4PMDA

Crystal structure of cbxyn10b from caldicellulosiruptor bescii and its mutant(e139a) in complex with hydrolyzed xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
329
structure length
329
Chain Sequence
TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 127
structure length 329
sequence length 329
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmdA00
2DSUA 3PZGA 4TVUA 2Z1SA 1MYRA 1GPFA 2WMHA 1KGXA 1JXKA 4D6DA 1B3XA 3A47A 1P6WA 3BAXA 6CGTA 3VD4A 1CIUA 3PN8A 1GHRA 1BFNA 5FKYA 4XX6A 3HJEA 3ECQA 5CSUA 1B1YA 1E56A 1UD2A 1VIWA 1E40A 2F61A 2JFEX 1RD6A 1V6VA 5A2BA 4GXPA 9CGTA 4PMZA 3WH9A 3GZAA 4QFUA 2E8ZA 2PBGA 1XHGA 4NZCA 4DUVA 4AD1A 3SCPA 2XVPA 5I78A 3W26A 2PWHA 4PTXA 3WD3A 3U57A 2BFGA 1V08A 1VEOA 3GYCA 3O6AA 2PWEA 1ISXA 4UZUA 4HOZA 3CHFA 1ODUA 3BC9A 1UR9A 1K6AA 1GJWA 1B2YA 1UZ1A 2W67A 3OGSA 4PYSA 4D6JA 2E0PA 2WCGA 4HTYA 1EQCA 3SCQA 3AICA 4AEEA 1XSIA 3L4TA 1C90A 1J0JA 3CUJA 1ESWA 4NRRA 3N04A 5GNZA 1C8XA 1CXFA 2DH2A 1CBGA 1BGGA 2X0HA 2WMFA 1E43A 2WVVA 4M24A 3OA5A 4OIFA 1NM9A 2GSJA 5I6SA 1Q6EA 3AROA 3FN9A 3TTOA 1XC6A 4ZXOA 1ITXA 3VNZA 1QHZA 4Z2IA 3KL3A 3B9EA 5AYIA 3SUSA 3GM8A 1Q6GA 4JFTA 3PZVA 1CXIA 3K4AA 5E6YA 3WH5A 4UQBA 3ZQ9A 2NSXA 2BHUA 2XWDA 4QP0A 3L2MA 2A3HA 1OCQA 3VVGA 3VIMA 4B3KA 2WK2A 3VIIA 1UH2A 3KL0A 5IDIA 1H5VA 3WQVA 2XGBA 3ZSSA 1JDAA 1B3YA 1VBRA 1VEPA 2VX7A 5D8ZA 5GQBA 1E15A 1E4LA 2J7DA 3UETA 1H11A 4PMVA 3AMLA 1BAGA 3ZT5A 2ZE0A 3AHZA 5M03A 2W4XA 1PIFA 2V3DA 1W9VA 2WKLA 1J01A 5DT7A 4UTFA 3NUKA 1QNOA 4CD7A 4K68A 3WQWA 5CG0A 3L4XA 3S6TA 3WDPP 1JG9A 1TCMA 3UERA 1F4AA 1ZBVA 4M81A 1UR0A 5HOSA 1L0PA 3CZ8A 4A3HA 3A6OA 1NWRA 3D3AA 2PC8A 2YA2A 2W91A 1FHLA 1JAKA 4YHGA 1BYDA 3WBEA 1EQPA 5D9PA 3IJ8A 4W88A 3ARVA 5A6SA 3RM9A 1UWQA 5C8BB 4JFWA 1UR4A 1FH9A 2AAAA 2YLAA 1E70M 4RE2A 2Y24A 2EPNA 1B3WA 1E4IA 4UOZA 1U2YA 5A6MA 1VF8A 3CMGA 3WNNA 3GNPA 2EXOA 4H8UA 4J3SA 1LL4A 1NOWA 1CXKA 5I24A 5I77A 1HJXA 2YL9A 3T08A 3CIVA 4W89A 2CESA 2WVSA 2J62A 3VD9A 3VPLA 3POCA 4CD4A 1JZ5A 1CXLA 4M82A 1JF5A 3A4AA 1W9XA 1OD0A 3ARSA 1C91A 2YIHA 3NYDA 3KZSA 1JI1A 2UY3A 3AIBA 1JNEA 4D6FA 3WEZA 1O7AA 3MV11 1UZ4A 3L4ZA 1UR2A 1OT1A 4GIAA 5E6ZA 1B90A 1GOKA 1XSJA 1XSKA 1RPKA 2W62A 4XZBA 2VURA 1QI3A 4GKLA 4GZJA 1ZJBA 4E8DA 1KBBA 1XGZA 1B30A 2J7FA 2CBVA 2ZUUA 2AMGA 5LA2A 1GJUA 2RGLA 3IAPA 4OJYA 4U5KA 4Z2JA 1GQJA 3VINA 3WDJA 4E8CA 1CEOA 2WVUA 4P8XA 1GCYA 5IHRA 4CVUA 3ZJKA 4BA0A 1GNXA 1M7XA 3CO4A 1WNOA 3VOCA 4ACYA 1TA3B 1X6NA 2YJQA 1JZ4A 3OIHA 1KXVA 3WMBA 2D0FA 2Y8VA 1UA7A 1NH6A 1M53A 1JZ2A 3BSHA 1JFHA 5F7UA 1M03A 4B16A 1QPKA 3AXXA 3WY1A 1WZLA 2QF8A 1G5AA 1J0HA 1HL9A 4L4PA 2ZUSA 1DWFM 2D20A 3BCFA 1V03A 2VOTA 2GDVA 1KXQA 1DEDA 1KGUA 3AISA 1S46A 3TOPA 1HJSA 2WC3A 2ZXAA 4PBGA 3FXYA 1H0GA 4DM1A 5C70A 4BQ2A 2ZX7A 4RL3A 4W93A 5BRPA 4WKFA 4V27A 1QI5A 4ZE4A 5EB8A 4M80A 5CZKA 3WH7A 2C0HA 1MXDA 2VR5A 3GNRA 4H2CA 1CPUA 4F8XA 4ATWA 1UH3A 1RP9A 4TX6A 3VMOA 1HJQA 2V5CA 4AD5A 2ESCA 1W3LA 2YA1A 2WMJA 1W3KA 4P8WA 5ECUA 1OWQA 1ZBKA 2WB5A 1NWUA 2UY2A 2JF7A 1B9ZA 3AMCA 2G3IA 1A47A 4KRTA 1VJZA 4MAVA 1G0CA 4JFUA 3AHYA 1JYVA 1XYFA 1GQIA 3TTYA 1LG2A 4PCTA 5CQ1A 1UWSA 2A3EA 4D6HA 1V3JA 4TUFA 1H49A 4PMUA 3T2OA 3BAKA 1E4NA 1AMYA 3OZOA 3UG5A 3ARUA 3VMPA 4PRWA 3AS1A 4IUGA 3WKZA 1CYGA 2DSKA 4BQ4A 3N1AA 1TUXA 2WW5A 4N0RA 4TVDA 3WSUA 3EDEA 3BLKA 1J0IA 1E1EA 4R27A 1WDPA 4CN6A 5A6JA 2FH6A 3GH7A 1GVIA 2NT0A 3WNKA 3GNOA 4HP5A 4CCEA 4CU8A 4J28A 3VIPA 3L4UA 1E6QM 4PUDA 3AMGA 4LXFA 3QHNA 1QW8A 4W8AA 1PAMA 4FLRA 4V28A 1UD6A 3FW6A 1K9FA 1KR0A 4FK9A 4OOUA 3EMQA 1EO7A 1OGBA 1D2KA 1EDQA 4GI9A 2WLZA 1V6YA 3L4VA 5EFFA 1E4MM 1GUVA 2XVKA 2VZVA 1CGWA 1QW9A 5GNYA 4HU8A 4ZFMA 2WNWA 3AFBA 3BCDA 1XH0A 1ODZA 4J27A 2IUZA 2ZX9A 4TX8A 3B9AA 3W82A 2G3MA 4WSKA 1E6PA 2XTKA 3TA9A 2GDUA 2VVNA 4U5IA 3AIQA 2VQTA 4HPHA 4W84A 4WKHA 1M01A 4GO8A 4LYRA 2ZX5A 2ZUNA 2QPUA 2HVMA 4S3JA 5CLWA 4HOXA 3F5LA 4BCEA 4OBSA 4MADA 1QHPA 2VRJA 2A3BA 3WUFA 1E3XA 3N11A 1NARA 3W6MA 4PSRA 2ZUVA 2WCSA 4C7GA 2W5FA 3VIFA 1US2A 3MANA 1B3VA 3NSNA 4URIA 2XVNA 4HU0A 4U3AA 3W4RA 3KEHA 3UEQA 1D3CA 3VGGA 5HPCA 3POHA 2WXDM 4JKLA 3WBAA 3AZRA 3IANA 3L4YA 4HA3A 3UG3A 3KL5A 4H8HA 4HPGA 3VM5A 3BMVA 4CCDA 3CUHA 1YQ2A 2WSKA 1K9EA 2EQDA 2OLHA 3WF4A 1U30A 5JBEA 3VTRA 3K1DA 2OYLA 3GXFA 1EOMA 3BAJA 4GI6A 2BXYA 1NP2A 4KH2A 2MANA 4AIOA 2W66A 3UG4A 5M3WA 3ARYA 3T09A 1W9DM 4AZBA 2BHZA 1UWUA 4P7NA 3RPMA 4M8UA 4LPCA 4U33A 1E73M 1QHOA 4A4AA 4HA1A 2D3NA 2XYLA 1WDQA 5IFTA 4MDPA 4U3CA 3I3EA 2V38A 2JIEA 4M1RA 1HN1A 4IPNB 1TR1A 2YL8A 1R8LA 3WH6A 2EPOA 4HZ8A 3ZR5A 4AMCA 1JD9A 3UCQA 1W2VA 5BYWA 3OLEA 1LG1A 3AS0A 4W7WA 3N13A 5KEZA 3NCOA 4QCFA 3WF0A 1UD4A 1PJ9A 4UQAA 2X0YA 1WDSA 3T2PA 1R7AA 1LJYA 1DWHM 3WL1A 2X8RA 2TAAA 2BY1A 1WKYA 3ALGA 3CUFA 3KE0A 2VZUA 1G01A 1UD3A 1R85A 4JCLA 5E9AA 3I3BA 3VIHA 1V02E 1JYWA 1SFSA 4C7DA 1UHVA 1EIBA 4HZ6A 3AMKA 3PZIA 1W1TA 4TOQA 8CGTA 4UR9A 2YDQA 4PMNA 2E3ZA 5IXEA 1JI2A 1PX3A 3EDFA 3RM8A 3VGFA 1BF2A 1AVAA 4QLLA 5JBFA 1IV8A 1GOOA 1LF1A 3B8SA 2WBGA 4AC1X 3T0BA 2CITA 3OGVA 1CLXA 1TVNA 3QHOA 4KRUA 3FAXA 1PX4A 1LWJA 1ZL1A 1Z32X 3PHAA 