3CMJA

Crystal structure of engineered beta-glucosidase from soil metagenome
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
441
structure length
441
Chain Sequence
b'KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucosidase
molecule tags Hydrolase
source organism Uncultured bacterium
publication title Crystal structure of engineered beta-glucosidase from a soil metagenome.
pubmed doi rcsb
total genus 173
structure length 441
sequence length 441
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2008-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cmjA00
1RPKA 2XYLA 1LL7A 2A3BA 5IHSA 1NM9A 2WMKA 2PC8A 1CXIA 1H3GA 3ARYA 2WC3A 4GPNA 4BQ4A 1V3LA 5ABGA 2YDRA 1Z32X 4ATLA 4RL3A 3SCSA 3SCOA 3I3BA 4LYRA 2OLHA 1LG1A 3VIMA 4GXPA 2QPUA 3VNZA 1XYFA 4ATDA 4CU6A 1L0PA 1WNOA 3DHUA 4YHGA 1HN1A 2YDQA 3GNPA 2J7CA 3CUIA 3AFBA 2UY3A 1OD0A 3PZTA 2XJ7A 1CGTA 3WUBA 2ZX9A 1OM0A 2EPNA 4P7OA 4DM1A 1C3FA 4W5ZA 2WVTA 4EKJA 5HPOA 2E40A 4Z2KA 3CZKA 3EDKA 2J4GA 5IFPA 3GBDA 3O2LA 4PTMA 3MV11 3AS3A 3W37A 2ZX6A 3L2MA 2BHYA 3NUKA 4D6IA 5JBFA 4J7RA 2DIEA 2J7FA 4MAVA 3ZR5A 2EBNA 1NARA 2FGZA 1BLIA 4D1IA 2UY4A 2V3FA 4F79A 1DWHM 1E6ZA 1V3KA 1BTCA 1C92A 1PZ2A 1KWGA 3VIGA 4GQQA 5A6JA 3ALFA 3MANA 4KGLA 1VFMA 1V6VA 2FH8A 3EDEA 4ZXOA 1KGXA 2VQTA 4FMVA 4WIWA 3WEZA 2DSWA 3B8SA 1QI3A 3W27A 3POCA 3WNKA 3OZPA 3VPLA 1GVIA 1P6WA 1W3JA 1TA3B 1E0WA 1UR2A 2X0YA 4IISA 1ODUA 4MPKA 4QCFA 1EO5A 2YL5A 2W63A 3NJ3A 5IXEA 4AD2A 1XC6A 4WF7A 1TE1A 4UQCA 2X2YA 3M46A 2E9MA 3VUPA 3CZLA 4X0VA 4J3WA 3AISA 1MQPA 1EOKA 2UY5A 4FK9A 1E9LA 2OSYA 4YHEA 3U5YA 4MNJA 7TAAA 2W66A 3CLWA 5JIWA 2G8ZA 3WF2A 1GZJA 2VMFA 4QLLA 4UZUA 1H4PA 3GM8A 2E4TA 2GDVA 3BGAA 5D8ZA 3QOKA 3CTTA 2YBTA 1VIWA 2XVPA 1GONA 3VDAA 3OGSA 1EHAA 3VMNA 2GFTA 2QMKA 3POHA 1S46A 5A6MA 2VX5A 2CBVA 4D6FA 1LG2A 3RILA 4JL2A 1E6XM 2QF8A 3WEMA 5I5RA 3PHAA 1E4LA 4NZCA 1QI2A 7CGTA 4B16A 4U2YA 3IK2A 3VTRA 4D6DA 1FFRA 3AICA 1ISWA 1GHSA 2DT0A 4PMDA 4HU0A 1CLVA 2BXYA 2WC7A 4NSBA 4CCDA 1CXHA 3WDQA 5BRQA 1C90A 1GOKA 1C91A 2JF6A 1QVBA 1AQHA 5FD0A 3WEOA 2XIBA 2J7GA 3ZJ7A 3AS1A 3ZO9A 1UKPA 2VRQA 5ABHA 2XIIA 3VGBA 3EMCA 1BPLB 6A3HA 5CJ5A 3L4XA 1FP8A 3W24A 4JFTA 2VR5A 1JXJA 2G4FA 3ZJKA 3HMCA 1UH3A 3WD1A 1JYXA 4C7DA 2YBUA 3AMKA 4PMRA 1BYDA 5GNXA 4CCCA 5A6BD 2VCBA 2QPSA 5IFTA 3CMGA 1J01A 4UOQA 1CGYA 3WNPA 2D3NA 4X9YA 2BS9A 4QFUA 1E1EA 2JF7A 2WKGA 2J8FA 4M81A 1UR8A 2QHAA 4R27A 4MJ2A 4ZE5A 2XVNA 1WAWA 3GZAA 3KZSA 3MUAA 4H8VA 1W9BM 4H41A 3S6TA 1Y7VA 1E56A 3F4VA 2VRKA 4PMYA 4PTWA 3AIQA 2DGAA 3HN3A 1R86A 1ZJAA 5EB8A 1HVXA 4JIEA 3D3AA 4TVUA 4KGJA 1H5VA 4HU8A 3WH6A 5GQBA 4BCEA 2XG9A 1XD1A 1VFUA 3W4RA 4AYSA 1HXJA 4CD5A 1E71M 4UFMA 4J3VA 3U57A 3HU7A 3W6LA 2OYMA 1W1YA 3CIVA 2J25A 1E40A 1PIGA 2DT3A 4BZYA 2Y2WA 2VO5A 4TUFA 1HJVA 5I78A 3VDHA 1DWGM 4N0RA 1MW3A 3WF3A 2CITA 5GNZA 4ACZB 1HX0A 5A8MA 2ZXAA 4AZBA 2BHZA 2WVUA 4TOQA 3KE0A 1E4NA 3L4WA 3N15A 1HP5A 4UFJA 4AZGA 4Y7EA 1UWIA 4HA4A 1J0HA 2CPUA 3LPPA 4OBRA 3WF4A 4MNKA 1DWAM 4F8XA 3VD4A 3MUZ1 1B9ZA 1J9YA 1EDQA 3DHPA 1V0KA 4R5EA 3S2CA 5CPQA 4HZ6A 1EIBA 3AHYA 1XSKA 3AMLA 3VGHA 4CD8A 5BXSA 3MUIA 2CYGA 3BC9A 4AZ5A 3I3EA 3G6MA 1UUQA 4K68A 3QGVA 3T2OA 3WDHA 1U2YA 4PBGA 4A3HA 2PBGA 1ZL1A 1BYBA 4PCTA 4QLKA 4ML4A 1CZ1A 3WD2A 2J7DA 1BQCA 4JFUA 1GCYA 3BAYA 1OINA 1NWUA 3ZMRA 3L4TA 1PX3A 4IPNB 1KXTA 3WF0A 1TFVA 5AC4A 2YLAA 2ZUNA 3PZOA 1QBAA 3SCPA 3NSMA 1JZ7A 4E8CA 1HKKA 2TAAA 3ARVA 5E09A 2XUCA 1XYZA 2D0FA 1B31A 3BLPX 2DEPA 3K8MA 4MADA 2GJXB 3B9DA 1OD8A 1W1TA 2J78A 1GJUA 1SYTA 4W86A 3VX0A 4W7VA 1IV8A 4M1RA 1V02A 4W85A 3OLEA 4M80A 1B3ZA 4CD7A 1KGUA 3WUFA 3WNNA 1GUVA 4RE4A 1E1FA 1QNQA 3SUSA 1MYRA 4W7WA 1JZ3A 3PZ9A 4Q22A 4LYQA 3AHVA 1RP9A 3VD3A 1ZS2A 4CD4A 3WFZA 5A6LA 2Y4SA 3OGVA 2NT1A 4U5IA 1E5JA 2ZXBA 4HOXA 1AQMA 1JZ4A 1FH9A 3OB8A 4OKDA 1TG7A 5M3WA 3VIHA 3MSGA 2QLYA 3WKZA 1K9TA 1V0LA 2J77A 1NP0A 1BVNP 1WKYA 1QW9A 4MNLA 4UFLA 2WW5A 3MU7A 1JF5A 3AMDA 3FXYA 1E6SM 1MW1A 4AD5A 3ZIZA 4HA1A 4D6GA 5A69A 3CBWA 1JYNA 2QV4A 4PCSA 3CHEA 5KEZA 4TXEA 3A4XA 3ARUA 2EO7A 3VDCA 1MFVA 1WDPA 1R8LA 2G3MA 1OGGA 4L4OA 2WZIA 3ARSA 4H8HA 1F4HA 4UFIA 1JD9A 2YL8A 3UETA 1YQ2A 4Z2LA 1UR1A 2ZUSA 3VIOA 1ODZA 1ITCA 1DTUA 3WQVA 5BXRA 4F9DA 1EQPA 1HIZA 2V5DA 5D8WA 3BMVA 3LPGA 5HNNA 1MW0A 4KWUA 1GOMA 3PBGA 4GI6A 2WSPA 3K8LA 1KB3A 1VENA 4AD0A 5A6AA 1BG9A 1UWQA 2X05A 1CTNA 3APGA 3L4VA 1KR0A 4PMUA 1GOWA 2D3LA 1TVPA 1QNSA 3SUUA 5FOOA 3OIHA 3CHCA 3NYDA 3UERA 3GTNA 3T2QA 1XV8A 5CGTA 2CCRA 1RD6A 2IXUA 4HA3A 3CZEA 2VURA 2WMFA 2GJXA 1GPFA 2OWWA 3NIYA 4D6HA 3VGGA 4BA0A 2YA0A 1E3XA 3U7BA 4U33A 1E0VA 1Q6GA 1Q6DA 3ZOAA 4IM4A 1UKOA 5JBEA 1FFQA 2WWCA 5C8BB 3WQ4A 3GDBA 1X6NA 3FHQA 5DO8A 1WP6A 5FL0A 3GH7A 1VFFA 1C7TA 2XPKA 4LYPA 1TVNA 4AD1A 2F8QA 3VMOA 3WBEA 2A3CA 2YKKA 2DQXA 3AOFA 4HMCA 3AMCA 3NSNA 5LA0A 3CH9A 2O9OA 2VX6A 3N18A 3AS0A 4BF7A 1W3LA 2VZTA 3T0DA 5DT5A 5EFFA 1UD3A 1B3WA 2W61A 4AWEA 4E4PA 5CSUA 4UQEA 1XD0A 1CYGA 2DDXA 3GXFA 4EE9A 1HJXA 5HXMA 5A6SA 3BSGA 5C70A 1UKTA 2OWXA 1G1YA 3ARPA 3GNRA 2DSZA 5A6KA 2OSXA 4EK7A 3WY1A 5A94A 2WPGA 2GJPA 4U3AA 5CLWA 3CHDA 4LGXA 2X1IA 