3MHUA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-nitroorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
307
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 107
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mhuA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mhuA01
1EX5A 1SW0A 2QR6A 1SO4A 3SIZA 1C8VA 1UCWA 4NJIA 3FIGA 3M5ZA 3CPRA 1H62A 2I1OA 1H7NA 4OV9A 2YYTA 5AHMA 1OVDA 4ZQOA 3KXQA 4XTDA 3VNDA 2CU0A 1Q6OA 2QCEA 2Y63A 5GVJA 3FFSA 3LV6A 3DZ1A 3AO0A 2DJLA 1TO3A 2YFOA 3C6CA 3O07A 3LTPA 3T40A 1TPH1 3O15A 3ABSA 3GR8A 4PCFA 3CM4A 1SZEA 4MPQA 3LX9A 3NQAA 4M6QA 3CWOX 1KLYA 1S3HA 4CQ8A 4NUWA 4CCCA 3M7WA 3IVUA 1M5WA 2H8ZA 4FEZA 1XM3A 1Q3NA 4LW7A 3FKRA 3WJXA 3CQ0A 2WSYA 3EWUA 3PUOA 4JX5A 2ZRVA 3W7NA 1KFLA 2YZRA 4U4MA 2WO5A 2X2GA 1T99A 4LV4A 5F4WA 3LCIA 1YDNA 3EKZA 1TSIA 3UWWA 4TMCA 3RNDA 5MHBA 1NF7A 2EAWA 1G7UA 2HSAA 3DFOA 4LVGA 2C14A 3QQ1A 5HUOA 3N73A 4K39A 2WPBA 4AHPA 3UPWA 4O1BA 5L6UA 1AL8A 2X1UA 5LHFA 2NWSA 2XN2A 4MLRA 1F2JA 3GLCA 3ZR4A 2TMDA 4JIPA 1HUVA 2QCMA 3M44A 4HNVA 3VE9A 1ZHAA 2PURA 1F74A 3O16A 3RU6A 1LP6A 2OCZA 4BK9A 2OMAA 4JY8A 1Q6RA 1S5TA 1OHLA 3PS7A 3PY2A 2F7FA 4O8RA 3AJXA 1QPQA 4O1AA 4OU1A 2E6AA 2ZA3A 1AL7A 5DXXA 4UFLA 5D37A 3ATZA 1KM0A 3P84A 3ZWTA 3W7LA 1TMHA 4YMZA 4PODA 5LNRA 3LB0A 4RLIA 2CLLA 4YCOA 3GDTA 2BXVA 4H6KA 5CSRA 3STCA 3TQVA 1X1OA 5LKYA 2VENA 2B4GA 5SWUA 4CCEA 3P8IA 3W7PA 3S1VA 3QFEA 2BX7A 1JUBA 3L5LA 4RXGA 2G95A 1LRQA 2ZRYA 5AN7A 5T26A 4Z0SA 3G1DA 5D09A 3N2XA 2NLIA 3TJXA 3L65A 3EWBX 1OFAA 1FWWA 1KM3A 3DFQA 3NQEA 1VCGA 1VLIA 4WY0B 1KV8A 5KSWA 1TPDA 5HQEA 2Z1BA 1K03A 1P1XA 2DZXA 4MZ8A 4UNKA 4AB4A 3PWAA 1AW1A 4ICNA 2V2DA 1YTKA 1VYPX 1G4SA 3M1ZA 5CG7A 3KVJA 1OX4B 4FNQA 1PCKA 4UNLA 1DJNA 3D0CA 4O1DA 4UMBA 4NNCA 5FESA 3T55A 4MYXA 4PA8A 3UWZA 5LSMA 3W2LA 2Z0IA 1L6WA 3PBVA 4MKNA 4OBTA 3RLUA 3MHUA 2QKFA 5F1UA 3QW3A 1FXPA 2Y7FA 1MSSA 5HUPA 2C19A 3I7RA 4JX6A 1XUZA 4AAJA 3KVMA 3NQGA 2ZCGA 4JY9A 1VCVA 3NQMA 2NV1A 4UTIA 2A21A 2J9XA 4UR8A 3PF3A 3QH2A 2EGZA 2JKAA 4UFHA 4MZYA 5AHEA 4R34A 2VFIA 3NO5A 5AYXA 1I8JA 3HIJA 4EVZA 1GZGA 3IGSA 5EYWA 5HJLA 1SO3A 3L9CA 1EUNA 2ZZ2A 1GQNA 2X30A 1E51A 3NVTA 4K38A 3W86A 3G18A 3S6DA 3TUUA 4OGZA 2P10A 5G5IA 4Q32A 4M6PA 2CFFA 3WFAA 1OX5A 3W70A 3W1TA 1LORA 2VFFA 3LCWA 3QPYA 4NX0A 1EP2A 4PFMA 1B4KA 3MYPA 4MJZA 1P0KA 3TSDA 2CLEA 3LHYA 3HQ1A 4ZQMA 5I3FA 3NQVA 2X1TA 4RKAA 2DU2A 1OJXA 1D3GA 3B06A 3I68A 1V7YA 2C6QA 3QSTA 4LOCA 2WOQA 1BKSA 2XFWA 5D2VA 4RZ6A 1K8YA 5EPDA 2C3ZA 2AGKA 4OV4A 1JCJA 1VPXA 2B7OA 3TC6A 1TPWA 1EA0A 1R2TA 4NXKA 3LERA 2CLOA 1PHQA 4CNOA 1TV7A 3UWVA 4Q33A 4P61A 1OFRA 1TTIA 1YDVA 4JTTA 1G67A 2QUTA 3LCLA 2VOMA 2YX0A 3LI1A 3IV3A 4LV9A 4LY8A 3L5AA 4B5NA 3BG3A 3G1SA 2JBMA 3V75A 5IM51 2JGQA 3GKAA 3CT7A 3W23A 2ZZ5A 2HMCA 2NX3A 3QSRA 4AVFA 3W73A 1FUYA 3Q37A 1EIXA 1F76A 1SPQA 3CB8A 4GXMA 4IPIA 3NL2A 1Z42A 3BPWA 5KMYA 3BLFA 3EX1A 3KHJA 3HOJA 2R14A 3TAKA 2C0AA 5DN1A 2QJHA 3TQ0A 3GZ3A 2Q3OA 3P62A 4WXYA 3UY7A 2UV8G 2VFGA 1C29A 3P81A 3OHIA 2ISWA 4KFPA 5I3HA 3A23A 3W6YA 1EWDA 3NQ8A 2ABBA 4H3DA 5D02A 5IBXC 3ZFHA 5FF2A 1GWJA 1WV2A 4MFDA 2AQWA 4JTUA 3G0XA 4O52A 5CPNA 4LS2A 3BW4A 5D2WA 1GJPA 1SUXA 3DFSA 3M43A 3R13A 3DHFA 4MIMA 4K8EA 5AOUA 4AWUA 5I3KA 1WQ5A 5HWNA 3QYQA 1H7OA 5LNUA 3W88A 3W85A 3KRZA 3TA6A 3MBFA 3L66A 4NT0A 3PBWA 4K37A 1MZHA 1YXYA 2KZHA 2YW4A 4TR9A 1ZENA 3HB9A 4HSNA 5EA9A 3BGGA 1TPVA 1ML1A 3LXCA 1H51A 4UFIA 4AWSA 4UTJA 3WK3A 4IMEA 2I14A 1VGAA 1QPRA 4LUIA 3QMSA 1G69A 3W71A 3OVRA 1H1ZA 1TJPA 1TV5A 3FLUA 4JX4A 4XTIA 2WV8A 2V5BA 4OQVA 5HMSA 2NXIA 1G7VA 1HTIA 4Z1AA 1ME7A 3HMJG 3W72A 5D2YA 1SSDA 5AHIA 5G4EA 3LM7A 4Z1BA 2QCDA 2ATSA 1TPB1 1B4EA 4XWUA 4JEQA 2NZLA 4O54A 1OFOA 4WZHA 4GNJA 5AHNA 1SZFA 2GJNA 2ZZ4A 4HN4A 5FF0A 3W7IA 3IIVA 1QNVA 1SW7A 4CNPA 5FEWA 3S9YA 1KTCA 1H5YA 1MEHA 2FB3A 5TBOA 2GQ8A 5EBUA 4HPXA 1QPOA 3CTLA 2H6RA 3W2KA 1Q6QA 1IF2A 1RQHA 3QF0A 1RVGA 3KOFA 4EF9A 3IEBA 3TW7A 3W22A 3TAOA 2LLEA 4UMCA 2TSYA 3LRKA 3GDMA 4NJGA 3LRMA 4MJMA 1KTNA 4IUOA 1TQXA 4FNUA 2YCEA 4QJ1A 5K3VA 5C54A 5CSSA 4FXRA 4JXCA 2DZVA 1DV7A 1LYXA 1JJKA 3CLMA 3GR7A 4JYDA 2OT0A 2ABAA 2QJIA 3LHZA 4ZQNA 1OFQA 2E5DA 1VS1A 1F7BA 4U28A 1GT8A 5BW6A 3QW4B 3W7OA 3DAQA 2FDSA 3GX9A 2Q8LA 3TCEA 3TMLA 6ALDA 1EUAA 1W56A 2QCGA 4IMFA 3NAVA 5K9CA 1O4UA 2CZDA 1SO6A 1J5TA 3M9YA 5FEZA 4FNSA 1P0NA 1VLWA 1K8XA 3C52A 3W2MA 1KM6A 4IXXA 2ZQ0A 2FJKA 3Q94A 1UASA 1JCXA 3W7GA 3SGZA 5HWMA 1S5WA 4IX0A 3W7MA 3STEA 1KFKA 3P5YA 4UC5A 3OBKA 2GVJA 3W1PA 5L9FA 1MXSA 5IBXA 1FBAA 5CZSA 3C2RA 4RV8A 5KZMA 4GUFA 3PSWA 2YR1A 3JR2A 1NVMA 2PRLA 1I2RA 2V30A 1K7FA 1VYRA 4N9EA 3E02A 2GJLA 1OF6A 4UTTA 2YDAA 8TIMA 2A7PA 4IGHA 4KWWA 1ONRA 1SSGA 5LZLA 2EHHA 2OT1A 5D2XA 3C3NA 3W76A 3MHGA 3M5YA 1HL2A 3EWYA 3M5VA 2HS6A 4A29A 2QCDB 2Y6ZA 3S8HA 1F05A 1RQEA 1JCMP 3L2IA 1OFBA 4GUIA 4X2RA 1N7KA 4MVAA 1AG1O 4GUGA 2GUUA 1TQJA 1FDZA 4AH7A 4EIVA 1W0MA 2FPYA 4LUJA 3G1FA 1SFJA 5E1QA 3I7SA 2BSLA 4S2CA 4N4QA 1HFBA 4PL2A 3SECA 2QCHA 2Z6IA 3HF3A 3I6RA 3PSVA 1TRIA 3UY8A 4RR4A 3B0UX 1LBLA 4J9JA 1AW2A 1GVOA 1FXQA 2YFNA 