3MHUA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-nitroorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
307
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 107
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mhuA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mhuA01
2JGYA 1OYCA 4IMGA 1WBJA 4JXCA 2ZZ5A 2ZTKA 3LCGA 2QDGA 1EB3A 2ZBTA 1FWRA 3G8EA 1W0MA 2J88A 4LUIA 3KVLA 3IVUA 1ZY9A 3P8IA 3HQ1A 4FXSA 3HBLA 3TQVA 2ZZ3A 4X3ZA 1SSGA 4JDBA 3TU9A 4O13A 1TPFA 3G1FA 3NG3A 3SSJA 3IGSA 1W37A 4DF2A 2H3DA 4JTKA 1SU5A 3W2MA 1T8XA 4LU0A 1YTKA 1HTIA 1QFEA 2C18A 2G95A 1IXNA 3DGRA 3I68A 4QITA 3YPIA 2QJGA 3KRZA 4JR5A 3UWWA 3NQ2A 2ZZ7A 2QAFA 5D09A 3A22A 3PWAA 3EKLA 2FPYA 1I2PA 1Q45A 1K8XA 2VEIA 1VLIA 3QW3A 1P1XA 3W9ZA 3W71A 1DOSA 4XBSA 3C4UA 3P74A 1L6SA 2V2HA 3PF3A 5F4SA 4RZ5A 1Q6QA 3L5LA 1ALDA 1O5KA 2FB3A 2ISVA 2QUUA 4FIRA 5G2HA 4K7VA 3BGGA 2ZRYA 4BI7A 2DJLA 1FY6A 4O28A 4ZL1A 3W2UA 4ADSA 1MEWA 1G4PA 3NXFA 2WKJA 1GTEA 3G18A 1DL3A 1OFAA 1S3HA 5AOUA 2TYSA 4O1BA 3DFPA 2CLFA 3GK0A 3E12A 1KM0A 2V5LA 3HG2A 1QWGA 3B06A 2GJLA 1VYRA 3UYCA 4O10A 2W79A 1F2JA 1E51A 4O54A 3DFNA 4R34A 1W3NA 2PE4A 5G2IA 4DPPA 2ATMA 1VRDA 3N14A 3W7MA 2YSWA 1LOQA 3CLMA 4DQWA 1HO4A 2X1TA 3STEA 4DXVA 4NNCA 3PAJA 1K3UA 4NQ1A 4LVBA 2ZRZA 3W1LA 3HGSA 3LCLA 4O16A 4RZ4A 3DKLA 4AB4A 5D32A 3F4NA 5CZTA 1TV8A 2TPSA 1OX5A 4WXZA 1GOXA 3A21A 3O6CA 1TREA 1X6UA 1YXDA 3TK7A 1TRIA 3EXRA 1X7FA 4L4MA 4HN4A 4BWLA 2QCCA 1GJPA 1KM6A 4FXRA 3I65A 1ICPA 2WQPA 1TV5A 5LGXA 4NVTA 3W07A 5DCBA 2CZDA 1JCYA 3TJLA 3VE7A 3O8AA 2X16A 1BWLA 1PS9A 4UTHA 4Q32A 7TIMA 1ZNNA 3LB0A 4IX2A 4AAJA 3P82A 5HWNA 4YWIA 2H8XA 1NEYA 1G7UA 3USBA 4PL2A 2XN2A 3M43A 2XN1A 2WOQA 2Y63A 1G6CA 3R13A 5LHFA 1S5WA 4GC4A 2JKAA 5EY5A 2QF7A 1LZOA 1SW7A 2Y88A 3N34A 3DENA 2BX7A 4JTSA 3W1UA 1W3TA 3OA3A 1B4KA 4CCDA 3BW2A 2VFHA 2DZXA 3W7DA 3HPSA 1FWWA 3GYEA 3IIVA 3NZRA 3MP4A 1WOBA 1FUYA 3NPVA 3G1XA 3TNOA 4LTSA 2Y7GA 4OU1A 3H53A 4DO6A 1GG1A 3EWWA 4ONVA 3WFAA 3IIXA 1AW5A 3EEGA 3QSTA 3EX6A 3GAKA 1M7PA 5IBXC 1VYSX 4FIQA 2H3BA 4PH6A 3W7QA 3G8RA 3LV6A 2J6XA 2QCFA 3PC0A 2WNNA 3LOTA 2Q3RA 4PEKA 4O53A 1QPQA 4O17A 3UWQA 4O18A 2AGKA 2JGQA 4U28A 3RU6A 2GVLA 2QCGA 4LS0A 5HWJA 3S42A 1PHWA 3W70A 3WK2A 5LSMA 5E0KA 1JUEA 1QO2A 3I7RA 4DO4A 3VE9A 2Z0IA 4M7TA 3W7KA 2R94A 5J5RA 5DBTA 4GUHA 2E6FA 2E5CA 2DZSA 2RDUA 3NEVA 1DHPA 1ZCOA 2V2DA 3ABQA 2CZFA 3GDKA 1WYIA 1ME7A 2I14A 4UFLA 4LWWA 2B0MA 1SW0A 1GYNA 5HUPA 2A0NA 1J4EA 1P4CA 3KXQA 4PODA 3C56A 3DZ1A 3EWYA 4OQVA 3QF0A 1FCUA 2OX1A 2OZ0A 3Q37A 5DLCA 3MBDA 1I8JA 3EX4A 1XDMA 4LOCA 4I7WA 3LV5A 3W7GA 2FLIA 4BK9A 2GJNA 3IEBA 4LV9A 1H7OA 1DKWA 1LBMA 1A5BA 2V9DA 3FYOA 1R46A 3W88A 1F7BA 1R47A 3C8FA 3G0XA 5LHEA 3LBMA 1IXOA 1J5TA 1UBSA 2Z1BA 1QPRA 4M5PA 4GUFA 5DY3A 4J9JA 2ZCGA 1WA3A 3PM6A 1LTDA 3UNDA 2V5BA 3MYOA 2ZRWA 3O06A 3G0UA 3TE9A 3OG3A 3PBWA 2PURA 3TA6A 4S2BA 3DI0A 3TMLA 1EUNA 1GVQA 3MI3A 5HR6A 4K37A 4AWTA 3I6RA 1X1ZA 1H63A 4O1CA 5BOOA 4RV8A 3MHUA 3W7OA 3EX3A 3GDTA 3SW6A 1OFDA 2C1HA 4GXMA 1ME9A 3T7VA 2CLLA 3HGRA 5AHFA 4WY0A 1PVNA 4TU1A 5CZJA 5FEWA 1DQWA 5K2ZA 2C16A 3PS7A 5LNWA 4K36A 4O11A 4N6FA 3W1PA 2DZTA 3CIXA 2CLMA 3TJXA 4H4IA 4MZ8A 1Q6OA 3C3NA 4JTTA 3U8GA 3S1UA 4JTFA 3HOJA 4MJZA 1EUAA 2HTMA 4LV4A 3N9RA 3FJ6A 5DY2A 1ZHAA 1K02A 4IMDA 3DH7A 2AQWA 1ZENA 5AHLA 1AW2A 1J2WA 2E5BA 2Q3OA 1F6KA 4LS2A 4Z0SA 4AVFA 3MJYA 1PV8A 1SO6A 5BMWA 3CU2A 4TO8A 3HB9A 3IIZA 1TJRA 1TPC1 2CWNA 2FTPA 2E68A 2CU0A 4UMAA 3M5XA 4FO4A 2QEZA 4ZQRA 4IXXA 3NOEA 4H3DA 2QKFA 2VFDA 3L68A 1W3IA 4DELA 5G4WA 1OFRA 1TTJA 3QQ1A 4N02A 5F4XA 3BW4A 4JTLA 3G1AA 3HPXA 5H91A 4FEZA 2QUVA 1DQXA 5E1QA 4QM1A 1XBXA 5D05A 2YX0A 2VFFA 3QMTA 4AXKA 2A7RA 3BARA 1I4NA 1ZFJA 2PCQA 5KZEA 2EF9A 2FDSA 1FDYA 2C0AA 4O0ZA 5C54A 3HMJG 3DXIA 1XBZA 3F1QA 3DFSA 4AHPA 4DF1A 3I7QA 5C55A 1VC4A 5DCDA 3A5VA 5DCEA 4HPXA 1T96A 4OV4A 3GNNA 4CQ8A 3TFXA 2CLKA 2ZRVA 1JCXA 3QH2A 4P2VA 4GNJA 1XKYA 1EIXA 3STCA 2E1DA 4JX6A 3BV4A 4GBUA 3UPWA 4RLIA 2QCHA 3PUOA 1YDOA 2Q8ZA 2RH9A 2CZEA 1ZAHA 1Z41A 3LI0A 4JX5A 5J5DA 3PSWA 3NR0A 3W7JA 2OT1A 1VHNA 4Z1CA 3C2FA 3S5ZA 3TR2A 3TW7A 2WSRA 2A21A 3F4WA 1FXQA 5CSRA 1WBHA 2BSLA 3LGEA 3NDOA 4BI5A 3W1RA 3E49A 3DI1A 2EPHA 1MZHA 1BEUA 5G1YA 3BVJA 1FQ0A 1OFOA 3MHGA 3S1VA 3OHIA 1YLVA 4KWWA 3G1HA 3HIJA 4QNWA 3DKJA 1Z42A 3O07A 4UTJA 2ZZ2A 4PL1A 4GFSA 3C52A 4HPJA 1UASA 3VI2A 1JCLA 3Q58A 2J9YA 2H8ZA 4JDYA 3W7HA 3LLFA 3LTSA 4MYXA 1FWNA 2ZDRA 1ONRA 2QCEA 4D2JA 3EB2A 1C8VA 3DBPA 1B4EA 3PUEA 1TJPA 5AYXA 2ZZ4A 1OVDA 3S5YA 3M47A 2C19A 1EP2A 2RDWA 1G67A 2A85A 5IM51 1VJIA 5DN1A 4UTLA 3SGZA 2RKXA 3G22A 4JTEA 1EWDA 3UZJA 2R14A 3ELFA 4XWUA 4XTIA 4XKYA 4A3UA 1CW2A 1LRTA 3O63A 1L6WA 2NUYA 4POCA 2NV1A 4BR1A 4Z1BA 1QO5A 2I1OA 2W6RA 1FXPA 3M9YA 5TBOA 4WQ6A 3W7CA 3HG5A 4EIVA 4TIMA 3W2KA 5CG7A 3O16A 1KW1A 2Y7DA 1FWSA 1BWKA 2ZA1A 3TH6A 1WOAA 2QCDA 1TQJA 5AC6A 4R53A 3LTYA 3TUUA 2HMCA 1LDCA 4IWWA 3H54A 1JRBA 4NJIA 3M5VA 4QNEA 2C14A 1IF2A 3C2VA 4UUIA 5AFDA 1NSJA 2YW4A 2ZRXA 4UR7A 2DZUA 4X2RA 1KM1A 1XC4A 4JIPA 3RLUA 5U4NA 1TCDA 3NZ1A 5U7SA 4UXDA 