3BVJA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with xmp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
257
structure length
257
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Orotidine 5'-monophosphate Decarboxylase Complexed with XMP
rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
total genus 99
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3bvjA00
2KZHA 4LC8A 3NA8A 2NX3A 4BK9A 2YFOA 3BG9A 4ORIA 2CLFA 1W5OA 1H1ZA 4JY9A 2Y63A 3Q37A 1SW7A 3PM6A 1VS1A 4FNSA 4WUIA 4X9SA 5AFDA 1LCOA 3LHVA 2ISSA 4K37A 1H61A 4KWVA 5KZEA 4N2YA 5C5YA 1IF2A 3W83A 4LVGA 3E96A 5AYYA 3TK7A 5HWNA 3QZEA 1EWDA 3C3NA 3W7MA 4FB7A 2A4AA 1N7KA 4N6EA 3IRDA 5IBXA 5HJLA 1X1ZA 2C18A 2VFEA 2ZTKA 1JJKA 5EKYA 3VCRA 1H63A 1SZNA 1JCLA 4MYAA 3MBDA 4JYEA 4DPPA 1B9BA 3EWBX 3WFAA 3L5LA 3QSRA 3UWYA 1SU5A 1W0MA 3CEUA 4LRTA 3NVTA 1GOXA 1KM1A 3GDLA 1H62A 1F2JA 5KSWA 3HF3A 3MMTA 1DVJA 2V0TA 1PE1A 2G96A 4K7VA 4XKYA 3EX3A 4BI7A 1YPFA 3BW2A 2YZRA 1KFBA 1NFBA 2H6RA 3W1LA 3LBCA 1O4UA 2QCEA 3MP5A 2CLOA 3W7QA 5AHLA 4JTJA 4LRSA 1FDYA 4YLWA 3RK8A 4XTIA 3HGRA 3HGJA 3P74A 4CCDA 2BXVA 5ABTA 3LXCA 4LVFA 1TJPA 1YLVA 3R13A 4GUGA 1VCGA 2W6RA 3DENA 3G1AA 4TMBA 2VXNA 1Z44A 3W1QA 4BR1A 5GVJA 3NM3A 1ZAHA 3TFXA 2E6YA 1WOBA 2NUXA 4NJHA 3QH2A 3PWAA 3EWUA 3R2GA 2DU2A 3QPYA 3UZJA 3HO8A 5AC7A 1S5VA 2F84A 5U7SA 2YDAA 1WXJA 3MI2A 4UTMA 1H7NA 4HNUA 5D2YA 5FF3A 3ABQA 3GXTA 3UY8A 1TPC1 2ZZ4A 4AAJA 2C13A 2R8WA 3O6CA 2UV8G 1HL2A 2V81A 4U4MA 3GDKA 4O4WA 1TTIA 5AYXA 1YDNA 1GJPA 1LBFA 3UWWA 1GG1A 4GUJA 3HMJG 2QCDA 3P62A 3TMLA 3LB0A 3UPBA 2QCMA 4NZJA 4LOCA 3LHTA 2C0AA 2WV8A 4KFNA 4UTLA 3TKFA 1G4PA 1AG1O 1TTJA 1SUXA 1OK6A 1VHCA 4ZQOA 3EWXA 3TC7A 1K8ZA 3BG5A 4DELA 4DBEA 1XM3A 3S5YA 4PTNA 1LP6A 4EIVA 3UZ5A 3QMSA 4TR9A 2C15A 4HNNA 1R2SA 1W5QA 5FI8A 1TV8A 1K7EA 2H3DA 3W87A 3W7KA 1GVRA 1CX9A 4EF8A 2H3BA 2A2IA 1UUOA 3O15A 5AC6A 4IX2A 1KW1A 2WNNA 4RZ4A 1BKSA 2VFDA 4O0ZA 4POCA 4QISA 4HSOA 4FNPA 4HN4A 1HO4A 2ZZ3A 3SJ3A 3M16A 1FCQA 4GWEA 3FOKA 3NNTA 4YXGA 5CPLA 3M5XA 2DZUA 3A23A 5D33A 3L5MA 1XBVA 1AW1A 1B4EA 5CPMA 3E49A 2B7PA 4MVAA 3FJ6A 4Z1AA 1W54A 3W2UA 4O57A 1JUBA 4MPQA 1R2TA 1H7PA 2YGYA 4O1AA 3RFAA 8TIMA 1QNVA 4K6AA 3W7DA 1S3HA 1TB3A 2ZZ2A 2QEZA 4G1KA 2GJNA 3NL3A 4IMCA 4NJJA 3YPIA 3NQAA 4UTWA 3PF3A 1T0OA 2B7QA 1THFD 4AHPA 4ZQNA 5EYWA 3PR2A 2FQIA 4MY9A 1JULA 4O50A 3PSVA 3TXVA 2ZDRA 1SW0A 2DZVA 3A5VA 3HGOA 1J2WA 5AHIA 4JYFA 4PL2A 4LNYA 6ALDA 1EUNA 2AAMA 4DF1A 3QJAA 4NX0A 6TIMA 2V2CA 4JYDA 4CLMA 4JR5A 1F6PA 4LVAA 4A2RA 3WK3A 1P0NA 3LERA 4N9BA 2QCGA 2ZTJA 3S5NA 2FB2A 1H1YA 5TIMA 3NQVA 1G7VA 4QJ1A 3KVJA 3P5ZA 4JX5A 4NZFA 4JTLA 1RPXA 4UTIA 3M47A 4Q4KA 1ME7A 2ZRWA 5CGQA 2VOMA 1FWTA 2P1FA 3T55A 4QIUA 2PCQA 3F03K 3MP3A 1AW5A 4NUWA 2QUVA 1OFOA 3ATYA 3TSDA 5BNKA 3G1FA 1Q6RA 2Z0IA 1OF6A 1X7FA 4JIQA 2Y7GA 3AJXA 5CZ0A 2RFGA 2VFIA 1FWWA 2Q8ZA 1GPWA 2GVJA 3C52A 1LOLA 5DCEA 5BMXA 3M43A 2QDHA 2G5WA 2QJIA 2ATMA 5FF2A 1FY6A 2IQTA 3LCXA 3QM3A 4NX5A 5FF4A 3S5ZA 1YTDA 3QQ1A 3MWAA 4WZHA 4MZ1A 1PVNA 4QSHA 1DQWA 1TTQA 2RH9A 3BO9A 4ICNA 3NQGA 3NPXA 4JX4A 1JCXA 1B3OA 1KBJA 1MEWA 3IIXA 5DBUA 1LRQA 2A21A 4UFIA 1TCDA 3N3MA 3W1MA 4MFDA 2R91A 1KV5A 3G8EA 5U4NA 1JRBA 1YPIA 4X2RA 1H60A 3PBVA 2A6LA 2DJXA 1N8FA 2RDTA 1S5TA 2E1DA 4M6PA 4PA8A 4S2CA 3EXTA 3RU6A 3MUXA 2NUYA 5D2WA 1XDLA 4PCFA 3W1TA 1SO5A 5FEXA 1PHQA 4IWWA 3O05A 4JTGA 1KFCA 2JBMA 2RKXA 3HPXA 4GXMA 1WBHA 3M0ZA 4MIMA 1UCWA 5CZJA 3NQDA 5G2IA 1AMKA 2R94A 2E09A 3VI2A 5F4SA 1Q6QA 5I3JA 1MSSA 2EAWA 1R2RA 4AXKA 1OX5A 3ABSA 1JUEA 4UIOA 3F4WA 3DI1A 3K30A 1I2RA 5CPNA 3NL5A 4CCCA 1OX4B 2HSAA 1XXXA 4KWWA 2Z2UA 1H7XA 4LS1A 1RQBA 5D02A 1KLZA 3GKAA 3W85A 3P61A 5HUOA 3QMRA 3KRSA 3Q2DA 3LI0A 2JGQA 3SR7A 4MJMA 3BGJA 3O6YX 4JTIA 5I3GA 4C1LA 4K8EA 2ZZ6A 1BTMA 2RDWA 3PG8A 3NQ8A 4JEQA 1PL9A 4UMBA 4MLJA 1MEHA 3I7RA 3TSMA 3N73A 3W2KA 3OIXA 3SIZA 1A5AA 1FWRA 1TSIA 1GTEA 2Y7FA 4BI6A 5LNVA 3PSWA 4MZYA 3I7QA 3TW6A 3G24A 3L66A 5J5DA 2C14A 1TO3A 1D9EA 3WJZA 2G97A 2A1YA 1A50A 3LX9A 3NPWA 1AK5A 4CQ8A 1W5MA 5TQLA 3NZRA 2JKPA 2HTMA 3M5ZA 2V9DA 1XKYA 4IOTA 1XBZA 1DOSA 1LLZA 3LTPA 1DORA 1K8XA 1TPVA 2J24A 2ZRVA 2QUTA 4LUIA 3LI1A 4HNTA 4Z08A 4KFOA 3E02A 3NQ2A 3OHIA 3KVLA 3W7HA 4RLIA 4D2JA 5SWUA 3NO5A 3TAOA 4UR8A 1EPXA 2YYTA 3FS2A 4ML9A 4UTUA 3G3DA 3GR7A 4OU1A 1M6JA 3LTSA 3PB2A 3THQA 3NQEA 1O95A 3U6WA 3KXQA 4R34A 4L4LA 4K8HA 4MY1A 1UUMA 3CEPA 5DXYA 2DP3A 5DLCA 4RR4A 4YCOA 4FXSA 4HSNA 4I7WA 2ZRZA 3M9YA 4AEOA 1OFAA 3DI0A 3S42A 2Q3RA 3KRZA 3W6YA 3UXDA 3W75A 4QITA 4FIRA 3CIXA 4JN6A 4Z1BA 3DGRA 3R5EA 4M6QA 2GOUA 3N2XA 4WD0A 1G7UA 5H2ZA 3U8GA 3C2FA 3ABRA 2JGYA 3V1PA 1VC4A 4PEKA 5E93A 4N9CA 4IJBA 2RDUA 3DHDA 1FDJA 4WY0F 4QAIA 3KHJA 5K9XA 4RXGA 4JTKA 1K7FA 3T7VA 3S1WA 3STCA 1T99A 2QCLA 3NEVA 1WBJA 1QCWA 5DCDA 4FO4A 4UNLA 4J9JA 3GX9A 4E38A 4AWSA 1TPEA 2C19A 3OBKA 1UB3A 2ZRYA 5K7JA 3JR2A 3IIPA 4JICA 3ZFHA 3E0IA 5EL1A 1XBYA 3GDTA 2J27A 2B4GA 4CQAA 4QQ3A 4Z1DA 4ADSA 3L65A 1QDSA 1CW2A 5LSMA 1RVGA 1Q3NA 5C55A 1LORA 3NM1A 4UC5A 4IQLA 3CB8A 3W1PA 5CSSA 1EB3A 5HWJA 3BLFA 2CLLA 3PC0A 3H55A 2CLKA 3HG2A 