4PMDA

Crystal structure of cbxyn10b from caldicellulosiruptor bescii and its mutant(e139a) in complex with hydrolyzed xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
329
structure length
329
Chain Sequence
TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose
rcsb
source organism Caldicellulosiruptor bescii
total genus 127
structure length 329
sequence length 329
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmdA00
1J0JA 3BC9A 2XGIA 1MW1A 1VEOA 1PJ9A 2GSJA 2WLYA 3L4VA 1E70M 3WELA 2XVLA 4XV0A 1Q4NX 1SFSA 4HOZA 1H1NA 4DM1A 4WJXA 2BS9A 5C70A 3AMDA 1XCXA 3KZSA 1E43A 1HVQA 3QHOA 2Y8VA 3LPFA 1V3KA 2PF0A 4PRWA 1EIBA 1WDQA 1FFQA 3IJ9A 4EANA 4CVWA 1NWSA 1GUVA 2XGBA 3OBAA 4WSKA 4TOQA 3SCOA 1OIFA 1CGVA 3WQ6A 4TUFA 1QI4A 4UNIA 5D4YA 2ZXBA 4P7NA 1C8YA 1VFOA 1HJXA 3DYPA 1E1EA 4Y7EA 5IHSA 4AEFA 4BQ2A 1D3CA 3ALGA 2Y5EA 2WCAA 1WZLA 1U2YA 3QOMA 4U2YA 1HX0A 1NWTA 3WDQA 4PMZA 5EB8A 1FFRA 2D22A 3WBAA 1JZ6A 3CUFA 4NZCA 1UKQA 2DEPA 2J74A 2J8GA 1BVNP 2G8ZA 3WUFA 3N13A 3RJXA 3CHCA 1R7OA 4AIOA 4M56A 1V3JA 3EDFA 5FD0A 1GHSA 1ODZA 4ZEPA 2UY5A 1UZ4A 4W89A 5EBAA 4YN5A 2CHOA 1JIBA 3WBEA 1CGTA 1A47A 8A3HA 2JE8A 3L4WA 1L0PA 1B3XA 1KBKA 1Q6FA 1WZAA 2W92A 4EKJA 3SUVA 2E4TA 1HXJA 1V03A 3MSGA 2X8RA 5TD4A 4GQRA 3MUIA 4Q7NA 5E9AA 5A8NA 3CGTA 2D24A 1WDPA 4TTGA 1GJWA 1QI0A 4D6CA 5BCAA 5CLTA 1G5AA 2OLHA 3UERA 1WP6A 3U5UA 1YHTA 1UD4A 1UR8A 2X2YA 1XYFA 3A4XA 2ZX9A 2VT0A 5CXPA 1J01A 1XC6A 1FP8A 4IM4A 1E56A 1XD1A 4XZBA 3BGAA 2VX5A 1ECEA 4F9DA 1G1YA 3KWXA 3WH9A 5JBFA 1W2PA 1W9DM 1WAWA 5ABGA 4HPHA 4E2OA 3WH5A 3I3EA 3A3HA 4PCTA 3S2CA 3GDBA 2VR5A 5BRQA 1GJUA 1OWQA 1WNOA 4Z2HA 2YIHA 4J3XA 2O9RA 1JZ4A 3W24A 2NW0A 1BYBA 3CTTA 1E4MM 4JFUA 3L4YA 5ABFA 1JDCA 1IV8A 2XM2A 3W82A 3VIPA 1M01A 4JHOA 1B30A 1EOMA 2W91A 1VAHA 3SCWA 2XVNA 4PSRA 1OINA 4EAMA 4F79A 3BAIA 3WD1A 2ESCA 5IXEA 1OIMA 1EDGA 2ZICA 3U7VA 5LA0A 1KWKA 4CD4A 1BHGA 1JDDA 3WFLA 2AAAA 2PBOA 2VO5A 3ZT6A 2EPOA 3VTRA 5AC5A 4AYSA 2OYMA 3G6MA 4B9YA 5AYBA 1WO2A 1FA2A 3SCPA 2WKGA 4PMQA 1FH8A 3IK2A 2EPKX 2G3MA 5GNZA 5HNNA 1KFWA 4CD8A 2BFGA 2O9PA 3VO0A 4CU8A 3EMCA 3PBGA 1C93A 5DT7A 4AZCA 1VF8A 4UQBA 1G01A 3VIHA 5BYWA 1JZ7A 5AYIA 4OUEA 2GVYA 1ESWA 1ZU8A 1GOKA 3ARYA 3VM7A 4D6EA 3M46A 3M07A 4BQ5A 1ITCA 4OOZA 3WF2A 5HXMA 3POHA 1TA3B 1D2KA 1UWRA 3GBDA 1EO5A 3L4ZA 1TCMA 1HP4A 3SUTA 3WQWA 1NP0A 2J47A 1CGUA 3AIQA 3WH6A 3WN6A 4JCLA 4H04A 2WSPA 1UD6A 2ZWYA 4C7GA 1Q6GA 4HZ8A 2VZVA 3NDYA 2WMKA 4W8BA 2WBKA 4M82A 2V3EA 2Y8KA 4HA4A 3BAWA 3WNLA 3AYRA 3LMYA 3SUUA 4AEEA 1UWUA 1C7SA 4XX6A 3AXXA 3BAJA 4S3KA 1H3GA 2QF8A 1W1PA 1O7AA 1C90A 3W4RA 1XH2A 3ZJKA 2VZTA 1QOXA 3AZTA 1CNVA 2QPSA 1V0LA 4ZE5A 2XFYA 2WWDA 1LWHA 1LG1A 1R86A 1TMQA 3FN9A 1UD8A 4QLJA 1W3HA 1OGSA 3F5KA 3WQ8A 3AMCA 4LX4A 2CBVA 1M7XA 1QNOA 2VRKA 3VPLA 2WC4A 3HN3A 4JFSA 2ZUSA 3OB8A 2V3DA 4D6HA 1GQIA 4E8DA 3FW6A 3NDZA 3CUJA 3DYOA 4M29A 5E70A 1R7AA 1HJSA 2YA2A 4QDMA 4F9JA 4UOJA 4CU6A 2VZUA 1DWIM 3N11A 1SMDA 3OGSA 2VUYA 1DTUA 4R27A 1E72M 1V6UA 4UOQA 1XRVA 4CD7A 2X1IA 2YOCA 1LQ0A 3LPPA 4RE4A 3VMPA 4DUVA 4GO9A 1U30A 4QAWA 3ZJ8A 4DWSB 3BCDA 1FHLA 4EE9A 1DWAM 3RM8A 1KCKA 1UR0A 1ISXA 2IUZA 4UFMA 1UWTA 2W66A 3BXWA 3L4UA 3NYDA 1TVNA 2OYKA 3L4TA 1PX3A 1TR1A 1MW3A 2GUYA 2WMFA 2CEQA 1E55A 6A3HA 2Y24A 1XV8A 4CCEA 4CN1A 4DWSC 4J27A 4YHEA 4AD3A 1AQMA 1GZJA 1HJUA 2JALA 4DWSD 4PEEA 3AMLA 3RDKA 1BGGA 4HU0A 3W25A 4W8LA 2J25A 4MNKA 2EBNA 4CVUA 3MO4A 4W7VA 5DEZA 1V6YA 3T0DA 1JAKA 1UH2A 1OT2A 3AS3A 5A95A 1V3MA 1HL9A 1UA3A 2WXDM 1E6XM 2J7CA 1L8NA 4ZXLA 1BSIA 1JZ5A 1K9EA 4GZIA 2QV4A 2AMGA 2DH3A 3GXMA 4HZ6A 3AIVA 3TTOA 2VQTA 1V3LA 1J11A 1M03A 1ZJAA 2VZOA 3TA9A 3AS1A 5A2AA 2YKKA 2A3AA 1RD6A 4U5KA 3VIKA 4D6JA 4PUEA 4Z2IA 4FLOA 4D72A 4J3WA 4GZEA 1X6LA 4JHZA 3AI0A 1QW8A 5BXTA 1UKOA 4WLCA 4YHGA 3VD4A 4F8XA 3BMWA 2VZSA 4LYQA 1QNSA 1V3HA 3B9EA 1CBGA 1HF6A 4P7QA 1WZKA 1I1WA 4XZWA 3T09A 1NQ6A 3GH4A 3AIWA 2WHLA 3W29A 1MXDA 3RILA 1Z32X 1BYCA 4K68A 3GBEA 4QLLA 5BRPA 3QGVA 3O9NA 2WSKA 1TUXA 3VGDA 2A3BA 5JIWA 1W9UA 1HKIA 3ALFA 1NP2A 3ZJ7A 2EPMX 1CGYA 1ODUA 4D71A 2J79A 1E1FA 3OZOA 2J7GA 1VIWA 1ZB5A 4AZ5A 5A94A 3N15A 2DGAA 2Y4SA 5FL0A 2WM0A 3MMUA 3WIJA 1B3YA 3BAKA 4MAZA 4TVDA 4WKHA 3THDA 3CZGA 1AVAA 2CKSA 4GXPA 5FL1A 4IISA 3WUBA 3N04A 2GJPA 2DT2A 1VBUA 4UZSA 1VEMA 4OJYA 1XGZA 2EO7A 2XM1A 4AD2A 4MAVA 3W6MA 2NT1A 3F5LA 5D9NA 1HL8A 2WVUA 4JCMA 2WMGA 3VDCA 1BFNA 2YLLA 4W7UA 1SR0A 3VIFA 4RL3A 1ISWA 2WHKA 1JF5A 1H2JA 3WNOA 1ZS2A 5D9OA 2NT0A 3GM8A 1XD0A 2FGZA 3ARZA 2BHZA 1GCYA 2W61A 1DHKA 3K8KA 3WEOA 5HOSA 1DP0A 3UR8A 1B9ZA 1KQYA 1JL8A 3VIGA 2EEXA 4U3CA 4HA1A 3N9KA 4V2XA 5A8QA 2D23A 1C8QA 4R5EA 1W9BM 2F8QA 3QHNA 4PYSA 2QMJA 1ZBWA 5DFAA 1GVYA 3ARRA 5I5RA 3FAXA 2W67A 2WVTA 4W84A 4XB3A 4MJ2A 2E8ZA 3WUEA 5A6BD 1KGUA 1MQQA 3AMKA 1H5VA 4P8XA 1US2A 3WD4A 4LPCA 4AZ6A 2WCGA 4NRRA 2YA1A 9CGTA 2J4GA 1NOUA 3APGA 4KRTA 2XFRA 1TZ7A 5LA2A 3ZIZA 3PZMA 3MSDA 3DHUA 2GK1A 2E9BA 4EK7A 2VRQA 2J62A 1Q6EA 1GORA 2WK2A 3IJ8A 1HKMA 1E3ZA 4RE3A 1CLVA 1UA7A 1KGWA 4D6FA 4BQ4A 2XYLA 1JGIA 2VR4A 3VD3A 3VOCA 1EHAA 3QHMA 4X0VA 1CIUA 2EJ1A 3OLEA 