2X30A

Crystal structure of the r139n mutant of a bifunctional enzyme pria
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
240
structure length
233
Chain Sequence
b'MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGNGWTRDGGDLYETLDRLNKEGCARYVVTDIAPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL ISOMERASE A
molecule tags Isomerase
source organism Streptomyces coelicolor
publication title Identification and Analysis of Residues Contained on Beta --> Alpha Loops of the Dual-Substrate (Betaalpha)(8) Phosphoribosyl Isomerase a (Pria) Specific for its Phosphoribosyl Anthranilate Isomerase Activity.
pubmed doi rcsb
total genus 83
structure length 233
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2x30A00
4N2YA 1P0NA 2QDGA 2YYTA 5H91A 1X6UA 1NEYA 4RV8A 2HSAA 2F84A 4HIBA 4PCFA 1VCVA 4MY8A 5K9DA 3LHWA 5K9CA 4N9DA 4GUJA 5SWUA 4Y8FA 3C0JA 3LHZA 4FO4A 1XUZA 2C16A 5FF7A 3WJWA 1VHNA 1ZJIA 4JYDA 5IBXC 1RD5A 2C14A 4XUGA 2NUWA 4PA8A 2A85A 5CG7A 1EA0A 3GKFA 3E9AA 2E5BA 2Y88A 2WNZA 4S2BA 3DFNA 4OBTA 1SZEA 4MKNA 1L9WA 3UXAA 3ELFA 1G4SA 1TPDA 3DBPA 3U2OA 1TIMA 1YTKA 4GUFA 3TFXA 2J27A 2Z1BA 1LP6A 2VEKA 3OVPA 4M19A 2A4AA 1O5KA 1TTPA 6ALDA 4TU1A 5K3VA 5K4XA 3TSBA 3LXBA 1KV8A 1OG0A 4CQ8A 1QWGA 2B0MA 1EX5A 4KWWA 3CPRA 4AAJA 2GVJA 1W3IA 5HWNA 1SU5A 2C1HA 5CKSA 1KLYA 3OEXA 3LCIA 4FEZA 3W7GA 1TQJA 4ZQOA 1LLZA 4AWTA 1KBJA 2YGYA 1PVNA 4O13A 1VYSX 3ANYA 3V75A 1F73A 3DHDA 3O16A 2HS6A 4YLWA 1TPFA 4MFDA 1O94A 1XUUA 4LRTA 4PTNA 5C2XA 2QUUA 1FWWA 3RFAA 5LNRA 3GXTA 3KRSA 1SO5A 3P81A 3GXNA 3BW4A 4CQ9A 2ABBA 5KITA 3M9YA 4OGZA 3PAJA 5J5DA 4A21A 3LOTA 3PUOA 2Y85A 2BXVA 2GQ9A 4LVBA 4AWUA 4P61A 1FCVA 2X30A 2E77A 3T44A 3NEVA 2V82A 3FJ6A 2Q8LA 2VFEA 4KFPA 1V5XA 4LU0A 4WZHA 3C3NA 4UMAA 1G67A 4WOQA 5K4ZA 3A9IA 4MYXA 4R7JA 1XDMA 2X2GA 3WK1A 2ISVA 1QCWA 1JQVA 1KM6A 4NNBA 3SSJA 4S1FA 3A21A 2QAPA 1XDLA 2FB3A 3DKLA 1QPNA 3W70A 3P8IA 3T40A 5FI8A 4BR1A 1PIIA 3CEPA 3KHJA 4K8EA 4O4WA 5F1VA 3TNOA 1NFBA 4U28A 1ZAIA 1UB3A 2C19A 3USBA 5FF0A 3L0KA 2JGQA 3LBCA 4DPQA 4XTDA 1DL3A 1OF8A 2DZTA 3N34A 1W37A 3LHVA 3MMTA 1TREA 1X8FA 3GKAA 3SI9A 3TU9A 3I68A 3HJZA 3SZ8A 1M5WA 2V2CA 4UNKA 2ZRYA 2Y7DA 3SGZA 4O8RA 3UWWA 3W7KA 2FPVA 3ATYA 3EXRA 3MI6A 1AG1O 1VJIA 1DJNA 4Z1BA 5KZDA 3NQ8A 1NF7A 1WV2A 4ML9A 1JJKA 2QCEA 5BNKA 2R91A 5HNRA 2QEZA 5HWMA 3GK0A 3R89A 4DELA 5LGZA 2PURA 1H7PA 5C55A 1LRNA 2WNNA 1Q6LA 3WJZA 3W7OA 3MHUA 1JULA 3F4WA 1GWJA 1P4CA 1LBLA 2O7SA 1D3GA 4JTHA 3EX4A 1LORA 4NU7A 3UXDA 1X1ZA 3HG5A 4ALDA 1H50A 3G1DA 4ICNA 3TUUA 3KOFA 3AO0A 2DZWA 4NT0A 3W1RA 3W1XA 1MEIA 1HUVA 5AHEA 1VCGA 4UTHA 1KFCA 2NXHA 1H61A 4N6EA 5H2ZA 2V5LA 3M1ZA 1FXPA 1VLWA 3UWVA 2VFHA 1JUKA 4HNNA 5G2IA 4MVAA 1SW7A 3M44A 3GDTA 3CIXA 4AHQA 4QQ3A 1BEUA 4WY0B 2A7NA 2Q8ZA 3MP4A 2YSWA 3P74A 3W2NA 3RLVA 4DF2A 4O0KA 2DZVA 3C8FA 2B7PA 3EWWA 1KTBA 3DH7A 3KX6A 3LCHA 1ZAJA 6TIMA 4NZJA 4K7YA 3S5OA 3DFTA 3BW2A 1I2QA 1LRQA 1YPIA 4IWWA 3CU2A 5G4EA 1XBYA 3O6YX 3TMLA 1TV5A 2V81A 4NJGA 3W2MA 4O12A 5AB3A 2Q3OA 1IGSA 3PC0A 3VFLA 1TCDA 5KMYA 1GTEA 4GJ1A 2WQPA 5LHEA 3L68A 3HIJA 3P62A 1VZWA 1FDJA 5U4NA 3HF3A 2CFFA 4PH6A 1S5TA 2ZA2A 4WQ6A 3TKFA 4HPJA 4Z0SA 5KINA 3TIMA 3G0SA 3LTPA 3BG9A 5DCBA 5CZTA 3NQ2A 3N2MA 3O15A 1ZENA 3L5AA 4AWSA 5LZLA 3N9RA 3EX3A 3C6CA 4OQVA 3MHFA 1F2JA 3QSRA 2HMCA 1YXDA 2VXNA 3TK7A 4IPJA 1XBXA 1TJPA 4NX5A 4JXCA 1O4UA 3DAQA 1GG0A 3S1WA 2BSLA 4LUIA 4HSOA 3EWZA 3TQ0A 5KSWA 3BVJA 4Z08A 4UTTC 5AYYA 3L5MA 1Q3NA 4UIOA 4JTTA 5DY3A 3FLUA 3PSWA 4LC8A 3UWQA 4UTJA 2V30A 3TCEA 5AYXA 4NXKA 3MP5A 3ZWSA 4BFAA 1Z42A 3NG3A 2CLHA 2VC6A 2FTPA 3JR2A 3EXSA 3W2UA 2FJKA 1OFOA 3HMJG 5G5IA 4BK9A 3DFOA 2ATSA 1JQXA 4N4PA 1J2WA 2X1RA 5I3KA 4O50A 1ICPA 3P61A 1W5OA 2ZZ4A 4WD0A 1W54A 4QSHA 3C2FA 1ZAHA 4M6PA 3B05A 5D33A 4X2RA 3B03A 3HGSA 4ZVJA 3PBUA 2BZNA 1B4KA 4LWWA 1NF0A 2GVLA 2E6YA 2A6NA 5KTLA 3LXAA 5EYWA 3DZ1A 4I7UA 2FLIA 2X1SA 3FYPA 1HTIA 3IVUA 1K8ZA 3IGSA 4GWEA 2BX7A 4O53A 1B3OA 1IIHA 2E1DA 3LLFA 5F4SA 1YTEA 4JS3A 1TSIA 4O14A 2J88A 3R13A 5HINA 4FXRA 4BF9A 3GDKA 4KFOA 2ALDA 4UTLA 3B4UA 1K03A 4MLRA 3HG3A 4JEQA 4JYEA 4U4MA 4KKXA 3CTLA 5AHIA 3NQ7A 3TDFA 2CZ5A 2A21A 2Z6JA 4LY8A 3PWAA 1F05A 5D38A 1LLWA 2C6QA 2TSYA 3IIVA 3N73A 1T8XA 2E6DA 2RDUA 3STFA 3GDRA 1HFBA 1VPXA 5KZEA 2XN1A 3SIZA 4MPQA 4I7WA 3BGGA 2QF7A 3BLEA 3IVTA 4JTJA 1JUBA 4AHPA 5DY2A 3RMJA 5AC6A 1SFJA 4Z0JA 4R33A 1KM5A 4XBKA 3NZRA 2JKPA 2DJLA 2AQWA 4CQAA 4CCDA 2FIQA 3G8EA 4ADUA 3PBYA 3NQDA 2DP3A 4UMCA 3M5XA 3CT7A 3KVMA 3R2GA 5DCEA 2ISWA 2GOUA 3B8DA 1XI3A 4GXMA 3QPZA 2ZDRA 4IMEA 2FQIA 4RXGA 1YXYA 5CGQA 3E49A 4LW7A 2QCMA 3G18A 4UXDA 1YPFA 5CPLA 3GYEA 1H51A 3EWUA 2GJNA 3E0IA 4OE7A 2C0AA 3LHUA 3W2JA 1UBSA 2UV8G 3W1AA 2C3ZA 3PY2A 2YDAA 2PRHA 4Y96A 2NUYA 3VKJA 1SO6A 3NAVA 3VI2A 1TPH1 3TMQA 5D03A 4GUGA 3LHTA 4UR8A 1KBIA 5I3JA 3GB6A 3TQVA 3MW7A 3DU0A 1OABA 2V5BA 1G69A 4QISA 3M5YA 1TPEA 3E12A 4O17A 5AHLA 5GVJA 4AMAA 3G1VA 3MBDA 3L65A 4CLMA 3W7PA 2PC4A 2C13A 3L67A 4I7VA 4CCEA 3QYQA 1C29A 4HNUA 3S8HA 2EGZA 2A2IA 3EX1A 3G8RA 1TYGA 3GIYA 4X3ZA 3G1SA 3BLIA 1EUAA 4A2SA 5HUPA 4KWVA 3THAA 4UFHA 4ZQNA 3DFPA 4RCXA 3LCFA 