2X30A

Crystal structure of the r139n mutant of a bifunctional enzyme pria
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
240
structure length
233
Chain Sequence
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGNGWTRDGGDLYETLDRLNKEGCARYVVTDIAPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title Identification and Analysis of Residues Contained on Beta --> Alpha Loops of the Dual-Substrate (Betaalpha)(8) Phosphoribosyl Isomerase a (Pria) Specific for its Phosphoribosyl Anthranilate Isomerase Activity.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 83
structure length 233
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2x30A00
1O94A 2O7SA 4QQ3A 3K30A 4JY9A 1W5QA 1OK6A 3ZFHA 4AEOA 1FY6A 4Q4KA 2EHHA 3S1WA 4AAJA 5D2XA 2NZLA 4UTWA 5CPMA 4NXSA 1N7KA 1RR2A 1Q6RA 5D33A 2F84A 1LOSA 4LVFA 3RNDA 4LC6A 3FOKA 4UTUA 4MZYA 5I3HA 2C0AA 3PS7A 4BWLC 4UNLA 1Z41A 3TMLA 1PHWA 3W7CA 4EWND 2PRHA 3B0UX 2NXIA 1K7FA 1R46A 3E96A 3G1HA 4KWVA 4LV9A 1KM1A 4U28A 3IIOA 3B05A 5T26A 1VCFA 3IIXA 4O57A 3W7IA 2QF7A 4PL1A 1MXSA 4MZ8A 4RKAA 2OCZA 4C1KA 1TRIA 4UMBA 3G3MA 3KAOA 3SGUA 1VZWA 1VLIA 1FWNA 4MUZA 1OFRA 3W7DA 4LRTA 1QNVA 3LBMA 1C9DA 3NQ6A 3TA6A 4ADSA 3GNNA 2CLKA 3G22A 5CZSA 3GVGA 1S3HA 1F7BA 2QUUA 2QJHA 4UR7A 3IIVA 4HHPA 3OVPA 2QKFA 2NUYA 4R7JA 3TQVA 3GIYA 1F6KA 3G1DA 4AH7A 2Z2UA 5AN7A 4IX0A 4QAIA 1YLVA 4AMAA 2NUWA 4MVAA 3C0JA 3TV8A 2E6YA 1KFCA 4X3ZA 1UCWA 1Y0EA 1DQXA 4FX7A 4ORMA 3S1UA 3WJZA 2ZZ3A 4DF0A 2DP3A 3JRKA 1I2QA 4Z1DA 1SZEA 3A23A 5L9FA 2BX7A 1I45A 4K8EA 4AWSA 4NQ1A 3M47A 5AOUA 1JUBA 3S5ZA 4FNPA 1TPEA 5G4WA 4LNYA 2WV8A 4XWUA 1HG3A 4GJ1A 1ICPA 5E1QA 3UD6A 2VFHA 3THQA 3LM7A 3TC6A 3NR0A 4FX8A 1A5BA 1ZY9A 4LW7A 1G67A 1LZOA 1G7VA 1YTDA 1KBIA 3TQ0A 1L6SA 4O52A 5DELA 3W3OA 2ISSA 1Q45A 3MHUA 4FNSA 1W8SA 1AW5A 1MEWA 3PG9A 5BW6A 4O19A 3W7PA 3UWYA 4DO6A 2CU0A 1JCLA 3LCWA 2H6RA 2C15A 1QPNA 3MWAA 3NQGA 1P0NA 4N9DA 2JKAA 4UTTC 3KOFA 1W5OA 3BW4A 4DPPA 3QYQA 2ZZ7A 4UTKA 1HL2A 2CLFA 3KFTA 2YXGA 4OQVA 1WBHA 2Z6JA 3RU6A 3PF3A 3BG5A 4K36A 1IXPA 1UB3A 3LRLA 1LP6A 3LB0A 3W2JA 3GXPA 5DN1A 3MI3A 3O05A 2H3DA 3OHIA 5IBXA 4XBSA 3ABOA 3G1VA 3NZ1A 3UWUA 4EF8A 3U8GA 1B4KA 5AC6A 4ZL1A 3EXSA 5BOOA 4NX0A 3M9YA 4NXKA 2QDHA 3M5YA 2ZZ4A 1JCNA 5I3KA 2QCDA 3IEBA 5EL1A 1AK5A 2I1OA 3WJXA 1IGSA 4FXRA 1NVMA 3GR7A 4TIMA 5D02A 2QCFA 3OIXA 4IX2A 4LY8A 3PB2A 5CZTA 1SZFA 1ICSA 1V5XA 4LRSA 1NSJA 2DZWA 2OT1A 4EVZA 3FEMA 3I7QA 1SZNA 4IOTA 2C16A 1TYGA 2DZSA 5LHEA 1XBYA 3SW6A 2NWRA 1JVNA 4JDBA 3G1YA 4N4QA 1OFOA 2Y7DA 2A7NA 1QCWA 4MLRA 4JDYA 1G4EA 2QR6A 3MMTA 3RK8A 1EX5A 1VH7A 2ZRXA 1H1ZA 3NG3A 2Y63A 2GJLA 4LU0A 3NM1A 3C2VA 3A5VA 3ABRA 1W3IA 2FFCA 4N4PA 3BG3A 4IPJA 3NQEA 2WO5A 5D05A 2ATMA 1KFJA 1X6UA 1LDCA 1QPOA 4UTHA 1CI1A 4J9JA 3C3NA 3GDMA 4N9EA 3LTYA 3NYZA 4FXSA 5F1UA 1JUEA 3L21A 4JD4A 4K7YA 5AC8A 2B0MA 2FTPA 1EWDA 1SW7A 3BK0A 1OFBA 3W84A 3FJLA 3DAQA 3MBFA 3P7YA 2PC4A 5LSMA 4QNEA 3W9ZA 3STEA 4OV4A 1H50A 3C2OA 5AFDA 4HSNA 2QCNA 1ADOA 3BV4A 3UWWA 1FX6A 4TMCA 3P67A 3JS3A 4K8HA 4HT3A 1A5SA 5GVJA 1UUMA 2XN1A 2I14A 3U2OA 1IIGA 1FWSA 1S5WA 3NA8A 4MY1A 5G1YA 4GUFA 5CG7A 4ZQMA 2H3BA 4QNWA 3RLUA 3SECA 3SIZA 3W1TA 3R5EA 4LUIA 4KFOA 1DJQA 2QCLA 3NQ8A 2TSYA 1B3OA 4W9TA 1TQXA 3BG9A 3KRZA 4NZJA 1VR6A 3LTPA 4CQ8A 4FHAA 4DO5A 1EP1A 5KINA 3UWVA 1ZFJA 3HPXA 3IIZA 4PTNA 4QISA 3LDVA 1TV7A 1IXNA 3EX4A 1B4EA 4RR4A 3P80A 1SO5A 2Y89A 1WX0A 2V2DA 3P5YA 5KMYA 5ABTA 1PV8A 1KFEA 2NX1A 2RHGA 3S5NA 1LROA 1AW2A 3QF0A 3TW7A 3W2UA 3TC7A 1KTCA 1XC4A 1WQ5A 4LV4A 1HO1A 3L65A 3G1SA 3PULA 5LNVA 1RV8A 2WJZA 3FYOA 3NNTA 3DH7A 3NL2A 2OZ0A 1M7OA 3L67A 3LCGA 5LKYA 3HG2A 5DCBA 4QJ1A 5U7SA 4E2BA 4Q32A 1I2RA 1YDVA 1GTEA 1YPFA 2QAFA 4BI7A 4OBTA 4QITA 3W1RA 5K2ZA 4O14A 2V5BA 3QQ0A 4LOCA 5K4XA 1OYAA 1F76A 2C6QA 4MLJA 4Z1CA 5I3IA 4FB7A 1BWKA 2Q3RA 1J5TA 1FWTA 3B8DA 1BKSA 1AG1O 1OFQA 4JN6A 4UR8A 5G1TA 2QJIA 1SR9A 3LOTA 1PCKA 1QPRA 3PUOA 3W22A 4O0KA 1MSSA 1UBSA 3IVUA 2ALDA 5CPOA 4WOZA 4DF1A 5E0KA 4DBEA 3HO8A 5HMSA 3YPIA 2B7NA 3PY2A 3PSVA 5EMUA 3C6CA 2B7OA 1W5NA 4JTJA 4OGZA 3ZWSA 3PAJA 1MZHA 4RLIA 2ABBA 1T0OA 1XBVA 3N3MA 3CM4A 3NZRA 2DZVA 4MKNA 1NEYA 3PSWA 4YXGA 1H7WA 3W7OA 2Y88A 3PR2A 3O6CA 1LTDA 1DKWA 1ML1A 3S1VA 2CLOA 3MP3A 4N9CA 1YDNA 4JTLA 4JIQA 4ICNA 4EIVA 3T55A 3HB9A 3B4UA 1HTIA 3TJLA 1EEPA 4IMGA 2J88A 5CPNA 1OG0A 2Z6IA 2NX9A 3Q2DA 4IPIA 2ZA1A 1JJKA 4FIQA 4E0CA 4LS0A 5TIMA 1E51A 1G4SA 1OYCA 2QCCA 1JR1A 3LCLA 1N55A 1W0MA 4O4WA 3TMQA 2KZHA 1MO0A 3TU9A 3CEUA 2VEIA 1TRDA 2DZUA 2X30A 3Q58A 3QSRA 2ZA3A 2EAWA 2QUTA 1T99A 3UWQA 3R2GA 2YPIA 4CQ9A 4JGDA 3DI0A 3GXNA 1F5ZA 4OHQA 3NL3A 3LRMA 5CZJA 3M1ZA 3H54A 3EWBX 2DU2A 1W31A 5K3VA 3KVMA 1I2PA 4IMEA 2C18A 1SFJA 1BWLA 1GZGA 4ONVA 1P0KA 3CIWA 4A29A 1LOQA 1F6PA 3L0NA 4HN4A 3HBLA 3M5VA 5AC7A 3HQ1A 3LERA 2FQIA 2QEZA 2J9ZA 3CTLA 1XXXA 5C2XA 3VE7A 3HG5A 4BR1A 5K9CA 3E02A 3T4CA 4XBKA 5HUPA 3UPWA 1H1YA 3LGEA 4LVDA 4JNMA 3DZ1A 5CGQA 1FWWA 3CWNA 5K4ZA 1TV8A 1RZMA 2P1FA 3LHYA 4KFPA 3S6DA 3F1QA 1KM5A 2DORA 2R91A 4O15A 2FJKA 3FA5A 2E6DA 3ELFA 3HG3A 2EPHA 4ZQOA 3N19B 4UXDA 3NPWA 2ZA2A 5DLCA 3M7WA 2TPSA 4UFJA 