1PIFA 2VURA 5IHRA 1TA3A 4GINA 1I75A 2O9TA 2ZUTA 3PTQA 3LPGA 1UOKA 4LGXA 1VFMA 2YDQA 3CHDA 1QW9A 3OLGA 1E4NA 4A3YA 1NOWA 4B16A 1PAMA 1H4PA 4P8VA 5BXRA 4U5IA 5CSUA 3VU2A 1JFXA 4CD6A 1FH7A 1UKTA 4UQEA 5ABEA 3QOKA 1DWFM 3T2QA 1JYWA 3CZEA 1JDAA 3VKKA 1NH6A 1Q6DA 3MKKA 5CLWA 3CIVA 3O2LA 1E6NA 4HMDA 4AZ7A 1C8XA 5D9PA 3WFZA 5M3WA 3GXDA 4KH2A 3T2OA 1XSKA 3VDBA 2ZXQA 5E0CA 1JD7A 1HNYA 1NWUA 1AQ0A 2IXUA 2BVYA 1JI1A 3T2PA 1H11A 1LL4A 4CD5A 5GPRA 2DT0A 4J28A 5KEZA 4MADA 1BVZA 4QCEA 3OG2A 2QHAA 3ARVA 2ZUVA 1JYNA 1FHDA 2CESA 3EDKA 3AISA 3UCQA 3VILA 4BQ3A 1K9DA 2VL4A 1GPFA 2UY3A 1VJSA 3WQ4A 2XJ7A 1MVYA 3ARUA 1RP9A 2VJXA 4J3VA 1EO7A 5EFDA 1UH3A 4ATLA 3U57A 1MFVA 1MQPA 3RPMA 1B3VA 4H8HA 3PZIA 3ECQA 3WNNA 2WVSA 3WUGA 2J7EA 2PI6A 4J3UA 1E9LA 1JFHA 1KGXA 5BROA 1O6IA 3KE0A 4DWSA 2EPLX 2YJQA 3ZT5A 5FIPA 1XH0A 2E0PA 2QMKA 3NSXA 3MV11 5I24A 5GNYA 2EXOA 5F7UA 3FNDA 3FHAA 1JZ2A 2FH8A 3PZTA 1LL7A 1UYQA 1BGAA 2WZIA 1GOMA 5CZKA 1JG9A 1VENA 5JUVA 3RJYA 3ZMRA 1BYAA 2V3GA 4KGJA 1F4AA 4PTMA 4U2ZA 4MNMA 3VIOA 4P7RA 3W28A 3SEPA 3SURA 2E9LA 1M04A 2YLAA 1OCQA 3VGFA 4WSJA 3N18A 4NSBA 2CNCA 4PMYA 1QHOA 3GXIA 4H7VA 1ITXA 4AZGA 1Y7VA 2ZXDA 1CXEA 1NARA 3K8LA 4NRSA 3OIHA 4JFVA 3W0KA 1B1YA 4AC1X 3RO8A 2GK1B 1UR2A 5CJ5A 2WW5A 1G9HA 3F4VA 3GNRA 3WL1A 5JIPA 3VMNA 4HU8A 3T0AA 2XFFA 4MDPA 3WF3A 1HP5A 4L4PA 1EQCA 1W1VA 1HVXA 1E73M 1P6WA 4CUCA 4B3KA 2ZUUA 5GQBA 5CPTA 3THCA 3WDHA 1HJWA 2WYSA 1HJQA 4ZXOA 3NSMA 2J7DA 1ZL1A 5DT5A 1J12A 1MXGA 2XHYA 1UQYA 1H0GA 2VNCA 4GZJA 1E5NA 1CWYA 4FLSA 4NI3A 3VGGA 1XCWA 1DEDA 3GXFA 1M53A 3BCFA 3PZGA 3ZSSA 1V6VA 1PPIA 4AISA 3WD2A 5D9MA 1ISYA 3PZNA 1U33A 3VGEA 3HJEA 2BV9A 2EQDA 1B90A 3I3BA 3QR3A 5EMYA 2VVSA 3VGHA 4D1IA 2ZUNA 2X0YA 2C0HA 5FOOA 3DECA 1E4IA 1W9VA 2ZX8A 4CCDA 3OA5A 1EHNA 1N82A 5A6AA 1GQKA 2PC8A 3ARXA 1I1XA 2PWEA 1V08A 4CGTA 3ZO9A 3W53A 1PX8A 1JXKA 1DWGM 3ARWA 1CDGA 4GI8A 3VNYA 2VX6A 3AHXA 1UR4A 1JF6A 1UHVA 5M5DA 4FLQA 2J7FA 2XVKA 4GPNA 1J18A 2FGLA 2ZUMA 3ARTA 3ZQ9A 4WKFA 3J7HA 1B0IA 2DSWA 3EMZA 2RGLA 4M8UA 5A6LA 1ISVA 1ISZA 1JAEA 1US3A 4W93A 2XWDA 1AMYA 6CGTA 4W87A 5HPCA 3JUGA 3L4XA 4UR9A 1KQZA 5HDRA 2WLZA 4ZFMA 1W1TA 2JFEX 1UUQA 5KZ6A 4H2CA 1J0IA 4L4OA 4PSPA 4U33A 1V02A 5IFTA 3L2LA 3A6OA 3AIUA 2CKRA 5A6BA 1J0ZA 1LL6A 4D1JA 1W3KA 3NCOA 2HVMA 3VINA 1PZ3A 2PB1A 2VQUA 2FHBA 1W2VA 4TTUA 4H41A 4ZE4A 4H8UA 1OGBA 4J3TA 4C7FA 3TONA 2DSVA 4AW7A 2V3FA 1V02E 4PMOA 2WNWA 3GTNA 2QPUA 1EDQA 1EXPA 4OBRA 4Z2GA 4M80A 3UETA 1H41A 4WIWA 3CUHA 2E8YA 4MTVA 3MS8A 4JAWA 4WKAA 2DT3A 4MPKA 4AD1A 4KGLA 3WNMA 3SCRA 3N1AA 1ZJBA 3IJ7A 1JXJA 3CMJA 3W38A 4UOZA 4UQAA 2Z1KA 3AHTA 1J0YA 1OM0A 2D1ZA 2V5CA 4P7OA 3T08A 1QBAA 3B9AA 4JZ5A 1VEPA 1HJVA 2CPUA 3AXHA 3CUGA 5A8MA 4X9YA 2DIJA 3D5HA 2D20A 3WDRA 5A1AA 2OWWA 1B2YA 4HPGA 4W88A 5ABHA 3CZLA 4WK9A 5CPQA 5D8WA 4N42A 1KBBA 3WENA 5BXPA 2VMFA 3MU7A 1H09A 3UESA 4UQCA 1QVBA 1OBAA 3K1DA 2ZXAA 4MB3A 3WDJA 4C7DA 2B31A 3WMSA 3K46A 4PMXA 5DMYA 2V38A 2CBIA 2IXVA 3I3DA 4AD4A 1MYRA 1BLIA 1JD9A 3OGVA 1UD2A 2D2OA 4GIAA 2W4XA 3EDDA 3TOPA 2C7FA 2BNJA 2D0HA 3B9DA 3AHYA 1LF1A 5FCZA 3BH4A 5A6MA 2WC3A 3WSUA 1QI3A 2ZE0A 3OLIA 3AFBA 3WF1A 1GQLA 4E8CA 1WE5A 1CXIA 4M81A 5E6YA 4GI9A 3ZSTA 4Q22A 2DH2A 3FHQA 3AICA 4GO8A 2VX4A 2WVVB 1J0HA 1GOQA 4MB1A 4MDOA 1PEZA 2FDMA 1UR1A 2XSBA 2BY1A 5A3HA 5HBFA 1EOKA 1K6AA 5AC4A 2WKLA 3WL0A 1BQCA 5I23A 3MUZ1 5JBDA 2CHNA 4AZHA 5A69A 2JIWA 2BY2A 2X05A 4PTXA 5M17A 4IPNB 2J77A 3GNPA 1W9XA 2Z1SA 1S46A 2YL9A 2BXZA 3AROA 1KCLA 1QBBA 4S3JA 2BHUA 2QLYA 2D0GA 2PWHA 1WDRA 1MW2A 3EDJA 3GZAA 1XYZA 2RGMA 3AMGA 3ARSA 2G3IA 2BY0A 3GH7A 3TTSA 1GQJA 3TP4A 7TAAA 1V3IA 1LJYA 4PMNA 1W1YA 3WEZA 4ACZB 2BY3A 1EDTA 4FLRA 2XTKA 5I77A 1E0XA 3T0BA 4UFIA 1QI5A 3PN8A 5IDIA 4X0NA 3F5JA 2O92A 1CXHA 4WF7A 4UCFA 4HMCA 3TTYA 1KXTA 1LLOA 2G3JA 1MW0A 4HZ7A 4W8AA 5A6SA 4CN4A 1X1NA 3EMQA 2MANA 3ZT7A 3K8MA 3ZM8A 4LYPA 4IUGA 1QHPA 2YL5A 1UWIA 1CYGA 5I6SA 5LYRA 1E6SM 4TXEA 1BG9A 2G41A 1V0NA 1E6ZA 1NWRA 4U31A 2FHCA 1RP8A 4KWUA 4UQDA 4BF7A 5CG0A 4IPLA 1C91A 3VX1A 3MV01 2UY2A 4BS0A 1OGGA 2DIEA 2PWGA 2VX7A 1HT6A 2DQXA 1EH9A 1KXHA 5AY7A 1FH9A 1GOIA 3PHAA 2WBGA 1V6XA 1B31A 1ZBKA 1HKJA 2D0FA 4P8WA 4OKDA 3CH9A 1VB9A 4M1RA 1W32A 3PZOA 3VX0A 2YDSA 3VD7A 3WQ5A 2BVDA 4LXFA 1MWOA 2D3LA 2OWXA 3RM4A 1R85A 5CSYA 1IZJA 2WHMA 4DUWA 1QNQA 2XVGA 1GOOA 4OZOA 1A3HA 5D8ZA 3D3AA 1PX4A 1E5JA 4PCSA 4F66A 1GHRA 3EYPA 3KL0A 3UG5A 3AOFA 1W3LA 2WMIB 5DF0A 4KRUA 1GONA 1WZMA 2VOTA 4UFLA 1AQHA 1CEOA 1E0VA 4M24A 5DO8A 3CMGA 3WMCA 4BA0A 1OB0A 4W5ZA 3L2MA 4OOUA 3K4DA 3VIMA 3II1A 2OWCA 3WH7A 1BYDA 2ZX7A 3AZRA 4AIEA 1KR1A 4AY1A 4RE2A 4QCFA 3KL3A 1R87A 2ZOXA 5E0FA 3AZSA 1CGWA 2GJRA 4ZENA 2WPGA 1NOFA 4FMVA 4ATDA 3UG4A 3W37A 4PMDA 3CLWA 1E4LA 3RM9A 2X0HA 2OYLA 1KB3A 5I79A 4UQ9A 2BHYA 3MUAA 2VC9A 1H0IA 2VCBA 1GOWA 4Z2KA 2EPNA 3PZQA 2FHFA 1J0KA 3WEMA 3GYCA 5I0DA 2GJXB 2HISA 1BPLB 1TE1A 1WDSA 1PBGA 2G3NA 1NM9A 2BVTA 1EGZA 3N12A 3WDIA 2JF7A 3NSNA 4DUXA 1TVPA 2GFTA 1DWHM 4MB5A 1K9FA 4B9ZA 1MFUA 3ZJ6A 3PTKA 4AZBA 1OT1A 4FF5A 2F61A 2Y2WA 5E6ZA 5LA1A 3U5YA 3RIKA 4HOWA 2O9OA 3BMVA 3CZJA 1QNRA 