4J2PA

Crystal structure of luxf from photobacterium leiognathi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
228
structure length
225
Chain Sequence
MTKWNYGVFFLNFYHVGQQEPSLTMSNALETLRIIDEDTSIYDVVAFSEHHIDKSETKLAPFVSLGKQIHILATSPETVVKAAKYGMPLLFKWDDSQQKRIELLNHYQAAAAKFNVDIAGVRHRLMLFVNVNDNPTQAKAELSIYLEDYLSYTQAETSIDEIINSNAAGNFDTCLHHVAEMAQGLNNKVDFLFCFESMKDQENKKSLMINFDKRVINYRKEHNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Non-fluorescent flavoprotein
publication title Structural and biochemical properties of LuxF from Photobacterium leiognathi.
pubmed doi rcsb
source organism Photobacterium leiognathi
total genus 90
structure length 225
sequence length 228
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4j2pA00
3B9OA 3B9NA 1NQKA 1FVPA 5AECA 2B81A 4US5D 1YW1A 3RAOA 1XKJA 2I7GA 3FGCA 1LUCA 1NFPA 1BRLA 1Z69A 4J2PA 1TVLA 4UWMA 1EZWA 1M41A 3B4YA 1LUCB 1BSLA 3FGCB 1F07A 5LXEA 5DQPA 1BRLB 3SDOA 1RHCA 3C8NA 4US5A
chains in the Genus database with same CATH superfamily
5A94A 2GWNA 4GYJA 2WC7A 5HBFA 3AOFA 1NWTA 2V3EA 4Z2HA 2D3NA 1UZHA 4BS0A 4OOZA 1WB0A 2PWVA 1S2WA 4DF1A 1Q6DA 2Z4GA 4J35A 1KGWA 4M6UA 4XBKA 1SO4A 1KRAC 1ZQ5A 3TYUA 2E67A 4QG8A 1YNYA 3CNYA 3OQ8A 3OBAA 2ICSA 3AMKA 5BU6A 4EOUA 1FWDC 3ZFHA 1SFTA 1TCMA 1V3MA 4HYWA 4HMEA 3VKJA 3R10A 4JIIX 3LPPA 4JFVA 3FGCB 1Q7QA 5LXEA 5LIXX 1JGIA 3UXDA 8A3HA 1DP0A 1KKOA 3PZGA 4DBUA 4JEQA 1D8WA 1EC8A 1LT7A 3LNPA 2VUYA 1TSIA 1AJ2A 1AQ0A 1J5SA 1I2RA 1BXCA 3LLFA 4WQ6A 2E9MA 1V3KA 2VR5A 3PP7A 3GB6A 3B9EA 3BW3A 2XVGA 2JF7A 2YDSA 4KRZA 3P8IA 4PMQA 4N6EA 2IXVA 1VR6A 3FA5A 1DJYA 3PZ9A 1CT5A 3MI3A 3VGGA 4GQGA 4O0KA 3RCNA 4G1NA 4V1XA 2DZVA 3T05A 3E38A 3MP5A 4GFSA 1TMHA 1YXYA 1OT1A 1EGZA 1OX6A 4LFYA 4WSHA 5HAOA 4ZQCA 3R8GA 3OQEA 4J5NA 4WGHA 4MY8A 2NQ5A 4JEJA 3GXDA 2D22A 4A35A 4EVZA 4U28A 3RCYA 3UWQA 2XHYA 4CEXC 1VFFA 3N2BA 5C9ZA 4FXSA 2XVLA 1IIGA 4E2OA 3FYYA 1XSKA 3ALFA 4PTXA 3NEVA 1Z6KA 2GQ9A 3BWWA 3NIYA 1O66A 5JH2A 1V79A 4UZSA 4XZNX 3SGGA 1NH6A 1TMLA 2R1MA 2OQHA 3U5UA 3B8IA 4O1CA 2ZUSA 1XCWA 1XLLA 5FCZA 4ZXOA 3T0TA 4QS6A 3AUOA 2DUXA 4D6FA 5B7YA 5EFFA 3XISA 2POZA 2P0IA 2RAGA 1R2TA 3VDGA 1A0DA 1QHOA 5IBXA 2PD5A 1F6KA 3N17A 5AHIA 4H3DA 4D2JA 1E51A 4JS3A 5JH1A 4I9TA 1G6CA 4IH3A 3F5KA 4KCTA 1E55A 4BY3A 1M5WA 3EX3A 4PFMA 1XLCA 2PP0A 3UA3A 4ECLA 4QQUA 3G77A 4O0ZA 2XFYA 1VQTA 5HUPA 4YTUA 1LOSA 3AWOA 4ZO7A 5FKYA 3T09A 3IS4A 2E77A 1XYLA 3WF2A 1K7EA 2TAAA 4INFA 4UIOA 2J62A 3L5MA 4PUEA 2PODA 4NJJA 4YL2A 4QIUA 2WMJA 2HDJA 3DEQA 1EX5A 4IFKA 1V0NA 1IE7C 3HQOA 1EH9A 1VCFA 1JYVA 4O18A 4LSBA 1OB0A 4O19A 1YMYA 1GQKA 2Z26A 3KL0A 3UJSA 2NLIA 3NSNA 1XPYA 1GOMA 3GG1A 3HQ1A 1E6XM 3IJ7A 4O52A 2C19A 2PSNA 3MHGA 3I6EA 3UBPC 4GO8A 4OOUA 4Z1BA 3WBYA 2C0HA 5I0DA 2GUYA 4HA0A 4AEOA 3UETA 4IIFA 1F8IA 2QGYA 2X1SA 3EX4A 1G67A 4E8DA 5BU9A 1FWNA 2OELA 3P2VA 4CN4A 1RALA 1J18A 5FIPA 1AH4A 1TPVA 7PTDA 3A4XA 2ZA2A 3CYVA 2IPWA 3C2EA 3XIMA 3OLEA 4BWLC 2FH8A 3ITTA 1UP0A 1REQA 2R94A 2PRMA 3KCLA 5BXSA 2OPJA 1ZBVA 5FAJA 4XKYA 5AHFA 4HJFA 4LB3A 4ZFMA 3MWAA 4GO9A 1GOQA 1JCMP 4ROQA 5A8PA 2VUNA 3WFAA 2ZC8A 1S2UA 1T6MA 3NUKA 3UR8A 3R94A 4B5UA 3Q58A 3ZJKA 1V77A 5I03A 2RGLA 4AIBA 3WLKX 1XYMA 2KZHA 3NWRA 2CKRA 2VYOA 4G7FA 1FCQA 4H6EA 2B7QA 4E3TA 4A2RA 1TELA 3BE7A 4IM4A 2EKGA 2BDQA 3BJTA 1DWFM 2ZX5A 3MVTA 3GNDA 4JKKA 3NVTA 1B5TA 2OFJA 3LHYA 3U9IA 1CXLA 3U0HA 5DXXA 3N25A 3S1GA 4ADSA 2QCDA 3HGSA 3NQCA 1KLYA 4UZUA 1TV5A 4G9PA 3U4AA 2Z29A 1XBZA 2OSXA 3LCXA 2FDSA 1SZNA 4PMNA 1BYDA 4M6PA 3S9YA 1BEUA 3GHTA 1FH8A 2PDKA 2GQAA 4GK8A 1GOOA 1EIXA 3IIPA 4HCLA 2GL5A 1W2PA 3W7EA 4Q6XA 3TNBA 3S9IA 4NAEA 1AQMA 3GR4A 3M07A 4KWOA 1JULA 3H12A 4GUFA 4L6OA 2V2HA 3MQTA 5CSUA 1GQIA 2O0TA 2JK2A 3CUJA 4DI8A 2P50A 4HNCA 1H2JA 3GZAA 1LRNA 5K2ZA 2WB5A 3MW7A 2ZUUA 3USBA 1HW6A 2ZA3A 4R5EA 2PWGA 2GGJA 1MMFA 5K9XA 4MWAE 3GH7A 4IMFA 4HNLA 1YTDA 3GR8A 1Y5WA 1W9BM 1XQLA 3SQLA 1IWPA 5TF0A 4KFOA 3W25A 3NJ3A 4XZHA 1XCFA 2C1IA 3MDUA 1XH2A 5I3FA 3QMRA 4POCA 4Q8WA 1LT8A 2OT0A 1AL8A 2WKJA 3PWIA 3R0KA 2V82A 3ONBA 4ATLA 3PM6A 2FGLA 3H22A 2PDIA 5DLCA 2IQTA 1CXFA 1KCLA 3MT1A 4AD5A 4AVOA 3F4CA 2J9ZA 3L0KA 3S5ZA 1SZFA 1X8FA 4F0KA 1MEHA 1J6OA 3WQ4A 2IPFA 4ZB5A 1M53A 1IEVA 3H2MA 1JQVA 1UROA 4XK2A 2Z0IA 1XGZA 1EKOA 2WCSA 4U3CA 3M5YA 1B4EA 3N2XA 5CBJA 3B4YA 2KX9A 3CV1A 5KTLA 3B8WA 1XIFA 4DBDA 3CC1A 3HFYA 4J3XA 1BD0A 1HUVA 1ME7A 4O4VA 2OJPA 4UXDA 1ZAHA 4BEUA 2PDPA 4JY9A 2PLMA 2BVDA 4TV6A 3WNLA 1CDGA 4O28A 4PCTA 1KBLA 1W3JA 3I7RA 4ZOCA 4DF2A 3VKAA 1GOIA 4XZLX 3P74A 2CWNA 4L1XA 1XBXA 1PEZA 5A6BA 2XVPA 4XO7A 4D6IA 3MP3A 1JYXA 5M17A 4QS5A 5CBIA 1XDJA 1UD3A 2PC4A 3BSHA 6PTDA 2C0AA 3EA3A 5EA9A 4IFRA 3R11A 3SQMA 5AC5A 1FWJC 4ICMA 1F6PA 1D8CA 1QO2A 4MPQA 3M0JA 1E71M 4JXCA 1OABA 1H61A 1UC5A 4JCMA 3FYPA 1Y5VA 3DFSA 1ZHAA 1Q63A 3H2FA 3H2CA 2VC7A 2VWSA 1G7VA 2QJJA 3GK0A 4HHHA 1NARA 1BVNP 2NVDA 2QLYA 4TO8A 1KXTA 1UHVA 1EXBA 1NTHA 1JL8A 2ODOA 3URBA 4C6KA 1KA9F 5C9UA 3B8VA 3SGUA 1VJSA 1ADSA 5I3IA 4N9BA 3UZJA 2OYKA 4R9XA 1G4EA 2QUTA 4REQA 3L4ZA 4TMCA 4AIUA 3QLLA 5E5CA 2WNWA 1CGYA 3A3XA 1JDEA 3RK8A 1CNVA 3G1HA 3WUBA 4XAPA 2X30A 4ZQOA 4ZZ9A 1E9IA 