2WWDA 3SEPA 4PMYA 1R87A 1Q4NX 3W37A 5A8MA 1EOKA 5FCZA 3FY1A 5BXRA 3RJXA 4W85A 4AD3A 2E8YA 3G6MA 4LQ1A 2ZUMA 1MW0A 1MFUA 4TTGA 2FGZA 4P7OA 5I23A 1E6NA 5CGMA 1BTCA 3THDA 4PMQA 2VTFA 2VCAA 4A3YA 2YBUA 1KXHA 3GH5A 1CGTA 3VILA 1W1VA 1DWJM 4B9YA 3TTSA 2WZHA 3WNPA 2DQXA 2BY0A 1SYTA 1I75A 1CGYA 4OBRA 1TZ7A 1G94A 3VD5A 1HJVA 1EHNA 4MNJA 1J11A 2FHFA 2PF0A 3K8KA 2DT2A 5JUVA 1KWGA 3ARRA 1XH2A 3BAWA 5AC4A 4L4OA 2CBUA 3WFZA 1BSIA 4J3UA 4AZ7A 3B9DA 2E9MA 4FLOA 2BY2A 1E5JA 3WH8A 3WEOA 1BYBA 2DIEA 3W29A 2PB1A 2VR4A 3M6DA 1KQZA 2Y8KA 1UKQA 2PWFA 4FLQA 3PBGA 3ZMRA 5GNXA 2D24A 3O2LA 4D1IA 3ZJ7A 3BAIA 2J8GA 3MU7A 1R86A 1XD1A 2Q8XA 3MV01 2XIIA 2J78A 3U7BA 1QI0A 1WAWA 1GONA 3VNYA 5BROA 4U2ZA 3RCNA 1HJUA 2X09A 3VM7A 1KXTA 2V5DA 4GO9A 2E4TA 4WK9A 3PZTA 1CNVA 1UKTA 2QPSA 3UESA 4J7RA 4AXNA 3JUGA 4CN4A 4LYPA 2XG9A 3IJ7A 3WDHA 4BQ3A 2Y4SA 3K8MA 2WAGA 3SCOA 3MS8A 3AQUA 3SUWA 1NOUA 3DYOA 4PSPA 4Z2KA 5FL0A 3OGRA 5A1AA 4WSJA 3GBDA 1HF6A 3W0KA 2PBOA 1W2PA 4J3TA 4CN1A 5A2CA 4HOWA 2JEPA 3FNDA 3VX1A 4EAMA 5A8OA 4AZGA 2Y5EA 1HIZA 2X05A 3DHPA 5EFDA 3W28A 1E6XM 4TTUA 2FDMA 4N42A 3MMWA 3CZKA 1VBUA 2DT0A 2VI0A 5BRQA 4WKAA 2ZOXA 2XM2A 1V0NA 1XYZA 4RE4A 5DO8A 4FMVA 3BMWA 4D6IA 4MDOA 1C92A 1ZB5A 1HKKA 3DYMA 2VCBA 1C8YA 1LQ0A 2CKRA 4UQEA 2E9BA 2J7GA 3AYSA 3ZM8A 2JEQA 3CTTA 2EPLX 4MB1A 1EH9A 2D2OA 4IM4A 5ABFA 2OSYA 1I1WA 1ZS2A 2WBKA 1SR0A 4NSBA 3OG2A 2DEPA 2G8ZA 4JIEA 1FP8A 2VX4A 1QOXA 2VCCA 5I2UA 2WZIA 3W6LA 4QCEA 2VX5A 3BXWA 6TAAA 3AXIA 2DH3A 3VKKA 4WIWA 4FF5A 4CD6A 2DSVA 4CGTA 2WHKA 3U7VA 2EBNA 1TMQA 4CU7A 1PZ3A 3VIGA 1WZKA 4BZYA 3WUGA 4U31A 3LPPA 1KGWA 1CGUA 2GJRA 4AIUA 3DECA 1WZMA 4UFLA 4Y7EA 2D0GA 2XJ7A 1MWOA 2VT0A 4CUCA 3WN6A 3QR3A 1OB0A 1HNYA 2OWCA 1GW1A 1RH9A 5CPSA 3MUIA 5ABFB 3MUZ1 2EPMX 4Z2LA 3ALFA 4JCMA 1QI2A 4CD8A 1EDGA 3W53A 2ZWZA 3F5JA 3D5HA 2CHNA 3E1F1 2ZX8A 4B15A 5CPTA 4ZE5A 1J0ZA 2CETA 4XZWA 4J3XA 5JIWA 2WPGA 3ARXA 3PZOA 3DYPA 1V6WA 2IXUA 1E55A 5FL1A 3VDAA 1G9HA 1EDTA 4EANA 4W7UA 3NSMA 1UD5A 4H04A 1HKIA 4RE3A 5CGTA 5BXPA 3CZGA 3VIOA 1NWTA 4JFSA 3WQ6A 2CYGA 4WF7A 4ACZA 1WE5A 3NSXA 4JKMA 3GXIA 1ISYA 2J7CA 4DM2A 1EXPA 1XCWA 4E4PA 3EDDA 1DWGM 2JALA 1BG9A 1W9PA 1VJSA 1E6RA 3ARTA 1NP0A 4PCSA 1WCGA 3BAYA 5M5DA 4IISA 5BWFA 5JBDA 1BVNP 1JAEA 5ABEA 3ZR6A 4GQQA 1HT6A 1J10A 2VJXA 1V0KA 4WJXA 3SUUA 1OINA 4D1JA 5CPQA 1BLIA 2OSXA 4UFMA 3WENA 1GHSA 2DPEA 1CECA 1PPIA 3EBVA 3WD2A 1MW3A 4JAWA 3SCRA 4F66A 1CDGA 4V2XA 1JYXA 3AS2A 5FOOA 1DHKA 4GZEA 1ZBCA 1VRXA 4JHZA 5DFAA 1JZ3A 1V3KA 5A69A 4MB3A 3AOFA 3ZT6A 1UD8A 3AS3A 3VIKA 2WANA 1UWRA 3LPGA 1OM0A 4GINA 1TE1A 3LMYA 1C7SA 1ZU8A 2J47A 5C71A 3GH4A 1J9YA 2F8QA 4OZOA 5IHSA 2C7FA 5D9OA 4ATLA 1SMAA 1NQ6A 1OGSA 1OD8A 4AZHA 2YL6A 1J18A 3GBEA 4H8VA 4MNLA 2WHLA 2ZUWA 1V3MA 1GZJA 1QNSA 1UA3A 1FH8A 3PTKA 1KCLA 3OZPA 2CIPA 3T0DA 2VUYA 5DEZA 1GOMA 4P8VA 1ITCA 1ECEA 3MUAA 3U5UA 4Z2HA 1AQHA 2V3GA 4KMQA 5LA1A 2J25A 4ZXLA 4AIEA 4C7FA 2FHBA 4MB5A 3ZT7A 2EEXA 1J12A 4CVWA 3OBAA 1W32A 3WD4A 2X2YA 1ISVA 1QVBA 1VB9A 1E0WA 1HP5A 5D9NA 4HMDA 3ZJ8A 3SCWA 1BQCA 5KZ6A 3WDRA 4NRSA 3A4WA 1WP6A 2D1ZA 1FH7A 4MNKA 2D22A 3RO8A 1KB3A 3AHTA 3NIYA 2OYMA 4UFIA 1WB0A 5EBAA 2EPKX 2CPUA 2B31A 4UOQA 3N17A 1V0MA 1UYQA 3K4DA 1ISZA 1BVZA 2VC9A 3TTQA 5HXMA 4J3WA 5A8NA 3EDKA 1EO5A 7CGTA 3QOMA 4W8BA 1JIBA 1V3LA 1EHAA 1MXGA 1HXJA 3UR7A 1PZ2A 3AIWA 4UFKA 2W63A 1W3JA 1HX0A 2UWFA 3L4WA 4KWUA 1TVPA 3ARWA 4MB4A 4LX4A 1H1NA 1ZBWA 4EK7A 3W81A 2XSBA 1VFFA 3SURA 2DGAA 1PEZA 3VMNA 1DWAM 3LPOA 3OLGA 3AYRA 1FFQA 1ZJAA 2OSWA 4P7LA 4Q22A 4OKDA 4PTMA 3THCA 1V3IA 2VVSA 1O6IA 3N9KA 2VQUA 3NDYA 2CHOA 1OSEA 1B3ZA 2WVVB 3FHQA 3KWXA 3RDKA 1DWIM 2XM1A 1H09A 5A6BD 1K9TA 4AZ6A 3DHUA 4DWSA 2XIBA 4YN5A 3GDBA 1HP4A 1LLOA 3APGA 4MPKA 4XUYA 3J7HA 2G3NA 4UQCA 3VD3A 3PZUA 3N12A 4J3VA 1E0XA 1LL7A 1GORA 1BGAA 1QBAA 1FHDA 2CERA 1I1XA 1H2JA 1TA3A 1V6UA 4AWEA 2VZSA 3PZ9A 3WMSA 4ATDA 1X6LA 3WD0A 2BVYA 1OT2A 4OOZA 3K46A 3HN3A 4HZ7A 2J8FA 1WZAA 2XVLA 1JZ7A 2WMGA 3WF3A 5I3DA 3OLIA 2XVGA 4DWSC 2ZX6A 3IK2A 4AZ5A 4MJ2A 3WELA 2J77A 3WQ4A 3WF2A 5D9MA 1L8NA 2QLYA 1OBAA 2YBTA 2WVTA 4UNIA 3W24A 1V3HA 4B9ZA 1E6SM 3GXDA 4MAZA 2GUYA 4IPLA 2XHYA 5A6AA 4LYQA 1GOIA 2YDRA 2J75A 1FOBA 2PWDA 3MMUA 5I5RA 1CXEA 4FLSA 1CGVA 1Q6FA 1E6ZA 2WMIA 3BLPX 3WD1A 2YL5A 2YA0A 1JD7A 3MKKA 1WO2A 2VRKA 4U2YA 2EO7A 1XH1A 1MQQA 1OIFA 3ZSTA 1KWKA 2OWWA 2JE8A 2GVYA 1NWSA 3ZO9A 4BS0A 1JXJA 1DTUA 4MNMA 2VO5A 4CKQA 2O92A 4H7VA 1JNDA 2DDXA 5BXSA 2V3FA 3ZOAA 3WNOA 3EMCA 1Q6DA 5E0FA 1V02A 3NDZA 3SIMA 2BVDA 5E70A 3TONA 2WKGA 3HMCA 3NJ3A 3K8LA 1KR1A 3DC0A 2YOCA 3ARQA 2Z1KA 1EGZA 1JL8A 4EE9A 2WSPA 2ZWYA 2CEQA 3AIVA 2O9OA 4X0VA 5TD4A 4AZIA 4D6EA 1PIGA 3SUVA 3WDQA 2JF6A 3RIKA 1JDDA 1PBGA 1U33A 4B3LA 2FHCA 4JL1A 4W87A 2XUCA 5A95A 2XFYA 1JZ8A 1US3A 2AOSA 1MVYA 2PWGA 3N18A 1PX8A 4AEFA 1HVXA 2FGLA 3W38A 1LWHA 1MW1A 2BNJA 3CUIA 3EDJA 2YLLA 4QDMA 1E3ZA 1E72M 3CZEA 1H0IA 4PTVA 2EJ1A 3G6LA 1VAHA 4JL2A 1JDCA 2QHAA 2ZXDA 4DWSD 2DT3A 2D3LA 1C93A 2ZXBA 7A3HA 4TXEA 2C8NA 4WLCA 3RMEA 3VU2A 3MSDA 3CGTA 3AHVA 1QI4A 2A3AA 1E1FA 1ISWA 2GJXA 2XSAA 4EKJA 4CU6A 