3MHUA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-nitroorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
307
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 107
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mhuA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mhuA01
1LP6A 3O8AA 3EXRA 1OX4B 3MI3A 3W7PA 2E5BA 1VZWA 4DBDA 2E09A 1H7OA 1GT8A 2X2GA 3G0SA 4DQWA 1Y0EA 3PSVA 4FF7A 2CU0A 2GQ8A 5TBOA 4WUIA 2DZPA 2I9EA 5E1QA 2CLOA 3HPZA 1KTNA 3TUUA 1A50A 1LROA 1TMHA 2QDHA 3LGEA 4ADSA 1OABA 3F03K 1FXQA 1RQEA 1FX6A 1DQWA 1N8FA 1ICPA 3W7MA 3TFXA 4UMBA 1AL8A 2NV2A 5FEWA 2V30A 3A5FA 3RK8A 1NSJA 3M0ZA 3P81A 3NO5A 3TSDA 3M41A 3HQ1A 3LI1A 5FEZA 3O05A 2X1UA 2ZZ1A 4PTNA 4P2VA 3WFAA 2OCZA 2QF7A 1KFLA 2W0UA 4HSNA 3N3MA 3NPXA 3MMTA 2NX3A 1QO5A 3OA3A 4BK9A 3QJAA 3QF0A 2YGYA 1W3IA 4O50A 1C29A 1MZHA 3EX4A 4NNAA 2XN0A 1UUMA 2B7OA 3NQFA 3DI1A 4ZQMA 4UR7A 3TXVA 4FNQA 3N19B 3G24A 1TTPA 5MHBA 4M7SA 2QCLA 2QUUA 3BGGA 3W1QA 3C6CA 3Q2DA 1FY6A 4W9TA 2CZDA 1P1XA 2EAWA 3UXDA 2PRHA 4O1CA 1EX5A 2DZWA 3M7WA 3G22A 2NX1A 3GNNA 3ANYA 3LCXA 2X30A 3NL3A 3NQGA 3FLUA 3N9SA 1G7VA 3C2EA 1WBJA 1JQVA 7TIMA 3V1PA 4ZZ9A 4WXYA 2H3BA 4O17A 1QOQA 4N9BA 1AW2A 1ZJIA 3DFQA 4JTFA 1SUXA 4JTHA 3P82A 4AMAA 2JKEA 4UUIA 3W1LA 3TJLA 3F1QA 3QQ1A 3ABQA 2NUYA 4O53A 3P67A 1OFPA 1XCFA 3LLDA 1ME8A 4JEQA 5K9XA 5AC7A 3UD6A 4BI5A 3BARA 4CQAA 2V2HA 4AXKA 3MYOA 4Y90A 3STFA 1OFAA 1L9WA 3L68A 2CZ5A 2DZVA 1TSIA 2Y63A 2CZFA 4N6EA 1SR9A 2BLEA 3G1VA 2EHHA 3OVPA 5D38A 4EOUA 1H7WA 1FBAA 5AHNA 3W84A 1OX6A 1JR1A 2AQWA 4O19A 2ZRYA 1TTIA 3BLFA 1JCLA 5KITA 1QPQA 3E02A 4RV8A 3GR8A 5D03A 2YSWA 5HQEA 1PE1A 3W7IA 1YPIA 1TJRA 4OV9A 5I3FA 3DBPA 3M5VA 2ATSA 1IXPA 3HGRA 3N9RA 2A7RA 5KZEA 1Z44A 3HPSA 1KBJA 3CEUA 3HG5A 2G5WA 3MUXA 2WQPA 4X22A 4XTDA 3RLUA 2FQIA 1PHWA 1DVJA 2YDAA 3C61A 1K03A 1SQ7A 4XBKA 4O18A 1IXQA 4AEOA 2WKJA 4KWWA 3HBLA 1LLZA 5F2IA 2V82A 3EX6A 3IGXA 5G2HA 1RVGA 1I8JA 3KVKA 4LS0A 4LUJA 1QCWA 2EF9A 1JJKA 1GQNA 3VFLA 3LOTA 3T44A 5HJLA 4IUOA 5F4XA 3DHFA 5D2YA 4ZQOA 5HINA 2GOUA 2WSYA 1FQ0A 1XL9A 2QAPA 1N7KA 1H62A 3S9YA 3DZ1A 5HUOA 4YCPA 1YXDA 5G4EA 1Q6QA 2C3ZA 3ZWSA 1JCYA 3EX2A 1Z42A 3I7RA 3W2NA 1DQXA 1OX5A 3S0CA 2KZHA 4NJGA 3R13A 5F2GA 1F74A 1G4PA 3ZR4A 5EPDA 3HOJA 1L6SA 3SGUA 3LHYA 4N4PA 4UFMA 3W1RA 4AWUA 4UMAA 4JTEA 5KZDA 1RR2A 3DU0A 5HWNA 3ELFA 2NXHA 3IGSA 3FOKA 4NZFA 2YCEA 3VE9A 4UFJA 4K7VA 3U2OA 2JKPA 4Q33A 5F2MA 1YXCA 4UXDA 1HTIA 2DZUA 3S5NA 4I7UA 3R12A 3E12A 4JX6A 4N9CA 1UUOA 1BTMA 4O52A 4S1FA 3P5YA 5EA9A 2B0MA 3DKJA 1I2OA 2A85A 3IVTA 1A5SA 3W70A 1EUNA 2VXNA 4OE7A 3DHDA 5LNWA 3KXQA 3PB0A 3LCLA 2CLEA 3W75A 2FPVA 1CX9A 3BG3A 5HWMA 1YYAA 3B0VC 4POCA 2CW6A 2JGQA 3PBYA 2A21A 3CEPA 4EVZA 1NF7A 3P84A 1I4NA 2FFCA 2I1OA 3M5YA 4JTSA 4CLMA 4NT0A 2I14A 3BW4A 2JKAA 2E68A 4CNOA 5I3IA 2NX9A 3A24A 3R5EA 4GJ1A 2BTMA 3MP5A 4QSHA 1K3UA 5LKYA 1VS1A 4RXGA 2WPBA 4N2YA 4TIMA 4FNRA 1QPOA 3F4WA 4AHOA 2WOQA 1G7UA 1WA3A 3SY5A 2QAFA 2ZQ0A 1FWNA 2ZRWA 4NNBA 4OQVA 1SW7A 3RMJA 4K7YA 3SI9A 1H60A 3PUOA 3HGJA 1LYXA 2C14A 4X9SA 5CPOA 5HMSA 5CG7A 4UFLA 4O0KA 1F7BA 2E5DA 1AK5A 3RF9A 5K9CA 4JTTA 5FEPA 3AJXA 1OF6A 3CWNA 5D09A 4IXHA 1SO4A 5TIMA 1TV5A 5SWUA 3DFSA 2WNZA 4JX4A 4CQ9A 5HULA 1B3OA 2QJHA 4TO8A 3NGJA 4AVFA 4CCEA 3EWZA 3W7LA 4JTUA 1R2TA 3LB0A 2HSAA 5HUPA 4JGDA 4TU1A 4DEFA 4IQLA 2O7QA 4OHQA 4OV4A 1HO4A 2Y7FA 1FDJA 1FCQA 5LHFA 3W2LA 4EF8A 2CLIA 4Z0JA 5DBUA 1O94A 3NR0A 3GDTA 3O07A 2VEPA 1D9EA 2R91A 4GUFA 5F1VA 2ZTKA 1IIHA 1SZNA 3M5ZA 5U7SA 4WD0A 2QCCA 4GBUA 1YDOA 3QW3A 4JICA 1RPXA 1DHPA 3HB9A 2DZSA 3W07A 3IIVA 4O57A 1TIMA 3O06A 2GVGA 3KRUA 4C1KA 3I7QA 5DXXA 3KVLA 1SFLA 1CW2A 3IVSA 4MZ8A 4Y6GA 4ZMGA 4K6AA 1EP2A 4AF0A 1P0KA 3GXTA 3TSMA 1Q45A 5AHIA 1QFEA 3EKLA 3S5OA 5ABTA 3LCFA 1VCFA 4I9AA 3MW7A 5K4ZA 1VH7A 3UY7A 4LV4A 2JK2A 3GAYA 2YFNA 2Y7EA 4RZ5A 1H7PA 5BRBA 1CI1A 4JYDA 3QRHA 5C6MA 1W0MA 3WJWA 5U4NA 2TSYA 1OJXA 3A22A 3CB8A 4RR4A 3H55A 4O12A 3PSWA 4Z08A 3W3OA 4HPXA 3PVFA 3DAQA 3GKFA 1W5OA 4CCDA 3P7YA 3TMLA 3KOFA 1EUAA 4O11A 1FWRA 3W72A 3W22A 1KM2A 2GUUA 1UASA 3HG3A 1TV8A 1X7FA 2ALDA 3GYEA 3W76A 2OMAA 1E51A 2LLEA 4H4IA 3TW6A 3G8RA 4KFPA 3M6YA 4UTMA 2GVLA 4HIBA 5D2XA 2NUWA 2QUVA 2R14A 1YTEA 1EPXA 1OYAA 2FLIA 3G18A 1ALDA 4R53A 2X1SA 2DP3A 3KVMA 3IIPA 2VFDA 3U6WA 2Y7DA 2C0AA 4NZJA 4MY9A 4O13A 3OVQA 3VCRA 3LRLA 3HO8A 2H3DA 3TJXA 3HJZA 3PBUA 1W3NA 3TIMA 4A3UA 5A5WA 3BG9A 1QDSA 2VC6A 4K8HA 4JYFA 3QMRA 1VJIA 5CKSA 1DOSA 3CM4A 1JCNA 2QCDA 3TFCA 2GPTA 3GX9A 5DXYA 2QKFA 3UWZA 5AHFA 4MLRA 4YL2A 5HR6A 3NQ7A 3THQA 1PV8A 3LXCA 2ZTJA 3W1MA 3DGRA 5LGXA 2CLMA 1KLZA 4G1KA 1XKYA 4BWLC 4XWUA 2R8WA 2A4AA 2B4GA 2VFFA 3W7JA 4IPJA 4WQ6A 1G67A 3NEVA 3W2JA 4LT9A 1HG3A 1AW1A 2Q8LA 2C16A 2F7FA 2HS8A 4A22A 4PA8A 4FNTA 5J5DA 4FO4A 1JQXA 3CU2A 3LXAA 5G2IA 4PL1A 3WJXA 3OG3A 2E6DA 5FF7A 1IF2A 3THAA 3G3MA 4IJBA 3W83A 3TCEA 1TPUA 1O5XA 1HUVA 4MIMA 1NVMA 1OFDA 5AC8A 3NZRA 3M44A 4PCFA 1SW0A 1A5BA 1LBFA 3B8DA 3E0IA 4UTJA 4AB4A 2NWRA 2V81A 5IBXA 2ZZ5A 4PODA 4YMZA 3LCGA 1RZMA 4IX0A 1K8XA 3ATZA 4OBTA 1AMKA 1FDZA 3NOEA 