3GVQA

Urod single-chain dimer
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
356
Chain Sequence
b'FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen decarboxylase
publication title Substrate shuttling between active sites of uroporphyrinogen decarboxylase is not required to generate coproporphyrinogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 120
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gvqA00
3BQ6A 4AY7A 2Q6ZA 3PPCA 4ZR8A 4WSHA 1U1UA 3L7RA 3T0CA 4AY8A 3PPHA 1R3VA 4L61A 4L6HA 1JPKA 1U22A 3GW0A 3GVQA 4L5ZA 2NQ5A 3GVRA 4L65A 3GW3A 3RPDA 1U1HA 4ZTXA 1XPGA 1JPIA 2Q71A 1J93A 1R3YA 1R3RA 3GVWA 3BQ5A 4L6OA 1YPXA 2INFA 1T7LA 3CYVA 3PPGA 3PPFA 4QQUA 1XR2A 1R3WA 1XDJA 1UROA 1JPHA 4L64A 3GVVA 4ZTYA 1R3TA 2EJAA 1U1JA 4EXQA 1R3QA 1R3SA
chains in the Genus database with same CATH superfamily
2VOMA 1IEWA 3VCRA 4U2ZA 5CBBA 3A5VA 2VL4A 2HPMA 4ZGYA 4AD3A 2YBVA 2TSYA 1M03A 3HZ3A 4HMNA 3EKGA 4GIRA 3O7UA 3QFEA 4FO4A 1IZKA 4IISA 4LVGA 3WCZA 1YXYA 2VC5A 1V6XA 3BZGA 2QJHA 2Z25A 3WUEA 1FDYA 4N9EA 4KIEA 3MVTA 3PBVA 4GWEA 3S1XA 4QS5A 1BVWA 1NJJA 3C2VA 4HSOA 1QOQA 2Y88A 2QMJA 3C56A 4AFYA 3AIUA 1HKJA 2J77A 4V33A 3AZSA 5CPOA 2Y5SA 1VKFA 1G1YA 3DOPA 3UXLA 3ZR4A 1X6LA 2WBKA 4JTUA 3IUHA 1T7LA 3GXFA 3GG8A 2PFHA 4V28A 2WHJA 2WQDA 3GG0A 1UMYA 4ZBCA 4U4MA 1Z69A 1UZHA 2A6LA 2V3GA 4JFSA 1E3XA 3NPUA 3R0KA 1HFBA 4LWWA 1MVYA 1NU5A 3A9IA 2A6NA 3OOQA 2DZAA 3A13A 1ZQ5A 3VDGA 1JI2A 1PZ2A 4NAEA 5A3HA 3RN6A 3B9OA 1OFOA 1KC7A 5MKGB 3OGRA 2HROA 4LS2A 3K4DA 1VPYA 4LPCA 4DJED 4IPIA 2WKJA 3EPMA 4JKKA 3TKFA 3TJLA 4PCPA 3VVGA 3WLTA 4GQRA 4NI8A 3W26A 2Y2WA 4E5TA 1P6WA 4ML9A 3SY8A 2VYOA 4C6PA 1VFUA 3FS2A 3FJ6A 3M0JA 5LNRA 2OEJA 4IFKB 3OVGA 2E8ZA 4QFUA 4MB1A 3S5OA 4US5A 4LYPA 2OB3A 2VUNA 4FOJA 5FKYA 2YA2A 2ZIDA 5CQ1A 1GW9A 4DXVA 2VO5A 2QR6A 5D03A 1SO5A 1FWFC 4L7ZA 4BK9A 3GDRA 3O1NA 5DMYA 4JEJA 3B97A 2WMHA 1PXGA 5DCBA 3SRDA 3TTQA 4PMQA 1JPKA 1Q6FA 5FL0A 3C8NA 3BG5A 4K38A 2ABAA 3W38A 1XQKA 4J3UA 3K1DA 2C1IA 2QAFA 3PZMA 1CCWB 3RM9A 1IGWA 1A0CA 1BEUA 4RV8A 1XL9A 3OYXA 1Q6DA 4MJZA 4A3QA 4LH8A 3E2SA 3SDOA 1TO3A 4MPKA 3IV8A 4AEOA 1GKQA 1JYXA 4HPXA 1V51A 1GOOA 3GAKA 3I3DA 3VKAA 3ARXA 1EF2A 4N4QA 1GYNA 4ERIA 5I03A 1V02E 4IMEA 6XIMA 3IIXA 4HBKA 2FZDA 2BVDA 3SCSA 3M0IA 1MFUA 2YR1A 4PMUA 1E3ZA 3CAWA 3O15A 1DJQA 3UD6A 1A5NC 5E0KA 2VQTA 3TYUA 3N34A 4PFMA 2GWNA 3WF4A 1H60A 2Q09A 1KFEA 2POZA 3BUVA 4C6KA 2J74A 4D6JA 5A6LA 2C13A 2D0GA 3LGEA 4GH1A 4ZB0A 5LIKX 4ICNA 1RVGA 1LP6A 5CZ0A 4J28A 2VURA 4QHRA 1E0UA 2E6FA 2FHCA 2AL2B 4FXJA 2P10A 2XH4A 1OFPA 4YS1A 2E1WA 3W7MA 1ZU8A 5BMWA 3GR8A 3SRFA 4GFSA 4ERGA 1XIJA 3VC5A 1XLEA 2DEPA 3CZGA 4HVXA 4HIBA 1SR0A 3R58A 4D6CA 3ZO9A 1O5QA 3FXYA 1H1YA 3E5BA 2NWRA 1BRLB 1V08A 4UTTC 4AU0A 4GUFA 2SFPA 1J0YA 4JD4A 3P0WA 2G37A 2QCDA 3U2CA 2W66A 3AU2A 3CHEA 4M5PA 4JTFA 3OIXA 3QH2A 4KIRA 3RU6A 3EOUA 1IR1A 2YIHA 1FHVA 2OLAA 1NAL1 1REQA 3CZEA 1WB0A 5FEZA 3NGFA 1BYAA 2ZUVA 2XDFA 5K7JA 4ZXOA 4L6DA 3ECQA 3S5YA 3HO8A 4X3ZA 1XLMA 1PX8A 3R8GA 2Z6JA 3MSRA 4PUWA 1JRCA 2I57A 2YL8A 3QEZA 1M9HA 4AZHA 3THCA 5M2FX 2XSBA 3HF3A 4U3AA 1MFVA 3B8UA 4Q7BA 2R8WA 3AAMA 3SGUA 2HXTA 3W74A 2VUYA 2EJ1A 4B2DD 4AHQA 1RUSA 3P2VA 5LA1A 1MUMA 2Y85A 3WLIA 2JGYA 4DF0A 1Q63A 1F61A 2DPEA 4PMXA 4GNVA 4ZQCA 1A53A 3ZLGA 4XBJA 5CJNA 3PZQA 4OBSA 4RXGA 3SGGA 4W7WA 3AMKA 2RGMA 2PRLA 5J5RA 1CXLA 2DT3A 3FN9A 2XSAA 3M1ZA 4A8RA 4GACA 3Q67A 4EXQA 2QCNA 2NQHA 1I1XA 4JDYA 4JEQA 4JTEA 3RPMA 2VX6A 3W02A 5K9DA 4LS0A 3SCRA 4NYYA 4O1BA 3BAKA 1KM6A 3QMSA 1I2OA 2MUCA 4C90A 4Z42C 1MW3A 2PDMA 4NZCA 1CXFA 1OABA 1ZJAA 1VENA 4N0RA 1T96A 5F2MA 3TLQA 3U4FA 3AIBA 1FWRA 1GZJA 2VC6A 3IEBA 3W81A 1L6YA 3BPWA 5G2HA 3TH6A 3REQA 4M82A 3LV5A 3FDGA 4AWTA 3PPGA 1CPUA 1E6QM 4YIWA 3POCA 1O5RA 1EQPA 2X05A 2CITA 3T44A 1DJYA 1KXQA 2PDGA 5A8MA 1QO5A 3S1UA 4CKQA 3G1YA 3RIKA 3T8LA 2PGEA 1WDWA 1W5MA 2ZFAA 1RCXB 3GO2A 3B9EA 3H70A 4MTVA 4R53A 2VGGA 2V63A 4DJDA 3TK7A 4J3ZA 3UGRA 1J4EA 4GBUA 3NPWA 1OCQA 1YNPA 4RDVA 4JYEA 3NO1A 3TROA 2D2GA 3UBPC 2DP3A 4B9ZA 3B4UA 3VZXA 1GVOA 1M41A 2YZRA 4NNAA 4NXSA 3N18A 1UC4A 2ICSA 2OOGA 4A05A 3CJPA 4GYPA 4YL2A 4N9DA 1H1ZA 1Q2RA 2R1LA 3LDVA 2XH7A 1PYFA 2G0WA 4ZOCA 2A7PA 3BURA 1FH8A 4WRHA 3UWQA 4JTQA 2OYKA 1GTEA 2IKHA 2HZGA 3QPZA 2FZBA 2X1UA 4IQLA 2VHLA 4PR4A 4MUZA 2ZUSA 3MV01 4L4PA 1OK6A 2D22A 6REQA 3QQ0A 3E74A 3S9YA 3MSDA 1WBJA 2F61A 4PH6A 2YOCA 4N7QA 3NM3A 1XDMA 3F4NA 1ME8A 4FXRA 1O12A 4AVFA 2WSPA 4ZZ9A 3SGZA 3APGA 4IQDA 4GISA 3W01A 3VD7A 1N7KA 2QGYA 4M6UA 4L4OA 4IMGA 3EMCA 3RO6A 4AY7A 4KESA 1FWEC 3VAVA 1GCYA 2ZZ7A 1K4HA 5HNNA 2Y7FA 4LUSB 4A3RA 2A2IA 5K4XA 1SZRA 1A80A 2QCEA 5FJOA 4CCEA 2BSLA 4NL1A 1E0TA 3C0LA 5JIWA 4MZ8A 3B03A 4X0NA 1TYGA 2J88A 1OK4A 5JUVA 3LG3A 4XG1A 1RVKA 3PTKA 3SZ8A 4JHZA 4OQVA 5HATA 4AZ7A 4QE1A 1AD4A 1DJXA 3NJ3A 3POHA 1W9DM 2X2YA 1GG1A 3VKJA 1W8SA 4Y9PA 5KITA 5HQLA 3EA1A 3T6CA 1TMQA 1MZRA 2OXNA 2JKAA 3WNPA 4A6GA 2FHFA 4KGJA 4HKPA 4MMWA 4GZEA 5EGRA 1H49A 3WQ8A 4HA3A 5HMFA 2ACSA 3AYTA 4WY0F 4Z0SA 4NZ1A 4UB9A 4Y2WA 1B2YA 3NQDA 4WKHA 1EP1A 5CXPA 2WHLA 1LRQA 1ZY9A 