3RM4A 1QNQA 4Z2GA 5HNNA 2CKSA 1W9UA 2BVTA 3F4VA 1MQPA 2J4GA 4JFVA 5DT5A 5CSYA 5LYRA 3IAQA 4AW7A 5A94A 3ZIZA 2BV9A 4PTWA 3GXMA 3RILA 4UFHA 5I79A 3W25A 1NOFA 3AZTA 1UR1A 3VUPA 5A6KA 5E09A 3WDIA 1UWIA 5JIPA 3TP4A 6A3HA 1CGXA 3WNLA 2D23A 5E0CA 3WQ8A 2VL4A 2GFTA 3CMJA 1IZKA 3WL0A 2G41A 1SMDA 3EMZA 1W91A 2RGMA 1HVQA 2BY3A 3WFLA 4S3KA 4HA4A 4MJ4A 1H4PA 3WMCA 5DF0A 4UCFA 4E2OA 1GOQA 3O9NA 3PZQA 1V6XA 4UQDA 4W86A 4W5ZA 1D7FA 5D4YA 2BHYA 4TVCA 1HL8A 2G4FA 3W27A 5IFPA 1HKJA 1C8QA 4AD4A 1GOWA 3AMDA 1VEMA 1B31A 4QLKA 3AXHA 3BGAA 3CZLA 2GK1A 3CZJA 4YPJA 2NT1A 4AZCA 2CNCA 4HMEA 1QNRA 1VFMA 5A8QA 1MQRA 1BHGA 3VDHA 2WLYA 2V3EA 1F4HA 4AY1A 4AZCB 1TFVA 4PN2A 4AYSA 2GK1B 1XCXA 3MO4A 3OB8A 3CHEA 1AQ0A 4PMXA 3BH4A 5FD0A 5A8PA 4PUEA 4ZENA 5M17A 2O9TA 2J7HA 4W7VA 3WNMA 1XV8A 1JFXA 2VMFA 2WM0A 4X0NA 2DT1A 2CCRA 3SUTA 1W9BM 4DUWA 3SCNA 1GVYA 1BYCA 4W5UA 1E0VA 5AYBA 4QAWA 3OLDA 3WEMA 5BCAA 3AIEA 2ZUTA 7TAAA 3QGVA 2JIWA 1W1PA 5A6LA 8A3HA 1E5NA 1W1YA 3HU7A 2XFRA 1OGGA 4M56A 4YHEA 5GPRA 3GTNA 2G3JA 3F5KA 1XRVA 1RP8A 1UKPA 1E9LA 2XGIA 2UY4A 4AD2A 3M46A 2YKKA 4GI8A 1R7OA 1UH4A 2ZXQA 3CPUA 5I0DA 1VFOA 3AIRA 1BYAA 4H41A 3LPFA 5HDRA 1UR8A 2Y2WA 3SCUA 4P7RA 1UQZA 2FH8A 4AISA 1J0KA 4PEEA 4XB3A 3VDBA 2WCAA 1HJWA 4ZEPA 2GJXB 2WC7A 4M29A 3N15A 2BXZA 1GQKA 1KQYA 3CHDA 3BSGA 3SCSA 3A4XA 2BS9A 3A3HA 3AHXA 4UOJA 4CCCA 4XV0A 1CZ1A 2O9PA 3ARZA 1X1NA 2DIJA 2HISA 4UFJA 1QNPA 4UQ9A 1JYNA 3AI0A 2E9LA 4PMDA 3WUEA 2QMJA 3RJYA 1M04A 3VD7A 1FP9A 4ML4A 2VZTA 4F9DA 4P8UA 1GQLA 2WMKA 2WWCA 1UKSA 3IJ9A 1BG4A 1UOKA 1VENA 4D71A 1WDRA 1W3HA 3CBWA 3M07A 4BF7A 3QHMA 2XFFA 1CTNA 3WF1A 3S2CA 3U5YA 3FHAA 3CH9A 2OWXA 3II1A 2QMKA 4MTVA 4W8LA 5DMYA 2O9RA 3VGBA 3VGEA 2ZICA 1B0IA 2CBIA 5A3HA 2VZOA 3CHCA 3AZSA 5ABGA 2XPKA 4BQ5A 2J74A 1JF6A 2E40A 2J7EA 5HBFA 2J79A 4D72A 2W61A 4GPNA 1LL6A 3MSGA 5A2AA 3ZJ6A 5HPOA 3WIJA 2CXGA 3WQ5A 3QOKA 4GQRA 1JGIA 1CWYA 1KBKA 3VGHA 4DUXA 2D0HA 2A3CA 1FFRA 5AC5A 1K9DA 1WPCA 3WUBA 1HKMA 2WHJA 4GZIA 1H3GA 1E71M 3PZMA 1IT0A 3SCTA 1YHTA 1IZJA 4QLJA 2WC4A 4OUEA 3VX0A 2DSWA 1XD0A 4NF7A 5CXPA 1MFVA 3VDCA 3SCVA 4Q7NA 3ARPA 5AY7A 2UY5A 5FIPA 3T0AA 2GJPA 4JKKA 1BPLB 4UZSA 4PMOA 2WZEA 5EMYA 2QV4A 1CXHA 4JZ5A 1CLVA 2J7BA 1KCKA 5CJ5A 2W92A 2WHMA 1KFWA 2F2HA 3T2QA 2VX6A 1FA2A 1JZ6A 2VRQA 3PTQA 2PI6A 1H41A 1QBBA 4CD5A 1C3FA 1V0LA 2VNCA 2OYKA 1Y7VA 1N82A 3AIUA 4PMRA 3VO0A 2XWEA 3PZNA 3M7SA 5D8WA 1Q6CA 1OIMA 1CENA 5CLTA 4LGXA 3MMDA 4KGLA 5A6BA 2IXVA 3AJ7A 1UQYA 4KGJA 1UWTA 1EA9C 5ABHA 4ACZB 4D6GA 3EYPA 1UG6A 3PTMA 4R5EA 4AD0A 2CBJA 1A3HA 3VIJA 4JHOA 1TG7A 2YDSA 4NI3A 2NW0A 1VFUA 5BXTA 1MW2A 3L2LA 4F79A 1UUQA 3VGDA 3I3DA 4DWSB 3CLWA 1AQMA 2ZIDA 4F9JA 5LA0A 1C7TA 3UR8A 2WYSA 3MUY1 1UKOA 4P7QA 4HMCA 4X9YA 1DP0A 2WMIB 3CUGA 3FAWA 2DSZA 2X1IA 4D6CA 1J0YA 1G1YA
chains in the Genus database with same CATH superfamily
3F2BA 2CW6A 2Z1SA 4GBDA 1MYRA 4PEKA 2WMHA 3DHDA 1GKQA 4C6DA 6CGTA 3NNTA 4UMBA 4US5D 1MUMA 4UR7A 3GHRA 1E56A 1E40A 1H7WA 3B0XA 4AEOA 3GZAA 4DUVA 4GUFA 3ITGA 3UBPC 3WD3A 5C7HA 3U57A 1V08A 1VEOA 1ODUA 4PRRA 2XH7A 1ME8A 1UZ1A 1M68A 2W67A 3OGSA 2WCGA 4HTYA 3SCQA 2QV5A 4AEEA 1XSIA 4AVNA 4NT0A 4NRRA 2PDQA 5GNZA 1C8XA 1EJTC 3GG7A 5T26A 3S5YA 1CBGA 2JQXA 1P0KA 3RHGA 1N7KA 2WMFA 4JNZA 2CLPA 4QS6A 2JBMA 3N6QA 1ALDA 1NM9A 1P4CA 3SECA 3GG8A 2BGQA 4JTJA 1Q6EA 4MJMA 3NQ2A 1XC6A 1FCUA 1R3TA 1ITXA 3VNZA 2ZRZA 3B9EA 4JXCA 3SUSA 4JFTA 3PZVA 2P8BA 3UPWA 4GFSA 3WH5A 4UQBA 3ZQ9A 2NSXA 2BHUA 2XWDA 4MYAA 4CNPA 2A3HA 3GFZA 3VVGA 3VIMA 1TO3A 3WX7A 3SY1A 2WK2A 1DIEA 4H9VA 1UH2A 2PODA 1H5VA 1Q2RA 3TDFA 1JDAA 1L6SA 4MF4A 1VBRA 3G1DA 3WLLA 3CAWA 1EP2A 1PSCA 1B9BA 5GQBA 3GVGA 2J7DA 3TOYA 4NG3A 2EF9A 3W2MA 3AMLA 4DYEA 4FEZA 3TN6A 1GTEA 3ZT5A 5BOOA 3QR0A 1HTIA 5DT7A 2RH9A 2OQHA 3WQWA 5CG0A 4J2PA 1GPWA 3S6TA 2HCVA 1TCMA 3PPCA 1UC5A 4BFAA 4YWIA 1ZBVA 1EGVA 3KRSA 1UR0A 1K7XA 2EGZA 1L9WA 1XDLA 3R25A 3W02A 3WBEA 3M0HA 5I3IA 1EJXC 4W88A 4HNLA 2P5NA 1W17A 4A8NA 2YLAA 4Q7BA 1B3WA 4C6PA 1H62A 2PDUA 2V82A 2DVXA 4GVIA 3QFWA 3UT0A 4H8UA 3DFHA 1LORA 5I77A 4JQ3A 3CIVA 4J1OA 3E0WA 1PVNA 4LRSA 3LCIA 4CCZA 4B91A 3VPLA 3KP1A 2I1OA 3UNDA 1CXLA 3H4GA 3S2MA 4TV5A 3A4AA 4FOJA 1W9XA 4IJBA 1C91A 4K8EA 2UY3A 3AIBA 1JNEA 4D6FA 3MV11 4POCA 3L4ZA 1UR2A 2PZ0A 1MDRA 3S5OA 3BJSA 4XZBA 4M1BA 3SY8A 4GKLA 1X7FA 4GZJA 4ROPA 3NQMA 1B30A 3ES8A 2GQ9A 4N02A 3CYVA 2ZUUA 2AMGA 2RGLA 3FSUA 1V6TA 1V5XA 4XVEA 4OJYA 1TQJA 3VINA 4IGMA 3CASA 1FWSA 4FNTA 4CNSA 3ZJKA 4YLWA 5D03A 3P61A 1WNOA 3WLSA 4GYPA 3ZWTA 3DESA 3FVMA 2D0FA 2Y8VA 3KHJA 3HG2A 1M53A 1RCXB 3RMJA 3VOHA 2PDGA 2QF8A 4RZ4A 4UTWA 4YJ5A 1HL9A 1UMLA 2ZUSA 3G1XA 1DWFM 2VOTA 2V67A 2VEFA 2GDVA 5BOFA 4XTDA 3TOPA 2ZXAA 3FXYA 1GW9A 1A0DA 2ZX7A 3W2LA 1TJPA 3OIXA 4NP7A 3RCMA 5EBUA 3G1FA 5BRPA 1W0MA 3GAKA 5BRBA 5EB8A 4M0XA 3PAOA 3B97A 1M1BA 1MXDA 4F8XA 1CPUA 2BB0A 1XW8A 1M7OA 4ATWA 2OOGA 4I6VA 3WLQA 1FWCC 3VMOA 4RDWA 4AD5A 3W7MA 3EPMA 3L2IA 4XVDA 2GWNA 1W3KA 4PODA 3M9YA 3VNKA 2WB5A 1UCWA 1R9XA 4GNVA 1OX4B 3M6YA 1P0NA 3QSRA 4B5VA 3V0TA 4MAVA 1PXGA 3QMTA 4ZODA 4C6MA 5DELA 3TTYA 5CQ1A 1ZRQA 1KFEA 