2H3DA 4YCPA 3W2JA 2O7SA 1OYBA 3TXZA 2C16A 2ZTJA 1XI3A 4A21A 5FEXA 1XBVA 4XKYA 4ORIA 1Q6LA 2JK2A 3T7VA 1NAL1 3CWNA 4DF1A 5G2WA 4JTHA 3EWXA 3MYOA 1JR1A 4JIQA 4NQ1A 3KFTA 3H54A 2WSRA 1W5PA 2RDWA 3MP3A 1ZAIA 1SZGA 3MP4A 4MOZA 1LRNA 5F2IA 4DF2A 2FB2A 4O0ZA 3MBDA 3EWWA 4GJ1A 3ZS4A 3EKLA 3L0KA 4ALDA 1OK4A 3DFPA 1T8XA 5D2TA 4FXSA 3K30A 3U8GA 3BG9A 3BLIA 1RD5A 4XUGA 5I3GA 3PM6A 4HIBA 3BARA 1QCWA 1U5JA 1ZAHA 3ELFA 1W1ZA 1GPWA 1X7FA 1KLZA 4R7JA 3NPWA 1KBJA 2Y7DA 3N9RA 3PUEA 4L4MA 4MZ1A 3QZEA 2CLIA 5LNSA 2H90A 4LU0A 3WK2A 1RQBA 4ONVA 3MI6A 3O6YX 3MO7A 3S5NA 4W9TA 1A5BA 3C8FA 4GE8A 5CZTA 3L21A 2GVLA 2E6FA 1W5OA 2FIQA 2E77A 4IQLA 1SFLA 3N2MA 4O13A 4UCGA 1AW5A 2TYSA 3NQ7A 3DHDA 3B0PA 1TV8A 1OK6A 4DELA 3TW6A 2PRHA 2YXGA 1JUKA 3KRSA 2WSQA 5CKSA 3NGJA 3NZ1A 3WJSA 4E2DA 2XN1A 4WX2A 3G1AA 1XFBA 1TPEA 1JQXA 1YPFA 1LROA 1YXCA 1TYGA 5G1YA 2QCFA 4Y96A 3W1QA 3M41A 1H60A 1B57A 3BW2A 3P80A 3DI0A 4DO6A 3B05A 3W84A 1T0OA 4FO4A 3DFTA 1W3TA 4E2BA 3W7RA 3NQFA 3A21A 2BTMA 3NZRA 4RK8A 3PULA 5FF7A 5KZDA 4D2JA 1BEUA 4I9AA 4DEFA 1LLWA 3EXSA 1ICSA 2P1FA 3G24A 3NL6A 4HT3A 4JTEA 3FS2A 5AHLA 1GYNA 3S1XA 3PB0A 3HG5A 2ATMA 1KM5A 3T44A 3NOEA 1G4PA 3CC1A 1QFEA 3FOKA 2J6XA 4JICA 3LI0A 2EF9A 1G4TA 5E0KA 4DO5A 4WOZA 3QC3A 2CLMA 5HINA 3SFKA 4XBKA 3R2GA 1TJRA 3PBUA 1QDSA 2A4AA 3TJLA 4RJEA 1OG0A 4UXDA 4PH6A 4IPJA 3W7HA 5AHFA 4UMAA 4N02A 4QIUA 3EB2A 1YPIA 3GAYA 4CQ9A 5K4ZA 3SY5A 1JUEA 4FIQA 4KFOA 4XBSA 1X1ZA 1U83A 3G1XA 5CPMA 3W7QA 1FDJA 4UTMA 1A50A 3SJ3A 4MYAA 3EX3A 3NQ6A 1AMKA 5U4NA 1ICPA 2RDTA 1VRDA 4FF7A 4QAIA 4M5PA 3W7JA 4I7VA 3W2NA 3LXAA 3CIXA 3P74A 1GYLA 1UUMA 3P61A 4BWLA 1LTDA 4DBEA 2QEZA 5DCDA 1D9EA 3DU0A 1W3IA 5K7JA 5I3JA 1MEWA 5LHEA 1VR6A 5A5WA 3OIXA 1DQXA 4X9SA 3NM3A 4GWEA 3PR2A 3W75A 2V9DA 5A8GA 3FJLA 1Q45A 1SQ7A 3P5ZA 3C2OA 4UFJA 3W1LA 1VJIA 2J24A 5J5DA 1Y0EA 1TTPA 1EEPA 1WXJA 2E6YA 4S1FA 3NPUA 3HGJA 1H7RA 2FPTA 3A9IA 3A5FA 5C55A 3G0UA 4Z1DA 5KTLA 1OX4A 4NJKA 3C2FA 1XXXA 4LC6A 3HO8A 1JCYA 1XDLA 4PTNA 3C2VA 1M7OA 4DBDA 2WNQA 3O8AA 1R30A 3UYCA 2FQIA 4Y9AA 1FCVA 4HPJA 4HSOA 1F6PA 1V5XA 4O10A 5BRBA 3TFCA 2ZZ7A 4WUIA 5HR6A 4GC4A 3UWYA 1FWRA 3L68A 4Y90A 3W7KA 4FNRA 2OX1A 3CIWA 3DGRA 4ZQPA 1IGSA 3SI9A 1GVRA 2RDUA 1O60A 5HR7A 1N55A 3MI3A 2W6RA 3NEVA 2BLEA 1KW1A 4O15A 5C5YA 6TIMA 3JS3A 1L2UA 3OVQA 3NL3A 3TFXA 1TREA 4AXKA 1YTDA 3TIMA 5J5RA 3N3MA 1LM1A 2WQPA 4TX9A 1GVQA 3DKLA 1FDYA 1QO5A 1KV5A 4N9CA 3BG5A 3G3MA 1TCDA 4IMCA 1VHNA 2YGYA 3W2UA 3M5XA 4N2YA 3G1VA 3FEMA 2V5LA 3EXTA 3QJAA 2G97A 1R2SA 4BWLC 4CLMA 1LOQA 3NXFA 3STFA 3UD6A 3W7EA 3A22A 3R8RA 7TIMA 1ZNNA 5D05A 4LNYA 4O57A 3LV5A 5LNVA 2ZRZA 1A53A 1EP1A 2E1DA 1KTBA 1UJPA 1BWLA 3UNDA 4MY8A 3Q2DA 2V81A 4JDBA 4UR7A 3O6CA 1W5MA 4HNNA 4O4VA 2XN0A 3W9ZA 5E93A 4RCXA 2QUUA 1H61A 5H2ZA 4IMDA 1GVFA 4M7TA 4LS0A 3GXNA 3P67A 3QEZA 4Z0JA 4ZMGA 2P0OA 1QPNA 3GNNA 2R8WA 4ZQRA 1VCFA 4FX7A 4AHOA 2H3BA 3P60A 4BI5A 3O63A 2GQAA 1OFPA 4XZ9A 4RX0A 2X16A 1ME9A 2GPTA 4JTLA 1Z48A 3W83A 4MFEA 3YPIA 4DF0A 2E5BA 4IWWA 3BGJA 3OEXA 4ADUA 3V1PA 3G1HA 3S0CA 3SR7A 4NJHA 1JVNA 2TRSA 2YSWA 3PVFA 3G8EA 2ZZ3A 1W8SA 1DOSA 1RV8A 2E09A 1I2NA 1KM1A 2VEKA 1M6JA 3TNOA 1O95A 2QCNA 3O05A 2VFEA 3DI1A 3UXDA 3W1XA 5KITA 2NXHA 4O1CA 4QITA 3LXBA 3KAOA 2VEIA 4LVAA 3QRHA 4JS3A 3USBA 3S5OA 5AYZA 4LVDA 4O0KA 5BOOA 4IX2A 1DJQA 1GTHA 3LCXA 1RPXA 4Y6GA 5CZ0A 1KA9F 1RZMA 3O1NA 3L0NA 3H53A 4QNWA 5D33A 5C6MA 1ZCOA 3GB6A 1PV8A 3EX4A 5EL1A 1SR9A 5CGQA 1J4EA 4JTKA 2QCLA 4K7YA 1XBZA 2A85A 3LBCA 1KFJA 3KVLA 1WAUA 3TX9A 2R94A 5G4WA 1PE1A 4R53A 1QWGA 3HBLA 5DY2A 2NUWA 2QDGA 1WOBA 4FHAA 2ZDRA 2DJXA 3KVKA 4EWND 1X8FA 2VXNA 4JTGA 5LGZA 3LHUA 1RR2A 3MMTA 1VZWA 3U2OA 4NX5A 3W1MA 2QCCA 1R2RA 4UFMA 2EPHA 2ZZ1A 3HG3A 3QPZA 4KKXA 4JYEA 3O6DA 4EF8A 1KM2A 2A1YA 1FCQA 1I2PA 3M0ZA 4IMGA 4WQ6A 2J9YA 4POCA 2O7QA 3CEPA 4UTWA 4OE7A 1DORA 3LDVA 2F84A 3GAKA 1KM4A 5D03A 3PB2A 3Q58A 3P7YA 2J27A 4C1KA 1H50A 3W1AA 3C4UA 1OYAA 1SO5A 3W74A 3GIYA 1VYSX 3N14A 2FTPA 2DZWA 3VFLA 2I9EA 2WKJA 1H1YA 1PS9A 3L67A 3LHWA 4X22A 1I2QA 4CCDA 4NXSA 3B4UA 3MHFA 3BLEA 1L6YA 1XBXA 1FCUA 5AC8A 2C1HA 4ADTA 4JN6A 5F2LA 4JNMA 1H7PA 2C15A 4ML9A 2PE4A 1QO2A 3RK8A 5I3IA 3MP5A 2JKEA 1X6UA 1D3HA 4UUIA 2TPSA 4QM1A 1XC4A 4LWWA 4C1LA 4LVFA 1EPXA 2B7QA 2VEMA 3B0VC 3F1QA 1JQVA 3E0IA 1KFCA 3NDOA 4XQ6A 4O4WA 5BMXA 1PL9A 3TU9A 1OFDA 2CZ5A 5K9XA 5DELA 3NR0A 3TK7A 5DXYA 3IGXA 4O50A 3ABOA 4I7UA 1LOSA 4DQWA 2YW3A 2GQ9A 4NZJA 3TH6A 3MWAA 2D73A 1ZY9A 2YPIA 1M7PA 3M6YA 2X1RA 1OYCA 1L9WA 3FJ6A 2VFHA 1IXNA 2PC4A 3QMRA 5CZJA 1W31A 4BI7A 1LBMA 4Z1CA 3VI2A 3B04A 3TE9A 3GYEA 3KX6A 2QAFA 4MY1A 2NWRA 3I65A 4R33A 3HG2A 2ISVA 3H55A 2ZA2A 4YLWA 2FLIA 3UWUA 1UBSA 1JCLA 2Y88A 3LHVA 3TSBA 4NZFA 3THQA 5LGXA 1F73A 4FNTA 1K3UA 1PCWA 2A2IA 1EP3A 2CLFA 2RHGA 4GUJA 4DO4A 2JGYA 1CI1A 2V82A 3T4CA 3WJZA 3EWZA 2A0NA 2BWGA 1K7EA 3S42A 1IXQA 2ZTKA 1LOLA 1S5VA 1W54A 2PCQA 4NVTA 3ABRA 1OFEA 1WYIA 1I4NA 3IGUA 2V2CA 3NL5A 3OVPA 1FCBA 5DLCA 3G0SA 3QMTA 1QMLA 3NG3A 4S2BA 2W79A 3TC7A 4QNEA 1R46A 4UTKA 1UB3A 3EXRA 5K4XA 3FKKA 4ADSA 1ME8A 2Y61A 3KRUA 3STGA 