2QCMA 2Y70A 3C4UA 3BLIA 3T44A 1ZAJA 2PCQA 1DJNA 2CZFA 2VFDA 5BRBA 2VELA 1F74A 3DGRA 3QW3A 3FS2A 1R30A 4RXGA 4NT0A 3W7QA 1OF8A 2FIQA 2E5CA 4O54A 4CLMA 1GYNA 1TPFA 1HO4A 4MFDA 2H8XA 3W2KA 1NAL1 4O10A 1SO4A 5E93A 1QO5A 4WY0F 2A7PA 1DL3A 3PBWA 3UWZA 3S5YA 4HNTA 2GOUA 3I7SA 3SSJA 2HS8A 1T96A 2DJXA 3MYOA 4BK9A 1PCWA 1SFLA 3S9YA 2DZXA 1TMHA 4O8RA 1R47A 4RZ4A 5F2GA 4I7VA 1F05A 1EB3A 4UIOA 1LYXA 5LZLA 4Y6GA 5LNSA 1DOSA 3WFAA 2IQTA 5HNRA 3L68A 3NO5A 1DVJA 3QM3A 4E38A 3T7VA 1I2OA 3W1UA 4NU7A 4GC4A 3I7RA 3TJXA 4RK8A 1ZALA 4TU1A 1I4NA 4Y96A 4OU1A 4IWWA 1DV7A 4R34A 4A3UA 3NOEA 5EYWA 1R2RA 2QJGA 1LCOA 4IGHA 5HR7A 1SO6A 3MO7A 3B04A 2GPTA 3Q94A 1G4TA 1JULA 4JTEA 3S8HA 3UY7A 2NWSA 2G5WA 2VFIA 3W87A 2ISWA 1Z42A 1Z48A 4RZ5A 3O8AA 1TPWA 3E0IA 3MJYA 1OX6A 1JRBA 3BVJA 2ABAA 2R8WA 1WDWA 3N34A 4BFAA 3L5MA 3BW3A 1O60A 2B7PA 5FF4A 4LC8A 5D2YA 3DENA 1OX5A 3OA3A 3KXQA 3ABQA 2E6FA 4LS1A 3N73A 4BI5A 2CLLA 3O6DA 4KKXA 3HGRA 3QPYA 1EUAA 5H2ZA 4E2DA 1KBJA 1XDLA 3GB6A 1ZCOA 1ME8A 4M7SA 2RFGA 3ATYA 2ZBTA 1V7YA 3P60A 3QW4B 3M6YA 2WSRA 2V9DA 3M0ZA 3NQVA 3PUEA 4JTGA 3OEXA 5D04C 1TTJA 1OABA 4UC5A 3EX6A 4Z08A 2V82A 1WXJA 1X1OA 3GLCA 5F1VA 4DF2A 2GQ9A 1PE1A 3SGZA 3BO9A 1YTKA 4O12A 2V5LA 1W5MA 5HWJA 3O06A 1TB3A 4TMBA 3O1NA 4N02A 5F4WA 4AB4A 3HJZA 3MI6A 4EF9A 3CLMA 1QOPA 1A50A 3UPBA 3WJYA 2E1DA 3CWOX 3QMTA 4NJHA 5D2VA 1K7EA 4QM1A 3TAKA 1PL9A 1U5JA 2G97A 4YCPA 2J27A 1X8FA 3L66A 1ALDA 3TCEA 1AW1A 1CX9A 2NXGA 3RLVA 2WNQA 1J4EA 2A4AA 3HG4A 3KRUA 4K39A 3P82A 2A21A 3IGSA 1L6WA 2BTMA 2CZEA 4YMZA 3QMRA 1U83A 5A5WA 3H55A 4WZHA 1LORA 1FUYA 3NL5A 3W7JA 2CZ5A 3C2RA 3FIGA 4GWEA 2QCDB 1OX4A 3TR2A 4UUIA 3UXAA 2JKEA 5J5DA 3PG8A 3EWXA 3TFCA 2CLHA 3R12A 5DBTA 4ORIA 1VS1A 4UTWC 1VCVA 3EXRA 2JKPA 3VE9A 1OX4B 3WK2A 1J2WA 2DZTA 3ATZA 1KFKA 5AB3A 4K38A 3PWAA 1WV2A 2NX3A 2V81A 2WSQA 3LV5A 4JTSA 5G5IA 4O0ZA 1EA0A 2CZDA 1HFBA 1W56A 3NPXA 3P62A 3C8FA 1RPXA 1D9EA 4OE7A 2JGQA 2CWNA 1FCQA 1VHCA 3B06A 3KRSA 4PODA 1AL7A 2YDAA 3ZS4A 4WX2A 5F2IA 3TW6A 1PS9A 2EF9A 1H7RA 2A0NA 4H4IA 1OVDA 2A2IA 4RX0A 2OJPA 3W1NA 1O95A 2CLIA 3L9CA 4M5PA 1EIXA 3PBYA 2RKXA 2X1RA 3KVKA 3I6RA 3CT7A 3W75A 1WOBA 2BWGA 1YDOA 2W0UA 4LVGA 2HSAA 3N2MA 2NXHA 2VEPA 1RVGA 1KM3A 2GVJA 4ZQNA 4XTIA 1O5KA 5FF7A 3B03A 1EUNA 3G0XA 2F7FA 2VXNA 5FF0A 1QO2A 3LXAA 4M6PA 1GVSA 1P4CA 1H51A 2NLIA 1SO3A 2NUXA 1K8YA 1TPH1 3FLUA 1M7PA 4IMDA 3TDFA 3W2MA 3GKAA 5K7JA 4RV8A 3BGGA 6ALDA 2YFOA 4BI6A 1TPVA 3TXVA 3P8IA 1BTMA 1NFBA 2Y7FA 1OYBA 3C61A 4RXFA 2E5BA 1KV8A 3OVQA 5LGXA 4ZZ9A 5TQLA 4HNNA 4ALDA 4DXVA 4XKYA 4NVTA 5G2HA 5EPDA 3LHUA 3BPWA 2UV8G 3W07A 5U4NA 4DBDA 3A22A 5KSWA 1LBLA 4AHOA 5BNKA 3DFNA 1R2TA 1FDZA 3LCHA 3FJ6A 4N6FA 3W7MA 4XKYB 1G6CA 4MY8A 5F4XA 2B7QA 4JYDA 3W1XA 2V30A 2YSWA 1YTEA 3PUDA 3DKJA 2ATSA 3F03K 2P10A 4NJIA 4NX5A 4A22A 5J5RA 3W6YA 2DZPA 1QWGA 3USBA 3MHFA 3QQ1A 2FLIA 2QDGA 1LRNA 2JBMA 3G8RA 4AVFA 3HMJG 1F73A 3T78A 1K03A 1VCGA 4PA8A 3F4NA 1R2SA 4BWLA 5KTLA 5BMWA 5I3FA 3UYCA 1W3TA 2X2GA 2TMDA 5CSSA 4UMCA 3TQKA 3D0CA 1QAPA 4B5NA 5KZEA 4MJZA 2HS6A 2OT0A 3CU2A 4GE8A 4Z0SA 1IIHA 5D09A 3PB0A 1XI3A 1H62A 3RF9A 3T40A 3IGUA 1TSIA 3THAA 3UQNA 1SZGA 3PBUA 4H6KA 3V75A 4HNVA 2WPBA 2FPYA 5IBXC 3UZJA 2XN0A 3EX1A 3A5FA 4PCFA 2VFGA 4MOZA 1ZENA 4I7WA 1FQ0A 2WSYA 2A6LA 3PBVA 1SU5A 1TCDA 1TO3A 5DCDA 1AL8A 1VRDA 3N2XA 7TIMA 2JK2A 4AF0A 3GDKA 1QFEA 4U4MA 3L0GA 1KW1A 3WJWA 2QUVA 3FKRA 1YXYA 3CPRA 3LRKA 4XZ9A 2J9YA 3W76A 2B4GA 3G24A 1GG1A 4O18A 4RCXA 1JQVA 4HPXA 1ME9A 5AYYA 3ZR4A 2AGKA 4O1DA 1LRQA 4FO4A 3W85A 4GNJA 5AHFA 3FYPA 4EOUA 5DBUA 4POCA 4IXHA 3W7LA 1GQNA 3UXDA 4WD0A 3TAOA 4WQ6A 1FDYA 4WXZA 5D30A 2PRMA 4M6QA 1PHQA 1TPB1 1IXOA 1DORA 1QDSA 1JCMP 4UMAA 1EP2A 3S1XA 6TIMA 4JEQA 4Y9AA 2ZRYA 4AXKA 2CFFA 3DXIA 4PL2A 1OFAA 2VENA 5HUOA 3SY5A 5KZDA 1I8JA 2GVLA 3W7GA 2ZTJA 3EWZA 3BLFA 4MZ1A 1WAUA 3IRDA 1ZAHA 3KX6A 3PC0A 3I65A 4L4MA 2ISVA 4TO8A 3AO0A 4HKPA 4YCOA 1OFEA 3CB8A 1NF0A 5F4SA 3GX9A 2NV2A 3W73A 2YYUA 2YR1A 3LI0A 5DY3A 3LHVA 2A85A 5D32A 4LVBA 3W7RA 2EKCA 1SPQA 2A7RA 3QSTA 4GUHA 3B0VC 4LT9A 4WY0A 4GUIA 1Q6LA 3CHVA 5EA9A 4JR5A 1UASA 4O13A 4UTTA 1H7OA 1THFD 3QH2A 1SQ7A 2W79A 2ZYFA 2BLEA 3G0SA 5CPLA 4WY0B 4DPQA 1GEQA 3TFXA 3QJAA 5EKYA 4JS3A 3R8RA 4Z0JA 3LV6A 2Y61A 5HWMA 4X9SA 1FBAA 3N9SA 3TXZA 1KA9F 3NXFA 2YX0A 4JIPA 1X1ZA 1VYRA 3OBKA 4UTLA 3CQ0A 3DFTA 5HWNA 3DBPA 5I3GA 4UNKA 2ZZ1A 2WKJA 3CIXA 2E09A 5L6UA 2XFWA 4RZ6A 2YW4A 2V8ZA 3NPVA 4OT7A 1S5VA 3A21A 4UFLA 3TK7A 5AHEA 1GVQA 1TQJA 1L9WA 1OJXA 4ZVJA 3EX3A 3O63A 2VOMA 4K6AA 1AMKA 4CCEA 3IVSA 1GPWA 2EGZA 2C13A 4LUJA 1PVNA 4X2RA 4PFMA 3W7EA 4LWWA 3W74A 3W7NA 3UNDA 1HUVA 1A5AA 3DI1A 4JTKA 4YLWA 2ZQ0A 3S5OA 3QZEA 4M19A 2RH9A 1GOXA 1VJIA 2H90A 5FESA 1GT8A 3HPSA 3MI2A 2LLEA 3NVTA 2Z0IA 2X1SA 3QPZA 1ZJIA 1M6JA 1XBXA 4GFSA 1QMLA 3P61A 1H60A 3JR2A 3DFSA 1CW2A 3GZ3A 3HGSA 1QR7A 1ZNNA 3EXTA 3RFAA 2ZTKA 5C5YA 1KLYA 4A21A 2R94A 4QIUA 4FNRA 8TIMA 2ZZ5A 2TRSA 1M5WA 1N8FA 3EKLA 3BLEA 2FPTA 2Z1BA 5I3JA 2PURA 1XDMA 5HULA 1TREA 4DEFA 2ZZ2A 3LLDA 3LXBA 4JXCA 2YCEA 3EKZA 1FWRA 3E9AA 5D2TA 2ZDRA 2CLEA 2YYTA 4JTHA 4JTFA 3HIJA 3PVFA 1ZAIA 3LCIA 5DXYA 4HIBA 