1V3JA 3T2OA 4PMUA 4UTTA 2XN1A 2PP1A 3K5XA 2QCGA 3OZOA 3VMPA 1XLJA 4GCXA 3WKZA 1CYGA 4I7UA 1SO6A 1ICQA 3N1AA 1TUXA 2PD5A 3WSUA 2F84A 4A05A 1WDPA 3SJ3A 4IPJA 4IIFA 3N73A 3GH7A 1EB3A 1GVIA 4AY7A 3TC6A 4EX4A 1IE7C 2V6AA 3C52A 3UXKA 3C2RA 4HP5A 3L5MA 4WXZA 3VIPA 3GRIA 3L4UA 1E6QM 5KZMA 1A3WA 1QW8A 3UQNA 2PDLA 5I3GA 1F8MA 1EDQA 1MEHA 2E5CA 1F74A 3S2NA 3W1LA 3D46A 2GVGA 5HJYA 2DW6A 1CGWA 4HU8A 1WKEA 3BCDA 2OODA 1XH0A 4WDTA 1VCVA 1DJWA 2IUZA 4MLJA 3ZLGA 4WSKA 3GXTA 4U5IA 2HJPA 1MNSA 4MY1A 3TSBA 2VQTA 1H7PA 3L5AA 3SN1A 3N14A 4KIEA 1S5NA 1QWKA 3F5LA 2VWTA 4BCEA 4HN4A 3BLDA 1YDVA 3UGRA 4UC5A 1NARA 4PSRA 2WCSA 2PPGA 1R3SA 1PZ0A 3MANA 3R58A 1B3VA 3UZWA 3GTIA 1I8JA 2BTMA 3RRAA 3W4RA 3KEHA 1D3CA 3EX1A 2HK0A 3POHA 1X39A 2WXDM 1OX5A 4UTJA 2YBVA 3THUA 1A53A 4JIQA 2OZ8A 3VOJA 3UG3A 4ILSA 4CCDA 5J5RA 1YQ2A 1O5KA 1EJRC 4GXMA 4FIRA 1PKMA 5JBEA 4GIYA 2OYLA 1RAKA 3RF9A 3GXFA 4LT9A 4JQ4A 3WJWA 2Q8LA 5U7SA 1ZENA 3T4WA 4LAKA 4AIOA 4LVGA 3UG4A 3ARYA 1UBSA 3KX6A 2BHZA 3YPIA 6XIMA 5HAOA 2KAUC 4M8UA 5CZSA 1GVSA 4KCWA 4U33A 1H60A 1L6YA 1OFBA 1QHOA 5E1QA 2NX3A 1R3WA 2V38A 4IPNB 1P43A 1W2VA 3OLEA 3AS0A 4ES4A 4W7WA 4DF1A 3P8IA 5KEZA 3MPGA 4QCFA 4AIBA 1UD4A 4UQAA 3JR2A 4A3UA 4KWWA 1VD6A 1WDSA 4UTIA 3T6CA 1DWHM 1PYFA 2TAAA 3PS7A 2Q8ZA 3CJPA 3CUFA 2VZUA 1G01A 4K38A 1V02E 1XIMA 2G50A 1RBLA 4KKXA 2VGBA 4HZ6A 3GD6A 3PZIA 2VFHA 3HPZA 1OF8A 4CLMA 8CGTA 3ISIX 4PMNA 1B4KA 2ZZ1A 1TWIA 1JI2A 4IIGA 5J5DA 4FO4A 1LF1A 2WBGA 4XISA 1KM1A 4ONVA 3P62A 3HQPA 1QTWA 1PX4A 3LNMA 4UTUA 1Z32X 3TAKA 3Q37A 3O07A 2HVOA 3W1RA 1R87A 4WUIA 2QCFA 3LOTA 4O15A 3H54A 2HMCA 4CNUA 5G1MA 2VEIA 4AD3A 1KV5A 3O63A 3G6MA 1LUCA 2V8ZA 2ZUMA 1MEWA 3KVJA 1MFUA 1UOZA 3P5YA 1OZMA 4G5DA 3T07A 2Z24A 3LCHA 3THDA 4PMQA 1FUYA 4UTWC 2DZSA 1QCWA 3I4KA 4IHCA 3TTEA 2ZRUA 2HS6A 3WQEA 1V51A 1X1ZA 2NQ5A 5D2YA 1DE5A 3NQCA 4B9YA 3N4FA 3TTSA 4LWWA 2DQXA 4NZ3A 3ANUA 1I75A 4IUOA 1CGYA 4US5A 4X9SA 1TPC1 4MWAA 3NZGA 4MNJA 5JUVA 4FPSA 3B3DA 1KWGA 3M0KA 1E9ZB 2QAFA 1LWIA 2IPWA 4NYYA 3OHMB 4J3UA 4GLEA 2E9MA 1RVKA 2BY2A 3LQLA 1ZLPA 4GI4A 3TXZA 3W29A 2PWFA 5TQLA 3H21A 3ZMRA 3EOUA 1DQUA 4CEXC 2D24A 4H9YA 2F38A 2RJHA 2Q8XA 4RZBA 3UZ5A 2C0AA 2DY3A 2SFPA 1QAPA 2XIIA 4HHMA 3U7BA 3C0LA 5BROA 1KXTA 1K7EA 1FWEC 2V5DA 4GO9A 2DZVA 2A4AA 2R1KA 4ZB0A 3DAQA 3IJ7A 2E5BA 1AJ2A 1DJQA 5FAGA 3MS8A 1A5OC 3MMTA 3BLOA 2WNZA 3QPYA 1NOUA 3OHIA 1REQB 3VABA 2OX1A 5FL0A 3AXMA 3V0SA 4BEUA 3OGRA 5A1AA 4LAZA 3L21A 2PBOA 4PGLA 2GGJA 3V75A 1S2WA 3S9YA 1W2PA 3SFWA 2HBXA 4CN1A 1XIEA 3SRDA 4HOWA 4I7VA 3VX1A 2IS7A 5A8OA 2DJLA 2YW3A 3ITVA 1E6XM 3GAYA 5DCDA 4N42A 1VBUA 5EL1A 1ZP4A 2R1PA 2VI0A 2DZXA 4WKAA 5KTLA 4HB7A 3BK0A 4DF0A 2YW4A 4TX9A 3TW7A 4D6IA 3U2OA 1A5NC 4K6AA 1OFAA 1R2RA 1C92A 3Q65A 4MDOA 4HYRA 3H4WA 1T99A 3P3BA 2P8CA 4NJGA 4L1WA 3XINA 2J8TA 3CTTA 1EH9A 3S47A 1ZS2A 4BI7A 4NSBA 2XH4A 4LV4A 3O6CA 4GYJA 2A3LA 4UTLA 2WZIA 1QNVA 3IV3A 3O3RA 3M0JA 3LV5A 3FA5A 2VX5A 3TUUA 3BXWA 3AXIA 4DZ5A 1G69A 4R34A 1TIWA 3CQ0A 5I07A 4FF5A 3VXGA 5AC8A 4J2MA 4CGTA 5K9DA 3QV6A 1PZ3A 2OO0A 3R11A 4XK2A 4BZYA 1KGWA 3BURA 2QVNA 1WZMA 4K3ZA 4UFLA 2XJ7A 2BOEX 4A8RA 3R12A 1RBOB 3GFYA 1SZFA 1W31A 4JYFA 3V4BA 1PTGA 4C90A 5K4ZA 3QW4B 1AQFA 5CPSA 1LM1A 4Z2LA 4GX8A 4ROQA 4TMBA 1KRBC 4NIRA 2ZWZA 1MMFA 5CPTA 4L9YA 4DJEA 7XIMA 4XZWA 4MVAA 4J3XA 4NNBA 5IM51 2O7QA 3SAZA 3RGTA 2V0TA 1V6WA 2IXUA 4NZFA 5FL1A 4LF2A 4O52A 1EDTA 1Q4WA 4W7UA 1XDMA 3W1QA 5CGTA 1XGDA 5BXPA 5REQA 1NWTA 1H7NA 2ISSA 4JFSA 3GXIA 4AF0A 3GKAA 5G2WA 1XCWA 4DPPA 4E4PA 3EDDA 1DWGM 2JALA 1BG9A 1XQLA 1E6RA 4XAGA 1UP2A 4FI4A 1NP0A 4L80A 5JBDA 1F3WA 4JTHA 3WBWA 1JPKA 3ZR6A 3GU1A 3GB6A 1OINA 1T40A 2C1GA 3EBVA 3WD2A 1MW3A 4JAWA 1XRFA 4RW3A 4Q8UA 1JYXA 3M1ZA 1XIGA 2X16A 1DHKA 1ZBCA 4H83A 3F2DA 3WFAA 1TV2A 3AOFA 4MB3A 2D2GA 1UD8A 2OGJA 1H1YA 2WANA 3FK4A 3E6EA 3LMYA 1C7SA 1FKWA 2Z1WA 2OEJA 3C3NA 3IIXA 4DJED 3M0VA 1GVQA 2BWGA 3GDMA 3WQPA 4MY8A 2IMRA 3QVQA 4JQ2A 2YCKX 4H8VA 1OABA 2C91A 3W6YA 2B7NA 3E2RA 1A5MC 1QNSA 5JH1A 1FH8A 2ZA1A 2VXNA 3IJDA 3OZPA 3S1XA 3Q45A 3EWWA 5DEZA 4C1KA 1GOMA 2YXGA 3HZ3A 4P8VA 3RU8X 3MT1A 4ZR8A 1AQHA 4L56A 5LA1A 2J25A 3EX6A 3O6YX 4RZ5A 2FHBA 4MB5A 2OTDA 1Q85A 5CC7A 3M64A 4NILA 4KETA 5HUPA 2X2YA 4JX4A 2PTXA 1J5SA 4YTTA 5D9NA 4HMDA 4TQTA 3ZJ8A 2QKFA 1WP6A 1YNQA 4GGHA 2D1ZA 1YNPA 4K8GA 1K77A 2HWGA 3NIYA 2OYMA 4EXQA 1WB0A 5EBAA 3PWGA 2B31A 4UOQA 1XG3A 2DVUA 1UYQA 4Y8EA 2JKEA 4WQ6A 2VC9A 3TTQA 3NQEA 4LSBA 2ZDSA 4NZ4A 1KD0A 3PJUA 7CGTA 1XRSA 2TRSA 1V3LA 3UR7A 1Q7QA 3AIWA 1I4NA 4KWUA 1TRIA 1WXYA 5LGZA 1TVPA 3ARWA 4MB4A 4BF9A 4I9TA 1GOXA 4S23A 5CC5A 3VUSA 2DGAA 2ACRA 4BJHA 1DWAM 4CNOA 1RQEA 4Q22A 4KCTA 4KFPA 4FF7A 2VVSA 3CV6A 3PR2A 2CHOA 1ELSA 4C6QA 3KWXA 3RDKA 1WKDA 1A0EA 3V5OA 3NEVA 5DQPA 3RO6A 4YN5A 1HP4A 3APGA 3OYXA 3V1PA 4MPKA 1NJJA 2CWNA 3DH7A 4Q8PA 1BGAA 1QPQA 1MZRA 1FHDA 4P5UA 1I1XA 2DZBA 1V6UA 3FVDA 4Q8TA 5CBIA 4ATDA 2RDXA 2BVYA 4ZSUA 4JNYA 3HN3A 2Y8UA 4PMJA 4HZ7A 1BTMA 2XVLA 4H6EA 4RW5A 3W07A 3OLIA 3CQHA 4MJ2A 2OLSA 4OU1A 4R33A 3REQB 3WYZA 2OELA 5D9MA 3INPA 3ABOA 1XYLA 4UUIA 1V3HA 1ENUA 4B9ZA 3DX5A 