1WDWA 1W37A 3NM1A 3BVJA 3R89A 2QJGA 2Q8ZA 3HG4A 4NJJA 5TQLA 3GNDA 1HO1A 1JRBA 1LDCA 4ZL1A 2X1SA 5DY3A 4KWVA 3THAA 1AK5A 3EX6A 5K2ZA 3LHTA 2B0MA 4UTTC 1XKYA 1WBJA 1SW3A 2ZRWA 4I7WA 2GOUA 4Z08A 5AFDA 3HPSA 4A2RA 4BFAA 4LTSA 3LCFA 4PL1A 3E96A 4CNNA 3PG8A 3TXVA 3BW3A 1IXPA 5AYYA 3NYZA 1K02A 2DP3A 3QM3A 4TMBA 4M7SA 3SGUA 1G6CA 2B7PA 2QF7A 3SZ8A 3BK0A 4RXFA 1YYAA 2J88A 2RKXA 4O19A 1ZAJA 2CWNA 3A5VA 4BI6A 4JD4A 1LZOA 1ADOA 4YWIA 5HWJA 3TKFA 3N9SA 5F4XA 3NPXA 4LRTA 3MUXA 3NQ2A 1ZFJA 1FWNA 3ZWSA 2A7NA 4ORMA 1HG3A 1GTEA 5H91A 1W3NA 3LOTA 3UWQA 3A24A 3WJWA 1ZJIA 3FA5A 4A2SA 3RLVA 3FYOA 4QQ3A 3P82A 1IXOA 1HO4A 4N6FA 3SW6A 1W5QA 1TPC1 4JTFA 2Y62A 1XCFA 2NX9A 4AF0A 2JKPA 5DCBA 2ZRXA 3UPBA 5G1TA 4O18A 4O16A 4YL2A 3TV8A 3TROA 3INPA 4E38A 4WY0A 3M47A 4AMAA 3QQ0A 1WBHA 4DPQA 3LLDA 1MEIA 1WA3A 3W7DA 3TSMA 4WXZA 3NPVA 3UQNA 4AWTA 5ABTA 3LTYA 5BMWA 5BNKA 4UIOA 3W1RA 3IIPA 4AEOA 3W7CA 3PG9A 2NX1A 3M16A 4O17A 2HTMA 3U6WA 5C2XA 3N34A 4NNAA 4UTHA 2VELA 2ALDA 4UTUA 5DBUA 3C2EA 1A5SA 2QAPA 5KINA 4NU7A 1YADA 2RH9A 1NSJA 3HPZA 2CLKA 3CU2A 3S5YA 2QUVA 4JTIA 1YDOA 2G96A 2VC6A 5U7SA 5HNRA 1XL9A 1PIIA 4JR5A 1KBIA 4H4IA 1VH7A 3DENA 3E9AA 2IQTA 3E12A 4GRSA 4K7VA 3SSJA 3VE7A 4A22A 3W1NA 2ISSA 2Q3RA 2Y89A 4WD0A 1J2WA 4DXVA 1K7XA 3F03K 2NXGA 1QOPA 4JDYA 2A6LA 3W3OA 2WJZA 3IIZA 2C13A 1QOQA 3C56A 1DHPA 3LRLA 4GFSA 3UZ5A 2FFCA 3IVTA 2V0TA 1FY6A 1OABA 3C0JA 4JYFA 5EKYA 1SZNA 4UFKA 1DKWA 5F2GA 3WK0A 2DZPA 3TMQA 4O53A 1OF8A 4RZ5A 4LC8A 4PC8A 3DBPA 3W07A 4XKYB 3UZJA 2VEPA 1TPFA 1B3OA 1N8FA 2Y7GA 2GVGA 4CQAA 5KZEA 1T96A 4YXGA 2AAMA 1Z41A 1TPUA 1JCNA 1TIMA 4FX8A 4KFNA 5D30A 5F1VA 4DPPA 4HNUA 3B03A 3HGRA 4MY9A 3VKJA 4N9BA 3HGOA 3NA8A 1QR7A 1WX0A 5D38A 1CW2A 3TR2A 3ANYA 1VHCA 5EY5A 1UUOA 2DZUA 3DKJA 5DBTA 4MLJA 4BF9A 3BO9A 3N19B 2J9ZA 2E6DA 3W1UA 1YTEA 5TIMA 1PVNA 5EMUA 1IIHA 2CZEA 2V8ZA 2Y85A 4NNBA 1L6SA 1W5NA 2PRMA 2A7RA 4RZ4A 2CZFA 1C9DA 3TDFA 5F4SA 1MO0A 3LBMA 5K9DA 2C18A 3CEUA 3PBYA 3IRDA 3LLFA 1FX6A 3ABQA 1LBFA 3HPXA 3PC0A 4N6EA 3B8DA 2ZYFA 5G2IA 4JTSA 3C61A 4LRSA 4N4PA 2ZZ6A 4L4LA 4JTJA 5AB3A 2QDHA 5HULA 4P2VA 1H7WA 2A5HA 4AHQA 3MW7A 2Z2UA 4K6AA 1NF0A 1NEYA 3TQKA 3UXAA 3GVGA 4O11A 2ZA1A 2WNZA 2BZNA 3DFNA 3NQCA 4M19A 3LCGA 1Z44A 2NUYA 2NUXA 1TB3A 3BV4A 1TTQA 1H7XA 2DORA 2Y7EA 4TU1A 4ZVJA 3WK1A 1JULA 1LRTA 2RFGA 5D04C 4OT7A 4FX6M 2V2HA 1I2OA 3LGEA 1GEQA 4UTWC 4QISA 1GVSA 4OWGA 2Z6JA 1LLZA 3DXIA 1QAPA 3PUDA 5AC7A 3P8JA 4Q4KA 5F2MA 4IOTA 2Y70A 3GDKA 2ZBTA 3G1YA 4K8HA 4OHQA 3S1WA 3T78A 2W0UA 5AC6A 3GKFA 1B9BA 1F6KA 4X3ZA 2VKZG 1ICQA 5FF4A 3HJZA 3L5MA 2B7NA 5FI8A 1DQWA 2ZFAA 3S1UA 1O94A 3S5ZA 4FB7A 1DVJA 3CHVA 4M6VA 1ALDA 4O12A 2OJPA 3E49A 4FIRA 1I45A 3NQDA 3G22A 4A3UA 3GXTA 3DH7A 1F5ZA 5FF3A 5CPOA 4O14A 1FWTA 1KFEA 4E0CA 3F4NA 1H63A 4QSHA 4WOQA 3I7QA 3F4WA 3O06A 3GK0A 1FWSA 3G3DA 3LCHA 4TO8A 5LNWA 3W87A 2FPVA 2R91A 3LTSA 1LCOA 1FQ0A 3IIOA 3NNTA 3RF9A 4ZZ9A 1IIGA 2DZTA 2VFDA 2YYUA 1O5KA 1NFBA 4LVBA 4IXHA 1R47A 1TRDA 1A5CA 2E5CA 4HHPA 1P4CA 1VC4A 1EB3A 3OG3A 4Y8FA 4UTLA 2H8XA 4N9DA 4PEKA 1PHWA 1GG1A 5DCEA 1JRCA 2CLHA 1YLVA 4TIMA 4WY0F 4HNTA 1GOXA 1TTJA 3GDRA 1O5XA 4EOUA 1KFBA 2OZ0A 3L0GA 1DL3A 1G4EA 3IIXA 1XUUA 3FYPA 4IJBA 1CX9A 4HKPA 4FNPA 2DZSA 3JRKA 3IVSA 1EWEA 3RMJA 2EKCA 2E68A 1P5BA 3OA3A 2G5WA 2WNNA 4MUZA 4GUHA 1SU5A 1YXDA 2CW6A 3ATYA 3GXPA 4WJEA 1GG0A 4O28A 4ZQCA 1K8ZA 1BTMA 5CPLA 3EX2A 4K36A 1DBTA 1BWKA 3R5EA 4JGDA 4LS1A 1XBYA 3PAJA 3MI2A 4BR1A 4LT9A 2NV2A 3WJYA 1OX6A 1ZALA 4AF0B 3MJYA 3RFAA 3R12A 3HGSA 3VCRA 3G8RA 4GBUA 4G1KA 5FEPA 2ZRUA 1WOAA 2HS8A 3GDLA 1VQTA 5G2HA 5D32A 3EEGA 1XDMA 2A6NA 1A5AA 1THFD
chains in the Genus database with same CATH superfamily
4YYFA 2OEKA 1SO4A 3RMEA 3ZR6A 3N6HA 3GC5A 1H62A 1H7NA 5A95A 4OV9A 4XKMA 3GVQA 3OW1A 2WYSA 1QNOA 3MMUA 3J7HA 2QCEA 2GWNA 3HV9A 3DZ1A 1TO3A 2PBOA 1C93A 4M0XA 3CM4A 1SZEA 3OQ8A 1RH9A 5LIWX 3M46A 3SY1A 3CWOX 1S3HA 2GOKA 3IVUA 1KFWA 3DYMA 2R24A 4FEZA 4XIMA 4PUMA 2R1KA 2QQ6A 1U2YA 3FKRA 2PTYA 1SZRA 1R5YA 2SFPA 3CQ0A 4EXQA 2WSYA 4AD4A 2ZE3A 2QPSA 1LF1A 3PUOA 3W7NA 2YZRA 3UPMA 2I17A 2WO5A 1FWEC 4RNHA 2X2GA 5F4WA 3LCIA 3R1ZA 3GNXA 1NF7A 2EAWA 4MWAA 2HSAA 3AIEA 3DFOA 4YS1A 4PFHA 7ENLA 2C14A 1Q8AA 2O0TA 2I5IA 4WKHA 4AHPA 3UPWA 2PFHA 2PBGA 5L6UA 1AL8A 5LHFA 4GCAA 4GO9A 2XN2A 1DJXA 1F2JA 3GLCA 3LUTA 3ARUA 4M51A 3W00A 3QHNA 2QCMA 4HNVA 1XIIA 1F74A 3O16A 1LP6A 4FPSA 3CQHA 1PTGA 3HQPA 1S5TA 1JZ2A 4O1AA 3FHAA 4NP7A 2QT3A 1Q2RA 1RCOB 2PWHA 4UFLA 3ATZA 4QAWA 3DC8A 1TMHA 1UG6A 4Y9OA 2G50A 5REQA 3LB0A 4RLIA 2CLLA 1BXBA 4YCOA 1F07A 2GGIA 3LMZA 3RHGA 3DG6A 1BSIA 4CCEA 3VOHA 1A5OC 5DMLA 3W7PA 4PTDA 2BX7A 1JUBA 1CXHA 1LRQA 5T26A 2PDGA 3ZIZA 3CPGA 1XS2A 3GU9A 5JBDA 3GWQA 2NLIA 1J6PA 1JCTA 3EWBX 1OFAA 3DFQA 1VCGA 1UKSA 4WY0B 1KV8A 4NHVA 1TZ9A 1P6BA 3O7UA 4C6IA 1HJUA 3ERPA 2PMQA 1EJVC 3DDMA 4GYPA 1P1XA 1QT1A 4AB4A 1EJ7L 5BOFA 2V2DA 4XV0A 4MMWA 3MSGA 3MZ2A 5CG7A 1FWCC 1LQAA 2OO6A 4D6GA 2ZUTA 3MS8A 3T55A 4MYXA 1KGXA 3FA3A 3UWZA 5LSMA 5T8GA 1VFUA 3OGSA 1ITCA 3K1DA 3PBVA 4MKNA 2Q8XA 3ARVA 3RLUA 2FZBA 4ML4A 3SUTA 