3MHUA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-nitroorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
307
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
total genus 107
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mhuA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mhuA01
3L21A 4R7JA 1TRDA 1GVQA 3DFQA 4JYEA 1XDLA 3A9IA 3BO9A 3STGA 3NQCA 5HWJA 2CLKA 2XN0A 4UMBA 3R2GA 2A6LA 4ZVJA 3I7SA 5H91A 1LZOA 4RR4A 2B0MA 2V82A 2J24A 5D09A 1S5TA 3E02A 2Q8ZA 2CLMA 3UXAA 1Y0EA 2WSQA 1MXSA 4MZ8A 5SWUA 1JRBA 3LRKA 3RNDA 2H3BA 3W2MA 3T4CA 5C6MA 2OT0A 1WXJA 4Z1BA 2CZFA 3PS7A 5TQLA 3BK0A 2RHGA 5AN7A 3S6DA 2A7NA 3KRZA 3MP5A 1W3TA 3GLCA 4TU1A 3N73A 1EUAA 3O6YX 3QMRA 1ZHAA 1IIHA 2ZCGA 3NL3A 1TB3A 4ZQCA 4G1KA 5F1UA 5TIMA 2ZBTA 3BW4A 5MHBA 1CW2A 3NO5A 4O8RA 4WOZA 4IXHA 1H1YA 1SU5A 3C3NA 4IMCA 1VH7A 1GVRA 1BKSA 2DZPA 4UTKA 1JQXA 1VPXA 4W9TA 1T99A 1A5CA 5LNUA 3STEA 1SO5A 4QNWA 1JVNA 4KFOA 3DFTA 1G69A 4XBKA 1VJIA 3FJ6A 1XBXA 4IOTA 3KOFA 3S8HA 1JUKA 3MP3A 1LBMA 5U4NA 3OVRA 4GFSA 5FF3A 1JRCA 1P0NA 3C6CA 3W7LA 4PA8A 1PCWA 4DEFA 5AOUA 1WX0A 3IGXA 4Y9AA 4K8HA 2QCDB 1WBHA 4GWEA 1Q6LA 5D33A 1R30A 4IXXA 1TV7A 5BW6A 1JCYA 3TSBA 4NVTA 4RJEA 4FEZA 2VEIA 3GDLA 5KINA 4LV9A 2V8ZA 1OYCA 2C3ZA 3L68A 2ISVA 5DBTA 5D2VA 1NVMA 4JYDA 4NQ1A 4WQ6A 5AHIA 3HF3A 3ZWSA 4FX8A 5G4EA 2V5BA 4UTJA 1RD5A 4FHAA 4MY8A 4JTIA 4UR8A 5CSSA 5F4SA 4M19A 2Z6JA 4KFNA 3YPIA 1NF7A 3TXZA 5AYZA 2P1FA 3QC3A 1F6KA 3W7NA 1H5YA 3C56A 3S5NA 2OT1A 3EXTA 4JICA 3A23A 4OE7A 2VENA 4EIVA 5C55A 2HSAA 1GQNA 2OJPA 4X2RA 4FNPA 3OEXA 3USBA 2AGKA 3GIYA 3MJYA 3BPWA 3C61A 4XBSA 3IV3A 4IPJA 3L0NA 3TC7A 3NPVA 1YPFA 3W07A 3S1WA 3PBYA 5AHLA 3L66A 3LHWA 2YGYA 1FWRA 3P82A 2E6FA 4S1FA 1TRIA 1X1ZA 3DFNA 1FBAA 3W9ZA 4JTTA 2ZRYA 4LVGA 2B7QA 3LHTA 2TMDA 5D03A 4WUIA 3M0ZA 2H8XA 4BWLA 6ALDA 2QAPA 5IBXA 4WY0A 1KTNA 4ZQPA 3V75A 2EAWA 2PCQA 5C54A 2VELA 4K7VA 4S2BA 3NQ8A 4BWLC 5IBXC 3GAYA 1OF6A 1K02A 1EEPA 1TPDA 2ZTJA 4UXDA 3FA5A 3BLIA 3LOTA 2CWNA 3TAOA 2NXIA 1X7FA 3IIOA 3P60A 1SR9A 3H53A 5F4WA 1XBVA 3HPXA 1W5MA 1JULA 5LHEA 4X3ZA 1I2PA 2ZQ0A 3LX9A 5CG7A 1W37A 1OFQA 2NX3A 5HNRA 2Y61A 1UCWA 2BWGA 5CZ0A 3TKFA 1S5WA 3O63A 2BZNA 2VFEA 1LCOA 3TIMA 4MYAA 2R14A 3N9SA 2A4AA 2H3DA 2NX1A 3W72A 5HQEA 3O1NA 1K3UA 5G2IA 4HNUA 2ZZ6A 2ZZ3A 3CC1A 1SUXA 4QISA 4LW7A 3G1XA 5HJLA 3HOJA 3ATYA 3W74A 3UWYA 5AB3A 3RF9A 4UNKA 1B57A 1XM3A 3DZ1A 3JRKA 4FXRA 4YL2A 4LUIA 3U6WA 2GQ9A 3G1YA 5AYYA 2XFWA 4JX4A 1GTHA 3W7HA 2Y7GA 2OMAA 3TMQA 3IIZA 3UD6A 3NNTA 1ADOA 3EWYA 2CLHA 5I3GA 1EIXA 2YYUA 4ICNA 3NQFA 3LB0A 1TPEA 1FDYA 3M7WA 3ZR4A 1HTIA 1NEYA 1LOSA 4GNJA 2JBMA 1Z44A 1BWKA 3OG3A 3LM7A 3PSWA 5LKYA 1KM4A 4NU7A 4N9DA 5BOOA 1IXOA 2Y63A 1SZNA 1UASA 3SZ8A 1VYRA 4K36A 3QF0A 3W87A 4XZ9A 5HUPA 2E5BA 3LERA 4FF7A 1TIMA 3W7QA 3HG2A 3S9YA 3W83A 4TR9A 1SZEA 2A0NA 1OX4B 1QAPA 2FJKA 1AW5A 1KFEA 2VEKA 1G6CA 4FNRA 2ZFAA 1FQ0A 1KW1A 2V81A 2FPVA 4B5NA 4D2JA 3FLUA 3PF3A 5K4XA 1PE1A 3QQ0A 3PWAA 2V30A 1D9EA 2JK2A 3CQ0A 5F2MA 3TAKA 4LS0A 1SFLA 4CQAA 1FDJA 1SW7A 3LDVA 3UNDA 1X6UA 2J27A 4Z0JA 4L4MA 3ABOA 1PIIA 5I3HA 4OQVA 1PHQA 4WY0B 3LI0A 4XKYB 1QO5A 1DV7A 2ZYFA 5K9DA 1OFEA 3W86A 2ZRXA 2NWSA 5EPDA 3BGGA 2WOQA 1I45A 3ABQA 1F2JA 3BW2A 3U2OA 4JYFA 3W1NA 3W7EA 1QMLA 1F76A 1O95A 4DBEA 3M5YA 4ORMA 2VFGA 3S0CA 3FIGA 4K7YA 1ONRA 4TIMA 4EVZA 1XC4A 5CZJA 5K7JA 1KV5A 3G18A 1OYAA 2ZDRA 1YADA 3NXFA 2FPTA 4R34A 2QCHA 3W1MA 2PRMA 4IX0A 2WPBA 4AXKA 4Q4KA 1W31A 2JKAA 3FJLA 3P80A 2J6XA 5DXXA 4IWWA 2B4GA 3MHFA 1IF2A 4OHQA 2NUWA 1TPFA 3TW7A 4MZ1A 3B0UX 1S3HA 3W1PA 3DI0A 4DQWA 1TPC1 3MHUA 4HNTA 3QZEA 3KRUA 4AWTA 1F74A 4U28A 1DORA 1EX5A 1EWDA 1B9BA 1QFEA 3G0XA 3W7OA 1C29A 3F1QA 5I3FA 1HFBA 4Y96A 1A5AA 4DPPA 3NQAA 1NF0A 4U4MA 4JNMA 1G4EA 2JGYA 1SO3A 4PEKA 3MI3A 4O4VA 2A7RA 4GC4A 1ME7A 3FYPA 5G5IA 2DZSA 1H63A 3TXVA 3S1VA 1WYIA 1K03A 4Z1AA 4OGZA 3IGSA 2QUTA 3IIPA 4GRSA 3T40A 3EX2A 1VHNA 4O18A 5K3VA 1FCVA 1QPNA 4IMDA 3A24A 3KVKA 2DZWA 3EXRA 2FTPA 4YCOA 1WQ5A 4RV8A 2PRHA 1K8XA 1OABA 1YXYA 3O16A 1VR6A 3UWQA 4JTJA 4EOUA 3LBMA 3P67A 1SPQA 5LNWA 4MY1A 2Y62A 3TU9A 2GVGA 1WBJA 3EXSA 4GE8A 3MI2A 4O15A 5G2HA 4WX2A 3OVPA 2HS6A 1VYSX 3L5AA 1W3NA 2Y85A 4FNUA 5J5DA 4FNTA 3NAVA 5DCBA 1XKYA 2Y88A 4AMAA 2A85A 1A53A 3GDRA 3B05A 3LV5A 4AHPA 3NEVA 3N3MA 4JIQA 2G96A 1RR2A 1JCJA 5A5WA 1J5TA 3DAQA 5D38A 1TPH1 1FWTA 1VLWA 2A6NA 3O05A 4HSNA 1W0MA 3N2XA 3EEGA 4NJHA 3R5EA 3W1RA 3OVQA 1AL8A 2ABBA 2C18A 5LHFA 1KM3A 3SIZA 5H2ZA 1I8JA 1W3IA 4YXGA 3BVJA 4DO4A 1TO3A 3LBCA 4ORIA 2ALDA 3BG9A 4GXMA 2QR6A 3P74A 4PL1A 1H7RA 4NNCA 3MW7A 1TPUA 3PAJA 3BV4A 1I2QA 2IQTA 4EF8A 3P5ZA 1F05A 1L6WA 1HO4A 1XI3A 3L5MA 2RH9A 5K2ZA 1I2RA 4J9JA 3NPWA 1Z48A 1PV8A 2QCDA 3FKKA 2P10A 4HHPA 3ABRA 1LBFA 3TROA 2DJXA 4WD0A 1EP3A 4ML9A 2GUUA 2ZA3A 3C2FA 3O06A 3KHJA 4AWUA 4FX7A 2QAFA 1W54A 1ZAJA 3W7JA 5FEXA 1R2RA 1DHPA 1TJPA 3LHVA 4QQ3A 3QFEA 2DU2A 1BWLA 2JKEA 3FS2A 1ZALA 3W2NA 3NQEA 5LGXA 1O60A 3NR0A 4HPXA 3PB2A 3QYQA 2BLEA 4LVFA 3S42A 4ADTA 1KFBA 3IVTA 3NL2A 4CNNA 4IGHA 1XUUA 2AQWA 2O7QA 3KVLA 3C8FA 5DN1A 1IGSA 