5I5RA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
440
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Will be disclosed later
rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Hydrolase
total genus 161
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5i5rA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i5rA01
1CGTA 2GJPA 3CUJA 1WDSA 3SURA 2V3FA 1BYCA 3FXYA 1PX8A 3N11A 2C7FA 1JF5A 4J27A 4XV0A 1DWJM 2PI6A 1B90A 4K68A 1GW1A 4BQ3A 1E15A 4U5IA 3VILA 1H49A 4MDOA 3WUBA 1FHLA 2BNJA 5I3DA 5TD4A 3NIYA 3N17A 5ABHA 2E8ZA 2BXYA 4UZUA 4PSPA 1W3HA 4WKFA 5HBFA 4KRTA 1U33A 2XPKA 1UOKA 2VC9A 4TVDA 1CXHA 3RMEA 1A47A 1E6SM 3BC9A 3A47A 4EAMA 4MNJA 4HMCA 4EANA 3MSDA 4HA3A 5CLTA 3CC1A 4PMNA 3II1A 3TP4A 1E1FA 1QX1A 1FFQA 3UG4A 2G3MA 3U7VA 3WDHA 3ZJKA 4UTFA 1JDDA 1BLIA 1GOWA 1TA3A 1Q6EA 4DO6A 1TVPA 1KWKA 2DEPA 1OINA 4HPHA 5I24A 4J28A 4M82A 1R87A 2DSKA 1BTCA 3WBAA 1NH6A 1OD0A 1JG9A 2CPUA 2JIEA 1YHTA 1TZ7A 4JFSA 3HMCA 4E4PA 1FP8A 2WLZA 1CYGA 4GQQA 2CBIA 1ZL1A 1CGXA 5A2CA 3KL5A 2O92A 2YKKA 1RPKA 1W91A 1UZ1A 2GFTA 1IZJA 1XYZA 3VOCA 2VI0A 2E4TA 3W28A 1WDQA 2UY5A 4JFWA 3ARUA 3CV5A 2ZIDA 1K9DA 3K4DA 4GPNA 1UKQA 3RO8A 4BQ5A 3CTTA 1CGUA 5A2BA 6CGTA 4W8AA 3EDFA 2XWDA 5EBAA 3TONA 3OZOA 1OT2A 1K6AA 4AMCA 4CCEA 1J9YA 2GJRA 1WAWA 3GYCA 3MUIA 3MUZ1 2BV9A 3ZIZA 2WVSA 4F66A 1NM9A 1U2YA 4MB5A 1PPIA 4OJYA 1J0YA 2PWGA 4H2CA 4CCCA 5HPOA 1OB0A 1KFWA 3PZ9A 1HKMA 4NXSA 1CECA 3SCSA 2WNWA 5FKYA 1W1PA 4FNTA 3VD3A 4JAWA 1KTCA 2XVGA 2PBGA 1WZKA 3UR8A 1C91A 1HTYA 5GNXA 2X0YA 1HJSA 4AY1A 2WCGA 3DYPA 3OLGA 3L4TA 3W6MA 5HPCA 4CVWA 1QNOA 4DO5A 1JFHA 4NZFA 1KCLA 1CDGA 1ZJBA 3W53A 1E6NA 1H09A 2OSXA 2DGAA 1B3VA 2A3EA 3MANA 1VIWA 1BVNP 1C8XA 4PSRA 2BY2A 4W7WA 3T08A 1Q6CA 1E4IA 4F8XA 3RJXA 2FH6A 4PRWA 5LA0A 3WN6A 4D6JA 1SMAA 4D6GA 1EO7A 3LMYA 1W9VA 1K9FA 1HJXA 3A22A 2V3EA 2XSAA 5E6ZA 2YA2A 7A3HA 1RP8A 1ESWA 2OWXA 4OKDA 2V3DA 2VTFA 1V3HA 3AS3A 1UKOA 1R7AA 1BVZA 3UESA 4CD7A 3ARQA 3NSMA 3WFLA 3VGBA 1H3GA 3WF3A 3WD3A 4KGLA 1QNPA 2V5DA 1E6ZA 1XHGA 4LYPA 2DT2A 1QI5A 4UQ9A 1C8YA 4WLCA 3GZAA 3U5YA 4B3LA 2RGMA 4OUEA 4KGJA 1OM0A 5AYBA 1XV8A 1BYAA 5A1AA 1ISZA 3CIVA 3AZTA 1CNVA 2F18A 3BVXA 3WY2A 3K1DA 4RL3A 5E09A 3UG3A 4X9YA 1X6NA 3RM8A 1V0KA 3AOFA 3KL3A 1KQYA 4PTWA 2WZIA 3UR7A 1GOIA 3PZTA 4UQBA 1DP0A 1W3JA 4WF7A 4AZHA 4M1RA 3WH5A 2OW7A 3RM4A 4PMDA 3SCOA 1W3KA 5IDIA 5D9MA 1O6IA 3UG5A 2ZXAA 3MSGA 4CU6A 4RE3A 2O9PA 1Z32X 5BXRA 3JUGA 1E70M 1UKPA 2CXGA 1MQPA 4CN1A 4LQ1A 3FNDA 3WDRA 4YHEA 1GCYA 2OW6A 4UOJA 4AIOA 4P7OA 2WC4A 1SMDA 1V02A 3NDYA 2XN2A 2F7QA 3B9DA 1R8LA 3MKKA 5A6AA 1UR1A 1V6XA 3VDHA 5CG0A 1RP9A 3EMQA 1EQCA 5CSYA 3ARYA 1HJUA 8CGTA 3VM7A 4QCEA 3EBVA 1PIGA 4HU0A 3AIWA 2F7PA 1QI2A 2DT0A 1JZ8A 2J74A 1VEOA 2ZWZA 2MANA 3F5LA 1AQHA 1W1TA 4EK7A 3ZJ6A 4M56A 3LPFA 3A5VA 4JFVA 1M53A 2UWFA 3VKKA 1IV8A 4UQAA 5EMYA 3NJ3A 3WNOA 1FH9A 4B16A 2WMIB 3PZUA 3HU7A 1VJZA 2YDRA 4D6DA 1PZ3A 2QMKA 3ZSSA 3W24A 5A6BD 2FHFA 2EABA 1V0LA 3PZMA 3HG2A 4AMXA 5EFDA 2VZOA 3WD2A 1UWIA 1FOBA 5I77A 3IJ7A 1JAKA 2JALA 5JBFA 1GOKA 2A3BA 3ARTA 2J7DA 8A3HA 1UR9A 1B1YA 2JF6A 3IAQA 1UYQA 4TTUA 4FK9A 3CZJA 2YFNA 3GNOA 1QNQA 4AZ5A 3AMGA 3OG2A 1DWFM 3APGA 3PZNA 1E40A 4S3JA 3W27A 2E8YA 2WVVB 3BSGA 3T0BA 1D7FA 3BVUA 3AHZA 2WHMA 2DSUA 2WWDA 2F7RA 3DX4A 4FMVA 2GUYA 4GINA 1VJSA 4QLJA 5A6SA 4U5KA 1BAGA 3VGFA 1HVQA 4E2OA 3WEOA 1C7TA 4QAWA 2C0HA 3VIJA 5HXMA 3BSHA 3EJTA 5FL1A 1EO5A 2DT1A 2CKSA 4WK9A 2ZX6A 1G1YA 4MB3A 1KB3A 5A2AA 3MMWA 3QR3A 5AC4A 1V3KA 3WFZA 4LXFA 3GXNA 1V6YA 1Q6GA 4PTMA 4WIWA 3SCUA 2WC3A 2EQDA 1UWRA 1ZS2A 3EYPA 5A6MA 2CNCA 4AZ6A 5M3WA 5BRPA 1RD6A 1WDRA 1B3ZA 2VR4A 4FNUA 1EXPA 4GI9A 4B9ZA 3E1F1 3WH8A 3DX3A 2UY2A 4HP5A 2VX4A 5DT5A 2XIIA 3MUY1 2J7CA 1US3A 3PHAA 4D6IA 3EJQA 2DQXA 4GZIA 1E4LA 2X2JA 4B3KA 4AZGA 3TV8A 4U2ZA 1HXKA 1GHRA 1P6WA 1E56A 1ITCA 1TCMA 1C3FA 3A4WA 4UOZA 4MNKA 3VDBA 3EDKA 4PTVA 1ITXA 4YN5A 3OIHA 4GO8A 4PMUA 4F9JA 4WKAA 3W29A 1ZBVA 4QLLA 1LWJA 4Q7NA 2W4XA 3WBEA 1OD8A 3GDBA 2GSJA 2EPLX 4D1JA 3GXIA 1JXKA 1GJUA 1UD2A 1HIZA 3IJ8A 1BSIA 4H8UA 3UCQA 3A6OA 2VVNA 1LG1A 4OGZA 4BCEA 1NOUA 4CU8A 5LA2A 2X1IA 1B30A 2BY3A 3L2LA 1UD3A 1F4AA 1UH3A 2DSWA 2DT3A 3AISA 3VMNA 5A95A 2WVTA 2X09A 3CUHA 1PJ9A 3N13A 1E4MM 2VQTA 1LJYA 3VD7A 1M7XA 1BPLB 1VFMA 1KR1A 5JBDA 3BAYA 3POCA 1EQPA 3MI6A 1BG9A 3GXTA 3FAWA 3IANA 1NOFA 1W9PA 2YBUA 4DWSC 3PBGA 3W82A 2XVKA 3VU2A 1B31A 5A3HA 4C7GA 1Y7VA 1OGGA 3KWXA 3SUUA 2Q8XA 1HX0A 1NOWA 1QI4A 1KBKA 1UQYA 3RIKA 5EB8A 2XFYA 1E9LA 1WZAA 2VX6A 4WSKA 4JHOA 1UASA 3F5JA 1W3LA 1I1XA 2EEXA 3QOMA 3AMKA 1HL9A 1NP2A 2GDUA 2CITA 3DECA 2A3HA 1J01A 4CGTA 1ECEA 3CMJA 1QWNA 1MXGA 3D52A 4Z2KA 3WF1A 4UFHA 1ODUA 2WMIA 2OSYA 1ISVA 1UD8A 2Z1SA 1CXFA 2XGIA 3AHYA 1E1EA 3W6LA 3VNZA 4W86A 2ZUNA 2RGLA 2ALWA 4S3KA 2GK1B 3J7HA 2GDVA 2IXUA 2F61A 3FN9A 4J3WA 5I79A 2VJXA 1CIUA 3ZQ9A 2F8QA 4CD4A 5C70A 5BWFA 3VGHA 2A3AA 4ZE4A 5CPSA 1UQZA 4AD3A 2YOCA 3UERA 1E43A 2E0PA 5DF0A 1KXTA 1XCWA 2G41A 4UQCA 1RH9A 2CERA 1QBAA 1FH8A 4MAVA 2VX5A 3BAWA 1VENA 3WMBA 1TQTA 2E40A 4GIAA 1JZ4A 4P8VA 3H55A 2ZOXA 4MPKA 