3GKFA 4PEKA 3TUUA 1FCBA 2JGYA 1FCVA 4OV9A 4QSHA 1K02A 4PH6A 2C3ZA 5K9DA 1B9BA 4AWUA 4MYXA 1OF6A 4Z1BA 1MEHA 1TPDA 5F2LA 3DFOA 3C2FA 3HF3A 1JQXA 5FEZA 2NV1A 4JYFA 4NUWA 4ADUA 2P0OA 1GWJA 1QPQA 2HMCA 4N9BA 1VQTA 3LCXA 1KM2A 2FPVA 2YW3A 4H3DA 1W37A 4MJMA 4S1FA 1JCJA 3AJXA 1GG0A 4FNQA 2Y7GA 4UTIA 3EEGA 5HJLA 1SUXA 1GTHA 3HGOA 3M44A 4FEZA 3G1XA 3LHWA 3M16A 3P84A 3STCA 4CQAA 3NGJA 1XUZA 2Y62A 3G1FA 1VC4A 3STFA 2V2CA 4NJGA 3STGA 3W1PA 3VI2A 2H8ZA 5C54A 2Q3OA 4K37A 4DELA 1BEUA 3FFSA 4JYEA 4WXYA 4ADTA 3ZWTA 3E49A 1DBTA 2GQ8A 1K8XA 1ZHAA 1LBFA 4IQLA 1H5YA 2E5DA 4N2YA 4Q33A 1FCUA 3LXCA 3SFKA 4N6EA 4GUGA 3TKFA 4A2RA 5G2IA 2FB2A 3W83A 2QCHA 5EY5A 4A2SA 2C1HA 2O7QA 4S2CA 2QCGA 1ONRA 2ZRUA 3TE9A 1YYAA 1IXQA 1VHNA 2VFFA 1UJPA 5DCEA 2A6NA 2WNZA 5EBUA 3NL6A 3M5XA 1GVFA 4IMCA 3GAYA 1C29A 4HSOA 3NAVA 5F2MA 1EP3A 4WOQA 1SW3A 1Q3NA 4Y90A 1LLZA 4DO4A 2WQPA 3SR7A 1H7NA 3O15A 3HPZA 4I7UA 1F2JA 4GXMA 4JTIA 3NQ2A 5AYXA 1LOLA 3I68A 1JUKA 4P2VA 3NQMA 1NF7A 1G4PA 4D2JA 3Q37A 3NQAA 3LHTA 1YXDA 3TROA 2C14A 1EWEA 2C19A 2PE4A 3A24A 1OK4A 3NQFA 4WUIA 3R13A 2W6RA 3DFQA 5AHLA 4LTSA 4O1BA 3EB2A 1RD5A 3TNOA 3GDRA 4XUGA 3WJSA 3PM6A 3CEPA 1A53A 1ME7A 1RQEA 1SSDA 4TR9A 3P5ZA 3HOJA 4FX6M 4FNTA 4HPJA 3G1AA 1RQHA 3QFEA 3SZ8A 2AAMA 3QC3A 1FXQA 3BW2A 1WOAA 3FKKA 1W5PA 2Q8LA 1WYIA 3W1AA 3LCFA 5SWUA 2PRLA 1KFLA 2X1TA 3VKJA 4YWIA 3MP4A 4L4LA 3F4WA 4AHPA 4WJEA 4DQWA 4UCGA 1VGAA 5HINA 4MPQA 2ZRZA 1KM4A 3LI1A 4LS2A 4NNBA 2J24A 5FF2A 4ML9A 1S5TA 1IF2A 3OVRA 3EWYA 1W1ZA 4TX9A 1GVRA 5AYZA 3C2EA 3EWUA 1L2UA 1H61A 4CNOA 4G1KA 3GDLA 2E6AA 1SSGA 4NJJA 4MIMA 2WNNA 5LHFA 2YGYA 3S0CA 3W1LA 2ZFAA 3TH6A 5BMXA 3RMJA 1KTBA 1Q6OA 3DHFA 4ZQRA 2I9EA 4ZQPA 3ANYA 2Q8ZA 2RDUA 3VFLA 5FEXA 3GNDA 1P5BA 2VEMA 3GYEA 3N9RA 4FF7A 3KVJA 3LHZA 5FI8A 1X7FA 4R53A 3TSMA 3WK1A 5C6MA 2R14A 2RDWA 3NQ7A 1XL9A 5A8GA 4O28A 1XBZA 4MY9A 4X22A 3MBDA 1VLWA 3GXTA 4NNCA 2AQWA 2GVGA 3W86A 5LNWA 3C56A 3KHJA 3G18A 3M5ZA 3INPA 3TSDA 3LX9A 5D03A 3EX2A 3UZ5A 2X16A 4PC8A 3L2IA 4LVAA 4C1LA 4NZFA 4K7VA 1VYSX 4O4VA 1JRCA 4O1CA 4Z1AA 3SI9A 2FB3A 2Y6ZA 5LNRA 4JTTA 3QRHA 4JX6A 2YZRA 3DKLA 4I9AA 2CLMA 1TJRA 2XN2A 4IJBA 1TIMA 5D37A 3MW7A 1O5XA 2GQAA 3L5AA 4P61A 1LLWA 3U6WA 3TSBA 5KITA 3G8EA 2DJLA 5KZMA 2WOQA 3NQCA 2ZRVA 1KTNA 3VNDA 2HTMA 3WK3A 4FIRA 2D73A 3EWWA 1PIIA 1O4UA 3QEZA 3MP5A 4IUOA 1JCYA 3R89A 1JCXA 2E68A 3E12A 3M43A 1T8XA 4FNUA 1XFBA 4M6VA 3VCRA 4UFKA 3NQDA 1TJPA 4O17A 4UFHA 4YL2A 4O50A 4RJEA 1Q6QA 2VEKA 2ZRWA 5LGZA 3C52A 5D2WA 3IGXA 2X1UA 3W23A 5FF3A 3GK0A 1TV5A 5H91A 5G4EA 1FDJA 2GJNA 3TIMA 4O1AA 3LTSA 3ABSA 3P74A 3SJ3A 1OHLA 1P1XA 1MEIA 1W3NA 3MHGA 3W7HA 3N14A 1ICQA 4O16A 3W88A 2ZCGA 3M41A 4GRSA 4AHQA 4Y8FA 5MHBA 3P8JA 4KFNA 1K8ZA 2A1YA 3O6YX 3HGJA 5HR6A 2A5HA 3B0PA 3TX9A 4AF0B 2J9XA 4NNAA 1C8VA 3A9IA 3W1QA 1YPIA 5K9XA 4KWWA 1XKYA 2QAPA 1DHPA 1XUUA 1G69A 1WA3A 2OMAA 5CKSA 1G7UA 3IVTA 3MYPA 3W7KA 2ZZ6A 2FDSA 2BSLA 1GJPA 1GYLA 2G95A 5CZ0A 1YADA 3KVLA 1TTIA 1LRTA 1TTPA 4UFIA 1XM3A 3W2LA 4O11A 4UTMA 1KFBA 3BARA 4S2BA 4O53A 4NJKA 5TBOA 4IMFA 3S42A 4UFMA 3CC1A 1Z44A 2VFEA 3OG3A 1D3GA 1KM6A 2VC6A 4CNNA 3H53A 5FEWA 3NM3A 5DXXA 1YXCA 1LM1A 1KLZA 3G3DA 1EPXA 1QOQA 3NEVA 1L6YA 5AHIA 4XQ6A 2QCEA 5AHMA 3L5LA 3QMSA 3MUXA 4CCCA 1KV5A 1SW0A 2V0TA 3UY8A 1B57A 4AWTA 2J6XA 4GBUA 3DU0A 1WBJA 2RDTA 3W71A 5HQEA 1VYPX 3P81A 1H7PA 4M7TA 4JTUA 1K7XA 2E77A 3NDOA 1TPUA 5IM51 3GAKA 1TTQA 4JX4A 3V1PA 1D3HA 5CSRA 5AHNA 2Y7EA 2Y85A 2VKZG 2V2HA 3G0UA 3W72A 3DFPA 1VPXA 5DY2A 1UUOA 3BGJA 2BZNA 4MYAA 3L0KA 3WK0A 4HNUA 1XCFA 3NPUA 1RQBA 1TPC1 4MFEA 3O07A 1K3UA 4IXXA 1H63A 3W70A 1OFDA 1H7XA 1DQWA 1W54A 4ZQCA 4CCDA 3W2NA 2GUUA 3LLFA 3LBCA 1A5CA 1I2NA 4JY8A 5D38A 4BF9A 3GDTA 4UTJA 1OFPA 2YFNA 4OWGA 3IIPA 3W1MA 2BXVA 5FEPA 5LNUA 2OX1A 4XTDA 5C55A 4GUJA 2CW6A 4R33A 5G2WA 4CNPA 3O16A 1KM0A 2G96A 2TYSA 3GR8A 4JX5A 3IV3A 4ZMGA 1LBMA 1GVOA 4JICA 3DHDA 1FXPA
chains in the Genus database with same CATH superfamily
2RAGA 3F4CA 2NQ9A 1EYEA 1XLAA 4ACYA 4F0LA 4Q6XA 1TV3A 1OK6A 4AEOA 1QK2A 1PZ1A 3S1WA 1U2YA 4AAJA 5D2XA 2NZLA 4AQLA 4UTWA 5CPMA 1B5TA 4NXSA 5E0FA 1RR2A 1TJ2A 1Y5VA 2ZXQA 5C71A 3EOEA 3PWGA 3RNDA 4UTUA 3BTNA 2FZ9A 2OO0A 3WLKX 4YIWA 5I07A 3TMLA 3WL0A 1QT1A 1RJPA 1PHWA 1HNYA 1WDDA 4WDXA 4M1RA 3B0UX 2NXIA 4RW3A 4NY2A 1IEWA 1RD6A 3G1HA 4KWVA 2WHLA 5AZ0A 1CGVA 4LEQA 1XQLA 3R8HA 2YL5A 4UMBA 4KQNA 3A9BA 3L12A 3FAWA 1VZWA 3K8LA 3W7DA 4LRTA 4Q7IA 1QNVA 2PDPA 4WSJA 3H2NA 2GK1A 5MKGB 2EG6A 5CZSA 1HJUA 4AMCA 1F8MA 2QUUA 2G41A 2BGQA 3CV6A 3UJRA 4HHPA 3AHTA 3OVPA 3N2TA 2NUYA 4R7JA 4HSHA 1YX1A 4O1EA 4QGCA 2VD8A 3M46A 2Z2UA 1V0KA 2IMRA 1PTAA 3SM0A 1PKNA 1XPYA 4ERIA 1V6UA 3W37A 1A3XA 3HQOA 3EA1A 1BXNA 1KFCA 3E0VA 1XGDA 3V0UA 1I2QA 1K6AA 2GJPA 4LANA 4JQ4A 3VMNA 2BX7A 4K8EA 4AWSA 4WGXA 2E9LA 3MT1A 3M47A 4RPQA 5AOUA 3CQJA 1UD3A 1Q6GA 3TYAA 1Z7AA 4MTVA 4EE9A 4K1GA 4HTBA 1C93A 3T2OA 1ICPA 3IAQA 2VFHA 3WLHA 3OW1A 4FX8A 1AH4A 3KE0A 1G7VA 5CH9A 1XYZA 2CWXA 5CAHA 5PTDA 3QV7A 3AIWA 5DELA 2D22A 4LUTB 1BF6A 1JF5A 1H2JA 2QVHA 1MEWA 4G8TA 3PG9A 1ISZA 4N0RA 1KQYA 1XPGA 1KCLA 3NZGA 2C15A 1J5SA 4DAIA 3NQGA 4NI8A 