2X30A

Crystal structure of the r139n mutant of a bifunctional enzyme pria
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
240
structure length
233
Chain Sequence
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGNGWTRDGGDLYETLDRLNKEGCARYVVTDIAPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title Identification and Analysis of Residues Contained on Beta --> Alpha Loops of the Dual-Substrate (Betaalpha)(8) Phosphoribosyl Isomerase a (Pria) Specific for its Phosphoribosyl Anthranilate Isomerase Activity.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Isomerase
total genus 83
structure length 233
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2x30A00
5G1YA 2CLKA 3DI1A 2YX0A 2HMCA 3QQ0A 4WY0A 3TUUA 2YR1A 3RLVA 2F84A 4XWUA 3R12A 4AVFA 4A3UA 4XTDA 1OYAA 1SR9A 3W2MA 2G95A 1JR1A 1AK5A 3UNDA 3RLUA 4JX4A 3W7QA 1JCXA 1H7RA 1XDMA 3M9YA 1GZGA 5CG7A 3F4NA 3C8FA 1T0OA 2R8WA 3BK0A 2NUXA 3P80A 1XDLA 3G1XA 1KFCA 1M5WA 2ZZ3A 4JTTA 3LHVA 1LLWA 2FQIA 4JTSA 4M5PA 2Y7DA 3EX3A 2VEKA 2I9EA 2ZZ4A 3MYPA 2NUWA 4MYAA 5FI8A 1QMLA 4Y90A 2DZTA 3ELFA 4IOTA 3N2XA 4AAJA 3TAOA 3RU6A 2KZHA 3P74A 4I7WA 4UFIA 3GLCA 4IXXA 2OJPA 4O53A 1B57A 4IWWA 1OX5A 4NJKA 1XBXA 3S6DA 3PULA 1XXXA 1Q6LA 1SO3A 4LOCA 4O15A 4UR7A 3G1VA 1DJQA 2D73A 3LM7A 1R47A 3E49A 5AHIA 2NWRA 2YPIA 5LZLA 3CIWA 3MI2A 5CZJA 3KRSA 1P0KA 2VEIA 1U83A 5FEPA 2FJKA 4IX0A 3DHFA 2DZXA 4O8RA 3LCLA 3ZR4A 5BW6A 3TW6A 1LZOA 1KFLA 1LRNA 2B4GA 3HPSA 3NVTA 3C56A 3OVRA 5AC8A 1FCQA 3IVUA 4HIBA 4AF0A 1H7OA 1OFPA 3W76A 3Q58A 1VRDA 3NZRA 3NXFA 3GXNA 5KZDA 2QUVA 3KHJA 1LBFA 1FCVA 1OK4A 1Q6QA 1KM4A 1MEIA 2CLEA 2V8ZA 4PL2A 3ZWSA 3HGSA 5CZ0A 2B7OA 3P60A 1W8SA 5A8GA 4BI5A 4DF0A 4O4VA 4Z1AA 3PG8A 3LCHA 3TQVA 3W1AA 4N2YA 1TYGA 2B7QA 1K03A 2VENA 4UTJA 3A9IA 4N9BA 4W9TA 2VFHA 2FIQA 2VOMA 3IIXA 1VCFA 1Q45A 1L2UA 1WOAA 3SI9A 4QAIA 3CIXA 3LXBA 3DFPA 2C16A 3WJWA 3TW7A 3EEGA 5GVJA 1S5TA 5LSMA 2CLOA 4ML9A 4LWWA 5K4XA 3SY5A 3BO9A 1EPXA 1PS9A 4RKAA 3G1FA 1QO5A 4E0CA 4AHPA 2X16A 3TC6A 3TX9A 1OFQA 2Q8LA 2EPHA 3PSWA 1C9DA 4JGDA 1SW3A 3HJZA 4GC4A 3K30A 5HUOA 5IBXA 3W71A 3TU9A 1DQWA 3UWWA 1WYIA 1ALDA 5I3IA 1KFBA 1O4UA 4BF9A 2WSQA 2A85A 1LLZA 3EX4A 3T40A 4O0KA 3O05A 2QDHA 3NPUA 4DPPA 4DBEA 5CSRA 1KFEA 1GVOA 3DFQA 2RKXA 1I8JA 1NSJA 3TAKA 4K8HA 4O50A 2CFFA 2NX9A 2OCZA 1ZENA 4UMBA 1VQTA 1DORA 3BLFA 4LW7A 1A53A 4K7YA 1PV8A 4MPQA 4QNEA 1DKWA 2ISVA 4MFEA 4A21A 2AGKA 3W7KA 1GG1A 1Z41A 4LVFA 1R30A 2GVLA 1LROA 1PIIA 3C3NA 3HOJA 4JX5A 2ZA1A 2ALDA 4IMEA 1WDWA 3LV6A 3PWAA 3W1RA 1ICSA 1JQVA 3F4WA 1IIGA 2WSRA 4HPXA 2E6FA 4PH6A 3PSVA 2FB2A 1YXDA 3SJ3A 3LHYA 3R13A 1FQ0A 4FIRA 3JRKA 5G4EA 4UTKA 5D37A 1JCLA 2QJGA 2Q8ZA 4Y96A 1XBYA 2FFCA 1WA3A 2BX7A 4BWLA 2E1DA 4TU1A 3GR8A 1VLWA 1Q3NA 1K7XA 2QAFA 3FYPA 4I7UA 3HO8A 2QF7A 4ADSA 3HGJA 3NQFA 4UIOA 4M7TA 2J9ZA 3NO5A 4WY0F 2NXHA 5H91A 4NXSA 4O57A 1KM0A 2WPBA 2A5HA 3EKZA 3G1SA 3CEPA 4WZHA 3R5EA 3YPIA 1SZNA 1JUBA 3MHGA 4YLWA 1WBJA 1EA0A 4NJJA 1OFRA 3SFKA 1B9BA 2CZ5A 3LDVA 4UFKA 5HNRA 3DFSA 2AQWA 4UTWC 3PB0A 3OIXA 1W1ZA 3G3MA 4WX2A 1OABA 3W7HA 3PM6A 1W37A 2J9XA 4GWEA 4M6QA 1TPVA 2QCDB 1KBIA 1FUYA 3LRLA 1XBZA 5AYZA 3UYCA 1HG3A 4Z08A 3N9RA 4MIMA 1GVQA 3CHVA 3H55A 1OF8A 3CC1A 3W1PA 2NLIA 4HHPA 3GR7A 2A1YA 2DZWA 1W3IA 3S8HA 4IGHA 2FLIA 2P10A 3P5ZA 2YZRA 4R53A 1EWEA 5MHBA 3LCGA 3NQVA 3FJ6A 2QEZA 3VI2A 4UTMA 4XBKA 4GBUA 3QSTA 1W31A 4LC6A 3S5YA 2Y85A 4Z1CA 4UMCA 5J5DA 1HL2A 3L5AA 2Y7GA 3QW3A 1N55A 4JTIA 1LOSA 4WJEA 3LB0A 2YDAA 1SPQA 4UTIA 1KM3A 3C0JA 5DLCA 4ZQOA 3LTSA 3STCA 4AEOA 3I68A 1JVNA 5C55A 3G8RA 3BGGA 5D2VA 1LBLA 1FWSA 4UR8A 5DXYA 1DHPA 4UTUA 2ZTKA 1XM3A 5FEWA 2JBMA 4GE8A 1H61A 3NAVA 1IXNA 1P5BA 5K7JA 3B04A 4MKNA 5DXXA 1J4EA 3L68A 3O63A 1H63A 1P1XA 1QO2A 2BXVA 3TQKA 5HQEA 3HIJA 3TC7A 2WNQA 2W6RA 1X6UA 3I6RA 4HNVA 4RXGA 5AC6A 1TIMA 4ZQPA 1V7YA 1TV7A 2FB3A 3M1ZA 3SZ8A 3BLIA 2BZNA 3OG3A 3DXIA 2NUYA 2TPSA 3W86A 1DVJA 4JICA 1FWTA 3WK2A 3NQMA 3DBPA 1MSSA 4O28A 1F2JA 4LU0A 4PC8A 4A2SA 1EB3A 2V81A 3U6WA 3GAYA 3MHUA 3LI0A 2ZA3A 4UXDA 1TV8A 2CZDA 3N9SA 2Q3OA 3QEZA 1EUNA 3W7LA 1DV7A 3NM1A 1LTDA 1W3NA 1FWWA 3W1MA 2ABBA 2VEMA 5D04C 1KV5A 1LYXA 3MO7A 2W79A 3DH7A 4Z0JA 3ZFHA 4O19A 4GUIA 5C5YA 1RR2A 5AHFA 2I1OA 2ZFAA 1DQXA 4ICNA 2QCLA 3NQ7A 3C2RA 3M6YA 3WFAA 4TX9A 3M5YA 3KVMA 4OWGA 2QCMA 2G96A 3CWOX 1AG1O 4ZZ9A 5T26A 2QAPA 5DELA 4CLMA 3S5NA 1SUXA 1WXJA 3TKFA 3UPBA 1GJPA 3EWWA 4N6EA 2ZBTA 1OFEA 3NOEA 4JS3A 4MUZA 3N73A 1O94A 5EL1A 2QCHA 3M5VA 1AL8A 4RZ5A 4Y6GA 1SO5A 4EF9A 3HG3A 4D2JA 2A4AA 2ZCGA 4O1CA 2DJLA 3L66A 5EA9A 1LORA 1TPC1 5E0KA 4ADUA 3Q94A 3TA6A 3UXAA 1OFDA 1Q6OA 3NEVA 3WK0A 3NPVA 3A24A 3TK7A 1VS1A 1RQHA 1W56A 4FF7A 2QCCA 3BPWA 1ZHAA 4O13A 3QH2A 3TE9A 3LX9A 1A5SA 1NVMA 4NZJA 3QMSA 1BWLA 2V30A 1YTEA 1LOLA 2DZSA 4BR1A 2HS6A 5TIMA 1R2RA 1OK6A 2I14A 3KAOA 4RCXA 5DY2A 4NJIA 4QQ3A 3KRUA 1P0NA 3QSRA 4RZ6A 4UNLA 3LV5A 3NQ2A 5CPMA 2G97A 1O5XA 1QR7A 4JY8A 1TO3A 3BW4A 4UUIA 3CB8A 4UFJA 4ORIA 1F7BA 4IMGA 5U7SA 1FDYA 2GPTA 3W85A 4NX0A 5CSSA 3R89A 3B8DA 1G4PA 2NXIA 1AW2A 3QPYA 1Z42A 3SSJA 4KFOA 1VR6A 3LI1A 3IRDA 2CW6A 3JS3A 4K36A 4H4IA 