3CMJA

Crystal structure of engineered beta-glucosidase from soil metagenome
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
441
structure length
441
Chain Sequence
KKFPEGFLWGAATSSYQIEGAWNEDGKGESIWDRFTRIPGKIKNGDSGDVACDHYHRYEQDLDLMRQLGLKTYRFSIAWARIQPDSSRQINQRGLDFYRRLVEGLHKRDILPMATLYHWDLPQWVEDEGGWLSRESASRFAEYTHALVAALGDQIPLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALSPAGSQMGITLNFNTIYPVSAEPADVEAARRMHSFQNELFLEPLIRGQYNQATLMAYPNLPEFIAPEDMQTISAPIDFLGVNYYNPMRVKSSPQPPGIEVVQVESPVTAMGWEIAPEGLYDLLMGITRTYGKLPIYITENGAAFDDQPDQSGQVNDPQRVGYFQGHIGAARRALADGVDLRGYYAWSLLDNFEWAEGYSKRFGIIYVDFETQQRTLKQSAQWYRDVIANNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-glucosidase
publication title Crystal structure of engineered beta-glucosidase from a soil metagenome.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 173
structure length 441
sequence length 441
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2008-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cmjA00
1UD3A 2PI6A 1KR0A 2WC7A 2WZHA 5A6SA 4D71A 2Y8VA 1QNOA 3ZM8A 7TAAA 3WNNA 5ABFB 3JUGA 4TOQA 4NRRA 2G3JA 2UY2A 4W7UA 1UUQA 2OYKA 4WSKA 2JF7A 4CCCA 4HMCA 2J7DA 5I5RA 1B31A 3KEHA 4PTVA 2EQDA 4ATLA 2J25A 3AZTA 4TX6A 3VTRA 5M17A 3VDBA 1JAEA 3O9NA 1LL7A 3MUZ1 4ZE4A 2ESCA 1LWHA 4UQBA 1YHTA 1XSJA 2CBJA 1BPLB 4UR9A 4RE3A 4AEFA 4KRTA 1CXLA 4OBRA 4MB3A 3OBAA 3RM8A 2Y2WA 3AOFA 3W82A 1JYNA 2G3NA 3AXIA 1VFFA 2WVUA 1V3IA 3WIJA 2Z1SA 1E71M 3OA5A 4FLQA 3SCRA 1OD8A 4DWSC 5M5DA 4UQDA 2G41A 3VVGA 1RD6A 1JI2A 1ISVA 4C7GA 2WMJA 1J01A 1HKMA 3AHZA 4RE4A 3LPPA 2WSKA 3ARRA 3RPMA 5LYRA 3VD4A 2E9MA 1UR0A 2VJXA 1WNOA 4CN4A 3AHVA 2CYGA 3U57A 1E6SM 3ZR6A 4PMVA 3WEZA 2XJ7A 3THCA 3UR7A 1OWQA 3OZPA 3WF0A 3ARZA 4PMYA 1V6YA 5A2AA 1C7TA 3M07A 1MQRA 3VGBA 1WZAA 4LX4A 2PBGA 3ARWA 3CTTA 1QOXA 3T0DA 1B3YA 3SCPA 1HNYA 2V3DA 2XUCA 4RE2A 2EPLX 2PF0A 4GKLA 3WH6A 3AIQA 3SUWA 5JBDA 4AZCB 1UZ1A 1WZKA 1FH8A 3MU7A 3OLDA 1NOWA 2WB5A 4PSRA 2VQUA 3OLIA 2DIJA 4Q22A 1BYCA 2WLZA 4AD3A 5IHSA 1SMAA 2WM0A 5HOSA 2HVMA 4ACZB 4OOZA 4TVUA 2JE8A 4DWSB 4L4PA 2ZXQA 2VZVA 1WE5A 3HJEA 3VIHA 1VJSA 2WMIB 3SUUA 4FF5A 3GNOA 1HKKA 2VOTA 2VUYA 3BLPX 4CU8A 1Y7VA 2BVYA 1EH9A 4U33A 3AI0A 4ZEPA 1J11A 3NUKA 1JYVA 1KB3A 3WMCA 1ISYA 3WMSA 2QMKA 5AC4A 1NP0A 1XD1A 3WD0A 3MO4A 1ZJAA 5JIWA 2WKGA 4UQAA 1UOKA 1Q6FA 3O2LA 1VJZA 3SCTA 4UOJA 3PZIA 4D6HA 3II1A 1CENA 1WP6A 3GXMA 2O9TA 2ZWZA 4F79A 1ITCA 1JYWA 5BXPA 3ARXA 1VEMA 2BY2A 2YDQA 1OGGA 4CKQA 1ODZA 4JHOA 4H04A 5C70A 1ODUA 4AD2A 4FK9A 1B3VA 3MSGA 5A8MA 2DEPA 2W5FA 4DM1A 5D9NA 5HBFA 3A3HA 3POCA 4CN6A 1XCXA 2CIPA 3OG2A 1GOIA 5I77A 1E73M 3FNDA 1WDQA 1KGWA 3OIHA 4X0VA 2C7FA 3OB8A 4M56A 1KXHA 2WPGA 2GUYA 1CXEA 5CQ1A 3EDFA 2J8FA 5CGMA 1GOKA 2WVSA 4D1IA 2D2OA 1HVQA 2YL5A 1VIWA 1JG9A 2Y24A 1LJYA 1BYAA 1OIFA 1W9DM 5BYWA 2YBTA 3QHOA 4CVWA 1KBKA 4UZSA 3RMEA 3MSDA 1V3HA 2WWCA 4EAMA 2JEPA 1CGWA 4QFUA 2DT0A 4FMVA 3WUEA 2X0HA 1WZMA 3VD3A 2WC3A 3CIVA 2J79A 3WF3A 4H8HA 4P8UA 2XVNA 4CD8A 3NIYA 4QLKA 2GFTA 2UY4A 3GH7A 1I1WA 5CGTA 4J3WA 3MANA 3SUSA 1WO2A 4MDPA 4AZ5A 2IXVA 2WXDM 4WSJA 3BAIA 3KWXA 3N11A 3N1AA 3LPGA 1H41A 3RILA 4UTFA 3D5HA 4DUXA 1MFVA 4CUCA 3NDYA 1U33A 2UY3A 1JNEA 3VU2A 1TA3A 1UA7A 1H3GA 3ARTA 3FXYA 5A6AA 2IXUA 4W7WA 4D6EA 1GOQA 3RIKA 1SFSA 3ZSSA 2QLYA 3OGSA 3RO8A 2WHKA 1JD7A 4W84A 3WUBA 1E4IA 1GQKA 1TG7A 2ZXAA 4J27A 5KZ6A 1QI4A 1JXKA 3W26A 4MB1A 2OSXA 2ZX9A 2DGAA 2AMGA 2ZXBA 1GJWA 3SUVA 3WL1A 1ZU8A 1JDCA 1GOWA 3WD4A 1QHPA 1CGVA 1HN1A 2JIWA 1LWJA 1HL8A 3EDJA 2J62A 1LL4A 1M04A 3VOCA 1NWTA 4W5UA 4U3AA 1U30A 3AS2A 1FH7A 1UQYA 1GUVA 2D0GA 4XV0A 5DT7A 2VZSA 1E6ZA 2VCAA 2CKSA 3PTKA 1XSKA 1V6VA 1MQQA 3MMWA 3DYPA 4M80A 1C90A 3HMCA 1OB0A 4Z2HA 1RP8A 3GH5A 4BQ5A 3GTNA 2GJXA 5AC5A 1EDTA 1BVNP 1BFNA 1JF5A 1WPCA 5GNYA 1HKIA 1OM0A 2YBUA 4HA1A 3WUFA 1V0KA 2XFRA 1AVAA 1X6LA 2WCAA 5DF0A 1H11A 5ABGA 3OLGA 1NM9A 2XVGA 3WNKA 1E1EA 1ZBCA 2YIHA 1R8LA 1VEOA 5A8PA 3VO0A 2CHOA 3PTMA 1E6RA 1BG9A 1GORA 1DTUA 2ZICA 2YDSA 1US2A 3ZIZA 2D23A 1MW2A 2ZX5A 5E0FA 5I24A 3CUHA 1B30A 3M7SA 2BNJA 4P8WA 1LG1A 2E9BA 1QW8A 1FFQA 2VR5A 2ZE0A 3VM7A 3POHA 2X0YA 5GNXA 2E8YA 1J10A 4GZEA 1HJSA 4IPNB 4D6FA 2JEQA 4E8CA 1OBAA 4ZENA 3U5UA 2CPUA 4P7QA 5A6KA 1AQHA 6A3HA 3ZJ8A 4W5ZA 3BGAA 2NT1A 5D9MA 2BY1A 3ZT6A 4Z2IA 3RM4A 4A3YA 4A4AA 5HPCA 2YOCA 4B3LA 2VNCA 3CZEA 1I75A 1MW0A 3SCSA 2Y8KA 3UG4A 2WWDA 5D9OA 4MNKA 5CLWA 2E3ZA 1VFOA 1V08A 3WNMA 1E4LA 4M81A 3UCQA 2W63A 2E4TA 1DWGM 3GM8A 4D72A 1F4AA 1V0LA 4H7VA 3WKZA 1C92A 2EO7A 4PTWA 2CBVA 3CHFA 3WQ8A 1KGXA 2DSVA 4WF7A 2J7HA 1EQCA 1W1TA 3ZR5A 2J78A 4WJXA 2BY0A 1ZJBA 3B9DA 2OSYA 2D0HA 1EOKA 1W9PA 4CD4A 3WD3A 1QI5A 1BLIA 1CEOA 3W37A 3N13A 5LA0A 4Q7NA 1JZ5A 4BS0A 1W3HA 4AD4A 1CECA 1NWUA 3SCQA 3ARQA 2RGLA 3ALFA 2XWDA 2WMKA 4KMQA 2FHFA 3KL3A 5A69A 3B8SA 4UZUA 1GHRA 2J74A 1Q4NX 1CLVA 3CUJA 1PBGA 1V02A 2FGZA 1KCLA 1TUXA 2W61A 1OD0A 4IISA 3CZLA 4OIFA 3AS3A 4OOUA 2D3NA 2OWCA 3CGTA 4J3TA 1GQIA 2O9RA 4W8LA 3IK2A 3KZSA 3WH8A 1ISZA 2GJPA 5AYIA 2HISA 1CNVA 2ZUWA 4B16A 3WF4A 3AXXA 1C8YA 3ZOAA 1GVIA 1HL9A 1KXVA 5EBAA 3TTSA 3CO4A 3VPLA 4B15A 3QOKA 1QNQA 4UNIA 4D6GA 4QAWA 1B0IA 2DSUA 