5F1VA 3BG9A 3LRMA 2V8ZA 2A4AA 2Y89A 1XM3A 4UTUA 3NNTA 1U83A 3LCHA 4JTHA 1NVMA 1TPVA 3OVPA 1YDVA 2BXVA 2VXNA 1IIHA 1KFKA 5KZMA 4TR9A 5AHNA 3PBVA 1TMHA 3V1PA 5I3IA 4MFDA 5BNKA 3B04A 1HL2A 1UCWA 4O52A 5G4EA 5L9FA 1CI1A 3FIGA 4MZ1A 3THQA 1MEIA 3QPZA 2CLIA 5K4XA 1AMKA 3HG4A 3ZR4A 2XFWA 2FB2A 5HNRA 1TYGA 1LLZA 3P84A 4AF0A 3GKAA 3FKRA 2CW6A 3PULA 1LBFA 3KRUA 5HQEA 5DXYA 4UFKA 4MIMA 5I3JA 2C15A 2EKCA 4S2CA 2NZLA 5K9XA 3QPYA 1VR6A 3NPWA 1YTEA 3O6DA 3BLFA 1KM3A 4NT0A 4KFPA 2P0OA 5ABTA 2I9EA 3EKZA 1TV7A 3L9CA 5FEZA 1H60A 1MXSA 2V81A 3TSBA 2H90A 1RPXA 3MI6A 3KRSA 4DBDA 3SJ3A 1QAPA 2OCZA 4CCCA 3EX1A 3BG3A 5F2GA 2O7SA 3KHJA 5D2VA 1TPEA 4ZQPA 3N2XA 1W31A 3C2OA 3NL2A 2YXGA 5L6UA 4QQ3A 2ABAA 4YLWA 4UTTA 3G1SA 3W1AA 1VCVA 4NNAA 4GWEA 3BO9A 1FCBA 3P67A 4IPIA 5CZSA 1MSSA 1DORA 5I3GA 1P0KA 3RFAA 2GVGA 3TROA 3M6YA 3W1MA 4MKNA 4MZYA 4RXFA 1SO4A 3PUDA 3N2MA 1MO0A 3CEUA 3NPUA 3KOFA 2HSAA 3A23A 3NQ6A 2NX9A 4IXHA 4LVGA 1PE1A 1NF0A 4E38A 3P5YA 2X2GA 5D37A 4K8HA 3MHFA 4WOZA 1XBYA 4PA8A 4Q4KA 4JTGA 3M5YA 5A5WA 3Q2DA 2WNQA 4O4VA 2ALDA 1K8YA 1Z44A 1N55A 2JKEA 3W7EA 5LNUA 3OIXA 4FNQA 5HULA 2VEMA 1F74A 3W7PA 1S5VA 1SO3A 4X9SA 2QJHA 3JR2A 1QR7A 3BPWA 3IVTA 4EF8A 1XUUA 3C2EA 3A5FA 3C2RA 2PRMA 4XTDA 5G5IA 4LRTA 1GQNA 5K7JA 1OYBA 4GRSA 4JICA 3BW3A 2FIQA 4UTIA 3U6WA 3W1NA 2VEPA 1VPXA 3GVGA 2GVJA 1KFEA 4LUJA 4NX5A 3UWVA 4RXGA 2F84A 3A9IA 3VFLA 2CLEA 4MPQA 2C6QA 4CNOA 3IVSA 3NQ8A 1OF6A 3UPBA 2VFEA 1VLWA 1O5XA 2O7QA 4P61A 3IIOA 5K3VA 1T99A 1R2SA 3KVKA 5C5YA 1XUZA 4OHQA 4JY8A 4OE7A 3WK0A 4HNVA 1TTPA 3TV8A 3B0UX 1IXQA 1RV8A 1VZWA 3MW7A 3NM3A 1YXYA 4N2YA 3UY7A 4CNPA 3GLCA 3EXTA 3C61A 2FFCA 3NQAA 3T4CA 1P5BA 2NXIA 4MFEA 2BWGA 3NPXA 4ZMGA 4O4WA 3TC6A 3UWZA 4NJHA 3PR2A 5FI8A 3S0CA 2ZZ1A 4RK8A 1W5OA 5T26A 4K39A 2VFGA 3S5NA 4WXYA 3F03K 1GWJA 5CPMA 4DPQA 2V82A 3P7YA 1G4TA 3L0NA 3LHVA 3L5AA 4W9TA 3W6YA 1OK6A 2NXHA 2V2CA 4RCXA 1K7EA 3MP3A 3TXZA 1G4SA 2QUTA 4HSNA 4LVFA 4BWLC 4QJ1A 1FX6A 1EP3A 1L2UA 3GX9A 2ZYFA 1N7KA 4RR4A 1W5PA 3FJLA 1TQXA 2YFNA 3BK0A 1KBIA 4XBKA 1KLZA 3MUXA 2E6DA 4UMCA 1XDLA 3IGUA 4A22A 4Y9AA 1Z48A 1EX5A 1OFBA 3GNDA 4MLJA 1OX4A 1EP1A 1H51A 4NU7A 1VYPX 3OEXA 1H7RA 4FX7A 3CPRA 2YCEA 2GQ9A 1GVSA 1OABA 2B7OA 3HPZA 1TPUA 1JCNA 4UFHA 4KKXA 4RZ6A 1W5NA 1ZALA 1JQXA 4Z1AA 5F2MA 3C0JA 4YXGA 1ME8A 3R12A 2NXGA 3HGJA 4N9BA 2ZA2A 3TSMA 4AF0B 1OHLA 1PCWA 2NWRA 4O12A 1QDSA 2WSYA 4OBTA 1OFEA 2DZPA 3W7IA 4EOUA 1WDWA 1PHQA 4DO5A 4HNUA 2E5DA 3DFQA 1FCVA 3NYZA 3TW6A 3W86A 4MUZA 4NUWA 1DJQA 2PRLA 4KFOA 4QSHA 3ZWSA 1B9BA 2WSQA 2J24A 2YPIA 1THFD 3QMSA 2BTMA 5F2LA 1VH7A 2YR1A 1OYAA 2LLEA 3FOKA 1EEPA 4KFNA 2Z2UA 2VKZG 5EMUA 2V30A 4ZQNA 4JIQA 3L0KA 3UWUA 5LNVA 3UZ5A 4A29A 3G1YA 1H5YA 3UY8A 3V75A 3NL3A 4AEOA 4AWUA 1I2OA 4Z08A 2B7QA 4O0KA 1GPWA 2CZ5A 2QAPA 3TSDA 3NQGA 1TPH1 4BF9A 3LM7A 2P1FA 1JULA 4LNYA 4RJEA 1I45A 4UIOA 4Z1DA 3ZFHA 1LRNA 3G0SA 5KINA 3A24A 4S1FA 3CTLA 5K9CA 2YYTA 4UR8A 1W54A 2CLHA 3QW4B 4UTKA 1TIMA 1K03A 5LKYA 1EWEA 4UTWC 5KTLA 1A5AA 2RHGA 1KFBA 3OVQA 1AL8A 4IMFA 3G24A 2KZHA 1X1OA 3LCFA 1YPIA 3B0VC 1WX0A 3G1DA 3JS3A 1BKSA 1PIIA 4N4PA 3M16A 1UUOA 3T40A 1GVRA 3NQDA 4NJJA 2A1YA 3E0IA 4MY8A 3LRLA 1H7PA 3L66A 3E02A 3HG3A 5TQLA 4Y8FA 3E9AA 3FLUA 3WJWA 5BRBA 5EKYA 1LRQA 2F7FA 2ISSA 1LBLA 1SPQA 3LLDA 3PB2A 3S5OA 2OJPA 4CCEA 3EWUA 4IPJA 4JYEA 3ZWTA 1UJPA 4I9AA 4E2BA 1GZGA 3AJXA 1W1ZA 3LXCA 4FX6M 4R33A 2Y62A 3CB8A 5FESA 1LLWA 3ANYA 4YCOA 4H6KA 3UD6A 1FBAA 1KM5A 1SFLA 3QQ0A 3P81A 3MP5A 5CKSA 1I2RA 1ZAJA 4AHOA 4L4LA 3N19B 5I3KA 2ZQ0A 3NQCA 4LVAA 1YYAA 2FPVA 3QZEA 1T0OA 3MI2A 2DZWA 4UCGA 1GTHA 4ZQOA 3PG9A 3ABSA 1GVOA 2QR6A 1TO3A 4BI6A 2B4GA 3CWNA 4N6EA 1KBJA 4HIBA 5EYWA 3TQKA 2FPTA 1LYXA 5DXXA 3LHZA 3BLIA 5HUOA 3WK3A 4TMBA 1L9WA 3RLVA 5AC7A 1RQEA 3GKFA 4FF7A 4HT3A 4LY8A 1QPNA 4QISA 4EWND 2W0UA 5AB3A 1WXJA 2J27A 3MYPA 4MY1A 3VKJA 4O50A 3M5ZA 4N9CA 4O14A 3TMQA 3W2LA 2E09A 3W1TA 1JJKA 2X1UA 4HKPA 3SECA 1IGSA 3SFKA 5K9DA 2C13A 4FNPA 2RFGA 3W1QA 1RR2A 1O95A 3RK8A 5C2XA 3CT7A 3W7NA 1H7XA 4OWGA 5BMXA 5BW6A 1NF7A 3LX9A 1G7VA 1N8FA 2WV8A 4M6PA 3W83A 2OMAA 4NZFA 5LNSA 1QOQA 5F2IA 1HO1A 2GPTA 1ICSA 4JX4A 5HINA 1QMLA 2Y6ZA 2X30A 3UWYA 1PL9A 2AAMA 1QOPA 1V7YA 1JCJA 3LCXA 5CSSA 2D73A 1HUVA 5A8GA 2Y7EA 3FFSA 4ADUA 3BLEA 2YFOA 4DEFA 4UNKA 1IIGA 3C6CA 2TRSA 3GR7A 2NUWA 5D04C 3E96A 1A5SA 5AHIA 4MVAA 3FS2A 3M7WA 3QRHA 5CPNA 1UB3A 2DORA 3LCWA 1QPOA 3DHDA 1Q3NA 2QCNA 3THAA 5C6MA 3W3OA 3TAOA 3DFTA 1UUMA 3P62A 4LW7A 4WY0B 2Q8LA 3MO7A 2QCLA 4K8EA 1SZGA 5AHEA 1G69A 3KAOA 2A6LA 2VC6A 5D38A 3P80A 3LHWA 3S9YA 4NZJA 1NAL1 3L21A 5D2WA 1TPWA 2A6NA 5DELA 3W7LA 4PC8A 4ICNA 3HGOA 1Y0EA 3W7RA 4HSOA 1MEHA 2P10A 4NJGA 2BZNA 2A7NA 4XZ9A 5HWMA 5KITA 3KFTA 3NAVA 2VOMA 3VCRA 2ZZ6A 4M6VA 3MMTA 4CLMA 1KTCA 1H50A 4GUGA 4IOTA 3LI1A 4IJBA 1DJNA 3Q94A 4WUIA 6TIMA 4TMCA 1KTNA 4ML9A 1RQBA 3W72A 3R2GA 4PFMA 3GXPA 3SZ8A 4O57A 1R2TA 1A50A 3DFOA 2EHHA 4O1AA 1AG1O 5IBXA 1RVGA 4IMCA 2Y70A 4WY0F 2VELA 4N9EA 1VHCA 3NQFA 3R5EA 3ZS4A 4B5NA 3NL6A 5GVJA 1S5TA 3KX6A 2R91A 3TX9A 4MYAA 4OGZA 2G97A 1O94A 4RX0A 3LHTA 2JKPA 