2Y62A 3LDVA 3W88A 3PG9A 1XBXA 4AH7A 1WAUA 2ATSA 2PE4A 5K9CA 3HIJA 4LV9A 4UMAA 1OFPA 1ZNNA 3QW3A 5H91A 2Y7DA 4JD4A 3NZ1A 3W86A 1VLIA 1PIIA 1KTNA 3Q94A 3P84A 4M7SA 5EA9A 1XFBA 3VKJA 5HINA 4JTEA 4O14A 2ZA1A 4TO8A 1ADOA 3N9SA 3M7WA 1P5BA 4MKNA 5F2MA 3A24A 4I7UA 4A22A 1LYXA 2CZ5A 3O8AA 4OHQA 4MFEA 3W1AA 3TV8A 1VQTA 4WQ6A 3GDRA 4N4QA 2ZZ5A 3I68A 3HGSA 1GYLA 2WKJA 3L68A 4AF0B 3TNOA 5G4EA 1JQXA 1OHLA 1P1XA 4M5PA 3HBLA 4X22A 2X1UA 3N14A 4JDBA 4UCGA 3W23A 5L9FA 2VEIA 3HG3A 1MEIA 1G4TA 2P0OA 1MZHA 2CLMA 1UASA 3EX4A 1I2NA 2WNZA 4OBTA 1YXYA 3MHGA 3W84A 3LV5A 1L6SA 1DV7A 2ISWA 2QF7A 3EWZA 4TX9A 3N34A 3TSBA 2E5CA 4PH6A 4NJKA 4O17A 4OE7A 1GVQA 4RKAA 4Y6GA 4E0CA 4DO5A 1BEUA 3C61A 4ZQMA 5CZSA 1SO4A 1OFDA 3W1RA 4BWLC 3LCLA 3M5YA 1BWLA 2I14A 3BV4A 4UTTC 4UTHA 2FPYA 4O15A 5G2WA 2CZFA 4AHQA 1ZAJA 2BLEA 3A21A 3W1UA 4FEZA 2DORA 3H54A 4IPIA 3W7IA 2AGKA 2XFWA 1A5BA 1ZAIA 1ICSA 2DZSA 2D73A 4MLRA 4P61A 4ADTA 1RD5A 4ZQRA 2ZZ7A 1SFJA 4CNOA 3SFKA 2V30A 4JTFA 4WOQA 3L0NA 1LRNA 1GZGA 4MZ8A 2J9XA 1FDZA 5G4WA 2A7NA 1G69A 3C0JA 1RQHA 4LS0A 1SO6A 4I9AA 3NOEA 1LRTA 4B5NA 3NQFA 4LU0A 4W9TA 3CIWA 5I3IA 3HPZA 1KA9F 3QYQA 4NT0A 4O0KA 4XBKA 3UQNA 1YTEA 2OZ0A 4XTDA 1FQ0A 4HKPA 3B03A 4C1KA 1WDWA 4UNKA 3CC1A 3M41A 3OVQA 2QCDB 2H8ZA 3R8RA 3C4UA 4U28A 4LTSA 3GYEA 3M44A 3KAOA 2WQPA 3ZWSA 4UTJA 3TJXA 3FKRA 3NQCA 3P80A 1VHNA 1B4KA 4N02A 5AC8A 2YW4A 5E1QA 4XBSA 1W8SA 3FIGA 4ZQCA 4ORMA 1FCUA 2DJLA 4RCXA 2Z1BA 1GTHA 2X1RA 2YSWA 4IUOA 3PBYA 1W5NA 3STGA 4JIPA 2GUUA 3HOJA 1L6YA 2GQ9A 2W0UA 1ALDA 5LKYA 5F2GA 2ZQ0A 2XN1A 4KKXA 3GAKA 2DZWA 3BLIA 3ELFA 2X16A 1KTBA 4QM1A 1AL8A 1K3UA 2FPTA 2CZEA 3SY5A 3LHWA 1JCJA 1TJRA 4O1BA 2BZNA 4GUIA 1PCKA 4WX2A 2Q3OA 3IIZA 3TIMA 4DF2A 4BWLA 5F1VA 4IMFA 3CQ0A 2FFCA 1DQXA 3C56A 4JNMA 4O16A 2ABAA 5LGZA 2WSQA 1WOAA 2TYSA 2J9ZA 3S6DA 3GR8A 2VENA 3QSTA 1KM0A 5LNRA 2H90A 3EX2A 2ZYFA 5FEZA 3LLDA 1C29A 5I3FA 1LDCA 2WSRA 4A2SA 1K02A 1X6UA 1H50A 3C2VA 3QQ0A 4O19A 1N55A 3UY7A 3OVPA 3FYOA 5LNUA 2G95A 2GQAA 4JGDA 2O7QA 3GIYA 3W1XA 2ZRXA 4IMDA 5KINA 1LBMA 1QO2A 3I6RA 3O1NA 4Y96A 5A5WA 2DZPA 3WJWA 1JRCA 1YADA 3W2JA 3B05A 1GVOA 3B0PA 4WJEA 3H53A 3B8DA 3TUUA 2HS6A 3ANYA 2A6NA 5CPOA 2F7FA 3EKZA 3C2RA 1PHWA 1QFEA 3LHYA 2FIQA 3DAQA 1FXPA 3TMQA 4XQ6A 2NXIA 1I8JA 2QCHA 4PC8A 2ZA2A 3G1DA 2VEPA 3GLCA 4FNQA 3MHFA 1HO1A 3B04A 4H4IA 3MYOA 1IXQA 4LT9A 2I1OA 2PURA 5K3VA 1VGAA 2VFHA 2VELA 3W7NA 3S0CA 4NXSA 3MI6A 3JS3A 1TV7A 2YX0A 3BW4A 1W5PA 4JTSA 3KVMA 4OV9A 1OF8A 4O1DA 1YDOA 3D0CA 1P0KA 5F4WA 2NWRA 3B4UA 3DFOA 3SGZA 2EGZA 1OYAA 2YYUA 1D3HA 1JCYA 5T26A 3CWNA 2H8XA 4JTTA 3TAKA 2TPSA 2YCEA 3TC6A 2QCFA 3MJYA 3PUOA 3IVTA 3WJXA 4LWWA 2CLIA 1ME8A 1EP1A 1VPXA 3HQ1A 3HPSA 2NV2A 1LBLA 2YFNA 4GUFA 2NLIA 4TU1A 3UWZA 3FLUA 4Z0JA 1C9DA 3P81A 5G5IA 3GAYA 3SSJA 2TMDA 1OFQA 3W7EA 1G4EA 4PFMA 3W76A 3GK0A 3G1YA 1QPOA 4OV4A 2OT0A 3CM4A 3LRLA 3P82A 1R46A 3TQ0A 3ZR4A 3L0KA 5LGXA 2J9YA 3LCFA 1L6WA 5F2LA 4FNTA 2W79A 4QNWA 3EEGA 3LLFA 3AO0A 1M5WA 3NQMA 2HMCA 2ISVA 4RZ6A 2PC4A 3G18A 4HIBA 4JY8A 1VRDA 1VLWA 2QDGA 5D38A 4AWTA 4XWUA 3NG3A 3STEA 2V2DA 1E51A 3W7GA 1SO3A 1H7OA 1XDMA 4NJIA 3S8HA 1TQXA 4FXRA 2DZXA 3BK0A 4UTKA 4BFAA 3W7JA 4GNJA 4UUIA 2Q8LA 1XI3A 3L0GA 2CWNA 3NL6A 3FEMA 5D05A 1NSJA 3QC3A 1SZGA 4X3ZA 2OMAA 4Q32A 1TREA 1U83A 1XC4A 4MJZA 3KFTA 5DELA 1WYIA 3G1VA 5LZLA 5BOOA 4OQVA 3WJSA 4OT7A 2E77A 2C16A 1EA0A 4NNCA 1JCMP 1OFBA 4HT3A 3JRKA 3S5OA 4M19A 3NYZA 3IGUA 1XL9A 2TSYA 3C6CA 4ADUA 4DO4A 3C8FA 4O28A 3TX9A 1IIHA 3MW7A 2WSYA 1SSGA 1ZALA 3M6YA 4EOUA 3A9IA 2C1HA 1W37A 2O7SA 1H51A 4LW7A 2EPHA 4NJGA 3USBA 4K39A 4Z1CA 2NV1A 3BW3A 1Z48A 3F1QA 5AOUA 1SSDA 1F05A 1TPFA 1KV8A 1QMLA 4UFHA 3NPVA 1SFLA 4DXVA 2J88A 1R30A 1J5TA 3QRHA 4S1FA 2ZRUA 1VJIA 3GXNA 1T96A 3F4NA 1VR6A 3TW7A 4CNPA 4LVDA 3ABOA 1ZY9A 3LCGA 4EWND 2Y88A 3MI3A 3TROA 1JR1A 5IM51 4AF0A 4O10A 3W9ZA 1TPDA 3L5AA 3P7YA 3G22A 2PRLA 3FJLA 4MY8A 3VE7A 4NXKA 4NNBA 3NDOA 4E2BA 1TPB1 3W74A 3RLVA 3DKJA 3INPA 3S9YA 1QPNA 3NXFA 1NVMA 1TV5A 3G3MA 3A22A 2YPIA 3RNDA 5J5RA 2A7PA 3QF0A 4UFKA 2FB3A 3G1HA 2DZTA 1ICPA 4YL2A 5FF7A 2Z6IA 3NQ7A 1W3IA 1S5WA 3W22A 1V7YA 2PRMA 2FDSA 5AHNA 5C6MA 3EXSA 1D3GA 3LGEA 3M5VA 2BX7A 1IXOA 3S1UA 1TPWA 4BI5A 5C54A 1SZEA 1OK4A 5AHMA 5E0KA 1KLYA 2RHGA 1J4EA 3PBUA 2QR6A 2ZBTA 4DF0A 4DPQA 2WNQA 5C2XA 3FYPA 2V8ZA 3P67A 5KITA 3BG3A 4IGHA 3KOFA 5FF0A 3N9RA 4NNAA 5AHFA 1ICQA 4MOZA 4WXYA 1F6KA 2VEKA 2ZFAA 3KX6A 1EEPA 1UJPA 4N9EA 3R12A 3DFTA 4UFMA 5A8GA 2NX9A 4JTUA 3IIVA 3HJZA 3PB0A 4YMZA 2NWSA 3TU9A 3MHUA 4XUGA 2PRHA 3PBWA 4LV4A 4A3UA 2NXHA 1VYRA 3KRUA 3WK1A 4TIMA 4O54A 2NXGA 4RK8A 4DO6A 3VFLA 1FBAA 4YWIA 4BF9A 1KM3A 1TPUA 2CLHA 2QAPA 3EWWA 1HTIA 3WK0A 4E2DA 4A29A 4UXDA 1OX6A 1AL7A 2X2GA 5HR7A 3W2MA 2OX1A 3W1NA 4Z0SA 4NVTA 5HQEA 5IBXC 3DBPA 5HR6A 1TMHA 4YCPA 4H3DA 4FIQA 5F1UA 2VKZG 3TQVA 3O16A 3WJYA 4N4PA 4UR7A 3EB2A 4R7JA 2E5BA 4EVZA 3T44A 5DY2A 2JKAA 4JXCA 1I4NA 1EIXA 1VCVA 3HG5A 5AYZA 1QPRA 4HNVA 3NR0A 5L6UA 1SQ7A 3LHUA 1FXQA 1YTKA 3A5FA 5D30A 1GG0A 1Q6OA 3GVGA 3QEZA 2FPVA 1A5CA 3IVSA 1F5ZA 1OYBA 2QKFA 2VC6A 3N2MA 4PL1A 4GBUA 