3BVJA

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with xmp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
257
structure length
257
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Crystal Structure of Human Orotidine 5'-monophosphate Decarboxylase Complexed with XMP
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 99
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3bvjA00
3TIMA 5EYWA 5D2TA 1IF2A 4JIPA 1TMHA 1IXNA 2NUYA 2NX9A 1TPC1 2FTPA 2A0NA 2QCCA 8TIMA 5LKYA 5I3IA 2A7NA 3W1UA 4Y6GA 3DENA 5BMWA 4ZQCA 3OVPA 3ABQA 1M5WA 2E5BA 3I7RA 4DQWA 1FCBA 3VE7A 3EX6A 3SY5A 3H54A 2VFFA 3ABRA 5FEPA 4RKAA 3QQ0A 1RQBA 3EXRA 3WJWA 4TU1A 1YTEA 4CCCA 3LXCA 5AOUA 1AG1O 1F6PA 5D2WA 3VNDA 1H7WA 4GJ1A 3LCGA 1SW7A 1TRIA 3RFAA 3MMTA 4AF0A 4PFMA 4TR9A 3NQ6A 3BK0A 2W79A 1DJQA 4IXHA 3L66A 3W7CA 1O4UA 4FNUA 4XBSA 5HINA 3O6CA 3DKLA 5J5RA 3NVTA 1A53A 2Y63A 1TPH1 4O1CA 3E02A 3NQEA 1DOSA 3WJXA 4MUZA 3BGJA 3I6RA 1G4EA 1VRDA 1EWDA 1YYAA 4GWEA 5FEXA 3GR8A 1LLWA 2C6QA 2YYUA 2QCLA 5LGXA 1YLVA 2A85A 1UCWA 3PUEA 1WX0A 2AGKA 1S5TA 3G1AA 1JRBA 1CX9A 3BW3A 4GUHA 5BRBA 2C16A 3MHFA 1FXQA 5G1TA 2OCZA 3QFEA 3G8RA 2FPYA 2Y7FA 3V1PA 1FWSA 3ATZA 2B7OA 3HG2A 5I3KA 3M16A 3K30A 2VEMA 2OJPA 4IPIA 1BEUA 5D02A 4NNAA 5D2XA 3WK0A 2WKJA 2WV8A 1VHCA 3HQ1A 1W5QA 2NV2A 3LCWA 2TRSA 3IIVA 1JCJA 1KFBA 1NSJA 1JUKA 4JTSA 3R8RA 1OFQA 3LBMA 4HT3A 4I7UA 3PS7A 5E93A 1JRCA 1W1ZA 2ZRXA 4B5NA 4GNJA 4FNRA 2E6FA 2O7SA 3C2EA 2QDHA 1OF6A 3DI0A 3GDTA 1XL9A 3LTYA 1R2TA 4XBKA 2O7QA 3NA8A 1BWKA 1ML1A 3TR2A 1NFBA 5K3VA 3GXNA 5EPDA 5HWJA 2Y89A 1W37A 3NM3A 1HFBA 2A6LA 2X1SA 4LY8A 3HG3A 3CHVA 3GDKA 3M43A 4ZQNA 4P61A 4QNWA 3WJZA 1RD5A 2ABAA 2CZDA 3WJSA 3P84A 3AJXA 4Y8FA 1KM6A 3I65A 4U4MA 3W73A 3RU6A 3C2FA 3NNTA 2Y88A 3O6DA 4UFLA 3HMJG 4DF2A 5CSSA 4NX0A 3CC1A 4FNQA 2VOMA 1GT8A 1PS9A 2GVJA 3EXSA 2NUWA 3RNDA 3W84A 3RLUA 4Y96A 3HBLA 1SQ7A 4DO4A 1H61A 1LCOA 3E12A 1X8FA 5I3FA 5IBXC 4O50A 5F1UA 4JYEA 3IVUA 3NQFA 4QISA 2BZNA 1JUBA 4UUIA 2WNNA 2ZRVA 1GOXA 2A4AA 3LB0A 4N4PA 2BXVA 3BO9A 4JEQA 4I9AA 1H7NA 3DHDA 3DZ1A 5KITA 1IXQA 3EX2A 3LHUA 4PEKA 3B04A 1W3NA 3GZ3A 4E2BA 1DQWA 1K7XA 4XZ9A 1KLYA 3E9AA 3BW4A 1JVNA 1Q6LA 1LBFA 1VJIA 3CTLA 3ABSA 1G7UA 2F7FA 3QSTA 3NPXA 1TJPA 1VQTA 3BLFA 6ALDA 2HS8A 4L4LA 5FF0A 3GX9A 4RXGA 3GXTA 2B7QA 3GAYA 4OT7A 1QDSA 1O5XA 1S5VA 1QFEA 3F1QA 3L67A 4PODA 1ME9A 1QMLA 1KM1A 2OZ0A 4WX2A 1K03A 2EGZA 3NQDA 3M9YA 3EX4A 4QSHA 1I2NA 3NG3A 3VCRA 1THFD 3HOJA 2HTMA 3C2OA 3FKKA 3GXPA 1F7BA 2BSLA 1SZEA 2GVLA 1WYIA 3W7EA 1N7KA 4C1KA 4JTLA 2X16A 5TQLA 4FIQA 3TUUA 4K8EA 1BWLA 3BW2A 1FQ0A 2ZA2A 5EA9A 3TQVA 2FDSA 1LM1A 4LVAA 1KLZA 3M6YA 4CNNA 1GG0A 1L6YA 3OBKA 4UMAA 3TCEA 5BW6A 3M47A 3CT7A 4CCEA 2V5BA 3LHVA 3THAA 1G69A 3L5MA 3B06A 4RCXA 3W7NA 3W2JA 2V5LA 1E51A 4ZQRA 4U28A 4BK9A 4HNUA 1DVJA 3LXAA 3P8JA 5F2IA 1TPUA 1W5PA 2JKAA 1F05A 2FIQA 1XBZA 4JX5A 3HGRA 3LLFA 3MYOA 2X2GA 4GUIA 3P61A 5SWUA 3NPVA 4MIMA 3IIZA 1YXDA 3HB9A 2B7PA 3TC6A 4DO5A 4GC4A 3GDRA 1GVOA 3NL2A 3PSVA 3TJXA 3MW7A 2GQAA 1H51A 3F4NA 3A24A 4WY0F 3P7YA 3GKAA 2C15A 3P5ZA 3TH6A 3SECA 3N9SA 1J5TA 3JS3A 4OV9A 4IXXA 1J2WA 4A2SA 3UWVA 4AEOA 4UFMA 4UTMA 5D09A 3IEBA 5F4WA 1SO3A 3LX9A 1ZALA 3ZS4A 3L0KA 4LV4A 1S5WA 2QF7A 3NQAA 3NYZA 2QKFA 3TFXA 3TQKA 2JK2A 1WQ5A 1YTDA 2Y6ZA 4TMBA 4A22A 2QJGA 2X1UA 1A5SA 2E6YA 2J9YA 4HKPA 3UD6A 3W87A 4NX5A 1W3IA 1M7OA 4OV4A 4PL1A 1JQXA 3KXQA 4FNSA 1Q6QA 1K8YA 3NPWA 3C52A 5FI8A 3FYPA 3M5YA 2Q3RA 1KTBA 4DPPA 3B4UA 3TAKA 1OX4A 2A2IA 3G1SA 3DFPA 3QEZA 5U4NA 4MZ1A 1WOAA 2Q3OA 4MLJA 3SR7A 4NVTA 2DZXA 3G24A 3BG9A 1EP2A 3TDFA 2ZTJA 4QJ1A 1XM3A 3TXZA 3ZWSA 3THQA 3TA6A 1QAPA 3W07A 3W6YA 1NEYA 5H2ZA 4AWUA 3PBWA 2V2CA 3STEA 3NGJA 1PCKA 2CLIA 2A1YA 4IOTA 1B4EA 3IIOA 2DZVA 1SSDA 3EKZA 4YLWA 5LHEA 1MO0A 2CWNA 3UQNA 3FIGA 4JTHA 4M19A 1OFRA 5I3GA 1HL2A 2TMDA 2GQ9A 3PAJA 1RPXA 5AYZA 1QO2A 3A21A 5BNKA 2FLIA 5G2HA 4WY0B 1K02A 3P5YA 4HSOA 1LLZA 2J9ZA 2QCNA 4O11A 4X22A 3JRKA 3S5ZA 2B7NA 2VEPA 1TPDA 3SGUA 4NJKA 1ZFJA 5AHNA 5EY5A 5K9DA 4JTGA 1MZHA 4JDBA 5D05A 4ZMGA 2NX1A 1VS1A 2RDWA 3PM6A 4IMDA 1XFBA 2V81A 1VGAA 2CLLA 5DXXA 4MPQA 1Z42A 4LW7A 1WAUA 2DJXA 3BLIA 3OA3A 2IQTA 1KV5A 2R91A 4M7TA 4E2DA 1WBHA 4O54A 1TCDA 4Y90A 2NXGA 5D2VA 1LTDA 4GRSA 2YSWA 1HUVA 2ZZ1A 1UJPA 4HNTA 5LNUA 3T4CA 4JICA 3C56A 1SFLA 4N9CA 5EBUA 2QEZA 1JCLA 3EX1A 5D04C 2H3DA 4O13A 1R30A 1H5YA 1XDMA 3KRZA 4JTKA 2X1RA 4LUJA 5D38A 2CLKA 4S2CA 4KWWA 5LZLA 3IRDA 4O0KA 3PG9A 1V7YA 4MOZA 1I2PA 1Q3NA 3SFKA 1MSSA 3O6YX 4NXSA 3W22A 4MY9A 3TNOA 4DBEA 4EWND 3S8HA 3G18A 2QUVA 3O15A 2ZRUA 1FCUA 3R2GA 4DELA 3UWQA 1OFDA 3O1NA 3PBYA 4JYDA 1TTQA 5AHIA 3CLMA 1H60A 1OFAA 1X1OA 1ZNNA 1P1XA 2FQIA 3PULA 1SU5A 2ZCGA 4OWGA 3M44A 1TPB1 4LC8A 4Z1AA 2V30A 2NX3A 1WBJA 1Z44A 1P0KA 3IGUA 1C8VA 4Q33A 4LV9A 3W1PA 1YPFA 1LZOA 1TB3A 2TPSA 1YTKA 4LC6A 4H4IA 3PSWA 1N55A 3IGSA 1OG0A 3AO0A 5FEZA 3MP4A 4Q4KA 4DF0A 4ZQMA 1UBSA 1FWWA 2Z2UA 1SW0A 1QO5A 3CWNA 3EWBX 1LDCA 1KTCA 1S3HA 3NR0A 5G5IA 3GK0A 1WV2A 4AHQA 4GUJA 2ISWA 4UFIA 2QCMA 2GJLA 5HJLA 2VKZG 4UC5A 1GYNA 1VCGA 1G67A 4WZHA 3W3OA 