2WVVA 1C8QA 1R47A 3BAKA 2D0GA 3M46A 5A6JA 3MV01 4CVUA 6A3HA 1J0JA 4Z2JA 1XGZA 2XUCA 4YHGA 1JDCA 1DWGM 3TOPA 1UUQA 3N18A 3LXCA 4P7QA 2BVDA 3T0DA 2VQUA 3VINA 3VIFA 1AMYA 2WMHA 2WMKA 4ACZB 4P7LA 5GQBA 1E4NA 1W9XA 2WMFA 3AXXA 4MJ4A 2UY4A 5E0CA 4CD5A 6TAAA 1WKYA 3PZQA 2PBOA 3EJRA 4FLQA 2DH3A 4FLOA 1MQRA 2J47A 2YL5A 1V3IA 3ECQA 1KTBA 1UA3A 2IXVA 1ZBKA 4NZJA 1R86A 2G3JA 3BXWA 1LWHA 3LXAA 3VTRA 4D71A 4U3CA 5ABEA 2X0HA 2YL8A 4H8VA 1T0OA 3AI0A 4IUGA 4PMXA 2AMGA 2NT0A 1DHKA 5DT7A 4AEFA 3HG5A 1HJQA 2AAAA 1UH4A 1H5VA 4FF5A 3CMGA 1ZU8A 1AQ0A 1AVAA 3A4AA 2EO7A 2D0HA 5F7UA 1E6RA 4W8BA 4BQ2A 4FNPA 4IPLA 4AIUA 2XVPA 4CD8A 1GHSA 4DO4A 3AYSA 3AHTA 4Z2LA 1DEDA 2CETA 1J12A 1E6PA 1UR8A 3BUBA 3AMLA 2VUYA 3DC0A 1EDTA 2CHNA 1QNSA 2NSXA 4TTGA 3BGAA 3PTQA 3F5KA 4NRSA 5FCZA 1MW3A 3OGRA 4CUCA 1FFRA 4DUVA 1BFNA 2J77A 4H7VA 4XB3A 1W2PA 3AS2A 5HDRA 4QCFA 2YLAA 5IHSA 4TVUA 1XYFA 1QWUA 2CBUA 2DPEA 1UA7A 1EA9C 2VURA 2QMJA 3OLEA 1BYBA 1VFFA 2WWCA 1E3XA 1EDGA 1X6LA 2WM0A 1WCGA 4PMVA 2D73A 2IGTA 1H11A 2D0FA 3OLIA 2D1ZA 2V38A 4QFUA 3HZ3A 3S5ZA 3DYOA 2XN0A 4AD5A 3WSUA 2FGLA 4A3HA 1PAMA 4M24A 1CXKA 3T2OA 4AZ7A 3SIMA 2VT0A 3EJSA 4H8HA 1BGAA 1EH9A 2VRKA 2OWCA 1HVXA 1UHVA 2EADA 3OB8A 1G5AA 4GQRA 4RE2A 2ZUTA 4M81A 5C71A 1J10A 2WMJA 1BG4A 3A4XA 1J0ZA 3ARZA 3AS1A 1JNDA 1QOXA 3L4XA 2VNCA 3M6DA 4UFKA 5A8MA 3K8LA 3SCTA 2E9LA 5A8NA 1TQWA 3WUEA 1DWHM 1WO2A 1TFVA 2GVYA 1SR0A 1OGBA 4HMDA 4AMWA 5CLWA 2GK1A 3VSUA 1HN1A 2CBVA 1QBBA 2F7OA 3NCOA 2JIWA 2VZVA 1UD6A 1V02E 3QHMA 1GPFA 1PBGA 3SCPA 2YDSA 1W1VA 1MWOA 2WHLA 3VO0A 1HF6A 3AZSA 1TMQA 1OIFA 2JE8A 5BROA 1LL7A 2ZUWA 3VNYA 2AOSA 4KRUA 2G3IA 5GNZA 3WF0A 4Z2IA 4MAZA 1MXDA 3HJEA 1N82A 2Y8VA 3ALGA 2C8NA 2E3ZA 2XG9A 3GH7A 4J3VA 1EDQA 3N1AA 3HG4A 5HNNA 4TX8A 1G0CA 3N04A 3SUTA 3TTQA 1Q6FA 1HXJA 4UQEA 2J78A 4ACZA 3VIMA 3H53A 1TQUA 3VSTA 2BY1A 1OCQA 4AYSA 3WENA 1JFXA 1PS3A 4W88A 3CZ8A 4ATLA 5I6SA 3TTOA 1XH1A 3WQ8A 2W92A 1I75A 5I23A 2CCRA 3VX1A 3WDJA 1UWSA 5KZ6A 2GJXB 1ISXA 4CCDA 4BS0A 1UZ4A 5BXPA 5EFFA 4NZCA 3WNPA 4AC1X 3WMSA 1GQJA 1VBUA 3AIRA 2J7EA 4JFTA 2QPSA 4HA1A 1VEMA 4AZCB 3MMDA 3LX9A 1V08A 5GPRA 2OWWA 5JUVA 1LQ0A 1PX3A 3SUVA 3LPPA 3VMPA 3EMZA 1VBRA 3WDIA 3H54A 3W0KA 2W91A 1MQQA 3D5HA 2FE0A 5AYIA 1PZ2A 3FW6A 3SEPA 1XSIA 3PTKA 3WD1A 3ZJ7A 1GOQA 4LGXA 1EHAA 3WL1A 5A8PA 3SCRA 3VVGA 1QW9A 4F9DA 3ZSTA 3CHFA 3LPOA 1E6XM 3AS0A 3ZMRA 2WW5A 4JL1A 1BGGA 3VGGA 2IUZA 1BYDA 1W9DM 1LL4A 4TXEA 4MTVA 4ACYA 2OYLA 2B31A 3HN3A 4QDMA 4L4OA 4LX4A 1ZJAA 1HL8A 1JNEA 1UKSA 3G6LA 4E8CA 2WZEA 2BHUA 4J3SA 1E73M 5JIWA 2QLYA 4PMOA 1PX4A 5DFAA 2EPNA 1GONA 2VVSA 3GBEA 5CGTA 4JKMA 2FGZA 5CQ1A 1IT0A 1JL8A 2FHBA 2VZUA 3THDA 4PUEA 1U30A 1B0IA 4U3AA 2Y24A 3MS8A 2ZUUA 4JIEA 2JEPA 3CZNA 4HU8A 1QPKA 7CGTA 2Y8KA 4EE9A 2WKGA 4V2XA 4W5ZA 5M5DA 3VM5A 1LL6A 1GVYA 2J79A 4FNRA 3NYDA 4GZEA 4V28A 1EIBA 2YL6A 1E71M 4OBSA 3AZRA 2DSZA 4UR9A 2CBJA 2ZX7A 3K8KA 3GH5A 2O9TA 3RPMA 1CGVA 3VIHA 3BMVA 1MFUA 1R7OA 2X8RA 1CBGA 3AIUA 3FHQA 3PZGA 3ARWA 1CZ1A 2BVTA 3KL0A 1JDAA 3I3DA 4W84A 1FH7A 2XFRA 4WKHA 4N42A 2VCCA 2O9RA 3QOKA 4JCMA 5E70A 3GXDA 4Q22A 3RCNA 4DWSB 4R5EA 1TVNA 2BHZA 2J7BA 3O6AA 3VIOA 2VCBA 2XM1A 2X2YA 1V0MA 2WCAA 4B15A 1TQSA 2YJQA 3PZVA 1KXVA 3GXPA 2PF0A 2WBGA 1JYNA 1K9TA 1V6UA 3CH9A 3M07A 1GQLA 1BF2A 4IPNB 3B9EA 4MB4A 1CLXA 4JKLA 1GNXA 3WEMA 3VGEA 1YQ2A 1EOKA 5C8BB 1V03A 3NUKA 4BZYA 3S5YA 3OZPA 1NWSA 1J0KA 2XM2A 4HOZA 3NDZA 3BVTA 3W37A 3D4ZA 1HKKA 1JXJA 1GUVA 4QP0A 1WDPA 1G01A 5BCAA 1UG6A 4M8UA 2DH2A 1GQKA 5LA1A 2WHJA 2J7HA 4BQ4A 4TUFA 1EHNA 2D23A 2VL4A 2XJ7A 3NSXA 3WMCA 4QLKA 1OIMA 2W63A 4W85A 1QI3A 1LG2A 2FHCA 3OBAA 3N9KA 2VCAA 5HOSA 4DUXA 3WDQA 3ZJ8A 1B3XA 1VAHA 2XTKA 4UFMA 4D1IA 3FAXA 1C92A 1R85A 1AQMA 3AFBA 3S6TA 2ZX5A 1H4PA 1JI2A 3LRMA 1W2VA 1B9ZA 3VGDA 2GJXA 1TG7A 2XVLA 3VMOA 3AIEA 1PIFA 3CZEA 1O7AA 1B3YA 4OIFA 1JZ7A 5DEZA 2WHKA 2YA1A 3WNMA 4P8UA 4AZCA 9CGTA 1WE5A 1ODZA 2WXDM 1H2JA 4GO9A 4HOXA 5I5RA 2XHYA 4LYRA 1Q4NX 1BHGA 4NI3A 1XSJA 5M03A 4CD6A 3CLWA 1SYTA 1MW0A 1JZ5A 1QHOA 3AQUA 3B9AA 3A3HA 3POHA 2WYSA 2WSKA 1NWUA 4PCTA 1C90A 2V5CA 4P8WA 5E6YA 2QPUA 2XVNA 3L4YA 3BVWA 3SUWA 2ZX8A 3NSNA 3L4ZA 3GXMA 4DM1A 3WF4A 5BYWA 2PWFA 3WH9A 3F4VA 4RE4A 3CZGA 3LPGA 3W81A 2FH8A 3BAIA 2JFEX 3T2PA 5E9AA 2WMGA 4ATDA 4TX6A 1Q6DA 3BCDA 1VB9A 2ZUSA 1HT6A 5I78A 1JI1A 4JL2A 1JYVA 3VD5A 5D9PA 1NARA 1XH2A 5LYRA 5GNYA 1WP6A 1M03A 4GI6A 1ZB5A 3AICA 3GXFA 2VX7A 3EDDA 2PWDA 4PN2A 2ZXQA 4Y7EA 3AIQA 4ZEPA 4HZ6A 2WK2A 1L0PA 5E0FA 3BCFA 4R27A 4AD4A 3CGTA 3FY1A 3N12A 3GNPA 2VOTA 4AD2A 2XSBA 1TE1A 3ZR6A 3DYMA 1QHPA 3BUPA 4ML4A 4Z2GA 2WZHA 3WQ5A 2D22A 5D9NA 1H41A 4JZ5A 2XWEA 2FDMA 3BMWA 3U5UA 1GORA 3VIKA 4GI8A 3VSVA 3W38A 1XSKA 3BAXA 5CXPA 3BLKA 1W1YA 5ABGA 4UOQA 2BVYA 4W7VA 1R46A 4CN4A 2PWEA 3AYRA 4PBGA 1NP0A 5FL0A 3WEZA 3U7BA 2XGBA 3IJ9A 3VIGA 1ZBCA 2Y2WA 3GBDA 2YBTA 3G6MA 3S2CA 5M17A 3CHCA 3EDJA 3BUIA 2A3CA 1FP9A 4DWSA 4XZBA 4AISA 5FD0A 3K46A 2BFGA 2EJ1A 1UR2A 4FLRA 2VZSA 3ZOAA 2EXOA 3O2LA 3WQ4A 5DO8A 1G94A 1BQCA 4ZXOA 3AIBA 1HKIA 5CPQA 1KXHA 3CZKA 2YL9A 4HZ8A 1JGIA 1CLVA 4PUDA 3WL0A 