2PC8A 1DWAM 2QF8A 4GQRA 1W91A 3FHAA 3CZGA 5IXEA 2EJ1A 3WFLA 3W24A 1RPKA 3W38A 3CUIA 1J0HA 2D20A 1E40A 1MQPA 1PAMA 2DH3A 2G3MA 1D2KA 1EHNA 5E6YA 4MAZA 3PZUA 1E43A 3OGRA 1UD2A 5A8QA 2DSZA 2WBKA 3DHPA 5C8BB 1ZBKA 3K1DA 1CXIA 4PSPA 1MYRA 3UETA 8CGTA 1KFWA 4DUVA 1OIMA 3K46A 1VFUA 1QHZA 3BAYA 2VX7A 1RH9A 1J0ZA 1LQ0A 2WMGA 1BQCA 1KWGA 4HZ7A 1J0YA 1HJXA 2A3CA 2VRJA 3CPUA 3CHCA 2E9LA 2XSBA 1E6NA 1ZBVA 3AIUA 1CZ1A 2YJQA 3O6AA 1VBRA 1U2YA 3L2LA 4AISA 1JIBA 3BSGA 1ZB5A 2ZIDA 1J0KA 2ZUUA 3F5LA 4J3VA 2D0FA 3ZJKA 4AXNA 3SCOA 2ZOXA 3L4WA 2WZEA 1CGTA 3DC0A 5JIPA 2QPSA 1OGSA 3W28A 3W81A 3SCNA 2GK1B 5BWFA 4W88A 2A3EA 4QCFA 4GXPA 1W9UA 4S3JA 3M6DA 1H2JA 4AWEA 1EIBA 1NOFA 5BXRA 5DMYA 3ARUA 3QHNA 2OWXA 4HMDA 4U2YA 1H4PA 1CLXA 3EDDA 2UWFA 3T2QA 1E5JA 1V3JA 3CZJA 2BVTA 4W8BA 1MFUA 3VX0A 4W85A 1XV8A 1BGAA 3BC9A 1MXDA 5A2CA 1W3JA 1CWYA 4UCFA 5CSUA 5I3DA 4XX6A 1G01A 4JL1A 4EANA 3U7BA 2DT2A 3LPFA 3W25A 1MW1A 2CESA 1W1YA 3AS0A 4GIAA 1V3LA 2CXGA 3HN3A 3AHYA 2WZIA 2VCBA 3WNLA 3T0BA 4AZIA 1UR9A 2ZX8A 1HJWA 1B2YA 2YL6A 2VMFA 3GNRA 5EB8A 3PZGA 5D8WA 1V6WA 1XHGA 4ZFMA 1VBUA 4PEEA 1UH3A 3IJ9A 2WHLA 1Q6EA 3VIPA 2VZUA 7CGTA 2YDRA 2V3GA 3PZMA 2VURA 5CG0A 3EMCA 3VX1A 3ZJ7A 1DWJM 1UH2A 4ZXLA 1LLOA 4WKFA 3UG3A 3S6TA 3WY1A 3L4ZA 3CHEA 5A1AA 1X6NA 3LPOA 2EPMX 1HVXA 3WDIA 1D7FA 3WH9A 2XGIA 3MKKA 3UERA 1V6UA 1W2PA 1ZS2A 3PZTA 4UOZA 5IFPA 1PX3A 1W3LA 5DO8A 1JNDA 4NF7A 3ZJ6A 1ISWA 5E6ZA 3ZQ9A 1CXFA 2PWEA 1OT2A 2WMHA 1E1FA 4E4PA 5JBFA 2FHCA 1G0CA 3SURA 2DSWA 4P7NA 1R87A 2FDMA 4QDMA 4H2CA 4UFKA 4DWSD 2WVVB 3L4TA 4M29A 1E6PA 1GOMA 4A3HA 1QBAA 4LGXA 2BXYA 1UD6A 1WDRA 2BHUA 4HP5A 4UFHA 2BHZA 1S46A 4CN1A 4HU8A 2DDXA 2WSPA 5TD4A 1XC6A 1W9VA 1GJUA 2XFYA 2W62A 3CZKA 4PN2A 3TOPA 2FH8A 3K4AA 1UH4A 1XSIA 1UYQA 4PMNA 5BXSA 3WEMA 4JFVA 2A3AA 1JZ4A 1HF6A 3F5KA 5HDRA 5ABFA 5FOOA 3PZQA 4BA0A 4MB5A 5I23A 1QW9A 3WF2A 1WAWA 1BYBA 1R7OA 3AMKA 1JD9A 1K9FA 3WL0A 3PTQA 4NRSA 4W8AA 1E6QM 3I3DA 4TVCA 1W1VA 1J0JA 4NI3A 4CCDA 1A47A 4W89A 4B9YA 1H1NA 1R7AA 3W29A 5GNZA 1EO5A 2JF6A 3K4DA 3TTYA 4J3UA 1H09A 4MNMA 4KWUA 4PMXA 1GZJA 4LQ1A 1PZ2A 4GQQA 4LPCA 1N82A 4YHGA 3WQ4A 3VIFA 1MVYA 1D3CA 4MJ4A 4OUEA 4Z2GA 1OCQA 3T09A 4AZ7A 4AY1A 4CD5A 3CH9A 3OGVA 5I2UA 2W66A 4AZGA 3N12A 3BAJA 3RJYA 4PYSA 2WNWA 3WQ6A 4KRUA 4N42A 5CSYA 1RP9A 4JL2A 3VUPA 3FAWA 3ZMRA 2V3EA 1BG4A 1CGYA 1NWRA 4HPHA 8A3HA 1XYZA 1LG2A 1JZ3A 1UR1A 3GBEA 3A47A 1E4MM 4Y7EA 1ZBWA 4R5EA 2XG9A 5D8ZA 4M82A 1XRVA 3ARVA 1I1XA 1Q6GA 1C8QA 1UWSA 2NW0A 3W4RA 2BHYA 2WK2A 1EDQA 1UWRA 2ZX7A 3BMWA 4D6JA 1V3MA 2A3BA 4AZCA 1E15A 2W67A 2ZWYA 1BGGA 2NSXA 1JZ8A 4J3SA 1BAGA 4YN5A 2A3HA 3L2MA 1GCYA 3WENA 2J7EA 4UFMA 2ZUTA 4ACZA 1M03A 1G1YA 4JAWA 4DWSA 4UQ9A 3VGHA 2Q8XA 1A3HA 3EDKA 4AZHA 2WMIA 5ABEA 1VB9A 2DIEA 1E3ZA 2ZXDA 3AHTA 4B9ZA 1H49A 5CLTA 3AISA 1G94A 4LYQA 5A6MA 1C7SA 2VI0A 1UWTA 2ZUSA 1B1YA 4MPKA 2VRQA 5CPQA 4HA3A 1E4NA 9CGTA 2CKRA 4C7FA 4V27A 1FOBA 4HA4A 1DWHM 2XVPA 1O6IA 3MUY1 3A4WA 4HU0A 3VNYA 4KGJA 1UR2A 4M8UA 1XH1A 4C7DA 2YLLA 2BXZA 1GPFA 1TE1A 1HIZA 2C8NA 2XVLA 1J9YA 2BVDA 2Z1KA 2YA1A 4HOXA 2YKKA 4JIEA 2VC9A 2G3IA 3NCOA 4HTYA 3VDCA 1VEPA 2CNCA 5KEZA 1HXJA 1E0XA 1W3KA 2RGMA 3WD2A 4N0RA 2XM1A 1WZLA 3RJXA 3A6OA 1E56A 4FLSA 3BCFA 3QOMA 1PIGA 4F8XA 4PUDA 5C71A 1JXJA 3N17A 1V03A 4QLLA 1B9ZA 1H0IA 3VD5A 5E9AA 1PX8A 2IUZA 3PBGA 3WBEA 4GO8A 3T2PA 3WNOA 3GXIA 1W9BM 5E09A 2F2HA 1HX0A 3OLEA 2YLAA 2YL9A 3DECA 4V28A 5DT5A 3T0AA 3WEOA 2PWGA 5ABHA 1DWIM 5I0DA 4PMZA 1W32A 1W9XA 4D6DA 2D22A 3FY1A 3F5JA 4EK7A 1E6XM 4XZBA 7A3HA 3KL0A 1MWOA 4W7VA 4JHZA 3AIRA 2CEQA 4FLOA 2WANA 3WQVA 4BF7A 4S3KA 1HP5A 3THDA 1KR1A 4V2XA 4JCMA 5CJ5A 2WBGA 3PZOA 3QR3A 3FW6A 4QP0A 1GOOA 2WCGA 4D6CA 1TVPA 2J75A 4MTVA 3AMGA 1Q6DA 1YQ2A 4M1RA 4TTUA 3B9EA 2DQXA 2ZX6A 2DPEA 4BZYA 5BROA 1PZ3A 4URIA 1W2VA 1KGUA 2J7BA 3MUAA 2VX4A 4TUFA 3N18A 3AMDA 2XPKA 5AYBA 3MV11 4HMEA 1XH0A 1VENA 5JUVA 1LL6A 5A8NA 4P7LA 1X1NA 2PWFA 2WVTA 1UKSA 3W27A 1HP4A 4MNJA 1K9DA 2VVNA 3GYCA 3A4XA 2EEXA 3AJ7A 1E70M 4PMQA 3W0KA 1SMDA 4UFLA 1FHLA 3VILA 4JCLA 5HPOA 4H8VA 2WMFA 3TTQA 4EKJA 3W6MA 1WDPA 3WMBA 2V5CA 1Q6CA 4PBGA 2X2YA 4CU6A 5AY7A 1BTCA 3K8MA 1KXQA 1NQ6A 3BMVA 3MMUA 3WQWA 4OBSA 1BHGA 5LA1A 5E0CA 2XGBA 5I78A 1JDDA 2BV9A 2WCSA 1E5NA 4WIWA 2DT1A 2V3FA 4PRWA 4J3XA 2GDVA 1QI2A 3WDHA 4PCTA 1XD0A 1TZ7A 3WH7A 2XM2A 1FH9A 2GVYA 4AD1A 2VCCA 4MNLA 5JBEA 2D3LA 3WFZA 3SCVA 5IHRA 2VVSA 1GQLA 4JKKA 4TXEA 2Y5EA 1QHOA 2G8ZA 5FL0A 3BH4A 1O7AA 3ARSA 3VIOA 5FL1A 1PEZA 1BVZA 4DUWA 1EXPA 3M46A 3RDKA 3AMCA 2B31A 1LF1A 1UHVA 2BY3A 3VMOA 4WLCA 3NDZA 2OWWA 1E72M 3AYRA 4WK9A 2DT3A 4PMRA 2VTFA 1OT1A 1B3ZA 4QLJA 3TTOA 5D4YA 3K8KA 5EFFA 4AYSA 2O9PA 4NSBA 1HJUA 2J77A 4JFWA 5LA2A 1V02E 2GSJA 3VDAA 4M24A 3CZ8A 3HU7A 3AROA 3GDBA 2W92A 3MS8A 3UR8A 4L4OA 3VIGA 3GZAA 1B3XA 3PZVA 3I3BA 2CERA 4FLRA 1UWUA 2V38A 5A6BD 1IT0A 2C0HA 5A94A 3VGFA 5DEZA 4U3CA 1J12A 4EE9A 2YA0A 3VKKA 2YL8A 3TP4A 3T2OA 1VFMA 1XYFA 1IZJA 3MMDA 1UZ4A 3N04A 4IM4A 2VR4A 1C91A 5GQBA 1PIFA 2WAGA 2O92A 4E8DA 1QNRA 3GBDA 4AMCA 3CMJA 2X09A 3DYOA 5M03A 1TA3B 4W86A 1NH6A 1PX4A 1UD4A 1WB0A 2JFEX 3AIEA 4D6IA 3SCWA 1CIUA 4GZIA 3VD9A 2TAAA 1JL8A 1JFHA 4PMUA 