1X8FA 3EKLA 4UMCA 2CFFA 1SZFA 4LUJA 5CZTA 1KM5A 5D09A 1GVFA 3I65A 4AVFA 3UD6A 3DH7A 2E6DA 3E12A 1HG3A 3THAA 3C2EA 1MXSA 3V75A 3B0VC 1LOSA 1KTCA 4RX0A 1F7BA 1YYAA 3EX6A 1PV8A 4PODA 1OVDA 3OEXA 3SZ8A 4GUHA 1WA3A 3W7PA 3RF9A 2QUUA 3CU2A 4MUZA 1F76A 1M7OA 3RMJA 4JX6A 1TYGA 4FX8A 4GE8A 1SW3A 2E6FA 5EPDA 3W2LA 3NPUA 5LHFA 3PAJA 5DBTA 1F73A 1WQ5A 1IXPA 1W56A 3W7CA 2BTMA 2A5HA 4K7YA 1KFEA 2VEMA 2XN2A 4EF9A 4L4MA 3W70A 3TJLA 2EF9A 3W3OA 1H5YA 1JQVA 1XUZA 1H7WA 5AN7A 3SI9A 2V82A 2WO5A 1Y0EA 4S2BA 4R53A 1FUYA 1G67A 4AWUA 1VYSX 1QOPA 2V5LA 1QOQA 2OJPA 2BWGA 2V2HA 1WX0A 3T40A 2QJGA 1VCFA 3BGGA 4WXZA 3CTLA 4DEFA 3TDFA 4UTTA 4LVBA 5I3HA 3L9CA 1TQJA 1R47A 2V5BA 4O4VA 1TPH1 1OX4A 2ZZ1A 1O5KA 3LRMA 5KZDA 5KZMA 5AHEA 1I45A 1P4CA 5HUPA 5EBUA 3BVJA 1OABA 2FJKA 2VFFA 4GFSA 5G2HA 4CCEA 3W72A 5CSRA 2OCZA 1G4SA 3LCWA 1UBSA 3B0UX 2NZLA 3W2NA 1XCFA 5LNWA 1EP2A 1GYNA 2ZCGA 4HPXA 3QFEA 1WV2A 3G1SA 4O53A 1ML1A 1I2PA 3DFSA 1QAPA 3B06A 1XUUA 2Y61A 5KMYA 2GPTA 1YDVA 2NX1A 4IPJA 2XN0A 1RR2A 2TRSA 1LTDA 3G8RA 4GRSA 3PULA 2GJLA 5CKSA 3S1XA 5D2TA 5D2XA 2I9EA 1IIGA 3VNDA 4Y8FA 3LXBA 1LROA 1SR9A 3DU0A 5AB3A 4ALDA 5HWMA 1DJQA 1B57A 3TH6A 1ME9A 2ZA3A 1W31A 3S1VA 3TFCA 1YXCA 5K9DA 5EY5A 1Q6LA 1LLWA 1EP3A 3FKKA 4O13A 2CW6A 1Z41A 3L21A 1GT8A 2B7NA 4ONVA 1PS9A 5HULA 1LM1A 4OGZA 4K38A 2E68A 1TRIA 1OFEA 5D32A 4AB4A 1W3TA 3MP4A 3IGSA 1FCBA 5BRBA 3O6DA 1Z42A 1FX6A 1M7PA 1MO0A 2FTPA 3ZS4A 2CZDA 3R89A 3IVUA 2X30A 2JK2A 1VH7A 2ABBA 3PS7A 2C6QA 2VFGA 4A21A 3W71A 7TIMA 1ZJIA 4RXFA 5K4XA 3BLEA 4FHAA 3UNDA 3CLMA 3PUEA 3G0SA 4N9DA 4H6KA 3IV3A 2YXGA 1W3NA 3C2OA 2A7RA 5LNSA 3PUDA 2E6AA 2R14A 1U5JA 4JS3A 3QW4B 4FF7A 4DQWA 4M7TA 3TR2A 1GWJA 3TCEA 1GVSA 4P2VA 2Y85A 2E5DA 1KM2A 3P60A 3NAVA 4FX6M 5G1YA 2A0NA 1NAL1 3ATZA 2P10A 2QAFA 1G6CA 1RQEA 1ZCOA 2YW3A 4ZMGA 2Y6ZA 4RJEA 3DFPA 3W73A 3DZ1A 5FEPA 4ZL1A 3W7OA 3G0UA 1QR7A 1L9WA 4WY0B 1BWKA 2CU0A 3LXAA 1O94A 5F4XA 1ZFJA 3NGJA 4O18A 2J6XA 1DL3A 4AHOA 4NU7A 4RZ5A 3QMTA 3CPRA 1FWSA 3GXPA 3HB9A 3DXIA 3OA3A 1QO5A 1OFRA 3P8JA 3QPZA 5DY3A 4Y9AA 4OWGA 5DXXA 3PY2A 1X1OA 3DFQA 4ZVJA 3T78A 3OG3A 5HNRA 5DN1A 1PCWA 1OYCA 3I7SA 4JDYA 3RLUA 2WJZA 4LY8A 2QJHA 3DFNA 1NEYA 4FX7A 1YXDA 3FA5A 3GNNA 3G0XA 3GNDA 3PVFA 1QPQA 4CNNA 3TQKA 3CWOX 4XZ9A 1EWEA 1C8VA 1GQNA 1KFJA 1F74A 2YR1A 3KVKA 4GC4A 2CLEA 4RV8A 1DBTA 4JTHA 3W7RA 4WOZA 1HUVA 3GKFA 1LOQA 3OVRA 1ZHAA 3FFSA 3UXAA 2ALDA 2B7OA 2QCCA 3P5YA 2Y89A 4O11A 5D37A 3TA6A 5TBOA 1TTPA 1OG0A 5D2VA 1TRDA 4CQ9A 5G1TA 3UYCA 1L2UA 4KFPA 3LCHA 1O5XA 5BMWA 1HFBA 2A85A 3O06A 5EMUA 4O8RA 3GZ3A 4FNRA 2Y7EA 3SGUA 4NQ1A 3EWYA 1O60A 1I2QA 1ONRA 2LLEA 4N6FA 4Q33A 3U2OA 1JCNA 2C3ZA 2NUWA 4O52A 5DCBA 1I2OA 3LM7A 2BSLA 5FESA 3DHFA 3HG4A 1NF0A 3T4CA 5CG7A 1DJNA 4Y90A 3W7LA 3CT7A 4O1CA 1A53A 3MO7A 1RZMA 5K4ZA 1DKWA 2WOQA 2EHHA 1IXNA 1SPQA 1JVNA 1EUAA 2GVLA 4UFJA 3L2IA 3SECA 3W07A 4IMEA 1A5SA 3BPWA 1JUKA 2GVGA 2AQWA 4FNUA 3G1XA 5HMSA 3EXRA 1TIMA 1IGSA 2OT1A 3SW6A 3LCIA 1LZOA 1K03A 4MYXA 2FLIA 3UWQA 3Q58A 3EX1A 4WY0A 3NQ6A 5MHBA 5KTLA 5FEWA 2Y70A 3L67A 1KM4A 2B0MA 4UTWC 3NL2A 3STFA 2WPBA 4TMCA 3LBMA 4K36A 5I3KA 3LV6A 1QWGA 4DBDA 4R33A 3MYPA 1VZWA 5LHEA 3MBFA 1FWNA 2QCNA 4HPJA 2JKEA 2X1TA 3GB6A 1RV8A 2HS8A 5F2IA 4I7VA 3TXZA 1K8YA 3LTYA 4IX0A 3O07A 1T8XA 3O63A 3BARA 4UFLA 3N19B 1FCVA 5K2ZA 2EKCA 3UPWA 3UWUA 1W1ZA 4IXHA 2X1SA 3LOTA 4GJ1A 1DHPA 4AMAA 1K7XA 3M1ZA 3E9AA 3ZWTA 2Z6JA 1AW2A 4XKYB 3IEBA 4O12A 1ZENA 1V5XA 1Q45A 3IIOA 2GQ8A 4IMGA 1KFKA 1KBIA 4ZQPA 1CI1A 5D03A 4HHPA 1GEQA 4M6VA 1NF7A 1EX5A 5D04C 3WK2A 5BW6A 4LS2A 4LC6A 1KFLA 3LRKA 4IXXA 3TE9A 3IGXA 4ZZ9A 3LHZA 3UWVA 3CHVA 1H7RA 1VYPX 3DKLA 4QNEA 1KM6A 3GDMA 3VE9A 3P8IA 1OJXA
chains in the Genus database with same CATH superfamily
2KZHA 4LC8A 3NA8A 2GSJA 3SCTA 2PDYA 3BG9A 3B8UA 1TV4A 4M1BA 4PSRA 2G3IA 4GO9A 3BAWA 4X9SA 3LZ5A 1XC6A 4JNZA 1KCLA 2ISSA 3NDYA 4N2YA 1IF2A 3LNPA 2OLSA 3E96A 4LBUA 1EWDA 2WB5A 4KCWA 4FB7A 2YLLA 3OZMA 2C18A 2W66A 3RXZA 2ZTKA 1JJKA 1MNZA 4B5XA 3MBDA 1WUEA 4DPPA 5BXRA 4J27A 3RCYA 1IEXA 3H70A 4GLEA 1SU5A 3RITA 4CGTA 1QRQA 3LG3A 1GOXA 1UC4A 3GDLA 3O0KA 3MCMA 2VC9A 1Y7VA 1TVNA 5A94A 3UERA 3WNPA 4NP7A 1DVJA 1JI2A 4KBXA 1UZHA 3EX3A 4ZA0A 1Q7MA 2YZRA 4PMYA 3QLDA 1NFBA 1FFQA 3PZIA 4JTJA 6TAAA 3V36A 4P8XA 4KW2A 1BD0A 4CCDA 2OPJA 2XHYA 2V6AA 5I3DA 3LXCA 4ZXLA 5DANA 1YLVA 3TLQA 3WLJA 4TMBA 5FOOA 3WYZA 3GYCA 3KOWA 1VFOA 5GVJA 2OO6A 3IJIA 4ZGYA 1JZ3A 1WOBA 1G0CA 4NJHA 3EWUA 1H11A 3R2GA 1HJUA 4C1NA 5AC7A 4AZCB 3VNLA 1Q6FA 2YDAA 4PTDA 1VBJA 3MI2A 3RRAA 1MFUA 2IPGA 3WUBA 2VP8A 5ABHA 4JN7A 3VFCA 3KBSA 1XCWA 1L2QA 1VIWA 2HZGA 4JFVA 1KR1A 3CS2A 4GYFA 5C9ZA 5CAKA 2QXWA 1ONEA 4J2PA 3NOYA 4PCTA 1FWEC 1B1YA 4CVUA 4DJDA 2V68A 3LMYA 4NZJA 1F9CA 4LOCA 4J35A 4MWAB 3TKFA 5T91A 5CBJA 3GNOA 3TC7A 4DELA 4MKSA 4WKAA 2AL2B 5DMLA 4OVXA 3OYZA 3QMSA 4TR9A 3WQ4A 4HYRA 1V02A 1W5QA 5FI8A 1TV8A 4J28A 1K7EA 2H3DA 3W7KA 1W9BM 2W67A 1CX9A 4EF8A 3KP0A 2VX5A 2H3BA 3VCCA 1UUOA 1XLBA 5AC6A 1KW1A 1DWGM 1NQ6A 4POCA 3GNPA 4QISA 3SQSA 2GK1B 4HN4A 4HTYA 3FOKA 3NNTA 3OQ8A 4YXGA 2W4XA 3L5MA 1XBVA 