3BVJA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with xmp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
257
structure length
257
Chain Sequence
b'KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Crystal Structure of Human Orotidine 5'-monophosphate Decarboxylase Complexed with XMP
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 99
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3bvjA00
4M6PA 3CQ0A 1H60A 1O5XA 3V75A 4JY8A 1YXYA 3TH6A 3W1NA 3I7SA 2BSLA 4K39A 3P62A 1H7RA 1QO2A 4EF9A 3BK0A 3NQ8A 4UTIA 1LOSA 4ML9A 3U6WA 4XBKA 5CZ0A 4GUGA 2F84A 3TE9A 3WJZA 3GDRA 3GKAA 5LGXA 4O8RA 5LNVA 5G2IA 4FO4A 4JTLA 4UTJA 4HT3A 2Z0IA 5CSSA 4GFSA 5K2ZA 1T96A 5D2VA 1YXDA 1K3UA 1D3HA 2OJPA 3LHZA 1SW7A 3ANYA 2CU0A 1ML1A 4AAJA 1VLIA 4OU1A 5D2YA 1PE1A 4CCEA 1RQBA 1SO5A 3E02A 2XN2A 3NYZA 1WX0A 3MYPA 2YFNA 3DKJA 5A8GA 5LNUA 1NFBA 1KTBA 1JVNA 5LKYA 3NQCA 1L6SA 1TPH1 3CWOX 2BXVA 3GX9A 3HMJG 4UNKA 4XUGA 2X1TA 1GJPA 4MY9A 1KFJA 5HULA 4CQ9A 4FNPA 4L4LA 1KTNA 2B7PA 3MUXA 3C0JA 4WOQA 3UQNA 4JX6A 3L0GA 5D05A 1T0OA 4JTEA 4JIQA 4OE7A 3PM6A 2V9DA 1J2WA 1N55A 4MLJA 2P10A 1XDLA 1WA3A 1VYPX 3UWVA 5KZDA 1QR7A 5CPLA 3L68A 1ME7A 1VZWA 2PRHA 4Z0SA 4PEKA 3LM7A 1SSGA 3W1QA 1DV7A 3FYPA 2ZRUA 1XCFA 3AJXA 1DQWA 2ATMA 1FWWA 4JS3A 4O1CA 2Y7GA 1OK6A 4ICNA 1K8XA 3M1ZA 5DY3A 1TQJA 5HWNA 4IX0A 1ICPA 4QJ1A 1F5ZA 3O07A 5CKSA 3NQ2A 1SU5A 2W0UA 3HB9A 5BNKA 3L5MA 2YDAA 5LHFA 2J88A 5CPOA 1IXPA 4O17A 2EF9A 2ISSA 3GNDA 5FF2A 1EWEA 5AHNA 1YDOA 5FEXA 2YYTA 4J9JA 3M41A 3WK0A 4BK9A 4LU0A 2VEIA 3MW7A 3L67A 1IIHA 1TJRA 2WJZA 3FJ6A 5D33A 4O28A 4UTKA 2YZRA 4WQ6A 5F2LA 3PB2A 1RPXA 3GNNA 2OT0A 2NX9A 1H1YA 4FXRA 1OFDA 3LHUA 2ZA2A 1W0MA 3R12A 5DLCA 4YWIA 3W1LA 5BRBA 4DXVA 5G4WA 1WBHA 2BX7A 1BEUA 1VGAA 3PBWA 2VEPA 3DHDA 3W7MA 5K9CA 2JGQA 3FKKA 4K8HA 3S5OA 3NNTA 3HJZA 1Q6QA 2EHHA 3H55A 4YLWA 1FCQA 5DY2A 4RZ6A 4FX6M 4JEQA 3WJYA 2YW4A 3QSRA 3R5EA 4GUFA 4Y6GA 3W7OA 1A50A 1GVRA 4UTTC 5AC8A 3B8DA 3TA6A 3DU0A 2V81A 2PURA 3W7NA 4PL1A 3V1PA 1WBJA 4H4IA 1F7BA 1B4KA 1R2SA 1VCFA 4ZMGA 1EP3A 3CPRA 2FTPA 5AYZA 3B0PA 4Z1BA 4JICA 3G1DA 4LOCA 4JYDA 1UASA 3UWYA 4KWWA 1RV8A 3VFLA 4DO6A 4ZQPA 4FHAA 4JX5A 5HINA 4NJJA 1TPEA 3QZEA 1K8ZA 4AXKA 1Q3NA 3NQFA 3A24A 3W1TA 3DXIA 3S5YA 1X1OA 4W9TA 1YLVA 2PCQA 2Z6IA 3ZS4A 1JCXA 2P0OA 3SSJA 1N7KA 1VJIA 4JTHA 1FDJA 4AWSA 3UY7A 4WY0F 1W1ZA 2JKPA 2A85A 5F1VA 4O1DA 3UPWA 3HG4A 3P82A 5LZLA 1B9BA 3NXFA 1QPOA 4M6VA 1ZY9A 1FDZA 1DJNA 4TMBA 4LUJA 4MUZA 2HS8A 5HWJA 3N34A 3C4UA 3DZ1A 3SY5A 4LV9A 2G96A 5F2IA 3UXDA 1AG1O 4ZQOA 1XKYA 3SW6A 1PL9A 4NXSA 3OIXA 1X6UA 3A5VA 3IEBA 1W37A 4AWUA 2CLLA 2BZNA 1NEYA 5IBXC 3N9SA 5DBTA 2QUVA 1GQNA 2ZFAA 2NLIA 3PUDA 1P0KA 4DF1A 3FOKA 3A5FA 1DHPA 5C54A 2H8ZA 1JJKA 4UTLA 1YTKA 2H3DA 3M47A 4HHPA 1OJXA 3S5NA 1FX6A 2RHGA 1ZFJA 2WNQA 1YPIA 1JRCA 5BMXA 2WPBA 3LERA 2GVGA 3HG5A 3LI1A 2NWSA 1EP1A 3G22A 3F4WA 5FEZA 5DN1A 1EUNA 3UY8A 2WOQA 5CPMA 3HGJA 3P7YA 4Y96A 4RLIA 5HUOA 2NZLA 1W3IA 3BW4A 3EX6A 4OQVA 3C2VA 3HG3A 1B4EA 2E6AA 4RR4A 3STEA 3PUOA 1LM1A 1TCDA 3TSMA 2QCGA 4H6KA 1FBAA 3Q58A 4IMCA 1DBTA 2C18A 3OEXA 5G2WA 1FCBA 2J24A 1TTJA 4MYXA 4GE8A 5KZMA 1QDSA 2V5BA 3S1UA 3W7JA 4FF7A 4PCFA 4A2SA 1XUUA 2AAMA 3LXCA 5DCDA 4JR5A 1FWTA 2OZ0A 3N2MA 4MVAA 5AB3A 2TSYA 3LV6A 2ZTJA 4MZ8A 4OT7A 2WO5A 3THAA 5HWMA 2QJHA 1AMKA 2D73A 1TTPA 2ZZ1A 3TIMA 1OF8A 1JCJA 1OFRA 3JRKA 3O15A 1VCVA 4JTJA 4N9CA 3TSDA 1SW0A 1V5XA 3W7EA 4NNCA 2V0TA 1QPQA 1ICQA 1OHLA 1JQXA 4UFKA 2ABAA 1JQVA 4C1LA 5DBUA 4I7WA 5C2XA 1XXXA 4TMCA 3G8RA 4DF0A 4NX0A 2CLHA 2A7RA 3N3MA 1GTHA 5D2XA 4BR1A 1KFKA 3FEMA 1GZGA 4UTHA 2H6RA 3P8JA 1H62A 2VC6A 1DL3A 3GAKA 1W31A 1QWGA 3TC7A 3MP4A 1BTMA 1IXNA 3W22A 4A2RA 4BWLC 1X7FA 1X8FA 3P61A 4DPPA 4E0CA 2C19A 4DO4A 3QYQA 3TNOA 1RR2A 2A2IA 2W79A 3EWXA 3CT7A 3FYOA 3KVKA 2V8ZA 4NJIA 1ZHAA 4M19A 1JUKA 4CNOA 4CCDA 1ICSA 1VR6A 1GVSA 3C3NA 4HNVA 3TFXA 1RQHA 4UTWA 3FS2A 4CQ8A 3EXSA 3EX3A 4JTUA 1SSDA 2ZRWA 4UNLA 4OHQA 4JX4A 1T99A 4FNRA 3RLVA 2I9EA 3ATZA 2ZZ5A 3LCLA 4NUWA 3BARA 2CW6A 3W1RA 3T4CA 1PHWA 3QQ0A 5AN7A 2NX3A 3S5ZA 3A9IA 2G97A 3TK7A 3H53A 1ZENA 5T26A 2FPTA 4FNQA 1W8SA 3KVJA 1LBFA 4LRSA 2GJNA 2CLKA 2X2GA 4S2BA 3QQ1A 5I3IA 5L9FA 4IJBA 1NF0A 4PC8A 1GYNA 3UD6A 4TR9A 5I3JA 1H50A 1Z41A 4H3DA 3S1VA 3U8GA 3DGRA 3GR8A 3HBLA 1FXPA 2H3BA 2DJXA 5MHBA 4GUHA 5EMUA 1KM1A 3LLFA 4MFDA 2A6LA 2E5BA 4MLRA 3HF3A 3LXAA 4UMAA 3BPWA 3WJSA 1TQXA 2PE4A 3BLEA 3NL5A 3EWWA 1EA0A 1ZAJA 3UXAA 1HUVA 2Y70A 3T55A 3GDKA 2FJKA 3DFPA 5G5IA 3B0UX 4EVZA 3P8IA 3DFQA 2X30A 1GVOA 3P5YA 4LY8A 3W7DA 3GIYA 2GQ8A 5AHLA 4UFHA 5HJLA 2W6RA 1S5TA 1TREA 3RMJA 2Y61A 1JRBA 5EKYA 3NL3A 1AL8A 1XM3A 2QCHA 3IVTA 1H7NA 1KBJA 1M7PA 2WNZA 2JKAA 3C56A 3P74A 3SGZA 1GYLA 3HO8A 5AHMA 2EGZA 5F4XA 3MHUA 4NQ1A 4AHQA 1WV2A 4LC6A 4FEZA 4JDYA 1ME8A 3NR0A 1VQTA 4IXXA 3RLUA 1TPFA 3EWUA 1O5KA 5AFDA 4CLMA 2X1SA 3TX9A 1IGSA 4M7SA 1OFOA 3CIWA 3QMRA 1DKWA 1ZALA 1A5CA 1FCUA 3CB8A 4IMGA 1UBSA 4N6EA 5GVJA 3K30A 2WQPA 2O7QA 2YYUA 3RFAA 1EUAA 1G7VA 3BLFA 3FFSA 4O1BA 4Z1CA 4E2DA 4OGZA 1NSJA 3DBPA 3TUUA 3A21A 3BW3A 4LC8A 3OVRA 