA 2E6YA 4R33A 3R7MA 1DWIM 3TR9A 5ABTA 1US3A 1RD5A 3AIUA 3IVTA 2DW7A 1CX9A 1HJVA 3LTYA 3T05A 1UD5A 4XSLA 2ZTJA 2FKPA 1TPB1 5DN1A 2O7QA 3USBA 4MAVA 1E0VA 1EJRC 4QS5A 1V02E 2V2DA 1P6BA 1TZZA 2XN0A 2Y6ZA 3N25A 2Z26A 2AQOA 2OTDA 2P76A 1ZAHA 4TU1A 5FJRA 1U1UA 4E0CA 1DJGA 3QZ6A 3CUHA 3U4FA 1BGGA 3O0FA 5LHEA 2X41A 4F2TA 5I23A 2EAWA 2GJRA 2QW5A 5C7VA 2BBFA 5A3HA 3LRMA 1LOQA 1G4EA 2VD9A 1KV8A 2OWWA 1DJXA 4PRWA 1CLXA 2HS6A 4YS1A 2VYOA 2EHHA 4Z1AA 2W63A 3BAJA 3VIFA 4IP7A 3D6NA 1EO5A 3RPDA 1CW2A 3TU9A 3FSUA 1ONXA 3FVDA 3BLOA 4H9XA 2J8GA 4UWMA 3LMZA 4UCGA 3FDKA 1CPUA 2NLYA 3VU2A 1D3CA 4Q4RA 3VKJA 5KZMA 1Q6EA 1D9EA 3PJXA 1S3HA 3A4XA 3M0LA 3S1VA 4TUFA 2UY4A 4OE7A 2FFCA 1EGVA 2VEMA 4O18A 3KEHA 2NT0A 4K3ZA 3Q45A 1THFD 5CPNA 3U0HA 3VMOA 1VEOA 2ZDSA 3M0YA 2R1LA 1T41A 4FNQA 3QC0A 5FJUA 4QISA 1B90A 4LY8A 5EBAA 5HMSA 3IRSA 2J79A 1QOQA 3VCCA 5M03A 2XFFA 2AAMA 3NL6A 5AC6A 1VZWA 4XBJA 3BAKA 2FZMA 2BX7A 1XIDA 3O0KA 4XO6A 1LTDA 4H41A 4JL2A 4HMEA 2J6VA 2VI0A 4PMJA 3OHMB 1F9CA 2YCLA 4GA8A 5LXXA 3UZWA 3WKZA 5J5DA 1MW0A 4OTKA 1J18A 2RKXA 1SJCA 2X7WA 3G3DA 2D2GA 4NZ3A 1JZ5A 1EJVC 3R43A 3O2LA 3NQ7A 4ERAA 1CGWA 3CPRA 1N7KA 2HRWA 3H55A 1AD4A 5AHMA 6TAAA 4JKLA 3BE7A 1SSGA 3HFTA 4EWND 4DBDA 1TR1A 3W83A 1YPIA 5F2IA 3S2NA 1JCJA 2VUNA 3L5MA 1KLZA 3DC8A 3KX6A 3SECA 4KEUA 2BY3A 1R3QA 3LS9A 4PBEA 3TTEA 1PVNA 2GVYA 3CEUA 1SZGA 2JF7A 1YW1A 4Z1YA 1NFBA 3W1XA 1A0CA 3RXZA 3TYCA 3UGRA 4IPJA 2CBIA 1TWDA 4KIEA 3CT2A 1XC6A 3S2CA 3P60A 3WFZA 1UZ4A 4DF0A 2CZDA 2FMOA 4NP7A 3CUZA 4Q4PA 1FWAC 1QNQA 1UB3A 1DJIA 2WKLA 4TX9A 2Z6JA 2CLPA 2HBXA 3W81A 4XIAA 1RH9A 2QCDB 3IGUA 3B9AA 3VM5A 3SRFA 2XZ7A 3NQVA 5EMLA 4LUTA 1JYXA 4NZ5A 2IUZA 4GUGA 3EDKA 5H8UA 3W1AA 3D3AA 2DH3A 2POZA 5XIAA 1WDWA 1XIBA 1JIBA 2E8ZA 2XZ9A 4CCEA 1W56A 1GG1A 3STGA 4H8UA 3PUDA 1K4GA 1XIJA 2INFA 5GJPA 4F79A 3E0LA 3TAKA 1ME7A 4WLCA 3G6MA 2CLEA 1W3KA 3LCWA 1DBTA 4A3RA 3D0CA 2OGJA 3GX9A 3GTXA 1OQFA 4DO6A 3OGVA 2BSLA 1CENA 1W2VA 9XIAA 2XFRA 4G1KA 1UZ1A 2NSXA 2XJ7A 5L9FA 3G1RA 3CWOX 1F61A 2YB1A 4GBUA 3WH8A 2J9YA 2J8FA 4ONVA 5TBOA 4RE2A 1EXBA 2JKPA 3W7OA 3TNOA 2TODA 2W4XA 1WZLA 3BCFA 3EKZA 2E7FA 4NNBA 1X96A 4JTFA 1JAEA 3LHYA 3IS4A 3M47A 3VE9A 3GZAA 4IHCA 5DXXA 4M6VA 2Q8XA 4RW3A 1TCMA 2VX5A 3FAWA 3NWRA 3H2CA 3RX4A 4K8EA 4IUGA 2V38A 1YHTA 3UWQA 5AVHA 5H1WA 3KE0A 4ZB0A 4ASTA 4B5XA 4ZTYA 4D6DA 5HAOA 2I9UA 5I3IA 2HK0A 2HTMA 3CMJA 2PBGA 4FLQA 1BVZA 1BF6A 3UFYA 2AQWA 3G0XA 3L5AA 3SZ8A 3MCOA 1MSSA 4JIRA 3MHUA 5EGRA 4XUGA 2R94A 5DRIA 5D2TA 3TYZA 2NV1A 5BRPA 3CT7A 4JHMA 3AI0A 1LZOA 1H4PA 4JIIX 5CQ1A 4CVUA 4UIOA 4BF5A 4QRNA 