3GVQA

Urod single-chain dimer
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
publication title Substrate shuttling between active sites of uroporphyrinogen decarboxylase is not required to generate coproporphyrinogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gvqA00
3GVWA 4QQUA 4EXQA 1YPXA 2NQ5A 3CYVA 1R3QA 1U1JA 3BQ5A 4ZTYA 2Q71A 4ZTXA 1U22A 3GVRA 4L6OA 1R3SA 2INFA 3GVVA 3GVQA 4L6HA 3GW3A 3PPCA 1XDJA 1XPGA 1JPHA 1R3RA 3PPFA 1JPIA 4ZR8A 1R3TA 2Q6ZA 1R3WA 1U1UA 1T7LA 1J93A 3PPGA 4L64A 4L65A 4WSHA 4L5ZA 1XR2A 1UROA 3T0CA 3RPDA 1R3YA 4AY7A 4AY8A 2EJAA 4L61A 3PPHA 3L7RA 1JPKA 1U1HA 3GW0A 3BQ6A 1R3VA
chains in the Genus database with same CATH superfamily
4D6DA 5HATA 4GISA 2Z2BA 3KFTA 2J7FA 4L80A 3FYYA 4J4KA 2XFFA 3K1DA 5HMFA 3UXAA 4GH1A 4MIMA 3CAKA 2V3DA 3GDBA 1F07A 3CTLA 4IXHA 3V16A 2A5HA 3FVMA 7CGTA 4Z42C 3AMDA 3F1QA 5A1AA 3VOGA 1HKWA 5FEPA 3CIVA 2IQTA 2VXNA 3MU7A 4ERGA 4YYFA 5J5RA 1V6WA 1OG0A 1E0UA 1Q2SA 4LW7A 3UYIA 4UCGA 2CZDA 2X2YA 3RCMA 1WDDA 3DYMA 1XBZA 1PZ0A 3DHFA 2PDKA 1XLLA 4I5XA 3C2RA 4H6KA 4IPNB 1BYBA 4GVHA 3RK8A 2FTYA 1MRQA 2PP1A 1OK4A 4LS1A 4HZ8A 1QOXA 2XVKA 1UD5A 1MEHA 4UOQA 1KXTA 4O18A 5AZ0A 2ZIDA 1G4EA 4JL1A 4F3HA 1AL7A 1XIIA 4YYCA 3CPUA 1UR2A 2D0GA 2J9XA 3VCRA 3B03A 4IF2A 3GR7A 2R94A 3CQIA 1BRLA 4QDPA 3PJTA 2EQDA 2NLIA 4KW2A 2Y6ZA 1JF5A 4GVIA 5FEXA 5H1WA 4C6BA 2FPYA 1L8NA 3WF0A 4W5UA 3M5YA 4Q33A 4HB7A 3TYZA 1QO5A 2ACSA 3FDKA 1C9WA 4XTIA 2G8ZA 2YW4A 2IPWA 3M7WA 3UGRA 3WEZA 4JAWA 4BKNA 3T2OA 4HNOA 4L9XA 3GAYA 1BVNP 2XIQA 1E51A 4HU8A 4D9PA 1CYGA 3GXNA 5LIXX 3V4BA 4UTLA 2X42A 2BGNE 2VR5A 1P6BA 3CNYA 3QKZA 1XFCA 4Q6JA 4R27A 1FTXA 2ZX9A 1T41A 4WX2A 4M1BA 4QM1A 5G4WA 3Q4DA 3U2CA 4GUHA 3W00A 1GZJA 3H4GA 4FHAA 4AWUA 4DWSA 3H7RA 1W5QA 3CK5A 3WLQA 5C55A 3QXBA 3EDFA 1XF0A 3OZMA 4KESA 4CQ8A 3CUXA 4PTDA 3LS9A 2VNCA 1RBAA 1VAHA 2VEFA 1DYSA 1OX6A 3AYSA 3GXPA 3UZ5A 1E6PA 1GW1A 3BK0A 3P84A 3W7CA 8XIAA 1UD8A 3TNBA 4DX3A 3WQPA 3QSRA 2OSWA 2FB3A 2YYTA 3A22A 3HFYA 4YWSA 3M46A 5K3VA 1ECEA 2VI0A 2FMNA 1V6TA 4KEUA 4IPLA 3KVJA 1KFCA 4GKTA 2PD9A 1M6JA 2E9BA 3KUMA 5E5CA 1H5VA 1Q4NX 3VOCA 3I6EA 2NV9A 2ACUA 3EBVA 2E9LA 3W86A 5BOOA 1XLKA 3H2NA 4REQA 3S2LA 3ITYA 3GU1A 4WHBA 3D47A 1TV4A 2Q8XA 3T4WA 2J9ZA 4ZMGA 4UCFA 3FJ6A 3C86A 4S3KA 3ANUA 3W07A 5E9XA 2XH7A 4LRSA 5JVLA 2OOFA 1XWYA 2J6VA 3GG8A 4FA3A 1LWJA 3N17A 4LF2A 4NZJA 5LXXA 1YQ2A 2YDSA 1DWFM 4QG8A 1QWKA 1J2WA 3TCSA 2PI6A 1TJ2A 3W76A 3QYQA 4Z1BA 4D8AA 3W0KA 4HTBA 2HK0A 2DZAA 1O68A 2UY4A 2IPGA 1Y5WA 3BCDA 4M7TA 3MUIA 3I7RA 1ZCCA 4Y96A 3ICJA 4FR1A 1VGAA 1F6YA 4F66A 4E6MA 3WFZA 1RLDA 3C2FA 3LI0A 3ZOAA 3MT1A 2WB5A 1LCOA 1PX3A 3GNRA 2GJPA 1VFSA 4MFEA 3R89A 3E0IA 1PAMA 1FA2A 4NYYA 1P0DA 3VGFA 3KW3A 4PSRA 4S3BA 4WD0A 3NQMA 1VEOA 2AL2A 4GYPA 4JHZA 1VFOA 3H23A 3TN6A 1TPVA 3VGDA 2VT0A 2XJ7A 4IJCA 4PMYA 4M29A 3S2MA 4UBPC 5T91A 3BO9A 4L4LA 2NXIA 2ZX8A 3N25A 1FWFC 1OGBA 5HNUA 4EX4A 1KRMA 1LT7A 3M0VA 1E4NA 2W63A 2P3EA 1UWIA 4YN5A 2WHJA 3FVDA 4GIYA 4MLRA 1V4YA 4XZMX 1M7JA 1JULA 4DUVA 3LD5A 3CAWA 3KBNA 1KWGA 2QPUA 4LX4A 2HWGA 2QIIA 5I23A 1P0BA 3UPWA 1R2TA 1YTDA 5C9UA 1KKOA 5I3KA 4KGJA 3QW4B 1E0WA 4LYKA 1CI1A 4FOUA 4DRSA 4IQJA 2ZTKA 1PVNA 3ABRA 4YHGA 2PPGA 4JTDA 5AFDA 1QTWA 3MCNA 5CSRA 1UA7A 3SFWA 3LV6A 4GY1A 2NVAA 2J7HA 3SCQA 1SFLA 5FCZA 2GQ8A 3UXLA 3GKFA 1O60A 4CEUC 4YTRA 5G2IA 3ZFHA 4C6DA 3F03K 1PIFA 2CIPA 1EJWC 3W7EA 3NZ1A 3GG7A 3CUZA 2KAUC 4W84A 4ZQNA 4DJFA 5FF7A 3FYOA 3W6LA 5CC7A 1I2RA 3KP1A 2OB3A 1G4PA 1BKSA 4JN6A 4L56A 1XYLA 5IHRA 1A53A 5I07A 1N7KA 1HX0A 4QCFA 4UZUA 3VNIA 4NZ4A 3K46A 4UQEA 3SECA 4QFUA 3MCMA 1UWQA 2AQWA 4ZQRA 2BVTA 2CBUA 4IGSA 1OCJA 4YXGA 1KM1A 3W7RA 2UY3A 1I2PA 1ZY9A 3S3GA 2Y61A 5HOSA 1C8QA 1UR8A 3FJLA 3HPSA 2V68A 2ZX5A 8RUCA 2FGZA 2E6YA 2INZA 3MSGA 5RUBA 3FEMA 2AAMA 4UMBA 3N4EA 4FIRA 3VKCA 2C3ZA 4YNGA 3EWZA 5AHNA 1T7LA 4OOZA 3DI1A 2G3NA 2YL9A 3MMUA 2OO0A 3O16A 4J1OA 3ANYA 3NPXA 2OYMA 4FLRA 4MNJA 1B3VA 1ZQ5A 1XGEA 3PWAA 3S6OA 2YCLB 1JFXA 2C1HA 4LVDA 2ZX7A 3WNPA 5IOBA 1RQBA 3K8LA 4FEZA 2PDBA 5EA9A 3ZIZA 3V1PA 2VX5A 2PEVA 1GQNA 1SJAA 3TC7A 1K03A 2QQ6A 2GGHA 3DFHA 1VPXA 2ZZ4A 3GB6A 1W0MA 3PPHA 3UJSA 2VCCA 4QLJA 5KMYA 4O28A 4MWAB 2J47A 4WSJA 1Q4WA 1M1BA 1V0KA 1M9HA 1JGIA 1S5NA 2J7BA 1W3NA 1XISA 1XUUA 1MO0A 1EBHA 1Q63A 2FZBA 4JOMA 4H2CA 1XIEA 3AYVA 2QF7A 4UC5A 2Q71A 1J79A 3C56A 1H51A 2X7VA 1NY1A 3E9AA 3CMJA 2HVNA 3WLMA 3GFXA 1KFJA 2QCLA 3H55A 3WQ4A 1IYXA 2WK2A 5H6HA 1Y8BA 3GO2A 4QLLA 3TLQA 3SR7A 2WLZA 4HJFA 1RV8A 3GFZA 4PUUA 4CQCA 1YEYA 3AZTA 1YPFA 5D9PA 3RGTA 2QCDA 4CQ9A 1UPMB 3SN1A 4PCFA 1GQIA 3MSRA 2ZC8A 4KERA 2DT1A 1HJQA 1MQRA 2EAWA 5FEWA 4PULA 4Z1DA 4DJDA 3BOFA 2RKXA 3C0LA 3UXIA 5FKYA 3VYLA 3LXAA 1Q5MA 4H00A 1OINA 1VD6A 5CGQA 2ABAA 2XZ9A 5AHEA 1IIGA 2JGQA 3VIHA 3TONA 3QMSA 2XDFA 1XG3A 3MTWA 2EHHA 5D32A 3LGEA 1TZZA 3LB0A 2Z6IA 4FNTA 1XLHA 1JCJA 4MPQA 2Q01A 1QNOA 1XXXA 2OLSA 5A94A 4N9DA 4HOWA 1JFHA 1JNDA 3WG6A 4H9VA 1OQFA 3I4EA 4D1JA 3CUIA 3H7UA 1OFOA 2I7GA 6REQA 1A5NC 2PAJA 4G7EB 1RA5A 4W4QA 3IV3A 3CL8A 5CPSA 3FK4A 4AY8A 5JU6A 1RY0A 1KR0A 