4PMDA

Crystal structure of cbxyn10b from caldicellulosiruptor bescii and its mutant(e139a) in complex with hydrolyzed xylotetraose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
329
structure length
329
Chain Sequence
TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
total genus 127
structure length 329
sequence length 329
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmdA00
1OIFA 4S3KA 1TA3A 2YDQA 3PZVA 1B3YA 5A6BA 3SCOA 1ZL1A 2PBGA 3CHCA 2WB5A 1JZ8A 2W91A 1NWUA 3BMVA 1DTUA 1JAEA 4U31A 1D7FA 2EO7A 4J28A 4OUEA 3CZKA 3WNKA 4CCDA 4XZWA 5FKYA 1H4PA 1Q6GA 4H04A 1KBBA 1OINA 2WHJA 2OYKA 5E09A 3B9AA 2OWCA 1HNYA 3UESA 1UD4A 4M24A 3AICA 2ZUTA 4AEEA 1JZ2A 1OGGA 4W5ZA 1GONA 1UWQA 4MNLA 3ECQA 2DSZA 3VVGA 4AZHA 2J7CA 4PMXA 5A8OA 1E6PA 1BLIA 1MFVA 4GIAA 4FK9A 4PUEA 2XM1A 2DSUA 1HJQA 5A1AA 1LG1A 2DT3A 1V6YA 1H5VA 1BVNP 3O9NA 1K9EA 1PX3A 4IUGA 4UFIA 2ZIDA 3WMSA 3VNZA 3WH7A 3F4VA 3ZJKA 1XCXA 2VQUA 4JIEA 4DWSD 4CUCA 1O6IA 3AMGA 1E40A 2DH2A 2BVTA 3GNOA 4D6HA 3NDYA 4JAWA 2VZSA 2EPLX 4CKQA 1BGGA 3I3BA 3BCDA 4V27A 5CSUA 3W24A 1HVXA 3B9DA 4MPKA 3N1AA 1CLXA 3GM8A 4UFHA 3AYRA 4AXNA 2A3AA 3T2PA 1H0GA 1E71M 1R85A 1CXLA 1V6XA 3CZLA 3UG5A 2OWXA 4UFJA 1JI2A 3SUTA 4BQ4A 3ZJ6A 8CGTA 3VIFA 4RE3A 5JBDA 4OOZA 3DYOA 2BS9A 1E6SM 3EDFA 1QHOA 1TCMA 3MSGA 1JYNA 2XIBA 1VEMA 3WD0A 3EMZA 4WSJA 5D4YA 5I23A 1WB0A 4IM4A 2YL9A 2AMGA 2Y8VA 1ODUA 3KL0A 1UR0A 3AMLA 1UHVA 3ARUA 3CZ8A 5A6JA 3VGFA 1E6QM 1WDSA 1VJZA 4D6FA 1W32A 1OGSA 3MUY1 3M7SA 1CZ1A 1GJWA 1HJXA 2V3DA 2V5CA 2WVVB 1FA2A 4BCEA 2BY1A 5HOSA 1PZ3A 3ZMRA 2WMIB 4U5KA 1WZKA 3BAYA 1V0LA 1J0IA 4PMUA 2W66A 4UOQA 2XGIA 1PEZA 3RM8A 4U3CA 3AISA 2VZTA 3NSNA 4KRUA 1K9FA 3WF1A 2ZUWA 3KEHA 3MS8A 2G4FA 1US3A 2FHCA 5BCAA 3ARYA 2VURA 5DF0A 3FHQA 4JCLA 3L4VA 1C8YA 4HU8A 1TA3B 1HVQA 2G41A 4AC1X 1TE1A 3LMYA 3WNOA 1UUQA 3AS1A 3GYCA 1BTCA 4E4PA 1W9DM 1SMDA 3CPUA 3WD4A 3OIHA 3VMPA 1H1NA 1V3MA 2ZUUA 1Y7VA 1HKMA 4TTGA 3K46A 2WLZA 1XD0A 1HF6A 3PHAA 1ISZA 5BYWA 1BFNA 3OBAA 2GJXA 5E70A 4A3YA 1ODZA 4MNMA 5GNYA 3PTMA 3T0DA 2WSKA 3AIEA 3LPOA 4PMZA 2VX4A 5FOOA 4B9YA 3WDIA 1HKJA 2WC7A 1JYWA 5FL0A 1QNRA 2XIIA 5D9PA 1BYAA 1US2A 3SCNA 3WH9A 3T08A 4IPLA 2ZICA 4M82A 3AIBA 2XHYA 1IZJA 4C7FA 4HPGA 5CPQA 2WMKA 1BPLB 4Z2HA 1LJYA 1ZJBA 1MW3A 1I1XA 2BY2A 1VENA 2J8FA 3WH5A 1W3JA 2VX7A 1NP0A 2QF8A 2YA1A 3IJ7A 3I3EA 1JFHA 3SUSA 4B3LA 2FHBA 3PZNA 5AYBA 4LXFA 3GDBA 3FN9A 2ZX7A 1B31A 1V0KA 1HKIA 3SCWA 3AHXA 1WCGA 2GDUA 2BVDA 1UKTA 2RGLA 2DPEA 4UOZA 2J75A 4P8XA 1HP5A 2FH8A 1JI1A 1LWHA 3MO4A 1W1VA 2D24A 1UR2A 1ESWA 1UKPA 1ZS2A 4D6IA 2D20A 2J77A 2QMJA 2E9BA 2YL5A 3BGAA 4D6GA 3EYPA 5CGTA 3OG2A 1KXQA 1V3LA 1PBGA 2ZXDA 3WMBA 4F9DA 3N11A 3GZAA 1GORA 3WF4A 4HPHA 1XSJA 4MB5A 3QGVA 2CBUA 3OGSA 4GI8A 2YLLA 1UH4A 1CECA 4YN5A 3VIPA 3WY1A 4OBSA 3WD1A 4BZYA 3VU2A 2VX5A 4UFKA 5ABFA 4RL3A 4W88A 4WK9A 1V3HA 1JXKA 5EMYA 2Y8KA 4TVCA 4AW7A 2UY3A 2JEQA 1NOWA 3APGA 3SEPA 2EXOA 2VCCA 4IISA 2VQTA 1B1YA 4QLLA 2NT0A 4DM1A 3EDKA 2J7HA 2WVTA 1GNXA 1HJSA 4AZ6A 2O9OA 3AS0A 2J7EA 2BV9A 4M1RA 4OBRA 5D9MA 3G6LA 1BG4A 4J27A 2WNWA 3NCOA 5IXEA 1X6NA 3UETA 1UD8A 2ZUSA 3OGRA 3AYSA 3SCSA 4D6CA 3OGVA 4CU8A 3WQVA 3PZ9A 1E3ZA 4TX8A 3ZT6A 4S3JA 3VGDA 3WSUA 1WZLA 1E43A 2PWGA 4J3SA 1ZJAA 2X8RA 3DC0A 4QAWA 5DEZA 2GJXB 1WNOA 3CMJA 1GOOA 5JBEA 1N82A 4P7OA 1QNOA 3WL1A 3ARQA 2DIJA 2J8GA 1RP9A 1E55A 1UG6A 3WF2A 3VMNA 3PZUA 4MDOA 3VGEA 3WDHA 2VMFA 3A6OA 1UH2A 3GH4A 4PCSA 1M04A 1ITXA 2BVYA 1B3ZA 1HX0A 1GHRA 1MVYA 2DT0A 4MAZA 2VRQA 3ARZA 2C0HA 2VC9A 4H8UA 4KWUA 3RM9A 5BXSA 2VT0A 5E0FA 1PX8A 1WE5A 3EDDA 3PZOA 1ISWA 3CUFA 4DUXA 4F8XA 2BY3A 4UOJA 5CJ5A 2YDSA 2VRKA 2XSBA 2CBJA 3B9EA 4W7VA 2W4XA 3W28A 4JHOA 3RCNA 1G01A 4UQEA 4M80A 1XCWA 3QHOA 2PB1A 1CXFA 1EOMA 1VFFA 1KXTA 1VAHA 4TOQA 3RO8A 2Y24A 2IXVA 2XFRA 4F9JA 1I75A 3GBDA 2BHZA 4HZ8A 1KFWA 4FLSA 4PBGA 2WXDM 1DWHM 2YA2A 3S6TA 3GH5A 1UD2A 4TVUA 1EQCA 3MKKA 3VPLA 3K8MA 3WBAA 1LF1A 1UZ1A 2XFYA 1D2KA 2PI6A 1KGWA 2D3LA 2BXYA 2VRJA 4NRRA 2E8YA 4CD7A 4ML4A 1QHPA 4AIUA 4B3KA 1V02A 4J7RA 1E6RA 2J7DA 1OM0A 3BAIA 2WHKA 2WMHA 4FLQA 1UWUA 3DYMA 1WAWA 1JZ3A 1TVNA 4BQ3A 1BQCA 1J0ZA 2EBNA 3W6MA 1QPKA 1MFUA 3CH9A 4RE4A 1TFVA 1SMAA 1GCYA 3II1A 1HP4A 1NOFA 1Q6CA 2Y5EA 3MUZ1 3W29A 5ABFB 3WF0A 2QPUA 2UWFA 1BVZA 4CVWA 5A94A 5DFAA 3PZTA 1EO5A 1XRVA 1VBRA 2V3EA 4JFWA 3UERA 5CPTA 3HMCA 1FFQA 4HA4A 1KWKA 3RM4A 2B31A 3T0BA 4AWEA 4K68A 1Q6EA 3QR3A 2DGAA 4HZ7A 2WMJA 2D0GA 2HVMA 1JD7A 5IDIA 1TG7A 2PWEA 4V2XA 1Q6FA 3N12A 5C8BB 1XHGA 5D8WA 4AZCA 3AHVA 3WUGA 4MB4A 1MW1A 2VTFA 1C7TA 1ZBWA 3D3AA 4P8WA 2QLYA 1BGAA 3U5YA 3K4DA 2VZOA 2F2HA 2W63A 1BHGA 3WDRA 3CZEA 5BXPA 4Z2LA 3DECA 1NWSA 4AD3A 5I77A 1PX4A 1QVBA 2VZUA 1NH6A 1UA7A 3THDA 4MJ4A 4UFLA 1E4NA 5GPRA 1NQ6A 3CBWA 2BHUA 6TAAA 4NZCA 1J9YA 2DT2A 1MXGA 3UEQA 5IHRA 1UQYA 1VRXA 4ZENA 4HMEA 2C8NA 4CCEA 1CGVA 1C7SA 3WDPP 1G5AA 3U5UA 3J7HA 4WLCA 2XJ7A 1JFXA 4AISA 4FLRA 1XYZA 3L4ZA 4XV0A 1IZKA 1OCQA 2RGMA 1EIBA 3GBEA 1V02E 4ATWA 4M56A 2CNCA 2F8QA 4FMVA 4XZBA 3AS3A 3POCA 5C71A 3WQ5A 4D6EA 1Q6DA 3F5JA 4MJ2A 1VBUA 3ARWA 5I3DA 2GK1A 