2ACRA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acrA00
3B3DA 4XO7A 2PF8A 2PDFA 4MHBA 1SM9A 3WBYA 4LB3A 4XZLX 2DV0A 2PD9A 2VDGA 4DZ5A 1Z89A 1AH3A 2R24A 5LIYX 3UZYA 4GIEA 3GHRA 4DBWA 1QWKA 3LENA 3P2VA 4Q3MA 4PUUA 3CV7A 2IKGA 3UZZA 4HBKA 3CMFA 2ACQA 3G1RA 4PMJA 3GUGA 2IPWA 3DN5A 1AH4A 4LBRA 5C7HA 1AZ1A 4QXIA 3LZ5A 4GQ0A 2ACSA 1PZ1A 1M9HA 5LIWX 4LAUA 2IKIA 4PRTA 4GCAA 2A79A 2PDIA 4WDWA 3GHSA 3BURA 4H8NA 1C9WA 4JTRA 3LUTA 4EXBA 3EB3A 4I5XA 2ACUA 2FVLA 3FJNA 1S2CA 4QR6A 3N6QA 3LZ3A 3ONBA 3H7RA 3R43A 3CASA 4YVPA 3UWEA 3M64A 2PDMA 5HNTA 2BGSA 3O3RA 2FZ9A 4XVEA 3R8GA 3BCJA 3V35A 3R94A 4JIIX 1AZ2A 1VBJA 1A80A 2IPGA 2HE5A 4YVXA 3ONCA 4R9OA 1XF0A 3V0UA 2IKHA 4XVDA 4XK2A 2WZTA 5KETA 3LBOA 5JH1A 1XJBA 3COTA 4JQ1A 4YS1A 1X97A 2PDPA 3UYIA 2HVNA 2DUXA 4IJCA 4LB4A 4PRRA 1IEIA 2IQDA 2R9RA 1YNQA 1XGDA 1PZ0A 1ADSA 2P5NA 4L1WA 2ISFA 3NTYA 2HE8A 1Z3NA 2PDBA 4JQ2A 2DUZA 5LIKX 1S1PA 2F2KA 4JIRA 1PWLA 4L1XA 4H7CA 1K8CA 1OG6A 3R7MA 4XZMX 4FA3A 3KRBA 4ZFCA 3Q65A 1X96A 1ZSXA 2CLPA 2FZ8A 3UGRA 2PFHA 1AH0A 4GABA 2IQ0A 1PWMA 3BV7A 2WZMA 3CV6A 3MB9A 4XZIA 4XZHA 4DBUA 4EXAA 4PR4A 1Q13A 2IPFA 1RALA 2INEA 5LIUX 3EAUA 2PDCA 3ERPA 1IHIA 4IGSA 1ZUAX 3WBXA 2INZA 1VP5A 2PDUA 2QXWA 2BP1A 3BUVA 2PZNA 2FZBA 2FZDA 1Q5MA 1AFSA 2FGBA 1Z9AA 2BGQA 5AZ0A 5LIXX 4G5DA 3R6IA 4PUWA 1MZRA 1MI3A 4GQGA 4QBXA 3GHTA 2PDHA 4WRHA 4YU1A 2HV5A 1UR3M 2IKJA 3O0KA 4ICCX 3H4GA 3V36A 1X98A 1HQTA 4DBSA 4RPQA 4QX4A 4JTCA 3EB4A 4GACA 2IS7A 3S3GA 4WGHA 3F7JA 5HA7A 1EXBA 3M4HA 3C3UA 3H7UA 3WBWA 3LEPA 3UP8A 1EKOA 3VXGA 4XZNX 2PDJA 1US0A 3UZWA 4LAZA 4YVVA 2NVDA 2ALRA 5AZ1A 2HVOA 4JTDA 4GA8A 5JH2A 2C91A 4XAPA 2F38A 3R8HA 2PEVA 4JQ3A 3MC5A 4LBSA 3LN3A 3WCZA 1J96A 1LWIA 4WDUA 1RY0A 3UFYA 3CAQA 1EL3A 3R58A 2PDYA 1MRQA 4JQ4A 3LNMA 2I16A 2HDJA 4ASTA 2J8TA 2PDXA 2PDQA 2HEJA 1ZQ5A 3GHUA 3FX4A 3WG6A 3CAVA 3LD5A 3G5EA 2AGTA 4JTQA 2PD5A 3RX3A 3U2CA 4JIHA 1YNPA 1GVEA 5DANA 1Z8AA 4JQAA 3M0IA 1RY8A 3V0TA 2IPJA 2PDNA 1S1RA 3LQLA 4WEVX 2PDLA 3V0SA 1R38A 4XO6A 4HMNA 4AUBA 3D3FA 2NVCA 1T40A 1YE6A 1JEZA 2PDWA 2PDKA 3N2TA 1S2AA 2ACRA 4Q7BA 4OTKA 4F40A 1YE4A 4FAMA 1QRQA 3RX2A 1T41A 1ZGDA 4FALA 4JTAA 5HNUA 5M2FX 1HW6A 3RX4A 4WDTA 1EF3A 4WDXA 3UZXA 3QKZA 4FZIA 4NKCA 2PDGA 1PYFA 3DOPA 3Q67A 3LQGA 3UG8A 2I17A 4IJRA 1LQAA 3T42A 1FRBA
chains in the Genus database with same CATH superfamily
3BAJA 1G1YA 3CPUA 4KCWA 3FLUA 4ZENA 4OBTA 4J2PA 4N6EA 2G3FA 1FWIC 3STFA 1CLVA 1H7PA 4IG2B 1E4MM 3WLJA 2A0NA 3WLPA 2YFOA 4NJJA 1WXYA 3NZ1A 3PPHA 2XIJA 4QQUA 4RPPA 5DELA 3EWUA 3P2VA 3AHZA 5GJNA 4LJ3A 4XD6A 4HK5A 1FWHC 2B7NA 4HBKA 1FCUA 4AEFA 4KESA 4HHLA 3B06A 1XLFA 3UT0A 3W22A 3PF3A 1XC4A 3WL0A 3W23A 3M9YA 3TROA 3B8VA 4KQNA 3QV8A 2Y89A 3CT2A 3EOUA 2BFGA 1X8CA 3MY9A 4X9YA 1BPLB 4E0CA 3IVSA 1Z7AA 1UD8A 2UZ9A 1XQKA 2OJPA 1UZ1A 5FCZA 4REQB 1K03A 4H8NA 3R0DA 5AC5A 4HKPA 4GUHA 4H6EA 4RW3A 2F9RA 4QRNA 4PMUA 4JEQA 2QDHA 4YIWA 2ALDA 4EPKA 4KFOA 1M7OA 4LUIA 1EX1A 2NX1A 3ANUA 4LCRA 3GVGA 2ZUWA 2VEPA 1CGXA 3TX9A 1P0EA 2V5JA 2FZ9A 1B1YA 3CQ0A 3CWNA 1DWGM 2GWGA 3W71A 4NQ1A 2VDIA 4RDYA 3O07A 4N02A 1FTXA 1P6BA 3NO1A 2BXYA 1VCVA 1GOXA 4OWGA 2P0IA 1IZCA 3MYPA 1ZP4A 2YXXA 4U10A 4DF2A 3RM4A 3LCHA 3BAXA 1FDZA 1S3TC 4ZOCA 2CZEA 1P1MA 1DIKA 2R6OA 2B7OA 4F2BA 1FFQA 4DJED 1RBAA 3VKCA 2FMOA 1O5KA 1BGAA 1Z3NA 2QULA 3N4FA 1J6PA 4OBRA 5HWNA 3ARZA 1QO2A 4PSPA 1JYVA 3IK2A 1HVXA 4JKKA 1KW1A 5HMSA 4B5SA 1QT1A 3VGBA 2V3EA 3G8RA 5HMDA 1QCWA 3R7MA 4YMZA 1GVSA 1LROA 1NOFA 3H7VA 3VGHA 5K4XA 3HPZA 4JPGA 5BU9A 1KFKA 1NDVA 2WHKA 1NDZA 3WELA 2CKSA 4XV0A 3GU9A 3HZ3A 3F03K 1CXLA 4UOJA 4EWND 5A2CA 1PWMA 4AZ5A 3AZRA 3LMZA 2DIKA 1UA7A 1XXXA 4WKHA 3UNDA 1XLCA 3W2NA 3SFKA 2YZ5A 3G6LA 4W85A 3WQ5A 4DWSC 3HN3A 4G6CA 3WX7A 3EAUA 1EHNA 1LBMA 1JULA 1M7XA 4LOCA 2ABAA 5HOSA 5E09A 3EDJA 3GRIA 2NXIA 1GYMA 4B92A 1RJPA 2Q8LA 2YB1A 4HMEA 1ZRQA 1QPRA 1GZGA 1QNQA 4GMEA 3WEMA 1TZ9A 3EKLA 1OF6A 4GD0A 4FNQA 1K6WA 1DL3A 1MZRA 5CPNA 6TIMA 3QSRA 1RSCA 3OGSA 6TAAA 2NXHA 3ITOA 3K4DA 3PM6A 1HJWA 2RGLA 2Z1XA 4UCFA 3VCNA 5LGXA 5DMNA 5IDZA 3WDIA 1SO5A 4J35A 3ZR4A 1TZZA 4WY0A 2FPTA 2WCGA 3UGVA 3Q4DA 2EKCA 3PS7A 1HQTA 4XX6A 3BMXA 3EOOA 3G1DA 4YWIA 3M41A 1DJIA 4H9MA 3A3HA 1TV5A 4HTBA 4UTHA 2I5IA 1S2VA 3NEVA 1GVIA 2JIEA 3A24A 4M5PA 4CD6A 1PX4A 1XUUA 3ARUA 4B5XA 2NWSA 3WDJA 2GVJA 1SZEA 3ZVIA 1QU4A 4X0VA 4JTDA 3K4WA 3VCCA 3SAZA 3B0UX 2JQXA 2YOCA 3SCWA 1RCOB 3ANYA 4KFPA 3AS1A 1R3TA 3QY8A 1KFCA 2EG6A 4BK9A 1TJPA 1DWFM 4BA0A 1RY0A 1RR2A 4Y9MA 3VX1A 1Q2RA 4LXFA 5FEPA 4PFHA 1W5NA 4ZVJA 3QR0A 4M6QA 3QGAC 2CHOA 4FEZA 1ZCCA 2YCLB 3ES7A 2R1LA 1MUMA 2CPUA 2R8WA 1R9XA 1F6PA 4CU6A 3B4UA 4NX5A 3KTCA 5KITA 2OYLA 1RD5A 1S1RA 3KOYA 1G4TA 5GPRA 3MUCA 3ABZA 4M1BA 3VDHA 3N12A 4X22A 4HMNA 2POTA 1NIUA 1LJYA 4ROPA 4M8UA 3UNTA 2POZA 3E6EA 3GX9A 4HMCA 4OVXA 4MOZA 1DJNA 4KWVA 4MM1A 5HDRA 4LVGA 2B7QA 5HUPA 4F0LA 4LF1A 3KS6A 5K3VA 1EDGA 1PB0A 3ISIX 2PWVA 2EPLX 4JYDA 3FNDA 1JRCA 3OYXA 2PURA 2FPYA 4W8AA 4NAEA 2PODA 4NKCA 4HA4A 4O28A 4GLEA 3DOPA 3QGKC 3BE7A 3ZT6A 3C5QA 1G7UA 1I0BA 1MNZA 