4MTVA 1KWGA 1K02A 1ZS2A 4Q4QA 2OLHA 3LQGA 3TLLA 1BYAA 3W0KA 1ONRA 1QPQA 1T5AA 2ALRA 3AMDA 3UU0A 1QR7A 2PTXA 1ZL1A 3LPFA 4L9YA 2R1PA 3KAOA 1R7AA 2V3GA 2VFDA 1CLXA 4XZWA 1PHWA 4N6FA 3ICJA 3UYCA 3AU6A 1RH9A 3OVRA 1GJWA 1OWQA 4O17A 2ATMA 3VDHA 4GX8A 5EMMA 1SR9A 5T8GA 3VE9A 4MYAA 3CQHA 3TSBA 3NQDA 1UOKA 4IGMA 5LGZA 1Y8BA 5FJPA 4QROA 4PULA 2E8ZA 4Q8MA 4XZIA 1TE1A 2H3BA 3FW6A 1EA0A 2NX1A 2BSLA 2UY2A 3DYPA 3P82A 1TUFA 3MUZ1 1TWIA 2ISSA 1XL9A 2DVXA 5HDRA 1FXPA 5B7ZA 4LCQA 4L80A 2XZ9A 1KGUA 1QW7A 4MJMA 4L4OA 1H60A 4GNJA 4RNHA 1TWWA 4E2BA 3WLIA 2DQWA 4IPNB 4CQAA 3O16A 3TA9A 1S3HA 4V15A 1FHVA 1P0BA 3ZMRA 1XLKA 2TSYA 1O5XA 3NNTA 1V6WA 1A4LA 1EC9A 2DW7A 1S2VA 2QULA 1VPXA 2ZRZA 4N2YA 3RU8X 3PB2A 2IXUA 5K9CA 3O6DA 2E5DA 2ZRXA 3T7VA 4I7UA 1UD8A 2OZ0A 2Q09A 1PZ2A 3CAVA 5IFTA 3MMWA 3WO8A 5G2HA 1C93A 2PFHA 5G1YA 1H4PA 1RCOB 4OGZA 4IIEA 2OGJA 2QDGA 2PZNA 2ZZ1A 2EXOA 3W4RA 4Z17A 2UY4A 3GIPA 4EANA 4U10A 1MW1A 3N3TA 3WEMA 3F03K 1G1YA 2RDTA 4W87A 2PAJA 1XLFA 3H53A 2PLKA 1GEQA 5CZJA 1CIUA 3AS2A 5TBOA 3P61A 2VEGA 1EJWC 3LTSA 4GI4A 1EPXA 3E0FA 4PCFA 1MNZA 3KL3A 3THAA 3EWWA 4QNWA 3VD7A 2VFEA 4WDUA 2B81A 3HG2A 3VNKA 1CX9A 4NZFA 1KXVA 4AWUA 3G3DA 1DJZA 1WKFA 3FJ4A 3S1VA 3VZYA 1EOMA 2J6XA 4NKCA 1US2A 3DU0A 1M9HA 1A5MC 3M44A 1SMAA 3VGBA 3MMDA 5LIYX 5H6HA 3VD3A 2E6AA 4DZIA 4YXGA 1LYXA 5G4WA 1JUBA 5JBDA 4YN5A 3KBNA 5C6MA 4JX6A 5EL1A 3N11A 2CLOA 2GUUA 1E72M 2YW3A 2D69A 7XIMA 3SCVA 3N6JA 1JPKA 1R9XA 3BTNA 2VGGA 5U7SA 3MPGA 3UZ5A 2HVMA 1OGGA 1GTHA 1E6PA 1WZKA 2HISA 1IEIA 4QNEA 1S5MA 4MB4A 3AXMA 1UIOA 1XLHA 4H04A 5I09A 4JAWA 1NIUA 1OFEA 3T1GA 5JMUA 3GC5A 1WA3A 4D6EA 3PUEA 2QVHA 3W71A 4CQ9A 3SCPA 3PG8A 3U48A 1AMYA 1HL9A 1OGBA 6CGTA 4FF7A 3CAWA 1ALDA 3K4AA 1LOLA 5FEPA 4LUYA 4PB5A 2MNRA 1ZAJA 4JIEA 1A5BA 3L4UA 1U30A 2QVNA 4HU0A 1JDDA 1KGXA 4LX4A 4UQDA 3GFXA 2R1LA 2Y88A 4H8HA 1VHCA 1KV8A 1CENA 3MYOA 1VEMA 1AQFA 3RDKA 1R6WA 4MB5A 3UERA 1AW1A 4ZENA 4CN1A 3F2DA 3MUCA 4Y7EA 1XLDA 2YB4A 3GVWA 4W7UA 4NJIA 4NZ3A 1K03A 1V3IA 3WLTA 4PE8A 3TYCA 2FIQA 1XYFA 1ZJHA 2XVKA 1ME9A 3P5YA 1BHGA 1KCKA 3L5AA 2J8FA 5DT7A 4CD6A 1XYZA 3WSUA 3ANVA 3RPDA 4GOAA 8TIMA 5AHEA 1A49A 3KWXA 2OOGA 2W67A 1GHSA 1J79A 5A6MA 3K8LA 4K8GA 4MOZA 4URIA 3BH4A 3H7RA 1SJCA 3S5SA 2PI6A 3FDGA 3DECA 1E43A 1IEWA 3PZTA 1O5RA 3GHUA 4HYVA 4XTDA 4IXXA 4ROPA 1XRTA 5DMYA 4J3SA 2QT3A 1DKWA 3G0SA 1BWKA 1ME8A 3VIFA 1B3VA 3H23A 2X0YA 3W22A 1RCQA 1Z8AA 1H3GA 3CV6A 4K7YA 1SO5A 4KEVA 5FEXA 3NA8A 1EX1A 4D8LA 2QV4A 4X2RA 4U5IA 2QPXA 1BAGA 1UJPA 3P8JA 1VH7A 4HPHA 1KD0A 5D38A 1QVBA 1UC4A 1V3JA 4KH2A 4AZ7A 2D23A 3WDIA 4LQ1A 2Z00A 4CQCA 3M16A 3T0CA 2J8GA 1UA3A 1UR1A 4NJKA 4JYFA 3PZIA 1GQJA 3DHPA 3EMQA 3I3DA 5A8OA 3Q65A 2X42A 3EDFA 1WUFA 2PS2A 1IT0A 1UPPA 1JF5A 1F7BA 2NQHA 3CO8A 5I79A 4LBRA 4IHCA 3STGA 4BQ4A 4ZOAA 5KINA 4JNYA 1WOAA 5GJMA 5DMNA 4E5TA 2ABAA 4HHPA 3CYJA 2XSAA 3KUMA 1H7PA 3K30A 1W1IE 3H26A 3RMEA 4EE9A 3FGCA 3QY7A 1DJGA 3EDJA 4NYUA 3LMYA 3U7BA 3TQKA 5HPCA 4UTHA 2CITA 4EWND 3OA3A 3NQ7A 2XH7A 1SM9A 2F7FA 4JTRA 3LRKA 1B4KA 3M46A 5IHSA 1Q4NX 5ECVA 1ZNNA 3T44A 4EK7A 4DELA 2V81A 2J24A 3MZNA 1CECA 1Q6EA 4KWSA 4JX5A 1H7XA 3OBEA 3I4KA 2GQ3A 2QCFA 4K6AA 1AJZA 3THUA 4QTGA 4I8YA 3WFZA 1V0MA 3UCCA 4JTAA 1LP6A 4TX6A 3OZYA 2Z2UA 1SFJA 2ZXAA 2WSYA 4DJDA 1Z32X 1J96A 4LJ3A 1F2JA 1MXGA 2WNQA 3GNXA 3WN6A 3BW2A 2QV5A 5F2MA 3F4WA 4IOTA 3W28A 3BLPX 4I9AA 3N9SA 4F0SA 5C70A 3G0XA 2WJEA 4DRSA 2UY5A 1G4SA 1PX8A 3SFKA 1XFCA 4XD5A 1FBAA 5HNTA 1F3EA 1IHIA 3PG9A 3VOJA 3UD6A 3QW3A 1KC7A 5C9WA 4ICCX 3SUVA 3V1PA 2PRHA 3ITOA 4C1KA 7REQA 3I6TA 3REQB 3G6LA 2O56A 1GG1A 3NQ6A 4B3KA 2G37A 5C0QA 3OYXA 1TIWA 1SW7A 3M9YA 3M43A 4ASTA 1QRQA 2CHNA 3DFHA 2X1IA 2OSWA 1TVPA 1BG4A 3LG3A 4RZ5A 3G1FA 5D2VA 4PUWA 1R2RA 3II1A 1FCBA 1UP2A 1TVLA 6A3HA 2J66A 4YTQA 2BY0A 2R6OA 4F0LA 3H7UA 2BHZA 3NO1A 2Z1SA 2H8ZA 4UC5A 4HPJA 3OGVA 3FEQA 1GOKA 4GC4A 2D2OA 4XKMA 3W6LA 2EGZA 2WVVB 4A4AA 3FA3A 2JGQA 1VJZA 2F2HA 1PX4A 4O16A 3IV3A 3KCJA 1C7TA 3GDMA 3PR2A 4M51A 3SRFA 1CBGA 5LKYA 5CSRA 2TODA 4LC6A 4MGGA 4R88A 2E8YA 1XGEA 3UQNA 2DZWA 2XIOA 1XV8A 2PDGA 5IBXC 4A29A 4DNMA 3GTNA 3NPVA 4DJFD 4QJ5B 3GC4A 4L1WA 3ITLA 4B5WA 4ZB2A 4DZHA 4DWSC 4NG3A 5D2YA 3T08A 4MHBA 4HCDA 1AW5A 4IIHA 4H9YA 4QRNA 4UTMA 1C29A 3DG7A 4D6GA 1YYAA 2QDDA 4LOCA 3QPEA 4IGSA 5H1WA 4Q4MA 3CHEA 2WOQA 4R53A 1XPGA 4GQBA 1WQ5A 3WLJA 1W0MA 1HF6A 3QSRA 3B0PA 4S3CA 5CLWA 4KF1A 1ISZA 2P88A 4FLSA 4R3UA 2WWDA 3HPSA 1HIZA 2R24A 4AWEA 4CCCA 4E2VA 2PDMA 2QGHA 4F8XA 4GVHA 4HNVA 4OECA 5AC7A 5HR7A 2HK0A 2BVYA 3G2GA 4W84A 2PUZA 3RLHA 3ANUA 1ENUA 4HOWA 3H2EA 2J77A 4HBKA 1PTDA 1XSIA 4H7VA 3VOGA 4QCEA 4XBJA 4FLOA 2Y2WA 1U5HA 1KB3A 3KX6A 2WXDM 3B9NA 3BAJA 3AISA 4J3UA 4LVGA 2ADAA 2X1TA 1VRDA 3B9AA 1J0KA 2FJKA 4HQVA 2CNCA 3TSDA 2Q3RA 1VGAA 3QMSA 1XH1A 4HNNA 2VENA 1JNEA 2D73A 2BHUA 3KOWA 3VNDA 1OCQA 1UR0A 1TCDA 3LSBA 3HB9A 4OT7A 3LLXA 2G97A 3O07A 1UR4A 4LVDA 1M7XA 4PMUA 5AYYA 4H9MA 3FX4A 1Z41A 5DCEA 2REQA 3AFBA 3KOFA 1BVWA 4AWSA 4NZ5A 4PMXA 4LXFA 3EX2A 3SN1A 1YTKA 2VVSA 1YPIA 1F5ZA 1UH3A 5LZLA 3V18A 2J9YA 4PH6A 3VABA 2QUNA 3NAVA 4L56A 4YVVA 3I7SA 4DXKA 4YVPA 3UXKA 2EJAA 2QW5A 