3LN3A

Crystal structure of putative reductase (np_038806.2) from mus musculus at 1.18 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
319
structure length
291
Chain Sequence
QHCVLNDGHLIPALGFGTYPEVPSSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSIAGVVREDLFVTTKLWCTCFRPELVPALESLLQLDYVDLYIMHYPVPMSGDNDFPVNEQGSLLDTVDFCDTWERLEECDAGLVSIGVSNFNHRQLERILNPGLYPVCNQVECHLYLNQRLLDYCESDIVLVAYGALGTQRYEWVDQNSPVLLNDPVLCDVANRSPALIALRYLIQRGIVPLAQSFENEMRENLQVFGFQLSPEDMTLDGLNNFRYLPAEFLVDHPEYPFVEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrodiol dehydrogenase
publication title Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution
rcsb
source organism Mus musculus
total genus 86
structure length 291
sequence length 319
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3ln3A00
2PDLA 2IKGA 1RY0A 1XF0A 4WRHA 1IHIA 1T41A 2HE5A 5AZ0A 3WG6A 3WBWA 3C3UA 1XJBA 3EAUA 4HBKA 3LEPA 1GVEA 1EXBA 4F40A 2IPGA 1AH0A 2ACSA 1Z9AA 4GQ0A 4JTCA 4LB3A 4FAMA 3LN3A 3ONBA 2NVCA 1PWLA 3CASA 1AZ1A 4G5DA 3EB4A 4QX4A 2PDKA 1S1RA 1R38A 2PDPA 3T42A 1YNPA 3O0KA 4XZNX 1YNQA 4ASTA 2ACQA 2IS7A 2PDBA 4Q7BA 3R43A 1LQAA 4WDUA 3UG8A 5AZ1A 3R58A 1YE4A 3GUGA 4L1XA 2WZTA 2INEA 3UZWA 3UGRA 1ZSXA 4GIEA 3RX3A 3MC5A 1S2AA 4XAPA 3KRBA 4JTRA 1PWMA 3R8GA 4JQ2A 4WDXA 1US0A 1AZ2A 2PEVA 3DN5A 4WDWA 4XO7A 2PDJA 5JH2A 1Q13A 3LNMA 1FRBA 4XVDA 1Z8AA 2PDYA 2ACUA 1HW6A 5LIKX 3GHRA 2PDUA 2IKHA 4WDTA 4YS1A 2IQ0A 2FZDA 4DBSA 3LENA 4YVXA 3LZ3A 4QBXA 2HE8A 2DV0A 4WGHA 2IKJA 1QWKA 2F38A 3CV6A 3B3DA 3UYIA 1EF3A 2INZA 4GA8A 2I16A 2IPWA 1PYFA 4XO6A 1X96A 1OG6A 5LIXX 3M64A 1RALA 3FX4A 2HDJA 2CLPA 4H7CA 4FALA 3U2CA 3UWEA 3UZZA 1ADSA 5LIWX 4DBUA 2PDMA 2PDNA 2PZNA 4JIHA 4JIIX 4L1WA 2DUZA 1Z3NA 1VBJA 3CV7A 3COTA 2BGSA 2ACRA 3D3FA 3GHTA 4MHBA 2QXWA 2PF8A 4AUBA 3LUTA 3BURA 4Q3MA 2PDXA 2FZ9A 4JTDA 3F7JA 4YVPA 4PUWA 5LIUX 5LIYX 3QKZA 4HMNA 3R94A 4ZFCA 5KETA 2FVLA 2J8TA 2F2KA 4EXBA 4EXAA 2IPFA 4XK2A 3V0UA 3H7UA 2PDCA 4RPQA 1JEZA 3NTYA 2PDWA 3N6QA 2FZBA 1Z89A 3VXGA 1LWIA 4DZ5A 3UZXA 1PZ1A 2R24A 4QR6A 1EL3A 3Q65A 2BP1A 4XZMX 4IGSA 3BUVA 3H4GA 2A79A 1X97A 2FZ8A 3BV7A 2PFHA 4PRRA 3V0TA 4OTKA 3G5EA 2FGBA 4LBSA 2P5NA 3S3GA 4JQ3A 2HVNA 3WBXA 4JQ4A 1YE6A 3R6IA 4LB4A 1T40A 3BCJA 2ALRA 1IEIA 1VP5A 3LQLA 3LD5A 5M2FX 3M4HA 2PDQA 4FA3A 2PD5A 4WEVX 3LQGA 3V35A 3Q67A 1AH4A 1HQTA 4PR4A 3EB3A 3MB9A 4NKCA 1QRQA 3V0SA 1XGDA 4XZLX 1SM9A 2ISFA 1RY8A 4DBWA 4PUUA 3O3RA 2IPJA 4IJRA 4LAZA 3WCZA 4JQAA 3UFYA 3G1RA 3ONCA 2HV5A 1MI3A 2R9RA 2BGQA 1EKOA 4ICCX 5JH1A 3H7RA 2DUXA 3V36A 3DOPA 3CAVA 3LZ5A 2IKIA 2HVOA 3FJNA 1AFSA 2PDFA 1PZ0A 4IJCA 4XZIA 3R8HA 2VDGA 3CAQA 4GACA 1A80A 1MRQA 4QXIA 1ZUAX 1MZRA 2AGTA 1S2CA 1Q5MA 3WBYA 4H8NA 3P2VA 1M9HA 3CMFA 2C91A 5HNTA 5C7HA 4I5XA 4GABA 2PDGA 4PRTA 3UZYA 1UR3M 1S1PA 4JTQA 3UP8A 4R9OA 4XZHA 3RX4A 3N2TA 5HNUA 3LBOA 3ERPA 4YU1A 4GQGA 4LAUA 4JTAA 2I17A 1AH3A 3M0IA 2IQDA 4JIRA 1ZQ5A 1C9WA 5HA7A 1K8CA 2PDHA 1J96A 4GCAA 4YVVA 3GHUA 1ZGDA 2NVDA 3R7MA 4LBRA 4JQ1A 4PMJA 2PDIA 2WZMA 2PD9A 4XVEA 5DANA 4FZIA 3GHSA 1X98A 3RX2A 2HEJA
chains in the Genus database with same CATH superfamily
2G0WA 3WNKA 5C6MA 3R4IA 2FQIA 3UETA 2OKOA 1CXKA 1SO5A 1QI5A 3WBWA 3WQVA 5FAJA 1PAMA 2DZVA 2WVTA 2R91A 3G1DA 2Y63A 2XIOA 1TJPA 3CHCA 3AZSA 5FESA 1JYWA 3B8TA 3NGFA 3NXFA 1Q6LA 1GVYA 4LYKA 1O66A 5C71A 3WEMA 1S1RA 2OT1A 4HMCA 3FVDA 1YNPA 4QLLA 3SFWA 2VZVA 4W88A 4XZ9A 4GK8A 1NFBA 4R9XA 3HV9A 4TXEA 3R58A 2I56A 3CL7A 5CJMA 3UGRA 3T0BA 1P1MA 2WNZA 1VFUA 4XISA 4XAPA 3N2OA 2XIQA 3BC9A 1PL9A 3AU2A 1GPFA 3TYCA 4NYUA 1JIBA 4O1EA 4KRZA 1OZQA 3KW3A 3MV11 4FK9A 3KAOA 1GVQA 3ZJ6A 3HA1A 3VYLA 3PAOA 4JFVA 3WENA 2PWUA 1Z8AA 2WNNA 3PB2A 3HPFA 3IRSA 4PCFA 2VRQA 1V3KA 2C19A 2A7RA 1WDWA 4QCFA 4UR8A 1I2QA 2IQ0A 4P7RA 1LT8A 3BDKA 3K2GA 1JJKA 3B04A 4MNJA 2EPLX 1P0EA 3LSCA 2VR4A 1UKQA 1JXJA 3UR8A 1R3VA 3HGOA 4WSHA 3GX9A 3GXPA 3DH7A 4H9ZA 1JYXA 1EIXA 1PZ2A 1OX4A 1TWDA 4GE8A 3LNPA 2PPGA 1PKMA 3QSTA 4JTKA 2HWGA 3LRLA 1F3XA 1OCJA 3PZ9A 3GTXA 2W6RA 4OU1A 4ZXLA 1RBAA 3UVAA 4OE7A 5HWNA 2YDQA 4RUBA 3M41A 5A6KA 4J3WA 1VRXA 2BGSA 3FW6A 4IMAA 4YTUA 2HTMA 4HU3A 1IGWA 4RZ5A 1TTPA 4E2VA 3PNZA 4J7RA 1S2UA 2P0IA 2PWEA 4WJXA 1DJGA 4HU0A 5CLTA 7ODCA 4B3LA 1OFAA 4JTEA 3CK5A 3DHFA 1H60A 3KBWA 3TR9A 4L56A 1E1EA 4ZZ9A 2YDRA 2VCBA 1EC9A 4JN7A 4M82A 1M7JA 1XLDA 4EK7A 2UY5A 4LU0A 1Q63A 4L61A 2NUXA 1EF2A 2ZTKA 3BARA 1IIHA 1AJZA 3MY9A 4DYJA 3KVLA 4C7GA 1KCLA 4J35A 3ZIZA 1YMYA 2DSZA 1EWDA 3FYYA 1I1WA 2P3ZA 2Y0FA 4JHOA 1G7UA 3S5NA 4O0KA 1EBGA 2E0PA 1PDYA 9XIAA 2JALA 1UZ1A 3MVTA 3MUIA 4IL0A 5A8PA 3BW3A 2NLYA 4LTSA 3TJXA 4GI6A 4P7NA 4LBSA 4NAFA 1SZFA 4YL2A 2BXYA 3UESA 2OLSA 3VIGA 4X0VA 2ZRXA 3RGTA 3VOHA 1Y0EA 3QVQA 5CC5A 3GW3A 1SMDA 1LQ2A 1WXYA 2VD9A 3HN3A 1TPWA 4QAWA 3LD5A 1LG1A 4PTWA 1KW1A 1VFHA 2QJGA 4O12A 4Q6JA 4PR4A 1NH6A 5DLCA 1DEDA 3UJFA 1TPDA 3LY0A 3HQOA 1UKOA 1SJBA 2VFFA 1TJ0A 1I2OA 2NUWA 1F07A 1YTEA 3T0CA 1UROA 1E71M 4QJ3B 5EFDA 1SFJA 1MXDA 1GVFA 3B9AA 3UFYA 1H7NA 4XBJA 4DWDA 1MI3A 1QMLA 4B4HA 2BOEX 2PI6A 5U7SA 1XLAA 2PLJA 3RIKA 3FHAA 4EIVA 3SUSA 4C1KA 7CGTA 3DDMA 4JN6A 2VCAA 3D6NA 5U4NA 2JF6A 3VPLA 