4UMAA 1BEUA 1VJIA 5CPLA 1O5KA 2NX3A 3ABOA 3WJSA 3N3MA 3EX2A 2JKPA 5DN1A 2JKAA 2X1TA 4OV4A 3W7NA 5LNVA 5LHFA 3L0KA 3HF3A 3IV3A 4CCEA 3MI6A 3DFNA 5EYWA 4L4MA 3STFA 3BW3A 3G24A 1QWGA 4AXKA 1JULA 3G0SA 3Q37A 4NUWA 4GUHA 4YMZA 5IM51 5FF2A 1I2RA 1KFKA 3W84A 4B5NA 3W7JA 4PFMA 3DGRA 4LV4A 1EP1A 3FLUA 1H50A 3HGRA 1K8YA 4G1KA 3LLDA 1SSDA 5HJLA 3G18A 3KFTA 5J5RA 1B4KA 5D03A 4UTTA 4A2RA 4JTUA 1CI1A 4K8EA 3L65A 3M5XA 4O12A 1PCWA 1YLVA 3NQ8A 2VFEA 4FNTA 1NEYA 1XC4A 4JIPA 1H7PA 1KTNA 4LVGA 1QPOA 1BWKA 3AJXA 2QCFA 5C2XA 4E2BA 1K7EA 2EF9A 3H54A 4K7VA 4NU7A 5F4XA 4QIUA 2PURA 3MI3A 4NT0A 1R2TA 3OA3A 1F6PA 1ZALA 2A6LA 2P0OA 4HT3A 3SW6A 1A50A 5TQLA 2OT1A 3IVSA 4ZQCA 4YL2A 4EWND 4X2RA 2O7QA 1RZMA 4N9DA 2RDTA 2VKZG 5LHEA 4WUIA 2ZRXA 4LY8A 1VC4A 4DBDA 3W23A 4MY8A 4FNSA 5K9DA 3M7WA 2ISSA 2VFIA 4BI6A 3EKLA 4WOQA 4HPJA 3QW4B 4AWSA 2P1FA 1TQXA 3PY2A 3GDLA 3GKFA 1BTMA 3STGA 3P8IA 3IEBA 3PBYA 1L6WA 5F4SA 2DP3A 3GK0A 3NQAA 4JY9A 2H90A 3VNDA 1S3HA 1SO6A 1PHQA 1OX4B 4FHAA 4DEFA 1NAL1 3PUDA 4MZ8A 4E38A 5HWJA 3LBMA 3NL5A 2A21A 1PE1A 2H8XA 3INPA 3IVTA 4LS0A 2IQTA 3B03A 4IMDA 4JNMA 4WOZA 2PC4A 3W2LA 3FOKA 3LGEA 1L9WA 3W7EA 1KM2A 1HO1A 2QCDA 4LS1A 1DJNA 3P67A 1I45A 5EKYA 4YWIA 4CQAA 2JGQA 3MHFA 1IF2A 1OVDA 3EB2A 1C8VA 4CNPA 4ZMGA 3QRHA 4O1DA 4Z1DA 1ADOA 1V5XA 2W0UA 4JYEA 2QJHA 4QITA 2YGYA 3MMTA 4AMAA 5D09A 3MP3A 3CPRA 4ZL1A 1ME9A 1F73A 4RXFA 1F74A 2UV8G 5LGXA 3S1XA 4U28A 1G4SA 2HTMA 2GJNA 4LUJA 3TXVA 3GYEA 3HQ1A 1B3OA 2BSLA 3O15A 3QFEA 4HNUA 4Q4KA 5D05A 4FX7A 4S1FA 2V82A 4LVDA 5FF7A 1QPRA 1P4CA 3BGJA 5L6UA 1GVSA 3AO0A 3GVGA 4RLIA 5D2TA 1XKYA 4IPJA 1SU5A 4RJEA 3OBKA 3G1YA 2Q3RA 2ZRVA 1XUZA 2E5BA 1YDOA 5D2YA 2X1RA 2GQAA 1ZAIA 3EWUA 4IUOA 4HSNA 1R46A 3W6YA 2GJLA 5AB3A 5HMSA 1SZGA 4N02A 3TIMA 1TSIA 1KTCA 4GJ1A 2XN2A 5U4NA 4IMCA 3WJYA 1DL3A 4FEZA 1RQBA 1ZJIA 2A6NA 5BOOA 3S1UA 4R34A 3QJAA 5I3FA 3OEXA 3TV8A 1TPFA 5I3HA 2X1UA 1Q6RA 5I3JA 1G69A 1J5TA 1VYPX 2ATMA 4S2BA 1TTJA 1ZAJA 1YPFA 2J6XA 1IXPA 2NX1A 3LERA 4JX6A 5SWUA 1EP3A 2ZRUA 4FO4A 4N6FA 3U8GA 3TDFA 5K3VA 8TIMA 6ALDA 3HGOA 3ATYA 3DZ1A 2TYSA 3DU0A 1UB3A 3T4CA 3W1UA 3PR2A 4WXZA 2ZRYA 3MBDA 4XBSA 4M7SA 4UTLA 4DXVA 3M41A 4HNNA 4O18A 4RX0A 1ME8A 3KRZA 4DPQA 4OT7A 5LNUA 2ZDRA 4AWTA 1OX6A 5F1UA 3SR7A 2ISWA 2YW3A 5KMYA 1W5QA 3FIGA 3TFCA 3MBFA 2VFDA 1DBTA 4NNAA 2Y7FA 2QUUA 2DZUA 3G3DA 3M0ZA 3E9AA 3UD6A 3I7SA 5G4WA 3W74A 4AH7A 4MJZA 3W75A 3ZWTA 1YADA 3ABQA 2V0TA 4GUJA 2QKFA 2WNZA 4GUFA 3U2OA 3UZJA 1ONRA 5FEZA 1GYNA 1I2NA 1ZCOA 2QJIA 1A5AA 1M7PA 1KLYA 5HWMA 3OVQA 4FB7A 4FNQA 3UWQA 3T78A 4O11A 2ZZ1A 3S42A 2J24A 3IIVA 4MZYA 4BI7A 3H53A 3GXPA 1WOBA 3LCWA 1RVGA 2E5CA 1UCWA 1W5MA 3NPWA 5F2IA 4KWVA 4R7JA 1A5BA 2H8ZA 5D30A 4OGZA 2RH9A 3L0NA 4K6AA 3NPXA 1I2OA 1KM1A 3O8AA 5IBXC 5G5IA 4Y8FA 1KM5A 2ATSA 4FNRA 4IPIA 3B06A 1FBAA 2X1SA 1GYLA 2YSWA 2V5LA 4CNNA 4UFMA 4OE7A 5LNSA 3HG4A 1QPQA 3G8EA 2C14A 3CQ0A 3L5LA 5KSWA 4EVZA 3BW2A 3GKAA 3O1NA 1GEQA 3L2IA 4GNJA 3GDRA 2G5WA 3GDTA 2GOUA 4O52A 5AYYA 1W54A 4CQ8A 3C6CA 3LLFA 4NJHA 4Z1BA 3EX6A 1FDJA 1K8XA 5FESA 4XKYB 1TMHA 4ZQMA 3EWYA 4O14A 3NQ6A 5KZEA 2V2HA 3FJLA 1XI3A 4JTHA 1L6YA 3UXDA 3EWBX 4FNUA 1XCFA 2NZLA 1ZNNA 4MZ1A 2CLFA 1EWDA 2PE4A 4LNYA 1SW0A 3VE7A 1QNVA 2TSYA 3UWUA 4NNBA 2E6AA 1SZFA 4EIVA 4LUIA 2V2CA 2WQPA 3F1QA 3N2MA 1GTHA 4PEKA 3QMTA 3TQ0A 2GVGA 1NFBA 3RK8A 3D0CA 3W2NA 4MJMA 3PBVA 1MO0A 4TR9A 4UC5A 2VC6A 3S5OA 2YXGA 1G6CA 4OHQA 3W70A 5AHLA 2XFWA 1GT8A 3KVLA 3LHZA 2E77A 1GOXA 3NYZA 4JTGA 4N9EA 3W7DA 1LBMA 3PUOA 3NDOA 3TXZA 4JXCA 2HS8A 4PODA 3GDMA 3M5ZA 1TPEA 4KFPA 1EEPA 2X30A 3IGXA 2YCEA 1HUVA 1QOQA 3R8RA 3L21A 1MEHA 2NXGA 1AW1A 4HKPA 3TJLA 1VYRA 3UZ5A 1FXPA 5I3KA 2WSYA 2A7RA 1JRBA 3IIPA 1D3GA 3LCXA 2EHHA 3ANYA 1TTQA 3FKKA 4QJ1A 3ZS4A 3MJYA 1K7FA 1IXOA 3BV4A 1FDZA 1S5WA 2ZRZA 4WXYA 1QOPA 5K9XA 2E5DA 3W1QA 1Y0EA 4IJBA 3R2GA 3UWZA 1H51A 2AAMA 4UFLA 4O54A 5AOUA 5FF3A 3EXRA 1YYAA 2R94A 1SZEA 3BLEA 1N8FA 4JYDA 2FPTA 1KA9F 2A0NA 3DENA 1FWNA 4DO4A 3IGSA 2ZA2A 1B4EA 3CM4A 4LS2A 3NL2A 3WK3A 5E1QA 3FEMA 1KV8A 3B0PA 7TIMA 5FEXA 1TPWA 3BARA 5G2IA 3NL6A 2C18A 2ZYFA 1JCMP 5G2HA 2C6QA 3THQA 2JGYA 2JKEA 2V2DA 2CLLA 2Y89A 1TTIA 3G1AA 3NQEA 1GVFA 4CCDA 2GUUA 1SQ7A 3HBLA 2XN0A 4M6VA 3TFXA 2RHGA 2Y6ZA 1WQ5A 1Z44A 3C52A 3DKLA 3LHUA 4OV9A 2QCEA 4L4LA 2ZZ5A 4M19A 3W2JA 2NV1A 3HG2A 1OX4A 5AHNA 4XQ6A 4BK9A 1EX5A 4MYXA 3F03K 1FX6A 3W7RA 3HB9A 1GWJA 2A7NA 1X7FA 4NXKA 3UWYA 3P81A 1G7VA 1GQNA 3Q2DA 1JRCA 3O6CA 3W3OA 2Y88A 1W5NA 3SGUA 3O07A 4GFSA 4O16A 4Q33A 2RFGA 3QYQA 4FNPA 1T8XA 4AB4A 4O0ZA 4MVAA 1MXSA 2FPYA 4X3ZA 3N14A 3NQGA 5K2ZA 3PUEA 1KTBA 1VHCA 1X1OA 3NZ1A 4DO5A 4IX2A 3B0VC 3KX6A 3G1HA 4NVTA 3TMQA 3JR2A 3P82A 1UUOA 3CT7A 1F05A 2CU0A 2DU2A 5G1TA 4OU1A 2ZZ2A 3C2VA 4JR5A 3S5ZA 3UQNA 1JCYA 3P7YA 5KINA 3LRMA 1HTIA 3VE9A 1GTEA 3FFSA 3W87A 3HPZA 5DBTA 1RPXA 3TMLA 4Q32A 4NQ1A 1C29A 3LHWA 4O1BA 2WO5A 3NM3A 2X2GA 4POCA 1O95A 1HO4A 3PVFA 5HR7A 4MY9A 5LNRA 5BRBA 1WBHA 4U4MA 4XTIA 1VGAA 1HFBA 1EUAA 2GQ8A 4RV8A 3QMRA 3W1LA 3LOTA 3S1VA 1EP2A 4QM1A 3QPZA 3L0GA 1WAUA 3G0UA 4HNTA 2OX1A 3W7OA 3PS7A 3A5VA 5K9CA 3PAJA 2C1HA 1G7UA 1NF7A 5FF4A 3TROA 