3TV8A 2E68A 3RK8A 5E1QA 4HPJA 3W1AA 2PRLA 3RNDA 5LSMA 1FXQA 3FIGA 1SZFA 1CX9A 2RDTA 3O16A 4YCOA 3IV3A 1ZCOA 4WY0A 3MI3A 3R89A 3MHFA 5DCBA 3FKRA 4ADSA 3GZ3A 5AYXA 1TJPA 4TIMA 3S6DA 1YADA 2GJLA 3LTPA 4MZYA 1XBYA 4O4VA 2ZRVA 1I2NA 2ZZ6A 1WXJA 3QSTA 2QEZA 1QCWA 3NQAA 4XWUA 3UNDA 4JDBA 1QO5A 2Q3RA 3F4NA 3W7IA 2QCMA 2VENA 2HSAA 3C2RA 5TQLA 1OX5A 4JY9A 4ADTA 5D04C 3B03A 1XBVA 3O63A 1Z42A 3W2NA 4E38A 3Q94A 3O6DA 3LHVA 4O57A 4Q33A 4IMDA 3QMSA 1I2QA 5TIMA 5LGZA 4L4MA 1KFLA 2Z1BA 4NNBA 2JKEA 1B3OA 4AEOA 1H5YA 5EBUA 3CLMA 1SZEA 4MY1A 3NL2A 1ZAIA 4ZQRA 4NJGA 4S2CA 1DJQA 2I1OA 4JN6A 1C29A 5I3FA 3QC3A 5LNRA 2C14A 4WJEA 5AHIA 2RDUA 4AHOA 2O7SA 1G7UA 3LCGA 1THFD 3TSBA 3PR2A 1PCWA 3GDTA 3EWYA 4UFLA 2DP3A 2G5WA 3PUEA 4XQ6A 2CZFA 2R8WA 1OFEA 3S1WA 4NJHA 1MEHA 1W5OA 2JK2A 3OBKA 3M16A 3W7KA 4ZZ9A 3TQ0A 3HG2A 3LX9A 1O95A 3T78A 4OV4A 4LVGA 2TPSA 3W2LA 3C6CA 1LOQA 3HGOA 1LLWA 1LORA 4FIRA 4MY8A 1RZMA 3STFA 5D03A 3LHWA 1UB3A 2WKJA 1KTCA 3W23A 1FCVA 5KITA 3EX2A 3W2JA 4NJKA 3BGJA 4AB4A 5E93A 3IIPA 4P2VA 4WD0A 2A7NA 3KRSA 2H8XA 1VYRA 1OFBA 5AOUA 1JR1A 3W7LA 5LNWA 1OYCA 4JTIA 3G3MA 5U7SA 3GXPA 3W1UA 4KFNA 2KZHA 4O50A 1EEPA 1TTQA 3TKFA 1P0NA 2NX1A 4HSOA 3PBUA 3UWWA 2FIQA 3G0UA 3QH2A 4ORIA 1Y0EA 3G1VA 3STGA 3M7WA 4XZ9A 5EA9A 1Q45A 4BFAA 4RXFA 2VEKA 3PAJA 2A0NA 1QFEA 4LV4A 1JULA 3HOJA 2NXGA 3ZFHA 3L66A 3W1PA 3HGRA 1SO6A 4FXSA 3UWUA 4O11A 5KSWA 4ALDA 3N14A 4MIMA 1WOAA 4LVAA 4MJZA 4B5NA 5L6UA 4AF0A 3MJYA 2E6YA 4UUIA 5CPNA 4LUIA 3M5YA 4LS2A 3H54A 1DVJA 3Q2DA 3OG3A 3QPZA 3LRMA 3P67A 3G1XA 3W72A 4UMCA 4HNUA 3W85A 1C8VA 1H7OA 2B7OA 3E96A 4N4PA 3UZJA 3L0NA 1F73A 1RQEA 3L5AA 1QOQA 4ZQMA 3NZRA 4ZVJA 3LOTA 3DENA 1YDNA 3E9AA 4GBUA 2ZDRA 2CZEA 1EIXA 3NQEA 4OV9A 4UC5A 2RH9A 1FY6A 3JR2A 4NNAA 5G1YA 2QCFA 2DORA 2Y63A 4N9EA 1U5JA 4CCCA 1JUEA 1W5NA 1TPUA 4K38A 1GVFA 3BGGA 4TO8A 3W86A 5AHFA 1VLWA 3NQ6A 2V2HA 3W87A 2Y6ZA 4KWVA 1MSSA 2BTMA 5EL1A 1G4PA 1K8YA 2CLOA 3KFTA 3W83A 3MBFA 4IXHA 5F4SA 3C2EA 5FF4A 3NL6A 2PRMA 1IXOA 3IIVA 1I2PA 1L6WA 5FF0A 4O10A 1KBIA 1XI3A 5CG7A 2X16A 3TW6A 1UCWA 3E49A 4I9AA 3SFKA 3FJLA 1TPDA 3L2IA 3EWBX 1AL7A 4K36A 1DORA 5EYWA 1PIIA 2FPVA 2DU2A 5BMWA 2QCNA 3QMTA 1XBXA 1ZAHA 2C1HA 1TPWA 1NAL1 2ZYFA 3W71A 2Y85A 4QAIA 3NA8A 3VE7A 3IGXA 1HTIA 2PC4A 1QOPA 3OA3A 5I3HA 3WK3A 1WDWA 1E51A 1MZHA 3PBVA 3FA5A 3GK0A 4EIVA 3PG9A 4WY0B 2CLMA 2Y88A 3VNDA 3BVJA 1YXCA 4QITA 2NV2A 1TRDA 1KLZA 2E5DA 4QISA 1GT8A 3PBYA 1F74A 3BG9A 3IVUA 1WAUA 5CGQA 2ZBTA 2C6QA 2QCEA 3QF0A 2QF7A 3LXBA 2GUUA 5K4XA 3BW2A 3QRHA 2R14A 1W3TA 1Q6LA 3G1SA 2V5LA 4UIOA 3NQDA 1TO3A 2RDWA 4FX8A 2NXIA 4NX5A 3LTYA 3NGJA 4E2BA 5C6MA 1TMHA 1YPFA 4LRTA 4ADUA 3KRZA 4FNTA 2QUTA 3W3OA 3W7HA 5D09A 2OX1A 4DO5A 4U28A 3EKLA 2C15A 1ZJIA 3NPVA 5A5WA 3TJLA 1SO3A 2ZA1A 1OABA 2E1DA 4RZ4A 3WJWA 2ZCGA 3IGUA 4TU1A 1O4UA 2WSYA 3TDFA 1TIMA 5DCEA 5D30A 3MO7A 3MP3A 1JCMP 4LS1A 4RCXA 2VFHA 3GXNA 3SIZA 4O15A 5K9XA 3SI9A 3LRLA 1PVNA 1N8FA 1T8XA 4O53A 2NXHA 3OVPA 3CEPA 1RD5A 2Z6JA 4OWGA 3EXRA 4K6AA 2ZZ2A 1G4EA 3DH7A 5H91A 4JYFA 3R2GA 1LLZA 2QAPA 1GOXA 1TSIA 1OFQA 2J9ZA 4GRSA 1LDCA 4G1KA 2IQTA 2QDGA 3PB0A 3O6CA 3ZR4A 1G6CA 3W1XA 1SPQA 1FQ0A 1OVDA 3C2OA 5TBOA 1G4TA 2YFOA 1XBZA 3LDVA 3USBA 3LRKA 2A1YA 3MWAA 4DQWA 3AO0A 2FB3A 4X22A 4LS0A 3KOFA 1ZNNA 2UV8G 1XFBA 4HNNA 3IVSA 3T44A 4IWWA 5AC6A 3L21A 3MHGA 4FNSA 1SW3A 1I45A 1TV5A 3TR2A 3M43A 2V30A 3P84A 3T7VA 2BLEA 2VKZG 5D02A 4WZHA 1P1XA 1K03A 4WOZA 3EB2A 4MFEA 1VPXA 4NU7A 2WSQA 2TRSA 1JCYA 1JCLA 3NVTA 4CNPA 1OX6A 3IIXA 4YCPA 3O1NA 4O52A 4Q4KA 4UFIA 2QDHA 4HSNA 3G18A 3HPZA 3NM1A 2NV1A 3WFAA 1KFEA 3KVMA 5AHEA 3KRUA 3W7CA 3MYOA 3W2UA 3NPXA 3WK1A 1EP2A 2H90A 2ZRZA 5EY5A 1MEIA 1YYAA 3SR7A 1J5TA 1LBLA 2B4GA 1CI1A 3KX6A 4QIUA 1W56A 1A5SA 3SECA 2Y89A 2Z2UA 4HN4A 4JTGA 4O19A 4OBTA 3NZ1A 3EX4A 2DZWA 1WOBA 4AF0B 4WUIA 1I8JA 5U4NA 3W2KA 1VC4A 1Q6OA 3ZWTA 3TMLA 4POCA 2QKFA 4U4MA 3G0XA 2X1RA 5E0KA 4JTKA 2OT1A 3S42A 3T40A 2QCCA 1X1ZA 3FLUA 1R2TA 2VFDA 1QPNA 4HNTA 5ABTA 3E12A 4TX9A 3NO5A 4N6FA 4A29A 1K7FA 3ABRA 1OX4A 1M6JA 2Y7DA 1O60A 4PH6A 1OG0A 2ALDA 4MZ1A 3SZ8A 1P4CA 3NM3A 2RFGA 4X2RA 2OMAA 2ZRXA 3B05A 1FWNA 5KINA 4HIBA 2WV8A 1IIGA 3GLCA 1V7YA 3DFOA 4LT9A 1GG1A 1S3HA 5D38A 4JD4A 3VI2A 2DZPA 4HKPA 3UZ5A 1UUOA 4RKAA 2X1UA 3M5XA 1A5AA 3L65A 3ELFA 3GR7A 3IIOA 3PWAA 3EX1A 4ONVA 1VCGA 3GVGA 4RJEA 6TIMA 2E6DA 4JTSA 4QQ3A 1K7XA 3PY2A 2F7FA 3TJXA 3KAOA 3I7QA 3O6YX 1F05A 3CWNA 3M0ZA 3LTSA 4IMFA 1LOLA 1MXSA 1H63A 1W3NA 1LRQA 3QM3A 4XBSA 4ZQCA 1KV5A 5SWUA 4JXCA 4AHPA 1B57A 3I68A 3TAKA 4Z0JA 2YW3A 3C61A 1KM3A 3I7RA 4NXKA 4UR8A 2R91A 3W75A 2YSWA 1OFPA 2Y7EA 4C1KA 5G4EA 3NAVA 1H7XA 3DKLA 2NUYA 4DBEA 3KHJA 2B7NA 3TU9A 1LBMA 2QCLA 3C8FA 1NVMA 4Z1DA 3B04A 3QJAA 4D2JA 3LHYA 5F2MA 4BI5A 2J9XA 2CZ5A 1K02A 5AYYA 2DJLA 4JYEA 4FIQA 3G1AA 3PVFA 4R53A 1GTEA 1C9DA 3NG3A 3W70A 4IPIA 3W84A 3S9YA 1EPXA 3LBCA 3W88A 5C55A 4IOTA 4UFJA 2DZTA 4IPJA 4K7VA 2JGYA 3NPWA 3VE9A 1EX5A 4M7TA 1MO0A 3INPA 2C3ZA 3UYCA 1TV7A 1JCNA 4RK8A 3LI0A 3MP5A 3PF3A 4O13A 1LTDA 3TAOA 4UCGA 3GB6A 3G24A 2GVLA 1ONRA 1Z48A 3GDMA 1HG3A 3GYEA 3JS3A 3TROA 