3SEPA 1VBRA 1V0MA 4U2ZA 5A3HA 3WNLA 1V3IA 2FH6A 2J62A 5E70A 1FP9A 5M17A 4KH2A 4E8DA 4JKMA 3RCNA 3WMCA 3GYCA 4FLOA 2VT0A 3AIVA 3CO4A 4F9JA 3WFLA 1IZKA 2WHKA 1ESWA 2WZHA 1UD4A 3WSUA 1QBBA 2BV9A 1SR0A 1LLOA 3BAIA 4H2CA 4OZOA 3VILA 5BRPA 1LWHA 3GXIA 4GO9A 4ZXLA 3W0KA 1UHVA 1B30A 1KBKA 3SCTA 2BNJA 2GUYA 4S3JA 4UQ9A 3VOCA 2WMIA 3VM7A 3AIWA 1VAHA 3PZNA 1Q6CA 1DWJM 1OGSA 2X8RA 3N13A 5A6BA 2CHOA 2XTKA 4TVDA 2BVDA 1NH6A 4W8LA 1PJ9A 3WN6A 2VUYA 1M03A 1E6NA 3PZGA 1JD7A 4AEFA 2PWGA 3M6DA 2EXOA 2VVNA 3VIFA 1C93A 4S3KA 1R7OA 3AMGA 5A95A 3NSXA 2BY3A 3K4AA 5EMYA 4MDPA 3VGEA 5KZ6A 4WKHA 5I2UA 4D72A 3CZJA 4AZIA 5BXTA 2NW0A 1M01A 1W3KA 2XGIA 8CGTA 1W2VA 3OBAA 1CGWA 2XGBA 3GH5A 5FKYA 3VDBA 4MNMA 4V28A 3EYPA 3IAQA 1HNYA 3I3DA 2VX4A 4X0NA 4B9YA 3AI0A 1W9DM 3THDA 4B3KA 1HL9A 1HL8A 3MMWA 2WHJA 4PRWA 3WD4A 4CN6A 4ZFMA 1EOMA 3W53A 3UESA 2BFGA 1CDGA 3VIPA 5I79A 1G9HA 2PF0A 3FW6A 3VD5A 3ZQ9A 4JKLA 4WK9A 1E15A 1E4IA 2EQDA 2ZWYA 3NDZA 1W1PA 4WKFA 1ECEA 3UR8A 4QAWA 1H11A 2ZICA 6CGTA 1KGWA 1H0IA 4H04A 3WDIA 2PWDA 2MANA 3JUGA 1V6UA 3BXWA 3TTYA 1US3A 4BQ3A 4GKLA 2J79A 2CBIA 2W67A 4XB3A 1X6LA 4U5KA 5CXPA 5IDIA 3SCWA 4P8WA 1KXVA 1PAMA 2ZUVA 3WD3A 3VGFA 4EAMA 2YDSA 4JAWA 4WLCA 3ARXA 1B3XA 5A8PA 4PSRA 1NP2A 3BCDA 5D9MA 3VX1A 3F5KA 1NWRA 3HJEA 3TTOA 1CECA 1JZ2A 3N17A 1WCGA 1JDDA 1W32A 2F2HA 3T2PA 2ZUUA 4OBSA 1XH0A 1G94A 1B3YA 4XZWA 1OCQA 1KFWA 1UWRA 1W91A 3M07A 2V38A 1R7AA 2XWEA 1GW1A 1LQ0A 3WH7A 3KWXA 1PX4A 1D2KA 5CPSA 4DUXA 3QHMA 3BLKA 2YA1A 2D0GA 4BQ2A 1QNRA 2OSWA 3CPUA 4C7FA 5ABFB 4J3XA 4GI9A 1UKQA 1R87A 4W84A 4D6JA 4P7QA 3K46A 3VM5A 1V6WA 2CIPA 3AXHA 4UFHA 4XX6A 4AIEA 5M5DA 3TTSA 1XCXA 4HZ8A 1KBBA 2ZX7A 3SUVA 5GPRA 1EO7A 1K9DA 1VFOA 4NF7A 2CKSA 1UZ1A 2XM1A 4MAZA 1BVZA 4HZ7A 1IT0A 3W81A 2Y8VA 1CPUA 1ISYA 1UZ4A 3MMUA 1GORA 1UD5A 5CGMA 4JFSA 4MB5A 4AISA 1I75A 1V0NA 1UQYA 5DMYA 2PB1A 3PZVA 2ZUTA 1UOKA 3RM8A 1WZAA 4MB4A 1OT1A 2WVSA 4EANA 4BQ5A 3PTMA 4Z2GA 3EDDA 1X1NA 4TTUA 3AIRA 3WH5A 2WYSA 4HMEA 1K9EA 3CUJA 4LPCA 2G3NA 2GVYA 4U3CA 5BCAA 1HJUA 2WSKA 3OLIA 4DWSC 1J0YA 1ZBCA 2ZXDA 5FIPA 4PTXA 1CNVA 3IANA 1D7FA 3DYMA 3W38A 1F4AA 1V08A 4Z2HA 4M82A 3WDJA 5ECUA 1UR9A 2EEXA 5D9NA 1PPIA 3D5HA 4UZSA 3CHFA 2XFFA 1W3HA 2JALA 1OWQA 7A3HA 4OJYA 4Z2IA 2J7EA 2ZXQA 4MB3A 4UNIA 1E3ZA 4P8VA 3KL5A 2ZUMA 4AMCA 1E6RA 3WIJA 4URIA 1MXDA 4HP5A 3ZT6A 4M56A 1EDGA 1UYQA 2V3EA 3L4UA 2YL9A 3VIKA 2ESCA 2DH3A 3T0AA 4CN4A 4UQBA 3RIKA 3OG2A 2VX7A 1B3VA 1MWOA 2VZSA 4FF5A 3W26A 1XGZA 4M24A 4P8UA 4NRSA 2V3GA 3WUGA 1E73M 1GQIA 1OSEA 1XCWA 2JIEA 4FLRA 1PBGA 2VL4A 2D1ZA 4P7NA 1KCKA 1ISVA 1ZBVA 1FHLA 3ZJ8A 1UD8A 2CKRA 1BYAA 3IAPA 1GQKA 3N9KA 3ZSTA 1VEMA 3IJ8A 1ZBKA 3T08A 1BHGA 3AHXA 4IUGA 4AZ7A 1NOUA 1VEPA 2G41A 3U7VA 3VU2A 5A8OA 4KRUA 4AY1A 1WPCA 4W89A 5C71A 1UG6A 2WLYA 2YOCA 1QI4A 1IZJA 1NOFA 3ALGA 4PN2A 4PMNA 3K8KA 4HOZA 1KWKA 2BY2A 1E6QM 4D71A 4WSJA 2Y5EA 1QHZA 4CVWA 1UA3A 2CEQA 4AC1X 3WD0A 2BVYA 2WCAA 1E70M 2E9BA 5A1AA 4F66A 2PWEA 2YIHA 3BCFA 5EBAA 3DC0A 3IJ9A 1W9UA 5AYIA 4PUEA 2XWDA 3M7SA 4GIAA 2RGMA 1QHOA 5E9AA 3TA9A 5CG0A 5E6ZA 2YL6A 5CZKA 1OT2A 1RP8A 1C7SA 3EMQA 2E8ZA 3CGTA 1JDCA 1K6AA 3K4DA 2DSKA 3AJ7A 1ISXA 1XSIA 3WQ8A 2D20A 3WMBA 1AQ0A 1H1NA 3AXIA 4Q7NA 2D24A 2WLZA 2XSBA 4L4PA 5D9OA 3W82A 3WNOA 2Z1KA 4CKQA 3LMYA 2G3IA 1KXQA 1DEDA 3WQ5A 4AZCB 1FH7A 4RE2A 4DWSB 1UH4A 3L2LA 1L8NA 3BAJA 3OA5A 3GBEA 3DYOA 5CPTA 2CXGA 3N04A 1JG9A 1DHKA 5E0CA 4AZ6A 2Z1SA 3EMZA 5JIPA 4WKAA 2CNCA 3ZSSA 2Y24A 1ZB5A 3E1F1 3TOPA 2HISA 5BWFA 5LA1A 2BVTA 1GOQA 4GZJA 3SURA 4JKKA 2ZWZA 1J12A 3VD9A 3ZT5A 2VCAA 2ZOXA 2BXZA 3ZM8A 3KL0A 4PSPA 2AMGA 2J75A 2DIJA 3A47A 4W88A 3AXXA 1MVYA 2FHFA 2WM0A 1QNOA 2W4XA 4GI8A 3WENA 2Y8KA 1TMQA 3WNMA 2E3ZA 2GJRA 4PMOA 1JFHA 3CUGA 1DWIM 1B0IA 3EBVA 1CGVA 3WMSA 2WCSA 2JEPA 1QHPA 4J3SA 1K9FA 2C8NA 5HDRA 1EHNA 4M8UA 1E4MM 3L4ZA 1JYWA 3W25A 1CXFA 9CGTA 3UG4A 3QOMA 1PZ3A 3PZUA 5JUVA 6TAAA 3FHAA 2WZEA 3N11A 1KCLA 5HBFA 3O9NA 4UOJA 5E0FA 1JF6A 1Q4NX 3RJYA 1UH2A 1U30A 2WVVA 2X0HA 3VD7A 3MMDA 4W8AA 1OB0A 4CD6A 2IXVA 1QI5A 1NQ6A 3SCRA 8A3HA 2BY1A 1MQRA 3AZRA 2NT0A 4YPJA 5ABEA 1V03A 4CUCA 1UR4A 4ZENA 3QR3A 1UWUA 4OUEA 1VJSA 3NDYA 2A3EA 2E8YA 2C0HA 2VQUA 3PTKA 4ZE4A 3B9EA 2DSUA 2NSXA 4H8UA 3ARZA 2G3JA 2WHLA 3THCA 1XH1A 2WMGA 2GK1B 5IHRA 4FLQA 1W9VA 3A4WA 2AAAA 1BGGA 1BFNA 5F7UA 1CWYA 3ECQA 5ABFA 3VIIA 3KEHA 3SUWA 3F5LA 1WZMA 2J8GA 2GSJA 1GQLA 3SCUA 2XVKA 1JZ5A 3WDRA 4PEEA 4OOUA 1HKMA 3W6MA 4XZBA 3T0BA 2VC9A 1J0KA 2W91A 4MTVA 1Q6EA 3WL1A 3AIUA 3CUHA 1U33A 4AD3A 1H41A 2JEQA 3B9AA 1DP0A 1MXGA 5A2CA 2DPEA 1W1VA 3VGDA 1QI0A 1XH2A 2RGLA 1WZKA 3AZSA 1MW2A 3WF1A 2BHUA 1J0JA 1EGZA 1KR1A 5AC5A 2V5CA 3WQWA 3L4YA 4RE3A 5CLTA 1N82A 4PMXA 2XSAA 3FAWA 2OYLA 4XUYA 2ZE0A 3RO8A 1JFXA 3AS2A 3FAXA 5LA2A 3PTQA 2CERA 4U31A 2FDMA 4W87A 3W28A 5I3DA 3PN8A 1B2YA 4MB1A 1UD2A 4UQAA 1JYVA 2EPMX 2Q8XA 3GH4A 3EDJA 4ACZA 5E6YA 3GNOA 1HVQA 3MV01 4FLSA 3FN9A 3OLDA 2FGLA 4MJ4A 1KXHA 2YA2A 4B3LA 2VCCA 2WBKA 2CESA 1EDTA 1JXKA 3BSHA 4M29A 4UQDA 1C8QA 3OLGA 2O9PA 4PTVA 1B1YA 1D3CA 2O9TA 1NWTA 1I1XA 2WCGA 1NWSA 4A4AA 4B9ZA 1JL8A 2QMJA 5HOSA 1CEOA 1WO2A 