2IKGA 4QJ4B 4PC8A 4DWSC 1VFFA 1G6CA 4I9JA 2WVSA 4RCXA 3C3NA 2FZ9A 3OB8A 1XLFA 1OK6A 3AMCA 1KXHA 1TWSA 2VGBA 4IFOA 4Y9PA 3AIBA 1FXPA 2IPJA 4R9XA 5BZAA 2F6XA 1R38A 4GX9A 3S2MA 3PULA 1UP2A 4MNJA 5A8OA 2A6LA 1XHGA 6CGTA 4PEKA 4DQWA 2WB5A 1AQHA 2REQB 1CLVA 4LTSA 1XIHA 2OSWA 3RITA 3S6DA 1RCXB 3EMQA 2CLFA 3DBNA 3TNBA 3IJ7A 3VVGA 3AALA 4H6EA 1FHDA 3OTRA 1VFOA 5DBUA 1MQPA 1J2BA 1GOMA 4JEQA 4YYCA 2WK2A 2OWCA 5TAOA 4K7YA 3AIVA 1SJDA 1VF8A 4A35A 4J3UA 5XIMA 4D6HA 4HOWA 1UA3A 4N9CA 4R27A 3ARQA 4JN6A 1L9WA 1GQKA 2PF0A 3DERA 3UNDA 5A8MA 1B57A 4EPDC 3CM4A 1EHNA 4E2VA 1DTUA 2EJ1A 4PBFA 2XN2A 3MJMA 1O4UA 4A05A 1WBHA 1KXQA 2VP8A 1W3IA 2CZ5A 5KTLA 1D8WA 4L9ZA 3CB3A 4DY1A 2NWRA 3BSHA 4L80A 1QO2A 4GY1A 1RCQA 5EB8A 2G3IA 4BF7A 5FACA 2QDDA 2X7VA 4DBSA 3BK0A 3KCLA 1KM5A 2YBUA 3TSMA 1E4NA 3GNPA 1W54A 1CXLA 2IKHA 2FHCA 2PF8A 4TVUA 4XZNX 4C5YA 2J9ZA 3ZXWA 1XCFA 3ZT7A 4TTGA 5LGXA 1HGWA 3B03A 3WX7A 3QPYA 1K70A 4Q8WA 3WLNA 4NI8A 1ICPA 3UJ2A 2GQAA 4NZ1A 1VP5A 1DIKA 3RUBL 3WBYA 2Z24A 1XFCA 2PDWA 3QM3A 2FVKA 4CNTA 1EDTA 2FPYA 3UR8A 1UWTA 1J0ZA 1SGJA 4MHBA 3QEZA 4W5ZA 4Z1CA 3W7DA 5TIMA 2Z25A 4HNTA 3VGBA 4M1BA 4NAFB 3Q2DA 3OQ8A 2HV5A 4QX4A 3TYDA 1OGGA 2IMRA 1JCNA 5HXMA 3W2JA 3KBVA 1V3MA 2A5HA 5AY7A 3B9OA 3VDHA 2EPNA 5CJNA 3PJUA 5GQBA 4KCTA 1ITUA 1JDDA 4ML4A 3EEGA 3AZSA 3O6YX 3SCPA 1AJ0A 4ZQRA 3CTTA 3R25A 1FBAA 3SUSA 1PKNA 2WLZA 4E4UA 3NO3A 2DT3A 2X0YA 3MQTA 3PZUA 3LV6A 5K9CA 4NNAA 4XBKA 4INFA 4YJ5A 4DLFA 1XBYA 9CGTA 3ARRA 4UTKA 3BL3A 1U1JA 4E38A 1SR9A 4HHHA 3HPZA 3QXBA 3KBJA 3D47A 3DECA 2CITA 5I02A 4AZIA 3KW3A 4GG9A 3G8RA 5ABEA 3WL1A 1SFLA 3IJLA 4DXKA 2CYGA 4RDVA 1H61A 5CJMA 1B54A 1T8XA 1F76A 2DZUA 4O52A 2QKFA 3TA9A 4EPKA 1OYCA 3TW6A 2GL5A 3PBVA 3UW6A 3P0XA 2HE5A 4AVOA 1A49A 3EWCA 2WMIA 3JUGA 3CV7A 1AUSL 4UNKA 3SSZA 3OBEA 3LXBA 4OBTA 1TCDA 1Y5WA 1FWIC 4OOZA 4MB5A 2PLMA 2JIWA 1GZJA 1GPFA 1U5VA 3EX1A 4DVOA 1XD1A 3G18A 1ISXA 1DWFM 2WC3A 3DBPA 3CZLA 1S5NA 1GJPA 3R5EA 1HO1A 1L6YA 4MPQA 1IZKA 2VURA 3UZZA 1OGBA 5LA2A 1PX8A 3WLMA 4J4KA 4LVDA 1R9XA 1NOWA 1UR4A 3G0UA 4L4PA 1EFZA 2DVXA 4ZODA 4CN4A 4G7EA 2YXXA 1Z7AA 2J7EA 3EBVA 4LF1A 1W1PA 5C9UA 4H7VA 2XUCA 4WUIA 2PS2A 3ZR6A 2ZUWA 1XG4A 4PMYA 4GFIA 1DV7A 3C86A 3TSDA 5FF0A 3TROA 1F3EA 4GOAA 4Z1DA 3FN9A 2GGIA 1E0UA 1Q6RA 2VFHA 1ELSA 1HX0A 1G4PA 1FA2A 4O0KA 4R7WA 2PLCA 2ISSA 3PC0A 5L6UA 3T0CA 3W7LA 3PY2A 4JGDA 1HXJA 3W9ZA 2Z2AA 1VBHA 3A3XA 3FX4A 1BEUA 3PHAA 3G3MA 3QHMA 3BDKA 1V5XA 3CIWA 1W3NA 2D3NA 3O07A 5GNZA 4BQ3A 3L5LA 3TIMA 4X0NA 1GJUA 1TG7A 1OCQA 4GIAA 1E56A 2FVMA 3UA3A 4FXSA 1H1ZA 3L4UA 2XIJA 5HNUA 3TJLA 