2ACRA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 102
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acrA00
2QXWA 3U2CA 2ACRA 4JTRA 1EKOA 1VBJA 1MRQA 3V35A 4YVPA 4JTQA 4IJRA 3CAQA 2PD5A 3DOPA 4JQAA 3H4GA 2PEVA 3GHTA 3Q65A 3LN3A 1QWKA 2FGBA 4WGHA 1Z8AA 2FZDA 3CAVA 1YE4A 4JTDA 4QBXA 3RX4A 4FALA 2R24A 3BV7A 1S1RA 3LQLA 4MHBA 1FRBA 2IKGA 1ZGDA 3LUTA 3M4HA 3H7UA 4PR4A 2INEA 1EL3A 2IPWA 3UWEA 5DANA 2PDPA 1AZ1A 3D3FA 1ZSXA 2ACUA 1M9HA 3R58A 2ISFA 1A80A 1MZRA 3O0KA 4JQ4A 3P2VA 2BGSA 3V0SA 3WBYA 4DBUA 3UGRA 4XVDA 3R43A 3WCZA 1OG6A 2PD9A 2FZBA 4ICCX 1PZ0A 3BURA 3M64A 4JIRA 1K8CA 4NKCA 5AZ1A 1US0A 3ERPA 3LZ5A 4YVXA 2WZMA 4H7CA 1GVEA 2VDGA 4GQ0A 1ADSA 4FZIA 2HE5A 4WEVX 2IKJA 1AFSA 2BP1A 1XF0A 1IEIA 3UYIA 1QRQA 2WZTA 4DBWA 3GHRA 1YNQA 2IPGA 3EB3A 1Q13A 3S3GA 2DUXA 3R7MA 1R38A 4WDWA 1UR3M 3EAUA 2J8TA 3G1RA 1AH0A 2AGTA 5LIKX 2DV0A 5JH1A 1RALA 2PDIA 4I5XA 5LIUX 1RY8A 3BCJA 3WBXA 2PDUA 3M0IA 5C7HA 2I17A 4PMJA 5JH2A 3UZZA 3LBOA 2NVCA 2IKHA 4LB4A 4YVVA 3UP8A 1JEZA 1XGDA 1RY0A 2PDYA 4GCAA 2BGQA 3KRBA 3GHUA 4HBKA 4R9OA 3R8HA 4LAUA 3RX2A 1S2AA 2HEJA 2HVOA 2FVLA 1YNPA 4EXBA 3LENA 3EB4A 4JTAA 4JIIX 2ACSA 4Q3MA 3LQGA 2IPFA 1HQTA 4ASTA 4H8NA 1S1PA 3QKZA 4XO6A 5HNTA 2ACQA 3CV6A 3C3UA 3N2TA 2PDQA 1X96A 2IPJA 1Q5MA 3N6QA 3F7JA 3R6IA 5M2FX 4GA8A 3MC5A 3LEPA 2I16A 3CMFA 2INZA 4OTKA 4RPQA 3GUGA 4XZLX 3O3RA 1AZ2A 3T42A 2PDKA 4EXAA 3FX4A 3UFYA 3G5EA 4LBSA 3RX3A 2CLPA 4L1WA 1EF3A 1XJBA 3LZ3A 2P5NA 4Q7BA 3V0TA 2PDLA 1X98A 1J96A 4QR6A 4DBSA 4QX4A 4PRRA 4GIEA 1X97A 1S2CA 4IGSA 4XZNX 4IJCA 1PWLA 4LBRA 1T40A 3UZWA 2PDBA 4AUBA 2PZNA 1C9WA 2PDNA 2HDJA 4FA3A 4F40A 1PZ1A 2PDGA 3R94A 3ONCA 2A79A 4PUUA 4XZIA 4FAMA 3CASA 2PDFA 1Z89A 4L1XA 3V0UA 1T41A 3B3DA 3R8GA 4GABA 4LAZA 5HNUA 4WDUA 3DN5A 4YU1A 2PDWA 4XAPA 1Z9AA 3CV7A 4WRHA 3GHSA 3FJNA 3MB9A 5HA7A 4G5DA 2NVDA 1SM9A 2PDHA 2PFHA 3LD5A 4WDXA 5LIWX 4LB3A 4XO7A 5KETA 3V36A 1MI3A 2HE8A 2F38A 4GACA 3Q67A 2IKIA 4YS1A 3COTA 2IQ0A 4XK2A 2IQDA 3WG6A 1IHIA 2F2KA 3WBWA 4HMNA 2HV5A 4PRTA 5AZ0A 4XZHA 3BUVA 3VXGA 1PYFA 4PUWA 4QXIA 1LQAA 1PWMA 4DZ5A 1AH3A 2PDMA 1Z3NA 3H7RA 1ZUAX 1LWIA 3ONBA 4JTCA 3UZYA 2HVNA 4XZMX 1HW6A 1YE6A 3UG8A 2DUZA 4JQ2A 2ALRA 4JQ3A 2PDJA 4JIHA 1ZQ5A 4JQ1A 2PDXA 3LNMA 4XVEA 3NTYA 1AH4A 2FZ9A 4WDTA 4ZFCA 2R9RA 5LIYX 3UZXA 1VP5A 1EXBA 4GQGA 5LIXX 2C91A 2FZ8A 2IS7A 2PDCA 2PF8A
chains in the Genus database with same CATH superfamily
1ONXA 4WVXA 2IW0A 3UR8A 2O7SA 3BG5A 4UBPC 4RLIA 3OO2A 4US5A 3FAWA 4ERGA 4UFJA 1VQTA 1MMFA 4FF7A 1KR0A 4NHVA 4LUSB 5HMDA 2CLKA 2G8ZA 1XUUA 3DOPA 3EGJA 2E7FA 4JTEA 3R89A 2OEMA 1T96A 5HK4A 4N02A 3FVDA 1X6NA 4TX9A 3TFCA 1TR1A 1KCZA 3F4DA 4HHLA 1AW1A 1T99A 3DYOA 5BNKA 1NQKA 2CNCA 4MMWA 3BOXA 1L6WA 3ANYA 1VH7A 1NELA 4ES4A 3WH6A 3RJYA 1CI1A 5A3HA 2PBOA 3ARQA 1BRLA 4CNTA 1B0IA 4HOZA 3NO1A 3MS8A 3KEHA 3AS0A 2ACUA 3BVJA 1M9HA 2XN2A 4UZSA 1X1ZA 4B4HA 4JQ4A 1YPXA 3CPGA 1TTQA 4KFPA 2F6UA 4G1KA 1XUZA 3GIQA 4TV5A 3S2MA 4DO7A 2OT0A 3IV3A 4MWAE 1W8SA 5E5CA 1XBXA 3AYTA 1JCXA 2GDVA 3GDKA 3UF9A 4GI9A 3APTA 2RJGA 2J75A 2EKCA 3R25A 3WEMA 2YLLA 1H5VA 1HKJA 1QOXA 3DECA 3SUTA 1QJWA 1WZKA 3EXTA 3VKDA 5HBFA 3WJWA 1XIEA 3OQ8A 4NI8A 2BZNA 1E56A 4GI8A 4MM1A 4DPPA 1O5XA 1BGAA 1J0YA 1GG0A 1KFBA 1GT8A 1LBFA 2VFIA 3ZJ7A 4P8WA 4KFOA 3AMLA 1P1XA 3ZZ1A 1MW2A 1FY6A 2X1UA 4QLJA 3WL0A 4AG0A 3BJTA 4MVAA 3WJZA 2HPIA 1AFSA 5T26A 3AU2A 3HPZA 4DBWA 3XINA 3R0DA 3GVQA 4P7QA 4DUVA 3YPIA 2NW0A 3FS2A 1V8EA 2JALA 4GYFA 3N17A 4AZGA 3NYDA 1RV8A 4MFDA 3IJQA 5JVLA 1AH0A 3MUXA 1F6KA 4XBSA 2YCLA 3B0XA 1UP2A 3IJLA 2VRJA 3EDFA 3VKBA 1U33A 1LG1A 3TW7A 1W9UA 4GG9A 4F48A 1VHNA 5CCZA 4GNVA 3PSWA 1TB3A 4KF1A 5GNXA 1HJXA 4JDBA 1FP8A 4GCAA 2GPTA 1AA1B 4R9OA 2VFGA 1GPWA 2YL5A 4RDYA 1RSCA 2P88A 2DSVA 4IT1A 2OFJA 1T5AA 4UMAA 3AJXA 1HKKA 1V5XA 5FF0A 1RVKA 1VIZA 2ABAA 2ZZ1A 4XO6A 2A6NA 3GFXA 3L4XA 1W1VA 4O17A 3O0FA 4GXPA 3VGHA 2BNJA 3TSMA 4C1NB 5LGZA 3THUA 5BYWA 3CMFA 5CGMA 5CSYA 2OXNA 3U9IA 1MUCA 5JQ9A 3ME3A 4HU0A 2NXIA 1HJWA 3HFYA 3UFYA 1KFKA 2IQTA 2J6VA 1MDLA 3RX3A 4HK6A 4QRNA 5F1VA 3FHQA 5DEZA 4L56A 2VEIA 3UJRA 3SBFA 3N04A 4ZOEA 4GXWA 3CT7A 1V3MA 3UJFA 3WMBA 3GU9A 4OV4A 4DM1A 3IUDA 5I02A 3AMGA 3GXPA 3TAOA 4ZE5A 3LRLA 4GBDA 5KTLA 4BY3A 5FIPA 5CAHA 1I4NA 1GTEA 3M7SA 5HULA 6XIAA 4Z1BA 3GBEA 4X9SA 1GWJA 4IXXA 3KS6A 4E6MA 5KITA 3UZWA 2B0MA 3MI3A 4FIQA 2JK2A 1N8IA 1P0NA 2DSZA 3PK7A 4O4VA 4AF0B 1J10A 5HOSA 1VHCA 3CUHA 3PFRA 3QQ0A 4AWSA 3MZ2A 2VEKA 5A8QA 4QCFA 4CVWA 4L1XA 4FX6M 3V0UA 1H3GA 1EC9A 3BARA 5KZEA 3FFSA 1K9TA 1ZNNA 4WDUA 4GZJA 1Z32X 1DWHM 4JCMA 4L6HA 5CZSA 2GQ9A 4W7WA 4IQJA 3OBEA 3E0VA 4DQWA 3A9BA 2WJEA 3IUHA 1SM9A 1BXBA 5G5IA 4NNCA 2AL2B 1YTEA 4NVTA 3KVJA 4KW2A 3S5OA 4H6KA 4Z2LA 3A13A 2QZRA 4YS1A 1LLOA 1I60A 3COTA 3QPZA 4IPPA 5J5RA 2E5DA 3W2UA 1G94A 3SSJA 3ENLA 1IIGA 4Q4KA 2ANUA 2Y2WA 3NVDA 3QLLA 1Q7MA 5CPTA 2CBJA 1S38A 5A6KA 1LQAA 5CSSA 4MYXA 4L1GA 2Z2UA 1WBJA 1P0EA 4R9XA 3H7RA 4RNHA 4DRSA 4XV0A 3PULA 4BI6A 2UWFA 3MMDA 3UXKA 3TFXA 4DLMA 2VCAA 2NQHA 3HPXA 3DUGA 1BFNA 1TWIA 4M6UA 2Y7FA 