3CTLA 3NOEA 3M44A 3R13A 5HUPA 2ATSA 2VFEA 2I14A 1UUMA 3A23A 1YTEA 1WYIA 1H7PA 2V2CA 3TXZA 3L5LA 2ZQ0A 5K4ZA 2YPIA 3NQGA 3KXQA 1SR9A 1AW1A 1P5BA 3W7QA 1F6KA 4CNNA 1VHCA 4RV8A 3EXTA 1LRTA 4LW7A 3GKFA 4O0ZA 4GC4A 1GPWA 2ISVA 4M5PA 3CEUA 1S5VA 2Y62A 5K7JA 3PSVA 1M5WA 3W7PA 3O8AA 4NZJA 4EWND 5CZSA 4LNYA 5HMSA 1SO4A 1FDYA 1HL2A 3O05A 3ATYA 4O18A 3UWZA 3LBMA 3LLDA 3PULA 3ABQA 2A4AA 3SGUA 3VKJA 2FFCA 1NF7A 1LZOA 4IMEA 3TW7A 4JGDA 2QCDA 4GWEA 4RZ5A 4N9BA 1VYSX 3DHFA 3RU6A 5C5YA 3YPIA 2P1FA 2AGKA 1WQ5A 4JIPA 4JTTA 4I7VA 1TPC1 1W5MA 4Z08A 1OYAA 1DOSA 2J27A 3O06A 4ZQNA 3NEVA 4MKNA 2R94A 4NZFA 4I7UA 4JTFA 4PL2A 4IX2A 4DPQA 3CHVA 4KFOA 1H7WA 1PHQA 4N9DA 1R47A 2E6FA 3QW4B 3TC6A 3W6YA 1L9WA 1W5PA 4DELA 1IF2A 3OVQA 2ZZ7A 2ZA3A 5FEPA 3SJ3A 2Q8ZA 1OF6A 2VFGA 1SQ7A 3BG5A 3B4UA 4MYAA 2NUXA 1LROA 2TMDA 3BLIA 3OHIA 2VOMA 1KM0A 8TIMA 3S8HA 4PFMA 2C0AA 3W1MA 5FF3A 3DFTA 2DZUA 2QAFA 3TFCA 1R2RA 1BWLA 3BV4A 4KFPA 4ZL1A 1KW1A 4X3ZA 5IM51 4FB7A 4ORMA 3G0SA 4A21A 1TV8A 2Q8LA 2LLEA 4R33A 3TXVA 4QSHA 4RXGA 3MI2A 3P60A 2J6XA 4S1FA 3LGEA 1KV8A 4DBDA 4XKYA 1L2UA 4K8EA 2FB2A 4GJ1A 5F2GA 2Q3OA 3MI6A 3TQVA 1FWSA 4LVBA 2J9YA 2BWGA 3BG3A 3QW3A 4R34A 1BKSA 1L6YA 2C16A 2TYSA 1OX4B 1LRNA 2HS6A 3THQA 3CC1A 2DZVA 5HQEA 5HR6A 4GXMA 4K7YA 4Y90A 5D2WA 2YXGA 2E77A 4M6QA 1JUBA 4XTIA 1SZGA 4FNUA 3TMQA 3ZWSA 3EKZA 1VH7A 2XFWA 3PSWA 2HTMA 3DI1A 4PODA 1KM6A 3L9CA 1VHNA 4QNWA 3B06A 3KVLA 3CM4A 2CLEA 4NT0A 5DXXA 2YX0A 2XN0A 5BW6A 4WX2A 2QR6A 3HQ1A 1HO1A 3LB0A 1D9EA 4LTSA 4IGHA 3NDOA 3STCA 3D0CA 2EAWA 3NQMA 3UPBA 3DFNA 1BWKA 1QMLA 4UTTA 4LVFA 2XN1A 4YMZA 4AVFA 4BI7A 4GNJA 2QUUA 5G1TA 1U83A 3DAQA 1I2RA 2GVJA 2YR1A 4X9SA 4LVDA 1SFJA 5K3VA 3NQ7A 4Z1AA 4O54A 1HFBA 3HPXA 4UTWC 3EEGA 3WK2A 1KM2A 1H61A 2JBMA 5F1UA 3I6RA 4UFMA 1KM5A 5LHEA 5FESA 3LCFA 2VEMA 1GG0A 4KKXA 3DI0A 4O14A 2FDSA 4DEFA 1VRDA 2B7QA 1W54A 4Y9AA 4UR7A 1Q6RA 3QPYA 4UMBA 3S0CA 1H1ZA 2DZXA 1LYXA 5F4WA 2A6NA 3R8RA 1AW2A 1S5WA 4AWTA 4UTMA 3HIJA 3P81A 1A5BA 3QEZA 4O4WA 4JNMA 3IIZA 3M5ZA 2OCZA 1A53A 4CQAA 3M6YA 1AK5A 3LCXA 1D3GA 3W76A 1LP6A 2VFFA 1GVQA 5CZJA 3W74A 3LHTA 2GQ9A 4A22A 4GUIA 4EF8A 1XDMA 3CIXA 2A7PA 4O16A 1TRIA 5I3KA 4XTDA 2G95A 1QNVA 1FUYA 2HMCA 3WJXA 1MEWA 5HNRA 4BI6A 4N4QA 3NQVA 3GXTA 1EWDA 2WSRA 3W7RA 3W9ZA 2CWNA 4RX0A 1FWRA 3VCRA 5IBXA 2RKXA 2GOUA 3W07A 1HO4A 1KFCA 4QM1A 1Z44A 1TB3A 4YXGA 2EKCA 4HPXA 4PA8A 1TTIA 5KTLA 2NWRA 3G8EA 1OYBA 3GDLA 1OFAA 2CLIA 3F1QA 4Y8FA 2YCEA 3E0IA 3W7GA 1G67A 4AH7A 2FPYA 2QJGA 3TQKA 1G69A 1KFBA 1DQXA 4K37A 1GWJA 1SZNA 3M9YA 3Q37A 1QAPA 4AMAA 5LNSA 1I2OA 1YTDA 2GPTA 5FI8A 5AC7A 2GQAA 3LCHA 1RVGA 1QPRA 2V82A 3G1YA 3PS7A 1UJPA 4QNEA 2E5CA 4EOUA 1O94A 2C13A 5BOOA 3G1FA 1AW5A 3P80A 1YDVA 2QCDB 4N2YA 5HR7A 4DF2A 4NVTA 4MJMA 5KMYA 3HGSA 2WNNA 2Y7FA 1GEQA 2QJIA 2A21A 5I3GA 2A5HA 5FEWA 3BO9A 5CSRA 2ZZ4A 4UTUA 1F2JA 3HPSA 2YGYA 3S1XA 3TCEA 2ZTKA 4O0KA 3N73A 2DZSA 4WXZA 1CW2A 1I4NA 2NUWA 2CZDA 2FQIA 7TIMA 5K9DA 3N2XA 2AQWA 2ZRYA 3G3DA 1K7EA 5G2HA 1ADOA 2FLIA 3C52A 5D32A 3N9RA 4Q32A 5DELA 1KA9F 1TYGA 2B0MA 1PCKA 1LCOA 3A22A 1R46A 4P61A 1ALDA 2VXNA 1TPVA 3ABSA 2CFFA 1J4EA 5D37A 5FF7A 5KZEA 2VFIA 4IQLA 3C2FA 5EPDA 3B0VC 3LV5A 5D2TA 4WXYA 1XC4A 4N02A 1TPB1 3I65A 1M7OA 1R30A 4BWLA 5H2ZA 3CU2A 1W5QA 2ABBA 3M5VA 3L0KA 1VS1A 3EWZA 3IRDA 3LCWA 4BF9A 1EB3A 3W73A 3MMTA 4FX7A 2V2DA 1ME9A 2VELA 1XL9A 3MBDA 4R7JA 6ALDA 3U2OA 4LWWA 4XKYB 3NPUA 1G4SA 2E09A 3G1HA 4GUJA 1SFLA 1XUZA 5J5RA 3PG8A 3ABOA 1F76A 3F03K 4UXDA 3GAYA 1OK4A 1IXQA 3P5ZA 3RF9A 3W2MA 1H51A 1PV8A 2ISWA 3QFEA 4IUOA 4MPQA 4YL2A 3DFSA 3PC0A 1SUXA 4PTNA 2ZZ3A 4O1AA 3UWQA 3LCIA 3IGSA 5J5DA 5DXYA 5CZTA 1KM4A 2CLFA 2EPHA 4MOZA 1PS9A 1F6PA 3N19B 1KLYA 4A3UA 4O12A
chains in the Genus database with same CATH superfamily
4G6CA 2OWXA 3H2NA 3MCNA 4JY8A 4GJIA 1DWAM 3TH6A 3GU1A 4V1XA 4OZOA 1QO2A 4RE3A 1CCWB 1ENUA 5A8MA 1VJZA 5BCAA 1DJWA 3V1HA 3GDRA 2PP3A 3VGBA 2HE5A 3SCPA 3TYBA 4URIA 1VEPA 4JTLA 3WLPA 5K2ZA 5D2VA 4OOUA 1GJUA 2GVEA 4GISA 1F8IA 4ZB0A 1UW9A 3WMCA 1VLIA 4DAFA 2VC9A 3D3AA 5BXRA 3PJXA 1SO5A 2Z28A 1T5AA 3NYZA 3BJSA 4L5ZA 2ZX9A 2DT1A 4L56A 3B3DA 2FMOA 1DEDA 3NQCA 1L6SA 2Y24A 4Q4RA 4UNKA 2X1TA 1GJPA 4KIRA 5HULA 4CQ9A 4AQLA 4L4LA 1ISVA 1DXEA 1TX2A 5JBDA 4F79A 4WSJA 1U1JA 3UQNA 4JX6A 3L0GA 3N18A 1SMAA 3FAWA 1XGEA 4JIQA 1UWSA 1UWIA 3FCPA 4OE7A 4AD1A 3KDNA 4UQEA 2P10A 1XDLA 1WA3A 4DJDA 3UG8A 2PRHA 3QR1A 3LM7A 1XCFA 2OYKA 4IIEA 5I06A 4KS0A 5BRPA 2Y7GA 1C3FA 4F4RA 3M1ZA 4LXFA 4GMEA 1JIBA 1Q8JA 3URBA 4IG2B 1MZRA 4HHMA 1E56A 4LCQA 1F5ZA 4PMOA 5ECVA 1PKMA 1J0YA 1SU5A 2PS2A 2CKSA 1DPMA 1IXPA 3HQPA 4PTVA 3SRFA 5AHNA 4PMUA 1Q6EA 3M41A 4L1WA 4LU0A 1NARA 5MKGB 3MW7A 2YB4A 3FJ6A 5D33A 3SADA 1TJ1A 1F8MA 4WQ6A 1IT0A 3GM8A 1S5MA 1CXLA 2DGAA 1H1YA 2VVNA 3U9IA 3LGGA 4C90A 2ZA2A 2J6VA 1W1B1 3V7PA 4PEEA 1HGYA 2PLCA 2BV9A 4Z2LA 3IUDA 1VGAA 2VC7A 2CEQA 2VEPA 3W7MA 2XWEA 3GNPA 4K8HA 1AZ2A 2PD5A 4F48A 1XIDA 5DY2A 4FX6M 2I5IA 1WDPA 1QRQA 3W7OA 3FYYA 5D9MA 2PURA 3W7NA 1B3VA 3V0SA 5CC7A 1W32A 3CPRA 3DHPA 1E15A 2Z1XA 3B0PA 1BVZA 2W61A 1KC7A 4US5D 3VFLA 4ZQPA 3T07A 