1GVYA 3RLUA 2QVNA 3GDKA 1M5WA 1JG9A 1V8EA 4JN7A 4W86A 2DSKA 1SJAA 3RG6A 4IIGA 1SSGA 3FIGA 2PDFA 3TJIA 2VD9A 1PE1A 2V3DA 3WDHA 2Q8ZA 3UZYA 1I8JA 3GHRA 1WDRA 4QHRA 3LHTA 2ZXAA 3CMGA 5JU6A 1LBFA 3EPNA 4PBEA 3FDKA 2ZDRA 2DSUA 3AIQA 3VMPA 5DF0A 1NH6A 1RCXB 4X2RA 2V69A 1BTCA 1KRBC 4AEOA 1ICPA 2HISA 3UCDA 3UCCA 2YBUA 3IJIA 5D2WA 2WKLA 3A9IA 1TV7A 2WLZA 4RE0A 4C6DA 1XRVA 3MSGA 3RFAA 2PRHA 1XIBA 5DEZA 3UY8A 4ORMA 2NW0A 3GH4A 3TN5A 3NOYA 2RDUA 2J7GA 4J27A 3WQEA 2YYTA 3LXAA 2CLLA 2WYSA 3FJ6A 3PNUA 2WKJA 3EEZA 4RKAA 1VR6A 5K9CA 3D46A 3VIGA 4LNYA 4LV4A 3DFTA 3SEPA 4MUPA 7XIMA 3PSWA 1OGSA 3XISA 2EPHA 1Z48A 2A3AA 2A3LA 1CYGA 4OOUA 2NXGA 4KH2A 1N82A 5DCBA 3IAPA 1OSEA 3DFHA 4PTVA 2FJKA 7REQA 1POJA 2ZXDA 3L5AA 3AXHA 3E2QA 3B40A 4H9ZA 1JL8A 1X97A 4LEQA 1NELA 4O10A 5HJLA 3S2LA 1UWTA 1WCGA 5IBXC 2RDXA 3AXMA 5F1UA 4DHGA 2QCDB 2C15A 3PTQA 1EEPA 1I2PA 3KXQA 2CKRA 4L1WA 2O7QA 1J6OA 2VUYA 2HE8A 1MQRA 3R25A 2PRLA 4XD3A 4JQ2A 5CAHA 2ZTKA 4IP4A 4O17A 4MDOA 1NTHA 3ZSTA 2AL2B 1LM1A 3GH7A 4PN2A 1OIMA 4XAYA 2GVEA 2W62A 4LQ1A 4DXVA 2GGIA 2BMBA 2V5KA 3BG5A 2J6XA 3VGDA 5DBTA 3BV7A 3LDVA 4PBGA 2J74A 4RZ6A 3SM0A 1HFBA 3NWRA 4ZZ9A 5I06A 4AZIA 1Q13A 6REQA 3T08A 2E8YA 2J9YA 3OO2A 3GTIA 2PDCA 3BL3A 1IHIA 5BROA 1W31A 4M6VA 1TMLA 3NQDA 5TBOA 3OQEA 4X0NA 4D6JA 1MW0A 5HR6A 4XB3A 1HP5A 3L66A 4GNKB 5KSWA 2YR1A 5M5DA 3K46A 1EFZA 4B9YA 3OQ8A 3KCLA 5A8QA 3WNOA 4KEZA 2RKXA 3PSVA 1MO0A 1DKWA 3EX3A 4RXGA 3U4FA 3N6HA 4QJ1A 4RXFA 3ZJ8A 3HQ1A 3H4GA 1PDYA 3BJFA 3SUUA 3WQWA 3TIMA 3NOEA 5K9DA 4DAFA 5IHSA 1XM3A 4YJ5A 3WNLA 3SRFA 3WLIA 3SW6A 4TMBA 3TKFA 4C7GA 4GZEA 4ZR8A 2PZ0A 1MQQA 1SW0A 5J04A 3F7JA 3LG3A 1EXBA 1QBBA 4M29A 3GFXA 3NUKA 2ZRXA 4P7LA 3BGGA 3W1XA 3BVJA 1Q4NX 1JCLA 4NUWA 3LEPA 1KC7A 1LG2A 3PWAA 3EKZA 3VXGA 1F3TA 1V6YA 3TK7A 3LHYA 3NSNA 5ENLA 1TTPA 3LCXA 4ZB0A 3MV01 1AJ2A 1K70A 3DFYA 2A2IA 5A69A 2OGYA 4P8WA 4UTUA 3BTNA 1MVYA 2J24A 5HQMA 4LBSA 3T2QA 3TEVA 4GI9A 4H04A 1J96A 2NSXA 3W7EA 1HNYA 4ZOEA 2E77A 3TQ0A 4PE8A 2EGZA 1QVBA 1Q7MA 1XIFA 1E9IA 1A5SA 4UTTC 3W24A 3LNMA 1U1HA 4PL2A 3P62A 1UD6A 4CEUC 1EX5A 5TAOA 1HN1A 3W1UA 4UTWC 4IIEA 4A8NA 3SURA 4US6A 2XWDA 4K8HA 4AY1A 3UG4A 3CAVA 4CQAA 4MMWA 4JDBA 2AGTA 2XWEA 5GJPA 1UP2A 3R4IA 3JUGA 2X09A 1ZL1A 5DANA 1JD7A 2VZUA 2X0SA 3WJWA 2OZ8A 3F4CA 4QISA 4HPXA 3SO7A 4H9YA 1E6XM 1J8VA 1KM1A 3LQLA 3NQAA 2NX3A 4URIA 2QQ6A 3POCA 2YSWA 2XSXA 1GT8A 1YE6A 1JEZA 2PDWA 4QROA 1OVDA 3CTTA 4ZOAA 1MFVA 2ZFAA 1OWQA 4OTKA 5FI8A 2ZXBA 4W5ZA 3IAQA 1NOWA 3CUHA 3HFTA 3TW7A 3S2NA 2HCVA 5HNUA 3I10A 3THUA 1I4NA 4DJDC 2QUVA 3UWYA 3VO0A 3CHDA 3W2LA 5MHBA 4GXPA 5LGZA 2C13A 2FH6A 3L2IA 2WVVA 1E6SM 3T44A 3EYPA 4TVUA 5I79A 2VDHA 3I4KA 1EA0A 5A95A 3POHA 5H6HA 2A85A 4E8CA 4Q6JA 4CGTA 3QY6A 2X8RA 3ZR6A 2QPUA 3P0WA 3NGJA 5I3KA 4LVDA 2D2OA 4FNPA 4C6IA 4L9ZA 3FA5A 5FF2A 1E6RA 3V5OA 2O9RA 3G1FA 1RPKA 3VABA 4CQ9A 4EX4A 4BF7A 3LBCA 1P4CA 1EZWA 4W87A 1V6WA 3ABRA 4NRRA 4Y7EA 4GX8A 4WSJA 1VYPX 4WQ6A 4I9AA 4PMDA 2CU0A 3LZ5A 4L9XA 3PTMA 3VOHA 1RH9A 5LA0A 2CNCA 1UD4A 3BCFA 3H53A 2VFFA 3HGRA 4HOXA 3L4XA 3P81A 1CWYA 3CB3A 3PANA 5E9XA 5HAOA 3MZNA 2QIWA 1I1WA 3BXWA 5C2CA 3BURA 3LX9A 4Z2KA 4D6EA 2OEMA 3BAIA 3LCGA 4WSHA 1R46A 5DMLA 3VZZA 1FCBA 1XLHA 3AQUA 2QCMA 4J3UA 3B8UA 1Z6KA 1V3HA 4XKMA 4MKNA 2A3BA 2X05A 2A6NA 1DWJM 2O9PA 1ZALA 5DQPA 4ZTXA 1E4IA 4YLWA 4NASA 4WY0B 1W2VA 1NVMA 3WJXA 1VYRA 4X61A 5CJNA 4OBSA 4RZ5A 1Y0EA 1V3MA 4ZBCA 3QQ1A 1XLLA 3BCJA 1VEOA 5BWAA 1F61A 4G7EA 1H1YA 3IIVA 4J4KA 5DCDA 1KGWA 4XK2A 2OCZA 1U1UA 4F0HA 2J62A 4WKFA 3TNBA 3UYIA 3OG3A 4PRWA 1FWSA 4I5RA 1FHUA 4JL1A 2F6UA 1MSSA 4RE4A 4PUEA 3TTEA 2R94A 4DBEA 4LVAA 4MFDA 2GJXB 4GYJA 1E5JA 2GGGA 2TPSA 3NTYA 2WNNA 2ADAA 4D6CA 2DZXA 3XINA 1X1NA 3VD4A 1XC6A 5GNXA 3G3MA 5EMYA 1C91A 2R1MA 1W1ZA 1DJHA 1FDJA 1X96A 2GDQA 3CUGA 2QR6A 1R3YA 3NSXA 3NDZA 2JGQA 1XIJA 3F5LA 5F4SA 1H2JA 1WV2A 1YTKA 5FEZA 5D8WA 3QQWA 4H4IA 1MNSA 1RVKA 2VENA 2WWCA 3VFLA 4XZIA 2WSKA 3OPSA 3MO4A 3MA8A 1VEPA 3LOTA 4MAVA 2YXOA 1J0ZA 3LK6A 2WJFA 3QW4B 2YA2A 1VP5A 3MQTA 5I5RA 3UPBA 2FFIA 4B2DD 3GDMA 1F8MA 1KB3A 2J78A 1G6CA 4NT0A 1MRAA 3BOXA 1NDWA 4NJKA 3V5CA 3N4AA 1LUCA 3IK4A 1G4EA 2WVSA 3KVLA 4RNHA 5G4EA 3ME3A 5JIPA 2OEJA 1CEOA 3MBFA 3TCSA 3KL0A 3HM7A 3U57A 1YKWA 1BTMA 3QW3A 4C6OA 3AU6A 5I0DA 3AYTA 4XD4A 3CIVA 1LOSA 4XG1A 1GQKA 1TB3A 5AHNA 3NGFA 1J2WA 3THCA 1KGXA 4CN4A 4CD8A 3EB4A 4QS6A 4PMQA 3SI9A 4L7ZA 4GE8A 2X7VA 1CLKA 5M17A 4J28A 1ZBKA 3M4HA 1AL7A 1YBQA 2PWGA 3ARQA 3WBWA 1LYXA 2BASA 3F1QA 5L6UA 3W6YA 4OHQA 4UFKA 3UXAA 5RUBA 1R7AA 2JKAA 1GTEA 1UP3A 3M6DA 3LYEA 2PA6A 3NCOA 2ALRA 4R5EA 4UTFA 1JD9A 1GG0A 4PB3A 3TA9A 4FR6A 1XLMA 2CERA 1FBAA 1UUMA 4O18A 2WHLA 4NIRA 1JPKA 4ML4A 3A13A 2D3NA 2QT3A 4ZQRA 4PZVA 4PFMA 4F2UA 3B04A 4LNCA 9CGTA 3GE7A 3KBVA 1I2OA 1EOMA 4H00A 1XG4A 4W5UA 2QPSA 4C6EA 2C19A 2VRQA 3H70A 3HG4A 2XIQA 1A5OC 3BLPX 4LC8A 1P0BA 4LY8A 3FKRA 3P60A 4CNTA 5C70A 2CBVA 2C0HA 2ZOXA 3FYYA 3PTKA 4MWAE 1UP0A 2GVLA 2VWSA 1UD2A 1Z8AA 1X6UA 2AL1A 4N0RA 4XO6A 4OQVA 5HPOA 3H2AA 1FWFC 1ZPTA 3TE9A 3NFUA 3M47A 