3GVQA

Urod single-chain dimer
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen decarboxylase
publication title Substrate shuttling between active sites of uroporphyrinogen decarboxylase is not required to generate coproporphyrinogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 120
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gvqA00
3RPDA 4AY7A 2Q71A 3L7RA 1XPGA 4AY8A 3PPGA 4QQUA 4EXQA 1U1UA 2EJAA 3PPHA 4L64A 1XR2A 1YPXA 4L5ZA 4ZTYA 4ZTXA 3GW3A 3CYVA 2NQ5A 4L61A 1UROA 1JPHA 1R3VA 2INFA 3PPFA 1JPKA 3GVQA 4L65A 1U1JA 3T0CA 1T7LA 1R3YA 4WSHA 3GVRA 3PPCA 1R3SA 3GVWA 3GVVA 1R3WA 1U22A 1JPIA 1R3RA 1J93A 2Q6ZA 4ZR8A 3BQ5A 3GW0A 1XDJA 4L6HA 1U1HA 3BQ6A 1R3QA 1R3TA 4L6OA
chains in the Genus database with same CATH superfamily
3DHFA 3MBFA 3CJPA 1VFTA 1NDZA 3RF9A 2BP1A 1R7OA 1FWSA 3GX9A 3E96A 1JD9A 3TC7A 7PTDA 2NUXA 4YXGA 1EF2A 1XJBA 2HBXA 4NZCA 3USZA 3LY0A 3E0LA 3NNTA 3JW7A 1VBHA 3FLUA 3G0SA 1TVLA 4ZOCA 4RE4A 1YBQB 4K37A 2BLEA 3GY1A 4DN1A 4LALA 1PZ3A 1Y0EA 2CZVA 4JTAA 1TWDA 2E6YA 2WJDA 4BKNA 4HTYA 3W26A 5D2TA 1BFNA 4B5NA 4FHAA 1KM1A 4GPNA 2WNZA 3SR7A 1RK6A 3PY2A 1WBJA 7A3HA 2JKPA 2EG6A 2OOGA 2J25A 3LHWA 5EL1A 1MO0A 4W7WA 2NZLA 4G6CA 2CW6A 3H2OA 2VUNA 3TN4A 1X8FA 3GTNA 4Q4MA 1OWQA 1HX0A 1SYTA 2XUCA 4LUTB 3H2FA 3NVTA 4V33A 3N34A 3BAWA 4LY4A 3CUIA 1TJ1A 4M8UA 3ABXA 3RJYA 2B0MA 2G37A 1FWAC 3DN5A 4MZ8A 4ZQPA 5CJ5A 3GG1A 5AYXA 4XZMX 1TTPA 1PIGA 4IJRA 3JR2A 2A4AA 2QPSA 5CC5A 3OYXA 5F2IA 1N2VA 3LCFA 4ZTXA 3IS4A 4D2JA 4GE8A 4CNSA 1JCJA 4J35A 2AKZA 4DPQA 1T0OA 2NXGA 2CEQA 3PP7A 3S5SA 3DYPA 3N17A 2DZXA 5ENLA 4I90A 3TROA 1JDFA 1REQA 5FJIA 3H22A 3DI1A 3K30A 4HU8A 3VOCA 4PBFA 4Z0JA 3PANA 1EQCA 2ZWZA 1DWGM 4W84A 1WDPA 4PB4A 1AL7A 5C6MA 3L4UA 4FNQA 2WMIA 3EWCA 4LANA 1KFJA 5MHBA 3EX1A 3OOQA 1S2UA 4F8XA 2GVYA 3RRAA 2C16A 2J66A 1VENA 3EWYA 2Y5SA 1W5QA 2XIIA 1BKHA 1Q3NA 4EAMA 4I9JA 3VX0A 4RNIA 3CXOA 1MW1A 1CB2A 4CVWA 3HM7A 1PIFA 3GG0A 4B92A 1JRCA 4S3CA 3VFLA 5JH1A 4DBWA 1SO3A 4ZSUA 4LPCA 5GQBA 3W1XA 3ZM8A 2F61A 1P0DA 3M0HA 3MHGA 3SQSA 4Z2HA 5CZJA 3PZMA 4BQ3A 1E0UA 3K13A 2QIWA 5H8UA 3LHYA 3PJUA 2OWXA 1Q6OA 2GDQA 3FX4A 4QGCA 2VQUA 3B03A 1CXEA 4RW5A 3OPSA 4IIEA 4O1DA 3F5JA 3QV7A 4AF0A 1OF8A 4UR7A 4O57A 3GIYA 1K70A 3OJGA 5BRPA 3DFHA 1OCJA 2C6QA 3ZLGA 2ZZ6A 1XIIA 3GDKA 5A8QA 4Z08A 1LYXA 4IM4A 3V5CA 4DBDA 1MWOA 5DCDA 3S8HA 1XIHA 4WR3A 3R94A 1MEWA 4GVIA 3GAKA 4PUEA 1FY6A 4ILSA 2FTWA 3UWEA 2BBFA 3M6DA 1OIFA 5EMKA 5K3VA 2XIQA 4DXXA 3ZZ1A 3STPA 3LRLA 1JCYA 3AMCA 2D22A 2CBVA 4RXGA 3IJLA 3HGSA 3WJZA 3S2CA 5BOOA 6ENLA 1V08A 1VFUA 4PZVA 1CXFA 4H2HA 1DBTA 1H7NA 4P61A 2OU4A 1NARA 4DBEA 2NUWA 5AZ0A 2CBJA 4QE1A 4B5VA 3SN0A 4UFHA 3QLDA 3N4EA 3P84A 2J8FA 3W7CA 1CEOA 2RDWA 3F4DA 3TKFA 5LKYA 2PE4A 4O1EA 3IWPA 4GQRA 3SADA 4NI3A 3E49A 4YLWA 3C2VA 3TH6A 3N2BA 4JFSA 1Q65A 3OG2A 3LTYA 3GUWA 4KGLA 1M6JA 5CZSA 3MMWA 1WKYA 2XIOA 5FF0A 1NTHA 7XIMA 8XIMA 3P61A 4KQNA 1ODZA 1TO3A 1XH1A 5F4WA 2WQDA 2ODOA 2Y6ZA 1IWPA 5XIAA 4GY1A 3ZIZA 4I9AA 4ASTA 1E1CA 3WO8A 1S3HA 2EG7A 2ZDRA 2XZ9A 1F6YA 2E6DA 2QUVA 3UWWA 2C0HA 3HB9A 3SCQA 3O6DA 2RDUA 4NAEA 5KITA 4NZ4A 2DORA 2HBVA 3NGJA 3MU7A 2FVMA 2ZUSA 3MYPA 4R85A 1XQKA 2FLIA 1XX1A 3RM4A 2MNRA 4TV6A 1SO5A 2OZ8A 1MNSA 2PU0A 3NZQA 1TE1A 4O10A 1EL3A 4EK7A 3O7UA 1V3KA 2OYLA 2WK2A 2YB1A 3HQOA 5KINA 3AXKA 5C7HA 3E5PA 1P0KA 1PHWA 2OG9A 2IPGA 1BD0A 3L0GA 1LCOA 4A3QA 4L1XA 4RV3A 2DSKA 1E9IA 1P7TA 3R4IA 2NQZA 3APYA 1YEYA 1AG1O 1SPQA 1Q6RA 5FJPA 3KTCA 2BSLA 3STCA 1YPIA 1R87A 1W9BM 2VFEA 1AJZA 3UWZA 1XUZA 3SGUA 4LBRA 4WF7A 1XICA 1CIUA 1HKKA 4IICA 3IGXA 3PTKA 3CHCA 4AQLA 2HVOA 3PAJA 3W7PA 5CAHA 2OLSA 1A5UA 1PIIA 3TN5A 1DJWA 4H04A 3L21A 1UP3A 1YADA 4HU4A 1JDAA 2PZ0A 1OSEA 1JULA 3WD2A 2DSVA 1GKPA 1OX6A 6TIMA 3B05A 1FWNA 2PDJA 2ZDSA 1TPFA 3ICJA 1ZALA 3CMFA 5AY7A 4JQ1A 2Y0FA 1OFRA 1XGDA 2QCGA 1KM4A 2O4MA 3WDIA 1Z9AA 3BOXA 3L67A 3WQCA 3ZFHA 1UQZA 1B3WA 2VI0A 4LBSA 1ZFJA 1KKRA 2FDSA 3T09A 1XIEA 3TJ4A 3OG3A 3W87A 5D2XA 1E9ZB 3N2CA 1EP1A 1UKQA 2WJEA 1GEHA 5TAOA 3O07A 2AQOA 1R3RA 4WKFA 3C8NA 1N8FA 3LHZA 3NIYA 1BG9A 1DXIA 1R8LA 3ZJ7A 1W9VA 3V5FA 1B3VA 4ACZA 2YZRA 7TAAA 2IKJA 4ZO6A 1TUXA 2PDNA 1VRXA 1SSGA 1OFBA 1WDRA 3UXLA 3P2VA 3FGCA 2XFRA 1GVSA 3PBUA 3BUVA 1QWKA 3O63A 4O0QA 1TPC1 4PUUA 1TWIA 4PCPA 4A3HA 1RY0A 4K7YA 1LL6A 4H9XA 3BQ5A 2QXWA 1WAUA 4NZJA 3RLUA 1OHLA 1XIMA 2VENA 1QDSA 4A4AA 2YR1A 3EOOA 1GKQA 2V6AA 1VAHA 3VDHA 1Y7VA 1QK0A 4GCAA 2I5IA 1EYEA 4F66A 1J2WA 1H09A 1X39A 4PTVA 1RQHA 3WN6A 1XG4A 4TTGA 1FWTA 3MMUA 4N6EA 3BAKA 3DFOA 1H62A 3O2LA 2ISVA 1R86A 3F2BA 4WDTA 3IIPA 1RCQA 3DGBA 2PDPA 1L6GA 4FLSA 4HHHA 1QBAA 1ONRA 1QNOA 4NT0A 1OX5A 2R1MA 4WLCA 4LGXA 1J12A 4KWUA 4Q4QA 3TOPA 1KW1A 3C0JA 2AKMA 2O9PA 2DW7A 2DZSA 5I3KA 1WB0A 2OQYA 4US5D 5D32A 5FF4A 3UY7A 4PFHA 3LLFA 4P2VA 1BQGA 1KKOA 2HEJA 3G1XA 4CD7A 5CC6A 3L0KA 3N04A 3SZ8A 1Z3NA 1KCKA 5CPQA 1FWGC 3ZVHA 2HQAA 3LPPA 1OYAA 4D6DA 1CLKA 3CAKA 2GSHA 2EQDA 4US5A 3MHUA 4UMCA 4E8CA 4C6OA 1W1VA 4KEVA 5FSEC 3EMQA 1OK6A 2GUUA 5BRQA 1ISXA 4Z1CA 4AY7A 4W8AA 4WX2A 4NZ5A 4BWLC 1QTWA 3N19B 3P5ZA 