2CLHA 2PCQA 2E09A 3W1TA 3LTYA 5H2ZA 1MEWA 3KXQA 2OT0A 2ZTJA 1R2SA 1ME7A 4JDBA 2FDSA 2Z6JA 1OHLA 3I65A 5D32A 4EF8A 2NWSA 2YFNA 4PTNA 3OVPA 1XFBA 1TB3A 3A5FA 3C2OA 1OYCA 3NR0A 1X1ZA 4I7VA 1SW7A 1T99A 2WJZA 1AL7A 3M43A 1CX9A 2BTMA 2B0MA 1JCJA 1TPH1 2XN1A 3W22A 1K02A 4QISA 5CGQA 3T44A 1N7KA 4RK8A 2Y70A 4JYFA 1VHNA 4JD4A 2NV2A 3O06A 5F4WA 4DF2A 1LCOA 3E96A 1IGSA 1TPUA 4O4WA 1ML1A 5C6MA 4E2DA 3DFOA 3W73A 3UY8A 2R14A 1KM6A 3GXTA 1T96A 4KFNA 3LBCA 5HUPA 3O6DA 1XL9A 3QQ1A 4N4PA 1K3UA 1JJKA 3C2FA 1F6KA 1IXQA 1X8FA 3CTLA 1WX0A 2HSAA 1GVRA 4EOUA 2A2IA 4LT9A 4LC8A 4UTWA 2OZ0A 5DBUA 1JQXA 1W3TA 3IIZA 5AFDA 3TJXA 1QDSA 3W07A 4Z0SA 4PCFA 1TPDA 5DCDA 5TBOA 3TSDA 4ALDA 4QNWA 3CEUA 4UTHA 1I2PA 3NG3A 4JIQA 3HPXA 3UPWA 3QM3A 5AN7A 4JEQA 5EMUA 3DAQA 5AC7A 4YCOA 1K8ZA 1TRIA 1D9EA 2FPVA 4KKXA 1VPXA 4FXSA 3E02A 5D2WA 1A5CA 5LKYA 4WY0B 3GX9A 5D38A 1XUUA 1D3HA 1OFOA 1IIHA 1O60A 3GNDA 1YDNA 4WD0A 1YTDA 4C1LA 3PG9A 1VCVA 2E6YA 3BVJA 1PVNA 4PA8A 2C0AA 4X22A 4IMFA 1H62A 5KZMA 3NGJA 5EBUA 2GQ9A 3L5MA 4ZVJA 5DCEA 4FX6M 1VZWA 1LDCA 4MLRA 3T55A 1OJXA 4JTJA 5F2LA 4UTTC 4IQLA 3B4UA 3KVKA 4LV9A 3W7IA 3CWNA 1VCGA 4DELA 1H7WA 4WQ6A 2YFOA 4GXMA 1YTKA 2ZRWA 4ADTA 3HG5A 3P84A 5F2GA 3V1PA 2FTPA 2ZQ0A 3CU2A 3RFAA 2Z6IA 5EPDA 4O1AA 1JCNA 1ICQA 3ATZA 3GZ3A 4JTKA 3LXCA 1KLZA 4OQVA 5KITA 3EX1A 4N9CA 1SSGA 4XKYA 4O10A 3A22A 3WJXA 4YCPA 3MW7A 3QC3A 2CLMA 3KOFA 1M7OA 3W7CA 4NX5A 2J9YA 4GRSA 2VEPA 3DHDA 3SECA 3MWAA 3FS2A 4TO8A 1GG0A 1OFBA 5HULA 4S2CA 2EGZA 4TMBA 3TCEA 2WOQA 3QF0A 3TSBA 2CWNA 2TRSA 3VKJA 2C15A 1M6JA 3W2KA 3P62A 3BG9A 3NL3A 5HWNA 4C1KA 3PBUA 2GVJA 4P2VA 1TREA 2Y63A 4FIQA 4ONVA 3NQCA 2QUTA 5AHEA 2QCNA 1RD5A 2WV8A 4AF0B 2QCGA 3T7VA 1FCUA 3RMJA 3STEA 4LRSA 1LP6A 3E12A 1YPIA 1YXCA 3W7PA 2F7FA 2RDUA 3I7RA 3GB6A 1RV8A 1QAPA 1I2QA 3MUXA 3LCFA 1J2WA 2WKJA 4K39A 4FX8A 3ABRA 2WNNA 2B7PA 1I4NA 5CZSA 1UASA 3LTPA 1AW5A 4LVBA 3EXTA 1LM1A 4OBTA 3VCRA 1RQEA 1TCDA 2RDWA 5HR6A 4CQ9A 5I3GA 1PL9A 2CZFA 4NJGA 2Y62A 3LCIA 1NF0A 4CCCA 1G4EA 2QR6A 3PF3A 3B0UX 3ABSA 5BMWA 2E6DA 4HN4A 3WK1A 3L9CA 3RF9A 5L9FA 4UFHA 4K38A 1AMKA 4JN6A 3E0IA 4JTLA 4UNKA 3B05A 5KTLA 1W5OA 4H3DA 2V5BA 2ABAA 2ZZ7A 5C54A 4MY1A 2OMAA 4XZ9A 3N34A 1TPB1 3NA8A 3LXAA 3IIOA 4UCGA 3WJZA 1H7NA 3PC0A 3FYOA 1VH7A 4TIMA 3BG5A 3HMJG 4GUGA 1PCKA 5E93A 5F2MA 2EKCA 4FXRA 5CPOA 1BKSA 1WV2A 1VYSX 3TNOA 1VLIA 3USBA 2DZVA 3W9ZA 3W83A 4LRTA 3FA5A 3NNTA 2E68A 1YXYA 4DF1A 4YXGA 3A23A 4NZFA 1H1ZA 3I7QA 4RZ4A 4TMCA 5D33A 3G0XA 5AHMA 4CNOA 3MP4A 2O7SA 3DKJA 1H7XA 4Y9AA 2VFFA 4JTFA 2DORA 3UWVA 1QFEA 1W5PA 3S0CA 3M44A 1SFLA 2C19A 1TTPA 1TV5A 4QSHA 4ZQNA 5K4ZA 4I9AA 2JK2A 2J27A 3S1WA 2PRMA 5AYXA 2PRLA 2Y61A 2BWGA 3EWXA 4BWLC 4DQWA 3P8JA 1JUEA 2H3DA 1CW2A 4LTSA 2Y7EA 4H6KA 5ABTA 1OYBA 1UJPA 3O16A 3W88A 3GAKA 1L6SA 2YW4A 2Z0IA 3PBWA 2A7PA 4MLJA 3GIYA 5CZTA 4AWUA 4N4QA 1FCBA 4A22A 4DO6A 5CPNA 4JDYA 3VFLA 4JTEA 5D2XA 3W7MA 6TIMA 1LRQA 5A5WA 3GNNA 2DJXA 1ZY9A 5DY3A 5FF0A 4K37A 2VFGA 4M6PA 3IGUA 5HINA 3W2UA 4IXHA 2CLIA 3CLMA 3G1DA 1GPWA 5CKSA 1XBVA 1Z48A 3LHTA 3EXSA 1U5JA 1YDVA 3W1NA 3PB2A 3C61A 2TMDA 2CZEA 4XUGA 2Z2UA 2PRHA 2ZZ6A 1QCWA 5F1VA 3A21A 3G22A 3MYOA 1JUKA 4AHOA 3FKRA 2R91A 1H60A 3KVJA 4X9SA 2YYUA 2DZPA 1H5YA 1ZAHA 4A29A 5LNWA 3UY7A 1G67A 3L67A 1MZHA 2H3BA 3TH6A 3DI0A 1THFD 3THAA 3M47A 4HSOA 1FXQA 4LVAA 4PL1A 3RNDA 3M16A 1QPNA 3SIZA 2LLEA 1ICPA 2VELA 3NQDA 3QZEA 2V9DA 5G2WA 2H6RA 1KFJA 4ORMA 2YYTA 3OHIA 2J88A 5BNKA 4R33A 2VXNA 4ZQRA 1SFJA 1FY6A 3C4UA 1LOQA 2BLEA 3P61A 5BMXA 3P5YA 5D02A 1PHWA 1TRDA 3W1XA 4MOZA 3S9YA 1OG0A 2B7NA 2EAWA 1SO4A 1UUMA 4AHQA 4BFAA 1F5ZA 1KW1A 3O6YX 3TSMA 1TJPA 1FWRA 3LRKA 4KWWA 1TQJA 2Z1BA 1ZFJA 4NNCA 3MP5A 3V75A 1KBJA 1H1YA 3SGZA 3W72A 4MFDA 1W0MA 1F76A 3C2EA 1E51A 4J9JA 4P61A 1G4TA 1OFAA 1DOSA 3N19B 1S5VA 3GDKA 4O17A 3TR2A 3BG3A 4RR4A 3W7GA 2QDGA 1EIXA 1TJRA 2C3ZA 3DFTA 1UBSA 2C13A 1OF6A 1LRTA 3EWZA 5DCBA 5EY5A 5LGZA
chains in the Genus database with same CATH superfamily
2GGHA 1REQA 3DI1A 3AU6A 4S3DA 1NWRA 2YX0A 1FRBA 4LUYA 4W8LA 1QU4A 2HBXA 2PEVA 4QGCA 1EF3A 4XWUA 5FJUA 4A3UA 4BY3A 1CGWA 1OYAA 1SR9A 2G95A 3UNDA 4MGGA 3W29A 3RLUA 1H7RA 1VFSA 1XDMA 3WUBA 3UEQA 2HRWA 1T0OA 3BK0A 2RUSA 4D1IA 3P80A 1XDLA 1E1FA 3G1XA 3W37A 4QQUA 1GW1A 1VBGA 4M5PA 1GJUA 2Y7DA 2VEKA 3EX3A 2I9EA 1HJSA 4AFYA 2ZZ4A 1W1PA 4AWEA 2WSPA 3FSUA 3QR1A 4LF2A 1QMLA 2DZTA 4M1RA 5A8PA 1MNSA 3SADA 4IJRA 3GNPA 3HN3A 4I7WA 3GLCA 4H00A 4H2CA 5HXMA 1OX5A 1VJSA 3VNMA 4LYQA 4L56A 3TCSA 1TR9A 3WQ4A 2CXEA 1R47A 3R94A 1PX8A 4IICA 4AD3A 3PPHA 3PPGA 3GBDA 5AHIA 3WSUA 3VIPA 1MQRA 1UZ1A 3CIWA 1LUCA 2ZKMX 4Y8EA 1M68A 4FOKA 4L65A 1U83A 3GWQA 3ES7A 2DZXA 4O8RA 2FKPA 4S39A 1PJ9A 3LCLA 3EDEA 4L5ZA 2B4GA 3M4HA 3HPSA 4IH3A 3QBUA 5AC8A 3FHQA 4AF0A 3W76A 3GZAA 3MDWA 3V4BA 2Z2AA 3RCYA 3GXNA 1FWJC 2YCKX 4YHEA 2QUVA 1NDWA 3ARPA 4Q4SA 1OK4A 4PL2A 2V8ZA 4AISA 4BEUA 1ZBCA 3P60A 4WVXA 3EOEA 4BI5A 4MB5A 4DF0A 4O4VA 4ZXOA 4YU1A 4Z1AA 1HX0A 4I8DA 1TYGA 5GJPA 2VENA 3MSYA 2VOMA 4LX4A 1Q45A 1L2UA 3SI9A 1TVLA 1TX0A 4WSJA 2IS7A 2GGIA 2ZXAA 3DFPA 5A8NA 2C16A 2FVKA 3GHUA 4H7ZA 4HPGA 1XLBA 5K4XA 4ZO6A 