3DX1A 2PC8A 3AHXA 1JF6A 1JZ6A 4J3TA 4D6FA 1EGZA 2XIBA 1OSEA 4L4PA 4XZWA 2EPMX 3CHEA 3LXBA 5D8ZA 2JEQA 3CZSA 4HOWA 3B8SA 2PB1A 3ARPA 4AZBA 3EJUA 4KMQA 5A8QA 3L4WA 2NW0A 2VZTA 1WPCA 1CXEA 3WH7A 4CU7A 1JD7A 3GTNA 1SFSA 2W5FA 4HPGA 3PN8A 1E3ZA 4YPJA 1QHZA 1GQIA 4C7DA 4CN6A 2WLYA 5IFTA 2XYLA 2QV4A 4PMRA 1OGSA 1VEPA 1HWWA 1A3HA 3AHVA 1HP5A 2G8ZA 4OZOA 1VFOA 3N15A 4DM2A 1UR4A 4U2YA 2WAGA 3W4RA 1NWRA 1HJWA 3KEHA 3WUFA 1E0XA 3RJYA 1CPUA 3CUIA 2XN1A 4GZJA 2E9MA 2ZE0A 2W67A 3D51A 4WJXA 4URIA 4FNQA 5BXSA 1VFUA 1V6VA 5ECUA 2J62A 2E9BA 1VRXA 1GOOA 1KCKA 2ZWYA 4GXPA 5D8WA 1JIBA 1GJWA 3AXHA 2J7GA 3DDFA 7TAAA 2V3GA 3T09A 5AC5A 4UZSA 4A3YA 2G4FA 4F79A 3AIVA 3DHPA 5IXEA 2YIHA 1O7DC 3CUGA 3I3EA 1J0HA 3BH4A 2DSVA 1EOMA 3CZLA 1KGXA 4W7UA 4TOQA 1KGWA 3SUSA 4AD1A 4HZ7A 1HKJA 1XD0A 5CGMA 1DTUA 4D6EA 2DIEA 5ABFB 2PWHA 2EAEA 3GM8A 2CYGA 4UFIA 4PCSA 4PMQA 3TA9A 4D72A 3RDKA 4U33A 2XFFA 4Z2HA 1ISWA 5A6KA 1JAEA 3BVVA 3ALFA 3CHDA 2TAAA 1OBAA 3A21A 2ESCA 4FLSA 4W89A 4X0VA 5AY7A 1UH2A 2Z1KA 1MVYA 2ZX9A 3KE0A 4A4AA 3WNLA 4AZIA 2Y4SA 2CIPA 1GOMA 1H0IA 3IGUA 2CEQA 1W9UA 4J3XA 1H0GA 2QF8A 2J8GA 2EPKX 2YDQA 5A69A 4DUWA 1W9BM 3VUPA 1CTNA 5CSUA 4AEEA 1QW8A 2BHYA 5BRQA 3ARRA 1V3LA 3W25A 3WKZA 1E0WA 3VPLA 1QVBA 2J75A 3FHAA 4FNSA 2F1BA 4U31A 4NSBA 4P8XA 4OOUA 3WQVA 4JCLA 1R33A 3WELA 3BLPX 5CZKA 1V0NA 1CWYA 3ARVA 1G9HA 1R34A 4J3UA 2CHOA 3T2QA 2F2HA 4OOZA 2ZICA 4EKJA 3VX0A 1ISYA 2EBNA 2OYMA 1V3MA 2BY0A 3D3AA 4MDPA 1HP4A 2Y5EA 5JBEA 4UFJA 3WIJA 2W62A 4NRRA 3LRLA 1MFVA 2X2IA 3TTYA 1KR0A 2YFOA 3WD4A 1WZLA 2D24A 3CO4A 2YLLA 3RM9A 4D6CA 4NF7A 3SCVA 5I2UA 2WBKA 1XD1A 2VMFA 2BS9A 2ZUVA 4OBRA 1W32A 4IM4A 2D20A 2OYKA 1I1WA 4KWUA 3ZT5A 4GKLA 1OT1A 1HNYA 3I3BA 4JHZA 1TUXA 3SCQA 4AIEA 3SCWA 5KEZA 1KXQA 4XUYA 3U57A 3OGSA 1R75A 1E5JA 2UY3A 4X0NA 2J25A 3CPUA 3ZR5A 4N0RA 2NT1A 4XX6A 3WQ6A 2WC7A 1E5NA 4PEEA 1JD9A 1C93A 1UKTA 3MO4A 4HA4A 4PYSA 1CXIA 3O9NA 2VO5A 2F1AA 4C7FA 2J4GA 2G3NA 4W5UA 1LF1A 3QHOA 4IISA 4W87A 4ATWA 4WSJA 2WKLA 1KGUA 3CUFA 4NX0A 3K4AA 1UR0A 5CJ5A 1PEZA 1UD5A 3DX0A 1K9EA 2YA0A 4W93A 4ZE5A 4M29A 1GZJA 3MV11 3THCA 4AXNA 4B9YA 3WF2A 3TTSA 2OSWA 3GH4A 3MUAA 4HMEA 4AW7A 3AMDA 4PMZA 3IAPA 1UWQA 5D9OA 1CEOA 2D2OA 3EJPA 4UFLA 2HISA 4BF7A 3CBWA 2VRJA 3AXIA 4MADA 1M01A 1CENA 1HJVA 4E8DA 3UEQA 5IFPA 2W61A 2DDXA 2O9OA 4JKKA 3BLBA 1GVIA 2WB5A 3EDEA 1WB0A 2WCSA 1MW1A 1L8NA 1XRVA 1XC6A 4J7RA 3WY1A 4CKQA 3WY4A 1TA3B 5BXTA 1DWIM 4LYQA 1JYXA 1KWGA 5A8OA 3K8MA 2WANA 1KQZA 1E6QM 1H1NA 1VF8A 2EPOA 3PTMA 4MNMA 1UWUA 2J8FA 2BXZA 5ABFA 4PTXA 1E55A 1E0VA 3BUDA 4ZXLA 3VIIA 1F4HA 1UWTA 3WUGA 2D3NA 2VRQA 3UETA 3PZOA 1B3WA 4ZENA 4D6HA 3D4YA 3VD9A 1FA2A 4AYGA 1S46A 4JFUA 3ARXA 3GNRA 1US2A 1TR1A 4KH2A 3PZIA 3VDAA 3MMUA 3HG3A 4H04A 3KLKA 3W26A 1QNRA 5E1QA 5D4YA 4ZFMA 1V6WA 3AMCA 1SZNA 2OLHA 1WZMA 3KZSA 3OGVA 3D50A 5A6BA 1QI0A 2WVUA 2ZXBA 3A23A 3BUQA 4MB1A 3ZT6A 3VIPA 1C7SA 4P7NA 3L4UA 4V27A 2VR5A 1NWTA 3ZO9A 3OA5A 4UCFA 2W66A 5I0DA 1OWQA 3SCNA 3WNNA 3DDGA 1FHDA 1LLOA 3ZT7A 4UNIA 3WNKA 3OLDA 3DX2A 3DHUA 1JZ2A 1MYRA 3L2MA 4PMYA 2ZXDA 3QHNA 5A6LA 5CPTA 1CXLA 1XCXA 4TVCA 2CKRA 3LRKA 1NQ6A 5IHRA 3ZM8A 1KBBA 3L4VA 4LPCA 4NXKA 2WPGA 3RILA 4AD0A 4AWEA 2WSPA 1X1NA 2JF7A 1CGYA 4UQDA 3A24A 5FOOA 1J11A 3M7SA 5JIPA 1J0IA 4M80A 1E72M 1JYWA 1TQVA 1M04A 3AROA 2X05A 3AJ7A 5FIPA 3T0AA 4DWSD 1V3JA 3WY3A 2J7FA 3WD0A 1DWAM 3IK2A 1ZBWA 1WNOA 4H41A 3VD4A 5A94A 1D3CA 3QGVA 2FYVA 4HTYA 2D3LA 2DIJA 1UD4A 3WH6A 3WQWA 1MW2A 4MJ2A 4MNLA 1D2KA 2EACA 2HVMA 1JZ3A 3KLLA 3BAJA 2CESA 3VDCA 1XH0A 1IZKA 3EMCA 3MU7A 2QHAA 4P7RA 2X2HA 3WDPP 5DMYA 4W8LA 4BA0A 3ARSA 1B2YA 1J18A 2ZUMA 1CGWA
chains in the Genus database with same CATH superfamily
1BZ7B 1S1PA 3ITYA 1NIEA 3C8DA 4XNQB 1I1AD 5C08E 3KPSA 3NYZA 4ZX4A 5GGTL 1FHLA 2OBGA 4QIRA 4NENA 5JQ6L 1P48A 1IC4L 5TD4A 3NIYA 1IBFA 5DZPA 3F2CA 4PSPA 2JCCB 1LRTA 4KH9A 4TVDA 2Q0ZX 1A47A 2IDSA 3A47A 2ZUYA 3EFOB 1HCFX 4OLVH 4DO6A 4Q8TA 1PEWA 3OEXA 3W56A 2L7JA 5EZPA 1NAKL 5D04C 1FP8A 2FJFA 4MLIA 2Z0BA 3PJSA 3C0LA 5CEWA 1AH0A 3RLGA 2WZ5A 1W91A 1EEUA 1AFSA 4NP4H 3J27A 1XIFA 3MRDB 2UY5A 1ADQA 1O7SA 3V0WL 4PJCF 3RO8A 4F7PB 3QUMB 5L9DL 3S34H 1DE6A 2G97A 4QG8A 1JQVA 32C2B 3RVVD 2RGSA 2CLVB 3QIWB 1NM9A 2NX5A 4QYOB 2FGBA 1A2YB 2F9RA 3MNVB 1TJXA 5EEWA 1PS9A 3UA3A 1PFCA 2L04A 1LRNA 2JKXA 3U7WL 4UUJB 3MDUA 4N28A 1XR9B 4APQA 2VEGA 1BVLA 3WK2A 3OKEB 1PD0A 1QSZA 2B5IC 3BI9X 1E9QA 2D7MA 2ATKA 4CNNA 1I9JH 1QNOA 1T5XB 2VWTA 2CKBA 2BVUA 3VXGA 1GGUA 1NCDL 1E51A 4Z7WA 3OZYA 1G6VK 1B3VA 2V17L 4ICNA 1H62A 3GK0A 1HXYB 3MJ9L 4GRLA 3NACH 3QQ0A 1YRRA 4BWLC 3WN6A 1UFGA 4QHUA 4UTLA 3RY4A 4HF5L 5ADPH 2VXNA 5FW7A 5HHXH 1XIWB 2VLKA 1CDBA 2J43A 3UJ2A 2N4IA 1T2JA 3BCJA 3ITOA 3WD3A 1KW1A 1C8YA 2QR0A 3UFYA 2QHLA 1YQVH 3QGKC 2K6WA 3WJMB 4PJ7A 3UPCA 5E99H 1OK6A 3HTLX 4X9YA 1LYQA 4ZQOA 5DMJB 3AOFA 4HJJL 3V9FA 2ZE3A 3RP1A 3WI9A 4WDWA 3KLHD 2F15A 2WGXA 4TUOB 4OLUH 2RDWA 3OF6D 4U1SA 5KVGH 5F1IB 5E93A 5D1XB 4IT1A 3WJLA 5EC1B 1OAZL 4JFEE 4X6EA 4DBEA 5BXRA 5HDBB 4ODXA 5E5UB 2AJZA 4H44C 2EDXA 2Y0SA 1I7RB 4AW4A 2VXUL 2WYIA 1XCFA 