1W8SA 8TIMA 4G1KA 4AH7A 5CPOA 3AO0A 5EL1A 5MHBA 1KFLA 1VS1A 3BGJA 2G96A 3GZ3A 3FA5A 3N9SA 1WV2A 4C1KA 5D03A 4YL2A 3KVMA 2Y7FA 3GXNA 1SFJA 3WJZA 3NM1A 4AMAA 5FEXA 1V5XA 1KLYA 2QCMA 3ABRA 1XL9A 4MJMA 4YCPA 4MOZA 3NQ7A 4IX0A 4RKAA 1SSDA 3K30A 1ZJIA 1GT8A 1AL7A 1VCFA 2ATSA 5FF3A 2YGYA 2YZRA 4IGHA 4PCFA 4AHQA 1QNVA 3PSVA 3OVRA 3W22A 3L2IA 1H61A 1WAUA 1OFQA 3M41A 1EA0A 4WOQA 2GQ8A 3SIZA 1YADA 1KA9F 2NLIA 4LC6A 4MY9A 1LCOA 3BG5A 4FNTA 1KFCA 4NXSA 2ZRUA 2NUXA 1XFBA 2RDTA 4ZVJA 2E77A 3CWOX 4WX2A 3SY5A 2CFFA 1F05A 4Y6GA 2R8WA 1XI3A 1ICQA 1JUKA 2NX3A 1PCKA 1VCGA 1RD5A 3QMRA 5F1UA 3S1WA 4M7SA 2GOUA 3ATYA 2WPBA 2WNZA 1D3HA 1KM4A 1OX6A 5I3HA 1IXPA 1OK4A 3QM3A 5HR7A 4ORMA 4R7JA 2B7NA 3CQ0A 4WD0A 1Q6LA 2HS6A 3GAYA 4YMZA 3CM4A 3NL5A 1W5MA 3RMJA 3UQNA 1LORA 1ML1A 3U2OA 1H1YA 4AWSA 5H2ZA 5LZLA 4Q33A 4XKYB 3NQEA 1O4UA 2Y85A 2EGZA 4O15A 1H7NA 3TAKA 4HHPA 1LP6A 3W73A 1TPDA 2UV8G 1K8ZA 1XCFA 3D0CA 4JD4A 4EVZA 2J9XA 1FDJA 3LRKA 3LERA 5D33A 1F5ZA 3L65A 5LGZA 3B0PA 3B4UA 4OT7A 1JRCA 5DBUA 5D2TA 1X8FA 3P61A 4K6AA 3CHVA 3S1XA 1LROA 1M5WA 4JY9A 2DU2A 1VQTA 2QCDB 1TTIA 2C3ZA 3W87A 3TFCA 3QC3A 1SW3A 3SR7A 4UTTC 3W84A 3G3DA 1M7OA 3GDMA 4QIUA 3PBUA 4XQ6A 4XUGA 4UFMA 2J9ZA 2NX1A 5KMYA 3GXTA 2H6RA 2E6YA 3ATZA 3O1NA 4U4MA 1FWTA 4A21A 2JK2A 4Z0JA 4IMEA 4UTMA 1F6PA 2CLOA 4CQ9A 2QJIA 5KSWA 1CX9A 3B05A 3PG8A 3ABOA 3CEPA 1HFBA 3NO5A 3W1XA 1NFBA 4UTWA 1SZFA 4X22A 2YYUA 5I3FA 5F4WA 1DV7A 3MBFA 5CZ0A 3T55A 4JYFA 2PC4A 3STFA 3L0GA 2NWSA 1EPXA 1B3OA 4ADTA 4LC8A 3FEMA 4HNTA 4K7YA 3T78A 2A7PA 4CQAA 3CIWA 1Q6RA 1M6JA 3LHYA 2Z6JA 3EX2A 1JQVA 2VENA 2DZVA 2B7PA 5FF4A 5HMSA 5D30A 3LCIA 4LT9A 5EPDA 2EAWA 3MWAA 2WO5A 6ALDA 5AHMA 3DAQA 3FYPA 1OFPA 4N4QA 3B03A 2G5WA 5KZDA 3N3MA 3O6YX 4GE8A 1B57A 4ZQCA 3CC1A 1RZMA 1XBVA 1TRDA 4FNUA 1H7WA 3QYQA 3PB0A 5E93A 4OV9A 4JEQA 3W85A 3IGXA 1K7FA 4NJKA 1I2NA 1YDNA 3RNDA 1D9EA 2DJXA 1GVFA 3T44A 2FQIA 2NV2A 2IQTA 2X1RA 1A53A 4K38A 3WJXA 1C9DA 1JUBA 5AC8A 2ZFAA 1RQHA 2YW3A 1SR9A 3W74A 2TSYA 3HO8A 3W75A 2JBMA 4GUJA 5FF0A 3I7SA 1GYLA 3OBKA 5D2XA 1WQ5A 1TTQA 1JCMP 1R2RA 4EF9A 4E0CA 3NGJA 3G3MA 1LM1A 1K7XA 2ISWA 3QJAA 1DVJA 2VEKA 3NVTA 4M6QA 3L5MA 3W23A 3L67A 1ADOA 3R8RA 4LVDA 4UFIA 5AYZA 4I7UA 1D3GA 1TPB1 4WZHA 3M0ZA 3PBYA 1HG3A 2XN0A 3QEZA 4UFJA 2ABBA 5D2YA 3W2NA 3LDVA 1DBTA 5HJLA 3SGUA 1SQ7A 1BTMA 2X1SA 2ZA3A 1U5JA 3R89A 4JYDA 3TCEA 4JNMA 3JRKA 3LHUA 1R30A 3P5ZA 4A2SA 1JR1A 1QCWA 1OF8A 4Y96A 3TIMA 3O15A 2DP3A 4HNNA 4E2DA 3STGA 1FCQA 2YDAA 3P8JA 5CPLA 3EWBX 4IUOA 3TXVA 4ZQMA 1W5QA 1F73A 3VNDA 3N73A 3GIYA 3TKFA 1KV8A 1YXCA 3KVJA 4LRSA 1O60A 4I7VA 3FKKA 3GR8A 1L6YA 2VFIA 3M1ZA 4NXKA 3EWXA 1TB3A 4ZZ9A 2V0TA 2E6AA 5G2WA 2A5HA 3LXBA 4FNRA 1AK5A 1KV5A 3M44A 2HS8A 3O05A 5K4ZA 1G4EA 1KTBA 1SUXA 2Y61A 4ALDA 4BFAA 3UXDA 3WJSA 4QAIA 4JN6A 1TSIA 4C1LA 1AW1A 4DBEA 2GQAA 2QDHA 3QFEA 1ZAIA 2FJKA 4KWVA 4NX0A 4O19A 4ORIA 4FX8A 1KFJA 1YTDA 3SI9A 1C29A 3TDFA 3EWZA 3W76A 1GEQA 1OG0A 4UMBA 4FNSA 4O1DA 2TMDA 1FDZA 4FB7A 5FF2A 1F76A 1JVNA 3LBCA 3DHFA 4LS1A 3IIPA 5D02A 4O8RA 3WJYA 1XXXA 3GDRA 3IRDA 5LNRA 3EXSA 3B8DA 3TQ0A 5AYYA 2GUUA 3WK1A 3NQVA 4IQLA 3GB6A 4A2RA 1KM2A 1SZNA 3LXAA 1GG0A 1I2QA 3W2JA 4CNNA 3TC7A 1LOSA 4GJ1A 2WJZA 3DU0A 4JGDA 4JTUA 1H1ZA 2PRHA 4NNBA 5AN7A 3GDLA 3HJZA 4GUIA 2OT0A 4PTNA 4WJEA 5SWUA 5FF7A 4DF0A 3S8HA 5G1TA 2A2IA 3H55A 1OX4B 3UXAA 3S6DA 1OJXA 3NA8A 4MLRA 4TX9A 1SO5A 2Z6IA 4JTJA 1H62A 4UNLA 1LOLA 5FEPA 1YPFA 3HF3A 3IV3A 1P0NA 4JTIA 3NQMA 3RF9A 4UC5A 4M19A 1VGAA 1W56A 2BLEA 1A5CA 4N9DA 4Y90A 3PY2A 5EBUA 5EA9A 5TIMA 5CGQA 1SZEA 3P60A 4JS3A 4FHAA 3QSRA 3PVFA 3INPA 3G1VA 2ZTJA 3LTPA
chains in the Genus database with same CATH superfamily
2JGYA 1V3IA 3SAZA 2L5HA 1WBJA 4IMGA 2ZTKA 3LCGA 3SURA 2BVTA 4WDUA 4ZO8A 1OEPA 3WQPA 2YOCA 1V0NA 3G8EA 2V5DA 3WQFA 2J88A 3TWBA 2A3HA 3BAWA 3GE7A 5CAKA 3TQVA 4X3ZA 4JDBA 2BGNE 1I9CB 4H7CA 4PB5A 4GZ7A 4JTKA 1JDDA 3W2MA 1HTIA 4JKKA 2G95A 1IXNA 3DGRA 3YPIA 5C9WA 5MKGA 1L8NA 3NQ2A 4BY3A 3EKLA 1Q45A 2WJEA 2PDLA 2GYIA 3IJIA 3HV8A 1P1XA 1QBBA 3WUGA 3MKKA 3P74A 3WFLA 2Z00A 5F4SA 3MSDA 1W32A 2BXYA 4LAUA 1ALDA 2FB3A 3QKZA 3BGGA 4BI7A 2J4GA 2P50A 4QEEA 2DJLA 1FY6A 1H3GA 2YKKA 4ZL1A 3A6OA 1MEWA 3NXFA 3G18A 1MWOA 3KBWA 3VKDA 4O1BA 2V5JA 4P8WA 1EQPA 1DJGA 4R7WA 1UROA 1QWGA 1GHSA 1L8PA 2BOGX 2DT0A 4O10A 4CU7A 2J77A 4DPPA 2GSJA 4GQQA 3WLOA 2Z2AA 2NT0A 3CT2A 2R82A 2RAGA 3GW3A 4NNCA 3PAJA 4FLOA 4NAFB 1P0DA 4PEEA 3SQLA 3HGSA 4O16A 2Y8UA 3U5YA 3L7RA 1U5HA 4AB4A 5D32A 1EJXC 4GIAA 1KWGA 1OX5A 2A3BA 4Q8MA 3VOJA 2O55A 2XINA 3RX4A 7PTDA 1GOXA 2P5NA 3RRXA 3O6CA 1QNQA 2FVKA 4JIEA 2XVPA 4RV3A 4A3QA 4Q4QA 1OGSA 1KM6A 3I65A 3QTGA 2PTWA 3VX0A 2GVYA 4M8UA 5LGXA 1CXEA 1Z9AA 3VOFA 4Q4RA 1FHLA 4H8UA 4JHOA 4DUWA 1OCQA 1B3YA 7TIMA 3ARTA 1ZNNA 2X42A 3MS8A 3P82A 3NCOA 4MAZA 4HHLA 2MNRA 1G7UA 3UJSA 1A4LA 4UQDA 3SB0A 1UP2A 2XN1A 2Y63A 4IP5A 3QHOA 4PSRA 1PPIA 2QF7A 3GIPA 5H8PA 1LZOA 1SW7A 3AC0A 2QJJA 1K77A 4JTSA 4YNGA 1FP9A 1EJTC 1X6LA 5DMLA 4DZ5A 3BW2A 3RPMA 2VFHA 2CIPA 2QHAA 1ESWA 3QLLA 3UR2A 3DG3A 1FWWA 3IIVA 1E4NA 1T40A 