4WF7A 4FB7A 3ITGA 3W24A 4LRTA 2XIIA 2XSBA 3IAPA 4CD5A 4RDVA 3L68A 4ILSA 5HQMA 4WOQA 5C55A 2NXIA 4KRTA 1XYCA 1Z44A 4PZVA 3C56A 3KVJA 1RSCA 2FZDA 3ITVA 4CKQA 4GX9A 3MBFA 1NELA 1BSLA 4GG9A 3DX5A 3ZYZA 2H3DA 4E4UA 4JTEA 1HJUA 4P5UA 3W2JA 1IV8A 4MKVA 1L8NA 5D9MA 3VAVA 1XIMA 2X16A 5KETA 3W29A 4DUVA 4FA3A 2CLEA 5A6LA 2HTMA 4Q4OA 1I9CB 3ARXA 4AC1X 3FIGA 3QRHA 4WJXA 1OFRA 3DESA 4IMAA 1DIOA 1FDJA 2VR4A 3IEBA 2ZA1A 4GKLA 1Q13A 2FTYA 4ZQNA 3TWAA 5C2GA 1FQ0A 2PWFA 3R5EA 1QI3A 3UWYA 2XGZA 1QW8A 2Z1BA 3SZ8A 1Q5MA 4GCXA 3S83A 4AMCA 1KBJA 1RAKA 4YCPA 3MCMA 2VTFA 1K9DA 1MQRA 4Y2WA 1HO4A 3CEPA 1R3YA 4AH7A 3TYBA 4QM1A 4H4IA 4JTQA 3CJPA 5XIAA 4GRSA 4GIRA 3GD6A 2HQAA 1W5MA 4BEQA 2WZMA 1QT1A 2V0TA 1EOKA 4W8AA 4K37A 3VOIA 5HQLA 1E0WA 3NZPA 5CEWA 2WC4A 3V0SA 4IP4A 3BGAA 1X8CA 3KRZA 1FHDA 4UTWA 3K13A 1XIEA 4XTIA 1YHTA 5I00A 4LY4A 5AZ1A 1ICPA 1X6NA 1F07A 4L1GA 3V1HA 4N0RA 1A5OC 4M8UA 1GPWA 3WNKA 5GVJA 2E0PA 2WQDA 1GGOA 1T96A 5LA2A 3RX2A 3RAOA 1XS2A 2WKLA 4DJEA 3M7SA 1NAL1 1GVOA 1VFMA 3HG5A 2ANUA 3VUPA 4JFUA 2GSJA 5M1TA 3RO6A 3V75A 4W93A 4UFMA 2PB1A 3NXFA 3RITA 4GBUA 4RNJA 4JIQA 3K5XA 2CHOA 5IHRA 3VMNA 4DI9A 3D47A 3RG6A 1OX5A 1QNVA 2WQPA 4GVFA 1EDTA 4WVXA 3RRAA 2HWGA 4H8NA 3MY9A 4S3JA 1TX2A 1WE5A 1KQYA 2INEA 1D3CA 3LPGA 2ZUMA 3IRDA 3JUGA 4I9MA 5DY2A 1S1RA 1F73A 3PNZA 1DIKA 7TIMA 3BLDA 3WJYA 1PTGA 1HG3A 5K4ZA 3GXIA 1HP5A 1RV8A 1DTNA 3B40A 4NNAA 2Y8VA 2Y4SA 1QPKA 1UUMA 1RBAA 2G0WA 2HNEA 3M0IA 1UYQA 2YLAA 3P0XA 3FJNA 2Z1XA 2BS9A 1NF0A 4D6HA 4WIWA 3AIVA 1OFOA 4HA4A 2QUUA 5E1QA 5FOOA 3LENA 4JDYA 4D1IA 3U3HA 2DT2A 3PTQA 1B0IA 3WJXA 4W88A 1W2VA 3PZQA 1XUUA 5L9FA 3TLQA 3M0MA 1ZU8A 3KRSA 3L66A 1M6JA 2O9OA 3SQSA 2OKTA 2NSOA 4E0CA 2YZ5A 4L5ZA 2PMQA 3E9AA 4MZYA 1JD7A 3DFNA 5C7HA 2FMNA 4O14A 4HZMA 1DJWA 2WJDA 1I2PA 3LLDA 3BV7A 4O50A 3SUWA 3AICA 2ZRWA 1CYGA 3HPXA 3NL5A 1K6AA 3CH0A 3RR1A 3HZ3A 4LBUA 3QN3A 3B3DA 5D9PA 1GVYA 3SFWA 3SADA 4QEEA 3C6CA 3STPA 3CZEA 3ALGA 1S46A 3RYSA 2AMXA 3TP4A 4DZAA 3MKVA 5A8QA 1P4CA 1Q4WA 4FR6A 3CHCA 3SDOA 3ARTA 4QAIA 3M6YA 1J0ZA 2F2KA 3F4NA 3T2OA 3L5LA 3BW4A 4MWAC 2WMIA 2A3BA 2F84A 3FLUA 1H09A 4O8RA 3TYDA 4E4FA 2J7GA 2VI0A 4MPKA 4PMYA 4QE4A 4NQ1A 4MKSA 4UOQA 1N8WA 2TPSA 3RM4A 3R8RA 2ZX8A 3CB8A 5TIMA 2UBPC 1KV5A 4WRHA 4XZ9A 1F61A 4HKPA 1GOXA 3IUIA 4AC7C 4CEUC 3L2LA 3FVMA 1KRBC 2NQZA 2Y70A 3OZOA 2GPTA 3W7IA 1KNWA 2XM1A 4PL1A 4X61A 5LSMA 4JFTA 5H2ZA 4JIHA 1XLGA 1HO1A 2QJIA 3IRSA 2PP1A 4K36A 5M5DA 3UNTA 3GDRA 1GYMA 4KT2A 2VD9A 1UKPA 4DXVA 2VGBA 5GPRA 3G1AA 1ONWA 1XJBA 1VBGA 5E0FA 5C7VA 3LXCA 5DN1A 1OF8A 2POTA 4DO4A 4KW2A 3DFPA 2GGGA 3BCFA 3UG3A 2RHGA 2IW0A 7ENLA 4RL3A 1Q6OA 3LCLA 1YW1A 1FFRA 2WAGA 1ZY9A 1N2VA 2I5GA 1R30A 4W7VA 3PC0A 4Z2KA 4R7OA 4FX8A 2BGNE 4LUSA 1L6FA 3IARA 2WCAA 4MJ4A 1XX1A 4ZODA 3TW9A 3VIKA 2XUCA 1ICSA 2WLZA 2YLLA 7A3HA 4WJ8A 1OHLA 3PB0A 1OIMA 1TKKA 5M3WA 2D0GA 2CBJA 3CAQA 4JKMA 3F2CA 3EDDA 1P6CA 3LRLA 3W01A 2CETA 5F2LA 3VKDA 3WF4A 3EOUA 3QVQA 4WEVX 5I07A 3ELFA 4C6QA 1TV3A 2PPGA 1PPIA 3MCOA 4GY0A 4H83A 5D37A 3NGFA 2NW0A 4GXMA 1PHQA 3EOSA 3UZXA 5AVHA 3MB9A 3L9CA 2DZUA 2ZX7A 3KOXA 4A3HA 5DY3A 3TTEA 1DWGM 2J7HA 3EGJA 4O1AA 1BWLA 4FS9A 3GFYA 2IMRA 1EUAA 3STCA 1SZGA 3QV9A 5CXPA 1H51A 3N2OA 3UG8A 3IV8A 2DZAA 1GEHA 3W1NA 1ITCA 3AI0A 3MC5A 5CPMA 3WBAA 1OT2A 2X2YA 1EHAA 2WZHA 3H4WA 1CXHA 3L12A 5CG7A 1OZQA 2HMCA 1XIBA 4G6CA 1G9HA 1POJA 2A0NA 5REQB 3LGGA 4ZO8A 4MJZA 2J6VA 4NZJA 4JYEA 1WXYA 3GC2A 1ITUA 2W9MA 4YIWA 3W85A 5LXXA 4C1LA 1H63A 3TXZA 2DUAA 4M19A 5CZ0A 4UTKA 4OZOA 1KM3A 1VFHA 2FPTA 3NR0A 3SY1A 4AZCB 3B03A 3W70A 1MUMA 4DY1A 3TTQA 1MI3A 4KIEA 3BAXA 1QU4A 3UESA 1VP5A 3RILA 4RX0A 4UR7A 2XGIA 3T9PA 4DNHA 2H8XA 1SJDA 3ZT5A 4FEZA 1H7WA 3JZEA 4QX4A 2CU0A 3JS3A 4HTBA 5AC8A 3W02A 3UA4A 2CERA 3EYPA 1K7FA 4DVOA 1PCWA 6XIMA 2OVLA 3A9IA 1PSCA 3WQ5A 3LI0A 4PCNA 1AD1A 4D6CA 1VRXA 4NI3A 5AC6A 4HSOA 4MLRA 5HWNA 1NDZA 2YJQA 3RGTA 3QXBA 4P7RA 2HEJA 1FDZA 3CUIA 1FRBA 5CJ5A 4LEFA 2J7EA 3RPTA 3U2OA 1TJ1A 2WZEA 2WC3A 1HN1A 4UB9A 2YBTA 2ISFA 1O68A 2GVLA 1LQ2A 4BWLA 3IJQA 4D6JA 1C7SA 3Q67A 5F2GA 4XQ6A 2W4XA 3B04A 3S5NA 4EWJA 3CL7A 3UF9A 1R5YA 5JQ9A 1YNQA 4RDWA 1FWHC 1NDWA 3LHUA 2XSXA 4ZQRA 2AAAA 2VC9A 3VM7A 2GDQA 2XN2A 3W38A 3VOFA 1TQXA 5I7GA 2PCEA 1KBBA 4GYKA 8CGTA 2SFPA 1E4LA 3SM0A 5JXQA 1J8VA 3A9BA 3ISIX 1K70A 2ZUWA 2I9UA 1H5YA 4H8VA 3XINA 1DJNA 4K68A 2Z6IA 1Y5XA 4M0XA 3WF0A 5LA0A 1RPXA 2BWGA 1REQB 3SCTA 2V38A 3IVSA 1IT7A 1QPRA 1HQTA 4AZGA 1TV2A 3RMJA 2VEPA 1SW0A 2GVEA 1HP4A 2H90A 1SSDA 3EKLA 1JAKA 2VEFA 2V2DA 3OW1A 5E9XA 3W1LA 1IXPA 1JVNA 2WCGA 3KHDA 2ZWYA 2P1FA 4I7WA 2OEMA 1A3XA 1L6GA 2BXVA 4RZ4A 5FF2A 4LUTB 1EUNA 4RXFA 2X09A 5G4HC 4R27A 5CZKA 3GU2A 4BI7A 1XRFA 4F4RA 1ICQA 3WMBA 3QEZA 4C1NA 1R46A 5IOBA 4GVIA 5LIWX 3N15A 4PTNA 3THDA 4C6EA 4MFEA 3TN5A 2PU1A 4FXJA 3BANA 1L6WA 1OYAA 3K4WA 3E2RA 4HK5A 4RK8A 1ZRQA 4XG1A 1DIDA 5J8LA 2QCDB 1T99A 3G8RA 1SSGA 5G4EA 4NXSA 3S9ZA 3PS7A 4YU1A 5BMWA 4RLIA 3N3MA 1A5CA 1ISWA 1MW2A 1KCZA 4B5SA 1PV8A 2AKZA 4Q7BA 3VD9A 4Q8PA 4J7RA 4ORMA 2Z1KA 1M01A 1HT6A 2D0HA 4KWWA 5FA5A 1E9ZB 2ESCA 4HGXA 4IP5A 3UW6A 1HVXA 5MHBA 4C6LA 4IGNA 3T42A 1RZMA 1UZDA 