4E5TA 4WGHA 1SUXA 2FLIA 3SQMA 4L6DA 4LBRA 4MUZA 3OA3A 2GSHA 5FJIA 2JGYA 1CXEA 4FLSA 5AECA 1XIBA 3I6RA 3MDUA 3T9PA 3I7SA 4O1DA 2VRKA 1VCGA 2H8ZA 3G1YA 4GY7A 4DLMA 1TJRA 4KPLA 2OWWA 5AB3A 1Y8BA 5XIMA 4L1XA 1NWSA 5D2TA 1KRCC 1OADA 3TC3A 4ENLA 4MNMA 3UPBA 1S38A 3CMFA 2O92A 3PM6A 2VGFA 1JNDA 1RVGA 4ZB5A 5BXSA 2V3FA 1WQ5A 3HJZA 5E0FA 4OV9A 3KVKA 2BVDA 3EPOA 5E70A 3TONA 2XIQA 3NJ3A 3LS9A 3DC0A 4DIAA 4G7EA 2JGQA 4QNEA 1EGZA 4ADUA 1M65A 3TE9A 1JL8A 1TPEA 3SGZA 3MYOA 1Z7AA 3NPVA 2ZWYA 4YU1A 1Z6KA 3AIVA 4N4QA 5DMMA 3T40A 3PPGA 4AZIA 1LT7A 4JEJA 1TPVA 3R1ZA 2FMOA 3RIKA 2QJGA 3M0YA 1PHQA 4GA8A 2XFYA 2PWGA 5MKGA 3VKDA 1H1ZA 1XRTA 1PX8A 4AEFA 1U5HA 1VLIA 2FGLA 4FP1A 3W38A 2VEMA 4A21A 3IVTA 1E3ZA 1E72M 3G0UA 4PTVA 3G6LA 1VAHA 1JDCA 2ZXDA 4UXDA 4DWSD 2XGZA 2D3LA 2E1DA 3NOYA 4A29A 4WLCA 4XZLX 3MSDA 1S2CA 3AHVA 1QK0A 2NV1A 5I3FA 3K30A 3E2QA 4JTIA 3D47A 2CLMA 1QNQA 4H9MA 4D8LA 1EBGA 1MQPA 2VKZG 3BWWA 1O1HA 4AW7A 2BV9A 4PTWA 2OOFA 4RXGA 2MNRA 2BGNE 4FX8A 4NJIA 4H19A 3SZ8A 2Z1VA 5C7VA 4PUMA 4R7JA 3BZGA 2DZWA 4BWLC 2D23A 3L65A 5E0CA 2VL4A 3CMJA 3H70A 1MNZA 1IZKA 1HFBA 1SMDA 1U5JA 1W91A 1HVQA 2BY3A 3OO2A 1JRBA 7ENLA 1X38A 1LZOA 2ZZ4A 3WMCA 3LGDA 5DF0A 1SFTA 4RR4A 4UCFA 3PZQA 3NAVA 2PGFA 2OVLA 1F76A 2LLEA 3SM0A 3AALA 4ZSTA 3S9ZA 1GVOA 4XO7A 4TVCA 1HL8A 3M0MA 1Z69A 1MEIA 3W1TA 3BSMA 4Q7IA 2EG8A 3SJNA 1GOWA 4M6QA 4JTTA 2ON3A 3BGAA 3WJXA 3CZLA 2GK1A 3CZJA 3O16A 4YPJA 2NT1A 1YEYA 1QNRA 5A8QA 5CSRA 1T96A 1BHGA 1SJBA 5REQB 4AHQA 4AZCB 1SVDA 4BR1A 3LTSA 2GK1B 3REQA 3M43A 1IR1A 3BH4A 2NQZA 3DC8A 2QCLA 3HM7A 1DXEA 4ICNA 1XV8A 3VNDA 3VOIA 1JPIA 1JFXA 2PP0A 5LHFA 3WLHA 3GFXA 3SW6A 3SUTA 1AH3A 1W9BM 4JYDA 1B57A 4DZAA 1PYMA 3KS5A 3IIOA 4DAIA 4W5UA 1E0VA 1PB0A 3VNLA 4DJDA 3F4WA 3MVIA 3QF0A 5T91A 5BCAA 2ZUTA 3LSBA 7PTDA 6PTDA 1UIOA 4MZ8A 8A3HA 1FDJA 1E5NA 4MGGA 1SZNA 1OGGA 1G4EA 1YX1A 2NUYA 4M56A 4F0HA 3W22A 3CQKA 1DTNA 1ITUA 1I2RA 3LENA 4IZGA 2XGIA 4O4WA 2UY4A 3WMLA 1A4LA 5G2HA 3MP4A 3VZYA 3CPUA 1VFOA 3WK1A 4H41A 4B3ZA 1OFOA 2Y2WA 2FH8A 4ERIA 5H2ZA 5TBOA 3CEUA 4XQ6A 3HOJA 1HJWA 2BMBA 2WC7A 2BXZA 1GQKA 1KQYA 3T05A 4S38A 3SCSA 5JXQA 4XUGA 4O1CA 3A3HA 1AJ0A 2CLIA 4UOJA 4H3DA 4XV0A 1VBGA 1CZ1A 2ISWA 4AH7A 1X1NA 2H6RA 3UZJA 2HISA 2XN0A 1QNPA 1JYNA 2RKXA 1FWNA 3KW3A 4I9MA 4OGZA 1R3YA 4HMNA 3LM3A 3VD7A 1FP9A 1K7FA 4DBSA 4ML4A 3NVTA 4JY9A 2XZ7A 5F2MA 2WMKA 2WWCA 1UOKA 1XQKA 3H22A 2F6KA 3CBWA 3M07A 1QO2A 2XFFA 5HMEA 2VDGA 2PF8A 1NVMA 4MTVA 4LEQA 2O9RA 3TMLA 1CB7B 3I6TA 4MHBA 5A3HA 3CHCA 3U3HA 3M0ZA 1EUNA 4BQ5A 1B4EA 2J74A 1F5ZA 2E40A 4J35A 4RNJA 5HBFA 2FJUB 2AQVA 1OZQA 1S1PA 3A22A 4LUTA 4C6NA 4D72A 2W61A 1EPVA 3K2GA 1LL6A 1EIXA 1D8WA 4Z1BA 3ZJ6A 4ZZ9A 4WHBA 1O95A 3WIJA 2NV9A 1JGIA 2POTA 3KRUA 3A9IA 3CU2A 2R6OA 3B05A 3PANA 1IXNA 2A3CA 2V63A 1VBHA 1SFLA 3UVAA 3C8NA 3WUBA 2H3DA 3G1AA 4GZIA 1E71M 3SCTA 1YHTA 3QEZA 2IKGA 3KOFA 4QJ4B 4OUEA 3SCVA 1OC6A 3A12A 3EXSA 4Q7NA 1SW0A 5RUBA 3BG9A 1IEIA 5FIPA 3T0AA 2FZMA 4JKKA 3UXIA 1Q6OA 1BPLB 2ZYFA 1CXHA 1VQTA 1X98A 2GVEA 2CLLA 5CJ5A 3T2QA 3WLPA 2YB4A 1K4GA 2I9EA 4UMAA 1FA2A 3IUIA 3PTQA 5EYWA 3UA4A 3PB2A 4D8ZA 3GW3A 3TQ0A 1S1RA 1V0LA 4G56A 3G1HA 3N2TA 4AG0A 4G1KA 1N82A 1KCXA 3PFRA 4OV4A 3M7SA 3ME3A 3R13A 5D8WA 3RU6A 3W3OA 1TZ9A 1OJXA 4LGXA 5G2IA 1ZAHA 3N25A 4LB4A 3TYDA 4AMAA 2A5HA 1TTJA 5LNVA 4KGJA 2C15A 2H9AB 2P10A 4ACZB 4D6GA 3OQEA 1RPXA 3PTDA 1A4MA 4AD0A 4JTLA 3VIJA 2YDSA 4NI3A 1GKPA 3WQCA 4LCRA 2YCIX 1PKNA 3JRKA 2GGIA 2ZZ7A 1UUQA 1EUAA 2Q3RA 2R8WA 1E0UA 1AL8A 5C2XA 3WK0A 3PUDA 3VA8A 1C7TA 2Z26A 1ECQA 1CB2A 4P7QA 3Q58A 4IXHA 2X1IA 3TVAA 1J0YA 3EWXA 3G0XA 3UJEA 4XZHA 3NGFA 1TTQA 2W9MA 4DO5A 3FDKA 5FJJA 4GX9A 3LRLA 1RV8A 1KGXA 1KKOA 1JXKA 4XBKA 3A47A 3KLLA 3CEPA 5A6TC 2DJXA 3BAXA 1CIUA 4YYCA 3PN8A 3GY1A 5FKYA 3DGBA 2HNHA 4C1NA 3ECQA 5CSUA 1B1YA 2JFEX 1RD6A 1SU5A 1V6VA 4AVOA 4GXPA 5E93A 4PMZA 4YYFA 2PBGA 3SCPA 1ZSXA 1J79A 4Z42C 4UZUA 1BXCA 5D2XA 3CHFA 2ZRWA 4MJZA 1UR9A 1LYXA 2E0PA 3NR0A 3NQ7A 4GKTA 4TIMA 3CUJA 2PLMA 2QDDA 1ESWA 1A0CA 3UZYA 3MKVA 1E43A 4JTDA 1YBQB 4M5PA 1TSIA 4HTBA 5I6SA 1GWJA 4DI8A 4G1NA 2YYUA 2NQ9A 4ZXOA 1FKXA 3FA3A 3KL3A 4NASA 1TE6A 4J40A 1U5VA 3ZLHA 3K4AA 3W1XA 3L2MA 1OCQA 3NVDA 4B3KA 5KETA 1CW2A 5IDIA 4PCNA 1K8ZA 2XGBA 2NX1A 3LD5A 1EJUC 2PWVA 4FR1A 1UC4A 4MZ1A 4KESA 4LS2A 2OFJA 5D8ZA 3PJXA 5FF2A 3KBNA 3UETA 1E4LA 2QNEA 2QZRA 4PMVA 3P84A 1BAGA 4XKYA 3TYZA 3WLOA 2ZE0A 5CZ0A 5M03A 2W4XA 3AAMA 1BRLA 1PIFA 1W9VA 2AGKA 1J01A 3TFCA 4CD7A 3KBVA 3L4XA 3TQVA 3WDPP 1BF6A 2BOFX 1JG9A 2OGYA 5L9FA 3UERA 4AVFA 5HOSA 1L0PA 3A5FA 4A3HA 1J6PA 4ZQNA 2PC8A 2W91A 1JAKA 3S1WA 3TZNA 2ZC1A 3W76A 3ARVA 4HPXA 5A6SA 1UWQA 3PJTA 4F2BA 1UR4A 4PZVA 3GHUA 4RE2A 4NYUA 1GEHA 2HV5A 2Y24A 3CUZA 2EPNA 4K8HA 1E4IA 3ZWSA 1FXPA 4UOZA 4HYVA 2AQWA 1U2YA 4L1GA 3UY7A 4MUPA 2GWGA 3N2XA 4J3SA 1NOWA 5I24A 3WLMA 1R6WA 3CPRA 5EY5A 2ALRA 2J62A 3AUJA 3TFXA 4Z1DA 3PP7A 2PGRA 4M82A 1T6MA 1ZTVA 4I7WA 2Y7FA 3MCMA 1JDFA 3ATZA 3WEZA 1O7AA 1UZ4A 3W7LA 4FNPA 4S1FA 5E6ZA 1XSKA 2UZ9A 4KWVA 2V30A 3T81A 2XFWA 4EXAA 1QI3A 1ZJBA 1T41A 1Z3NA 2CBVA 1S3HA 4PTNA 3LBOA 