3MHUA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-nitroorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
307
Chain Sequence
b'GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 107
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mhuA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mhuA01
3TDFA 4HPXA 4HNVA 1A53A 1TCDA 4JX6A 3PSVA 1LDCA 3RFAA 4GRSA 3B04A 2YYUA 1OFQA 1VH7A 5G1TA 1HO4A 4E0CA 1KTCA 3HIJA 3S5NA 2ZTJA 3DHDA 1VHNA 5TQLA 8TIMA 4RLIA 2V2HA 4FX7A 3E12A 1JCJA 4FNRA 4C1LA 3FEMA 4BWLC 1K8ZA 4JGDA 3ATYA 4GUIA 5K9XA 1SO3A 4D2JA 1WYIA 4RCXA 2QKFA 3M9YA 3R5EA 3PB0A 4IQLA 1O94A 1PS9A 2ZRXA 4O1CA 5EY5A 2VEIA 1TQXA 4XKYB 1G7VA 1FCUA 1UBSA 3W1TA 3BLFA 3NPXA 1HFBA 1QOPA 3NPUA 4GBUA 2EKCA 5E0KA 4YXGA 2E09A 4E2DA 2J9XA 4ADTA 5FF4A 1I2RA 5HJLA 3I68A 2OJPA 5DXXA 2B7NA 3W1PA 2TRSA 3CIWA 3W1AA 1AL7A 3LHYA 1OG0A 3S1WA 3LCFA 2A2IA 3B0PA 3Q94A 5DBTA 3HG4A 4O1BA 3PBYA 3DH7A 1H7OA 2WKJA 1HL2A 3W1QA 3PVFA 2V82A 3IIPA 1I2PA 4FX6M 4O12A 2ZZ1A 3OA3A 1VR6A 1XBXA 2VFGA 3LRLA 4NJHA 2TPSA 1KFEA 4MVAA 5D03A 3A5VA 4KWVA 4K6AA 5FEPA 1XCFA 1EPXA 3T40A 5HR6A 4UFLA 3WJWA 1SZFA 1RQHA 3AJXA 4FNTA 2ZZ6A 4UIOA 4FIRA 2WQPA 1DQWA 1EX5A 3TAOA 1ZALA 4FXRA 3NQ8A 3UXDA 2H3DA 3CT7A 2DORA 2XN0A 1OYBA 4TMBA 3W7DA 4GE8A 2HMCA 5G2WA 3WJXA 3W3OA 3TQKA 2E6YA 4MUZA 1DL3A 5D05A 4K8HA 3Q2DA 4UFMA 5G2IA 3N3MA 2CU0A 2ZCGA 5DELA 4GUFA 3A22A 3TC6A 2UV8G 4RR4A 1E51A 4IJBA 3A21A 1OX4B 4JY8A 1VPXA 3N2XA 3P5YA 4DPPA 4RK8A 4IOTA 4BF9A 2PURA 4DO4A 4UUIA 4Q4KA 2F84A 2R14A 3WJYA 1QPQA 4JN6A 2BXVA 1FY6A 1YTDA 1HUVA 1YTEA 4UXDA 3EX1A 4Y8FA 1F5ZA 5A8GA 1PVNA 5FEWA 3TK7A 1F7BA 3OVRA 2PE4A 5GVJA 4FO4A 2Q8LA 2V2CA 1KM3A 4OBTA 1W5QA 4O15A 2QCHA 4O4VA 4NJJA 3LLFA 1RV8A 1YDOA 3HBLA 3GKAA 3TKFA 5F4SA 1DORA 1TB3A 3MBFA 4MZ1A 4CQ8A 4WUIA 1WOAA 3CHVA 2DZXA 3EWYA 3PUOA 4LVBA 1L6WA 4EF8A 3RLUA 5K4XA 3TW7A 1R2TA 4ZQCA 2B7QA 4EVZA 3PG9A 5D02A 3GXTA 3E02A 3MP5A 1QFEA 5AYYA 4O19A 3WFAA 1OFRA 4LUIA 4AF0A 3BG5A 5L6UA 1A5BA 1MO0A 2JKPA 3W9ZA 3FFSA 5K3VA 2NUYA 1SZGA 1X7FA 5FESA 2JK2A 1XUZA 1W54A 3LCIA 3CLMA 1RD5A 3MHUA 3UNDA 4A2SA 2PCQA 3B05A 1TPUA 4A22A 5C5YA 2EPHA 1THFD 1QPNA 3UZ5A 1PCWA 2RFGA 3V75A 5AYXA 5AOUA 1G4EA 3UPBA 4PL2A 1WA3A 2ZFAA 3R13A 1SFJA 4WY0B 4XBKA 1FUYA 3NQGA 4GUGA 2NZLA 4MLJA 2I1OA 1QPRA 1LBLA 3QSTA 3KVLA 1VJIA 1YPFA 1C29A 4O50A 4N6FA 1JULA 2IQTA 2D73A 4YWIA 4FHAA 3SGZA 2B7OA 1TV5A 1O60A 5G4EA 4AWUA 2B7PA 5CPOA 1LTDA 2Y6ZA 2C16A 1DHPA 5AC8A 2VFFA 4MFDA 1G4TA 4TX9A 3DI0A 1N55A 2BSLA 1H63A 5FF0A 5DCBA 5EPDA 1OYAA 3THQA 1VLIA 1VS1A 5CZSA 4ADUA 3EWZA 4OT7A 3OVPA 2W79A 2YZRA 4MZ8A 3NQFA 3GLCA 4NJKA 1D3HA 3TV8A 2HSAA 3O63A 2XN2A 3M5ZA 4Y9AA 4CLMA 3M47A 3KRUA 3P74A 4O53A 1I8JA 3EB2A 3FS2A 4O4WA 4TR9A 2PRMA 3LCXA 3O16A 3EEGA 1VYSX 1SFLA 2B0MA 4TO8A 2H8ZA 1TSIA 3M5YA 4RJEA 4DO6A 2A85A 3NQ6A 5CSSA 1EP1A 3P62A 1KFKA 4JX5A 2FFCA 1S5WA 3KVMA 2KZHA 1Y0EA 1SQ7A 2YYTA 3QSRA 5KMYA 4B5NA 1W3IA 4BFAA 3W1MA 3TROA 5EKYA 1BEUA 1H7RA 1OK4A 1Q6RA 4OV9A 3GNNA 2ABBA 4QSHA 4HSOA 4HSNA 5CZ0A 1ADOA 3B06A 3CIXA 1VQTA 3Q37A 4UFHA 4LC6A 3BLIA 3UWYA 4JTKA 1OFOA 5DBUA 5D37A 1W5MA 3O6CA 3T7VA 1Z41A 3W70A 1I4NA 3KAOA 1F05A 3QC3A 4AWSA 3SECA 5U7SA 3O6DA 1IF2A 1FQ0A 2Q8ZA 4YMZA 1KLYA 3GK0A 1SR9A 4I7VA 3C2VA 1DJQA 1QCWA 3GIYA 3D0CA 4IX0A 1SZNA 3NO5A 1S3HA 3GXPA 1KTBA 3A23A 4Y6GA 3NPVA 1VRDA 3W22A 1OFBA 2OX1A 3W1RA 4WOQA 1KV5A 3DZ1A 2GQAA 3C52A 3G3MA 3W7PA 3C6CA 3L67A 4YL2A 3BLEA 1W37A 2DJXA 2Z0IA 2NWSA 1XL9A 1EUAA 3ZWTA 4MJMA 1QWGA 1ZFJA 3NZRA 3QW4B 5C6MA 3W7MA 5EMUA 4LOCA 1GT8A 2GJLA 4HNTA 3DFTA 1WOBA 3FA5A 3L5MA 1FBAA 3A9IA 4LRTA 1BWLA 2PRLA 2XN1A 1EA0A 2NLIA 3QMSA 2QCNA 3PY2A 1XBZA 4HKPA 1FXPA 1T96A 1SW0A 1NSJA 1ONRA 2HTMA 3P60A 2JBMA 3BK0A 3BG9A 3E0IA 4Q33A 4MYXA 1GZGA 3MI6A 1H50A 3NM3A 5KTLA 3UY7A 4XQ6A 2QDHA 1TREA 1K8YA 1UUMA 4NU7A 1F73A 4K8EA 4AVFA 4CCDA 3GNDA 1G4PA 4N6EA 5DY3A 4FNUA 2Y62A 3DXIA 1HG3A 2C1HA 3TNOA 4L4LA 2CWNA 3W75A 1W8SA 2CLHA 5LNRA 2QF7A 4I9AA 3GKFA 1HO1A 3M5VA 3M0ZA 1F6PA 4YLWA 2FLIA 5HWNA 3TU9A 3W7RA 1U5JA 3NNTA 4LW7A 2EF9A 2E1DA 3P84A 1OFAA 3UWVA 3G0UA 3O6YX 3OHIA 5HUOA 4DBEA 5HNRA 4HNNA 3LHTA 4NNBA 4WD0A 3C56A 3TAKA 4UNKA 4K7VA 2GOUA 2G95A 1VYRA 3S1VA 2ABAA 1AL8A 2C15A 3KVJA 1A5CA 3BARA 3HPZA 2CFFA 1IXOA 5BMXA 2VFIA 2GUUA 5DY2A 4CNOA 2Q3RA 3LXAA 5KITA 3SSJA 3RNDA 5CSRA 2C0AA 3LHVA 1R30A 5EL1A 2JGQA 3KHJA 2CZEA 3QPZA 4E38A 4RKAA 4N02A 2CZFA 1OFPA 4Y96A 1VLWA 3TW6A 2YW4A 3CWNA 3AO0A 2AGKA 2ZRVA 5LGZA 1S5TA 3BG3A 4ZQMA 1ME7A 1G4SA 3CC1A 3HPXA 1AW1A 1VC4A 3GDKA 1JCMP 5MHBA 4IXXA 3PBVA 4OV4A 2VFEA 2GQ9A 3NL3A 2QCDB 1TTQA 1G67A 4ZZ9A 4JTEA 3C2OA 2HS8A 3WK1A 1AW5A 3B0VC 3TCEA 4UR7A 2Z6IA 2J24A 1FCBA 3DKLA 2CLIA 3HG5A 4X2RA 3W7HA 3JRKA 4IX2A 4LS2A 3QJAA 2A6LA 2QUTA 1OFEA 2H90A 4PCFA 4LVFA 4MY1A 4A29A 2X16A 2I14A 3QM3A 4HPJA 5G2HA 3MP4A 3SR7A 3O06A 3UYCA 1PE1A 1L6SA 3LB0A 3G1FA 4QAIA 2QAFA 3NQ7A 1I2QA 3C3NA 1GYLA 4LS0A 1Z48A 1VYPX 3SJ3A 3W7NA 2QUUA 4BI7A 5I3GA 4XKYA 4M7SA 1N7KA 3NR0A 2X1SA 4AH7A 3L0NA 4OQVA 3W7JA 1TJPA 4X9SA 1OHLA 5CZTA 3L0KA 5HUPA 1TRDA 