3ZSTA 2XIBA 4U31A 4MADA 5FIPA 3WD1A 1EHAA 3ARPA 3RCNA 6TAAA 1GHSA 4XUYA 4F9DA 4J7RA 1DEDA 2E8ZA 2F61A 2E0PA 1JGIA 4D1JA 3WUGA 3PHAA 2J7FA 2QHAA 2VX5A 1JI1A 1KQZA 1CXHA 1ZL1A 4GPNA 4R27A 1KBBA 2NT0A 3ZO9A 2CETA 4RL3A 3CLWA 3WF1A 3VDHA 3EMZA 1JZ7A 4ML4A 2OLHA 2WYSA 2EPOA 4GI9A 1NOUA 3K8LA 4H8UA 3KL5A 2J7CA 4PTMA 2FHBA 3L4UA 4ATWA 2YA2A 3WQ5A 2W91A 6CGTA 5IFTA 3AQUA 1DWFM 1QBBA 4TTGA 1XH2A 4MJ2A 4CVUA 2ZUNA 2XHYA 1HT6A 1C8XA 2WC4A 1PJ9A 1QNPA 2GJXB 1KXTA 4BQ2A 3GNPA 1V3KA 1FP8A 4KGLA 5A8OA 1G9HA 1K9EA 4GO9A 3AICA 4NZCA 1K9TA 4JFUA 5D9PA 3FAXA 3NJ3A 2D1ZA 1J0IA 1M53A 1AQ0A 1SR0A 1V0MA 1CGXA 4KH2A 3BSHA 2W4XA 3ECQA 1VF8A 3AIWA 2CCRA 1DP0A 3IJ8A 2PB1A 1UKPA 2D24A 3J7HA 5CXPA 3AIVA 3EDEA 3FN9A 4X9YA 3SCUA 2J8GA 1UA3A 1TR1A 1H5VA 1CBGA 1HJQA 4AD0A 1R85A 1VAHA 4F9JA 5A95A 3D3AA 4U5IA 3G6LA 4JZ5A 1CXKA 3TA9A 4UQCA 4TVDA 3VMPA 4OZOA 3E1F1 2JALA 1GW1A 3EBVA 2VX6A 3U7VA 4IUGA 4B3KA 2VT0A 3TONA 1J18A 3NYDA 3N9KA 1CTNA 4PMOA 5A6BA 3WN6A 2VRKA 3PZ9A 1XCWA 4DM2A 1OSEA 1UKOA 3WDPP 1OINA 2PBOA 5CPTA 1F4HA 3VNZA 4PCSA 3APGA 3IJ7A 3CBWA 3EYPA 2WHMA 1IV8A 1IZKA 1XGZA 1UD8A 4UOQA 3WH5A 1E0WA 2XTKA 2DH2A 1L0PA 4CD7A 2JIEA 1DHKA 4OKDA 3PN8A 5IDIA 1M7XA 5EFDA 3W53A 2GK1A 1QVBA 3BAXA 1QNSA 1UWQA 1P6WA 5GPRA 1TMQA 2VZOA 3BLKA 2V5DA 1AMYA 1GQJA 3N15A 2CHNA 1UG6A 4GINA 5BRPA 3VIKA 2XVKA 3AYSA 4CGTA 1C3FA 4AEEA 3B9AA 3AFBA 2XSAA 3DYMA 2EXOA 2EBNA 4YPJA 2VQTA 3AZRA 4HOWA 5A2BA 1JYXA 4UFJA 3EMQA 3S2CA 3CUGA 3AHXA 1Z32X 2X1IA 3WNPA 3L4VA 1WDSA 1MW3A 1L8NA 4JKLA 3GXFA 3CMGA 5HXMA 1TFVA 2G4FA 1BYDA 1C93A 1JDAA 4XB3A 3L4XA 4X0NA 1M01A 4W87A 4P8VA 3WSUA 4MB4A 1UKQA 1BF2A 1WCGA 2XYLA 3I3EA 1E3XA 3VM5A 5BXTA 1UKTA 3BXWA 1NARA 3MV01 1GONA 1CGUA 1KWKA 1ISXA 4ACYA 2GDUA 1EOMA 3AZSA 2XFFA 3U5YA 3L4YA 1VRXA 1E55A 3PZNA 3QGVA 4AC1X 2J47A 3UESA 2J7GA 3CUFA 1V0NA 1FA2A 3F4VA 4K68A 4GZJA 5DFAA 5ECUA 5FCZA 2VL4A 2CBIA 3IAPA 1JFXA 2PWHA 1UD5A 3AS1A 4AIUA 2EPNA 4MDOA 1K6AA 3SIMA 3IANA 5FD0A 4P7RA 4BQ4A 2WKLA 4LXFA 2BFGA 1R86A 3G6MA 3VMNA 2ZUVA 2WVVA 3QHMA 1EDGA 3IAQA 3ALGA 5BCAA 5E70A 5FKYA 2WHJA 3GH4A 1CPUA 4HZ6A 2OYLA 4YHEA 3ARYA 4JKMA 1QI3A 4PMDA 4CD6A 4HOZA 5M3WA 2OSWA 5A6LA 3WDJA 5EMYA 1AQMA 2ZUMA 3OZOA 3VIMA 1TVNA 4JFTA 1CYGA 2X8RA 3BCDA 4AD5A 4JFSA 3WBAA 3AXHA 3MUIA 4J28A 4BQ3A 3RM9A 2J4GA 4PTXA 2QPUA 1JAKA 5BRQA 4LYRA 3SUTA 3WDRA 1NWSA 2GJRA 3VGGA 1HKJA 5I79A 4WKAA 3BAKA 1BSIA 4ZE5A 2FH6A 1B90A 4ATDA 2PWDA 2OYMA 3DHUA 1EGZA 3UEQA 4PUEA 2WLYA 2QMJA 3FHQA 3UG5A 4IPLA 1FFRA 1UWIA 4Z2KA 1OGBA 4LYPA 2E40A 5HNNA 1US3A 2UY5A 2WW5A 4TX8A 4Z2JA 1QI0A 4GI8A 2CITA 1SYTA 1ESWA 4WKHA 3SEPA 4AW7A 1V6XA 1ECEA 1UR8A 2CBUA 4CU7A 3VIIA 4F66A 5CZKA 3VGEA 2O9OA 1G5AA 5F7UA 4UFIA 1KQYA 4UQEA 4GI6A 2XWEA 3AMLA 1CDGA 3W6LA 4Z2LA 4HPGA 1WKYA 3LMYA 3WDQA 3VINA 3ZT5A 3AIBA 2VO5A 2MANA 4CCEA 1TCMA 1FHDA 1B3WA 1PPIA 3WELA 2VZTA 4ZXOA 1GNXA 4E2OA 2DSKA 1E9LA 5A3HA 4AZBA 5CPSA 1MXGA 4AIOA 1KCKA 3T08A 2XIIA 4QCEA 2FGLA 1FP9A 3KE0A 5I6SA 3NSXA 1QPKA 3CHDA 4XZWA 3VD7A 3A4AA 2F8QA 4AZ6A 2EPKX 3BAWA 4MAVA 1EA9C 1NP2A 1ITXA 3VIJA 1UQZA 3NSMA 3VGDA 1GVYA 2Y4SA 1E0VA 5A6JA 2X05A 3NSNA 3GXDA 1H0GA 4W93A 4P7OA 1JF6A 1UR4A 4AIEA 1HJVA 4P8XA 4U5KA 1EO7A 4BCEA 1EQPA 3ZT7A 4HZ8A 2QV4A 1JZ6A 2BS9A 1W1PA 4H41A 4U2ZA 4OJYA 1JZ2A 2AOSA 2AAAA
chains in the Genus database with same CATH superfamily
2WC7A 3OBEA 1E1CB 3RITA 3UZJA 5A6SA 4NY2A 3ZM8A 7TAAA 4JIPA 1Z48A 3C3UA 4TOQA 1XUZA 4NRRA 2G3JA 3BURA 3LENA 1XP3A 4WSKA 1PIIA 2JF7A 3V5OA 2J7DA 2EQDA 4IIBA 2ZA3A 3SJNA 4OFCA 3OYZA 3BOLA 3REQB 2FKPA 1O12A 4TO8A 1S2AA 3H12A 3P60A 3QGKC 4GGBA 3O9NA 1PB0A 2P76A 2VD9A 3A9IA 3CL6A 2ESCA 4UR9A 2X40A 1PZ1A 4KRTA 1TIWA 3RYSA 1REQA 3RM8A 2X16A 3AOFA 3PTDA 2BOEX 3DESA 3R10A 2WVUA 4O0KA 2Z1SA 4NNBA 4FLQA 1FUYA 3SCRA 2DVTA 1OC5A 2G41A 3A12A 1RD6A 3OU8A 3TYBA 3NFUA 1A5NC 2FGBA 3LPPA 4UB9A 3RPMA 5DQPA 4MJZA 3MP4A 3N2XA 2GUUA 3EEGA 3TC7A 3U57A 3HQPA 3UXAA 4UNLA 4L56A 4S3AA 3THCA 4KS0A 3OZPA 1V6YA 3COTA 1C7TA 3R1ZA 3M07A 3UGRA 1WZAA 4LX4A 2PBGA 3ARWA 3CTTA 1QOXA 4XG1A 3L0GA 2YZ5A 2V3DA 3TMQA 4IMEA 1CCWB 2EPLX 3WH6A 4GVFA 3TWBA 5JBDA 3DEQA 1FH8A 4LY4A 4FNTA 3SJ3A 2DIJA 3W7DA 2WLZA 4AD3A 5FACA 3FDKA 5HOSA 2V68A 1F61A 3BLEA 3RG6A 1YADA 1XW8A 5H8PA 2Y88A 1OHLA 3VIHA 2EKCA 1W3NA 1Q65A 2ZRZA 1UASA 1XRFA 4GG9A 1SGJA 2VUYA 3BLPX 2GQ9A 1GVFA 1EH9A 2VFIA 4PMJA 3NUKA 1A50A 3L7RA 1RCQA 2BB0A 5AC4A 1NP0A 1XD1A 3MO4A 3FK4A 4GCAA 3O2LA 5AHMA 2Q6ZA 1WP6A 1OG0A 1UIOA 2GSHA 3GTFA 4F79A 1MZHA 1UW9A 2YDQA 3WLPA 1ODZA 1I9CB 3TLLA 5IDZA 4QNWA 4V33A 4PB3A 5A8MA 3MDWA 3QKEA 6ENLA 5HNUA 2V30A 3I4EA 4WOQA 3POCA 3R0KA 2CIPA 5I77A 1F73A 1RJQA 1KGWA 3WLHA 1UP0A 4N9EA 4X0VA 2C7FA 3HJZA 3NZGA 1QK2A 3H2AA 3STCA 1SU5A 1PWMA 1MRQA 3O8AA 4AC7C 2J8FA 3BCJA 5T9CE 1AJ2A 1GOKA 4IGMA 4D1IA 1EGMA 3OZYA 1HVQA 1JG9A 4I6VA 1W9DM 5BU9A 3OP2A 3AJXA 4JX4A 3W7NA 3QHOA 3SGGA 4XD4A 4JTJA 2BDQA 3TZNA 3UNTA 3GC2A 3GY1A 1CGWA 4NUWA 1X38A 1F3EA 3CIVA 3NPXA 4O12A 2ABAA 4WOZA 3WF3A 2XVNA 2NQLA 2E1WA 4MKSA 2UY4A 5HMSA 3UXDA 5C2GA 5L6UA 1GVRA 1WO2A 1W0MA 4YS1A 4AZ5A 4JTEA 2IXVA 2ZE3A 3FV9A 1A5SA 4H1ZA 3M0MA 4LEFA 4WSJA 3M0LA 3NVDA 4DX3A 3AUJA 3S46A 5CZ0A 