3LBOA 3XINA 1OVDA 3VIHA 4ZE5A 4CU8A 4MKVA 4GK8A 3EKLA 1VBJA 1T8QA 4LQ1A 1DPMA 3DFYA 2BVWA 2VT0A 2OEKA 4EE9A 1V0LA 5GJPA 3AHXA 2YCLA 2GJLA 2PTXA 1ECEA 4QJ4B 1F8MA 1CGYA 5M2FX 4NL1A 4MNLA 1HJUA 3SBFA 2PGWA 2OQHA 2WB5A 1EZ2A 3G24A 2PAJA 4RDVA 4GABA 4JTJA 3WH9A 3PTQA 1R3YA 4AWUA 3WNLA 3MUAA 1RALA 4CUCA 3II1A 4JNMA 3E9AA 2X30A 2RKXA 1WDQA 1DTNA 4JYEA 3VD7A 2XYLA 4HYRA 4L5ZA 1WNOA 1TUFA 3VIMA 4KFPA 3D3AA 2E6AA 4ZL1A 2HS6A 1Q5MA 3BJSA 3IGUA 5ABEA 4XZNX 4GVFA 3RNDA 3N25A 1TPWA 5A8MA 4HNVA 5TIMA 4B90A 4IT1A 4GKTA 2NXHA 4H6QA 1JQXA 3BMVA 3OLGA 3UPWA 3N6JA 2WLYA 3LV5A 4HN4A 1PWMA 1XYAA 4GYJA 2DJXA 4ERGA 3UPBA 3BAJA 3BMXA 1R46A 1XDJA 2R6OA 1PS9A 5C54A 3BLEA 2V2DA 4TXEA 1XWYA 2QJIA 5DANA 3BV7A 3VCRA 3RX3A 3GD6A 1XLEA 1G01A 2GFTA 4Z2JA 3HF3A 3GKAA 3RAOA 4QG6A 3WEMA 3MUCA 3FEQA 3E1F1 2D2GA 5C7VA 1RR2A 3A13A 3FN9A 3T05A 3UZJA 4DUXA 2Z0IA 1QHOA 4QHRA 1JZ5A 3UETA 3CUJA 1HTIA 2NW0A 3AQUA 1ZAIA 1FUYA 4ZQNA 2J24A 1VIWA 4L4MA 3LCIA 3V5OA 4EWND 3VPLA 3WQ6A 8A3HA 1E6NA 5GNYA 1KFKA 4X3ZA 4YHGA 4WK9A 1B57A 4WOQA 4RUBA 4KW2A 5E0CA 5HUPA 4HU3A 2WNWA 3VGFA 2DGAA 4ADUA 3LCWA 4EP8C 1RJPA 1TCDA 1UH2A 4MJZA 5D30A 1DIOA 4RPPA 1EPVA 3D3FA 4DWDA 1WKEA 4MPKA 2Q71A 3TAKA 1QT1A 4QLJA 3OODA 1KGWA 1V6XA 2FZ9A 3WLOA 2WSYA 2GQAA 1SQ7A 4HNUA 4E8DA 1BWVA 3IK2A 1IEVA 3T0BA 1S2CA 4DZ5A 1A5BA 4NYUA 2J13A 3ARXA 3C0QA 4W7VA 4LB3A 1JF5A 2A5HA 3DBNA 3APTA 1UWRA 3O0KA 3RU8X 4FX6M 5JH2A 1JD7A 1ZY9A 3T2OA 5CC3A 3AWNA 4O52A 3TA6A 3A5VA 2YGYA 3E2VA 4MNMA 3H26A 3PPGA 1BHGA 4JQ2A 5L6UA 1Q7QA 3QHNA 1JPDX 4M56A 3VIOA 3W2NA 2R91A 4IMCA 3AMLA 4LEQA 5F1VA 3GR4A 1E51A 2W6RA 4MADA 3Q67A 3BSGA 4IFKB 4L80A 5C71A 2JEQA 1VPQA 4GD0A 3UWYA 3W71A 3W75A 3Q2DA 3AHZA 4YVPA 3GXTA 3N14A 4DIAA 4JAWA 1XQLA 4XAFA 2X0HA 2C14A 2JBMA 2GK1A 1FWJC 2W3ZA 5J5RA 3CUFA 3HIJA 3OP2A 1H61A 1LF1A 2QCEA 1MEIA 1EJRC 4DO4A 1Z89A 2ZRZA 4IQJA 1HN1A 4C90A 1J5TA 2DZVA 1FTXA 3R11A 5M3WA 4EXQA 3GNDA 1RUSA 1P0NA 2I5QA 4IXHA 3LV6A 2XVPA 1IIGA 3CL7A 1UW9A 2VDHA 2J27A 1JXJA 2XH2A 4HIBA 3T1GA 2BVTA 1IZJA 3BLFA 1UUQA 4QQUA 4M7SA 2OOFA 2QJGA 4NNCA 5BOEA 5B7ZA 3EMZA 2P10A 3KVLA 3KBVA 3UG8A 3S9ZA 3WFAA 1JUKA 3ZQ9A 1HL2A 3TUUA 2V0TA 3TIMA 3G6LA 3EOLA 2BHZA 3PJXA 2GGEA 4J3UA 4BF9A 1F7BA 3F03K 3GC4A 1FH8A 1ZRQA 1KR1A 2GJNA 3UJRA 2X7WA 1JZ2A 3BLLA 2V68A 4IXXA 3TYZA 1YDYA 3WUBA 3QFEA 3BANA 1L6YA 4Z1YA 1LROA 1C3FA 3E0WA 3PM6A 4AEEA 3A4XA 5MF5A 3VD9A 5B7YA 3C61A 4KEZA 4ICMA 1D3HA 3WQ8A 4ZTYA 2VGBA 4C6BA 4NJHA 4TOQA 2VDIA 2PDBA 1DWAM 3GU9A 2XH0A 4H9TA 1E56A 1BVNP 4EWJA 2QHAA 1TVNA 3HPZA 3KL5A 5EMUA 3GYEA 4R9XA 3MUXA 1ME7A 1XSIA 4L6OA 3W1NA 4O4WA 4XG1A 4FK9A 1F5ZA 5AC7A 1UR3M 1PCKA 2Q8ZA 1AW5A 4K8HA 1GYLA 4IH3A 2WM0A 3TYDA 3M4HA 2PDCA 2XIJA 1K8YA 3GWQA 3LMZA 4YCOA 2E8YA 1W3NA 1MFVA 1XCWA 5D9MA 4E3VA 1L0PA 3H7RA 3VIJA 3URBA 3LN3A 1P1MA 1XPGA 3LEPA 5HR7A 4K6AA 3G1HA 3C2YA 2ALDA 4Y9OA 4G9PA 4WHBA 1KCXA 3NQEA 4F0RA 3S5ZA 1SUXA 2ISFA 3W83A 1AQ0A 4F2UA 2ZE3A 2R1KA 3WQ4A 2O9OA 1VJSA 3LRMA 3AOFA 3MP4A 4DJDD 2PZNA 2ZZ5A 4R7OA 2VZOA 1Q45A 1TMHA 3POCA 3H6OA 2A3AA 5D38A 1QBBA 4A2RA 1ISZA 1JCTA 1EXPA 5F4XA 3PPFA 2YDRA 3QMSA 1DJXA 3S2JA 3VOGA 4LAZA 3VZXA 4ATLA 3KHJA 1QK2A 4LFYA 3PG9A 2D2JA 2YCJA 3GNPA 1EJ7L 2YA0A 1JAEA 1KTCA 4D6IA 3A4WA 5D2WA 4OUEA 1K4GA 3GSMA 1FBAA 3F5KA 5H2ZA 1VJIA 2KX9A 2QDGA 1VCFA 9XIMA 1OIMA 2NVDA 1ZJHA 3P14A 4W89A 1AL8A 2WKGA 1IQ8A 3DKLA 1Z7AA 3VGBA 1AFSA 5EGRA 3WLQA 1UJPA 3PULA 3EMCA 1H7PA 1EHAA 4C6EA 5JQ9A 3T0TA 5A94A 3LXAA 3WH5A 3B8TA 3B9OA 2WMKA 1R5YA 2ZRUA 4H6RA 4FIRA 3W74A 3ITVA 3S1XA 2EJ1A 2TAAA 1TR9A 4O13A 3ARQA 4J7RA 3M7WA 4M1RA 4RPQA 2R9RA 4X9YA 4N4QA 2PEVA 4PC8A 2BGNE 4ZQRA 1NOUA 3MS8A 4NZFA 2NSOA 1OCBA 2HROA 3C4UA 3TDFA 2JF6A 2W5FA 3EPOA 1J93A 4QEHA 4AHPA 4PB3A 4MB5A 1Q6EA 4NF7A 3OZMA 3HQ1A 5HQEA 4JOMA 5CPOA 4IZGA 3NQAA 1N8WA 1EWEA 3ALGA 4KPLA 4AVOA 4GLEA 1H3GA 4HPGA 1SO4A 4U5KA 4TU1A 3TP4A 1WBHA 1V5XA 4C6JA 1D3GA 5DXXA 2WVVA 3RO8A 1I60A 4X22A 3NAVA 1A5AA 4JN7A 4HCDA 4C6CA 1DHKA 3T8QA 1K02A 3U2OA 3GHUA 1L2UA 1JCMP 3ITGA 2V82A 3QW3A 1HG3A 2C79A 5FJUA 1U5HA 1GYMA 1SW3A 1WDWA 1WDDA 4L9YA 1QFEA 2HVNA 3B4YA 3S0CA 2EF9A 5G1TA 5IDIA 4K8GA 3VDAA 1NDVA 1W17A 3D46A 3SIMA 4AMAA 3L68A 4J2MA 3A5FA 5BNKA 1HW6A 4U33A 2YCIX 4KBXA 2JQXA 1EO5A 1CPUA 4UQ9A 5I02A 5H8MA 1KXHA 2OFJA 1YIXA 1K8ZA 3LTSA 3LPFA 1XGZA 2R24A 3GFZA 4UTWA 3I7SA 4IGSA 2Z1SA 3WYZA 1RQEA 1B9BA 3RFAA 1AZ2A 2GGGA 2WBKA 3N9RA 3EYPA 2YDQA 3L4YA 2VC5A 1R6WA 2BS9A 4XZ9A 3T0CA 4JX4A 2PB1A 1XRVA 5A2CA 4B5TA 4JN6A 2PMQA 2VOTA 2FHBA 3KDOA 4P8VA 2WNQA 3KBNA 3RPMA 1YX1A 5I07A 3ARYA 4LUTA 4Q7NA 1CENA 4GXPA 1TPB1 4PA8A 3OGVA 1FP9A 3AIEA 1J96A 1DYSA 1CECA 1GTHA 3BE7A 3CUZA 3FJ4A 1GOQA 1VHNA 3TU9A 4GY0A 3A4AA 4C6KA 2ATSA 2G3NA 3IJ8A 1VPXA 3ZJ6A 2VNCA 3CWOX 1LJYA 3NO1A 2DJLA 3HN3A 1UPPA 1H0GA 2W0UA 5A8OA 2WYSA 2RAGA 3JRKA 3S46A 2VGIA 1F3EA 1UCWA 4EX4A 3ZO9A 4F79A 4S39A 5G2WA 1YE6A 3AMKA 4QITA 4H6EA 1F07A 1W5NA 1TTQA 3VVGA 4MIMA 3W7DA 1LG1A 1NVMA 5KSWA 1BQCA 2O7QA 5A5WA 1BWLA 3TONA 1DWHM 3BURA 4NI8A 1ZHAA 5E09A 1KRAC 2A6NA 1XS2A 3FDKA 3PZ9A 5ECVA 1LLWA 2I9EA 2NX3A 4Q22A 