2QULA 3BDKA 1WOBA 5M5DA 1JFHA 3G6LA 4OU1A 3NO1A 3UG4A 3SRFA 4ONVA 4IISA 2I17A 3M0JA 4UQCA 1FTXA 3BLLA 1M7PA 3HFYA 2FGLA 1Z7AA 4GH3A 4FIQA 2H3BA 3VTRA 2XVKA 2WZEA 3MSGA 3UWQA 3ABZA 2IKHA 3BAKA 1P6WA 3CMJA 2JGQA 1AQ0A 3AZRA 3RU6A 4HNLA 3W70A 2NQZA 3WK2A 2QVNA 1GQIA 4L4PA 5E0KA 3I7RA 4XAZA 4C6CA 3VE9A 2Z0IA 4IHCA 1EDQA 1J01A 1P0BA 2R94A 3S3GA 2FHCA 2E5CA 1QHZA 3BQ5A 3NEVA 1ZCOA 4B4HA 3BICA 3N4AA 2I14A 4UFLA 4LWWA 3VIOA 4F9JA 2B0MA 1GOWA 5JBEA 1J4EA 4K1WA 1WZMA 4AZIA 3DZ1A 3AHVA 1UW9A 3R94A 4H6RA 2OZ0A 1XRTA 1C90A 4IQEA 4IPPA 1XIMA 3MBDA 3WNKA 1TG7A 3LV5A 3W7GA 2FLIA 4BK9A 1GW1A 3WQ8A 1EC8A 4LV9A 1LT8A 3C8NA 2BFGA 4GX8A 3DERA 1R46A 1VFLA 4TUFA 4GUFA 5DY3A 2ZCGA 3JVAA 3PM6A 3NZGA 1LTDA 1QTWA 5B7ZA 3OG3A 3PBWA 1A5NC 1W3LA 2D2OA 2PBOA 2J78A 3DI0A 3NSXA 2ZUSA 3KBNA 2SFPA 1X1ZA 3TTQA 5BOOA 3LQLA 3VIGA 1AQMA 5AVHA 2Z1VA 1LUCB 1J0IA 3PWIA 1OFDA 5AYBA 2C1HA 1ME9A 3KS5A 8XIMA 3T7VA 3GFXA 5TD4A 3HGRA 2CXGA 4TU1A 3CH9A 5FEWA 3AUOA 1FVPA 4O11A 3EDKA 2F61A 4N6FA 3H21A 4ICMA 2CLMA 3BAXA 2OSYA 5FOOA 1NDVA 4MJZA 3V1HA 1V6TA 1EUAA 2HTMA 4PTMA 2V3DA 3VIHA 1P43A 1ZHAA 2Z2BA 3CBWA 4EE9A 1XF0A 4IMDA 2VX5A 1XPGA 3DH7A 2YXOA 3BQ6A 5AHLA 3CL6A 1AW2A 1BYBA 4GACA 1F6KA 4LS2A 1JZ3A 5A95A 1AODA 5CSYA 1NELA 1XYBA 5BMWA 2PWHA 1LF1A 2X7VA 3IIZA 4J2MA 2PDJA 2CWNA 4ZSUA 2CU0A 3NFUA 2QEZA 4IXXA 3NOEA 4J3WA 1S2UA 3E0WA 3QOKA 4QROA 4KRTA 5G4WA 3TYBA 3RN6A 4MNKA 5CH9A 4HK6A 2CBIA 1FKXA 1TTJA 3QQ1A 3QVQA 5F4XA 4E2VA 5C7HA 3G1AA 2F6XA 1DQXA 1DIKA 2YA0A 3ZVHA 3UNTA 1XG3A 5D05A 1S1RA 4Y8EA 4B9ZA 1I4NA 3BZJA 4X60A 2FHFA 2ZUNA 4KEZA 2EPKX 4B91A 3F1QA 3MCMA 1R87A 1I0BA 1WE5A 4QE4A 3A3WA 2XSXA 1Q6DA 4KMQA 1YRRA 1VC4A 3U4FA 3U0HA 3A5VA 3B8UA 3ITTA 1T96A 1AZ1A 2QW5A 3N4FA 3VGDA 4H7ZA 1W1VA 1XKYA 3UPWA 4LBRA 4FPSA 2Q8ZA 2JEPA 5I23A 3ENLA 4NZ5A 3VNJA 4IH3A 1Z41A 3QZ6A 2OZTA 4TV6A 5J5DA 3NR0A 2GL5A 1RLDA 2QV5A 3M6DA 4Z1CA 3TW7A 4Y9NA 3VFCA 3XISA 1AH0A 1RD6A 2DSKA 1FXQA 5CSRA 3H7VA 1A3HA 3UR7A 4BI5A 3W1RA 3E49A 3JUGA 3R7MA 1MZHA 4W84A 5G1YA 1S38A 4KWWA 1QPKA 1K9DA 4UTJA 1HKIA 1XV8A 5H1WA 2O92A 3VI2A 3Q58A 4XK2A 2HDJA 1FWNA 1ONRA 5EU9A 4ZO6A 4D2JA 1RLCL 4A3HA 2GLKA 4N7QA 5E09A 1TJPA 3BTNA 1KXVA 1YKWA 1OVDA 4J27A 2PWDA 2ZXDA 4NG3A 2C19A 2RDWA 3H24A 1KBKA 2A85A 3IJDA 1VJIA 3EOUA 2AL1A 4HQVA 7XIMA 1ZS2A 3ELFA 4XWUA 4ZFMA 1CW2A 3T8LA 4D9PA 4HU4A 3VGFA 3AYSA 3EA2A 4HU8A 3AIVA 3G6MA 2DIJA 3M9YA 3M64A 3ARZA 4S3KA 1G5AA 4H9UA 3UJRA 2PLKA 1JYNA 4JFSA 5BRQA 4PCPA 1BWKA 3E5PA 3TH6A 4FXJA 5BXTA 3LTYA 3W4RA 1ZCCA 1BYAA 4X63A 2HMCA 2WNWA 4IWWA 3LN3A 1JRBA 3NEHA 2ZVRA 4P7LA 1UKQA 1M65A 3EWCA 2YW4A 4UWMA 3M7SA 4C6NA 3FA4A 3R6IA 3CZLA 3U7VA 3BG9A 1D2KA 3LRMA 1UP3A 1RVKA 1XX1A 5AZ0A 1GOIA 2V8ZA 4G5DA 2VYOA 3NNTA 1HKJA 4JTHA 1DJZA 1TPVA 1H41A 2WZTA 2VXNA 1IIHA 2E1WA 5KZMA 3CIVA 3WUFA 1IZCA 1TMHA 4MFDA 1BHGA 3F2DA 3FIGA 4GY7A 3THQA 5K4XA 2V67A 1EEXA 1C93A 5I7GA 2PDPA 4AF0A 3ZYZA 3N2CA 3KRUA 5HQEA 5LIUX 1TVLA 1KXTA 2GJPA 3F4CA 4QXIA 4KETA 4DJDC 5I3JA 2C15A 4S2CA 4OVXA 1HL9A 2NZLA 1SM9A 3I6EA 2J47A 1Z32X 3TYAA 3PN8A 4KFPA 1NFGA 4I9JA 4NAEA 1EKOA 1EPVA 1PZ3A 1MXSA 2I5QA 1YHTA 2XIBA 4DBDA 3SJ3A 2OCZA 2CHOA 3W0KA 5HMEA 3VD5A 3DYMA 3N2XA 5HATA 4E4PA 4LUTB 2ABAA 4YLWA 1VP5A 3RR4A 3W1AA 4KGLA 1VCVA 4JKMA 4Q6XA 4GYPA 1FCBA 3B9NA 3LZ5A 5I3GA 1P0KA 5FJUA 2V5CA 4V15A 3DFHA 3W1MA 4MHBA 4MZYA 1MO0A 4CNUA 1MDLA 3KOFA 3WENA 4GCXA 3H2AA 1TR9A 4E38A 5IDZA 1XLKA 3MHFA 4WOZA 1XBYA 4C6MA 4PA8A 2FH8A 3TTOA 1REQB 2ALDA 1K8YA 1Z44A 2JKEA 2QJNA 3VIMA 3P2VA 4GY0A 4H8VA 3WL0A 4ENLA 5HULA 1SO3A 2WZMA 3EPOA 1UWSA 3JR2A 1QNRA 2EG7A 3UA4A 3IVTA 3A5FA 5C2CA 5EB8A 2WHMA 4CEXC 3U3HA 4CEUC 4XIMA 3QGKC 2ZXAA 3T2QA 1CLXA 1E9LA 3TYEA 4PMRA 1UA7A 4LALA 4UTIA 4QJ4B 2VEPA 4BA0A 1KFEA 3E0VA 3UWVA 3ZMRA 1Q4WA 4KWUA 2EG6A 4RXGA 2W3ZA 1E4MM 2PDCA 1C8XA 2C6QA 4F0KA 3NQ8A 3ABXA 1VLWA 4ZODA 2O7QA 1R9ZA 3IIOA 2VEGA 2J8GA 4FS9A 4W86A 1R2SA 2DQWA 4GD0A 4OHQA 2Z4GA 1S2VA 3QHMA 3NM3A 1M41A 3WDHA 3UY7A 4R9OA 3S47A 4CNPA 4DUXA 3GLCA 3S46A 3C61A 3T4CA 1J0YA 2BWGA 1RBAA 3CPGA 3QR3A 4GYFA 3UWZA 4EX4A 4NJHA 4QAWA 5FI8A 2ZZ1A 4RK8A 2G8ZA 2RDXA 1YE4A 2FYMA 5IXEA 3SRHA 1GWJA 3WNMA 2V82A 3OA5A 5A6KA 3L0NA 2FZMA 3LHVA 4W9TA 2NXHA 1K7EA 1G4SA 2QUTA 4QJ1A 4AVNA 1L2UA 4C1NA 1TQXA 3UVIA 2E6DA 1BXCA 4XVDA 1Z48A 3C5QA 4GQBA 1J79A 5IDIA 5GJPA 3ARQA 3VOGA 4F2UA 3OEXA 5HMDA 1P6CA 4FX7A 3CPRA 2GQ9A 2D23A 1OCNA 1QI2A 4I3GA 1V08A 1W6TA 1TPUA 1JCNA 3A4XA 5FCZA 1CPUA 1HJSA 4XZNX 4MWAA 2HROA 3ALFA 1ME8A 2NXGA 4N9BA 1W2VA 1GUVA 2NWRA 1ZSXA 1ISXA 5I0DA 2VCAA 2DZPA 2Q01A 3WLHA 4IL0A 3B8SA 5HPOA 2W63A 1HJVA 4MB5A 2GGGA 4MUZA 4NUWA 5LXXA 3WLIA 4QSHA 3ZWSA 1UC5A 2VR5A 2D22A 3BGAA 1AQFA 4UBPC 1THFD 3M0IA 4LCSA 2VOTA 4XAFA 4PUEA 3GU1A 1OYAA 1Z69A 3FOKA 2W91A 1EEPA 2VHLA 2VKZG 3QBUA 5TAOA 2IXUA 4ZQNA 3ZM8A 2WM0A 1RSCA 4HCLA 2AL2A 4YS1A 3L0KA 2PBGA 3V0SA 4US5A 2QLYA 3UWUA 3UZ5A 4Q8NA 2FH6A 1H5YA 3RCYA 4QCFA 1Q6CA 1KKOA 3ZZ1A 1UKPA 4Z08A 1TV2A 1GPWA 3TSDA 4IM4A 1R0MA 5HNUA 3LM7A 2P1FA 3GWQA 3SCSA 4Q4PA 3ZFHA 3A24A 1ZP4A 1XYFA 2YYTA 3AMDA 1TIMA 3WD2A 3OVQA 3EOOA 