1E6NA 1VEPA 2WLYA 2GDVA 3BSHA 1B3WA 3B8SA 3VMOA 1CEOA 2YIHA 1C8QA 4KGJA 3N13A 2EPKX 4PTMA 2X05A 4WKFA 5A6KA 4D6JA 2ZUMA 2J7BA 3CUJA 4C7GA 4PEEA 3CHDA 4AD2A 1W3LA 3ZQ9A 3ZSTA 3NSXA 3IANA 3CGTA 1H11A 4MB1A 1MQQA 1QW8A 4W89A 5HDRA 2WC4A 2JALA 1GPFA 4V28A 3ARVA 2XVGA 4W85A 4YHGA 2BHYA 1GVYA 1HJUA 4F79A 3W27A 3I3DA 1V3JA 1JDAA 1H41A 4H2CA 4W8AA 4HOXA 5GQBA 1YQ2A 4PMNA 3VIGA 4M81A 3AMDA 4MNJA 4DUVA 1QOXA 4MTVA 2V38A 5BRPA 3VOCA 3FW6A 4M8UA 5HXMA 1HKKA 4XB3A 2JE8A 4OJYA 1DHKA 3BAJA 1EDGA 1AQHA 2O92A 1CYGA 1JDCA 4N0RA 5I5RA 3N9KA 3VIJA 2WYSA 3ZM8A 5AC4A 1MW2A 3M07A 1QI0A 5M3WA 1JD9A 4QCEA 4GINA 1UA3A 2PWFA 1KB3A 1GW1A 2OYMA 3AHZA 4LYQA 1CPUA 2PC8A 3WIJA 3GXMA 4AZGA 2D1ZA 3DHUA 1F4AA 2OSXA 4AZBA 3VD5A 4CCCA 1M7XA 2YOCA 4GXPA 3AIQA 3VILA 4W87A 1EGZA 1GJUA 2GFTA 4X0VA 1OB0A 1C93A 4AZCB 1JF6A 4UZUA 2O9TA 2CHNA 2YDRA 1OIMA 3UG3A 1X1NA 2J78A 3TONA 3VDAA 3WBEA 1X6LA 1CDGA 3W6LA 2A3CA 4PYSA 1LL7A 1W1YA 2XWEA 1GQLA 4X9YA 4JFTA 1UR4A 4CN4A 2NW0A 3ZOAA 3POHA 4FF5A 4Q22A 4TVDA 1OBAA 3RMEA 3PTKA 4CU7A 2XM2A 1CXKA 3ZR6A 4EE9A 3L4WA 2DH3A 5E0CA 3N15A 4DWSA 1K9DA 1W3HA 2AAAA 1VEOA 6CGTA 3L4YA 4C7DA 3AIVA 1MQPA 3WEZA 3K8KA 2XVNA 1NARA 3VINA 3CUGA 1GOQA 4W93A 4B16A 4ZE4A 4QFUA 4E2OA 1OT2A 2GSJA 3VIOA 3NDZA 5A8MA 1BYCA 1H09A 1JAKA 2FGZA 1C91A 2DT1A 3O6AA 1PIFA 2D3NA 2CIPA 3TTQA 4A3HA 3WELA 3AIRA 1EQPA 3IAPA 2WW5A 2E3ZA 3WQWA 1KXVA 2GK1B 1ITCA 4AIEA 1GUVA 1V6WA 1E3XA 3BLPX 1GOWA 1J12A 3AXHA 1QI4A 4HU0A 9CGTA 5DO8A 4E8CA 3MUAA 5D9OA 8A3HA 5GNXA 5CSYA 2QV4A 3MU7A 2J74A 4NF7A 4LX4A 1JYVA 1CTNA 5FCZA 4B9ZA 2YBUA 5JUVA 1H3GA 2FHFA 5LYRA 4Z2GA 5AY7A 1XD1A 1CGYA 2XVKA 4M29A 4URIA 3GXDA 3NIYA 3SCRA 3CO4A 2VVNA 4GKLA 1CIUA 3L4XA 3WEMA 1OWQA 3GNRA 3AQUA 4PSRA 4JKLA 3WL0A 4YPJA 1KGXA 2W92A 1BSIA 5IFTA 2DEPA 4BQ2A 2CITA 1BYDA 2JF6A 4JFUA 2NSXA 3U57A 4OZOA 1OT1A 5A2AA 3ALGA 2A3EA 4KH2A 3ZT5A 3UR8A 1LQ0A 3HU7A 4MNKA 3EDJA 3ZT7A 3ZJ7A 4J3UA 1W9UA 2E9LA 4LYRA 1EOKA 4F66A 4LPCA 2VJXA 4HZ6A 1VFUA 3A47A 3PBGA 1C8XA 4ATLA 2ZXBA 1GOIA 4PUDA 3QOKA 2BFGA 2XSAA 4J3WA 4HP5A 3AOFA 3FXYA 1E5JA 3CUHA 4TUFA 5FL1A 5JIWA 3E1F1 4JCMA 4LQ1A 1E4IA 1H0IA 4D1IA 3WH8A 1W1TA 1CNVA 4AMCA 4J3XA 4AYSA 2CBIA 4ACYA 4UQDA 1H2JA 4HMCA 1E73M 2O9PA 2WKGA 2WZHA 3OZPA 3AIWA 1WDQA 5AYIA 4Q7NA 4TX6A 3GH7A 1UWTA 3A4WA 1CXEA 5JIPA 3ARPA 1LL6A 1LLOA 2WK2A 4DUWA 4H8VA 5CLWA 1BAGA 1OD0A 1XYFA 1W9XA 3DHPA 2FDMA 3VDBA 4P7LA 2E9MA 4WSKA 1KGUA 4H8HA 3BMWA 1WPCA 2QPSA 2ZX5A 3VM7A 1FP9A 4P7QA 1A3HA 4GO9A 3VX0A 5HNNA 5ABHA 4WIWA 4KRTA 3AZRA 3CIVA 2W5FA 4ZE5A 1E1FA 3VUPA 3UG4A 3BCFA 4W7WA 5E9AA 3SCPA 1J0HA 2Y2WA 1V3KA 3FHAA 1UD3A 3U7BA 5A6MA 3QOMA 4DWSB 4AZ5A 2CESA 2BXZA 4PMQA 1WKYA 1JXJA 2VX6A 3M46A 4X0NA 1EDQA 2Q8XA 5A69A 4CN6A 1WP6A 3SCVA 1R8LA 1V0NA 1P6WA 4PCTA 1SR0A 3VD3A 3JUGA 1UOKA 3WQ4A 5M03A 4NSBA 2WBKA 1R86A 3W53A 7A3HA 2F61A 2ZXAA 2G3IA 2BY0A 2GJRA 2G3NA 1PAMA 5FIPA 3ZO9A 3ZJ8A 2E0PA 3VGGA 4WKHA 2ZX8A 1EHNA 4QP0A 5A6BD 3WF3A 4TXEA 1MYRA 1UYQA 3CMGA 4GPNA 1W91A 3SUWA 1JG9A 1G0CA 1FHDA 4L4PA 3SUVA 1E4LA 2VCAA 5I24A 3QHMA 1OD8A 2PBOA 4U33A 5LA0A 2UY2A 2JFEX 3LPPA 4CGTA 5I78A 4UR9A 4RE2A 3VNYA 1CGWA 3T0AA 3AIUA 3TP4A 2OYLA 1IT0A 3HJEA 1UZ4A 1E56A 5IHSA 3WQ8A 1UQZA 1GHSA 3L4UA 4P7NA 4CD4A 3W26A 3GXFA 3WD3A 3OLGA 4EAMA 1BYBA 3A4AA 1JZ5A 4L4OA 4U2ZA 1EA9C 3TTSA 1R87A 3AHYA 2G8ZA 5CXPA 4D71A 3ARXA 3QHNA 1A47A 1SYTA 1W2PA 4AIOA 4EKJA 4CU6A 1HIZA 1J10A 2Z1SA 3WDQA 1WZMA 2PWHA 3PZIA 4UCFA 3MANA 1L8NA 3SCTA 2WM0A 1E6XM 2X1IA 3WNPA 1CXIA 2IUZA 2DSWA 2J7GA 1JZ6A 1QNPA 4CD5A 4HA3A 2DIEA 1ZU8A 1FP8A 1V0MA 1LG2A 4PMRA 3ARTA 3VO0A 2YKKA 3CZGA 4ATDA 1E4MM 2YBTA 1XH2A 3ZIZA 3ZSSA 5A8NA 5ABEA 5HPOA 4Z2KA 3MMWA 3D5HA 5A3HA 3T2OA 1XH0A 2JF7A 1RPKA 5D9NA 2WVSA 3AXIA 1ISYA 3WH6A 4GI9A 5HPCA 3VIIA 1JIBA 2EPOA 1UR8A 1ZBKA 4GQRA 3AJ7A 1EO7A 3WUBA 4NRSA 1UD5A 3SCUA 1QI2A 1TUXA 4P8VA 1G94A 5BRQA 1OSEA 1TZ7A 1YHTA 2YL8A 1E5NA 4OOUA 1CBGA 2CKSA 3VDHA 5I79A 1AQMA 3WFZA 2A3HA 4Y7EA 4ACZA 4U3AA 2MANA 3MV11 5EB8A 4W86A 3TTYA 3UR7A 4WF7A 1W9PA 4LYPA 3A3HA 4XUYA 2W61A 1KQYA 3CUIA 4Z2IA 1V03A 5ABGA 1MXDA 4AZIA 5BROA 2ESCA 2ZX9A 4ZXLA 1NWTA 3VIKA 3BH4A 3L4TA 1NM9A 1G9HA 3DYPA 3IAQA 1VB9A 3RJYA 1FH7A 3PZQA 2ZWZA 3AFBA 4W7UA 4TTUA 1JNEA 5ECUA 2HISA 3LPFA 3TTOA 4P7RA 4JL1A 4WKAA 2WCSA 3HN3A 5I2UA 1JZ4A 1W3KA 3IJ9A 1CENA 1S46A 2E8ZA 3IJ8A 1ISVA 5DT7A 3U7VA 1L0PA 3VX1A 1SFSA 2XWDA 2JEPA 1JNDA 1NP2A 1FFRA 3WEOA 1LL4A 3M6DA 3VD9A 2V5DA 3GTNA 3AHTA 3L2MA 2WCGA 2WWDA 3VGHA 3W38A 3L2LA 4PMOA 4UQCA 1B3VA 5GNZA 4JL2A 2J25A 2FGLA 3RILA 1E72M 5HBFA 2CEQA 2A3BA 5BXTA 3OLDA 1QHZA 2VI0A 5CPSA 1HT6A 5A8QA 2G3MA 2OLHA 3RPMA 2WPGA 1BG9A 4AD1A 4J3VA 4BS0A 3S2CA 2WMFA 2V3GA 3BLKA 1KCKA 3WFLA 1OGBA 1MW0A 5EFFA 2VO5A 4H41A 4QCFA 3KE0A 4KMQA 1O7AA 1WO2A 5A95A 3MUIA 2XPKA 3VM5A 3WDJA 4CD8A 4CD6A 3ALFA 1U2YA 2CETA 1R7AA 2EEXA 1HN1A 2G3JA 5KEZA 3AI0A 3G6MA 2ZWYA 7TAAA 3ARRA 1TMQA 4UQAA 1PIGA 1KXHA 4W84A 3VIHA 3N17A 3AS2A 3BC9A 1B9ZA 1TR1A 2CPUA 4ZFMA 2O9RA 2JIEA 2CHOA 2DDXA 1EXPA 3WUFA 5KZ6A 2D2OA 2WZEA 3MV01 5D8ZA 4AZ7A 3T09A 3K8LA 2D0HA 1ZBCA 1UKQA 4MAVA 