3KOXA 2ZX6A 3ONCA 3BW4A 1P6CA 3BWWA 5CPSA 3BQ5A 3KFTA 2YXGA 2Z6JA 1KBLA 4J3SA 3BG5A 3JU2A 1UB3A 4DWSD 5M2FX 4W8AA 2RDXA 3QY8A 1ECQA 3O05A 1F4HA 5DN1A 2H3DA 3OHIA 4R3UA 4A6GA 4B5XA 4ICMA 1BLIA 4EF8A 1B4KA 3U2ZA 4GH3A 5A2CA 3M9YA 3M5YA 4G1NA 2QV5A 2I1OA 3H2FA 1QW8A 1IGSA 4HU8A 5D02A 3V5FA 2QCFA 1AZ1A 2BOEX 1S2AA 2PB1A 3K8KA 3ENLA 1Q6FA 2DZWA 2OT1A 2OGJA 3FXYA 4RPPA 1XFCA 2YKKA 5EMYA 2C16A 5I03A 2DZSA 2NWRA 1JDAA 1JDFA 2XGBA 4JDBA 3G1YA 3E2SA 1OFOA 2DY3A 2Y7DA 5B7YA 4MLRA 2NLYA 1EXPA 1E1CB 1H1ZA 2Y63A 2E8YA 2R24A 2FFCA 3VOFA 3NQEA 2E67A 1LL6A 2WO5A 1OY0A 1NDWA 6CGTA 4H6QA 3SRFA 3ZOAA 3NYZA 2WZEA 2VZUA 3GS6A 4FXSA 4HNCA 4GI4A 5F1UA 4K7YA 5HMEA 5AC8A 3SADA 5GNYA 2FTPA 4PCNA 4US5A 3W84A 3DAQA 3K46A 3CUHA 5J8LA 1GKQA 3PZTA 1H50A 3C2OA 1CGTA 4JIEA 4HSNA 1ADOA 1IZCA 1R3TA 4TMCA 1E55A 3MUAA 4K8HA 1A5SA 8XIMA 4H6RA 2V67A 2WVTA 3AYSA 1S5WA 2PDBA 4LGXA 4GUFA 4AC1X 3W1TA 5FJTA 4LF2A 2YLLA 1G0CA 3NQ8A 1B3OA 3RR1A 1VR6A 3MKCA 5KINA 1UWTA 4GXWA 1UKOA 1JZ4A 3IIZA 4HNLA 1D8CA 1PKMA 3VD4A 3TC3A 3CHCA 2QXWA 3PNZA 2D0FA 2PWDA 4D72A 3KBJA 2G4FA 3OQEA 3GNXA 4ASTA 4HA1A 4IIGA 1SO5A 1WX0A 3TNBA 1FH7A 5FACA 3B40A 3LK6A 3QKEA 5ABTA 1QBBA 4FOJA 1PV8A 1QI2A 1E6PA 2PI6A 1XLKA 3M0KA 4GD0A 4MNMA 3QYSA 1WQ5A 2GGEA 2VTFA 1V6YA 4NL1A 5BU6A 4HVXA 3MMUA 3DH7A 3NL2A 3LMYA 2GGJA 4E2BA 4JKMA 1W8GA 5HMFA 1I2RA 2QAFA 4OBTA 3W1RA 5K2ZA 4O14A 4PE8A 2PWHA 2V5BA 3QQ0A 4LOCA 5K4XA 1F76A 1V79A 2G3FA 3ES8A 2O56A 1BWKA 4A8RA 1C8YA 1FWTA 3B8DA 4GOAA 4UR8A 5G1TA 2QJIA 3LQGA 5E9XA 1PWLA 4NRRA 3NZQA 3AIVA 4MSSA 4DF1A 3MV11 3AS2A 3HO8A 2MUCA 2B7NA 1US0A 3PSVA 4E2VA 2J8TA 4WJXA 3PAJA 1Z69A 1MZHA 2VQUA 5EB8A 1XBVA 3CM4A 3NZRA 4GI9A 4RNJA 1BGGA 3BZJA 4I6VA 4GX8A 4MKNA 4MWAA 4JAWA 1UP2A 3PSWA 4YXGA 3GD6A 3P14A 1Q4WA 2WZIA 3K13A 4ZTXA 1DKWA 3UU0A 2OFJA 2CLOA 1XYMA 1QNQA 4N9CA 4GKLA 4DLMA 3IJIA 2WPGA 4ICNA 4EIVA 1TJ0A 2BVYA 3B4UA 3GO2A 1EC8A 3H4WA 3ZMRA 2CC0A 2J88A 3Q2DA 4RDWA 3R6IA 1E5JA 3ARXA 4FIQA 5GJNA 3HQPA 5HANA 3LCLA 1N55A 1AQMA 2Z00A 2KZHA 1DWFM 3WQ5A 3LS9A 1TRDA 4YVXA 1W9XA 3Q58A 3NDYA 4CVUA 9XIAA 2HWGA 4GYKA 2BB0A 2YBTA 3CUJA 4DUXA 5F7UA 1M7XA 5B7ZA 2Z2BA 4GYPA 3D5HA 3MZNA 3BAIA 3M1ZA 2DU2A 4LPCA 2GWNA 1P0BA 1I2PA 3WNMA 2RGMA 2NV9A 4ONVA 1L0PA 3CIWA 2ZUWA 1F6PA 3L0NA 4OIFA 2J7GA 1WDPA 4QE4A 4C6PA 3CTLA 2POZA 4LF1A 5C2XA 1WPCA 1IWAA 2CHOA 3VE7A 4WRHA 3HG5A 1XGZA 4BR1A 3E02A 5K9CA 4XBKA 3MUZ1 5HUPA 1H1YA 2JIWA 3CLWA 3MQTA 5DFAA 4GHRA 2WJFA 1JYVA 4ILSA 4LB4A 3AHYA 5CGQA 1RZMA 5REQB 3LHYA 1C92A 2FZNA 3S6DA 3OB8A 1XD0A 5I7GA 1N8WA 2V5DA 4M82A 5C0QA 1I6NA 3WEMA 3AUOA 1PDZA 3FA5A 2E6DA 3HG3A 1PWMA 1EBHA 5ECUA 4UXDA 2BFGA 4CD8A 2QJMA 4YTUA 4P8UA 4DWSC 2TPSA 2QCMA 1B3XA 2BHYA 3C4UA 4KETA 1DJNA 4LH8A 3QW3A 3DGRA 4GK8A 1HXJA 2GLKA 4DO7A 3W7QA 3GNOA 4MNLA 2FIQA 3DUGA 4CLMA 1LQ0A 4JL1A 1TPFA 3WH7A 4DUVA 2UBPC 1NAL1 3HJEA 4GVIA 5E93A 1QO5A 2VVSA 2PWGA 2W63A 1DL3A 3PBWA 4GX9A 2VEFA 3S5YA 4L7ZA 1E4NA 3CH0A 3MYOA 4NRSA 3GG7A 1XH0A 1PCWA 3CYVA 3F5LA 1E40A 2DZXA 1TMHA 1NJJA 1FTXA 1KRAC 3DCPA 4J3UA 1F05A 2TAAA 2GWGA 1EJ7L 2DDXA 2Z24A 4PSRA 5HDRA 4E38A 4MB3A 4LX4A 4L1XA 3T7VA 4HPNA 5FA5A 7CGTA 1IEQA 4NU7A 4GC4A 2Z27A 2G37A 3TJXA 1ZALA 4YYCA 3GBDA 4I5XA 1GCYA 4Y96A 4US5D 2QULA 2XH4A 4P7RA 2JALA 1R2RA 2E25A 3ARSA 4BZYA 3RM8A 1LCOA 3A4XA 5C7HA 2NQHA 5HR7A 4AC7C 5I2UA 3B04A 1NIUA 4BQ2A 4U2ZA 3UY7A 4ZE5A 2IKJA 1V3JA 1X8CA 1W9VA 2VFIA 2ISWA 1Z42A 3VKAA 1XIHA 4DRSA 4HN8A 1JRBA 2R8WA 3N34A 1XQKA 1O60A 5FF4A 4LC8A 3SN4A 1KWGA 3LPPA 3HGRA 4LFYA 9XIMA 1BQCA 1EUAA 1XDLA 3GB6A 1ZCOA 1ME8A 3T05A 2X0HA 1XCXA 5XINA 1V7YA 1WUEA 3P60A 3QW4B 3SURA 2BASA 2WC7A 1A5MC 1LF1A 2WSRA 2FHCA 4J35A 3NQVA 1TTJA 4UC5A 3OZOA 5ABEA 4Z08A 1Z8AA 2V82A 1X1OA 2VCCA 3AXKA 3GLCA 3CZGA 5F1VA 2PU0A 2GQ9A 3TTOA 3QTPA 3HV9A 3N2OA 1PDYA 2D0GA 4IP7A 3QR0A 3SQLA 1TB3A 3O1NA 4N02A 4JHMA 4EF9A 4J3VA 4DUOA 2E1DA 1FA2A 3CWOX 3QMTA 4NJHA 2VZSA 3ITLA 4QLKA 3SGGA 1CXFA 2CIPA 4PR4A 4QM1A 4YCPA 4Q22A 2BY1A 1X8FA 3C0SA 3AMGA 3CZKA 3LBOA 1CX9A 1XICA 3RXZA 1J4EA 3KRUA 2A21A 1L6WA 2BTMA 5A5WA 3OBAA 4WZHA 3W7JA 3FIGA 5CPTA 2BY0A 4J27A 4FMVA 3TR2A 5J5DA 3TFCA 3V35A 4AVNA 2CLHA 4L64A 4C6KA 4DYEA 4UTWC 3D47A 4UTFA 1XF0A 3CGTA 4G9PA 1J2WA 2RGLA 3AQUA 1KFKA 2QDEA 1YKWA 1MRAA 1JD7A 3BH4A 4K38A 3AMCA 1MW0A 2OQYA 4V2XA 1T41A 1VFOA 1VKFA 1RPXA 2Z26A 3WMCA 2NT1A 2JGQA 1VHCA 4MWAD 1AL7A 4QSFA 2YDAA 3G77A 3IGHX 1R86A 5F2IA 2HK0A 1PS9A 2EF9A 4QFUA 3U5YA 3H23A 1OVDA 4E4FA 4B5VA 4HZ6A 3MUY1 2PD9A 3CNYA 1WKEA 2VDIA 3PBYA 1F3WA 4QX4A 2RKXA 4RNIA 2EEXA 4PUDA 4JTQA 3B3DA 3QBUA 4XIAA 4GYJA 2HSAA 3N2MA 3A3XA 1S2TA 1RVGA 3TZFA 4ZQNA 2VM8A 2X2YA 1O5KA 1BGAA 1Q6CA 2R1MA 1UMYA 3UA3A 2XVPA 3ORWA 2VXNA 2PPGA 5FF0A 4XSLA 2X42A 1GVSA 3VOHA 2CKRA 1ZJAA 5TAOA 3TDFA 4W93A 3CUXA 3BGGA 1JXJA 4HCHA 1EDTA 1E6QM 1BTMA 3ZLGA 4YWSA 1OCQA 4ZZ9A 1RCXB 5TQLA 3F2CA 4HNNA 4Y9OA 3GHUA 5HAOA 3W07A 3WQ6A 4HMNA 1TV2A 4MB1A 5KSWA 1LBLA 4AHOA 1R2TA 3LCHA 3GU1A 3WF3A 1LT7A 1I0DA 3IRSA 4PMQA 1WB0A 3CK5A 2V30A 3PUDA 3DKJA 4YPJA 3N2BA 1I75A 2NVDA 4J3TA 2J75A 5J5RA 2NQZA 3USBA 1QWGA 3RLGA 4YHGA 1UIOA 1XLHA 2CITA 1LRNA 4Q8WA 