3OG2A 1YNYA 2UY5A 3WJXA 4J3XA 3N4AA 5LNUA 3GU1A 1EJTC 1P48A 1AH4A 3BMXA 3RLUA 4GIYA 5KZMA 5LIYX 1YPIA 1E70M 3M44A 1CECA 3VTRA 1I2OA 4C6CA 2EO7A 4OWGA 1Z44A 4YTQA 3M5YA 3BGJA 3D47A 3RUBL 3W81A 1J11A 1V3IA 1VYRA 3QSTA 1NWRA 5A2AA 4RDVA 3IIPA 1O1HA 3O7UA 4S3KA 4Q8PA 5CPQA 4X9YA 4X0NA 2PD5A 3JU2A 1QWKA 1Z8AA 1IWAA 1UOKA 5F4XA 2GK1B 4OU1A 2PWUA 4CGTA 4UMCA 1LUCB 2OSWA 5FJPA 2O9OA 4XIMA 2OLAA 5CH9A 3ZQ9A 1VFMA 2NX1A 1ZBCA 3TSBA 4NNBA 3BCDA 3H7UA 3VIFA 5LZLA 1OVDA 5BRBA 3KL0A 2ZIDA 3GNOA 2GSEA 4C6MA 5C9RA 1XKYA 3M47A 1RLDA 4NRSA 3MTWA 1ZSXA 1L6GA 1MZRA 4NAFB 4FPSA 4IL2A 5BWAA 4Z1DA 5GVJA 3V4BA 3WBYA 2YPIA 4C6NA 4IG2A 5M1TA 3W28A 3O6AA 1KD0A 3QOMA 3P14A 2YLAA 1IWPA 3IEBA 2PD9A 1TPDA 2FZBA 3BURA 1BSIA 1H1NA 2QUUA 1EJ7L 3VCNA 4CU7A 4MSSA 1PZ2A 4YJ5A 1TJ1A 4CD5A 1V3LA 3G1HA 2E1DA 4OBRA 4INFA 3GRIA 3KTXA 1FWIC 1V02E 3AI0A 4PB4A 4A21A 3EEGA 4KIEA 4D8AA 3KRZA 4DJDD 5DO8A 2XINA 3N4FA 4ZSTA 2C3ZA 1VR6A 1D2KA 2BG5A 2VCCA 2CIPA 2J8TA 4TVUA 4AEFA 3S1WA 2WW5A 1KCKA 4NXKA 4ZSUA 3O16A 4B9YA 1XLBA 1A53A 2PTYA 1H2JA 1JJKA 2YX0A 4GZEA 1BG4A 2FMOA 3GFYA 3QHNA 1WX0A 3LBCA 2YCLB 1FWDC 1TPWA 1IXOA 4WY0B 3CGTA 1E4NA 4WSKA 3W1LA 1W1B1 4MG4A 6REQB 1OYBA 2FB3A 3W25A 4X61A 7XIMA 4IGNA 4ZCWA 4L9XA 2PLCA 3OLIA 3LCFA 4UTWA 1H7NA 4MJZA 1JDAA 3R8HA 2XH7A 4DF0A 4AD3A 1HUVA 1UZDA 2CCRA 3GXFA 4V1XA 4E2DA 1G4EA 2D2OA 2B7OA 3PZUA 1JCTA 1FUYA 1TUXA 4J2MA 2EXOA 3C0QA 4AZIA 5A6LA 1O1ZA 1GYNA 3T2PA 2QKFA 1O94A 1NF0A 2XSAA 1R7OA 1Q5MA 2A0NA 7CGTA 1XG4A 3EA3A 3RIKA 3P6LA 4N9CA 3I65A 2GJLA 4C65A 1J5TA 1HZYA 2VFDA 4WCJA 1DQUA 4H04A 1F61A 2Y5SA 7A3HA 3HURA 2OSXA 2Y85A 3GG0A 4XBJA 5IHRA 3VGFA 3C61A 2BOEX 3CH0A 4HK7A 6PTDA 3PVFA 4MNKA 3G0XA 3HB9A 1AL8A 4L4PA 4RNFA 1Q6QA 3E0WA 4D6GA 3DEQA 2W67A 1PUDA 3K1DA 1XL9A 2B4GA 3LYEA 1B30A 5A8PA 3FK4A 3A4AA 4XTIA 4KCWA 3BAKA 5H8MA 1S2CA 4M1RA 4GH3A 4AY1A 4CCCA 1KFCA 4PUKA 3QH2A 5CZ0A 1BQCA 3GZ3A 4S3AA 1A47A 3WK2A 4AEOA 3GBDA 1QI3A 2V3GA 6REQA 4HZMA 2DJXA 2YIHA 4DUWA 1EJSC 4LANA 3PUDA 2PGRA 4QFUA 4A8LA 1WAWA 3BLLA 3IARA 4AISA 3IAPA 4LRTA 3UG3A 3LHZA 2IXUA 2ZZ6A 1A50A 2F2HA 1XISA 4F8XA 3MPGA 1C90A 1T8QA 3R8GA 1YDVA 1A0DA 1ZAJA 1MEWA 3H23A 1PL9A 4F9DA 2GQ3A 3WLOA 4O12A 1PIIA 3DFOA 2XH2A 4LUTA 3FJNA 3MB9A 2XVPA 4EAYA 1DE5A 1BXCA 2OO6A 4OGZA 4DF1A 1K8YA 4FLRA 2HBVA 3HGRA 4MGGA 4HNOA 2A3EA 3OBAA 2CXEA 3U2EA 3SUVA 2PP0A 5EL1A 3W3OA 1JDEA 3A4XA 1Z41A 2WHMA 3S5ZA 1WDWA 1O12A 3W1NA 3AALA 2WZHA 2PTWA 3WH7A 3VXGA 3W75A 1PYFA 4ZQNA 1WV2A 1YDOA 4QAIA 3LX9A 1E9ZB 2Z0IA 3QKEA 2ZA2A 4JEQA 3LGDA 3VIJA 1IEXA 3N11A 2E28A 5TNVA 3T07A 3D6NA 4JKMA 1QHOA 4PTDA 3W7JA 2PDXA 3LNMA 3OW1A 5AYYA 4D8LA 4RW3A 2BOGX 3UWQA 4U33A 2FZ9A 5T91A 5F2GA 2H8XA 4B90A 3PJXA 3ZSTA 3G1FA 4I5UA 1G7UA 2WSQA 3QHOA 4JAWA 5FI8A 3SCRA 1TV7A 3VGGA 1QASA 1W54A 3C86A 5DMNA 3BMVA 1HGWA 2ZXQA 5D8ZA 1AJZA 1FH7A 3WDPP 1B3YA 1YRRA 3H4GA 4D6HA 1V0MA 3LSBA 3QPYA 4GJ1A 3KHDA 4DXKA 4FS9A 3NQ2A 2CXGA 4KCVA 1TPC1 5IFTA 2X42A 2R14A 1VD6A 5HJXA 3M0YA 4WF7A 3G6LA 2GGEA 2ON3A 2XZ9A 2V6AA 4ZXOA 4A3QA 1DPMA 2VRKA 3PP7A 3WFZA 4DHGA 3WUEA 1Q6RA 1RHCA 3CQIA 4RR4A 4NZ1A 2NUWA 3RR1A 4JR5A 8XIAA 5G2IA 1LRQA 2WQPA 4AB4A 3CXOA 3O63A 3K8MA 3AIUA 3QY6A 1DJHA 1KLZA 4XD6A 1IT8A 4NG3A 1VAHA 2ZADA 4GY1A 3QGAC 5IHSA 5FF3A 1SU5A 1WB0A 1W9VA 1JPMA 4NL1A 1M65A 2TRSA 3WDRA 3WNNA 4FEZA 4GUIA 3A22A 3DXIA 4MAVA 1JD7A 4HJFA 1S2WA 3USZA 3S0CA 4FP1A 3S2LA 1XG3A 4QJ5B 3THCA 3S83A 1FVPA 4Q4PA 1B4EA 4LUIA 5AVNA 3H8AA 3EWDA 4A4AA 3DHUA 3IGSA 1V7AA 3ORWA 3M5ZA 5HQLA 4DWSA 4LH8A 3K13A 3U2ZA 2BVYA 3QQWA 4EVZA 5K9CA 4O54A 4AHPA 2IPGA 2C79A 1XDJA 5D32A 4UQDA 3AWOA 4NASA 4OUIA 3PBUA 4AZ7A 5AYZA 2F8QA 1V03A 1S5WA 4Z17A 3H7VA 3GC2A 2BY1A 3GKFA 2DVTA 1OWQA 3TYBA 4DN1A 3MKVA 1JQXA 5AC8A 5LA0A 3RCMA 1R2RA 2YR1A 1XBVA 1NEYA 1XIDA 3GH4A 5C8BB 3KTCA 1F73A 4L4MA 1S2AA 1SJCA 3LMZA 4RDZA 2PWGA 1RJPA 1WXZA 3HMJG 4J4KA 4EXBA 3ARSA 4R34A 2O9PA 2WKGA 4D9PA 2XVNA 4WHBA 4PODA 1SJAA 4IMDA 4K2SA 4MB5A 3UERA 1WZAA 4Q8TA 3CZJA 3ZOAA 3N2TA 1CGYA 3A47A 4CLMA 3F4NA 1L2UA 1UH2A 1V6XA 3VUPA 2DIKA 4GYJA 2BB0A 4KGLA 1SMDA 3CEUA 1EGZA 4QIUA 4JTJA 2W6RA 4M24A 4HNLA 2W91A 3JRKA 1BXNA 4Q6XA 3GDMA 1W3JA 4Q8MA 3ITYA 4Q8OA 1P6BA 4AX6A 1BLIA 4DZIA 3LCGA 4H41A 3AS2A 4JXCA 1SVDA 1VBHA 3NZPA 1C8QA 2FJKA 4L1WA 3MZNA 4FO4A 3HOJA 1DTNA 4F0KA 2NXHA 2W27A 3RYSA 4K3ZA 4F0SA 5I79A 1P0BA 4I7UA 3SRHA 4JN8A 4QX4A 1B9BA 4JHOA 2HPMA 4O1FA 1Q65A 1W1YA 4U5KA 1EX5A 5CSRA 1MXGA 2J4GA 1ITCA 4WUIA 1RBLA 3O6DA 2A3HA 3TKFA 5IXEA 4IJCA 1ONWA 4ACYA 1QNSA 1T0OA 4JHZA 4XUGA 1Q6OA 1EDTA 3TQ0A 1W2VA 1E0TA 4LVBA 3NQGA 4YCOA 1UJQA 1XBZA 2PZNA 4TMBA 3VGEA 4NY2A 5AECA 4A35A 2HDJA 1C91A 4LPCA 1XRVA 2ZFAA 3GXTA 2ZVIA 4AD5A 2HMCA 2C7FA 5D33A 4U28A 4PYSA 4W88A 1QPRA 4QG6A 2R8WA 2BMBA 1UWIA 2XIIA 1O66A 2XIMA 4CNNA 3TXVA 1CIUA 1AK5A 3L0GA 2FHFA 2X40A 3NQEA 3FYYA 4WGXA 3UNDA 2VZUA 4Q4RA 4AWUA 4ZGYA 3KRUA 4A3UA 3Q58A 4L9YA 2F38A 4Q8NA 2NV1A 4O53A 3W23A 4URIA 2XHYA 3OODA 2C8NA 1YMYA 3PJWA 4LUJA 4ACZB 5REQA 4I9TA 4AF0A 4Q8QA 1IZKA 1IHIA 4EACA 3WBWA 4JY9A 3QY7A 2FPTA 2NQ5A 2Z6JA 