4PMDA

Crystal structure of cbxyn10b from caldicellulosiruptor bescii and its mutant(e139a) in complex with hydrolyzed xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
329
structure length
329
Chain Sequence
b'TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
total genus 127
structure length 329
sequence length 329
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmdA00
2UY3A 3W25A 1PEZA 4J3UA 3MKKA 3UESA 2WSKA 2EXOA 3AMCA 3LMYA 4D6CA 1GJWA 1J0JA 5A2CA 4AD5A 1FH7A 5A8NA 5GNXA 1XYFA 3UR8A 1OGGA 3VGBA 3AMKA 1IZKA 2ZOXA 2GK1A 3VDAA 4Z2LA 2ZUUA 3SUTA 1WO2A 2O9TA 1E55A 1UWUA 1CPUA 1NWTA 4AY1A 1XH1A 1B30A 2D0FA 4UQAA 2ZXDA 2CBJA 4RE2A 4ATDA 1J0IA 5E09A 5HPCA 2V5DA 5BYWA 2ZUNA 3FHQA 3AIQA 1C8QA 5EFFA 4GI8A 2WC7A 4UOQA 3CZ8A 3WQ4A 3S2CA 1PZ3A 3N9KA 5A8QA 2DIJA 5DO8A 1HVXA 3CZEA 3GYCA 4AIOA 1UH2A 5CSYA 5AYBA 4AMCA 3SCTA 4JZ5A 3VPLA 2VZTA 5JBDA 3II1A 3BSGA 1MYRA 1KCKA 4AD0A 1XSIA 1PX3A 2DSZA 5A69A 3AMLA 3CZJA 2WHLA 3AIVA 3ZT5A 3BLPX 3W6LA 1Z32X 3PZMA 1KR0A 2EEXA 3K1DA 3MMWA 4PMYA 2VVSA 1NWSA 5D8WA 1JYWA 4U2ZA 3WMCA 2JIWA 2XSBA 3N15A 4V2XA 1OM0A 1TA3B 2VI0A 1E73M 4C7GA 4DUWA 2BHZA 3CGTA 2J7DA 4ZE5A 4IUGA 5ABFB 3BC9A 2BVYA 4UQEA 1G01A 4HPHA 1OD8A 2D1ZA 1UWSA 4H8UA 3KE0A 8CGTA 1CXHA 1MVYA 3FN9A 1NOFA 2YL8A 1LQ0A 3QOMA 2D20A 5JBFA 3AS2A 1E6NA 1DP0A 3OLIA 4JAWA 1JXJA 1WE5A 3ALFA 3VKKA 1ECEA 4MNKA 3WEOA 1UKTA 2W91A 1B9ZA 4UFJA 5E9AA 3WNOA 3W82A 4D1JA 5A6BA 4V27A 3I3BA 1NWUA 2RGLA 4ZE4A 2ZX8A 4GZJA 4H41A 4QAWA 1W9PA 1XV8A 1ZJAA 1XHGA 3WD0A 1HKJA 5HBFA 1OWQA 2DH3A 3VILA 3EMCA 3BAXA 2BHUA 1RPKA 2JE8A 4H2CA 4K68A 1CECA 5CSUA 2XVNA 5GPRA 3PZ9A 1W3JA 1H5VA 2PWEA 4R5EA 4OJYA 1E6RA 4KH2A 4DM1A 2EQDA 2YKKA 4KRUA 1WAWA 4UQ9A 3WH6A 2VX6A 1UR2A 2DT2A 1JZ5A 3WF4A 2XWDA 1Q6DA 2WCSA 3RJXA 5ABEA 3A4WA 4AZHA 1JD7A 2ZX6A 2VZUA 5BXPA 2JEQA 3VIGA 3WDIA 4UFKA 1G1YA 3N12A 2XFRA 1B3YA 4J3SA 1TE1A 1PIFA 1QI4A 5A6MA 1JZ3A 5IFTA 5LA2A 4GZEA 4W7WA 1U33A 1ITCA 2JF7A 2WNWA 4OBSA 3ARWA 2OWCA 1G9HA 4D1IA 1HVQA 4UFLA 3RDKA 3ZIZA 3VX0A 2WM0A 3KEHA 1WDQA 2F8QA 2WPGA 2W67A 3EYPA 1PJ9A 4JCLA 4JL1A 3W28A 4PMQA 1XRVA 3AIWA 2RGMA 2AMGA 3MUAA 1WCGA 2XVPA 3BAYA 4AYSA 4BQ5A 2OYMA 3QHMA 1HXJA 4PTWA 2WBGA 1NOWA 3NUKA 2ZWZA 2CXGA 1K9FA 3W53A 3GTNA 1I1XA 2WLYA 4HOXA 4EANA 5CQ1A 3WNPA 1RH9A 1CBGA 4H7VA 1J0ZA 5IHRA 4ACZB 1O6IA 2ZX5A 2XUCA 4NRRA 3UR7A 2YBUA 3B9EA 1EO7A 1KCLA 4GO9A 3TTYA 3NIYA 2BFGA 1LJYA 2W63A 1E40A 2QLYA 2XIBA 1GNXA 3AQUA 5JIWA 1XSJA 2J8FA 4WSJA 3DYPA 2V3GA 4WIWA 4CD6A 2CHNA 2F61A 4JKKA 4MADA 1UD8A 3AS0A 4Z2KA 4P7NA 1SR0A 1UR1A 1UWQA 3EMQA 1GORA 3AOFA 1EHAA 3WNKA 3WUGA 2J4GA 1E0WA 4BS0A 1Q6GA 3RIKA 3AFBA 4P8WA 1HJUA 3WQ8A 3N04A 3MMUA 3NSMA 4GI9A 2TAAA 4GPNA 1KGXA 2XWEA 4H8VA 4CUCA 4KMQA 2W4XA 3BAKA 3G6MA 1JAEA 3PZQA 3I3DA 1GCYA 1JF6A 3VGHA 1OB0A 4JFUA 4E2OA 4LPCA 4PMRA 2A3EA 4PMOA 1EH9A 1E1EA 3VIMA 4A3HA 1JYXA 3A47A 3WH7A 5FL1A 3ARVA 5A6SA 2VQUA 1PPIA 2VUYA 2J78A 1AVAA 3W38A 3WNNA 3ZQ9A 3CHCA 3FY1A 3AMDA 1JI2A 4UFMA 1NM9A 3N17A 2D3LA 5ABHA 2CITA 3U5YA 4GI6A 3VNZA 1OGBA 3W6MA 4PSRA 1Q6CA 3RMEA 3ECQA 5F7UA 2YIHA 2CCRA 1V08A 1EIBA 1QNOA 4PBGA 1H11A 4N42A 1X6LA 2DSWA 1X6NA 1EOMA 2DQXA 5A6KA 5I78A 1NP0A 4MB3A 1FH8A 1FHLA 2WVUA 3VIFA 5E6YA 3OBAA 3ARUA 1C93A 1SMDA 3AI0A 4W93A 2WAGA 4LYQA 3ZJ7A 4GINA 2J7FA 3AXHA 4CU7A 4JHZA 3CIVA 3RCNA 4Z2HA 1FOBA 1B3VA 2ZUSA 4CD7A 1DTUA 1CDGA 2WC4A 4RE3A 3VDBA 4JFWA 2VJXA 2CKSA 3D5HA 4MJ4A 5HOSA 4EE9A 3GM8A 4JIEA 4X9YA 4LGXA 2DT3A 4TX6A 4D6HA 1QI5A 3ARPA 3L4VA 1LWHA 1VBUA 3SCPA 4AEEA 1TFVA 3THDA 4PRWA 3RILA 1NARA 2O9OA 1VJZA 2QMJA 4KGJA 3ZT6A 1UR0A 3VGDA 2D22A 4BCEA 4OOZA 1UA7A 5BWFA 2WHKA 1B3XA 3F5KA 3WDQA 1GONA 4KWUA 5D9PA 2YBTA 2ZUVA 3MUY1 3ZOAA 4OIFA 3W24A 3WKZA 1XH2A 3WN6A 5I2UA 4QLLA 1KXTA 4GO8A 1B3ZA 1UKPA 2JIEA 3WF2A 2B31A 1JNEA 5JUVA 1KWKA 2YL9A 1J01A 3ZR6A 1FHDA 4ZXLA 1GZJA 2VO5A 3AIRA 1TA3A 1CWYA 2VTFA 4AISA 3GH7A 1BSIA 6CGTA 2QHAA 2BS9A 2C7FA 2D3NA 4B3KA 2WHMA 1BGGA 2VR4A 3ARSA 5KZ6A 1JF5A 3PTKA 1E6SM 2UY2A 4GQRA 1NP2A 1R7AA 3AJ7A 1HL9A 4HZ8A 3VGGA 4CD5A 2Q8XA 1UWIA 1BVNP 3VUPA 1J0KA 3KL5A 3LPPA 1HIZA 1J10A 3I3EA 4WK9A 3WNLA 1V6WA 1UUQA 3RM8A 4WJXA 3WDRA 4DWSC 4PMXA 1WDSA 5D9MA 1RP8A 4NI3A 3WD1A 2VCAA 2Y5EA 2EPLX 3MUZ1 3VIOA 3MSDA 1GJUA 4CU8A 2PWFA 2GJPA 4MB5A 3M6DA 1MXDA 3BAJA 4W85A 2BY1A 3UG4A 5DMYA 2PWDA 3CZGA 3QGVA 4Q7NA 4UFHA 5AC5A 3E1F1 1EXPA 1W2VA 7TAAA 3WF1A 3W29A 1JYVA 1JYNA 3L4ZA 1MXGA 3ZJKA 1CGYA 4W8BA 4NRSA 4WKFA 2XGBA 5AY7A 3WMBA 2FGLA 3AYSA 1ESWA 3CUHA 3FNDA 4AEFA 3L4WA 1W1TA 1GOMA 3DHUA 3F5LA 2AOSA 5KEZA 3UERA 1HJWA 5EFDA 5AC4A 2YDRA 1F4AA 2WBKA 4GQQA 2C8NA 2WCGA 1CXKA 4IPLA 1HJSA 1LG1A 3PZVA 3AZSA 5HNNA 4FLRA 2YA1A 1K9DA 1E71M 4CCCA 1GUVA 1B3WA 1HNYA 4AXNA 2XVLA 3SURA 4Y7EA 1V3KA 3AHVA 3A6OA 4UQCA 3VVGA 4CD8A 1JZ8A 4KGLA 3SCUA 4JFVA 4DUVA 1E3ZA 2XIIA 1NWRA 4S3KA 3WUEA 2PC8A 2J77A 1BYDA 1VBRA 1TMQA 1JFXA 1BF2A 1W3KA 4OUEA 4IISA 1V3HA 3WQVA 1PBGA 3MS8A 5LYRA 1CENA 2WWDA 1QNQA 3O2LA 3L4UA 1V0NA 2WXDM 4UZSA 1BVZA 4FLSA 4MNJA 3THCA 1E3XA 2DIEA 4Z2IA 5BROA 2PWGA 3RM9A 1KWGA 4BQ2A 4YHGA 2VZVA 