2BMBA 3S5SA 2J62A 3E49A 1HX0A 1OBAA 3WLTA 1RD6A 1W54A 4O57A 1JUBA 3LGDA 4YHGA 1R2TA 3AZTA 3WFZA 1P0DA 3L2LA 4G1KA 4NJJA 2J74A 1T0OA 3BANA 4ZQNA 5CCZA 1RJQA 3PR2A 4MY9A 3VVGA 1JULA 4Q8PA 4O50A 1SW0A 3IJ8A 3U2ZA 2YCLB 3CXOA 4LNYA 3G6LA 2QUNA 1EO5A 4JFTA 4DF1A 3BWWA 5LA2A 4LVAA 1C9WA 1T7LA 2XM1A 3LERA 4N9BA 2QCGA 1JZ2A 1V6UA 3NIYA 1S5MA 3M47A 3BAYA 3LS9A 4NIRA 5XIAA 2D0GA 3MP3A 1Q8JA 3KLLA 2V38A 3ATYA 3TSDA 2W9MA 1EQCA 1HNYA 4GH1A 1OF6A 4BY3A 1OQFA 2V5JA 2YL8A 1BRLB 2Q8ZA 2GVJA 3C52A 3WD4A 5DCEA 4H6RA 4NILA 2OYMA 3V0UA 4Q8VA 4BS0A 5FF2A 3FJNA 2Z27A 3N18A 4WZHA 4WJ8A 5HNTA 4WR3A 5E6YA 2PDIA 4WCJA 4ICNA 3CB3A 3NPXA 3V5OA 4IICA 1JCXA 1KBJA 3IIXA 4C65A 1ONXA 4J3ZA 1JPHA 5FJPA 3W1MA 4MFDA 1HW6A 3DDMA 3G8EA 3I10A 3M0JA 2W62A 5EMLA 4X2RA 1H60A 3H26A 3BJTA 3PBVA 2FH6A 3WF3A 3CO4A 4S2CA 3WNMA 1AODA 1XDLA 3Q67A 3DC8A 2JBMA 3K13A 3UBPC 3K8MA 4Y8EA 4ZO7A 3SM0A 4B9YA 1M41A 1B90A 4E4UA 4OOUA 1WBHA 3M0ZA 4MIMA 1UCWA 2XFFA 3NQDA 1OSEA 5F4SA 5I3JA 4QS6A 3EA3A 1WZAA 4KIEA 3WLRA 2ZXQA 3F4WA 3PJWA 3K30A 1I2RA 4H8NA 1YBQB 4CCCA 4AEFA 1QOXA 1H7XA 5M5DA 4IIDA 2HXTA 3PBGA 4C6MA 3MUAA 1KLZA 3GKAA 3P61A 3FX4A 2CLPA 3LI0A 1E40A 3OJGA 2ZZ6A 1FWBC 3FYYA 1VAHA 2D20A 4UMBA 3NZGA 2GOKA 1A47A 3XIMA 5A2CA 3I7RA 3N73A 1B30A 1FWRA 1MW3A 4NAFB 2XFYA 2W3ZA 4EAYA 3GXFA 4DZ5A 2C14A 4V27A 4EPEC 3WJZA 2A1YA 1UD3A 1TX2A 4R3UA 1KWKA 2C79A 5TQLA 5I02A 3W37A 1Y5VA 3WDQA 2V9DA 2QIWA 1C93A 3QPEA 5FJTA 4RPPA 3LTPA 1K8XA 1TPVA 4RE4A 2J24A 3A47A 2ZRVA 3LI1A 1HL8A 4HNTA 4Z08A 1RVKA 4KFOA 4U31A 3E02A 4GKTA 3H4GA 3NQ2A 1JGIA 1ZS2A 3W7HA 4RLIA 5SWUA 1QI2A 1OIMA 4S3EA 3FS2A 4KMQA 4U2YA 4LCSA 4ATLA 1M6JA 1UBPC 1JZ6A 3LTSA 3THQA 3WBWA 2WWCA 3UG4A 1C8XA 2JEQA 3F4DA 1KC7A 1A49A 4K8HA 3QYSA 2DP3A 3H4XA 3P0WA 5DLCA 4G7FA 4YCOA 5BRPA 4HSNA 3LMZA 3I3DA 4AEOA 1OFAA 2Z1WA 4I90A 1VFHA 4ACYA 2RUSA 1WDDA 3E0FA 1VBUA 1T40A 4JN6A 3CIXA 5I03A 2WLYA 3AWNA 6PTDA 4JQ1A 3R5EA 3ZVIA 3KWXA 4DY1A 1L6FA 3ONBA 2QDEA 1FHDA 4ZR8A 2HPIA 4PCPA 1LLOA 3U8GA 4AY1A 3ABRA 2JGYA 5E93A 3DHDA 4WY0F 3KHJA 5K9XA 2XYLA 4QHRA 1DJXA 4JTKA 3T7VA 3S1WA 4M51A 3NEVA 1QCWA 2OYLA 4FLOA 4E38A 3VD7A 2PU0A 1QT1A 3KDNA 3U9IA 2AQVA 2OWWA 3CZEA 1R86A 5K7JA 3IIPA 1CXFA 2YBUA 3E0IA 3AFBA 3FHAA 3TJ4A 2J27A 4CQAA 4Z1DA 1AJZA 5LSMA 3KBVA 1Q3NA 1LORA 4XD3A 3W1PA 5CSSA 3BLFA 2CLLA 5EFDA 3H21A 3W0KA 3W88A 4UB9A 4GI4A 3WX7A 3W29A 4R5EA 2PE4A 5A8NA 2YDSA 3HIJA 4LV9A 2D24A 1RY8A 3QW3A 4AX7A 5H91A 3FXGA 4YU1A 3W86A 1BRLA 1IT8A 4GX8A 4M7SA 3P84A 1B31A 1XFBA 4DYJA 4XD6A 2A3EA 3S6OA 1IWAA 4YTSA 5F2MA 3A24A 1BLIA 3POHA 1AUSL 3O8AA 4MFEA 3UA4A 3W1AA 1A0DA 3DBNA 1UWRA 4WQ6A 3SJNA 1CTNA 1G01A 2ZZ5A 3HGSA 4L6OA 4AF0B 3TNOA 1JQXA 4M5PA 3HBLA 4X22A 2BP1A 4JDBA 4B2DA 3ZLFA 4GINA 3ES7A 1MZHA 2PC8A 3TCSA 3MHGA 3UR5A 2ISWA 3SIMA 1XSKA 3TSBA 2PWDA 2CITA 4O17A 4OE7A 3N15A 3VIGA 4RKAA 3D47A 1VFTA 3OBAA 3OLGA 2PFHA 1OFDA 3W1RA 4XSLA 5CAHA 1PTDA 4QX4A 2DUAA 1U22A 4DZHA 1I9CB 1P43A 4UTHA 2FPYA 4O15A 5GNXA 1ZAJA 2MUCA 1WO2A 3H7VA 4HA4A 4FEZA 3W7IA 1W1YA 4TX8A 4XB3A 1A5BA 4CD5A 3N9KA 1RD5A 5TD4A 4DLMA 1GKRA 1ISYA 4ZQRA 2ZZ7A 1SFJA 5GNYA 3AZSA 1TZZA 2P76A 1U33A 4H7ZA 3UT0A 3MMUA 4IFKA 1SO6A 1LRTA 3NQFA 4LU0A 1UQYA 4KERA 1XPGA 4AMCA 1MI3A 3UQNA 3VDAA 1FQ0A 4HKPA 2AL2A 2UY5A 4C1KA 4DNMA 3CC1A 2ONEA 2NVAA 3QVQA 1Q5MA 3BC9A 2QCDB 3CUJA 3WQGA 3N6JA 4U28A 1EKOA 4LTSA 1SMAA 3KAOA 1X98A 2WQPA 1NWRA 1JIBA 3R11A 3TJXA 3FKRA 1X8CA 1E55A 3DG3A 2NQJA 1KCZA 4L1XA 1GVIA 5AC8A 2YW4A 5E1QA 4XBSA 5JBFA 1EJTC 4ZQCA 5DX7A 1OCQA 4RCXA 3AUOA 1YE4A 2X1RA 1KNWA 4HCDA 1W3JA 2DSVA 4JBRA 2CCRA 1SZRA 4F48A 5A1AA 3OGVA 4PMXA 2MNRA 1KTBA 2CNCA 2CZEA 2DSZA 4AD3A 1LUCB 3OW1A 3H2NA 1PCKA 4WX2A 2Q3OA 3W6MA 2QV4A 4IMFA 3CQ0A 2FFCA 3C56A 4JNMA 4PEEA 1OC6A 4I9MA 3N12A 3VM7A 2WSQA 1EJ7L 3LLXA 2OZTA 3WQPA 1XYLA 2J9ZA 2VCCA 4LGXA 1GHSA 3H7UA 3VOCA 4GQ0A 3LD5A 1KM0A 4HYVA 2H90A 1A4MA 2Y4SA 4YVPA 1YDYA 3LLDA 3MDWA 5I3FA 4ENLA 3M0IA 2QHAA 2BY1A 1LDCA 3N1AA 3VINA 1K02A 3K4WA 3WBAA 3C2VA 4Y9PA 4HZ7A 5LNUA 4GZ7A 2OLAA 1DIDA 3GIYA 1NOUA 1FH8A 4ERAA 5KINA 1BXCA 1TWSA 4Y96A 2DZPA 1YADA 4I8DA 3G1RA 3B0PA 3H53A 2HS6A 4JNYA 2A6NA 5CPOA 2F7FA 1W3KA 2Q6ZA 3C2RA 4B2DD 3RN6A 4NZ1A 1QFEA 3LHYA 2FIQA 3DAQA 4LSBA 1FXPA 1ZRQA 4ZSTA 3TMQA 1A5UA 4IQJA 1I8JA 2QCHA 4MB3A 1MDLA 3A3HA 1UKOA 1CENA 2VEPA 3H2AA 3E74A 3CWHA 3MHFA 5LYRA 4NG3A 2O9OA 3B04A 2BVDA 4ZODA 3QHNA 1VGAA 5H6HA 4KCUA 4F2UA 3JS3A 3AXIA 2EPMX 4E3VA 1W5PA 4JTSA 3WENA 4O1DA 4ZB0A 4NRRA 4G9PA 4AD1A 5F4WA 1RK6A 2NWRA 3B4UA 5CGMA 2VTFA 3GNRA 3ONCA 2DIKA 3BAKA 1OYAA 2YYUA 3L4UA 1J79A 5JQ9A 3B3DA 2H8XA 4OZOA 1J2BA 4G2DA 1E3ZA 3W02A 1J6PA 2PA6A 4X0NA 1ME8A 1EP1A 1LBLA 1VBHA 4UOZA 4IP4A 2NLIA 2DDXA 5G5IA 1EHAA 4H01A 4XV0A 1XRVA 2ISFA 1BQGA 1XGEA 3GTIA 4DI8A 3G1YA 4OV4A 2MANA 2CYGA 2GZXA 2VR4A 3IJDA 5LGXA 2FHBA 3LCFA 4EK7A 4FNTA 1EGVA 1OCNA 2W79A 5FJUA 1GJUA 4OBSA 1V02E 2XVNA 3QHMA 2OGYA 3Q65A 3UVIA 4CNTA 1WDQA 1HKMA 3FDGA 3P0XA 2O56A 4I6KA 1HKKA 4S38A 3W26A 3WH7A 4B3LA 1EXPA 1E51A 1LT8A 1SO3A 1H7OA 2JALA 1U2YA 1TQXA 5CLTA 3W7JA 4GNJA 3H24A 3NYDA 6XIAA 2Q8LA 1XI3A 