2A7RA 3C8FA 1ICSA 5HMSA 2WPBA 3LRKA 1OK4A 3KVLA 2DJLA 3RK8A 3NQ8A 1F74A 1W56A 4ZQPA 4MYXA 4OU1A 1IXPA 1YXYA 2V8ZA 2WO5A 3W1NA 1TTJA 1LROA 4DXVA 3QJAA 4RX0A 4RZ4A 5K9XA 5AYXA 2ZZ7A 2J9XA 4UTTA 3UY7A 1UASA 4OBTA 4UR7A 3GAKA 3T40A 1RV8A 3NO5A 5FF2A 4KFPA 4OHQA 4POCA 1L9WA 3NPUA 3OHIA 2BLEA 3NQGA 4JTIA 1KM0A 3W1LA 4UNKA 3W1RA 2XN0A 3A9IA 1QNVA 4NJGA 1QPNA 1OX6A 3VFLA 3TV8A 2RKXA 3HJZA 2YFOA 4IGHA 4NT0A 1DQXA 3T55A 1I2RA 5F4SA 4C1LA 3TROA 2C1HA 1FDYA 5CZSA 1OHLA 2E6AA 2QR6A 4AH7A 3NQMA 4AF0B 4ZVJA 1EUNA 3TW7A 5CPMA 1H1YA 4FNTA 5CKSA 3SJ3A 4YCPA 2J27A 3MBDA 3O8AA 2CW6A 2Y85A 1IIGA 4O52A 2VFHA 5AC8A 3TC7A 2E6DA 2G96A 4UIOA 4UFKA 4EOUA 3B0PA 4LRTA 1VZWA 3GYEA 2G5WA 4LVDA 1BKSA 2P10A 3PWAA 1W5OA 4AXKA 3T78A 2HS6A 3GB6A 3W7MA 4ORIA 3NOEA 3P81A 2I14A 4RV8A 5K4XA 1W0MA 1H1ZA 4H3DA 4IX2A 3FEMA 4EF8A 3QZEA 4K37A 3VE9A 3U8GA 3HO8A 4G1KA 4NZJA 1I2OA 4XTIA 1IIHA 4UTHA 3W2MA 1UB3A 2C14A 2QCFA 2B4GA 1FDZA 3KAOA 5HR6A 3UPBA 2ZZ3A 1JQVA 2VENA 4YWIA 3HIJA 3U6WA 5D2YA 3LBCA 3OVQA 5I3JA 1G4TA 3PUDA 4M5PA 3MI3A 2PC4A 1FCVA 3PG8A 1TPFA 1XKYA 2Z0IA 5AFDA 4JS3A 1VPXA 4RZ5A 2OT1A 2WSQA 1OVDA 1YDNA 2CLMA 2Z1BA 4N9BA 2V9DA 3DU0A 1YXCA 3STFA 3KRUA 2E1DA 4IMGA 3FKRA 3OIXA 3N34A 4FXRA 3LGEA 3Q94A 3A22A 4UR8A 1ZAIA 4KFNA 1SPQA 4AB4A 4LRSA 1R2SA 4RR4A 5DN1A 1QWGA 1ZENA 3EX3A 2PURA 3STCA 3MBFA 3ANYA 5DBUA 4N02A 3SZ8A 2EKCA 3B05A 4N2YA 5TIMA 1Z48A 1HO1A 2QCEA 1PV8A 5DELA 3W75A 4O1AA 3W88A 4N6FA 5G4WA 1DBTA 4Q32A 5C2XA 2DZUA 4I7VA 4CCDA 2VELA 3O05A 4PCFA 4EIVA 2ZDRA 1JCMP 2VFIA 1MEHA 1SZNA 2YYTA 3PVFA 3SW6A 3LDVA 3PR2A 4GUGA 1K7FA 3LCLA 3L65A 2D73A 4UTTC 1TV7A 1OFEA 5HUOA 4XKYA 2CFFA 3S5OA 2YW4A 3T7VA 3NAVA 2W0UA 3TK7A 2BTMA 2HSAA 2A6NA 3QPYA 3GKFA 4XUGA 2V82A 3HPXA 1WDWA 2H8XA 2E5DA 2VFDA 3BGGA 1JCNA 3C4UA 3W7KA 5L6UA 5A5WA 4FEZA 2JKEA 4P2VA 1W5MA 1T99A 2E77A 1QOPA 1M6JA 2EPHA 3PUOA 3N3MA 4R53A 1XC4A 4O1DA 5C54A 1LOQA 2AAMA 2QCHA 3LCIA 1H7XA 3DKJA 4LVGA 3IIPA 4WXZA 4NNCA 3L5LA 1TO3A 1EEPA 1VHNA 4LVBA 3C2RA 1OYBA 3W2UA 3MYPA 1U5JA 3M41A 3G1XA 4JYFA 4RZ6A 2ISSA 1GTEA 1ZAHA 2A5HA 4UTKA 2GPTA 1XUZA 3C3NA 1OX5A 3CU2A 1NVMA 1TQXA 3IGXA 3L5AA 5HNRA 2C3ZA 2QUTA 1NF0A 4LUIA 3W9ZA 3TU9A 3WK3A 2FB2A 1L6SA 2VXNA 2QAFA 5CZJA 3CM4A 5DCDA 3FA5A 1R2RA 2Y61A 1KBIA 1EP1A 4M6PA 3QH2A 3L9CA 4UMBA 4FNPA 2WJZA 3TAOA 4OE7A 4O14A 4O4VA 4UTWA 3UPWA 3F03K 1TYGA 4GE8A 3G0XA 1OF8A 4DPQA 1OFOA 3HG5A 3DH7A 3EWZA 1XDLA 5U7SA 3W1XA 2Y7EA 4FO4A 3NQCA 4N9DA 2DORA 4ORMA 4RLIA 2EAWA 1KFKA 5LHFA 2GVGA 2E5CA 4BI6A 4NJHA 4O17A 5F2LA 3MWAA 5LNSA 3DFNA 3USBA 2CLOA 4X3ZA 5G1YA 1W54A 2Z6JA 5K7JA 4R33A 2WQPA 2A21A 1ICPA 1GVQA 1HTIA 4TX9A 1TPEA 4O0ZA 1AL7A 1GVFA 2KZHA 1B9BA 1GPWA 3EEGA 2QCGA 1LOSA 1A5CA 1RQHA 3P62A 4MFDA 3TSMA 1QPRA 3P82A 5EMUA 3CIWA 5BOOA 2Y7DA 1W8SA 5J5DA 1AK5A 2GQ8A 2ZRWA 4XQ6A 1H63A 1M7PA 3IVSA 3NM1A 3C2VA 5EKYA 5BMXA 2RHGA 2H8ZA 2VFEA 3YPIA 3QF0A 4LTSA 1OYAA 3L21A 1VYPX 3QW3A 3W7DA 2B0MA 1OFPA 3M0ZA 1LYXA 3BVJA 4K6AA 3JR2A 2RDTA 2RFGA 4JXCA 3W1MA 3QPZA 3V75A 2GJNA 2ZTKA 3FS2A 4XWUA 1PE1A 3W71A 3PF3A 3B0UX 3W72A 4JTUA 2A7PA 3CEUA 1TSIA 1XI3A 3KVJA 4O28A 1OX4B 5I3HA 3PY2A 2BX7A 2FB3A 4MJZA 2ZA1A 1ME8A 3L2IA 1GVSA 4E0CA 1L2UA 3EWYA 4Z1DA 3TE9A 1VYSX 3S0CA 2EF9A 3W7LA 3I68A 3KVKA 2ZZ5A 3PB2A 1LBLA 5L9FA 3SI9A 2ZYFA 4WXYA 3CB8A 3L0GA 2ZFAA 3DFQA 4IWWA 3Q58A 3NL5A 4O8RA 3WFAA 4Y9AA 3M5ZA 3QC3A 3W74A 3CPRA 1H7PA 1BTMA 1T96A 2PE4A 3WJYA 2V2HA 3C6CA 1J4EA 3SIZA 4K38A 4TO8A 1TV5A 2ZRYA 5E1QA 4AWTA 4JD4A 3Q37A 1RR2A 4JGDA 3W86A 1WA3A 3L0NA 1DJNA 3DFSA 3MI2A 4LU0A 4UMCA 1ZHAA 2I9EA 1RZMA 2QAPA 3LHWA 2CLEA 1VC4A 3CIXA 3G1FA 1SW3A 4YXGA 1QOQA 3GLCA 5D33A 4AWSA 5F4XA 2C0AA 1XBVA 1O5KA 3R13A 2FJKA 1I4NA 1SSGA 3UWYA 1KA9F 2ATMA 5AB3A 2PRMA 3H53A 3DGRA 2GOUA 4HIBA 4NZFA 3N2MA 4LOCA 2YFNA 4MFEA 3BLEA 5D37A 4WUIA 4UFJA 3QQ1A 4WJEA 1C9DA 1Q6OA 4UTWC 5K2ZA 3LCHA 2CZFA 3W76A 3UYCA 3NQ2A 3S1WA 1WOBA 4DEFA 3W2KA 2NUXA 2Q8ZA 3KHJA 3ABOA 4GXMA 4GBUA 3LOTA 4BWLA 1DV7A 2H90A 3LI0A 5A8GA 3LTSA 2Y70A 2QCDA 3LV5A 3GDMA 2YPIA 3N19B 4R34A 1N8FA 3GNNA 4DBDA 3W7JA 2ALDA 4CNOA 3EXTA 2QDGA 5DXYA 4GUFA 1Y0EA 2I1OA 3S5YA 3SGZA 1JJKA 2WNZA 4LVFA 3E0IA 4IUOA 3KOFA 1X6UA 4L4MA 2TYSA 4JX4A 1JR1A 4KFOA 3IVTA 2RDUA 4CNPA 1EIXA 3G0UA 4N9EA 4PTNA 1ZY9A 3GIYA 5CZTA 3TSBA 3PBUA 1YDOA 1HG3A 5AYYA 1HO4A 3FJ6A 2YR1A 2PCQA 3W7GA 1GZGA 4ONVA 4MZYA 1DORA 1FY6A 1YPIA 2AQWA 3M7WA 4A3UA 3G1HA 3BPWA 5DBTA 2QCDB 3S5NA 4WD0A 3UWWA 2QUUA 2FPVA 1EP3A 5DY2A 5K9CA 1YADA 4HN4A 3W85A 5CGQA 4H6KA 4D2JA 5FF3A 3P60A 2NWSA 3TXVA 3G0SA 1LORA 2ZZ6A 1MXSA 3NQ7A 2C19A 5KSWA 2RH9A 4Z1BA 3BARA 3VKJA 4BI7A 4O10A 7TIMA 1OFBA 1CI1A 4O19A 2ABBA 1D3GA 1KFCA 2Y7GA 1XXXA 3VI2A 3UZ5A 2P0OA 3I7QA 4OQVA 4LT9A 1KFLA 3RLVA 5KTLA 3HGOA 1EX5A 4NJIA 2Z6IA 3QMSA 3GNDA 1KM5A 3DXIA 1KM3A 1SO4A 1H50A 3G1DA 1ZCOA 1ADOA 2ISVA 4OGZA 2CLFA 4Z08A 1AW5A 3W7QA 4LWWA 2WSRA 4DF1A 1I2QA 1R46A 4M6QA 3W2LA 4M6VA 2DZTA 3IV3A 2ATSA 3LRLA 1P4CA 4Z0JA 1PIIA 2VEIA 3QMRA 4HSNA 5F2MA 1SUXA 3CQ0A 2OT0A 4ADUA 4BFAA 5LSMA 2Y62A 1OK6A 1TTIA 1KBJA 2UV8G 3INPA 1G4PA 2JGYA 1SZGA 3GR7A 3LHTA 