1NDYA 2ACRA 2V2DA 1A4LA 1JF6A 1QRQA 4A05A 3MT1A 5D2YA 3EXRA 3WLKX 4OV4A 4OGZA 5BW6A 4WDTA 5DN1A 3RCMA 3PBVA 2DZWA 4FX6M 1JUBA 3VC5A 3SBFA 2FZMA 1I0DA 5DBUA 1RA5A 3P82A 4E4UA 2QCLA 5CC6A 3KWSA 3BK0A 3Q67A 3EWDA 3NVDA 4D9PA 2ZX6A 4KRZA 4Q4QA 4IOTA 5I23A 3E74A 4DY1A 3N2XA 3QZAA 4RJEA 2JKPA 4AYGA 3OVPA 3TWAA 2QUMA 2RAGA 4BWLA 2HROA 5XINA 1OM0A 4YTRA 3DKJA 3G0XA 3QKEA 3E5BA 3WQDA 1US2A 3A47A 4GZJA 2IKGA 2VM8A 1JNDA 3G6MA 4Y96A 1OK6A 4JEJA 1QNPA 1PTGA 2EKGA 5EYWA 6REQB 1P43A 4IFKA 4D8AA 2J6VA 2VGBA 3WQFA 3P14A 3SCTA 4KCVA 3TMLA 3F4DA 5I6SA 3S9YA 1QOQA 5DLCA 4AU0A 3KS5A 2J7EA 1K8ZA 4OJYA 4Q8WA 2Q3RA 3GXPA 5BXRA 1MXGA 4FOUA 4F2TA 3LI1A 3UZ5A 1Q6FA 2D22A 1BXBA 2WC3A 5XIAA 4Q4RA 1Q2SA 2PSNA 3E9AA 2CWXA 4LS1A 4YHEA 3QMRA 5CEWA 4HU4A 2ZCGA 1YRRA 2XVGA 3INPA 3G1YA 5A8OA 3CLMA 9XIAA 3M64A 3DERA 1PJ9A 2ZDSA 1GOMA 3NZPA 1A47A 4QSFA 3GVQA 2BGNE 4LRSA 4IXXA 3BCDA 2VWTA 2IPGA 4NVTA 1EQCA 3L7RA 3NQVA 1G94A 3UQNA 1XF0A 3TH6A 2IKHA 3OODA 3N2BA 1RQEA 1E1EA 3OA5A 2GGJA 5KETA 1NSJA 3DU0A 1RBOB 3AYRA 3UW6A 5I24A 3KRSA 3BSMA 3W27A 2E5DA 4H9UA 1JNEA 4LUTB 1FQ0A 3W1PA 1DJQA 4LU0A 1O1HA 3MTWA 4F66A 1S5MA 1O95A 3BW3A 1JZ8A 2XM2A 2O55A 5DRIA 1ICQA 4L64A 3C0JA 1O66A 3FSUA 1IXQA 1OGBA 3F4WA 1FXPA 3CU2A 1CECA 2YJQA 3D47A 3ITLA 1JZ7A 1VF8A 4UFLA 4DXKA 1Q6GA 4BCEA 1IE7C 2QLYA 4L1XA 3BW4A 3KRBA 4GZ7A 1OZMA 4Q6XA 4A29A 1UHVA 2IQ0A 1M68A 3GG7A 2FDSA 3CO4A 4ZO7A 4C6CA 3DENA 3M5XA 3L21A 2WPBA 1SU5A 4IMCA 2OU4A 4OU1A 3PZMA 1Q7QA 3QYQA 4Z2LA 4BQ3A 1BEUA 1Q6QA 4IJBA 1JI2A 1WDSA 2INZA 2PDUA 3L67A 1EIXA 4TO8A 1YXYA 5JBFA 4LUJA 3AMLA 3MCOA 1F4AA 3CK5A 4JL2A 3HPXA 1GWJA 2PE4A 2CLFA 2IXVA 3H4WA 4G5DA 3WMLA 1WOAA 1MI3A 4W8BA 1KFBA 3U2ZA 3WF3A 1WBHA 1GVOA 4MNJA 1QTWA 2IKJA 3MUY1 3ZJ6A 3V36A 3EWZA 2EPKX 2HNEA 1UASA 1FWWA 2WVVB 1KQYA 4J9JA 4QQ3A 2ZX8A 3T0BA 2BNJA 4JR5A 3H4XA 1TVNA 3OU8A 2J7HA 3LGGA 1CENA 2GQAA 4HN4A 2TMDA 3OZOA 4TTGA 3WLHA 3FOKA 2AQVA 4OV9A 4PEKA 1SZGA 3MV11 5BNKA 3UR2A 3WH7A 1XLEA 3WMBA 3OVQA 3M1ZA 1MUCA 4GH3A 3LM3A 2YX0A 4DWSD 4HZ6A 1SO4A 2PU0A 3TP4A 2GZXA 3L0NA 3M0LA 3D6NA 4CU8A 4IL0A 4GKTA 2G4FA 3PFRA 4LW7A 1GEQA 4GQQA 2D2JA 1AW2A 2Z29A 3KP1A 2ZX9A 1XSIA 3VMNA 1NU5A 2Y85A 4Q4KA 3FFSA 3W7JA 4ZGYA 2EG8A 1ONRA 4CNNA 1WZLA 1C7SA 1PSCA 3II1A 3G0SA 3QEZA 1S3HA 3N1AA 5IXEA 1AQHA 1AUSL 2VGGA 5I00A 2XIBA 4KIRA 4W8LA 4FF5A 3W7HA 4JFSA 5G1TA 4G9PA 4DBDA 3WDQA 1WKYA 4AD4A 4ROQA 3FA4A 3QFEA 5ABFB 2V5CA 2ZUVA 4JFVA 3N3TA 1A53A 2FLIA 4JIHA 3L0KA 3BC9A 3RCYA 2RGMA 3K13A 4JOMA 2X1RA 3M0IA 4KCUA 3RPDA 4WY0F 1JI1A 1CBGA 1F07A 1FA2A 3U3HA 5BZAA 2Q71A 3HJZA 1I2QA 1M53A 3MVTA 2EEXA 1Q6RA 3KCJA 5IDIA 3TSBA 4KERA 4G7EB 3S1WA 4MDPA 5E0KA 3WSUA 4I7WA 1PZ3A 4W93A 2BX7A 3OIXA 3WLTA 3T09A 3URQA 3KHDA 1H09A 4YCPA 5DMYA 2G96A 2WMJA 2X1UA 3IJ9A 3VAVA 1B4KA 3GXMA 1OFEA 3MWCA 3MDWA 3CEPA 4FNRA 3TTOA 4B5VA 2ZA1A 1JCJA 4C6LA 1O68A 2PWHA 2CXEA 4O1FA 4MZ8A 2G3MA 4KWOA 3GR8A 3QC0A 1D3CA 3VOCA 1GOKA 3RLVA 3UWWA 1IWBA 4LB3A 1I60A 3TZFA 1KFEA 4E2OA 3CBWA 4DZ5A 3MJYA 2JF6A 4LWWA 1R3WA 1EDQA 2NQ9A 3VFCA 3DG7A 1QR7A 5D03A 1FWDC 3UBPC 3UERA 2Y5SA 4A3UA 3M0HA 2BVDA 4MJ4A 4QG9A 3AMDA 2DW7A 3SY5A 4Q3MA 3O6CA 3OHIA 2YIHA 1I6NA 1VQTA 1KM4A 1KWGA 3TXZA 1ZNNA 4JTFA 4FLOA 1EPXA 4LYKA 5D9MA 1E40A 2VMFA 4TMCA 4H7VA 4M81A 1HT6A 3W00A 2ZQ0A 5C54A 1AD1A 2YKKA 2YYUA 4QAWA 2BLEA 1AQFA 3GXDA 2BHZA 4CCEA 3MMWA 1XDJA 1QBAA 4LVFA 5FJJA 4HMDA 3LUTA 3IRDA 2BY0A 3QYSA 4IFOA 1KRCC 1BXCA 3DHUA 1OK4A 3S5OA 3BSHA 2X0HA 1BWKA 1JDDA 3H7RA 2WOQA 3PJUA 4EAMA 5FD0A 1IXPA 1LOLA 1YYAA 2HQAA 5KTLA 1UPMB 1JDAA 3TU9A 2FGZA 4UIOA 4L61A 1MXDA 3LLFA 1M04A 5HNTA 7PTDA 2CLMA 5CPLA 4LC6A 4X3ZA 2BOEX 3JW7A 3W1TA 4C6QA 1Y5VA 4ZQNA 1YBQB 3KBSA 1NFGA 1KM2A 2H3BA 3OGVA 1ENUA 4ZTYA 3VIMA 3ATYA 1V7YA 1PL9A 3VIHA 4PUJA 3B8WA 1ECQA 2XH4A 1E71M 4AD2A 1HZYA 3WJSA 1GGOA 1V93A 4ZQOA 3LPOA 4F4RA 4JCLA 1YTEA 3QV7A 2VX5A 3NURA 1E6NA 1GHRA 1OCBA 3ABXA 1JPMA 5C9RA 4OUIA 4QTGA 2DUZA 3IIZA 5CC3A 4Q7NA 1R2TA 3VOIA 4JIRA 3TSDA 2DSWA 1E55A 1DXIA 2OZ3A 2PWUA 2OG9A 3B0XA 3WL1A 2OSYA 2XH0A 1HVQA 3ZLGA 1EBGA 1HKVA 1CW2A 1TPC1 1PBGA 1EWEA 1R2SA 1A5LC 3R0UA 4US5D 2CLPA 3MSDA 4XBKA 4AZGA 1QAPA 3PP7A 2XVNA 3FAWA 3TN6A 1WZKA 1GQNA 1H5YA 1VHNA 3N14A 2VC5A 2PMQA 2ZKMX 3EEGA 4FNUA 1G7VA 1J0JA 1RALA 4ZODA 3KE0A 3EDFA 4NL1A 3DG3A 3GG8A 1RV8A 4GX9A 4GHRA 1MEIA 5A8NA 4CNSA 4Q32A 3RIKA 1O94A 3AISA 4D8LA 1O4UA 2FZBA 3CH0A 4WUIA 5EKYA 2TAAA 1IR1A 2WHJA 1K7XA 3GWQA 3RM9A 5ECUA 4Z1DA 5GNYA 1ML1A 3IPWA 3ABSA 1XWYA 1EJUC 5EBUA 1K7FA 1QPNA 1XYMA 3F5KA 2OO0A 3T4CA 1KXTA 3EKGA 2HV5A 3FHAA 1LQ2A 1I75A 3AJXA 3DDMA 3C52A 4XIMA 1IEVA 3OVGA 4JIPA 1WX0A 4WGHA 2OVLA 1BWLA 3LMYA 3Q58A 1BF2A 3I3BA 2WMKA 2OXNA 3C3UA 4JN6A 1XD0A 2F84A 4PB4A 2E7FA 1KTNA 4HOWA 2NUWA 1FOBA 3NQ8A 3S46A 4PUMA 5CJMA 3VD7A 1DWIM 1Q85A 4QLLA 3R5EA 4IH3A 2AMXA 4A3RA 1W9DM 1TJRA 2QV4A 3ELFA 1FUYA 4C6BA 3W7MA 5I03A 2VR2A 1LOQA 4TV6A 3ES8A 3WCZA 3GIQA 1U22A 3L4WA 3UFYA 3CAQA 3GTNA 5AOUA 3GG0A 1X7FA 1PDZA 2BSLA 3FEQA 4FXRA 3U2OA 1EJSC 2XIOA 3C56A 2HPIA 5D32A 1CXFA 1OJXA 3UA3A 