2XHYA 2ZIDA 3PZIA 1ZJBA 1GNXA 2CBUA 3OZOA 3RM4A 1XSJA 5CQ1A 2JIWA 1R85A 2D0HA 4W5UA 4AZCA 1I1WA 4UR9A 3G6LA 4P7LA 1G01A 5I0DA 1RH9A 3BAWA 1UQZA 2A3HA 3CMJA 4GINA 4JFVA 1EH9A 1AVAA 3TONA 5GNYA 3MKKA 5A2BA 1HT6A 2XVGA 5A2AA 4GZIA 5I23A 1JZ6A 3AZTA 4JFWA 4TTGA 4JCLA 2XFRA 2B31A 2WMIB 2O9RA 4LX4A 2E0PA 3AROA 1YHTA 3OGRA 2D2OA 2JFEX 3FY1A 2VJXA 4P7RA 3ZT7A 2UY2A 3AYRA 1JIBA 4AZHA 1WZLA 1W2PA 5BYWA 1JAKA 2AOSA 1OBAA 1GOOA 1HKIA 2A3AA 3WELA 3GXMA 3RJXA 4CU7A 3VINA 1O7AA 1WDRA 1JI1A 3ARRA 1GQJA 2WAGA 2OYKA 1V6YA 2FHBA 4YN5A 1EA9C 2D22A 2EPLX 1ZBWA 3ARTA 3ARWA 4QCEA 4GO8A 5AY7A 3AHTA 2X09A 5DFAA 1CXKA 1BAGA 1PX8A 3MUY1 4JL1A 4TVCA 3LPOA 1E55A 1VJZA 1VBUA 5LYRA 3WH8A 3UR7A 4ZEPA 1GHRA 2WWDA 1QNPA 1V3MA 2IUZA 1CENA 4D1JA 3WL0A 3WDPP 1MFUA 1LL6A 4PMZA 4UTFA 1VEOA 1A3HA 1W9PA 2PI6A 2ZX8A 5D4YA 4AW7A 4J3TA 2XM2A 3BMWA 3WQ6A 5A8QA 1FH8A 1H49A 1Q6FA 3VNYA 3BAKA 1LWJA 4XV0A 1FHDA 4OIFA 2CETA 4NI3A 1C8XA 1E43A 1M7XA 1HKJA 3A6OA 4A3YA 2WXDM 3VIJA 3F5JA 1BGAA 2XFYA 1QW8A 2EPKX 1UKSA 1LL4A 2C7FA 1UWSA 1SMAA 3SIMA 3ARQA 1M04A 4AD4A 1EQCA 4W7UA 4CN1A 1BSIA 1E72M 3UG5A 1OGBA 2PBOA 3CUFA 3PZQA 1JGIA 5TD4A 1J18A 1E0XA 1V6XA 2VZVA 4W8BA 1H09A 4DM2A 1E6PA 2OWCA 2VRJA 3AHZA 3DECA 2EJ1A 4AEEA 2WMHA 1SMDA 4JHOA 2VTFA 1TA3A 2GK1A 1V02E 3AIEA 5CSYA 1W9XA 5EFDA 2ZUWA 3EDFA 2UWFA 1HF6A 2VOTA 1J0IA 3QHNA 3SCVA 1NOWA 1GVYA 4W93A 1JI2A 2W62A 4WJXA 4D6EA 4AXNA 1HP4A 3NCOA 2WHMA 2YLLA 2WK2A 2WVVB 2VI0A 4J28A 4KRTA 1A47A 4DUVA 4DUWA 1EXPA 1GOIA 4J3UA 3WBAA 4NRRA 1LF1A 1VB9A 2EPOA 3BH4A 3U5UA 1US2A 5D9PA 2J47A 3SCQA 2XVLA 3TP4A 2J7HA 3N1AA 1WE5A 3UG3A 1CXLA 1JNEA 4LXFA 1CBGA 1OIMA 2JE8A 4AIOA 3T09A 3MSDA 4KMQA 1ITXA 2DT2A 1TUXA 1TCMA 4HTYA 5DT7A 3LPFA 3SUTA 2VR4A 1JDAA 4UOZA 5FL1A 3UEQA 1BYCA 1CXEA 3SCNA 2WBGA 1JNDA 2J74A 4UFKA 3CZ8A 3TTQA 1VF8A 3QHOA 3VO0A 3UCQA 1J0ZA 1VRXA 1QPKA 1AMYA 3AQUA 3W29A 5FCZA 1V3HA 3N12A 1SFSA 4HOWA 3BAXA 2PWFA 1CGXA 1XRVA 2O92A 4B15A 4Z2JA 1J10A 1GJWA 4TX8A 1CGUA 1G0CA 3K1DA 5I6SA 4DWSA 4D6CA 3DYPA 4J27A 4MDOA 3PZMA 1H0GA 1UWTA 1C8YA 2E9LA 4CU8A 3J7HA 3RMEA 1KQZA 4JHZA 3ZR6A 3VMPA 4IPLA 4ATWA 1J11A 1V3JA 1JZ8A 5BXPA 3RM9A 1DWFM 2VNCA 3KL3A 4C7GA 4CCEA 3AYSA 3VVGA 1BF2A 4GQRA 4QDMA 1PIFA 1CLXA 4OOZA 1TR1A 5AYBA 2DSVA 4V27A 2CBJA 3AIBA 4CVUA 2WANA 1OIFA 1FA2A 2WMJA 5I24A 2F61A 4TX6A 2V3DA 5M03A 1HJQA 1ZU8A 4QP0A 1MQQA 3MO4A 3WUEA 2WB5A 2HVMA 1LJYA 1QOXA 3II1A 1WDSA 3VKKA 5JBDA 1TZ7A 2VZOA 4GZEA 3RPMA 3WH9A 3RDKA 1ISZA 1H2JA 1XHGA 3ZJ6A 4JZ5A 1WB0A 1HJWA 3O6AA 2GDUA 3A4AA 1O6IA 1JAEA 3FNDA 4PYSA 4P8XA 2WNWA 1UA7A 5HPCA 3IJ7A 2D23A 1E5NA 3MS8A 2ZX5A 5I77A 4PMQA 3GXDA 2PWHA 4ACYA 4BS0A 5DF0A 2J7BA 2YJQA 4DWSD 1UD6A 2WKLA 2W92A 4WSKA 4JCMA 3A3HA 2CHNA 4PUDA 1WDQA 2FHCA 5BROA 1FOBA 4HPGA 1M53A 2VVSA 1CIUA 1UR0A 1HJSA 5DEZA 4LQ1A 4HMDA 4PMVA 4H7VA 2VZUA 2BY0A 4HPHA 4CGTA 4UCFA 2WC4A 4QLJA 4AIUA 2W5FA 4V2XA 1B90A 1BG4A 4E2OA 5A8NA 2DT1A 3CZGA 1G5AA 2DH2A 4N42A 1PEZA 1KQYA
chains in the Genus database with same CATH superfamily
1M6JA 4C6PA 1LL7A 1TTIA 2E1DA 4Q4PA 4WX2A 1MEHA 4OFCA 2B7NA 1UZDA 1H3GA 2WC3A 3LQLA 4GPNA 4Z17A 4AX6A 1Z32X 4ATLA 4RL3A 3SCSA 1P0NA 1DV7A 1MDRA 4Q4OA 2PDKA 3VIMA 3P2VA 4JTGA 1REQB 5E0KA 5BZAA 4L6OA 4ATDA 3PJUA 4YHGA 3FDKA 2R91A 3GNXA 4NASA 3AU2A 1VIZA 1Q6RA 2YDQA 2J7CA 1P0DA 4DPQA 1TKKA 1DE6A 3TWAA 3MHUA 3PZTA 4FR6A 4O18A 3BG5A 2QUTA 1OM0A 3FLUA 2WVTA 2CLKA 5LNVA 2E40A 4JN7A 4MIMA 5BMWA 3QTPA 1R9XA 3K13A 3W37A 3EA3A 2BHYA 1EBHA 4K8EA 3RGTA 5EMKA 4JTHA 5JBFA 3FJ4A 4J7RA 3SO7A 4KWWA 4L61A 4MAVA 4RXGA 5HUOA 1K7FA 3JRKA 1BLIA 5RUBA 2UY4A 1TQXA 3IS4A 1DWHM 4O0ZA 1EF2A 3VOIA 1BTCA 1C92A 3H2FA 3QC3A 4I7UA 1KWGA 1L6WA 3ALFA 3MANA 1QJWA 4RNHA 3EDEA 1N55A 2DSWA 2ZRWA 5AHLA 3WBXA 1QI3A 3QMTA 3TW7A 2E1WA 1IIHA 3L9CA 5HJXA 1EYWA 1VCGA 3GB6A 3H7RA 1W3JA 4HNVA 1E0WA 2GYIA 1U5HA 3VNJA 1TJRA 1ODUA 1EJXC 2W0UA 3BWWA 4QCFA 2GVEA 3NPVA 4IG2B 3ABXA 4GBUA 3N34A 5D05A 4JQ1A 4YWIA 1WA3A 2YL5A 4LH8A 3QV6A 2W63A 1CI1A 3RRAA 4RPQA 4QJ5B 3NJ3A 2BBFA 3GVWA 1XC6A 3LTYA 1TE1A 1FWCC 4UQCA 1FWBC 3M46A 2UY5A 1E9LA 2OSYA 3BCJA 3U5YA 7TAAA 5JIWA 2G8ZA 4PB4A 5HJLA 4A2SA 4XZMX 4QLLA 3MVTA 4UZUA 2E4TA 3HJZA 1M65A 4FNTA 3BGAA 5CGQA 5D8ZA 5I3HA 1YNPA 3QOKA 3CTTA 1X1ZA 1AJ0A 3W7GA 1GONA 3OGSA 1XIJA 3NXLA 1H7RA 5A6MA 2VX5A 3VOFA 2QULA 3PBUA 1RAKA 3Q37A 3G18A 4DI9A 5I5RA 1E4LA 3S1GA 5C2GA 4B16A 2ISWA 4U2YA 3IK2A 4D6DA 3AJXA 1ISWA 3GHUA 4HU0A 3BW3A 1CXHA 1NDWA 2NLIA 1Y5VA 3TWBA 3FA5A 1IZCA 4ZR8A 1AQHA 5FD0A 1SJAA 1T8QA 3WLRA 2POZA 3EWDA 1YKWA 1UKPA 3VGBA 4GY1A 3EMCA 6A3HA 3ZLGA 5CJ5A 3W7PA 1XIEA 3L4XA 6PTDA 2D2HA 2VFFA 5LKYA 2VR5A 4QNEA 3GNDA 3VK5A 3W1PA 2W6RA 3IIZA 4YVXA 1TIWA 4F2TA 1UH3A 3BO9A 3H23A 2F6UA 5LIWX 4XZIA 1JYXA 2YBUA 4RCXA 3FJLA 1GWJA 2OOFA 1BYDA 5I3GA 3GR8A 4KS0A 2VFGA 2D3NA 4A05A 4QFUA 1E0TA 3C3UA 2WKGA 4R27A 4H9UA 3MUAA 4H8VA 5T9BG 3RR4A 4LUJA 4K36A 4CNTA 4F0HA 1LOSA 2VEFA 4RZ4A 3S0CA 3LS9A 3F4VA 5EMJA 4EVZA 1XC4A 4MUZA 3KUMA 1ZJAA 3NQAA 4JY9A 2Z28A 4TVUA 4GY7A 3P7YA 3WH6A 4EPBC 3NQ8A 4CD5A 2E5BA 1W31A 4UXDA 2QQ6A 3IUDA 1OCNA 5KINA 4JQ3A 3AU6A 2J25A 1E40A 