1QHZA 4ACZA 2NT0A 2WVVB 3VMOA 1WKYA 5E0FA 4NZCA 5GNYA 2X05A 3AZTA 4J27A 5HDRA 1JAKA 3AHTA 4ACYA 2WKGA 3WFZA 1BYCA 2DH2A 5C8BB 3DECA 1CIUA 1V03A 4J3WA 3AHZA 2DGAA 3FW6A 4HP5A 1DWAM 1ZBCA 1E4LA 5E0CA 1TUXA 1BHGA 2D24A 5EBAA 2MANA 4U31A 4W8AA 4TXEA 2BVDA 1J12A 4PMUA 4U3CA 3POCA 1JZ7A 3GH4A 2XM2A 4GIAA 5I79A 4HA1A 2VQTA 3T0BA 4PEEA 5IHSA 2VC9A 3L2LA 3WEZA 1C8YA 3WY1A 4OOUA 5FL0A 1C90A 3AIBA 4MDPA 2OYLA 1E4IA 3ZM8A 2CBUA 2GDVA 1V02E 4URIA 1WZAA 4UR9A 3HJEA 5A6LA 3AZRA 4M80A 2BXYA 1O7AA 2PB1A 4JHOA 3CBWA 1KXQA 1LF1A 2VRKA 2XGIA 3OB8A 1HP5A 3PTQA 3IJ9A 4F8XA 3GNOA 4ZENA 1KBBA 3KL0A 1CGWA 4PMVA 1MW3A 1XGZA 3VD3A 1D7FA 5LA1A 3BH4A 4MB1A 3BCDA 1E6PA 3VDHA 1FFQA 5I3DA 2QMKA 3GBDA 1V02A 4P8UA 1J11A 3OLEA 1UD4A 4PSPA 2X2YA 3MUIA 1LWJA 2FHBA 4U5KA 3WEMA 3PTMA 1UYQA 3APGA 4UQDA 1FP9A 3NDYA 1ODZA 3QOKA 1B90A 1UWTA 2NT1A 5HXMA 3F4VA 1DWJM 2OWXA 4ATWA 5BCAA 1C91A 2DT1A 3UCQA 3LPOA 3OIHA 1OGSA 1FP8A 1W32A 2XPKA 5CGTA 4W5ZA 2J7EA 7CGTA 4PMNA 1UD3A 4BQ3A 2DEPA 2QPUA 1CNVA 4GZIA 1HKIA 3WF0A 1PX4A 1R87A 4DUXA 1GHSA 1ZL1A 2Y8VA 4EAMA 4TX8A 1XYZA 3VNYA 1EOKA 3M46A 3DC0A 1JGIA 3VINA 2EO7A 2F2HA 1MQRA 1QOXA 5I0DA 5EMYA 3POHA 5BXSA 4H8HA 1V0KA 2BHYA 5I77A 3IJ7A 3VD9A 3AISA 1QNRA 4E8DA 1E6QM 2CYGA 2Z1KA 1HF6A 1G5AA 3MANA 1H0GA 1LL7A 1J18A 2VRJA 3IJ8A 1UQZA 2YDQA 4MNLA 2A3AA 1KB3A 3VIHA 2OSWA 1WZKA 2WZIA 4W86A 3PZOA 1CTNA 3CZKA 1UD2A 1EQCA 2VR5A 3BSHA 4OBRA 2QF8A 1UKOA 1GOIA 3VD4A 1JIBA 1E4NA 1UD6A 1VFFA 4U3AA 2J7GA 4WKAA 4B9ZA 2FDMA 4LX4A 1E4MM 3SCSA 2J25A 3WDJA 3J7HA 5A8MA 4U2YA 1WZMA 3KZSA 3GZAA 3CUJA 2XTKA 4FMVA 1EDGA 2WSPA 4H04A 2X8RA 2YL6A 3CMGA 1C8XA 4YN5A 3N1AA 4YPJA 3A4XA 2GUYA 1KGUA 1AQMA 3WBEA 2J74A 1E6ZA 3VTRA 1J0YA 5I24A 3OG2A 2VRQA 2EBNA 2ZX9A 4CCEA 4CVUA 3FAXA 1OD0A 1VJSA 3AYRA 3CUFA 2V3FA 4TUFA 4XZWA 3EDJA 4CN1A 1QW8A 5A3HA 1WPCA 1ISXA 4AWEA 1WB0A 1XCXA 3ZR5A 1LL6A 4L4PA 3K46A 2ZIDA 4PTXA 3ZT7A 4KRTA 3TP4A 5HPOA 1UOKA 2GDUA 4ML4A 1QHPA 1UA3A 4HZ7A 1CGUA 3ZSSA 3F5JA 1GQIA 3A3HA 3QHOA 1DWGM 2VURA 4C7DA 1QNSA 1VFMA 4OKDA 3OGVA 1UD5A 1PZ2A 1UWRA 4B3LA 4F66A 4XX6A 4AIEA 1AQHA 1JZ4A 4B16A 1GOWA 4MPKA 3CO4A 1K9TA 3NSXA 1CXFA 4HMEA 1I75A 1PIGA 4MJ2A 2XJ7A 4MAZA 2J8GA 1CXLA 3VIIA 5DF0A 3GXMA 1E70M 2WC3A 3EBVA 1YQ2A 1JD9A 1BG9A 4WSKA 2OWWA 1JFHA 1TVNA 3K4DA 1H3GA 2G3IA 4P8VA 4M8UA 3SCQA 3B9DA 5M17A 2J7BA 4FLQA 3RPMA 4AD2A 2VT0A 2PBGA 2JF6A 2CBIA 5BRPA 3LPGA 3RM4A 1QPKA 4UQBA 1FH9A 1BLIA 1KXVA 4XUYA 2WHJA 5CGMA 1VEPA 3AROA 3VM7A 5TD4A 1ISYA 2WK2A 3JUGA 4AD4A 7A3HA 4PUDA 3B8SA 3SCRA 1E56A 2XYLA 1JXKA 2CERA 4HOWA 1GHRA 1H49A 3NYDA 2WVVA 1L0PA 1PX8A 2J7HA 3AHYA 2IXUA 1Y7VA 5CXPA 2D0GA 3ZSTA 3PZNA 3N11A 3U7VA 1XD0A 2WLZA 4LQ1A 2O9RA 3SCNA 1A3HA 4PYSA 3EDKA 1E5NA 4MTVA 1VFUA 4QDMA 2DSUA 1E72M 2PBOA 4LYRA 3ARRA 3IANA 1OSEA 6TAAA 4TTGA 5FIPA 4ZXOA 2WZEA 5CLTA 1UHVA 4AZCB 3PZIA 1PAMA 2GJRA 3PN8A 3VMNA 3HN3A 1NOUA 3IAPA 1MW1A 1C92A 4UNIA 1V6VA 1GVIA 4FF5A 3B9AA 1W2PA 5CZKA 2W92A 5A2BA 1OT2A 1BYAA 4ATLA 1AMYA 5BXRA 4B15A 1JZ2A 5CPQA 5ABFA 1CXIA 1V0LA 1ISVA 2W5FA 2YA0A 2OSYA 4U5IA 1WNOA 2X0YA 4BQ4A 1CLXA 4AD3A 1OINA 4J28A 4XB3A 2DSKA 1H4PA 3OA5A 1W1VA 1ZU8A 5FOOA 1TVPA 1HL8A 1R7OA 2WANA 2E9MA 1IZJA 3PZUA 1MFVA 4CD4A 1DWHM 2ESCA 3W26A 3WMSA 1JG9A 2VX7A 1W9XA 3VD7A 2V5CA 2YDSA 5DEZA 3AXXA 4Q22A 4AZIA 2GFTA 2VCCA 3BCFA 5A2AA 3GXIA 2G41A 1M04A 1BPLB 1M53A 1KFWA 4PCSA 4TTUA 3WFLA 1W91A 3KWXA 5DFAA 1E9LA 2WMIB 4AZ7A 3A4AA 4IPNB 3WDHA 2V38A 2J79A 2EPOA 1E1FA 1GQKA 4LXFA 3WD2A 1GVYA 2XFYA 1UH3A 3ZJ8A 3ARTA 3WD3A 1W1PA 3WQ5A 1TG7A 4QCEA 1JDCA 3W0KA 3L4TA 2XFFA 1KGWA 3VGFA 2CKRA 1BQCA 3MV11 5A1AA 3SCVA 1UZ4A 2E40A 4MAVA 4QP0A 2G3NA 3T09A 2XSAA 3WH5A 5JIPA 2D0HA 3VDCA 3RO8A 5CPTA 1W1YA 2UWFA 4J3TA 5GNZA 2BVTA 3SIMA 2PI6A 2D2OA 3U57A 4QLKA 2OSXA 3GH5A 2EPNA 3EDDA 3VD5A 2O9PA 4D72A 4QLJA 3MSGA 4CU6A 4PMZA 3AHXA 1H41A 2ZUTA 4W8LA 4P7LA 1G0CA 1M7XA 3L4XA 4CKQA 3WBAA 1OBAA 1GQJA 1CGVA 4DWSB 3OLDA 5I5RA 2VNCA 2VMFA 4HPGA 5BRQA 4AZ5A 3BMVA 5A8PA 2WWCA 4P8XA 2WVTA 5I23A 2CESA 1ISZA 4DM2A 3OLGA 2BY3A 3T2OA 2FH8A 1VRXA 1CYGA 1SMAA 1HJQA 1LL4A 2WMKA 3ARXA 3CHDA 2JALA 1IT0A 1W9BM 1V3JA 4HA3A 3UEQA 4W7VA 3BXWA 4JCMA 3CHEA 2EPMX 3G6LA 4A3YA 2GVYA 2X09A 3K8MA 4QCFA 3N13A 3U5UA 1E5JA 2E0PA 3RJYA 1E0VA 2IUZA 2X0HA 3CH9A 2DDXA 2XHYA 2X1IA 1JDDA 4E8CA 4PCTA 2Y4SA 2ZUMA 1VFOA 1VIWA 5IXEA 4W89A 1ZS2A 2G3JA 4QFUA 3CTTA 1H2JA 1KBKA 3WL1A 4FLOA 1BAGA 1BTCA 2A3CA 4HU8A 4J3VA 2VCBA 1W9UA 4YHEA 1F4HA 4Z2GA 2HVMA 3GXDA 4M29A 4RL3A 1E43A 1V6YA 1R8LA 4CGTA 2BY2A 4CVWA 2YOCA 1VAHA 2NSXA 2W62A 3BLKA 2WYSA 3OZOA 1SYTA 1MFUA 2DPEA 1V0MA 5D9NA 2BY0A 1VEOA 1JZ6A 3PHAA 3VOCA 1C7SA 1J0HA 1BG4A 1K6AA 3WL0A 4WF7A 1XC6A 4W87A 2YLAA 3WUBA 2GJXB 2WB5A 5EB8A 3K4AA 3AXIA 3DYOA 1CGTA 1UR8A 2E3ZA 3CMJA 2QPSA 1AQ0A 2YA2A 1QBBA 2J7CA 2ZX7A 4HOZA 3AS1A 4BF7A 1HKMA 1DWIM 5M5DA 1W3HA 2A3BA 5CG0A 3WH8A 2ZXQA 4D6FA 1WZLA 1EDTA 4UFIA 5A94A 3ARYA 3SCWA 1H1NA 5BXTA 4XV0A 1B31A 5M3WA 4AZBA 4NSBA 1OIMA 2ZICA 1XCWA 1HJVA 1WDPA 2CETA 2V3DA 2EJ1A 3OZPA 1OCQA 1V3LA 1KR1A 3VIPA 3ARZA 1Q6EA 2AAAA 3PZGA 4UOJA 3VIJA 1B2YA 