2J74A 5HUPA 3CV1A 4PUJA 3UJFA 1PTDA 3NQMA 2NV1A 3JZEA 4PB3A 1R85A 4UFHA 4IIGA 2HBVA 2VFIA 3ENLA 3NO5A 1QK2A 1UR9A 1I8JA 1ISXA 3HIJA 4EVZA 5EYWA 3L9CA 1GGOA 2X30A 4REQA 4PE8A 3F5JA 5G5IA 2CFFA 1LORA 3VDGA 1V93A 4D8ZA 3ORWA 2PWUA 1EP2A 4LXFA 1B4KA 4MB4A 1P0KA 4X63A 3TSDA 1A0EA 1A3HA 5I3FA 2X1TA 2GYIA 4HU4A 2R9RA 3I68A 2C6QA 2NQZA 3QSTA 4AISA 2WOQA 2VX4A 2Q02A 1TA3B 3CQJA 5EPDA 5IHRA 2AGKA 1E5NA 1EA0A 3LERA 2HNHA 4RDZA 2C1GA 2VGGA 1A5MC 1TZZA 4IQDA 1R9YA 1TV7A 4BKNA 1TTIA 3MMDA 2QUTA 4XISA 1UD2A 4HPNA 3KOXA 3LI1A 3PZMA 3L5AA 4GYPC 3G1SA 1H49A 3B0XA 1B3ZA 4Q8QA 4QLKA 2JGQA 2ZZ5A 1CNVA 2O56A 4W5UA 5BXTA 1BVNP 3W73A 2GGJA 2D0FA 4GXMA 1Z42A 2YLAA 2GSEA 3EX1A 3HOJA 2R14A 2IQDA 4G5DA 4FOKA 4NKCA 3P62A 1FP9A 4TTGA 1UR0A 2VFGA 1C29A 4HOWA 4KRTA 1UOKA 3H7UA 2ISWA 4KFPA 1HZYA 1BWVA 3WLHA 4AEFA 3GFXA 2X7WA 4PBGA 1UQYA 3NQ8A 4KCUA 2GDVA 2EEXA 4KQNA 4QLJA 5D02A 3ZFHA 5FF2A 4QE4A 1WV2A 3ITTA 2VI0A 4U2YA 5I23A 4IIEA 3ZVIA 4LS2A 3WQ5A 3BW4A 3PHAA 1GJPA 4J1OA 3DFSA 1B3XA 3A3HA 3M43A 1UH3A 3VO0A 3DHFA 3KWSA 2FKPA 4AWUA 5XIMA 1WQ5A 3KRZA 3L66A 4NT0A 1JG9A 1MZHA 1YXYA 2IS7A 1EO5A 1ZENA 3K1GA 3QVQA 5BU9A 3WF1A 3BGGA 1ML1A 2VNCA 2I14A 4F40A 4DM2A 4LUIA 3OVRA 1TV5A 1TJPA 3FLUA 2TODA 5ABEA 4RPQA 4JX4A 2V5BA 5HMSA 2NXIA 5I5RA 3W72A 1SSDA 2EQDA 1HXJA 4QDMA 1BHGA 2QCDA 3N11A 4HMNA 2NZLA 3N2CA 4PCSA 2BNJA 4GNJA 4H00A 3SURA 2VVSA 2GJNA 2XVLA 2ZZ4A 5FF0A 1DXEA 5JQ9A 2CCRA 3S9YA 2DZAA 5EBUA 4UZUA 4ACZA 1OGGA 1RQHA 3MSYA 1JDFA 3N2TA 1VJZA 4MWAB 1MDLA 3W22A 2F6KA 4NJGA 1YIXA 4GG9A 3W24A 1KWKA 4RE2A 2FJUB 3IV8A 5GPRA 1UWAA 2WMKA 4FXRA 1F6YA 1YMYA 4A8NA 3RJYA 5C9ZA 5EU9A 4B91A 4JYDA 5H8MA 1E1FA 4QLLA 1CZ1A 3AC0A 1VS1A 4U28A 3VNYA 5BW6A 3QW4B 3QLDA 3TOYA 1NOFA 3GXFA 3SRDA 6ALDA 3CZEA 3I6TA 5I09A 1W56A 1JPHA 5C9XA 4IPLA 4CU6A 3VKAA 2ZQ0A 1UPPA 4GI6A 4NRRA 3W7GA 3GSMA 3SGZA 2MUCA 2C0HA 1NY1A 3V0SA 4J3SA 3P5YA 2GVJA 3ZJKA 3IGHX 4GC3A 5L9FA 2CESA 4QXIA 3L2MA 1FBAA 5KZMA 3PSWA 1I2RA 2XISA 1K7FA 3E02A 2GJLA 1OF6A 2A7PA 1ONRA 2OT1A 3D47A 3M5YA 3EWYA 3VTRA 5C8BB 3AXIA 3C3UA 3L2IA 4AG0A 2INZA 5KEZA 4KWOA 3TTYA 3L23A 4L7ZA 1FDZA 1W0MA 3U2CA 2HK1A 3TN4A 3I7SA 2BSLA 1O5RA 5DMMA 5CC3A 1C3FA 4FXFA 2UY3A 2YCIX 3LYEA 3VKDA 1TRIA 4RR4A 3CZJA 3FGCB 1TKKA 2YFNA 2H3DA 1NOUA 1LQ0A 3CV6A 2O7SA 3QGVA 2P53A 3GG1A 2ZTJA 1XI3A 1XBVA 3KDOA 4ZR8A 1Q6LA 2JK2A 3CWNA 2YOCA 4DZIA 3MYOA 1JR1A 1BQCA 3NUKA 4WLCA 2PWVA 5IXEA 5CZKA 3AWNA 3MUZ1 4JQ1A 5JMUA 3PJUA 4R9XA 1SZGA 3AIBA 3MP4A 4F2BA 1EH9A 4GQBA 3R6IA 4IGMA 1DIDA 3N18A 2R6OA 1T8XA 1J12A 3OYZA 1HW6A 2W9MA 1RD5A 5JUVA 2OODA 3VIMA 4NI8A 1NIUA 1PKMA 3A47A 1U5JA 1W1ZA 4JNZA 1OC7A 1V3KA 1HJXA 1JPMA 4OOZA 2ZUNA 4LU0A 1RQBA 2RUSA 2BODX 4K2SA 4AX6A 1S38A 4ONVA 1TV2A 4TUFA 3DCPA 2E6FA 4B3LA 3SCUA 1SFLA 4UCGA 2TYSA 3QV6A 4B3ZA 5FOOA 3B0PA 3U5UA 4JIEA 5CEWA 2V3FA 4LFYA 1JYVA 1I9CB 1A5LC 2EKGA 4YYCA 5BXSA 4XB3A 1SJCA 3GHUA 3NZ1A 4E2DA 2XN1A 2J7HA 1XFBA 1ZBCA 1DEDA 1YPFA 4ZO7A 2Y1HA 1P43A 4OUEA 3GTFA 2G4JA 2ZUUA 4DO6A 2OXNA 3B05A 4LUSA 2F61A 3WF4A 1LL4A 1T0OA 4GI8A 3DFTA 5CJ5A 1E5JA 2BHYA 4B5SA 3U2EA 2WZHA 4DEFA 1CENA 2YIHA 4S3DA 2NVCA 3G24A 3NL6A 4JTEA 4XO6A 1E6SM 1GYNA 3RPDA 5CBJA 5E70A 3HG5A 4PUWA 2FTYA 2OZTA 3LNPA 3T81A 2YL5A 3SIMA 3H7VA 3FOKA 4JICA 4DO5A 1CIUA 3NVDA 3PZNA 2VRJA 4E6MA 1TVPA 2CLMA 3R2GA 1TJRA 1QDSA 3TJLA 5JXQA 4IPJA 4IF2A 4JZ5A 1K6WA 4UMAA 4N02A 3VOJA 3TYDA 3IARA 4P7OA 4KFOA 4XBSA 2DIKA 3H2OA 4KBXA 3OP2A 3ZJ7A 3GU2A 1QI5A 3SCSA 2YBTA 3W7QA 1FDJA 1S5NA 4RDVA 4HBKA 3F7JA 2GWGA 2XDFA 4GI9A 3NQ6A 1XW8A 1IWAA 4PYSA 5U4NA 1FWGC 1VEMA 3CT2A 2CXEA 5FJRA 3K4AA 3W7JA 3FEQA 4I7VA 3WH5A 1GYLA 4R7WA 3P61A 4DBEA 2QEZA 4C6CA 5G1MA 1W3IA 1KR0A 3FDGA 1VR6A 2OYMA 5CAHA 3OIXA 4QROA 3NZGA 1WZAA 1ZJAA 2A3CA 4M29A 4C6NA 3NYDA 5FIPA 1NFPA 2V9DA 3FJLA 5IDIA 5E6ZA 1SQ7A 3P5ZA 4HA3A 4Q8WA 1U5VA 2GK1A 3N17A 3RITA 4J4KA 1Y0EA 3JUGA 1EEPA 3TWAA 4YNGA 1VEOA 2CKSA 2IUZA 1CGUA 3LG3A 3A5FA 4RUBA 4Z1DA 3RGTA 3KP1A 2QUMA 1JCYA 1XDLA 4PTNA 3C2VA 5ABHA 1M7JA 3O8AA 3VOIA 1R30A 3CZGA 1XIEA 3UXLA 3RO6A 3VD4A 3JW7A 1FA2A 2XINA 1V5XA 4R27A 5BRBA 2XFFA 4S3GA 4F8XA 3W7KA 2OX1A 1P6WA 4ZOEA 4AD5A 3MCNA 1GVRA 1O60A 2I9UA 5HR7A 4JQAA 4O15A 4UQDA 2XSBA 1A4MA 2OU4A 6TIMA 2BOFX 2L5HA 3NL3A 1LM1A 1JXKA 1GVQA 3DKLA 1V7AA 1KV5A 4N9CA 3B9NA 4QGCA 1J18A 2E0PA 2HPMA 3W29A 2IPJA 4IMCA 4Z17A 1TV4A 1LJYA 1NQ6A 2A3EA 3RPTA 4W87A 3CL7A 2XZ9A 2OGYA 4CLMA 3PFRA 3UD6A 3W7EA 4XD5A 4DWSA 4LNYA 3VDBA 3FAWA 5LNVA 1A53A 2R1NA 6CGTA 4K3ZA 1KTBA 2J8TA 2W92A 3B97A 3TN5A 1GQKA 3WBEA 2OGJA 1GCYA 3Q2DA 1EZ2A 3KL0A 5A3HA 4UR7A 1W5MA 3H2MA 2EPNA 1ZTVA 2JF7A 2QUUA 2WWDA 2R1PA 4RCXA 2F9RA 1PZ2A 3BLPX 5BXRA 4M7TA 1OT2A 3FXYA 1HIZA 4Z0JA 3TN3A 2P0OA 3GH5A 3POHA 1VCFA 4XZ9A 3KOWA 4LAMA 2GPTA 3O0FA 4JTLA 4FSAA 4XZLX 2E5BA 1KCXA 1W1VA 4IWWA 3G1RA 2DVXA 2FFIA 4K1GA 3G1HA 4KEUA 4TQTA 2J13A 4MTVA 1JVNA 4PCNA 1OZQA 2E09A 3VZYA 2WCSA 5C2CA 1WE5A 4X60A 3W1XA 2J77A 3GFYA 4O1CA 1ZRQA 2BGNE 4LVAA 4JS3A 3ABZA 5IRPA 3S5OA 5AYZA 3WDRA 4IX2A 2BMBA 4M82A 4HOXA 1XLMA 1KA9F 1RZMA 4FS9A 3L0NA 3UG8A 1ZCOA 