1FFQA 1VEMA 5KETA 1PS9A 1QO5A 4E0CA 3OGVA 3O9NA 3G77A 3TX9A 3AYTA 4PMJA 2DIEA 5CPTA 1OFQA 2WZHA 2DQXA 3BQ5A 3K30A 3C5QA 4XZWA 4RDWA 1ITUA 3W71A 3V16A 1DQWA 1ALDA 3I4KA 4PUNA 1A47A 2WSQA 3AXKA 1O1ZA 3GU9A 2A85A 3EX4A 4O0KA 3O05A 3NPUA 4DPPA 5BWAA 1C8XA 1CXKA 2BGNE 3QV7A 2W62A 3DFQA 4BZYA 3COTA 1NSJA 4K8HA 2P53A 2OU4A 4JFUA 4JFTA 2CFFA 5DMLA 4UMBA 1DORA 2DVUA 5I79A 1CGUA 1PV8A 1YQ2A 4MPQA 4NZ4A 4QNEA 3H2EA 2ISVA 2GJXA 3U3HA 4GNKB 2ZUVA 3T1GA 1GG1A 3W7KA 3C3NA 3ABZA 2BVTA 3HOJA 4KGJA 2ALDA 4D6FA 3W1RA 2WSRA 5I3DA 3OB8A 4LAZA 1GHSA 3R13A 5CCZA 3H4XA 4UTKA 4DUVA 5D37A 2ADAA 3PJTA 4Y96A 1WA3A 3MY9A 3PZ9A 3BAKA 4I7UA 4ADSA 3S83A 1BRLB 2ZX5A 4UIOA 1FHUA 2AQVA 2FZDA 4WY0F 2G0WA 5H91A 1V77A 2Z1XA 4FXFA 1KR1A 2X7VA 3R6IA 3NDZA 4NAFA 1BXNA 1NFPA 3CEPA 4ECLA 4X0NA 1SZNA 2OEMA 1WBJA 2BY1A 4FI4A 2FGZA 2BXZA 4FS9A 3LDVA 1CT5A 5HNRA 1XLHA 2QUNA 2AQWA 2ZICA 3OIXA 1W1ZA 1PBGA 4WX2A 2DT1A 3BAXA 2I5GA 4RE4A 1TPVA 3LRLA 3V18A 5E0FA 3AUOA 1OF8A 2OFJA 3WBXA 3W1PA 3KCJA 3B3DA 2EPNA 3GR7A 2A1YA 3V7PA 1W8GA 1EYEA 5E9XA 4Y9NA 5IRPA 1ESWA 2DPEA 5MHBA 1XHGA 3LCGA 3SURA 2ZC8A 4Q8PA 5AYIA 4Z1CA 3F4DA 3RU8X 4C7GA 3TZFA 1XLJA 4DB7A 1LLOA 2ZWYA 1UQYA 3L5AA 3QW3A 4H6QA 3KZPA 4YJ5A 2UY5A 3T0DA 1DJWA 2XIJA 3N13A 1QASA 4IM4A 2Z1WA 4QS5A 3CZGA 4AEOA 5C55A 4JAWA 1XGDA 3E5BA 3G8RA 4E2OA 4MPKA 1UUQA 4DJDA 1OT1A 4UTUA 4C6JA 5FEWA 4GE8A 1H61A 3NAVA 1CXEA 1IXNA 5K7JA 1EDTA 1AQ0A 1J4EA 1H63A 3DX5A 4TQTA 3TQKA 2WNQA 4W7UA 4HMCA 4H2HA 1T6MA 4DXXA 5AC6A 3VD9A 2ZUNA 3BLIA 1EDGA 3LY0A 2E8ZA 6XIAA 5LXEA 4Z2HA 4O28A 1F2JA 1EB3A 3CZLA 3GAYA 3MHUA 1YKWA 4H9VA 2CZDA 1W3NA 2Z1VA 1FWWA 5D04C 5GJMA 4HU0A 3ZJ7A 3RO8A 3HMCA 1JEZA 1XR2A 3TTEA 3MO7A 3DH7A 3ZFHA 3FDKA 1RR2A 3NGFA 1W1A1 4IF2A 4GVHA 5EBAA 2XDFA 2ZFAA 1DQXA 1VP5A 4LQ1A 5EMMA 2ZIDA 3C2RA 3HQPA 3T6CA 1V3HA 3M5YA 3KVMA 2Y8KA 3VIMA 3LPGA 4E4UA 5ABFB 4ZZ9A 2ZXDA 5CLWA 2X7WA 1WXJA 1YPXA 3TEVA 1R3TA 1GJPA 1XW8A 3KP0A 1OFEA 3N73A 4KEMA 5C8BB 3FA4A 2QCHA 4RZ5A 4JBRA 4QP0A 2O4QA 5A3HA 2ZCGA 4YYCA 1FWGC 4XK2A 5E0KA 1UMYA 2V5DA 3UVIA 1V0NA 3WK0A 3A24A 3BPWA 1ZSXA 4O13A 1J11A 3QMSA 2VQUA 3TYDA 5TIMA 1CNVA 1RCXB 4NJIA 3LM3A 3RXZA 5HQLA 1E0XA 4RZ6A 1UP3A 1ECQA 4UNLA 3LNMA 1XGZA 2E4TA 5CPMA 5MKGA 2Z24A 1BVZA 3T4WA 3E74A 4RDZA 3G6LA 3WBEA 5AZ1A 4ES4A 3CB8A 4ORIA 1F7BA 2GPTA 4NX0A 4PUKA 4Q4MA 4L4PA 4WHBA 2VMFA 2NXIA 1E9ZB 4A3QA 4IFKA 3LI1A 1VENA 2VVSA 3JS3A 1PKMA 3N9KA 3ABOA 3ZOAA 1U1UA 2JKAA 3EKGA 2X1TA 4OV4A 3W7NA 5CAHA 3E38A 4KEVA 3MI6A 3SUWA 1DWAM 3STFA 4G8TA 3BW3A 2YBTA 1DTUA 2QDDA 1QWGA 4AXKA 1FVPA 4GUHA 4R5EA 4B5NA 3W7JA 8XIMA 3K1DA 2VEFA 2V63A 4D71A 3RITA 1EJVC 1H50A 1SSDA 2EJ1A 3TWBA 3KFTA 5J5RA 1S2AA 4E4FA 4JTUA 1CI1A 3W53A 1YLVA 3ITVA 4FNTA 1XC4A 4N7QA 3AJXA 3TR9A 1XRFA 4N42A 5AVNA 1XIIA 2GGEA 3L4ZA 1DE6A 1S2WA 5CBIA 3VYLA 4M56A 1IR1A 5F4XA 4F2BA 2HK0A 1ISZA 1CXFA 1F8IA 4KCWA 5BU9A 2P0OA 1A50A 2OT1A 1OWQA 4C6CA 3QTPA 1XICA 4ZQCA 1K6AA 2PDLA 2CHOA 1XIDA 4HA0A 3QV8A 3W23A 3WFLA 1FHLA 4FNSA 4NZ1A 4Z2JA 3EKLA 1TQXA 5LIYX 4J3UA 4IQEA 3GKFA 1BTMA 3STGA 3QZ6A 4RPPA 4F2TA 3PBYA 5DANA 1TA3A 1HKWA 4MM1A 3RN6A 2YZ5A 3FYYA 3QGVA 1Q85A 3I3DA 3RX3A 3PZUA 1TMLA 1SO6A 4YYFA 1H0GA 2VC7A 4E38A 2PP3A 2YCLB 5HWJA 4DZAA 4LALA 3ZLFA 3BL3A 1HQTA 5CJMA 4JNMA 3W2LA 2VZSA 3FOKA 3TN4A 2PDQA 1CPUA 1KM2A 1W9DM 3SQMA 2QYGA 1OEPA 4YWIA 1CLXA 2JGQA 4B3ZA 1IF2A 1OVDA 3EB2A 3S6TA 4ZCWA 1QTWA 4QEHA 3U2EA 1V5XA 4QCFA 1S2VA 3UJSA 2XG9A 3N4FA 4JYEA 2HXUA 4ERGA 4QITA 2YGYA 4AMAA 5D09A 3MP3A 3NEHA 1F73A 4RXFA 1F74A 5LGXA 4FLQA 2GJNA 3F2CA 2UWFA 3GYEA 3HFYA 3N18A 2NQZA 4S1FA 3MSGA 4F79A 5FOOA 4LVDA 1QPRA 5EB8A 1E0WA 1UD8A 4RLIA 1TIWA 1UD6A 2FZ8A 4S38A 1XKYA 2VVNA 3OBKA 3G1YA 3KEHA 1XUZA 2E5BA 4M1BA 3VGDA 3WH6A 5KZ6A 1XRVA 3D6NA 3EOOA 3UZXA 1Q8JA 5HMSA 1KTCA 4JTRA 1FFRA 1T40A 3QHOA 2VWSA 4Q8UA 4E3VA 5U4NA 3EPMA 3N2CA 4FEZA 3CO8A 1KBKA 4DUOA 1J5TA 1ZJBA 3N17A 2ATMA 3UU0A 4LCQA 1ZAJA 1MW0A 4XX6A 4JX6A 2OEJA 3LERA 2YOCA 1EX1A 4N6FA 3U8GA 3TDFA 1S5NA 3M64A 1XQLA 1D2KA 1AD1A 3DZ1A 1L6FA 5FSDC 3DU0A 1POKA 2VD9A 3AS0A 2INFA 2CCRA 5CXPA 4WXZA 4AD1A 1AH4A 3MBDA 4BS0A 4HNNA 4RX0A 1G94A 3QKEA 5LNUA 3AMCA 1JYNA 2ISWA 5KMYA 1E3ZA 3TFCA 3MBFA 1YX1A 2VFDA 1R3SA 1DBTA 3PTQA 1UWQA 1MXDA 1UD4A 2DZUA 5C7VA 3T0AA 4MJZA 3W75A 2WPGA 3ZWTA 2Q09A 4GUJA 2F61A 4CD7A 2WNZA 4OKDA 4DIAA 4LCRA 1GYNA 1I2NA 2QJIA 4H8NA 4UQEA 1NM9A 1V8EA 1O12A 1V79A 3UWQA 3QR0A 3T78A 3M0MA 3S42A 3WLMA 2J24A 3IIVA 3B9OA 2Y4SA 2OOGA 2OKOA 4MZYA 4BI7A 4A3YA 1F61A 1EC9A 3H26A 1PZ0A 4IJCA 1UCWA 4R7JA 3L4TA 4AD5A 2EJAA 1HW6A 1I2OA 3O8AA 3U9IA 4Y8FA 3AIBA 1S2UA 3MDUA 4JTQA 3UERA 4YTUA 2YSWA 4CNNA 1EH9A 1LJYA 3G8EA 4PZVA 5FJOA 4F40A 3NYDA 5GNZA 1IZKA 1GEQA 1O7AA 2G5WA 5FJPA 1BGAA 1W54A 4CQ8A 2PF8A 3APTA 1XPYA 3T08A 1H0IA 4NG3A 5FESA 1Y8BA 4NF7A 4HNLA 3EWYA 3NQ6A 2XUCA 3ZO9A 3VABA 3CK5A 2NZLA 3AFBA 2UY4A 4MZ1A 4V1XA 3W27A 1SW0A 3VE7A 3UWUA 4NNBA 4JQ1A 4QSFA 4LUIA 3RDKA 4FSAA 2XINA 5HDRA 1EC8A 3N6QA 4CU6A 4W5UA 2GVGA 3RK8A 4DZ5A 3D0CA 2J13A 1MO0A 4TR9A 4UC5A 4MTVA 2VC6A 3PZTA 4OHQA 3DHPA 1E72M 4ZSTA 4N9EA 1J0ZA 3PUOA 2HS8A 2IUZA 1VFUA 1Q6FA 4KFPA 1EEPA 