4BQ2A 3LGDA 1W9PA 3ES8A 1TR9A 2PBOA 1MO0A 3L0GA 3M0IA 4C7DA 4C6MA 5BOEA 1DXIA 3RPTA 3PBYA 2XVKA 4J9JA 3IANA 4XZIA 1TV8A 2W61A 3ZJKA 1DPMA 2VOTA 2WW5A 2WVTA 2J88A 1OF8A 1OIMA 1SU5A 3LBOA 4ECLA 3VKCA 2C0HA 3EDEA 1T96A 4UQEA 1V51A 3GUGA 2A3AA 1CEOA 5BXPA 3QH2A 2XG9A 3RK8A 1K9TA 5T8GA 4UZSA 1V6UA 4Y9AA 1XYZA 4KBXA 3WDHA 1Q7ZA 1IV8A 3KTCA 1V79A 1MRAA 1JPDX 2FHBA 4ZO6A 4PUEA 2ZUNA 4EVZA 3HGOA 4IJCA 4MFEA 3H12A 1HW6A 1Z8AA 2E09A 2ZRUA 5HWMA 3WMBA 3UJEA 2YCLB 1K8XA 1J79A 4OGZA 2DSKA 3N2CA 3VNLA 4KW2A 2RUSA 4H2HA 3OZPA 1VENA 5A6TC 3CO4A 3VNJA 4WJ8A 1M7PA 1TX2A 1QOPA 4LAKA 3LNPA 4W4QA 3OBKA 1P7TA 1NY1A 4FX8A 3VD7A 1HT6A 1C93A 5CZ0A 3W7IA 5IHSA 1MFUA 2WMHA 4LPCA 1V4YA 1UD8A 2YCJA 1MMFA 1S2UA 2WJFA 1KV5A 4AXNA 1XBXA 1UW9A 3MJYA 2YFNA 2PGRA 2V3DA 2ACSA 1BYDA 5C8BB 5PTDA 3U6WA 1GVYA 3AHZA 4FXFA 3QFWA 2C3ZA 3BGJA 3WL0A 3VOGA 1WX0A 3WD1A 5CEWA 2YBTA 4S39A 4I8YA 4QTGA 1GHSA 3NQGA 1HFBA 3STEA 1F8IA 4M51A 1FH8A 4UTMA 2DU2A 4QQUA 1RSCA 4LRTA 4LUTB 4KEZA 2ZYFA 2FFIA 5AECA 3FXYA 1WKDA 3M9YA 4C6LA 5B7ZA 3MI2A 1ICSA 5H91A 4B15A 5D9PA 4Z0SA 3VI2A 1E3XA 1CT5A 3PZOA 3NO1A 1KB3A 3R6IA 4AZBA 4O57A 4C6NA 4XB3A 2CKRA 1WKYA 3KAOA 3PSWA 4MY1A 3N4AA 1AW5A 3BJFA 4AIEA 3IIVA 2C1GA 1EZ2A 2ON3A 2VGIA 5D03A 3KBMA 3T8LA 1PWLA 4QG6A 5DY2A 1JG9A 1L8NA 1XIEA 4GINA 4J3TA 4NAEB 3PBMA 4GYPC 4Q7BA 1EF2A 1NF0A 1QRQA 2F8QA 3THCA 4S3EA 2WMFA 1HTIA 4DYEA 1K8YA 3G5EA 1NDVA 2FVLA 1LP6A 3LCIA 4JHZA 2G50A 1H1YA 3KHJA 3HG3A 4KH2A 5D2XA 3VD9A 2X2GA 4GGBA 1A80A 1MWOA 3MU7A 4UB9A 2PMQA 1VFHA 4KT2A 4JR5A 5IRPA 3ARYA 4BF9A 1ONEA 4YVPA 4FNRA 1WO2A 3MI6A 4NSBA 1M41A 3MSDA 3IAPA 1W1B1 1NWRA 3C52A 5AC5A 1GZGA 3NIYA 4GABA 1GHRA 1TELA 4W93A 1M01A 3UZYA 3NQMA 1EQCA 2QJNA 3UETA 5HQEA 1NSJA 3VNIA 1NU5A 3GVVA 2F61A 1NH6A 4AHOA 4KRTA 1PX3A 2CKSA 2Q01A 2GVGA 3EX3A 2EG7A 1EF3A 3H2EA 4PMXA 3HB9A 5F2LA 1VJSA 1R3RA 3CHVA 1L6FA 5JUVA 1YTEA 3GFXA 1DJQA 4LC8A 1Q4NX 2D20A 4K36A 3B9NA 3HPXA 1W1YA 4TMCA 1AA1B 1W32A 3GR4A 4YIWA 2VRQA 2WNZA 2CERA 3IK4A 1PDYA 4J2MA 4K8GA 4A22A 2DSVA 4S1FA 5CC6A 4C91A 2ACUA 4ATLA 4IIBA 4QIUA 4EK7A 1GTHA 1XLKA 3GVGA 3FNDA 4LCQA 3TEVA 4XKYA 4B5WA 3IARA 4Q32A 1XDJA 2O4MA 2F2KA 2VEIA 4OQVA 1DJYA 3BZJA 1HJQA 2FJKA 1R8LA 2YL6A 3HZ3A 4CD5A 1C3FA 1QCWA 2E6DA 4HNNA 4MDOA 3PFMA 3S42A 5C5YA 5FSDC 2FGBA 1XH0A 3WF2A 4AZCA 4J28A 2Y5SA 2WKJA 4A8LA 4AWUA 3CHCA 3PPGA 2ZXBA 2NQ5A 2BXYA 4BZYA 2OEJA 5IFTA 1X39A 1EX5A 3G1DA 4P61A 5AHLA 4L4MA 4HK5A 4U4MA 2QULA 1Y65A 4AD1A 1GYLA 3UZJA 1BYAA 4E8GA 3KDNA 2EG6A 3EB2A 3CPGA 1ZJHA 2HQAA 3QW3A 2QXWA 3ABSA 1BWVA 4NYUA 3LLFA 3ABRA 3NNTA 4YCPA 