4UTFA 3BUVA 3NQVA 1TA3A 1WOBA 3ARTA 2CZVA 3VCNA 1GOQA 1DIKA 4C6QA 4HCLA 3NQ6A 4DJDA 5K2ZA 2GL5A 1GQKA 2BTMA 3STGA 2YSWA 3SUVA 1YDNA 5H91A 1CGVA 1X1ZA 2Z1BA 3QYQA 1MZRA 4S23A 2P50A 1HN1A 1R2TA 4YJ5A 2I5IA 1HL8A 3EDJA 4F0HA 3O05A 1JCYA 5D2VA 3AS2A 1HZYA 1UQYA 3JVAA 3M0JA 4XV0A 3NEVA 4MG4A 2DFAA 1SQ7A 1TYGA 4R33A 3UU0A 5FESA 1XIEA 4OUIA 3TNBA 3SGUA 1AG1O 1FCVA 3E12A 4Z2HA 1RP8A 4BQ5A 4US6A 5G5IA 4X2RA 5BRBA 1XBYA 1RUSA 4DBWA 1KKRA 1J2WA 2IPFA 2RDUA 2WCAA 3QPEA 5ABGA 1NM9A 5LNSA 4WDWA 5HAOA 3HOJA 1E6RA 4LNCA 3TYUA 1US2A 1N2VA 2J9YA 3UJRA 4IQJA 5I24A 3NWRA 5REQA 4P8WA 1FFQA 2VR5A 2ZE0A 4ORIA 2Q01A 5GNXA 5EMJA 4G8TA 5I07A 1J10A 3RLHA 1VHNA 3SRDA 4IPNB 1S5TA 1UWAA 2JEQA 4PB5A 3GDTA 1IXNA 1MXSA 2CPUA 1R5YA 2GUBA 2Z27A 1A3XA 4LT9A 4A3YA 4XBKA 3GHRA 2YOCA 1Q2RA 5DBUA 1OZQA 4A3UA 8TIMA 3DKLA 3O7UA 2QCDA 5HULA 1OK6A 2Z29A 3OTRA 3CZEA 3FEMA 4JTFA 2Y8KA 1ZCOA 3B8UA 4H8NA 4XQ6A 5DXXA 3UG4A 1TPC1 3CC1A 1RAKA 4LAMA 1V08A 4IJCA 4W4QA 2PDXA 4ENLA 1PUDA 1EJSC 5D2WA 5GVJA 3CV1A 2A7NA 5C2CA 2Y63A 2FPTA 4D72A 1D8WA 4BJHA 4XZIA 3WKZA 1F74A 3S2LA 4LAUA 3CHFA 1EQCA 1W1TA 3ZR5A 1JUEA 1VGAA 4WJXA 1ZJBA 4Q8VA 1W9PA 2C19A 4CD4A 4ZZ9A 4UTIA 3DFTA 3KTXA 2NXHA 5D02A 4GNVA 3N13A 4C65A 1YW1A 3ITVA 4R3UA 4NJGA 2NQ9A 1NWUA 3OVPA 3QV6A 3ARQA 3ALFA 3WLKX 2WMKA 3W7MA 4ASTA 4LFYA 5I09A 4JX5A 4UZUA 3ELFA 2J74A 2J9XA 4Q4KA 4O15A 2W61A 1XIBA 1LUCB 4IPJA 4OIFA 3C0SA 3CGTA 1GQIA 2O9RA 3NXLA 2LLEA 3H7VA 3UW6A 4DEFA 1SW7A 1A0EA 2PTZA 4M7TA 3RPDA 4YTTA 4JYDA 3W1XA 1CNVA 1SO6A 4IXXA 3WF4A 1C8YA 3TTSA 1O60A 3CO4A 5BZAA 3VPLA 4C6PA 1FBAA 3AU2A 3NTYA 4UNIA 1IEQA 1B0IA 2DSUA 2I16A 3FHAA 3EEZA 3DIPA 3EWWA 3W24A 1J0HA 1XJBA 1NU5A 2J6XA 2Z26A 4XKMA 2PDBA 1DXIA 3EOOA 3L5LA 3IK4A 4TQTA 2NQ5A 4ZR8A 4RV8A 5AYZA 3HO8A 1E43A 2DSZA 5CPOA 3KDOA 1CXIA 1MYRA 1E0UA 2C18A 1QHZA 3BAYA 2WO5A 2YXXA 4HZ7A 4O0QA 3NQMA 1PTAA 5IM51 1J0YA 1HJXA 2A3CA 5EPDA 1CZ1A 5DELA 1VBRA 3T8LA 1U2YA 2CHRA 1JIBA 3V7PA 4GY7A 1J0KA 3F5LA 4J3VA 3PC0A 4Y8FA 4EF8A 3BW2A 1CGTA 4G7EA 1ZGDA 3DC0A 5JIPA 3SCNA 2GK1B 4O54A 2YCEA 4TX9A 1YDYA 4S3JA 2WZTA 3M6DA 1H2JA 4CQBA 4GUJA 4OV9A 2E1DA 3MMTA 2PURA 2JKAA 3R4IA 3CZJA 4K37A 1RY8A 2UV8G 4C1NA 3PFRA 1BGAA 3BC9A 1CWYA 1XDLA 7ENLA 5I3DA 4PCNA 2ALDA 4JL1A 1KC7A 3U7BA 2DT2A 7REQB 1AFSA 1W1YA 3TQVA 2XN0A 3PPFA 1V3LA 3AHYA 3U9IA 1ADOA 4AZIA 1S1RA 2CZEA 1HJWA 2VMFA 3PK7A 1HL2A 1NDWA 3B0VC 4RZ6A 1UH3A 3IJ9A 1VBGA 3TYEA 3VIPA 2RJHA 7CGTA 2G50A 2YDRA 2VURA 4E3VA 1K6WA 2R1KA 1DWJM 3S6TA 3WY1A 5A1AA 3UG8A 2H6RA 1PKMA 4TMCA 1QU4A 1W2PA 3PZTA 3PBVA 3BJTA 4NF7A 3A21A 2QCGA 4HPXA 3KBWA 2PWEA 1E1FA 3H4GA 5AYXA 3LTPA 3AO0A 3LBCA 1MUCA 1R87A 3OW1A 3H8AA 2Y61A 1RSCA 2QDGA 1BVWA 1DJYA 2R91A 3HA1A 3QV7A 4A35A 4R88A 4A3HA 4CNSA 1Q3NA 4QHRA 4ECLA 2BHUA 1A5UA 2BHZA 2PP1A 1S46A 5LXEA 5EYWA 3MCNA 3B8TA 1UMLA 1BF6A 2XFYA 3OPSA 3C3NA 1MEWA 5LNWA 3FYOA 4E5TA 3WEMA 2A3AA 3GVGA 1JZ4A 1SJDA 4QITA 1T41A 2VDIA 3G8RA 4NZFA 2WOQA 1SZRA 3WF2A 5I3GA 3N4EA 1R7OA 4EWJA 4J35A 3FA3A 1K9FA 4MYXA 3PTQA 1P7TB 2W3ZA 4GQ0A 2A3LA 4GJJA 3WJWA 1P6BA 1B5TA 1R7AA 3BTNA 3GU9A 3CIWA 3M0IA 2D69A 1N82A 4S1FA 4RW5A 3XINA 2Q71A 1MVYA 2P53A 2OQLA 4OUEA 3H7RA 4AZ7A 3OGVA 5FI8A 4AZGA 3N12A 3GFZA 2HV5A 4UR8A 4PYSA 2WNWA 3WJYA 4LC8A 2VC5A 4TMBA 1OFOA 3S5OA 3GW3A 3UR5A 2V3EA 2ZDRA 2YR1A 1EBHA 3NZ1A 5I3JA 3FKRA 1YXDA 1ZUAX 3A5FA 1JZ3A 3E3HA 1XG4A 1E4MM 3R5EA 5D8ZA 4M82A 3TSDA 3DGBA 4XO7A 3YPIA 3W4RA 2YCLB 2BHYA 4F2TA 2ZX7A 4QRNA 4AZCA 2IQTA 3WJXA 1KCZA 2NSXA 3C56A 4UTLA 4X22A 5CBBA 2J7EA 3O63A 3RRXA 3CWOX 4ACZA 3M9YA 1W5OA 3VDGA 4AZHA 2BLEA 5ABEA 1G7UA 4JQ2A 3C2YA 2DQWA 4B9ZA 4H00A 3LDVA 1C7SA 4J1OA 4XAFA 2PUZA 4WDTA 5M1TA 3Q45A 4GE8A 4NNAA 2XVPA 3S42A 1GTEA 1SZGA 2YDAA 1TMLA 4JNYA 3VNYA 4O53A 3EA1A 3TC3A 1P4CA 1O5RA 4O1EA 3IVUA 2C8NA 1XISA 2FZDA 1J9YA 2XVLA 2YA1A 4A2SA 1VBJA 4ZQCA 1VC4A 3V5FA 2R82A 3GVVA 2YYUA 2Z24A 2G3IA 1Q13A 4TV6A 1HXJA 1E0XA 4CEUC 1REQB 2RGMA 1VD6A 1FCQA 3LGDA 4XAZA 1CI1A 5C9UA 4PUDA 5C71A 3N17A 1V03A 1TV7A 4LUJA 4QLLA 2WNNA 3GC4A 1H0IA 3PG8A 3IJLA 1S2TA 3WNOA 1W9BM 2F2HA 2YL9A 4V28A 5T9BG 3WEOA 1UOZA 2PWGA 1DWIM 3E0VA 3GFXA 4HD5A 1BXCA 4PODA 1Q6LA 3MCMA 4O18A 4HN8A 1C9DA 5D33A 1E6XM 3N34A 7A3HA 1S38A 3DX5A 4JHZA 4B3ZA 1VHCA 2PDPA 4BF7A 1QFEA 1MO0A 2YFOA 1R2RA 2WBGA 2ZRVA 4XTDA 1FWRA 4GC4A 1GOOA 2WCGA 4Z08A 3UWZA 1YQ2A 3GDRA 4IPIA 2Z1XA 4A29A 3B9EA 2ACRA 2DQXA 2ZX6A 2DPEA 1SO4A 1PZ3A 3VNKA 3PNZA 3LRMA 4HK6A 6TIMA 3MUAA 1LT7A 2Z0IA 4E3TA 4GUFA 3CL7A 3MV11 4L4LA 4S3FA 4LRTA 2C1GA 1EJUC 1KFLA 4P7LA 3JS3A 3F1QA 2GGHA 4BK9A 4FNUA 3RO6A 1UKSA 4MNJA 4AVNA 4DIAA 3GYCA 4RZ5A 2YXGA 4S3DA 2WSRA 4PMQA 1LRNA 2BASA 3NO5A 1FHLA 3VILA 4H8VA 4MZ1A 5TQLA 3DI1A 4GOAA 3SY8A 5XIMA 2OZ0A 1EJ7L 4NZ3A 4IQLA 2HROA 2I14A 2SFPA 4RNJA 3WLTA 1KXQA 3W2MA 2I56A 1NQ6A 4OT7A 4OBSA 4YTSA 5D04C 1FWSA 3NQEA 2BX7A 1FWAC 2WCSA 1GGOA 3P80A 4WIWA 1LTDA 2DT1A 2V3FA 3UWYA 5AHFA 4PRWA 3KHDA 2Z4GA 4NP7A 2C15A 5CC5A 1XD0A 3H26A 1M65A 2JKEA 2XM2A 2VGFA 4FXJA 4GKTA 5DCBA 5CG7A 1QT1A 2VCCA 4S3EA 4GVGA 3MHGA 1A4LA 3G1YA 2PWUA 4Y9AA 1TPB1 5IHRA 2VVSA 3USZA 2VFGA 3ATYA 1R38A 4JKKA 1KBLA 1V7AA 4TXEA 1XIDA 2G8ZA 4FOKA 1NDVA 3BH4A 