2XIOA 1J93A 2BFGA 1MI3A 4E8CA 3R8RA 1XH2A 3RUBL 4HKPA 5I3KA 2WSYA 3AUJA 4GO8A 3UYIA 3UPMA 2EHHA 4IG2A 3ZS4A 1K7FA 1IXOA 2OYMA 2DEPA 4ENLA 3VIGA 2E5DA 2PGWA 3T8QA 2Q6ZA 1H51A 3ES8A 4UFLA 4O54A 4UBPC 3EXRA 2R94A 1SZEA 2VQTA 4JYDA 1W3JA 4B3KA 2FPTA 4IUGA 3DENA 1FWNA 4WDWA 2WXDM 2Z28A 3W01A 3E6EA 2O9OA 3GBEA 3NL2A 3WK3A 3FEMA 1KV8A 7TIMA 5JH2A 1VFLA 3PZMA 1TPWA 4DBSA 2WBGA 2A3AA 5E09A 3AIRA 3RR4A 3VIJA 5G2HA 2NLYA 4LAMA 1S1RA 1JZ7A 1UR9A 3WH7A 4W86A 1DPMA 1Q8AA 3GNXA 4PCSA 5FJTA 2Y89A 3G1AA 4JIIX 4DWSC 4UQCA 4M6VA 3WF1A 2RHGA 3E2VA 1JL8A 4I5RA 1Z44A 1CGXA 1UKSA 3DKLA 4L4LA 3HG2A 1OX4A 4XQ6A 1J8VA 2UBPC 3F03K 1GWJA 2OLAA 3L4VA 1X7FA 4U31A 1G7VA 4H6RA 3CUHA 1GQNA 1NWSA 1UKQA 2NQ9A 2G50A 3P93A 3O07A 4GFSA 2HK1A 2RFGA 1B31A 1TUFA 3IUHA 1KGUA 4IQJA 3NQGA 5K2ZA 4PMQA 1KTBA 1V4YA 1E5NA 3NZ1A 1IV8A 2J79A 4NRSA 3B8SA 1LG1A 3G1HA 3JR2A 4GI9A 3UR7A 4IIEA 2IQDA 3WNPA 3RGTA 2DU2A 5CSUA 2GUBA 2ZZ2A 4JR5A 1DWHM 1XKJA 2WAGA 1Z3NA 1JG9A 3RM8A 3LRMA 1HTIA 3VE9A 3OW1A 1MDLA 3VMOA 2ACSA 3WQCA 3LHWA 1J2BA 2X2GA 1XD0A 4POCA 2SFPA 4MNKA 3PNZA 3VDCA 3PVFA 1ITQA 3AMDA 2XFYA 1M53A 3AISA 2GQ8A 4ZOAA 3QMRA 3R0UA 3S1VA 1EP2A 3QPZA 5C7HA 1N8IA 5DF0A 2VDGA 3LN3A 4H8VA 3VD3A 4REQA 4UB9A 3WQPA 3H8AA 1G7UA 4ZO7A 1AJ0A 1NF7A 2PCQA 2WCAA 2XIQA 4JTAA 4LBRA 2ESCA 1MEWA 2ZTJA 1NQKA 4GQ0A 4XSMA 1MW3A 1CGYA 4LNCA 1M01A 3QY7A 1OD0A 4P7LA 2XVKA 1TB3A 2PZNA 3A5FA 5CBJA 4HYWA 3V0UA 3A4WA 4DZIA 2WJZA 1AL7A 3M43A 2AL2B 1CX9A 2DDXA 2QULA 1E6SM 3WX7A 1TPH1 3LSBA 2OTDA 3DIPA 1TCMA 2PU1A 3BZJA 4JYFA 3XINA 1TWSA 1HNYA 3R4IA 4JD4A 2D24A 3E96A 1IGSA 3DFOA 4XD6A 3UY8A 3W73A 2R14A 4P8WA 1KM6A 1ONEA 1JJKA 3TTOA 3C2FA 1F6KA 1IXQA 1X8FA 3BURA 1M04A 1WX0A 4JHOA 3K1GA 2HSAA 1CTNA 4EOUA 4LT9A 5DBUA 5ECVA 2PDGA 1VRXA 1Z69A 3AS1A 3REQB 1TPDA 3DOPA 3UR8A 1C7SA 5TBOA 1Q63A 5I7GA 4UTHA 4ZGYA 1I2PA 3CUXA 4MWAB 3HPXA 3RRAA 3DAQA 4YCOA 3ECQA 2CITA 1TRIA 1UIOA 3QV9A 4KKXA 1VPXA 3HV8A 3E02A 4Q4RA 2DQWA 5LKYA 3HZ3A 1LT8A 3SM0A 5PTDA 1IIHA 1O60A 4UOZA 1YDNA 1P1MA 5GPRA 4C6OA 3OBAA 2C0AA 1S39A 2V3EA 5EBUA 2GQ9A 2PDKA 2CLPA 1YBQA 1VZWA 3T55A 4JNYA 4JPGA 3B4UA 1J10A 3ME3A 5D9OA 3CWNA 4RW3A 1US3A 4GXMA 2XWEA 4OOUA 4ADTA 2VDHA 5F2GA 3V1PA 2VWTA 4PMUA 3RFAA 3WNNA 2J7HA 4KMQA 1YE4A 1ICQA 3LXCA 1SMDA 4N9CA 2AMXA 3DERA 4IGMA 3A4JA 1BPLB 1M7OA 3O0FA 2RJHA 5GNYA 3AS2A 4LBSA 4ZTYA 3VIHA 2VEPA 3DHDA 1U33A 2ODOA 2YL9A 1V02E 1HKMA 3SEPA 3QF0A 3TSBA 4NL1A 3VKJA 2C15A 1QHZA 2WVVA 1BQGA 4C1NA 1M6JA 3FJ4A 4C1KA 2GVJA 2RJGA 3SQSA 2QUTA 2WKLA 3MC5A 2EPKX 2WV8A 3KTSA 1K9TA 2QCGA 3QGAC 4KCTA 2J78A 4LRSA 1AQFA 4OJYA 3E0VA 4FR6A 1YPIA 4DLMA 2PUZA 1P48A 5JUVA 1XYMA 1VIZA 1X1NA 3W7PA 1RV8A 4JCLA 2QMKA 2DT3A 1QWKA 2WKJA 4GYKA 4RDYA 5CGMA 3MS8A 1Q6EA 5ABFA 2XH4A 4GG9A 4O8AA 3H2MA 1UASA 3EXTA 2I7GA 3VCRA 4YTTA 4WKAA 1M9HA 1RQEA 2XPKA 4C6IA 3LCIA 3FXYA 4GBDA 4BKNA 1LL7A 3WQWA 1MW2A 3WIJA 4IMAA 3PF3A 4C6PA 3ARRA 4TV6A 2OLHA 3WK1A 3L9CA 3RF9A 2DSUA 3BLOA 5L9FA 2IPGA 4UFHA 2BASA 3WNLA 2CEQA 4ZFCA 2OWCA 1KCZA 4H3DA 2ABAA 7REQB 1CCWB 1V6UA 3SDOA 4GD0A 2YXXA 1TPB1 1C91A 3GE7A 3WJZA 5BOEA 3F2BA 3LPOA 3BG5A 2PC8A 4Q4QA 5E93A 5F2MA 4FXRA 1UWSA 1WV2A 1VLIA 1RVKA 1XYCA 3FA5A 3I4EA 3NNTA 1YXYA 4GI8A 1D7FA 1FWAC 4YXGA 3IJDA 5HNUA 1UD5A 1FH8A 5IXEA 4TMCA 1ELSA 5BXPA 2O7SA 1W3HA 5HOSA 2VFFA 4JTFA 4JZ5A 1QI0A 3S2MA 3S0CA 1EC7A 3M44A 4LYKA 3WDIA 5K4ZA 3BLPX 2BY3A 2J27A 2CPUA 2JK2A 3S1WA 2WSKA 2PRMA 1JXJA 2FJUB 3EWXA 1A3WA 5GNXA 2ZVRA 3CV6A 1RXOB 1Q2SA 1CW2A 4LTSA 2XFFA 1OYBA 1Z6KA 1TE6A 3NJ3A 3K8KA 3O16A 3PZVA 1L6SA 3WELA 3PBWA 3TVAA 2A7PA 3GIYA 2CKRA 3RPTA 3OGSA 2QIWA 4A22A 4GACA 3VFLA 5GQBA 3WDHA 4UZSA 2OSWA 3GTHA 3SB0A 6TIMA 1KWKA 1LRQA 3I3BA 4JOMA 1WDQA 3L4UA 3N25A 2GJRA 2Y1HA 3W2UA 4IXHA 3LQGA 4OTKA 2WMIA 3NUKA 1S46A 1XWYA 2QIIA 2CLIA 1GPWA 4JEJA 1XBVA 3EXSA 1U5JA 1YDVA 4Z42C 2I5IA 3SRHA 3C61A 4D8ZA 5C9UA 4GIAA 1K1DA 2XSXA 3NZGA 4XUGA 3F2DA 4TOQA 1XLGA 3TJIA 3D3AA 2VX7A 2E9MA 3WLHA 1D7KA 4X9SA 3RM9A 2DZPA 9XIMA 1HKKA 1HF6A 1K8CA 2ZWZA 3UY7A 3L67A 2H3BA 2WMFA 4LGXA 2XFRA 4EANA 3ZLHA 2C1GA 2BB0A 3BDKA 3KM8A 3THAA 3OP2A 5AZ0A 2QPXA 3SUVA 3KLKA 4BQ3A 4HA3A 4WRHA 4GYPA 2VELA 2H6RA 2YYTA 3A12A 2KX9A 3GTNA 2VXNA 1TKKA 2NV9A 1SFJA 5BYWA 2A3LA 3P5YA 1TVNA 3BUVA 4ZA0A 4MOZA 2J8TA 1SO4A 4BFAA 4WCJA 3UESA 1KW1A 1HZYA 4LCSA 3PFMA 3HURA 1FWRA 4K3ZA 4KWWA 1ZFJA 1NDYA 4NNCA 4IGSA 1H1YA 5DT7A 4AD0A 4U10A 1PYMA 2PMQA 1F76A 2Q71A 3IUIA 4P61A 3VGHA 1MDRA 3VNIA 3TNBA 1DOSA 4U5IA 4B3LA 4XB3A 4O1FA 4J3ZA 3BAWA 3TR2A 3KE0A 3TOYA 1F3EA 1EIXA 1PWLA 1NQ6A 2C13A 5EMYA 3EWZA 4GH1A 1JZ3A 5CGTA 1UR4A 2CLKA 1N82A 3S2NA 3WBYA 4Z2LA 4CUCA 3ARUA 3RLVA 3GIQA 2PWEA 2OX4A 2PF0A 1L6GA 4DBUA 4DAFA 1RY8A 2BS9A 5A6BD 3W2MA 1JR1A 1IWBA 4JX4A 3WNMA 4RNFA 3F5KA 1V6YA 2WMKA 4J28A 2R8WA 5LIKX 1LWIA 1M5WA 1S1PA 2ZZ3A 4JTTA 5AECA 3LHVA 4ROPA 3KP1A 5CQ1A 2IPJA 2AGTA 3UBPC 2WB5A 1VKFA 4KEZA 3A3XA 4UNIA 1ISWA 1RAKA 2NUWA 4MYAA 5FI8A 1WDDA 4E8GA 2I56A 4Y90A 3IWPA 3HPAA 2PDJA 2CBUA 2INEA 4H9TA 3G5EA 5J8LA 3D5HA 3AIVA 4IXXA 4ATDA 1WE5A 3P0WA 2D2JA 4HN8A 5I00A 1H4PA 3PULA 1Q6LA 4LOCA 2D0GA 2ZX9A 1FP8A 1QNRA 2YA2A 5D9PA 