2ZUWA 3EX4A 1SR9A 5EL1A 4F0KA 2J7EA 2ZICA 4P7NA 1J4EA 4GXPA 4JTKA 1CXEA 4K7YA 4AIBA 3HPAA 1B3YA 3BV7A 5A94A 1EJWC 3LBOA 1VBRA 4WJXA 4HHLA 2ZUVA 5DY2A 4HA0A 3E38A 2NUWA 4AEEA 4FHAA 3V5FA 5EMMA 2ZDRA 3I3DA 2DJXA 4EWND 1X8FA 3N4EA 4JTGA 5LGZA 3LHUA 1RR2A 3MMTA 3XINA 3U2OA 5JU6A 1AQMA 4IFKB 3W1MA 3EAUA 4UFMA 3KCJA 4DIAA 4J3VA 1F3WA 4LYPA 2A1YA 3MV01 1I2PA 3M0ZA 4P7LA 2J9YA 4POCA 2O7QA 3CEPA 1GW1A 3H70A 4WVXA 1DORA 1V6TA 3LDVA 3Q58A 3QKZA 3E0FA 4GQRA 1JNDA 4C1KA 1H50A 2YCLB 1VFSA 3KE0A 1OYAA 1SO5A 4YVPA 2VUNA 5HQLA 3HMCA 1J2BA 2FTPA 2V5CA 3WEMA 3LHWA 4MM1A 1UIOA 5CG0A 3B4UA 4DM1A 3OZYA 1YNYA 1TWIA 3USZA 2GSHA 4GVIA 4JNMA 4CCZA 1H2JA 2QGYA 1ZJBA 3MP5A 1B2YA 1UA3A 1X6UA 1P1MA 4LWWA 4C1LA 1X38A 5DT7A 3RDKA 2B7QA 2VEMA 3B0VC 1JQVA 1OM0A 3CWHA 1W1B1 3ARQA 2WLYA 5G4HC 2VGFA 5M5DA 4WGHA 5HPCA 3L4TA 3NR0A 3IGXA 4O50A 3ABOA 2ACSA 4LSBA 3TH6A 4NYUA 1M7PA 3CUHA 2X1RA 5JH1A 4D72A 3TVAA 2PC4A 1N8IA 5CZJA 4Z1CA 3GS6A 4O0QA 3KX6A 2QAFA 2PWGA 1OINA 4NASA 3IAPA 2NWRA 2OEJA 2CBIA 3SN0A 3HG2A 3VNJA 2ZA2A 3C0QA 1UBSA 3CHCA 1PIGA 3TSBA 4IIHA 1E73M 4Z2IA 3SFWA 4KIRA 4JNYA 1IEVA 3U48A 1S5VA 4NVTA 1OFEA 2Z7KA 1AFSA 4LQ1A 1KXTA 1P0BA 3SUWA 1TWWA 1FCBA 3NG3A 1BXNA 3IUDA 1TVLA 2W79A 4JHMA 4Y8EA 3BC9A 1YPXA 5EBAA 1W9UA 3R25A 1OG6A 1JAEA 2Y61A 3STGA 1WDWA 3BVJA 2BS9A 4GJJA 2R1MA 1JRBA 1S2TA 2B0MA 1XKYA 4BFAA 1GPFA 2X7VA 4QS5A 2WMFA 1EA9C 4LTSA 3LEPA 3WUEA 1FKWA 4IFRA 3E96A 1MNZA 3PG8A 1Q6FA 2YCLA 3KBMA 2J7FA 4GLEA 2IXUA 1CYGA 2PB1A 3N4AA 4IL2A 3SZ8A 3ZT6A 1POJA 2PDUA 4HZ7A 4ZENA 1TWDA 4US6A 2CWNA 4CGTA 3LQLA 1JYXA 1JXJA 3HPFA 1FWIC 1XGZA 4C6QA 4MJ4A 3MUXA 2FGBA 2A7NA 3R11A 4D1JA 2YJQA 1B31A 3A24A 3WJWA 4H8NA 4A2SA 4GY1A 1FTXA 1EXPA 1HO4A 1ZU8A 3G5EA 2XVNA 4JTFA 1E9ZB 4I9TA 2ESCA 4AF0A 3OLGA 1X1NA 5DCBA 2XM2A 3E3HA 3UPBA 1ODZA 5G1TA 1UWIA 3PZGA 3TROA 2O9OA 3TYCA 3M7SA 5HMDA 2WPGA 4F0LA 1NELA 4HU0A 1XJBA 3VAVA 3N25A 3QQ0A 1WBHA 4DUWA 4F2UA 4KRZA 1VPQA 3W7DA 3TSMA 3NPVA 4B15A 3UQNA 1H4PA 2VC5A 3W1RA 4AZHA 1K4GA 4ZO8A 5A6KA 3W7CA 1EQPA 2NX1A 4CN6A 3M16A 2OVLA 4S3JA 1XH0A 1MW0A 3AS3A 1PWMA 1Y65A 2BDQA 1Q13A 4PB5A 1TJ1A 4P8XA 4LUSB 1MVYA 3AISA 3VD9A 5HNRA 1WPCA 4PBEA 4HU8A 1HKVA 4GXWA 1EOKA 1VH7A 3VMNA 4MADA 1FFRA 4JKMA 4K7VA 3SSJA 3VE7A 3CNYA 2W62A 5F7UA 2Y89A 4WD0A 1J2WA 4CQBA 2GDQA 3F03K 2WCGA 1SVDA 4JDYA 3VGHA 4CKQA 5CPTA 2Z1VA 1NP2A 2V0TA 1FY6A 3UXKA 3QR3A 3C5QA 5EKYA 1REQB 1A5UA 1VEPA 1TIWA 2RDXA 1JZ5A 3W07A 4XKYB 3N1AA 2VEPA 2OLSA 4GQQA 2PLKA 2J62A 1XYFA 4B2DD 3AQUA 4H9MA 4DUXA 1TPUA 2H9AA 1JCNA 4OECA 1BAGA 4HNUA 5IDZA 3UESA 1RK6A 3HGOA 3NA8A 5D38A 5E0CA 3TR2A 3ANYA 5CC5A 2DZUA 4IL0A 1K1DA 4CU8A 2P50A 3T09A 1IIHA 4M24A 2Y85A 3KZSA 4YN5A 1ZBKA 3N12A 3WDJA 1ZBVA 4JTQA 4RDWA 4J40A 4D8LA 3NDYA 1DIEA 1VF8A 4Q22A 4MDOA 2CZFA 4DJFD 3LBMA 2VWTA 2C18A 4LYQA 1MXDA 3WLIA 4AZCB 4HQVA 3S83A 1S2CA 1LBFA 2C8NA 4E3VA 3PC0A 3GXMA 1UKQA 1GUVA 2ZYFA 4JTSA 4XZHA 3C61A 3PK7A 4LRSA 4JTJA 3WCZA 4U3CA 2PDNA 3GIQA 2R1LA 1NF0A 3WMCA 3NWRA 1B1YA 1XLHA 1UKOA 3FNDA 4O11A 1HL9A 2XIIA 3ZT5A 3IK4A 3VIFA 3LCGA 4E8GA 1Z44A 3SY8A 2YDSA 1V02A 1O6IA 2DORA 4TU1A 1LRTA 4F9JA 3WLQA 1F61A 3LGEA 1GEQA 2BG5A 4OIFA 1VAHA 2OX4A 2HV5A 3WF3A 4OWGA 3WD2A 1V3HA 2VP8A 1DJYA 3I3EA 1C8YA 6XIAA 1Q4NX 1DP0A 4OHQA 3Q4DA 4HHMA 3GKFA 1B9BA 4X3ZA 1G0CA 3WD0A 2WKGA 4US5D 1US3A 3S1UA 3VINA 3GNOA 1Q6EA 2VX7A 4M6VA 4I8DA 1ALDA 4O12A 4AIEA 4FIRA 2PDXA 1I45A 3NQDA 3GXTA 3DH7A 1KQZA 3ARXA 2J7DA 1V02E 3HURA 4O14A 2PGRA 1WKYA 4E0CA 3QPEA 2O9RA 1H63A 3I7QA 4JFUA 4LAUA 1REQA 3G3DA 3Q45A 4TO8A 2F2KA 2WNWA 5A6AA 2FPVA 3LTSA 1ODUA 4XBJA 3QHMA 3NNTA 5GJMA 2GDUA 2ACRA 4M6UA 2DZTA 1S3TC 3ZQ9A 3BL3A 2V69A 4D6FA 1RY8A 5DEZA 1RLCL 2D1ZA 1YE4A 4KCVA 2E5CA 2XH0A 4HHPA 4U33A 3WQWA 3R58A 3PJXA 3OG3A 4Y8FA 4N9DA 2ZOXA 4INFA 2YL6A 1PHWA 1CT5A 3G77A 4DWSC 1UZ1A 2G41A 1GOXA 4EOUA 3URAA 2XG9A 1G4EA 1XUUA 4PRTA 2VOTA 4IJBA 4HKPA 1QU4A 2XH2A 5B80A 1EWEA 3RMJA 3SQMA 2EKCA 1YE6A 1H3GA 3OA3A 2WNNA 1XSKA 2G0WA 1BTMA 4K36A 4C65A 1EGZA 3OOQA 5BZAA 4H8HA 3AMLA 3WJYA 2QF8A 4AZCA 4DXXA 3RFAA 3FX4A 5JH2A 3OB8A 1U1UA 4W86A 1H41A 5D32A 3UP8A 1A5AA 1XYZA 2ZWYA 2JIWA 2QR6A 2V3GA 3E2VA 3LPOA 3L2LA 3A4AA 1OVDA 4ZQOA 2IKJA 4XTDA 1RSCA 1Q6OA 4KPLA 5GVJA 3FFSA 3WQFA 2DJLA 3P0XA 3LTPA 3T40A 5KETA 3NZPA 4PCFA 2E40A 4M6QA 3WN6A 2CHRA 2RAGA 3CH9A 3BDKA 3VVGA 3O3RA 4NUWA 4CCCA 4O8AA 4AZ5A 2XTKA 5FJTA 4DZAA 4WDXA 5I79A 3OLEA 5J8LA 4A3QA 1IEWA 1RA5A 4F2TA 2ZRVA 3PP7A 4XVDA 2FDMA 1DWAM 3RX3A 2ISFA 1GQIA 1TSIA 1TX2A 2GVEA 4NAEB 2FZ8A 3N04A 2VCAA 4W89A 3H7RA 3POCA 4LJ3A 3N73A 4K39A 4L1XA 3CZ8A 1RJPA 2NWSA 5HMFA 4UZSA 3NEHA 1HUVA 3F5LA 1E0UA 2YLLA 2VO5A 3OLIA 2PURA 3F2BA 4E4FA 1ZCCA 3C0SA 5EMYA 2QIIA 4JY8A 2QJMA 4EPKA 7CGTA 1QI3A 3W01A 3TJIA 2XFYA 4OU1A 2E6AA 2ZA3A 5DXXA 3T1GA 4Y9MA 2HVNA 1KM0A 3LPFA 4ZOAA 1C91A 4YMZA 5CSYA 3BQ6A 1Y5WA 2OR2A 1AH3A 2CYGA 3GDTA 5CSRA 4B4HA 2VENA 5SWUA 1AVAA 1O68A 3GO2A 4H2CA 3MT1A 4AZGA 1AH0A 3S1VA 3QFEA 3S2MA 4S3EA 3BGAA 3G1DA 4L5ZA 2OYKA 4DWDA 4DUVA 3XISA 1KM3A 1UQZA 1TPDA 4I9MA 1YNPA 3T0DA 5HQEA 2JEQA 3L4VA 