1O7AA 3ARSA 2PLCA 1AQFA 1LRQA 1PEZA 3GTXA 1BWVA 3M46A 3MP5A 2RHGA 3LNPA 1OCBA 3M0VA 1O5KA 4KEMA 3WK3A 3G0SA 2YFNA 4REQA 2D2HA 4LUTA 3VMOA 4MWAD 2VDHA 4GIRA 2WJDA 1P43A 3LHYA 2DJXA 3AYRA 3S83A 3C61A 1M6JA 5CSSA 1NELA 3LCGA 1OT1A 2QR6A 3NZRA 1B3ZA 3K8KA 2E6AA 3TZFA 2O9PA 3CB3A 1WDWA 4JN6A 4JFWA 2J77A 5LA2A 1J5SA 4H9YA 3V3WA 3CZ8A 4Z1CA 4C6JA 4PFHA 4L4OA 3VIGA 3L5MA 4MZYA 3EX3A 2Y5JA 4RXGA 1RLDA 4AHPA 3LX9A 1IT0A 5D32A 4XZHA 1W3TA 1LT8A 1J12A 2VWSA 1PS9A 1XI3A 1P0KA 4PBFA 1JDEA 3RLUA 4QIUA 4KESA 3WYZA 1FWJC 1TR9A 3TCSA 1VFMA 1IZJA 3N04A 1RVKA 1C91A 3QPZA 1PIFA 2WAGA 2O92A 1QNRA 4AMCA 3LBOA 5M03A 1TA3B 3CU2A 1W1A1 5RUBA 1NH6A 3KP1A 4OVXA 4KKXA 1UD4A 4DO7A 1NQKA 2EKGA 1RJRA 4JDYA 4XZLX 4M1BA 3RMJA 2AL1A 1GG1A 4MADA 3UZYA 1HQTA 4Q4SA 3RCNA 1GHSA 4E0CA 1H61A 4J7RA 2F61A 2E0PA 1JGIA 3VOHA 4D1JA 2ACSA 2DV0A 3SI9A 2VX5A 3G3MA 1KQZA 2B7NA 2XH7A 2JBMA 5HR7A 1F5ZA 3EXSA 1KBBA 4QSHA 4RL3A 3KCLA 3VDHA 4HHMA 4EXQA 2FJKA 4IZGA 1CX9A 3SZ8A 1H7PA 4F0SA 1DJHA 2CLLA 4MHBA 3L4UA 3LYEA 2W91A 3WQ5A 5IFTA 1LM1A 1TTJA 1QBBA 4LY8A 1YYAA 1HT6A 1ME9A 4EP8C 1PJ9A 1QNPA 4O16A 1FP8A 4KGLA 5A8OA 4LVBA 1K9EA 1J0IA 5HQMA 5IOBA 3MC5A 2YCIX 4C6CA 4OV4A 2D24A 3SQMA 2ATSA 3THQA 5CXPA 3OVRA 4A21A 4JTLA 3S6OA 2GQ8A 3LI0A 4U4MA 3TROA 4MY9A 1ITQA 3EA3A 4UWMA 5CZSA 1G7VA 2TPSA 1HGYA 3D3AA 5REQB 2DP3A 4B5XA 5C9ZA 3EPNA 1CXKA 4M6PA 3TA9A 3VMPA 3TFXA 3EPOA 1RCXB 4OZOA 3V5CA 1GW1A 4B3KA 3TONA 1XUUA 1J18A 3F03K 3NYDA 4GUGA 1CTNA 1TRIA 4JIQA 3LGGA 2V2DA 4DM2A 1OSEA 4IIDA 1YPXA 1BXBA 5CPTA 2YYTA 3GD6A 3OODA 3CB8A 4PCSA 2QCDB 3EYPA 2WHMA 1ZCCA 1IV8A 2PWVA 1IGWA 1IZKA 4IMCA 4K7YA 4QJ5B 3SRHA 2G3FA 5FEXA 3W00A 5MF5A 2QAPA 1E0WA 2XTKA 2VP8A 4H7ZA 4KW2A 2Q8ZA 3UYIA 2DH2A 1G4EA 1R2SA 5C55A 3M7WA 4QNEA 4CNPA 3KLKA 5D09A 2E25A 1M7XA 3NYZA 3BAXA 4X2PA 3OOQA 3T4CA 3W70A 2OCZA 2VZOA 2ZRXA 3BLKA 2V5DA 1UZHA 4MVAA 4DJFD 1Q6QA 3FYYA 4J3ZA 3VIKA 2V5LA 4Z0JA 2NXGA 1PKLA 3DHDA 3RAOA 5HANA 4QEEA 4NILA 1XLGA 2X41A 4PTNA 5HWMA 1LLZA 2ZCGA 3KZPA 4EPDC 1DIOA 3CUGA 3AHXA 4KIEA 4N9DA 1WDSA 1L8NA 1TRDA 1DBTA 1TFVA 1LOQA 3QZAA 4AHQA 3Q37A 4I7VA 4XSMA 2ZZ5A 4GCXA 1JDAA 5TAOA 4X0NA 5A8GA 4CLMA 1KV5A 3GX9A 3S0CA 4P8VA 4MB4A 3M47A 2XYLA 4YU1A 2RDWA 4Q8MA 1SZEA 5LZLA 2GGGA 3ZLGA 1NF7A 4HYVA 1NARA 3MV01 5HR6A 5AZ0A 5HQEA 1CGUA 4ACYA 4LVDA 3L66A 2XFFA 3BQ5A 3U5YA 4LU0A 4A2RA 1FDZA 4ZOCA 3LCXA 1GYMA 3G1RA 3WJSA 2YCJA 3L12A 2WV8A 1V0NA 4HVXA 3F4VA 5FCZA 1I0BA 3CUZA 2PF8A 2FDSA 2B4GA 2O0TA 4POCA 1K6AA 4FNSA 3A22A 2ISVA 4GQGA 2I7GA 1JRCA 3VMNA 3L5AA 3PS7A 2WSYA 1TX2A 2WVVA 1KV8A 4FX7A 4INFA 1VFLA 2WHJA 3GH4A 1N7KA 4YHEA 1L2UA 3BLFA 3LM7A 4B5TA 5DY2A 3C0QA 4CD6A 1KD0A 1W6TA 3KRSA 5JXQA 4V1XA 2OSWA 1XPGA 3WDJA 2OT1A 2F6XA 2PTXA 5EMYA 3IGXA 1AQMA 2ZUMA 1TVNA 1XYCA 1O68A 3WQGA 3RM9A 2J4GA 1JAKA 3ATZA 1M41A 5BRQA 4HA0A 1XLHA 3B3DA 2FVLA 1DJXA 1K02A 2GJRA 4WKAA 1BSIA 4ZE5A 2PWDA 3DHUA 3CV7A 3UG5A 4C1NB 1FFRA 3IGHX 4RR4A 2EAWA 1UWIA 4Z2KA 2OXNA 2E40A 5HNNA 2V5KA 4WY0F 1DJQA 3EKGA 3ZS4A 4CQ8A 2FQIA 1QW7A 2WPBA 3Q67A 4AW7A 1I2NA 5CZJA 2HVOA 1TWDA 2O9OA 3LHUA 1G5AA 3QMTA 1F6KA 1T7LA 3H2OA 3WLSA 1CDGA 3W6LA 3U48A 1WKYA 3LMYA 3VINA 2GWGA 3UPWA 3VNLA 1N55A 1B3WA 1PPIA 3DCPA 3WELA 3KXQA 2VZTA 1L6GA 1VYPX 1HW6A 4ZXOA 2ONEA 1X6UA 1E9LA 4P2VA 3BICA 5CPSA 4AZBA 4C60A 1R3RA 1MXGA 3S2JA 3OBKA 1FWBC 1VYSX 4L6OA 1KLYA 3VKJA 4J4KA 3HBLA 2VDGA 4ML9A 3W22A 1KCXA 3BOFA 2IQDA 3TWAA 3VD7A 1TO3A 3CJPA 1OZMA 1GVQA 4AZ6A 4MAVA 3VIJA 1W5QA 2WQDA 1OYBA 3GG1A 2X05A 3NSNA 3C2OA 2Y1HA 2QCLA 4B5VA 1Y8BA 4HYRA 4AIEA 4P8XA 1EO7A 5CPNA 3W23A 3MPGA 1WAUA 4O28A 4GYKA 2WNQA 3NA8A 4U2ZA 4G56A 4OJYA 1XR2A 1YXCA 3M16A 3DZ1A 5CPMA 3HTWA 5FF2A 1FRBA 2PDMA 3KRZA 4DELA 1F8MA 1KLZA 1QNOA 5JH2A 1AK5A 2PCQA 1S5WA 1OFQA 3HPZA 3JUGA 4W7UA 3FJ4A 3CQ0A 4HMCA 4NXSA 1B31A 4ATLA 2J25A 1H51A 3AZTA 3I6TA 3W7RA 4JICA 3A5VA 1ELSA 3UF9A 2OZ8A 1V7YA 1W1IE 1KKOA 1UJQA 1JAEA 3UPBA 5XINA 3T42A 2OLAA 3MUZ1 1LWHA 2CBJA 2JK2A 1OC6A 3OO2A 4NQ1A 2PDWA 1Z9AA 1CXLA 4OBRA 4OGZA 1W8GA 3KVKA 4CQCA 1VFFA 4DZAA 2FFCA 3TLQA 3OA5A 1ONXA 4KFPA 2PRMA 2I17A 1F6YA 4XD5A 1OYAA 1X98A 4WDUA 4Q8TA 1JI2A 3W2KA 1HTIA 1BRLA 1ZZMA 3URAA 1HKMA 3CLMA 3IWPA 2A1YA 2WSKA 1UR0A 2VJXA 1E6SM 4S3GA 3K30A 4PMVA 4I3GA 2XJ7A 4Q8UA 3UR7A 1OWQA 3PSWA 1MQRA 3RX2A 4F0KA 2I9UA 1R3QA 3T0DA 4F4RA 2Z2BA 2G97A 4QS5A 3CYJA 3SCPA 3MW7A 3S1XA 2XUCA 5F1UA 4RE2A 5AHIA 3SUWA 1NIUA 2PLKA 4LALA 4AZCB 1UZ1A 4YCPA 1WZKA 3OLDA 4H9ZA 1NOWA 3QPYA 3SW6A 9RUBA 3OLIA 1BYCA 1TWSA 3SBFA 4JN8A 1SMAA 4ACZB 4OOZA 4DXXA 2A79A 3NOYA 1OF8A 1V8EA 2VZVA 3QR1A 1JGMA 4C6NA 3HJEA 3GNNA 1VH7A 4C1KA 3W07A 3P3BA 3SUUA 4A8IA 2VOTA 1EB3A 4H6EA 1A53A 1R30A 3QGAC 4IJRA 3THUA 1PDZA 4U33A 1J11A 3GHUA 1KB3A 3WMCA 4JY9A 1ISYA 4YTRA 1ZJAA 3QVQA 2OPJA 1UOKA 4EWND 3G0XA 1Q6FA 5HJLA 5HMFA 3SCTA 2G4JA 4D6HA 1CENA 4NVTA 3GXMA 3WK0A 1SO5A 3UWVA 2VHLA 2Q02A 1YE4A 4IQDA 3QH2A 4JHOA 4EF9A 1ODUA 4AD2A 3VYLA 1SJCA 3WBWA 3WG6A 4O57A 2ALRA 4DM1A 5D9NA 1XLLA 3LOTA 4DN1A 3A4JA 4RDWA 4AAJA 4ZMGA 1ME7A 2C16A 4M6QA 3FNDA 4XWUA 1L2QA 3OIHA 4AWSA 3VUSA 4DBUA 4NZ1A 5G2WA 1R9YA 4K8HA 4N4QA 4QBXA 1CXEA 1L9WA 1PO9A 1EFZA 5ENLA 4GUHA 2OEKA 3A9BA 