3BVJA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with xmp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
257
structure length
257
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
publication title Crystal Structure of Human Orotidine 5'-monophosphate Decarboxylase Complexed with XMP
rcsb
source organism Homo sapiens
total genus 99
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3bvjA00
5EPDA 1PS9A 2P0OA 3TMQA 4GUGA 4JTFA 2CLIA 2ZZ7A 4JS3A 1YXYA 1EP3A 1ICSA 3Q58A 4EOUA 2E5BA 2FLIA 3G22A 4UTKA 3SZ8A 5DY3A 3WJSA 4YL2A 1HO4A 4CCEA 2YDAA 2ZZ4A 4LUIA 2WOQA 2ZRWA 3GR8A 4DO6A 5K9XA 2DZTA 6ALDA 4TMCA 1OK4A 3UWYA 1JCMP 2GVLA 3W3OA 1I2NA 4O50A 5AHMA 3HGJA 1J2WA 4LRTA 2NUWA 1LBLA 3DHFA 2KZHA 3N14A 1VYPX 4JR5A 2YSWA 1R47A 4KWWA 4Y9AA 5AYZA 4EF8A 1I2RA 3WK0A 5L6UA 3L68A 4M6VA 1MSSA 1FWTA 1XC4A 3U8GA 4AHQA 3TNOA 3TCEA 1GG1A 5BRBA 3Q37A 3M6YA 2PRLA 5LNSA 1WA3A 3W73A 3HGSA 3E0IA 3HF3A 4MY1A 5HWMA 3B8DA 1AMKA 3M47A 5CSSA 3KVMA 2P1FA 3IVUA 5CPMA 1OG0A 1GZGA 4UIOA 1ZNNA 3FEMA 3B0PA 5AN7A 4I7VA 3M5VA 4WXZA 1Q45A 4O1AA 4K38A 5G4EA 3H53A 2E09A 3CEUA 4NXKA 4QSHA 3GNDA 5AHLA 3L65A 2DORA 1F6KA 3I68A 3ZWTA 5CSRA 1OF6A 2B0MA 1SFJA 2NV2A 2JKEA 2Z0IA 4PTNA 2VFGA 2JK2A 4WD0A 3HPZA 2W79A 4YCOA 2PRHA 1WDWA 3KX6A 4QIUA 3B0UX 1HTIA 5EBUA 2A7PA 2ABBA 4LV9A 4PH6A 2NX1A 4LW7A 1TO3A 3G3MA 2ZRUA 3IGSA 1M6JA 2H6RA 1X7FA 4DF2A 3UQNA 1GQNA 3S9YA 1O4UA 3LRLA 4TR9A 1SO3A 3CEPA 2I9EA 3NNTA 1OJXA 3W1QA 1H62A 2ATMA 4FEZA 4ZQPA 2QCMA 4AHPA 2OT1A 3DFOA 3W6YA 3G0SA 1KW1A 1OFBA 3HG3A 2VC6A 4LRSA 4PEKA 3O07A 3TSBA 3W1TA 3WJXA 2X1UA 3W7PA 1YDVA 2GQAA 1P0NA 3OA3A 3OBKA 1EUAA 4XKYB 5K4ZA 2B7PA 3PUOA 1SZNA 1H7XA 3NPUA 5HWJA 1DBTA 5D04C 4K6AA 1SZEA 2J9YA 2BX7A 3HOJA 5AHIA 3MI2A 4BI7A 2HTMA 1SO6A 2HS6A 4LVDA 3RFAA 1KLYA 2A85A 3NQAA 2BSLA 3NQFA 2WSQA 1MZHA 1TPC1 3E02A 2Y85A 3LXAA 2UV8G 1OFEA 5HR7A 1XKYA 4NXSA 5AC6A 4LTSA 3CWOX 5HJLA 5H91A 3NEVA 1Z44A 1D9EA 3QMSA 4O11A 1K8YA 3P84A 3MUXA 4H4IA 3BLEA 1ME7A 5CG7A 1AL7A 1FUYA 4K8HA 1JCJA 5CGQA 3BW3A 2Y7EA 2H8XA 3LTSA 4FX6M 1EB3A 2NX9A 1ZALA 4ICNA 4ZQRA 3KHJA 1TV7A 3IIVA 2YXGA 3W70A 1F76A 3KRSA 2B7NA 3IV3A 1TQXA 5DBTA 4MFDA 2ZTKA 1GYNA 5FEPA 1LLWA 5I3FA 2ZRZA 1CI1A 4NZJA 1ME8A 3ZWSA 1C29A 2LLEA 4FHAA 4RKAA 3QMRA 1K7XA 3MP5A 4B5NA 2X1SA 3WJWA 5F2IA 3W1NA 3EWYA 1O60A 1T0OA 5BMXA 4FO4A 4Z1DA 2E68A 3A22A 3GXPA 3GDRA 4AHOA 2O7SA 3W76A 3LXCA 3MWAA 2G5WA 3U6WA 1EIXA 5D38A 1KTNA 2G95A 4ML9A 1SSDA 3CLMA 4DQWA 1HFBA 4WQ6A 4WOQA 1O95A 4K36A 2RFGA 5D02A 3M5XA 1IXPA 3OVPA 1C9DA 4KKXA 3N9SA 2J6XA 4YWIA 2C0AA 3EX4A 4P61A 3WK1A 1UASA 3PAJA 3UWWA 3BO9A 3LHUA 1YPFA 3W2KA 2VEMA 2BWGA 3DZ1A 1LZOA 1SQ7A 3GAYA 3BW2A 4IUOA 3W7HA 3G1DA 3SIZA 1BEUA 4N2YA 3EXRA 1DQXA 4JTUA 5LGXA 3T40A 5K2ZA 4XTIA 1P5BA 3NQDA 1XFBA 2JKPA 3USBA 2ZRYA 2NXIA 2WJZA 4NJGA 4OV4A 1DL3A 2NXHA 3QH2A 4PA8A 3QZEA 3NQGA 3W72A 1QAPA 1XXXA 1H50A 4H3DA 4RJEA 3W1MA 2FFCA 2A6LA 3O6YX 4TMBA 1FXQA 1J4EA 2QCDB 3THAA 2V0TA 3UZJA 4NZFA 3UPBA 4TU1A 4WXYA 5CZJA 1DHPA 1W31A 1IF2A 2FPTA 3GIYA 4JTHA 3W2NA 1XBZA 5DELA 1FX6A 1NF7A 3NGJA 3DHDA 1TTIA 1GVQA 4MY8A 1P0KA 5HMSA 4NVTA 4JNMA 1TQJA 1H61A 2ZRXA 5ABTA 1BKSA 4P2VA 4LVGA 3NM3A 3DFQA 2FIQA 5BNKA 3P5YA 1JUKA 3CIXA 1N7KA 2ZYFA 3T7VA 5KZMA 3KVJA 4O52A 4UR7A 1G4EA 3V1PA 1O94A 4ADSA 1PVNA 1MXSA 4W9TA 2CZEA 5EL1A 1O5XA 4UFMA 3F4NA 1TPVA 1TB3A 1A5BA 1OX4A 1B57A 2QEZA 3Q2DA 1NF0A 3LCLA 2TRSA 3ZR4A 4WY0B 4ONVA 2RDUA 3HGOA 1QNVA 2YGYA 4KFPA 2DU2A 1OFRA 2XN0A 2J9ZA 1XL9A 3GXTA 1RZMA 2DZPA 3IEBA 4JTEA 3IIXA 3G0UA 5T26A 2CZDA 3BG5A 4BI6A 2J9XA 3HO8A 4LC8A 3P61A 4QNWA 3G1YA 2NV1A 2J24A 3HJZA 3S1WA 1QWGA 5DCDA 2NZLA 4HT3A 4GE8A 4XUGA 1IXQA 2GQ9A 4U4MA 2CLKA 2VFDA 3DBPA 1K03A 4FNUA 4IOTA 1FCBA 3I7RA 4RXFA 3FA5A 3UY8A 3W7KA 1H1ZA 3UWVA 1BWLA 1EP1A 2YFNA 2YR1A 2G96A 2QR6A 2V5LA 1KBIA 2V2CA 3STEA 3F1QA 5KTLA 1K8XA 4AMAA 3UXAA 3W1AA 5HNRA 4JY8A 3W7JA 1L6YA 1TYGA 5EKYA 1TRDA 2JGQA 1SUXA 2JKAA 4O19A 2X2GA 1UB3A 2DZXA 2NUXA 5A5WA 3FKRA 3DFTA 1OX6A 1PHWA 3PY2A 1KV5A 2OJPA 3W2MA 1OK6A 2WNQA 1K02A 1H7WA 3VNDA 3L67A 1VH7A 4E38A 4JXCA 2E5DA 4BFAA 4YXGA 2TMDA 2QF7A 3PBUA 4N6EA 2V2DA 1LBFA 3TR2A 2VEPA 4QJ1A 3CQ0A 1Q6OA 3STGA 1TPEA 2QJGA 5D05A 4A2SA 3NG3A 1A50A 3MP4A 1FBAA 2R8WA 1KM5A 3P67A 2WPBA 3GLCA 1QO5A 2X1RA 3HBLA 1JRCA 3W07A 1B9BA 4O4VA 1XUZA 3MYOA 1XDLA 3BARA 1X6UA 1OFDA 3PUEA 3UWQA 1MEWA 5HINA 1EWDA 1GJPA 3MBFA 3N19B 3C52A 4LV4A 3FKKA 1DJQA 1WXJA 5LZLA 3W7MA 2OX1A 1GVSA 1H1YA 1NVMA 5C6MA 3B4UA 3PC0A 1O5KA 3BGGA 3L21A 1TPUA 4MLJA 5F1UA 1JCXA 2YFOA 1NFBA 4CNPA 2GOUA 4GRSA 2H3BA 3QW4B 2C3ZA 1N8FA 5J5RA 1H7OA 5IM51 3W7NA 4JEQA 4AWTA 1I2PA 1HL2A 5C54A 1TIMA 1TPB1 2WQPA 1QOQA 3UY7A 3PWAA 1M5WA 1HO1A 5EMUA 1SZFA 5CKSA 4ZMGA 3TQ0A 4JX6A 3NQVA 4DBDA 3SR7A 3W88A 1LDCA 3UYCA 2C14A 3LERA 1PV8A 4FNTA 5K9DA 2Q8LA 1W3TA 2V2HA 1MEHA 5A8GA 5FF4A 4PC8A 1KM0A 3G18A 2V8ZA 3W7EA 4MKNA 1WAUA 3FYOA 3NAVA 2I14A 1X1ZA 5I3KA 4O12A 1KFEA 2DJLA 4UTTA 4DF0A 2JGYA 5E93A 4MFEA 3OVQA 4WUIA 1XDMA 2DZUA 3PVFA 4HKPA 1QO2A 1WV2A 2E6YA 1LRTA 4DPPA 1G7UA 4XWUA 2C16A 1EWEA 3MO7A 