4J2PA

Crystal structure of luxf from photobacterium leiognathi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
228
structure length
225
Chain Sequence
MTKWNYGVFFLNFYHVGQQEPSLTMSNALETLRIIDEDTSIYDVVAFSEHHIDKSETKLAPFVSLGKQIHILATSPETVVKAAKYGMPLLFKWDDSQQKRIELLNHYQAAAAKFNVDIAGVRHRLMLFVNVNDNPTQAKAELSIYLEDYLSYTQAETSIDEIINSNAAGNFDTCLHHVAEMAQGLNNKVDFLFCFESMKDQENKKSLMINFDKRVINYRKEHNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-fluorescent flavoprotein
publication title Structural and biochemical properties of LuxF from Photobacterium leiognathi.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Luminescent protein
total genus 90
structure length 225
sequence length 228
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 4j2pA00
1LUCB 3FGCB 1FVPA 2B81A 1EZWA 3SDOA 4US5A 3B4YA 1M41A 1BRLA 5LXEA 2I7GA 1NQKA 1RHCA 5DQPA 1XKJA 1TVLA 1Z69A 3FGCA 1BSLA 1LUCA 4US5D 1YW1A 3RAOA 1BRLB 4UWMA 3C8NA 1F07A 3B9NA 5AECA 3B9OA 4J2PA 1NFPA
chains in the Genus database with same CATH superfamily
1KTBA 3ZM8A 3VUSA 1IXOA 1ZPTA 2YDRA 3MUY1 2JIWA 3FSTA 3W2MA 4HOXA 2GK1A 3ATZA 5CGMA 2BBFA 4NY2A 3SUUA 3V3WA 1CXKA 1CXHA 1OGBA 2NXGA 3WDRA 1KFEA 2WAGA 5ABGA 4KCWA 2RFGA 4MNLA 3GU2A 2OXNA 1D2KA 4W88A 4KESA 2X2YA 1VH7A 3TNBA 3HURA 1N8WA 3WK0A 4NASA 5ABTA 2ISVA 3UY8A 4O19A 4XZHA 2PDQA 3C0SA 1M65A 1R2TA 2CHOA 2V63A 2PE4A 4F8XA 3CV2A 3WK2A 3TXVA 2BGSA 4H7VA 5EL1A 1VFSA 3G5EA 1GJUA 4IP4A 1E6XM 2E09A 1UKTA 1DE5A 4C90A 1RBOB 4AXNA 3MKVA 3COTA 2OYLA 4B5UA 1B2YA 3SFKA 4DM2A 2DZVA 4K68A 4CNNA 3PSWA 1FTXA 2WM0A 1HXJA 3MVTA 3AYTA 4F66A 3GNRA 2YJQA 1TV5A 3LMYA 1ML1A 1GONA 1DOSA 2DSKA 1K8XA 3W1TA 1MDRA 2CKRA 3EKGA 1Q6DA 1POKA 4EXQA 5I07A 4BI6A 4QP0A 3W22A 3GKAA 4R5EA 1ME7A 2J88A 4KERA 4N0RA 4W4QA 1K9DA 1UR1A 3L21A 4C6MA 3TN3A 5E1QA 3NIYA 3AIVA 4ZXOA 4OIFA 4HTBA 4JNYA 3VX0A 2IMRA 5AFDA 3LZ3A 2J13A 4W86A 4D1JA 1EJRC 2WNQA 3GK0A 3EMQA 2VZSA 3BSMA 4RE3A 3JW7A 2B7QA 4LVAA 3VFCA 3RCYA 3TC3A 3F4DA 3ITVA 4UQBA 3KRBA 1VBUA 3LBCA 3M6YA 4AW7A 4QSFA 1JYVA 1REQB 1R0MA 5FI8A 3KBMA 1JVNA 4IZGA 3PZ9A 3YPIA 4O57A 3UERA 1P1MA 4A2RA 3REQB 2JQXA 2REQA 2NZLA 3PBWA 5CKSA 5HNUA 3HM7A 2OG9A 2OTDA 2HDJA 3MSGA 3IWPA 1N8IA 2C14A 3AXKA 3IVSA 3BGAA 3ITCA 4G2DA 1TJ2A 4K37A 1DIKA 2D22A 2IQDA 3L2MA 3F5KA 1FY6A 1OY0A 2I7GA 4IQEA 1WXZA 4DAIA 1H41A 3RILA 1VEOA 1GHRA 4PH6A 3R1ZA 3MSRA 3A4WA 1VCGA 3TTYA 5JIWA 4JYDA 1XLKA 4U28A 1W9PA 2EHHA 3B8TA 1BVWA 4MY1A 3TUUA 3CV1A 3Q58A 4RNIA 3T8LA 3DCPA 2EAWA 1EP1A 5A8NA 3WQOA 1F3EA 1H7XA 4R85A 4GG9A 3PPCA 4X9YA 4YPJA 2Q6ZA 2PWVA 2OT1A 3MUAA 1GKRA 3L4ZA 4RDVA 4IXXA 4QCFA 3LX9A 2VENA 3V5CA 4R7WA 3APGA 1XLMA 2XINA 1HFBA 4GIYA 5JBDA 2P0OA 1O5XA 2VEMA 1G7VA 2XUCA 1F76A 4WF7A 3IAQA 1OC5A 3HGOA 1VKFA 4J3VA 1A0EA 4J3ZA 1W54A 1V6TA 3RG6A 2XM1A 4K1GA 3WKZA 3KWXA 3L68A 2D69A 3SQSA 4D1IA 1TWDA 4GUHA 3ITGA 3HQOA 4JTCA 4LUIA 3MJYA 2X42A 1OCNA 4F2TA 3TOPA 2QZRA 5BWFA 2H9AA 3GW3A 3GFXA 4K2SA 5FEXA 3GVVA 3FSUA 1I8JA 1LDCA 3F7JA 2W61A 2R9RA 4GQ0A 1SJDA 3N34A 3LBOA 4LY4A 3LENA 4URIA 3S9YA 2NLIA 3MTWA 3S1GA 4ENLA 1QI5A 4PUJA 3EA2A 1JZ5A 3R6IA 1XHGA 1QRQA 2XZ7A 1WKEA 2V5BA 3E38A 2YFNA 3WQ8A 5D2WA 5M5DA 1LORA 2B0MA 5G5IA 5CJNA 1HKWA 4O52A 4LCQA 4N02A 1HGYA 4IIHA 3DUGA 4S3JA 4GGBA 4CEXC 1V6VA 2YDAA 3IARA 4PRTA 4KWSA 1PZ1A 3GR8A 1G9HA 2GWGA 2FTWA 1QI2A 3MQTA 4K6AA 1S2WA 4MYXA 2OZ0A 3ARUA 5FACA 3QPEA 3G1SA 2A1YA 1CB7B 5CEWA 3K13A 4IJBA 1JUKA 3B06A 3Q37A 1YPXA 2GSEA 4NYUA 4E3VA 2Y61A 4AVNA 2VVSA 2J74A 1MUCA 4CNTA 1J9YA 1B0IA 1GVOA 4Z17A 4PCPA 4DYEA 3C8NA 3PF3A 3RX2A 3DI1A 4OFCA 1WZMA 1EUNA 2IPGA 1XRFA 1J0ZA 2BODX 3UXKA 4KKXA 3KOYA 3AHTA 4IGMA 4RPQA 1WAUA 2ZRYA 1HQTA 3RXZA 5G4EA 3MV01 2AGTA 3O0KA 1ONWA 1JGMA 2EPLX 2WSYA 1EOMA 4N9EA 4HNVA 1SU5A 3W82A 1TUFA 3CHEA 2AAAA 5F4SA 1BKSA 5DCEA 3PTQA 1FFQA 4L5ZA 4D6FA 3MPGA 3OP2A 3TOYA 4QDWA 2J7CA 3NQGA 2F8QA 4W84A 5I06A 4JIPA 1QWKA 1UD6A 3CHVA 3T81A 3N2CA 4AIOA 3VD7A 1WPCA 1U1JA 1GQJA 3RGTA 4B4HA 1JXKA 1EBHA 5FESA 3BJTA 5I3KA 2BZNA 4KW2A 4MIMA 1TO3A 2IUZA 5G2HA 3CJPA 1UJQA 4OOZA 4LSBA 3OZOA 3HTWA 4L80A 4C5ZA 4PR4A 3URAA 3GXDA 2QVHA 4DJDC 1WKYA 4CCDA 4WVXA 2ABAA 5I24A 1ZHAA 2G95A 2P3EA 1CWYA 4JTKA 4C1NB 2X41A 3LQGA 5AZ0A 1IWPA 1ZBWA 4ACZA 3W1PA 3QEZA 4AF0B 2G3MA 1UD2A 3FY1A 4C6BA 3LXCA 4IMDA 1FHUA 5EY5A 1WNOA 2XIQA 4ZTXA 4BCEA 3RRAA 3AUJA 3VILA 2EPHA 3PSVA 3FKRA 4JBRA 2ZADA 5A3HA 2BVYA 1FOBA 1OG0A 2DUAA 1KW1A 3ITXA 4ZGYA 3HQPA 3PUDA 4ZCWA 3EOOA 4D8LA 4NI8A 4IFOA 2WVSA 5F2IA 1DJNA 5CCZA 2G3JA 4R34A 3EWXA 4XVDA 1R9YA 2PC8A 5HXMA 1KXHA 5AKQA 3T0AA 1UPPA 3KUMA 3PTMA 3TMQA 4S3CA 4XAYA 1FWHC 4M24A 4Z2IA 1Y8BA 4YTRA 3GHRA 5CQ1A 3L66A 5G1MA 4ZO8A 2IXVA 2HXTA 1V3JA 3WJSA 3NO3A 1Q7QA 1XYFA 1Z48A 2D2HA 3R8RA 1XH2A 1VENA 3GD6A 5HK4A 4KT2A 4L4OA 3K30A 1MMFA 5DMYA 1RQHA 2E6DA 1KFLA 1BEUA 3NL2A 1W31A 4R3UA 5HQEA 4JTDA 1AG1O 2PGWA 2NXIA 2OVLA 1XLJA 1B54A 4C7DA 4DJFC 1G4TA 1IWAA 3FCPA 8XIAA 1JD7A 1LOSA 5JIPA 3N2XA 3G1VA 1XDMA 3R2GA 1P43A 1SO3A 2OR2A 2WHMA 4YCOA 2QKFA 3LCXA 1YXDA 3POCA 1HUVA 4L7ZA 1TPC1 2V2CA 3L4XA 2NQ9A 4GNKB 2P5NA 1XLIA 2Y7GA 2OCZA 1S2VA 1NH6A 9RUBA 1SYTA 5C7VA 1VBJA 4PZVA 