1RZMA 2D73A 1PHWA 1DVJA 2A1YA 1CX9A 4AB4A 1Q45A 1JRCA 3CIWA 2ZTKA 3LCXA 1TPVA 3NR0A 4QIUA 4H6KA 4FIQA 3M43A 3L0NA 1BTMA 3NZ1A 3W7DA 2PE4A 3NL2A 1VR6A 2A6LA 4NZFA 1SQ7A 2EKCA 4BI5A 1W5MA 2ZZ5A 1B4EA 3PM6A 3UY7A 5EA9A 2Z0IA 3S5NA 3KVKA 4A2RA 1M6JA 3EKZA 3OG3A 3W07A 1ME7A 3ABSA 2I9EA 1OHLA 3CEUA 4O28A 4ZQCA 2VFDA 4N9CA 1KFEA 3F03K 4UTUA 4ZQRA 1W0MA 1QO2A 1VYRA 5D05A 1TB3A 4MJMA 3W72A 3C2VA 3T7VA 4JTUA 1I2OA 3PUDA 1PE1A 3DGRA 4GRSA 2Y7FA 3LTYA 4FNSA 4DPPA 3S5ZA 1JR1A 3OBKA 3PB0A 3O07A 1P5BA 1MO0A 1Y0EA 2DZUA 3TROA 7TIMA 4IMDA 3W75A 1ME8A 4LS0A 3UYCA 2VELA 2R14A 4JTGA 1AW1A 1SZNA 1QPOA 3K30A 3LXCA 1O5XA 5F4WA 1WBHA 5C5YA 2FDSA 3GR8A 1F74A 1WOAA 4YCOA 1RQBA 4QNWA 4LRSA 1LYXA 2X1UA 2NX9A 1UASA 4Y6GA 3KRUA 3CHVA 3MP3A 5FF3A 3C2OA 3W7LA 2ZZ1A 1J4EA 3NM3A 4FNTA 3NL6A 3LCGA 5F1UA 4N6FA 4JYFA 5D2XA 1H63A 3SECA 3UPWA 3D0CA 3O63A 5G2HA 1DOSA 5HR6A 1LDCA 2WSYA 2BLEA 4JGDA 3MWAA 1A5CA 4MYAA 3C61A 5AC8A 1UJPA 3QQ1A 2QCNA 3P67A 1T0OA 4MZ1A 1FDZA 2NZLA 3FFSA 1H7RA 3W83A 1FWNA 3GVGA 1G4PA 1JCMP 4WJEA 3FS2A 4HNVA 3PG8A 3S1XA 3DHFA 3O06A 4HHPA 1QDSA 3FYOA 2OCZA 3IVSA 3W84A 2ISSA 4GBUA 4ZZ9A 1JCJA 3M16A 4MFEA 1TMHA 1LM1A 5DBTA 3I65A 3TJLA 3O05A 1C8VA 2W79A 2Y62A 4UFMA 1TPC1 4MZ8A 3EWYA 4HT3A 3LI1A 2ZRVA 3NQCA 3C2RA 3YPIA 3MUXA 1GYLA 3HQ1A 3PSVA 1P0KA 2V2DA 3C2EA 3M41A 1EB3A 2RHGA 4PL1A 3W86A 5AC7A 3G3DA 5EBUA 1A5AA 1RVGA 2ZRXA 1SZFA 1ZNNA 4UTTA 2DU2A 3ZWTA 2Q3RA 3G24A 4Z1DA 3CLMA 3TH6A 3TXVA 1XBZA 1BWLA 3C52A 1LCOA 3GDLA 4S2CA 1W56A 4ORMA 2VEIA 3A24A 4E0CA 3W1NA 1WXJA 5FESA 1E51A 1I4NA 2VFIA 3WK2A 1EWEA 3QW3A 5D02A 2ZRZA 1LOQA 4IMFA 1F76A 3TC6A 2O7QA 5I3IA 3NQVA 5F4XA 3PBWA 3S0CA 3NPUA 3A23A 3LGEA 4IX0A 1PCKA 1LRTA 3UY8A 1XFBA 1KTCA 1DHPA 5F2GA 5IM51 2R94A 1YDVA 5FF4A 4LV9A 4ONVA 1W5PA 2CU0A 3C56A 5FEPA 1LOLA 4AXKA 3W71A 4HNTA 3ABQA 3NQ6A 2CZFA 5D2WA 3SY5A 4RXFA 1AW2A 2QCDA 1JCLA 2CLOA 4AF0B 1OX4A 3TXZA 1EUNA 1V7YA 4K8HA 3FEMA 3G1XA 4KFNA 4C1KA 1G7VA 4JX4A 1R46A 2OZ0A 1QO5A 5CZSA 4PL2A 3FA5A 4LOCA 1M7PA 2TYSA 4R34A 5E1QA 2AAMA 1KV5A 1OYBA 3RLUA 3TSMA 1XL9A 1H62A 2C18A 1T99A 3HGRA 1VCFA 1GVFA 1Q6QA 3E02A 2Y7GA 3LBMA 4MUZA 5TQLA 1TPUA 5LHFA 1LROA 4O0ZA 1I2RA 2I1OA 4W9TA 1PHQA 3R5EA 1VRDA 4JDBA 1QPQA 3LCWA 3TQKA 1W31A 2NXIA 4O1BA 4PODA 1IXQA 2A0NA 2RDWA 5FF2A 1H7NA 3W1MA 4A22A 3SW6A 3GDMA 3N19B 3N14A 2J9YA 1PV8A 5I3GA 4JTSA 4AF0A 2YW4A 3ATZA 1JRBA 3NPVA 4YL2A 3W1TA 3W6YA 3BK0A 2YPIA 1TTQA 5LGXA 2ZBTA 1NVMA 2ZA3A 2QJHA 1K3UA 3H54A 3QMRA 1DJQA 1UCWA 1ME9A 3KVJA 4JX5A 5D32A 3HPSA 4AH7A 4QNEA 4WY0F 4Z1CA 2Y63A 3F1QA 3TFCA 1B9BA 1TQXA 1R2SA 1IF2A 4LC6A 3MHGA 4MY1A 2DJXA 2WPBA 2H8XA 2G95A 1ZFJA 1MEHA 4UTIA 3P84A 2QCHA 1VC4A 5CPMA 1FX6A 3W7QA 4ZQPA 5BRBA 4YMZA 3W7NA 3WK0A 4FXSA 4OV4A 3TW6A 1KFBA 1N8FA 3O6DA 1RPXA 1SPQA 1PL9A 3TAKA 1OFPA 5HQEA 1H5YA 2FB2A 4JTFA 4DO4A 2ATMA 3QMTA 1GPWA 1G4TA 3VE9A 4JTIA 1KFJA 5AHFA 1TTJA 3CQ0A 4D2JA 1W1ZA 3LV5A 2C15A 2CW6A 3LV6A 5LNUA 3GXPA 3W87A 4Y90A 4LUJA 3G1HA 4A3UA 4IMGA 1N7KA 5DELA 1O60A 4UUIA 1TTIA 4O10A 3WJYA 3PG9A 4BI6A 3BLFA 1KM0A 1GZGA 4JD4A 4M6VA 1DORA 4PFMA 3A5FA 4N9BA 5C54A 1HO4A 2WNQA 5D2TA 5DXYA 1XBVA 4K39A 4EF9A 4N4QA 4K6AA 2W0UA 4EIVA 4WXZA 3NQEA 5I3HA 3EKLA 4DF1A 4GUIA 3HO8A 1VHCA 4O57A 4MZYA 3INPA 1TRIA 2QJGA 3B0PA 4X22A 3WK3A 2G5WA 3IGUA 3UZJA 1CI1A 4IXHA 3IGXA 3T55A 3UQNA 1OF6A 2JKAA 1TJRA 1YXCA 5AN7A 2HTMA 4ZQMA 5G2WA 1G7UA 3QQ0A 1OFQA 2ZRUA 1K02A 1A5SA 3DENA 4GC4A 4O11A 2B7OA 1GJPA 3W73A 4PEKA 4K38A 1W5QA 5LKYA 1IXPA 2DORA 5F2LA 2ZYFA 3TE9A 1FWRA 3ABOA 4AHOA 1YDOA 3G0UA 1AL8A 4NXSA 2OMAA 1QPRA 1KA9F 3W7MA 1W8SA 4ADTA 3W7HA 5HR7A 3P60A 3P7YA 3FKKA 4L4MA 5TIMA 1OFDA 2YFOA 3HBLA 1B57A 3LX9A 2HS8A 1Q6RA 2J6XA 3GAYA 5D2VA 3M5ZA 3SGUA 3PF3A 2WO5A 1H1ZA 3RU6A 3W1UA 2EHHA 2XN2A 1K7EA 3O8AA 1LZOA 1GTHA 5HMSA 3IV3A 3L21A 3EX6A 2WV8A 2A5HA 4LVDA 5D30A 3HGOA 4POCA 5LNSA 3BARA 3BG5A 2CLIA 4OT7A 3W85A 3UWZA 2DZXA 4RX0A 2QR6A 1D3HA 1S5VA 2FFCA 5J5RA 3STGA 2VEMA 3L2IA 2RH9A 3I6RA 3NYZA 4DQWA 5K9XA 2RFGA 3SR7A 4NX0A 2AGKA 2WOQA 5KZMA 5K2ZA 2NV2A 5AYZA 3VNDA 4H3DA 5FEZA 3T4CA 1FY6A 3P8JA 3W88A 3DFSA 3GX9A 4IGHA 4YXGA 3UWUA 3M6YA 2JKEA 3QJAA 4CNNA 1ONRA 3EWBX 3W1PA 2V8ZA 1QFEA 2PCQA 1ZY9A 2P1FA 2R8WA 3W7RA 1SR9A 2ZCGA 1PCWA 2QKFA 2F7FA 4DEFA 1FQ0A 3NPXA 4IX2A 4RJEA 3NQFA 4EVZA 3S1VA 1U83A 5EY5A 2ZRWA 3G1AA 2CLKA 3CM4A 5HWJA 3TR2A 3VE7A 3EB2A 2Y70A 1R2RA 1A53A 4RZ5A 4IUOA 3B06A 1RV8A 3QMSA 3B0UX 3HPZA 4UFLA 5DBUA 1Z48A 3TW7A 4UNLA 2YZRA 4GUHA 3UPBA 1O95A 5BW6A 3IIZA 3ABRA 1AL7A 3A5VA 3M47A 1GVOA 3LRMA 1MEWA 3HGJA 5D2YA 3KAOA 3P82A 2QDHA 4IOTA 2W6RA 4K7VA 3HG4A 3GNNA 1BWKA 1S3HA 2ZA1A 3NQGA 3LI0A 4JDYA 3LHYA 1P1XA 3QPYA 2TPSA 1R47A 3QFEA 2YW3A 1ML1A 3IIOA 4DF0A 1MZHA 4E2BA 5G1YA 2H3BA 3S5YA 1W3NA 2ZZ2A 3Q58A 4DBDA 2NUXA 3PB2A 3OA3A 3E96A 1WAUA 1WOBA 1OFBA 1X7FA 1GG1A 1YLVA 3O6CA 3FKRA 4Q4KA 3EEGA 4WUIA 1IIGA 4WOZA 1TO3A 1F6KA 3W1LA 1K7FA 3DXIA 5IBXA 3QW4B 2FPTA 5EL1A 1H7OA 4G1KA 1QNVA 4TMCA 3ZR4A 5AHNA 3OVQA 1YYAA 2TRSA 1VGAA 2NWRA 4BI7A 2GQAA 3F4NA 4L4LA 4XWUA 3EWXA 2KZHA 2BWGA 1G6CA 5TBOA 1H60A 1QMLA 4B5NA 4LS2A 4NJHA 3KFTA 4X9SA 1DQXA 1KFLA 4JNMA 