4TX9A 4KWUA 1PBGA 1LLZA 5I78A 4L4PA 4US6A 4ZVJA 3BPWA 2GGIA 3Q37A 5HR6A 1XBYA 1JRCA 1TWSA 4CD4A 4XISA 1R47A 1LQ0A 3GY1A 4ZEPA 2XJ7A 4MF4A 5K4XA 4IQEA 3UJEA 2BXZA 2ZDRA 3W7LA 1JFHA 1DXEA 3VNJA 3PUDA 2QCGA 4DLMA 1OFPA 2WVVA 1NWRA 4WXZA 3H4GA 4GQ0A 2WSPA 3HURA 3QZ6A 3O6YX 4HJWA 3EEZA 4V33A 3TTSA 3I6RA 3H6OA 1K3UA 3LTYA 3VILA 2G4JA 3BDKA 3OIXA 1HL2A 3C0SA 2DT0A 3G1DA 1X97A 3SBFA 2I9EA 3W7DA 1KM0A 1E1CA 1V7YA 2PDCA 5CAKA 3AZRA 1OD8A 2FMOA 1BRLA 3KM8A 1OQFA 1XIGA 3GM8A 1GK8A 2AQVA 2H9AB 5A6SA 1R3RA 1Z7AA 1V02E 3PBUA 2Z2AA 4J9JA 4Q4SA 1B3XA 2FZ9A 4W89A 1WDWA 5ECUA 2OQYA 4Z2LA 5I06A 4Y9PA 1GONA 2XN0A 4TIMA 3WELA 3VOCA 4G56A 4AVNA 1K4HA 3UG5A 1EEXA 1VKFA 1F3WA 2DH2A 1XLIA 2OODA 1IZCA 6XIAA 5C2CA 3ZSSA 4DWDA 3IJ9A 3QR3A 3WG6A 3DDMA 3F5JA 3CUHA 3D6NA 4FF5A 3W07A 3APGA 3VFCA 3IAQA 2OWCA 2HNHA 4F9JA 3KRBA 3EA1A 4HCHA 2QUVA 1NSJA 3N4EA 3CAKA 3U2CA 4Q4RA 1GKPA 2YKKA 5A8NA 3F1QA 3EX6A 4JDBA 4LAOA 1EEPA 4WZHA 2ZZ2A 1U83A 3PTKA 4MLJA 4B9ZA 4WKHA 3IVUA 2VO5A 3C61A 2AGTA 3SCOA 4XSMA 4AD3A 2E4TA 3CHVA 1ZCOA 3W6YA 1UIPA 3S2MA 5LYRA 1CGWA 2J74A 3CZGA 1FX6A 1EB3A 2VRKA 5D2XA 4EIVA 2YCKX 4MY1A 3VGHA 4PCSA 3T0DA 2R1KA 5C8BB 1BLIA 1TZ9A 1KBKA 2VFGA 2VNCA 3EWCA 1U2YA 3U2EA 3HMCA 1QTWA 3WQ6A 5HMSA 5JIPA 5HNUA 3T55A 1JD9A 3BICA 1GVSA 3B97A 2BASA 5D09A 2LLEA 1LRQA 1PXGA 1V6UA 4GXWA 4NX5A 3QHNA 2GGEA 2Z1WA 3M7WA 3KBJA 2B7OA 3APYA 4NX0A 1LORA 3N1AA 3QH2A 2YDRA 2D1ZA 2WZIA 1W9UA 4XUGA 3KBWA 4M6VA 4IL0A 4O1EA 2Y8UA 3URQA 1ISVA 3SIZA 1JXKA 2NXGA 2PF0A 3MSGA 3T40A 1MEWA 5BOEA 2OTDA 1VEOA 4DHGA 4C90A 4FLQA 3O6AA 3KOZA 1B3ZA 2XN1A 3GXMA 3WJWA 3TUUA 2G3IA 4XBSA 4PSRA 3LS9A 4BK9A 1UJQA 3IIZA 2ZX9A 4I6KA 1FWCC 1ELSA 3L4VA 4J3ZA 2X05A 4JTTA 1H62A 1YLVA 4F0HA 2Q8ZA 3PAOA 2P76A 3K4DA 1OEPA 4MDPA 3GVGA 5ENLA 5GJNA 3EDEA 2VEKA 3CM4A 1S2TA 3WQ8A 3ABOA 3CUXA 1TTIA 1V02A 4YYCA 1GJUA 1GJPA 2EPHA 2FGBA 2ASHA 3GXFA 1TRDA 4LW7A 1VEPA 4DUOA 1ZB5A 2F61A 4EXQA 5CAHA 4CCZA 3GTXA 4FI4A 4EF9A 3SECA 4O54A 3QC3A 3OODA 3BGGA 3ARUA 4HZ8A 3TN4A 5GQBA 4JCLA 4OIFA 2DJLA 3L4XA 2ISWA 4UTTA 3ARVA 2W91A 3U6WA 2VDHA 2CFFA 1WCGA 2QMKA 1T8QA 1JDAA 4V27A 1XF0A 1C90A 3HV9A 1JZ7A 2VMFA 4MUZA 1S5TA 1O94A 1S5NA 3UT0A 1A5UA 3CL8A 4JIPA 4JYDA 1EZ2A 4HSHA 4ACYA 2W5FA 1WAWA 4QE1A 1W8SA 4NHVA 4GXPA 4DAIA 4YPJA 4L7ZA 3CHFA 1WZAA 2HBVA 1JDFA 2PEVA 4GYFA 4ML9A 5FSDC 4MFDA 1C8VA 1HJQA 1JPMA 4QLLA 3EOLA 3CPUA 4E38A 3WD2A 4FNQA 4U3AA 3BCJA 1GOWA 1R3SA 3MUY1 1SYTA 3NM3A 4WXYA 2YBUA 4DB7A 3QYSA 4MNKA 4QITA 1O5KA 1LM1A 1FA2A 5A5WA 3BARA 3EB4A 4D8AA 3WX7A 2XFFA 3HM7A 2VZVA 4FX6M 3GBEA 1W5PA 4W8BA 4CUCA 2B4GA 3WBEA 4PMZA 2UWFA 3SCQA 3G24A 3FS2A 4HNUA 5CC7A 1R87A 5F7UA 1D9EA 1L2UA 4JTIA 1EC7A 3WY1A 5I23A 3BJSA 5IM51 4S2CA 1G4PA 1TB3A 3BQ5A 4KGJA 1JUKA 4EF8A 4OV9A 1J01A 3QM3A 4L61A 4ZB0A 4F0RA 4KESA 3M0KA 2XWEA 4OU1A 4C6OA 3GO2A 1O5QA 1E1EA 3G1RA 1SJAA 3DFTA 1TZ7A 3TTYA 1GNXA 2PDBA 4AYSA 1RQEA 5I3HA 2QR6A 4JTCA 3C4UA 2AQWA 3AIUA 3VA8A 1EJ7L 3VNZA 3GKAA 1E0UA 1ZTVA 1VB9A 5ABGA 3QQWA 2CZFA 3PPCA 3PJTA 4TR9A 1TTQA 2OGYA 4GC3A 5FI8A 2H6RA 1FOBA 5IDIA 9CGTA 4WUIA 1OIFA 4IT1A 2QKFA 1VLWA 3GDTA 3QOKA 4QDMA 4A2SA 3VKCA 5I3GA 2YSWA 2CLKA 4H7ZA 1QK0A 2E5CA 3QY8A 4F3HA 3BGJA 3WDJA 2JE8A 1BGAA 3MUIA 2YX0A 4Z2GA 4MZ8A 4AW7A 3B8TA 2C16A 3S3GA 6TIMA 3RO8A 3SN4A 3RLGA 3CB3A 2P10A 3CO4A 1EJSC 4KETA 1J2WA 2V9DA 3TOPA 3ARWA 3IGHX 4CNNA 4MIMA 3B9DA 3B8DA 3W7GA 2WHMA 4XIAA 2HBXA 4JHZA 4AY1A 5HNNA 1DEDA 1FCVA 4ERGA 2AL2A 1EA9C 2J88A 3CV2A 2C14A 1QCWA 2P8CA 4PUNA 5I6SA 3QFWA 1JCNA 1OK6A 2FZMA 4B4FA 2V6AA 3D46A 2DW6A 5LHEA 4LAMA 3OLDA 3RLVA 3DFYA 4PCPA 3LV6A 2YA1A 3LCFA 2OO0A 3UJRA 4CD8A 4YNGA 3S1WA 2VURA 1IXQA 1IEXA 2PU0A 5E93A 3SRDA 3A4JA 2VCCA 4AXNA 3CTLA 3AXKA 2HS6A 5K3VA 1GZGA 3DKLA 2GDVA 4I6VA 1E6QM 4ZR8A 3KTXA 3P81A 1RR2A 1G0CA 3BQ6A 3AXXA 5LNRA 2J8TA 3WENA 3L0NA 3LHZA 4B5NA 1FHUA 4DM2A 3PK7A 2UV8G 3DXIA 3KP1A 4Z1YA 1GZJA 3VMOA 1EJVC 4K38A 4US5D 1HJSA 2NUYA 4K39A 1ZALA 3SRHA 4BQ5A 2E09A 1K6WA 3CV7A 1P7TB 1M7PA 4BKNA 4QHRA 3LN3A 5HUOA 3FV9A 4QSFA 3PTDA 2ZE0A 4PGLA 1ZCCA 2WHKA 3PSWA 3MANA 1EO5A 3G0UA 3AHXA 1K8XA 2XH0A 3AJXA 5H8PA 2RJHA 1A5LC 3BO9A 2V3DA 1L6SA 4GUJA 3VU2A 3CMFA 3MHUA 2VX7A 2EPOA 3OYZA 1XLAA 2W61A 4AUBA 3JU2A 1FWFC 1RK5A 1EGMA 1RD6A 3VK5A 1VC4A 3OHIA 3WDHA 2PF8A 1MO0A 1AVAA 1I2NA 2YBVA 4X9YA 1DXFA 2PLJA 4DUXA 2J79A 1AG1O 1ZPTA 1W1VA 4O1FA 2PBGA 4JQAA 1W1TA 4Q8VA 4ZQMA 2YXGA 5HWMA 1VLIA 3M0YA 2VP8A 1J11A 1HZYA 4RV3A 3WQWA 2BNJA 1DWIM 3EEGA 2DSZA 3PF3A 1AZ2A 1Z89A 1PVNA 1E6NA 2V8ZA 1OINA 3D0CA 2GYIA 1YE6A 2DP3A 3U57A 4UR9A 1XICA 3QV7A 3KVKA 2V69A 1TO3A 4YWSA 1DOSA 1E70M 1TV4A 3O3RA 1IEQA 2WVTA 4IIGA 3BK0A 1FWAC 5REQA 2E1DA 4AFYA 4AZBA 2BB0A 3V7PA 1PL9A 3ZXWA 3GYCA 4CU6A 3OVPA 3FYOA 5CZSA 4RR4A 2QS8A 4WHBA 4AZ5A 2WSRA 3KZPA 2E9LA 3PFRA 3IGSA 5A6TC 3E96A 4AZCA 7REQB 4GY1A 4UQAA 5EB8A 3ARZA 2RDUA 3G5EA 4IPIA 1PB0A 1YXCA 2VM8A 1V0KA 2DORA 3NZ1A 4YCOA 2DSVA 5CGQA 2XVNA 4DXXA 4MKNA 3GDBA 4UR8A 4WY0F 4U31A 2C7FA 1A4MA 1ZJAA 4FOKA 4F9DA 1S5VA 1UKOA 4UQ9A 4DWSA 4QLJA 2P0OA 3KP0A 1RUSA 4L9XA 3R2GA 1OGSA 3M0ZA 1UA7A 1E9LA 4KMQA 5KZ6A 3TC7A 5GNZA 5HWJA 5KZMA 2CZDA 2QCEA 