3R11A 2D3NA 2FZMA 1W5NA 4S3CA 2VX4A 1DVJA 2CPUA 2QQ6A 3L9CA 1VS1A 4QDMA 2G95A 2Y5JA 4JIHA 4I7WA 4PSPA 1W1B1 5BROA 1YDYA 4QGCA 1JCLA 3GC5A 2GJPA 2ZC1A 3N3TA 4P8XA 4AD2A 3OW1A 3VILA 4OOZA 1A5KC 2O0TA 4QE5A 2OELA 3WFAA 3U5YA 4AZGA 1WDSA 1TV5A 2VXNA 1RALA 1QU4A 3I10A 3T0CA 4YTUA 4E2BA 1A5LC 1IF2A 2IUZA 3ARTA 4YTRA 1EYWA 4FX7A 4DBWA 1UP2A 2OVLA 1JZ4A 1BYDA 3ZJKA 5DLCA 1DHPA 3G1SA 4LV4A 4J3WA 3O6CA 3MKKA 3G1HA 1Q8AA 1VBUA 3P82A 3RYSA 5CJ5A 4OOUA 1EO7A 3RPTA 1WZAA 3S6OA 1OEPA 4U3CA 3A3HA 1P0KA 4RDZA 1JNEA 3GDLA 2B7NA 3H55A 4MY1A 4AYSA 4CD8A 4NZ3A 4C7FA 5HPCA 3MY9A 1S2WA 1LM1A 1XH0A 3LBMA 3B8IA 4FIQA 4E6MA 4XTIA 2ALDA 5EMJA 3N9RA 2VEKA 3ABSA 1X6UA 2YGYA 5GPRA 2DDXA 1V6YA 4XBKA 4JR5A 4B4HA 2ZRYA 1JDCA 4LAKA 1CT5A 1JIBA 2X1TA 1JCYA 1JCTA 2OGJA 1KXHA 1X1ZA 1OC7A 1XUUA 3GVGA 2P1FA 3QR1A 3ITOA 1YTKA 1XINA 3CLMA 3COTA 3LCLA 3S47A 1VBJA 1AW1A 4CNSA 4I5XA 3G2GA 3NQFA 1KGUA 3U6WA 3CQIA 4Y90A 1K7EA 5HPOA 1QNVA 3LPGA 3WD2A 2YL5A 2C79A 2XZ9A 5HULA 4ZEPA 3N11A 4ORIA 3ZLFA 5DY2A 4G56A 4DPQA 4RUBA 3BAXA 3H2CA 1W1A1 1X38A 2WM0A 4ZO8A 4DLFA 4DO5A 5AYXA 4NASA 7XIMA 1A0EA 4NAFB 3OTRA 4XD5A 4UTHA 2OQHA 4DIAA 4AXKA 1LJYA 1XLJA 3TQVA 4E2VA 3BDKA 1V7AA 4U5IA 1VFLA 2OCZA 3ZSSA 4P61A 1KW1A 1O6IA 3TAKA 4PL2A 2O7QA 3ZJ6A 4TV6A 1PHQA 3MI6A 2D1ZA 3VC6A 4B16A 5FACA 4E8DA 3DYOA 1LG1A 1TELA 4Z2JA 2Z0IA 4GYFA 4JTAA 1IIHA 2BXVA 4H6KA 4Q8NA 3PBWA 4RX0A 4XQ6A 3NAVA 2G5WA 2Y6ZA 3L5LA 1F73A 3I4KA 4ATDA 1H3GA 1F3EA 4UTWA 3E9AA 3IRDA 3ITYA 4NZFA 4EACA 1GQIA 1P6CA 2YXOA 3GC4A 4OKDA 4QLKA 3M0YA 4KWWA 2XM2A 4AF0A 1SZNA 4FOKA 1CI1A 5A2BA 1W6TA 3VM5A 1JNDA 1QASA 1FWCC 4YN5A 5ABFA 3BMVA 3AIVA 4AH7A 4S2BA 2D0FA 5CPNA 1SU5A 1TJ0A 2QDDA 5DMMA 5J04A 5E1QA 1DP0A 2GWGA 2VD9A 1IR2A 3GH4A 3IWPA 2F38A 4U5KA 1UR4A 3W1QA 4GMEA 3NNTA 1EH9A 1XH2A 3NYDA 3BO9A 1UA7A 3UZZA 4DYJA 1MDRA 1TWWA 3PWIA 2QCHA 1OHLA 1C9DA 2FPYA 3DU0A 4OUEA 4WJ8A 4D6HA 2E5DA 5CSUA 4C6FA 3DBNA 1GQKA 1VIWA 5TQLA 3LY0A 5EFDA 1UCWA 2XYLA 2WW5A 4UNLA 4J2MA 2HQAA 3I3EA 3LX9A 3PJTA 2GGEA 1OCBA 3G8EA 4LUTB 4WXYA 3LZ5A 5JH2A 1TA3A 5LNSA 5BWAA 2OOFA 3C8FA 2XIBA 7ENLA 2YXXA 3NXLA 3U57A 4K39A 4O0KA 3CZLA 1ADOA 1RK5A 4H9TA 2GFTA 1V0NA 3DFOA 4YHGA 4LX4A 1O7AA 4D6EA 3G77A 4QS6A 3U7VA 1E1EA 1L8NA 1VCVA 2CLHA 3CQ0A 3UF9A 1BTMA 1BXCA 4IIDA 1DJIA 1RD5A 3NYZA 4IPNB 3WKZA 3WH6A 5HOSA 1EKOA 1J01A 1UIOA 1KRCC 2ZZ3A 4LFYA 1HP4A 1JDFA 3R5EA 1IXQA 4B5WA 2XN2A 1PTGA 2IXVA 3EDDA 4J7RA 3G5EA 3EAUA 3KOFA 4A4AA 2NT1A 3ZT5A 1Q66A 3CHCA 3SCTA 3UWVA 1NF7A 1G6CA 2GZXA 3GVRA 3O0KA 2CZEA 1G7VA 3OVRA 2WNNA 5D8ZA 3MJMA 7TAAA 1D3GA 2I9EA 4IICA 5L6UA 2ISWA 3BG3A 2HSAA 1JCMP 2YCIX 3URNA 1OB0A 1HT6A 3L7RA 1N8WA 2A3EA 3MJYA 2AQWA 1H51A 3UA3A 3P80A 2GJXA 3O9NA 3Q58A 4LVAA 2ISDA 2NQJA 1MDLA 1TPC1 2DUXA 4Q22A 2XU2A 5I06A 1E1CA 1UJQA 4XAPA 4JFTA 1J18A 1V5XA 1S5TA 1RQHA 4PUMA 5D2YA 1XSIA 3W2KA 2DV0A 2A79A 5AYIA 1C7SA 1LT8A 4UTMA 1F3TA 3ENLA 4IZGA 1QOXA 1YBQA 1OGSA 1WUEA 2FDMA 5CGQA 3U2OA 1JEZA 1ZAHA 1BPLB 3E5PA 1UUQA 2FPVA 3S0CA 3UPWA 2QV5A 1S5NA 1P0BA 1ZLPA 3U2EA 5TNVA 1PO9A 2QCMA 3UYCA 3WEOA 4QCEA 3NQBA 4NJKA 4Z2HA 2W91A 4KEZA 1P1MA 3STCA 4L61A 2QJMA 1R38A 2EPMX 4ERAA 2V9DA 1DWJM 3SIMA 4JNZA 2OO0A 2Y70A 1R3SA 2P88A 4YVPA 4BHYA 3F7JA 2W92A 3T55A 2D20A 1IT0A 3AIRA 2C8NA 4Y9OA 2CHRA 4DJDC 3PULA 1AH0A 3AXKA 1NDWA 4GY1A 1EF3A 2UV8G 1DQXA 1NDYA 3P0XA 1H2JA 4LEQA 2X0SA 4Z2IA 2VCBA 2DW7A 4BI6A 1FXQA 3FHQA 3CHVA 1YTEA 5LHFA 3MUCA 1P7TB 4JQ1A 1RK6A 1TVNA 2GJNA 1JR1A 3NQCA 3NO3A 2AQVA 1JJKA 1A5MC 1F07A 5HJXA 3LXAA 1FH9A 4ZOEA 4Q8UA 3QHMA 3CTLA 3KLKA 1XBVA 1EO5A 1E72M 4E3VA 4URIA 3QSRA 2VEMA 4O1DA 3K2GA 3AROA 2QW5A 3TJXA 4G7FA 2DORA 4MY8A 5I7GA 3IJ6A 3L4YA 3NSXA 4M7SA 1XISA 5E70A 3QKEA 3G0UA 1KGWA 3T40A 5HK4A 4O1CA 3OVPA 3MTWA 4JICA 3G0SA 4MPQA 4MLJA 4UCGA 1LBLA 4AD0A 1JAKA 1FXPA 3M5VA 3QV9A 1V3MA 4US5D 1HO4A 1F2JA 1XJBA 1DTUA 2DIEA 3L5MA 3OODA 3KP0A 4L1WA 3H2AA 4BQ3A 3M0ZA 2XGBA 4R7OA 3GD6A 4R85A 4XZ9A 3S2JA 4LYQA 1S1PA 3NR0A 4HU4A 1M3UA 3BLFA 1KR1A 3M43A 4LVFA 1S1RA 1EJXC 3CPUA 3N2BA 3W7CA 4I7UA 4S2CA 1E9ZB 3GBDA 1FP8A 3LI1A 4QLJA 3M0HA 2GUBA 3BMWA 2W27A 2OX4A 1PE1A 3JR2A 1WDDA 2QNEA 1EPVA 3N2XA 1Q7MA 2I14A 1QPKA 2WC3A 3AS1A 1KFJA 5C70A 5KINA 3P5ZA 5GJNA 3CGTA 4B3ZA 1GJPA 3T2PA 4DZHA 1BAGA 1X39A 2UBPC 4XSMA 1K03A 2X2GA 1V3LA 3A21A 4MB4A 5DQPA 2AKZA 3MC5A 5U7SA 2DJLA 3FX4A 4EP8C 3IPWA 4WKAA 3E2VA 1K8CA 2F7FA 1PSCA 3HTWA 4AY8A 1FWHC 4BZYA 5D2VA 3E96A 1WXZA 4MWAB 4PTVA 3FJ4A 1A5CA 1OC6A 3PVFA 1HJUA 3I65A 4U28A 3KRZA 1XLGA 2P50A 1US0A 2VZTA 3JZUA 2ZE3A 3WLSA 8XIAA 4GFIA 4MKVA 3QM3A 4HCDA 1HN1A 1ZP4A 3ABQA 3UWEA 9RUBA 4OJYA 5E0FA 4FEZA 1V0MA 4XVDA 1ZSXA 3EDKA 5GJMA 5JU6A 3N6HA 1B0IA 3VMNA 4XTDA 5LIUX 3MO7A 1IZCA 3T05A 1IWAA 2D3LA 1NH6A 3K30A 2WK2A 1RBLA 1XG3A 4JTTA 3DUGA 2J47A 3PZIA 3HG2A 3D3AA 1HIZA 1GPFA 1ICSA 1G69A 2IQDA 3IAQA 2QGHA 2CU0A 3VX1A 1VBHA 4EPDC 3AYSA 1HGWA 4KPLA 4E4PA 4GYKA 2DIJA 3L4VA 5A5WA 4LF1A 2FZNA 2QUTA 3CLWA 1QPQA 3OGSA 2WYSA 1VPQA 5LIXX 4HMDA 2ASHA 4UTIA 3TMLA 1OCJA 4L9XA 1BXBA 3LA4A 1QTWA 3ATYA 5DXXA 4KF1A 4U31A 1AODA 3VOFA 1V6UA 1LWIA 2X30A 1EUNA 