1OT1A 1UKQA 1JL8A 1KQZA 4FK9A 1V3MA 1BYBA 3GNRA 1K9EA 4GXPA 1MW0A 3CUIA 4HTYA 4W5UA 1UZ1A 5JBEA 2WMJA 4F9JA 8A3HA 4DWSD 1CZ1A 2ZXAA 1QI3A 3AIUA 1XD1A 4TVCA 4IM4A 3L2MA 1IV8A 5D9OA 3W4RA 4OZOA 4W88A 3K8LA 3VGEA 9CGTA 4AD1A 3O9NA 4D6GA 2G4FA 2E9LA 3PBGA 3BGAA 2WMGA 4JKMA 4AZCA 4UTFA 2XG9A 3NCOA 4D6IA 1FA2A 3T0AA 5M03A 1E15A 1LLOA 1QHOA 4V28A 1B0IA 2BNJA 3K8KA 2VX5A 3SEPA 4UCFA 3NSNA 4HU0A 2GK1B 2FH6A 1E6XM 1QI2A 3T2PA 1XH0A 3FAWA 4LYPA 4M56A 1ZBKA 5C71A 3D3AA 1ISWA 4BA0A 4AC1X 4MB4A 3UG3A 3WD4A 1A47A 4M24A 2VOTA 5IFPA 3TOPA 1CLVA 2FHCA 3CPUA 1P6WA 2CIPA 4NF7A 1UKSA 4J7RA 4W84A 4WKHA 1QNPA 2IXVA 4D6JA 4EK7A 1XSKA 2XVKA 4J3XA 5FKYA 4MDOA 1UQYA 1LG2A 2FGZA 4BZYA 4HZ6A 2G8ZA 3DHPA 5CLWA 1EGZA 2PF0A 2WMIA 4PMDA 1VF8A 3BAIA 3CUGA 3VU2A 4PN2A 4Z2JA 1GQLA 1KQYA 1HP4A 3ZJ6A 3TTQA 4F9DA 4D6DA 3WF3A 3GDBA 1I1WA 2WCAA 3U7BA 2BXZA 2Y8KA 4P7OA 3NDZA 4CN6A 3OGSA 4CN4A 1TR1A 1DEDA 3WQ6A 4AIUA 1V3IA 3W27A 4RE4A 1VB9A 2Y2WA 1ODUA 2A3HA 3VIKA 4M82A 2WKLA 4EKJA 5CPSA 2Y24A 3WUFA 4GKLA 1VENA 2VZOA 4N0RA 2YL5A 3UG5A 4PTMA 3WENA 1ZBVA 5A6AA 1S46A 4W7UA 1CXEA 1UH4A 4S3JA 2XM1A 5GQBA 3TONA 3GXFA 3CHFA 4B9YA 3GBEA 3VMPA 2DT0A 3DYMA 1WP6A 1YHTA 4D6EA 4D71A 2FHFA 1EA9C 1FFRA 3OGRA 2CPUA 1GOQA 5A95A 3FXYA 1BGAA 1US3A 3GNPA 1U30A 4F79A 1TCMA 4ZEPA 1Q4NX 1US2A 1RP9A 1QW9A 2W66A 5I6SA 3NJ3A 1QVBA 2NW0A 3MV01 3WIJA 4P7RA 5CJ5A 4X0VA 3SCOA 3QHNA 2BV9A 4DWSA 3WDPP 1MWOA 1EQPA 1E0XA 2DSVA 1C7TA 4A4AA 1MQQA 2GSJA 3SUWA 3PZTA 3VM5A 1HN1A 3WELA 4C7FA 1W3LA 2VL4A 2Z1SA 4TVUA 4P7QA 2ZWYA 3UETA 1GOKA 3QR3A 4JL2A 2ZUWA 4CCDA 1V6XA 3W81A 2HISA 3AIEA 4HA4A 2ZE0A 3TTOA 5E6ZA 4TOQA 3CLWA 4M1RA 1UR4A 4R27A 3IK2A 1J9YA 1W9DM 2J62A 1EDQA 5A8OA 3VX1A 1NQ6A 1X1NA 1V6UA 3CZLA 1CEOA 4WLCA 3T2QA 4UOZA 3ALGA 1R85A 5AYIA 2EPKX 3EDFA 2VVNA 2WVSA 1ITXA 4U33A 1NH6A 2J75A 3W37A 3HU7A 5IDIA 2YJQA 3VO0A 4AZ6A 3MO4A 2UY5A 2JEPA 3N18A 4JKLA 3T0DA 1DHKA 1QBAA 1R86A 5D8ZA 1MQPA 1GW1A 2E8ZA 1OIFA 2E4TA 4HMCA 2CHOA 3ZMRA 3ZO9A 5C70A 1HJXA 2WMHA 3M07A 2CNCA 1C3FA 3FHAA 1JNDA 1WDRA 1G94A 1HX0A 1TZ7A 3SUUA 2CEQA 1ZB5A 5DT7A 3WQWA 2VX4A 5FD0A 3KL3A 5D4YA 4AW7A 1W9VA 1H09A 1JI1A 4PTVA 4UZUA 1GOOA 1HKKA 1JDAA 2V3EA 1DWFM 4PUEA 3MU7A 5DT5A 3WNMA 3AMGA 3EDEA 4AZGA 5LA0A 2GJXA 1QI0A 3TA9A 3LPFA 1HT6A 2WZHA 3TTSA 2D23A 2OLHA 3BAWA 2C0HA 1EHNA 2YLLA 5A6JA 1GPFA 4M81A 3WH9A 1L8NA 5ECUA 1U2YA 2WMFA 3AS3A 2J47A 1M01A 3M7SA 4X0NA 3BMWA 1UG6A 1CGXA 1UR9A 4JFSA 4MNMA 4L4OA 2O92A 1ZBWA 3HMCA 3L4YA 1SFSA 3ARQA 1BFNA 1EO5A 2OYKA 1KXHA 1M03A 1MW2A 1ZJBA 3MMDA 4JFTA 5ABGA 2CBVA 5E70A 1RD6A 2E9BA 1B1YA 4HMDA 3S6TA 4ZFMA 2ZXBA 3IAQA 4TVDA 2W61A 2VZSA 2G3MA 3T08A 2JFEX 2XVGA 1N82A 2QV4A 3O6AA 1D3CA 4E4PA 1Q6FA 3AICA 2WW5A 3SUSA 3EMZA 2PWHA 4XZBA 1H0IA 3SUVA 2E8YA 5A6BD 1VEMA 5FCZA 2UY4A 3WSUA 1D2KA 6A3HA
chains in the Genus database with same CATH superfamily
3W25A 4DJDA 1PEZA 3DKJA 3LMYA 4D6CA 3OPSA 1AL7A 4U10A 1FH7A 3PULA 1WXJA 2OQHA 2VKZG 5GNXA 4AMAA 3O7UA 4QEEA 4S2CA 5FSEC 1XG3A 4H6EA 4OBTA 2GPTA 2J24A 4QDPA 3SUTA 1GYLA 1KTNA 4GH3A 4LYKA 2F6UA 1P0DA 1XLBA 2CBJA 4ATDA 2Q02A 2YZRA 5E09A 2V5DA 1ITQA 2FVKA 2CZDA 3FHQA 3LLFA 5K9DA 3VC5A 1PZ3A 5DO8A 2PD5A 3P3BA 3IIZA 3NM1A 1SR9A 3GYCA 1V93A 3DFHA 1UH2A 5CSYA 5AYBA 5LXEA 3GVRA 3H4WA 4C5ZA 3UYCA 3ORWA 3II1A 1WUFA 3VYLA 1KCKA 4RCXA 3JVAA 1XSIA 4CQCA 3A4JA 3G1FA 4JQ3A 5HAOA 3AMLA 2WHLA 1NU5A 3FYOA 5MKGB 5AYYA 1Z32X 3WLJA 4YIWA 4HQVA 2Y7DA 1J96A 4PMYA 4GVGA 1KLZA 3NQDA 3BICA 3UXDA 4U2ZA 1TWZA 2JIWA 4PULA 4V15A 4V2XA 3W2UA 1I2NA 1Q7QA 4NUWA 3IJQA 2Y5SA 1Y0EA 3CK5A 3GXTA 1U1JA 4UQEA 4MVAA 1VRDA 1S2VA 5LNRA 3H2EA 2DVUA 2OG9A 4IXHA 3CPGA 1CXHA 4ZBCA 3FSUA 2DZPA 1NOFA 2ZTKA 1LQ0A 3GU2A 4NP7A 1S1PA 2OGYA 2D20A 1DP0A 3OLIA 3FVDA 1JXJA 1IE7C 3H7UA 5CJNA 3WEOA 4JIPA 2W91A 5FF4A 4UFJA 3M6YA 5K7JA 4LU0A 3QW4B 4D1JA 5A6BA 1U5JA 2ZBTA 2NQ5A 2RGLA 4QAWA 1ZJAA 3UF9A 3GQYA 3WD0A 3LEPA 1P6BA 4HTBA 4BHYA 4JTKA 4DEFA 1CB2A 1PB0A 1OC5A 4XBSA 4A22A 1W3JA 5CPNA 1SQ7A 1VHNA 2Z26A 4S3BA 4GYJA 1A5KC 3O63A 2YKKA 4QQUA 2XU2A 4UQ9A 3WH6A 4XO6A 2QXWA 1UR2A 3L0KA 3WF4A 2XWDA 4Y9AA 4UCGA 4WQ6A 1IR2A 3A4WA 2Z2UA 1XP3A 1TCDA 4XVDA 3TYZA 2QUMA 1V6TA 1B3YA 4GVHA 5A6MA 4ZSUA 2V81A 4Q8QA 4H9UA 2FZMA 4XK2A 1SM9A 1P7TA 1PVNA 4PTNA 2FDSA 4O13A 3U2CA 2RDUA 5AHNA 2I56A 2PD9A 4OE7A 3P74A 2WNQA 4JNYA 4UFLA 2A3LA 3W1LA 1XBYA 4GNJA 2F8QA 3SJNA 5FSDC 2CU0A 4C6DA 1OG0A 2R1KA 2O7SA 4XAYA 5BZAA 3PAOA 4TX9A 4H19A 4BEUA 2ASHA 4ZSTA 4MWAB 3MUAA 2QDDA 3BAYA 5CC5A 4AYSA 1HXJA 1W8SA 2E7FA 4QE1A 2Q09A 2HNHA 3SADA 2ZWZA 5I3JA 4DPPA 1J2WA 2VM8A 1XM3A 1VFTA 1RH9A 1TPDA 4CLMA 2BLEA 4QNEA 1O6IA 5HULA 2XUCA 4NRRA 1RVGA 2Q01A 3UR7A 4FB7A 4GO9A 4DRSA 1KM5A 3GVQA 1LJYA 5CEWA 4B5WA 3B0UX 3TYAA 5JIWA 2J8FA 4WSJA 4RPPA 2V3GA 4WIWA 1NTHA 4JKKA 1BXNA 3EB4A 4Z2KA 3V5FA 4P7NA 1UP2A 1EHAA 3WNKA 5EMKA 2J4GA 3LX9A 3HPFA 1BTMA 3AFBA 1HJUA 2RDWA 3MMUA 2TAAA 4H8VA 3TE9A 2G3FA 4N6EA 5ABTA 3PZQA 4O0QA 1OCJA 3VGHA 4JFUA 1EH9A 3L2IA 1E1EA 3SIZA 2CWNA 4ZFCA 1JPIA 1K3UA 2HMCA 2VUYA 3HURA 5CKSA 3W38A 3A13A 2Y88A 3CHCA 1WXYA 1SO4A 1A53A 2PTDA 4O1CA 