5DCEA 4J27A 3QPZA 3K30A 2J25A 5HNTA 2EPLX 5E70A 3LCWA 1A5LC 3UPBA 4BQ2A 2HISA 4Y6GA 2GPTA 3WL0A 1EPVA 3E02A 2ZRUA 1V02E 2VWSA 4IX2A 3UG8A 2WMHA 1E1CB 4FF7A 4PA8A 3BLFA 3RO8A 2ZOXA 1TWSA 1A3WA 4FZIA 1DIKA 3C5QA 4POCA 2V38A 3STPA 4OUIA 5EB8A 1OYBA 1CGXA 1GG0A 4IQEA 4NUWA 4B90A 2Z6JA 5KTLA 3WJSA 3P8JA 1H7XA 4BA0A 2IXVA 4HMCA 3S6DA 2OZ8A 4U3AA 1EP1A 3PBWA 3RM8A 1FWBC 5AYIA 4M8UA 1LBLA 3NSNA 3OYXA 4AF0B 1HGYA 3VX1A 1RBOB 3GC2A 4QSFA 2DT3A 2ZZ6A 4FNRA 1R3TA 4B5XA 1FY6A 3EDDA 1F3XA 2IKHA 3EMCA 3W7KA 5TF0A 2VP8A 2GK1A 3RNDA 4QS5A 3WMSA 1IHIA 5TD4A 4ZGYA 4GGHA 2ONEA 4DJED 2I56A 1L8PA 3WJXA 4Q8VA 3NPWA 3U9IA 3QR1A 4ATDA 2XVLA 4LYQA 2O9TA 5LNUA 1MXSA 3CT7A 1U1UA 4AUBA 4MSSA 3BURA 3HO8A 4F48A 1TIMA 1PIGA 4HTYA 2JEPA 1IWAA 3GZAA 1LUCA 1VPYA 3THAA 3AXHA 4Z2LA 4LBUA 5LIKX 3GC5A 4RXGA 2EKCA 3VI2A 3TAKA 1DJGA 3HURA 4INFA 4UUIA 3AWNA 5LIYX 1FUYA 1GHSA 1NWUA 1WZLA 1OCNA 1B3XA 5JBEA 1ZUAX 4JCMA 4XKYB 2P1FA 4HPGA 1GVIA 1VFMA 2Z0IA 2OZ0A 3BCJA 3OZPA 4O4WA 2NZLA 4LJ3A 3LRMA 2D3LA 4MY8A 1E6ZA 3LY0A 1TWZA 2YA1A 4CD5A 2GSEA 3VD4A 3A24A 3J7HA 3ELFA 3FAXA 4RZ5A 4MYXA 3VGBA 1JCTA 1GNXA 4Q8TA 2R1NA 3DX5A 5H2ZA 3DFSA 4MZ1A 2VEMA 2X16A 3WNNA 2A4AA 4IPPA 1S2WA 5I5RA 1KGUA 1ODUA 3AICA 3CHVA 3T0CA 4QITA 1P6CA 4C7DA 3U2ZA 3OIHA 3SEPA 1OFBA 1RJPA 1MMFA 2FLIA 3V0TA 3ZVHB 4O54A 3VGEA 1PL9A 3VZYA 2MUCA 1KRCC 2ISSA 2PWDA 2G4JA 1VEPA 1OGSA 3N18A 5BOFA 3LENA 1W9XA 3W2JA 1JCLA 1FVPA 3WIJA 5D4YA 3SGZA 1IT7A 4HZ6A 1DIOA 3W1PA 2V67A 1H11A 4LB3A 3E49A 3SY1A 2ISFA 4HNLA 1J0HA 1V03A 4RE0A 1OX4B 1GKQA 3PM6A 1UC4A 5HAOA 3TQ0A 5AHLA 2WYSA 1UH3A 4J9JA 3C0QA 2BOEX 4MJZA 1O66A 3EX4A 4YU1A 3H24A 4GXWA 3LPGA 1EZWA 1UKOA 2PTYA 3MYOA 1GYLA 2BP1A 3RF9A 2JALA 1Q6FA 4GNKB 3G18A 2D0FA 3DERA 3VFLA 1W56A 3W75A 3MV01 3PZUA 1QI5A 2DP3A 2WVTA 3ATYA 4J28A 5AVHA 1OIFA 5H8PA 4QJ4B 4DI9A 3ALGA 4DZHA 1HJVA 3SRHA 3ZR4A 2Y70A 4GJIA 3AIUA 4FNQA 4WR3A 4IHCA 2G41A 4ZSUA 4AZ6A 2PURA 2UBPC 1ISXA 1J96A 3GNOA 3GIPA 1XLBA 1ZNNA 1MW1A 2HRWA 2A79A 1FHVA 4PL2A 1GOXA 3D5HA 1XYCA 4QE5A 1ICSA 1HGWA 5REQA 1EGVA 4MJ4A 3SQLA 4FF5A 5I3DA 1VJZA 2NQ5A 2DZWA 4MHBA 3UWEA 2GQ9A 1QHPA 4TUFA 2CU0A 1TX0A 4LU0A 2WZIA 3W2UA 3HMJG 2A6NA 4ZB5A 3CV1A 4HZ7A 4Z0SA 1VHCA 1B9BA 2WKGA 1DJZA 4CGTA 1UASA 1IGSA 3EXRA 4YVVA 3FXYA 3UERA 1TUXA 4N4PA 5CC3A 3HOJA 2AAAA 4GMEA 1IWBA 1KXQA 9RUBA 5HJXA 4UFMA 5A8GA 4DXXA 5AVNA 3OODA 1Q8AA 1W17A 1UIPA 1MDRA 2QULA 1X8FA 1DJWA 5HR6A 1A5OC 1DXFA 2ZDRA 1Q45A 1A5CA 4JDYA 1UKSA 2OG9A 3CGTA 1HJXA 1WXJA 1ODZA 4PUWA 3PPFA 3CYJA 5GVJA 3SCSA 2WM0A 7A3HA 3GUGA 3RPDA 1ADOA 1FWAC 2P8CA 3OZYA 4YTUA 5T9BG 2ZRYA 1FOBA 4AZ5A 1JAKA 1J0JA 3FGCB 3MVTA 3PZQA 2XN1A 2QW5A 2WJEA 2WJZA 4AVFA 1F5ZA 4RXFA 4PRRA 3QC3A 2VKZG 2Z28A 3CB3A 5A8PA 1ZRQA 3P67A 3DBPA 2J62A 2VFEA 2OSYA 4X60A 4J3VA 1WQ5A 4A2RA 3STFA 4ECLA 2DJLA 3RYSA 5LGXA 5F2MA 1VH7A 3AXMA 4O1FA 2YL6A 1WO2A 2NSOA 4RDVA 3TE9A 3O6DA 3Q45A 2XTKA 4GUGA 2G3JA 4H9XA 5FJOA 3QV8A 2WCSA 3MI6A 3VMPA 3W3OA 2PDCA 3QH2A 2OZTA 1E4MM 4ZQOA 4FX6M 3P6LA 3CTTA 1XLEA 2EO7A 3DG7A 4NZ1A 1BTCA 3G1XA 3A23A 3ES7A 4FXSA 2TYSA 2VOTA 3M1ZA 1FWSA 5G2HA 5BMXA 5E6ZA 2R8WA 3VTRA 3BJTA 2FHFA 4Q4OA 3EWCA 4M51A 1PTGA 1XX1A 2QCGA 3OP2A 1XRTA 1TPH1 3URNA 3GUWA 1TVLA 2VURA 1V7YA 4ERIA 3DN5A 4TQTA 4JTHA 3ENLA 1JRBA 3B8VA 4TX8A 2J8GA 1GOIA 5A6SA 1NFPA 1FCUA 3ARQA 4NJKA 4CD4A 2P88A 4Z2IA 5AN7A 1P0KA 1Z9AA 3BAJA 2A3LA 3G1DA 2IQ0A 3F5KA 1W31A 4JQ1A 4WDUA 3W7QA 5JUVA 3TN4A 1KM6A 1FCVA 3HPAA 3VIFA 4GIRA 3FA3A 2FVLA 4IFKB 5E0KA 1XC6A 4QJ1A 1S3HA 2F9RA 2BV9A 4AZBA 2O7SA 1S5TA 2GSJA 3BSHA 2E6FA 3IIVA 1TPUA 3AMGA 1KCZA 1FDZA 1UQYA 4O13A 4PCSA 3TUUA 3PBUA 5EMYA 5D30A 2ZUNA 3EOSA 4BI5A 3ABOA 5E0CA 2WNQA 3LQGA 3VM5A 2YCKX 1GVSA 1V6YA 3EWDA 2F2HA 2BG5A 2GGEA 5A2BA 1POKA 1EGZA 5DLCA 3NA8A 3S46A 3TTEA 3TN3A 5CCZA 3I7QA 5I3HA 1UD2A 1DTNA 3QM3A 4JFVA 3MKKA 1E9ZB 3URAA 4D6CA 1ZJHA 4TMBA 1QATA 1ZCOA 2FHCA 5JBFA 5TBOA 1XICA 2C6QA 2LLEA 1VLWA 5FF2A 5CSUA 1ZP4A 1EB3A 3CO8A 4PRWA 1ZENA 3AS1A 2VEKA 4LVFA 1JXJA 7REQA 3DC0A 4D6EA 2WCAA 4M7SA 1EOKA 4DO5A 2DH2A 5DRCA 2NUWA 1FHUA 3URQA 4HNVA 3W25A 1Z48A 3ARVA 3H2FA 1QNRA 3DFYA 3R6IA 1Q6RA 3QGKC 2O56A 1D3GA 2NXHA 2FB2A 5I24A 3WFAA 3MWCA 1K7EA 4TVCA 4J7RA 3WO8A 4F0MA 1D3CA 4WGXA 1PIIA 1SZGA 2VWTA 4R7WA 2ZZ2A 3NZPA 4JEJA 3ZO9A 2WSYA 2CKSA 1QNVA 3EMQA 1TE1A 1XP3A 4U28A 1NDYA 1X39A 4YL2A 1SUXA 2FFCA 3TH6A 1F4HA 4JYEA 4AXKA 1X6UA 3P93A 2NQ9A 1F05A 1VIWA 1T99A 3VIIA 2EPHA 3QZAA 2PDNA 4TV5A 2O4QA 2WZHA 2OODA 2XH2A 2G4FA 3GBEA 6A3HA 5CZJA 3LMYA 4OGZA 3WK0A 3QY8A 4RZ4A 4O1AA 3H70A 5CKSA 3DBNA 2ZWYA 3BOXA 5C7HA 4PTMA 2NW0A 3R0KA 4WCJA 2ZE3A 4QJ5B 2QGYA 4H8HA 3GNXA 4O8AA 4JNYA 3S0CA 3WF2A 1W3KA 3L5AA 4FSAA 2CLIA 1K3UA 1R46A 3U48A 2GWGA 5FF0A 3OA5A 2GOUA 2GSHA 4LUIA 5EYWA 3LQLA 5G1TA 4Q7IA 2OT0A 2OX4A 3VE7A 3WBYA 1F8MA 3ZSTA 2Y63A 3DDMA 2C79A 4ZE5A 2D24A 1V3MA 2WVSA 3PZ9A 4XV0A 5KZDA 4C6KA 1FWDC 1ADSA 3A3HA 1R3SA 2XM2A 4AD5A 3W38A 3IK2A 1IQ8A 3KVLA 3UESA 1SZEA 1JQXA 1XR2A 5AC4A 4JYFA 3B97A 4AC7C 1OD8A 3HGJA 4PGLA 2BLEA 1AQ0A 1EH9A 1ZSXA 3AFBA 2HQAA 2RAGA 3VUSA 2PDYA 2NT0A 