3NDZA 1M7XA 5DANA 2Z1BA 4D1IA 1A80A 1OC5A 4MGGA 2DZXA 1FWJC 2DQXA 3IJ6A 4ICNA 3K5XA 1VYPX 5T9CE 4B4FA 3KVJA 1Q7QA 1OX4B 1W32A 4UNLA 1E6NA 3D0CA 4O1DA 4UMBA 4NNCA 4C6KA 4PA8A 3W2LA 1MW1A 2Z0IA 1XPYA 4H8UA 3W28A 4OJYA 2XFRA 1UMLA 5F1UA 3SQSA 3CQKA 4JX6A 1ZBWA 1XUZA 4AAJA 3NQGA 3WFLA 3GTXA 1VCVA 2PUZA 4ZCWA 2J9XA 4LGXA 3QH2A 2JKAA 2PDKA 2ZC8A 5AYXA 8A3HA 2OSYA 1GZGA 3IGSA 5FJUA 5HJLA 1W8GA 1SO3A 3AROA 4KCWA 2ZZ2A 1GQNA 3JU2A 3AYRA 1KKRA 1GJWA 3NVTA 1MI3A 3N2BA 4Q32A 4M6PA 3WFAA 4UQ9A 3ICJA 3TTSA 1KQYA 1OCQA 1SGJA 4NX0A 3VIIA 4PFMA 1DPMA 3P93A 3R10A 1VB9A 2OLHA 4NI3A 3GTHA 4RKAA 2G8ZA 4Q7NA 1HKKA 3IS4A 1OJXA 1D3GA 3QOKA 3B06A 4H04A 4LOCA 1NJJA 3N2OA 1R3VA 2NVAA 4KIEA 3SCQA 2XFWA 1ISZA 3A13A 4F4RA 3ARTA 1U1HA 4NXKA 4TVDA 7REQA 2OWCA 4BF7A 3MDUA 1OD0A 3BLKA 2ZX7A 1PHQA 4P61A 5HOSA 4JIHA 1YDVA 4MWAE 1L0PA 1XLDA 4MPKA 4QFUA 3MWCA 2YX0A 5C71A 5BCAA 2I5GA 4JCLA 3EOEA 4H19A 4J3TA 2ZUMA 3GKAA 3VMPA 2Q71A 4GACA 4WDTA 3Q37A 4IP7A 1SPQA 5XINA 4QJ4B 5KMYA 3V4BA 4BQ4A 5FJOA 3M0MA 3RM9A 3F4VA 3B0YA 3PPFA 3SDOA 3TQ0A 3GZ3A 2Q3OA 4WXYA 1US0A 4J3WA 3UY7A 5AC5A 1E43A 3IWPA 1E15A 1JGIA 1W3LA 5EMLA 4GY7A 1BRLB 1L8NA 2QDEA 3THDA 3MPGA 2ABBA 3VX0A 3FYYA 1NH6A 3GHRA 4Z2KA 1EDGA 5IBXC 2OPJA 3H4XA 3KHDA 3VX1A 4MFDA 2O92A 4DYEA 4GQGA 3G0XA 3N29A 3PTQA 4O52A 1FWAC 5AVNA 3M64A 4PEEA 5FACA 5CCZA 3EOUA 3R13A 2WWCA 3U2ZA 4HTBA 3RR4A 3WNNA 1KB3A 4JOMA 3WD3A 3QYQA 3W88A 3M0LA 3P3BA 3MBFA 3OVGA 2GGEA 3WH9A 3AIRA 2BOGX 1KRCC 2KZHA 2YW4A 4TR9A 4HSNA 2CKRA 1TPVA 2PU1A 4AWSA 4DO7A 4UTJA 3WK3A 4IMEA 4Q4OA 2Z27A 2GGGA 9CGTA 3PZTA 4AWEA 4XAGA 1V0MA 1H1ZA 3RJXA 3T05A 1E4LA 2PDLA 3SCVA 3UFYA 1G7VA 3SRKA 1OSEA 2QIWA 5AHIA 1F4AA 3ITYA 4GKTA 1TPB1 3AIVA 3CHDA 1UJQA 4JEQA 4WZHA 1SZFA 3UA4A 1SW7A 3PN8A 4DJEC 4ZB5A 2FZMA 3WD1A 2GQ8A 4DB7A 3M0HA 4QX4A 2H6RA 1G94A 2DY3A 3GUGA 4H1ZA 3GUWA 4CVUA 1RVGA 1ECQA 3V7PA 1IR2A 3RM8A 3TAOA 4IP5A 1KXVA 3WNOA 5CQ1A 3GDMA 3DFHA 3LRMA 1MYRA 4MJMA 4AMCA 5CPSA 4C7GA 4IUOA 4AZBA 1BXCA 2YCEA 4QJ1A 2AOSA 3PWIA 2OG9A 4GVHA 2DZVA 1ITXA 3AMGA 2IW0A 1PKNA 2WM0A 4EE9A 2PDCA 4IZGA 3GR7A 4LBRA 4AIOA 2QJIA 2YDQA 3VNLA 3IJ8A 4PTWA 2VURA 3GX9A 1MW2A 1B3VA 2Q8LA 3TMLA 3WG6A 1BFNA 3LZ3A 1CTNA 4QDWA 1WNOA 5A8OA 5FEZA 1P0NA 5AYBA 4QS6A 3WUGA 2G3IA 2VGBA 4IXXA 1FKXA 3GXIA 4WDWA 2XM1A 4A05A 2FJKA 4ZEPA 2D3LA 4WIWA 1UASA 1JCXA 3MCOA 3T0TA 3STEA 4AD1A 1XFCA 3W1PA 3B9AA 5C7HA 1D8CA 1UWQA 2Y2WA 5CZSA 3C2RA 3DHUA 4RV8A 1VP5A 2YR1A 1NVMA 4S3KA 2W61A 1JPDX 1KGUA 4M8UA 2YDAA 8TIMA 3FW6A 5LZLA 3GBDA 1DXFA 4XIAA 3W76A 2DZBA 1EQCA 1I1WA 3BSGA 1UKPA 2Y6ZA 3S8HA 3M0VA 1RQEA 1JCMP 1OFBA 3AU6A 1AG1O 1TQJA 4GA8A 4MB3A 4EIVA 2Y8VA 5CJNA 2QNEA 1QNRA 4KT2A 5IHSA 4LUJA 1E3ZA 4S2CA 2A3AA 4N4QA 2YXXA 3S4TA 1BVZA 2BFGA 4AVNA 4LY4A 1NDYA 3UY8A 3B0UX 1LBLA 4J9JA 2ZC1A 1AD1A 1OQFA 2C7FA 4EP8C 3CUFA 4XKYA 4ORIA 1JD7A 2PC8A 4DF1A 3UG5A 2RGLA 1RBAA 1QW7A 3KFTA 5CLTA 3THUA 1UKTA 3EKGA 4L80A 4AZIA 3H54A 1HKMA 2WSRA 4PN2A 1W5PA 4FF5A 5HAOA 1ZAIA 4AD3A 4MOZA 2AMGA 4GZJA 5F2IA 1LRNA 4DF2A 2FB2A 4O0ZA 3EWWA 4H9TA 4GJ1A 3ZO9A 5CC7A 1EJUC 2V5JA 1HKIA 3GG8A 2ZUSA 3MUY1 3K30A 3U8GA 3BLIA 2W5FA 1JDDA 4XUGA 1HKJA 4BEQA 4ICMA 3QQWA 1KLZA 4DRSA 4R7JA 4MG4A 3BE7A 1KBJA 1UC4A 4L4MA 5LNSA 2VUYA 3HA1A 4WKAA 1DYSA 1EFZA 4W9TA 2IPWA 4S3CA 4GE8A 1GZ1A 3L21A 1PIFA 1W5OA 2FIQA 4IQLA 4RW5A 3NQ7A 2QV5A 1TE6A 2NT0A 1GEHA 3TW6A 1I60A 4H9XA 2EPKX 3GG7A 4HNOA 4WX2A 1RHCA 1ESWA 3G1AA 4MNKA 4L4OA 1MMFA 1TPEA 2AKZA 4ZE4A 4FLOA 3ZM8A 1W1YA 1V6VA 5G1YA 2QCFA 1H60A 4G6CA 1E6PA 3PNUA 3KLKA 1ZSXA 4BS0A 3VFCA 3W7RA 3A21A 4AFYA 3QGAC 1M53A 3PULA 5FF7A 5KZDA 1BEUA 4G8TA 3AU2A 2XSXA 2PLJA 4HT3A 3GNPA 4GK8A 3NOEA 4NAEA 1QATA 2FMNA 4B5VA 1Q7ZA 2J6XA 3RRXA 3QC3A 3SFKA 4L64A 3PBUA 2A4AA 1IQ8A 4RJEA 4B3KA 5BWFA 2WW5A 1TUFA 3GRIA 4IIFA 1E0WA 3PZIA 4I5XA 4CQ9A 4Q6JA 3SY5A 3WMBA 4AZ6A 1JUEA 4FIQA 1ZB5A 4GPNA 4J3ZA 4XAZA 5CPMA 3B8TA 3G1XA 4E5TA 1V51A 2DT0A 1AUSL 4PUNA 3WLJA 3EA2A 2Y0FA 4V2XA 4F0HA 1ICPA 2RDTA 3ZMRA 4M5PA 5I3DA 4UBPC 4A3RA 3BUVA 3W2NA 3PNZA 8XIMA 3CIXA 3H24A 1UUMA 4R9OA 4W93A 1LTDA 2QJJA 5DCDA 1D9EA 2PP0A 4U3AA 2GUYA 3DU0A 3TQPA 4S23A 3T2OA 2YL9A 3MSDA 4U31A 5LHEA 1KO0A 4ATLA 1DQXA 5C7VA 1OGBA 4K68A 1VFHA 2Z28A 5ABFB 4FOUA 4KH2A 4AC7C 2F6XA 4V1YA 3SO7A 1FOBA 3W1LA 3APYA 1Z3NA 4DX3A 4DLMA 1WXJA 2UY2A 4S1FA 2GFTA 3GE7A 1WUEA 2PU0A 1JEZA 4C6PA 5C55A 1OX4A 1R3TA 4NJKA 3VNKA 4DBWA 5BRPA 4EK7A 3BJFA 4EANA 1ZQ5A 1PX4A 2HROA 5FJJA 4B2DA 4Y9AA 3OA5A 1GVEA 3RN6A 2YXOA 3BCJA 4GZIA 4WUIA 3TA9A 1FWRA 1VIWA 4Y90A 4FNRA 2FVLA 3CIWA 4ZQPA 3SI9A 4W88A 1DJHA 2RDUA 4V33A 1N55A 1J0KA 4DJED 2BLEA 3KEHA 4U2ZA 1XHGA 1KCZA 4WSKA 3JS3A 4HD5A 4GQ0A 4EPDC 3E5PA 3H22A 1YTDA 3N3MA 4TX9A 1FDYA 4IFOA 4DAFA 4DJFA 4FP1A 1VHNA 1SMDA 3FEMA 2V5LA 2W3ZA 3DYPA 3CPUA 5E09A 1ZUAX 4KEZA 4G7EB 4NAFB 4QP0A 3QYSA 1ZNNA 3ARZA 3WQDA 4O57A 3LV5A 1R3YA 2ZVIA 1EP1A 4PULA 2E1DA 3OLDA 2DEPA 3W53A 1PDYA 3K13A 1ZJHA 5DMNA 4FMVA 5TF0A 3O6CA 4HNNA 4O4VA 2XN0A 1H61A 4MWAD 3WDPP 4IMDA 5FJPA 1YKWA 4Q4QA 3SQLA 3KBNA 1H0IA 3T2QA 4AY7A 3GNNA 2R8WA 2Z4GA 2H3BA 