1J0YA 3V36A 1H0GA 1K4GA 1TKKA 1LWIA 2V8ZA 2ANUA 1KRBC 3LTSA 3SUSA 1NELA 3KX6A 4TX6A 4U3AA 4X63A 1Q2RA 4QEEA 1R3SA 4UFLA 2BXYA 3WDQA 3L5LA 3PFMA 3T42A 1HX0A 4I7VA 3BLEA 1JNEA 1XYAA 3GC2A 4F0RA 2OPJA 2W66A 3LRKA 4ECLA 2V3DA 3UF9A 3B03A 3G18A 3EZ4A 1IIHA 3FGCB 4NJGA 1RCQA 1DJIA 2VELA 3L2LA 1E0UA 4IGSA 3WQFA 4WOQA 2VGBA 4TTGA 5DBTA 4GISA 1R38A 2YR1A 3A9IA 3HGRA 4D6JA 2G8ZA 4M7SA 3VKAA 4AD1A 2O9PA 2G4JA 3GXTA 1QNQA 4JKLA 5HQMA 4RZ5A 2Y5SA 1H7WA 3N14A 1FHVA 3M47A 4JQ1A 1XGZA 3W25A 3CGTA 2BY1A 1F6PA 1UD4A 2ZFAA 4EPKA 2QR6A 1X8CA 5HANA 5HNNA 2J6VA 2DJLA 3DN5A 3F4CA 1EJSC 5I3DA 4V1XA 2DY3A 3CEPA 1SZEA 3NZRA 4KQNA 5BU9A 1YXCA 2WJEA 3CT7A 4W89A 3S1VA 2VR5A 1V08A 3WD3A 4HPGA 5AVHA 4AHOA 5L9FA 3L4TA 2CFFA 4B5SA 5F2LA 1OFDA 3ARSA 3DYOA 1KNWA 2WVUA 1VBRA 3PJWA 1I0BA 4BWLC 1YE6A 2VDGA 1GJWA 3IIVA 4QS6A 4D2JA 1OT1A 4GQGA 4AX7A 3WQ6A 1AL8A 1KO0A 4K8GA 5EA9A 4QJ5B 4DBUA 4ORMA 2W6RA 2VURA 1GW9A 2OEMA 2G50A 4GNVA 1WUFA 4OBTA 3PC0A 4W8AA 5FOOA 4A35A 1LG1A 4MAZA 3FVDA 1ZRQA 4N9DA 3FN9A 2W92A 3GE7A 1MYRA 4DYJA 2NSOA 1RV8A 3OYZA 2VXNA 1BAGA 3DX5A 3CIVA 3LXBA 4PMJA 2FPTA 4R53A 4WLCA 2O55A 3UGRA 5DQPA 4QJ3B 1QNRA 1KRAC 4GVFA 2BOGX 5ENLA 3GFZA 2GFTA 2PDGA 4H8NA 5LIUX 3R8GA 2V2HA 2ZUMA 5DANA 4BQ3A 3MY9A 4LU0A 1W3TA 3WLMA 4NAFA 5T8GA 1POJA 1P4CA 3R10A 4GI9A 2RKXA 4GCAA 4Y6GA 4PMDA 5D38A 4ALDA 4MWAC 1HKMA 1OG6A 4NKCA 4B90A 1GYNA 3UESA 3OB8A 4XK2A 4G6CA 4BF9A 3SCQA 4ZB2A 1QOQA 2R6OA 3QYSA 1OHLA 1OYBA 3N12A 5JH2A 2YGYA 4RXGA 1NM9A 4J5NA 5A6KA 4JTRA 4XIMA 4R9OA 3G3DA 3M5XA 5DX7A 2V67A 2PGEA 3RDKA 1HNYA 3CZKA 1DL3A 4Z2HA 1Q6EA 1QHOA 4EWJA 1O6IA 1YNPA 4AX6A 4M8UA 3CU2A 3FS2A 3TIMA 2VC6A 1OYAA 3QY7A 5FEWA 2A2IA 1LWHA 3AS0A 1P6BA 4Q4KA 3VFLA 2UY5A 5MKGA 3KCJA 4RKAA 2BOFX 4GC4A 4RDZA 3VDCA 1OQFA 4EX4A 3T2QA 4HJFA 2CU0A 1ENUA 1BGAA 1R9XA 3GTNA 5M2FX 4ERGA 1V0KA 4NRSA 1S2TA 2O56A 1FWCC 4O1FA 3BICA 4Q7BA 1SJCA 3QY8A 1XW8A 2RDUA 1P0EA 2CWXA 2ISWA 5CLTA 2D24A 5LIXX 5EPDA 3M7WA 1E6NA 2WSPA 1TUXA 4GYPC 1DWGM 1VGAA 3EWCA 2ZX5A 3THQA 4C5YA 3VIPA 3D3AA 2G0WA 2JALA 4MKVA 2VCCA 4WKHA 4EWND 3QN3A 5C70A 2H8XA 3CWHA 4PFHA 3N6QA 1JUEA 2CZDA 3VCNA 3WO8A 2XM2A 1J5SA 2J9ZA 3LG3A 3M7SA 2R24A 1O4UA 3P0XA 4D9PA 2AQWA 4ZMGA 3OBKA 4LUSB 2O7SA 2FFCA 3O15A 4GRSA 4QG6A 3RCMA 1WA3A 4WDTA 4AD3A 3S1UA 3R0KA 3TN6A 1FCVA 3SJ3A 3ZVHA 4JX4A 7ENLA 5H2ZA 3OVGA 1KV8A 3D3FA 3E0FA 1M03A 2Q02A 5KZDA 1ISXA 5AHNA 2GUUA 4OECA 4TV5A 3SCUA 2CZEA 4IT1A 4S3GA 2FZNA 4ADUA 3RLVA 1DIDA 4O28A 2VD9A 3CEUA 2W67A 4QLLA 2PDIA 4UR8A 3QZEA 4DELA 1RQBA 2UY4A 5LA2A 1DHKA 2I14A 1KWGA 2A3CA 2DV0A 4DZAA 4UQDA 2QV4A 1AQHA 4DJEA 1LZOA 4PEEA 4HQVA 1E4NA 1T7LA 3GDRA 3WQCA 4GUIA 3CLWA 4JHOA 1FH7A 1HJVA 3FVMA 1LL6A 4DBWA 3UD6A 1VPQA 3EBVA 1PHWA 1MEWA 3SCOA 1XIHA 1TJRA 2QCHA 2ZOXA 1ADSA 4MTVA 4K8HA 4KETA 1BXBA 3D6NA 1PZ2A 3QC3A 4LALA 3H7UA 2PEVA 1RXOB 2X1SA 2PDHA 3FX4A 1KLYA 1RA5A 2ZRVA 2VT0A 5BROA 3KZPA 3CQHA 1CX9A 4H2HA 3WLQA 4HPHA 3CYVA 2HJPA 2F61A 1R7AA 3VKKA 3B04A 3G1XA 2AKMA 3M07A 2VQTA 5I00A 3L4VA 3I3EA 1F6YA 4IMAA 3U0HA 4MUPA 1K6AA 4C1KA 4HNCA 4MPKA 4PCTA 1GEQA 3GYEA 1KRCC 1V02E 4GACA 1CGVA 3PUEA 1FRBA 4HHMA 4EPBC 2O0TA 5BXPA 2YXOA 1LBMA 3QSTA 4AC7C 2PP3A 3W76A 4A22A 2J7EA 5A5WA 3SGUA 1I2QA 2CLFA 2PU0A 2Z00A 1QR7A 4X2PA 3T0BA 2CW6A 3ME3A 1XYCA 3MWAA 1R3RA 4YVXA 1VBGA 3QOKA 1R7OA 1U2YA 1JCJA 1V93A 4MAVA 4G9PA 2PDXA 4FZIA 3WQDA 3LGEA 1X6NA 2GL5A 1H7NA 3TC6A 1QPNA 3HMCA 4HCLA 1H7PA 1ZBCA 2QCDA 5GJMA 5AC7A 2X1RA 1YPFA 5KMYA 1CGUA 3LRLA 4D6DA 4DB7A 4GLEA 3VNMA 1DXEA 3H2EA 1RK6A 3NCOA 2ZRXA 2E9BA 3Q67A 3K8MA 2Z6JA 1SFJA 4WY0A 2NX1A 4XAFA 5G2WA 4NNCA 4CUCA 4J3SA 2D2GA 1J10A 5I3FA 2FTPA 1P0KA 4G1KA 4EAYA 3HIJA 5C9XA 1FWDC 4H6EA 3BCJA 1V51A 1Q66A 2J79A 4QR6A 3AWOA 3GWQA 1JZ3A 4LF2A 3NQAA 2UWFA 1JZ2A 3H12A 5C2CA 2ATSA 1M1BA 2OT0A 3P7YA 1HKIA 4D6IA 2Q8LA 2A85A 3HFTA 4PSRA 5CJMA 1BQGA 3EDEA 3A3HA 1K9FA 1A5KC 1H61A 1TX0A 2E9MA 4BQ4A 4GK8A 2OODA 2Z29A 3PK7A 2W9MA 1RVKA 4HNUA 4FI4A 4XG1A 3NQCA 2Z7GA 4TXEA 1XKYA 1R2RA 3OHIA 3E5PA 4HPXA 2WCSA 2V9DA 3EXSA 2ESCA 3UXDA 1O5QA 3VZXA 3SO7A 2HQAA 4KEMA 3I10A 1XIGA 5HOSA 2NUYA 3VD5A 1JDAA 4P7NA 3KL0A 1TWIA 3W37A 1TA3A 3S1WA 2OLHA 3Q2DA 2XFFA 2EF9A 1WB0A 2CKSA 4HTYA 4WUIA 1YDOA 1J0KA 1BHGA 4GXWA 3RAOA 3I65A 3LNPA 2VC7A 4LWWA 3GS6A 2CETA 2WNZA 3E0IA 3QR0A 4HN4A 4IMGA 1JF6A 2PD5A 5EU9A 3NEHA 3IGHX 4HHPA 3TA9A 3F2CA 1SO5A 3DIPA 4YLWA 1WOAA 1MQPA 4D6CA 3RLUA 5HNTA 3GH5A 5DT7A 5I3HA 5AYIA 3VD4A 4N9BA 4IP7A 3VINA 3WK1A 1B9ZA 1UUOA 2YCEA 3IAPA 3MP3A 4MY8A 4GZEA 1F3XA 3QKEA 1XH0A 4UZSA 5A8QA 2BV9A 1K8YA 1EX1A 4UFHA 3VIGA 1H49A 4JTIA 3NQVA 1ONRA 5ABEA 1KBKA 3ICJA 2J6XA 1VLWA 3SURA 4FLSA 3VI2A 2EG7A 1NOFA 3RR4A 4U31A 2IKJA 3GVRA 3W2KA 1EWDA 1ZL1A 3ZLHA 4DY1A 1HL9A 4ZENA 3FXYA 4Z08A 1L6SA 3B8VA 3E2SA 3GDTA 1B5TA 1R3QA 4NJHA 1ZU8A 2PDYA 4UTIA 3VNJA 4DJED 1EPXA 4A8RA 3G77A 4DZ5A 4JHZA 5HWNA 2QUNA 4AYGA 3WN6A 2DIKA 5E9XA 3P5ZA 4MSSA 5RUBA 3QLLA 1KFBA 1ZZMA 3M0HA 2VFHA 1VJZA 3LPGA 4DO6A 4FXSA 3UJEA 5BCAA 2OMAA 3ABQA 3L0NA 4PULA 2PB1A 2QPXA 4FNUA 4IM4A 5DMLA 4H83A 2GVJA 5CZTA 2XFWA 3GG1A 4F0LA 1XQLA 2W4XA 1KCZA 2GK1B 2F6KA 3AHYA 3DC8A 4I9TA 3ENLA 