4D6GA 3HMJG 1WXZA 4CD4A 5BWFA 4BWLA 1R2SA 4PGLA 1HKKA 3BC9A 1V3MA 3VD3A 2WANA 3UYCA 4C5ZA 2TMDA 3PJUA 4PN2A 4PBGA 3D0CA 3E38A 4B5NA 4OVXA 1X38A 1L8NA 3CMJA 4GE8A 1IIHA 5D09A 3PB0A 3SCWA 1QPKA 3T40A 1ONXA 1EJSC 3RG6A 3UQNA 3GFXA 3OZMA 1XW8A 3UZJA 3MMWA 5I79A 2VFGA 1VRXA 3CPGA 2XZ7A 3ABXA 1PB0A 3C0QA 3OU8A 2ANUA 1SU5A 3FHQA 1VRDA 3N2XA 4NF7A 2P8BA 3EDDA 1IYXA 1XC6A 3PTQA 2QUVA 3L4UA 3KL3A 3S47A 3B0XA 1O6IA 4O18A 3BAKA 1KB3A 2OWWA 4HPXA 3VIHA 2HQAA 4IPPA 4ERGA 3EPMA 4GNJA 3CV2A 2O55A 4B4HA 3KL0A 2F6UA 4JIRA 3A6OA 4W87A 5D30A 4GYFA 4M6QA 4I6KA 1DORA 2E40A 4GC3A 4XKMA 1JCMP 4C5YA 4DI9A 1EP2A 2O9RA 6TIMA 1VFTA 4AXKA 3MSGA 3ICJA 3I6TA 3UZXA 2J62A 4IP5A 3WX7A 2OKOA 5KZDA 4C6EA 1I8JA 4R88A 3BJFA 3EWZA 3S2MA 4V27A 3NSMA 2Z1KA 4H00A 1CB7B 3AO0A 3GQYA 1Q6EA 3IJ7A 2R9RA 5FJJA 3WUEA 3W73A 4GQGA 3LI0A 4DLFA 2A85A 5D32A 1UH3A 1RCQA 4LVBA 2EKCA 2ZE0A 2HRWA 3WIJA 3BURA 3B0VC 4LT9A 2V5CA 4GUIA 5AVNA 3CHVA 1IR1A 1H7OA 3AIEA 1VFLA 4KRUA 2WZTA 4QEHA 3ZLFA 2W79A 4ZE4A 2BLEA 1XLDA 4EANA 2DW6A 3OVGA 4WY0B 3VIGA 3TFXA 2PP0A 2FH6A 2NQJA 3LV6A 4KT2A 2GZXA 2W67A 5EMJA 4IT1A 4X9SA 2DSZA 3L4VA 4MNJA 1H5VA 1BAGA 4TVUA 1HP5A 2YCLA 3N12A 1LJYA 3G6MA 5I0DA 3E2VA 3W27A 4LAZA 4UTLA 3CQ0A 3VNMA 3DFTA 1Q66A 3DBPA 4ZO6A 5I3GA 4UNKA 4DNMA 4CEXC 3RPDA 3T0DA 3NPVA 5AKQA 2VYOA 2OWCA 3W01A 4S3KA 1J6OA 3VD9A 2ZDSA 1JFXA 2CLPA 4ZVJA 4ATWA 4F48A 1TX2A 3IJLA 1GPWA 3KDNA 2C13A 4X2RA 3VYLA 1T7LA 1HUVA 2CHRA 3GUWA 1E0WA 2YLAA 4AEEA 1U5HA 4P8WA 4YLWA 1XIFA 3S5OA 1E72M 1VJIA 3HPSA 4B9ZA 2LLEA 3NVTA 3CMGA 4R85A 1OGGA 4CN1A 3QLDA 1GKRA 1IZJA 2F6KA 1FWAC 3MMDA 3OGVA 1UD2A 4PMVA 1US3A 3FCPA 3VUSA 1PTDA 1QR7A 4HK7A 4IQEA 4A21A 2R94A 4QIUA 3G2GA 2ZZ5A 2OKTA 5DF0A 1RP9A 1XDMA 3APTA 1TREA 3LLDA 4I90A 3LXBA 1LWHA 2YCEA 1FWRA 4UWMA 1RY8A 4DJFA 2CLEA 3MWCA 4IPNB 1JNDA 4MWAC 1JGMA 1ZJHA 3J7HA 3PVFA 1PBGA 4Y9PA 4HIBA 2XFRA 1NQKA 2DIJA 4PEKA 4QJ5B 2JGYA 3SFWA 4QSHA 1OT1A 2F2HA 2C3ZA 3LEPA 4C91A 1B9BA 4MYXA 4Z1BA 4JFSA 3DFOA 3IARA 4XD4A 2P3ZA 3MSYA 4N9BA 1XD1A 5CJMA 3LCXA 1KM2A 4H3DA 1W37A 3S2LA 4FNQA 5JIPA 1HJSA 2Y5SA 4B4FA 2OYMA 3DN5A 1GTHA 3HGOA 2NT0A 3OLIA 3G1XA 1ZZMA 3LHWA 3BLPX 1UH2A 2DSWA 3V1HA 3STCA 1KBBA 1W1PA 4NJGA 1P6BA 3VI2A 5C54A 4OFCA 5CAKA 4GYPC 3IJDA 2IS7A 2YBUA 1ITQA 4MGGA 1IWBA 2FZBA 1UWUA 2REQB 5RUBA 3C2YA 1DBTA 2GQ8A 2VR4A 3KWXA 3MDUA 2F38A 3VC6A 4IQLA 1ZRQA 4OKDA 4AZ6A 1A5NC 3U4AA 3SFKA 4GUGA 3TKFA 3VM7A 3OPSA 2QNEA 3CB3A 1X39A 5EY5A 4A2SA 4S2CA 1ONEA 2JFEX 3MANA 2PAJA 4R7OA 4DBUA 4XV0A 2FZMA 1V6VA 1UJPA 5IHSA 1LL4A 4I9MA 2A6NA 4TQTA 2WNZA 1GVFA 2B81A 3NAVA 1EP3A 4XZWA 3RYSA 1Q13A 2YL8A 2X7WA 4GY7A 2XVKA 1EX1A 4Q8TA 3B9EA 4JTIA 4KBXA 3WDHA 3QV8A 4FPSA 5AYXA 1EJVC 3VKBA 1TWDA 4QXIA 1RLDA 3WQWA 1NF7A 1G4PA 1KKRA 3Q37A 3TROA 4KCWA 4M29A 1Y65A 7REQB 4GG9A 2WM0A 3NQFA 3R13A 3DFQA 4AZBA 4LTSA 4O1BA 3EB2A 1RD5A 1PO9A 2PA6A 3GDRA 4XUGA 3WJSA 3A4JA 1JPKA 3PBGA 1EF2A 1RQEA 1OC6A 1SSDA 4TR9A 3P5ZA 3H24A 3OIHA 4FX6M 3SZ8A 2XFFA 3UR2A 3LA4A 1BHGA 2BVTA 1CXIA 3AMKA 3LCFA 1GYMA 4M24A 3VCNA 2FDMA 2EPLX 4C7FA 2VCBA 2ZRZA 4RV3A 4XVDA 1O7AA 4LBUA 5C9UA 4QBXA 1ZP4A 1KM4A 4FLRA 2J24A 5LIXX 4UQ9A 1V51A 2ZUMA 2PU1A 3EWYA 3OVRA 4TX9A 3AS0A 5AYZA 2A3LA 4PMDA 3EWUA 4NZCA 3T1GA 3K4DA 4MKSA 3R25A 2HE8A 1RALA 2BG5A 2D0HA 5FJOA 4HOXA 3MDWA 5CC3A 3DHFA 4UQDA 1UZ4A 3ANYA 5A8QA 3ARZA 3TZNA 1TE6A 4NHVA 4CCZA 3WD4A 1R38A 2Q8ZA 3VFLA 1BG9A 5FEXA 2QIWA 4DJDA 3GYEA 4FF7A 1CLXA 2GYIA 1S3TC 3ABZA 2R14A 4DX3A 4HYWA 2WMKA 4FALA 1KCKA 5HMDA 3S3GA 1YEYA 4F0HA 4X22A 3MBDA 3REQB 1VLWA 3GXTA 1GVEA 2GVGA 2QPUA 5LNWA 1E4IA 2QS8A 1RBAA 2HVMA 2XIMA 4FR6A 3GE7A 5JH2A 2FGLA 1J0ZA 5FL0A 4Z1AA 2Z1VA 4MG4A 3ZSTA 2Y6ZA 4JTTA 3QRHA 2YZRA 4PFHA 1TJRA 1H0IA 3UXIA 3CYJA 4PTMA 3QOMA 5D37A 4JCMA 4AIEA 4CNSA 5KZMA 1GOWA 5GQBA 1KXVA 3B97A 1VF8A 3WK3A 3EWWA 1PIIA 1UKPA 3R43A 1JCYA 3GXMA 2QW5A 2E68A 1Q4NX 3M43A 4AZCA 3WDQA 1XFBA 3PPCA 5BRQA 3VKCA 1SFSA 3SUSA 1TJPA 4O17A 4GMEA 4H41A 1Q6QA 4B92A 4KEUA 4RE2A 5DEZA 3TIMA 3ABSA 3P74A 2DV0A 3CJPA 1P7TB 3DG6A 3N14A 4GRSA 5E6YA 4BF7A 2WSKA 4F8XA 1F6YA 2G50A 3BLDA 1S38A 2QMJA 2UY5A 2A5HA 4WHBA 5CEWA 3W1QA 1CXKA 5K9XA 1ECEA 2QAPA 1OGBA 1XUUA 4ZB5A 1G69A 2C0HA 2Q02A 2OMAA 1ZS2A 4MAZA 2AOSA 1FHDA 1XRSA 3FGCA 1NWRA 4WCJA 2ZZ6A 3UA4A 1GJPA 1GYLA 2G95A 1YADA 1TTPA 4UFIA 2ZX8A 3MB9A 4O53A 1JAEA 3S42A 1Z44A 4DJFD 4D1IA 2VC6A 4LSBA 4UR9A 3K8MA 2AQVA 1UD5A 3NM3A 1PZ3A 1YXCA 1KLZA 3G3DA 3FX4A 1QOQA 5E70A 1L6YA 5AHIA 1IR2A 4WF7A 4IL2A 5AHMA 3WLIA 1SW0A 3AIRA 2J6XA 4GBUA 2RDTA 3BLLA 2D20A 5HQEA 4ZENA 3CQIA 2DEPA 3HTWA 2UY2A 1V02A 2G3NA 3V1PA 1D3HA 5CSRA 2Y85A 3W72A 5A8MA 6ENLA 3B9NA 4MYAA 3T0AA 3WK0A 3VDBA 1XCFA 3RDKA 1TPC1 3BMXA 1VP5A 4WIWA 4IXXA 3WEZA 1W9DM 2VC7A 4Q8NA 1J18A 3BAXA 1V3LA 1IT8A 3PAOA 3RPTA 3MCNA 3LBCA 1NU5A 1I2NA 5D38A 2G3IA 5HJXA 4G5DA 2YFNA 4C90A 4OWGA 3PFRA 3PZIA 1W9PA 2OX1A 2PGFA 4S23A 4Q8UA 3O16A 1VAHA 3URBA 4JX5A 1F8IA 1J2BA 3SY8A 3DERA 1Z9AA 1O94A 2O7SA 4QQ3A 1XR2A 3FA4A 2OO6A 4WKFA 4KRTA 2F6XA 3MSDA 5D4YA 1DTNA 1A47A 4KGJA 1QRQA 2EHHA 1VIZA 4XZNX 2OGYA 1M3UA 4AYSA 1Q6RA 3R8GA 5D33A 3CAQA 4OZOA 4MZYA 3JUGA 