3G1VA 3SCPA 4LUIA 1ME9A 4KIRA 4ADUA 5AVNA 3GVGA 1YQ2A 3B0XA 2JKPA 1Q6EA 4XIAA 2EJ1A 1C7SA 1MZRA 1RK6A 2A3LA 1V3IA 3TYUA 1LRQA 1ZS2A 3C2FA 1T8XA 1IYXA 3GLCA 1RH9A 3CQJA 1HGWA 4JZ5A 3VILA 3SY8A 4TQTA 3BLDA 2DIJA 4Z1DA 4LVBA 1DORA 1IXPA 2XSXA 4B5XA 1I6NA 4LSBA 4E2DA 3N17A 5EB8A 4PMNA 4KS0A 5FEWA 4GINA 1ICSA 4B15A 2DIEA 3LK6A 4WZHA 1EXPA 4MJ2A 5F7UA 1Q6DA 5A2AA 3EDDA 3AO0A 1A5CA 1EB3A 3DAQA 5C5YA 4DUOA 4XTDA 3M0MA 4M6VA 1GOKA 1TMHA 5DQPA 2XDFA 1JDEA 4CQDA 4M6UA 4O4WA 2W5FA 4PMZA 4A05A 4PMOA 4C6BA 3UGVA 1V0LA 1F3EA 5BWFA 2PD9A 4XVEA 3O0FA 1DWJM 3RX2A 1TJ1A 1HF6A 4CKQA 2KX9A 2VEIA 4IQEA 4GJIA 1HL2A 4K8GA 1YNYA 3PG9A 4JDYA 4JTLA 3BJSA 4CGTA 4UQCA 1J0KA 1E72M 1XC4A 5JUVA 2NQJA 1P0NA 1EXBA 1MWOA 1DIDA 1FWBC 3SRFA 1VZWA 3MCMA 4PBEA 1TSIA 1WKEA 2V82A 1Z9AA 2PP0A 1RZMA 4LB3A 1FOBA 3PPGA 4P2VA 4ZVJA 1LBLA 1J93A 3OPSA 3ZWTA 3WQ6A 2YDSA 4H83A 1DWGM 3W7CA 3OLEA 3LHVA 7TIMA 3SB0A 1ISYA 5EMUA 4Z0SA 1K7FA 1XGZA 3BMWA 2ZZ7A 2OVLA 2Q09A 1TWWA 4LH8A 1TV4A 1ZJIA 3GYCA 1W9PA 2DZWA 3MTWA 4FX6M 4HSNA 3HB9A 4M24A 2J47A 1CXLA 1V6YA 1G1YA 1FCBA 1B3WA 2PWGA 1OFDA 5RUBA 1J79A 4HNOA 2HPMA 3O6YX 3HG2A 3WUBA 1Q13A 2JE8A 1RLCL 2O4QA 3A6OA 3B40A 5H1WA 4H7VA 3M5XA 2TSYA 3IVSA 1HKKA 5KZEA 1W3KA 4FXJA 3SUTA 4H9YA 3MWCA 2DORA 4HZ6A 2J88A 4AY8A 4HPNA 4UC5A 1BXBA 1J11A 4GQQA 1TZ7A 1WOAA 4GIYA 3BGJA 1GK8A 4W87A 1UMYA 5CZJA 5CG7A 2VUYA 4BHYA 4JKKA 1FFQA 3CAKA 2QCLA 2C16A 1ME8A 3VD3A 3VNMA 1W17A 4AF0B 1RALA 3FX4A 4A35A 2XTKA 3ATYA 4U33A 2O4MA 1VJSA 3QLLA 4AVFA 3LXAA 1K9EA 4Y9PA 4OVXA 3L0KA 4J4KA 3FSTA 4RE2A 3PANA 1V8EA 1OGGA 4QITA 2QXWA 5KZMA 5AYBA 4AUBA 4PL2A 3TTOA 4B5UA 3QSRA 3OVQA 2ZA2A 4Y9MA 4HNTA 1KM3A 1HKMA 3N2CA 5KETA 1CEOA 1DOSA 1LG2A 1A5MC 5DF0A 2E5DA 2NQLA 2FB3A 4RPQA 2R1NA 3DZ1A 4FR6A 1QOQA 1Q6OA 1UMLA 2AOSA 1OY0A 3JR2A 3W73A 1ENUA 2CHRA 4EACA 4LNCA 3LLDA 3P6LA 4HT3A 1AUSL 1POJA 2ZRZA 2QJIA 1OFBA 2VL4A 4ZA0A 3EOLA 3E02A 5AYXA 5HANA 5ABHA 2VVNA 4TVUA 4LANA 2OEKA 2XUCA 4DQWA 2CZ5A 3BUVA 1W5PA 4HCDA 4A3YA 3WQ5A 4DO7A 1T99A 4GY7A 8A3HA 1W9VA 3W1AA 4HSHA 2OQHA 1DJYA 3C4UA 5I3DA 4B5VA 4KETA 4N9DA 3ZT5A 4JFTA 4UFMA 3W1UA 3HQ1A 1Q6GA 1OQFA 4LVGA 3RLUA 3CO4A 4C6LA 4GJ1A 4ZTXA 2F61A 3W2JA 5LA0A 3BCJA 4LUSB 3C2VA 5A8GA 1QI3A 1F3WA 1VP5A 2V3FA 3LQLA 2JBMA 4KESA 3L4VA 4WKAA 4A2SA 3P81A 3CWHA 4TMBA 3Q67A 3D5HA 4R7WA 4FIQA 1UD2A 1XFBA 1JAEA 3TJ4A 5KZ6A 4HOWA 4K7YA 5DXYA 2H8XA 2ISFA 3GWQA 3SO7A 5H2ZA 1CB7B 3WUGA 4TR9A 2OJPA 2Y6ZA 3K46A 3WCZA 3AYVA 1N82A 5BMXA 4JQAA 3T55A 4ZQMA 4GHRA 4AZ5A 2X16A 1EUAA 3T40A 5K7JA 2GWGA 2DFAA 1EOMA 4KPLA 4B9ZA 2WQDA 2OGYA 2TRSA 2D2HA 1V0NA 4WVXA 3MU7A 3OBEA 4J9JA 4HNNA 1QTWA 2IKIA 1WX0A 5I3HA 3VE9A 1VS1A 2J4GA 1WDDA 1UWRA 4XAGA 3GK0A 3B9OA 3M5ZA 4N6EA 2NQ5A 5J8LA 5LHEA 1S2CA 4PTNA 5BOFA 8XIAA 1O5QA 3AU6A 4H19A 1T0OA 2W4XA 1M9HA 4QSHA 1UD5A 4MPKA 1RP9A 3ATZA 3EDKA 2QV4A 1ZB5A 5I07A 2OO0A 2NUYA 3VCNA 1NSJA 1EJRC 4JNZA 4O50A 8XIMA 5AFDA 3EOEA 1YPXA 4XD5A 4UTKA 3UP8A 4IPLA 1SW3A 1KWKA 3W26A 1L6FA 2YX0A 5LGXA 4BCEA 2FVMA 2PB1A 1V3JA 1QNRA 2WKLA 1QPRA 5D4YA 3BK0A 3ARTA 2PWVA 4KWUA 1H50A 4NUWA 1DP0A 1EPXA 3CHVA 2ZUNA 3GE7A 2QJMA 3LPGA 2ZE0A 2XZ9A 4RDWA 3DHPA 4OFCA 2YA2A 2VEMA 2WZMA 3ZFHA 3NDYA 2XIJA 3WFZA 2VZUA 3KVKA 3IV8A 4ZB5A 4JTCA 3FS2A 2HBVA 3SY5A 3E2RA 2X42A 1XF0A 1JZ2A 3GZ3A 3LTPA 2FIQA 2Q8XA 4DLFA 1OX4B 2PWHA 1RCOB 1TE1A 1XV8A 2P50A 4QGCA 4UFJA 1QVBA 2CLHA 2IMRA 5IBXA 1BTMA 2W62A 1TTQA 5C54A 3AZRA 4XV0A 5CC3A 4NNCA 3TJIA 4PULA 1GYMA 4UMBA 3MVIA 2ONEA 1AZ1A 1QBBA 1NDWA 1S5MA 1MXGA 3GAKA 3PG8A 3KLLA 1WQ5A 2QCGA 3L2LA 2OEJA 2A3HA 3FJ4A 2NQ9A 1YNQA 3TSDA 3EMCA 4PH6A 1PPIA 1LQAA 2J7HA 2YFNA 1M68A 4Q8MA 4HGXA 1R9ZA 3ABXA 4PSRA 5EMMA 1ZHAA 3VZYA 3S4TA 2UZ9A 3CEUA 4MWAB 1GORA 3P62A 2WNQA 2B31A 2ZE3A 3LHTA 2QR6A 2QEZA 4WDWA 1RPXA 2ZRVA 1LUCA 3MW7A 3SSJA 4I9MA 2O56A 2B7NA 4IPNB 5A6TC 4XVDA 3L2IA 4TX8A 9RUBA 1REQA 3W72A 4MMWA 4RXGA 4X9SA 2YIHA 4HMDA 5FSDC 4M19A 3IIPA 1A0EA 3EWZA 4AHQA 1TJ2A 4V15A 2V6AA 2GSHA 2WBKA 2WZIA 2AL1A 4A8NA 4ZFMA 2DU2A 4GX9A 2WCAA 3CV6A 3UXAA 1TVNA 1JZ7A 3IJQA 1OSEA 4L9ZA 4NAFB 1TREA 3S9IA 3ARQA 1OM0A 3T78A 1X7IA 3BSHA 2F8QA 3ITCA 2Y5SA 3POHA 3CIVA 2FPYA 4A6GA 4C1NA 1HTIA 3LPPA 2CLPA 3W4RA 3CQ0A 1KM1A 1S5TA 1JRBA 3U2CA 1VFFA 1MMFA 1BG9A 2PTDA 3PBGA 6ALDA 3AJ7A 1EOKA 4NNAA 2E09A 1PUDA 3H12A 5E0KA 3W3OA 4O10A 4EVZA 4JOMA 3UU0A 1SZNA 1TWIA 3DFOA 2OR2A 3A21A 3VGEA 1KQZA 1UYQA 4B4FA 1WZMA 3SCVA 3VGDA 1C90A 5I7GA 4AMAA 2WC7A 1FWHC 1KCZA 1TUXA 4BA0A 5C2GA 2ZA1A 1EEPA 4URIA 4Y90A 3TCEA 3RM8A 3MP5A 3P74A 1UR8A 3WUEA 2PDCA 3O15A 1O7AA 1S46A 3UWWA 4XBKA 3T6CA 5LA1A 2VX7A 2WKGA 1T96A 3ITYA 2V3DA 1UH3A 1ISXA 3WQPA 3FYOA 3A13A 1QOXA 2PRHA 3QW4B 2I5GA 4CUCA 5CBJA 3QY7A 4BKNA 1Z41A 2QCDA 2EKCA 1XLGA 4U31A 1HO4A 1M01A 2ZDSA 3FOKA 1GVSA 1KKRA 3N13A 3UT0A 4FO4A 3RPTA 3GU2A 4FOUA 1AQHA 4JAWA 4J2PA 2YCKX 1KGXA 4OTKA 4HA1A 1J01A 2WJZA 1FHLA 1GPWA 2OODA 2XIMA 3IV3A 1E6XM 3EMQA 1XYFA 1MQRA 3BLLA 3BAIA 2WXDM 1H0GA 2YW4A 2TAAA 4QRNA 3WZ0E 3CB8A 5F2GA 1IEIA 2YCIX 4F4RA 1E6SM 3W25A 2D1ZA 1WZKA 5FKYA 2I5QA 4XTIA 2EG6A 3M4HA 3OEXA 4FOJA 1M1BA 3PZTA 1DTUA 1OYBA 5GJPA 4O13A 4NXKA 3L67A 3F4VA 2FGLA 