4JFWA 5C71A 4W85A 3CBWA 4JKKA 1E71M 1UR9A 3S6TA 1PIGA 1VFUA 2WMHA 4AWEA 3VGBA 4MNLA 2JEQA 3G6LA 1C3FA 2XUCA 1IT0A 3LPOA 4E4PA 1UD5A 2CYGA 1UZ1A 2WCSA 1TFVA 2YA0A 4LYRA 3IANA 1KXVA 3ZR5A 1KR0A 2WZHA 2J78A 3AJ7A 3FAWA 2GDUA 3POCA 3AIEA 3U7BA 3WQVA 1GW1A 1SMAA 1F4HA 1CPUA 3W6LA 3VUPA 3NIYA 3W81A 2CITA 4HOXA 3E1F1 4PTVA 3WNKA 1OSEA 2CCRA 2WANA 2W63A 3AYSA 3BLKA 2G4FA 3WKZA 2PBGA 4BCEA 1CGXA 4Z2JA 1JYXA 1OD0A 1JNDA 2AOSA 1W91A 3VIJA 1BTCA 5A6KA 4V27A 3A4AA 3MANA 4V28A 3OGRA 2XG9A 5A6JA 3AS0A 4TX8A 4PMRA 3BSGA 8CGTA 3FY1A 5M03A 1VBRA 2CERA 2VVNA 2OSWA 1CZ1A 2WAGA 5EFFA 2W5FA 3W27A 3VD5A 4B3LA 5A2CA 3CPUA 1XSIA 4P8UA 1BF2A 1E6QM 1FOBA 4PN2A 1QHZA 2DSZA 3TTQA 5FKYA 5I78A 1Q6CA 4UFJA 4QFUA 4BZYA 3WD0A 4MNJA 3PZ9A 3NUKA 3CUIA 4TVCA 4DM2A 3OLDA 2VCAA 4AMCA 4HA3A 4UZUA 4ATWA 7CGTA 4HP5A 4P7LA 3SUSA 1V6WA 5A2BA 4UTFA 1UQZA 2WVVA 1G0CA 4QLKA 4W5UA 1B3WA 1EA9C 3VM5A 6TAAA 3WY1A 1OD8A 3A47A 2WB5A 4AD0A 1HIZA 1CTNA 4U3AA 5E09A 3PZUA 2VI0A 3CZ8A 5BWFA 5A8PA 3VNZA 3KEHA 4ACYA 2A3EA 5A8OA 2GDVA 4URIA 3RCNA 4XUYA 4MJ4A 5I3DA 4HTYA 2F2HA 4TVUA 1VFFA 5I2UA 3O6AA 1GNXA 2CXGA 3EDEA 1E3XA 5BXSA 1JZ3A 2XIIA 1KXQA 2E9MA 1G94A 5JBEA 2PWFA 1UG6A 1XSJA 4JL2A 3M6DA 3AHVA 2DDXA 3WMBA 4JKLA 2DT1A 5ABFB 2CIPA 1E6PA 4AD5A 4D6GA 3SIMA 1CXLA 2E3ZA 3B8SA 3SUWA 4ACZA 1E15A 1E40A 2VCCA 1XHGA 5IFPA 2WC7A 1V0KA 2ZIDA 2WWCA 3RMEA 3VDHA 2E40A 4PUDA 1CENA 3BSHA 1V0MA 2JF6A 3HU7A 1UWSA 4J7RA 1RPKA 3CO4A 1B3ZA 1D7FA 3KL5A 1J10A 4UFKA 5HPOA 1BAGA 1E0WA 3DYMA 3SCSA 5GNXA 2XVPA 1J9YA 2FH6A 1QNPA 3HMCA 2DSKA 1X6NA 2J7BA 1KWGA 3K4AA 4TX6A 1H49A 2X09A 3VIIA 1WKYA 3UG3A 4GKLA 3WH8A 2C8NA 2J7HA 3PTMA 1WPCA 3MMWA 2CETA 4AZCB 3FXYA 3SCNA 3AHZA 4MB4A 4KMQA 5C8BB 1WCGA 3DC0A 4ML4A 2PWDA 4J3SA 3UR7A 3ARPA 2J8FA 5CQ1A 2UY4A 3CZKA 2UWFA 4AIUA 4H8VA 4AXNA 4CU7A 4PMVA 3UEQA 2YL8A 1JNEA 3PZVA 5CGTA 1JZ8A 2NSXA 2OSXA 3VVGA 1CXKA 3GNOA 2A3CA 2D3NA 4A4AA 2TAAA 3AQUA 2CBJA 3ZR6A 4GQQA 1UKPA 2BXYA 4OBSA 4JFTA 3ZOAA 3IAPA 1R8LA 1PZ2A 1YQ2A 1W9PA 4PTWA 1E6RA 3WD3A 2VRJA 3OZPA 2WMIA 1WB0A 2YL6A 2VTFA 4D6IA 1ZBVA 4PBGA 4CN6A 2V5DA 1RH9A 2DSUA 1IZKA 3A4WA 4FK9A 2XSAA 2A3HA 3N17A 4N0RA 3BAYA 2JEPA 4CKQA 1VRXA 1QPKA 2WHJA 3GH5A 5ECUA 2XIBA 2WMJA 4YPJA 1EQPA 5CGMA 1UWQA 1DWJM 3BAXA 2W62A 1MQRA 2ZX6A 1C7TA 2YBTA 1LG2A 3BLPX 4W7WA 3IAQA 2ZWZA 1GVIA 1VJZA 1HKKA 1W3JA 1C92A 1XH1A 1QI2A 1UD3A 5CPSA 2XPKA 4JIEA 2GJXA 2Q8XA 1CLXA 1CXFA 3AIRA 3MUY1 3CHFA 3AIBA 3VMOA 1HN1A 3SCUA 3AS2A 3NJ3A 2ZX5A 4AZIA 2YBUA 3VD9A 3WDPP 4GI6A 3W26A 1SYTA 1UH4A 2J75A 3ARQA 3MMDA 3AXIA 1K9TA 1CECA 1LWJA 1ZBCA 3M7SA 4JL1A 2XWEA 1BG4A 2YDRA 3WNPA 4QP0A 1JI2A 4NF7A 2JIEA 1JYVA 4B15A 7A3HA 4A3HA 4UFHA 4D6DA 1TG7A 4OIFA 3WF4A 3DHPA 3SCQA 2ZUWA 3CHEA 1FP9A 1UKSA 4LQ1A 4CCCA 4PMUA 3SCVA 2DPEA 4HMEA 4JKMA 3SCTA 4Z2LA 2WZEA 2OSYA 3EBVA 4W86A 3VDAA 3WF0A 2CBUA
chains in the Genus database with same CATH superfamily
3LEPA 1MW1A 1VEOA 2WLYA 3L4VA 3WELA 2XVLA 1H5YA 4BI6A 2R1KA 2P10A 3W74A 1PDYA 4HOZA 3UA4A 5C70A 4HCDA 3VXGA 3SFKA 1UBSA 4KIEA 2CC0A 2R1PA 4PRWA 3L0GA 1EIBA 2I1OA 5FF7A 3IACA 1BWLA 2XGBA 1L9WA 5D2VA 4TOQA 1OIFA 4TUFA 2XGZA 3LQLA 1QWKA 2ZXBA 3HJZA 2YYUA 1C8YA 1XPYA 1HJXA 3DYPA 3RO6A 4RNFA 5IHSA 2FPYA 4DN1A 1D3CA 1AMKA 1RY8A 3OHIA 3REQB 1REQA 2WCAA 3EPMA 4U2YA 4WOQA 4QE5A 3QY7A 2G50A 4QAIA 3EWBX 2Q6ZA 1IIGA 1FFRA 2ISFA 2OU4A 2R1MA 5LZLA 3CIWA 2DEPA 2J74A 2J8GA 1V7YA 2VC5A 4O14A 3RJXA 1XPGA 4RNIA 1AW2A 5FD0A 4WOZA 1ODZA 4ZQRA 4ZEPA 1EPVA 1UZ4A 4W89A 2CHOA 3LHZA 1PHQA 3WBEA 1A47A 3MC5A 4AB4A 7XIMA 2HZGA 5AFDA 2O7SA 3AO0A 3L4WA 3MVIA 2YCLA 1L0PA 3L5MA 4EKJA 5H8PA 1SQ7A 3CUXA 3U2EA 1SFJA 5H91A 4RKAA 5KITA 5E9AA 1G67A 3UYIA 2HXTA 3M0XA 3FYYA 3B04A 3ICJA 2CLFA 3RN6A 1PKLA 1WP6A 1NSJA 1XM3A 1AH0A 4LAMA 1UD4A 3W1RA 5FF4A 5FI8A 4MSSA 4Z1AA 3P82A 1DJHA 1FP8A 3V0UA 3M44A 4IM4A 4JOMA 2OOFA 2VX5A 2Z29A 3AU2A 3LOTA 3WH9A 1XIIA 5AHFA 3GHSA 2OZTA 3LI0A 5ABGA 4NZ3A 5F4XA 3I3EA 2NW0A 1H1ZA 1E4MM 2AAMA 3L4YA 5ABFA 4PEKA 1IV8A 4GMEA 3GS6A 2XM2A 3QY6A 1M01A 4N4PA 4C6OA 3UW6A 3SCWA 2AL2B 4HPJA 1OINA 3COTA 5BMXA 1W37A 2SFPA 1KFLA 4TQTA 3GUWA 1EDGA 3R1ZA 2WM1A 3U7VA 4DYJA 3W1XA 5LA0A 2C1IA 2VC7A 1RJQA 2AAAA 2VO5A 1RVGA 3DFSA 1T7LA 1F8MA 5TNVA 4AYSA 2OYMA 3B4YA 1N8IA 4G2DA 1MMFA 2QXWA 3N3MA 5FJIA 2Y8UA 1OVDA 4X61A 1QDSA 1XR2A 2O55A 2G3MA 9XIAA 4CD8A 1SJAA 5F2LA 2X16A 2QIIA 5DT7A 4AZCA 3WLQA 3P62A 3PM6A 3HO8A 4PA8A 2IW0A 1G01A 5DBUA 2GVYA 1H7PA 1ENUA 1LRQA 3V18A 3VM7A 1FVPA 4DQWA 3DBNA 3POHA 2DV0A 1D3HA 4MJMA 1R3WA 1G4PA 3HQPA 4I7WA 3WQWA 2OLAA 1CGUA 3QJAA 4RPPA 1VFSA 3WH6A 2KAUC 4JIIX 1UD6A 4M7SA 1Q6GA 5F1VA 4QGCA 3LRMA 3E5PA 1XLBA 1TB3A 2WMKA 4W8BA 2WBKA 2V3EA 1RCQA 4JTTA 1W1IE 4AU0A 4KWVA 1XLEA 4GNKB 2PGRA 4S3KA 5D02A 4BK9A 1O7AA 4RE0A 1IEWA 4LY8A 3C0JA 1HZYA 1XH2A 3C3NA 1U5VA 1CNVA 1F76A 3ABZA 4RZ6A 1LWHA 3HGSA 1LG1A 4L9XA 1TZZA 3TU9A 4I9JA 3WQ8A 3AMCA 2FFCA 4M6UA 1RALA 2WJZA 4JFSA 2V3DA 2ATSA 1GQIA 3CWNA 3A22A 3W85A 3NDZA 1FDYA 4E2BA 4M29A 3N2OA 5BWAA 8TIMA 4NIRA 1IR1A 4BF9A 1DWIM 3VOJA 1SMDA 3OGSA 1E72M 3MWAA 1TJPA 2R1LA 3S5NA 1LQ0A 3D0CA 4XZ9A 