3CHVA 3BG5A 1D3GA 2XN2A 1MXSA 5CPNA 3CTLA 1SPQA 5CZ0A 1DORA 2C15A 4IXXA 3FEMA 4O4WA 1VGAA 3G1FA 2EKCA 2OZ0A 1M7OA 3INPA 1JULA 3PG8A 3B0UX 3A23A 1I2QA 4O1BA 1R2SA 1VCVA 3O16A 3A9IA 4K36A 4LS1A 4LY8A 3GNDA 4WY0A 1X6UA 2IQTA 4ORMA 3DXIA 3MBFA 1K02A 2J88A 5K2ZA 4UTHA 4Z1DA 2ZYFA 3B05A 3QFEA 2A2IA 1T0OA 4BI6A 3KFTA 1P5BA 2NXIA 2FPYA 4IMFA 3QW4B 1OYBA 3TV8A 3N34A 3RLVA 1EIXA 4L4LA 4LUIA 1LRTA 2ZZ2A 3T55A 3NQ8A 1W31A 4JTGA 1LDCA 3W1TA 1EP1A 1WXJA 1R30A 5CZTA 1WBHA 1H5YA 2QDGA 4RZ4A 4QJ1A 1EEPA 5C5YA 1LTDA 3QQ0A 2EGZA 5F4SA 1PIIA 1KM6A 4TMCA 1IXOA 1WAUA 3EXSA 1V7YA 2Q3OA 2WNNA 3B06A 4L4MA 1X1OA 4CNNA 1KBIA 1H51A 2P10A 1W5QA 4HHPA 4FX6M 3NM3A 2F84A 4BWLA 1SFJA 3LM7A 1K8ZA 1ME9A 3L67A 3L21A 1JUKA 5G5IA 5AHLA 4JY8A 4AF0B 4GNJA 4GUJA 4N02A 5K4XA 3LV6A 3R2GA 5F4WA 2PRMA 3STEA 3RNDA 1H1ZA 2G97A 4WJEA 4YXGA 3C4UA 1MEHA 1H50A 1T99A 2FPTA 1KFBA 3OHIA 2ZRUA 4KFOA 3FA5A 4XKYA 5EKYA 1ZAIA 4KFNA 3LRKA 3PUEA 1JCJA 1PCKA 3GR7A 4NJKA 3L0KA 1MEIA 2NLIA 2QCNA 1OFRA 2V2DA 4UNKA 3S1WA 3CWOX 4NU7A 3EWUA 4JD4A 3L5AA 2V9DA 4ZL1A 3P60A 1GYLA 1RV8A 5G2WA 3NXFA 1FCUA 3BGJA 1OK6A 2Y62A 1MO0A 1H7RA 1SZEA 1G4TA 2A7NA 2Q3RA 4M5PA 5H91A 3VE7A 2BX7A 2BSLA 1I45A 1OG0A 3IVUA 1VLWA 3G1DA 5EMUA 3GDRA 3P74A 3GXPA 3GVGA 3QH2A 5F1UA 3L0NA 1HO1A 3W74A 2WO5A 1WX0A 2Y85A 3W1AA 4GUGA 3STGA 3A21A 3GK0A 1GPWA 4I7WA 3W6YA 5FEXA 2J24A 2QJGA 3OIXA 5D02A 4O15A 4RX0A 1JVNA 1L2UA 3KRSA 4JIPA 3G1AA 2YW4A 3MBDA 3PG9A 3GDKA 3WJZA 3O1NA 5CZJA 3L5LA 5AB3A 5K3VA 2J9YA 2ZDRA 3NPUA 1VHCA 6TIMA 3I68A 3MWAA 1K8YA 3R89A 3TU9A 1QWGA 4FEZA 1KFEA 1PCWA 5DELA 2C18A 2DZTA 3JS3A 2JBMA 2QCDB 2Y61A 1KW1A 4CQ8A 1XDLA 4FNPA 3PWAA 2GQ9A 4J9JA 5I3HA 5L6UA 3LTYA 4HN4A 4MY8A 1GWJA 4FXRA 3LHVA 2QCGA 1OK4A 2PCQA 3KX6A 1R2RA 3JR2A 1IXNA 4JR5A 4UCGA 3Q58A 3TK7A 1X1ZA 1THFD 2ZBTA 1QPRA 4PH6A 4QIUA 1F6PA 3TC6A 2C13A 3SECA 1W3TA 3NL6A 4RK8A 1WOBA 2J6XA 4NXSA 4GUHA 3DI0A 5FI8A 4UTWA 3VI2A 4MYXA 1TPDA 4LRTA 5KMYA 1OFQA 1YXYA 3IIZA 3KHJA 1MSSA 3EX3A 3PC0A 2G96A 5BMWA 3B0PA 3LCIA 5TQLA 1AL7A 4O28A 4JIQA 3C56A 4IX2A 3T7VA 3CQ0A 4RLIA 3OBKA 2E5CA 4BFAA 1KM4A 4OT7A 3FYPA 5IM51 2BXVA 4GXMA 4O14A 1KLYA 1SZGA 3M47A 3OEXA 3LTSA 4HPJA 2E6FA 3K30A 4CNPA 1DJQA 3EEGA 4FXSA 4ZVJA 5EL1A 4N4QA 5D37A 4QITA 1K7XA 3B4UA 3R8RA 5CZSA 4K37A 3HGSA 4ADTA 1XBVA 3LHTA 2FB2A 1UJPA 3T78A 5GVJA 5AFDA 1S5VA 3M16A 2ZCGA 4AHQA 1KA9F 1LOLA 1GTEA 1TPC1 4GUIA 1TJPA 4XQ6A 3DH7A 2CFFA 2OX1A 3S6DA 5EBUA 1U5JA 1YDNA 1ZFJA 4A29A 1DKWA 1TPB1 1YPFA 2Z2UA 2J9XA 1JUEA 2YYUA 4WY0B 3QZEA 3TC7A 2VEKA 3GIYA 3N2MA 4EWND 3DKLA 4O16A 4UTKA 1JCXA 1C8VA 1T8XA 4AHPA 2DZXA 1F2JA 3OVRA 4LOCA 4K38A 3N73A 1FWWA 3STCA 4I7VA 5D04C 3UNDA 5LGZA 4MJZA 3TA6A 1M5WA 1A5CA 2W79A 1WDWA 4YCOA 1QMLA 3L9CA 3ZS4A 1KM0A 2YX0A 3P61A 3FKKA 3W1PA 1W8SA 1TYGA 4NXKA 1Q3NA 5C2XA 3M43A 3ZFHA 1VRDA 1KFCA 2CLHA 2VEMA 2X16A 2HS6A 4K39A 1G4EA 3LCWA 3IGUA 1GVSA 4MZ1A 1LM1A 1YDVA 2FB3A 1BWLA 2RHGA 2FTPA 4PC8A 1YLVA 1S3HA 5LSMA 1W1ZA 3AO0A 3MP4A 3EX1A 1OFOA 4FIQA 1H7XA 3NQMA 4UC5A 2YR1A 2E1DA 3CC1A 1KTBA 1TPEA 5FF0A 3LBMA 5KTLA 1OVDA 5D33A 1OYCA 5IBXC 4MKNA 5I3GA 4DF1A 4PEKA 1NFBA 2E6YA 2E77A 5EYWA 1VHNA 4P61A 1RQBA 1O95A 3WK1A 5DY2A 2ZRVA 2PE4A 2X1TA 3PY2A 1ZENA 5D32A 5FESA 1ZHAA 2WV8A 3UWWA 6ALDA 5D2TA 3CIWA 1G6CA 4UR8A 3EWYA 1RQHA 3GLCA 2YFOA 4UIOA 3NPWA 3RFAA 2ISSA 4LS2A 2QCEA 4LVFA 1H1YA 4NX0A 1XDMA 5H2ZA 3N14A 4PL2A 4RKAA 5CPMA 4JDYA 3LRMA 5D05A 3G8EA 3W7KA 4RXFA 1I2NA 3MJYA 3LHZA 4WOQA 5EY5A 2CLFA 3EKZA 4LW7A 1NF0A 4ZQCA 1LRQA 3QMTA 3BO9A 3G0UA 1DV7A 3HF3A 4E2DA 3S8HA 1Z48A 4FIRA 2Z6JA 5J5RA 3TXZA 3W7GA 4DBEA 2VENA 3PS7A 4MFDA 1VC4A 5HR7A 1FDYA 5L9FA 3TMQA 1J2WA 4M19A 1UBSA 1Q6RA 4ZQNA 3BLEA 4BR1A 2ZA2A 1EWEA 3QMSA 3S1UA 2TMDA 3TW7A 1GYNA 3TE9A 1H7NA 1B4EA 1KM5A 2R94A 4DXVA 3LBCA 3S42A 4TR9A 3ABSA 4JS3A 2G95A 3HG2A 2FDSA 4WXZA 3M5XA 2H8ZA 4Z1BA 1WOAA 4GE8A 3WK2A 3M1ZA 1TQJA 3YPIA 4IGHA 1MEWA 3TQ0A 1GG1A 1N55A 1VQTA 1IGSA 2H6RA 5I3JA 4XUGA 1I2PA 1TPVA 4NUWA 3PULA 3IEBA 2YYTA 1ME7A 3LHUA 1G4SA 3W23A 4GFSA 2WJZA 4KWVA 1KV8A 1TO3A 4DPPA 1O4UA 3G3DA 1P4CA 1X8FA 4JTJA 1WV2A 2Z1BA 2QEZA 4E0CA 3NNTA 3LTPA 3ABRA 2PURA 1SZFA 4MLJA 2VOMA 3D0CA 1M7PA 2AAMA 3KVJA 1WYIA 4RJEA 1ONRA 1ICSA 3W88A 2GJNA 3I7SA 3O63A 4E38A 1F05A 3RU6A 5D2WA 4IPIA 1TPH1 5HNRA 4JX5A 4O10A 4UFIA 1HFBA 1ICQA 2J27A 3KRZA 2ZA3A 3P62A 3DENA 3L65A 4ALDA 1ZAHA 4HSOA 4HNTA 3P8JA 5DN1A 1VPXA 2NZLA 3JRKA 4MFEA 1LZOA 3C3NA 1DBTA 2VKZG 2Z6IA 3S1XA 3PF3A 1TPFA 2RFGA 3UZJA 3MYPA 3ATYA 5LZLA 3O6DA 3NM1A 1SW3A 2ZZ4A 1EB3A 2C6QA 1W37A 4LVDA 3S5YA 3FJ6A 4M6QA 4JTLA 4QAIA 1K7FA 3W85A 1SSGA 4RCXA 3QPYA 2AGKA 1FXPA 1XBXA 4R34A 1EWDA 2FJKA 5AHEA 1GEQA 3TQVA 1WQ5A 2RDWA 3W7CA 3P5ZA 3VKJA 3CIXA 2VFHA 3IIOA 1XUZA 1TTQA 4MPQA 3MHGA 5HWJA 1FCBA 3HMJG 3HPXA 3FKRA 2W6RA 3L66A 3VNDA 4JXCA 3G0XA 4LVGA 4QNEA 1XM3A 1TTJA 4O4VA 5DCBA 4TX9A 1GJPA 2DJXA 2V0TA 1L6WA 3H54A 3L5MA 2V5LA 3P8IA 4XZ9A 3LI0A 3IIXA 5AC6A 3NQ6A 4BI7A 4D2JA 4QM1A 4HNVA 3I65A 4FNSA 3W2UA 1XI3A 2GVJA 5AYZA 3PUDA 4OWGA 1SSDA 1SU5A 4XBSA 1U83A 5DBTA 3PR2A 1GVFA 2PC4A 1H63A 