2Q02A 3APYA 3P0WA 1RJQA 3HBLA 4GQBA 2P0OA 1KM3A 3FNDA 1QJWA 1C29A 3PSVA 3K4DA 4IP5A 3NO3A 3VAVA 2Y7EA 3VX0A 1O6IA 1RD6A 3LK6A 1KTNA 3W29A 3GY1A 5KZMA 3BAKA 4GD0A 3T2PA 1S3TC 3A5VA 4R7OA 3EX6A 3NQ7A 4N9CA 1H60A 2PE4A 2W67A 3DH7A 3U4AA 5I3FA 3W2LA 4YCPA 2DVTA 2PTWA 3WQ5A 2BODX 4CQBA 2NWRA 1LTDA 2PMQA 2Z1VA 2PCQA 2PDFA 1DL3A 4HCDA 1GVOA 3VOJA 2QCHA 4AYSA 2VR2A 3EZ4A 3NQ6A 5D33A 4JTGA 2CC0A 4EE9A 3EKZA 1FHLA 1XSIA 4WSHA 5CAHA 2ZFAA 3QRHA 3ID7A 3A9BA 1PKYA 5FJTA 3GH5A 1O95A 2REQB 2OR2A 3IJIA 4XBKA 3T6CA 5LGZA 3TYUA 4P61A 1OY0A 3BGAA 1LRTA 2YLLA 4DNMA 4H83A 4BI6A 3T40A 4U10A 4WY0A 2GJXB 3HA1A 1YRRA 3M0LA 3SIMA 1R3VA 3SSZA 3S5NA 4LVGA 1G5AA 1U1JA 1EBGA 3M5VA 1W8GA 1RK6A 4J40A 3UWYA 2F84A 2W3ZA 4P2VA 3K5XA 1VBRA 3K8KA 5HWNA 3B8WA 5D9OA 2VCAA 5DXYA 3CV7A 1ZAHA 1HXJA 2QYGA 3BAXA 4GCXA 1KTCA 4NY2A 3WSUA 4MDOA 2PRMA 3UZXA 4OBRA 1JYNA 3PZVA 3IACA 4GH3A 1KRBC 1OX5A 1CGVA 2QJIA 4S3EA 3GXIA 1RQEA 3C4UA 4O4VA 3CUFA 5FL1A 2PWUA 3BW3A 3PZIA 2QCMA 1RPKA 5ABHA 1RP8A 5I3JA 1W1YA 3TP4A 2CBJA 3IUDA 4Q8OA 3L2MA 1CGTA 4Q4KA 3M6DA 2R9RA 3BLPX 3CS2A 4N02A 1KCKA 2YYUA 1W3IA 3DKJA 5IBXC 4GYFA 3O6AA 1RK5A 2Y0FA 3SI9A 4DF0A 3IAPA 5CH9A 3BG9A 4QAWA 2G5WA 4JR5A 3IJ8A 1VFLA 3EPNA 2G95A 5A6MA 3WKZA 4PBFA 3LSCA 4BK9A 3HQOA 1E4IA 1H4PA 3E12A 1RY8A 3FS2A 2YFOA 4UFJA 1IZCA 3G1AA 2X30A 4TVUA 3W4RA 1BG4A 3BQ6A 2GOKA 3UR2A 2RGMA 2XYLA 3G1YA 3OW1A 1B3OA 3OYZA 4UFLA 1UW9A 5CPLA 1XIDA 4DZ5A 2E25A 2VJXA 4S23A 1UOZA 3FDGA 1GJUA 2XVGA 4K6AA 1B2YA 1JUKA 1RCOB 2YB1A 1QW9A 2XVPA 3LPPA 3CC1A 1E6XM 2INEA 3Q58A 4J3ZA 4EANA 1RBLA 2GDQA 1YBQA 1SJDA 4O1BA 2GVLA 1YNYA 2ZVRA 2VO5A 5A95A 1I60A 5A5WA 3AROA 3VC5A 3VDHA 2BWGA 1NDVA 2QIWA 3ES8A 1Q6EA 5A6BA 3IRDA 3DI0A 3HV9A 2VENA 4JTKA 4H41A 1G69A 3BANA 1VBGA 4KEZA 3SM0A 4HT3A 1D3HA 4IG2B 2DZUA 3MB9A 2XHYA 4Z1YA 1G67A 2VGFA 3FX4A 2H90A 1AW2A 2EJAA 4GO9A 1XG4A 4GG9A 2C1GA 4WGHA 1XSJA 1KO0A 2HBXA 4EIVA 1IEWA 1UZDA 1DE5A 4S3GA 5A6BD 2E68A 2QAFA 3IS4A 1TPC1 3GFYA 2E6DA 2GJRA 4B9YA 3WLSA 1XBYA 4RNFA 2XG9A 3NEVA 2D69A 4UR7A 4H9ZA 1W1PA 5ABGA 4WKFA 3NQ8A 4NJHA 1BVWA 4AZGA 1LYXA 3N4AA 2G96A 4X22A 2XN2A 3KM8A 4UXDA 4QROA 4CU7A 1KQZA 1M7OA 3SO7A 2TAAA 2BVDA 3EX3A 1KD0A 3H6OA 4ZB0A 2E3ZA 3BCFA 5CJNA 3SADA 2HZGA 1GYMA 1WKDA 1K6WA 3CQJA 4LC8A 1UR3M 3F2DA 2DQWA 1P7TA 3EPMA 3EXTA 3WLRA 1NDWA 1TVPA 1K8CA 1WBJA 2X1TA 3WCZA 3AU6A 3TEVA 3FA5A 1R8LA 4AEOA 4D8LA 3CIXA 5D38A 1P0NA 3U2EA 4H6RA 2QV5A 3DZ1A 4PTWA 4GO8A 1KQYA 3W81A 3L2IA 1JZ4A 4JTUA 1VYRA 1O4UA 1S5WA 1EXPA 2I5GA 4Q8UA 1W37A 3TFXA 4HPNA 4Y8FA 2PWVA 1R86A 4EOUA 3G0XA 3AIWA 3ZWTA 2WJFA 1IV8A 1V02A 2V0TA 4GACA 4YJ5A 4A8RA 4TO8A 3OVRA 4PMVA 1GORA 1JVNA 3E2VA 4G6CA 1OC6A 5ABFA 1EO7A 3C8FA 3NTYA 2UY2A 2BFGA 3SSJA 4C6JA 4PB5A 4QNEA 4GI6A 4FO4A 2ZUSA 4HU4A 1HP4A 3OTRA 4E2OA 3N2MA 5CG0A 3ARTA 3EX2A 1P0EA 4P7OA 4K3ZA 3G6LA 4US5A 2AKMA 2WSPA 4IIGA 1JJKA 1GW9A 4W7WA 2V5DA 1BYCA 3KLKA 4AHOA 3TTYA 1ZAIA 3V5OA 3GDRA 1PYFA 3FSTA 2J79A 3P3BA 2R1KA 3UF9A 3HZ3A 3B8TA 2WC4A 2J13A 3TXVA 1KFLA 3CHDA 3N2BA 2Y5SA 3H2EA 2XFWA 1X1NA 1BEUA 2TMDA 2NVDA 5CBJA 1D8WA 4XAPA 1SW7A 3AIRA 4PMNA 3CHEA 2QUVA 4AWSA 2WNZA 4L1WA 4AIUA 4IX0A 3A64A 1A4LA 5LHEA 3N3TA 3GW3A 3UR8A 1WP6A 4O1CA 1JZ8A 1TIWA 2TPSA 4C1NA 3Q94A 4FXFA 2EJ1A 3CBWA 2OQHA 1VCFA 4KWUA 2NXGA 2YXGA 1LG2A 2H8XA 4PCNA 1UG6A 4I8DA 2NVCA 3GHRA 1HO4A 1SZRA 1UKPA 3LLFA 2E67A 5H91A 1JUBA 1MW0A 2O9RA 2VCBA 2EPNA 4G9PA 3WEOA 4LUSB 2WZTA 2PF8A 3PFMA 5BXSA 1LOSA 2OU4A 1XD1A 1X6LA 1HIZA 1CX9A 2VZVA 3W84A 2QNEA 3GYCA 3EMZA 2PDQA 3F2BA 4A22A 1EP2A 1R47A 3B40A 2NX1A 2OWXA 4YVXA 1V7AA 1IT0A 4DPPA 1KWKA 5I00A 2FFIA 4C6CA 3CWHA 4M3PA 1WZKA 1LM1A 4PFHA 4LCRA 3EDKA 3R0UA 1X1ZA 1X97A 2CFFA 4OTKA 5GQBA 1N55A 2OZ3A 1X7FA 3R43A 1NWSA 4X3ZA 3HMCA 3WQFA 3CO4A 3LXCA 1FWJC 3B8IA 3GXMA 4JY9A 3S5ZA 2ON3A 3KVMA 3O6YX 2HSAA 3WFLA 3MSDA 4LF1A 3C0JA 4ATLA 2WOQA 1TMQA 1QOPA 4ORMA 1FFRA 1HZYA 1J8VA 3EAUA 3S5SA 2OJPA 3I68A 1V5XA 2TRSA 4GI8A 3AJ7A 1OF8A 1B3WA 2HS6A 1PHWA 4JTRA 2J8FA 4BQ3A 1AZ1A 4LB4A 2QCFA 3L12A 1HUVA 3LTSA 3MBFA 2EG8A 4WDTA 5FAJA 3RJXA 3UY8A 4Y9OA 2VHLA 5CSYA 4PN2A 3C8NA 1XBVA 1F3EA 1LL7A 1P1XA 2XGIA 3G2GA 2E8ZA 3T2QA 3LYEA 1E0TA 3CQKA 3FYPA 4AXNA 4CQDA 1XJBA 4YPJA 1EWEA 1ZU8A 5C2GA 2H6RA 3OLDA 3PZOA 4QP0A 3QHNA 1W1VA 4NG3A 2XIBA 4JCLA 3FJ4A 3A3XA 1U33A 1Z3NA 2YZ5A 2YX0A 1REQA 4LNYA 3UXDA 1VP5A 5I77A 3CQHA 3Q65A 1OHLA 3DYOA 3MDUA 3W71A 3WK3A 1XKJA 2DVXA 1DWJM 3CT2A 3LLDA 4I5RA 3KWSA 3VIJA 3MBDA 3BLDA 1ITCA 1K4HA 2VRJA 2JE8A 3UGVA 1RD5A 3UQNA 3FW6A 2YL8A 1UB3A 5MKGB 1HKIA 4PEKA 1IIHA 1OD0A 4XUGA 4H2HA 4FXJA 1NVMA 3TC3A 5DT7A 4F2TA 1YLVA 2W9MA 4LYPA 5I7GA 1U5VA 2DZBA 2A85A 1ECQA 4B5NA 6PTDA 2VTFA 3N2OA 1HJSA 1ZJIA 3NL3A 1WZMA 2Z24A 3O15A 3K13A 1QPNA 2YJQA 4LYRA 3DC8A 2GGGA 4NAEB 3GNNA 1V6XA 4XKMA 4LS2A 1D7KA 4K2SA 3UG4A 3KTSA 3UWZA 1IZKA 1LBFA 1F76A 2OTDA 1PJ9A 4ZFCA 5HQMA 3UZWA 4WOZA 1AW1A 2C91A 4NI3A 5CZTA 2C16A 2WHLA 4S2BA 2DIEA 3OIXA 3WQWA 4F2BA 3WQGA 1E15A 1B31A 4GK8A 4X2RA 3PF3A 3RITA 1FFQA 4GKLA 3CAQA 7TAAA 5JIWA 3LCXA 3W1TA 3W85A 5L9FA 3STGA 3G77A 1DIEA 