1VC4A 2V2DA 2XIMA 4KCVA 2VO5A 1KFKA 3PWGA 3DG6A 1EWEA 4IWWA 4N0RA 2QCCA 1S5WA 1MW3A 1RALA 4JY8A 1I2OA 3L4WA 1E4NA 3R94A 3OVPA 3TCEA 2OXNA 4HA4A 4OBRA 5A8GA 2PDIA 3MUZ1 1AL8A 2YB4A 1WOAA 4Z1AA 2Z6IA 1E9IA 3NM3A 3S2CA 4GYJA 4GZ7A 4CD8A 1IGSA 4DLMA 4AZ5A 1UUQA 3GG0A 1W6TA 1UW9A 4RE0A 1QDSA 2PDNA 3T2OA 3WDHA 1WKFA 2Y0FA 3HM7A 4A3HA 2ZVRA 2PBGA 1BYBA 1IXPA 4WQ6A 3EPOA 3EWBX 5G4HC 3EXSA 4QLKA 2J7DA 3M44A 4JFUA 1GG0A 2P0IA 4WR3A 4Q3MA 1RY8A 4UBPC 5JVLA 1FQ0A 1OK4A 5AC4A 2BGNE 2ZUNA 4O8RA 3NSMA 1RHCA 4M7TA 5AZ0A 4PEKA 1HKKA 3ARVA 3RCYA 2XUCA 1NDVA 3RNDA 1B31A 2YSWA 3BLPX 1KFEA 2A7NA 3B9DA 1OD8A 1FWEC 1W1TA 3EWUA 3VX0A 3HOJA 4W7VA 4ORIA 4M80A 3NEHA 3W83A 4CD7A 2P88A 8RUCA 4IJRA 3ENLA 1FDYA 2TODA 1DJXA 1R5YA 2V5KA 3PZ9A 4LYQA 2XIJA 4QE5A 4AHQA 4RNFA 1TO3A 3OGVA 2G95A 3P14A 1K4HA 3IACA 1E5JA 1A5BA 4Q4SA 1TWSA 1FH9A 5M3WA 3MSGA 1BD0A 1K9TA 2BZNA 5FACA 4OV4A 1V0LA 3O3RA 3W72A 1BVNP 1A5SA 2GOKA 1I45A 4Q8WA 3CEUA 3O6YX 1U1UA 4MNLA 3AMDA 4CQAA 4A3RA 4HPXA 2RFGA 3IVSA 3CASA 4ZQRA 3TSMA 1A80A 4IX0A 1ITQA 2QV4A 4TXEA 3A4XA 3DDMA 3KCJA 3ITVA 3VDCA 1SUXA 3FEMA 4N9EA 3LV6A 1WDPA 2PTWA 3V35A 3AWOA 4LY4A 5HQEA 4MGGA 4MSSA 3I6EA 3VIOA 3COTA 4MWAC 3BOFA 2CLHA 1S2WA 5D8WA 1OZMA 1XL9A 5C9WA 4N9DA 1MW0A 3PBGA 2WSPA 3GW3A 4O17A 3ORWA 4LVBA 4JXCA 1DOSA 3O15A 3MDUA 1BG9A 1NSJA 4HNUA 1AUSL 3APGA 3T4CA 2VWSA 2A3LA 3WK3A 4OHQA 5H1WA 4L5ZA 3E2VA 4BK9A 3TLLA 2XGZA 3CHCA 3UERA 4E0CA 1DJNA 1M3UA 4M7SA 3QSTA 1XV8A 2YCEA 1XYCA 2CCRA 4ZOAA 3A3WA 1V4YA 3NIYA 3O7UA 4D6HA 3O16A 4BA0A 3U7BA 1KBIA 2FZMA 1E0VA 1Q6GA 3LOTA 1GKPA 4H7CA 1ZJIA 4IM4A 4E38A 1XI3A 1FFQA 4O57A 1KTCA 3WQ4A 1PZ0A 3FHQA 1XIGA 1PB0A 4LCSA 3CV1A 3GH7A 3NVDA 1VFFA 4BR1A 4LYPA 1TVNA 5CEWA 3G8RA 3VMOA 1KLYA 1IEQA 2FTPA 3WBEA 3T40A 3KVKA 1T41A 2X16A 4BF7A 1MO0A 1W3LA 3T0DA 5REQA 3OHMB 2W61A 5EFFA 4S3BA 5D02A 1XD0A 4JTLA 3GXFA 1HJXA 4LW7A 5HUPA 5A6SA 5G4EA 1W0MA 4FSAA 3TC7A 1OFQA 3SI9A 4XISA 1RJPA 2OSXA 1DQXA 4JYEA 5BMXA 3LLXA 4U3AA 3CHDA 2OKTA 3IRSA 2Y61A 3WLQA 5FF2A 1K6WA 3LHYA 4GNJA 2J62A 1B4EA 4KH2A 4JKMA 3DI0A 3CAKA 3GYCA 4OGZA 3BLOA 3V36A 2FYMA 4F9JA 1IZKA 4AFYA 2WZHA 3WSUA 4MKSA 1LLOA 4Z1YA 4H2CA 5BRPA 3W00A 1W5OA 1B30A 3SCTA 2BNJA 2GUYA 2GLKA 4UQ9A 5DXXA 1XXXA 3R0UA 1KRCC 2Z4GA 2NVCA 3CYVA 1AFSA 2X8RA 3N13A 4GCAA 5A6BA 2XTKA 2PDJA 4A35A 4GISA 4C6QA 4YMZA 1TTPA 4E6MA 3MYOA 4XO6A 4AEFA 4GYPC 4C6KA 2EXOA 2VVNA 5E1QA 1PSCA 3VIFA 1EGVA 4FNQA 9XIAA 4S3KA 1UUMA 3INPA 3NSXA 2BY3A 3I10A 4WGXA 4MDPA 4LAMA 4WKHA 2XFWA 5I2UA 4R33A 3CZJA 1GYMA 1RQEA 4PZVA 1W3KA 4QEHA 4IL2A 4MYXA 1CGWA 2O56A 5FKYA 4OU1A 3S3GA 5AC7A 1S1RA 3MUXA 2NLYA 4F0LA 3W3OA 1WAUA 3MMWA 2WHJA 1R9ZA 4PRWA 4ZFMA 2V6AA 2PDWA 1CDGA 4GYFA 5I79A 3VD5A 2PF0A 3FW6A 3AUOA 2X2GA 1PKYA 2EQDA 4O19A 1DJZA 1W1PA 3RLUA 3KZPA 3HIJA 1TIMA 2X1RA 5HNTA 1CB2A 3WDIA 4MVAA 4HBKA 3JUGA 1FCUA 1XIMA 4Y9AA 1HKWA 4Q4QA 4S3DA 3UPMA 4GKLA 3QM3A 2Y85A 1IXQA 2PDQA 3KTXA 2XH7A 3IGUA 4XZNX 2ZUVA 3WD3A 3VGFA 4EAMA 3HQPA 4NNBA 4HN4A 4WLCA 4MKVA 4NAEA 2XIQA 3ARXA 5IM51 3DFSA 1G7UA 5A8PA 1EIXA 1TVLA 1H63A 2PUZA 1OFDA 3TTOA 5LIUX 1JZ2A 3ITCA 3N17A 2ISSA 2ZUUA 1B9BA 4GIRA 1VFTA 4XAFA 4UTKA 1OCQA 3A12A 3PANA 1W91A 1XRTA 4DJFA 2V38A 2C71A 1GW1A 2CZFA 3PJWA 3QFEA 3REQB 3GAYA 4POCA 4ZO6A 2YA1A 5FAJA 4M6VA 2X1SA 5ABFB 1GEHA 1J96A 5LIXX 4Q33A 2NXIA 3IVTA 1OG6A 5G5IA 4PC8A 2JGYA 4AIEA 3TTSA 4JX5A 5IDZA 5CSRA 1GVEA 2ZX7A 3O1NA 4O1EA 2QT3A 5JQ9A 1EXBA 2XM1A 2XU2A 1BVZA 4ZO9A 1IT0A 3R2GA 3GLCA 2GJNA 1UZ4A 4JEQA 2IPFA 4JTCA 3F2CA 5DMYA 1BWKA 1YADA 5DCBA 1UOKA 3UZWA 5BOOA 4EANA 3TK7A 4H9XA 4WXYA 4C6NA 3WJXA 1ZAJA 3EOSA 4YTSA 1XBVA 1KM0A 3ABOA 4JIRA 1VKFA 2WZMA 3DFYA 1X1NA 3ES8A 1YX1A 4HMEA 1SW0A 3CUJA 5EKYA 4U3CA 5HMEA 2WSKA 3YPIA 3OLIA 1QNVA 1LTDA 1XGDA 1D7FA 3QV7A 4Z2HA 2PFHA 4GGHA 1WKDA 1XLKA 3D5HA 1Q45A 1PUDA 3RX4A 3TXVA 2J7EA 4AMCA 1E3ZA 2ZUMA 4QJ1A 1EPVA 1KFJA 4C60A 3FIGA 2G97A 3W7JA 2I16A 3M6YA 3PB2A 3CNYA 3L4UA 4OTKA 4DUOA 3WLKX 3FV9A 1R3WA 2DH3A 4QSHA 3PR2A 1V6TA 3RIKA 2TSYA 1MWOA 4XZHA 4P8UA 2V3GA 3WUGA 2PP3A 3GFZA 1F7BA 1OSEA 4FZIA 1SGJA 2JIEA 2R1NA 4E2VA 4FLRA 3EWZA 5HA7A 1KCKA 1ZBVA 3WLJA 1UBPC 3S6DA 1W1ZA 2QGYA 3A13A 3WX7A 3RO6A 1JPDX 2PS2A 1XLFA 3GDLA 1QAPA 3M47A 3NA8A 3UA3A 3TC6A 3AHXA 3BLIA 4X63A 5DMLA 4IUGA 1YDYA 4I9TA 1WPCA 3EPMA 4M5PA 4W89A 5CC7A 1L6GA 2WLYA 1QI4A 1YXCA 3TFCA 3UZZA 1KWKA 3K8KA 3L0GA 5J5RA 4PR4A 1OQFA 4XKYB 4D71A 4DZIA 3WQOA 1G4TA 4ZODA 2CEQA 4AC1X 3GIPA 2PLKA 4F66A 3T78A 2YIHA 4NZ3A 2C18A 4C6IA 2RDUA 4BI6A 1TYGA 2Z2UA 2PRLA 3TVAA 2XWDA 2OZTA 4IFRA 4GIAA 1A5AA 5E9AA 3NQBA 2YL6A 3W1XA 2E68A 1FWSA 5HQLA 2NWRA 3IUIA 3UWUA 2WSYA 3K4DA 4Y6GA 4WHBA 1ISXA 1XSIA 3H7UA 2AMXA 3WMBA 3AXIA 3XINA 4I9AA 2E6YA 2OG9A 1XINA 3THQA 3CB8A 4I7WA 3KOXA 3QR1A 3EB3A 1GTEA 1THFD 4HCLA 5D9OA 3P62A 3BZGA 3MCMA 3WNOA 3KS5A 4CQDA 1KXQA 4XO7A 2GL5A 3C2OA 4AZCB 1DQUA 2FIQA 3BTNA 4DWSB 1UH4A 1L8NA 3QLDA 1OZQA 3OA5A 3N73A 4BEUA 1IEIA 3KVMA 3B97A 3ZSSA 2D69A 2A21A 3TOPA 2HISA 3CV2A 3EKLA 3QGKC 1J12A 4RK8A 1Q66A 4C6EA 1NJJA 2EG7A 4FX7A 2ZVIA 2J75A 3UXDA 2QNEA 2V67A 3A47A 4ZQOA 1T5AA 3WNMA 4WDXA 1OFBA 