2ACRA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acrA00
4JTDA 3BCJA 3BURA 1Q13A 4QXIA 1UR3M 1SM9A 3GHTA 3LQGA 3U2CA 3GHSA 3R43A 1PZ1A 4GQGA 2R24A 3RX3A 5HNUA 2PD5A 3DN5A 4JTQA 2PDMA 2IPWA 4GACA 2PD9A 1YE6A 2FZBA 4JQ1A 5LIYX 1S1RA 3EAUA 2PDIA 3WBYA 3V0UA 5AZ1A 2IQ0A 2IPGA 4WEVX 4JIRA 3GUGA 4JTCA 4LB3A 1HQTA 1VBJA 3T42A 3LENA 4EXBA 1ZQ5A 2CLPA 4GABA 4QBXA 1EXBA 3UYIA 1C9WA 4IJCA 2ACRA 2I17A 2BP1A 5JH1A 2INEA 3UWEA 1YNPA 1PWLA 1XJBA 1X98A 4JQAA 4GCAA 2P5NA 1S1PA 1RALA 4DBUA 4ZFCA 2HEJA 4JQ4A 1AH0A 2WZMA 1Z9AA 2VDGA 4EXAA 1Q5MA 2PDUA 1Z89A 2IKIA 2R9RA 3R8GA 4L1WA 4XZNX 4FA3A 3S3GA 3R94A 1ZSXA 2PDXA 2IQDA 4XZHA 2FZ8A 1GVEA 5LIWX 1MI3A 1EF3A 1RY0A 1A80A 1ZUAX 4ICCX 4XVDA 2ACSA 4LAUA 4QR6A 2PDGA 3LNMA 4JTAA 2IPJA 1VP5A 3COTA 3N6QA 4YS1A 3ONCA 2IKHA 1JEZA 2ALRA 3UZWA 3GHUA 3CMFA 4HBKA 1K8CA 2A79A 1Z8AA 4JIIX 1HW6A 3LUTA 1QRQA 3O3RA 3V35A 3EB3A 3V0SA 5JH2A 4LAZA 2IKGA 3M0IA 4PUUA 3H7RA 1IEIA 1OG6A 1IHIA 5C7HA 2PDPA 4Q7BA 3WCZA 2IKJA 3N2TA 4PMJA 1X96A 3F7JA 3H4GA 1Z3NA 4FAMA 4JQ2A 3RX4A 1EKOA 2DV0A 2ACUA 3Q67A 4WGHA 2PEVA 4IGSA 1MRQA 4YVXA 4RPQA 4XZIA 3G1RA 4LB4A 4WDTA 4DBSA 1PWMA 4YVVA 1X97A 5LIKX 5HNTA 3FX4A 3UZZA 4H7CA 2J8TA 4XAPA 4YU1A 5M2FX 4PUWA 2BGQA 3GHRA 4HMNA 1J96A 3G5EA 2QXWA 3CASA 3KRBA 4R9OA 2ISFA 3FJNA 1XGDA 2HVNA 4JIHA 2PZNA 2PDNA 1AZ2A 3M4HA 1AH4A 2PDYA 1QWKA 2HE5A 2PF8A 3BV7A 2HE8A 3VXGA 5AZ0A 4NKCA 3C3UA 4XK2A 5LIUX 4MHBA 3UP8A 2PDHA 4QX4A 1FRBA 2PDJA 2PDKA 4WDXA 3LZ3A 2FGBA 3RX2A 3R7MA 3CV6A 3UZYA 2F2KA 1AFSA 1M9HA 2PDCA 4FALA 1R38A 2HDJA 4JTRA 4G5DA 2HV5A 1ZGDA 4OTKA 4DZ5A 4XO6A 3UFYA 3LN3A 1YNQA 3WG6A 3MC5A 3CAVA 4FZIA 2FZDA 4LBRA 2IPFA 3V0TA 4DBWA 1LWIA 2HVOA 1MZRA 3Q65A 4WDUA 3ERPA 2FZ9A 1EL3A 2WZTA 4LBSA 2INZA 3NTYA 2PDFA 4PR4A 4GQ0A 5LIXX 1YE4A 4GIEA 3UG8A 3H7UA 1LQAA 4XZLX 2IS7A 1ADSA 3LD5A 2I16A 1RY8A 3D3FA 3LEPA 2NVCA 3V36A 4GA8A 2DUXA 3WBXA 4AUBA 3BUVA 2AGTA 4Q3MA 3P2VA 3MB9A 4XZMX 4F40A 3LBOA 1XF0A 4ASTA 2F38A 3B3DA 2ACQA 3R6IA 2BGSA 1AZ1A 4L1XA 1AH3A 3WBWA 2C91A 2NVDA 4WDWA 1T41A 4IJRA 2PDQA 4PRTA 3UZXA 1PZ0A 4JQ3A 4H8NA 1T40A 5DANA 3DOPA 4XVEA 3CV7A 5KETA 2DUZA 2FVLA 3M64A 3CAQA 3EB4A 3ONBA 2PDLA 2PDWA 3LQLA 4WRHA 3QKZA 3R8HA 4XO7A 3UGRA 3LZ5A 3O0KA 4PRRA 1S2CA 4I5XA 1S2AA 5HA7A 2PDBA 2PFHA 1PYFA 3R58A 4YVPA 1US0A
chains in the Genus database with same CATH superfamily
2GSHA 3BCJA 4CD4A 3M0MA 5CZTA 3C2VA 1OSEA 3EWBX 3VCCA 4C6IA 3GO2A 4O10A 3FA3A 1V3KA 1G69A 1J01A 1EDTA 3WF4A 1S38A 3SY5A 4W8BA 4GQGA 1HFBA 3QYSA 2P1FA 3WLLA 5HNRA 1XV8A 4GYKA 1VFUA 2NT0A 4F48A 2VR5A 1LOSA 1S2VA 1J12A 4XV0A 1OX5A 1Z32X 2PDMA 4ENLA 2WNNA 1FHDA 1PIIA 1XISA 4NAEA 4LV4A 4GIYA 4MOZA 3CC1A 5H2ZA 3H4WA 1T99A 3AZTA 3TROA 1Y5XA 1RJPA 3EKGA 8TIMA 3TSMA 3UD6A 4AYGA 1M04A 3WQWA 1W5NA 3S9YA 3WL1A 4CUCA 1MEWA 4ZE5A 3NVTA 1PX3A 4G1KA 3ZLGA 1O60A 3RU8X 1J0IA 3NXFA 3VOJA 4UTWC 2JKEA 2DGAA 2OX4A 3M0XA 2WLYA 3VK5A 2J6XA 4ICMA 4YNGA 5BXSA 5TIMA 1KCLA 2ZIDA 1WO2A 4LAMA 3GS6A 1S1PA 1QNQA 3RU6A 2O9RA 4HJWA 1OADA 4HHLA 4N9CA 4UCGA 3FYOA 2EJ1A 4RNJA 1K1DA 2CW6A 1QOQA 4QITA 3ARSA 3VOIA 4CKQA 2G4JA 2H9AA 3R8GA 2BG5A 3UR5A 2NLYA 2VGFA 4UZUA 5DMMA 4JL2A 4XZHA 4JTUA 1I6NA 4LFYA 4QM1A 2XN1A 4WOQA 3STPA 1MI3A 2MNRA 4Y9PA 1I1XA 6TAAA 3FSUA 3RPTA 2G96A 3TYCA 4YIWA 5JBFA 2XSAA 2R1MA 4G9PA 4ICCX 5F2IA 3WH8A 2WXDM 4LT9A 4QR6A 5C2XA 1OIFA 3F2DA 3N6QA 1CXFA 3ONCA 1CXEA 1K9TA 5REQB 5C9WA 3LV6A 3EEZA 3P67A 1GVYA 2QF8A 4DWDA 5LNSA 2OOGA 3GTFA 2QCLA 1W9XA 1HJWA 1V3MA 2QUNA 3A21A 3K1DA 3N19B 4HIBA 4JKMA 5CEWA 1QRQA 3VE7A 4CLMA 3V35A 4RE4A 4U3AA 5HOSA 1UUQA 4XZWA 4CQ8A 1G7VA 4PTNA 3I7QA 4HPXA 4HP5A 3ZO9A 1EF2A 1I4NA 2P50A 3GNNA 2XM1A 4PMDA 4RXFA 3GK0A 1P1MA 3TKFA 1IEQA 1F6YA 1HL9A 4AD5A 2OZ3A 1ZALA 4FX8A 2Q71A 1H1NA 1PTGA 2QDHA 4RLIA 2EPHA 3ARTA 2XZ9A 1J0ZA 1TTIA 3PTQA 1MQPA 2WCGA 1JZ6A 3BAYA 3OVGA 1O68A 2I9UA 4MY9A 1DE5A 4B15A 2I57A 1PE1A 5M17A 1PZ3A 4NY2A 1GW9A 4Q22A 2PLMA 3WK1A 4I90A 4RDZA 2Y7GA 3NQDA 4JBRA 4R9OA 1QPOA 2PLKA 1EC8A 1F3EA 3TYAA 1M1BA 3M0VA 3G8EA 5C70A 1EP2A 3RG6A 3WLHA 2VEPA 1YKWA 1I0BA 3MMUA 3LU2A 3O05A 3BAXA 4ZB2A 1X1OA 4DHGA 3NQCA 1JCTA 5LIUX 2A3AA 4GJJA 3MVIA 4RPPA 2FPTA 4M6PA 1XLEA 4WDXA 3W88A 1O5XA 1UWIA 1CX9A 3AMCA 3GXPA 1J0JA 2Y85A 3RPDA 3W24A 1F2JA 1FWJC 4ZB0A 2HV5A 3AXMA 4O0QA 3U4AA 4AB4A 3WQOA 1DIOA 3MI6A 3W7MA 2QDDA 1HJVA 3CHEA 4ZR8A 1VYSX 2A3HA 4HNOA 2Z0IA 3TFXA 4K36A 2WMIA 3M9YA 3GIYA 2GGJA 3W74A 3CUJA 2HVOA 1EFZA 1WZMA 1XIMA 4LSBA 2W92A 3WUBA 4JCMA 4A8RA 4Q33A 2E1DA 5LHEA 3KCJA 5D32A 4ZBCA 3OZOA 4MB1A 5G1YA 3AMLA 3USZA 4NX0A 4PFHA 2PC8A 1TRDA 4DAIA 4ERAA 1EBHA 3LI0A 1H7PA 1R85A 2OEMA 1F76A 3MKKA 1LBFA 4UCFA 1TJ0A 4J2MA 4F40A 5G2WA 3MHUA 4LXFA 5EBAA 2X0HA 3F5KA 5CGMA 2EKCA 2ZFAA 4TU1A 1W9UA 4E4PA 2NLIA 3N2XA 2P8BA 4A2SA 4E8CA 1UKPA 4I5RA 2GOKA 1T41A 4I7WA 3TK7A 1EHAA 3PUDA 5I7GA 4YXGA 4DIAA 5AC4A 5DANA 2V5DA 2BMBA 4S3KA 1PB0A 2QPXA 2OYLA 4RCXA 1OINA 4MZ8A 1W1PA 4RKAA 4QHRA 1TE1A 3R11A 3ONBA 3V1HA 3KP1A 1O1HA 4WRHA 3QC0A 4AAJA 5GJNA 1ESWA 3BDKA 3WDJA 3BSHA 3JU2A 2PP1A 1US0A 