5F2IA 3TQVA 4K39A 4ZQOA 1GVQA 1PL9A 4JICA 1ICPA 2QCLA 3GDMA 3P7YA 1WBHA 3M44A 1JRCA 2QR6A 5CGQA 4DF2A 3CM4A 4LTSA 3W2UA 4NT0A 3IVTA 3FYOA 4OHQA 1TJRA 1WAUA 2I9EA 4MJZA 2QDGA 1LBFA 4JX4A 3W1NA 3W7GA 6ALDA 1XC4A 5CKSA 3MBDA 2Y89A 3STGA 4IUOA 3L65A 5I3IA 3LHZA 3ZS4A 4L4MA 3BPWA 2Y70A 1QO5A 4UMBA 2ZZ3A 2CLOA 4N9EA 3NVTA 4UNLA 4O14A 4E2BA 3A5FA 2A1YA 3LBCA 1SW7A 3P81A 1XKYA 2DZVA 3UWWA 1A50A 5D33A 2Z6JA 4Z0SA 1AK5A 1PHQA 1YXDA 3TSDA 3DFSA 4UMCA 3KX6A 1KM4A 4UR8A 4J9JA 2DZWA 4NZJA 1GJPA 1MEHA 1TQJA 5D2XA 1FCQA 3OIXA 5DCEA 3S6DA 5H2ZA 4O17A 3TIMA 3I6RA 3GXNA 1OX4A 4NX5A 3SGUA 4NNAA 3WJSA 1X8FA 3HGJA 3NQVA 4M6VA 2ISVA 3G3DA 2EHHA 1GVFA 5AYZA 3DI1A 3TE9A 5EBUA 1KM6A 2Z1BA 1Q45A 3E96A 4JDYA 3UZJA 2P10A 2FPYA 3W7IA 4EWND 4NNCA 3O1NA 3K30A 4BK9A 3G0SA 3TFCA 2ZZ2A 3PR2A 3S8HA 2BZNA 3STFA 3TA6A 3L0GA 2E5CA 3CWOX 1DKWA 4GXMA 5K4ZA 3LCGA 3UY8A 3OBKA 2VC6A 1XM3A 4N9BA 3NAVA 4EF9A 1TV7A 2J9ZA 1PIIA 2LLEA 3H55A 3BVJA 1BWKA 2O7QA 1VHCA 1R2RA 2VEPA 2ZZ7A 3ABSA 3NQEA 3NPWA 1KTNA 1X1OA 4JNMA 1WQ5A 1M6JA 2A4AA 5AHNA 4A2RA 4IWWA 4O28A 1NFBA 1SU5A 4UMAA 2NV1A 3R2GA 3C2RA 1R2SA 5LZLA 1VGAA 4IPIA 1M5WA 1OVDA 3MWAA 1YADA 3C4UA 3LTSA 3ABQA 1QOQA 4GJ1A 3N34A 3BW4A 4GFSA 3HMJG 3W7KA 2QCCA 2VELA 4LUJA 4MY9A 5DLCA 1TPH1 1H7WA 3S1XA 3FKKA 4NJIA 3FJLA 1KV8A 4ML9A 3BV4A 3NL6A 4WY0A 1SPQA 1YDNA 3C61A 2GPTA 1BKSA 2DP3A 4POCA 3HJZA 5KZEA 1GVRA 3DKJA 1QNVA 3B8DA 3W07A 3NG3A 1D9EA 5D2VA 1PCKA 5AHLA 5D30A 1ZCOA 1VCVA 4M7TA 1W5OA 3LXCA 3MUXA 4JYDA 2E6AA 4O0ZA 3HF3A 5LNUA 2R91A 4MFEA 5D32A 3FJ6A 1XFBA 2J27A 2Y7EA 3MP3A 4XTIA 1RR2A 3BGGA 5AC7A 4AMAA 1LCOA 2Z2UA 4LNYA 1ICQA 3QPYA 1JQVA 2AQWA 2A5HA 4AHQA 2ATMA 1P0KA 4NVTA 2A7RA 3P80A 1GTHA 1WX0A 4CQAA 1GYNA 2FB3A 4NUWA 2CLKA 1DV7A 2ZQ0A 1KLZA 3SY5A 4GC4A 3I7RA 4IMDA 2NUWA 3W2JA 1VZWA 3MI3A 3FOKA 3GR7A 2V5BA 4H6KA 1P0NA 4Z1CA 3FLUA 3STCA 3W76A 2H6RA 4RZ5A 2TMDA 3WK2A 3MO7A 3W6YA 4RZ4A 4DEFA 3NL2A 2JKEA 1PHWA 1ME8A 2VFHA 2WPBA 1RQEA 3G1SA 4PC8A 4N4PA 4O8RA 1ZAJA 1GWJA 3N14A 4KFOA 3NXFA 5AB3A 2ZRUA 3TR2A 2YXGA 2BWGA 4FEZA 4MIMA 3W84A 2RDUA 2W0UA 4KFPA 3PUDA 1B4EA 1K7EA 5HWJA 5KINA 3W2MA 1UUOA 2DZUA 2CLLA 4PL1A 1K7FA 5AHIA 1RPXA 2ZZ4A 2W6RA 2X2GA 2VKZG 1KFLA 3MJYA 3W88A 4UTWA 3WK3A 4QJ1A 1NVMA 4ONVA 1YXCA 5H91A 5IM51 4OGZA 2ISSA 1EP3A 1IXPA 1SO5A 4PFMA 2A7PA 4UTTC 3N19B 3O07A 3TMQA 3MHGA 2X1UA 2ISWA 1TTPA 2OZ0A 4NZFA 1DJNA 1O5XA 4MOZA 3B0UX 1TV8A 1N8FA 2J6XA 5F4XA 2Y7GA 1GG1A 1H7PA 3VFLA 4JR5A 1K8XA 5HULA 2R8WA 3S5OA 4ICNA 1YLVA 3M41A 5TBOA 3CU2A 3N9SA 2QJGA 3QZEA 1GOXA 4PODA 1MSSA 4UFIA 3ABOA 1C9DA 1W1ZA 4DF0A 1OF6A 3IVUA 3TH6A 5LNVA 3LTPA 1DVJA 3CPRA 3G0XA 4IPJA 4C1KA 3T55A 1TPDA 1TYGA 2ATSA 4JTFA 3G1VA 2Y85A 3TQ0A 3GAYA 1G7UA 3QF0A 2CZDA 4GNJA 1F2JA 4RV8A 3LV5A 5I3HA 5J5DA 5BW6A 2EAWA 4NQ1A 1F6KA 1LRNA 1ZAHA 1QR7A 3GAKA 4A21A 1JQXA 4QNWA 3W86A 4KFNA 2GVJA 1SZEA 2QUVA 1JR1A 4Z1AA 4UC5A 2YDAA 1QO2A 3EXTA 4JY9A 2YW3A 1X1ZA 5LNWA 2HS6A 1B4KA 4GUHA 2WV8A 5BMWA 4N9DA 3EX6A 3TFXA 3QMTA 2J88A 4AHPA 3SIZA 4CNPA 3DFOA 3DBPA 1RQBA 3HG3A 3IV3A 3YPIA 2V2DA 1W3NA 2YGYA 3OEXA 5EYWA 4IMCA 3W1XA 3JS3A 4WX2A 1H62A 5HWMA 5HR7A 3W85A 1AG1O 3ZWSA 3DHFA 5DCDA 1Q6LA 3TXZA 4N4QA 3G1HA 5AHMA 1TPC1 3LLDA 1KFCA 2OT1A 3VE7A 2BTMA 1LRTA 2J9YA 3IGSA 4JTJA 4RZ6A 2WSRA 4O1AA 5CPNA 3LERA 5KZMA 1Z44A 2TSYA 3CEPA 3NEVA 5FI8A 2YR1A 3BGJA 4MY8A 3G22A 3G1YA 3TXVA 1S5VA 4K37A 3EXRA 3L5AA 1LBMA 1WBJA 2WNNA 5AHEA 4U4MA 1OX5A 2DU2A 4AXKA 2VXNA 4FNSA 4IMFA 2QCDA 2Y7FA 5KZDA 1GEQA 2QCEA 2EGZA 5CG7A 4OE7A 2TYSA 4WZHA 2QCFA 3P67A 3W2LA 5FEZA 2FQIA 3O8AA 3HOJA 3KRSA 2YCEA 4KKXA 3P5ZA 1KM2A 4RXFA 3G1XA 1GVOA 1DQXA 1YXYA 3VE9A 4AAJA 4G1KA 2FJKA 3MW7A 2H3BA 3G1AA 3QW3A 3R12A 1QDSA 3PAJA 1MEWA 3M7WA 5U4NA 1FDJA 5I3JA 4XUGA 4BR1A 2C6QA 2C3ZA 5KSWA 2NXGA 5D2TA 3B4UA 1Q3NA 3LX9A 3LV6A 2VEMA 3LBMA 4LS1A 1DBTA 2RKXA 3BW2A 3HPSA 4N9CA 1O95A 1U83A 2ALDA 1OABA 5F2MA 2NWRA 1B3OA 3FKRA 2V81A 1TMHA 1SSGA 1ZY9A 2PC4A 1V5XA 3W7LA 1K7XA 3LHUA 1Z42A 2C18A 4IMEA 3INPA 2F7FA 1EIXA 5BRBA 3TJLA 4MYAA 4HIBA 4ZQPA 1Q6OA 3DFQA 5L9FA 1WV2A 2QJIA 3LDVA 4EOUA 1ICSA 4AHOA 1H5YA 2H8XA 3W71A 4AWTA 3KVKA 4MLRA 3OG3A 5TIMA 1YYAA 2WNZA 3W7OA 2C13A 3O05A 1JVNA 4MKNA 5K9DA 5IBXA 4FX8A 4JIQA 2QAPA 1I2NA 6TIMA 2OT0A 2ZA2A 3GVGA 3FIGA 3L21A 4NJGA 3ATZA 1RVGA 1UCWA 4CQ9A 3P8JA 3IGUA 3L9CA 5F1UA 5K2ZA 4X22A 1J4EA 3IGXA 4XBSA 4O16A 4PH6A 4WQ6A 1EUNA 4QNEA 5F1VA 4JTTA 1YPIA 2FPVA 3TX9A 1K03A 1HTIA 3W2NA 2E68A 1EEPA 2AAMA 3STEA 4JYFA 1YTKA 5LHEA 4LRSA 3DFNA 3W2KA 4XTDA 4M6PA 3RK8A 3EKZA 1TIMA 3MMTA 3LTYA 4YCPA 3PB2A 4Z08A 4DO5A 1LYXA 1KM5A 3TSMA 4IMGA 3CB8A 5K9CA 4JYEA 3F4NA 3B03A 4LC8A 2RDWA 2Y88A 3IRDA 4H3DA 3HQ1A 2DZSA 4AB4A 2Y63A 3GZ3A 5I3FA 2BX7A 4OU1A 5FF7A 2ZYFA 4HNUA 3S0CA 1GPWA 3MHFA 2WJZA 4BI6A 3EX2A 3LRKA 1B9BA 1IIGA 3QRHA 4CCCA 1IXNA 4KWWA 5AN7A 3RLVA 2G96A 4O13A 1R47A 1AW2A 4WXYA 3NDOA 2WOQA 4PEKA 5CZJA 2BLEA 4GUJA 3I65A 2WSYA 3GR8A 3NYZA 3T44A 5D04C 3EWBX 1SSDA 3KRZA 5ABTA 3H54A 4I7WA 3SW6A 1R46A 3PF3A 4Y90A 1JRBA 3LOTA 1H7XA 4UTKA 4EIVA 1EP2A 2DJLA 4Z1DA 1O5KA 3R8RA 