1HJUA 6ALDA 3EOLA 4C6QA 1GKPA 4PODA 3W23A 2WNQA 4S2CA 1VCFA 2DUXA 4LGXA 1H7XA 3QSRA 4B3LA 3UVAA 2QHAA 1QWGA 4JN8A 4BCEA 3TX9A 2D73A 1ZCOA 3OLEA 3T44A 1H60A 1UOZA 3TQVA 3LTSA 3SJNA 1TPUA 5MHBA 2ADAA 4N4QA 3RR4A 3QOKA 1ZP4A 1A4LA 1LQAA 2B31A 4LEFA 4QXIA 3VDBA 1LRQA 1Q66A 4L64A 5EFFA 3T0BA 1ONRA 2YSWA 4HA4A 1GQJA 1A53A 1BPLB 3WMSA 1D7FA 2O4QA 2OODA 3GG8A 2J78A 2QUUA 2VZOA 3KS6A 4JTQA 4QGCA 3GYEA 2XGZA 4FNSA 5D4YA 1Q2SA 3F2CA 4LCSA 1EUNA 2ALDA 5IXEA 5HNRA 5AFDA 3VD3A 1XYBA 1EKOA 4XV0A 4IX2A 1HP4A 1W3TA 2HMCA 1M6JA 4ML9A 3LGGA 3TTSA 4I9MA 4JICA 1EL3A 2ZZ3A 1YXCA 2ZZ1A 2CU0A 3EOOA 4QEEA 3K46A 1PWMA 4N9DA 3CAVA 3EWUA 4JTLA 5E9XA 1BYBA 3SCUA 1QNRA 1V6YA 4IQLA 3FHAA 3M0XA 4GI8A 3GR7A 3P67A 2ISDA 3TQ0A 4BA0A 4FOUA 3NYZA 3K8LA 3WJZA 2Y62A 3JVAA 1HL8A 4AQLA 4DLMA 3AYRA 4H7CA 1GWJA 1F3XA 3OZYA 1P0BA 3WZ0E 5F2GA 4JY8A 3WLQA 2OKTA 1KFBA 4CNOA 3W74A 2PP0A 4IF2A 1JNEA 4YYFA 5KEZA 4MUPA 3EA1A 2V3EA 5E6YA 1U33A 2AMXA 3CQKA 2ATMA 8A3HA 2C18A 3DAQA 1KM2A 1DWJM 4O0ZA 3ORWA 3VABA 3KZSA 2B7QA 3PAOA 4B91A 1P43A 4KESA 2WMIB 3NVDA 3G22A 1WDPA 1EZWA 3QF0A 3GG7A 1S46A 3ICJA 1Q6QA 4OU1A 4U10A 2C6QA 2DUZA 2V63A 2HNEA 3OO2A 4LBSA 3RF9A 1F6PA 3QOMA 3CL6A 2ZDRA 1JZ7A 2PWVA 4DUWA 2GJXA 3WH6A 4P7LA 1CXKA 3VC5A 2OSYA 3PSVA 3I4EA 3RJYA 1I9CB 3C61A 2CWXA 2VNCA 3MKVA 3K4AA 3E9AA 4RZBA 2A3HA 2VC6A 2QMJA 4A3YA 2WKGA 1QASA 3QQWA 4KFNA 2A21A 4TO8A 1E6SM 2ZKMX 3S2LA 1FDJA 1MEWA 3ALGA 2WXDM 3ANVA 4JKMA 1Q6OA 2BY1A 1KKRA 3WBWA 4BEQA 2YCIX 5AKQA 3WBEA 2OLAA 3NDZA 3M16A 1EH9A 3WQFA 3RX3A 4HVXA 4IL0A 1LRTA 4IMFA 4UFKA 4F0LA 3M5ZA 1ZFJA 2Z1BA 4R5EA 4IQEA 1E3ZA 4K1GA 2R1PA 3EGJA 3ONCA 4PTDA 1FCBA 4GE8A 4K8HA 3T2PA 4LBRA 1AZ2A 4H01A 4DBUA 2OZ0A 3QKEA 2RDXA 1I8JA 1WDDA 3HQ1A 1IEQA 1W1IE 3H7RA 3K4WA 3N18A 3UESA 3VOCA 3MO7A 1W8GA 3SB0A 1XRVA 1F07A 1OJXA 1S2AA 2FGZA 4W5UA 1XSKA 3NM1A 2ACRA 4G7FA 3W1RA 4NU7A 4ZB5A 2YW4A 3KOFA 1SPQA 4J3SA 4QQ3A 4GMEA 1C91A 1JUKA 1G4SA 3N34A 2E77A 1QBAA 1DWAM 7ENLA 4XK2A 3L67A 1Z6KA 2VL4A 2OGYA 1VD6A 2R8WA 3W7GA 1GPWA 3CYVA 4XISA 3WQGA 1GVEA 1VJIA 5KETA 1S5VA 1PZ3A 2YB4A 4DPPA 2RHGA 1Y5XA 4D8AA 3QLDA 2MANA 4H04A 2IKIA 1RP8A 3R0DA 4PUDA 3DOPA 4MUZA 4W86A 5HUPA 1E1EA 3VOJA 3NXFA 4LBUA 1XYMA 4WKFA 1H7PA 1ZSXA 4NZ4A 1IXNA 4FMVA 4OJYA 3CH0A 3NQ6A 6PTDA 2BGQA 1OZMA 4O28A 2V3FA 4E2DA 2QJMA 1WOAA 2CLHA 1S2TA 4RV3A 3LGEA 1E9LA 2VWSA 3B97A 3LV5A 1ZHAA 1XLAA 3M0KA 4MLRA 4MB4A 4XD4A 3RG6A 5AYYA 3VDGA 4GKLA 4HU3A 4KQNA 3B9EA 2PDQA 1PZ2A 4C6DA 4RXGA 1KFKA 3GFZA 3S1WA 1QDSA 4GYKA 2OO0A 3QTGA 1XLJA 3IGSA 4YTQA 2VCAA 3S4TA 3W84A 3S5OA 2FPVA 1AQFA 4GCAA 