4IGMA 3C5QA 3PB0A 3MSDA 3SW6A 3W38A 4LXFA 4J28A 3CQKA 1EIXA 3W88A 5FD0A 5FL1A 3KZSA 3RLVA 3K4DA 3TQKA 3ERPA 4R27A 5C9XA 5HANA 4CQ9A 3MV11 1RBLA 3IARA 2VRQA 1QI2A 1Q6GA 2D24A 4W4QA 5LA0A 3HU7A 4P7NA 3O6CA 4AUBA 1XLFA 4DAFA 5LHFA 1S2AA 2VYOA 3S5YA 5I5RA 2I56A 1PZ1A 2X42A 3T6CA 1P6CA 4RCXA 4HOWA 3GO2A 3OO2A 3WF4A 2BY3A 2FZ8A 4JHMA 3VGGA 5FOOA 3HV8A 4C6IA 4N0RA 3WZ0E 3DFPA 1XDMA 2GJXA 3ZS4A 4HOXA 3AU2A 1U1UA 1XLCA 2D23A 1BG4A 4RZBA 3SUWA 5AOUA 2DUZA 4RKAA 1KM2A 4D8AA 2PDLA 3BSHA 5DMLA 2CU0A 1MI3A 4NJIA 2WKJA 3H23A 4AC1X 1OC5A 2FPTA 1J79A 6REQB 1XIDA 1XBVA 2WZTA 4FXJA 4XX6A 3WNKA 1W2PA 2WO5A 4IMGA 3HGRA 5LZLA 1E40A 3MCOA 2GPTA 2RDTA 2QUMA 4FX8A 3WF1A 3VIFA 1GEQA 2QEZA 1KRCC 2VFIA 5A6BD 1E0WA 4H00A 5K4XA 4E6MA 5D8WA 2OJPA 4ZEPA 4OBRA 3GDLA 3VKKA 1RPXA 3VU2A 2V5LA 3R2GA 2W9MA 3LENA 1G0CA 4J40A 3L5AA 5LGZA 5A6BA 1E6PA 3Q58A 1OYCA 3ZWTA 2ISSA 4RDZA 3F4NA 4CCZA 1RLCL 3LDVA 4RLIA 1VYRA 4NX5A 3UERA 1GHSA 1GOXA 2QJHA 1W3HA 1OFOA 3D47A 3IVSA 2FKPA 3W7NA 1WUEA 2Y7DA 2NWSA 2H90A 3REQB 5LIUX 1YE4A 3LMYA 1B90A 4NAFA 4DWSD 1TFVA 4YTSA 2I14A 3L2MA 1J11A 4LF2A 3TTSA 5FAJA 2FH8A 4FX7A 1RCOB 4GINA 3AHVA 4DWSA 3E6EA 2HPIA 5DT5A 5ABTA 1UZ4A 4PE8A 3ARWA 3AO0A 1CGXA 2FGLA 2F6KA 1V79A 1W3KA 5U4NA 4MM1A 3UCCA 1W3IA 4QR6A 3FJNA 5D04C 1LWJA 4Q8WA 2QV4A 3WQWA 4A8NA 1JZ4A 1DWJM 1GKRA 4B16A 5FEZA 3RCYA 3M07A 2Y70A 1JYWA 4F4RA 3UCDA 5GJMA 4PH6A 1Z32X 4F0KA 1NP0A 4TX6A 2ZRYA 1E4LA 3QZAA 1SR9A 3GHSA 1UROA 5DBUA 3VE9A 2JIEA 4XZIA 1A0CA 1LG2A 5HPOA 8CGTA 4JX5A 3LZ3A 1AQMA 1YLVA 2VUYA 1J01A 3IPWA 1DEDA 4OHQA 2HWGA 2FHFA 3EDJA 4FNSA 1IXQA 3W7LA 3WUFA 1XLAA 2XIMA 2DZPA 5BOFA 4H7CA 4LWWA 2Q3RA 2VWSA 2WCSA 3OA5A 1UR9A 3SSZA 4MDPA 2WMIB 2OZTA 1GNXA 5BW6A 3FNDA 2V3FA 4ICCX 1SJDA 3FEMA 1FH7A 1TMLA 2C19A 2QCNA 4ZO7A 4Q4OA 3VZYA 2ZUNA 4QAIA 2P3EA 3SQMA 1E72M 8XIAA 4O0ZA 3BCDA 3P62A 2EPMX 4TMCA 5ECUA 1EEPA 5EMLA 5AYBA 2PSNA 3V18A 1C7SA 5DY3A 1BYDA 4PTMA 4NNAA 5CPNA 2OYMA 2VFDA 4BR1A 3KOWA 3LSBA 2DSUA 1IXOA 4H9VA 1DWIM 3AI0A 4L56A 1W1TA 3LLXA 3GFXA 1P1XA 2XVLA 4YYFA 3KAOA 1LWHA 1GVIA 4AF0B 1QPOA 3KWXA 3PB2A 1W5PA 4QCFA 2QPXA 5E93A 1PZ0A 2FVLA 1Z42A 5FA5A 4K1WA 4O16A 3QXBA 1XYCA 6ALDA 3C3UA 2VCCA 1BVWA 3AALA 3N29A 5T8GA 2PLKA 2VO5A 2V3GA 1J0HA 3UXIA 3RG6A 3VUPA 5A6MA 4HA4A 1PYMA 5IBXA 1WDSA 2J7GA 2P8CA 3H24A 1JI1A 5CPSA 3BZJA 3IIOA 2C15A 2VEMA 3LBCA 5I0DA 3EPMA 2Q01A 4P7RA 4C1NA 3UW6A 3MDWA 4IIHA 4FLOA 3UG4A 2CESA 3DG7A 2XFYA 3LQLA 2D0FA 5F7UA 2Y7FA 1EC8A 4KCWA 4KF1A 2WM1A 3F4WA 4JHOA 5CGTA 5I2UA 2Y5EA 1QNSA 2QW5A 4L4OA 1WA3A 3HFTA 3I3BA 4REQB 1B3YA 3F1QA 4QG8A 3P81A 2Y8KA 5CGQA 2YFOA 1GW1A 2J7DA 1KFEA 1EDTA 1S38A 3PBWA 4DI9A 3ZYZA 1YKWA 4HQVA 3GU1A 4HBKA 1OK4A 4D6FA 2X05A 3U6WA 1U83A 4CNNA 4RNHA 1HJQA 1L6SA 4C6LA 4O14A 3G1AA 1PKMA 1U2YA 1TIWA 3WD4A 4RE2A 1J0KA 3DCPA 1QCWA 5K2ZA 1TJPA 3A9IA 4LC6A 4O1CA 1J6PA 3P5YA 4B15A 1ZCCA 3GC5A 3PNZA 3M64A 5KEZA 4Q8NA 5LHEA 3B0UX 1GQLA 3CTTA 4NAEB 4HMEA 5DT7A 2DVXA 4LAKA 3WDHA 3ALFA 2ISDA 5T9BG 1CCWB 3UA4A 2J75A 3U0HA 2QPUA 3ANYA 3O1NA 3SAZA 2YW4A 3ABQA 3WQGA 3OVRA 3AC0A 1FWIC 2G3MA 3CIWA 1GK8A 3TQPA 4K7VA 4HK7A 4HNNA 5G1YA 3HGJA 1XFCA 4O1AA 4W8LA 4KRUA 1I8JA 3CZKA 3HG5A 1ZAJA 3IRSA 1FQ0A 4D1JA 4DJFD 1ICPA 3WUEA 1P7TB 1DWFM 4UTHA 1VKFA 1RVGA 4DO7A 1JQVA 3EPNA 3G5EA 1CI1A 3PBGA 1FWBC 4O18A 4DJFA 2V5KA 4E4PA 2WSRA 1C8VA 4C1KA 1KQZA 2YDAA 3U4AA 1DIDA 1JL8A 2NQHA 2FZBA 1CTNA 2VL4A 2P8BA 4AVNA 1QMLA 3MTWA 5E0KA 2HVMA 5I24A 4PEKA 1AH3A 3SUVA 1RAKA 3STGA 1ML1A 3R7MA 1FHDA 1FCBA 3R8GA 3H70A 2QJJA 5I03A 3TA9A 3NDOA 2E1DA 5DN1A 5KZMA 2Z1WA 1XF0A 5I3IA 4L1GA 2Z1VA 3RLGA 2Y8VA 5CSRA 2PBOA 1S1PA 3SI9A 4UR9A 3UG5A 1LBFA 3GH7A 1BXBA 2CYGA 3UF9A 2J9XA 3H55A 3PZVA 1BXCA 3STEA 4GXWA 4JL1A 3B8DA 3WY1A 4H8VA 4GIYA 2J9ZA 1O7AA 5HQLA 1PPIA 1XYBA 4KFNA 1BYAA 1JDEA 4GCXA 2P1FA 3N12A 3KRBA 1J0JA 1A50A 3BCJA 3WMSA 5C2CA 3CHDA 1V6VA 4YS1A 4AX6A 3VXGA 3CAVA 3LNMA 3DZ1A 4JTTA 3HOJA 2X09A 2DQXA 1EFZA 1ALDA 4OQVA 1FP8A 2QYGA 3O06A 4DUOA 2FFCA 1OD0A 2GZXA 4ACZB 4PUMA 3B40A 1K8XA 5DY2A 1Q85A 2E5CA 3W25A 6TAAA 3F2CA 1W37A 2V5DA 3E38A 4ZB5A 4N9EA 1UWIA 4JS3A 1H11A 2BOGX 4ENLA 3FGCB 3EB2A 4GYFA 2XWEA 3BW3A 3T2QA 1PEZA 1YDVA 1MYRA 3EB3A 3WLIA 1EGMA 1WOAA 3A12A 2XVNA 2VFFA 1W56A 4ATDA 1FWWA 5EU9A 1HT6A 5EMMA 2QCHA 2WMJA 1LRTA 4DZIA 1T96A 2PWHA 1ADOA 3ONBA 1B9ZA 4FB7A 1HKMA 2DZBA 3P8JA 1UYQA 1PV8A 5FJOA 3UXDA 3NQMA 2DQWA 1IEQA 3GBDA 5CLTA 3IUIA 3W7IA 2DT0A 1SFJA 1OZQA 2E67A 5LXXA 2VEGA 3C8FA 1G67A 5C55A 3MV01 1NIUA 4MB3A 4QISA 3UZ5A 4HP5A 3BGGA 5G2HA 1IV8A 3FSTA 5FJTA 5CCZA 3PN8A 3VGHA 2IXUA 3RLHA 3VNJA 1AH4A 1V7YA 3LK6A 4DUWA 2DW6A 3WH6A 2VXNA 2J6VA 4L6HA 1GYNA 3RN6A 3PPHA 1FX6A 2BOFX 3JUGA 4P8UA 4A21A 1H2JA 1IXNA 3F7JA 3ZVHB 4AWEA 2ZQ0A 1ICSA 1Q63A 4RJEA 3ABZA 3EOSA 3DYMA 3NQBA 3ARSA 3GVVA 1W9PA 5A8NA 3EDFA 1EDGA 5FJJA 1QUMA 4NP7A 1UD5A 1TYGA 1EZWA 1RK5A 4K36A 4AU0A 2DVUA 4NX0A 1NF7A 2A7RA 1EPXA 3W82A 2OWWA 5KZEA 2HK1A 3WEOA 1W1IE 4LRTA 4X0VA 1K8CA 4IPLA 1OCNA 5D09A 3QM3A 3V16A 1W9XA 1VBRA 2X7VA 3GR8A 3LTPA 3VKBA 2YCLB 2VD9A 4NJKA 1TTJA 2HDJA 2POTA 4KETA 3TTEA 