1FDYA 1ML1A 4Z0JA 3M1ZA 3P82A 2A7NA 4S1FA 3G8EA 4M19A 4UCGA 3LCLA 2DZTA 3DU0A 2GVGA 3Q58A 3E9AA 3NL5A 2YSWA 3VCRA 5C54A 4JTSA 3W73A 4QQ3A 3IIXA 1XI3A 3UWZA 4BI5A 4JTGA 5G1YA 1A5AA 3GB6A 4ZVJA 3ZR4A 3A24A 4BWLA 1W0MA 3WJZA 5K7JA 4PTNA 2CLMA 2NX3A 3IIOA 4M5PA 1RZMA 5HQEA 3PM6A 5FF3A 3M6YA 1JUBA 1ZAIA 3PC0A 3W74A 1XXXA 2YFOA 2NUXA 1GQNA 2C19A 3BW3A 3PUEA 1KBIA 3IVSA 5LNSA 1ME9A 4JXCA 5AC6A 2NXHA 3PG8A 1KA9F 2O7SA 2CW6A 4YCOA 4FXSA 3LRMA 3HO8A 1F74A 3BO9A 1XBVA 4M6QA 4JTLA 3M43A 4UTJA 1TO3A 4O57A 3THAA 3N2MA 5C55A 3F1QA 4MZYA 4S2BA 5C2XA 1XDLA 1SUXA 4DPQA 3LCWA 4WY0F 5FEXA 2V30A 3EWWA 4MPQA 1JJKA 5HMSA 1OX6A 3RU6A 3TMLA 1I45A 2JKAA 3PULA 1OYCA 1KBJA 3LGEA 3GDTA 1FWTA 1FX6A 2Q3OA 3WK0A 4Q32A 3P8IA 1KFJA 1TRIA 3M16A 3HGOA 4UTWC 1D3GA 1BTMA 3LHWA 5DXYA 5E1QA 1UJPA 1TPFA 4O54A 1MZHA 5EA9A 2QJHA 3S5ZA 3USBA 3C2FA 3RF9A 1NAL1 4Z1BA 2FTPA 2QEZA 4DELA 2P1FA 4ORMA 2CZ5A 1VCFA 1IXQA 4LVGA 4LVAA 4XWUA 1LLZA 4WJEA 2V5LA 2YX0A 3DGRA 3LM7A 2A6NA 3VKJA 4O18A 2V8ZA 3EWUA 4QITA 4A3UA 4JDBA 3DAQA 5LKYA 1F76A 1P5BA 2QCMA 1Q6QA 1DOSA 3V1PA 1AMKA 1LP6A 4OWGA 3IIZA 2YFNA 2NX1A 4UTMA 4DQWA 1FWNA 4IXHA 3HGRA 1XUUA 4LT9A 2X1TA 4O0KA 2V9DA 7TIMA 2RHGA 3G1DA 4FNQA 4PA8A 4TMCA 4AF0B 1H1YA 4TU1A 1JUKA 1UASA 3NQ2A 2JGYA 3N73A 1JCYA 3W72A 4ORIA 1MEIA 4LU0A 4JTHA 1K3UA 5BNKA 3SFKA 3LXBA 1LORA 4W9TA 1T8XA 2FDSA 2ZTKA 4P61A 3I7SA 1FCVA 3N9RA 3F4WA 3QH2A 2G97A 3LI1A 2RH9A 3QEZA 3W1UA 2ZA3A 1X6UA 1ZENA 3NQDA 1W31A 4P2VA 4QISA 4LVDA 2R94A 2ZRYA 1G6CA 3G24A 1FXQA 1XBYA 3G18A 2RDTA 3TC7A 4DF1A 3TJXA 3QQ0A 4JTUA 3EX4A 1TPWA 5D09A 4QIUA 1JCLA 4X3ZA 3PBWA 3SI9A 2E6FA 1JCNA 3MI2A 2YPIA 5G5IA 1H60A 3NM1A 3GX9A 1W5PA 2WSQA 2ZZ5A 2OCZA 1UB3A 2ZA1A 3NA8A 1OFDA 5D2YA 3T78A 1SO4A 2E5BA 4UTIA 1FWSA 3U6WA 1I2OA 4WOZA 3UXAA 2V0TA 1OF8A 5HINA 1TTJA 2VOMA 1LZOA 3NQMA 4K7YA 2WO5A 5F4WA 2A0NA 2VENA 3L5LA 1KW1A 3M5XA 1QPOA 3EKLA 1LOLA 1W3TA 3CEUA 1ZHAA 3IIVA 5AHFA 3NGJA 3DFPA 2ZRWA 4HN4A 2ZRZA 4R34A 5FF2A 1SW3A 2PRHA 3NOEA 1KFBA 1OJXA 1LOSA 1V7YA 4ZQRA 4HT3A 4JEQA 3EX3A 1MXSA 4K36A 5G4WA 3VNDA 4UTHA 2FPTA 1P4CA 4ZL1A 4K38A 4XZ9A 1L6YA 4LY8A 3SZ8A 3KOFA 2G5WA 3H53A 2NXIA 3OVQA 3U8GA 1QMLA 1WDWA 1TPEA 2QCGA 5AFDA 3W83A 4HHPA 4O10A 2ZDRA 3CQ0A 4ADSA 4DXVA 1LLWA 4AEOA 3E49A 5D2WA 1CI1A 5LHFA 1B57A 3KFTA 1J2WA 3UWUA 4I7UA 3I7QA 1PV8A 4UTTA 1T99A 3L68A 3C8FA 4FB7A 4NXSA 3UWQA 1FWRA 5F2GA 3IEBA 2FIQA 4GWEA 3HG2A 4JIPA 3W7CA 4NX0A 3GDRA 3PS7A 3W87A 4FF7A 2OMAA 1EWEA 3S1UA 1GTEA 1IGSA 2VFDA 5CPLA 4NXKA 3PBUA 2CLEA 1W56A 4UTLA 5DN1A 5E93A 3NQAA 4U28A 1IIHA 4RXGA 1TPB1 1OK6A 2ZBTA 2GQ8A 4ZQNA 4UTUA 1JUEA 1O4UA 1CW2A 5SWUA 1W5NA 5BOOA 4ZMGA 3W1LA 1EWDA 3W23A 2GVLA 1GVSA 5LSMA 1EB3A 3CTLA 4R33A 3QFEA 5CPMA 4R53A 2NV2A 2WNQA 3L66A 4O52A 4LV9A 2Y7DA 4UFKA 3TUUA 2FB2A 4O11A 2VEKA 3S42A 3W7EA 3G8RA 1NF7A 1KM1A 3C2EA 2E77A 2X30A 3O15A 1CX9A 3ELFA 1L2UA 3P61A 4JTIA 3HB9A 2X1RA 5IBXC 4FNPA 2XFWA 4FIQA 3QMRA 3LI0A 1FDZA 1G69A 4TIMA 2B4GA 3L2IA 2C14A 3ABRA 5LGXA 3ZFHA 1GG0A 3T4CA 1QAPA 3VI2A 4QM1A 1H51A 4UFJA 1M7PA 1J5TA 3F03K 3R89A 3QYQA 1WXJA 2Y61A 3TSBA 1VCGA 3RMJA 1K02A 4S2CA 3DENA 4WXZA 1KM0A 3HGSA 1H7NA 3QQ1A 1P1XA 3FYPA 1ALDA 1LRQA 3C0JA 3JR2A 1FWWA 2E6DA 2A21A 2CLFA 1LM1A 3PWAA 3UPWA 1ZNNA 4IGHA 3EWXA 1YDVA 1T0OA 1TPVA 2GJNA 3LCHA 4DBDA 2NX9A 4JD4A 1TTIA 1JCXA 1ZJIA 1H61A 1A5SA 3W7QA 1H1ZA 3MYOA 3ANYA 1LOQA 1XDMA 5T26A 4LWWA 1L9WA 3GDLA 4CNNA 4JS3A 5J5RA 4RX0A 4O1DA 3UQNA 1C8VA 4CCEA 2DZPA 3UD6A 5I3KA 1M7OA 5D38A 3PSWA 5F2LA 2E5DA 3EXSA 4N2YA 2P0OA 4ALDA 3MYPA 3U2OA 1NF0A 1NEYA 3S9YA 1SO6A 4R7JA 3NZ1A 3GYEA 4H4IA 3KXQA 3NQCA 3S5YA 5A5WA 4LV4A 1LROA
chains in the Genus database with same CATH superfamily
3TDFA 4HNVA 1TCDA 4EK7A 3AHVA 1LDCA 2HROA 2D2HA 2YYUA 3B04A 1OFQA 5G1TA 1UZDA 1HO4A 4L61A 4N7QA 1H4PA 1O1ZA 3NTYA 1R3RA 3NVDA 4FNRA 3VINA 1HP4A 4E6MA 4XAYA 3VFCA 3MY9A 3ATYA 1NU5A 2P76A 4GY7A 4D2JA 3H24A 4H7ZA 1E1CB 3R5EA 3PB0A 4ILSA 1QK2A 4IQLA 3DG6A 1PS9A 1EC9A 3WBYA 4XKYB 1G7VA 2GGGA 1FCUA 1XCXA 4LGXA 1O66A 2J7HA 2FGBA 3BLFA 1QOPA 4E3VA 2GGIA 5E0KA 4YXGA 4JEJA 4ADTA 1EYEA 2V3GA 3VABA 4AZ7A 3I68A 2OJPA 5DXXA 2TRSA 3W1PA 3CIWA 3S47A 2A2IA 4C5ZA 4QS6A 2PBOA 3HG4A 3W1QA 1KQYA 1I2PA 4FX6M 1PZ3A 3R79A 1VBRA 4DWSD 1FWEC 3VNKA 1GYMA 3CHDA 1CLVA 2HQAA 4MVAA 1CGTA 4F0SA 4HYVA 6TAAA 3VGBA 1XCFA 1K6AA 1UQYA 4FIRA 2F6XA 2WQPA 4J4KA 1DQWA 5J8LA 4JTQA 4Z2GA 3GVRA 1AA1B 4WDXA 4UQBA 3NQ8A 3C8NA 3UXDA 3UA4A 2A3EA 4E8GA 5CGTA 1OYBA 1QNOA 3W7DA 4GE8A 5G2WA 4B9YA 1MXGA 1XISA 3O0KA 1UWSA 1NOUA 4GGHA 1DL3A 3NURA 4K8HA 2VCCA 3MKCA 5JU6A 4QDMA 2GK1B 2ZCGA 4XO6A 5DELA 2UV8G 3A21A 2AMXA 2PWUA 5E0FA 5ABFB 5LXEA 2VR4A 3M46A 3D6NA 4RK8A 2PURA 2R14A 3WJYA 4JN6A 4LAUA 1FY6A 1BVZA 3WBAA 2F2HA 4UXDA 2ZOXA 3EX1A 4TTUA 2DSKA 2WMFA 2J77A 5GVJA 1CENA 4EKJA 3KBJA 1TJ0A 4O4VA 4DI8A 1OZQA 5F4SA 1DXFA 2DZXA 1QWKA 1L6WA 1VB9A 3QYSA 1QI0A 1R2TA 4H9MA 4M80A 1KRMA 3B8IA 5XIMA 3AALA 3PG9A 3JZEA 4JQAA 3WY1A 3WFAA 3FGCA 1OFRA 4DX3A 3QOKA 1JFXA 3UR7A 5L6UA 1M03A 3DBNA 5K3VA 1SZGA 5FESA 4FI4A 1QHOA 2F6KA 3CLMA 3B05A 