1UR3M 4HMEA 1Y5XA 1GK8A 4WSKA 1PTGA 1XYFA 5CZJA 3GHRA 1W2VA 2OGJA 3U0HA 2BMBA 2FJKA 4IX0A 3DHFA 5LA0A 5LYRA 5B7ZA 1KFLA 1LRNA 1PDZA 3NIYA 2AQOA 2RGLA 3IVUA 4P7NA 4GI4A 5H8UA 2WC4A 4A05A 4XZIA 2MUCA 3SY8A 5A6LA 4GY1A 3GHSA 3KHJA 3R8HA 2VT0A 4ACYA 1FCVA 1R3WA 1Q6QA 1KM4A 1MEIA 2CLEA 4E8DA 2C79A 1HIZA 1HJQA 3PZGA 1DJHA 3OZOA 2HEJA 4N2YA 4JQAA 2B7QA 1K03A 4UTJA 3AALA 3A9IA 4FAMA 2VGBA 3N12A 4W9TA 1VCFA 1RD6A 4QAIA 2V5JA 3MB9A 3POHA 2WM0A 2DIJA 2O9PA 4AZ5A 5GVJA 3VX0A 4JN8A 4AU0A 1B90A 1AD4A 2NSXA 2Q8XA 1HXJA 4LWWA 2XVPA 3KTCA 3BO9A 2OEKA 2PWDA 3H7UA 1AQHA 3G1FA 1W1TA 4AHPA 1XLIA 3TC6A 2Q8LA 1C9DA 5FACA 4JGDA 1ZGDA 2YL5A 4GC4A 1J0KA 3UG3A 4DJFC 2J7CA 1IHIA 5EGRA 1OGGA 4JQ4A 4LYPA 4BF9A 1E43A 4AZBA 5M1TA 3MJMA 2OWWA 1JPIA 4W8AA 1FWFC 1H41A 2VGGA 4DBEA 1Q7QA 2CNCA 4PUWA 5CSRA 3VGFA 3VKKA 2GJPA 3CMGA 2Y2WA 3TAKA 3WD4A 2OCZA 3WL1A 4LW7A 4LYRA 3CBWA 1ADSA 4KIRA 4PRRA 4XIMA 4ACZB 1NDVA 4J3VA 2EXOA 4JFVA 4A21A 1Z41A 5CJNA 1OCJA 4HNOA 3WBWA 1PIIA 4JX5A 2ZA1A 3LV6A 1JQVA 3QKZA 3F4WA 4HPXA 1JAEA 3LGGA 3LHYA 1DHKA 3JRKA 2QJGA 2Q8ZA 3T07A 3TYBA 2BX7A 3QHNA 1OCQA 2ZUSA 3M07A 4TU1A 2BBFA 3U2CA 5M17A 2VC5A 1K7XA 3FYPA 4MADA 4NYYA 4K1WA 5DQPA 3NQFA 3LZ3A 4M7TA 1GVYA 4Q22A 2NXHA 4PYSA 3GM8A 4KQNA 4NIRA 2G37A 4IL0A 3ALGA 1P43A 4LAOA 3K4DA 4WZHA 1SGJA 3R5EA 3YPIA 1JUBA 3MHGA 3AXHA 3CAKA 4ICMA 2JF7A 1EA0A 3A4XA 4JKMA 2CZ5A 4AW7A 1TWWA 1QHPA 3GG1A 5REQA 1MUCA 1B30A 4M29A 3G3MA 1OABA 5D4YA 1W37A 3DHUA 2J9XA 4BHYA 4U3CA 4GWEA 2PI6A 2QCDB 3L23A 2EBNA 1XBZA 2HE8A 1HG3A 4Z08A 3N9RA 3CHVA 3H55A 3SIMA 3CC1A 1MYRA 2NLIA 2C0HA 4V27A 3I6EA 4DHGA 1EJWC 4IGHA 2P10A 5HMFA 3P5ZA 1GONA 2YZRA 2IPWA 3VI2A 3FJ6A 2QEZA 1BSIA 1UC4A 4FOUA 2O9TA 2OSYA 2Y85A 1KGXA 2QXWA 4UMCA 3R11A 3WD2A 1HL2A 2Y7GA 3RM4A 4QE5A 1H49A 2B81A 3IAPA 2PP0A 2PDYA 1E4LA 1M65A 1QJWA 2YDAA 1PO9A 4M82A 4ZQOA 4LUSB 3I68A 4HBKA 2J66A 1LL4A 4AG0A 2YBUA 3WLQA 4FMVA 5D2VA 4L61A 2P0IA 1UZHA 1GQJA 5JU6A 2ZTKA 1RSCA 3AIUA 2JBMA 2QT3A 1R9XA 1P5BA 4QAWA 2D69A 3L68A 1ZU8A 2CWXA 1EEXA 1JI2A 1QO2A 1VIWA 1O5QA 3TC7A 1A0CA 2YDSA 3KOWA 2QUMA 1EF2A 1BAGA 3I6RA 4HNVA 2BVYA 2XJ7A 3AIEA 1TIMA 1V7YA 2FB3A 1JZ5A 3M1ZA 1VF8A 3SZ8A 3WDQA 3AXMA 5E5CA 2XZ7A 3W86A 2ZC1A 1FWTA 1OGBA 3NQMA 1MSSA 2CZVA 2YKKA 1PX4A 5HK4A 3SCTA 5GJNA 4A2SA 4MJ2A 1P7TB 2ZA3A 5JIWA 4JTDA 3WUGA 1JXKA 3QEZA 2EG6A 1KV5A 1PZ3A 4C7FA 1E6XM 3LNPA 4O19A 4GUIA 5C5YA 4NILA 4B5WA 5DRCA 3NQ7A 1LQ0A 3M6YA 1KWGA 1OC6A 3MUZ1 4TX9A 3U2ZA 4LF1A 4Q6JA 3URAA 1UWUA 3OZYA 4W7VA 2G96A 3CWOX 3FVMA 5T26A 1XLCA 4NZ3A 4N6EA 3ID7A 2ZBTA 3NOEA 4CEUC 5BXRA 4C60A 1A3XA 1AZ2A 1O94A 3EDKA 3M5VA 1AL8A 1DJZA 3OODA 5AC5A 2BDQA 3HG3A 4B5VA 1EOKA 3H2OA 2PA6A 3PZQA 4GMEA 3K4WA 4O1CA 5DFAA 5J04A 4ADUA 2W92A 3UXAA 1OFDA 4ZENA 3NEVA 3NPVA 1ZBVA 5A69A 1XV8A 2QCCA 4FF7A 5LA2A 1OZMA 1NVMA 2V30A 2E0PA 2Q01A 1YTEA 2DZSA 3M0YA 1R2RA 1TWDA 1CGVA 3OIHA 4PTWA 4QQ3A 3KRUA 1P0NA 4AZCA 3MWCA 2X41A 3NQ2A 1A80A 2GYIA 1XRTA 1WNOA 3PBGA 4B5TA 3EMQA 4IMGA 2V3FA 1O1HA 3LMYA 5U7SA 1FDYA 3MUIA 4NYUA 3N6JA 3AXXA 4GH3A 1G4PA 2POTA 2W61A 2YL6A 1DIOA 3DDMA 2GUYA 3TONA 3IRDA 1ZBWA 4GX9A 3WL0A 1ZJAA 2GDVA 5DN1A 3KCLA 3EX2A 4H9XA 4F0LA 5LHFA 2F6XA 3L0KA 3HF3A 2WMHA 3DFNA 1OBAA 4L4MA 2MANA 1F3TA 1JULA 3G0SA 3KOYA 4NUWA 2DVTA 1BVNP 1KFKA 3W84A 1NOFA 1SJBA 3R58A 4PFMA 3UR5A 3MU7A 1K8YA 4G1KA 3LLDA 2FFIA 1B4KA 5D03A 1UZ4A 4UTTA 4UTFA 5M3WA 2RGMA 3M5XA 2F38A 1DTNA 2DZBA 4ZOBA 3EWDA 4IIBA 3R0KA 4J3XA 1QPOA 4JTCA 3VOHA 3II1A 5C2XA 2EF9A 4NU7A 4GQRA 3LG3A 4GABA 7XIMA 4GI6A 4IIDA 3UZWA 1F6PA 3MANA 1B3WA 2Z4GA 4Q8OA 4X2RA 3OHMB 5A6MA 4WUIA 4GZJA 2L5HA 1V6VA 1ZRQA 3N04A 1QATA 4DBDA 4MY8A 2V6AA 2GDUA 3VFCA 2JEPA 2WWCA 4KH2A 4Q8QA 2VFIA 1E1CA 3FGCB 4WOQA 4JIRA 4HPJA 3QW4B 3PY2A 5CAKA 2Y5SA 1ISXA 4GYFA 3P6LA 2O55A 4GIEA 4F0KA 4W7WA 3DG7A 3AS3A 4BJHA 4F0RA 3B8UA 3BOLA 1SVDA 1ZTVA 4OBRA 4JY9A 1IYXA 1W1IE 2OG9A 3AYVA 4N0RA 4QE4A 1PXGA 1NAL1 3PUDA 3NL5A 2VR4A 2A21A 1Q7ZA 4IIHA 3W28A 3SUSA 1PE1A 4LS0A 3A9BA 1IZCA 3B03A 3BANA 4IMDA 2OOFA 3THDA 4DYJA 3MKCA 4J40A 2OZTA 4MWAC 4ILSA 1JYWA 4C91A 3QRHA 5KEZA 2ZDSA 3NWRA 2JALA 1GKPA 1GOOA 4FZIA 5CSYA 4J7RA 2W0UA 2VD8A 3MMTA 3AXIA 3CPRA 4HU4A 4ZL1A 3FA3A 4S3FA 1XSIA 2HROA 2HXTA 3GNRA 2UV8G 4XZNX 4U28A 4LUJA 3MV11 4IIFA 4HNUA 5D05A 1XS2A 3PK7A 1XIEA 1Y7VA 2V82A 2WHMA 1X7IA 3BGJA 3AO0A 2W91A 2FZ9A 3T0TA 1TMQA 4MNMA 3KDOA 2OQHA 2ZRVA 4B90A 2X1RA 1DIDA 1ZAIA 2E9BA 2GQAA 3PHAA 3UVAA 2PFHA 3TIMA 1SJCA 4B5XA 4Z1YA 5RUBA 4CKQA 3V5OA 4IMCA 1DJXA 3Q4DA 3PTKA 5BOOA 3QJAA 5I3FA 1TPFA 1ODUA 1Q66A 2XVNA 3DN5A 3GW0A 4CN4A 4KBXA 1QRQA 5A2AA 1NOWA 3IJ6A 1VYPX 2CHNA 3N1AA 3GFXA 1TTJA 2G3JA 3T2PA 4QBXA 1GW9A 3A3WA 4PR4A 1PB0A 5SWUA 2P3EA 1RJRA 3NTYA 3WEMA 1NDZA 3HGOA 8TIMA 5FCZA 4HOZA 2VGFA 3USZA 3S5SA 4XBSA 3M41A 1KRMA 1ME8A 4DPQA 4FLSA 4OT7A 2QPUA 2ZDRA 1OX6A 1R5YA 5F1UA 3VDGA 3CXOA 3FIGA 3IJ8A 4NNAA 1V6TA 3G3DA 3G6MA 5G4WA 3W74A 3PTMA 1J5SA 4EXAA 2V0TA 2QGHA 1TZ7A 2QKFA 3TW9A 3U2OA 1JDAA 1ONRA 3BMWA 3B40A 5FEZA 1TZ9A 3B97A 5G4HC 4ML4A 1X6NA 3OVQA 4EPDC 5AVHA 6REQA 4JQ3A 4I6VA 1HL8A 5BRPA 3MUCA 5LIUX 4QDWA 4UQ9A 2HISA 1RVGA 4WDTA 