4YIWA 3AJ7A 3FVDA 5BU6A 2RAGA 2PSNA 4MNLA 3NSXA 4Q32A 1XC4A 3TWBA 3G1VA 1H5VA 2QZRA 3WJSA 1EA0A 1Z7AA 1XWYA 1JCMP 3S5OA 3NYZA 3V5FA 1UQZA 4QR6A 4L1WA 4YTRA 3IGUA 5T9CE 1DXIA 2TSYA 3LZ3A 4DO4A 4O28A 3BAIA 3MW7A 2WSYA 1PO9A 1SSGA 3SRHA 4PZVA 4XBJA 3SCSA 4LW7A 4NJGA 2EPHA 5FAJA 3WDPP 3MVIA 3USBA 3WQFA 3F1QA 5HNUA 4F2TA 9XIAA 1SSDA 1QTWA 3NPVA 3GSMA 1R30A 3QRHA 4S1FA 2ZRUA 1VJIA 3CUZA 2V63A 3B9EA 4CNPA 7PTDA 3ABOA 1FHLA 1ZY9A 2J4GA 1R9ZA 1TR1A 2Y88A 4W5ZA 2WZHA 4AF0A 3FCPA 1TPDA 1LUCA 3CJPA 3G22A 3M0KA 1V6XA 3VE7A 1TPB1 3RLVA 4HPGA 1K9DA 4XZIA 3UZXA 3INPA 2X09A 3A22A 3RNDA 5J5RA 1RCXB 1XLHA 1W1A1 4B90A 3WEMA 5ECVA 3L2MA 4LPCA 4YL2A 3VOHA 2Z6IA 1BSIA 4GQBA 3FSTA 3CBWA 3DOPA 3P93A 2PRMA 5AHNA 3PZGA 2JIEA 5C6MA 4E8CA 1S39A 3WLQA 3TA9A 2BX7A 1IXOA 5CSUA 2POTA 5C54A 3IJQA 2W91A 1AFSA 2RHGA 4R7WA 1NU5A 1V79A 3BAJA 2QR6A 4DPQA 5C2XA 5CC5A 2ALRA 3FYPA 2V8ZA 2CERA 1REQA 5KITA 2OGJA 4HZMA 5FF0A 3NZPA 3GXDA 4NHVA 2RJGA 1ICQA 3VIHA 4WXYA 4L9ZA 2VEKA 1EEPA 4N9EA 1ZUAX 3DFTA 3N2CA 4UFMA 5JIPA 4EPKA 5E6ZA 3HJZA 2FZ9A 3FSUA 1WDPA 4A3UA 2WC3A 3A4XA 5I0DA 3V35A 1TZ7A 4A3YA 3WNOA 4K68A 4NF7A 2NXGA 3VNJA 1R3TA 1W32A 2CLHA 3QY7A 3EWWA 3ALFA 3WK0A 1PZ1A 2Y2WA 3GVQA 1E15A 5HR7A 4KPLA 3W2MA 2Z1VA 3CNYA 2GGEA 3OLIA 3DBPA 4C7FA 3APYA 3CQKA 2VD8A 2V67A 4HA0A 5F1UA 1GOQA 1BF6A 2J25A 5D8ZA 3O16A 3WJYA 3FJ4A 4K1WA 4N4PA 5C71A 4R7JA 4A6GA 3BCFA 1A4LA 2NQZA 2Q8XA 4JXCA 2OWCA 1QPRA 2BHUA 3NVDA 3NR0A 1YTKA 3PTQA 1R87A 2PODA 3VD9A 4H6EA 2O9PA 3GVGA 3QEZA 2FPVA 1YEYA 3PZ9A 3IVSA 3AISA 4C6PA 4ZCWA 1FRBA 3VIJA 1X8FA 4LNCA 4LUJA 3CT2A 4FI4A 1UD8A 3RIKA 4QG8A 3DH7A 3VGEA 2WVSA 4IP5A 1HG3A 3THAA 3MUZ1 5CEWA 5REQB 2HISA 4IGSA 1XIEA 1CIUA 4NAFA 4PODA 2E9LA 1OVDA 1X6NA 2Z29A 4GUHA 4GZJA 1EEXA 1F76A 3V0SA 2WBKA 4JX6A 1BQCA 4QRNA 1Z9AA 4FX8A 4GVHA 5GPRA 3W2LA 5C9XA 1VP5A 4REQA 5LHFA 3PAJA 1PYFA 5DBTA 1Q66A 2XISA 1W56A 1XGZA 1P7TA 8XIAA 4QJ4B 1KFEA 2PAJA 2VEMA 2XN2A 3B0XA 2F2HA 4FALA 2JF6A 3ARUA 5DMMA 3R0DA 2C91A 4LAMA 2VMFA 1Y0EA 4TTUA 4P7LA 3T9PA 4EACA 2OJPA 1WX0A 1VCFA 5AY7A 4EAMA 3TDFA 3EPNA 1Z3NA 5I3HA 4BQ3A 1YHTA 1TPH1 1OX4A 5KZDA 5KZMA 1I45A 2WJFA 5HUPA 1OABA 1NP2A 1J8VA 3W72A 2CPUA 5CSRA 3FY1A 5A6AA 4MUPA 3TLLA 3GVVA 3LCWA 1UBSA 1US0A 1EP2A 1GYNA 4HZ8A 3GNXA 4XAYA 3WQEA 1GQIA 4TXEA 2FH8A 4O53A 1UIPA 2DZBA 4DUXA 1VFSA 3DFSA 3B06A 4AVOA 8CGTA 4PSPA 3CHFA 3B40A 3MQTA 1RR2A 1LTDA 3G8RA 3WEZA 1B9ZA 2PDCA 4KRUA 2G37A 3WF0A 3R0KA 1R3WA 5CH9A 2XVLA 4ALDA 4FA3A 1DJQA 5HWMA 1Z69A 2XINA 1W31A 1JDAA 2FMOA 3MSRA 3TFCA 1YXCA 3AHVA 1LLWA 4X63A 4LB4A 3FKKA 4O13A 5DT7A 2A3BA 4CD7A 1PS9A 2V3FA 5HULA 2J7EA 4OGZA 2ISDA 1BGAA 2E68A 1TRIA 1OFEA 4AB4A 1IEIA 1W1PA 1HJWA 2VZUA 2GYIA 2XSBA 2XGBA 3O6DA 3ZS4A 3RCMA 4GYJA 1MQQA 3IVUA 2JK2A 2OEJA 1VH7A 4D6HA 2HPMA 2GGIA 4RXFA 3UNDA 4R9OA 2ZWZA 2HWGA 1EGZA 4DUVA 1WZLA 2P3ZA 2FVLA 3IAPA 1OWQA 2YXGA 1W3NA 3B9NA 4M29A 1CLKA 3VGBA 2A7RA 4F3HA 1QW9A 2P3EA 1QXLA 4M7TA 2J8GA 3ANUA 3TCEA 2E5DA 4RUBA 4D6CA 4FX6M 1P6WA 4F0LA 4LF2A 3ZSTA 4U3CA 1DIOA 1TWDA 4RJEA 1DTUA 1BTCA 3KE0A 3DZ1A 5IHRA 5FJJA 4WY0B 3FK4A 3WUFA 1S3TC 3NGJA 4O18A 4HJFA 4AHOA 2HDJA 3EEZA 3WUGA 1UWSA 2IPWA 3GXPA 2WZMA 3HB9A 3BJSA 3DXIA 1XLGA 4MNMA 1EIBA 4Y9NA 2YDRA 2PDFA 3DFQA 4ZVJA 4HB7A 4EXBA 3L4WA 1PCWA 3TTSA 3PZQA 4C6DA 3B9DA 3OG2A 1ISVA 3G0XA 3GNNA 5H8UA 1C8VA 3MCNA 3G77A 4FOJA 4WOZA 3GKFA 3PK7A 1IE7C 2ALDA 3E1F1 1OZMA 4O11A 4AIOA 2IMRA 1TTPA 1OG0A 5D2VA 3HPAA 3GUGA 5LIWX 5G1TA 1L2UA 1EGMA 3ITVA 1TV3A 5BMWA 4XAPA 1V4YA 4P8WA 3WIJA 2CEQA 3W00A 1AQ0A 4M80A 3KTCA 4NQ1A 3TZNA 3EWYA 1O60A 3CPUA 2Q09A 4PRWA 2OKTA 1JCNA 1ZL1A 5KZ6A 2HV5A 3CH9A 5DCBA 2XGIA 3DHFA 5M1TA 4NRSA 2QMJA 4MJ2A 1G1YA 4H6QA 4QJ3B 1JVNA 1RBAA 1MXDA 4TV6A 3L12A 5BZAA 1I1WA 1V03A 3BPWA 1JUKA 4BHYA 2GVGA 3V5CA 3EXRA 1ZBVA 2OT1A 3SW6A 1KXVA 3E2QA 4QROA 1KQZA 1LZOA 5EU9A 2G3NA 4C6KA 5FEWA 4MDOA 4TX6A 4UTWC 3STFA 2WPBA 3LPFA 3LBMA 1PPIA 1QHOA 1QWGA 4DBDA 3TN4A 2AMXA 1KGUA 3VNYA 2I57A 1F4HA 4S3CA 1FWNA 3XINA 2JKEA 2OO0A 2X1TA 1NOWA 4QS5A 5A3HA 3BCDA 4QSFA 2OU4A 1T8XA 3ITGA 3O63A 5FJOA 5K2ZA 3UPWA 3KUMA 1W1ZA 4IXHA 4LAOA 3LOTA 3DIPA 5CPTA 2Z6JA 1DWHM 4GH3A 1AW2A 4XKYB 2CIPA 2EPLX 4NY2A 1P0EA 2BOFX 4DYKA 4B91A 4O1FA 3PJTA 4MGGA 3BCJA 4HHPA 1GEQA 1FWAC 1UKTA 5BW6A 1KFLA 1XLLA 4Q4MA 3DKLA 3E0VA 1QK2A 1J0IA 1R8LA 3P8IA 1S2VA 2WPGA 1R6WA 4W88A 2NX3A 2YFOA 3MSYA 4ORIA 2CLFA 3MB9A 1UKSA 4JY9A 3BLOA 4L4OA 2I9UA 5AECA 4FNSA 4TVCA 5AFDA 3LHVA 1A3WA 1TA3B 3VKAA 5FACA 4LVGA 3TK7A 5HWNA 3C3NA 4HTBA 1TJ2A 3IRDA 3NURA 1X1ZA 5E0FA 5EKYA 3VCRA 4LCQA 1SZNA 1JCLA 1HJVA 1JAKA 3IPWA 1DE6A 1B9BA 3L5LA 4JFSA 1XDJA 4PMVA 1W0MA 4GY1A 1X96A 3OODA 1KM1A 1H62A 4C6LA 2VR5A 1PE1A 4W8LA 3BW2A 4C90A 3OGRA 1A3XA 1KFBA 2A3AA 2H6RA 5I77A 3LBCA 3W7QA 3UPMA 1IGWA 3VGDA 1FDYA 3CLWA 3EB4A 3HGRA 3AU6A 1NY1A 1DPMA 4HD5A 2F38A 1TJPA 3BTNA 2UBPC 1E6NA 4LAZA 4GUGA 3W28A 3QR3A 2W6RA 3DENA 1RAKA 2JE8A 2FJUB 3ZR5A 1ZAHA 2E6YA 3SN0A 3CTTA 3E6EA 3PWAA 3QPYA 2DU2A 3UZJA 1P48A 3REQB 2F84A 2VZSA 1R7OA 1G94A 5U7SA 4EE9A 4FLQA 2REQA 3A12A 4LEQA 4G5DA 2NT1A 3HQOA 1W2PA 