3WH5A 2PF0A 4HQVA 1EHNA 1K8ZA 4AXKA 2WM0A 3NQFA 5C71A 3DXIA 3PZVA 1YLVA 1XYLA 1NWTA 3ZS4A 1JCXA 1GEHA 3F5KA 4AWSA 1KR0A 3QVQA 4O1DA 5DFAA 2J8GA 1B9BA 3FXYA 2J7FA 3AMGA 4M6VA 3H21A 1FDZA 2OGJA 4LUJA 4MUZA 3WNKA 3LPGA 3GHRA 2VCBA 3VNLA 3EMQA 4M56A 2H9AA 2FTWA 5F2IA 3WYZA 3CUZA 3BH4A 2AQOA 7REQA 3UESA 3K46A 3IEBA 2BZNA 3R8GA 1NEYA 2QUVA 2ZFAA 3WEMA 4DF1A 1WP6A 4H7ZA 5C54A 2H8ZA 1YTKA 4GIRA 1E4MM 4HHPA 1W3KA 2WNQA 4IQEA 3LERA 3LMZA 3SCVA 3HG5A 4TXEA 3CV1A 1IWBA 4K3ZA 3W37A 2RAGA 5DANA 1J0ZA 5HUOA 3MUZ1 2NZLA 3BW4A 4OQVA 3FEQA 3C2VA 1M04A 2CHOA 3NZPA 1B4EA 2E6AA 2QCGA 2O9OA 4H6KA 1IYXA 3BMWA 4CGTA 1DBTA 1BSLA 3WD4A 1FCBA 1TTJA 1W3HA 4D1IA 4GE8A 3S1UA 2V5JA 2DSZA 1XUUA 3LXCA 5DCDA 4JR5A 1FWTA 3SY1A 2OZ0A 4L9ZA 3DBNA 1BLIA 5D8ZA 3LPOA 2ZTJA 3QZAA 4MZ8A 4OT7A 4XZNX 2WO5A 5FJPA 2XJ7A 5HWMA 4MWAD 1XIJA 3UA4A 1KFWA 4M8UA 2FHFA 5AZ1A 1UIOA 2E1WA 3TIMA 3WF1A 2ZUNA 3A13A 1VCVA 3TSDA 1SW0A 3ZT6A 1V5XA 2PGEA 3I3DA 2VGGA 4GY1A 1QPQA 1BYAA 1D8WA 4C6FA 1J6PA 1JQVA 3GXMA 4C1LA 3H24A 1FWDC 4DF0A 5CG0A 4HCLA 1V3HA 4O1EA 2A7RA 3LZ5A 1KFKA 3P8JA 2VC6A 3SO7A 2G37A 1HJSA 3MP4A 1BTMA 2W63A 3W22A 4DPPA 3KZSA 1NELA 1EOKA 3EWXA 3CT7A 3FYOA 4WJXA 1ZHAA 1UWAA 3VKCA 4CNOA 1ICSA 4W7WA 3EOUA 1GVSA 3C3NA 3WLLA 3TFXA 1RQHA 1R7AA 3R79A 3SUWA 3ATZA 2CW6A 4EANA 1D8CA 3W1RA 1ZGDA 3T4CA 1WZKA 4GBDA 4NYUA 1JZ3A 4PYSA 4MADA 2VOTA 4GPNA 4JZ5A 4PMJA 2XH2A 1ZENA 3QXBA 1ISWA 5BU9A 5TNVA 1BD0A 2BY3A 1CEOA 3WBAA 1HIZA 2GJNA 1VAHA 3QQ1A 4QBXA 4INFA 1XLGA 1MXDA 2ZVRA 4QE4A 1Q7ZA 4BQ4A 1Z41A 3S1VA 3UG5A 3L4YA 3GR8A 1A0EA 1Q65A 5MHBA 3ZM8A 2J4GA 3LLFA 3CTTA 1BTCA 2PBOA 2CLPA 4Q4QA 1NIUA 2A6LA 1W1PA 2E5BA 1E9YB 4Q4SA 3WJSA 1BSIA 1TQXA 2QMJA 3EWWA 2ADAA 4PMNA 1ZAJA 3UXAA 1HUVA 2Y70A 2FH8A 2PTZA 3B0UX 4BZYA 3DFQA 4LCRA 4TX6A 1QW9A 2PLMA 3VNMA 1PDZA 3W7DA 1TR9A 5H6HA 1KRBC 4NZ1A 1S5TA 3RMJA 1V79A 4PCTA 4L65A 3OODA 1BQCA 4CUCA 1XM3A 2EG8A 3EGJA 1V6XA 3VM5A 3IVTA 2YXOA 1HNYA 2WNZA 4GIEA 3HO8A 4C6NA 4S3KA 2EGZA 2CZVA 3CZEA 4AHQA 1WV2A 1RY8A 5EMMA 2XIJA 4RE2A 1TPFA 4GO9A 5AFDA 2X1SA 4PCNA 4JNYA 1ZCCA 2H9AB 4EAYA 3DESA 4GXWA 5JBEA 3QR3A 1BG4A 1DIDA 3K30A 5C0QA 1UR1A 2C79A 7REQB 4C7FA 2YYUA 5LIUX 4AZ5A 1V7AA 2VGBA 1G7VA 3DERA 3BLFA 1XLMA 3OYXA 4PMDA 4XD5A 5A2BA 3A21A 1HP5A 2VZVA 2GQ3A 4LC8A 3RK8A 1TX0A 3TNBA 3IJQA 1IEQA 4QJ3B 2XIBA 3WBXA 2F2KA 1KBKA 3AOFA 3ZJ8A 3IV3A 4WY0A 1IZCA 4ICMA 1LF1A 1TZZA 3MHFA 1M65A 2QPUA 2BBFA 1MFVA 2VCCA 2WBGA 2WWCA 1Z32X 4JTRA 4MZYA 1XBYA 5FJUA 2ZRVA 3WLMA 1I2NA 1WXJA 1MQQA 3CGTA 3NQAA 5A2AA 3UNDA 4ZE4A 3AROA 1QO5A 1R3SA 2QCMA 2VENA 4GI8A 1E4NA 4JY9A 1XBVA 5T8GA 2PDNA 1FHDA 2VTFA 2VC5A 2F61A 3Q94A 1Q63A 3TQPA 4XK2A 5LGZA 1KFLA 1SJCA 2WVVA 4DM2A 2Z1BA 4AX6A 2JKEA 3MMUA 1NFGA 3BTNA 2DUAA 4MY1A 4XZMX 2XYLA 1VFFA 3V35A 1DJQA 3TA9A 5I3FA 5A6BA 3MZ2A 5AHIA 4AHOA 3VUPA 1EYEA 3AIWA 4YU1A 3PR2A 3FN9A 4NJHA 3OBKA 3T4WA 1MDRA 2Y0FA 3W7KA 3HG2A 2QYGA 4GGHA 4FLOA 2QVNA 1J5SA 3HGOA 3IUIA 1LLWA 4CU7A 4H6EA 3STFA 3ITOA 1P1MA 3LHWA 3T42A 2WKJA 3W23A 4GQQA 3ZLFA 1XIEA 4PUDA 2DV0A 5E93A 3KRSA 2H8XA 2VX5A 3BUVA 1A3WA 3AYTA 3MS8A 3T0DA 1UQZA 3CL8A 2YDQA 3G3MA 3M0LA 1I0DA 4O50A 1TTQA 4HZ7A 1XLJA 3GG0A 2HROA 3G0UA 3ZSTA 3QH2A 3FJNA 4ORIA 4W93A 3STGA 3FA4A 4LB4A 4F2BA 2QGHA 1AZ1A 2ZUMA 4EXQA 2A0NA 3V16A 3K4DA 2OSWA 4IIFA 4YTQA 3HGRA 4O8AA 1K9FA 1SO6A 4K8GA 1HKMA 4J4KA 2B81A 1YW1A 4ALDA 3N14A 1P43A 1KWKA 4B5SA 4H8VA 1S2CA 4UWMA 1I0BA 4AF0A 1KD0A 2EPMX 3SCUA 4US6A 3Q2DA 3OG3A 3U48A 1XQKA 3LRMA 4H9VA 2IQ0A 3G1XA 4XSMA 2IKIA 3A4AA 1K8CA 2BY1A 3HPAA 4HNUA 1UP3A 3W85A 1OC6A 4WKAA 4N4PA 2FGLA 1RQEA 4ZQMA 1Q2SA 2J77A 4PN2A 1C90A 3MT1A 4GBUA 3NQEA 4F40A 2RH9A 3UCQA 5G1YA 7XIMA 2NSOA 4WDWA 2DORA 2D3LA 1U5JA 3BAKA 1W5NA 2QS8A 4K38A 1Z89A 1J6OA 2BS9A 5I09A 1VLWA 1VFMA 1IR1A 2O0TA 1WE5A 2VVSA 2ZE0A 1RH9A 1MSSA 3BSHA 5EL1A 3N4EA 3KFTA 3MBFA 3SUSA 5DT7A 5FF4A 1J2BA 3QR0A 4M1BA 2BHYA 3WBEA 4QCEA 3PPGA 4MJ2A 1L6WA 2R1PA 1A3XA 1UCWA 4I9AA 2BVWA 3C0SA 1TPDA 3CQIA 3L2IA 3EWBX 3E2VA 1UZ1A 3AHXA 1PIIA 5BMWA 3QMTA 4YNGA 5CGMA 4QS5A 1E0TA 2J79A 4FXFA 4M24A 1BXBA 3CHCA 3NA8A 1V6YA 2W4XA 3ZIZA 1FWBC 3WMBA 3CK5A 5I0DA 4GVIA 5B80A 5M2FX 1UC5A 1UKPA 4WY0B 3LD5A 3NSMA 3BVJA 3DC0A 2AGTA 3C2YA 1KLZA 1L2QA 3IVUA 1WAUA 4V33A 1KCKA 2R14A 1TWIA 1Q6LA 5EB8A 4EXAA 4UQDA 2D2HA 1FFRA 4J28A 3TVAA 1W6TA 4FX8A 1CGXA 4PTDA 4GYPC 5C6MA 1E5JA 5IDIA 2WVVB 1SR0A 2WYSA 5D09A 2PZ0A 5D9OA 2AKZA 1H41A 2EJAA 3L4TA 2OXNA 2ZCGA 4I5XA 1TIMA 4DYKA 1K1DA 3MO7A 3MP3A 4MDOA 4LS1A 2JFEX 3SI9A 3GH5A 2Z1SA 3PHAA 3LRLA 1V6VA 3MUY1 4YVPA 3WDHA 4ZEPA 5CGTA 1K70A 4CVUA 3K4WA 4K6AA 3EWCA 2YBTA 2ZZ2A 1G4EA 1BF2A 1CXIA 3E0VA 5FAGA 1LLZA 2OKOA 1GOXA 4GRSA 3OHMB 2DT0A 1IGWA 2IQTA 2QDGA 3PB0A 1TG7A 3W02A 3A3XA 1UYQA 1SPQA 1FQ0A 3C2OA 2KX9A 1TZ7A 5HPCA 2DFAA 1G4TA 1F07A 2HWGA 4FS9A 4DQWA 4ZOCA 2I17A 3W27A 4X22A 4DJED 1NWSA 1MW1A 1F6YA 1JZ7A 4E8DA 4HNOA 3MCOA 2GJXA 3L21A 4FNSA 3GH4A 3EA1A 5D8WA 3TR2A 1GOIA 1XV8A 3M43A 4GINA 3T7VA 2YLAA 2BLEA 4ZFMA 1NDWA 4WZHA 1K03A 5DRIA 1O12A 2EJ1A 4JFUA 4MFEA 2DZAA 2OLSA 4NU7A 4GLEA 2GGJA 1J01A 4IFOA 1CWYA 