4G7EB 1F3WA 5C0QA 5F2IA 4KWVA 4YVXA 1E9YB 5C70A 4K6AA 5H1WA 2QNEA 4H01A 4JNZA 3CYJA 5IBXC 2VTFA 3WMSA 4E6MA 3B06A 1U1JA 3UZYA 3N2OA 2Y5JA 1DJYA 5CPQA 1B2YA 3E0WA 4US5D 4UFMA 4OE7A 5LNSA 4GISA 2JFEX 3CQ0A 3L5LA 7TAAA 1OC7A 3GKAA 3O1NA 4IL2A 1B9ZA 4O52A 3UF9A 3FDGA 3KBNA 3HA1A 3CL8A 4WF7A 4GCXA 4LEQA 1RJPA 2PLKA 3C6CA 4RE0A 1UP2A 4H6EA 4MKSA 3EX6A 4B2DD 1J9YA 1PSCA 4XKYB 1TMHA 5FAGA 4HPHA 3V3WA 4O14A 3FJLA 5C9ZA 1L6YA 5FAJA 3EWBX 1A5OC 3R79A 1ZNNA 2ISFA 2CLFA 5I06A 5A6BA 3HQNA 4BQ5A 1Q13A 5FJIA 1QNVA 3R25A 4OFCA 3KWSA 3UNTA 3NVDA 5IFPA 1EHAA 3N11A 1SZFA 3W26A 1AH0A 2V2CA 4A35A 2WQPA 3W81A 3N2MA 1GTHA 2E8YA 3QMTA 4M8UA 1J6PA 3M46A 1KO0A 3W2NA 2IPFA 4MJMA 3VPLA 3S5OA 3W70A 5DEZA 1QXLA 2XFWA 3UETA 2NVAA 1OT2A 3APYA 4M80A 3FK4A 5BRQA 1BHGA 2XIBA 3TXZA 3NSMA 1UA7A 3GDMA 1V3JA 5FL0A 3ZVIA 3M5ZA 3H6OA 3IGXA 4JL1A 2YCEA 1QOQA 2NXGA 3M0XA 3KBWA 1KXVA 5FL1A 3IIPA 3LCXA 4KRTA 2E28A 1WB0A 1TTQA 3FKKA 1G5AA 2QW5A 3GH5A 4QJ1A 2IKIA 5I24A 3BV4A 4B9YA 3GHTA 2JF6A 2H9AB 5K9XA 2PTDA 3AQUA 1QPKA 1V6WA 1Y0EA 1Q4NX 1SR0A 3R2GA 3AHXA 2AAMA 3TN6A 1R7AA 3RR1A 1N8FA 3GQYA 4W4QA 3F7JA 2A0NA 3CASA 3CM4A 4HZ8A 5E1QA 3DUGA 3B0PA 4AZGA 2VX4A 1W91A 2OGYA 2ZYFA 1KBLA 3RLGA 3EOLA 2C6QA 4ZEPA 5HJYA 2JKEA 2V2DA 2C1IA 1GVFA 2GUUA 3HBLA 3EPOA 3CB3A 1QK2A 3GG8A 5AKQA 3TFXA 1WQ5A 1SYTA 2VYOA 1S2CA 3ZQ9A 5C9XA 1EPVA 1R0MA 4M19A 1GOWA 5FSEC 1Y5WA 4BK9A 2V3DA 5T91A 1EX5A 4MYXA 2XH7A 5E9AA 1V93A 2WZEA 2A7NA 1K70A 3WMLA 4DWSD 3KS5A 4W8BA 1BGGA 1X39A 1JRCA 2Y88A 3SGUA 3AROA 1V6XA 4GKTA 4EPBC 3QYQA 4FNPA 4AB4A 1MXSA 3OZPA 5CPSA 1EJXC 1X1OA 3GRIA 4DO5A 2NW0A 3KX6A 5BCAA 4B5UA 4GQGA 2IKHA 4BF7A 4TXEA 2V38A 1WKEA 1F05A 2CU0A 3KUMA 1KXHA 3HU7A 2PPGA 4OU1A 3WFZA 3VNJA 1GJWA 2DSKA 3C2VA 3MCMA 2YJQA 4KIEA 3MZNA 3P7YA 2XU2A 3UT0A 5KINA 3NXLA 4DZHA 3H4WA 3SCVA 3CUZA 1RPXA 4NQ1A 4BA0A 3RJYA 1EA9C 1HKVA 3NM3A 1AFSA 3PP7A 1O95A 3GY1A 4FLRA 1WBHA 4G7FA 3WLKX 1FHDA 3N4EA 4H41A 3LOTA 4QM1A 2EQDA 3ABXA 1RA0A 4C6LA 1WAUA 3W24A 2W4XA 3TC3A 4PULA 3LZ5A 1R3VA 2OX1A 2YA1A 4YTQA 3RIKA 3PS7A 3A5VA 1NWTA 3PAJA 2R82A 5FF4A 2CLHA 2CKSA 1AMYA 1ODZA 1ZJHA 2E09A 3LTYA 5H2ZA 3VIOA 4PMDA 2OT0A 4NAEA 3BMVA 1H1NA 1ME7A 2FDSA 4L80A 1E1EA 1QW9A 2BXYA 1A5KC 4EF8A 1TZZA 2NWSA 1PTDA 2YFNA 4LAUA 3OVPA 1XFBA 2XYLA 5HPCA 3S9ZA 3C2OA 5EFFA 3PJXA 1R3RA 4QJ4B 1WXYA 1QHOA 1QBBA 2V69A 4GIYA 1JDDA 2BTMA 2B0MA 4MSSA 2D3NA 3CNYA 3W22A 5CGQA 5CC6A 3SAZA 1OM0A 4G1NA 3DECA 2GK1A 3VAVA 4QDPA 4DF2A 3BLDA 1TPUA 4O4WA 4D6DA 4E2DA 2BOFX 4KW2A 4KFNA 1XL9A 3QQ1A 1B5TA 1K3UA 4C6FA 3DC0A 3VMNA 3EEZA 1JFHA 3ARZA 1CECA 2X8RA 1JQXA 3TJXA 1EGVA 3W07A 4Z0SA 4PCFA 4GYJA 2E67A 4AX7A 3MSRA 3A13A 1S3TC 4ALDA 4JIQA 3UPWA 1VEPA 3QM3A 5AN7A 5EMUA 5AC7A 4GZ7A 1D9EA 1IEVA 1EJUC 3APGA 4RNJA 1XD1A 1REQB 1A5CA 1B0IA 3AU2A 2BY0A 3C0LA 3GX9A 1R38A 1BD0A 4KEUA 4C1LA 4ERIA 1TJ0A 1VCVA 2V5CA 4FLOA 1PVNA 2PDNA 4HD5A 4PA8A 4V2XA 4X22A 1H62A 6PTDA 2X0SA 3UG8A 3NGJA 3DEQA 4PUJA 4ZVJA 4MLRA 2YB1A 4QXIA 5F2LA 4LV9A 3ZJKA 3W7IA 3LEPA 1H7WA 3NQBA 4MWAE 4QRNA 3HG5A 3P84A 2WC3A 3GG7A 5HMDA 2FTPA 2ZQ0A 3CU2A 2Z6IA 4U5KA 1E3XA 1CB7B 5EPDA 1V3MA 4JTKA 4X2PA 1KLZA 2X05A 2GQ3A 3AYRA 1P0BA 1UR2A 3MW7A 4IGNA 3WLJA 4TX6A 3W7CA 1Z8AA 2J9YA 1XLAA 1IEWA 3SECA 4PE8A 1JCTA 1CBGA 1M41A 4TO8A 2EGZA 2QF8A 4GHRA 2GFTA 4YHGA 3ARVA 1VBJA 4AZIA 1J18A 2R1MA 3QLDA 1LUCB 3MKVA 1MVYA 3P62A 3NL3A 3GH7A 5B80A 1HT6A 3S2JA 1IT8A 2Y63A 4FIQA 3EPNA 2XGIA 2QCNA 4UR9A 2OVLA 2HZGA 3H23A 1JNEA 4AF0B 3DFHA 3TTSA 1I6NA 1IEXA 1YXCA 1XPGA 3IS4A 1W3LA 1OIMA 4QX4A 3SN1A 2RDUA 3I7RA 3GB6A 3TZNA 2FTYA 1TV4A 1J2WA 3JZUA 4K39A 5E70A 4FX8A 1W9VA 1J79A 2AOSA 5A6AA 2B7PA 3ZM8A 4S3AA 5CZSA 2W5FA 1J01A 4PRTA 4LVBA 3UCQA 4OBTA 4PSRA 3EDFA 1TCDA 3IANA 5I3GA 1PL9A 4AIEA 2CZFA 3VA8A 1KQZA 1CDGA 1E6ZA 4HCDA 2PBGA 3ABSA 5BMWA 2ZOXA 1W6TA 4K38A 4JN6A 4JTLA 9XIAA 4UNKA 1XINA 5KTLA 1V03A 3JUGA 3KHDA 5CEWA 2V5BA 3VZYA 1GOMA 4X61A 3B8VA 2CIPA 2OMAA 1HKJA 1RH9A 4AY1A 3IK2A 1H7NA 3PC0A 3FYOA 1VH7A 3U7BA 1RCOB 1PCKA 4PGLA 4QLJA 3H22A 2EKCA 4PB3A 3W83A 4LRTA 4GGHA 2E68A 8A3HA 4DM1A 3A23A 4NZFA 1H1ZA 3I7QA 3CLWA 5D33A 3G0XA 1UKOA 5AHMA 3MP4A 4Q8WA 3DKJA 1H7XA 2GJXB 4Z2IA 6A3HA 1W5PA 3TYCA 3GU2A 3LS9A 2IW0A 1YRRA 1V3LA 1TTPA 4QSHA 4I9AA 4Q8VA 3ZZ1A 4MAVA 4D6HA 2PGRA 3WUEA 1CIUA 3P8JA 1DWJM 1JUEA 1UZDA 7A3HA 4JFWA 4H6KA 5ABTA 1PKLA 1E15A 1EKOA 3FX4A 2ANUA 1D8WA 1BFNA 3SCNA 3WLPA 2Z0IA 4CQBA 2A79A 4DWDA 4FALA 3IAQA 1DJGA 5CZTA 3TN5A 4N4QA 5CPNA 3WDPP 2WBKA 1DXFA 3W7MA 4HK5A 2J7GA 4NAFB 5FF0A 4K37A 4FP1A 3JVAA 3IGUA 3OPSA 3SQLA 1UR0A 4OBSA 1H3GA 3CLMA 3G1DA 2R1LA 3CL7A 2REQA 4QTGA 3GU1A 4ZE5A 3W1NA 3GG0A 3F4CA 1RJQA 1O68A 2VCBA 5FA5A 4FA3A 4OOZA 2PRHA 4YWSA 5F1VA 3S6OA 1VFHA 4I90A 2IKGA 4PUEA 1C7TA 4A6GA 3FKRA 2VX5A 1UPPA 2R91A 1DXIA 1H60A 4S3EA 3ZJ6A 3KVJA 4G6CA 3I10A 2YYUA 3N2BA 1GZJA 2P8CA 1ZP4A 4Q4PA 1G67A 4HZ6A 4ZO8A 2VRKA 1VFTA 3E5PA 2LLEA 4JCMA 1ICPA 4A3RA 3UW6A 3T42A 1KFJA 1JAKA 3OHIA 5BNKA 1WKFA 1EO5A 4GIRA 3WH8A 4ZQRA 2B31A 1FY6A 3UXLA 3CT2A 3CHCA 1E6PA 2P76A 4MF4A 1OG0A 2EAWA 4B4FA 1UUMA 3EA3A 4P7OA 4XO7A 2CBVA 1TJPA 1H2JA 2G3MA 1JF6A 2Z26A 