4OBTA 3AYSA 1Q2RA 1VBRA 1IGWA 5JBEA 4MMWA 3HGOA 3CZJA 2DT1A 4JQ1A 4C6IA 4JOMA 4P7NA 3HJZA 3QW4B 3LXAA 5T91A 4KFPA 4JQ4A 3RF9A 2NVAA 1UBSA 5CPNA 3CPGA 2XISA 1XKJA 4XX6A 3RM9A 1DQWA 3UXAA 3CU2A 2FQIA 4NILA 4P8XA 5T9BG 2JIEA 4RW5A 1KXHA 3PUOA 1JEZA 2GK1A 1NP2A 4F79A 3PZUA 3ABQA 3BAYA 5EY5A 1NWSA 4TVDA 1JR1A 3NZGA 1B30A 2YA2A 3TOYA 3A12A 1GVRA 4GZIA 1L2QA 2ZRVA 5FF3A 1MQPA 4IMGA 3IJDA 5IFPA 3SGZA 1B2YA 4W85A 5B80A 4Q22A 4U4MA 1Q6FA 2I17A 1QFEA 1HJWA 1KCXA 3BXWA 1QWGA 5M2FX 1J93A 3W74A 1PZ1A 2QJGA 4RCXA 1W1A1 5LNUA 5HQEA 3O1NA 1DE6A 3AHZA 1EQPA 3K1DA 4O10A 2DDXA 2FJUB 2WKGA 1KKRA 3W83A 4GH1A 4GUGA 4KEUA 5EPDA 2HXTA 4OE7A 4RXGA 4XV0A 1BQGA 3PHAA 2ACUA 2X1RA 1TPH1 4WY0B 2BLEA 1UZ4A 2OYMA 1LOQA 1R3QA 4LUTA 4GINA 4AZIA 1PAMA 1I45A 1TPB1 2GZXA 1NFGA 2YIHA 1QMLA 1K1DA 4A8NA 2I5IA 1RHCA 3NL3A 3WMLA 1YDOA 2ISVA 1P5BA 3PZOA 5HJYA 3IIXA 2DSUA 1LLWA 2JBMA 3USZA 1XFBA 4UWMA 4NF7A 3T07A 2XIJA 4LANA 3HV8A 3W81A 2PURA 5D9OA 4CU8A 2ZVIA 1KTNA 2HS8A 2REQB 4IMEA 3V0TA 4DAFA 1G01A 2NX3A 8RUCA 4O15A 1OJXA 4DZ5A 3LBOA 3DFQA 4PB3A 4ERAA 4JTGA 5BRQA 1Y0EA 1MWOA 3FAWA 4MNMA 3I7QA 3I4EA 1EWEA 3LBCA 4MJ2A 3GDKA 4S3KA 1FKXA 3W1AA 4F66A 4ZMGA 5EBAA 3W2UA 5FL0A 1QATA 3W75A 2HV5A 3N13A 4PA8A 4MAZA 2EPMX 3QGKC 4JY8A 2A3HA 4FPSA 2KAUC 3PBWA 3BLKA 1HX0A 3OIHA 3MV11 5LNVA 3ABSA 3CZ8A 5FF4A 4QQ3A 4Y96A 1ZUAX 1CGTA 2DIEA 3FXYA 4QJ1A 5E0CA 4B15A 1L8PA 2JQXA 4C6JA 4DBEA 3VDBA 1TA3B 4IJRA 1YNPA 3W84A 2V5KA 4D9PA 2VKZG 4I5XA 1E5JA 2J47A 1MNSA 3LNMA 4PEKA 3UGVA 3IPWA 3H2AA 4JPGA 1F05A 4LS1A 3LSCA 4H41A 4XSLA 1PJ9A 1W56A 3OGSA 4B2DA 1JPHA 3T0BA 2DUZA 1DE5A 3VINA 3H7VA 5KZDA 2TRSA 3GAYA 3TCSA 1KTBA 3W9ZA 3HG4A 1KFJA 3HPFA 5XIMA 3U4FA 4TTUA 1W3HA 2YL5A 5ABFA 3MSRA 3W1TA 2JALA 1EIBA 3S2NA 3WQFA 4DO6A 4FOUA 1UWAA 1TWDA 4AD2A 2Y89A 4H9ZA 1ESWA 1WOBA 3WUGA 3GQYA 4AAJA 5FSEC 4AHQA 2H9AA 3WYZA 4OJYA 1RQBA 3VUSA 3IGXA 4UFJA 2VZSA 2HCVA 3GG0A 2BOEX 4B92A 1F6YA 3V4BA 2DJXA 1ZJIA 2J75A 4HMCA 3VMPA 2FYMA 3WL1A 3BUVA 5CZTA 3TWBA 3C0LA 1TPC1 3RPMA 3RIKA 1ML1A 1S38A 3LM7A 1VIZA 2G3FA 3N73A 3EX1A 2XG9A 1KM1A 4FXFA 2L5HA 3C2FA 3SY5A 3DGRA 4GLEA 3GR7A 4NXKA 3NQEA 2VCAA 3N4FA 1E0XA 1VYSX 2Y24A 5AHMA 3AYRA 3S2CA 2C79A 1EZWA 4FOJA 4E4PA 2PTYA 1L9WA 3TYZA 2ZICA 4J1OA 4I3GA 1MZRA 1JF6A 2WMHA 4UQCA 5ABEA 3E0IA 4DJFC 2GJRA 4H1ZA 4S38A 4L6DA 4XAZA 3ARSA 1MRAA 1XYAA 3TXVA 3QPYA 2FDMA 1UH4A 3D3FA 1U22A 2AL1A 3OLIA 3FKRA 5HMDA 3ANYA 3HMJG 3EA2A 4OV4A 4O57A 2VEMA 1H7NA 4JHOA 5LNWA 1X6UA 3AIBA 4K1WA 4ZL1A 1XD1A 1GORA 1JCLA 1U1HA 3L0GA 4PODA 1CCWB 1NFPA 4UCGA 3UXLA 1LROA 5A6BD 1ZSXA 2BHYA 4XAFA 2ZDSA 3S0CA 5D2WA 3VZXA 1D3HA 2EJ1A 3PULA 5CCZA 4GZEA 2NLYA 3UZWA 2WM1A 5CPQA 1NP0A 5C5YA 1KM5A 2BV9A 3VD4A 2E40A 4UMBA 2Q8LA 2YL6A 4GY7A 3ZLHA 2ATSA 3JRKA 2D2HA 4D71A 1DXIA 3PJXA 2ZQ0A 3NM1A 4UNLA 3AALA 2P3ZA 3Q45A 1PYMA 3FKKA 4PYSA 4LALA 5D03A 1BTMA 4MWAA 3KVMA 4LAUA 5CKSA 1O4UA 1WAUA 5AFDA 4EACA 1P0NA 1X1OA 4LV9A 5D05A 1EJUC 1LQAA 3M0XA 4M1BA 1YPXA 3GNNA 3AAMA 3WLQA 3BMXA 1V6XA 3GWQA 5A8MA 1RBOB 4MYXA 2A2IA 3CWOX 3UCQA 4PR4A 3CLWA 5HMEA 4S39A 1XSJA 3VIMA 2HVNA 4MUPA 1HKJA 5TQLA 3VIHA 1NQ6A 4PUUA 3AMLA 1IR1A 4P8VA 1FFQA 1QPOA 1P6WA 3BG3A 4UMCA 1UD2A 1XYBA 1TR9A 4JQ3A 3KL5A 2WMIB 4J3TA 2OMAA 1W5QA 4OBRA 3L65A 3PAJA 3W1MA 5J5DA 2XU2A 1T7LA 4KBXA 1FWGC 2ACSA 1UASA 1L0PA 3GRIA 1TPWA 2A21A 5AYBA 2QEZA 4LGXA 2YXOA 5FAGA 1F3XA 2VGIA 4CLMA 1EBGA 3GXTA 5DX7A 1YKWA 4C6CA 3WQDA 4ZTYA 2TMDA 1UR2A 4BZYA 4M3PA 4WJEA 3NQ8A 1VBJA 3LBMA 3AYTA 2VD8A 1GW1A 4O11A 1TTJA 2C71A 3AYVA 3LB0A 1AD4A 2PWDA 5GNYA 2Y5EA 4ZSUA 3P60A 1I1WA 1U5JA 1ADDA 1EQCA 5AYZA 2NUXA 4TMBA 5BZAA 1C92A 1P1XA 3WH7A 2DZSA 5LIKX 3OZPA 4G5DA 4C6MA 4UTTC 3W26A 1BF2A 5F2IA 3GS6A 4IGHA 4H6QA 4L64A 2OZTA 5FACA 1H1NA 4RUBA 5J04A 1I2QA 4X63A 3W6MA 3SUSA 5EMLA 4Q8QA 1DVJA 2WBGA 2XPKA 3AWNA 3WD3A 4P61A 3CUGA 4MZ1A 3VCNA 1NOUA 5FJTA 4MNLA 3CQ0A 4J40A 4LUSB 3AQUA 1MZHA 1FWWA 2BFGA 3L21A 3IJ6A 4J2MA 3DUGA 1Z69A 1UKSA 4TTGA 4PL2A 3NQGA 3NOYA 4Y8EA 2CLPA 5CC6A 3TONA 3UPBA 4FMVA 1W6TA 4CN6A 4Y90A 3BSMA 2O9PA 3H70A 3GNOA 5G1TA 4GISA 1LZOA 1V4YA 4RZBA 4E8CA 1J10A 3EDKA 3NG3A 1W5NA 3C5QA 3WNPA 1C9DA 3BMVA 1Q6LA 2CXEA 3NYDA 4BCEA 3GW0A 2NZLA 3WMCA 1TYGA 4N42A 3TKFA 2E6YA 3A24A 3FHAA 2OKOA 3E12A 1ZJBA 1M1BA 1IZKA 1W3KA 1EJRC 3WL0A 2EPLX 2HPIA 1SU5A 3L4TA 1Q2SA 2GWGA 2JKEA 1SW3A 2A5HA 2FVLA 3RCMA 4GI8A 4J27A 2DSKA 4FNTA 3OTRA 3NVDA 3MU7A 3T81A 4KEZA 3KBMA 1W5OA 3LUTA 2DY3A 5CPSA 1S1PA 4LY8A 4QP0A 3W7HA 1ITXA 3AS3A 3TN6A 1E40A 5ABHA 2PGRA 8XIMA 4XO6A 3ARQA 2CLIA 2PGWA 4Y6GA 1AMKA 2WSKA 2PGFA 2YXXA 1N7KA 1MDLA 1MXDA 1P1MA 2G96A 1R85A 3QLDA 4GHRA 4Q8NA 5A8GA 5CJNA 1LG1A 1A80A 1THFD 3DH7A 4A05A 2XIBA 4BQ2A 2PTWA 1NVMA 4HK7A 4A8LA 3OP2A 1RA0A 3PVFA 1GCYA 1XQKA 1VD6A 3W1RA 2XFWA 4JN7A 2ZX6A 4IIDA 4E2DA 3KXQA 4ZSTA 2A7NA 4JZ5A 4UFIA 1F4HA 2E7FA 4EX4A 4WX2A 3BOXA 1KQZA 1WKDA 1OVDA 2Z24A 3GU1A 2W6RA 1MUWA 3RXZA 2NWRA 2WHLA 3BCDA 1GHRA 5AHNA 3ENLA 4ZOBA 5E6ZA 1TJRA 4R34A 5BW6A 3W88A 2OOFA 4IICA 3BG9A 3GVVA 2X41A 3PBMA 2X40A 5J5RA 1R3TA 3BC9A 1QBBA 3W76A 1QNPA 5ABTA 1PIIA 3EBVA 1WNOA 4GD0A 2BP1A 2HE8A 3ATYA 2ZWZA 3B0VC 