4L4MA 1U30A 1KTNA 2VD9A 4QAWA 4DWSB 1IT7A 1OYBA 1KFJA 3RM8A 1H50A 4JQ4A 3GK0A 1ISXA 2IUZA 1PTGA 5FF3A 1AH4A 4UFMA 3NYDA 3K2GA 2OYKA 5LGZA 1PX3A 2BSLA 3EKZA 5K2ZA 4B5NA 3BSMA 3PBVA 2PU1A 1TQJA 3HG5A 2IQDA 3MA8A 4AD3A 1AQMA 4KCVA 3W7GA 2JALA 4DWSD 4IMFA 3AMLA 1BGGA 4R7OA 1TYGA 1UJPA 2J25A 2AMXA 4C6CA 5DEZA 1V6YA 2XH2A 5AZ1A 3W2MA 2Q02A 4NNCA 3B40A 1OT2A 1J79A 4GK8A 1V3MA 4QRNA 1UA3A 3G1AA 2J7CA 2OKTA 4MZ1A 1EJTC 2BDQA 1BSIA 1JZ5A 4GZIA 4HZ6A 2J24A 5CC5A 1US0A 3N6JA 1DIEA 1S2WA 3O6CA 5HA7A 3HPXA 2G5WA 5A2AA 2YB4A 4B2DD 2FPTA 3I4EA 4CQCA 2RKXA 1RD6A 3MZNA 4F0RA 1Q2SA 4Q8TA 4U5KA 4JIHA 4J3WA 1X6LA 3IV3A 1A4LA 3KVMA 5HWNA 1QW8A 5BXTA 1K03A 1UKOA 1OC5A 2OT1A 1QNSA 1V3HA 1O5QA 1OF8A 2VGBA 3GU2A 2FB3A 3GFXA 2HWGA 1TKKA 4WHBA 3TFXA 3H2OA 3W2LA 1I1WA 3T09A 3RPDA 1MXSA 3IJDA 2IQ0A 3GO2A 1ADOA 3RLHA 1AA1B 2CLMA 2H8ZA 4WJ8A 4C1LA 3QGVA 3N9RA 3C0LA 2GGGA 2A3BA 3ALFA 1SZNA 1ODUA 3Q65A 3NURA 1E1FA 2ACRA 1ZB5A 4FF7A 2PF8A 3E5BA 1DJXA 4YNGA 2DGAA 2ZC8A 3VUSA 2WM0A 3WIJA 3EWYA 3P0WA 4QM1A 1Z41A 2ALRA 4GJ1A 2GJPA 2DT2A 3E0LA 3QMRA 3BV4A 1XGZA 2XM1A 1X8FA 1AW5A 3T42A 4A8LA 2EG6A 1AJ0A 3DHDA 2BOGX 3UZXA 1KRCC 4KWSA 4IGMA 1ECQA 2I14A 4YWIA 1TPVA 1WDDA 2WO5A 1KM6A 2WHKA 1H2JA 1W5MA 3NM3A 3G1XA 4Z1DA 5D9OA 3GM8A 1XD0A 2FGZA 3ARZA 4QR6A 4WDXA 2BHZA 3L9CA 1GCYA 3K8KA 1DHKA 3WEOA 4DXKA 2EKCA 1ZAIA 3ZWTA 2QCNA 4WUIA 1TV2A 3FVDA 2WQDA 3CAWA 3UR2A 1KV8A 3WK2A 1POJA 5A8QA 3AYTA 1C8QA 2PTDA 4R5EA 4Y8EA 1DV7A 4OECA 4K8HA 2X40A 1ZBWA 4PR4A 2NV9A 3ARRA 4M51A 4XD6A 3H23A 3Q45A 4O12A 4ZBCA 3WUEA 3MZ2A 1MQQA 3AXMA 3AMKA 1VS1A 1VZWA 4JTRA 1S38A 4XD5A 5D2TA 4AZ6A 4NRRA 2YA1A 2J13A 4CQ9A 1OK4A 3EXRA 3ZIZA 4E4FA 3TN6A 2VRQA 1VGAA 3E0FA 2IPWA 4FB7A 3GXNA 4DB7A 1HKMA 1E3ZA 4OQVA 5IDZA 2C19A 4BQ4A 2GVJA 3NQBA 4I5RA 2EJ1A 3N2BA 5LGXA 4LALA 1XQLA 1VH7A 1I75A 4DBSA 2ZUTA 5FEWA 1VFMA 4KPLA 2YDQA 5CBIA 1QMLA 1QW9A 3OLGA 1TRDA 3R13A 1R9YA 3MO7A 2P53A 2VGGA 1PAMA 1UZHA 3C61A 2HBVA 1POKA 3GE7A 3LXBA 4D8LA 2E5DA 5C5YA 1PE1A 1YE4A 1D7KA 4MWAE 1JYWA 1JDAA 3VKKA 2IS7A 2V30A 1Q6RA 4Y96A 5D9PA 5M3WA 1EFZA 4KH2A 4NU7A 2ZRUA 4FNTA 4I8YA 1AQ0A 1JI1A 3NQ2A 4DLMA 7REQA 4C6LA 3TYEA 4PCFA 2E67A 3JZUA 3KRBA 3WX7A 3PWAA 2ZUVA 4LAKA 1FUYA 1GWJA 1VHNA 5HUOA 1X1ZA 4BQ3A 2GGEA 3C8NA 3MP3A 2VDHA 3IJLA 1GPFA 2YCIX 1K4GA 1S2AA 4J3VA 4ATLA 1UH3A 3CC1A 3O0FA 4LBSA 3W01A 3Q4DA 1KFBA 3I6TA 4RK8A 3TXZA 3BGGA 3SRDA 3ECQA 2WVSA 3WUGA 4GA8A 2OB3A 1JFHA 5BROA 2OZ3A 4EWND 1RJPA 2EKGA 3CV1A 2E0PA 3MV11 4A3QA 1R3YA 4MKNA 5G2HA 5HK4A 3FHAA 2NXGA 1LL7A 3PZTA 1UYQA 5CZKA 2ZZ3A 3W87A 4CLMA 3THUA 1T41A 1S5TA 4O8RA 4ZA0A 3ZR4A 2IQTA 4HJFA 5I3IA 4JX6A 1A5UA 3PBMA 3SEPA 3SURA 2Z1VA 1M04A 1HKWA 4WSJA 4H00A 5LIWX 3NO5A 4WGXA 5D09A 2CLOA 2NSOA 1UOZA 5D38A 5HAOA 1CXEA 5HJLA 3K8LA 3I4KA 3OBEA 1G69A 4NZ1A 2GK1B 5ABTA 1BF6A 3ABQA 1FXPA 2NV1A 1G9HA 3GNRA 5JIPA 3WL1A 4QG9A 3VMNA 4HYWA 3S42A 4IPIA 3KS6A 4L4PA 5GJPA 1EQCA 1W1VA 3ID7A 5K9CA 2A2IA 4FZIA 1P6WA 1E1CB 5CPTA 5GQBA 3WDHA 3FCPA 1NIUA 3UPMA 2ZCGA 1YNQA 4J4KA 4XBKA 1ZL1A 2QULA 1S2TA 3BLIA 4F4RA 1H0GA 2DQWA 4FLSA 4NI3A 4DBUA 1XCWA 3GG0A 1DEDA 1M53A 1NEYA 5CBJA 3BCFA 3PZGA 4MKVA 4U28A 1IHIA 2YCJA 3WD2A 1AG1O 3AC0A 3PZNA 3N3TA 3CASA 3VGEA 3HJEA 2BV9A 4Q33A 4R7JA 1B90A 4LYKA 1OG0A 3VGHA 1GZ1A 2GGIA 1XIFA 1E4IA 1FDZA 4Q8MA 3GXTA 2QIWA 2NXHA 2PC8A 3ARXA 4FA3A 3CB3A 4AUBA 2J9YA 3ZO9A 3S1WA 3VNJA 2FLIA 1DWGM 2F2KA 3KBWA 4LF1A 2VX6A 2GYIA 1UR4A 4NJGA 1UHVA 5M5DA 3GX9A 2FGLA 3ARTA 3GG7A 3J7HA 2DSWA 3KCJA 4YTRA 1EJRC 1KFKA 5A6LA 1JAEA 1US3A 5HPCA 3DXIA 3WLJA 3DOPA 1DKWA 2QAFA 4ZFMA 5KZ6A 4UUIA 1IIHA 1D8CA 3DFHA 1JCTA 1V02A 2PGWA 1ZFJA 1WDWA 2CKRA 3GD6A 4QG8A 3DFNA 3CHVA 4D1JA 2Y7GA 3WJXA 1A5LC 2VQUA 4S1FA 1W2VA 3GW3A 2GVLA 4ZE4A 4J3TA 3CWOX 4X60A 4AW7A 3G0SA 3QN3A 1LDCA 4FOJA 3S9YA 4XZIA 4GIYA 4OBRA 4DPPA 1H41A 4WIWA 1RK5A 2FVMA 1NJJA 3CQHA 3TN3A 4A2SA 4WKAA 1S39A 1SFLA 1SM9A 3W3OA 1B5TA 3SCRA 3UXIA 5ECVA 3IJ7A 5T8GA 4NXKA 4I3GA 4UOZA 4LVDA 2DJXA 1JCMP 3HQ1A 2D1ZA 3EX1A 4P7OA 1J2BA 3T08A 3W1QA 2P3ZA 4X3ZA 4P61A 2CPUA 3NVDA 3O8AA 2PDQA 3AXHA 3SQLA 4X9YA 3EPNA 2DIJA 1CI1A 2H6RA 1W3NA 1QO2A 1JCYA 4GQGA 4DO6A 3CUZA 3LDVA 2DW6A 4JGDA 4UNLA 5BXPA 3MCOA 2VMFA 1H09A 3HQOA 2QVNA 3AWOA 4C7DA 1R2RA 3S6OA 3GKAA 2R1NA 3K46A 4C6JA 1EIXA 1I9CB 3HIJA 3R12A 4AD4A 1BLIA 1EPXA 3OGVA 2CZVA 4XAYA 1UD2A 2D2OA 2G4JA 2H8XA 2REQA 1HQTA 2W4XA 3EDDA 3TOPA 2BNJA 1KM1A 4HNLA 2D0HA 3LV6A 3MUCA 4EXBA 1WA3A 4GVGA 3BH4A 4CQAA 2WC3A 3WSUA 5CKSA 1ZNNA 3TC7A 3WK3A 1SZFA 1IWAA 3D46A 1GQLA 3UWUA 3UT0A 4M81A 3CO8A 4Q22A 3VOGA 3AICA 1VHCA 1PEZA 3QQ1A 2HNHA 5HBFA 1EOKA 4IPPA 1K6AA 5AC4A 2W9MA 2WKLA 5BNKA 1QCWA 2I9EA 4XUGA 2IKGA 4C5YA 2CHNA 1LUCB 2JIWA 3W2KA 1P0EA 3D3FA 4J2MA 3GNPA 4QS5A 1KKOA 2PUZA 3G1FA 3S2NA 1J5TA 4UWMA 2BXZA 3QYQA 4IJCA 1WDRA 4LAOA 2NQ5A 1A80A 4UR7A 3GZAA 4UTJA 3UGRA 3QEZA 1KD0A 3ARSA 3SN1A 2FYMA 3KCLA 4GQBA 3BTNA 1VJIA 4LF2A 3TP4A 5CJMA 1Q7QA 1DBTA 1LJYA 4PMNA 1XLCA 3WEZA 3FX4A 1YE6A 5I77A 2YGYA 3T0BA 2I5IA 1IR2A 3GYEA 2ZRWA 3FSTA 3R79A 3F5JA 3CV2A 1SUXA 1WXYA 2XH4A 1NVMA 4WF7A 1AODA 1TPWA 5FEZA 