1E1CA 1JVOA 2Z1PA 1NCWH 4IPIA 2R2HA 2CA3A 2WD0A 1JCNA 5BW7C 1SJBA 2ED6A 5EFIA 4XNUH 2R23A 3FA3A 3ENEA 3N2BA 1HO1A 1OE3A 2GK2A 3TFKC 3LS9A 3KBNA 1PZ5B 4N8CH 3VTMA 2VXQL 2H47C 4EXPX 3KJ4C 5IESH 1Q90A 2KLSA 4WCYL 1TTAA 1QR4A 3HLAA 1TIWA 4AIZA 3M8OH 1KCZA 5E2UL 4LEBA 3NJ3A 5DLCA 1AD0B 5B38A 3ZSSA 3RGVC 1QLEL 3PZMA 2DKSA 5GZNA 1JHLH 1MH5B 2P8PA 1IGYA 2W1NA 1F76A 1X5XA 3MGTA 3IKKA 4F57L 1S5MA 1KIRA 2IGLA 1NGXB 4UIMB 4AZ5A 3VQMA 4GIRA 1E40A 2WVVB 5SWQA 1UZ6E 3FUEA 2OMBA 3FTVA 2UZ9A 3MRIB 1IEWA 3Q3GB 4QLJA 4LC6A 3AJXA 1IXNA 1W6LA 2XH7A 5A2AA 2D7TL 3FKKA 3IGHX 4J6IA 1A6PA 1M7IB 3DV4B 1Q6GA 4Y4KC 3KHOA 3K0WA 2YGPA 5M3WA 5CFHA 1MJ7L 1FFOB 1TTIA 3WIHL 2OTDA 4IRJA 3W7HA 2PXYB 4JO5A 3FK3A 4P5RA 3HMXL 3RWFB 2GTWB 5E8NA 5D1QB 2GG1A 2NQHA 2A77H 5HGDA 2QF7A 1JUFA 4LBSA 5FA5A 3GBLA 1PB0A 4OE7A 1OD8A 3S36H 4L4TB 1ADQH 3JWDL 2VVNA 4G9PA 1E67A 2ACRA 1K4GA 3HHMA 3PU7A 2B4CC 4LKXA 1MNSA 3P4NB 3RVUD 4KTDH 3QJZA 5MEOB 4ESKA 3MJ8A 3BICA 1X1ZA 4EO5A 1MCBA 1EBAA 2Y7EA 2VZ3A 3OB0K 1CFSA 3P3RA 1U8KB 1XCQB 1M42A 4PCKA 3VWKB 1R0AL 1K8DB 5D2YA 2BNQA 3QUZA 3P62A 1OFQA 3A6BL 4EZMA 1KC5H 3DFQA 4UC5A 4P2RD 5C0CA 1ZAIA 2CITA 1CFNB 5FDYA 2HKAA 3OZMA 1SZRA 3BT0A 5JLZB 3GMLB 4OSUH 5IZ7A 4DJFC 1ODUA 3KBWA 5C09E 3B8TA 5H37A 4W86A 1R5IA 3OR7A 2KERA 4KX7A 3RU8L 4GVHA 2AGJH 4Z78B 3VWJA 4EBQH 4NKQB 4AGLA 4PRTA 1O5QA 3SDCD 3IIOA 3H3BC 4UQCA 3MYZA 2OMTA 1VYPX 2E40A 3CB8A 5HJ3A 5GIRA 2IPKA 4Q4PA 3RCMA 6A3HA 3IJYB 1JPGA 5D4QA 3EAUA 3MT1A 1XYMA 1U8JA 3PL6C 4ZBCA 2IFGA 4ZNCD 5AZ2L 4RDQG 5D4HA 1A0QH 4GNJA 4XCCL 3QPXL 3D3VB 5DDHB 4A6YB 1UM4H 3PSWA 4W68A 4X6CB 5GVJA 3KOZA 5DMLA 5BRZB 1SJHB 3FT0A 3QUML 4PMXA 3LBOA 3S97C 2Z8VC 1H5VA 4FF5A 1LTXA 2FVKA 2LU5A 2B77A 4H5SB 4UINH 5KSBA 4KU1A 3H9HA 2WLLA 5C0NC 2WSQA 3FUJA 3MLPA 4XBEL 4PHXA 3ATFA 3BIKB 1S5NA 1WC7A 1N26A 3DTXB 7REQA 1T6BX 4I2XA 4K7PX 2YD0A 2NZLA 4TVUA 5FV2A 3TJPA 1O95A 1U58A 2NQZA 1WCGA 2IGTA 3NH7H 4I9XA 4PGCA 5T1MA 1PTDA 5HJBA 2D1ZA 1IGWA 1DJYA 3JV4A 3RAJL 3CM4A 3WUZA 3RPIB 3WQEA 1U3ZA 3WQDA 4GKSB 3TJXA 1J10A 2BCKA 2E7LA 3ATAA 1PCKA 2R59A 2VDMB 4KI5E 3P9WB 1H0DA 1M56B 1TFVA 1MAMH 3HZYA 1F9CA 2QJJA 2JJSC 3D3VE 3NCOA 2VZVA 2VDPH 3UDWA 4PJ5D 5GS0L 2UXGA 1LBLA 5T5NG 1D5ZB 1XTLA 3O05A 1J1OH 2FZ3A 3CLFH 2XACC 4Z2IA 4UDUB 1OM3H 4JR9L 2Y1YA 2XXFA 3N04A 3K30A 1HXJA 3LS4H 4HG4J 3H0TA 3CZUB 3L3IA 3M88A 1XGUA 3DCPA 4GJJA 1QUNB 1MI5E 4W88A 1YE6A 4J3ZA 1P1ZB 4ALAL 4NHVA 5BQDA 1VKFA 2NTSP 5GSRB 1UZ4A 3U0WH 3HNVL 3UFIA 1IWPA 1V51A 3WNPA 2C6QA 2FECL 4Z08A 1VD6A 1K8CA 2W91A 2R91A 4IICA 4L4MA 3MRNB 3TBSB 4DKEL 4PGEA 1EHAA 4UM9D 4IOFC 3W1LA 4HIHB 3DBNA 4MAYD 3DOIA 4Y2DD 1GOGA 1MRCL 1TITA 3F5WA 4IP5A 5RUBA 4O8AA 3DJZA 5CZJA 1SDDA 4XPTH 5K33A 5BNXD 2AEWA 4AUUA 4YTRA 1M9WA 1P43A 5ALBL 4KKZA 4HC1A 4LSPH 3OHXA 2ZUUA 2PDXA 2IQAB 3QDHA 1ZPUA 4WDUA 4OECA 3C2AH 2RFGA 4OBSA 2PP9A 4YLCA 4JO4H 4RV8A 1CGVA 2RH0A 2OK0H 1AZCA 1NAML 3AY4A 5HHOD 1KO0A 3NQVA 3NABL 1OAKL 3TIDB 4XHJD 3VIOA 2NZ1A 1RUKH 5HJXA 1XHHA 5FHBH 4Y8DC 3VRJA 1V0MA 4B15A 1OFBA 3GK8L 3CH9A 4MZRA 1O0VA 1CLXA 1P7QA 1EEYB 4XO4A 2FR4B 2EE0A 3GVRA 1J0KA 4IMAA 2NXGA 4FFWC 2NV9A 3SDOA 4JGUA 1JXJA 4LSTL 3QY7A 3WKYA 3IVKA 3NCYS 4LF1A 4E41B 2BVQA 1QFPA 5CIPB 4FL4C 4LVNC 4Y4HA 3QWNA 3ABQA 1IEBB 4ZS6C 2VCAA 4P2OB 4J2XA 3F3HA 5JW3L 3HI1A 4KVPA 3O4LB 5JIQA 4POYA 4ZDHA 2XPYA 3P2VA 5CBEB 1RQ5A 5DD0L 3MRGA 4FQLH 3GKFA 3ZS4A 4YR6B 4TLSA 3ZZSA 1H63A 1U8LB 2P44B 3FB5B 3ZE2F 1IGTA 1XLHA 1S2AA 4D0BA 1XBXA 2CJSA 4HHWA 1U6AL 3KPPA 1G7LA 1SM3L 1A6UH 4HBCL 3HJ0A 4UMCA 2FZDA 2GZXA 5K9QI 2PDPA 4W6XB 4E5XA 3EADA 5FCUH 4GYPC 4GI6A 1PSKL 3P81A 3C6LA 3BUVA 3FBKA 2ZZUT 4HZ6A 4XTRC 1FVCB 3GPEA 3UPRA 4GT0A 3HUJA 5BVJB 3ZR6A 1CO1A 3RWHA 3AT9A 4PJFE 1GTNA 1XF3A 4PRIA 4Y5YC 5FOBB 1T0NB 3DGDA 3BLKA 4KROC 1IGFL 3RI5F 1J8SA 2KDYA 1EXUA 1QSFB 3AYRA 1U93A 3U7BA 3IJ9A 4G9DA 3BQ6A 3CHCA 3DSNB 1DBKL 4AISA 3HC0A 4OCYL 3L23A 2PTUA 2IAMD 5K5YA 3EG9B 4LRTA 3E3QE 2DVTA 5JMUA 1EWDA 1HIMH 2WCPA 4GW4A 4E38A 1W5MA 4AV5A 4TRPH 2YL9A 3EBIA 3DX1A 6ENLA 4N68A 3IF1A 3V16A 3NXLA 5JQIB 1JRHL 3N2MA 1AZZC 3SCMB 4X3ZA 1KPUB 5C0GA 4RGOH 4R3UA 3N55A 4WV1C 5ITBH 4FQ1H 1OSYA 3VXMD 2ERJB 1IGJB 3GTNA 2EILB 3UX9B 4HPGA 5AVSB 1K4DB 4C7DA 1HFUA 3LUTA 1DLHA 1DIDA 2MCMA 3P74A 4L6OA 1X5FA 3NA8A 4X42A 3KEHA 1SXCA 3CPGA 1AR1B 1XO8A 1KCUL 1VR6A 4WJXA 2W0FB 4LW7A 1LE5A 2AJVL 3QEQD 5D8WA 1RURL 5E8EA 2ONEA 4RXFA 3GY1A 1J9SA 5F1UA 4PCFA 2Y7OA 4KVNL 5CAHA 1XLMA 2VDML 4HC1H 2DQTH 4X7TB 2VIRB 1FZJA 4TOQA 1ZY9A 4YJ5A 5CC3A 4UTWA 2Y06H 4OB5H 3TA9A 3T77B 4YVVA 5A6KA 3HOGA 4OFVA 4N4PA 3MUHL 1OBAA 3ISYA 4FLSA 4W89A 4IXXA 2WQWA 2Z1KA 3C5SB 1I6NA 3T0VA 5B38G 4FGMA 4JHMA 1UBSA 1CBJA 3P4MA 1I9RH 3HPAA 2BHYA 3WKZA 1V3LA 2NPLX 3W25A 5CEZD 2J75A 3HTWA 4P8XA 3SKJL 2BX7A 3ECBB 4JFDB 5E08L 4EZLA 4OD1H 3MRRB 3GO1L 2GOUA 4YFEA 4PRHA 3FUKA 4Y5VA 3ZL2A 1M1XB 4XNZC 4M62L 4NRRA 3WHE0 1UGKA 2X2IA 1KR0A 2YFOA 3QQ9C 4NIRA 3FO0H 1LOLA 4D6CA 3HE7C 3SCVA 3L1OH 2YKLL 3M41A 4G80A 1WJ3A 1Q6RA 2V4LA 3FQWA 5FOJA 3AG3B 3I3BA 1RFDH 3PWGA 3IN0A 1DZBA 1NBVH 3DH7A 1D7BA 5IVXE 3STCA 3VKJA 3PIQB 