4AAJA 1YTDA 1OFBA 4B5NA 2H90A 3USBA 2ABAA 1XC4A 1XUUA 4YLWA 4UFHA 3TQKA 3W7OA 3CT7A 4A21A 1RD5A 3U8GA 1O60A 2P1FA 3T40A 3CLMA 1W5PA 1GTHA 3LXBA 3SR7A 4CCCA 5K9DA 4M6VA 5G1YA 5LNUA 3UPWA 4WZHA 2RDTA 4UFKA 2V2CA 1VYSX 5FF3A 4M6PA 4IMCA 1QNVA 3QEZA 4WOZA 4UTWC 3W7QA 2D73A 1VYRA 1QR7A 1ZNNA 4JNMA 4MOZA 2ZFAA 4DO4A 3EXTA 1LCOA 5E0KA 3W1NA 1NEYA 1Q6OA 3MP3A 5BNKA 4JN6A 5CSSA 3BPWA 2YW3A 3BK0A 4FX7A 1AG1O 2Y6ZA 1A53A 3W87A 2OJPA 1PHQA 5AYXA 1D3HA 3S1VA 4AH7A 4ORIA 3S5ZA 3NVTA 4Y9AA 2Y89A 3W1XA 1F6KA 3FIGA 1ML1A 4E2BA 5BOOA 2RH9A 3EWXA 2H8XA 1T96A 4C1LA 1F76A 1VLIA 2Q8ZA 3W2KA 1GG0A 4LVBA 1R47A 4UMCA 3NA8A 5A8GA 1L6YA 3CPRA 3C2FA 4OU1A 1YTKA 1HL2A 3QSRA 4ONVA 2VEIA 3MHFA 3GB6A 4QQ3A 3EWBX 4EIVA 1S5TA 2X1RA 3Q37A 2GQAA 2Z0IA 5DLCA 3I6RA 3DFNA 3NL5A 4IOTA 3KAOA 1G69A 4O54A 4QISA 4LWWA 5FF2A 3NDOA 2ATMA 3MO7A 4GRSA 3W1UA 1W54A 1K7EA 2ZZ6A 1J5TA 1DJNA 1ZAJA 3GAKA 3NL2A 4O1AA 3MI6A 2ZZ3A 1LLWA 1FWSA 3WJYA 1TPWA 4H6KA 1OFEA 1M6JA 4IMEA 3T4CA 4WX2A 4H3DA 1W56A 2YXGA 4JDBA 4LRSA 4IMGA 2ZRXA 1Z41A 2ISVA 1SO3A 1XBYA 4WY0F 3DFOA 3PAJA 4ICNA 2A0NA 4UTIA 2PRLA 3W2MA 4GWEA 2Y88A 3W7NA 4X2RA 2P0OA 1W5MA 2ISWA 1B57A 2XFWA 3NYZA 1F73A 4Q4KA 2RDUA 4O1DA 3W7RA 1OX4A 1Q6LA 3SZ8A 5BW6A 1KFJA 4NQ1A 1TRDA 4R7JA 3SGZA 1H61A 1TV7A 5G1TA 2NXGA 3SJ3A 2FIQA 3TKFA 3C0JA 3PM6A 4Q32A 3NQ2A 1LOQA 2O7SA 1KTCA 3BLIA 1KV5A 2VFEA 3GDMA 4MUZA 5F2LA 1UCWA 2NUXA 1LOSA 3W73A 1ZCOA 1GOXA 2ZRZA 3O6YX 5CGQA 4UTLA 3UWVA 3LX9A 3MI2A 3PBWA 5LNSA 3BVJA 2QUTA 2YZRA 2ABBA 1LORA 2Y70A 4Z1AA 3IV3A 1AW5A 2OT1A 3LDVA 5G4WA 3E49A 3C2VA 2VFIA 2CLKA 3P80A 2C1HA 3G1SA 3G1XA 2ZA1A 4A2RA 1VYPX 1GVQA 3Q94A 1BWKA 4HT3A 1NAL1 1LRNA 1EP3A 4O0ZA 4DF0A 3FFSA 4PFMA 1TRIA 1KM3A 1IIGA 3FJLA 1JUBA 3SW6A 4UTUA 1QOPA 4HNNA 4LTSA 3WK3A 2E6AA 1A5AA 4X3ZA 4UTTC 3C2OA 4N9EA 3WK0A 4LV9A 3UQNA 3C8FA 2Y7GA 2XN1A 3SSJA 2WSRA 3C52A 3GDLA 2CZEA 3IRDA 1SO6A 3F4NA 1OF8A 1PS9A 2CWNA 5DCDA 5K7JA 3V75A 3NQDA 2J9ZA 4DELA 3UY8A 4AWTA 3NZ1A 1V5XA 3TAOA 2NWSA 2GJLA 1JRCA 4Z0SA 1B4KA 5AHMA 3TX9A 1GZGA 2EPHA 2QCHA 5E93A 3A5VA 4A2SA 4LVAA 4N6FA 3FS2A 3NQCA 3B03A 4QNWA 1ZY9A 1DL3A 3NQEA 3PBVA 3QYQA 2A5HA 1W5NA 3E9AA 4DF2A 1XFBA 3QSTA 1QAPA 3LHWA 1TREA 4BF9A 1F5ZA 2WNQA 3UZ5A 2JGYA 3TROA 1S5WA 3W71A 5T26A 1UB3A 5KINA 1GVOA 4Y8FA 4LC6A 3QC3A 2VELA 4IWWA 3TNOA 4LNYA 1QPNA 4ZQRA 1XXXA 3W7DA 2TYSA 4MVAA 1JCMP 2CLLA 2B7NA 5DY3A 2V5BA 2ZZ7A 5KSWA 2RKXA 3UXAA 5FF4A 3TSBA 3O6CA 2YPIA 3TDFA 4RZ6A 1PL9A 4NJHA 1R46A 3LV5A 3GKAA 4JTIA 5AN7A 2HTMA 3NAVA 1FUYA 4FX8A 3E96A 5LNVA 1GVRA 2C19A 3DFTA 5KZMA 1SO5A 2QR6A 4N9DA 3W7HA 3H53A 1TB3A 1ZALA 1KM1A 3LERA 5AYYA 3UWQA 4Z1CA 1VR6A 4JTKA 4HNUA 3LCHA 1PVNA 4U28A 3UWYA 2DU2A 4S2CA 4DO6A 4FNUA 4UNLA 4LU0A 1LBMA 4NX5A 3TAKA 4TMBA 3BW2A 2V8ZA 5C55A 3G1HA 3HGOA 1O5KA 4DPQA 2QCFA 4XKYB 3LLFA 4NJIA 4MYAA 2HMCA 3EB2A 1LBLA 3BW3A 2A6LA 3BV4A 4MJMA 2NV1A 3QPZA 3TH6A 4Y96A 3NG3A 3GZ3A 3UPBA 4NJJA 1J4EA 3ABOA 5LHEA 1BKSA 3PB2A 3G1YA 5CPLA 1VCGA 2WSQA 1I2RA 2OT0A 1YADA 2A6NA 3UYCA 5AOUA 4UTTA 3W86A 1FCVA 3L2IA 5CSRA 5DCEA 2VFGA 4NVTA 3O15A 4K8EA 4LC8A 4GC4A 3MHUA 4XTIA 1BEUA 1B9BA 3HIJA 5D30A 5D2VA 1TCDA 2TRSA 2QJIA 4EF9A 5BMXA 4FB7A 1P0NA 3SFKA 3L0GA 4MY1A 4AWSA 4IMDA 4R33A 2B7QA 3C2RA 3EWWA 3N2XA 3B04A 3W9ZA 2B7PA 3FYOA 4JY9A 8TIMA 4O8RA 4S2BA 3SIZA 3NQAA 4OGZA 2DORA 4NNCA 4JYEA 3DFPA 1KFKA 2UV8G 4DO5A 2TPSA 3TR2A 3M9YA 3NPVA 5LNRA 1XBZA 1TQXA 5I3KA 1C9DA 1JRBA 4KKXA 3WJSA 2QCMA 4YWIA 2BZNA 5C54A 4FHAA 3UWUA 4HKPA 1ADOA 4ML9A 3ZWTA 3QM3A 4ADUA 1FWTA 2BWGA 1EA0A 3W7EA 3HG4A 2A7PA 1QO2A 4ZQPA 2A1YA 3GXNA 3NQVA 4M7TA 1OHLA 4MZYA 2DJLA 4U4MA
chains in the Genus database with same CATH superfamily
2PA6A 1LP6A 1F8IA 5A1AA 3URAA 3T09A 3ZT5A 4EAMA 4AD1A 2CLOA 1EDGA 3T8LA 4KW2A 1TMHA 3VX0A 4IIDA 3F03K 4QGCA 1FXQA 1N8FA 4MKVA 5A6BD 4QJ5B 1AL8A 5FEWA 2V30A 4DHGA 5A3HA 2EPKX 3HQ1A 2D0HA 5FEZA 3O05A 4Z2JA 5C0QA 2X1UA 4PTNA 1OCQA 3FJNA 2E1WA 5E0FA 4QROA 3QVQA 3MUAA 3L7RA 3N3MA 3MMTA 2JALA 3QJAA 3WEOA 2V69A 2GDUA 4GXWA 3AXIA 3WNLA 1E40A 3SCQA 3NQFA 2VDIA 4ZQMA 4FNQA 3N19B 4D1JA 3RAOA 5I23A 5MHBA 2QCLA 4EP8C 3BGGA 3W1QA 2QUMA 3VGGA 2Z7GA 3CBWA 1AJ0A 4HGXA 3UXDA 2PRHA 3KBNA 5J8LA 2WVSA 3BQ6A 4LAMA 4ZSUA 4J3WA 3ANYA 3NQGA 3N9SA 4H9VA 1FFQA 3WY1A 3CV6A 3OQ8A 3V1PA 1X97A 4ZZ9A 1MW2A 4WXYA 2H3BA 3VIOA 2WKGA 1C93A 3PZOA 5C9ZA 3S2NA 5ABFA 3VIJA 1KC7A 1ONEA 3P67A 3LLDA 1ZJHA 3N13A 3EMCA 3V0TA 5JXQA 1P6BA 4CQAA 4CQCA 4Y90A 4C6BA 2VL4A 4UCFA 3CHFA 2DZVA 2XVGA 4Q8PA 5EMYA 4C90A 4C7FA 2CZFA 4N6EA 3O6AA 2F8QA 4FLSA 4RPPA 4QHRA 3OVPA 5D38A 2IKHA 4LBSA 3P2VA 3VOFA 1TTIA 4S3BA 3E02A 4RV8A 5D03A 2YSWA 1J5SA 3IGHX 3TYBA 4G7EA 1PE1A 1YPIA 1W32A 5BZAA 5H8PA 1MVYA 4JTDA 1IXPA 3KOXA 2UY5A 4DWSB 3WDRA 1W9PA 1ZSXA 4H9MA 1Y65A 4MHBA 1UIOA 2YZ5A 3BCFA 2YDAA 3U7VA 3C61A 1SQ7A 4XBKA 4O18A 4F9DA 1VBRA 2FGBA 2NQ5A 4AEOA 3FAXA 4Y9OA 3B8SA 3EX6A 3IGXA 5G2HA 1XYFA 3KVKA 4JQ2A 1E6ZA 1JJKA 1QWKA 4IFKB 5TD4A 3VFLA 1IZJA 5F4XA 3DHFA 5FJIA 5D2YA 4L6HA 3VIFA 4BS0A 3DFYA 3LZ5A 3U2CA 3IJIA 2OYKA 3AQUA 1N7KA 2W66A 2OG9A 3VILA 