1EGVA 3VD7A 3O1NA 3EDJA 4O52A 3HPZA 4HN8A 1GVIA 1RBOB 1KGXA 2I7GA 3KVMA 3WK1A 2V68A 1IE7C 2X7WA 2CITA 5EY5A 2V69A 2OB3A 1MEIA 3S1GA 3SR7A 1KGUA 4PZVA 3B8SA 3KX6A 3UXIA 4MGGA 5HPOA 3VX1A 3HU7A 2INFA 3QGAC 4O19A 2DZWA 1WOBA 4AF0B 4HP5A 4BQ3A 3OO2A 3TMLA 4U4MA 4JTKA 1E40A 4LYPA 1WKEA 1X1ZA 2JF6A 2IKGA 1NOFA 4ZB5A 3VOJA 3DDMA 3QKEA 3E12A 4TX9A 3NO5A 3ABRA 1OX4A 4H41A 4PH6A 4ZFCA 4Y9OA 2CHRA 3WLJA 4NSBA 2XIMA 3SCNA 4Z2KA 1P4CA 3N13A 3ARYA 1TE6A 3P6LA 4OTKA 3CIVA 4PBGA 1RAKA 1GG1A 3GS6A 2ON3A 3M0HA 1S5NA 4JIEA 1AODA 4X0NA 2XM2A 3WBYA 1QVBA 1VENA 1E0XA 2XVKA 3EX1A 4W87A 4PUMA 4D72A 2WZTA 4QQ3A 2F7FA 3GVWA 2CBUA 1LT8A 3KAOA 1MVYA 4LUTB 4HMNA 3OYZA 4CEXC 1ISXA 1Q6CA 3LTSA 4HVXA 1LOLA 5LIXX 1LRQA 3T0TA 4ZQCA 6ENLA 2CETA 1KV5A 4JXCA 1HKKA 1KQZA 4AHPA 3I68A 1SFSA 3E3HA 1FTXA 1HL8A 4V1YA 1N8WA 3UJRA 1DTNA 3CWHA 3PZNA 2FGBA 2WVTA 4WK9A 2P88A 2PA6A 3RJXA 1OFPA 2Y7EA 1KCZA 3PTMA 3UXKA 5CAKA 1W9PA 4DBEA 4ZCWA 4QCFA 3TN4A 3QN3A 3L4ZA 4LANA 5F2MA 4AZBA 2J9XA 2CZ5A 4C6DA 6CGTA 4JYEA 1V3LA 2XH4A 3ES7A 4R53A 1C9DA 2E67A 3MSRA 1DYSA 3F7JA 3W84A 3S9YA 1NDYA 2VMFA 5C9RA 1A5KC 3RPDA 2HISA 3TN3A 2JGYA 3NPWA 1EX5A 3UYCA 4DUWA 5CEWA 1JCNA 4RK8A 1CXHA 3UEQA 1UROA 2YOCA 1TKKA 2WK2A 4I8YA 3GYEA 3TROA 1XGDA 3M44A 3CASA 2VFEA 2I14A 3H7VA 3A23A 2A3CA 2PWDA 3L5LA 2ZQ0A 1BYCA 5K4ZA 3NQGA 1NP2A 3APYA 3SCQA 4CNNA 3U4AA 3IK2A 4RV8A 3EXTA 3R0KA 3FX4A 4O0ZA 1MYRA 2PDUA 3W7PA 2XISA 3EAUA 1AQHA 3MKCA 3TYAA 3O05A 2J8FA 3LLDA 1OWQA 4B9YA 4MUPA 2A4AA 5E0FA 2Z27A 1W9XA 3SGUA 4RUBA 2QCDA 4GWEA 2EPOA 5C5YA 4HGXA 3YPIA 2AGKA 4JTCA 4JIPA 2Y8UA 2D69A 1DOSA 1TCMA 3VINA 3ITGA 4EWJA 2R94A 1S46A 4JTFA 4IX2A 4DPQA 4Z2IA 4O0QA 5DMLA 3VYLA 4KFOA 4FF5A 3W0KA 4N9DA 2E6FA 3CUXA 3BXWA 4NG3A 3OVQA 3GW0A 5FEPA 3SJ3A 1BHGA 2VFGA 3KP0A 2AL1A 3VM7A 3BLIA 4W7UA 3BWWA 1L8PA 1QNSA 1XH1A 3S8HA 3EZ4A 5FF3A 4LQ1A 3K13A 2DZUA 3ABXA 3NTYA 6REQA 4ZL1A 1KW1A 3EEZA 4AZ6A 4FB7A 3GR4A 1WXYA 3AIEA 4WVXA 4H7CA 4ORMA 4F2TA 4A21A 1TV8A 5D9NA 1X38A 3AWNA 4R33A 4E3TA 4QSHA 4YTRA 2CNCA 1ITQA 3NWRA 3P60A 4AWEA 5HA7A 4DBDA 4H2CA 4X61A 4DUVA 4YS1A 3KLLA 2BWGA 5JBFA 3E6EA 2BASA 1OX4B 1D3CA 4FLSA 1TUFA 4K7YA 4Y90A 2P8BA 1SZGA 9CGTA 3TMQA 3BLOA 1KQYA 4B5XA 5CSYA 3QQWA 8XIAA 4GC3A 2X41A 3F5LA 2HTMA 4KMQA 5HNNA 3SRHA 3L9CA 2WJDA 3B06A 2VZUA 3BCJA 3VD3A 2PCEA 5DO8A 4X2PA 2ONEA 2ZE3A 4IMAA 4DYEA 3GTIA 4GA8A 4QGCA 3STCA 1RCXB 1F3EA 3UPBA 4Q7NA 3H2FA 3AIVA 3TTQA 4LVFA 1PTAA 2XN1A 4F0SA 3ARPA 2QUUA 1U83A 3LGDA 1V77A 4AY1A 1SFJA 1A80A 4PGLA 2VP8A 4GX9A 2HXUA 3EWDA 3T09A 2VEMA 4DBWA 4DNHA 3DI0A 2FDSA 1UR4A 1FH9A 2FJUB 1EXPA 2G50A 2JEPA 1Q6RA 2PDFA 1ZQ5A 4UR7A 4W89A 3RIKA 3WLNA 3VNIA 3HA1A 5A2CA 4Z17A 4C6JA 3R8RA 3S4TA 3RN6A 3H7RA 3F2DA 2E8YA 2OFJA 4TX8A 3DOPA 1SMDA 1U1HA 1OC7A 2BNJA 3QLDA 3GHTA 4IGNA 4MSSA 3M6YA 1AK5A 3LCXA 1V08A 1D3GA 2BY2A 1DJGA 2F9RA 3UYIA 5CZJA 3QHOA 1LQAA 3CZ8A 4AD2A 4RL3A 2A7PA 4O16A 5I3KA 2V3DA 1MEWA 4KCWA 1E43A 4Q8TA 1E3XA 3VCRA 2GOUA 1BVWA 1EX1A 1KFCA 2QPXA 4TV6A 1Z44A 3VKBA 3ZJKA 1XLEA 1DTUA 1HGWA 2NWRA 3VIGA 2WHMA 4PUEA 4QAWA 2PEVA 2XINA 2CLIA 1EYWA 3W7GA 4AH7A 2FPYA 2QJGA 4W8LA 4AD3A 2J74A 3N6HA 4CD6A 4GO8A 2IKJA 5M17A 1GWJA 1SZNA 1QAPA 2GPTA 3OTRA 1JNDA 1RVGA 3FY1A 2Y5EA 1BRLA 3PS7A 2BB0A 2OZTA 2E5CA 1PZ0A 2WLZA 1O94A 4GY0A 3C5QA 1Q6FA 5AVHA 4JQ2A 2FVMA 2C0HA 4ZE5A 1AW5A 3P80A 3AMDA 4JL2A 4IGMA 2QCDB 4N2YA 4NVTA 3TN5A 3SQMA 4MJMA 4B5UA 3CL7A 4NI8A 2WNNA 4TVCA 1Q85A 1GEQA 3H4WA 2CWXA 3T81A 3NSNA 2DT3A 3TCEA 3VNKA 2O9PA 1ITCA 1V8EA 1JD7A 3VD4A 4L80A 4NRRA 1TV4A 4XBJA 3USZA 1E6QM 1K7EA 2CESA 4RW3A 1ADOA 5D32A 2G3IA 1V6TA 1XYCA 1TYGA 1PCKA 4P61A 4IQJA 4OECA 2CFFA 1J4EA 2OR2A 3A6OA 1TV3A 5EPDA 4AC7C 1JGIA 4N02A 5CAHA 4BWLA 1CB2A 1PIFA 5BWAA 3TEVA 3LNPA 1VS1A 3EWZA 3LCWA 3W73A 4FX7A 1ME9A 1XL9A 3AIQA 3CQKA 4R7JA 3O2LA 1UD5A 4J27A 2ZIDA 3QOKA 5CH9A 4LWWA 2OELA 3G1HA 1RCOB 3OP2A 1F76A 1ZJHA 4DUOA 3FHQA 3KRBA 4XAYA 3QKZA 4LGXA 1GK8A 4XVEA 4IPLA 2ISWA 3QFEA 5HJXA 2QJJA 1P6BA 3M4HA 4YL2A 3IGSA 4FSAA 2NSXA 3URAA 4GI4A 1TWWA 1QK2A 2CLFA 2EPHA 3SQSA 3HTWA 1F6PA 3GNOA 1ZRQA 1IT7A 3PJUA 4M6PA 3CQ0A 1O1ZA 3E0LA 1WAWA 1PZ2A 1E73M 3KBWA 3ONBA 1YXYA 4HB7A 3WH9A 3I7SA 3S2MA 3P62A 4H7VA 4EF9A 1GOKA 1BWVA 3NQ8A 4UTIA 4YTUA 3WZ0E 1ZJAA 5CC6A 1HZYA 4ML9A 3U6WA 3GU2A 4F9JA 5CZ0A 1JZ6A 1XJBA 3RX3A 3LQLA 3W38A 2FZDA 4O8RA 4IFRA 2J47A 4XAZA 4UTJA 3KL3A 4HT3A 3SB0A 3ZVHB 5CSSA 3O7UA 4L64A 3E2QA 4JFTA 1YXDA 4IIGA 2FKPA 4JFSA 1D3HA 4IISA 2QVHA 3WF2A 4JBRA 3S6OA 4MB3A 3ANYA 3T2OA 1EDGA 2ZXBA 3EOOA 4OU1A 5D2YA 1PE1A 3R11A 4CD4A 1EC9A 3WD1A 2XN2A 1R8LA 3MYPA 5A8GA 1QNQA 3IV8A 4B3KA 4EAMA 3KHDA 5LKYA 1TPH1 3HMJG 1FKXA 4MY9A 3ZXWA 1FP9A 2QNEA 3KOZA 3UGVA 2YJQA 1Z6KA 4JTEA 1EHAA 3BAYA 1L6GA 4PTMA 4AIOA 2R24A 1VYPX 3UWVA 4XZLX 4KEVA 5CPLA 3L68A 3QY8A 4PTXA 1DQWA 1WDQA 2ATMA 2XWDA 2X0HA 5DY3A 1PX4A 2O9RA 3VZYA 3S2CA 3PAOA 4XZWA 1ZBVA 1ECEA 2YLLA 3LNMA 3MQTA 5BNKA 2YDAA 2J88A 7TAAA 2VX6A 4O17A 3N3TA 2EF9A 1M68A 3GBDA 4QP0A 1EWEA 1YDOA 3GH7A 2XDFA 3WK0A 4BK9A 4H9ZA 5HMFA 3L67A 4M3PA 1IIHA 1TJRA 1OIMA 4O28A 3B8VA 3QOMA 4H6QA 4FLQA 