2BTMA 4HMCA 3JU2A 1MEWA 4AHPA 5A6SA 3RXZA 4DO7A 4RXFA 4QEHA 1DIDA 1QHPA 1LZOA 1UWIA 1CYGA 5I6SA 4OE7A 1E6SM 1LTDA 2PFHA 2G41A 1E6ZA 3TFCA 3EB3A 4MWAA 3TIMA 3VNIA 4ILSA 1C91A 3VX1A 4EPBC 1KLZA 4OTKA 3SN4A 5IOBA 4BS0A 3DDMA 3QKZA 5AY7A 3LUTA 5T9BG 3W75A 1QR7A 1LQ2A 4LRTA 4ZL1A 3MY9A 4F0LA 5U4NA 2CXEA 4PL2A 4KEUA 5E5CA 3URAA 1MWOA 3EGJA 4V1XA 3RM4A 5AC8A 3LG3A 3LYEA 3PUOA 4DUWA 4A35A 4FNQA 2FFIA 2C91A 4X63A 4PCSA 3FS2A 3I6EA 2DUAA 3PUGA 1GHRA 1OC7A 1G4EA 3UG5A 1PIIA 2Y85A 4S3CA 3L0KA 3V16A 1XKYA 3TW7A 4DIAA 2VOTA 3UY7A 3NZRA 3TNBA 3DKJA 3OEXA 4LJ3A 4UTMA 1O5KA 3OW1A 4OOUA 3VIMA 4JIRA 4MF4A 3II1A 1T8XA 4A29A 3KUMA 2ZTKA 1BYDA 3UZWA 2ZX7A 3AZRA 2OZ0A 3M0LA 4AY1A 2GVEA 4L80A 1R2TA 3GQYA 4YYCA 4D9PA 3IS4A 2NX3A 1NOFA 4FMVA 4ATDA 2E6DA 3CLWA 3GTFA 2VFEA 4LW7A 3CAKA 3WLMA 2BHYA 3MUAA 1H0IA 3GVGA 5IBXC 3P6LA 3LCWA 3WEMA 1J0KA 1PV8A 1XDMA 3N25A 3GVVA 1TE1A 4ZB0A 3TROA 1ONXA 1XKJA 4C1NB 4JTJA 1EGZA 4GZ7A 5FAGA 3WDIA 5TQLA 4B5WA 3ES8A 4DUXA 3M47A 3O05A 1ELSA 3OO2A 4F0KA 3E0VA 3IK4A 4F2TA 2ISSA 4IMDA 1XYBA 5LA1A 4ML9A 4MUZA 2O9OA 3OP2A 3BMVA 5DCBA 3RLVA 3VDGA 2VDIA 1VFUA 5D2XA 3NG3A 4I7VA 1E9YB 3H2MA 2CYGA 1AZ1A 4XZLX 2DZBA 3UWEA 2HVNA 1XQKA 3OPSA 2YA0A 4UXDA 3IIXA 4IP5A 1W1B1 1KXVA 2P50A 4UC5A 1UROA 3FAWA 2GDUA 3POCA 4NZ4A 4HYVA 2DUXA 1RHCA 4DELA 3NIYA 3B3DA 3CL7A 4KFPA 1OSEA 2CWNA 3AYSA 3BLKA 2G4FA 1SO5A 2V5BA 3P67A 3DESA 5AVNA 3GKFA 3Q37A 1ZY9A 1XGDA 3TVAA 1K7FA 1JNDA 1OX6A 1TCDA 3LV5A 1A3XA 1XF0A 4AIBA 2E09A 4V28A 4GCAA 1YRRA 4TX8A 3BOXA 1K7EA 1NU5A 3FY1A 3R43A 1VBRA 2CERA 4POCA 2WAGA 5EFFA 1XYLA 1NDZA 5A2CA 3CPUA 5AKQA 4JIQA 1VCGA 3F2BA 2FTWA 1QHZA 4NYUA 4RLIA 2V0TA 4Y9PA 1Q6CA 1TV8A 4MNJA 3UR5A 3DEQA 1ITQA 1GKQA 2A4AA 3BL3A 2NLYA 2YCLB 5C9RA 4L6DA 5DXYA 3OLDA 3BWWA 2HPMA 2I16A 4HA3A 2X42A 1V6WA 1ZHAA 1XWYA 2WVVA 1G0CA 3G1VA 4H9ZA 3NZQA 2R9RA 3WY1A 4AD0A 1CTNA 3LCHA 2ODOA 3W1PA 9XIMA 5JH1A 2VI0A 4S2BA 2E5BA 2QW5A 3KEHA 4URIA 2DZPA 1ZJIA 3A9IA 1E51A 4HA0A 4HTYA 4X2PA 4TMCA 1QW7A 1RCXB 2ADAA 5BXSA 3ZLHA 2OGJA 4B3ZA 1LM1A 3SFWA 4TU1A 5KINA 5KMYA 1G94A 1RQEA 1ZAJA 2PLKA 1TTIA 3WCZA 3Q94A 1EEXA 2A1YA 4AMAA 3WMBA 2DT1A 5ABFB 1Z7AA 2W27A 1TUFA 1H61A 2QJNA 2H3DA 3HG3A 4EACA 2HQAA 1E40A 4DLFA 1HO4A 3Q2DA 4O1BA 1PS9A 3M0JA 1V0MA 3NQ6A 3URQA 5HMFA 1AW1A 3PPGA 4AX6A 2QDHA 3DBPA 3KL5A 3SAZA 3QGKC 1XLLA 1J9YA 4LUIA 3NPWA 4ROQA 4JTFA 2Z25A 4TX6A 2X09A 4N9EA 3VIIA 1PKYA 4FOKA 1KKRA 1CB7B 4JQ3A 4IQEA 4YIWA 4DAIA 3C6CA 1XG4A 2OCZA 4AZCB 2PU0A 3ITCA 5HR6A 4DPQA 3FXGA 4LNYA 3P5YA 2O4MA 1SU5A 3T55A 1WCGA 4LUYA 1J8VA 3UBPC 2PWDA 4XZMX 2NVCA 3FVMA 4HSNA 4H8VA 3IUIA 4PMVA 3AXKA 3ZYZA 3TYDA 3REQA 2PODA 1JNEA 1KM5A 1XC4A 2TRSA 5AYXA 1A5BA 2OSXA 3EWXA 1CXKA 3GNOA 2A3CA 4A4AA 3D6NA 2VDGA 3AQUA 4O13A 1UKPA 4OBSA 2YX0A 4JS3A 3RRXA 2BZNA 4JFTA 3ZOAA 2QDDA 5BMWA 3FKRA 3S5YA 5LNUA 3WD3A 2VRJA 1WXJA 3URBA 3LK6A 2VTFA 2FVLA 4H9TA 4D6IA 4UCGA 4PBGA 4CN6A 4DHGA 1XFBA 3MW7A 2HDJA 4N0RA 4CKQA 3F4WA 1QPKA 2WHJA 1UP2A 4NNBA 5DCEA 1EB3A 5GJNA 2WMJA 3AJXA 4I6KA 2J27A 2Y1HA 2W62A 2ZX6A 1C7TA 1LG2A 2DVXA 3ATZA 4DI9A 3TWAA 5HNUA 2H3BA 4FNSA 1W3JA 5C6MA 3FGCA 5B7YA 3VNLA 1QI2A 2ACQA 1F7BA 4J2PA 3ME3A 2XPKA 4KEMA 2QR6A 5DY3A 4PODA 3VMOA 3F4CA 1F3WA 3SCUA 3AS2A 2ZX5A 1XRFA 1EGVA 2YPIA 1SYTA 3ARQA 4JNZA 1K9TA 1CECA 5T91A 4DNHA 3M7SA 3IWPA 3PTDA 3WNPA 1TPC1 3L5LA 2BMBA 3RMJA 3VNKA 4RW3A 4Z17A 3R11A 2JIEA 3CYJA 3TZNA 7A3HA 2H90A 4X9SA 1IF2A 5HR7A 2ISVA 3TJIA 3UXKA 1FP9A 4CCCA 3O16A 4C5ZA 4LVBA 4RNHA 3NQ8A 2WZEA 3EBVA 3WF0A 2PDKA 1LT7A 1PJ9A 2E6YA 2GSJA 1A49A 1S5NA 3HA1A 1C8VA 5G2IA 1UR3M 1G6CA 1H1NA 4PL1A 4WJXA 1FWRA 1GYMA 1HVQA 3QHOA 1F73A 3N34A 4Z42C 1FFQA 2CWXA 3IJ9A 2PDHA 1JGMA 3EOLA 3SCOA 2IKIA 4R34A 1X6UA 4ERAA 5D4YA 3JZEA 1ZALA 4UR8A 3G18A 4C6QA 3R2GA 1VFOA 3HPZA 4O0KA 5LNRA 4JTDA 4GYFA 3QOMA 1M3UA 4PUJA 3DN5A 1HX0A 1IXOA 1NWTA 3WDQA 4PMZA 2YR1A 4NVTA 4DJDA 3NYZA 3VABA 1WV2A 3WBAA 2MNRA 5G4HC 2TPSA 1UKQA 4LVGA 1OFDA 1BVNP 1Q4WA 3MWCA 3MSYA 2X1RA 3U3HA 2Z4GA 3QTPA 2KZHA 1ZCCA 4S3EA 1GHSA 1VLIA 2A79A 2MUCA 2VC6A 4P2VA 3TTEA 1Z89A 4BR1A 1JCNA 1IXPA 1CGTA 4CCZA 1J2WA 4CEUC 3CM4A 1WZAA 1AD1A 3W86A 3SUVA 2E4TA 1A5OC 4WY0A 1ZRQA 2FIQA 3LN3A 3MSGA 3PJXA 5TD4A 1TPFA 3CGTA 2D24A 1OABA 4OT7A 1GJWA 1QI0A 4AF0B 1AUSL 5BCAA 5CLTA 2OLHA 3DI0A 4GCXA 1AL8A 1YHTA 2PE4A 2I9UA 2X2YA 2LLEA 3DUGA 1RK6A 5BOEA 2VWSA 2VT0A 1W8SA 4NXSA 1C29A 1XC6A 2OFJA 4ZR8A 4MZ8A 4LS0A 1OFQA 4F9DA 4BI7A 1W9DM 4AXKA 3BZGA 4HSHA 1MSSA 3SB0A 2WSQA 4ZZ9A 3GDBA 4FI4A 5BRBA 1GKRA 1OWQA 1WNOA 3NL3A 2BGSA 1H1YA 2YIHA 3QLLA 1L6GA 2O9RA 1BYBA 1FWSA 2E6AA 3CTTA 2YFOA 4JHOA 4R53A 1B30A 1EOMA 2W91A 1RJRA 4EAMA 2Y7DA 2AQVA 3EWWA 4HKPA 1OIMA 3LM7A 1Q7ZA 2RDXA 2QJMA 4N2YA 1Z3NA 1BHGA 2XIJA 1JDDA 2PBOA 3QH2A 4ORMA 1GK8A 1N8FA 3SJNA 1TPDA 3VTRA 3V5FA 4DX3A 3WLPA 4K7YA 4B9YA 4S3DA 5J5DA 4M19A 3IK2A 2EPKX 4XIAA 2PDPA 5GNZA 1KFWA 3L7RA 4C6MA 2OKOA 3EMCA 5HJYA 3BGJA 3EKLA 1Q2RA 4I5UA 3KOZA 2B7NA 4PTNA 3VIHA 4DF2A 1PZ1A 3SN0A 4OUEA 1I2OA 2OO6A 2DW7A 1OADA 1ESWA 3ARYA 4GXWA 4GYPA 3CIXA 3M07A 3H7RA 3JR2A 4KWOA 3GVQA 1WKDA 1ONWA 2PS2A 