2IPGA 3DG7A 3DBNA 3IAPA 5EKYA 4U5KA 4W9TA 1XLHA 1GQJA 3DENA 3WDJA 1CEOA 3NQFA 5D2VA 2P50A 2WVUA 2QIWA 4P8XA 3W7RA 1GCYA 3GC4A 1M7XA 1M9HA 4ACYA 1TWDA 1UPMB 1YDYA 4Y8FA 1JZ4A 1LRQA 2V68A 3BSHA 4I9AA 1JFHA 1M03A 1UUMA 4B16A 3NPWA 1RY8A 2ZZ2A 3WY1A 3TNOA 3VE9A 1G5AA 1J0HA 1JQVA 2IQTA 4IIBA 1UZDA 3BCFA 1KGUA 1YIXA 2R82A 2FZ8A 5I3KA 7REQA 1S46A 4HQVA 2WC3A 4I8DA 1ZY9A 4IP4A 3F1QA 5E5CA 2PU1A 4DM1A 4I6KA 2Y6ZA 1X7IA 3G24A 4IGHA 3BO9A 3EAUA 2PRMA 3MI3A 3LCFA 4G6CA 3LHWA 4WKFA 4V27A 4DY1A 4DXKA 4ZE4A 1A5AA 1EYEA 1POKA 1QOPA 3NM1A 1XYCA 1BSLA 3GNDA 1K8YA 3FFSA 3GDRA 3B40A 2IQDA 1RP9A 1JCNA 3LG3A 6ALDA 2CFFA 4TX6A 1HJQA 2V5CA 4A3QA 1XIFA 1ONXA 4JN8A 3HG5A 1REQA 4PH6A 3KTCA 3G77A 1C9WA 6XIAA 4UTTC 4IT1A 2UY2A 1B9ZA 5G4HC 3AMCA 3W2JA 3AJXA 3ICJA 1VJZA 4FS9A 3GLCA 1JYVA 1XYFA 1LG2A 2HROA 4EP8C 1H49A 3BAKA 1AMYA 1Q66A 2QCDB 4MWAE 3UG5A 3AS1A 4Y9AA 4IFRA 2AL2A 3EKLA 3QTGA 3E0FA 1NDVA 4TVDA 3HBLA 3PBMA 5DCBA 3EDEA 1ICSA 2VHLA 1E1EA 2C18A 2D2JA 3NL5A 3EGJA 4ZVJA 4XZNX 4WGXA 4CN6A 3TV8A 3SQSA 2FH6A 1FRBA 3MUXA 1YXCA 3WNKA 1QPOA 3V7PA 1E1CB 3N2CA 2Y62A 4YTUA 3BMXA 4A6GA 4CU8A 3R10A 1FDYA 4S3EA 4PUDA 4GK8A 4QITA 1XIJA 3AMGA 5FSEC 2PTZA 1PAMA 2QUTA 2INEA 4C6KA 1K9FA 4GJIA 3B0UX 4QAIA 3PBYA 3W70A 1KR0A 3EMQA 3I68A 1EO7A 4NXKA 1D2KA 3U2CA 2WLZA 1B5TA 1V6YA 4J3ZA 3SADA 3GC2A 1QW9A 2Z4GA 2WNWA 3SGUA 1X97A 1ODZA 3LN3A 4HU3A 4AUBA 2GDUA 2VVNA 1PL9A 3OTRA 2HRWA 2OZTA 4HPHA 3W01A 5EA9A 5JH2A 2QJMA 1M01A 4GO8A 4LYRA 2ZX5A 2ZUNA 2QPUA 4JDYA 4ZO6A 4RK8A 4S3JA 1FWDC 2A3BA 3WUFA 1WKFA 1YRRA 1KM3A 2HXTA 3H55A 3W6MA 3UF9A 4HZMA 3TR9A 2W5FA 2XIMA 2J13A 3M5YA 3PUGA 4G7FA 4M51A 1Q45A 4URIA 4HU0A 9XIMA 3FGCA 4YWSA 3UEQA 3KRBA 3B0VC 3OP2A 4UBPC 2NV2A 5HPCA 3ITLA 4JKLA 3H23A 1H61A 4HPGA 3VM5A 3DXIA 2BXVA 2WSKA 3WF4A 1PV8A 2EPHA 1LTDA 1IYXA 2Z0IA 4KH2A 2R24A 1S5TA 2ATMA 2MANA 1VGAA 3SBFA 2W66A 1W9DM 3EX3A 3NZQA 3RPMA 1XWYA 3ABQA 4A4AA 1YYAA 3KZPA 4ORIA 2XYLA 3DZ1A 5IFTA 4U3CA 4GUIA 2X7WA 1F2JA 4M1RA 2ZKMX 1R8LA 3ZR5A 1JD9A 4R7OA 3UCQA 3GYEA 3N2MA 1IIGA 4ZTXA 3NG3A 4Y6GA 3WF0A 2O7SA 2NUXA 2X0YA 3BLEA 3LHVA 3T2PA 3WL1A 2X8RA 2BY1A 4GNKB 1J8VA 1LQ2A 3ALGA 2YCEA 4HHHA 1UD3A 1UHVA 1EIBA 1ONWA 4ADTA 3C0SA 3AMKA 1O68A 2I5QA 3DFOA 1PCWA 3O7UA 1PX3A 1E0TA 3EDFA 3RM8A 3VGFA 1KBIA 1AVAA 9RUBA 2PDFA 2GQAA 3T0BA 1FHUA 2CITA 5K3VA 3QHOA 4JGDA 2PURA 3AU6A 2PU0A 1D9EA 3BG3A 3SEPA 1TX2A 4JIIX 3GNXA 2X1UA 3LGGA 1AG1O 4HNUA 4Z17A 2E8YA 4PR4A 3EWDA 4QQUA 1QATA 1XBVA 2FGZA 4P7OA 2E6FA 1E6NA 1TTIA 3KS6A 1T8QA 2Z2AA 3P6LA 1O60A 3GXPA 2YBUA 4AHPA 4ZO7A 1D7KA 1X1OA 1JQXA 3ABSA 3GH5A 1EX1A 5F2IA 1CGTA 3ENLA 3VILA 1DWJM 4EWND 3VZXA 5DRIA 2H8XA 4KEZA 1SYTA 4QDPA 1S39A 1TELA 1TZ7A 5FI8A 3NM3A 2FHFA 2PF0A 3K8KA 4GY1A 3S6OA 3ARRA 5AC4A 2CBUA 1TWSA 4OBTA 3TWAA 4AZ7A 2XN2A 4FLOA 4NNAA 5F2GA 3WEOA 2ODOA 2PRLA 1BYBA 2DIEA 3QN3A 2DW7A 4CQ8A 1KQZA 4I5XA 2FVKA 1UKQA 2Y8KA 4L64A 4FLQA 3M5VA 2QJHA 3EOEA 4D1IA 3ZJ7A 3BAIA 3MU7A 1R86A 1XD1A 1RHCA 4F3HA 4LW7A 4QNWA 2XIOA 1WAWA 3MP3A 1GONA 4XSLA 2QF7A 1ICPA 3TK7A 4MM1A 4WK9A 3LHUA 3UESA 4H00A 3W86A 1F73A 2IKIA 3OVRA 3KDNA 1MUWA 4PSPA 4Z2KA 1H7OA 3E74A 3GBDA 4A22A 3W0KA 1HO1A 4J3TA 4I5RA 4RE0A 1VHNA 1W3NA 3P7YA 4GG9A 1IT7A 3RG6A 4EVZA 3E5BA 3C2OA 1RALA 4MLRA 1D3HA 2X05A 2OCZA 2FZNA 1HGWA 3MMWA 5C2GA 4KIRA 1S5MA 3WLTA 3P5ZA 3CB8A 1F6PA 1M3UA 3RPTA 5ECVA 2VR2A 5AC6A 4FMVA 5CC6A 3BMWA 1HKWA 4NJJA 1H7XA 1IEWA 5FEPA 4ML9A 3LMZA 4RPPA 4Y90A 1HKKA 4E6MA 4Q33A 1FWGC 1C8YA 4JTGA 3G2GA 4UQEA 1F8IA 4KBXA 2J7GA 3TA6A 1W1B1 1XJBA 5H8UA 4MB1A 1BEUA 3E02A 1I1WA 3HG3A 1SR0A 2Z7KA 4H1ZA 3BJTA 2DEPA 2G8ZA 4HGXA 1QOXA 4C91A 3KUMA 3TEVA 5I2UA 3B06A 4I8YA 2HXUA 7ODCA 1EL3A 3W6LA 5KSWA 4OT7A 2YYTA 2GQ3A 3IS4A 3W88A 4A8IA 2DH3A 2VYOA 3VKKA 1TMLA 3U2EA 1QUMA 2DSVA 4HA0A 1T7LA 2B81A 1EXBA 2WHKA 1JCXA 3M0XA 4LBSA 3U7VA 2EBNA 2QIIA 2PD9A 4U31A 3MYPA 2CZ5A 2WSRA 4AIUA 3MY9A 3MJYA 5D33A 4Y7EA 2D0GA 4GIRA 5HATA 1GG1A 2HK1A 3OBEA 3QR3A 1HNYA 2OWCA 4FR6A 1A49A 1GW1A 3SI9A 2WNQA 1GJPA 3OG3A 3MUZ1 3ALFA 4JCMA 3XISA 1QI2A 3KLKA 5KINA 3E9AA 3O0FA 3F5JA 1XC4A 1KO0A 1E51A 3QV9A 4XTIA 4LALA 4ZE5A 2CETA 5BOEA 3UWUA 3BL3A 3PZOA 3GC5A 1W3TA 1VBJA 4FSAA 4NZJA 1G9HA 1RJRA 3NSMA 3OQ8A 4QJ1A 3URBA 1UD5A 1HKIA 2Q71A 5LNRA 4WF7A 4ACZA 1WE5A 1Z42A 3CM4A 2OQLA 3WLRA 2J7CA 1J2BA 1GVRA 4FIQA 1YE4A 4DM2A 3V5FA 3N19B 2OU4A 3FGCB 1W9PA 1WCGA 3BAYA 1S2AA 1JAEA 3C0QA 5ABEA 3UXAA 2VJXA 4E0CA 2HDJA 3MZNA 3ELFA 3O05A 3C61A 1VP5A 2VFEA 4D1JA 5FJRA 3RX2A 1BLIA 3NYZA 2OSXA 4UFMA 1R0MA 3EA2A 4LH8A 1FY6A 3C4UA 1PKYA 2GZXA 3WBXA 4GZEA 3CV7A 4GRSA 1JZ3A 4PULA 3MHGA 1V3KA 5E0KA 2VFDA 5L6UA 1WUEA 2C71A 3ZT6A 1OQFA 3AS3A 3TQPA 3VIKA 3WQGA 1YMYA 3LPGA 4IFOA 2Z25A 2J47A 1HUVA 1NTHA 1SM9A 1P1XA 1J9YA 1EZ2A 1YW1A 1OYBA 4OZOA 2PFHA 1NY1A 1L2UA 1NQ6A 3BCJA 3NL6A 2VFIA 4AZHA 2YL6A 1J18A 3EXTA 1TPB1 4MNLA 4IXXA 1V3MA 3W9ZA 1UA3A 1VCFA 3P2VA 2BASA 1KW1A 1FWIC 3KRZA 2Y7DA 4MKVA 1ADSA 3MUAA 3E0IA 8RUCA 4Y9PA 2V3GA 3UZZA 4ZXLA 4AIEA 3CUXA 3L0GA 2NSOA 3ZT7A 1MDLA 3GWQA 1UASA 2RDUA 1XKYA 5FESA 3WD4A 2I14A 3S0CA 1DQXA 2UBPC 