3KS6A 5PTDA 3KBVA 2D2OA 4WDXA 1G4PA 1VIWA 1XGEA 1YIXA 4QJ1A 3F2DA 1UC4A 2OO0A 3GFYA 2YBTA 1YTDA 5CEWA 4N9CA 4YTUA 3QZ6A 2OGYA 3B03A 3GR4A 4JPGA 4B90A 3G5EA 1EC7A 4UZSA 3NR0A 3RMEA 4RPPA 1UUMA 5B7YA 5K7JA 4L9XA 2JEPA 2VUNA 4FMVA 5FF0A 3N4FA 2J79A 4P8UA 4CD8A 2PLMA 3GH7A 2NV9A 4J3WA 2Z2UA 3SN4A 3QF0A 1M3UA 1XXXA 1FCBA 2NLYA 1EJXC 3UXLA 2OKOA 4JTRA 1JVNA 2ZVIA 1BSLA 3LPGA 2AKZA 1H41A 3BW4A 1T6MA 2FVMA 3B04A 4CUCA 2UY3A 3VU2A 5F2IA 2ICSA 3TN6A 4D6EA 1GEQA 1A3WA 3LSBA 1SFSA 3OGSA 2IS7A 3RO8A 1OADA 1JD7A 5H2ZA 1XX1A 1VRDA 3QC3A 3T7VA 2V8ZA 3WUBA 4J27A 2V9DA 4LAKA 5DCDA 1YE6A 2ZZ1A 1JXKA 3SGZA 3T9PA 4MB1A 1B9BA 3R94A 2DGAA 3KVMA 2AMGA 3K5XA 4FR6A 3WL1A 1JDCA 4B2DD 1QHPA 3CHVA 2OOFA 2DZVA 4CCZA 4WUIA 1S1PA 2JIWA 3GUGA 2V2HA 3ISIX 3ENLA 3WX7A 1M04A 1MNZA 3VOCA 1NWTA 4ICMA 1U30A 1FH7A 3I4KA 4NAFA 2D0GA 5DT7A 1FY6A 5I02A 2RFGA 1E6ZA 4C5YA 4GYFA 2CKSA 1V6VA 5LIYX 1C90A 4JTTA 1OB0A 2EG8A 2PU1A 3GTNA 2GJXA 1V5XA 5AC5A 3DGRA 1JF5A 4REQB 4LUTB 4JD4A 1OM0A 1V0KA 2YB4A 2HS8A 2V69A 1AVAA 2R1LA 2FLIA 3KTCA 1E1EA 2H9AA 1LYXA 2YIHA 2E09A 5A8PA 2POTA 3PTMA 2C14A 2ZICA 3UJEA 3ZIZA 3WBXA 1MW2A 5E0FA 3HGSA 3KBJA 3KCOA 2P0OA 4L4MA 1NSJA 4Z1YA 3POHA 3EKLA 4L6HA 1RQBA 4Q8WA 2PDUA 3CPRA 1Q85A 4PR4A 5HNRA 3ZLHA 1EBGA 3NQ8A 1VFSA 4KWWA 1OBAA 4O8RA 4IQEA 5C7HA 3GDKA 2IQ0A 4W5ZA 3BGAA 2BY1A 3RM4A 2OLSA 5HPCA 3QV9A 3CNYA 3SFWA 3ES8A 2VNCA 2OZ3A 1P0DA 3VXGA 1DE6A 1TV2A 4HCHA 1MW0A 4RNFA 2WWDA 4MNKA 3LHTA 4YWSA 2PC4A 1JQVA 3WNMA 4M81A 1AMKA 4DF1A 2ZQ0A 4Y96A 1OFEA 3S5ZA 2E4TA 3TEVA 4MWAC 2PRHA 1JCNA 1KFKA 1OFBA 3MZNA 4JOMA 3PAJA 5KZDA 4H7CA 4N6FA 3DI0A 1R9XA 1WUFA 1YDOA 2EO7A 1V93A 1AW1A 4KWSA 1KGXA 4Y6GA 2J78A 1P1MA 3QTGA 1K70A 3B9DA 2OSYA 1EOKA 3GZ3A 1DKWA 4GI4A 3CYVA 3E2SA 3W37A 3TU9A 1DIDA 3MSRA 5LA0A 2PDJA 4JNZA 1JZ5A 3IRSA 3G3DA 3I6EA 2FZ9A 1K7EA 2NQJA 2RGLA 1O4UA 2XWDA 2PAJA 4MY8A 7XIMA 2FHFA 5AHEA 3KL3A 1W3IA 4KFOA 1FX6A 3VCRA 1CLVA 3CUJA 1PBGA 2FGZA 1MDLA 1TUXA 2E67A 4ZOAA 5LNVA 2GGIA 2NVDA 1RQHA 3S5SA 4OOUA 3N3MA 1TV4A 4J3TA 2HEJA 3LA4A 4JTIA 1XLFA 3BG9A 1KBJA 1TPFA 4QE4A 4Q8PA 4PFMA 5D2YA 3B8DA 3QR0A 3ZOAA 1QMLA 2PCEA 3WQEA 1AD4A 4JR5A 5K9XA 3TXVA 1QNQA 4D6GA 4QS6A 2PGWA 2QF8A 4GQRA 1W91A 2NX3A 3CZGA 3WFLA 5LNUA 3W38A 2HS6A 3CUIA 2ABBA 2D20A 2F6UA 3TQPA 4LBSA 1E40A 3D0CA 3NQ7A 1D2KA 4R9OA 5E6YA 3W2JA 3PZUA 4DBEA 1TSIA 5AKQA 3DHPA 1JCXA 5C8BB 3W1PA 1O94A 1EWEA 1Z8AA 1IIHA 3UETA 8CGTA 1GVSA 1YPFA 3K46A 2VX7A 4F0MA 1RH9A 5HMDA 2WMGA 1BQCA 3LRLA 3MHUA 3CPUA 4MLRA 1E6NA 3VE9A 1KBIA 3T05A 5BW6A 1AJZA 3L2LA 4UCGA 4AISA 4GNKB 3BSGA 4RPQA 2ZIDA 2ZUUA 3ONCA 3L68A 2ZOXA 5D03A 3WQFA 1OGSA 3W81A 3M41A 5BWFA 4DYEA 4I8DA 3W7QA 3W7CA 4GXPA 5T26A 1W9UA 1FWDC 4RXFA 4UUIA 3D6NA 2YPIA 1F7BA 5DMYA 3L65A 3QHNA 3W6YA 2RAGA 1CLXA 2WSQA 2FTPA 3BWWA 3DUGA 1E5JA 3QW3A 2IKGA 1MFUA 1WKFA 3VX0A 5DRIA 1YPIA 1SJBA 1H1ZA 2AGTA 1VQTA 4UCFA 5CSUA 1H63A 3C86A 4GXWA 3TX9A 4XX6A 3CS2A 4EANA 3LHZA 3I6RA 3LPFA 3W25A 1K1DA 2CESA 3NPUA 1SW0A 2L5HA 4FSAA 3MZ2A 2CXGA 3WNLA 3ZYZA 2ZX8A 1B2YA 3NM3A 5LHFA 3VK5A 1O5QA 3PZGA 3FGCA 4PBEA 1V6WA 3SECA 1XHGA 4PEEA 2GVJA 7TIMA 3L0NA 2WHLA 1EZWA 5CG0A 4WKFA 3UG3A 3ZVHA 2DZTA 3CHEA 4ZO8A 1X6NA 3LPOA 4DYJA 2EPMX 2E6FA 3ONBA 1D7FA 5EY5A 3UERA 5IFPA 2CLOA 3E38A 1JNDA 3EXRA 2R24A 1ISWA 1H7NA 5E6ZA 3ZQ9A 3T55A 2WMHA 4PRRA 3IIZA 4PZVA 4DJFC 3LG3A 2FHCA 3GS6A 1G0CA 2XH2A 2QUNA 3SURA 3H6OA 4A8RA 2FDMA 3M5YA 4QDMA 4H2CA 3I10A 2A6NA 4OWGA 2WVVB 3L4TA 3A13A 4DWSD 4GUIA 1O1ZA 2FVKA 4Q4PA 2BXYA 1UD6A 4JTQA 4HP5A 4CN1A 2DDXA 5TD4A 2QNEA 2C6QA 1XC6A 1F9CA 2DUZA 1DHPA 2NVAA 2EJAA 3DHFA 3EX2A 3K13A 4O52A 5HDRA 2BWGA 3PZQA 4MB5A 5CAHA 3S2NA 3UQNA 1JD9A 3WL0A 4UR7A 3GYEA 4NRSA 2YGYA 3RX3A 3F4NA 3R43A 1E6QM 3H54A 4TVCA 2VWTA 1K4HA 4FI4A 3WBYA 1BWLA 4NI3A 1PYFA 4HPNA 3M5VA 1EO5A 2I5QA 3HG2A 1W5MA 3TTYA 3DH7A 3WFAA 3TAKA 1E9YB 2E7FA 2OEJA 3HM7A 4A3QA 4ZFCA 3KOYA 4C6MA 1KFJA 1GZJA 4LQ1A 1IHIA 1PZ2A 3V0TA 4GQQA 2Y7EA 3FIGA 3BLDA 4LPCA 4YHGA 3WQ4A 3VIFA 1OCQA 4HZMA 4JS3A 3B40A 2E6YA 5I2UA 4WCJA 1ZNNA 2WZMA 4ZCWA 4YCOA 3BAJA 1D9EA 3RJYA 1XKJA 4QDPA 2QIIA 2D2JA 4N42A 4O4WA 5CSYA 4JTUA 1RP9A 2W79A 3VUPA 1BG4A 1CGYA 2A5HA 1JPMA 2NUXA 4ADUA 4R34A 3KBSA 3DENA 3GBEA 1V51A 4Y7EA 1ZBWA 3KDNA 3W9ZA 4IFKA 4FB7A 1XRVA 1Q6GA 1XYLA 1WXYA 1EEXA 4HHLA 2WK2A 4IPPA 2C1IA 1UWRA 4JEQA 1V3MA 4LCSA 3LSCA 1DJZA 1J2BA 3E6EA 3LY0A 4KEZA 3W72A 2W67A 2ZWYA 3DDMA 3APTA 2NZLA 3UXIA 3WLLA 1F8IA 3SDOA 3HPFA 1PSCA 4GJ1A 4UFMA 2GSEA 3CWHA 2GGJA 4RNHA 4UQ9A 1FWEC 3VGHA 4RNIA 1A3HA 4D8AA 4G7FA 2WMIA 3UYCA 1VB9A 4F48A 2ACUA 3FA4A 4M0XA 2O4MA 1H49A 5CLTA 5JVLA 3M5ZA 2NV2A 5A6MA 1K8ZA 1LQ2A 2VI0A 4WVXA 1K8CA 2C3ZA 1MUMA 1TPWA 1UWTA 2ZUSA 2ZVRA 3ZWTA 1RPXA 1E4NA 3JZEA 3QN3A 4C7FA 1DWHM 2Z1VA 4D8ZA 3A4WA 2NSOA 4HU0A 4LJ3A 2HBVA 1TPH1 3H2CA 1RZMA 4EOUA 1GPFA 1LBLA 3W2NA 2Z1KA 4AWTA 2AQWA 2YKKA 3W01A 4UTMA 2VC9A 2ISWA 4FXRA 2ZC8A 2CNCA 5KEZA 1W3KA 3WD2A 7ODCA 2UBPC 4FLSA 1VCGA 1JXJA 1RBLA 3W7IA 3C2RA 3U8GA 1PX8A 2IUZA 3PBGA 1MDRA 3BOXA 1TJPA 4CQ9A 1BRLB 2HK1A 1EZ2A 4K6AA 5I0DA 4UMBA 2D22A 4HPJA 2TODA 3USBA 1EA0A 3LLDA 4IP5A 3AIRA 3CAVA 1HP5A 3THDA 4FNQA 4JCMA 1JPDX 4QG8A 3PZOA 