2Z00A 3DFHA 2VR4A 3A9IA 4NX5A 1F8MA 4U3CA 1B9ZA 3E0LA 3UPBA 1KA9F 5C2CA 4XAFA 5A69A 5JBDA 5E70A 1UC5A 4XAYA 2FIQA 4ZFCA 3TC7A 1TUFA 3AHXA 2E9BA 4R53A 4JTFA 3LI0A 3JZEA 4UQCA 3E0IA 1N8FA 3M0HA 3G22A 1SPQA 2WNZA 3U2CA 4IICA 2XYLA 1M7JA 2AMGA 1G67A 1H7RA 1MQQA 5C55A 1QW7A 4ECLA 1DL3A 3H2EA 1I75A 4ML4A 3GNRA 1QTWA 2PEVA 3IIXA 3H2NA 2BVTA 4ZB5A 4XKYA 3NZRA 1E1CB 1XLKA 4BWLC 2Y61A 1IGWA 1P7TA 3UY7A 3N73A 2HJPA 2J66A 1RJRA 2WWDA 2YXXA 2Y7EA 2YJQA 1VFHA 3APGA 3P0XA 2IKGA 1R9ZA 1Z69A 3QPEA 2G41A 1UH3A 2G4FA 1MDRA 2RHGA 7REQB 4JY8A 3VNZA 4XG1A 1Q6FA 3EKZA 3RLVA 1EA0A 3B06A 4CQBA 2E6AA 3E3HA 3ZWTA 3VD3A 3MO7A 2VNCA 5D9PA 5A95A 5LKYA 2PB1A 3EX1A 3RCNA 3BLOA 2E5CA 5AHIA 3VAVA 3I6TA 4PMNA 1XGZA 1DXIA 3LTYA 4HD5A 4NZFA 3O15A 3BJFA 4K8HA 5I3HA 1VLIA 3ZR6A 3MBFA 3FA3A 1TCMA 1VFOA 2ODOA 3LBMA 3R10A 1RJQA 2YFOA 4JKLA 1MRAA 3RXZA 3WF4A 3GIYA 4ICNA 1BKHA 5I0DA 4TXEA 2J9ZA 3M16A 2GUUA 4QLKA 1K8CA 3W0KA 3BOLA 4EKJA 2RUSA 4W9TA 2ZUSA 3MUIA 3VNKA 2PU0A 2EEXA 1XLAA 1FWFC 4RNIA 2FH8A 3AIQA 4W85A 2OODA 1JXJA 4JS3A 5IBXA 3OJGA 3PANA 5BMXA 2J7DA 3EB2A 4E4FA 2DSUA 3LHVA 4D1IA 1MW1A 1E4MM 1FFQA 5E0FA 4WEVX 1Q2RA 3GTXA 3OYZA 1FWJC 2ZX7A 2VFEA 1DIOA 1R7AA 2GJXA 2O4QA 3L4WA 1G9HA 1A5LC 1FXPA 2E1WA 3CHFA 1OFDA 1QOPA 2PA6A 5DT5A 3ARRA 1V4YA 4Z42C 3VUSA 3MYPA 3T1GA 1TZ9A 1KO0A 2ZZ2A 2D0FA 1EC8A 3PN8A 2PDUA 4B5SA 3MANA 1WKYA 4MKSA 4GCXA 2YL9A 3DHFA 2ZA1A 1SFLA 4IJBA 4M3PA 4P61A 3PG8A 4HNVA 2BVWA 4J3WA 5HAOA 1B3VA 4FXRA 3VILA 3AZSA 5DMMA 4JGDA 1ZHAA 4L4LA 4NZCA 4MJMA 3GHUA 3ZVIA 4FX8A 3EOUA 1HL8A 3MDWA 3KTSA 2XGBA 3K5XA 3WF0A 3C52A 1FXQA 3ABRA 3PAJA 2CWNA 2MANA 2HK1A 1EEXA 3PPFA 2V2DA 3EPMA 2E4TA 3SN4A 1EBHA 3PAOA 3DERA 2ZKMX 1US3A 3ZYZA 3VNJA 3OA3A 4AU0A 1BVNP 4K36A 1X96A 1YX1A 3DI1A 4U2ZA 2VD9A 2G4JA 3K30A 3N9RA 2QPUA 4Y9PA 2PBGA 3EDJA 1GVOA 3OBKA 2ZE0A 3BWWA 2G3MA 1XLHA 3PFMA 2YA2A 4JN7A 1RQEA 2FVKA 5HDRA 1W91A 3BLFA 4GJIA 1PTGA 4UUIA 4UTWC 5FSDC 5CXPA 1VFLA 4IPIA 5FJRA 1A0EA 4NYYA 3AIVA 3S47A 1JYVA 2D0GA 3DFQA 1S2VA 1XLLA 4PRRA 2PURA 4GIEA 2Q3RA 2ATMA 5B7YA 2OLSA 1QK0A 3MW7A 4JPGA 5AHLA 5ABFB 4M19A 1MZHA 5EFFA 4W5UA 2YCIX 5CC7A 2DGAA 2CHOA 3H2AA 1ADOA 2VZSA 4QDPA 3KUMA 1L9WA 3MSDA 1A5BA 4FXSA 1CXFA 4IPJA 4V1YA 1WKFA 2HS8A 3V5CA 2XH0A 3M46A 5CPNA 3ZT7A 1ECQA 2ATSA 4XSLA 1IF2A 4Q4OA 4RZ5A 3DHDA 1UD4A 3KLLA 2A3BA 1NJJA 3KCLA 3T0AA 1ONRA 3GG7A 2E9MA 1SW7A 2DP3A 3TTQA 3PBVA 4CCDA 4AC1X 3AIBA 3AHVA 4GVGA 3VCRA 4R7OA 4P7LA 4YMZA 1HF6A 4K8EA 4G5DA 2VD8A 5I5RA 1GW1A 2OOFA 5KETA 3LCWA 3VKAA 4GVIA 3MUAA 2DIEA 4JCLA 2F61A 4I9AA 3LV5A 3LY0A 1U1UA 3WD0A 1NWUA 3BTNA 2VMFA 4HCDA 4D6CA 2QPSA 1ELSA 4O50A 3SCWA 1L6SA 2REQB 3EWBX 4S3DA 4WX2A 5F2MA 1XXXA 1Q7QA 5D2WA 1HXJA 1SFTA 3KBJA 4PCPA 2REQA 3SRFA 2P0OA 4MNJA 3WNPA 2EPNA 4BI5A 1A3HA 1QPOA 3GNDA 4ATWA 4N4PA 4ZVJA 1TV5A 3C8FA 1QNVA 2Y63A 2W62A 3W1MA 4JTCA 5I7GA 4XZMX 1GOOA 3CT2A 4FNRA 1M04A 3NQMA 3BAXA 3QV8A 4UR8A 3WLMA 1UMYA 3H54A 3WYZA 1QT1A 1LWJA 5F1UA 5REQB 1BYDA 4H7ZA 4GE8A 1VP5A 3KBMA 1XH2A 3PPGA 1KQZA 4W4QA 1IEVA 4KMQA 4AVNA 1I2RA 3PZTA 3T0DA 2Z1VA 7REQA 2VC9A 3IGHX 1QR7A 3NL2A 2NQZA 4CD7A 5KSWA 1B90A 4P8VA 1YEYA 2XIQA 3DBNA 1EKOA 1VBJA 3FW6A 3IVSA 4GNJA 4BA0A 1YTKA 3CNYA 5H1WA 4OOZA 5G4WA 2QCGA 5C54A 3NEVA 4UNKA 4NJHA 4W87A 4OKDA 3DG7A 2OGYA 2OQHA 4HTBA 4AD4A 1OFPA 3CAVA 1R86A 1KW1A 1LOLA 2X05A 3ZM8A 3EMCA 3CTLA 4FIRA 4MB1A 2XVGA 5JUVA 4S23A 2Q3OA 4O13A 1Y5WA 6ALDA 3LQLA 3LS9A 2Z1BA 4HPGA 4WSJA 4KFNA 4NNAA 4DELA 2BX7A 1B3WA 1C29A 5D2TA 3WNOA 2OX4A 1JZ2A 1GKQA 4GIRA 2PGWA 4GD0A 3A4JA 3PB0A 3T09A 3GVVA 3MJYA 2R1LA 1E0UA 5FEZA 3EWZA 4MNMA 2Q8XA 3AZTA 3TN3A 4GPNA 2X7WA 1BQGA 2BGSA 3ZR5A 5HWNA 1TV3A 2NX9A 1V0NA 1P0DA 3SIMA 1Q6LA 3VKCA 2BODX 3APYA 4ICCX 3WMLA 3VX0A 1W3HA 2A7PA 1PZ3A 3M64A 2ZRVA 5BW6A 5JIPA 2WOQA 4XD5A 1LTDA 3S1GA 5AZ1A 3N4EA 5DBUA 3EMQA 5AN7A 1M7OA 1LOQA 4H7CA 1TPUA 2GQAA 2QJJA 2ALDA 3O2LA 4GQ0A 3NG3A 2Y5EA 1VEMA 1JYWA 4HYVA 3WFAA 1WXJA 2YDAA 1BWVA 3T2QA 3VOCA 1XIIA 4B5NA 2EGZA 3AHTA 2OOGA 2FLIA 2XIJA 2ZWYA 1E5JA 2PTDA 5EBUA 3ANVA 1H61A 3MKCA 3B0YA 5E6YA 4AIOA 1UR3M 1H0IA 3WLIA 3G1RA 1BWLA 5LIKX 1PCWA 1RPXA 2XN0A 5E9AA 2GVEA 3S6TA 3IJ8A 4HSNA 4WK9A 3VOIA 1VF8A 4GLEA 5LGXA 3H22A 1UWAA 2FTPA 2EPLX 1SZGA 2E67A 1WP6A 3RLHA 1EJRC 1FWWA 4P7OA 1OGBA 1XYAA 1OGSA 3ARPA 4TUFA 4JTIA 1W3LA 3W7HA 3NA8A 1RD6A 2VVNA 1WCGA 5IFPA 1QHZA 3EKLA 3CZKA 1A0CA 2VUYA 1S39A 1E6PA 4JTHA 4WJ8A 2WXDM 5HNTA 2ACQA 1QU4A 3W74A 4QSHA 2TMDA 4ZO6A 4TVDA 4DJED 7TAAA 1EXPA 2WLZA 1UA7A 2QCMA 3F4VA 1OF8A 1OBAA 1G4TA 5M2FX 3BK0A 3Q45A 3SSZA 3TSDA 1NOFA 1OCJA 4W7UA 4XISA 1FHVA 1AZ2A 2OCZA 4IPNB 5EY5A 2CLOA 3PF3A 1PKYA 2R1MA 2XGZA 4UB9A 4G2DA 2Z1SA 2Z2BA 7ODCA 4AMAA 1I1XA 2EKGA 1DWFM 5T8GA 4CKQA 4QDMA 4IMFA 2ZTJA 4CCEA 4Z1CA 5LNSA 5D9OA 3CK5A 3VDHA 2NUXA 3AWNA 4E3VA 3I6EA 3ZIZA 4M80A 3ABOA 1EGVA 5FJOA 3LLXA 1KBBA 1JCLA 1M7PA 1A5MC 1ZRQA 1O60A 4PH6A 3GQYA 2VKZG 3NEHA 2WSPA 5C9ZA 4RE0A 1KM0A 3U7BA 2HTMA 3PBGA 3DKLA 2VR2A 1Q4WA 2E8ZA 1LRTA 3I7QA 4HTYA 3NYZA 1L6FA 1WPCA 1YDYA 4NZJA 1SO4A 3PUEA 3VNDA 3ARVA 