3RLVA 4XKMA 3B8UA 3V16A 3N17A 2QPXA 4HSOA 3U5YA 1H7XA 4LCQA 3W6MA 1QDSA 3ECQA 1KRMA 2YIHA 4B5XA 2DSWA 3A9BA 1X6NA 3SGZA 2JGQA 1H7RA 3W7NA 3DGBA 4L7ZA 3SO7A 3OBAA 3KDOA 3KTXA 1MNZA 3KOWA 3QSRA 4LYQA 3VCNA 4GINA 2GZXA 4JHZA 2ATMA 3CIVA 3PSVA 2R91A 4ZA0A 2RJGA 1DTUA 1CDGA 2WC4A 3IK4A 3KOZA 5G1MA 4DQWA 4XO7A 4JFWA 1CCWB 2V63A 3EWDA 4EE9A 3MI6A 4M51A 3GM8A 2CLFA 2DT3A 4TX6A 3R8GA 3N73A 3QQ0A 5DLCA 1RBOB 1VBUA 1WV2A 3SCPA 4AEEA 3LLXA 3MUCA 7REQA 1AD4A 3R58A 2JGYA 1O60A 3ZT6A 1YIXA 4BCEA 1XIHA 3H7RA 1K8YA 4H6RA 4MWAD 1B3XA 1FWSA 1GONA 3W2KA 2D2HA 5MKGA 2BWGA 2YBTA 1ZALA 3N2TA 5AN7A 3WQEA 4OIFA 3WKZA 1XH2A 4QROA 2Z2AA 4QLLA 1QPOA 3WF2A 4DHGA 2BX7A 2IKHA 5JUVA 3F03K 3IACA 1FHDA 4ZXLA 2VO5A 4WVXA 2HS6A 2BS9A 2D3NA 4B3KA 2PZNA 5HNRA 5E1QA 4QX4A 4GKTA 4F4RA 3N2BA 3LG3A 1Q8JA 3WJXA 1JF5A 1E6SM 1RJRA 5H8PA 3AJ7A 4YTTA 3B8WA 4CD5A 4NJJA 4WJEA 1XJBA 5HWJA 3GC5A 3I3EA 1XBZA 1NQKA 3NQGA 3E5BA 4LRTA 4RDZA 3WDRA 2IKGA 3IPWA 2OKTA 1Q45A 5D9MA 2VEIA 3CB8A 4NI3A 1K7XA 1WX0A 2Y5EA 3VIOA 3GHSA 1I2OA 3MSDA 2GJPA 4Y8FA 4QHRA 1MXDA 4BFAA 1AW2A 2BSLA 4PFHA 2YB1A 3BDKA 3UG4A 1G69A 1TR9A 4EAYA 5DMYA 3CZGA 3VDGA 3O0FA 3DFQA 4UFHA 5AC5A 3WF1A 4ICMA 3W29A 2C19A 2SFPA 1JYVA 1JYNA 3GXNA 3JU2A 2X1UA 3B8TA 3B40A 1VC4A 4NRSA 4W8BA 4FO4A 4HPXA 3QH2A 4RE0A 4H6KA 1W1TA 3GR8A 4GHRA 1TV3A 3NXLA 5CJMA 2QCGA 2C8NA 3M0MA 2WCGA 4IPLA 1HJSA 4Z0SA 3PZVA 3AZSA 1XYMA 3S4TA 1IGSA 1XXXA 2I9UA 3UWQA 1E71M 1M7PA 1YADA 1OFPA 2XVLA 3SFWA 3GDKA 2V0TA 3VVGA 3SCUA 4JFVA 3LXBA 2QJJA 5AC8A 1W31A 4JTJA 4RV3A 1UUOA 4MWAA 2QCEA 1BYDA 1JFXA 2VUNA 4D9PA 4UBPC 3V5CA 1V3HA 3MYPA 1I2QA 3CS2A 3L4UA 4ZVJA 1V0NA 4OV9A 4JTSA 3RR4A 4QJ4B 3N9RA 3U2ZA 1SJCA 3THCA 1E3XA 2DIEA 1LP6A 5BROA 1KWGA 2QULA 4YHGA 1QHZA 1BKHA 2V67A 2NT0A 3VMOA 3L66A 3SM0A 4GIEA 3TX9A 5D30A 3L5AA 3LQLA 4XAZA 3FLUA 4LAZA 4QE5A 1DWAM 1XRTA 3BARA 1TUXA 4G2DA 1XKYA 2D24A 4W8AA 4TXEA 1IEIA 1Q6LA 4U3CA 1MMFA 5TIMA 3POCA 2B0MA 4C6MA 3GG0A 3KBNA 1XIMA 2XM2A 1GGOA 5CSSA 3ABOA 3HZ3A 3T0BA 4DO5A 3RUBL 3MI2A 1WOAA 3PY2A 4LAKA 4AUBA 2VC9A 5IHSA 2RFGA 1SPQA 3AIBA 3O0KA 3MVIA 3H4GA 1V02E 2ZDSA 1DKWA 1G67A 5IRPA 1LDCA 1O7AA 4DJDC 3RLUA 2PB1A 2QIIA 2Z4GA 3BO9A 1M3UA 3OB8A 2G97A 1LLWA 3KL0A 1U5VA 2AL2B 2QUUA 4PMVA 1MUWA 3T55A 5M2FX 4H4IA 5DY2A 4ILSA 4O0ZA 1JCMP 2EG8A 5LA1A 1YTKA 2A0NA 3BCDA 2QMKA 3OBEA 2PLJA 2PCQA 3C0JA 4PH6A 3OLEA 1A49A 2P0OA 3OQEA 3MUIA 2FHBA 2TODA 3SY1A 4DXXA 1IXOA 4O1BA 1S2UA 1FP9A 3BJFA 5HWMA 2DZAA 2OWXA 5BCAA 1EC9A 3UCQA 4I9TA 4L9ZA 1X96A 4NAEB 2OEJA 5G4HC 2VENA 1UD3A 2QPUA 4KRZA 4GZIA 1HKIA 4NZ3A 4XAFA 1PX4A 1EIXA 4DUXA 3PUGA 4QS5A 3EXTA 3L21A 4TX8A 3VNYA 3O16A 1JGIA 3LHZA 4I90A 3VINA 4IP4A 2EO7A 2F2HA 1MQRA 1QOXA 5I0DA 1O4UA 5BXSA 1YPFA 2BHYA 5I77A 4WY0F 4KERA 1IEWA 5RUBA 3QV8A 5D04C 6XIAA 4E8DA 3IGHX 1H0GA 2QJNA 1XLLA 2VRJA 2NVDA 3IVSA 4QSHA 4Q4KA 4JN7A 2OSWA 1FWWA 4RZ6A 3IVTA 2VR5A 1EQCA 1FWJC 1T41A 3BSHA 2E5DA 4A3QA 2QF8A 1K77A 4J40A 1Q2RA 1XLKA 4E3TA 3ID7A 4UTIA 2QDGA 2GDQA 1L2UA 1VFFA 3GG8A 4WKAA 4WJ8A 3ABZA 1D3GA 2Z00A 1RUSA 4ERGA 3IV3A 3SRDA 1WZMA 4KW2A 4H3DA 5TQLA 4C91A 1GKPA 1Q85A 2YL6A 5HUOA 5D2TA 4LBSA 3EZ4A 4G7EB 4YPJA 5EMMA 2QVHA 3A4XA 2GUYA 4KEMA 2J74A 3NQFA 1TTPA 4X60A 1EJ7L 2ZX9A 1TTQA 5D32A 1OD0A 2DW7A 2HS8A 2FZ9A 1JDEA 4IPPA 2V3FA 3ZLFA 3C52A 1GEHA 1XI3A 5A3HA 3DG6A 2DY3A 3A23A 1HUVA 4AWEA 3DG7A 1WB0A 1M7OA 3ZR5A 1LL6A 2ZIDA 2FQIA 3ZT7A 5HPOA 3GHTA 1F3TA 3ZSSA 1OY0A 4LB3A 1U83A 2HTMA 2BGQA 2INEA 2VURA 5TAOA 5AC7A 4C7DA 2A4AA 3VI2A 1VFMA 4C1NB 4O1EA 1A50A 1UWRA 3DERA 4XX6A 1AQHA 1R9YA 3VKCA 4B16A 1PCKA 4MPKA 2I16A 3NSXA 4Z08A 1J4EA 3CT7A 1CXFA 4HMEA 1I75A 3U8GA 4MAZA 4UUIA 2XJ7A 2J8GA 4FHAA 2WC3A 3EBVA 2BASA 1LBLA 1VJIA 2OWWA 5DCEA 1TVNA 3K4DA 2IQDA 4ICCX 4LF1A 3NO5A 3Q37A 5C5YA 3CV6A 3B9DA 5M17A 4FLQA 4KWOA 1Z44A 4JS3A 3LS9A 2Z1WA 2L5HA 4US5A 3FYYA 3LPGA 3LCHA 4AG0A 1BLIA 4XSMA 3FX4A 3GVVA 4XUYA 4ZB5A 1VEPA 3P84A 1RD5A 1ISYA 1F76A 1E56A 4E4FA 3NZQA 2CERA 3C56A 2PS2A 3HV8A 3ABSA 2AGTA 6ENLA 5C9UA 1XD0A 5FJOA 4LQ1A 3SCNA 4DVOA 3EDKA 1E5NA 2R1MA 1VFUA 1W3TA 5DMNA 2FTWA 4LYRA 3ARRA 4A05A 3PG8A 4TTGA 2ATSA 5FIPA 4HNNA 2IPJA 5CLTA 4NXSA 3PZIA 3VMNA 3LHWA 2C91A 4GISA 1V6VA 1DIEA 3NOYA 4ZQNA 5HQMA 1W2PA 5CZKA 5A2BA 4FX6M 1XLIA 5BXRA 3EEGA 1R46A 4Q32A 3CL6A 4IFKB 4LVFA 5ABFA 2PCEA 2W5FA 4LEFA 2YZ5A 4U5IA 3TLQA 4CNNA 2X0YA 3IIXA 1K8XA 3W2NA 4XB3A 4F0HA 3OA5A 3V0UA 2AKZA 3F4DA 4K38A 5J8LA 5ENLA 5DBTA 2YR1A 4UR8A 3VE7A 3LGDA 3VNKA 1P1MA 2Y8UA 3W26A 3WMSA 3UJEA 4K8GA 3GDTA 2X1TA 2YDSA 3AXXA 2AL2A 4NAFB 2BOGX 3W7PA 5A2AA 1VBHA 3AO0A 2QZRA 1I2RA 4FR6A 1AL8A 1M53A 4GRSA 3WBXA 3IIOA 4BI5A 3WFLA 4GA8A 2FYMA 4TU1A 3KWXA 2ZRWA 1PV8A 1O95A 2WMIB 1EKOA 1GG0A 3A4AA 3QMSA 2J79A 2EGZA 4N9DA 4ENLA 3SRKA 4WSHA 3B9NA 4AVFA 2YYTA 3IJ6A 3WD2A 4FEZA 2YW4A 3ARTA 2OEKA 4UTWA 1W1PA 2E1DA 3LXCA 5F4XA 3W0KA 5A1AA 4NAEA 3UCCA 1EX5A 1UJQA 3MUXA 4QQ3A 3UR5A 1VGAA 3S1WA 3VCRA 4MY9A 4LBRA 3RO8A 5HMFA 4HKPA 1O5XA 5G4WA 4J3TA 4DZIA 3U57A 1LBFA 2I9EA 4ADTA 1DYSA 4B4FA 2EPNA 3EDDA 4ZTYA 3VD5A 3W71A 3FJ6A 4PMZA 4YTRA 4A2SA 1G0CA 4RX0A 