1D2KA 4PCNA 3VYLA 4RPQA 1HP4A 2AGTA 3HV8A 2V5LA 2J47A 3C8FA 3BE7A 1T96A 1WQ5A 4HHLA 1I2QA 1QJWA 2CLHA 4H04A 5HINA 4GHRA 2VZVA 1W0MA 5FJUA 4E38A 4EWJA 4AEEA 1UWUA 1C7SA 5DBTA 2XN2A 4Q4MA 2R6OA 1M7PA 2QF8A 3EB2A 3GW0A 2ASHA 3UA3A 4UTWA 3ZJKA 3QRHA 1T40A 2Y0FA 2ZADA 2W79A 1V0LA 7REQB 3H4XA 2ZC1A 2WWDA 3L21A 1UD8A 1TR9A 2E68A 2QUMA 3KHJA 4H7ZA 4NT0A 2HROA 1J6OA 2F38A 3TYCA 1UUOA 2CBVA 2VRKA 5T26A 1E9IA 2WC4A 2XH7A 4NAFA 3C86A 3RG6A 3QTGA 3VFLA 3ZXWA 4D6HA 4E8DA 3P81A 2NQZA 1GQNA 3GDLA 3B0YA 3UPBA 1A3WA 4NILA 1XUUA 3H2FA 4UOJA 4YJ5A 1SO4A 1H7XA 5HATA 1VIZA 1QXLA 4GVHA 2YOCA 3VMPA 4GO9A 2GJLA 3GB6A 3M64A 3NFUA 2ZFAA 4XSMA 4C1KA 1JJKA 1ZSXA 3HM7A 3ITYA 4TIMA 4MVAA 4EE9A 1FCQA 3ABSA 2ACSA 3B9NA 4O53A 1X39A 2W66A 2ATMA 3V5OA 3QR1A 3L4TA 2QDEA 4MY9A 1TR1A 3CAQA 1MW3A 3TQVA 2Z6JA 2OVLA 3CWHA 5CAHA 2G0WA 4C6BA 1E55A 2Y24A 4JPGA 4DWSC 4J27A 1OEPA 4YHEA 3BK0A 3U4FA 2PLCA 3FA4A 2PZNA 1V77A 4W8LA 4DO5A 4CVUA 4KT2A 4W7VA 3DGRA 4GUIA 3WJSA 1QFEA 5D2WA 2JKEA 5F1UA 5A95A 1HL9A 2WXDM 4IMCA 2J66A 5LHEA 4Q8PA 1QK2A 1VBJA 4ZXLA 4EP8C 3EOUA 1ITUA 1OHLA 4IT1A 2AMGA 2YW3A 2I5QA 4AWTA 2R94A 4G6CA 4F0SA 3GU1A 2VQTA 1J11A 1M03A 1EEPA 4H1ZA 1FWIC 1GPWA 4R7WA 2ZZ2A 3AS1A 1K8ZA 1TZ9A 1B54A 1W1ZA 2A3AA 1JPIA 5GVJA 4UB9A 1DHPA 3G1HA 1H7OA 1IWBA 2VFDA 4PUEA 5MHBA 3AI0A 1NDWA 3NR0A 2VZSA 5I3KA 1SO6A 1KO0A 4Q8QA 3MT1A 2VEMA 2PDBA 2HTMA 4XZWA 3BG3A 3WMLA 2X1SA 3LLXA 3AIWA 2WHLA 1MXDA 4IL0A 1KFEA 2XIMA 1X7IA 4I90A 4FNUA 3W00A 1HFBA 3MUXA 2QYGA 3MKVA 5BRPA 3W07A 3O9NA 1AFSA 2PDUA 2WSKA 4LANA 3H7VA 3WQGA 5JIWA 2PMQA 2G97A 3ABXA 1NP2A 3CQ0A 2G95A 4WDWA 4YTTA 3UP8A 3PANA 2VP8A 1H7RA 5F2GA 2J7GA 3GFZA 1VIWA 2A6LA 4AZ5A 1DTNA 4KW2A 3K5XA 5FL0A 3U8GA 4K39A 4B5UA 4WDTA 4MAZA 3THDA 4ZFCA 2OXNA 3CZGA 1AVAA 1F3EA 2X30A 1C9WA 4BI5A 4IISA 3N04A 4OJYA 3H54A 4BEUA 4LT9A 4JQ2A 4UTHA 1CW2A 3W6MA 3T81A 4V15A 3SQMA 1YNYA 3H24A 4EIVA 4JCMA 2WMGA 1BFNA 4W7UA 3ITGA 3VIFA 4HPNA 4HIBA 3BVJA 1JF5A 3HQNA 4BFAA 1XDLA 1DJWA 4IQLA 1SZGA 3SO7A 3B8TA 1YTEA 4AY7A 1JL8A 4GD0A 3WLIA 3BG5A 4UTTA 3N9KA 3BO9A 1MZHA 2D23A 1PXGA 4PYSA 2QMJA 4PMJA 5DFAA 3TWBA 4KERA 1F5ZA 4MLJA 3LENA 4E3TA 2XH0A 3GSMA 4ZO8A 1ZLPA 3L23A 5FA5A 1PL9A 3GAYA 4Q8WA 1US2A 1YPXA 4LPCA 2WCGA 1UMYA 4Q4KA 1NOUA 4CNPA 4KRTA 3TJ4A 1BXBA 1TZ7A 5LA2A 3MSDA 2GK1A 2QUVA 5DXXA 1UA7A 2JK2A 1MDRA 3EX2A 1OK6A 4R88A 3WLOA 5HQMA 1JGIA 2VR4A 3SZ8A 1BWVA 1CIUA 3OLEA 5IHRA 1TA3A 1QTWA 2O9TA 4GX8A 2JGQA 1ADSA 3PJTA 2GUBA 3DIPA 1E4NA 4NHVA 4A3YA 3MJMA 2PC4A 3W7NA 4P8VA 4LV9A 3GIYA 3FYOA 8RUCA 4UQEA 4JTCA 1DWFM 5DRIA 3M0IA 3UWVA 1Y5WA 4M5PA 4HMDA 5BW6A 3WFZA 4IFKA 2BLEA 3T2OA 2Q8LA 2ZXQA 5E0CA 2JKPA 1NWUA 2IXUA 4KQNA 1V8EA 4Q4QA 4CD5A 5H2ZA 5GPRA 1B57A 2C3ZA 3RRAA 4MADA 3SGZA 3MVTA 5CCZA 3NQAA 1FHVA 4S39A 4GNVA 2HE8A 3N2CA 3KOWA 3VILA 4Z0SA 2GQ8A 4E6MA 2PLJA 1GTEA 2VL4A 4DF1A 3WQ4A 1MVYA 3ARUA 1RP9A 5EFDA 3U57A 2RDWA 3QFWA 1MQPA 2GLKA 4H8HA 3V36A 3U0HA 8XIMA 3WNNA 5D30A 4XIMA 2IKJA 3QMSA 1YPIA 2J7EA 2PI6A 4MY1A 1KGXA 2HV5A 1UZDA 2CZ5A 3U4AA 5JH2A 5FIPA 3E38A 3T4CA 3RF9A 4UMCA 2QMKA 3CK5A 3E02A 5F7UA 2X1UA 1VCVA 2QNEA 1JZ2A 3H22A 2GL5A 3BOLA 3N4AA 2WZIA 3R7MA 1GOMA 2PEVA 1JG9A 3ZMRA 2QAPA 4KGJA 1F4AA 3FV9A 1MDLA 4MNMA 3W28A 1XYAA 4B92A 4BKNA 4ICCX 2E9LA 2D73A 4AH7A 2QF7A 4IH3A 3RNDA 4O50A 4ALDA 2YLAA 4Y8FA 1OCQA 3VGFA 3N73A 4IIDA 4B4FA 2CNCA 3BLEA 1K1DA 2BOFX 4AZGA 4LCQA 4GIRA 1Y7VA 2Z1XA 1BTMA 2X7WA 1EKOA 4KCWA 5MKGA 5D2YA 3MYPA 2HNEA 4JFVA 1O4UA 4JQAA 1FXQA 2TODA 3T0AA 4WXZA 4MDPA 1P1XA 3S47A 3RU8X 3WF3A 3CT7A 4QJ5B 1E73M 4GQ0A 4B3KA 3UJFA 1VR6A 4MWAB 1GKPA 2A21A 2CLKA 3WQPA 2B7QA 4GC3A 4DZAA 1UQYA 4LS1A 1E5NA 1RBAA 3S8HA 5I3HA 3LZ3A 4BJHA 1V6VA 4GNJA 9RUBA 3C3UA 2QGHA 2VENA 5GJMA 3I3BA 1FWWA 3ZZ1A 5EMYA 3VKDA 4GYKA 3QXBA 1F9CA 4D1IA 2TSYA 2VFFA 2X0YA 5FOOA 3W1AA 4JEJA 1W9VA 1ICPA 5A6AA 4PRRA 2FTYA 1OCNA 1GQKA 1P0BA 4WZHA 4BWLA 4DBDA 3SIZA 2G96A 3NGJA 3U2OA 3VAVA 4GI8A 4AG0A 2E5CA 3DG7A 2B4GA 4IWWA 1PKMA 5DLCA 3LI1A 4GPNA 3A64A 4A21A 2RGLA 2DZXA 4M8UA 4YTSA 4HTBA 1A4MA 1KQZA 3C0QA 3KLKA 3ZLGA 1I0DA 5D05A 3TCEA 1W1TA 2JFEX 1J0IA 2PCEA 4S38A 1X98A 1XBXA 2CLPA 3KBJA 5CH9A 5HQEA 4U33A 3EA1A 4B5XA 1AK5A 1L8PA 5IFTA 1EJ7L 4H7CA 4N02A 3PSVA 4MFEA 1BVWA 3NQEA 4L6HA 4G8TA 3TYUA 4EAYA 1PZ3A 2PB1A 3EWCA 4O1CA 2FHBA 3CV6A 5AC7A 3T4WA 2JQXA 3LB0A 3HOJA 2A85A 1BEUA 4C7FA 3ORWA 6XIAA 3F1QA 2V3FA 3SY8A 4PMOA 4Q6XA 1B9BA 2QPUA 3DI1A 4PULA 3G8RA 5C9ZA 4IICA 3DHFA 3NPVA 4PUNA 3UETA 2ZZ7A 3QLDA 4C91A 4CQBA 1BD0A 1IQ8A 3B0PA 4V1YA 2DT3A 4MPKA 4EX4A 1TTQA 1YMYA 2PP1A 3LSBA 2YCEA 4M3PA 1U5JA 4UQAA 3AHTA 4D8AA 3W7EA 4AYGA 1QBAA 2A0NA 3WO8A 1EZWA 2Z28A 3RGTA 3GVWA 1R9XA 3SI9A 3EOEA 5CSSA 1N55A 4O10A 3M5VA 2D20A 1TWZA 3O06A 3W7JA 5A1AA 4C60A 1S2CA 4HPGA 4A22A 1LBLA 1N8WA 4W88A 4Q6JA 1NF0A 4JTHA 1VYRA 4WK9A 1DXEA 4ZSTA 4DO4A 1XIDA 3MU7A 4DY1A 1OBAA 1NELA 5KZMA 3WDJA 4RW5A 1DPMA 1XG3A 1N2VA 3UWZA 3WMSA 4PMXA 3R0KA 1Y8BA 3UXAA 2V38A 4K7VA 2IXVA 3I3DA 1KW1A 2F84A 1KCZA 3IJ6A 5SWUA 2PDXA 3OVQA 4AVNA 1K8CA 3B9DA 1JCJA 1FHUA 2NZLA 1S3HA 3IGHX 4LH8A 1LF1A 5BZAA 1QI3A 2E77A 