4CQBA 5C8BB 3ICJA 2XGZA 4K7VA 4JTIA 1OCNA 2PDJA 3D47A 5F2GA 3ZQ9A 5F1VA 1EZ2A 4HZ6A 5EBUA 4E4FA 3XIMA 3AFBA 2X16A 4FF5A 5T9BG 1OF6A 2GGHA 4KFPA 2DVTA 2IS7A 2EKGA 4I6VA 4WF7A 3GHUA 1I2QA 2VFHA 3W7HA 1MW2A 4KRTA 3WMLA 4AAJA 4LAMA 5AVHA 1SO4A 1SZEA 1K9FA 3NGJA 3NEHA 4WSHA 3ZOAA 1AA1B 3TMQA 2E9LA 4XZIA 3KTXA 2VX7A 3PPHA 5D9NA 5CZJA 3PG9A 3MWAA 3FYYA 3ABXA 1Q6GA 3H8AA 2WBGA 1EIXA 1UUMA 2I5GA 1B3ZA 3OQ8A 4MFEA 5TAOA 2IPFA 4AISA 3KBMA 4LTSA 4XKYB 1J96A 4Q3MA 1YDNA 3LCWA 3TTYA 4QITA 3EPNA 4DBEA 1JFXA 3QBUA 4B15A 1MYRA 3OZMA 2ATMA 1BFNA 2JALA 1PTAA 2BV9A 2RJHA 2C16A 5AHIA 3STGA 1I60A 1HKKA 4D6FA 3KCJA 3MMWA 3BLLA 3J7HA 5F4XA 1JQVA 3LHVA 1KCXA 4W89A 3UYIA 3HPXA 1DJGA 1ZAIA 1OY0A 4DJFA 4C1NB 5EMYA 4CN1A 4DJDD 5JVLA 3TWAA 3ZJ8A 1DIKA 2WO5A 3VPLA 1EIBA 3PG8A 1Q7ZA 1HKMA 4XAZA 2INFA 1KKOA 1W9BM 3UFYA 3JS3A 3NOEA 1CEOA 1QR7A 2XIMA 3B8WA 3BW2A 1EBGA 2W67A 1BG4A 2I1OA 5C9UA 4NX0A 4NZ5A 5G1TA 2L5HA 2WNWA 4IM4A 2GSHA 4G5DA 1A4LA 2ZUNA 4XD6A 5LHEA 1Q6QA 5TIMA 3WFLA 3W37A 2H3DA 4UTUA 4E3TA 3N2OA 3V18A 5BNKA 4TX9A 5MKGA 2Z1VA 3GNOA 1FFRA 1Q65A 2C6QA 3H2MA 1CX9A 3OVQA 4FLRA 2VDGA 2OG9A 3FK4A 2FGLA 5A2CA 4PTMA 5I3KA 5CEWA 4V1XA 1LBMA 4BI5A 3K8MA 4FSAA 3C5QA 1ZTVA 1W37A 4IFKA 4R5EA 2VZOA 4EPKA 1JYWA 3IJQA 3WF1A 3NPVA 1XKJA 4S3BA 4FLOA 3VIGA 4CCDA 1UWQA 4XD3A 3FY1A 4UOJA 3LMYA 1IT8A 2ZUTA 5HMDA 1QCWA 2EPLX 2RJGA 1NFPA 4UQAA 2G4FA 3W85A 1NVMA 3UR8A 3KWSA 3TNBA 1P0NA 2D2OA 3AHYA 4IGHA 2Z1KA 3ZWTA 4O4WA 1W3HA 4HZMA 3TFXA 2E0PA 2ALRA 4K36A 4FOUA 4C6OA 3F4VA 4MAVA 4Y96A 1RP8A 3UXKA 2HVOA 3TV8A 4LCRA 4N6FA 3S9IA 3ID7A 3M7SA 4ZQNA 1EWDA 3WLKX 3LXCA 4N9CA 4B3KA 2Q3RA 3DCPA 4RNHA 3T4WA 4GI6A 4S3JA 3F4WA 4ZO7A 3GNRA 1LCOA 4R27A 1VF8A 1QNQA 3B0PA 3WZ0E 3LPFA 3CQJA 3EGJA 1K8ZA 2X42A 1WKYA 3LSCA 4YCPA 3BAWA 3NDOA 2PSNA 4W9TA 3CV7A 4F0HA 2A3CA 3M5ZA 2WZTA 2REQB 2PDKA 3EB4A 1F4AA 1G4PA 1PL9A 3AS0A 2ESCA 2BODX 2HNEA 2D24A 1R3VA 3AS2A 3TQPA 1TPEA 4TTGA 2VGFA 3R43A 1HG3A 5IRPA 1W56A 3N04A 1KBKA 1VC4A 4P7RA 1GONA 3N25A 1M1BA 4GO8A 4B5SA 4MAZA 2P3EA 1B1YA 4GUHA 2AL2A 3H7RA 5G1YA 3WG6A 2ZRVA 4EXAA 1R2TA 1OYAA 4IOTA 2P0IA 4RL3A 4C5ZA 3LMZA 2FH8A 1T41A 3AIQA 1KBJA 2NQ5A 3GAYA 3TYAA 4PUKA 4JNYA 1YNQA 3O6YX 3HGOA 4ZCWA 1VJIA 2Y62A 4ZENA 3B9AA 3QRHA 5HBFA 2V2DA 4X2PA 5A94A 5AVNA 1QBAA 1MNZA 1BRLA 2C0HA 2CHOA 1WE5A 1EEXA 5BMXA 2V2HA 3AHZA 1W2PA 4MZ1A 4XIAA 3FAXA 2B7QA 4BWLA 3UESA 3BVJA 4UFIA 1B3OA 3AHVA 4S1FA 5DF0A 3GUWA 3D5HA 1T0OA 3B3DA 1ISVA 3I7QA 3B0YA 4MJMA 1Q6EA 2VVSA 5CG0A 2FVLA 2UZ9A 3O06A 2C71A 4BKNA 3MYOA 5PTDA 4PA8A 4D72A 1TUXA 3DERA 4EF8A 3UEQA 4K7YA 2CYGA 1SFLA 5FF3A 3LTSA 4IL0A 2PWUA 1R85A 2JIEA 3CS2A 3EDEA 2J8FA 2WM1A 3L4ZA 5AFDA 3C2OA 3G3MA 3FOKA 5I3JA 3LCXA 3M64A 2FJKA 3CYJA 4KGLA 1E4NA 1A5BA 1VD6A 2PWHA 4H6QA 4ZXLA 1YXCA 1GPWA 2Z1SA 3UCQA 3BSHA 1WXJA 1H7XA 2ZE0A 3DFYA 4E4UA 1XC4A 3EWDA 3KRSA 5AECA 3QY6A 4F2UA 4PUUA 1XGDA 5B7YA 9XIAA 2CLLA 3W25A 3GW3A 2YJQA 1XBYA 3CT2A 4BQ4A 1SYTA 3KW3A 2VFGA 4YTQA 3PAOA 4AWSA 3QLLA 1Z3NA 3M0VA 2EPHA 3I6TA 1MMFA 1KM3A 3RM8A 3KDOA 2E9BA 4IGMA 4JGDA 5ABTA 4UNKA 3CWNA 3M5YA 1SO3A 3L67A 3PZ9A 1UIPA 4AIOA 4D1JA 1ZJBA 1M7XA 4UR7A 1DYSA 3DKJA 4O0ZA 3TLLA 2D23A 1ZP3A 1UKSA 2P0OA 1TRDA 1LORA 5D37A 2PB1A 2XINA 3WQ5A 4HCHA 2ZCGA 2WV8A 2ANUA 4ZSUA 4GI8A 3BLDA 4M6QA 3UQNA 5CSRA 1QATA 4EPEC 2J8GA 1J0JA 3FJNA 1TQJA 1OGBA 3IJ8A 1TTIA 5FJUA 3CV1A 5C5YA 4GPNA 4EK7A 1FRBA 4BF7A 4QG9A 4IQEA 1XDJA 2C18A 3O16A 3P7YA 2YYTA 2FTYA 3DHPA 1D7KA 4XAYA 3SCOA 4S38A 3VNZA 5IBXC 4JL2A 3PZGA 3WD0A 3ZR6A 3ITCA 2Q02A 4L56A 3D3FA 3RMEA 2OYMA 4DWSC 1JPHA 4H7VA 2H9AB 4B5NA 1PWLA 4LVBA 3WDPP 3KCOA 4AY1A 3LLFA 3N73A 3T08A 1ZJIA 3G6MA 2QYGA 1WCGA 3NL5A 4CUCA 1AL8A 2PDYA 4M6PA 1EUAA 2R1PA 3KWXA 2J9YA 4EKJA 4QG6A 3PJUA 4DWDA 3RF9A 4GZ7A 1GQLA 4NY2A 3THDA 5B80A 1U1HA 3L0NA 3PF3A 3LGDA 5CPTA 3CMJA 1J0IA 4GKTA 4M7TA 1GKPA 4UIOA 3MANA 2X40A 4F0SA 2BOFX 4TVCA 3V0UA 5C71A 5HWJA 3W1AA 3TWBA 1QNOA 4WOQA 3ZZ1A 2FYMA 2QUMA 4PEEA 4IXHA 1AQ0A 2ADAA 3NUKA 5C54A 3KM8A 2PTDA 1J0HA 3VNLA 8A3HA 4IH3A 4RE4A 4J4KA 5BRQA 3T2OA 3BLOA 3KL3A 4UOZA 4MB5A 3F5LA 5AC8A 3SCWA 4BCEA 2WVUA 3HPSA 3CUJA 3TNOA 1O5XA 1KTBA 5DX7A 1YXDA 1W0MA 1VIZA 3XISA 1L6SA 1UR9A 1CTNA 2DVXA 1KM1A 1PS9A 2BOEX 3GXPA 3RG6A 4MIMA 4DUXA 1JCNA 3BXWA 4LUSA 2DU2A 1RQEA 3CB8A 4MY9A 1TCMA 3CMFA 5IDIA 3F2DA 6ALDA 3I68A 3W1PA 2V5LA 5JBFA 4HTBA 1JPDX 3OHMB 3WL0A 1P5BA 4AEEA 4AX7A 4FHAA 4A2RA 3W7OA 1J2WA 3CYVA 3SJ3A 1VCFA 4CVWA 3K46A 1GJUA 3KLLA 2QUUA 1QJWA 3MKVA 3W75A 3LI0A 4GKLA 2D0HA 2FIQA 3A4XA 2C91A 1BWKA 4XUYA 3CWOX 4US6A 3UWUA 2G3JA 4UOQA 1JQXA 2PDXA 3NWRA 3HGJA 3BV4A 2QDGA 1I6NA 3SN1A 2HMCA 3V4BA 4QQ3A 1RA0A 4TU1A 3F4DA 5FOOA 3W1RA 2OSWA 5A8NA 1AL7A 4QJ3B 3KHDA 3SY5A 4DEFA 2R1KA 4RPQA 2YW4A 1FUYA 2PTYA 2VFEA 3ZSTA 3NL2A 5D33A 1TX0A 5DANA 1JPMA 3RO8A 4MYAA 4R3UA 1XFCA 4GX8A 3AZRA 1YW1A 3L2LA 4ASTA 2AOSA 1MUCA 1XGZA 1WOAA 2YLAA 1NQKA 2NZLA 5DFAA 3LQGA 3A3WA 5EMMA 3ARQA 3G18A 4JN6A 7REQB 4O28A 5D2WA 3OA5A 2Y89A 3C3UA 1WDRA 1FWWA 4FLSA 2VVNA 4YNGA 1TREA 4GXWA 5LYRA 3F2CA 1W31A 1ZS2A 2X1SA 1XCFA 5XIAA 2RDUA 4YMZA 1TV4A 