3M0IA 4J2PA 4D6EA 4W87A 1XIDA 4AC1X 3B8WA 1H41A 1NFPA 3ZWSA 1JCYA 3ZVHA 2G37A 5E0CA 1YRRA 1ZS2A 2W63A 4ATDA 3KBJA 2KZHA 1W9VA 3ZR4A 1HL9A 4ZCWA 3HOJA 2WSPA 1HKWA 3W1RA 4DXKA 1UD2A 2YCEA 1XIFA 2A3BA 1R3QA 4GH3A 3PTKA 1R86A 2QF8A 2ZUTA 1YXCA 2YA2A 3ALFA 2Z25A 3ITXA 4L4OA 4I7UA 3S5NA 4JX6A 4EWJA 4S1FA 3P5YA 1LL7A 4E8GA 2A85A 3IVTA 2VXNA 2ZWYA 3KXQA 3PB0A 4INFA 1FWIC 1KBKA 1YYAA 1RP9A 4POCA 3SRKA 4AZCA 3PBYA 1N82A 3AI0A 4EVZA 3MCMA 2Z1SA 1I4NA 4QG6A 2I1OA 4JTSA 3BW4A 2JKAA 4FXJA 1JZ4A 2E68A 2HK1A 4AD4A 4X63A 3BOXA 3VNIA 3OG2A 2AQOA 3TYCA 2FZNA 3GDBA 4JNYA 4GJ1A 3WQVA 1ZBVA 1K3UA 2ALRA 1XR2A 2NW0A 4GY0A 3AHTA 4FNRA 1QPOA 4LUSA 3N2CA 3J7HA 1PIFA 2QAFA 3CL7A 3I3EA 2ZQ0A 1FWNA 1Y5WA 4NNBA 1SW7A 2WJEA 3SCVA 3UR2A 1GHSA 3WYZA 2J7DA 4XO6A 2Y8VA 2FMNA 2RDXA 5CPOA 5HMSA 5I79A 4UFLA 4IIHA 4Q7BA 2E5DA 1AK5A 3MPGA 4JTTA 3AJXA 1XSIA 1V6XA 3CWNA 1CXFA 2QW5A 3M4HA 3B9NA 1HX0A 2W5FA 3DFSA 1GZ1A 3VMPA 4TTGA 4TO8A 2XIQA 4JKMA 2ODOA 2E40A 2VZOA 4CD5A 1VFLA 4NKCA 4TU1A 1MFVA 4H8UA 2J13A 1PKYA 2O7QA 4IQLA 4Q4RA 1HO4A 1FDJA 1BXCA 1FCQA 2CLIA 3S4TA 2R91A 3TZNA 1ITQA 5U7SA 2QULA 4JICA 1RPXA 2DZSA 4M29A 3W07A 3IIVA 3IUDA 1WE5A 5ABFB 2ZXAA 1GOQA 4PRTA 2E8YA 2PPGA 3KZSA 4Y6GA 4AX6A 1EP2A 1P0KA 3GXTA 3CAQA 4PUJA 3L4VA 1P0EA 3Q4DA 3F5KA 3S5OA 3QV7A 9RUBA 4I9AA 3MW7A 3ITOA 4PTMA 3GAYA 1ODZA 4UOQA 4ZA0A 2WMGA 3OA5A 1HVQA 4QCEA 5BRBA 1CI1A 1J6OA 1HVXA 1IEVA 1P6WA 1BG9A 4XVEA 1ADDA 1CXEA 2PDFA 4Z2GA 3W3OA 3S5SA 4IIEA 1TV2A 3DAQA 3KHDA 3WBEA 4CCDA 1TR9A 4G7EB 1EUAA 3W72A 2CIPA 2GUUA 4CU8A 3GIPA 3HG3A 1X7FA 1AQFA 4AIOA 1V0NA 3W76A 1XYLA 1E43A 4H4IA 4B9YA 5JIWA 2DQWA 2ACRA 2YDQA 3HV9A 4TV5A 3KS6A 3TW6A 3G8RA 1OEPA 3OU8A 5D2XA 2EEXA 1JF6A 2R14A 1DXFA 1TA3A 1YTEA 1EJTC 3G18A 3SCSA 1LUCA 1E9IA 2BHYA 2ZUVA 3IIPA 2VFDA 2WVUA 2C0AA 4WF7A 1M04A 2ACUA 4LALA 4MY9A 3SQLA 4UQBA 3OVQA 3VCRA 3ZO9A 2XFRA 1E0TA 1XW8A 2EPNA 1W3NA 5A5WA 2OYMA 5C9UA 3PWIA 2EKGA 3BG9A 4K8HA 1UD4A 3GX9A 1TZ9A 4PBEA 1L6FA 3ZVHB 1XIEA 4YL2A 1EBGA 3NQ7A 4F48A 5C9WA 2ZTJA 2OXNA 1AJZA 2YOCA 3DGRA 5A8QA 3KOYA 5LGXA 2BOFX 1XRFA 5FJJA 8XIAA 4LFYA 1RHCA 3QXBA 4X0NA 2B4GA 3LEPA 4WQ6A 1E9ZB 1G67A 2ZUWA 2VR4A 3H7RA 2Q8LA 2VHLA 4A22A 2HPIA 1BGGA 2VUYA 1F3XA 4FO4A 1UKPA 3F5LA 3SJNA 2BOGX 1IT7A 2E6DA 2NSOA 2OZ8A 3G3MA 1WP6A 4MIMA 3CUIA 1QI4A 1GVIA 5CG0A 1XLLA 1FTXA 1LBFA 3B8DA 3E0IA 4AZCB 4IFOA 2OO0A 2PP1A 3KP0A 1RSCA 4QEHA 4PODA 3R58A 3LCGA 3ATZA 5LIWX 1AMKA 1ODUA 3BG5A 1FVPA 1GKRA 4F2BA 1EOKA 3MSGA 2V6AA 3ECQA 4LEQA 1VGAA 2W67A 2EKCA 4LUSB 1M7OA 3L4XA 2Z24A 1I2QA 4H9ZA 2VX4A 5H6HA 1Z89A 2HXUA 1J8VA 2IQTA 1XS2A 4ZE4A 1K02A 4WIWA 3WLOA 4BI6A 3PJXA 1P5BA 2NXIA 1J0KA 3FXGA 4V28A 3N34A 2OODA 3RLVA 3N12A 2OWCA 3QHMA 3T55A 1RALA 1YX1A 1W31A 4JTGA 4D6FA 3WLPA 1AQHA 1R30A 3GXFA 4QJ1A 1EEPA 3UESA 2VEFA 2EGZA 5F4SA 2G0WA 1T8QA 1CYGA 1DPMA 2OTDA 1W1IE 4G2DA 3VGFA 3K4AA 3TR9A 5DMNA 4L4MA 4U2YA 4CNNA 2PZ0A 1V6UA 3EMQA 4NY2A 2P10A 1W5QA 4LUYA 3M0YA 4P7NA 4BWLA 3C86A 2GSJA 3TONA 1K8ZA 3L21A 4FOJA 1CGWA 4JY8A 4OZOA 4GNJA 4GUJA 4HTYA 1RA0A 4MTVA 2DPEA 3H2AA 2VP8A 1OGBA 2ZRUA 2ESCA 5EKYA 1BHGA 1PCKA 3FSUA 1JI2A 4NJKA 1RA5A 2GVYA 4PMJA 2V2DA 4UNKA 3S1WA 3UZYA 4JD4A 1D8CA 3V5CA 4MWAA 4FZIA 3SRDA 4W85A 2R1NA 2PTXA 5G2WA 3BUVA 2Y62A 5E9XA 4XKMA 2CBUA 4JFSA 2A7NA 1M03A 2R1LA 1YE6A 2BSLA 1I45A 4S3CA 1CTNA 4LCSA 3TVAA 3UYIA 5EMUA 4PUNA 3AISA 4PMOA 2W3ZA 3QH2A 1BF6A 3L0NA 3U5UA 1HO1A 4BQ4A 3E0LA 3N4AA 1WX0A 2Y85A 2ZOXA 2FZ9A 1TA3B 3PWGA 5T8GA 1MNZA 4H83A 1LUCB 2XZ9A 4TOQA 1JFXA 4TVCA 1L2UA 2D3NA 3WLLA 7ODCA 3G1AA 3MBDA 5BXRA 2O9PA 1Q6DA 3CAVA 1KWKA 5CZJA 1LWJA 5K3VA 3GIQA 1JYNA 3AIQA 3FSTA 5HANA 1ZL1A 3LLXA 4RPQA 2D0FA 1A5LC 2XJ7A 1RBOB 4ATLA 3AFBA 1KW1A 4CQ8A 1XDLA 1IZCA 2OYLA 3NZQA 3VYLA 4Y7EA 4J9JA 3B0XA 3LTYA 4HN4A 4MY8A 3LPPA 1HJQA 4LF1A 1EZWA 4H7VA 4QSFA 4B4FA 4HOWA 3N9KA 2C13A 3MUY1 3SECA 1W3TA 3APYA 3NL6A 4PE8A 1WOBA 4HCLA 1AMYA 4UTWA 4MYXA 1TPDA 3HPAA 8CGTA 3KHJA 4LX4A 1Q4NX 5EGRA 3B0PA 3DC0A 5TQLA 1AL7A 1SJBA 4JIQA 3C56A 3CQ0A 3UA3A 5I78A 2E5CA 4BFAA 3QGKC 3FYPA 4LYKA 2BXVA 1B1YA 2PAJA 3LM3A 2WLYA 2P3EA 3K30A 4TVDA 4FXSA 1B3WA 3KWSA 3B4UA 1GNXA 3CK5A 2O9OA 4ADTA 4PUDA 3OZYA 4KWOA 1HF6A 1HJUA 2HVOA 3ARSA 4NG3A 1K9DA 1XP3A 3L2MA 1M7XA 3PZNA 4NZ3A 1CB2A 1TPC1 1AUSL 3H4XA 4B5VA 3KCOA 1OGSA 2CFFA 2OSWA 3WQWA 4NYYA 1XC6A 4BEQA 4XISA 3QZEA 1NWSA 2YL8A 3N2MA 4AZHA 2P0IA 4UTKA 4FA3A 1JCXA 5M17A 1GW9A 4KPLA 4DLFA 1NQKA 4I7VA 3WFLA 5CLTA 1VPQA 3TA6A 2ISFA 5LIKX 3POHA 1WDWA 3K1DA 4MB4A 4YCOA 2IMRA 3BAJA 1JI1A 3SFWA 4LH8A 2A3HA 3CQKA 2YX0A 3FKKA 1EJRC 3ZLGA 1D8WA 4A05A 2D2HA 4PUMA 3VD3A 3ZFHA 1KFCA 4D1IA 4AMCA 1LM1A 1YDVA 2FB3A 2YJQA 2I16A 1QOXA 3CPUA 1S3HA 1D7FA 3EX1A 2EQDA 1OFOA 3WQDA 2AQVA 3CC1A 3LBMA 3V18A 4AISA 4GY1A 3QLLA 1OVDA 4QLJA 4DF1A 3B0YA 1K4GA 1GVEA 4ZO6A 1RQBA 1BTCA 3WK1A 3M64A 1XGZA 3W24A 1VEPA 5D32A 5FESA 1YW1A 1ZJBA 4HZ7A 1ZHAA 6ALDA 3OGVA 5C9XA 2HK0A 3AHZA 3CIWA 2XSXA 4UR8A 4R27A 2VGGA 3OZMA 3D5HA 3WMBA 4MWAB 4LS2A 1CGXA 1H1YA 4NX0A 3MCOA 1RLCL 5CPMA 2PDIA 1Q65A 3HFTA 1QNSA 3KZPA 3MJYA 3LHZA 4WOQA 