3GVQA

Urod single-chain dimer
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate shuttling between active sites of uroporphyrinogen decarboxylase is not required to generate coproporphyrinogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
total genus 120
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gvqA00
4L5ZA 3GW3A 2NQ5A 4WSHA 3PPFA 3GVVA 1JPKA 1R3RA 3PPHA 4L64A 1R3SA 3GW0A 4L6HA 4ZR8A 1U1JA 1R3YA 1U1HA 1XPGA 2EJAA 2Q6ZA 3GVRA 4ZTYA 3RPDA 1JPHA 1R3VA 4L65A 1U22A 3BQ5A 4L61A 3GVWA 4AY7A 1U1UA 1YPXA 1JPIA 4QQUA 2INFA 4EXQA 1J93A 3BQ6A 1UROA 3PPCA 1XDJA 2Q71A 3GVQA 1R3QA 3T0CA 1XR2A 3L7RA 3PPGA 4L6OA 4ZTXA 3CYVA 1R3WA 1T7LA 1R3TA 4AY8A
chains in the Genus database with same CATH superfamily
1TIWA 2BMBA 4WSJA 1AMYA 2WC4A 2ZE3A 3E96A 2FPTA 4DUWA 3T09A 4BWLA 3MDWA 1I2NA 4NJGA 4XISA 1HIZA 4HZ8A 3LHZA 3WLOA 3GIQA 4CQDA 2Z25A 1I2QA 1XSIA 2VKZG 5JH1A 2CKRA 3DG7A 4PTVA 3G1YA 4HHMA 5BYWA 1D8WA 1BXCA 5H91A 4I7VA 4WDUA 1Z3NA 3VD7A 3B8SA 3KVJA 3VCRA 1TPWA 3W83A 3CTTA 3GAKA 1ZAIA 3DFOA 3DFHA 3F4NA 3KZPA 5A8OA 1X1ZA 2PTZA 3VFCA 2YW4A 3OA3A 4X2PA 4D6FA 3S1VA 2YZRA 5DY3A 2YSWA 5AYZA 3HGRA 1KKRA 4KS0A 1UIPA 2O56A 3OYXA 2WLZA 3HGJA 3LPPA 3P6LA 5E0FA 1JJKA 1TE1A 3M07A 4H6KA 5AKQA 1XLIA 1FP8A 3L2IA 2QIWA 3GVWA 4Z17A 2XN0A 1GHSA 4I9AA 2RAGA 3CIXA 5C7VA 3AIWA 3TOYA 4DYKA 1TE6A 2W3ZA 2W79A 5CSUA 1UR0A 4TMCA 1UPPA 2PDUA 1XLMA 1TO3A 3GDKA 5C6MA 2Z7KA 3D47A 4LCRA 1PVNA 3TTEA 1XGZA 2I14A 5F4SA 4NI3A 1J96A 1TVNA 3W29A 3LGGA 4GO8A 3MSDA 3STPA 3BLIA 5E09A 3B8WA 1BYBA 5D04C 3S42A 2XH4A 4HHLA 2IXVA 3B9AA 4UMBA 1X97A 3KM8A 4NI8A 1WO2A 3F2DA 4UUIA 3L7RA 3MI3A 1TWDA 2DW7A 1UKSA 4AIOA 1XGDA 2NWSA 3TWAA 3W3OA 2YLLA 1DORA 2KAUC 3MWAA 1GYMA 1F6KA 4ZCWA 4CCCA 3UG5A 1H7PA 3ATZA 3W2NA 3VOFA 5E93A 1VKFA 4DAIA 4S1FA 4LNYA 3TSBA 2P8BA 2J9ZA 4O1AA 1CYGA 1PHQA 4W86A 5K9XA 4M81A 4JTIA 1JCMP 3P5ZA 1GQJA 1IEXA 1S2CA 3W27A 4U2YA 4A6GA 4UTFA 4W9TA 1P5BA 3DFNA 2V67A 2YYTA 3CUZA 3WBEA 4MWAD 3S2NA 3WDJA 4HPJA 1U22A 4JXCA 5I78A 3DHFA 4CQBA 1QCWA 3EWCA 2WCGA 3ENLA 1SVDA 3ZO9A 3R8RA 3HV8A 3PPGA 1HL8A 1M41A 3BG5A 1W1TA 3WDHA 1E9IA 3P84A 2J7EA 1HXJA 3S9ZA 7TAAA 1V6XA 5IOBA 2DPEA 1RAKA 4Q4QA 2C1IA 4P7LA 3B0VC 2FFIA 3WQPA 2RDXA 1LTDA 4S2CA 3CEUA 3MKCA 2WCSA 4LUTB 2XFWA 3AROA 2OFJA 5F4XA 2OYKA 1ZRQA 1OWQA 1J9YA 2DIJA 2AKMA 4O52A 1U1JA 1OFRA 2BFGA 3NEVA 4H9TA 1XBVA 2Y7EA 4AIBA 1HKMA 3RO6A 3OIXA 1BFNA 4H6RA 4CVUA 4PCFA 3HV9A 1G01A 1GONA 3CQKA 1UC4A 7PTDA 2GVLA 1KFWA 1ELSA 1LROA 5D03A 2JF6A 2NW0A 4YMZA 2GSEA 5A6KA 1IIGA 3NOYA 1XLKA 1TZ9A 3CZLA 4QISA 2JKPA 1TKKA 3W2JA 2JE8A 5C9RA 1QBBA 3A5FA 3N9SA 2PZ0A 2J8GA 5DRIA 3ARVA 3BV7A 4US5A 3K1DA 1WP6A 2X42A 4B91A 1K8ZA 3CHVA 2A0NA 4ZFMA 4UC5A 2B7NA 4JIPA 1V0LA 3BANA 3I68A 1H4PA 1Q3NA 1NELA 4ML9A 1JPDX 1XHGA 4ICCX 1JXKA 4TTGA 1DJHA 4ZQCA 3KP1A 5ABEA 4EVZA 3FSTA 5HPCA 3EMCA 4JL2A 4AX6A 3UBPC 4NT0A 5E5CA 3U2CA 2PU0A 3PG9A 3GW3A 4LY8A 4ACZB 3AHTA 4CLMA 2WC3A 4XTDA 1RY0A 2YCLB 3DZ1A 4XVEA 2ADAA 3SN4A 3MP3A 1M03A 3D5HA 1B1YA 4DXXA 1C8QA 3S5OA 1IR1A 1KM2A 3VPLA 4IMCA 4B92A 3QSTA 1KRMA 4ZO6A 5F2MA 1S5TA 2XJ7A 1GOQA 1L8PA 2WSQA 2OX4A 3XIMA 2D23A 2RDUA 1HKKA 3CS2A 3BV4A 1GTHA 1XDLA 4FNPA 4NZ3A 3LY0A 1D2KA 4BK9A 1I0BA 4NP7A 5A6MA 2C14A 3ZQ9A 4H9VA 4RZ4A 3ZOAA 3SEPA 1A50A 2DSZA 3BLLA 3T6CA 2CHRA 4FNSA 2QCMA 3H8AA 4IPPA 4PCTA 4MLJA 1EEPA 2ZUNA 4WUIA 3GNXA 4QCEA 2O55A 4HNOA 3RUBL 1DWFM 1WDRA 4AZGA 5A6SA 4R88A 4AZBA 5MF5A 5JBEA 2VFEA 2DZUA 2P3EA 5CPQA 3QR0A 4HCLA 1SM9A 2YFNA 3VNYA 3RRAA 4GIRA 2J79A 3EMZA 3BSMA 1W9DM 1TSIA 4MPKA 3HG3A 1JG9A 3EX3A 4Y9MA 2BOEX 4ERAA 2WMJA 1SFLA 4IP7A 1V02A 5HQEA 4X63A 4GC3A 3NL3A 4UTMA 3LHUA 3MYPA 3CMJA 5FD0A 3LXCA 1W9PA 2ZFAA 1BVZA 3TDFA 4ZSTA 3G8EA 3L4XA 1V02E 5I79A 2WMIB 3CWHA 2A3HA 4JX4A 1Z89A 5LNSA 4LUIA 1JEZA 3WK1A 4G56A 1K9FA 4KRUA 4WHBA 4JN6A 3A9IA 1UB3A 4GX8A 1WKEA 5DEZA 2VD9A 2XIMA 2PAJA 4DX3A 3VD5A 1FWEC 2OLSA 3BH4A 4YVXA 3UFYA 3SRFA 2GJLA 4H9ZA 2AQWA 4CNPA 3KOYA 1S1PA 4ZQNA 2XFYA 1TV2A 2J66A 1WKYA 1BYDA 4FX6M 2OGJA 5A6JA 4QLLA 4AZ7A 2ANUA 1SW7A 2CW6A 3C2VA 2VRJA 1ZZMA 3FCPA 2YXXA 1Q7MA 4JDYA 4NUWA 3N2OA 1UPMB 3OG2A 2QDEA 2BP1A 3UWWA 3IGUA 3L23A 2J25A 4Y8FA 3MHUA 4B2DD 1EP3A 1JPHA 1WPCA 1REQA 3TSDA 5AC7A 2EPMX 2H3DA 4FR1A 5EU9A 1OABA 5EBUA 3DI1A 3MO7A 1UG6A 3S6DA 5T26A 3LHTA 4W4QA 2JIEA 3ECQA 5XIMA 4L56A 3PSVA 3VI2A 2BVDA 2ZXDA 4MHBA 3F4DA 3W7EA 3G1DA 2AL2A 3FYOA 4RW3A 4HNUA 3A23A 3LLFA 1QI3A 1QI5A 4F0SA 3WD1A 1FHLA 2XSAA 2Z28A 1XW8A 4QG8A 3OOQA 1XFBA 1GWJA 3WK2A 1EQPA 2E5CA 1JD7A 1RHCA 1QFEA 2G97A 3L4WA 7ENLA 1JZ7A 3QY7A 1YE4A 2PTXA 4LUJA 5IFPA 4I3GA 3O8AA 3TP4A 3IRDA 3INPA 3GFXA 3N18A 1OIMA 1XIGA 4LB4A 3BCDA 2BHYA 3HPAA 2FVKA 5LIUX 4IMAA 4IT1A 1XIJA 4RK8A 1KTCA 1QJWA 3M5YA 1K8YA 3QZEA 1XLGA 2CLLA 4XSMA 6CGTA 3HU7A 1WDWA 2HSAA 5ENLA 2QNEA 2RDWA 4PA8A 3PJTA 1TX0A 5LNRA 1VFHA 1EPXA 4GYPA 1XD0A 3SSZA 4BI5A 1H7XA 3W6YA 1EYWA 4DPQA 1DE5A 1QT1A 1SGJA 5B7YA 5DN1A 2Y70A 4ONVA 3HA1A 2WWCA 2DFAA 2VR4A 3W2MA 3VX1A 4WXYA 3ELFA 1LWIA 2QUMA 4FP1A 1ME9A 3W6MA 4LBUA 4PUEA 3FHQA 1BF6A 4WIWA 2WVVB 