4DNHA 4LTSA 3BH4A 3VE9A 4XKYA 3BANA 4Q8QA 4O4VA 4Y2WA 5I02A 1FX6A 4HK6A 1LLOA 3OBAA 5G1MA 5I3JA 2QYGA 2PDNA 3HTWA 4O14A 3YPIA 2A5HA 1X1ZA 4MNMA 2W4XA 3ARWA 1P1XA 6ALDA 3GNXA 1ZBVA 1GKPA 3W88A 3APTA 1BRLA 5LXEA 3N2TA 4C6MA 4B91A 3WK1A 4HQVA 2UBPC 1T5AA 4FAMA 4NI8A 2VFDA 1KM3A 3OLEA 1XX1A 1QPQA 4Q4PA 3M0JA 2XUCA 4HIBA 1XLKA 4DYKA 5M2FX 3TTQA 2CLOA 1NFBA 3VDBA 4N9EA 1OT2A 2ZRUA 4EVZA 4WF7A 3NYDA 3BLEA 3AALA 3R89A 1B3ZA 1EHAA 1PYFA 3K5XA 5H2ZA 2BDQA 2VKZG 2HBVA 4F9JA 1FHDA 1RP8A 3WUFA 3FA3A 5ABEA 1ZS2A 3DKLA 4MKVA 3W6MA 4L9YA 4L4PA 3IACA 2ZVRA 2PTWA 1RAKA 1SM9A 4XWUA 1SZNA 3MUAA 4JS3A 5FJUA 4AZHA 3GXNA 2HSAA 1HJVA 4NZ5A 1D8WA 1V3LA 1XRTA 3WD0A 3W82A 5A6SA 2C1GA 4PMNA 1BYCA 3MKVA 4HOZA 2P50A 3W0KA 3FJ4A 3VKKA 1IWPA 4TUFA 4HSNA 2FDMA 5BRPA 1FXQA 3WDPP 2NX9A 1TV8A 4IG2A 1V03A 1OFOA 5C6MA 1YMYA 1ZZMA 3PWIA 4W7UA 1AH4A 5C7HA 3JVAA 1EUAA 1NOUA 3VOGA 2JF7A 2D23A 3SUSA 4PL1A 4E2VA 2OFJA 3URNA 5CGQA 2Q02A 4HT3A 1H7OA 3W37A 1EJXC 4O16A 4DJDD 1ZLPA 3V3WA 1TJ1A 3U8GA 4U33A 2QAFA 1FHLA 3PAJA 5HULA 1FWAC 1W1PA 2PC4A 3MI3A 4DX3A 4JHMA 1XDLA 1A3WA 5A6JA 3P93A 1OFAA 3PY2A 5D9NA 4RCXA 4GXWA 2WNZA 3S2JA 4GC3A 4UQDA 4I7UA 4RNJA 3PC0A 1J93A 1A5AA 2BGSA 4FXSA 5AHMA 1R3QA 4AC1X 3HQNA 3SN0A 3QH2A 1V6VA 1VFMA 3V35A 4NXSA 4HNLA 4JIIX 4ECLA 2IUZA 4DZAA 1V6TA 4MPQA 1B3VA 3DHDA 2Q3OA 1QDSA 1FY6A 1GONA 1W2PA 4DN1A 3NJ3A 1XJBA 3M5VA 2JALA 3OB8A 4QEHA 1G69A 1GQLA 4XZBA 4AQLA 4NG3A 5FIPA 4LB4A 3LERA 3QGVA 1M65A 2HJPA 4PULA 5DT7A 3BSGA 2JBMA 1TR1A 5FSEC 2VCAA 3PG8A 4TXEA 2P5NA 1MW2A 4I6VA 2AKZA 4GRSA 1C8QA 4P7NA 3WDRA 5MKGA 4F48A 2PDBA 1JDFA 3EDKA 4H9VA 3QOKA 3W7GA 1B57A 1J9YA 1QOXA 1XPYA 4E2BA 2P88A 2ZBTA 1E56A 1VPQA 5D2XA 1E0WA 2QIIA 3H8AA 1TPFA 4H7CA 4PCTA 2QF7A 2GUUA 4O13A 3NM3A 4MUZA 1KA9F 1YLVA 1W1IE 3H2MA 4KS0A 1QNSA 3BV4A 5FAGA 4DWSA 1F5ZA 2PFHA 4Q22A 4WGXA 2CZDA 4DRSA 2WZMA 3UPWA 4E38A 1O5RA 2X16A 3HBLA 2HNHA 4WSKA 4TV5A 3WFZA 2IPFA 1QJWA 5DRCA 3TFXA 2INEA 4JYFA 4ACZA 4H6RA 3EA2A 2Y61A 1S2UA 3BUVA 2CYGA 1SZRA 5FL0A 1IZJA 2E6AA 1W5QA 3LTYA 2BGQA 1IT7A 1V0LA 3AS2A 3RF9A 5EGRA 3R6IA 1KO0A 2Y0FA 1H3GA 3MW7A 1P7TB 4KEUA 3DFOA 2PS2A 4GVIA 3M0KA 3W2KA 4DF0A 2J66A 3EDEA 3B8IA 2CBIA 1EZ2A 3PB0A 1JIBA 1XIIA 4IXHA 4O0KA 1TE1A 3ZLHA 2PCQA 2X41A 5FF4A 1JPIA 4CEXC 5LYRA 3GTXA 1Q65A 2VFEA 3C3NA 1V0MA 3JU2A 4QITA 2YDSA 1W1TA 1E70M 1UC4A 2Y7FA 1Q6DA 3GH5A 4IPJA 3ZM8A 1WAWA 4YHGA 1EEXA 3N2MA 2GWNA 2E40A 4FX8A 5FESA 4IISA 1TPDA 1K77A 5EBAA 4H41A 1LT7A 4DYJA 3WLNA 4C7DA 5A6MA 3GDLA 1KXQA 3ECQA 3UZWA 4GUFA 5KZMA 4P8VA 1C90A 2GJNA 2JFEX 1J5SA 2HVOA 5FEXA 3R10A 4NP7A 3G1XA 3UJEA 4M7SA 4R34A 1B3OA 2QNEA 4EPBC 5DX7A 1NJJA 3UXIA 3NZQA 3LHZA 4PMOA 3GZ3A 4UOZA 4AF0B 5CSRA 5G2HA 6XIMA 2F61A 3VM5A 1LL6A 1TWSA 4JX5A 2RDTA 2HPMA 4DF1A 3TAOA 2OSWA 4WDUA 3BGAA 4DM1A 3CQHA 1DWHM 5EB8A 2ZICA 3ARVA 4MPKA 4R33A 1GW9A 4YN5A 2QEZA 1QWGA 3AAMA 3DESA 4FNTA 5D30A 3KVMA 3H2OA 4UUIA 3UCQA 4TVDA 3GLCA 1DJYA 4TIMA 1PPIA 3W1RA 3TR2A 1XBVA 4AG0A 5G2WA 3GDBA 2GGHA 4K7VA 4GI4A 3HGJA 4P7OA 3VIIA 2YCLA 2P1FA 1XLDA 1E73M 1WA3A 3DECA 5EMKA 3RAOA 1EP3A 4MWAA 2H90A 2X40A 2ZXQA 1YXCA 5C9ZA 3AIWA 4XZ9A 3TWBA 1QI4A 1E51A 3E2RA 1UKPA 2VVNA 3MMTA 3PN8A 2H8XA 1UPPA 3TN3A 1ZGDA 1TTQA 4GUIA 4MB1A 5AVHA 1J18A 4JZ5A 3R79A 3CEUA 2G3JA 1J0KA 3NNTA 2QAPA 5T91A 3N19B 1VJZA 4X60A 4HGXA 1L9WA 1R87A 3VZYA 1PHWA 4KWUA 4AB4A 2PDGA 2AOSA 1SR0A 4O0ZA 3UG8A 1YDNA 2J8GA 1WXZA 5H91A 4BKNA 3O9NA 3TC7A 1VBGA 1IEWA 3CIXA 4X63A 1O7AA 5D2VA 1JDCA 3URAA 1XISA 2CXGA 4AIUA 2GQ8A 1Q7ZA 3AMGA 1DPMA 3RRAA 2WCAA 3UXLA 3CL7A 4MJ2A 2YA0A 4HPNA 4AXKA 1YEYA 3UXKA 3VIPA 2IPWA 2VZSA 4AMCA 4WZHA 1C93A 1WPCA 3VTRA 1W3KA 5K2ZA 2B7PA 5CBIA 2AGKA 3DYPA 4U3AA 3ARPA 4LAUA 1KBLA 7TIMA 3K8LA 1Q66A 1HGWA 3SCQA 4DWDA 2CC0A 2YBTA 2E1DA 4K37A 1B54A 3PWGA 5JMUA 4CNUA 4US5A 4EXBA 4AAJA 1B3WA 2ZZ7A 4CCZA 1RXOB 5M1TA 1TVPA 4FPSA 4IWWA 4NZFA 3SY8A 2WQPA 3G1AA 3TLQA 1Z32X 3EPMA 3HV8A 2J88A 4EK7A 3S6DA 3S4TA 4WOQA 1E6PA 2DZTA 4S3EA 4FHAA 1HL9A 1GW1A 3STEA 5CGTA 2TYSA 1HKWA 5D9PA 2VEMA 2GL5A 1AZ2A 2HE5A 3SSJA 1H7WA 4MF4A 2B31A 4DNMA 4U28A 2DVUA 4UNLA 3V0UA 4F0MA 1ONEA 2GSEA 3IUIA 4V1YA 8A3HA 5IBXA 4EKJA 1CTNA 1VRDA 4A8IA 4U2ZA 3COTA 3DUGA 1KM5A 3M46A 4NU7A 4UQCA 1IGSA 3NL6A 2CBUA 2TSYA 1J0YA 2NWRA 2ZZ3A 3S1VA 1XYFA 4EPDC 1F76A 5K7JA 3SQMA 3ZJ7A 4D1JA 9XIMA 1XCFA 3PZUA 5F2MA 1VFTA 3LCLA 1GG1A 5IFTA 1S1PA 3THAA 3LHUA 2DZAA 2Q09A 3U9IA 2HXUA 1RK5A 3EWYA 2EO7A 1UYQA 1BQGA 4FXJA 3A4AA 2FB3A 3GBDA 3Q65A 3EOLA 3UG5A 2WZHA 4TX9A 1L6SA 5BXTA 1HJQA 1TJ2A 1XYZA 1OX4B 4HSOA 4HK7A 1TCDA 1A50A 2J77A 1JAKA 4RE3A 4MY9A 4KGLA 3W7PA 4AWTA 1B9BA 2VZVA 1JFHA 1F3EA 4XKYB 4EXAA 4GC4A 1NFPA 1TPWA 2PLJA 3GDRA 1FH9A 3PFMA 4QG8A 2BXVA 4UMAA 4K7YA 4BQ5A 1F4HA 3A4XA 4I9JA 4QSHA 3LRLA 4TQTA 5LHEA 3TQVA 3ITGA 2W61A 2XM1A 3OA3A 4C65A 4RNFA 2FZDA 1BF6A 2BXZA 2ICSA 4UWMA 4NRSA 2OOFA 1AW5A 4M3PA 1KBBA 4W89A 3W2JA 2OX1A 3NPXA 4P2VA 4HYRA 3O06A 1JXKA 1W9VA 4KT2A 3F2DA 4HNTA 4NZ4A 1JCNA 1RD6A 3S2MA 2BY1A 4DUOA 1B2YA 1YX1A 1PO9A 1QHZA 2ABBA 1G4SA 1TWIA 