4FAMA 5EY5A 2CLFA 3EKZA 1LRQA 3W25A 4QRNA 1DV7A 4BJHA 2Z6JA 4PULA 3PZUA 4YVPA 1HXJA 3W7GA 3IAQA 2HRWA 4MFDA 3SN0A 3VGDA 3PZVA 1VC4A 1WPCA 1J2WA 1XLCA 3BLEA 4QG8A 1Q5MA 2QUNA 2W27A 3TW7A 1B4EA 3VTRA 3B8TA 1CLKA 3U57A 5B80A 1BVZA 3ABSA 4JS3A 3SUSA 3WF1A 3AHYA 3II1A 3VCCA 3M5XA 4S23A 2H8ZA 1JFHA 1CNVA 1JPKA 1WOAA 3M1ZA 3MMUA 5FJUA 4XUGA 3PULA 3IEBA 5EB8A 3ZJKA 2DSVA 2XSAA 2J7GA 3G3DA 1ZTVA 3TEVA 3NNTA 1E6XM 1XH0A 4GBDA 3LYEA 2PWFA 3H2NA 3D0CA 2QJNA 4ZBCA 5ECVA 4HQVA 3KVJA 4H2CA 4RJEA 1ONRA 5H8MA 1F05A 5D2WA 5C70A 1TPH1 4JX5A 4DAFA 3VK5A 3TTOA 2J78A 2XPKA 2PDXA 3KRZA 4A6GA 1TJ1A 4WK9A 2D24A 3L4ZA 3P62A 4OUEA 3DENA 3P8JA 3WD0A 3CH0A 5DN1A 1S46A 4H1ZA 3JRKA 2D2GA 4HMNA 1RUSA 4J7RA 2XM2A 2Z6IA 2FVMA 3S1XA 3PF3A 3F4VA 1TPFA 2RFGA 1Q2SA 3QBUA 2PF0A 3ATYA 3TYDA 1O66A 2HXTA 2C71A 2ZZ4A 3GRIA 3I6EA 2C6QA 3QOMA 4LVDA 3FJ6A 4M6QA 4U5KA 4JTLA 4H41A 5I5RA 3CAKA 4RCXA 3OYXA 2AGKA 1XBXA 3ALGA 5AY7A 1R3TA 5AHEA 1GEQA 3TQVA 2RDWA 5LIUX 3W7CA 2E25A 4U3AA 1JG9A 2YCJA 2PLKA 1FCBA 3HMJG 5TNVA 3HPXA 3H2OA 1NDYA 4LVGA 3E2SA 1XM3A 5DCBA 4R85A 4ZB0A 2DJXA 2O9RA 4QXIA 8XIMA 3P8IA 2WJDA 3LI0A 4QEEA 5AC6A 3SRHA 4QM1A 4FNSA 3CV1A 1RK5A 2XH4A 1JXJA 4G1NA 2PWGA 2CPUA 1V0LA 4DZAA 1U83A 5M2FX 1GVFA 1BYBA 4AAJA 3NURA 1OFBA 4MB5A 1WXZA 3SURA 3CT7A 1RD5A 3GC5A 3U8GA 4OFCA 2JEPA 3RCNA 3XISA 5BOFA 1GTHA 3SR7A 1A3WA 4PR4A 5C2CA 5LNUA 2HROA 5CBJA 3OGRA 3EEZA 1QNVA 3MUIA 3CGTA 1W1B1 3K8KA 1W91A 1VYRA 2JEQA 4JIIX 4JTQA 3UZXA 1UZHA 3CIVA 4MOZA 3EXTA 5BNKA 4JN6A 1LL4A 1PO9A 5CSSA 2YW3A 3WQ8A 1AG1O 4U5IA 1VFUA 2A3CA 2J7HA 2X0HA 1AD1A 3AWNA 3FIGA 2BB0A 3IK2A 1HQTA 2H8XA 1TWDA 1PZ3A 3SCPA 1GG0A 4LVBA 5ABHA 1UMYA 1F8MA 1L6YA 3CPRA 1P43A 4Q8NA 3CUGA 4C60A 4NIRA 3QSRA 4KEVA 4ONVA 2WK2A 1NQ6A 1EHNA 1VIZA 5LXXA 1ZU8A 4RZBA 3NL5A 4XZNX 1K70A 3P0WA 1Y7VA 4IHCA 2VCBA 2AKMA 3PPGA 4RNHA 4HA0A 4IIFA 1K7EA 4NZ4A 4QE4A 1K4HA 3GAKA 3NL2A 4UNIA 5D9PA 2VCAA 1UC5A 1LLWA 1FWSA 2E8ZA 4MB1A 1EC7A 2Z2BA 1OFEA 4J3TA 3K5XA 1W56A 4LRSA 3QGVA 1ECEA 2OZTA 1KGWA 2ZRXA 3EDDA 2ISVA 2DH2A 5DF0A 3VNMA 3W6LA 3FV9A 3W2MA 3W7NA 1XD1A 4J3SA 2BY2A 1UZDA 2EG8A 4QDPA 1LQAA 4E5TA 4Q4KA 2WZTA 4F2TA 4O1DA 1Q6LA 3SZ8A 5BW6A 1H61A 1AFSA 4GI6A 3GHSA 2FIQA 4IUGA 5DMYA 3TKFA 1QW8A 5FD0A 2W61A 2W91A 1FH8A 3H70A 3W73A 3MVIA 1GOXA 3UJFA 2DGAA 1UQZA 5CGQA 4UTFA 4XVDA 3LX9A 3NDYA 2I5QA 1O7AA 5MKGA 3PBWA 1M7JA 4JBRA 1LORA 3IV3A 1R3VA 5C9RA 3SEPA 1CZ1A 2OZ3A 4TQTA 3GU9A 3NSXA 3QFWA 3LN3A 3G1XA 2VZVA 3R10A 1EP3A 4AD5A 4DJFD 1FFRA 1A0CA 1WZAA 3FFSA 5FJPA 1KM3A 3LU2A 3FJLA 4BA0A 1KGUA 1QOPA 4IJCA 1M1BA 4ACYA 3FGCA 1A5AA 4X3ZA 3C2OA 3WK0A 3UQNA 4KBXA 4GX8A 5FIPA 2E7FA 4B3ZA 2Y7GA 3SSJA 1ZGDA 3IRDA 2CZEA 1UJQA 4FLOA 5FCZA 4FF5A 2REQA 1VAHA 3V75A 4HK5A 4WCJA 3CAWA 3KW3A 4AWTA 1JRCA 5AHMA 1CGTA 1GZGA 2P88A 1XQLA 4N6FA 3R11A 1IGWA 1HP4A 1RH9A 2O56A 1RPKA 1ZY9A 4Y9PA 1DL3A 5JIPA 1S2TA 3QYQA 4BQ3A 3BICA 4DF2A 4Q8OA 6XIMA 2ICSA 4F66A 4DAIA 4BF9A 1UA7A 2OLSA 3TROA 4CQBA 3APTA 4Y8FA 1GJUA 4B5UA 1S39A 1QPNA 1D7KA 1E0UA 2CCRA 1XXXA 2TYSA 2H9AB 3PTQA 3LQGA 1KGXA 3CXOA 1VKFA 1T6MA 2RKXA 1JGMA 5I0DA 3WUEA 2AKZA 5FF4A 3TSBA 1SFTA 2ZX9A 1PL9A 1DWGM 3H23A 3IJDA 5AN7A 4JEJA 1TVLA 3GW3A 1BXBA 4A4AA 3UF9A 4EXBA 1IV8A 4N9DA 3W7HA 3H53A 4DI9A 1TB3A 2WNWA 3KM8A 4Z1CA 1VR6A 3S9IA 4JTKA 3BOLA 3LCHA 2XIOA 2X1IA 4S2CA 4AVNA 4NX5A 3BW2A 1UKOA 4JN8A 1OZQA 2PBOA 1O5KA 4KH2A 1KXHA 1MQRA 3L4UA 4XKYB 2V67A 3UG4A 3PPHA 2VRJA 2HMCA 3EB2A 3BV4A 3QPZA 4HYWA 3LNMA 3NXLA 2PDWA 3VU2A 1BKSA 1POKA 4CNSA 3U4FA 4B2DA 1WNOA 4NI8A 4U3CA 2WSQA 5I03A 4ICCX 5HMDA 5AOUA 1EJXC 4UTTA 2X41A 5BWFA 1KCKA 5DCEA 1EC9A 4LXFA 1J10A 3O15A 4XTIA 1TCDA 2ZX7A 3TTYA 2VDHA 3OP2A 2POZA 1O6IA 1PKNA 2GDQA 4JHMA 1C7TA 4QFUA 2CKRA 3VDGA 4OGZA 2DORA 5IDZA 3QQWA 4XZWA 3AMGA 2TPSA 2GK1A 4NP7A 2D22A 4J3VA 9XIAA 4KKXA 4ZEPA 3WJSA 3AOFA 2BVTA 1XSKA 1ADOA 4ML9A 3ZWTA 1YNQA 4ADUA 1K9EA 4CCZA 2G3JA 3W7EA 4BQ2A 1JD7A 3O2LA 4YN5A 4L9YA 3W7PA 1HKIA 1VZWA 2YB1A 4OVXA 3RJYA 4DQWA 4BEUA 2QYGA 3GC2A 4P5UA 3PSVA 4FF7A 3BZJA 4CVUA 1YHTA 2GQ8A 3WBAA 2HV5A 5A6BA 2DZPA 4NL1A 1R5YA 4J3XA 3GG0A 1V02A 3TUUA 4NRRA 3LGEA 4ADSA 5CPQA 1FH7A 1KRBC 1DQWA 5MKGB 3QR1A 1ICPA 2PTWA 4LUTA 1W2PA 2NV2A 4DJDC 3NO3A 4IL0A 3RK8A 2ACQA 2VCCA 1AQMA 3WNOA 3M41A 3Q67A 3E0VA 4ROPA 2X7WA 4C6IA 4P2VA 4J27A 4GI4A 3UEQA 2OCZA 1KFLA 1DHKA 3NPXA 1S3TC 1QO5A 3QF0A 2YGYA 3UXLA 4O50A 1C29A 3FGCB 1LJYA 3R79A 2TAAA 5I6SA 1JCTA 2XVLA 4F0HA 1EYWA 2C7FA 2REQB 3DI1A 3WBWA 1HJSA 4M7SA 1RD6A 2RGMA 3M07A 1EQCA 2GFTA 1OZMA 4MAVA 4EKJA 4JL2A 3QPEA 3ARWA 3GM8A 3LCXA 3BMWA 4LAZA 1WBJA 2YBUA 4US5D 5DFAA 1P6CA 1EEXA 2XTKA 1AW2A 5BXTA 3VD4A 4DVOA 4JTHA 4PCPA 4H9UA 5HNTA 2JKEA 1SJDA 3QQ1A 4DI8A 3I4KA 4HHLA 4W89A 1OFPA 1U30A 4I8DA 3NYDA 4HOZA 3UD6A 2Y8KA 4BI5A 2QXWA 3E2QA 5REQA 2GJRA 2CETA 3MYOA 4HHHA 5I7GA 5EMLA 1PSCA 3UGRA 4OKDA 2J7CA 1S38A 3ME3A 1SR9A 2WMHA 1F4AA 2EHHA 4GZIA 3VM5A 5A8MA 3DESA 3GVRA 3SY8A 1JR1A 1BPLB 4L7ZA 5KITA 1QPQA 1GQKA 2QQ6A 1QXLA 1XGDA 1A4LA 1PTGA 1ISZA 2WCSA 3M5VA 4KWSA 2A7RA 3HQNA 1Z44A 4AZ7A 3HG5A 2NVAA 4M81A 