4A7GF 4AGNA 5F1OB 4YDIL 3GUFA 4UV7H 3KPLA 4HYRA 2XKNA 4RDYA 3CFJA 1ZANH 1DE4B 4ETQB 2Z92A 3MLUH 2QNEA 1UKTA 2FX8L 2J4GA 2OR9L 2FBRA 4R26H 2PAJA 5E5CA 1KGUA 3L3DB 4NHCH 5FJPA 3MOBL 1R3JA 1BQGA 1WTLA 1D5BB 2NXYD 3IJSB 3GMNA 4S1QL 4AW7A 1RK0B 4LCWB 3IIZA 1RQEA 3S37L 2VRJA 2AQPA 3WEAA 1GY1A 3M0HA 2GY7B 5F96L 2QJHA 4M4RA 3LKNB 3MMEA 4LSSH 4KKPA 2W61A 3QQ1A 4KKLC 4QF1B 2OGYA 5C07A 3IMTA 2Z4QB 3TZVD 4Z5RA 3IU4H 1DN2A 2XTJB 2QGHA 3ZLFA 1IIGA 1DWIM 4AG0A 3MV8B 2A4AA 3PY2A 3E0VA 4C6EA 5DK2B 3APNA 5D7JB 5AOMA 1M1BA 2OJPA 2VWSA 5EYWA 4L37B 5DJ8B 2BXZA 3QEUB 4ZXLA 1RJZB 2CO3A 3N3EA 3BFOA 3STGA 1ORQB 2DMCA 3D4YA 3NCWA 4WWOA 1AQDA 1TR1A 1NEUA 3GSNA 4RWHA 5AD0A 4ZCWA 5H37G 1UWXK 2R0KH 3KZSA 3D50A 5A6BA 4ZW6A 4DLFA 4S0HA 4N8VB 5HATA 1IR1A 1JSYA 2W66A 2O7QA 1TSIA 4PJDB 2KX9A 5F0LB 3K4WA 2DQJL 1SJVA 2J8UB 2AZAA 4MWAE 4R88A 3X17A 1TOXA 1LO5A 2P7TA 2AJ3A 1PQZB 1GZ1A 2E28A 3LRKA 4LPCA 3LI0A 4ZB2A 3MDWA 5I1IH 2IBBA 3CLEL 1RJQA 1MCCA 3UC0L 1XGYH 4NZRH 4MASA 2Q76B 5AFDA 4NQEE 2BP3A 3MV9A 4Z7VB 4IQHA 1M04A 4B5UA 3QMTA 1CDYA 1V3JA 4CSSA 4EPEC 3DENA 3OVPA 3PB0A 3UTTD 2DBLL 5A94A 5AVNA 5IB5A 4KY1L 4ZUWB 4JQIA 2ITDA 4IGNA 5JQHC 2GPZA 2BZCA 2CESA 4XMKL 3WFDH 2C16A 3EMCA 3VXNA 4XCYA 1N7ML 2AQTA 4BH8B 2NY7H 3TXAA 2ZUMA 2AJUH 3CUJA 4G8EB 2RHEA 4U6VL 3SGKA 3AU0A 1ZSHA 3N9RA 1PWMA 2X28A 2MTAA 5D1ZC 1S9YB 5MHBA 1JXDA 1Z9LA 1GKPA 4NRZB 3QDMA 1SFJA 3B2PA 5EA9A 4B60A 3NFSL 2BIOA 2AQ1A 5DA0B 4QGCA 3MKVA 3MRJA 3DG7A 3SDAB 3DVNB 5D5MB 2I5GA 2Z1WA 1TO4A 4HJGA 4TV6A 1AACA 5DRNA 3TN6A 3IFOB 3NZQA 4Z7UB 2J8UE 3C0QA 2DUXA 1KM4A 2IF7A 5ICYA 3U79A 4HUCA 4DQOH 4ODWB 1YHTA 1NBYA 4JFSA 1RALA 4QE5A 4LASH 1XF5A 2BC4A 1AW2A 1R3IL 1RPKA 4UQ2B 1JN6B 5TBOA 2GFTA 2VI0A 4Z7VE 1XICA 4OGYH 4GLRI 3OPZH 2ADJB 5C0DA 4QRNA 4W8AA 2V67A 2L7QA 5E00A 4HKXA 2VW4A 1NL0L 3GSVB 5BUAA 1KV7A 4OF8A 2WINA 3IPEA 4LU0A 2I69A 2FIQA 5HHVL 4WW2F 3SYAA 3SCSA 3DOSA 5CD3A 4I5XA 5I1CH 4RMQA 4LHUD 4QXTA 1F4WL 2KDGA 2PBGA 3JT0A 3CHRA 3E6FA 4PJCE 3CK5A 4D94A 5F7WC 5AZEL 3OLGA 4CVWA 1BX2A 3SKMB 2X70A 4FXGA 1EJSC 4CSTA 3IDMA 1W17A 3OXSA 5I18L 2W9DH 1NGWB 4XH2A 4LV4A 4HT1L 2A7BA 2OCZA 4YHKH 1JV2B 4O58H 2GVEA 4S1DD 1K3IA 3K6OA 1SMAA 4M9OA 5D5ME 2D3VA 1JNHA 5AQ0A 4M6NH 4UAHA 2Z8WC 4I18A 4OKDA 4NNPL 1TSHA 2VTFA 1V3HA 4N9EA 3O2DH 1UKOA 2X89D 3WN5A 4NJAH 4GWEA 4BQCA 5J13C 2G5WA 3ULVH 3SJ3A 2GFBB 2OYPA 3V79C 2WXFA 5J6SA 2W80C 1T20A 3IRZA 3Q45A 3DPBA 3OVGA 1S7TA 3MN8A 1D5XB 4YGVB 4U1HB 4S38A 3WG6A 4WNQA 3RFRA 2J6EL 3KOFA 4G9FE 1MQKL 2PS2A 1KLYA 2QCGA 2OW7A 5MHSE 1F6LL 4KO9A 1BQSA 3C3UA 2XSKA 3TO2B 3N73A 3A9IA 3QQ4B 4IBVA 5F7HA 3ULUE 3LY0A 2JKEA 2X1WL 1RIVH 3VCLA 4Z7OB 2H6RA 2GUOA 1KN4L 3D34A 1SMDA 4KDVA 4WWNA 3BE7A 1I4FB 4JAMA 1A5MC 4U3XA 3OR6A 4HUUA 5DI8A 3WK0A 4PWFA 1D2OA 5AHEA 3MKKA 1Q9OB 1JPSH 1YDOA 3CBJB 4IOIA 3DSFL 5DQPA 4X2UA 3EBVA 1PIGA 3REQB 2JJSA 4KFNA 1JZ8A 4EIVA 1KY7A 4N2IA 3CDZA 2DJLA 5CSZA 4JFVA 5JMRA 5A3IC 1XIBA 4DKFH 4ZAKB 3HG0A 2UY6A 1E5BA 2IKGA 1CB7B 5DK3A 4ZFGH 2PR4L 2OU4A 2MTPA 4LZKA 3L5MA 3R0MA 4BH7A 1BD0A 5DCCA 1VBHA 5HYJD 5E2TH 3TJLA 1OZTG 1KFCA 3SDYH 4PCPA 2JF6A 3A67H 2JJTA 2GTZB 3SZ6A 3JWNE 1B3JA 4HKZB 1A3WA 3T0BA 1D7FA 2DVUA 2PMQA 3VXSB 2E75C 1NDMA 3FFCA 4MJIB 4M93C 2UZYA 1I9CB 1L0YA 1MF2L 3O3RA 4FAAB 4PVNA 1U8HA 2ZX6A 2B4CH 1UMYA 2Z00A 4GAJL 4J4PC 4PRDB 5FWQA 1W31A 1P4BH 2IH1A 1W15A 1YSOA 4QE1A 1SLWA 3THML 5IMLB 4K1GA 3M0MA 1R5VB 5AAWC 3TYZA 5KG9A 1P6WA 1C3FA 4MNKA 2CCWA 3X1EA 3WTUA 5CD5C 3W29A 1AZRA 2UZPA 3HHSB 4QTFA 4Z42C 3OKMA 1GS7A 5IHZB 2OO6A 2A21A 2H26A 3CHSA 1NOUA 3QXAB 3PFRA 1H7RA 4PRAA 4YEFA 4OFPA 2UZXA 5TF1H 1KLUB 5IHHA 3W7IA 1YY8A 4MS8C 2BP5M 5D4IA 3DHDA 4C7GA 1PVNA 3HC4H 3FOKA 4XT1C 3IPFA 4NWTH 3HQPA 2XX0A 1UENA 2YLKA 1NFDE 1R3WA 4GUPA 3QOMA 4DEPB 2A3HA 4MJIE 2BCMA 2AL2B 3PPHA 5I15H 3B9NA 4TUJB 1I8KA 1CXFA 4I87A 3AHYA 5CHNA 3IU3B 5F8QC 4DQWA 5PCYA 3OTRA 2ATAA 2XZAH 3LNIA 5I0ZA 3ZE1B 3IKCB 2MOGA 4PRPA 4I0PD 4M48L 3TJ4A 4AD3A 2RJHA 3QVAA 4MQ7A 4WEBH 2ZOLA 3WMBA 4BK5C 3CAKA 5JORB 3UPWA 5DQJA 1KD0A 3T5WA 4N90D 3FONB 4KJQD 1C8QA 1BQHA 4LDOB 2YO3A 4QR7A 1JEZA 2V37A 4E0RB 4ADSA 1I82A 4K2UH 4IKLA 2UY4A 5DJ2B 1Z0NA 4CC4C 2DQFA 4L2LA 4K7VA 2B81A 2IW0A 1O9ZA 3IXAB 2XPGA 2A6KA 2NNXA 3BXWA 3N6JA 4I77L 2AJSL 3G08B 3LXAA 2I57A 1KNOA 5JIKA 1UB5A 4W81A 1L6ZA 3RMJA 4OCRH 1KM1A 4AEFA 4GK8A 2WZ0A 1XYCA 3ES7A 1T4KA 4HXAL 1DVFA 4GYPA 1DUYA 3T8VA 3FO1B 4V15A 4B0MB 1LWIA 4JB9L 3DX9B 3WLNA 3D08A 2DIBA 1DEDA 2CETA 3ULUL 4D2NA 4FB7A 4UQ3A 3KAAA 1SXZA 3MBED 3AMLA 5E8PB 2YR3A 4HFUH 3LPWA 4X98B 1RU9H 1F74A 3U3HA 4Y5YA 1DLFL 5ACZB 1ZSDA 3OQ8A 4YIWA 2DWDA 4DSYA 4R7NB 3LZQA 4OV5B 3TBTB 3UZQB 1TKKA 5CJBA 1I7TB 1YW1A 1EA9C 4J1UB 2G50A 4Q6XA 1BYBA 1BM7A 1AD9B 5E6IB 4KXBA 1OQFA 1GJPA 1VPQA 4Z23A 4YVXA 4TV5A 3KS0J 4MM1A 4YBHA 4WI8A 3GFUA 1T89C 4AD5A 5DWUL 4A3HA 4M24A 1FNGA 2FGWH 4JN1L 5B7MA 1E9ZB 3IIPA 3UR5A 5BO1L 4OM1L 3OKKA 1EEZB 1FBIL 43CAB 1MHCA 5IEHA 3RZCB 3Q06A 1HWHB 1AH3A 4WGHA 1DL7L 4IP7A 2YDSA 2GJ6B 3UIYA 3QIWD 1TMQA 2VM3A 5IW1A 4PBXA 4FTVB 3KXFE 2C8NA 3F03K 1H3PL 5E8OA 5DCBA 1YNTF 3BO9A 1G69A 