2VDGA 4MAVA 4H8HA 1EJVC 5BMXA 3IV8A 2NV9A 1DL3A 4HTBA 4HHLA 3T55A 1ZL1A 4Z1BA 4B3LA 1RLDA 2V9DA 4G8TA 4K3ZA 1TRIA 3O6YX 1B3ZA 3MCNA 4IIFA 4N7QA 3NOYA 3N9KA 3QMRA 2ZXQA 4Z17A 1TE6A 3WF2A 1KWGA 1C8YA 2Q8XA 2E9MA 1R3TA 3CK5A 3GVGA 2XIBA 1BLIA 3NQ7A 1UA7A 1V77A 3G1YA 2IMRA 3NEVA 1JR1A 1VBUA 2Y1HA 1BSIA 3OHMB 4Y8FA 1TX2A 2WPGA 4MFEA 3AXXA 4G7FA 3MSGA 1UD8A 3TW7A 1ODUA 1D7KA 1R3QA 3PUGA 2CCRA 3IIZA 3WENA 2GWNA 4PMNA 2CHRA 1Z6KA 1Q6FA 1FWDC 4QCEA 3GHRA 2PA6A 1UD2A 3VUSA 4O53A 2HNEA 4LS1A 3PSWA 4AISA 4U3CA 1G4EA 2YXXA 1OB0A 1PAMA 1EO7A 1NDWA 3KX6A 1RA5A 1M7XA 1TV2A 3DG3A 2VVSA 2Z2UA 3NXFA 5D2VA 2UWFA 4D8LA 2QUTA 1Q8AA 4MFDA 2IPWA 4H1ZA 2JFEX 2X16A 4UMAA 3B8IA 3IANA 3KVMA 4QXIA 1ZLPA 2HJPA 4CQBA 4O8AA 4QS5A 3UBPC 4UOQA 8TIMA 4TQTA 1WZAA 3AISA 1W3LA 4M3PA 1E15A 3BL3A 1J10A 1HVQA 3CUGA 4WXZA 1U1HA 5C9RA 4GRSA 2HPMA 1WV2A 1CGVA 4PYSA 1NF0A 1HKJA 2W79A 4CNUA 2J79A 1UR8A 3OU8A 4HMCA 3WBWA 1UWTA 2HISA 3EBVA 3SCNA 1AD1A 1DXFA 1JFHA 4ZA0A 2R1PA 2TODA 3U7VA 3CAQA 3W22A 1NJJA 5I3FA 1QXLA 4KT2A 3ANVA 1GVEA 4X60A 4HNOA 5FAGA 4JNZA 2Z7GA 1EGVA 4BY3A 3LCHA 1L6WA 4DNMA 2GJPA 2BG5A 3LCXA 4OBSA 2DSZA 1N82A 4IGNA 1BPLB 3M6YA 1O1HA 3GNXA 3N15A 3PNUA 4CVUA 1HXJA 1OABA 2PF0A 1MRAA 1BEUA 2HE8A 1ADDA 1LRNA 3N4FA 1UZDA 4M19A 2CIPA 4CD6A 4U5IA 4U10A 4TIMA 4B4FA 1IT0A 3TJIA 1TWZA 4RDYA 4I7VA 3DFSA 1AA1B 4G5DA 4HD5A 4CNOA 5A69A 1VS1A 2FPVA 3VD3A 2QJNA 1YXCA 1TA3A 3NUKA 3W7KA 4E0CA 1LDCA 2E4TA 2YXGA 2OPJA 4LUSA 3AJXA 3KTXA 3EWDA 3OA3A 4IX0A 4WSJA 6XIMA 2GK1B 2ZUWA 3GDBA 3LHTA 4INFA 3L4WA 4UTTC 1YRRA 3CPRA 1F4AA 3MMTA 4JDYA 1O5XA 1Q4WA 9CGTA 3A22A 4OV9A 2O4QA 3UVAA 2P3ZA 3VNLA 4OGZA 3EWZA 3P7YA 3PZIA 4H19A 4ROQA 2F6UA 2VRJA 2H6RA 1XG3A 1E6ZA 4XAYA 1KM6A 2CPUA 1VF8A 1IGWA 4DJFC 3A64A 4MLRA 1H0IA 3R0KA 2YOCA 3NZ1A 3DENA 4IPJA 3A23A 4JTSA 1BAGA 2ALRA 1XC4A 1K1DA 4QE4A 2YA2A 2AGKA 3L4TA 2XHYA 2IKGA 2A3LA 5BU6A 4AZ5A 4IMFA 2DZUA 4GISA 4DBUA 4AZ7A 3FFSA 5DX7A 2VFGA 2YL5A 3MI3A 3NURA 4H9UA 2J8GA 5EB8A 5LIKX 1GOKA 3FA5A 1P0BA 4CD8A 5BXTA 1GG1A 1W9DM 3NPVA 3T0AA 3QHMA 3MWAA 1NSJA 3UPMA 1E4NA 1JF6A 2CHNA 4NG3A 4W87A 3DX5A 1XI3A 3BPWA 4EAYA 3TC6A 4Q4RA 5AN7A 1VEOA 2A3BA 3TWAA 3P74A 4RDWA 3OYZA 3NXLA 3CZJA 1RCXB 3MI6A 5AHIA 3PZUA 5IOBA 4YCPA 3DUGA 5LSMA 2NX1A 4NZ3A 1IWBA 4ZFMA 2IQDA 4DM1A 4UOZA 3ZXWA 4O19A 2OLHA 3HQNA 2FB3A 2B7OA 1W32A 1ONXA 3AIWA 3UXKA 3W00A 3CMJA 4PMUA 2EG8A 1TJRA 1IHIA 3ANUA 4IJCA 3VDBA 4WUIA 5GVJA 1B3OA 4ZMGA 3M0VA 4D6EA 3E2QA 3LRKA 2O92A 1QJWA 1DP0A 3D5HA 1VP5A 1V6WA 2YBTA 3QV6A 1EA9C 3TN6A 3WBXA 2OGYA 1RQBA 3VM7A 3QTGA 1KGXA 4KWVA 3UEQA 5ABGA 1ZS2A 4MZ1A 1L9WA 3NQFA 2VR2A 3AYRA 5EYWA 5CQ1A 3KBJA 2E9BA 3AWOA 1E6RA 2PWFA 3ITXA 4L61A 2VR5A 2W91A 4I8DA 3K8LA 1XLKA 4HVXA 4C7DA 3T9PA 2CLMA 5BXRA 1LL4A 4W88A 2CXEA 3TCSA 1JXKA 4Y8EA 3P8IA 4N9CA 3W1PA 2WWDA 2YPIA 3LI0A 1XHGA 1DJNA 4JEJA 4S3FA 1I6NA 1KO0A 4XD4A 1ZP4A 4J4KA 2CFFA 1GQNA 3ZSTA 2W66A 1OGBA 4LCQA 1IZCA 3OLIA 3SFKA 2JGQA 2P53A 4QSHA 1K7EA 3BJTA 2CLIA 4EF8A 3LZ5A 1TZ9A 1TREA 3EA1A 4Z0SA 1G4SA 1SSDA 3CHVA 4D6HA 3FY1A 2IS7A 1AQHA 3I65A 1XLGA 1W8GA 4OBTA 1XC6A 2KZHA 1X97A 3W84A 2GWGA 3CB3A 3IAPA 1OM0A 4PCNA 4KFOA 4XO6A 3B06A 2J7BA 2PDIA 3LA4A 3RO6A 3FHQA 4FS9A 5XINA 4DYEA 4NHVA 1ZPTA 3ZMRA 3BLKA 3GUGA 2D3LA 5AHNA 3U9IA 3NCOA 4DF2A 1R2TA 2BY0A 3CUHA 3N4AA 4FPSA 4AY1A 3W7QA 1Y5VA 1VD6A 5FSDC 4PMXA 3W73A 3ITOA 4LUYA 4QTGA 3C2FA 1DVJA 4KWOA 4ECLA 4WY0A 3EX2A 3NTYA 3VKCA 4UTUA 3DOPA 3W07A 4PR4A 2JIWA 2XFFA 2YSWA 3WK1A 3PBMA 3QQ1A 1F3XA 1BGGA 5JXQA 1B1YA 1ZENA 3E2SA 3WLKX 1DOSA 1R7AA 3G1FA 3PZQA 4MWAE 1TPEA 3OQ8A 1ZB5A 6REQA 2PODA 3AJ7A 1OG0A 4Q6JA 1PX8A 4EANA 1XYFA 3HGOA 1TG7A 1MXSA 4ZOAA 1T5AA 1Y8BA 4HMDA 2DUXA 4YTRA 1DIEA 2HRWA 4J5NA 4FMVA 2GUBA 3M5XA 3DAQA 3AS1A 4Q4SA 1QNQA 1OGSA 5FJRA 2HS8A 2W63A 1OQFA 1MUMA 3G1RA 3P0XA 1XLDA 3MB9A 3C3NA 4C5ZA 1O5KA 2CWXA 3WEZA 1SW0A 3W7MA 4HA3A 4GO9A 2ZC8A 1EBGA 5EBUA 3W23A 3OGSA 2CLLA 4IP7A 1I4NA 1XFBA 4AVFA 2XN0A 3VM5A 4I8YA 1P5BA 5AC6A 3REQA 1OC7A 4UNKA 4AX7A 2ZOXA 3QGAC 3QSRA 1VHCA 2NV2A 1XR2A 4QEEA 4LYPA 2G4JA 2V67A 2V69A 5CH9A 3DFQA 4JTDA 1CB7B 4PBGA 2TMDA 4KERA 2V38A 2NQJA 3S1GA 1DV7A 5FEPA 1X1NA 3WSUA 2NQLA 1WAWA 4UFMA 1GTEA 1R9ZA 3KVKA 3RXZA 3BTNA 1RVKA 5C5YA 5LIYX 1SZEA 1CGUA 1ISYA 1EIBA 1BF2A 1P0EA 2H9AA 1FFQA 1R3VA 4M80A 1UMYA 4UQCA 1B0IA 1HFBA 1C8XA 2J74A 4GO8A 1A3WA 3MUIA 3SEPA 3SCWA 3FA3A 1GONA 4LYKA 3DDMA 4PMZA 4IQDA 4H41A 1XPYA 3BZGA 2VHLA 4E2VA 4S23A 4FOJA 3UU0A 3DERA 3CV1A 4JCMA 1WUFA 5E0FA 3QR0A 5DCEA 4ACYA 5G2IA 4XKYB 5CC7A 3M0YA 1KRBC 5FI8A 4OV4A 2DH3A 3V75A 3PBYA 4BWLA 5BROA 5LXEA 4D6GA 3NZPA 4JIHA 1IR1A 5KETA 3NDYA 4JIPA 3U48A 2QCFA 5C9UA 2V2CA 4B3ZA 4GACA 1Y5WA 2HE5A 1VGAA 1LOLA 3DGRA 1DHPA 3VABA 4YTTA 2XM2A 1DJGA 1AMKA 4Q32A 4MYAA 2Z6JA 5HPCA 2FTYA 3QMTA 2QMJA 4Q33A 1TV8A 5CEWA 3LLDA 1MQPA 3G22A 1U5VA 2WPBA 1S2VA 4M6QA 2PRMA 1GCYA 1PL9A 5BXPA 2F6XA 5HATA 1E55A 3ES7A 2PCQA 4IF2A 4C6DA 4A6GA 1Q7ZA 2PWGA 5D9NA 4MKNA 2ZZ4A 4NXSA 2J7FA 4IIGA 1W1B1 2UBPC 4GZIA 4QNEA 5AVNA 1FCVA 3RHGA 2QCCA 4QG9A 1O66A 5HJXA 4O0KA 3O0FA 4IWWA 4IISA 