4PTXA 1JDDA 3WNMA 4HOWA 1C3FA 1UKSA 3LPGA 2ZXQA 2WHLA 1V6UA 1M01A 5A8PA 1C90A 1FH9A 1KBKA 2DSKA 3VDCA 5LA1A 2VOTA 3GNPA 4HOZA 1JF5A 2C7FA 3PZMA 4ACZB 3W81A 1E0WA 2D23A 1XH1A 1B2YA 1U30A 5A6AA 4U2YA 4R27A 2XVPA 4GZIA 5A2BA 1UKOA 1ZBVA 3AZSA 2VL4A 4EK7A 1DWIM 1UD6A 3WD2A 4D72A 3OZOA 5EFDA 2UY4A 3MMUA 4D1JA 4U5IA 3CZJA 2WHMA 1VF8A 2IXUA 4PN2A 1K9TA 6A3HA 4MB3A 2CYGA 4QLJA 3EMCA 3EBVA 4HA1A 1UWIA 2XG9A 4JKKA 4OIFA 3WENA 3VTRA 4AD5A 1AMYA 1E15A 1RH9A 4W8LA 1QW9A 1E0VA 2GJPA 2XUCA 1E0XA 2YJQA 4DM2A 2FH6A 4PMDA 3EMQA 2ZUNA 2J47A 3SCQA 4R5EA 3RJXA 4CVUA 2OSYA 1J11A 5F7UA 1CXHA 1VJSA 1V3IA 1V08A 2J79A 3W25A 2GVYA 3W37A 2WCAA 2YA0A 1DWGM 1UWSA 5I0DA 1ZB5A 1DWFM 1KCLA 2JIWA 3CHEA 2PWDA 1J0YA 1PZ2A 2E4TA 1UR1A 2X0YA 1AQ0A 2X09A 1E70M 1FH8A 5E6ZA 1E9LA 1DEDA 5CG0A 2VR4A 1UH3A 4PTWA 2X2YA 2CCRA 4A4AA 1H49A 2J62A 3VD4A 3W82A 1XGZA 3CLWA 4MDPA 1WDRA 4HTYA 5E6YA 5M17A 4GQQA 3FAXA 4JFSA 3NUKA 4DWSC 2D22A 3AZTA 1FOBA 2WSPA 4EANA 3AMCA 4AY1A 4P8UA 1GZJA 1M03A 1NWRA 1KR0A 3CTTA 2J7FA 3W0KA 5CQ1A 3UCQA 4QLKA 4N42A 3BSGA 1IV8A 2VNCA 1C92A 1Z32X 2VZVA 2ZOXA 1BF2A 2XFFA 2TAAA 3O2LA 3ZR5A 4GO8A 4WJXA 4BF7A 1AVAA 1MWOA 1B90A 1GQIA 1FHLA 1EH9A 3SUUA 2GUYA 5JBFA 2PF0A 1I1WA 5LA2A 1NOUA 3K4AA 4GI6A 3RIKA 3KWXA 1W9VA 2ZE0A 5DMYA 3KZSA 1QNQA 5EBAA 4PMYA 1B0IA 4BQ5A 4MADA 4UQBA 4FLOA 1PPIA 2WANA 4UNIA 1HL9A 5A6LA 1EHAA 4QDMA 3BXWA 3SIMA 2QMKA 2NT1A 3PZGA 1M53A 2AOSA 3K1DA 1W9BM 4UZSA 1J0JA 2BNJA 2D0FA 4GZJA 1B3XA 1XSIA 3T2QA 1EDTA 1UR9A 2WWCA 2XVLA 4YHEA 4PRWA 3FAWA 3AROA 5AC5A 3ARSA 4CN1A 1QBAA 1F4HA 1WDPA 2EPMX 4Z2JA 5C70A 1CGUA 1XSKA 4NI3A 1B30A 2J4GA 3N04A 3OLIA 2VVSA 3IK2A 5M5DA 4PTVA 3W4RA 5FD0A 1DP0A 2UY5A 1J01A 1MQRA 3A4XA 1WZAA 3VKKA 1K6AA 5CGMA 4D6DA 5IFPA 2QHAA 3VGBA 1CGXA 3CHFA 2EJ1A 1KR1A 1E6ZA 1CWYA 5I6SA 3N18A 4AEFA 2OSWA 1HJWA 2WZIA 4GZEA 1XC6A 1JL8A 2E40A 2WBGA 2YL6A 4ZXOA 3WKZA 4JFVA 3EDEA 3KL5A 3NJ3A 4XX6A 4UQ9A 4JHZA 1QNSA 2XTKA 3F5LA 1RP8A 1XV8A 3TOPA 2CBVA 1KWGA 1W1PA 1G1YA 2CERA 3PN8A 2WC3A 2Z1KA 5DT5A 1VIWA 3OB8A 4AD4A 1VFMA 1J18A 4LGXA 3BAXA 1D3CA 1QI5A 2EPNA 7CGTA 1ECEA 4BA0A 2ZX6A 2WMGA 3VIMA 4B15A 1HJVA 5TD4A 5BWFA 4OKDA 4PSPA 1V6VA 1JZ7A 2YLAA 5BXRA 3WQ6A 1QBBA 1Q4NX 1GVIA 2XGBA 1ISXA 3WMCA 2XYLA 2CKRA 2WKLA 2DSVA 1KQZA 1GQJA 4UTFA 5A6SA 1LWJA 3GXIA 4JKMA 2ZUVA 1CGTA 2WAGA 3WNNA 2W67A 3FY1A 3VD7A 1QI3A 1GQKA 1E1EA 4ZEPA 1CLVA 2VUYA 4UFMA 4E8DA 4IPNB 2Y4SA 4KGLA 1U33A 2EQDA 1HXJA 2X0HA 1JGIA 3AMKA 3TA9A 1JYXA 5CLTA 3BAKA 3THCA 1R7OA 3NYDA 4HMDA 4JZ5A 1TVPA 2WVVA 3SURA 3KL3A 3PTQA 3WUEA 3WN6A 1VFOA 1RD6A 2WMIA 2CXGA 1PJ9A 2W62A 3OLEA 1W2VA 4W5UA 2V3FA 2WVUA 3BAWA 3MMDA 5CZKA 4AD0A 1DWJM 3F5KA 3MSDA 3FNDA 3AXXA 5A2CA 1HL8A 3WNLA 1UWRA 4W8BA 2VCBA 1DWAM 1J0KA 4H7VA 3RDKA 2OWWA 4PMVA 3OA5A 4J3TA 1GOKA 1GOMA 2DQXA 3NSMA 2VR5A
chains in the Genus database with same CATH superfamily
4S3KA 3HG3A 2YDQA 1B3YA 3IARA 1B54A 1ZL1A 3CHCA 4B4HA 3GG8A 3GWQA 5H2ZA 3S3GA 3BMVA 3B4YA 5CH9A 3BLEA 3QQ1A 2HV5A 3I7QA 3CZKA 2CU0A 1Q6GA 1FWCC 4H04A 1RD5A 1E0UA 1W1B1 1F7BA 3VCNA 5GVJA 3QZAA 4HHMA 5LGZA 2XISA 1I2RA 4GNJA 4IJCA 2H90A 3VNDA 4NZ1A 2D73A 4JTFA 2DSUA 5DMMA 1ZP3A 1LORA 3WLSA 5H91A 1LG1A 1S5NA 4IUGA 3WMSA 3DFNA 3HPZA 1XCXA 4GWEA 3NQGA 3W1XA 2GZXA 3WLRA 2BVTA 3ABXA 2EPLX 4CKQA 2Z24A 1HKVA 3HZ3A 4A8NA 1XYAA 2ISVA 4CQ8A 1XLGA 4GUGA 1REQA 3S2MA 2RJGA 1E51A 4MPKA 1CLXA 3GM8A 3L2IA 5D09A 1AODA 1OF6A 3QY7A 1E71M 1CXLA 3UG5A 3CZLA 1S3TC 1RJRA 3SUTA 4ADTA 4US5A 7TIMA 4OOZA 1OX5A 4C5YA 1E6SM 2GUUA 3T05A 3MPGA 1O5XA 1JYNA 2XIBA 5JXQA 4WSJA 2QXWA 5I23A 1I60A 1UIOA 4IGHA 3U2EA 2VEGA 5FEPA 2AMGA 1FWJC 4EXQA 1KM4A 3P0WA 3KL0A 3MO7A 4AHOA 5A6JA 1VJZA 5HUOA 1GJWA 1HJXA 2DJLA 4C6EA 1NTHA 5CJNA 3B0YA 4ZQNA 3DBPA 5AB3A 3BVJA 1DJZA 3AYTA 4G56A 3PFMA 4U5KA 3H7UA 1WZKA 4JQ1A 1V0LA 1YEYA 4ZB5A 3W2JA 3MVTA 4ENLA 2YXGA 3AISA 4FIRA 3NSNA 3ITXA 4Q32A 3MS8A 3QW4B 1FQ0A 3ARYA 3VOHA 1JJKA 1WXZA 5T9BG 3ITLA 3L4VA 3LS9A 1C8YA 4INFA 4TV5A 1DQXA 2XN0A 3NQVA 4IMAA 1UUQA 1XBZA 2C6QA 4Q8UA 1XFBA 3GYCA 2VD9A 3TVAA 1SMDA 2EG7A 4Y90A 3WD4A 1TPUA 1H1NA 4IMFA 2ZUUA 1HKMA 2CZ5A 3T9PA 4B5UA 4WRHA 1HW6A 5LIUX 4HPJA 2WLZA 4QSHA 3PHAA 4IQLA 2WSQA 2W27A 3C0QA 4XTIA 5E70A 4O1FA 4KFNA 2PDGA 1IGWA 4PMZA 2IS7A 2VX4A 3S83A 4B9YA 1HKJA 4A2SA 4LWWA 2GVGA 3Q4DA 2BOGX 1S2TA 3QQ0A 3SCNA 3WH9A 2PWUA 5HA7A 4IPLA 3HTWA 4C7FA 3VZZA 1RZMA 5CPQA 5EMKA 4QROA 1ZCCA 5ECVA 1G4PA 9XIMA 4O14A 1LJYA 4LVAA 1W0MA 4PUMA 3T81A 3WH5A 3IIVA 4LYKA 3TYUA 2QF8A 2YA1A 3FSTA 3VK5A 3SUSA 4AF0A 4WSHA 4B3LA 4REQB 2ZX7A 3W6YA 4RCXA 3UXLA 3QMTA 5TNVA 2J27A 1TPDA 3CC1A 2E67A 2RGLA 1OFEA 2VXNA 3WQEA 4YYCA 2FH8A 2QF7A 1RA0A 2I17A 1UR2A 1F05A 4MJZA 3L5MA 3UY8A 2QUTA 4DYKA 4NZJA 2E9BA 2YL5A 1A4LA 1GVOA 1XLJA 4HHHA 4F9DA 1FWSA 3N19B 2CZVA 3N11A 4GC4A 2P5NA 1EYEA 3I4KA 4J4KA 1GORA 1YPFA 2X42A 3WF4A 3O6CA 4HPHA 4MB5A 3SW6A 2CBUA 4DWDA 4I9MA 2POTA 3U4FA 4YN5A 3VIPA 4OBSA 4BZYA 1X98A 5ABFA 4RL3A 3CUZA 3M5VA 3URQA 1KV8A 2HNHA 3LRKA 4X63A 3MY9A 4BHYA 3WK0A 2Y8KA 4XAFA 3SEPA 1O1HA 2ZZ7A 4OV9A 2JGYA 4L9XA 3R0KA 2WVTA 1DKWA 3HPXA 3LBMA 