1GTHA 1B4KA 5FA5A 3WBAA 1OBAA 2ALRA 3PSWA 1CGVA 1HGWA 2INFA 4IG2B 1F3EA 3BMVA 3NQBA 4Q8WA 4JTRA 1ISZA 3TYCA 2ZADA 4H83A 5K9CA 3FGCB 1LL4A 3ARXA 3CHDA 3THAA 3PFRA 3XISA 2JALA 1ZAJA 4L1XA 3LCGA 3SFKA 2DJXA 5DELA 2IQ0A 3LNMA 1EJUC 4XIAA 4GUJA 4GWEA 2E0PA 1L8PA 2WZMA 2DDXA 1BKSA 2XHYA 4G7EA 4MGGA 4UMCA 5IXEA 4Z1AA 4W89A 1ZS2A 2J88A 4GX9A 2QDEA 1K1DA 1H2JA 2XGZA 3WL1A 1DJGA 4FLOA 2C14A 4H9XA 2VCBA 1HO1A 1M1BA 4QJ3B 1PYFA 1VPYA 4GQBA 2DZXA 2YOCA 4AF0B 4TMCA 2NSXA 3WQCA 1W17A 3OZOA 2VEGA 4NU7A 1F3WA 1V0MA 5D9NA 1ZNNA 1XYBA 1KKOA 1VEOA 3TN5A 4L9XA 4Q6XA 3VOCA 4ZOCA 2OEMA 1KFEA 3G1VA 1FWBC 1S2WA 1BG4A 1DPMA 2J13A 1UROA 3WL0A 4PB4A 1XC6A 1VFSA 1XQKA 2E1WA 3GTHA 2D73A 3EPOA 4W87A 4Q6JA 1XICA 1UR8A 2E3ZA 3CMJA 4UTLA 2QPSA 3VNMA 2YA2A 1KC7A 2DUXA 3AS1A 4IGNA 3E0IA 3NR0A 2AGKA 1K4HA 4BF7A 1THFD 1W3HA 3WH8A 2OKOA 2ZXQA 1EC8A 1MZHA 1TREA 3QW3A 4RXGA 3TW7A 4MWAC 3SCWA 1H1NA 5BXTA 1RV8A 1XRFA 1KTCA 5M3WA 3V3WA 3T8LA 4GYPC 2V3DA 2G37A 4D8LA 1XBXA 4LS1A 1SJBA 1G7UA 1Q6EA 3PZGA 1OT1A 4KKXA 3UGVA 3VZXA 3DFYA 2ZA3A 1D7KA 4W5UA 5XIMA 8A3HA 2ZXAA 1QI3A 3TW9A 1QT1A 3BGJA 4IHCA 4RZBA 4W88A 3UJRA 2H3BA 3TR9A 4AD1A 5CPOA 1Q7ZA 4D6GA 1QWKA 2P76A 2G4FA 3PBGA 2E6AA 3W07A 1W5NA 1YTDA 4H8NA 3R8HA 1I0DA 1XFCA 3QTPA 1LLOA 3N2CA 2VX5A 3SEPA 1WYIA 4UCFA 4UMBA 3EWUA 4JYDA 2FH6A 1QI2A 4IFKA 4A8NA 3BE7A 1H7WA 1ZBKA 5C71A 3EGJA 2HEJA 1YNQA 2PDWA 4PODA 5IFPA 2VOTA 4WOQA 3R4IA 5EBUA 4JX6A 4O10A 4AYGA 4NF7A 2JBMA 3UY8A 1J6OA 3NEVA 3D47A 1JGMA 1JQVA 3NNTA 1QNPA 4NAFA 4D6JA 1UW9A 5J04A 4N4QA 1XSKA 2XVKA 3IGSA 2FGZA 1LG2A 4BZYA 4EF8A 2PP0A 3DHPA 2PF0A 2FJKA 4L4MA 2WMIA 2PRMA 1VF8A 1YPIA 5K2ZA 3CUGA 1SW7A 4PN2A 3W1QA 4Z2JA 3CO8A 2MNRA 2XDFA 3EX4A 4EPEC 1K8CA 4EP8C 2WCAA 4EPBC 4N9EA 2PTWA 2QCLA 3U7BA 2BXZA 1OF6A 3ITVA 3WLTA 3UXAA 2F84A 1HGYA 4M82A 4GLEA 5CPSA 1DIOA 2WO5A 1Q66A 2VZOA 4R9OA 3QKZA 3TROA 1Y5XA 2YL5A 4PTMA 1FX6A 1RQEA 5DQPA 3RLGA 5A6AA 1XRSA 3NQ6A 1XLAA 2ABAA 4S3JA 2XM1A 4NY2A 5TF0A 3DYMA 3LHYA 1WP6A 1YHTA 3E9AA 3N14A 3BQ6A 4D6EA 4D71A 1FFRA 2BG5A 4L65A 2CPUA 5A95A 4H7CA 1U30A 2ZDRA 4RLIA 4ZEPA 2NSOA 4C6PA 2VFFA 1OCBA 5AB3A 3MV01 3UR2A 1H62A 3NQVA 3QZAA 4QSFA 5DN1A 1E0XA 4IG2A 1C7TA 4AHQA 1LM1A 3KWSA 2GSJA 1DJXA 2AQOA 1XYLA 4WGXA 2V68A 4C7FA 3WELA 1LT8A 1W3LA 4TVUA 2C1GA 3FGCA 2C79A 3TSBA 2ZUWA 4CCDA 1NJJA 3H23A 1V6XA 2HISA 3AIEA 2Z27A 1OFAA 3ATZA 3GVGA 4TOQA 2VR2A 3CLWA 1FDZA 2FPVA 4IIHA 3GNXA 1F9CA 3IK2A 4OGZA 3UWEA 1JRCA 3LDVA 3UCDA 4PZVA 3OO2A 1F73A 1IR1A 1J9YA 5FI8A 3UZ5A 3KP1A 2B4GA 1V6UA 3TOYA 1CEOA 4ZQRA 3ALGA 6ALDA 3EDFA 1DORA 2FJUB 2FZ8A 1KM2A 1EXBA 3QV6A 4E8GA 5LKYA 3LB0A 1RCQA 2YJQA 1QU4A 2Z25A 4X2RA 2IKJA 2PU1A 4GVFA 3QMTA 1P48A 1OVDA 1DHKA 1MQPA 1GW1A 2O55A 3CU2A 3S46A 4AF0A 3UWYA 2NXGA 4HMCA 2CHOA 1HJXA 2CNCA 1JNDA 3TTEA 1WDRA 1G94A 1HX0A 3N3MA 3SUUA 4AWSA 2BP1A 5DT7A 2Y89A 1MXSA 4EWND 4GBDA 4AW7A 3CNYA 4PTVA 4PUNA 1HKKA 2ZC1A 3APTA 4LY4A 4YXGA 3MO7A 4N9BA 1DWFM 3MU7A 1JRBA 1QOPA 3WNMA 4KWSA 4P2VA 4NYUA 3IARA 1F05A 3LPFA 3MB9A 1HT6A 1P0KA 3V0TA 1TPFA 3P61A 2YLLA 5A6JA 3WLOA 1YDVA 4PUJA 2BOFX 1U2YA 3PF3A 4FNRA 3MI3A 5LIXX 1UG6A 1VH7A 4PR4A 3DENA 1KV8A 3O8AA 5FJUA 4JXCA 4KESA 1ZBWA 3WLNA 2W27A 2AL1A 1M03A 1NFGA 3OODA 5ABGA 4F0LA 5HQLA 5E70A 2E9BA 2YGYA 3G1AA 3T1GA 3S6TA 3ITOA 2Y5JA 1HQTA 1VYPX 3GUGA 4IOTA 2XVGA 3QC0A 3A5VA 3P5YA 1HKVA 3G24A 1D3CA 4E4PA 1PWMA 1IEXA 1Q6FA 4FIRA 4GX8A 5AYXA 4C6LA 2QCNA 3NQAA 3SUSA 3ENLA 2A1YA 3SUVA 1KV5A 4PRTA 1IT8A 3UPMA 4IMEA 2FPYA 4JGDA 3WSUA 1D2KA 6A3HA 2UY3A 5IM51 3N6HA 5DRIA 2WSKA 2EXOA 3AMCA 1V77A 5FJPA 4E0CA 1TPB1 4XZIA 1J0JA 3STCA 1ZP4A 3LTSA 4AD5A 5A8NA 2ZA2A 2V2DA 2V2CA 4HCLA 4KWWA 4E3VA 3AMKA 3GYEA 2ZOXA 5AZ1A 1R2RA 4TQTA 1UWUA 5FJTA 4GC4A 1NWTA 3BJTA 1XH1A 2D0FA 2Y0FA 3I10A 2J6VA 2ZXDA 4RE2A 4XZLX 4V1XA 3Q2DA 1J0IA 5BYWA 7ODCA 5I02A 2ZUNA 2ZE3A 1M9HA 1RSCA 1EL3A 3CZ8A 3S5SA 3S2CA 3N9KA 5A8QA 3SAZA 3E0LA 3CZEA 3UY7A 3LENA 3M4HA 4Y9MA 3VPLA 4IICA 2IW0A 1YTEA 3BSGA 3U4FA 1MYRA 3C3NA 3E2SA 4AD0A 1PX3A 1FKXA 4KCVA 2ZQ0A 5A69A 3CZJA 3AIVA 4MM1A 4A35A 3BLPX 2ACQA 2KX9A 3S1XA 3VOFA 1Z8AA 4WDXA 3MMWA 1X7IA 3R89A 4ZOBA 2A85A 1Z69A 3NO3A 3ITCA 2XSBA 3N15A 1MNSA 2QAPA 1TA3B 2VI0A 3LV5A 2X7VA 3TYEA 4RV8A 1HTIA 3PJWA 1RY8A 2BHZA 2WQDA 4IUGA 4ZE5A 1KKRA 2ZZ1A 5FJJA 4UTJA 5F4SA 1A80A 3KE0A 5LSMA 1W0MA 4G6CA 4AY8A 1OCNA 2YL8A 4FP1A 3MC5A 4RK8A 1WE5A 4MNKA 1XLCA 1B9ZA 4FR1A 1PTAA 4Y6GA 1A4MA 4TV6A 4JHMA 3USZA 5AC6A 3S5NA 2ZYFA 5HMSA 2DUAA 2ZX8A 4GZJA 4UWMA 1W9PA 1XV8A 1HKJA 1XIFA 2IPWA 2XH7A 1MEWA 4N6FA 2TMDA 2POTA 4H2CA 2XVNA 2CLHA 4ADSA 2VC5A 3TV8A 1H5VA 3BK0A 2ZRYA 3PTDA 2PDLA 5BNKA 1E6RA 3MHUA 4GJJA 3LSBA 2EQDA 4KRUA 1QTWA 2VX6A 4ZO6A 4M7TA 4FXRA 1DJQA 2DT2A 1JZ5A 1Q6DA 2WCSA 3MTWA 4L4LA 2QJMA 3P8JA 2JEQA 3VIGA 4Q4PA 1KM6A 1F61A 1G1YA 3N12A 4IMCA 1QI4A 1T8QA 4LB4A 3P8IA 5LA2A 4GZEA 4W7WA 1U33A 1NELA 5A8GA 4C5YA 3HPAA 2JF7A 1P0EA 4E38A 4I8YA 2WKJA 3DEQA 3WJZA 2OWCA 3BG3A 1HVQA 2R6OA 3ZIZA 4S3CA 3VX0A 1LYXA 5C7HA 4BI7A 3QM3A 1GJPA 1UB3A 1PJ9A 1AH0A 2XVPA 3PFMA 4KEVA 3IV8A 3QVQA 3MQTA 3B04A 1JVNA 3TN3A 3HPXA 