3TVAA 4Y96A 2PBGA 2OZ8A 3W2LA 1S1RA 1ZAJA 3H24A 3PTKA 5KZMA 2H8XA 4Q4MA 3POHA 2CBVA 1C9WA 4JKKA 2ZZ5A 4GQ0A 1BGGA 3SZ8A 3ARRA 2CBIA 3V0TA 1XFCA 3SCVA 1VEOA 1EH9A 1UBPC 4OUEA 4OFCA 4FALA 4EK7A 5DANA 1XP3A 3VKCA 3E6EA 2CZEA 1D7FA 1IGWA 1LT7A 1O4UA 3W0KA 2MNRA 2CBJA 2BV9A 2DVUA 4NXSA 3VGBA 3WH7A 4LYRA 1S2AA 2GUBA 2PP0A 2PTDA 4GQQA 4S3CA 4QSHA 2PLMA 3WLLA 3BMXA 4AWTA 4EXAA 2ZIDA 4JQ4A 1OFDA 2GGHA 3UZWA 5AY7A 3FNDA 1GKQA 3W1RA 1LG1A 3PUEA 2ON3A 4N02A 4D8LA 3YPIA 2NT0A 3URNA 4GX9A 1OCJA 4EPEC 2ZRYA 4KEUA 4AD4A 2GDVA 3WUGA 3BW3A 1UP0A 4CQCA 2YLAA 2WVSA 4ADSA 4UNKA 4LANA 5TF0A 3W23A 1KTNA 1MQPA 4UZUA 5KTLA 3L0GA 4N9CA 1SO6A 2PMQA 3WH8A 1K4HA 2H9AA 3W71A 1AZ1A 1SFTA 5DFAA 3OYZA 1EB3A 1GOIA 9XIAA 3BQ5A 2E9BA 4LXFA 3PB0A 2BVWA 4IFKB 1J79A 2GGEA 4OJYA 3Q94A 2ZYFA 3DC8A 2HEJA 3ARZA 1ISVA 3IUDA 1FWHC 3P80A 5CXPA 3IGXA 1OD0A 3S4TA 1E4IA 1YDOA 2HS6A 2PWEA 3IJDA 1KXQA 4DBWA 4URIA 3W72A 1JI2A 4K2SA 3COTA 3W24A 5BCAA 1TZ7A 1EP2A 1FWGC 4DXKA 4LYPA 5BMWA 2FVMA 4IIEA 1E5NA 4W84A 4AWSA 4RR4A 1ME7A 1E6NA 1V93A 2Z29A 1SJCA 4PB4A 4PMXA 4RNIA 1LL4A 3GDTA 3I10A 4J3VA 1KWGA 2OMAA 1J0ZA 1QDSA 5GNXA 3F2BA 1G94A 1QW9A 5H6HA 3EKGA 3ZT6A 1XIEA 1OGGA 2GJXB 2QUUA 1RK5A 1H49A 3GXPA 1H3GA 2ZRXA 2WSPA 4GKTA 1SFSA 3KW3A 3L2LA 4Q8MA 2G96A 3UXKA 3BLPX 4P8UA 4U5KA 1LOSA 2TMDA 1GKPA 4MIMA 1MWOA 2ZUUA 1JDEA 4DJDD 3TOPA 4GI6A 2PDHA 1U30A 1QATA 1W0MA 4WJXA 3AICA 1NY1A 1OEPA 4CNOA 5EGRA 1A5AA 1I1WA 1L8NA 2Q3OA 3K4AA 4GG9A 1F07A 4PSPA 1X38A 3KCOA 1UR2A 3DYMA 3J7HA 2PTYA 4U4MA 3TU9A 1QW7A 1P0DA 4KEZA 4W93A 3M16A 2CLKA 2NLIA 3IVSA 2PEVA 1M6JA 1YNYA 3SGGA 3TFCA 2DU2A 4KCTA 3Q65A 4Q8UA 5JBFA 1ADSA 4ZQMA 3IVUA 4BQ5A 4I7WA 3MQTA 2ABBA 1M5WA 2L5HA 2JALA 4JX5A 2PDXA 4MKVA 1XYAA 1MUWA 2PWFA 3SUTA 2VEIA 2I5GA 3HN3A 4TIMA 2A1YA 4C1NB 1RXOB 4UTWC 3M44A 2CCRA 3CGTA 1S5NA 1EO7A 3P5YA 5CPNA 5C54A 1J0HA 3KAOA 4PBFA 4PUDA 3QF0A 4HJFA 4EAMA 4QX4A 1OFEA 1LLOA 2YFOA 4RDVA 4A3RA 1XWYA 2Y7FA 2HRWA 5A2BA 3E0WA 1E43A 4AH7A 4P8XA 1V3KA 4O4VA 3RMEA 3HURA 2HWGA 4ACYA 2X7WA 3KS5A 5FOOA 3QVQA 5CJ5A 2XVNA 1OCBA 2ZE0A 3QTPA 2DUZA 4QEHA 1E0WA 1UMYA 4QAIA 2PS2A 5BZAA 5AYXA 1MDRA 1T6MA 3N13A 5AC6A 3R8GA 1OGSA 1XYMA 1FQ0A 3GNNA 4GD0A 4D8AA 1EJRC 1E6PA 3HZ3A 5I7GA 3OO2A 4Z2KA 3LU2A 1GOWA 2XPKA 1T7LA 3BAYA 4N7QA 3VX0A 2QJIA 4C6DA 3CUFA 4A29A 1UKTA 2BASA 3VZYA 4M6QA 5J8LA 3N4AA 2B7OA 1R0MA 3H22A 3BJFA 4OTKA 1FWDC 1KM3A 2IUZA 3AI0A 1K8XA 3QR1A 3SN1A 5H8PA 1XI3A 3WNOA 4KWVA 2G0WA 3IIVA 3WBWA 3TONA 1V6VA 1KTBA 4S3AA 3SFWA 2PGRA 1Z69A 3OBEA 1GT8A 2QT3A 3FGCB 1EO5A 3SIZA 1FTXA 4IFRA 5D9PA 4XIMA 3VXGA 2X1RA 1XLDA 3CV6A 3WH6A 2V2DA 2XVGA 2ZUVA 2DT0A 3WMLA 5IDZA 4BF5A 4PTNA 3LTSA 2VC6A 4NX0A 1SFJA 4Y7EA 4HTYA 1VP5A 4A21A 1WUEA 5CZSA 3T78A 1FWTA 1XLCA 1ZNNA 1P4CA 1YPXA 3IIOA 1PKLA 1F6YA 3E12A 3LHWA 2YPIA 5CLWA 5CZTA 3BW2A 3QQWA 3KOZA 2HBVA 3VO0A 4JHMA 1E6SM 4GUFA 3WQ8A 2VZSA 1REQB 4LVAA 3O7UA 2PWGA 5CQ1A 2VWSA 4WCJA 4JFVA 4UFHA 3R94A 1H60A 3RR4A 1KNWA 1WXYA 5A95A 1R2SA 1JYVA 2X16A 1BWLA 3OODA 2V5KA 1QMLA 3PVFA 4LS1A 3V7PA 2OX1A 2NUYA 1XJBA 4FHAA 3WZ0E 5DMYA 4DUOA 4XVDA 2GGJA 3HMJG 1S5WA 4GO9A 2A6NA 1W3TA 4DPPA 3WF0A 4MAVA 3TYCA 1S2UA 1LCOA 2J88A 3MS8A 2WHKA 2WPGA 3T2PA 1BXBA 1J18A 3WG6A 5A8MA 3BOXA 3O6DA 1ZJHA 1EDQA 3R2GA 1ZGDA 4Z2LA 4GI9A 4HSHA 4FX8A 3AS1A 1UUMA 4A3YA 3GHUA 1F05A 4OBTA 4W7VA 2QIIA 1XSJA 4GQGA 2XGBA 4O1EA 2WMHA 3OHIA 1WE5A 4O11A 2XH2A 5M17A 1YX1A 3CL6A 1TCDA 5CAHA 3W7HA 1Q6OA 1X8CA 3MWCA 3T07A 2BY3A 1DJXA 3MO4A 4GZ7A 1MW0A 3ITYA 5CGTA 3AXIA 1L2QA 4J5NA 3O06A 3KDOA 3G1XA 1M9HA 4KWWA 3VILA 3BO9A 3R25A 1K9DA 1QPRA 1BTMA 4DVOA 3S5YA 2GFTA 2V68A 1SJBA 3W85A 4NJHA 3N6HA 3RU8X 4QROA 1VFTA 1XGEA 4KFNA 4O8RA 4Q8NA 1LBMA 3A6OA 5AVHA 4IIBA 3TFXA 2PODA 3LCHA 4GGBA 3AHYA 1XQKA 2PGWA 5EMYA 2FZBA 3AAMA 2D0FA 1K8CA 3IAQA 2RFGA 4RDZA 4NAEA 1IWPA 4Z1AA 4H7ZA 4NZ5A 4NYUA 3VZZA 1V51A 1XH1A 4BZYA 2CLIA 4K37A 3MUAA 2QGYA 4MKNA 2VTFA 1VJZA 5G5IA 2R14A 4NY2A 3SRHA 4GE8A 4MFDA 2CZVA 2TSYA 2AGKA 3H53A 3T4CA 4XO6A 3RLUA 1SQ7A 3F4CA 1RK6A 1V6TA 4S39A 2PZNA 2OZTA 4GA8A 1X6UA 4MLRA 3IS4A 1PKNA 3M6YA 1DVJA 2F8QA 3GXMA 2HXUA 4QRNA 2ESCA 3JUGA 4LB3A 3LSBA 3C3UA 1A5NC 4H3DA 1ZQ5A 1GEQA 1X7IA 4O19A 3HPFA 4D6CA 1D3HA 1UW9A 1QPOA 2QAPA 3EB3A 4KKXA 3SDOA 2YIHA 4WGXA 4KERA 1LL7A 3TN4A 1C8YA 4F79A 1EJTC 5HDRA 4HMNA 1X7FA 2V6AA 3BLFA 3MYOA 3M0LA 3AIQA 1JAEA 4PL1A 2DZWA 1WQ5A 2BODX 3SADA 2Y8VA 2EQDA 1CLKA 2I5QA 1XRFA 2D0GA 4JTUA 3VMOA 1JZ3A 1G69A 1TWZA 4DO7A 1PX4A 4WDTA 3CNYA 3ORWA 2XHYA 3TZNA 4DF1A 3WH5A 1CX9A 5ABHA 2OELA 1OYAA 3VCNA 2OR2A 3TTOA 2E6DA 3QW3A 2AGTA 2ZC8A 2A3BA 2B31A 3NR0A 2HS8A 3AO0A 1RQEA 3MBFA 5GJNA 4UFIA 4X3ZA 4CCZA 5CKSA 1HJXA 3EOUA 3CZ8A 3G3MA 4M6PA 1ZBCA 4WSKA 2X0HA 5I03A 3O63A 2PDFA 4WJ8A 1H1YA 1US0A 2W92A 1GVEA 3UW6A 4ALDA 1JULA 1PBGA 2YA2A 3S47A 4H9UA 4ZQOA 2NQ5A 3QV9A 5FAJA 3H54A 1WNOA 2OQYA 2V5CA 3NEHA 3G1VA 4HP5A 2DZTA 2ZZ7A 3QV6A 3ZJKA 4YLWA 2FZMA 1RLCL 3NYDA 4M19A 3ZSSA 4YTRA 3HPXA 3AZSA 1XD1A 3N2BA 2WJZA 1BPLB 1EGMA 1JXJA 1PO9A 5HATA 1EIXA 2G3NA 1J5SA 1BSIA 3BUVA 2NXIA 3FX4A 4NAFB 3VNKA 