2ACRA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acrA00
4HMNA 2P5NA 4JTRA 2IPWA 3FX4A 4Q7BA 4DZ5A 2FGBA 1EKOA 1YNPA 2DUXA 2QXWA 3U2CA 3LEPA 1MI3A 2PDKA 2HE8A 3WG6A 3M64A 3G5EA 4LBSA 2C91A 3CV7A 3CAVA 4XK2A 2CLPA 5LIYX 4H8NA 2I16A 1Z9AA 5JH2A 2PDNA 4JIHA 4JQ2A 4YVPA 2FZ8A 1Z3NA 2NVDA 2FZDA 3UZXA 4PUUA 5KETA 2HVOA 3G1RA 3BURA 4H7CA 2PDHA 3H7RA 1FRBA 1T40A 4IJRA 4Q3MA 4MHBA 1S2AA 1Q5MA 3V35A 3CASA 4GQGA 1RY0A 3BUVA 1S1RA 1IHIA 3P2VA 4JQ3A 3DN5A 2PDBA 1PZ0A 4QR6A 3B3DA 2INZA 3V0SA 3R94A 1JEZA 1X98A 3GUGA 4YVVA 4L1XA 4JTCA 4IGSA 4JTQA 3QKZA 4JQ4A 2PDYA 4OTKA 3UWEA 1C9WA 2PEVA 2F38A 3R58A 1YNQA 1LQAA 1R38A 4GIEA 3CV6A 1HW6A 4I5XA 1EF3A 1PWLA 4AUBA 3T42A 1ZSXA 3V0UA 1Q13A 3UZYA 3MC5A 3V0TA 5M2FX 5JH1A 2BGSA 1RALA 1MZRA 2HE5A 2IPGA 1GVEA 3UG8A 3EAUA 4QX4A 2I17A 4WRHA 2NVCA 3BV7A 4XZIA 2J8TA 2PDQA 1EXBA 1XJBA 1YE6A 2HEJA 4QBXA 4WDTA 1XF0A 2FVLA 1X96A 4EXAA 2PDMA 3UYIA 2IQDA 1T41A 4DBUA 3LBOA 1EL3A 3UGRA 4ICCX 4EXBA 3UFYA 1AZ1A 3DOPA 4JQ1A 2IKJA 3S3GA 4XZHA 4PRRA 1PWMA 1UR3M 2HV5A 3CMFA 3LQLA 2FZ9A 1VP5A 3LQGA 3Q67A 3ONBA 4DBSA 2ISFA 5C7HA 2WZTA 5AZ1A 1AFSA 2BP1A 1RY8A 4WEVX 4F40A 4PUWA 4XO7A 2PD5A 2PDGA 3NTYA 1Z89A 2PDPA 4IJCA 2DV0A 1K8CA 1US0A 4JIIX 4LBRA 4NKCA 2HVNA 2A79A 2PDUA 5LIUX 2R24A 3N2TA 3RX2A 5AZ0A 3UZZA 3N6QA 3EB3A 4PRTA 3WCZA 1YE4A 3LZ5A 4GACA 4JTDA 4QXIA 1J96A 1XGDA 1SM9A 1QWKA 3RX3A 4XZNX 3KRBA 4YU1A 3LZ3A 1VBJA 3LUTA 3M4HA 1AH3A 2PDWA 1ZQ5A 2ACUA 4XVEA 4XAPA 4RPQA 1X97A 2ACSA 4GCAA 3O0KA 3D3FA 1PZ1A 4WGHA 4FALA 2DUZA 1S2CA 3GHUA 4L1WA 1A80A 4R9OA 3BCJA 2PD9A 4FZIA 4G5DA 2IKGA 2PFHA 4PMJA 1ZUAX 3LENA 2R9RA 1S1PA 2PDIA 2BGQA 3F7JA 1HQTA 3GHRA 2ALRA 3LD5A 4LAZA 3H7UA 1AH4A 4LAUA 4FAMA 3GHTA 3ERPA 1LWIA 1OG6A 3V36A 3LN3A 4WDWA 4XO6A 2PDJA 4XVDA 4JIRA 3GHSA 2IS7A 2IPFA 4GABA 2PDLA 2PDXA 5HNUA 2IPJA 4YS1A 4PR4A 1AH0A 3R8GA 2PF8A 4JTAA 5LIWX 1MRQA 3R43A 5HNTA 3Q65A 2ACQA 1ADSA 2PZNA 1IEIA 1ZGDA 2PDCA 1AZ2A 3M0IA 2PDFA 3CAQA 4DBWA 4ZFCA 2AGTA 2HDJA 3COTA 4HBKA 4GQ0A 3O3RA 3R8HA 3R7MA 4YVXA 3WBYA 4GA8A 2VDGA 4WDUA 3FJNA 3ONCA 1M9HA 1QRQA 4FA3A 1PYFA 4XZMX 4LB3A 5LIKX 3RX4A 4WDXA 3MB9A 3H4GA 1Z8AA 3R6IA 2WZMA 2IKHA 3EB4A 4XZLX 2ACRA 5DANA 2IQ0A 3UZWA 3WBWA 2F2KA 2IKIA 3LNMA 3UP8A 4ASTA 4JQAA 3WBXA 5LIXX 4LB4A 3C3UA 2INEA 3VXGA 2FZBA 5HA7A
chains in the Genus database with same CATH superfamily
2XYLA 2JGYA 1C9DA 3BAYA 3AI0A 1RZMA 3TC7A 4S2BA 2FH8A 1O5XA 1ZAHA 2VDIA 3RFAA 3CM4A 1E0VA 4TX9A 4Q4QA 3GIQA 4JICA 5CBBA 2VCBA 4Y9AA 1QNPA 3HPZA 5FKYA 4I5UA 2DT1A 2VELA 1JZ5A 2I9EA 1BRLB 3DFYA 3E5BA 2WPBA 3E0VA 4J1OA 2CLMA 4URIA 2D0HA 4DJFC 3CPGA 1MQRA 1Z3NA 1WKFA 3SI9A 1IXPA 3A4XA 4FPSA 3T07A 2HVOA 1UKPA 2YKKA 3FAXA 1LCOA 1ZAIA 4JBRA 4QG9A 4E0CA 4CCEA 5ENLA 5AB3A 1Q5MA 1XLDA 4J3TA 1R5YA 3DN5A 3EXRA 4Z1AA 4I7UA 4P7NA 1EJ7L 4K38A 5D05A 5FF4A 4C7FA 1DWHM 2FB2A 3GO2A 2W5FA 1K4GA 2E5DA 1LROA 1MQPA 3FHQA 1JEZA 1EEXA 1B57A 3SUVA 3THQA 1FWCC 1XG3A 3F2DA 4S3JA 2VEPA 5D2TA 3QKZA 5DMYA 4OTKA 3KWXA 4FNQA 5C71A 2F38A 3KAOA 3W7KA 5KZ6A 1WP6A 4Q4OA 3OJGA 4LUTB 4GYPC 3QFWA 3ME3A 4UQDA 1V51A 1NM9A 3W1LA 3CQHA 1A5BA 4Z42C 2QJNA 1YDNA 1M53A 4J9JA 1GVEA 1TE6A 4IJBA 1LLOA 2ANUA 5T91A 4IIHA 4OV4A 3UJSA 5A3HA 2WQPA 1QVBA 4Z0JA 3TW6A 1DL3A 2VZSA 3E2VA 3MKKA 2VUYA 1JPMA 2QCEA 4ZA0A 4W84A 4W7VA 4BF5A 1V02E 3OODA 1TRIA 4KBXA 4ZO7A 5IBXC 1XL9A 2VI0A 2WO5A 3UF9A 5J04A 5FESA 1V6XA 4XIMA 2Z1SA 1G94A 3WEOA 1OFEA 3PWAA 2P88A 3CMFA 2DZWA 2EBNA 3WDPP 3LCWA 3EWWA 2CHRA 4Q4KA 4ZENA 5AC4A 5I00A 4FF7A 5KITA 2Z26A 2J9XA 3SJNA 1QCWA 3RLGA 4JHMA 2V5BA 1QK0A 1H49A 4H9VA 4Q32A 4CNNA 4FK9A 1F3XA 4NAFB 5TQLA 3C0SA 1HFBA 1V3JA 2ZVRA 2CLIA 1EJXC 2G96A 2PGEA 1ONEA 3WQ8A 2WM0A 3WQPA 5BWFA 3R0DA 5FSDC 1SZGA 3AIRA 4AG0A 2WNWA 3PB0A 2A7PA 3N13A 2W67A 2PWGA 1R2TA 3CUZA 1MUWA 3MVTA 1KNWA 2O4MA 1HXJA 1ALDA 3S4TA 2WHKA 5IFPA 3AXIA 3C0JA 2OWWA 3DXIA 2LLEA 4UZSA 1ZQ5A 3VE7A 3W1QA 2RAGA 2ZXAA 4XD6A 1FH8A 4GCAA 4UOQA 4YN5A 2E67A 4MYAA 5EMYA 3CO4A 3TJLA 4EAYA 1TO3A 3VMOA 4NF7A 1MO0A 4BS0A 4L56A 3VGBA 1LYXA 4X3ZA 4HP5A 5CXPA 4WY0B 5AVHA 5AY7A 2I56A 1RJQA 1JL8A 1XIHA 4H01A 4UQEA 4ZQCA 4PN2A 4Y9PA 4Y9MA 5HQEA 3W85A 1D7KA 4LS0A 4MGGA 4Z2KA 1ZU8A 3DAQA 1KGXA 2Q71A 2GGIA 4X63A 1E6NA 2PDLA 3F1QA 1E9ZB 3D6NA 5C2CA 3QMRA 5I3FA 2DW6A 4LVAA 6XIAA 3Q94A 4U28A 1HVXA 1A5MC 3N6HA 4GVHA 3V4BA 2DSWA 1MUMA 3MV01 4P7OA 2NSOA 3MPGA 4RX0A 1WZKA 4AD2A 3VM7A 3ITYA 1LG2A 4TIMA 2OSYA 4LW7A 1K8YA 1E1CB 2P8BA 3FYYA 3M0KA 4IXXA 1TR1A 1WE5A 3G1SA 3ZR5A 3KHJA 4XTDA 4X2RA 3TROA 1VFTA 2ZZ4A 3VKJA 3R2GA 3W00A 1M65A 1Q8JA 4QISA 4LXFA 3IANA 1JRCA 3PSWA 3EPMA 3VOJA 2NUWA 2C1IA 3OLEA 2Z1BA 2ABAA 3W2MA 3S5ZA 3V5OA 1UWAA 1DIKA 5REQB 3GFYA 5XIAA 4CNTA 4ZO9A 3IIOA 4KFNA 4ALDA 4AH7A 1ESWA 4EP8C 2W27A 1CCWB 1T0OA 3G22A 3NQ2A 4QSHA 3L67A 4GI9A 4Q7BA 5I7GA 1FKXA 1EKOA 4MPQA 2D22A 2G41A 1UWRA 1EGMA 1C8YA 1J11A 3A3XA 3M0VA 3ORWA 4TOQA 4B15A 1V77A 2BHZA 4KCVA 4DUXA 3N1AA 1A5NC 2PDKA 3PUDA 1JYWA 3O6DA 4DUVA 1QNRA 4RNFA 3BPWA 3GDKA 1DE6A 4O28A 4UMCA 1LWHA 1GTHA 5E0FA 5T26A 4BWLC 5DRIA 