3VA8A 2EG8A 3OLIA 3W02A 4E8CA 1WE5A 4DBWA 5F4SA 3FHQA 5KZDA 2WVVB 1J0HA 3BW4A 4MDOA 3PNZA 3P93A 3LCLA 1R46A 2R91A 4JIPA 3SECA 1Z9AA 4D2JA 1BQCA 4R9OA 3EOOA 1OFBA 5A8GA 4L5ZA 3DKLA 4LWWA 3P74A 4AZHA 2VELA 1EYWA 2X05A 3UNDA 2Q8ZA 1DQXA 4IPNB 2YXGA 2J77A 1VQTA 3BLLA 3W1MA 3TNOA 4K8EA 4IUOA 2NQJA 4H6QA 4NAEA 1W9XA 3AROA 5C0QA 1KCLA 1QBBA 1V7AA 4S3JA 1TTPA 2D0GA 2PWHA 1RR2A 4ZQPA 3G3MA 1YX1A 2RGMA 3AMGA 2BGNE 3OZYA 1JUEA 5XIAA 4K36A 5G4WA 3SADA 1ICSA 4DXXA 1V3IA 4GWEA 4Y90A 1W1YA 3I7SA 3T8QA 4XD3A 3B0XA 2Y5SA 3MSRA 4H3DA 4YS1A 3IJQA 3W2JA 3KLLA 3A9BA 1XBVA 5IDIA 3ELFA 3THAA 2O92A 4MLRA 1CXHA 4UCFA 2X0SA 3EWDA 1MW0A 1IEXA 1X1NA 3ZT7A 1UPMB 2OT0A 2Y62A 5EMUA 2Y5JA 1QNVA 3A13A 3BV7A 2Y89A 1P4CA 3K4WA 4XAGA 4U31A 3ERPA 1LOLA 3QSRA 3QV8A 4UQDA 5EMLA 1RA0A 4IPLA 3S2MA 3MV01 1OGGA 3WG6A 2P8CA 1HT6A 3NQCA 1FH9A 1WUFA 2VOMA 2WBGA 1V6XA 3PHAA 5D37A 1D8WA 1TMHA 4PUMA 1ZBKA 4RX0A 4OKDA 3T1GA 2WZTA 1VB9A 1ADDA 4F40A 1EA0A 1W32A 3WLRA 3RAOA 4B5SA 4FXSA 3CL8A 4HK5A 3VD7A 3WQ5A 3HFTA 4IMEA 2D3LA 1XLIA 5A6TC 1XRTA 5FJJA 4LVAA 3WBXA 3ZS4A 1A3HA 5D8ZA 2WKJA 2XIQA 4HHMA 3E96A 1KFCA 4ZQCA 3KTCA 4F66A 4MY8A 4OWGA 3EYPA 3C2VA 5CPLA 1W3LA 4ZTXA 1J96A 4I9TA 3W9ZA 4QSHA 4KRUA 1PCKA 1XYCA 1WZMA 1H63A 2HRWA 4BF5A 1CEOA 3RPTA 1E0VA 5DO8A 3WMCA 4BA0A 1YDOA 1OB0A 3NXFA 1QRQA 4HN8A 4ZODA 5G5IA 3K4DA 1W8GA 1GTHA 1KR1A 4A3UA 3G24A 3NZGA 1R3TA 5JU6A 5B7ZA 3W1NA 1CGWA 4ZENA 2WPGA 2CZDA 3W37A 4PMDA 4NJIA 3RM9A 2FVKA 1KB3A 4K37A 3FGCB 2VCBA 1GOWA 2AGKA 2EPNA 4JBRA 5DCDA 4O1EA 5I0DA 4ZQOA 2GOUA 1U22A 2Z24A 2G3NA 4GBUA 2BVTA 4PFHA 2JF7A 3QW4B 4FX8A 1Y65A 3W22A 3QQWA 3TYZA 1DWHM 3NNTA 3PTKA 4Z1YA 1DJYA 1OT1A 5C7HA 1VBGA 2F61A 2Y2WA 5E6ZA 2X7VA 3GC2A 3LRLA 3CZJA 4JFWA 3PULA 3CU2A 2YB1A 3S4TA 4W85A 1UR9A 3GIQA 3GY1A 1UASA 2WMHA 1EJUC 4BEQA 4MPQA 1YNPA 3BJFA 5CC7A 3N19B 1WXZA 1S2VA 2OOGA 2WCSA 3LCIA 4LYRA 3IANA 3ZR5A 4Q3MA 2PDFA 2NUXA 5L6UA 1SMAA 3DG6A 3C52A 3XISA 4NASA 4M7TA 1BRLA 2GZXA 4HOXA 3E1F1 2WANA 1RQHA 4DZIA 1WYIA 3KRUA 3WKZA 1CGXA 5F2MA 4L64A 5LNVA 4Z2JA 1XICA 3L65A 2X41A 1Q85A 3B9OA 5K4ZA 3USZA 1BTCA 5A6KA 1OJXA 3MANA 3MP4A 1KRMA 4LUTB 3MMTA 2RDTA 3BSGA 3NL6A 3RITA 3QMTA 3M5ZA 3H6OA 3TEVA 1CZ1A 3WLTA 5D03A 3W27A 4J9JA 4ZTYA 4P8UA 1BF2A 4GLEA 1O12A 2DSZA 3S46A 4RZ4A 5I78A 4BZYA 3CUIA 1LYXA 4TVCA 2ZBTA 3OYXA 4DM2A 1TWDA 1X96A 4ERIA 4WY0B 4DJDD 2VWTA 7CGTA 1GVEA 4HP5A 2I5GA 5A2BA 1GJPA 2I56A 4UTFA 5EBUA 4LEFA 4W5UA 1LBMA 6TAAA 2ZZ5A 4HNVA 4KEVA 3TC3A 2PDLA 2Z00A 1QUMA 5BWFA 2PWUA 5A8PA 1R3SA 2A3EA 2RDUA 2GDVA 3RCNA 4XUYA 1X1OA 4F48A 3WJZA 3UU0A 3LERA 4LCRA 1T8QA 5E1QA 4TVUA 4W9TA 3PPFA 4YMZA 2EAWA 2CXGA 3EDEA 2DZAA 3THQA 2XIIA 2E9MA 3WLSA 1GVQA 3DH7A 1DJIA 5JBEA 3TSDA 1UG6A 4JL2A 1NY1A 3M6DA 3AHVA 2HK0A 1ZZMA 1IT8A 4XKMA 5DQPA 4D6GA 1XCFA 3KM8A 2OEJA 1RVKA 3W2UA 3IGXA 3G0UA 5I06A 3LLDA 3SUWA 2GSEA 3IIOA 1E15A 3TSMA 1XHGA 5IFPA 3VDHA 1W5QA 2HSAA 3HU7A 1UWSA 1QK0A 1RPKA 4DJFA 1B3ZA 3LTSA 4HNUA 1DJQA 4DJEA 5BU9A 1BAGA 1E0WA 2QVHA 1Q6LA 3DYMA 3SCSA 6PTDA 3HMCA 2ZA2A 1X6NA 3KTSA 1PVNA 5I09A 1KWGA 5M2FX 4ECLA 3B0UX 4NP7A 2C8NA 3PTMA 2CETA 3FXYA 3SCNA 3VKBA 3AHZA 4MB4A 1GZGA 4KMQA 2RJGA 3DC0A 1PKNA 4ML4A 1MUWA 3QPEA 1XX1A 3ARPA 4O8AA 2J8FA 3TV8A 2NVAA 1MEIA 1QAPA 2GOKA 4AIUA 1Q6QA 1DOSA 2V68A 3OVRA 4C6PA 3RX2A 3KOXA 3H2AA 2AQWA 2D3NA 1XIEA 4CEXC 3NQGA 3ES7A 4TX9A 4GQQA 3HZ3A 1YQ2A 4PTWA 3UF9A 4E4UA 1E6RA 2DUZA 3OZPA 2WMIA 4GKTA 3DFTA 4HGXA 3PUDA 1ZBVA 3FA5A 1P43A 3UPWA 3LHVA 2ABBA 2DSUA 4JEQA 4NYYA 3A4WA 1FWGC 1FCBA 3N17A 2JEPA 1VRXA 1F3TA 3TC6A 3GH5A 1DE5A 1W3TA 3QPZA 4YPJA 3HV9A 1UWQA 1DWJM 5AHMA 2PDYA 4AF0A 1UUMA 4JNYA 5CZSA 1A0DA 3E74A 2GPTA 4NAFB 1Q65A 5XINA 1G4SA 1TPB1 1C92A 4H9XA 2Z1BA 4RDYA 5CPSA 4JIEA 3GU9A 1CXFA 3AIRA 2DZUA 3S2JA 1HN1A 2ZZ1A 3U9IA 2DY3A 3RU6A 2PDNA 3W26A 1YEYA 1UH4A 4MJZA 1ZBCA 2Y7EA 4CNOA 1BG4A 4IXXA 3VE7A 3GHUA 4IHCA 4QP0A 3GHRA 4O0ZA 1JI2A 2KX9A 4RZBA 5HULA 4R33A 4UFHA 3PS7A 2Z7KA 2ZUWA 3CHEA 3UQNA 4RUBA 2EF9A 2ZVIA 4HMEA 1KA9F 3I7RA 3QGAC 4R85A 1JRBA 5FF2A 1JUKA 4LBUA 1J0JA 4M6PA 3EB4A 3M0YA 1FWTA 1OCJA 5CZTA 4LV4A 3GNDA 1Q8AA 4FIQA 4GUFA 4Y9NA 1SFSA 4HU4A 4DM1A 2BS9A 3AMDA 1L6WA 1XCXA 3KZSA 3P7YA 1HG3A 1OX5A 1E43A 4JDYA 2Y8VA 3HPSA 3LPFA 1V3KA 2PF0A 1JULA 3ITXA 1WDQA 4FX7A 4EANA 4CVWA 3VE9A 3OBAA 4IPJA 4FAMA 1XUZA 4UNIA 1MRQA 4P7NA 1GG1A 3N29A 4Y7EA 4AEFA 2OO0A 4XAZA 4QSFA 1IGWA 5AN7A 4PB5A 2Y5EA 1U2YA 2OPJA 3A3XA 1UMLA 5BOFA 5EB8A 1JRCA 1W5OA 2D22A 4FR6A 4LUSB 3BQ6A 3CUFA 3WUFA 3N13A 3PVFA 3QM3A 4ZQNA 3WQFA 1V3JA 3EDFA 3PFMA 5G4EA 4ZQMA 4GY7A 5EBAA 3LU2A 4E0CA 1JIBA 4OVXA 8A3HA 3GDTA 2YZ5A 1EX1A 2JE8A 1KBKA 5DMMA 1C9DA 2W92A 1DJNA 1HXJA 1V03A 4WEVX 3IVTA 4GQRA 3A3WA 2GVGA 4Q7NA 3P8IA 1YXDA 1QATA 4RV3A 1WDPA 1PCWA 3TJXA 5FAJA 2A7NA 1GVFA 3AU6A 1SR9A 4D6CA 4JY9A 3AWNA 3LCGA 3C2OA 2FZ9A 3U5UA 4ZMGA 1UR8A 1PZ0A 3L68A 5LSMA 2HJPA 2ZX9A 3UZYA 2QKFA 1XD1A 5G1MA 4IOTA 1DXFA 1ECEA 5EPDA 4HCHA 1G1YA 1W6TA 2QCLA 3QBUA 4WXYA 4E3VA 3LNPA 1WAWA 4E2DA 4HPHA 1O1ZA 1VFTA 2ISWA 3A3HA 4ZGYA 3S2CA 2VR5A 4BHYA 1GJUA 3UZJA 4Z2HA 4M6QA 4J3XA 1DJZA 3CT2A 