3NL6A 1F5ZA 3MJYA 4UCGA 1B3OA 2CLHA 5HWNA 4XTDA 3LV6A 5FF7A 1TJRA 4UTIA 3ZWTA 4AAJA 3GVGA 1FXPA 4HPJA 3TW6A 3KX6A 3LLDA 3W1QA 3W23A 1R47A 3A5VA 3UWZA 5HR7A 3KRSA 4O4WA 5C6MA 4BR1A 3MP3A 1DL3A 3C0JA 5C55A 1FUYA 3LCXA 4I7WA 1VLWA 1QCWA 3FYOA 4MY8A 2WNQA 1A5BA 2NWRA 5EL1A 3G1VA 3P80A 1VLIA 1GQNA 3TX9A 3S1UA 3TKFA 4A29A 1G4SA 2QJIA 3PB0A 4N6EA 2X30A 4S1FA 1CW2A 5LGZA 2XFWA 4S2BA 4IX0A 5CSRA 1Q45A 4E38A 4JTTA 1JUEA 1VCVA 4ALDA 5K4ZA 3W1TA 3NDOA 1EUAA 3N14A 3Q2DA 1XBXA 1K8ZA 5C5YA 3P67A 4NUWA 3ZFHA 2XN2A 1VH7A 4EVZA 4M7SA 4BWLC 2CZEA 1KW1A 1U83A 3B03A 1FX6A 3N73A 4YL2A 5HUPA 1EPXA 1W31A 1EB3A 2H3BA 1I45A 3UXAA 5G4EA 1B4KA 5KINA 1A5AA 3UNDA 5AHEA 1AMKA 4O15A 4CQ9A 3O16A 4QIUA 1X1ZA 3E49A 1P0NA 4QNEA 4IPJA 5LNVA 5E0KA 1KM2A 1KTNA 1TREA 2JKPA 3LHZA 4HPXA 2R14A 4NJJA 4K8HA 4MZ8A 4NU7A 1AL8A 5D03A 3QMTA 1MEIA 5LNRA 1F2JA 1TQJA 4IMCA 4PA8A 4JX6A 3TMQA 3MUXA 1P5BA 5AN7A 3LHYA 5DLCA 3R5EA 5G2IA 3F4WA 4FB7A 4FX7A 2EHHA 3EWXA 5D32A 1D9EA 3S42A 4O53A 4RK8A 2VC6A 3I7SA 4QM1A 1K8XA 4JTEA 4NNBA 1PVNA 1ZJIA 3MP5A 2NZLA 3LM7A 1GTHA 3EWUA 2VEKA 2C18A 3CEPA 5AHFA 3NZRA 1O94A 1EWEA 2ZZ2A 5GVJA 5KMYA 3MI6A 2WOQA 3NQVA 1K7EA 1GWJA 1IXOA 5F2GA 1NF7A 2LLEA 4QQ3A 1QPQA 1TPWA 3NXFA 3QRHA 5HQEA 4JR5A 3MHGA 3NEVA 2ZRZA 3O63A 2JBMA 3W83A 4IMFA 3P8IA 1VCFA 1H7OA 4A2RA 1G6CA 2FPTA 2GUUA 1SO5A 3EB2A 1TTPA 3R89A 2R8WA 4WOQA 3S6DA 3H55A 3DBPA 2OMAA 3W1AA 3LERA 2R94A 3B8DA 4QITA 1F6KA 4XKYB 3FLUA 4BI5A 4JN6A 4JY8A 1SFJA 5AC7A 2DZWA 2H6RA 1KFJA 5CPOA 1LRQA 3M5VA 1SR9A 4UTLA 4MJMA 4KKXA 2JGQA 2G97A 4WOZA 4HNVA 5DCEA 4KWVA 3W7RA 3HG4A 4YMZA 2X1TA 5KZMA 1GEQA 1RVGA 3BG5A 1RQEA 3NL3A 3W70A 3UWUA 1TRDA 4MY1A 3BV4A 3E96A 5HULA 1DKWA 4ADTA 5FF4A 3STGA 1JCXA 4PL2A 5FEWA 1JCYA 3UXDA 3DI1A 3SSJA 3LI1A 1H62A 1PL9A 1Z41A 3C61A 4UNLA 1X7FA 2NV1A 4MKNA 4W9TA 5G2WA 3RMJA 3ELFA 1XCFA 4JIQA 6TIMA 4AHPA 1FDJA 3PC0A 3HGSA 4JY9A 2YXGA 5D30A 2YW3A 1K3UA 2NXIA 1V5XA 3TFCA 1LOLA 4K36A 4LS1A 4X9SA 5LNWA 4UFHA 3HGJA 1GYLA 3MHUA 2NXHA 4FXSA 1L6WA 4FF7A 1GG1A 1FWNA 4LNYA 4RXFA 5CG7A 5ABTA 4O57A 1WXJA 2W6RA 1YDVA 4MLRA 1TV8A 4ML9A 3W7HA 2F84A 1ZAJA 3FJLA 1T8XA 3W7IA 3KFTA 5DY3A 2V0TA 4CLMA 1SZFA 3N9RA 3RF9A 2VFGA 4IQLA 3WK2A 3DHFA 4ZZ9A 5CPLA 2C13A 1FCQA 1W5NA 2CZ5A 4DO6A 2BWGA 2ZQ0A 1OJXA 1O60A 4O18A 4WY0A 1KM4A 2CU0A 1UUMA 3FFSA 4NXKA 5H91A 1A50A 3OVRA 4O1BA 1H7RA 1Q6RA 3OG3A 2DU2A 2J24A 3HPSA 2TSYA 2ZBTA 3LXBA 4PC8A 3TJLA 2G95A 5TBOA 5AHMA 3HF3A 4Z0SA 3G3MA 3R12A 3W7OA 4WQ6A 4JTFA 5HWMA 5CZ0A 1G7VA 1TPVA 4LS2A 3EKLA 1ICQA 1LBMA 1DHPA 4O12A 1PHWA 4FX6M 3T44A 1ALDA 3W7PA 1UUOA 3B0VC 3D0CA 4ZL1A 4CQ8A 1LP6A 4TMCA 1FWRA 4AMAA 5AC6A 3P74A 1C29A 3O07A 3TMLA 4UXDA 3UZJA 3NZ1A 4BF9A 5FESA 4X2RA 3LCFA 1KV8A 1JULA 1SO6A 1F73A 1GJPA 5MHBA 3G8EA 1D3HA 3QW4B 3BG3A 2YGYA 4MYAA 3DFTA 3S1VA 4IJBA 4JTJA 4A21A 1LRNA 3A5FA 4K7VA 1QR7A 1GVRA 3U2OA 2FFCA 4LS0A 2YDAA 2E09A 5T26A 4O16A 3TQ0A 3DAQA 4ICNA 2PRLA 2DZPA 1OABA 1ME7A 3QSRA 2Q8LA 1NAL1 2P1FA 4JNMA 3GDLA 2DZSA 4Z1CA 2ZZ4A 3N2XA 2PRHA 1IGSA 3QM3A 3W2NA 4ADSA 4K39A 4NQ1A 1T0OA 4UTJA 2WSYA 5KZDA 4K7YA 1AW2A 3FOKA 2YCEA 1VYRA 3LTPA 4FIRA 1W3TA 1QPOA 4RJEA 1F76A 3DFOA 1FWTA 3ZR4A 3G1YA 1ONRA 3IIXA 3S9YA 1OYCA 3KVMA 2E68A 1EA0A 1PCWA 2YX0A 3A23A 5KZEA 2QJHA 4UTUA 1XBYA 4J9JA 4FHAA 4CQAA 3WK1A 4QAIA 4FX8A 1VR6A 4MVAA 1MEWA 4AVFA 4EF9A 2ZA3A 4AHOA 1O95A 1LRTA 1PHQA 3EWWA 5CPNA 3LRMA 2NLIA 1AW1A 3S1XA 3MO7A 1B57A 2XN1A 4IMEA 3M5XA 3ATYA 5IM51 3M1ZA 2YZRA 3CWOX 1FBAA 5AHLA 2DP3A 2V2DA 3G3DA 2J88A 4GFSA 3HPZA 5DCBA 4N4QA 4YCOA 2J6XA 4HNNA 5F1VA 4R7JA 2OX1A 3G22A 3PBVA 4ZQOA 4HHPA 2HMCA 1TIMA 1I8JA 4JDYA 3UY8A 3OEXA 3QYQA 1KFEA 3L68A 4TIMA 5IBXA 3TSDA 3O06A 4PH6A 1XUUA
chains in the Genus database with same CATH superfamily
5A6BA 3TIMA 2J62A 4EPKA 5D2TA 4RE4A 4BQ4A 1IF2A 1XH1A 1TMHA 1UQZA 2AL2B 1FHDA 2FTPA 8TIMA 1FWJC 3DENA 5BMWA 3VE7A 2YB1A 3DUGA 4L64A 1VBUA 1GVIA 4RKAA 1HQTA 3QR0A 3MCOA 2OXNA 4TU1A 1AJ2A 4CCCA 1H7WA 2QLYA 3LCGA 3UR8A 3GS6A 3NOYA 4ZFMA 4PFMA 4JTDA 3VIPA 3BK0A 2W79A 1XIDA 3P0WA 2FFIA 4AY7A 4XBSA 3FAWA 3H2MA 3O6CA 4EACA 1US2A 3GVQA 4W86A 4I90A 3MZNA 4O1CA 4XO7A 3LPGA 3WJXA 4MUZA 1TWIA 3ABZA 4GQGA 4BF5A 2PTWA 1G4EA 3KOYA 3G1RA 1EWDA 3UR2A 3UXIA 4MDPA 3N4AA 5FEXA 4NZ5A 2D0FA 1M7JA 2GJXB 2BXYA 5LGXA 5JH1A 2PGWA 1KXQA 3PUEA 4M0XA 3BAIA 1R9ZA 2AGKA 1UOZA 1JRBA 2XVGA 1CX9A 4XZMX 3AIRA 5BRBA 1VEOA 1CWYA 2BVYA 3VNLA 4ZA0A 4F8XA 3SGGA 1WB0A 4O1EA 3HG2A 1RLDA 2PLCA 3M16A 2DT0A 2WB5A 4QLLA 2XIIA 4LAUA 2VEMA 4GH3A 3AXHA 2GGEA 2OJPA 6A3HA 4WJXA 1IHIA 4MUPA 1PZ2A 3P14A 4DZAA 4DXKA 5BOFA 1IR2A 3LBOA 5CG0A 1XKJA 3NEHA 3WQ8A 1KFBA 1NSJA 4LF2A 3C0QA 3NZGA 1OFQA 3LBMA 5E93A 2DVUA 3PZ9A 3PZNA 4FNRA 1EYWA 2QDHA 2JIEA 3GDTA 2XSXA 4GYKA 3TR2A 1NFBA 4GQRA 4MMWA 1U1JA 3UYIA 1VEMA 3CHVA 2O92A 1JYWA 2IKIA 4DJFC 4D1IA 1TR1A 2ABAA 3IJ9A 2UY3A 4Y8FA 3I65A 1GGOA 4H9YA 2Y88A 3O6DA 1XCWA 1KXHA 1J18A 1GT8A 4JQ4A 2DVXA 4B9YA 3RLUA 3FYYA 1H61A 3E12A 4H9MA 4J2MA 5I00A 1QI0A 1EGMA 5T8GA 2PB1A 1E6QM 2DH2A 1S2VA 1MW2A 2WNNA 1A0DA 2OYKA 1IZKA 3ITCA 4L56A 4JEQA 1V8EA 3DHDA 