4QP0A 3GQYA 4YL2A 3RK8A 3KP0A 4D6CA 2QS8A 1TVPA 2J75A 3AMGA 4BWLC 4M1RA 3AAMA 3U4AA 1ALDA 2E6DA 3WZ0E 1GZGA 1KGUA 2DZUA 1KM2A 2GLKA 3PJWA 4FXSA 3N18A 1RBOB 3BLIA 4JYFA 3IIVA 2INEA 3EWXA 1DXEA 3OVQA 3M43A 4I5UA 2CC0A 1XH0A 3G77A 1LL6A 5A8NA 1X1NA 2PWFA 4RLIA 2R1NA 4M7SA 4PUNA 3QKZA 1HP4A 1UP3A 4WR3A 2VVNA 1SFTA 1B4EA 3A3WA 2G5WA 4WX2A 2CW6A 3W0KA 4UFLA 4JCLA 2WMFA 3TTQA 1OFRA 3W6MA 1WDPA 2AKMA 2X7WA 3QBUA 1K8XA 1Q6CA 4PBGA 3THAA 2X2YA 5AY7A 1EXBA 4US5D 5IRPA 2TRSA 3BMVA 3MMUA 5FJIA 5LA1A 5E0CA 3CPGA 4JN7A 3TJLA 1KRBC 4UMAA 3LEPA 3LXCA 5CGQA 2F7FA 4J3XA 1A80A 1U1UA 2PZNA 2DORA 3NL2A 4MKNA 4LUIA 1FKWA 4AD1A 2J24A 1Q7ZA 3RCMA 3UWQA 3LMZA 2D3LA 4MJMA 3WFZA 4NZ4A 3SCVA 1H62A 3S1UA 1P48A 2GJLA 2RDXA 4DLFA 3VA8A 4J40A 3MVIA 3RDKA 1EKOA 2BY3A 5G1YA 4GXMA 3TKFA 2CLMA 4O1BA 4L9YA 3L0KA 4IGNA 2OGJA 1E72M 3CEUA 1B4KA 3QSTA 3F4CA 1S5VA 4PMRA 3U6WA 2PPGA 3PG9A 1IZCA 4QLJA 3TTOA 5D4YA 5EFFA 3IUHA 4NSBA 5M2FX 2A21A 2GQ3A 1DJWA 3HU7A 4QGCA 3MS8A 4QSFA 3RFAA 3GZAA 5FAJA 1POKA 4LWWA 4PGLA 3RF9A 1A5AA 1CLKA 1XLMA 1NFGA 4RV3A 3I3BA 2BMBA 1TTPA 2ZDSA 2V38A 5BU6A 1WXZA 2PTYA 5EU9A 5DEZA 4U3CA 3QQWA 1YBQA 3E74A 3IIXA 2OEMA 1OK4A 1FQ0A 3UWUA 1GQNA 3T2OA 1XIFA 5GQBA 4RZBA 3S1GA 1W5NA 3CMJA 4PUJA 3DYOA 2CU0A 4GFSA 1PX4A 3E96A 3EX6A 2TAAA 3PBMA 1JL8A 2XIBA 2FZ8A 4U31A 3G0UA 4KRZA 5J8LA 5FIPA 3WD1A 3ARPA 4DBDA 4F2UA 5KTLA 3QYSA 4NKCA 3UR2A 5FJRA 3QY7A 3NL6A 2QHAA 3CAKA 1JI1A 4HU3A 1QTWA 3MTWA 1CXHA 3BG5A 4DZ5A 2J8TA 1JRBA 3EMZA 4WJEA 4AWUA 2WYSA 1TPUA 3K8LA 4PTMA 1FVPA 2C91A 4NAFB 1KTCA 4KETA 2YA2A 2ZC1A 1DWFM 5CBJA 4CVUA 2ZUNA 4JTKA 2XHYA 1C8XA 6REQB 2HE8A 2WC4A 1W31A 2GJXB 4ZVJA 3GU1A 4M5PA 1G9HA 4GABA 1EUAA 3AICA 1P0BA 3H24A 1K9TA 5D9PA 5D38A 2D1ZA 1M53A 1AQ0A 1V0MA 2IMRA 1CGXA 1VR6A 1VFTA 2YW3A 3R12A 1Q8JA 1Y5WA 4MWAA 4N02A 1DP0A 3IJ8A 4OE7A 4B91A 1UKPA 2H9AB 4AB4A 4C1LA 4X9YA 3GR8A 1UA3A 4Z1DA 4AH7A 1R85A 2UZ9A 4JTSA 1VAHA 1WBHA 2HNEA 1QR7A 4M6UA 2B81A 1TE6A 1DJNA 2XH0A 4UQCA 4DY1A 1UC5A 2QXWA 2HSAA 1S5NA 2JALA 3KOZA 3REQA 2VX6A 4IUGA 2VT0A 5AOUA 1G67A 1AL8A 2B0MA 3N9KA 3M1ZA 4PMOA 4H9MA 4P61A 4OU1A 2KZHA 1VLIA 3G24A 1UKOA 4LH8A 2PBOA 1DORA 3TOYA 1AH0A 8XIMA 2OU4A 1Q2SA 1B3OA 3OHMB 4ZOBA 5DMNA 3CIXA 3APGA 3W7PA 3IJ7A 3CBWA 3DG6A 1NEYA 2A85A 4Q32A 4GX8A 3EOEA 1AW2A 3WH5A 5EA9A 3RCYA 4AQLA 2ISDA 3H4XA 1OF6A 3LLFA 1W8SA 2PD5A 2QULA 4P5UA 4OKDA 3PN8A 5IDIA 2Y0FA 1TIMA 3BLOA 2J9ZA 3DAQA 1UWQA 2ZKMX 1P6WA 3MSYA 3LZ5A 1GQJA 1ZJHA 3D46A 3N15A 3N9SA 1UG6A 2XVKA 1C3FA 3W7JA 3B8WA 3DYMA 4Q8QA 5D2TA 4RX0A 1HUVA 2OX4A 2P0IA 1FWWA 3KUMA 5HINA 4HOWA 4NJKA 2CZFA 5AHLA 3BJSA 3EMQA 3S2CA 1Z32X 3WNPA 3L4VA 4JY8A 3NNTA 4PC8A 5LGZA 3TV8A 4NJIA 2V2CA 5HXMA 4LC6A 2IW0A 2OODA 2VENA 4XB3A 3L4XA 1TZZA 2G95A 3P62A 4NX0A 3WSUA 4DNHA 3T81A 2JQXA 1GT8A 3VM5A 4PH6A 2BP1A 2GVLA 4EAYA 1KWKA 1GJPA 3G1VA 4HT3A 1EOMA 3GLCA 3L4YA 5FF4A 3PZNA 1CW2A 1XQKA 3AUOA 1ZENA 1BKHA 4AC1X 4MMWA 2EG7A 4GY1A 3UESA 2J7GA 3CUFA 4DF0A 5DFAA 5ECUA 3I7QA 2CBIA 2PWHA 4FX8A 2OO6A 1F05A 4AIUA 2QCNA 1R46A 1D7KA 1JPIA 3EOSA 3GC5A 3CO8A 4ZGYA 4P7RA 3ZWSA 2Z00A 3W85A 1GTHA 4GGHA 2F2KA 2ZA1A 4GYPC 1BXNA 5JH1A 2QGYA 2NLIA 3QHMA 1EDGA 2R9RA 1YNPA 1CPUA 4IL2A 3PPHA 4JBRA 2VFDA 2HPIA 4TIMA 3ZZ1A 5C9XA 5M3WA 1TPDA 1J79A 2OMAA 4C5ZA 4Q8OA 3B9OA 4KBXA 3OVGA 4G6CA 3VIMA 4LSBA 2NWSA 2Y62A 4JFSA 3AXHA 4FOUA 3MUIA 3TW6A 2QPUA 1RA5A 1GYLA 4LANA 4LYRA 3SUTA 3WDRA 4GD0A 3QRHA 1NWSA 1GYNA 1HKJA 5I79A 3TN3A 3NG3A 2OYMA 3OEXA 1EGZA 3UEQA 4G2DA 4DJFA 4PUEA 4CNUA 1U22A 3BL3A 3PAOA 1KA9F 3LXAA 2ZADA 4XTIA 1JJKA 3NL3A 1LP6A 1XPYA 1US3A 2UY5A 3HB9A 4TX8A 4Z2JA 4UTJA 1SPQA 1V6XA 4EACA 1ECEA 5K9CA 1IGSA 3IACA 3R13A 1X8FA 4C90A 3VIIA 4GVIA 1Y0EA 2VELA 3NEHA 4UFIA 2DY3A 4Y8EA 5DBTA 3TE9A 4GNJA 1A49A 2XWEA 4Z2LA 3WDQA 2VO5A 4CCEA 3E49A 1FHDA 1BQGA 2XU2A 3ZVHB 5J5DA 4BEUA 5FJTA 2VXNA 4AIOA 4NI8A 2XIIA 2PFHA 3DU0A 5F2LA 3GDMA 3CHDA 5CJMA 3ANVA 2HK0A 3SRFA 3N25A 3RU8X 1E51A 3BVJA 3BAWA 2EGZA 1EA9C 2VEFA 3NSMA 1GVYA 1H50A 2QCHA 5A6JA 3GXDA 5C2XA 3QQ0A 3A64A 3FSTA 4U5KA 3KAOA 3IRDA 1OCNA 3KLLA 2IPGA 2VEIA 3QSRA 3ZT7A 1EYWA 4UNKA 3VKBA 2Y89A 3VKCA 1W1PA 2QZRA 5I3IA 3RRAA 4DUOA 4LEQA 3S5YA 1XLEA 4Z42C 3RR1A 2PI6A 4ZSTA 3WO8A 2CLKA 1I60A 5EMMA 4D71A 2HBXA 3BMXA 3WNNA 4RCXA 2Q3OA 2UY2A 1UUQA 2OYKA 2F84A 5I5RA 3KEHA 3TVAA 2X1TA 3CQIA 1XIMA 4TX6A 3TN4A 5B7ZA 3MI6A 1IEWA 3HV9A 4QQUA 4KT2A 1JQXA 2PODA 1LL7A 1PYMA 4L7ZA 3E9AA 1YHTA 1XSJA 3TDFA 4I7WA 4RE3A 1B54A 3U3HA 4AEFA 1LOLA 4MB3A 3OBAA 1H7RA 2H3DA 1OABA 1VPQA 3AXIA 3C8FA 3HMJG 3WIJA 5U7SA 1E71M 3DBPA 1S2VA 1H60A 3MJMA 5F4WA 4DWSC 5M5DA 4UQDA 4AX7A 3AXKA 3WQPA 3FFSA 5BNKA 1PZ0A 1TCDA 4C7GA 3QXBA 4NYYA 4LUSA 2Y7FA 3MO7A 3QY8A 2CZ5A 2X0SA 3AHZA 4FZIA 2YB1A 3ARRA 3VD4A 3KOFA 1WNOA 4D8LA 1FTXA 3VNJA 4RK8A 4QDWA 2XN1A 2FZNA 3NZQA 4M6VA 1VYRA 3WEZA 1KRMA 2ZRYA 2Y7GA 1WYIA 4F2BA 3A23A 3O3RA 4IFKB 4I9JA 1S5MA 2QUTA 1NFBA 5FF3A 4BF5A 4E8GA 2E5CA 2VOMA 3MA8A 1HNYA 1MMFA 1RR2A 1ZY9A 1FDJA 4GKLA 3AIQA 3HPAA 2VKZG 3IJQA 2Y70A 1OX5A 3FJNA 2QVHA 2JGQA 3LD5A 4Q22A 4GZ7A 4LB3A 1QOQA 1HGWA 4TVUA 3GB6A 2ZXQA 3L67A 5C6MA 2PDLA 1VJSA 1ADSA 1ZTVA 1FHUA 3EWCA 2WMIB 3GNOA 1HKKA 1NDZA 