4DPPA 1WFOA 1S2EA 3MOAH 2XU2A 3SUTA 1NSNL 1OQXA 4UQEA 5HGHA 3O8AA 4HUXB 1IF2A 1UXSA 3DIFA 3GR4A 4XSMA 1FORH 4JTJA 1A49A 3TYEA 1U21A 2ADGB 3COOA 2VFIA 1OGTA 5CN3A 4DP9X 1ZS8B 2GIXA 2KT6A 2R29A 3GNML 1VPYA 3CV2A 3C2EA 1SUJA 1VEMA 1S7VB 4XVTL 1FCUA 1GVQA 4DPCX 1FJ1B 4E5TA 4RGNC 3FT9A 3CQIA 1XIWD 2SEBB 5IB1A 1Z5YD 5H2ZA 2HLEB 3PWUA 1XSIA 3O2VL 4Y19E 4FX7A 4IBYA 3A9BA 3NO1A 4PJBB 4C1KA 4LVHC 1KFAH 3RJQB 5K9QG 3EA3A 3BD5A 3ZDXF 1EGJL 3FH5A 2YRBA 4GUCA 2GGJA 2Q20A 4UCGA 1QVOA 1M1SA 4P2QD 3G6LA 2E6YA 2O4QA 3BLIA 4NDMA 2PPFA 4PMOA 2ZJSL 1DKWA 3EX3A 3S4SA 1GCFA 4AQAB 1UIOA 2GGGA 1WYIA 2V7NA 1UJ3A 1JTOA 3O11B 4XBGA 4AL8C 1ZLPA 3CZNA 1QPKA 5D1XD 2BOBA 4PJXA 1QLEB 3IAGC 2F19H 5IOPA 4A2FA 5BMXA 1IXQA 4KK5D 5DJDB 2KH2B 4EDXB 1W72A 3PPSA 3BOXA 1CW2A 5DS8A 2CDFA 4UMSA 4RKAA 1B0RB 4LBRA 1K7XA 3TASA 4JVUA 3FGCB 3BVNA 2VH5L 4PWIA 3HMJG 1V6UA 4IBTA 3K74B 3B9EA 4QXWA 5BMFH 5JPMC 5C08B 2R4RL 5I74B 4F0LA 5D6CB 1P84K 4BZYA 4EPBC 4HT3A 2CIIA 4QLWA 5IGXL 5JQ9A 1GC1L 1YMMD 15C8L 1OL0A 2V5YA 3QB7C 1AXTL 4PJBE 1NDGB 3HCVA 5CLXA 4L5FE 1WUZA 4X7CC 1MJUH 1PKQA 4AK2A 5GZOC 3HZKB 4QROA 3CU1A 1AQMA 4YHZL 2GVGA 5JOPD 3MXVL 5FJOA 2GJXA 3WLIA 4P4KA 3U1QA 1NGQL 5E4EB 1B3YA 1DQLH 2A99A 2YA1A 4P8UA 2BG5A 4X4ME 1G87A 1Q4NX 1XLDA 2LTQB 2H8PA 3L3KB 1OY0A 4ZW8A 1P5UB 1E2VA 2I7SA 1HHGB 3GXMA 4Z18A 3WH9A 2YCKX 4WK2B 1ZVYA 5I6PA 2J13A 1BQUA 4FO4A 1H6FA 3FUDA 4HNOA 3S3DB 5IB3B 3SKOA 3TN4A 4ELKA 5D9PA 35C8H 2JNZA 4E42A 3LCHA 4YOKA 2L0DA 3EDDA 5D1QD 4AY8A 1IRAY 1T1WB 2QAFA 3BP6A 1TWDA 3DFOA 3G1YA 4FMFA 4MDJB 4P3CL 2D22A 3BZ4B 2GK0B 4L4TD 3QIBB 5C0BA 5T3XE 2HTKD 5AVZB 1GORA 1KTLA 1OWWA 1XSKA 2EEAA 2HRLA 4IS6A 2XWTB 4YC2C 3U9PH 4IX2A 1L4IA 4BWUA 3PXHA 2XRAL 5EBUA 1H15A 1JPKA 5TPWH 5F0MB 2YHGA 3VIGA 3O7UA 4WY0A 5M17A 3D4GA 2ARJB 5D2VA 2NNAA 3ZYZA 2CNYA 2I60H 2W8CA 3F1QA 3TWCL 4M8VA 1ETZA 3ALWA 1HJCA 3OHIA 4H1ZA 1U8OA 3CX5K 2HG5B 2MKWA 3AG4B 4XWOD 1JZ6A 1BMWA 5FA4B 4RETB 2EC8A 2R29H 5TF0A 3N29A 1YEKL 4BKSC 3KDMB 3ARPA 4HBQA 3E0GA 3P0VL 3N0AA 3EJYD 4KV5F 1SBBA 3LHAA 4G3YL 1PGRB 2IANA 2JTDA 4Q6YA 5FA3B 4L29B 3V35A 1OGSA 4JFEB 1HWWA 1VSCA 2ALAA 4EF8A 3HQOA 1O6TA 3MGAA 2MOVA 2WAGA 1NWRA 1TJHH 1E0XA 4GW1B 3MKCA 1J48A 4G6AD 3F04A 5DGQA 4FIRA 1KFBA 5JZ7C 5CSRA 4B50A 4GXPA 3BEWB 3TH3T 2V3GA 3BEVA 3L67A 5AHLA 5DT1H 1RCOB 4HGMA 2JLLA 4HNNA 1NOAA 5B7EA 4JPWL 1RK1A 5BRZD 3FA5A 3XISA 4FQXA 1KELL 3GMRB 3EO9L 4MXVF 1XD0A 5HNUA 4QOKA 3GM8A 3CHOA 3T0EC 4C6OA 1W72H 4U0RC 5DLLA 1RVFL 3VW3H 4X4XA 3BW2A 3A21A 1PWLA 1GYUA 2Y5JA 2ESCA 3UBFA 1UOZA 4DK6A 2NQCA 1Z9NA 4O28A 3BPNB 1QLFA 3E8VA 2FFCA 2CEQA 5FB8B 1NM4A 1TTUA 3UBGA 4FCAA 1MXSA 4R4FH 1EAQA 3QNYB 5IB4B 3VPLA 3MODL 3OXRB 1PU0A 5AB3A 5I8KH 5IR1B 1L9TA 1X7FA 1T99A 1PYFA 2PDLA 3GHBH 2EPHA 4TPRH 3T2QA 4PUMA 4PW3A 5MEND 4EKJA 1YYML 1FYTE 4JNMA 2ZKHH 2GABA 3WIJA 4FA8A 5GXBB 1WAUA 2IEPA 2PP3A 3EH1A 4ZMZA 1TWIA 1K8ZA 4OBRA 4PI0A 3GI8H 2KUTA 1OGAE 4L5FL 5EZLB 4M1CC 5C7XL 2G2RB 4NZTL 4X7SL 1R3HB 5EN2B 2GDQA 2B0SH 2GGHA 4LEOB 3NL3A 1TZOA 1LM8V 1LP9A 4AX6A 3EWXA 3TCLA 5EDXA 4XMPL 4NU7A 4NX0A 2VKZG 4LP5A 2B59B 4AXNA 3N6YA 2O6FA 5HP5A 1LGVA 3K2MC 5C0AE 2EIEA 3IPWA 1M01A 4F7CB 5D2LF 3LBMA 1EDYA 2YJLA 3KPNA 4URTB 4U1KA 5F0PB 4M51A 2WCSA 1J1PL 3WKPA 2OJEB 4MCMA 4HYVA 3FO2B 3WY4A 2DWEA 1YMHB 3FSUA 4ABWA 4DFHA 1YNPA 1NAMB 1UWUA 4XXDA 4KTYA 5C09B 5T3XL 1UEMA 1EWHA 3D87B 1MJJB 1A4JA 4WX2A 4EDWH 3VXRA 4Y2WA 5IROD 4FZEL 3C6SA 4KH2A 1ACCA 4GVFA 4GX9A 5D9SA 4UB0H 5D4YA 1LO0H 2Z26A 4K3JH 4RCAA 3EFFB 2ATSA 3W2DL 1J2WA 1XR8B 4P7NA 3D4CA 4YUEL 3FCSA 1HYSC 5EF1A 5DQ9A 3PS6A 5PTDA 3NFPB 5IJVA 5HHQB 3ILDA 3DHUA 4KCUA 4EWND 2IOIA 5J9PB 1BQHG 5CPTA 4NM4H 3SE4C 1KBBA 4NNAA 1R5WB 5F9JA 4AWEA 3WSQH 4UNLA 1HILB 3LKSB 1J0IA 5A43C 5LNRA 1B9KA 5CZ0A 3ATBA 4YU1A 2AK1H 4QJ1A 1H3VA 4MDIA 3N43F 5B8CA 1GK8A 4OCXL 5FO2A 3WH6A 3ZVIA 5KJ4A 1Y0LB 1X9QA 3OPUA 4J3OC 4IGBB 2HVMA 4MZ3A 4J6RL 3VDCA 4PJHE 4OJEH 1ITBB 3D6GA 3VOHA 1OCRB 3LEVH 3GIVA 2W9EH 1ED3A 2JTYA 2GSEA 3D0LA 1JF5A 4NEHB 4XODA 1XM3A 4E41D 4HLZG 4U5IA 3VILA 3MLVH 3C4UA 1VZWA 1Q1PA 2BNJA 4JRXE 4UNUA 4D7BA 3NK3A 4AF0A 4P2OD 1PLCA 4ISVB 3CQKA 5AYYA 4XOAA 3S35L 1UOKA 3BWZA 3O4LD 5HQLA 1HSAA 3LHPL 3BC9A 4MNJA 4GH7B 4YDKH 4YDJB 2GGEA 3W07A 6PTDA 4JDYA 4GG9A 4NPYA 4DK3A 2NY4C 1GOWA 1AI1H 3X14B 3W00A 1GW6A 1OINA 5FKAA 3VI4A 5KBLA 1OCCB 1A3XA 2IQ9H 2WLZA 3LVTA 4OLXH 4FQIL 3IJEA 3UOAB 3PWPD 5DVOA 3UWUA 4LRNL 2W3ZA 1UZ1A 4FYSA 5AYQA 4MUPA 3DERA 1MVUA 4JFWA 5KAQG 1UFUA 1L7IH 1N8OE 2O5ZH 4EPSA 1YDNA 3D2UA 4KUZL 3VFNB 5IVNA 3UC2A 5I71C 1SVCP 3IDJA 2C9RA 3H4FA 1M7DB 1SXAA 4MB5A 1JERA 1JNNL 4LP8A 4CA4A 4H2CA 4AHPA 1MI5B 3SD5A 5EBGA 4XO5A 1RUPL 2ON3A 3CEPA 2K9UA 5HHPA 2X1OA 4PCNA 3FFDA 1BZEA 1MFCH 2NXHA 1MDLA 1T1ZA 3ARGC 3AO0A 1QSFD 2A9MH 5L2JA 1OX4A 2Q7YA 5HR7A 3KP1A 1K6QL 2NQDA 1OW0C 5G4MA 1DQWA 4PSRA 3U82B 3GBNL 5IT2L 5T3ZH 4HGWB 1J05B 3O45A 4WGKA 4R0LC 2AQSA 1DJNA 4HIIA 3NMEA 3CVHH 5AW2B 3FDGA 1XLEA 1PG7W 3LNFA 3ENLA 3DHMA 3S5NA 2WB1A 3LKPB 2PDMA 2B3RA 4BJHA 1KCWA 2Q3ZA 4PJAF 4RZCA 4XCEA 3WFCH 2N1KA 3SCMD 4P3DA 1BAFH 2AABH 4QWWC 