1IXQA 4D6HA 2GYIA 1A0CA 4HTBA 3LHUA 3BAJA 3VXGA 1TX2A 2OEMA 1V7AA 4IIGA 3BMVA 4AFYA 5BOEA 2Z7GA 1KLYA 3KZSA 3XIMA 1W1A1 1JVNA 2Y5SA 2F7FA 4M80A 1VQTA 4P8XA 4MAZA 1X6NA 4OT7A 4PUUA 1O5XA 3K46A 1S5VA 4LYPA 3VD3A 4XUYA 2WBKA 1FWAC 3F1QA 2A3HA 3PFRA 3PZOA 3B8SA 1KM1A 2OZ0A 1K03A 2EGZA 3R43A 4QTGA 1WDSA 3FHAA 4QSHA 1P0EA 3NG3A 1THFD 5HJXA 2VUNA 4DN1A 3GXPA 5CPTA 5DEZA 3UG3A 5A2CA 1WDPA 3R4IA 5HBFA 3LG3A 5LIUX 4W88A 1N7KA 1XHGA 1RA5A 4LBSA 4S3FA 1R9YA 2FDSA 3ZT7A 1ZQ5A 4CNNA 4F0KA 1GG0A 1L6YA 3OBKA 1FP9A 2V5CA 1QNSA 3PNUA 3N29A 3QN3A 3M47A 3WLKX 1G69A 3WD2A 4LPCA 3USZA 4BK9A 4QE1A 3LXAA 3VIOA 4UOJA 4GNKB 2PLKA 4DVOA 5ABFA 3ARXA 4JHMA 4MIMA 3IIZA 3HB9A 4I5XA 3TC6A 1PEZA 5REQA 1GVOA 1JZ6A 2DSZA 4AIUA 3TJXA 4N0RA 4WY0F 3GKAA 1YBQA 2CHNA 2DT3A 5JUVA 3DEQA 3SECA 3N9SA 1J5TA 3TLLA 4J3UA 8A3HA 1J2WA 3GXFA 3ZOAA 1J96A 2EPMX 4AYSA 5D09A 4YTUA 5F4WA 3VOCA 2OEJA 2A79A 3HFTA 5HMDA 3JZEA 3ZS4A 2VYOA 4L5ZA 1BXNA 3QY8A 2WJDA 3NYZA 1XIFA 2WMFA 3PZTA 1YTDA 4TMBA 4A22A 2C1IA 5JU6A 3BAWA 2J9YA 4C5ZA 1G9HA 4HKPA 3OVGA 3UD6A 3FEQA 1PYFA 4OV4A 3B9AA 4PL1A 3UCDA 3ARSA 5CCZA 4H9XA 4UR9A 3NPWA 3M5YA 2UBPC 5A6JA 1R5YA 2A2IA 3DDMA 1IWAA 3GVRA 3M7SA 3QEZA 1GOKA 1GQLA 1WOAA 4MLJA 5M2FX 4L1WA 4QJ1A 3TXZA 4B5UA 2ZC8A 2PU0A 4XO6A 1QAPA 2E7FA 3EA2A 3H7VA 3W6YA 4US6A 1OT2A 1BD0A 1RLCL 2V2CA 4L6DA 3STEA 3ARUA 3HU7A 3NGJA 1PCKA 1G0CA 4HA1A 5LHEA 1MO0A 4XD5A 3FIGA 4JTHA 4S3AA 3LNMA 4WHBA 3A21A 5BNKA 2FLIA 1XYZA 5G2HA 1K02A 1OGBA 2J9ZA 1C91A 4O11A 1UR8A 1PSCA 2INFA 1EEXA 3KEHA 2CITA 5AHNA 4L80A 2DV0A 3WCZA 1VS1A 4X2PA 3PM6A 2G3FA 3WG6A 1VGAA 7TAAA 1MUWA 3MKKA 3LS9A 3H2AA 2DJXA 4LW7A 5XINA 3OA3A 3WMCA 4QDPA 1KV5A 3GC2A 4OBRA 4Y90A 2NXGA 5D2VA 3LENA 4GRSA 2G3JA 2ZZ1A 1TMQA 1UJPA 2DDXA 4JFSA 3IPWA 1U1HA 1JCLA 3EX1A 3A4WA 2B81A 3N1AA 1S1PA 4O13A 1R30A 1KCKA 1XDMA 2CXGA 3TYEA 4KWWA 5LZLA 3IRDA 1S2WA 2WVVB 3PG9A 1KQYA 1V7YA 4UCFA 1A5UA 2EBNA 4U5KA 2W5FA 3U0HA 2Z24A 3WN6A 4MY9A 3LM3A 4G7EB 2QUVA 1MUCA 2ZRUA 3AJ7A 3R2GA 1S2AA 1US3A 1FKWA 2B31A 1FWEC 1X1OA 1P1XA 5I6SA 4ZO9A 4EXQA 4LC8A 2V30A 2NX3A 1KBKA 3T0TA 3GDBA 3ZM8A 1C8VA 2Q8XA 4LX4A 4WLCA 4ECLA 5MKGB 1LZOA 4H8UA 4K2SA 3LSCA 4LC6A 3CAVA 2V5JA 4CNUA 4QQUA 3IGSA 2HVNA 1RK5A 3B8UA 2PDXA 2E9MA 1UBSA 1SW0A 4W89A 2CYGA 1WV2A 1QASA 4GUJA 1E71M 4UC5A 3U2EA 1GYNA 5DMLA 1WZLA 2WPBA 3LRKA 3FK4A 2V5KA 3KVLA 2DJLA 1C90A 3RK8A 3NQ8A 1D2KA 1PB0A 3EWDA 2GWNA 1IXPA 1YXYA 2V8ZA 1TTJA 1LROA 4DXVA 3WLOA 4RX0A 5AECA 5AYXA 4OKDA 3FCPA 1BAGA 2VNCA 3NO5A 3T0CA 2XH2A 1UR2A 1UUQA 3NPUA 3L4UA 1KM0A 3W1LA 4IHCA 4UNKA 4YVPA 1QNVA 3P2VA 4NJGA 3WLQA 2ASHA 3VFLA 2YFOA 3POHA 2IPFA 3CH0A 3LY0A 2FVLA 4C1LA 9CGTA 2C1HA 2E6AA 5E5CA 4FA3A 4LB4A 2W4XA 1A5NC 4IGMA 1AD4A 2J27A 3KLLA 1EX1A 2XSAA 3VNIA 1E0TA 1OZQA 4H6EA 4UFKA 3BSHA 5C9XA 4XIAA 2PWVA 2P10A 1W5OA 3BL3A 2HS6A 1UC5A 1O6IA 1UWRA 3AXKA 3CO8A 5B7YA 2PDYA 2EPNA 2I14A 1FH9A 5K4XA 1W0MA 1R7OA 4KMQA 2G0WA 2J77A 1UZ4A 3QZEA 3QOMA 4V1YA 3TWAA 1WKYA 2G3MA 1Q8JA 1EHNA 4G1KA 2FMOA 1EQCA 1T5AA 3QKEA 3W2MA 1Y5XA 4J3SA 1KGWA 2C14A 4TXEA 3OIHA 1FDZA 3C0SA 3GTNA 1KXVA 3NZQA 1RXOB 4Q3MA 4A8IA 2Y8KA 1PJ9A 3CNYA 3LBCA 5I3JA 3TCSA 4QJ3B 3SN1A 3PG8A 1TPFA 1JNEA 1JPKA 2Z0IA 3IWPA 2DZBA 3VINA 2HQAA 1JI2A 4W84A 3WEZA 4N9BA 4DB7A 1YXCA 5AC4A 4PTWA 1JAEA 2E1DA 3WQFA 4FXRA 3Q94A 2BGQA 2O9TA 3A22A 1DEDA 4LFYA 5JVLA 5M03A 4MPKA 4L6HA 3ORWA 1ZLPA 3AIBA 1ZENA 3BJSA 3STCA 3MBFA 4E5TA 3ANYA 2YJQA 3SZ8A 3QKZA 3B05A 5TIMA 1HO1A 1PV8A 2Z2AA 4DJDD 3W75A 4W85A 3RGTA 4Q32A 5AYIA 3FNDA 1UR4A 2VD8A 4CCDA 3VNZA 4HCHA 2ZDRA 1JCMP 2Z29A 2VFIA 3ITVA 1SZNA 2YYTA 5EMMA 3ZR5A 4GUGA 1K7FA 3GTFA 3LCLA 4R27A 3ZVHA 1HJWA 1AQFA 4UTTC 2CFFA 3R0DA 3MUAA 3TK7A 3OGVA 3MUIA 2HSAA 1LQ0A 3GKFA 5HK4A 2V82A 1DJIA 2Z1WA 4EPDC 2E5DA 2VFDA 4F2TA 3W7KA 5L6UA 5HQMA 4FEZA 2JKEA 3AU6A 1XIJA 4IG2A 3SQSA 1VIZA 3EPOA 2WW5A 4ZCWA 2QZRA 4CU6A 2X42A 2JIWA 1CLVA 5I5RA 3DKJA 4C6IA 4LVGA 3L5LA 1UC4A 3LZ3A 3VMOA 1TVNA 2VR5A 3W2UA 4XK2A 1PKNA 3GYCA 4UNIA 2PLMA 4YVXA 2Z1VA 1GTEA 1JYVA 3FJ4A 1WDQA 3S83A 1OX5A 1TQXA 3DG7A 3DYMA 3WK3A 3AMLA 4R5EA 4FXFA 3RJXA 3GH4A 3AIEA 3CM4A 3UXLA 3NVDA 1N8WA 3VUSA 1KBIA 1W9BM 4M6PA 2EQDA 4GD0A 4C6PA 2WJZA 2F6KA 3KP0A 1ZZMA 3L12A 3UPWA 5FJUA 1DE6A 1LQAA 2W3ZA 3UWEA 4PEEA 3GU1A 1OFOA 1KQZA 1EXBA 1UH2A 2Y7EA 4FR1A 1Q2RA 1JF6A 1HJUA 2DORA 1A49A 3B8IA 2PGEA 5LHFA 2E5CA 1NFPA 3UEQA 2YCKX 1NWTA 3MY9A 4B5VA 4O17A 5ABFB 3ZZ1A 4F48A 1GVEA 3USBA 2CLOA 5REQB 5G1YA 1IEQA 3WQWA 5K7JA 1SJBA 3RCNA 2WQPA 3V4BA 3H8AA 2YLLA 1KWKA 4IFOA 1GVQA 1HTIA 4TX9A 3RLGA 3VIMA 1B9BA 1GPWA 2PDUA 3P62A 4MFDA 3I4EA 3WNMA 2YXOA 1CGYA 2ACSA 2QDEA 3SCUA 3EMQA 1XCXA 2E9LA 4RV3A 5FSDC 4EKJA 3NM1A 3VIKA 1Z7AA 3HQPA 4B91A 2H8ZA 3KL0A 4QROA 1OD8A 1QI5A 1OYAA 4QX4A 3L21A 2BP1A 3W7DA 2EPLX 2B0MA 2PWUA 3BVJA 3T1GA 1YEYA 3JR2A 2RFGA 3W1MA 4IZGA 2GJNA 2CCRA 2ZTKA 4XWUA 1PE1A 1YKWA 2OKOA 4C60A 3W72A 4RDVA 4JTUA 2Z26A 4O28A 4I6KA 1E70M 3ES7A 2ZA1A 1UD4A 4KCVA 3UETA 3POCA 3W7LA 3I68A 3NUKA 5DT7A 2ZYFA 3L0GA 4LNCA 2QULA 4J27A 4GQBA 4IWWA 3Q58A 4NAFA 3NL5A 4O8RA 1Q6DA 1E9YB 1BTMA 3GC4A 