3VNMA 4U31A 4XTIA 2F9RA 2QF8A 2P0OA 3BWWA 1SU5A 4ZO8A 1HF6A 3EXTA 4AZHA 1GPWA 2WZIA 3GS6A 2GJXB 4HSOA 3NPUA 3W2LA 2IKHA 1OINA 1NDYA 3UYCA 3FW6A 1AW1A 1W8SA 1PO9A 5M03A 4UFKA 2IKIA 2YLAA 2DZAA 2HK0A 2CKSA 4BI6A 1A3XA 3AIRA 1WYIA 4RE0A 2TRSA 2D2HA 4HYWA 4ONVA 4LC8A 1XRTA 4LCRA 1HZYA 2GVLA 3O3RA 1HNYA 3N3MA 4A3RA 4RV8A 4AH7A 1UWAA 2BOEX 2GL5A 2XGZA 3P67A 2IPFA 3BG9A 1JCXA 3VO0A 4D72A 4HU0A 3GAYA 4F0LA 1L6FA 5IFPA 2Z24A 4AWTA 4YWSA 4IG2B 4X2RA 4OECA 1ZAHA 4UWMA 1KR0A 2ZADA 3DC0A 3W86A 1LQ0A 3AHTA 2PDQA 3NSXA 3B04A 3ARPA 4JQ4A 1Z44A 3B0PA 1T99A 3VA8A 1OFEA 3TWBA 3K46A 1K9DA 3PS7A 2ZA1A 4FLRA 3SQLA 5F2GA 3SSJA 4DYJA 1K7FA 3ISIX 1R38A 4EXAA 3MWCA 2PGFA 2QVHA 4REQA 4L65A 4NAFB 4ZXOA 1AD4A 3AMGA 2AGTA 3CASA 2Y88A 2G96A 1I0BA 3KXQA 2VC6A 3O6AA 3G8EA 2C71A 1OF6A 1QASA 3I68A 5JMUA 4RE3A 3GH5A 1I2PA 4EPEC 4EPKA 2PI6A 4DWSB 4GGHA 3WJSA 2P50A 3B8VA 1A5NC 3B4UA 2A6LA 2WHLA 1A47A 4PMQA 4UTFA 1EQPA 4M7TA 3RCNA 4AMCA 3Q37A 5A3HA 1TWWA 1FHVA 1G69A 3G1VA 1ZP3A 1OD8A 3LGGA 1FXQA 3U5UA 2OT1A 5EY5A 2D0HA 3ONCA 4LVGA 5D33A 1E0XA 2QCDB 1MXGA 1TQJA 4GGBA 4MJMA 1SJCA 2D0GA 3CV2A 2NXIA 2R1LA 2XPKA 3C2EA 2EKCA 6A3HA 4OWGA 2OX4A 3GNNA 2PWUA 3VOJA 5C9ZA 1ZBVA 3CT7A 4NILA 4PCFA 4XKMA 3SUUA 4LU0A 3G3DA 5AC4A 2ZA3A 4CLMA 1ZBCA 1KV5A 3NL2A 2OEMA 3OIHA 2YLLA 4NRRA 3LHUA 1B3XA 3VINA 2W62A 3N2OA 5HAOA 1E4IA 1OFAA 1QW8A 2JF7A 2ATMA 4CN4A 3QPYA 1I0DA 3PWGA 3UGRA 4A35A 1CXLA 3HV9A 3XIMA 2WHMA 1W0MA 5I23A 3DC8A 1W3TA 5F2MA 1V8EA 4WKHA 3MDUA 2JGYA 4KGJA 5DLCA 3GTIA 4DJEC 1QOXA 5IDZA 2AQWA 2V5BA 3NOEA 1M04A 4MY8A 1SVDA 3USBA 4LYRA 3CWHA 3LCLA 4LSBA 1EEXA 1JYXA 4NQ1A 4ORIA 2YYUA 1US0A 3G3MA 4M51A 3NPWA 5DEZA 4GFSA 5G4HC 2WZEA 4YYCA 4DNHA 3VOFA 4GQQA 1LP6A 3H53A 1UHVA 3QH2A 2XN1A 4MJ2A 2QLYA 3W4RA 1M9HA 2BZNA 3KRSA 2VGGA 4J9JA 2EO7A 4E2DA 5I00A 2QJMA 5JBDA 1AJ0A 3WBEA 3HMJG 3LHVA 5H1WA 5FESA 1F8IA 4ZOBA 1LZOA 4C6FA 3BAXA 2PLMA 1M68A 3F5LA 1V6YA 2OODA 1TPUA 3T4WA 4Q8QA 3R58A 4NNBA 2YW3A 4AWSA 5CBJA 3PUEA 4S1FA 4ALDA 3MW7A 1I75A 3T2PA 3FKRA 3EDDA 1EJWC 1QI4A 3CHFA 3DHUA 2C13A 2YBVA 1RBOB 3BMWA 4C1NB 1IT8A 2V3DA 3QBUA 2PWDA 4MF4A 3HFYA 1CW2A 1NAL1 3RITA 1JZ8A 3KCLA 2ZRXA 3P80A 4XTDA 3IK4A 3QZ6A 4C91A 2DT1A 2Z00A 4MTVA 1F73A 3JZUA 2CHOA 4M1BA 3H54A 1EP3A 3W2UA 3WLNA 3PBVA 4U28A 3IGSA 1WXZA 1DORA 1RJRA 4PMOA 3U2ZA 1GHRA 4QJ5B 3WLJA 3VGDA 2R8WA 3ARRA 2OT0A 1E6XM 2Y2WA 5M5DA 4CEXC 1XCFA 3W7HA 4ZQOA 4H9YA 3HPXA 4LCSA 1VFHA 1X6UA 4HA1A 5L9FA 3IRDA 2E09A 4HA0A 3CO8A 2DH2A 1OX4A 4HK6A 1UIPA 3QOKA 4R7WA 3PAOA 3V35A 1PWLA 1H1NA 3G1DA 1R3WA 1LQAA 4GG9A 3TYCA 2Y61A 1R3SA 1S1RA 4ZQCA 3PTDA 1SM9A 5EMJA 1Z41A 4UIOA 5J8LA 5A6TC 2V2HA 1D8WA 4Q8MA 3VD4A 1R2SA 2CXGA 1EXBA 4UNIA 4BQ4A 2DVTA 2VFHA 3VTRA 3WLMA 9XIAA 3A9BA 4EF9A 1WO2A 3P0WA 2XVKA 3SUSA 3SCTA 5F4SA 5AECA 4MVAA 4PL2A 1G9HA 2MANA 4ZODA 3CLWA 1XKYA 2XVGA 3TAOA 2ANUA 3CQIA 1E6QM 4RR4A 4HMNA 3W1RA 1XM3A 3EZ4A 1XD1A 3B0VC 3WDPP 2NT1A 1KB3A 4TX8A 1R9YA 2H8XA 1R2RA 4LT9A 4H7ZA 1WE5A 4ML4A 3IJ9A 3FXGA 2XFWA 3CC1A 2FJUB 3N2TA 4MY1A 1E0TA 4JKLA 1YTEA 4YVXA 3W85A 2XN2A 1GVOA 5DMNA 1NU5A 1M3UA 4W5ZA 2MUCA 3UQNA 1V0NA 1YPXA 2YDSA 4B9YA 2DFAA 2G8ZA 2ICSA 1K4HA 3H21A 1E3XA 1F76A 4RZ5A 2C1HA 3UR2A 4WSHA 3QSTA 1ZQ5A 1U22A 4IMEA 3QPZA 5H91A 1V3LA 3R89A 2B31A 3GW3A 3HG3A 1ONWA 3HPFA 2ABBA 3NO3A 2IQ0A 1F3WA 3L5MA 4O8RA 5BWAA 2Z1XA 1HQTA 2PDXA 4AIUA 4GC4A 2J7HA 3VNDA 3WJYA 4QJ1A 2VKZG 1J0IA 1FWCC 3M16A 1GT8A 4R3UA 1TSIA 1TJ2A 3UR8A 4CQDA 2FZDA 3C52A 3AIQA 3PZTA 3G0UA 3FIGA 2J8TA 1W54A 1VFFA 4DYKA 3OEXA 2Y8UA 2B7PA 4XVDA 1G4PA 4GUHA 4MWAC 1A49A 1JJKA 5ABFA 5HWNA 1QPQA 2BASA 3ATYA 3OW1A 3H2CA 1VQTA 3VMOA 4MG4A 1JIBA 1FFRA 3W6LA 4S2CA 2PP0A 1B54A 3RPDA 3VX1A 2BXVA 1QPNA 5EMYA 4GX8A 1IYXA 1YTDA 3MQTA 3QYQA 4OVXA 4JX6A 2J77A 5AB3A 5I6SA 5C2XA 4IIBA 2OKTA 4XD6A 3GQYA 3L4VA 1GOWA 1QRQA 4WOZA 3LBMA 3WLLA 3BARA 5LYRA 3FVDA 4H4IA 1JDDA 4JYFA 2ZXAA 4DM2A 4M29A 5FACA 3KL3A 2NV1A 2BY1A 1S5VA 3BK0A 1I1WA 1K7XA 4O1BA 1IEIA 1NWUA 3NYZA 1VPYA 5BU9A 3L5LA 4POCA 5D37A 3W81A 1FOBA 3KZPA 4UXDA 1K9EA 2ZC1A 2A3HA 3N13A 3RUBL 3MC5A 1YHTA 4XSMA 3KUMA 5JIPA 4GBDA 1VLIA 1PXGA 2WXDM 3KL0A 2QDDA 4WKAA 2VC9A 3WLRA 3RDKA 3VNYA 4M81A 1VEMA 1H1ZA 5DQPA 2DY3A 5A8GA 4QAWA 4GA8A 4XZLX 4A3YA 3W7JA 4A05A 2OELA 8RUCA 3NEHA 1IIHA 2OWCA 2E40A 3TZNA 4MPQA 4NJJA 7ENLA 1SR0A 1EUAA 4M24A 4IHCA 3T7VA 4RXFA 2OTDA 1H5YA 3HQPA 4F0MA 3PPCA 4IPPA 4Z2IA 4LH8A 2YL8A 4FIQA 3PFRA 4LS0A 2L5HA 2QCMA 5FEXA 4JTCA 2ZZ3A 2R82A 1Y5XA 2F8QA 5C8BB 1DJZA 1LLZA 3WQ5A 2X1UA 4FXFA 4I6VA 4DBSA 5E9AA 4EVZA 5I3DA 1E9YB 1CDGA 3BLDA 2PTDA 2ACRA 4R88A 1A5SA 3SUTA 3GDRA 3BDKA 2G4FA 2ZRVA 5AHEA 3QC3A 2UV8G 4LV9A 3KRUA 3S83A 4HNTA 2J6XA 1BVZA 3PUOA 2AAAA 3ZJ8A 2QIIA 1VFLA 1M7PA 4FA3A 3EWXA 1XYLA 1PDZA 1DQUA 1DJYA 2ZX5A 1QW9A 1UBSA 1EX5A 5EPDA 3SY8A 4GNVA 1QI3A 1EUNA 3THQA 1UZ1A 1A5KC 2OSWA 1WZLA 4J3WA 2VEFA 4BA0A 5AHLA 3Q65A 1LOSA 3UJSA 3AFBA 3EA2A 5LNRA 3VC5A 2XU2A 1MNZA 2OZ3A 3VIGA 3LGDA 1ZCOA 1UA3A 3THAA 3JS3A 1QATA 2Z1BA 4XBKA 1S5MA 3RMJA 1E73M 1V3IA 3M44A 3KS5A 4H7VA 4QE5A 4IL0A 4H83A 2PRHA 2QV5A 1QNVA 