4AXKA 4FXRA 3CO8A 1E0WA 4DLFA 3SGGA 4JN6A 4NAEA 1IWBA 3SCWA 3EXRA 2FTYA 3UU0A 4BWLA 2CU0A 3A4WA 3QGAC 4E2BA 2D22A 3LZ5A 2RFGA 3CWHA 2ATSA 3CL6A 1VHCA 2EPKX 2CPUA 3A21A 4LYKA 1V0MA 2RJGA 2CLFA 2J24A 3WJZA 1SPQA 2NVAA 1BVZA 1G4SA 3EB4A 5CBBA 5HXMA 1XBXA 5A8NA 2WQDA 1FWAC 3QOMA 4W8BA 3EX2A 3B9NA 1EHAA 1HXJA 3A3XA 3QH2A 4UFKA 4RUBA 1HX0A 1EWEA 3B03A 3L4WA 3IJIA 1YPFA 4QIUA 2I16A 4ZOBA 1XKJA 4LX4A 1H1NA 2R1LA 2PUZA 4EK7A 1KM6A 2EAWA 2GGEA 1NF7A 3KTXA 2E6AA 1VFFA 3SURA 4B5SA 3URQA 1SO4A 3NA8A 3OLGA 5AYXA 3SN4A 1W54A 2OLAA 4CQDA 3JZUA 4OKDA 4GBUA 3THCA 3N9SA 2Y85A 1MXSA 3S6DA 1DJNA 1YBQA 2VQUA 6ENLA 4ADSA 1D3GA 3FHQA 3E96A 2I56A 1QFEA 4D2JA 4HSOA 1FWFC 1K9TA 4AZ6A 1GT8A 2XIBA 1XYMA 3QYSA 4UB9A 1OCNA 1LLOA 3NL3A 2J6XA 3DU0A 3O1NA 1VLWA 4KCUA 4XUYA 3J7HA 4UQCA 1W5PA 5U4NA 4ICMA 3NZRA 4E3TA 1R2TA 2ACSA 4J3VA 1E0XA 1LL7A 1LLWA 1GORA 2ICSA 3APYA 4AWEA 3GTFA 2VZSA 1DOSA 5GJNA 2NWSA 1X6LA 3RRXA 4OOZA 1K8XA 3K46A 4LEFA 1JZ7A 4QJ5B 1DIKA 2GPTA 4DWSC 5I3DA 4AZ5A 1LOLA 2C13A 1VZWA 3QZAA 1ZQ5A 5CSSA 4ERGA 1L8NA 5LZLA 2QLYA 2Q09A 2Z6IA 5EMJA 1BWKA 2WVTA 4UNIA 3W24A 4KRZA 3GXDA 4FALA 2ZVRA 4CNTA 2GUYA 4QS5A 3DN5A 5EMLA 2FTPA 4ECLA 3SRHA 4IIEA 1CGVA 1Q6FA 2GYIA 3GNNA 2WMIA 3BLPX 3RFAA 2YL5A 2FKPA 3M16A 4QR6A 2NWRA 3DFPA 3ERPA 2DP3A 2FVLA 4N9BA 1JUEA 3HB9A 1MQQA 1OIFA 3ZSTA 1XYBA 4AHOA 1MSSA 2I9UA 2PZNA 1BRLB 4BS0A 3V3WA 2QQ6A 4B5XA 3KBWA 2VO5A 4CKQA 2WSYA 3HFYA 3IJ6A 4R53A 4REQA 3ZOAA 2GL5A 1Q6DA 3DHFA 3NDZA 1WV2A 2WKGA 1KR1A 2YOCA 5MF5A 5H91A 1V7AA 4RDVA 3U9IA 1I6NA 1I2QA 3FSTA 4EE9A 1A5CA 3OZMA 3HPFA 2WSPA 4DN1A 4X0VA 5C9WA 5TD4A 1Q6RA 1G67A 1JDDA 3HV8A 1PBGA 1FWWA 4V1YA 1RK6A 3PNUA 2HPIA 1GTHA 5A95A 3KFTA 1FQ0A 3N18A 3A3WA 1HVXA 3OZYA 4GACA 4TV6A 4JTAA 5LIYX 4LUSA 1MW1A 1QR7A 3CXOA 3BOFA 4O1EA 3E3HA 4Q4QA 2VOMA 4QDMA 4JR5A 1H0IA 4JYEA 1Q8JA 2EJ1A 4JL2A 1RA5A 3GQYA 1WX0A 2ZXBA 7A3HA 2QCDA 1GVEA 4Z08A 3D6NA 1QI4A 1ISWA 1L6FA 3GS6A 4Z2GA 4K7VA 5HNNA 3WLNA 1QXLA 3FKRA 1W9UA 4QHRA 3C86A 3QY7A 4QG8A 2J4GA 4RXFA 5CSYA 5LYRA 1TJ2A 3LTYA 3NXFA 3GXMA 3UJSA 4UFHA 1L8PA 5C9UA 3M44A 3LY0A 3BZJA 2DFAA 3VUPA 2YXXA 1UWIA 1TMHA 1XG4A 3UYIA 4O11A 6A3HA 1CGXA 1JJKA 4DX3A 4RJEA 3DG3A 3EMZA 2RGMA 4WD0A 4Q8QA 1Q6QA 5FF7A 4OHQA 4HA4A 5AHMA 1LQAA 1JCYA 4E2OA 3ANVA 3Q2DA 2E5DA 4UQDA 2ABAA 4NJKA 1RD5A 3W00A 3NPXA 1G6CA 2FVMA 2WSQA 3AMDA 2C1IA 1KBLA 1P7TB 2GDQA 1KCZA 1VEMA 1XYAA 4QLKA 3AXHA 4B5NA 5C6MA 1TPDA 2YCJA 5TNVA 2CNCA 1Q13A 4O4VA 1VFMA 1XCFA 1PDZA 1TFVA 2WNNA 1XCXA 2X2GA 1AQ0A 3R8GA 1EC8A 4ICCX 5A8PA 4PUEA 3B8VA 3SB0A 1ZPTA 4W7VA 4DJDC 1AL7A 2D69A 3PF3A 4XO6A 1VFSA 4HK5A 4DUWA 3SCNA 3MHUA 5TAOA 3VDGA 5H6HA 1DJHA 4QAWA 3B4UA 3WEMA 4DJFC 3FYYA 3H7UA 5FF3A 2XINA 2OG9A 1PCKA 7TAAA 3RR1A 5CPOA 2JIWA 1HW6A 4NVTA 3MB9A 4US6A 4ZBCA 3GTHA 3T78A 4DBWA 3F5KA 3M7WA 3Q94A 3QYQA 3TNBA 1AUSL 1T5AA 2Q01A 3G3MA 4J5NA 3UR2A 1V4YA 2CWXA 4QSFA 3M46A 4GI8A 1R7OA 5I0DA 5FSDC 3AIRA 5HDRA 3FLUA 3S3GA 4NHVA 1UR8A 3GVQA 4X2RA 4IG2A 3SCUA 4ZTYA 4AISA 3QV7A 3QM3A 2GJXB 2VC6A 1FBAA 3N15A 4XZIA 3COTA 3HMJG 3TYEA 1YXYA 1JCTA 4O17A 3EKZA 3AHXA 2G4JA 5LXEA 3P74A 5T8GA 5H8MA 3E0VA 3K13A 1QO5A 4UQ9A 4WDUA 2YCLA 4IQJA 4PC8A 4DEFA 4JPGA 4UR8A 4P8UA 5CAKA 5MKGB 1GQLA 1VENA 3TN5A 1WDRA 4PB5A 2QW5A 4BF7A 3OVPA 4XKYB 3QHMA 1KTBA 3NQDA 3II1A 3SFKA 1KTCA 5KZDA 3TU9A 5DMYA 2BG5A 4PL2A 1T8XA 1P48A 2QUNA 3ZVHB 1JVNA 2VZOA 3EZ4A 3W72A 4IMFA 1JF6A 5I06A 3G5EA 4GPNA 1XFCA 5HMFA 2GGHA 3W73A 2QJNA 3PG9A 4ZCWA 3G1RA 4DUXA 1OYAA 4M6VA 2D0HA 1Q7ZA 1S2UA 1DHPA 3W71A 1LBMA 1RXOB 1IT0A 2WC4A 2R14A 1MFVA 1JEZA 1PWLA 3BOXA 4C5ZA 3KAOA 5FJTA 3N2OA 3NO3A 5CPNA 5EMKA 5GJMA 3RR4A 1LP6A 4PMOA 4GGBA 2QV4A 4O19A 1GEQA 4Y9OA 4IOTA 2AQOA 3UWZA 2KZHA 2W92A 3RLVA 3WLIA 1A50A 3STCA 1KFWA 3H4XA 2VX6A 3GO2A 3LI1A 4IP7A 2PI6A 3L67A 1H41A 2Z6JA 2CLOA 3B9OA 3N9RA 1C3FA 4PUUA 4FXJA 2XDFA 5CG7A 4PMRA 3LCGA 1XL9A 2XWEA 3PZNA 4DRSA 3GIQA 5LIUX 4A8LA 4Z1AA 1Q6CA 1CENA 2PWUA 3PVFA 4C1NB 3LBCA 3SIZA 1MZHA 3W2NA 3AJ7A 4G7EB 5T9BG 3VFCA 2QCNA 1UWTA 4A2RA 4JX5A 1IHIA 5HWJA 3EYPA 1UG6A 2O4QA 2Z7GA 2Y61A 3UJFA 4JTEA 1DJIA 3F2CA 1VFUA 2HZGA 1R2SA 4YNGA 3HO8A 1MW2A 2VENA 4QTGA 1EWDA 4TO8A 1EP3A 1V79A 3I3DA 1HZYA 1BVWA 2AKMA 3QGKC 2QGYA 4NL1A 1H5YA 4N6EA 1PHWA 2L5HA 2GUBA 4HMCA 4X9YA 5BZAA 3UA3A 3FAWA 4NXSA 1G1YA 2DSUA 1SJAA 4TVUA 3VKBA 4R9XA 1B3XA 2EKGA 1BXNA 5KITA 5DMNA 1P6WA 4S3DA 3VD4A 1ZHAA 4XX6A 3W7NA 1TJ0A 1K02A 1U1UA 3W84A 1UD2A 1LLZA 4BHYA 9CGTA 2ACQA 4QFUA 5HNTA 1XHGA 5LKYA 2VFGA 4AD1A 1Y0EA 5I78A 3QQWA 1YDOA 4HNCA 1XBYA 2BFGA 1R30A 3GYCA 3O6AA 2PWEA 1OEPA 4YVVA 4AWSA 4IX0A 3V1HA 5CAHA 2HE5A 2PTWA 4QISA 3HG4A 1B2YA 5LIKX 3FCPA 4D6JA 3SRKA 1S5WA 3AICA 1VFHA 1C90A 3RK8A 3RCYA 3RLUA 1J0JA 4CQBA 3N04A 3NO5A 2PTYA 4KT2A 1BGGA 4XKMA 2X0HA 1S5VA 3DI0A 4M24A 4OIFA 1OCJA 2J27A 3H7RA 4K37A 1N2VA 3T44A 3FN9A 2QDGA 3TTOA 5D05A 1ZGDA 3LLFA 2NQJA 3CAVA 1KM5A 4Q8NA 1QHZA 1CXIA 4QP0A 5TF0A 4IQDA 1JGMA 4JS3A 4DZHA 3RYSA 1PZ1A 4NX5A 3VIIA 3KL0A 4IL2A 2QULA 1KKRA 3QKEA 1XPGA 4L4MA 4S3AA 3ZSSA 4X61A 3GU2A 2PDBA 1C9DA 2QUMA 2VX7A 3SN0A 1E15A 5AKQA 