2PE4A 3WJYA 3UJ2A 1EJXC 2V2HA 3QR3A 3C6CA 4IP5A 3SIZA 4IL2A 3H4XA 1UWSA 3GFXA 4IMAA 2YKKA 1UROA 3AZRA 1CGUA 2BOFX 1UW9A 3W86A 4JTRA 1ZHAA 4PB5A 3XINA 2CLEA 1VC4A 1LL6A 3CIXA 1SW3A 1CB7B 2RAGA 2C0AA 3SCQA 2FJKA 3ARRA 1SSGA 3SM0A 1VKFA 1PZ1A 5AB3A 3DGRA 3S4TA 4NZFA 4DZHA 3HA1A 5A2AA 2YFNA 2ON3A 3KCJA 3ZLGA 2WMJA 5GPRA 3U2CA 3CUZA 5LIYX 3T6CA 5K2ZA 1UD2A 1BLIA 2PDKA 3S1WA 1WOBA 4AWEA 3ABOA 4PUNA 2OZ8A 3LOTA 4CU8A 4BWLA 3LI0A 3EDFA 3GDMA 3IARA 1N8FA 1FWDC 4DBDA 3VD9A 3ZSTA 4IISA 3M46A 4GUFA 5AVHA 2WNZA 4HK7A 4IUOA 3MKCA 1CECA 2TYSA 2RDUA 2O56A 1KFWA 2PUZA 3GIYA 4PBGA 1DWFM 3WBYA 1HG3A 1XD0A 4LF1A 1HO4A 1R38A 2FZMA 1FHLA 3TZNA 4HU8A 1GZGA 3M7WA 4A3UA 3P6LA 4G5DA 2QCDB 3UWWA 4ZXLA 4HCDA 5IRPA 4AVOA 4HU3A 1XF0A 3WBXA 4HZ8A 3WQEA 4D2JA 4GO9A 4S3EA 2NWSA 5JQ9A 1CZ1A 1LORA 1NDZA 2OLAA 3RJYA 1MXSA 3NQ7A 5KSWA 1V93A 1H3GA 2BMBA 3VZZA 2ABBA 4H01A 3VDGA 1QT1A 4DJDC 2P0OA 2V6AA 4D6GA 3I7QA 1KFLA 3RLVA 2R6OA 5KTLA 3HGOA 3ITOA 2Z6IA 3GNDA 4W8AA 4F0RA 1KM5A 3DXIA 4ZOCA 1KM3A 1H50A 2Y1HA 1JZ3A 1UIOA 1ADOA 4C6BA 3TQPA 4YU1A 4IM4A 4KGJA 4XAYA 2PWHA 4OGZA 2CLFA 4XZIA 1VEPA 3CT2A 3D5HA 1R46A 1IZCA 1QNPA 3U5YA 4M6VA 1Q66A 2ATSA 3AC0A 1P4CA 1PIIA 2CEQA 4CEUC 5A3HA 3GBEA 3BV7A 7REQA 2WPGA 3CQ0A 3WUBA 1ITUA 3AXMA 5LSMA 1OK6A 3BCFA 4DX3A 3INPA 1KRBC 2JGYA 2KAUC 1SZGA 3NWRA 4M24A 3MJYA 1JG9A 4UOZA 2PZNA 4WDUA 3OZPA 3RN6A 3CV6A 3LV6A 3ZWTA 2FHFA 5LXEA 2GWGA 1FXPA 4HPJA 2GDQA 3TW6A 4CD8A 1UMLA 3W1QA 1R47A 4REQA 5C2GA 2YIHA 3ZYZA 4CEXC 4NKCA 3MC5A 3SN4A 4JTCA 4UBPC 1VLWA 3FYOA 5XIAA 4YPJA 3FGCA 3TKFA 2J75A 4DAFA 2EJAA 2QJIA 3PB0A 2QUNA 2X30A 2X2YA 4U5IA 2WXDM 1EIBA 3CHCA 1UR9A 3E6EA 3NDOA 4Q6JA 3ZMRA 1EUAA 1XYLA 4LBRA 1XBXA 2BHUA 3RCMA 3QGAC 3PK7A 4NUWA 2J7BA 2XN2A 1VH7A 3UG4A 3ZFHA 1DIDA 4EVZA 1GJUA 1KBBA 3B03A 1DWHM 4YL2A 3UXAA 1M04A 5KINA 4OJYA 1AMKA 1GZJA 2PDHA 4CQ9A 3O16A 1MXGA 3BAXA 1FFRA 4QNEA 4IPJA 1DWGM 1KM2A 4GIYA 3LHZA 1JDFA 4HPXA 1AQHA 4K8HA 4MB1A 6XIAA 2FZ8A 1F2JA 4IMCA 1JFXA 4AUBA 1E1CA 4PRRA 3AALA 4JX6A 3TMQA 4C6JA 1BKHA 5CSYA 4YIWA 1P5BA 3WLHA 1NOUA 5AN7A 1T6MA 5CLWA 5DLCA 5BXPA 3R5EA 4FB7A 4FX7A 3H2OA 3FXGA 3KOZA 3SRDA 5D8WA 1NELA 4JL2A 1RD6A 7CGTA 3MP5A 4QAWA 1B3VA 2XFYA 3MI6A 2WOQA 3WLJA 4F9JA 1GWJA 1IXOA 4GXPA 8XIAA 1HKWA 1OBAA 3R94A 4JR5A 2A3AA 3NEVA 2ZRZA 2JBMA 4IMFA 1H7OA 1FWGC 1G6CA 1P0DA 2BFGA 3EOOA 3CGTA 1PX4A 2GUUA 4M81A 4WOQA 3S6DA 3UGRA 1J0YA 4D6EA 3OYXA 1RSCA 4GYFA 3ZVHB 5C8BB 4JN6A 1GNXA 1VF8A 1SFJA 5AC7A 4MB4A 2DZWA 2H6RA 4U10A 3WENA 3SB0A 1GOMA 1LRQA 2WK2A 1TWSA 1XLEA 2JGQA 2G97A 2QGHA 4WOZA 1VAHA 1MMFA 2BVDA 4IPNB 1C9WA 2YL8A 4IG2B 4YMZA 3E38A 5KZMA 1RVGA 4C6KA 1RQEA 2XPKA 1XYCA 2IKGA 3W70A 3UWUA 3RRXA 3BV4A 3E96A 3QC0A 4G1NA 3LN3A 4D6JA 4U3AA 4LAZA 2GUYA 4DM1A 1LT8A 5I78A 1K4HA 5DMYA 1AJZA 1HJSA 4UNLA 1X7FA 2NV1A 4ZGYA 3ERPA 3VIGA 2F38A 4RW5A 3RMJA 4AHPA 3PZGA 1XX1A 5HXMA 3CYVA 3PC0A 1PYMA 5D30A 4MWAE 2NXIA 1V0KA 4QLKA 4LS1A 5LNWA 4UZSA 2REQA 2QXWA 1PXGA 5FSEC 2D2HA 1BVWA 1MRAA 3E2SA 3KRBA 3NSMA 1DXIA 2ZKMX 1E0UA 1KGUA 2ZE3A 3HN3A 1HGYA 5C7VA 3PJUA 4CD4A 4Q4SA 4J40A 2V0TA 3T0BA 3W82A 3I3EA 3VM7A 5HNTA 4JHZA 3WK2A 2WMGA 4ZZ9A 5CPLA 4PYSA 1OJXA 1VJSA 1A50A 3OVRA 3THDA 4O1BA 2VC7A 1E6RA 2DU2A 1XWYA 4PC8A 1TWZA 2PWDA 3UA4A 2WLYA 3SCVA 1SR0A 3HURA 2P5NA 3CQJA 5HNNA 3LYEA 4XAZA 1DWAM 3UCCA 4HOXA 3IJIA 2J13A 4ACYA 1PHWA 3KW3A 4FX6M 1TJ0A 1ALDA 3U7VA 1GZ1A 3B0VC 2NVCA 4ZL1A 3S9ZA 2SFPA 4TMCA 4RNJA 4CKQA 5AC6A 3AMKA 3EBVA 3GC5A 1C29A 1CPUA 5I77A 3IAQA 7PTDA 2XGIA 1XRVA 4BF9A 2CETA 3R8GA 3QFWA 5MHBA 3WKZA 1Z3NA 3G8EA 4GZJA 3BG3A 4HSHA 2YGYA 1EGVA 4J1OA 4IJBA 3T0DA 3OO2A 4K7VA 2VEFA 3UPMA 3R10A 1VPYA 3RILA 4V27A 2E09A 5T26A 2CHRA 4RNIA 4ICNA 1B54A 2HZGA 1OABA 1ME7A 4JNMA 2ZWZA 2PRHA 2WCAA 4XKMA 2WSYA 5KZDA 1AW2A 4JOMA 3FOKA 4NAFB 1DJXA 5LA2A 3T2PA 1TVPA 1VJZA 1VYRA 3D3AA 4DI9A 4RJEA 1XP3A 4HQVA 2PWEA 3OJGA 4LGXA 1XDJA 1ONRA 3GNRA 1VRXA 3A23A 1Q13A 4DWDA 3MS8A 3CPGA 3VZYA 1S3TC 2OZ3A 2RUSA 4J9JA 4FHAA 4GKTA 3AYRA 1V6VA 2TODA 3T05A 1R3YA 4HMDA 4AHOA 1PHQA 1S5NA 1K9DA 3RAOA 3VX0A 3LRMA 1AW1A 4BEQA 4CVWA 4V2XA 3BLPX 2YZRA 1EF3A 4DJFA 3CWOX 2FVKA 2DP3A 1S38A 3URNA 1B5TA 1O5QA 2OX1A 3PBVA 4KRTA 3BAYA 4O1FA 3TSDA 5EMYA 4ES4A 1PKLA 2WHMA 4PTMA 1CTNA 3L4TA 1DJZA 1IXNA 2RJHA 4QG6A 4FXJA 3SUUA 1WXZA 1TPC1 2QCCA 5LKYA 5I3IA 3W1UA 4Y6GA 3U48A 1WUFA 2INZA 4ZQCA 3ABQA 5T9BG 2W61A 1J79A 2VFFA 3QQ0A 5CC3A 2R1MA 3WJWA 4WCJA 1NQ6A 1UD6A 1YTEA 3IRSA 3GU9A 3IJ7A 1UG6A 4D8ZA 1QK2A 4ZB0A 3RFAA 4IIBA 2DSUA 4KEVA 3C8NA 1FP8A 1O4UA 5HINA 5BWAA 3EA1A 2D69A 1E56A 2J8TA 1B30A 5J5RA 1Q6FA 4AIBA 3AS3A 1A53A 3FVDA 3FX4A 3NQEA 1DOSA 3WD0A 3F7JA 3OLEA 4MWAD 4XZBA 4EANA 4AZCA 3MVTA 1M68A 1XISA 3PUGA 2A85A 2F61A 1UCWA 4PMJA 1WX0A 1BQGA 1S5TA 3KL5A 3AYVA 2HK1A 2OSWA 1YIXA 3BW3A 5GJPA 4GUHA 1P7TA 2VQTA 3WMBA 1EJVC 3BH4A 4AD0A 5A6AA 5G1TA 3G8RA 2Y7FA 3ATZA 1J8VA 1W1B1 4BJHA 3TC3A 3K30A 3WFLA 2C79A 3EOUA 4JZ5A 4IPIA 2OB3A 4P7LA 5D2XA 4ERIA 4CQCA 2Y24A 1VHCA 1W5QA 3RIKA 3LCWA 1IR1A 1PIGA 3IIVA 5H8PA 1HKMA 2ZDSA 2F8QA 3MVIA 7REQB 3RO6A 1XV8A 3R8RA 4HT3A 1L6FA 3UG5A 