4N02A 3UWZA 3NPXA 1GYNA 1K8ZA 5EY5A 4JTHA 1DL3A 2DZXA 2B7OA 2W6RA 2TSYA 3CWOX 1KFJA 3KFTA 3F4NA 1W5NA 1GYLA 4A2RA 4DXVA 4UTMA 3O6DA 4O12A 3NM3A 4DF0A 1D3GA 5G1YA 5FF7A 1ALDA 1TREA 4UTUA 4ADSA 1H7NA 1XL9A 3P7YA 3P84A 1TMHA 3R13A 4DO5A 1G7VA 4WZHA 2G97A 2ZRUA 4MJZA 2CZDA 1ZY9A 5K4ZA 3CWNA 2ZRVA 3SSJA 3TFCA 3EKZA 4O16A 1FWSA 3M6YA 1PS9A 3G0UA 4AHOA 2ABAA 3W70A 1L2UA 4LV4A 3PBVA 1N55A 1KLYA 3EWZA 2GPTA 3NOEA 5BRBA 2X1SA 3VKJA 2WNZA 5D30A 2OZ0A 3QQ1A 3EWBX 4O11A 3W2KA 2WQPA 1LLZA 4POCA 4JDYA 3PUEA 4MZYA 3UQNA 1H7PA 3L2IA 4UMCA 3TCEA 2E68A 1YTKA 1TTIA 3LV6A 3ZFHA 1ICQA 1SQ7A 4UNLA 1XFBA 4RCXA 1SSDA 1FXQA 1TPWA 4LTSA 4NT0A 4NXSA 3B06A 3NM1A 1QR7A 1K8YA 2FB3A 3VNDA 3P61A 1WV2A 5DCDA 1DVJA 3PULA 2FFCA 3N2MA 3QSRA 3GNNA 3CPRA 3T78A 1OK4A 2E6AA 5DY3A 3C2VA 3B03A 1FCBA 4AVFA 4R33A 2I9EA 2RKXA 4ZQOA 1L9WA 2DORA 3VE9A 3M43A 2ISSA 2VOMA 3M47A 2NZLA 1CI1A 1L6SA 1JUEA 3GKAA 1O5KA 4Z1CA 3HQ1A 3NA8A 3QJAA 1GEQA 1T8XA 4JTSA 4RZ6A 2QDGA 1MO0A 2ZZ2A 1S5VA 3W7KA 2QCFA 4UFIA 3P8IA 3SECA 4HN4A 3G3MA 3W23A 3W1TA 3SI9A 3KAOA 4FXSA 2GVLA 2YSWA 3TDFA 3GR8A 2QDHA 3TK7A 4BK9A 3MUXA 1OX4A 4OWGA 1ICSA 3UY7A 4OBTA 4XUGA 1FWNA 2F7FA 1A5BA 1ML1A 4EWND 3MWAA 4JY8A 4A29A 4E2DA 2VFDA 3M44A 3W7RA 1BTMA 4S2CA 1JUBA 4BI6A 1RQBA 4WXYA 2X16A 5I3JA 2V5LA 4AB4A 1VHCA 5HUOA 1W5QA 5GVJA 4UTTA 2NXHA 3HJZA 3NQVA 4XKYA 2ZTKA 1BEUA 4E0CA 4KFPA 4WY0F 3NDOA 3G3DA 3W75A 3TJLA 5EA9A 4RZ4A 1OHLA 2CFFA 2WKJA 1EWEA 3DHDA 3W71A 4LRSA 1YXDA 3SGZA 3W7GA 4MKNA 4IMGA 3PBUA 2TRSA 4UTHA 4O0ZA 2W0UA 1NSJA 2RFGA 2Q3RA 1Z41A 4A2SA 3PM6A 4LVBA 3QRHA 3PVFA 3KX6A 3T7VA 3W7PA 4O54A 3RLUA 1TQJA 3DGRA 1M5WA 3R89A 3G1AA 2QJHA 4X9SA 1H7OA 1JJKA 3QMTA 1G4TA 1LTDA 1RQEA 1LORA 4GUFA 1SFJA 2C13A 3TFXA 5CZTA 2BX7A 3G1HA 3NZRA 2VFIA 1FXPA 2A7PA 4JTEA 2BXVA 2FQIA 4Q33A 3IIXA 3CLMA 2E1DA 3GDKA 3LTYA 5AHNA 4GBUA 3GDTA 3HIJA 2Y89A 1VCFA 1VZWA 1A5SA 3LCHA 1TV5A 2J9YA 3G8RA 2NV1A 3W1LA 3VI2A 2UV8G 1PVNA 1D3HA 3R8RA 3WJXA 4CQ9A 5K9XA 2QKFA 5FEWA 3VFLA 5E0KA 3LCGA 2YCEA 4IMEA 5J5RA 4UTLA 1UJPA 4P2VA 1TV8A 3SFKA 2GVJA 4ZMGA 1ZJIA 4O14A 3O8AA 2NWRA 3NVTA 4BI5A 4CCEA 5C5YA 5LNVA 1KFKA 2C15A 3EKLA 3M41A 4LY8A 4Z08A 5BNKA 5HULA 4FB7A 5AC8A 1LM1A 3NZ1A 3LRLA 5KSWA 3TJXA 3LTSA 4XWUA 2JGQA 5G1TA 1TYGA 4LC8A 2F84A 4N6EA 4Z1DA 4TX9A 4CCDA 3V1PA 3HGOA 1M6JA 3UYCA 4DO6A 3P62A 1SZGA 2C19A 1Q3NA 4DBDA 1H60A 3C0JA 3W2LA 2TPSA 2WV8A 1T0OA 2PURA 1C8VA 2QCMA 4LT9A 1JQVA 3ABSA 5HMSA 3DBPA 2X30A 2J9ZA 4QAIA 4L4LA 2YYTA 4UFJA 3MBFA 5FF2A 2FDSA 5L6UA 3UXDA 1LBLA 3P81A 3TA6A 3TH6A 4MLRA 4MLJA 1M7PA 2VC6A 5CGQA 2E77A 3GXTA 1X8FA 3LHUA 4I7WA 4LUJA 4ZQRA 1UBSA 2VXNA 1YTEA 3F03K 3O6CA 5FEZA 1DJQA 1P5BA 1GZGA 3AJXA 1OX6A 3S5YA 2C0AA 4A21A 5I3IA 1GVFA 3QW3A 2VEPA 4RK8A 4IQLA 2ZZ4A 2Z0IA 2PC4A 3UPBA 1N8FA 6TIMA 5D37A 4H4IA 4ZL1A 3W84A 2PRLA 3MYPA 2FIQA 3UWVA 3NG3A 4O53A 2XN2A 3M5XA 5HWMA 4LS2A 1F7BA 1H7WA 4O19A 1Q45A 4RKAA 1PCKA 3HGRA 4NJKA 3A21A 2VFHA 4RZ5A 5G2WA 4HT3A 3C4UA 1OFOA 4BF9A 2FB2A 1KM0A 1IIGA 1TTQA 4JTFA 4P61A 3BARA 3I6RA 3PUDA 4UIOA 2YDAA 3PG8A 3I68A 1GJPA 3DENA 3TNOA 4I7VA 2A21A 3QM3A 4AHQA 3LLFA 3MI6A 3ANYA 4JTLA 3TSMA 3PSVA 2YXGA 3W85A 2HMCA 3D0CA 3W2JA 4LWWA 5G4WA 2EKCA 3E96A 4PFMA 5CPNA 1QNVA 4IJBA 5FEPA 1RPXA 3I7QA 1EP1A 1OFDA 2H8ZA 4HSOA 3W22A 4AWSA 2H90A 5F2GA 3GR7A 3TW6A 3PG9A 4NUWA 1AW1A 2I1OA 3C2OA 5D02A 4MVAA 3L5LA 1W8SA 4N9EA 7TIMA 4M7TA 2Y70A 3W3OA 4JD4A 3THAA 1W5OA 3E9AA 1JCMP 1OF8A 3IGUA 2QJGA 4KWVA 4RXFA 3G22A 5CSRA 1I2NA 2DZTA 2JKPA 1FWWA 3GAKA 1B4KA 3N14A 1W1ZA 1W56A 3EB2A 3QSTA 1RV8A 3WFAA 3QMSA 4JTGA 2GJLA 1AK5A 2I14A 4AEOA 4UTWA 3EWUA 5L9FA 3JR2A 1XBYA 5E1QA 5TBOA 4MUZA 3T55A 3LCIA 1ICPA 1KA9F 1MEWA 4FNQA 4UTWC 4GUHA 2NUYA 3S5OA 3JS3A 4O4WA 3NGJA 4NJGA 4QJ1A 2V2DA 3LCLA 4PTNA 4E2BA 4O1CA 2HTMA 3C2RA 4DF1A 5LZLA 1GVSA 3IIVA 1SW3A 2Y6ZA 1YYAA 1UB3A 1DKWA 5I3KA 3NQ2A 2W79A 1HG3A 5DELA 4AAJA 3G8EA 1UUOA 3KVMA 4O1AA 3E49A 3OIXA 3EX3A 3GDMA 1UUMA 1N7KA 2C1HA 3LXBA 1OG0A 3HBLA 3GNDA 2YW4A 4ONVA 3MYOA 3WJZA 4O57A 2CLOA 1H7XA 2EPHA 1H1ZA 1V7YA 4PCFA 2EF9A 1LLWA 3LI1A 1GG1A 1DQWA 3W7CA 3GXPA 1OFBA 2R8WA 1VRDA 1A50A 1XBZA 3HG3A 1ZFJA 2ZRWA 2YFNA 5KZEA 2H6RA 4LRTA 1VYPX 2CU0A 4Y8FA 2NLIA 3HPZA 1Q6QA 4QM1A 1LP6A 2ZA2A 1GVOA 1EP2A 3LCFA 2ZA1A 1U5JA 2LLEA 1M7OA 1PHWA 2V9DA 1DBTA 5D2WA 4JIPA 3Q58A 4JGDA 3LRMA 1H61A 2Q3OA 2R91A 3CIWA 2WNNA 1TTJA 4JY9A 1RZMA 1LROA 1KFLA 2RDWA 1F5ZA 3BGJA 5F1VA 1I4NA 2Y7FA 3LXAA 4K39A 1TCDA 1ME8A 4QITA 3SR7A 1DOSA 3DKJA 3G1FA 1B3OA 1K7FA 4NXKA 4Y90A 5LSMA 4M6PA 1MZHA 2RDUA 3DKLA 4M6VA 4IUOA 2GQ8A 1TSIA 2YR1A 5CPOA 4MOZA 2YW3A 1YDOA 3Q94A 1ZENA 3W73A 1GTEA 2J88A 1WDWA 1FCUA 2GQAA 4GUIA 4PH6A 3HGJA 1FDZA 3W76A 1XDMA 4UR7A 3IVSA 3WK3A 3RFAA 2TYSA 4NX5A 2QCEA 1IXQA 3W6YA 1FX6A 3FKRA 4LU0A 5LGZA 5LNRA 2BSLA 5AHMA 4AF0B 2XN1A 5EL1A 5U7SA 1L6YA 1KBJA 5F4XA 3MO7A 1THFD 3GB6A 5HWNA 3P5YA 2EGZA 5KMYA 1YDVA 3LHZA 1X1OA 4N9CA 2VEMA 3BLFA 1J2WA 1LDCA 2O7SA 3CHVA 1G4SA 2QCCA 4MPQA 4YLWA 4MFDA 4IPIA 5HINA 3W7DA 3STFA 1OK6A 5KTLA 4GUGA 1JCNA 2QCNA 3H55A 1G7UA 1GG0A 5CKSA 2X1UA 