1Q8JA 5GNXA 3LSBA 1MNSA 2XU2A 2ZXAA 3TC6A 1CGUA 1DEDA 2WZMA 2V30A 3WQ6A 4NAFB 5IFPA 4ADTA 4FNSA 1EJRC 3OHIA 1JDAA 3QF0A 4GUIA 5FF4A 3G1HA 5IDZA 3DYPA 1CT5A 1NSJA 1VEMA 3H8AA 4IUOA 3UXKA 1WPCA 1UP2A 3PS7A 1KFBA 2Z4GA 3AQUA 1QUMA 4GBDA 5JMUA 3OPSA 1IEXA 2CLLA 1FRBA 2WSQA 1GUVA 2BY2A 1ZBVA 1XLFA 3HQNA 4JQ2A 3RAOA 4GUJA 4UB9A 2PCEA 1R2RA 3ONCA 1UH2A 4PB3A 1GZGA 3PNUA 2QLYA 1B0IA 1E6QM 2O92A 2TSYA 1UA3A 7TIMA 4IP4A 1NDZA 3S5YA 5J04A 4CNTA 1QR7A 4JGDA 3WQDA 2PD5A 4AVOA 4LY8A 6CGTA 2VQTA 5A6LA 3BG5A 4IMDA 1S2AA 3H21A 3GK0A 4LBRA 2FTWA 2GVGA 1J0ZA 3WLLA 3IV8A 1J0IA 5DN1A 3U4FA 3WQOA 1KR1A 1XS2A 4K68A 3L5MA 4W93A 4QEEA 1TJRA 1GVRA 1JDDA 2V2DA 1K8YA 1B4EA 1J01A 1S2CA 1MFVA 2ZKMX 1YKWA 2R24A 5G1MA 1XW8A 3M0XA 4GY0A 4TTGA 1G1YA 3GDTA 4W9TA 5C9WA 1RSCA 4BS0A 4JIEA 2QVNA 5E9AA 1KA9F 3MUXA 2B81A 3WUFA 3R58A 2VFGA 3KS5A 3GDKA 4I90A 4MLJA 4F0RA 1NOWA 4AY1A 2E8YA 4PTXA 1H63A 1Q65A 5HQLA 1YXYA 3ARPA 5FACA 1GJWA 3KHDA 1ZL1A 1F3WA 3TJXA 4UMCA 1BHGA 3P5YA 1MW2A 5K4XA 1OFQA 1YADA 3GC4A 2CLHA 2B7NA 3U8GA 1NF7A 5BU9A 1RQHA 2A3AA 1PPIA 3UNTA 2NUXA 3AMLA 4A05A 2BX7A 4MVAA 3BWWA 3DU0A 4ZOEA 4P7LA 1KFEA 4B15A 1BXNA 3KDNA 2BGQA 4U2ZA 4RCXA 5FI8A 1J0YA 1O5QA 3ZLHA 4L4OA 4I9TA 1NARA 3ARWA 4LSBA 1VFTA 3HPZA 3OBKA 3CUJA 5B7YA 1J18A 3RDKA 2BHZA 4S3CA 3VINA 3W1AA 2QJMA 1SU5A 1KBKA 3BXWA 2WW5A 4KS0A 2VM8A 1FWHC 4D6GA 2ZBTA 1DE6A 2JF7A 2BOGX 3FCPA 4P8WA 1PDYA 1E9YB 5GJMA 5FESA 2OKTA 1BTMA 1W5PA 1R9XA 1XC4A 4LCSA 4CN1A 3UWQA 1NFBA 2V82A 2VFFA 3AALA 2GDUA 3USBA 3RCNA 3VDAA 1ZB5A 1YTEA 4YTQA 3WY1A 5I03A 2W79A 4XO7A 3E38A 1JIBA 2V8ZA 3ABQA 1TX2A 2XFRA 3KZPA 1NWTA 3BSMA 3R7MA 2ZRWA 4KGLA 2VDHA 4LOCA 2GDVA 4FIQA 4XAZA 1XPGA 2FH6A 1V0MA 4NHVA 2ZRVA 2GGJA 3OB8A 4Q22A 3IUIA 2WM1A 1XH0A 3QLLA 4AVNA 1A80A 1CLVA 3GTFA 4XTDA 1XYZA 2GZXA 2V5LA 2GVJA 3QSTA 3SCPA 2PBOA 3GXTA 2DORA 3TTSA 1S1PA 3WDQA 1PHQA 2VEGA 2CLMA 5M2FX 1XBXA 3BV7A 1RXOB 1TPB1 1OJXA 3KX6A 3NVTA 2QCEA 3UFYA 1P6WA 2WBGA 6ALDA 2VC7A 2O0TA 4O17A 2EXOA 3PB0A 1CB7B 1JDFA 1AD1A 1CBGA 1YTKA 3KBVA 4MNKA 1Q6CA 2WXDM 3ITOA 4GIAA 3MMWA 4GNVA 3SCRA 2DSZA 5HK4A 1JI1A 4H8NA 4XIMA 5C6MA 4W5ZA 3TW9A 3LHVA 1PUDA 4BEQA 4NNCA 1CXKA 1TO3A 4C6PA 3NYDA 3CQ0A 3P60A 4QRNA 1J93A 3VKAA 4H9MA 1TREA 1F61A 3N11A 2Z7GA 2NV2A 1RUSA 2I5IA 2NUYA 2YXOA 4DJEC 3OVGA 3P81A 3LHYA 3ISIX 1UR1A 3MJMA 4NASA 3D6NA 2QUMA 3RPMA 4E5TA 3FXGA 2DH3A 3AS0A 3WD3A 1OFEA 1BGGA 2JKPA 5DMNA 4H8VA 3W72A 2OEMA 7ODCA 1V79A 1FH8A 4IZGA 3EGJA 3HGOA 1D9EA 4QR6A 3NDZA 4E0CA 3OQEA 3AUOA 4B2DD 3RJYA 3CHFA 5LNVA 1NP0A 3E3HA 1HFBA 4G1NA 1UOKA 4Z0JA 4KRTA 3R12A 3T1GA 2GJNA 3FKKA 4AZCA 1NM9A 5DANA 2V5KA 1TPEA 4WJXA 1WUFA 3TMQA 4U5KA 4JTTA 1TJ1A 4GPNA 3TYEA 2PDJA 3GVVA 4AD2A 4ZFMA 1JPIA 1SO6A 1DHKA 3VZZA 3FY1A 4WJ8A 4H4IA 3QTGA 3E1F1 1E9IA 5DT5A 4O15A 1E70M 3T81A 3NQGA 3TMLA 3GVWA 1YE4A 5K7JA 2CNCA 1H1NA 5BU6A 5AZ1A 1QWGA 5ECUA 1PKNA 5IM51 3W2NA 1NP2A 4GQQA 2XWDA 4ZSTA 5DMYA 1H5YA 3AS3A 3ZQ9A 3TIMA 2E5BA 3VXGA 2AGKA 3MJYA 1MUWA 5J5DA 4AHPA 3H22A 3SY5A 4OHQA 1AQFA 1R30A 5LIUX 4KCVA 2Y8VA 2CBIA 3WF4A 1JYVA 1V77A 1US0A 2AQVA 1OF6A 2WZEA 4Y7EA 4WK9A 2WSRA 4BWLC 4S3JA 3M44A 3ITVA 1C3FA 3VIPA 4Q4PA 3NSMA 4EXAA 5CLTA 3IPWA 3TSBA 4DF1A 1OC5A 2WJDA 4M6QA 3S9IA 3WEMA 4XD3A 3SBFA 4L5ZA 3DG3A 5K9XA 3RG6A 2VDGA 1LROA 3NUKA 2X1IA 1CDGA 3O07A 2CZ5A 3R10A 1U5HA 3BLKA 4JIIX 3WLNA 1UR9A 3ARXA 3SZ8A 1C8YA 1MVYA 2ZTJA 4M0XA 3L23A 3EDEA 3SRFA 3SJ3A 3H7VA 1UD3A 2VMFA 4ZL1A 2WMGA 1ADDA 2WMIA 3Q37A 4JTFA 3AIQA 2ATSA 2WMKA 1QW8A 4HBKA 1JPKA 2VDIA 1RZMA 5EMUA 3KRSA 4Y90A 1TFVA 1RALA 2BY3A 3LCHA 1LORA 1ITQA 3S2JA 3D3AA 3BL3A 2XN0A 1PYMA 3OHMB 1I2QA 1BRLB 3RR1A 4OV9A 3REQA 4H7ZA 1CGWA 3IVSA 1VCGA 4C5YA 3M0HA 2V2HA 3S5OA 1SJCA 4U2YA 1OYAA 3RM9A 2ALRA 2YDRA 3MZNA 1JRCA 3USZA 1EYEA 5KSWA 3P2VA 4PZVA 3KLLA 2F38A 2B7PA 1PCKA 5C9XA 2YPIA 1TA3A 4K7YA 1RAKA 2ZYFA 4NNAA 4EPBC 1PZ3A 1VJIA 4A29A 3M0IA 4B9ZA 4UR9A 1TR9A 1LLOA 3R8GA 3TZFA 4PUMA 1UR0A 3TQPA 4XWUA 3KBJA 1TZ7A 2YIHA 3SCVA 3UT0A 1PZ2A 1UKQA 3B0UX 4ZO7A 2AMGA 4DWSB 3K4AA 4Y8EA 1L6WA 2QF8A 4LS0A 5I06A 3MI3A 1K8XA 3M0KA 4GFIA 3EA2A 3ZWSA 3H2OA 4XSLA 3UCDA 4UTMA 5CPOA 3KVKA 3M41A 5DMLA 1PZ1A 1WB0A 1Q6LA 3K4WA 1UWTA 2X40A 3KXQA 4FMVA 4G56A 2QMJA 4MB1A 4KMQA 4PC8A 4HSOA 3GH4A 2Y4SA 4S2CA 2YLAA 3B8DA 1E5NA 3PSWA 1XLJA 4FX7A 4L1XA 4AH7A 3QHOA 1QK2A 1H41A 5EL1A 3WX7A 3DIPA 1LG1A 3AUJA 1C93A 3GD6A 2QV4A 4I9JA 1WDSA 2CZEA 1DTUA 1UBSA 1QHZA 2Y89A 3IAQA 5CBBA 3EA1A 2DJXA 4F9JA 3KOZA 4REQB 4K1GA 1EJXC 2V69A 1YX1A 3NQFA 1WKFA 4HHLA 5F2IA 3N34A 4IIEA 2JEQA 1F7BA 4CCEA 4EPDC 4FP1A 5LHFA 4X9YA 1UUQA 1GZ1A 4CNSA 2QMKA 1M7XA 1T0OA 1AH0A 1S2VA 3OZOA 4UQDA 4FOJA 4DO4A 1EA9C 1YE6A 3MO7A 3WELA 3BJSA 4TVDA 1WAWA 4MZ8A 4KEVA 2BHUA 3WNLA 5KZEA 1AA1B 4GRSA 3PJXA 4JYDA 3GE7A 3LGGA 4YMZA 4DZIA 1VZWA 4NIRA 2FZ9A 3LMZA 5HUPA 1J12A 4MG4A 2C14A 1Q7ZA 4UR8A 2OT1A 2CZFA 3B9AA 1F6PA 4HNCA 1FWRA 3QVQA 3MUZ1 3DCPA 3INPA 5BXPA 4OFCA 3SCUA 3A4XA 2XVNA 1QI4A 4JBRA 1GVYA 2MANA 4Y9AA 4QAIA 4ZZ9A 4FS9A 3RX3A 5DX7A 3S9YA 4WF7A 2EBNA 4DM2A 5BRBA 1H7NA 3AHTA 4XSMA 3NL2A 1H1ZA 