4MAZA 3URBA 1QNPA 1CENA 3BL3A 4X22A 1DQXA 1DE6A 2C14A 1DQWA 3T08A 4O52A 1F6YA 3OVGA 1EH9A 2H3BA 3WUBA 1RQBA 4LC8A 4DY1A 1R0MA 4S38A 5AB3A 3CV7A 1QATA 3MP5A 2VT0A 3UG5A 4GGBA 4W89A 1DKWA 2V63A 1KB3A 3SQLA 1MEHA 1LBMA 4UTFA 5EGRA 1WDSA 5DLCA 1UKTA 3T9PA 4ERAA 2G3FA 1UIPA 1WUFA 3WNLA 2V5CA 4WQ6A 3NDYA 2BY2A 3FXGA 1KQYA 4XIAA 3WNMA 1ZAIA 1AH3A 2PDMA 2PZ0A 3E96A 4H83A 2E09A 2DT0A 4JIEA 2G37A 1BVWA 3W9ZA 1X1NA 3AYRA 4WJEA 5A1AA 4NI3A 4YNGA 4PMQA 2WVSA 4JQ3A 3EWYA 5CBBA 4IX0A 1A5UA 4AD1A 4GQQA 3GG1A 3S2JA 5IDIA 1UPMB 1BG9A 1X1OA 1AQMA 3TOPA 1O7AA 3LCHA 1OK4A 3INPA 3EEZA 1EQPA 3W2MA 1GZGA 3QY8A 1W1TA 3LM3A 1EHNA 4AZ5A 4E4UA 4G9PA 1DWAM 5EA9A 3MYOA 1HL9A 4GZ7A 3U48A 1ZS2A 5BZAA 2XVKA 3H2FA 1RR2A 1SO5A 4NRRA 1VKFA 4JTQA 2ZRZA 1K03A 2EF9A 1HIZA 1MNSA 4GRSA 1UA3A 2OB3A 1JYNA 4JTTA 3S2CA 1HL2A 3S42A 1XD1A 1PBGA 4J3SA 1BTMA 5A6TC 2CZVA 1EQCA 3SY5A 4JL2A 1DIDA 2R24A 5DX7A 4OJYA 5AC4A 2DZTA 4A22A 2DT1A 3T8QA 4PR4A 3CWNA 1BKSA 4N7QA 3W24A 3VMOA 3LCIA 4PB3A 1ZJAA 4YIWA 1I1WA 4N9BA 3EZ4A 4LV9A 1TREA 3ZT6A 1OSEA 5CZTA 1RQHA 3M0KA 1WDPA 4A8NA 4O18A 4AFYA 3UGRA 1IT7A 4GO9A 5JIWA 3UW6A 1ADDA 1IXNA 4BHYA 3C3NA 1KV8A 1OG6A 1HX0A 5BXRA 4BR1A 4PMYA 4MFEA 2A85A 2Z6IA 3GDTA 2VXNA 1KRCC 5CPMA 1MW0A 1A5NC 3C8NA 1NFGA 4S3CA 3WLHA 1I0BA 3OOQA 5C2XA 2OKTA 3W7KA 1E72M 4CD4A 4MB3A 3LHTA 4KPLA 5DF0A 4H1ZA 3FYOA 1IXQA 2AL2A 3DHPA 1W5PA 3B9NA 4A05A 3R79A 1G7VA 2D3NA 3FNDA 1NDWA 3M0JA 1GGOA 4AC7C 3UWUA 1DJNA 3O6CA 2FTWA 1KC7A 3KXQA 4K38A 3FGCB 2A7RA 4Z1AA 1F2JA 4N6EA 4A8RA 4AAJA 3THDA 4WDWA 1AJ0A 4JICA 4AD2A 2FHCA 2YXOA 3L4VA 2WJDA 2WM0A 2F9RA 2JE8A 1RALA 4HHPA 4R33A 2X0YA 1EOKA 5GNZA 5BOEA 4TR9A 1D3CA 2CPUA 2VENA 2X1SA 3BH4A 4UCGA 4PUNA 1C7SA 2PE4A 2X30A 4L65A 1TQJA 2ISVA 2CWXA 1TYGA 3WLKX 1XGDA 5E6ZA 2J88A 4GINA 1SO6A 2DFAA 4UOZA 1P6WA 3IAQA 1KTBA 4I5RA 2GSJA 3TW9A 4B5XA 4EXQA 2G3IA 4GH1A 2J79A 3AISA 1YNPA 3WK3A 3VKKA 1EP2A 1DXFA 3F03K 4UFLA 3GR7A 3TVAA 1AG1O 4GIAA 4LCRA 4LYRA 1XLIA 3C3UA 4I9JA 3GG8A 4JIQA 1I2QA 1HJVA 4IP5A 3OLEA 3A3XA 1NARA 2B7QA 2EJ1A 3MV01 4H7VA 1KGXA 3R6IA 1OFOA 4PCFA 3KE0A 2PMQA 1FWCC 3H26A 4EAMA 4RPQA 5CC3A 2P50A 4UQEA 2PRHA 5CSUA 3AOFA 2RDTA 1V6WA 1UBSA 3LERA 4EXAA 1NSJA 5I00A 3LHYA 3GXNA 4IXHA 4GY7A 4LBSA 2YDRA 1F8IA 1PHWA 2I57A 5B80A 2HXTA 1EF3A 1XKJA 3TW6A 2G5WA 1XJBA 4LYPA 2ZUUA 1ZCOA 4FXJA 4ZOBA 5I6SA 1DJGA 1V0KA 4MUPA 3MJMA 4LFYA 2VC5A 4W93A 1TPB1 1VFFA 1JFXA 2JGQA 1SZEA 1ENUA 2J7CA 5T9CE 2RGMA 1EO7A 4PA8A 1PWLA 3IJ7A 2J77A 4GKLA 2V2HA 3W1RA 1B5TA 4E38A 1T40A 3IK2A 1JPDX 2VX6A 3GDLA 4UQBA 3EWUA 4QS6A 4DO5A 3OA5A 1FDZA 4ATDA 4LAOA 3ONCA 4WR3A 2Y89A 1GYMA 2PWFA 2WMHA 1ICSA 4HN8A 3KFTA 3C2YA 3RRAA 1YBQB 1ZLPA 4RNJA 3W2LA 1DVJA 4IP7A 4CQ8A 5K4ZA 3VO0A 1T41A 2CETA 4CN1A 1YDNA 1E6QM 3UA3A 2CYGA 2ZUWA 3L66A 4K37A 1L0PA 2ZYFA 4M29A 4C91A 3RPTA 1VGAA 3OVQA 4LAKA 3A23A 1CDGA 3QGKC 4UTUA 2OWWA 5AHFA 4ZFMA 3C0JA 4CQAA 3EX4A 3RU6A 3LXBA 2QCLA 3R11A 3E5PA 1R6WA 3NL6A 4GFIA 1TKKA 1JPKA 3LCLA 4XK2A 1PIFA 3QFWA 3TTOA 3CQHA 3RU8X 1W3TA 2AAAA 3NQVA 4HMNA 4PRWA 3S5YA 1XIHA 1FCVA 2J8FA 1M7XA 4LTSA 4RXGA 1GJUA 3RFAA 1Y0EA 3CLMA 4N6FA 3LV6A 5HNRA 1LWIA 3G0UA 1PE1A 3UZYA 2QVNA 4QROA 1KFWA 4PBGA 3NM1A 1S3HA 4DIAA 3MHGA 4JIHA 4XVEA 1BF2A 4FNUA 1A4LA 4MLJA 3SCQA 3KRSA 2J6XA 3VDAA 3AYVA 4MKVA 2CLFA 5GJMA 1OCNA 2VRQA 4NJGA 1KLYA 3RO6A 4HNTA 2IUZA 3VOGA 9XIAA 2UY3A 3CQ0A 1OIMA 4JFUA 4HPXA 1J0KA 2PDCA 3OGVA 4JL1A 2P8BA 3TE9A 3W22A 3P84A 4NP7A 1ZCCA 5FESA 2DJLA 1XINA 1OB0A 4N0RA 3WQ5A 1EPVA 4ZQMA 2E6FA 2CITA 1AQFA 4FOKA 4B3LA 2E77A 3W02A 4X3ZA 4FR1A 2JKPA 4IFOA 3RHGA 1PHQA 3W53A 2CZEA 1XDLA 1RD5A 2FZDA 3WLPA 4S2CA 1L8NA 1F3XA 3LGEA 3NPWA 2F84A 3LOTA 3QRHA 3WQ6A 3BPWA 4H9MA 3CU2A 3O9NA 4HGXA 3TQPA 3P5YA 4M5PA 1EL3A 1F4HA 2DIJA 3VNMA 3BLDA 1U5HA 5DANA 4QE4A 1EA9C 3K4DA 3KVKA 2WNWA 2WNNA 4QLLA 3TIMA 2GVGA 1ZAHA 4WOZA 3U3HA 4Q7IA 1CB7B 4S39A 3MWCA 1H60A 5BU6A 4P7NA 4PEEA 4QAWA 1VEPA 4ZL1A 4UQ9A 3W6MA 3WN6A 5JBEA 4WKHA 3CH9A 1PKMA 2Y8UA 1SW0A 3FLUA 4GVHA 3T78A 2C16A 1YKWA 4OE7A 3REQB 2WC7A 2GGGA 3DX5A 3QJAA 1DTUA 1YADA 1DXEA 3MMUA 2ZE3A 4QCEA 4LBUA 4KRTA 3W1TA 2NLIA 1ODZA 1OGGA 2D3LA 1KGWA 3SECA 4MF4A 2V8ZA 5RUBA 1J2WA 4KWSA 4L9ZA 5ECVA 3B8DA 3L7RA 3WMCA 5D05A 1FKXA 1NFPA 4HPHA 1ZBVA 1YNQA 1EYWA 3WD3A 3WNKA 1F9CA 3IJDA 1R38A 8TIMA 4HMCA 1CXKA 1M1BA 3G0SA 4DNMA 3N29A 3L5MA 3CC1A 1POKA 2FGZA 2RJHA 4REQB 4OZOA 3C2RA 1BHGA 2Y8VA 4I5XA 1KXVA 4O14A 1TPEA 1FOBA 5EMMA 2I1OA 1HVXA 3U7VA 1AD1A 2C1IA 4FNSA 1V3HA 4EPBC 1RY0A 2PDYA 1EWEA 1GVSA 2PWEA 1W5OA 4K6AA 1TQXA 3T2OA 1JNDA 2J25A 5CPLA 3WENA 3M0ZA 3EB4A 4K68A 3KX6A 1AW5A 3VNIA 5ENLA 1PCKA 2PF0A 1E1CA 4BQ4A 1JFHA 3GM8A 3TLLA 2YW4A 1SJDA 2DT2A 3TYEA 3A21A 1ZU8A 2IPJA 2IXVA 3FYPA 3ARXA 3WLJA 4GA8A 2V5DA 1JIBA 3G1XA 1JCJA 1FKWA 1LRNA 1VS1A 4Q33A 1TRDA 2J8GA 4XKYB 1NAL1 4OQVA 1XH0A 1EZ2A 1WDQA 2CEQA 4H9XA 1C3FA 1IGSA 1TVLA 3GFZA 2FPVA 1RZMA 5MF5A 3S5NA 1TMLA 3ES7A 5G1TA 1NIUA 4AQLA 3BZGA 3MSRA 1XYZA 4GO8A 4H8UA 1NFBA 1ODUA 3HV8A 1UKQA 3BV4A 1J96A 3XIMA 4AZCA 4MKNA 4D1JA 2I5GA 1LF1A 