4FA3A 3NUKA 2PGFA 2PGWA 2OELA 3R25A 2DVXA 4C1LA 3SQSA 5CQ1A 3WNPA 1D8WA 4FALA 1KD0A 5DMMA 1S39A 3PJUA 4YS1A 4QRNA 2RJHA 5XINA 1KCLA 1N8WA 1X1OA 3LRMA 4DF2A 2V5LA 2BFGA 2HZGA 1ZAHA 5L6UA 1E40A 2HCVA 2QCFA 2V5BA 5F1UA 2XIBA 3ANUA 3DYPA 2BVWA 3ONBA 2F61A 4LCSA 3SR7A 4MADA 2AAMA 3EMQA 3B9OA 3P81A 4IIDA 1V8EA 1WQ5A 3AOFA 3EXRA 4YWIA 4NYYA 2HJPA 4HPJA 2Z2BA 3M5YA 3NSMA 3M5VA 4GI9A 1WAUA 4GPNA 2XWEA 1JAEA 1GCYA 1OB0A 4PTDA 4LPCA 4PMRA 4F40A 3N25A 2H90A 4WRHA 3VIMA 2YFOA 1JYXA 3DESA 5C0QA 2VQUA 1PPIA 3QFWA 1OZQA 1JI2A 2PEVA 2D3LA 5ABHA 2PC4A 2CITA 3SN0A 4GI6A 1OGBA 4AHPA 3RMEA 1OX6A 4PBGA 1H11A 1X6LA 4DZHA 2DQXA 4BF9A 4LTSA 3UQNA 4MB3A 1N8FA 5EY5A 1FHLA 2FFIA 3M44A 1C93A 3TJ4A 4S3EA 3HJZA 5AHLA 1T0OA 4W93A 2NLIA 4UMAA 3ZJ7A 3DDMA 2J7FA 4CU7A 4H01A 4Z2HA 1YXDA 1WKEA 3VNLA 3QTGA 4CD7A 3IJIA 5CBJA 4ZO9A 1PDYA 2CKSA 1RA0A 3OVRA 4LGXA 1IIHA 1JPDX 1SZEA 3QPZA 3SGUA 2VEPA 3E3HA 3S47A 1LWHA 4V33A 1XPYA 2FVLA 3RILA 1NARA 1AJ0A 4I5UA 2O9OA 1VJZA 5BRBA 2QMJA 4KGJA 4LRSA 1ML1A 1F6YA 4GOAA 4TMBA 3AU6A 4F3HA 2WHKA 2VWTA 3LHUA 4KWUA 2XIQA 3E2QA 4J9JA 3CL8A 3ZOAA 2PDFA 3WN6A 3WMLA 4IZGA 1KXTA 4GUGA 4DBDA 3C2YA 1B3ZA 3CAWA 1UKPA 4FNPA 3LCFA 7ENLA 1KWKA 3MA8A 2NVCA 1TA3A 1OQFA 1RCOB 3MDUA 1LBMA 1DOSA 1BSIA 3RMJA 1YMYA 6CGTA 3LRKA 2C7FA 4AHOA 1ZGDA 2V6AA 3R2GA 5CPMA 5KZ6A 3IGUA 2IS7A 3UNTA 4GQRA 5FJRA 2Y7FA 2OU4A 1DQUA 2Q8XA 2XSXA 1J0KA 3KL5A 2POZA 8TIMA 3OQ8A 4K7VA 3LPPA 1HIZA 5KMYA 3KAOA 4CQBA 4MHBA 2Z1XA 3GKAA 2BB0A 3KCLA 4QJ1A 3GG1A 1L9WA 3IRDA 3B8VA 3WD1A 2VCAA 4KCWA 2EPLX 3MUZ1 5EL1A 3Q67A 1GJUA 3OYZA 4DBWA 5AHEA 3KCJA 3VKAA 4H2HA 4WXZA 5F2MA 4PMJA 1ELSA 1R3RA 3OZYA 1ZENA 3OJGA 4L1WA 3L4ZA 6TIMA 3CASA 1XG4A 3EOSA 4LF2A 3JS3A 4WKFA 5KTLA 1JPMA 2XGBA 5AY7A 2GWGA 1VLWA 3L68A 4F0RA 4AEFA 3L4WA 2AMXA 2OOFA 1GOMA 3BLOA 3KXQA 1IWPA 4AH7A 3ZZ1A 5KEZA 3Q45A 3NL5A 1RHCA 2YFNA 4O50A 1R30A 1HJWA 5AC4A 3RK8A 4N4PA 2Q8LA 3UWVA 2WBKA 2PDKA 2CLEA 1AUSL 1CXKA 1JCXA 3IUDA 1LG1A 5HNNA 4FLRA 2YA1A 4EXQA 2P50A 1HNYA 3S1UA 4AXNA 2A6LA 5ECVA 5E5CA 3GDLA 3CQ0A 1V3KA 3LM3A 4GUIA 5C2CA 4LAMA 2QAFA 3E02A 1NWRA 3WZ0E 3VFLA 3WUEA 3TK7A 4GABA 3M0JA 2C3ZA 2J77A 4C6KA 1VBRA 1E9YB 1W3KA 1DXIA 5D37A 3HQ1A 3CAQA 3HB9A 4IISA 5I03A 3WQVA 3RX3A 2NUWA 1PBGA 1G4PA 1CENA 1LRNA 4RPQA 3O2LA 1A5BA 1U1HA 5D2XA 4MUPA 5EYWA 4Z2IA 5H91A 2PWGA 4BQ2A 2QVNA 1AJ2A 4B5VA 4LUYA 1WKYA 4NZCA 2X05A 2JQXA 1EX1A 4LY8A 4J27A 4DPQA 1JAKA 1MUMA 3M9YA 4ACYA 5CC3A 3BANA 1NFBA 2EJAA 3DECA 4LW7A 2VD9A 2DGAA 4L64A 2RDXA 3BV7A 1E4LA 1UCWA 2YCIX 5EBAA 4ZQOA 3MP4A 2BVDA 4C6NA 4PMUA 4NNBA 4HA1A 1EJWC 2VQTA 4M3PA 4PEEA 3KRUA 3W1PA 1EJRC 3WEZA 3GD6A 5FL0A 3EWBX 4MDPA 2OYLA 5HA7A 4J2PA 3M64A 3R8RA 2NWRA 1UZDA 4URIA 1WZAA 4UR9A 1ZTVA 1PS9A 4AIBA 1XLEA 1PZ0A 2TYSA 1LF1A 2VRKA 1HP5A 3IJ9A 1AD1A 4O12A 3GNOA 3QY7A 3KHDA 3MDWA 2HK1A 2PE4A 1KFLA 1XQLA 4W4QA 2BTMA 1JQXA 4MB1A 1E6PA 4QR6A 4J35A 1V02A 4P8UA 3MWCA 4MJMA 1TQJA 4LBUA 2XIOA 1LRQA 1FCVA 2X2YA 1JCLA 3LBMA 1KCZA 3OHMB 4U5KA 5FF0A 3MJMA 4LVGA 1S5WA 3G1YA 4NZFA 5LNSA 2CLIA 4AY7A 3NDYA 1ODZA 2NT1A 2ZCGA 2UV8G 5HXMA 2ODOA 1OYBA 2PZ0A 4XZNX 2DT1A 3PNUA 3LPOA 1FP8A 1W32A 3QR1A 4MOZA 3BURA 1VFHA 5FF2A 2A2IA 4QAIA 2LLEA 4ZOEA 7CGTA 1I45A 3MMTA 1GZGA 3NPVA 5KZEA 4BQ3A 1CNVA 1TUFA 4RKAA 4PCFA 3ZXWA 5IDZA 4DN1A 1MSSA 1XYZA 2VDHA 3I7SA 3O15A 3MCMA 4Q8OA 1QO5A 6REQA 1D9EA 1W1IE 5EMYA 4ORIA 3CXOA 4POCA 4JDYA 3THUA 3R7MA 4HIBA 5LNVA 3VD9A 3KBWA 3AISA 1QNRA 1F07A 2X1RA 4PBEA 3B8IA 1AG1O 4K2SA 2PDGA 1XLMA 2B7OA 8RUCA 3IJ8A 3HQOA 4GH1A 2YDQA 2A3AA 2OX1A 4H7ZA 4ZL1A 2WZIA 2Z7KA 1LOQA 4JQ1A 4W86A 3PZOA 2YX0A 4GUFA 4OBRA 2PLMA 5HMEA 3VD4A 4NILA 5FF3A 4JYEA 4JY8A 4M6QA 4MSSA 1N55A 1XIEA 3EOEA 1E4NA 3KHJA 3ZYZA 4U3AA 4B9ZA 2FDMA 3DBNA 3UU0A 5MHBA 3SCSA 2J25A 2PDBA 4S23A 3WDJA 5A8MA 3BMXA 2E28A 1ADOA 3S9YA 1EDGA 1XISA 2WSPA 4H04A 3CMGA 4YN5A 2PDHA 4ZZ9A 3N1AA 1KGUA 3EKZA 3H7VA 4LUSB 1AQMA 5HJYA 1E6ZA 3VTRA 5I24A 3OG2A 1YW1A 2EBNA 1Q7MA 4CCEA 4ZOAA 1VYRA 4BR1A 4LT9A 3L67A 2FB2A 4TUFA 2PDNA 4L5ZA 4XZWA 3M1ZA 4ML9A 1PYMA 3L7RA 2VC6A 1ISXA 1RVKA 4ZQPA 1BSLA 3PB2A 4PTXA 4GQ0A 1QHPA 4XBKA 1UA3A 4HZ7A 1F5ZA 2G95A 3F5JA 4JNZA 4KBXA 4RUBA 1LRTA 1MDLA 1X6UA 1Z3NA 2DZVA 1P0NA 4A8RA 3GIYA 1J2BA 4LNCA 1VQTA 4OKDA 1ONEA 1W1A1 4L61A 3CO4A 2BMBA 1K9TA 3S1VA 5PTDA 1EZ2A 1PIGA 4MJ2A 1CXLA 3GXMA 1TV8A 3O1NA 3FOKA 3UG8A 1KO0A 3SY5A 3IUIA 1DIKA 2X30A 4ERAA 5XIAA 5FEZA 5L9FA 1JFHA 1VBJA 1H3GA 4LC8A 4JTCA 2X2GA 2F2KA 4M8UA 3FYPA 3NQEA 4KS0A 5C9ZA 3WLSA 2PBGA 3IIPA 4S3AA 2D2GA 4EVZA 5AKQA 2JKEA 1MO0A 1BD0A 4C60A 2ZZ5A 1KXVA 4DXKA 3UZWA 1GVFA 4O1FA 3KVMA 3VM7A 4Q8MA 4X3ZA 4RJEA 2XYLA 2Z1BA 1JXKA 3NYDA 3H8AA 3AHYA 3A3WA 4FXJA 1DL3A 2D0GA 3FIGA 1YRRA 3PZNA 3KX6A 1H7NA 3N11A 3ABRA 3MPGA 3DFPA 4YVXA 3SN1A 4QDMA 2DSUA 1E72M 2PBOA 3S6OA 2VGFA 3IANA 4HJFA 1OSEA 4DYKA 6TAAA 2WZEA 5C9XA 3T05A 2GVJA 4FX8A 3PN8A 3YPIA 3WQGA 3KBSA 4JTAA 2ON3A 1C92A 4UNIA 3GY1A 4GGHA 2W92A 3G3MA 3G3DA 1FRBA 4B91A 4LSBA 4F2UA 5CSRA 4B15A 2P3ZA 5CPQA 4PL1A 1CXIA 1V0LA 4GCXA 3G2GA 2J27A 3E2RA 3OOQA 1WNOA 3QLDA 2OLSA 1CLXA 2B7NA 1OINA 