5HBFA 1LG1A 2C0AA 4BWLC 1X96A 4UNLA 3WQVA 4EWND 3C5QA 5A6JA 1K7FA 3E96A 4FZIA 1KM1A 4U28A 1QNSA 5T26A 1VCFA 3W7IA 5CBIA 1GONA 3W82A 4RKAA 2PLCA 2OCZA 3TQPA 4LCRA 4Z17A 5MKGA 1W2VA 1VLIA 1UZDA 1R5YA 1BYDA 2DVTA 3NQ6A 3TA6A 1FWCC 2D23A 3LZ3A 2CLKA 4QJ3B 1XLJA 3GVGA 4Q8VA 3B9AA 2FHFA 1BTCA 4UR7A 4Q4RA 3CAKA 3IIVA 2EPNA 1WDQA 3PANA 3TQVA 2JF6A 3LNMA 1SM9A 2ZE3A 3VVGA 1JEZA 1P0DA 3SCOA 3B9DA 5JIWA 2BY3A 3S1UA 2ZZ3A 3TLLA 3JRKA 5BXRA 2PDXA 1XWYA 2Y5EA 3QR3A 2IPJA 4NQ1A 4KESA 7ODCA 3S5ZA 4ZTYA 2YXOA 2IKGA 4FNPA 4AUBA 1YMYA 3ZJKA 3IWPA 4DJDD 4XWUA 1HG3A 4GJ1A 3UD6A 3TC6A 3NR0A 1XRVA 2HDJA 4LUTA 4LW7A 4IF2A 2WMFA 1YTDA 1BVNP 3TQ0A 1I60A 1R7OA 1ADDA 4KRZA 1EJTC 1SJAA 4WGHA 2IPFA 4FNSA 1I0BA 2XPKA 4D8AA 5BW6A 1YDYA 3W25A 4DO6A 2CU0A 1XG4A 2H6RA 3SCTA 3CV1A 3MWAA 2JEPA 3P2VA 3CTTA 1LLOA 4W5UA 3LLXA 4D6FA 3RCMA 3NIYA 4UOQA 1DJXA 3EWDA 3QYQA 2ISFA 1W9BM 4JQ2A 2CLFA 1WBHA 4Q3MA 1MQQA 3L23A 4EX4A 1O68A 3EMQA 4TX8A 4F3HA 1CYGA 3FAXA 4D6DA 3MI3A 5IBXA 3BANA 4AIOA 3EXSA 5BOOA 2I17A 4JL2A 2F61A 4NX0A 2CCRA 4NXKA 1K9EA 2OEJA 2BGNE 5XIMA 1JCNA 2F9RA 5C70A 3N6HA 3LNPA 1A0CA 1P0EA 1CLKA 3V0TA 4IX2A 4EXAA 1SZFA 2C79A 4LRSA 1HP4A 3VNJA 4YU1A 3KCOA 5KZ6A 4YN5A 4JKLA 1SZNA 4IOTA 4F0SA 4S3GA 3VIKA 5LHEA 5IRPA 1WKFA 1E1CA 1RA0A 5HNUA 4JDYA 2QR6A 5CSUA 3NG3A 4A35A 2X0SA 3C2VA 3ABRA 4N4PA 1W1B1 8XIAA 4C1NB 2CEQA 1JPMA 3WQEA 3W0KA 2WKLA 3KZSA 4C60A 1ZB5A 2AMGA 4J9JA 2WMGA 5CJNA 5A2AA 4XZLX 3FYYA 3L21A 3H7VA 3CUFA 1LQAA 1XJBA 3MBFA 3BMWA 4UBPC 2J8FA 2PC4A 5LSMA 4LUYA 3UBPC 2P8CA 2X05A 2QCNA 3UWWA 3GBEA 1KGWA 1FX6A 3PWIA 3P67A 3JS3A 4DJFC 3DC0A 1SGJA 4NKCA 1UUMA 5FAGA 1JF6A 4JN8A 1M9HA 2VD9A 1IIGA 1FWSA 3GG1A 3NA8A 3R4IA 4J5NA 5G1YA 3SIZA 2JIEA 3DX5A 3SECA 4LUIA 2BBFA 4KFOA 1GK8A 2TSYA 3O0KA 3WQ4A 4DM2A 3LZ5A 3TJ4A 1TQXA 4NZJA 4FHAA 4KPLA 1MQPA 3H7RA 1ZFJA 3HPXA 2Q01A 4QISA 3TR9A 1TV7A 1IXNA 2RJHA 3HU7A 3SRHA 3S2CA 3VABA 4RR4A 4UQBA 3B8VA 3VILA 3UJEA 2DUZA 2Y89A 4NYYA 4ZO7A 4B3ZA 2C91A 1GZJA 2W3ZA 3VGFA 2WCSA 2C71A 1R3RA 1KFEA 1RVKA 4ROQA 1QHZA 3QY6A 2ZX7A 5CGTA 4CN6A 1FKWA 3TC7A 1JYWA 1KTCA 1XC4A 4YJ5A 2GGGA 3EMZA 4U33A 4AIUA 3EMCA 3G1SA 3L65A 2YA1A 4L4PA 3GR4A 3OLDA 2WJZA 3GTIA 4U2YA 2DUAA 3LCGA 4DWSB 1ZSXA 3W53A 3PJTA 1KKOA 1E0TA 1K9TA 1EXBA 3KOWA 4CGTA 3AMLA 4BI7A 2C6QA 4MJ4A 1DQUA 4Z1CA 1XIGA 2Q3RA 2OYLA 2GSEA 3TTYA 2FYMA 1EHNA 3LOTA 1QPRA 4PTXA 4JNYA 4L9ZA 2ISDA 3CL7A 3WF1A 3Q45A 2W62A 5E0KA 4F9DA 3PY2A 3C6CA 4TVDA 3VO0A 3ZWSA 1F3TA 1N8IA 1W3KA 2XG9A 4RLIA 1TIWA 2ABBA 3N3MA 3BAYA 3BCDA 1O1ZA 1YQ2A 1LUCB 4KS0A 3FN9A 5CZKA 2VI0A 1TE1A 1ML1A 1FWFC 1MZRA 1BWVA 1MW2A 3OOQA 1YDNA 3U5UA 4H9XA 1UPMB 2RUSA 1R0MA 2YCKX 4RE4A 3WLSA 4L9YA 4S3DA 3WH9A 2YL9A 1HTIA 3EDJA 3TJLA 1OG0A 1R3VA 1EC7A 4IPIA 1JJKA 4ATDA 3KCLA 1JZ6A 1G4SA 1UWRA 2QCCA 1U33A 3KHDA 3VNZA 4DY1A 1RJQA 4DIAA 1QHOA 3TU9A 3QSRA 1IGWA 2DQXA 2ZA3A 2EAWA 4L1WA 1DJWA 3UWQA 4N42A 3DI0A 1F5ZA 3NL3A 3T6CA 4MADA 4XZHA 5MF5A 4QLJA 2ZOXA 3VMPA 5K3VA 4FLSA 3N3TA 4GZEA 2Y2WA 1EBGA 5GNZA 3URNA 3EA3A 4L4OA 1BYBA 5AC4A 4MF4A 4A29A 1LOQA 3VOJA 4DJDC 4HN4A 1W1YA 3HQ1A 1D8WA 4RDYA 3M0MA 3N4FA 3SQMA 3ANVA 3SO7A 1X97A 1VBRA 3LSBA 2G0WA 3VDAA 1OSEA 3LGEA 4Q8MA 2XJ7A 4LVDA 4XAGA 2CERA 3DZ1A 2NQ5A 3AU6A 5J04A 2P1FA 4NI3A 3F1QA 3LSCA 4B3KA 2DORA 4MB4A 5IXEA 4MUPA 3LU2A 3K5XA 2PF0A 4O15A 4ZQOA 3N19B 4GY1A 1DYSA 3QGVA 4S3FA 2FJUB 2EPKX 5LA2A 2HJPA 4AZ7A 4JTDA 4UOJA 3SCRA 1KBKA 3OO2A 4QEEA 1OF8A 1N82A 1ZBWA 2E5CA 3UEQA 1GYNA 3IJ8A 2WB5A 1HO4A 4JTCA 5GPRA 2H8XA 3W28A 1FVPA 4IG2B 2QUNA 1OWQA 4GQBA 3UR7A 4I3GA 3LPOA 4F2TA 4KWOA 1DWGM 5M3WA 2NW0A 2CBIA 1RLCL 1T96A 4BK9A 3S9YA 1BKHA 4B9YA 3UR8A 2G3JA 5F2GA 1NQ6A 2IUZA 3KLLA 3OZPA 1LYXA 3WFAA 2IQTA 5HNRA 4K68A 5DX7A 1E56A 3W1UA 1SFTA 5AVHA 3UT0A 4A3QA 2PGWA 2OR2A 4ZB2A 4C6QA 4RL3A 1DV7A 3WH5A 4A3UA 5EYWA 2QJGA 4IGHA 2INEA 1EGMA 3U48A 4GJIA 1J6PA 1JULA 3S8HA 2EPOA 2NWSA 3BOFA 4US6A 3NOYA 2G5WA 1Z48A 3BQ6A 1OX6A 2PEVA 3T0CA 4IQJA 1P43A 4IL0A 3L5MA 3BW3A 2ESCA 3KZPA 2B7PA 1WDSA 1EC9A 3KXQA 4A8IA 3UG8A 2E6FA 4LS1A 4HCDA 2O9PA 3O6DA 4C6BA 3EAUA 3H2OA 3LPGA 4E2DA 4YHEA 1XS2A 1Q7ZA 3ATYA 1FWEC 4B5UA 3M6YA 3MKVA 4WEVX 3U2CA 4J2PA 3M0ZA 4U5IA 4HPHA 4XG1A 3U7BA 4GZIA 3OTRA 2XSAA 4H7VA 3BO9A 5I3DA 3PBMA 2PBOA 2V5LA 3ZVHB 4TMBA 4OBRA 3AJ7A 3GM8A 4AB4A 3HJZA 4C6LA 3CLMA 4FI4A 4ICCX 2XSXA 5D2VA 2ZVIA 3GIPA 3TAKA 1PL9A 2HZGA 2J27A 1HKMA 4G7EB 3HG4A 2A4AA 4UZUA 3QMRA 1U83A 3H55A 2ACSA 1FUYA 4NZ5A 1ISYA 2CZ5A 3EYPA 2V3FA 2R82A 1QOXA 2PODA 1VBJA 8RUCA 3R12A 4B15A 1J9YA 4ORIA 4EAYA 3HN3A 3WQCA 1VJSA 3ATZA 3TJIA 4Z1YA 4ZOBA 1L6GA 1EA0A 5I78A 4XD5A 1UW9A 1S1RA 1Q7QA 1H1NA 4P7LA 1TZ9A 2BODX 3G5EA 1D9EA 3B8WA 3CAVA 3B06A 4DAFA 1ZPTA 3ZT6A 1EOMA 1H7RA 4ZA0A 3VM5A 1RHCA 3PUGA 4H4IA 3GTHA 1B30A 2OJPA 3GXIA 2CLIA 3VZXA 1GJWA 1UR0A 2VEGA 1UH4A 5E6ZA 2NXHA 1KM3A 4XTIA 1E6RA 4J28A 3GTFA 3SJNA 3FJ4A 4B2DA 5A6KA 3WD0A 3E6EA 1QO2A 3LXAA 4J1OA 1P4CA 3M0XA 1SO3A 4IIBA 4IMDA 2Z1SA 3GKAA 4RV8A 3S1GA 1TPVA 3UWEA 3P8IA 1MVYA 2Y7FA 1OYBA 4RXFA 4P8VA 3OVQA 4AZIA 1M41A 4GVFA 4ALDA 1QW9A 3I10A 4QDPA 3LHUA 1ZLPA 5U4NA 3A22A 2G8ZA 1FDZA 1NDYA 