4MB4A 4JY9A 3EEGA 1TR9A 4LT9A 3HGSA 4ERIA 2OSYA 1KXHA 4E4FA 1EC7A 4WX2A 4DJFA 1NDVA 3PBGA 4H19A 1R3RA 3MB9A 1GZGA 2DJXA 3CU2A 4PMUA 4GACA 3P60A 4XUGA 1OFPA 1KR1A 1T96A 4R27A 4NYYA 5FIPA 3B05A 3WEZA 2UY2A 3C61A 1UWQA 3EX4A 2CU0A 2HTMA 3WMBA 4H6EA 3FKRA 4TUFA 4N42A 3NQMA 3CPUA 1P7TB 5AHEA 4O15A 3WJWA 2W63A 3S3GA 3F5KA 1BTCA 3ZJ8A 1PJ9A 1FWNA 3LA4A 1RP8A 1ZCOA 2R1KA 4IUGA 3R58A 3A64A 1C3FA 1LL6A 2F61A 1DQXA 3C86A 3ABQA 4O8AA 4ZTXA 3M0VA 1C92A 2VYOA 5HA7A 5FF4A 3ZT5A 3V36A 3A4XA 2P0OA 3TSMA 2B0MA 3F1QA 3STFA 5A69A 1BQCA 3NL5A 3UWQA 1G0CA 2WZIA 2G3FA 1XBXA 1FKXA 3ATYA 1S2TA 4W87A 5IBXC 1LWHA 2HZGA 1GK8A 3ZVHA 4ZVJA 2XUCA 3CV2A 1OX4B 3P82A 4F0HA 5HAOA 3PZQA 3TN5A 4GY7A 4D6EA 3S1XA 3TW6A 4PSRA 4L6DA 1YRRA 2AL1A 3G24A 5A1AA 4MNKA 1NIUA 4N9BA 1RA5A 3MUY1 4JFWA 3HPZA 1ZL1A 2WHMA 5KMYA 1QO2A 4MZ1A 3VD9A 1C90A 2FB3A 3KTSA 4IL0A 4UR8A 3DEQA 4OBSA 2WMKA 4UQCA 4Z2HA 4YCOA 5I00A 2V3GA 1A3HA 1XX1A 4PUWA 3V3WA 1JAKA 1Q7QA 4OU1A 4CD7A 3W7LA 2BHUA 4B9ZA 4O17A 3TYZA 2PP1A 4NRRA 4HPHA 2YCKX 3THCA 4C60A 4CD8A 3OVQA 3DG6A 3NPWA 4LPCA 5EMLA 1GW9A 3TUUA 2BHZA 2W9MA 1R2RA 4QNWA 3LQGA 2WNNA 4OGZA 4HA3A 1N55A 4POCA 1S2VA 2POZA 1HVQA 3F4WA 2Q8ZA 1S39A 4X0VA 4MKSA 1MEWA 4JL1A 3QTGA 7CGTA 3RFAA 3WBYA 1UD4A 1PIIA 1WZLA 3NUKA 4KCVA 1XPGA 2GYIA 1UHVA 4INFA 3REQB 4AYSA 5L9FA 3CPGA 3PM6A 3V5CA 3KRBA 1XIMA 2Z2UA 3H12A 3QYSA 2INEA 4ZOAA 1T99A 1IXPA 2XVPA 3DOPA 4CN1A 2QJMA 1LP6A 1B3VA 1HL2A 1EPVA 5G4EA 1VFSA 3V75A 3WQCA 4WQ6A 3EX2A 4LVBA 4MM1A 4M29A 2YCJA 2XTKA 5BOFA 2G41A 1S46A 2WCAA 5HMDA 2QJGA 3QMTA 4IXHA 4S3EA 1HJQA 1Z32X 3IIXA 3UWUA 2WM0A 4KESA 4UTKA 1A0DA 3O0FA 4FNUA 2ZUWA 1KCXA 4FSAA 1JNEA 3KDNA 3NM3A 1K7XA 4JNYA 1XM3A 2PTWA 1R9YA 4LW7A 4PRTA 4EXBA 4EXQA 1OK4A 2RGMA 4MPQA 2HXTA 5DCEA 4MOZA 5F1UA 3RM9A 2B7QA 3UPWA 5LGZA 1U5VA 1R85A 3LM3A 1W9BM 4HOZA 5G4WA 4E3TA 1O1ZA 3I7QA 4IIDA 4OV4A 2IXUA 1KBJA 1LM1A 2QJHA 1B3OA 4M56A 4MNLA 1WZAA 3LSCA 1JF5A 4IXXA 2DH2A 2D24A 3NXLA 1GORA 3SUVA 3RNDA 5BOOA 4JTJA 3P8IA 2BVYA 4DZIA 4QG6A 3IJQA 2CXGA 1OX6A 3N6JA 2W27A 3PFMA 3RPTA 4ZEPA 1Z44A 3V5FA 5AYYA 1UUQA 4H6QA 5CSYA 2IQDA 1DYSA 1TCMA 1X8FA 2ZRWA 4OQVA 3EWYA 3MJMA 1IGSA 2GJNA 4QLJA 1FDZA 1GW1A 5I09A 2ZXBA 4F2TA 1XLEA 3PK7A 1FWIC 2GVJA 3LG3A 2P1FA 3ZIZA 2QDGA 2ALRA 1J0IA 2ZVRA 3O07A 4JX6A 1NF0A 4GQBA 3I6TA 1Q8AA 4FXRA 1OT2A 3E5PA 3RHGA 3RU6A 1OC7A 3RLHA 2BNJA 1TA3B 2Q8XA 3GU2A 3CB3A 1UMLA 2ZICA 2PD9A 1JRBA 5EB8A 1XPYA 1NFPA 3GXDA 1MMFA 2XH7A 3ZLGA 1ECQA 2VCCA 4C6OA 1DJGA 3GHRA 4PFHA 3N73A 4E0CA 4ICNA 3URAA 3MT1A 3F5LA 4C1LA 2TYSA 1X6LA 4C6KA 3GG8A 5BXSA 4NASA 1HO1A 3DECA 1E5JA 3T2OA 2TRSA 3W9ZA 4HNVA 3WJSA 3ANVA 3BAIA 3E38A 1HF6A 3OW1A 3WNKA 3GHTA 4K7VA 3WFAA 1KKOA 5AC4A 4J35A 4FI4A 3VM7A 4NSBA 1E0UA 7REQA 5BXPA 5FL0A 1UYQA 4L5ZA 2HCVA 4YTTA 4YTQA 1R38A 3FYPA 5CCZA 2FJUB 4K68A 1VGAA 2FH6A 5BW6A 4IX2A 1BWVA 4H8UA 4MAZA 1XR2A 3WLRA 2FHCA 1QHZA 1OYCA 5HMEA 3E0LA 2HROA 3K8MA 1R3YA 3USBA 2UY4A 4GNKB 3BOLA 3C0SA 1RCOB 4UQDA 4PMJA 1C7SA 3MV11 2I1OA 3IAPA 2VFHA 4MNJA 2WSKA 4U5IA 1AJ0A 2R1LA 3PWIA 2X30A 4IHCA 1PPIA 1FFQA 3LX9A 2DZPA 1OD8A 1FY6A 3QH2A 4UQAA 3MMUA 5C2GA 4IH3A 4KETA 4RPPA 4QGCA 5AZ0A 3KL5A 1VF8A 3B04A 1JCNA 1ZY9A 3TW9A 1F8MA 1GHRA 2C8NA 1UR8A 4PMRA 5LHEA 2F6XA 2H9AB 4GZIA 4GQRA 1JYWA 2ZX9A 4NQ1A 3VTRA 3THQA 1SSGA 1AH0A 3TYUA 2Z26A 2QCFA 1NDYA 1OIFA 1O95A 4MFEA 3BLEA 1I60A 1KA9F 3GM8A 1QWKA 3ZR4A 3GC4A 4HHHA 1E1CB 1E6ZA 4IGNA 2DVXA 3A5VA 2WV8A 2VDHA 4HKPA 4PUJA 1NFBA 3EOSA 3G5EA 2DZXA 3PWGA 3ZXWA 2HISA 3LI1A 4I5UA 1RP9A 2QCNA 4S3GA 2TAAA 3WUEA 4C65A 3QW4B 2Z4GA 3N19B 3H26A 2W91A 4WJEA 4XIAA 4QE4A 3RGTA 3GDMA 1RVGA 4PN2A 4QSFA 4LSBA 2HJPA 3XINA 1H7WA 4ZO7A 5BMXA 3BAJA 2G5WA 1HT6A 4AF0B 1EXPA 2OWWA 1ZJBA 1YNPA 4JY8A 2HE8A 3N29A 5CPSA 3N15A 4GK8A 2NVAA 5A8PA 3MMDA 4DJED 1ODUA 5K2ZA 3KTXA 4HN8A 3NO3A 7A3HA 4HB7A 3ME3A 3NG3A 2DIEA 2GVYA 4ZBCA 2DH3A 2XSXA 3FYYA 2EJ1A 2VXNA 3QXBA 4NHVA 1UD3A 3CH9A 3TA6A 2CWNA 2PWUA 3WL1A 1Z9AA 4A4AA 4IIHA 1L0PA 4AQLA 2DT3A 2AMXA 3G0UA 1KFJA 1FXPA 4LRTA 2VGIA 1IF2A 3AXHA 1GOXA 3UETA 3NOEA 5JU6A 1UWSA 2X1IA 4Q32A 3TC7A 4Z08A 1VYRA 3TN3A 1PUDA 2F84A 1GTEA 3C2RA 1RQBA 4ZTYA 1X96A 3B8TA 4O1DA 2BY2A 3LCIA 4FNRA 3W86A 1JPMA 5BU9A 4AD2A 4EWJA 1CI1A 1CTNA 1VPQA 4IX0A 1UZ4A 1PE1A 4MB1A 1RD5A 2WPBA 3WD2A 3DYPA 1ZJIA 4ZXOA 5LXXA 2WMFA 4YYFA 2PF8A 3SCOA 1UKOA 4O0ZA 3A9BA 1JF6A 1E56A 5HR6A 2VC5A 3O6AA 2VL4A 1HL9A 1TZZA 4M6UA 3DU0A 4LUTA 1D9EA 4HYVA 3TTSA 1J0JA 1XIBA 3EZ4A 3GFZA 4E2BA 5CG7A 3OHMB 2EJAA 3SGUA 4YTUA 5CSSA 2X7VA 1W5MA 3W2UA 4WZHA 3GDRA 3RYSA 5TBOA 2GSHA 3CC1A 3SCWA 3U2ZA 1UWAA 3MCNA 1HJSA 4YIWA 4YXGA 5BRQA 4PUUA 4TO8A 4DJDC 4L4PA 2DQWA 4ZGYA 4DHGA 1HVXA 3L4UA 1R46A 1OGBA 3MTWA 4MDPA 3DFQA 4US5D 4QXIA 4F66A 2J27A 2XM1A 3NQAA 1KM1A 1UR3M 1F74A 3M46A 4GYJA 1F3WA 1CCWB 3H70A 3B40A 5LIYX 3CYVA 4BHYA 3L68A 1QVBA 2WSRA 1EZ2A 3PTDA 1QNRA 3I6EA 1F8IA 5E0CA 1Z42A 4K36A 4KF1A 3PG8A 4L61A 1U2YA 5I3GA 3S0CA 4YHGA 2VRKA 1VHNA 4AB4A 1YHTA 3JVAA 3LGDA 3O6CA 5F1VA 4NU7A 1G1YA 1K6WA 3HO8A 3VDBA 1JDFA 3BLKA 3VDGA 3TK7A 4JBRA 2FGZA 3W7PA 3FAWA 