4H6RA 1UYQA 2E4TA 3ZYZA 3NSNA 1KQZA 1DL3A 5CLWA 1IXOA 3AI0A 1L6WA 1B9ZA 3WQDA 1ESWA 1BGAA 1R2SA 2E7FA 3L4TA 1POJA 3DIPA 4W7UA 1XYLA 3MP3A 4JYDA 4XZHA 3ZVHB 4AG0A 2GYIA 1TZZA 2G8ZA 2BVYA 3NQ2A 3CC1A 5D04C 2I9UA 1EYEA 4CD6A 1HVXA 1QNSA 3B05A 3PP7A 3W6LA 4Q6JA 1OF8A 2ZUUA 1SJCA 3BW3A 3FIGA 2OZ8A 4A3UA 1OINA 2PDIA 4MNMA 4YVXA 2PMQA 2V30A 1W54A 2R6OA 1KBBA 4RE2A 1FQ0A 2OTDA 4ADTA 1QW7A 3IAPA 4DJFC 1OIMA 1DWFM 1GOXA 1VJSA 4I5RA 4LUIA 3C2FA 1QO2A 4JIEA 2OJPA 4R33A 3UP8A 5A6MA 2PZNA 2ZRUA 2EGZA 1V6VA 3EWYA 4M81A 1K9DA 1N8IA 1IIGA 1UBSA 1G94A 4IXXA 4HN8A 3ONCA 4IP4A 1NELA 2ODOA 1XQLA 1DWGM 4YU1A 3NEVA 2FGZA 4YVVA 3NFUA 5B7ZA 4I9AA 1E0WA 1WA3A 5CC6A 4POCA 2PU1A 2J24A 1JGIA 4F2TA 2BY1A 3SRKA 5C9XA 3VMOA 3WQ4A 2WOQA 4CQAA 3KZSA 1AZ2A 3PZNA 4ECLA 1Y8BA 3ZIZA 4WDTA 5C2GA 4JCLA 3DI1A 3MUY1 1Z6KA 3GZ3A 4LSBA 3TN4A 2B7PA 3GNPA 1S38A 2Z7GA 3K8KA 4NAFA 4B5TA 5EMUA 3LHTA 3TE9A 5A69A 4ICMA 1E1FA 2WANA 4MVAA 5AHFA 3LTPA 3W2NA 5A6BD 2DY3A 2NUWA 1V3JA 1Z89A 2VI0A 4HK6A 3RX3A 2W3ZA 1J2BA 1OADA 3H21A 3PUOA 3A5FA 1UKTA 4IIEA 3PHAA 4X9SA 3KHJA 3VUPA 3B0UX 2V5JA 3KEHA 2WVSA 5C2XA 3G3DA 4RKAA 5FI8A 3AWOA 3B9DA 2BOGX 3VOHA 3RLGA 4QJ1A 3S3GA 1TPFA 3GTFA 5BRPA 3AHTA 1ZBVA 1QI2A 2ACUA 3CL8A 2QPUA 4CVUA 2CLFA 3W22A 3CBWA 4AVNA 4R9OA 3II1A 3PB0A 3GY1A 1O60A 4JPGA 4DWSD 3DFTA 2VGBA 4HSNA 1PZ0A 1US2A 3FKRA 1T5AA 4L1GA 3VD4A 3U3HA 1XLCA 5GQBA 3EMQA 4P5UA 3CZ8A 4Z08A 3USZA 4CD5A 3N14A 3WYZA 2Z6IA 3A12A 5HMSA 2BG5A 3U4AA 3C0SA 4LC6A 5LIYX 2VWSA 1XIEA 2X1IA 3ARUA 3GBEA 1NWTA 4ZQOA 2V5KA 1G9HA 2QV4A 3N1AA 4NVTA 1OG6A 4WX2A 2DW6A 5LNUA 4JTKA 4NAEB 2J7EA 4JTCA 3IS4A 3M0XA 4AIUA 1H7NA 5TBOA 1M01A 1NOWA 4X0VA 1DJWA 4JN8A 4NHVA 2F6UA 3FGCB 2J9XA 2DZXA 1H61A 3T1GA 5FAJA 3EX6A 2VRKA 1TTQA 4KH2A 2HK0A 2YA1A 3MV11 4MSSA 3BCJA 2GVJA 1OZQA 1XLHA 3IRSA 3CAKA 1RAKA 3LPPA 1W9VA 5HNUA 1J5SA 1S5VA 2VFIA 3HJEA 3SECA 5A6JA 4G9PA 2E1DA 3W82A 2GDVA 1YYAA 4DUVA 4EIVA 2E77A 4EANA 3A3XA 3VDCA 4JL1A 4OBRA 3WQEA 3ARSA 2BNJA 1V3HA 4Z1BA 2JK2A 5C2CA 4GJ1A 2I16A 4DBUA 1PKNA 4GQBA 2Z1XA 2BY0A 3AUJA 3TDFA 1FWSA 3E0WA 1DJNA 2YDSA 4XD4A 2BHZA 4XB3A 5D8WA 1KWKA 1C92A 4QJ4B 2WWDA 1Q3NA 3TEVA 4JN7A 3NZQA 3SQSA 4LCSA 3W7QA 3EEGA 1I9CB 4C6IA 3R94A 3OJGA 3HA1A 4AUBA 2BVWA 3N13A 4HGXA 1VB9A 4IUOA 1F5ZA 2J62A 1YEYA 1XRVA 5C9RA 3DFNA 3BK0A 2GQAA 1PCKA 3KOXA 3OBEA 3E0LA 3OBAA 2PBOA 4O1FA 1SJAA 4V15A 3R1ZA 1K7FA 5HR6A 2XFWA 5EBAA 3V16A 4FK9A 2Z26A 4ZOBA 5IOBA 1GK8A 4UFKA 1EOMA 3WQCA 3UZJA 3VIJA 2ZXDA 4HHHA 2E8YA 3LQLA 1TSIA 5H2ZA 2H90A 3R25A 3I7RA 3RCYA 1L2QA 3W1XA 1XIHA 4ATWA 1IHIA 3F1QA 3GH5A 1TJ2A 1NY1A 3PPFA 2XIJA 3Q4DA 1PTDA 5CGTA 4MNKA 3W70A 2EQDA 2R14A 1GEHA 2PC8A 4RE3A 1VFFA 1TV8A 1A49A 4O50A 4M1RA 4UZSA 1XIDA 3GXNA 2CBUA 3HGRA 3CUIA 5T26A 4LJ3A 4D8LA 1FX6A 3MBDA 2ZXQA 2FVKA 4Q7IA 2WHMA 1A3WA 1EA0A 3MMTA 1AVAA 4A29A 1C8QA 5DBUA 4CU7A 4KRUA 2GQ9A 3LCIA 5H91A 1TG7A 4QNEA 3G24A 2R1MA 4I9JA 4DJFD 1D9EA 1QPRA 2PP3A 2QCGA 3RUBL 5ABEA 2YA0A 4KWVA 2WPGA 3PNZA 1U83A 4C6EA 4C6DA 1EP2A 2AMXA 2PF8A 2Y8KA 1L6GA 4IQJA 4GGHA 5CZTA 3H12A 3MHUA 3E0FA 3TTOA 1LOLA 4GD0A 3VABA 4QP0A 2HTMA 3I4EA 3QV6A 1IXNA 5BU9A 4KS0A 1P43A 3AICA 5AYZA 3GXDA 4GA8A 1HL2A 2TYSA 1UPMB 2AGKA 3QHNA 3KE0A 5FJIA 3C0QA 3LUTA 4LUYA 2NXGA 5I77A 4ZE4A 4HP5A 3WLNA 3OLGA 4YYFA 2GVGA 3AYRA 4PMZA 1OC5A 4PB5A 3VKBA 4GBDA 1J11A 4H9VA 4DO6A 5E09A 3VTRA 3EXSA 3WK1A 1XPGA 4QISA 1H41A 3PBUA 1DORA 5AHLA 3ITTA 1LZOA 2FJUB 4J40A 2GL5A 1DHKA 1F4HA 1C93A 3T8QA 1O4UA 1MI3A 4R34A 3CIXA 2HBXA 5I23A 4GZJA 5DBTA 3KOZA 3O2LA 1CGUA 1ME7A 2FB2A 1X8FA 5AZ1A 4PTDA 4R9XA 8TIMA 4P2VA 5IHRA 4KCTA 3VIOA 1UC5A 5H8MA 3NQ8A 3OG3A 3VD5A 1DWHM 4MOZA 2DJXA 3TIMA 2DSVA 2YDRA 4MJ2A 1J9YA 3OYZA 3MP5A 3RGTA 1W3JA 4O17A 1ELSA 1RPXA 3P93A 3SIZA 3CO4A 1VEPA 2XVKA 4GI9A 2PDQA 1UWTA 4WDUA 4JIIX 4MZYA 3RR1A 4LV9A 3SUVA 1JXKA 4F79A 3C0JA 5I78A 2UY2A 4QAWA 3NA8A 3FA3A 3A4JA 2WKLA 3VKCA 1K77A 3WMCA 1YQ2A 3FCPA 3ZLHA 2ZTKA 2VRQA 3EWBX 4OECA 3F5KA 3WNNA 3H22A 2OQLA 1EC8A 3JVAA 3CK5A 4MWAA 4WEVX 5K9XA 1A5AA 1G0CA 4D9PA 5C0QA 1KV5A 1QHZA 1GORA 3DFPA 4YTSA 1U30A 4O11A 1PKMA 2QF8A 3AS3A 2OFJA 4Z1AA 1GVFA 1LQAA 4ZMGA 3UZYA 4J35A 2D2JA 1RD6A 3UW6A 4PUDA 3ARVA 1PVNA 3THAA 4J5NA 3IIZA 1XYAA 1HJWA 4O1EA 6REQB 4DBSA 4XZWA 1UD3A 3ELFA 2ZZ6A 4EXBA 3ABZA 4AWEA 3M07A 1R5YA 2ZUMA 2DZTA 4D8ZA 3C6CA 4LEFA 4N4PA 4HNTA 3TTSA 3NL3A 3V5OA 1NP2A 5D9OA 1QBBA 3L66A 1S2VA 3WSUA 4DM1A 4MNJA 3CUZA 1C90A 4ZB5A 3BOXA 1EGZA 4H7CA 1JL8A 1BVZA 2BGSA 4B90A 1XC6A 5FJTA 3WD1A 5FEPA 4FALA 4O4VA 3IJ7A 2IQ0A 3BSMA 2GQ8A 1Q7QA 3VGGA 1S2CA 3SSZA 5C9WA 4GE8A 4JQ2A 1D8WA 3PBMA 4IPLA 2V69A 4LYKA 1JFHA 3CT7A 2WZMA 1Z9AA 3PPCA 3PK7A 4V1YA 3KX6A 1GHSA 4QROA 1I2RA 2CXEA 3UWWA 4W7VA 2CZFA 3TFCA 2VEFA 1C3FA 1ZRQA 1WKDA 2J9ZA 2QCLA 4WSJA 1GYMA 2JF6A 3WLOA 3R6IA 1J79A 1AMKA 1Q8JA 4NRSA 3WD4A 3O8AA 3SADA 3GNNA 4M51A 1VBGA 1EJRC 2PTXA 4QXIA 1H0IA 3S6TA 2EPKX 3PR2A 3CAVA 1U5JA 3QMTA 1ISYA 5G4WA 3BJFA 5AN7A 4K3ZA 4HT3A 1AMYA 3EOOA 3R8HA 3P74A 1O94A 3WN6A 4MJ4A 2WB5A 4TMBA 4XKYA 1H09A 2NX1A 4EPBC 4CU8A 2W5FA 3EOEA 3L4WA 2CBVA 3SURA 2W62A 