4CU8A 3B06A 3TQ0A 3EB2A 1AD1A 5G4EA 4ZEPA 3QTPA 1HO4A 1JYVA 1IEXA 3SIZA 4TV5A 3WD0A 3S9ZA 5JIWA 4K38A 4UQAA 3W75A 1VJZA 3IVSA 3TN5A 3PZIA 3MBFA 2O9TA 3LN3A 5KZEA 4ZQPA 2ZWZA 3SFKA 4GFIA 1TPEA 1ITCA 1ZP3A 4XUGA 1JYWA 5BXPA 1PL9A 1NTHA 1XG3A 1VEMA 4BWLA 1R6WA 4YTQA 2OT0A 4AFYA 1XC4A 1Y5XA 3M4HA 4FK9A 3KWSA 1B3VA 3KHJA 3R11A 4QROA 4WD0A 3MSGA 2DZBA 2PDFA 2W5FA 3TJ4A 3ITTA 1J93A 3A3HA 5C9RA 4CN6A 1XCXA 3OG2A 1GOIA 3RN6A 4Z1AA 1AL7A 2FYMA 1EJTC 2Y6ZA 4LS1A 4M56A 3W1UA 2HRWA 1KXHA 3IGUA 1V4YA 2VEMA 2XIJA 3G1DA 3VC6A 3T1GA 2VGIA 5I3HA 3PPCA 1VIZA 2XDFA 5EGRA 2Y24A 1BYAA 3SQSA 1OIFA 2NV1A 4MF4A 4PCPA 3O0FA 3KM8A 3QJAA 1XYMA 3GNDA 1V3HA 2WWCA 3QMRA 1ME8A 4QFUA 2DT0A 4HGXA 2O7QA 1K8YA 1WZMA 3VD3A 2WC3A 1XINA 3OZMA 2GDQA 4ZO7A 4PTDA 3MKCA 1O1HA 1K77A 4H8HA 1LORA 2P3EA 4UTTC 3UT0A 2GFTA 4MWAE 3VOFA 1I1WA 3SUSA 2ZYFA 1TJ1A 3W7HA 4MDPA 3WLOA 4RDVA 5H8MA 2HXTA 2XSXA 2WXDM 5TIMA 4CEXC 4DHGA 3BAIA 3KWXA 2OELA 3N11A 2BBFA 3N1AA 2BGQA 1X96A 4DUXA 1MFVA 3TUUA 3DFHA 1U33A 2FTYA 3NVTA 1UA7A 4QE1A 3WK2A 3FXYA 4S38A 5A6AA 4W7WA 2QYGA 3EOUA 3RIKA 4Q33A 5F2MA 3ZSSA 3C5QA 1RV8A 4QM1A 2WHKA 4W84A 3V1PA 1CB2A 1WOAA 3F2CA 1E4IA 1YEYA 3HGRA 2ZXAA 2PGRA 3VABA 4OTKA 5KZ6A 1LQAA 4Y2WA 2QV5A 3W26A 3MHFA 3NQAA 1WXJA 2ZX9A 5GJPA 1ZU8A 3WD4A 5BMWA 3DFYA 3WCZA 4HIBA 4MUPA 5AYYA 3I7RA 3E0FA 5DRCA 4W5UA 3DKJA 4TR9A 1V6TA 4U3AA 5DXYA 1AA1B 1GUVA 1QJWA 2VCAA 2YXOA 1MQQA 3BARA 3MMWA 2V5BA 2VFFA 4B92A 3HMCA 5C7VA 1L6YA 4DO4A 3GH5A 3LU2A 2PDGA 3ITLA 3GTIA 1BVNP 2YBUA 4HA1A 3PWAA 3WUFA 4AY7A 1Z69A 4LVAA 2GVEA 1POJA 5DF0A 1H11A 3OLGA 4A05A 3TQKA 4CQDA 2EF9A 4EPBC 4O11A 1ZBCA 5FJOA 1TTIA 4OECA 1VLWA 4BF9A 4ERAA 4O19A 3QLDA 1VEOA 3VO0A 2OQHA 2HJPA 4B5SA 2C13A 2CHOA 2QUUA 3GE7A 1GORA 1DTUA 4C6IA 5I06A 4I5XA 4FR1A 4C91A 1J8VA 3WMLA 2X42A 3IJIA 3CUHA 1B30A 2DZAA 3M7SA 1LG1A 2E9BA 3MDUA 3BO9A 3C52A 1GG0A 3LBMA 3NQGA 1M7JA 4GZEA 3G1AA 4OQVA 3UWWA 4JNMA 4P7QA 5A6KA 4C6BA 4MOZA 1AQHA 3ZJ8A 9XIAA 4FALA 3APYA 2NT1A 3PJTA 4Z2IA 1ICPA 5EL1A 3GNXA 4G5DA 3W1LA 2POZA 1E9IA 3M6YA 2VR2A 1I75A 4LV4A 1GVOA 3W1MA 2P1FA 3SCSA 1S3TC 1XYBA 2VEKA 4L1WA 4L9ZA 2E3ZA 1VFOA 1E4LA 4JIRA 5C5YA 2GVGA 1RBAA 3GM8A 4AF0A 1OJXA 1F4AA 3M0YA 3R25A 1OQFA 4XO6A 1C92A 4ICNA 1ZAHA 4PTWA 2VEGA 3TC6A 3WQ8A 2J7HA 4ZQNA 4LVGA 2CLIA 4MZ8A 1QI5A 4D9PA 1BLIA 4OBTA 5FEZA 1EUNA 4Q7NA 4BS0A 5CKSA 4B2DA 3GVQA 1CECA 2V0TA 1Q7MA 4RDZA 2DU2A 3OYXA 5A69A 3B8SA 1XRTA 3CAQA 1Q4NX 1R3YA 4KERA 1KCLA 3T78A 4HNVA 1OD0A 4IISA 2OKTA 3CZLA 1UPPA 2OWCA 3VNIA 3GAKA 1I0DA 4W8LA 3WH8A 1E0TA 4ADSA 1QWKA 3H22A 1XQLA 2HISA 2ASHA 4MWAB 4B16A 2QDDA 3PUEA 3AXXA 2FFIA 2DUXA 1KXVA 3S5NA 3LQLA 4G1NA 5BOFA 1XM3A 3V0SA 1PHWA 1U1HA 3HV8A 3R79A 2PC8A 1IWBA 5IXEA 2EJ1A 4BY3A 1RPKA 5L9FA 3W02A 1MQPA 2G3MA 1XRSA 2ADAA 4H3DA 2E68A 3KOXA 4ZOEA 4PUKA 1K7FA 5A8QA 2QDHA 1ZBKA 3HG3A 7PTDA 2QEZA 4JDBA 1KFWA 4DUVA 5K3VA 1R0MA 1OIMA 4FIRA 1VFUA 1WA3A 4H01A 2PGEA 3IUIA 1LQ0A 4DLMA 1KWGA 1I2QA 2PDHA 3O6AA 2YJQA 4BI7A 3GVWA 4DZIA 5FAGA 3EX1A 4GIEA 3CAWA 3CV6A 1ZB5A 2BGNE 1JCTA 2D0FA 3ZJKA 4WY0A 4AXNA 3SCOA 1IQ8A 3P0XA 4EPKA 4IMFA 1PWLA 4Q4QA 4QCFA 1U83A 1L8PA 3LERA 1NOFA 1PDYA 4IICA 5BXRA 5LGXA 5MHBA 4DPQA 3R0DA 1TZ9A 2OWXA 4HMDA 4U2YA 3H70A 2UWFA 3KFTA 3C2FA 2BVTA 3MQTA 3SAZA 4E38A 3PNUA 2C71A 2FJUB 4WHBA 4AMAA 3O6CA 1MXDA 4L65A 1W3JA 2KX9A 4NL1A 1TB3A 3S9IA 1M1BA 1MNSA 4GYPA 4IT1A 1THFD 1MW1A 4NNCA 4GIAA 4JTAA 3HFTA 2WZIA 1J4EA 1UR9A 2YL6A 3GNRA 1UUOA 5EB8A 3H2MA 5D8WA 3JW7A 1EX5A 1T5AA 3CM4A 1DTNA 1KW1A 1Q6EA 2VZUA 1SM9A 3UCCA 2V3GA 4XSLA 3H21A 3ZJ7A 5J04A 4ZXLA 1LLOA 1QO5A 3DG3A 1XGDA 5HATA 3HQ1A 4DO5A 1UMYA 1OVDA 3LHWA 5E9XA 4LS0A 2V67A 2XGIA 3MKKA 1V6UA 3L21A 4K2SA 1PX3A 1K7XA 5DO8A 5FEPA 5MKGA 2PD9A 4XD6A 3ZJ6A 4XIMA 3LCHA 2CLPA 2DSWA 4P7NA 2GQAA 1WUEA 3NZPA 4IP4A 1ZLPA 1MI3A 3O6DA 3V18A 4UTHA 3PVFA 4M29A 1GOMA 4O4VA 3UJ2A 3GIQA 4ZTXA 4UFHA 1NJJA 4IMDA 3UVIA 3N3TA 3LS9A 1QASA 1A5BA 1RK5A 1EF2A 1GJUA 3TTEA 2W62A 3IVTA 4PN2A 5K4ZA 3TOPA 2FH8A 1UH4A 1XSIA 4N7QA 3UY8A 3C2EA 4PMNA 5BXSA 1QUMA 1NVMA 1KO0A 1SW3A 4XZ9A 2P3ZA 4JFVA 3F5KA 5ABFA 3TIMA 3O16A 5FOOA 3UZ5A 2G37A 3MVTA 5I23A 1WAWA 3MYPA 1IYXA 2RKXA 1QO2A 1OC7A 4HYWA 1P0NA 2VGGA 2A4AA 4W8AA 3IPWA 2INZA 4H9TA 2TSYA 3QW4B 1J0JA 1XWYA 1A47A 4W89A 4B9YA 1H1NA 3W29A 5GNZA 3T0TA 2JF6A 4HMNA 3K4DA 5HWJA 1H09A 4MNMA 2W27A 4KWUA 2XIOA 1YX1A 4HSOA 3KS5A 3R8GA 3U0HA 5I03A 1IEVA 4DWDA 4A3RA 4MJ4A 4GACA 3LTSA 4Z2GA 3QC0A 3LCWA 4AY1A 4CD5A 5LHEA 2W66A 4PULA 3UJSA 1FWCC 1ONWA 4IL0A 2G0WA 3CUXA 3IARA 5AHNA 3WQ6A 4LCRA 4X60A 3CQKA 3K2GA 3MUCA 1PXGA 3ZMRA 4QE5A 4RDYA 4GA8A 2RDTA 2Z6JA 1NWRA 3KW3A 3P93A 1LG2A 2BVWA 4QJ4B 1UR1A 3B0PA 1A0DA 4XBSA 3ID7A 5KSWA 1YMYA 1FCUA 1I1XA 4WRHA 1UWSA 1Q6RA 2HPMA 2NW0A 1DPMA 3ZVIA 2HQAA 3BMWA 4M19A 6ALDA 4D6JA 1AUSL 4I5RA 4NZJA 3QFEA 1UCWA 1GK8A 3IIPA 5I00A 4AIBA 4YMZA 4I9MA 4QJ3B 1BGGA 1JZ8A 1N8WA 3M5XA 3N6QA 4J3SA 4ZO6A 1UBPC 1BAGA 4W9TA 4FOJA 3G1HA 3L2MA 1GCYA 4FO4A 2PLJA 1G1YA 5D37A 4DWSA 4H6KA 2ZRWA 2DIEA 1E3ZA 2ZXDA 3AHTA 3R2GA 1MSSA 3AISA 3PBUA 3U4FA 3W71A 3S47A 2Q3RA 3S1WA 4AX6A 4JGDA 4B5UA 1A5MC 2CKRA 4V27A 1FOBA 4HA4A 4L5ZA 3H55A 3MUY1 5HWNA