4I7UA 3EEZA 3MMWA 1JRCA 1P48A 3HZ3A 1I75A 2BVTA 1YNQA 4HN8A 2O7SA 3C2EA 9XIMA 4JQ3A 3CS2A 1OF6A 1RY0A 1R2TA 1ZS2A 4X60A 5K3VA 4WK9A 2VR4A 2Q09A 3HG3A 3N18A 4IT1A 4ZQNA 4QNWA 1MI3A 4REQB 2CZDA 3F4VA 3WJSA 4UQ9A 2VZVA 3ARQA 4U4MA 3RU6A 4AG0A 1GW1A 2FGLA 3A6OA 3C2FA 3TZFA 1OD0A 2VOMA 1PS9A 2GVJA 3FGCB 2NUWA 3RNDA 3WUGA 3HBLA 4IH3A 4DO4A 3OGRA 5I3FA 4NSBA 4O50A 2VVNA 5F1UA 3NQFA 1J5SA 5JMUA 1Q6CA 3T0AA 4UUIA 5LIKX 3OG2A 3LB0A 1NP2A 1HGWA 1J0ZA 4I9AA 1H7NA 5KITA 1F8IA 1ZGDA 3B04A 5GNZA 4C6DA 3GZ3A 4E2BA 2VO5A 3CBWA 2DW7A 3C0LA 3WLIA 3EYPA 1Q6LA 3ABSA 3QSTA 3VOFA 1TJPA 2WMIA 4FOJA 1DTUA 1ZSXA 1E1CB 4D8AA 1QFEA 1MRQA 4PODA 1ME9A 5TNVA 4WX2A 2J4GA 3WNPA 3PHAA 3M0IA 3CB3A 2BSLA 3W26A 1O1HA 2GVLA 3OLDA 3WLLA 2QHAA 1BQCA 4K8EA 3C5QA 4M8UA 4PUKA 5EA9A 3M6YA 4M82A 4UMAA 1V6UA 3AU2A 3SUWA 4PUDA 5BW6A 4CCEA 2V5BA 2Q02A 1MW3A 3B06A 4RCXA 2V5LA 4B5WA 2AAAA 4ZQRA 5A94A 4HNUA 5CBBA 5H8MA 3P8JA 4FI4A 3SUVA 4AZGA 3WNKA 4XAFA 2X41A 2PU1A 4CD6A 3WNOA 3LLFA 3MYOA 4CD5A 2ZXDA 1QRQA 4DO5A 3GDRA 1RJRA 4JIHA 3B9EA 3W25A 3B9DA 1H51A 2X05A 4PB3A 2NLYA 3CUHA 5HAOA 4L4OA 2C15A 3ARPA 1TUFA 3NYDA 3UWVA 4ICMA 3S2JA 1E72M 3WYZA 1SO3A 3RPMA 2XWDA 4RDWA 3L0KA 2HISA 3TFXA 3TQKA 2JK2A 2YLAA 3U7BA 2ESCA 3VZXA 5DO8A 1A5SA 2Z1SA 3W87A 1QBAA 5CSUA 1VFUA 1Q6QA 1U2YA 2VR2A 2E8ZA 1UWAA 3FYPA 3V5FA 1PWMA 5D9NA 2JEQA 4UQAA 4YWSA 1JEZA 4NYYA 4H8VA 4NVTA 3G24A 3BG9A 2HPIA 1HNYA 2ZTJA 1XM3A 2ZX6A 3SCRA 4AYGA 4W93A 3B97A 1NEYA 2IUZA 3WQ4A 1V79A 2A1YA 4IOTA 3LGDA 2DZVA 1SSDA 4PE8A 3EKZA 5A8OA 2CWNA 4AX7A 4CQDA 1QHPA 4M19A 1OFRA 3UJFA 1HL2A 1EJWC 2GQ9A 5AYZA 1J9YA 5ECVA 3MZ2A 3AS0A 2XH4A 2MNRA 1LLZA 2CIPA 2QCNA 4X22A 3JRKA 1TPDA 1E3XA 4Q8OA 3SGUA 5FL0A 3GFZA 1XLCA 4DUXA 2ONEA 4JDBA 3CUGA 1JYXA 1P0BA 3L2MA 5DXXA 4W8LA 2VX4A 1EZ2A 3L4VA 3QBUA 1AH3A 3BLIA 4BEUA 4S3KA 3K4DA 1FH7A 2IQTA 5CEWA 4M7TA 1H5VA 1MZRA 3C3UA 1LTDA 1HUVA 4HNTA 5EFDA 4DIAA 5CJ5A 2QEZA 1UH4A 5D04C 1H5YA 4JTKA 3HJEA 1J01A 2PF0A 3BURA 5D38A 2VURA 4LQ1A 2PSNA 5J04A 4MWAC 4HP5A 3W29A 3EZ4A 2D2OA 4V15A 4JN7A 3F2DA 4PMYA 4DBEA 4EWND 3QPEA 4LH8A 3S8HA 3G18A 2CNCA 3AIWA 5HA7A 3DG3A 3ECQA 1FCUA 1V77A 3IK4A 1CLXA 5FJTA 1P43A 1OFDA 2ZXQA 4V33A 4R88A 1TTQA 5E9XA 1H60A 1OFAA 1ZNNA 2FQIA 2PDMA 2RGMA 1B3XA 1RY8A 2ZCGA 3R79A 3SY1A 1L2QA 4HOWA 1TPB1 5C9RA 1O1ZA 1OC5A 1XG4A 4MKSA 1QTWA 1JD7A 3PNZA 4Q33A 4ROPA 2F6XA 4NI8A 1EJSC 2P88A 4ZR8A 4H4IA 3BSMA 3PSWA 1N55A 2OQLA 3VNMA 3OQEA 3HPAA 4WSKA 2XU2A 5FEZA 3MP4A 4DF0A 4WR3A 1FWWA 1J11A 3PJWA 1QO5A 3ZSSA 3CWNA 3EWBX 2QJNA 1KTCA 1S3HA 5DRIA 2PP3A 3V0SA 4Y7EA 1SVDA 3S9IA 3W3OA 4ERGA 2G4JA 3C8FA 5FACA 5A8QA 2Q01A 4ZXOA 3IK2A 2QMKA 1T40A 3TJIA 4XAPA 1Y65A 4MYXA 4OU1A 3W1NA 2CBVA 4QRNA 5D9MA 4WKHA 2V38A 3OOQA 2WHKA 1IEXA 2F9RA 2PZ0A 1X97A 2G8ZA 4UTTA 3THUA 1UASA 4HMNA 3RUBL 1Q7ZA 2OQYA 1VP5A 1LWHA 1DPMA 5FF2A 1XQLA 3VIHA 1HW6A 4S3GA 2V3GA 2Z7KA 1L9WA 2RGLA 3NQGA 4PUJA 4TVCA 4XZNX 2V5DA 2OO0A 1DP0A 1BXBA 2Z2BA 3O6AA 3TN3A 1KGXA 1VFMA 4EPBC 1V6XA 1MVYA 4NT0A 4C6FA 2EO7A 4B2DD 1DQXA 3TTSA 5F4SA 3OQ8A 4FALA 3CZKA 1GHSA 4H00A 5CZSA 3GW0A 1EUNA 1XLLA 4FNTA 5CPMA 3SJ3A 3N3TA 1RBLA 4YCPA 4P7NA 3MBDA 3DECA 2XIQA 5C71A 3RU8X 2CW6A 3WD3A 2VFHA 3TC7A 3CK5A 2G96A 4GX8A 3J7HA 3VTRA 2L5HA 5EFFA 3B0PA 3WF3A 1VZWA 3GYEA 2G5WA 2XSBA 3VC5A 1BKSA 4AXKA 3T78A 3UG8A 3VYLA 3K8KA 4F40A 3P81A 4AZCB 3SCSA 1DTNA 1H1ZA 4WKAA 4EF8A 2UY2A 3VE9A 2ZVRA 3OODA 4A3YA 3ISIX 4YYCA 4NZJA 3NXLA 3BZJA 3GBDA 3DBNA 1IIHA 5ABGA 3N6QA 1P7TB 3ZIZA 5HNUA 3CAKA 1KCXA 1UB3A 1FOBA 1XICA 4I5UA 3UPBA 4O0QA 3IJLA 1FWIC 1JQVA 4YWIA 2ZVIA 2I9UA 2PC4A 5ENLA 1XC6A 3RR1A 4GFIA 1UZHA 3FV9A 3S5SA 4JS3A 3GH7A 3MUCA 2WSQA 1OVDA 2CLMA 2Z1BA 4H6RA 3VGGA 4AY1A 4QEEA 2YOCA 3KRUA 3WQ6A 1BVZA 3FKRA 4GZ7A 2UY4A 3LGEA 2DGAA 3TYBA 1Q4WA 4ILSA 4F79A 4IFKB 2I56A 9XIAA 1S2CA 3V7PA 1ZAIA 1V3MA 4KFNA 4RDZA 3GNOA 4AB4A 1XR2A 3H7RA 1QWGA 4GYPC 2DEPA 3ENLA 3TNBA 1R3TA 4N02A 3B8VA 1XPGA 3WLRA 3TOYA 2DH3A 3S46A 1UKPA 3CHDA 1R3QA 4I7VA 3QTPA 3K4AA 2GGJA 4NZ1A 1JNDA 2W91A 4O8AA 1UP3A 1KWGA 3PVFA 1W9DM 2IXUA 3UVAA 3PZMA 2VUYA 2BV9A 4JQ2A 3CMFA 5T91A 3FJNA 1W3JA 2D73A 3RLHA 1OFEA 5HUOA 1CDGA 3T7VA 1TR9A 4X61A 1POKA 2BTMA 1DIOA 4GO8A 4XUGA 3HPXA 3SCPA 3WQ5A 2AMXA 2HVOA 1TE6A 1JCNA 2VL4A 3N17A 2WC4A 1AMYA 5A69A 2CWXA 5A5WA 3WZ0E 1FKXA 4KWUA 3N3MA 2NVAA 1J10A 4R53A 1XC4A 1WDDA 5D4YA 4HPNA 5FCZA 3QY7A 4DBSA 2QCHA 4GIRA 5BRPA 3LCIA 4WXZA 4NNCA 1R85A 1TO3A 4TUFA 4LVBA 4UB9A 1NDWA 3CMJA 3MYPA 4XISA 1U5JA 4JBRA 1WKFA 1KCLA 3OBEA 5KETA 2A5HA 4UTKA 4IF2A 4J28A 2E3ZA 1XUZA 3C3NA 3CU2A 1NVMA 3L5AA 2V69A 2QUTA 1NF0A 4LUIA 2YL6A 3LPOA 2INEA 2PI6A 4Q22A 4L4PA 2Y2WA 4IICA 3TAOA 1XYMA 1ZCCA 3OBAA 4Q8WA 1B3ZA 1TYGA 1OF8A 4DPQA 3HG5A 3DH7A 1XYBA 5U7SA 4L61A 1W1VA 3NQCA 4G7FA 4NG3A 5JH2A 2ALRA 1IQ8A 4KCWA 4XZHA 1KFKA 1Q4NX 2VT0A 2QQ6A 4ZOAA 1JPIA 4B9ZA 1BPLB 3COTA 3DFNA 2O9RA 3TYZA 4OUIA 4P7OA 1BRLA 3BOXA 1W54A 2Z6JA 3K4WA 3MA8A 4IP4A 1AL7A 1W3KA 3EEGA 2QCGA 2WHJA 4US5D 3OLGA 4AISA 3P82A 2YZ5A 2FMNA 2Y7DA 1W8SA 3BAKA 4XQ6A 2ZRWA 1H63A 1M7PA 3GUGA 3C2VA 1W2VA 5EKYA 2VJXA 2RHGA 