4A8LA 1RLDA 4FAMA 3W84A 3PM6A 5GNYA 5ABHA 2DSWA 2HNHA 2VELA 4D8AA 1W1TA 2FMOA 3QLDA 3S2MA 3B8VA 4JHOA 4I8YA 1MXSA 3QFWA 2V3FA 3GNDA 1E6XM 5D30A 1UZ1A 4S3KA 1B4EA 1BQCA 2OZTA 4HHLA 3M41A 1UQZA 1UD6A 4WK9A 1E5NA 4IL2A 2NQ9A 3HIJA 3EWUA 3RX4A 4B5XA 1JCJA 4DB7A 5DELA 2YCLB 1ZHAA 1IGSA 4JAWA 1EWEA 2YZ5A 1KCKA 3WEMA 2CBIA 4C1NA 3V7PA 3NTYA 1EEPA 1V4YA 4GZIA 1VLWA 3BQ5A 2LLEA 3WEZA 3LBCA 3BICA 1BTCA 2QPXA 2JFEX 3LEPA 1MRQA 1SZGA 4Q8PA 3GIYA 3VUSA 2P8BA 3RX2A 1QFEA 4C6CA 1TPVA 5HXMA 4B3LA 4NQ1A 3VZYA 3GU9A 2CW6A 1JPIA 2GSJA 2IPJA 2QZRA 4IWWA 2WLZA 2PWFA 3IUDA 4TR9A 3PZVA 1E70M 3GU1A 3Q37A 1J6PA 4LRSA 5C7HA 1QI3A 3A23A 3TXZA 3MUAA 3EX3A 1MO0A 3S83A 5BOFA 3H7VA 1KCLA 3MCNA 2B7OA 3TJIA 4DUWA 5XIMA 5BWFA 1FCBA 4IJBA 4XKMA 7TIMA 1YMYA 2R9RA 5LA0A 5LIWX 2YPIA 3KFTA 1XGEA 1EPXA 2FMNA 2WSRA 3GTIA 5HINA 1YDVA 3QXBA 3RK8A 1MW0A 5RUBA 2IQTA 2XWEA 3NURA 3CHDA 2ZXAA 2VEPA 4BS0A 2QAPA 4UFJA 3B0XA 3NL6A 2G3MA 1KRMA 3OO2A 1AJZA 4GLEA 4LQ1A 4G1KA 2ZX7A 2DQWA 2CESA 3GXTA 3QOKA 4JFUA 1RBAA 1K3UA 3PZTA 1PIFA 4WGXA 3UGVA 2D2HA 3QTGA 4ZB2A 1QK2A 1H7WA 1TJPA 2ZYFA 3MT1A 2NUYA 3UR7A 1UP3A 3AYVA 1UPPA 2CERA 1VH7A 2PS2A 4LBRA 1JUEA 4JZ5A 1MNSA 3MHFA 1GNXA 4NP7A 2DZPA 3PJWA 1QVBA 4ACZA 3CWHA 4MKSA 1YE4A 4OIFA 3SCQA 3GR4A 4H2HA 1R3WA 2V5CA 4P8VA 1E6PA 4D1IA 2HE8A 4WCJA 8XIMA 3HG4A 3O05A 1VYPX 2MANA 1EJWC 2J7CA 2UWFA 3PBGA 4JIQA 1DXFA 4J9JA 1DJZA 4Z17A 1CXIA 1W17A 3MHGA 3VIKA 3WQFA 4OV4A 3I6EA 3R10A 4UNIA 2J66A 1H5YA 1RV8A 4PMOA 3RNDA 1PWMA 2REQA 4JNMA 4HNNA 2FH6A 2OKTA 3GYCA 1R3YA 4Z2LA 3UY8A 5ABFB 5AC4A 3G1VA 3M16A 4EVZA 4AD1A 3SN4A 4BR1A 4H01A 3U5UA 3V0TA 1OFAA 2A3AA 3SRHA 3MI2A 3NCOA 4G2DA 1S39A 1C91A 4IJRA 4RNFA 2INZA 3N6JA 5CC7A 2YBTA 2NV2A 1MEHA 1UZ4A 3AJXA 5HANA 4DZIA 1K8YA 2VQUA 4O1AA 1G67A 2VD8A 4GYJA 5D09A 3E49A 2E09A 3C2YA 4J3TA 5T91A 4CGTA 1WBHA 4BQ5A 2P3ZA 3TA9A 2VEGA 3T0TA 1ISZA 4ZO9A 3WJXA 2KAUC 1WUFA 2J79A 1W1PA 2NX9A 3QR0A 4UTLA 2FZ8A 2OSXA 2VNCA 2BMBA 3P8JA 3ZJ7A 2A7RA 3W6MA 3W7NA 1LT7A 4JIPA 1XV8A 4C6MA 3HPFA 3IK4A 3JZEA 4DAFA 2QJNA 2RAGA 4H00A 5A6SA 1MUWA 4KEUA 2BVTA 5KTLA 2W9MA 4IGSA 1Q4NX 2CFFA 3GZAA 2V8ZA 4X63A 4O14A 2J4GA 1JZ8A 5DT7A 1NOFA 1GKRA 3S46A 1CGVA 2WKGA 3N2CA 3E2QA 3KRBA 1E5JA 2GOUA 2X41A 1EQCA 1MWOA 2O9RA 2QLYA 2VZUA 3AXHA 3QVQA 4JQ3A 4DBDA 2ZXBA 5GVJA 2Y7EA 2HJPA 3QKZA 1E40A 1NARA 2OODA 3UU0A 4IFOA 4CQ8A 4M56A 2C15A 3NPXA 1A47A 2QIWA 1WZMA 4QBXA 1BWVA 1OWQA 1UD4A 1EZWA 2Q8LA 1VCGA 2PDBA 1OSEA 2PTZA 1VHNA 3W88A 3WENA 1I75A 4YTTA 4FMVA 4ZO6A 2ZQ0A 2QHAA 1VFOA 5KEZA 4OFCA 3FKKA 3STFA 4JQ4A 1DIDA 1OQFA 4F8XA 3LXBA 4QSHA 4JX5A 1VR6A 3KBSA 3WMSA 1J10A 4GG9A 3L4UA 1SMDA 4WY0B 5LXXA 2BB0A 1JF5A 4KRZA 1ONXA 1WKFA 3PNUA 3TC6A 1Z8AA 3OLDA 1IQ8A 1LLOA 4JTGA 4FR6A 3S9ZA 1XBZA 5HQEA 1JRBA 2QUVA 2QMKA 1B31A 1TV7A 9CGTA 2DIKA 3KOYA 4NSBA 5K2ZA 3DG3A 4O18A 4CCZA 1I1WA 2JKEA 3DHUA 1KCZA 1B5TA 2ZBTA 3T4CA 4BJHA 5CPSA 1DXIA 4GX9A 4HQVA 3TXVA 1TZ7A 2PI6A 1L0PA 2V0TA 2J78A 3LLDA 2O9PA 2PLCA 2UY4A 4WUIA 2WSQA 2VRJA 5ABGA 3O0FA 2WSYA 3W1UA 2VTFA 4K68A 3LN3A 4ZL1A 2JIWA 2Z29A 3E3HA 4PCSA 4ML4A 5JMUA 2HRWA 4MYXA 2DZVA 3CIWA 5IDZA 4UQDA 1ALDA 3MS8A 4NT0A 4CQ9A 4MF4A 4WSKA 3XINA 3NOYA 3URQA 2EPNA 5K9CA 3KL5A 3HG3A 4KBXA 5C7VA 3WBWA 5BCAA 1VFMA 5DXYA 1ZBWA 5C9ZA 4FZIA 4G8TA 1DV7A 2OEMA 1DIEA 1NWUA 1K9TA 4ZFCA 1HL9A 4REQB 4DLMA 2IKJA 4KEMA 2QIIA 2R1NA 1EC9A 3U7BA 3BLEA 2W63A 2QS8A 4N2YA 4B9YA 1X96A 4F9JA 2Q71A 1B90A 4A8IA 3VA8A 1LQ0A 4IP5A 5G2WA 1FWGC 4GOAA 4RNJA 1M53A 1ZCCA 3BOLA 1PZ3A 3NQEA 5M17A 5BYWA 5M3WA 2J6VA 3KS6A 1X98A 3W7EA 1PDZA 1XLAA 3LCGA 2JGQA 2O55A 2YLLA 3PSWA 5LZLA 1UB3A 4ORMA 1IEXA 3IJ9A 4I7VA 3WQOA 1TKKA 3AIWA 1HX0A 3V1PA 1FP9A 3GU2A 4S3AA 2QF7A 3N6QA 2OX1A 3HN3A 3UJRA 1V93A 1VRDA 2DH3A 4HPJA 3VDHA 6A3HA 1CGTA 3NIYA 1H7OA 4L65A 5MHBA 3NVDA 1PHWA 1PKLA 1TMHA 4WJXA 1V8EA 4WJEA 1W3IA 1HQTA 1I45A 4ICCX 3RJYA 4DM2A 3IGHX 1UKPA 3T42A 1KRBC 1L9WA 1K4GA 3G1DA 1EOKA 5FF7A 1F8MA 1AFSA 4E0CA 1G4EA 1W9XA 1GGOA 3RRXA 3PWAA 4HZ7A 4YWSA 1EJSC 1EC7A 3WMBA 1WV2A 3AZTA 1TIWA 2Y5EA 3AOFA 1KRAC 2QUNA 3APTA 4L64A 5K4ZA 4PEKA 4FR1A 1HXJA 1RZMA 3WNMA 4C1KA 2HWGA 2V3DA 1LBFA 5FD0A 1AJ2A 1LYXA 1X7FA 1FH7A 3W76A 2ZUWA 3OU8A 3UWYA 2WMKA 3WH7A 3GH7A 2Y61A 1XH1A 4I9TA 1TWSA 4HMEA 4GVGA 3LNMA 5CH9A 4NYUA 1LOQA 2ISFA 5M03A 1UD5A 2GJLA 1PBGA 2XVPA 2G3FA 2ZZ2A 3FYPA 3KVKA 5A6KA 4IP7A 3GSMA 4DWSB 4AZCB 5SWUA 1O1HA 4S39A 1CLKA 3CH9A 1TPH1 4HSHA 3TOPA 5D4YA 3GG7A 3VE7A 5HA7A 3ARYA 4XZBA 3CL6A 1XIIA 2EXOA 4O57A 4AW7A 2DVUA 3MWCA 1TMLA 1B9BA 3LS9A 1T8XA 3T0AA 2BP1A 4H8NA 3EWCA 4TXEA 3TQKA 1ONRA 4KFNA 3DG7A 4QIUA 1JVNA 1CGXA 4GUJA 3GS6A 3P62A 2WC4A 1UASA 1PCWA 1VPXA 3WBAA 2QDEA 4GABA 2JE8A 3MDUA 2OWXA 2QJIA 2P5NA 1F7BA 1QT1A 3D46A 1M7OA 4MADA 3VD9A 4UTFA 1HKIA 1XFBA 4GQ0A 1RH9A 3UERA 3BOFA 4AIEA 4PULA 3H2OA 3K8LA 3GFZA 1T99A 2QPSA 3OZOA 4LY4A 5EPDA 2DFAA 2ZADA 2DUZA 3OZPA 2PE4A 3N4EA 3LU2A 3SCPA 3AISA 1XWYA 3BSGA 5EL1A 2YYUA 2WMIB 1QNRA 1GZGA 1IT7A 1XR2A 1UG6A 2NVAA 4IMFA 1TPUA 1QW8A 1R3TA 4ZOAA 1XHGA 4ZODA 3VU2A 1NP0A 3F5JA 4H19A 4RZ4A 3TAOA 3ITVA 2J7FA 4HHPA 4JKMA 