3MUXA 4I6KA 1B9ZA 4PSRA 2AMGA 4XSLA 1PHWA 2QPXA 1K03A 1GOKA 1GHRA 4KGLA 4KWWA 5F2IA 2V82A 4HZ6A 3K8MA 4LS0A 3W28A 4LUJA 5A2AA 1QCWA 2EF9A 2ASHA 4C7GA 5HINA 2GOUA 3A13A 4UQCA 1GOOA 4HCDA 1SZRA 1H62A 3DZ1A 1YXDA 1Q6QA 3A3HA 3EX2A 3I7RA 3WEZA 3W2NA 3TJIA 3T8QA 2GK1B 4NJGA 1F74A 3EPOA 1G4PA 3VA8A 1G01A 2L5HA 3SGUA 3LHYA 4N4PA 4IH3A 4UFMA 3N29A 2PCEA 4UMAA 1MDLA 5FL0A 1UD3A 3DU0A 3GZAA 3AXMA 3ELFA 3V36A 3MANA 3UZZA 4HJFA 3FOKA 4NZFA 5B7YA 4Q33A 4UXDA 3LENA 1W8GA 4L80A 2DZUA 3R12A 4I9JA 3IACA 3BE7A 3BZGA 4N9CA 1BTMA 1UUQA 3VDHA 2B0MA 3S3GA 1HN1A 2XVKA 4CN1A 1KRAC 3CMGA 3LCLA 2CLEA 1EF2A 3SUUA 1CX9A 4C6JA 3B0VC 2I5IA 1V3JA 3R6IA 2JGQA 1DIOA 3AHVA 4LGXA 1EZ2A 2FFCA 4LUTB 2Q8XA 4CLMA 4CNOA 3WCZA 2VX6A 4ZO9A 4EACA 1PKMA 1W1PA 4V27A 3LPGA 4UBPC 1QATA 2BTMA 3AS2A 4MM1A 3RIKA 4IJRA 4Y9NA 1VS1A 5JVLA 2WPBA 4AYSA 4N2YA 3F4WA 4GQ0A 1FWCC 1J6PA 4PCSA 2BS9A 3PUOA 4YHEA 5KEZA 2XDFA 3RR4A 4IGSA 4LCRA 1F7BA 3ZJ7A 3RF9A 1OF6A 4OBSA 4U33A 2XWDA 3KUMA 2ZIDA 5AYIA 1YMYA 1XIJA 4H6QA 4UZSA 1Y8BA 4DLMA 3LB0A 3CQJA 3A4AA 2HSAA 3CO4A 4M82A 5JMUA 5CLWA 2WMJA 4R7OA 2Y7FA 3BAXA 3MB9A 2GUBA 4MPKA 1TCMA 5LHFA 3W2LA 4EF8A 3RLHA 7REQA 1O94A 3GDTA 3O07A 1D9EA 1GUVA 3RG6A 5F1VA 2ZTKA 2PMQA 4S3KA 4IP7A 4NASA 2QCCA 3SGGA 1E3ZA 2HE5A 1DHPA 3HB9A 4EX4A 5PTDA 3RO6A 4O57A 2OB3A 1TIMA 2YL6A 1HIZA 4D6HA 2XU2A 2OKOA 2J47A 3I7QA 1DIDA 3IVSA 2BGNE 1XYBA 4AF0A 2BGSA 3TSMA 4FK9A 3JU2A 5REQB 1MZRA 3CTTA 4I5UA 4O0QA 4RW3A 3GHTA 2JK2A 2YFNA 4RZ5A 1H7PA 3BTNA 1GKPA 4EPBC 3QRHA 1W0MA 3VCNA 3BURA 4YJ5A 3CO8A 3AALA 2PWUA 2TSYA 1OJXA 3A22A 4RR4A 2PP0A 2HJPA 1U1JA 1OM0A 5FAJA 4JHZA 4AD0A 4NYUA 4PMUA 3VNKA 4WDWA 3TMLA 1FWRA 1V77A 1HZYA 3WNKA 4J40A 1UASA 2WANA 3V16A 1QRQA 3KLLA 1BKHA 2OMAA 3CL8A 5FACA 6REQA 4IZGA 4HYRA 1CIUA 3M6YA 2GVLA 1CCWB 3EDJA 1DQUA 1VJSA 3QLDA 1W1YA 1ALDA 4R53A 1EGVA 4QTGA 1UD8A 3N15A 3VZXA 2Y7DA 3KEHA 2FHCA 3W01A 2E9MA 1V3LA 2VWSA 4DJEC 3LRLA 1EGMA 2H3DA 1EDQA 3L4WA 3NOYA 3KOWA 4LJ3A 1E6SM 2VC6A 1AH4A 3QMRA 1JDFA 1VJIA 5CKSA 1XISA 1DOSA 4D8AA 3CM4A 1E15A 3TFCA 4Q6XA 3GTXA 2B31A 2QKFA 3UWZA 1YPXA 2V3EA 4M6UA 3MKVA 1XPGA 2BASA 5HR6A 1XG4A 4GOAA 3THQA 2ISDA 2PDQA 3SBFA 2VRKA 1UKQA 2I7GA 1KLZA 3FDGA 4G1KA 5T9CE 3BLOA 1XKYA 4RV3A 4HN8A 4PBGA 1K1DA 2A4AA 4L65A 1UWIA 1XH1A 2VFFA 4IPJA 2FH6A 3KBVA 7PTDA 1OG6A 4PRWA 3W2JA 2C8NA 2C16A 3CUFA 2F7FA 1G9HA 4PA8A 4FNTA 4U31A 1VFTA 3MUCA 1JQXA 2PDKA 2GSHA 1NOUA 3LXAA 5G2IA 3CYJA 1DWAM 1S2UA 1XIGA 1FKWA 3OG3A 4Q8VA 1XQKA 3THAA 2ZDSA 1NVMA 3NZRA 3WF0A 3M44A 4Q3MA 4PCFA 1NOWA 1I1WA 4AB4A 2NWRA 2V81A 3B9OA 1IE7C 3ZT6A 1QK2A 1IEQA 1WB0A 1K8XA 1OQFA 1EX1A 3T9PA 5IHSA 2W4XA 3DEQA 4LAUA 5A6TC 3IARA 4A3HA 4C6DA 5A6AA 1RBLA 5CEWA 4AVOA 1Q7QA 4V33A 4YVVA 1Q66A 1DORA 1KXTA 4W5ZA 3HV8A 4IXXA 3FEMA 2VT0A 4JHOA 3WX7A 3INPA 1JULA 3E1F1 1XRSA 3PG8A 3B0UX 5CZKA 5BXPA 4K36A 4LS1A 3F2CA 4LEFA 1DJYA 1X6UA 2CLPA 2Y24A 3GNXA 5K2ZA 4I6VA 4W86A 3QFEA 1T0OA 1Q4WA 3T07A 3L2LA 2FPYA 3QW4B 1IR2A 1XCWA 3OOQA 2RUSA 4L4LA 2FYMA 3WSUA 1LRTA 1ZJAA 4JTRA 3NQ8A 3E0FA 5M03A 3AYRA 1EP1A 1WBHA 2XFFA 4DJED 7REQB 2HWGA 5E6YA 2QDGA 4RZ4A 1KR0A 1UC4A 1PIIA 1XIHA 3Q65A 2G3IA 1IXOA 3VNYA 4F79A 4Q22A 1C9WA 1WAUA 4DO7A 2WNNA 1UG6A 1QHOA 5E09A 3PZGA 4DM1A 1XYMA 2C79A 4DWDA 3IUHA 1IZKA 4A8IA 3THDA 2F84A 4JQAA 1A5OC 1B90A 5G5IA 5AHLA 4AF0B 3PUGA 4MAZA 4N02A 4ZODA 3A6OA 1SVDA 3STEA 2PDLA 1H1ZA 4HVXA 1T99A 2FPTA 3OHIA 4KFOA 4PMXA 3C5QA 1PX4A 1JCJA 1MDRA 3GR7A 1TG7A 2OOGA 1B0IA 1OFRA 3K46A 3CWOX 4NU7A 3EWUA 4BZYA 2YCIX 3CQIA 3SSZA 5EFFA 3P60A 1CBGA 3BGJA 1OK6A 4XG1A 1MO0A 3WENA 3NTYA 3UR8A 1WKYA 3VKKA 1OG0A 3IVUA 3XIMA 5D9MA 1PZ0A 3P74A 2JIWA 3GXPA 4AIUA 6REQB 4XAGA 1GGOA 2IPGA 4YTRA 3W74A 2WO5A 3STGA 1QBAA 3A21A 1AQ0A 3UFYA 1Q7ZA 3TTSA 3JZEA 5D02A 2DIKA 4O15A 1ISWA 4RX0A 2OQHA 4ZOBA 1E70M 3WD1A 4ZXLA 2YW4A 3GDKA 3GFYA 2GWNA 3L5LA 4ZFCA 5AB3A 3PPFA 1KRCC 2J9YA 4PMYA 3MWAA 1K8YA 1E4LA 1AVAA 3WH8A 3QY6A 2GUYA 5DELA 2DZTA 3H8AA 3PWAA 2UY3A 5L6UA 1MQPA 3BLPX 4UOZA 4FXRA 3LHVA 5GPRA 4QS6A 3AIUA 1L8PA 4UCGA 4YVXA 1X1ZA 3K4WA 1QPRA 1GK8A 2FHBA 4ASTA 1T5AA 3AYTA 4PBFA 1F6PA 3TC6A 2CXEA 4PTXA 2J6XA 3OQEA 3VM7A 2XM1A 1O1ZA 4XAFA 4LRTA 3UA4A 1QI3A 4W5UA 5CPSA 4B5TA 1W9UA 5BMWA 1NY1A 1E1FA 2VJXA 3DG3A 4HNCA 1M53A 4EE9A 1KM4A 1LG2A 4OT7A 1PKLA 4H6RA 3SAZA 4O14A 5HATA 5I2UA 1H3GA 3LTSA 1GZJA 3HM7A 2E6FA 4CNPA 1U1UA 4ZVJA 2DIEA 1DIKA 1K7XA 3I6TA 3R8RA 3VXGA 3BCJA 5CZSA 3V1HA 4I9MA 3HGSA 3MSRA 2AMXA 3PTMA 1UJPA 2VD9A 5C2GA 1XINA 3M16A 4GZ7A 2ZCGA 3BL3A 2GJPA 1PX8A 1XJBA 4GA8A 4GC3A 2NV9A 3WD4A 3V5FA 1LOLA 5XIAA 4J1OA 4S3EA 1PZ1A 1TJPA 3RXZA 1KBBA 5EBUA 1ZFJA 3LY0A 1DKWA 1B3YA 1DJXA 2Z2UA 3VO0A 2J9XA 2YYUA 1I1XA 4V1YA 1E0XA 4TXEA 3TC7A 3PZIA 3IJLA 3WDPP 3GH7A 2NSXA 3DKLA 5FJRA 3ZLHA 2JIEA 4A8NA 1E6NA 4AHPA 4BHYA 2DZXA 3OVRA 1NIUA 3L4YA 5E9AA 2PZNA 5DT5A 1VIWA 4GMEA 5D04C 1LT7A 2XH7A 4LYQA 2QGHA 2ACSA 2FTYA 1M5WA 2W79A 1W3KA 4GYPC 1OINA 3QY7A 1KM0A 4K3ZA 3WBYA 3P61A 4QDWA 5CJNA 1BD0A 2QS8A 3XINA 3EBVA 5C2XA 1MUCA 2O0TA 1J79A 1H09A 3NJ3A 1G4EA 3VDCA 1DWFM 3IGUA 1GVSA 