1W5QA 1YX1A 3PBYA 5PTDA 4UNIA 3I7QA 2VR2A 3VX1A 3IGUA 3N15A 1IQ8A 2PU1A 4IPJA 1J9YA 4IJRA 3CUFA 1A47A 2BOGX 3V16A 5AYZA 2X1UA 1XKYA 3MO7A 1NFGA 1HO1A 2FGZA 3SQMA 2XYLA 3R10A 5CBIA 4PTDA 4F9JA 5GNZA 4PTVA 2PDFA 1VH7A 1PZ0A 1Z7AA 1JFXA 4NZ1A 4XZIA 1AJ2A 3VKKA 1UB3A 5FA5A 1ZBKA 4GACA 2PCEA 2ISVA 3GH7A 1JD9A 5C0QA 2FH8A 5LNSA 3F4CA 4NZ5A 1UP2A 2PTXA 4AXNA 3AWOA 4ADSA 2QCHA 3BO9A 4IQLA 4W9TA 2O55A 1O5KA 3G6LA 1XQLA 3L0NA 3GDMA 3FGCA 1JCNA 3A4JA 4ZOCA 4HYRA 4W8BA 4NASA 4AHPA 2Q01A 3VKDA 4Q8OA 2WO5A 4HD5A 1UKTA 1WXJA 1IZJA 1DV7A 4DXKA 4H41A 5LKYA 1FKWA 1OFOA 3PBWA 1ECEA 4RK8A 3BPWA 4JYDA 3D47A 4JIRA 1EH9A 2IQDA 3Q58A 5D8WA 2TMDA 1K8CA 4EAYA 3H54A 2J74A 4LYPA 4WCJA 3UW6A 3MS8A 4GVIA 4ZGYA 2GQAA 1PIGA 1XGEA 2XSAA 4CCDA 4PMJA 1LDCA 2VR5A 1R9YA 3T44A 1XKJA 5A95A 2YLLA 3GHSA 4U3CA 3THCA 3W22A 2Y61A 2G96A 2NV1A 3CUGA 1UBPC 1KTBA 5JXQA 1IHIA 5AZ0A 4MZ1A 5A1AA 4GUFA 5FEXA 1WNOA 1GW1A 4FNQA 3YPIA 3NURA 4YTRA 7REQA 1P48A 2QUTA 4D2JA 1XSJA 1MRAA 1PWLA 1XBVA 1E6NA 4DM1A 1ITCA 2P1FA 4ES4A 4O4VA 1UR1A 2GJLA 3PZNA 3DYPA 4LVFA 3BAJA 5BXSA 3TKFA 3LERA 4L1XA 5CPMA 3U8GA 4GWEA 1QR7A 2P0OA 4IIHA 4P7OA 3GNXA 3BANA 2OLHA 4OZOA 1PWMA 2O9RA 1HT6A 4GO9A 1PKLA 3S8HA 1EJWC 1M03A 1IT8A 2VJXA 3MKKA 1RD6A 4ZQRA 2ZZ4A 3GYEA 1MO0A 3N34A 1UUQA 3TA9A 1AJ0A 1J12A 2NX1A 3K8MA 3BOXA 3W0KA 3MMUA 3UEQA 1WBJA 4KF1A 3VIHA 3TXZA 3CTTA 3AMGA 4IXHA 1JF6A 4DBSA 2OSXA 1H09A 3MJYA 4JXCA 3XINA 1DL3A 4C6FA 4JCMA 2EEXA 2IKJA 2QPUA 4Q32A 5AC4A 4W7WA 3OHMB 1KFLA 3I6EA 4JIPA 3RM9A 3OG2A 1X1OA 1TR1A 3GW0A 1GOXA 3DENA 4EWND 2WCSA 3PZMA 5E6ZA 3PFMA 5AKQA 3GRIA 3V5OA 3RK8A 1A5AA 2OG9A 1W32A 3OLGA 3TCSA 3WNOA 3NCOA 3QM3A 5EMYA 2CHOA 3COTA 1RQHA 4LRSA 4UFHA 3W02A 2WMGA 2V67A 4ZL1A 2PRMA 4UQAA 2V8ZA 1JCTA 1VFLA 4GKLA 4BR1A 1Q45A 3P0WA 3T8QA 2IW0A 5LIYX 1ISWA 4Q8QA 5HMSA 3W74A 1I2PA 2Y5JA 3PS7A 4UFIA 3LYEA 3IJ8A 4H3DA 3MBFA 2PTWA 3TQPA 3V0UA 2CLMA 4GY0A 1RCXB 1DQWA 4AQLA 2FZBA 4KH2A 3VU2A 3CUXA 4R34A 1WAWA 3TUUA 2Y4SA 1PZ1A 4FXRA 1EX5A 2UWFA 1RR2A 1W5OA 3VOFA 1TA3A 2WJDA 4G8TA 3TN4A 3HMCA 4F0HA 1GJPA 4UR7A 3G0XA 2BP1A 3DFYA 4R33A 4IGSA 2Y7EA 1BPLB 1M5WA 3IEBA 1DJQA 2P76A 4FHAA 4Z17A 2FZ8A 3BV7A 5FEPA 3IK4A 3GH5A 1QT1A 1VRDA 3W1QA 1KTCA 1TTIA 7A3HA 1MQQA 4F2BA 2P5NA 3HFTA 3OGRA 1ITQA 4NF7A 2ALDA 4L4OA 2NLIA 1P6BA 3RPDA 4MTVA 4AVNA 1JNEA 4MWAD 4R88A 2HCVA 1XBYA 2Z0IA 3WF4A 3S6DA 3I7SA 1I2RA 4RR4A 1U22A 1HJXA 4L9XA 1HKIA 2GGJA 4NAEB 3F4DA 3S5SA 2PMQA 3M7WA 3M5YA 2VEFA 1M6JA 2BY3A 1OG0A 4WQ6A 1TV2A 1XIIA 1E0WA 2QCFA 3SSZA 2BASA 2FMNA 4PUUA 2WJEA 4B3ZA 1QPKA 2OLAA 2EAWA 3OGSA 4LAZA 3VOIA 3AXKA 4GZIA 1IT0A 1JGIA 4L5ZA 2JQXA 3UPWA 3L9CA 1SFLA 4HU8A 4YNGA 1KXHA 3VIKA 1DXIA 1AQFA 5JBEA 3GC4A 1JQVA 3SUVA 2YDAA 2YCLA 4DUXA 1D3CA 3CZKA 1QNPA 3TYDA 5HUPA 3W00A 1UJPA 2J8GA 5FJIA 3SAZA 1SUXA 4JTJA 1E6PA 4JFUA 3R79A 1VFTA 4M7SA 4JX6A 5E70A 3RILA 1UA7A 3VGBA 4IOTA 3VE7A 2VDGA 1H3GA 3APTA 2J7EA 4NT0A 2ZWZA 3QXBA 2F84A 3VD5A 2Z2BA 3WLPA 2OTDA 5HPOA 5EBUA 1HX0A 1VBUA 1I75A 3MMWA 3T2OA 1XLLA 1EP1A 5TIMA 1SGJA 1RXOB 1IWPA 3CMFA 1J5SA 4H8VA 2PGRA 1V02E 3Q4DA 2J62A 4H2CA 3P5ZA 1SR0A 3N2MA 5EY5A 1O60A 1W9XA 3WKZA 1LUCB 1E9YB 4V1YA 3HO8A 1A49A 3C8NA 3N3MA 4P8XA 4DF2A 3VOCA 3EX4A 1S3TC 1A53A 3BLKA 3M0JA 3DI0A 2D73A 1OIFA 3SCTA 4CCEA 1LZOA 3W84A 2CU0A 3MUZ1 3CV1A 3VM5A 3T9PA 3XIMA 1IZCA 1J5TA 4H00A 4JGDA 3O05A 1W1VA 3SN0A 1EFZA 2R6OA 4DJDD 2DT1A 3K8KA 4MJMA 3N1AA 3H55A 1NU5A 3HTWA 2OSYA 3RCNA 3U3HA 2WK2A 1XSKA 4N9BA 1UASA 3M43A 1L6GA 4AFYA 2C1HA 5DO8A 4OQVA 1P7TA 2X1TA 3CYJA 1XXXA 4MM1A 4BF5A 1OZMA 4HCLA 2E1WA 3C3NA 3HV8A 3U0HA 4C1NB 3TFCA 4NZJA 3QH2A 2WBGA 3T08A 1GVEA 1SZEA 3W01A 4M1RA 2R8WA 3R25A 3UZJA 4QE1A 1A3HA 1W5NA 3WQCA 1MNSA 2VC5A 4RE0A 2GSJA 1K4HA 3ONBA 2YOCA 3W24A 5AYIA 4PTXA 4BF9A 4Z08A 4G7EA 2O92A 5BRQA 1W3TA 4GLEA 3WDQA 5CPTA 3UERA 2GK1B 1DJWA 4ERIA 1ADOA 2NQZA 5B7ZA 4UTHA 4PODA 1I2NA 3CHFA 1TWZA 2OCZA 3KBSA 4YTSA 1KBJA 4CQ9A 4E38A 2DVTA 3NM1A 1LBMA 1LLWA 3LPFA 3WLRA 5I3FA 3HOJA 2OZ0A 5BWAA 1FRBA 4Z0JA 3EX1A 1FXQA 4B92A 5CAKA 2E9MA 4BF7A 3W9ZA 1P1XA 4IGHA 5A8QA 3QV7A 4IX0A 5G5IA 3KDOA 2QCDB 4S3KA 1W1TA 3VGHA 4F8XA 2AGKA 1EHAA 3HIJA 1ONRA 3AIVA 2VC6A 3VIIA 5JIWA 1IF2A 5H8UA 4Q4SA 5D37A 4RNHA 2XH0A 3WMSA 2Q8ZA 1KM2A 1EF3A 2O0TA 4X63A 5HATA 2WKJA 1PYFA 3GBEA 4KEUA 1LOSA 1F74A 2FZNA 4WKFA 5D04C 5EU9A 2WPGA 4RE4A 1GGOA 1F8IA 1QNSA 1BYBA 1ICPA 3MUCA 1LOLA 5C9RA 1V3HA 2PGFA 1L0PA 1W9UA 5HQLA 4UZSA 2G8ZA 2HS8A 4GUHA 4Q4PA 4XKYA 4ICNA 3LTSA 3MDWA 3BURA 3WLNA 3F7JA 2PWFA 1PX3A 1WBHA 3N14A 2W3ZA 3ABQA 1HJVA 5M1TA 2V3GA 2EPHA 5I3GA 3GTFA 5KZDA 4HZ7A 3VUPA 2RHGA 2ICSA 4XK2A 5AC8A 1G7VA 3WLMA 3MUAA 1FY6A 4JKMA 3SUWA 2ZUSA 2WLYA 1TPEA 4Z2HA 3BLIA 1W1YA 4LWWA 5HMEA 3WMBA 2E6FA 3NQVA 1FWTA 1KLYA 1ISVA 3M6DA 3EYPA 2C6QA 1EL3A 1V51A 1XBXA 3S2NA 3DKLA 2DW6A 3WJZA 2YYTA 1R3TA 3VCCA 1E5JA 4AC1X 3LI0A 4QG8A 5HJXA 3UR7A 1WPCA 2G4JA 2ABBA 4F48A 3KCLA 1HJSA 3ZT7A 3BSGA 4E5TA 4BZYA 3S3GA 4LOCA 3UWYA 2MUCA 5H6HA 3PZOA 3WD0A 1PTAA 3WBXA 1V4YA 4U5IA 3FGCB 3UA3A 1V02A 5A5WA 3HG5A 5LNUA 1VR6A 4P7QA 1GZ1A 3IANA 2ESCA 4F0MA 3ZLGA 4KQNA 1DJXA 3QR1A 5SWUA 4HMEA 3QY8A 1B1YA 1BXNA 