2PU0A 1DJXA 3ZT7A 2AL2B 1OADA 3E6EA 2RUSA 1BQCA 5MHBA 2Y5EA 3FOKA 1G01A 1YXDA 2I57A 2Z00A 3ABXA 1H7OA 3IJQA 4KH2A 3ZS4A 4GZEA 2GYIA 3B4UA 4J3XA 3TNOA 1V8EA 4S39A 2ISVA 2RFGA 3O3RA 4CN4A 2PDIA 3C3UA 3W7HA 3L0NA 4C7FA 3HJZA 5HWMA 1E6RA 3TTOA 4ENLA 1Z42A 3R8HA 1NJJA 2D73A 2QUUA 1BQGA 1UQZA 4LBSA 4ALDA 3LHWA 1FWGC 4XQ6A 3DHUA 3M0ZA 4CNNA 3KCJA 3UBPC 4B5UA 1XD0A 1BFNA 1TWIA 4LTSA 1GJPA 2E6AA 9CGTA 4P7NA 2J4GA 5FIPA 3CU2A 3A12A 1KFKA 3SB0A 5DBUA 3LBOA 4ZODA 3F4VA 3QMRA 4JKMA 1A50A 2WVVA 3RRAA 2ZUUA 2V5CA 3WUBA 4XZLX 3G8EA 2UZ9A 3SJNA 1HL9A 4V15A 3EPOA 5KITA 4N6EA 1ITUA 3LHTA 3FV9A 3VOHA 3PJWA 2GQ3A 2E0PA 3GTHA 4F0LA 3IGUA 4AX6A 1O7AA 4E3TA 2QS8A 3TROA 5FD0A 3LN3A 3IIZA 1PO9A 1NAL1 2C8NA 1WBHA 1ISZA 5GPRA 4ICCX 3APGA 1G9HA 3DXIA 6XIAA 4JNZA 4LAKA 2OVLA 3V5FA 1A5AA 1R38A 3IJ9A 3OLIA 4O0ZA 4X2PA 4JY8A 1MDLA 2ZA3A 4QXIA 2E77A 2EPKX 4C6IA 2HK1A 3B9NA 3PUOA 1OFDA 3O7UA 4IICA 4RDYA 1FH7A 1HNYA 1EFZA 4JXCA 3RO6A 3CZKA 4DUXA 2F8QA 3W28A 4DWSC 3NQ2A 3VKJA 3ZM8A 1E9LA 2B7OA 4JIHA 4O12A 4AZ7A 1QK0A 4QDWA 1O12A 1EJUC 4ZXLA 3I3EA 2NQJA 4PR4A 4RNIA 3MCOA 1FKWA 5CSSA 4Q8WA 3NNTA 3WDIA 3RHGA 2IPFA 5CZSA 4IOTA 3RM4A 1DBTA 3DFOA 5JIPA 4H7CA 5JH1A 2HCVA 1KBBA 3RMEA 1VBJA 2DGAA 4B3ZA 3W01A 3RPTA 3SW6A 1Z44A 3M0JA 1OCBA 1V3JA 1W1B1 1M53A 3WBXA 1Z89A 3TJLA 2YBTA 4AQLA 4XVDA 4JKKA 2ZDSA 3O6CA 3PPCA 2ZC1A 3WD2A 3UNDA 2QCNA 8A3HA 1TR1A 3WJWA 4WJEA 3MMDA 3VNDA 3BSGA 3DFNA 1H7RA 3C3NA 4CQAA 4BQ4A 3KOWA 2X0SA 5I09A 5T9CE 3S9ZA 1DXEA 3I6RA 3ITTA 4GC4A 4I6VA 3PPGA 3O05A 3ZJKA 3U6WA 1LF1A 4W8AA 2QCDB 4XG1A 1RJRA 5D05A 3AXXA 3LGDA 5MF5A 4H9UA 2R1LA 2YL5A 2QJHA 3CMGA 3NZRA 4JHOA 3WQEA 4U31A 3WLIA 3G0SA 3GAKA 1VYSX 3JW7A 3L66A 2JGYA 3M9YA 4W89A 4L61A 4MAVA 3PTDA 4MDPA 4YIWA 3SQMA 1M04A 4K8GA 1JPHA 1R3RA 3CHCA 3IVTA 2OO6A 1PSCA 3QZEA 2VC6A 1CXFA 1J5SA 1FBAA 3MHGA 4R3UA 5LA2A 2W92A 4GYPC 4K37A 2A3HA 3EWWA 6REQB 4RLIA 1R5YA 1W3TA 3NQVA 4Q7BA 1CWYA 1OBAA 3NG3A 3OJGA 4A3UA 5EKYA 4JTAA 1LRQA 3PZMA 4N2YA 4UTIA 4DUWA 3ZJ8A 5E93A 2VFIA 4MWAE 1GPWA 4C91A 5DMMA 5EBUA 2XUCA 4UTTA 4NZ5A 4BHYA 1XUZA 1ZGDA 2CCRA 3XISA 1SO5A 1QO2A 2R82A 2RH9A 3RLUA 4O57A 3UWUA 5D04C 1ZJBA 3PZTA 2YDQA 2Z1SA 1ZZMA 3H26A 2YW3A 1JCYA 3GDLA 4JNMA 1EIBA 3ZVIA 1D7FA 3CWNA 4QEHA 2DZPA 4ZO6A 4H1ZA 2PBGA 1EKOA 1UCWA 4CVWA 1UC5A 1AVAA 4JTSA 2Z7KA 2WKJA 3PTQA 1Q7QA 3W1MA 4XZIA 2V3FA 3ARRA 4OOUA 5HR7A 4Q32A 4EWND 2GK1B 8TIMA 1WAUA 1DWGM 3VDGA 2Q3OA 5K9CA 2ZRZA 4DJFC 3N73A 1TYGA 2ZUVA 3LNMA 1MZRA 2FZNA 4PUEA 4Z08A 4NX0A 3TK7A 1JD9A 3PAJA 4KCUA 1UUMA 4MY9A 3BZJA 3GQYA 1OFAA 4AEEA 4LWWA 3GS6A 1V0NA 1LUCB 2GUBA 4R88A 4FOKA 4W86A 2TODA 4IFRA 2D2HA 3W73A 3UETA 2Y2WA 3GYEA 3T0AA 1ZPTA 5EMJA 3VD5A 3LRLA 2Z27A 3MO4A 3ARSA 3F5LA 3K2GA 1GPFA 1SR9A 4V28A 1FXQA 2HBVA 1I8JA 3B05A 4ML9A 4AHQA 4DYKA 3M0YA 4DJEA 1XINA 4I7VA 3TW6A 1JPDX 4PYSA 1JDEA 1E4LA 4US6A 3NAVA 1AH3A 1QBAA 4TMCA 5KETA 4PMRA 4DN1A 4E38A 1L6YA 1O1ZA 2J66A 2V3EA 3NR0A 1PX8A 2PDUA 1M7PA 3TQVA 4RNJA 3T7VA 2VZUA 3WD4A 2QXWA 4PMDA 3BAYA 2BTMA 4DEFA 3BOLA 3M7SA 1TWWA 2X1SA 3VNMA 1XRSA 1E1EA 2E09A 4RPPA 3AS2A 3KBMA 1PKLA 1EHNA 4GJ1A 4MB4A 4DQWA 1E3ZA 1R7OA 3BMWA 3MUY1 4GFSA 1V6VA 5C70A 3EYPA 4RDWA 2DUAA 1KFWA 2JBMA 1W5OA 4WZHA 1LP6A 5LNWA 1F6KA 1FDJA 1LWHA 3B0VC 1W2VA 3T4CA 1YDNA 4KWSA 2VC9A 2YXXA 4NKCA 4DELA 5F7UA 3CV6A 4W8BA 2Z2AA 4O0QA 1P4CA 3FAWA 1YXCA 4CEXC 1QNSA 2HPMA 2X1RA 3DESA 4P8VA 3MW7A 3EOEA 4RZ6A 4C5ZA 3A6OA 1M41A 4HGXA 4PRTA 1RA0A 4KCWA 4LUJA 5BMWA 3JS3A 2PTZA 3WQ8A 3VOIA 3HB9A 4FPSA 1JDCA 4GLEA 4DM1A 3M16A 1VHNA 2JKAA 5CPQA 3EKLA 1TZ9A 1BF2A 1Q13A 1KNWA 4N9EA 3B04A 4YCOA 4UTWC 4DJDC 5CAKA 5AC8A 3NDYA 2H9AA 3QC0A 1MW3A 1TTJA 4BWLA 1J4EA 1TTQA 1CB2A 3DEQA 1F4AA 2DZTA 4GOAA 3ITCA 3CLMA 4A3YA 3N6JA 4TU1A 4MWAC 2FVKA 1F2JA 1WKEA 2FH8A 2ZRXA 4NSBA 8CGTA 4AWTA 4QE1A 4HHMA 2Q09A 2PZ0A 2J75A 4LALA 5T26A 3TR9A 1SSDA 3KBWA 1WDPA 3ABSA 4HNTA 2BZNA 2RDUA 1YDOA 1GVFA 4IMAA 1JL8A 5REQB 2FTPA 3HF3A 2PFHA 1V3LA 1XKYA 3EOLA 1PXGA 3QN3A 4NU7A 4HOZA 1X38A 1BVZA 5D03A 3PN8A 2VD8A 1JYXA 3TVAA 4OUEA 3LV5A 4WLCA 4F9DA 4O52A 4JZ5A 3GHTA 1E0XA 1SO3A 1UJPA 3G1SA 3V1HA 4ML4A 3EWXA 3DECA 3M5XA 2FKPA 2RDWA 2PLMA 1XLDA 2J74A 3VMNA 5IRPA 1GTHA 1JZ3A 3I4KA 4J3WA 3FLUA 2A7PA 3UJ2A 1CIUA 1TTPA 5F2LA 4ICMA 3WMBA 2CXGA 3SFKA 1SZNA 4ZCWA 3CL6A 3BH4A 4H19A 2VRQA 5EGRA 3U5YA 4Z2HA 4MM1A 1UZ1A 4BFAA 4HZMA 2DW6A 4QJ3B 4ACZA 3AMKA 3AHYA 1N82A 2C1IA 1KBJA 3CYVA 1R3QA 3VU2A 3K8MA 3WLHA 4XD6A 4B4HA 4E4UA 2A3BA 1HVXA 5F4XA 2IPJA 3NPVA 5C7VA 1CLKA 3MP5A 1BSIA 3MWAA 4I7UA 1WDQA 3MC5A 2PDHA 5HINA 4MGGA 4HSHA 3BTNA 3D46A 3UCCA 2P10A 4P7RA 1QT1A 3DUGA 2XPKA 2PGRA 2O55A 1AG1O 2W5FA 1VYPX 3QV9A 2D2GA 1QNQA 4M5PA 3FFSA 1M03A 3HIJA 2BVYA 4ZQCA 1G6CA 2CZVA 1V51A 5LYRA 3ZJ7A 5I6SA 2B4GA 3LLXA 1CW2A 4B5TA 1TSIA 2JKEA 3G1FA 4LUYA 4WRHA 2W4XA 2EG7A 2V5JA 1RPXA 2XH4A 4JEQA 3GSMA 2PLJA 2VGBA 3T55A 4AYGA 4LAUA 1UBPC 1ZHAA 3BW2A 4GBUA 3IIPA 1UJQA 4S1FA 1XDJA 5BXRA 4RW3A 4A8IA 1YHTA 3W7IA 4IISA 3CH0A 1R3WA 3QQWA 2DFAA 4RNHA 3U0HA 1XLMA 1A4MA 1MUMA 2PLKA 3T05A 4LUTA 5SWUA 2CW6A 1EP3A 