4B3LA 4AFYA 3F4CA 2OELA 4DEFA 2I16A 1TPFA 1Z9AA 1FDYA 2DZVA 1ONXA 3MANA 4V1XA 2V30A 3G8EA 1Y5XA 1V8EA 3I3BA 2F6XA 1LQ0A 4ORIA 3VNMA 2FZDA 4W88A 2ZZ7A 4EE9A 1BXCA 4PUUA 4HHPA 5CSYA 5KETA 2OVLA 4MM1A 1IEXA 1EIBA 2GLKA 1H62A 3DHUA 4N9CA 1HN1A 3E9AA 4BEQA 4KH2A 2DZSA 4RE4A 5BOEA 1NIUA 1RV8A 1AW5A 1XSIA 2VZVA 4E2OA 1KLZA 3S5NA 4JTTA 1DJQA 4LUYA 4KS0A 3G24A 4D71A 1DBTA 1H7PA 2HQAA 4CKQA 1XKJA 4ORMA 3R1ZA 3QZEA 3DYOA 3OLIA 1O68A 4IMEA 1B5TA 4P2VA 3P6LA 1ENUA 4UTLA 2BDQA 2F61A 3NEHA 4O54A 2E68A 3HF3A 1F6YA 1EYEA 4AYGA 3BAKA 2RDUA 2Y61A 4KERA 1C9WA 3WNKA 1LQAA 3FW6A 5AVNA 1KCLA 3ARXA 3FSTA 4IFRA 4OWGA 4TVCA 2QJMA 2TYSA 1JQXA 1SJDA 1JDAA 4N02A 1UASA 5LNSA 1GORA 3IJDA 4AX7A 3KFTA 4JFVA 2HE5A 3UG8A 1UUQA 1E6XM 1R3VA 4ZXLA 4D6JA 3BV7A 4HOXA 3T1GA 3W1XA 2CESA 1E55A 1JD7A 1KRBC 2ZZ5A 3ZFHA 4F2TA 2D23A 2DY3A 4XG1A 1VRDA 3GDMA 3GKAA 4JHZA 2NQ5A 1R9ZA 4EXAA 5FIPA 3PPFA 3W73A 1O94A 3W7NA 3LBOA 3NAVA 3P74A 4KWWA 4LRTA 5A8MA 1K7EA 4DUOA 5BRBA 4UNKA 1OCQA 1XBZA 1PWMA 2HV5A 3HGRA 1A5SA 4ROPA 2CWXA 2PP0A 4H8HA 1GG1A 4JTFA 2R8WA 2Z6JA 1P6WA 4L9ZA 1JXJA 1PHWA 5E70A 3WJXA 1KFWA 3UR2A 3HGSA 2F8QA 3VGDA 2D2JA 3E2RA 4ONVA 3L68A 2G5WA 3RCMA 1BWVA 1WKDA 3RG6A 3GVWA 4AZBA 2YR1A 2R14A 2ZX6A 3T08A 1L6FA 1KBIA 3CWHA 3ZVIA 4E2BA 3O6CA 2FTYA 2IXUA 5CLTA 3GDLA 1QDSA 4REQB 3W4RA 3M41A 3NO1A 3HG2A 3PZUA 4GZEA 3PWGA 3WQCA 2J7DA 4MLJA 3IUIA 4LUSA 2WC3A 1PX3A 3GH4A 2P3ZA 3VC5A 4UR9A 5AZ0A 4H9UA 4PODA 2BOEX 1GEQA 4AMCA 2TPSA 3THCA 3PSVA 4GIAA 3EKZA 5G1MA 4LV4A 5D32A 3TNBA 2J6VA 2P3EA 3SEPA 4DJED 1W3LA 4KIEA 4OU1A 2FHCA 1XIGA 3C2FA 4N0RA 1SZFA 1ZY9A 2J66A 5FEXA 3TQKA 4UCFA 3T0DA 2UBPC 3H2AA 2YCLB 4HPJA 1QR7A 4AEFA 2A0NA 1K6WA 4LC8A 2BGNE 1JZ6A 2RJGA 4D72A 4AZ6A 1TWIA 4RPQA 4KRTA 1TQXA 2NZLA 4QQUA 4OE7A 3CEPA 1H7RA 3TJIA 4M7SA 1GW9A 3T2PA 2Z2UA 3W7MA 2X1IA 4AIBA 2CERA 2WXDM 5HINA 2VEFA 2YZRA 1Z48A 3ZWTA 1FCBA 1LBMA 1M41A 1GT8A 3BW2A 4PMYA 4ACYA 3VDGA 4ZQMA 3AC0A 2PDIA 2BGQA 1VF8A 1CGWA 2PTYA 4BQ5A 1QNVA 4N4QA 3HM7A 3W3OA 1RA5A 3WY1A 1OJXA 3F5LA 3P81A 3W02A 2I57A 4HNLA 1DJIA 2Z1VA 2Y88A 3W26A 3SCWA 2IS7A 4IGHA 2NWRA 4W5UA 4UB9A 1IR2A 1OF6A 1G5AA 1OGGA 3BLEA 3KM8A 2ZYFA 4PB5A 1CIUA 1OM0A 1JFHA 4MB1A 2VGIA 1Q6GA 1IZJA 3MCNA 2Z28A 4WK9A 2XVLA 1HGYA 4HCLA 4HHHA 5CH9A 3ANUA 5D38A 4RKAA 4UR8A 5JBFA 3MO4A 3EWDA 4WOZA 3RILA 4HBKA 4YIWA 1L2QA 3AZTA 4HA4A 1I1WA 1EC7A 3CTTA 4S3GA 4XAGA 4QIUA 3S0CA 4H6QA 3CXOA 1M7XA 1UJPA 4IPPA 1BXBA 3OBKA 1L6WA 4I9TA 4Z2HA 3FXYA 3TJ4A 1XDJA 2ACRA 3VOIA 1PXGA 3ZYZA 7TIMA 1Q66A 2WHMA 5JBDA 1BSIA 5LIXX 1G4TA 1DTNA 3HO8A 1POJA 1EP3A 4ERGA 3W7PA 4RUBA 3B9OA 1OFOA 1Q6OA 3TC3A 1B3ZA 1Q6DA 3A5FA 9RUBA 2PAJA 2ISVA 2ZXQA 4DZ5A 3NZGA 3I6EA 3HJZA 1J18A 3O63A 2PTXA 4Q22A 5I3JA 5D37A 3RHGA 4W8LA 3IK4A 5DMMA 3BLOA 1G7UA 3L0GA 1IT8A 4HJWA 1K02A 3G1DA 1G4SA 1LL6A 2NUYA 4MNMA 5DCDA 2VNCA 1H50A 1OD0A 4CNPA 4XB3A 4WKFA 3SCNA 5FEWA 1VENA 3BLIA 2FTPA 5C9WA 4F3HA 4JFUA 3CH9A 4GH3A 1OFPA 3IVUA 3B97A 3PVFA 1W1ZA 2QZRA 3QQ1A 1EZWA 1J0ZA 4LF1A 2QCDA 4K37A 5K9CA 1MSSA 3VNLA 1U33A 4ZSTA 2V8ZA 5LSMA 3PBMA 2EJ1A 3W7GA 5M5DA 4ECLA 3QTGA 2XU2A 1DJXA 1QNQA 3UCDA 1HL8A 1YPFA 1PZ0A 4IOTA 3LCFA 2GL5A 4IT1A 2YSWA 4DWSC 3P8JA 1PX4A 4HOZA 4D6DA 3HBLA 4Q8QA 2GJNA 1AL8A 3PBUA 5C70A 3E49A 2WM1A 3WMCA 4HB7A 3DX5A 3JS3A 3CQKA 5IDIA 1WDRA 1F7BA 4RDZA 4XZBA 5G2HA 1GQJA 5BU6A 2OEMA 4OQVA 3OZMA 4HMDA 3GG7A 5A1AA 5C6MA 2WZHA 2GQ8A 3CZGA 3OW1A 3LI1A 1E9YB 3GC2A 3BMWA 4RE2A 4R7WA 3N9RA 3QGKC 4L65A 3MY9A 1R87A 3QTPA 1XLGA 2DPEA 3B0YA 1W1A1 5JH1A 2QUMA 4CCZA 3E0WA 4FB7A 3UPMA 3NXLA 2VRJA 4QCEA 3N3TA 4K8GA 2NT0A 3K4DA 4JTKA 1NU5A 4DZHA 1XJBA 4K2SA 5A6TC 2E0PA 4C5ZA 4W87A 4O17A 4ML9A 3GW3A 3PNUA 4LBUA 2WCGA 3OTRA 3FIGA 1TTPA 1XIBA 1A3HA 4DLFA 5ABHA 4C6IA 1O1ZA 4LEFA 4J3XA 5EGRA 1TCDA 2ZRVA 2E7FA 1X39A 2YBVA 3LMZA 3WQ4A 2DSUA 4FXRA 4R33A 3ZS4A 2X8RA 2C1HA 4IGNA 5K4XA 3LQLA 3G2GA 2ZUVA 5BXSA 4L6HA 4UQAA 1P0NA 3Q67A 4QFUA 1NJJA 5BZAA 2ISFA 2CZVA 5AZ1A 3OQ8A 5D04C 2ZRWA 3IJLA 2OG9A 4D9PA 2XN0A 4C60A 3LM7A 3W0KA 4QRNA 1Q4WA 1QI2A 1L2UA 4PUWA 5CKSA 2QCCA 3OO2A 3OBAA 4IZGA 2VFEA 2O7QA 2WSKA 4MB3A 4MF4A 3EEGA 1RHCA 2Y5EA 4UTFA 4PUJA 3SY5A 3BOLA 1F3EA 3MMDA 3I3EA 3K5XA 1GOMA 4FX6M 1GQKA 3VAVA 3GWQA 1BXNA 3MW7A 4RLIA 1R2RA 4XBKA 2BVWA 1QPNA 1AQ0A 3A24A 3F5KA 1BPLB 2NV2A 1E43A 4P8VA 4RV3A 3EMZA 1JZ7A 4IIBA 3MZ2A 1ZBVA 2WC4A 3GSMA 3H21A 3ZR6A 4GC3A 1SM9A 1DIDA 2GGJA 1O6IA 1TA3A 4I9AA 1F8IA 1PDYA 4Q33A 1ZRQA 4KQNA 5A2BA 4HZ7A 3BW4A 4Q4PA 3AROA 2HNHA 2ACUA 1TJ2A 5TD4A 5A94A 3UJRA 3MUAA 2D2GA 1NDZA 4UC5A 3PN8A 1YNYA 3TW9A 3WEMA 5F1UA 2ZIDA 1FWHC 1RBAA 4XUYA 2QMKA 4XQ6A 4WUIA 4POCA 1MQQA 4R9OA 2Z1WA 3E2QA 4HIBA 1QPQA 3WQGA 1L9WA 1TV4A 1ZL1A 2IKGA 4AVNA 2OQLA 1I2QA 1M01A 2VD8A 1K8ZA 2OQHA 2DUAA 4AVFA 4NJHA 4HZ6A 1Q6CA 1J6PA 1K03A 3WDQA 4M1RA 1AH4A 1PX8A 1BYDA 1LWIA 2OOGA 2J24A 3M1ZA 3R4IA 5DBTA 1Z42A 1LQ2A 4E3TA 3M46A 4S2CA 1W37A 2VGFA 3AO0A 4G1KA 4KRUA 1QXLA 3IIZA 4UTHA 3H2MA 3WELA 3A47A 3N2OA 4S23A 1L8PA 1W3IA 1QATA 3HG4A 1JPKA 4E8CA 2PRLA 1OCNA 2ZZ2A 2FDSA 2VGBA 