1AJZA 2VDIA 3I6RA 4BEQA 1G9HA 1PCWA 1GOQA 3B0UX 1UZ1A 3AYVA 1WUEA 4E3TA 5CLTA 2WZEA 1ISXA 2R6OA 4GNJA 2I1OA 2B7NA 4UMAA 1QASA 4FSAA 1K03A 2A7RA 4Q32A 2NUWA 3W00A 4JTQA 1UPPA 4EACA 4J4KA 2DZWA 3UJEA 3LGGA 3OBEA 1MUCA 2XH2A 4Q4OA 3BQ5A 4L6DA 2C18A 4C5YA 1QNPA 3WBYA 3GU1A 1GT8A 4K3ZA 3ANYA 5CJNA 3T1GA 3HG5A 4QLKA 3T6CA 4IZGA 2OKTA 5FJPA 3OPSA 4O0KA 1EJTC 2L5HA 3CJPA 1JDFA 4IP7A 4Q8QA 2Y61A 3UVAA 4U3CA 3WZ0E 2CC0A 1MXSA 5CZKA 5TAOA 1DQWA 1ZQ5A 3UETA 1N7KA 2BOEX 2YBVA 2JFEX 3RFAA 3UYIA 3E74A 1FCVA 3W73A 3FJ4A 3N2BA 5J04A 1WKDA 3BW2A 3C2OA 2TSYA 2CHOA 1QOXA 4M6QA 1RALA 2YSWA 2YR1A 2FFIA 1JR1A 4AZBA 1ISWA 3B9EA 1W9DM 2J27A 1OGSA 2AMXA 2WZMA 2P53A 3OZYA 4NNAA 2JK2A 1WCGA 3PBVA 1DJHA 1PEZA 1RSCA 1DTUA 1NAL1 3AROA 3YPIA 4BF7A 4GIRA 1DJWA 1J18A 2IQDA 2YDRA 3VIGA 1GVEA 1DEDA 4Z08A 1BRLA 1RBLA 1R30A 1LL6A 2D0HA 4ZA0A 1TPWA 4B9YA 1UHVA 2VX4A 3N3MA 4R88A 3G1VA 1R3YA 4QG6A 3VPLA 3EOEA 4O53A 4EPBC 1TUFA 4JTAA 5C71A 4LF1A 1EGZA 4RNIA 3TIMA 4N9BA 3VGDA 1CLKA 2BHZA 4QISA 3OVQA 4UOQA 2NX9A 4I9JA 4JN8A 4Z1AA 3W7LA 3IJ7A 1JXKA 5FL1A 3W1AA 2C79A 3I3BA 5CZJA 2DZXA 4HA0A 4N9EA 1TUXA 1UD6A 4LYPA 3THAA 1QNSA 4DF2A 5C7HA 4LRTA 4P8WA 3MSGA 1AQMA 3DIPA 1DWHM 4RL3A 3B0XA 3T0DA 2QJGA 2WMFA 3WJWA 4FAMA 4QTGA 3GAKA 1ONWA 1UQZA 3BMVA 4RV8A 5C5YA 2QGHA 2J47A 4Q4QA 5BOEA 5GNYA 1AD4A 1TWIA 4DI9A 3IUDA 3SSZA 2DH2A 4Q8UA 4I5UA 1ZP4A 1SGJA 1A50A 4QG8A 3ARQA 1KM1A 2HROA 2OWXA 2OEKA 5FA5A 3RXZA 3UG4A 1KXQA 4B90A 3G8RA 4J1OA 2XN0A 3OGRA 1XBVA 2CBJA 2P76A 4BQ3A 3LSCA 4LVFA 3T0AA 3KDOA 5AYIA 8A3HA 1Q6DA 3QGKC 3QF0A 1HZYA 1GOMA 1OZQA 1UJPA 1F6PA 4LBUA 1Z44A 3MZNA 2CXEA 1EXPA 3L2IA 1TV4A 3M4HA 2Q01A 1TTPA 2CZDA 2CIPA 4DJEA 3AALA 5E09A 3K30A 4O15A 1ZLPA 1U1HA 4FIQA 1AA1B 3K4DA 4CN4A 3GBDA 4B5VA 3PFRA 3VD3A 3PY2A 1SZEA 3E2VA 3P7YA 3O6CA 1ZAJA 2HDJA 4BWLA 4X3ZA 3L0KA 1RXOB 5T9BG 3AMKA 2ZDRA 1SFTA 1V6YA 2UZ9A 5FACA 3EXSA 2WM0A 1LRQA 4C7FA 3VKDA 4ACZA 3V5OA 4IFOA 2WOQA 1QVBA 4ZXOA 2YL8A 1EPXA 1UD5A 1I2PA 4DYKA 1EOMA 4MDPA 1U5VA 2GUBA 4MUZA 1E1EA 4R9XA 3LOTA 2WZTA 5M1TA 4Z0SA 5I07A 4DJDC 5AYYA 3GWQA 4NZ1A 1MXGA 1OT2A 3VAVA 3NQMA 3RMJA 2E6YA 2VQTA 2DZVA 4LALA 4WVXA 3APGA 3H22A 3GH7A 3PWGA 3SN0A 3E0LA 4PTMA 3VO0A 4Q4MA 3WQ6A 4NAFA 4NF7A 1CXIA 5E9AA 3H24A 3KVMA 3REQA 2F6XA 1G94A 3G1DA 3C61A 3IANA 4V2XA 4WY0B 5KZMA 2YOCA 3ZWSA 5C9RA 5DXXA 2EG8A 2ZRVA 4DWSC 4M82A 1EUNA 2H3DA 4KFPA 5I03A 4F9DA 3OB8A 2EJAA 3ZR6A 3OYXA 3WELA 1R2SA 1YDYA 3W6YA 2C91A 3AISA 4J3XA 4WDWA 2PDQA 4OBRA 4ZE4A 4TTUA 1BKHA 2DZTA 1AQHA 4JQ3A 1C92A 3DOPA 1CCWB 1VPQA 4QDWA 4QEEA 3H2EA 4IOTA 3C86A 1VJIA 3R8HA 2FHFA 3UGRA 4BY3A 3O0KA 4DYEA 5CSUA 1AJ0A 4NYYA 1SO6A 4H83A 4DRSA 3RO8A 3PC0A 3VKJA 4OZOA 1FWCC 4ZMGA 2XH7A 5BYWA 4LS1A 3BG9A 5D05A 2GGIA 4M6UA 3KS6A 5U4NA 3KBVA 3GHSA 4LUJA 5FF0A 5A8OA 3SAZA 2B7PA 2I5QA 3TMLA 4UMCA 3UWYA 6XIAA 3U57A 4Q4SA 4GZEA 1H63A 4MKVA 5FD0A 4UFMA 1LUCA 2G8ZA 1L6SA 4KERA 1DJYA 1F3WA 1UZ4A 3S1VA 3WQCA 4KGLA 1UPMB 4UTTC 4Q6JA 3PN8A 2IMRA 1OVDA 5BWAA 1E55A 4IX2A 4W86A 1TQJA 2GGEA 3FIGA 4JOMA 3AIVA 2IPGA 4HMDA 4Q7NA 2Y62A 1YQ2A 4KESA 1V6UA 4PCFA 2F7FA 1JYVA 2EG7A 2WAGA 4GXPA 4CD8A 1UD3A 3OG2A 1E0VA 1JCJA 4NNCA 3XISA 3LLXA 1H0GA 2WZIA 4ALDA 4O52A 1OC6A 1V5XA 1YNPA 3N15A 3CHVA 5AN7A 3VGEA 1UW9A 3SY8A 3P93A 1U1UA 3UZJA 4QS5A 4DJFC 1BFNA 3OG3A 5IM51 5FEZA 3EWWA 1WPCA 3E0VA 3ENLA 3HPFA 1P7TB 1EOKA 2WMGA 3ATZA 2EKGA 2GLKA 4M3PA 3R13A 3UWVA 3UCCA 4HSNA 1J9YA 4XZNX 3QTGA 4JN7A 2DZSA 3IJDA 5HNNA 1TZ7A 4YL2A 4DBDA 5T91A 1GJWA 1XYBA 1EBGA 2ZQ0A 2YW3A 1MWOA 3CZJA 5BWFA 5HR7A 5EGRA 3ZZ1A 3SQLA 1JUKA 4JTFA 4ROQA 3VZXA 4GYPA 5HQEA 5AC7A 3TR9A 3KS5A 2HWGA 3O1NA 4PSRA 3NJ3A 1HP5A 3VM7A 2PDGA 2DSVA 4N4PA 3WN6A 2NSOA 1GG0A 1FUYA 1OFBA 2ABBA 2UBPC 1L6GA 1ISYA 1B31A 1XRTA 1E6QM 5GPRA 3MHGA 1Q6GA 3WEOA 2X30A 3CIWA 2VR2A 3QR1A 5XIAA 1OCJA 2R8WA 4PUNA 3WQ4A 4N2YA 5CC7A 3WEZA 4LS2A 4CVWA 1FHVA 1GQJA 4GYJA 4C1NA 1UOZA 1P48A 3M7WA 4DO4A 2ODOA 2O7QA 1DVJA 4ZO7A 6TIMA 1TPDA 3P5ZA 4WXYA 4JQ2A 4AZ7A 2QCHA 4B3KA 3W1LA 2VEIA 3S9IA 4D6HA 1X39A 1VFLA 4IGSA 2PUZA 4A29A 2C1GA 3RRAA 2ATMA 4NRRA 1EGVA 1G4PA 3S6TA 1DBTA 5C0QA 4LB4A 1RHCA 4R27A 1C91A 1W1TA 4HD5A 4KWWA 2REQB 1OWQA 5HMSA 2ZRXA 1ICPA 1NDZA 1V6TA 3RHGA 2OU4A 2WC4A 2QXWA 3FEMA 1OG0A 1UIOA 3EOUA 4G1NA 3R5EA 4KS0A 5I3DA 4MWAC 2VRKA 4XTDA 3ICJA 2ZX8A 3HG3A 5DQPA 1T8QA 3RCYA 2PLCA 2PDKA 2D2GA 4IGNA 3WL0A 2Z26A 3CTLA 4O54A 4TVUA 1O95A 1OC5A 4XIAA 1LLOA 4LH8A 4G5DA 2RH9A 1P4CA 3DBPA 3TYDA 3A5VA 3LCFA 2Y8UA 3HGSA 1TIMA 2DVUA 4XO6A 3W29A 4A3YA 3TC6A 3QPEA 1BWVA 5CBIA 1LLZA 1ALDA 3GXDA 1UH4A 3WG6A 1HUVA 5CBBA 4XD6A 3CH9A 4WKHA 3GSMA 1ITXA 1PX8A 5F4SA 1U2YA 3AMGA 1MZRA 4TX8A 4EVZA 1F3XA 2GYIA 2PWDA 3AWNA 5D33A 1N82A 3MMDA 5LIXX 2FB3A 4J3WA 1FWHC 1HKKA 3WFZA 1EGMA 1W5MA 2J74A 5A6TC 5B7YA 4EIVA 2W63A 1ADSA 4W84A 1BG9A 3W6MA 3IVTA 4Y96A 4IICA 2WBKA 2BXVA 1O5QA 4MNLA 2D73A 6CGTA 1HL2A 1OYBA 5DT7A 2J7HA 3CTTA 3E6EA 3GB6A 3UPBA 5HMDA 4MG4A 4Q3MA 3NZQA 1F3TA 1B4KA 1YBQA 3U7VA 3G1AA 4NAEB 1IXNA 4ZSTA 1ICQA 1XYAA 4EF9A 5HXMA 4A2RA 1VKFA 