3GXTA 4CUCA 1F3EA 1TPC1 2ZZ4A 1GQJA 2R8WA 1A5NC 2OTDA 4Q8OA 1HL2A 4CN4A 4F79A 3BQ6A 4U4MA 3EWDA 3GDKA 4O4WA 4H2CA 3E5PA 1LBFA 2R82A 4KEMA 3UWWA 3SQLA 2WM0A 1WZMA 1AVAA 2IS7A 1TUFA 3LB0A 4DXKA 3AIQA 3LHTA 3W27A 2WV8A 2GJXB 4UTLA 1G4PA 4LALA 1AG1O 2PTDA 4ZQOA 1K8ZA 3BG5A 1XM3A 1UD6A 1XG4A 4PTNA 2PGWA 4DLFA 2I5GA 2PD5A 2C15A 2Z1XA 1R2SA 1XIHA 1FWJC 3K4DA 4B5SA 4J5NA 3NTYA 4D71A 2A2IA 1O5RA 3O15A 4L9YA 2UY3A 2D2JA 1IV8A 4RZ4A 4QE4A 1BKSA 1MUMA 1NELA 1BG4A 2VFDA 4O0ZA 5CQ1A 4FNPA 3UEQA 1HO4A 2ZZ3A 4HU0A 3K4AA 1BVNP 2YZ5A 3A23A 5D33A 1QASA 5JBEA 4Y9OA 1B4EA 4QCEA 5CPMA 2FVKA 1U5HA 4NI8A 2B7PA 2Z2AA 4Z1AA 2PDNA 3W2UA 2WAGA 4MPQA 4GZEA 4MKVA 1ZJBA 4LBSA 1MWOA 4O1AA 3RFAA 8TIMA 4K6AA 3W7DA 1TB3A 2ZZ2A 4AX6A 3AUJA 1ZP3A 1CXKA 3RO8A 1THFD 2ZDSA 5EYWA 5H1WA 2FQIA 1VENA 1O1ZA 1OGBA 2ZDRA 3WD3A 2YCLA 1IZKA 2X0HA 1E3XA 3GC4A 3TJIA 3A5VA 2Y24A 2ZC1A 1Q2RA 6ALDA 5FJIA 1GVYA 2AAMA 2WM1A 2GVEA 3QJAA 1KBLA 1XX1A 2V2CA 3AAMA 5H8MA 4CLMA 3JVAA 1RK5A 3WK3A 1P0NA 3SRFA 4DJDC 2ZTJA 3EZ4A 1ITCA 3CZJA 3S5NA 4IFKB 1A0EA 3NQVA 1G7VA 2WLZA 3P5ZA 4NZFA 1RPXA 3NEHA 3EWCA 1E72M 4Q4KA 3MKCA 1R0MA 2ZRWA 1FWTA 2PCQA 4G1NA 1OT1A 4NUWA 3ME3A 5BNKA 1NQKA 1X7FA 4JIQA 1E6RA 1PX8A 2Y7GA 2XM2A 5CZ0A 1B3XA 3SUUA 2VCAA 3VMNA 4ATDA 1R5YA 1O6IA 2ZICA 1VFFA 5A69A 1AJ0A 3M43A 5C9RA 1E70M 1SYTA 2X7VA 2VOTA 4TTGA 3FA3A 4JPGA 3AHTA 2PDMA 1R3YA 4NX5A 4Q7NA 5FF4A 4AIEA 2D0FA 3QQ1A 4MZ1A 4CVWA 4QSHA 4WGHA 1TTQA 3F2BA 5MKGA 3MUY1 2PTZA 4O1EA 5A6SA 4JX4A 2JQXA 1B3OA 2HEJA 1NWUA 2HVNA 4IT1A 1LRQA 2WSKA 2PDJA 1TCDA 3M6DA 3VC5A 2XPKA 4NAEA 5DEZA 1E0WA 2DV0A 4D6JA 4H7VA 3TYAA 4IP7A 4BEQA 3AIRA 5BOEA 1N8FA 4BJHA 4Q4OA 1S5TA 4M6PA 4PA8A 5DQPA 4FAMA 3RU6A 3CMFA 1C92A 5D2WA 2IKHA 3W1TA 3SO7A 1SO5A 1EJRC 1PHQA 1KFCA 3F2DA 4FLRA 3CUXA 3GIQA 3T81A 2QQ6A 2RKXA 2UY4A 3HPXA 4ZFMA 4GXMA 2CETA 4JQ4A 5HA7A 4QXIA 2R6OA 2R94A 1Q4WA 2E09A 1OGGA 3VI2A 2UWFA 1Q6QA 1MSSA 2EAWA 1R2RA 3TN3A 3LK6A 3DI1A 3D5HA 1PIFA 5CPNA 3F4VA 2O92A 2D69A 4XD4A 3WLIA 1Q2SA 4GJIA 4QJ5B 3ABZA 2Z2UA 3BSGA 2QJJA 4LS1A 1XG3A 3M46A 1VPQA 1RHCA 4KCTA 2DFAA 2OEMA 4FXFA 2J7HA 1W6TA 5C2CA 3WFLA 2YCKX 3DN5A 3QMRA 1BAGA 2GWNA 3LU2A 4MJMA 3BGJA 5I3GA 4JTIA 5BYWA 4K8EA 1PSCA 2RDWA 3OLDA 3DGBA 3PG8A 1PL9A 2QPUA 1O12A 4MLJA 5D9NA 5EBAA 2NSXA 3W2KA 4XZLX 3OIXA 4PMJA 1A5AA 4BI6A 5LNVA 1XCXA 3PSWA 4D1JA 4UQEA 3TW6A 3G24A 3L66A 5J5DA 1QNSA 3AS1A 2A79A 3CH0A 1A50A 3ZJKA 1GVEA 1J12A 1IT7A 4CQ8A 4HSHA 1GUVA 1R3RA 1DOSA 2WXDM 3GU2A 4ZTYA 3QC0A 3T8QA 3OQEA 2SFPA 4LUIA 1M01A 4ROPA 4ZE4A 5ABFA 1EC8A 3PZNA 2PF0A 3VABA 3M0MA 5IXEA 4C6BA 3PB2A 3L23A 3R25A 1S1RA 3SN1A 3KXQA 4R34A 5E0CA 4MWAA 1UUMA 3H2OA 4WKFA 1IQ8A 2ZRZA 4GYPA 2AOSA 2XIBA 1MRAA 4K2SA 1U1JA 5A95A 4FIRA 1ZJHA 1AZ1A 3DGRA 4YYCA 2GUYA 1K9EA 4IM4A 4M6QA 3N2XA 3ZJ7A 4WD0A 2ZXDA 1X39A 4EANA 3NCOA 5LIUX 1VC4A 8XIMA 4B3ZA 2RDUA 1R85A 1WDRA 4RXGA 1Q6CA 1XSIA 3WQDA 1FH7A 1K4HA 2E8YA 5MKGB 1J0HA 1UD2A 4KCVA 4DO7A 1WBJA 3ZJ6A 4HVXA 4HHMA 1UOKA 1E6XM 4Q4RA 3VIIA 1Z8AA 4AWSA 1DJZA 1CPUA 2QJMA 1DWAM 2C19A 3FVMA 3ZLGA 3OBKA 1J0KA 3CV2A 2ZRYA 2P0IA 3F4CA 4JICA 5PTDA 3VXGA 1AMYA 1XBYA 1LG2A 4Q6JA 4ZXOA 4QQ3A 5EGRA 4ADSA 4J1OA 1CW2A 3N4FA 2QF8A 1XF0A 2C71A 3CB8A 1EB3A 4LYPA 2VDGA 4ACZB 3H55A 2CLKA 4I5UA 3LDVA 1JYVA 1XBXA 4AH7A 2ATSA 1ISWA 4PYSA 3AXHA 4JD4A 4IIEA 4Q4SA 5EA9A 3VKJA 3K46A 3TYUA 2VC7A 1KRBC 4DM1A 5FSDC 2EPNA 3N4AA 1FP8A 5D9MA 3GVRA 4CEUC 3OHMB 4MJ4A 3TV8A 3VCNA 1Q4NX 3VD4A 3CHEA 3L68A 1EHNA 8RUCA 4WF7A 1V3IA 1TE6A 2X1UA 3N14A 3W23A 3HG3A 3ARYA 3CAKA 4ZTXA 1O7AA 3COTA 3WQWA 3S47A 4OBTA 4PBEA 1YXYA 4LYKA 1L6SA 3N34A 5A2BA 4D9PA 4PH6A 4NJKA 3PNZA 5CC3A 1GVQA 1CZ1A 4DIAA 4DO5A 3DERA 1BEUA 1SMDA 4JFWA 1IWBA 3H2FA 1HGWA 5CZSA 4GGBA 4Q8UA 4OOZA 3M5YA 2Y1HA 4XSMA 5HBFA 1GZJA 2VGBA 3UJRA 2PDHA 1AH0A 1XV8A 5G2WA 1EJUC 4DBWA 2BLEA 3N4EA 2XFWA 3R0UA 1ZAIA 2ACSA 1ICSA 4ADTA 2CHRA 3SFKA 2V30A 4WOQA 5FL0A 2G4JA 4MZ8A 4J3UA 4PB4A 2A7NA 1FVPA 3B9OA 4LS0A 3C0JA 2D1ZA 4I9AA 4KT2A 3PUGA 3NOEA 3EGJA 3N25A 5HMFA 3LBOA 1EX1A 5EMKA 5I3IA 1UP2A 4NT0A 2IPFA 4O0KA 1JXJA 3T42A 2DW7A 3B03A 4LUYA 1FTXA 1WDWA 5HDRA 3A9BA 3THDA 3SEPA 4DWSA 3VIOA 3M41A 3OVQA 2ACUA 4AY8A 2BGNE 2VQUA 3QFWA 3NDZA 1DHKA 1NTHA 2L5HA 9RUBA 2V5CA 4I5XA 1RXOB 1E5NA 2PWHA 1DWFM 3PTMA 3JU2A 1B3YA 2DJLA 2Z1BA 1S2TA 4IIBA 1F61A 1GTHA 2WCGA 3PBYA 5C7HA 4AEEA 2GUUA 4M56A 2EPKX 2W0UA 1ALDA 2ZQ0A 4FK9A 4KKXA 1XPYA 3GAKA 2PEVA 3LHWA 3F2CA 2WMJA 2PGEA 2QS8A 3STPA 1QW7A 2DT3A 2PDQA 1SJAA 5F1VA 4H8UA 3TP4A 4LAUA 1DQXA 3W24A 2V3GA 1UP0A 1HIZA 4AIUA 1ECEA 5LGZA 1FHVA 1WOAA 2GGHA 1EZWA 3QN3A 3VNKA 3S6DA 3MV11 2VENA 5LNRA 1MW0A 4BQ5A 2D3NA 2D2OA 3M0LA 3ZT5A 3VUSA 1H50A 3C0LA 4S3JA 3OVPA 3PFRA 2G95A 1H4PA 1WP6A 2O7QA 4JCLA 4XZBA 1ZBCA 1KGWA 4IMDA 4C6EA 4CNSA 3O1NA 3WJWA 1JRCA 3B05A 2CBIA 2Y8KA 4A8NA 3S4TA 2P8BA 1TX0A 3B8DA 1M7XA 1UWIA 3BLLA 2GGJA 3U7VA 3EMQA 1PHWA 1FKWA 2WHKA 2I7GA 5EMMA 1ISXA 2NXIA 3QOKA 4Z1YA 4E5TA 2ZA2A 3G1DA 5G1MA 2PI6A 2XFRA 3GHRA 1HO1A 2CKRA 1QI0A 3ITTA 3K5XA 3BSMA 4HNOA 4H4IA 3MYOA 4AXNA 2PURA 4L5ZA 4C91A 1GNXA 5JBDA 3PNUA 