3P80A 2O9OA 4DI8A 4I5XA 2V5KA 4DJEC 2WNWA 3HURA 5IXEA 1UD8A 2ZUSA 3NQMA 3OGRA 2YFOA 3GU1A 4I8YA 1G6CA 2UV8G 4G1KA 1XLHA 4Q6XA 3MMTA 1PXGA 4TX8A 3ZT6A 1E43A 3S5SA 3S2JA 1ZJAA 2X8RA 1M6JA 3UQNA 2GJXB 1DJHA 4K8GA 3KW3A 3HM7A 1R47A 1PCWA 4U28A 1OABA 2PRHA 4H1ZA 1RP9A 3TC6A 3ES8A 3VMNA 4MDOA 3VGEA 3WDHA 2VMFA 3A6OA 1UH2A 4PCSA 1FWBC 4RNJA 5HAOA 3KCJA 1ITXA 3G1DA 1GHRA 2X2GA 3VOJA 3V0TA 4HCLA 2YSWA 2VC9A 1V51A 4QG9A 4IOTA 1PX8A 1WE5A 1EP2A 1ISWA 4DUXA 1K1DA 2V2DA 2ISSA 1U1JA 4W7VA 3W28A 2AL2B 2NUWA 3GG0A 4M80A 1GKQA 5DX7A 3NPXA 4PULA 4WY0F 3KBVA 2IKGA 1S2CA 1MEHA 4IT1A 3RO8A 2CLMA 3GC5A 4D8AA 2Y24A 3GBDA 1UCWA 4FLSA 2GVLA 4PBGA 1KKOA 3GH5A 4O4WA 3IRSA 3MI6A 3D0CA 5LNSA 3VPLA 1XPGA 3WBAA 2GOKA 1EB3A 3B05A 4O1CA 1D2KA 1TV4A 3FKKA 3EPOA 2WZTA 4NRRA 2HZGA 2QULA 5CC7A 3WLOA 3M43A 1E6RA 2J7DA 4KKXA 4XO6A 4O16A 1Q5MA 2WMHA 2ZA2A 4FLQA 2WJDA 1UWUA 4MFDA 1JZ3A 3OVRA 1BQCA 3W6MA 4JBRA 1QPKA 4RE4A 1OFPA 3DUGA 1GCYA 1Q6CA 2Y5EA 3I4EA 3WF0A 3UWQA 1XDJA 4CVWA 5A94A 2QCCA 2HNEA 6REQB 4HA4A 4ZBCA 1I4NA 1XINA 3DIPA 4DZAA 1AA1B 3PFRA 3M6YA 3KBWA 4FI4A 3LCFA 3G1SA 2D0GA 4J2PA 3R94A 2B7OA 3T8LA 5IDIA 4WOZA 1YW1A 2PDCA 1OX6A 1TG7A 2V9DA 4HBKA 5LKYA 1SUXA 3BMXA 3MZNA 1Z44A 1ELSA 3OVPA 3VAVA 4O1EA 3KOYA 4MB4A 3V4BA 3HO8A 3UU0A 5DRCA 3L5AA 3D3AA 2KAUC 2WO5A 2V30A 2DVXA 2R6OA 3B97A 5BXPA 4HN4A 2QS8A 2Q3OA 5I77A 1P7TA 4H9UA 2VZUA 1UA7A 1QWKA 4I7WA 6TAAA 4NZCA 4PL2A 1OG0A 2DT2A 5A8GA 5C2GA 5CC5A 1MXGA 3UEQA 3DCPA 1UQYA 5IHRA 3G0XA 3PAJA 1H5YA 1GEHA 3WK2A 4O11A 4CQBA 2C8NA 3IRDA 4BI7A 3V5OA 1CGVA 2WQPA 2GOUA 4MLJA 4AFYA 3TN4A 1G5AA 1MMFA 5HWMA 3U5UA 4ZQOA 3LXBA 2C18A 2QCDB 3L4ZA 4XV0A 4GABA 1EIBA 4M56A 3FSUA 3SIZA 2RDUA 1H7XA 1ZRQA 5FJIA 2DUXA 1WX0A 6ALDA 4UR8A 4RUBA 3F5JA 1VPYA 3ME3A 1OFDA 4OGZA 2O4QA 3B8TA 3D47A 4WR3A 2WLYA 5G2WA 2GDVA 3VMOA 1CEOA 1UUMA 1A5OC 4JTAA 4REQA 4X22A 1GG0A 2ZQ0A 4HQVA 1JUBA 4IMDA 3Q2DA 3CUJA 4C7GA 4LVBA 3CHDA 4XTDA 4AD2A 3LEPA 3BSMA 1RLDA 4RZ5A 1MQQA 2VDIA 1ONEA 1Q8AA 4WXYA 3WBXA 1MZHA 2GL5A 4E5TA 4GH1A 1E0TA 3G18A 3F4CA 2DFAA 4DN1A 1GVYA 1HJUA 3TNBA 4F79A 4XG1A 3A12A 4EWJA 1JDAA 4W8AA 4IF2A 4PMNA 3S2NA 2CZDA 1IYXA 2GGHA 4DUVA 1R3WA 4G1NA 3QMRA 4MTVA 3FW6A 1X39A 4LUTB 3L5LA 3AXMA 1JDCA 1IXNA 3VXGA 1O1ZA 4CQAA 3N9KA 2WYSA 3LA4A 1XIIA 3KBNA 1MW2A 1QI0A 3TKFA 4CNSA 4DJFC 4LUJA 5KTLA 3AHZA 2PC8A 3GXMA 1YYAA 4HSNA 3VNLA 3R7MA 1J2WA 1R3TA 1P6CA 3UGVA 5TBOA 3EWWA 3ENLA 3W7JA 2GFTA 4X0VA 3GXPA 4GJJA 4DEFA 2PTWA 4UZUA 2GSEA 4G9PA 3TNOA 4YXGA 2J9ZA 1DIEA 5FJRA 3W6LA 3U48A 4NAFB 1UR4A 5HQMA 2NW0A 3ZOAA 4BY3A 3POHA 3USZA 1W31A 4TVDA 3H4WA 3TCSA 2J8TA 3O1NA 3MC5A 2A6LA 4EE9A 3HB9A 3L4WA 5I00A 2PTZA 3LGDA 3HQNA 5HJYA 3EB2A 2AAAA 2UZ9A 4I3GA 1CX9A 4UTUA 3NYZA 1TIWA 2ZRWA 1NARA 2ZBTA 5HMEA 1EPVA 3H55A 2ALDA 4B16A 4ZE4A 1AUSL 5IDZA 4QJ1A 3VNKA 2DZBA 4P5UA 4YU1A 1DVJA 1H09A 4EPBC 1C91A 2ADAA 1RVKA 3O6AA 1PIFA 4YVXA 4M19A 4A3HA 2V81A 3AIRA 3IAPA 5LGXA 1SR9A 2H9AA 1E1CB 2GK1B 4RDWA 4IIFA 3DENA 3EPNA 4AIEA 4H9TA 1E3XA 4B5VA 1GOWA 2I5GA 1TPEA 1U1HA 3NZPA 4HU0A 4M6VA 1W1ZA 5GNXA 5LSMA 1RXOB 3DN5A 3SY5A 5AHIA 2Y7GA 3DAQA 1CTNA 2ZDSA 2E28A 2Z2BA 2YBUA 4PBEA 3PG9A 3RYSA 3C0JA 2I9UA 3PR2A 4Z2GA 5AY7A 3P74A 4RNFA 1CGYA 1QO5A 5CAHA 3NIYA 4JTKA 4XZNX 4GKLA 5LZLA 5DRIA 5DBUA 1GVSA 3EKGA 3LGGA 4ZVJA 3WL0A 1KGXA 1BSIA 2DEPA 5AZ1A 2JF6A 2NSXA 3U57A 1R9XA 3SQLA 4OZOA 4Z1DA 2ZVRA 3EDJA 1RCQA 1F6YA 4F3HA 4MY1A 4K36A 3NL6A 4QITA 1EOKA 3LBCA 4HK6A 4HZ6A 4C6LA 1VFUA 4ERGA 3PBGA 1C8XA 3ANVA 4J3WA 4HP5A 3AOFA 4IG2B 5JIWA 3KP1A 4QG6A 1F8IA 4MG4A 4JCMA 4LQ1A 1E4IA 2CZEA 4D1IA 4RV3A 1O12A 6REQA 4E0CA 4K2SA 3GSMA 2I5IA 1PV8A 3KFTA 1B3OA 3M0VA 1H2JA 4HMCA 3NQEA 2WKGA 4NUWA 4Y9MA 4FHAA 1U5JA 4C5ZA 3XINA 3O63A 3GH7A 1EPXA 1LLOA 4DUWA 1XGEA 4L5ZA 5CLWA 4K1WA 1VBHA 3A5VA 2O7QA 1OD0A 1TPWA 5BMXA 1K02A 3K13A 3W7KA 4J3ZA 4P7LA 4WSKA 1BVWA 1KGUA 4H6QA 1XLCA 5HNNA 3GAKA 5ABHA 4WIWA 3NO3A 1XRSA 3TXVA 4CCZA 4AVOA 3BCFA 4W7WA 1X38A 2VFDA 2LLEA 1V3KA 1RALA 3OQ8A 3FHAA 4ES4A 4QNWA 3VABA 3S47A 2HTMA 3V5CA 4DWSB 1WDDA 2RH9A 4TV6A 3XIMA 2HRWA 3WQGA 1JXJA 2GPTA 3M46A 4JNYA 5A69A 4EPEC 5DXXA 1KFKA 2Y70A 1AJ0A 3QV8A 5M03A 2YFNA 5C54A 3ABZA 7A3HA 1KW1A 2GJRA 1K6WA 2GQ9A 3O05A 1ITUA 3UZXA 5FIPA 3LLFA 3ZO9A 3ZJ8A 3VGGA 3W7IA 5XIAA 4DYEA 3W7PA 5LNVA 3WF3A 4LBUA 4O10A 4QIUA 1W91A 1MSSA 4HCDA 4KT2A 4I8DA 1YTDA 3BPWA 3PF3A 4F48A 1E4LA 3TOYA 3QHMA 5LA0A 2UY2A 5FF0A 4GGBA 4AYGA 3UYIA 3WFAA 1Z9AA 4NJKA 3HJEA 1UZ4A 1FWFC 1E56A 3D46A 1RR2A 1XBVA 3GU9A 3APTA 4P7NA 1O94A 2G97A 3GXFA 2PDWA 1BYBA 2PDKA 2E6FA 3A4AA 3N9RA 4DJDD 2VFFA 4U2ZA 3VOGA 1QFEA 1EA9C 3G1VA 3HGRA 3TTSA 1R87A 5CXPA 3ARXA 4EVZA 3UWUA 1J10A 1VS1A 3BGJA 4JYEA 3WDQA 2I56A 2PWHA 5U7SA 4UCFA 3CEUA 5JU6A 5LNUA 4H9YA 1L2UA 2X1IA 3R0UA 3KTSA 1J93A 2DSWA 1C8VA 1XPYA 3CK5A 1QNPA 5XIMA 2HS6A 1T8QA 4O18A 3PSWA 4Z1YA 5ABTA 1V0MA 2OKTA 3VO0A 1POKA 5IBXC 1LM1A 1WOAA 1XBXA 1E4MM 1FCVA 2YBTA 3ZSSA 5HPOA 2Y7FA 3MMWA 5TQLA 3VKDA 3QPYA 3E0WA 2OELA 2ISFA 1PS9A 5D9NA 4JTUA 4DXKA 2A6NA 3ICJA 3EWDA 3TJIA 3ES7A 8RUCA 1ZBKA 4GQRA 2ZRVA 2FB2A 2EAWA 3AXKA 