1RY0A 4HCHA 5HNUA 1FHVA 1O1HA 2RHGA 4P7OA 1YLVA 3WF2A 2BV9A 1I9CB 1OT1A 9XIMA 1HNYA 1W1ZA 3VVGA 3AO0A 3M46A 4AIEA 4PEEA 4UC5A 2G50A 2QJJA 3RHGA 3VOCA 5KTLA 1HKVA 1V6VA 4NF7A 4C65A 2BVWA 1FHDA 4MKNA 4AWEA 4PEKA 2E77A 1VHNA 3WMSA 1NTHA 4XIMA 4HA1A 3MDUA 4PUKA 2WV8A 2WHLA 3HPFA 5CC7A 4JIHA 4OIFA 3BJSA 3OYZA 2YFOA 4UIOA 3NPWA 3LPOA 3L23A 2QCEA 4LVFA 3ZOAA 3GC4A 4YTSA 3QV6A 4PL2A 2EBNA 5TF0A 1J0JA 2XUCA 3G8EA 1SMDA 1I2NA 3COTA 1XF0A 5AECA 3N2TA 3BCDA 2VDGA 3TYZA 2CBIA 1UD5A 3N2OA 4PMVA 2PLMA 3DIPA 5J5RA 3WBXA 3TXZA 4DBEA 1KRMA 4F40A 4YS1A 3PHAA 4PTWA 2UZ9A 1FDYA 5L9FA 2WSKA 3TMQA 5HR7A 3VGBA 1EWEA 3T0TA 1KM5A 4I5XA 2ON3A 2R94A 3ARZA 4OOUA 3S42A 3MZ2A 4TR9A 3UW6A 5B7ZA 3R8HA 2G95A 3U2EA 1Z3NA 1XKJA 1SMAA 3WK2A 1K6AA 2IQ0A 2D0GA 1N55A 1MNSA 3ZR5A 1IGSA 3KE0A 5I3JA 4Z42C 1TPVA 4MJ4A 3ZSSA 3LHUA 1G4SA 3W23A 3AZRA 4GFSA 4KWVA 4Q8UA 4DPPA 4GISA 4PFHA 1PX3A 4E2VA 3TLQA 3LTPA 1SZFA 4EPDC 2VOMA 2AAMA 2ZE3A 1EOMA 1ICSA 1HGYA 4JTCA 3I7SA 4E38A 4JCLA 3RU6A 4AEEA 4MDPA 4O10A 5HNRA 3U4AA 1HFBA 2J27A 1XV8A 2DW7A 1IHIA 2ZA3A 4XB3A 3L65A 1ZAHA 4HSOA 1OGGA 4AX7A 2PWVA 3EA1A 4RL3A 1DBTA 3ARYA 4GO9A 3MYPA 3P6LA 5LZLA 4QLKA 4A3YA 1EB3A 3S5YA 2WC4A 4QAIA 4KRTA 1RCXB 4TX8A 1V79A 2X42A 4GIEA 4IPLA 1JPDX 3WLSA 4R34A 2I56A 1WQ5A 5A6JA 3GTIA 3N04A 2PD5A 1XUZA 4KCWA 3KWXA 5HWJA 2EPMX 4EAYA 4MDOA 3RUBL 1ISYA 3RM4A 3L66A 3VNDA 2G3MA 4QQUA 1K77A 4GGHA 3LBOA 1V3MA 1L6WA 4GGBA 2V68A 3L5MA 1XYZA 4BI7A 3BJTA 3GTHA 3NEHA 4YWSA 3KP1A 1XI3A 3WL1A 4IP5A 4BKNA 1SSDA 3PR2A 2PU1A 1N8IA 3MMWA 2PLCA 2VZTA 2H90A 4CGTA 2ABAA 1CXIA 1XC4A 1XUUA 4UFHA 1CT5A 1F61A 3T40A 2WAGA 3LXBA 4C6EA 5K9DA 4XZHA 1OSEA 4IP4A 3UPWA 4M6PA 4CNUA 3FVMA 3UR7A 4UTWC 3V5OA 5I00A 2BOEX 3IJ7A 1QR7A 4FPSA 3UP8A 2ZFAA 3VIGA 1LCOA 5E0KA 1KQZA 1NEYA 3MP3A 3BK0A 1YQ2A 4JL1A 4IPPA 1BYDA 1PHQA 4AH7A 1TR1A 1SJCA 3NVTA 1E9LA 4Y9AA 1UP2A 3W1XA 1ML1A 3FX4A 1J11A 1PYMA 3EWXA 1FOBA 3UERA 2YBVA 4KESA 1F76A 2PDUA 2FZBA 2VR5A 3W2KA 1Q13A 4UMCA 3NA8A 1JZ5A 3C2FA 3IJQA 5GNZA 1JPMA 1V3KA 4UB9A 4GABA 2Z26A 4GZJA 4DXXA 4QQ3A 3H26A 1C90A 1S5TA 1CXHA 2VUNA 3VOJA 3SCOA 5CH9A 4KRZA 1KBLA 1KCLA 3VNJA 3I6RA 3H7VA 3OJGA 3ZQ9A 4GZEA 3WH5A 2DSUA 3VOIA 1G69A 4O54A 4GYFA 1YKWA 4AD3A 4MWAE 4QISA 1AH3A 4LWWA 1F07A 1T41A 3TN3A 3MCNA 3AROA 4QP0A 1ZCCA 2ZUSA 4GRSA 1DJNA 3MI6A 1DJWA 3CLWA 3PBGA 2Y2WA 2VRQA 4H6KA 3AS3A 2D2OA 1OIFA 3RPMA 4C5ZA 3F2DA 3R43A 3LMZA 5DMLA 2YDSA 3GNRA 1H49A 3VNZA 4AZ6A 1XBYA 4HU0A 4UTIA 2DDXA 2PRLA 2XISA 1IEXA 2GGEA 4XZBA 3ARUA 3UG8A 1BGAA 2P0OA 1W5MA 1YE4A 5FJTA 2RDUA 3WQGA 4LAKA 1KFJA 1TRDA 3OW1A 4R7JA 3SGZA 4GO8A 2NXGA 3WLNA 3KTCA 2Z27A 3PM6A 3NQ2A 1LOQA 1KV5A 1IR1A 1XLDA 1E9YB 1UOKA 1UCWA 3TZFA 3DCPA 3ZVIA 4Y8EA 1J0IA 2ZRZA 3A4JA 5DO8A 3H2FA 3UWVA 4XO7A 2FMOA 3MI2A 3STPA 1M01A 4W8BA 3BVJA 4DJFA 2ZE0A 1FWEC 2YZRA 3GHUA 2Y70A 4Q8QA 3LDVA 1UH4A 3E49A 2CLKA 3IJ8A 3P80A 1JEZA 2ZA1A 2NQZA 1GVQA 2QVHA 1E0VA 3Q94A 4HT3A 1NAL1 1BAGA 3ARQA 4O0ZA 3WH6A 4DF0A 4KEUA 4D6IA 1TRIA 3VABA 1J0ZA 3B40A 3APGA 2E6AA 1S2WA 3AC0A 4N9EA 3PNUA 3C0LA 2Z00A 1IWAA 1SO6A 1OF8A 1PS9A 1W3JA 1IYXA 3UY8A 3WMLA 1VFFA 3PANA 5CPTA 3TAOA 4C6FA 4RUBA 3RPDA 2YCLA 3DECA 1WZMA 3WLJA 3RU8X 1MUWA 5CJMA 4LVAA 3FS2A 3NQEA 1UWQA 2A5HA 1BVWA 1W5NA 4GY7A 3E9AA 2AGTA 1Q7MA 1IWPA 2J8GA 2DVUA 1QAPA 3LHWA 1F5ZA 2Z29A 3G5EA 3WUBA 3CV2A 3CZEA 2V63A 1S5WA 4L4PA 1UB3A 4PYSA 1GVOA 3QC3A 2BMBA 3ITTA 4NZ5A 3TNOA 3B8VA 4FXFA 4W88A 1XLKA 4ZQRA 4A3QA 1JCMP 5HQMA 3MKKA 4GLEA 4DM2A 2CESA 1VFHA 3OB8A 1OC7A 4C6KA 2GGIA 4HJWA 3U3HA 1DWHM 3TDFA 4RZ6A 4NI3A 1DJGA 4JTIA 2HTMA 3GTFA 4FX8A 1POJA 1GVRA 2FHFA 3TOYA 3DFTA 2WZMA 3ZXWA 1X8CA 1EF3A 1ZALA 1KM1A 1GJWA 3LERA 5AYYA 4XZLX 4J3UA 1GEHA 4HNUA 1PVNA 4U28A 3SUWA 1Q8AA 4DO6A 4UNLA 4LU0A 2ZWZA 1HKKA 3GXDA 3G1HA 5C55A 3LLFA 4NJIA 3VPLA 4MYAA 4DBUA 2ZUUA 2A6LA 4MJMA 2NV1A 3R7MA 1S2AA 3F7JA 1A5KC 3OLDA 4FLRA 1J4EA 4YPJA 4E6MA 1S1PA 1VP5A 3G1YA 4P7LA 3GE7A 5AKQA 1EXPA 4QCFA 2ZC1A 2OT0A 1YADA 2CHNA 2POTA 4J3ZA 3W86A 1FCVA 1E0WA 3UCDA 5AZ1A 4ZOCA 5CSRA 4NVTA 4K8EA 4GC4A 3MHUA 3FY1A 4CQDA 3D6NA 1XRVA 5AYBA 2MNRA 3MS8A 2TRSA 4A8RA 4FB7A 3BDKA 1P0NA 3SFKA 3RPTA 4MY1A 5D8ZA 4N7QA 2B7QA 4GIAA 3C2RA 2ZUMA 3W9ZA 3B04A 1Q6GA 2B7PA 3FYOA 1TVNA 4JY9A 8TIMA 4PZVA 1VENA 3NQAA 2PFHA 4JYEA 3DFPA 1YEYA 4UQ9A 4DO5A 3M9YA 1H0IA 3CHEA 3K4DA 4KS0A 3NPVA 2G3FA 3TWAA 5I3KA 2MUCA 2OSXA 1C9DA 4C6QA 1TE1A 4JFWA 2O55A 3VUPA 1ZPTA 3UWUA 2INZA 1J12A 2DIJA 1UWAA 3HG4A 4IMAA 4TUFA 3WDQA 4ZQPA 2A1YA 1TIWA 3NQVA 1Q6EA 4M7TA 4MZYA 3O8AA 3CUHA 3EXRA 4E8DA 2E5BA 1GYMA 1TWIA 4DBDA 2E09A 1H7OA 4HZMA 3VC6A 4DUWA 2QPSA 3ORWA 4WUIA 3I3BA 1ONXA 3HPZA 2G8ZA 2A3LA 3UG3A 1LROA 2QDHA 2VC9A 1PBGA 2ZICA 4ZSTA 2DFAA 2QVNA 4HK7A 1FX6A 4JQ4A 5GQBA 3TFXA 2PDJA 2CWXA 4GH1A 3VOGA 3A5FA 3CMFA 2OLHA 3P81A 3TSDA 3LI1A 2OQLA 3ABXA 4DZIA 2NQJA 3WFAA 4Y2WA 2QF7A 3ISIX 4GFIA 4HSNA 3L4TA 3BSGA 4BK9A 5I07A 4KGJA 1W3IA 1G94A 3KRBA 3L12A 3EX4A 4NNAA 3VIHA 2PDCA 4YIWA 5I09A 1GOMA 2B7OA 2EPOA 3VZZA 2FGLA 3BOFA 4MSSA 2ZXDA 5JU6A 3TXVA 2PBGA 2QUUA 2DSKA 1HW6A 3BGAA 1JYVA 