4BA0A 4NXSA 3MI6A 1TV7A 3AXKA 3CUGA 1DWIM 1B54A 1PB0A 1QPKA 3UU0A 1F8IA 3KVMA 4OV9A 1OF8A 3D0CA 3IS4A 3QTPA 1WKFA 5BXSA 2EGZA 2ZUMA 1PTGA 3QR0A 4DHGA 1B2YA 1JPKA 4GNKB 5C2GA 1FH9A 1VJZA 1NM9A 4JTTA 4A3QA 5KEZA 4M81A 4DZAA 4KGLA 3WJXA 1S46A 2ADAA 4QQUA 1E0XA 3WLOA 2NV2A 5M17A 2YFNA 4GUFA 3GRIA 4CU7A 3GAYA 4I8YA 1G4EA 3W7EA 2OT0A 1J6OA 2YDQA 3S2MA 3P82A 3ZR4A 1KBBA 1KR0A 1OM0A 1J93A 1V93A 1V3LA 1VEPA 3LGGA 3B8IA 1SJBA 1OINA 1XH2A 2WBGA 3NQMA 4H83A 2HMCA 4CD6A 3A4AA 4AVNA 3IRSA 4JY8A 1UZDA 2VQTA 2GSEA 4E3TA 4E6MA 1EL3A 2X42A 4QBXA 5B7YA 2QDGA 5D38A 1ZSXA 4AWTA 1VEMA 5REQA 3PWIA 4G6CA 1OIFA 1XDMA 2QVNA 1O68A 3EAUA 2BXYA 2VHLA 4UTKA 4BFAA 2Y8VA 4B9ZA 3FAWA 4QFUA 2IPJA 4V15A 3TEVA 3NL6A 5D05A 2PWGA 3DC0A 1SZGA 1TREA 1UWQA 1M04A 2IKGA 3KFTA 5DMYA 4OT7A 2BGSA 2C16A 3WH8A 4A35A 1BSLA 1OFBA 1XIJA 2OXNA 3JRKA 4H8VA 2V3DA 2WZTA 1XL9A 2A3CA 3IUDA 2YIHA 4MWAC 1IIHA 1PYMA 3MDUA 4EOUA 5H8PA 1YNQA 4M82A 4H9MA 1W37A 3EOUA 2O7SA 4PE8A 1PBGA 4CQDA 4Z1CA 2NV1A 2X40A 1F05A 1TPFA 3DX5A 4P7RA 2D22A 3OZYA 1J5TA 3AS0A 2IW0A 3GXNA 2FZMA 1WPCA 1VR6A 5BCAA 3I4KA 7CGTA 3BGAA 1JYXA 3P3BA 1JR1A 4UBPC 1JYNA 2G3FA 1UP3A 3MKVA 1MUCA 2PRLA 4NXKA 4E2BA 3HM7A 3WLSA 4IUGA 4XAGA 1QPNA 1QU4A 1NVMA 3WMLA 2YPIA 3HA1A 3URNA 4DN1A 1P0BA 2DZTA 5AC5A 3AMLA 5FF7A 2QYGA 3W22A 3HFTA 2E4TA 1EA9C 1WAWA 1V7YA 3UG8A 1D3GA 5AZ1A 3LGEA 1MUWA 4HJWA 4BI5A 1QJWA 2PZ0A 1SZEA 3VKBA 5E0KA 1BVZA 1VJSA 5AC4A 1J4EA 4GOAA 2OOGA 3PBUA 4PUJA 5CC7A 4V2XA 3GFZA 3KOFA 1XH0A 2OSXA 1IWPA 4MOZA 3L4YA 3M0YA 1UJPA 3GW0A 3R12A 1Y5WA 3RUBL 1I1XA 4YMZA 2NWSA 1CYGA 3MHUA 4LQ1A 4LJ3A 3PBWA 5T9BG 2WHMA 4PB5A 3KRUA 4YTUA 1UR0A 3R1ZA 3ERPA 1SJDA 1QNQA 4M0XA 2NW0A 3F5LA 2QAPA 4GVGA 1JYWA 1HTIA 1F4AA 4R7OA 2XH0A 4A29A 2X2GA 1ZTVA 3T0CA 1DE5A 3UGRA 3S2JA 1JGMA 2ICSA 3W1NA 4MF4A 4NVTA 4Z0SA 2PLMA 5IBXC 3UESA 5HR6A 1TMHA 4YCPA 4J3WA 1XLMA 1FWHC 1LL6A 4UR7A 3EB2A 1I0DA 1PDYA 4LBRA 2E5BA 4IPPA 1CNVA 5DY2A 1Y8BA 1I4NA 5AZ0A 2DVTA 1EIXA 2BV9A 1VFLA 4HNVA 1I60A 1SQ7A 5A6KA 3A5FA 5D30A 4A8IA 2X2YA 2TAAA 4LFYA 1BF2A 1RY0A 1F5ZA 3N2MA 4HOZA 3AHZA 4GBUA 1F3XA 4UMCA 2CFFA 2XIJA 4PUWA 2ZX7A 2CZVA 1JF5A 1GVFA 1KB3A 3SURA 3ITXA 4IJRA 1JI1A 5D8WA 4FR6A 3MS8A 4GCXA 3B0VC 1LOSA 1KTCA 2ZOXA 1YYAA 4DJDD 1PV8A 5D4YA 3W7PA 3IUHA 1TG7A 2QUUA 3CU2A 3G5EA 1M7OA 1N8IA 2WMGA 1TYGA 4GE8A 2ZXBA 2E6FA 1JZ5A 3MMDA 3VOFA 3NPUA 1WQ5A 1RH9A 1X7IA 1P1MA 1GEHA 2OZ3A 1LWJA 3KZSA 4EF9A 3W70A 1ZPTA 1GGOA 3D6NA 2XIQA 2J7FA 3F5JA 1JQVA 1XUZA 4AISA 4JHMA 2WO5A 1EBGA 4S2BA 5E9AA 1G67A 1VYSX 4IG2A 3U4FA 1QOPA 1QNRA 3SQMA 1HJSA 4AWEA 3T40A 3R6IA 3CTLA 4GG9A 2I16A 1CT5A 1TQJA 4GI8A 2V5BA 1MDRA 2ZZ1A 5EBUA 4YNGA 5G2HA 5CLWA 2PUZA 4CCEA 1RCQA 5E70A 3I3BA 4V1XA 5CBBA 1J18A 1CGTA 4JTQA 4J3VA 1DJIA 3UR2A 3W2NA 5LNWA 3HURA 2ZCGA 3R79A 2YA1A 1WV2A 2FGBA 3G1SA 4US5A 3GHSA 1ML1A 1I2PA 4IH3A 3MUCA 4HPNA 2GPTA 5ECUA 3DFYA 4IFRA 1K1DA 4FZIA 3AZRA 4GRSA 4B3KA 3PULA 2OQLA 2GJLA 4RDZA 4QGCA 4D6GA 2PTWA 4KS0A 4HMNA 1L0PA 1WKDA 1IIGA 4URIA 5A6BA 1LROA 3DU0A 1S1PA 1CB7B 4EXQA 3OGSA 3TH6A 2ZUVA 1KO0A 2ZA3A 3PFMA 1OADA 1BHGA 3S1VA 3RG6A 5EY5A 1EP3A 1XLIA 1D7FA 1Z41A 3LNMA 4G7EB 2VD9A 4K38A 3VM5A 5A8QA 5D32A 1UOZA 4N0RA 1H09A 2WSPA 5BROA 3GWQA 3MP4A 3IGSA 2VYOA 2JEPA 4RNFA 4C5YA 3VIPA 1FX6A 2FTPA 2WMHA 2W92A 2ABBA 3PS7A 7TIMA 1ZJIA 3BLEA 3TWAA 3RDKA 3PPFA 2OQHA 3CLMA 4MB1A 1ZCCA 3L4VA 3PUDA 2E6AA 2R14A 1U5JA 4JS3A 1AQFA 2ZVRA 3BE7A 4FF7A 3GW3A 1GVSA 5AVHA 5FD0A 1KCKA 3P60A 3KBJA 1ZGDA 3ZT7A 4IHCA 2BOGX 2RGMA 2OVLA 5FEPA 3EPOA 1G5AA 3G0UA 1L9WA 2YB4A 4OUIA 2F8QA 5IOBA 1DL3A 1DJYA 2QNEA 4NU7A 3VX1A 3QMTA 4AD2A 3IACA 1J0ZA 1QO5A 1OFRA 5DY3A 4Y9AA 1VFMA 1W1TA 4J3TA 4U5IA 1X1OA 1H2JA 5DN1A 2OZ8A 1OYCA 2QMKA 2WJZA 2QJHA 3H4WA 1NEYA 3IGHX 1YXDA 2PTYA 2QULA 1E43A 1E4NA 1HP4A 1XQKA 1AH3A 3CWOX 1GQNA 1F74A 1H41A 4GKLA 1ZQ5A 1E1EA 4GC4A 4AZ7A 2NVCA 3S2CA 4EP8C 3WDIA 1HUVA 1M68A 3OVRA 3M4HA 2VGGA 3GFYA 1J10A 4HHHA 4DWDA 2RDXA 3C0QA 5D9OA 2WJEA 1TRDA 3RRXA 1UZ1A 2OEKA 1L8NA 1KD0A 3T4WA 2A85A 3E3HA 5EMUA 1ENUA 2Y7EA 3RHGA 5GQBA 3OBEA 1F3TA 3QR1A 4L64A 3CK5A 4A3HA 3U2OA 3CGTA 4PFHA 2KAUC 4Z2KA 3WLKX 3VD5A 3HZ3A 4OECA 2ZX5A 4J3XA 2BSLA 4JEJA 5FESA 5I7GA 3PBMA 3T05A 3CT7A 1A53A 5K4ZA 2YBTA 2Y5JA 3SECA 3MSGA 3VOJA 4MM1A 3W07A 4XIAA 5CJMA 3GH7A 5ABGA 1A5SA 1ODZA 2DQWA 2AQWA 3R58A 1JDCA 5JH2A 5HMSA 1TIMA 3GC2A 4WSHA 2BY3A 2FLIA 3UWQA 4UZSA 2ACQA 3SGGA 5KTLA 3OP2A 1KM4A 1Q7QA 2QGHA 3PAOA 3DHPA 4K36A 5I3KA 4ES4A 3S83A 4BQ4A 4P7NA 3TONA 3CUFA 1TVPA 4R33A 2Y8UA 2VM8A 4L6DA 2C7FA 1L6GA 4OBRA 5A8MA 1XS2A 1KRCC 4HPJA 1QNPA 1R9YA 1RV8A 3PZUA 4I7VA 3TXZA 3BARA 1M1BA 4E4FA 3S6TA 1Q8AA 4UNIA 5CZKA 4LF1A 4FOUA 3IK4A 2J8TA 4YTTA 4GJ1A 1DHPA 4AMAA 1K7XA 5HQMA 4MTVA 3M1ZA 4DBUA 3EKGA 1WKEA 4O12A 1PJ9A 4WDXA 3EOEA 1XYAA 3Q4DA 3ARWA 4IMGA 1KFKA 1KBIA 1GQKA 5CJNA 1POJA 5EFFA 3GE7A 3PZTA 5D04C 3WK2A 4XAFA 4ILSA 3CYVA 3NUKA 5I2UA 3WELA 4IXXA 3IGXA 3L4XA 4ZZ9A 3LHZA 4JFUA 3UWVA 3UVAA 1VYPX 4QNEA 4HNCA 1LQAA 1SJCA 4RNJA 3WQ8A 4AZBA 1OJXA 1R38A 1ADSA 5CJ5A 3P6LA 4BK9A 4JKMA 2PDGA 1W5OA 1H1ZA 1YIXA 3Q37A 