3E0LA 2GVEA 1TPH1 1GVSA 3HOJA 2VWTA 4GXPA 1I2PA 1TJ0A 3VFCA 1M04A 4A8IA 3LLDA 2B7PA 1XBYA 1PEZA 2PDFA 2YXGA 1SMAA 1UUOA 3ITGA 1LBFA 4BI6A 3DKLA 3KL3A 5L6UA 2HWGA 5AC8A 4O4VA 4QLKA 4QHRA 3QKEA 3QR0A 1TV7A 5D03A 3RX4A 3KBMA 3VNZA 1ODUA 1MFVA 4PMXA 1D2KA 2IKHA 1V3KA 1KBKA 3TOYA 1WNOA 4OFCA 1Q6EA 3TC6A 1PKLA 1YDYA 2PCQA 3VCRA 3PZOA 3PBWA 2QVNA 3Q37A 4HKPA 2OZ3A 2OYKA 3CZJA 3ATYA 4HHLA 3SUSA 3UCQA 3VXGA 3GBEA 4RPPA 3RITA 3GLCA 3VE9A 1IWAA 2NX3A 4JTRA 3NQ8A 4I9MA 4J3VA 5BMWA 3GDBA 1JZ8A 2J9ZA 5LYRA 1XDMA 4NI3A 4CQ8A 3SCTA 3W83A 5C9XA 6REQA 3S6TA 2QCDB 3PPGA 2OMAA 3IVTA 1S2VA 1C92A 2QV5A 3OB8A 2OLHA 2GGEA 2FMOA 3IAQA 3AZRA 3W7QA 4JNZA 2OSXA 3P61A 1O5RA 4JYDA 2Y6ZA 3S83A 2ZUTA 2GJRA 1LLWA 2VUNA 4Z1DA 4RK8A 4JIHA 3EPNA 3STGA 2X7VA 3QGVA 1RBOB 2WKJA 1E40A 3DC0A 2Y2WA 1A5CA 3VD7A 2PPGA 4UTTC 5GQBA 4GBDA 4A3QA 4UTJA 1QW9A 4IJRA 4Q3MA 1NTHA 2YLAA 2BBFA 1S2AA 4RNHA 4MDOA 1JCJA 4JIEA 4LVDA 3EX3A 1IHIA 4FO4A 3GKFA 4DB7A 1RA0A 1JI2A 3N2MA 2Z0IA 4QTGA 1H3GA 2PBGA 4X61A 3DHPA 4ZGYA 4LYQA 2PLKA 1K1DA 5AECA 1HO4A 4UTIA 4O11A 3NCOA 3TTSA 3GTNA 2WK2A 3R8RA 3VFLA 1WQ5A 3BOXA 1PKYA 1R7AA 5G2WA 1W9VA 1YQ2A 4FNPA 1HW6A 2FH6A 2F2HA 4JR5A 2J77A 4HSOA 3BMVA 4KCWA 3OGRA 3UZ5A 1TV3A 1B4EA 2NUXA 1JF6A 3TR2A 2YW4A 1POKA 3II1A 2O92A 4TUFA 4J40A 3AIQA 3CUGA 1R2SA 4OVXA 3FN9A 1B90A 3K2GA 3IS4A 2VD9A 5IDZA 3EGJA 1ODZA 1L0PA 2E25A 4KEZA 5A69A 2IPGA 2QV4A 5E93A 2PC8A 4J35A 2A3AA 5AHNA 4JIPA 4MFDA 4PBEA 3FVDA 1XYZA 2Y1HA 2OU4A 3CQIA 3G1HA 1HIZA 1YE6A 3NVTA 2HEJA 2EKCA 3WH7A 1NELA 4L4OA 3UYIA 3OA5A 4M6PA 3I65A 2VR5A 2BVYA 2BWGA 3TUUA 4C6MA 2F7FA 2Y62A 5M3WA 4JAWA 3TN4A 2XWDA 3R10A 1XIIA 5AYBA 3BK0A 1UR3M 1M6JA 2BNJA 4HA3A 4A6GA 2WAGA 4C1NA 4C90A 3T09A 2WNNA 1TV8A 4RZBA 2D3LA 3H7VA 1KGWA 2OPJA 1F5ZA 2PODA 4H6EA 2BOFX 5BRQA 4MUZA 2A21A 2PGFA 5D2YA 3N2BA 5B7YA 3DUGA 4IG2A 1WA3A 3P7YA 4IMCA 3UWQA 4LU0A 1FXPA 4NKCA 3RGTA 2HVNA 2QJJA 2FZNA 4UBPC 3ZLHA 2R24A 3N2TA 1OC7A 4Q8TA 1E5NA 2DU2A 2BFGA 2J7FA 2QUUA 3MYOA 3UQNA 1BGGA 3RPTA 3IACA 1J6OA 3TCEA 3AHZA 1W31A 3WF4A 3GYCA 1J01A 4A22A 2R1PA 3FKKA 1VEMA 2XN2A 4Z17A 1X6LA 3HA1A 4OBSA 5JXQA 3ZOAA 3KDOA 3V5FA 4YWSA 5EU9A 1UA7A 4LQ1A 2YFOA 4EF9A 5CPLA 1OEPA 3PTMA 3USBA 1UP2A 1VYSX 1VBJA 3ICJA 3ZMRA 2Y63A 3H2EA 2DIKA 1YBQA 3XIMA 1XLIA 4BY3A 1XLEA 3UYCA 3CLMA 3KVKA 3M16A 1S5WA 1YX1A 5FL1A 3LCIA 3P8IA 2GJLA 2DGAA 4B5NA 4QE4A 4G5DA 3AISA 3M5ZA 1ZUAX 1XIMA 4GPNA 3E0FA 5T9CE 1TCMA 1HQTA 1O5QA 2ATSA 3U57A 3RN6A 3QY8A 1AJZA 3WLQA 3MMWA 3GHTA 2WVUA 2BTMA 3B4YA 1A47A 1XXXA 1JXKA 2DZBA 1WOBA 3G1XA 4O0ZA 1LORA 2EQDA 3ZXWA 1FX6A 3UXKA 2ASHA 5HNUA 1ZBKA 3EA2A 2IPJA 5H8PA 4C6OA 4PR4A 3GY1A 4D6IA 3TU9A 1E73M 2PF8A 3BAJA 4FLRA 1TWDA 2WNZA 5A6BD 4AIOA 4JX4A 4NZ3A 3N14A 2ACQA 4GVGA 1UZ1A 4X9YA 3FJ6A 4ENLA 4IQEA 3DHFA 4QAIA 1HP4A 1GPFA 3GXFA 3G3DA 1NSJA 4N6FA 4I6KA 3K46A 1LLZA 3UR5A 1V93A 3LG3A 2PRHA 4KMQA 5CCZA 3UG4A 4UTKA 1CXLA 1LZOA 3WQFA 3B9EA 1XR2A 1EA0A 4Q8PA 3QVQA 4HTBA 1WZLA 5LIKX 2PF0A 1NVMA 4US5D 2FHBA 5CGMA 5HJXA 4H2HA 4B5VA 1PTDA 2PB1A 2YCJA 1WZAA 5I24A 2GQ3A 3NR0A 3TDFA 4LT9A 4S1FA 4RE3A 1V3HA 3G0XA 2FZBA 1TX0A 4Q8WA 1P0KA 5HUPA 3KCLA 3W1NA 4W5ZA 1TMHA 1VPYA 1U1HA 4ACZA 4NNBA 2OEKA 1A3WA 5H6HA 4ILSA 3U2CA 3N04A 4LANA 3V5CA 3QSRA 1N7KA 2NX1A 1OIMA 2XIOA 1VIZA 1LF1A 3EMCA 3KEHA 3GS6A 1O1HA 3CPUA 5HQMA 2CIPA 4NZCA 1YPIA 3EDKA 1J10A 1YMYA 4ZTYA 1JFXA 2RH9A 2B4GA 5BU9A 1LG1A 4W86A 4UMAA 3S1GA 2EAWA 2GVGA 5AHMA 3WUEA 1YKWA 4X0NA 2O0TA 3LPFA 4GUIA 1ZCOA 1Q4NX 3NDZA 3A4AA 2WWDA 4YJ5A 4JDYA 4HU0A 5CG7A 1GKPA 4NP7A 3SN1A 3WFLA 3B05A 4DO6A 2QLYA 3N12A 5SWUA 4PSPA 4IP4A 3NVDA 1KFKA 1W2VA 3MMUA 3P2VA 1ZBCA 3ITTA 4XISA 4GOAA 3B3DA 3UVAA 4FXSA 3TONA 3BQ6A 4PTWA 4DRSA 1EP1A 3DU0A 2VRQA 2YOCA 4GE8A 3WNMA 1SO5A 4W85A 5KEZA 3TP4A 3STFA 3WDIA 1H63A 5AYIA 3UERA 1PBGA 4CD5A 4MKVA 1QK2A 3G1AA 2J78A 1UZDA 3DBNA 1PWLA 3B8IA 1YIXA 2Y0FA 3RJXA 1JPDX 4KKXA 3LRMA 3UR7A 2F9RA 4BKNA 4WF7A 4Y2WA 4PUNA 1FH7A 1AD4A 4DJEA 1DWIM 4O4WA 1NDYA 3D5HA 3NL6A 2E77A 4E2VA 3LCGA 3VNIA 4P61A 1A50A 4WKHA 2XGIA 2OLAA 1KM6A 2DZAA 1QOPA 3TYDA 2QAFA 3WMLA 2XSAA 2PDMA 2CBUA 3SCPA 3QHNA 2IQDA 2G0WA 5MKGA 2XFYA 3POHA 1Z44A 4RNIA 3N29A 2JQXA 3EA1A 2UY3A 3V16A 4LF2A 2BHYA 4P7RA 3AXKA 3ES7A 1EIXA 1F73A 4AVOA 4AZ7A 1WZMA 3SZ8A 4D1IA 3L2MA 4AF0A 3HMCA 4M0XA 5LXEA 2VP8A 5LA0A 3UETA 2RKXA 4UTUA 2QUNA 4MJ4A 5EY5A 1E0UA 1UD2A 2X05A 4PRWA 2YCIX 3C8FA 3UXAA 4JGDA 4JOMA 2Q02A 5EMUA 3D0CA 4WJ8A 2R1KA 2EPKX 4WJEA 2VRKA 2QCHA 1E0TA 1TYGA 2GJXB 1KFCA 1HUVA 4JIIX 1YXYA 4GHRA 4UMBA 1KBLA 4W7WA 1H51A 3W81A 4AD5A 3OPSA 1SJAA 2WJEA 2TRSA 2JF7A 2Q3OA 1BTMA 1Q85A 4PCSA 4RXGA 1U30A 4TX6A 5IM51 1E4LA 4F9DA 3ITXA 4QJ3B 1RD6A 1YBQB 1ZB5A 3NPUA 5DCEA 3RMJA 3LBCA 4Y9OA 3H8AA 1CBGA 5HATA 1Q3NA 4J2PA 4BCEA 5DEZA 1V08A 3C8NA 2X09A 3T78A 3URQA 1J2BA 1VD6A 1XCWA 4S3KA 4LUIA 5M03A 4Q8NA 1A5UA 1ICSA 4R53A 1R46A 5I3GA 5CC3A 4UFJA 2YFNA 4GFIA 3TFXA 4TTGA 3KP0A 4AWUA 3PZNA 1ZJAA 4IL0A 3RIKA 3A4WA 3UU0A 5FF0A 2OX4A 2R9RA 4DIAA 5F1VA 4F0SA 3O1NA 3GNOA 4RR4A 5HDRA 3C52A 3PG8A 