4YTTA 1VYSX 5D37A 2I5IA 1E6ZA 1YIXA 3B8UA 4PUDA 3G1AA 5AHMA 3L5AA 2NQJA 2Q09A 3UCDA 2GWGA 3MSYA 4EWND 2YGYA 3NNTA 2Q8LA 2YXGA 2X0SA 1HKMA 3HU7A 4QEEA 2ZOXA 1Q6GA 2DT3A 4EPEC 3QEZA 4U10A 2TAAA 1K02A 3RILA 4TOQA 1JUKA 4IIBA 1W5NA 2VGBA 3MY9A 5D2VA 3N14A 1BYBA 1GJPA 3LLFA 3TJLA 3T05A 2EJAA 4BF9A 2Y70A 1EP1A 2B7NA 1F5ZA 1QVBA 3R0UA 4MTVA 1HJSA 1R47A 1TZZA 3LPPA 3IJIA 4MJ4A 2NT0A 4UTKA 2NV9A 3EWWA 1LZOA 1LG2A 3N6JA 3RN6A 4AIBA 2Q02A 2PDWA 3L4ZA 3QMRA 4B5WA 2PLKA 1UKSA 1EHAA 3G77A 4F0RA 2PDHA 3EPOA 1OX4B 2H90A 3OYXA 2EPKX 3GVWA 4ZO8A 4PTVA 4KWOA 4KEUA 1XH1A 1GOWA 4DX3A 4RL3A 4GWEA 1VFTA 3QV6A 3SN0A 3Q67A 2VGGA 4QTGA 2QJMA 4YWSA 2VEFA 2CKSA 3F5KA 4F0HA 3WG6A 1NU5A 4Q4MA 1TR9A 2FPYA 4F9JA 1H7XA 2QUNA 1XRSA 5BOOA 5AC6A 1JGMA 3L12A 4JN6A 1L2QA 2JFEX 2HROA 1A3XA 2J47A 2E8YA 2XM1A 3CHEA 4GKTA 5DXYA 1ZUAX 2JEQA 4BCEA 3TR9A 4DI8A 3P0WA 4DUOA 2Q01A 4L7ZA 1OX4A 1ICPA 4JQ2A 4PFMA 3R8RA 4ONVA 3MCOA 4O16A 1TO3A 3WQ8A 1VCFA 4FHAA 4PCSA 4RV8A 1EJXC 3RM8A 1QO2A 1JR1A 1LLZA 3S5SA 2XTKA 1SFSA 4I8YA 5IOBA 2CZFA 1R3YA 4MPKA 2NXGA 2OX1A 4PMDA 4LVGA 3EDDA 3S6OA 3LXAA 1H62A 1U2YA 2QGYA 3I7SA 4Q8WA 1AQ0A 1DP0A 2V3FA 1P1MA 1FCBA 2V3EA 3ECQA 3VVGA 3ZT5A 1TCDA 5FJIA 2QJNA 3DBPA 4IQLA 3Q65A 4G56A 1Q6EA 1A49A 3WH8A 4AXKA 5I09A 1TZ7A 3L5LA 3W87A 1UIOA 4MLRA 3TJ4A 2AGKA 2PGEA 4C6LA 3EDEA 4RUBA 3JW7A 3HPFA 1OFAA 3NQFA 4M7SA 1TWSA 5CLTA 3B9OA 1ZGDA 2WSYA 1RK6A 1HO4A 3C4UA 3W82A 1SSDA 1NF7A 3D3FA 3NGJA 1I2NA 2J7FA 4C7GA 3UR7A 2DZBA 3VIOA 2YBVA 5FF2A 3THAA 3VIGA 3C0LA 1I9CB 2J13A 3TH6A 1PX3A 5HNNA 1JAKA 1OC7A 1TE6A 3NJ3A 4DBEA 4UFHA 3URAA 4R85A 1PZ0A 2QF8A 4OOUA 1D8WA 4CQCA 2PWHA 2NV2A 3LDVA 3W1XA 2Y0FA 1HTIA 1E43A 3JS3A 4GVFA 2ISSA 3UJSA 4MZYA 4B5TA 2CBVA 4JTKA 3GNXA 3G1SA 1IYXA 3ERPA 3VD9A 3OIHA 4IQDA 4NZ5A 1TWZA 2PCEA 5AVHA 1UWQA 4Q32A 1JCYA 1J0HA 5CZJA 5M3WA 2ZUMA 3URNA 1E15A 3TN4A 1OFRA 3B9EA 1J8VA 3LB0A 1KRMA 2X1RA 4R88A 3DU0A 1F07A 1GVYA 2MNRA 2WZTA 3T4CA 4HNNA 1FHDA 1LBLA 2B81A 3R7MA 3F2BA 1NOUA 4NAEA 1KRAC 4O8RA 4K1WA 3TZFA 5A8MA 1VCGA 2BV9A 2WHKA 2FDSA 4O57A 1YQ2A 2DZPA 1K3UA 4TVCA 3T8LA 1KM4A 3GTNA 3UJ2A 3B40A 3LK6A 5BROA 4B5VA 5C7HA 2YZRA 4PMJA 3PZVA 1VJZA 1FWHC 1JZ4A 2ZC8A 1K77A 2QDDA 1V51A 4LCSA 1ZENA 2PI6A 4GQRA 1CLXA 4GMEA 1FHLA 1XIBA 3NDZA 3EWXA 4HBKA 2GGJA 3NQ6A 3FDKA 1UYQA 3GZAA 1DV7A 1EDQA 3FIGA 5HQMA 4E5TA 4UTLA 3K46A 3RAOA 4ASTA 5FF4A 4K1GA 2Z1XA 3KDNA 1LORA 1UD2A 1ITQA 3RPDA 1UASA 3CV6A 3TCEA 2HS6A 3PPHA 1IEQA 3UXIA 2CFFA 2BDQA 3WDIA 3I3DA 3S1VA 4J2PA 3LEPA 4HYRA 3AXIA 2I16A 3UD6A 2INZA 4HA4A 3CB8A 3BO9A 1KR1A 3UWZA 3WF2A 1S2UA 4KEZA 1MUWA 5FKYA 1VJIA 5LXXA 5AFDA 1J2BA 1ZJHA 4Y9AA 1B3ZA 1TRIA 3FX4A 1NDVA 2ZX9A 5I3GA 4J27A 1CLKA 3NSMA 1KGUA 4PUMA 4GBUA 4DUXA 2INFA 4DJEC 4E2BA 3HF3A 2PDLA 3E2SA 4QR6A 4ZR8A 1UZ1A 1W1A1 3FSTA 3WQCA 4JHMA 4TX6A 1GG1A 2WC4A 4H19A 3B0VC 3SJNA 1CGUA 2J62A 3N13A 2ONEA 3LA4A 3VM7A 1MXSA 2I9UA 2UY4A 4F66A 1GQKA 5G1MA 2VFFA 3A5VA 4LS2A 4UFMA 2ZTKA 3PBYA 1C93A 3TR2A 1GOIA 2W63A 2WNQA 4G6CA 1E0XA 4LV4A 1NWSA 2QIWA 4XZIA 1VPYA 1DBTA 1ISYA 3GH5A 3VCCA 3DAQA 4GNKB 1XPGA 4PSRA 2DH2A 4UFKA 3M5XA 3FVMA 2BLEA 4TO8A 4IHCA 1AMKA 3GHSA 2D22A 5HA7A 4UR9A 4ZE4A 5G4EA 3ITVA 2FHBA 5LIWX 3GYEA 4XO7A 3A12A 4MJ2A 4QGCA 3EOEA 3T55A 2ZA3A 3NM3A 5G2HA 3VM5A 4A3YA 3MV11 4IIDA 1J0IA 3VNLA 3SGZA 1E40A 4GHRA 4HJWA 4KEMA 4BEUA 1D9EA 5LNWA 4RJEA 4DJEA 1JF5A 1OD8A 1XRFA 4A3HA 3QR0A 3OHIA 1KWKA 2YB4A 4LALA 5XINA 3ISIX 3QZEA 1POJA 1D7FA 3ZXWA 3E12A 1M5WA 1Z3NA 3EBVA 4O0QA 3LPGA 2OYLA 4AH7A 3WQVA 3BXWA 4ZA0A 1HJQA 3W26A 4FR6A 1TFVA 4OVXA 4QJ4B 4DZAA 3UCQA 3W2NA 2GZXA 4LSBA 1J18A 4HSHA 4Z2IA 2J9XA 1UD6A 4DAIA 2ZBTA 3RO8A 2J24A 1OC5A 3KP0A 5A6BA 3W29A 5G2WA 3VPLA 3HG2A 3TEVA 3UVAA 3IJ9A 1M03A 3SRDA 2NWRA 4MY9A 4UFIA 1UOZA 3CO4A 3B0UX 4KETA 4WKFA 5DMYA 3R2GA 4H9TA 2C18A 3FXYA 3AHZA 4PBFA 4D8ZA 3WELA 1ESWA 1HKVA 1MRQA 5CQ1A 3SB0A 2F7FA 2WC3A 2Y24A 3W27A 5F7UA 1XFCA 3P62A 3P80A 1YHTA 1R85A 4JQAA 3SCSA 2NVAA 3P93A 2EHHA 3FKRA 2GUYA 1ITXA 4DEFA 3F5LA 1H5YA 4O11A 2O92A 2W5FA 4QBXA 2BGNE 2WPBA 1HKIA 5I23A 1SSGA 1YXYA 1MXDA 2JKEA 3AIEA 1DJIA 3CQJA 3DC8A 3M4HA 3P74A 1K7XA 2ZRWA 3SCTA 4C6PA 2L5HA 3G6MA 4ERIA 4BFAA 2YSWA 1ZB5A 2QMJA 3PTKA 4NUWA 3WL1A 5I3JA 4RE3A 5F4WA 3O0KA 1JYXA 1EBGA 4F0MA 2OZTA 4BWLA 4CNPA 2H3DA 2WSKA 3CWOX 3B8IA 4M6VA 1CCWB 4NILA 1R2SA 4KS0A 5EMKA 1UUQA 5L9FA 3BAYA 4KESA 4KWUA 3PZNA 3W7CA 4PEKA 2QR6A 4NAEB 4R3UA 1Z6KA 3L4UA 1RXOB 3NVTA 4QQ3A 1TMHA 3S1UA 1FWBC 3MSGA 3P8JA 1EGMA 1OG0A 4KKXA 3QYQA 1SZFA 3UGVA 4QNWA 1N55A 3TJIA 1THFD 2OYKA 1GOQA 2VDGA 3AXHA 5CAKA 3NO3A 5AYIA 2VR5A 3W1QA 3P3BA 3VFCA 1MEIA 2QULA 1LCOA 4LT9A 2OT1A 4MZ1A 4LS1A 1S5MA 3TX9A 3RMEA 4G8TA 1DWIM 1ZY9A 1D7KA 1ZP3A 3T6CA 4I7VA 4HMDA 1B4KA 3WBAA 2AGTA 1CW2A 3FDGA 5FOOA 2D0HA 1TTJA 3EOLA 1OK6A 4X60A 5J8LA 5FAGA 4B2DD 2NVCA 5ABFA 2HQAA 2A6LA 5C9WA 5K2ZA 3E6EA 4YVVA 1KXHA 4Z0SA 1N7KA 1H1YA 3N25A 1NDZA 4JTGA 4R7JA 1AL7A 4ICMA 3IK4A 2QDGA 1KM3A 1M6JA 3BW3A 3C56A 3GW0A 1XCXA 2QCEA 3PZMA 1IT0A 2Q8ZA 1HFBA 1OF6A 1XSKA 3ZLHA 4M82A 4LS0A 