3OG3A 3K30A 4J9JA 3GDKA 7TIMA 1OYCA 3QYQA 5BMWA 1ZFJA 2ZQ0A 1PL9A 4N4QA 2E6DA 3P82A 2GJLA 2ZCGA 3TV8A 2YYUA 4LUJA 2B4GA 4M7SA 4TX9A 4HNTA 5CZTA 4ORIA 3SGUA 2PURA 2FB2A 1IXOA 3P5ZA 3DXIA 3G1HA 4CQAA 1GTEA 2FTPA 5CZSA 3G24A 5AOUA 1EEPA 3SJ3A 1Z42A 1KM6A 4DPQA 3HQ1A 1H7PA 3PBWA 2R91A 3NDOA 4RCXA 4NNAA 2F84A 5L9FA 3HGRA 3C2FA 4G1KA 1JQVA 4UTMA 5I3HA 5CZ0A 1TPH1 3C2VA 1DORA 4ZQMA 3IGXA 3NPVA 1ZAHA 1IIHA 3HG4A 4JDBA 3IIPA 4NU7A 5F1VA 3RNDA 3UWUA 4LS0A 1Y0EA 3QC3A 2CLEA 3JRKA 3OIXA 1VCVA 2P10A 4AXKA 3TXZA 3RLVA 5G5IA 3LRKA 5FESA 1KM4A 3G3DA 5D09A 5D03A 3TUUA 1SW3A 2NWSA 3EWWA 1LRNA 3W7GA 3M43A 3KAOA 5D30A 1RQHA 4GNJA 3QQ1A 4RLIA 2R94A 3L66A 2ISWA 2VXNA 2NUYA 3LDVA 5DBUA 3QF0A 4BWLA 3SGZA 4N9DA 1IXNA 1TMHA 5AFDA 4ORMA 1RD5A 4MZ1A 4NQ1A 3TXVA 2V82A 3L2IA 3EXSA 1FCQA 3NOEA 4LVAA 1YYAA 1SPQA 2RH9A 5BOOA 4FXRA 2V9DA 4IMFA 3BW4A 1OX4B 4WY0F 1JUBA 4DXVA 3GDMA 1SFLA 4JTGA 3UZ5A 4EIVA 3CHVA 1LBMA 1JR1A 1K3UA 1QOPA 4NJHA 3H54A 2QDGA 3KFTA 4OU1A 1RPXA 3EX6A 1C8VA 1G4SA 1VYRA 1DKWA 5G2IA 3UPWA 1R46A 1L9WA 5LKYA 3A21A 3MP3A 4OE7A 2VEIA 1PIIA 1LRQA 3NXFA 4KFOA 3CWNA 4UFKA 1Q3NA 1SR9A 3U2OA 5HUOA 4JTKA 1RQEA 3CU2A 3G1AA 1G7VA 1ADOA 3N34A 2AAMA 4N4PA 2C19A 4M6QA 2PC4A 3W84A 3VE7A 1KFLA 5CPOA 5K7JA 3A5VA 4OGZA 2CLHA 1W5OA 2GVJA 5D32A 4R34A 4FX8A 3O6DA 1GOXA 4M19A 1OFQA 1PE1A 5D2WA 1XM3A 2QKFA 3S5OA 1GWJA 3O63A 3TA6A 1A5AA 4EWND 2A1YA 4A22A 3MYPA 3W7LA 5C2XA 3HG2A 3ELFA 5TIMA 2CZ5A 2Y89A 4MJMA 1TTPA 5G1TA 3UD6A 5E1QA 1MEIA 1QPQA 3VE9A 1F6PA 3N3MA 5F4SA 3F4WA 3GZ3A 3T55A 3LM7A 3BK0A 3B06A 1TCDA 5IBXA 2TSYA 4NX5A 3RMJA 3W1PA 1WBJA 4UR8A 3A23A 2CFFA 1HUVA 4FB7A 4MOZA 1GVOA 4UTTC 3T44A 3G1VA 1VZWA 1KTCA 1TV5A 1H60A 3W87A 4O15A 4IQLA 5DCEA 1QFEA 3EXTA 2OMAA 3N9RA 3GDLA 3TFXA 4JY9A 1EUNA 5G4WA 3C2EA 1QPOA 5KITA 3I65A 1M7PA 1QDSA 3GYEA 1FDJA 4L4LA 2RHGA 4CNNA 4FX7A 4H6KA 4DEFA 3O8AA 5LNRA 3I6RA 3MHUA 2PCQA 2QUUA 4OT7A 3BVJA 4CQ9A 1KBJA 4IXHA 2VFHA 3M41A 1YDOA 3CC1A 5BW6A 2YYTA 4A2RA 3V75A 1JCLA 2OT0A 3EX2A 4PFMA 3W7OA 4X22A 2ZBTA 1F73A 3I7QA 4X2RA 4IGHA 1G69A 4N9CA 1U5JA 3DI1A 1THFD 3E96A 1VCFA 4A21A 4XTDA 4CQ8A 1P1XA 4E2BA 1LOLA 1S5TA 3ATZA 4UFLA 3TQKA 4HNNA 3NQMA 3LHWA 4JTIA 4C1LA 4O18A 4GUIA 2WV8A 3M5YA 2A7NA 1I2OA 2WSYA 3CPRA 4UFHA 1KV8A 4E0CA 4UTIA 1Z48A 4PCFA 3PBYA 4O16A 1JVNA 5AC7A 5DN1A 2ZZ6A 2E6FA 2V30A 2ABAA 1OFAA 1GEQA 2C13A 4PL1A 3S42A 4UTJA 4PL2A 4DO5A 3T78A 5DXXA 1Q6LA 3I7SA 3TJLA 1ZHAA 2YPIA 4JYFA 1Q6RA 1ZAJA 1F74A 1TSIA 2H3DA 4MYXA 1RR2A 4BWLC 3IGUA 4Y90A 1LOSA 4GWEA 3CT7A 3G1XA 3G0XA 4R7JA 3RF9A 4OV9A 4O13A 3W2UA 2HS8A 3P81A 3QRHA 1ZCOA 4K37A 5AYXA 3TAKA 2G97A 3N2MA 2C6QA 1FWSA 3DU0A 3LI0A 4RK8A 3L0KA 1D3GA 4ZZ9A 3GKFA 1P4CA 3NQ7A 4KWVA 4BF9A 3NQCA 4NJIA 3GAKA 1WOBA 4WOZA 4K39A 3W1RA 3LV5A 1XI3A 1KM2A 4UNLA 5G2HA 4RV8A 3EWBX 3UNDA 1UUOA 3GXNA 4IWWA 3M44A 3ABQA 2E1DA 3R2GA 4K8EA 4ADTA 1MO0A 2PRMA 3VI2A 3DKJA 3EWZA 4O17A 1LORA 4HIBA 4MLRA 5AHEA 3THQA 2Y7DA 3NPXA 1V5XA 3PG9A 1OF8A 2XN2A 4JIQA 2ALDA 3PB2A 4HHPA 3P8JA 3E49A 1JRBA 3SI9A 1B3OA 4YMZA 2F7FA 3WFAA 4A29A 2XN1A 3LTYA 1UJPA 1AG1O 3FJ6A 1I45A 3NQEA 3FIGA 2TYSA 1SW0A 3QSTA 3GX9A 1R2RA 3FYPA 3C4UA 3NL2A 3QPZA 3YPIA 3R12A 1G6CA 4LS2A 3LCFA 4O14A 3C2RA 4QAIA 1H63A 4RX0A 1AW1A 3CIWA 4MIMA 3C3NA 2VEKA 3QW3A 3M16A 5F2GA 2BZNA 1FXPA 3TMLA 5TBOA 2BXVA 4AWUA 4Z08A 1NSJA 4AF0A 5KZDA 3A9IA 5E0KA 3C8FA 3LBMA 3LV6A 4GBUA 3BLIA 2CLLA 2D73A 3NM1A 4N9EA 1UBSA 3RK8A 1WYIA 1VJIA 3VKJA 2GVGA 3S5YA 3RLUA 2Q3RA 4U28A 1ME9A 4M5PA 1W0MA 3M9YA 4HSNA 3WK2A 5DXYA 5FF2A 5U7SA 1VHCA 1OX5A 1I2QA 3NYZA 2V5BA 3L0GA 5IBXC 3S0CA 4MZYA 4LU0A 1ONRA 2W0UA 1XBYA 4O1CA 3HPXA 2CWNA 5EY5A 3P62A 2VOMA 3NVTA 2ATSA 4HPJA 3BV4A 4UUIA 3W83A 3D0CA 2PE4A 1K7FA 3W86A 1L2UA 2RDWA 1DOSA 3LOTA 4JYEA 1W1ZA 4UTWA 1TJPA 4YCPA 4ZQOA 1SU5A 3NQ8A 3Q94A 3FFSA 1RV8A 1ZENA 2H90A 4FNQA 1FCUA 3FLUA 4O0ZA 3PULA 4M6PA 3QSRA 1JJKA 4NUWA 4GXMA 1ZY9A 1JUEA 4O53A 3P8IA 2QCEA 4NJKA 1VC4A 3NZ1A 5K4XA 1FWNA 2E77A 3LB0A 3LXBA 4UCGA 4O57A 4Z1BA 1J5TA 1W3IA 2WNZA 1F2JA 4LC6A 4Y6GA 3A24A 5SWUA 3KVLA 2QCLA 1JCYA 1VPXA 4MYAA 1BWKA 2B7OA 3TFCA 2Y61A 1S5WA 3O16A 3QQ0A 3S5NA 1LROA 5FF7A 3W7IA 3OHIA 4JYDA 3PSWA 3EEGA 2RKXA 2FPYA 4IMGA 3IIOA 6TIMA 4WZHA 3G8EA 3TDFA 3KXQA 4MJZA 3N2XA 3B05A 3LLFA 1B4KA 1YXDA 3SW6A 5DY2A 4RZ4A 1AK5A 4RR4A 2CW6A 2ZZ5A 3G1SA 2Y70A 3T4CA 4FNSA 1IIGA 5F4WA 5I3GA 4LVBA 3TC7A 2Q3OA 3LHTA 1QR7A 2Q8ZA 2A4AA 2EAWA 3HIJA 4ZQNA 3P7YA 3WJZA 4Y96A 1VHNA 1JQXA 2X16A 2EHHA 3NZRA 4JX4A 4HPXA 4EVZA 5LHEA 1QMLA 4UMAA 2A6NA 3MHGA 3QM3A 3IVTA 4I7UA 1I4NA 5HULA 4IMDA 4IPJA 3MJYA 1OFOA 1XBXA 3G8RA 2QCGA 1ZJIA 4IPIA 3BG9A 4UTHA 1N55A 1FWRA 4OQVA 5MHBA 1VLIA 2Z1BA 3EB2A 2ISVA 3L5AA 3NR0A 4DF1A 4DELA 1SO5A 1TJRA 2WO5A 2CU0A 2EPHA 3UWZA 3W7QA 2J88A 2CZFA 2QUVA 4LS1A 4X9SA 4ZL1A 2QCCA 1F05A 3B03A 3EX3A 2O7QA 1D3HA 2GJNA 3ABSA 3R8RA 3ZFHA 2DZWA 1GVFA 2ZRVA 1T8XA 4N02A 1H7NA 5HWNA 5KZEA 2EGZA 3TIMA 1AL8A 1T96A 3GDTA 3R89A 5G1YA 4UTLA 1XUUA 1H51A 4FIQA 2ZZ1A 1V7YA 4KFNA 5I3JA 3LHYA 1KA9F 1KM1A 5LNVA 1WBHA 1KFKA 1TPDA 4ZVJA 1HG3A 2VKZG 5AB3A 3GNNA 1AW2A 2GUUA 