3FGCA 3LHTA 5DF0A 2P1FA 4DWSD 4AY8A 4PMOA 4CNUA 2DJLA 3DESA 1KXTA 4GNVA 1MMFA 3ECQA 1W3NA 2ZUWA 4IIFA 1CGUA 2CWNA 2REQB 2OT0A 1W5OA 3TMQA 1BEUA 4QG6A 5DELA 3BC9A 3M0MA 3FLUA 1ISXA 4J3UA 1UMYA 3B8TA 2EPHA 8XIAA 3DERA 4ATWA 5A6LA 4UNIA 2OX1A 3GVRA 5C0QA 3ZT6A 3S2LA 4KFOA 1I60A 3UJ2A 1AZ2A 3LSBA 1K4HA 1BFNA 2WBKA 5HWJA 5H8UA 2WMGA 3EWCA 4IIGA 3KOXA 2CKRA 3I6TA 1B3OA 3KVLA 3MUY1 2ZUMA 4GO8A 4ROQA 5JQ9A 1QRQA 1S5VA 1HJWA 1V0MA 3VMNA 4KCTA 3LM3A 1F74A 5CC6A 3N17A 3L4YA 1YXCA 2CLLA 3H4GA 3W01A 4GRSA 3M43A 2ABBA 4UOJA 3KVJA 2XVKA 5BWAA 3PZMA 3IV3A 4PBGA 2AQOA 4IP5A 3KP1A 5XIMA 4X0VA 3ZJ8A 1ITXA 4FOKA 4HK5A 3PR2A 2Y5JA 1GWJA 5F4WA 1S38A 1ADDA 4PL2A 3UJEA 1JD9A 4MG4A 1XYCA 3CHVA 3UXIA 1B9ZA 7ODCA 1KTBA 5ABTA 3A13A 4LY8A 2VVSA 1XC4A 5CZKA 1JG9A 4LVFA 1EOKA 4U2ZA 4I9JA 4GUGA 3GTXA 4GUHA 3THUA 4IISA 4LOCA 5CBIA 1QBBA 1KXHA 4LSBA 2O9TA 3K13A 4S3FA 2BY3A 3P93A 3V7PA 3TYBA 1UP0A 1CZ1A 4LUJA 4B9ZA 3WLLA 2FTWA 1J12A 2A3HA 1IIGA 4EANA 4L1GA 4OJYA 5AYZA 5CQ1A 4ZFMA 5DMNA 3QR1A 3JZEA 1FDZA 5K4ZA 1KXQA 2GDQA 3PZVA 1XIJA 4OBRA 4MHBA 2ZTKA 2XH2A 4HA0A 4JQ3A 2CPUA 5C8BB 3BQ5A 1GYMA 1R3YA 5CZSA 1PIGA 4PE8A 3V0SA 3NEVA 2F84A 3NQCA 1R0MA 3GXDA 1WPCA 2F6KA 1R8LA 2IW0A 3V1HA 3IJ7A 4GY0A 2QR6A 1EX5A 8TIMA 4IGSA 2WMJA 1K6AA 1Z32X 2FVKA 1SFTA 3LHUA 2PDYA 3CT7A 1TRDA 1ELSA 3I7QA 3HTWA 3PC0A 2G3FA 4BZYA 2Z6IA 1QNSA 3ITLA 9XIAA 2RDTA 3TJXA 4E5TA 4NAEA 3VOGA 1K9TA 1ZSXA 4GYJA 5IOBA 1H7XA 3WDJA 3NL5A 3H24A 4WVXA 4C6KA 2XVGA 3TEVA 1FWAC 1GONA 2O9OA 1MZRA 2QDGA 3H53A 3U2OA 4YL2A 1NOWA 1NP0A 4INFA 2VFGA 1CXIA 4YPJA 3DZ1A 3OP2A 4Z2GA 1YDVA 6XIMA 4KT2A 4BF9A 2D69A 1VIWA 1JAKA 2YIHA 2ZFAA 4AF0B 4MNKA 2HVMA 2WVVB 3DFQA 2FVLA 3P84A 1NDWA 3EWZA 5B80A 2XH0A 4NNCA 4DJFA 5D8WA 1CXFA 4GX8A 3WFZA 4MPKA 2IKJA 3S3GA 2X1TA 4LVGA 3FXGA 4ZR8A 2ICSA 1R6WA 1V02A 2UY5A 4HHMA 1PKNA 1JJKA 2E1DA 2HSAA 3LPOA 1VFUA 1CYGA 1V3IA 4Q6JA 3ARWA 1UKTA 4KRZA 2V6AA 1BD0A 2OYMA 3D47A 1WDDA 4PUMA 1GQNA 1PIIA 3MP5A 3MWAA 1Z41A 2RJHA 3VZXA 4DM1A 1R3WA 2W62A 2VZOA 4DJDC 5GNYA 4BF7A 1XCXA 4JNMA 2VZUA 3JR2A 3APTA 1I8JA 5BYWA 3UA3A 4EK7A 1B1YA 2KZHA 3MUXA 4E6MA 1BWLA 4GYPA 3L4ZA 1G4PA 1BTCA 3WCZA 1YE4A 5D02A 4AYSA 4CN1A 3KRZA 3WLHA 3GIYA 1HJUA 1XYMA 2JGQA 4HNOA 1VCFA 4M8UA 3QHMA 4RCXA 1CT5A 2CXEA 4HOWA 3VZYA 3A23A 3W7RA 4IMFA 1XLMA 3UW6A 1GKQA 1J93A 3W28A 4L6OA 2VFIA 3O8AA 5LGXA 3GYEA 1M7OA 4V2XA 3N4AA 5JU6A 1UR2A 5IBXA 4ZEPA 3FGCB 3RNDA 2PWFA 1T8XA 3THDA 3ZWSA 3GHUA 3LCLA 3B9NA 3L2LA 1BKSA 4GH1A 3ZM8A 1SYTA 3QV8A 4QE1A 5TF0A 3DFNA 3LENA 4FHAA 5M1TA 2XG9A 3S2NA 1SSDA 1SSGA 4US6A 1CB7B 4IL2A 2QIIA 3GHRA 1OC5A 1JI1A 3CWNA 2RGLA 3WEZA 2H8ZA 2UWFA 1C7TA 1Q65A 3T0AA 1GVYA 4TV6A 2V2CA 3V36A 5ABGA 4XD5A 4FOUA 1MW0A 2VFFA 1CECA 5E6ZA 3A5VA 2HS8A 2Q8XA 4GABA 1RK6A 1U5VA 3VOFA 1EFZA 4UTMA 3GRIA 4R9XA 3LERA 2PTDA 4TMBA 1IZKA 2W3ZA 5U4NA 2Y89A 5AFDA 4NXSA 3CQ0A 1ZP3A 4B4HA 1QW7A 4UQ9A 4NSBA 2DEPA 4EOUA 5E0KA 5FD0A 5D2VA 4PTXA 2QPUA 3LLXA 3M0IA 2ISSA 3NNTA 4GX9A 3NQ7A 2W91A 4Q6XA 4AB4A 2Q8LA 3CWOX 3IJ6A 4UWMA 2VEGA 5G4HC 3KTXA 1EB3A 3ZT5A 3AU6A 3DG3A 4RDVA 2YL9A 3N6JA 3EXSA 3HV8A 4WDUA 4PFHA 5CGQA 1FA2A 2CZDA 2ZOXA 3G8RA 3G1FA 4IFKA 5BXPA 4LCSA 1XGZA 4ZOAA 1BAGA 3ZSTA 2NW0A 5CGTA 3BV4A 4AZCA 2P10A 1M68A 3V75A 1TG7A 4XZLX 2Y85A 1K9FA 3LNMA 3SY8A 2QPSA 3L5LA 2PWEA 3VDBA 1EQCA 5JIWA 3PPHA 2G3MA 4ATDA 2HNEA 2VDHA 3M07A 5C55A 1FUYA 3C2VA 3WBXA 5BCAA 1C91A 2I7GA 4JYFA 1IR1A 4GCXA 4G2DA 1DVJA 1DJGA 4UUIA 4F8XA 2RHGA 2XZ7A 5DX7A 5I5RA 1DYSA 3OVGA 3NYDA 4WGXA 1H7OA 4RDWA 1JRBA 4B5WA 5AHIA 2YGYA 1MVYA 5CSRA 4O15A 1WAUA 4DAFA 4LAKA 3SCUA 3W72A 2OT1A 2A4AA 5D9PA 4HPXA 2EXOA 4XK2A 2CZEA 3V1PA 3PM6A 4CN4A 3PBVA 1DORA 1DHKA 1IEVA 3WBAA 4JQ2A 4YCPA 1XWYA 3NZQA 3UWUA 2E6AA 3NQVA 1UJQA 5I2UA 4CCDA 3IV8A 3HQNA 5EB8A 1AMKA 4MJZA 1UPPA 3TVAA 3LOTA 2OOFA 4IF2A 1UD6A 2Q09A 5AHLA 1W1PA 1W54A 3GG8A 1RY0A 4C65A 3QPYA 1UW9A 4HSHA 4BK9A 1CTNA 2WOQA 4BI7A 4PUDA 3TWAA 3UNDA 2ZE3A 5D9OA 2AAAA 3KW3A 2VQTA 2NWSA 3TN5A 5J5DA 1AD1A 2GUUA 4L1XA 3UGVA 2YDRA 3OA3A 3RM9A 2P0OA 3NQBA 2WZEA 5F2GA 1UWTA 3FV9A 4I5XA 2FKPA 2JFEX 3VGFA 3B8SA 1TIWA 4NAFA 4H41A 1SQ7A 3WL1A 3UR8A 4QNWA 3S2MA 2I9UA 4V15A 3PZIA 3C5QA 4HNNA 3L0KA 2QCGA 1PHQA 5K7JA 3EAUA 4H4IA 1AW2A 3OG2A 3W1TA 4Q7IA 4QQ3A 1PKMA 4DN1A 4CD6A 4LC6A 3AALA 4RV8A 5DMLA 3VIHA 3LS9A 1XF0A 4K7VA 4IPLA 1N8WA 1VZWA 2O9RA 4U5IA 2FPYA 2QKFA 3LY0A 1NP2A 2J7HA 3PNZA 2GSJA 1SZNA 3S9IA 2GVJA 3UGRA 3NM3A 3K30A 4KGLA 4EXBA 4GQQA 3AIUA 2DJXA 1AZ1A 1R86A 5TAOA 1V7AA 2PWVA 3OYXA 2RGMA 4IH3A 3JUGA 1WB0A 3P67A 1S2TA 3S1VA 2H6RA 3TR9A 3G1VA 1CLXA 5C7HA 1RQEA 3E02A 3R5EA 2A5HA 2G4JA 2GDUA 1AFSA 2YBTA 3QLDA 1TZ7A 4Y8EA 1GQIA 1XSJA 5EYWA 1I0DA 4WY0A 3U3HA 3HMJG 1UBPC 2QMJA 3LXBA 4PMZA 3T8QA 1BYCA 1XS2A 3ENLA 8RUCA 2ISDA 3W23A 1FY6A 1X1OA 1K8CA 4A4AA 2D2HA 1W5NA 3U2ZA 3PJTA 4JTUA 4CN6A 2V3FA 3NZPA 4DO5A 3TYZA 3R25A 3HPAA 4PL1A 3H2FA 1WDSA 2QQ6A 3ITOA 2QUVA 5A6BA 3UZZA 2BODX 3SRKA 3SECA 4U3AA 1UMLA 1F2JA 1V0LA 4PRTA 1KM1A 1UD8A 3EYPA 3WDHA 3EOOA 2A2IA 4M7TA 1OG0A 3QC3A 4QXIA 