2B81A 4O4VA 4FP1A 5I3GA 4JFUA 1JDCA 3R0DA 5HMDA 3VIPA 1G7UA 3PG8A 4FOUA 2XVNA 4IJRA 3H55A 3S5SA 4F79A 3BAIA 3WD1A 3PWIA 4WR3A 5DMNA 3A4JA 4C6EA 4N6EA 2ESCA 2Z2BA 5LIUX 5IXEA 4QDWA 4MG4A 4YL2A 4CD4A 2YW4A 3WFLA 3JRKA 4S3BA 2Y88A 3MHGA 2EPOA 2HBXA 5F2IA 2GQ3A 3NAVA 5AYBA 3JS3A 4IGSA 3G3DA 1FA2A 3W73A 1A5KC 4TV6A 3SCPA 2OX1A 3W7PA 2VM8A 2WKGA 4PMQA 1Q8JA 3DENA 5HNNA 2GQ9A 2O9PA 2CFFA 1XYMA 4DYKA 3GDRA 4HBKA 1C93A 3TJLA 1VF8A 2PCQA 5KZEA 4UQBA 5F4WA 3TLLA 5AB3A 1JZ7A 5AYIA 4B5VA 1ZU8A 3LXAA 3M46A 3UG8A 1ITCA 4QJ3B 3WLKX 4IF2A 3R8HA 1LOQA 3PAOA 5HXMA 1TA3B 4Q8UA 3GBDA 1UWRA 4YVXA 4GJJA 5HJXA 4Z08A 5IRPA 4LVFA 4GFSA 1NP0A 1OZMA 2PZ0A 3W23A 1QPOA 4NG3A 1WX0A 4WQ6A 2D2JA 3LBMA 3AIQA 3PJUA 3WN6A 4JCLA 1YADA 1F2JA 3G0XA 4C7GA 3KFTA 1Q6OA 4HNCA 3BAWA 3FK4A 1QU4A 3WNLA 3AYRA 3LMYA 2W3ZA 4XX6A 3AXXA 3BAJA 1H3GA 3NM1A 4IFKB 1W1PA 1C90A 4ZB2A 5EMMA 1J5SA 3W4RA 2VZTA 2NQ9A 3KDOA 4ZE5A 2XFYA 4YCPA 1V4YA 4H9UA 5I00A 3M0ZA 4MGGA 2IPFA 3F5KA 3K30A 3TAOA 1QWGA 3UXLA 1D9EA 1O1HA 4NQ1A 3VPLA 3HN3A 3FKKA 1YDYA 4LBRA 2YBVA 3TK7A 3FW6A 1YDVA 2Y6ZA 3VC5A 1XIMA 3C2FA 4FX6M 1W31A 4GH1A 2HVOA 1Z6KA 1HJSA 2YA2A 4NY2A 4QDMA 3UXDA 1E0TA 1HO1A 5PTDA 2VZUA 2NQLA 2VUYA 3RX3A 2OQYA 4ZOAA 4R27A 4KS0A 2QZRA 3PBWA 2X1IA 4DUVA 1THFD 1Y5VA 3ZJ8A 4O11A 3BCDA 1FHLA 4RXGA 1UR0A 1EP2A 3M4HA 1P6CA 2CLEA 1UWTA 4O28A 1A53A 4HNTA 3BXWA 4CQDA 1G4TA 4NZ5A 1TVNA 1XLJA 2GUYA 2WMFA 4CCEA 4CN1A 1NFGA 2PRLA 2F6KA 4LRSA 1BSLA 3PG9A 4OFCA 1RXOB 1HJUA 1IEVA 4DYEA 3GR7A 4HU0A 3W25A 4EXQA 2EBNA 3MO4A 1F6PA 3F7JA 3T0DA 3UWYA 1JAKA 1UH2A 5MKGB 4YTQA 1P6BA 2VFIA 1KTCA 2Z26A 2ZA3A 4OV4A 4ICNA 4ZCWA 4JN8A 2QEZA 2QV4A 2DH3A 4L1WA 1W56A 3AIVA 3S1UA 1JUBA 4UNKA 1K7XA 4JTKA 3H4WA 3TTOA 4XD4A 1ZJAA 1M68A 4LC6A 2GWNA 3VCNA 1VC4A 2YKKA 3VIKA 4D6JA 4Z2IA 4K1GA 4D72A 1VYSX 4GZEA 1A5SA 3QYSA 4YHGA 4F8XA 4REQB 3GG1A 4PFMA 3B9EA 1CBGA 1TO3A 4G9PA 3S3GA 4P5UA 4NZJA 4E2VA 1MO0A 2WNNA 3RLGA 3R6IA 4PUUA 3W29A 3B8VA 2WSYA 2VD8A 1Z32X 2AL1A 1BYCA 2Q3OA 3PB2A 4CQ8A 1OF6A 3VGDA 3HB9A 1W9UA 2FQIA 1HKIA 2EPMX 1CGYA 1NDYA 1S3TC 4CNNA 2J79A 3TLQA 2A7RA 1TJRA 5FJPA 2HE5A 1MZRA 2D2HA 2HPIA 3N15A 2Z27A 4MM1A 2GUUA 2OTDA 3ZVIA 4TVDA 1EL3A 3ANYA 5LXXA 4IGNA 2ISDA 3EEZA 5FL1A 3W7KA 4UZSA 1VEMA 4OV9A 1SSGA 2EO7A 4AD2A 1ZP3A 2NT1A 1HL8A 2YLLA 3W71A 1ISWA 4DNMA 4XVEA 3WNOA 1ZS2A 2NT0A 4IMAA 2W61A 2PPGA 3UYCA 1JQVA 1DP0A 3N2XA 3ZWSA 3UR8A 4Q32A 4AWUA 5CPNA 3V3WA 3B97A 2DIKA 3VIGA 5REQA 4HA1A 3B8UA 4V2XA 3OYZA 1YXYA 2OLSA 2XFWA 3CQKA 4EPKA 1W9BM 5C9UA 3QHNA 3CPRA 4EF8A 5G2WA 2WNQA 5E93A 3FAXA 5FSEC 4FPSA 4W84A 3R0UA 4S23A 4XB3A 2WPBA 4KFOA 3C4UA 4HNOA 4LFYA 4QQUA 3QPYA 1F61A 4HT3A 5AYZA 1H5VA 4P8XA 3WD4A 3CLMA 4IMGA 9CGTA 3STGA 2PGEA 3APGA 2Z2AA 2XFRA 1GEQA 1UW9A 3CYVA 3KOFA 3EPOA 3PZMA 4YVPA 4HVXA 3MI2A 3V35A 2QCFA 3DHUA 2E9BA 2WJFA 3KWSA 1GORA 1VBHA 3IJ8A 3ITTA 4JTEA 1CLVA 4TO8A 3ATYA 3TYAA 3TKFA 3H21A 2XYLA 3VD3A 4L65A 3GG8A 4QE1A 4AEOA 1JDEA 2EPHA 1PIFA 4C6IA 4GINA 4PB3A 5HWJA 3PTQA 3LHTA 3LPGA 1UOKA 2GQAA 5HNTA 1K77A 4C90A 1NOWA 4TMBA 4B16A 4ES4A 1XL9A 1KM2A 1JFXA 4CD6A 1FH7A 4JTIA 4JICA 4C6KA 1UKTA 1HGYA 1PYMA 3CZEA 3SSJA 2V2DA 3UJEA 1NH6A 1Q6DA 3CIVA 2ANUA 1E6NA 3O2LA 4JTUA 1CX9A 3CQJA 3VZZA 1R47A 2BB0A 3E0IA 3GXDA 5C2XA 1XSKA 1JD7A 1HNYA 1EP3A 4YXGA 3MDUA 1H11A 3KZPA 1ZENA 3G22A 2E7FA 3P14A 3L66A 3KDNA 1TVLA 3OG2A 2QHAA 5TF0A 4MYXA 4TV5A 1CLKA 1JYNA 2CESA 4ROPA 3EDKA 2VHLA 3BICA 1JCLA 4NI8A 3VKAA 2VJXA 1EO7A 1KTBA 2NUWA 1MFVA 4JXCA 3RPMA 3LHYA 4INFA 3PZIA 2VYOA 1R5YA 2AQOA 4H6EA 3IRSA 1XBZA 4J3UA 2VEPA 4Y9AA 1ICQA 1E9LA 1RLDA 1HKVA 1O6IA 3KE0A 4NAEB 2FJKA 1FQ0A 3ZT5A 1K6WA 3TQKA 4RV8A 2P0OA 1SJDA 1XH0A 4JQ1A 5I24A 1XLHA 1U1JA 3DFYA 2EXOA 4JR5A 4R9XA 4DZHA 5JUVA 3RJYA 1ZCOA 3M6YA 4L1GA 4U10A 5EL1A 2V3GA 4PTMA 5AOUA 3VIOA 4P7RA 4L61A 1K02A 1TV5A 5HWMA 3ABOA 4IGHA 3N18A 4NSBA 3TMQA 3VKCA 4KFNA 1TMLA 5FACA 1QHOA 1ITXA 1L2QA 1P0KA 2ZXDA 1OFEA 4J1OA 5FF0A 1NARA 3KBMA 3I10A 3W72A 1B1YA 5AZ0A 3MQTA 2WW5A 3FLUA 1MNSA 4EOUA 2XFFA 3BZJA 3DZ1A 3S5OA 3HF3A 1SO3A 5I7GA 1DIKA 3THCA 1HJWA 2WYSA 1ZTVA 4Q7BA 2EHHA 4ZXOA 3NSMA 4UTIA 2J7DA 3V0TA 5K4XA 1M7JA 3NO1A 3LZ5A 1L6FA 1OFAA 4HSOA 2XHYA 3OG3A 4I9AA 2VNCA 4GZJA 3VGGA 3IUHA 1J6PA 3OQ8A 5FJRA 2FPVA 1EC9A 3ZSSA 1F74A 1PPIA 4MWAC 4V33A 5D9MA 1ISYA 2JGYA 1U33A 3VOIA 2EQDA 4MOZA 1UC5A 2VVSA 1QOQA 1O94A 2ZUNA 5AHLA 1U1HA 3DECA 4CCDA 3HBLA 3OA5A 4KBXA 2PGFA 4NL1A 1I1XA 2Y63A 4JYFA 1QT1A 4LSBA 4PCPA 3OTRA 3P3BA 3W53A 3LS9A 1PX8A 1JXKA 1XRSA 1R9ZA 3GXPA 3AHXA 4GH3A 1JF6A 3BLFA 5HQLA 3DC8A 4FLQA 2J7FA 2XVKA 5LNWA 5CPOA 5DN1A 2WJDA 3ZQ9A 1B0IA 3EMZA 2F6XA 1ISVA 1ISZA 3PF3A 1UJQA 4W87A 2YCKX 3JUGA 3W7QA 1N7KA 3L4XA 1IGSA 1W5NA 1S1RA 4L4OA 3M5YA 2QJHA 3RCMA 2OQHA 2Z7GA 2ZDSA 3L2LA 1AH3A 3AIUA 5A6BA 4W4QA 4L56A 1J0ZA 1LL6A 3CEUA 3A21A 3NCOA 2PLMA 2HVMA 3VINA 1R2SA 2YDAA 1HUVA 3HMJG 3T8LA 3LNMA 6REQA 4H8UA 3AUOA 3TONA 3WQEA 2PRMA 4DEFA 1EBGA 1EC8A 2F9RA 5CGQA 1V02E 2ZVRA 1EDQA 2EGZA 1EXPA 2DZWA 3VZXA 3FEQA 3PR2A 2PURA 3KVLA 3ANUA 1OX4A 2QQ6A 2R82A 2E8YA 5C55A 3MS8A 4AVFA 3R5EA 3WQOA 4GACA