4W88A 4IMFA 2KZHA 3WMBA 4DNHA 1UMLA 4ZEPA 2VGIA 1YPIA 1RAKA 2HK0A 2YL8A 3JS3A 2R24A 5TF0A 1V6VA 2WKGA 2XSBA 4NJJA 2VQUA 1H7PA 3NTYA 4L80A 4LAZA 1GOOA 1ZJAA 2NVAA 3QHNA 1FH9A 1LRQA 4LH8A 3WLPA 4RDZA 3ITYA 4XISA 3S5OA 3V5FA 3EWUA 4TXEA 3A47A 4JYEA 1RUSA 4EACA 4XZHA 1V4YA 3V16A 3QOMA 3ANYA 4H41A 1FBAA 1VJSA 4FLRA 2PGWA 3ALGA 5I3KA 2ZQ0A 3NQCA 4LVAA 1YYAA 2FPVA 3UESA 1T0OA 1IEXA 4ZQOA 3PG9A 1GVOA 4AZCB 1TO3A 2XIIA 3EWDA 2D3NA 4HIBA 1XYCA 2FPTA 5DXXA 5M17A 1KO0A 4U2ZA 3PZNA 3GG1A 1RQEA 4HT3A 5FJJA 2W0UA 1WXJA 1MRAA 2OQYA 2OB3A 3A3HA 4O50A 3EYPA 4W93A 3RX2A 4N9CA 1ENUA 1FA2A 5M2FX 2WVVB 3SFKA 2RFGA 3APTA 3EMQA 5REQA 1O95A 1MW3A 5C2XA 3RM8A 4OWGA 4W5UA 1NF7A 5CBBA 4HZ6A 2GJRA 1YW1A 4NZFA 2ZUVA 3CYJA 5F2IA 3RPDA 5HINA 4NYYA 4I8YA 4JFTA 4AIOA 3B0XA 3CQKA 1TWDA 3WBEA 1V6YA 5CSSA 1CGTA 2G3FA 2Y7EA 4TX8A 4ATDA 4NY2A 2VD9A 4YHEA 3RPTA 1KBBA 1A5SA 4GKLA 3CO4A 3UP8A 3M7WA 1XLJA 2PFHA 4E8GA 1NOFA 1UB3A 2NQLA 4KF1A 4E8DA 3THAA 4OOZA 3GNRA 1B3ZA 3DFTA 2DW6A 2ZC8A 2J74A 4ZXOA 1UUMA 2FZBA 1YMYA 3GG7A 5CJMA 4LW7A 1N82A 1SMDA 2Q8LA 4DZAA 1SZGA 1VPYA 1G69A 3WDQA 3VD7A 2VC6A 3MSYA 5CGTA 5HBFA 1JF5A 4EKJA 3S9YA 2GJXA 4NZJA 1B2YA 1XINA 1B0IA 1NAL1 3L21A 2DV0A 3FY1A 4JL1A 3HJEA 3TTSA 2AKZA 3WQOA 3AXHA 3CL8A 3R11A 3W7RA 1YBQB 4GINA 3WQEA 4GOAA 5KITA 3NAVA 2E9LA 5AECA 3VCRA 3CPUA 2ZX9A 5ABFA 4GUGA 5I24A 2QJMA 3AIQA 1DJNA 1UWQA 1V3JA 1UD8A 4WUIA 4EPDC 4TMCA 3R10A 3MVTA 4O57A 1R2TA 4GI8A 1MQQA 2PLCA 3VC5A 4WY0F 5FL1A 1BQCA 2VELA 3AJ7A 1GQJA 4GGHA 3NQFA 3R5EA 5LIXX 3LNMA 3ZJKA 2GOKA 3ZVHB 3VMNA 1EJRC 1S5TA 3KX6A 2PTZA 1B1YA 1EBGA 2OG9A 4KQNA 1E70M 4HB7A 1O94A 1UWAA 1W8SA 4IFOA 4PUJA 4G1KA 4AH7A 4HNCA 5CPOA 3AO0A 3K13A 1KFLA 5JMUA 1MUWA 3GZ3A 1WV2A 1J2BA 1UPMB 2Q09A 3KVMA 2XU2A 1UR9A 3S2JA 1SFJA 3NM1A 4JTDA 1O66A 2VR4A 5A2BA 3ABRA 3N2BA 1NDWA 4YCPA 4MOZA 3WLNA 3AZSA 1SSDA 7ODCA 3ZR5A 4W4QA 1ZBVA 2PWFA 4PCFA 3OVRA 4DWDA 1SFSA 5FJPA 9XIMA 1WAUA 5LA2A 4WOQA 2JIWA 2JQXA 2NLIA 6ENLA 3VILA 3VUPA 1A0EA 3QR0A 1TX0A 5E70A 2E77A 3H2FA 3CWOX 4WX2A 3PZ9A 1XI3A 3D3AA 1ICQA 4IIBA 1GZ1A 4KBXA 3HV9A 3MUAA 3WDJA 3QMRA 3E5BA 5D9PA 3ARYA 1ZBWA 2V38A 3P93A 4KCWA 2WPBA 6XIMA 2WNZA 1BLIA 1D3HA 5I3HA 1IXPA 3CAWA 1NFPA 1VBHA 5E5CA 4ZO7A 1JDFA 2B7NA 1XSKA 2ANUA 2HS6A 3P0WA 3GAYA 4YMZA 3NL5A 4MUPA 2XVLA 4A8NA 3WLSA 3I3EA 2ON3A 4AWSA 2I16A 3B4YA 2INFA 5D8WA 2DH3A 2Y85A 5CPTA 4H9YA 1Q13A 4H04A 3ZQ9A 4ECLA 4HMNA 5CJNA 4JD4A 5D33A 5LGZA 4IL2A 3B0PA 4IIGA 2ZKMX 1XH2A 1V03A 4H00A 5ABHA 1CNVA 3CHVA 4PMUA 1LROA 1M5WA 3VDGA 4UTTC 4AEEA 3PBUA 4B4FA 3ZT6A 3GXTA 5BXSA 3ATZA 2YZ5A 1MNZA 1FWTA 1IR2A 4CQ9A 1ONXA 2QJIA 4WDXA 1QNOA 5KSWA 1UP0A 4O8AA 3CEPA 1HFBA 3NO5A 1M03A 2QV4A 1CBGA 2YYUA 1IT0A 3ZXWA 2X0YA 3MBFA 4OZOA 5CZ0A 3T55A 4JYFA 4WCJA 3IJ8A 4LC8A 1EL3A 1MDRA 5DT7A 4US5D 3J7HA 3LHYA 2Z6JA 4MNMA 2QIIA 1VPQA 1UMYA 1MI3A 1LWJA 4H19A 5HMSA 3LCIA 3MWAA 2WO5A 1KFWA 1Y5XA 5AHMA 1V3KA 2PAJA 3N3MA 3O6YX 4Q8WA 1B3WA 3THUA 3QYQA 4REQB 8RUCA 4OV9A 4S3DA 2HNHA 4PTVA 4NAEB 4NJKA 1I2NA 3RNDA 2QMKA 3AIUA 4NF7A 2FQIA 1KXQA 4KRUA 1EX1A 4K38A 4J3SA 3GUGA 4XD5A 4HOXA 5JIPA 1RQHA 2YW3A 1SR9A 1PKMA 3HO8A 1NP2A 1V93A 4NKCA 3VYLA 1RJQA 1W9VA 3SUUA 3VDBA 1YEYA 1GYLA 4LAOA 3TN6A 5D2XA 3WKZA 3TW9A 2R1MA 1TTQA 4OTKA 3T42A 1JCMP 1R2RA 4R3UA 4Z17A 3NGJA 4MDPA 3KDOA 1XH1A 3QJAA 1DVJA 4M6QA 3L67A 3EGJA 3GSMA 1ADOA 2PC8A 2BHUA 1D3GA 3M0ZA 3AYTA 3PBYA 3QGAC 3S6OA 3WQ6A 4UFJA 2XFRA 4A4AA 3LDVA 3W00A 1DBTA 1SQ7A 4JNMA 1O6IA 3R43A 1R30A 4IPNB 3P5ZA 1PWMA 2EPOA 4S3GA 2PLJA 4Y96A 3TIMA 4E2DA 5I02A 1FCQA 3P8JA 5CPLA 3GIYA 3TKFA 3CAVA 1ITCA 4RW3A 1OZMA 1O12A 4LRSA 1V3LA 3PUGA 3FKKA 5JH1A 3VCCA 3M1ZA 3AZTA 4DI9A 4ZZ9A 5G2WA 4FNRA 4IP4A 4FAMA 1KV5A 2DSZA 2HS8A 3VAVA 2VI0A 3TZNA 4YPJA 1KTBA 1JDAA 3R58A 3REQA 3USZA 2C8NA 1JZ7A 1Y5WA 1J0KA 1E3ZA 1TSIA 1V7AA 5HAOA 5JBDA 4JHZA 4RNHA 2VP8A 4JKLA 3QFEA 1ZQ5A 1OD8A 4QS5A 1EXPA 2IMRA 2FJKA 4KWVA 4AX6A 5J8LA 4Q6JA 4D6JA 1M7XA 1UYQA 1PBGA 1C29A 1GEQA 1XD1A 1PKLA 4UMBA 5T9CE 1E0XA 4FB7A 1EJUC 3IIPA 4DJFA 3WJYA 3GDRA 3IRDA 5LNRA 3WH8A 3SUVA 3B8DA 5AYYA 3U9IA 1ZBKA 3WK1A 4I9MA 3GB6A 4C1NB 3PHAA 1I2QA 3TC7A 4DBUA 2UZ9A 4L6OA 2VZSA 5AN7A 1IV8A 4GVIA 5SWUA 1VBJA 4QR6A 5G1TA 4CN1A 3R79A 3FAWA 1SO5A 5M03A 3N13A 3A4JA 1YPFA 2ZDSA 5C8BB 3HF3A 3IV3A 3GXMA 3ZSSA 1WB0A 1P0NA 4CNTA 3CAKA 5E9XA 4JTIA 3WFZA 4Q7NA 1FWFC 4MWAB 4PUDA 1FH8A 2W9MA 5EA9A 2BG5A 1K9FA 3PVFA 1PTGA 3IS4A 4D6EA 3G1VA 3RO8A 5C9UA 4PULA 4B5WA 5A6LA 5KEZA 1Q85A 4NHVA 2P53A 1JPDX 1GQKA 1R3YA 1GJWA 1W0MA 3B8IA 1S39A 4LUIA 2Z29A 1S2TA 1PIGA 1JZ2A 4B9YA 1SSGA 1SJDA 1F07A 3NQBA 4AEFA 4LX4A 2X7WA 3B9OA 3BCDA 1RBLA 4S3FA 4WK9A 4XZWA 2ISDA 4F9DA 2H3DA 1P7TA 1T8XA 3RJXA 1YTKA 2OZ3A 3GZAA 3U2EA 4IMAA 4RNJA 4U5IA 4QITA 3KRZA 3AXMA 4JR5A 2ZZ7A 3A22A 3N12A 1NH6A 3QW3A 4S3JA 1KB3A 4AYSA 2ZXBA 2V2HA 4QHRA 4EAMA 3UCDA 2ADAA 3L5LA 1O5KA 5G2HA 2ZRYA 3M4HA 2VNCA 3W2UA 4ADSA 4EXQA 1G4PA 1GTEA 1DL3A 3GNXA 4XB3A 4UOJA 1S3HA 1HKMA 3ISIX 3WQDA 1KCKA 3GK0A 3E12A 3CASA 1VYRA 2G4FA 3EOLA 1I1XA 2Y24A 1PTDA 3DBNA 4R34A 4ZB5A 1ZGDA 1TZZA 