1ZHAA 3G1YA 5HUOA 4O4VA 2E68A 4OV9A 2YXGA 3LRLA 1GOXA 2GUUA 3MYOA 1SSGA 1A50A 5A8GA 4A29A 2XN0A 4QJ1A 5HULA 1UUOA 4AEOA 1AMKA 5FEXA 4M7TA 1FWSA 3QSTA 3M5VA 4UR7A 4BWLA 4HN4A 4LVGA 3PBVA 4LVFA 2WKJA 1L6SA 3IEBA 1WYIA 5DXXA 2G97A 3EXTA 1K8XA 3KRZA 2B7NA 4AVFA 1X1OA 2NV1A 1RQHA 4O52A 3RNDA 2NWSA 3RK8A 3TA6A 4FNUA 4TIMA 2V0TA 1L6WA 3IIXA 4FNRA 3IRDA 3JRKA 2JGYA 1JVNA 3O1NA 3P5ZA 3QF0A 5CZ0A 1G4EA 1ICSA 1BKSA 3TJXA 1EP2A 3NOEA 3W7JA 4IMCA 4UTWC 2PRLA 3OIXA 3QZEA 5LNVA 1W5NA 1GVQA 1QOPA 2H8ZA 5ABTA 2EF9A 1UUMA 5F2IA 5LSMA 1DKWA 2WJZA 1J5TA 1WBJA 3HG2A 1QR7A 2H6RA 4UTKA 3W9ZA 3NA8A 4WY0A 1EPXA 2CLEA 2JK2A 1KM4A 1CW2A 4J9JA 1GYNA 4OWGA 3L66A 1H7WA 2E5CA 1IXOA 2VFGA 4JN6A 3FOKA 5L9FA 4M6QA 3QH2A 2GVGA 3QM3A 3VCRA 4GNJA 1DBTA 3KVLA 1KM1A 5MHBA 3NO5A 2E5DA 1A5BA 5CSRA 1VS1A 3W23A 4CNOA 5D04C 2GQ8A 2ZTJA 4ZMGA 1DV7A 4K36A 1THFD 3PS7A 4WXYA 2NXGA 4FHAA 3TAOA 1GVSA 4WX2A 3V1PA 3DI0A 1XC4A 3MO7A 4QAIA 3HPXA 3LDVA 3WJSA 3NM1A 4RK8A 1GT8A 2Z6IA 2ZQ0A 4OU1A 1W3TA 2QCCA 3GR7A 1Z41A 4N9EA 3G0XA 4DXVA 1I2PA 3NQAA 1TV7A 1ALDA 5DN1A 2VOMA 2E6AA 2OX1A 4RKAA 5K7JA 2YX0A 3U8GA 2EAWA 3L9CA 8TIMA 2A7PA 1C9DA 5EPDA 3DKJA 4JX6A 4O18A 2QUVA 2P0OA 4XTIA 1TV8A 3W76A 2Y6ZA 4ADSA 4JR5A 4HKPA 5BMWA 1PS9A 5F2MA 4Q33A 3LM7A 3KXQA 2P10A 2NX3A 2Z2UA 4TMBA 1H1YA 1HO1A 3W1QA 1VH7A 2GPTA 4XKYB 3W3OA 3TV8A 1AW5A 5AOUA 1OX4B 4O1DA 4JY8A 4K37A 2YCEA 2ZZ3A 4UFKA 3NVTA 3BO9A 3HB9A 4MOZA 1D9EA 5AFDA 1MXSA 4NNCA 1SSDA 4DBEA 2ZFAA 1M7OA 5L6UA 3W74A 3QC3A 2CLMA 1EEPA 4RLIA 1ADOA 2XFWA 3DI1A 3NQMA 1QAPA 5BOOA 3QRHA 2X1TA 4EOUA 1OVDA 4LT9A 2Y7EA 2CWNA 1F7BA 4OHQA 4MY9A 3FIGA 3L5LA 3UWYA 4Z1AA 1GEQA 1K8YA 1SFLA 2QCGA 5E93A 3NL3A 2CZEA 4LV4A 1RR2A 3STCA 2VFFA 4E2DA 1FBAA 4UTWA 2GJLA 3LRKA 3ZS4A 1ZCOA 1TRDA 3S42A 4IQLA 3STEA 3PVFA 4PC8A 1F6PA 2VEPA 4NJJA 4UTMA 2JBMA 4O15A 2RKXA 2QUTA 3U6WA 1FWTA 4UMBA 1FDYA 3W7EA 4IJBA 4ZL1A 2J9XA 3GZ3A 3THQA 3MI3A 4EWND 2OJPA 2CLFA 4Y9AA 3SJ3A 1Z44A 3UD6A 3BPWA 3SFKA 2Y61A 1VLIA 3CC1A 3WFAA 5DCDA 2ZZ7A 1OK4A 3TC7A 5C6MA 4GE8A 1U5JA 1XKYA 2E09A 3H53A 3MBFA 3QEZA 1JCYA 2YYUA 3A22A 4QITA 5CPOA 2WSQA 4XBSA 2TMDA 3DFQA 4UCGA 2H3DA 3W2KA 4R53A 3S6DA 4JICA 2YR1A 4EF8A 3IIPA 3MYPA 1N55A 3I7RA 3LB0A 3CB8A 3B04A 1OYCA 3GNDA 4TR9A 4MIMA 1KM3A 3NDOA 4BWLC 2CLLA 4QM1A 3AJXA 3N3MA 1WQ5A 4H4IA 1R30A 4FX6M 3N9SA 3ZFHA 1ICQA 1SO4A 1L2UA 2Y89A 3WJXA 3S9YA 1FCUA 1SO3A 1OJXA 3TX9A 3I7QA 3H55A 1SZGA 3G1FA 5T26A 3NNTA 4CCCA 2J24A 3W7IA 1I45A 1KLZA 4C1LA 1XXXA 3HOJA 1IXNA 3C4UA 5EMUA 2DZPA 3M0ZA 1KW1A 3CWNA 3OVRA 4RZ4A 3NGJA 1JUEA 4NJIA 1LBFA 1OK6A 2NLIA 1KTNA 3P80A 1L6YA 1HG3A 4FIRA 1OX5A 4O54A 4CNPA 4XQ6A 4MLJA 1RQEA 4I9AA 1VQTA 1NSJA 3S1UA 1EP1A 1EWDA 1VYPX 3R8RA 4UFIA 1FUYA 4GFSA 4HPXA 2BTMA 1F5ZA 2V9DA 2E6FA 2G96A 3LLDA 1MSSA 3TSDA 2RDTA 2H90A 3Q2DA 2VKZG 3BW3A 3UNDA 4NVTA 4XKYA 4IXXA 2ABAA 3R12A 4FF7A 1OFAA 5FEWA 4LTSA 2B7QA 4JTLA 1K7XA 3Q37A 3JS3A 3W7CA 3N2XA 1YTDA 2PRMA 4FNQA 1HL2A 4LNYA 1XCFA 5AHMA 3GLCA 4M5PA 5G4WA 1OX6A 3NPWA 2QJIA 2OT1A 1I2NA 2YFNA 5I3FA 3G22A 2NX1A 4DO5A 1JCNA 2QCLA 1LBMA 3GAKA 5D37A 2EPHA 1QOQA 5BMXA 4O16A 2OT0A 4NJKA 4UFJA 2DZSA 4JIPA 3LERA 4JTEA 1EIXA 3NXFA 1XM3A 5CSSA 3RF9A 4TO8A 3BV4A 1Q6OA 4XZ9A 3T78A 1OYAA 4IPIA 2QAFA 3MJYA 2V2HA 1TPWA 4JIQA 4O1CA 1S5WA 4FB7A 5CPNA 4YCPA 3EX2A 5E0KA 1OFEA 2J9ZA 4FNPA 1LOSA 4N02A 4E38A 2QCFA 2CZDA 1YADA 4NQ1A 5D09A 1DQWA 2X16A 2QCDB 4JTKA 3CWOX 1FCQA 1H7XA 4RZ6A 4LVAA 1WDWA 4NNAA 1KFKA 2B4GA 3M7WA 2I14A 2WSRA 5HJLA 3BG3A 3UZ5A 1KM2A 1WX0A 1NAL1 1SW3A 4YWIA 4FX7A 5G1TA 1GQNA 4O19A 4FX8A 3P5YA 3PUEA 5U7SA 1R2TA 4HSNA 3W2LA 2VENA 1JCXA 3LTSA 3Q94A 1GVRA 1WA3A 4MJZA 1TPB1 1I8JA 5DLCA 3I7SA 4TX9A 1YDNA 4JY9A 1ZALA 3L0GA 4NUWA 1EP3A 3BGJA 4DO6A 5EKYA 2LLEA 5CZJA 2ZZ6A 1SW0A 4UC5A 1AK5A 1FCBA 1T96A 2IQTA 4O1AA 3FJLA 4RR4A 1FXQA 3MI2A 3B0VC 3W22A 1SUXA 3G3MA 3OHIA 2FPYA 3PULA 4P2VA 4Q32A 1LTDA 4ORIA 5A5WA 4LS1A 5LNWA 2A7RA 1OFRA 3LCLA 3NL5A 3PR2A 4M7SA
chains in the Genus database with same CATH superfamily
4ACZB 2YYTA 2FJUB 4RV8A 5CZKA 4Q4OA 3C0LA 2F84A 4HIBA 4PCFA 5K9DA 4JKKA 5K9CA 3K8LA 4GUJA 1XUZA 2X0SA 2C16A 3BLKA 4REQA 2OEJA 4HA0A 1XYBA 5I24A 2PZNA 3ZIZA 2P50A 3RM4A 3VIMA 5CG7A 2PA6A 1DJYA 4B3ZA 1EXPA 3SFWA 4ICMA 5LYRA 4ZXLA 4J5NA 3ARQA 1TMQA 2QPXA 3CO8A 5D9MA 4QE1A 5T8GA 1G4SA 4IIHA 3TWAA 3TYUA 4GGHA 4DUOA 2BNJA 2Z1BA 2ZUSA 2CC0A 2VZOA 2ZXAA 6ALDA 4TU1A 3TSBA 1ZBCA 3ARXA 3UXKA 1Q2SA 1JZ5A 3FCPA 4QHRA 2GVJA 3K8MA 1SU5A 3BH4A 1M65A 3A6OA 1KLYA 1MXGA 5TAOA 2YGYA 3STPA 2FGZA 4C6KA 1BD0A 1YDYA 3ANYA 1F73A 4FOUA 3HV9A 4B3KA 3WH8A 1O94A 1XUUA 4LRTA 4OOUA 2RGMA 3ARPA 3QBUA 3ZYZA 1LL7A 4XISA 3KCLA 3VXGA 3BW4A 2CXGA 1FWGC 3M9YA 4OGZA 4FAMA 2G50A 3PUOA 2Y85A 3FVMA 2VCBA 4P61A 3RGTA 4DJED 3T44A 2OEMA 1KRAC 2VFEA 3MWCA 4TTUA 4WZHA 1J9YA 2P8BA 5FJOA 5K4ZA 4R7JA 1XDMA 4EKJA 4X9YA 3QPEA 2ZIDA 1KM6A 1NDZA 2BOFX 4B3LA 3E2QA 5I00A 4JOMA 3S2MA 4S1FA 2SFPA 2AL2B 2QAPA 5IDIA 1W1IE 5CC3A 5FI8A 3IJIA 8CGTA 3CEPA 3VKKA 5C9UA 4ZTXA 1NFBA 4XAZA 5FF0A 3LBCA 1OF8A 1SMAA 1YW1A 1N8WA 1X8FA 3I68A 2Y7DA 4GIRA 2X7WA 1EIBA 2OSXA 1RLDA 3O9NA 4GI8A 1DXEA 3ZVHB 3VD9A 