1Q85A 1TPUA 4DUXA 5C5YA 3A64A 4JNYA 1THFD 1QPNA 3V75A 2I5IA 1D7KA 5AYXA 4W93A 3T1GA 2QPSA 2RJHA 3R13A 3ZMRA 3QR0A 2OO6A 3IK2A 4GUGA 2NZLA 1S1RA 1LBLA 3KVLA 1CXIA 1YPFA 5BZAA 2IQTA 4YWIA 4F79A 3N18A 3UZXA 5G4EA 3UWEA 4AWUA 4C6QA 4IIGA 1TV4A 2Y6ZA 3VZYA 1Q65A 5AC8A 4MFDA 2REQA 4TX9A 1WXYA 3THQA 5CZSA 2ASHA 1EO5A 3NQFA 4X9YA 1D3HA 1WKEA 1J01A 3A3HA 2AL1A 1HW6A 4W4QA 3PJXA 2QGYA 3ENLA 4O4WA 3BV7A 4YHGA 3LCXA 2QMKA 3O16A 1DJWA 4DRSA 1SFLA 1BD0A 3DGBA 1JD9A 2A85A 5CSSA 5CAHA 1UR1A 3UJFA 1KFKA 1DP0A 3PZVA 1S5WA 3I6EA 3WLPA 2KZHA 4H41A 5HNTA 1SQ7A 1WAWA 1MQQA 5KMYA 5EKYA 1BEUA 4PMNA 1VFSA 1BQGA 4GYFA 1R0MA 1QATA 1ONWA 5CC7A 4B4HA 2DZAA 1E55A 3O6CA 3CXOA 2QLYA 3IANA 1EJXC 4E8DA 1WCGA 1JZ6A 3GNXA 3UP8A 1EJUC 1FQ0A 2Q8ZA 1EJWC 3EPMA 4YMZA 1NWSA 1SR9A 4I5XA 1W9UA 4XZNX 2ZC1A 1QCWA 4H9UA 3GXPA 2FZ8A 3A23A 4Y6GA 3QC0A 4OKDA 1RLDA 3B4YA 5CAKA 4R7WA 4XZMX 2OX1A 3W1RA 1MNSA 2GQAA 3L7RA 4LBSA 2X0HA 1W37A 2NWSA 3BJSA 4JFUA 4CD5A 1ESWA 3UXLA 3RM9A 4W89A 5C6MA 3W7MA 3L12A 4QLKA 1DQUA 2GJLA 4CD4A 3DFTA 3RN6A 3FA5A 3A9IA 1BWLA 4Q22A 2GOKA 3E2QA 3NO1A 3GVQA 2QCNA 1WDPA 3TTQA 4HA4A 1XBZA 1OINA 2ANUA 4HKPA 1FXPA 1T96A 2HTMA 3BK0A 4FS9A 4Q33A 6PTDA 4MNKA 1GZGA 2WLZA 3TQPA 4CGTA 3DIPA 1K8YA 4HTYA 4NU7A 1F73A 4K8EA 4AVFA 3WNLA 4CCDA 3GNDA 4N6EA 3WLMA 2H9AA 1W8SA 2HVNA 3O6AA 3PNZA 2CLHA 4AU0A 2QF7A 1XIHA 1HO1A 5CXPA 1TZ9A 2OEMA 1U1HA 2NT1A 4AIEA 4Q4OA 4HZ7A 3NNTA 2EF9A 2E1DA 3P84A 1OFAA 2YJQA 3G0UA 3WNKA 5BRPA 5IXEA 3LHTA 3SRFA 4WD0A 1UH3A 1XIEA 1VYRA 3S1VA 1AL8A 2C15A 5BMXA 5BU6A 2GUUA 5DY2A 1SZRA 3TW9A 3OLDA 3LXAA 3IWPA 1Q2RA 3RNDA 2C0AA 2L5HA 3LHVA 1X6NA 3KWXA 1R7AA 2CZEA 1K9TA 1WP6A 1V3KA 2WW5A 4N02A 4A8LA 2CZFA 3PWIA 3AS3A 1IEIA 1V6TA 4HMDA 4I9TA 1MUMA 3AO0A 1CXHA 5LGZA 1F3TA 1S5TA 2POZA 1EC8A 3CC1A 2J8FA 3W28A 3GDKA 2NVAA 2OKOA 2PDGA 4IXXA 3QKZA 2QCDB 4G5DA 4XSMA 1QXLA 1S46A 3CO4A 3GFYA 1M41A 3WD4A 2J24A 2CLIA 1X96A 1I1XA 3EDDA 5CPQA 1R8LA 2A6LA 1OFEA 4PCFA 1BWVA 4LVFA 4MY1A 2BOEX 4A29A 1TZ7A 3QM3A 5G2HA 1RJPA 3MWCA 3U2EA 3LB0A 3ARVA 1XIIA 4AEFA 4LAZA 5C70A 1IR2A 2QAFA 1I2QA 3NQ7A 3SJ3A 4BI7A 1OC5A 3VK5A 4AH7A 1Q13A 4OQVA 1TJPA 4M56A 5CZTA 1X7IA 1GVQA 1UA7A 1PL9A 1A3XA 1ICPA 4P7LA 3B8SA 3P7YA 3W24A 3M44A 4XIAA 2CCRA 2WSKA 3CM4A 3DC0A 4KRZA 3IVTA 4MJZA 1LBFA 2WQDA 5TNVA 1IEXA 4MHBA 2V63A 2PGEA 2OGJA 1RVKA 2EEXA 3KOXA 3LHZA 4ASTA 3S2NA 2HE5A 4RDWA 2ZZ3A 1WE5A 3NVTA 4E2BA 1JYXA 2A1YA 4GOAA 1XIBA 1WKYA 3T2QA 4IHCA 4ICMA 4Z0SA 3GG8A 1YXDA 2VURA 4N0RA 2XWDA 4J3UA 3TSDA 3DFSA 3MVIA 4OFCA 1Y7VA 1EPVA 3FX4A 4J9JA 2DZWA 1SMDA 4X61A 1MEHA 5CC3A 1KBLA 2E40A 1GKRA 3AXHA 2AKZA 3QR1A 5HJXA 3I6RA 3ITYA 2FH8A 1C8QA 3H23A 1V6UA 4NX5A 1OT2A 4H83A 3WJSA 2ADAA 6REQB 1X8FA 4GINA 3G3DA 1PEZA 2I5GA 1GVFA 5AYZA 3DI1A 5EBUA 1KM6A 2Z1BA 3URQA 2FPYA 6A3HA 3W7IA 2HVOA 4NNCA 5DO8A 5HOSA 3TFCA 2ZZ2A 3PR2A 3S8HA 2BZNA 3STFA 1X1NA 4GXMA 3LCGA 3PPHA 1R9YA 1HJQA 5C2CA 2VC6A 1TV7A 2CC0A 3SCWA 1QI2A 3WDRA 1A5MC 1DWFM 3BVJA 3S9ZA 1R2RA 4PUNA 1YRRA 1CLXA 1KTNA 3O0FA 2O4QA 1L6FA 2XM1A 5AHNA 4O28A 5D9MA 1NFBA 4UMAA 2WVTA 4WGHA 3R2GA 2YBUA 1OVDA 3GU9A 3AIEA 1YADA 4J3VA 1UP3A 2QV4A 5I09A 4NZ4A 2D0FA 3E1F1 1XFCA 5E0CA 2CZVA 2QCCA 1QJWA 4MY9A 2BOGX 5DLCA 3VZXA 5IFTA 3SCTA 4IIHA 3O2LA 4ML9A 1D8CA 3WELA 1V6XA 3GYCA 3C61A 1SM9A 5A8PA 1BKSA 4W7VA 4GZ7A 5A2AA 4LF1A 1JEZA 5D2VA 1PCKA 4PTXA 2BVWA 5D30A 3AZTA 1QI5A 1B3VA 4MNMA 2GUYA 3KL5A 3NO3A 1WDRA 3UXIA 4U3CA 1YBQB 2G8ZA 3R0KA 3OP2A 4LNYA 3QPYA 1JQVA 2YA0A 1W8GA 1BRLA 2VMFA 5HATA 1P0KA 1KGWA 2A7RA 3P80A 1UHVA 1JZ3A 3ARRA 5FL0A 2FYMA 1YIXA 3UFYA 4NYYA 4R27A 2ZQ0A 1J0HA 4PCSA 4Q7NA 1WPCA 3VOCA 3BSMA 1TMQA 1JIBA 3AHXA 3FOKA 5FA5A 5JIPA 1VBGA 4L7ZA 5HQMA 3CUJA 4Z1CA 5IOBA 2QJNA 3W76A 3EA3A 4AZCA 1YHTA 2YA2A 3OHMB 4B5UA 1ME8A 4G2DA 1QNQA 1GWJA 3AUOA 3GTHA 1EEXA 4JFVA 2ZRUA 4DLMA 2BWGA 1R86A 2W0UA 1K7EA 1J0YA 2PD5A 1KRAC 4HPNA 3TN6A 3GWQA 1UQZA 4PL1A 3MA8A 1DPMA 2DUXA 3QGAC 1PSCA 4E8CA 1K8CA 1KFLA 3HN3A 1ZL1A 1NOWA 1E3XA 3VD3A 4B2DA 2WVUA 3MSRA 1EP3A 1DWHM 2A7PA 4UTTC 1R85A 1V93A 2QF8A 3N19B 3O07A 2ISWA 3WQPA 3MPGA 1E4NA 3VIJA 1A5OC 5GPRA 3HMCA 1GG1A 1H7PA 3TC3A 1B90A 3VFLA 1V3IA 3QY6A 2HNEA 3EAUA 1V4YA 4ICNA 1YLVA 5TBOA 3RIKA 2PZ0A 3CU2A 4PODA 1B54A 4UFIA 1C9DA 3JZUA 1QASA 4GNVA 1DVJA 4PMXA 4IPJA 1V3LA 1R7OA 1TYGA 4JTFA 3G1VA 4NHVA 4H8NA 2GSEA 3SCSA 1G7UA 3QF0A 3OQ8A 4GNJA 3QOMA 1F2JA 3LV5A 3RU8X 2VRQA 1N8IA 3BOFA 1LRNA 4A21A 1JQXA 4ZE4A 2W67A 4KFNA 2GVJA 1ONXA 4K1GA 4Z1AA 4UC5A 2YDAA 2CXEA 1WZAA 3UGVA 4IFKB 2HS6A 1NQ6A 1B4KA 4GUHA 1PTAA 2R1LA 2WV8A 4HBKA 5BMWA 3EX6A 3TFXA 2GJXB 3SIZA 3DFOA 4I90A 3AS0A 3HG3A 3IV3A 2YGYA 3OEXA 5EYWA 3ZM8A 2FFIA 4AG0A 5AC5A 3JS3A 4WX2A 5CCZA 8XIMA 4LALA 5HR7A 2BY2A 2VZUA 1AZ1A 1AD4A 3DFYA 3PNUA 1S2VA 1W3LA 2DQXA 5AHMA 4QLJA 1TZZA 3CUXA 1KFCA 1UOZA 3V4BA 4AD0A 4RZ6A 5T91A 4P8WA 4B5VA 4B92A 1Z44A 3B8TA 1NFPA 4I8DA 1PPIA 2BDQA 4US5A 4B5XA 1LG1A 1EIBA 1S1PA 4LCRA 2G3NA 5FJPA 4INFA 3TXVA 3HV9A 1KQZA 1OBAA 4PB3A 4V27A 1WDDA 2DU2A 3KDNA 2V5DA 1K4GA 1UWAA 4FNSA 4IMFA 1YEYA 2Y7FA 1GEQA 2QCEA 2EGZA 5CG7A 