3CM4A 2HS8A 2X1RA 4X22A 3BG3A 3NQ6A 3EWXA 1IXPA 1EB3A 3MHGA 3S1XA 1JCLA 1I2OA 3O15A 4RLIA 2E6DA 2Z6IA 3HG4A 5AC7A 1G67A 3N19B 3GXNA 3EWWA 2WSYA 4CNPA 4O1BA 1OFAA 1SO6A 5DCEA 4TMCA 2ISWA 2Z2UA 1XCFA 4CCCA 5DY2A 4HNVA 1T96A 2C16A 1DQXA 1TTPA 1VS1A 3EX4A 4I7UA 4JTUA 4MY9A 3UY8A 3CU2A 2CLLA 5DBUA 3A5FA 3KRSA 4AH7A 1IXNA 3VE7A 4O28A 1KTBA 3HGSA 2CZEA 3F4WA 5EKYA 3W1XA 1QWGA 3HG5A 4ZQNA 2P0OA 3AO0A 3LCXA 2AAMA 5D04C 1KTCA 1AL7A 1R46A 2FPYA 4XTIA 5FF0A 5IM51 4MJMA 4ZZ9A 3G1VA 1EPXA 1LRQA 1QO2A 4UTTC 1O5XA 4OV4A 4JR5A 4UUIA 1TQXA 4BI7A 4O13A 1QOPA 4N2YA 3QEZA 3W1AA 3FOKA 3TQKA 4N4PA 1ZAHA 4MYXA 4TMBA 4O0KA 4YMZA 1YDNA 3MMTA 1R2SA 2C14A 1OX5A 3PUOA 3DFOA 4K8EA 1FY6A 3OHIA 4JDBA 3LGEA 4GJ1A 3WK2A 4TO8A 2OX1A 3CEUA 1ZAIA 3G1SA 4YWIA 3SW6A 4BFAA 3TC6A 1XXXA 4CNOA 4KWWA 3NQMA 4HKPA 2DJLA 3TR2A 1B4EA 1NAL1 2QCGA 4DPQA 1R2TA 4BR1A 2OCZA 2CLFA 1QPQA 3PBWA 2G5WA 1KBIA 3TUUA 1WA3A 3ZS4A 3OA3A 4FX6M 3TQ0A 2RDTA 3ATZA 5A8GA 3B0PA 3RK8A 1LRNA 1TPB1 1TJRA 2ZZ7A 8TIMA 3S1UA 1OVDA 1YLVA 3GYEA 3UZ5A 1H62A 2YFOA 3NPUA 4EF9A 3QPYA 4JX5A 1DJNA 4K38A 4DF2A 4LOCA 5DLCA 4FNSA 3C2EA 3W2UA 2A1YA 5D2TA 3UWUA 4A22A 3WK0A 3PC0A 4RXGA 1G4PA 4HIBA 3VCRA 1YPIA 5C2XA 3LCWA 1K7EA 4QSHA 3LXCA 2V2HA 1KV8A 5EBUA 1AMKA 2E09A 1QPRA 1WAUA 2YPIA 3I7RA 1P0KA 3B4UA 3B8DA 4O17A 2NUXA 1LOQA 4N4QA 4GUJA 5FESA 5AC6A 2BTMA 3QH2A 2X1TA 1OFPA 4QIUA 4LVAA 1GPWA 3NQDA 1OJXA 3U8GA 3FEMA 3QW4B 2QJIA 4K37A 2A5HA 3NQGA 1Q6OA 1W5PA 3WK1A 3GK0A 1VCGA 5BMWA 3B04A 1V5XA 3A5VA 4CQ8A 1JR1A 2WJZA 4Q32A 4NX0A 5KITA 4LS1A 3GX9A 1OYBA 4O1DA 2FLIA 3WJWA 4M5PA 1PL9A 4JX6A 3BW3A 4E38A 3MBDA 4WOQA 3DH7A 1AG1O 1WOBA 2NV2A 1QDSA 1MEIA 3IVUA 1KLZA 2VKZG 3T44A 1QOQA 4LC6A 3NL5A 4A3UA 3PB0A 1LRTA 3M5ZA 4UTIA 3THQA 1F73A 2WNQA 3L67A 1GT8A 5HR6A 5EMUA 3INPA 5CZSA 1RQHA 4FO4A 4QNEA 3RLVA 4NNBA 3I65A 1LYXA 5CPMA 5KZDA 3R12A 4N9BA 3W1UA 3KXQA 2X2GA 2QUVA 3PR2A 3LLDA 3G1DA 2E6YA 3M16A 5ABTA 3SJ3A 4PC8A 4UFLA 1MEHA 1JCXA 3UPWA 2ATMA 2ZZ5A 3EX6A 1C9DA 4LNYA 4UMAA 5KZMA 1F6PA 5D32A 1GWJA 2ZRZA 3WJYA 3GZ3A 3CIXA 3B0VC 1CX9A 1ZCOA 2PE4A 3ZWTA 1SO4A 3A22A 3KVJA 3L0KA 2DZUA 1AW2A 1MSSA 3G0SA 4PL2A 2WO5A 4C1LA 1FCQA 3DU0A 4MFEA 4NNAA 3TSDA 4IX2A 4LVDA 4H6KA 4KKXA 2C6QA 1VGAA 5HR7A 1KM1A 1P4CA 1SSGA 3DFSA 2QCLA 1Z42A 4UFHA 2J9XA 1YXCA 5D2XA 1VQTA 3HB9A 3H54A 3DHFA 5AYXA 4JN6A 2CW6A 4DELA 1QCWA 1VLIA 1TPVA 5AHFA 3UWWA 1FUYA 4JEQA 3TQVA 3NYZA 4UC5A 1ME9A 4M6QA 1SZFA 3G24A 1Q6RA 4XQ6A 3HMJG 2ZZ1A 3FFSA 3C52A 3NL6A 2Y7DA 1EA0A 1HUVA 5DXYA 3W7IA 1J4EA 4JTKA 5F2IA 3UZJA 3P8JA 4ADUA 5AHEA 3LHYA 3ELFA 2QUUA 4FIRA 2E5DA 1HO1A 2B7NA 2ATSA 2D73A 4WJEA 3L0GA 3RMJA 1NFBA 4WXZA 1KM2A 2V2CA 3MP4A 2A2IA 3STCA 4OT7A 4MIMA 2CZ5A 1ZNNA 3LTPA 3DI1A 4N6FA 1R47A 4FIQA 1H51A 3TV8A 3WJSA 1U83A 3W1QA 4Z0SA 4O50A 3E12A 1VC4A 5LNSA 4O10A 5FF4A 2R94A 3Q37A 3O07A 1O4UA 4NJJA 4H3DA 3W7MA 3CB8A 3TX9A 4RX0A 3HO8A 1VCVA 4IMFA 3M5VA 4JS3A 3GKFA 4OU1A 4M7SA 1LOLA 3EX1A 4YCPA 2B7PA 5F2LA 4ALDA 1P1XA 1O94A 4R53A 1EUNA 2Z1BA 2E5CA 2GOUA 3K30A 3N9RA 3QPZA 2V0TA 5FI8A 4HNNA 1H50A 3W88A 1OFRA 2QF7A 5D05A 4O52A 3BLEA 3FYOA 3TE9A 3M9YA 1KM5A 2YZRA 2WSRA 4AF0A 2KZHA 3BG5A 4NZJA 3CEPA 2NXGA 3OBKA 4UFMA 4UFKA 1SW0A 4I9AA 3IEBA 3SGUA 2YX0A 1KFCA 3M1ZA 4JXCA 1RVGA 3N34A 4OV9A 2NX9A 4NZFA 3TMLA 5BMXA 3HPSA 4C1KA 5E93A 5CPLA 4Y6GA 3Q2DA 2VFFA 2Y7EA 3CTLA 4ZQMA 2DZVA 3L65A 2QEZA 5EYWA 5K9CA 1XUZA 3SY5A 5T26A 3S5ZA 1QPOA 1HL2A 4CLMA 4K6AA 2CLIA 4NJIA 1E51A 4XTDA 5AFDA 1WOAA 1KM6A 2EHHA 3CT7A 3PY2A 5D2YA 2Q8LA 2G95A 2DP3A 3DXIA 1YTDA 3IRDA 3DFPA 3NQ7A 1K7XA 3RU6A 4PODA 4UCGA 3L9CA 3GVGA 1GOXA 2CLEA 4HPJA 3E0IA 2GJNA
chains in the Genus database with same CATH superfamily
2WB5A 2ISFA 3GDBA 1SMAA 4KRZA 3AUOA 4JYEA 3OB8A 3A9IA 5H1WA 2XN0A 3RMEA 3WBEA 2PPGA 3IJ7A 3R2GA 3VGBA 1XLCA 2PC8A 3BICA 1LZOA 4DUXA 2V82A 3E02A 4K8GA 5HJYA 2WSQA 4MZ8A 3OZMA 5SWUA 3RNDA 4L1XA 5DO8A 3T4CA 2OT0A 5C6MA 2EO7A 4IPLA 3RM9A 2CZFA 3UJSA 1F07A 3S6DA 3CGTA 1HJVA 2A7NA 3MP5A 4YTUA 3N73A 3CIVA 3CMFA 3UG5A 1ZHAA 2BVTA 1IIHA 1Q8JA 4P7NA 4JIRA 4QR6A 1J0YA 4WOZA 4NKCA 3DFYA 4A3RA 4IXHA 1H1YA 4QJ3B 2X05A 3VIGA 1X1NA 3M0MA 2OWCA 1GVIA 2Z28A 1T99A 5LNUA 2YLLA 2ZIDA 3PPHA 1JVNA 3DFTA 1WB0A 4XBKA 3H22A 4FK9A 4H6EA 4IOTA 2VCAA 3MP3A 1VEOA 1YIXA 5LXXA 2PEVA 3C6CA 4PA8A 5TF0A 4FLQA 4Y9AA 2QCDB 4S3FA 4GWEA 1Q6LA 2F38A 1R30A 2FMOA 3ITOA 4IXXA 1TV7A 5BW6A 1JCYA 2V5CA 3TSBA 1R9ZA 4FEZA 3WMCA 2ZWZA 3GDLA 3K4DA 4GCAA 1UC5A 2PGRA 5KINA 3UGRA 1WKEA 3VIJA 2CXEA 1NOFA 1NVMA 1GPFA 3MVIA 4WQ6A 2QV4A 3HF3A 1NWTA 2GGHA 2R24A 5G4EA 4UTJA 1US3A 2ZXAA 4MY8A 4JTIA 4Q7BA 3S2CA 5AECA 4KFNA 2P1FA 3W7NA 3EXTA 2GUBA 4OE7A 2VENA 4QRNA 4A8RA 1X96A 1MDLA 3RLGA 2NSXA 3WF1A 3U7VA 1WDPA 2OYKA 4FNPA 3A4WA 2OKTA 3HU7A 3BPWA 4F0RA 3B9EA 4IPJA 3WQPA 3NPVA 1PSCA 3PBYA 5AHLA 1A3XA 3P0WA 2BGQA 3OQEA 1JXJA 3SCTA 2J13A 3VNMA 1V0LA 2O4MA 3TTSA 3DFNA 3UG4A 2G37A 1UWTA 3LK6A 3LHTA 2FVLA 5D03A 4WUIA 1B3YA 4BWLA 1V0KA 5CPQA 3V75A 1UR4A 2EAWA 5C54A 5REQB 2YZ5A 1QNRA 4S2BA 1UKTA 3QY6A 4XB3A 5HXMA 4RNIA 2ZTJA 3OZPA 5HMEA 4UR9A 