2ABBA 1Z9AA 2OOGA 1K77A 2VR5A 5G5IA 2YA0A 2PE4A 3JZEA 3WELA 3FKKA 3GG1A 4O19A 3TYUA 3FHQA 2CC0A 3HG5A 4FF5A 3REQA 5E6ZA 1GEHA 4PMOA 3SGZA 4UFMA 4WZHA 3VD5A 1FTXA 3ZQ9A 1JRCA 1TZ7A 3WNOA 2X1SA 1O6IA 1F73A 4XZHA 2QCFA 4O13A 8CGTA 1FP9A 1CXEA 2G8ZA 3BGAA 3M43A 3VM7A 2AOSA 1R3SA 4ATDA 3EA3A 3ITVA 3AXIA 3P5YA 1LM1A 1T99A 4US5D 2GOKA 3N14A 1EXPA 4QDPA 2VEKA 1QNVA 4D72A 3B0YA 4KFOA 1ZBKA 2ZXDA 3AUJA 2J7FA 2Q8LA 3U2CA 7TAAA 4N6FA 3MSYA 5LIWX 3GC5A 3UXDA 3G1FA 1F4AA 4C7FA 3GH5A 5EMUA 2HNHA 1G94A 3ZVHA 2PB1A 3FYOA 1GW1A 3SQMA 3OZMA 1DE5A 1ALDA 1YEYA 3Q65A 4EXQA 1TTIA 3SN1A 1V6TA 5D30A 5MKGA 4NJJA 2J7CA 4UTLA 1QW7A 1AH4A 3B0PA 2NUWA 2VTFA 1EO7A 2SFPA 4MAZA 1I1XA 3MB9A 3THQA 4AC7C 4IP4A 3N29A 3W7CA 1E6QM 1LWIA 4LUSA 1CBGA 1KKOA 1R5YA 3RCMA 2X42A 5DXYA 1TA3B 1QPQA 1HVQA 3TSBA 1BG9A 1KTNA 1UC4A 4F8XA 3LCFA 3OZOA 1LWHA 3W24A 3N2MA 2ZX8A 4OT7A 4FALA 1V6VA 3APGA 5EBUA 2XN1A 4OVXA 2WYSA 3EMZA 1WZKA 4Q4SA 3GU9A 4A3UA 1H3GA 3MKCA 3MPGA 4B5NA 5HR7A 2IXVA 1X1NA 2C79A 3UCQA 3VE7A 4AEFA 4LU0A 1SFJA 2FIQA 1OINA 2HJPA 1Q45A 3CLWA 4QNEA 3EDJA 3DN5A 3O06A 2PU1A 4CQBA 1BVNP 5BOFA 4H1ZA 2HS8A 4JNMA 3LHUA 3VAVA 3GHRA 2CBJA 4HIBA 5JBEA 1JPHA 3L0KA 1V0MA 3HO8A 3MYPA 3TC7A 4AD2A 1F6YA 4O4WA 3UU0A 4DNMA 4DYKA 1VPQA 5CSYA 5KMYA 4JTCA 1X6UA 3DG6A 1ADOA 2OG9A 2TPSA 2AL2A 3M0HA 3T07A 4IJRA 3EWZA 3G2GA 5I3DA 4LWWA 5EMKA 4ZTXA 4HPXA 1E40A 1TRIA 3AQUA 3PNUA 1FCUA 3HA1A 1M7OA 3NO5A 4JQAA 3VKDA 3ZZ1A 1DHPA 2OX4A 3ZOAA 2NQ9A 1HQTA 3N2BA 3SEPA 2R14A 1P0KA 2E9BA 4C90A 1PCKA 4UMCA 2C16A 3C0SA 5AYBA 3PS7A 2BOGX 3I3BA 4GQ0A 2PURA 2YIHA 3GDBA 5FA5A 5DQPA 2P88A 4HSOA 2CFFA 3M6DA 3KTXA 4Q7NA 3IEBA 1DEDA 4D6JA 3Q58A 2VFGA 5FJJA 3WIJA 4HSNA 4AU0A 2OT0A 4M82A 4NZFA 2ZVIA 4ALDA 4GI6A 1NEYA 4PUWA 2HVMA 2DDXA 4Z08A 2VCCA 1VBRA 4P7OA 3WD2A 4QNWA 2X1UA 1KFCA 3S8HA 3L0NA 1TV4A 5BXSA 4AZCB 3HBLA 1S2CA 4QS6A 2GSJA 4IMAA 4FA3A 1B30A 1OCJA 5EYWA 1W6TA 4OUIA 1ZLPA 2DZBA 1JYNA 1UYQA 3GNNA 2R82A 3GXIA 4B5SA 4JY9A 2ISWA 1K02A 1VAHA 1E0XA 3GD6A 2BZNA 4YCOA 1RALA 4DAFA 2OWXA 5BRBA 1PPIA 1IWPA 1OFOA 5LA0A 2OEMA 3WYZA 1HL2A 2QAFA 3AFBA 5BNKA 3R8GA 4WD0A 3AOFA 3E0IA 3AIRA 4B2DD 1CB7B 3U4AA 3MCMA 3NPUA 3JU2A 3OIXA 2G37A 1UIOA 3HGJA 3WMLA 3CUFA 4O4VA 4MIMA 3HG4A 4WXZA 1EJWC 3AMLA 3UXLA 1GONA 4JX5A 4LALA 1WXYA 3TH6A 2BG5A 3A4JA 4HU8A 4DN1A 3U9IA 5C54A 3IAQA 2Z1WA 3W38A 2Z7GA 5LIXX 1R6WA 1B9ZA 3GXPA 5T91A 5HQMA 3O05A 1NELA 4Z1BA 1ZL1A 4DJEA 1EYEA 5HUOA 3HMCA 4QFUA 3SW6A 3VX0A 4S38A 3VUSA 2CCRA 3WLPA 1W3JA 5TNVA 4J1OA 4ZOAA 4OV4A 4PYSA 2FH8A 2JGYA 1FWWA 3W2UA 3MP4A 2GPTA 4NQ1A 3TZFA 3ARUA 