3CUGA 2YB4A 4TR9A 5AC5A 1EC8A 3W74A 4MF4A 1KW1A 1TV3A 5TNVA 4H6EA 2DT2A 1C90A 3A13A 3GDMA 4JX5A 4YS1A 1VQTA 4NF7A 2IXUA 2WHKA 4PUJA 1NELA 5CZKA 3GKAA 4F2UA 5D8WA 1BG9A 4RKAA 3WLKX 8XIMA 4TXEA 1BWLA 4U33A 2UY5A 1ESWA 3KE0A 1XI3A 3SCNA 3UG5A 2J7GA 3TOYA 1IXQA 2PGWA 1W3HA 5E6YA 4MAZA 2CPUA 1BPLB 4J5NA 5DY2A 3TLLA 3L4WA 1A5SA 2ODOA 4XZBA 5CGMA 4AX7A 3WLJA 2ZADA 5CPMA 4JIPA 4YVPA 3U3HA 3HTWA 4JTEA 3L9CA 5AC7A 2P8BA 1L2UA 4GQGA 1ONXA 1I2OA 3SUWA 4W88A 4Y9MA 2VYOA 4M6PA 2HMCA 5ECVA 3QEZA 2J7CA 2X1UA 3SN0A 3RCYA 1OM0A 4HYRA 2Y88A 5I02A 1R7AA 3TYDA 1DJQA 2ZA2A 4HPXA 3A3WA 1EJTC 2OFJA 2WC3A 1A49A 2WV8A 2X41A 5A6TC 3URBA 5GJPA 4IMEA 4XIAA 2G37A 4V1YA 4PBEA 4XZHA 3IIXA 3MP3A 1DWHM 2QGHA 2VX4A 3BGJA 4IIFA 1E5JA 3MI2A 3PZGA 2OQLA 1CLXA 1DKWA 4UFHA 3W6YA 4D71A 1LOLA 2G50A 3P62A 3U57A 1LZOA 5BWFA 3RLHA 7REQB 2PLCA 4IQDA 5IHSA 5AY7A 1W54A 4UFIA 1P1MA 3CMFA 3P14A 2PRHA 4LAZA 3I10A 1A47A 3GXFA 2W61A 1NIUA 1YDYA 1POJA 1AD4A 1ICPA 3OVQA 3W24A 1GEQA 3UD6A 4XD4A 4KT2A 3W7LA 1UD4A 4YLWA 3T44A 1HT6A 2VRKA 1JCXA 5BRQA 1W9PA 4DXVA 1EGMA 1GHRA 3F5JA 4RR4A 1DORA 1WNOA 1J0KA 4R9OA 1BXCA 4NI8A 3UJRA 2C0AA 3WMLA 1Y5XA 1BYAA 1K9TA 4NJIA 2D2OA 4XD5A 4Q8NA 5AHIA 1X8CA 1H61A 5A8MA 1BSLA 2CWNA 6TIMA 4I9AA 5LIWX 2F2KA 1VR6A 3HPFA 2DV0A 2QEZA 3SUTA 3CWOX 4GC3A 3F4CA 1TCMA 2ZA1A 4E8GA 1I45A 4GJJA 4UQ9A 3E2SA 4CCZA 4CCCA 1ZALA 2I5QA 3AJXA 1VPQA 1S2TA 3CZGA 3JUGA 3E0LA 5ABTA 4Y9NA 3B9DA 4IUGA 2QDEA 2R14A 2FHBA 4E8CA 4IGNA 2PDXA 3SCTA 3W9ZA 2QUNA 3B8UA 4FLSA 3UCQA 1SJBA 1VRDA 1PS9A 1HJUA 3CZJA 4LEQA 1KM0A 3KL5A 1EDQA 4NYUA 4V33A 3UZZA 3WUEA 3RXZA 3V36A 2XFYA 1S38A 1C92A 2FQIA 4LH8A 3GTXA 3AZSA 2QUTA 1T96A 1EJ7L 3QKEA 1OFRA 1GKRA 4DWSD 1JQVA 3GW0A 2Z1BA 1CEOA 3MS8A 3WNOA 1UUOA 4MKSA 1MNZA 3FKRA 2D20A 2QT3A 5HANA 1WOAA 4ZOAA 3FHQA 5BYWA 2Z29A 4PEEA 2Z1WA 3NQEA 1CECA 5A2AA 3E5BA 2HDJA 1WV2A 3UA3A 1QI2A 1SPQA 3ZT6A 5DF0A 4BF5A 1DQWA 3NURA 2ZX6A 3BQ5A 1K77A 2HNEA 4HPHA 3SGUA 4DO7A 3PC0A 3G5EA 2YGYA 2EEXA 1IE7C 1TELA 2PDMA 3VGGA 1I4NA 1THFD 1TJPA 5A8QA 4B4FA 3A47A 3NGFA 2Y62A 4WKAA 3A4AA 2NT1A 3BLIA 4DNHA 3W70A 4ADSA 5HJLA 4ZVJA 3B0XA 5K2ZA 2WMJA 1IXOA 1S1RA 2Q8LA 3T0TA 2J88A 1LL4A 1VC4A 1AH4A 4HA1A 3T07A 2YCEA 3PWGA 7ENLA 5HDRA 1VBHA 1K9DA 4JIQA 4DLMA 3P5ZA 1EQCA 2PC4A 3PJUA 1EX1A 2WPBA 3KCLA 5BWAA 2V81A 2WMFA 5D2WA 4LANA 4LV4A 2RDXA 4UQBA 1W5NA 4JFWA 3HG3A 3HU7A 3M07A 4Z2JA 3B06A 1QVBA 1UR4A 4CD7A 4WY0B 4FR6A 4O11A 1DJNA 4A3HA 3TAOA 4DAIA 2G3FA 1TRIA 3NZGA 2DUXA 2VVSA 3V3WA 2OCZA 4GX9A 4PE8A 4IFOA 1SQ7A 1NEYA 3NGJA 3SRDA 5FOOA 1W5MA 1SFSA 3U5UA 1CTNA 1JUEA 4NL1A 1AMKA 2WLYA 3PUGA 4O1EA 4AWEA 4XUYA 3VFCA 2BASA 3QOMA 4UTHA 1UMYA 3VC6A 5DY3A 1FCBA 2W0UA 4RL3A 4H01A 3MVIA 4JS3A 3SRKA 4MOZA 2P5NA 3UU0A 1DQUA 3N2XA 2GUYA 1J9YA 5BOEA 3E2RA 2AMXA 3UA4A 3GLCA 1M65A 1U83A 5AOUA 3AMCA 1J2BA 3L67A 4JDBA 3BPWA 1VKFA 3LEPA 3TXZA 1BAGA 4ONVA 3N9RA 5B80A 1UHVA 4HD5A 1ME8A 1CGYA 3CEPA 1G7UA 2CEQA 1W32A 5EPDA 5CPNA 1H62A 2RDTA 5B7ZA 2E1WA 2VELA 1Y7VA 2IKGA 5AYBA 2R1MA 5CC5A 3R11A 5TQLA 3TU9A 3E5PA 3PG8A 4DLFA 4LAOA 3AOFA 5A6AA 4XX6A 2QJGA 4JN8A 1CXEA 3S42A 2E40A 2D22A 1KGWA 2O9OA 4GYKA 4QG6A 3SIZA 1XQLA 3I65A 3QR0A 2XM1A 3GVGA 3BARA 4UZSA 6TAAA 3WH9A 3A5FA 4PMZA 4C1LA 4S38A 5AYYA 2E7FA 1PDZA 5I3GA 1TPWA 3W7OA 3NOEA 3TQKA 4A3RA 1B3ZA 4GA8A 4TOQA 1FWNA 1XRFA 3V18A 4R7JA 1UP0A 3MYPA 1YNPA 4DJFD 5F1UA 1YBQB 1M5WA 4L6DA 7PTDA 4C7GA 1U2YA 4D8ZA 3WH7A 3T0BA 3I7SA 3TSDA 1ZBKA 4WEVX 4BEUA 2EGZA 4RV8A 3AISA 3L68A 3AYTA 2XGBA 1XGDA 3DOPA 3KAOA 5BZAA 4KETA 5I0DA 2OYLA 4EXBA 3HG4A 1VBUA 1Q2RA 4ORIA 1FH9A 2F6KA 1XIHA 2P50A 3V5CA 4OWGA 2QHAA 4GY7A 1ICQA 5D9MA 4A4AA 4BF7A 4WSKA 2H8ZA 3N4FA 5JXQA 5E09A 3LU2A 1CCWB 4N9BA 3M64A 2YCIX 1DJIA 3JZEA 3TA6A 3P0XA 4DVOA 1W1IE 1XYAA 4OT7A 2PWFA 1R87A 3A4JA 4OECA 1NH6A 5TAOA 1OABA 3W83A 3V35A 2NWSA 4J3UA 2DU2A 2ZQ0A 1KC7A 3LBMA 4GIEA 4D6HA 3LI1A 3GNDA 4G2DA 4XISA 2CWXA 1SZFA 4AMAA 4N6FA 1CZ1A 2X2GA 4MMWA 1AQHA 3DHPA 5C2CA 2R91A 4YWIA 3W23A 1H7WA 4Q3MA 5JBDA 5HQEA 2Z2UA 1SGJA 2PA6A 3TZNA 2Z26A 4WY0F 1A5UA 3DFTA 3VNYA 1KB3A 2OEKA 4A21A 2OGJA 4QG9A 5HWJA 5LSMA 2GQAA 4R53A 3WZ0E 4EXQA 3W02A 2OX1A 4PMUA 5M03A 2WBKA 3UWVA 5CPTA 1P7TB 3NWRA 1VENA 4AMCA 1J6OA 2PTDA 4JTIA 3EWYA 2YCLA 3W1UA 3ABZA 2C0HA 3EDJA 4GZ7A 4UTWA 2DEPA 3W2KA 3S1VA 3KP0A 3H4WA 4JTQA 4EAYA 4C6QA 5D2TA 2EG6A 1X96A 3QPYA 5KZ6A 1MXGA 1S39A 2W6RA 4MWAA 2QKFA 1FP8A 4RE4A 1XRVA 3OBAA 1L2QA 1MSSA 2J9YA 4XVEA 2J8TA 3ITGA 3MMTA 4Q7NA 3LZ3A 4ATWA 5ABFB 4MNMA 3MQTA 3LHZA 4DJDD 4LVBA 2UV8G 3CUHA 3SY8A 1QAPA 4MTVA 2A1YA 2HXUA 2V6AA 3TJ4A 2C19A 2AL1A 2WWCA 4GQ0A 6XIMA 3IEBA 4H7VA 1WX0A 2HNHA 4DWDA 4MWAD 1KTBA 3W53A 4KWVA 4H04A 1I1WA 4IMGA 3VIMA 4UTUA 2CITA 4D6JA 4X63A 5LZLA 4Q8MA 4JQ3A 3KCOA 4AFYA 1NQKA 2PGFA 3VIGA 1TPDA 1W3JA 3QLDA 3EB4A 1LDCA 2G3IA 1JXKA 3NCOA 3THUA 4B5SA 3R4IA 1X6NA 3MANA 1JZ5A 4IIBA 4PSPA 4XZNX 2UWFA 4W87A 2BBFA 2Y7DA 1YMYA 2HJPA 4QISA 3VNZA 3S1GA 4W85A 1OG6A 3WDJA 4M6UA 4F0SA 5ENLA 4PMOA 2ZZ7A 5CC6A 3UWWA 1NF0A 2V3GA 3QBUA 1XGZA 5IDIA 3JRKA 1T5AA 2BB0A 5I78A 2ACQA 3E0FA 