4PEEA 3HFTA 4DYKA 1MW0A 2OU4A 3BAWA 5DFAA 4AVFA 2OYLA 5JVLA 1P7TA 2V3FA 1UWSA 4FZIA 3GH4A 3EKGA 5BYWA 1ECQA 1R86A 1JJKA 1RY8A 3EPNA 3VE7A 2EF9A 1SO3A 5D9NA 4KCWA 1A5NC 1V3HA 4N4QA 3T8QA 1PIGA 5HOSA 1OCBA 3VIGA 4C6BA 1EXPA 3E74A 3A3HA 2Z1VA 2ZC1A 2IQDA 1BKSA 2YW4A 3LI1A 2G5WA 1WBJA 1B31A 3V5FA 5I5RA 4K3ZA 1HGYA 3KCOA 4GA8A 1UWUA 5CSSA 5BMXA 4N9DA 3LCWA 4Q7NA 5HNRA 3IK2A 4D8ZA 4HOXA 2Y7EA 3G22A 3KDOA 4PFHA 3HGRA 4C5YA 4PBFA 5A2BA 2FZ8A 3MMUA 3HTWA 1K8CA 3MMTA 1QOPA 3ABXA 1XG3A 4UMAA 2V2CA 3W73A 3FAXA 4C1NB 1F9CA 2Y5JA 3NXLA 3W00A 5DRIA 4Y8FA 3O0FA 1WBHA 1LUCB 1E5NA 3N12A 2CESA 4QCFA 4TQTA 1MW3A 1Z42A 2Z25A 4XIMA 1B3YA 4O12A 4DF0A 3U2ZA 4N9CA 1HGWA 5BXPA 1KFWA 4KRUA 3SSZA 1UMYA 1LWJA 4UQEA 3I68A 1C8QA 4OKDA 3ABRA 1A0EA 1W9XA 3T2PA 3VDAA 3QSTA 2VFHA 3M5VA 2O55A 1DBTA 4BQ3A 1JZ2A 2NVCA 5C2XA 3DG3A 3RHGA 1XCXA 1N8IA 3ONCA 3ZR5A 3NDOA 3V16A 4Y9AA 1FTXA 3TYEA 3WK3A 3LCIA 4NZ1A 2J13A 3W7JA 4RE3A 2PZ0A 5HXMA 1UW9A 4DJDD 3WKZA 2PDJA 4YMZA 2FKPA 3A23A 3BMWA 1NFBA 4LYRA 3DC8A 5G2WA 3PPFA 3ID7A 1DQXA 8XIAA 1W9DM 1I75A 3TVAA 1OG0A 4Q8OA 3N18A 3R13A 1EP2A 5F1VA 2D3LA 3GUWA 1EF3A 1VBHA 4M56A 2J9XA 2EAWA 3CQKA 1VFUA 3CL6A 4KERA 4W5ZA 1QOQA 4HYRA 5DXYA 3NEHA 2BOFX 3VM5A 1V03A 3GTHA 4LH8A 1WP6A 3MUAA 4CNTA 1EWDA 1UQZA 1V7AA 1Z3NA 2BGSA 3W7KA 1Q3NA 2X7VA 1I0DA 1SFSA 5RUBA 5AKQA 3NL2A 4DIAA 1LL7A 4CGTA 1GKRA 2VL4A 4Z0JA 5DELA 5T26A 3IACA 5AY7A 1VS1A 1CLKA 3NQBA 1O7AA 4NRRA 5I02A 4YS1A 4HMNA 3GKFA 4A22A 1E1CB 3R4IA 1YADA 4Q8UA 3BZJA 1LBFA 2QDHA 1M41A 2FVKA 2E28A 1XHGA 1Q45A 1VZWA 1BRLB 1KFCA 5KEZA 3NGJA 1W9PA 5F4SA 1X38A 3BJFA 4P7OA 1YRRA 2GSEA 5T9CE 4AZ6A 4LV4A 3N2MA 4HK6A 1RPKA 2WWCA 1WKYA 3VD5A 2DU2A 1H0GA 1A0CA 3VGFA 1D2KA 4X0VA 3IWPA 1CZ1A 3MJMA 5BOFA 4CU7A 5DEZA 3CIVA 4A21A 1SGJA 4ES4A 2J7BA 2OB3A 3OOQA 3UWZA 4G2DA 1IQ8A 5BWFA 5E70A 5A95A 1LWIA 1EJTC 4V28A 2X2GA 4JGDA 1XG4A 4Z2JA 2DEPA 4TUFA 3NDZA 3QJAA 1O12A 3W1PA 1K9EA 3Q2DA 1UOZA 2QIIA 1XLBA 2O92A 2CIPA 4GUIA 3GIYA 4HZ6A 1LF1A 3QMTA 2HJPA 3IIOA 3DENA 2BY2A 5E09A 4WY0A 4IUOA 2X0HA 3O6CA 3AHYA 2W27A 2ZUVA 4MVAA 2B0MA 1BWVA 1ZAIA 4O53A 3UP8A 4JD4A 3ECQA 4O4WA 2V5LA 4A6GA 4NZCA 5F1UA 3OB8A 1W32A 3OU8A 3UR7A 1TJ2A 4KQNA 3G8EA 3LTPA 1OY0A 2D2JA 1AA1B 2YGYA 2ZXBA 3W7NA 2WPGA 4RZ6A 4XB3A 3TU9A 2PWUA 4UFHA 1OADA 3LGEA 4ZO9A 2J27A 3EOOA 1ZBKA 3TA6A 3GTFA 5CG0A 4Q7IA 4JX4A 3AZTA 4EXBA 3A47A 3FEMA 4Q3MA 2G50A 2V5DA 1TWZA 3PPHA 4B3LA 3WBWA 2QZRA 4UTUA 3WCZA 4FSAA 1OSEA 5AYIA 5BNKA 4U5KA 1PKNA 3HA1A 4H9XA 4AEFA 1UMLA 4AZHA 3WMSA 4H9UA 1LTDA 2X7WA 1BSIA 3P67A 1OX4B 3R25A 3NURA 1AJ0A 3T0AA 3DGBA 1QBAA 4PTDA 3W2MA 2J25A 3VGEA 3THQA 1TJ0A 3BG5A 2W0UA 3PBGA 1OM0A 3GUGA 3OVQA 3N2CA 5TNVA 1TA3A 1X7FA 1EP1A 4DLFA 1CXKA 3SAZA 1H41A 1BVZA 2A3EA 1UD5A 1J0JA 4J3WA 1DJQA 4Z2IA 1HJVA 4NJHA 1OZMA 2AOSA 3B8SA 2WM0A 1KR1A 3FSUA 2BBFA 4LNCA 1W91A 3MI2A 2QDEA 2IKGA 3O2LA 3LMZA 3GXNA 2ZUTA 3NPXA 1UKQA 4GNKB 3SY8A 1R3VA 3F5LA 1HJXA 4EPKA 3VNYA 2DVTA 5FJUA 1B9ZA 3BOLA 4K1GA 3F4DA 5LIUX 1NEYA 3QY6A 4ZBCA 3V5CA 2ZRYA 1EHNA 3LYEA 2I5QA 4JFSA 3C2RA 1YBQB 4Z42C 3VIIA 5HANA 2RDWA 3VPLA 4ATDA 2VOMA 2GJXB 3FK4A 2IKIA 2P5NA 3GZ3A 3N14A 1B54A 3TJXA 1X39A 4PC8A 2VOTA 2W63A 3GBDA 3CQJA 4M81A 5FJOA 4HU3A 2GDUA 2PDWA 3W72A 3B0YA 5KSWA 3QC0A 3PANA 5CC3A 3RX4A 4H7CA 1U33A 1FH7A 1CPUA 4ZTXA 4IQLA 3TDFA 3SJNA 3CASA 2VXNA 1HKMA 3LCHA 2Y62A 1OYBA 1W1YA 4GBDA 2Y6ZA 3QKEA 4HPGA 1QPNA 5C71A 2CKSA 4NU7A 1VIWA 3KVLA 3CTTA 4GKTA 1HKIA 2RDXA 2Y7DA 2GSHA 5MKGA 2YL8A 3DN5A 4RPQA 5A1AA 1MRQA 4D72A 3KDNA 4M7SA 1YPFA 4NI8A 3EAUA 3POHA 4B5XA 2QNEA 3KBSA 1S3TC 3LU2A 4A8IA 2R82A 5A2CA 4MB1A 3WLSA 3WDRA 4V1YA 2VZOA 2VWTA 3AROA 3WNOA 3SURA 4ALDA 5I24A 2G3NA 3SCWA 1TTPA 4DJED 2VQUA 1WKEA 1I2OA 5FEZA 4IPLA 2A7RA 5BWAA 1EDQA 1SVDA 5GNXA 3CHDA 3W7RA 1R9ZA 3VX1A 4FNPA 1W1PA 4A3RA 1M7JA 3TYAA 3VXGA 3WLPA 3URAA 2A3CA 1B90A 4IQJA 3Q94A 2DIKA 1DTUA 1FWEC 2QJNA 1W9VA 3ZJ6A 4HA1A 1IXNA 3SB0A 1M03A 2QCNA 1HL8A 3CUFA 2OLSA 2OEKA 5CGMA 1CB7B 1KM2A 1N8FA 5XINA 3NQFA 3T4CA 1W1ZA 2BODX 4K2SA 1Q65A 2ACQA 3CZKA 3EMZA 2A79A 1MYRA 2Z7KA 2QAPA 3DKJA 1KTCA 1JCXA 5CPLA 1MDRA 2EPNA 1XIJA 4TVCA 2JGYA 2BY3A 4QJ4B 4RE4A 4LF1A 3CWHA 4FR1A 3TFCA 3C3NA 3HO8A 2VGFA 3W23A 3LM3A 4GZ7A 5A6KA 4LUIA 1KM6A 5D8WA 3W1QA 1BF6A 3MHFA 4UUIA 3LCGA 1PKMA 2DIJA 2I57A 3PJUA 5DT5A 3MDWA 2YCLA 4O1BA 1LBLA 1LBMA 3APTA 2I1OA 3WQEA 2FHBA 1J9YA 1A3WA 1F8MA 1JYWA 2J78A 2VZTA 1K77A 2G4FA 5A6JA 2CLLA 4B5TA 3KW3A 1QXLA 2AL2B 2QMJA 1UUQA 1BYBA 3FHQA 3C0QA 1O60A 3VIJA 3TR2A 4H01A 2FTWA 2PA6A 4CQ8A 2CHRA 3VI2A 1PCKA 4X2PA 4AEEA 5JUVA 5FJRA 1ZBCA 7ODCA 1XISA 2FZNA 3QGVA 4O0QA 1B3WA 4NUWA 1R38A 3IJ8A 4NNCA 2PDUA 1QI2A 1ZZMA 2EHHA 4QSHA 3DBNA 4Y9NA 3WLOA 3FJLA 5CPOA 4GNVA 4FXRA 4EPBC 3N19B 3G18A 3TK7A 1JYNA 4KKXA 5FF7A 1HXJA 1XIDA 3BURA 3W7OA 2HK1A 4PN2A 2WNNA 4X9SA 1KR0A 3GHSA 3MTWA 1YX1A 1O6IA 1VJIA 4P8UA 1KFKA 5CH9A 4AYGA 3KS6A 3WUEA 3TW6A 4ERIA 1B57A 2V63A 4Y9OA 4UTLA 5FESA 4IJCA 5PTDA 3NTYA 3QR0A 3OA5A 1VF8A 1PDYA 3EB2A 3EKZA 4O13A 3LD5A 1FWSA 1JXJA 2GUBA 4S2BA 3OGRA 3IANA 5CSYA 2HE5A 3FVDA 1YXDA 4GACA 1YIXA 4EKJA 4AIOA 3VX0A 2ZZ5A 2BY1A 3V35A 