1SR0A 3TYZA 2ZXQA 4DZ5A 2BP1A 3WMCA 4OE7A 2TYSA 4WZHA 7REQB 2QCFA 3P67A 3OZPA 1UR8A 3FA4A 2FQIA 4RXFA 4ZTXA 3G1XA 2HV5A 4W84A 1DQXA 1GOWA 4MWAA 4PCPA 2FJKA 4OOZA 3TN5A 2H3BA 2VZOA 4Q8WA 1CGWA 2ZUTA 3PAJA 1MEWA 5BROA 3WF0A 5U4NA 5FAJA 2FTWA 2C3ZA 5KSWA 1AD1A 2VNCA 3LX9A 2DT1A 2VEMA 3AU2A 3VX0A 4LS1A 2XIOA 1UG6A 3BW2A 2OR2A 1UC5A 3U5UA 2FJUB 4BA0A 1PDZA 2V81A 2VUYA 2G3FA 3BANA 1TMHA 3BSGA 5AVHA 3W7LA 3PZUA 1O68A 1K7XA 3LHUA 1Z42A 4IMEA 2WCGA 3VOJA 5BRBA 1PZ0A 4HIBA 1Q6OA 3DFQA 3REQA 2ZUUA 5L9FA 4AD1A 3L4TA 2XFRA 4EOUA 2DUZA 1YE6A 2H8XA 4AWTA 3F4CA 2Z7KA 4G7EB 1IYXA 5DF0A 5I23A 4JZ5A 2DZBA 3T09A 3T0BA 4JIQA 3H26A 3EBVA 6TIMA 2ZA2A 3QPEA 2XVNA 4DYJA 4U3AA 1EXPA 1RVGA 3TYBA 2PA6A 4H6QA 1O5QA 3IGUA 5F1UA 1JGMA 4X22A 2GZXA 1KR1A 4XBSA 2J7DA 4O16A 4PH6A 2HJPA 3VIFA 3WQ8A 1ONEA 3MUCA 1W1TA 1OC7A 6ENLA 2PDWA 2PEVA 2FPVA 3WUBA 1HTIA 3VKDA 2Y0FA 3STEA 1YTKA 4AUBA 3KOYA 3RK8A 1TIMA 3VNIA 3KP1A 3LTYA 3LPGA 3TWAA 4YCPA 5DMNA 1KM5A 3BQ5A 2PDFA 1NJJA 5K9CA 4JYEA 3F4NA 3H70A 3CV7A 3HQ1A 2Y63A 1PKLA 1E6SM 2ZYFA 4HNUA 1X38A 3MV01 2QIIA 5HNNA 1FWJC 3MHFA 1FWAC 2WJZA 3FYYA 1DXIA 3OLGA 1UMYA 3F5JA 3CQKA 2E9MA 1IIGA 2P3ZA 4CCCA 3OB8A 4I6KA 5IDIA 4WXYA 5CSUA 4PEKA 1E6RA 3LY0A 3S9IA 4GUJA 5C71A 1CB2A 3MU7A 5D04C 1SSDA 3H54A 3L4UA 4I7WA 5EFFA 4FAMA 2DT0A 3GG1A 3LOTA 3BC9A 4B3LA 4UTKA 1B3XA 1WNOA 1M7JA 4QCEA 1QW7A 2DJLA 1OIFA 3IK4A 4Z1DA 3SCOA 1FDYA 2CIPA 2A7NA 2PSNA 3LLXA 4M19A 4QGCA 1XLMA 3AYTA 1NH6A 4WK9A 1KXVA 3E9AA 3VCRA 2BVTA 5A6KA 1FWCC 3UWZA 4MPKA 4BI5A 3H2AA 3JVAA 3VKKA 1TIWA 1A5AA 5J04A 1QW8A 1PTGA 3R94A 1B3WA 3IIOA 1GOMA 3MUIA 2Q6ZA 3PM6A 1JUBA 4MB3A 2WAGA 1XXXA 2C19A 3BW3A 4JFSA 2EG6A 3PUEA 1KBIA 3RO8A 2NXHA 3NSXA 4REQA 4CEXC 3GZAA 3P2VA 1VIWA 4I5RA 3HO8A 5KEZA 2OU4A 4C5YA 3UGRA 3N04A 3TNBA 5FL1A 3N2MA 1C8YA 1R87A 1PX3A 3WUEA 4F0KA 1VPYA 2FVLA 2EPKX 2Y5EA 2NSOA 4ZOAA 2V30A 2J7EA 2Y5JA 4MPQA 3WNNA 1AQ0A 5HMSA 4A8NA 1I60A 4BQ3A 3RU6A 1UWQA 4GZEA 1KBJA 3FN9A 4TV6A 1FX6A 2Q3OA 4UBPC 1X8CA 3EZ4A 4QFUA 3KRBA 2XTKA 4MJ4A 3M16A 3LHWA 3SCUA 5LYRA 3FEQA 4BF7A 4V2XA 3S5ZA 3QZ6A 3UCQA 4GIAA 2OB3A 1FP9A 4FLRA 1XWYA 1KXQA 2QULA 2CZ5A 2UZ9A 1BSLA 2YIHA 3VNLA 4O18A 1H41A 1UD3A 1L8PA 4N42A 2F2KA 3QVQA 4D9PA 1F76A 2YXXA 4XISA 1DOSA 2ICSA 1IR1A 3V1PA 3ZSSA 2G4FA 3K8LA 4UOJA 1FH7A 2NX1A 3IJQA 4FXJA 1FWNA 3CNYA 2X1TA 4OOUA 1PBGA 4TMCA 1W9XA 1C3FA 3EKGA 2RAGA 4TU1A 1JUKA 2EQDA 3NDZA 1T40A 3QKEA 3IRSA 2WHLA 1E43A 4ORIA 1MEIA 4LU0A 2UY5A 1LORA 1QHPA 2CERA 3NDYA 4P61A 4DUWA 4JOMA 4IL2A 3R25A 3QH2A 3QEZA 1E15A 4RE3A 3KBVA 2GWGA 3NQDA 1GEHA 1W31A 4DLFA 3S2CA 2YBTA 2R9RA 1UUQA 2RDTA 3VOFA 2XFYA 4WDWA 2BS9A 2G50A 3GS6A 3TJXA 1FFQA 3EX4A 5I3DA 1TPWA 1GONA 1OQFA 4H19A 2YL9A 2YPIA 1XH0A 3GX9A 3KL3A 2J78A 4QAWA 4U5IA 4DJDC 9XIAA 1I2OA 4NI3A 3UXAA 2PDNA 2EKGA 1OF8A 4JBRA 1ZJAA 3VDGA 1LZOA 2VCAA 2PWDA 4E4PA 1W6TA 1W3KA 3L5LA 3M5XA 4S3BA 1NWTA 2OYKA 1LOLA 3CEUA 1ZHAA 9XIMA 1F4AA 2PMQA 5AHFA 3ZVHA 3N2OA 4PMOA 4C7FA 4L80A 2HWGA 3WH6A 3PP7A 4ZQRA 2DT2A 4JEQA 3S83A 5DMYA 3EX3A 5FAGA 2OLSA 5G4WA 4GVGA 4MMWA 3HPFA 3KCJA 5M1TA 1A0DA 2XVLA 4XZ9A 1AJ2A 3T4WA 3KOFA 4JQ2A 3E2VA 1DIDA 3EMQA 4GGBA 3OVQA 1WDWA 3RMEA 4X63A 5AFDA 3W83A 4O10A 1UWRA 2ZDRA 3CQ0A 2YBVA 3KCOA 3PZGA 3V0SA 2WMIB 3GHTA 4GJIA 3A3WA 3VCCA 4AEOA 5D2WA 4XAFA 1KB3A 4MWAC 4WJ8A 3UPMA 3WEOA 5AVNA 4I7UA 3I7QA 1VF8A 2ACQA 1AH4A 1T99A 4PMVA 4CU6A 4NXSA 3SUTA 5F2GA 3FA3A 3MUZ1 3GDRA 3W87A 1G01A 1V6VA 2OMAA 1V77A 5MF5A 1IGSA 3T0AA 3NEHA 5CPLA 3U48A 1W56A 2C71A 4GXWA 4UNIA 2YDSA 2G3JA 4U28A 4B3KA 1OK6A 2ZBTA 2GQ8A 2XPKA 3ZT5A 5SWUA 4AQLA 3CUHA 5I77A 2WJFA 1E56A 1EZ2A 2PTZA 3EOSA 3R4IA 2RUSA 4R33A 4KH2A 4PBEA 4YS1A 3H2OA 2WNQA 4L9ZA 4O52A 4X0NA 4CNTA 1PJ9A 1EF2A 2Y7DA 2MNRA 4FR1A 1AJZA 1YE4A 2F8QA 3R11A 3W7EA 1T8QA 1W1YA 5I03A 3DOPA 2WANA 3AJ7A 4JTIA 4YYFA 1CIUA 3QMRA 3ITLA 3LI0A 1UKOA 4TIMA 1E0VA 1HZYA 1L0PA 4KCVA 2QZRA 5HNUA 4UFJA 1J5TA 1W9PA 5CLTA 4BHYA 1UR3M 3L2LA 4PMYA 3M0XA 2VC5A 3RMJA 2DY3A 1JCTA 2CYGA 1K02A 4NILA 1KRBC 3DENA 4WXZA 4OUIA 1BG4A 1EO7A 3KHDA 1H7NA 1HVQA 4O1FA 5RUBA 1IZJA 3PAOA 1ALDA 1LRQA 3C0JA 2X8RA 4IFOA 2E6DA 1BGAA 4W5ZA 2IQ0A 4NASA 1TPVA 4AZHA 3W7QA 5M5DA 1Z32X 4LB3A 1H1ZA 3ANYA 1S38A 5HMDA 4C7DA 5T26A 4LWWA 1E0WA 4EPKA 4YU1A 1UYQA 4IPPA 4AZBA 4RX0A 4L6OA 4PMUA 3LZ5A 7ODCA 4W8BA 4HU0A 2P0OA 2PI6A 4ALDA 3PJTA 1EGVA 4RW5A 2WK2A 2X40A 3GTIA 3OZYA 1NOFA 1E71M 1NF0A 5I78A 1W1IE 1VFFA 1UD4A 5A5WA 4Q8OA 1LROA 1B2YA 4J1OA 3EDEA 1RCQA 2DH2A 4IUGA 4HHMA 3SY1A 3W4RA 1KTCA 5AC4A 2FZDA 4RLIA 1HL8A 2V2HA 1UOKA 1FWIC 4E5TA 3H2NA 4FK9A 4B9ZA 3FEMA 3HZ3A 4YTSA 4JGDA 4GUIA 4L1WA 4G9PA 1W2VA 3MO4A 1GJUA 1E4IA 3MQTA 1O94A 2PZNA 5B80A 5EY5A 2VEIA 1TQXA 5GJMA 3W1TA 4R5EA 3NPXA 2R6OA 3BMWA 2EKCA 3M0VA 1I2RA 5HJLA 1BKHA 1UKSA 4W5UA 1FOBA 1AL7A 4PE8A 3LCFA 3RX3A 3Q94A 3PBYA 3KTSA 3QTPA 2J7CA 3IIPA 3Q45A 4LCQA 3IPWA 4O12A 3K2GA 5C9UA 2PS2A 1XBXA 3LRLA 3EMZA 4NJHA 2TPSA 1KFEA 4MKVA 2C1GA 4K6AA 5FEPA 1EPXA 3T40A 4D71A 4CU7A 1SZFA 4FNTA 3BGAA 2ZZ6A 4UIOA 2XVKA 5CPSA 3VX1A 1DXEA 3TAOA 1ZALA 1WUFA 3M4HA 