1TTJA 2VFFA 1JCNA 3PSVA 5DCBA 1ZAIA 1YTDA 1KFBA 4O28A 1ICQA 5GVJA 5HUPA 1GG0A 2VFIA 2WNNA 5K3VA 3PB0A 5F2MA 1CW2A 4O8RA 5F4XA 4C1KA 4AB4A 3BPWA 2VENA 3MI6A 1VCGA 2CLMA 4ADUA 3L9CA 3S1XA 4JIPA 1ALDA 3LHZA 1GVRA 3KRUA 2GQ8A 3W71A 3WJYA 5J5DA 3WK3A 4GFSA 3LTPA 4IX0A 3C6CA 4JTTA 2Y88A 4AAJA 5CPNA 3DFNA 4TO8A 5DLCA 3F03K 2QDHA 5I3IA 3DAQA 1OYAA 3TE9A 4NJJA 1L6SA 1SO4A 3IRDA 2X30A 3W23A 5KINA 3RU6A 2Y6ZA 1VLWA 1W5NA 2Z2UA 4RZ5A 3TROA 1QCWA 1E51A 3QEZA 3NL5A 3C0JA 3O15A 1R30A 1FDZA 1S3HA 3NL3A 3PR2A 3VCRA 3NA8A 1OFPA 3W7DA 5F2LA 1NEYA 3C2OA 1JULA 3O6CA 2ZZ3A 4PODA 4QISA 4JTJA 4UTWC 5LSMA 1W5QA 4WX2A 4JTSA 1VGAA 4E2DA 3DFPA 2W6RA 4L4MA 4EF9A 2VELA 4LOCA 5EA9A 2OZ0A 2NWRA 4HNUA 5AC8A 4GUJA 1H7RA 3MW7A 5FF3A 3M1ZA 1YPIA 4GC4A 4R33A 3EX1A 4IMCA 5FEWA 4GUFA 2E6AA 1DQWA 2ZA3A 5CPLA 1A53A 4OHQA 3JR2A 1VRDA 3OVRA 2I1OA 5FI8A 2QCNA 1VYSX 3TC6A 3PBVA 4O54A 1YDNA 2NXGA 3LI1A 2YW3A 4YLWA 3E9AA 3GKAA 3MMTA 1EP2A 1T99A 3TAOA 1KTBA 1TPFA 2A5HA 5FF0A 3M0ZA 3IVSA 3EKZA 1YTKA 3INPA 2QJIA 3LCHA 4UMCA 4XZ9A 4OBTA 4NNCA 4DO4A 3OEXA 5FEXA 2QJHA 4TIMA 4CNOA 3LGEA 2DJXA 4Y8FA 3HB9A 3TX9A 4CCDA 2Z6JA 4POCA 2A0NA 5D2YA 2QUTA 5LNWA 2ISSA 4K7VA 3P60A 1KLZA 2NX3A 3TK7A 3O05A 1TPWA 3TSMA 2C15A 4NX0A 3SFKA 4NT0A 4O10A 3ANYA 3NQ2A 3W85A 2J27A 5LGZA 3DGRA 1LM1A 4FNPA 1K7EA 4DBEA 1OYBA 1M7OA 4Q32A 1SW7A 5D2XA 3TH6A 3AJXA 3PM6A 4AF0B 3QPYA 3LCXA 2BLEA 1TREA 2VFEA 3L5MA 1EX5A 2FB3A 1OVDA 1FDYA 4O0KA 4BK9A 4LNYA 1DVJA 3KOFA 4Z0JA 4QQ3A 5HQEA 1YADA 3C61A 3SECA 1WX0A 4AVFA 4AH7A 4UXDA 3EWUA 3LBCA 2HSAA 4AEOA 4XBKA 4JDYA 3LHVA 1L6WA 1VS1A 1X1OA 3S1UA 2FPVA 4CLMA 4BI5A 4LVFA 2X1TA 2Y62A 3ABRA 2FJKA 2YCEA 3QMTA 2B7QA 1W37A 2AGKA 3PUDA 1TTQA 4S2CA 5LHFA 4MUZA 1G4TA 3EWXA 3MI3A 4Q33A 4QM1A 3HPSA 5FEZA 3W1UA 4UNKA 1LCOA 2A21A 4Z1AA 1W5MA 3UXDA 3QJAA 1QPRA 4Q4KA 1KFJA 3O1NA 3IIZA 1YTEA 3PG8A 3CM4A 1DJNA 2A2IA 1H5YA 1GPWA 4RZ6A 1XBVA 1A5SA 2Y63A 1IGSA 4Z1CA 5KSWA 4O4WA 1OHLA 1PCKA 1VQTA 4XBSA 1U83A 4WJEA 3DKLA 5K9CA 1TV8A 3TW6A 2CLFA 3NPWA 1WOAA 3KRZA 3LCGA 3TU9A 3N73A 3A5FA 1YXCA 3TJXA 1LLZA 3W7CA 4JTLA 3G1FA 4M7TA 3DI0A 3ATYA 4HN4A 5EYWA 3M5ZA 3TQVA 3W22A 1S5VA 5C5YA 2DZSA 3HG5A 2R14A 3L0NA 1KM3A 2IQTA 4IJBA 5H2ZA 1B4EA 4BR1A 1W3NA 4FNRA 2YX0A 1GYLA 1SSGA 1YLVA 1OABA 4XKYA 2EKCA 4JICA 3W7RA 2GPTA 1PCWA 1R2SA 2QCFA 2Z6IA 1UUMA 2ZDRA 4LY8A 1PHQA 3E12A 1VR6A 1W54A 5HR6A 2QAPA 3DFSA 4HSOA 2ZA2A 2DP3A 3HMJG 3MBDA 1UCWA 1G67A 4HNVA 1G4PA 3H55A 4JD4A 3GK0A 2FDSA 2Y7FA 3CB8A 5G2WA 3ZS4A 2C1HA 2Y7GA 3B0VC 4X3ZA 3LCIA 4UC5A 3S5ZA 2WKJA 3B04A 4O1BA 3STCA 4MY9A 1KFCA 4FF7A 5D33A 3QFEA 4RXGA 4I9AA 3NO5A 3GB6A 4QITA 4GJ1A 3FJLA 3GVGA 4NNBA 1W5PA 3M7WA 3DH7A 3BGJA 4S1FA 2XFWA 4GUHA 4FXSA 3P74A 2AQWA 4N6FA 4OWGA 1EPXA 3FOKA 4K7YA 3STFA 3JS3A 3NQ6A 5D2TA 4Z0SA 4AWSA 2C18A 3AO0A 4UMBA 1GTHA 4UTUA 1BTMA 2YZRA 1R2TA 3VFLA 1A5CA 3SSJA 3DENA 3LCWA 1ICPA 3ABOA 3LRMA 1LP6A 4LWWA 2FQIA 3CTLA 1I8JA 4IXXA 1FCVA 5AHNA 4MZ8A 3W75A 4A3UA 1AW5A 4LT9A 3R5EA 1FQ0A 4JN6A 4MPQA 3EKLA 2E5CA 1NAL1 4N9BA 2ZTJA 3C56A 2BTMA 1LOQA 2QAFA 4S2BA 3O06A 1ML1A 2A7RA 2EF9A 1W56A 1X8FA 2H8ZA 4ZQCA 4UFJA 5AHFA 2V81A 3PF3A 2WSRA 1LYXA 1TRIA 4QNEA 4IMEA 2ZA1A 5LNUA 3S8HA 2ZFAA 3W2JA 3PS7A 5TQLA 1F7BA 1RVGA 3S6DA 3BLFA 1QPNA 3W9ZA 5C55A 2JBMA 4R53A 4O1DA 3W2LA 4FIRA 3SY5A 1XCFA 1FWWA 1GT8A 5KMYA 3BG3A 4ALDA 1F5ZA 2QCDA 1FY6A 1K8ZA 2NLIA 4UFIA 1RQBA 4CCCA 1Z41A 4I7WA 5U4NA 1W8SA 3KVKA 3S1VA 4MVAA 4JGDA 2QCHA 2ZZ2A 3LLDA 1EA0A 3FS2A 1DV7A 3P80A 2YW4A 4IX2A 3MHFA 4D2JA 3TW7A 1CX9A 3W74A 5D2VA 5D37A 5AYYA 3TSDA 3LX9A 1Q6QA 8TIMA 3W1XA 2OCZA 3NL6A 2CLOA 3TKFA 4JX5A 1LTDA 1WQ5A 2HMCA 2DZVA 3GR7A 1SZGA 3W1LA 3L5LA 4XQ6A 2TPSA 3R13A 2RDTA 4WY0A
chains in the Genus database with same CATH superfamily
1PS9A 2J47A 4JS3A 2E5BA 4U3CA 3WJSA 4V15A 1HO4A 4XAYA 1E71M 3ZMRA 1GNXA 3N3TA 1WKYA 2ZRWA 4DO6A 5K9XA 1V6WA 4TMCA 1OK4A 1WKDA 3UWYA 2WZIA 3W3OA 5AHMA 1XYLA 3LPGA 3KL3A 2VI0A 1YRRA 2KZHA 4HP5A 1R47A 4EF8A 3WK0A 2FZDA 5L6UA 2VM8A 1JZ5A 4JFVA 3QTGA 1SMAA 3A13A 1FWTA 4X0VA 1XRSA 3OIHA 2PU0A 3Q37A 5IHRA 2WMKA 2PRLA 3FDGA 4JFTA 5LNSA 5T91A 2PGEA 4MY1A 4IUGA 5HWMA 2EJAA 3KBVA 3KVMA 3KBMA 1RY0A 3WH9A 5M1TA 3NSNA 3BTNA 3OLGA 1M65A 4UIOA 1ZNNA 2W91A 3FEMA 3AMCA 1XIBA 5AN7A 4V33A 3M5VA 4O1AA 4K38A 1TJ2A 2WZHA 4YYFA 5E9XA 1K9DA 1MMFA 4QSHA 3SUSA 1CXFA 1R38A 1E0WA 3I4EA 4JQ3A 1UWSA 4X9YA 1XLBA 2NV2A 2Z0IA 4XD6A 1W1YA 2VFGA 3LNMA 2DDXA 1HZYA 1TX2A 1XIIA 1BG9A 3DERA 4QIUA 1UA7A 3SN1A 3PZVA 3KP0A 1XLCA 1TO3A 4FXJA 1GKQA 1K4GA 1JYVA 2Z1SA 2H6RA 1XLJA 3E5BA 1GQNA 4TVUA 3CL7A 1JZ3A 1SO3A 4H83A 3AU6A 3ITCA 3B4YA 3F7JA 2OT1A 3DFOA 1VEOA 1KW1A 3HG3A 2VC6A 3CL6A 1R5YA 3TSBA 4B5UA 2X1UA 4UZSA 2GQAA 2FHBA 3OA3A 1E0VA 3AHTA 2OR2A 1RAKA 3ZLFA 1SZNA 3G6MA 1IT7A 3NPUA 3QBUA 3T0BA 1XWYA 2BMBA 3MI2A 3H7UA 4BI7A 2HTMA 3WZ0E 2G3FA 2VEFA 4H8VA 4F9JA 3LXAA 2UV8G 1OFEA 1XKYA 4NXSA 3GU1A 1FWDC 4HU0A 2YCIX 3MSGA 3K4WA 4CKQA 3CK5A 3QMSA 3P84A 4C6JA 1NU5A 3BLEA 4DX3A 1HX0A 2XVLA 4HZ6A 4XIMA 4B2DD 3BW3A 4URIA 3GG1A 3BAYA 2H8XA 3LTSA 4FX6M 4R88A 4D6DA 4XZMX 1F76A 