3G1YA 3ANVA 2HRWA 2OPJA 3S1XA 4WEVX 3NA8A 1AH4A 3C8FA 5DMYA 4GYFA 3AISA 1XI3A 1WDQA 3H70A 1EA9C 4G2DA 1JYNA 1IEQA 1L8NA 3IUIA 1XLCA 4WX2A 3S1GA 1TWSA 1EO7A 3QR0A 4Z1YA 1T6MA 2Q02A 1G4EA 4AISA 3FA5A 4C6OA 3WIJA 1JULA 4PL1A 3W1MA 2DH2A 3A4WA 3JW7A 1FH8A 3GM8A 1EC8A 4OOUA 3WDPP 2A85A 4O8AA 2HROA 4U28A 1YDOA 3MANA 3TN6A 1LQ0A 2WC4A 4JL2A 5C55A 1YLVA 2A2IA 2HQAA 1BVZA 4HPHA 4ZQPA 4LV9A 3B0PA 2B0MA 5C7HA 4I5XA 4RL3A 1KCKA 3ID7A 4DO5A 3BAWA 1MW1A 4HK6A 1PSCA 5IOBA 3GTNA 5FL0A 4P5UA 5LSMA 2E7FA 3CL8A 2ZX6A 3EA3A 3ERPA 4AEFA 1F6KA 2A21A 3PPFA 3ANUA 1TR9A 4NI3A 3RN6A 3DCPA 5AY7A 2VEKA 1WDPA 4HPGA 3U7VA 3L5LA 3TTSA 3T0DA 3BAYA 1ZAHA 5L9FA 2W67A 1XYAA 3PY2A 1LF1A 3C0LA 1OFPA 2RUSA 2VGBA 4AX6A 4Y9AA 1AD1A 4GX8A 3ME3A 1OK6A 2WHLA 1GKPA 4L64A 4NY2A 3ZYZA 3BQ5A 3QQ1A 3VA8A 3WJYA 1SR9A 1CCWB 3RHGA 1F8MA 2YL6A 3C0JA 4HN8A 1PX8A 4FLOA 2AMGA 4HHLA 1IE7C 3GR7A 1WV2A 2ZTJA 3NOYA 4LCSA 2BHZA 4XSMA 1AW1A 3AMLA 4I9AA 2ZX5A 2BWGA 3MDUA 4ORMA 1PIIA 2IUZA 4DO4A 2Z2AA 2BY0A 1EDQA 1KBBA 4MYXA 4RDZA 3A9BA 2DZSA 3NQ6A 4AD5A 2E6YA 2ZRWA 2NVAA 1M7OA 5BRPA 5IBXC 3V1HA 2V3EA 4OWGA 1R38A 2G5WA 4NVTA 5D2TA 3VIJA 3CTLA 1ZTVA 2DGAA 3R43A 5G2HA 1NP0A 3W6MA 4A3RA 3TMLA 1HUVA 4WDUA 2XHYA 1KFEA 1YE4A 4RW3A 1CTNA 3EWXA 4O1CA 3TWBA 3QYSA 3PULA 2XM2A 3VMOA 3NEVA 4XG1A 3RO6A 3C2OA 3GNPA 4MAZA 2YL5A 2QIIA 3ZMRA 4R85A 4UMCA 1GTHA 5FL1A 1JUEA 3BZJA 4O1DA 3I6TA 2WWDA 3PP7A 2Q71A 3ZM8A 3MT1A 4LX4A 3BH4A 1AODA 1KFKA 4D72A 1E4LA 2QNEA 2ZADA 2NV9A 2VXNA 2PDYA 2ACUA 4EPDC 3T81A 1TA3B 1ESWA 1XRTA 3GHRA 1DHKA 2IKHA 1OFRA 3A5VA 4BQ2A 4YLWA 2QVHA 5ECVA 3N3TA 3CZ8A 2P88A 3O16A 4YVXA 1ITXA 2GOKA 1VGAA 1RVGA 5FF4A 5I0DA 3HPZA 2B81A 2PS2A 3W86A 3W75A 4GYKA 4E8CA 3HG3A 2V5JA 3KUMA 3CL6A 1U30A 1BF2A 2RDTA 3CZEA 3AHXA 4NG3A 1XIGA 2ZQ0A 3WLSA 1EDGA 3A22A 3CQIA 4O53A 2CW6A 4UTFA 1DXFA 3WNLA 1Q4NX 2ZUVA 3O2LA 4JIIX 4WSJA 3M6YA 2RFGA 1YDVA 2D2JA 5AYYA 4Q8WA 1E15A 3IIOA 2X7WA 4UWMA 2YR1A 4HVXA 3ITXA 3TYEA 2ACRA 1TCDA 4INFA 4PMXA 3O07A 2ZX7A 5BOOA 2HXTA 3LV6A 3CUHA 1H1NA 2RDUA 1I0DA 2VX5A 1KQYA 2EJAA 1Z6KA 4CD6A 4AZCA 3HZ3A 1N55A 2XH7A 1LWHA 4KFOA 4RX0A 4HNCA 1ITUA 3HMJG 4DJEA 1VJZA 1G4TA 4ZE5A 5C9WA 5KSWA 1JD7A 2ZKMX 5A8MA 3CZLA 4IMDA 5A6MA 3N6QA 2J6VA 5HQMA 3ARXA 2JF7A 2H90A 1UCWA 4UUIA 3FJ6A 4P8VA 4DZ5A 3OBKA 3KX6A 4HPXA 4C7FA 3T2QA 5DRCA 2YBUA 3S2JA 4PYSA 5D02A 3B05A 2ODOA 2VI0A 5H8PA 3IPWA 4AB4A 3VMPA 1H11A 5HPCA 1AL7A 2POZA 3MP3A 4NJIA 4OV9A 1SQ7A 1JI1A 5JU6A 3U4FA 4OOZA 3T09A 2GUBA 1HJQA 2HVNA 3GNNA 3TMQA 2WZEA 1JZ8A 2TPSA 4CD5A 3LMYA 4RDVA 4F0LA 1OEPA 3KP1A 1CECA 4LB4A 3TZFA 4JY9A 3WD2A 1E0XA 3UY7A 4YXGA 3OLDA 1S2VA 3NL2A 1UH4A 5AHMA 3M0HA 4H9XA 3LRKA 1OT1A 3DFQA 3UNDA 2CWXA 1EJVC 1FWEC 1QHZA 4E8DA 3P0XA 4KGLA 2Y8VA 3EB3A 3H22A 3OZPA 1VPQA 4G1NA 4K38A 4LC8A 1OGSA 2DT3A 4HYVA 2ZRYA 3LA4A 4ADTA 4BS0A 4Q4QA 2Z6IA 2E3ZA 3O3RA 1S5WA 1KRAC 3EWYA 5AECA 3CC1A 4PBGA 5IXEA 4B5WA 3WF3A 1IIGA 3LGEA 1O94A 1G67A 1EQCA 2ZC8A 1SVDA 3WJSA 3UCQA 2R9RA 4QG6A 3UPBA 2OSWA 2EO7A 3JS3A 4KCVA 1ZBCA 1DIOA 1CENA 3KP0A 5HK4A 2XFYA 3DFPA 5ABFA 3W27A 3GC5A 1GQKA 3A24A 3R8HA 4AMCA 1QXLA 3GXNA 3WLHA 3PZQA 1DQXA 5FJRA 5J5DA 5GQBA 1JVNA 3LCGA 4G7EB 4H7ZA 3ORWA 3HF3A 3NDZA 2WMHA 5DMNA 4XSLA 1Q5MA 1Q6QA 4I6VA 1ZAIA 3QBUA 1D7FA 5T8GA 1P6WA 1VEMA 1K6WA 4N0RA 4MOZA 3UZYA 3FVMA 1E1CA 3EZ4A 2I9UA 2Y70A 1H61A 1W1A1 1UWIA 3CLWA 3RO8A 1BD0A 1E6ZA 3SIMA 2P53A 3DU0A 2I17A 4WXZA 5D9PA 1JAKA 2O7QA 2WQPA 2OX4A 3M0IA 1V3MA 1R5YA 3S9YA 1R2RA 4J3XA 3LDVA 1L6SA 4NP7A 2NVDA 3OA3A 3AS2A 4JQ1A 4US5D 4I5UA 1P4CA 3CWOX 3G0UA 2WSRA 2JFEX 4B16A 1HZYA 2C1IA 2YBVA 1K7XA 3PK7A 4LXFA 3G24A 1H7RA 2QIWA 3KHJA 3O6CA 2WVSA 5JMUA 4WRHA 1Q2SA 1U5HA 4XUGA 3WH9A 3BLEA 3IGXA 4GZEA 5A2BA 1EYEA 1FWSA 3H21A 4EANA 1CXIA 4R5EA 4F0KA 2CKSA 2UY3A 2G4FA 2X41A 4FMVA 4YPJA 3O06A 4JNMA 4G6CA 3GIQA 5D09A 1JPHA 1MW3A 2B7OA 3B4UA 1A5UA 1GOMA 2Z6JA 3EPMA 4L4MA 3EB4A 1FWIC 1ML1A 1NY1A 1ZJHA 2PDKA 1FDZA 4XKYB 4M8UA 4AEOA 1LWJA 2NX3A 1JPDX 1C8XA 1OINA 2PLCA 2VFEA 3GTIA 4MIMA 3DGBA 3DC0A 1TMQA 3Q37A 4LAKA 5LNVA 2DT0A 2ZXQA 1DVJA 4IIBA 5HWMA 4JQ2A 3SUUA 3LM7A 4L80A 1HJWA 1XLBA 2EPNA 1LBFA 1QO5A 4PGLA 1RJQA 3WJWA 3TK7A 2YXXA 2X05A 2NSXA 1LYXA 4XO7A 1PE1A 5F2LA 2PDJA 2REQA 3MHGA 4ACZA 3L0GA 1QAPA 2A6NA 3LNMA 4BY3A 1NFPA 5CC6A 4RCXA 4NHVA 4WLCA 3WLLA 3OU8A 1A0DA 2CBIA 5FF0A 5E93A 4PA8A 1NDZA 4JICA 1UKSA 3MSDA 4KRTA 3VNJA 2Q3OA 3M0XA 1K7EA 4WJEA 1Y65A 3LTYA 1QW8A 2BGNE 4GVHA 3U2ZA 4AHOA 3GC2A 4DNMA 2V5BA 2QF7A 2YL8A 4Z1AA 3CH9A 1W2VA 2WMFA 3E2VA 4JKLA 1OG6A 1QPQA 4GFIA 3M64A 3R0KA 5BNKA 1QNOA 3UWEA 1LL7A 4F0RA 3LM3A 1IV8A 2DJLA 1OF8A 1VLWA 5EFFA 4YYFA 4GI4A 1KA9F 4EE9A 3UG3A 2ANUA 1BG4A 1NP2A 4MY8A 4MHBA 5CZ0A 4GI9A 3N9SA 2TYSA 3LUTA 4CEUC 5GJNA 4RV3A 2NZLA 5I24A 3QKZA 3VFLA 3W88A 4O52A 2PA6A 3B97A 2VOTA 3N2BA 4EPKA 2FVLA 1VYSX 1TJRA 5E1QA 3S5YA 5CPLA 3BQ6A 4LUTA 3H7UA 4QNEA 4S3EA 3TDFA 1GONA 1B9BA 3PAJA 2XPKA 3FV9A 3OW1A 4GNKB 4V27A 3D46A 1OX6A 3WELA 2VFDA 2ZUUA 3THUA 3S2CA 1GT8A 2ZIDA 1E51A 3ZJKA 3A3HA 2PGWA 4I3GA 1AW2A 3LXCA 4CQAA 1CXFA 1OIMA 3W81A 3T4CA 3QPEA 5K9XA 1NF7A 3NQ8A 4LVAA 3TTQA 3AUOA 4S3FA 3PTQA 4DF0A 3DXIA 