2FJUB 1TUXA 3RNDA 2F84A 1TZ7A 2DZWA 1E5NA 1RPXA 3VDHA 2ZYFA 3NZRA 4Y7EA 1G69A 4NAFA 4CEUC 3FFSA 2OXNA 1UIPA 1TX0A 4ACZA 2MANA 4AC7C 3CV7A 2VC7A 4W86A 2NV9A 3TTYA 3AWOA 1XWYA 3QGKC 2QGYA 5I3HA 2F38A 3ZWTA 2P53A 4GY0A 4ZOAA 1GVRA 3D3FA 4GOAA 3STFA 2ESCA 4D2JA 3BJSA 3GVVA 3BH4A 3ITTA 2NXHA 1NM9A 4RKAA 4Q8VA 5JQ9A 2YXXA 2OT1A 4NG3A 5FJUA 2VR2A 3PZQA 4PBFA 5IM51 4HVXA 4W7UA 4QEHA 4KETA 1JNEA 1BXCA 3BG3A 4JTRA 5F2MA 5AYXA 1OG6A 3KVLA 4P7RA 2WZMA 3KTCA 5I2UA 1O4UA 4MKSA 3OG3A 1CENA 4JTIA 3E0FA 2DZTA 3EB3A 2JKAA 3VZXA 3WQPA 4EPDC 4C90A 4RE0A 3P82A 3VX1A 1ZFJA 4EPKA 1IF2A 1XICA 3P67A 1F6PA 3M6DA 3VD9A 1L6FA 3MKCA 2WWDA 1KM2A 4FO4A 4H6RA 1B3VA 4L4MA 2Y5SA 1TR9A 4AHPA 2V5LA 3FLUA 1Q7QA 3P81A 3VKAA 1E72M 1VYPX 2CEQA 1DE6A 3APYA 2VI0A 3UZZA 1FHVA 3HBLA 5A8QA 1AMKA 2ZZ4A 4C6OA 1K8XA 2OLHA 1KD0A 2WPGA 1BG9A 4PTNA 3CL8A 3AUJA 2WMFA 3WBWA 3BLKA 1DQWA 3WLNA 3KCLA 1OGBA 3KX6A 1FDZA 4H41A 5EPDA 3N29A 1MXSA 4CD8A 3WDJA 3LV5A 1U2YA 5JH2A 4R85A 1R7AA 3ITYA 1HN1A 5T26A 4BI5A 5BWAA 4IG2A 3G6MA 4H01A 7TAAA 1N8IA 2VFEA 4K8HA 5BOEA 3W00A 3N17A 3BC9A 4Q7IA 3Q94A 1YMYA 4HHLA 4LOCA 3C3UA 2CHOA 3VUSA 2DDXA 1ECQA 3WUFA 1OVDA 3BW3A 1TTJA 3GQYA 3MV01 4JR5A 4K8EA 2GQ8A 2VP8A 4V1XA 3R8RA 3T09A 3K8LA 2D0HA 4WY0B 1UKQA 3F4WA 4KPLA 1XM3A 2Z6JA 3WCZA 1YIXA 1AD1A 2SFPA 2J9XA 3CL7A 2DSKA 3MDWA 2PDIA 3VDCA 4HOZA 1JF5A 2KZHA 2PS2A 2D23A 1XH1A 1OY0A 1U30A 5A6AA 3THQA 2I16A 4FSAA 3RLGA 3RMJA 3O3RA 4QX4A 3BZJA 2HPMA 2UBPC 2VL4A 1CW2A 1ZSXA 3BW2A 5EFDA 3M0LA 3P61A 3R43A 2IKHA 3IIZA 1JR1A 1FKXA 3P3BA 2P1FA 1VF8A 3ITGA 3CYJA 2B4GA 3M16A 3FK4A 4HA1A 2XG9A 4JKKA 3VTRA 4AD5A 4LS1A 5KINA 1VD6A 4W8LA 3LN3A 2Y88A 2DZUA 3GU2A 3WBYA 2E5CA 4PFMA 3SCQA 1LQAA 2NQ5A 5CPNA 1CXHA 1FDYA 1XLMA 4X61A 3C8FA 3W25A 2E5BA 2E09A 4JN6A 1MI3A 3S9ZA 1ZB5A 1DWFM 2NXGA 3CHEA 4RNHA 2C71A 2PWDA 8XIAA 5C5YA 1W3NA 4UIOA 2V2HA 4H00A 3MA8A 1UR1A 2R1LA 3O8AA 4N2YA 4DJEA 3FGCA 2PDFA 1JCYA 4NILA 3BL3A 5L6UA 4A4AA 3OHMB 1EC7A 1BWVA 2NX3A 4HTYA 4LV9A 3WJYA 1ZTVA 5M17A 3PJWA 3F1QA 3S1GA 1R3YA 4GNKB 4H6EA 3GFZA 1FOBA 4B2DD 2HS8A 4JIPA 1RQEA 1U22A 2QCHA 4P8UA 3U4AA 5C6MA 1WUEA 1NWRA 1KR0A 3KDNA 5CQ1A 4NZFA 3IPWA 4QLKA 5I3KA 2P3EA 4N42A 2VNCA 1BF2A 3NZQA 4QS6A 3O2LA 1AVAA 1B90A 1MWOA 4HNOA 3CO8A 4O50A 1XLKA 1XBYA 2GUYA 3W72A 4NIRA 5LA2A 1QU4A 3W1MA 3RRAA 3RCMA 1K7XA 1W9VA 4UBPC 2ZE0A 5DMYA 4HHPA 3NL5A 3T6CA 1LOLA 1QNQA 2FZBA 1LBMA 3PG8A 5EBAA 3CJPA 1TRIA 1DXIA 3W76A 1P0EA 4BQ5A 4UQBA 4D9PA 1X8CA 1UC5A 4UNIA 4WCJA 1EF2A 4EOUA 3B8IA 4QDMA 3FVDA 3UGRA 3NQAA 4C1LA 2NT1A 3PZGA 2AOSA 4Z17A 1W9BM 1UROA 1AW5A 1QWGA 4KBXA 4PH6A 3ATZA 1EDTA 1SFJA 4Q4MA 4PRWA 4QISA 4AU0A 3AROA 3CV6A 1PIIA 5KITA 1F4HA 4RDZA 4PCNA 1XSKA 1B30A 2J4GA 1D8WA 5M5DA 4PTVA 3W4RA 2VENA 5FD0A 3THAA 1P4CA 4TMBA 1MQRA 1R2RA 3B0PA 1PTAA 4Q33A 1K6AA 1LLWA 1XCFA 1F3XA 3GAYA 3PBWA 1M9HA 4LEQA 2EJ1A 1TTQA 1SM9A 5LXEA 5LXXA 2OFJA 1CWYA 4LS0A 2OSWA 2WZIA 4GZEA 2WBGA 4NNBA 4LC8A 3BV4A 3EDEA 3NJ3A 4UTHA 5HWJA 4XX6A 2A5HA 3AUOA 2XTKA 1R3QA 4GH3A 1L6SA 3TOPA 2CBVA 1KWGA 4KS0A 2WC3A 1BD0A 5L9FA 1QDSA 2PZNA 3R1ZA 1VIWA 4PE8A 4E4UA 3PPCA 3VKBA 3H8AA 4RW5A 1VFMA 4LGXA 3BAXA 2VEKA 1P5BA 1ECEA 4NX5A 4CNOA 3W2KA 1HJVA 1F2JA 1XKJA 4JTJA 3OQEA 1P1XA 1KM0A 2HXTA 5CJMA 3KTXA 2R14A 2YLAA 3UWWA 3WQ6A 4OU1A 5MHBA 3RU6A 3NM1A 3T4WA 2XZ9A 1FCBA 3DXIA 5DY3A 2XYLA 3DZ1A 3PPGA 4UTMA 4E8GA 4UTFA 1HZYA 5A6SA 3EEGA 2YCLB 3GXIA 3NURA 2WAGA 2DV0A 3FY1A 3VD7A 1TIMA 1GQKA 1CLVA 1HXJA 3QQWA 4L7ZA 5F2LA 2A85A 3UWEA 3THCA 3TJ4A 2XINA 3NQ2A 3I7RA 4JZ5A 2PGFA 4RXGA 1S1RA 5F1VA 4X60A 3UXAA 1FWWA 3L9CA 3WN6A 4WVXA 3W23A 2WMIA 5I06A 3P60A 3URNA 4NY2A 3MMDA 4AD0A 3UPBA 1DWJM 3F5KA 2VGBA 3CV2A 1W37A 3M47A 5A2CA 1HL8A 1GTHA 4PUNA 3PUGA 2VCBA 1DWAM 1QPOA 4H7VA 4E6MA 4PMVA 1TPC1 2C1IA 3OA5A 3LU2A 4J3TA 1GOKA 4GJ1A 4KWSA 1UW9A 2DQXA 1P48A 2VR5A 2WSRA 4NYYA 4DRSA 3N2OA 3AU2A 3SCOA 3MZ2A 4KWVA 1MNSA 4OT7A 1PZ1A 4GLEA 4KERA 1DTUA 1JAEA 3G5EA 1D7FA 4J28A 2XU2A 4C6NA 1UZHA 1ZAHA 3N9SA 1PE1A 1QCWA 2WHJA 2OYKA 5E09A 3B9AA 3R8HA 3BJTA 1NDYA 1UD4A 3B8UA 1V6TA 2XIOA 4HYRA 1GONA 1T96A 4MNLA 1H51A 3B9NA 3ECQA 2J7CA 3MHFA 1E6PA 1BLIA 4JN8A 5FF4A 2ICSA 1IXOA 4PUEA 3IIOA 2XM1A 4JTEA 5A1AA 1IWBA 1YPXA 3T0TA 1H5VA 1BVNP 4KCTA 3MSRA 4DJFA 3WH7A 1UB3A 1ONRA 2VKZG 1A0DA 3TW6A 3ZJKA 2VQUA 4HNVA 4JIEA 3CQJA 4DWSD 1O6IA 3AMGA 3W75A 1YX1A 2DH2A 3TA6A 3GNOA 3NDYA 3PJUA 4IHCA 3HG4A 4XKYB 1BGGA 3TX9A 5CSUA 4IPJA 3RX4A 1HVXA 3E96A 1FWTA 1KLZA 4A8LA 2ZA1A 4CLMA 1T8XA 5I09A 5C7HA 3IEBA 4E2BA 3ANUA 3AYRA 2A3AA 1H0GA 2NWSA 4FR6A 4WDXA 2ZADA 1V6XA 4XZIA 4UFJA 1JI2A 2RUSA 1MDLA 3ZJ6A 8CGTA 4R33A 3DYOA 1QR7A 3OYXA 1X1ZA 3EDFA 1VQTA 1PHQA 1LP6A 3QLDA 1TCMA 4M6UA 1VEMA 2RKXA 2BODX 1OZMA 1BTMA 2OR2A 2A7RA 4IM4A 2AKZA 2Y8VA 4FEZA 1ODUA 5AHFA 1UR0A 3BLDA 3YPIA 3ARUA 4KEUA 2I7GA 3VGFA 2Z27A 1Z6KA 5H6HA 2V3DA 4GYPC 1I2PA 4ZTXA 5C9RA 5G1MA 2BY1A 3UP8A 3GS6A 1KV5A 3ZMRA 2PODA 4DYJA 1A5UA 1J0IA 2R94A 2W66A 1IEQA 2XGIA 1PEZA 3RM8A 2P88A 1YLVA 4KRUA 4K7YA 4NAEB 3WF1A 1OZQA 5CZJA 2G96A 2FHCA 5BCAA 3CIWA 2VURA 4ZOBA 4GMEA 2HE8A 3G1YA 2AQVA 