1UWRA 3T0DA 4BZYA 1EL3A 3UZJA 1XDMA 3LM3A 3SUVA 4IMFA 4G7EA 4C1NB 5DCDA 2CKRA 1WZAA 2F61A 2VFDA 4ZBCA 4E2DA 1DJYA 4EP8C 1HL2A 5HA7A 4RK8A 4EAMA 4Q4QA 1Q3NA 1JR1A 1C8VA 2PWGA 3S8HA 3ERPA 2VX6A 3QW3A 5EFFA 2XINA 4BJHA 1A0EA 1GQJA 1GTEA 3XINA 1ELSA 3AAMA 2YSWA 3LRKA 4G7FA 1EJVC 3OBEA 1E1CA 4XAYA 1VRXA 3OU8A 4ROQA 2YBVA 4O10A 3SUUA 4CVUA 1X98A 3NL6A 1UP3A 3LTYA 3UEQA 2QJNA 4QQUA 1TG7A 5BCAA 3NXFA 4S3DA 2PDLA 5CXPA 4B92A 3B9OA 2CLPA 3VNKA 1YPIA 4EVZA 4A2SA 1HTIA 4AF0A 5EMKA 5G1YA 2VEIA 1WE5A 3V7PA 2I9EA 2P3ZA 1IZJA 3BICA 3O1NA 2ASHA 3COTA 3ZT5A 3QY6A 4FALA 3NO5A 2FVMA 4HN8A 3HG2A 1H2JA 2DSKA 4J2PA 3LG3A 2RHGA 1H1YA 4W8LA 1A3XA 1KCXA 1KGXA 5HMEA 3W22A 4L65A 4QE4A 1EA0A 1XCWA 2PU1A 4OIFA 1UROA 3GG0A 1VJSA 2B31A 3ZMRA 5A8NA 3VIOA 1GVEA 3PWIA 4ZA0A 4QX4A 3RN6A 3ECQA 3U2OA 3W7GA 3NJ3A 2XSXA 2FZMA 1T8XA 2A21A 1MQPA 2PF0A 4GXMA 4DHGA 3EA3A 4K39A 1NOFA 1DHPA 5AYXA 3S83A 2IKJA 4XKYA 2HROA 1MQQA 1SO4A 3WF3A 3UVAA 4JL2A 1OSEA 1FP9A 4I3GA 5F4SA 1OK6A 3QR3A 1IR2A 3UZYA 1T8QA 2D3NA 2CBVA 2G97A 2P76A 4ZO9A 1E6NA 4Z1CA 4WDXA 4LT9A 1REQB 3OLEA 3THDA 3OG3A 3KL0A 4HYVA 1O5XA 2E28A 2WO5A 4I6KA 1QBBA 3GHUA 1OB0A 3R79A 3C61A 3LHUA 4QNWA 4G1KA 1OZMA 1PTDA 4NZFA 1TQJA 2E5DA 4DBUA 3B9EA 3CAVA 1RLCL 3BW4A 3RUBL 5U7SA 4DY1A 2RJGA 3VIKA 3U7VA 3CPRA 3WQCA 1KCLA 2EPMX 1JD7A 2SFPA 4LXFA 4JKLA 5C5YA 4MFDA 3TJIA 2DVUA 2IMRA 1MI3A 3OEXA 2A6LA 5CGTA 4HN4A 1W9VA 1SFJA 3CASA 3ZVHA 2CHRA 4FNPA 1K1DA 1KLZA 2KX9A 5E1QA 4RUBA 2J78A 1PCWA 3ZLGA 3N9SA 2EPOA 3ARZA 3T08A 1M68A 1SSGA 1ZP3A 3H2AA 1UKTA 3TKFA 4GZIA 2YA0A 2ESCA 5FEZA 3FA4A 4PFMA 1YW1A 1EYWA 1FQ0A 2O9PA 3AIVA 5K4ZA 4CU6A 4U4MA 1OX4A 1W8SA 3TA9A 2J24A 3O2LA 2NQHA 2DQXA 2IW0A 2OPJA 4E3VA 2A3CA 5BW6A 5EY5A 3MHUA 5TIMA 3WDPP 3LXBA 2QDDA 2DDXA 3EOUA 4JICA 1TVNA 3IJ6A 5D2YA 1EQPA 2YBUA 4F0KA 4GX8A 3H53A 2AQOA 3RILA 2Y8UA 1K7FA 2YOCA 4O50A 3AXIA 1UWAA 1MEWA 1M01A 3AO0A 3AYRA 4YTTA 1PE1A 1UD6A 2PC8A 1DPMA 3QGAC 3ZYZA 2A0NA 3G22A 3N15A 1VIZA 3VK5A 3BG3A 4GI4A 5CZ0A 2HPIA 3DFPA 2AOSA 5CEWA 2ZE0A 3C2VA 3T09A 4AZIA 4F8XA 4S3FA 4WUIA 3A21A 4Z1AA 5M1TA 3PAOA 1TWDA 3CM4A 4M80A 1FCQA 4DB7A 1XSKA 4NQ1A 2WAGA 1TQXA 5LNRA 4BF9A 3O0FA 5DQPA 1KBLA 5JH2A 3AIBA 4ZR8A 4JD4A 1JYWA 4IT1A 4BR1A 2VUYA 3GR8A 3R1ZA 1E1FA 4A35A 3G8RA 3DKLA 4JFTA 4CCDA 2ZVIA 5IFTA 2V5BA 3W7NA 3N1AA 2WWDA 5L6UA 3UR5A 4M1RA 1EPXA 1LQAA 1IEQA 1K6AA 1AL8A 4HMDA 2E9MA 3PUEA 3KOXA 2H3BA 4IGMA 3GU9A 1K7XA 1V3KA 4W7UA 4PMQA 1ZBWA 2ZUMA 4DBSA 1N8WA 4IP7A 3V0SA 1E43A 2OLHA 2RGLA 2F7FA 3KRBA 1Q85A 4WKHA 5DCBA 3B0PA 2CLKA 3M6YA 1MUCA 3QGVA 3LPOA 4WXZA 5A8OA 1J5TA 5A69A 3C2OA 1Y5VA 2XWEA 3GR4A 4ROPA 4DF2A 3WL1A 1BKHA 3SDOA 3P7YA 1W9BM 1H09A 1DXIA 1KM2A 3NYZA 3WYZA 4L6HA 4Q6XA 1DJHA 4I8YA 4I5UA 2HTMA 1VS1A 2OWCA 2OMAA 4JX6A 1QPRA 3PBYA 4HA0A 3FGCA 9XIMA 1L6GA 3N12A 1EDGA 3Q2DA 3C52A 3IANA 4U5IA 1ZLPA 3TYBA 1IXPA 2FGLA 2WQDA 1RCQA 4GQRA 2Z1KA 1W6TA 1KLYA 1ZAJA 1TB3A 1L6FA 3PY2A 5C0QA 2ZUTA 2BDQA 3T9PA 1BF6A 2DSVA 2V2CA 3FSUA 1U1HA 4HYWA 4KBXA 1GCYA 2DSUA 1GOQA 4UTJA 3W7PA 3GVRA 3BZGA 3BUVA 1A0CA 3HG5A 5CQ1A 2GUUA 4LAMA 3VVGA 1ME7A 3R13A 4AC1X 1R2SA 5G4HC 1G4TA 3NPUA 1RP9A 3PUDA 4TIMA 1TCDA 1ZFJA 2IQDA 3M5ZA 2Y8KA 3VE9A 3MDWA 3PBVA 3DHDA 5HNRA 2G3MA 3H2MA 4RX0A 4XAFA 3LX9A 2DZSA 3PTKA 3KOYA 4ERAA 3KHJA 2A7RA 4M24A 4CU8A 1H3GA 4EF9A 4AW7A 3Q67A 3M0MA 1TKKA 3SAZA 4GNJA 1QI0A 3QY7A 3R0DA 4OBSA 1QPOA 1QHOA 4PUKA 3WMCA 3GRIA 1HVQA 4GVFA 3OVPA 3V75A 4HIBA 3L4TA 3R2GA 3VDCA 3LERA 3QJAA 3ZSSA 3HN3A 3LZ5A 1ONWA 2XIMA 3D3FA 1HKVA 1RVGA 3MA8A 1C7SA 1XL9A 5LA1A 4HU3A 1Z32X 4H9YA 2FYMA 4MUZA 4KFOA 1UWUA 5D02A 4FX8A 4L64A 1ONEA 3S1WA 4DZAA 1GQKA 4IFKA 2ZCGA 2AKZA 2E1DA 1EDTA 3I3BA 3W1XA 3UYCA 1W9DM 1OT2A 3QZ6A 4UFKA 3H2CA 4G5DA 5E0FA 1O94A 1DIDA 1EC9A 1OZQA 1FX6A 3QQ1A 4PTVA 4J3SA 4NXKA 3KBSA 3L5LA 2GGIA 2OOGA 4ZOCA 2JFEX 4WQ6A 1UZ4A 1LOQA 3O9NA 4DO6A 1TV7A 2D2JA 4OE7A 3RFAA 2PUZA 3G1VA 3BVJA 1DWAM 1IGWA 3R8RA 3GBDA 1SMAA 3WBEA 5T8GA 2Y1HA 1B54A 3PHAA 2C15A 4C6NA 4KEMA 3GNPA 4L9ZA 3II1A 3GU2A 2FGBA 3W6MA 4UTKA 2GFTA 3C2EA 5F4WA 1R0MA 4FAMA 3IWPA 2GVYA 4WVXA 2OEJA 5FJIA 1QASA 4PBGA 3PTMA 3M43A 5DRIA 3S1XA 3OO2A 3WDHA 3N6HA 5FSDC 1PTAA 3NZQA 1MXDA 2FIQA 1LLWA 4NJGA 1HF6A 4HA3A 2IS7A 4PL1A 3UY7A 4C6MA 2FDSA 1KV5A 1F74A 4LPCA 4FB7A 5HNNA 5DFAA 3ARYA 1HJWA 4TX9A 4MB3A 2PWEA 1P48A 5IBXA 1XIJA 3TYAA 1KV8A 4J2MA 2QVHA 3VGHA 4XK2A 4PCPA 2PWHA 1N8FA 5HUOA 3GWQA 2ZXDA 4IMCA 2QR6A 3VD3A 1ZBCA 1U5JA 2YDAA 2Y7FA 2BXZA 3EB3A 4K38A 3S1UA 2I17A 2A2IA 5HBFA 3G1RA 4ZXOA 4IPIA 1S5MA 1QPQA 3TR2A 4DIAA 4UOJA 1TRDA 4MJ2A 3L4UA 2ZWZA 1QU4A 3NO1A 1HL8A 4HCLA 1QRQA 1GGOA 5FJPA 2VQUA 2OLAA 1DP0A 3KWXA 1J6PA 4S3AA 3IGHX 5GJNA 4ZE4A 1VFFA 2JK2A 3WJZA 1TMLA 2FZDA 2PDGA 4PUDA 4C1KA 3KL3A 4A3QA 4UQAA 2B7QA 1MEIA 1R3YA 1WDWA 4CNPA 1ZJAA 3ARUA 5J8LA 2QAPA 1XHGA 2C7FA 3APTA 3RU8X 4AZHA 4AEFA 1A5BA 3G3MA 3L2LA 3TV8A 1HG3A 4RE3A 2L5HA 4I9MA 1NU5A 1EEXA 3TCEA 1X7IA 4EPEC 4OJYA 4C6EA 1R9YA 1R6WA 4UIOA 3QTPA 4AZCB 4Y9PA 3CLWA 4NP7A 2VVNA 4EK7A 4CD6A 3ANVA 4JPGA 1AQMA 4NRSA 1D8CA 4FLOA 4P5UA 4ZOBA 