3ATYA 2DVUA 5MKGA 4DJEA 3EA3A 2ACSA 3NQ8A 1NF7A 4KF1A 5BNKA 3LGGA 5HNRA 5HWMA 4CN6A 2AKMA 2Z27A 1V51A 2WNNA 4UQEA 1K6AA 4FK9A 3F4WA 4UQDA 4LEFA 1LBLA 4JTHA 1D3GA 4AZHA 4AG0A 2PLJA 2O0TA 3UXDA 3HG5A 5AZ1A 1H50A 2PB1A 2VWSA 3N3TA 1AQ0A 4ZO7A 4L80A 1MEIA 4M81A 4GO9A 3KM8A 1KCLA 1KFCA 2V5LA 2PWEA 3RX3A 1MI3A 4IGNA 1JUKA 3B9OA 4HNNA 3CIXA 4ZFCA 2X41A 3W82A 4QQ3A 1W1B1 1TX2A 2NVCA 2A7NA 1FH9A 2PDPA 2YIHA 2ZC8A 1UPPA 2WJDA 4DUWA 2B7PA 3G6LA 4PRRA 2GJXA 4DJDD 1FA2A 3KX6A 3AMGA 4QDMA 5KEZA 2GWGA 3PPCA 2OYKA 1EOMA 1Q7MA 4AWEA 1DE6A 4ASTA 3DFTA 3VDBA 1LRQA 3CU2A 2QDEA 1TV5A 2P5NA 2Q3OA 3TP4A 3BMXA 3H23A 4V1YA 5D8ZA 2Z2AA 3MZ2A 3VFLA 5KMYA 5AVNA 1GTEA 3VINA 2WQPA 5LHEA 3L68A 1JD7A 3P62A 1FDJA 3ZVIA 2PGFA 2PS2A 3PZMA 4YVXA 3WBYA 2XGBA 6ENLA 4PH6A 2EKGA 3TKFA 3T09A 3MSYA 4HPJA 4Z0SA 2VQUA 2XIJA 2QLYA 1XIIA 3LTPA 3WX7A 1UMYA 5CZTA 3N2MA 3KWSA 4NP7A 1L6GA 5J8LA 1TA3A 3N13A 3U0HA 3C6CA 2FTYA 3SCTA 4OQVA 3B8SA 4GJJA 3MHFA 1XSKA 1F2JA 4WVXA 5CBIA 4KERA 3K4DA 3OGSA 1XBXA 5A8PA 2Z7KA 1O66A 1Y7VA 9XIMA 1GG0A 2YA0A 2BSLA 4LUIA 3EWZA 3TQ0A 2DGAA 3BVJA 4M80A 5PTDA 3VM7A 4N7QA 4OJYA 1Q3NA 4UIOA 1Q6EA 5DY3A 3IWPA 4YTUA 4LC8A 3UWQA 2V30A 5AYXA 1IHIA 3H4WA 4NXKA 1PKYA 3MP5A 3U2CA 3WLNA 3CQIA 1MUWA 4ZBCA 2CLHA 1BGGA 2FTPA 3JR2A 3WBAA 4MWAD 2OLSA 2Q71A 1CCWB 3UG4A 1H09A 4BK9A 4QG9A 1JQXA 3J7HA 3NWRA 4C1NA 3AIQA 3P61A 4CQBA 1W54A 1UD4A 4QSHA 4M6PA 4MKVA 2VRKA 1Y65A 2PD5A 3XIMA 3KBMA 4W5ZA 3QY7A 5EYWA 4I7UA 1G5AA 1HTIA 1K8ZA 3A3WA 4I8YA 2D2HA 2VL4A 1BGAA 3E5PA 1IIHA 3LLFA 3N15A 4U2ZA 3D3AA 2I56A 4IL0A 3PTKA 1C92A 2WVVB 1Z69A 1NQKA 1GYMA 1A0CA 1PDYA 1WZKA 5I09A 1K03A 4MLRA 3HG3A 4JYEA 4AX7A 1UP0A 1VIZA 5AHIA 3NQ7A 4W89A 4YIWA 1OADA 1P0BA 3TDFA 1BVNP 5C0QA 3CYVA 4KEMA 4IL2A 3QQWA 3MUZ1 3D5HA 3SRHA 3IIVA 4LBRA 4W4QA 2E6DA 2RDUA 2ICSA 1VPXA 1GOWA 3CO4A 2XN1A 3SIZA 4KW2A 3BGGA 1K4HA 2F38A 2ZUMA 2QF7A 2QXWA 1LUCB 1CLXA 1NP2A 4K1WA 4YYCA 5JUVA 5AC6A 2WHKA 3N9KA 4R33A 5BCAA 2Z1SA 2PBOA 3VAVA 1X6NA 3CQHA 4D72A 4L65A 5JQ9A 1O12A 4LPCA 4EWJA 4CQAA 4CCDA 4NL1A 2DP3A 3M5XA 3CT7A 1YE4A 2FQIA 1YXYA 3WD1A 1L8PA 4UXDA 1JPDX 5CPLA 4J1OA 1W8GA 3GYEA 3RILA 8XIMA 2L5HA 3T0TA 4X2PA 4XZHA 1R38A 1SZRA 3W1AA 3PY2A 2P8CA 4YHEA 3RR4A 5D03A 3U2ZA 2OFJA 4GVIA 3MW7A 1EL3A 3DU0A 2VVSA 3NSMA 1G69A 3LUTA 2XZ9A 1U33A 4UOZA 1NDWA 1HKIA 1N2VA 2NT0A 2C13A 4A35A 2Z1XA 1C29A 3QYQA 4OBSA 4ILSA 4DWSC 1JZ6A 3N2BA 5C9WA 2V5CA 3BCJA 3BLIA 4Y8EA 4J27A 5HUPA 2EG6A 3AC0A 3OU8A 3AXMA 3PTMA 1VB9A 2FZBA 3L4XA 1C91A 4PMQA 4FS9A 1CX9A 3VZYA 4YHGA 4Z2HA 2A79A 4GACA 2J7GA 3NR0A 3PTDA 3UR7A 3ZT7A 3L0NA 3VDCA 3TYBA 4C91A 2IPFA 1XIHA 4FF5A 2I17A 3NL2A 5HDRA 5C9XA 2YCLA 2ZZ5A 5T9BG 1B4EA 3UY7A 3S5NA 4IG2B 4DVOA 3KVKA 1M6JA 2INEA 4KPLA 1MQPA 3W07A 3W25A 2JF6A 4QLLA 2VFDA 4N9CA 4UTUA 1VYRA 1W2VA 2WMFA 3R79A 5D05A 1TB3A 4MJMA 4MB4A 1HIZA 3M0KA 2OR2A 4PR4A 1VFHA 2P53A 4GRSA 3CUJA 2BOGX 1MFUA 1RP8A 3LTYA 4WRHA 4FNSA 1A5UA 1P5BA 1KRCC 1MRQA 1Y0EA 3TROA 4HZ7A 4IMDA 7TIMA 2VELA 1AW1A 3CUGA 4B5XA 5FAGA 2AMGA 4GGBA 3UW6A 1POKA 5F4WA 4OFCA 4A3QA 3KP1A 1MW3A 4YCOA 4QNWA 3WZ0E 1E70M 2NX9A 2WMKA 1SVDA 3KRUA 3NVDA 4R9XA 5FF3A 3WLRA 4H19A 2VRJA 2ZZ1A 1VPYA 1ESWA 1H63A 3O63A 3ICJA 4Y7EA 3MWAA 1A5CA 3BOLA 1OCJA 4MZ1A 1FDZA 3O6AA 5FSEC 1H7RA 3W83A 3DFYA 4TV5A 1G4PA 1JCMP 3SCSA 3VD3A 4HNVA 3KZPA 1E9ZB 3S47A 1YX1A 3O06A 4HHPA 4KT2A 4L4OA 2OCZA 5E70A 4GI6A 4JQ4A 1ZLPA 4RDZA 1LM1A 3I65A 3TJLA 3O05A 4AZ6A 1UA7A 3FVDA 3K4AA 2Y62A 4MZ8A 3RYSA 9XIAA 3NQCA 1T5AA 5A8MA 4PGLA 3HQ1A 3TTQA 1NOUA 5E6ZA 4IPPA 3C2EA 3M41A 1EB3A 3UU0A 2INFA 3H2FA 1BSLA 1RVGA 4PEEA 5A6SA 4UTTA 1PYMA 1E9YB 3ZWTA 1IT0A 2Q3RA 3FHAA 3G24A 1XFCA 1P7TA 3TN6A 5BROA 5IHSA 3F2BA 2FZDA 1BWLA 3R0DA 2DQXA 4ORMA 2VEIA 4E0CA 2WC3A 3MUAA 1IEIA 1P43A 3WDHA 3TWBA 4JNYA 4H00A 3I4EA 4Q8NA 3CHCA 4JL2A 3VC6A 1LOQA 4IMFA 1GJUA 3BAKA 3S0CA 3LY0A 1K8CA 1PCKA 1ZL1A 5IM51 3WQ6A 4LUSB 1W5PA 2CU0A 3C56A 3GYCA 4J3TA 3VA8A 3UXLA 4RUBA 5FEPA 1DWAM 1LOLA 1X38A 2WBGA 4AXKA 4HNTA 4PBEA 2PDKA 1A3XA 1PIGA 5D2WA 1UR9A 4URIA 2QCDA 1XP3A 1JCLA 1XGZA 5C7VA 4AF0B 1ELSA 1OX4A 2HK1A 1UD8A 1RHCA 4LALA 3GUGA 4KFNA 4M1RA 1G7VA 4JX4A 1SJCA 1R46A 1QO5A 3VK5A 2TYSA 1B31A 2I16A 1L8NA 1O5QA 2EG8A 2YBUA 4RL3A 3I6TA 3F4DA 2F9RA 3TSMA 1IWAA 3GC4A 1XYMA 3SADA 1IYXA 4IHCA 1FHVA 3GW0A 1V03A 3QOKA 1XGDA 2OQLA 2Y7GA 2D24A 1PHQA 3R5EA 2HDJA 1V02E 1VRDA 3KBWA 3WY1A 3MO4A 3WBEA 3TQKA 1W31A 2NXIA 4H01A 3BAJA 1H7NA 3N1AA 5I3GA 4N0RA 1CGTA 3GZAA 4QJ4B 2YW4A 4C1NB 1JRBA 4CNSA 3KLLA 2INZA 1TTQA 2J6VA 2QJHA 1W6TA 4JTAA 1QOXA 1IZJA 2E25A 3WIJA 4WKFA 3VGHA 3SAZA 5CLTA 3CYJA 4BQ2A 3F1QA 1P1MA 2HE8A 3L4VA 2VNCA 1E55A 2XH0A 1F61A 2EPLX 2YL8A 1R2SA 1IF2A 4LC6A 4MY1A 1CYGA 5HATA 2CKRA 2G95A 1HGYA 3CAWA 4E6MA 3P84A 2QCHA 4D8AA 1E3ZA 5H1WA 1XLDA 3ITOA 4FR1A 3W7QA 3GXFA 2Q6ZA 1CEOA 1X97A 1MNSA 1KFBA 3RCNA 2HBXA 1GKRA 1RXOB 4X61A 4JTFA 4REQB 5BOEA 1UH2A 3QGAC 4B5WA 3WG6A 5AHFA 3OLEA 3R6IA 1IGWA 2ZWYA 3LV5A 3TN4A 1YKWA 2XDFA 4GD0A 1XISA 3TYAA 4S3JA 5DELA 3SQMA 1M53A 1TTIA 3AIWA 4C6CA 3WJYA 3PG9A 1RCXB 4FSAA 5DRCA 1DORA 2WJFA 4PFMA 3A5FA 1XBVA 4EF9A 5C71A 5HPCA 4D6JA 