1RK5A 1H11A 5HMSA 5H1WA 2BSLA 3AXKA 6REQA 2YFOA 3AHZA 2PTDA 3AC0A 1OG6A 5F1UA 5HJLA 3A5VA 1J93A 2OMAA 1WOAA 4UTFA 3NUKA 2HS8A 2ZZ3A 3N6HA 4BF5A 5AZ1A 4FHAA 4ZL1A 2Z29A 4UNKA 1M6JA 3PG8A 2QXWA 2WV8A 2IKJA 3CZ8A 1N8IA 3A6OA 3D3AA 2YA2A 1FHLA 5E9XA 1BYDA 1LBLA 4F0RA 4B2DA 1ONEA 1GK8A 5D9PA 3LA4A 4F40A 4RV3A 3PB0A 4JFWA 3CIXA 3TN3A 1FH9A 2AAAA 1E70M 3SR7A 3UY8A 4REQB 2Z2UA 3PY2A 2QPXA 3O15A 4PRTA 3H2FA 3UYCA 3CMGA 3QXBA 3WZ0E 2C3ZA 3GNPA 1CXKA 2BGSA 5D37A 4EIVA 1HJXA 2YL9A 3T08A 4BKNA 4P2VA 2CESA 1I0BA 3VD9A 4G2DA 2BVWA 4QSHA 1I2PA 3POCA 3TSDA 4LBUA 5EMMA 3OVQA 1SSGA 1U1JA 2G97A 1JF5A 1TWWA 5DXYA 2RAGA 3S46A 3HQOA 5K4XA 3SQLA 1OD0A 3ARSA 3GHSA 2YIHA 4HCLA 1Q3NA 3KZSA 1JI1A 3MBDA 3HF3A 3WQFA 1OT1A 1B90A 4NQ1A 1RPKA 5H8PA 3P0WA 4E8DA 3M0LA 1XGZA 3H8AA 1QWGA 2ADAA 1GJUA 4YXGA 4XZMX 2RUSA 3BLIA 4Z2JA 3TAOA 4E8CA 4IFKB 1JPDX 4BA0A 5IBXA 1GNXA 3CO4A 4GQ0A 5XIAA 4UTKA 2DZPA 2YJQA 3WMBA 1JZ2A 1V8EA 3KCJA 5A5WA 1QPKA 3FKKA 2ZVIA 2EG7A 4LNYA 3IPWA 1P7TA 4DQWA 1IR2A 2E68A 4WRHA 4UWMA 3TLLA 3LYEA 1V03A 3RX4A 1DEDA 5I03A 5BWAA 2A7NA 2D73A 3JS3A 4HT3A 4R3UA 3CH0A 2WZMA 4OVXA 4RL3A 3LB0A 3R5EA 2XH0A 3ITXA 1QI5A 5HQLA 5LGXA 3HGSA 4DWDA 3GNRA 1UH3A 1LOSA 2NZLA 3QZ6A 3WO8A 4AX7A 4MFDA 2ESCA 3TQKA 2WMJA 3V0UA 4RV8A 1OWQA 1ZBKA 4RKAA 3EEGA 1O5QA 4I90A 2JF7A 2YXOA 1R3VA 1A47A 2YSWA 4N4PA 2HBVA 4JFUA 4F2TA 5CJMA 1TPUA 3LM7A 1GQIA 3PSVA 1PO9A 4HJWA 4WSHA 4D6HA 4S3GA 2GVJA 3ARUA 2W6RA 4IUGA 3BARA 3RN6A 4BQ4A 4GCAA 3W1AA 3BW4A 5FEZA 1SQ7A 3W7KA 2ZRXA 3PPHA 3B4YA 1J0IA 4IMEA 1OC5A 4C6JA 1SZEA 4U4MA 3EPNA 5D02A 1DL3A 4F4RA 1KV8A 4KFNA 2RDTA 3I6EA 3GNOA 4KWOA 3CWNA 4HPJA 4J28A 5DRCA 1XLBA 4LXFA 3BICA 4HJFA 4W8AA 4A3RA 3W83A 3GE7A 1UD6A 4DZIA 1PUDA 3FW6A 4F48A 1AODA 2H90A 2I17A 4OOUA 4H7ZA 1JRCA 2YZ5A 4XD4A 4X22A 1TQXA 1GUVA 3WK3A 3W7HA 1TTPA 1EC9A 1RUSA 4ZFMA 2CXEA 4HNVA 3AFBA 2VP8A 3TYBA 4O50A 2OEKA 4J27A 4GH3A 3OJGA 2ZRVA 4PCPA 4TX8A 3W82A 2G3MA 2XTKA 2DU2A 1I60A 1YTKA 2CZFA 4W84A 4WKHA 3NQBA 3EA1A 3TSMA 3H7VA 5CLWA 5FEWA 4HOXA 3TCEA 2PMQA 4OBSA 4MADA 2E77A 1E3XA 2E25A 2ZC8A 3N11A 4OQVA 3UZXA 2MUCA 2ZUVA 1A5LC 1AJZA 4AAJA 4QG6A 3S9IA 1W37A 4IH3A 4U28A 3VIFA 4JIPA 4EF9A 1DJGA 4AYGA 3NSNA 3N4AA 3NEHA 3WLJA 2VGGA 3A23A 3SSJA 1X8CA 1VC4A 3H2CA 3GU9A 3VGGA 5M1TA 3STPA 3TJIA 5F4XA 1OX4A 4K2SA 3IANA 3MW7A 4HA3A 3KL5A 4H8HA 3O6DA 4YCPA 1FCVA 3CUHA 1F6YA 1K9EA 1TB3A 3USBA 2EQDA 3R79A 3IVUA 3LLXA 1Y5VA 3K1DA 1EOMA 4GI6A 3G8RA 1XIDA 4HHPA 5C0QA 1YXDA 3EB2A 3W7OA 4D9PA 4OUIA 2PCEA 5M3WA 4H6KA 4LB3A 3T09A 4AZBA 4RPQA 1UWUA 1A80A 2QS8A 4Q32A 1LCOA 4Z0SA 2F6XA 4PFHA 3WJSA 2OXNA 1YPIA 1WDQA 4MDPA 4QE5A 3I3EA 1HN1A 3RX3A 4IJCA 2YL8A 2NQHA 3WH6A 4HZ8A 4AMCA 2G95A 1QT1A 5BYWA 2G3FA 1LG1A 3L9CA 3N13A 3UNTA 5BW6A 3NCOA 4LC8A 3W2KA 1PJ9A 1UUOA 2NXHA 5HULA 3XIMA 1R7AA 2B4GA 3IIVA 3TXVA 4BI6A 2DZAA 1WKYA 3BGGA 4YS1A 3BV4A 4C6EA 5E9AA 4KW2A 3VIHA 1UR3M 4JTUA 4N7QA 1JYWA 1SFSA 1WDDA 4YTSA 2IW0A 2TPSA 2JKPA 3FYOA 1Z9AA 1OG0A 3GR8A 1W1TA 4S3FA 2YDQA 5BNKA 1MO0A 1DQWA 2PDIA 2E3ZA 5C9XA 1BF2A 3ITYA 3GTXA 3MJMA 4QLLA 1I2OA 1IV8A 1GOOA 1QOQA 4CQCA 5DX7A 3OGVA 1TVNA 3FAXA 4FZIA 2V2CA 3PHAA 1GQNA 1PTDA 2QUUA 4LUIA 1EOKA 3FY1A 3U6WA 2P53A 4F0MA 2FTWA 3RJXA 4UNLA 1X6UA 4QEHA 3LTPA 2ZRYA 1F6KA 2QJJA 5I23A 1RLCL 5CGMA 5BU9A 4YIWA 1BTCA 4LY4A 4IJRA 1Y65A 3LGEA 2VTFA 1NIUA 5C54A 1KXHA 1KC7A 1JDEA 3ANYA 1W1VA 1Q8AA 4OECA 3B04A 4GY0A 3WNPA 4Q6XA 1FTXA 1O94A 1EEPA 2ANUA 5B7YA 1K70A 4CNNA 4MSSA 3N4EA 1XH2A 2V5BA 5KZEA 3VC5A 3V36A 2PDPA 3B9DA 3GK0A 3NQVA 4IQEA 1E5JA 1B3OA 3FOKA 5PTDA 3KCOA 5AHLA 3UXDA 3PBGA 4JTSA 3O2LA 3RXZA 4JTFA 2J88A 2TMDA 3P0XA 3LU2A 4NUWA 2J8GA 4L61A 4RDZA 1XLCA 1QI0A 3VNYA 4Q8VA 4JD4A 4ZO8A 3VM7A 1OK6A 2J9ZA 4PUJA 5GJPA 3C0JA 2R94A 3ZLFA 3JUGA 4B5TA 4LYPA 2XG9A 4WOQA 3S42A 3RLHA 4BQ3A 3VOGA 2Y4SA 2WAGA 2INZA 3V18A 3SUWA 3DYOA 4Q4OA 4ZA0A 2Z28A 1FVPA 4A35A 2C14A 1EEXA 4C6IA 2E6DA 3HPSA 4FX7A 1ZJHA 1AZ1A 3DOPA 1W5MA 5A2CA 4JOMA 1KFCA 3FNDA 4EAMA 4ZQMA 4O18A 2Y5EA 2DUAA 3W28A 4GVGA 3W87A 2OEMA 4TTUA 1ZALA 2FDMA 3B0PA 3EOLA 4DJDD 2XM2A 1GYLA 4S3BA 5DO8A 3T42A 1LRNA 2GJNA 1TX0A 3DYMA 2VCBA 1QASA 4DNMA 2GSEA 3CS2A 3USZA 2R1NA 4I3GA 1LQ0A 1RJQA 2CKRA 3MWCA 1XLMA 3AYSA 2EPLX 2NXIA 3E2VA 3UP8A 2D2OA 4IM4A 1V7YA 3NO1A 4KEVA 1TPFA 4LS1A 3OG2A 4HNNA 2TODA 5HQMA 2VCCA 5AHIA 4V1XA 2PDWA 4Q4MA 4Q8WA 3JW7A 6TAAA 2A85A 1N55A 4ZFCA 5FACA 1P1MA 2FB3A 4H6RA 3WBYA 2PDKA 4HCHA 4CU7A 1BWVA 2P0OA 3WUGA 3LPPA 1VRDA 5IOBA 2I5IA 5EGRA 1GYNA 1MWOA 2VT0A 3WN6A 1I0DA 1NFGA 3PFMA 1S3TC 4WY0F 2WJFA 5ABFB 2EPMX 1VPQA 4CD8A 1DJYA 3HPAA 1TUFA 1N8WA 3D5HA 3KOWA 2CHNA 3E1F1 1SW3A 4JDBA 3LCLA 3ONBA 3MVTA 4HIBA 1J0ZA 4ALDA 4H9XA 2ZFAA 1YTDA 4NU7A 5JIWA 2Y0FA 2WPGA 3ARXA 5CC3A 3I7RA 1WA3A 5D2WA 2BP1A 3LDVA 4UCGA 4O28A 4S2BA 3VDAA 4EANA 2P88A 4H04A 4RE3A 2OR2A 3WQOA 3OYZA 3UWEA 3VIOA 4FOUA 3WQ6A 2CYGA 3NSXA 3SY5A 1G4PA 1F3TA 1EXPA 3E0LA 3DFQA 1DYSA 1VJSA 3ARTA 1WOBA 1KA9F 4PCSA 1QDSA 5M5DA 3E5PA 4QX4A 5C9ZA 1DXIA 4GQQA 1HT6A 1DV7A 3FDGA 3QR1A 3SUUA 4DBDA 3I7QA 5CPQA 2WOQA 3WENA 2DPEA 1CECA 4DO4A 1PPIA<