3D46A 3UXKA 1GONA 4HN8A 4C7GA 1NARA 1AQMA 1M7JA 4QLKA 1TA3A 4PMNA 1LCOA 1EBHA 1FWGC 3RM8A 4KWVA 5KZEA 2DVXA 5AYYA 3QZEA 1CGVA 3DUGA 4RW3A 4EPBC 3W7MA 4IL2A 4RDVA 3KBNA 5IBXA 3UG3A 1MZRA 4IJCA 1H63A 3R94A 2EQDA 4JYEA 3HFYA 3VA8A 3QSRA 1PAMA 3LN3A 3PJUA 3S9ZA 4DJED 2FZDA 5KETA 1W2VA 1F2JA 5KSWA 4GBDA 1CXLA 2V0TA 2G96A 4K7VA 1QI5A 4WSJA 1O4UA 5AHLA 1NWSA 4YLWA 4XTIA 4HCLA 3HGJA 1KXHA 2AMGA 3P74A 3GU9A 1PKMA 2BXVA 3O0FA 4WEVX 4NL1A 2VZTA 1DXEA 2YCJA 5BXPA 3GFXA 4ZB5A 3VD3A 2VXNA 1F3WA 3MCOA 3W1QA 4BR1A 2Z25A 1P6CA 3TFXA 4AZGA 2NUXA 1XYBA 3M7SA 5A6TC 3QH2A 4OKDA 2OFJA 1TWWA 4DX3A 2HK0A 2EKGA 3HO8A 3APTA 3LENA 1S5VA 3HMCA 4S23A 4UTMA 3MTWA 1H7NA 4F0RA 4BKNA 1XIIA 2F6UA 5FF3A 3ABQA 4OIFA 3KHDA 3UY8A 4LH8A 1J9YA 4AAJA 3VMOA 4H41A 3O6CA 2UV8G 4YVVA 2V81A 4R88A 3CL6A 1M53A 3H2EA 3QXBA 1TTIA 4W93A 1YDNA 1GJPA 1LL7A 1GG1A 4CD8A 4RE2A 4GUJA 1XIDA 3AOFA 4B5TA 3HMJG 1N82A 1NDVA 2NQLA 2QCDA 3P62A 3PANA 3TMLA 1V08A 3IWPA 3UPBA 2QCMA 4ZO9A 2C0AA 1R3SA 4JHOA 1CGWA 4QE1A 1VHCA 3AIWA 3EWXA 3W01A 3G2GA 3GQYA 4DBEA 1LL4A 2YXXA 2GUBA 4DYEA 3A4JA 1U1UA 3UZ5A 1UR1A 1S2WA 1V8EA 4HNNA 2BY0A 2Y5SA 4GFIA 4DJFD 2WMIB 1E9ZB 3SB0A 3W87A 1LJYA 4GMEA 1YE6A 1WNOA 4MDPA 1DXFA 3MT1A 4A3RA 3WDRA 2PDXA 4IX2A 1Z6KA 1BGGA 2VDIA 4HSOA 2YLAA 3DG6A 2P50A 1GKPA 3FGCB 4J7RA 4QLJA 4PMZA 5CPLA 4F9JA 3M5XA 1HT6A 5E9XA 2H9AA 1A80A 4GVFA 4INFA 1PZ0A 4UTFA 1CEOA 2AGTA 3LEPA 1H7PA 1JFXA 5A6BD 4MB5A 3LY0A 2NV9A 1QNVA 5J04A 3GBDA 1S3HA 3CUIA 2QEZA 4JN8A 3A64A 1JZ4A 3NL3A 4IMCA 2BXZA 3NQAA 3OTRA 3PF3A 2OB3A 2B7QA 1Z32X 2FKPA 4AHPA 4PTWA 3KP1A 4MSSA 3PSVA 3TXVA 6REQB 4ZOBA 4HZ6A 2DT1A 3B4YA 4US5D 3HGOA 1J2WA 2Z7GA 4PUMA 3N2TA 4GYKA 2F2KA 3V16A 4NX0A 3BOXA 3EDEA 4D6IA 4JYDA 4JR5A 3N29A 4IISA 2R1PA 1TCMA 4A2RA 3WL1A 4GO8A 1J01A 4S3GA 4L6HA 2HVOA 6REQA 1TIWA 2FB2A 4AZCA 5TIMA 4V1YA 4QJ1A 3KVJA 4JTLA 3LPPA 4GPNA 1ME7A 5CGQA 3T55A 4CKQA 3QV6A 4AZIA 4D6FA 1AW5A 2QUVA 1OFOA 5J8LA 2Z0IA 2PD9A 4HHLA 5BWFA 4PCSA 5BXTA 1H1NA 2RFGA 4H1ZA 1FWWA 4PRRA 2VFIA 3POCA 1GPWA 1UR9A 3CZKA 1LOLA 1S2UA 2QDHA 3BZJA 3WNLA 1MVYA 4XUYA 4CEXC 3LCXA 1YTDA 3MWAA 1PVNA 1ITUA 3SDOA 3TYDA 1DQWA 2RH9A 2Z24A 2PP3A 5CC6A 2PDLA 1MEWA 4X60A 1US3A 1LWHA 5DBUA 1RP8A 1UH3A 2A21A 4UFIA 3N3MA 4YHEA 4GIRA 2R91A 1KV5A 3ZXWA 1JRBA 3ARSA 1YPIA 1I75A 2A6LA 2INEA 2E1DA 4RNHA 1PX3A 3EXTA 1XJBA 3WY1A 3L7RA 1R7AA 1BWVA 3O05A 1TMLA 1GOMA 2HJPA 1LF1A 5G2IA 4ZOEA 1AMKA 4HA3A 2BBFA 4IQDA 4JQ2A 5JIWA 5T8GA 1XD0A 4HQVA 1QNOA 1OX5A 2WMFA 3ABSA 2DT2A 3NL5A 1XGDA 2DQXA 3BL3A 1CWYA 4ZFCA 2HSAA 1XXXA 4KWWA 4AU0A 2JFEX 2ZUSA 3E2SA 5D02A 4E8DA 4PN2A 2W27A 3MPGA 1V6TA 5M2FX 4Z2IA 3KRSA 2JGQA 2XG9A 1SFSA 4C1LA 2E67A 5JMUA 1CXHA 2WNWA 4JEQA 1KXTA 1MEHA 3WLNA 5A6JA 3GIPA 5EMYA 1E1FA 3LSCA 5I06A 3U0HA 1KGXA 1XW8A 2E0PA 1MXGA 3N3TA 4MZYA 3I7QA 4N42A 3XISA 3VC6A 1D9EA 2AKZA 9XIMA 3WKZA 2HBVA 5TAOA 3V4BA 1T8QA 4MB4A 2R1NA 2Z00A 3NWRA 4HBKA 3NZRA 4X0VA 1M03A 2JKPA 1VPYA 1XKYA 4IOTA 2GFTA 1LLZA 1DORA 3A6OA 3RMEA 3USZA 3VDCA 3BLDA 2YL5A 3UR7A 4E4PA 1YBQA 2WZIA 4D2JA 4RPQA 3NO5A 6ENLA 4UTUA 2CWXA 3CV6A 4WDWA 3GR7A 3BAXA 2YA0A 4OU1A 1PZ2A 5XINA 4IL0A 2EEXA 3NQEA 2CBVA 1O95A 2F9RA 3U6WA 4QAWA 1OZQA 1UH2A 3BXWA 4MY1A 1MW2A 2VL4A 3CEPA 2VGFA 4RR4A 4FXSA 4LAKA 5CGTA 2OODA 3DI0A 3S42A 3PZVA 1K9FA 2Q3RA 4PUNA 3KRZA 3UXDA 3W75A 4Z2LA 2OELA 3UZZA 2PDUA 3OA5A 1FP9A 1A0CA 2GOUA 2BVWA 3CIVA 1G7UA 5H2ZA 3V1PA 4PEKA 4N9CA 2CESA 4QAIA 1TUXA 3UWEA 1B3WA 3STCA 1T99A 2O4MA 3LM3A 5DCDA 4FO4A 4J9JA 4IFOA 3GX9A 4PMUA 2YKKA 2PWUA 4ZBCA 5I6SA 3FV9A 4CU6A 1TPEA 1UUQA 4PMQA 2ZE3A 3ZFHA 5EL1A 5C9WA 3RYSA 2VVSA 3WLLA 4IQEA 3JUGA 2GLKA 1W91A 3L65A 1L8PA 1YNYA 1R9XA 4BEUA 3ITLA 3UP8A 3VNMA 4J4KA 4IQLA 5HWJA 2NQHA 3PC0A 2Y62A 2EJ1A 2IQDA 3WZ0E 5K9CA 4UMAA 1CB2A 2P5NA 3NZ1A 4JAWA 1KTNA 4FLSA 1MRQA 4O14A 2ZA1A 1ADOA 3N9SA 4HU4A 4I7UA 2ON3A 1LYXA 2CZ5A 3E0LA 4XZHA 4NKCA 1MW1A 1VQTA 1GYLA 3N17A 2WKJA 1YPXA 5G4EA 3CQHA 1OHLA 1P1XA 2OX4A 6XIMA 1W1IE 2YOCA 4UCGA 5L9FA 2VEIA 2XH4A 1K70A 4PR4A 2IXUA 5HAOA 3KL3A 3EX4A 3KS5A 3LV5A 1DV7A 4TX9A 4IPNB 2E5CA 2QJNA 4RNIA 2Y0FA 1IZJA 4HK7A 1VKFA 2DIEA 4Y6GA 2DIJA 3C61A 3OZOA 3EBVA 5JUVA 3PTKA 2D2GA 3WD1A 1V77A 4NAEB 4BWLC 4G8TA 3RGTA 2X05A 5CPSA 3SUSA 2CZFA 1TZ9A 3A21A 2DORA 3H54A 2CBUA 3KM8A 4C6IA 4M1RA 1ZBKA 2DZSA 2JF7A 4MLRA 4P61A 1H0GA 4CNOA 1REQB 3F7JA 4IIHA 4ICMA 1LRNA 1GZGA 4KRZA 2J9XA 1PXGA 3GBEA 5DF0A 5G4WA 4AC7C 2QLYA 2FDMA 3ZR6A 1K77A 1XLDA 5IFPA 3CIWA 4HP5A 3LSBA 1KA9F 4XBKA 5CXPA 3WF4A 1SGJA 3IANA 1YTEA 3GG0A 2ZE0A 1AJ2A 4TV5A 4UZUA 4M6UA 4XVEA 3B0YA 4KESA 3CO8A 3MANA 3QQWA 2H8ZA 3R8RA 3C4UA 5A6MA 5CBIA 3GYEA 3M44A 1OC5A 1J11A 4UTJA 2O4QA 4JTCA 3P80A 4YPJA 1HGYA 2GQ3A 4J2MA 1EC7A 2C1IA 1B4KA 1NH6A 4N02A 1PKLA 4S39A 1W8SA 1GCYA 1E6QM 4ORMA 4WDUA 2VEFA 3EOSA 4IUOA 4JIPA 2KX9A 3V18A 1E0TA 3HOJA 2GQ9A 5LKYA 3SAZA 1IYXA 4Q3MA 5F2GA 3SADA 2XN1A 3T6CA 2W63A 2DZWA 3BLIA 1GOOA 2X16A 4B4FA 3CL7A 1XQLA 5HK4A 3B8VA 1JCJA 4KWSA 1TJRA 2ZC8A 4GUIA 2QVHA 2PBGA 3UR8A 3IIZA 1C90A 2Z26A 4B15A 3GHTA 3CAWA 1UD5A 3LUTA 1BYAA 2WHLA 3L4TA 1EFZA 1LWIA