1XIEA 2AL1A 3NQEA 2BVYA 3EKLA 4YJ5A 4X22A 3VD4A 2G5WA 4IXHA 4HOXA 3UQNA 1TJRA 4DWSD 1G7UA 1OFQA 3QQ0A 1K02A 4H9VA 2B7OA 1BRLB 4Z1YA 1BRLA 5LKYA 1IXPA 2ZYFA 2B81A 3ABOA 4IPLA 1AL8A 4NXSA 3PPHA 4XBJA 3WFLA 5ECUA 4IIDA 3W7HA 4B15A 5HR7A 1WE5A 4R5EA 1B57A 2PU0A 1EJTC 2HS8A 3C0QA 3GAYA 3VX0A 3WLQA 5D2VA 3PF3A 2WZTA 3KDOA 3W1UA 2EHHA 1V3HA 1K7EA 3O8AA 3B0XA 5IOBA 4Q8TA 3AMCA 3M4HA 3AHYA 3UZYA 4LVDA 3WDPP 3HGOA 3IS4A 5LNSA 3BARA 1WCGA 2W27A 3WDIA 2IQDA 4HOZA 3CL7A 3W85A 3HTWA 3S9IA 3EMZA 4RX0A 2FFCA 1US0A 1GK8A 2EJ1A 3L2IA 2GGGA 2RH9A 3U7VA 2GSHA 4IMAA 4MADA 2RFGA 2QQ6A 3GG8A 3PWIA 3CWHA 2WOQA 2G3NA 3WNPA 5K2ZA 2NV2A 3UCQA 4KESA 4I5UA 5FEZA 1FY6A 3KWXA 3P8JA 5GPRA 3W88A 3DFSA 3GX9A 4IGHA 3ZJ8A 1LL4A 2VC5A 3QJAA 3OLDA 1H49A 2R1NA 3QOMA 1ONRA 4UZSA 2OSYA 2V8ZA 4M56A 1QFEA 1ZU8A 2YOCA 2P1FA 2R8WA 3W7RA 1PCWA 3WSUA 4RJEA 3KTXA 4QE4A 3UFYA 4KCTA 4AIOA 4RZ5A 3V36A 1EEXA 6XIAA 1WDQA 4AY7A 2J78A 3WO8A 1AD1A 3HPZA 1Z48A 3TW7A 1EA9C 4GUHA 1O95A 1V8EA 3IIZA 3ABRA 1EX1A 3M47A 2XUCA 3RLGA 5AC4A 4ZO9A 3GG0A 5D2YA 1ZRQA 3KAOA 5I0DA 4K7VA 3HG4A 2OGJA 3LI0A 3LHYA 3QFEA 3IIOA 2ZVIA 4WLCA 4DRSA 1MZHA 3GTNA 3H8AA 1TG7A 2H3BA 2YXOA 1XIBA 3OJGA 4DBDA 1I1WA 4Q6XA 1WOBA 1YLVA 3EMQA 1LQ2A 4WUIA 3EEGA 2WWCA 1JGIA 4WOZA 5BU6A 1ENUA 3P93A 4AEEA 2D3NA 3GHUA 3QY6A 3W1LA 3RR1A 9CGTA 4LAZA 3LM3A 2FPTA 5GJMA 5EL1A 2AL2A 2PDWA 4C5ZA 4DZAA 8RUCA 3WLIA 3A3HA 3IAQA 3TCSA 3EWXA 2BWGA 1OM0A 3VD7A 4P5UA 5FACA 2FKPA 1Y5VA 3RLHA 1OCNA 1DP0A 4NJHA 2XYLA 1HGWA 3MMWA 3U4FA 2BBFA 3MPGA 1JD9A 2VP8A 3S6TA 2AQOA 3LRLA 4PTXA 3USZA 4GH1A 5A8GA 4A29A 4E3VA 2XN0A 1Z7AA 2PTXA 4QJ1A 3ZOAA 4LYRA 4AY8A 5HQLA 4LVGA 4LVFA 3IEBA 5DXXA 1CB2A 1X1OA 3PZVA 1J6PA 4BS0A 1KGWA 1RQHA 2VO5A 3WQVA 3LK6A 4HU8A 3RNDA 3ZSSA 4XZMX 2OGYA 3LQLA 1CGUA 4BKNA 3IIXA 1WXYA 3FGCA 1MWOA 3BSHA 2CNCA 3PBMA 3P5ZA 4H9UA 1XC6A 4ES4A 3NURA 1G4EA 3R11A 3T0DA 3CB3A 3IJ6A 4RDWA 1HNYA 3TJXA 3UNTA 2HPIA 3MTWA 2PRLA 2DY3A 3OIXA 3QZEA 5LNVA 2Z29A 3OZOA 4V28A 1L0PA 2EF9A 2BY1A 3KRBA 2J4GA 5LIUX 1BAGA 4S38A 1R7OA 1JZ7A 4J9JA 3KBVA 1GYNA 4ZOAA 4DZ5A 2E5CA 2VFGA 3SO7A 4UZUA 4LGXA 3GU2A 5D9OA 4M6QA 3VCRA 4EPEC 4GNJA 2ZICA 4UOJA 4ATWA 1QUMA 3NO5A 4E8CA 4ACZA 2BXYA 2E5DA 1VS1A 1B5TA 2PC8A 4F9JA 5HOSA 2Y8UA 4RE4A 3COTA 3TAOA 4GQGA 4WX2A 5A2CA 4DZIA 1MUCA 4JHMA 3T9PA 3OIHA 1E1CA 3LDVA 3WJSA 4CNTA 1GT8A 3VNZA 2ZQ0A 4J3WA 3GR7A 3CL6A 1Z41A 3AS3A 1B90A 1I2PA 3H2AA 2PBGA 3T1GA 1TV7A 3W53A 2YA1A 2VRQA 2E6AA 3IUDA 1S2CA 2OX1A 4RKAA 1XLMA 2YX0A 1HJWA 3TQPA 2C7FA 3WQPA 3RRXA 4L61A 3ITGA 3DKJA 1GQJA 2E7FA 4G8TA 3MS8A 1NIUA 2DUZA 2XIMA 2YJQA 3W76A 3E0VA 2JALA 1OINA 2PDGA 5D9NA 5F2MA 4Q33A 3LM7A 2Z26A 1DIOA 1XH0A 3GNXA 3HQOA 1CECA 1JCTA 2PD9A 3EB4A 1Q5MA 1HF6A 1VBHA 1AW5A 1Z9AA 4K37A 1CXHA 3ECQA 1D9EA 5HMEA 4JTQA 1SSDA 5L6UA 3W74A 3QC3A 1EEPA 4RLIA 4CVUA 4EP8C 3PJXA 3L7RA 1GOIA 3NQMA 4IM4A 4U10A 4JIIX 2IPWA 3CQKA 3ITTA 3CAQA 2X1TA 1OVDA 2QJNA 4MY9A 3FIGA 5C8BB 4LQ1A 3R4IA 1GQKA 4LV4A 2MUCA 1XIJA 3SN1A 3SRDA 2FVMA 2BB0A 1UUQA 4IQLA 3STEA 3PVFA 3VGFA 3CUIA 3POHA 1ISXA 3ORWA 1FWTA 3KL5A 4UMBA 1HP4A 2WKLA 2O4QA 4P7RA 4EAMA 3THQA 4ZL1A 2OELA 3SJ3A 1Z44A 4XZWA 2YL5A 4M1BA 3CC1A 3CL8A 1OK4A 3DBNA 4GE8A 1ADDA 1U5JA 3QEZA 3A22A 2WSQA 4UCGA 1C8XA 4R53A 4PMRA 3PANA 1VBGA 2ALRA 2YR1A 4EF8A 3CUFA 3CB8A 1IV8A 2FZ9A 3Q4DA 3CPUA 2OLHA 3AJXA 1R30A 3N6HA 3L12A 3N9SA 1HKWA 4H7ZA 3ZFHA 1ICQA 4TUFA 4BA0A 1SO4A 1TV4A 1J0IA 1NQ6A 4AY1A 3S9YA 1FCUA 1OJXA 1IWBA 3XISA 3H55A 3G1FA 1UBPC 1XXXA 3HOJA 1IXNA 3C4UA 5EMUA 3M0ZA 2D2GA 4DM1A 3II1A 4Q8QA 3VMOA 4ATDA 2PEVA 2OZ8A 4NJIA 4NZ5A 1LBFA 1XLKA 1T41A 1OK6A 4ROPA 1KTNA 4H6RA 1L6YA 1HG3A 3CPGA 4FIRA 2DH3A 2WPGA 4O54A 4MLJA 4F0KA 4Q4SA 1VQTA 1EP1A 2RGLA 1FUYA 4GFSA 2V9DA 1DJHA 2DPEA 3TSDA 2W9MA 3F4CA 4NVTA 2W5FA 4HCHA 1RK6A 2OKTA 1XQKA 1IWPA 3S4TA 1GW1A 1K7XA 3Q37A 1ZGDA 3W7CA 1ISZA 3CASA 3UG3A 2PRMA 3NSXA 1HL2A 4GC3A 3MSRA 1ZBVA 1H1NA 1UOZA 3TN3A 4DYKA 2YFNA 3AXXA 3Q65A 1PSCA 2EEXA 3KTSA 1AZ2A 1G01A 2NX1A 4FOKA 4DO5A 4W7VA 2QCLA 3GAKA 2FZ8A 2EPHA 5BMXA 3REQB 2OT0A 2PTWA 2J25A 4UFJA 3LU2A 4NASA 4GZEA 4ATLA 3BV4A 2OU4A 3T78A 1OYAA 3CV1A 3MJYA 1UR8A 2BHZA 4LYQA 4PB4A 2EPNA 2XH4A 4FB7A 4L64A 5CPNA 3SCVA 2GUYA 4YCPA 3EX2A 4MWAB 2ZE3A 4N02A 2QCFA 2PLMA 4NQ1A 1SYTA 1DQWA 2X16A 3AIVA 3V5FA 4GYKA 4RZ6A 1AD4A 4NNAA 2CXEA 1KFKA 2B4GA 2OO0A 1AH3A 2PF0A 4QEEA 1OT1A 2IQ0A 3UZ5A 2FHCA 1SW3A 1K1DA 2X09A 5EMYA 1W9DM 4YWIA 4FX7A 1R2TA 4YVPA 4HSNA 1T8QA 2QV4A 1PJ9A 3W6MA 2VENA 1JCXA 3LTSA 4TX8A 3FYYA 1XLGA 3A4XA 1KQYA 1EP3A 3BGJA 4DO6A 2HZGA 2R1PA 1R8LA 5FJTA 2ZZ6A 1TWWA 1FCBA 3H4GA 2XFFA 4O1AA 4IF2A 3W22A 1SUXA 3G3MA 3OHIA 4P2VA 4ORIA 1XSIA 3NQBA 3CS2A 4LS1A 2BVTA 3NL5A 3PR2A 5H91A 1X6UA 1QHOA 4MY8A 3LHWA 1JYXA 4N9DA 5SWUA 1J79A 1UQZA 3TONA 4S3FA 3VOCA 1PKMA 1TZZA 3WJWA 2VR2A 1KNWA 1ZJIA 2FDMA 1RD5A 1G9HA 3RDKA 2NUWA 5E0FA 4W84A 4CN4A 3EKGA 4PUNA 3E9AA 2E5BA 3SDOA 5BXTA 2Y88A 4JN7A 1SZEA 1FFQA 1DJIA 5FAJA 3UXAA 1QK0A 1TPDA 3U2OA 5DEZA 4F8XA 3H22A 3ITLA 2NQ9A 2VEKA 4GINA 2A4AA 1WDPA 5A1AA 1D2KA 3VUPA 3LXBA 2FMOA 4PBFA 4D8LA 1OG0A 4CQ8A 3W0KA 4DAIA 4NYUA 1OC6A 3APYA 5CCZA 