3O6AA 1JDCA 3FXGA 3LRKA 3RO6A 3SDOA 1PV8A 4OOUA 4D8AA 4A3HA 2NVDA 4CNUA 2ONEA 1SFSA 5HWJA 1NM9A 5EMMA 3ARWA 5CGQA 2PTZA 1A0CA 2W5FA 3VC6A 4M1RA 1AG1O 1JYNA 2HBXA 2AL1A 3FV9A 1BHGA 1W3JA 1US3A 2OEJA 5ECUA 1EHNA 4RNFA 2BY2A 1W1VA 1YIXA 4J3TA 4ZOCA 3VUSA 4P7LA 1TJ2A 2VHLA 1ADOA 1AK5A 3T0BA 5AFDA 3D5HA 2X1SA 3G18A 3W84A 1E9ZB 3R79A 3E3HA 5DMYA 4FLOA 4QNWA 2TMDA 3PBUA 2J66A 4Q8TA 1XBYA 5CPMA 1PCKA 1OM0A 2E09A 1H11A 2H9AB 4AIEA 3WLIA 4MDOA 5E5CA 1IT8A 1KRCC 4CD6A 8RUCA 2QCNA 3WJXA 2PD5A 1DWGM 1IXQA 3PZUA 2E0PA 4N02A 4OT7A 2A3LA 3PNZA 1KQYA 3EOOA 2ZXDA 3UJFA 2PP0A 4G7FA 3LV5A 4MSSA 1HO1A 1OABA 1RQBA 2PODA 2C1HA 1SZFA 5JU6A 4N6EA 4HN4A 3F2BA 4O0ZA 3V0UA 4I9AA 2EO7A 3OTRA 3NZPA 4CVUA 4P7OA 4M7TA 4ZXLA 3UW6A 4M1BA 1W5QA 3GUGA 1F07A 4HMCA 4FOJA 3BLKA 2BASA 1VBJA 5FF3A 2E8YA 2OWWA 1EXBA 1ME8A 3T2PA 3NZGA 2RJHA 4ZO8A 2B31A 6ALDA 4UFKA 2DORA 3MI3A 1BPLB 2P0IA 4UTUA 1ITQA 3FA4A 3IIXA 3NUKA 4H1ZA 4GUJA 4QJ4B 3DH7A 1J4EA 1H3GA 2CFFA 4DVOA 2VGGA 2ISVA 4UTMA 2BTMA 2HEJA 5HBFA 4P8VA 2DQXA 3H23A 4GRSA 2PWGA 1PPIA 2P3ZA 3WLRA 1XH1A 1F5ZA 2X8RA 5D2WA 1QO2A 3HV8A 4GVHA 4CNPA 1VEPA 5IDIA 1W2PA 5A69A 4NX5A 4C6MA 3MI2A 1A47A 1A0EA 1J10A 1W5OA 3A47A 4O1BA 4ZOBA 4L4LA 2JKAA 3SN4A 3N4AA 3CQKA 4INFA 4GLEA 2O0TA 1SYTA 4NZCA 3CMJA 3LNMA 4JTHA 4W7UA 1XYCA 3V18A 2W62A 2PAJA 2OYMA 3NYZA 4HK7A 2HQAA 4RNHA 3URQA 4ADUA 3MS8A 4HBKA 1V02A 2YCKX 4LQ1A 2GOUA 4QE5A 3P0WA 1B3XA 3EB3A 4E4UA 4LUSA 2XVNA 2GSJA 1GJUA 1OG6A 2VQUA 4YHGA 1XIFA 4LCRA 4WLCA 4WOZA 4UTJA 2VOMA 3WD4A 3RN6A 4N9DA 2FDMA 4V33A 1V6VA 2V9DA 1KRAC 1E3XA 3THQA 2PGFA 5C9ZA 1E72M 2ALDA 2VC6A 4ML9A 3A64A 3F2CA 2WMIB 4I6VA 4KW2A 4LNYA 3W1MA 1LQ0A 4X9YA 4RDYA 3S2JA 3LCWA 2VL4A 2CEQA 1TV7A 5DX7A 4PE8A 3GFZA 3BJFA 3QMSA 5A6BA 4I6KA 2D2HA 3F1QA 2O9OA 1K9DA 3ZFHA 4KCUA 4KCWA 5LIKX 3CYVA 3VIHA 3UZZA 3VNZA 4QEHA 3GG0A 3N4EA 2OB3A 3LXAA 2WVVA 1A5UA 1SPQA 2FIQA 4C6EA 3THUA 3SRKA 4HJFA 4IF2A 4ZB5A 2VC5A 3IGUA 3IS4A 3HJZA 5I24A 2FJUB 2NQZA 2QV4A 4IIGA 1RCOB 2GVGA 1VC4A 3QY8A 3GC2A 1EB3A 1F7BA 1I60A 2G5WA 1EZWA 1A5BA 2PWEA 1VFTA 4H3DA 3G24A 3S1UA 1ADDA 2BXZA 1IWAA 3A3XA 3HBLA 1FWRA 1C8YA 3LZ3A 5BXRA 3U4FA 3SCNA 3R7MA 3GIQA 1O6IA 3K2GA 3M0KA 3PJXA 1CNVA 1HGYA 1OK4A 4Z17A 1BLIA 3NM1A 1W8SA 3VKAA 3SGZA 2QCGA 1EWEA 3AHXA 3PFMA 3HURA 4BK9A 1H62A 2H8ZA 3UESA 3IIVA 1N8WA 1G5AA 6ENLA 3S1WA 3QW3A 4HHMA 4QSFA 1WAUA 3T55A 3DDMA 2MANA 3PTKA 3MSYA 3AIWA 2Z2AA 4XISA 1J6OA 2QHAA 1FHLA 4RE2A 4EP8C 1N8IA 2INZA 2QEZA 5CJ5A 1EP3A 1DV7A 4U33A 4UQEA 3GKFA 4YTUA 2WMJA 3LMZA 2YB4A 3WF2A 1BXCA 1JD7A 3POHA 4CNOA 2E5CA 4L65A 2Y5EA 6XIMA 2G4FA 4ZGYA 1B30A 3QOKA 4E2DA 1WOAA 4WQ6A 2VENA 1OD8A 3WMLA 5LNVA 1B3YA 4GCXA 3OGSA 1XKJA 4PMNA 4H9VA 3BUVA 3H70A 4GQRA 5FJRA 1XLFA 3CHDA 2AGTA 3U2EA 3H2OA 3V7PA 2TAAA 4ASTA 3G1YA 3VGGA 3Q94A 3URAA 4PH6A 3UU0A 1FH8A 1GVFA 4H6KA 4XWUA 2W4XA 1E4LA 7ENLA 1A3WA 3R1ZA 4O8AA 4EPEC 4A6GA 2VX5A 4OBSA 2P8CA 1KFLA 3NSMA 5I00A 5JUVA 4FNQA 2ZVRA 4XVEA 2ZZ2A 4TV6A 4W7WA 2DW6A 1TQXA 4B3ZA 4DM1A 4PB3A 4NSBA 3EB4A 3Q4DA 2ISDA 1ZJHA 3K46A 2FFCA 5DY2A 1XLJA 4K38A 2XVGA 5D8ZA 2C7FA 3LQLA 4FLSA 3QXBA 3W2UA 3C0JA 2YA0A 3BSMA 3F4DA 4NP7A 5D04C 3FY1A 3GM8A 2NW0A 4YVPA 4US5A 2CHRA 3LTYA 1E9YB 3CLMA 5LHFA 4H6RA 3U48A 1XYMA 1XX1A 1W1A1 2POTA 1ME9A 3KWXA 1EH9A 4PYSA 1POJA 4L5ZA 2CYGA 3FSTA 5HR6A 2ZA2A 3WBEA 4S39A 4DUXA 4BFAA 3B8WA 4AG0A 4UR9A 3TCEA 1RJQA 1XPGA 1WDRA 2V3GA 3EMZA 3MV01 3OEXA 4GACA 1YE6A 1NWSA 2FZBA 3B8SA 2HZGA 1ZNNA 5A8PA 1M7XA 3URNA 5L6UA 2NX3A 2CNCA 2NQLA 3E2SA 2YDSA 5AC6A 3PS7A 3UVIA 4NILA 3N3TA 4NI3A 3W7GA 4OU1A 1YYAA 3QSTA 3PJUA 1ECEA 4GD0A 5BOOA 3L2MA 3RR1A 6REQA 3CHFA 3A5FA 4XKMA 4H8UA 4EXBA 2GFTA 4U31A 5FL0A 3S2NA 2F84A 3I3EA 5AHMA 5DRIA 2OO6A 5LGXA 1CGUA 4A3QA 3W7EA 1MW0A 1SZRA 2D69A 1QHPA 3N29A 1EDGA 1EJRC 4K6AA 3HO8A 4M0XA 3A23A 3OIHA 4JHMA 2B7QA 4RR4A 3CQ0A 3WIJA 4YMZA 1R3RA 3KHJA 1U5JA 4BF9A 5A3HA 4NRSA 4KMQA 1R3VA 1W1YA 2YXGA 3W2JA 3NAVA 2QDGA 3FGCB 1O5KA 3WSUA 5BCAA 1KLYA 4GXWA 3G6MA 5IXEA 5REQA 4POCA 1VBUA 3IJ8A 1XCWA 2PA6A 3GXIA 1IZJA 3GTIA 1AW2A 4GG9A 2GSEA 4B16A 3LPPA 4EXQA 5FCZA 4CU6A 1DKWA 1J0KA 5EMUA 1SW7A 5FAJA 3QYQA 3GQYA 1AMKA 1VJSA 1VBHA 3P14A 2E67A 2WSPA 4OVXA 2Y2WA 4S1FA 2BGNE 4KRZA 4FEZA 3B0YA 3MO4A 3U7BA 2WJZA 4PUDA 3UZWA 4O1DA 4GKLA 1K8YA 3VDGA 1Z8AA 3VKKA 1M7JA 3S83A 4HMEA 3MUY1 4O18A 4WR3A 4F66A 1I9CB 3MUCA 2V69A 4IX0A 5CBJA 2W6RA 1ODZA 5I3HA 3SCUA 4AD2A 2QMKA 3WCZA 2PB1A 4AD1A 1UR1A 1RJRA 4ACZB 3UWQA 3N9SA 4PMYA 4Z2KA 2E1WA 7A3HA 2PTWA 1E6PA 4D9PA 4XZIA 3TR2A 1XD1A 3PM6A 4PCNA 2QPSA 2Z1BA 2A6LA 2VFEA 4WDTA 4F2TA 3MWAA 7TAAA 1EIXA 3SUUA 7PTDA 4IMCA 3L12A 4FXJA 5HNTA 3ZS4A 1F6KA 4MKSA 4BQ2A 1TIWA 1EC7A 4NAFB 5EMYA 3VIKA 1E6SM 1TV3A 4O19A 1Q8JA 1UQYA 3W23A 3GVQA 3TWAA 3AU6A 4G7EA 2OQHA 1EYEA 5I06A 4AMAA 3ARPA 5FF2A 2DZAA 3PVFA 1FRBA 3WLJA 1DORA 2WC3A 1SMAA 1Z7AA 2F2KA 3AIBA 3MV11 3QR3A 3PPFA 4N0RA 3LTPA 4JTRA 1RD6A 2GK1A 4CNSA 1V02E 2XIBA 1R46A 3LN3A 2A5HA 2YKKA 4ZL1A 3CAVA 1XIIA 3HGRA 4HQVA 3LTSA 3WFAA 2QJJA 1TJ1A 3SCOA 2IPFA 3FOKA 2HJPA 