1PB0A 1U83A 4XKYB 3S2MA 3CHCA 1I75A 1PKLA 2PWFA 5I3GA 1CGYA 2VRKA 1JCNA 2DJXA 5LA0A 3HBLA 2AMXA 4MKSA 3U5YA 2A7PA 2V5CA 4CD4A 3QQWA 1QHPA 4LC8A 3SSJA 1UWQA 2YL6A 4OGZA 2F6UA 3M43A 3VU2A 3EAUA 4LVFA 4PN2A 3OEXA 4BF7A 1SR0A 3MVIA 3P67A 5BMWA 3N4EA 2HE8A 3AXIA 4PUNA 2VEPA 1GJPA 2JBMA 3NQ2A 1F4AA 3THAA 1WDQA 4HYVA 3VOFA 4AZIA 4D8AA 5DN1A 3W1RA 2PDMA 5AVNA 2CLOA 1FWGC 1PV8A 3M0MA 4IPIA 1XX1A 4FR1A 5FJUA 4Q6XA 3UWUA 4NAEB 4YTUA 5AZ1A 4CQDA 2XSXA 4B3LA 1F7BA 2VEFA 2INEA 2EG8A 3MJMA 2ZBTA 4KCVA 1C9WA 3VIKA 4OVXA 3W1LA 3UGVA 1S39A 3B8IA 3VNDA 1W3LA 3II1A 4B5WA 4XKMA 3N18A 3MI2A 1Y65A 2VFFA 3VNZA 2CLMA 1UD3A 4Q4QA 4QROA 1T8QA 6CGTA 4R88A 1NVMA 3O1NA 1GG1A 2X1IA 3LERA 3OG3A 2E28A 1OM0A 1NFBA 4PYSA 1VFMA 1OD8A 4PCFA 3PVFA 4LNYA 2PCEA 3XIMA 3TE9A 4S2BA 3UWEA 4BQ2A 2X09A 4XD4A 1TQXA 3JS3A 3PUOA 1A5LC 4DBSA 1CXFA 4TQTA 1PYMA 4RE0A 5A6MA 2ZKMX 2OX4A 2YKKA 2Z2UA 1P7TA 3V0TA 1OD0A 4LY8A 4B15A 1UC5A 1UJPA 3CUXA 4ZQCA 2F2HA 4JTTA 3ZIZA 6REQA 2YCKX 3CPRA 5I7GA 3VA8A 2REQB 4J7RA 1SSDA 1K9TA 1ITUA 5FKYA 3VIMA 4IIDA 3WL1A 4A3YA 4KEUA 4YL2A 2ZA3A 2QIWA 4HJWA 3NR0A 3BV7A 3B9EA 1QT1A 3MI6A 1L8PA 1W9DM 1MO0A 1RQEA 4S38A 5LNWA 4K36A 1AMKA 4LYPA 5DCDA 4MNKA 3AQUA 4HK5A 1E6ZA 3IV3A 5TAOA 4F4RA 5LIWX 1X1ZA 2V2DA 5EFDA 1W8GA 4EVZA 1W91A 2PZ0A 3W6YA 1WUEA 4H1ZA 4OTKA 3PULA 3SCTA 1PHQA 4QQUA 1BVNP 4Z1AA 3GR4A 1I60A 1TTJA 1FHLA 1FWEC 3E12A 3T55A 3AJXA 7CGTA 1JZ7A 3GC5A 4UQEA 2VOTA 2VHLA 2TYSA 2BGQA 4U4MA 3QPYA 2V81A 1D7KA 1XH1A 2ZRUA 4CNUA 1TRIA 1GOWA 5LA1A 1UKPA 4NP7A 1RJRA 1ZP4A 1XXXA 4HKPA 3SBFA 1CGWA 3BXWA 1ZNNA 3BG5A 2FJUB 3WLRA 5F1UA 2DVXA 3MMDA 4IIBA 5B80A 4CCEA 1L0PA 3VE7A 4BZYA 4GJ1A 4A3HA 3W26A 1SZNA 4HZ8A 1XQKA 4Z2LA 3D46A 2X16A 1H09A 4GYFA 3T6CA 3PPHA 3HG3A 3T44A 4PBGA 1J18A 4H7ZA 4PTDA 3DXIA 1X1NA 1PWLA 3CMFA 2H9AB 5KINA 4KBXA 4FLRA 3NQ8A 4KRUA 4JTLA 4IPNB 5LXEA 4UTWC 3MWCA 4KGJA 1XSIA 3GC4A 4ZXLA 4O1AA 2OSYA 4IPJA 4E2BA 3SAZA 1R2SA 8RUCA 3W7NA 6XIAA 3QRHA 4KWWA 3N25A 4X22A 5CPQA 5DELA 4GWEA 1C9DA 4O14A 3OYXA 3OODA 3B8UA 1KXVA 4MNJA 1W3JA 2V5KA 3QW4B 3W7OA 1PIFA 5D9PA 2OZ8A 3DERA 4JIIX 3A47A 4QRNA 4BEQA 3DYMA 4JFSA 4K39A 4JFUA 4EF8A 3EDJA 2G3FA 5K9DA 3W7HA 3ANUA 1F05A 3A4JA 2Y7EA 3W53A 1Q4WA 1YDYA 5EMUA 5T9BG 3NURA 3VTRA 3CH9A 5A6SA 1J8VA 4HCDA 3LHYA 5A8GA 4LAZA 3QPZA 4KF1A 3RLGA 4DWSA 3BARA 4GPNA 3WCZA 4GNJA 1UCWA 1CB2A 3MHGA 3VM5A 2VR4A 1UC4A 3LHTA 2JGYA 2E6YA 3LCWA 1LROA 2PAJA 4JTFA 4GVHA 4PB4A 4FO4A 4KEVA 1A0DA 2YL8A 2A7NA 3MB9A 3KBVA 1HKJA 3FHAA 3L12A 4ZSUA 1Q7MA 1RP9A 1JRBA 3I6TA 3O3RA 3DESA 3EOLA 4IQDA 4CQAA 5K7JA 1BWVA 1PKMA 3H54A 4TMCA 3ANYA 3OLGA 4X2RA 2CXEA 3SIMA 3M0ZA 3T7VA 2AL1A 1XD0A 3GXMA 4HMDA 1RCXB 4GVGA 3RX4A 2DW7A 4ES4A 1QNVA 4EANA 1OFPA 2FZMA 4QE1A 9CGTA 3C2YA 4ZZ9A 2DZTA 1HKVA 3UPWA 1DTNA 2VFGA 3DFNA 3FFSA 3W02A 3UZWA 3QHNA 4N4QA 1CENA 2Y85A 4Y9MA 3UWVA 3IANA 3WLJA 5LIYX 4J27A 3AHZA 3CUFA 4GX8A 3I7SA 4RJEA 1I2OA 2NLYA 7REQA 3BLIA 3GFYA 1NU5A 4B5XA 2SFPA 4QGCA 1I1WA 3WJXA 3M44A 4ACZB 3TFXA 2EXOA 3W7KA 2YCIX 3A13A 3M5YA 3B97A 3P0WA 4KIRA 3N9SA 3H2NA 1MW2A 2A3AA 1KTNA 3WX7A 3AISA 5TBOA 1W1B1 4REQB 4O8RA 1ZJIA 5C71A 2DU2A 1GYMA 4DM1A 1C8XA 1A5AA 4Q8QA 1VRDA 1AA1B 2EQDA 3ARRA 4FB7A 1KBBA 1E9IA 4WJXA 3E02A 1AQ0A 4FOKA 3DFTA 4Z1DA 2R8WA 2WANA 4MFEA 4AY1A 3DFPA 1T0OA 3IGSA 1ECQA 4WRHA 2XPKA 4MZ8A 2OELA 1JDCA 2BHZA 1PIIA 3IUDA 4WK9A 1PJ9A 5T9CE 3H4XA 2NV9A 3VDGA 1KM3A 3TMLA 2F7FA 1FP9A 4UMBA 1BWLA 4PMVA 1KD0A 4Q8VA 2QMKA 3ALGA 4PTMA 1E5NA 2IKGA 5D2VA 2GJRA 3MO4A 3TX9A 2CLLA 4AY8A 3TYUA 3OZPA 1QHZA 3ABZA 1W32A 2FVKA 3WY1A 1VQTA 4GY1A 1VC4A 1ZS2A 4ZO6A 1QOPA 3G2GA 1U33A 1AQMA 2P0IA 1EC9A 4OUIA 4H8UA 4ROQA 4MUZA 1UBPC 3E74A 4S3EA 4XZLX 1ITQA 4QJ4B 4Z0JA 2PWDA 4Y8FA 5E5CA 5CZJA 4JHMA 2VWSA 3M9YA 4UTMA 4BK9A 3M0IA 3EB3A 2V68A 1WO2A 2PLCA 1UZ1A 3CV7A 1V3HA 4CD6A 1LQ0A 2G97A 4YXGA 2FVLA 2BVTA 4S39A 1H1NA 3CWNA 2Y0FA 3NZQA 1AODA 3A4XA 2RGMA 1MVYA 2XIJA 4O17A 2ISFA 1S38A 4GA8A 2UBPC 1TPFA 3E2RA 1U1UA 2HRWA 2J9XA 1U5VA 3RPDA 3L23A 3ERPA 3WDHA 2O4MA 2XH2A 3L4UA 1JFXA 2J8TA 2WMJA 1XYLA 2DQXA 1C91A 3WQ5A 2UV8G 1UPMB 4LGXA 3LY0A 5D9OA 5C2GA 2BB0A 1EGVA 3N19B 5D02A 1Y5WA 3KTXA 4GOAA 3BL3A 3AICA 1PDZA 4DNHA 4E2OA 4DZHA 4Z1YA 3EKZA 5BXSA 2X7WA 4ZEPA 1Z69A 1J11A 1BSLA 1E4MM 1OFEA 3BQ5A 5DY2A 4WDUA 2PLKA 2OKTA 1V6YA 3MO7A 1LBFA 4Q6JA 1XCXA 3VMPA 3CZJA 1QDSA 3UZXA 4YTQA 1R5YA 1SPQA 1AH4A 3UG3A 2XFYA 1T6MA 3ZWSA 4MM1A 8A3HA 4LBRA 1P0NA 4UFJA 1FXPA 3SCRA 1B90A 5I03A 3CAWA 1OCJA 3W2LA 1PZ0A 4LS0A 4UXDA 3M16A 5CC3A 3I4KA 4J2MA 3GUGA 4AXKA 4J28A 4DJFA 3VNLA 3XISA 1YDVA 3AFBA 4JEQA 2PDCA 1S5TA 3MDUA 4O0ZA 4CQBA 2JKAA 4O13A 1ZBKA 4Q3MA 1RD6A 4GKLA 3W2UA 3WZ0E 1ADOA 3ARWA 3G1RA 2Z25A 3MZNA 2CZVA 4MZYA 4NJKA 4HMCA 2ZA2A 2TMDA 3GZAA 4MNMA 2FPYA 4Q8MA 4WXYA 3CAQA 3XINA 3GR7A 2QCEA 3GW0A 4US5A 2QDHA 5ABFA 2D0GA 1W1IE 1OT2A 3L65A 4LBSA 2DZPA 1XIIA 4LT9A 3PTDA 4F2BA 1PTGA 2BVDA 1JAKA 1X6UA 3CUHA 1OFOA 2PTDA 3VOJA 3PS7A 3UZ5A 1G5AA 1CCWB 3QMRA 4ZE4A 1XPGA 3CHFA 3SRDA 4FAMA 4HIBA 3KCOA 3ARVA 2ACQA 2DUXA 3CBWA 5IDIA 3WEOA 1XPYA 1SFLA 2VVNA 3ZR4A 4JDYA 3VVGA 1O94A 4Q4RA 2FMOA 2OZ3A 3WLTA 4E2VA 2POTA 