1HKKA 3EMQA 3IJQA 1XBVA 4QE1A 3HPXA 3WLKX 2ZQ0A 1RY8A 4P7RA 3T0DA 2Y61A 2CHOA 5CZ0A 3P14A 1VJSA 3VD3A 1LUCA 2AL1A 5I5RA 2R14A 2A4AA 2NX1A 1PYMA 3O1NA 2ZZ6A 1E1CA 1SUXA 3QYSA 4ZR8A 1HL8A 3UWYA 5AB3A 1B57A 3R8HA 2WMGA 4FXRA 2DSWA 1FVPA 2GQ9A 2DQWA 4XAFA 2OMAA 2FZNA 2PWVA 3NNTA 1Z8AA 3EDEA 3DYMA 4C6IA 2YYUA 4DAFA 1FDYA 1XYZA 3IJIA 1HTIA 3DBNA 2HVNA 4V33A 3LM7A 3CUIA 1YNPA 3FEQA 7CGTA 1J8VA 1VYRA 2DIKA 5EFFA 3W87A 1RK5A 2J8FA 3W7QA 1T6MA 5BU6A 3S9YA 3U48A 4MSSA 1SZEA 3KUMA 3CV1A 1QAPA 2J75A 4HA1A 2YCJA 1T41A 3ES8A 2CLPA 1G6CA 2ZFAA 1FHLA 1FQ0A 3S47A 4B5NA 3QQ0A 1EHAA 4GJIA 4IGMA 4LS0A 3AXIA 1R9XA 1X6UA 2YCLB 3GFZA 2XVNA 1G1YA 4MNJA 2YL6A 4L4MA 4LAKA 1PHQA 4WY0B 3LI0A 4XKYB 1QO5A 2Z1WA 2GSHA 2ZYFA 2JF7A 4EACA 1ZB5A 1TUFA 1OFEA 2YL5A 4U33A 3CHDA 5EPDA 3WD0A 4PMVA 1I45A 1Z69A 3ABQA 4LBUA 3WLPA 4L6OA 2WC3A 1QMLA 3N9KA 1WP6A 2DSUA 1TJ2A 3S0CA 1ONRA 4C6DA 5CZJA 3KLLA 3WDJA 4L64A 3NXFA 5D9PA 2QCHA 3POCA 4UOJA 1RXOB 2WPBA 2ODOA 4D6IA 3WL0A 3P80A 1IHIA 4IWWA 3WEOA 3K8MA 4L9YA 4OHQA 2NUWA 2P50A 3RYSA 1TPFA 4HVXA 3MSDA 3W1PA 3ONCA 1EIBA 4DQWA 4HNTA 1S2VA 3F5KA 2OPJA 1V02E 3KRUA 3VNLA 3QGKC 1EX5A 1B9BA 5FCZA 4R9XA 3QTPA 5E70A 1BSIA 1XWYA 1A5AA 4Y96A 4JAWA 4JNMA 1G4EA 1P0EA 3UZYA 3VNYA 3VFCA 4GC4A 1DIEA 1ME7A 2FFIA 2ZUVA 3FYPA 1IV8A 3R79A 1I6NA 3GNXA 2DZSA 2ZUSA 1WYIA 2PU1A 2R6OA 4GRSA 1EDQA 2Z7GA 3D47A 1E0WA 1FCVA 1TWSA 4YCOA 4F3HA 4RV8A 5A8QA 1GW9A 5BXRA 2WPGA 3UZXA 3WQCA 1TWZA 3ZT7A 5HMFA 2VJXA 3O16A 2VL4A 1UIPA 4EOUA 3SCUA 3P67A 1SPQA 1DJHA 2FH6A 4X9YA 2QUMA 3UXKA 2JE8A 4KCVA 1A49A 2GWGA 3OVPA 4NAFA 3U4FA 4M3PA 2G3FA 1VKFA 1W3NA 3SCRA 2Y85A 3MJMA 4FNUA 2PB1A 4Q22A 1XLAA 5J5DA 4Q8NA 4GO8A 2A85A 2WC4A 3LV5A 1CNVA 3GS6A 1UR8A 3URNA 1Z6KA 1J5TA 4GCXA 5D38A 1VLWA 2A6NA 2CKRA 3O05A 1W0MA 3AYRA 4BF7A 3W1RA 3Q65A 3OGSA 1TO3A 3C0QA 3LBCA 2OU4A 3LA4A 1OT1A 3V0SA 2QR6A 4PL1A 5ECUA 2Z1KA 3PAJA 2DPEA 1XH1A 3P5ZA 3W02A 1OCQA 3E0LA 3L5MA 2RH9A 4J9JA 2O9PA 2XYLA 4ACZA 3TROA 5A6LA 1S5NA 2GUUA 2ZA3A 4HZMA 3KHJA 4FX7A 1W54A 4DZ5A 1DHPA 3LZ3A 1HJWA 4QQ3A 3CWHA 4L9XA 3KTCA 1ZALA 3W2NA 4DJDD 1UKSA 1O60A 3NR0A 4HPXA 4OECA 4QHRA 1KKRA 4H83A 3S42A 3IVTA 4QQUA 4CNNA 3VYLA 3ZJ6A 3SUUA 3KVLA 2G8ZA 5BXSA 1QI3A 3KCLA 3GNPA 1GYNA 1K8ZA 3LQGA 1O6IA 4JTHA 2B7OA 4L6DA 4G9PA 3T09A 2W6RA 2DW7A 4V2XA 2DUZA 2BODX 2E8YA 1E6SM 4R27A 3M0HA 1B54A 2WWDA 3MY9A 3T2PA 1W5NA 1B3VA 4O12A 1BFNA 2DT1A 3RJXA 1F3XA 4Y9NA 2GJXB 1E0XA 3VAVA 2XSXA 1ZBVA 1ZJHA 4UTUA 3PBMA 2VDHA 4ADSA 3T6CA 3P7YA 1BG4A 4IP4A 4U2ZA 2YBTA 3GHTA 2CZDA 3CWNA 4DI9A 1Z7AA 3EKZA 3DUGA 3M6YA 3WLLA 4AHOA 1XHGA 2ABAA 1C7TA 3PBVA 1W2VA 3WN6A 3EWZA 3NOEA 1U1UA 4HN8A 2WNZA 1F61A 3EWBX 3W2KA 2WQPA 2PI6A 3UQNA 4LSBA 1E6QM 4UMCA 4OKDA 1M68A 3ZFHA 2XG9A 1QW7A 4XX6A 1Z89A 1TPWA 4LTSA 3CNYA 3UERA 1BYBA 3V0UA 1E6XM 1K8YA 4BF5A 4MAZA 3TR9A 3VNDA 3CUGA 4AZ5A 5DCDA 2BHUA 3SRDA 1DVJA 3VGHA 4DWDA 4I9TA 1KC7A 2D69A 2WVVA 1Q7MA 4CD4A 2FJUB 2FZ8A 3B03A 4AVFA 4J40A 2I9EA 3CMGA 4DM2A 2ISSA 3BURA 3ZM8A 1UZDA 4Z1CA 4Q4OA 1MFUA 3VIFA 3QJAA 1GEQA 3OODA 2PDLA 4JTSA 1S5VA 1EQPA 1NOUA 5JUVA 1QI2A 2KAUC 4I5UA 4ECLA 1W9VA 3UR7A 3VD9A 3SI9A 2GVLA 1W1B1 2YSWA 1T8QA 2OLSA 1OX4A 3SY8A 3K1DA 3UY7A 2ZX8A 4OBTA 4EANA 4ILSA 3G6MA 1POKA 4E4UA 1ML1A 1IR1A 3ARRA 3W7RA 1BTMA 1GOOA 4US6A 1HW6A 4GYPA 1H1NA 1RQBA 4C1NB 1UW9A 4EX4A 2W5FA 1EO7A 1PZ0A 4UTTA 1FFQA 4HCHA 1OD8A 3NQVA 4H41A 3VOHA 2YBUA 4W87A 2KX9A 5HANA 2ZTKA 3BLLA 4E0CA 4GACA 3MV11 3T0BA 3RDKA 3RR4A 3R7MA 1RLCL 4PCNA 4RZ4A 1OEPA 3PZUA 5HNTA 1JZ7A 2CFFA 1EWEA 3EOOA 5EMKA 3SGZA 3W7GA 3SB0A 3ITCA 5CC3A 2V5JA 4UTHA 2W0UA 2RFGA 4KWOA 3PM6A 3KX6A 3P3BA 3T7VA 3UJFA 4KPLA 2PD5A 3CPUA 4EKJA 1A5MC 2MUCA 3R4IA 1M5WA 5C70A 3EA3A 4HYRA 4I8DA 1J0IA 3G1AA 2IQ0A 3BAIA 5IHRA 1RQEA 4GUFA 4IG2B 3EPMA 5DT5A 3NZRA 3WDHA 2A7PA 3AQUA 2XIQA 1TX0A 2ZICA 3FNDA 2PDGA 3IIXA 3CLMA 2OO6A 1S39A 2E1DA 3T9PA 1V6XA 5AHNA 1R3TA 1J5SA 2NVDA 3GDTA 2B31A 2INEA 1UWRA 3WLMA 1XYFA 1A5SA 1VBGA 3A64A 2CYGA 3LCHA 4PULA 1H0GA 4IM4A 3WJXA 2PWDA 4RDVA 3VFLA 2FTWA 4RZBA 4I90A 4L56A 4EXAA 4IIGA 4H04A 1C91A 1Q6EA 5JIWA 1XRFA 3RXZA 2GVJA 4CNTA 4ZMGA 4W8LA 3ZLHA 4A6GA 3BSGA 4FP1A 3DG6A 4XBJA 2NWRA 4BI5A 2NQZA 1R3WA 4V1YA 1KFKA 2C15A 3EKLA 4LY8A 3I3EA 1T40A 1X6NA 3L4VA 4FB7A 4NSBA 1LM1A 1TIWA 3QZ6A 1VBRA 4LC8A 3HGOA 1Q3NA 3DDMA 3GC2A 3SQLA 4PTWA 1PDZA 3EOEA 5LIKX 2QCMA 4WIWA 3M0JA 1JQVA 3ABXA 5BCAA 4L4LA 2YYTA 2WNWA 2ZX6A 4Q8MA 5L6UA 2YDRA 3KZPA 3P81A 3TH6A 3LU2A 2VC6A 2NQLA 3VOFA 3RHGA 1DWJM 1X8FA 4LUJA 1DXFA 1YTEA 3F03K 1O5QA 4L1WA 1DJQA 3GW0A 1P5BA 4AU0A 1OX6A 4H00A 4ZFMA 3VZZA 5I3IA 1ITCA 1ESWA 3QW3A 4RK8A 1XSKA 1GW1A 2Z0IA 1BQCA 1TV4A 2G3MA 4AD0A 4H4IA 1MRQA 4IZGA 2PRLA 1WE5A 4O53A 3M5XA 2HNEA 4FR6A 1P6WA 4PTMA 2PGWA 4HMNA 4HU4A 1FKXA 3HGRA 3O0KA 1XKJA 4GK8A 2VFHA 4HHLA 2PBOA 5JXQA 4JTFA 1XLFA 3UR2A 1RSCA 3ZSTA 3I6RA 3WD4A 5BWAA 1J93A 3I68A 4AHQA 1AJ0A 6PTDA 4U2YA 3TYCA 4D8ZA 5CQ1A 4C6KA 4JL1A 3E96A 1OCBA 1ZPTA 5T9BG 4PFMA 4S38A 3O6AA 3H7UA 1QNVA 1RPXA 1XYBA 3UCCA 3RIKA 1O5RA 2H8ZA 7A3HA 4AWSA 5F2GA 2ZADA 1MFVA 3WLRA 