4L64A 4DBWA 1O66A 4QDPA 3P5YA 2ZWYA 3ERPA 3ITLA 2YCIX 3WLQA 2GZXA 3WJYA 1X7IA 2DSUA 2EPKX 3CXOA 1UD8A 1UKQA 4GVGA 4JFSA 3FK4A 3KZPA 3W9ZA 3CUFA 5EB8A 3V36A 3WQDA 1MUWA 4JAWA 3QSRA 4AUBA 3BGAA 3VMPA 1A3XA 3QR0A 1JUEA 4HSHA 1WBJA 3K8LA 5D02A 1JCNA 1TWZA 3CEPA 5DELA 3USBA 2J8FA 2VP8A 3TQPA 1JRBA 1LZOA 1ISVA 3BSGA 2Y70A 1EX1A 4L1XA 4MNJA 5T8GA 3RLUA 3ZLHA 1LWHA 2PCEA 4IMDA 3W7DA 1H61A 4M19A 2XZ7A 2PE4A 2NVAA 3VX1A 1VEMA 4PRTA 3PPCA 1PZ0A 1R47A 2ZTJA 1JZ7A 1CI1A 1VIWA 2PU1A 2WYSA 4Q7IA 4MPKA 1DXIA 1XL9A 1IZKA 3VYLA 1J6PA 4LUYA 1A53A 1TA3A 3GG8A 5A8GA 1OK6A 4HU0A 1RA5A 1PBGA 2GUYA 2CWNA 4O1EA 2G50A 3ZWTA 3WLNA 4Q8VA 5BRBA 4D71A 1GOWA 1EZ2A 2FZNA 3W6LA 4IPIA 2W9MA 3STCA 2XISA 3JW7A 3Q58A 2ZUTA 4I3GA 5HA7A 3VNIA 1NEYA 3A13A 3ELFA 2OLHA 3SECA 2YXXA 3ABQA 3SFKA 4H6QA 2XH0A 4ZO9A 1V7AA 1FVPA 2R24A 3GU9A 2PCQA 5JIWA 1V79A 3KTCA 4KWOA 5F2GA 3W1NA 1XWYA 1XCFA 3PAOA 3DN5A 4IUGA 4M6VA 4MNKA 2X0YA 1GHRA 2I7GA 3QV9A 4I8YA 1W54A 3D47A 5CKSA 1KTCA 3OQEA 1R9ZA 3SURA 1DIKA 3BH4A 4PMUA 1GOIA 3N11A 3MBDA 2VFIA 4ZZ9A 3QV7A 1MSSA 1VF8A 1L8NA 2G3MA 1O1ZA 3RM9A 2BFGA 4JDYA 2QW5A 5KINA 1UR2A 2OZ8A 3W4RA 1EA0A 2JF7A 1KM0A 2Z24A 2YX0A 3MUAA 3EMQA 3BWWA 5BRQA 3L5LA 4RK8A 4YTSA 2X7WA 3DHPA 4C6CA 3LPFA 1EPVA 4C1NB 1KBJA 4PODA 4JIEA 2A3BA 5HINA 2NQJA 1V77A 3KOYA 5CPQA 3RM8A 4JTLA 1KFKA 4LUTA 3SUWA 4DBUA 1HX0A 4ADTA 4QNEA 4ATDA 1K8ZA 4ORMA 1Q4NX 1WKFA 3DZ1A 5AECA 1OFPA 2XM2A 4YCOA 1QJWA 4S3CA 5KEZA 1KCKA 1XIEA 1HGWA 2WKJA 1BVWA 1NFBA 2NXGA 3V5FA 1E0UA 2PF0A 1XD0A 1FXPA 1IYXA 2W79A 4XAFA 2FZ8A 1FFQA 1RVGA 4RUBA 1OC7A 3VDBA 4HZMA 1EF3A 5HJXA 5AOUA 4C6KA 2AAMA 4AVOA 1EJUC 1YXDA 1DE6A 2FVKA 3H2FA 3EWXA 3AIEA 1NDVA 5GNXA 1XIBA 3L21A 5JMUA 4XAYA 3B9AA 3CWOX 4AWSA 3VTRA 4HYRA 3DBNA 4KRUA 1XKYA 5LGZA 2ALRA 3Q2DA 2PC4A 2DW7A 3KOZA 1UR4A 4W89A 3O3RA 3SJ3A 2YDAA 2Q02A 2X1RA 2JALA 4ZOAA 1QW7A 2EPNA 1V51A 4W9TA 4WXZA 4B2DA 4GC4A 3BLPX 5JBDA 4GZIA 3B97A 4AX6A 1U30A 2ZC8A 5FEWA 3KCOA 3BL3A 4TUFA 1GZGA 4HPJA 1SO3A 3DG6A 3ID7A 2ZA1A 2EPLX 3FJLA 4J9JA 2Z29A 4GX9A 2Q8ZA 2NSXA 2PWHA 5HULA 3SCSA 4R33A 5AYZA 4LU0A 3UNTA 1JF6A 1YXYA 1EJVC 2G95A 1TSIA 4AISA 5DCDA 2YXOA 5CSYA 3TN6A 3B8VA 1R3QA 3SQMA 5EU9A 1VAHA 4HMNA 1LRNA 3AXHA 3K4WA 4AY8A 3LM7A 3CASA 3KRBA 3PZIA 5DO8A 2ISFA 1S3HA 1XGDA 3GZ3A 2PDNA 3RCMA 3KZSA 1FWDC 3GXMA 2F9RA 3WNLA 3W72A 2X7VA 1J5SA 5TNVA 3SCTA 5E1QA 1LWJA 1YBQB 1UP2A 2PF8A 5IBXA 3I6TA 4UQDA 1IEWA 4WJ8A 3EOSA 1TZZA 2ZUUA 4E8GA 1EX5A 1UP0A 1CYGA 1XC6A 2PDJA 3QHOA 3LG3A 4ORIA 2WHKA 5MF5A 3TA6A 1NARA 2OYKA 1TZ9A 2OZ0A 3LMYA 4IT1A 1QCWA 1TWWA 4R5EA 4F0KA 2GQ8A 2A21A 1KBBA 2ZXQA 1KW1A 2W27A 2AL2B 2Y5JA 3G77A 3GH4A 3NGJA 3EKZA 2OZTA 1ZP3A 3GNDA 1OFDA 1XFCA 4LBRA 1P1XA 4JNZA 1BGAA 2PU0A 3SCRA 3NTYA 4LCQA 4TOQA 4QE4A 5TQLA 3UG8A 3ZMRA 5CPTA 1K4GA 1P6BA 3MKCA 1JZ3A 3CB3A 2V5CA 4Z2HA 2W66A 3LD5A 4EANA 2XFWA 4EK7A 1Q3NA 1DJIA 2OCZA 4K37A 3KXQA 3LEPA 3SUVA 2F2HA 1IQ8A 3WBXA 1E4IA 2VWTA 3AHVA 1C93A 3CZEA 1VFOA 4C6NA 1SW0A 1QDSA 3A22A 1XQKA 1FTXA 5ABGA 1EC9A 1XF0A 4AIBA 1R87A 1G1YA 4DBEA 4HHPA 3B3DA 3FKKA 4RE0A 2E6DA 3VNMA 2BGSA 4GJIA 2D22A 4HA3A 4UTLA 3SRHA 1AZ1A 2OXNA 4PTDA 4L9XA 3EB2A 5FSEC 1TX0A 3AYSA 1FHUA 4GGBA 5DN1A 5CAKA 3GU2A 4S3EA 4IGMA 4B4FA 5ABTA 3TJLA 4E6MA 5I77A 3BW4A 5AHLA 1B90A 4FHAA 4H8VA 1VH7A 1MEHA 3IJIA 3MUZ1 3WO8A 3KX6A 2E5DA 4HNNA 3GIPA 5I23A 2DH3A 3P74A 3CYJA 1PKMA 3OLGA 4PULA 5E6ZA 1SFJA 1L6WA 3BO9A 2V2CA 2V82A 1M6JA 2XIMA 3IVUA 4F9JA 1Q13A 2CCRA 4ZQPA 4CU7A 3UR7A 3IGHX 1UH2A 1AL7A 1E9LA 1SQ7A 4JXCA 3GHTA 1WZKA 4P61A 4HYVA 3PUOA 4KKXA 1OX4A 1XLCA 3KDNA 3LRLA 3B04A 2X2GA 4GINA 2DSZA 1GTEA 1LOLA 3ARZA 3QOMA 3VOFA 3DHFA 1XDMA 4S3DA 2BVDA 3SEPA 3ME3A 1TTJA 4UOZA 2XWDA 2J62A 3THCA 4NJKA 1P0NA 1RLCL 4AX7A 2ZUNA 4WGXA 4CCDA 4AC7C 3PZNA 2PTDA 3MO7A 3QFEA 4TX9A 4XKYA 1WQ5A 1Q2SA 1H1ZA 4FR1A 4MZ1A 5FAGA 4WEVX 3T44A 3CGTA 3WH6A 4JY8A 2W67A 4JIRA 3A9BA 3R4IA 3PZVA 4LB3A 3KE0A 1HKMA 2Q09A 1HJQA 4C60A 3H55A 4LUSB 4FXSA 4GABA 2ZZ1A 2ZRUA 1TO3A 3KHDA 4DUOA 5D03A 4ZO6A 1H7WA 4X60A 1CENA 1US2A 4B5XA 1N2VA 4OWGA 3W7QA 1BF2A 4HNVA 1BVZA 4PL1A 5DBTA 4V27A 2H6RA 2CXGA 4Y7EA 1A49A 2PGRA 3IRSA 1Z9AA 4EXAA 1XG3A 4AHOA 3S2MA 1Q5MA 4XBSA 3EX6A 3I65A 4M81A 3OW1A 4R7OA 5CG7A 1NF7A 3FJ6A 3S3GA 2V81A 3HJEA 1XXXA 1G0CA 2J4GA 1GGOA 1LF1A 5ABEA 4CD5A 1IXPA 3IACA 2WSYA 3N4FA 2WVVB 4FK9A 4G8TA 3CQJA 5G1TA 2XINA 4CD7A 3G3DA 4GBUA 1VP5A 2FVMA 2Q3OA 1IWBA 1LTDA 2VTFA 3GHUA 1DWFM 1DJZA 3BG5A 3TSBA 2V6AA 4M7SA 5HMFA 3M0IA 4RV3A 1OB0A 2VXNA 1IHIA 2VCAA 4AXNA 1CECA 1O12A 3NQ8A 3E2QA 1VGAA 4HGXA 2ZZ7A 1BKSA 4FF5A 3NYDA 1NTHA 2OODA 4KIEA 3C56A 2X1UA 2YFOA 1KQZA 3UERA 2VD8A 2DJLA 1XH0A 3FAXA 1QFEA 1GJPA 3IARA 4BS0A 3P62A 3G1RA 4LY4A 4UR8A 1CTNA 5G4HC 4DJDD 4L9YA 4DBSA 1MNSA 3UA3A 3S2LA 4JFVA 3AXIA 4YU1A 2WSKA 1J96A 3UA4A 2V3EA 3VGBA 1JDDA 1H0IA 2PZ0A 1VPYA 2BZNA 4Z1BA 3EDKA 2ZRYA 1AH4A 4BQ5A 3S5SA 4AMCA 1OCQA 1QT1A 2XUCA 1GKPA 3L5AA 1VRXA 4PTXA 4HYWA 3ZOAA 4LEFA 6A3HA 5I3IA 3PP7A 4C6JA 3KTSA 1F73A 3CU2A 4H9MA 2E9BA 4DWSD 4UB9A 3S1GA 2EG6A 4CQCA 