3VOIA 4IFKA 4JFWA 1JZ2A 1GYNA 2ZTKA 5FEPA 1WB0A 4RNJA 1LLWA 2ZRZA 4HOXA 4NZJA 5FSDC 3TYZA 3H2CA 3QMRA 1Q7MA 1J9YA 1TJ0A 3KTCA 1M7JA 4B5NA 3SIMA 5F2IA 1E72M 3AMKA 5BMXA 3T07A 1KQYA 3A22A 3GXPA 1H09A 4AHOA 2HJPA 3LXCA 3GHTA 4FZIA 3H6OA 2GWNA 2ZOXA 1UD8A 3CLWA 4JOMA 5D38A 1SSDA 4DQWA 3IK4A 1M04A 4CU7A 1O95A 1NIUA 5ABEA 1IXPA 3OVPA 1C9DA 3ID7A 1V3HA 4UNIA 4YWIA 3ANUA 3PAJA 3UWWA 5JIPA 1YPFA 2EKGA 3W2KA 1LZOA 2R1MA 3KOZA 4IUOA 5E09A 1DQXA 1QHOA 1S39A 3MSYA 1BF6A 1XFBA 2JKPA 3UA4A 1IZCA 3WMSA 3IJ9A 1QOXA 1EKOA 4H9TA 4R85A 3M0LA 3P2VA 3RLHA 1PKLA 3W72A 1QAPA 2BY0A 2FFCA 3KWSA 2ADAA 2J7HA 1V02E 3O6YX 2DSVA 1J4EA 3THAA 3TTOA 3ZT5A 3AQUA 2Y5JA 3KOYA 3CZLA 4DAIA 1IF2A 4JTHA 1XBZA 1NF7A 3DGBA 3NGJA 5HQLA 2ACQA 2ANUA 3DHDA 4PMUA 1TTIA 4MF4A 2PLJA 4QG6A 3SURA 5LA1A 5CSYA 4NVTA 2GJRA 1C8QA 1TFVA 4KIRA 1DJWA 3DFQA 5C2CA 4EPEC 2QGYA 4A8NA 3B9DA 4ADSA 3I4KA 3CASA 2CZEA 5EL1A 3IAQA 1OX4A 4GYFA 3LYEA 1B57A 4MB5A 3GUGA 3Q2DA 4DJDA 2X41A 4L65A 2TRSA 4WY0B 2RDUA 2JF7A 2XGZA 2QIIA 3QV6A 1JG9A 3AAMA 4F0KA 2FVLA 2CXEA 3WNLA 2D0FA 1OSEA 4K68A 3RM4A 2YLAA 3G0UA 5DMNA 2DIKA 3BG5A 3L7RA 2J9XA 4LC8A 2YKKA 2J24A 1JD9A 2XISA 3AMLA 1F3TA 3F2DA 4GE8A 2O9RA 3CUGA 4ICMA 2J7CA 2VFDA 5GJNA 4FNUA 4QS6A 4N42A 3UZYA 1E6SM 3I7RA 3U4AA 3CYJA 4ACYA 1ONEA 1BWLA 1EDGA 3GG0A 2YR1A 4D8LA 2J8GA 1KBIA 3STEA 4HYWA 1NP0A 3W1AA 4D72A 1XR2A 5IDIA 1L6YA 1TYGA 1SUXA 2JKAA 4O19A 2R82A 3S83A 1EGMA 1NH6A 5MF5A 1VAHA 3PY2A 3W2MA 1OK6A 2WNQA 3NO1A 1K02A 4E38A 1XRTA 1UD4A 4BFAA 4DNHA 2O9PA 3FA3A 4AU0A 1ZBVA 3PBUA 4N6EA 4RUBA 2V2DA 5C7VA 1LBFA 1TX0A 3TR2A 3GM8A 3B9AA 3CQ0A 1Q6OA 2R8WA 4J3UA 3UGVA 4PULA 1JRCA 3CL8A 3AS1A 3VAVA 1XUZA 4IH3A 2QUNA 3BARA 4Q8MA 5E0CA 4HA3A 3S6OA 3UWQA 5HINA 1EJSC 2BY2A 2VD8A 1DJQA 3W0KA 3CBWA 5LZLA 5DFAA 2OX1A 4AIEA 4B5WA 3HFTA 1Y5VA 1H1YA 3IRSA 4HNOA 3B4UA 4FLOA 2QIWA 1O5KA 4XVDA 4BQ3A 1JYXA 1TPUA 5F1UA 1JCXA 1RH9A 2CKRA 3W01A 2BHZA 3T1GA 4CNPA 3CHEA 3WBAA 2HRWA 3EA3A 4M8UA 3GY1A 4XO7A 4JPGA 4JEQA 1EF2A 3OZOA 1I2PA 4UR9A 3VZXA 2J8FA 2DFAA 2ZADA 4G8TA 2E1WA 4IPNB 3VNLA 3VX1A 1SZFA 7PTDA 1TCMA 2HISA 3IUIA 4BS0A 1W3HA 2P8CA 2Z7GA 4ZXLA 3W88A 1LDCA 4C6LA 3UYCA 2C14A 1PV8A 2AKZA 2WSKA 5M17A 3UXIA 1W32A 1J10A 5FF4A 2AL1A 3NAVA 2I14A 1Q13A 1QATA 1UUQA 2BV9A 4XD5A 4UTTA 4DF0A 1EZWA 2DZUA 3GFXA 1W3LA 4D1JA 1HKIA 4DPPA 1O68A 1D7FA 2C16A 1EWEA 1V0MA 3K30A 3CWHA 2OLAA 1GGOA 3QYQA 2ZQ0A 2EPNA 2E6DA 1B0IA 3IUDA 2GJLA 4Q8WA 2YYUA 4LUJA 4M7SA 4HNTA 2BY3A 4PUJA 1GYMA 5FJTA 4XSLA 3CAWA 3G1HA 3CPUA 1GTEA 4B9YA 2DV0A 4WKAA 4QLKA 3AFBA 2R91A 3AZSA 4JL1A 2F84A 3DYOA 2ZUVA 3U2ZA 3SB0A 5CZ0A 2ZX9A 3NPVA 1ZAHA 1X98A 4DYEA 4GIEA 1V77A 3IIPA 4RW5A 4LS0A 3CQHA 3L4WA 2CLEA 3OIXA 2JFEX 3VA8A 1VCVA 2P10A 3ARUA 3GXIA 3RLVA 4E6MA 5G5IA 3LRKA 5C70A 2E8YA 1KM4A 2GQ3A 1XC6A 2PTXA 3TUUA 2NWSA 1JNEA 3W7GA 3M43A 3NZPA 4HMEA 3RITA 1CGVA 3BWWA 4Q8VA 4GNJA 1R87A 3H7VA 2ISWA 3RJXA 5DBUA 4BWLA 1XIFA 3SGZA 4N9DA 3QV7A 3NFUA 2ZUNA 1EYWA 5LA2A 4OUEA 2PWHA 2OO6A 3GH4A 5BWAA 2ZDSA 3TXVA 3W26A 2Y5EA 2FDMA 1YE4A 1M3UA 1FCQA 4LVAA 4IP7A 1PYMA 3WH7A 1EXBA 2RH9A 2V9DA 1KXQA 4FA3A 4NZ4A 1JUBA 3GDMA 1ISVA 3UZ5A 4EIVA 1JR1A 1Z69A 1DTNA 2OGYA 3BCJA 4NJHA 1MZRA 2YL9A 1RPXA 4W84A 2QDEA 1C8VA 1G4SA 3ITVA 4IG2B 1JEZA 1VYRA 1R46A 1L9WA 5LKYA 2ISDA 3MP3A 4OE7A 4PZVA 3N1AA 4KFOA 3QKZA 1Q3NA 4JTKA 3C86A 1X8CA 5JMUA 1Z3NA 2AAMA 4N4PA 3W84A 1UBPC 5AZ0A 5CPOA 4U2ZA 4R34A 4AYSA 4FX8A 4NP7A 2QHAA 1PE1A 4YN5A 1XM3A 3CV1A 2O55A 2IKHA 3BLDA 3O63A 3H12A 1GQJA 2A1YA 1YQ2A 3B0YA 2FGLA 3R58A 3ME3A 2CZ5A 2Y89A 3TJ4A 3C0SA 4KW2A 5G1TA 1QPQA 4WK9A 4CNTA 2Y8VA 1Q6DA 2YBUA 3GTXA 1XD0A 3MA8A 1TCDA 1VIZA 3RMJA 3W1PA 4J5NA 2X0YA 3WH6A 3EMQA 4KCWA 3TNBA 1HUVA 4MOZA 4UTTC 1P6WA 4JAWA 5CZKA 2D3LA 3QPEA 4O15A 4JTQA 1XRFA 2YL5A 3G2GA 3M46A 1MW1A 1F3WA 2WZMA 3WL1A 2ISFA 5IFPA 1JDEA 3ECQA 4QLJA 3GYEA 2G3NA 4FX7A 4CNNA 3FAWA 4L1WA 2IW0A 4GQBA 3I6RA 2PCQA 4HK6A 1KBBA 2WLZA 3HQNA 4IXHA 2XH2A 2DSUA 2IS7A 3CC1A 2FGZA 1VKFA 1JCLA 4H9MA 4NF7A 3F2CA 4ZA0A 2ZC8A 4IGHA 4N9CA 3E96A 3E3HA 4CU6A 3CJPA 5REQB 1AD4A 3N9KA 3TQKA 4JTIA 4O18A 3WLHA 3M5YA 3KLLA 5ECUA 4UFHA 1I60A 1HJSA 1JYNA 4E0CA 4UTIA 1W1B1 1C7SA 3PBYA 4O16A 1JVNA 3BANA 2OZ8A 2PWVA 4L61A 3WDJA 4PL1A 4UTJA 4PL2A 5DXXA 1KWKA 4Y9OA 3I7SA 3TJLA 1ZHAA 4XKMA 2E25A 4MDOA 4H01A 1Q6RA 3VGHA 1GK8A 4MYXA 3PANA 5I77A 4BWLC 4JN8A 2NQ5A 1E1CB 2CBIA 1SR0A 1A5LC 3CT7A 1E73M 4O13A 3M0JA 2HS8A 4GI8A 4K37A 3CZJA 4H7CA 1V0NA 3L0KA 3CUIA 4WGHA 1E5JA 1V4YA 1P4CA 3U2EA 3NQCA 2ZXAA 2BGSA 4PCTA 4EK7A 1G0CA 5G2HA 3EWBX 5HPCA 2OWXA 3NQBA 4C1NA 3GXNA 4HA1A 4GO8A 4PTWA 4ADTA 2DT2A 3U4FA 4S23A 4MLRA 2Y7DA 2VDGA 3NPXA 2P76A 1YIXA 5AC4A 4RPPA 2R1PA 2XN2A 5ABHA 3SI9A 1OM0A 4I90A 1J0YA 1NFGA 3WFAA 4A29A 3QR3A 3UESA 1LUCA 2BVDA 3NQEA 1SW0A 1CXLA 5A95A 1IEVA 4S3JA 4L1XA 2WKGA 3FSUA 3QPZA 3R12A 4LS2A 2HCVA 3C2RA 4Q8OA 3CIWA 3OOQA 4F66A 4QCEA 5F2GA 1XLDA 2BXVA 3UCQA 4AWUA 4Z08A 1AQHA 5KZDA 2WVUA 4Z2JA 4GBUA 3BLIA 1XDJA 1IEWA 3RK8A 3S5YA 1O12A 2VEGA 4TVDA 3AICA 4M5PA 4ML4A 4HSNA 4GIYA 4MNMA 3NCOA 1I2QA 3NYZA 5BROA 3L0GA 4J40A 4V1YA 