5CJMA 4PMOA 3CUGA 3THAA 5ENLA 1CGVA 3UXKA 3HPXA 1WUEA 1W17A 2WCSA 1HZYA 4H6KA 1EJUC 2AL1A 1TV2A 4J3SA 4QE1A 1ZAHA 4GQ0A 1E4MM 3GSMA 3QOMA 3S1WA 4C6CA 2JGQA 4LRSA 4B5TA 6TAAA 2WZEA 4ERGA 3VFLA 2GVJA 5HBFA 3FKRA 3NZQA 1U30A 2IQDA 3M9YA 5H8UA 3LEPA 1L2QA 2PEVA 3B0VC 2XN2A 2HE5A 2HMCA 3NPWA 1Q6QA 4W8AA 3F03K 4E2DA 5AZ1A 1QI5A 6REQA 1NQ6A 8A3HA 4M19A 1MQRA 4E8GA 4YPJA 1V03A 4CUCA 3I68A 3M1ZA 4M6PA 4FIQA 4OUEA 3PTKA 3NO1A 3R43A 1FHUA 4H8UA 1YE4A 3WLLA 4HHMA 1W9VA 1B3OA 5F7UA 3B9NA 1CWYA 5EY5A 3KEHA 3H4GA 3TN3A 1PKNA 3HURA 3LZ3A 4Y9OA 4GIYA 2A4AA 1VH7A 4AAJA 1QMLA 1WDDA 2C13A 3W6MA 2VWTA 4REQB 2X42A 1FXPA 2VC9A 2EJAA 1OX4B 4S2BA 2GWNA 1POJA 1DP0A 3OIXA 2VEMA 1XH2A 3BQ5A 1MW2A 1LWIA 3LENA 1TPB1 4N7QA 3BUVA 1RPXA 1L9WA 1Q8JA 4RE3A 2PE4A 5CLTA 2OLAA 4PMXA 4O15A 3HV8A 1FWWA 3ZYZA 2OQLA 2ZYFA 4UR8A 3WZ0E 3LRMA 2FJUB 3JVAA 5HANA 4AY7A 4X9SA 1Q85A 3TU9A 3PTQA 1PS9A 3VCRA 2CERA 2OGYA 2FDMA 2FZ9A 1VYPX 2FMNA 2IS7A 3H70A 3M0LA 4C5ZA 2PF8A 3PN8A 4MB1A 3CUXA 2CLPA 3QLLA 5T9CE 3GH4A 5LGZA 2FFIA 2P1FA 3EDJA 2VC5A 1HVQA 4J2PA 2NV1A 3BOLA 3HTWA 4MJ4A 4MOZA 2YA2A 2VCCA 1DJWA 3LK6A 4YTRA 5AYXA 1S5VA 2CWXA 1C8QA 2PU0A 3OLGA 3UFYA 4GHRA 4C6FA 4AG0A 4IP5A 4DQWA 4Q8QA 3VUSA 1XICA 3GAKA 1XLCA 5D2XA 1I1XA 3G8EA 2KZHA 2DUZA 1CEOA 1WO2A 5CZTA 2XHYA 3TYAA 1JQVA 3PZIA 1ZJBA 3CWHA 1ZENA 3H2CA 5FEXA 4ZSTA 4WDTA 3RM4A 1XSJA 2JIWA 2OVLA 1K8YA 3NR0A 1H7PA 2OPJA 3ZVIA 3TQPA 1QATA 4AZCA 1BRLA 4UTMA 3BVJA 4XAGA 3VE9A 3UWWA 4LEFA 3BAWA 4UMBA 1ZCOA 4JFVA 1EH9A 1AVAA 3JS3A 3H8AA 4LJ3A 1KV5A 5A2AA 5I23A 3AZTA 4LX4A 3AROA 3OGRA 4MLJA 3FY1A 2VJXA 4P7RA 4AZHA 2AOSA 3B03A 2QCNA 4GUHA 1OBAA 2PP0A 1HKIA 3FDGA 3C0JA 4CU7A 2OB3A 1WDRA 3W70A 4Y90A 1WQ5A 3ARRA 1GQJA 3W88A 2HZGA 3W2JA 1EA9C 2EPLX 4DBUA 5DXYA 3CT7A 4HSHA 3G1SA 3LHWA 3T42A 1DJQA 2BX7A 3EEGA 2H3DA 4O1FA 1BAGA 4UTTA 3IIXA 1PX8A 3P5YA 4B91A 3MUY1 5KZMA 3LPOA 2BLEA 4PCFA 4ORMA 4MHBA 2FKPA 4IQLA 3UR7A 4ZEPA 1YXDA 2WWDA 2IUZA 1S5NA 4Y8EA 3WL0A 4JTAA 5D37A 1F8MA 3RU6A 4UTFA 2DZVA 3WJZA 1VEOA 1A3HA 4KIRA 5D4YA 1G67A 4J3TA 1JQXA 3KCLA 3BMWA 1WXZA 3NL6A 2PDXA 4LVAA 5A8QA 5LNSA 1UZHA 1UIOA 3GDRA 1N7KA 4B4FA 1X6UA 2WXDM 3TLQA 4XZ9A 1AZ1A 5G2IA 2FPVA 3MA8A 2XIOA 3E02A 3DGBA 1LL4A 3UGRA 1UWSA 1SMAA 5BU6A 1KM4A 4AD4A 4CN1A 4RKAA 3LNPA 4MM1A 2V5JA 1JGIA 1E0XA 1S5MA 5AC6A 1LQ2A 4J4KA 3DFQA 4DM2A 3RX3A 3AHZA 3G0SA 2B7PA 2EJ1A 4AEEA 2WJDA 4JHOA 1TA3A 1V02E 5CSYA 1F3TA 1HF6A 2DJLA 3VKJA 2E09A 1U5VA 2GQ3A 2RUSA 2V69A 2Y5SA 2VEGA 1NOWA 1KBJA 4W93A 4D6EA 1G7VA 5D33A 3NCOA 1PDZA 2WK2A 4JTRA 1J8VA 1A47A 3B8UA 1TZZA 5JH2A 3W87A 3SAZA 5C7VA 1D8WA 3CYJA 3U5UA 5D9PA 3ZWSA 3T0TA 3SCQA 2XVLA 2J7HA 3BK0A 1IHIA 3SM0A 3N1AA 4FHAA 2BWGA 5AOUA 2DUXA 3NQGA 2FDSA 4ZBCA 4M6QA 4PTNA 5BRBA 1MI3A 3EX4A 3QVQA 2DT2A 2QJJA 2PODA 3KX6A 2CZVA 1TPUA 1LRTA 2D2JA 4DELA 3G1RA 5FL1A 3SCNA 2WBGA 1SZRA 1JNDA 1RSCA 4UFKA 4GNVA 2C79A 3TTQA 3QHOA 5AHIA 1JDFA 1GVQA 4EWND 1UJPA 1VRXA 3UW6A 3AQUA 1V3HA 1AH0A 1D3GA 1RA5A 4B15A 4Z2JA 4ZB5A 3IPWA 2HWGA 3HPFA 3KXQA 2IPWA 3DYPA 4MDOA 2HQAA 2E9LA 3E0LA 2BP1A 4O1BA 4RW5A 3TOYA 3NL2A 3LI0A 4ATWA 2PA6A 1J11A 2OCZA 1WKEA 1V3JA 3A22A 4DYJA 4JNMA 3KL3A 2IPJA 1TMHA 3TIMA 2NXGA 3VVGA 4JEJA 1F3XA 4G1KA 2FPTA 1CLXA 1AL7A 4EXBA 1IWAA 1TPWA 2WANA 1OIFA 1XS2A 2WMJA 5I24A 1A0EA 1VCVA 4TV5A 4AMAA 4US5A 5LZLA 1XKJA 1OHLA 3C8NA 5I3KA 4FOUA 3PB0A 5E93A 1LJYA 1WDSA 2C1GA 3ZVHA 4GZEA 1ISZA 5XIMA 2QUMA 1FHVA 3BLDA 4NQ1A 1J2BA 2FZBA 4L1XA 3O6AA 4GGBA 3LN3A 1W37A 4CLMA 4PYSA 3CXOA 3PAOA 2WNWA 4QHRA 4H9TA 1OFEA 4G7EA 5HMSA 1E5NA 3BV4A 3MS8A 3UCCA 5JXQA 1ONWA 1IYXA 1UC5A 2GQ9A 3W1NA 2J7BA 1LBFA 1N8WA 1XDJA 3U2OA 4DWSD 1UD6A 4LTSA 2WKLA 5SWUA 2W92A 2PTXA 4AVNA 4GYPA 1WDQA 3G24A 1FOBA 3SQLA 1PVNA 5BWAA 4XKYA 4F3HA 1B4KA 3W2LA 1CIUA 4ZQCA 2GSHA 5E5CA 2BY0A 4G6CA 2PGFA 4GFSA 3RU8X 4QLJA 5D09A 3V5CA 3HBLA 4B92A 1NU5A 1AW2A 1AG1O 2ZZ4A 3CZGA 1Z3NA 4AQLA 4JQAA 4N42A 3MJYA 1PEZA 3NZGA 2VDGA 1PDYA 2XYLA 2A3BA 1NM9A 2WMKA 3OBKA 3ANYA 3H21A 2YZ5A 3TDFA 1CXIA 3ARYA 5ABGA 2Z6JA 3FA3A 4HHLA 3L0NA 3I3BA 1GW9A 2BOEX 1KM1A 4UNKA 4GXPA 4IJCA 2D2GA 3RUBL 1XYFA 4KWOA 2QCDB 4ML9A 3GNPA 5DBTA 2UY3A 3I6TA 1JCNA 2Z7GA 1VBHA 2FB2A 2ZTJA 1OD0A 2CZ5A 3OG3A 4LBUA 3EX3A 4YVPA 4DM1A 3GE7A 3H24A 1S2AA 4EKJA 3T05A 4YCPA 4Z2KA 3EDKA 2J4GA 5IFPA 1VS1A 5LXEA 1J6OA 3O2LA 3AS3A 2ZX6A 5I3JA 3NUKA 2EF9A 4D6IA 3TAOA 1YDOA 2YCKX 3P93A 2DIEA 3RLHA 1ZCCA 3ZR5A 1KLZA 7XIMA 4BEQA 4L9YA 4C6MA 4D1IA 4OBTA 1TV4A 1R3RA 4TIMA 4XAPA 2Q09A 4D8AA 4XWUA 4G9PA 5A6JA 4V15A 2HK1A 3NVTA 2FVKA 2FH8A 3GNNA 5REQB 3CLMA 2Z26A 1C8VA 3B8SA 3POCA 3WNKA 4NT0A 3P0WA 4FX6M 1P6WA 4E3TA 4ECLA 4QIUA 3GIQA 4IISA 3OA3A 1ZZMA 3F4CA 4NZ5A 2QR6A 3V0SA 3SGUA 1XLBA 2FPYA 3RITA 3WLPA 2JKEA 3HQNA 3WQGA 3TMLA 3LRKA 4WF7A 3LGEA 1NF7A 3N9SA 4GVFA 3KRUA 3GR4A 3VUPA 4IHCA 1MQPA 2W66A 3WBYA 3CLWA 4NZJA 4J35A 2NQLA 3WLTA 4KW2A 4PRTA 1MUCA 1VIWA 2XVPA 1EHAA 1E0UA 1IR1A 3VMNA 2GFTA 2QMKA 3QH2A 4RZ6A 1S46A 5KMYA 1LG2A 4IMCA 3LRLA 3PHAA 7CGTA 1YPIA 2FZDA 1FFRA 4P61A 1E51A 1GHSA 2DVTA 1CLVA 4NSBA 3R6IA 3WDQA 3VC5A 1C91A 2FJKA 2CLFA 5L9FA 1QFEA 3LERA 5T26A 