1R3WA 5HINA 2I5IA 4P8XA 2OU4A 3B04A 4Q4QA 4D6EA 4XAPA 1OX4A 2JK2A 4I9AA 2FJUB 2WSKA 4PSRA 1M3UA 1XH2A 3ME3A 2UZ9A 3EOUA 2ZOXA 2WNNA 5BYWA 4H8HA 3EYPA 1F05A 2I14A 1UKQA 4LYKA 3H2MA 4UR9A 3DU0A 1EB3A 2W6RA 2DORA 3QV7A 5HATA 3H2AA 3EOEA 3MC5A 1KRCC 4G1NA 5A6JA 4HKPA 1ISZA 4LT9A 4F0MA 3URNA 1H7NA 2QV5A 1E0TA 4MKVA 4WR3A 4NY2A 3MUY1 1DYSA 5A2CA 3H26A 4ACZA 4X22A 5I77A 4H2CA 3ATZA 5A6MA 3ABXA 1UH2A 5B7YA 1FHLA 1OC5A 4QE4A 5TF0A 3W28A 2QVHA 2XH2A 3GNOA 3DHDA 4WCJA 3GR8A 3HGSA 3GHUA 2GZXA 4OIFA 2WMGA 2PC8A 3PTDA 3DYPA 3H7VA 3JZUA 4DPQA 4GZJA 2VR2A 5DO8A 4KEVA 5FF7A 3S9YA 3LOTA 4B9ZA 4MZ8A 4RNHA 3SBFA 1Z69A 1AJ2A 4LQ1A 4K37A 4JDBA 1VYPX 2CHNA 2PP1A 4F0HA 2BVTA 2GSHA 3L9CA 4EP8C 3EZ4A 1Q65A 1BWLA 3H4XA 2VUYA 3WK0A 4QEHA 2GJXB 4RK8A 3EX4A 3UVIA 1JI2A 2Z00A 3JR2A 1X7FA 4R53A 2EQDA 2WNWA 3W73A 3NM3A 2NQLA 1MNZA 4ZCWA 4REQA 1IR1A 1FHUA 1M65A 1LQ2A 4CNSA 4XVEA 1VCVA 2VFEA 4OV9A 1EC9A 1D2KA 3UR7A 3WLKX 3W1NA 4L1WA 4UUIA 4ZSUA 1MVYA 2DQXA 2ISVA 4GZ7A 3ABZA 2V5BA 1GOOA 1KFEA 1QNSA 3H70A 5LNUA 4Q33A 4LRSA 1EJTC 1IWBA 1SM9A 1E5NA 2VFFA 2PGWA 3UG8A 2VQTA 4Q7IA 3GK0A 1V3LA 3S5NA 1V3JA 3GC2A 2A2IA 3W53A 1TJPA 1A5LC 3FA3A 2IQ0A 2BASA 4U2ZA 1AW2A 3QBUA 3VKKA 3ITCA 4QE5A 3LPPA 5CPTA 1EP3A 3GU2A 3LSBA 4O1CA 2BXZA 1Z89A 1G7UA 3B8VA 4MWAB 1TQJA 2G41A 1H5VA 3A3WA 1PSCA 3PFRA 3TJXA 4RPQA 2OQYA 5FOOA 2VRJA 1CI1A 1E72M 3E5BA 4HCHA 2G3NA 4QG8A 3RRXA 1A4MA 3U7BA 4R3UA 4A3QA 4ZQNA 4DJDD 1G9HA 3T7VA 4BR1A 1X1OA 1LOLA 1JDFA 3A13A 5C9ZA 1LBFA 1XLDA 1KR1A 1XYLA 3PUEA 5DT7A 3F2DA 1UP3A 3UT0A 3T9PA 2CEQA 3CUGA 2WOQA 3BPWA 2JKAA 3BLIA 2D22A 1TIWA 2UWFA 3HQNA 5F4WA 1YX1A 3B8IA 3UCCA 1RJRA 5HWNA 1JCXA 4W8AA 3B8DA 3QN3A 1ZJIA 4XKMA 1FWNA 1UKSA 1JPIA 3NEVA 2PPGA 3B8UA 3BC9A 3O6AA 3L4XA 3QGVA 4GVGA 3GH4A 1BKHA 3PZVA 1PIFA 1L6GA 1LYXA 1AMYA 2NUYA 4MWAD 2BVYA 4F4RA 3AZRA 3IJ6A 4AEOA 4FOKA 5GNYA 1VBGA 4JPGA 4AXKA 1KC7A 4WSKA 5CPLA 4B9YA 2XIQA 3WQOA 3C5QA 1J93A 3TOYA 3M0VA 1UPMB 1YNYA 3QHNA 4EE9A 1Q8JA 5DLCA 2WMJA 1JVNA 4HTYA 3REQB 2XVLA 2ZC8A 2QEZA 1QUMA 3HV9A 4N4PA 3R2GA 5HJLA 3UCDA 1Q8AA 1S3TC 4PMUA 2UV8G 2J62A 5C9XA 3WLTA 4X9SA 3OQEA 1RQHA 4L5ZA 4ZFCA 4UOZA 2WJEA 1KRMA 1RY8A 4BK9A 2Y61A 3OLGA 5HMFA 1E6NA 3MUAA 3TOPA 1OFPA 5G4WA 2YGYA 4W7UA 1FHVA 2D69A 1CXIA 5AYIA 2WMKA 3GHSA 3HQOA 4F9DA 3LY0A 2WAGA 5D2WA 5M3WA 4MPKA 3ZVHB 2VX7A 4PTNA 2V8ZA 3IVSA 1UR0A 1JQXA 1B4EA 3M7SA 5CJ5A 2GJPA 4GISA 3OP2A 2GGGA 5MKGB 1A5UA 1FDZA 4GNJA 1SZRA 2OMAA 1IGSA 3ZLGA 2FQIA 3IK2A 4BI6A 1GVRA 4WKHA 4IQDA 1AODA 3CZKA 4ATWA 3U2EA 3VIPA 1KA9F 1XFBA 1Z42A 4LUSB 1NAL1 2ZUUA 1R2SA 2OEKA 1J9YA 