3LX9A 3SR7A 1UWSA 1CGXA 2QKFA 1MUMA 3GS6A 4WD0A 8RUCA 2AMXA 3TNBA 2ZZ6A 3K4AA 3M1ZA 4FXSA 3TLQA 2HPIA 1TTJA 2X2YA 4MG4A 2ZRUA 4IP5A 4WGXA 1J6OA 1EIBA 5AHNA 3O6AA 3BAKA 5CEWA 2OQYA 1I60A 4AZIA 1ZAJA 5EA9A 4BK9A 4RNIA 1CZ1A 1H7XA 2OOFA 4Q8NA 1F6PA 2PDQA 3BW4A 3KOWA 2PD5A 1JXKA 1HQTA 1LRNA 3L4WA 2QCCA 1HN1A 2E40A 3C0SA 1PB0A 2OX1A 2BVYA 3SURA 5BROA 2AKZA 4DBWA 2GUUA 1WA3A 5L6UA 4DAFA 4LV4A 1G94A 3GVQA 2DJXA 4RDYA 1XDMA 1J2WA 3QMRA 3UD6A 2PWDA 5IM51 3OVPA 1WP6A 4E4UA 2GWNA 1FWRA 5DRIA 3KTSA 2QCEA 1J10A 1HNYA 1TO3A 1EBHA 5BRBA 1F76A 4ZE4A 4HP5A 2DH3A 1ZCCA 3OODA 2PCQA 3DOPA 3GO2A 4YJ5A 3AICA 1WE5A 4D8LA 4IISA 4S2CA 3N4EA 5DX7A 1HL9A 4ML4A 3PJWA 1E55A 3WSUA 4HU4A 4W93A 1KM5A 3AXXA 3EBVA 3IIZA 3QW3A 5M5DA 4GMEA 4JPGA 3ZSTA 1XHGA 3PUDA 3JZEA 1Q8JA 3PZIA 2DUAA 1FFRA 4M5PA 1FHDA 3A9IA 3PVFA 3UJ2A 1FDYA 3MBDA 2WW5A 1XYMA 5K9CA 4MKSA 3SCOA 2R1PA 3E5PA 2QV5A 2VMFA 2ATSA 4HHMA 3T1GA 2A3AA 3ARVA 3BICA 3LBOA 1BRLB 3GAYA 1R2SA 5DFAA 2B4GA 2DIKA 1AH3A 3LBMA 5HNRA 3WMCA 3AAMA 2BVDA 3HBLA 4YVVA 4K6AA 1J6PA 4U5KA 4XD3A 1NWSA 5HXMA 4IFKB 4NL1A 1V7YA 4MUPA 5D32A 1NM9A 1N8IA 1RA5A 5JBDA 3NDOA 4Y96A 3QFEA 3AMDA 4ROQA 5D33A 5I3IA 1EJTC 4GIRA 4A21A 1ELSA 3ZT6A 2PP1A 3MCOA 3W7LA 4WXYA 3WD1A 1SU5A 1QO2A 4H6EA 4TTGA 4DWSC 1QU4A 4GZJA 1BHGA 4GYPC 5BU6A 1S2WA 5D2XA 1SYTA 2ACSA 4BJHA 4GQ0A 5T91A 3CU2A 3GFYA 4GOAA 1E3XA 2X1IA 4G5DA 2WVVB 3S2LA 3AXIA 2VVSA 3VZXA 2Y5EA 3W7KA 3T42A 4XZNX 1EO5A 1XR2A 2DZPA 3BJTA 1K9FA 4AZCB 3FFSA 1XH1A 3T0TA 3M7SA 4LRTA 3VDBA 1KO0A 3R8RA 4UOJA 3KRBA 1ZY9A 4HA4A 1X6UA 3N29A 3VZZA 4LPCA 4GZ7A 5K9DA 2PEVA 4ZO7A 4A8RA 1G69A 3EKLA 2ZXAA 1JF5A 2ZYFA 2CXGA 1YDYA 4XAFA 2VGFA 4XZWA 1JZ5A 3G3MA 3N04A 4HNLA 2HVMA 2FHCA 3CGTA 1H0IA 4AD2A 1F9CA 5TNVA 4ERGA 2Y8KA 2JGYA 4Q4KA 1D3HA 1QCWA 4MFDA 1I1XA 3W2NA 3QR3A 4KEVA 3QGKC 4Y7EA 3LB0A 2F38A 4HKPA 3QF0A 2FJUB 4RZ4A 2D3LA 4ZENA 5FSEC 4GA8A 1V6TA 2IPWA 2ZCGA 5E09A 3C61A 1G0CA 6TIMA 4QROA 5C2CA 1IXQA 2A1YA 4HNUA 1WUFA 5HWJA 2J9ZA 3NL6A 2GOUA 2PDMA 1QNQA 2GJXA 4GQRA 2PZNA 3LOTA 4XKMA 3QZEA 3P84A 1Z3NA 4NZ4A 2WSPA 4GUIA 4CNTA 2CZDA 3W83A 4AIBA 1PXGA 2CETA 3CUJA 4Z1CA 1LT7A 1JI2A 1P43A 3D3FA 4JBRA 3VINA 3NZPA 2WJFA 1OD8A 3VKAA 4NJJA 1MDLA 1WDSA 4O14A 5DT5A 1QPOA 2PDXA 2J7CA 3S1UA 2CITA 3ITLA 3QHOA 2JKAA 4IH3A 3N4AA 4YVPA 4E2OA 3W6LA 4HMNA 5CSUA 3M16A 1TG7A 4UIOA 3OZOA 3QZ6A 2J8TA 1U5VA 1BQCA 4GGBA 1A50A 2D3NA 3QTPA 1XICA 3AS0A 1PCWA 2X7VA 1L2UA 4OECA 3E96A 1X39A 4WHBA 4MNKA 4A8IA 4B9YA 2GGEA 2F6UA 4MB4A 3GDRA 4JTGA 4DEFA 3MI3A 1DYSA 4C6NA 3ZZ1A 3QV8A 4G7FA 1Q7QA 4EOUA 1LLZA 4WIWA 5CPQA 3WQOA 1IEVA 3B8IA 2F2HA 4QISA 1RVKA 3PZVA 1VIZA 1IGSA 1RQBA 1PEZA 4IPIA 4C6JA 1DE6A 3O1NA 2MNRA 4JQ3A 2W91A 3BXWA 1U2YA 4Q22A 2D0FA 1Q6CA 2OWWA 3EKZA 4CQ8A 3M9YA 4PMQA 3TSBA 3UWUA 5F1UA 2Y8UA 3H53A 1XLKA 2PBOA 3F5KA 5HNNA 3L68A 4Y9NA 4DZAA 4EP8C 2VHLA 3TTYA 3R13A 3ABOA 1THFD 1EGZA 3MPGA 5I03A 3II1A 2XVNA 1WZLA 1RBLA 5E6YA 1FXPA 5F2IA 4PE8A 1VFOA 4KMQA 4UCFA 5HMFA 1RY8A 3GKAA 3KRUA 2OWCA 3P3BA 1YXDA 3ITVA 3IGHX 1VCVA 3APYA 2BVTA 3O6DA 3A64A 3M0YA 2BVWA 5EMLA 3OOQA 2HV5A 3UQNA 3CNYA 1WB0A 3CPGA 3BG5A 3GKFA 4HZ8A 2BGQA 4OBRA 4O8RA 5CG0A 1V5XA 3ES7A 1CPUA 1H1ZA 1E4NA 3P14A 2R1LA 1P0DA 4JX5A 2OXNA 2VM8A 3T0AA 4IP4A 3TYBA 2QGYA 4GKTA 6TAAA 1B54A 3GVWA 1OBAA 3G22A 1XH2A 2QUUA 3P8IA 4I9JA 1OK4A 3WBYA 3ABSA 1XS2A 2NWRA 3SZ8A 5A6LA 4Y9OA 1OFEA 3TR2A 3VD9A 1R6WA 1KWGA 5TAOA 3MA8A 1PX4A 3PUOA 4ZQCA 1XRSA 4I90A 3Q45A 4J5NA 5CSRA 3I3BA 1CLXA 1KR0A 2J79A 3UJRA 4JTQA 3NQCA 1NQKA 1FDJA 2PUZA 5FJPA 4HIBA 3KM8A 3N2TA 4ACZB 1E5NA 4JFSA 4GQGA 1UJQA 3KXQA 3SJ3A 2P3EA 3G8RA 1KFCA 3F1QA 1ZQ5A 1F5ZA 3KOZA 1XX1A 3CIWA 3KFTA 4C6KA 3DFHA 1EP2A 3NJ3A 4WOZA 1XYZA 4M56A 3MSGA 2A6LA 3R7MA 4FSAA 1EYWA 4ZEPA 1BSLA 1UPPA 1YBQB 3TW7A 1IWAA 3HPSA 1XDLA 3QQ0A 1TE6A 1TIMA 2WPBA 4WY0B 3JVAA 1AA1B 1RY0A 2ZOXA 1YIXA 4DVOA 2Z28A 3UA4A 3W2LA 1XH0A 2E6DA 3EPOA 4I5RA 3W7PA 4HBKA 3LEPA 4AX7A 2ZZ2A 4A22A 3MSRA 4FF7A 4LVDA 1XLHA 2CHNA 3L4YA 2VZOA 2O9TA 3W1XA 1H7OA 1X7FA 4JNYA 4W84A 2BX7A 4EF8A 5AHIA 2BXVA 4N4QA 2WVUA 2PDPA 3O0KA 1ZBWA 3CH0A 2DSVA 2QHAA 1KBKA 4QDMA 3E12A 2EXOA 3P67A 2VYOA 3TLLA 3GUGA 4J28A 7ENLA 3VGFA 4GBUA 3RM4A 3VC6A 3VNKA 3CM4A 1BVNP 1SO3A 3DFNA 1XG4A 3AXMA 2H3DA 3R8GA 4ERAA 4WDXA 4LUTB 2VT0A 1QI2A 4LW7A 4C60A 1WOBA 4KFPA 1SSGA 5EL1A 1AMYA 4JL1A 5HR7A 2G97A 1HW6A 3PJXA 1VYRA 4M6PA 2R94A 2BLEA 1H2JA 3EA2A 4MKVA 3GNOA 1TQXA 3ITGA 1VBGA 2WLZA 1XM3A 3SGGA 3FJLA 3HPXA 3NFUA 1SW7A 2VP8A 3RDKA 3B3DA 1CXEA 3W7DA 1UA3A 4DRSA 3HJZA 5JIPA 5CLWA 5D05A 4E3VA 4AD0A 3MHFA 2FYMA 4GNVA 2W9MA 2V2CA 1GYNA 2VNCA 1RJPA 2V38A 4D8ZA 4N6FA 3AYRA 3NQ2A 4C6DA 2W63A 3J7HA 2E1DA 2C1GA 2VC7A 3R2GA 3M07A 1JNDA 5EYWA 2DUZA 4ATDA 4J40A 3FY1A 4NQ1A 4KIEA 3CV7A 3VCRA 1FH9A 3GTHA 3SGUA 2IQTA 1CGWA 1F6YA 2RDWA 4QG9A 4OGZA 1SFTA 3A4AA 2J7GA 1E43A 3W7GA 4RE3A 2FZ9A 3VKBA 1GOWA 3AHVA 1PO9A 1BSIA 1WZAA 2XGIA 3MUY1 3V5CA 3G77A 5F4SA 3HU7A 2VFIA 4R27A 5D9OA 2X0HA 2W61A 3E74A 1PCKA 3VD4A 4EXBA 2YL9A 2CZEA 3ELFA 1I8JA 3VDCA 1JCXA 3W1NA 3G1SA 4AYGA 4PBFA 1WCGA 3LBCA 2GZXA 1SO4A 1R8LA 4H6RA 4DJEC 2Z1WA 5BOEA 9CGTA 1XLMA 3FA4A 1RD5A 