1TA3B 3F2BA 3TZNA 3ZR4A 3LMYA 4I5RA 1XUZA 3S1WA 3QMSA 1BTCA 3NWRA 1KFEA 4NKCA 1DJNA 1P0BA 1Y7VA 3SGUA 4O15A 4TTGA 4P61A 2VDHA 3IV3A 1HF6A 2OPJA 3UWVA 1BFNA 5LHEA 4OV4A 1QOPA 3GX9A 3F4DA 3FEQA 3N2CA 4DB7A 1ODZA 3I65A 4H7ZA 3LM7A 2Y61A 5A6TC 5FOOA 4AVFA 2WC7A 2AGTA 3S5OA 5D9PA 1JGMA 1US2A 5CC6A 4B3ZA 3CQHA 2Y6ZA 4JY8A 1Z42A 2AMXA 2FZNA 2VD8A 1QJWA 4HPGA 2ZKMX 1HO4A 4FX7A 1BPLB 3QXBA 2GYIA 2PTXA 1I1XA 1VENA 2J8FA 3DC8A 3ZVIA 5DQPA 5K7JA 3EOOA 1NP0A 5I03A 4RW3A 2OO0A 3NM3A 4GY1A 2G50A 3WJZA 2FHBA 3PZNA 5AYBA 1EBGA 4LXFA 3GDBA 3FN9A 1V0KA 1QK0A 4C1KA 2PGEA 2GDUA 3N2MA 1UKTA 4RZ4A 1TTPA 1QT1A 3QC3A 2V0TA 4FXFA 4IFOA 4UOZA 4QR6A 2EG6A 1JI1A 3N73A 2QNEA 3QTGA 4BI6A 1OFAA 1XYMA 2GVEA 3T1GA 4RZBA 4XUGA 1ESWA 1RY8A 2D20A 2J77A 4DO6A 3BGAA 4D6GA 4J35A 1KXQA 4IGNA 1PBGA 3RU8X 4QNEA 4JD4A 2FPTA 1XSJA 2J6XA 1LBFA 4DLMA 3H2OA 5CPMA 4GI8A 1CECA 5KZDA 2ACQA 3FXGA 2VX5A 3LLDA 4MYAA 3T40A 3K2GA 4GVGA 4WK9A 4NNAA 1SZFA 2QUVA 1JXKA 1OC6A 2DW7A 5EMYA 4KFPA 4UMCA 2UY3A 3APGA 1A5SA 1Q6LA 1TB3A 2PU1A 2VQTA 5HQEA 2RDTA 1B1YA 3TTEA 3PBUA 2H3DA 4XVDA 1OFRA 3OP2A 4AZ6A 2WOQA 3AS0A 2J7EA 1VYSX 2BV9A 3G6LA 4A2RA 5FA5A 3GLCA 3NCOA 1X6NA 3U6WA 1A5CA 5G2HA 4D6CA 3M0ZA 3JZEA 2ZZ6A 3PZ9A 2YCEA 1JEZA 1DJWA 4JGDA 4S3JA 3VGDA 3WSUA 1W5OA 5KSWA 2PWGA 3THUA 1TWIA 4J3SA 3TW7A 1OX4B 4DBSA 4QAWA 3CMJA 1ZENA 1ONXA 1N82A 1XC4A 3G1RA 3WL1A 3ARQA 1FDJA 1UPMB 3GIQA 4PA8A 2J8GA 3E5BA 1RAKA 3V35A 1UG6A 5CBIA 3PZUA 4NASA 2QGHA 1ZAJA 3QF0A 3GH4A 1EC8A 5K4XA 1QPQA 5B7YA 4FX8A 1R3RA 4GYJA 1FWNA 4MAZA 1ZHAA 1VFHA 3BLFA 3ARZA 2C0HA 1VYRA 3RM9A 2VT0A 5E0FA 4HN8A 2OKOA 5IBXA 1KFJA 3VYLA 3PZOA 1Y65A 4F8XA 2BY3A 4UOJA 5CJ5A 2YDSA 3B9EA 2PA6A 2W4XA 1KRMA 2BTMA 2WNQA 2FB3A 4NU7A 4U10A 2BLEA 1RBAA 1R30A 3I6EA 3T78A 2PB1A 1EOMA 1V77A 4L64A 4XKYA 2YCIX 2ZC8A 3ERPA 1KXTA 3DI1A 2XFRA 1I75A 3V18A 1LRQA 4O57A 4PEKA 5F2IA 1DWHM 3GUGA 4MF4A 5K2ZA 4Q8TA 3S6TA 4TVUA 1EQCA 1DQUA 2BZNA 1FXPA 1VRDA 3KBJA 3K8MA 3SN1A 1LF1A 3O06A 1QMLA 2PI6A 4KCVA 1KGWA 3EEZA 2BXYA 4JTLA 1BRLA 1B4KA 4CD7A 3TWAA 4C65A 1QHPA 4AIUA 3STCA 4J7RA 4F2BA 1NDWA 1WAWA 3FX4A 1TVNA 1S2AA 4BQ3A 4YNGA 4CQ9A 5CBJA 1J0ZA 1MRQA 2XH7A 3CH9A 1TFVA 1SMAA 1W8GA 1HP4A 1X6UA 2WSYA 5G4EA 3LI0A 2V3EA 1FFQA 2P10A 2FTWA 3HQ1A 4TQTA 1XIEA 3RM4A 3T0BA 1VHCA 3N2TA 1TQXA 3QR3A 3EOUA 1CLKA 5MKGB 1ZLPA 3FIGA 3S5ZA 3SJNA 3SRHA 3VA8A 2QJNA 4B90A 3CAKA 4YTQA 5E5CA 1D9EA 2J13A 2XDFA 3BGGA 1EWEA 4Y6GA 5FI8A 2XGZA 4V2XA 1A5KC 3N12A 5C8BB 4EP8C 1BXBA 1IT7A 3V0UA 3LNPA 3TN6A 4LALA 2A3LA 3DDMA 1JPIA 2FZ8A 3VNJA 1AH0A 4WJ8A 1BGAA 2W79A 3U5YA 2VZOA 2F2HA 2W63A 5D05A 3W02A 2H6RA 2VEFA 3EWUA 1OADA 1QVBA 4HNCA 1GYNA 4N7QA 3THDA 3C5QA 1OFQA 2YZRA 4UFLA 1E4NA 4HB7A 4A3QA 4HMNA 4YTSA 2HE5A 2BHUA 2E77A 1J9YA 2J66A 3TFCA 3MBFA 1Q6OA 4MGGA 1DOSA 3C8NA 4CNNA 4MKVA 3TSMA 4CCEA 2FTYA 2J24A 1SW7A 5FJOA 3WDPP 2XJ7A 1IEWA 5DY2A 4LFYA 2Q8ZA 3RPTA 1IZKA 1X7FA 3DX5A 1OCQA 3H2MA 4O0ZA 4BF9A 2CNCA 3QEZA 3EA3A 2IQ0A 4FMVA 1UZDA 4XZBA 3CAQA 3E74A 3WQ5A 2OZ3A 4MJ2A 5REQA 3PPHA 5MF5A 1E6NA 1VEPA 3CB8A 4PFHA 3BSHA 3B8SA 5I07A 2YIHA 1C8QA 4KGJA 3GO2A 4S3FA 3TN3A 3DESA 4IL2A 4LF1A 2OEKA 5A6KA 1F3WA 4J5NA 3NAVA 4DELA 3ZQ9A 3GK0A 1J4EA 3CPRA 3DFQA 1YXCA 2R1MA 2OLAA 4N9EA 2WC4A 1SJBA 3H22A 4N9BA 3ARVA 3EWCA 1LQ2A 1EJWC 2PDNA 1B4EA 4H9ZA 3TLLA 3C3NA 1AH4A 1H41A 1V8EA 2HK0A 3VC6A 4HOXA 1M1BA 2JBMA 4GQBA 4IQDA 1PDZA 3EKLA 4HNNA 1J5SA 1QOXA 3VOCA 3IIXA 3PJTA 3VCCA 4M8UA 2JE8A 3C2FA 3PWIA 3GW3A 3BAJA 1EDGA 1CYGA 2PP0A 1F74A 3VIJA 1XIBA 1XRFA 4IFKB 3S2LA 1EEPA 3B0XA 1Z89A 4QCEA 4GINA 4XD4A 2PWFA 1KB3A 4H9VA 4LYQA 3TSBA 1A5BA 3DHUA 4ASTA 3JVAA 3AAMA 3WJWA 2YOCA 2GGIA 4GXPA 3AIQA 4GQGA 3VILA 4GIRA 1FY6A 4HPNA 1EGZA 1OB0A 4AZCB 1JF6A 1TZ9A 4M1BA 2CHNA 2GVJA 3E0VA 2J78A 4IMCA 1X6LA 3BQ6A 2XH4A 5FF3A 3RX3A 1XX1A 1PYFA 1GQLA 4GXWA 4DZIA 4JFTA 2JKEA 4FF5A 5E1QA 3DFTA 1OBAA 5BRBA 3KS6A 3ZR6A 2QDEA 2E25A 3FOKA 3Q67A 1M41A 3GHUA 3N15A 1KM3A 2YW3A 4C7DA 1OC7A 3TQPA 1VH7A 2FJKA 3CUGA 1OCNA 3BJFA 3NOEA 1OT2A 5H8PA 1PUDA 4IX2A 3ZS4A 2BASA 2GUBA 1XF0A 3MI3A 2DT1A 5BZAA 5G4WA 3OHIA 3CS2A 2DZAA 3WLPA 2D3NA 4MYXA 3TTQA 4N02A 4XSLA 1T99A 1EQPA 1YTEA 2E3ZA 3WQWA 3SM0A 2A0NA 3HGJA 3GFXA 3SFWA 4E8CA 3MUAA 1S2VA 2PPGA 8A3HA 3TK7A 2QV4A 3LRMA 3MU7A 3UBPC 3UY7A 1Y5VA 4NF7A 4GQ0A 4GHRA 4G2DA 5JUVA 3GXDA 3ORWA 3CO4A 2PTDA 2Z1BA 3IGUA 4EIVA 2G0WA 1OC5A 4R88A 2W92A 3MSYA 4GFIA 2CITA 1BYDA 4B4FA 3KRUA 4JFUA 3R89A 3VFLA 3ALGA 4KH2A 1LQ0A 3HU7A 3DGRA 2Z1VA 4ICCX 4XISA 5T91A 4LYRA 3GXNA 1I45A 1FWGC 4GK8A 4JTGA 3TYCA 1TRDA 4ATLA 4PUDA 3QOKA 2BFGA 4MFEA 3SY8A 4WGXA 1E5JA 4FNPA 2NQZA 3PUEA 2I1OA 3WH8A 1A0CA 1ZNNA 4UQDA 1E73M 4I6KA 1IR2A 5DANA 2XN2A 2FFIA 3BOXA 3TC7A 1M7JA 4QJ4B 2WK2A 4B91A 2ZZ1A 1BAGA 1W9XA 5K9CA 3DHPA 2FDMA 1I6NA 3SB0A 1KTCA 3H21A 1WPCA 4G7EA 4UTJA 6PTDA 1A3HA 4GO9A 3VX0A 4LVDA 3CIVA 1Q6QA 3SRKA 1E1FA 1GG1A 3UG4A 4DBUA 1L8PA 3SCPA 4Y9PA 4Q4RA 7XIMA 1ENUA 5A6MA 3QOMA 1SZEA 1BKHA 5C7VA 2BXZA 4PMQA 1FWAC 1H7WA 2OOGA 1BSLA 4N4QA 4X0NA 1EDQA 2Q8XA 3BCJA 2BXVA 1WP6A 3SCVA 1V0NA 1ICSA 1SR0A 5FF7A 3EOLA 1O5RA 3AO0A 