3PG9A 2PGFA 4NUWA 2WMHA 1XPGA 5D02A 5M03A 4KBXA 4ZE4A 1OIMA 3MB9A 1E70M 1EPVA 7TIMA 3H2FA 1WZAA 1R6WA 3W01A 4P8XA 4DJDA 3B97A 3E9AA 1JCMP 3RM4A 1TA3A 2QJGA 2DIJA 4RXFA 5CSRA 3NWRA 4DWSD 2WANA 2JKPA 3GAKA 2PDHA 4D1JA 3KZSA 5FJRA 3N14A 1W1ZA 1W56A 3EB2A 4U3CA 4S23A 1RV8A 2VOTA 2FGLA 3QMSA 3KS5A 4DLMA 1AK5A 1Q6FA 1FWFC 1AMYA 4UTWA 5BRQA 4JTDA 4ATDA 3VOGA 3SCSA 4MUZA 3UT0A 1MWOA 4FNQA 3XISA 2JEPA 1G0CA 2NUYA 1A4LA 4W8AA 3S5OA 3LCLA 4X60A 2IKIA 3IUDA 4RV3A 4LAZA 2OGJA 2VNCA 5H8MA 4Q7IA 4DHGA 2Y6ZA 1YYAA 1EA9C 2Y1HA 1NH6A 4AAJA 1KXHA 5M2FX 3UA3A 4LH8A 1AODA 1S2WA 4EK7A 3OIXA 3EX3A 1UUMA 3BLKA 3DOPA 2VVSA 1JDFA 5AZ0A 3FVMA 1BRLB 3BLDA 2CLOA 1H7XA 1H1ZA 4PCFA 2EF9A 3N25A 4DJEC 1RCQA 4D1IA 1DQWA 3W7CA 3QPEA 2R8WA 2WZIA 1VRDA 1A50A 3HG3A 3NDZA 3WCZA 4JQ4A 3DESA 4LRTA 1XLLA 2WWCA 4PCSA 3BMXA 3LCFA 4DBSA 2LLEA 3B8UA 3QLLA 1KBKA 2XFRA 2Y8KA 1DBTA 2HE5A 4CEUC 4JGDA 3T4WA 4A8NA 1E4MM 2R91A 4GIAA 2XH7A 1Q2RA 2RDWA 2W3ZA 1F5ZA 1R85A 4K2SA 2ON3A 1XJBA 3EMCA 1I4NA 3SR7A 1B3OA 2ALRA 1K7FA 4NXKA 5LSMA 4JPGA 1J0HA 2RDUA 4B9YA 2HVOA 4M6VA 3PP7A 1F8MA 4X0VA 1F3TA 1QW9A 1YDOA 1UZ1A 2V6AA 3W73A 5C8BB 1GTEA 2J88A 5M1TA 4AC1X 1EGVA 4GUIA 4PH6A 3L4WA 4HMCA 1XDMA 3RGTA 2P88A 1IE7C 4PB4A 3V5FA 3LLXA 3W6YA 1QHZA 3LGGA 3OHMB 5EL1A 3AAMA 1L6YA 3VINA 3N18A 4MWAD 5KMYA 1S2AA 4JTRA 4UQDA 1X1OA 3BLFA 2BFGA 4E8GA 1KRMA 4H8NA 4ICMA 4F0MA 2QCCA 2VX5A 4WGHA 2Q01A 3T42A 4B5XA 1B3XA 4G1NA 3AWNA 5HINA 3OVGA 1TUXA 3H12A 2G50A 1KXVA 1V6UA 1E3ZA 2X0SA 3CM4A 2DSVA 2HS8A 4X22A 3IUHA 4Q8WA 3NQ6A 1IXPA 2WMFA 2XIJA 2E6DA 2Z6IA 1G67A 4L65A 4XVDA 1LF1A 4CNPA 1K4HA 2BVDA 3MMWA 1PBGA 3ISIX 4TMCA 2ISWA 2PDUA 2BMBA 1T96A 1DQXA 4AY7A 1VS1A 3DG7A 3EX4A 4JTUA 4MY9A 2CLLA 2YB1A 4PB5A 2V3FA 3SN1A 4XD3A 4AH7A 1AQMA 1DE5A 3VE7A 4O28A 2PWHA 4ZO9A 4E4PA 3LCXA 2AAMA 1KTCA 3U2CA 3QFWA 1LJYA 1R46A 2FPYA 4XTIA 4AW7A 4D6GA 3B8TA 4PUUA 5IHSA 4ZZ9A 4RDZA 1QO2A 4UTTC 1Q65A 4O13A 1KGUA 3QY7A 2VGGA 3GO2A 1TJ1A 4Z1YA 3QEZA 3W4RA 2PTZA 3TQKA 2HK0A 4TVDA 2QVHA 4YVXA 2REQA 4O0KA 3I6EA 3UETA 2Z4GA 3MMTA 1R2SA 1W91A 4AFYA 1D8WA 4C5ZA 5CZKA 1FP9A 4NRSA 2EEXA 2OX1A 2FH8A 3CEUA 1ZAIA 2DUXA 5CSYA 4KWWA 3NQMA 4J1OA 4HKPA 3EOUA 4LBSA 4DPQA 4ZOCA 4BR1A 1XFCA 2OCZA 4U5IA 2OZTA 2GDQA 3PBWA 5FACA 2PZNA 3ZS4A 3OA3A 4CQCA 4J4KA 1H11A 4MKSA 4HYWA 2RDTA 2A3AA 3W29A 4ZOEA 1WZKA 2ZZ7A 8TIMA 3S1UA 4GY0A 3UZ5A 4HA4A 3UG3A 3NPUA 3WLTA 2VC9A 4DF2A 4LOCA 5DLCA 4FNSA 3W2UA 5D2TA 3OU8A 4RXGA 1G4PA 3OYXA 3HPFA 3NJ3A 4Q4RA 1Y65A 3HN3A 5GNYA 2E67A 1ZJAA 1QPRA 1XIHA 2YPIA 3ZJ7A 3E2QA 3I7RA 5BROA 3B8DA 3NCOA 1AH0A 2HCVA 3ME3A 5GPRA 4J3UA 5TAOA 4BQ4A 3VIHA 2PS2A 1V6YA 2ACUA 2PDIA 3GFYA 5AC5A 4MNKA 6A3HA 3DG3A 2X1TA 1OFPA 4M81A 4LVAA 3PK7A 1VFTA 2ACRA 7PTDA 4WKHA 4ZODA 4E2VA 3FEMA 3QW4B 1PKYA 5T91A 2QJIA 3KOWA 1FWIC 3NQGA 4QG9A 5CJ5A 1VCGA 3IJ6A 4XVEA 2IPWA 1WKFA 4NX0A 4DZIA 4EXBA 1OYBA 3POHA 1KKOA 2HXTA 1EJWC 4P7OA 2ZWYA 1MEIA 2VKZG 2V3EA 1KXTA 2ADAA 4A3UA 2WLZA 1JNEA 2R1NA 1F73A 1K8CA 3L67A 4QAWA 3INPA 4UTFA 1RQHA 1XLJA 2FDMA 4UZSA 3RLVA 4NNBA 1LYXA 5CPMA 1A5KC 1R3RA 3PR2A 1HGWA 1LUCB 1J9YA 1CWYA 1UKOA 3EX6A 2HQAA 4E5TA 1E1CB 1L0PA 5E0CA 2PDWA 3GZ3A 4IFRA 1CX9A 1ZCOA 1JD9A 2PE4A 1SO4A 5CGMA 3L0KA 1QNSA 2WO5A 2B81A 1FCQA 7XIMA 3TSDA 4IX2A 2WQDA 4S39A 4LVDA 4DWSA 2C6QA 3AXHA 5HR7A 5FSDC 3FA3A 3GC4A 2CXGA 4M80A 1VQTA 1UMLA 1JGIA 2OSXA 3DHFA 5HAOA 3DHUA 2CW6A 1EC9A 3VCCA 3M7SA 1QCWA 5AHFA 7ODCA 3CV6A 3ZZ1A 1EC8A 1VPYA 3FFSA 2Y7DA 3NIYA 3W7IA 1J4EA 4C91A 4PMYA 4BHYA 4IL0A 4ADUA 1XSIA 4N7QA 4QXIA 4DJFD 2QDDA 2E5DA 2B7NA 2ATSA 4WJEA 3L0GA 4GFIA 3RMJA 3WDRA 1EXBA 1SFTA 1CDGA 5AVHA 2OXNA 3NSNA 4LAMA 3MP4A 4FI4A 4UBPC 4IIEA 4MIMA 3MT1A 4W86A 2CZ5A 1ZNNA 3LTPA 3DI1A 3UEQA 1R47A 5I03A 3N4EA 5DEZA 3KP0A 1KCLA 3MV01 3E12A 1CXIA 1R3QA 5FF4A 4XZIA 1QOXA 2UBPC 4IJCA 2VDGA 3EMZA 3B3DA 4IQJA 1LOLA 1PTAA 4ZSUA 3NZPA 5F2LA 4ALDA 4LYQA 1P1XA 1IWPA 4R53A 3C3UA 3H2MA 3CASA 1AD4A 3QPZA 4GMEA 5FI8A 4GI9A 3ANUA 1H50A 1B9ZA 1O7AA 1OFRA 4IF2A 1NDZA 5D05A 2EG6A 3FYOA 4ZEPA 4OVXA 4WKFA 2BV9A 4WKAA 4AF0A 1CB2A 2KZHA 4NZJA 4FLOA 2D2GA 3BC9A 2NXGA 4OUIA 4A3HA 2G3IA 1KFCA 5CPTA 1RVGA 4OV9A 4NZFA 2WYSA 3VDCA 5E93A 3WMSA 3CTLA 2DZVA 2QEZA 5EYWA 1XUZA 3SY5A 5T26A 3CQIA 3F7JA 5CPSA 2VP8A 1LT7A 1BGGA 4XTDA 3UA4A 4QBXA 2ZXBA 1XG4A 4P5UA 5A95A 4QDWA 1KM6A 3XINA 3PY2A 2Q8LA 3A4JA 3WUFA 5LA0A 1V3IA 3AIQA 4UCGA 3VX1A 3GVGA 2HVMA 3I10A 1BQGA 3RITA 2GJNA 4R7JA 1NIUA 3UJRA 1GQKA 4HQVA 3DFQA 3MO4A 1PX4A 4UQAA 3LNMA 4AD4A 1R87A 3NQCA 4UMBA 4MWAA 4ZVJA 4RR4A 3GIPA 2B0MA 2FZMA 1S5TA 3UVIA 2Q8ZA 2CLMA 3WDIA 1PTDA 1Y0EA 4IICA 3W2MA 3VKAA 3LPOA 4JKLA 1WXJA 2VRJA 3RCMA 4E8CA 3PS7A 5AN7A 4YPJA 2J7HA 3KRZA 4BEQA 3FSTA 4NAFB 1F8IA 3ZO9A 2VUNA 3AISA 2VDIA 2ZXQA 4AZ7A 9CGTA 5TIMA 5I0DA 2ZBTA 3BW4A 5MHBA 1CW2A 4O8RA 3TZFA 2X42A 1UBPC 1HP4A 1SU5A 1GQJA 1JFHA 1DTNA 1KBLA 1UWAA 1VH7A 1H3GA 2DZPA 1JQXA 1A5CA 3CXOA 1EGMA 5HMDA 3GVVA 4OZOA 1G69A 3FJ6A 3KOFA 3S8HA 1ONEA 4JHOA 1GOKA 1E9YB 3W7LA 1IEIA 4R88A 1DE6A 3IGXA 3W82A 5D33A 1JD7A 1Q7QA 3C2YA 5C9RA 3ITGA 4PTDA 5A6BD 3JW7A 