2QQ6A 3VOGA 4Z0SA 3TMLA 2NWRA 3C56A 3HMCA 3K5XA 1GQIA 2EPKX 3H2OA 4IG2B 2BS9A 2ZC1A 3T44A 2QUNA 3UR8A 3T8LA 1A47A 3W7GA 5A6LA 3ARSA 3FAXA 4JICA 3I4KA 3ABSA 3I65A 4IP5A 3DH7A 4JD4A 1RQHA 1R87A 3A47A 1KV5A 3VC5A 1SZRA 1JCTA 5FESA 2IKJA 1O12A 4GC4A 3HB9A 4AZHA 3EBVA 1TV7A 1TVPA 3VIFA 4IQLA 3CZKA 4J7RA 5FEWA 3KL3A 1FBAA 3IANA 3VA8A 4ATWA 1DE6A 5H1WA 3N9RA 2HVMA 3S5SA 4DF0A 4EX4A 4FF7A 5LIKX 2GJXA 4R34A 4R9OA 1SPQA 4GBDA 4O14A 1O6IA 3H4WA 4GY1A 3GVGA 1A80A 1PL9A 4G5DA 4W88A 1DQUA 4AIEA 1JZ4A 4GNVA 4CEXC 3SW6A 1KLZA 3UA3A 2VX5A 3E49A 2J77A 3Q37A 5I3KA 4P7OA 3GC2A 5GNZA 3OVGA 1E3XA 1W6TA 3EMQA 4R5EA 2JQXA 2YZ5A 5D37A 3BCJA 1L6WA 5TAOA 1KC7A 2QJNA 1R6WA 3SCQA 4BEQA 3II1A 4UTTC 3LZ5A 2TODA 2J62A 5C5YA 4H83A 6PTDA 3LTYA 4XZWA 3VKAA 1S2WA 2C1HA 1P1MA 3WQEA 4JTKA 4IQDA 1JR1A 1A3WA 4HNTA 3SURA 3SUSA 1TWWA 4AIUA 2Q3RA 2ZZ6A 2QMKA 4UQEA 3QQ0A 1R47A 1X39A 2QCDB 4O18A 1PKYA 3UWEA 2H90A 4JTTA 1EC9A 1QXLA 1R86A 3NZRA 3BSHA 3KX6A 1GKRA 1AW2A 2FVLA 3P3BA 1L9WA 3SY1A 1QNOA 3HJEA 1HJWA 3BSGA 1PDYA 1DJIA 3IUIA 4FF5A 5A8NA 1HFBA 4RZBA 1EF3A 5U4NA 4LUSA 3ITOA 4M7SA 4NX5A 4XKYA 3C8FA 4PFMA 3IRSA 3CH0A 4F8XA 2GOUA 3B97A 5I07A 3EOEA 4Z1CA 4DEFA 4LEFA 1CIUA 5B7ZA 4PMDA 5DMLA 4XG1A 3HQOA 3V18A 4DNMA 1BGAA 3LM7A 4GLEA 4KRZA 1ENUA 2XVLA 2J9YA 4BY3A 4O4WA 2Y62A 2CEQA 2CBUA 3ZR5A 3KL0A 2E3ZA 2DZSA 2PLCA 3EXTA 4IQEA 4IMDA 4HVXA 2DSWA 3W4RA 3D6NA 4ZB5A 3CK5A 1K77A 1O1HA 4HK5A 5FJPA 2NQLA 2Z27A 1W2VA 1QBAA 2Y61A 3GHSA 1H0GA 1Q6DA 3WL0A 1W5NA 3N04A 5M2FX 4CEUC 3S2LA 1SO3A 4CU6A 3EAUA 1NTHA 1RA0A 1WAWA 5KETA 3AOFA 3DFTA 5CBJA 2JEPA 4C6FA 3FOKA 3LOTA 1PYMA 1VD6A 3EKLA 3VMNA 1KR0A 3OG3A 3LDVA 3CAVA 4A35A 5HQMA 2V9DA 2BXZA 5C7HA 3NO1A 3E0VA 3AISA 3EDJA 1XICA 2UWFA 2X41A 3UXDA 3AFBA 2PRLA 2Q8LA 4JKLA 1TVLA 4G7EA 3WQOA 3GR8A 1X98A 4MYAA 1JUKA 2G8ZA 3K46A 3TE9A 4PUNA 3OTRA 2JKEA 3OU8A 3CAKA 3T05A 3M1ZA 2EPHA 3FVDA 5M1TA 1SYTA 3H2CA 2V69A 4L80A 4PE8A 4HYWA 1DIDA 1XS2A 2A3AA 2V5JA 2CWXA 2V82A 4DJFC 5CGMA 2XGIA 4CQ8A 2D0HA 3QC3A 8A3HA 2DZBA 2EPNA 3GBEA 1G7UA 2YB1A 1ZS2A 2UY3A 3G1HA 3KBSA 2YA0A 6REQB 8RUCA 1F3XA 1VBUA 4XB3A 3QN3A 4TXEA 3AYRA 3TV8A 2E8ZA 3UP8A 4LF1A 1GVYA 3ZLHA 1CLXA 3QC0A 1BKSA 5GVJA 3TW7A 1N8WA 2FPYA 3NPUA 1OJXA 4AXKA 1DTNA 4J3ZA 4DUXA 3N14A 1EKOA 4RDYA 4KIEA 3IIPA 2VC9A 4NAFA 4WXZA 1AA1B 4FOUA 3ZT7A 4MUPA 5FF0A 2OQLA 3C6CA 2B7PA 4HA1A 3A22A 4O10A 1G9HA 3RAOA 3W25A 3ID7A 5A6BD 3WQ6A 1JRCA 3RX3A 5ABFB 1POKA 5I3JA 1Q6GA 4M0XA 3P8JA 3NDZA 3UF9A 3HG2A 3FJNA 3CHFA 4UFLA 4V1YA 1ML1A 1N8IA 3T55A 1QNSA 3RJYA 5KZEA 1TMHA 2EKCA 5LGXA 1THFD 4B5SA 2E68A 2YGYA 4JFUA 2OLHA 1Q6EA 4DIAA 1XIIA 4DNHA 3ALFA 3KRSA 2WKGA 4U28A 4C7GA 3GKAA 1DXFA 4MG4A 1PKMA 4H8NA 2FMOA 5FACA 1ONWA 1PWMA 4C6NA 3HFTA 5HWJA 3QSRA 2E09A 3PF3A 4I9MA 4AMAA 3UNDA 1IV8A 1KLYA 2P53A 4BR1A 4GABA 2ALDA 3BURA 4EAYA 1CGYA 3NQEA 4QITA 2Y8UA 3LPOA 2DV0A 3PZGA 5LNWA 3SB0A 2RH9A 2JEQA 5BWAA 4DZ5A 3G6MA 3CWNA 1EXBA 3GK0A 1W1B1 4BWLC 3MKVA 3G3DA 3HPSA 4J3UA 3NSMA 5BU6A 4CU8A 5KINA 4US6A 1MXGA 1O68A 3ARYA 1XLBA 3G0XA 3H7VA 4B5WA 3FA3A 1SO4A 3B8VA 2CFFA 4DI8A 5FL1A 2C91A 2VGFA 2QCLA 3CUIA 1UWUA 3NXFA 2YBUA 1K02A 3W1TA 3MI2A 1LQ0A 5I06A 1Y5XA 1WXZA 1KFLA 7REQB 3C2EA 3UZJA 4B3KA 4X9YA 1VFFA 1TELA 3VMPA 1D8CA 2OOGA 1XRSA 1Q85A 4D6IA 1I1XA 3MANA 3FW6A 2XWEA 1KQZA 3F5JA 1HQTA 2GPTA 1UD5A 2GJPA 1TFVA 1LLZA 5BXRA 4RKAA 2Y4SA 3QY8A 4HYRA 4LC6A 3KLLA 5HJXA 2WC7A 1WDQA 3SRDA 3BJSA 3PAJA 5ABFA 2WKJA 3GSMA 1SW3A 1S3TC 2E6YA 3DGRA 1J0YA 1SU5A 3TJIA 3GTNA 5MKGA 3N12A 1S3HA 3T9PA 2YBTA 4X61A 2OEJA 3VIIA 4Z0JA 4Q8QA 1VAHA 4FO4A 3B9OA 3KTCA 3GXTA 4ZSUA 1IEVA 3UERA 1SUXA 1ZLPA 1A5OC 1TV4A 1UBSA 3TXVA 4S3JA 4DWSD 1A0EA 3KWSA 4WOZA 1XCWA 3EOOA 3ARUA 1E1FA 3A4JA 3GDBA 3PAOA 4W5UA 4JCLA 3G1AA 3MUIA 4F0KA 3BDKA 2WBKA 4XAPA 3UGVA 2FTYA 2W4XA 4FEZA 4KGLA 3E2VA 2YR1A 5RUBA 1P6CA 4GMEA 3AIUA 1XYBA 1H7RA 1QK2A 1RJRA 1NH6A 1T41A 3UGRA 3AU6A 2X2GA 1DL3A 4RW5A 4PMQA 2Y88A 4G7EB 1WAUA 4RZ6A 1ZP4A 2HVOA 2V38A 1KBKA 3WF1A 1VENA 1IYXA 1RLDA 3SO7A 3OVRA 3L12A 4DRSA 1YMYA 2FQIA 1CENA 2FLIA 5G1TA 3R5EA 3FHAA 4K1WA 3WCZA 4M1RA 4QHRA 1MW2A 1EZWA 4WRHA 5A2CA 2WB5A 4DF2A 3PZ9A 4PRWA 3KBVA 1XIDA 1L6GA 2QCEA 4DI9A 3RG6A 4UOZA 4JGDA 4WKHA 4E38A 3LHYA 2PBOA 1L2UA 1SSDA 1QOPA 2QF8A 3C2YA 2VMFA 3WY1A 4Z2GA 1J6OA 1UA3A 2BOGX 3BW4A 2XIIA 4AVOA 3W02A 1ZB5A 1SJDA 4MVAA 2IMRA 3A3HA 4M24A 3NA8A 4HNNA 4F0LA 4HK7A 4GIAA 4UZSA 3OQEA 2FKPA 4YVVA 2BGSA 2QULA 3STCA 2J8TA 4AZIA 1UCWA 1ZALA 5J04A 1RJQA 1H09A 5KITA 1EJUC 3HF3A 4ZA0A 1VBGA 4XZ9A 2I17A 3PSWA 3LERA 3NQBA 2DSKA 1SR9A 3C0QA 5IBXA 4JCMA 3O0KA 4HOWA 1EQCA 4JEJA 5LNVA 4XBKA 2OJPA 4Y9PA 2HMCA 4CCEA 4X60A 3DGBA 3DFYA 5F2IA 2EHHA 3PULA 5CZJA 1PCKA 4HPGA 3V4BA 1EWDA 4UTHA 5FEXA 1UJQA 4OKDA 5CC7A 1E1EA 3GS6A 4PMZA 3QHMA 2CLFA 3MHGA 3WD3A 4ZQRA 4Q8TA 1PTDA 1LLWA 4QFUA 4GY0A 2R9RA 3ABOA 1UOZA 3DENA 5GQBA 3VNDA 4L65A 2OSWA 2NUWA 4JQ1A 3L67A 1UASA 1TPEA 4I7UA 1SMDA 2VT0A 3TQVA 1G4PA 2PUZA 3CM4A 2PCQA 1NOFA 4AZ5A 1JQVA 1C8XA 2AMGA 3GNOA 3UZXA 2BGNE 3KCJA 3DCPA 4WF7A 2J78A 2VEGA 4FZIA 3RILA 2GLKA 1RBLA 