5AHIA 1FH8A 4POCA 3KRZA 4G1KA 4RPQA 3HO8A 3S6OA 2GGEA 3WF2A 4H83A 2VC7A 2B0MA 5TIMA 3S3GA 2VFHA 2Z7KA 4QNEA 3WO8A 5GNZA 3L9CA 3K1GA 3HQOA 3KBWA 4L1GA 4PMZA 1L2UA 4J3WA 2O4QA 2MANA 4OOZA 2KZHA 3CZKA 4D8ZA 2C3ZA 4H9TA 1XFBA 1GPFA 1UQZA 4C7FA 2WMIA 4WD0A 1RCQA 4ZSTA 3FN9A 1MYRA 1G5AA 1W3HA 4UTTA 1RK6A 3NPWA 1N8FA 1WYIA 3K4AA 4HSHA 4XAFA 5C9UA 2NUYA 5C8BB 2QS8A 4O50A 4MLJA 5G4WA 2D73A 5LNSA 1QPKA 1BSIA 2V2CA 3R13A 5HMFA 1CGTA 4UTWA 4B5TA 3P8JA 4FXFA 4MLRA 4RW5A 3H54A 1MRQA 5HBFA 2I16A 1VLWA 4WR3A 3LSBA 1XG3A 3CM4A 3SSZA 3ATZA 4CD4A 3N18A 4Q8PA 3L4ZA 2PP0A 5A6BA 1D2KA 4J3TA 3TR9A 2NLIA 4KBXA 4JTQA 3QTGA 3E2VA 1UMLA 3W83A 4M7TA 1QUMA 3IV8A 2ON3A 2DPEA 1KCXA 4AD3A 1XHGA 1HTIA 5FF7A 5DY3A 1YW1A 4KF1A 1BD0A 1DQWA 3AO0A 3ARSA 4U31A 3TQKA 5AC8A 4BEUA 2Z24A 1QXLA 1V79A 1ZB5A 1CDGA 2Y88A 5KEZA 5B80A 3MZ2A 1CNVA 1BKHA 4DO6A 1QNVA 1VJSA 4DJDA 3RXZA 1WQ5A 3BOLA 2B4GA 3L5MA 2Z26A 4DO4A 1EP2A 1T41A 2QW5A 2WO5A 4KETA 4JTAA 1XIHA 3TYZA 5FJTA 3P7YA 4JN8A 6XIAA 3UJSA 2BY3A 2I56A 2VL4A 4Z1BA 1FWBC 2FZNA 1BVZA 2Q01A 5TQLA 1U5HA 4ZCWA 3GSMA 1ISXA 3TJ4A 3LQGA 4BQ2A 3V16A 4GINA 1OD0A 1UH2A 1OINA 3BAWA 1FWGC 5MKGB 3LLDA 3N17A 1O1ZA 2OWWA 1L0PA 1KKOA 1OB0A 3GBEA 4UMCA 2J25A 4D1IA 1RP9A 2EF9A 3LXCA 4GYFA 4DWSB 2MNRA 1GTHA 3PZVA 4IIBA 4UB9A 5FJIA 4N4QA 1TWWA 2ACQA 1TUFA 3VIOA 2BWGA 4YPJA 3GUGA 1MDRA 1EF2A 1XQLA 2J4GA 3WENA 4DAIA 3NO5A 1DV7A 2ASHA 2D24A 4ACZB 4C6JA 1BFNA 4CU7A 4ATDA 1PZ1A 1LLZA 2XHYA 4YCOA 1KXHA 4DZHA 3RU8X 3NL3A 4WHBA 2A79A 5D9OA 4L80A 3TXVA 1UZDA 2YL9A 1XW8A 3UYCA 1JCXA 4FMVA 4WDWA 4LGXA 4DIAA 2YCJA 3C86A 1R0MA 3QPZA 3SRHA 1C9WA 3A5VA 1RLCL 4GY0A 1SPQA 3NR0A 4ZB5A 2ACUA 2VNCA 1F8IA 1JF5A 3N6QA 3WQGA 3EB2A 3KRUA 3DEQA 1GJWA 1N7KA 4M6PA 3TTSA 1KNWA 3VK5A 3T0DA 3QF0A 1A5CA 1HP4A 3QM3A 4ORIA 1VPXA 2QVHA 1KBJA 3K8KA 5GVJA 1SSDA 3F2BA 3KZPA 4FK9A 4G8TA 4M51A 3MS8A 4EACA 3QV6A 1XPGA 5LA1A 4GH1A 3WMSA 2XZ9A 1H49A 2E9BA 1NWTA 1DXEA 1E1FA 3LS9A 2XPKA 3VDGA 3WNNA 2HVNA 3TJXA 1WE5A 2WAGA 3CV2A 2V0TA 3GNPA 2CZFA 1XGDA 4XISA 5CZ0A 4R7JA 5HJYA 4GBUA 3THDA 1KCKA 2F2KA 2G95A 1CPUA 4IUGA 4Z1AA 5FA5A 2DT2A 1A3XA 2GJXA 1R3RA 2A3CA 2WB5A 4JTSA 4QJ5B 3A22A 2XSBA 2V3GA 3VA8A 1BXNA 2GYIA 4GY7A 3B05A 3PBGA 3TOPA 1JGMA 3ZS4A 3TYAA 1QFEA 4ERAA 2H8ZA 4HN8A 3AIBA 4E8GA 3BLDA 2DP3A 2DGAA 5BCAA 4NYUA 1WZAA 4MWAB 8XIAA 3KOZA 4D71A 4L6OA 4NI3A 1BVWA 1ZP3A 4D6IA 3W1NA 1DIDA 5I3DA 5JIWA 3MANA 4GO9A 3W01A 3TQPA 2QDGA 2WZEA 1DYSA 1E9YB 1BYDA 2CLIA 3C4UA 3DYMA 1LT8A 4PUWA 1WBJA 4PTMA 4QBXA 4FLRA 3E0FA 3ZT7A 3U7VA 3EXSA 3C6CA 1IGWA 1EGZA 4CQCA 3VIFA 4HYWA 5F2GA 3NAVA 2J7BA 4MWAC 3K2GA 3G1VA 1H62A 2G4JA 2WVUA 2OYKA 5CG0A 3S8HA 3N34A 2Z6JA 1XCXA 2Z27A 4GACA 3M0YA 1KWKA 1DWAM 1K1DA 3FDGA 4C1KA 3ORWA 1Q6EA 2NLYA 2RUSA 4AMAA 5ECVA 4EP8C 1A5MC 2FH8A 2YL6A 7A3HA 2G3IA 5BRQA 3NIYA 1NWRA 2PAJA 2Z2AA 4B5UA 4D2JA 4FP1A 3ZMRA 2P53A 4R7OA 4FB7A 1JAEA 4YWSA 4R9XA 1X1OA 3VMOA 4W84A 1ISYA 3KZSA 1UKTA 4J7RA 4ZO9A 3N25A 1KFJA 5HJXA 4O52A 3CH9A 4PMRA 5C7VA 4BI6A 1PIFA 2NT0A 1K02A 2YLAA 1UR0A 3PBUA 4FI4A 2EXOA 1BWVA 3GYEA 2ZE3A 4O53A 3AZSA 2PI6A 1S2TA 4HPGA 5E6YA 3ARRA 4BEQA 2J79A 3LTPA 3GVWA 2B81A 3VGFA 3PJTA 4TX8A 4O8AA 5M3WA 1EYEA 1FWNA 1POKA 2KAUC 2X2YA 3C2EA 3VIKA 3KBNA 4MGGA 1M7JA 3PZNA 3LU2A 3JZEA 3VKBA 1QOPA 2E28A 1GVEA 2QJHA 3EMQA 3S6TA 1KTBA 1SJDA 3TA6A 3PZ9A 5FL1A 4KWSA 4AWEA 3FSTA 3W72A 1PUDA 3E0IA 2VR5A 4QDWA 2W9MA 3EA1A 5DFAA 3SECA 1TSIA 1GOQA 2VC9A 1UG6A 3L4VA 1C7TA 1UCWA 1WNOA 4LVBA 3GTHA 3EX2A 4K2SA 4QLKA 3S0CA 2CLHA 5FJPA 2WM0A 1QHPA 2W0UA 1SMAA 4CCCA 4XSLA 2E3ZA 4I9TA 1X7IA 1F74A 1A0CA 1OX6A 4PC8A 1MWOA 2NV9A 3IIOA 4NXKA 2OT0A 4IPNB 2OODA 1E3XA 3WQPA 3CUZA 2XTKA 2PWFA 4K1GA 1AQMA 3VGGA 3H24A 3KX6A 2CWNA 3GXIA 1W9BM 1Q6LA 3VM7A 4MB3A 5EFFA 3D0CA 4XO7A 3N9KA 5CKSA 2VEIA 3URBA 4J3XA 2FTYA 3C2YA 4IQLA 4GPNA 2I1OA 3WK3A 2G50A 1TTJA 2ZUUA 1AH3A 3EMZA 4MAZA 3DGBA 3W84A 3MKCA 5LKYA 5LNVA 1YXDA 3MWAA 2PBOA 3FGCA 3IIXA 1GOWA 4ZEPA 5BWFA 3RN6A 1XH1A 1XYAA 1HJXA 2RH9A 3VUPA 3QXBA 4ZXLA 1AZ1A 1J79A 1TQJA 3BW2A 2X2GA 1XLBA 3TC6A 1W1VA 2IKIA 4A2SA 3TOYA 5HUOA 2EAWA 1NY1A 1ISVA 3GHSA 5J8LA 2E09A 1Z41A 3PBMA 4JFTA 2V5LA 4RE2A 3WNPA 1BQCA 5HNRA 5A5WA 1UROA 4PUKA 1FP9A 4UCGA 5C5YA 2Z1SA 1P6CA 3SCUA 1V51A 4LFYA 3S47A 1AMYA 1TIWA 2CLKA 2ZZ4A 2PDMA 2PTDA 2A4AA 3RU6A 4J3ZA 5CG7A 1HF6A 2R1NA 4A22A 1TA3A 4LY4A 1A4MA 3BARA 2ISVA 3VX0A 2Y24A 2P8CA 4XVDA 3T78A 2EPNA 3MSYA 1NWUA 2DFAA 3CQIA 4HP5A 2I9EA 4QM1A 3MP3A 1K9EA 2GOKA 1S5WA 3B4YA 1GOOA 2FVMA 2EQDA 4HZ8A 4IJCA 2INFA 3WUGA 2WMIB 2GJRA 3UG3A 3PUEA 3QTPA 1IF2A 5HINA 3A4WA 4IHCA 3WLMA 4IM4A 4L5ZA 1K4HA 2DQXA 1M01A 5E0CA 4HPHA 4LUTA 1PWLA 3B8SA 4V15A 3ID7A 4IPPA 1EYWA 5M03A 3ABOA 3ZFHA 1I1XA 1TRIA 4MNLA 2H3DA 4GXMA 4B3LA 5DT5A 2YCIX 3T0TA 3P74A 1J0HA 6CGTA 3DBNA 3T05A 4B90A 4F3HA 1ODUA 4Q8TA 2A21A 4I9MA 4ZE5A 4CQDA 5FEWA 4Z2JA 4C6KA 3ZT5A 4ATWA 4PR4A 2OZTA 4FOKA 5TF0A 2GSHA 1EXPA 2D2GA 1U83A 3WBXA 3B9NA 1NEYA 5FSDC 3BOFA 5D02A 2BP1A 3DHFA 2Q8XA 3MMDA 1FWCC 2BG5A 4PTNA 2BHYA 4UOQA 4QJ4B 3AHVA 4NNCA 