4XKYB 5A69A 3AROA 1KCXA 5F4XA 1PTGA 1UP0A 1LQ2A 2ATSA 3AXIA 2PDCA 4PYSA 2P10A 4AEFA 1CZ1A 4AZ5A 4PMYA 4A4AA 4EACA 1V77A 2FLIA 2JBMA 3PPFA 3GHTA 1F73A 3T78A 1AH0A 4XUYA 1UKQA 3USZA 3GSMA 1GQLA 2W4XA 3TWAA 1QAPA 2VRKA 2OT0A 5FIPA 4Z0SA 3S6OA 1H62A 1NWTA 3RF9A 4MAVA 3IGUA 3THAA 3PBUA 4H6KA 1U5VA 4LYKA 4G56A 4LBRA 3LQLA 5IBXC 1R8LA 2XN0A 2DGAA 3TTSA 1U1UA 4MOZA 4IH3A 4UB9A 4I7WA 2HNEA 1UOZA 1TCDA 1V02E 1H41A 5DCDA 1AL8A 4A8NA 2JK2A 5KEZA 3GDKA 3UZZA 4U4MA 3L0GA 1KW1A 3WYZA 1S46A 4F40A 4HZ7A 1YXYA 2VX7A 3CPRA 4QP0A 5DO8A 3G24A 3EDEA 1ME9A 5AYYA 3ZR4A 5FCZA 2XM2A 2PDWA 5AHFA 3FYPA 3H22A 5DBUA 4POCA 3W7LA 3WZ0E 2SFPA 4WQ6A 1FDYA 2ALRA 2PRMA 1PHQA 1TPB1 1IXOA 1QDSA 1E0VA 1AD4A 3S1XA 3E0LA 3WLTA 2VMFA 4Y9AA 4GJJA 1OFAA 3TWBA 1R9XA 1XLEA 3SY5A 3UCDA 4PBEA 1R9YA 3KLKA 2ZTJA 3AWNA 4MZ1A 3QPEA 3PZNA 5ABGA 1Q6DA 2ISVA 4TO8A 4YCOA 1MUCA 3W02A 1OFEA 5F4SA 1UR9A 3OP2A 4O8AA 2D1ZA 1HJVA 2YR1A 4S39A 5DY3A 3QSTA 4WY0A 3PZ9A 4UQEA 2WK2A 4JR5A 3EEZA 1AJZA 1EJXC 4O13A 1THFD 1SQ7A 2BMBA 2HISA 3APGA 3G0SA 1MWOA 1V3IA 1GZ1A 2AAAA 4DPQA 1GEQA 3IJ6A 3VIFA 5EKYA 1YHTA 2I56A 4GGBA 1E73M 1U1JA 2Y61A 1TVPA 5HWMA 1TWIA 4PUUA 3TXZA 1KA9F 2AKZA 4BQ3A 3XINA 1XIDA 3TP4A 3LM3A 3VCCA 1AVAA 4H9UA 5G4HC 3ISIX 1TA3B 4YS1A 2OLSA 4GCXA 2O9OA 4JCLA 2WVVB 4HA0A 1P48A 1NTHA 4C6FA 7A3HA 3QY7A 3KM8A 5A8PA 2Y8UA 4IICA 2ZZ1A 3GH5A 1W3LA 2UY4A 2WKJA 3ARQA 4CU8A 4RZ6A 3HFYA 3A21A 4UFLA 2CZVA 3FHAA 3KRBA 5AHEA 2WVSA 2XGZA 2WMIB 1K8CA 2VOMA 1K70A 3GC4A 4CCEA 4ECLA 3IVSA 4ZBCA 4LEFA 2AGTA 2VC9A 1W1IE 1Z6KA 4CUCA 2XH2A 4Q4MA 4M19A 5FESA 1GT8A 3LUTA 2BOFX 2Z0IA 3U0HA 3QPZA 4DI8A 1ZJIA 3PZQA 4DBSA 2XWDA 3P61A 3AXHA 4HU4A 3DFSA 4TV6A 3GZ3A 3HGSA 1SJBA 3NXLA 8TIMA 3QZ6A 4XB3A 3EKLA 3BLEA 2Z1BA 2BV9A 1V03A 3VDGA 3G1RA 1CTNA 2ZZ2A 3W38A 3APYA 1V08A 2GUYA 2ZDRA 4JTHA 2E4TA 3WQPA 1R6WA 1ZAIA 3LCIA 2DQWA 5DXYA 4QTGA 4CEUC 1REQB 5K9DA 3MUCA 2Z25A 4B2DD 3QGKC 2OXNA 2EJAA 1PX8A 4NUWA 4A05A 4ADUA 3L4TA 1YBQB 4HJWA 1TVNA 4X0VA 1VQTA 3WKZA 2YW3A 4MJMA 4S1FA 3GC5A 2PGEA 1GG0A 1HW6A 1S2WA 4H1ZA 5T8GA 3V5CA 4J40A 3KBNA 4UTIA 3EEGA 1SUXA 1MNZA 1UA7A 2OG9A 3M16A 3GH7A 2Y62A 3G1FA 1VC4A 2REQA 3E5BA 1W1VA 3H2CA 5FKYA 4DELA 3GZAA 2C8NA 4ADTA 3E49A 3A3HA 3WBEA 1UR2A 4G2DA 1ZHAA 1KQZA 3DOPA 4H8VA 3VIMA 3L4XA 2VDHA 5TD4A 3THUA 3QV9A 4AD1A 1VFHA 5G2IA 3W83A 1QHPA 1CXHA 2D69A 3BGAA 4MM1A 1YYAA 3M0IA 2VFFA 1QK0A 1EEXA 4IMCA 1WZKA 4W7VA 2QIIA 2QJJA 1FWHC 1SW3A 1CLVA 2VZOA 1Y8BA 4I7UA 2PWUA 1ZJBA 1OCJA 1LOLA 2VWTA 5T9BG 3SN1A 4V33A 2CETA 4O1FA 3LHTA 1DIEA 3CHFA 2C14A 1EWEA 3VNLA 3WUFA 3DFYA 1DXEA 4WUIA 2XSBA 1MI3A 5AHLA 3TNOA 3LGGA 2Z7KA 3CEPA 4TUFA 4GISA 5H8PA 2C1IA 4PCPA 4OBSA 1FXQA 4JIHA 4F2BA 3UXKA 5SWUA 1KFLA 3U57A 4NAFB 2DVXA 4HMEA 4YWIA 3SN0A 2DT0A 2FVLA 4H6EA 4AHPA 5C2GA 4RNFA 1E6ZA 5HINA 1OC5A 1KD0A 4LS2A 3VGBA 4ACZB 1FWJC 4XD3A 1JDDA 1W1ZA 3DC8A 3ME3A 1V0NA 1VEMA 1H61A 1Q63A 4U5KA 3GDLA 2E6AA 2QPXA 1EQCA 4MIMA 4XIMA 2WNNA 5LHFA 3W1LA 3TH6A 5BMXA 4PB5A 1Q6OA 4P7OA 4W85A 2V6AA 3H4XA 2RDUA 1KR0A 2VEMA 1RUSA 3REQA 5FI8A 1X7FA 1MW1A 1CENA 4N7QA 3QZAA 1XL9A 3UNTA 4NNCA 4C7DA 2WQDA 4W89A 8A3HA 4NASA 4E8DA 1VD6A 3INPA 2QUMA 4L9XA 2PDYA 5IFPA 3EX2A 2X16A 4PC8A 2ONEA 3L2IA 1ODZA 3UPMA 3FDGA 1JZ8A 4CKQA 1D7FA 1G1YA 4O1CA 1X6NA 5LNRA 3I3BA 2FGBA 4JX6A 3AYVA 5LIWX 2YDRA 3POHA 2MANA 1O5XA 4DWDA 3UYIA 2PDHA 4P61A 3U6WA 5KITA 3ZJ8A 2DJLA 3V16A 3BUVA 1EQPA 2YCJA 2HTMA 3U2EA 4JKKA 4IUOA 3VKDA 1ZP3A 3E12A 1UC5A 2ZUNA 3K2GA 4XZBA 4NAEB 4UFKA 4QE5A 1P1MA 4XBJA 3IV8A 5M5DA 4UFHA 3BMVA 2VEKA 2ZRWA 1P7TA 5JVLA 3T9PA 1DIKA 3KBWA 1TV5A 3IS4A 5G4EA 2GJNA 4J3WA 3SJ3A 5A95A 1OHLA 1ITUA 1P1XA 3MC5A 1A5UA 1RPKA 1W3NA 1JD9A 4AHQA 3ZIZA 4Y8FA 1CEOA 4PUEA 1PSCA 2J7CA 4KFNA 3IANA 2A1YA 2EG7A 3B0PA 4DZHA 4YVVA 1YPIA 5I23A 1XKYA 2HROA 1CCWB 4JNZA 4IISA 5H8UA 5CZ0A 2W66A 3SUUA 4W7UA 4CD6A 1LRTA 3BDKA 1XM3A 4LALA 3W2LA 1PEZA 1NOFA 1KFBA 3BARA 4S2BA 3SEPA 5BOEA 4V15A 5TBOA 3FDKA 4UFMA 3CC1A 2P88A 4MHBA 1OADA 4WVXA 1WCGA 3WNOA 4CD5A 2PP3A 3H53A 5FEWA 2J4GA 4CD7A 3F4VA 1IT7A 2FVKA 2HEJA 4JHOA 2PSNA 1YE6A 1LM1A 4C6CA 3R0UA 1K9DA 3NEVA 3TN4A 2VDGA 1JZ7A 2QCEA 2XHYA 4B3LA 1ZUAX 3QMSA 2ZWZA 3MUXA 3UY8A 3WN6A 4QJ4B 3DU0A 2MNRA 1WBJA 5HPOA 3IAPA 3VGEA 1G9HA 4JTUA 2E3ZA 2V3DA 1JIBA 1K7XA 2VOTA 2Z29A 1TPUA 2BVWA 4W8BA 3AS1A 5IM51 3WQDA 1EO7A 1QI4A 1W9UA 2V2HA 1LWIA 4PMRA 3VX0A 1KC7A 1BSIA 2BZNA 3L0KA 1Q8JA 4HNUA 2OEMA 4MFEA 2XIQA 1K3UA 1HGYA 4XAYA 3W70A 1OFDA 4AYGA 1H7XA 3P0WA 1DQWA 4XK2A 2G3MA 3FA3A 1EGZA 2GUUA 2O4MA 3AZSA 1HN1A 4QG9A 2O4QA 2Y24A 3WENA 3GDTA 3AIBA 4UTJA 1JPDX 3W1MA 2BXVA 1Y5WA 3GDBA 4D6HA 1UHVA 3WF2A 4XAPA 2ZUSA 2HV5A 1ENUA 2CW6A 2GL5A 2YB4A 1XKJA 3VUPA 1KM0A 3IV3A 2J8GA 1LBMA 1GVOA 3O2LA 2YCLB 1L2QA 1J0KA 3K30A 5FJPA 3F7JA 2Z2AA 3T4WA 3E3HA 2VZTA 1W5QA 1B31A 2WZMA 3ZFHA 4KWUA 1WNOA 4AX7A 3UZWA 3IJ9A 1N7KA 1V0MA 2F84A 1AQFA 1MUWA 5EFDA 4LVFA 3BSGA 5I3HA 1TUFA 1PX4A 3E2RA 1XP3A 4GQ0A 2PRHA 4B5WA 5H1WA 1K4GA 1AA1B 2VGIA 4Q4PA 6XIAA 3IIXA 4O57A 3ALFA 4PL1A 1MXSA 2V5JA 3BZGA 4C1KA 2PCEA 1R3YA 1TRIA 3UVAA 1HL9A 3GIQA 1UUQA 4JTAA 4GFIA 3SGUA 1FWNA 4JN7A 