2WJDA 2J7GA 3QY7A 4ZO8A 1S46A 5FJUA 1E4NA 2YL5A 3GNPA 4Q8VA 3CUFA 4TTUA 1JNDA 1JPHA 3MU7A 4MUPA 3VA8A 4Y90A 2XN1A 2OB3A 9XIMA 2UZ9A 1OZQA 3W37A 3JRKA 5CZTA 1TJ1A 2J27A 4GXWA 1E1CA 3EX1A 4RE0A 4US5A 4NILA 3FYPA 4YTRA 4PUKA 2V5DA 3EDFA 1KRCC 1B4KA 3MSRA 4TQTA 3RPMA 2BXZA 3NUKA 4S38A 3BAIA 3NGFA 1TPWA 4D6GA 4F0MA 3BCDA 3NGJA 2J79A 1HKMA 2A7NA 5REQA 4X60A 3GVVA 5CSSA 4QM1A 3WUBA 4P7QA 2BV9A 3CB3A 2J74A 4Z0SA 2CBVA 3RDKA 2AL2B 2V3DA 3ERPA 4DAIA 4ZB0A 2XFRA 4HU3A 1HF6A 1QPRA 4M6VA 2PDJA 4XO6A 5DQPA 3VIPA 4E8DA 1LRTA 2Y7DA 4XVDA 3W2JA 2G8ZA 1TPB1 3CAKA 4OT7A 3VILA 3F03K 3WF2A 1E5JA 1UROA 3ABRA 1F6KA 5A8QA 3F2CA 7REQA 4F66A 1XRFA 4CGTA 3T55A 1QI4A 1I2NA 5I77A 4WLCA 2VC5A 1J0HA 2NQLA 3UVIA 3WK3A 4FNTA 3GTHA 3EX2A 1DJZA 1MRQA 3QMSA 4IFKB 2PZNA 1F4AA 3L23A 3KCOA 2J4GA 4JTLA 4AZCB 4A8RA 1P6CA 3VNYA 4YVXA 2HPMA 4JX5A 1VJSA 2ZRUA 3WN6A 1SW0A 1MNSA 3C61A 1M9HA 1J5SA 3NQ6A 4NY2A 5DCBA 3BDKA 2V5JA 1W17A 2VOTA 5CPTA 2AAMA 3GU1A 3WENA 3B9AA 4HU4A 4KF1A 4LRSA 3QV9A 1YHTA 1C8XA 1SU5A 1Z8AA 4PB3A 3ISIX 3WK0A 4MTVA 3VIMA 3EB4A 1GZ1A 1KWKA 1IT7A 3H2CA 3A6OA 3UP8A 1J0IA 4V28A 4A8LA 3AIBA 1QHPA 4JQAA 4LB4A 1UOZA 1YXDA 1OYAA 3P3BA 4ERIA 3HPXA 1OHLA 1VB9A 4WHBA 5AC7A 1BGAA 1XC6A 1P0EA 1H41A 4MNLA 2D73A 2B7QA 3BICA 1W3HA 4M80A 2OZTA 3T81A 2Z1KA 3LU2A 3O05A 2F6UA 3VCNA 4A29A 3THAA 2Y24A 5JMUA 2EPMX 3O07A 1Q6FA 4QJ5B 1F9CA 1KFEA 5C5YA 1IV8A 4GVFA 3W22A 4NIRA 3A64A 3YPIA 4O10A 1QBAA 4UTWC 1GYNA 5FCZA 2CLPA 4E4UA 3AQUA 1RAKA 2UY4A 3N9KA 1OZMA 4MZ1A 2MUCA 3SQLA 1N82A 3QV6A 1AQHA 2RDXA 3DC8A 1KFJA 3ABSA 1R30A 4WQ6A 1UG6A 5HOSA 3WD3A 2E8YA 5FJTA 4PCFA 5AYXA 3SFKA 4GI8A 3C86A 1SZRA 3LHWA 1GOKA 3GC4A 2YA1A 3GFXA 5HULA 1CNVA 2PDBA 2PZ0A 2VCAA 2WV8A 4QR6A 4Y6GA 2YXOA 3WNLA 4GLEA 2QDEA 2PLMA 3CNYA 1LL7A 2TMDA 3L5AA 3BSMA 4M19A 1XRVA 1CXHA 2PI6A 1DP0A 3L66A 3WMBA 4MYXA 1I2OA 1OFRA 2ZXBA 3VIKA 4LTSA 1R38A 1EF3A 1EF2A 4REQA 1GPWA 1UQZA 2XGBA 1EC9A 1XBVA 3FEMA 3DGBA 3W70A 1RALA 4ZOBA 1FDJA 2QCMA 1CLVA 3TX9A 1FHDA 2AKZA 3IJIA 4Y8FA 5E6YA 4E4FA 3TLLA 4YMZA 3I7SA 2WW5A 5KSWA 1VFHA 4X9SA 2BHUA 3MCOA 4IPNB 4QBXA 1OX6A 4WDTA 2VVNA 1LM1A 1E0XA 1XBXA 4DPQA 1X96A 1UPMB 4DBUA 4EPKA 1R9YA 3SRDA 1TPC1 3AXHA 4K7YA 2YCLA 3BLKA 4NJJA 1TPUA 2BY1A 2D0FA 2I5IA 1GGOA 1QHOA 3DENA 3RAOA 2OR2A 2YCEA 1M03A 4CQBA 1NEYA 3KOWA 1NAL1 3DYMA 3CIXA 4YTQA 2EO7A 2C0AA 3PJWA 4WD0A 4DBSA 3W2NA 3EWBX 4WOQA 3UWVA 3GNNA 1VLIA 4KWVA 5H1WA 3AMGA 4GVIA 4ZBCA 5HNNA 1RPXA 4OECA 3ZR4A 4CLMA 4H83A 4TXEA 3VZZA 1SR9A 5L9FA 2DV0A 3PUEA 4Z1YA 1E6PA 1US0A 2CBIA 3RXZA 4IMAA 1OIFA 1BF6A 4NU7A 5KZDA 4G7FA 4MSSA 1TUXA 1HGWA 2BXYA 3F4DA 2WSQA 2W4XA 1GNXA 2BSLA 4WX2A 3H2NA 1ME8A 5KZEA 2V81A 3A21A 1FWGC 2ZX7A 1XISA 3CPRA 8XIMA 4S3BA 4YYFA 3LGEA 1JDEA 3OHMB 5GVJA 3HG5A 4O8AA 1JYVA 3H55A 3UJFA 3T6CA 2DDXA 3OQEA 4OUIA 1PCKA 5LNRA 1MRAA 4RJEA 1VBUA 3AWNA 3OVRA 2EG8A 3WSUA 4H9TA 3EX4A 5CG0A 4XVEA 2VX4A 4DI9A 1QT1A 4UFKA 2Q6ZA 4B5TA 1DXEA 4EKJA 2E1WA 4KW2A 1OK6A 3W6LA 3BSHA 3WLPA 1O95A 3VC6A 4IXHA 3HZ3A 3GE7A 2PD9A 2XWEA 1BKHA 2X42A 2Q3RA 3ARVA 4DZIA 2SFPA 3IJ8A 3KOYA 4NZ5A 4C6NA 4OGZA 1HG3A 2PFHA 4D8AA 4IMGA 5F2MA 5D9NA 4K8HA 1VFOA 2WSRA 2CKSA 7REQB 4OBTA 4YCOA 1KQZA 4H9XA 4LYKA 3F7JA 4O18A 4F0LA 3LHYA 2GQ9A 3DDMA 3FNDA 4FR6A 3MQTA 1VQTA 5CPQA 4LAZA 4IUOA 1PTAA 2C18A 1TWWA 3CIVA 4M24A 1A5OC 3PK7A 3MDWA 3G0UA 4L7ZA 3AXXA 4KPLA 3NOEA 1XH1A 1ECQA 1JDFA 3RM8A 3TW7A 4AZHA 3IGUA 2V69A 1VBRA 3CV2A 1AH0A 3UWWA 2ZXDA 3HGJA 4HPHA 1VR6A 1XINA 1B30A 4DO7A 3G6MA 1GHSA 3WD0A 4F0RA 3N3MA 2VJXA 1GOXA 1IEIA 1ZGDA 3IGSA 2JBMA 2PDCA 3TSDA 2FLIA 5CZJA 1FWEC 4QCFA 3BGAA 4NL1A 1JYNA 4D1JA 2PU0A 4PCPA 4M6QA 2AGKA 1CXKA 4QJ4B 5BROA 3PFMA 2D2OA 3S2JA 3VYLA 4L9XA 4GI4A 3FKRA 3ALGA 2CHNA 1BVNP 1BQGA 4WR3A 3DFHA 2NSXA 3F5JA 3QM3A 4XZMX 1GYLA 1SVDA 1NWSA 1YEYA 4YTSA 3O2LA 3R6IA 3UBPC 7TAAA 1UZ4A 3PANA 1R3RA 3WBWA 4IQDA 2IKIA 3PB2A 4JD4A 4ZOEA 3NFUA 3RYSA 3SO7A 3RU6A 5CC7A 1EA9C 3QW3A 4B9YA 2INEA 2WMIB 4PMNA 3Q45A 3CC1A 3B03A 2X0YA 4L64A 2J9YA 4CQDA 2E3ZA 1VHNA 4AD3A 2XHYA 1UZHA 2V68A 4S3AA 4RW3A 4QS5A 2QDDA 5HR7A 2ZBTA 3GXPA 5K9DA 1TPVA 2X1RA 3U2EA 3N19B 1LUCB 4DLMA 2OQYA 3KRUA 4LBSA 3SFWA 1ML1A 3AYVA 3U8GA 4DJDD 3CV7A 4H6RA 5EMKA 4PULA 5GJNA 4KESA 3UPWA 1Y0EA 4UCGA 5I07A 4WY0F 3A12A 4O19A 4YVPA 3OGVA 2FZ8A 4Q8MA 2B0MA 5H8MA 2H9AA 4WXZA 2D24A 1C8VA 1BYAA 4K1GA 3TYUA 3OEXA 3HG3A 1E9LA 3WQ5A 3WD2A 3AWOA 2OZ8A 3GU9A 2YDSA 3H4WA 3R79A 1W2PA 1WCGA 2V2HA 2H8XA 4K1WA 3EPOA 4TR9A 3BANA 2XH7A 4P5UA 1V6YA 3NO5A 1HKIA 4U2YA 1Z6KA 4M82A 4K68A 4TU1A 1T6MA 4WZHA 1N8IA 1ZENA 3MWCA 2BLEA 3QGAC 3MS8A 4GWEA 3U0HA 3UWYA 1KM4A 1AL7A 2QJGA 3T2QA 1GJUA 1KFBA 4AHOA 5A2CA 5GNZA 1VPXA 1BG9A 2E5CA 2PEVA 1ISWA 3CV6A 3R13A 4KCUA 3UXDA 3S47A 1KD0A 1A5LC 1UOKA 3V0UA 4D8ZA 1XFCA 4BA0A 3P14A 1S2WA 3TLQA 3A3HA 2I17A 2O56A 3LCXA 4EACA 1E6QM 2PUZA 2E09A 2B81A 4GQRA 4QDMA 2YCKX 3BJTA 1EX1A 3N25A 1WUFA 3IRDA 3GAKA 1R9XA 4IUGA 5EFFA 1NFBA 3WLKX 3C0LA 1NFPA 1TV2A 1OFDA 3SQMA 3PY2A 5CPSA 4DF0A 4HTYA 3BJFA 3NDYA 4DWSB 4KEVA 3IEBA 1F3WA 1FOBA 