3QGKC 4RXGA 4FXFA 1G67A 4H41A 5BWFA 2PC4A 1YDVA 5AHIA 3TZFA 1EGVA 1WBHA 3IK2A 3NGJA 1FWCC 1B3XA 2NQ9A 4O28A 2IPWA 5EFFA 1P0NA 3CIWA 1LJYA 4E5TA 1MVYA 5HOSA 3SAZA 4AY7A 5D4YA 1OSEA 1JPIA 1E9LA 1QAPA 2GVGA 3U7BA 4PMOA 5CBBA 5JIWA 2ZUTA 4LVDA 4N9EA 3K8KA 4QBXA 3LZ3A 1TMLA 4LAOA 4FNQA 5F4WA 3L0KA 5AHLA 1GPWA 5D30A 3TC6A 3ARXA 3MSYA 2PDGA 4MY8A 3M0ZA 2D2HA 1DJZA 3L65A 4AAJA 1IEQA 1U33A 3KRZA 2Y7DA 5G1YA 1CXKA 1OY0A 3VKBA 3E9AA 1F4AA 2Z0IA 3WQGA 3WF3A 1WUFA 4DWSC 6A3HA 3VINA 4UR7A 4N6EA 4IUOA 4QIUA 3RIKA 4IQJA 1L6YA 1KGUA 4B3ZA 3MUCA 1EBHA 2CNCA 1UWTA 4UCGA 2BOFX 4Y6GA 4TVCA 3W74A 5FJUA 4D6DA 4LS2A 1H1NA 5C9XA 3MZNA 5HJYA 3QOMA 3EWXA 3VKJA 2QPXA 4H9YA 1UD2A 1C8VA 4OVXA 4HOXA 2E1WA 3DXIA 3N6QA 3TC3A 1E4LA 3KEHA 2D2JA 1P0KA 6ALDA 4FX7A 3CUHA 4PCNA 4DXVA 5DY2A 3OLIA 3FV9A 4Q6JA 1DWIM 1B5TA 4JYDA 1H5VA 4NZJA 1KRBC 1B9BA 1XC6A 3TNBA 3BMWA 1ALDA 5CPTA 3L4ZA 2QPUA 3VNIA 5IHRA 1QNVA 1Q4NX 3GUWA 3VK5A 1YLVA 1TPUA 1PWLA 1EJSC 1KFCA 3L4VA 3EKZA 4NF7A 2E7FA 3MKKA 1Q6QA 1VLIA 4GRSA 2B81A 2PC8A 3LCWA 1V0NA 1XSKA 3S5ZA 1E71M 1G5AA 1FHUA 1I2PA 4G7FA 3PHAA 1EGZA 1QPQA 1UJPA 1ZAHA 1MEHA 3DX5A 1PZ0A 3MP4A 4ZO8A 2PP3A 2Y85A 3JW7A 5JIPA 3WLPA 4CNUA 3EPNA 5EMJA 4X0NA 3RM4A 2VZOA 4XTIA 3AIVA 3I3DA 2C79A 3NQFA 2E0PA 4D72A 5M3WA 4HT3A 2GGGA 4CD5A 5HR7A 3CAQA 3LV5A 3KHDA 3L0NA 2OO6A 3AMKA 2F2HA 3W7QA 3NQVA 2ZX5A 1AH3A 3OEXA 2NQZA 3T0DA 3WUBA 1JZ5A 2J7HA 1K7FA 4UMCA 4C6MA 4GYFA 4J2PA 2XIBA 1VYSX 3CQ0A 4Q7IA 5BRBA 4QQUA 5HUOA 4HTBA 1VPYA 4GUHA 3UD6A 2GJRA 2Q71A 4RUBA 4AD1A 2CYGA 3GU1A 2I56A 2P3ZA 1AZ2A 2QGHA 4RJEA 1TJRA 1TJ2A 4RV3A 1UP2A 1OADA 3CQHA 3PBMA 4TV6A 4QS5A 4A8NA 3N11A 2A2IA 3S1UA 2DT2A 4M80A 4EF8A 4UR9A 1OQFA 4KCWA 1QU4A 5FA5A 2GK1A 4XZNX 3VM5A 2VQTA 3WJXA 1B4KA 4HMDA 4J3XA 4C90A 3GKFA 1QWGA 1VFUA 4A8IA 1KO0A 3GIYA 2A7RA 2YCEA 1Z7AA 3GYCA 5DMNA 1WDDA 1DJYA 3AWNA 4NZ4A 1NEYA 4O0KA 4JTCA 2KX9A 1VBHA 1FDYA 1WKFA 4HQVA 3KCLA 4YCPA 1IHIA 3HQPA 4DUVA 3A4AA 1Z48A 3LENA 1IZJA 5DBTA 3AMLA 3B03A 2J7FA 3O16A 1M7OA 3GTFA 1OCQA 2PDKA 2E25A 1KQYA 1OFQA 2PDNA 3EDKA 4R3UA 3FSUA 3CEPA 1E40A 2XSBA 4KW2A 5DXYA 3SQMA 5REQA 1DWHM 1O5KA 3SSJA 5C55A 1QI4A 1WOAA 4XKMA 4AZ6A 1U83A 2YDAA 3QKZA 3ZJ6A 3N25A 4PTWA 5CBIA 3SQLA 5TD4A 1GYNA 4DJFD 1L6FA 1XBZA 3B8IA 3IIZA 1JCLA 5TQLA 4QTGA 3ARPA 2A3LA 3EYPA 1ZENA 4FAMA 2C15A 3HQNA 2XZ7A 3W7CA 4WGHA 1D7KA 3RX4A 4MJ2A 4AYGA 4IG2A 4ZZ9A 5CAKA 1GVSA 3SI9A 1A3XA 1RALA 3GAYA 1MFVA 4YPJA 3MW7A 2WVVA 4S23A 3ABXA 3TMQA 5XINA 4JTDA 5CGQA 3UWZA 1G6CA 3W81A 3GTIA 1P1XA 2AAAA 3IJLA 4TX6A 2GUUA 3AWOA 4I6VA 4WDWA 3GG1A 4OUIA 3RJXA 5DMMA 1AQHA 1GNXA 4O50A 3N2CA 3WFLA 2V5BA 1Q2SA 2EG6A 1RVKA 1KCLA 2D2OA 2GL5A 3CUGA 3M47A 3NGFA 1VCGA 4Z1YA 3DFSA 1Y5WA 2YCIX 1OFOA 2QXWA 4ECLA 4JZ5A 3PFRA 3T42A 2CPUA 3ITLA 3W1UA 5AVNA 3EWDA 1U1HA 1XRTA 4A3QA 4DZHA 3PZIA 3TH6A 4UTJA 4PMYA 4JNZA 4ZOCA 1H0IA 3UWYA 3ERPA 3WLIA 3XISA 4LYQA 4CU7A 5K7JA 5AB3A 1Y0EA 4U10A 1TPVA 1B31A 3PZOA 1TR1A 2GQAA 4WOQA 3GNRA 1G4SA 5T9BG 2VQUA 2FZNA 6REQA 1NOWA 5HXMA 4GYKA 3NQ7A 4PMNA 4GVHA 3SRKA 2W5FA 4KMQA 1PYFA 5D9NA 1M1BA 2A7NA 2DJLA 3L2MA 2WQDA 1Y8BA 2MUCA 3OP2A 1UR9A 2DUAA 4WKFA 3NWRA 4C6EA 1TTQA 2YA1A 1NDWA 1EHNA 1TX2A 3L21A 1A5UA 2HNHA 3AHZA 3R7MA 3CB8A 4EIVA 2QEZA 2I57A 1OK6A 1HKJA 1RZMA 3L4YA 2V0TA 5FAGA 4E6MA 5I77A 4MADA 2FGLA 3LMZA 1I9CB 5TIMA 2CITA 1J93A 3LHVA 1AODA 1JZ6A 1FH9A 4MZYA 4IPIA 3EB2A 2D20A 4DO6A 2P10A 1W17A 1J01A 3LRKA 1JIBA 3GTXA 2YKKA 4H7CA 3DHPA 4MB3A 4IPJA 4J40A 1FWJC 4PUKA 1PSCA 1P6BA 3NQ6A 3RF9A 3IJIA 4ILSA 4EP8C 4PTMA 1JVNA 4GIEA 4PB5A 5LIWX 1PX3A 4HHPA 2ZZ4A 3TNOA 2GWNA 4PZVA 2YDRA 2RJHA 4B5VA 2XDFA 1M53A 3C5QA 3RR1A 4AEOA 2FGBA 1W3KA 5K4ZA 2NXGA 3ZSTA 2GUYA 3NSNA 1PCWA 3OA5A 5FCZA 3M5XA 4QE5A 4AEFA 3RXZA 1A5MC 3OGVA 1AMKA 4N0RA 1CLVA 4NIRA 4UXDA 5DO8A 2WM1A 1AUSL 3VGDA 3EDFA 4A2SA 2XM2A 4JTEA 5U7SA 4DWSB 2UZ9A 2VOTA 1J0KA 2A21A 3R43A 4CVWA 3IARA 4NJIA 3MI6A 4QEEA 2FJKA 1W32A 1Q13A 3CIVA 1I8JA 4FXJA 2ZKMX 1P43A 1ZUAX 2ZX7A 5FI8A 1TIMA 3EX6A 1W9UA 3MSGA 2VFDA 3VOHA 1LOLA 2FZ9A 4XQ6A 2J24A 2BVTA 4IGSA 2WNWA 3P62A 1CXEA 3IJ7A 1W31A 4JYEA 5BOEA 4LALA 2P0IA 2X1SA 4LV4A 2HE5A 4C6IA 1AD1A 2E4TA 4ZE5A 3L5MA 1J12A 3KBMA 4MGGA 4G9PA 1YEYA 3M64A 4L64A 1KBBA 1TRDA 4NAEB 1POJA 4IP4A 4GCAA 4FB7A 2YX0A 1E73M 2QCGA 3O3RA 1LUCA 2J74A 1DIOA 3VD4A 4MWAA 1B57A 3PUDA 5AN7A 1O5XA 1WDPA 3OZYA 1XDJA 2Z1VA 3QBUA 1UKPA 4FLRA 2V3FA 1R5YA 1V6YA 4HNCA 2Z7GA 2ZUMA 1IXNA 4IFKA 4TV5A 4XZMX 1WX0A 1OCNA 1QI0A 3DYOA 3T1GA 5EKYA 3EPOA 2QDDA 1RV8A 2IKIA 1EOMA 4WEVX 3G77A 2FTPA 1K9EA 4FR6A 2W6RA 1J6PA 1C91A 1TTIA 3WLKX 4DAFA 4LNCA 4AMCA 1CW2A 2OWXA 3FXGA 2YXGA 1ZBWA 4C5ZA 4IJRA 2VC7A 1SZGA 2WYSA 4AEEA 4B2DA 1XLJA 2NV9A 1SZNA 2CESA 2TPSA 2C18A 4J3TA 3OLGA 2QCDA 3VGFA 4JKMA 2NLYA 3ONCA 3GDLA 3NIYA 3B8DA 1AW5A 2EG8A 4TVUA 1VJIA 4RPQA 5JH2A 1P7TA 1W9VA 3CTLA 2PWDA 3BLDA 3P61A 3NL6A 1O5RA 1VYPX 1JD9A 2E1DA 4YJ5A 2FB2A 3DHUA 4KBXA 3OLDA 2Y5EA 3MP5A 1XF0A 4V33A 4FA3A 4WK9A 4A3HA 4JTGA 2WZEA 4U3AA 8XIAA 3THAA 1TPFA 3TYAA 3VAVA 1HX0A 1JQXA 3LB0A 2CHOA 3W87A 3ARQA 3S2CA 1WOBA 