2XDFA 2FH8A 5KEZA 1B3XA 2I5QA 2PCQA 2VKZG 3VE9A 3FJ6A 3JR2A 4KWUA 2YCLA 3PWAA 1UWTA 4NAFB 4AVFA 1EJ7L 2PDPA 3LZ5A 3CLMA 3TFCA 2Y89A 4QHRA 1XD1A 4KH2A 2DP3A 2L5HA 3TZFA 4FEZA 3TZNA 1XSJA 1DJWA 5D8ZA 2ZUTA 3ZWTA 3B0YA 4O16A 3BLPX 4NI3A 4JTEA 2IPJA 3GTIA 2NT0A 3WH7A 3L2IA 2NT1A 3N3MA 2W62A 1X7IA 3I7RA 1HO4A 2JEPA 2OQYA 3VX1A 3W38A 2OYKA 1E6PA 1XIMA 1DWIM 2VX7A 1TJ0A 4O18A 5CBBA 3EXTA 5HJXA 4MJMA 4HA0A 4XVEA 1M7PA 1E56A 1UHVA 3W87A 4M80A 2E3ZA 3KP0A 2XYLA 2E68A 5HA7A 3MU7A 1R3YA 1GKQA 4S3AA 5HINA 1GHSA 3FEQA 5MKGB 1AD1A 4GUJA 1H0IA 3UJSA 4PB5A 1J93A 5ABHA 1XDJA 1WCGA 1UP2A 1YHTA 3QFWA 4HA3A 2WW5A 1DP0A 1QJWA 1I9CB 2P10A 2AOSA 1DIOA 1D3CA 2DH2A 4GIAA 2DT2A 5HAOA 3L4YA 4P8WA 3NL6A 5MHBA 2XSAA 3A12A 1OX5A 4JFWA 1VIZA 3VZZA 3OZMA 4DJDD 4LW7A 3BQ6A 3RM9A 3KDOA 2RDWA 1TV7A 4KRZA 1BGGA 4MWAE 2V5DA 3T08A 1KFCA 1FFRA 1RBLA 1C8VA 1WYIA 1RPKA 3AMDA 3G0XA 2XIOA 2G3IA 4LAKA 4ZFCA 5D2XA 1P6WA 3EPMA 3N6HA 1D7FA 5AHMA 3WJYA 1E70M 1PSCA 3PBYA 3S5OA 3OPSA 3GH4A 2J75A 4H19A 3V18A 3T09A 3W3OA 4RZ4A 1VFOA 2E1DA 4DF1A 2VDIA 1X97A 4P2VA 3ZVHB 4ZSTA 1BPLB 1ZSXA 1W56A 1GVEA 2QCNA 2OGJA 1OABA 2WHKA 4QJ1A 1QXLA 2OSWA 1VIWA 3VOCA 1B3YA 1HP5A 4H9ZA 3VGBA 2Y5EA 5C9UA 2P3ZA 3T78A 1L6WA 1MFUA 3H24A 5A6TC 1L9WA 2PBGA 4OV9A 2DZXA 3QBUA 3M5ZA 2PTYA 1NWRA 1C90A 3D47A 4C60A 3A22A 3UFYA 3QHOA 2V69A 4UMAA 1PBGA 3GIPA 4ERAA 1HJQA 2GGJA 3S6OA 1W9XA 1YXYA 1UWRA 2QMJA 3S3GA 1MQQA 1WOBA 5E9AA 1G7UA 4W5UA 4G7FA 2OGYA 1WDRA 4F9JA 2CHRA 2ADAA 3WMLA 5AC6A 3BMXA 2GVYA 2JKPA 4JQ2A 1EHAA 3QGVA 3CTLA 5HUOA 1SFTA 4GYPA 2PDNA 3NAVA 2BXVA 2J66A 1FCBA 4ERIA 5CH9A 4ZOEA 3EB2A 1PWMA 4DJFD 5D32A 1T41A 1XBVA 5HJLA 2PD9A 4DWDA 2Z1VA 4HSNA 1OCBA 2NV1A 3SCVA 4L61A 5D04C 3B8SA 1KXTA 2FFIA 4CGTA 3SCWA 1TWWA 1ZENA 3N2MA 3S2CA 4JXCA 3UW6A 3VZYA 1XBZA 3W7PA 1GOKA 2HV5A 4CQ8A 5XINA 1E0VA 1LCOA 1TR1A 2GDQA 2WZHA 2E5BA 4AHPA 3LLFA 2OOFA 2ZRWA 3C52A 1VB9A 3QQ0A 4GVIA 3SQMA 3SY1A 2YBUA 2PDJA 4PBEA 1TE1A 1MUMA 1YE4A 2F38A 2R1NA 1V79A 3HV9A 3NEVA 1ZAJA 1BLIA 2VYOA 3RN6A 3EPOA 2Z1KA 1UD5A 4E8GA 3S47A 1EUAA 5CBJA 3POHA 2QCDB 4D71A 2V3FA 3S4TA 1XRSA 3WK3A 2ICSA 1EOKA 2ALRA 3WD1A 2YPIA 2G37A 3F5LA 2WZEA 3GHSA 3I7QA 3PBVA 3SR7A 4WY0B 4GUFA 1SMAA 1W1ZA 2XH7A 3OJGA 4S3FA 3ZXWA 2Q8ZA 2WPBA 2NVCA 2F9RA 2I5GA 3J7HA 3EPNA 4PBFA 3OA3A 3JRKA 1K7EA 2KX9A 2FIQA 3TR9A 3F1QA 3URNA 4JS3A 4LX4A 4FHAA 4FXJA 1U1HA 3C0LA 2Y7FA 1EFZA 2J7GA 1NARA 2BY2A 2CBVA 3L0GA 4WD0A 1XWYA 2ZUVA 3PFRA 4EXBA 3DBPA 4B5VA 4I3GA 5DLCA 2PTWA 4M5PA 1U5JA 2I57A 3FJNA 4IX0A 1M7OA 3ZLGA 3SECA 4FXRA 3N29A 6PTDA 1OB0A 2JEQA 3N6JA 1A3XA 2FZ8A 3K4WA 3VYLA 2C7FA 1A3WA 4QCEA 5A6AA 3BMVA 4G7EA 1KFKA 3VC5A 4PMQA 3MCMA 2NQ5A 1BVZA 1LRNA 3IGXA 4OHQA 2A21A 4NRRA 5KTLA 5AB3A 2GLKA 2QJMA 4L9ZA 1VEPA 1F2JA 4NZCA 3CC1A 2WNNA 2J7BA 3KLLA 3WFAA 4MPQA 5JH1A 3W7QA 1JPKA 4YYFA 2Z1XA 2QJHA 1LLOA 6ALDA 3HQNA 1GWJA 4S3KA 2FMNA 3BLLA 4YMZA 1HGWA 4YU1A 3IIPA 3HG2A 4LV9A 1GT8A 4QLKA 2CYGA 4WEVX 3PWGA 3WNKA 1NP0A 2WC7A 4QLJA 3S5SA 3CZGA 2E6AA 1TPVA 3N2BA 5ECVA 1XUZA 1ME9A 4RZBA 5LHEA 3R11A 4F3HA 1SMDA 1EDGA 1VS1A 4JKKA 4H01A 1VFHA 1K9EA 4ZR8A 5FIPA 1TPUA 3FYYA 1I4NA 2ZVIA 1HN1A 1V3LA 2X0SA 4QIUA 2PZNA 4Y7EA 1IGWA 4M6PA 3RHGA 1TZ7A 1BXNA 3GY1A 1BSIA 3P74A 4RL3A 2PP1A 5C9ZA 3V75A 1MXSA 3MW7A 4CU6A 3TR2A 4MJZA 2XVGA 4WHBA 1W3HA 3WL0A 4AY7A 3W1AA 6A3HA 1HJWA 1NOWA 2Q71A 3R13A 4Z0SA 3AMGA 4C6FA 2PWEA 3E6EA 4ML9A 3VOHA 1F3WA 2D20A 4GJJA 4J3TA 1XBXA 4XZIA 3HA1A 3CUJA 3WSUA 5GJNA 4QM1A 3T2PA 3EWZA 4JN7A 4GMEA 1SZRA 5LIKX 5I02A 3GLCA 1JGIA 4OE7A 4XZBA 1QW8A 4G1NA 3GAKA 1NP2A 3S46A 4HYWA 1UR4A 3ITLA 3U4AA 1TV4A 3MMUA 3T4CA 2ZX6A 4TX8A 4A05A 3TYAA 3G6LA 1QASA 1XP3A 4ONVA 4DXKA 4UQAA 3WLHA 3VKBA 1LLWA 1IV8A 1LF1A 5FJJA 3CM4A 2J7DA 1E73M 2WVTA 3FDKA 4PMZA 3WLIA 2KZHA 3RM8A 1WDSA 3S9IA 1ODUA 3FXGA 4U5IA 3W7DA 1GYLA 4IFRA 1A5UA 1MRQA 4DUVA 3VM7A 5TNVA 3LSBA 3PZNA 4Y9NA 4GZIA 4DQWA 3VKCA 3C56A 2GPTA 2P88A 4HB7A 4C6LA 4IL2A 4WY0F 1Q8AA 3B05A 1PTAA 2FH6A 3KRSA 2GYIA 3WDPP 1LYXA 4UNKA 1FWWA 3S2LA 5AYBA 1PKYA 5D37A 3CL7A 4AD5A 1VAHA 3ATYA 5LNSA 2VX6A 4UFKA 1VLIA 4MADA 1EIBA 3TU9A 2Q09A 5KZ6A 2E40A 5I2UA 5ECUA 3E1F1 1XLEA 4A21A 4DAFA 3MUZ1 1JCTA 2GDUA 3HGSA 1GZJA 2IKIA 4X61A 3V5OA 4QBXA 2Y5JA 3TJLA 1B3VA 3FIGA 4F0KA 3H70A 3QTPA 3ITTA 3M0KA 4UQ9A 5FA5A 1H62A 3CZLA 4FLQA 1FCUA 2VDHA 5FD0A 2X7VA 4IIEA 3MDWA 3BZGA 2QW5A 2ZIDA 2V6AA 3W85A 4L4LA 2HS8A 4LF1A 1WBJA 2X40A 2NQJA 1IYXA 3QF0A 3SRKA 1YQ2A 2ZICA 2Z28A 4I8YA 2DIJA 2NVAA 4ILSA 1MW0A 3ALFA 2Y1HA 4Q32A 3B9NA 2XVLA 5H8MA 5H91A 4M51A 5H6HA 1UR3M 4MOZA 3N1AA 4GY7A 4TIMA 2Y4SA 2CERA 3GVQA 1CECA 1ADDA 3LS9A 4IICA 1BQCA 2GQ3A 3N04A 3C2VA 1IEWA 5IBXA 2Z1SA 2X1TA 3AMLA 1EP2A 3E9AA 4L4PA 3SCSA 4LOCA 3GXFA 3TSBA 3CO8A 1RPXA 2J24A 4UTLA 2ZUUA 1ISVA 5HDRA 2KAUC 4NNBA 1XRTA 4H9VA 3H4GA 1LL7A 5D2YA 5DBUA 3U2EA 3P5YA 4WOZA 1EC7A 4XZ9A 4YNGA 1B30A 4QQ3A 4YS1A 1NDYA 3PZTA 5CZSA 3LEPA 3ZR5A 1E15A 3DEQA 4JTJA 3H6OA 4YVPA 1PDYA 1NIUA 4S3BA 3VGGA 1DKWA 1RALA 1W1A1 6REQB 2WC4A 3GRIA 5F7UA 1MEIA 4LPCA 2Y63A 3EXRA 3HPFA 1E0WA 1QNSA 2Q8XA 3RJYA 3AZTA 1OADA 3AU2A 2GUYA 4TR9A 3VIOA 5BXRA 4IISA 2QV5A 3QFEA 