4ICMA 4LVGA 2J7GA 2XIBA 4XSMA 3WCZA 3ZJ7A 2VRQA 2ICSA 4XBSA 2PTDA 3M43A 1FP8A 1KBLA 2B7QA 4DHGA 2G4FA 4B90A 1KA9F 4A3QA 3IIPA 1XDLA 2BB0A 3UWQA 4C7DA 2WJZA 4TX9A 2F7FA 2VCBA 5IFTA 8XIMA 9XIMA 1Q3NA 1MDLA 3VCCA 1CGYA 3I6RA 5AHEA 1OY0A 3UNDA 1PIIA 2BS9A 3HMJG 2J8FA 1XWYA 4PUUA 2VKZG 1WAWA 3KZSA 4FI4A 2Z24A 4WSHA 4EPDC 3A9BA 3S6TA 4I6KA 1Y7VA 1EFZA 3E5PA 1R86A 1WXYA 1BWVA 4YXGA 1HVXA 3PTDA 2BSLA 3R11A 2Q3RA 4BCEA 1DBTA 3M4HA 4L9ZA 3W4RA 1HXJA 1ZFJA 4LUYA 1BQGA 3VZYA 4OV9A 3AO0A 1W1YA 3CIVA 1PIGA 3VOJA 2DT3A 4TUFA 1HJVA 2INZA 3H6OA 5I78A 1OX5A 2CITA 3GKAA 3PUDA 5A8MA 3FX4A 1XLGA 1F3EA 2CFFA 3BG3A 3BOXA 2BHZA 3R12A 2WVUA 3NAVA 2VGBA 4TOQA 3N15A 4H1ZA 3CEPA 1FWIC 1O5XA 1IQ8A 1SU5A 4Y7EA 1GYLA 3H53A 3A24A 1V5XA 3LCHA 4F8XA 4F40A 2G37A 4R5EA 4FIRA 1Q6LA 5CPQA 4P5UA 5BXSA 4X22A 5K9CA 3PUEA 3MUIA 2CYGA 4DAIA 5DELA 2OEMA 4QG6A 4K68A 2E6FA 1MSSA 2ACUA 3EOEA 4PBGA 1DXEA 4MZ8A 1V79A 4PCTA 1TPEA 1GJPA 3TW9A 1GCYA 2C15A 3C6CA 1OINA 3G77A 3ZMRA 1PX3A 1BXCA 3WF0A 1TFVA 2IW0A 2YLAA 1O5KA 3QFWA 4JBRA 3SCPA 2QV5A 4XK2A 4AU0A 5DN1A 2V68A 1SSDA 1X97A 5E09A 2I5GA 1XYZA 1E1CA 1FBAA 4Q7BA 4W9TA 4TV6A 2Y6ZA 1GJUA 1SYTA 5I3FA 4M1RA 1V02A 4W85A 1VPXA 4QJ3B 2HSAA 4S39A 1D3HA 1MYRA 5DBUA 1UIPA 4LV9A 1RP9A 3VD3A 6ENLA 1FX6A 1SFJA 3LYEA 1ZS2A 4CD4A 3P0XA 3WFZA 3B4UA 5A6LA 2Y4SA 2WNQA 2OOGA 1JCYA 2AL2A 2NT1A 3STPA 1AQMA 4OKDA 3USZA 3WKZA 2WQPA 4ILSA 1FWFC 1MEIA 1A50A 4PUKA 1NP0A 1RV8A 3CL6A 4Q4RA 1XLAA 1A49A 3CB3A 3MU7A 1NELA 1ZALA 4AD5A 4B5XA 3APTA 3C86A 4PCSA 3CHEA 2EO7A 3H7VA 3M5YA 1MFVA 4MJMA 1R8LA 2G3MA 1OGGA 3GDTA 2ANUA 4KEUA 4V1YA 4DXXA 4S3CA 1HGYA 1TSIA 1EJ7L 4FXJA 4MMWA 3LMZA 1Q4WA 1HIZA 1QPQA 3LPGA 5HNNA 4Z1DA 4KWUA 1XLEA 4GI6A 1R3VA 3CQ0A 4JPGA 1KB3A 1M7JA 4LS1A 4FB7A 4AD0A 2R8WA 3I7QA 5ECVA 1O68A 4KEMA 5A6AA 4NYUA 2X05A 4ZSUA 3W9ZA 4JICA 3PS7A 3EWXA 1FCBA 4PFMA 2YXGA 1DORA 2HS8A 4WDWA 2PTYA 2D3LA 1QNSA 3SUUA 1TZ9A 4MG4A 3GTNA 3PBVA 3IUHA 2H9AA 4HNOA 2G50A 4HA3A 2IXUA 3CZEA 3G1YA 5K9DA 1W3TA 2WMFA 3W71A 3CC1A 1GPFA 3W84A 4KBXA 1FWTA 2I7GA 1Q6DA 3GC2A 2SFPA 3PVFA 3W6YA 1YDVA 3GKFA 3VOGA 2WWCA 4GJ1A 3P5ZA 4EWJA 3GDBA 1X6NA 2Z1XA 5DO8A 1WP6A 2B81A 4LS2A 1AMKA 3G1DA 4K1GA 2EG8A 3Q4DA 1QU4A 3NM1A 4Q8PA 1OYBA 4AD1A 3RPTA 2A3CA 4PE8A 3AOFA 4HMCA 3AMCA 2YYUA 3NSNA 3OQ8A 3ANUA 3IGXA 5CKSA 1CLKA 2A5HA 3I4EA 3R25A 3CH9A 5AFDA 3N18A 4WOZA 3S5YA 4EIVA 4LU0A 4AWEA 3FS2A 5CSUA 3NFUA 3TV8A 4UQEA 3GTFA 4WXZA 1CYGA 2OWXA 3ARPA 4LBSA 2QCEA 5A6KA 3XIMA 1GVRA 3QY6A 2WPGA 3BLFA 3RN6A 4IGNA 5FAGA 5CLWA 5C6MA 3PBYA 2A79A 3TZFA 3B9OA 4DXKA 4GUIA 3SEPA 3IV8A 5IOBA 3DN5A 1W1IE 4U2ZA 5A3HA 3R13A 2E5DA 3W7DA 2I56A 4E8DA 1OFPA 3JR2A 5LXXA 3RCNA 3WMCA 4Q8MA 3TYZA 3LHTA 3HPSA 4EACA 2GWGA 3G1XA 3QPEA 3CO4A 3PSVA 3WFLA 4QXIA 1SR0A 1EPXA 2PWVA 3EA2A 3N2CA 3GXIA 4YNGA 3ATYA 3GFXA 4ZXLA 1KBKA 3EPNA 4JDBA 4YS1A 4L65A 3C56A 3GS6A 2ZRXA 3VM7A 1VAHA 2ACQA 4PB5A 1OGSA 3QW3A 4TVDA 1YPXA 3V4BA 3KLLA 4OE7A 1M03A 4QEEA 1E6NA 3R79A 3PZGA 1VP5A 3TROA 3Q58A 3C4UA 2PWGA 3M6DA 3SQMA 2DZPA 3DC8A 1FTXA 1C93A 5TAOA 2NV9A 2O55A 5KZ6A 3LCXA 4KRZA 4D72A 4AZIA 2NW0A 3RPDA 2XGIA 1VLWA 2WM1A 1W2VA 5LHFA 4F2BA 1Z7AA 4FF7A 2XGBA 4XIMA 1L6FA 4YLWA 4N4QA 3UJEA 1KO0A 2RAGA 5G2HA 3IAQA 3LM7A 4LNYA 2VX4A 3AI0A 3THDA 3WD4A 4GIEA 1PO9A 3UGVA 2BFGA 4O1CA 3U9IA 3ZQ9A 3KTSA 1LLWA 2HJPA 4NKCA 1E15A 2O0TA 1XFBA 4C6JA 1OK6A 3TEVA 1RJRA 2ZWYA 3NDZA 3ZWTA 3VKCA 4IMAA 4LC8A 4PL1A 3DUGA 4GH1A 3TYCA 3UR8A 2OU4A 2ZICA 1K8XA 3QMRA 1PYMA 4QS6A 1ONRA 3ME3A 3IJIA 2P50A 2MANA 2O7SA 5I07A 2MUCA 4WDUA 4H7ZA 4BQ3A 3HV9A 3NQVA 3LCIA 1P0EA 1PE1A 2CBIA 2W67A 4XB3A 1OABA 3C8FA 1HKVA 2PDLA 4EF9A 1RA0A 3SCWA 1S3HA 2F6XA 1UP3A 1WUFA 1RZMA 1SJCA 2YDSA 5K4XA 1ME7A 3AXKA 4I5RA 5T8GA 4IJBA 1Q7QA 4HB7A 4PUMA 4PSRA 3GVQA 1NP2A 5D9MA 2JKAA 1NWRA 1CECA 4IF2A 4O14A 3UNTA 1VPYA 1XH0A 3T4WA 1YDNA 1UWRA 3S46A 2DQWA 3U4AA 3M07A 1DL3A 3NNTA 3QXBA 4MF4A 1GVFA 1K8ZA 3WH7A 4HIBA 3RLVA 4ZQMA 1F73A 3N2OA 5J5DA 1R46A 3QHMA 4RDVA 5HATA 2PURA 3BLKA 3LD5A 1ML1A 3EGJA 4BQ2A 4C7FA 4J3XA 1W5NA 3TC3A 2YFNA 4N6EA 2UZ9A 4NAEB 1U22A 1R87A 4P7QA 4DEFA 3K46A 1OYCA 3VM5A 3CS2A 1XPYA 2HRWA 3PNZA 1EO7A 1BTMA 2CKSA 5I06A 1U1JA 3EB2A 2PCQA 4GX9A 2X40A 3TX9A 3MMUA 4LOCA 5CGMA 1UD5A 1UP0A 4JFSA 4AISA 1I75A 3WBWA 4XUGA 1R38A 4DAFA 5AHMA 1MMFA 4IMDA 2ZUTA 1YXYA 4L4MA 5MF5A 1GKRA 1UB3A 4HZMA 4MB4A 4LUTB 4KERA 3WH5A 2WYSA 3WJWA 3G1AA 4DO5A 4LPCA 2C91A 4LFYA 2GVYA 1HJUA 4HKPA 3P84A 4DBSA 1J0YA 3N3TA 1ZBCA 3HQ1A 2ISFA 4K7YA 3IANA 4YTUA 4IPPA 4LSBA 4ONVA 3MZ2A 3U0HA 5ECUA 1EC7A 1PPIA 2XZ9A 3GTXA 2XFFA 3QV8A 1EJWC 2JALA 4AY8A 1OWQA 2ZXQA 4UNIA 4P8VA 1R6WA 3WIJA 1XJBA 3H2OA 4KPLA 4URIA 5AVHA 1EDGA 1UYQA 4M56A 2AQVA 2YL9A 3T0AA 3LNMA 2UV8G 2VX7A 3GRIA 3L66A 1O5QA 3W26A 1MRAA 1XGZA 4DO6A 2OT1A 5JH1A 3QY7A 2W79A 3O05A 1XCWA 1TE6A 4QTGA 2XH4A 1U5JA 3UXAA 1ISVA 5DCEA 4LWWA 3ZJ8A 1UD8A 1KC7A 4IQEA 4L6HA 1BYAA 1QWKA 1NIUA 2DZSA 3ZSTA 2VEPA 2J8TA 3T08A 1T0OA 1MEWA 5HMDA 2QCFA 3TJLA 4QQUA 1VEPA 4AY1A 4QG9A 4IIDA 4GBDA 4PN2A 3KVLA 2Q3OA 4HOZA 4DJFD 2BY2A 1UMLA 1PWLA 1N8FA 4CVWA 3SR7A 1UA3A 4HNLA 4PCNA 