3UYIA 4FAMA 4KS0A 3WDQA 1NQKA 3FHAA 4XQ6A 1RV8A 1YTKA 1Q6QA 1X38A 3W6YA 3O16A 3H4XA 2YFNA 4A8RA 1EOMA 4BI5A 3JZEA 4A8LA 4G1KA 3N6HA 2JKEA 3H4GA 1QI5A 3E02A 3M41A 2AL1A 3QQ0A 1GVRA 2XSBA 4WCJA 1HP4A 4LYQA 3FCPA 2WKLA 4N9DA 3S6TA 4W85A 4P5UA 2OR2A 1HUVA 1OJXA 2HCVA 4JY8A 4K39A 2CZEA 3ARUA 3AYTA 2VRKA 2EEXA 5LNSA 1W91A 2ZVIA 3D0CA 1I2QA 4BF7A 4EOUA 2GLKA 4WDUA 5DBTA 4JR5A 4ROPA 1H50A 3UR5A 3OBKA 1KBJA 4H9MA 1FWFC 4MB4A 2JK2A 2QKFA 5H6HA 4ZXLA 2WJFA 4PUNA 4RL3A 4GMEA 2RJHA 2XISA 3AUJA 4R5EA 3B0YA 4WIWA 4ERAA 4KRTA 4PGLA 5A1AA 4CCCA 1TPH1 4QLLA 3LI1A 3CV7A 2DV0A 1OFPA 1E43A 1U33A 1SZRA 1JUEA 4HT3A 2INZA 1E1EA 3C6CA 2X2YA 4ZO9A 4V27A 3DBPA 1LBLA 4H6KA 3L4XA 3EDEA 4O11A 2WC3A 2VGFA 1KNWA 1T6MA 4C7FA 3QJAA 3MCMA 3KCOA 4JIIX 4HK5A 3WLTA 1V4YA 3A4JA 1MUCA 4FF7A 2D73A 1PTGA 3ENLA 5I09A 3MSYA 1E9LA 3J7HA 4F2TA 1FRBA 3GW0A 4UB9A 4UCFA 1VZWA 1R47A 4Q8OA 4YHEA 4DF0A 1H49A 5RUBA 1HJVA 4V2XA 4YTQA 1LLOA 5TBOA 3OVQA 4Y9PA 4AEOA 4ZE4A 1LT8A 2Q6ZA 4JGDA 4C7GA 3B3DA 5A6JA 3GLCA 2VVNA 4KRZA 3E2RA 3T8LA 3BAIA 2FTPA 4S3GA 2AMXA 1KWKA 3GFYA 1OFDA 4MNKA 2R14A 3EB4A 3QEZA 1J2BA 1J9YA 1FDJA 4J3ZA 4MLJA 1TA3B 2C1GA 4Y90A 4BZYA 3SRKA 2I17A 5G1MA 3H2AA 1NWRA 4LUSB 1ZJAA 3AXHA 4BEUA 3S5OA 3IAQA 1EP2A 2ASHA 3AROA 3VMPA 1MMFA 3WH7A 1HL9A 4CNPA 2PDUA 1WKFA 3ARZA 4Q8UA 2EGZA 3CT2A 1XDLA 2GYIA 1FDYA 1NP2A 4LY8A 1IR2A 5CG0A 1J8VA 3MYOA 1GW9A 1VIZA 5TD4A 4E38A 4E4UA 2PWVA 4HPHA 2QS8A 1KRMA 4JIRA 4AHQA 3N1AA 1R0MA 1GOOA 3SY5A 3KRZA 3I6RA 2WVUA 3NM3A 3KTSA 3NGFA 4JIEA 2Z25A 2YCEA 2WOQA 5CGMA 1IGSA 5CG7A 2W61A 1BSLA 2BNJA 3WFLA 2QQ6A 3NG3A 3MP5A 3GIQA 3EEZA 1P6BA 5A2BA 1A0EA 3NYDA 1GGOA 4FEZA 4K2SA 1XLLA 2FGBA 3SCUA 4TMBA 3TTOA 4AFYA 5DELA 3A21A 4GUJA 2ESCA 1J4EA 2NLIA 2H3DA 2PUZA 1FXPA 4NZ1A 3RILA 3BLOA 1ZNNA 1RD6A 1Q2SA 4IMAA 3K8MA 5FF2A 1QWGA 5HNTA 3WD3A 1YW1A 1ISVA 2EPHA 4PSPA 3IJDA 4AW7A 4XV0A 2XGIA 4G56A 3S2MA 4DLMA 3VILA 4LAMA 3L7RA 5AKQA 4S3BA 3M1ZA 2PTZA 2VEKA 1RZMA 3LX9A 3NJ3A 4S2BA 3WCZA 3U2EA 3ABRA 1SGJA 3GVWA 4H3DA 2WHKA 4V15A 5D9OA 3M43A 3FKKA 4LRSA 5HMFA 3SCVA 2FMNA 2E6FA 4NU7A 4RX0A 1ZJBA 3NQVA 3TR2A 3UD6A 3FAWA 1IEWA 2WZMA 1UOZA 2VM8A 3AYSA 3B8WA 5AFDA 1PKNA 3N9SA 5E9XA 4OUIA 3W28A 4A3UA 1K9FA 1PDYA 1VEPA 1MQQA 2WWCA 1H7XA 2A2IA 3L2LA 3R0UA 2ZICA 5PTDA 1TWSA 4FF5A 4JFVA 2YZ5A 1KQYA 1ME8A 1MFUA 2E68A 3NDZA 1UWQA 4ADTA 1TV3A 3RMEA 3URQA 3M47A 4A8IA 1XD0A 4O12A 1JGMA 2F2HA 5FEWA 1G6CA 3DHPA 4K8EA 2ZKMX 4L6DA 3WUGA 3RGTA 5KTLA 2IW0A 2R94A 3OVGA 2Y63A 1TPDA 3NM1A 3E0VA 3P60A 2NX9A 4TVDA 4XKYA 5HJYA 4HJWA 3TQ0A 3GNOA 4Z2GA 5F2LA 3Q4DA 1IF2A 2J7CA 1F3TA 4ES4A 1QAPA 4TUFA 5T9CE 4RK8A 2GDVA 3GTHA 2EJAA 1P43A 1UZHA 5BCAA 3T0DA 1HKVA 1Q7MA 4HB7A 1M03A 5IM51 3UZWA 4GJIA 3LUTA 4AHOA 1V02E 5BMWA 2XSAA 1PX3A 4FXRA 4PRWA 4Q3MA 1TQXA 3S6DA 1MRQA 3BXWA 4DAIA 3OHIA 1VCGA 1F74A 1G5AA 1NFGA 1CLVA 5JUVA 1D8CA 1X1ZA 5D03A 2PBGA 3I6EA 3R8HA 1X98A 3R10A 1CYGA 3I3DA 2DUAA 1FKWA 3INPA 3SGZA 4HSHA 2GGHA 1QPRA 1XW8A 4N2YA 1A5MC 2ZWYA 1JPHA 4IUOA 2Z2BA 5CSSA 3WMBA 3AZRA 3URNA 4Q7BA 2Y85A 4K1GA 4DEFA 4UQEA 4WY0B 4GQBA 5CZKA 3HURA 3LGEA 3SECA 4I5UA 2Z2AA 3L2IA 1EB3A 4JY9A 3CGTA 3WELA 1EH9A 2DPEA 3CZ8A 4F9JA 3MKKA 5CPLA 5DFAA 4OOZA 1SZGA 2AL2A 5E1QA 2GSEA 2XJ7A 2E9LA 1GOMA 4WXYA 2AOSA 2PLCA 1ECQA 5JBEA 2NQ9A 1FHLA 1UJQA 3L66A 1X8CA 4HGXA 4JTGA 4R34A 3QFWA 1LOQA 1TR1A 3NQGA 3CNYA 4M6PA 4C1LA 3VIIA 3I10A 3IJQA 5EA9A 1GJPA 3AIUA 3SRDA 2ZTKA 2BVDA 3GYCA 1UKTA 2P76A 4X0NA 5HWJA 5AC8A 1LT7A 2PP1A 1A5OC 3TJXA 1JEZA 3TK7A 3TX9A 2PRLA 4IG2A 3H4WA 3S6OA 1B30A 3ITLA 4CCEA 4KCVA 1HJWA 3CIXA 3NFUA 1LTDA 2X2GA 1V7AA 1AH0A 3A24A 4TR9A 3V7PA 3I4KA 3FJ6A 3H2MA 1M01A 4DXKA 1OT1A 1PZ2A 4AG0A 5DRIA 2ZCGA 4XVEA 3MA8A 3S9YA 5F1UA 5I3JA 3FA4A 4XAGA 1UUOA 3KOZA 4LNCA 4YMZA 4NYYA 4C65A 5B80A 3QGKC 3UG3A 1HGWA 4UOJA 4O28A 4LAOA 2ZE0A 4DPPA 3HTWA 2UY5A 3V0UA 2XDFA 2D3NA 2EBNA 1E0VA 1JG9A 1JPIA 1L8PA 2H9AB 4L4LA 1YDOA 1XCXA 1MZHA 2FDMA 4PODA 5J5DA 2C8NA 1EKOA 3CYJA 1DQXA 4J3TA 3W2JA 1DE6A 1XGEA 1XXXA 2QCDA 4ZVJA 3U4FA 9RUBA 5EFDA 1EJUC 3CB8A 4M0XA 5T26A 1QOPA 1JVNA 2XINA 1N55A 4JTFA 1JPKA 1V0KA 4OOUA 5KZDA 1EYWA 4YPJA 2RH9A 2NSXA 3E5BA 1BYCA 3HG4A 3UFYA 4JEQA 4DHGA 3T40A 3IGHX 3WJWA 3BLIA 4H9ZA 1Z69A 4RZ4A 2KAUC 2CLOA 3NL6A 3BOFA 2HSAA 2ISWA 4CNTA 3O9NA 2OLAA 7REQB 3KWSA 1U5JA 3UZZA 1NEYA 3CPUA 3CLMA 1K3UA 3WX7A 1V02A 1WZKA 4GH1A 3GXIA 5FL0A 4D9PA 3N6QA 4XAPA 2WVSA 3IJ6A 1KTBA 4PN2A 3NR0A 4G1NA 1AQFA 1LM1A 3GG8A 2WV8A 3QVQA 3W3OA 1QI0A 3DG6A 3DFNA 6PTDA 4GNKB 4KCTA 1KFCA 3W02A 3W76A 3OBEA 4QIUA 2OX1A 1S3TC 4F0SA 3NVDA 2BHUA 5M17A 1DJHA 1SJAA 3ZT7A 3WD1A 3QF0A 3OVPA 4XIMA 5AVHA 4XBSA 1UR1A 5HMDA 5HR6A 5HOSA 3N73A 5DXYA 4LUIA 2A21A 3P6LA 3QV8A 3WBYA 2G3IA 2XG9A 2RGLA 1Q8JA 1W31A 3U3HA 2VX6A 3WQFA 1FCUA 4MWAB 3AXIA 1DTUA 2X1IA 4XSLA 5HULA 4C6PA 1TV5A 4WSKA 4QSFA 2ZUTA 2ZX8A 1KA9F 2CKRA 2ZA2A 3O15A 4FSAA 3SJNA 3C0SA 4QDWA 5FCZA 2ACQA 5U7SA 4DQWA 4R9OA 3WLHA 1GUVA 3RRXA 3HPAA 3AU6A 3SCOA 2QUNA 4QDPA 1XH0A 4UQAA 3WLPA 1V6TA 3T81A 2Y62A 3MBDA 2Y7GA 4P8XA 3FXYA 3THUA 3T78A 2GSJA 1C9WA 1KD0A 4XB3A 