4AD5A 1UR1A 2WKLA 3W00A 2V3EA 1GZJA 1EUNA 5D38A 5T8GA 3WNNA 4F0MA 1GG0A 1EL3A 4LAMA 1E6QM 3VDCA 3WELA 4GUJA 1KBIA 3STEA 3D3FA 3MHFA 4J27A 5AC8A 1ONEA 1W3JA 2W61A 4AHOA 1V79A 5AYBA 2ZRUA 3LLXA 1UD6A 1HZYA 2P50A 5LZLA 4JHZA 1EIBA 1MQRA 1UUOA 2BGQA 4UIOA 1RY8A 1YXCA 1HKVA 3KUMA 2Z1BA 3UCCA 2O92A 3KVKA 3EXRA 2NUXA 1X1NA 3CWOX 1RUSA 1IZKA 1XYZA 4K8EA 2AQOA 2Z1WA 1MYRA 1Q65A 1MNZA 3PZVA 9XIMA 2Q6ZA 2NSXA 1ME8A 4WDXA 2OZ3A 2Y2WA 3FXYA 2XIQA 1KGXA 4LBRA 1XLHA 2CZDA 4C6PA 4XV0A 2ZQ0A 2WXDM 3W6LA 2AQVA 3UJRA 4H1ZA 6TAAA 1TYGA 1E9ZB 3HOJA 4C91A 1DHPA 3GE7A 4AZCA 2O0TA 2P88A 4CGTA 3URBA 2CETA 2PDPA 3Q45A 1H1ZA 3W7MA 1R30A 4Y2WA 2PI6A 3GR4A 1AG1O 2B4GA 3UJFA 2Z1SA 3VIHA 1BG4A 3GVQA 4F40A 2WAGA 4GHRA 3GNDA 1OC5A 3U57A 4GISA 4AW7A 3LCXA 4IMEA 4KEMA 3VDHA 2G4FA 3WK0A 4WVXA 3N4EA 1IZCA 1F76A 4M7TA 4QCFA 2ISSA 1F4HA 4MZ8A 1OINA 2HQAA 1WCGA 1Q7ZA 2AKZA 4G2DA 2IPFA 1XDMA 5D2YA 2DSVA 5EPDA 1XLFA 4TQTA 1EHAA 4GYPC 3QV7A 3JRKA 3C52A 2CERA 4BFAA 3W01A 2PDLA 4XD4A 3CASA 1UWIA 4LH8A 4JIQA 3TKFA 1AJ2A 3CLMA 3KFTA 3NQ2A 3H7UA 3URQA 1EOKA 1F73A 5D05A 4AUBA 2QUVA 4MJMA 3C8NA 1ITUA 5G2WA 3UJEA 2PDIA 2ZXQA 2VVNA 9CGTA 3GH7A 5ABGA 3WO8A 4GJ1A 5CJMA 3CZGA 2YL9A 3BCFA 3ITXA 4R53A 1MUCA 4M1BA 4E2DA 1LORA 5DF0A 4O57A 3N3TA 2C71A 3KBNA 4BQ2A 2J47A 1XLAA 4UQ9A 3ZM8A 2QAFA 4KT2A 2R24A 1LF1A 3A21A 1HO4A 2R1NA 3WEOA 1QPKA 2R1PA 4JN7A 1YYAA 3PTMA 3WQVA 4BA0A 4RLIA 3LPGA 4GIYA 4PYSA 3P0XA 1ODZA 3NPVA 1YTEA 2MANA 1QRQA 3U5YA 4CCDA 1O66A 3WN6A 1B3WA 1YADA 5FSDC 3GZAA 4K8GA 2DT1A 4HU3A 4K3ZA 5CEWA 4KEVA 3ANYA 3QZAA 1JPKA 3IJ8A 1WYIA 2BTMA 3S2JA 2E28A 3UR2A 4XAYA 1DTUA 1OYBA 1UROA 3DBPA 1YBQA 3GG0A 1JDCA 1MZHA 4N6FA 1X6NA 4NILA 2GQ8A 1OZMA 1DV7A 4HGXA 4JTSA 4HBKA 3AJ7A 3W7JA 4E8GA 5MKGB 2Y24A 1QR7A 4EE9A 1JI1A 4B5XA 1R3QA 2INZA 2FFCA 4WLCA 4H00A 1E0TA 2EF9A 2R1MA 4GNJA 1I4NA 4TMBA 3WLJA 3TR9A 4X9SA 2YCLA 4N4QA 4O0QA 2HPIA 4KWOA 1Y7VA 1TJ1A 3WLHA 3Q2DA 3QV8A 4XZBA 3W38A 2VDGA 4Q8VA 1R9XA 2VOMA 3A24A 3M0KA 3MDUA 1LOQA 4K39A 4LUSB 3OVPA 5A6BA 2WSYA 2ZBTA 1CXLA 4KQNA 3W70A 3QEZA 4B4HA 1BEUA 1O5QA 4XK2A 3TTQA 2PDCA 3NQ8A 1JGMA 5EMKA 2BSLA 3OZMA 2H8ZA 1XXXA 4GI8A 3PPHA 4L6HA 4OIFA 2WZMA 1V4YA 3O9NA 3B0UX 5FEZA 1SZEA 3WMCA 4QDWA 5C8BB 3JR2A 1GQKA 4FPSA 4Q8WA 3ALGA 3MCMA 4GFSA 3SECA 2ZVIA 2J6XA 1DPMA 1KWKA 3VVGA 3D46A 1NU5A 5LKYA 1B30A 2WQPA 2OGYA 3FJ6A 5B80A 3ZZ1A 5E9AA 3BLOA 1ITXA 4AD3A 5I0DA 3M43A 5I23A 1F3TA 3W7KA 1BYAA 4QLKA 1SZFA 1FCBA 1XYLA 4BI6A 1A53A 1HNYA 4W8AA 2A5HA 4TX8A 1HGYA 4UOJA 3VE9A 3R6IA 4DN1A 4NG3A 1OC6A 3C2FA 1A4MA 1NQKA 1W1PA 2YDSA 3AHXA 5AHNA 3SCUA 3FK4A 2HBXA 2QVHA 4W8LA 3RCYA 4U31A 1XISA 3C2OA 5FJIA 2PSNA 4CN6A 2D73A 4V28A 1DQWA 3E5BA 5G2IA 2ZTJA 3MBDA 3PZNA 3AXXA 3QPZA 1NP0A 3LD5A 4GH1A 4CD4A 1Q8JA 3W2KA 3BARA 4LGXA 5G2HA 3GVRA 2RKXA 4DYJA 3S8HA 4LEQA 2VZTA 4H9MA 4JAWA 4J1OA 2ACUA 2OZ0A 2VZUA 4AHQA 2YDQA 4AD0A 4C6QA 2NX9A 1DXEA 2VX4A 1Q66A 2WO5A 3E3HA 3CXOA 3MSRA 2WBGA 1EX5A 3MC5A 1C93A 4IOTA 3P74A 3PPFA 4Z1DA 2Z24A 1IT0A 4JIEA 2EBNA 3N3MA 1B4EA 3H2MA 4GI4A 3VKKA 3BL3A 1OVDA 3AHVA 1I0DA 3WH9A 1VRXA 2QVNA 2IKHA 2V3DA 4Z2IA 3AIRA 4LQ1A 1VIWA 3AZTA 1CDGA 3S6OA 3U4AA 2FIQA 4GCXA 4XZHA 2ZA3A 3R1ZA 4CKQA 6XIAA 4MSSA 3FS2A 4NJKA 3Q67A 3LRLA 5D02A 5FSEC 1WKDA 3BJTA 3PZTA 2QJJA 2ZUSA 3QQ1A 1DKWA 3ANUA 2ZA1A 3LI0A 1TPDA 3U4FA 3CZJA 4OV9A 1VCVA 1E4NA 2CKSA 4I8DA 5A94A 3E02A 3E74A 2NV1A 2Q01A 3TCSA 1T0OA 1WXJA 1XQLA 3W22A 1IT7A 1NJJA 2VP8A 3BE7A 2P5NA 1K9TA 4LAKA 3RLGA 4XO7A 2DZVA 1A5LC 3IJ6A 4OWGA 3VNMA 5HNUA 3HFYA 4S38A 3ITTA 2NVDA 4CN4A 1DIKA 3AZRA 2A3EA 2POTA 2HNEA 2VX6A 4BCEA 3POCA 4H7VA 4OOUA 3AMGA 2V5LA 3LS9A 2IKGA 4G8TA 4FIQA 4L7ZA 3PZMA 1FWAC 3IPWA 4QE1A 1BVWA 2ZRZA 3SGZA 4C6JA 3MMTA 1HN1A 4GVGA 3TLLA 2XWDA 3ZS4A 4XUYA 2O9TA 3KWXA 4NXKA 1HP4A 1GPFA 1RJPA 2E5DA 3KE0A 5HNTA 3LLDA 4P7QA 3UPBA 1OX4A 5HNNA 1W91A 3HJZA 1SJAA 1J11A 4F0RA 6TIMA 5HPOA 3N34A 1M3UA 1Q6LA 2D69A 2G3MA 4H8VA 1N7KA 3WNPA 3LPFA 3CYJA 2HV5A 3G1RA 1ISYA 3ABZA 5EBAA 3KOXA 1G7VA 4PB3A 1TPC1 3UQNA 2QW5A 2RUSA 1CGUA 4YS1A 3DG3A 1DHKA 4PTXA 1DEDA 4OHQA 4MUZA 1H63A 1M7XA 3PB2A 4YNGA 1PV8A 3FEQA 1JFXA 2ZDSA 1F2JA 1T8XA 5J5DA 3GNPA 3EWZA 1OM0A 2C7FA 1TV3A 3RLVA 1JCJA 3R11A 1IQ8A 5E9XA 3VOCA 2PD5A 4H4IA 1Y65A 2PU1A 1NSJA 4HU4A 4M5PA 5KZ6A 3VOJA 3CL8A 2DVTA 2V2CA 1KGWA 5CC5A 2Y6ZA 1PXGA 2WOQA 3GO2A 3NSXA 1EJWC 5FJRA 1EJXC 3R79A 3UXIA 5HULA 3IJ9A 3BQ6A 4J4KA 3GXFA 3VU2A 1QO5A 4DLFA 5JXQA 5D2XA 2C1GA 1LBFA 3UG8A 2G3JA 2ZXAA 1E9YB 1NP2A 5DLCA 3GVVA 3WDIA 4DO5A 1JYXA 4F2BA 2JIWA 4AFYA 3EDDA 1MW1A 1ITCA 8XIMA 3VZXA 4ZQPA 2GSJA 1C7TA 2VRQA 3VC6A 4E2VA 2BY0A 3N1AA 1XV8A 2XN2A 3TYEA 3UXAA 3EWWA 2PCEA 1MXDA 3U2OA 4CNNA 3WD0A 3RX2A 3LBCA 1V3JA 5T91A 3VKDA 1GYLA 3NO5A 3FIGA 4LV9A 4HU8A 2ABAA 3VGEA 4BS0A 4EPBC 4NNCA 1AH4A 3QMRA 2A4AA 5M5DA 1J2WA 4GH3A 1KRAC 3AMCA 4YU1A 4E8CA 3BGAA 1CXFA 2GZXA 2D22A 3B0PA 2OQHA 3DAQA 5HQLA 4MWAB 1QW8A 4J3SA 4D1IA 3M9YA 5C9ZA 3FLUA 4L4MA 3TAKA 5EL1A 4PH6A 2PLKA 2OB3A 3B06A 3SUUA 2XG9A 4B5NA 1US2A 4JIHA 2J7BA 4YVPA 1ITQA 3QFEA 1BWKA 1B3YA 3W7NA 2YBVA 3WBXA 1EA9C 