4C91A 3R1ZA 2GVGA 1FKWA 3H12A 2BVYA 3N6JA 2E9BA 1BXNA 4RZBA 4GC3A 1NFBA 3DC0A 4YVVA 4QISA 3KBVA 3I7SA 1TPVA 2RGMA 3TA9A 5CG0A 1O1ZA 1OT2A 3CU2A 1C7SA 1IEXA 4ZL1A 1K6AA 2DSKA 3WQ8A 3W7OA 1TB3A 3EX2A 4BF5A 3JW7A 5D2WA 3DAQA 1NEYA 4B3ZA 2WLZA 2ONEA 4X60A 3W82A 4C1KA 3D46A 2J6VA 3ZLFA 2Z1KA 3LMYA 2G3IA 1FH7A 3KBSA 3W1MA 2ACRA 3QQWA 1ZHAA 3GC5A 2W27A 3GBEA 5CPTA 3B3DA 1JG9A 1DHKA 2PWUA 5E0CA 1OCBA 2Z1SA 1OC6A 5JIPA 4H00A 3H55A 2A7PA 4KKXA 5F1VA 5BWFA 5LA1A 3M41A 3KRZA 2FB3A 1XRSA 1BKSA 1KM5A 2VDIA 3BV7A 1M9HA 2FTWA 1Z8AA 1RY0A 3KL0A 3S9ZA 2DIJA 2WSQA 3QQ1A 3KHDA 4W88A 5DCDA 2YR1A 2WM0A 1Z44A 2W4XA 4GI8A 5AC8A 2A1YA 3QEZA 2ZTKA 2BASA 3CK5A 2CLLA 1ZUAX 3ABQA 2F2KA 3G3DA 1B0IA 4IOTA 2NVAA 4L80A 1G4EA 3SB0A 4EXQA 1DYSA 4M8UA 5G1YA 2ZA2A 3CM4A 1CXFA 3HGOA 3FSUA 3PZUA 1JGMA 1IR2A 3FHAA 2VM8A 1DXIA 1R3YA 1XQKA 2PDMA 4ZB0A 1SM9A 4UOJA 2QCLA 3ISIX 3T0CA 3UWVA 4G2DA 2WVVA 2WNZA 1OCJA 3WYZA 4Y9MA 2XH0A 2IKHA 5LSMA 3SCRA 3C0SA 2BY1A 2QVNA 3QMSA 2NT0A 3B0PA 3Q67A 5ABEA 1MNZA 1MZHA 4ADTA 1UWUA 1H62A 2A3EA 2E8YA 3M0IA 4ZE4A 1BEUA 2DSUA 1YW1A 2NSXA 3ARZA 2G3JA 2WHLA 2R9RA 3NQ6A 3L5AA 1ZY9A 2ZDRA 3ECQA 4CNUA 4ES4A 3F5LA 2BGSA 1WZMA 4LV4A 4NU7A 3KOZA 4M51A 3DEQA 4Y2WA 2Z29A 3SCUA 5B7ZA 4G7FA 5HJYA 2QDHA 4PEEA 4OOUA 4R53A 3QW4B 3SN0A 4XZBA 2VEIA 3T0BA 2CZEA 3QJAA 3KTCA 2W91A 4MTVA 1Q6EA 5I7GA 4V33A 3MKCA 3AIUA 4AD3A 1U33A 4IFKB 4AVOA 1XIIA 2NSOA 1BSLA 3B9AA 3PPFA 1NTHA 1NDYA 3FYPA 2OMAA 1W1VA 3A5VA 5DQPA 3B04A 4JTSA 1RLDA 3WF1A 4DLFA 4GH3A 4DJDC 2X41A 1KR1A 3UWYA 3OTRA 2V5CA 3M0XA 2NUWA 1N82A 3PY2A 3URAA 4YCOA 4XUYA 1JJKA 1R2RA 1FCVA 1H5YA 3RO8A 1IEVA 4GOAA 4A6GA 3B05A 4S3GA 1JFXA 1FWRA 3RHGA 4A8LA 3AS2A 4KESA 2VGGA 4C6DA 1D8CA 1J93A 4JYFA 2Y7FA 2ON3A 4R85A 4IP7A 3CT2A 4K3ZA 4GG9A 2JBMA 3LBCA 4HA0A 1RJQA 1Q65A 4NAFB 3N25A 1WX0A 1YMYA 5DMMA 1VLIA 4YTQA 4JTUA 1JYVA 3E6EA 2EPMX 5F2IA 5HINA 4PULA 3HFYA 4XTIA 4XD5A 1POKA 1GVOA 4CQBA 1R3TA 4IT1A 3GNOA 4QQ3A 3FN9A 4H9VA 1GK8A 3OLDA 3ITXA 3O6DA 1KXHA 2DW6A 4B3LA 1UP2A 2WBKA 5F1UA 1R2TA 1JXKA 5J8LA 4DIAA 3ITTA 4D8LA 4M29A 3DENA 1TPH1 2VGIA 4K8HA 1D3CA 3TFXA 4J5NA 3VI2A 3CWOX 2WCGA 1NWSA 4A4AA 4JQ4A 4IGMA 1I2RA 1JL8A 3G3MA 5HOSA 3WLNA 2J6XA 2ZZ2A 2ZIDA 2CBUA 4GMEA 3OZOA 5CQ1A 1PTGA 3ES7A 1R85A 4DZHA 4KQNA 4UR9A 3WQPA 4P7LA 1Q13A 1G01A 5I0DA 1RH9A 1P48A 1JZ6A 4JCLA 2J9XA 1ECQA 2XFRA 4OECA 1GYNA 4D8ZA 2C1HA 2JFEX 3NPUA 2QYGA 1J2WA 5LNRA 2J13A 1DIDA 5BYWA 2VR2A 3LU2A 2PDPA 1GOOA 3IGSA 3KRBA 3WELA 1O1HA 3T44A 1JI1A 3P8IA 2GVLA 3M0HA 1QCWA 4JTTA 3GG7A 5AY7A 5DFAA 3PP7A 1JCXA 4OVXA 1Y65A 4JL1A 3PFMA 4F4RA 1VJZA 4HK6A 4LBRA 5LYRA 1I2NA 3O07A 2F38A 3RCMA 4QDPA 1GHRA 1QNPA 4MWAD 2XISA 4D1JA 4Q8VA 3U3HA 3GDMA 3RRXA 4LVDA 1G4SA 1MFUA 2CW6A 4PMZA 1XUUA 1W5MA 1F61A 3R0DA 5BOEA 4AW7A 3U2EA 3R58A 4REQA 1H61A 4A21A 2YCJA 3HGRA 5EA9A 3BAKA 3GXTA 4V1XA 4ENLA 4OIFA 2CETA 1F6PA 1M7XA 1ZTVA 2DZBA 1S1PA 1HKJA 4ZZ9A 3TTEA 4GKTA 4TMBA 2EPKX 1UKSA 4UR7A 4JNZA 1I0DA 1DHPA 3QYQA 4N4PA 4JR5A 1AH3A 4NJHA 1BSIA 5HMFA 1E72M 2X7VA 2VYOA 3TYDA 4GVGA 1J18A 1V6XA 4NJGA 4W8BA 1H09A 3DCPA 3M5ZA 4JX4A 2I1OA 3LG3A 1KCXA 2LLEA 4IPIA 1FUYA 3GU9A 4JIPA 1W9XA 5EFDA 3EDFA 3NYZA 3ABSA 4WUIA 5CZSA 1Z9AA 3ELFA 4C5YA 4BKNA 4H6QA 5HNUA 1V7YA 1GTHA 2JK2A 3H2AA 3UBPC 2I14A 1IE7C 3PUOA 4J28A 4KRTA 1QTWA 4C65A 4DUWA 3MI3A 1DKWA 1GOIA 1EA0A 3HG3A 4I9MA 1LF1A 1VB9A 2RH9A 2EPOA 3C2FA 3BH4A 3AYVA 3TP4A 3UG3A 4JN6A 3W1TA 1JNEA 5G1TA 1CBGA 4Z0SA 4AIOA 5AHNA 1P4CA 1NQKA 2PPGA 4KMQA 1ITXA 2AL2B 5DT7A 3N4EA 1DIEA 2POTA 1TPFA 4CQCA 1MUWA 2OQHA 1REQA 3PWAA 2TMDA 4JS3A 3WLHA 2HNEA 3VO0A 3CAVA 3F1QA 3UCQA 2X1TA 2BODX 5EMMA 1J0ZA 5FCZA 3N12A 3O63A 4HOWA 3F4WA 4KETA 2O92A 4GRSA 4GE8A 3QY8A 3MJMA 1G0CA 2AQWA 5I6SA 4D6CA 2NX1A 1SVDA 1KQZA 4JHZA 5DRCA 3Q45A 3BICA 1H7OA 3THUA 4DJDA 3T81A 4C7GA 4LAOA 1VD6A 4JNYA 4IX2A 4ZO8A 4DY1A 4GQRA 4QDMA 1PIFA 3MP5A 4OOZA 1TR1A 3MI6A 8TIMA 3HF3A 3W7NA 3AIBA 3W75A 3B8TA 1FA2A 4C90A 4TX6A 2J27A 3Q2DA 2HPIA 3CPGA 2E6DA 1ZU8A 4QP0A 4MY1A 1JUKA 2BDQA 2WB5A 3ZR4A 3TMQA 3WH9A 3H4WA 2CLEA 4JZ5A 3NZPA 1HJWA 2GDUA 1O6IA 1M5WA 3FNDA 3S2JA 2VXNA 3IJ7A 4Z08A 4PMQA 4FNRA 4BS0A 5DF0A 5DANA 4LCQA 2YJQA 4Z1CA 2L5HA 3QRHA 3NQMA 2AGKA 3E5BA 1KTNA 4Q8NA 3LUTA 1AQFA 4X2RA 1XDMA 1UR0A 2QS8A 4EPKA 2VUNA 4PMVA 3L65A 4HPHA 2WC4A 4EX4A 3BDKA 4V2XA 2REQB 1EBGA 4DF1A 1DIOA 3IARA 1BKHA 5A8NA 4AX7A 1G5AA 3GHTA 3TR2A 1K1DA 3RK8A 4K1WA 1KQYA 1TPC1 3VC6A 1RPKA 1R3QA 1IT7A 4K7VA 2CXEA 4GVIA 4ZFCA 3T55A 2PC8A 5BNKA 3QYSA 1P43A 2KAUC 1Y5WA 3PJXA 1EB3A 4KEZA 4BQ4A 1V3LA 3M5XA 2GZXA 3MKVA 3VA8A 2OLHA 4IXXA 3UR2A 1F76A 1XUZA 3PSWA 1IXNA 3HO8A 1SO3A 4GABA 4CU6A 1JRCA 3KP0A 3DHUA 2DV0A 1LZOA 3CUIA 4ZTXA 2XDFA 2ZA3A 4LEQA 3GYEA 4B5UA 1A53A 1A5UA 3V0UA 2INEA 3QPZA 2XJ7A 3WUBA 4UIOA 1V77A 1PTDA 3N19B 2ZX9A 3F2DA 3OZMA 3GG1A 2EPNA 4P7OA 1LM1A 3FJNA 5HPOA 4BWLC 3CPRA 3CZKA 5XINA 4XBJA 1O94A 3GBDA 4LS0A 3HZ3A 3WLSA 4PTMA 1TJ2A 3MV11 3L2MA 2YYTA 3SGZA 3CJPA 2HE8A 4KFOA 2J9YA 2J7FA 3UCDA 4JQ2A 2EBNA 4KF1A 2P10A 2FGZA 2E5CA 4A2RA 4DRSA 2V3FA 4F79A 1HFBA 4IUOA 1PZ2A 2H8ZA 4HMNA 3DG7A 1DIKA 3VIGA 3NQCA 