2OT0A 2VJXA 3U2ZA 3GG7A 5E5CA 1PXGA 1BRLB 2A3AA 1XSKA 3CHDA 3W1LA 4FPSA 3Q65A 1OT1A 1E1CA 5BRBA 2W5FA 1ZL1A 3CLWA 1P6CA 3E0FA 3FKKA 2X09A 1P0DA 1XCXA 3S5OA 1PEZA 3HJZA 1Q6QA 3PTDA 2EHHA 3DG3A 3ONCA 2HXTA 4FOKA 4NZ3A 3WJYA 4Y9MA 2XIQA 2YW4A 4GUFA 1MFUA 4UTTC 5AC8A 3B8DA 2PWVA 3TA6A 1ITUA 3EDKA 3EA3A 4WGXA 4PL1A 1Z7AA 2F6KA 3U5UA 1WBJA 1F7BA 1B4KA 1EJUC 1KXTA 3WNOA 3ANVA 4RZBA 5FKYA 1SZRA 1UWTA 1UASA 3MMWA 1MW0A 4FHAA 3VIKA 2UBPC 3AQUA 1X6LA 1NY1A 3FJ4A 1X96A 2DH2A 2BODX 1Q3NA 1AJZA 3WF0A 5AYBA 3GVVA 4LUYA 4W9TA 2PCQA 5PTDA 2Z6IA 1U2YA 3DG7A 2P0OA 3F4DA 2CXEA 1VJIA 2GYIA 3M7SA 3EB4A 3ITLA 4OOZA 2JKPA 5F1VA 3UPWA 4AZGA 4DZAA 1UUQA 3CUIA 4DJDD 4DN1A 3VMNA 1HJXA 2JIEA 1ISZA 1ZY9A 4L1GA 3QV7A 1FWIC 4Z2HA 3GFXA 3N34A 1A4LA 3SY5A 4S39A 1V02E 2G96A 1JD9A 4HA0A 4V27A 3UJEA 1AG1O 4ZQOA 1XHGA 2HNEA 5CPQA 3BQ5A 1GONA 3BCDA 3U2CA 1X6UA 1HKWA 3ARUA 1GHSA 1BFNA 1W37A 4XAGA 4LF1A 4KERA 5IBXC 2Z2BA 1A5LC 1UWQA 2MUCA 1OD0A 1W9DM 5AZ0A 2O9TA 2NLIA 3PUDA 4ERGA 4DIAA 4RE4A 4LNCA 1JJKA 4FZIA 3IAQA 4AFYA 4DJFA 4ILSA 3FXGA 1YPIA 1JRCA 3B9EA 2OYMA 2PODA 2E25A 3LI1A 4QSFA 3G22A 5FEZA 3LQGA 5DN1A 1EUNA 3UY8A 2WOQA 3G2GA 4HK6A 2ZX7A 3LLXA 3EX6A 3M0YA 1KRAC 3STEA 4PCSA 1LM1A 3TSMA 1RP8A 2C18A 3OEXA 4GD0A 2J24A 5JH2A 4KF1A 4DUXA 5LYRA 1W1IE 5KZMA 1TV2A 2V5BA 2AAMA 4IH3A 2YL8A 2PDQA 5AB3A 3RR4A 1O6IA 3THAA 3WQ6A 2QJHA 1AMKA 1ZS2A 4IUGA 3U5YA 1XSIA 4CQDA 1K9EA 4N9CA 4Z42C 2RJHA 4NNCA 1ICQA 1JQXA 1M1BA 4E2OA 4ZXOA 3MUAA 3MVTA 5HNTA 4I7WA 1XXXA 3I3EA 3QV8A 4AISA 2VO5A 3P2VA 5D2XA 2L5HA 3FEMA 3R25A 3ARXA 3B8WA 3GAKA 3VIMA 2RDXA 3WN6A 2YDRA 2ALRA 1US3A 1X7FA 3OIHA 3QGVA 4WGHA 4DO4A 2QMKA 3SQLA 1CECA 2E9MA 1QUMA 2A2IA 1AH0A 1RVKA 2OX4A 4G9PA 2GK1A 3MKVA 3KVKA 2V8ZA 3M6DA 4M19A 1HJQA 4W8AA 4K68A 1JDEA 4H9UA 4P8WA 4JFWA 2HV5A 4UTWA 1JZ8A 3T1GA 3EX3A 4JTUA 3H4GA 4JX4A 1T99A 3RLVA 2I9EA 3P0XA 4NUWA 2GSEA 3BARA 3NO1A 3NSXA 3AAMA 5AN7A 4EXBA 3U4FA 2G97A 2J7HA 1JDAA 1XYBA 1XQLA 1A5MC 2QIIA 3CPUA 1W8SA 2WKGA 2X2GA 4S2BA 1UWRA 5L9FA 2BOEX 4JN7A 3R43A 1RJPA 1O66A 3CMJA 5I3JA 4ASTA 1H50A 2VDHA 3GFYA 3U8GA 3DGRA 3HBLA 2H3BA 1MRQA 4GUHA 4AUBA 1KM1A 3TTSA 4MFDA 4AYSA 4UMAA 3KOWA 1V93A 1VFTA 2PE4A 3BLEA 3BURA 3NL5A 3A64A 4ZOBA 1EA0A 2PDJA 4UNIA 3T55A 4Q8VA 3SN1A 3PWIA 3FGCA 5HMDA 3NZGA 1WNOA 2PU1A 1GQLA 2GFTA 4JIRA 1DJYA 4GXPA 5AHLA 1MDLA 1TREA 2Y61A 2QJMA 3NL3A 3ZJ6A 1UA3A 1LWJA 1B30A 2QCHA 2PMQA 1GYLA 5A8OA 1Q7QA 4GYJA 4LAZA 3EOEA 1PZ1A 3V36A 2INZA 3PANA 1E9IA 4FEZA 4JDYA 1ME8A 3TOYA 1VQTA 3RLUA 4A35A 1WDRA 5LA1A 2P0IA 2VEFA 4D6CA 1OFOA 1E55A 1DKWA 5E6YA 2PTWA 1XIGA 4KESA 4IMGA 3WF4A 4BY3A 1N2VA 1UBSA 4Q8OA 5CLWA 4H8NA 1EF2A 3GXFA 4Z1CA 4E2DA 4OGZA 4AD5A 1TE1A 3DBPA 1R87A 3BW3A 2E68A 5E1QA 4CEUC 2PRLA 3RNDA 5LSMA 1FXQA 4JN8A 3V0UA 4MAZA 4GVGA 1ZCOA 4P8XA 3MI3A 3H4XA 3FKRA 1UQYA 1WUFA 2VGFA 4TIMA 3WX7A 2XTKA 1YADA 3LTPA 2WHLA 4O4VA 3OU8A 2ZZ6A 2QEZA 1QCWA 4JL1A 4JDBA 4US5A 2Q3RA 1IWAA 3IJLA 2HSAA 4HK7A 2F38A 5I03A 4ADTA 3PJTA 1V02A 2ZWZA 4OVXA 5D04C 1AJ0A 1HX0A 2JE8A 1C7TA 3WDRA 4HA4A 3MKKA 4O57A 4E2VA 5TIMA 1BGAA 4L4MA 3PZIA 4NZCA 4NNBA 1Q5MA 5M5DA 4ZO7A 2HCVA 1J11A 1H5YA 2G4JA 2OG9A 4F0MA 2CBIA 4NASA 4S2CA 3RJYA 1S3TC 1C29A 3FV9A 4TTUA 2C14A 3UJ2A 2O7SA 1THFD 2OWCA 3BAJA 4QDMA 3GDTA 3EWYA 2DP3A 4XQ6A 2DVXA 2CZFA 4GNKB 2R8WA 3S1WA 4NZ5A 1W5OA 2WB5A 4DVOA 2JK2A 4NIRA 4UZSA 1XIMA 4UB9A 4OV4A 1E0UA 4HPGA 4LVGA 3PBMA 4JQ3A 3MV01 3W2LA 3C6CA 2Q6ZA 1BGGA 1UR9A 2R6OA 2V3FA 4J7RA 1UZHA 4LBRA 3ALGA 4FIRA 3MSYA 3EX2A 2D22A 2GGIA 2GK1B 2A7NA 2REQA 3CZGA 1RK6A 1CGTA 1JR1A 4MNKA 2ACQA 1PZ3A 4KEZA 3RCYA 3GXPA 3N9KA 4KFNA 3KCOA 3K1DA 4PMYA 1S38A 2NX1A 1YNQA 4R88A 2DDXA 1R7OA 3M7WA 4XZBA 2MNRA 5EA9A 1E6SM 1Q45A 3PAJA 2HDJA 1JULA 3HOJA 4MWAA 5CPSA 2CC0A 4V28A 5A6KA 1X97A 4YPJA 3WLOA 3UWUA 2WPGA 3IACA 1WOAA 2OO0A 3UF9A 3NCOA 5E70A 5M1TA 4CN1A 5L6UA 1PYMA 4UQBA 6A3HA 2EEXA 3M5YA 4E3VA 1DVJA 3HJEA 1XYAA 3P67A 3E5PA 2UZ9A 3OPSA 1OEPA 4UMCA 1WDSA 4C5YA 1OBAA 4FR1A 1H7OA 2B7OA 1WDDA 3L0NA 1F73A 2Z7KA 3SGGA 4CNUA 1B9ZA 3NZRA 2X7VA 1QI2A 3VU2A 3L12A 3OGRA 2AL2B 4BEUA 3JR2A 2QCFA 3CS2A 3XISA 1JUEA 5A6BD 1M41A 1TPUA 1GVFA 3BGGA 4TO8A 3W86A 5AHFA 3NQ6A 2DQWA 2V2HA 5B7ZA 2Y6ZA 4B5TA 2BTMA 1XPGA 1X1NA 1G4PA 2CLOA 4DZ5A 3H6OA 3KW3A 5I5RA 4MDPA 5FF0A 4O10A 1KBIA 4YIWA 3E49A 2Y4SA 3FJLA 1UG6A 4PB3A 1AL7A 3ORWA 4A05A 1UMLA 1H2JA 1E4IA 5EYWA 4DZIA 2DU2A 1ZAHA 2PWUA 2C1HA 1NAL1 3W71A 2Y85A 4QAIA 1TELA 1DXIA 3NVDA 3OA3A 3BJTA 1YNYA 3T0AA 2QIWA 3VDBA 3FA5A 3GK0A 4EIVA 3PG9A 1KWGA 3CAVA 4Y9PA 3VNDA 1YRRA 1YXCA 2CXGA 1TRDA 3UCCA 1S2AA 3BAWA 4QISA 2DUZA 1GT8A 6XIAA 3PBYA 1F74A 1R3WA 1IQ8A 3VO0A 2QCEA 1M53A 3LXBA 4TV5A 3H8AA 1QI5A 3KEHA 1QI4A 1KRCC 1W3TA 1E70M 3LTYA 3NGJA 4E2BA 2W3ZA 1TMHA 4RNHA 1QBBA 4LRTA 7CGTA 3UXLA 3W3OA 1MW2A 2V3EA 3EKLA 3S9IA 4KCTA 1J10A 3VK5A 9XIMA 3ZJ7A 1FHUA 1KGWA 5A5WA 4AD4A 2PDIA 4RZ4A 3WJWA 4TU1A 2WSYA 5M3WA 3QYSA 3VIJA 4O15A 3EA2A 2ZUVA 4F8XA 4H1ZA 1QHPA 1XG4A 1RD5A 5J04A 2DIEA 3VIFA 4S3CA 2W27A 3DH7A 5H91A 3KBSA 2F6XA 4Y9NA 1NU5A 4BQ5A 4L7ZA 2ACSA 1TSIA 2J9ZA 3WG6A 3S9ZA 