1KFBA 4AY7A 3RX2A 3FEQA 3W76A 1ENUA 2WVSA 1RCXB 2DU2A 3CO4A 4OTKA 2VEGA 2XN2A 3GW3A 1JPDX 5LNUA 3WLSA 1QO5A 3HFYA 1S2TA 4UR7A 3WD2A 4FZIA 2BLEA 3CBWA 4DZHA 5CZSA 3HPXA 1NWTA 3V0TA 1PVNA 1LBMA 3QKEA 4RX0A 1HVQA 3NIYA 1FWEC 5TD4A 5KZEA 1M65A 1W31A 1UWRA 1YMYA 4OE7A 2HBVA 1GKRA 2BY0A 4GMEA 3TZNA 3MCNA 3MCMA 2PGEA 4GIEA 3S5ZA 4RDWA 4LVAA 1LBLA 2ZYFA 2QDEA 4AZHA 4D6FA 1UWQA 1ECQA 1G4SA 1RY8A 3D3FA 5DFAA 2Z4GA 3HGJA 3A9IA 1GPFA 1XYZA 3OLIA 1I1WA 2V5LA 5FEPA 1JI2A 2J7FA 4GOAA 4PN2A 5HUOA 1R9XA 2YLAA 1GKQA 3KLLA 1Y0EA 2V5BA 4HK5A 3GVVA 1E1FA 2ZVIA 3HF3A 4GO8A 2F61A 2FTPA 4MPQA 3VD5A 2OGJA 4HPHA 3S0CA 3SM0A 1VLWA 5M03A 3IIPA 1F9CA 3TJ4A 4Y8FA 1A5KC 2C16A 2HCVA 4IIHA 6REQB 1B9BA 3OA5A 3XIMA 3W85A 1GPWA 4PBFA 1IT7A 3ALFA 3AOFA 3CV7A 3GNXA 5KETA 5BU9A 3VA8A 3VIOA 3JUGA 1J2WA 3T40A 4PGLA 2WJDA 5D2TA 5G4WA 3M7SA 2FZMA 1UCWA 3ABRA 2CBIA 2JE8A 1YLVA 2W3ZA 3CWNA 4W5UA 3UXAA 1OCBA 3NQ7A 4JTDA 5XINA 1D7FA 4DJFD 4HPNA 2QCCA 2VURA 3EA3A 2Z2UA 1RR2A 2D0FA 3P82A 1H7NA 4AWTA 2V2HA 2YYTA 3LCGA 3MMWA 5T9CE 1UR8A 2Q3RA 1NELA 4PUEA 3EEGA 4JTTA 1BTCA 4QFUA 4IXHA 1FCUA 1MW3A 1A5LC 3KRZA 3GRIA 3J7HA 3P80A 2QV5A 1CW2A 4PB5A 1QI4A 3F03K 3UXLA 3SCQA 3KWSA 3UXKA 2J7BA 1E4MM 1S1RA 3EAUA 3SUSA 2ANUA 4UQAA 4EKJA 2HMCA 2PTXA 1X1ZA 1CGVA 3V3WA 3N25A 1ONXA 3RLGA 4JPGA 1MDRA 3WK3A 1JCYA 5ABHA 1YDNA 1KTNA 3VFCA 2FB2A 4H9YA 4C1KA 4LYQA 3M44A 3ZR5A 3I3DA 2YZ5A 3TN4A 4PA8A 3DYOA 2D0GA 3N2MA 5JH1A 3K1GA 5C7VA 4AZ6A 1GVRA 2I5IA 1PWLA 1XJBA 2X40A 1XDJA 3VABA 3DHDA 3AHTA 1KNWA 1W56A 5J5RA 3PNUA 1BXNA 1S2UA 1E0TA 3W81A 1QWGA 1TVNA 3ZIZA 4GI9A 1VCGA 3LA4A 3SZ8A 3WLTA 3NPUA 1JNEA 4UOJA 3H2NA 4LOCA 2QJMA 1HT6A 1KD0A 4LWWA 3GX9A 1JF5A 2XFYA 4DJEC 3UY8A 5HK4A 2DPEA 2FGZA 3CT7A 2GGHA 1XDLA 1WB0A 1K6WA 3R12A 3TDFA 4JIPA 2DT2A 4HPGA 4B5UA 1W0MA 1DWJM 1FOBA 5HAOA 4I7UA 4DF0A 3SUTA 2E8ZA 4XD4A 4BWLC 1A80A 1CPUA 1WDDA 1Y5VA 3VKCA 4S38A 2FHBA 2DZPA 1E1CA 3VD7A 2VT0A 5AHEA 1QUMA 4JNYA 3LCXA 2O9PA 4G7EB 4UXDA 3HM7A 3O9NA 5HWNA 4MWAD 1YX1A 4AQLA 3ZQ9A 5D09A 1ZHAA 1JVNA 1JYXA 3CMFA 1QW8A 4ERIA 4JIIX 1H5YA 2QUUA 3FFSA 2V8ZA 4MKNA 1TMLA 5MHBA 3ITYA 3F4VA 4N4QA 3WF3A 1BQCA 4CEXC 4HTYA 1B54A 2GK1B 2PDPA 4GNKB 2QF7A 3JS3A 2PGWA 4O17A 3L4UA 3UJRA 3ITTA 3T2QA 4PMJA 1X96A 3ISIX 1Z3NA 1IIGA 4AZIA 4C6DA 3E9AA 1PHWA 1EJXC 2X42A 4Z1CA 2DV0A 3NDZA 4WHBA 3APYA 3WDRA 1NWRA 4HU4A 2Y24A 1XIDA 3SRFA 1VENA 2WPGA 2Z00A 1OIMA 4Q4KA 3GDBA 2J6VA 3E2RA 1FWIC 4C7GA 1F61A 1I8JA 1V8EA 1HKJA 3M6DA 4GY0A 1Q45A 3L66A 3PUEA 5M2FX 5GJPA 3GVGA 4MADA 1FQ0A 1IIHA 3RUBL 3T78A 4F0MA 3H54A 2TRSA 2P3EA 1XRVA 5CPNA 2ZADA 4OHQA 3KBMA 1OHLA 2Y8KA 4OOZA 4UFIA 1C7TA 3CZLA 5T26A 2CKSA 5A94A 4AXKA 3FCPA 5BW6A 3RAOA 2OGYA 2Z25A 1SSDA 3PZTA 3OZPA 4MFDA 2PDHA 4JTSA 2SFPA 4D6CA 3AIUA 3OGVA 3HOJA 3UZYA 2HS8A 2A6NA 4FALA 4BF5A 4G56A 2XIOA 5L9FA 2PBGA 3W1QA 4WJEA 1D2KA 1W9VA 4FR6A 3NDYA 3UGVA 3QGAC 2OLSA 1E0XA 4JX6A 3TCSA 1TA3B 1ONRA 2V5KA 5B80A 5EFFA 2GWGA 5CPOA 4Y8EA 2BXYA 1RQHA 2QIWA 5CPSA 1LWIA 1B3ZA 3ITGA 4QROA 2X1TA 2VGBA 2OWCA 1HL8A 1JZ2A 1JAEA 4AYSA 4US5D 2PDFA 2W61A 3S9ZA 3O16A 3TYZA 2VRQA 2R1NA 3QQWA 1G7UA 2BVWA 2A2IA 1TE6A 4OQVA 4IG2A 3NZ1A 3AHZA 3PF3A 4GQBA 1G4TA 1WDWA 3SADA 3KFTA 4LYRA 1AUSL 3GYCA 1KXVA 4AF0B 4DAFA 1E9IA 3W7JA 5A8NA 2Y6ZA 3GNPA 3H2AA 1L2QA 1XLIA 3KW3A 3S5YA 3HG4A 1Y5WA 2J9ZA 3WDPP 4HOWA 1X8CA 4GH1A 5FJOA 5I5RA 3PBMA 5F2LA 1NFGA 5AHFA 1D9EA 4LEQA 3W71A 4PBEA 3WUFA 1QK0A 4WSHA 2FYMA 4Y9NA 3L5MA 1H7XA 4Q4RA 1SZGA 2OPJA 2CLLA 1PYMA 1QMLA 4MFEA 2VEKA 3LYEA 2DEPA 1UP3A 1K9FA 3B05A 2A3CA 3U5UA 5CC6A 4PRRA 2FMOA 5K9DA 2XGZA 1EUAA 1OT1A 3KBJA 4AC1X 4O4WA 4LUTB 3GNOA 4NZ5A 2ZE0A 3KM8A 3HZ3A 4DF1A 3KVKA 4GYPC 1ZY9A 4QXIA 1LG2A 4L9ZA 4J5NA 4EWJA 5I3FA 5HQMA 2VEMA 4BR1A 4EX4A 1H60A 4KWSA 2WMKA 1PZ1A 3RX3A 3D6NA 2NV9A 4PEKA 2NQ9A 4E8DA 5A2CA 4B91A 4Q8OA 1VHCA 5D37A 2ZZ5A 1PDZA 1WKYA 3HN3A 5E6YA 2QYGA 3U8GA 5FESA 4H04A 2QT3A 1HKIA 1RA0A 4IPLA 2VC7A 1RP8A 4LCSA 2WSRA 4HA4A 1DWIM 2PD9A 4K7YA 3CWHA 1GEHA 1Q7QA 2WJEA 1V93A 2F6KA 2E5BA 1PUDA 4JQ1A 1WUFA 5G2HA 4ERGA 3ZXWA 4GH3A 4TMBA 3SCPA 5CJMA 3DFQA 3KL5A 4JCLA 4ZQCA 4FOKA 3DEQA 5I3JA 4XAZA 1MNZA 4NXKA 1YPFA 3AQUA 3H2CA 3DFNA 3T42A 3K8MA 3NQEA 2Z28A 4C91A 3E1F1 2VZTA 1Q6RA 3C2RA 4QBXA 4QG9A 1C9WA 1WZAA 2Y8VA 3CAWA 3FDGA 3K8KA 2AKMA 2BP1A 2Z27A 3EWUA 3PWAA 3N2OA 3VINA 3FGCA 1KM4A 3RK8A 3QPZA 2JBMA 4WX2A 3KCLA 3I10A 1Q66A 3G1HA 2G97A 1YHTA 4PMOA 3QHNA 1GZJA 3N17A 2R1KA 4W8AA 4IQEA 3W02A 1RVKA 3U2OA 3DFSA 1MDLA 1I2OA 3GR4A 3PBYA 3KLKA 5EKYA 3WNMA 3UCDA 2VDGA 1HKWA 2UY5A 1Z89A 2BSLA 3TN3A 5LA1A 4PUJA 2W91A 5HDRA 1H2JA 1EYWA 1QNOA 4PMQA 3TP4A 1XQLA 3WK0A 2CETA 5F7UA 4ATLA 2V63A 2G3NA 1U83A 2DQWA 4GJ1A 3SQSA 1RY0A 4PEEA 3L7RA 4UWMA 3SGUA 4KCTA 3IJLA 3W7RA 1NP0A 3P84A 4AVFA 3COTA 3BLLA 1HIZA 2ZE3A 4BQ4A 1ZAIA 1ZCOA 1JPMA 3EYPA 3HQ1A 3ARXA 1KV8A 3VC5A 2QPUA 4GX8A 3CNYA 5DMNA 4H9UA 4K8HA 1JPKA 1E5JA 1K02A 1XS2A 4DXVA 4F0RA 3CL8A 3ZT7A 5DCBA 1SVDA 3S47A 4M51A 1E6XM 3C8FA 4HU3A 3ZYZA 2NXIA 5BNKA 4MGGA 2ZOXA 3RITA 1M7PA 1OZMA 3THDA 2OT0A 