4LU0A 5H8PA 3BSHA 1ONRA 2ZUMA 2W0UA 3HPXA 4W7VA 3BV4A 1AQFA 3MMDA 2QS8A 3W83A 1XLIA 3V5CA 9RUBA 2P3ZA 3CUXA 4I6KA 1L2UA 3URAA 1SU5A 3NQ8A 4O1EA 4YIWA 3E0LA 2OSYA 3R25A 3DEQA 2H90A 3XISA 3DHUA 4BY3A 1VFFA 3NDYA 3PULA 5EU9A 1JUEA 1FHVA 2PGRA 1E9LA 3AZRA 3NZ1A 3W53A 5K4XA 7CGTA 3A3XA 3RCNA 3M0XA 1X96A 4XO6A 5GJMA 1XLEA 2OKOA 1J5TA 2FH8A 3CV7A 5ABGA 2F6KA 1ENUA 5SWUA 4G7EA 3KVLA 4ZFMA 1HIZA 4RZBA 1XIHA 3VD5A 1RALA 2XTKA 2XSBA 5FF7A 3W7IA 3T8LA 1EJTC 4KPLA 6TIMA 5AY7A 2GGJA 3UG4A 5AVNA 2FZ9A 4FK9A 3LLFA 1YXDA 3EKGA 2FGBA 1TVLA 3SW6A 2D2JA 2CERA 3G1SA 4L80A 1W1TA 2HBXA 3LHTA 1QR7A 3HIJA 3P7YA 3TYBA 4I6VA 3ARWA 3GNXA 2EHHA 4JTRA 4IPLA 4HTYA 4EVZA 5BZAA 1US2A 4UMAA 4ZO6A 1NP2A 3QM3A 2W4XA 4I7UA 1I4NA 3A4XA 1DXIA 4OQVA 3CYVA 1VLIA 5MHBA 1JAKA 3LZ3A 2ISVA 1TJRA 2WO5A 4PUDA 3AWNA 2EPHA 3WDPP 2QUVA 4LS1A 2J25A 3WQ5A 3LNPA 2DZWA 1GVFA 2O9TA 4UOJA 3H8AA 5KZEA 2FVMA 3WD1A 4J3ZA 4HHMA 1H51A 2ZZ1A 4FIQA 1WCGA 4RNHA 3PK7A 1VFHA 3LHYA 1KA9F 3KBNA 1B3ZA 1V3IA 3LMZA 2PP3A 1S46A 1ZU8A 2XM1A 1KFKA 1MI3A 1LG2A 1CGXA 1EGZA 3ITGA 3WD0A 2VP8A 1XLFA 5HA7A 2GUUA 1TTJA 3QOKA 2Q8XA 4ACZA 1KFBA 2XIIA 4O28A 2X42A 3O0FA 3PB0A 1KRCC 3CZ8A 1ITUA 2DT1A 4C1KA 3AI0A 3S9IA 5I79A 2VENA 2R24A 3T2QA 4XZIA 1CYGA 1ALDA 1T8QA 1ZTVA 1GVRA 2FKPA 2OPJA 4ZO7A 3WL0A 3ZVHB 3BGAA 1FKWA 4X60A 3WEZA 3U5YA 1GOQA 3J7HA 4GFSA 1V0LA 2OZTA 4F2UA 4IX0A 4GD0A 1EJ7L 4PMNA 3GUWA 6REQB 5PTDA 3DFNA 1MDRA 2PDWA 3ALFA 2Z27A 2X30A 3OZPA 4EP8C 1CZ1A 1BFNA 1FVPA 2R6OA 4ZSUA 1W5NA 3WUEA 5C9RA 2VDHA 3RPTA 4RZ5A 4B15A 3TROA 1E70M 1E51A 3QEZA 3O15A 1FDZA 1REQA 3NL3A 3AXHA 2DQWA 4XZHA 3UXKA 4PODA 2DW7A 4JTJA 5LSMA 3WUBA 2X8RA 1EOMA 5HANA 4JTSA 5A8OA 2W6RA 1DJXA 4L4MA 1E4IA 4LOCA 4YTUA 5AC8A 4GUJA 3K46A 1H7RA 2ZWZA 3M1ZA 2WMFA 3BZGA 2BBFA 3EA1A 4AIOA 4DJFD 1RJQA 1VBGA 4S3DA 4DWSB 4O8AA 3WQ8A 3AUOA 5CPLA 1A53A 1CB2A 4OHQA 3JR2A 4UQEA 2I1OA 2QT3A 1HKVA 3VZZA 3FY1A 3TC6A 2G4FA 4GGBA 3WG6A 3VC6A 3LI1A 2V3EA 4KT2A 3RR1A 2ZX5A 1TPFA 2A5HA 4W85A 5FF0A 3O9NA 3M0ZA 3IVSA 3D47A 4EACA 3CB3A 2QW5A 4XZ9A 1Z8AA 4DO4A 2IUZA 3WLRA 3LGEA 2DJXA 3HB9A 2BFGA 1A0EA 3TX9A 3PFMA 1I0DA 1NARA 3PZMA 3MSRA 4POCA 2INEA 4GQRA 2POZA 4RL3A 3BCDA 3AIEA 1GOOA 1HL8A 3TK7A 3P0XA 3TSMA 2Q02A 3AXKA 3SFKA 3ZR5A 4MNJA 2YL8A 1IV8A 1UPMB 5LGZA 1M7OA 4HNCA 4Q32A 4NZ1A 3VFCA 1W1IE 3PM6A 4AF0B 3QPYA 1QXLA 1QI2A 3WBEA 1WDDA 8CGTA 1T7LA 7ODCA 2XHYA 1NY1A 4FF5A 3UG5A 4DNMA 4MUPA 4Z0JA 5CEWA 4GVHA 4XVEA 3WDQA 2C91A 3G5EA 4AVFA 3EWUA 2QQ6A 4D8ZA 4QHRA 4JDYA 5DANA 3BE7A 3OTRA 2D2OA 4ZXOA 2D24A 2Y62A 2HXUA 2B7QA 5B7ZA 3PUDA 5LHFA 3F5JA 4MUZA 3MI3A 4MKVA 3W1UA 1EJUC 4RDWA 1C93A 2GSEA 3NZQA 3USZA 1GW9A 1XBVA 1A5SA 4GYKA 1DWHM 4XUYA 4O4WA 3VIHA 1OCNA 1OADA 1PCKA 3N17A 1VQTA 3QZAA 1YMYA 3BLLA 1EBGA 3M0YA 4C5ZA 3DX5A 2CLFA 4R3UA 3LCGA 4Z42C 1HNYA 1EC7A 3N4FA 1Q8AA 5MKGA 3RO6A 2ZXQA 4TX8A 4O1FA 3DI0A 2CXGA 2INZA 5GQBA 2BXZA 3LQLA 1KRMA 3L0NA 1KM3A 4WVXA 2OQLA 3EOSA 2WXDM 1ISZA 1B4EA 4FNRA 3E0VA 4B90A 2PDPA 3KCOA 1YLVA 1OABA 3IS4A 3MMUA 1JF5A 5HR6A 2WJDA 4EXQA 3OGVA 2VURA 1F4HA 1QVBA 1JIBA 3H55A 1WDQA 1Q6EA 2QGHA 2XGIA 3B8IA 4LBRA 4AD2A 3B0VC 1UKTA 4X3ZA 3VKKA 4PEEA 2IPWA 3S5ZA 4O1BA 4M3PA 3FGCB 5BXSA 2ZX7A 4E8CA 1VPYA 4UQDA 1B9ZA 4RXGA 3GDBA 3CV2A 4GJ1A 3FJLA 3BQ5A 4MKSA 4DYJA 1P7TA 3DH7A 5HNUA 3BGJA 3HZ3A 4S1FA 1BYBA 3WUFA 4GUHA 4N6FA 1EPXA 3ARYA 3OPSA 4AWSA 1P0EA 2EBNA 4UMBA 1R2TA 1FWFC 1A5CA 3GRIA 3RX4A 3KS6A 1HVQA 1Q4WA 4IXXA 1FCVA 1AD1A 4FP1A 5AHNA 4MZ8A 1TR9A 1AW5A 3F5KA 1FQ0A 4JN6A 4GVGA 2E5CA 1NAL1 2YCLA 3AALA 2ZTJA 2J7GA 3R79A 4MJ4A 3GH5A 2MNRA 1LOQA 2WCGA 1UQYA 3DDMA 1ML1A 1KD0A 2A7RA 1X8FA 2H8ZA 4UFJA 2HNEA 3BAIA 3NJ3A 3PTDA 4IMEA 3II1A 3Q4DA 5TQLA 1RVGA 2E0PA 5BRPA 3VNKA 2JBMA 4R53A 1DEDA 3M0HA 1SGJA 1XCFA 5HK4A 1FWWA 5KMYA 1ZBWA 1BQGA 1MFUA 2UY2A 1K8ZA 4UFIA 5CJMA 3K4DA 1E3ZA 4M6UA 3IJQA 3CAVA 4TTUA 4JGDA 5BXRA 4C6KA 4GIAA 1CEOA 4XAPA 4IQJA 1JPDX 3VD3A 4US6A 3P80A 2HWGA 4C6IA 2YW4A 1A4MA 2Z26A 4GI6A 4ZTYA 3GH7A 1I9CB 4KGJA 3W74A 4Y9PA 4PMRA 3TSDA 1Q6QA 5A6AA 3NL6A 3SCNA 1OIFA 4JX5A 1MQRA 3N25A 2RAGA 1BRLA 4KEVA 4GC4A 2P0OA 1F61A 3TMQA 4JTFA 2CLIA 2VCCA 5I07A 3Q58A 3E2RA 2FLIA 1AH4A 4UTKA 2EJ1A 3WQFA 4CCEA 3W27A 2Q09A 1S2TA 4MWAA 2P50A 2WOQA 3GR8A 3TZFA 1E40A 6ALDA 4AX7A 3WFLA 3HGJA 1J2WA 2W92A 4LRTA 4LF2A 4ZR8A 2PP0A 3WQVA 3MDWA 1ONWA 3DHFA 3EB4A 1OC5A 5BOFA 2P5NA 2YSWA 3WF3A 5AYZA 1I2RA 4A35A 3TYAA 2CIPA 4AEFA 1MSSA 1OD0A 3ISIX 1LG1A 3U8GA 1HP4A 2BOGX 3TCEA 1GG1A 3PWGA 2VR2A 4OBSA 2QNEA 4GH3A 4TVCA 1A49A 1MWOA 3HGSA 1OINA 3WLTA 4LYPA 1O5RA 3B8DA 1UMLA 1PWMA 4P7NA 5CSSA 4AW7A 3IVUA 2P1FA 3L4UA 1DIOA 1GZGA 4XD3A 2I5QA 1QK0A 3B0PA 4ASTA 1Q45A 3WH8A 3WLPA 3H53A 3EDDA 3WY1A 1CIUA 1JZ4A 2E09A 4NXKA 4J3SA 5AHLA 1VFUA 3ONCA 4PR4A 3ZWTA 3UZZA 2B0MA 3ORWA 1SFJA 2JKEA 4QX4A 1E0TA 2GSJA 1UP0A 4WD0A 4DXKA 1E1FA 4YCOA 2PRHA 3KX6A 3B0UX 3GC2A 4REQA 4PH6A 2NX1A 3W82A 1XSKA 4HNLA 3A9BA 3G3MA 3BL3A 3IGSA 3R0DA 3WQEA 3R1ZA 3ARQA 2NLYA 3VIMA 3LRLA 5IFTA 4J2PA 2I9EA 1EIBA 5D9PA 3W1QA 4ZQPA 3FX4A 5AECA 2QCMA 4AHPA 4ES4A 4LX4A 4F0LA 4AD1A 2BY1A 1OFBA 