3FDKA 4J28A 3BCJA 4LNYA 1ZU8A 3USBA 2DORA 1W5QA 3S1GA 2E67A 1QATA 2WANA 1ZFJA 1SUXA 3BLIA 1IZJA 3PZUA 1MFVA 1WUEA 4CD4A 5EMLA 1DWHM 2QT3A 2RAGA 2PSNA 2NQLA 1ZUAX 1W9XA 1MRQA 3VD7A 1O68A 2V5CA 5FEWA 4AZIA 3BCFA 1U5HA 1M04A 1BPLB 4RDVA 2HQAA 4YTUA 1SVDA 3TNOA 1TJ0A 3TFXA 4PCSA 1T96A 4DYJA 4AZ7A 3H2FA 5LIYX 2E25A 3G8RA 4NKCA 4DBUA 3LGEA 1TX0A 3G8EA 3GKFA 4LXFA 2TRSA 2XFYA 2GQAA 3ZJ8A 1R3WA 3W7QA 1JDCA 3VNJA 1KGWA 3VGFA 1BQCA 1OZMA 3SCVA 2E40A 3E0VA 4CNUA 1TV7A 3VDCA 4B5UA 3JR2A 3M0LA 1AZ2A 1H50A 1HO4A 3SIMA 2PI6A 4LEQA 3TAKA 2OSXA 4JTEA 1PIIA 2R94A 3GH5A 3DX5A 2O9PA 1YEYA 4QLJA 4XAGA 3MSGA 3LCWA 4CU6A 2ZUTA 2QCMA 3R6IA 5GJPA 4JPGA 1VFLA 3L4XA 1EBHA 1XDMA 3EX3A 2PLKA 1LTDA 4Z1DA 3IJDA 2VMFA 1XLDA 3INPA 5A8PA 4P8XA 2QJGA 2WVTA 5KINA 4BI6A 5I23A 2CESA 3C0SA 4DX3A 3EA3A 4QG8A 3T2OA 1VRXA 3L23A 1SMAA 3P2VA 4H9YA 4NNCA 1SZFA 1V5XA 3HPZA 4PUUA 2HK0A 2UZ9A 4FIQA 1IT0A 1W9BM 4GNKB 3F2BA 2PRHA 1RLCL 2R14A 3CHEA 2EPMX 3G6LA 4A3YA 3QF0A 1FUYA 2YB4A 2X09A 3RJYA 1XW8A 1E0VA 1A0DA 2X0HA 3L5MA 1IQ8A 4OVXA 2E5BA 1R38A 3GTFA 3PBVA 1JDDA 3NXFA 4PCTA 1E0TA 1R3VA 2Y4SA 4LUSA 2ZUMA 1VIWA 4HNOA 3P0XA 7REQB 1ALDA 2F9RA 3V7PA 4GK8A 3W87A 1YXYA 1KBKA 1J93A 3ME3A 2A3CA 4J3VA 1NFPA 2ZVIA 3SRHA 1XDLA 3GXDA 4M29A 4L6HA 4HGXA 3PUOA 4RL3A 1E43A 1LQ2A 2P10A 4CGTA 1DIDA 3PPHA 1DBTA 4K36A 2WYSA 4E4UA 1XIGA 4ZQMA 4I7UA 4G56A 2BY0A 1KRAC 5DMLA 1QCWA 1JZ6A 3MCOA 3GW0A 3R0UA 4FSAA 1C7SA 3G1DA 4WF7A 4QS6A 3WUBA 4G1NA 2CLMA 2WB5A 2DW6A 5LIKX 1FVPA 1CGTA 2REQA 3RPDA 4O17A 4Y9OA 1JR1A 5LIUX 4QG9A 1BQGA 3TZNA 2A3BA 5CG0A 1WZLA 1EDTA 4XUGA 1CT5A 4D8ZA 1UPMB 4XV0A 1GG1A 1G7VA 2Z1VA 4NSBA 1OIMA 4HK7A 2ZICA 5FF7A 4LUIA 1S5TA 4JN6A 3R79A 3FCPA 4JN8A 1OCQA 1V3LA 4Y2WA 4OU1A 4MFEA 5I07A 3DBPA 1UP3A 3ARZA 3P7YA 2AAAA 5CPLA 3UP8A 3VIJA 1A0CA 3VOIA 1JL8A 4FK9A 2OT0A 4ORMA 1BYBA 2R82A 3WFAA 2ZVRA 3OZMA 4ZB0A 2OZ0A 5LHFA 3QC3A 2DZUA 4WOZA 3C0LA 1UZ1A 4KIEA 3AIUA 1UIPA 3AUOA 2HE5A 4IM4A 3LCIA 3L2MA 3CQJA 3F2CA 1P43A 3K8LA 3KOFA 4Q4OA 2HROA 1SZGA 2E9LA 2WMGA 4I9JA 5LXXA 4UTFA 2PMQA 1SO6A 4WCJA 2I1OA 5M03A 5EA9A 2EKGA 2HSAA 4V28A 3BV4A 2BNJA 1Q13A 3T2PA 2NX1A 1XH0A 4RNFA 4PEKA 4YLWA 1PKYA 3SDOA 4LYPA 4M56A 3H2MA 2X1SA 4AC1X 3K4WA 3C8FA 3UG3A 5K4ZA 4H9VA 3O06A 1A47A 3WLLA 1P6WA 3NA8A 2XH2A 2Q8ZA 1PL9A 4OWGA 4J7RA 3BPWA 3I4KA 3CWHA 5FJIA 4IIEA 3CQIA 4EK7A 5AHMA 1RJQA 3E0WA 2XIMA 1I4NA 5FKYA 4MDOA 4Z1BA 4GG9A 3G77A 3TZFA 4XIMA 3NVDA 3BL3A 2G8ZA 1F2JA 5CLWA 2FGBA 1AK5A 2V82A 1TPVA 3BAIA 4WZHA 1GQLA 1HP4A 4D6DA 4S38A 3WF3A 3GDBA 1RAKA 4HYVA 4YU1A 1TR1A 1QAPA 1DEDA 3WQ6A 3WK2A 4RE4A 1VB9A 3VIKA 3RLHA 1JUKA 1TVLA 3IVUA 1IXPA 4E2VA 3HGRA 4EKJA 4HPNA 4JOMA 5LNWA 2Y24A 3IGXA 3WUFA 1L6GA 4LAUA 1Q6OA 4EF9A 1GTEA 5F1VA 3CHVA 1OFQA 4KCUA 1S46A 5K4XA 4GMEA 3CHFA 4GY0A 4O0KA 1R3YA 1E9ZB 3KBVA 3OGRA 3VABA 1K03A 4I9MA 3UA3A 5HATA 3FXYA 2HRWA 4F79A 3ANYA 4L6DA 1RP9A 1QW9A 3LHTA 2NVAA 3V1PA 4P7RA 2DZWA 5CJ5A 4HHMA 3SCOA 3QHNA 3EA2A 4IH3A 1VHCA 3A3XA 3V36A 3WDPP 4Q8PA 4A4AA 1GVRA 1MQQA 3TJLA 3EWXA 1PTGA 4O1AA 2FZBA 3SUWA 3CQHA 3PZTA 4QEHA 3VM5A 1HN1A 3OEXA 3UETA 1GOKA 1K7FA 1X98A 4JEJA 1DJIA 3WK1A 5FESA 1KFBA 2BZNA 4HA4A 2ZA1A 4NJGA 2NV1A 4I6KA 2B7PA 1XIDA 3DKLA 4M1RA 1T99A 1EF2A 3W23A 2D69A 1OC7A 1EDQA 5A8OA 3VX1A 1UJPA 4WR3A 3E2VA 3I6EA 3PJTA 5CZ0A 3LCLA 1R85A 3LERA 5AYIA 3MKCA 1ITXA 1H60A 3BZJA 3AU2A 4ERIA 4PA8A 4U33A 2FMOA 2XIJA 3LXAA 5SWUA 3HU7A 3W7DA 3FA3A 1O94A 3VO0A 4AZ6A 1JUEA 4RZ5A 2JK2A 3TH6A 3W1RA 3ZR4A 3EWZA 4JKLA 1R86A 4PBFA 1OIFA 1YE6A 2E4TA 3ZMRA 2Y62A 3WYZA 4Z1YA 3M07A 4IUOA 3W7RA 2GWNA 1EEXA 1ZB5A 3F1QA 3KW3A 3C2VA 3WQWA 3EX6A 5D4YA 2FB3A 1W9VA 1H09A 1GPWA 3TN4A 1GOOA 3TQPA 1POKA 2V3EA 5DT5A 3K13A 1NDVA 3AMGA 3L12A 5LHEA 3BLFA 3TA9A 4ZODA 1ONWA 2WZHA 3TTSA 2G96A 4GE8A 2Y7EA 3WBWA 3GNDA 2AQVA 3B06A 3O6DA 2Y61A 4QDWA 3PWIA 1M01A 5G2IA 3BMWA 3C2FA 1DJHA 3T81A 4JFSA 4WXYA 4MNMA 4LVAA 3BJSA 3HMCA 4ZCWA 5JQ9A 4C6BA 1TV4A 5JXQA 1WA3A 4DLFA 3RHGA 1EO5A 4M0XA 2OYKA 1EP2A 3PWGA 1K8ZA 1OFOA 1Q3NA 3WG6A 1EPXA 1HL2A 1VPQA 2OPJA 4TVDA 2W61A 1I6NA 1YBQA 5J5DA 1B4EA 2JFEX 3HGJA 4DF0A 1JDFA 2Z29A 2QV4A 1KBJA 2GUBA 3TKFA 2C18A 5I3KA 4M6PA 2E6YA 3LZ5A 5D05A 1H51A 4XZBA 2Q3RA 4QITA 1VEMA 5FCZA 3VAVA 2UY4A 3T7VA 4C6JA 3N34A 3CV7A 4K1GA 3WO8A 4J3UA 3MKKA 3NFUA 2MUCA 4IP5A 3GHUA 6XIMA 4V1YA 1TPH1 2VWSA 4X61A 5A2CA 4X2PA 3UR8A 1OGGA 3VGBA 3WBYA 3H55A 3EX1A 4DZ5A 4IGMA 3VDAA 3G1XA 3UVAA 2O9TA 3QKEA 1IF2A 1CPUA 2I5GA 3ITTA 1B30A 2WPBA 1Z9AA 4JD4A 2P53A 3WJWA 3SGGA 4K39A 4IL2A 1UR3M 3WLPA 4IT1A 3COTA 3S5OA 3AIQA 5EFFA 4GI8A 2WC7A 4UOQA 2ISSA 1V79A 3WQ4A 4I7VA 4OFCA 3FJLA 1S2AA 4MMWA 4ROQA 1FCQA 4AIOA 3V4BA 1S5MA 3SZ8A 1AA1B 4JZ5A 4DO4A 2PURA 2VZTA 5JBDA 3QJAA 3NDOA 3S2NA 5H2ZA 4K1WA 2DSZA 1BEUA 4DF1A 4JTGA 4MF4A 1GVOA 3C0QA 1BVWA 4JTDA 2EEXA 1C29A 3K1DA 1UMLA 1NWSA 4AWTA 3BG9A 5D8WA 3WMCA 4O52A 3RITA 2IQTA 2QUNA 1OM0A 3LOTA 1BF6A 1KM3A 4S3GA 3WQDA 4DUWA 3CGTA 5D38A 5ABFB 1PCWA 4QBXA 1EB3A 2I5QA 1OD8A 2D1ZA 3KS5A 3SN4A 1PE1A 8CGTA 1MVYA 4GZ7A 3SRFA 2OZ8A 2QW5A 4H9TA 1UBPC 3QOMA 5JBFA 3AS2A 4JX4A 3G1HA 