2YIHA 2X41A 1ZFJA 4ZQRA 1UG6A 5G2IA 2O56A 5DT5A 1VIZA 3OA3A 1RP9A 2VJXA 4F0HA 4CN6A 1UUMA 1GORA 4DY1A 2QCMA 1PS9A 2TYSA 4YLWA 3OYZA 3BLFA 3TJXA 1XGEA 2WSQA 3SIZA 3H8AA 1NDYA 1SUXA 4JHOA 4OUIA 5AHIA 3OVRA 1HJSA 3MYPA 4C90A 5EY5A 2DSKA 3E02A 4JIHA 1W5PA 2EHHA 5HJLA 1JCMP 1QR7A 3CQIA 3AIRA 3M1ZA 4WJXA 3BJSA 1U5HA 3FVDA 4D8ZA 5AZ0A 2OSXA 1WA3A 4MHBA 1DIEA 3DUGA 2QAFA 1PKNA 2HVMA 1G4EA 3IUIA 1V0NA 3UJ2A 2Y89A 3S2CA 1TWDA 4A22A 1XLLA 1ZGDA 4YN5A 3WQEA 3WMCA 3EWCA 4Z2GA 3M5XA 1PSCA 4KIRA 1UWTA 2P10A 1DQXA 1X38A 3MMTA 4YYFA 5D2VA 1FWFC 2BHYA 2QMJA 1X6UA 3LM3A 3GBEA 1MZHA 2VO5A 3H12A 1QI5A 2VZVA 2B4GA 3WENA 3UYCA 2PSNA 3O0FA 5IDZA 2JGYA 1KTBA 3N73A 4PMXA 3K5XA 2Y63A 4QLLA 2EGZA 4GQ0A 4CQBA 4NASA 3TWBA 3P0XA 4P8UA 4GUFA 2XGBA 2JGQA 1OX4B 4LPCA 3V75A 4ZFMA 4E3VA 1KM3A 4M29A 4CCEA 2ZCGA 1V4YA 2H3BA 3NGFA 2GPTA 3EA2A 4K8GA 2VVSA 3CUHA 3W25A 3VDHA 5HWMA 1TPEA 5RUBA 3SB0A 5ENLA 1ZPTA 2PP3A 3ZSTA 4FNSA 4TO8A 3SIMA 3P2VA 4PL2A 3LBOA 1QU4A 4IL2A 4PUKA 2JQXA 3EOLA 3KBWA 1KV5A 3PAJA 4XKYB 1UWSA 3QBUA 2ZICA 1H7RA 1SO5A 3WNPA 5D4YA 5EA9A 1CDGA 1D8WA 2Y5SA 4ONVA 4IJRA 3AYRA 3OZMA 1E6ZA 2KX9A 3UZXA 3G1SA 1WZLA 3W7OA 4CNTA 3POCA 1QPRA 3QV8A 4K2SA 4J27A 4K39A 5FJIA 2YLLA 4FF7A 3FW6A 2YFNA 4LC6A 3LPOA 1R3SA 1KR0A 1PO9A 1XPYA 3WQ5A 3RMEA 1I75A 1FH9A 5BMXA 1J0YA 1F8IA 5A2AA 7XIMA 4W88A 4NUWA 2NQHA 4K1GA 4KPLA 3GC5A 3U2CA 3GFYA 3ZJ6A 3TOYA 1RD5A 3ZJKA 1AL8A 2ZC1A 1UKTA 1GOKA 2QIIA 1YXCA 3LXBA 3VDCA 2NWSA 4GO9A 5HNUA 3E0WA 4BKNA 3AICA 4FLQA 1XINA 3L67A 1VJZA 3E5PA 2CLEA 2J79A 3PG9A 1EJ7L 4JEJA 5CCZA 3N2CA 2QKFA 1IR1A 3ABOA 3ES7A 2WQDA 3DYMA 2HSAA 3FA5A 5LIYX 2OTDA 2VI0A 3AJ7A 1P5BA 2PDIA 3M0YA 2HXUA 4QJ3B 3RM4A 5H8PA 5EMLA 4Z1YA 3CQHA 2POZA 2VD9A 3GD6A 2PS2A 4L6OA 5HPCA 4V1YA 4REQA 5KITA 1YNYA 3LHUA 2BBFA 4FX6M 1SU5A 2OELA 3PB2A 4KFOA 2MUCA 4US6A 4C6QA 1UA7A 3GTXA 2OMAA 1JIBA 3IIZA 1TX2A 4B4HA 3TU9A 3RLVA 4GWEA 2IXVA 3GR7A 4HNLA 1V3JA 1J5TA 4IJCA 4W8LA 1RAKA 2ZX7A 3TYUA 4J3UA 3WD0A 3M5VA 2GVEA 4S3AA 1CGTA 1RV8A 3BLOA 1TVPA 3NQVA 4J2PA 1E43A 1LYXA 2CPUA 1KCZA 2VCBA 4GISA 1OYAA 2FLIA 3GXNA 2OX1A 4WCJA 3UZ5A 5E93A 1YRRA 3CV2A 2ON3A 5IRPA 4DXXA 5CSRA 1A4LA 3MTWA 3VZYA 4B3LA 3BAIA 2VUNA 3NO5A 3WJZA 3TA9A 2PDUA 1B4EA 2O7SA 3U0HA 4QSHA 1FBAA 1E3ZA 3D0CA 4GVIA 1QPQA 3STEA 1JPHA 3B9NA 1RLDA 4MZYA 2VGIA 2IQTA 5F1UA 5LIWX 2Z7KA 5H8UA 1W91A 1MQRA 3TXZA 1XLAA 1J8VA 1ZB5A 2HISA 5JVLA 3CZKA 3S6OA 1GQLA 3N13A 5DMLA 3RPMA 1KBIA 4LAUA 4KEMA 3MBFA 4LY8A 3NSNA 3AU2A 3L68A 4EOUA 3PBWA 1SR0A 3UR2A 4GKTA 2VM8A 2Y4SA 2FDSA 1TV5A 1MFUA 4RW3A 1XSKA 2J75A 1MFVA 3PBGA 2CZFA 4Z42C 1HW6A 4O1AA 1JGMA 4WD0A 5JH2A 1C7SA 4PUUA 2WLZA 4EF8A 2G0WA 3GAYA 3EDDA 1L8PA 3L4YA 3N2TA 2ZUVA 4LGXA 3H4GA 4WK9A 1F4HA 1LCOA 1C8QA 1JPIA 1HG3A 1O5RA 1XGZA 1TG7A 1AQ0A 4E2BA 3DG3A 4LUIA 4AD3A 1VBRA 2PEVA 1BAGA 4KETA 1IT0A 1X6NA 4GGHA 4JNMA 2GDVA 4JX5A 2J7CA 3T7VA 5GVJA 3U2ZA 2XH4A 3KOFA 5AC8A 2OQLA 1ZJBA 3PJWA 2QUMA 3W83A 4AIUA 1ZTVA 4L56A 3A4WA 2C71A 2X05A 4FS9A 3TE9A 2BGQA 4HZ7A 2RFGA 4GI8A 1V03A 4MB3A 4H9ZA 1J0HA 4U4MA 1QPNA 4JS3A 3H26A 1KFEA 2PDYA 2ZRZA 1FDYA 1YPIA 3ZT5A 3WLPA 3NPXA 1V6XA 1OFQA 4O11A 5I6SA 3UQNA 3PSVA 3AXKA 2AL2A 4QX4A 4S2CA 1HP4A 1QHOA 2ZKMX 4N7QA 1H7OA 4Y6GA 4A35A 2FGBA 4PZVA 2CLFA 1JULA 2YW4A 4Q8WA 3NPWA 2UY4A 1THFD 3CIXA 4DZ5A 4X2RA 5DXYA 2BVYA 2YA2A 4FPSA 3W2NA 1EO7A 5FKYA 3AS1A 4JX4A 2GQ9A 4B5SA 1JYWA 1C8XA 5B7ZA 3PWIA 3PANA 2VOTA 3MANA 4RZ4A 2WNWA 2CU0A 3GG7A 3R8RA 3VILA 4J40A 3P6LA 5H8MA 4DELA 4WDUA 1UR0A 1FCQA 3ZJ8A 2DZUA 3C2EA 3ITCA 3DAQA 4OECA 2NV2A 5KSWA 3CPGA 1ML1A 3GC4A 3H7UA 3QW4B 1L6FA 4XBKA 3ABXA 3EPMA 1WOBA 5CZ0A 1IEXA 4UQ9A 4OV4A 2NVCA 3VKBA 4GA8A 1L6YA 2X2YA 3DKLA 4FNPA 4QRNA 4X9SA 1X7FA 4MVAA 1TPH1 1QTWA 5FJUA 1ONEA 2Y7EA 1W3TA 4XZMX 4LYKA 2J8GA 1SSGA 4MLRA 3WNNA 3MJMA 5AC5A 4YTTA 3M16A 1XM3A 2OSYA 5DLCA 1RK6A 4U2ZA 2P0OA 1P43A 1PDYA 3C0QA 4JKKA 1CGYA 3C52A 3GDLA 3R0UA 3FN9A 1C90A 4IH3A 1FP8A 1CLVA 3NQAA 1AMYA 3EZ4A 4DZIA 3AJXA 1UKSA 5GJMA 5CXPA 1X8FA 2PDLA 1V0LA 4TX6A 4C5ZA 2GVLA 4QAWA 3LZ5A 1WDSA 1S2CA 3STFA 5A6KA 1ZZMA 1PYFA 5AY7A 5C6MA 2YL9A 1XIJA 3P8IA 4PUMA 1UR3M 3WYZA 1XLKA 3C2YA 4AY1A 1T8XA 2PRMA 1YTKA 2R94A 3R43A 4UFJA 4ZENA 1XH2A 1UWUA 3RNDA 1NY1A 1YEYA 3WQPA 1NVMA 4AEOA 4IP4A 4A3UA 4ZODA 5D9OA 3LI1A 4FMVA 2HNEA 4WF7A 4D72A 4AZCA 3TV8A 4IISA 3EPOA 3RYSA 1DJQA 3OHMB 5A6LA 3RIKA 2C8NA 4RZBA 3HPSA 1E1CB 2E3ZA 3PJTA 3WLKX 3ATYA 4TVCA 3PUGA 4XIMA 2BS9A 4YJ5A 4AW7A 1OQFA 4J7RA 2D20A 5MKGA 1LL7A 1GHSA 2BVTA 1UBPC 5LA0A 3GDRA 1YDOA 1Y7VA 2NXHA 1H50A 1H4PA 4KEVA 1E56A 1XUZA 4M5PA 3G1XA 1P0EA 2YB1A 2EAWA 3TH6A 2FMNA 1Q6QA 3NL3A 5U7SA 2DY3A 1M03A 5BROA 2I17A 3W70A 5HATA 1KB3A 3DECA 3TW6A 1KR1A 4JEQA 1BG4A 4LTSA 4OGZA 1OGBA 4F0SA 4JFTA 4D6IA 2NV1A 2BNJA 2YGYA 2J9XA 2QJIA 1AW5A 2YCLB 3SFWA 2HPIA 3FHQA 3B40A 4P8XA 3WF1A 1EJSC 3IK4A 1PAMA 2R9RA 3S5NA 3WDHA 1Q6FA 3TAKA 1EEXA 1IGSA 2QCDA 2R1LA 2VFDA 3SW6A 2WCAA 4A05A 1T96A 1JXJA 7REQA 3AS3A 3SO7A 3VNDA 3VGFA 4MUPA 3MSRA 3M0JA 1XR2A 4X2PA 4D6GA 3GXTA 3DFTA 2ACSA 3DKJA 