5CH9A 3ANVA 3L2MA 4YTTA 5AZ0A 4HB7A 4MG4A 5AKQA 2MUCA 5I7GA 2Y4SA 1TR9A 1UWUA 1HJSA 4ONVA 3CC1A 1GZ1A 2AAMA 1W17A 5A2BA 3LPFA 3T55A 4K38A 3E2SA 1F05A 1VFUA 1T96A 4LF2A 4GNVA 1UC5A 3GFZA 1HUVA 1X98A 4GKLA 4H8HA 2Z28A 4PCPA 4ATLA 3S5NA 4WVXA 3LPPA 3HGSA 3G24A 4KGJA 4F79A 3NSMA 3WLLA 1MXSA 3VNMA 3U4AA 4TOQA 4M82A 4GYPA 1EKOA 1YDVA 1VFSA 2G97A 4PSRA 4BI7A 4EXQA 4YL2A 3QMTA 4KEVA 2VX6A 4M19A 3GAYA 1U5JA 1UIPA 3QC3A 5G5IA 1TTIA 3AHYA 4YXGA 4AFYA 2Z4GA 3QPYA 3BZGA 4JTIA 4DLMA 1KBIA 4GVFA 1QATA 2PTYA 1YDOA 1E72M 3P80A 1W1YA 2BODX 1HO4A 4G2DA 1M1BA 4L4OA 3T4WA 1KRMA 3HU7A 3ABQA 1EL3A 3D3AA 1EUNA 3R1ZA 2W66A 4ZO8A 2UY2A 4HTYA 1J11A 4X2PA 1TX0A 4IL2A 4IICA 1SJBA 1EC9A 4IMAA 2CW6A 2RJHA 1W8GA 3H2FA 3S5YA 4ACYA 3LHVA 1LTDA 3BAYA 3U2CA 5F2LA 3IRSA 1LCOA 1VHCA 5D04C 1RY8A 3MP5A 3PZTA 2IPJA 3PULA 2ZZ5A 2HK1A 2PDLA 5ABFA 4ICNA 3DH7A 1R3VA 4QFUA 3G18A 3AXKA 2ZUTA 2ZRYA 1FWJC 5GJMA 4F40A 3V7PA 4DI8A 5I3IA 4HNNA 3MDUA 2QCNA 1KM6A 1TWZA 1TELA 2Y70A 3WD1A 1UKQA 4ILSA 1PXGA 3F4VA 4DO7A 3GYCA 3DAQA 2XU2A 2YDQA 4JKMA 1AA1B 1SGJA 4FZIA 2V82A 4NYYA 3W74A 5D4YA 3WFAA 1U5VA 4LT9A 2XFFA 4AZCA 2DVXA 4DELA 1TV2A 3WY1A 1RQBA 5HK4A 1E1CA 2VT0A 3SJNA 3CUJA 4Q8MA 2HK0A 5LA2A 3PBWA 4Q7IA 4HNUA 4Q8UA 2DV0A 2PD9A 1UWAA 4JBRA 2E67A 4HCDA 3ALGA 4GJJA 1KKRA 1TREA 3VCRA 2A7NA 1GZJA 4O0QA 4MNKA 2XG9A 4QIUA 3TC3A 2OSXA 4RZ4A 3IGXA 4TVCA 4Z17A 1JZ6A 2UV8G 3H23A 2O4MA 3LM7A 1E0UA 2SFPA 3RITA 3T81A 3KOWA 4CVWA 1VS1A 1RJQA 3EDDA 4ERIA 3VPLA 1CX9A 1UOZA 2Y1HA 1XP3A 3CUIA 3K1DA 1OFQA 3VILA 1VEMA 3WD2A 3CHEA 1Z44A 3UJ2A 5CPOA 1V08A 1YPIA 1I9CB 1OABA 3CUFA 4AZ6A 4QDMA 1SYTA 3EB3A 2QUTA 4DUWA 4AW7A 2PLMA 2R1KA 3LCWA 5AYYA 4HJWA 3UWVA 3MBDA 1DQUA 4PUNA 4S3AA 2OYMA 5E5CA 4ERGA 1TVLA 4A21A 3DFNA 2CIPA 3DZ1A 3I7RA 4E3TA 4EAYA 5CPMA 3MJMA 2X7WA 1B31A 2W92A 5F2IA 3EWBX 4PCNA 4PEEA 3RHGA 1UZHA 4PBFA 1JQVA 2DJXA 3HPAA 4B9ZA 1EO7A 2GDUA 3ZZ1A 3TUUA 4C90A 4K1WA 4R9OA 2ZVIA 2OT1A 1IQ8A 2DEPA 5CZJA 1XD1A 3KW3A 4XUYA 2PBGA 3W02A 1XINA 3PB2A 4HNCA 4MB4A 5CPQA 4ES4A 3DC8A 4Z2GA 2QUUA 3T40A 3WH6A 1F73A 5AECA 3GVRA 3M43A 1SO6A 1IR2A 4GOAA 1IEXA 2YZRA 1ADDA 2E25A 2Z1KA 2ZADA 2DIEA 1V02E 8XIMA 1B9ZA 4UBPC 3CUXA 2JEPA 3SRDA 1TV3A 1YNQA 3FEMA 1PZ0A 1UKOA 1OY0A 3QFWA 3VD9A 4JDYA 2VYOA 1B90A 4I8DA 2C1IA 2NQHA 3PAOA 4V28A 3T0AA 1D3HA 2NUXA 2XGIA 2Z25A 4XZWA 3M0MA 1H60A 1OG6A 3OP2A 1UR2A 5I3HA 4ZFCA 1P6WA 3KWXA 1YDYA 3WK0A 4NNAA 3C2OA 5JVLA 1E4LA 4GABA 3JS3A 4A8LA 1H5VA 2GSJA 3CV6A 1QMLA 1JQXA 2VXNA 4O8RA 1QHOA 3ITCA 4XZHA 1H1NA 3Q94A 2YDRA 5T8GA 2A7PA 4KEMA 5F4WA 5A8MA 2X30A 1NP0A 5D2TA 1FH7A 1CGYA 2V38A 3A3XA 1HKIA 3IGUA 1W37A 2CFFA 3BLOA 2PGRA 1YHTA 4IMDA 3PVFA 3LRKA 5CZKA 1P48A 3EOSA 4JX6A 3AS3A 3REQA 3BG9A 4JX4A 4IQJA 4D6FA 2WC4A 3WNMA 3IJ6A 3GW0A 3G2GA 3GNDA 2NQLA 3N73A 3STGA 4K36A 4WRHA 4OE7A 4YU1A 1K9TA 4JY9A 3TFCA 4IX2A 1VBUA 3MVIA 3L4TA 2DSZA 4NILA 3NQMA 4LV9A 1ME8A 1V3JA 1R8LA 4KIEA 4UTKA 4ALDA 5HA7A 1ZAHA 3KBMA 5HWMA 4PYSA 4DUXA 3PPFA 4GK8A 4GIRA 4W4QA 5HNNA 3WQ6A 3GO2A 2ZUSA 5D38A 4AD5A 4MIMA 4HZ7A 2YA1A 3UESA 2XFYA 2Y7DA 3SDOA 3W25A 2C14A 4UMBA 2EG7A 3TLLA 4AD1A 1OIFA 3TSMA 1D8CA 3FXYA 3BLFA 5CSSA 4G1NA 2BY2A 2C91A 3FGCB 4WXZA 2FYMA 1RJRA 4K39A 4HHPA 3EWWA 1XBXA 3UWUA 2PEVA 3M7SA 3ZO9A 4O1EA 4LRTA 1IIGA 3B9EA 1TUXA 1DEDA 3R11A 4Y9NA 1C29A 4HA1A 5A2AA 5CBBA 2ZIDA 3Q37A 2WHMA 3U6WA 4NHVA 4JQ4A 1WOBA 1SUXA 4EF8A 3MI2A 3C2FA 1XLGA 3CHFA 2Y7GA 1ELSA 1CGWA 1BG9A 1PKNA 1ZQ5A 4EWJA 3I3DA 3FX4A 2CHRA 3MKKA 3MI6A 4ZQMA 4H2HA 2FIQA 1G01A 3LXBA 1PYMA 3P67A 1R3SA 3PR2A 1US3A 4B4FA 1M7PA 2DU2A 1JR1A 4HNOA 3DFPA 1T40A 5EA9A 1CT5A 1TJ0A 1TA3B 2DZUA 3IJ8A 1OFPA 4BFAA 4TTUA 1EJRC 3CWOX 2Y5EA 3IJ7A 1SQ7A 2PTZA 5FACA 3DCPA 1OHLA 3DFSA 1XBYA 4GG9A 4MFEA 3SGUA 1GOIA 3APYA 5B7YA 2XYLA 3VNKA 4S38A 3W4RA 1OZQA 1UBPC 2QUNA 4FF7A 1T8QA 3TV8A 4U3CA 3EMCA 2DY3A 4RNIA 3JRKA 4A3HA 4NZ1A 5A8PA 2NSOA 4AHQA 1JCTA 1CCWB 3S42A 3B97A 2E5CA 2LLEA 3NQ7A 1DE6A 3OZYA 4QS5A 5AYIA 2PF8A 2D1ZA 3AYSA 4MHBA 3W7QA 1EC8A 3CXOA 3LHWA 3QPEA 3IGSA 3C0QA 1C8YA 1ZBWA 2W91A 4BS0A 1F3XA 3P84A 1VRXA 3SGZA 3WJYA 3LV5A 3KAOA 3LENA 2E6FA 3T8QA 3USBA 3SADA 4DJFA 1V77A 1S38A 2C6QA 3G1RA 2ONEA 3AIRA 1VBHA 4EF9A 2C71A 4J3VA 4B15A 4CNOA 2O9OA 2UY3A 4XBSA 5AC4A 3AOFA 3WYZA 1ODZA 1NWSA 1U2YA 4GCAA 1XIMA 3L4UA 4KFNA 3C8FA 3R8RA 2FFCA 1SZFA 3WQVA 5C9WA 4OUEA 2C1HA 1MEHA 3TNOA 3OGRA 2H9AA 3GNNA 3UETA 2E9LA 3UWQA 1H41A 2DZPA 3TW9A 1W5OA 4V1XA 1FCQA 3ONBA 5IM51 4PGLA 3G3DA 1SFLA 1Y65A 3RO6A 4AZ7A 4YVPA 3P61A 3UWEA 1LG1A 1AW1A 1JDEA 1GHSA 2G37A 2PTXA 2XINA 3Q2DA 3FY1A 1U30A 3O3RA 3CQKA 5IFPA 4XD5A 2VUNA 4K3ZA 1PCWA 4YVXA 2I9UA 1CI1A 1IEQA 3EA3A 1FKWA 1IIHA 1GCYA 2Z1WA 2EPOA 4XAZA 3M5ZA 2WSQA 1HKMA 1JCYA 4FS9A 3LRMA 2PLKA 1ESWA 3AWOA 1YQ2A 4CD5A 5H8UA 1XICA 4CLMA 4D6DA 4UTIA 4L6HA 1T8XA 4UQBA 3AICA 1DVJA 1DIEA 1K8XA 1UJQA 1DTNA 3LI0A 4PRRA 1IEIA 1K4GA 3RO8A 5T9BG 2QKFA 1V0KA 2YDAA 3WIJA 1D3GA 1L6FA 1YTDA 1SW3A 5CLTA 2V5BA 4HA3A 3V5FA 1N55A 1E43A 4A8RA 2XZ7A 4GYPC 2QGYA 2QCCA 3BO9A 1Z42A 3FYOA 3HG5A 2WKGA 