7ODCA 3PN8A 3VDBA 1E4IA 2VFEA 3YPIA 2D3NA 4LTSA 3ITYA 1V3JA 2C7FA 3QW3A 1EFZA 1OFPA 4GBDA 4G6CA 4PMNA 3M0ZA 4PFHA 4L1XA 3IAPA 4C7FA 4JXCA 2ISDA 1H0GA 1PKMA 1BSLA 3QV9A 4XD4A 3B0UX 2YXXA 3CEUA 3RM4A 4M51A 1TSIA 4H8HA 1WXYA 1K70A 1W3HA 3UJEA 4DJDA 3BLKA 4MJZA 2W63A 1ME8A 1WE5A 3LQGA 1GVSA 1NARA 1QW7A 4X63A 3S0CA 1NWRA 3H12A 3PB2A 4KWSA 5L9FA 3SCWA 3SI9A 1Q5MA 2HWGA 5ABHA 3DYPA 3M0YA 4Y9AA 6CGTA 1UPMB 4JIRA 3M5ZA 3CPRA 1H7PA 3OTRA 5AY7A 4XD3A 3WL1A 1DIKA 1J4EA 4K38A 4TO8A 3KTSA 4BQ3A 3T81A 3RYSA 3ZT6A 3Q37A 1E9LA 1QI2A 2J66A 4GG9A 1LWIA 4JGDA 3L0NA 3KBVA 3UBPC 4I9TA 4AIEA 2PWGA 4D6FA 2WC3A 3IGHX 1ONWA 2PDNA 3S1GA 1QOQA 5D33A 4QG8A 1XBVA 1G1YA 4WKFA 1WNOA 3FY1A 3UWYA 5CBJA 3A3WA 1OCQA 3GG8A 1KA9F 5IXEA 3PBGA 4ENLA 1V6YA 4HPGA 4Q8NA 4MFEA 3FDGA 5D37A 3FA3A 4WUIA 8CGTA 2HROA 4WJEA 5BU9A 1C9DA 1E40A 3JU2A 2BG5A 2OWCA 2CZFA 3LD5A 3W76A 1XLJA 3UYCA 3V35A 1OC7A 4DEFA 3WL0A 1F3EA 3KHJA 3URAA 4AEEA 4CD7A 1A0EA 5A8GA 3LV5A 2PDCA 4UQCA 3N19B 3FDKA 2ALDA 4H19A 4NZCA 3VKDA 1TA3A 3EXTA 4GH1A 3SGZA 3E0IA 3KOFA 1X6UA 1RP8A 3ID7A 4JX4A 4LAOA 4Q4MA 3AMGA 3IVTA 4N9EA 1ZY9A 2VGBA 5CZTA 2W9MA 3N2CA 1DIEA 3PBUA 1MDLA 1RK6A 1YDOA 2VGIA 2HNEA 2PCQA 2J47A 2TAAA 1DORA 4ZBCA 4CUCA 3G1HA 1PTGA 1XIHA 2BGNE 4H8NA 5DBTA 5EGRA 4WD0A 3GXDA 5ECUA 2FPVA 1EP3A 4CN1A 2HDJA 1TWWA 5K9CA 1FHVA 1YADA 4HN4A 4H6KA 3G0SA 2ZZ6A 2IQDA 5C9WA 3O0FA 4JTAA 4DY1A 2V63A 3BARA 3L2LA 4O10A 4D6CA 1OFBA 4F2UA 1CI1A 4IJRA 1XLBA 1D3GA 2Y7GA 3TOPA 3UZ5A 3PPCA 1C8YA 4Q4QA 2RDXA 4I8YA 4LT9A 1SJAA 3ARYA 2P0IA 1VFFA 2OELA 1F07A 3G1DA 3PPHA 4FR6A 3W6MA 1A47A 3KL3A 3A13A 1J12A 2YA2A 1AW5A 1Q8AA 3W7QA 2WSRA 3UZWA 1BHGA 4ZEPA 4M6QA 3W24A 1LG2A 2DZTA 4FLQA 3SUTA 3QMRA 4HSNA 1P6WA 4WDWA 2VRKA 3BSGA 4QR6A 4ADUA 2UV8G 5H6HA 1O7AA 5CAHA 3AHYA 3GR7A 1WKEA 2ZUUA 1F5ZA 4DWSD 4UCGA 1UKQA 3U9IA 1B90A 2CC0A 5HWNA 4V1XA 1NDYA 5FKYA 1TJRA 4UTIA 1XH2A 1CXFA 3GVGA 3W23A 3MV01 3UWZA 1CXEA 4GVFA 4C1NB 2WZHA 5HQLA 3MP3A 1MW0A 4I7WA 1UR1A 1DJWA 1POJA 2J7HA 2WMKA 3G1VA 4NZ3A 3TX9A 3S1UA 1G4SA 4N6EA 2BHZA 1UKOA 2XFWA 4E38A 4GIEA 4JTTA 2JE8A 2G50A 4ATLA 5K4ZA 3E0WA 3N14A 2PDLA 2PBGA 4KIRA 3S47A 2HEJA 3WDJA 1U83A 1ZRQA 2Y0FA 3LGGA 2QNEA 4KIEA 4RZBA 3M07A 5AZ0A 4CN4A 1TJ2A 1W31A 1I45A 1IEWA 5G4EA 4BS0A 5AHEA 4O15A 4QIUA 2NQJA 2XIJA 5LNVA 5E0KA 1KTNA 2CHOA 4LUSB 1S1RA 1AL8A 2A3BA 1J0HA 2OVLA 1R3WA 3V5CA 4EPEC 3CL7A 5PTDA 9RUBA 3DOPA 3MUXA 4UTFA 2PF8A 2CBUA 1F3TA 2DSWA 2WNWA 2EHHA 4LYKA 1RBOB 3S42A 4RK8A 3I7SA 4JTEA 1PVNA 2ZWYA 2NZLA 3LNPA 1W6TA 6PTDA 4FLSA 2C18A 3N9KA 5AHFA 2I17A 2ZZ2A 1L8PA 1K7EA 1XLIA 4A8RA 2ZXBA 1MW1A 1QPQA 2VZTA 4I8DA 2P50A 2FYMA 5HQEA 2GSEA 1E9IA 3MHGA 4HOZA 3W83A 3LU2A 1VCFA 2DSVA 3ZLHA 2FPTA 3EB2A 1SO5A 1TTPA 2R8WA 1KO0A 1E3ZA 3VD7A 1JI1A 4YYFA 3LERA 1V3HA 2QT3A 4QITA 4GI8A 1E4MM 1V6WA 3FLUA 5H8UA 1XINA 4BI5A 3AMDA 1W1YA 1D8WA 1KFJA 5CPOA 3M5VA 4MJMA 3K8LA 4HNVA 3B4YA 1CLKA 5DCEA 1V03A 3TTOA 2QW5A 2IPGA 2X1TA 3PTKA 4N42A 3NL3A 4DM2A 1K6AA 4KCUA 4JNZA 4MY1A 4ADTA 3SEPA 4AVNA 1OINA 3STGA 1J0JA 5FEWA 1ODZA 3HTWA 1V3KA 3LI1A 3EDKA 2E4TA 1E73M 1PL9A 3DIPA 1KKRA 1BYBA 4W9TA 1YNPA 4K8GA 2VZUA 2YA0A 3CQKA 1C8QA 3ELFA 2X7VA 4E4PA 4KRUA 3HGSA 4LEQA 4Q8VA 5RUBA 5KEZA 4X0NA 1V5XA 3BQ5A 3DG6A 2OO6A 3TTEA 4X9SA 4XIMA 4UFHA 3EDDA 2YDQA 4AX6A 3GHRA 4PCSA 3H24A 4FXSA 5CG7A 5ABTA 4O57A 1XRSA 3QY6A 1OZMA 4MLRA 4LUYA 1W9VA 4MDOA 3W7HA 2E1WA 3N6HA 1ZAJA 4GKLA 5DY3A 3ITXA 3UF9A 1QPKA 1RVKA 2BY0A 3N9RA 3RF9A 4IQLA 3DHFA 1W1TA 1TWDA 1FCQA 1W5NA 1EJTC 4DO6A 1O60A 4O18A 4WY0A 4DNMA 5H91A 2WCSA 3EAUA 1BYCA 1E15A 1BRLB 3N6JA 2J24A 2TSYA 3TW9A 1QATA 1UBPC 4JCMA 4AD5A 4TOQA 5AHMA 3R12A 4KW2A 5CAKA 2EJ1A 3W7OA 5CXPA 3DESA 2VZSA 4HU0A 1TV4A 3QTGA 4QG9A 4E8CA 1LBMA 4B3KA 1DHPA 4O12A 4LJ3A 3T44A 4Q7BA 1N82A 3W7PA 1VPQA 4S39A 4PMOA 2NT0A 3O07A 1ENUA 3O9NA 4QSFA 2FZNA 3JUGA 3UZJA 3ZLFA 5FESA 1IYXA 1M41A 4X2RA 3LCFA 1V51A 1SO6A 5G1MA 1PTDA 4LAKA 1D3HA 3QW4B 4MYAA 4JAWA 3DFTA 4AZ5A 2D23A 1EC8A 1QR7A 5CC6A 3SCTA 2YDAA 4O16A 4HZMA 5A95A 5IFPA 3PZVA 3KBNA 3QSRA 2P1FA 2VC9A 1K9EA 2XG9A 2FZ9A 3VX1A 4K39A 1T0OA 1VBGA 1KXTA 4HBKA 3L4YA 1RAKA 3NO3A 4FIRA 1FWTA 4AU0A 3QGKC 2J8GA 4HK6A 2VGGA 1U1UA 3IIXA 4PUWA 3S9YA 5G4HC 1UOKA 2E68A 1EA0A 1PCWA 1F6YA 4W7VA 5KZEA 2QJHA 4GLEA 1XBYA 4M56A 4JL1A 2YA1A 3B8WA 1PWLA 2AOSA 2ZA3A 3IJDA 1LRTA 3EWWA 4U3CA 1PDZA 2NLIA 1BFNA 1V6TA 4IMEA 2O4QA 4DWSC 3WDIA 5IM51 5FIPA 3M1ZA 5LA1A 1A3XA 5AHLA 1HF6A 2V2DA 3G3DA 3U4AA 4GFSA 3HPZA 5DCBA 1KBLA 5A6LA 1I60A 4HNNA 5F1VA 1LUCB 5A6KA 2XM2A 1TIMA 4JDYA 2E0PA 3OEXA 1KFEA 3WX7A 1I9CB 1XUUA 2XIOA 5EYWA 1GW9A 4I3GA 3PP7A 4MADA 4I9JA 1N2VA 2OGJA 2NX9A 2NUYA 3P3BA 5A8PA 1J0IA 3VIIA 2V3EA 2A0NA 1GHRA 2WYSA 2A7NA 1W3LA 3VIFA 3B9NA 3OVPA 1M5WA 2E5BA 1NFGA 4Z2GA 3DERA 3EX6A 1EJUC 3SY5A 2PD9A 2I5GA 3IJ8A 3ABRA 5FEPA 4YTSA 1E6ZA 3EXRA 1TA3B 2FZDA 4IP7A 3LXCA 4IL0A 1ZPTA 1F6PA 5D2WA 3VNDA 1TRIA 4KEMA 4HNCA 3MMTA 4AF0A 2HNHA 1BG9A 1CYGA 3VOJA 1ZL1A 2EG6A 3L66A 3W7CA 4FNUA 2DY3A 3UCQA 3DKLA 4DBUA 4GXWA 3NVTA 2Y63A 2OPJA 3RMEA 2C0HA 4JFUA 4ZE5A 5BXRA 3URBA 3AS1A 1EDTA 