4LV9A 3GG1A 3L68A 1KFWA 5D2VA 4AWEA 5CEWA 4NQ1A 5AHIA 1JI1A 3ZVHA 1ITQA 1MQQA 2V5BA 1RD5A 1NQ6A 4W8BA 1ISXA 4FHAA 1L8NA 3RG6A 5F4SA 1S5MA 4M19A 3IV8A 1NF7A 3TXZA 5AYZA 1F6KA 2J78A 2F9RA 3U4AA 1UZHA 3HTWA 1H5YA 3C56A 2OT1A 3A23A 3ARYA 4M82A 5B7YA 4XZHA 1KRAC 2JF6A 1UZ4A 4X2PA 4E6MA 3EGJA 1QBAA 2AKMA 1GQNA 1K4GA 4JL2A 1UP0A 2VUYA 4URIA 1A47A 3USBA 3GIYA 2PU0A 3PTDA 4XBSA 3EDDA 3TC7A 3S1WA 4RDWA 3T1GA 1NDVA 2E8ZA 3QV7A 4S1FA 1BF6A 4REQA 3TNBA 2O55A 1TRIA 1X1ZA 1FBAA 4JTTA 5RUBA 4NI8A 1ZCCA 4LVGA 1JYWA 1TZZA 3R43A 2PDBA 4PTXA 3GTXA 2H8XA 6ALDA 5IBXA 1O1HA 4I9JA 4WY0A 4ZQPA 2PCQA 1HKWA 1TZ7A 2I17A 2OODA 3NQ8A 3ARZA 4ATWA 3UW6A 1PKLA 2D20A 4GNKB 2WSPA 1EEPA 1TPDA 3QKZA 4MHBA 1A5NC 4MF4A 4A8LA 5C7HA 4UXDA 3B8SA 3FA5A 1B30A 2CWNA 4RE4A 1AQ0A 3DERA 1JULA 2YA2A 1I2PA 3WNOA 1OFQA 4LGXA 1EQCA 4IH3A 1UCWA 4IQEA 3TKFA 1S5WA 3IK2A 1ZZMA 2BZNA 4QROA 4S3KA 1LCOA 3M0IA 3FJ4A 5G2IA 3G1XA 3HOJA 5KEZA 3W74A 3SURA 4F2UA 3FCPA 4F4RA 3DZ1A 4NHVA 4UQ9A 4LUIA 2I7GA 2CIPA 2Z25A 1GNXA 3DYPA 5FJTA 4M24A 4PFHA 3W7HA 4H2CA 4MMWA 3MUY1 3TMQA 4HGXA 2CLHA 5DF0A 4ICNA 1V3MA 3W24A 1A5LC 4DNMA 3M7WA 3W37A 4HCDA 3RJYA 4GNJA 1LOSA 2DT0A 2JBMA 1UA7A 5DMNA 3WBAA 1HVXA 4TTUA 4YS1A 3PSWA 4NU7A 5BOOA 1SZNA 4K36A 3LERA 4AVNA 3HG2A 3ITVA 1MW2A 2A0NA 1B2YA 4IFKA 1Q6DA 1OX4B 4D6JA 1AW5A 4YHEA 5EMJA 2VEKA 3WLIA 4FNRA 1KW1A 2WKGA 2FPVA 3P0XA 3TVAA 1OBAA 3FLUA 5JMUA 5A3HA 3TAKA 2WKLA 4CQAA 3UNDA 1QI4A 5IDZA 5C9ZA 1OGGA 1ZBKA 2WC7A 2QIIA 1DV7A 3H23A 3IJLA 3GXMA 1VBJA 1TMLA 3W86A 1W1TA 2BDQA 4XV0A 3N2CA 3MSYA 4DAIA 3BW2A 5DQPA 3W1NA 1KRCC 4JN7A 2PWGA 4FOUA 4Z2KA 3M5YA 3N17A 2VFGA 5CAHA 4A35A 3KW3A 4DJFA 2NV9A 3AALA 4TX6A 5MF5A 4R34A 2PRMA 4IX0A 4AXKA 4Y9PA 4O0QA 1W31A 3S2NA 3FJLA 8XIMA 3N6JA 1IF2A 4TV5A 2EQDA 4F0KA 5FL0A 2CERA 4FLRA 1S3HA 2P76A 3DI0A 4LAOA 4AWTA 1FFRA 4C60A 4DZAA 1DORA 3D46A 4XK2A 3W7OA 2DT2A 4NP7A 1Q6CA 1EJ7L 1C29A 3F1QA 4DWSC 5HPCA 3FK4A 5GNXA 5CLTA 4DPPA 1NF0A 1XIBA 4J5NA 1VFLA 4GVHA 1SO3A 4O4VA 4H8UA 1JF6A 3MUZ1 3BSHA 2PDJA 4XIAA 3IK4A 3IGSA 2QUTA 2JALA 4O18A 1XLMA 2DZWA 4W5UA 2FTPA 1WQ5A 4S3AA 4QTGA 1JDDA 3WH9A 3VOIA 3CB3A 1YXYA 3L7RA 3EB4A 4EAMA 2Y4SA 3LBMA 3FYYA 1CBGA 1ODZA 5LNWA 3CHCA 3N3TA 4AXNA 4GE8A 3V4BA 1UJQA 2Q71A 5G2HA 4EWJA 1V93A 4L6HA 2HS6A 3L5AA 3CQHA 3QHMA 1YNQA 4D6DA 3AIBA 2GFTA 3NAVA 3D3AA 3RX3A 4AHPA 3NEVA 2D3LA 3MCMA 5E6ZA 4BA0A 3EAUA 2XWDA 4HU8A 5MKGA 3ARQA 1AJZA 4EE9A 1M3UA 3N2XA 2PDFA 3UBPC 4K3ZA 2OWXA 1KM3A 3LMZA 1U1JA 2ZUWA 1I8JA 4Y8EA 1J6PA 1W3IA 2QS8A 4W89A 4PUJA 4DO4A 4ORIA 1VFHA 4OBRA 3BG9A 2J66A 3P74A 4YVPA 3BXWA 4FALA 3KL5A 3AZTA 4WSKA 1I2QA 4EF8A 3VA8A 4H9UA 1L6WA 2WJDA 1I2RA 1QHPA 1XS2A 2VGFA 3FKKA 1W3JA 3MCNA 2DJXA 3IACA 4ML9A 3URAA 2WCSA 5I3DA 4R7OA 1CXLA 1I1WA 2IS7A 3W7JA 1R2RA 1TFVA 1CLVA 2UY3A 3QFEA 2JKEA 1W9BM 3FS2A 5LGXA 1XRTA 4MNLA 3QYQA 4DXXA 1OSEA 5I02A 1CYGA 1ISZA 4B90A 4ADTA 4HK6A 1ZJBA 4DBUA 4I6VA 4AX7A 3CLWA 2AQWA 3DECA 3C8FA 5EY5A 3RLHA 3ARXA 1JF5A 1ZU8A 2QZRA 2R1KA 3SRKA 3V1HA 1JL8A 5LIYX 1U33A 3KFTA 3DC0A 3AXKA 4UQCA 4DXVA 4UTMA 1MYRA 5T8GA 4L1GA 3KS6A 4DYKA 5A8MA 2XJ7A 4BCEA 4Z2IA 5A6BA 5FF7A 4C1NA 1TREA 4MAVA 4D6EA 2E3ZA 5FAJA 2Q02A 1J11A 1A5UA 1TMHA 3TJ4A 4MJZA 2ZRUA 3DYOA 1ZY9A 3EOLA 4C7DA 5K4ZA 2WVSA 3TFCA 3WMBA 1KGWA 4KETA 4O16A 4PUEA 1TA3B 3VNJA 5CBJA 1UKQA 3G0UA 3U0HA 2PP0A 3W70A 5FJOA 3S1GA 1L2UA 1KWGA 4HA0A 5M5DA 2OLHA 4QLJA 5BRBA 2VCCA 2X1SA 5D30A 2OZ0A 4GIYA 1UD6A 4PUDA 4O11A 1TWIA 1LLZA 5CC5A 1H7PA 3L2IA 1C3FA 2HK1A 3AMKA 1KXQA 1YTKA 3LV6A 2GSEA 1V6VA 1SSDA 1X6LA 3ZJ8A 3NM1A 2VRKA 4LXFA 5LIWX 4IG2A 1RA5A 1XC6A 3MS8A 5HATA 1DJIA 2VURA 3WNPA 2FFCA 3QSRA 3T78A 2GUYA 3WG6A 2P0IA 4JFTA 2E6AA 5DY3A 4HNCA 3C2VA 1FCBA 4TX8A 1L9WA 2DORA 2VOMA 2OB3A 3M6DA 3M47A 5XINA 4DX3A 3NA8A 2C79A 1VEPA 2PF8A 2QCFA 1XINA 5CGTA 1UR3M 3HQOA 3G3MA 3NSXA 3W23A 1EJSC 3W1TA 4FXSA 3TDFA 3GR8A 2X7VA 4TQTA 4OWGA 1V6TA 1UKPA 3E5BA 1ZP4A 4G8TA 3W53A 1WZLA 3VC6A 1DIOA 1LG2A 3GU1A 4ASTA 4W7UA 4BI6A 4H9TA 1JZ2A 2FTYA 3UPMA 2DEPA 2X16A 5I3JA 4MM1A 5E09A 5C9WA 4AB4A 3AYVA 1TV2A 3R58A 5GVJA 1DJWA 3HJZA 1TVNA 1DWHM 1BLIA 4HB7A 4WY0F 5ECVA 3G3DA 2WLYA 4WR3A 1X97A 1UH2A 3LSBA 3VNZA 3DHDA 3OLEA 3WUEA 3QXBA 2GK1A 3BMWA 3W71A 3GE7A 1YXDA 4JTCA 7REQA 2Y2WA 4M6UA 4O0ZA 1NSJA 1UPPA 1PTGA 1HNYA 1KNWA 4AZGA 2F2KA 3QRHA 3ITYA 3W7PA 4O54A 3AUJA 3V3WA 3GNOA 1AVAA 1Q4NX 3R89A 2VZTA 4CD7A 2XGBA 2QMKA 1LORA 4IIDA 2VYOA 2GOKA 3HMCA 2PDXA 5KETA 4PZVA 3G1HA 2J62A 4CN6A 1F4AA 2VFIA 1FXPA 1JCTA 1IEWA 3FVDA 1GKQA 2DDXA 3HZ3A 3WQEA 1IR2A 3OP2A 3IAQA 4E8DA 2R1MA 1W3HA 3LENA 3GDKA 3LTYA 3B0YA 2W27A 1VF8A 3SEPA 2H9AA 1M53A 2Y89A 1VZWA 5FSEC 2V3GA 1X38A 3W1LA 2PLMA 3VI2A 4CQ9A 1R0MA 2QKFA 3E1F1 3M0KA 3ARUA 5E0KA 1KD0A 1XICA 3AMLA 4UTLA 4NY2A 2WHKA 2XU2A 1WAWA 2G4JA 3C0SA 1ZJIA 3CAQA 3KBNA 2X7WA 3TA9A 1PX3A 3WLQA 2HBVA 3V36A 1M65A 5LNVA 2I5QA 1A5OC 2RGLA 3M41A 2YL8A 5EBAA 1NWUA 5EMMA 1HF6A 4ERGA 5KSWA 3TJXA 4XWUA 3CZ8A 4Z1DA 2F84A 4CCDA 4DO6A 4RW5A 1XIFA 1NARA 1V79A 1R5YA 1H60A 1JPDX 3W2LA 2PCEA 4GQQA 2G3NA 4LT9A 3ABSA 3DBPA 3WNNA 