4Q4OA 1DJNA 4Q8TA 2Z1VA 1DE5A 3BL3A 3A12A 2R24A 2XGZA 4BWLA 4KCUA 3NL3A 4QR6A 1N8WA 1QATA 4CNOA 4XZMX 4LGXA 1BVWA 2G50A 1PDZA 4WY0F 1NTHA 3MMDA 2X0YA 6XIMA 1UR2A 4I8YA 5C2XA 3R0UA 3G6MA 2O9OA 4JTIA 4O1FA 4DN1A 3ZR6A 3QGVA 3TQVA 4AXKA 4FR1A 4GG9A 3I6RA 3VTRA 1FKXA 3I4EA 4E4PA 3AS1A 8TIMA 2F9RA 2QUNA 3RPMA 3CV2A 4PTMA 3U5YA 4AZ7A 4DXXA 1R86A 3KRZA 3NUKA 3WH6A 2X40A 1PYMA 2DSUA 5LGZA 4HA3A 3WNPA 3N6JA 1AQMA 3W6YA 4FB7A 2FZMA 2XN0A 1FP8A 1ZLPA 1U1HA 1E1FA 2YKKA 3V0SA 1PBGA 3H2AA 1RBOB 2AAMA 2FLIA 4EWJA 3K1DA 3TN5A 1ZZMA 2V5KA 2WSKA 3WNNA 5CXPA 1VCGA 4Z2IA 3DBNA 3SDOA 1K03A 1CGTA 3N4FA 1VEOA 1BLIA 4L7ZA 1AK5A 3NO3A 2J13A 5JH1A 3H7RA 4D6IA 1S5VA 4LYRA 2YXOA 1OYAA 3NQGA 3LCFA 2Z26A 1R9XA 2WSYA 1PIFA 4GRSA 3VOJA 4C6QA 1MYRA 1MW2A 3AOFA 2QVNA 1MRQA 3NSNA 1Q85A 4FXFA 3IGSA 2DY3A 3CT2A 3WQDA 1HG3A 4MJZA 3EEZA 3CQHA 2FDSA 3UF9A 2J77A 5BXPA 1UQYA 2DZUA 2ISDA 1UZHA 3HG4A 4ZQNA 2EPOA 4GO8A 4JTHA 4NSBA 5DMLA 1W8SA 4L6OA 5I3KA 3A4XA 1OADA 3KVJA 4QEEA 3EXSA 5IHSA 2HISA 1KXVA 5I09A 4Q6XA 2GVLA 1XLJA 1FWWA 2FMOA 3I4KA 3KBJA 5GPRA 3LGDA 1GOOA 2CNCA 4XZHA 1V93A 3NM3A 4AWUA 3BLOA 3B0UX 1DWAM 5I79A 3SEPA 3HFYA 3APGA 1X8FA 4UTMA 4GGHA 1K4GA 3LCIA 2CLKA 3W2MA 3HQNA 3QPZA 5HMDA 1UC5A 4JIEA 4DX3A 2XJ7A 4IIEA 1NEYA 1XFCA 3S1WA 3C86A 6CGTA 4X0NA 2NT0A 2WMKA 2C7FA 3WYZA 3GVRA 3NQDA 3RUBL 6XIAA 1TPB1 1XSIA 1NOFA 4FZIA 1N8FA 1K8ZA 3AWNA 2IKGA 3NPXA 3V5FA 2QDEA 3GUWA 1H7PA 3SQSA 3ICJA 4FX7A 1XJBA 3M47A 3C5QA 3OBAA 4WR3A 5F4WA 1KRCC 2IPGA 2W92A 1P0BA 1AH0A 1JQXA 5D9NA 4GPNA 2GJXB 4FAMA 3USBA 2VOMA 4PMRA 3WLJA 3QV6A 3AC0A 1HXJA 5IFTA 4HJWA 4MY9A 1YYAA 5HDRA 4AIUA 2X1RA 1R7OA 4UMAA 1UIOA 2YZ5A 3PWAA 5LNWA 2BODX 4KWOA 3E2SA 4M1BA 1Q6RA 4K39A 3WJXA 1GQJA 5C8BB 1ZPTA 3ALGA 3DYOA 3MKVA 2UV8G 1PKNA 3KCJA 1OF6A 2YA1A 2DP3A 3MC5A 1LCOA 1NWUA 1H7WA 3V4BA 4KCWA 2VRKA 3CMJA 3NPVA 3AZTA 2QAFA 2O7SA 1US0A 3IUHA 3QYQA 3C2RA 2FDMA 1F3TA 2VCCA 4JR5A 4OHQA 4MNLA 4HA0A 4NZFA 3H4XA 5I06A 3QV9A 1QW7A 1AG1O 2C8NA 4FLSA 4LEQA 1OC5A 2NXIA 3SI9A 1RPKA 4I7VA 1CI1A 3HPAA 4IL2A 3S6TA 2DZAA 3B8DA 3GB6A 2R1KA 2XN2A 1M53A 3TA6A 3TC6A 3W76A 1T5AA 1NWRA 2Z2UA 3TYAA 3NG3A 3H2FA 3BVJA 4WF7A 2XH2A 2VFGA 1TPUA 3F4WA 5DXXA 5IFPA 1W8GA 4R7OA 4M29A 2CPUA 4JTFA 4O11A 3A47A 3P8JA 4NI8A 4RZ6A 4DBUA 4E2BA 4ILSA 3B9DA 3TJLA 3EDEA 4HOZA 4S3GA 3CT7A 3SECA 4L1WA 1C92A 1W1PA 4FS9A 1ME7A 3OB8A 3W1RA 1PS9A 2BTMA 3GHTA 4PSPA 3NO5A 4LFYA 4QJ1A 1R3WA 1KLZA 1PHQA 3IS4A 1BGAA 5HAOA 1IZKA 3W7RA 2XIBA 5D2WA 4BQ5A 2RAGA 1UZ4A 1VF8A 1UZDA 3UCDA 1KXTA 3L4TA 4AIOA 3WLOA 3W7HA 4EPBC 4MB1A 1W54A 2FPTA 3GDBA 3NTYA 3CZJA 5E0FA 4BI7A 3RCYA 1Z89A 4OBSA 4CLMA 3QPYA 3UJSA 1C8QA 4EF9A 4CN4A 2QPSA 4UNKA 3ZLFA 4GYJA 1BAGA 1RA0A 3DHUA 4Z2JA 3QY6A 4TU1A 1J0ZA 1U5JA 2XH4A 2Z1XA 1VPYA 1P0KA 3SGZA 4HTBA 2GGGA 3H4GA 4DF1A 3GDLA 5C9XA 3F2CA 4S3CA 4E8GA 2P10A 7PTDA 1HL8A 3RRXA 5I00A 1DXEA 2ADAA 3MI6A 1TVLA 3D3AA 1QHOA 4KEMA 4JQ4A 3V75A 3NQEA 1OFQA 1FWFC 1YKWA 3UXKA 4IJBA 1C93A 3RLGA 1TELA 4FX8A 3KBVA 1MEWA 3CBWA 1B3YA 3N18A 2Y7GA 1JDCA 4UNLA 5T9BG 3OQ8A 1NVMA 4QCEA 1VLIA 5FJOA 2RH9A 1UWQA 4P8WA 1MQPA 3QRHA 4FA3A 1FCUA 3UY8A 3B8VA 1QRQA 1YDNA 3JZUA 3NZ1A 4GY1A 3KL5A 4D6GA 3NGJA 3L4ZA 3VIPA 2D23A 1PTGA 2NV2A 1XIHA 1XIDA 4HB7A 6PTDA 2GQ9A 1F61A 4GUJA 3L12A 1JCYA 3CLMA 3ABZA 3C52A 1O68A 2I5IA 4MWAA 3G1XA 1W37A 1XIEA 3ZVHA 2NX9A 2GGHA 4B3KA 1XLEA 5A6SA 3QFWA 2YLAA 3CAVA 4W4QA 5A6AA 2B7PA 3NEHA 4QE4A 3U9IA 4AYSA 4A3HA 1ICQA 3TSMA 1CB2A 4ATLA 5FF7A 3RR1A 1GHSA 1C91A 4LF2A 4R7JA 4PCNA 4GXPA 2VGIA 1OC6A 1M65A 3A23A 1SZRA 3KVMA 2EF9A 2CLFA 2OEMA 3PZGA 3BLPX 3E38A 3AJXA 3H2MA 4Q7NA 4X3ZA 2FJKA 2BNJA 3KTCA 4V2XA 3P2VA 1BGGA 4ORIA 3OGVA 2V81A 1GQLA 4AC7C 4Q8VA 3IACA 1M04A 4PRTA 3W1LA 4G56A 3U48A 4Z2LA 3KLKA 2XSBA 5HULA 3RFAA 1IEXA 5LXEA 4DJFA 1DJIA 2VQTA 3GVVA 4GUGA 4ZCWA 3AHYA 3P82A 2A7NA 1YTKA 5A6JA 2INFA 3RX4A 1P5BA 1VFMA 1ZP3A 3TWAA 4LAUA 1XIMA 1W9BM 3L66A 2E9LA 1TV5A 2WM0A 3OO2A 1TX0A 1PKYA 3I68A 4A4AA 4HZMA 4ZO8A 3V1PA 4W7UA 4GISA 1EA0A 3ITOA 5JVLA 3WUFA 4XIMA 4PCSA 3ALFA 4KKXA 3EWUA 3PNUA 2XWEA 4B5NA 1JCMP 2F6KA 5E0CA 4X22A 1JPKA 3NQMA 4QJ4B 3VKCA 3W7OA 3C3UA 4IIGA 2Q8LA 3DFSA 1B30A 1TV7A 4NILA 3EX2A 4FNTA 1FA2A 1DWIM 3U2OA 5ENLA 2NVCA 3N6HA 3ZR4A 4E6MA 4H9MA 4UFLA 3DHDA 4MDOA 3GXMA 3RCMA 4EAMA 4PMUA 1WKFA 4DJDA 4ASTA 4Q8PA 2XFRA 4QIUA 3UYCA 3TE9A 4UOZA 2VUNA 4NX0A 3RG6A 3CIXA 2G3FA 4GIEA 4UOQA 4RNJA 2F6XA 1BWLA 3RRAA 3FKKA 4H9UA 1AQ0A 4QLJA 4J27A 2EPKX 1O12A 4N42A 4RZBA 5I6SA 4CCZA 3NL5A 3JRKA 1FH7A 5G2WA 3WN6A 4OBTA 1R3RA 4DI8A 1XD0A 3TQ0A 1R87A 4ONVA 4AZ6A 3TP4A 3EXTA 2VFHA 1CGYA 4H6KA 2V5LA 4A3QA 1E70M 1XRVA 2WV8A 2VX4A 1UR4A 3I10A 1TQJA 5LIKX 3PBUA 3SCNA 2QCNA 4WDTA 2FZDA 4H9VA 3PUGA 5A8OA 2V68A 3DUGA 3S0CA 5KITA 1TKKA 3WY1A 4DAIA 3DERA 3PJUA 4TO8A 8CGTA 3B9NA 3E0WA 2QCMA 4WGHA 4GH1A 4O16A 3GD6A 3PC0A 3VK5A 4LS0A 5HBFA 2CLIA 3S5ZA 2I16A 3HM7A 1PV8A 1E6QM 5CGTA 2WHKA 2DZBA 1IXNA 5LIXX 3FNDA 3W7MA 1HGYA 2J9YA 1JL8A 4FALA 3EX3A 1CBGA 4MSSA 3KL3A 1WUEA 3E9AA 1CLVA 1Q8AA 1FP9A 3GSMA 3AALA 3OQEA 4JIQA 3QEZA 2QLYA 2PDNA 3TONA 2CLLA 4B90A 1GEQA 3RU6A 1ZCOA 3H2NA 4KFNA 4JCLA 1TPVA 