3JUGA 5D30A 3WQ4A 4F2TA 4NSBA 3LSBA 3UJFA 2PDMA 4MZYA 3W53A 1HL2A 2ZXAA 2G3IA 4NXSA 1SU5A 2BY0A 3TDFA 2O7SA 1H7NA 1YE4A 1PAMA 1EHNA 5A6BD 4A05A 1YXYA 4H19A 3SUWA 6XIAA 4PCPA 4LW7A 1LUCB 3SUVA 3UW6A 2VCAA 4J1OA 4IJBA 2BVWA 5CSRA 1L9WA 4Q8NA 4ZQRA 3VNYA 3AIUA 3H53A 5AOUA 4JEJA 4FALA 4IWWA 1EXBA 1KRCC 5IHSA 1GKPA 4FPSA 1GHSA 3CNYA 4I5UA 3LDVA 4DO4A 3LMZA 4LCSA 3BUVA 4OE7A 2KX9A 3W26A 3WD3A 2DW6A 4XAYA 5CZTA 1F76A 1MDRA 3LRLA 2CLOA 4FX6M 4Z1AA 4X3ZA 1XS2A 2I9EA 3WK1A 3QYSA 4HTBA 1SYTA 2A79A 3JS3A 1W2PA 4AIOA 4EKJA 1BWKA 3ZLHA 5G4HC 2Z1SA 1K4GA 3MP3A 1WZMA 1G7VA 3PZIA 1L8NA 4Y9AA 3SCTA 1E6XM 4WGHA 5BMWA 1CXIA 5FEWA 1A3WA 1QUMA 2J7GA 1M7PA 1AQFA 4ZO6A 1JCMP 4CD5A 3QBUA 2DVTA 5DXYA 4JDBA 2DIEA 4PB5A 1XLBA 1LG2A 1H60A 4MVAA 2MUCA 4Z1CA 5A8NA 1XH2A 3ZIZA 3NNTA 4H4IA 2FQIA 5D02A 2XH2A 3JZUA 3O0KA 3N34A 2JF7A 3W01A 3EOSA 1EP1A 2EPOA 1GVQA 3AJ7A 1OFOA 1DYSA 3SCUA 1FHUA 1AW2A 5BRQA 4LB3A 1YHTA 2OEMA 2CKSA 2CZFA 1SO4A 4NJHA 2QYGA 4U3AA 3BTNA 3MV11 3AWNA 3MUCA 1N8FA 4WF7A 1P43A 1VHNA 1W9PA 2YCKX 1V7AA 3O0FA 3PY2A 2EF9A 3FV9A 2W61A 4Z2IA 3DGBA 2VC5A 1V03A 3O7UA 1I2OA 4DAIA 4C6JA 4UTLA 2NSOA 5DMLA 3EXRA 2GWGA 3REQA 1G9HA 3DYPA 3IAQA 3GDMA 3RJYA 3NQ7A 3S6DA 2VWTA 3AFBA 1I8JA 2HISA 3VCRA 4DF2A 2Y63A 3IVTA 3LPFA 4TMCA 2I5QA 2BGQA 3E0LA 4JL1A 4WKAA 2WCSA 4KFOA 2DZVA 5F4SA 1JZ4A 1ZALA 4GYPA 3RK8A 2HDJA 2B0MA 5DT7A 2A21A 1V79A 1L0PA 1LROA 3EWBX 1PVNA 1LL4A 2X30A 3G1FA 2V5DA 3AHTA 4OECA 4A21A 3P8IA 1VR6A 1EP3A 3L2LA 3BARA 4PMOA 4UQCA 4ZO9A 3Q65A 4AUBA 2E7FA 3SSZA 3O15A 4XZLX 3RILA 4Y2WA 4RR4A 3PSVA 2A3BA 2X40A 2ZRZA 1YBQB 5CPSA 1W54A 2VFHA 4L1GA 3WLIA 3SGGA 4J3VA 3S2CA 5M2FX 2PGWA 3TC3A 1QO2A 3AJXA 4O1AA 1KCKA 3WFLA 1JPMA 2XZ7A 1H1ZA 1PTGA 1MW0A 3LHTA 2TYSA 2FVKA 2FZ9A 1DV7A 2V5BA 3PBMA 4KMQA 1O7AA 4CD6A 1SZGA 2IQDA 2CETA 2G3JA 4DJED 4DX3A 4IX0A 1XQLA 4EXAA 3ARRA 4GACA 4R7JA 4EXBA 2AL1A 1PZ0A 4W84A 1VPXA 1XIFA 1GOXA 4BWLC 4NI8A 1JUEA 4JY9A 3WYZA 4IGMA 2JIEA 3AYVA 4MOZA 4QE5A 4XIAA 2BMBA 3W2MA 2Y8UA 2WZEA 4B92A 4WEVX 2CFFA 4MAVA 2P76A 3UD6A 3WNMA 4HOWA 3V7PA 1C3FA 2ZXQA 2WHLA 1V6UA 4GVFA 5A8PA 2TRSA 1FH9A 1EJXC 3DFPA 4PZVA 1KBKA 1WDWA 3FA4A 3QSTA 3IJDA 4RPPA 1E0WA 4WOQA 3NTYA 3UCCA 1I2NA 2XVPA 5A2BA 1PO9A 3AZSA 2IQTA 3FYOA 5K9DA 2YZ5A 2GGJA 3OJGA 3SADA 4YJ5A 1DWIM 4LY8A 4UXDA 4D72A 3IVSA 4LB4A 5DELA 2UY4A 4FAMA 4IGSA 4NNCA 6ENLA 4C6MA 1M3UA 4ZSUA 1JDEA 4OIFA 1K8YA 1MNZA 3QLLA 1Q7ZA 3C56A 5HWNA 3C86A 3IJ6A 2QAFA 1RH9A 3IUIA 4NP7A 4JEQA 1QW9A 1E0VA 2GJPA 3PK7A 3R6IA 4IL0A 4JIHA 1D7KA 2PMQA 3T42A 3WLHA 3EAUA 3EMQA 2J47A 1HUVA 1TVLA 1PYMA 5D33A 1DORA 1WKDA 2XSXA 5EL1A 4CNTA 4RK8A 3RJXA 3TSDA 4S1FA 1LYXA 3W1AA 5HUPA 3W71A 3RR1A 3NQFA 1V3IA 2J79A 3H26A 2PP3A 3LGEA 4ILSA 3EA1A 4JTCA 1DWGM 1UWSA 2VHLA 1QTWA 2Z7GA 1NDZA 1QXLA 3K5XA 2E4TA 1F6KA 1X97A 1AQ0A 2CWXA 3GXTA 3GIPA 2PDUA 4HD5A 1E9LA 5CG0A 4L1XA 2ODOA 3LBOA 2X2YA 3QRHA 2CCRA 3CMFA 2J62A 4AG0A 1T5AA 5E6YA 1RQHA 5JMUA 4GQQA 2E6DA 1G7UA 1WBHA 1JUKA 4TO8A 2X1SA 4DWSC 2D22A 3LERA 1JRCA 1SFLA 2PURA 4BFAA 3O6DA 1DJGA 2G95A 2AAMA 4MHBA 4B5NA 4H2HA 2CLPA 5GJNA 2HK1A 3H6OA 3VKCA 1TV7A 1NIUA 3BSGA 1Z32X 4A3RA 1V4YA 4YIWA 1H7OA 4WJXA 1FHLA 3DH7A 3HOJA 3PBVA 1Q13A 4AWSA 3R58A 1DJXA 1DXEA 1EKOA 1KM1A 1FBAA 1VCGA 3USBA 3UVIA 4IPPA 5C55A 1MEWA 3KZSA 2QCLA 3BLOA 4PMYA 1SPQA 4MADA 4FLOA 2F2KA 2WANA 3BDKA 1HQTA 4RDVA 4F40A 2QJHA 3V75A 6TIMA 1M53A 2J9YA 3K1DA 2BNJA 4XSMA 3DOPA 3UA4A 1B3XA 3A22A 4Q6JA 1XSIA 1FKWA 2NX1A 1NELA 1R46A 2Z0IA 3C0LA 3UZJA 4CN1A 4PUJA 4NJJA 1LBLA 3N14A 2YB4A 2HWGA 4WX2A 1EC9A 1J6OA 2IKJA 3T8QA 4JTDA 5CGQA 2OMAA 3DG6A 5EMLA 5CCZA 3S46A 3ABSA 4RNIA 3ONBA 1WZAA 4Q4PA 3CHFA 4FNUA 1TV3A 3B04A 4H9XA 1E6ZA 2CLEA 5I6SA 1Q45A 4AEFA 1KO0A 4FF7A 3W87A 3WJSA 1JL8A 2E40A 2YL6A 3BOLA 3WKZA 4L6DA 3DHDA 4N9CA 3C4UA 3FKRA 4UQ9A 4JHZA 3GG1A 4AB4A 3BANA 1XV8A 3ITVA 1PKNA 2CERA 3QFEA 1VLWA 3LK6A 3PN8A 1H7RA 5DT5A 2V2CA 3PUOA 2AQOA 3IJQA 1L6GA 2DZSA 4Z0JA 4QM1A 1J18A 1GT8A 5J5DA 2EPNA 3UXDA 5F1UA 7CGTA 4ORMA 1P1MA 1FWIC 1FCUA 2WMGA 3VIMA 5BWFA 3LCWA 4WUIA 4DJFD 5C0QA 2ZTJA 1VBJA 4B5XA 5BXRA 1IEIA 3ITOA 1QBBA 4ROPA 3KRSA 3WMCA 2RAGA 4XK2A 1LWJA 3BLLA 1EJ7L 1CGTA 2V67A 3WNNA 1AJZA 2QDGA 2R91A 3FJNA 4I6VA 4UUIA 1KM5A 4ZEPA 5D04C 2QVHA 4UFMA 2HVNA 2Z7KA 4IP5A 4IPNB 1U33A 2EQDA 1DJQA 4YWIA 3W1TA 4HPXA 1EGMA 3KBMA 2X0HA 1JGIA 2CLKA 4FXJA 4ORIA 5CLTA 4I9JA 3BAKA 2C0AA 1R7OA 2ZTKA 3W7OA 4HU3A 4R9XA 4HYVA 3WUEA 1VFOA 3FDKA 2CXGA 1PJ9A 3OLEA 4IXXA 1M7OA 2V3FA 3QV6A 3AXXA 3P14A 4ML9A 3WNLA 4W8BA 3RDKA 2OWWA 5HULA 4DNMA 2WNNA 4DXXA 2QAPA 2HQAA 3NSMA 3GVRA 3HA1A 3W85A 3B0UX 1P0KA 3WQFA 1JZ8A 2W91A 1UP0A 1NWUA 1VGAA 4U31A 2YYUA 5E93A 5C9WA 4OUEA 3S0CA 4E2DA 3WNKA 3G1AA 4CCDA 1XDMA 3QV9A 4J9JA 4XZWA 3COTA 4JDYA 2OWCA 5LNWA 4HNTA 1KFBA 4M24A 4LAOA 5C9XA 1YTKA 2OTDA 4DF0A 1OGGA 4GG9A 3FYPA 1UWQA 4L9ZA 2PSNA 4PMXA 3NO5A 1MFVA 1TPB1 4FK9A 2X1UA 3IUDA 2IPJA 1NEYA 2R24A 1QATA 3LHVA 1Q2RA 4Q8QA 2DT3A 4UFIA 2QCNA 3VNZA 3URAA 1U1UA 4V1YA 1RVGA 1XLDA 2OO6A 3QZ6A 4GUIA 1E40A 1WQ5A 2OCZA 4D6HA 2Z4GA 3RX2A 4MMWA 3W24A 3BW4A 3QM3A 