1TWDA 4B9ZA 3MP4A 3W7RA 2P0IA 1NH6A 5MKGB 3N19B 2ESCA 1N82A 3TTSA 1YTDA 4H2HA 3GKAA 3LTPA 5CJNA 3OLDA 1W32A 3O1NA 5LNRA 4MWAB 4LEFA 3O6YX 3GTHA 3GD6A 4OTKA 3KDOA 2WZEA 2MUCA 3LTSA 3RM4A 3GUGA 4RZ4A 2NQ9A 2DORA 2HWGA 1TG7A 4O1BA 5AKQA 3NZQA 6TAAA 5AYXA 1MQRA 1X7IA 2Z7GA 8XIMA 3URQA 2P1FA 1SJBA 3FN9A 3VA8A 2WMIB 3UU0A 2VURA 3ZJKA 1SUXA 1CTNA 6A3HA 4M1BA 3HN3A 3CZGA 1TX2A 1DOSA 3BAWA 2CLHA 1DHKA 1IXPA 1ALDA 4DVOA 5DN1A 1GORA 1E0WA 2O56A 1J12A 3S8HA 2O9RA 1I0DA 3HGSA 2BBFA 1HO1A 1W1IE 3LLDA 2RAGA 1WA3A 2Y6ZA 4ZB0A 3N9KA 3ARUA 1Q6DA 3XISA 3B4UA 4KIRA 1IWBA 4FOJA 5K9DA 4YWIA 3KOXA 1P4CA 1UJPA 4C6FA 4QG9A 3H2OA 5GNYA 4Q8VA 3VGDA 5E93A 1Z89A 3F4WA 4M56A 4F0LA 3NIYA 4ZMGA 3MKKA 4A6GA 1QNOA 1RLCL 4Y2WA 1VYPX 4R27A 5HNUA 4W5ZA 1J79A 2CESA 5EU9A 2NSOA 1H7OA 1WNOA 1Z9AA 2F6KA 3SI9A 1UD3A 3N2MA 1MO0A 4CNOA 4FNTA 4TX8A 1AW2A 5BRQA 4CN6A 1GHRA 1WE5A 2HNEA 3AMKA 1MNZA 4CD6A 1E1EA 1FH9A 4WLCA 1ISZA 1Q2SA 2XM2A 1FDJA 3WQGA 1XLMA 2FFIA 2HE8A 3W6YA 4RPPA 5HUPA 1U1HA 3GSMA 4NX0A 5FL0A 3N2OA 4IG2B 3W7LA 1TV8A 1HKWA 3MCNA 5AY7A 4AVOA 4L61A 1W3IA 5EMJA 5LA1A 4MYAA 3WK1A 1CXIA 2ZRYA 4LGXA 5DCEA 1W0MA 2IMRA 2OTDA 1JXKA 2HV5A 5U7SA 3QBUA 3BUVA 1GHSA 4DM2A 1PWMA 2FZNA 1XYBA 1JRCA 3DGBA 3B05A 3VD5A 1HN1A 1DJYA 1TA3B 3SDOA 4H9ZA 3I3BA 4K7YA 3HPAA 3V16A 1HW6A 3GYCA 3ZWSA 2YA1A 4AEEA 1UR1A 4HZ8A 8RUCA 1ZQ5A 2H9AA 1W9XA 3MUCA 4MOZA 5AHEA 4UTIA 2A3AA 2EPMX 2DZWA 1JF6A 2D2GA 2OGJA 3AS1A 3VMPA 1G5AA 5A6AA 3BW4A 4GQGA 2C91A 2NLYA 2HK0A 1SYTA 1EDGA 3SUSA 1OQFA 2YCJA 1T8XA 4JNMA 4F2TA 2R1KA 2Q6ZA 5LSMA 2WSRA 1GQJA 1UP0A 3SADA 3K4WA 3HJEA 2AKZA 4XD4A 5IBXC 3T0BA 2Y1HA 3GAKA 4XZWA 3VYLA 1CGVA 4WY0F 3EXRA 2QUVA 4DF2A 1O5KA 5MHBA 1Q63A 1QPNA 4DJFC 2NUYA 3RX4A 2C1HA 3JR2A 1RCQA 1XV8A 3TMQA 4MHBA 1GVFA 1R3VA 5CZKA 1KCLA 4AZBA 5D2XA 1EC7A 2INEA 4EK7A 1REQB 1IR1A 2GVYA 3HQPA 2C13A 3UWEA 4KCUA 1OABA 1W1ZA 2V68A 1AZ1A 5G4HC 3SY8A 3HG3A 4U5IA 3SURA 6TIMA 4PMOA 1J5SA 3HGOA 3MP3A 3P2VA 4NIRA 4KGJA 1NP0A 2DEPA 1JGIA 1XLEA 3HQ1A 4HSOA 4JX6A 1DWJM 2V81A 5I3FA 2Z1WA 1GNXA 4D72A 4LW7A 4HK5A 3F5JA 3J7HA 3E74A 4PTNA 4POCA 5C9XA 3RPMA 1I2PA 4YHEA 2PRLA 3B03A 1MFUA 4WJXA 1DORA 1CXHA 2UZ9A 2ZWZA 3GUWA 3NGFA 4DI9A 3CV2A 4ROPA 2X2GA 3DCPA 2CU0A 2JF7A 1K9FA 4BJHA 4C6KA 3SCPA 3W4RA 4UTTA 3L4YA 3CHVA 2JEPA 4LXFA 3GVGA 2OJPA 3PTQA 1UPPA 3UYIA 2YDQA 1QRQA 3HA1A 2ASHA 2CERA 1FQ0A 3DZ1A 4P5UA 4CQ9A 1S5TA 4I9MA 1H7PA 1BEUA 2PS2A 5KINA 4O19A 4KH2A 2BFGA 4H6QA 3PZIA 5XIAA 1BD0A 1KBKA 1V0LA 3QLDA 3CTTA 2GGHA 4D6FA 2EG6A 1XLFA 3G1DA 3IWPA 1JPIA 1I45A 4DPQA 4Y9OA 3L68A 1H1ZA 2X0HA 3U0HA 4XKMA 2BSLA 3AAMA 3O8AA 3TYDA 3NXFA 2WYSA 2PWVA 1E0VA 5HMEA 1ISVA 2VDIA 1QOQA 3KL3A 2LLEA 1LOSA 1E9IA 1PXGA 4ZQOA 3QKZA 1FCUA 3TUUA 2PWDA 1HVQA 1FWEC 4H9UA 3VU2A 3WDHA 1JPHA 4PMZA 3W2KA 4Y90A 1OM0A 3MI6A 3DFPA 4LNCA 3CM4A 3TXZA 5HINA 1KM1A 2C19A 3WSUA 2D73A 4J28A 3QVQA 4QE5A 3A3WA 1L8PA 3GE7A 1CBGA 2QV4A 1NM9A 2GDQA 4LU0A 5M17A 2AKMA 2PDKA 2P3ZA 2W92A 3F1QA 1CX9A 1R46A 2E6YA 3UG4A 3BLPX 2FGLA 3KOYA 3HO8A 3IPWA 3NQAA 4OHQA 5KMYA 3ABXA 1XC4A 4QITA 1J93A 2XWEA 4GY0A 2OYMA 3KOFA 4O0ZA 4BQ5A 1A5OC 4MB4A 1E9YB 5A2BA 5CGQA 1GYLA 2YB1A 5A8NA 3M0LA 4HT3A 3VIKA 4EPKA 1KFEA 3MCMA 3VGBA 3KZPA 4A2SA 4J35A 1UROA 4LBRA 2PDBA 3W38A 1NP2A 4IF2A 2OVLA 2QCHA 3FCPA 1VJSA 4GI4A 2QMKA 3HJZA 1WXYA 1XIFA 3R94A 1FCQA 5D02A 1XHGA 4PMRA 2OO0A 3CUJA 3ITTA 1KV5A 3ALFA 5AC7A 3WZ0E 4PC8A 2XIOA 4JTSA 2QEZA 3A3HA 3GDBA 4RW5A 3DN5A 5DFAA 5D9NA 3S9IA 3H12A 3SCVA 3WLLA 2OZ3A 1FWRA 1KCXA 5BRPA 4E3TA 3A24A 4LYKA 5IDZA 7TIMA 1PV8A 1SO3A 4QJ3B 3ATYA 1E4LA 1MW3A 1W5QA 1EUNA 5JMUA 2E0PA 3REQA 4DXVA 3VX1A 1JDFA 3VZZA 3VIHA 4J40A 3QW4B 4JYDA 4ENLA 1W3KA 3T0CA 4E8CA 1OT2A 5FJTA 1E9LA 1GQLA 2XISA 1PYMA 1S2TA 4P8XA 4ADUA 4MPQA 3GTIA 3E2QA 2OQYA 3UYCA 5ABTA 3ZFHA 2OSYA 4M81A 3VC6A 1GW9A 3WLTA 4DZ5A 3E49A 4AZCB 3I68A 4H9YA 1DWGM 1W37A 3QC3A 4S3BA 2JQXA 2ALRA 2ZZ7A 2X41A 4JQ1A 4Q22A 2YFNA 3PWAA 2OKOA 4KRZA 4DJFD 5A6MA 5H8PA 3NTYA 1E6SM 1GPFA 5D4YA 3DDMA 4PFHA 1T6MA 2QF7A 4EP8C 4HIBA 3QMSA 5HPOA 5LIXX 1JI1A 2E9LA 3QQ1A 2Y7DA 2QUTA 4IUGA 3JUGA 4I6KA 5I03A 3C2VA 2PPGA 5M5DA 2PRMA 3TNOA 2PP3A 2OPJA 3FJ4A 1FBAA 4GYPA 3CLWA 1F3EA 1FX6A 3GS6A 5DELA 3V35A 1C9DA 3VIIA 5FJUA 1OYCA 1QI4A 5D38A 3OEXA 1XYFA 3I4EA 4ZO7A 3HQNA 1LT7A 2V82A 3NXLA 3TU9A 3QZAA 2Z27A 2YBTA 5HQEA 3WEZA 1YE4A 3W7IA 5AHNA 4GYKA 3AICA 3TQKA 1AJ2A 2GJRA 1F74A 4REQA 1UWSA 2WBKA 1S46A 3LCXA 5F4SA 3K4AA 1GJWA 4IIEA 3E38A 4LF1A 5E1QA 4BF5A 5I78A 2QCDB 1QI5A 4LY8A 5G1YA 5K3VA 3CS2A 3WEOA 3UR2A 1W1PA 2OWCA 2VC6A 2YA0A 3S9ZA 4FF5A 2OZ0A 1LDCA 3P60A 4W8LA 2G95A 3RJXA 1TPH1 4JNYA 5TAOA 2Z4GA 1H63A 1SGJA 3TA9A 2V30A 4M6QA 3V18A 3NQ8A 4L64A 3WQEA 4FI4A 1VFUA 2YOCA 3P5ZA 1HNYA 3UPWA 3WMSA 2POTA 4O1AA 3NL3A 3BSGA 2EPOA 1V6YA 1Q8AA 3KM8A 1CGXA 1KXTA 3PBMA 1SFJA 2JGYA 3HG5A 3ELFA 4ZTYA 4F3HA 2NQLA 4DLFA 3IRDA 3GTFA 3FEMA 3WDQA 3FA4A 3CBWA 1Z42A 1IEIA 5H91A 1XICA 3GX9A 3N1AA 3VKJA 3R1ZA 2DUXA 3T40A 1VRXA 1X39A 1DEDA 4H8HA 3D46A 4JOMA 1V3KA 4X0VA 2Z29A 2EG7A 2PLMA 2AQWA 5LHFA 