4M1RA 3VOJA 4FA3A 2V63A 4LSBA 2F7FA 3E12A 4C5ZA 2FZ8A 1SFJA 2IW0A 1J01A 3U5YA 5C71A 1TG7A 4XBJA 2Y8UA 3KL5A 4Z1YA 3BAKA 3DHPA 3KCOA 4LX4A 3FYPA 3ZIZA 2G41A 3EZ4A 4DBUA 4Y8EA 1H0GA 4CVUA 3L12A 1ADOA 4JTKA 5F7UA 3NQBA 4OZOA 2WQDA 4MTVA 2L5HA 1ZUAX 5CGMA 2HZGA 3WH9A 2QXWA 3MPGA 1PTAA 3SJ3A 1AFSA 4JNZA 1FFRA 3SGGA 2RDWA 1LL7A 5JBDA 4IPLA 1SVDA 2NV2A 5XIMA 5DCEA 5A6AA 3I3EA 4QE5A 1JXJA 3NZRA 2Z7GA 3UEQA 1OCJA 3C2VA 2RHGA 4B3KA 1UR3M 4C1NB 4ICCX 3CGTA 4S3GA 3QLDA 2H6RA 4YNGA 1DHKA 1CLXA 1P7TA 3NQCA 1YIXA 4P7RA 3QOMA 1WZMA 3EWCA 1WDQA 2CZVA 5HANA 5FAJA 4AZCB 1V3KA 4F0SA 3A23A 1OBAA 3IVUA 2XSAA 3ZJKA 1E1CB 3H7UA 3BWWA 4IMGA 1UR1A 4JTJA 2OKTA 4YTQA 2PDJA 3VDCA 2OQHA 1X6LA 1I2RA 4UC5A 2NVDA 3V1PA 1JZ3A 4JIQA 3PHAA 1H63A 4ZFMA 3RNDA 2VELA 2XVPA 5JH2A 1UBSA 1R85A 2DW6A 2VCBA 2C7FA 4JY8A 3I4EA 4BF9A 3L0GA 4JQ3A 2V3FA 1OT1A 2XN1A 4XTDA 4TU1A 2WK2A 2V30A 1ZJHA 1QI3A 3KP0A 5FOOA 1BLIA 4XQ6A 2BOFX 4UNIA 2PDYA 2VX7A 5E9AA 1F7BA 4AF0A 1VC4A 1T0OA 1RQHA 4ZSUA 3B0VC 3B9OA 1K9FA 5AHFA 6ENLA 2BB0A 4MWAD 2ATSA 2X1IA 3OLIA 4HCLA 1Q63A 4PB5A 4E4PA 5TD4A 1REQA 3LD5A 3RX3A 2Y63A 3PJXA 2E1WA 1UWIA 3RJXA 3CYJA 1W9XA 1SFSA 4LS2A 4UFIA 1PEZA 3V0TA 1QK2A 2WSYA 3W76A 2VOTA 3AU2A 3VNIA 2I5QA 4V33A 3RDKA 2F6KA 3IANA 4DPPA 4WK9A 4N42A 3T1GA 3HG2A 4JICA 3VINA 1YE4A 1W5MA 3RX2A 3I6EA 4AX7A 3MHUA 4W9TA 2YFNA 1O6IA 3FXGA 1J5TA 5FKYA 1PX8A 1VFLA 3QR3A 1BHGA 3K8MA 4HU8A 3VNLA 3W7CA 5HXMA 3GNRA 4GCXA 4JIEA 2QV5A 4WDXA 3A9BA 3QKZA 3W9ZA 3W7DA 1XLJA 1OEPA 4RK8A 5A94A 1TFVA 3UD6A 3VZXA 1R2RA 2EJAA 4HCHA 4DYEA 2X0YA 2VEGA 2FPVA 4J1OA 4H01A 1T6MA 4S3JA 1L6WA 1ONWA 5CPTA 4GYKA 2ZX7A 3ARYA 3ZQ9A 5F4XA 4B4HA 1DOSA 4FO4A 1WUEA 5HWJA 3M0VA 2R24A 1ZJAA 4HHMA 3HFYA 5CC7A 3KOXA 4S3FA 1HKKA 3T2OA 3E0WA 4BI5A 3FKKA 1UUQA 1ZHAA 3UVAA 1VLIA 3IIPA 1TZ7A 2WPGA 3W7KA 3UZZA 1ZJBA 3VNZA 3C0LA 5F1VA 2QCHA 3O6AA 1VCFA 3EX4A 3SZ8A 3E0VA 3ZYZA 4LAKA 4QXIA 1XLIA 3AFBA 7CGTA 3H26A 4Q8NA 4GQ0A 4QLJA 5CPSA 1M9HA 3VDAA 1OGGA 4GJIA 3WQ4A 4C5YA 4DEFA 4NZJA 5E93A 1N2VA 1Y5XA 1KCLA 1W3JA 5C9XA 3DGRA 3W26A 1QASA 2WZIA 3LSCA 3REQB 4JTRA 4AY7A 3RM8A 3GC4A 3V18A 4GFIA 2G3NA 4I5XA 2W5FA 2VGFA 4QR6A 3TTYA 3AWNA 3P0XA 4RR4A 3R43A 7ODCA 3KTXA 4P5UA 4CD7A 4NJIA 4IIDA 4R3UA 5HQEA 4ZXOA 3E49A 3OW1A 2GPTA 1IV8A 2WBGA 1JYXA 2YW3A 3BQ6A 4DXXA 4XVEA 3UA4A 1BAGA 1THFD 3UVIA 3O16A 2CITA 2JK2A 4UTMA 2VFIA 3FW6A 3ONCA 3S9ZA 5CZTA 5K9XA 1PX3A 4GY1A 1UUOA 4Z1CA 4R27A 1BKSA 2GK1A 3H22A 4RX0A 1KFLA 3QVQA 3SUWA 1VFHA 1I45A 4GI6A 2HRWA 4O11A 4Q4OA 2Q6ZA 4Z08A 4PA8A 4GQBA 1V6XA 2XIIA 1ADSA 2BS9A 1CZ1A 2QCFA 2ISFA 3NQGA 3DYOA 3ZOAA 1L8NA 4K6AA 4BHYA 3CNYA 2FB2A 5FJRA 7ENLA 4X9SA 2FKPA 1KLYA 4DQWA 1GKRA 4O4WA 1K8CA 3AMCA 3SN4A 1JYNA 4QP0A 3QSTA 4XZMX 5FJOA 4DJEA 1GQJA 1WKFA 2QZRA 1Z69A 1ITCA 3UGRA 3BMVA 4HU3A 2CEQA 3SIMA 2FHCA 1FHVA 4MY8A 5IRPA 3L68A 2ZRWA 3VU2A 2PPGA 4LEFA 4HNVA 3NPUA 4JYEA 1O60A 1NP2A 1AJ0A 2OGJA 1TPB1 5CXPA 5AC6A 3WUEA 4C60A 1OX4A 4LUSA 1MZHA 5D05A 4GJ1A 3LA4A 4PTDA 4U4MA 1QI2A 2EJ1A 4O19A 2W27A 1EIBA 4B5NA 5HQLA 2XVKA 1SFTA 1Y8BA 4UNKA 1V0NA 3PK7A 4ZQPA 4MJZA 4F0RA 2O9TA 1EOKA 2HMCA 1OX5A 3ITXA 1M6JA 3IV3A 1ME7A 2HVMA 4PODA 2XDFA 3S5ZA 1UR8A 4GI8A 3NM1A 4QAIA 2IQTA 3UXDA 2BHUA 1JYWA 4S3BA 2OLHA 3VYLA 4N2YA 1I2NA 3ZWSA 2QCGA 4JCMA 1H51A 2DQWA 5JBEA 1GNXA 3I7SA 3WMCA 4LS0A 3FV9A 1WAUA 2VX4A 4PCFA 3ZXWA 4DZIA 1R86A 1R9YA 2DZBA 3OVRA 3AHTA 3GIPA 4EPEC 4N9CA 4AVFA 1UMYA 3GVVA 1H7RA 1AJZA 1OFDA 1OC5A 3WNKA 3DBPA 3N2CA 3S2CA 5AB3A 3T2PA 3CAKA 1ZTVA 4BZYA 1QO5A 4G7FA 2UWFA 4MZYA 3WQCA 1W1A1 3NDOA 4S3CA 3W2MA 2J9XA 5A6BD 2BTMA 3RLGA 4EANA 5A3HA 1VYSX 3W73A 3BJTA 3NQEA 4NY2A 1W32A 1YADA 4ASTA 1W6TA 3B0PA 3WUBA 5I2UA 3NL5A 4JNMA 3V75A 2XH2A 4DJFC 3T07A 1D7KA 3QV9A 3SCOA 2H9AB 4J5NA 4K68A 5KMYA 4QEEA 4DUVA 1GEHA 4BQ4A 4K8GA 2QJGA 4L4LA 1H4PA 3PUDA 3TYEA 2EPMX 2CZ5A 4RV3A 4BR1A 3W75A 2OOGA 4MYAA 3PPCA 1KR1A 1P0KA 3I7QA 3AIUA 1E0XA 3OYZA 5FF0A 4QG6A 4J3SA 1WDPA 2HXTA 3OJGA 4IUOA 2PDKA 4DO5A 2XJ7A 3R2GA 4Q7BA 4HZMA 3HOJA 3EX1A 3RJYA 1GUVA 3GNOA 4NAEB 4JGDA 2ZRZA 2J7FA 1K7EA 3KTSA 2WW5A 2RJGA 1DJWA 3UR5A 2VTFA 3MCNA 1YPFA 1TRDA 2QF8A 3KEHA 1UJPA 3W1LA 1NQKA 1TIMA 1UWQA 1W5PA 1W56A 2E0PA 1XSJA 4NZCA 2VGIA 1W3IA 1H11A 4INFA 4H19A 4F9DA 1S5TA 1DBTA 1GJPA 3B3DA 3W7OA 1OFBA 2GJPA 2ZRVA 1KCZA 3GW3A 3WBYA 3DI1A 3IUDA 2YBVA 3MHGA 3MCMA 1C8VA 1Z89A 4XUGA 4Y9PA 3RCNA 4LYPA 1HO1A 1P0NA 5U4NA 4DBWA 2PGEA 4AXNA 2J75A 3M07A 5REQA 5AN7A 3G1SA 2OTDA 3ALFA 4P7QA 4A4AA 2O92A 3CMFA 3O05A 2AKMA 1K8YA 4WXYA 2XH7A 2WV8A 3DFQA 1B3YA 1ONXA 4KRTA 1OC7A 1E5NA 3BZJA 1M3UA 4FX7A 3QHOA 4KCTA 2QMKA 3VE7A 5HPCA 3BLLA 4F0KA 3QZ6A 4UZUA 2YPIA 3GR4A 3W29A 3NQFA 2HS6A 3B9DA 3W28A 2ISWA 2E6YA 4AIOA 4ZOBA 5A6TC 3VUSA 5A1AA 4GIYA 2NT1A 3PTDA 5LHFA 3SRKA 1QW8A 3ITYA 4AWSA 1JPDX 3E96A 3OHMB 4A35A 3W87A 3AC0A 2BVTA 3B0YA 1E6ZA 5I09A 3OIHA 4PCSA 1XBZA 3KHJA 7REQB 5DY2A 4EOUA 3GD6A 3S9IA 3L5LA 1H61A 2D20A 2QPXA 3CO8A 5JQ9A 3R8GA 1VBJA 3B9AA 3DX5A 2TRSA 3O15A 1K6AA 1CXEA 3ICJA 2VZOA 4I7VA 2I5GA 1EDTA 3L65A 3O0FA 