1TPB1 3D9AH 2FQFA 2I17A 4X6BB 4N8PA 2DUAA 5A1AA 4WI5A 1D2PA 3CIVA 3SSZA 2AJYL 5AAPA 4KRNA 1CNVA 1EC9A 2CA4A 1X5IA 4GUIA 3S4SG 1T03L 3G6AB 2BVEA 4A29A 3ARBD 1GOIA 4EPDC 1VCFA 1OF2A 4N24A 1KYFA 7XIMA 1AR1D 2Y1AA 2XZZA 3Q48A 1FWEC 1UACL 1SVBA 2Z7UA 2K6ZA 4FULA 1A6ZB 4LQ1A 2W88A 2LE9A 2BOEX 3LTYA 2EEDA 3SPHA 3O3AA 3UYCA 3BJ91 3PY9A 1OTUD 4ZXBD 3V0VA 2F7QA 3MLSH 2PF8A 4F3FA 2OJZL 1DDHB 4Z0XB 1NCBH 1UR1A 3VDHA 5EU4B 4PC8A 5L4IA 4G8GA 5KN5A 4D9LL 4RFOH 3N6QA 1U92A 4F7MA 3TU9A 2BK8A 1QPPA 4G1NA 4L6HA 1EFXB 2VLRE 2OMNA 1FH9A 4JQXC 4M1DL 5LGHL 1I7ZB 1THFD 3W24A 1T8XA 3MTRA 3EO1A 3UP8A 4O18A 4JQ2A 5LHFA 1OY3B 4ES4A 1UR9A 4N26A 4JFDD 2CDEB 1JBJA 4NNXB 4PLOB 2P5WE 3RWIA 2E8YA 4YZFE 1JWMA 5CP7A 4FMVA 4WCJA 1OFRA 2W60A 3GSUA 1HVQA 4JFFA 3QI9B 3BSHA 2YBRA 3SYPA 4ZUSA 3CHXA 3BLDA 4YGAB 2F5AL 3NJNA 5HI3D 4KW2A 2EQDA 2Y2YA 1SVDA 4F2EA 4XBPB 5A6MA 5FUOL 2R0ZH 3NL6A 3RITA 4LVOC 4B9ZA 1A7NH 2EXYC 2WUCH 1XS2A 1Y8BA 3KGRA 1UZ8A 1RPUA 4EXAA 4PJFB 1I9IL 1O5XA 4AM0A 3LV3B 4U49A 4PV9B 3PS7A 4W9DC 1GHRA 1TCMA 4F8QA 4Q52A 3KPRA 4P99A 1XLBA 5D37A 4WKAA 1MZRA 3N50A 2VLMD 3F7RA 2W4XA 4RISH 3RKPA 4TMCA 4HUVB 1KIPA 2FSEA 2CO4A 4LCWD 1LEIA 4MSSA 3WFBL 1LG1A 5D7KD 2DYRB 2JWYA 4PTTB 3EYQC 3MJ7B 2HXAA 3TLRA 1UD3A 4WAFA 2O55A 2G0KA 2YXFA 1OKEA 4L3EE 3TNBA 5I3IA 1M7XA 4OQTL 4OLZH 1ZHKA 1EQPA 1WIPA 2YXXA 1LILA 3FSOA 4R33A 1UM5H 4CNTA 2QCCA 1S1RA 2XTJD 4XE5B 1F86A 4H6RA 4XMUA 4POCA 5HUPA 3MV8D 4LQFH 2C3VA 5EZJB 5I16A 3BTNA 4LRIC 4WSKA 4ADTA 5D38A 4KWOA 1TX2A 2OX5A 1CDHA 3S5LB 2PRLA 2GDUA 2YEVB 2HLAA 1J01A 1MXGA 1HQRB 2CGYA 1UD8A 5IFJA 1E1EA 3UAJD 3MUGB 3HNTL 2YGVA 3WJWA 4KZCA 3C0SA 2YPLD 2DD8H 4IHBA 1UQZA 5DF0A 1KXTA 1LEGB 1FZOB 3BE1H 1FH8A 3QBUA 1XGPB 1X98A 3AADB 5EORL 2OMZA 4GPVA 4MPKA 3BAKA 4QXUL 1UXLA 3KBPA 1UUQA 3R1GL 3NM1A 4ACZB 2CK0L 3PBMA 7ENLA 4DGYL 3EOEA 3HG1A 2QHRH 4NO3B 4Q2ZB 3V52H 6TAAA 1IGCH 2PBOA 1J2BA 3D25A 4LLAA 4LPWA 4HNVA 1V3IA 5AOJA 3DI0A 1G7JA 1N59A 4WGWB 5ILTL 2A6NA 4C56A 3EYOA 2YL8A 3I50H 1NLDL 4IJ3B 5F3HA 3P3TA 3EX6A 1LLAA 3TL5A 4IU2B 4ZFFB 1Y1UA 2CMRL 1KM5A 4LLWB 5GRVL 3H2NA 5EU6A 1JPDX 4U6XA 5EOCH 1MEXL 1QSEE 4NUWA 2Z7ZA 1OCJA 4Y9BA 3FVMA 4WIQA 3C9NB 2XWJB 4KMLB 2NSXA 4K5LA 3QCTH 2HQAA 4QG9A 3JR2A 1LJMA 3LH2H 1O5PA 5IHSA 4QKXB 1GGTA 2DV6A 1QWUA 4JW3A 4ZUUB 3SDAD 2X5PA 4XN5A 4K8RD 5EU3A 4L0PB 1WA3A 4HUNB 3LZ3A 2QKSA 4H0IA 5IKCA 2FUTA 2R1YB 3HZ3A 3ARFB 1J5IA 4B91A 3T2OA 3MZGB 5DEFB 1KM0A 5FSDC 4M43L 5IVXB 3H9ZA 1BGAA 4HKJB 3GIPA 2EADA 1BG4A 4ZFQA 1A7RL 1X7QA 4YHLL 1DPMA 4QM1A 3GMPA 5LAXA 2CO6B 5JXED 5T8IA 3WUEA 2IQTA 4PB9L 2VFEA 1WHPA 5JHDA 4ELMF 1S2TA 3JSSA 4JHAH 1JZJA 1WBJA 4YCPA 5BROA 1SFDA 3MRFA 4MAZA 1FLTX 3K5RA 3I68A 4HK7A 5AW9B 3F7YB 2VLJB 2D7NA 2O0TA 3TYDA 4G1KA 3CSPA 3DAQA 1KCXA 5U7SA 3VOJA 3FF8A 3WQ8A 5IIEB 4BI5A 1N0LB 4JFPB 4LSRH 3C09B 4H7CA 1TTQA 3MSRA 5D02A 4CCDA 1WBYA 5LNEA 4AL8H 4HCGA 5KSAC 1OTSC 4DTGH 2G37A 4NQXA 5BOEA 1CR9L 2C26A 4BWLA 2OWWA 1LQ0A 2FIKB 4LOUC 4I1NB 1DSFL 2YAQA 1JCTA 2D31A 4F2MB 4ONHB 3TH2T 1E8ZA 1XJBA 4IEFA 4MLRA 5HYQB 2GJZA 5DFVC 7PTDA 1VGEH 4RZ5A 4F0HA 4MWAB 1XSOA 4XBKA 4Z7IA 4XHQA 5LVEA 4WEMB 1JCMP 2VVSA 3GBEA 5CQ1A 5D7IF 3WBWA 4NQEB 3B8DA 1LL6A 4W6YB 1GVYA 1RIUL 1R3LB 3K8KA 3ZDXE 4JYFA 4LJ3A 4X7FC 3ZLHA 2VLJE 1UM6H 4FXFA 3O2DA 4JTEA 4PJ8C 2VO8A 4EN3B 2C34A 4N42A 3A64A 4M7JL 1TETH 2O9RA 4NP7A 4JCMA 4DYKA 4BV1A 3HGJA 3RCNA 4KJPC 1TVNA 1VHCA 5BW7A 1D8CA 1ETA1 2WCAA 2BS71 3P77B 2YSWA 4YHIB 5J1TC 1F05A 3M07A 4ZZFA 3QPEA 4E9WA 5TGBA 5H2BB 4REQB 3ETSA 5IP4A 3ISRA 4FXRA 3MV7A 1LK2B 4ZAKD 3W37A 4FQQA 3OMZA 3SFKA 4F2ME 3WOVA 4LEEA 1AHWB 3NOIA 3RGVA 3WMCA 5LN8A 3ROOB 3OBAA 4A2LA 3N9KA 4R96B 5IF0A 4Y8EA 5DRWB 3PBUA 4YSCA 4RAVA 4UXDA 5F2GA 2ZX5A 4GH3A 3LRMA 4I3GA 3VXSD 1B9ZA 1JGDB 4LAUA 1BZQK 3RUBL 4M1GH 4GLEA 3VAEA 3IUDA 2PDNA 4HKBA 3EZJB 2R1WA 4GO9A 2DZSA 4NUQA 2VGLM 3I9GL 3T8MA 1KJMA 5LHDA 1YLBB 1L6SA 3WD5H 4LB8A 4XNMA 2J6XA 3TIEB 3MCKA 4Y4KA 5IV2A 1AZVA 2VDKH 1ZLWH 3F4VA 4C60A 1URLA 1GGIH 1IQWH 4LKCB 5FECB 1XH2A 2CRMA 4OZGA 1WFIA 3CQQA 4I6KA 2BIPA 3URQA 4TQ8A 1GZHC 3G5XB 4PJCB 1X5MA 4XPAH 4DXXA 5D9NA 3WLHA 4R8WL 2FDMA 3DOPA 1YEIH 4EX4A 2Z25A 4O16A 4B5XA 1THCA 4KQ3H 4P9HC 2NW3B 3HQ1A 1G7IB 4YHPB 3TKFA 5AHFA 4N0FB 3QUKB 3LSBA 2HH0H 3EOBB 3T4AB 2IC2A 4WFGD 1TR9A 4M5SA 3VAVA 5ANHA 2FQEA 4X8JA 4HJEA 3GKAA 1IL1A 5F7YC 1FO0A 5DO8A 4OFQA 5DXWA 1J9CT 4R4ND 5MEQA 1A22B 3AIBA 3EYUH 4GP5B 3KS5A 5REQB 3NL5A 4WVRA 4FD0A 5ID1A 5G2HA 1DQIA 4PUDA 4A7UA 1WAPA 4D6FA 3KWWB 2EPMX 4DJFA 2VC6A 1C12A 7TIMA 1FN4A 3KGSA 5LQBH 2YCJA 5AEAA 5DEJA 5KVFH 3UZVA 3KAOA 4G9FB 3TGXA 5CPMA 1GAFL 2P26A 1IAMA 3PN8A 3FUNA 4JFHD 4CN6A 1IILE 3WLPA 3LHVA 3HRZC 4X60A 4XCFL 2ZG3A 4U2YA 1OSZA 3W4RA 3C2FA 2NMSA 1PLGH 3GEWB 1J6PA 2E9MA 2W67A 3E9TA 4KCWA 3B8IA 1KLFA 2E67A 4TF4A 3PL6A 2OP4H 3TSMA 1GJWA 3AXHA 2QCFA 2YB4A 5AC5A 2VZ1A 3I6GB 3U1SL 2OL3L 3KCPB 1WGOA 2AEPL 5KZCB 5FCSH 1ZGLB 1A9EA 4NQSA 1OCWH 3IDNB 5FM5M 2DQHL 2NXZB 5BO0D 1FGNL 2WP3T 1I8UA 3IEAA 2FVLA 5I3JA 5E0QA 3KXQA 1Q38A 4DJED 4LCUB 1C5BH 1NDWA 3QS2A 2HVNA 3CHDA 2VSDA 3R19A 3ANUA 