2PWUA 2R9RA 4JQ1A 3F5JA 3UYIA 2X1TA 1K3UA 3V5OA 4NQ1A 4UQAA 1VD6A 2WMJA 4OECA 3F4NA 5CZTA 1TV8A 4J3VA 4WXZA 3MDWA 5BXPA 4ZO9A 1SJCA 4WF7A 4C7GA 3W82A 3N15A 2WVSA 3RRAA 2EPNA 4NZCA 3W07A 2ZXQA 5DCBA 1JCYA 3VE7A 3O8AA 2ZVIA 4RDVA 5T91A 2INZA 4Q32A 3LS9A 5T9BG 3BL3A 4DYKA 3LB0A 4IX2A 1KRCC 2XTKA 4W85A 5HWNA 2MUCA 3WNNA 3BAYA 3USBA 3OYXA 3M43A 2J7EA 2WOQA 1JZ4A 4P5UA 4DYEA 1G6CA 1JYVA 3OVGA 3R13A 5LHFA 1S5WA 2BVWA 5EY5A 1JGIA 4K2SA 3DENA 4YHGA 3OA3A 4ZE4A 4CCDA 4Y9OA 1ZU8A 3CZJA 4MWAE 4G9PA 3M0MA 1HP4A 2OSWA 1FUYA 1QASA 3MDUA 1EGZA 1AH3A 2VUNA 3H53A 1GG1A 3WFAA 2ZWZA 4Z1YA 1JL8A 3BJSA 2CBJA 2CKRA 2E40A 3QSTA 2P8CA 1R38A 4PH6A 3AMLA 2WNNA 1ONWA 3F2CA 3WLJA 4O53A 1QPQA 4O17A 3ANUA 2AGKA 3KP0A 3I4KA 4HA0A 4G1NA 2CCRA 1W1B1 4GPNA 1JUEA 3MKVA 3W7KA 2VQTA 5DBTA 1HL8A 2A79A 1TR1A 3LYEA 2V2DA 1X98A 4NRSA 3I3BA 1BSIA 1GKRA 3H7RA 3GXFA 1GYNA 3W37A 1DXIA 1DHKA 4BJHA 1NDZA 3W6LA 2Q8XA 1P4CA 4AMCA 5CXPA 2YCLB 3EWYA 1FCUA 2OX1A 4F66A 1O5RA 1CGVA 3D6NA 3VD3A 7REQA 4AG0A 3EX4A 1XDMA 4QTGA 2V3EA 4KT2A 4JTRA 1E9IA 5D8ZA 3IEBA 1LL6A 1JZ8A 1DKWA 3E74A 5ABFB 3WCZA 4ERIA 4V33A 1F7BA 1RP9A 3C8FA 3G0XA 2Z1BA 2RGMA 5LIWX 3UETA 1WA3A 3CS2A 2OO0A 2V5BA 3E2VA 3G0UA 3TE9A 3TA6A 3TMLA 4AWTA 1JGMA 3CB3A 5I3DA 3MHUA 3ID7A 2EO7A 1PXGA 3W7OA 2WJDA 3GDTA 1CDGA 3SW6A 1LLOA 4GXMA 3NURA 1BF6A 3AFBA 1XIHA 3VUSA 4WY0A 5CZJA 3PS7A 3UW6A 4K36A 3CHCA 1J18A 5JQ9A 3RR1A 2X0HA 3VM7A 4H4IA 3TYUA 3C3NA 4DJEA 3U8GA 2Y5EA 2PMQA 1CCWB 3K1GA 2XPKA 1FKWA 4PZVA 4W8LA 1US0A 5DY2A 3WD3A 1WUEA 2J7BA 3TYDA 1ZENA 2GGHA 1W1PA 1UC4A 2CZVA 2Q3OA 3U4AA 4AVFA 3MJYA 1PV8A 4V27A 2J7DA 3CU2A 2KX9A 2YLLA 1UZ1A 3HB9A 1TJRA 1ISZA 1V8EA 1A80A 4MJ4A 3AI0A 2WBKA 3AIWA 4FO4A 3KZSA 2VM8A 1MVYA 1W3IA 3WBYA 2HPIA 1ZUAX 1ZBCA 4XAPA 3D47A 1OFRA 3BW4A 4DJFD 3HPXA 5A8QA 2EPLX 3UGRA 3ES8A 5E1QA 1XIGA 3WBXA 2YX0A 2VFFA 4AXKA 4RNFA 2A7RA 4AXNA 1ZFJA 5A94A 2FDSA 4MWAC 4CN4A 1CGUA 4XVEA 3DXIA 1ITXA 1KCZA 4JIIX 5ECUA 5DCDA 1VBUA 1HT6A 4CN6A 1TV4A 4KWSA 3TFXA 2ZRVA 1JCXA 3VIKA 2ZICA 3QH2A 2YB4A 4XV0A 4GNJA 1F3TA 3GTXA 4GBUA 3KL5A 4RLIA 2QCHA 2BHZA 2CZEA 4Q22A 1QJWA 3LI0A 4JX5A 3PSWA 1SMAA 1Z89A 3W7JA 3EDDA 2BASA 3C2FA 3LA4A 3RO6A 5HNTA 2XGIA 3DG7A 4E3VA 1WBHA 2BSLA 1OSEA 3KS6A 4AY8A 1CEOA 3DI1A 1UG6A 3BVJA 1OFOA 2VMFA 3MHGA 3OHIA 3GYCA 2TODA 2GQ3A 3O07A 2ZZ2A 1A5OC 2W66A 2XH2A 1JCLA 2J9YA 4JDYA 3W7HA 3LLFA 1PZ0A 4MYXA 1K9TA 2FFIA 3DBPA 2YA1A 4DM2A 3TJ4A 1U1HA 4QSFA 4UQ9A 2WMGA 5AYXA 4UZUA 4LF1A 1EP2A 4YTSA 3VZZA 5FJOA 4P8UA 3APYA 2RKXA 2OPJA 3CTTA 4US6A 3F4VA 4XTIA 4XKYA 4A3UA 1XFCA 5A2CA 2QPXA 3SCPA 1LRTA 5HDRA 1L6WA 2OQHA 2NUYA 3UCQA 1R6WA 2GVEA 3IJ9A 1FHVA 1Y5VA 2EQDA 3L4VA 3HG5A 4TIMA 3W2KA 2BGQA 1B3VA 1PDYA 1J93A 3O16A 3O0FA 4S3BA 4B15A 4HA4A 1WOAA 2QCDA 3CUIA 4GHRA 1LDCA 3H54A 4C7FA 4UOZA 3WEOA 4QNEA 1GJUA 4ACZB 3C2VA 4UUIA 1NSJA 4P7RA 2DZUA 4X2RA 4JQ4A 1KM1A 1XC4A 2WMKA 4U3CA 1L2QA 5A3HA 5U4NA 1TZ9A 1TCDA 3NZ1A 1RALA 4KCUA 3UU0A 4UXDA 4E8CA 3AU2A 4Z2KA 2A4AA 1XM3A 1SZRA 2PP0A 1FWJC 1QK0A 4HK5A 1EO7A 3OVPA 2PS2A 3BAJA 4TR9A 5BZAA 4G2DA 1RA5A 3MUY1 5I3IA 3B04A 4WSHA 1HL2A 4HU0A 2PDBA 1UD2A 4O52A 5L9FA 1CI1A 1XLEA 3HU7A 4H9ZA 2DIKA 1MEIA 4DRSA 1J6OA 4MGGA 1L6GA 3ZR4A 3U2ZA 5HNRA 3UERA 2QXWA 1LLZA 3WMCA 3CAQA 3GKAA 4ZGYA 3EPMA 5LIKX 1LBFA 3MY9A 3OG2A 3UEQA 1XGZA 2GGJA 4MIMA 3GUWA 5LXEA 2EKCA 1DIDA 5DMMA 5K9XA 4ATLA 3O6DA 5BU6A 1QHPA 4NT0A 4KEVA 2P0OA 1E9ZB 3WEMA 4L61A 4PUKA 2V81A 3TSBA 2H90A 4CCCA 4GI9A 3BG3A 1QU4A 1CXLA 3F2BA 1S2AA 5D2VA 1M53A 2IQ0A 4ZQPA 1FWBC 3C2OA 3FHQA 2YXGA 4F0SA 4Z2HA 4XZLX 3S2MA 3G1SA 1ZB5A 4NNAA 4GWEA 4HPHA 3BO9A 4IPIA 5CZSA 3H70A 3OO2A 4OBSA 3B97A 3Q4DA 4LYRA 1OC5A 4ZR8A 2G3NA 1NQKA 3A23A 1PE1A 1NF0A 2PUZA 5D37A 4ZB0A 3M5YA 5A5WA 1XP3A 1KQYA 1A0DA 4O4VA 1UQYA 2QT3A 4KCVA 3AS3A 5BWFA 5CPQA 3W7EA 5LNUA 2VEMA 1F74A 2VCCA 4Q8PA 5JBFA 1NM9A 3W7PA 1IEIA 1S5VA 4X9SA 2QF8A 4ZTXA 3BPWA 1TELA 2CKSA 4GIEA 1GYMA 4EF8A 3C2EA 4JQAA 7A3HA 2YXXA 1TJ1A 3C2RA 2PRMA 4I90A 2XIQA 5G5IA 1PKNA 1OCJA 4AZBA 1PTAA 1OYBA 1VFHA 4GRSA 2IPFA 3U6WA 2IQDA 3DC0A 4LYQA 3W25A 1VPXA 5A6AA 3RHGA 3MKCA 1WZLA 1EJSC 2WKLA 3EAUA 2VFEA 3WN6A 3BC9A 3V18A 3Q65A 4LCRA 4S3EA 2X8RA 4P61A 4CD5A 5K3VA 2OLHA 1B30A 3KVKA 5EMYA 1F4HA 1ZJBA 5FSDC 1V0MA 4JY8A 4HNVA 1TTPA 3B0UX 1IXQA 1YXYA 4CNSA 3SFWA 3NQAA 3HTWA 1P5BA 2NXIA 3K8KA 1D7KA 4DZIA 3PR2A 3CUJA 1C3FA 4K39A 2VFGA 3S5NA 3CUFA 2Z7KA 3T0AA 2Y5SA 4XBJA 5CPMA 1WDRA 1XHGA 3P7YA 3MCNA 3NJ3A 3W6YA 3ZR6A 2V2CA 4RCXA 2VRQA 3MP3A 1PO9A 3DYOA 4LVFA 3AICA 4BWLC 1SR0A 1EP3A 1UKTA 1N7KA 1W5PA 5AY7A 3FJLA 1H49A 1SFTA 1XGDA 1KBIA 1KLZA 3MUXA 3VC6A 2PDWA 4MMWA 3BZGA 1OCBA 5CPSA 2DT1A 3GNPA 4RE3A 1H51A 4XAGA 2CLPA 1H7RA 6PTDA 2YCEA 4PTDA 1JCTA 1OABA 1UR3M 2CPUA 1C92A 2FZDA 4C60A 1W9BM 4RZ6A 4C6DA 2FGZA 4MM1A 3LM3A 3OGSA 7TAAA 3KOYA 3NO3A 3WLKX 5A8MA 4YXGA 1NWTA 2ZA2A 1TA3A 2ALRA 4D1JA 4FR1A 8CGTA 2DT2A 1WO2A 2I5GA 4X9YA 3OLEA 1OFEA 1H0IA 3W7IA 3EOSA 4LYKA 4IJCA 3KRBA 1X8CA 2D0HA 1E4LA 4HNUA 2E5DA 3DFQA 1VFOA 3NYZA 4PMJA 1DJQA 1XLLA 1JXKA 2PRLA 4KFOA 3A9BA 1MXDA 4YTRA 