1UR1A 4LRSA 4PEKA 4GVFA 3EDFA 4JKKA 2DUXA 1P0NA 3E5PA 1KXHA 1F07A 3KWXA 2B7PA 3PUOA 1JAEA 1MFVA 5HWJA 1DBTA 4K6AA 4GFIA 1B3XA 2BX7A 2J9YA 2QJMA 1ZB5A 4P7LA 1SO6A 4KEMA 4MB3A 3LSCA 6XIMA 2WSQA 1MZHA 1BGGA 5AC6A 4LTSA 5HJLA 1MQQA 5H91A 3BURA 1Z44A 5AZ1A 1K8YA 3MUXA 3LA4A 4Q4MA 1ME7A 3PTQA 2WAGA 1V51A 1AL7A 4K8HA 4H6RA 5CGQA 4A3HA 4WSKA 4CGTA 2NX9A 4EPDC 3JZUA 1W1PA 1TJ1A 5C7HA 3KHJA 3IIVA 3W70A 3WEMA 1KR1A 2PLCA 5KEZA 3WQPA 4MTVA 3KOWA 5E5CA 3PP7A 5I3FA 1CI1A 4KMQA 3GC5A 3ICJA 1WDSA 1C29A 4LAZA 4DVOA 1K7XA 3MP5A 2G3MA 3MS8A 1H41A 1XICA 1SJBA 4PUMA 3EWYA 1HKJA 1O60A 3VNZA 1UR4A 4F0RA 4FO4A 1FH9A 1VBJA 4YNGA 3THDA 1WXZA 1W1VA 4MWAC 4GA8A 3WQCA 2F2KA 1UOZA 3CLMA 3JUGA 2WANA 3VU2A 4WOQA 4WDTA 2YB1A 2GDVA 7REQB 2NT1A 5A3HA 3WK1A 1YW1A 3REQB 3R43A 4HZMA 3NOYA 3OA5A 1SQ7A 3CPGA 3CIVA 3U7VA 3VINA 4N2YA 3EXRA 5LGXA 5K2ZA 1I1WA 1QNOA 3NQDA 3AYSA 3USBA 3CUHA 5ABFA 5BXPA 2WJZA 2MANA 4XZBA 4ZFCA 2VX4A 2Z25A 3QH2A 1HT6A 3CZKA 2EPMX 4PA8A 2XZ9A 2VC5A 1WAWA 3NQGA 1H50A 4U5KA 3KS5A 3W1MA 4GX8A 1QNRA 2D22A 3FJ4A 4TMBA 1Q6GA 3UR8A 1DHKA 3VIJA 4A3YA 4ZTXA 4FLQA 2V0TA 2JEQA 5IRPA 3OO2A 1IT8A 1KCLA 2DZAA 1FX6A 1TMQA 2IPGA 1YNYA 4U31A 1GVQA 1P0KA 1H0IA 5HMSA 1JDCA 4JNMA 1W3JA 4Q7NA 2VL4A 2HQAA 1BKSA 4P2VA 4LVGA 3P5YA 1HJXA 2JIEA 4B2DA 2ZYFA 5KZMA 4O52A 3V1PA 3UG8A 1MXSA 1GCYA 4OOUA 1A5BA 4R27A 3VGGA 1NF0A 4NKCA 3UGRA 3UYIA 3ZR4A 1KXVA 4OFCA 1IR2A 3OQEA 1O1HA 4KFPA 2YZ5A 3DCPA 4FALA 4QFUA 2DIJA 3WNPA 3MUCA 4C6NA 1XYAA 3IIXA 3VKCA 1A0DA 4W87A 1M68A 3P61A 4PUNA 4K2SA 1UG6A 3S46A 5A8NA 3S1WA 4MNKA 1QWGA 5DCDA 1KR0A 3LEPA 3LPOA 4NAEB 4DHGA 1IXQA 1UIPA 4U4MA 3TLLA 3W37A 3DBPA 3GQYA 4MDPA 3WN6A 4IOTA 1FCBA 1PWLA 4PB3A 3WQ4A 3FA5A 1CBGA 1EP1A 5DRCA 2OQYA 4QG9A 2QR6A 3BMWA 1DWJM 3UFYA 4OIFA 5FOOA 2V2CA 4H9XA 1B31A 1J11A 4M51A 1EX1A 2HVMA 5EKYA 1LQ0A 1TRDA 2JGQA 1OC7A 4DJEA 1PSCA 1PUDA 2QLYA 1UB3A 2DZXA 1H11A 1PB0A 3V5OA 3ZLHA 2OJPA 1H7WA 4U10A 4JXCA 2QF7A 3HTWA 2V3FA 3QR0A 1NQ6A 4X0NA 4JEJA 2VEPA 2PAJA 4Q7IA 3DC8A 1FTXA 3I3BA 3STGA 1TPEA 2QJGA 2WMIA 4A2SA 1A50A 1FBAA 1JYWA 3T9PA 1KM5A 2WPBA 5JBEA 1G1YA 3IJ7A 4ILSA 1GZJA 3GG7A 3OG2A 3E0WA 3N6HA 4Z2KA 3I3EA 4GCAA 1XDLA 2GJXB 1OFDA 3PUEA 4CD8A 4F2TA 1GJPA 3OGRA 3MBFA 3C3UA 3C52A 2PFHA 3VIKA 4KERA 5CLWA 5JXQA 1OWQA 2XSAA 3AHVA 4I5XA 4UZUA 4A3RA 3HFYA 4MLJA 3CO8A 2PWUA 4GYPA 3B8SA 3IWPA 3R94A 1V08A 4GRSA 3ZJ7A 4LJ3A 1N8FA 4AMCA 5B7YA 5J5RA 5IM51 2IXUA 3P0WA 4UQCA 3W7NA 4RE0A 4HA0A 2W3ZA 4DZ5A 3DFYA 4C6DA 4HCDA 3EWDA 4GNVA 1BYDA 4I5UA 4B91A 3ES8A 3OBEA 3AS2A 4F3HA 1WO2A 5CKSA 3TQ0A 4GACA 4JX6A 1Q66A 1DWGM 4A05A 2P88A 3RLGA 2O4MA 4L6HA 3P3BA 1FKXA 3W6LA 4D9PA 1J8VA 4IJRA 5A8GA 2AAAA 5CXPA 1V79A 2Y5SA 3DECA 4AFYA 1D8WA 1EOKA 2BASA 4PC8A 1BSIA 3G18A 4LXFA 1WAUA 1X1ZA 5I3KA 4O12A 5M03A 5A69A 4PMQA 5E93A 1UWIA 4GK8A 2VVNA 3FHAA 3DHPA 5FJPA 1LRTA 2IKJA 3DIPA 4XWUA 2OWCA 1J79A 2NSXA 1HP5A 5BMWA 1E9ZB 2VCAA 3CAQA 4N4QA 2VQUA 2WMGA 2B4GA 4U33A 2QZRA 4C7GA 2FB2A 1G94A 1IXOA 3SQSA 3DXIA 4Q7BA 5AOUA 3SJ3A 1Z42A 3HQ1A 4DUWA 1Q6FA 1XLAA 3AIVA 5L9FA 3HGRA 4YJ5A 1JQVA 4UTMA 2DH2A 1DORA 1XV8A 3WLOA 1FWIC 3AXXA 3IV8A 5EMLA 4QXIA 5F1VA 3BJFA 1XINA 3N2OA 4HB7A 4FSAA 2PP1A 4AXKA 1K9TA 3QXBA 3MCMA 5FESA 4DJEC 1SW3A 3VC5A 4AZGA 4IIEA 2WZTA 3KDOA 5HMFA 3BXWA 1RK5A 1V93A 2VXNA 3LDVA 4NRRA 4CUCA 1DJZA 1GORA 4P5UA 2Z4GA 1TMHA 1TV2A 2E9MA 3E2SA 4JIHA 4NQ1A 3LQGA 3MO4A 3L2IA 1Z9AA 4DIAA 4ZB2A 2AL2A 2HVOA 4JTCA 3NOEA 3D6NA 2CCRA 2REQA 3BW4A 1DTUA 2YDRA 3D46A 4JTGA 1QT1A 4LUTB 1UR2A 1B5TA 1QRQA 2QDGA 2GDUA 1A3XA 3KFTA 3UR7A 1HL9A 2Z2BA 4UCFA 4OU1A 3GVVA 4IFRA 4A8RA 3A21A 5JU6A 1PIIA 1LRQA 3NXFA 2SFPA 4QDMA 2P3EA 3V0UA 3R8GA 3CUZA 3U2OA 5I00A 4GYPC 4D6FA 3A12A 1RQEA 8RUCA 4LUSA 3CU2A 2OZ3A 3MV01 1ADOA 3QOMA 2C19A 4M6QA 1VJSA 2PC4A 5BOEA 1UYQA 4OGZA 4F2BA 2CLHA 4GCXA 3GBDA 4M19A 4H9ZA 2V68A 1UPPA 1A5AA 4J2MA 4EWND 4A22A 3MYPA 2PODA 4L4OA 5HQMA 4D71A 1V6XA 2FFIA 4MJMA 3UD6A 3VMNA 1ADSA 3F4WA 1G5AA 2XVGA 3R8HA 3WQWA 1NOFA 4OKDA 2WJEA 4FB7A 1POJA 3T44A 1IE7C 3DYMA 3G1VA 1VZWA 1KTCA 4D6EA 1TV5A 1S1PA 1UQZA 2DT3A 3W87A 4IQLA 4KS0A 2WMHA 3N9RA 1F4AA 3TFXA 2WPGA 4JY9A 1EUNA 3RDKA 5CPTA 2PWEA 4E8DA 3I65A 2CHNA 1M7PA 1FDJA 1E0XA 2RHGA 2XFRA 3VK5A 4H6KA 1KQZA 3O8AA 4HPNA 5LNRA 1GZ1A 5C9UA 2QUUA 1HW6A 3TOPA 4CQ9A 4Q22A 3V0TA 1KBJA 3DBNA 4Q8QA 3WH5A 3VKBA 5BW6A 1JD7A 3R10A 4A2RA 3W4RA 2OT0A 1FWAC 3EX2A 4X22A 2ZBTA 2GL5A 3GS6A 3ZT6A 3TVAA 3DI1A 2AKMA 4J3TA 4JIRA 4DBWA 1JXKA 1QJWA 5FACA 1P1XA 4UFLA 3LHWA 1C3FA 4C1LA 1UA3A 3COTA 4BA0A 2A7NA 2HK0A 4W4QA 4MNLA 1TV3A 3B9OA 3CPRA 4E3TA 5F7UA 4FOUA 4PCFA 4A6GA 1TWSA 1RHCA 5AC7A 5DN1A 1TE6A 2E6FA 2V30A 2EPOA 1OFAA 2ZUTA 1GEQA 3S42A 4AG0A 2POTA 4J4KA 1RP8A 3GU9A 1UKQA 1GHSA 2QMJA 3GHSA 1M01A 4GWEA 2A3HA 4R7JA 3P81A 3E38A 1W91A 4EXBA 5AYXA 1RCXB 2C6QA 3GU2A 3N29A 3DU0A 4RK8A 2XG9A 2PA6A 1BF2A 3H21A 4ZZ9A 2YJQA 4KWVA 3NQ7A 4NJIA 1WOBA 4R7OA 2QJJA 3K4AA 4IWWA 3R2GA 3VI2A 3PHAA 4V28A 3DKJA 4O17A 4HIBA 5AHEA 4M0XA 3QGVA 4C6PA 1I1XA 1V5XA 4PSRA 3PG9A 2XH7A 4JIQA 2RGMA 1WXYA 3E49A 3UCCA 2NV9A 2OLSA 4NI3A 2F7FA 