3GNRA 4HU8A 2Q6ZA 2WW5A 3NFUA 3TH6A 3SR7A 4DPQA 4XVDA 3T8LA 1BG9A 3SSJA 3DAQA 4YLWA 2DZPA 4MAVA 2V30A 2Y61A 1EO7A 1JFXA 3NZRA 3OEXA 1E0TA 1H49A 4F40A 4LYQA 4Q32A 2NQJA 1QOXA 5LNSA 4MY9A 1F74A 1J12A 1E56A 2R1NA 4DX3A 2RGMA 4ZO6A 3QZAA 2CW6A 3QHOA 4P7QA 5H91A 3LPOA 2C91A 4GGBA 4NRSA 5D32A 3OO2A 3E2VA 3A13A 2NV9A 2CYGA 2P8BA 3VNMA 3IJLA 2V5CA 2XH2A 1KLZA 1QI0A 3I3EA 2VDGA 2Y63A 2AQOA 5EMYA 3A22A 3E0WA 3ITYA 4L4LA 4HOZA 4PRTA 3PZNA 1T41A 4IMDA 1LL4A 1PYFA 3AO0A 4S3AA 3W7PA 1W37A 3GVQA 2RFGA 4PMJA 4QLKA 4I5RA 3MKCA 3ATZA 4D6DA 3C3UA 4GIYA 3PBYA 3E0VA 4JTSA 3ES7A 4GYPA 3C8FA 1LWHA 1A53A 2X8RA 3KLKA 2DSWA 2DQXA 1UWTA 1B1YA 4HB7A 1E4MM 4LBSA 4XUYA 4FIQA 2A4AA 3HQPA 4QISA 3L23A 1S39A 2VDIA 2YYTA 1PWMA 4HSNA 3ZJ7A 1DJXA 1XDLA 1JGMA 1IZJA 2XIMA 4TX8A 5BROA 5G2IA 2TYSA 2E1WA 1DHPA 3NSMA 4HNTA 6REQB 3QZEA 3BLFA 2XZ7A 5JBFA 3IK4A 3PZVA 1XW8A 2VX4A 3VC6A 4DN1A 2WLYA 1RP8A 1US0A 4PMVA 3MO4A 1RLDA 3MSYA 1X1ZA 5CBBA 3FA4A 3ZVHB 4YWIA 4CD7A 3CLMA 4QXIA 3WD1A 1Q85A 4GI9A 4EPEC 4LPCA 3NOEA 2QQ6A 3ZSTA 3HU7A 3CMJA 3UWVA 1QNRA 3TJIA 1K9FA 2V68A 1WXJA 2OO6A 5BRBA 2F6UA 1TG7A 2FB3A 4DWSB 1WUEA 1DWJM 3M5ZA 4UTJA 1IR2A 4FLRA 2G95A 4WLCA 4HD5A 4MADA 4AY7A 4IUGA 4ONVA 3UXIA 1FH9A 4Z0SA 3FOKA 3Q4DA 1W3LA 4TU1A 1XLMA 4TOQA 3GVRA 4S3FA 3AHVA 2YPIA 1NY1A 3UZYA 1SPQA 4JTFA 1CB2A 3P93A 4MM1A 3H55A 4M24A 2IS7A 3MV01 3KTCA 4D1JA 2O4MA 4AF0A 2J7FA 2GJLA 1JCJA 4YJ5A 2BZNA 1O95A 1AQHA 5I3DA 4GJJA 4DPPA 4BF7A 4YHGA 5D2TA 3SUTA 3VKKA 4WK9A 4J3VA 1U1JA 3S6OA 2GK1B 3NL6A 4PUKA 5DBUA 4JNMA 1XM3A 2Y7FA 3DBPA 3KE0A 3G1YA 1UR8A 4Z1DA 1T0OA 3TC3A 2NV2A 3HOJA 3MS8A 1WZMA 2I14A 9XIAA 3SCUA 4JQ2A 4Z1CA 4WOZA 1UR9A 5AZ0A 1TE6A 1OG6A 1MVYA 3AUJA 4Q8TA 3QGAC 5EYWA 1XUZA 5L6UA 2AGKA 1JZ5A 3PNUA 3YPIA 2Q02A 4WDXA 5FEWA 3O9NA 1AH3A 3S2LA 1S5WA 3HBLA 4GUHA 4NL1A 3FN9A 2P53A 4IXHA 3N6HA 4R7WA 3UY7A 1EPVA 1UUOA 2ISDA 3U5YA 3M41A 1JI2A 4G7EA 4B90A 4LAZA 4L4MA 2XDFA 1WDSA 2I7GA 2BTMA 4B9YA 3M47A 3W3OA 3LDVA 2F8QA 5LHFA 2YFOA 4GH3A 1G69A 3RR4A 3WLMA 1KFLA 1JRBA 2PLCA 4NZ4A 3STEA 3TR9A 5EGRA 1WDDA 3P80A 3WD0A 3E6EA 1A50A 2WJZA 1PDZA 1XGDA 1A5AA 3I3BA 1LUCA 3WLNA 3CXOA 1Z48A 4G8TA 3VFLA 3KTSA 1X6LA 4JTJA 1TQJA 2PDXA 3RFAA 1QI4A 3L2IA 3CIXA 2WMGA 2V5BA 4B3ZA 5TD4A 3IGUA 3AIEA 3ZR4A 4FNRA 4OBSA 5DMMA 4NAFB 2C18A 3CZLA 4JNZA 4PMRA 3BAIA 2E6FA 3GU9A 2DH3A 2PRLA 3PN8A 4BJHA 3GLCA 2HROA 3MWCA 5EBUA 3HGJA 5LA1A 3MO7A 1GVIA 2NXHA 1TJPA 1J0IA 1VBUA 1O1ZA 3LHTA 4GIAA 1Q7ZA 3PJWA 4E6MA 4PRRA 4S3DA 3MJYA 4AG0A 3CMGA 1CXEA 1UWRA 2GLKA 3ZQ9A 3NSXA 3DI0A 3E5PA 3P62A 3I65A 5DRCA 1UCWA 3RU6A 4I5UA 2P3EA 1RQHA 1FY6A 3E1F1 3O8AA 5EMKA 1LRTA 5D8ZA 1E1FA 2XH4A 4H6KA 5EMJA 1HNYA 3SN0A 4BHYA 4W4QA 4QBXA 4M29A 3EWUA 1OCJA 1V08A 2RKXA 3TC6A 4GWEA 1QUMA 1C91A 1KRMA 2HVOA 3DIPA 1RBLA 3ZZ1A 1YQ2A 4HA3A 2F6KA 4RJEA 3F2BA 4DUWA 5D33A 5BXRA 3VYLA 3QHMA 6ALDA 5ABFB 1YDNA 4DO7A 1W3IA 3M64A 3S2JA 3DFOA 2A6NA 3WDQA 4IMCA 4AD1A 4RKAA 4LEQA 3T78A 5I2UA 1OBAA 4AQLA 5BCAA 3SCRA 2FFIA 1H1ZA 4HP5A 1GT8A 4DJFA 2VFFA 2O7QA 1PS9A 4LVBA 1OD0A 3TSMA 1CLVA 2F6XA 3DERA 1H5VA 3WLRA 3STFA 3OG3A 1QASA 1G94A 3UVAA 2BOGX 4BR1A 1S2AA 2VT0A 1XKYA 3SI9A 4ZGYA 3T2QA 4LNYA 4JTDA 2BXYA 3CT2A 4Q6JA 4IX2A 4JIRA 3AIWA 5DO8A 4NIRA 3H21A 3MBDA 2R14A 4UOZA 1X96A 1MUCA 4DYEA 3PZMA 2ZIDA 1MQQA 4AXKA 1YDYA 1OK4A 1PUDA 1P0DA 2IKHA 4W9TA 3BLIA 4BI6A 5D30A 1EGVA 3S46A 4ZOEA 1KO0A 4QJ3B 5M03A 1W17A 2FHCA 5G1MA 5AECA 1E4NA 4IJBA 2C6QA 3E3HA 4EPDC 3P0WA 1SJBA 2B7NA 2MUCA 1EBHA 3W2KA 3F7JA 2VEIA 5AHLA 4BFAA 2OLAA 2BX7A 2PC8A 3OHMB 2FTPA 1A5SA 3PY2A 2A1YA 4ZQPA 3L7RA 4H00A 4EXAA 4HVXA 1UBPC 2B7PA 4XAGA 1RVGA 4M6QA 3S1UA 3WF1A 5CQ1A 1HKVA 3CS2A 4H19A 3VDCA 4OTKA 2QHAA 1WDRA 1EYEA 3B8UA 3S4TA 2INZA 1E6SM 5HULA 4AX6A 7TAAA 3NZQA 4ORIA 1TV7A 3QV6A 2AMGA 4ZCWA 3UVIA 4S3EA 3RJYA 1E0VA 2J4GA 3DYOA 5G5IA 1UD4A 4MWAB 1OX4A 3UG4A 3QTPA 4RNIA 2YCIX 2GOKA 3WD4A 3G1XA 2I56A 3UWWA 1IYXA 3TZFA 1DPMA 3B0XA 3TE9A 3ABZA 1DHKA 3FSTA 4CCEA 4F48A 1GZ1A 1ODUA 4MDOA 3V0UA 1BTCA 3R12A 4TXEA 3IUDA 1VFLA 3S6DA 4JN6A 1DQUA 3AJ7A 3UNDA 4XAYA 1Q6QA 4FALA 1SUXA 1E3XA 1LCOA 4WSKA 3P5ZA 3ZWSA 1RY0A 1VYRA 1UWIA 4FO4A 1YDVA 2PTZA 3K2GA 3PSVA 1PKLA 4KFNA 3LZ3A 2NSXA 4AU0A 3RUBL 5AVNA 3W7MA 4F2BA 3UJ2A 2E25A 4ENLA 3S6TA 4WD0A 3TFXA 1Q6GA 2C8NA 3ARRA 4ACZB 3WF3A 3DC0A 4KCVA 3ZOAA 4HHMA 1ZP3A 1YBQA 2ZADA 3LERA 4GQQA 4LYPA 3W37A 1UZ1A 1XIHA 2GJXA 3LK6A 1LJYA 5EKYA 4AB4A 4IPJA 2Q71A 3A4WA 5CC5A 1TX0A 3VOHA 1IXOA 2FLIA 5AN7A 1X1NA 3J7HA 3TJ4A 1HKKA 2XWDA 5CLTA 1J0HA 4L65A 3PWAA 4PTMA 4BA0A 3EPMA 2OX1A 3N2TA 2YZRA 1D3GA 3WQGA 1C3FA 1R2SA 3UY8A 5F4WA 2X1UA 3TCEA 2XINA 3PFMA 2EEXA 2MANA 3M6DA 1YTEA 1E6RA 3W7QA 3WLHA 1ZP4A 2VQTA 1RP9A 4LB4A 5CGTA 1PO9A 1FCUA 5H8MA 4QAWA 2GVGA 2ONEA 4JHMA 1GTEA 5FD0A 3VCRA 3BLEA 1UR3M 3ERPA 4LS2A 1SO6A 1Q8JA 1R9YA 1ZENA 2OQLA 3LA4A 3UR5A 2OZ8A 1NOWA 1DJHA 3WQVA 1A5KC 4PTWA 3PTMA 1F3TA 3OVGA 4IG2B 4UNIA 3KOYA 4PUDA 3N29A 2VR2A 4ADTA 3R0UA 2DGAA 2O9RA 3VZZA 4OUEA 3U8GA 4Z08A 2YR1A 2Z6JA 3ITXA 4C65A 3GYEA 3MVIA 5BOOA 1B3OA 1TPDA 1BPLB 3GSMA 4NSBA 2QJMA 4QDWA 1QHPA 2ABBA 2QCMA 5FJJA 2IPJA 4DM1A 3TAOA 3VC5A 4DQWA 