2YBUA 1RCXB 1RY8A 3I3EA 3ZLGA 1SR0A 3KWXA 3SGUA 4NJIA 4HU3A 3TN5A 3F4CA 5JH2A 3D0CA 3UZZA 5FEPA 1A5AA 1DJQA 1S5VA 1CLVA 3NAVA 2YZ5A 3QR1A 4LB4A 3C5QA 1M01A 2BHUA 2ISDA 1GEQA 4E2OA 1K7FA 4MADA 3SY1A 4ILSA 2FH6A 2GWNA 4LVFA 2TYSA 4AW7A 1UH4A 3TMLA 1TJPA 3EPNA 3LENA 3W72A 2ACSA 3UY8A 4Q3MA 4KQNA 2JKAA 2IPFA 1R87A 5BOFA 4GX8A 3GU2A 2XSXA 1XC6A 3BQ6A 3H2MA 2JF6A 1EJWC 3F7JA 4HNCA 1BYCA 4JNZA 4BQ2A 3A6OA 4AY7A 4Q4SA 4DB7A 4XZLX 3EX2A 3O3RA 4HP5A 1Q8JA 1E6NA 1A4MA 3G5EA 4MUZA 4C6DA 1VENA 3NO5A 2CLPA 1UR8A 3M41A 2ZUNA 2P5NA 4US5D 4Q7BA 5HMSA 4GZIA 2HXUA 1F7BA 5A6JA 2DSWA 3NUKA 4C6JA 1FFRA 3SJ3A 5KEZA 1XLJA 1CPUA 2ZDSA 1X97A 1IEWA 4YPJA 1FWTA 2PCQA 3THQA 3PNZA 2R94A 1OX6A 2TPSA 1XLCA 1XWYA 1XX1A 3OZOA 4AUBA 3NQDA 1EB3A 4PL2A 3NFUA 1OZMA 3ZLFA 2G50A 4PULA 1VPQA 4PUUA 2VUNA 4OUEA 4FAMA 1OHLA 3ARZA 2WMIA 3CASA 3KBNA 2D69A 4EF8A 1UR4A 4RE2A 3UESA 3WD4A 2DZSA 3WY1A 2V67A 4PE8A 1ZJBA 2PU1A 1RCOB 1VB9A 4HZ7A 5I3KA 5TF0A 3RR4A 4NZ3A 2QGHA 3CUIA 3UR5A 1H4PA 1W9DM 1G1YA 3WLNA 2PFHA 4UIOA 2I14A 3BLKA 3SUUA 3QZ6A 4U31A 2V5BA 1R3TA 1VPXA 4HHHA 4DYEA 5C6MA 5GQBA 2WHLA 4NJKA 1U5VA 4XD3A 1J0ZA 1M68A 3KBVA 6XIMA 3E9AA 4NAFA 2SFPA 2OMAA 3CWHA 1G01A 5C71A 4G7EB 2QW5A 4AZHA 5C9UA 1DYSA 5FL1A 3OZYA 3IS4A 2W79A 3POHA 4PRTA 5E9XA 4M6PA 3VABA 1TV4A 4FMVA 3ID7A 1REQA 4YL2A 1C8XA 2ZXDA 2ZQ0A 4UZUA 3KS5A 1OFBA 4GUFA 4X2PA 3ONBA 2WV8A 3BG3A 5E0KA 4IFKB 5I3DA 1EEPA 3O05A 1P6CA 1XQKA 4CEUC 4LRSA 3FEQA 1KFLA 3MU7A 1JUEA 5FF7A 5A2CA 4S2BA 1ICQA 5A6SA 3BGAA 4LJ3A 2XSBA 2CW6A 2P10A 2OEKA 2R91A 1WQ5A 2BY3A 1EFZA 3KVLA 3HMCA 4DJFA 2FZ8A 1V77A 4K7VA 2PF8A 2GLKA 3QGVA 1OX5A 1U5JA 3AO0A 4NZ4A 3B8SA 1RVGA 1H49A 2CLMA 3BJSA 4FX7A 4LUTB 2WVVA 4G1NA 4DO6A 3DFSA 4IM4A 2PC4A 1Y65A 3GHTA 4PCTA 5BCAA 2FGBA 3WF1A 1JD9A 3OZMA 4JBRA 5JXQA 1JRBA 3EDKA 4Q8UA 3H6OA 4Z08A 3WBEA 4N9EA 1VBRA 2X1TA 4BZYA 2ZXBA 1QUMA 1Z7AA 3BV7A 3PNUA 3WF3A 3P61A 5C70A 4J3TA 3WDJA 2W61A 4WXZA 2IPWA 1ZTVA 3TP4A 1IV8A 4CU8A 2VO5A 1K7EA 5AC5A 1MUMA 5CBJA 4IMAA 3KOZA 2ISFA 2WKLA 3TCSA 4H3DA 1A80A 3L21A 4Q6JA 4FLQA 4ZZ9A 4DNHA 3V0SA 4B91A 3N34A 3G24A 1T7LA 1FHUA 3UCCA 4N42A 4B15A 1B31A 1V93A 4O1CA 3HZ3A 3R43A 1JDDA 1H7WA 2AAMA 2BXYA 2XH4A 1W8GA 3GW3A 4XX6A 5DQPA 4D6EA 1KTCA 3AFBA 4NKCA 2O9TA 4O28A 1EZWA 2WCGA 5JBFA 2DQXA 1UD5A 1JUBA 5H2ZA 3SRKA 5D9MA 4A2RA 4DWSB 2DU2A 1UP3A 3PR2A 1XFBA 5I2UA 2J9YA 3AQUA 1XS2A 3MQTA 1JZ8A 1LUCA 1V7YA 1X38A 3LPFA 2VOMA 4UMBA 1K4GA 1X8FA 5CJMA 3Q94A 3W00A 1UWTA 3M0XA 3BAIA 4O1EA 2P3EA 1CEOA 4HOWA 1FTXA 2Z28A 1R9YA 4MDPA 1VFSA 3STGA 5HJLA 3PZQA 1JL8A 3VE7A 1NY1A 2ADAA 3RITA 5U4NA 2XWDA 3HM7A 4GOAA 3W1PA 5FAJA 4PN2A 2DH3A 1N2VA 1KM5A 2GUBA 1Z48A 5CPOA 1Y5VA 3CUZA 3IVUA 4IOTA 2D20A 1LROA 2XZ7A 4FLSA 3NZGA 2VJXA 2EPHA 3PM6A 1PDYA 2ICSA 3D3AA 3W84A 1GOKA 5EMYA 3ZO9A 4NYUA 3EX6A 3FKKA 2IKHA 3IV8A 5H8UA 2YL8A 3KVMA 4XWUA 2UBPC 3RRXA 6ENLA 3FOKA 2V3DA 4JD4A 4CEXC 1TMQA 1QXLA 4JDYA 2BXVA 2VFHA 2GK1A 4U3AA 3ZMRA 5I77A 3NQ7A 3MUY1 3DYPA 2V2CA 3TTYA 4AWEA 3U8GA 2GJPA 3O06A 2RDUA 4DYKA 4Q7NA 3QV9A 4PB5A 4ZB2A 2RGLA 1KBIA 3MMWA 4JTAA 4JZ5A 3VOFA 4HPNA 3WD2A 3VE9A 4H9VA 2B7PA 5CGTA 4MY1A 1VEOA 4I7WA 3UPMA 4LVAA 3CPUA 1QWGA 2QAPA 3N6QA 3K1GA 3G3DA 1V08A 4RK8A 3WH9A 1TIMA 5GJNA 1K9DA 3P81A 3P8IA 1QCWA 2OU4A 3IIVA 1XGEA 1TPFA 4C7DA 3NPUA 1S5NA 1QW8A 4IWWA 3T42A 2O4MA 2WMKA 2AL1A 3FA5A 1DJWA 4NT0A 4LUSA 3STPA 2GJNA 3VIPA 3RGTA 4QJ1A 1LM1A 3WO8A 5TIMA 4QP0A 1QPQA 1XYLA 4YN5A 3I10A 1JZ3A 4AIUA 1IIHA 2OZ8A 3WH5A 2O0TA 3B4YA 3W7EA 1FWSA 5AOUA 3L67A 1U1JA 4KWWA 3UA4A 4E8GA 3BG9A 4M7TA 1XBYA 1XI3A 1RAKA 1TJRA 4PMUA 3WLQA 3NURA 2ISWA 4EPDC 3BLIA 1PX4A 2WWCA 4LQ1A 4Y8EA 4F2BA 3STFA 1XYMA 4XZ9A 1MQPA 4ZODA 1KBLA 4DXXA 1E6XM 3BICA 2ZZ3A 3B8TA 2PDGA 1TPVA 1BSLA 4NSBA 5I3IA 4RKAA 3P7YA 3ZSSA 2DW6A 1YLVA 1F4AA 1FP9A 1F05A 3W6LA 1PPIA 1XD0A 4LCQA 2VDHA 2X09A 4J1OA 4RXFA 1PVNA 3M9YA 4HZ6A 3TYUA 3W76A 4N9DA 2PLJA 4LF2A 4O0KA 1WAUA 1YXCA 4NJJA 4IH3A 2QPXA 3W07A 3V36A 2ZX5A 1MI3A 4PMVA 2A4AA 3OP2A 3ARTA 4O10A 1UWRA 3FSUA 2WMFA 1B1YA 3CHCA 5D04C 1KXQA 4AHOA 4C5YA 3DYMA 1JQVA 2VZVA 1VLWA 3H55A 3KCJA 4PUWA 4QXIA 3NPVA 4CUCA 4KCTA 1SR9A 2ZDRA 4HKPA 4IIHA 4G7FA 2WKJA 1GKRA 1YE6A 1X7FA 2VOTA 2WMJA 4QQUA 1ISXA 4MWAA 4V33A 3II1A 1PO9A 4LUYA 4WDTA 3DC0A 1U22A 2ZICA 1C7TA 3VK5A 5C0QA 1Y5XA 2H6RA 5D30A 4WSHA 3VDCA 3QF0A 3ARYA 3W71A 3KCOA 5CC5A 4IUOA 1J6OA 5HR7A 1Y8BA 1VBUA 3WQPA 2QXWA 3R13A 1W31A 3TJXA 2Y7GA 5EMUA 3HG4A 1P43A 1UMLA 3PS7A 3UWWA 4DBDA 4BF7A 4YVPA 2BOFX 1LJYA 3CAQA 1XSIA 2QJHA 3QSRA 3HIJA 1O95A 1XIJA 2CLEA 1IZCA 1B3XA 3V1HA 4D71A 3MBDA 1TE1A 1PDZA 4XAGA 3MT1A 5FACA 4LX4A 1AMYA 3WD1A 3U5UA 4RV3A 3GNNA 3PUOA 3HTWA 2JIWA 4AWTA 4HA3A 3CAWA 5BXSA 1TX0A 2QYGA 2HRWA 2ZX8A 3BE7A 1IE7C 4AX7A 2FFCA 2Z1KA 3U4AA 2DPEA 1A5CA 2PC8A 5CPSA 3PJTA 1EO5A 2WBGA 3W83A 5TQLA 3UQNA 3C2OA 1XP3A 3G18A 3FV9A 4W8AA 4DBUA 4P7RA 3KLKA 3PBWA 5EYWA 3NPXA 1XM3A 2BVDA 3N15A 1GOXA 2VELA 1E4IA 2FQIA 1OD0A 4E4PA 1A5SA 3SEPA 4MWAD 1G4PA 3JVAA 4XUYA 3WQOA 5DMLA 3FY1A 1ZZMA 3E5BA 4CU6A 4QSFA 3EA1A 2WZMA 5CC6A 