3LBMA 3POCA 4ADSA 3GNNA 5CG0A 2D2OA 3UP8A 9CGTA 5IOBA 4S38A 3U9IA 1J01A 3VA8A 3G22A 1JI2A 1S3HA 3KBMA 2QJHA 3GU9A 3GNRA 1TWSA 2QKFA 4UZSA 4CNUA 4BA0A 3VXGA 1A0DA 1M03A 4JPGA 1PKYA 3W26A 4E8GA 4IX0A 3TCSA 4QAIA 4LUSB 2XISA 4AMAA 2GDUA 2NUWA 2PDLA 2X8RA 3TV8A 1EHAA 1NWSA 2PTYA 1J8VA 4X3ZA 1UCWA 4ORMA 1DQXA 1HKWA 2A3AA 4DF0A 4HK5A 2A3EA 3URQA 3KS6A 4AU0A 1NOWA 4UQAA 5G4WA 3ITTA 2P50A 4HTYA 5CC6A 5E1QA 3AZTA 3THQA 3LM7A 3FVMA 3UFYA 3CL6A 1A4MA 1A5BA 1G67A 1LZOA 3MKKA 2JEQA 3C0LA 3WEOA 5LXXA 1L6SA 1FFRA 2VUYA 3TN5A 2HVOA 1AW5A 2R1LA 3TYEA 1PYMA 5A6MA 4E4PA 4O19A 4FSAA 3S9ZA 1UWSA 1FRBA 3LCWA 3EA2A 3GHRA 1P0NA 4BJHA 2FKPA 4QDWA 3NFUA 3WNPA 5BOFA 3KOFA 1VEOA 3CV7A 3JW7A 3PPHA 4DPPA 3T07A 4UTKA 2YBVA 4LNCA 4OQVA 3EZ4A 1AQHA 1VENA 3QVQA 3HFTA 1IXPA 2I7GA 4LAKA 1LP6A 3LRLA 3GXPA 5ABFB 3ABOA 4F2UA 2WSPA 3BV7A 2BGSA 4FA3A 5AC6A 3H6OA 2FZDA 3E2QA 3ANUA 2Q09A 2QDHA 3GVWA 4BKNA 1E43A 1MFVA 2QCDA 4HBKA 4IJCA 4J7RA 3IEBA 5I3KA 1AK5A 3WJXA 1NVMA 4HGXA 4MDOA 4TIMA 3OIXA 3PB2A 3E0WA 1ICSA 1V5XA 4K2SA 1E3XA 3B4YA 3MY9A 1NSJA 1DTUA 2PWFA 4PRRA 1TYGA 3LD5A 1EYWA 3SW6A 3MO4A 3OHMB 3VPLA 4N4QA 1WXYA 2GOKA 2A7NA 3TVAA 4C1NA 1QCWA 4Y9MA 3WMBA 1VH7A 2ZRXA 5EU9A 1XSIA 2GJLA 4IIEA 4LU0A 3P6LA 3WDIA 1W3IA 2I5IA 5C7VA 1GNXA 3O0FA 5D05A 1WP6A 2ATMA 1KFJA 3A13A 3V18A 1X6UA 2GFTA 4S3AA 1LDCA 4UTHA 1CI1A 3LTYA 2HBVA 4S3JA 2E7FA 4GGHA 2B0MA 3B8TA 2BHZA 1PKLA 1OFBA 3BK0A 1MXDA 3FJLA 3LGDA 3P7YA 3RX4A 4QNEA 3AOFA 3STEA 5AFDA 2O9TA 3BV4A 3N11A 1AJ0A 4HT3A 3NJ3A 1ESWA 3QN3A 1U1HA 2PC8A 2BY2A 4QG6A 3U2OA 1GGOA 3VTRA 2VT0A 4ZQMA 4QNWA 2AL2B 2QCLA 4ZSTA 1WO2A 5D9NA 4CQ8A 4DO5A 1UP3A 2OODA 3FSUA 3HURA 1C90A 3LDVA 2XIJA 4Q8QA 3TTEA 3NQBA 3P80A 3GW0A 3VKKA 3P5YA 5KMYA 1H49A 2I16A 4XAZA 5DRCA 3N6JA 2NX1A 5ECVA 2RHGA 2DH2A 1NY1A 3QF0A 3O3RA 5IHRA 2QGYA 4C65A 3GXDA 4LV4A 2EKGA 5LNVA 1RV8A 5EGRA 3NNTA 4FF5A 2BHUA 5D9MA 2DSVA 3ES7A 5LKYA 5DCBA 5U7SA 1V6WA 4Q32A 3UJ2A 4J2MA 4QS5A 5D8WA 2QDDA 4S3BA 5I3IA 2HNHA 4FB7A 2E8ZA 3WNKA 4KIEA 2GDVA 1OFQA 5A1AA 4JN6A 1SR9A 3PUOA 1C8QA 4WLCA 3PJWA 3ARUA 1I1WA 1KRBC 3IVUA 1F3EA 5JH1A 5CPOA 4WOZA 3WLQA 4DBEA 3YPIA 3GRIA 5I6SA 1LUCA 1X6LA 3KTXA 5EMUA 1W5NA 3UXLA 3WBWA 2QT3A 1PIFA 4OGZA 2OYKA 1C7TA 4M80A 1GOMA 3EB4A 2J7BA 1NEYA 2BVDA 1RSCA 3RCYA 3W7OA 2Y88A 1T8QA 3PR2A 3O6CA 1LTDA 3MP3A 3WFZA 4JTLA 1UBPC 3HB9A 1EKOA 4LYRA 2ZICA 1AZ2A 2FTYA 5CPNA 3RM4A 3RX2A 3GHSA 2GJXA 3HZ3A 5C9ZA 3EB3A 3MJMA 4BHYA 4EKJA 1OYCA 2L5HA 3WCZA 1MQRA 1JR1A 1W0MA 4O4WA 1BSLA 2E1WA 3TMQA 2WHMA 1HKJA 1MO0A 2VEIA 3WD3A 4QHRA 4U3AA 2PLJA 4DN1A 2QUTA 1BD0A 1T99A 5E5CA 4QLLA 3SCVA 2YPIA 4CQ9A 4JGDA 2PDMA 3GXNA 4TXEA 2PGRA 3NO1A 4LCSA 1SZRA 4OHQA 3IUDA 3EWBX 1UOKA 5A3HA 3UETA 3BICA 3MSRA 3KVMA 1DJGA 1ZBVA 2PTDA 2C18A 2ACRA 1E9IA 1GZGA 5CC7A 1HL8A 2WCGA 1P0KA 4XO6A 1KWKA 2KAUC 5AC7A 3LERA 3K4WA 2FQIA 2QEZA 1XXXA 3T42A 7TAAA 4AVOA 1SVDA 1WKDA 2PWVA 4NYUA 1QWKA 1DXFA 3UVIA 3UPWA 3BOXA 3OGRA 3DEQA 2OELA 1IEVA 3WELA 3RCNA 4JNMA 2WHJA 3SBFA 3E1F1 5K4ZA 3SRDA 1TV8A 4KFPA 3WLMA 1CT5A 3W29A 3CMFA 2ZUUA 3EKGA 5DMLA 2DZBA 2OOGA 2JQXA 1S2UA 3ELFA 1OINA 4ZGYA 1OB0A 2EPHA 3H8AA 3NPWA 4XVEA 3VGDA 5DLCA 3M64A 3M7WA 2Y70A 3P0XA 4P7QA 2PS2A 4NZ1A 2PCQA 3T44A 2VFDA 5BRBA 2VELA 1J0IA 3RN6A 1M7JA 4W8LA 4NT0A 4IG2A 2WAGA 9RUBA 1M65A 4XAFA 2WBKA 1SO4A 4WY0F 2J7EA 2A7PA 1DJYA 2Q8XA 2E9BA 1DE5A 3UWZA 4H9VA 1XHGA 2I57A 1MMFA 2DT2A 2GOUA 3I7SA 1AD1A 4MPKA 5BZAA 4GABA 2DJXA 4FR1A 1RJRA 4GIRA 4O8RA 2NVAA 1R47A 3CZJA 1GPFA 4I7VA 5AYIA 4EP8C 1EB3A 4UIOA 5LZLA 4ZOCA 1B3YA 1DOSA 1XG3A 3NO5A 1YNPA 3B8SA 4Y2WA 2PDFA 1I2OA 3Q4DA 2J7DA 5E0CA 3R58A 1A5LC 2A79A 3NSNA 3I7RA 4F0RA 3AU2A 1YIXA 2IW0A 4TU1A 3N4AA 2C1GA 4IWWA 4A3HA 4R34A 1XRTA 2HPIA 3M07A 2PMQA 1BFNA 5D9OA 4D6CA 2HPMA 1SO6A 2GPTA 3QQWA 3Q94A 1G4TA 4JTEA 1PX3A 3OA5A 4KEZA 4U31A 2VGBA 4ZO8A 1TPWA 3E0IA 3MJYA 1TR9A 4IFRA 3OG2A 1S1PA 2ABAA 5BCAA 3AI0A 1G5AA 1KR1A 4D9PA 4BFAA 3T8LA 2HXTA 1HJQA 5D2YA 4ENLA 6A3HA 3FSTA 4LQ1A 3ABQA 2Y8VA 3N73A 1KGXA 4BI5A 2TODA 2CLLA 3VNKA 1O1HA 3QPYA 3IACA 5H2ZA 1C8XA 1KBJA 2FHBA 1UWAA 1POJA 4M7SA 2PTWA 1UG6A 3LMZA 2Q6ZA 2RFGA 2BP1A 5LXEA 2V9DA 3EOSA 3SDOA 2VL4A 3WUBA 3H2EA 3OEXA 5D04C 4CQBA 5DRIA 1OABA 3CWHA 3EX6A 3AYTA 4M3PA 3ZVHA 1WXJA 4LBSA 3VC5A 4DF2A 1JZ3A 1PE1A 3NURA 2QPSA 1IV8A 2UY3A 3JZEA 4O12A 2IPGA 1JI1A 5HWJA 4EXQA 3SSZA 2DIEA 5F4WA 3N25A 5BXTA 4KGLA 1XLCA 1A50A 3UG5A 3UPBA 3WJYA 2Z1XA 4G7EA 3TYCA 5CJ5A 1K7EA 3I4EA 3OQ8A 2G97A 3F2BA 3TCEA 1AW1A 2NXGA 3RLVA 2WNQA 3CHEA 1O5QA 4M51A 2Y1HA 3NZPA 3AYRA 3P82A 3IGSA 4BEUA 2CZEA 4PMXA 4Z2HA 2CNCA 4GI6A 1E9ZB 3GVQA 3R10A 3NL5A 4Y9NA 3V4BA 1VEPA 3C2RA 3KOYA 5LA0A 3PG8A 3MTWA 5DBTA 3QC0A 1BVZA 1VCVA 1R3SA 1OX4B 1XLFA 4D6EA 1HVQA 3OGSA 3PWAA 1WV2A 2GVEA 2NX3A 2V81A 2WSQA 3LV5A 5G5IA 4O0ZA 4RDVA 3W6LA 2CZDA 4FLQA 1W56A 3NPXA 2P5NA 3P62A 3C8FA 1W2PA 3AIUA 1WKYA 1FCQA 2O92A 1GKPA 4Z2GA 3BE7A 3KRSA 4PODA 3ZS4A 4WDUA 1K4HA 4WX2A 4REQB 4P5UA 3KP1A 2A0NA 2X41A 3R94A 4FP1A 3ZM8A 2A2IA 1QI0A 3W1NA 1O95A 3T81A 3RRXA 4TTGA 4GINA 1JZ2A 2X1RA 2YA2A 3I6RA 3KVKA 3NDZA 4B5SA 1UMLA 3CT7A 2VNCA 1UR4A 4LVGA 1HJXA