1E3XA 4XSLA 3SAZA 2FDSA 4UOQA 1UROA 4IP5A 1PB0A 3TA6A 4MLRA 4RPPA 1UD5A 2REQB 2D1ZA 3DHPA 1V51A 4AD2A 3GXTA 4I7WA 1HVQA 1H41A 3O6CA 4QJ5B 4D71A 5CLWA 4P8WA 3S5YA 1EBGA 5BZAA 4C5YA 1J6OA 4A8IA 2PC4A 1E9IA 4BEUA 2F6KA 4J3XA 3Q67A 3LPPA 4GHRA 1P0DA 3MYPA 2FIQA 3UWVA 1YBQB 3CH0A 3PTKA 1MZRA 1ITXA 3S2JA 1NWRA 4LS2A 5LA1A 3NUKA 1F7BA 1Q13A 4LF1A 4RKAA 4NJKA 3A21A 3C4UA 4UCFA 1OFOA 2QGYA 4Z2JA 1SMDA 1KM0A 3VIKA 1OM0A 1TTQA 5TNVA 3RRAA 1QASA 3QGAC 4DN1A 4ZXLA 3PUDA 1HZYA 3L4UA 3DENA 5A94A 4I7VA 3MI6A 4TVUA 4JTLA 2WM0A 3TSMA 2Z1VA 4HSHA 1K6AA 3AHTA 4A05A 1AZ1A 2EKCA 2A3LA 1WDSA 4QEHA 4L61A 4JCLA 4H6RA 4JCMA 4I5RA 1UOKA 3GR7A 1NJJA 3VK5A 2WVUA 4HU3A 1AW1A 3O7UA 4W7VA 3KCJA 1WNOA 4OOUA 4WDWA 4N9EA 1A4MA 3PJUA 1W5OA 2ZXDA 1OF8A 3W00A 1UR0A 4RNFA 3G22A 3NZGA 3URQA 3T05A 2EBNA 3A3HA 3SM0A 3W28A 1XH2A 4GX9A 1CGWA 4FPSA 5L9FA 3JR2A 1XBYA 2QT3A 5TBOA 3N11A 3T55A 3LCIA 3N12A 2O9OA 4LCQA 4GISA 3GHUA 3VILA 2UWFA 4O4WA 3UFYA 2V2DA 1VBHA 1E15A 4E2BA 3CK5A 4DF1A 2BOEX 2RJGA 1SW3A 3UCDA 4PGLA 1UB3A 3NQ2A 2W79A 2VC5A 3G8EA 3ENLA 2W91A 1FWHC 4O1AA 1J01A 2C1HA 3LXBA 3FDKA 1CXFA 3HBLA 3GNDA 1QW8A 1PZ3A 2ZC1A 2EPHA 3WEZA 3CO8A 3EOSA 1PKNA 2XFYA 3GXPA 1UUQA 3MTWA 1XBZA 4D6HA 3GD6A 4Z42C 3SADA 2ZRWA 7ENLA 2H6RA 4YTQA 3JUGA 2QV5A 3BZGA 3HPZA 3WZ0E 3SIMA 2QUNA 5AY7A 1GVOA 1U5JA 3ERPA 1EOMA 2YDQA 4XAPA 1ZTVA 4GH1A 5D2WA 3LRMA 1H61A 2Q3OA 4HP5A 1TTJA 1RBAA 3BGJA 2YKKA 3K4WA 3LXAA 3NXLA 3AIVA 4K39A 3VZXA 1TCDA 2WCGA 5AYIA 1DOSA 1V6WA 1Z32X 4PCTA 4Y90A 1RCOB 3DKLA 3OIHA 1ZGDA 4IUOA 5LIXX 3VKBA 5BYWA 3SUWA 2D0FA 4XD6A 9XIAA 1EL3A 3BOFA 1XPYA 2WVTA 1Q66A 3HGJA 2PFHA 3IVSA 3WNLA 1TR9A 3RFAA 5ABGA 3NYDA 2QCEA 2XINA 4G7EA 5IFPA 2BSLA 4AF0B 5LNRA 4Q4MA 5U7SA 3GTHA 4X0NA 1R86A 5I6SA 5HWNA 3VC5A 2EGZA 4N9CA 3QHOA 1JEZA 1LDCA 3PZTA 1FWGC 3SQMA 3VIPA 5EGRA 3VD7A 1WUFA 3FHAA 4K68A 4MFDA 2XVKA 3VTRA 2GGJA 2BG5A 3W7DA 3RPTA 5KTLA 2QCNA 1J2BA 4GZEA 3U2EA 3HA1A 3BQ6A 2X1RA 4CN1A 3EWXA 1EB3A 4QJ4B 4RLIA 3BSMA 2VT0A 3PFRA 2AGTA 1M7JA 1JYXA 3GVQA 1VFSA 4I5XA 1E40A 2AQVA 5AC4A 1BSLA 2Z2UA 3G77A 1XCFA 4CCCA 3ZR6A 3BAJA 4MWAB 3AIRA 4I7UA 2OZ8A 3CU2A 1SZRA 3GY1A 3TTYA 2PMQA 3HGSA 2CZEA 5T9CE 4MWAE 1QWGA 3AO0A 2EKGA 3FAWA 4YHGA 4WSJA 1AL7A 4QLKA 1PIFA 4PUKA 1UR2A 3ZYZA 2PSNA 5IM51 1H2JA 5JU6A 2A3BA 1LRQA 2ZVRA 4LYRA 4FOJA 4OV4A 2DZBA 4RUBA 3ID7A 4BI7A 4P7QA 1QOPA 4L9ZA 4KT2A 4GI8A 3FOKA 4CUCA 1RBOB 2IKGA 4N4PA 4PUWA 1XRVA 5IXEA 5B80A 2CETA 4YWSA 2BASA 1YDNA 3AHVA 3GXIA 3QGVA 1M03A 4K8EA 1C8YA 3OHIA 4JDBA 3GR4A 3IARA 1X98A 3BAWA 1SJDA 1C90A 1DIDA 1V08A 3O3RA 8CGTA 4BFAA 1XXXA 1JGMA 1E6ZA 4CNOA 1TE1A 4Q8TA 1K1DA 1NAL1 2QCGA 1UP2A 3M07A 4WVXA 1QPQA 2VGBA 1KBIA 3TUUA 1WA3A 2WHMA 1QK0A 4FX6M 4WF7A 5A8GA 4ERAA 3B0PA 4GOAA 3BAXA 1TJRA 1Q2SA 1H62A 2YFOA 3CL7A 4KRUA 3ZVHB 2QPXA 2XM2A 4JX5A 4GZ7A 4AYSA 5CSUA 5E9XA 3WUGA 3WK0A 1OC6A 4AX6A 2PTDA 4PMDA 4IPPA 1K7EA 3LXCA 1FRBA 5EBUA 1P0BA 2E09A 4RPQA 1US2A 5J04A 1UWQA 3GQYA 3M4HA 4O17A 3WQ8A 1HKIA 2NUXA 3CUHA 1LOQA 4N4QA 1W2PA 4GUJA 3BCFA 1IYXA 1VIWA 2BTMA 4QIUA 4Q8PA 2CKSA 4C65A 4NI3A 3U8GA 1KB3A 1VB9A 2OYMA 1W5PA 4INFA 2PDNA 3CTTA 1V5XA 4REQB 5XIMA 2PWEA 2WJZA 4H1ZA 4Q32A 2EPLX 4HK5A 3SSZA 1F3EA 3GX9A 4O1DA 2FLIA 1PL9A 4E38A 3N6HA 4W85A 1XP3A 1WOBA 4CN4A 1QDSA 3G6LA 4YVVA 5EMLA 4GNVA 2OVLA 5F7UA 4H9VA 3NGFA 1QOQA 4XZBA 3NL5A 1LRTA 3M5ZA 2VM8A 4IIHA 3PTQA 3WQOA 4A3QA 1QRQA 3HFTA 4U31A 2FGZA 3LLDA 3G1DA 3M16A 2UZ9A 2PAJA 2WK2A 2ATMA 4LNYA 4UMAA 3KHDA 1K77A 1MQPA 4F0SA 3IJDA 5KZMA 3F5LA 5D32A 1R9YA 1WPCA 4WJ8A 5FJUA 3W25A 3CUZA 3KVJA 2DZUA 1BXCA 1AW2A 1MSSA 2BHZA 3G0SA 3G2GA 3U3HA 4LCRA 4ZFCA 1V0MA 4MFEA 3LSCA 2HISA 4KKXA 2XWEA 1VGAA 4HBKA 4C7FA 2QCLA 3DFSA 3DIPA 1LL6A 4C6JA 3VKKA 3UJ2A 1DXEA 4LEQA 1A0CA 4DELA 3UWWA 3UU0A 4H9MA 1FUYA 4JEQA 1RA0A 2ZDSA 1GOQA 1XIJA 1ME9A 3G24A 1Q6RA 3WENA 1XIEA 3NL6A 1XQLA 4IFKB 3N04A 5F2IA 5CBIA 6CGTA 3P6LA 2G41A 3KWSA 3ELFA 2QUUA 3LHYA 3NTYA 3SUSA 1HO1A 3OOQA 3V16A 5CC6A 4WXZA 2POTA 1KM2A 3WY1A 3ZSSA 3M0VA 2OYLA 1V8EA 2CCRA 4RNHA 3GIQA 2C91A 4OTKA 3WJSA 1U83A 4BJHA 4UQBA 1XV8A 4U5KA 1OZQA 4Z0SA 1R3SA 1VC4A 4O10A 3IGHX 1SFSA 4Q4QA 3W7MA 2VZVA 4QSFA 3GH5A 3HO8A 3M5VA 4M7SA 2HROA 3EX1A 1YKWA 4F9DA 2C71A 2Z2AA 4MDPA 2Z1BA 5CBBA 2FZBA 3RPMA 4LALA 1U5HA 1VD6A 2V0TA 1GONA 1K70A 4HNNA 3LY0A 4IIFA 1VFUA 4LX4A 3BLEA 2YZRA 2PWFA 4LY4A 3KEHA 4W5ZA 2V63A 3BG5A 2QLYA 1E71M 4UFMA 4UFKA 4F2BA 5I78A 1B3WA 2YX0A 4JXCA 3BCDA 5AKQA 5FJIA 2XDFA 2NX9A 3TMLA 1PPIA 1UR1A 4Q6JA 3HPSA 4GZIA 4C1KA 2I9UA 2ZUMA 3FV9A 3KTSA 4AUBA 3ALFA 3L65A 1UG6A 3VGFA 3F4VA 4FA3A 3UJEA 2JIWA 2OTDA 4K6AA 2CLIA 4NJIA 1FWEC 2GSJA 2NVCA 1RJRA 2D2JA 3CT7A 1V0NA 3A12A 1DWIM 1YTDA 1OC5A 2ZX7A 3RU6A 4PODA 4C6NA 3L9CA 1N8WA 3GHSA 4XD4A 4FXJA 2ACSA 1S2CA 4JIHA 3QC0A 3L21A 1E6PA 4H6QA 1UQZA 3ZJKA 2FYMA 3BO9A 3STGA 2CLKA 4JFWA 1L6GA 2A6LA 5H91A 4GI4A 2J24A 3WSUA 3UXAA 3LRKA 1S3TC 1X7IA 1YDYA 4Z1BA 1AH3A 1XH0A 1ZUAX 2CHNA 1W9PA 4GZJA 2ZUNA 1XX1A 1XCWA 3F2DA 3KRBA 1GOWA 1VRXA 4UOZA 2UY4A 1RAKA 1EUAA 3QMRA 1UD2A 3KBJA 2Z00A 1Z3NA 4Z2GA 3NL3A 