2V5JA 1JRCA 3SJNA 3QQ1A 3N14A 4NG3A 5TF0A 4C65A 3WY1A 1B57A 1DJGA 2E9MA 2X09A 1CLXA 3JRKA 3HA1A 2A79A 4DXKA 4V15A 4MJ4A 3UPMA 4IFKB 3SRDA 3VD9A 1PKYA 1RCQA 3MZ2A 1DXEA 4MJZA 2V3FA 1ZBVA 1LORA 2PRLA 3GR8A 1TCDA 3VNLA 4MTVA 1OX6A 2CHNA 3DENA 3AWOA 4UTHA 2ZTKA 2XHYA 2BODX 3Q67A 3TAOA 1ICSA 4UTWA 3B0PA 2GVYA 1LRTA 3HU7A 3ES8A 3VNYA 4UC5A 3KUMA 3FHAA 3UG3A 1AQFA 2CERA 1Q6OA 3ITXA 3KEHA 1OJXA 4DI8A 1PWMA 4YVVA 1X97A 1GYMA 1A5AA 5IFTA 3I68A 3TC7A 4LNCA 4XAPA 4PUWA 4IG2B 3G5EA 2WC7A 3TQVA 2H8XA 1IZCA 4J3ZA 1XIGA 2HVNA 4MM1A 3UPWA 7CGTA 3GDKA 4JY9A 2CLOA 1VFHA 1OY0A 4B5WA 2WVTA 4NJGA 3WNKA 2FTYA 1AODA 3FS2A 2XJ7A 3QC3A 1W3KA 3VGHA 1Q85A 1PIGA 2QZRA 1GCYA 1E6RA 1VFMA 3GDMA 5GNZA 2WBGA 3QJAA 3HGOA 2DVTA 5ABFB 3MUIA 4KRTA 1AFSA 1M9HA 4I7VA 4AHPA 3T81A 5D2XA 3CUZA 3FNDA 5BMWA 4Z2JA 1XLDA 4H01A 5FJTA 4D6JA 2HNHA 3DGBA 2V0TA 3NL2A 4MB4A 4DNMA 4JICA 3WLOA 2V2DA 5FF4A 1JG9A 2PWFA 4WSJA 4JGDA 4TR9A 3UG5A 4XQ6A 3Q65A 4FLRA 3NVDA 3DFPA 3PZ9A 4LBSA 4AEEA 4AD0A 3S8HA 1D3GA 4D2JA 1AW1A 3N34A 3E49A 2RGLA 2RHGA 2I9EA 4IQDA 1PXGA 3S42A 3NEVA 1W8GA 3NXLA 1CB2A 1YTDA 4L80A 2NX1A 1IEVA 2DUXA 3BPWA 1VFFA 1P6WA 3OODA 1E40A 1VCFA 4OV9A 2O92A 4UFLA 1NSJA 3KBSA 8XIAA 2E9LA 3DFHA 2AMGA 3IVSA 5I02A 3T07A 4HB7A 2F38A 3JVAA 4PCTA 1JCXA 3WJSA 1RPKA 1AH3A 2XVPA 4GI6A 4H19A 4P2VA 2WWCA 5HMEA 1BEUA 1EA9C 3BQ6A 3O06A 3BGGA 1HXJA 4O1FA 3BANA 1EJWC 3FYYA 4GK8A 4GIAA 2FGLA 2JF6A 1U1JA 1Q63A 3B8DA 2V3DA 4IMGA 3QN3A 1W1ZA 4XO7A 2GJXA 1R7AA 3EDEA 4CEUC 4I5XA 1AD1A 2PDBA 2XSBA 1NOUA 1UB3A 4JL1A 4C6LA 4Z2IA 1W3LA 4CQ9A 1G6CA 3CAKA 3IWPA 3L0NA 3ZVHA 2V68A 4YWSA 1TPC1 1ZL1A 2R1PA 1U22A 3L4WA 1TR1A 2HXTA 2B7OA 3W26A 4A8NA 2QR6A 1X1NA 4F2UA 2PURA 5A5WA 2HK0A 3JZEA 1CXKA 1OBAA 4ZTYA 2ZBTA 4KF1A 4E2OA 1FCBA 1VHNA 3TTYA 1MYRA 1W6TA 2VDHA 3IGXA 3O2LA 3H6OA 1R6WA 3FDKA 3EWDA 5C9UA 2PMQA 3PZQA 2J88A 4IPNB 3NSXA 1V6WA 4X22A 2O4QA 2Q8LA 4PMRA 2V38A 3LSBA 3MSDA 3A12A 2DDXA 2G3FA 4HVXA 4MMWA 1LQ2A 3R2GA 1M01A 1S5WA 3W0KA 1QNRA 1E73M 1O94A 3P60A 3OBKA 3EBVA 1XRSA 3WMSA 4AIOA 1B0IA 3WLMA 1SZNA 2CLPA 4I8DA 3T0CA 3WFLA 3BMXA 4HSOA 1DJXA 1EIBA 3I6EA 3LHVA 3O63A 3TQ0A 1Y8BA 2INEA 1Q65A 2YYUA 1BYAA 2VZOA 3WEMA 1RQEA 2ISWA 2HTMA 3M0HA 3IEBA 1Q6LA 1QI2A 1FFRA 1M53A 1QATA 4Y9OA 4EPDC 4DUVA 1AH0A 1NWUA 2VNCA 5CGTA 1GZ1A 3QH2A 4DN1A 4MNMA 3W22A 3U5YA 3BOXA 2IKIA 4L6HA 4UNIA 3VU2A 3G0UA 1Q6EA 1YW1A 5D38A 3PZMA 4L4MA 5IBXC 3VIMA 3EPNA 1GQIA 4NJIA 2PDXA 1TV8A 3DFYA 4UZSA 4Y9AA 4ICNA 3VIJA 5GQBA 2DZBA 1RBAA 5M3WA 4R7WA 5HJYA 1GQKA 3VUPA 3CZ8A 1A5CA 3NURA 1K9EA 1T0OA 4LS0A 4HN8A 4M8UA 3Q37A 4NZFA 4XVDA 5LSMA 1E5NA 5EMJA 4NVTA 2IPJA 3MWCA 1IF2A 2BV9A 2ZDSA 3LNPA 1UC5A 4JR5A 2HPMA 3C0LA 2J24A 2WHJA 1S5TA 3MVTA 4X0VA 1Z69A 4U5IA 4JN6A 3KRSA 4JIQA 3H4XA 4J3SA 3S46A 1K8CA 1NF0A 1UJQA 1UYQA 1C3FA 4C6OA 4YTQA 1FKWA 1MEIA 1ZENA 4OIFA 4FOUA 2DT1A 1FKXA 3RLHA 5CSSA 2WCSA 2YBUA 5AB3A 1JD9A 1UUOA 4Q7BA 1KGUA 1DOSA 2Z1WA 3SGGA 1NFPA 2IKJA 1DQUA 2AQWA 2WPBA 1NH6A 4IXXA 1ZBWA 4ILSA 3HQOA 4UTIA 1JFXA 3ARYA 1XC4A 4R53A 1ZCCA 4KEUA 3W38A 3WDQA 4GNVA 2WQPA 4AEFA 3S6DA 3CM4A 3F4CA 4QGCA 5EPDA 4MY8A 1GVOA 1MW2A 1JQVA 3FX4A 4UQBA 3RJYA 2RDWA 3LY0A 3T9PA 1D3HA 3G0XA 3BW3A 4XSMA 2Z2BA 1CEOA 3FJNA 1R3WA 2BY1A 1I2NA 2A85A 4D1IA 2D23A 4IM4A 1R0MA 1UBSA 1W1B1 1KWKA 3E12A 1KBLA 3VOGA 5LXEA 1X6LA 1SMDA 5LNRA 2R14A 3G0SA 1K7FA 4HZ8A 4U5KA 3VXGA 2CBVA 4K8EA 3C3UA 4IIFA 1I0DA 3HQPA 4FIRA 3W2KA 1GEQA 2ZZ6A 1SFLA 3AZSA 4TQTA 3PTMA 4GC3A 3AS2A 3UXDA 5JQ9A 4E2VA 3EA1A 3B8UA 1R38A 3TFCA 4AVNA 2FKPA 3I7RA 3TSDA 1QPKA 4IIEA 4TIMA 4U2YA 3BXWA 1B3WA 1H09A 3LERA 1JJKA 4QJ5B 4J28A 3QGVA 1QHZA 1WP6A 3QY7A 7TIMA 1BD0A 4L4PA 3TQKA 1TJRA 4WZHA 3IIOA 1NP2A 3NQGA 4Q8MA 3OO2A 1EL3A 1PX4A 2GJRA 3MP4A 3IGSA 4JYEA 1L0PA 1DIDA 2GUUA 1VS1A 4AF0A 2J7GA 3BOLA 1UMYA 2E4TA 1LQAA 3SR7A 3UJSA 3NOEA 3EMCA 2UY2A 1TTQA 4H00A 4QCEA 1LT8A 3MQTA 4FX7A 3FAWA 1RUSA 4Y9MA 2FH6A 2YL6A 2ZUSA 2CZVA 5H91A 1HKVA 3WKZA 3P61A 1YTEA 1YDVA 1YADA 1UMLA 3EKLA 5CG0A 4B92A 4C6PA 2YBTA 3P3BA 3DC0A 5DRCA 4E0CA 2OJPA 3BTNA 4GFSA 4XTIA 9RUBA 2IUZA 3NFUA 1W32A 5E0FA 2VFHA 3VE9A 3AI0A 4NXSA 3IK2A 3WNOA 4XD5A 4LRSA 4REQB 3NQ6A 1XCXA 2QUTA 3R0KA 2YCJA 3MU7A 3LRMA 4S3FA 3AFBA 3OVPA 3KRUA 1TKKA 2PPGA 3MA8A 4I9TA 3TTQA 1CGWA 3BLEA 3CAQA 4ES4A 3B9OA 1UR9A 3B03A 1WYIA 3CHCA 2VR4A 4QJ1A 1TMHA 3HQNA 2PFHA 3EDFA 3A6OA 1CZ1A 1PHQA 1NQKA 2WZHA 1CWYA 3UBPC 1M68A 4YWIA 2CBUA 4JZ5A 1REQA 5AVNA 1WDQA 4AFYA 1SM9A 5DY3A 4P5UA 3HG2A 2I5GA 1P6CA 1ZBKA 3OHIA 1WNOA 1MUMA 4DJED 2HS6A 3IV8A 1FWSA 1HO4A 1Q4WA 1PIFA 5JIPA 3RILA 3W1TA 1JDAA 3R0DA 4BZYA 3KBNA 4ROPA 3NZRA 4ZCWA 2FQIA 4CU8A 2C19A 4DJDA 2IPWA 3HV9A 4ML4A 3W7PA 3E96A 2C15A 5G4EA 3MP3A 3PK7A 3W87A 1XFBA 4RDVA 3EWYA 3OOQA 2UV8G 4P7NA 4M80A 2BWGA 3RDKA 2WHMA 2I56A 4RXGA 1UD4A 4EE9A 2RDXA 3QZ6A 4Z1DA 1M7OA 3ZVIA 1HNYA 2JEQA 3BOFA 4ZTXA 4A21A 4IUOA 1DYSA 2NZLA 2AAAA 3LENA 5JXQA 4GUGA 2WO5A 3L23A 4JTEA 4DWSA 3VIIA 4HOXA 2VKZG 1LROA 3PPHA 3CPUA 4DO7A 3B4YA 1SJBA 3DESA 4JQAA 1DHKA 4FNTA 4IMFA 1UA3A 2E77A 3OJGA 