2DORA 4B5SA 2PWVA 3AMGA 4TMBA 2GWNA 3OU8A 3A3XA 5M03A 3SCNA 2Q02A 4ACZB 3QY8A 5I24A 3BDKA 2PTXA 5E6ZA 1JDDA 3N6HA 1HJXA 3A22A 3TC6A 4RR4A 1E51A 2HK0A 4KCWA 4A4AA 4C91A 3P5YA 1K9DA 1V51A 5I79A 5ECVA 4IOTA 2ZX8A 2FHFA 2IPJA 3PANA 1W9BM 1W2PA 4J2PA 3T9PA 4Y8FA 4HHHA 1F5ZA 3NYDA 3TK7A 2YL8A 3MANA 2Q8LA 1EQCA 4O15A 1VD6A 1YDOA 3TKFA 3MBFA 4WUIA 3UJSA 2BBFA 3OIHA 3T42A 3MDWA 4LVBA 3RLUA 3TW7A 1TFVA 1WXZA 3LPFA 3ALGA 3CHFA 4CN4A 1MW2A 3AIBA 3WDPP 1C8XA 3ITTA 1S3TC 4AF0A 1HJVA 2FTYA 5EMYA 1MO0A 4QG6A 2FVMA 2NUYA 4RUBA 2ACRA 1A5LC 3OBEA 1RD5A 4MG4A 5C0QA 4A2SA 4Q6XA 4A22A 2CHRA 3VD4A 5MKGA 3HQPA 2RFGA 4WKHA 1EBGA 1G4EA 4LEQA 3VD5A 5A8QA 1N2VA 1WA3A 3VIPA 2DVXA 1AZ2A 1JI2A 2GGEA 4H9YA 4I8YA 1SFJA 3URAA 2VX6A 2QVHA 3NQGA 2F61A 4F2BA 2XJ7A 3TYEA 2J6VA 1UR0A 2WJDA 1JULA 4A6GA 2B7OA 2V69A 1XLFA 3RUBL 3N2CA 5CPOA 1LTDA 2AAAA 1TJ2A 2C16A 2PDKA 3GNPA 3L4VA 3O3RA 4DJED 2BSLA 1F6YA 3FSTA 1OYAA 1Z6KA 2G37A 3UR5A 4C6EA 4FA3A 1DIEA 2HSAA 4LUTA 2D0HA 5BXTA 1K70A 3BAWA 3P74A 4O53A 3K4AA 3GW3A 2PRMA 1I1WA 3EEGA 1LT7A 3N4AA 3VMPA 1XLBA 1VYSX 3UXKA 2H8ZA 4JAWA 4PBGA 2YDRA 4FLOA 3M5YA 4RJEA 4UQDA 3LGGA 3W29A 3NQ6A 1EP1A 5ECUA 1R38A 4IQEA 2GDQA 2A3HA 4JNZA 2OEKA 1ZSXA 4TX8A 4MF4A 2PU1A 1Y0EA 3QSRA 1JXJA 1QBAA 5BXPA 4B5NA 3DYPA 3ZR5A 4GPNA 2ABBA 4QSHA 3CUZA 2P8CA 1ADOA 3IUDA 1VQTA 3Q37A 3GH4A 1IEVA 3AISA 3BLIA 2YOCA 3UVIA 1P7TA 1W5MA 3H4WA 4J5NA 1TVLA 3ANUA 4F0MA 2GYIA 1Z41A 1A5KC 3W70A 4GCXA 3GXFA 5A6TC 1F05A 3HTWA 3URNA 2EJ1A 3QC3A 1UPMB 2HE8A 3P6LA 6XIAA 1KLYA 4I7VA 3WMBA 1DJQA 3GIYA 3VUPA 4K8GA 2WVVA 1T5AA 3BSHA 2QV5A 1DYSA 4A35A 3MMUA 1E3ZA 3C6CA 1ISYA 1RY8A 3L67A 2BASA 3SN1A 4YL2A 1XL9A 1EUAA 4KCUA 1KWGA 1QWGA 1LWIA 3H2EA 1RJRA 3KLLA 4DWSB 3ERPA 5LIKX 2ZE3A 2YLLA 3CQIA 1QHZA 1WOBA 1BYDA 4IP4A 3K4DA 2XH7A 1EA0A 1U30A 3R8HA 3QMSA 2PGRA 1KCXA 1AH3A 4LAMA 5DX7A 1Q7MA 1NSJA 3MUAA 3P60A 1UP2A 1PX4A 3KTCA 5A8NA 3E0IA 2FDMA 1AQFA 4HZMA 1Q63A 3UY7A 3THUA 2GDVA 2QDHA 2WSPA 5IDZA 5A2BA 5AY7A 4FLQA 1G4PA 5DY3A 4FNUA 4YVPA 1J79A 4G6CA 1TX2A 1LUCA 3FDGA 5LNRA 3W25A 3Q4DA 1F6PA 4GQRA 4UZSA 3AU6A 4ENLA 1GQIA 4LW7A 3NUKA 3ZXWA 5HUOA 3PK7A 4HNNA 4HNLA 5CG0A 1Q8JA 5E5CA 3TAKA 1XLGA 1XH1A 2G95A 4D8ZA 3ALFA 3KVJA 3BARA 1M7XA 1FA2A 4GVFA 3CL8A 4ZTYA 3MUY1 1D7FA 5BXRA 4HU4A 3R7MA 1XRFA 5BWAA 2VZVA 1ZCCA 3VIOA 2H9AB 1R30A 3QHMA 3CK5A 2QDEA 2JGQA 3DESA 1J2BA 1SJCA 2PDXA 1RHCA 3QPZA 4E38A 3BOLA 4QEHA 1OFPA 1A47A 1Z7AA 2V3FA 1ME7A 4YWSA 1REQB 1DJIA 1AW1A 1VC4A 2Z00A 3UR8A 1JDFA 4W87A 3I10A 2VFEA 3K1GA 2GQ9A 4RZBA 4GQBA 5JH1A 2ZC8A 3B0VC 4DXXA 4X0VA 3WENA 5A6SA 3CS2A 4I9JA 1E6NA 1GJWA 3MP4A 4AXNA 4QEEA 4ZOCA 4QAIA 4L9YA 4AZGA 3B9AA 2W63A 2FH6A 1VYPX 4XKYA 1N7KA 3NR0A 3MKKA 4M82A 4Y8EA 2ZXDA 3W7JA 4QG9A 1KGXA 4X9SA 4Y9PA 4KF1A 1JPIA 2Z29A 5HUPA 3O7UA 4K39A 2AMGA 4JICA 1J6OA 2VX5A 3GG0A 1KCZA 2PP0A 4QJ3B 4JTRA 5CGQA 5CH9A 2D2JA 4DF2A 3FYOA 1TJRA 4DY1A 1CNVA 4JX4A 6ALDA 1XC4A 3AYRA 1M01A 4IUOA 1HKWA 5I3IA 3RXZA 2J75A 1QO5A 4BEUA 4N9EA 2AQOA 1TMLA 5KZ6A 1EC7A 3CPGA 1SW7A 3P81A 3UWWA 3SRDA 5FIPA 3SRHA 1AK5A 1HIZA 4B3ZA 4QE5A 2VGFA 4HZ8A 3I3EA 5HXMA 3V5CA 5D2XA 5G1MA 3ABXA 3IAPA 4JQ4A 3OIXA 3RCMA 1JYVA 2GK1A 3S6DA 4O17A 3TIMA 1LQ2A 1HKVA 5ABFA 1AJ0A 1AQMA 3LM3A 3NQVA 5I0DA 5A1AA 2W62A 4AFYA 2IKIA 3E96A 1MVYA 2OXNA 3UZJA 1A5UA 1IQ8A 1XH2A 4EWND 1XP3A 3DHPA 1D8WA 2VI0A 2YCIX 3CWOX 1DKWA 3F4DA 4DO7A 3UY8A 3OBKA 2WM0A 3S4TA 1TX0A 3SSZA 5CJ5A 4EF9A 5BRQA 5I5RA 2J9ZA 3H55A 2LLEA 2O7QA 4F0RA 4Y9MA 3E38A 3LEPA 2VRJA 2ZZ7A 1JAKA 1VBJA 4F9DA 3GSMA 1X1OA 4JNMA 3ARPA 3WLSA 1GOIA 4HPGA 2NV1A 2PODA 2ACUA 5LZLA 2ISDA 4WEVX 1E70M 1HJSA 2KX9A 3DHUA 1GZJA 2QUMA 3CUFA 3P0XA 3BLLA 4BQ2A 1QOQA 3QV6A 4GJ1A 3N34A 5FJIA 4GFSA 4EX4A 1J8VA 2VELA 4GI4A 3W37A 3AMKA 1TPH1 1H7WA 4NJIA 1EFZA 3FJLA 2PB1A 4XD5A 4HGXA 3V0TA 3BV4A 3M0MA 4M0XA 4D8AA 2DP3A 2Y8VA 4POCA 3E2RA 2WM1A 4LXFA 2Y8UA 1P6BA 3FXYA 1GVRA 5LA1A 3DKJA 4WF7A 3B8DA 3BMXA 3VC5A 1CGVA 4DAFA 1BSIA 1ZCOA 1VCVA 2Y24A 1G0CA 1TR9A 3LXCA 3WNOA 3MUXA 1I9CB 2JQXA 1LG2A 1C90A 5LNUA 3FJ6A 1XFBA 1IHIA 3WNPA 2J27A 3MP3A 4XTIA 3BGGA 3VCNA 5AC7A 2PDJA 1ICQA 4H9XA 1OCQA 4IG2A 5BYWA 3TEVA 4TVCA 1OGSA 4GYKA 4H9ZA 2ATMA 4PMJA 4CQAA 1A3WA 1HX0A 3KZPA 3PJUA 3DX5A 2EG8A 4MJ2A 3DFHA 4QXIA 3WH8A 2HEJA 4FF5A 3D46A 2NUWA 4UOQA 3W2JA 2I9UA 2PLMA 1VZWA 5C9RA 3MI3A 2VRKA 1ZJBA 3STCA 3FLUA 2H6RA 5E09A 2DIEA 3WK2A 5C7HA 2WKGA 3WF2A 4DEFA 3VXGA 1BFNA 1PHWA 3AMDA 1M04A 1C93A 1UWUA 2WPBA 3G1SA 4O8RA 4HSHA 1KKOA 3N14A 4KFOA 3HFYA 1BRLB 3TR2A 3IJDA 2OLHA 1ZRQA 4IT1A 1HKMA 2O4MA 3H2MA 1HQTA 4ATWA 5HWJA 3W2MA 2OZ3A 5D4YA 1TWSA 4ZA0A 4F0HA 4GYPC 4FPSA 5AHIA 2WMGA 3K5XA 2W6RA 2BNJA 3QGKC 1UIPA 3P14A 3WK3A 4C90A 1F61A 4QJ1A 2EJAA 4UWMA 5H91A 2ISSA 4NAEA 2G3MA 1SO5A 3MKVA 2VVNA 3F5LA 3WLTA 3MHGA 1TTPA 2OZ0A 3OO2A 4NZFA 1O5XA 1GHRA 4HD5A 1TV8A 2ZX7A 1XW8A 2Y7GA 1RALA 4NZ1A 4JR5A 1K8XA 5HULA 4BQ4A 3IS4A 3B9OA 3ZR6A 2PDLA 3B9NA 1V6YA 1MNZA 3N9SA 4WSJA 4AW7A 4GVIA 4WKFA 3WH9A 1W1ZA 1OF6A 4PB5A 5LNVA 3TH6A 3LTPA 4E4FA 3KM8A 2QMJA 3M07A 3LGDA 3PBMA 4MM1A 1KWKA 3T2OA 3CZEA 