1OT1A 3VMNA 1A5KC 3PG9A 4HPJA 2QIIA 1O68A 2FB2A 4WZHA 1HJUA 3CB3A 4EIVA 2NT1A 3WQWA 3ATZA 3CL8A 4D2JA 3BCFA 1XYCA 2KX9A 4KWVA 2PGFA 3WK0A 2HE5A 2IKJA 2VZTA 3BW2A 4HCLA 4J3UA 4FXFA 2VQTA 1KRBC 2VGFA 2VWTA 4PGLA 2G3JA 4GUHA 2FVMA 3ALGA 1KNWA 1Q13A 2GFTA 2QS8A 3RM9A 3S3GA 5C2GA 4C1NA 3AXXA 2XFFA 1PTDA 2PTZA 3AXMA 4Y7EA 3KBSA 4IFKA 3GWQA 1QO5A 5DRCA 4UTMA 5HWMA 4I8DA 1R2TA 2PDIA 3VDGA 3HPSA 1UWUA 1FWGC 5FEXA 5T9BG 4TTUA 2C71A 5A8OA 1CXEA 3M1ZA 3M0IA 2C0AA 1CWYA 2VX5A 1MYRA 1OJXA 5FJJA 4KRUA 1WYIA 1LL4A 1VRDA 3E2RA 1WDRA 3AS3A 3TOYA 1JEZA 2CLIA 3WFLA 4J7RA 4J3VA 5CKSA 2D24A 1GZ1A 4GI6A 4LAUA 3VZYA 3JZUA 1CGTA 2HEJA 4PBEA 3UZJA 3S4TA 4HN4A 3QW3A 4IISA 5CEWA 2DZXA 4ADSA 3W70A 5ABGA 1TELA 3MDUA 2ZRUA 4H8NA 1S1PA 1GEHA 2G0WA 4NQ1A 3ITCA 4MY8A 4CCZA 9RUBA 4HQVA 3MC5A 4PUJA 5ABHA 3AUJA 4O15A 2XJ7A 2XPKA 4C1KA 1V3JA 1WOBA 3BGGA 4DWSC 1BGGA 4AVFA 1CNVA 1OCBA 2YYTA 3R0KA 2QDEA 3B97A 3DI0A 3LRKA 3FAXA 4MZ8A 3C0SA 4JTLA 2QQ6A 5A5WA 4ZQCA 2QUMA 2W66A 3OPSA 4S3EA 5KZ6A 2CBUA 1K8XA 3GIPA 2P53A 3AIWA 1YBQA 3L23A 2FKPA 3LSCA 1RBOB 3QYSA 1V6UA 2HISA 2FJUB 3R4IA 4DJDA 3GR8A 4IGSA 1JULA 1MVYA 4A29A 4IP4A 1UUMA 1W17A 4A3RA 1J4EA 2ZUTA 3N12A 2V69A 3LRMA 3MUZ1 1SMAA 3S1XA 3OGSA 4AHQA 1TTIA 1ZALA 3N2CA 2A7NA 1Q85A 3U4FA 4X2RA 3NSNA 3ARWA 1PJ9A 2PDFA 1X6LA 2VM8A 3MHFA 3WUFA 1F3WA 5GPRA 4GABA 3GC4A 2NWSA 1CZ1A 1DHPA 4LEQA 1UKOA 1CT5A 5FCZA 3U5YA 1VC4A 4WRHA 3EMZA 5DCDA 1M3UA 3OVRA 2NVDA 3TYCA 5CJ5A 3UNTA 3LD5A 2XIBA 3PZOA 4ZXLA 4C6OA 4LB3A 1NDYA 1QI2A 1KFJA 5ECUA 3WJSA 1XPYA 4EF9A 3CUXA 3G8RA 4FNPA 4L4OA 2IQ0A 2IQDA 2BWGA 4DZHA 3N2BA 2F2KA 2VX7A 3A64A 5F2IA 3CYVA 3L9CA 2FTYA 1GZJA 1GCYA 4EANA 2EQDA 1VCVA 2JIEA 5AZ0A 4S3JA 2AMXA 1O5QA 1AQHA 1ZFJA 4FB7A 3GH7A 3BLEA 3QOKA 1X6UA 2QHAA 2BASA 3ZS4A 2CBIA 2HCVA 3CIWA 3SR7A 4UR7A 1XQLA 2I7GA 1YW1A 4FLOA 3UG8A 3H4XA 1WOAA 1J0JA 1AD4A 3T0TA 4EE9A 3VZXA 1UQYA 1W3NA 4DWDA 1QNQA 2V5LA 1EXBA 3I4KA 2DZVA 3BANA 2FMNA 1H50A 3MVIA 3ZJ6A 1C92A 3KHJA 4RCXA 4JIPA 1K70A 1SZRA 3UZ5A 2X7VA 2RDXA 5EKYA 2EBNA 2D2JA 1GTHA 3B04A 3MI2A 4NXSA 1H0GA 4LVDA 3IANA 2BHYA 2OQLA 1OINA 4HB7A 4ZOCA 3PSVA 2X16A 3LN3A 3W7MA 2PTXA 1OFQA 3W7GA 4CNUA 3EA2A 2XUCA 3DGRA 4GC4A 5DRIA 5LNVA 2OLHA 1ZJIA 3E2VA 4LYQA 1JZ6A 3QR3A 3N3MA 4PCNA 3AIRA 1JCNA 3EWCA 4KERA 1E55A 4HHMA 3SZ8A 5CLWA 2H9AB 3RNDA 2DVXA 4JFWA 5HXMA 1EYEA 2H8ZA 4ZO9A 3UXDA 3BZJA 2VCBA 2PDPA 2W0UA 2A1YA 3O07A 5C5YA 3AUOA 4C6EA 3LXCA 3SM0A 8CGTA 4UWMA 3Q4DA 5HUOA 4O1DA 4Z2JA 1IZJA 3VDBA 4ALDA 4QM1A 4Q4QA 2KZHA 3AHYA 3NOYA 1B57A 2EG8A 3QC0A 1TVNA 4IQEA 3WCZA 3LU2A 3NZ1A 3W7OA 2I5QA 3N2XA 4AXNA 3QXBA 1TJ0A 4Y8FA 3QM3A 4JIRA 3CL7A 2C1GA 4KBXA 3M0VA 4OBTA 4ORMA 1UZHA 1N8WA 4RX0A 3FHAA 1TV2A 3VI2A 3CIVA 2BY0A 3KP1A 5HANA 4GUGA 2WAGA 3NOEA 4H01A 2HZGA 3OU8A 5HWJA 1UB3A 3PPCA 4NU7A 3UT0A 4RZBA 3ZR4A 3SW6A 3SCUA 2G96A 2I56A 1NVMA 4ATLA 5CG7A 4FZIA 1ISWA 3U2OA 4C1LA 1E1FA 1US2A 1R8LA 3CEPA 3E02A 4DAFA 2F6XA 2B31A 3VD7A 3CHDA 2WVVB 4B4FA 4IL0A 4V15A 3RMJA 3HQOA 1QAPA 3VIMA 3NWRA 2E25A 1RA5A 3EAUA 4OT7A 2DDXA 2C6QA 2WLYA 4I90A 4C5ZA 2AOSA 4J5NA 3N3TA 3Q2DA 5KZDA 1JCMP 4Z0JA 4JX5A 4QS5A 1MWOA 3LBOA 2GOUA 4UTTC 2P8CA 2ZCGA 3GAYA 3W1UA 1ZBWA 1ME7A 5EB8A 2CC0A 3WUGA 1OZQA 2PSNA 2BGQA 2RH9A 3GB6A 3IVTA 1JAEA 1NQ6A 3OGRA 4QDWA 4MIMA 3NDOA 1W6TA 2X2YA 1EJVC 4UNIA 2GSHA 1W2PA 5I24A 1G0CA 3CJPA 4FOUA 3SQMA 3LQGA 1HQTA 2W3ZA 1UC4A 4IGHA 4QHRA 4Z2GA 1JI2A 5EFDA 3TLQA 1EIBA 3N18A 2PDQA 1R3WA 4Z1YA 1CXLA 1LL7A 1OEPA 4H00A 4HOXA 1ZL1A 4H4IA 3QV7A 3LG3A 1BPLB 4B92A 1QK2A 1KKOA 4MNLA 3SFWA 3RLGA 4JFTA 2FYMA 3F2DA 1IR2A 1RPKA 3D5HA 3GXMA 3W7PA 4UXDA 5D2YA 1KTNA 4ZOAA 4WIWA 1XIGA 5M03A 5D8WA 2QCDA 4R5EA 3K8KA 1ONEA 3W7QA 4UTJA 4DJDC 2WVUA 4YTSA 1I8JA 4XB3A 1C8YA 4IMEA 1EPXA 1DIEA 5CG0A 2PODA 5HPCA 1RUSA 3EKGA 4GXMA 1ECEA 1QBAA 4GJJA 4JYEA 1K6AA 2Y5JA 1QBBA 3ICJA 4TQTA 3UJEA 1BTCA 2WANA 1UBPC 2J7HA 4GYPC 4O8AA 5LA2A 3W7DA 4PUEA 4DYJA 2Y4SA 3MHUA 5J04A 2A79A 3IACA 2VL4A 1OADA 2YYUA 2XN1A 5HATA 2OELA 1P7TB 1UCWA 2XVLA 1LQ2A 2DUAA 3CMJA 5D03A 4PTXA 4YU1A 1E5NA 3W88A 1E73M 2BHZA 4ORIA 4S1FA 4LAMA 3N6HA 1E3XA 4PMXA 1IQ8A 3QFEA 1LLWA 3M43A 4H2CA 3WQFA 1XCFA 4OBSA 4S3FA 3PWGA 3STEA 4WDXA 3WQDA 3AC0A 2TODA 4B2DA 2R82A 3SUWA 3DENA 2VX4A 4TU1A 3WLSA 3OIXA 5IM51 3PWIA 2AQOA 1GONA 1KM6A 3USBA 4TTGA 3RF9A 1EF2A 1BF6A 2GYIA 4I3GA 4BQ3A 3NR0A 2RFGA 1EP3A 4XBKA 3CAKA 3UETA 4AIEA 4ROQA 4HA1A 1U83A 5EMLA 4IIFA 2XFRA 3MMTA 2E6DA 3ITGA 3C2FA 3DIPA 1QDSA 3EOSA 4UOQA 4JX4A 1WZMA 1AODA 3GXDA 4B5UA 3FGCA 1M53A 3UWVA 2OG9A 1UD8A 3TZNA 4YCPA 4IX2A 1Q3NA 3R12A 4ZQPA 4LNYA 1JVNA 3GK0A 3UZXA 3I7RA 2ZC1A 3CPRA 1KWGA 4H6RA 4IFRA 1GVRA 4FK9A 4JTRA 3RK8A 3LHWA 3PZGA 1R3RA 3H21A 2QVHA 5PTDA 2P76A 3QTPA 2QLYA 2ZRXA 3TWBA 1GVQA 3TC3A 4U2YA 3M6DA 4JFVA 3GNPA 3UVIA 4BEQA 1GUVA 3NSXA 3IGXA 5HJYA 1XR2A 2A3LA 4GK8A 2G3NA 2GL5A 3CL6A 4JTDA 3WLRA 4RDWA 1E3ZA 1FWAC 4ML9A 3DFNA 4FALA 1W5MA 3Q37A 1WDDA 1S1RA 3NQBA 5C7VA 2D23A 3VOJA 3LUTA 5TD4A 4AY8A 2D2HA 1FH8A 3F2CA 4WKAA 2QV5A 4YTRA 3TK7A 3T44A 1J9YA 1GQIA 1S3TC