4UTTA 4MVAA 4OHQA 2O4QA 3LLFA 1QAPA 3ARSA 4ZOCA 4PMVA 4WJXA 2CCRA 4H3DA 1RSCA 4TVDA 1OSEA 5I02A 9CGTA 3MI2A 1JVNA 3SCQA 4AU0A 2ZRZA 3W7LA 4I8YA 3RLHA 2P53A 1KKRA 4MNJA 4B3ZA 4QROA 1IYXA 2E8ZA 1B3YA 3NURA 1EQPA 4AAJA 3VI2A 4GO9A 1BHGA 1KQYA 3V3WA 4X2PA 1Y65A 1HNYA 3CZEA 3KXQA 2JEQA 2JE8A 5D2WA 1P48A 1VKFA 2DT3A 3W29A 3FSUA 3L21A 3JU2A 3VUSA 1W91A 1JZ3A 4IP7A 3RU8X 1WDPA 1ZFJA 4JKMA 3URNA 1WAWA 3MV11 1G4EA 2BVTA 2ESCA 3J7HA 4LH8A 3MT1A 4O0KA 1C3FA 3KRSA 2OLSA 4CVWA 1OX4A 3IIXA 3E2SA 3HIJA 2J6XA 2D3NA 3STCA 4DBDA 4NYYA 3RX3A 1W9PA 3CLWA 3LUTA 3HPFA 4L9YA 1XRSA 3OG3A 4CD4A 2C8NA 1X97A 3TQ0A 1DJNA 4GI6A 3O0KA 4XIAA 4G9PA 3ARUA 5G1YA 1SFJA 2DUZA 4ATLA 3QHOA 5T8GA 3PTQA 3W7IA 4H9ZA 4DBEA 3BCJA 4DF2A 5BXTA 3IIVA 4QEEA 4DZAA 1GCYA 3GXTA 1THFD 4MAZA 1P1XA 3BTNA 3CMGA 1F6PA 3FDGA 3LD5A 1B0IA 3VGHA 4DQWA 2HBVA 3L12A 4LWWA 5HNRA 4EVZA 4QNEA 3RCYA 4HNTA 3VIIA 4MWAC 1KFLA 3PZGA 4DNMA 5DFAA 1XPYA 4M51A 3W6MA 4FEZA 1QWGA 4JX6A 4PGLA 4U33A 1JCNA 1EDTA 4C6BA 1UR0A 4JEJA 4KWUA 3NIYA 4H04A 4QITA 3MSGA 4IQLA 2XPKA 4HA1A 3LXCA 1R3SA 3CTLA 5D9MA 1JDCA 3Q65A 1AQFA 2WNQA 1ADSA 3AMLA 2E9BA 3O0FA 3QZAA 3NM1A 3CAQA 1Q6RA 3O6YX 4IHCA 3HFTA 1SUXA 3DFTA 3QYSA 5K9XA 3ANVA 1CGXA 1UH4A 1TZ9A 3DEQA 3ONCA 3P80A 3NZ1A 1E3XA 1PAMA 4BEUA 4GMEA 4FA3A 3Q58A 2C14A 4CQCA 3CMJA 1XLKA 4LB3A 1FXQA 2PS2A 4WDXA 3DH7A 2DP3A 2WZMA 3W53A 3UZWA 4XKYA 2YL6A 1XICA 3LRLA 5HJLA 1D7FA 2NXIA 4NUWA 5BRPA 4MWAE 3NPVA 4C6LA 1RP8A 2CLOA 1ZALA 2CLHA 2EPOA 2AMGA 3TWBA 1EXPA 1IEWA 5LHFA 4TMCA 3M7SA 4LX4A 1YNPA 3CUXA 3P0WA 4Y96A 2P50A 4JFWA 5FAGA 2XIJA 3SY1A 4FXJA 2H9AB 2QAPA 1TMQA 3IRSA 6CGTA 1K70A 1WYIA 1XV8A 4JL1A 3VKKA 3TZNA 2P0IA 1X6UA 3EDEA 1E9IA 4F2UA 3WL0A 7XIMA 4XKMA 3O7UA 3LNPA 4R7JA 3PP7A 1H1ZA 3WD4A 2DH3A 4CD7A 1FWDC 2V63A 3B0UX 4HNCA 1XQKA 3TN6A 5DT7A 5HANA 1LBLA 4Q4SA 1PL9A 1NFGA 1DQWA 5DY3A 3HPSA 4MMWA 3L4TA 4XD4A 3UZXA 3TOPA 4I3GA 5G4EA 3EDDA 3G1RA 3NSMA 3M0JA 2DSVA 4AY1A 4D6HA 3H7RA 4F9JA 1FRBA 3B04A 3AS0A 3XINA 1VCVA 2DFAA 4GC4A 5LA2A 3SR7A 4GQGA 1XYFA 1EWEA 3MBFA 2YA0A 4HMCA 3RRAA 1GZJA 2E6FA 1W3JA 1UB3A 3B06A 1E72M 4QLLA 1ZNNA 2J7BA 3NQFA 3RRXA 3TTOA 4FLSA 3N18A 1A0EA 2VMFA 2WKLA 3ID7A 4HNUA 2Z7GA 2DZPA 3SGZA 3QQ0A 1XFBA 5E1QA 1B2YA 4MIMA 1RLCL 1ITCA 1M1BA 1OC6A 1I0BA 2R1MA 1XHGA 2G37A 2DIJA 1V5XA 5M2FX 3DI1A 1X6NA 1KO0A 5ECUA 4O1BA 1OT1A 2NT1A 4MB5A 1CGTA 1W8SA 3FCPA 5DLCA 4GXMA 4P8WA 3SW6A 4D2JA 4Z1CA 2WLZA 3AHVA 1ME7A 4NVTA 1KBJA 4B2DA 4CU8A 1C7SA 3Q4DA 2GGGA 4PH6A 3UY7A 5HBFA 1TIMA 1ITQA 1WDQA 1BSLA 2XSBA 3AIWA 1WKEA 2XM2A 4AC1X 1ONRA 2FQIA 5CZ0A 2CZFA 3UFYA 2JIWA 2VXNA 3CB8A 3W2KA 3NL3A 1MNZA 4CQAA 5EA9A 3WIJA 5GJMA 1EHNA 3C56A 1VFMA 3ITVA 2DSKA 2Z7KA 1M7PA 3ONBA 3U48A 3CZKA 1TUFA 1AK5A 2WJFA 3OZYA 3N2XA 1V79A 3WLTA 1OYCA 2DVTA 1NQ6A 4X22A 1FWBC 2DT2A 3AUOA 1OADA 3QR3A 3EKGA 3JVAA 2PD5A 3FJLA 1YLVA 1E4MM 1G0CA 3W07A 1W5MA 4D6EA 1H1YA 1KKOA 1UH2A 1OX4B 1QO5A 1KLYA 2PDUA 1GVOA 2G4FA 3LHVA 1S5TA 2VHLA 3IJ9A 2V5KA 1AMYA 3TE9A 2VM8A 1IE7C 4CEXC 1XD1A 4D8LA 4JTEA 1ISYA 3ABZA 4O1DA 4IIEA 3B8UA 2Y7EA 3GD6A 2NQHA 2XVPA 1DIOA 1FP9A 1C90A 3BWWA 1R7OA 3STEA 1VRXA 4NG3A 1UR4A 2QGHA 2QNEA 4DXXA 1DJYA 1KV5A 3LBMA 4NZFA 4AZIA 2HROA 3M4HA 1UKQA 1TR9A 4GY7A 1JCXA 3WQOA 1A53A 4KETA 3D3FA 1A49A 1RPKA 2DVXA 4NX5A 1N55A 5C2XA 1MW2A 4A8NA 3VD3A 2A3LA 1A5KC 1UWUA 4J3SA 1WXJA 5AC6A 4I90A 3KBNA 4P7LA 3W38A 1BYBA 3KL0A 1WO2A 2XFWA 2H3BA 4HYWA 3HB9A 5D09A 1W1TA 3CIWA 3NZRA 2GK1A 1K8XA 1N8FA 1J2WA 3H4XA 2J88A 1H0IA 4DX3A 1SGJA 4KGJA 1XRTA 3GXMA 2X16A 4A21A 3MTWA 2W9MA 1ISZA 2PLCA 5LA1A 2W61A 1AG1O 4LCRA 1XLFA 3N73A 1FHLA 4IIDA 1M3UA 2ZA3A 1ZCCA 3WUGA 1K77A 3VX0A 3R43A 2VYOA 4BFAA 2XIBA 3R89A 2EPLX 1PE1A 1G7VA 1RUSA 1K9EA 1D9EA 1TVNA 2DZTA 3G6LA 3O3RA 4XKYB 3W9ZA 1VC4A 3EOLA 3IK2A 5CJMA 3NQEA 2VDGA 5TIMA 1XP3A 3KVMA 1P4CA 2JEPA 3S9ZA 3N15A 3USZA 4LALA 4E8GA 2J25A 3ATZA 3ARQA 2G95A 2ZZ1A 4H7ZA 3VIJA 2PWUA 1ZAJA 4FI4A 4I8DA 3ZVHB 2F2KA 1ZJBA 1BVZA 1ZHAA 3H6OA 3TKFA 3TTQA 3VMPA 3CL8A 4C5YA 1K7FA 1XYLA 3CUJA 1J5TA 3ZLFA 1JUEA 2Z1XA 2I5GA 4O1FA 3S6DA 3M6YA 3LTPA 1KBBA 3FX4A 1BQCA 3VKAA 3TYCA 4ZB2A 3ABOA 1XYAA 4C1KA 1X7IA 3WD1A 1MI3A 3QF0A 4WKAA 2TODA 1KCKA 4M6UA 4KWSA 3JZUA 4ES4A 3CO8A 4XX6A 4H9YA 3G5EA 3U4AA 4QG8A 4PEEA 2C91A 2JALA 1FWNA 4O0QA 2BXVA 1Q2RA 3UG3A 2OKOA 1MYRA 2GSHA 4FMVA 1PZ2A 3QFEA 4PEKA 3NSXA 3FY1A 3OU8A 1UWIA 1EO7A 1W5PA 5CAHA 1CDGA 1EZ2A 2YA2A 2X2GA 2DQWA 1I9CB 4H7CA 4M5PA 4LS1A 4MKSA 2Z27A 3GK0A 2H3DA 1RH9A 1YADA 3NO3A 1KM2A 3SGUA 3PZQA 1Q7MA 1S1RA 3IUDA 1MW3A 1Q6QA 1NWUA 3WNOA 3PJUA 2INZA 2Y8VA 3VNJA 1BWKA 2JIEA 1X98A 1UQYA 1OBAA 1F61A 4MFEA 4UR7A 2POTA 3QYQA 3AXMA 1C8QA 5BOOA 3P5ZA 3SN4A 3O9NA 5H91A 4JTCA 4JTQA 1YYAA 2C16A 1T8QA 2DZXA 3T9PA 2QT3A 3ABQA 1US3A 2BY2A 3WNPA 3M6DA 3S5OA 1OCJA 2AQWA 2GJXA 1XDLA 2W63A 3NPWA 3TK7A 3WLRA 4YXGA 1H7WA 2EG7A 3LSCA 5I6SA 2FJKA 2R1LA 3TYAA 1Q13A 3AFBA 1I45A 4QE5A 3W7HA 5C54A 2PMQA 3VNKA 3M0XA 1QJWA 3C2EA 2VEKA 3MO7A 1AW1A 4H1ZA 1SW3A 3SBFA 4IQJA 4FS9A 2AL1A 1EXBA 1GEHA 2E9MA 1I4NA 3V18A 