3WMSA 4F4RA 2CZDA 2ZADA 2GSJA 2B81A 4RV8A 4PMDA 4NQ1A 1F6KA 1IV8A 1VJZA 4QNWA 4H6RA 3WEZA 2QUVA 3H2FA 2WWDA 3K4WA 2ZUWA 4W8LA 2WZEA 3EXTA 1QOXA 2YW3A 2DW6A 5T8GA 2BODX 1ZJHA 1ZBKA 3QMTA 2J88A 3AZRA 3WEMA 5I2UA 1P0EA 2PDYA 3EPNA 3F2BA 3TOYA 3L4XA 4GYJA 4ROPA 2VGIA 1W3NA 2Y1HA 4IMCA 3WF1A 3PFMA 5JVLA 3R58A 5HWMA 3W85A 2AKMA 4LANA 3ZWSA 3DHFA 4H9VA 1VFOA 1MYRA 3TXZA 4C6FA 4N4QA 1DEDA 2NQ5A 4P7OA 2XGIA 5FJJA 4PTMA 1LRTA 1X39A 2J9YA 3IGSA 4IM4A 4JTJA 2WSRA 5CPNA 5D8WA 3C3UA 2OWWA 2TSYA 3CEPA 5FI8A 1C7SA 3RLHA 3WBXA 3BGJA 4UQ9A 4EPBC 3G22A 3AICA 1S5VA 4B91A 1E0UA 4PUMA 1WKFA 5IHSA 3PZTA 3L5AA 1P6CA 2CBIA 1XPGA 1V02E 4JIHA 1OX5A 4U4MA 2QCDA 4C6IA 3EDKA 5KZDA 1L8NA 3UG4A 4CQDA 2D0GA 5XIAA 3KBWA 4FOUA 4UTFA 1XKJA 1V0KA 2E28A 2UBPC 5FEZA 3HOJA 4KKXA 3L4ZA 1QNRA 4WJXA 4AAJA 4RPPA 4QX4A 3QW3A 4PEEA 2YKKA 3GO2A 3R12A 3RR1A 2DW7A 3M7WA 2XIBA 1FDJA 5I3JA 4L65A 2NXGA 3GFZA 1VEMA 3KP0A 1NY1A 5DEZA 3DEQA 1DBTA 2RKXA 3H7VA 1U83A 2ALDA 1E5NA 3C2YA 4JFWA 1OABA 1YNQA 1B3OA 3FKRA 1SSGA 1V5XA 5I06A 2C18A 5HA7A 4LUSB 4M81A 3WDHA 4RPQA 3TJLA 4MYAA 4ZQPA 2R1PA 1WV2A 2QJIA 3LK6A 3LDVA 2O9TA 1H5YA 3N2TA 1SYTA 1KGUA 3W71A 2X7VA 4C1NB 3KVKA 3OG3A 5AZ0A 5TIMA 4DNMA 2WNZA 3I3DA 2C13A 1V0MA 3O05A 1YQ2A 4ZOBA 3PTMA 4MKNA 1OD0A 4O0QA 2O9PA 3CZLA 1LWJA 2J7BA 3GVGA 2JIWA 3L21A 4W7UA 1UCWA 4NAFB 4CQ9A 2OFJA 3WQEA 3VGFA 3T07A 1J4EA 6REQA 3IGXA 3AOFA 3QHNA 4WQ6A 2X7WA 1OZMA 2ON3A 4QNEA 3B9EA 5F1VA 1MUCA 1J0IA 3REQB 3W2NA 2WZTA 2AAMA 4YHEA 3KUMA 2E1WA 4JYFA 2VOTA 1DTUA 4LRSA 3DFNA 3W2KA 3U4AA 1UW9A 1CEOA 3UJEA 3MMTA 5FACA 3WBWA 4Z08A 3TCSA 1LYXA 1HJWA 3CB8A 1FKWA 4LC8A 2Y88A 3IRDA 3W6LA 1SGJA 2DZSA 4AB4A 3ARUA 5I3FA 5ENLA 1ITQA 3NZPA 4GY0A 3WDIA 1HN1A 2BFGA 4CVWA 3QRHA 1IXNA 1I6NA 1ELSA 1H2JA 2G96A 3VM5A 3CHEA 3CLWA 1R47A 3H8AA 3WQWA 2WOQA 5CZJA 2V6AA 2BLEA 4IIEA 1NQKA 1RBOB 2Q01A 1QI4A 3NYZA 1PTDA 1PIGA 3MB9A 2O9RA 5ABTA 2XSBA 1JRBA 3IUIA 3VNYA 4EAMA 1EP2A 1O5KA 3DC8A 3AYSA 4H8VA 3ECQA 5BU9A 1EF3A 5DMLA 4S1FA 3G8EA 4BF5A 3RILA 2DZTA 2RGMA 2GVGA 3Q58A 4LB4A 3VIHA 2YSWA 4JTSA 2P50A 3W73A 3SM0A 4P5UA 4HU3A 1QBBA 3RAOA 2VWTA 4ZVJA 3UR2A 5GNXA 1W0MA 4PTNA 2CXGA 2RJGA 2Z25A 1Q6FA 5HQEA 4LYKA 2YFOA 1NDVA 1GQNA 4H2CA 2NQZA 3IVSA 1ME9A 1R3WA 4B4FA 3PG8A 1KA9F 3PZ9A 2CW6A 4JCLA 3LRMA 3V35A 4PTWA 1F74A 3BAIA 4IGSA 4JTLA 3M43A 4UTJA 1KRCC 1YPXA 4LYPA 3THAA 3AXIA 3V18A 2VC9A 4OIFA 5C9WA 1OCBA 3UW6A 2NV9A 5F7UA 1XDLA 4H9TA 1UZHA 1SUXA 3LCWA 4XVEA 1P6WA 1SJDA 1OX6A 3PULA 4HCLA 5EBAA 3EB4A 2I16A 8A3HA 3SCPA 3D5HA 1UWTA 3P8IA 1KFJA 4D6EA 3HGOA 5AYBA 5DXYA 1E0XA 5E1QA 5A6AA 1U22A 2D2OA 2OELA 1UJPA 1TPFA 4MTVA 4KBXA 1MZHA 2QJHA 3USBA 5GNYA 5A2CA 4PBFA 3RF9A 4Z1BA 1JZ8A 1PDYA 4DELA 2W61A 3E0VA 3T0CA 1VCFA 4LVGA 3H7UA 4XWUA 3VOIA 3QGVA 3OQEA 2YX0A 2A6NA 3FJ4A 3VKJA 2XZ7A 2R24A 3SCQA 1WDQA 1S5NA 3DAQA 1IGWA 3EDJA 3BZJA 1Q6QA 3RJXA 4F8XA 2I56A 1LP6A 3IIZA 2W66A 2CKSA 4C7GA 4DQWA 4S3GA 2C79A 7TIMA 4PUKA 5C9XA 4XZHA 4F0LA 2Z1WA 3WLRA 1T6MA 3K46A 3W81A 4IPNB 2SFPA 4XAZA 3LXBA 1H09A 1PB0A 5LA0A 2PAJA 4GH1A 4X2PA 3V1HA 2AL2B 1PO9A 2CHOA 3N9RA 3F4WA 4H2HA 4DUOA 2G97A 2RH9A 3ARYA 4GJJA 1V3JA 3A13A 1QPKA 1BHGA 4P2VA 4QISA 3BAXA 1CT5A 3G18A 4GK8A 3OW1A 1XBYA 4DM1A 4LAKA 2OYMA 4QIUA 2QXWA 1V7AA 4W88A 1JCLA 4X3ZA 3PBWA 2E6FA 1V3MA 2WHMA 1H60A 3OGRA 2E67A 1GUVA 5JBDA 1UB3A 2ZA1A 3WL0A 3NA8A 4W7WA 1SO4A 3E6EA 2E5BA 1FWSA 2XZ9A 4AIBA 4IFKA 2PWGA 3VILA 4K68A 2ODOA 5HINA 4K7YA 1R9XA 2IW0A 2A0NA 3P0WA 3F7JA 2ESCA 1FFRA 2GJXA 2YCKX 1EDGA 3NGJA 3DFPA 4HN4A 5DMMA 1XYFA 5FF2A 1SW3A 4Y9OA 3NOEA 1OJXA 1V7YA 2P53A 3J7HA 3SIMA 3AIRA 1MXDA 3DYMA 3R0DA 2G4JA 5HPCA 2CITA 3VNDA 2BG5A 3IARA 1CXLA 1J96A 4A8IA 3ONBA 4ZL1A 3GR4A 1L6YA 1E9YB 2PWFA 4L6DA 1A4MA 2P88A 2BV9A 4J3TA 4JL2A 1R3TA 1O5RA 4HHPA 3GM8A 1A49A 4HZ6A 4PFHA 5CJNA 3IV8A 4EACA 4XK2A 1E6XM 5LHFA 3ARWA 4C6JA 4AIOA 5FSDC 2IPFA 3N4FA 4HCHA 3WD2A 1IT0A 3QHOA 1FHVA 3WQCA 4UTTA 4GQ0A 2PCEA 5FJOA 3VDBA 3L68A 4FB7A 4F40A 1V0NA 3LYEA 3WQ6A 4OJYA 1P48A 7REQA 3IEBA 3HG2A 4NX0A 3CJPA 4DZHA 2C1IA 3S1UA 1K4HA 2Z1KA 2VFDA 2PF0A 4F2UA 3PBUA 2D1ZA 4DI9A 2CLEA 3GVVA 3ZLGA 4B90A 5DN1A 5E93A 3V16A 1YNYA 3OGSA 4IJCA 4RXGA 1JUEA 3BAKA 3W1LA 1EWDA 5LIXX 1M65A 3CTLA 1XS2A 2JEQA 3QFEA 5CPMA 2NV2A 1JF6A 3L66A 4KT2A 3U5YA 3TUUA 2X09A 3S42A 4KWUA 1VIZA 4LSBA 1KM1A 4GD0A 2X30A 3O15A 3VKBA 1JPKA 3ELFA 3CHCA 3PFRA 3VM7A 1L2UA 4PMZA 4FIQA 1FDZA 3SUUA 2QT3A 2CBJA 3BLDA 3L2IA 4MNLA 2C14A 1B3ZA 3ITXA 4Q4MA 3T4CA 4QM1A 3CAQA 5C9ZA 3HURA 1WXJA 1VKFA 1WZKA 1EHAA 1VEOA 5DT5A 3HGSA 4GZJA 2QGHA 1P1XA 3FYPA 2CLFA 1LM1A 2VHLA 1JXKA 4HNOA 3T05A 3ORWA 3UPWA 1ZNNA 4IGHA 3EWXA 1YDVA 1ENUA 1SFSA 4DBDA 2NX9A 4JD4A 1JCXA 3B8UA 3NWRA 4IZGA 1H61A 5I00A 1MMFA 1P1MA 4C6KA 2OQHA 3M6DA 3UJRA 1IE7C 3IJ6A 1XSIA 3GXDA 4XD6A 5J5RA 4JS3A 2OODA 3TZFA 3CYJA 2DV0A 3ZJ7A 7A3HA 3CIVA 4DJFA 3UD6A 1WO2A 4EXAA 4LYRA 5F2LA 2E5DA 1M3UA 3WLIA 4HA1A 5CPTA 5CSYA 3MYPA 3LS9A 4EWJA 5JBEA 2PLCA 2PDCA 1DWAM 3S9YA 1SO6A 2PDIA 1SVDA 1E5JA 1DJZA 3BZGA 3S5YA 2XSAA 2E25A 1R6WA 4GA8A 4GRSA 1C91A 1XQLA 4E0CA 