2DUZA 1F9CA 2XIIA 2WCGA 4OKDA 5C2XA 4OU1A 3FEQA 5U4NA 2FDMA 4ZB2A 1TMHA 1XDLA 1T6MA 4UQCA 4B2DA 4UNIA 2BXVA 3LCLA 4M6VA 5I2UA 4MPKA 1JCMP 2Z25A 3GTNA 3NXLA 1T40A 5DEZA 1DV7A 3I6TA 1YIXA 4OZOA 4F40A 4HP5A 1FWWA 3POCA 1VLIA 4BCEA 2BMBA 1B90A 4K1WA 4NVTA 3R25A 1GYNA 3QQ0A 1C9DA 4C6LA 3JU2A 1AMYA 1AW5A 1LLZA 4YHEA 1XCFA 5K9DA 4GGBA 4KIRA 1AODA 1W1TA 4HQVA 4MB5A 3BJFA 2XIOA 4P8UA 1JZ6A 1AJZA 3T8LA 4DBWA 1I9CB 4GCAA 2DSWA 1GOWA 4HMNA 4IQLA 2POZA 4ZENA 2B0MA 2F6XA 3ZXWA 4DXKA 4IGHA 5H8MA 1XLIA 1WXYA 4D6IA 3MUAA 3VD9A 2I9UA 3N19B 1Q6QA 3MP4A 2Q6ZA 4WXYA 3O63A 3WJYA 3WN6A 2REQA 3B8SA 4N0RA 1W2PA 7XIMA 5PTDA 2VZOA 1BD0A 3MKCA 4K7VA 3IGSA 3VKKA 1GOMA 4MY1A 4D2JA 3SCOA 1WYIA 2WMIB 3G6MA 4L6OA 3W1RA 1WOBA 3M47A 2GJXA 2Y24A 3MHFA 3S2NA 1E72M 2BNJA 1PWLA 2DY3A 1XYFA 3EEZA 3W87A 2ATMA 1NWRA 4HHPA 2WPGA 4ASTA 1XLCA 4Y2WA 4FK9A 2YKKA 1XLAA 1EOMA 4JTLA 3SURA 1WKYA 3REQB 2F6UA 4JN7A 1M3UA 2PDWA 2ZXQA 2VUNA 1XH1A 3O0KA 4IIHA 2CERA 3CJPA 4IPJA 3PG9A 4K8EA 1WXZA 3W1NA 3PANA 4LQ1A 2ICSA 3GX9A 4RZBA 1SFTA 4JX4A 5HPOA 3WENA 4KFNA 2FJUB 2FMOA 4C90A 4M81A 3FHAA 1OT1A 1TA3B 3CH9A 4C60A 2QJJA 2BSLA 5HXMA 4H6QA 4LV9A 3I3DA 1QMLA 3PNZA 2VZTA 3STCA 1GT8A 1FDYA 3KS6A 1G0CA 3W1QA 4O1DA 4TTUA 1AFSA 3G3DA 2PRLA 5A3HA 2WNWA 5AHFA 5HMSA 5EFDA 5G2WA 4TX6A 5D8ZA 3MKVA 3U7BA 2BY0A 4HCHA 3R94A 2Y7GA 3VOFA 1X1OA 3TN5A 1LT8A 6ENLA 4H8UA 2FPTA 4Z17A 1L6SA 5BROA 3WLOA 1V3HA 1U22A 3GHSA 5EMMA 4NNBA 3E0WA 4KCTA 4PMJA 3W26A 2VL4A 3IK4A 1HKMA 1KKRA 3GIYA 2CLEA 1LL6A 3NM3A 3B0YA 3QMTA 4PCTA 1CXLA 3OQ8A 3ZLFA 2VR4A 1EHAA 3L4YA 4KF1A 2OSXA 4KRUA 3CZ8A 5AYZA 3GXDA 2Y85A 2FJKA 3GVQA 4NT0A 4HK6A 2NQLA 4F79A 2BGSA 1EEPA 5HULA 3N14A 4DYEA 4HJWA 1HKJA 2MNRA 5FJJA 2NQZA 1LWIA 4Q8QA 1ITXA 3L7RA 2HE8A 1UWSA 3IIOA 1QXLA 3VPLA 3RR4A 3B4YA 1FXPA 1SYTA 4MJMA 3OGRA 3BMXA 4P7QA 1E73M 1EF2A 4LFYA 4PMXA 1LQ2A 1S46A 2PGEA 4QHRA 2PP0A 1QPKA 4IL2A 4PB4A 2J7DA 4L4MA 1ISWA 3R5EA 4IG2A 1IR1A 2GVEA 2QDHA 3WBAA 3UJEA 4E4FA 5FAGA 5C8BB 3HV8A 1Q66A 3KOFA 4ILSA 5XINA 1QDSA 2HXTA 1W3LA 4W7VA 1UZHA 3PBGA 3BDKA 4UTFA 3EWUA 3NFUA 1OFPA 4JQAA 3QV6A 1DWIM 3AIEA 5CJMA 4JFUA 2PB1A 4ACYA 1L0PA 5A2CA 3RMJA 4CNUA 3AI0A 4KWOA 2D0HA 3P74A 3NQAA 2X05A 3H54A 1QCWA 1EF3A 1XYMA 1EX5A 3T42A 1WUEA 2PZNA 1Q7MA 4IJRA 1FWCC 4AIOA 3V0UA 1AJ2A 4UMAA 1Y0EA 1KM4A 3W2MA 3E0VA 3POHA 4C6FA 4ZO8A 1WA3A 2OKOA 4E8DA 4U3CA 2YZRA 4AD4A 3LDVA 4HNNA 3NQBA 3SCWA 4P8XA 4JTCA 3C6CA 1ML1A 1E6SM 3BLEA 5BXTA 2BHYA 2BVWA 2POTA 1SW3A 2FPVA 1B30A 1TJ0A 4B5WA 3TOPA 1L9WA 3THQA 1HKKA 1ISYA 4XB3A 3AU2A 2C18A 1C7TA 1Z41A 4QGCA 1JZ7A 1GKPA 3AXKA 2I16A 3OGVA 3IVUA 4US5D 3N6QA 3YPIA 5M3WA 5DXXA 3TWBA 2GJLA 2BS9A 1I6NA 2J77A 1UMLA 3PFRA 3WF1A 4NZ3A 3T8QA 4F0HA 2HEJA 1RCXB 1PV8A 3BLLA 4Q4RA 3H12A 5HMDA 1XLGA 1GQLA 3LA4A 1CPUA 1XIGA 4URIA 5G4EA 2WVVB 2RJHA 1Q6DA 4WOQA 1OEPA 1A0DA 3AHXA 5D09A 2Y5JA 1JF6A 1J11A 3N13A 5H8UA 3ORWA 2VZSA 5FJRA 3TTQA 4IWWA 4AD0A 4C6OA 4N4QA 4QCEA 1QI3A 3MUCA 4DAFA 4D1IA 4ZTXA 4QIUA 1V3IA 3ZR6A 1S5VA 1KBIA 2WC7A 9XIAA 1BLIA 3MY9A 2VX7A 1KXVA 1QNPA 1R85A 2XIJA 5LXEA 4O16A 4M82A 2ISDA 2VGIA 4FLQA 1RHCA 2ADAA 3DGRA 4A6GA 2HE5A 1Q6GA 2QPSA 3LOTA 2CHNA 5F2GA 3G0UA 1MRAA 1PX4A 1VFUA 2NX3A 3W1LA 4CN6A 3OLGA 3HPXA 2VOMA 3NQCA 4LY4A 4HVXA 3F7JA 3ZJ6A 4HSNA 2P0IA 3W82A 1ONRA 4BY3A 1JI2A 1GOKA 4LVAA 1MWOA 1LQ0A 1ZS2A 4QTGA 4FXRA 2XZ7A 5FA5A 1IF2A 4GXPA 1U30A 3QFEA 3T78A 2VC5A 4OQVA 3A4WA 3GG1A 1RR2A 3HQPA 2O4MA 4ZEPA 3IJLA 3WH6A 3C2YA 2DZVA 3LBCA 1PWMA 2W91A 3EKGA 5EU9A 3IGXA 5ABEA 2WQPA 3LPFA 3ZR5A 4XO6A 5HPCA 3NIYA 3F4DA 1E71M 3KRUA 4MZYA 3STEA 4XBJA 4HKPA 4J3TA 1TV2A 4HA4A 4RE2A 1E3XA 4GWEA 5FL0A 1IEVA 3VZXA 2PP3A 4B91A 1OC7A 3NEHA 4LCQA 4A8LA 1EUAA 1EIXA 4UOZA 5G5IA 1JZ2A 4EF8A 3G24A 2VD9A 3IRSA 1VF8A 1GOOA 4LC6A 5XIMA 1Z8AA 1XPYA 4LUSA 4ES4A 2VEPA 1W1ZA 1NTHA 1MFUA 3VNJA 3WQVA 3WH8A 3E96A 4AD3A 4PTNA 1W1A1 3L0GA 2W27A 3P82A 4HOXA 2OGYA 5KEZA 1ZTVA 3AWOA 4GYJA 3CEUA 3TWAA 1I0DA 4O19A 3HJEA 1EWDA 1UYQA 5CJ5A 4CD8A 1EC7A 4KKXA 3VO0A 4RPQA 4XZWA 2H3DA 4PODA 2HV5A 2YFNA 2ZZ3A 3UPMA 2OXNA 3JVAA 4KPLA 1HN1A 3NVDA 2J6XA 4RV3A 4Q8PA 3W7DA 3AZRA 4HU0A 2NV1A 4CKQA 1O5RA 4GABA 4UNKA 3LCFA 1ENUA 4NXSA 2ANUA 4DBEA 4QQ3A 1UPPA 2DPEA 1XFBA 3VCNA 1EO5A 3AC0A 3TDFA 3WLPA 1E0VA 1AK5A 4IH3A 1HW6A 1SM9A 1OGGA 3PVFA 1ALDA 3KZSA 3UP8A 2EKGA 4QSHA 4OBTA 3N2CA 1C8XA 1H0GA 2C13A 3S47A 1AJ0A 3KRZA 2HVOA 1FWIC 3HM7A 3MZ2A 1XH2A 1QOQA 3S2CA 3QPEA 4DI8A 1WDRA 5CG7A 2NX9A 3VKDA 1US2A 4NILA 1FKXA 1J10A 1TV5A 3UW6A 1PBGA 5D9NA 1KM5A 4XZ9A 1V0LA 5KINA 3C0SA 1JEZA 2OELA 4CLMA 4ICNA 3VDBA 4AAJA 2O7QA 3EXSA 4AIEA 3E2QA 4L4PA 4R85A 2CHOA 4AD1A 1H50A 3NM1A 1VCVA 3VD7A 2BOFX 2PDPA 3MV11 2JIWA 4JFSA 1XIBA 1KXHA 1BGAA 1PEZA 2ISWA 2XH0A 1I75A 4O0KA 3BAIA 3PR2A 2ZICA 1DVJA 4OVXA 3KTXA 1N8IA 2I14A 3D0CA 5EMLA 2DW7A 1PKMA 2WSKA 3VMOA 3BE7A 3NSXA 1FHDA 2XGZA 3O8AA 1A5MC 1NQ6A 4L1GA 2V9DA 1PB0A 2XSBA 3FIGA 1K70A 4GZJA 1GVQA 2X0HA 3DAQA 3GM8A 5MKGA 1B5TA 1S2UA 4IIDA 4Q4MA 5I3IA 4X61A 1CXIA 2J27A 2ZUWA 1WCGA 3PB2A 1F3TA 3QFWA 3CPGA 3K1GA 4N42A 1R9ZA 4NAEA 3VABA