4UB9A 5FAGA 1Y5XA 4PFMA 2EG7A 3VNDA 3M44A 4DO6A 1QK0A 4AWSA 5BXRA 3KOXA 4YTTA 1TPH1 5D03A 2GUYA 4UTIA 1G4SA 4QNWA 4CCCA 4YCPA 5CZTA 2WMIA 3AIBA 4O1AA 4FPSA 4EXAA 2YFOA 3LHWA 5MHBA 2BV9A 5A2CA 4QDWA 4ZODA 3MO4A 5GNYA 2JEPA 3MZNA 1R46A 2D0GA 2XG9A 4WKHA 3I3DA 1O6IA 3VXGA 1MEIA 1LWIA 3KBMA 1AW5A 3GIPA 3VMNA 2VX6A 3UZXA 1W1B1 2VRJA 4K7VA 3BG3A 1A5LC 2EQDA 5BMWA 1LROA 4DPPA 1FWNA 3Q65A 3MP4A 3TAOA 1O5XA 5MF5A 3DG7A 1DJZA 3L65A 2Z1SA 1SFSA 3URNA 2BS9A 3IVUA 5EBAA 2FHBA 4MAVA 4WK9A 4NYYA 2GLKA 3IJ9A 4D6CA 1KKOA 4D8AA 2Y1HA 3C2EA 4FOKA 1H62A 3M46A 5I77A 3W1TA 4IX2A 4UFKA 5GNXA 4RPPA 4U10A 4H9TA 3BGGA 1E3ZA 2CEQA 4FNSA 4M81A 1U83A 1REQB 2Z4GA 5M17A 3SIZA 3ISIX 3AIEA 3VIOA 3GIYA 4LY8A 4QQ3A 2J7BA 3ARUA 1TMLA 1FWJC 4GXMA 3B8SA 1P6CA 2FTYA 5CBBA 2E67A 1G9HA 1V7AA 2C14A 3C56A 2X09A 5DEZA 4PN2A 3MJMA 3V35A 4IGNA 4AZGA 4DWSA 1NOWA 1JCJA 3W29A 1VPXA 4NKCA 4JTTA 4XZLX 4GYPA 4RW5A 4CU6A 3M5VA 4C5YA 1JDAA 2D2OA 4AD4A 4NU7A 3D0CA 2RGLA 3OA5A 5I02A 3URQA 1UUMA 3BGAA 1FWDC 3TX9A 1PTDA 5LZLA 1EX1A 3G1RA 4BI5A 3OHIA 4LYQA 4DB7A 3CS2A 4JYFA 1GCYA 4ICCX 3TH6A 3P60A 4ZO6A 5F2MA 3V36A 2GFTA 5AN7A 2OKTA 4MZYA 1W3NA 2Y24A 2YCEA 1L2QA 3IJ7A 1GWJA 2G41A 4DELA 4C6PA 4QE5A 3ARPA 3AIQA 4M51A 4ZMGA 4QXIA 1ZUAX 4L6HA 3PTMA 4D1JA 1RQEA 2AGTA 1QNVA 3EDFA 3KWSA 4C1LA 2V2HA 3WL0A 2O9PA 4ZR8A 5IDZA 2D2GA 4CN1A 3ZOAA 4LNYA 3FDGA 4NJKA 4MGGA 1RHCA 2HXUA 3UG5A 2B7QA 5REQA 1PVNA 5HINA 3RAOA 5FI8A 1YEYA 1UWUA 1A3WA 3WX7A 3F5JA 3AMKA 4LY4A 4UTWA 5A6BA 1BQGA 1MFUA 3OVRA 1E73M 1KXQA 1UPMB 2Y7FA 3KZPA 3QHMA 2QDDA 3G8EA 1J18A 1TRIA 3E0VA 1XWYA 3KHDA 1E0TA 1ZJAA 2DSKA 3LCHA 5HA7A 3W87A 3FXYA 4DXVA 1RLDA 3GHUA 2QMJA 1Q3NA 2PDIA 3TC3A 1GZGA 2J78A 1UP0A 3QOMA 2I1OA 1C3FA 3WDHA 1OCBA 2IXVA 3UXDA 1X1NA 4ZBCA 3LRMA 5CC7A 4MKNA 4QSFA 1J2BA 3OYXA 1KM0A 1PJ9A 1VFSA 2VC9A 4CU8A 1S38A 3TU9A 3FSUA 4RNFA 1XINA 4MFEA 3TW9A 3KDNA 4W85A 3VOGA 3L23A 4IGMA 1W91A 3GNDA 4O1BA 2W79A 3V3WA 2ISWA 2NQHA 1TZZA 3T4WA 4FLQA 3AMCA 5HJLA 3DFTA 4PUJA 4B5SA 2D22A 4ECLA 3KL0A 3K30A 3PPCA 2FHFA 4AVOA 5BU9A 3LCWA 4DZIA 3R0DA 4C6MA 4O18A 3KS5A 5F4XA 3VDHA 1FWAC 1FTXA 3IVTA 3MSYA 3RXZA 1AZ2A 4PUNA 4MJ4A 1T8QA 1ECQA 3I3EA 3C6CA 4CEXC 1LJYA 3EMZA 2ZICA 4IFOA 4J3UA 1MUWA 3U4AA 1EUNA 3W70A 3E5BA 3T2PA 5B7YA 4DBEA 1XCXA 1VB9A 3LG3A 3NO1A 3EPNA 2VD8A 1W3JA 4QS6A 4XD4A 5M3WA 1EGMA 3LCXA 3AIWA 4K1WA 1VD6A 3LENA 2OWXA 4NAEA 3LZ3A 4L4LA 4QBXA 2X2GA 1XCFA 3NYZA 3BZGA 2FVKA 3QLDA 4S38A 1GNXA 1RCQA 3VAVA 2XFWA 3IAQA 3TNOA 2GJNA 4ZOAA 2BFGA 2INZA 2VDIA 3UVIA 4JHZA 1XYLA 3LS9A 3UXIA 1GZJA 4K37A 4G1KA 1AMKA 4UZUA 3T07A 2Y2WA 4DY1A 1DBTA 2PP3A 3UJEA 1XCWA 1A4MA 1G01A 4C5ZA 1W56A 1FWGC 5DCEA 2X30A 4YWIA 1V6VA 3VGGA 1CNVA 2BDQA 3WDIA 4OJYA 4GI8A 4Q3MA 1YTDA 4HJFA 2JIWA 4ZO9A 3VUSA 4CQBA 3RMJA 1BEUA 3TOPA 3AROA 3WDJA 3EWBX 2Z1BA 1VHNA 2V30A 5CSYA 2Y88A 5JQ9A 3KRSA 3SW6A 2IPFA 1H49A 4MVAA 3SCRA 7REQB 2YGYA 1R3QA 1TVPA 2D69A 2G3NA 3HGSA 3S42A 3WLTA 3ZVHB 2TODA 1UD4A 4E4FA 1D8WA 5K4XA 3M0LA 4WOQA 1KCXA 1R30A 1CT5A 1F4AA 1CLKA 1WYIA 4HTYA 3F2BA 3U2EA 3EOUA 2NSOA 1Q66A 2OZTA 1W3HA 2DVUA 2BSLA 2CBUA 5EKYA 4N9EA 4BWLC 1JZ6A 2OZ3A 3UNTA 5DCDA 4PRRA 4NRRA 1XL9A 4LAMA 2EPMX 3MI2A 2QJHA 4UXDA 2C15A 5CPOA 2F7FA 2OB3A 4PEKA 3SM0A 5CAHA 5T26A 2D24A 1D9EA 1CX9A 2V2DA 5M03A 5HUOA 4P8UA 3NWRA 4O0ZA 3OG3A 1JPIA 1V0MA 4TX6A 1YRRA 3L4XA 7XIMA 3W37A 1VCFA 1Y8BA 3LHUA 2PLMA 1A5OC 2E77A 3SJNA 3QC0A 4TUFA 4X2PA 1XGDA 5T9CE 3NIYA 4QQUA 4HN4A 3SCUA 4MYAA 3P5YA 2GK1A 4AH7A 1R3SA 2OFJA 2CCRA 2Y89A 4C91A 5HJYA 4DUVA 2ZVIA 4U3AA 4GVFA 3L5AA 1KNWA 2GVGA 3W7NA 3WBEA 3VI2A 4UQDA 1J0YA 1OYCA 4D6EA 4TX9A 1Q7MA 4UTUA 3UZ5A 2I7GA 4DM2A 1FHUA 2PLKA 3H7VA 2PTYA 3I7RA 2V0TA 2J6XA 2HVOA 1MSSA 1K9DA 4OIFA 3OVGA 1EEXA 1TPC1 2J66A 1GJWA 1UOKA 1U1JA 5G1TA 2V69A 3NYDA 3N73A 3G0SA 3GG7A 1A80A 2PSNA 3DESA 1XRFA 5CZSA 4FP1A 1HJUA 1V6WA 5E5CA 2G95A 3THQA 2R1MA 4O54A 1C7TA 2AQWA 4MLRA 3M0VA 2A7PA 3S46A 2LLEA 2OGJA 3WQGA 3WQEA 5G4WA 1IEWA 4YWSA 4S3DA 4CD8A 4F79A 3ANYA 4W5UA 1I45A 2E5CA 1Y7VA 1WKDA 1QHPA 3UWQA 2WB5A 5TF0A 4PFHA 3R89A 4PB4A 4I7UA 2QYGA 3CUZA 3F2DA 1OT2A 5IDIA 1FVPA 3DG6A 3E2QA 3R11A 3I65A 3VIFA 4YU1A 4JEJA 2PU0A 3GU9A 1WDRA 3FEMA 1FBAA 1Q7ZA 4J2MA 3PSVA 2VDHA 3INPA 1NDVA 1V6UA 1DIEA 2PDHA 3QJAA 3QZAA 3EX6A 2ABAA 3KEHA 1ZGDA 2BY2A 1XYCA 1GUVA 3IIXA 4Y8FA 1BYDA 2CLEA 3O8AA 4HSOA 2QW5A 4PUKA 3OZYA 1HKWA 3RU8X 3E1F1 4X2RA 3RLHA 1ZL1A 1DTNA 2NXHA 4IIDA 1UC4A 5LYRA 1LTDA 1B57A 4ZOEA 1Y5WA 3B8UA 3L4UA 2J8FA 2JIEA 4REQA 1KFBA 5MKGA 3EAUA 1EZWA 4DUWA 4FLRA 2J7FA 3VDGA 4H4IA 5KEZA 1B90A 3KOYA 3LLXA 2RDXA 2WANA 3LN3A 1C29A 2X0SA 1OABA 1NARA 3MYPA 2CFFA 3ZWSA 3SRHA 2UBPC 1RUSA 5GVJA 2OYLA 4IUGA 5DBUA 2CBJA 3WQ8A 1TV8A 4FEZA 2C0AA 3LHZA 4US5A 4NX5A 3UG8A 3ZVIA 5AZ1A 3TAKA 3U5UA 3GXDA 3H26A 2BZNA 2J7DA 3WH7A 4KGJA 5AB3A 3O63A 4DIAA 2INEA 3UZWA 3VABA 1UW9A 3PTDA 4PEEA 1R0MA 1UKPA 4XWUA 2WMIB 1CYGA 3WLQA 2GJRA 2RJHA 4IF2A 2YCLB 4YYCA 1JZ4A 5BZAA 1V77A 3AYTA 5LHFA 2XGBA 1CGUA 5AHLA 1WKYA 3W28A 3CPRA 4EKJA 5AVHA 4MPQA 4Z2KA 1TX2A 4K68A 4L1GA 4A8LA 1XIBA 1JUKA 3MHUA 1O4UA 4YHGA 2BY1A 4BQ4A 4AZHA 2D0HA 3V7PA 5DMMA 1SZGA 4K8EA 