5CJ5A 4GZIA 2WZTA 3AI0A 5JH1A 3PZGA 3AZTA 1ZAIA 2G0WA 3ARXA 2V68A 1HIZA 3KL3A 4BJHA 5SWUA 3CPGA 2IQDA 3AXXA 2I7GA 1XIGA 3HB9A 5KZ6A 4R88A 1PHQA 4WOZA 3VNYA 2C18A 1VAHA 1JVNA 4KKXA 3TN4A 5BOOA 2ZYFA 3GKAA 1UKSA 4B3ZA 1MW1A 1V02A 2VEFA 4IX0A 1XI3A 3EWXA 1WKEA 3SR7A 3UY7A 1V7AA 5BU6A 1LORA 4DI9A 4ZE4A 1VH7A 4LBUA 3CZ8A 4UFMA 2R1PA 3KLLA 1FWRA 3GR7A 3CJPA 4ZO6A 2ZA3A 1JPHA 3IWPA 3GG1A 3OG2A 1REQB 3MB9A 4LPCA 2ISDA 3NG3A 3NXFA 3P5ZA 1CIUA 2ZX5A 2YCEA 4N9BA 1N8WA 4J40A 3CS2A 3N9SA 2HWGA 3HIJA 4IQEA 1QNOA 3HPSA 4AYSA 1ZY9A 1U1JA 1HGYA 4L56A 1KQZA 1PKLA 3N04A 1A0DA 2FGBA 2BV9A 1F3WA 1J0IA 1IZKA 3STPA 2OQYA 1IXOA 3RRXA 1N8IA 2VQTA 3S1GA 1CXIA 3GHTA 4LCSA 3B8DA 2A6LA 2V81A 4O54A 2ZUMA 1TPEA 2E4TA 3WD4A 3P8IA 3CT7A 1E15A 3GY1A 4FSAA 1W8SA 2OEKA 1LBLA 2VR4A 2FGLA 1VZWA 1SMDA 2CBJA 1HKJA 4QX4A 4C6PA 4H6QA 1X8FA 3MMUA 4CN6A 2TODA 3S5SA 4D72A 5LXXA 1KRAC 1SR9A 2WMHA 4GGHA 4GGBA 3W2UA 1T99A 3N13A 1UD5A 2GLKA 1DIOA 3NEHA 4XZNX 1E0TA 4Q4SA 5LSMA 3LCIA 1RZMA 3CL8A 1WO2A 3W6LA 2W6RA 4HVXA 3O1NA 3CHCA 4GA8A 3RGTA 5J5RA 5A8GA 3OZMA 3L23A 5PTDA 1UD3A 4XAPA 1ZAJA 3IUHA 1SO3A 1GVFA 3U0HA 2ZC1A 2VFGA 2Y2WA 1LWHA 1XIEA 5C2GA 2KX9A 2UY5A 3I6RA 1AQ0A 3WF1A 3D5HA 1KLZA 5BOFA 3NPVA 3QR1A 3HG3A 1Y5WA 3OZPA 1VB9A 3CWHA 4OIFA 1E4NA 4CQBA 4MSSA 3PZOA 3AIEA 4F8XA 2PP3A 4JHOA 5DMMA 2PB1A 4UR9A 2P3EA 4NX0A 4P8UA 3F2CA 2HEJA 1ISWA 2WNWA 1UW9A 1UH4A 4Q8VA 1TE6A 4W88A 4OKDA 4UZSA 4AIEA 5C55A 1JJKA 1WUFA 1XYLA 1YNPA 3MUIA 4XAGA 4Y9AA 3B8TA 2FHBA 4JTLA 3I68A 3BG3A 1LRTA 3PG9A 3PUGA 4CUCA 2VI0A 1VFOA 3M44A 3W81A 1R38A 2W63A 1QI0A 5DXYA 3D3FA 1OCQA 5D37A 2V9DA 1WXJA 3LGDA 1GK8A 3CHVA 2F6XA 4IF2A 3NDYA 2X1SA 2WXDM 1D7FA 5BOEA 4ZQCA 5K4ZA 3DI0A 5ABGA 3W85A 3UWZA 3R12A 4FALA 5IOBA 1A49A 4KW2A 2C0AA 1TPUA 3QJAA 3Q45A 2GK1B 3QRHA 4U2YA 3APGA 3GZAA 1H7NA 1TX2A 4N9DA 3KDOA 3MYOA 4GIAA 3A64A 3C8NA 3I6TA 3SUTA 4FR1A 4LAMA 1E3ZA 1GORA 1MEWA 1RLDA 2I17A 2QMJA 2GJLA 4FLSA 3W1MA 2PUZA 3VNJA 2PP1A 3O7UA 4S3KA 1X38A 3HJEA 3KOFA 1CXHA 3CMJA 3VC6A 1PKYA 2PGFA 2IMRA 2VD8A 2VDGA 1EP1A 2ZTJA 5JUVA 1RA0A 3EX6A 4JD4A 4ENLA 1KR0A 4Y90A 3W86A 4GIEA 3SCPA 3N15A 4UQ9A 4O15A 2HS8A 2W3ZA 3UZJA 1TPH1 1F9CA 5KINA 2O0TA 4PUUA 3CV7A 1EQPA 4UR7A 1XYBA 2ESCA 2G8ZA 3TYDA 4O57A 1C9DA 4PMJA 3IVTA 5D8ZA 2FQIA 3DN5A 1PZ2A 4YTUA 1E0VA 3VIJA 3FK4A 4I6KA 2YL8A 2BZNA 2PC8A 4LUSB 1XSKA 3RMEA 3AJ7A 1VCGA 4OECA 1DJXA 2PDIA 1XRSA 4WJ8A 2CCRA 4DJEC 4HD5A 1XKYA 3RPTA 5CQ1A 1Q6CA 4H1ZA 1WKDA 5ABHA 2DJLA 1RUSA 2HTMA 3DXIA 1K3UA 4WLCA 3FJNA 3QQ0A 1PIIA 3WKZA 1MFUA 4M80A 1JRBA 3ITVA 3H12A 3LZ3A 4W7VA 1CB7B 1ZENA 4PTXA 2RFGA 3CASA 3L2LA 3DIPA 2OZ0A 2ZWYA 5TNVA 3FHQA 3USZA 2QJNA 1JZ5A 2V5DA 4PMVA 2X1TA 4MY1A 2GUYA 2AMGA 1HG3A 2EBNA 2JGYA 4ZA0A 1A80A 3P6LA 4HHHA 2Y8KA 3MSRA 1EA9C 4BY3A 3QLLA 4D6GA 5CCZA 1B4EA 3QZEA 1NF0A 3M6YA 3BPWA 1PV8A 1VBRA 1O5XA 4CNPA 3LNPA 4XTIA 1FP8A 3C2RA 4JTUA 2R9RA 1WB0A 2Z6IA 3LPGA 2ZE0A 1VFFA 1XH2A 1XRFA 4K8EA 2VZTA 1HXJA 3TVAA 2I57A 2VVSA 4XSMA 4C6NA 1EBHA 1IWAA 5LIKX 5EL1A 1W3TA 3T6CA 4GNJA 4YYFA 3H2NA 4QDPA 4TR9A 3THQA 4I3GA 2FTWA 1VD6A 3NYZA 2PWEA 3WF0A 1L2QA 2BVYA 2ANUA 3BGJA 3WEOA 1BYBA 2NVAA 1ZSXA 1R5YA 1Q45A 4ICMA 1FCVA 1JFXA 1EB3A 5HR7A 2WM1A 3TZNA 3UJRA 5BMWA 4WKAA 3TJLA 3EGJA 4V27A 4AHOA 1DHPA 5E1QA 4QNWA 3GIYA 3LV6A 1E6QM 2WBKA 1KD0A 1EO5A 2XN0A 1YPXA 1LUCB 4IGSA 5D33A 2QDDA 1NAL1 3KUMA 2DIJA 4IGHA 1G67A 1TCMA 1IXNA 2PZNA 1UWSA 1LRNA 1Q5MA 2Z2BA 1R6WA 2UY4A 5CLWA 3N4EA 1EGMA 5I3FA 2PCEA 7TAAA 3W7NA 1WDWA 5I3GA 4N6FA 1PCKA 2OWCA 2OO6A 1H7XA 3VKAA 8RUCA 3SCVA 4AD0A 3OBKA 3IS4A 2OELA 4H2CA 1S46A 4B2DA 2C16A 3O0KA 2ZZ2A 3W3OA 2EHHA 3VD5A 3GB6A 4WX2A 2V67A 3PZIA 3MU7A 4DBSA 3CLWA 3HURA 3LBMA 3VGEA 2DZSA 1LLWA 5I07A 3VD3A 1W54A 4QE4A 4E4FA 4ZL1A 1XUZA 2A3EA 1J2BA 3J7HA 1DTUA 4QCFA 4O1CA 3GFYA 1MUWA 4ADTA 4ADSA 4RZBA 1XCWA 3UR8A 5EMMA 2P8BA 2J7CA 4MADA 1TKKA 1KTCA 5H1WA 3GC2A 4YVVA 2OLSA 3ARTA 4R53A 2QJIA 3M0ZA 2GQ9A 1TWDA 3S1UA 3AROA 5REQB 3F5JA 4NZ3A 3RR1A 4O1AA 3VNDA 2WMFA 4RUBA 1DJZA 3LN3A 3BICA 4UR8A 2VC6A 3PJWA 3NZGA 1S2WA 4RDZA 3RK8A 3C0SA 5B7ZA 3WBEA 2Y6ZA 5EMUA 1Q6OA 3KFTA 5CZSA 5T26A 2WC7A 2HDJA 3W1QA 3W7IA 1OF8A 4AISA 4B16A 3WJZA 1EJWC 2DT0A 1TO3A 3GHUA 1LRQA 2J27A 3HMCA 1A5UA 1AL8A 4A6GA 4V2XA 4GUGA 1FKXA 3T0CA 1KV5A 1V4YA 4S23A 3ZR5A 2ATMA 1L6GA 4WEVX 1V3IA 1EC7A 3TDFA 8CGTA 3IJQA 5GQBA 3GAKA 1UIOA 4NAFA 2YGYA 3O6YX 4O1DA 3WD3A 4H8VA 3U48A 4DPQA 3G8EA 1IYXA 2REQA 4Z0SA 1S2AA 3JZUA 3S83A 4AZBA 4AVOA 4P8XA 4M24A 3GC5A 1EPVA 1PS9A 4QCEA 4MKSA 3U2EA 4UTJA 3HMJG 3W38A 1F6YA 4JHZA 1W9PA 4H7ZA 1V5XA 4IGNA 1EGVA 4MB5A 2FVKA 3QN3A 1EF3A 5E70A 3VKJA 3IJDA 3U7BA 1LDCA 3RPMA 2WMGA 4JNYA 5I77A 1UR4A 2PGWA 2NQZA 2Y8VA 1Q3NA 2WJEA 3T42A 1FRBA 5I78A 3QMSA 4C91A 3GKFA 4GUJA 1UB3A 1TQXA 4IMEA 1J12A 4I90A 4XZLX 2NZLA 1UOKA 1OD8A 4IIFA 4UFJA 4ML9A 1UZ4A 1UH3A 2Z00A 1EJVC 1ZFJA 1HJUA 5E0FA 1UR9A 5LIYX 4CQ8A 3H6OA 4R85A 1DJGA 1XLAA 3N3MA 1QWKA 3SCRA 4IFKB 2XIMA 1QW9A 1E9LA 4BWLC 3OEXA 4UTLA 2BOGX 1B0IA 1H1ZA 1OCNA 1R47A 4I5UA 2YXGA 3TCEA 2Z1VA