2ZKMX 1TB3A 1UQYA 4ZQCA 2WHLA 3NO5A 3C3NA 3I4EA 4IMCA 5MKGB 2IXVA 1GVRA 2UY2A 3N6QA 1BKSA 1HJXA 3SCQA 3NVDA 1E72M 1RUSA 4CD5A 1VPXA 4W9TA 5CXPA 1JPMA 2NT1A 3STEA 1SO5A 4KFOA 2ZOXA 5GQBA 4ZB5A 5BU9A 3BQ5A 2QHAA 1XBXA 4YYFA 1JUKA 2OOGA 1LBMA 5U4NA 4GFSA 1P0NA 3R25A 1MNZA 4KGLA 1PCWA 3QTGA 4LYKA 3MU7A 4DEFA 5AOUA 4GVGA 4AG0A 4MB3A 2GDVA 3S83A 2PDCA 4QLLA 4M1RA 4XG1A 4NVTA 3UVAA 3GYCA 1AQFA 2V8ZA 2ISVA 5CAKA 2PD9A 3ZWSA 1D8CA 4FMVA 4J7RA 1CXHA 3BAYA 1A0DA 2AQOA 3O9NA 2Z6JA 5BWFA 3UZWA 2R1PA 4YN5A 4PBGA 1R38A 2VWTA 1JAKA 4JICA 3I3DA 4NG3A 4EIVA 3K46A 2HSAA 2HDJA 2OJPA 4GKTA 2BY2A 2AOSA 3WF4A 3C61A 2OEMA 4GJJA 5EFDA 3IV3A 6TAAA 4NRRA 3W07A 3LHWA 3LM3A 2YGYA 1FWRA 1KBBA 3P82A 2E6FA 1HKVA 2XUCA 3MDWA 1DJYA 2XVLA 3R8GA 4HJFA 1ZL1A 2B7QA 3NFUA 3WQDA 2QAPA 1XSJA 1KTNA 5A8PA 8A3HA 4BWLC 1W8GA 1P6CA 2GLKA 4GX8A 3GAYA 3CUXA 3W27A 4H19A 1G94A 1ADDA 4M0XA 2TAAA 3BLIA 3LOTA 1SR9A 3H53A 5F4WA 3RRXA 5KZ6A 4X3ZA 5LHEA 5CG7A 1W37A 5HNRA 4GIEA 3GH4A 1WKYA 1E1FA 1JPKA 4HHHA 4KEMA 3WELA 1OINA 1AFSA 3TIMA 2J4GA 4MYAA 3N9SA 2BBFA 2H3DA 2F6XA 4ATLA 3FDGA 5HQEA 4CD6A 1K3UA 3E38A 1F4HA 2IW0A 5HJLA 4C6CA 3L12A 3ATYA 3HQNA 3ITLA 4UNKA 1JFXA 1XM3A 4YL2A 3U6WA 3EKGA 3G1YA 5AYYA 4JX4A 1GTHA 4PUMA 3QY8A 2Y7GA 2VTFA 4ZB0A 1U30A 3PZNA 1ADOA 3EWYA 5I3GA 1EIXA 3N15A 2OO0A 3NQFA 3LB0A 1QT1A 3N2TA 4K1WA 3ZR4A 3WO8A 1NU5A 5LA2A 1Z44A 1BWKA 4ZBCA 4G7FA 4M56A 4D6CA 5LKYA 3LPGA 2R1LA 3T2OA 1IXOA 2Y63A 1UASA 3SZ8A 2QULA 1JPIA 3QF0A 2E5BA 4FF7A 4YYCA 1S2UA 4TR9A 4H7VA 1Y5XA 4JTQA 2FJKA 5DRCA 1J79A 4V1XA 1KCZA 1OT2A 3PF3A 1PE1A 3PWAA 1D9EA 1SFLA 1FDJA 1M41A 3HQPA 4LCSA 3IUIA 3UYIA 5C2CA 3UXIA 4Z0JA 3SY1A 5I3HA 4OQVA 3S3GA 3THCA 2NQHA 3H4XA 4FZIA 2ZRXA 2QW5A 4HNLA 2X09A 3BGGA 1S38A 1MDRA 4IP7A 1F2JA 2HEJA 4JYFA 1FHDA 3NDYA 4GYFA 2GK1B 4DBEA 3OLDA 1EC7A 4ORMA 3EDJA 3FIGA 7REQB 4TIMA 3SN0A 3H2OA 4EVZA 3DC8A 1XC4A 1MXDA 1TV3A 4QDPA 2XVGA 1KV5A 3G18A 5A1AA 2ZDRA 1YADA 3W1MA 3GG8A 5I24A 2CBJA 3QV8A 5DXXA 2J6XA 4B2DD 2CEQA 3MHFA 1E0TA 3TW7A 4AZHA 2V38A 4W93A 4QCFA 3VIIA 4UWMA 4ROQA 1R7OA 3TOPA 2GWNA 1XR2A 3L2LA 3MHUA 3S2MA 3QZEA 1F74A 4U28A 4XO7A 2AMXA 4DIAA 1EWDA 3VD4A 1E73M 1XLEA 5FKYA 2H9AB 5H6HA 1TVPA 3NQAA 1JZ3A 2EJAA 2BGNE 1V4YA 1XGDA 3VDHA 4DB7A 3OLGA 4XISA 3E5PA 3U57A 1GORA 1K03A 4Z1AA 4OGZA 2RJHA 4JFSA 2BS9A 3AXXA 4R5EA 3B8WA 3RILA 3T40A 3MZ2A 4IMDA 4JFVA 3A24A 4CVUA 3EXRA 2PRHA 3B0XA 2GQ3A 1K8XA 1PZ2A 4XAGA 3AC0A 1XDJA 4KCWA 1QBBA 2WZEA 3OW1A 2WBKA 2XFFA 3DCPA 3M0YA 4YNGA 2Y62A 1RBLA 1MUCA 2GVGA 3EXSA 5A8NA 3NZQA 4GXWA 2DIEA 4IGSA 4ACYA 3K13A 2Z2BA 3CZKA 1TWWA 1XIMA 4FNTA 5DCBA 4DUVA 4AD1A 3OG2A 1A53A 3B05A 2DY3A 2VEGA 3N3MA 3XIMA 2QJJA 5LXEA 1WXYA 1RR2A 4I8YA 3WX7A 4MKVA 3DAQA 1TPH1 1FWTA 4NJHA 2Y8UA 5M3WA 1AL8A 5LHFA 3LQLA 3PNZA 4GO9A 1PWMA 5H2ZA 4JKKA 4YXGA 4WDTA 2EPOA 1RK6A 3BVJA 3WBYA 2GGIA 1RLDA 3TLQA 1P7TB 4NNCA 3MW7A 1TPUA 1PZ1A 1GEHA 3R0UA 3BV4A 1XI3A 1Z48A 3BTNA 1AJ2A 5HQMA 4HHPA 3CYJA 3ABRA 3WQVA 1LBFA 4HMEA 4F0HA 4WD0A 3WQ6A 4QP0A 3C0LA 2X40A 3O06A 4AWUA 2QAFA 1ZAJA 3S6OA 5G4HC 2QPUA 1TJPA 4BKNA 3LMYA 3PUGA 1D7FA 4E3VA 1FH8A 1BWLA 3NQEA 1DWGM 2FHFA 4GKLA 4AZ6A 3PPCA 3R1ZA 1KFBA 2OLAA 1CIUA 1ELSA 3E0WA 3FJNA 4IGHA 3AHYA 2O7QA 3W38A 1IGSA 4N02A 1DL3A 4TTGA 3LPFA 2TSYA 3AZRA 1F3WA 4LB3A 2PDYA 3ZLGA 4FS9A 1QTWA 2YBVA 1XIIA 3GVRA 3TN5A 3O6DA 1JZ8A 3NM3A 2NT0A 3K2GA 5G1YA 4DYJA 3EYPA 1XL9A 4PCPA 2DH2A 3P84A 4DYEA 3ARPA 4DO5A 3PWGA 4WZHA 2D22A 4TV6A 1ECQA 4AYGA 3SSJA 4AIUA 4C6QA 3GTIA 4W88A 1FWSA 4MTVA 4E4FA 2XTKA 3WLNA 1XGEA 4DJED 1KLYA 2GPTA 4B4HA 3ITXA 4NIRA 3PJWA 1QUMA 4PRRA 5I00A 1EZWA 3MMDA 1XQKA 4POCA 4PRWA 3PUEA 4MZYA 1Q5MA 4W4QA 4LEFA 2DQXA 4AISA 4B15A 5PTDA 5IRPA 1FH9A 1TTIA 2GZXA 4UNLA 1L6FA 3MMUA 1XFBA 2J8TA 4NT0A 3B06A 1QR7A 1NWSA 2G0WA 1CGVA 2FB3A 3VVGA 2XH4A 4NZ1A 5ABEA 2PLJA 1WV2A 3PULA 4L4OA 3GNNA 3KL3A 4JIIX 3CPRA 3TOYA 1B90A 3ARWA 2Z1XA 2YJQA 2X8RA 3KE0A 4R33A 1O66A 2F8QA 1HJQA 2RKXA 4ZQOA 2MNRA 3WH6A 4BQ3A 2IPFA 3T08A 7TAAA 1JUEA 3U7BA 3ARTA 3MUCA 1O5KA 3GWQA 3HQ1A 2QGHA 1MUMA 1XF0A 2ZZ2A 2Z29A 3W7KA 3P8IA 3SECA 2D2OA 2CPUA 4PRTA 1J12A 3REQA 3TK7A 4QG8A 4ZCWA 2VCBA 1ITUA 1ICSA 4XUGA 2F7FA 2ICSA 4EWND 4EPDC 2NQ5A 3MWAA 4A29A 4S2CA 5H8PA 1LWIA 1IWAA 1JUBA 3WNKA 1QPKA 2W66A 4WXYA 2GYIA 4IHCA 1EGZA 1GJWA 1RD6A 2V5LA 1EDGA 4GYPC 1EBHA 5HUOA 3ICJA 4GH3A 2NXHA 3MWCA 2WHJA 1PX8A 1HL9A 1EOKA 1BEUA 4MB1A 5CJMA 4DVOA 3W75A 1OHLA 4EPBC 3RCNA 2HRWA 2WKJA 2XH0A 2X1IA 4KIRA 1OG6A 4LRSA 1IZJA 3ZLFA 1RHCA 4MKNA 4NAEA 5AYBA 4NASA 2TRSA 3CAKA 5DMMA 1J0KA 1Z41A 4A2SA 4AIBA 5BXTA 4LVBA 2BP1A 3PVFA 4G7EB 3RLUA 4XZWA 3SUVA 6REQA 5BXPA 4EXQA 5ENLA 2WZHA 1N8IA 1TR1A 3L2MA 2HZGA 2C13A 1W32A 3FHQA 1Q8AA 1YBQA 2DZAA 4H7ZA 4CNUA 1PYFA 3SDOA 2WXDM 2BXVA 4Q33A 1FP8A 1KWKA 1V7AA 1JXKA 3LEPA 5D9NA 4GBUA 1JZ4A 1LL4A 1VCFA 2CESA 2J25A 2J9YA 3AIUA 1BGAA 3WF2A 1EF3A 1D3HA 1PEZA 5K9XA 4IT1A 1S1RA 5FEWA 1I75A 3SCPA 5J5RA 4PB3A 3WLJA 3A13A 3WQ5A 3V0TA 1TV8A 4ZENA 4CQBA 1GZJA 1QI0A 1OZMA 4O14A 4B2DA 3O8AA 3BOXA 3NVTA 3CO4A 3T8LA 4LJ3A 4DO7A 4Z08A 5BRPA 1KO0A