3MP5A 2OB3A 4ERAA 3WF3A 4MFDA 1W0MA 1Z89A 3WYZA 2DIKA 1UWTA 1G4TA 5XIAA 1D3CA 1OFAA 3SCWA 1G1YA 4RV3A 1S5VA 3GDKA 1IWAA 4AY8A 4H04A 4RR4A 5FKYA 1TJRA 2C3ZA 3DFTA 4HTBA 1UBSA 4GFIA 4NZ5A 3R8GA 1LRTA 3FAWA 5DCBA 5EY5A 4EWJA 1R3YA 2O9RA 5HJXA 2NQHA 3BXWA 4LUTA 2HMCA 4WY0A 3CIVA 1V0KA 2YR1A 3ARXA 3H2CA 2F84A 1ZZMA 2OYKA 2I17A 2PBOA 4XTDA 3BOFA 4H9YA 4HHHA 4CCZA 2DVXA 4HSHA 4TTUA 3VU2A 5CG7A 1GZGA 3WH5A 3F4NA 3O6AA 5DMNA 2VI0A 3C8FA 2HVNA 4HHLA 2DW6A 5LIXX 5IHSA 3EAUA 4V28A 2NUXA 4FXJA 1C8YA 1LLWA 4D8AA 4JTSA 1A0EA 3MA8A 1XCWA 5JBDA 3MYPA 1J96A 3WY1A 5HAOA 1XIMA 1WAWA 4IOTA 2PD9A 3TAOA 7ODCA 3RU6A 2F8QA 4IP7A 3SCOA 2KZHA 3P74A 4UFIA 2OJPA 5B7YA 4O53A 1B57A 4YTRA 1QI2A 4NJKA 3A47A 1XBXA 3S6DA 1V51A 2WJDA 3PZIA 2PZ0A 3TYZA 1SO3A 4UR7A 1XG3A 3G1VA 1DJQA 2YB4A 3PAOA 4PMYA 2Y24A 4NKCA 2YPIA 5LZLA 1R85A 1BF6A 4HA4A 1WZAA 3MI2A 3ZT7A 3KRSA 4L1XA 4GY0A 2IXUA 3WQGA 1OZQA 4L64A 2AKMA 3CZKA 5M5DA 5BW6A 4Z17A 3V36A 4CNSA 2VX6A 3GXDA 3NVTA 3C56A 3OVRA 1FCQA 3F5JA 1H7OA 1O6IA 8XIAA 1VRDA 3M0VA 3SY1A 1A5MC 3DGBA 1XX1A 1LBFA 4GVFA 1DJIA 2ZXBA 4MUPA 3B8TA 2B7OA 4CNTA 5MKGB 2WQDA 3KL0A 3LCHA 3TQVA 3W1AA 4V15A 1IEIA 1GEHA 3MMUA 2HWGA 1M1BA 3B8WA 4IP4A 4OVXA 1EJTC 3IIXA 1WOAA 4WSHA 3CIXA 4IFKB 3ZR5A 4HTYA 4RE2A 5AY7A 2GVYA 3TW7A 1GHRA 2Z2BA 2YBVA 4DRSA 2CLOA 4ML9A 3KOZA 1UH3A 4HK6A 1EPXA 4US5A 4H9UA 3E3HA 2EPHA 3PSWA 2QLYA 1V3IA 1ZCCA 4TVUA 3HJZA 5HUOA 2XH2A 3ITXA 1UH2A 3IRSA 1W9PA 3D46A 3TU9A 3UWWA 1WYIA 5I3IA 1KFBA 5TF0A 1O4UA 3B4YA 1WP6A 2XIIA 3QYSA 3SSZA 3URNA 4HU3A 2G41A 2QDHA 3MUAA 4B2DA 4CVWA 4GO9A 1KFEA 1GVOA 2W67A 1RBAA 1XP3A 2RKXA 1I8JA 2PS2A 5I78A 3W38A 4DJFD 1VQTA 3BLFA 4K7YA 2DUXA 3ALFA 5H8PA 2D0FA 2XSAA 3KBVA 3E2QA 4MFEA 3N3TA 4LVFA 4A8NA 3OQ8A 1WDWA 4TX8A 3PWAA 2BNJA 3BSHA 1ICSA 1XC6A 4XUYA 1IIGA 4PFHA 2HVOA 4WEVX 3P2VA 4OZOA 3PSVA 3QXBA 2E3ZA 2FB2A 1YXDA 1FQ0A 4FIRA 3WEZA 1ITCA 5G4EA 2W9MA 1XBYA 2FFCA 2PP1A 4BWLA 1WUFA 1KXTA 1K9EA 3GR8A 1VLWA 2QF7A 3WLIA 3HGJA 4HHMA 3QQWA 3EA2A 2J9ZA 3NO5A 5IOBA 1TA3B 4O57A 2QJMA 2WPBA 1FH9A 1UQZA 3EKZA 3G1SA 1HVQA 2UY3A 1A5UA 1PTAA 4YLWA 1BYDA 3SFKA 1NP2A 4HYVA 4RL3A 2YIHA 3ZT5A 3DYOA 2G3NA 4UTWC 2HE5A 2OODA 5IDIA 3W7HA 1ZS2A 2D22A 1GQKA 1FP9A 4LEFA 1KBIA 1NOUA 1W1B1 1FUYA 5AYZA 3UYCA 3ZYZA 1ADDA 3U7VA 3RAOA 1BG9A 3R43A 4DXKA 4B9ZA 2I57A 4HZ7A 1ONWA 4HHPA 4J3TA 5DT5A 4PMZA 3BZGA 1EGZA 3S8HA 1RY0A 4CN1A 4R53A 3WF4A 4FOJA 4XBKA 1L8NA 4IP5A 4LC6A 3S5YA 1ENUA 3K13A 4EK7A 1SM9A 2HVMA 3ITLA 4UQAA 1N55A 4IT1A 2D2HA 4DWSA 2QMJA 1LOSA 4WJEA 1I0DA 3LB0A 4UTIA 5TAOA 1KM3A 3C0JA 5DLCA 1OQFA 4UOJA 3LTSA 3UXKA 4F8XA 1JVNA 1U5VA 4DJEC 1EIBA 2D20A 2G3IA 3VIKA 1AUSL 4HCLA 3CWHA 1LBLA 2JEQA 3M7SA 2VEGA 1VEOA 3WUFA 4X63A 1DHPA 4AIUA 3PNUA 3ISIX 3FHAA 1XM3A 2DT2A 2G4JA 2NQ5A 2NVDA 3B04A 4MKNA 2BOGX 1HL9A 3KL5A 1P1XA 3GYCA 1OINA 3HIJA 4MB4A 4CQDA 1TV7A 4XZHA 2BZNA 3OG3A 3WQ5A 3DXIA 4RZBA 2WK2A 2TPSA 4B16A 2R9RA 2OSXA 4KCVA 3DBPA 3C3UA 3W4RA 2YDRA 3U6WA 3LI0A 4UXDA 3K5XA 3N9SA 1EUNA 3W7LA 1KKOA 3URBA 3NM1A 4RNIA 3W1MA 4QFUA 1HJXA 1R9YA 3OBEA 2W79A 4Z0JA 4H1ZA 1OADA 5AHFA 4PUDA 3GC4A 2ON3A 2EKGA 3VINA 4ICNA 5A6TC 1UWAA 4OWGA 2QCMA 1AG1O 5EU9A 2QAPA 4CLMA 3GC2A 1SUXA 5JXQA 3UPBA 3BAJA 4WGHA 2ALRA 3GH4A 1XGEA 2EPLX 3VOJA 2EG8A 4JS3A 4PB5A 3WLOA 4IPPA 1B3XA 5EL1A 1UG6A 2VP8A 1SO5A 4EF9A 4D6CA 4J3SA 2A4AA 1JDEA 3T2QA 2VDIA 2DJLA 3L66A 1TPC1 1MXGA 4U3AA 1VS1A 1RQHA 1RLDA 1ZHAA 4PTXA 1UOZA 3TE9A 4XAZA 1A5SA 1R87A 4HCHA 2RDXA 1GVEA 5CC7A 1A0DA 4ZB0A 4LB3A 2X0HA 3ZT6A 3EOSA 1AVAA 2X2YA 3KAOA 5DY2A 4TUFA 1CXIA 3GXFA 4DUWA 4LANA 6TAAA 1O5XA 3CJPA 4JY8A 1TO3A 2INZA 3BW4A 3VC5A 4UUIA 1OC5A 3LA4A 1HGYA 5T9CE 3H7VA 3V1HA 3QLLA 1JZ8A 5CSSA 4I9MA 3R89A 2XTKA 3DESA 5EMJA 1AW2A 1Z42A 3SSJA 3N29A 4KFOA 3M0JA 2D2OA 2CW6A 5T8GA 4UMAA 1O5KA 2NX3A 3WJSA 3N3MA 2HDJA 3AHYA 5LNVA 3GIPA 3URQA 3G24A 1KD0A 3C0QA 3KDNA 3IJLA 1XIFA 3QTGA 4BQ2A 3RCNA 4LXFA 1VPQA 3DGRA 1EP1A 3AHZA 3FLUA 4HP5A 3HGRA 2O92A 3SN0A 5HJLA 1R3QA 4UQBA 1TJ2A 4K8EA 3L65A 1PYFA 1Q6DA 4O12A 3NQ8A 3VCNA 3BCJA 1NEYA 5EMLA 2W66A 1R6WA 1TJ1A 3L7RA 1H7PA 1KTNA 1MQQA 4S3KA 4F2UA 1UKPA 1LT7A 1JGMA 1K7EA 4QIUA 4NT0A 3OA3A 2PDBA 1BVWA 4IG2B 1UWRA 1ZALA 4HT3A 4A8LA 3SW6A 5TQLA 4QR6A 4EP8C 5JH1A 3BMXA 3RRXA 4YL2A 4EWND 4AVOA 2O7QA 1RZMA 2RDTA 2VKZG 4F0SA 3GTXA 1O5RA 3HM7A 4XAYA 1XLLA 4JFSA 4GXPA 4GXWA 4IFRA 2VOTA 2ISSA 5JVLA 3VKBA 1UD2A 3GDLA 1X97A 1BRLA 3IEBA 4F9JA 1F3XA 2WW5A 3KS6A 2DP3A 3TQPA 4ZOEA 2R1KA 4RDVA 4KERA 3LU2A 1S3HA 1PHQA 1OX4B 2O56A 1V7AA 4DEFA 2PB1A 1CXLA 3LBMA 2NT0A 2H8XA 2IMRA 1P0EA 2IQTA 4WOZA 2PC4A 1RPKA 3L2MA 1L9WA 2W27A 1F4HA 1KR0A 1DJNA 4KWSA 1HKIA 3P0XA 4GZIA 5EKYA 3VD4A 5I07A 3ITCA 4J27A 3MHFA 2WZTA 2OZ8A 5JMUA 2Y8UA 4DX3A 1NWUA 4Q8NA 3W6MA 4LJ3A 4O1DA 3W82A 3H2FA 3FJNA 4Z1DA 1VAHA 3SCRA 4KF1A 2J7BA 2J47A 5A2BA 2QJHA 2AMGA 2QDEA 3PFRA 5FIPA 2E25A 3ARSA 4MWAD 1K9DA 2J4GA 3SFWA 3CS2A 1NFGA 3OU8A 2HTMA 2JIWA 3TXVA 1TWZA 3AZTA 1GOIA 3QFEA 1QT1A 4NHVA 2G3FA 1R7OA 4FX7A 4J5NA 4XAPA 4H7CA 4MB1A 5FF7A 4AVNA 1P4CA 1GVSA 4IZGA 4FPSA 2ZVIA 4W84A 1NTHA 4RJEA 3VNLA 2XGZA 3SN4A 5D2YA 1VD6A 4IUOA 4REQB