2G3NA 3EXTA 4JXCA 2WMHA 4JDBA 4NHVA 4IMDA 4EIVA 3OZOA 2QW5A 5E09A 4PTVA 3UA4A 2HBXA 2ZCGA 4HN8A 3GTIA 4PTNA 3KL5A 8CGTA 2G50A 2QULA 4GIRA 2ZX8A 2QGYA 4C7GA 4E3VA 3CZLA 1L8NA 1VEPA 3DGRA 4BQ4A 3IPWA 4XZHA 5ABEA 1W9XA 1MDRA 5FJJA 2OGJA 1HJVA 1XQLA 5CPOA 5CLWA 1XLAA 4C6FA 1YTDA 1UD4A 2WHJA 2X1UA 4ZE5A 4Q8OA 2BP1A 1M7JA 2NV1A 4F40A 1S2UA 2XFFA 5G2IA 1VH7A 2VEIA 4UFMA 4NASA 2VT0A 1QI3A 2RDWA 1P0DA 1DXFA 4XSMA 1FP8A 4FX8A 4HMEA 1OX5A 1LRNA 2BVDA 2FPTA 4XSLA 1HVQA 3T40A 1OK4A 1XKYA 3CL7A 2REQA 4ADTA 3RX2A 3AMDA 4K3ZA 1DV7A 4FP1A 3MZNA 2D20A 1G9HA 4AZGA 3LZ5A 4JTDA 1IXQA 3SIZA 3VKDA 1EGZA 4I7VA 3N4FA 4HT3A 1DOSA 3DKJA 3M9YA 4C6CA 1KV8A 5CJNA 3L5MA 2C71A 4GNJA 3ZJKA 2GGHA 5E9AA 4H9MA 2ZC1A 5LNWA 4AD0A 1UR9A 3KRBA 5C9UA 3NG3A 1DWFM 4MJ2A 3U7VA 1OT2A 2XDFA 1DQUA 2QJIA 2ZX5A 4NQ1A 2J7EA 5CEWA 3KE0A 1P5BA 1RCXB 3T0CA 2Z00A 4QGCA 3SRFA 3LB0A 1IGSA 2BX7A 1DE5A 5U7SA 2GK1B 4IX2A 4L1WA 1A80A 3ZQ9A 2YLLA 3ALFA 3CAWA 2X2YA 1TELA 4KEMA 2VC7A 4UQCA 1TFVA 2DQXA 4N4PA 1QTWA 4KFPA 2W0UA 2Y8UA 1JIBA 3ABXA 4ZE4A 1FKWA 3MUCA 3F4NA 1NQKA 2VR2A 3TSBA 1TWZA 4HU8A 2CFFA 1PSCA 3C2RA 4LAUA 1XM3A 1EWDA 4C6JA 1HTIA 4A2RA 3LN3A 3WLSA 3EKLA 3DI0A 2ZWZA 1VS1A 4QEHA 6TIMA 1REQA 2ZKMX 2P76A 4DJDA 1KA9F 1JF5A 1KC7A 7ENLA 2XH4A 5FL0A 1J0JA 2WJZA 2JKPA 2A3CA 4NJKA 4JNYA 1O4UA 3A3WA 2WB5A 2Q8ZA 1VEOA 3OYZA 3CUHA 3L4XA 2CLKA 1U5JA 1MW1A 3KBSA 2YDAA 5FJOA 2R94A 4ADUA 3ARRA 1MFUA 1UWSA 2ZZ3A 3PG9A 2GSEA 3R7MA 3KCJA 3PHAA 4GA8A 1E15A 1YTEA 4AHQA 1X8FA 3IJQA 1PO9A 1XH0A 1FFRA 2FMNA 5TBOA 1S5MA 2G3IA 3B8DA 1I1XA 1R47A 4RZ5A 5DO8A 3VX1A 2IQ0A 3M44A 2UV8G 5GPRA 3GXIA 1JCTA 4YWIA 4ASTA 3SB0A 3MMTA 1VFSA 3L4UA 2VENA 2GVYA 3E5PA 3C3UA 3EB2A 3AAMA 1UYQA 3DFPA 2QHAA 4JN6A 1TSIA 1JZ4A 2EHHA 3FVMA 4S3CA 2DUXA 3N11A 3K8MA 4RZ4A 3W84A 3LEPA 1GG0A 3KBJA 3EOUA 2PTWA 3M64A 3UESA 2C13A 2ZDRA 4K36A 2INFA 5HUOA 3UT0A 2CLFA 5CBJA 2A3EA 3M7WA 1PVNA 4BQ2A 4K6AA 1E1FA 3CAVA 4QS6A 4XUGA 2OXNA 3VINA 4C91A 1V6WA 2ISWA 1TTJA 4NJGA 1T96A 2PDNA 3WK1A 1RJRA 2RFGA 2WVVA 1U1UA 2YX0A 3DG6A 3A4JA 3CZ8A 1W3KA 2PA6A 4MZYA 3ZLGA 3ZO9A 3SGGA 4R3UA 1EGVA 2WHLA 1OYBA 2WYSA 3W7CA 2ONEA 4HJFA 1X38A 3I10A 1CENA 4PSRA 3CV1A 3FEQA 5HMSA 4W9TA 5C9RA 2IUZA 2BOGX 4PZVA 1P0BA 1U1JA 2C6QA 3U9IA 5D30A 3PTDA 1N2VA 2W79A 3CJPA 3BE7A 1O12A 2I5QA 4JL2A 2PLJA 1VHCA 4JFSA 1YPXA 1TJRA 1H60A 4JFTA 1F76A 4H7VA 3GVQA 3GQYA 3WF1A 2O7SA 3GG0A 3SM0A 2YPIA 4GIEA 1EPVA 1OABA 1FWTA 3FK4A 1IT0A 2PP1A 1E70M 4AUBA 1RK5A 3U5YA 2OZ0A 3QPZA 4EAMA 1F4HA 4O1AA 2VWSA 2KX9A 2EEXA 3MC5A 1SMDA 2PRMA 3NQMA 1X1NA 3HQOA 3BGJA 2AMXA 4TO8A 3M5VA 1EH9A 1JNEA 4AY7A 4WRHA 1OGSA 2WLYA 4XZIA 5EKYA 1MEIA 1JCMP 3WLIA 4MWAD 2G3JA 1E6SM 3LV6A 1RVGA 1EYWA 3FOKA 3G1YA 1A5AA 4F48A 1PDZA 5F4XA 1S3HA 3OLGA 1KM0A 1T41A 4O12A 4AXNA 1EC8A 4RZ6A 5A5WA 4AWEA 3L9CA 4N9EA 1EL3A 4JTGA 4H8UA 3IVSA 1U83A 1H4PA 1MDLA 3H23A 3CT2A 2X30A 4JQ1A 4QLJA 7PTDA 4PRRA 3W88A 2XIIA 2CZ5A 4Y7EA 1QPKA 4J5NA 2FFIA 4JY8A 1LP6A 2J8GA 3ZSSA 3DG7A 3E74A 4ZQPA 4F79A 4FXFA 5IRPA 4C6PA 4QSFA 1VCGA 1JGMA 4RNJA 1OFQA 1RY8A 3CK5A 2XIMA 4Q8UA 1UA3A 1QASA 4JKLA 4XTIA 1A4LA 2FGLA 1RCOB 3TTYA 1V03A 3P82A 4IJCA 4ADSA 4ZZ9A 1W1YA 3PAJA 4E2DA 2ALDA 1V7YA 4ZQNA 4HGXA 4Z2LA 3EEZA 1UR1A 1VAHA 1GVRA 3UG5A 4B3KA 4OKDA 4E38A 4W7UA 1AA1B 5LIUX 3H54A 2C79A 3OIXA 4DXKA 3QPEA 5FA5A 3OLDA 3PULA 1FQ0A 4LNYA 4HPNA 2WZIA 1PZ3A 1DXIA 4IFOA 4DXVA 2CW6A 1OF8A 1TREA 3NDOA 1PIFA 4B90A 2X41A 1Y7VA 3INPA 2EKGA 1BF2A 4JHOA 2QJHA 1UH3A 1XGEA 3QSTA 4I7WA 4XZNX 3KX6A 5HJYA 1JQVA 1AH3A 1FBAA 3VCCA 3WF3A 4ZB5A 4LFYA 1KB3A 4BJHA 4WXYA 3B40A 1H0GA 5XINA 5D2XA 3U7BA 5I3IA 2VX5A 1OFBA 4FALA 3AJXA 3FA3A 2QYGA 1P43A 1REQB 2QEZA 4LGXA 4U3CA 5IXEA 3TMLA 4AXKA 1LRQA 3MBDA 4PFMA 5F4SA 5FJIA 1DWJM 3U6WA 5MHBA 1M5WA 3H7UA 3K4AA 3H26A 1XSKA 3GZAA 3G3MA 4HZ8A 3SCRA 3GU2A 4BHYA 3PWIA 4H8VA 5G1TA 1OB0A 2V9DA 1W1B1 4RXFA 5DXXA 6ALDA 1NWTA 4LUSB 4JIRA 4DYJA 1D3GA 2IPFA 1RQBA 1E6RA 4N9DA 2XGZA 1OCBA 2PDXA 2Z24A 2R82A 1YTKA 2YJQA 1J0YA 4W4QA 1GJPA 2EF9A 1KCZA 4C6QA 3MHFA 3EBVA 1MWOA 2E4TA 1OGBA 3A22A 2NVAA 5LGZA 2HK1A 4ZFCA 4B5UA 3WO8A 3SAZA 1ADOA 2HDJA 3B9DA 2XISA 4JN8A 1TKKA 1TPEA 4PYSA 5I3HA 4J7RA 1UCWA 1DIEA 1QW8A 1VGAA 4AWTA 2Y5SA 4UFIA 1SFSA 5AYYA 1V6UA 4XBJA 2OFJA 3P62A 1HZYA 1MXDA 2WANA 4FOJA 5DANA 1YW1A 4MY8A 4L4MA 3IIPA 2E40A 1OINA 1RVKA 4Q4RA 3CGTA 3E1F1 4DJFD 1DKWA 3CH0A 4AIUA 2IQTA 3M0LA 5HA7A 2V3GA 2P5NA 4Q7NA 3TA9A 1B54A 4HVXA 1H7NA 3E3HA 4PCNA 5CC5A 1WX0A 2Z2BA 4XZ9A 4ZCWA 1OFAA 2X0HA 4DF1A 1H11A 4LS2A 5AOUA 2OWXA 3WFAA 2GOUA 1XUZA 2D0GA 1EJUC 3POCA 3NQAA 1GOWA 3LYEA 3RMEA 4K8EA 4XWUA 1XPGA 3IWPA 5A2AA 3WH9A 4V27A 2HISA 1ZLPA 4MZ8A 4WCJA 5T9BG 1NOFA 5JH2A 3RLVA 1VJIA 1D3CA 1NWRA 1ZJIA 2I1OA 4MJMA 1WDWA 1K3UA 3HFYA 2ZA1A 2OSWA 3WJSA 4OOUA 4JN7A 3P0XA 4W8BA 3W82A 2XTKA 2I14A 3U4FA 5HWNA 4N6EA 3QXBA 1X1ZA 1K9DA 4O14A 1Z69A 4DVOA 4PC8A 5BXRA 3CASA 3BUVA 1LOQA 2G97A 5DRCA 1HO1A 3VD5A 4NZJA 3W27A 2WCSA 2E6DA 3BXWA 4B4FA 4A05A 3SADA 4OUEA 1VLWA 2JKAA 4YVVA 2WMFA 4HK6A 2CEQA 5F7UA 4EWND 2A6LA 