4D6CA 2RJHA 5CC6A 1W3IA 3KS6A 2GSJA 5FD0A 4XAYA 1MRAA 4CEXC 2PP0A 4FEZA 3W7GA 4XG1A 4D6GA 3W81A 1U5VA 4E8GA 5CG0A 2OLAA 1YMYA 1PVNA 5A2AA 3CNYA 3DHDA 3O16A 4KWSA 4CCZA 3AZRA 1UZ4A 4MFDA 4MTVA 4PTNA 2E8YA 4LX4A 2J74A 1EZ2A 4BF5A 3GXTA 5TF0A 3KRSA 2ZUVA 1SO5A 1TWDA 4CQ9A 2IKJA 5KITA 1RPKA 4A21A 3BOXA 2BXVA 2GQ9A 3FJ4A 3WDRA 2XSAA 4XX6A 2Q8LA 2GJRA 2VC9A 3ONCA 4LU0A 3S2CA 5JIWA 4UMAA 4HYRA 4P7QA 2X2GA 1XRTA 8XIAA 1H0GA 1B3XA 2HRWA 3SSJA 2NT1A 4D6HA 3P8IA 3FXGA 1XIFA 2XWDA 5REQB 1EBGA 2GFTA 3KHJA 4WSKA 5F1VA 4U28A 2C19A 4B91A 1Q2RA 1XLAA 2VX5A 4DPQA 3V3WA 1TUXA 1DL3A 2DZTA 3N34A 3UGRA 4UWMA 3SI9A 3SZ8A 3WBXA 2E1WA 4UNKA 3TVAA 2R82A 4XVEA 3VIFA 4C6PA 4JL1A 5AYBA 1GKPA 4HHHA 2OB3A 1DJNA 2AGTA 4Z1BA 4AFYA 4JFTA 1NELA 1WV2A 4AYGA 4I6KA 1JJKA 3EOLA 5AY7A 3K1GA 2HNHA 1UR1A 1GVEA 1C7SA 2PURA 1H7PA 4WSHA 2PAJA 4PMXA 4JIRA 1GWJA 2VZSA 1LORA 4NU7A 3AIRA 1AVAA 3VCCA 3O7UA 3KOFA 2DIJA 1M7XA 4NT0A 3W1RA 3BLDA 4KBXA 5AHEA 4JHOA 3CQJA 1H61A 2CIPA 1FXPA 1TE1A 5DQPA 4QROA 3M44A 2WC7A 1K4GA 1BEUA 4Z42C 4S3AA 2YSWA 4HZ8A 2PLKA 5KETA 1W1TA 4RW3A 4H2CA 2O9TA 4AZGA 3MDUA 4HU4A 1XBYA 2V81A 5CBBA 4QDWA 1XIDA 4QG8A 4X0VA 4IIGA 4YWSA 3EPMA 4QE5A 1TCDA 3WQDA 3GFYA 2D2OA 2BS9A 5I7GA 1S2AA 3H7UA 4C90A 4FZIA 3M0YA 4ML4A 3HF3A 1OB0A 1S5TA 4WQ6A 5FKYA 4PRTA 3TA9A 1R3SA 1GEHA 1YRRA 2W61A 4B2DD 5KINA 1V0NA 3BG9A 3NDZA 4GOAA 3ZJ6A 3NQ2A 1ZENA 4ZODA 2CBJA 3BJTA 2WW5A 3QSRA 3FA4A 2HMCA 4B2DA 1KWGA 1PDZA 4XSLA 4WDWA 3DAQA 1NARA 1Q6DA 2J8FA 5AYYA 3GNOA 1J0KA 4YTTA 2AOSA 5FJRA 4D71A 1BYAA 4YPJA 1OZQA 2V6AA 2Q01A 3TCEA 2WNWA 3SY1A 2PUZA 1Z42A 3EA1A 1ISVA 2BASA 3UT0A 3W2UA 2FJKA 4CQCA 1OFOA 3QZAA 2ATSA 4PCPA 3GU1A 4AD3A 3AWOA 2ZXBA 4N4PA 1NWSA 1BYCA 1ICPA 1Q85A 5CGMA 4MB3A 3KL0A 3C2FA 4X2RA 1HJQA 1D3CA 1REQA 5HK4A 3HGSA 2BZNA 1B4KA 4LWWA 1UPMB 2I57A 4FMVA 2WVSA 2E6YA 4HNCA 1TE6A 1JZ4A 5I77A 5CQ1A 2C71A 4GWEA 1H2JA 3IARA 4TOQA 2DT0A 3GH4A 1B3OA 2E1DA 4XD3A 4E4PA 1TSIA 4O14A 4X63A 5HINA 2FZMA 1XWYA 1FHDA 2ALDA 1S39A 2WK2A 1CNVA 4MM1A 4JEQA 4B92A 2ZX7A 3MJMA 4H2HA 3ZMRA 1C93A 3WQ5A 4IG2A 4FLOA 1E9LA 4MAVA 2A21A 3UF9A 4LJ3A 1PYFA 3QY8A 2D0GA 2C6QA 2E3ZA 4W7WA 3STFA 1HFBA 3MV11 4J3UA 2O56A 1W9UA 4MPQA 1C8YA 4DWDA 3KS5A 5CPQA 3MC5A 4Q4RA 2EBNA 1GHRA 1QI5A 1IEWA 4S3CA 2QW5A 3SUWA 3NZRA 2JKPA 3LPFA 5CSYA 4L6HA 3G8EA 1AZ1A 3NQDA 4J3SA 2PDUA 4UMCA 2CWXA 2ISWA 4LFYA 1GQLA 5JBFA 5IRPA 3QPZA 2ZDRA 4IMEA 3B9AA 4RXGA 3WD0A 5CGQA 3E49A 4LW7A 3G18A 1YPFA 3HV8A 3TNBA 4XD4A 3E0IA 2DVXA 2DZAA 4OE7A 1X7IA 2OWXA 1KBLA 3UJSA 2G3FA 3LHUA 3FGCB 3AMLA 3WF2A 2UV8G 1WKEA 2C3ZA 2PDBA 3QR1A 1VFUA 4KETA 3TMQA 4GUGA 4UR8A 4NILA 1V6UA 4CKQA 1KBIA 5CC5A 5I3JA 3GB6A 2ZX8A 2V5BA 3M5YA 3E12A 3SRKA 5AHLA 5GVJA 3PNZA 3RITA 4AMAA 3MBDA 4CLMA 3L67A 4CCEA 1RY0A 4F4RA 2EPKX 2FYMA 3S8HA 2NQZA 4X3ZA 4XKMA 1JL8A 3CHEA 4US5D 3FSUA 3ZZ1A 3QYSA 5EGRA 2FHBA 4DBSA 1GNXA 4UFHA 5BXPA 1FP8A 3DFPA 1FKXA 3ITVA 2POTA 2XHYA 4ZTYA 1Q45A 3W29A 1RAKA 4QIUA 4A6GA 4GVGA 2VGBA 2O9OA 2PE4A 3K13A 4NZFA 1SQ7A 3ARUA 2EKCA 5HJXA 3SCWA 2BVWA 4INFA 3AS1A 4RDVA 4GMEA 3H7RA 2CYGA 5HQMA 1BWVA 3EKZA 2J7CA 1ME7A 2I9EA 1OHLA 3CEUA 1XG3A 1R86A 1ISWA 1I9CB 2HVMA 4H6EA 3F03K 1W0MA 4MKSA 1QO2A 2E40A 3MUY1 1K6WA 4HCLA 3T7VA 3VO0A 3PUDA 3DGRA 4U31A 2YCKX 4IFKA 1E4NA 4AISA 4DPPA 3S5ZA 5H8MA 4OKDA 4AVNA 2D22A 2VR5A 1E1CB 4ZO6A 4U3AA 3BLOA 3XINA 1FWFC 4LS0A 3IGHX 1NY1A 1TWIA 2WHJA 3VFCA 3CUXA 3NTYA 3K30A 3WCZA 3LXCA 4ZEPA 1A4LA 4J4KA 2O9PA 1WBHA 9RUBA 1TR9A 4IISA 1RQBA 2VHLA 1LYXA 2X1UA 4C6FA 1UASA 5JBDA 1K77A 1FH7A 4QAWA 5GNYA 3MP3A 1X98A 2QIIA 1RUSA 1J4EA 2DSKA 4U5KA 3NL6A 4AZIA 3HN3A 4N6FA 2JF7A 3O3RA 4NI3A 1T6MA 2WKGA 5D2XA 2XIIA 5HR6A 3ALFA 4XO7A 2BLEA 3ONBA 1AJ2A 3KBSA 2W63A 3C61A 1WAWA 5AC8A 4XD6A 1JI1A 3QQ1A 3P67A 2IXUA 1TWSA 3GTHA 1PBGA 1FWNA 2VDIA 4WJEA 3TLQA 5G1MA 2BGNE 3IVSA 4OUEA 3W84A 2C79A 3HQPA 4ZZ9A 4H9ZA 1V3KA 4DWSA 1F3WA 4CUCA 1H11A 3DERA 1TMHA 3FNDA 2VWTA 4EXAA 2Z28A 5DBTA 1XPGA 1UD6A 1C8VA 1B3VA 4AC1X 1Z89A 4UQBA 3EWYA 4HT3A 3N12A 1CGWA 3PSVA 2VZTA 3CBWA 2V5KA 2RHGA 4PL1A 3W86A 5AC7A 3GIQA 5EBUA 1WNOA 4J40A 1W1YA 1C9WA 1ZJBA 1V79A 1VD6A 5FL0A 4AVOA 4GH3A 4GQ0A 1AH4A 1E4IA 4Z1DA 3GNRA 3TXVA 3R25A 3CT2A 3C52A 7ODCA 3GDLA 2PGWA 4IH3A 1WXJA 1O1HA 5FESA 4NYYA 1DIEA 4HQVA 1I4NA 3H70A 2VZUA 1VFMA 2XZ7A 1MMFA 1F76A 3TC6A 4RE3A 5F4XA 2EJAA 2DUAA 3A23A 3UY8A 4PMUA 1KTCA 5F2GA 2R94A 3A4WA 5FF4A 1E5JA 3U5UA 1A3WA 3WQEA 1ZBKA 1EJ7L 3WUBA 3ZR6A 3ES7A 3B97A 3K1DA 3ARRA 3SSZA 5HA7A 5FJJA 1PZ2A 3WEOA 2CHNA 4LUTA 1V7YA 1A5KC 3CUHA 3UESA 1IT8A 2AKZA 2VCCA 4B16A 4R27A 5M03A 3M0LA 2OZ0A 3VNKA 5CZSA 3FA5A 4LOCA 1M7PA 4PUMA 4DLMA 2AAMA 1CGVA 4C7FA 1FP9A 4QCEA 1FWBC 3AZTA 4NZ3A 1XL9A 3WL1A 4CEUC 3KDNA 3V5OA 1H62A 1O7AA 3NYDA 3GVVA 3BAWA 3OP2A 4Q8WA 1TV3A 4M3PA 1GVFA 3SQLA 3NO3A 1Q8JA 1I2RA 3LPOA 1LQ0A 4W9TA 1S5NA 3WF1A 4JDBA 1RY8A 1U1HA 3PUGA 4NRRA 1XLBA 2Y0FA 3TTSA 4DAFA 4Q6JA 4AZ5A 5FF2A 1G0CA 3GDMA 2AMXA 4JTSA 3N4EA 3NPVA 3BK0A 3EOOA 2YPIA 2ZBTA 1UKTA 2ZA3A 3U57A 3QMRA 4RZBA 1UCWA 3KVJA 4CQDA 1R87A 4C6DA 4QNEA 4HK7A 1E3XA 4UR9A 4A8NA 3PTQA 1B9BA 3TFCA 4NAEB 1KWKA 2WAGA 3TN5A 2WPBA 