2WVVA 3P60A 4BI5A 1N82A 3VC5A 1CWYA 4CVWA 3P14A 1Q2SA 4YVXA 1PX8A 1A47A 4MFEA 1HVXA 3YPIA 4TTUA 2JIEA 1BGAA 4ADUA 3OEXA 2B31A 3V1PA 1Y7VA 3UZZA 1R3SA 4C7FA 3SR7A 2RJGA 4GX8A 2TRSA 3MTWA 1X98A 3G8EA 1DOSA 1RV8A 1I2NA 4QEEA 3S2CA 4KGLA 2VEKA 4OBRA 1O95A 2VFEA 1KKOA 5FSEC 3S2LA 4C90A 2ADAA 3LXBA 3KAOA 4CN4A 3QRHA 1X6LA 3OGRA 4O0KA 1DJQA 3LCXA 2QVNA 4H7VA 2IKGA 1W1TA 1PPIA 4GYKA 2WMIB 4NG3A 2QCLA 3EOOA 4AY8A 1DTNA 1AD4A 2WBKA 4KERA 1TCMA 1KFJA 2XUCA 3KVLA 5DFAA 2WAGA 2R94A 4P5UA 1O66A 4M1BA 1WXZA 3B8IA 1O5QA 1QWGA 3GVVA 4C7DA 5FJIA 3TNBA 3KVKA 1DJIA 4D6IA 1Q6CA 1VZWA 4A6GA 4UQCA 4JYEA 2OB3A 3O6DA 2X40A 4DJDC 1KM2A 1FCQA 4WQ6A 3WLTA 2X8RA 3GY1A 1K9EA 4Q6XA 5HATA 3QV9A 5D03A 3PB2A 3P7YA 4AD0A 1F3EA 1CLKA 3I4KA 3LZ5A 1TJ2A 1QI4A 1WDRA 2WKJA 1H1YA 4GZEA 5ECVA 1VJSA 4PRRA 1XCXA 3EOSA 1TWSA 1UIPA 1Z6KA 2G4FA 4AX7A 5AC8A 3W6LA 5F2LA 1KBLA 1H7PA 3PZ9A 2X05A 2VYOA 3CL6A 3VD5A 2PE4A 3MKKA 5I3IA 1RUSA 1GNXA 4UUIA 2TPSA 4QM1A 4B9YA 4LVFA 3PANA 5A8QA 2XVGA 3WLMA 1R87A 2J25A 3E0IA 7TAAA 1RXOB 4WF7A 4O4WA 1PL9A 3TU9A 2VMFA 1OFDA 3A6OA 3E1F1 5K9XA 4X2PA 5I78A 3TK7A 5DMYA 1LOSA 3H21A 2VZUA 2YW3A 2GQ9A 4NZ5A 3E5BA 4GMEA 1OYCA 1L9WA 1F4HA 1IXNA 3SUVA 1UUQA 1LBMA 4XAPA 3TC3A 3B04A 3GYEA 4MY1A 3ARPA 2ANUA 4XSMA 2WJFA 4PMJA 1L6FA 4UTFA 4R7OA 1V6WA 2CWXA 4YLWA 1U1JA 5I7GA 5A8NA 4JBRA 1NDWA 4IH3A 3UWUA 5GQBA 2VDHA 3PZOA 2Y88A 1CECA 4NZFA 1JNEA 3EBVA 3OHMB 2Q09A 4DBUA 5LGXA 1K3UA 1PCWA 2V82A 3BZJA 2D3NA 3VPLA 3RUBL 3WJZA 3EWZA 1EIBA 2BWGA 3VZZA 3S42A 1IXQA 2V3DA 4ZOBA 1J79A 2PCQA 3SEPA 1WYIA 3TOPA 3ZLHA 2PCEA 1I4NA 3IGUA 2V2CA 2ZXDA 3BSMA 2J7BA 3NL5A 5DLCA 3G0SA 3QMTA 1QMLA 2VR4A 3UCCA 3WQ4A 3TC7A 4QNEA 2GJXB 2ZVRA 1UB3A 3ONBA 4B90A 3EXRA 2WM1A 3U9IA 4ADSA 2CC0A 1E3XA 3BTNA 1BLIA 3NM1A 5EGRA 1BVWA 2Z1XA 4V27A 5CBBA 3HG4A 2DQWA 4NJJA 1E72M 3CJPA 1X8CA 3CQIA 3GNDA 2PI6A 1O7AA 2X1SA 3THAA 4KWVA 1AK5A 3WZ0E 5K2ZA 3LHTA 1TWZA 4NY2A 3S6OA 3UETA 4GABA 1WBJA 1K4HA 1WDSA 4I7WA 4IGNA 4Z08A 1GOIA 3HPSA 1XH2A 3SSZA 2VEFA 4PL1A 4CNNA 3UXIA 2DP3A 2JALA 4JTRA 1V0LA 3ALFA 2QF7A 2OZ8A 2J88A 2RKXA 4O19A 1X97A 1QHPA 3A5VA 4LBSA 4MAZA 1E9LA 3GDBA 4JD4A 4YWIA 3TKFA 2IPFA 3ZWSA 2QZRA 1GTEA 4AU0A 1W3NA 3LOTA 3UWQA 3RLVA 4H7CA 7ODCA 4QQ3A 1JGMA 4KWUA 4YWSA 1UP3A 4URIA 3E6EA 1WZLA 4QTGA 4JAWA 2JKPA 3LS9A 1W9XA 2QGHA 2ZRXA 1HJQA 3OG2A 2Z1WA 3WNLA 3MUIA 4YL2A 3NO1A 2J6VA 2F2HA 4N7QA 4AMAA 1BYAA 3WBYA 4WXZA 3EYPA 3GQYA 1NP0A 3IIPA 3VU2A 3PG9A 1KWGA 3U6WA 1E6QM 3E74A 1XISA 4Q4RA 4UTHA 1JFXA 3RILA 4ZB2A 3C2EA 4AZ7A 4EPEC 1A5SA 5AC4A 5KINA 2RH9A 8CGTA 4DWSD 5I00A 2HJPA 3W82A 3S5YA 1UWTA 1YDOA 3CUJA 4Q8NA 2VC6A 4PB4A 3KP0A 1PIIA 4JR5A 2VC7A 3E12A 3LPPA 4GRSA 4HZ8A 4MNJA 3W1NA 2XWEA 1TE1A 3N9KA 2Q3RA 1NOWA 3WQEA 1E1CA 3UR8A 3VDCA 1K7XA 3KLLA 3H26A 4EXBA 4L6DA 2A6LA 3W3OA 3QBUA 3FA4A 3QY7A 3IIZA 3A4WA 2WJZA 1C7SA 2ZADA 5FD0A 4GFSA 3IVTA 5HQMA 2WHJA 4DI9A 2XYLA 2VR5A 5M3WA 4MAVA 4PGLA 1DKWA 2EPLX 4XK2A 5F2GA 3IACA 3WK0A 2QULA 3VGFA 1E0VA 4PC8A 1AH4A 2NLYA 3N15A 1GK8A 1XH1A 3VDAA 2E25A 1B3OA 1EXBA 1T96A 4W7VA 4L6OA 1G1YA 3AXKA 3MKCA 3JZUA 1P0DA 3N13A 1EZWA 3C86A 1SFTA 4KFNA 5F1VA 1LG1A 2CNCA 3B03A 4MY9A 3VKJA 4JTAA 1W17A 2WJEA 1CW2A 3IJLA 1S2AA 4IT1A 3R94A 4BF9A 2VD9A 4TVUA 1UR3M 3BO9A 3N19B 2E6DA 3TZFA 3D5HA 2WMGA 2P3EA 3IJQA 4HCHA 1PXGA 4NNBA 1UOZA 4IMAA 4BA0A 2A7RA 1Q5MA 1W2VA 5CGTA 3TDFA 4LEQA 3CEUA 3IJ7A 1L2QA 1RJQA 3NGFA 3KBSA 1EHNA 3ABQA 2J8GA 5A2BA 4N6EA 2V38A 2YB4A 1QTWA 2ZZ6A 1B9ZA 3BANA 5AB3A 5HULA 1TR9A 1CLVA 4P2VA 2A5HA 4DAIA 2Z2UA 3V18A 3GVGA 1EHAA 3EPMA 2X41A 2ZA1A 1XG3A 2BZNA 4BQ3A 4M19A 2NUXA 1S2UA 5BWAA 3WK1A 1UW9A 1HX0A 5D04C 3T0CA 4FX6M 4QISA 1PYFA 4GJIA 5I06A 1IT0A 3MJMA 3DXIA 1GZJA 1QAPA 5AC7A 4PUUA 4Q4KA 1JZ3A 2BY1A 2E4TA 3II1A 2ZBTA 1GKQA 2VCCA 3KM8A 3S1WA 3T78A 2W0UA 3VILA 1VFFA 3KBJA 2E67A 3L5MA 5FI8A 3QLLA 3S5ZA 3CK5A 1G01A 1TVNA 2OJPA 3B4YA 4J28A 2OFJA 4A3UA 3CXOA 4IISA 5FF3A 5C70A 3K8MA 4UQBA 1FWTA 1Q85A 3MDWA 4UR9A 4AC1X 4QSHA 1JDCA 2AL2B 3UU0A 2DSVA 1IV8A 3VCCA 1MUCA 4ENLA 1XIHA 1LCOA 3VYLA 1VFLA 1FQ0A 3IIOA 4H7ZA 3RF9A 2Z00A 4GD0A 1TA3A 1IIGA 2WQDA 3G2GA 4LVBA 1IYXA 1EGVA 4LCRA 4ZBCA 1QBAA 1A5CA 2VTFA 2YDRA 1P4CA 4HJWA 2H8XA 2PF0A 5DCEA 1JRCA 1GVYA 2CLHA 1YLVA 4WY0F 4BHYA 5TD4A 1TTJA 1O5XA 1KFBA 3PBGA 2Z29A 3L4XA 3L0GA 3L4ZA 4FR1A 3IIXA 4HMDA 1HF6A 4FNPA 2DZSA 4JL2A 5HXMA 5HNUA 5HMEA 2E68A 3U7VA 1P5BA 4JQ4A 2CW6A 3WNMA 3MUCA 4WJEA 2J79A 1K8ZA 3CUXA 1XLIA 5CPLA 3R8GA 1VBGA 2J75A 4LS1A 2E9LA 4IPNB 3EDDA 3OODA 1NM9A 4H6EA 4C6EA 1Z32X 3C8NA 1UROA 2NV2A 1DXIA 3MJYA 3R12A 3HGSA 1JPKA 2NV9A 5FEPA 3AS2A 1UBPC 2ZX6A 1J0IA 2AAAA 1VBUA 3RR1A 1Z8AA 3MU7A 3WMSA 1XD0A 2A6NA 3WLNA 1THFD 2PTZA 1C8VA 1PAMA 4TXEA 4NJIA 3LY0A 3WBXA 3FIGA 3CPRA 2YBUA 1GW9A 1GKRA 5AHMA 3SCPA 4ZTXA 4FK9A 1H11A 1FHLA 3VNDA 2CU0A 2Y63A 1RY0A 3QC0A 3AO0A 4RDYA 4JN8A 3C6CA 5I03A 3O07A 4H9VA 1J5SA 4MKVA 1MW3A 1TPH1 3O15A 3ABSA 1L8PA 4MPQA 1F8MA 1MUMA 2AQOA 3CGTA 2IXVA 3BURA 1KLYA 3N4FA 4QG6A 4CQ8A 3CUGA 5JVLA 3M7WA 2EXOA 4IPPA 3RO8A 1XM3A 3IK2A 4EAMA 3SBFA 3CO4A 3RX2A 