4MMWA 4N02A 3VFCA 4Q6XA 3NL5A 3DIPA 4LV4A 2OEJA 3U7BA 1EGZA 1UUMA 3B0XA 5K7JA 2Z7KA 1KLZA 4LS2A 4GQ0A 3QOMA 1W1A1 4I5XA 3MZ2A 4U2YA 1B4KA 3DFTA 3QYSA 4GZ7A 2BGSA 3S1UA 4KH2A 1YDNA 2QT3A 5CKSA 4WGHA 4BQ2A 2GJRA 3CQHA 3VNIA 5CLWA 4D71A 4HKPA 4JTQA 4UC5A 1UWUA 1D9EA 1TV4A 1DKWA 2ZUVA 3PUDA 1OT2A 1TV7A 1UD6A 4HJFA 3TYUA 4C6QA 1UP2A 4PUJA 2X40A 5MKGA 1UASA 1OCQA 2WZHA 3PR2A 3IVTA 4A2SA 3PZNA 3C86A 2NLYA 1KTNA 1XBXA 3M0LA 4OE7A 5TNVA 1PE1A 7TIMA 4NVTA 4HCLA 4Y7EA 1RY8A 4CD4A 3PG8A 1EHNA 4NUWA 4PMDA 1POJA 1US3A 1O68A 2GQ8A 1SZNA 3BICA 4ERIA 3LQGA 1VB9A 4AXNA 4GIAA 1M65A 1XSJA 3R8RA 5T91A 3MKCA 1KCZA 3KLKA 3FSUA 1TZZA 2NT0A 2WMFA 4AYSA 4JNYA 4DRSA 1LUCA 1TELA 1OY0A 3ZT6A 3K1GA 1GQIA 1POKA 1X1OA 1O12A 4UTTA 1XLIA 1XRFA 5I77A 1XBZA 1T41A 4FR1A 2GUYA 2WSKA 3KW3A 4IPIA 3IIXA 3AIBA 3L0NA 2XSXA 1MW2A 2DDXA 2VTFA 1BTMA 1BF6A 3APGA 4V1YA 3WF3A 4Y9AA 2PURA 3QR1A 1C92A 1HJXA 2ACSA 1C91A 2EPOA 3KEHA 1A5LC 4AD2A 3P3BA 4OZOA 3I3EA 4BFAA 1WOBA 1JZ7A 3U5YA 3F2DA 3P93A 2TPSA 3GDTA 1I2NA 4LJ3A 4XD5A 3WQOA 2AMGA 4EPBC 3WL0A 1W1PA 2VWTA 4JTRA 3UWVA 1T7LA 2HMCA 1OGGA 2E28A 3THCA 3URAA 2B7NA 2PD5A 2EPLX 4QNWA 5CSYA 4JKMA 3UZYA 3W1AA 3WNOA 4US6A 3TVAA 3OIXA 3LXBA 2QCLA 4JL2A 2ZTJA 3EWBX 1B2YA 3EWWA 1GZ1A 2E77A 4GWEA 4PBEA 4AZCA 2PDFA 2O0TA 3N18A 4GZEA 2W67A 3NQCA 1OC6A 4B9ZA 2BVYA 2F7FA 3UJEA 3ZVIA 4NXKA 3VK5A 3W37A 3M5VA 4HNLA 2WNNA 1G94A 3BG3A 1JZ6A 3GVRA 2BY2A 1JYVA 4DX3A 2GOUA 3OLEA 1AZ1A 1NH6A 3TFCA 3KP1A 4RNJA 2XGBA 2F84A 1CZ1A 4JTIA 3ZLFA 4UBPC 2E8ZA 1JNEA 2A0NA 4Q7IA 4PRRA 2OZ0A 4XWUA 4JHZA 5D2YA 1V3HA 3CAWA 3UJFA 2J7EA 5I79A 4QDMA 2BX7A 4ZSTA 3WDJA 3E0IA 1MDRA 2OKOA 4MHBA 1V03A 3SRFA 2C1IA 2OSXA 2RFGA 3VI2A 3MSRA 4BI7A 4J1OA 2Z28A 3U8GA 4XO7A 3H8AA 1VYPX 3NZRA 2PGEA 2X41A 5HNUA 4JICA 4WEVX 3W27A 4IQLA 2WW5A 3CEUA 1GWJA 4QROA 1O1ZA 4J3VA 4W7UA 3IJ7A 1VCVA 1EJSC 1RHCA 1OX4B 3TYEA 4AB4A 3QQWA 5IHSA 3GNRA 1XIBA 4L7ZA 3T08A 2WAGA 2ZX9A 2QGHA 1H1YA 1E71M 2BFGA 4OIFA 5JVLA 2YBUA 1PTDA 5HXMA 2JALA 5DMMA 3DESA 1F9CA 2IPJA 4FALA 5DMYA 2ZZ7A 1JFXA 3R1ZA 4UR8A 1W6TA 3SIZA 4FNPA 4FNTA 3BO9A 4PUKA 4DLFA 1HIZA 2GOKA 4OTKA 2PD9A 5G4EA 3TCEA 5GPRA 1K77A 5C2GA 2NQ5A 1KBIA 1XUUA 4W93A 5E6ZA 3QPEA 2J62A 1RSCA 3KOXA 2QAFA 1CGWA 2VQTA 1LWIA 1SFSA 3TTYA 2B7QA 5HQMA 1X96A 1V93A 4PMRA 4S3DA 1PKYA 1HP5A 4KMQA 4CN6A 2WC4A 3WQVA 1UIOA 1NOWA 2HZGA 1ITQA 4G7EA 5HK4A 1YPFA 5FKYA 2FZMA 1CXKA 3JVAA 2RHGA 3S42A 3VNKA 3K4WA 1XL9A 1X7IA 3SGGA 4E2OA 2XTKA 2QZRA 4DI8A 1F61A 1XV8A 2W27A 4WJEA 1MSSA 3ES8A 4JQ3A 3VD5A 1S5NA 4AY8A 1A3HA 3M0KA 3QHOA 2WMGA 3GZAA 1B5TA 1D3CA 1KXTA 2EHHA 1TCMA 3KHDA 5I3GA 4QX4A 3VKDA 4O50A 4HNCA 3FS2A 1FVPA 3WDRA 4DJDA 4FNUA 4UFLA 2E3ZA 1RD5A 3IUDA 2C3ZA 3HA1A 1GOIA 2CC0A 4ZENA 3CPGA 3TNBA 3WNPA 2PC8A 1EBHA 2Q02A 3LB0A 4FZIA 1EC9A 4ICNA 3UR7A 3CQJA 3B8SA 4XD3A 1GVFA 3AYVA 1UOKA 3CL6A 2POZA 2QNEA 4BF5A 1BRLA 1UR0A 1RBAA 4WRHA 1P48A 4AIEA 3PC0A 3VMNA 1U1JA 1H51A 3ZR5A 3QKEA 1GQKA 5REQA 2WSPA 2YCKX 1B4EA 5AC5A 2G41A 3PF3A 4IUGA 4L9XA 4C5YA 4F40A 4XISA 2E0PA 3TJLA 1MW0A 1ISWA 2WLZA 4ATWA 1EF3A 2ZUUA 1SZFA 1HO4A 5D8ZA 1OADA 3TNOA 1XIJA 3EOUA 4F2BA 3SDOA 3UGVA 2LLEA 5HMEA 4S3JA 3OZPA 5ABFB 3WH8A 3WIJA 3PSVA 4AD5A 2G3JA 4MOZA 5BWFA 3C0LA 3SM0A 3WQPA 3ABSA 3CYVA 5CXPA 2I5GA 3GG7A 1QOQA 1BYBA 1KXQA 2QGYA 4HPNA 1KBKA 1BKSA 3M5ZA 3QY8A 2GVJA 4HPXA 4GQGA 3TYAA 1JPMA 1AW2A 3GXPA 1X7FA 2VJXA 3Q45A 3QY7A 4B5XA 4Q8TA 2WQPA 2REQB 2F2KA 3EXRA 2PTWA 4QM1A 1OEPA 3MMDA 1GJWA 1O5QA 2JE8A 1I1XA 4GXMA 3GXMA 3NSNA 1H60A 4MSSA 3WK0A 2D20A 5C70A 5JU6A 4NJGA 2G5WA 4CQCA 5HINA 1FWRA 1TJ0A 3W9ZA 3PWIA 3AUOA 1H7RA 5DCBA 4Z2KA 1THFD 2W92A 4KWWA 1MVYA 3VKAA 1ICQA 2AQVA 5LA1A 5SWUA 1OZMA 1B31A 3IUHA 3RCMA 3WG6A 3MVIA 3VAVA 1M41A 4MUZA 2X1RA 1XIGA 2FHCA 1H41A 1XLHA 1YBQA 1KV8A 4NSBA 2VEPA 3RU6A 4DZAA 3QN3A 1L8NA 4GUIA 4PMYA 3RR1A 3GHTA 3IIVA 4FOKA 2I9UA 4C6NA 3VDGA 2F38A 3R79A 3UESA 2FJKA 1JDCA 4XZBA 1UKSA 5LIWX 4TVUA 1XLBA 4UTLA 4S38A 1J5SA 3KOFA 1C29A 4X9SA 2BWGA 1VJZA 3W53A 5D4YA 1XBYA 1QHZA 3N2MA 4IP4A 2P5NA 2YJQA 4GVGA 3ARTA 1Q66A 1NWSA 3H7UA 2PPGA 2VX5A 1E5NA 4FOUA 2V81A 4JIQA 1ESWA 1GJUA 3K4AA 4NASA 4B5SA 4Z42C 3G18A 5G4WA 1A0DA 3TQVA 3RYSA 1IE7C 4RW3A 3HJZA 1YMYA 3A3HA 3NO5A 4JD4A 2Z6IA 2O55A 4GJ1A 3RX2A 3VKJA 4C60A 1GORA 3MUY1 1XRSA 1BWKA 4UZUA 3TFXA 4RZ6A 4O54A 2VZVA 5E6YA 4QQ3A 3SJ3A 4LVFA 2X8RA 2YYTA 4KIRA 5FF7A 1VR6A 1ZTVA 3EKGA 3QY6A 5A95A 4I7UA 4PUDA 1VFMA 2FYMA 1SJBA 4PEEA 5LIXX 1YXYA 1O6IA 1UKOA 4KEUA 1XYZA 3VDCA 4CEUC 1F6KA 4I7WA 3OZOA 1ZJIA 3C56A 1QNPA 3PVFA 4GOAA 3LS9A 1DIKA 4I6KA 1XISA 1RJQA 3EGJA 3KBSA 4GFIA 4UQBA 4GY7A 3WD0A 5E5CA 4DXVA 4U3AA 1AVAA 1F05A 4P7QA 3W72A 1KFBA 1WCGA 5BRBA 3OLDA 4DF1A 5I3HA 1V0MA 1V3MA 2A7NA 2WHJA 4KKXA 3FV9A 3KLLA 1ZZMA 5CZTA 1A53A 3UWQA 1M7OA 3DXIA 1UBPC 1KBLA 1CT5A 5JBFA 1WP6A 1G7UA 4X61A 3WMLA 2QVNA 4PCSA 5KMYA 1KCLA 3TN3A 4YJ5A 1US2A 3GB6A 3LOTA 3PWAA 4MGGA 3KE0A 4PL1A 4CD5A 3LSCA 2XZ7A 3NL3A 2FH6A 4HYVA 2DIEA 4K38A 4AC7C 3TYBA 1ITCA 1HJSA 1TX0A 6XIAA 2CLKA 1GPFA 1JRBA 1O4UA 4JTKA 1P6WA 4R53A 2HXUA 4L9ZA 1EJTC 1ZGDA 