1NTHA 1AG1O 1JPHA 1I45A 3N2TA 3SCOA 1XLGA 3QSTA 3NL2A 2A3BA 1FWEC 3FK4A 5FJOA 4JCLA 3A3HA 4R7WA 1NDZA 2DIEA 1H63A 2NW0A 3L12A 4MIMA 4ZOBA 4MWAD 3C3NA 3IPWA 5I0DA 3URNA 1R3QA 3OW1A 1L8NA 3RJYA 3F2BA 3NZGA 1S2CA 1RJPA 2D73A 4N9EA 5CBJA 4HN8A 2VT0A 2Q3RA 1ME9A 3U2CA 3LMYA 4D1IA 4DBUA 5DXYA 1XSIA 3WQGA 1Y65A 3AOFA 3S0CA 1OGBA 2OFJA 4HPGA 2CWNA 2VOMA 2ATSA 4UUIA 2CESA 3S2NA 3MCOA 3D0CA 1K7FA 1DIDA 4W88A 3W86A 4G1NA 3VIFA 4L1GA 4XIAA 3LOTA 4UTWA 1TJPA 2UWFA 3LGGA 4ZQOA 5IOBA 1OT1A 1RV8A 5I3DA 1ZENA 1CLKA 4FNQA 2I7GA 3QSRA 1JJKA 4DO7A 4I9MA 3TA9A 1BHGA 4IIDA 2VWTA 1YPXA 3AMDA 2VUYA 1RY8A 4LNCA 3LB0A 4LEFA 1ZJAA 1W3IA 3PJTA 4F9DA 3R11A 1PO9A 5LIUX 4WDUA 4LC6A 3HQOA 4CN1A 1VPXA 4U5IA 4WDXA 4MYAA 1BWKA 2B7OA 3EDJA 3QFWA 5HPOA 4XSMA 3TFCA 4ZCWA 4HK5A 4CQCA 4HD5A 1WP6A 3O16A 5TAOA 3QQ0A 3WNMA 2DPEA 3KW3A 2RKXA 4LB4A 4IMGA 2ZWYA 2VHLA 3G8EA 5A2CA 3N2XA 3B05A 3GNRA 4B5SA 4B3KA 5DY2A 1AK5A 2WBKA 4RR4A 2CW6A 3RHGA 2Y70A 3T4CA 4FNSA 1IIGA 2J62A 3KDNA 4QJ5B 3WIJA 5I3GA 4GABA 4LVBA 5KETA 2Q8ZA 4AIUA 5FIPA 3NZRA 4JX4A 1S5MA 2A6NA 1VFLA 2I16A 5HULA 1GOWA 4IPJA 4BQ5A 4GIRA 2Z1KA 3N4AA 4H6EA 3G8RA 1ZJIA 4IPIA 1N55A 4OZOA 2Z1BA 1U30A 3EB2A 2V63A 4PMXA 4AZIA 3L5AA 3NR0A 4DF1A 4PMDA 1HKMA 3W7QA 4EPKA 4X9SA 2QCCA 2WK2A 2HV5A 2GJNA 2CBVA 1S2WA 4LQ1A 4QE4A 4N02A 1QUMA 4FR1A 2IPJA 2CLPA 3R89A 3SEPA 1AUSL 1V7YA 3MY9A 1KM1A 4PCNA 1WBHA 2XSXA 2OO0A 1LWHA 3R6IA 1B3YA 1D2KA 4ZVJA 2VKZG 2XFFA 1BWVA 4JQ4A 3GNNA 4XISA 1AW2A 1BGAA 1JPMA 2OOGA 1OCQA 3T0CA 5DCBA 4BEUA 2QV5A 1H3GA 4ZGYA 5HUPA 1YX1A 2VFIA 1R86A 3WO8A 5K3VA 1NOUA 5F2MA 1CW2A 4O8RA 4UBPC 1XYBA 2D23A 4QQUA 4DZHA 4PRWA 4ADUA 4ROQA 3S1XA 4JIPA 3MPGA 3RCYA 3W71A 1R3WA 1FWBC 2X7VA 3BAXA 4LALA 2B81A 2UY4A 3ZT7A 6TAAA 5KZ6A 2CBJA 6CGTA 1PKYA 3KP1A 4Q8NA 4J3VA 5CPNA 1Y7VA 1V3KA 1P1MA 5DLCA 4QG8A 4M29A 2QDHA 1FHLA 2VRJA 4PCPA 2Z1VA 3TE9A 2PI6A 4GX9A 4HZ8A 3CXOA 4W5ZA 3JW7A 2HK1A 1US3A 4JTDA 4AY8A 1QCWA 2GDQA 1R30A 1GKPA 3VCRA 1UZHA 4ZE4A 3NA8A 1NEYA 3H22A 1F6YA 3C2OA 1JULA 1S1RA 4QISA 4IZGA 4UTWC 5GNYA 2PZ0A 3AYRA 6XIAA 1E43A 3VUSA 3DFPA 4AY1A 1UOKA 2VELA 4JIIX 1E5NA 3AIRA 3UNTA 2F9RA 5FF3A 1D7KA 3QQWA 1R3YA 4R33A 3EX1A 4C7FA 4K1GA 3QR1A 1V02A 4XX6A 1QTWA 3APTA 1VRDA 1WZAA 3PBVA 4O54A 2NXGA 1X6LA 1EP2A 1T99A 4Q4PA 3TAOA 3VGBA 2Z1WA 1RK6A 1Z7AA 1YDYA 3EKZA 3UVIA 1YTKA 2QJIA 3LCHA 1N8IA 4OBTA 5FEXA 1DWFM 2QJHA 3ZR6A 4YYCA 3KL0A 4Y8FA 2PD9A 3IJDA 2PF0A 2FZ8A 2A0NA 4C91A 1NWRA 1YKWA 2QUTA 2ISSA 1PKNA 1A5NC 2NX3A 3H2OA 3ZLGA 1TPWA 2C15A 4NX0A 1UROA 1KB3A 3ANYA 3W85A 3DGRA 2A3CA 2QXWA 1OYBA 3EOOA 1SW7A 5D2XA 3AJXA 3VMOA 1OZQA 4IFOA 3L5MA 1OVDA 4BK9A 4GQGA 5I2UA 1DVJA 3KOFA 2BB0A 4EE9A 2XUCA 3UJEA 1F8MA 1MVYA 3SECA 1WX0A 1ISWA 3VOFA 1VBHA 4AH7A 3LBCA 2HSAA 4XBKA 2OYKA 1W17A 4HMDA 1VS1A 4L9XA 1X1OA 3MUIA 3LPFA 3DYPA 2FPVA 4BI5A 1E9IA 1EZ2A 3ABRA 1YBQA 1XD1A 5CSUA 4Q33A 4QM1A 5GJPA 3HPSA 4WGXA 3SUWA 4DJED 4M1RA 3U48A 2KX9A 2F6XA 4QRNA 3QJAA 1J0KA 3O1NA 3IIZA 3PG8A 3AXIA 1CTNA 3BAJA 3IJ8A 3GR4A 3V36A 5D9OA 3FXYA 5J8LA 5HXMA 4GY0A 4KWSA 4JBRA 1TWDA 2FZNA 2ZKMX 3DKLA 5H8UA 1I75A 3KRZA 4QEEA 4DJFA 3TJXA 3W7CA 4EWJA 1PDZA 1C9WA 2YL6A 3QY6A 3M5ZA 3TQVA 2CPUA 3W22A 1LQ2A 3MUAA 1QNPA 1S2UA 2ZX8A 3E2VA 3HG5A 3KCLA 4DLFA 3HJEA 1FFRA 5I5RA 3AIUA 3N11A 1LL4A 3S47A 1QW8A 3MUY1 1JGMA 1GYLA 2EKCA 3W7RA 2GPTA 2H9AB 2Z6IA 4P8XA 2ZXBA 3E12A 1JI2A 2ZA2A 3OODA 2J7BA 4JN7A 1U5HA 3MBDA 3UWEA 4XBJA 4G56A 3MKCA 3D3AA 4F0MA 1JDDA 2UBPC 1XG3A 3CB8A 3PTKA 4RE3A 3WD2A 1Q63A 4JQ2A 2VQTA 3STCA 2C79A 4C6MA 4GISA 2ESCA 4FF7A 9XIAA 5D33A 4ROPA 4I9AA 3NO5A 4YTSA 3GB6A 3PJUA 4NNBA 3BUVA 3VOGA 2JEPA 1DE5A 1AQMA 5T8GA 1H1NA 5AKQA 1JDFA 2XFWA 3HA1A 4FXSA 2AQWA 1XIMA 2OTDA 3JS3A 4I5RA 5CBBA 3AO0A 3GZAA 1BTMA 2YZRA 4KF1A 3VFLA 3MKKA 1IEQA 1CXIA 3LRMA 1R9YA 2FQIA 1I8JA 3EPNA 4C90A 1KRBC 4PUWA 1J2BA 3SN4A 2A79A 1UR9A 3EKLA 3WSUA 2PWDA 1EGVA 4N9BA 3PJXA 4HK7A 1M41A 4HU8A 2QAFA 4S2BA 3R4IA 1Q8JA 3ITXA 3K1GA 4ZQCA 1XGEA 5AHFA 3N13A 3PF3A 3K1DA 1YNPA 2O4QA 2FZMA 2ZA1A 5LNUA 3S8HA 3QKEA 4HU3A 3PS7A 4U2YA 1F7BA 5EMMA 4JL2A 1DJIA 3IANA 4FIRA 3T2PA 3ZO9A 3LK6A 2QPSA 3GTHA 1F5ZA 1L0PA 3LENA 1FY6A 2R9RA 3TR9A 3WFZA 2NLIA 2FTYA 4CCCA 1Z41A 5ENLA 3UJRA 1E6RA 4I7WA 1ODZA 3JVAA 3GTIA 3S1VA 4HA4A 4MG4A 4UOQA 3OB8A 2QCHA 4NAFB 3LLDA 5A8PA 1EA0A 1AODA 2VR5A 3THCA 4MJ2A 2IKIA 5BCAA 4D2JA 1KBKA 2WYSA 4ZBCA 1EJXC 5D37A 2Z29A 3LX9A 3W1XA 3TKFA 1KGXA 5FCZA 1WQ5A 4XK2A 2DZVA 1SZGA 4CVUA 3W1LA 3I10A 1ESWA 3L5LA 2EXOA 2JF6A 1RA5A 4IMDA 4WY0A 3I6TA 5EPDA 2VNCA 4GUGA 4RV3A 4DJFC 2ZZ7A 3C0QA 4EOUA 1R7OA 5DY3A 3S2CA 1P6CA 4YHGA 5GNXA 2WLYA 4LUIA 2OLHA 3HU7A 4HHHA 2DZTA 1NFPA 4Q4SA 2GVLA 1I2NA 4O50A 1RLCL 1QW9A 2OGJA 2FMOA 2NUWA 3IJIA 3WF2A 3N14A 4JR5A 1H0GA 5C9ZA 4KWWA 8XIMA 1E4MM 4Y9NA 3L68A 3PNZA 1XCWA 4M6VA 3AJ7A 4XB3A 4PE8A 2G41A 4ZOEA 1CENA 4GPNA 2DT0A 5FAGA 2HROA 2D1ZA 1WA3A 2DZBA 1IWPA 2PDHA 2VDIA 4QDPA 2BS9A 3NSXA 3V1HA 3ES7A 4RE2A 2WM0A 4KEUA 3LN3A 3K13A 4JHZA 2QPUA 4ZB0A 4WXZA 3WLMA 5G4EA 2E28A 4J1OA 2R1LA 3MCNA 1CXKA 2GOKA 3ABZA 3CEUA 2Z24A 1YE6A 3K8LA 3W24A 5AYBA 2C8NA 