2GJNA 1BKHA 3ZVIA 3TW7A 1DYSA 2ZTJA 2YA0A 3V3WA 4OHQA 2QF8A 3BVJA 1X7IA 1M68A 1BGGA 2ZOXA 4UFLA 3UPWA 1JPDX 3BLOA 3FCPA 4M1RA 2NT1A 1YEYA 2XIQA 5A6AA 4PUMA 3LHVA 4EAYA 2D2GA 1TPEA 4PBGA 3UYIA 3QPZA 1D7FA 4JKLA 3S5YA 2JKPA 3SEPA 1J4EA 3NQ2A 2OG9A 2QAFA 2Z27A 4WR3A 4RDYA 3M1ZA 1WV2A 3N34A 4S3GA 3MI6A 1XP3A 2OX4A 3WH9A 4GGHA 3EZ4A 1S2CA 2QPUA 4M82A 4HIBA 5IDZA 2Y8KA 1F4AA 3FFSA 3O15A 2BGQA 4QGCA 2YFNA 3GFZA 3LHWA 3RJXA 4OQVA 2CLFA 3T6CA 1NDYA 1RJQA 2Y1HA 4KEMA 3P84A 3CGTA 4GABA 1B9BA 4GVGA 3CWNA 3RN6A 2E5BA 4S23A 4LCRA 1FVPA 4GCAA 2BG5A 1XWYA 3FDKA 4AX7A 2Z2BA 4XZBA 4G1KA 2C13A 2EO7A 4JTKA 1NM9A 2G3JA 3NO5A 1QO5A 2JKAA 2ZTKA 1WZLA 2EG6A 4CVUA 3CH9A 4ADUA 2PDNA 1LLOA 3AXIA 3LXBA 3O06A 4JL1A 3O05A 4XVEA 5HJXA 1EL3A 1Y65A 2WVSA 3DHDA 2CZVA 4LCSA 3WNMA 2NQ9A 3ZS4A 1UKTA 1JIBA 1L6YA 3AIQA 4W5UA 4L9ZA 4HPNA 4S1FA 3QTGA 2WYSA 1M65A 2XTKA 4F2TA 5K9DA 1SFLA 1HKWA 1EF2A 3KS5A 4ATWA 4YTTA 1QW9A 1IF2A 3KZSA 1QI5A 3DHUA 3OJGA 3WH8A 3M0HA 4HMDA 2XYLA 3RM8A 3TQPA 3WZ0E 3I10A 4C5ZA 1I0BA 4HT3A 2O7SA 5BRPA 3CK5A 4C60A 4N9EA 3KRUA 1QNQA 2NWSA 3EXSA 1OFDA 2VFIA 3AU2A 4GPNA 3LEPA 1XLEA 4PRWA 4IP7A 3WBXA 3NQVA 2BVWA 4LU0A 4LWWA 2R8WA 2ZXDA 3DOPA 2CEQA 3U7VA 2CC0A 2ZZ4A 4WKAA 2FGZA 1XC4A 1JCYA 4MSSA 1AFSA 4DBWA 1RCXB 2PD9A 3JVAA 4KIRA 5C9XA 1KM4A 5DQPA 1QWKA 2DV0A 6TAAA 3L4WA 4HPXA 2WVUA 4C91A 1T40A 1JPIA 3NQAA 4E8GA 3IIVA 4WDTA 4C7FA 1GG0A 1UPMB 3SJ3A 1ZBWA 3GIQA 4JTHA 3EWDA 5CJMA 3ZT7A 3WIJA 4AHPA 1KWKA 3KFTA 4M80A 3R8HA 4CQBA 1JZ8A 3V5OA 1FWRA 3IUHA 1HTIA 2WZTA 1DJIA 2W62A 2IUZA 3FNDA 1V93A 3B9OA 1BXNA 1CW2A 2YL9A 2YYUA 2F9RA 3ZWTA 1KBIA 4E3VA 5E9AA 3IJIA 4C6PA 4I7VA 2WMKA 1LG2A 2PWEA 3VGDA 1V6YA 3GAKA 1C8YA 3W82A 3TNOA 4X0NA 3N4AA 2VX5A 2EG8A 1XIIA 3GNPA 1FXQA 1BYCA 3QQ0A 4IFOA 4IIBA 3UWEA 4H6RA 1WPCA 3JW7A 4K7VA 1RA5A 1QDSA 4UOJA 2RUSA 4QR6A 4JL2A 1AH0A 4X3ZA 2WNZA 2CPUA 3L67A 3R7MA 4NASA 4QEHA 3KBVA 1XD0A 1TUXA 3V36A 1NQKA 2QXWA 4NYYA 1ADOA 1E73M 1ITQA 4JTLA 1JUEA 2ALDA 2G3MA 2IKJA 4J2PA 3ARPA 3LZ5A 1UG6A 4GZJA 3QOMA 3AS0A 2BMBA 3P6LA 4YTSA 3CT7A 4PBEA 1PZ0A 3ZM8A 6REQA 2BVTA 3NPWA 4PMOA 3CBWA 3QF0A 5TAOA 3LV5A 4ZE5A 4DYJA 3UPMA 1T8XA 4W86A 5I3KA 4OFCA 1SZEA 1ZGDA 4U2ZA 4LS0A 3ZVHA 4GYPC 3O7UA 4FAMA 3E49A 4EAMA 2CXGA 3K46A 5EU9A 3WQCA 3TMLA 4AHOA 3D3AA 3H4XA 4J4KA 3BV4A 2ZZ6A 2Y7GA 4A3YA 3H2OA 1UP3A 3AMGA 1UD6A 2EG7A 3MP4A 4OWGA 3WH5A 1LL6A 3BAKA 4XD4A 5HINA 2EBNA 1W1B1 2ZKMX 3O63A 1CEOA 5C54A 3PUGA 3K8MA 3EMCA 4X22A 1W31A 2PWHA 5HPOA 1GKQA 4WCJA 4ZA0A 3TEVA 4KS0A 4P7LA 3D5HA 1XDMA 1UH2A 2VJXA 4LUJA 4UNKA 3POCA 3SW6A 2JIWA 3MUXA 3WH6A 1IWBA 1XBVA 1VYPX 3EXRA 1DWAM 4H8UA 4UQBA 4XZMX 3RLUA 3BL3A 2O9TA 4DWSD 1OC7A 1CWYA 2E68A 1KW1A 2HPMA 1FP8A 1R8LA 5AYXA 4WKFA 4UCFA 4GI6A 4XD6A 1RLCL 3GH5A 4HU4A 1QK2A 4FNUA 5DF0A 3LGDA 2WV8A 1A3HA 2A3LA 1NWUA 1KFEA 2PE4A 3L2MA 4I9JA 4HN8A 1V3LA 4C6NA 4Q4PA 1WYIA 4N02A 2A7PA 1NJJA 3HIJA 4WDWA 2WMFA 3WK0A 3VIOA 1KRCC 3P7YA 3G3MA 2WJFA 2QCCA 1AW2A 3NCOA 3GTIA 1XH0A 1XXXA 2X0SA 1AZ1A 4Q4KA 5AC4A 3GW3A 1I60A 3E02A 3M0VA 3HG3A 5EMUA 5HMFA 3B05A 3AIRA 3N9RA 1JQXA 4H9VA 3TJLA 4GFIA 2FFCA 1TIMA 4BI5A 2QIWA 4IFKB 4MNJA 4H2HA 1XINA 3R58A 1GVFA 3GE7A 5A69A 3ZO9A 3GXPA 1HFBA 1EFZA 4A3UA 5SWUA 2CLHA 1DIEA 4UBPC 2I16A 1FP9A 1OCNA 2RJGA 1BXBA 3ORWA 3A6OA 4QE5A 2WBKA 2OT1A 1CTNA 3W86A 4HZ7A 4K8EA 4NAFA 3ZLGA 2W92A 4U33A 4FX7A 3W7CA 4LT9A 2YCEA 4F2UA 3ZT6A 1NOFA 5F4XA 4XKYB 3NPUA 1Q6CA 1UWQA 1XRSA 2E3ZA 3MZ2A 4QG6A 1ODZA 2PBOA 1F76A 1AL7A 1J6PA 1OYCA 4XWUA 3PBVA 2WANA 4CVWA 1V6TA 3GX9A 1VFSA 2ZRUA 2A85A 3R0DA 4BF5A 2XGBA 3DI1A 5KMYA 1H0IA 1W3NA 2FPVA 1OFBA 3W27A 5DBTA 2J7DA 3SUUA 5H8UA 3M5XA 2B31A 4UFKA 2ZBTA 3UR2A 4IPPA 5GJPA 5U4NA 3O0KA 3MA8A 2CZ5A 3M0LA 4OVXA 1ZLPA 4B5VA 2QCHA 2FPYA 1TPUA 4C7DA 1TV8A 1MXSA 1PIFA 1VAHA 2PP3A 4ZFCA 5D04C 1I8JA 4I90A 5IRPA 1V5XA 3OBKA 5DMLA 4NNBA 3C0JA 3P14A 1MEIA 1P43A 4B91A 1TVNA 4NT0A 1Q7MA 3RNDA 4DO5A 1C9WA 2CLMA 3SRKA 1IIHA 3A3WA 3W87A 3ZLFA 3TQ0A 4IL2A 4DJDC 3REQA 3HN3A 2PDLA 4H2CA 3GG7A 9XIMA 3NYZA 2Y0FA 1ECEA 3E5BA 1MFUA 4O1DA 4NAEB 4RV8A 4GJIA 1H1YA 3UFYA 1J0YA 1AUSL 3WJZA 4N7QA 4CNUA 2ACRA 4GQRA 3W1XA 3ME3A 4B2DD 3TMQA 5DANA 2HRWA 1K8ZA 2AAMA 2VX6A 3H54A 3EWZA 3A64A 4IX0A 3C2OA 4AIEA 3KWSA 2ZFAA 5FL1A 2DZXA 3OG2A 1CGVA 3P3BA 4IF2A 1JDCA 1ONXA 2GVYA 5KZEA 1PKYA 3HF3A 4KCUA 3HQNA 4YTRA 5E0KA 1CGXA 3DG6A 3KEHA 3C52A 1VFOA 1JZ3A 1RJPA 2OZ3A 3COTA 2VZUA 3BOFA 1WO2A 4QDPA 4R33A 1POKA 2CCRA 2GFTA 2VCBA 2WK2A 4LVAA 2EQDA 4L6HA 3ZJ8A 1VCGA 4RW3A 3N9KA 1NDVA 3LX9A 3AZSA 1VHNA 5MKGB 4AY8A 4JR5A 4F0MA 4AD4A 1CXIA 2QJHA 1BFNA 7CGTA 4RDZA 6ENLA 2V67A 1AODA 3H8AA 5FF0A 1FWIC 1K9TA 2INFA 1N82A 4YVXA 2PDFA 1DV7A 2HSAA 4TV5A 1KXQA 1E3ZA 3IVTA 2Q8XA 3R43A 3A4AA 1W3TA 1P48A 3WK1A 4RNFA 3WEZA 2E9BA 1RJRA 1H7RA 3WK2A 3QYQA 1XC6A 3K1GA 5DCDA 3QKZA 3VCCA 4QFUA 3S42A 4DBSA 4IISA 4ZE4A 4NJGA 3CPRA 1H50A 3VNIA 2Z7GA 3WUFA 4FP1A 1P0EA 2PDYA 1NF7A 1I4NA 4MB3A 1GYNA 1J5TA 2DPEA 3WDPP 3DHFA 4U2YA 2DT3A 5FJIA 3A5FA 2OWXA 1QJWA 3WLLA 4WSJA 5CPTA 1Z9AA 2G8ZA 3G1VA 3LY0A 3HPZA 5JU6A 5HATA 1WDPA 2C15A 1A47A 2OEJA 1SZRA 1JI1A 3GHRA 1R3WA 4V2XA 3OLGA