5CBJA 3F5LA 4D6FA 1XLCA 4QEHA 4DO7A 1MEHA 4UTIA 5REQA 3THUA 3WF3A 3HFYA 1KCKA 2GDVA 2PDIA 2HXTA 3W7NA 5BXSA 3TW6A 1SPQA 1PL9A 1H5YA 2EPMX 1EZWA 2FB2A 2YBVA 4DO4A 1HKMA 2ATMA 3QMTA 1GPWA 3DHUA 4JTIA 2NQJA 4D2JA 3PZGA 2C15A 2CW6A 3WLTA 3LV6A 3BGAA 4HU0A 4GVFA 4DN1A 4LUJA 2HE5A 5EMLA 1J93A 1NJJA 1V6XA 4W86A 1MVYA 4UUIA 2J66A 2MANA 1Q6CA 4BI6A 3M0JA 1KM0A 4JD4A 3KOZA 4M6VA 4N9BA 4QG6A 1HO4A 2WNQA 5DXYA 3GRIA 2REQB 3DYPA 1A47A 1J10A 4K6AA 4EIVA 4LF2A 3U2EA 1QATA 1KKOA 4GPNA 4MZYA 2PSNA 1XG4A 3T2PA 3B40A 1FWAC 2J7EA 1CI1A 3IK2A 4PSRA 4ZQMA 1UWAA 5G2WA 3AU6A 3DENA 4GC4A 1GJPA 3W73A 1UWTA 1XH1A 4K38A 1VBJA 1PZ1A 2DORA 4G7FA 3TE9A 4ZXOA 1RJPA 1RSCA 2BFGA 1DHKA 2Y1HA 1XCWA 3G0UA 3BXWA 3W7MA 4ADTA 3P60A 3GM8A 4L4MA 4TXEA 4Q7IA 2GUBA 1K70A 2YFOA 3UCDA 2ZKMX 3OW1A 1PIFA 5XINA 1Q6RA 1W3KA 2CHRA 4KRUA 3ZLFA 2WCGA 3M5ZA 2WO5A 3DG3A 2XVPA 3RU6A 1BTCA 2XN2A 1QBBA 1YNQA 2GJXB 5HMSA 3IV3A 3L21A 3EDKA 3EX6A 3WENA 2A5HA 4J35A 1Y8BA 1GZ1A 5JVLA 4UQAA 1TUFA 4DJEC 2ISFA 2C0HA 2CLIA 4NKCA 3QKZA 4WR3A 3S1GA 4D6EA 3LG3A 4MGGA 1ZPTA 1ZJAA 3B9EA 1W17A 4DY1A 4KS0A 3WNOA 2QR6A 1D3HA 4U2YA 5CJ5A 4F9DA 1KBBA 1XR2A 4KCWA 4CD8A 1PZ0A 4F66A 5DT7A 1TFVA 5K9XA 3SR7A 3OODA 3WEZA 4HSHA 5CAHA 2NSXA 3HURA 3VNDA 3T4CA 1XLHA 1RJQA 2F2KA 4A8RA 2CZVA 5I78A 4YXGA 3UWUA 2BXZA 3M6YA 3EWBX 1FKWA 4MUPA 3UJ2A 2CBIA 4AIBA 3UZZA 3CV2A 1SR9A 4EPBC 2W66A 2F7FA 4XB3A 2ZVRA 4DEFA 1CBGA 1U1UA 4EVZA 3S1VA 1XQLA 3G1AA 2CLKA 3CM4A 1JAKA 1TR1A 3QTGA 2Y70A 1R2RA 3UA3A 1R6WA 2X2YA 2CPUA 2PDJA 3B0UX 3GHRA 2YZRA 3CIVA 2E28A 2AAAA 1YNYA 3WH5A 4F0MA 1PKLA 4TTGA 3QV8A 1DWFM 2Y2WA 1YE6A 4ZE4A 2FTWA 3SCUA 1WDRA 2YLAA 3VGGA 3P82A 1EGZA 4H6QA 4IOTA 2PTDA 1JZ8A 3D46A 4B5SA 1S3HA 2ZA1A 3QPYA 2TPSA 1GOOA 1R47A 3ES8A 1JGMA 4E2BA 3CMJA 5G1YA 4US6A 2ZUTA 1W3NA 2ZZ2A 2VD8A 1JYNA 1RA5A 1WAUA 1X7FA 1V4YA 3PZ9A 3WBWA 3AIEA 4I90A 3VIGA 1IIGA 2PMQA 1F6KA 1SJDA 2G3MA 4U5IA 3GNPA 3DXIA 5C9RA 4PUKA 2V3FA 4R9OA 4G1KA 1QNVA 4TMCA 3MSDA 3SIMA 1C8QA 3OGRA 3TOPA 1QNSA 2TRSA 1VGAA 3FA3A 2GQAA 1BHGA 5CLWA 4P8UA 1H60A 3WEMA 2P88A 4B5NA 5EFFA 4LBSA 2W67A 1XIMA 3LZ5A 2ZXDA 1KFLA 3H6OA 1NOFA 1ZHAA 3BJSA 4QDPA 1S46A 1ADSA 1GOXA 3F2CA 1SSGA 4Q8UA 3WH9A 3T8QA 4IQJA 4ECLA 3W00A 4GIAA 5HULA 4M7TA 3RX2A 3M5VA 2DIKA 4HN4A 3ME3A 3SEPA 1NP0A 4Z2GA 3PBVA 5GQBA 1TVPA 1OD8A 4Z2LA 4G9PA 1WYIA 2G97A 3ZO9A 4PN2A 2B7NA 3GVWA 4LH8A 4C6EA 2NLYA 1C3FA 4H41A 1XRFA 5C70A 6REQA 2J7FA 4LB3A 3GTXA 4FNUA 2V68A 2CERA 2P0IA 3S2LA 3O1NA 1UG6A 3QF0A 3FW6A 4HNLA 2Z7GA 3DDMA 1ODUA 3VC5A 3NOEA 4QR6A 4HMNA 3SUSA 1GVQA 3T42A 5ABTA 3AU2A 2WJZA 4DB7A 2XVKA 3N4FA 2H6RA 4H8UA 4D1JA 3NA8A 4WY0A 1Q13A 2CLEA 2JK2A 1KM4A 4KWOA 4QXIA 1V6WA 4KGJA 3VIOA 4OWGA 1HVQA 3L66A 3S6OA 3FY1A 4PMOA 3FOKA 5LA1A 1YEYA 2VX6A 4HTYA 2Y24A 5CJNA 2CEQA 3QM3A 1DBTA 2DSZA 3VU2A 2GDUA 5MHBA 3ZQ9A 8A3HA 2X42A 1M7JA 2J47A 2GQ8A 1ISYA 2ZTJA 4GXWA 4K36A 5AZ0A 3EA2A 3DI0A 3ARSA 1QRQA 2KAUC 2X7VA 2YBTA 3HPXA 3KBJA 4RK8A 1EOKA 2Z6IA 3SB0A 2QCCA 2WVVA 4R7OA 3FAXA 4N9EA 4JFVA 4QCFA 1UR2A 1OIMA 4B5UA 1ALDA 1PPIA 5DN1A 1YNPA 5DT5A 2XSXA 2G41A 3L9CA 1DTUA 1UKPA 4O18A 3NZQA 3VGDA 4G7EB 2P0OA 1REQB 4XTIA 1TV8A 3GD6A 4HA4A 3L4WA 3UA4A 2GGEA 4CD4A 1WXZA 4X60A 3SUVA 1EBHA 4L9XA 2Z2UA 1H1YA 4JIEA 4OOZA 2V63A 1E4MM 1VIWA 4XKYB 2PDLA 4I5RA 3OGVA 4O1DA 4JY8A 1XD0A 4UFKA 3HB9A 4P8XA 3UPMA 2CESA 4O8AA 1CZ1A 1A4MA 4NNCA 3PP7A 4AX6A 2ZFAA 1M7OA 1ECEA 2IKHA 2CLMA 2XFWA 1WUEA 3CAVA 3PZQA 4LCQA 2YLLA 4LT9A 5T91A 1EO5A 3O0FA 4OHQA 2W4XA 3WQGA 3P2VA 2W3ZA 1E43A 3NO1A 1GEQA 1K8YA 2DVTA 1QASA 5E93A 2HJPA 1RR2A 3STCA 2GJLA 3R1ZA 2X05A 1TA3B 1DTNA 4NJJA 1NTHA 4UTMA 3T0AA 1KCZA 2RKXA 4FLQA 4KEVA 1FDYA 3GDBA 4KWUA 3T0CA 3W7EA 5DX7A 2OZ3A 3GZ3A 3N18A 3UGVA 2OJPA 2WB5A 1Z8AA 3UD6A 3BPWA 5CC7A 2Y61A 1W1A1 5DCDA 3TC7A 3BAXA 3H53A 5CPOA 3AYVA 2X0HA 1OZMA 2KX9A 3VDAA 3H4XA 3BL3A 3H2EA 1POJA 1WZAA 1I75A 2E4TA 3B04A 5C7HA 4MIMA 3NDOA 1ZSXA 1VRXA 3V1HA 3VZXA 4GYJA 1GKQA 2E8ZA 3WJXA 2YCJA 4H8NA 2EG7A 3AISA 3I7QA 4C6NA 3T08A 1I45A 3N17A 4JKMA 2DZPA 4W8BA 1E4LA 3IACA 4RZ4A 3NGJA 4PMZA 3DX5A 3SCQA 3TLLA 3MB9A 4C7DA 2XM2A 1OX5A 4P8VA 2UY4A 1QK2A 3WLKX 2JQXA 1JF6A 3S1UA 3H21A 2BGQA 2GYIA 2PWFA 4QX4A 4DXKA 5AKQA 3SCPA 2E6FA 3AROA 5DRIA 5F7UA 2H90A 3UZXA 2J8GA 4FPSA 4K68A 3UNDA 3OBEA 3GG7A 3EDDA 4LTSA 4JTLA 2PLCA 3EBVA 4LANA 2MNRA 3PZNA 5AHMA 1B9ZA 3N25A 1OX6A 3DYMA 3LSBA 2DQWA 3VOGA 4LNCA 1I2NA 2ACRA 4I5XA 3WD3A 3G22A 2POZA 1AH0A 1QOQA 3WDJA 4JIPA 1EIXA 3URAA 3NXFA 5CSSA 1Q6OA 4XZ9A 2HK0A 1E6NA 3RM8A 1CXFA 2AQVA 5CAKA 1M68A 4MSSA 3V0UA 4JIQA 4O1CA 3MKCA 1QPKA 3AALA 1LOSA 3QV6A 1YADA 5D09A 2WVTA 2QCDB 3CWOX 1DJWA 2DUXA 4F0LA 4RE0A 1DPMA 2UY3A 2I14A 4XVDA 1S1RA 2VI0A 5E5CA 1NAL1 2HVNA 1E6SM 1QXLA 1GQNA 3P5YA 4EX4A 3LS9A 5U7SA 3QV7A 3SCRA 2W92A 4J3VA 1RALA 4AD2A 2PZ0A 3ANVA 3CAKA 3EWDA 3FAWA 3Q94A 4US5A 4XK2A 1TPB1 5DLCA 4PUEA 4TX6A 3ENLA 2VX7A 3MCNA 1YDNA 1ZALA 5EKYA 4MB1A 1RVKA 3IRSA 5CZJA 4MB5A 1T96A 3CZLA 4KCUA 4RR4A 1BPLB 4Q32A 5DF0A 2FPYA 1LTDA 4JAWA 4PULA 5A5WA 5LNWA 2A7RA 4LF1A 4QQUA 3ZM8A 3W4RA 3U7BA 3CV7A 2QDGA 4B9ZA 5DMLA 1NEYA 1TCMA 2HSAA 5B80A 5BZAA 4Y8FA 