1V03A 3TCEA 4B5UA 4JTQA 1ZCCA 1A0CA 2ISDA 2GGIA 1GVIA 5K9CA 3GQYA 7TIMA 4TTUA 1IWAA 3LYEA 1FHDA 1W1IE 5LYRA 1RCXB 5IXEA 2VURA 2VEKA 3MUZ1 1FH7A 3ES8A 8CGTA 2JGYA 1OF8A 2E8YA 3R12A 4PTDA 3LCFA 4Q6XA 5CLTA 1V3MA 1XINA 4GUGA 1CWYA 5DXXA 2NSOA 1EP1A 2EEXA 1VBJA 2JKAA 3PBVA 3WF2A 3QMSA 1V5XA 1KM5A 4JIIX 4RNFA 6ENLA 3LGEA 4I9JA 2JBMA 3AUOA 1AFSA 3AXKA 4LAZA 3APGA 3PBYA 3VD3A 1US3A 4Q4SA 3R0DA 2PDMA 4JPGA 3O2LA 3BAKA 1TA3A 1F3EA 3B0YA 4LS0A 4AX7A 3WNMA 3G2GA 1YIXA 2QCCA 4P61A 3W1MA 2FYMA 3BZGA 3B4YA 3U7VA 3VFLA 4W7UA 4M51A 1BXNA 1Q6CA 5I3IA 1JNDA 2XINA 1F9CA 3PNUA 4L4LA 5LNUA 5LIXX 2Z2BA 5H8MA 4W8BA 4BF7A 2GWGA 4H8HA 2VENA 1V7AA 3UCDA 2VWTA 3N17A 1ADOA 1UA7A 3H23A 3UPMA 4QM1A 1ICQA 4TU1A 3TQ0A 3AYVA 1YKWA 4FOKA 4MB5A 4L1WA 3WJYA 1VB9A 3N2MA 5D9MA 1LQAA 4X22A 2WMIA 4OZOA 2J6VA 1CGWA 3U48A 3WLNA 1FWBC 1WA3A 1JDAA 4RCXA 2GOKA 1S5VA 3IWPA 2JK2A 1Q5MA 5C71A 1KV8A 4EOUA 4UTTA 3W76A 3ISIX 5F7UA 3IGHX 2XVKA 3HTWA 1QHOA 3ZYZA 4Q4RA 5A6AA 3DUGA 3CQJA 3OIHA 4K1GA 1RPXA 1PAMA 5A3HA 3W26A 1CPUA 3AIEA 4BI7A 3GXIA 3V1PA 3L5LA 1ZHAA 4ZOBA 4C6LA 3GWQA 3HM7A 3WLSA 3AJXA 3VIMA 4ML4A 2ZTKA 1YPIA 4OOZA 4WD0A 3CMGA 1MXSA 2G50A 1WV2A 1SO5A 4OT7A 1V08A 4RXFA 3H6OA 1F6PA 1K6AA 2D3NA 4H2HA 4CNSA 3NNTA 2PA6A 1KBLA 3NTYA 4N4PA 2PPGA 2PGFA 2VM8A 4AISA 1UIOA 4FOJA 3FFSA 1LRQA 4BEUA 3TIMA 4EANA 1W3NA 4H2CA 2NT1A 4HPNA 1V6UA 4EF9A 4AG0A 3FJLA 1OG0A 1ZBKA 4O53A 4Q3MA 2PWVA 4MDOA 4Z2JA 1ISZA 4OECA 1A5BA 2OU4A 1KM6A 3ARTA 3O6YX 3K4DA 3E1F1 1ISXA 1GCYA 1ZSXA 1ZJAA 4IF2A 4JDBA 2OO0A 3V35A 4K8HA 4Q22A 3G1FA 4HN4A 3T40A 1XG3A 3R10A 5REQB 4UB9A 5E6ZA 1EX1A 1BHGA 2BY1A 2VNCA 4L1XA 3G18A 4NNAA 2PDQA 2A3CA 1LG2A 4P7RA 3V0UA 4NZFA 1AL7A 1U5JA 4OE7A 3UXLA 4DQWA 1LRNA 1O60A 3GB6A 1W1A1 3L66A 1XIHA 3G22A 1TTJA 4ROPA 3QPEA 4I90A 3H4XA 1GJWA 5D2TA 1TG7A 1BQGA 1ICSA 1N8FA 3RK8A 1XYCA 5I6SA 4D6HA 2REQB 2Y89A 3USZA 1YQ2A 4Q8OA 3TJXA 4GBUA 3APTA 3OBKA 4YTSA 4ZL1A 1O94A 1DXIA 2W67A 3PPCA 5F2LA 1VLWA 4KGJA 2SFPA 3G8RA 2YW3A 2DORA 1A49A 3A3WA 3UY7A 1W1YA 2WMGA 3QHNA 3QLDA 2DUXA 2PDYA 4EPKA 2QUTA 4QR6A 4JTLA 4IJBA 4IZGA 5IDIA 3WQ5A 3RRXA 4KRTA 1UWRA 3W1QA 1HGWA 3UT0A 1A5KC 2BZNA 4RZ5A 4HD5A 4LFYA 3UA4A 4ZB0A 2VJXA 4NL1A 1CXIA 2BWGA 3LK6A 3AALA 1CBGA 3G1SA 3GXNA 1F7BA 2AAMA 9RUBA 4AWEA 3QGAC 1WZKA 2CLEA 1IEIA 3M5ZA 4RNJA 5I3FA 1NF7A 1OBAA 8TIMA 3QPYA 2PF0A 3W7DA 3GW0A 3S6TA 1EA0A 1I2RA 5JMUA 4W7WA 1P6WA 1MZRA 2CC0A 2O9OA 4GFIA 4HA0A 3PBUA 1PZ3A 1BRLA 4LUYA 3M7SA 1LYXA 1XC4A 3APYA 1KFBA 3H4GA 4QAWA 3KXQA 3DN5A 3UJ2A 2PRMA 4F3HA 3KS6A 1DIEA 2X09A 3FA5A 2QS8A 4L9XA 1PIGA 2REQA 1MFUA 3VIKA 4HZMA 1E1CA 2QCHA 4FXSA 2W66A 2FHBA 1LUCB 1XCXA 5AECA 1W37A 5CC6A 5I02A 3GIPA 3LNPA 1FWSA 3JZEA 2IS7A 2VDIA 1KB3A 3CZEA 3EXSA 3PANA 3IUHA 5MHBA 2VEMA 4CUCA 2E77A 4QJ3B 3WKZA 2ZADA 4HMCA 1M01A 3ES7A 3OBAA 3W53A 1GQLA 1HKIA 3S1GA 2EO7A 4J28A 2OOFA 3EEZA 5CSRA 4MJ4A 4QNEA 4IMGA 3MMWA 2BX7A 2C6QA 1W54A 3ZVHB 3K8LA 4M82A 1VFLA 5JVLA 2ZWYA 4V27A 1UP3A 3K4WA 3NM1A 3ZMRA 4DM2A 2VEFA 4ROQA 3D0CA 2Y63A 3W37A 1S38A 6XIMA 2CLHA 1ADDA 4GXMA 3M0JA 4LVGA 1B54A 7XIMA 5BNKA 2PRHA 5SWUA 2R8WA 2XISA 4GWEA 1JYNA 3QKEA 3NURA 4DJEA 4Q33A 1RBOB 1PZ1A 4A3UA 5M03A 4MYXA 1NARA 2ZZ3A 3VUSA 4XBJA 3OGRA 3M0MA 1ZPTA 5A2AA 3LXAA 4D8ZA 1NM9A 1UKQA 3DHDA 5JBDA 1Z8AA 1IE7C 1MNSA 3TROA 1VRDA 4XAGA 3UJSA 2BLEA 1YDNA 3K30A 3U2EA 3B0XA 3BK0A 2DP3A 4ZXLA 2Z1XA 2X2YA 2ZWZA 3TJLA 3H21A 3T0TA 4HA4A 2OWCA 4FLSA 4MWAC 4IFOA 1XH2A 5GJPA 5DBUA 1JUEA 1CGXA 3NZQA 1I75A 1I6NA 4ZODA 4EACA 1WBJA 2FMNA 1XYFA 3W1NA 3R89A 4IGHA 3SCNA 3KVMA 5A8GA 3VOIA 3LCGA 1PEZA 4XWUA 4TX9A 3HIJA 3TEVA 2ACQA 1FVPA 3AYSA 1AQMA 1LQ2A 4DELA 2PWHA 1TB3A 2PDWA 1N2VA 3RCNA 5I24A 2G37A 5AHMA 1KD0A 3CQIA 3NFUA 1F5ZA 3QLLA 3ITVA 3GG7A 3NYZA 4U33A 1JUBA 3UVIA 1FOBA 3EA2A 1QOQA 2DY3A 4XZLX 3V5OA 1YTKA 2GDUA 4J9JA 1JZ8A 5A5WA 2VX7A 3LN3A 3THUA 1E70M 1MEIA 2E9MA 3E2QA 3T8QA 4FNTA 1TUXA 2ZOXA 3WQ4A 2VZVA 3E2SA 3I4EA 5KZDA 5LXEA 3WQFA 2NXHA 5GJMA 2NQJA 4MTVA 3JZUA 4O13A 1BAGA 1TQJA 1FUYA 4FIRA 3WDQA 3NQDA 4M6VA 4PL2A 1NFGA 1QASA 4YYCA 2PE4A 3CO4A 4JR5A 4L4OA 1VPXA 3VCCA 3GU9A 1Q6FA 4HU0A 4IJCA 3IACA 4BKNA 1Q6RA 3PS7A 4L9ZA 2G3IA 2OT1A 3CHCA 4XD3A 3PJWA 5CJNA 1PTAA 2F38A 1PX8A 3VABA 5I5RA 4HJWA 4S3DA 3VIPA 5GPRA 4JNMA 5EFDA 1W2PA 3WDRA 1E72M 4M8UA 1W8SA 2FTWA 3F7JA 3B9NA 4P7NA 4FS9A 2CHNA 3QYQA 2PDBA 1FWFC 4HSOA 1T40A 1CGVA 3GC5A 1QOXA 1OB0A 4Y90A 2XN1A 4TVDA 4NVTA 2DDXA 4QJ5B 3RO8A 1OHLA 3NVDA 4LU0A 1M7JA 4X2RA 3W1LA 5C2XA 3CPRA 3H2NA 4V15A 4GKLA 3EPMA 3ZVIA 4HCHA 3PWAA 2CLOA 1HJUA 4UWMA 4FMVA 5BRPA 2OSXA 4K6AA 2V81A 2IPGA 5AZ1A 4NRSA 4RDWA 2GVEA 1LBLA 2INFA 3Q4DA 1ZP3A 1JCYA 1DJWA 1UH2A 2W62A 5H8UA 4ADTA 3HBLA 1BYCA 2ZDRA 4CQ9A 2YYUA 1E4MM 4QDMA 1SMAA 4G1KA 4GXPA 3I7SA 3PY2A 5D2WA 4R85A 1XKJA 2VGGA 3FVMA 1JGIA 3OZOA 4G1NA 4AWUA 2Y5SA 3M41A 3EDEA 2WVUA 2E9LA 3RMJA 4NJJA 4UBPC 3QR3A 2D3LA 3KZSA 1H5YA 4DBUA 2R94A 2DQXA 1JCXA 1RSCA 1MW3A 2C3ZA 1TWSA 1UZHA 1W5OA 1V7YA 2C0AA 5FEPA 3A4WA 1K7EA 1PTGA 4UFKA 3W7IA 3LXBA 3VNZA 3WNLA 4LF2A 2YJQA 4HSNA 5HWMA 1QK0A 2O4QA 4U2ZA 