4AU0A 2Y2WA 2GUBA 3L0KA 4XBKA 3VD3A 4EACA 4MGGA 1ISZA 2YB1A 1YLVA 4XO6A 3ES8A 4W8BA 1GVRA 3O6CA 4UTKA 1KRMA 1OJXA 1P1XA 4KRTA 4RE4A 1FQ0A 4PB3A 1S1RA 4ICNA 3VIIA 5D9MA 3M6DA 2CZ5A 3TH6A 2ON3A 2EKGA 1K8CA 1AMYA 1LQAA 4ROPA 4PUEA 4FX7A 5A2AA 4PMYA 1XRVA 1YPIA 3WF4A 3LK6A 2O9OA 1T99A 4UUIA 4AHQA 3PTKA 3UG4A 5CG7A 4YN5A 1JYNA 5DRIA 1TV2A 2OWCA 4TVDA 1P5BA 2WPGA 1EJVC 4L6OA 4LRTA 3WUEA 5GVJA 2VUYA 4HP5A 1QPQA 4UOQA 3WD2A 2BVWA 3W72A 4Q8OA 1ZJHA 1KQYA 1PAMA 3AXMA 1OF8A 3AHVA 1G94A 1QVBA 2Y6ZA 3UZYA 3WUBA 2D73A 3ABOA 2NQZA 5LGXA 3IJ7A 4N2YA 3ABXA 1AJZA 5CSSA 4RE2A 1Q63A 1KLZA 1TMHA 2ZXBA 3VOGA 3E0VA 1ESWA 3AIEA 1KM5A 1EO7A 2ZZ4A 3LHZA 4I6VA 1NF0A 2NVDA 3ABRA 1MI3A 4MYAA 5L6UA 1IR2A 3DECA 3IJ9A 1MZRA 1EJWC 3BLDA 5BNKA 2PC4A 4DLFA 3CUZA 1DHPA 1W2VA 3DH7A 1XLDA 3SRFA 1TWSA 3N3TA 1JCLA 2VO5A 3ZVIA 2OX1A 4B92A 5C7HA 1IT8A 2WB5A 2NX3A 4I9JA 2CLEA 3ZMRA 5PTDA 1K70A 1B3ZA 5I5RA 1LUCB 2BLEA 2B7NA 4Y2WA 5AC5A 2HXUA 3WD0A 3WF3A 4FIQA 3K1GA 5E6ZA 3WMSA 2NQLA 1XM3A 3NDYA 3HV8A 1TV8A 1O66A 2QUTA 3EX6A 1EZ2A 2BHYA 4FS9A 4XV0A 4BS0A 1V6WA 1NTHA 3GIYA 2WKGA 4J2PA 3ITYA 3WBAA 5HR7A 3H4WA 2PDWA 4FNTA 2XGBA 4AEOA 1US2A 4GH1A 1O95A 1UA7A 1TTQA 4E0CA 4DWSB 1W5QA 3JUGA 4XAZA 1DWHM 1Z3NA 3GBEA 4G8TA 4CU8A 1A53A 1DJYA 5HUPA 2A6NA 1NQ6A 2B7PA 1JYWA 3CTTA 3IJQA 1QI4A 5H1WA 4XQ6A 3SCNA 3I3BA 1A5OC 4W85A 4LQ1A 3GTFA 4GQRA 4JDBA 4JQ3A 2GWNA 1LRTA 1SVDA 4UTWA 3T9PA 5EYWA 3P3BA 1E9ZB 3S83A 3THDA 5HBFA 1Q45A 3PANA 4TO8A 1R6WA 3U9IA 3P82A 2ZZ7A 3GH7A 5JUVA 4QE5A 2XGIA 2DT0A 1UR9A 3CL8A 4LC6A 1OC7A 1XC4A 3E5BA 1SZGA 4V28A 2EPNA 1DJHA 3JU2A 4I5RA 3WBXA 5LHFA 3HJZA 3CZ8A 1G4SA 1H51A 5CAKA 5EMYA 4JQAA 4O1BA 4IXHA 4GZ7A 3WQVA 1EKOA 4NIRA 2PDUA 2QUMA 1V5XA 1Q85A 7REQB 2VRQA 4WZHA 1CI1A 1M04A 3QH2A 3NZGA 2QPUA 1E72M 4XB3A 3VABA 3W81A 4PEKA 3U7VA 2J77A 3KWSA 4HMEA 4ZTYA 2I5IA 3FAWA 3E0WA 4DVOA 2BWGA 5A6LA 4A4AA 3F2DA 4EIVA 1RR2A 4FR6A 1QO5A 2VGIA 2XIIA 1W6TA 1E6QM 5G2IA 1PCKA 5HJYA 4I7UA 3VO0A 3FJ4A 4IQJA 1QBBA 3NA8A 4LCSA 4LBUA 1MQRA 2VQUA 2D0FA 3DHPA 1DWJM 5JXQA 2OSXA 5T26A 1C8YA 4H9UA 2PLJA 3PZIA 4FSAA 3MA8A 2V82A 1S5WA 1X7FA 5A8PA 2C1HA 3CIWA 1Q13A 4JAWA 3U57A 5A6BD 5LZLA 8TIMA 4GJIA 4D72A 4JICA 1LP6A 1KCKA 1WAWA 4L6DA 2QCLA 4MG4A 3O7UA 4NT0A 3SN1A 2E67A 4H6QA 4OKDA 3EX1A 1FDZA 3GXIA 2E0PA 3F2BA 4Z2KA 2G4FA 1V03A 1Q6QA 3WBYA 3GX9A 3UJRA 2BP1A 2PF8A 1XI3A 3S0CA 1CXLA 3VNIA 4RX0A 3KOWA 2BY3A 3HB9A 1QMLA 1UROA 3UCCA 1E43A 2Z26A 3EMCA 1PO9A 3KM8A 3W73A 4BJHA 3KTCA 4CCZA 4H6RA 3P8IA 3PB0A 1XYBA 4B2DD 2RJGA 3UG8A 4DBEA 1YDNA 1GUVA 3IK4A 4ZE5A 5BU6A 1PCWA 1QU4A 2BASA 2GZXA 1V77A 4HNNA 4LVGA 5EKYA 4ICCX 3WJZA 3VMNA 1A0CA 4LUTA 2Y7DA 1A5BA 1T40A 1W5MA 1AH3A 2B31A 4H2CA 4ATDA 5G1YA 4IGNA 2QF8A 3R89A 2GQAA 1X98A 2ZDSA 3T05A 1SSGA 1J79A 3W6LA 3HZ3A 1M3UA 5D4YA 3QV9A 2VM8A 3IJLA 4WGHA 1XIJA 1XLBA 4OJYA 3TQVA 3VKDA 2OO6A 4XBJA 2ZX8A 3EWBX 1FVPA 1V8EA 3A4AA 5CAHA 1FP8A 2DZSA 4GXMA 4C6IA 2A6LA 3MUCA 3HO8A 3VUPA 3NXLA 1S5NA 1UQYA 3OBEA 5A6JA 4IPLA 1EWEA 2H3DA 4O10A 1UWAA 1RSCA 1Y0EA 2PP0A 2E4TA 3URQA 4Q4SA 4XAPA 3KOFA 1XDLA 3KRUA 1UUMA 2C91A 1KKRA 3W00A 1XYZA 3BAKA 3VD9A 3F03K 4UFMA 3BG9A 3NVTA 2QF7A 1E1EA 3KCLA 4LB4A 3CXOA 1I6NA 3L4WA 3UR8A 3W7RA 4YTTA 4XBSA 1J01A 4MB3A 4J3WA 2FJKA 2WNWA 3HOJA 5F4XA 3R58A 2FB3A 3PAOA 2WSKA 4LV4A 5D8WA 5F4WA 3SM0A 3UA4A 3W71A 4UR9A 5AY7A 5AYZA 1Y5VA 1DJXA 4KFPA 4HPNA 1DJGA 3E49A 1YBQA 2OWXA 4MLJA 4Y90A 1NDWA 3O2LA 4JKMA 1K7FA 1YTEA 4ZQNA 4R7OA 1F4HA 4M6VA 3WF0A 2WBKA 2C18A 3GQYA 2YB4A 3AZRA 3TXZA 3W88A 1VHNA 5ABFB 1JG9A 1HL8A 3AIQA 5C9RA 4CVUA 4LB3A 1L8NA 3H26A 4ZB5A 3LA4A 5AYXA 3QMSA 2UY3A 3P84A 5KETA 2CBUA 3CHDA 1MZHA 3UXAA 1JDFA 4NL1A 4WSKA 3NM3A 1SJAA 3WH8A 2C6QA 2C0HA 2ZDRA 4RW5A 1YYAA 1VD6A 1EA9C 2XZ9A 3ZJ7A 2Q3OA 1ELSA 4RW3A 3GU9A 4B9YA 1C3FA 2HK0A 1IR1A 4O53A 3B8DA 5CPSA 3OVQA 4NNAA 1XFBA 2YL9A 4MKNA 3T07A 4PC8A 2EKCA 2ISSA 1FWAC 2WHLA 4LS1A 3U2CA 3W24A 3W0KA 2R14A 3WH5A 2C71A 4EOUA 2D3NA 1H4PA 4NJIA 4S1FA 3GNNA 2Y8VA 3W23A 4QTGA 4HNLA 2AQVA 3NQ6A 4YVVA 1EQCA 1S1PA 4NF7A 4K8EA 3AMCA 3P60A 3K8LA 2F84A 2A0NA 4QS5A 4YWIA 3LQLA 3OHMB 2C19A 3VC6A 4P5UA 4Z1CA 5BMXA 2V0TA 2R1KA 6TAAA 3NVDA 1DV7A 1DQUA 3QC0A 4XO7A 4IJCA 1N2VA 2I1OA 5BOOA 2GDVA 1KTCA 1WZAA 3LPPA 1GVSA 4XAGA 4IFKA 2EG6A 5BW6A 3B9AA 5F1VA 4F48A 2W5FA 1FWBC 3U3HA 4BQ5A 4A29A 3W1MA 1RUSA 4PL2A 1AW2A 2PMQA 2P76A 1ICSA 1L2QA 3L7RA 4MDPA 3FKKA 3RCNA 1RLDA 4RNJA 4C6EA 3EOEA 1I45A 2QULA 3NDOA 3VGDA 1NWTA 3AS1A 5J8LA 1UZDA 3B4UA 1M5WA 1XBYA 3TAOA 1W5OA 3UY7A 4KS0A 1AL7A 4EK7A 2FQIA 3PG9A 1XR2A 1IXNA 5J04A 1W9UA 2XHYA 3GYCA 1TSIA 5A94A 1A47A 4LUJA 4YIWA 2Y88A 1EPVA 4NX5A 3TWAA 1BYBA 3SW6A 4C6QA 3N9RA 5GNXA 5FCZA 2VZUA 3CS2A 3UP8A 3TVAA 3KFTA 4E8CA 1J4EA 1US3A 3DC0A 3G1HA 3VNYA 1SO4A 1FCQA 1PZ3A 5K4XA 4HA1A 1K8ZA 4TU1A 3WQGA 2ZC1A 1W3NA 3N4AA 3OW1A 4XUYA 2W63A 2CBIA 3R12A 3KTSA 1K4HA 5C5YA 3H2CA 2H6RA 3Q94A 4KEZA 3MC5A 4GBUA 4XISA 5B7ZA 3PBUA 1FUYA 1IEVA 1MXDA 1WXYA 1PX8A 4ZQPA 3BURA 4KPLA 1JDEA 1EBGA 1K03A 2NX9A 3SDOA 5LKYA 1K7XA 1UP0A 4H8VA 4AYSA 2R1PA 1SR9A 1CXEA 1FKXA 4MB4A 1GKPA 3R25A 1V0NA 3H2AA 1R85A 3O6DA 3N13A 4WKFA 