4FOJA 1U22A 1T7LA 1G6CA 3H23A 3VIPA 2IS7A 3NQBA 4C7DA 3VX0A 2A1YA 1O5RA 2IPWA 2NVCA 2FB3A 4W85A 3KOFA 1ZNNA 2OO6A 3ARTA 4IWWA 2REQB 3CUHA 1I45A 1TV5A 2DY3A 2V30A 3AJ7A 3P84A 4AY7A 1HJWA 4WOZA 5CXPA 4R7WA 1HF6A 4J2PA 3AS0A 2XVPA 3WMLA 4B16A 5A6AA 4PSRA 1JCYA 3NVTA 1P6WA 3IIXA 4A6GA 4ACYA 4HSNA 3G18A 3AXXA 3LS9A 3UR5A 2NV1A 1KFEA 2D2JA 4PB5A 4QE5A 3W7CA 3RDKA 1E6ZA 5CJNA 2DT2A 1Q8AA 2GGEA 4AW7A 1YNPA 1J5TA 3LSBA 1W56A 2PU0A 3N25A 4HN4A 3BLKA 3SY8A 2V38A 3NZ1A 4OBTA 3VUSA 1RA0A 8RUCA 4WUIA 1I8JA 2IQDA 3ZWTA 2QKFA 3G0XA 2X1RA 5E0KA 3S42A 5JU6A 2QCCA 4P5UA 1JPDX 5ABTA 2Z29A 3RU8X 1JNEA 4IIHA 4I6KA 3UU0A 3VAVA 1FP8A 1M6JA 1O60A 1DWIM 1ELSA 1VFOA 2D2GA 2E0PA 3P3BA 1K4GA 3NM3A 3MY9A 5GNYA 4X2RA 2XM1A 1FWNA 2XGZA 1PIGA 4LT9A 3ANUA 3WL0A 2ZDSA 4JD4A 2C8NA 5LXEA 1A5AA 1XW8A 2IPGA 3PWAA 4RJEA 6TIMA 1VCGA 3GVGA 2PBGA 4JTSA 1KB3A 2P3EA 4JHZA 4D6JA 4H9YA 1HN1A 3S2NA 3O6YX 3VNJA 3CWNA 4DNMA 3KOYA 3OLGA 4WDUA 2OEKA 1H63A 3ZZ1A 3TOPA 4KETA 4QFUA 4XBSA 3L7RA 1EPVA 5SWUA 4P7OA 1B57A 2EPKX 3QTGA 2PWEA 3UERA 2CIPA 4PRTA 1GW9A 3AI0A 2PFHA 1KM3A 3EMZA 4JNZA 1BG9A 2R82A 3H22A 2POTA 4E4PA 3B8IA 3W75A 3PPFA 1HKVA 5G4EA 3NAVA 1H7XA 3UW6A 2NUYA 5AY7A 1U1UA 4Q7IA 3C8FA 2QCLA 1WCGA 2O4QA 1UR3M 1CXFA 1FWFC 4D2JA 3LHYA 4QXIA 1K02A 5AYYA 1DWGM 5CBIA 4H04A 4JPGA 3KS6A 3N17A 4NILA 2JIWA 1POJA 3W70A 4WKFA 1G1YA 3MU7A 4IPIA 1B3XA 1XLKA 2X05A 1W8GA 2VQUA 5C55A 4UFJA 1VIWA 3VE9A 1QU4A 4LAUA 2C3ZA 3QBUA 3PF3A 4UCGA 4ATDA 3GB6A 4XX6A 3NDZA 4NZ4A 1ONRA 4D71A 4WDXA 3EKGA 3R8HA 3R13A 2ATSA 1UUMA 1YTEA 3CV7A 5A6JA 1NWRA 1UIPA 2PDPA 3G77A 3WQGA 4IM4A 2Z4GA 5HQLA 3RCMA 1ZB5A 1VRXA 4R7OA 1P5BA 3LENA 1LRTA 2G3NA 1WB0A 3ES8A 2ISVA 3LG3A 4JEJA 1CTNA 1S5VA 3GG8A 4DI9A 2PWGA 3SAZA 3K8LA 4M0XA 4PUUA 4QLKA 4NY2A 1LJYA 1DIKA 1SO4A 1QW7A 4PTWA 3LBMA 3H70A 3PULA 1FWHC 4A8LA 2EPNA 4JKLA 4XAPA 2FFCA 2VEGA 4IMEA 3TW7A 4A3RA 3PZGA 3WENA 1VYSX 4EX4A 3DHFA 3RU6A 2P1FA 1MWOA 4BJHA 4DJEC 1WQ5A 3T0CA 4JTTA 1W5MA 1R9XA 2EXOA 4ZQNA 4LAOA 3KM8A 4U3AA 5TD4A 3ZOAA 4MKNA 1X39A 2VRKA 4Y7EA 1Q6DA 3WNPA 1XLLA 3WQPA 3CHVA 2YZ5A 3T8QA 1R47A 3VCNA 4ML4A 3UPMA 2NQ5A 4F0KA 1QTWA 1W5PA 1IF2A 4DXXA 3IJ6A 5BZAA 1JPHA 1E5NA 1JFXA 1SQ7A 3DECA 3HURA 2Y1HA 7PTDA 4AEEA 3OHIA 4HZMA 2OEJA 3RX4A 1VFHA 1SGJA 4PFMA 4KWUA 4M81A 5IM51 3BAIA 4AXNA 3TR9A 3RHGA 4L6OA 4C6MA 4Z1YA 2J66A 2IMRA 3GXDA 2V63A 4C1NA 3CNYA 1A49A 3S5SA 4S1FA 1KV8A 3IGHX 4XKYA 7ENLA 1JXJA 1VEOA 2Q3OA 1H4PA 3TQVA 3QW3A 4E8GA 2TYSA 2HZGA 3THQA 1R3YA 3CC1A 1MUMA 1UZ4A 3KP1A 2DZVA 5HQEA 4GXMA 2E77A 4M6QA 4XTIA 3SFWA 1C92A 4LAKA 3DI1A 4Q4OA 3A3HA 4XV0A 3TYEA 1KM6A 5I23A 5FJTA 2PTXA 4YHGA 2W62A 2CLEA 5DXXA 2YX0A 3PUGA 2XN0A 2Z25A 2QR6A 4WDTA 2WMJA 1ZZMA 3BDKA 4IGHA 5HJYA 4C6KA 3D0CA 2EAWA 3REQA 3NQMA 5IHRA 1OGSA 4Q8PA 4HZ8A 3DFNA 3WBWA 1QMLA 2Z2AA 3CXOA 2VX7A 2PP1A 1OT2A 1HKIA 3UNTA 4X9SA 4LVDA 1YPXA 1X6NA 3AS1A 2JQXA 3OQEA 3NQ7A 3DG6A 1EF3A 4Z1AA 3EMCA 5IFTA 4UTWC 1ZJBA 3ARZA 1KM2A 1H61A 5F1UA 4HK5A 2YCLA 2HE8A 2VQTA 5FESA 1E9LA 2YIHA 5FACA 3ZMRA 3VKDA 4DEFA 1W54A 1U5VA 5GJMA 3ZLGA 1H1NA 3OGSA 5F4WA 3T2QA 2A6NA 4RNJA 3BZJA 4AWTA 4ATLA 5CC3A 3H7UA 4AX7A 4JNMA 1WXZA 3WQCA 2GUYA 2V3GA 5CJMA 2XFFA 3GVQA 1LP6A 5JVLA 1GVQA 3LHTA 4A22A 2OKTA 1VF8A 1GQJA 3CIXA 2G95A 5HATA 5HNRA 3NQVA 3ARVA 2YBUA 2CWNA 4F0HA 2PLJA 1ODUA 5AECA 3AALA 2WHJA 4GZJA 4QM1A 1J18A 4JKKA 1TB3A 2B31A 3I10A 2EKCA 4N42A 4HPXA 4DLFA 7ODCA 2E9LA 3BL3A 4HYRA 3GDLA 4JFVA 2E28A 4GI9A 3E0IA 1AVAA 2XUCA 3R6IA 4JTQA 2ZC8A 2DSWA 2IXVA 2KAUC 1QPRA 2V82A 4EOUA 1D2KA 1A0CA 3CV6A 3G1FA 3AYSA 3KBJA 4ERAA 5FJIA 3FVMA 1QK0A 2QJIA 1PAMA 2A21A 4IPPA 5I3GA 3OBEA 1PYFA 5BRQA 5CSRA 4G7EA 4DLMA 2EQDA 2YGYA 3GG1A 4C6EA 4YHEA 2DZSA 4IT1A 4WXZA 3WY1A 4IP4A 2NUWA 2CBVA 2CZDA 2NLYA 1OGGA 3HN3A 7TIMA 3N2XA 2AQWA 4RPQA 1B3YA 4PUWA 1CT5A 5DF0A 3N9RA 4J35A 3J7HA 3VXGA 1LCOA 1ONXA 2I5GA 1W3LA 2VXNA 1I1WA 4KQNA 1CB7B 5EU9A 5H8UA 1AD4A 4MHBA 2WJFA 3CUJA 1AFSA 3BOLA 2XFYA 3NEHA 5D37A 4L1XA 5FF7A 3UVIA 3WUGA 2VFIA 4HPNA 2OYLA 5CSUA 3STPA 3B0VC 2PSNA 1G9HA 2ZKMX 2J25A 5H2ZA 1UR0A 3CU2A 2RJGA 1XCWA 3BCFA 1EB3A 3MMTA 4MM1A 4MNJA 2P53A 5I07A 1OZQA 2V2DA 5I79A 4C1NB 1OD8A 4RV3A 4XKYB 5A6TC 3NPUA 1G4SA 1JZ2A 3GC5A 1E71M 3U7BA 4YYCA 3F03K 3VFCA 1DJXA 4UXDA 4R9XA 5H8PA 1Y5WA 1D7FA 3HFTA 4H00A 2PC8A 4IUOA 2BMBA 3PC0A 1SUXA 4FLRA 4PTNA 2ZZ3A 3W82A 4LB3A 4S3DA 2HRWA 1BXCA 3MVIA 3OA5A 5J5DA 5ABFA 4DWSA 4CD7A 1IR2A 5H1WA 2PGRA 2VR5A 3V75A 2JF7A 3GIQA 4K39A 3BK0A 1LOSA 2OWWA 8CGTA 4GUGA 2F84A 3WJZA 1YEYA 3GKAA 4GIYA 5LGXA 4Y2WA 5LNVA 3WLKX 5G2IA 5CC5A 3SJNA 4XD4A 4FO4A 1OCNA 2Z0IA 4GFSA 1T96A 3ZT7A 1K3UA 2FMNA 3LHZA 5DT5A 2X42A 1XLIA 2W9MA 2DUXA 4PMVA 4P7RA 4AAJA 2PP0A 4I9MA 2PDKA 1VPYA 3WLRA 3E02A 4WLCA 3CAWA 3N6QA 4J5NA 3BZGA 4ZO6A 1JGMA 2YCLB 1EC7A 2YFNA 5LNUA 3WKZA 1KTBA 3OZPA 4YVXA 5HQMA 4C60A 1GKQA 1Y7VA 4PUNA 4ROQA 2F8QA 4X9YA 4XUGA 1VBGA 4CNTA 1KFJA 2YB1A 3E5BA 4BF7A 4WJ8A 1KTNA 1UH3A 3C0JA 4YWSA 3T2PA 2WMKA 1QATA 3PPHA 1GJWA 2Z7GA 3PM6A 2V9DA 3LMYA 1N55A 4OUIA 3BLDA 4MLJA 2DW6A 3EYPA 2BY0A 3MPGA 4X63A 1VKFA 1QR7A 1XRTA 