4K6AA 4YPJA 2YDQA 1H5VA 4JHMA 4K1GA 2RFGA 3CV2A 3S5ZA 5HDRA 5JXQA 4YXGA 5HAOA 1GVEA 2O4QA 5BW6A 3PY2A 1JZ5A 3M0MA 4JCMA 3TN6A 2VR2A 1TTJA 3H4WA 4HOWA 3DC0A 4MKNA 3STPA 3WQWA 2PLKA 3KVJA 2E68A 3MP4A 4H3DA 1DJHA 3UJ2A 4L4LA 1E4MM 2R82A 1S2TA 2FPTA 3W2JA 1NWRA 1QNPA 4RZBA 3QTPA 1F6YA 4W5ZA 1HUVA 4B5UA 2VX5A 3QYQA 2DQXA 1SJBA 3U9IA 1FWAC 1GVIA 3QPEA 3UJSA 3EKZA 3IIPA 1QI4A 4PRWA 5LSMA 2XWDA 4HCLA 3PBYA 3DFHA 3JUGA 1TE6A 3SUUA 3HPAA 3GC2A 2WVTA 1XLFA 2OT1A 2ZX8A 1CB7B 4XX6A 4ZTYA 1ITCA 1VEOA 3NQMA 4J3XA 3W0KA 2WZEA 4F48A 3ZFHA 3WDQA 3HB9A 3TVAA 1HTIA 3WQGA 3UXAA 4NI3A 5F7UA 3LHZA 1Q85A 4GRSA 3VIIA 1SVDA 3W28A 4W87A 1JG9A 1P4CA 1EJTC 1ZB5A 2VEIA 4O8AA 4RR4A 1RR2A 3W1NA 3UVAA 3VOIA 1BKSA 3VM7A 2KZHA 3H2FA 3KAOA 3NQGA 2PCEA 4H8VA 4DO7A 3A4WA 3AO0A 1DPMA 4JTSA 1KLYA 2X0HA 4QJ5B 3UNTA 4M6VA 1HP5A 1J6OA 3BQ6A 4A21A 5T8GA 3EB2A 1SSGA 2Z1BA 5F1UA 2NLIA 2QXWA 4MWAE 1KBIA 1W1YA 1OX4A 4GY7A 4OZOA 5KZ6A 1L2UA 4W84A 3A9BA 4PBFA 3W2UA 4MWAD 1QOPA 1XF0A 3ANYA 1NDVA 2VCAA 4RLIA 2YXGA 3MDWA 2F8QA 1TPDA 3CQKA 3SB0A 4GYPC 4I90A 2Z27A 2INEA 1TJRA 4C6JA 3LENA 5FESA 1EJVC 3FGCA 1Q6OA 3LHYA 1G01A 3WO8A 4JIRA 3HV8A 3QQWA 3WLLA 4U10A 3TSMA 2HVNA 1YE6A 3S8HA 1HKVA 3ARPA 3FLUA 5HR7A 1R3RA 5I79A 1TE1A 1BGGA 1I2PA 2BTMA 3R7MA 1XX1A 4PBGA 1KGXA 2XISA 2I56A 1E4LA 1WOBA 3WF0A 3L0KA 5J5DA 2FB3A 3FVMA 1WDPA 3RRAA 3CB3A 3H2NA 1F6PA 2AAMA 4HD5A 1AQFA 4JXCA 2YBUA 3TN3A 3HPZA 2DSZA 3P6LA 1P6BA 2O92A 1IEIA 5FF2A 1PB0A 2YCEA 1R9ZA 2YCJA 4H9YA 3WH5A 1M65A 1ZJHA 3TCSA 5G2IA 2GVYA 5AB3A 3N2TA 4LANA 2XZ7A 4F3HA 2BWGA 4TV5A 1RLCL 1XS2A 4WDWA 2OEKA 5ENLA 2D73A 2XJ7A 3F2BA 1V77A 4FXFA 1TCDA 2VOTA 2CLPA 3ME3A 3VIFA 2GSEA 5CBJA 1F05A 5REQB 1K70A 2XUCA 4H9UA 3I6RA 2PDCA 3MUXA 4M0XA 4FA3A 5EA9A 3GLCA 3GKAA 2CXGA 2EG6A 5BOEA 4H1ZA 3BW4A 3UVIA 1HJVA 1RJQA 1ADDA 3F4CA 1K7XA 3WY1A 3WQ6A 3EOLA 2Q8XA 4PMDA 2OLHA 3L2IA 2VFFA 4PCTA 1UKOA 2WPBA 4XVEA 2ISSA 1YADA 2E9MA 3IV3A 2GK1A 4GO9A 5DEZA 3TZFA 2WLYA 1TRIA 1E6ZA 1UWSA 1B3WA 5AZ0A 3LCFA 3VIHA 4NF7A 2PD5A 2DT0A 4UWMA 3NQAA 3GVVA 4XAGA 3M9YA 3SCNA 1UJPA 3FDKA 2Q6ZA 3TSBA 4L9YA 1VP5A 3MMUA 3MKCA 1ZALA 3ALGA 4IPJA 1Q6LA 1FY6A 3EWWA 3TOYA 4ZQPA 1LOSA 1TQXA 5FEXA 1E6SM 1X97A 3VNKA 1BYCA 4OTKA 3WF2A 5AC7A 3UY7A 1C29A 4LU0A 3V5CA 3EX1A 4HYVA 3GTNA 3AWNA 4UBPC 4TUFA 4AZIA 3DFQA 1LWJA 3DKLA 3W1MA 4N9BA 4I5UA 1FCUA 2WWCA 3PUGA 1W1ZA 3CZJA 1GTHA 1DWAM 2VC7A 2BGNE 1J8VA 4LF2A 4NX5A 5DCDA 3OBKA 1GVSA 1FA2A 2F6XA 1KBLA 1SW3A 2IKGA 4PBEA 3UZ5A 4H4IA 3C4UA 1KA9F 4RZ5A 2X1RA 1Z44A 2F2HA 2NVDA 3H53A 1D8CA 1OFRA 1AJ0A 4YJ5A 2Z7KA 1DOSA 1CW2A 4PL1A 1R30A 1UBPC 2DSUA 4DYEA 3WX7A 3OGVA 1Y65A 2VJXA 2RH9A 2VFDA 4LALA 2PWEA 1SFJA 2PCQA 1CXKA 2GGGA 4MDPA 4RDYA 3DN5A 3G1XA 1KWGA 4WHBA 1NOUA 3SEPA 2J7GA 4IG2B 1ISWA 1MXDA 3L68A 1UR2A 2DUAA 1MQPA 5CLTA 2PWVA 1KB3A 3PN8A 2ZOXA 4OUIA 1A50A 2ZX9A 3QGVA 1E9LA 3DXIA 3K1GA 1A3HA 5EMKA 2ZVRA 3S1VA 1CBGA 5FL1A 2CZ5A 3RLUA 3QGKC 3D0CA 3FA4A 4LYRA 4JOMA 5HMEA 1PPIA 1PIIA 4FNUA 4F0KA 1XSKA 4UQEA 1N2VA 4NJHA 1Y5XA 3WD3A 3AXIA 3CIVA 1TR1A 3T9PA 3N9SA 3UJEA 1QDSA 2QVHA 4WIWA 5CKSA 3E02A 3W29A 5JIPA 1AH4A 1XDLA 1LQ2A 3VOGA 1W1VA 3EX4A 4KCWA 4B4FA 1UD8A 3S1GA 3NG3A 3QV8A 2CLMA 3U48A 4AVOA 4H83A 2CNCA 4S3EA 3UA4A 3WQPA 3QMRA 2WCSA 4HA0A 5J8LA 3B9NA 3SJNA 6PTDA 2OQYA 2JQXA 4ACYA 1YDOA 3TC7A 1IZJA 4MFDA 4GC3A 3RU8X 2PLJA 1R3QA 4LBSA 3DESA 1NF0A 2BZNA 1U5VA 3BH4A 1ADSA 3CO8A 3N9KA 3VE9A 3KVLA 3IIVA 5A8QA 2OGYA 1DXEA 3USBA 1ODZA 3B8SA 3HURA 1KFWA 5D05A 3W7RA 1UROA 4R88A 3U2ZA 3NDZA 3CTTA 4FNQA 2FLIA 4QAIA 2R91A 4L80A 4JTJA 2BX7A 1GW1A 2NWSA 2BDQA 2Z4GA 3GFXA 4UMAA 1JZ6A 1QHPA 4UC5A 3G1AA 4DF1A 4OU1A 1P1XA 4H2CA 3DDMA 4TX8A 3SBFA 4A2SA 1KKRA 2XGIA 4HYWA 2RDTA 3RCMA 2HCVA 2PDLA 3W24A 4BEQA 1T6MA 1PEZA 4EX4A 2V5BA 2CCRA 3WUGA 1KTNA 2A7NA 3W73A 1JZ3A 1XI3A 3V0SA 1CDGA 4Y8EA 2XM1A 1P0EA 3VGEA 1ONWA 2YDAA 3P60A 1HZYA 4TTUA 4WVXA 4FP1A 3W86A 5I3GA 1EDGA 4RK8A 4UTWC 1MXGA 1Q4WA 1Y5WA 3G22A 1ISXA 4GUIA 4DZ5A 4E8GA 3NSMA 1OIFA 4ZQMA 5DN1A 4ILSA 1EXPA 1BQGA 3ZVIA 3LM3A 1YPIA 1VGAA 1A5SA 4DY1A 4TVDA 1Q13A 3OHIA 1AG1O 4WZHA 1T8QA 1H63A 5AY7A 3HQOA 1E71M 3S2LA 3N15A 4GINA 2I5IA 1D3CA 3BLKA 1EDQA 4ZFMA 4HU0A 3LB0A 3W00A 1QWKA 2Q3OA 3BL3A 2EF9A 1DQUA 1EGVA 4CNOA 1KLZA 1BF6A 1DE6A 1H50A 3M7WA 4L1XA 1R9XA 1VLIA 1TX2A 4HJWA 5DY3A 1SUXA 2NSXA 3HJZA 4EOUA 3UXDA 3L0GA 4KEVA 4GXMA 1GG0A 4Q8MA 4ZE5A 3K13A 3ABRA 3ES7A 5KZEA 1RXOB 3HG5A 3TR9A 1O1ZA 3PZOA 5I2UA 3L21A 2BFGA 1LL6A 3T0BA 1BKHA 4NIRA 2YX0A 2EJAA 5LGXA 2EO7A 3VKKA 2MNRA 3CHFA 3BZJA 1AUSL 2XHYA 1UUOA 5I07A 3GB6A 4C7DA 2ZICA 3VDAA 2A3BA 1JDEA 2WCGA 1I2NA 1XIMA 3BJTA 1IE7C 2A1YA 5BXTA 2PODA 4EWJA 1FHLA 2RDXA 3AU6A 3INPA 4UQ9A 1ICQA 1XLKA 3W87A 1W2VA 1L6FA 4Z1CA 3W7IA 2TPSA 3UPMA 2PD9A 4YLWA 3S2NA 3TC3A 4KCVA 1B54A 4OGZA 1ICPA 3FA5A 3LRKA 2CKSA 1O5KA 2RKXA 3MBFA 1R2RA 2PRMA 3A47A 1UR1A 4PTXA 3EXRA 4IMDA 3UCDA 2QEZA 4IHCA 2FTWA 2XVGA 3S42A 3TN5A 2CLKA 3LRLA 3O6AA 1GOMA 3RLHA 2TMDA 1EJUC 1LWHA 1FKWA 4AZBA 1XRSA 3ATZA 3AMDA 1JUKA 3KZPA 2ZVIA 4LBUA 2VKZG 3FYOA 3QYSA 3QR3A 1VHCA 5I00A 2WJFA 1KFBA 4NJGA 