3HIJA 3DHDA 4FOJA 2X42A 1J18A 4FX7A 3E12A 2EPMX 2YCLA 4MDPA 4C1LA 1UD6A 1S2WA 5K9XA 1SO3A 3LENA 4RCXA 1JDEA 3MSYA 2ZRXA 4O1CA 1V8EA 2YB4A 1TA3B 5LA2A 5A94A 3ISIX 4B2DD 1HFBA 4XAPA 4GBUA 4E2DA 2J9XA 4PYSA 1KCKA 1SJBA 4GC3A 3KE0A 4OVXA 2B7NA 4FLSA 4AIUA 3S46A 2PDMA 5D9OA 3LHYA 1OG0A 3S1WA 1F3XA 3MS8A 2WVSA 4L6HA 1ADSA 3B0PA 5DBTA 1H7OA 2WZHA 2XGZA 1HL2A 4Z2KA 3PVFA 4QDWA 1FP8A 3P3BA 1VR6A 1NFGA 3SGGA 1J11A 4Z2HA 3RX2A 4WKAA 4XZBA 1TV2A 2PTYA 3WLKX 4ES4A 2ZE0A 1XYMA 2HRWA 1GK8A 2JALA 5HR6A 4XD3A 3GNRA 3WJWA 1UROA 1RQHA 3AJXA 1RP8A 3GXMA 3B97A 2XH2A 3F4VA 4MDOA 2A3LA 4WRHA 4YYCA 3NQBA 2H3DA 3KOZA 3CT7A 3RCYA 4KESA 3UT0A 1Q4WA 1OGBA 3WJXA 3W3OA 3AI0A 4JN7A 2F38A 3BCJA 4H00A 3S2JA 3VGGA 4UFMA 2WCSA 3VTRA 2Z2AA 2CU0A 3B8WA 3NZGA 4GUFA 4IJBA 1OX4B 4JY8A 1VPXA 3DYOA 3GU2A 7TAAA 4YTTA 1CPUA 4AISA 4TXEA 4AWEA 4UUIA 2F84A 1QPQA 1DE6A 2BXVA 3VKCA 1LF1A 1YTEA 5FEWA 3OVRA 2VQUA 2PE4A 5I7GA 4UCFA 2V5CA 4FO4A 2V2CA 1KM3A 1JD7A 2DSVA 1BAGA 4DJDD 2QCHA 1NP2A 1AQHA 1BGGA 4NJJA 3LLFA 1RV8A 3OVGA 3GG7A 3HBLA 1DORA 3L4WA 4MZ1A 4CQ8A 4KGJA 2VM8A 4EF8A 4ZQCA 1TKKA 3EOOA 4EVZA 4FSAA 2HXUA 1TE1A 1PWLA 3E02A 1RXOB 1NP0A 3IUHA 4O19A 4QROA 3LSCA 4US5D 3GH7A 4LUIA 4JQ1A 3T8QA 3BG5A 1D3CA 1A5BA 1R3VA 2JKPA 3VUSA 4M24A 5BWFA 2JK2A 3GUGA 3LCIA 3WUFA 1CWYA 2BGNE 2EPHA 3FJNA 3A12A 1PCWA 9CGTA 1J6PA 5AOUA 3UPBA 4S38A 2BHZA 3BCDA 4WY0B 4S23A 5HBFA 1XLDA 2GQ3A 4XB3A 2NW0A 1QPRA 4OTKA 3QSTA 1VJIA 4O50A 2CLPA 3C5QA 4N6FA 5GJNA 2D73A 4FHAA 4KS0A 1GOKA 4MWAD 5CZKA 1EBHA 5AYIA 3U2ZA 1YNPA 1J93A 2VFFA 4CUCA 3WLOA 4IH3A 4C6MA 2OWXA 4FXFA 1G4TA 3T2PA 1N55A 5C7VA 5FF0A 1H63A 5DCBA 5EPDA 1VS1A 4ADUA 4PN2A 4OT7A 3IJ8A 1U33A 4F9JA 4XIMA 3TV8A 1ZPTA 1SMAA 3EB2A 4TR9A 4RDZA 2Y4SA 3K1DA 4PSRA 2J66A 4QS5A 1WKDA 4DO6A 3UZYA 3DDMA 1XQKA 4V28A 2FFCA 3KVMA 3UETA 1TWWA 4PUJA 1HGWA 3VKAA 2Z2BA 3MCOA 1ECEA 4BFAA 3W1MA 4PSPA 1H7RA 1K6WA 1OK4A 9RUBA 1Q6RA 4OV9A 5D9NA 4I9MA 4BCEA 4HSNA 5CZ0A 3B06A 3IGHX 4PGLA 4GKLA 2ZIDA 5BOFA 1ZU8A 4LUYA 3RCNA 2XFFA 2WMIA 3ARXA 5A3HA 1DIKA 4JTKA 2PC8A 3SN4A 3U0HA 1OFOA 1OGGA 5DBUA 3AXMA 4PB4A 2V68A 5D37A 3T7VA 4HYRA 3U3HA 1I4NA 3KAOA 4FOKA 4AWSA 2PFHA 1XIDA 5U7SA 4DUVA 2V5JA 3BLOA 3O6DA 2Z1SA 1M9HA 1G5AA 3GK0A 4GVHA 4ZO9A 4IX0A 1SZNA 3VC6A 1S3HA 3TVAA 3NZQA 3W22A 1OFBA 4Y2WA 4LX4A 4WOQA 1KV5A 2X0YA 1IT8A 4FZIA 3WIJA 2DJXA 4H1ZA 4EANA 2NQJA 2QDDA 3CV1A 5T9CE 5FD0A 4J28A 1NDYA 1BVWA 4LOCA 3ITOA 1GT8A 4ECLA 4EPEC 1FBAA 1TELA 1W3JA 4LRTA 3TTYA 2XINA 2PRLA 2XN1A 3VIIA 1LL7A 3LUTA 1XRVA 4CQCA 3U9IA 4CN1A 2B31A 4M6UA 3VNMA 4HNCA 1SW0A 2JBMA 4L9XA 4DJDA 4GIYA 4LBRA 6CGTA 4MYXA 2BVDA 3MI6A 1IWPA 3NM3A 4MAZA 5KTLA 3WNMA 1TREA 3WMLA 1UUMA 3SQMA 1F8IA 1W1PA 3ZLHA 4IGNA 2EBNA 2X41A 1EJRC 3DXIA 2C1HA 4H6EA 3E5PA 2CWNA 1Q7QA 3GKFA 3M5VA 1N8WA 4YLWA 5HWNA 2FLIA 3CGTA 3W7RA 4HK6A 1EL3A 3UWVA 1FTXA 3ID7A 4HQVA 1GVEA 4DJFC 2Z1VA 3LPPA 4KIEA 4K7VA 4ZE5A 2GOUA 3N12A 3RG6A 1A5CA 3HPZA 1GGOA 3RM4A 4H7VA 1VFLA 3UU0A 3BXWA 5FJUA 3GHRA 5KITA 1W3HA 3M0IA 5EL1A 4AZ6A 2PP3A 1LUCB 3CV6A 1KBBA 3CQJA 1UZ4A 1SFTA 4RKAA 4TOQA 4Y96A 3T6CA 3TW6A 4Q4PA 3CWNA 4L64A 2AGKA 2ZRVA 4ZQMA 1S2AA 1G4SA 1F3EA 3HPXA 1JNEA 3W27A 4YTUA 5REQB 3VD9A 1LQAA 3GBDA 5MHBA 3MSGA 3PBVA 4QBXA 4OV4A 3VO0A 1TTQA 1G67A 3AROA 1QU4A 2HS8A 1AW5A 3TCEA 2Z6IA 2YA1A 3HG5A 4ZO7A 4X2RA 3W7HA 3JRKA 4IX2A 3WN6A 3QJAA 1PAMA 1V08A 3EDFA 3WUGA 1MW3A 2X16A 1PKMA 2I14A 3O06A 3UYCA 4GO9A 4PCTA 3G1FA 1MI3A 1GYLA 4LS0A 1QVBA 1Z48A 3W7NA 2QUUA 2WC4A 2DUAA 2X1SA 2WPGA 4DIAA 4NY2A 3L0NA 4C6PA 1JG9A 1Q4NX 2WXDM 1RUSA 2R1KA 3L0KA 1TRDA 3PZQA 5F2IA 3PWGA 3TQVA 3D47A 4XKMA 2QCLA 3GDMA 3L23A 2VDIA 4LTSA 4LFYA 3W2UA 4OHQA 2VUNA 1WAUA 4DYKA 3SJNA 3WQGA 5CKSA 2Y89A 3L65A 4L4MA 3E0FA 4UMBA 4KRUA 4UNLA 3TYDA 2E8YA 4TV5A 3LBCA 3QV9A 3BLKA 3GH5A 1EH9A 2UWFA 2DZVA 1A50A 2QJJA 5D33A 3E2SA 1E72M 4IIBA 4Q8MA 1PHQA 3ZO9A 5M2FX 5D9PA 3SBFA 1U1UA 2JEPA 5CC6A 4L4OA 1MFUA 1KM4A 4UR8A 1DJYA 4ACZA 1TQJA 1FCQA 4LJ3A 1GZ1A 3CYVA 5H2ZA 3HM7A 2BY1A 3GXNA 3AMCA 2WZMA 1O7AA 3HGJA 2ISVA 1NTHA 1VEPA 1Q45A 3WQOA 2C8NA 4JDYA 4KPLA 1MRQA 1UC4A 3V5OA 5I6SA 3O1NA 1F9CA 1PZ2A 3G0SA 3R1ZA 3TA6A 1LL6A 3LMZA 1MUWA 4AY1A 4M3PA 2FMNA 3NAVA 4Z2LA 1PIIA 4ZSUA 1VHCA 2FKPA 3VDCA 4PUDA 1Z69A 3NPWA 4XO7A 3W26A 4RDYA 3BMVA 1UR9A 3Q67A 2A4AA 3CH9A 3WLLA 1SU5A 1R2SA 1VGAA 4IPIA 1M5WA 5FJTA 3MWAA 2O9OA 4GHRA 3C4UA 3LTSA 3WCZA 3W7KA 1GQKA 1Q7ZA 2WHJA 5HMEA 3KS6A 5KETA 2AGTA 1OY0A 4ZFCA 3FNDA 3S1XA 3FKKA 3APGA 3T0DA 3NL6A 1SPQA 1YDNA 4EE9A 2GPTA 3HJZA 2A79A 3HPAA 3R10A 1QNVA 1D9EA 3II1A 5E6YA 4JKMA 4M7TA 5FSEC 1BF6A 1W5OA 3HF3A 3FCPA 3VAVA 5D32A 1W1A1 1AH0A 3FAWA 3WQVA 1H1NA 4LPCA 4NIRA 1JZ7A 4A3RA 4AMAA 1LCOA 5H1WA 4WSKA 2Z2UA 3IJ7A 4CNSA 4E3TA 3DG7A 5M17A 4LCSA 4HOXA 2A5HA 4F66A 1ZTVA 3QQWA 1M1BA 4NVTA 1WX0A 5A6MA 5HPOA 2FB3A 3W6MA 4NUWA 3N6JA 1UH4A 4CKQA 4C6BA 1DV7A 1NIUA 4D8LA 4GQQA 3JW7A 1KLZA 1JYWA 1JF5A 5JIWA 3KS5A 4GC4A 4IMDA 2IPGA 1XLHA 4G7FA 3G6LA 4NSBA 4H6KA 1P0NA 4AX6A 2NLYA 4AD3A 2BXYA 4RZ4A 4F48A 3CZKA 2JKEA 2EPNA 2VJXA 1DTNA 2Y2WA 2QPXA 1RQEA 1E1EA