2OGYA 3U2CA 2J24A 4F40A 4AIEA 3RMEA 1CGXA 1DIEA 3GFZA 2Z7GA 3WIJA 2OZ8A 2YR1A 2YA2A 4LAKA 5H6HA 3EMZA 3PZMA 5I03A 2GGIA 3ARUA 1A3XA 3UXLA 2DIEA 4WR3A 1WDDA 4A29A 3UY8A 3T1GA 4FOUA 3V75A 4X0NA 3AS1A 2PGRA 4AWUA 4F2BA 2PF8A 5BOFA 1I2OA 4YJ5A 4O0KA 2IKIA 2CC0A 1TPH1 1Q4NX 4BF9A 1JULA 1LQAA 4ZOCA 5KINA 4HSHA 4S1FA 3CTLA 2CYGA 2I56A 1Z3NA 2VZTA 1Q7ZA 1W9UA 3BMWA 5A1AA 4HZ8A 2BY3A 2XDFA 1OGGA 4XSMA 8A3HA 3M16A 1UUOA 1GVRA 3NQDA 2A1YA 4WKFA 1ISVA 4I8DA 5DRIA 4MY8A 1UIOA 5HA7A 3LD5A 5CLTA 3EB4A 3BURA 3BMVA 3E02A 2WHLA 1E0VA 1HXJA 3FLUA 3WJWA 2F7FA 4M51A 4QG6A 1LBLA 1SPQA 3LLDA 3LLXA 4CCEA 4IPJA 3ZWTA 1QATA 3S9ZA 4OJYA 4Z2LA 3QY7A 4I5UA 1GZGA 3AJXA 3LXCA 4TX6A 5CGMA 1LLWA 3LBOA 4H6KA 1XYAA 4H9VA 1H11A 3ONBA 2ZX7A 3MP5A 1ZAJA 4AHOA 5HQMA 3N19B 4E6MA 3SCVA 4FALA 4ILSA 3WO8A 4YTQA 1JXJA 2HXUA 4XZMX 2B4GA 3AWNA 3UFYA 3TQKA 3O0KA 4LXFA 3BANA 3LHZA 5HUOA 4TMBA 2QUNA 2PDFA 3GKFA 3KOZA 5C9ZA 3VIPA 1F6YA 5AB3A 4IQDA 1ODZA 2J27A 4MY1A 3VKJA 3PBMA 2E67A 3W2LA 3EB3A 3W1TA 1JJKA 4AQLA 2XFYA 4AD3A 1JDCA 4FNPA 3UZYA 2EKGA 4L1GA 7REQB 3W7NA 4GI6A 3LX9A 2DH2A 1N8FA 1TWIA 1KNWA 2OGJA 1B90A 4IIFA 3RUBL 1QOQA 1HO1A 1E0WA 1ICSA 3LPGA 2Y6ZA 3ITOA 1NOWA 2GFTA 3UWYA 1PL9A 4Q7BA 3SCOA 2VURA 2C71A 1TIWA 4HGXA 1Q6FA 3M0YA 4UNKA 3OP2A 2NUWA 5EMMA 3H8AA 4ZSTA 5D04C 5AHIA 3OOQA 3KBMA 4RPPA 3PZOA 4MKVA 5CPNA 1Q3NA 4I5RA 5C6MA 1J0JA 3MV01 3TAOA 2WW5A 4PGLA 3P62A 1E6SM 2C1IA 4WY0B 1UD4A 3WDPP 2QCLA 4K8EA 2J7FA 1K4GA 3MUCA 1CGYA 1LWIA 1JG9A 3P80A 1KWKA 1OT1A 3G1RA 3CZEA 3PJUA 1CLVA 3HQOA 2ZUTA 1TPWA 5DELA 4HYRA 2XISA 4BF5A 4FMVA 1Y0EA 1UWUA 4HSOA 3POCA 1D7FA 4MTVA 4LF2A 4BKNA 3GU2A 2BZNA 3MO4A 4PMQA 4XZ9A 5HWMA 3KFTA 4LQ1A 4NZ1A 4PSPA 1Y7VA 3MMTA 4CLMA 1KTCA 1H50A 4IOTA 1E15A 1KTNA 4ML9A 1RQBA 4PFMA 3R2GA 4PBGA 3SZ8A 2OLAA 1S1PA 4QLKA 4H9XA 1IGWA 1S3TC 4I6KA 5FJTA 1V79A 4UOQA 3AROA 1AD1A 1RVGA 2HEJA 4DYJA 2ZIDA 5AVNA 1RCQA 4B5NA 3WNPA 5GVJA 4Z2JA 4HNOA 2PU0A 4OGZA 2G97A 3VGHA 4DVOA 4RX0A 3LHTA 1SJAA 8TIMA 3T2OA 4EPKA 3KP1A 4D1IA 4CVWA 5MHBA 4RDYA 2OYLA 2G96A 2VDIA 3VD9A 3ME3A 3FA5A 2RJGA 4H2CA 3L4XA 2Y7FA 3GVWA 4ZE5A 4U2YA 4E2OA 5FEXA 2CBUA 2QMJA 1NWSA 4B16A 4DWSD 2PB1A 3K8MA 1MW2A 5CSUA 1GPFA 3VIJA 1XL9A 3NQ7A 2P88A 3QV7A 1ZJIA 1GT8A 1AL7A 1VCFA 4JQ3A 1RHCA 2YGYA 2YZRA 4AHQA 2ZC1A 5KZ6A 2WAGA 4GVFA 5IFTA 1X38A 2OXNA 2WCSA 4HOWA 3L2IA 1XLAA 1H61A 2GQ8A 3B9AA 4LC6A 4MY9A 5BU9A 3IJQA 2WVUA 3PJTA 3BG5A 1BWVA 3R0DA 2ZRUA 3VIIA 2PWVA 2E0PA 2AKMA 3H23A 4Y6GA 4YN5A 1XKJA 2J8TA 3MZNA 1Z8AA 1K1DA 3S1WA 4M7SA 4P8XA 2PI6A 4G6CA 1OK4A 3QPEA 3GXDA 3RYSA 2XUCA 4HMEA 4FXFA 1RCXB 5DF0A 4WD0A 1UKSA 4P7QA 4O0QA 3ZO9A 2WPGA 4D6HA 1W5MA 4XX6A 1ML1A 2JALA 2OEJA 5G1MA 2WHJA 3GNOA 5LZLA 4Q33A 3I10A 4XKYB 1O4UA 1WDQA 1H7NA 4BS0A 3W73A 1TPDA 3EDJA 3TN4A 3I4EA 4TVDA 1XCFA 2YL9A 3WH7A 4EVZA 2J9XA 3LRKA 3M0VA 1F5ZA 1NOUA 5A69A 3GH7A 1JRCA 5D2TA 1SVDA 2F9RA 3S1XA 4FOKA 2Z28A 2QCDB 1W1IE 3TFCA 3SR7A 3D5HA 3PJWA 3GDMA 4D6IA 3WX7A 2NX1A 1MW0A 1H09A 4U4MA 2QPSA 1VIWA 4A21A 3O3RA 2JK2A 3P6LA 1V02A 2Y1HA 4Z0JA 4DAIA 1F6PA 2ZX6A 3B05A 3H2OA 4WIWA 5BXRA 3W1XA 1NFBA 2GDUA 4UTWA 3ZJ7A 1E6PA 4X22A 4DZHA 1MXGA 3FDGA 1DV7A 4G8TA 3QXBA 1KCXA 5EFFA 4D8LA 2J7CA 4EXAA 4ADTA 3C86A 3FEMA 2W61A 5IHSA 3OLIA 2PTXA 3NSNA 3T78A 3M0HA 2A7PA 4B5VA 3CIWA 3LZ3A 3EX2A 1JQVA 1XCWA 4WEVX 1QUMA 2VENA 5JIWA 2BBFA 2DZVA 1EOMA 4P8VA 1KR1A 4AZ5A 4QRNA 3T6CA 2GSHA 4W5ZA 3ARXA 3SEPA 3B03A 2G5WA 4JIHA 5E0CA 3FN9A 1OC7A 1B57A 3POHA 4FNUA 5E93A 2JFEX 2DZBA 2XIMA 4JEQA 4YYFA 3IGXA 1YDNA 1LQ0A 1KGUA 4HTYA 1K9EA 1YX1A 3T44A 4V1YA 1XRSA 1V6XA 4HA1A 4LEQA 5D9MA 3WJXA 2VO5A 2TSYA 3W74A 1RY8A 3V35A 1WDPA 1WQ5A 1ISWA 3PNUA 2OEKA 3S1GA 5E0FA 4EF9A 1WXZA 1XPYA 4GISA 1POKA 3FW6A 3VX1A 1TJ2A 2GUYA 2VEKA 1CLKA 3L5MA 2J13A 1XD0A 4UFIA 4WZHA 4W7VA 2J25A 3PTDA 1XIIA 4RPQA 2X1SA 1Q7MA 4OOUA 3T8QA 2VC5A 3Q45A 3JRKA 1ZPTA 4GBDA 4AC7C 4C7DA 2OODA 3QYSA 2O4MA 1K4HA 1T5AA 2O9RA 4HD5A 1QCWA 1OF8A 3BWWA 3EWBX 4IUOA 3TXVA 1W5QA 1F73A 3VNDA 3N73A 3AMGA 2HJPA 1KV8A 1EIBA 4Q8UA 3KVJA 1BGAA 1UUQA 1L6YA 2ZUMA 3BCJA 4NXKA 1TB3A 2VJXA 3LEPA 2E7FA 4AC1X 1M1BA 2V0TA 2A5HA 4KIRA 1AK5A 1FP8A 4F8XA 4MF4A 4C5ZA 4ERAA 4PUWA 3LSBA 2R6OA 3U5UA 2IKJA 3UXDA 3WJSA 4QAIA 3M0KA 4GLEA 3LPPA 3SCRA 1K6AA 2O9OA 2WSKA 3ITLA 1GVEA 4NX0A 2WMIA 1JD9A 2D1ZA 3WQGA 3H2EA 5GNZA 3CQJA 4HVXA 1T7LA 4DJEC 5FKYA 1GW9A 1OG0A 4AD4A 2PGFA 4PMOA 1K6WA 5FF2A 4P7NA 5FA5A 4Q8TA 3OZPA 1XXXA 4GA8A 4BEQA 2VDHA 3EXSA 3FXYA 2GUUA 1B54A 4HMCA 4A2RA 4Q8VA 3PANA 3BV7A 1GG0A 4W7UA 3ARWA 2ZX8A 3V4BA 1P0EA 2DUXA 3GFYA 4GZIA 1H1ZA 1JDEA 4KIEA 1Q66A 3K8LA 1VRXA 4DF0A 5E6ZA 2W62A 2OWCA 3H55A 1DIOA 1W9PA 3L4TA 2V63A 1OJXA 3BLKA 3R25A 1A5UA 1TUFA 4MLRA 2PZNA 1LOLA 3MU7A 5I79A 3DCPA 3W38A 4MG4A 3GM8A 1HKVA 2VT0A 4MPKA 2C0HA 4GFIA 3N9KA 2BLEA 1A5CA 4N9DA 1S2CA 3AALA 1W9XA 4DM1A 5TIMA 3L2LA 5CGQA 3AXKA 1SZEA 4JS3A 5HK4A 2WLZA 3QSRA 4IIDA 4AZ6A 4C6KA 4XSLA 3LTPA 3K2GA 4MB1A 4X2PA 1OYCA 1WPCA 1VKFA 3RILA 4GQRA 1KCLA 2QDGA 1EB3A 5CZKA 1FWRA 1AA1B 3UWEA 3C2YA 3KVLA 3UZWA 3P8IA 1KD0A 3HQ1A 4GVGA 