1NWSA 3H2FA 1G4TA 5HUPA 3KBJA 4D9PA 5KSWA 3SY5A 1HW6A 5DRCA 3LEPA 3R4IA 4HNLA 2BBFA 1KXVA 4C7DA 4QQ3A 2CIPA 1TWIA 3S5NA 1TPB1 1T8QA 1AW1A 3MUXA 2WVTA 3QM3A 3IEBA 2ODOA 3W7OA 2C19A 4JQ2A 1A4LA 1UC5A 2EKGA 2OEMA 5J5RA 2E40A 3WK3A 4F9JA 4J3WA 4IPNB 1GVOA 1V3LA 2Z6IA 4CD6A 3NQCA 3W07A 3P7YA 3AS2A 2P76A 1E6XM 4B15A 2QV4A 2EAWA 1CZ1A 3KHJA 2EGZA 4LCQA 1R3SA 3B9DA 4NZ1A 5JUVA 1MO0A 2DEPA 1W1VA 3KLKA 3STGA 2R91A 3BGJA 3CL7A 1PZ2A 4KFOA 1KW1A 3CUXA 4I6KA 3R13A 5LA0A 5D09A 1UZDA 1LZOA 1R3WA 4W85A 3ZWSA 4N9DA 4TR9A 1VIZA 5FKYA 1XL9A 3UG4A 1J8VA 4LOCA 4RV8A 3GUGA 5HINA 4B5TA 2XFFA 7ODCA 1ZFJA 1TJPA 2WHJA 2I9EA 3UR7A 1W8GA 2Z6JA 5D33A 4DWSA 3LCLA 4GVFA 1B9ZA 1CXHA 3UYCA 1VFOA 2WK2A 5T9CE 1E3ZA 3I3EA 1QI2A 4Q4OA 2QZRA 1CNVA 4JQAA 4LC8A 5I3DA 2OPJA 1GOMA 1VJSA 3PR2A 2QF7A 3CAWA 3MV01 3S1WA 2BG5A 1J5TA 1H50A 2VEPA 3SR7A 3NPXA 1Q2RA 3T0CA 1HJVA 3NJ3A 3DBNA 1DWAM 3M0IA 5K4XA 2D1ZA 2F6UA 2WANA 4JEQA 4W5ZA 3M7WA 1H2JA 1Q45A 1GVRA 3SCTA 3CT7A 4DBSA 4C5YA 1TUFA 1VEPA 2CLMA 4KPLA 3DKLA 4Y9NA 2OODA 5E1QA 1EYEA 1EF2A 3PNZA 4S3KA 3RN6A 4KH2A 4QG9A 4DWDA 1XCFA 1RD6A 3K1GA 1G4EA 3N4FA 4E8DA 2PURA 3CMFA 3DKJA 1E0XA 4HZ7A 4MMWA 5ECVA 3GYEA 3EWBX 5D8WA 3MPGA 4IGMA 1GEHA 5HMSA 2ACRA 4A05A 1HKWA 1O7AA 3A12A 3CHDA 4DB7A 1DP0A 2AOSA 2O9RA 4H04A 3N9KA 2E6FA 1Q63A 3M0XA 4RL3A 5DELA 3WDPP 3FKKA 4WR3A 1YPFA 1EC8A 1E55A 3L9CA 4O1BA 1FCVA 3MVIA 5C70A 4DBEA 1H7NA 1W3HA 4UTIA 3NAVA 1E6RA 3TWBA 1W3LA 2Z00A 4IL2A 1GUVA 2DW6A 4JQ3A 1VR6A 3NZPA 1KFKA 1CGTA 4CNTA 3FGCA 2J7CA 5LA1A 1QHPA 3RPDA 4J2MA 1YXYA 3CV1A 1ESWA 4GUIA 2QKFA 3G6LA 3U6WA 4KWSA 3P2VA 4E4UA 3JU2A 4LVFA 2QPSA 3V0SA 4JIRA 2WJDA 4C1KA 1JL8A 4PCPA 2WWDA 3TN6A 1EBGA 2OEKA 1H61A 4KWUA 2Y5JA 2YL8A 1EUAA 2ZRVA 3P93A 1BF2A 4XSLA 2QYGA 4C1NA 3QRHA 3TYBA 2F7FA 4IWWA 1X1OA 1UH4A 1I45A 4ADUA 1F61A 4XD6A 3W88A 2GK1B 3BICA 4PGLA 1JFHA 3A3XA 1FCQA 1QNQA 4UNLA 1R3VA 2HVNA 1BD0A 2OYMA 4GPNA 4RX0A 3UZZA 3GH4A 4ASTA 3ZLFA 2VFIA 2YB4A 1VZWA 3SUWA 2Y7GA 4AVFA 3H7RA 3MA8A 4Q4PA 4O1CA 3GD6A 4UFMA 3T0AA 1TRIA 1FRBA 3DDMA 3RM8A 4BF9A 4UTUA 5HNRA 4AU0A 1S5MA 3NL2A 2WNZA 5CPLA 3SJNA 4O12A 1PDZA 4CQAA 1OX5A 1MRAA 5HANA 2FZ8A 2QMJA 1GJPA 2Y0FA 3UVAA 1M7PA 1D3CA 2VO5A 2I16A 4BQ4A 1MDLA 4B16A 1R9ZA 4LYKA 4I9TA 2VUNA 1XIFA 4FK9A 3UNTA 3QJAA 4PC8A 2NVCA 1IXOA 3SJ3A 3MVTA 1NDZA 1GOOA 1LWJA 3ITGA 4S2BA 4L9YA 3V1HA 2HK1A 4Q4KA 5FJOA 2I9UA 4BJHA 2XYLA 4JTFA 5GNYA 3LUTA 3W73A 2H3BA 4R7JA 3TA9A 4A22A 3WEMA 1PS9A 1FDJA 4A8RA 4AY8A 2VELA 2HDJA 3WSUA 1V0KA 1FFRA 3K2GA 2J8FA 3KOWA 5A8QA 3E0IA 4IICA 1V0MA 3TXZA 4AY1A 1GQNA 5DQPA 1BLIA 2ZA2A 1Z41A 1OFBA 5C9UA 4XBSA 3PP7A 2FZDA 2OCZA 1FWWA 2A85A 4EPDC 3TX9A 5TNVA 4XKYB 3GH5A 1DWJM 1HP5A 1L6SA 4K38A 3THDA 2V63A 1XKYA 3DI0A 3PC0A 5CZKA 1VFMA 1VS1A 2BDQA 2Z1KA 3O15A 1YBQB 3JS3A 4L6OA 2YXOA 4F4RA 3M6DA 1GVFA 1ZU8A 1W5QA 1GVQA 1FH8A 3VNLA 3CUJA 5D8ZA 2EG7A 3OPSA 4D1JA 4DJDA 4DLMA 1A5SA 2CZFA 5DCBA 3WLQA 3VGHA 1OT1A 3UCQA 3BMVA 4JOMA 4UOQA 5HJLA 4KCUA 3FDGA 3WFZA 2OXNA 4IIFA 4LRSA 3BVJA 3LQLA 1JZ2A 1NWRA 1ICPA 2XIJA 3BWWA 5DCDA 4UFJA 4Y8EA 4FLQA 4V1XA 1QTWA 3P81A 3WJZA 4ZO9A 1RCQA 1V3HA 3U8GA 1W1ZA 4DJEC 1W56A 4GZEA 4N2YA 2ICSA 2OYLA 3L5AA 1GJUA 3GLCA 1YE6A 3C4UA 1TMQA 4ORIA 1E51A 4C7FA 2RDTA 3QZ6A 1Z6KA 5BROA 4YN5A 3VNJA 2X05A 3ICJA 3N2TA 1XH0A 2KZHA 1R2TA 2LLEA 3VYLA 2W0UA 2PFHA 4AC7C 2VR5A 1YTDA 2VI0A 1GG1A 5G1MA 3GBDA 2ZZ2A 3OGSA 1EFZA 3CJPA 3AS0A 1KRCC 1FX6A 3IGSA 2VR2A 3W82A 3VGGA 1NWTA 2VUYA 3DC0A 1OG6A 5K9DA 3AS3A 3EGJA 4O16A 4XX6A 4KIRA 1FKWA 2DIKA 2P8CA 5FF3A 2HPMA 3R0UA 1M68A 1R8LA 2D2GA 3WQWA 4F48A 1KCZA 5CZ0A 4HPXA 3EA1A 5D9OA 5C9WA 5EY5A 4M3PA 4JHOA 4E2OA 1TPH1 4KFPA 2G95A 3M5VA 2IPJA 2X8RA 3CV7A 3W28A 5A6TC 4JTAA 2BXYA 4C6BA 1YNQA 3H2AA 2WW5A 4HIBA 3CLWA 4IM4A 4A8LA 4C6CA 3KOFA 3T08A 3E2RA 4ZB2A 3GFYA 3QHOA 3I3BA 2QV5A 2ZX6A 3WQDA 3W1AA 2JF7A 3MZ2A 1ZTVA 4EWND 3GRIA 2H6RA 5IFTA 4H01A 4LCSA 4D6GA 3DESA 1B2YA 4HK6A 5EMMA 1WDSA 3PBWA 1J10A 3AIBA 2CXEA 2J9XA 4MWAE 4OBRA 2NZLA 1LT8A 3W1XA 1Y5VA 4WY0B 1IWBA 3WMSA 3SBFA 3TTYA 1RBAA 5HMFA 2G4JA 4HMEA 1K1DA 1LRTA 1NVMA 3GR7A 1EDGA 3LNMA 3S83A 1MI3A 1FXQA 4REQA 2VFFA 4AZCB 4B90A 1XBYA 3U3HA 4ES4A 1CEOA 5ECUA 1XG4A 1YW1A 3E0FA 3TQKA 4R9XA 1N82A 4ZE4A 5AYIA 3PTQA 4K7YA 3WF4A 1VC4A 1R7AA 2XU2A 1NAL1 3OLEA 3H2EA 1H7OA 2R82A 5E6YA 3UWVA 4P8VA 3B3DA 2V2HA 2E5BA 4QDPA 3NDYA 4UQBA 3N2XA 1SR0A 4R7WA 2CLPA 5EYWA 5EA9A 2X1UA 2FDSA 3UR5A 1W9XA 4UTLA 2QLYA 1EJVC 4IIGA 4D6JA 1DJQA 3IVTA 4RE2A 1MRQA 1UH3A 2C13A 3P0WA 1AJZA 3REQA 1TQXA 3SM0A 4Q8PA 2C0HA 2NV2A 2F2KA 3BXWA 3K13A 4REQB 3ZWTA 3AUJA 2ZX8A 1YDYA 3UY8A 2WZTA 4XZIA 3QOKA 3MY9A 3RITA 3GX9A 3HQ1A 2A7PA 5G4HC 1LDCA 3KP0A 4WY0A 5XIAA 1IXQA 1P0BA 2ISVA 1C9DA 3NCOA 3ONBA 1R3TA 2Z2AA 1V6WA 1B3ZA 1VQTA 3RDKA 1QPNA 4AXNA 3L4TA 1I2OA 1PHWA 4NNBA 5ABTA 2VFGA 1OF6A 2UY5A 4PEEA 5CPOA 2XGZA 5AC5A 4B4FA 5D2VA 3B8UA 4IPLA 1GZ1A 1K3UA 2V30A 3ZFHA 3EOLA 1UR4A 4UCFA 2EXOA 1NQ6A 1BG9A 4LY4A 4LTSA 3CHEA 2JFEX 2VVSA 3DERA 3T0BA 3I6RA 2IW0A 4FLOA 2ISFA 3T7VA 5IRPA 4GZJA 4LAUA 2RHGA 1TV8A 1W5PA 2OKTA 5CG0A 3LBMA