3PY2A 4C6OA 5EFFA 1XINA 5EMMA 1M7JA 3S6DA 5JVLA 3NPWA 1AH0A 5CGQA 1GVIA 4AH7A 5FJTA 3NQDA 2GQ9A 1JRCA 4AZ6A 1ITXA 4H9MA 5K9CA 1QNOA 2V38A 3A5VA 4PMRA 2VP8A 3GAYA 2NQHA 1QK0A 4NZ5A 1J0HA 3TYCA 1VR6A 3R8HA 4QG9A 3BJFA 1EHNA 4Q22A 3P61A 1EJUC 2XIBA 4CVWA 4JNZA 4ATLA 1Q6OA 1GOXA 4DX3A 1TPWA 3M41A 2YCJA 3NG3A 1EDTA 2VFEA 3A9BA 2INFA 4BEUA 4P8XA 4R7JA 1AZ2A 1Q4NX 2PGRA 3UYCA 4RPPA 2D1ZA 3TJ4A 3UQNA 3G8EA 1KM0A 3LRMA 5TIMA 3JVAA 2OWWA 4C65A 2ZZ1A 4UB9A 5E70A 3WD4A 4UBPC 3LDVA 2D2OA 3CYJA 4ZA0A 3SZ8A 1IWBA 1Q6CA 2DZBA 2WKLA 1OIFA 3V7PA 4FOUA 5BOEA 4H8HA 1EF3A 3LLXA 5I6SA 1H7RA 4NQ1A 3U7BA 3Q45A 4JCLA 1UH2A 5CC5A 3VCCA 3MKCA 4F9DA 1LWJA 4IMFA 3RPMA 3L5AA 2RJHA 3DG3A 1W8SA 1K6WA 4LFYA 1PYFA 3N73A 4LAMA 3P6LA 1W3KA 3C2FA 4Y8EA 1L6GA 3USZA 3HF3A 2QIIA 3S6TA 3TW6A 4DPQA 2JKEA 3KBNA 1V02A 1TTIA 4UCFA 5BZAA 1HG3A 3P80A 2A3BA 3NO1A 5KITA 4HSOA 2YX0A 3PUGA 4W8LA 4GABA 3WNOA 1I1XA 6ENLA 1XFCA 4XKYA 5HR6A 1ZALA 2BS9A 2WJDA 2WJZA 3H2MA 3NSNA 1KA9F 2RAGA 4FNQA 3PNUA 3NZPA 3UR2A 1EGMA 1JQXA 4OQVA 3BW3A 3V1PA 5CSRA 1EF2A 1RK5A 1SW7A 1GTHA 3TW9A 1ZCOA 1Z42A 4ORIA 4Z1BA 5IHSA 1QPKA 4U2YA 4E5TA 2D0HA 4W7UA 3O8AA 1IHIA 5HWJA 4YHGA 3B8WA 2DZUA 1N82A 5IDZA 1S2CA 1O1ZA 4WJEA 3RYSA 4E2DA 3FLUA 3ZSTA 2YL5A 2ZZ6A 4RV8A 1DWFM 1JF5A 1MW1A 2ZXDA 4NAEA 2TRSA 4C6KA 3LCFA 3MSYA 3C2RA 3OOQA 4OT7A 5D9NA 1P6CA 5D2TA 1NWUA 1DYSA 3UU0A 3FNDA 4ZQMA 5AHEA 2VEIA 3IJIA 1DORA 1YW1A 1R30A 3BTNA 2XSBA 4DF2A 1KM4A 2EPKX 2PGFA 1I2PA 1NFGA 1P48A 2P53A 3AS2A 3BVJA 5FL0A 2Y62A 2ZRZA 2QUVA 3IVTA 2J78A 2QUUA 2Z0IA 2VX5A 4PUDA 3QZAA 4JTQA 2MANA 3AMKA 2ZQ0A 1EXPA 5BRPA 3ID7A 1S3HA 3K5XA 4EP8C 4Y9AA 2JE8A 4H04A 1X39A 4CN1A 1CPUA 3K1DA 1PVNA 4G7EB 1EB3A 2QJGA 4H6KA 5BYWA 5I77A 3EYPA 3SUWA 1NJJA 1TX2A 1G4PA 2J7FA 3IRSA 3ARZA 4OBRA 2WV8A 3KBSA 4K1WA 4ACYA 4PE8A 3HQ1A 4WJ8A 5E6YA 4B5TA 4GUGA 4JN6A 2ISDA 3TKFA 1UYQA 1QI0A 1H2JA 2ZZ5A 1UASA 2WWDA 1AZ1A 3UZJA 4RCXA 2FHBA 1Z89A 1GOQA 3O6AA 1FWJC 4PUMA 4O54A 3W74A 1G1YA 1F9CA 3T2OA 4N4PA 1TCDA 4IWWA 1DTUA 4FNPA 1H7OA 2W91A 1VFUA 3QXBA 4C7FA 4B9ZA 1KFJA 3EDFA 3I6EA 1UD8A 1UZHA 3NSMA 3DG6A 3MP4A 5C9WA 3FJLA 2FTYA 3W1UA 1VCFA 4XD6A 3ZZ1A 2OFJA 3DI0A 1F74A 3WJWA 1J12A 4UFIA 2VCBA 4KIEA 4C6NA 4NJJA 3GNDA 2WMGA 4OV4A 3IK2A 4XIAA 2JIEA 3MS8A 3CWOX 4J1OA 2YW3A 5A69A 1LT7A 3P2VA 3UZZA 2J7HA 3PAJA 3WH9A 4IF2A 3BZJA 1NOUA 5EMLA 3M1ZA 5LNUA 3TTOA 1B1YA 1T96A 4JEJA 4N42A 1OGGA 2A79A 3APTA 5LYRA 3GKFA 4WR3A 3FV9A 4OU1A 3WBEA 3PPGA 4B3KA 4L6HA 3G22A 2FGZA 1XGEA 2G3NA 2CLHA 2WMHA 3BUVA 4UTFA 4LS2A 1BG4A 4AUBA 1DXIA 3FK4A 3O16A 4DWSC 3RO8A 3ES7A 3GHUA 1Q5MA 4PCNA 2DVUA 3LGGA 2FDMA 4AMCA 3TAKA 2TODA 1IEQA 2PPGA 2ALDA 4O0QA 3WDIA 1TQJA 3LN3A 1YEYA 3I4EA 3ZT6A 4CD5A 4H00A 3UVAA 2YA0A 4N7QA 1H60A 3LPFA 4I7WA 3O05A 1ICPA 2QS8A 1SFSA 4BF5A 4DXXA 3UA3A 1DEDA 1RY8A 1GVQA 4UNLA 1WDWA 2XU2A 5A8OA 1SW0A 2ZTKA 1H5VA 2YBVA 3W27A 5IOBA 3A23A 3RRXA 3WNNA 4L65A 4UOZA 2OLSA 3QTGA 3VGEA 5JBEA 2P8CA 1G0CA 4IOTA 3EA3A 3OGSA 4I8DA 2YLLA 4ML4A 4W9TA 3Q4DA 1ZFJA 2QJNA 1GW1A 4LTSA 1EH9A 1QWGA 3WLLA 1K1DA 5DF0A 4AZ5A 2ACRA 2EO7A 1P0BA 3PJUA 4HPJA 2EPOA 3FHQA 3HMJG 3LI0A 4E4UA 2XWEA 4GFIA 2BOEX 1J2WA 1R87A 1VBHA 3A21A 5HPOA 1T5AA 4LH8A 4A3QA 3A3WA 5IM51 4RUBA 3RX3A 4HVXA 5AYYA 4IH3A 8XIMA 2GQ8A 3PWIA 1EEXA 4A3UA 1Q8JA 3TNOA 2UZ9A 4F40A 1JI1A 3WQ4A 1NY1A 3A24A 1JYXA 3UETA 1M68A 3KBJA 2GVEA 1DXFA 7XIMA 1W1VA 2FHCA 3STCA 5DXYA 3H22A 3O0FA 3N11A 2VFIA 1OF6A 4JTHA 5BOFA 4PUUA 3KLKA 1HKKA 3N9KA 3WNLA 4JX5A 2XVKA 3BLFA 2ZXQA 2BG5A 4IHCA 1K3UA 2XN1A 3LCHA 4L9XA 1EC8A 3EX3A 1M41A 4U2ZA 1Z44A 1OIMA 1V3MA 4GGHA 2D3LA 1UKQA 1F5ZA 1YMYA 3E3HA 2NWRA 2ZE3A 3WG6A 5I0DA 5HMDA 4UWMA 1UW9A 3C6CA 3O07A 5AECA 3I68A 3B3DA 2QCMA 1GTEA 3G3MA 1JJKA 4AZCA 5CG0A 4S2CA 3QR1A 4HU8A 1S46A 3RJXA 2XH4A 1GOIA 1I0DA 1MUWA 3WYZA 1LBLA 1OX4A 4BI5A 2J4GA 3EEGA 3NGFA 5DFAA 1MNSA 1QCWA 1B3WA 1IXQA 2PFHA 2E8YA 3CQIA 1WE5A 2WSRA 1CIUA 1VYRA 1RHCA 2AMGA 3GSMA 3KHDA 4YJ5A 5JQ9A 4REQA 4AEFA 4F0SA 3T4WA 3AC0A 1KBLA 1QPOA 2J62A 2NWSA 1TR9A 1GPFA 5C0QA 3ORWA 4PL1A 3N2OA 3KAOA 3H7RA 2Z24A 1NFPA 1JDDA 2HROA 2IXUA 1DIEA 1XIFA 4ADSA 3M0XA 4WQ6A 2ACSA 3UYIA 1OYCA 3U2ZA 2BMBA 4CQCA 4O4WA 2ZXAA 3LHUA 1UWIA 4XZNX 3LYEA 3AXHA 2WLZA 2O9RA 3I6RA 4UNIA 2PI6A 4D6HA 3TTQA 2AAMA 2YZRA 2GVLA 4JR5A 4HNOA 3CAKA 1ECEA 5K2ZA 1E4IA 3C2OA 2PTZA 2VI0A 3P8JA 1OZQA 1ZB5A 3UBPC 4HZMA 1VJSA 1DWAM 2C1GA 2ZX9A 1ODZA 1CXIA 3WNPA 2HPMA 5T91A 1KKOA 2DVTA 4H9TA 2V3EA 2XN0A 4AVOA 4JOMA 4CQ9A 3M0VA 3ONCA 1CBGA 1U30A 1LQ2A 3OO2A 1YTDA 3R94A 4IPPA 5GNZA 5REQA 4K7YA 3DFOA 4Z2JA 2WVVA 1E40A 2XG9A 3GXNA 1UZ4A 3AOFA 3ABSA 2GGHA 1NWSA 5TQLA 3MI3A 1JULA 3W1QA 4H41A 1XS2A 3UPBA 1GVFA 4P61A 1QBAA 4M6QA 4CNSA 3VIHA 4LUYA 2CHNA 4YCPA 4NUWA 1NEYA 1A50A 1XIDA 3BOLA 2YDSA 3W7CA 4O1DA 2ZA1A 5FF2A 4ZFMA 2QT3A 3HPSA 1IEXA 1UBSA 2B7OA 4O50A 1JPIA 4JZ5A 2FZDA 4EF9A 3H8AA 5GPRA 4C6PA 3PG8A 2V5LA 3GTHA 2DT3A 3H21A 4E6MA 2IKHA 3UNTA 3GHTA 4QG8A 1FKWA 3CO4A 3FOKA 3TYDA 2Z27A 1PIGA 1BWKA 3DDMA 1KBJA 4TTUA 3OVRA 3ZR6A 3FW6A 4FP1A 3AIWA 4Q8NA 3C86A 3MMWA 4PTXA 1KWKA 1OFAA 1BYAA 2ZE0A 1R9ZA 3A3XA 2XGZA 1QNPA 2BDQA 9XIMA 4OUEA 