2B31A 3SSJA 3B8TA 2OMAA 1OX6A 2ZTJA 2CZDA 2HDJA 2GDQA 1SW0A 4XV0A 3ANUA 1M7PA 1RCQA 3PTQA 1JD7A 4L4MA 1R0MA 1O68A 3UG4A 2J13A 2NW0A 2BXZA 1MQRA 3HFTA 4FI4A 4HYRA 4Q8WA 5LGZA 4YYCA 2DT2A 1SFSA 2YCLA 4UQBA 1IXPA 4QR6A 4UCFA 2GGJA 2VP8A 2VM8A 2XG9A 3H2EA 4LXFA 1DE5A 4ADUA 3VNMA 4UR9A 4IX0A 3URBA 3CUFA 3Q65A 4K8EA 3IUIA 4QDWA 4DAIA 2NV1A 3CUGA 5CAKA 4M8UA 4IIFA 3TX9A 1Q45A 2Z1WA 3RPDA 4HA1A 2WXDM 2Y63A 3MVIA 3NZGA 4WKFA 2V6AA 1W91A 2AAAA 4PODA 3BGAA 1TTPA 3ES8A 3VO0A 3PTDA 3WFZA 4K1WA 4KQNA 3I7SA 2HBVA 1K6WA 5DMNA 5D9PA 1WZLA 3B4YA 2I17A 3MYPA 4XZLX 4FIRA 1UKQA 1GQNA 1TV2A 2A21A 1GOIA 1Z48A 2J7DA 4ZR8A 2J8TA 3WIJA 4BFAA 4HN4A 4PMYA 1RJPA 1Z7AA 3LHWA 3AXMA 2CZVA 3EDJA 3EYPA 2OZ3A 3GTXA 2BGQA 1XYMA 3OPSA 4AB4A 3DYMA 3I3BA 3CQHA 1A5OC 1GHRA 2W79A 3QW3A 2JBMA 3MCOA 4JY8A 4V27A 1UH2A 1HJQA 4TQTA 2VZVA 1EHAA 4AX6A 1UWRA 4X61A 3TSDA 2X7VA 1SJDA 2Y8VA 1Z41A 5BRBA 1MQQA 3IJIA 1OD0A 3T09A 4GY0A 2ZRZA 4DNMA 4C6BA 3H23A 4UMBA 5I09A 4O54A 3PAJA 2WJDA 1KM0A 3AIEA 3VNDA 3KBJA 1BVNP 1F3XA 3W7PA 1AK5A 1OVDA 5HJYA 2ACQA 2WJZA 3WDRA 4PRRA 2A85A 5E0CA 4HK7A 4J2PA 4MGGA 2WMJA 4QG8A 1VFTA 3K4WA 1X1NA 5DT5A 3VI2A 1I8JA 1MZHA 4K8HA 4GNKB 5EFFA 3RILA 2OWWA 5CG7A 3H24A 2GUUA 5I0DA 2CIPA 1JF6A 1H0GA 2O7SA 3W07A 3M0KA 3WBXA 2H8ZA 1DBTA 5CAHA 4L9ZA 4M29A 4QM1A 4J3SA 1GVYA 1N8FA 3KVMA 5I6SA 1AZ1A 3KUMA 3OLIA 2W0UA 1LUCB 4LAUA 3WBYA 3TQ0A 1C8YA 4M1BA 3TU9A 2WMGA 5FAGA 4XO7A 1OG0A 3OEXA 3K5XA 2QULA 3GG1A 3BCDA 4UTJA 1V3IA 4TIMA 1QI0A 4LNCA 3AHXA 2IPWA 2BASA 2XFFA 1ODUA 5BXPA 1GJWA 1S5WA 4AMCA 1OX5A 4P7QA 3S4TA 2CLOA 3BMXA 2VC9A 1XLLA 1TWDA 1KM2A 3ARRA 2VDIA 1MEIA 3O63A 1R87A 2Z24A 1ONEA 1PUDA 3E0IA 5FF0A 1XIGA 4OWGA 1XP3A 4LAOA 1FHDA 2O56A 3OP2A 3TONA 3PB2A 3EPOA 3S5SA 5I3HA 3Q94A 3CU2A 3VYLA 3V3WA 2GLKA 2HS6A 4DN1A 4F4RA 4H6EA 4O16A 3KTCA 3QC3A 4U33A 2HPIA 2QJGA 2HISA 2J7BA 4XUGA 3CV6A 3MZ2A 5CGMA 4FNRA 4WXZA 3R8RA 5H6HA 4MUPA 7PTDA 5JH1A 4FB7A 2ONEA 3RDKA 3JU2A 4MDOA 4I9MA 4FPSA 3GR7A 2C7FA 3WNLA 5F4SA 1ECEA 1CXHA 3KP1A 2OSYA 1ZGDA 2WVVB 3Q2DA 3KBWA 3IANA 5CPLA 1SMAA 1X8CA 4GVIA 4JTDA 1ECQA 1PDYA 2CWXA 4HPGA 4DYKA 1TR9A 1TVPA 1WZKA 3CEPA 4KWSA 1XCWA 4NZJA 8CGTA 1C8VA 5AC5A 3DHFA 1GYLA 2OPJA 4LS1A 1DWIM 1NFGA 4WGHA 4CD4A 1X1OA 4NNBA 3QZEA 1DEDA 2FZ9A 4TMCA 1NM9A 1HJXA 1JD9A 5AC6A 3NM1A 1WAWA 3K4AA 4IMAA 3RFAA 2G96A 4PB4A 3JRKA 1PZ1A 4L5ZA 1H4PA 4GI4A 5HJLA 1LLWA 3FJLA 4A3HA 3ZT7A 3B06A 5G1MA 2QJJA 1MW1A 4HHMA 4IJCA 5FF4A 1M5WA 3WNKA 3GHRA 3KL0A 1UH4A 4S23A 1QXLA 1B3VA 3WL1A 4QE4A 3UG3A 4FNSA 1E6NA 1IEVA 2QVNA 3PFMA 4UTKA 5DMLA 2VMFA 1UW9A 3CH0A 5HUPA 4DPPA 1CNVA 4Z2GA 5JQ9A 4C91A 1VRXA 1EX5A 4WY0A 4GVFA 1WO2A 3SUTA 2OT0A 4AMAA 3W4RA 1TIMA 1BSIA 4HMCA 4PTNA 2BY3A 1RY0A 4ALDA 1W5OA 1V6TA 1U33A 3VNYA 1LROA 1V0KA 1LLZA 1R6WA 3SO7A 4RJEA 1ZENA 2VWTA 1EGMA 3DH7A 1GZ1A 5L9FA 1D2KA 2GVEA 3G8RA 3AQUA 4MB3A 4ZSTA 1TUFA 3FEMA 2UY3A 3PJXA 1FWIC 3QSTA 3G0XA 4G7EB 2FKPA 4MM1A 5G5IA 3CPGA 3DGRA 3QN3A 2V67A 3GX9A 3BANA 1TVLA 4B5VA 4J3VA 2YFOA 2NLYA 4HA4A 1GUVA 2I5QA 1U2YA 3VX0A 3P14A 3EOSA 3BWWA 1J0ZA 2PURA 2V81A 2WZHA 3BC9A 3GHSA 1I0DA 2NXIA 4HB7A 1ZL1A 9XIMA 1W9PA 2O9TA 1IV8A 5F2LA 1JCXA 4J1OA 3W72A 3N17A 1TJ1A 1UH3A 3FVDA 3GDMA 3RM4A 2FTPA 5FEWA 2BBFA 1Y5VA 2ZA2A 4REQA 3ALFA 3TCEA 3HBLA 1LDCA 1XG4A 2NX3A 3SFKA 3HV9A 3LYEA 4GIAA 5AYYA 1WP6A 3H4XA 5BXSA 1LL4A 4I8DA 1CWYA 1NTHA 5CCZA 4PE8A 3TA6A 5D38A 1DKWA 3CM4A 3TR2A 4KETA 3VIPA 3EKLA 3LOTA 1IYXA 1SO6A 4PCNA 3NZ1A 3U8GA 3SW6A 1KM4A 4GVHA 3VINA 4GQQA 1EA9C 4AHPA 2XVNA 4UFMA 1RHCA 4NRRA 1ZFJA 1ZZMA 2VENA 3AJ7A 4DUOA 1D7FA 4JTHA 3SUSA 3GYEA 3WBEA 1JDAA 1FWBC 2W4XA 3ABOA 4HOXA 3QW4B 4GCXA 3SCVA 2E3ZA 3LD5A 2RHGA 5A6BA 1XICA 2RGLA 3CASA 2ATSA 2YFNA 4G6CA 3C3NA 1KFKA 2JEQA 2C1HA 2WC7A 4KERA 1UOKA 1S5MA 3MMDA 2GUYA 1BWLA 3GVWA 5E9AA 3FNDA 1TFVA 4EAMA 4N6EA 3G1RA 1A3XA 4F40A 4P8WA 1XCXA 4UXDA 4FX6M 4B92A 1H7RA 3GDKA 3UR2A 3IK2A 3WF3A 5D32A 2TRSA 1SR9A 1P48A 3AMCA 2V38A 1JI1A 1OFEA 3UT0A 3MW7A 3VFLA 3GXMA 3HFYA 5IBXA 2Z00A 1K6AA 2Z2BA 4NJJA 1JGMA 4YWIA 4CCCA 1R86A 3CNYA 4AZCA 1UMLA 4DWSA 3GW0A 3IJDA 4PYSA 1UHVA 1KNWA 1XYCA 3O6DA 3Q45A 1GOWA 5KSWA 1FCVA 3PZUA 2A5HA 4XO6A 3FW6A 1RPKA 2GJRA 1ZPTA 4Z2KA 1XD0A 4JFVA 3NZPA 5HUOA 4CN6A 2XIOA 1YNYA 5CC3A 3ONBA 3PS7A 4IIBA 4NJIA 3L65A 1UA3A 3E38A 3GTHA 4CN4A 3DYPA 1U22A 1PV8A 4DI9A 2PU0A 3AXXA 4CNNA 4KWOA 3GE7A 4GJIA 4AZ5A 2A3HA 3STEA 1SW7A 4UR8A 3GKFA 2B4GA 2V3EA 1P0DA 3BGJA 3EB3A 5LNVA 4AXNA 1BSLA 4PC8A 2BY2A 4GQGA 4ROPA 3MO4A 3DZ1A 2PDHA 2O9OA 2BXYA 1K9EA 3DG6A 1FDJA 3CMGA 3PTMA 3TW7A 3VXGA 3UZXA 4Q32A 5FJRA 5A6AA 1TV3A 2PP1A 4LUTA 4F66A 4PUNA 4PMRA 1WPCA 2FFCA 1Q6CA 6ENLA 5H8UA 2WMIA 4O0QA 3CUHA 3V5FA 2CETA 3JW7A 5DRIA 3RXZA 4HOZA 3OQEA 1OBAA 3ZMRA 4QLLA 3UG5A 4BWLC 4CNPA 3GQYA 3VZZA 1POKA 1HNYA 4LGXA 2CC0A 4L6OA 2RUSA 3L5AA 3QY7A 3AUOA 3W27A 4PMJA 2ABBA 2ZKMX 3VGHA 1GVQA 5E6YA 1ZUAX 3QPYA 1ML1A 3C86A 2V5DA 3A24A 4Y9MA 4C60A 4DX3A 4K8GA 2PAJA 4AQLA 1QAPA 2YKKA 3ORWA 2NQLA 4DNHA 3TZNA 3HGSA 3R79A 2BLEA 4MNLA 2RDWA 1A0DA 2IMRA 3UWZA 1OFBA 1CB2A 3OLEA 4KFOA 4GC4A 4OE7A 5D9MA 