1DWGM 1YQ2A 5H6HA 4LS0A 3AS2A 3KBWA 3UY8A 1T0OA 1NOFA 1XYFA 4PUUA 2JGQA 1TMHA 1GQNA 2Z1VA 2NVAA 5FF2A 2WPGA 4YTSA 1TWIA 1B2YA 1VJZA 5DMYA 5KZEA 2QJHA 1QMLA 3RNDA 3BCJA 1JCMP 1JRBA 2PFHA 3CAWA 3BAXA 5A6AA 1ADDA 3W87A 1R47A 2DV0A 5E1QA 3WENA 4QJ5B 1XUUA 4ZSTA 2OJPA 2Z1XA 1KD0A 2BHYA 2I17A 2YXGA 4V1XA 4O17A 3A4AA 4DRSA 1XQLA 3WJWA 3V0TA 2Q09A 3TVAA 1X38A 3R8HA 2V5JA 3APTA 1K8ZA 1PV8A 4CGTA 1C7TA 3DUGA 4HOXA 3KCOA 2V5CA 3S2JA 3H21A 3TV8A 4AC1X 2BGSA 5I3KA 3GTFA 4LV4A 3W7NA 4AEEA 5FL0A 5A8NA 5D09A 2ZE3A 1UUMA 4P5UA 2WHMA 2PWEA 2J27A 1OFBA 3ARPA 4JNZA 3M46A 3CQIA 3M7WA 1E6PA 3IRDA 4M6PA 5D9MA 3CHDA 3SIZA 3BWWA 1PTGA 1LWJA 2O9RA 1EHAA 1ZGDA 4V27A 4KGLA 1PHWA 4DUOA 2AL2B 1FWCC 3UJRA 2PGEA 1JJKA 1EA0A 1E4MM 3N6JA 4DWDA 5I00A 3LI1A 1C29A 4M6UA 4G6CA 2E6FA 3IJ8A 2BY2A 2MNRA 4N42A 2PLKA 4KF1A 4EXAA 1LT7A 4LYRA 2C71A 3WJXA 1HKIA 4PEEA 4FR1A 3TAOA 1QAPA 1TKKA 3H2FA 2XSXA 3LMYA 4JTKA 4IISA 1F7BA 2HISA 2XWDA 3O6CA 2EF9A 3T0DA 1C8YA 1XINA 3LBCA 2E9MA 1O68A 1UKOA 3UA4A 2GVEA 3RM4A 2KAUC 4GZEA 1Q13A 4JYDA 1QW8A 3ZVIA 1YE4A 4HTBA 3MW7A 3A64A 1QW9A 2V2CA 2W66A 3VNZA 4GX8A 2G5WA 5DRCA 4Q8MA 2W5FA 4RNJA 2V6AA 1XICA 3F03K 3WBAA 4Z2GA 4O50A 2PGFA 4M81A 4DAIA 3VNMA 1S38A 2CETA 3P93A 4JIEA 3UWEA 3LN3A 2J8TA 5AOUA 4RZ5A 1RBAA 4QAIA 4IPLA 4GQBA 2G4FA 2CIPA 3SJ3A 4HZ7A 4KWUA 3OVPA 4D6IA 4B5UA 1XS2A 2X40A 1KBJA 2UY3A 2Z4GA 3H54A 5CZKA 3LLDA 4QITA 3AHXA 1B4KA 1WDQA 2XGIA 3N11A 2ZXAA 4KS0A 4MVAA 5M1TA 3VXGA 1S1PA 1FWFC 4H00A 1GQLA 1RK6A 3NEHA 4F66A 1GKQA 5HOSA 3WK1A 4LYQA 1IGWA 1EEPA 3UPWA 3T81A 5LIYX 4YTRA 1RA5A 3F7JA 5I5RA 1TPH1 3EWDA 4NXSA 2EPOA 3TYEA 5CG0A 1GQIA 4L9XA 4MGGA 1GVIA 3NL3A 2W67A 3UZ5A 4PUNA 1G69A 2YDAA 3GTHA 4FEZA 4H9MA 3SSJA 4U33A 3NQFA 3QTPA 5B80A 1YPFA 3SQLA 4XTDA 2X0SA 3N15A 1MQRA 3QGAC 3WFLA 4ZBCA 1KRAC 3JS3A 3WQ6A 3QKZA 3SFKA 1TPFA 1KM3A 3M0JA 4AY7A 3IJQA 3FCPA 1OX4B 3NL5A 1EC7A 3M5YA 2NWSA 4JOMA 2VCBA 3UJSA 3P6LA 3D5HA 2OPJA 1ODUA 3F4CA 4NZJA 3SDOA 3PTMA 4ZO9A 1WBJA 1XISA 1A0DA 3L4WA 1WA3A 3VIMA 3WNPA 2VFDA 3E02A 3OODA 4ACZB 5FSEC 1X7IA 5D32A 1XIMA 3N19B 5A69A 4JFSA 4R7OA 3KUMA 5LNSA 3FSTA 3P74A 1MDLA 2DUAA 4WDTA 3CZGA 3KRUA 1DXEA 3DFOA 4X3ZA 2ZRVA 2FZ8A 1E1FA 4WSJA 3A12A 2OR2A 1FWRA 3J7HA 2ZZ6A 3TC3A 4JQ2A 2Z2UA 5CKSA 1J5TA 2XVGA 4RV8A 2EXOA 1DQUA 4DI8A 4B5VA 3GC4A 3WBXA 4WJXA 1V08A 4JX6A 5CBBA 2W92A 1M7JA 3T55A 4HPNA 4JNYA 2BNJA 3L2IA 3S6TA 1FWHC 1FCVA 2VGFA 3WUFA 3AYVA 2FTYA 3KRBA 4CKQA 1CGVA 1UWQA 5KSWA 4ZENA 4S3KA 2PTWA 5A2BA 3O7UA 2P1FA 3ALFA 3NQBA 2Z28A 3SCQA 1J8VA 3QQ1A 2QAPA 1HNYA 4REQB 4JTIA 5HULA 3AXKA 4W88A 