4HZ7A 1SFTA 3TJIA 5HMDA 3I68A 1OF6A 4ERAA 5IXEA 2DUAA 1BVWA 2W79A 4L9YA 2IMRA 2V6AA 1HTIA 3KTSA 5EBUA 2WC3A 3B97A 1U1HA 1OIMA 1CGTA 3AIQA 1GJWA 2ZRUA 3W29A 1X7FA 1NOWA 4DN1A 3GD6A 1PX3A 4QAWA 3WLSA 1RXOB 2ATMA 1DXFA 2J4GA 4GJIA 1ELSA 1ITQA 1V8EA 4Q8TA 1UKSA 2RJHA 3W1TA 3PPHA 3ZJ6A 4IT1A 3FNDA 1YDVA 1EUAA 4XKYB 3TN4A 5K4ZA 1H7XA 1B3VA 4HVXA 1SZEA 3U57A 1Q2RA 3UU0A 5AHIA 3UR5A 5LIYX 3UEQA 2FTWA 4LVDA 2A85A 4ZB5A 3B9EA 3NQAA 3KHDA 4L6OA 1GPFA 3WQOA 3CWOX 1NELA 2I9UA 2ODOA 2XWEA 1V3JA 1D9EA 1EH9A 3QC0A 2EPKX 1PZ0A 4H4IA 2V5KA 4BF7A 1SZRA 1JCJA 1UWAA 5HATA 4QGCA 2Y7EA 2WVVB 2PEVA 2DH3A 4S3EA 7A3HA 4ICNA 3GW3A 2IQDA 4LH8A 3OLDA 3H7RA 4IICA 1PEZA 2YXGA 3BC9A 3URBA 4CN4A 1RPKA 4MFDA 3WNNA 2PC8A 1A3HA 1ZLPA 1RBOB 3ZWSA 4FHAA 2OKTA 4J28A 5FL1A 5DX7A 3SSZA 4FMVA 3N12A 3UERA 1T0OA 3BCFA 3NSMA 4Z1DA 2E68A 3RIKA 1IQ8A 3GDRA 1QI3A 2O7SA 3W76A 4B3LA 2CWXA 1KXTA 3L4XA 3WLQA 1LLOA 3U6WA 2G95A 3OLIA 4FPSA 1US0A 3CMFA 5A8MA 1E9YB 3SGGA 4WQ6A 4JQ1A 4A4AA 4K36A 3BAKA 5D02A 3M5XA 2D3NA 3IAPA 4HPHA 1N8WA 4GG9A 3N9SA 2C0AA 3RM8A 1UASA 2QV4A 1MW2A 1UD2A 3BO9A 3LHUA 2VEMA 2BWGA 1IWAA 4AZBA 3GAYA 3R7MA 3KLKA 3G1DA 3SIZA 4B5TA 2PGWA 4XTIA 1P5BA 2XIJA 2NXIA 1HKKA 3T4WA 3GXDA 3N2BA 3QZEA 4MPKA 4J7RA 2A6LA 3BSMA 1XLHA 1FXQA 5TF0A 5FKYA 1J5SA 2QCDB 3UZJA 1I6NA 4TU1A 1E15A 1U1JA 4WXYA 5CZJA 1DHPA 2FPTA 3GIYA 5A6SA 2WHKA 4G2DA 4PUKA 3A3WA 1RJRA 4GLEA 2WB5A 1ZPTA 3CUJA 1TQJA 4F4RA 1JCTA 2ZRXA 5ABTA 3W00A 5BNKA 3PZQA 3KZSA 1N7KA 4AWEA 3T7VA 4UR7A 1O94A 5DO8A 2PBGA 3RILA 4W9TA 1O5XA 2YA0A 3F4NA 1TPVA 1PIGA 3CUFA 2QEZA 1HJWA 1EC9A 1EFZA 2E3ZA 4JZ5A 1PAMA 4FLRA 5HBFA 4JCMA 1ZBCA 3HGOA 1JF6A 1PIFA 4QEHA 2DU2A 3TWAA 1V03A 3PN8A 4S3CA 1XL9A 3T2OA 4IG2A 4MAVA 1RZMA 3WX7A 1XYCA 1MXDA 2I17A 3VKDA 3IEBA 1GKRA 3GFYA 4ATDA 4AD3A 4JTEA 5T26A 1EC8A 2J75A 2CZDA 1JPIA 3WUGA 4BI6A 4LF1A 1VEMA 1ECQA 4DZIA 5G4HC 3ABXA 3VX0A 2PDJA 3LBOA 4XUGA 1LWIA 2CLKA 1TWIA 5E9AA 1K03A 3S5SA 1TIWA 5CCZA 3I6EA 1WKFA 2HXTA 4MB4A 3TN5A 3PZNA 4XAFA 3W7KA 4P8WA 1PXGA 1X39A 1ZL1A 2OX4A 2G96A 2PDNA 1E4LA 5A6BD 3VIPA 4JIEA 5KTLA 1K8XA 4ATLA 1RLDA 1KGUA 4JY8A 2VO5A 1E6XM 5C0QA 2X2GA 4I8DA 3BH4A 4GOAA 3RGTA 2NUXA 5A5WA 3QV8A 1PHWA 4ERGA 3SRHA 3SQMA 3VNDA 4Q4OA 4YXGA 2TMDA 4H04A 4GHRA 4ZOAA 4C6CA 4Q8UA 3TONA 3W81A 3EAUA 3A4AA 3OLEA 4S3BA 3NIYA 3PFRA 2KAUC 4QJ1A 2ZICA 3OGSA 4H00A 1ITCA 3NG3A 3MP4A 4HOZA 4I3GA 4PRTA 3GNPA 3P67A 3GLCA 1QO5A 1MRAA 2DVTA 3W28A 4OOZA 3VIIA 3W07A 4O4VA 1DIKA 3MYOA 3EMCA 3H70A 1MEWA 1O6IA 3N19B 3CQKA 3FKKA 1O5QA 1WXJA 2Z28A 3U3HA 3VIOA 4ZODA 1GVSA 3SAZA 1NVMA 2C1GA 5C6MA 3OHMB 3AUJA 4GBDA 3PC0A 4QDWA 3BGGA 2D69A 4HJFA 5REQA 2XIQA 3TZNA 1NFBA 5DF0A 4S39A 4F79A 2H3BA 2C3ZA 4L64A 4AWTA 1POKA 3SCUA 1HL2A 1JZ8A 4UWMA 1TIMA 1QOQA 1M5WA 4ZSTA 3TLQA 3CT2A 2X0HA 3AXMA 5EMUA 2BOFX 2YBTA 3S2MA 2QUMA 2AOSA 4ZMGA 2WHMA 2BVTA 3WQ6A 3NQVA 3BJTA 3SR7A 1OCBA 2PF8A 5K9DA 4CN6A 2HZGA 4FNTA 2Q8LA 4KEZA 1E1CA 1OGGA 2X05A 3GXMA 1CGUA 3ARSA 2XDFA 2GGEA 2V8ZA 1UIOA 2WHLA 4MKNA 3VUPA 1MNSA 1SM9A 2PMQA 4L5ZA 2B31A 3E6EA 4U3AA 4HYVA 4Q6XA 1XS2A 2Y4SA 3UZWA 4HOWA 1J0IA 4IFKB 2VOTA 3OVQA 1XP3A 4CD4A 3KCJA 2E6YA 3TP4A 4CU8A 3MO7A 3OG3A 4GC3A 4PMOA 3O0KA 3WMLA 7TIMA 4ZO8A 1OYCA 1ZFJA 1W9BM 3KEHA 1PL9A 2BNJA 3P82A 4JHOA 4V27A 4GINA 4QP0A 1FH7A 2PURA 3AYVA 2PCEA 3VKAA 4B5XA 3LY0A 3G24A 1EEPA 3FXGA 1H7PA 3PBWA 4CD5A 3NDOA 4WEVX 4NNAA 2X7WA 2ZIDA 4G1KA 4C5YA 5I3HA 1UH3A 1TPH1 4B4HA 4ZQMA 1IIHA 2OEJA 1N82A 3QV9A 1YBQB 3KBJA 3D3FA 4YVXA 3AISA 1W1A1 2VX7A 4NU7A 3IARA 3RNDA 3EPMA 2AQOA 3UWUA 1WZKA 1Y0EA 3QC3A 1OBAA 1BKHA 4I9TA 2BGNE 4BKNA 1EF3A 5TD4A 1U33A 3TXZA 1B1YA 2YIHA 1XX1A 2IXVA 1ZJHA 4XAGA 3T6CA 3G3DA 4IPPA 4NIRA 5HJXA 5D09A 5D03A 3BAWA 3EOUA 3EWWA 1LRNA 4FOJA 2OSXA 2E67A 5I24A 3VD7A 3ARTA 3QF0A 2EG7A 3WF4A 3MKVA 1XIDA 5JBDA 3ARZA 4NILA 1GJUA 1IXNA 3F4DA 4OTKA 3SUVA 3VOHA 4GO9A 4QE5A 4MZ1A 4LCQA 3OJGA 4M82A 3M07A 3LD5A 4XD4A 1R0MA 4WKHA 1E3XA 4PB4A 1UC5A 2ON3A 3MT1A 1YYAA 3ZIZA 1SPQA 4ZOCA 5EFFA 4IMFA 3RRXA 1XPGA 1OX4B 2X2YA 3GTNA 4DXVA 4AXNA 1SFLA 3LM3A 1TZ9A 2NQZA 3CHVA 3JZEA 3H54A 4F48A 3SY1A 4LCRA 3SM0A 1MNZA 2HPMA 3HM7A 3UPWA 3VTRA 3WQDA 1U5VA 3IUHA 3W02A 3ZJKA 1ZRQA 3VDCA 3CWNA 4UFKA 5HUOA 4CEXC 1AZ1A 3BLOA 3G1AA 3PZUA 1G7VA 3GG8A 2WCAA 4OUIA 3VE7A 1BAGA 1KFLA 1W5OA 2GVJA 5D32A 3O6DA 1GOXA 1TVNA 1XYMA 1QHPA 4TX6A 2W66A 4DAFA 5D2WA 2QKFA 3S5OA 4QSFA 1MDLA 2C7FA 5C2XA 3HG2A 1UWQA 5TIMA 4LYQA 1PKMA 1TTPA 4H2CA 5E1QA 1MEIA 4GI9A 4DI8A 5JVLA 3FDKA 1A3WA 2PDKA 2NT0A 3GZ3A 1K77A 3UJ2A 3BK0A 3IJ6A 4P7QA 2BGQA 2W63A 5IBXA 2TSYA 2BP1A 1PJ9A 4UR8A 3HURA 3MDUA 2CFFA 3RUBL 1DXEA 3VCCA 4KGLA 4WF7A 3N2CA 4P8VA 2VCBA 4PFHA 1UR8A 2GFTA 2GGGA 2X1IA 1H60A 3MVIA 4A3QA 3TTEA 2OMAA 4JNZA 3N15A 1GEHA 1QPOA 1LL6A 1EJVC 4GXWA 4LYKA 1BTCA 3H4GA 3UZXA 4QLLA 3N18A 2VZSA 3HQPA 1MQPA 2XJ7A 4NZ3A 4OT7A 3JU2A 4NYYA 3BVJA 2DUZA 2JQXA 2VFHA 1YDOA 4OVXA 2YYTA 5BRQA 3V75A 3ZVHA 5A1AA 3TN6A 1EEXA 5FJUA 4PFMA 2OWWA 3W7OA 3L4TA 4OJYA 4X2RA 2VC9A 1U5JA 1THFD 4LGXA 1VCFA 4XTDA 4E2BA 6REQA 2D0HA 4B16A 2XM2A 2D20A 3APGA 3IGHX 4YVPA