1JPKA 2HCVA 4KGLA 1VFMA 4JHMA 4R88A 2E77A 3MPGA 4ZXOA 1C29A 4J3ZA 4FMVA 3G1VA 4WIWA 2QJGA 4J40A 3EOLA 3G1HA 4O8AA 1Z41A 1GVIA 2YW3A 1FDZA 1FKXA 1J6PA 3EXRA 1K03A 2X0YA 4LUIA 1KD0A 1K02A 1EO5A 1PCKA 5FF0A 2INFA 3E38A 1F05A 3SRDA 1DJIA 2G5WA 3AC0A 2EGZA 1RK5A 2E9MA 3ABZA 1EJVC 3F4DA 3M0JA 3TJIA 3AISA 1EOKA 2H8XA 4LF2A 4B5NA 2VMFA 3U48A 2IKIA 4Q8UA 1RBOB 3GM8A 2GDVA 2Y7GA 1MNSA 3W74A 3MI2A 2V82A 2YBTA 5CH9A 3VDAA 2JKPA 4ZOBA 2QJNA 2YCLB 2Z7KA 3O0FA 1CB7B 4ZO7A 5DY2A 3LXCA 3I7RA 3FSTA 1E6XM 3L0KA 3WEMA 3OO2A 4IPJA 4UTIA 3VTRA 3AICA 4EXAA 1XCFA 4N6FA 5C9ZA 3ANVA 4W4QA 1FWGC 2Y7EA 5J04A 3OJGA 3R0KA 5BRQA 5L6UA 1GOKA 4PBEA 4DN1A 5IBXA 2JF6A 1QVBA 2R1MA 4HD5A 3W73A 1EYEA 3DERA 1BPLB 1XLDA 1O12A 1V93A 1OFAA 3W24A 2Q8LA 4O10A 3B8WA 3HMCA 3WD1A 4C6LA 3TSDA 3AMKA 4PMRA 3WK0A 1R9YA 1T40A 4H3DA 5GNXA 4CCCA 5A6BD 3UT0A 2QPSA 1LDCA 2PSNA 4UOQA 1ADOA 3BJFA 1TJ1A 3IGHX 2XN1A 2JF7A 3LZ5A 4M81A 3IIVA 4TQTA 2QHAA 2R14A 4DNHA 4MJ2A 4ZE5A 4YTTA 1Q7MA 2XVNA 5DLCA 2GPTA 1D7KA 3DX5A 2I17A 5MKGB 1XBYA 1DJGA 4H41A 3DXIA 1EC8A 1E56A 2C0AA 2VRKA 4PMYA 3AIQA 5HK4A 4TU1A 2PTZA 1H7XA 2JQXA 1PKMA 5FJPA 5EB8A 4JIEA 3D3AA 3M5VA 2VC6A 4KGJA 1H5VA 3S6OA 2XG9A 3EEZA 7ODCA 1VFUA 4RZ5A 3KCOA 4AYSA 2F9RA 3PFRA 4J3VA 4UFMA 3U57A 1E1CB 3EZ4A 4KCWA 4RW3A 5GJMA 3V18A 1X96A 3TYEA 1DJHA 3W2MA 2V30A 3VDHA 1DWGM 2P76A 3WF3A 2VDHA 3SRHA 1HX0A 3B4YA 3M0YA 2R24A 2EG6A 3KE0A 3KRSA 3VXGA 4GQGA 4AZGA 1J0HA 2QIIA 4JYDA 3WF4A 4MNKA 7TIMA 3V1PA 1XISA 3B40A 1I2PA 1B9ZA 2PRHA 2ZZ7A 1J9YA 1EDQA 5M1TA 3DHPA 2YFOA 4U4MA 1TELA 5FI8A 3AUJA 1XPGA 4HZ6A 3AHYA 1XSKA 3AMLA 2X30A 1SZNA 3IJQA 1F07A 3BC9A 3WLMA 3CAWA 5AYZA 3URBA 2BOGX 3I3EA 3G6MA 3S9YA 3QGVA 1JRBA 3UZ5A 1U2YA 2GGIA 4HSNA 5C7HA 2V8ZA 1LORA 2Y7DA 2NUYA 2OLSA 4ML4A 3WD2A 3SECA 1BQCA 2ODOA 1K8CA 3L4TA 3E0IA 1KXTA 3W02A 4GUGA 3EWYA 2A7RA 2ZDSA 5AYYA 3PZOA 1QBAA 3STFA 1JZ7A 4Z1BA 4E8CA 2OQYA 2TAAA 3PG8A 2D0FA 1FDJA 3NWRA 2DEPA 3OP2A 4GJJA 3W76A 1YNQA 4MWAB 5C55A 4W86A 5HWJA 3NZ1A 3FA4A 4XAZA 3P6LA 2OO6A 2QEZA 3BW4A 3OLEA 1YE6A 1KGUA 1LBMA 1GUVA 4RE4A 3K1GA 1QNQA 2CLOA 5K7JA 4WCJA 4W7WA 4ROPA 1JZ3A 1M7PA 4K2SA 4EP8C 2OFJA 3AHVA 1LT8A 2IQ0A 2H9AB 2FMOA 5KTLA 3AAMA 1IWBA 3P60A 5AKQA 3GXPA 3P74A 4PTDA 2ZXBA 4HOXA 1JZ4A 3USBA 1EEPA 1JUEA 4ERIA 1TG7A 2H3BA 3V0TA 1YBQA 2QDDA 4O53A 2FZNA 2J77A 4FXRA 5FF3A 2QCGA 3CMFA 3LTSA 1E6SM 1MW1A 2DU2A 2F84A 2DZUA 4HA1A 5A69A 4WRHA 1JYNA 1XYMA 5HQMA 2PDFA 1SO4A 3SY1A 3ZXWA 1KKOA 3GC4A 2ACSA 5E9XA 3GW0A 2WZIA 2HBVA 2P8BA 3ARSA 4H8HA 1F4HA 4UFIA 3TSBA 3UZYA 3ONCA 2YL8A 3UETA 2PDCA 3SGGA 2YCIX 4Z2LA 4A8NA 2ZUSA 3CL8A 3MWAA 1EKOA 1ITCA 3MCOA 2PCEA 4QS5A 1F2JA 2GJLA 4RDWA 3BMVA 4N9BA 1GOMA 1FWJC 3BJTA 3UZJA 3KBJA 3EWWA 1PHQA 1CTNA 3L4VA 5T91A 1GOWA 3TQVA 1VFSA 4US5D 1TVPA 3KDNA 3NYDA 3U6WA 1J79A 2CZDA 3JZEA 2HROA 3NO5A 4K38A 1RD6A 2NV2A 1PV8A 3W85A 2DVXA 3LXAA 1UCWA 1TQJA 2OWWA 1EX5A 3QC0A 3VFCA 1XR2A 3VGGA 4US6A 1E3XA 3PG9A 4EPEC 1ADSA 1JCMP 1UJQA 3KOFA 2Z1BA 1UKOA 1XX1A 4XD3A 5C8BB 1KM2A 1AJ2A 3NXFA 1J5TA 1LROA 4XD4A 4IL0A 1AODA 1EZ2A 1C7TA 3VNLA 3NL5A 2F8QA 2YKKA 3WK2A 4JIHA 3LQGA 4ASTA 4DJFC 3WK1A 2O9OA 3AS0A 4ADUA 5DT5A 1UD3A 6XIAA 4E4PA 4KIEA 2E25A 4MYAA 4LAUA 3A9IA 4EE9A 4I90A 4XIAA 5C70A 3GNRA 3FYYA 5PTDA 2PMQA 4RR4A 4EK7A 4QROA 2RDXA 4TO8A 3F2BA 4LGXA 2X1IA 4H2HA 4KFPA 1S2UA 3V5FA 1VBRA 1V0MA 3FGCB 4IMEA 5E70A 3W1RA 3L12A 1LT7A 5M17A 4FLOA 2VT0A 2OJPA 3AIVA 3V16A 4JTKA 1ESWA 2DP3A 4NXSA 1QBBA 2BV9A 3T1GA 4HGXA 4Q8OA 4S38A 3VILA 1LWHA 1X7IA 1H7NA 4GO9A 1UHVA 3GX9A 1GOXA 1LBLA 4S3JA 1FCQA 1MUMA 2VD9A 3IJLA 3VOCA 1HG3A 3AIWA 3IVUA 3PZNA 1Q6CA 1G4PA 4B5SA 2BVDA 1NH6A 4W8LA 4F0RA 1PJ9A 4S3EA 1NF0A 3BE7A 2EKCA 1TV8A 4O28A 1JD7A 4NY2A 4JN8A 3R10A 3MSYA 3LGDA 2ZRUA 1HGWA 2C1IA 3C2VA 4NI8A 1R7OA 3N4AA 4FNSA 2PZNA 3K4AA 4ZQPA 5EMYA 4I8DA 3WQDA 2WPBA 3T07A 3UXIA 5HNRA 3OODA 4HNNA 4NJIA 3UU0A 8CGTA 1DPMA 3C0QA 1R3SA 4DVOA 1P0KA 3QSRA 3GH5A 2QUNA 1UPPA 2X7WA 3VDBA 3K5XA 4XVDA 4V28A 1AH4A 3EB4A 3L5MA 4NXKA 4PUNA 3I3DA 4B9YA 1W9DM 4B3KA 1HL9A 1HL8A 4CN6A 1LYXA 1Z42A 3UESA 2VHLA 4NZ1A 1R30A 2EAWA 2YX0A 3VIPA 1QUMA 4JOMA 4ZMGA 2OO0A 4PCPA 1E4IA 4CQ9A 4NAFA 1RBLA 3PJTA 4G7EB 4QAWA 4AB4A 1XBZA 3WMLA 4H04A 2XINA 1JCTA 3SSJA 4AWSA 5D32A 1XRFA 3TTYA 1US3A 5CPLA 2J79A 1S3TC 2VFDA 3VYLA 2DIKA 3SY8A 5CXPA 5IDIA 4HJWA 3CUZA 1TWZA 1KXVA 1PAMA 3URQA 1OYAA 4F48A 4JAWA 2PDHA 1B3XA 3GVVA 3BZJA 3OU8A 2J9ZA 4B2DA 4J9JA 3VX1A 3F5KA 2PDUA 1WCGA 1W32A 3T2PA 4OBSA 4X3ZA 1G94A 2DY3A 1KFWA 3SFWA 1JPHA 1VHCA 4WD0A 3A3XA 2ZRYA 1PX4A 1ZJHA 1SZFA 3UD6A 4DUXA 3OEXA 2GGGA 3TNBA 4AVFA 4FOKA 4MLRA 2D0GA 2FQIA 1F74A 3BGGA 1QNRA 3CPUA 3QPYA 3ITOA 2VD8A 1QPRA 4I5XA 3MC5A 4UB9A 5DX7A 4DB7A 3H22A 1UKQA 5FF7A 1RVKA 3OOQA 1L6SA 4D6JA 1K3UA 1RD5A 2CIPA 4F2UA 4XX6A 5M5DA 1XCXA 3GTIA 1KBBA 3GXNA 3QN3A 3SUVA 2OX1A 4Q4KA 4LUSA 3TCSA 1K9DA 1H7WA 4NF7A 5EL1A 4JTEA 4HZ7A 3S5NA 4Q6XA 3W81A 5I09A 2VOMA 1CPUA 4AEOA 1OG0A 3GHSA 3BJSA 3P81A 3UA4A 2TYSA 2ZADA 1V0NA 2R1KA 5LNWA 1Y8BA 2PB1A 5LIKX 3RM8A 1WZAA 1XFCA 1I2QA 1OT1A 2WVSA 1AD4A 1LCOA 4BQ5A 3PTMA 4Z2GA 1H60A 3EDDA 1EZWA