4GUHA 3II1A 4MAVA 2Y88A 4FB7A 1XHGA 4RW5A 2EEXA 2WV8A 4WY0F 1D3CA 3HIJA 3VM5A 1WE5A 4CGTA 3N18A 3GZAA 1NIUA 2Z1KA 3ALGA 8XIMA 2OFJA 4HNUA 1XYFA 4UIOA 4JTGA 5JBEA 1KM6A 5E70A 1TPFA 4IL0A 3QPYA 1E70M 4KFNA 1POKA 1W3NA 3PSWA 4QQ3A 1JZ4A 3TJIA 1BWLA 3CZGA 4KH2A 1Z41A 3M46A 4YHEA 5BU6A 4DM2A 1TPUA 2B0MA 1GOOA 3LHWA 1TJPA 2WKLA 4JTIA 1I2QA 4YS1A 1L9WA 3PULA 2A7NA 3CL7A 1NU5A 1UIPA 4XG1A 4DX3A 1VRDA 7ODCA 1UD2A 2XIQA 4QAIA 1J79A 3WD3A 3W7HA 1XLHA 1KRMA 4NJJA 1U33A 2GWNA 1JFHA 3FLUA 5C9XA 3LHZA 4H4IA 2J77A 3CEUA 1N55A 4UTTA 1KM5A 3AC0A 5AHNA 3NOYA 3HPZA 3DI1A 3TOPA 1ZRQA 3WH7A 4H41A 3RX4A 4ACYA 1EKOA 3KVJA 3TXVA 1MW1A 1VQTA 3SY1A 3GYEA 1TV2A 4PTWA 1DTNA 4AWEA 5D9PA 5LKYA 3GW0A 3O7UA 4PCPA 1R9YA 3VZZA 5K4ZA 2I14A 1B3OA 3LCLA 1Q7MA 2D3LA 3L4XA 5HUPA 3KL3A 4DJFA 1TPVA 1PTDA 1MO0A 1CXLA 1VLIA 2E40A 1KGXA 4MLJA 3S1XA 2OSWA 1N8FA 1OF8A 2PZNA 3T09A 1ISZA 4I9MA 4N6FA 2RUSA 1AJ2A 2A3EA 4HNTA 3GKAA 3L4ZA 5LXXA 3AUOA 4D1JA 2WMHA 1LOQA 2ZX6A 2XFFA 4F2BA 4NKCA 1XRFA 3S5OA 1JL8A 1RPXA 4XK2A 3UP8A 2GDUA 3B8TA 1B3VA 4GPNA 1UOKA 4ECLA 2CLHA 4H9TA 2PLJA 3V1PA 3IJ6A 3NO1A 5K9XA 3M47A 1LT7A 2QVNA 4GZ7A 2G37A 3DI0A 3LCHA 4QDMA 3TX9A 4CCZA 4TXEA 4NZ3A 3BZJA 5CQ1A 9CGTA 1YPXA 4J3VA 4PMZA 3A4XA 2ESCA 2C0AA 5CC3A 2FZDA 2PRHA 4JFWA 2WKGA 4WIWA 2VZSA 2XSXA 3WUEA 4PC8A 1HVXA 3W75A 1XSJA 3T0TA 1JZ8A 1Q8AA 1LG1A 4TMCA 5IHRA 4UTFA 4GFIA 4PR4A 4PFMA 3UWZA 2C14A 3VIFA 1G67A 1OCNA 4JFUA 2EF9A 2EPMX 4IQJA 2AGKA 3MUXA 4NNBA 1WKEA 1IE7C 3QZAA 3G3MA 2I16A 5AKQA 3B4UA 2EBNA 2CWXA 2PI6A 3WUGA 3CUXA 1F74A 4AZCB 9XIMA 5A6JA 3EX2A 4QIUA 1OFOA 2C1IA 3C2FA 1TYGA 2VELA 2DT3A 3MCOA 2V67A 1BQGA 4DEFA 4O12A 1V3HA 4S2BA 3MB9A 3HMJG 2G3IA 1FX6A 2VX7A 3LK6A 5M5DA 4C1LA 3KAOA 1J11A 2PTYA 4DLFA 1XG4A 2F8QA 4GUIA 3GTHA 4GVFA 4H6EA 5MKGB 3ZM8A 4DLMA 3BARA 4S3GA 1BVNP 4O4VA 4IJBA 4UTKA 1WX0A 3NM3A 4FXRA 1W2VA 1OYCA 4BHYA 3CMGA 4ZQMA 5DF0A 4MWAA 4KEZA 2DUZA 3D3AA 3ARVA 3WD1A 3UNDA 1LLWA 4JHZA 1K77A 4JKLA 2PDWA 4ZVJA 3QKZA 4CQAA 3BG3A 1UZHA 4PCSA 1ODUA 3TLLA 4NJHA 3WQGA 1PKLA 5D8WA 1W9BM 2Z1SA 1GVIA 2DJXA 1UZDA 3ECQA 3LB0A 1ITCA 5I3KA 2Z7GA 3AO0A 5D30A 5A6AA 3VD4A 2E68A 3G6LA 3LQGA 2DFAA 1S5VA 2E7FA 2GQ3A 4W7VA 3DGRA 4AZGA 2BOFX 1C29A 5F4WA 3VNJA 1J93A 1R2RA 1HJXA 4LW7A 1BF6A 3WDIA 1CIUA 1FWGC 2YZRA 2QCDB 3TYBA 3D46A 3UY7A 3UWUA 4MY1A 2QULA 7REQB 1XIHA 3OP2A 1FWWA 4E38A 3L65A 4C6FA 4OFCA 2CLMA 1JZ5A 3C4UA 2ASHA 5CC5A 5I78A 2BX7A 4FO4A 3KTXA 3WH5A 5AZ1A 1KFJA 4F79A 1UASA 4KCVA 1JQXA 3CLWA 3N04A 3QMRA 5KZ6A 1OEPA 3VI2A 1JUBA 4X61A 5K3VA 2J7EA 1R5YA 1NJJA 1KC7A 2EQDA 3LX9A 1OGGA 3FXYA 5PTDA 1QI3A 4RE3A 1W9PA 3VFLA 2RDUA 2J25A 3NL5A 5G5IA 3BLIA 1KXHA 3IV3A 4XD3A 2QAPA 2CZEA 4HT3A 3EDJA 1MMFA 4GCAA 4QS6A 1LM1A 4XUGA 2TPSA 5D9MA 3HMCA 1P0KA 2FH8A 2YPIA 3STGA 2RGMA 3AS0A 5FF7A 3ZSSA 5FEXA 4JQ4A 5XIMA 5DCEA 3GUWA 2VFFA 3W7CA 4GXMA 1QBBA 2BHUA 4EAMA 3BJTA 2ZZ3A 5AYBA 3R94A 1ZSXA 3T05A 1WAWA 1F05A 4MJ2A 2G41A 2OR2A 1XLBA 1GVQA 4KWVA 4KT2A 3TNOA 3C6CA 5A6MA 4PTVA 3L9CA 1E0WA 2QS8A 1XUUA 3BCFA 2BDQA 1DJNA 3O6DA 3S4TA 4LX4A 1FWAC 3W28A 1CT5A 4L4OA 4WUIA 3GXFA 2XG9A 4NIRA 5C8BB 4JTKA 3VDAA 2ZXBA 1GYLA 3W27A 2VYOA 3V5CA 1QAPA 1A5OC 2D24A 2DUAA 1BRLB 2GJLA 2OOFA 3WQFA 3LUTA 2DP3A 3F4WA 3V0SA 2XYLA 1QOPA 4LAZA 3TZFA 2IKGA 3TTSA 3H7RA 1WBHA 4PMVA 3AYTA 2XDFA 3RF9A 4LV9A 5E0CA 4X0NA 3GY1A 4MYAA 3OLEA 5EBUA 4JYDA 1V0MA 4DPQA 4JTJA 3JR2A 4QQUA 1TR9A 3W1RA 2BOGX 2D2OA 2JKPA 4GHRA 4R3UA 2KAUC 1ZBCA 1S39A 2FPYA 4HCDA 2VX6A 3A3WA 3AXXA 4YVXA 3E0FA 3W1UA 4NU7A 3BZGA 4D6DA 3L2LA 4MF4A 3W7KA 3O15A 1BGGA 1CBGA 2QUVA 3KP0A 1DHPA 3IAPA 4XAGA 5ECVA 1VYPX 2AKZA 2NQ5A 2LLEA 1KRBC 4HCLA 3TW9A 5E9XA 2QJHA 3VOCA 2WVUA 4QCFA 1UH3A 3H2MA 2P88A 4H2HA 5F1VA 4LAOA 2WNQA 1XW8A 3BV7A 4ADSA 3BVJA 5EMKA 1VEOA 5H6HA 1GNXA 1RZMA 3NR0A 4KWUA 2HRWA 3W7NA 2D3NA 1VD6A 5G1MA 4LC8A 1WDPA 3CV6A 1LL4A 1HN1A 3SBFA 4D6EA 2NT1A 1HTIA 1ZJIA 4DUWA 1XSIA 4CQDA 3LHYA 2QGYA 3W86A 2GJPA 4U10A 3RGTA 2VMFA 3LDVA 2CLIA 2WNZA 3C5QA 3XINA 3HTWA 2GJXB 1F4AA 3P81A 4KBXA 2YJQA 4BEUA 3GG1A 1B9ZA 5LNWA 1H51A 6PTDA 2FZ9A 4JDBA 1KKRA 4DPPA 3G1FA 4H7VA 4Q6XA 3TN5A 2QLYA 2XPKA 1BSIA 3ZVHB 4BCEA 2C6QA 3LGDA 4TVDA 2J7DA 4AZ5A 3LBMA 4F3HA 1Z6KA 1ITUA 5K7JA 4NYUA 4GY7A 2GGGA 5AVHA 1CGXA 3EX3A 3CIVA 3IJ9A 4W93A 3BK0A 3UR8A 3DHUA 1KXTA 3N6JA 3EWZA 4A8LA 2WM1A 4Q4PA 4R7JA 3W3OA 2C0HA 2TODA 4MB5A 3QEZA 4GE8A 2ZA3A 3IPWA 3N9KA 3EXTA 3QMTA 2GDQA 3KL0A 2ACQA 1VYRA 5KMYA 1TRIA 3R6IA 1EWDA 2G3JA 3VMNA 2ATSA 1KBKA 1EO5A 1AVAA 1MRAA 1GW1A 2W0UA 3W37A 3TONA 1Y65A 3REQB 4CNNA 5CLWA 1JAKA 4RZ6A 4H7ZA 3DYPA 4OJYA 2WANA 1DXFA 1QBAA 1A4MA 2FVLA 1XLGA 4BI6A 4IMAA 1QNVA 3Q45A 4PB4A 3C8NA 4GZJA 5I2UA 3PB0A 1LJYA 2GQAA 5DBUA 3T8QA 2XU2A 1E15A 5A6BD 3QQ0A 1L2UA 4BI7A 4C6BA 1KFWA 1KKOA 3VCNA 1FWBC 2VZUA 3LXCA 3BICA 3L4TA 4PBGA 3INPA 1NDWA 1JCLA 2BY3A 3R58A 3B0VC 2F6UA 4J35A 3QV6A 3EGJA 3VIPA 1FP9A 1D7KA 4GQQA 4UFHA 2FTWA 1P0DA 3TW7A 2O4MA 4UQCA 1NQ6A 1V08A 4URIA 3ARUA 1R2TA 4XZ9A 5HQLA 2YCEA 3LGEA 5EFDA 4E4FA 4IFRA 1XICA 3N12A 2PWVA 3M6YA