8XIAA 3FS2A 2XIBA 2I1OA 1CXHA 3K5XA 1J6OA 1F6KA 1JUEA 4LF2A 4DF1A 3WF4A 3KWXA 3MMDA 1EYWA 3HPSA 3RHGA 3ERPA 3KL3A 1YNPA 3NAVA 4JQ4A 5AC7A 1ITCA 2B7NA 3G1HA 2W0UA 3G24A 2EG8A 2DSZA 3W82A 4EANA 4PCFA 3KLLA 5KITA 2HCVA 2XTKA 3TQKA 4I5RA 3PJTA 5IHRA 1F4HA 3TCEA 1WOBA 4AMCA 5C6MA 4PA8A 4MKNA 1T7LA 2PDJA 2JEPA 4KPLA 4LAMA 1P1MA 1W17A 1G5AA 1L6SA 3BAYA 2J47A 3U2ZA 1S5TA 3CB8A 2C7FA 1GCYA 2OSXA 4UTWA 1LCOA 1RBOB 1BD0A 2FZDA 3AHYA 4UFJA 5E70A 4Q8OA 3MWAA 2ZUSA 3BSMA 3HTWA 4D71A 2NV9A 3VDCA 2FDSA 4PRTA 2V0TA 4S3DA 1IIGA 1Q7QA 1BKSA 1ZAJA 2D0FA 5ENLA 2QZRA 2O0TA 2TMDA 1K7XA 1C90A 3O16A 1W3HA 1N2VA 4AX6A 4FSAA 1MRQA 3FV9A 2X09A 3G1XA 1HJWA 4DHGA 6ENLA 1K9FA 3VKAA 2QPSA 2XPKA 1DOSA 1E4IA 1ISWA 3TFCA 3LBMA 3WQ8A 4RX0A 3AIEA 1E5JA 3D46A 1GOXA 5E93A 4A6GA 1H51A 1CGXA 5F4XA 1CTNA 3R4IA 4JQ1A 1R85A 3PPCA 5FCZA 3AMGA 4RXFA 3VGEA 3SM0A 1Q6FA 3CV1A 3GG0A 2RDWA 3BJSA 5JQ9A 4UQ9A 4L65A 3CL7A 3NXLA 4F0RA 1PKYA 1ZBWA 1VFUA 4LC6A 6A3HA 1X6LA 5KINA 2HVNA 1OYAA 3SIMA 3MDWA 3O1NA 2R1MA 3LPFA 2OKOA 2GUUA 1UHVA 3FYYA 2H8ZA 4AD5A 1ZNNA 2FGLA 2JALA 5JU6A 4ZZ9A 3VOHA 4V15A 4US6A 5EU9A 3ITTA 2Q71A 1JULA 2QQ6A 5AC4A 2P8CA 3GW3A 5G1MA 1LG2A 1LLZA 1DJHA 1IZJA 1CGUA 1NM9A 3F2BA 4QE1A 2J13A 1TV7A 3MSRA 1TMQA 2PUZA 3WF1A 4HZMA 2VD8A 5CH9A 4Q4MA 1I75A 5U7SA 4IX0A 2NLIA 3CMGA 1YMYA 3KP0A 2DSWA 4O1BA 2VC9A 1SR0A 2GQ3A 1VR6A 3R0KA 2EBNA 3CQHA 1E9YB 2J7BA 2QDHA 1BVWA 3FGCA 5CLWA 1VRXA 3E2RA 2H8XA 3UGVA 1AL8A 1FKXA 1Q85A 1EPXA 4RZ4A 1F5ZA 3CGTA 1OYBA 4UQCA 3V0UA 1VCGA 4H9UA 5FAGA 1BTCA 1P5BA 2O55A 3TUUA 3MDUA 4XZWA 2BHUA 4NX0A 1SW7A 3ITXA 3W2LA 1J96A 4D8LA 4LV9A 4UXDA 2CLOA 2YCEA 4XZMX 4ZXOA 3V35A 4DUXA 4AZ7A 3M5XA 5EKYA 2YXOA 2PD9A 1XKJA 3VX1A 2PI6A 4FK9A 3F1QA 4ADUA 2Y70A 5BXTA 3K30A 2PZ0A 2BVWA 3GXFA 3KXQA 3WLLA 4L4OA 3P5ZA 3NR0A 3DHUA 3LRKA 1HZYA 1VH7A 4NNCA 4O8AA 3GRIA 5AZ0A 1GOIA 2NQHA 3MANA 2VC7A 2YBVA 3E3HA 4W87A 4JTGA 1OK4A 3VYLA 3OYXA 4TR9A 3H4WA 2TYSA 5CGMA 4H7ZA 3B4YA 3DHPA 3CL8A 2DZVA 5CAHA 1M04A 4LYPA 1OHLA 3WJSA 3T78A 3T09A 2ZWYA 1X6NA 3OVRA 4HA3A 5CLTA 4UMBA 2W91A 2D0HA 3VUPA 3IGHX 3IIXA 3POCA 1QPOA 3VNYA 2ZC1A 5HPCA 3P82A 1DORA 1BQCA 3UQNA 2OYLA 3A9BA 1BHGA 1U83A 5REQA 1W8SA 3GNXA 4NAEA 1TIMA 4MZYA 1HKKA 4Y90A 3QY7A 5G2WA 2WSPA 2VQUA 4PCTA 4UFIA 1XLCA 3SQSA 2PWDA 5HMDA 3PNZA 5AYXA 4UTJA 4UR8A 2OYKA 1QK0A 2E9LA 3DXIA 1I2NA 3WQCA 2W3ZA 4IGNA 4AZGA 1K8CA 4LEQA 3GDRA 1A3WA 3BW3A 3TP4A 3AS1A 3CEPA 5AHIA 2JF6A 4ZQOA 1XSJA 2NUXA 4R85A 3RN6A 1NWUA 1ECEA 4G8TA 2A1YA 1GG0A 1QPKA 1TX0A 2QF8A 3V18A 4ZEPA 3STPA 1Q6DA 1M53A 2AAAA 1JR1A 3E12A 1UMLA 4ZA0A