3T7VA 3B9DA 4CQCA 4BKNA 3N1AA 5F2GA 4F0LA 4IP4A 4ZQMA 3T07A 3WZ0E 1DXFA 4AXNA 4BJHA 3T2PA 4L56A 1R85A 3GKAA 3IK4A 2OWXA 4BQ4A 1EJUC 4RE3A 5JBDA 1EBHA 1AJ2A 2O55A 3LUTA 1QHOA 2ACUA 4U4MA 4JYFA 3A13A 3MSGA 4LNCA 3WD0A 3EMZA 1Q3NA 3LQLA 1XLEA 3HGOA 2OEJA 2YL9A 4UR7A 2F7FA 5BOFA 3UXKA 3G8RA 1RHCA 1WDSA 3WMLA 1W32A 3MUY1 3P8JA 3M7SA 2WVVB 1FA2A 3MYOA 1EX1A 2FLIA 2QCEA 5HOSA 1PZ3A 1O5QA 3GUWA 4CNUA 3NZ1A 4WDUA 3W7LA 2ZDRA 4GFSA 4KWOA 4UOQA 1Z41A 1ITQA 4GCAA 3FVMA 4U3CA 4GVIA 1OEPA 2ZUWA 3KEHA 3WO8A 1IIGA 4CQDA 2G4FA 4O4VA 3WLTA 1T40A 3FJ6A 2HSAA 2XH0A 3S8HA 1XDLA 2OLSA 3M41A 1HVQA 2G41A 3WNOA 4YL2A 4WXZA 1JVNA 3PWAA 3OBKA 4WQ6A 1W5NA 3OIHA 1C9WA 2NZLA 3K46A 1U5VA 2PLJA 3BICA 2PDYA 3P7YA 1XD0A 2CWNA 1ISZA 5BYWA 1I0DA 3OBAA 5J5RA 2GJXA 1XYCA 4A3YA 1IZCA 5C2CA 4MNMA 4N4PA 2WSKA 3AIEA 3LPOA 2Y7EA 3WDIA 1JYWA 5FL0A 2ABAA 3U3HA 2X1RA 1QNRA 1BYAA 1JCTA 3W1RA 3T08A 3AIBA 2XHYA 1IZJA 4O13A 3R0DA 4S39A 3A4JA 3UJRA 1ZGDA 1NFPA 3CV1A 4S3CA 4Z2HA 3MBDA 1M65A 3GTIA 4BR1A 1MW3A 2BY2A 1TELA 3SO7A 1W3JA 2NVDA 2AL2A 1F3TA 3IJ7A 1REQB 3I3EA 1JFHA 1QRQA 2ABBA 1TJ1A 4IMEA 3SCWA 3AHXA 2VFGA 3C2RA 3R10A 4QG8A 5D2TA 2BVDA 2DPEA 3B06A 2J75A 5D03A 3GY1A 1LWHA 3MO4A 1H63A 2D24A 1A80A 2WKJA 2FPVA 1R0MA 1UKPA 3W7GA 4D6IA 1XJBA 3EYPA 5CGTA 3UWZA 4LCQA 1SJDA 5LIWX 3PPFA 1R2SA 3M0YA 4AWTA 4Q4KA 3ZFHA 1Z7AA 1VKFA 4UCGA 2V5JA 4HK5A 3L0NA 1H7PA 4EWND 3NG3A 1TPH1 3LHWA 2YLLA 3WY1A 1K7EA 3W7NA 1IGSA 4LUIA 3WD1A 2J6VA 1VC4A 3PULA 1YDYA 4UFKA 3SZ8A 2E6AA 3P2VA 1IIHA 5FF2A 4C6QA 1IE7C 3PS7A 2OZTA 3MCOA 2PP1A 3HPSA 1NSJA 4GX8A 4TVCA 1FX6A 1NOWA 2JEQA 3EA2A 2EXOA 5T9CE 2VCCA 3N3MA 4QLLA 1W5PA 3EDKA 1A0EA 3TYBA 1HJSA 3SRFA 1BG4A 1C9DA 3UETA 3KP0A 3CM4A 2XIQA 4UWMA 3LTSA 1E3ZA 2B81A 2XIJA 4YWSA 4X2PA 2PDPA 3E49A 1WZLA 5DCBA 3DC0A 3A9BA 5FJJA 1XGDA 5A5WA 4LAKA 1XP3A 1JCLA 1QNOA 1CB2A 1CI1A 3P84A 3U0HA 3EOEA 2A1YA 3DERA 3M9YA 4Y96A 3A3XA 3KLLA 2BP1A 4LBRA 4YYFA 2EJAA 3OZMA 4S3EA 1ZZMA 5AFDA 4O0KA 1H62A 2OQLA 3GDRA 3SY1A 7REQB 2VRQA 4K38A 2C79A 3PC0A 4KWUA 3W2LA 5BXSA 3S9YA 5FSDC 1K8ZA 4WHBA 3R25A 2QCDA 2QUMA 3PM6A 4ECLA 1KTNA 1A53A 2CLIA 3ZZ1A 2VRKA 2X7WA 2Y5JA 4C6FA 3TH6A 2CBJA 1AL8A 4JHOA 1G01A 4L65A 4UQEA 4OWGA 1XQKA 4AF0B 1XCWA 3QHOA 3E3HA 3NPVA 3UVAA 1CXFA 4TIMA 2QDHA 1VFFA 1KM6A 4RV8A 1DL3A 4A6GA 1VAHA 4TOQA 3C2OA 1FWDC 1PL9A 2IXVA 4F9JA 3UR5A 2PLMA 4HZ8A 1KFWA 1XKYA 2WXDM 1N8WA 2YA2A 4KCUA 2HMCA 1Q2SA 3SFKA 1GVEA 1W8SA 2G3FA 2XFYA 2R1PA 1N2VA 2D3LA 1HG3A 4L4LA 4AH7A 2VRJA 2E8YA 4ML4A 2R9RA 1VBGA 3VKJA 1V02A 3RGTA 4UTKA 4LU0A 4QSFA 3BAIA 2VEPA 1EZWA 2EBNA 4AAJA 1MFUA 4I7UA 2INEA 3II1A 2GWNA 3MUZ1 5ABFB 2VYOA 3M5ZA 2QPUA 2UWFA 3ABOA 3IGHX 4O17A 3LOTA 1EO5A 4J40A 4F0RA 3UERA 2R1KA 3PANA 3QKZA 4A8RA 2B31A 4K68A 4LUTA 3CEPA 3SDOA 2DGAA 4R9OA 5B7ZA 1KRBC 3QPZA 1S5MA 1F3EA 4GIEA 4LVFA 3A3WA 2QIWA 3N6JA 4QTGA 4IPIA 4RDYA 2FIQA 2BX7A 5D8WA 3FDGA 2YW4A 1P0NA 3AHVA 2VUNA 3WUGA 5AYYA 3LLXA 1C7TA 2NXIA 4P8WA 1K03A 1OCJA 1QPRA 2QLYA 2RHGA 3C2EA 4NZ4A 3E5PA 3L0KA 1B9BA 3Q58A 1XRTA 1BHGA 2Q02A 4DZHA 1PTDA 4PRTA 1TJRA 3CZEA 3UNDA 3DECA 1NWSA 4AD3A 3QN3A 1PX4A 1NH6A 3IVUA 3N4FA 5DN1A 1Q63A 4MJ4A 4LC6A 4ZCWA 2ATMA 1MRAA 1NQ6A 1UASA 3U8GA 3RF9A 3OODA 4UMBA 1O95A 1WUFA 2D2GA 2F6KA 3LZ3A 5G5IA 1WXYA 4HMEA 3BV7A 1GJPA 4Z08A 4MKNA 3OEXA 4L6HA 5CZ0A 3J7HA 1JFXA 3MUXA 1XYZA 2EPHA 5AZ0A 2RGMA 2VOMA 1V02E 3QFWA 2NUXA 4F0SA 4BWLA 2F8QA 1I2QA 4JPGA 3OU8A 1RBLA 1TYGA 2PRMA 3POCA 1DIDA 5FJPA 2CC0A 1FUYA 1X7IA 5I3DA 1E1CA 2GK1A 4JX5A 3OPSA 3NQBA 1B3WA 2PF8A 1HO1A 4JTSA 3QKEA 7ENLA 1OQFA 3N13A 2X05A 3W1NA 1LZOA 4TU1A 4D6JA 2ZUMA 3LXAA 1B5TA 3EWYA 3W73A 2Z2UA 3UXIA 1RLCL 3GIYA 3CGTA 1H11A 4MB1A 1CT5A 3KZPA 3IWPA 5KMYA 2HBVA 3RO6A 4PR4A 3M4HA 3VZYA 4W89A 3KOWA 4OUIA 2JALA 1GPFA 3DFSA 3NR0A 4OVXA 4V28A 4FA3A 2XVGA 2REQB 4W85A 5D2WA 4YHGA 3MI2A 3I3DA 1V3JA 4K3ZA 1PWMA 1XR2A 4H2CA 3VFCA 4MWAD 4M81A 3AMDA 4MNJA 5BRPA 3ZLFA 1HKKA 4OJYA 1DHKA 1S5WA 4N0RA 5DBTA 5I5RA 4ZL1A 2EHHA 2OZ0A 4LRTA 3ZM8A 2E6YA 5AC4A 2G4JA 1QW7A 5M3WA 1UA3A 1NVMA 1QPNA 3CAVA 3WIJA 1PSCA 4O8RA 3S1UA 4AZBA 1UC4A 3IIPA 3PJXA 3W7MA 4W87A 4POCA 1GJUA 5DMNA 1O68A 1C93A 3GC4A 2O9TA 1VFLA 2YDRA 3M1ZA 2O0TA 1X1NA 3TONA 5LIXX 3WBEA 3ONCA 3G77A 4PYSA 5DCEA 2BB0A 1LL7A 1W1YA 1SO6A 3R12A 1JDFA 3KVJA 1TCDA 3G22A 1P7TB 3RMEA 1N55A 3EB4A 4CU7A 4G7FA 4LF2A 3H4XA 3TV8A 1JCXA 5E0CA 2GJLA 4DWSA 1K9DA 1W3HA 2C91A 4JOMA 3L4YA 5HJLA 3WEZA 5HMFA 2JK2A 3WLLA 3RLUA 3K8KA 3V0SA 4V15A 1UJPA 2XVNA 3A23A 2FVMA 4XZMX 2FZDA 5AKQA 4QFUA 3QW3A 4E2OA 3KLKA 2GSJA 2WPBA 3STGA 5A8MA 1YNPA 7REQA 2ZFAA 3TEVA 1DBTA 4B5SA 4Z0SA 4EX4A 4PCFA 4R7WA 3KUMA 3WELA 1KTBA 1Q7MA 3LNMA 4AQLA 3H2AA 3BG9A 2WW5A 4EACA 3TN5A 3S9IA 1KXVA 3C2VA 1GUVA 1V6WA 1W3TA 3URBA 1YNYA 4GUJA 1KKRA 3AXHA 3NQDA 4WZHA 9CGTA 3LCGA 5DO8A 2YDAA 3FJLA 5CSYA 2J74A 3G1XA 2YR1A 1VPQA 1JYVA 5FCZA 4B9ZA 1K4HA 2FHFA 5LYRA 5C2XA 3HG5A 1XD1A 2XVKA 4M29A 4GUHA 3GVWA 4FB7A 1CIUA 1E9ZB 4FOUA 3L4XA 1OWQA 4FOJA 1ZPTA 3N3TA 3GNRA 3AQUA 4PSRA 2NQ9A 4IIGA 4YPJA 5IFTA 4BQ2A 4UNLA 4XD6A 1OT1A 5A2AA 2A3EA 3ZT5A 3UR8A