4JFTA 1DXEA 1YNPA 2NVCA 4CU7A 4GBUA 3MANA 1Q6CA 5DO8A 2DZTA 3MO7A 1QU4A 4UFIA 1MW3A 3VOIA 3OB8A 3EWUA 1VH7A 4CU6A 2O56A 4LF1A 3U2CA 4I3GA 1C7TA 4IP5A 5E70A 3W01A 3VE7A 4Q4KA 2CBIA 4HOZA 3I6TA 1IXPA 2ZFAA 4Y9NA 2CERA 1H7OA 3B9DA 4W86A 3LCGA 3BLPX 3ELFA 3T44A 3CH9A 4GI9A 3GDMA 3AS2A 2GQ3A 2PLJA 2UY2A 5ABHA 3KBWA 2D2OA 4MZYA 3FDGA 2HNHA 1S5WA 3ITYA 1H63A 4W9TA 5AYIA 1O95A 3WBAA 3GK0A 1FKXA 4UNLA 4DJED 3FVMA 4ZBCA 4AD3A 1V51A 1CXIA 4QP0A 1SMDA 3CZLA 2E5BA 4DELA 4GH3A 3POHA 2DT2A 3WK2A 1WQ5A 5CPMA 1BGAA 3B9NA 5K9CA 4BK9A 5CAKA 2YL6A 4DJEA 3H7VA 2E5DA 3KS6A 2C0AA 3E0FA 5K9DA 3G1SA 4GHRA 4PTDA 3R12A 5A6SA 3IVUA 2D69A 3B97A 4UTKA 2C7FA 4HHMA 3ZR4A 5C0QA 2VMFA 3MT1A 2CLHA 4BS0A 5K9XA 4PMJA 3QGVA 4MDOA 3PZOA 3AMDA 1IT7A 3FJLA 4PMVA 3S1VA 3TSDA 4V28A 1FH9A 3W1QA 1TRDA 3H12A 3BQ6A 1RA0A 4UMBA 5CBBA 4LTSA 3STFA 1FWEC 3AIVA 4FXSA 1K6AA 3GRIA 4K68A 2YIHA 3TLLA 3SB0A 4AD4A 1QNRA 4GX9A 4XUYA 2Y89A 2Y24A 5K4ZA 4F0HA 1PKLA 2OGJA 3DYOA 1CLXA 2A3CA 1KGUA 1FWHC 3TMLA 1UB3A 1CNVA 2WVTA 3QTPA 1REQB 3EX4A 4JDBA 3LPOA 4LNYA 1Q2RA 1GVQA 3NQ2A 2ADAA 1YXDA 1P4CA 1W1YA 4DJDC 3ZJKA 4MUPA 5EBAA 2HXTA 3MY9A 5IFTA 3GVQA 1J6OA 3WJXA 1QR7A 1VC4A 5HJLA 1WKDA 3AICA 4L64A 3M5YA 4JTEA 2E25A 3ZR6A 2OSYA 4WGXA 1DE5A 4X63A 2ONEA 3UVIA 3U57A 1AK5A 1ZBKA 2I16A 4GIEA 4Z1AA 3W24A 1EA0A 3IACA 4JFUA 2SFPA 3FYYA 2BXYA 3GTXA 4DB7A 4EKJA 3K5XA 4PUWA 3UZXA 5D05A 3FAXA 3CBWA 1UQYA 2FPYA 2OYKA 3NA8A 3BW4A 4E2BA 4IPNB 3HG2A 4J2PA 4PTWA 1T8XA 4WY0F 4D6JA 3BSMA 2P88A 3UP8A 3UWUA 1FA2A 1G7VA 4IMDA 2Y4SA 3S2NA 3VCCA 1S39A 4NY2A 4UUIA 1PHQA 1C9DA 1PJ9A 4MKSA 1DJQA 2V30A 1UD3A 5GNXA 3MPGA 1VYSX 4WDWA 2BGQA 1MXDA 3NPXA 1ADSA 2DZWA 1EJXC 5KZ6A 5DF0A 4YTUA 3H2EA 1CBGA 4LEFA 3G8RA 1F2JA 2E7FA 3TZFA 3O8AA 1Q6DA 3CQ0A 3GC2A 3TLQA 1OFQA 3GKFA 2YX0A 5J04A 2QAPA 3UXAA 4A22A 2INFA 3G2GA 2V5JA 4R7JA 4X2PA 3EEGA 4DY1A 2UY3A 2RUSA 2GVGA 2NWRA 3CIVA 2B81A 1NQ6A 1Q13A 1NFBA 2PGRA 5AHMA 3OQEA 1YNQA 1VLWA 3WMCA 3G77A 4UFJA 4PFMA 1KC7A 2VX7A 3JU2A 4Y2WA 3PTMA 1W5OA 3SCPA 4LBUA 3V0SA 4E4FA 3LG3A 1UR2A 2FQIA 3CTLA 1CGTA 3BG5A 4GYPA 3S47A 3W0KA 3TSMA 2PP3A 7REQA 4ZOEA 3ECQA 5LNWA 1PYFA 2ZYFA 3ATZA 1HKIA 3CL8A 3TW9A 3O05A 4KCUA 3PFMA 1E6SM 4N4PA 4S3EA 3GH4A 4V1XA 3I7QA 2RGMA 4UTWC 2QULA 4DUVA 1D2KA 3KFTA 4MB1A 2Y5JA 2WBGA 1E1CB 5I7GA 4OU1A 2P0IA 1C90A 4L1WA 1MUWA 4J3SA 3KP0A 2J47A 3IV3A 1VBGA 3VIKA 3T07A 3TEVA 1UKPA 2INEA 5I78A 1PX4A 3SCSA 3S3GA 4RNFA 4Y9MA 3CH0A 4R33A 1MQRA 1J0YA 3ABOA 2PCEA 4YNGA 3BOLA 3CU2A 3W2MA 3KBMA 4LOCA 1K03A 4WZHA 4YVVA 3OTRA 3PJWA 3I4EA 1ZSXA 5CZ0A 3TOYA 4W5UA 3EX6A 1CWYA 3W1LA 3SY1A 1EX1A 1DQWA 1GZGA 1RP9A 2A7PA 3GU2A 4MWAD 1S5TA 1E70M 2WANA 3KOYA 4FR6A 5IHRA 3LM3A 2FVKA 4IQEA 3SCRA 2AL2B 1H5VA 5H8PA 5A6AA 4GUFA 3EA3A 4AIOA 2Q8LA 3EX3A 2DU2A 4MWAA 4NIRA 3CMGA 4JZ5A 4FNRA 1UPMB 1QW7A 3DKJA 4O4VA 1OBAA 3ITCA 2AAMA 2ZZ2A 1Z48A 3CS2A 3ZLHA 2BMBA 3CZEA 4BJHA 4HCHA 3BH4A 2YL9A 4EXBA 4ML9A 3VCNA 3FYPA 3BAYA 2D1ZA 1KM3A 3VNZA 4QLKA 1C8QA 1CXHA 4IFOA 2VZTA 5GNZA 2Y7EA 6CGTA 2OXNA 2OO6A 5G5IA 2I1OA 3SO7A 4H8NA 4J27A 4ZB2A 2DIKA 2YB4A 3PJTA 3ZWSA 4M6VA 4M5PA 2Z26A 1G4TA 4U2ZA 3MJMA 3LNPA 4ZB0A 5HUOA 5LNVA 3BCFA 4GKLA 4DO5A 2WCGA 3MKVA 1W2VA 1N8IA 2H3BA 5HMSA 3GXNA 2HV5A 3EXSA 4IOTA 3CO4A 4B2DD 1O60A 4M6UA 3BVJA 2GGJA 3PZGA 1EOKA 3UJ2A 2QDEA 4QFUA 1BXNA 1HGYA 1N7KA 1AUSL 4JYDA 4LUJA 3BJFA 2Z4GA 3MVTA 2PDMA 4B2DA 2A85A 3CM4A 1M1BA 3PHAA 3SN4A 2V5CA 3KCJA 3GBEA 1IWAA 4P7OA 2X1TA 4XZWA 4WJXA 5HDRA 4Y6GA 2FFIA 2R1NA 4FO4A 3ME3A 1V3JA 2CETA 3COTA 2EPNA 4JQAA 5IRPA 3NZGA 2ZBTA 4TV5A 3VC6A 1M7JA 4S3KA 1HO1A 5A2AA 4TTUA 2PS2A 1E4MM 4H2CA 4N42A 3UCQA 1LL7A 2OQLA 1KBBA 4B5UA 4FP1A 4QRNA 3BGAA 4PB5A 1KM0A 2VURA 2BODX 2ZIDA 4JTLA 1K6WA 4P8WA 3L4ZA 2A3EA 3M0XA 2H8ZA 3QLLA 3S4TA 3ZT5A 3A6OA 2VZSA 1HKWA 3MZNA 4AEFA 2Q09A 1CX9A 3WK3A 2WJZA 1SMAA 4IFRA 3MHFA 4UTJA 2J4GA 3R0DA 4PRTA 1NM9A 5BZAA 2EPKX 1QO2A 3F4VA 1XLMA 3XISA 3M0MA 1PB0A 2DEPA 2V3EA 3BGJA 4KESA 3V1HA 3ZSSA 2B4GA 1X6NA 3BW2A 3FYOA 4LVBA 1QHPA 2ZUMA 3QR3A 1KXVA 3WF0A 2PDYA 5CBIA 4IX2A 3LM7A 3SN1A 2ZRWA 1KFWA 1MDLA 1XYMA 4Y96A 1QVBA 2CZ5A 4DWSC 2I7GA 2JKAA 3TXVA 2VP8A 4XIAA 1OG6A 4WJ8A 4AD1A 2CLEA 5A6KA 3W1UA 2J88A 4AYGA 5BXSA 1GZJA 1AODA 3HBLA 1M53A 4AZIA 2VCBA 4TVCA 1JZ3A 1PTAA 2X0YA 3GR7A 2Q3OA 3T4CA 5CSUA 1UC5A 3SFWA 3GE7A 3UY8A 2BDQA 4OT7A 3N3TA 2OMAA 2YXOA 3C2RA 4ZR8A 3RPTA 4Q8PA 2W4XA 2UY4A 3RJXA 2VEIA 3WFZA 4IFKA 3NSMA 1SFLA 1ONEA 3EDKA 2IUZA 4LX4A 1UMLA 4XAZA 3LD5A 4Q4PA 2CWNA 2QUUA 2FIQA 4JFWA 1SO6A 1QPKA 4JBRA 3VIPA 3V3WA 3M0IA 1NFPA 4TO8A 4B3KA 5AZ1A 3WL1A 5I06A 2X0SA 4KWSA 3UT0A 3GZ3A 3RM9A 3UNTA 3CZGA 3WLSA 2FB2A 4MY9A 2VC7A 3VYLA 5IXEA 1WXYA 1IZKA 4C6MA 1NELA 2RJGA 1JAKA 4QBXA 4UCGA 3HMCA 1UG6A 3HO8A 3M7SA 1VRDA 4E3TA 3RR4A 5LA2A 2OO0A 2PDKA 4KIEA 2UZ9A 3R25A 2DT3A 2EAWA 1K9TA 1H7WA 1R30A 4HN8A 3L65A 3LPGA 1TVPA 3S1WA 2G50A 3EKZA 3S2LA 3CUXA 1D7FA 3NWRA 4P7LA 2V63A 5D9PA 4EIVA 3AXMA 3NQ6A 3EOEA 3G6MA 2A79A 3DH7A 3R6IA 2YKKA 4D8ZA 1PBGA 1TZ7A 2G95A 4QJ3B 4O15A 3R5EA 4G2DA 3FOKA 3SURA 1ME9A 1I45A 4I9TA 1A4MA 1A4LA