1R7AA 1FWNA 2ZWZA 2PGWA 2V2CA 4CEUC 1FKXA 2HE5A 4RZ6A 1EL3A 3LK6A 3G6LA 3BJSA 1CGWA 2IKIA 4W86A 6XIAA 3MI3A 3LM7A 2HXUA 2NUXA 2WAGA 1PJ9A 3PC0A 3KBNA 4Q8VA 2FFIA 3MA8A 1UWUA 2PDPA 1VEMA 1S46A 2BHUA 2P76A 2HK1A 2KX9A 4JKLA 2C19A 2PWDA 4KMQA 1RQBA 4DF2A 3PUEA 5JBDA 3GVQA 3ITGA 1E43A 1JYNA 4HU8A 3W3OA 4F0RA 5FSEC 3WDJA 2ZZ5A 4AWUA 1QRQA 2PTWA 3SM0A 1CECA 3RR4A 1AW5A 4DRSA 4A8NA 3B40A 3LSBA 4QEHA 3SY1A 4LY8A 4FS9A 1VFSA 2E5CA 7A3HA 1OYCA 5AHEA 3EA3A 2X09A 3WJZA 5I3IA 1QWGA 3BLPX 4E38A 5I02A 8RUCA 2PPGA 4GXPA 4WD0A 4CU6A 2QCDB 3T81A 5I3FA 1LRTA 1FWTA 2CWNA 4N02A 2F6KA 1WNOA 3CXOA 3LCHA 1YKWA 4FF7A 4IGNA 1OT2A 3VCCA 1WYIA 2F84A 4AC7C 2X0YA 1REQB 2EKCA 3C61A 4HNVA 1MRAA 3RMJA 3H6OA 4GGBA 1WXYA 2EPOA 1P7TA 3WJYA 1X6NA 3CEUA 1GOKA 4O15A 2Y1HA 3TP4A 2ZX5A 3ARZA 3R12A 3UETA 1S3HA 2ON3A 3MU7A 3IJLA 3B04A 5KZMA 5AHMA 3W2LA 3W7KA 2JEPA 4BI7A 4BEUA 5EB8A 3LNPA 1V3KA 4HJFA 3E2RA 1E0VA 2ZWYA 4IX2A 3SAZA 4ZQRA 4AEFA 2Z2UA 3QV7A 4IFRA 5H8PA 3SCUA 2OU4A 3OIHA 4F0LA 5IFPA 4Q8TA 1BG9A 4EF9A 3M0LA 2JF7A 1RSCA 4ZTXA 5A6TC 2Z28A 5H1WA 3AMGA 3RJXA 1FDZA 1JULA 4XIMA 5LXEA 3EWZA 4N42A 1OM0A 3HQNA 4JQAA 1S2AA 3BCFA 4XZMX 1VBRA 4IIHA 1YTDA 2VGIA 4LNYA 2C0AA 1JZ7A 2PDUA 1B57A 2CEQA 5F2IA 5G4HC 4HZ8A 3TYDA 1GQJA 2ZRXA 4Y9AA 3LZ3A 4CNTA 4QCFA 1YPXA 4WDXA 4GCAA 4A3YA 1CLVA 4QQUA 5LA2A 1FWJC 4P8UA 5D2XA 2PGFA 3KTSA 2WHKA 1R8LA 3RLVA 1NIUA 2WSKA 5REQA 4IMCA 1XKYA 4XSLA 3BE7A 3E0VA 1XLDA 3W1TA 4MG4A 2V82A 2PZ0A 4AIBA 3S1WA 4QRNA 4O13A 4OV9A 3REQB 4M3PA 4ACZB 2G4JA 4XAFA 3B8DA 2PF0A 1DQWA 5A95A 3EXTA 5EKYA 2IW0A 5TF0A 2E5BA 1DIOA 3UR5A 3CUXA 4E2DA 1NDZA 1AW2A 2XH2A 5FIPA 3THUA 1W8GA 3KXQA 1KM5A 1ZNNA 3ZS4A 1UR8A 3SQLA 2QCFA 4PCFA 4KW2A 1HO1A 2X7WA 1EXBA 1SQ7A 2XIIA 5E5CA 3S6DA 3ZXWA 3NDYA 2Y24A 3WH8A 2HV5A 1JUBA 2VR4A 5E93A 3VMPA 4F9DA 1CENA 4EAYA 1YHTA 4PZVA 1XSJA 4PSRA 3N4FA 1UWIA 3UJFA 5BOOA 3R13A 4D6DA 5TD4A 1US3A 2GOKA 3NZRA 3PFRA 4GNJA 1KV8A 2BS9A 4OVXA 3WJSA 5BU6A 4D6IA 3EX2A 2DT1A 1KXTA 1V79A 3ZWSA 1O66A 2ZA3A 5CPMA 1TWZA 2Q8ZA 3HQ1A 1ME9A 3DGBA 2PBGA 3RHGA 5C55A 4LRTA 1VZWA 4DJEA 4O10A 4S3DA 2AKMA 4H9XA 1EP3A 4R7WA 3QJAA 2XTKA 4NILA 3OZYA 1H1NA 5LNWA 5IHSA 3SI9A 3ZR5A 3R0DA 1XLIA 1E9IA 1XUZA 4LW7A 2FHBA 3W1LA 4C6NA 3W2MA 4XBSA 1KFLA 3DC8A 2DZBA 1KO0A 4R7JA 2UY5A 1CIUA 1XXXA 2E6DA 3N12A 1HGYA 3TTEA 1W1IE 1LF1A 4IG2A 3GNXA 3GIPA 3DENA 3G1FA 3IVUA 4JYFA 1UZDA 3TW9A 1M6JA 4IUGA 3MSYA 1N55A 3UCCA 3WJWA 1XW8A 1KR0A 2DSKA 1BXNA 2QT3A 4HTYA 2D69A 1E73M 4QEEA 1PAMA 4RNIA 3QGAC 3QHOA 1FTXA 3O3RA 1W3NA 1W3LA 2IPGA 4BQ2A 1GT8A 1AH3A 3QQ1A 1RBOB 5KMYA 2VDHA 1UP0A 4DI8A 2ACRA 3BV7A 4ZVJA 4UQCA 4W4QA 2QDHA 2EG7A 4PMVA 4K2SA 2B81A 3FEQA 1PX3A 2AMGA 2TODA 1E55A 4CEXC 4BF9A 4DVOA 4PTWA 5FCZA 3EBVA 2PLMA 2G50A 1SZFA 4IF2A 3ANVA 2OLSA 4W93A 2PEVA 3GDBA 2HEJA 4C7GA 2VT0A 5EU9A 3ITXA 1V02A 1K8XA 2EAWA 2PGRA 3IACA 1Y0EA 1SM9A 1F3WA 3FSUA 3VNIA 1HF6A 2GDUA 3GFYA 4CQDA 4RXFA 3DFSA 4JY9A 4DXXA 3VK5A 1S2UA 2EHHA 3W53A 2CHNA 4J27A 3QOMA 4LVDA 3V35A 4K37A 3V1HA 1H62A 1MSSA 1W3KA 4I3GA 3WUFA 4RW3A 1RY8A 2WCAA 1BHGA 4NKCA 3T7VA 3BGGA 5EYWA 4QTGA 1QK0A 3IGXA 3VD3A 3WLMA 3SQMA 5IM51 5BZAA 3W71A 3E1F1 4DELA 1UWAA 2ZX6A 3KRUA 3BARA 1RJRA 4P7OA 4ENLA 1PKYA 4IIGA 2ZDRA 4FLQA 4Y9NA 1W32A 3T2QA 3LPOA 4UZUA 3M5XA 2Y0FA 4I6KA 4XISA 4TOQA 2CBJA 4JX4A 3EEZA 1NQ6A 3VOJA 2DH2A 2EBNA 4P7NA 3ARWA 2GVLA 1LL7A 2CLIA 3C2RA 3P81A 3R0UA 1GVRA 4TO8A 1OD8A 1BF2A 2FGBA 5ECVA 4CLMA 4X9YA 1V03A 4HK5A 1G5AA 3FFSA 2XPKA 1E0XA 4W8AA 4JFWA 1OJXA 1WAUA 6TAAA 3FV9A 2X8RA 4X60A 5CC5A 1X7IA 4Y7EA 4CD7A 2YB4A 4S3GA 4MHBA 2E28A 3GK0A 4E8CA 1OZMA 3MQTA 3THQA 5A8GA 4INFA 3WK0A 4H9MA 3A22A 2CLEA 2YW3A 3LTYA 3MSGA 1XRTA 4BF5A 2GQ3A 5U4NA 2HS8A 4UMCA 3L4XA 1FBAA 3GIQA 3H4GA 1E15A 4QNWA 4W88A 4B2DA 4W85A 4PN2A 3HM7A 4WLCA 2JKPA 1B4KA 3A64A 2C3ZA 1R7OA 1HJSA 1TWIA 1XBXA 3N4AA 1N82A 3NQVA 3W7LA 3UXIA 2A3LA 4RCXA 4C5YA 2OYLA 1IWPA 5D02A 4PUEA 1NEYA 1NWSA 4XWUA 3DX5A 2VCCA 3DEQA 3DI0A 4KCUA 1XIFA 1UD2A 2Z2AA 3V36A 5FJPA 4PGLA 4Q4OA 4FX8A 1A5UA 1E4IA 3WK3A 5CZSA 2G41A 5AYBA 3DHDA 3WLJA 2XN1A 2H3BA 1K1DA 2GPTA 6TIMA 3P67A 3AMLA 3QZAA 1CGYA 3HQPA 1WKEA 3PANA 3H7UA 5HQMA 2G3NA 4EE9A 3S2CA 1Z32X 2PA6A 2Q01A 3UPBA 1PX4A 3VNJA 2DZWA 4C6QA 4O19A 5M5DA 2ZZ1A 5T9CE 4CNUA 1E56A 4LCQA 1QPNA 3BG9A 1HW6A 1UR3M 1ITUA 3IGUA 1Q5MA 3P84A 1VYRA 1I4NA 3TW6A 2OR2A 2CKRA 4WQ6A 5A1AA 1U5HA 2GGIA 1FCQA 3GXIA 3V75A 4OT7A 5I3DA 4JTRA 4Q4QA 4ES4A 1HKWA 1S3TC 2NT0A 4Q4MA 3KBVA 4PB3A 3W7GA 3B0VC 3F03K 2J75A 4KT2A 1QW9A 1W3TA 4LAZA 3CPRA 1U1UA 1H7PA 3IIOA 3RCNA 4RE0A 3LHUA 3MCMA 4H7ZA 2PUZA 4AF0B 3P61A 1J12A 2POTA 1QUMA 3VFCA 1B30A 2IXUA 3TJ4A 1R47A 3H26A 1XPYA 3H54A 5CSYA 1XLBA 3FSTA 5CBIA 2E67A 2ISVA 3HMCA 5EY5A 2QKFA 1M04A 4P7LA 1R9YA 4XK2A 2DZSA 4HNCA 2WQPA 1LG2A 4Y8FA 2BHYA 1L8PA 1T40A 3WNOA 1C8XA 1F74A 1TZ9A 2YL6A 1G7UA 4BY3A 3GHTA 2NV9A 1VYSX 2PDWA 2NVCA 3GM8A 7CGTA 2E25A 3A4AA 3W7DA 1OT1A 4FNPA 2OKOA 1F76A 2R24A 2XFRA 3DECA 3IGSA 4QSFA 2P53A 1O95A 5GJPA 1ZBKA 4F0MA 3VIMA 1QI5A 3WLPA 4YHEA 1D3HA 4JS3A 2I7GA 4PMNA 1TA3B 2W6RA 3AC0A 3L2MA 4G1NA