1VFLA 1M7XA 4IUOA 1XLGA 3FAXA 3EDKA 3VPLA 1Z7AA 2PRLA 4JTSA 4IQLA 4LRSA 3H2OA 1TB3A 3WLKX 2C79A 2CXGA 1GPWA 2ZC8A 2NUXA 3EB4A 3RMEA 5D09A 3BCDA 3G0SA 5D05A 3UCDA 3BE7A 1VRXA 1KBIA 3NQMA 4M1BA 3GNPA 2ATMA 3GXPA 2HVNA 2HVMA 1TPDA 2PDLA 1JCYA 1WX0A 1OSEA 1Q7ZA 3QGAC 1IF2A 1HVQA 4KWVA 1ISYA 4F2UA 3SFWA 4HBKA 3U6WA 3ITOA 1RCOB 1HJSA 3JZUA 3ZO9A 3TYZA 3C61A 1TFVA 5JMUA 3CB8A 1UA3A 3ONBA 3C3NA 1E5JA 4M81A 2VZVA 2PDBA 4XTIA 1SZFA 1UUQA 4POCA 1G4EA 5A2BA 3NO5A 1JZ6A 1OC6A 3DAQA 1YX1A 1O7AA 3K4DA 4YHEA 2HPIA 2VZTA 4HZ7A 1TZZA 5FL1A 3HN3A 1XC6A 1WZKA 3TJXA 3NPXA 1VP5A 1Q6FA 4M29A 3TDFA 1UMLA 5K9XA 4V27A 3WFLA 4O15A 3W7GA 1U5HA 1DQWA 4AZGA 1EO5A 1IEIA 1YTKA 3RPTA 3MMTA 3WLPA 2AGKA 4GH3A 4E38A 2HK1A 4C6CA 3KVJA 1UOZA 4K7VA 4OBSA 3WQEA 4NILA 4BKNA 2ZTJA 3GB6A 2OQLA 4NSBA 1QFEA 2MNRA 3DOPA 1B57A 2HZGA 3QYQA 2ZYFA 4JX6A 3VKJA 1L6FA 3F4VA 3R79A 2QJIA 1S5MA 1THFD 5CPLA 3N4FA 2ONEA 4NXKA 4E3TA 1UG6A 1ZAHA 4X9SA 3AUOA 4W93A 3QVQA 4HSHA 3BSGA 2Z2BA 3O63A 1E6RA 5E0KA 2TPSA 4U5KA 3BGJA 1OBAA 3S42A 4B91A 4O1EA 2Z4GA 4Q8UA 5DRCA 3G1DA 3BLKA 3GVGA 4YWSA 3RIKA 3UJ2A 1OEPA 2VR2A 3GG8A 3ZJKA 4DJDA 1UKSA 4Y9OA 3NL3A 1ZP3A 2TAAA 2D23A 4LEQA 5AHIA 3CV6A 2POZA 5K4ZA 1RZMA 5EBUA 3ZJ6A 3BANA 1F07A 3N15A 4C7GA 1LM1A 4A8NA 4FIRA 4G5DA 2R91A 2ZZ2A 4LUTB 3RLHA 4H9YA 3KVLA 3A5FA 2R82A 4XUGA 1IIGA 1DE6A 3TWBA 3R4IA 4ZODA 5CGTA 7TAAA 1A49A 5FEPA 2EEXA 2HISA 4UC5A 2WHJA 1UR2A 1CZ1A 1T8XA 1X8FA 1QTWA 4L64A 1LT8A 3THCA 3WQPA 5M17A 1VYSX 1WZLA 5GQBA 2PTXA 4MY9A 3SSZA 4DUOA 4A8LA 5KZEA 3FA4A 4J35A 3NSXA 3QHMA 5I3JA 3CK5A 1DVJA 2RHGA 4XX6A 1AVAA 4UTTC 2A5HA 2WO5A 2WCGA 3W28A 1DPMA 3PZQA 1F3TA 2V5JA 2P8BA 1D3GA 4EKJA 4L1XA 2XVPA 3KVKA 4P7LA 3DHUA 4JY9A 4NVTA 4QAIA 1R3VA 2GGEA 3G1AA 2HCVA 1TV3A 5I3IA 2WOQA 3KDNA 2QJJA 1XL9A 1UWUA 3OZYA 3MT1A 4HK7A 1A5MC 3QW3A 1G01A 5FEZA 2ZWYA 4KFOA 4JIEA 1JPHA 3GDMA 5DMNA 1M9HA 3WUFA 2VL4A 2HBVA 4DPPA 3CASA 3LUTA 4PRWA 3ZFHA 3R0DA 5G4HC 4WDXA 1YBQB 2ZX7A 2OJPA 4CD7A 5DT5A 4O11A 2YZ5A 2ZUWA 3VGFA 1OK4A 1B31A 3E96A 3BDKA 4ZBCA 3B0XA 4I6KA 3PBMA 3HFYA 2WC3A 5LXXA 2ACUA 3SUTA 3L67A 4GY0A 1RY0A 3SQLA 2BHUA 3HU7A 4XTDA 3DHDA 4DRSA 3KZSA 4NX0A 4JYEA 3LTPA 1O12A 1RP8A 3IJDA 4NZFA 2YIHA 1EZWA 2INZA 1BRLA 1P0DA 4PTNA 3WEZA 1FXQA 3UWYA 4O8AA 2NV2A 3U8GA 3LD5A 3BGGA 3NQFA 3AS3A 4IG2A 4CLMA 4DO4A 4HZ6A 5CLWA 3S1XA 2WMIA 2R1LA 2QDGA 3DFSA 3CPUA 1KGUA 3A64A 2B81A 1KXQA 3E2VA 2GVGA 3OLIA 4FNSA 3IGUA 1X96A 2JF6A 2HEJA 5U7SA 4AZHA 2BXZA 3EKLA 3A6OA 4I5XA 3IJ8A 3V4BA 3EX2A 1E51A 4GI4A 4AB4A 2VTFA 3AALA 3AIUA 4WCJA 2PU1A 4UMCA 2VFDA 1ZTVA 2YBTA 3AROA 1LOLA 3IIXA 4GI6A 4U3CA 3KP1A 5HWMA 3DKLA 1O5KA 4IIFA 1O68A 2Y24A 1XG3A 5AHLA 1H3GA 2QDDA 3MUXA 3T0DA 2WJFA 4JD4A 3TCEA 3GM8A 1V7YA 4WDWA 1GORA 5C2XA 1I2NA 1V6XA 3ELFA 4IFKB 3LM3A 4NZJA 1PTDA 1GQNA 3KEHA 4BWLA 4JGDA 1NSJA 4Q4OA 3T40A 4A3RA 1OX6A 2CEQA 2EGZA 3M0LA 1GG0A 1JR1A 2X8RA 3VOIA 4DZIA 2ZUSA 3LNMA 2J47A 3SADA 2VZOA 5FJRA 1J6PA 2Q3RA 3OIHA 2C16A 4DO5A 3SY5A 1FWTA 2AL2A 2VNCA 3B9OA 4CN6A 2GJNA 4LYKA 3OU8A 5U4NA 2VEGA 4KMQA 1E9LA 4R27A 3PB2A 1XJBA 3WELA 2E7FA 1QO2A 2YOCA 1S3TC 2DEPA 2CC0A 3BAJA 4PRRA 3VDAA 2VGFA 3LCIA 1FX6A 1QW9A 1ZCCA 1O60A 3EX4A 1ITCA 3PJXA 3K46A 2Z7KA 5IHRA 3AO0A 3B0VC 2IW0A 1AFSA 4Q7NA 3KOZA 1KCXA 2YFOA 1XLAA 1Y5XA 5G4WA 4TUFA 2Z2AA 3N17A 1X38A 4CNPA 4QITA 3DGBA 3CMGA 2GSJA 2E5CA 1JNDA 1GQKA 4S23A 4Q4PA 3BC9A 4KCUA 4MWAA 5I09A 3R7MA 3KVMA 1XLCA 1IQ8A 1HO1A 3H23A 3NZ1A 5BXTA 2C13A 4IMEA 1TYGA 3GZ3A 1CT5A 2Y70A 1RBAA 4AC1X 2XTKA 1E1FA 2RUSA 4DXVA 3BCFA 4FX8A 2IPFA 4R9XA 3AIBA 3LHWA 3C0JA 3NFUA 3RFAA 1JEZA 3H53A 3M64A 5LSMA 1V7AA 1ZLPA 3WMCA 1F73A 3PZGA 1UH4A 3NWRA 3THUA 3GDKA 3NQEA 3W9ZA 5XIAA 1UP3A 3M46A 4V33A 3G6MA 4D6GA 2GGGA 4TVUA 3AIRA 3UEQA 1PS9A 1Y7VA 1H63A 4JFVA 3DG7A 3L9CA 1OINA 3CZEA 2FZBA 4EAMA 2GJXA 3UT0A 3KBWA 4FOJA 3LM7A 1LG2A 4Q8PA 1E1CA 3C5QA 3E2QA 5DO8A 1N7KA 3D0CA 4RZ6A 3NOEA 1TWZA 1M53A 5E0CA 3URBA 3TQKA 2DPEA 2LLEA 3MYOA 4LCRA 3LCLA 1EGZA 2QQ6A 3FEMA 3C3UA 2ZWZA 4MB1A 4CN4A 1GGOA 5BWAA 4INFA 5E0FA 1V3KA 2ZZ3A 4YYCA 3BH4A 2PS2A 1JAEA 4P8UA 5TD4A 4I90A 5C54A 4GKTA 3TJIA 1J0JA 4DEFA 3N2TA 3WH6A 4IIGA 3LGDA 1B4EA 3CL6A 3DKJA 4HU3A 4F79A 1C7TA 1CEOA 4WIWA 4JCMA 5BRQA 1HW6A 2YXGA 1J96A 4U33A 1EEPA 3AYSA 4FF7A 4ADTA 5IBXC 4JPGA 1J0IA 4QAWA 1JCMP 1UH3A 2VC9A 3T0CA 5M1TA 3APYA 2WWCA 1XG4A 4W5ZA 3S9ZA 3CIXA 3TTEA 3W2JA 4HHLA 3UVIA 5IRPA 4AG0A 1PUDA 3MHFA 1PKNA 1H5YA 2BFGA 2DQWA 4HU4A 4P7QA 4NYYA 2NSXA 3W7JA 4X60A 3TLLA 1VF8A 3LPOA 3KS5A 3LTYA 3P81A 2X0HA 3D5HA 2PA6A 3OLEA 1GNXA 4IJRA 4AFYA 3IEBA 2J9YA 3TYEA 1W0MA 1XKJA 5CPOA 3SN0A 4PMOA 4RR4A 2XWDA 1VZWA 1Q65A 2GGIA 4RLIA 5AC8A 5HMFA 3QSRA 3GBDA 1EJTC 3CUGA 6XIMA 2XH0A 1NDZA 4ICMA 1EX5A 5FSEC 1HP4A 4RXFA 4UQCA 3W75A 3EWYA 5E93A 8CGTA 4X0VA 3PZMA 4B5NA 1TG7A 4ZB0A 1XICA 3UPMA 3NM1A 4GYJA 5GJPA 3W70A 1XCWA 3WLOA 4IL0A 3DENA 3TC7A 1EYEA 5IFPA 5EMJA 2O92A 4QDPA 1PE1A 2J25A 3OTRA 4GIEA 3U48A 3USBA 3KHJA 2Y8UA 2I16A 2WQDA 4I9MA 3KL5A 2JGQA 4C91A 5EBAA 1NDVA 1UWSA 4AWTA 4F0HA 4JNMA 4YTSA 1Z8AA 1ZJAA 3LBMA 2FB2A 4O12A 3G1FA 4J3UA 3V0SA 1C29A 3G24A 4KCTA 2DZAA 1TIWA 