1FCVA 2VGGA 2PTZA 3S6OA 2Z1KA 4ENLA 4AY1A 3WD4A 2DV0A 1US3A 4GBDA 4CVUA 5BW6A 3EGJA 2XISA 1QWKA 4K1GA 4MB3A 1B4EA 2X8RA 3FAXA 1EP3A 5BCAA 3W07A 1D7KA 5AHFA 3BE7A 3WH8A 5FIPA 2ZBTA 4IMCA 4UR9A 5I5RA 4QS5A 4PB3A 1DQUA 2PURA 4IMEA 4NXSA 5EPDA 1VBJA 1MUCA 1W0MA 1T7LA 1XG3A 1PZ3A 4HK7A 5HR6A 3UWVA 3WLKX 4A3UA 4QP0A 5C70A 3MYOA 1GQNA 4DWSB 2AL2A 4JTDA 3NZGA 3SQLA 1JPMA 2VENA 1P7TB 4XZBA 1F05A 1W3LA 4J3TA 3QMTA 3EA1A 1OX5A 2XWDA 2YB4A 3WK3A 3WDRA 5FACA 3FAWA 4UTJA 3S9ZA 4TTUA 2SFPA 3S47A 2PDWA 4AD3A 1WAUA 5LXXA 1W9DM 1JDDA 3CO8A 4AY7A 4QM1A 2ON3A 1S5NA 2YBTA 3RJYA 3G1FA 1NAL1 4HHPA 2DEPA 2FFIA 3UWZA 1UUOA 4I7WA 5TQLA 3VC5A 2CLOA 3DG3A 3N9KA 4ZXOA 3WQ4A 3WF2A 4KW2A 5AC6A 4NIRA 4XUYA 3RJXA 4QLKA 4GVGA 4XAZA 1KBLA 2PFHA 2BBFA 4N4PA 3CPUA 3PM6A 4FNUA 2WNWA 4L4PA 3ITTA 3L2MA 1E9IA 1FQ0A 4H8UA 4BFAA 2CWNA 4AD1A 3REQA 2QS8A 5DELA 5REQB 5E9XA 3IIVA 2YB1A 1C9DA 3MWAA 1E6RA 4DZHA 1JGMA 2ALRA 3PFRA 3FYPA 4LUJA 2QUMA 3POCA 1J0HA 2NT1A 1GG1A 1X8CA 1CWYA 2J27A 4CN6A 2VZSA 3W23A 1UD3A 4A2RA 4S3BA 1XQKA 1Z69A 1KRMA 4D1IA 4NJGA 2I57A 3R5EA 2A4AA 3SCQA 1QK2A 2AAAA 1BTCA 3THDA 1Q65A 2ZUTA 4W8AA 4Z2GA 1B3ZA 2V63A 1L9WA 3CB3A 1EWEA 1X6NA 2W0UA 2IPJA 2OZ8A 1LP6A 1VBHA 3MCNA 4UTTA 4IICA 3OIXA 4B2DA 3OJGA 2DT2A 1K02A 4OKDA 5CZKA 3LV5A 3VD7A 2PAJA 2QDGA 3NZRA 3BTNA 5ECUA 5CPNA 3LZ5A 1GOIA 1UIPA 4UQEA 3AI0A 3MZ2A 4MWAC 2EGZA 1S39A 1ONWA 1EDTA 1JZ3A 4KT2A 2BB0A 1YHTA 4PCPA 3SCSA 3SRDA 2PF0A 4US6A 4P61A 4IG2A 3M0ZA 3G3DA 2A3CA 2J9XA 4L9YA 1XYBA 2R14A 1RAKA 4LT9A 3BV4A 5HNTA 3TYZA 4GABA 2HJPA 3EWDA 2WAGA 4MF4A 1O1ZA 3ECQA 4NRSA 3EKGA 1ISZA 2YZRA 1CIUA 4LAOA 1S1PA 1VENA 5FD0A 2XVLA 3QTGA 2HSAA 2VEGA 2WYSA 1RP8A 2BXZA 3G1HA 2ZZ5A 2XINA 1J0IA 4DJFC 2PC4A 3VM7A 4TIMA 3VO0A 5DN1A 3B0YA 1R2TA 3WBAA 1H4PA 2OMAA 3BCFA 3VNLA 4C6IA 1QW9A 3WQFA 5EMJA 5DT7A 1W6TA 1QJWA 2DDXA 3NNTA 3EOSA 3GFXA 3F4NA 2A3BA 5A69A 4FNPA 4CQCA 3TTEA 5BXTA 4DNHA 3SN4A 4C65A 1E40A 2PDLA 1UD8A 2PC8A 2WSQA 4RXFA 3STGA 1ZALA 1BYCA 1B3XA 3DEQA 2HE5A 1EPVA 3W2UA 1ZBVA 3EB2A 3BMXA 4ICMA 1BKHA 2FFCA 3USZA 5K4ZA 1YADA 1VC4A 4MB5A 5IHRA 3TV8A 4K3ZA 4QEHA 4CNUA 4LCQA 4Q7IA 1A5SA 4DJFD 3CASA 3WEOA 2G3MA 1EJ7L 2V5DA 2VZTA 3BLFA 4HQVA 2WOQA 1DHPA 2A5HA 1K9TA 2CYGA 1QPNA 2ACQA 2PDBA 3HGRA 4PMYA 5FJTA 5IRPA 1EHNA 1FUYA 1MW0A 4DBDA 1GVIA 2Z7KA 4FI4A 1WO2A 3ENLA 1H41A 2IXUA 3AXHA 3VFCA 1W31A 1TFVA 3EDJA 2WZTA 2I14A 1QDSA 4AWEA 1ZSXA 4X61A 2RKXA 1K70A 3IUDA 3G2GA 4DJDC 4GQBA 3F5LA 5DY2A 2ASHA 2GVJA 3KTXA 5FOOA 3LGGA 3DN5A 1DWFM 4WUIA 2HNHA 3FK4A 1NDYA 4X60A 4D9PA 3V18A 3E0IA 1LL6A 3H2CA 1FCQA 4H6QA 2WCGA 4DHGA 3KS6A 1Q6FA 3PZUA 5CKSA 5CQ1A 3LMZA 5D8ZA 2H9AA 1MVYA 3PF3A 4H04A 3AS3A 1A5KC 3TVAA 2VWSA 5I23A 3AHZA 2QJNA 1UG6A 4M3PA 3QKEA 1KBIA 3NQFA 4GJJA 3U6WA 4K36A 4M80A 4PRWA 1VYPX 4QDPA 3S1VA 4LBUA 3UYIA 1B31A 2H3BA 3LPOA 1ZRQA 2GJPA 1EJUC 4L65A 4MLJA 4PB5A 4ZOBA 4IT1A 2HDJA 1AL8A 3STEA 1S3HA 1JFHA 1VIWA 1KD0A 4IXXA 4X9YA 1MZHA 2RJGA 2FH6A 1ADSA 4FIRA 1V08A 1QWGA 4AZBA 3HURA 1L6YA 2HK1A 3DYMA 1EQPA 3PWGA 1SW0A 2GDQA 3ARZA 4JIHA 5HQEA 3BSMA 4IMFA 2Z27A 1H51A 4RJEA 2QMKA 1TCMA 3E6EA 1G4PA 2HS6A 3R94A 3BWWA 1KB3A 3WH5A 4YN5A 3WD3A 4GFSA 2VWTA 1GKRA 1HKJA 7TAAA 1ZP4A 3IJLA 2KAUC 1M41A 1DIKA 1OC7A 2HK0A 4D6DA 1UHVA 1E0UA 2EHHA 4HYWA 1QI0A 5K3VA 2Z7GA 1GKQA 3GY1A 4TVDA 1JYVA 3Q94A 2ZX9A 2ZXDA 3EWWA 4F3HA 2EG8A 3STCA 1NQ6A 1O95A 4B5TA 1BYAA 3T05A 1H5VA 2XFFA 4GIAA 3W38A 1NELA 2GGIA 1E56A 3EWCA 2A79A 2CBVA 4O57A 3GBDA 4FNRA 5I3JA 6A3HA 4LS2A 5FF2A 5TBOA 1GVOA 3G5EA 2FGBA 3IJDA 4LALA 2J75A 2AKMA 4W8LA 4J3ZA 3SN1A 3F03K 3JU2A 2WHMA 1KM4A 4KEZA 3ZS4A 1SSDA 1T40A 4AW7A 1Q2RA 1TUFA 4NZCA 2OYMA 3BMVA 1HP5A 1OJXA 2Q3RA 1L6WA 2QUVA 3T8LA 4TV5A 1E4MM 4LQ1A 3PJTA 3WL1A 4M0XA 5EGRA 1ZU8A 2AQOA 2OU4A 3PB0A 3N9RA 1IR1A 4M7TA 3RF9A 2E6AA 3GH4A 5A94A 4TV6A 1JRCA 3GR4A 5DCBA 2I9EA 5CGQA 1UR9A 2E5BA 5AOUA 1QOPA 2OELA 5CPSA 1ODUA 3FCPA 3PR2A 5F1VA 3UBPC 3N19B 2L5HA 3N11A 1IT7A 3ONCA 1UQZA 3GU1A 2ZWYA 1S2TA 3EOOA 2WZHA 2GQ8A 1UBSA 1GYLA 2ZUMA 2XN1A 3CUIA 1ZJBA 4EPEC 3ZXWA 1KC7A 4REQB 3LLFA 5MKGB 5J5RA 2G3JA 4CVWA 3WMLA 4ATWA 3UPMA 4I8DA 4AG0A 1UH2A 3LHYA 3NOEA 4N7QA 4YCOA 3P7YA 3ZLHA 3CAQA 3VNYA 1A4LA 2CESA 2DQXA 4Y6GA 1XW8A 3QC3A 3UCCA 2ZZ1A 1E0VA 1SJDA 2CIPA 3KCOA 2CXEA 1XPGA 3W7IA 5CJ5A 1XDJA 4AIEA 4DWSD 3H2EA 1UR0A 2C71A 1BF6A 2E8ZA 3TN3A 1Q4WA 1SMAA 3GXIA 1GHRA 4HPJA 3L5MA 4KWVA 2PGEA 4ZTYA 1UD6A 1KR1A 3W82A 5I2UA 2QJJA 6REQA 1OCQA 4EXQA 3FEQA 3K13A 5CH9A 4MNMA 3WK0A 2NXGA 1D2KA 3BAXA 2DZXA 2MANA 5JBFA 1ONXA 1EJSC 1CW2A 4UTWC 3HGJA 1A5BA 5FJJA 1VQTA 1IR2A 1RSCA 1OD0A 4LBRA 1JDFA 2PBGA 3QMSA 5LNRA 3TEVA 2HEJA 2XVPA 2A0NA 4QHRA 2ATMA 2YYUA 3ARRA 1T41A 2NW0A 1JG9A 5K2ZA 3WG6A 1JR1A 5D2YA 1OVDA 1OWQA 4NJHA 4F40A 3OIHA 4ALDA 3G1AA 3B8WA 3E3HA 2POTA 3IRDA 1F4HA 1XP3A 1GW9A 4DLMA 4JN8A 4F66A 2HMCA 1GVRA 5A6BD 5D30A 2BHUA 1I9CB 3QOKA 3THAA 2CZVA 2FPVA 3ES8A 2DSWA 3ZQ9A 3W1PA 2Y85A 2AL2B 3TFXA 1HP4A 1K6AA 2E8YA 3QHNA 4UTLA 4FF5A 4H1ZA 3L7RA 4XD6A 3BCDA 3SBFA 2E25A 4IIFA 3VIMA 5C9ZA 1EZ2A 4JTRA 4C7DA 1Z32X 4KERA 4XX6A 1HKVA 2XU2A 5CCZA 5ABFB 3S83A 4R53A 3WEZA 4QTGA 3GDKA 4O0QA 3BW2A