2WMKA 3WQDA 2FZMA 5J8LA 3R11A 2BS9A 4JQ4A 2ZUSA 1GK8A 1YNQA 4M81A 3TZFA 1CI1A 3BZJA 3FA5A 4O13A 1WV2A 1TB3A 4DY1A 3TQVA 3MUZ1 5GNXA 4XD3A 3QEZA 3V0TA 2BGSA 1KWGA 3GUWA 1EBHA 1D8WA 1VFFA 4LVBA 2EGZA 3F2BA 1IF2A 1KR0A 4BR1A 1G1YA 2YYTA 2O55A 4J2MA 1EP2A 3NYZA 1EHAA 2PDQA 3C3NA 1EDGA 4S39A 1H1NA 5G4WA 4NZ4A 3LTSA 4QP0A 5I0DA 1ZS2A 1WXZA 4UTWA 4WSHA 3DHDA 4TV5A 5FSEC 3MP4A 5RUBA 1UKOA 4DYEA 1FWSA 4XAYA 3TAOA 3HQPA 3S5SA 4ICCX 4NRRA 2C7FA 4JCLA 3ARPA 3KTCA 3IARA 3LGDA 3U5UA 1EUNA 1E56A 2FZ9A 1CGYA 1VFLA 3GZ3A 4LEQA 2OTDA 3OVQA 1EPXA 3TN3A 1KR1A 1US2A 5A8PA 1TTIA 3AJ7A 3EMQA 2X1SA 4WEVX 4GZJA 3BZGA 2E5BA 2QCLA 3WQVA 3OGSA 5BMXA 4L5ZA 3G18A 5CAKA 3QJAA 2PSNA 5PTDA 4EPEC 2ZDSA 2HK0A 2AL2A 3HURA 4GUFA 5H2ZA 3RLUA 4AWSA 3ARZA 1LOSA 2A79A 3VNDA 2GWGA 4N7QA 3CS2A 4LCQA 4PCTA 1T7LA 4QDPA 3WH8A 1UIOA 3K1DA 5HPOA 1UUMA 3LHZA 3ELFA 3N6QA 3W74A 4U31A 3KBVA 1GOQA 1AJ2A 1LWJA 5I3KA 4A35A 4F0HA 4HNVA 3L4WA 1WOAA 1IXOA 3KUMA 3FA4A 5LXXA 1XGDA 1SO6A 1SJCA 3BLDA 2V3EA 1QWKA 3RUBL 1DJHA 5HMEA 4ZODA 5JIPA 1JAEA 1HT6A 3K4WA 4L4PA 3NQGA 2PDWA 2FIQA 3APGA 3W7EA 5E9XA 3WKZA 3FAWA 4NXKA 4ZQOA 3MVIA 1IEQA 3BMXA 1HKJA 4R7OA 3ANYA 3GNDA 1PZ1A 4WGHA 1HL2A 5J5RA 3WK2A 1WUEA 3W2LA 1XG4A 2OODA 1J4EA 1WXYA 3GR8A 4PUEA 1MEWA 3VU2A 1TMLA 4PMJA 1R3TA 3F4VA 4YTUA 4IPJA 2PC4A 3FJ4A 7A3HA 3WLJA 2QIWA 3NA8A 2XSXA 1LOLA 2ZQ0A 3STPA 4GD0A 1V3MA 4U10A 2A85A 4A3YA 2ODOA 1J8VA 1VBGA 2POZA 4WSKA 2GOKA 1JGIA 1XIDA 4IM4A 4H2CA 5EFDA 3WQ6A 1V0NA 1DEDA 4HD5A 5C9ZA 5D8ZA 1CPUA 5HWMA 4RDYA 1H5VA 5IHSA 4MAVA 2YB1A 3IGXA 3W87A 1AQMA 1B3WA 1DWGM 5LIWX 3G0SA 1VYRA 1V0KA 3RR4A 3RF9A 3T05A 4FSAA 4NJIA 1TA3B 3B0PA 2CHOA 4AIEA 2RUSA 3KHDA 1SZEA 1W1IE 3R8HA 2E9LA 1DWAM 4G56A 3WBYA 1E71M 2ADAA 3TXZA 3FJNA 5I78A 3FHAA 3EDJA 5TNVA 3TA6A 3I4EA 2JKEA 2ZTJA 4FNSA 3L2IA 3TAKA 4W8AA 2V67A 3L4VA 4W93A 2FFCA 4I6VA 5A95A 5I09A 4MADA 3APYA 1PUDA 1XIEA 4NNAA 1GVQA 3AYSA 3S9YA 4WSJA 3OHIA 1CGVA 1P7TA 4JYEA 4JPGA 3QBUA 5FF2A 1UP3A 4FX7A 1W9UA 2FGBA 3LPGA 1DQXA 4F2BA 3OZPA 1C29A 5CJ5A 4GZ7A 4GINA 4LY4A 1QI0A 1QNOA 6A3HA 4PMUA 4BWLA 2FB3A 3NOYA 2CBJA 2GUBA 1HJXA 3VVGA 3ARYA 4EWJA 4A3HA 4R5EA 1XYBA 1Q2SA 4CCCA 3PBYA 3WZ0E 1PPIA 1TQJA 3AMCA 2MNRA 4NI8A 4V33A 4B16A 1QFEA 3S1WA 5LIYX 3PZ9A 1G6CA 1FTXA 4JY9A 3URAA 3CYVA 4YHEA 3AS2A 3O6AA 3TSMA 3W86A 2NVDA 2HXTA 3BLFA 5DBUA 1RQHA 3BURA 3E96A 3AICA 3N9SA 1TVLA 1OQFA 3S8HA 4LPCA 4BQ3A 1RBLA 2Y8KA 4AC7C 3M0ZA 2V0TA 3VUPA 3GIPA 3EZ4A 4UZUA 2PGRA 1W8GA 1NH6A 3AOFA 4MLRA 3R94A 3W1AA 2OO0A 4F4RA 5E0CA 3UEQA 4DI8A 2WSPA 4LNCA 5CPMA 3T7VA 1T99A 1CXEA 4GISA 4Z1BA 1JUBA 3WDRA 4PMRA 1PCWA 2GPTA 4JS3A 3AU2A 2BZNA 1ITUA 3R58A 2W92A 4IGMA 3QZ6A 3VIFA 5JBEA 2ZUUA 3MDUA 3T42A 3LCHA 5A8NA 4PTDA 3NWRA 1EEPA 3UZYA 3A9BA 6REQB 3LK6A 5HAOA 5HPCA 1IQ8A 4R34A 3UY8A 2JK2A 3MCMA 3ZJ7A 4QX4A 3BLLA 2NVCA 4DWDA 2VQUA 3W7DA 5BOFA 1B9BA 3GR4A 3MSDA 4C6EA 1ZZMA 1TZZA 2W6RA 3EX6A 4HCHA 3H70A 4IPIA 1F05A 4DNHA 4GBUA 1PV8A 3E12A 4JCMA 3T2OA 1GOOA 4R85A 1QO2A 2NQZA 3FYOA 3Q2DA 3BW3A 1GVFA 1B3XA 2ZRXA 2DT0A 1SPQA 3DOPA 3CL6A 1SO3A 3AHXA 1DJWA 2ZVIA 5AN7A 2C19A 4NYUA 5FOOA 1VYPX 1EOMA 1JZ2A 3MJMA 2FPVA 4DYKA 1KTCA 2BG5A 3BAWA 1TV5A 3AUJA 4DM2A 3BG3A 2PCEA 2VGGA 4XV0A 3DIPA 2Z4GA 1XH2A 1FVPA 2VOMA 2IXVA 4XO7A 2V82A 3NTYA 5DXYA 4R88A 5EMJA 1JYXA 5KZMA 3TTEA 4PMDA 3TIMA 2CYGA 3GNRA 4I5RA 3SUTA 3CHFA 2YDQA 3H22A 2Z29A 1W0MA 2WCAA 3S5YA 3GG1A 4GK8A 1E6ZA 3PFRA 4UXDA 3W25A 1VPQA 2PP3A 3HU7A 2QF8A 4CU6A 2O9PA 2NXGA 2EJAA 2FDMA 5IHRA 3SURA 3TNOA 4GYKA 1IZCA 4M1BA 1CEOA 4C1LA 1S5NA 2V5LA 2WVSA 3QN3A 3NSNA 3VKBA 2NLIA 3UNTA 3S1UA 3EWUA 3PS7A 3D3AA 5HR6A 4YU1A 4J3ZA 2C0HA 2J47A 4HZMA 1MZHA 4KIRA 4DELA 3TCSA 3SDOA 1IWPA 2VCCA 1KRMA 1EJSC 4ZVJA 2ACSA 2TSYA 1HX0A 4C1NB 4ZL1A 2OGYA 2Y7FA 2CNCA 2YXXA 5KINA 1S2CA 3LPPA 2E28A 4O50A 3ZIZA 2A3BA 3GH5A 3WLOA 2J7CA 3DYPA 3LI0A 3D46A 1TWSA 4EPDC 3SSJA 5I03A 3BARA 1ONWA 4IG2B 4EPBC 3DBPA 2ALRA 3I4KA 3BO9A 5LHEA 2WMIA 3IAPA 4O16A 4FAMA 1GVIA 1FWWA 1E1EA 3GBDA 4GNKB 3VDAA 4WDWA 4RL3A 3AHYA 3WX7A 4CD8A 5EBUA 2QCFA 4OZOA 3RPDA 3BCFA 3GHSA 3CEUA 2W66A 2NXHA 1EJWC 2ZZ6A 3VKCA 3W1MA 3WMSA 1D3HA 1QHZA 5HXMA 1LUCA 2Y70A 1JULA 3LV5A 3MKCA 5AHEA 3SCVA 3VK5A 4JTAA 3F4WA 4L6DA 5A6SA 1LT7A 1UBSA 5FACA 5ECVA 1GUVA 3NPXA 3ZT7A 4JIQA 4CNOA 3S46A 3W7JA 3WH5A 4AZ5A 3R0UA 3O06A 1UD5A 4B92A 4DPPA 2AGTA 3OOQA 3WJZA 3BG9A 3COTA 7CGTA 4HPGA 1KTNA 1W9BM 4O1CA 1ICPA 4CVUA 1XIFA 3KBWA 3KLKA 1G01A 2DZUA 4PTMA 1TX2A 3VOHA 2YZ5A 1NF0A 3N2CA 4LJ3A 1P7TB 1PYFA 1V4YA 3E0IA 4EXQA 4Z2JA 3C6CA 3EOSA 1PB0A 3RM4A 3A9IA 2J75A 1I6NA 1EDQA 1XLCA 4H00A 3ES8A 1LDCA 3VDCA 2BMBA 1GKRA 5AHFA 5D4YA 1QOXA 3MHGA 1H61A 1V6TA 3VABA 4HMNA 3PUOA 4ICMA 3LDVA 1W56A 2DVUA 4NZ1A 3SQSA 2Q01A 3XISA 3SRHA 1E4IA 1JDDA 1EUAA 4IX0A 3K8KA 2Y7GA 3URBA 3GNXA 4DUWA 5ABFA 3LX9A 3REQA 4ICNA 3WNNA 4MWAA 3DFSA 2HJPA 1U2YA 1HKVA 5B7ZA 4U4MA 2ZE0A 1RR2A 2BB0A 3WBEA 4J3WA 4H8NA 5JVLA 2QS8A 3S42A 5AC5A 4ZTXA 3BLPX 3MI3A 1KRAC 5DT5A 2L5HA 3W1UA 4Z08A 1SJBA 2WKGA 4GKTA 1GTEA 4YTTA 1O7AA 4CNSA