3S5SA 3C0JA 2OG9A 5FF7A 4GY7A 2QUNA 1ITCA 1VHNA 2Z24A 5IBXC 4U3CA 1ZQ5A 4XUGA 3WLHA 4V2XA 1HP5A 4QS5A 4C6QA 4HPGA 2WNZA 4MPKA 3DFNA 3VKBA 4MKNA 1W3HA 3U3HA 3ITXA 1L9WA 3HA1A 1FWDC 4DZHA 3DBPA 3WNLA 1TIMA 3W01A 1YTKA 2BY2A 4Y9NA 3OVPA 4M19A 3GVQA 1TTPA 4DI8A 4E3TA 1KV8A 1XIGA 4I8DA 4I9MA 3E2VA 1EX5A 2VYOA 1BXCA 3JZUA 5HWNA 1UHVA 1VJZA 3I10A 1XV8A 3LCIA 1TQJA 2P76A 3VKCA 4ZQOA 3VYLA 4IQEA 1KBJA 3WNMA 1XX1A 1VYSX 3A3XA 1B3ZA 2HS6A 1DWJM 4GYFA 4YLWA 1KBKA 4KCVA 5C2XA 2QUUA 3RFAA 2VD9A 5LNRA 3ITCA 1B3WA 4AUBA 5A8OA 3EEZA 2YZ5A 3M0MA 3NEHA 1YBQA 5HPOA 4JQ1A 3PAJA 5J5DA 5AECA 2GK1B 2GZXA 3AIBA 1VENA 3EDFA 2D0FA 3PJWA 4AWUA 4BQ4A 1A49A 2E77A 4MWAE 3NEVA 2BHYA 3UG5A 2HV5A 1MDRA 3M0HA 3ZT6A 5CGTA 3C3NA 2G3JA 4WOQA 3WK1A 2ISVA 1DYSA 1NH6A 1JQVA 3AUOA 3CZJA 3GIPA 4BR1A 4ZOBA 3KEHA 3G77A 1TKKA 1UQYA 2XIBA 2OQHA 4JEJA 3PZUA 3USBA 3L0KA 2JGQA 1RBAA 3RMEA 1R9YA 4MF4A 4XTDA 2DH2A 3LHVA 3MMTA 3GKAA 1AQMA 3HJZA 3S2JA 2V2CA 3IUHA 2ZRYA 3SGZA 1LT7A 1UWUA 1UH4A 3W7KA 4MNMA 1F6YA 3EXRA 1W32A 1A80A 4GKTA 3VMPA 1VJIA 3VIHA 4W5UA 5KZDA 4ML9A 2QCEA 1FHUA 3ARTA 3GK0A 5EU9A 5C55A 3TW9A 1A5OC 4Y2WA 1Q6LA 3U4AA 3AMKA 3WJZA 3MHUA 1JULA 3URBA 1P4CA 3EX4A 4G6CA 1X1ZA 3C2YA 3TUUA 2VGIA 3LN3A 4Q8PA 3G1RA 3PPGA 1AODA 1GORA 2X0YA 4D6DA 1OT2A 3DHPA 4N6EA 5H2ZA 2ZADA 4XZBA 3UWVA 2VFHA 5GJNA 3LEPA 2ZDSA 5G2IA 4EAYA 3I3DA 4L4PA 1SW7A 3GDTA 3TTOA 2XJ7A 1UKOA 3CLWA 4AHQA 3RPMA 4WY0B 4K3ZA 3SRFA 1PTGA 3K4WA 3MP4A 1N82A 3P74A 3W2NA 4GK8A 2VR4A 3B8TA 4CVWA 3OVGA 3EWWA 2IKGA 3DH7A 3LCHA 3VGBA 3V7PA 4NZJA 1E0TA 1LQAA 3HPFA 3S5OA 4LSBA 3BW2A 1I2QA 1YPIA 4ZB5A 2QS8A 1XYLA 1UOKA 5G4EA 3O6YX 4HZ6A 3W2MA 3G6MA 3AYTA 1IGSA 5A6MA 2GL5A 4GJ1A 4P8WA 4C5YA 2ODOA 4NAFA 3HIJA 1VZWA 2F61A 1HL9A 3R58A 4OVXA 1D8WA 2F6UA 2ZA2A 4PE8A 2HEJA 3IJ8A 1AQFA 3UZWA 2VT0A 3TIMA 3G0SA 3L4YA 5DCBA 3RU8X 2IPJA 2DW6A 3SQSA 2OEKA 4GY0A 1J5SA 4AWSA 5LZLA 3N9RA 3EX3A 3Q45A 4JCLA 1DEDA 5JH2A 4S3GA 2JFEX 4IP7A 3E0FA 1YXDA 3AOFA 5ABGA 2VXNA 3TK7A 4DBUA 4IPJA 1M41A 2IS7A 1A3HA 3WQ4A 1TJPA 3EDJA 1XYCA 3IJ9A 1O4UA 1C90A 3SN0A 1NU5A 2WM1A 4HSOA 2FGBA 5KSWA 4Z08A 3UEQA 3KL3A 4JCMA 4UTTC 1DXFA 3MMUA 4AMCA 3FLUA 3AWNA 2QULA 1NWRA 3NG3A 3TYCA 2PDFA 3WLJA 4GCXA 3EXSA 4CD5A 1G94A 3AXIA 6XIMA 1UR4A 3C0SA 1PTDA 1RH9A 1TVLA 1J2WA 4UQ9A 4O50A 2ZZ4A 4BQ3A 4C6IA 1EO7A 4CU7A 4XAFA 3P0XA 7REQA 3B03A 3WD2A 7CGTA 4ZVJA 3PPFA 1GUVA 5KTLA 3LXAA 3DZ1A 4HJFA 3UERA 2X1SA 3FYPA 2BX7A 1AQHA 3H12A 3RM9A 2BHUA 4H8VA 5MKGB 2ANUA 2XWEA 1CIUA 1YTEA 3A9BA 4BF9A 2D2JA 4NHVA 3B4UA 1VFSA 4U4MA 3WQWA 5HNNA 1U2YA 4H04A 1G1YA 4M0XA 3T05A 3NUKA 2Z6JA 3HM7A 3S2NA 3BQ5A 5M3WA 1H5VA 3FJNA 3PWAA 4V15A 2IKIA 1UWSA 1Q4WA 2Z4GA 4O1FA 2TSYA 4EACA 3N73A 2OO6A 3GDRA 2PWDA 4C65A 2ZE0A 3E6EA 5KZEA 1PX4A 4YTSA 1EQCA 4PUDA 1QW9A 1NFPA 4NAFB 5B7ZA 1VF8A 4AHPA 5DY2A 3RMJA 1SFJA 4Z0JA 3AYRA 4XBKA 2ONEA 1UWRA 2DSWA 2DJLA 3PFMA 3PZTA 2AQWA 2FIQA 1TWZA 1XYAA 4ADUA 3WDQA 2OQYA 2PTYA 2GOUA 5EB8A 5E9AA 2YL6A 3AHVA 1Q66A 1J96A 3DG7A 1HN1A 3K46A 1ZB5A 4DYEA 2EQDA 3EWUA 3IK4A 4A05A 2WCAA 2PODA 2VOTA 3L4UA 2C0AA 2V5DA 3W2JA 2GGHA 5EBAA 2WC4A 2YDAA 2PRHA 4Y96A 5T9CE 2NUYA 3VKJA 4JQ3A 1KCXA 5GNZA 3LHTA 4AZBA 2VGGA 3N4AA 3T2OA 3TQVA 2UWFA 1OABA 4IT1A 1LWIA 1CXKA 4QISA 1SR0A 4Q7NA 4I6VA 1TPEA 5IHRA 2ZUWA 2E9MA 3VNJA 1VPQA 3PNUA 2PC4A 4I7VA 4HNUA 1JYWA 1GOKA 2EGZA 3LNMA 4GQQA 4PB5A 3G8RA 2DT2A 1Q7QA 3G1SA 1EUAA 4A2SA 1KXQA 4ZB0A 1BYDA 4LUYA 3THAA 4ZQNA 4RCXA 1P7TB 5JBEA 1RZMA 3UCCA 1DVJA 1WDSA 2OWCA 4H9XA 3IV8A 3WMSA 3CIWA 4ICCX 4AD4A 4FIQA 4H6KA 3M43A 3TJIA 3FN9A 3WNKA 1H3GA 4CU8A 3W7DA 4DNMA 2A6LA 3MY9A 2DIEA 3PM6A 5EA9A 2FGLA 2Z0IA 3WN6A 1EHNA 4A2RA 4L6OA 3EGJA 3TYEA 3OG3A 3TJ4A 3GHTA 3UR2A 2OVLA 4ZQCA 4E4FA 4NI8A 2X1IA 3EDEA 4HK5A 1GOMA 4ENLA 5XIAA 1JDCA 1XD1A 1XJBA 3C2VA 4FXFA 4JTUA 2BG5A 2WVUA 1PE1A 2QMJA 2BOEX 2Y7FA 1R3RA 5DO8A 3MCMA 5I02A 1J0JA 3R7MA 3LQGA 1TJ1A 3T6CA 2DZUA 2X40A 3W75A 1P6CA 2VDHA 2R14A 1RD6A 1Q8AA 1BQGA 1QPOA 2X8RA 1XSJA 4GY1A 3H26A 1BF2A 3BAIA 5I5RA 1O5XA 4NZ4A 4LEQA 1UYQA 5A2BA 5C5YA 1XCXA 3CZKA 3BWWA 3OPSA 2FDSA 1F74A 1WOAA 4A8LA 3VM5A 4P7OA 4ZENA 3CHVA 4DX3A 1Q7ZA 5BRPA 2QYGA 3W7LA 3NM3A 2OODA 3LCGA 5F1UA 1M9HA 4TVCA 1ZP3A 4JYFA 3D0CA 5HNUA 1E6QM 4JGDA 4AIUA 3GU9A 4MYAA 1UKSA 1BF6A 1JPIA 1UJPA 1KB3A 4QTGA 2NZLA 3FFSA 3SUUA 4BEQA 1V08A 5CEWA 3PG8A 1NFGA 3N2TA 1QDSA 3FYOA 3AZSA 3BURA 4FXJA 3RIKA 2ISSA 4GBUA 2NQ5A 5E09A 2QDDA 5LXEA 3M16A 1QBAA 2F6KA 4H83A 3B8VA 3BANA 2ACQA 2V5JA 4UFMA 1TPC1 1OGSA 5CJMA 1V6VA 3LI1A 2ZRVA 3C2RA 3YPIA 3GXIA 1JZ2A 1P0KA 3T4WA 2V2DA 1S2VA 1XLEA 4JZ5A 4UNIA 4B5TA 3L4ZA 3IUIA 1RA0A 4WGXA 1OEPA 3O0KA 4IGMA 1A5AA 3ZT5A 3VZZA 4F40A 1IR1A 1QHZA 3PWGA 4WJ8A 1F9CA 1KD0A 3ITYA 1ZNNA 2DU2A 5ECVA 2WJEA 1FH8A 3CLMA 2OOGA 3TH6A 5B7YA 4GX9A 1LCOA 2XIOA 4S2CA 1W56A 4AC7C 3A24A 1CDGA 3T0BA 3POCA 1M03A 1W9XA 3EYPA 4LBUA 2VFIA 3WK2A 1JDEA 2BODX 1EWEA 2I5IA 3QW3A 3F5KA 5D02A 2ZRZA 3OZMA 2G4JA 1JDDA 3JVAA 2O7QA 5I3IA 5H6HA 2GGJA 2Z1WA 3LGEA 4IX0A 1XFBA 1DHPA 2YCLB 4NG3A 1J12A 4ONVA 4LYPA 4JHZA 4DJFD 4B90A 1UW9A 1QI4A 3W71A 3QLLA 4JTRA 3ABQA 1VFFA 2PI6A 3GO2A 4XZIA 1EF2A