3Q2DA 1FY6A 5BRPA 2YCLB 4US5A 1TMLA 5J04A 2IUZA 2EAWA 3IK4A 1OT2A 3TYUA 3G22A 2NX1A 2R1PA 1UA3A 3NL3A 1EQPA 1QNPA 3DG7A 2GWGA 3C3UA 1BQCA 4D72A 3U0HA 5JH1A 1QOQA 3LSBA 3V4BA 4B16A 1VBGA 1OBAA 3DFQA 2BXYA 1UH2A 1SUXA 3P82A 4B5SA 4H8HA 5G1MA 3F1QA 3TYAA 1J01A 2NUYA 1F3WA 3NCOA 2CYGA 4O53A 3SUTA 4RDWA 1XCFA 1ME8A 5CBBA 4W8AA 3GVWA 5AC7A 4IPNB 2F6XA 3BARA 1JIBA 3RM8A 4WKAA 4AXKA 2PEVA 3CHDA 3NFUA 4AY7A 1L9WA 1KXQA 4IGNA 2Y63A 1IEWA 3G1VA 1RXOB 4EOUA 5CC3A 5AHNA 3W84A 3ZYZA 4EPKA 3C8NA 4O19A 4RW5A 4AZBA 3IJ9A 1JCLA 2P8CA 4ZB5A 3GR8A 3U9IA 3WNNA 3WZ0E 2XSBA 4PB3A 3E6EA 2YXXA 1CLXA 1TJRA 1FHUA 4OV9A 4KWUA 1QPKA 2HVNA 4I3GA 3N9RA 4JFUA 5KZEA 3HPSA 4LQ1A 3D47A 1HKJA 4JTAA 4X22A 3W53A 3TTEA 1TE6A 2ADAA 1EA9C 3GU2A 4CEUC 1O68A 3FYYA 1DVJA 4L6DA 1B3ZA 3WH7A 2YL9A 1IXQA 3EGJA 3O3RA 3HBLA 1LLZA 2QDDA 1H0GA 4H01A 5HMEA 3TQPA 4R7WA 1RVGA 1I8JA 4P8VA 1GCYA 4QAWA 4W7VA 1GQNA 3LOTA 5ABGA 3T44A 3SRFA 4MNLA 3CNYA 4ZQOA 4KMQA 2Q6ZA 1FQ0A 2Q02A 2QAPA 4PTVA 1NH6A 1CXKA 1DXEA 4AUBA 4O1EA 5DT7A 1TFVA 5G4EA 3W27A 2GJXA 1Z42A 1OX5A 1S5NA 3N17A 1YIXA 5F2GA 1TWWA 4B15A 2OOFA 5BROA 1QI0A 1TMQA 4PCNA 3F4DA 2INEA 3R4IA 4LYPA 4AWUA 4MKSA 2HZGA 4Q6JA 1MMFA 4EXAA 3LUTA 3VD7A 4P7RA 3ARVA 3RITA 2SFPA 3IGSA 3A47A 4XV0A 3VE9A 4UFJA 2VNCA 3U2OA 5F2MA 4DUVA 4GVFA 1HTIA 3SM0A 1WDDA 2P53A 3GR4A 3SB0A 2VGIA 4GNVA 3RRAA 2WMIA 3E12A 1XLIA 2R1MA 4O52A 5FL1A 5D9NA 4IGMA 4X61A 5EA9A 4QR6A 3DKJA 3E0WA 1KD0A 1A5SA 3W70A 1EUNA 3DHDA 1KR1A 3WDJA 3S83A 3PK7A 3BAYA 3SN1A 3CMJA 5C7HA 2A21A 3CEPA 4FI4A 5C7VA 6TAAA 4F3HA 2XG9A 4NT0A 3WLHA 4JZ5A 3ZJ6A 2NX9A 3A24A 1QNOA 3R5EA 2VQTA 3KL5A 1HL8A 3MP5A 3R1ZA 4HK6A 3N6HA 4TIMA 2PS2A 1HGWA 4AHOA 3ZSTA 3PPCA 2WOQA 1G7UA 1WA3A 3SY5A 3K2GA 4OQVA 2A3AA 4K7YA 3GXIA 4QJ4B 1LYXA 2C14A 3TLLA 4DUOA 4QLLA 3EAUA 5FEPA 3ES8A 1KKOA 1SO4A 1TV5A 5SWUA 3E2RA 4JX4A 1QK0A 5HULA 3TWBA 1B3OA 2ZVIA 4CCEA 2YDRA 3NGJA 2DUZA 5E6ZA 3W7LA 1F3TA 3HFYA 3ARTA 3WQFA 1JDDA 5HUPA 4JGDA 4OHQA 1GPFA 2C1GA 1NFGA 2WZHA 3BH4A 4Z0JA 4X0VA 3NR0A 2F2HA 3EDKA 4GK8A 3E3HA 3S6TA 1IIHA 3H22A 1X1NA 1A47A 2O92A 1YDOA 1R3YA 1WDRA 2BBFA 3KDNA 5H8UA 2GVGA 2J66A 3KRUA 3CQHA 3KVLA 4AY1A 1YNPA 2QGYA 4MZ8A 4ZMGA 3QHNA 3UBPC 3VGEA 2Z4GA 4FSAA 1B5TA 5AVNA 1Q45A 3VIIA 1E6RA 3A3WA 5AHIA 1QFEA 3EKLA 3WQPA 5ABTA 3ZMRA 1SYTA 2X0SA 2FTWA 3LCFA 4P8WA 3AXHA 1VCFA 4M51A 1BVNP 4LV4A 3R8GA 4FOUA 3WNPA 5BYWA 2INFA 2Y7EA 3H6OA 3POCA 4HB7A 1XFCA 3OLGA 4JYDA 3NO1A 5IDIA 3TNBA 4L5ZA 1E71M 1TWZA 1Z69A 3CYVA 1XGEA 2F6UA 4HPXA 2HNEA 4QBXA 2PGWA 3PVFA 5T91A 3P7YA 2O4MA 3KOFA 3W22A 3WQOA 1KM2A 1TV8A 4C7DA 4GCAA 4DIAA 1VBJA 4ZTYA 4LF2A 1LWIA 4C6NA 2LLEA 1FWFC 1DTNA 4O8AA 4KFPA 4HIBA 2QUVA 4REQA 1JD9A 5D4YA 1OYAA 2FLIA 4K1GA 3KBSA 2DP3A 1R3SA 4G6CA 3KVMA 4C6LA 2VGBA 3EKGA 3U6WA 4G56A 4NZJA 2I17A 4O13A 2JQXA 4S3JA 5KETA 3HO8A 3TJXA 3PBUA 3MSYA 3DBNA 5F7UA 3TIMA 4A3UA 5JBDA 4GD0A 2GOKA 1QDSA 4ES4A 1KNWA 3ITCA 1W17A 2HBVA 4PUUA 1DWJM 1RJQA 5DXYA 2XVNA 4AZ5A 2GJXB 3M0VA 5HJXA 5AHFA 4MLRA 1PV8A 2F61A 1DIEA 3BC9A 2E9LA 2YBTA 2J8FA 1CLVA 3LG3A 4XWUA 1PIGA 4UWMA 3W7JA 1AA1B 4N42A 3SCUA 3NEVA 1KB3A 1HG3A 1AW1A 1PTDA 1UR2A 2OLAA 2PGFA 3S2LA 5J5DA 2WMIB 2PODA 4O1FA 4HU8A 3CU2A 4F9JA 4HMEA 3P93A 4I90A 2MANA 4PL1A 3WJXA 2QIIA 3WUFA 5CSUA 5FF7A 3WD3A 2J7EA 4ENLA 1PDZA 3W83A 3TCEA 1TPUA 2XWEA 1PPIA 1HUVA 3FN9A 3VZYA 1JL8A 1UYQA 5AC8A 1V02E 2UBPC 3N25A 3AHXA 3ZM8A 3PJTA 1A5BA 1DJHA 1YDYA 5IBXA 1PUDA 1C8XA 1B3XA 4YMZA 3B3DA 3A12A 5BXSA 4IX0A 1SJAA 3URQA 1X39A 3EOSA 3ENLA 1FDZA 3CHVA 1D3GA 2NT1A 3VINA 3T0AA 1AZ2A 5CPNA 3CTLA 2D2JA 5CZ0A 3UZWA 1BG4A 2E4TA 4AY8A 2C15A 2UWFA 2VZUA 4RE2A 4O4WA 3HQOA 3G1FA 2WWCA 3LK6A 3H2CA 4HMDA 4D9PA 5CAHA 1R2SA 4UQDA 4KCTA 4F0MA 1XG3A 1MRQA 3O16A 5DMMA 1QBBA 7CGTA 1A5MC 2O9TA 4XAPA 2ZADA 3GNDA 1QNRA 4WY0A 4ORMA 3MBFA 1DE5A 4UTHA 4Z1DA 2ZYFA 3AS0A 3B05A 4UOJA 5JH2A 1JZ7A 4GQRA 4DJEA 2J4GA 4IMFA 2GZXA 3TV8A 6XIAA 4CNTA 3DHUA 2ZZ2A 2QV5A 4HU3A 2H9AA 1B31A 4XD6A 3W1TA 1XSJA 5CZTA 2VC7A 3TN5A 4N0RA 4OOZA 1H5YA 5HMFA 4WDXA 3K1GA 1N8WA 1NARA 5C5YA 2YLLA 1KM6A 1A3HA 3FW6A 5GNXA 3H4WA 1GQLA 4GKLA 3AZTA 3FA4A 1V6WA 3EXSA 2WC7A 3T81A 1V7YA 5A95A 1UROA 1KBIA 3ANVA 2R82A 4FX6M 1U2YA 2QT3A 3NM3A 3BLDA 3LM7A 1G5AA 3KL0A 1ME9A 3L67A 2IXUA 1JUKA 3F5JA 5K4XA 4MG4A 4WGHA 3RNDA 4YXGA 3O0KA 2B81A 4MF4A 3WKZA 1KFBA 3OTRA 2BY0A 3FA5A 4XKYA 1ZAIA 2NQHA 4KFNA 3LRKA 3L0KA 1MEIA 2NLIA 1R85A 3UG5A 3I4EA 4K68A 3L5AA 2V9DA 3EOOA 1I60A 1GYLA 2DT3A 2PF8A 1FCUA 3DGBA 4Z17A 3UWEA 3IANA 1H7RA 1RLDA 2Q3RA 5IFPA 3VE7A 4OBRA 1TX2A 3GDRA 1E73M 1F9CA 1WKDA 3GVGA 3H2MA 5FAGA 3GH4A 4JOMA 1Z7AA 4REQB 4B92A 1R87A 1RP8A 1UR3M 1AODA 4I7WA 5HXMA 5FEXA 1B30A 2J24A 4J35A 1MYRA 3QZAA 3UCQA 2Z1XA 3KRSA 4Q4QA 3ZT7A 2EJ1A 2G4FA 3PG9A 1EJWC 3WJZA 3O1NA 4H8NA 4UQEA 3OLIA 2PUZA 1L8NA 2XIBA 1UR8A 3V3WA 2DSWA 1VHCA 3I68A 5FA5A 2PP3A 3TU9A 1KFEA 2W92A 1XPYA 2C18A 2JBMA 2Y61A 3KLKA 1IQ8A 3N6QA 1TKKA 4FNPA 3AJ7A 3RX4A 2GQ9A 3DHPA 3U7BA 2PWHA 1GWJA 4L61A 1V08A 1S1RA 4R88A 1R2RA 1NWTA 4AQLA 1IXNA 2GGJA 4PUEA 3Q58A 3TK7A 1ZZMA 3ONCA </