1LDCA 4F8NA 4FFZL 1WBXB 4GG8B 2ZX9A 3KE0A 3EA1A 4HS6A 3P3SA 4X4YA 3RBGA 3AUJA 5FKPB 3DMMB 3NZ8A 1MELA 1CTNA 3HC2A 3T6XA 4K71C 4HS8H 5MERA 1E0WA 1TLMA 1P4LB 4QRQB 4WTZA 3WQVA 5HMFA 4MXVE 3HPLB 5JYLA 5E6ID 3DN5A 4LY4A 1AO7D 1Z9MA 2RUSA 3O6LH 3GSXB 1OW0A 1KEML 1CFTA 5BQ7A 2G30A 3ONCA 1ME7A 1M05B 5HHNB 4NKDB 2PCPB 5IMOB 3HZMB 3S36X 4R0LA 5C0JB 2C9UA 1RCYA 4GNKB 1W32A 2ZSVA 4JYDA 3TBYB 1A7BA 2ZOUA 4KWUA 3B7SA 2F2KA 4IFRA 3X3FL 1F8IA 3SYCA 3OYZA 3B6SB 3TESA 1J4EA 5L2KA 1X5KA 1MRFH 4BFAA 4X7EC 1IJNA 2O4EA 4H26B 2GJ6D 4OZIF 1E5NA 3CH1B 4FTVD 3TCXA 2R15A 2ZC8A 3CUFA 1G4MA 4FKEA 4F9LC 3P9MB 1PEZA 4YYFA 1RI8A 4RBPK 3HQNA 3ZTEA 3JZ7A 3ZBMA 4UBDC 1T41A 3AU2A 4FJYA 2IH3B 2PO6C 4NM8L 5M1TA 1FGVH 3T55A 2J1KA 4OLWL 3NFNA 3BG9A 5DURB 2E27H 1N9PA 4MRCA 4RDBA 2J88H 3OAYK 2LLLA 2WB5A 4N5EC 3GFXA 2QUUA 1NFDB 1XC6A 4AQ8C 3TQPA 4OLEA 2WOYA 3KBFA 2AP2A 2NV1A 1NIDA 1JYXA 3ABOA 3TEWA 1AZ2A 2EDNA 2E25A 4C4KO 5FYLH 3CD4A 4DPRA 3ATEA 3VJ6B 2FVMA 3CK0L 3AUOA 1C5CH 1I1YB 4WOZA 1S5VA 1AGEA 1L6GA 2D2JA 1BIIA 4HH9B 4APXB 1LUCB 4ZENA 1FCBA 5TE6H 2KKQA 5D2LE 2XN9A 5D71L 1OP5H 1S5IH 4JFQA 2C4FT 4QSFA 4E5XG 1BZ9A 4JDTL 4OD2A 3TEVA 3CFTA 4QHRA 2C3GA 3FQ1A 1FO0H 1M9SA 4Y9OA 1L9MA 2HWZL 1EHLH 4JZNA 3KLDA 2ZXBA 2X9WA 3PDDA 2MRYA 4L8DA 4DGIH 4RMRA 1FWAC 4FXSA 2IS7A 3ZO9A 3V4VL 5AUMB 5I0DA 4J9JA 1KJVA 4J3OH 2NY6B 1LLOA 2P3EA 1QRNE 1WXJA 5C8JA 4W9HC 1BWKA 3JS3A 3U1PA 4XD4A 2ASHA 3CUXA 4LPYA 3BUYB 2WO5A 2NNFA 4Q0XH 3WBDA 4FLHA 2QKIB 1Q8AA 3UTZB 3T4WA 4PPTA 4RW5A 3IETA 1QOPA 3PV7A 4A7TA 3WD0A 3RB7A 3QJHA 4HZAA 3AWNA 1ZJIA 3ETBJ 5H35A 1MW2A 3RCYA 5F4SA 5C08D 3BSZL 3W70A 1D2KA 4JPSA 3CL6A 2YXGA 1XH0A 1KGIA 1ZXQA 4QEEA 4U1IB 4NN5B 2GW5A 4LSVL 3LQZA 1BYCA 5BZDB 4F24A 1FE8L 1OPOA 4GIEA 1I3GH 4LCCB 4J27A 1MREH 1KB9J 4LBAA 1C9WA 3C5JA 1ZRUA 1DQQB 4PZVA 5IJBC 1OK0A 4IRSC 3INUH 3PJLA 2JELH 4HPNA 3RPDA 1GYNA 4X9HA 2YZ1A 3RMEA 3TT1L 3JBG7 2G60H 3X11A 4EANA 1YA5A 4MKMA 1E1FA 1ZXKA 3MLWL 3WDHA 3ZJKA 2Z91B 2YD9A 3OQ3B 1CFQB 4J2QA 5TH2A 2P8MB 4ERIA 3B40A 2OZTA 4M4PA 2NLYA 4LLYA 1WA1X 3G1AA 4AOFA 5IHUL 5KETA 2YQ3A 4LRIA 1TJ2A 3R12A 3QP3A 1BM3H 4AUJA 1CGXA 5GSVA 2O92A 4WFHE 4HNLA 3KOXA 3FXIC 4NWUH 1WDQA 4G43B 1UWYA 5HGBB 3KXFB 4P04A 4QAIA 3RVWD 1FG2B 4CCEA 4O2CA 4TS6A 2FB4H 3MACL 5KS9F 3W0WE 3M5ZA 3QC3A 3DDMA 2H2SC 3QIBD 1EZLA 5I30L 4TN9A 4R6UA 5FKYA 4LLQB 1KTCA 1C91A 3EOTL 3N25A 4JGJA 3QPYA 4W4QA 1W16A 1XIIA 3W6MA 5EC2A 5HPCA 3QFDA 4BEQA 3M44A 4NZFA 3W53A 4FI4A 2GBVA 7PAZA 3QYCA 4V1YA 5IQNA 4Y19B 3ORJA 1FL3A 4H3DA 3UJTH 5J04A 2K70A 1XP3A 5FLVA 2G0LA 4DY1A 1UWEL 3S3CB 1BVZA 3L5XH 3UESA 3QTPA 5FAJA 3I6KB 2EE3A 4B3LA 5IFAH 1K72A 2HA1A 3UBHA 2ZWNA 4GY0A 4KGJA 4WV1A 1A1OA 4KCVA 3VZYA 4AYFB 4IP4A 4JFED 2F18A 3JTSB 3GMMB 2OMVB 1ACYL 3CASA 4MUZA 4JX0A 1S3KH 4HN8A 4N4YB 1CB2A 5SV3A 4XP4L 2WZIA 3UR7A 5JHLL 4PAZA 5EMLA 4PJAE 2BSLA 3OC8A 1SHXA 3H70A 1F41A 4PFHA 3O2WL 3M7WA 5C9JA 4Q6IB 3GYEA 4NRXA 4YHEA 1TJGH 1PZDA 5E03A 4IH3A 4XKYB 1PLAA 3CYVA 1K85A 3B5TA 2XN2A 3T4YA 4R97C 3OQEA 4ODTH 4ML9A 4LP4A 3WIFB 5A6AA 1BXAA 4W1TA 4QHLA 4TOYH 4FHJA 3JVAA 4WRLA 3ZKXB 4PB0L 2OCFD 1IO4C 4R7DA 4EAEA 1ZP4A 3LPFA 4UQAA 1NEYA 2AQNA 3F8UB 3WLTA 3HU7A 3R2GA 4HAGA 5K7JA 2OAAA 1NMAH 1EL3A 1W54A 3ZL4H 1T8QA 3H21A 5GS0D 4IGHA 1H3WM 1JFQH 3V1HA 4LAQL 1BIHA 4WSGA 3SRFA 2VW7A 3C60C 4LEXH 3W7EA 1TJ1A 3D7PA 3BZDA 2HFTA 3AMGA 3OG2A 5IQMA 2QPXA 5G5DB 3FN0H 4OV4A 3AHZA 1YN6B 4Y1AA 2WWDA 4HSNA 4U5KA 3DGGB 4AEIH 1ZP3A 2C3XA 2CG9X 3QEGH 1DFBL 1XRSA 4ZUVA 3IIXA 3HE7A 1V55B 3BW4A 3IACA 5CGYD 3DVGA 4BKLB 4Y9FA 4F2UA 4KTEL 3ZE2B 5C2CA 1CF1A 3O3DA 4HP5A 1MRQA 2QGBA 3QSKB 2I9UA 4BZ1H 2I9LB 2ZUQC 4MA8L 3SJVA 4CC1A 1I8MB 4KRZA 3M9YA 4UOZA 5HNTA 1OP4A 3BYYA 4O2FA 4JKNA 5C6TL 2K3HA 5LNVA 1LWJA 1SJMA 1A6AA 5DK0B 1WITA 5C92A 1CL7H 4DQAA 3GXIA 3MLXH 1QNVA 2H2PC 2KPNA 2VMCA 4GSQA 3EFDL 3P0YH 1GKQA 3BD3A 1F4YH 3TJIA 4OAWB 2JB6A 3VMNA 1HEJC 2X09A 1IBGL 1XEDA 3S3SA 1KNWA 2C1PB 2GVLA 2BOGX 2R14A 4PJ8A 2CCVA 1W9PA 2NQJA 2X4PA 1Y7VA 2Q8XA 1QI4A 1T7WA 2VN6A 4GKZA 5C09D 4RZ6A 3O3EB 4JHOA 3FB8B 1ES0B 5I1JL 2EG6A 2E5EA 1IBDA 1HL9A 2I5IA 4DESA 3CMJA 2K78A 1H7XA 1RZ8A 2VL5B 3DO7A 1LO4H 4ANKA 1K4CA 4P9MH 2C1GA 2OSYA 2PXYD 2Z1SA 1YUKB 2BRRL 3VG0H 1I1AC 3RIFK 1PY0A 1ZV9A 2F74A 4NAMA 3ZQ9A 5DCDA 4ZE4A 1EEXA 3ZE2E 5BRBA 1USZA 5FX3A 3BKYH 2OTUB 2ZCKH 4NZ3A 2I7GA 4XNBA 4P8VA 3UTSA 4UTBL 1JK9A 1I4NA 2YSSA 3IFLL 4CVUA 3WCZA 4G5ZH 2X9ZA 5DXXA 3D85A 4PULA 5GRYA 1AMYA 4P7LA 3S2NA 4YHML 4MJHA 3ZDYF 1Q6QA 2FB2A 3H2MA 3E2QA 5FUCE 3D30A 2X12A 4GC4A 4FF7A 4BQ8A 4HK3N 1AS6A 3B1TA 4AH2B 1GVEA 2A6LA 5FGRA 1T1XB 3VWKD 3LU2A 3UG8A 4YNYA 3SQOH 4AM0Q 4EUPB 1QZ1A 2W9LA 5LXGH 2HX9A 3QFGA 4DCQB 1ZTXE 4GYFA 3TJEL 4IGBD 1I8LC 4D8PA 1FNHA 1XAKA 3H42L 3PPGA 3MSPA 3RVVC 1M3UA 1ZHNA 5F7UA 4O4VA 1I60A 4HQQH 3ABGA 3AYSA 4UM8A 1UR8A 2HRPL 4Q32A 4EIBA 1QNSA 1NELA 2VAJA 1MCIA 3RGHA 3Q8EA 2GI0A 5D1ZA 3I65A 1NJ9B 5EV7A 1M6UA 1BFNA 4GS7B 1ONXA 3AS2A 3H7RA 1FYTB 4WTZG 3LCIA 3PJWA 1ZHBA 3VI3F 1TVHB 4KZ0A 1ZAJA 1H11A 2WXGA 4N2NA 2D0FA 2E77A 1U5VA 2PD9A 4YSRA 4W9TA 4KI5D 1CXKA 1OGAB