2GZXA 1YYAA 4GI4A 3GR8A 1LLWA 1ELSA 3VFCA 2YYUA 5M17A 2QCLA 4I9MA 1YLVA 5JBDA 4NAEA 1X39A 3IV8A 3G1AA 1XD1A 1TUXA 1MQPA 3IUIA 5JIPA 2OYLA 2C16A 1OM0A 3MHFA 3GRIA 4JN8A 2DUZA 4B15A 2OCZA 4AC7C 3SY8A 3QFEA 2FPYA 2OLHA 2C71A 5I3KA 4NIRA 1A4LA 4FLOA 4RW3A 4RPQA 4LCSA 3GHTA 5DMNA 4PBFA 5HMFA 2WKJA 1UWQA 2WV8A 4KF1A 2WM0A 2TRSA 4J3VA 3B8TA 4M29A 4PRWA 1ZJBA 4HA3A 1JUKA 3ZR6A 4GVIA 4PMUA 1W1ZA 3BMXA 2E6FA 2V3FA 4J3ZA 2FH6A 3GW3A 4X9YA 3DI0A 3LTYA 4XBKA 2O7QA 3NA8A 1BWKA 1K1DA 1NDVA 3GXNA 5EPDA 3QV6A 3AMCA 2X8RA 3NM3A 2A6LA 4LY8A 2X0HA 5JXQA 3GDKA 3M43A 2OWXA 1B9ZA 1RD5A 1S5MA 2DW6A 4AD1A 3W73A 3NNTA 4DF2A 4NX0A 3CC1A 4H7ZA 1K4GA 3TN6A 4HHLA 3W84A 2OYMA 1SQ7A 3TONA 2AMGA 3PANA 1LCOA 1PAMA 2BASA 5IBXC 2EKGA 2D2GA 4JYEA 3IVUA 1L6GA 1JUBA 1V0MA 1QI4A 1GOXA 2A4AA 4N4PA 2BXVA 3BO9A 4JFWA 3EWCA 4EXBA 4Z17A 4GCAA 1V4YA 1A5KC 3EX2A 1Y8BA 3H7UA 4Z2KA 4PEKA 1W3NA 1Z89A 1GJWA 2WSKA 1DQWA 1K7XA 2PCEA 5M1TA 4XZ9A 3E9AA 3BW4A 1OCBA 3MKVA 1LBFA 1VJIA 2NQLA 4H83A 2HS8A 5FF0A 3GX9A 2E28A 4RXGA 2ZUMA 3GXTA 2XZ7A 2B7QA 2BS9A 3N11A 2DT2A 1QDSA 3MV11 3CV7A 5TF0A 1M53A 2Q71A 1QMLA 3E3HA 4QE4A 3NQDA 2VTFA 4XV0A 4CGTA 4LB3A 3VIJA 4YTTA 1BF2A 3HOJA 2HTMA 3C2OA 4IIDA 1Z32X 1JPHA 2ZUVA 3GM8A 1SZEA 3PBMA 1EO5A 3TN4A 3GH5A 1WYIA 1MNSA 3TEVA 5CC7A 4C1KA 2VX5A 2X16A 5TQLA 4FIQA 1WUEA 4E2OA 1OIFA 3BW2A 1FQ0A 2ZA2A 3TQVA 1LM1A 1KLZA 3BJFA 4LCQA 4MWAA 3MSDA 5FD0A 3TCEA 3W37A 3LHVA 4PMQA 3ZQ9A 1E51A 5I23A 4PN2A 4J2PA 1DVJA 2FH8A 2ZUNA 4D9PA 1TPUA 3O2LA 1UP0A 1W5PA 2JKAA 1F05A 2FIQA 1XBZA 1XLDA 3HGRA 2PD5A 4A4AA 2X2GA 4GUIA 3P61A 4OZOA 5CC5A 5SWUA 1DJYA 3OGSA 3V0TA 1Z8AA 4HB7A 3T2QA 1WZAA 1FHUA 4IUGA 3MW7A 3F4NA 3TH6A 3VOIA 4HVXA 1X38A 1RCXB 4A2SA 4AEOA 1O66A 4UTMA 3HQOA 3L4WA 4C6QA 3IEBA 1DJHA 4HYVA 1S5WA 2QF7A 2VRJA 3NQAA 2QKFA 4XSMA 1WQ5A 4W5UA 2QJGA 3WDQA 2X1UA 4LAMA 2E6YA 3VDHA 5IHSA 4GVHA 4RDYA 4NX5A 1W3IA 1KR1A 2IKHA 4CN6A 2D0GA 4ICCX 1W1PA 3KXQA 4FNSA 5LA0A 1UA7A 2NT1A 3UA3A 3C52A 4Y9MA 1UD5A 1YBQB 3TLQA 1KTBA 1M03A 4M1BA 2XVLA 4FMVA 4DPPA 3B4UA 3TAKA 2QS8A 1E4LA 1HL8A 1OX4A 3M0JA 3G1SA 2BBFA 3VO0A 4F2BA 5U4NA 2Q3OA 5IOBA 3SN0A 2DZXA 3LLXA 1XRTA 3QV8A 3TDFA 3ZWSA 3THQA 3TA6A 2A3CA 2OWWA 5H2ZA 2XUCA 4AWUA 5I09A 3SCOA 1OG6A 3KDOA 2NQ5A 2CLIA 2PGRA 1ZBCA 3I10A 3IIOA 2PDJA 4KS0A 3KWSA 2P53A 2ZXAA 4YLWA 1T7LA 3WF4A 3B0YA 4C91A 2BDQA 4KCTA 1LT7A 1XGEA 2TMDA 3PAJA 1SZRA 3MCMA 3CQHA 4WY0B 1CXKA 3P5YA 4HSOA 4DYEA 4PTVA 3ITTA 4TV6A 3S5ZA 2VEPA 3DX5A 4GK8A 1GORA 4JKLA 4HA4A 4NJKA 2WVVA 5EY5A 5K9DA 3U2ZA 1MZHA 4W7WA 5D05A 4ZMGA 1PX8A 2HXTA 2RDWA 4IMDA 3EKGA 1WZKA 1GONA 4PZVA 4MPQA 1A3WA 1SYTA 3BMWA 1WAUA 2VD9A 1VB9A 3NJ3A 1QU4A 1WBHA 1TCDA 4O54A 3GUWA 3OZYA 2YSWA 3APGA 3T4CA 4JICA 4AZHA 5BXSA 1EJ7L 4N9CA 5EBUA 3BJTA 1XPYA 3CTTA 3KRZA 2X1RA 4LUJA 1EO7A 3UU0A 2BGSA 4S2CA 2P3EA 1S2TA 4GNVA 3GZAA 1GPFA 3U4FA 1I2PA 1Q3NA 3SFKA 5A6MA 2PFHA 4NXSA 3H70A 1RH9A 3TNOA 3CZGA 1H49A 3D47A 2YBVA 3NSNA 5HOSA 1ZJHA 3UWQA 3VKKA 3O1NA 2VVSA 4JYDA 5AHIA 3CLMA 4FSAA 1EXPA 3IACA 1AZ1A 3MU7A 5GNYA 4M1RA 1SU5A 2FGZA 1AD1A 4OWGA 3M44A 5HPOA 1PUDA 4Z1AA 1UJQA 1Z44A 3KS6A 5DMMA 4JQAA 2GLKA 2VWTA 1SFTA 2DIKA 4L9XA 3W1PA 4GYJA 2TPSA 2YDRA 1YTKA 2QJMA 3RPDA 4WIWA 1XIBA 1DJGA 1JGIA 4GGHA 1HL9A 2DZAA 1ZB5A 1IE7C 4ZQMA 4AC1X 2Z2UA 2FZBA 1Q63A 1LDCA 3NR0A 1H4PA 4GYPA 2GGHA 4AHQA 2ISWA 1XIEA 2GGIA 1TV2A 1VCGA 1JDDA 3GVWA 4GJIA 4WZHA 2VRQA 5DQPA 4ZB5A 5FJIA 4DNHA 4B4HA 2YL5A 3RR4A 4KEZA 5HMSA 3ZJ8A 2OR2A 3TTYA 3WMSA 1OK4A 1T41A 3EA3A 2HCVA 3UFYA 1W8GA 1F74A 3CASA 1PZ3A 1W56A 4ZQPA 3WQPA 2E40A 5CPSA 4JEJA 4RZ4A 5K9XA 4LALA 1XIMA 2ZZ7A 4MF4A 2J9XA 3UY7A 3S2LA 4OBTA 1W9UA 1BXCA 4UR7A 1FH8A 1GKRA 1RV8A 4H7VA 3V5OA 4OECA 4R7OA 4RE2A 1QNOA 3KS5A 4HNOA 4ATWA 4POCA 3WQOA 3AS2A 3OHIA 3K1DA 1A5LC 4BY3A 3TR9A 1U33A 3W1RA 1JF5A 2XN0A 3A9IA 2P8BA 4ROQA 3ES8A 2HJPA 2OOFA 3EDEA 4DXXA 3CJPA 1OX6A 4QHRA 1D3CA 3T55A 1IWPA 3ALGA 4S23A 4JTQA 2OEKA 4WRHA 4DJED 3NQMA 4AF0B 3R0UA 4NILA 3TW7A 5CKSA 3E5BA 1IIGA 2E6DA 3QQWA 4EOUA 5BCAA 1H41A 1ECQA 4LRTA 1Y5VA 2AL1A 1C93A 1UD8A 2MUCA 3GG0A 3PWAA 5I02A 3RITA 2WWCA 3GB6A 3W7MA 3NOEA 2ZIDA 4CQBA 3VVGA 1NJJA 1JYNA 4H3DA 3FEMA 1P1MA 4NAEB 2QIIA 4JKKA 1BG4A 4K37A 4A8NA 1E55A 3HO8A 4WGHA 2XH0A 1HJQA 4KESA 4UTHA 3WDRA 1J93A 4U33A 1K6WA 4GVGA 1UMYA 2BXZA 2QCFA 4S3BA 5HR6A 1XIGA 2VX7A 2ZZ3A 1QW8A 3H4GA 4U2ZA 4Y9OA 2GK1A 3HIJA 3U6WA 3E2VA 3ONBA 5D2YA 3PUDA 3IJQA 4JPGA 3CAWA 1FCVA 2D0HA 5AFDA 1XKYA 4GY0A 1VPXA 4EE9A 2OT1A 4BQ5A 1YDYA 3DU0A 1VIWA 4IIHA 4C7DA 4C90A 2YL9A 3STFA 3CIVA 2PTXA 3DGBA 3BC9A 3N34A 4UR8A 2VCBA 4C6LA 1XG3A 4LSBA 4HJFA 4IQEA 5C9UA 3UT0A 1SPQA 3IUHA 3GWQA 4RR4A 5DN1A 5A8NA 5FAGA 1E5JA 5EBAA 2EKCA 1QJWA 2QCEA 4O1AA 4N6FA 1QOXA 5C2XA 1WKDA 5H1WA 2DZUA 2VELA 3O05A 4PCFA 3BLDA 3VGDA 3FN9A 4GISA 4CU7A 3SW6A 2W66A 4PUEA 3GE7A 1F4AA 1L8NA 3L65A 1JDEA 1MUMA 2FHCA 1TV7A 4XKYA 3S5OA 4WVXA 2G37A 3ZXWA 2IW0A 4GJJA 3QGVA 4L9YA 1WDWA 2PC8A 4H9TA 2H8XA 4S3CA 2WKLA 1GVYA 3NIYA 4KBXA 4ZSTA 1T99A 3EPNA 2E77A 1QOPA 3VOHA 4Y9NA 2EPHA 3PUOA 5I0DA 1K8CA 1LOQA 3FXYA 2AAMA 1MYRA 4MNJA