5J5DA 4ZOBA 4WSJA 3NOYA 1A4LA 1YNYA 3PNZA 3V0UA 2HE5A 1WBHA 4Q8TA 3EWWA 4MFDA 4TX9A 4EPEC 4M1RA 3AWNA 2MUCA 3IACA 4HA4A 5G1TA 2YLAA 1EIXA 2HBXA 3UR5A 1A5NC 1R47A 4DNMA 1BTCA 4HU0A 1REQA 3PHAA 2DDXA 3VCRA 2IS7A 1TA3B 3LHVA 2EJ1A 2WM1A 4B16A 1FWSA 2XVNA 3REQA 1KB3A 3NYZA 2IQTA 1QOXA 1ZBVA 2DZWA 4DLMA 3ZLFA 4UR7A 1TVLA 2PUZA 1IZJA 3R5EA 4PTVA 4IX2A 1GZGA 3S5ZA 1H1YA 4UTJA 4L9YA 4AEEA 1TJPA 1KM6A 4P8VA 2EJAA 5FJPA 1JZ8A 1N55A 4NZ3A 1UMYA 3MP5A 5DXXA 1JUBA 4MWAD 3K4AA 1FH9A 5SWUA 3HPAA 4BA0A 2CZFA 4UCGA 4Z42C 4DYKA 3VXGA 1MRAA 2ZCGA 2E25A 4LAOA 2E77A 1XLLA 3BV4A 1Q2SA 1KGWA 3AXXA 1KQZA 2OU4A 1TE6A 4QDMA 4FA3A 2X0YA 4MHBA 4GINA 1GEHA 4I9AA 4QNWA 2QEZA 2QHAA 5AOUA 4AIBA 2WMKA 2J8GA 1F8MA 1OCQA 2FGLA 4MJ4A 5E09A 3KRZA 4AISA 2A7RA 5IXEA 4M56A 2FYMA 3STFA 4DF0A 5LNVA 1QK2A 4A2SA 1UIPA 3GVWA 4M19A 3GTXA 3DFYA 1GCYA 3AYRA 3P62A 5FF0A 3DFQA 1LL4A 1PX3A 1C93A 1Q6LA 1W1TA 4AAJA 1UB3A 5EGRA 5K3VA 4H3DA 2AQOA 2VC5A 2PF0A 3CQ0A 4PUWA 4AMAA 3LB0A 1UR0A 2P50A 4GQQA 2DSUA 3U2OA 3RK8A 1E3XA 2QAFA 2C8NA 2TSYA 3UWWA 3V1HA 3QY6A 2DUZA 5AC4A 1CLVA 4K3ZA 5H8UA 2QGYA 3MBDA 3QV6A 3OG2A 3VIJA 5CPNA 3WFZA 3OGVA 1SO6A 1H50A 3CMJA 3BJSA 4M7TA 3W1XA 3BMWA 4BR1A 2O9TA 1KFWA 4EE9A 1Z32X 2Z1WA 2RH9A 4ZOCA 3AHXA 4LYQA 2I56A 3L5MA 3BO9A 2QCFA 3WNMA 3EA1A 1JZ4A 4FNRA 2Y8KA 1DBTA 1LUCA 1B9BA 2PODA 2VUNA 1JI2A 2ODOA 3RR1A 4JN8A 5BRBA 3LI1A 4A6GA 3BAIA 3WLNA 1GQIA 5HNRA 4O1CA 4TVCA 4XZMX 3SJNA 1GOOA 3INPA 2DSZA 3CQJA 3M4HA 3CAVA 3F4WA 2PSNA 2WZMA 4DI8A 1QPRA 3NYDA 1OFBA 4UTHA 4DN1A 2I9EA 1HJUA 1ME8A 4G56A 3CUIA 1HF6A 2VWTA 3MHUA 1W1PA 3MCOA 1B3OA 1TMLA 4RK8A 1ONXA 4AWEA 2G96A 3M0JA 2H3BA 4DHGA 1WDPA 4UOJA 4UIOA 4ZOAA 4MDOA 1FWFC 3ANVA 3DGRA 1XIBA 3MUIA 2PDFA 3UJFA 2JK2A 1BD0A 3UR7A 4E4PA 1XLFA 5C55A 2H90A 3CH0A 2GOKA 3ZYZA 4R33A 1W3IA 2DFAA 2OO0A 1UKOA 2HMCA 3W1NA 2OEJA 4L1WA 1TRDA 3ARTA 5CBIA 3SI9A 4JIRA 3B0PA 2QCCA 3IIOA 1BF6A 1RJQA 4HNTA 4FLOA 4ZQRA 4U10A 3KXQA 2FKPA 3B4YA 5D33A 3PM6A 5KSWA 5M03A 2ZUNA 4WKAA 3SY8A 2B4GA 1RD5A 3AYVA 2YDQA 1CNVA 1FWNA 3PJTA 3TONA 4M0XA 1P7TB 1IE7C 3P93A 4XSLA 3WLSA 1W17A 3VDBA 4P7RA 2DH3A 1O5RA 4Y9PA 5B7YA 4JQ4A 3RF9A 1XLHA 2QCGA 3QR3A 3G0UA 3P14A 3TA6A 5CC7A 2WYSA 3GDBA 1TJ1A 5H8PA 3RU8X 1BXCA 4AZCB 3NJ3A 2YW4A 1XYMA 7ODCA 1TPB1 3ARYA 3GO2A 2XJ7A 1UIOA 4C1NA 3BAYA 1ZY9A 1VEMA 2FGBA 1OX4B 2YYUA 4AF0A 4HHHA 3NUKA 3PZUA 3EWUA 5HMSA 1W9BM 1RA0A 5FSDC 4LXFA 2VCAA 3PZOA 1W9VA 1WDDA 3HPZA 3SB0A 2GJPA 1X1OA 2VEKA 3VNKA 5A6BA 3CB3A 3OVPA 1TZ9A 3GNOA 4ASTA 4JIHA 4QSHA 4E8DA 1CLKA 3QM3A 5A95A 2WXDM 4KFNA 1JIBA 1R8LA 2Z1BA 2QYGA 3LLDA 1RAKA 3EWDA 1PX4A 5CXPA 3UWQA 2R1MA 3FDGA 3AI0A 3OLDA 4WX2A 1ISWA 4GZJA 2HTMA 3R0UA 3BW2A 4PCSA 1W5PA 3VMOA 1V6UA 4B2DA 1F61A 5FF3A 5AHFA 3UWZA 3VGHA 5A2CA 1HL2A 2WBGA 3NDZA 4RDWA 4LJ3A 1TVNA 3C2EA 3W7EA 4LNCA 4PMUA 4FX6M 2DGAA 4GBDA 1YKWA 1UOKA 3PN8A 4M6UA 1CGXA 3DZ1A 2XN2A 2VGGA 3OA5A 1YNQA 4QISA 2DSWA 2XISA 2YYTA 2CPUA 1RVGA 3ZOAA 4O0KA 1AQFA 4Q4MA 1V3IA 2HVOA 3WDJA 4NZ1A 3T0TA 1GVYA 1XGDA 1A5CA 2VX4A 2FPVA 1I2RA 3WQWA 5REQB 2E6FA 4E4FA 4GQBA 1D8WA 1TREA 1RH9A 2WVVB 1E4LA 4EPDC 1IT7A 3TLQA 1XISA 2Q01A 1ONEA 4AIUA 4P7OA 1GZ1A 2CESA 3TW7A 2O4QA 3W86A 4BHYA 1NF7A 3MYPA 1IZCA 3NL5A 1KM1A 3HGJA 5JBFA 2PWGA 5A8MA 3BOXA 3IJ6A 1YADA 3ARXA 3TN5A 3GG0A 1S5VA 4MMWA 2QAPA 3G1YA 3IRDA 4L56A 1IZKA 3T8QA 2J27A 2WLYA 3F4NA 2CNCA 3S5NA 5FF4A 1JCXA 5DEZA 2BX7A 1BFNA 3FA5A 1EL3A 2VOMA 4Y96A 1J2BA 3UG5A 1SGJA 2V3GA 3HG5A 1JPMA 2GJLA 3Q65A 1E6SM 3DU0A 3FGCA 3NPVA 3FYOA 2CLKA 5LNRA 2E5DA 3TV8A 4A8IA 3B40A 3C8FA 2IPWA 1MW3A 1PL9A 1SJBA 2W79A 2YA2A 3W7IA 3DFHA 4ZO9A 4PMXA 2X1UA 5CPMA 3JZEA 1O1HA 4IGHA 1E3ZA 4CEUC 1MWOA 2JF7A 2QDEA 1A5SA 2C1IA 1A3HA 4HGXA 2PWHA 4CKQA 4XWUA 3QLDA 5KZMA 1FBAA 1AD4A 1TVPA 4PTWA 4Z2GA 2D2JA 2F6XA 1A80A 4LAUA 4F0MA 2BSLA 5I79A 3K2GA 4GC3A 3LSCA 1LRQA 1VCVA 1U22A 2E1WA 2HWGA 5HMEA 1LLZA 4DWSD 3QKZA 2O7QA 4QEHA 3RMJA 4TV6A 1EYWA 3WUGA 1H1ZA 4HD5A 3PR2A 3QV8A 2WSQA 3TEVA 2QGHA 3MBFA 1RLCL 4QE4A 1Z41A 5CC6A 4X0NA 3BPWA 7PTDA 4QNEA 1ZGDA 1VHCA 1OK6A 3LCGA 3OIXA 1KR0A 2FHFA 3OQEA 4JFTA 3HPXA 2A4AA 3W7MA 1AW1A 4H4IA 4FF5A 3M0YA 1VPXA 4GE8A 1W5NA 4HK6A 1PXGA 1G67A 1HZYA 1RJPA 1OWQA 1LOQA 1Z6KA 3MANA 2OEKA 1HIZA 5CSYA 1OZMA 1R3WA 4HN8A 3PBGA 3QQ1A 4EXAA 1VJIA 3UXLA 5F2GA 4GO9A 2WMFA 4OZOA 1FA2A 2YA1A 1OVDA 4X3ZA 1EA0A 3VAVA 4PA8A 1D8CA 4GXPA 1J5TA 4ZVJA 2FDSA 4CCCA 2X2GA 1FDYA 4FALA 2VMFA 5CPTA 1ALDA 3PP7A 1KV5A 2CLIA 1FHDA 2G41A 3O9NA 1WV2A 3IVUA 5EB8A 3FA3A 3SGZA 3RO6A 2YSWA 3OBAA 4FMVA 3BAWA 3STEA 2ASHA 3BOFA 3QGKC 1VFTA 5C6MA 2A3HA 2A3LA 2WKJA 2C0AA 1Q6GA 4PSPA 2HS6A 1D9EA 3GU1A 3U5UA 2OKOA 3IUHA 3LU2A 4MF4A 2NUWA 3WENA 3O06A 3EGJA 3TK7A 1LJYA 3TCSA 5I78A 1MDLA 5MF5A 2XFRA 4AD2A 3KL3A 1VPYA 4J40A 3UXIA 1W37A 1Q3NA 3H2FA 4BY3A 1N8FA 3V35A 4NXSA 4KWOA 3BK0A 5D03A 1CDGA 4DJEC 2PRHA 1WP6A 4AWUA 3M5VA 1FWRA 3TYBA 2R94A 3EEZA 5FAJA 3LXAA 5DCBA 2NW0A 4GI8A 4LVDA 4B3ZA 3VDHA 5C8BB 1V0LA 3PZVA 3GDLA 2YXXA 1UQZA 4MLRA 3S8HA 3BSHA 3WIJA 1C92A 1MXGA 1EXBA 1TMQA 2DW6A 2X05A 1S2AA 7A3HA 3EOSA 1F8IA 3CPGA 4RNHA 5AN7A 1TIMA 1XV8A 3QOMA 3LOTA 2OB3A 3BWWA 3DHFA