3NIYA 1POKA 1ME7A 4PEKA 4M29A 1SSGA 3FYPA 2YDSA 3AJXA 2PWHA 1FWWA 1DE6A 4JS3A 4XG1A 4PBFA 1JDDA 1RXOB 2YCIX 1OK6A 4ICNA 2R1KA 2YXXA 3UVAA 2GVYA 1XD0A 1NQKA 3RPTA 3GSMA 3ARSA 3O07A 5CKSA 4GKLA 3NQ2A 1KBBA 1KXVA 4HU4A 2GGGA 2JALA 3L5MA 3U7VA 1EXBA 1BYBA 5CPOA 1UR8A 4PB4A 4REQA 1SJBA 3IJ7A 3KBMA 3N15A 3RILA 5I02A 3N11A 2VEIA 4IF2A 5MF5A 4HSHA 2WJZA 3F2BA 4B3LA 1B1YA 1J9YA 5F2LA 3PB2A 1RPXA 5FIPA 2ZADA 2NX9A 3MUCA 1OFDA 2EO7A 3IPWA 2PDHA 3KS5A 3LK6A 1C7SA 1XLFA 2BOFX 3R12A 5DLCA 4YWIA 2P3ZA 4NP7A 4AVNA 2VWSA 2FVLA 2J8TA 4DXVA 1BEUA 4EPEC 1B31A 3VC5A 3PBWA 3ECQA 5K9CA 2GJRA 3NNTA 1W91A 3SRDA 4ATWA 4KEUA 4YLWA 4K2SA 1FCQA 3C0QA 2HVOA 5BOEA 1MXGA 4JEQA 3WLHA 4F0RA 2PWFA 4G7FA 1A50A 1EJSC 2BFGA 3S6TA 5CPTA 3RMEA 2QV5A 3V1PA 4H4IA 1R2SA 1VCFA 4ZMGA 1EP3A 3SCWA 3DUGA 3EDDA 2FTPA 2TAAA 5AYZA 5REQA 1P7TA 3G1DA 4OJYA 4LOCA 4F66A 3HM7A 3UWYA 4KWWA 1RV8A 4DO6A 4PUKA 2GDUA 3MC5A 4JX5A 1JF5A 2R1NA 1HT6A 1OY0A 4ES4A 3S47A 2HQAA 1UPPA 3T05A 1TWDA 1PPIA 3VNZA 2P50A 1UC4A 1OSEA 4ZTXA 1X1OA 1H5VA 5E09A 4JKMA 3W26A 3NFUA 2XVLA 2VT0A 1N7KA 2WXDM 1FDJA 5LA0A 4WF7A 3FSUA 1W1ZA 1CPUA 3WNNA 1V6UA 2G8ZA 2D24A 3HG4A 3TWAA 1QPOA 3KUMA 4TMBA 1HVQA 4NKCA 4KW2A 3DZ1A 3TYDA 1V3JA 3UXDA 5B7YA 2SFPA 1ZPTA 4D8ZA 5FSEC 3RM4A 3SW6A 4QLLA 2QXWA 4Z2GA 2YCJA 1XLAA 5ABFB 4DWSB 1WZAA 1XWYA 2QPSA 5DBTA 3A5FA 2GSJA 1C8XA 3DCPA 4HU8A 2H3DA 3M47A 1OJXA 3S5NA 4M51A 2WPBA 4N7QA 2OLHA 3EPMA 3BC9A 1VD6A 2GVGA 1EP1A 3F4WA 3ZSSA 5CPMA 3HGJA 3P7YA 4KCVA 1PJ9A 3FDGA 1UOZA 3LU2A 4MNLA 2DSVA 3IK4A 1FRBA 1WUEA 2GWGA 4XKMA 2ZXAA 3SCTA 5LIKX 4AIUA 1FBAA 2D0FA 3Q58A 4IMCA 1CBGA 4MYXA 1QDSA 1NDVA 1M03A 3N2MA 3DEQA 1ZP4A 4H83A 1LQ2A 4GK8A 1AQFA 1FWGC 1EJ7L 2D73A 1UZDA 1TTPA 3C0LA 1ESWA 1RSCA 4JQAA 3WLIA 3RO6A 1JCJA 1C8YA 3JRKA 3E2SA 4JTJA 1Y5VA 1TVLA 5RUBA 1UMYA 4AU0A 1OHLA 3UZXA 3A47A 1VPQA 5FSDC 1R3QA 1I75A 3GIPA 5DBUA 4TMCA 4S3EA 3G8RA 4ECLA 1UBPC 3WFLA 5H8MA 4C6IA 3IJ9A 1W1YA 1X7IA 3NZQA 1GZGA 4TVUA 4UTHA 2H6RA 3WQWA 4DAIA 3B9AA 3K5XA 1DL3A 4GYFA 3O0FA 3TC7A 1IXNA 1QT1A 4O1FA 4A2RA 1X8FA 4E0CA 1YKWA 2WSKA 5MKGA 2W79A 4NJIA 4GCXA 2D0GA 4H9XA 4CNSA 2UY3A 5EFFA 1VR6A 4NL1A 4REQB 4E4FA 4CQ8A 3SUTA 4TTGA 3EXSA 1O5QA 2ZRWA 4UNLA 4OHQA 4FNRA 2ZZ5A 3LCLA 3GTXA 5BROA 2YL9A 3FA3A 4HNCA 1UKQA 2VURA 4JHMA 3TK7A 5T26A 4GYPA 5BOFA 2WMFA 4DJFD 4LRSA 3IRSA 3ZVIA 1US0A 1LLOA 5I3IA 1XIFA 3DYMA 4IJBA 4I3GA 4PC8A 2O56A 1GYNA 3UD6A 5GNZA 3PZTA 4H3DA 5E9AA 5A69A 3PZQA 1V51A 5EMUA 3DYOA 3R7MA 5C7HA 3M0MA 1OZMA 3LXAA 3BPWA 1BXNA 1R9ZA 4ROPA 4UTFA 3N12A 2V67A 3LM3A 4QG8A 3DFPA 4QE1A 3P8IA 3MSDA 1H3GA 1J93A 1GVOA 3WQ5A 3P5YA 1HQTA 2PDCA 3OBAA 4EPKA 4G5DA 2WVSA 3GIYA 2OEMA 2W6RA 1JRBA 1B54A 1GGOA 4EPDC 3WUBA 1CDGA 3ITYA 1PBGA 3GYCA 3P74A 1M7PA 2JKAA 3E2RA 1HP4A 1Q2RA 4HA1A 2XZ9A 2FHBA 5AHMA 5F4XA 5IXEA 1V0MA 3MHUA 3U3HA 3NDYA 4NQ1A 4DJDC 4HNLA 4LC6A 4GGBA 2D20A 4IXXA 1O5KA 4CLMA 4L9YA 3TX9A 1IGSA 3CZKA 3CIWA 3QMRA 4ZOEA 5XINA 1A5CA 2NVDA 1FCUA 2XH0A 1MNZA 4GFIA 4N6EA 5GVJA 2NV9A 3WQ4A 2WQPA 4UQ9A 3RFAA 1NDZA 1P0EA 1RLDA 3AICA 5EGRA 3TUUA 2GLKA 3OVRA 3CYVA 4PRRA 3W1AA 5AKQA 5C2CA 4GYKA 3FIGA 1X98A 2RDTA 3O16A 1ISYA 3PNUA 4YCOA 2QUMA 4EKJA 4CN4A 5DCBA 4HHHA 4R3UA 4ADSA 3GZ3A 5AYXA 2WZHA 1XC6A 1TJPA 3O9NA 2GJLA 3WQVA 3B0YA 3QSTA 3RGTA 4EPBC 3AUJA 4EACA 3C2RA 3WDIA 3QPEA 5TQLA 2IKHA 4KGLA 2R1LA 1OX5A 3RUBL 3O63A 3AXKA 1Z42A 2R1MA 4H01A 1TZ9A 1IEVA 3O6DA 2WZMA 3QMSA 1QWKA 4GHRA 4AEOA 2I9UA 4WEVX 5DMMA 2VCAA 3CLMA 3TP4A 3R10A 3NL2A 1ZAIA 5DMNA 4ZQRA 4NJGA 4QJ5B 4PSPA 4XD6A 1EKOA 2X40A 2PDXA 3VKAA 2G0WA 4JN6A 2FZNA 3OLIA 3QC3A 3GRIA 3TC3A 3TTOA 1WKYA 2RDUA 1G7UA 1RLCL 3TSBA 4I9JA 1R6WA 4IIDA 2JEQA 4UFLA 3A4JA 1VEMA 2YBVA 3PUEA 1E6PA 3B9NA 1MEHA 1SJDA 1RJQA 3BMVA 4RDWA 3M16A 4MNMA 3SN4A 2WCGA 1L8NA 2X0YA 4ZZ9A 3TQ0A 2ICSA 2FZMA 4U10A 5LA2A 2ZUTA 1GOWA 3T78A 3HQNA 1G94A 1U33A 2FZ9A 2TPSA 1LOQA 2AAAA 1EQCA 2GGHA 3T08A 4MAVA 1RZMA 3V5OA 1ADDA 1KTCA 2WVUA 1XIBA 2J13A 4AB4A 5AC4A 4P2VA 4XVDA 1V3IA 2WBKA 2BG5A 4EK7A 4Q4PA 1F3WA 5BU6A 5LNWA 1OYCA 3LSCA 1E0WA 2CYGA 3AFBA 2PUZA 3R0UA 1OC5A 5U7SA 4J40A 2KZHA 4PMZA 1Q6GA 1P0NA 3HMCA 1QXLA 5LIYX 4GVFA 4XB3A 3CZLA 4HD5A 3UWWA 3SN0A 5EFDA 2FIQA 2GJXB 3VDGA 1Y0EA 1DQUA 3BOFA 4RXFA 2VEKA 4UOQA 1EJXC 1QFEA 4PULA 1S2VA 1AQ0A 3CT2A 3ZFHA 3RG6A 3L4VA 3OLEA 3T6CA 4HOZA 3WO8A 1QI0A 4L4PA 3NXLA 1XF0A 1GW1A 1B5TA 2A79A 1C8QA 4LVAA 3KTSA 4AG0A 3WELA 4L6HA 1UPMB 2E6YA 5CPNA 4LUIA 3FHAA 3MTWA 1RBLA 2A3EA 3PTKA 3QPZA 3CBWA 3W6MA 5I78A 2WMHA 5CBJA 3W72A 1JL8A 3VOGA 2PDGA 1XGZA 3WH7A 4Y8EA 2GZXA 3L5AA 1QNOA 3KCLA 3VTRA 2XGBA 1HKJA 4QROA 3VMPA 3DENA 2ZDRA 1KCXA 2CZEA 4UC5A 5FAJA 1XKJA 1FY6A 1V3MA 2HPMA 4L6DA 4NNAA 2D1ZA 3DFYA 3QV6A 4G8TA 5JUVA 3LYEA 4LUSA 1EIBA 1UHVA 1EOMA 2E3ZA 2P8CA 2Y63A 3M0KA 4N9EA 1WKDA 2C1IA 3HQOA 3S2LA 1R85A 4NF7A 3G1RA 1E1EA 4GY7A 5G4HC 4ZO8A 4KWVA 1RPKA 2INEA 3W83A 3C2EA 2PRMA 3MJMA 4WIWA 1KR1A 3IIVA 4CN6A 1I2PA 3D5HA 1XI3A 3CQJA 3A4WA 3TW6A 1M7XA 4S3BA 3POCA 5FJJA 5EMKA 3B8UA 2MANA 1DORA 2FPVA 2HBXA 1JEZA 1TPWA 3ITTA 2X1IA 2FH6A 1GOOA 3MUIA 3RCNA 3VE7A 4HHLA 1HTIA