2WB5A 3EWCA 4L61A 3EWUA 1ADDA 4UNIA 4JX5A 4XZNX 1KFLA 1XLLA 4GBDA 3H6OA 1YDNA 3UR2A 3KW3A 3UWWA 4PMRA 3AHVA 2W4XA 5MKGB 2CETA 2YKKA 4E3TA 4ATWA 1G7UA 1R7AA 1PO9A 2WPBA 4O1BA 3EOLA 1DWIM 4MLRA 8XIAA 3RIKA 4PMVA 1FH7A 1DWFM 4O1FA 2Y5EA 1IWPA 1SM9A 2OCZA 4BK9A 1E6RA 1Q6RA 2PTWA 1OHLA 3FSUA 2D20A 4O8RA 5GJNA 1P0EA 1AL7A 5D37A 4HNLA 3P84A 2OSXA 3GVWA 2FVMA 3W7LA 2D2HA 3RCMA 1WXYA 4PODA 3R4IA 2BGQA 2BXVA 3O0KA 4H6KA 3QHOA 3STCA 1X1OA 5LKYA 2WVVB 3KBVA 4JPGA 2EJ1A 3L5LA 4RXGA 2G95A 2ZRYA 3GC4A 5AN7A 4Z0SA 4FAMA 5D09A 1T41A 5JBFA 4C1NA 1E6XM 2ACUA 3TJXA 2PDHA 3GU1A 4BEUA 3AALA 3NQEA 4U10A 4IGSA 4TX6A 1I0DA 5KSWA 3O2LA 1DJGA 2A3HA 2OZ3A 1K03A 4MZ8A 4UNKA 3OZPA 3PWAA 1AW1A 1G4SA 2IKHA 4FNQA 1PCKA 3NURA 1DJNA 5FESA 3BWWA 5EMKA 1J93A 4OBTA 3MHUA 2QKFA 2Y7FA 3RX4A 2XGIA 1MSSA 2C79A 2QHAA 1VRXA 3VOGA 4LH8A 1E6ZA 3VUSA 1OCBA 4UR8A 3PF3A 4MZYA 5AHEA 4R34A 1C9WA 2WCAA 2PAJA 1GQJA 4MNMA 5A69A 3ME3A 3QZAA 3W70A 2DSWA 3W1TA 2VFFA 1L6GA 3UT0A 2WLZA 2X0HA 3QPYA 2DPEA 2I5QA 4J2PA 2J8FA 2C1IA 3BAKA 1B3WA 3MYPA 4D8AA 6REQB 3OZOA 2HBXA 2CLEA 3LD5A 3ITOA 3CTTA 3NQVA 2DU2A 2VHLA 3I6EA 2EG8A 1BKSA 5D2VA 3RU8X 1BTCA 2DW7A 1K8YA 2OOGA 2C3ZA 2WJDA 1MQPA 2GLKA 1JCJA 3K4DA 1VPXA 4GO8A 3TC6A 1TPWA 2CLOA 4LB4A 1FWHC 4CNOA 3UWVA 4Q33A 3COTA 4H01A 1K70A 4GVGA 1G67A 4GX9A 4NF7A 2CHOA 4ATDA 2I57A 2TAAA 3ISIX 4LV9A 4LY8A 4B5NA 3BG3A 2NSXA 2JBMA 3DG7A 4W8BA 5IM51 3CT7A 2HMCA 2NX3A 4F79A 2E8ZA 4AVFA 1B54A 1FUYA 4W8LA 1GONA 1VBJA 4ZFMA 1EIXA 4C91A 4IPIA 3BPWA 3NL2A 3TAKA 2FHCA 1KRMA 3PZQA 4QSFA 2VZTA 3QN3A 2QJHA 5DN1A 5LXEA 4LUTB 5CJMA 5LA0A 4GISA 2PDPA 2E8YA 3BLOA 4V28A 1MQQA 3A23A 4YTUA 1UMYA 1EWDA 2Y4SA 3DEQA 3PPGA 4H3DA 2VZOA 1R38A 2PTXA 3N6QA 1V6YA 3H23A 3AMCA 1GWJA 4IG2B 2AQWA 3MMWA 5CPNA 3W37A 4Q7IA 2X1IA 3WQ8A 3AXXA 3WLSA 4MIMA 5AOUA 5T91A 5I3KA 1PSCA 2PSNA 5HWNA 5A6BA 3T9PA 5LNUA 3EWDA 3LMYA 1RBLA 4MUPA 5CXPA 4MKSA 3PUGA 3VNIA 3HB9A 5EA9A 1H51A 4UFIA 4CD5A 3T2PA 3ZJ6A 3QR0A 4KEVA 4AQLA 1QPRA 2XGZA 4H9ZA 1TX0A 3DBNA 1DQUA 2XGBA 1CPUA 4FLRA 1T5AA 1W9BM 2WV8A 3TJ4A 2DT2A 5FA5A 1HTIA 4Z1AA 1ME7A 3HMJG 1NQKA 3GTNA 1XQLA 1MWOA 2YA0A 5G4EA 3LM7A 1B4EA 3PPHA 4ZB0A 2DSZA 4CQCA 1OFOA 5AHNA 4D9PA 4AYSA 4HN4A 5D8ZA 4C6OA 1QNVA 2W66A 4CNPA 5FEWA 1P48A 4KESA 3HZ3A 1H5YA 1MEHA 2FB3A 5B7ZA 4QE1A 4DXKA 4RE4A 1PKLA 3V16A 4HPXA 1QPOA 3CTLA 4Q3MA 3UBPC 3W2KA 3M0KA 1EYWA 5MKGA 1YHTA 3MZNA 3IEBA 3TW7A 2LLEA 3R0DA 1QNQA 3ZOAA 3ZVHB 1AQHA 4PCPA 5H1WA 1UHVA 4F48A 2FZNA 4JEJA 1ZZMA 5K3VA 3NO3A 1BYBA 3UA3A 4MWAC 5CSSA 5E5CA 2ZDSA 4DVOA 4QR6A 4JXCA 1DV7A 4ZO9A 1Q4WA 1JJKA 3MC5A 1JDEA 2Z2BA 3CLMA 3LENA 1WAWA 3KDNA 3U57A 3LHZA 4ZQNA 3WH8A 2E5DA 3VIHA 1F7BA 3VABA 4I90A 1P6CA 3NFUA 3DAQA 2FDSA 1PX3A 3WH7A 3EMQA 1KRAC 2OEMA 3TCEA 4B5WA 1YBQA 1EUAA 3LK6A 5J04A 2QCGA 3NAVA 5A6SA 1EOMA 5K9CA 3HFTA 1O4UA 3WELA 3S46A 2CZDA 1SO6A 3W26A 1BQGA 3M9YA 2D23A 4XZWA 4OVXA 1VLWA 4HJFA 5A6JA 3L4UA 5H8UA 3C52A 3SCTA 3W2MA 1KM6A 2VZSA 2XIJA 1RD6A 3A9BA 2EPOA 4B16A 5HWMA 1S5WA 2V68A 3W7MA 2CLPA 3AHTA 2V3EA 3MUAA 2J47A 3WLPA 1UD8A 1XWYA 3OBKA 8RUCA 4JIRA 1MXSA 3AHZA 3E0WA 3RRAA 3S2NA 5AECA 1XIDA 1AJ2A 1UR4A 2WC4A 3JR2A 2V30A 2PZNA 4N9EA 4TV6A 4UTTA 4IGHA 1UPMB 2QYGA 4KWWA 2PGEA 1SSGA 2GQ3A 1NDZA 1WCGA 2EHHA 5D2XA 4DZHA 2NQ9A 5HDRA 4XD4A 1OD8A 3C3NA 3MHGA 3BICA 6ENLA 2HS6A 4A29A 2QCDB 4RPPA 2QUNA 4WCJA 1M41A 2O9TA 4GIRA 4PUEA 1N7KA 4Q8UA 4MVAA 2GUUA 4ILSA 4GY0A 3ZJ8A 4AH7A 2FPYA 1SFJA 5E1QA 1HGWA 4ACZB 3TEVA 1VFOA 2QCHA 2Z6IA 3IUIA 1AW2A 4NIRA 1ONXA 4IJRA 1FXQA 2D24A 1D7KA 4YCPA 1OYBA 2C16A 4A21A 5FEXA 4FLSA 1O12A 3T7VA 3VA8A 1XLGA 5G2WA 4JTHA 3EWXA 5EB8A 5DRIA 4PTXA 2XU2A 3LPGA 1C8QA 4NQ1A 3ARSA 1B30A 5HJXA 1GJUA 1XSIA 3QXBA 4OBSA 2RDWA 5AY7A 2E7FA 1Q6DA 3MP3A 4KS0A 3H2EA 2GUBA 1FHUA 3MBDA 2A3BA 3ZS4A 1WDDA 3LA4A 4HP5A 3L0KA 1F8IA 5EFDA 3FAXA 5BOEA 3BQ5A 2ZXAA 1OK4A 4D6CA 4F3HA 5D2TA 2E3ZA 1T40A 4HOZA 3GW3A 3PWGA 1IEQA 2OQYA 3PTKA 7XIMA 2BP1A 3PM6A 4HIBA 1QNPA 1QCWA 1ZAHA 4LAOA 3HTWA 3NPWA 2Y7DA 1V77A 2E9BA 3PUEA 4MZ1A 2CLIA 2H90A 3RPMA 2UY4A 3WK2A 3AYSA 4A35A 1MXGA 4J5NA 2PDIA 3C8FA 4ERGA 1XIMA 1R3RA 5CZTA 2GVLA 4GH3A 5A6MA 3TTQA 4O13A 3FVDA 3N2MA 1AW5A 3UR5A 3DHDA 2WZMA 2ZKMX 1OK6A 4DELA 2PRHA 4CEUC 3BMVA 2YXGA 1JUKA 2WSQA 5TNVA 4UCFA 2OKTA 3WJSA 3FVMA 4MJ2A 2HWGA 1LROA 4DYJA 4I6KA 1W6TA 3W1QA 3M41A 1A0CA 3BW2A 3DI0A 3PPCA 1XD1A 2J7GA 1GQLA 4ZODA 4FO4A 4E2BA 2BV9A 3NQFA 4EKJA 2BTMA 3NZRA 1OEPA 3OBEA 3S9ZA 3UGVA 1DTUA 4RE0A 4EACA 1LLWA 3EXSA 1ICSA 4IG2A 2WC7A 3AXHA 3APTA 1XLKA 3PB0A 2ATMA 1KM5A 3ABXA 3T44A 1QFEA 5CLWA 1V3LA 5E0KA 1G4TA 4GGBA 3V5CA 1XRTA 3KCLA 4WOZA 5HINA 1H09A 1AMYA 4UXDA 4PH6A 3H2CA 4HNCA 2EBNA 3W7HA 2O4QA 4P7QA 2H9AB 4DZ5A 2OSWA 4QIUA 3EB2A 3GAYA 4P8WA 2OWWA 5K4ZA 2Z26A 1NU5A 1MDRA 1X1ZA 2AGTA 3TYAA 4PMNA 4M81A 4LYKA 2QLYA 3H4GA 4YHGA 3S3GA 4TOQA 2BVWA 3EX3A 4PR4A 2IKIA 1GOMA 4Z2JA 1TMLA 5PTDA 3WDQA 2MANA 1VRDA 1BKHA 2DUAA 4QAIA 1V6UA 3MY9A 2YL8A 1E4IA 3W6MA 1E9YB 5LA1A 1C92A 3AMKA 4BWLA 1EDTA 5LYRA 2XVPA 5K7JA 1MEWA 3PJTA 1XLJA 2REQB 5A5WA 2DH2A 3UVIA 4D6HA