1N2VA 3VKKA 1UKTA 4A2RA 5CG7A 3N4FA 4YTQA 2VEKA 1REQA 3I3BA 1B9BA 4H41A 4DAIA 5HBFA 1ME7A 2C1IA 3CEUA 3U4AA 2BHUA 4KIRA 1CECA 5GPRA 3PZ9A 2D2JA 4R5EA 4OJYA 4EXAA 3A9IA 3U6WA 3PVFA 4DM1A 2WV8A 4JX5A 3NL2A 2OXNA 1WAWA 2RH9A 4OUIA 4MYXA 4XKYB 3RJXA 4JIHA 3UWZA 3PBMA 4AZHA 5KSWA 1JD7A 3WLKX 4Q8NA 2ZRZA 2RUSA 3H53A 4UFKA 1LROA 3SQMA 3MT1A 3W7JA 1JZ3A 3JZUA 3K2GA 3R1ZA 3W7LA 2F38A 1ITCA 1U22A 1W54A 1NF7A 4WDUA 3FA4A 5JH2A 1RBAA 3RDKA 4DI9A 1G4TA 2FTPA 3BOXA 3ZLGA 3S6DA 1WDQA 3KEHA 2XISA 4HMNA 4US5D 2E09A 4J4KA 3AYTA 3EYPA 1FWGC 3W28A 3G0XA 4PMQA 1XRVA 3AIWA 3I7RA 1BWLA 1MEHA 2AMGA 1XCFA 4M5PA 1WCGA 3B0XA 4XBJA 2OYMA 1J79A 4OT7A 2OVLA 2WBGA 1H61A 5BOOA 1CLKA 3T78A 3CJPA 5DXXA 2CXGA 1TJPA 4GC3A 4CQDA 1I1XA 2WLYA 4HOXA 4AVNA 1CBGA 2QJIA 4H7VA 4EIVA 4ACZB 2ZX5A 2YBUA 3RR1A 3B9EA 2YXOA 4LS2A 1F3XA 1R0MA 3TTYA 2X41A 3NIYA 2WSRA 4R7JA 3RRXA 3KZPA 4PCNA 1JPHA 5CZSA 2QLYA 3AQUA 2NZLA 4AC7C 3EXSA 3TCEA 4CD6A 2CHNA 2PTXA 2B7QA 3S5ZA 4JQAA 3BLDA 4ASTA 1UWQA 4DJFD 3HQNA 3DU0A 3EPNA 2HBVA 1FWCC 4IMGA 3RIKA 1LWIA 1FBAA 3U48A 2W3ZA 4KEZA 4NX0A 3G22A 3N04A 3WQ8A 5EMJA 5D2WA 1KGXA 3P80A 3QQWA 4DWDA 2W4XA 3BAKA 1NIUA 3G6MA 4YJ5A 4CEXC 3I3DA 1JF6A 3VOHA 3CPRA 3WH7A 1L6FA 5A6SA 4H1ZA 1OX5A 2J78A 1RBLA 4GNVA 4YCOA 3WNNA 3GIPA 4QE4A 4IX0A 4OECA 4Y8EA 5F2GA 3AMDA 1ZCCA 3D6NA 1R2TA 4EX4A 3LUTA 2PRLA 1F7BA 3UWUA 3VNZA 3VKBA 4CNTA 1Q6CA 2CCRA 1EIBA 1QNOA 1S3HA 3R12A 4IJCA 4K8EA 4N42A 1ZZMA 3H26A 2NX3A 1QPRA 1EOMA 4B3ZA 5A6KA 3F2DA 5I78A 3LRLA 4FX7A 2EG6A 3E96A 3W2MA 2WVUA 5E6YA 1SMDA 1IIGA 3QY8A 3C3UA 2WAGA 4LJ3A 1WDDA 4DO6A 3AXHA 1ZQ5A 1FOBA 1B3VA 2ZRUA 2ZUSA 1ZRQA 4RE3A 5G1YA 3D5HA 4MJ4A 2OMAA 1QFEA 5E9XA 1XX1A 4JIEA 2QR6A 4D6HA 3TAOA 4B2DD 3ARPA 3L4VA 3C5QA 4CNPA 1TFVA 3THDA 2XZ9A 4P5UA 3OVGA 1YDOA 4PRWA 4OQVA 5D33A 1ZSXA 1A5SA 3W72A 3PAJA 1GQNA 2NX9A 3VKDA 4Q4QA 3TLLA 2H9AB 1OHLA 2ZRVA 1UZHA 5BWFA 3F5KA 4H9ZA 3QYQA 5C7VA 2HBXA 5D9PA 2ZUVA 4LV9A 2Y6ZA 3W24A 1YX1A 7PTDA 3DGRA 5KETA 1JNEA 2PDMA 2BDQA 2YL9A 4F2BA 1J01A 1L6YA 3BOFA 2P0IA 3QGAC 1GZJA 4O11A 4NVTA 1CWYA 2HXTA 3GH7A 3ABXA 3T4CA 2QHAA 3GDMA 2G5WA 1FHUA 2WHMA 2OFJA 3NURA 4DJFA 3QFEA 3ARSA 3MVTA 3CL7A 1D8CA 2UY2A 3KOYA 1XIBA 1XLJA 4Q3MA 1HL9A 4HZ8A 1P0BA 1A5AA 3UZJA 1QWGA 2CXEA 3IEBA 4A6GA 4M1BA 1BVNP 3VUPA 5JH1A 1J10A 1A5MC 3NZGA 4WK9A 1FWFC 3WNLA 1V6WA 3HF3A 3W9ZA 2XH4A 1EUAA 2ZTJA 4CQ9A 4LS0A 2PFHA 5B80A 2A7NA 4B5SA 5BOFA 1R5YA 4O18A 4Q7BA 3C8NA 2F6KA 2PWFA 4CU8A 3M6DA 3P14A 1YE4A 5D2VA 4HBKA 5I7GA 5BU9A 2BY1A 1SZRA 4HZMA 3SBFA 3A22A 2PWDA 4Q7NA 3VUSA 3WJSA 3E1F1 1EXPA 1W2VA 1KM1A 4BF5A 3PWAA 5HJLA 1MXGA 1CGYA 3QZ6A 3CEPA 4XKYA 2J66A 3LBOA 5I3FA 4FNUA 3WMBA 2HE8A 3AYSA 3QN3A 1ESWA 3FNDA 3L0GA 3F5LA 4PFMA 2C13A 2AOSA 4W9TA 3PS7A 2PUZA 1NSJA 2YDRA 4GQQA 3W01A 4PB3A 1J8VA 3AUJA 4Q8UA 1YYAA 4JIIX 1K9DA 4HNUA 4B2DA 2A79A 1GUVA 6PTDA 1R3TA 1GVSA 3F4CA 3EOOA 3A6OA 4CD8A 4DUVA 1E3ZA 4S3KA 3W7KA 4X63A 2PC8A 3O07A 3DOPA 5HANA 4BWLA 3NQMA 1TMQA 1BF2A 3W70A 2GLKA 3W86A 1NF0A 2Z7GA 3KFTA 3MS8A 5LYRA 2WWDA 3RFAA 3JRKA 1QPNA 1L6SA 1T5AA 4FLSA 4ZQCA 4MNJA 2VZVA 1KNWA 4ACZA 4XZMX 3KLKA 2ZZ2A 3AXKA 4HHLA 2OR2A 3AHTA 1GWJA 3P62A 2OT1A 3NQ8A 3KS6A 1IT7A 2DH2A 1R3SA 5BU6A 1CIUA 1TB3A 1V03A 4N9CA 4J3WA 3ZVHB 3B8DA 2P88A 3FW6A 4WUIA 4HCDA 3ITYA 1TO3A 4HP5A 2GOUA 3S3GA 3B05A 5E0CA 2MANA 1TSIA 3E74A 2WNNA 2YW3A 1KRBC 2YXXA 4RNHA 3E12A 3UBPC 1QW7A 3GH4A 5I79A 1WBHA 2WJEA 3W7HA 3E5PA 3GX9A 3WY1A 1U1UA 1A5NC 4O28A 3ZM8A 2GDVA 3QGKC 1FHVA 5A6LA 3DHFA 4M80A 4UNKA 4NX5A 1QPQA 4JTLA 1CI1A 1QO2A 3VC6A 3HG5A 3CBWA 1KXQA 2QCCA 2XGIA 3PTQA 3WJYA 4E2DA 1NEYA 2YBVA 4F8XA 1W8GA 3V35A 1CGWA 4ZMGA 4WDTA 3CUZA 1TWSA 4XTDA 2BODX 4GGBA 3S83A 3VD3A 3B97A 3BH4A 1B5TA 5I3DA 3BW3A 1OEPA 3BW4A 4MY8A 5DANA 5C9WA 1MI3A 1UD4A 2NXIA 1IEVA 1ME8A 4PSPA 5C2GA 1KW1A 2PAJA 3BTNA 4UQDA 4ROPA 3QY6A 3QOKA 1UWTA 3LYEA 1EWEA 3BW2A 1DWJM 1C91A 3C6CA 2QS8A 2XPKA 5CGTA 2WOQA 2QCDB 4GUHA 1W5MA 3RU8X 3TWBA 4TR9A 3VZYA 3RX4A 3HV9A 1QR7A 3S2MA 1GHSA 2TPSA 4NT0A 4IP7A 2Y8VA 1FDJA 1GT8A 4I7WA 3M46A 2H9AA 5C54A 1XC4A 1SFLA 3KBJA 3POHA 4H8HA 3D0CA 3UD6A 4UB9A 3U2OA 3TC3A 3HOJA 4HNCA 1R3QA 3FJNA 2I7GA 2Z1KA 4QGCA 2WJFA 1J18A 4MNLA 3MZ2A 4FF7A 3VIHA 1WZKA 1X8CA 4NZ4A 4QG6A 3M47A 1GVEA 3Q94A 1UKOA 3C61A 1GOIA 1RCXB 3RU6A 3S9ZA 1JIBA 3I6TA 3REQB 3TU9A 3CIWA 1TE6A 4LX4A 1E4MM 3FKRA 2CLOA 2HPIA 2OODA 4JR5A 3DG3A 4B90A 1XGDA 3CUJA 2GJNA 2DJLA 5KZDA 3B0PA 1C8XA 3PJXA 3EOLA 4PUKA 1J0YA 2GQ3A 4XD5A 4YYFA 5J5RA 4RNJA 4CVUA 3FAXA 1HZYA 3AYRA 1TWWA 5D09A 3QV9A 3PUDA 2OOGA 4KT2A 4XSLA 5G4EA 5CBIA 3EDJA 4CN1A 1QW8A 2WNZA 3S5YA 1Q5MA 3W7MA 5HR7A 3QQ1A 4GBUA 1XCXA 2NWSA 4L4PA 3K46A 2QDHA 4KRTA 3TP4A 1UOKA 2GDUA 3I68A 1OFBA 3R13A 3GR7A 1A4LA 4A3UA 1GQIA 3A3HA 3GFZA 1QNVA 1O66A 3RF9A 1QK0A 1QNSA 1RJPA 1UD5A 2PDCA 3NGJA 5JMUA 4AIEA 1JZ4A 1GOWA 2Q6ZA 1VYSX 4S2BA 4FOKA 3VIIA 1UMYA 1E70M 3MCNA 1JD9A 4HHPA 1JCNA 4L56A 3M43A 4LWWA 5GJNA 4PE8A 3SCQA 2PDUA 1EEPA 3N2MA 3RAOA 3RPMA 4C6IA 4HVXA 2V5JA 5H6HA 2OJPA 2CZEA 1TTJA 3KDNA 2VT0A 1F74A 2PWUA 4KETA 3AWOA 4I5XA 1I60A 2CBIA 5BRPA