3HBLA 2XZ7A 3N04A 3K4WA 5AC4A 2PDNA 3L4UA 5GQBA 4QE1A 3TU9A 4O13A 1TPFA 3G1FA 4XZIA 3NG3A 3SSJA 3IGSA 3N3TA 4I5XA 3VMPA 4LU0A 4AVOA 1QFEA 1UZHA 3WD4A 2QJGA 4G7EB 3UXIA 2QAFA 5D09A 3FX4A 1C8YA 4CKQA 2FPYA 1K8XA 2VEIA 1VLIA 1EZWA 2OOGA 2DUZA 1OD0A 3DOPA 5EBAA 4XBSA 3RDKA 4JAWA 1Q6QA 3ZT7A 3VOIA 3VDCA 2ISVA 2QUUA 3FCPA 1US3A 1WZKA 4QDPA 1E5JA 4E4UA 3CLWA 4DIAA 4FF5A 3FEQA 5AOUA 1MMFA 5KETA 3DFPA 3STPA 1BTCA 1DJHA 2PP3A 3HG2A 3B06A 2D20A 2GJLA 2FGBA 3AHZA 4B3KA 1LUCA 2RGLA 2W79A 4WKAA 4FR6A 3K5XA 2PTYA 3GH5A 2ATMA 3GIQA 1VRDA 1IE7C 1E1CA 2G3JA 3AYRA 5FIPA 4PBFA 2PTDA 3CLMA 1HO4A 3STEA 1GZJA 4MB3A 4K68A 5EMJA 4NILA 2UY3A 4DAFA 2PA6A 3LCLA 4M80A 4RE4A 2OX4A 5FACA 2YL5A 3A21A 1UWTA 1E71M 3WQVA 2E8YA 4CQDA 3GQYA 1X6UA 1YXDA 2G4JA 1TRIA 1TMQA 1X7FA 4L4MA 4HN4A 2P76A 1EBHA 3KCLA 1EQCA 2QCCA 4UQEA 1GJPA 5JUVA 4FXRA 1JI1A 3K1DA 1TV5A 4U5KA 1CTNA 4ZOBA 1NTHA 5H8MA 2ISFA 1O5QA 2CZDA 3TJLA 2PDUA 2X16A 3WQCA 1PS9A 1GK8A 2O56A 3VOCA 4AAJA 1ZRQA 1XIEA 2H8XA 4NRRA 4JZ5A 1GVYA 2C79A 4PL2A 1CENA 1ITUA 2FDMA 1LG2A 2I9UA 2DFAA 2VZVA 4PMNA 3BJFA 4H6EA 4AFYA 4GC4A 4Y9MA 2Y88A 3CUXA 3N34A 4FI4A 1VFTA 3IJ6A 3W1UA 1V51A 1B4KA 2ZUWA 2DZXA 3W7DA 3HPSA 4RNIA 3MP4A 2DW7A 4E5TA 4M24A 3G1XA 1E55A 3TNOA 4LTSA 2Y7GA 5CBJA 5A8NA 4DO6A 4CD4A 1OWQA 1C8QA 1JYXA 2J7GA 3SN4A 4RE2A 1AW5A 3EEGA 3ZSTA 4FK9A 3EX6A 4GYKA 5IBXC 3ZOAA 1CECA 2J6XA 3PC0A 3LOTA 2Q3RA 4PEKA 2PCEA 2CESA 1QW8A 4O18A 3CXOA 4U28A 3CH0A 2GVLA 4WLCA 4IQJA 4Z2IA 1I75A 3HM7A 1QO2A 4DO4A 4WVXA 4A8RA 4RDWA 1ELSA 2X41A 1E6RA 4GUHA 2E6FA 2BOFX 2DZSA 2RDUA 2WWCA 3MVIA 1TMLA 3ABQA 1ME7A 2YB1A 1SW0A 5HUPA 1DXEA 4H6QA 2PPGA 3QFWA 1OQFA 3C56A 4OQVA 5D9NA 2ASHA 3Q37A 5MKGB 3GDBA 4CUCA 3DDMA 4I7WA 3PK7A 3IJLA 2OOFA 1VEPA 1HVQA 2VX6A 2GJNA 1XIBA 1NU5A 1EOKA 2XYLA 1LBMA 1A5BA 1IT7A 1JAKA 2F2KA 1UZDA 1I60A 1X6NA 1U30A 3UVAA 3FYOA 3W88A 3T0DA 5LHEA 3LBMA 1IXOA 1J5TA 4U31A 4M5PA 1QPRA 2IPJA 4QE5A 1QVBA 1N8WA 1I0DA 4FSAA 2XM1A 3UNDA 3MYOA 4KH2A 3O06A 1G94A 2DZAA 3TN5A 1EGMA 3RCMA 5HR6A 3IWPA 2IPGA 4CVUA 3OQ8A 3THDA 4RV8A 4LBUA 4G7FA 2CLLA 1A49A 4YIWA 5AHFA 4QLLA 1PVNA 1DQWA 2C16A 5LNWA 3FVDA 2D24A 1IR1A 3VKKA 3CIXA 3MUZ1 4MZ8A 4PUUA 1AD4A 4JTTA 3SY1A 1JF6A 3LGDA 3UA3A 1JNEA 3HOJA 3CWHA 3S83A 4HPNA 5EMKA 3N9RA 3FJ6A 2HRWA 4J7RA 1K02A 3GTHA 4DNMA 1WNOA 2D2GA 3VABA 4BQ4A 1O7AA 3H4GA 3E38A 4QCEA 2NSOA 5AC5A 1U2YA 1SJBA 3B9DA 5D9OA 2OYMA 2FTPA 2E68A 4UMAA 2ZX5A 4ZQRA 1E1EA 5A8PA 4H3DA 3NGFA 2QKFA 3EKGA 2VFDA 3L68A 4F2TA 4DELA 3NVDA 4PCSA 2QDDA 3UZXA 1PWLA 1E0UA 1XQKA 3DUGA 4JTLA 2AGTA 2NLYA 3URNA 4FEZA 3CJPA 3DX5A 3AIRA 1U1JA 3H4XA 3N6HA 1SGJA 2J62A 3QMTA 4EAYA 4IIEA 5KZEA 2C0AA 4HYVA 4KGJA 3HMJG 1XBZA 3JU2A 3DFSA 3NUKA 4DJDD 3I7QA 1WKDA 5C55A 1A0CA 2PEVA 1NDYA 1B31A 1S46A 5DCEA 1IEWA 2X1IA 2WB5A 1Q5MA 4CQ8A 2I5IA 3II1A 3FAXA 2CLKA 4DBSA 3WD0A 4P2VA 1FWIC 3OBAA 1EIXA 4JN8A 3CL7A 4DXKA 1LJYA 4JX6A 4Q4MA 4FA3A 2EJAA 3BV4A 3PUOA 2B31A 4M3PA 2RH9A 2VWTA 1ZAHA 1REQA 1UWIA 3N17A 1VHNA 3W81A 1GCYA 4JCMA 1CXIA 1FWGC 1GVIA 2WSRA 3BAIA 4Q4OA 1VJZA 3F4WA 2H9AA 3LGEA 3NDOA 2UY4A 1Q65A 4QEHA 3COTA 1BEUA 1EJWC 3S1VA 1FQ0A 9RUBA 4NYUA 1YLVA 4QNWA 3DKJA 1Z42A 1CXFA 1XLMA 4PL1A 4L1XA 3C52A 4HPJA 1UASA 2H8ZA 3LTSA 2QCEA 4OFCA 4A3RA 2AMXA 1F3WA 3PUEA 1HNYA 2DQXA 2QYGA 3ARPA 2ZZ4A 1E5NA 4BQ3A 5IM51 4H9MA 1DJWA 2PP1A 3F4DA 4UQBA 5DN1A 4UTLA 3SGZA 1C7TA 2OO6A 3G22A 3IUIA 1EWDA 2F6KA 3MA8A 2E9MA 3URQA 3WL1A 1X1NA 3PZVA 4HU3A 2NV1A 3OTRA 4JL2A 3G5EA 4HCHA 5JH2A 3H7UA 2W6RA 4LCQA 1DWIM 2WWDA 3DN5A 2DSVA 3T0TA 1IEVA 1CB2A 3WH9A 1FWSA 2ZA1A 4DBWA 5AC6A 3TUUA 3OZYA 1HF6A 1QI0A 3M5VA 6XIAA 1IF2A 1AUSL 2ONEA 2ZRXA 1X39A 4UR7A 4GNKB 1HKWA 5C9XA 4IIHA 1WZAA 2E25A 4CGTA 4ZENA 4A3YA 3B9EA 4J3TA 3KTSA 3N4EA 2Y89A 1NVMA 2CERA 1YDVA 2BXVA 1KFKA 3GBEA 3PBVA 4U33A 3AS0A 3MZ2A 2HCVA 1NARA 1UCWA 5G4EA 6REQA 4MZ1A 3BUVA 2IPWA 2QIWA 2WCGA 2REQA 1AMKA 3HG4A 1TVPA 3C0SA 1WKFA 1CYGA 2FB2A 2PDYA 1TYGA 4EPEC 3TVAA 3H2CA 3P84A 3QQWA 1WDSA 4QFUA 2GGEA 1J8VA 2XGBA 3HPAA 4J2PA 2G50A 3O6AA 5C7VA 4HN8A 3NPWA 1YTEA 3BLFA 1CWYA 5ABTA 2I9EA 3EKZA 1TV7A 1XLFA 3RG6A 3L9CA 3FDKA 5FEZA 3QGVA 1H60A 1C9WA 1XIJA 1TVNA 3C0QA 1RPXA 4DX3A 2FZNA 1JFXA 5F2GA 2O7SA 4FP1A 1TPEA 3T0BA 3L12A 1QXLA 1W31A 1YIXA 2A3AA 3NL2A 4QQ3A 1XRVA 4UTTA 3IV8A 3HURA 3BH4A 3MWCA 1UD5A 1IYXA 2GVGA 3R1ZA 3TROA 3M6YA 2HZGA 1GKPA 1SO4A 3NPUA 3UZZA 5DANA 2HSAA 3NZQA 2NX9A 2WMIB 4IXHA 3N18A 4LVGA 3P5YA 2X2GA 3BMXA 1V02E 2OKTA 4K8HA 4DUVA 4Q4KA 2AAAA 3Q2DA 2WNQA 3VCNA 3TP4A 1N55A 1YNQA 5B7YA 4CU6A 3GTIA 4JTCA 4FNQA 3WG6A 4C6JA 4B3LA 1NP0A 5HMFA 4NL1A 3TWAA 5F7UA 2DSUA 4WGHA 5A6JA 3OB8A 1QI5A 4ZOEA 1NQ6A 3TLLA 3W1NA 2F2HA 1DWJM 3GVGA 2NQ9A 2GVJA 4LUJA 3IUHA 4NX5A 4GO9A 2V69A 4KEMA 2F84A 2CNCA 3VFLA 2CLEA 4AX7A 1R3WA 5HXMA 1HVXA 3CK5A 1OF6A 1W17A 1O5XA 1P1MA 3CHFA 1U33A 4WSKA 1H2JA 1ONEA 3CUZA 5C5YA 2C7FA 4YTUA 3TC3A 4LGXA 1R7OA 2RUSA 4EANA 4AZCA 1VZWA 3MW7A 3EXTA 2FFCA 4OKDA 5M3WA 3TNBA 3PFMA 3NPXA 3OBEA 4ZMGA 5GJMA 2YL6A 3TC6A 5IRPA 3S0CA 5T26A 5EMLA 3TJIA 4E4FA 3SUWA 3F03K 2YLAA 1G4TA </