5I5RA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Will be disclosed later
rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 161
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5i5rA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i5rA01
2J77A 2DSUA 4X9YA 2WXDM 2VO5A 4D1JA 3CZSA 1NQ6A 1PAMA 4YHGA 3GYCA 4P7NA 1V3LA 4UZSA 1UKQA 1E6PA 3SCTA 1TUXA 2CXGA 5A6JA 3VIMA 2ZUNA 1GVYA 1M04A 4JZ5A 2V5CA 1UWIA 3QHOA 3QR3A 4UQBA 3VIIA 4GZEA 3TP4A 4NXKA 4UOZA 2BY0A 3VKKA 2X1IA 1VJZA 3ARXA 4ACZA 3CZKA 4XV0A 1UR2A 2VTFA 2WCSA 4UZUA 2XSBA 3HMCA 2WMGA 5CXPA 2VX4A 4LYQA 3T2OA 5CG0A 2PWGA 2ZUMA 3DX4A 1ODZA 4XZBA 1A3HA 1PX3A 3QHMA 1NWTA 3EDFA 3PHAA 3EDDA 1NWSA 3AFBA 4GZJA 1JZ8A 4C7DA 3BUBA 2ZICA 3CUHA 1GHRA 3AIRA 3WEZA 3W6LA 1CIUA 3EMQA 2HISA 4HZ7A 2WLYA 4CKQA 3ZOAA 3BMVA 1HIZA 1W1PA 1HL9A 5I2UA 4M56A 1GQKA 3QGVA 1WO2A 1QNPA 1GQIA 3WUEA 4W7VA 4AZGA 4UFKA 2V38A 2BHUA 5BRQA 1B0IA 1UWTA 4PRWA 5FOOA 1JZ2A 2BNJA 2J79A 4QLLA 1QI3A 2OLHA 2JEPA 3GZAA 4FNTA 3LPOA 1KXTA 5CLTA 3RM9A 5FL1A 5M3WA 1WZKA 4JCMA 3U57A 3CBWA 4LGXA 2CESA 4MPKA 1C7TA 1NWUA 3PZQA 2VZOA 2CPUA 2D0FA 2JIEA 1LLOA 5E0CA 2WVSA 2GJXA 2DSWA 4FK9A 3GXFA 3AYRA 1L8NA 1V3MA 2EQDA 5E6YA 5A6LA 3N04A 4D6IA 3WDPP 3D5HA 2YOCA 2CITA 3UERA 4AIOA 3ALGA 4HA4A 4EE9A 3EYPA 4NRRA 1QI5A 1GZJA 2V3EA 3NSNA 2F1BA 2WB5A 1W3HA 1V0MA 4P7OA 1HJXA 1US2A 2DSKA 4P7RA 1JGIA 1BGAA 4KWUA 2WWDA 2J7EA 3PTMA 1UKPA 4MB1A 2VZVA 1TG7A 1K9EA 2UWFA 2GJXB 2CCRA 1EXPA 1FHDA 3IJ7A 3ARUA 1ZB5A 3WL1A 2VX5A 2IGTA 3K4DA 5CGTA 1FP8A 5BXRA 2JF6A 1DWHM 2ZWYA 3AMDA 1XYZA 2W91A 3ZJKA 4KGJA 2UY4A 2GK1B 2VMFA 4MTVA 1DHKA 4D6EA 1OINA 1VENA 2ZUUA 3WY3A 1OT2A 3MMDA 3GH7A 2YDQA 1PIGA 1VB9A 2YDRA 3VIFA 1ESWA 3BMWA 1TQVA 3GM8A 1E15A 1R46A 1EH9A 1G1YA 4PMNA 3A47A 1QVBA 4D6DA 1EOMA 3L2MA 1TQTA 2XGIA 3LXAA 1OGBA 1C91A 4PEEA 3W24A 1CGTA 2FGZA 4CN4A 4U31A 3HG4A 2WBKA 1TVPA 4TTUA 1WP6A 2J25A 1Q4NX 3BAXA 1ISVA 4PMVA 2ZWZA 3BH4A 5A8MA 1R75A 1ISWA 1C7SA 3VIPA 4HA3A 4DUXA 2ZUWA 2PF0A 4M8UA 1X6NA 1N82A 3T08A 3VIOA 4U33A 1UH2A 4CD5A 3S5ZA 3G6MA 1GPFA 3A3HA 2X2YA 3WN6A 3LMYA 5AYBA 3T0AA 2FE0A 4U5KA 2FHFA 1QBBA 1CXIA 2ZX5A 4UFMA 3M7SA 1NP0A 3OLDA 1E3ZA 4W85A 3WY4A 3WFLA 4IM4A 4A3YA 2FGLA 2A3BA 5A6SA 2WZEA 3CUJA 3MUIA 3NDYA 5A6KA 2ZUTA 4ZXOA 1VBUA 4D72A 5A6AA 2XN2A 2A3EA 1B3YA 3MUAA 4W7UA 4IPNB 2VRKA 2JALA 1W9PA 3KZSA 1FP9A 1UKOA 1E70M 4ATLA 4OZOA 2WC4A 2D73A 4IUGA 5CSYA 2XFFA 3O9NA 3E1F1 3WFZA 3D51A 2D0GA 3VD3A 1E71M 1WAWA 1I75A 1CNVA 1YQ2A 4C7FA 1KXQA 1V3KA 3WF0A 2OW7A 4UQCA 1XGZA 1E6SM 3LPPA 4JFVA 5I24A 2X0HA 2WHLA 3BCFA 1KXHA 2EADA 1KWGA 2FHBA 4QLKA 4AZHA 4AD0A 1E6QM 4J27A 1LWHA 4WKAA 5D9PA 4AD1A 1W9DM 4YPJA 1LG1A 5EMYA 1TQUA 2BY3A 2VT0A 2CBUA 2CETA 1XH0A 1IV8A 4UFJA 4JFTA 3AIEA 3WUBA 3PZIA 2XN1A 1V6VA 2XUCA 3FHAA 2TAAA 3BAKA 4BF7A 3F5KA 1SFSA 4HOZA 3APGA 2EABA 3OLGA 5A1AA 3H54A 3ZJ6A 2YFOA 2F1AA 1UH3A 4GQRA 1UR1A 3CHFA 1V3IA 4FLQA 1TQWA 1DWAM 3OBAA 3AMGA 2XIIA 1KQYA 4FF5A 1B30A 3ARQA 1GQJA 3W81A 2J75A 3WL0A 5I0DA 5A2CA 3FY1A 5EFDA 4HZ6A 1CLXA 1UZ1A 2A3AA 3AHXA 3HG5A 4AD2A 1XD1A 1DWGM 3N18A 1DTUA 3N15A 1XH1A 1ZL1A 4DUWA 3F5LA 2PC8A 3WDIA 1IZJA 3MU7A 1D3CA 4H04A 1SMDA 1V03A 3D4ZA 3OLEA 3AROA 6A3HA 3NIYA 4AMCA 2EO7A 2UY5A 2XVLA 5DMYA 4HMDA 5BXTA 4PMXA 4RE3A 1ZBKA 1JF6A 3WF1A 3VD5A 2YA1A 4MAZA 2YJQA 1ISZA 1GOIA 5IDIA 1H09A 3ARPA 3GH4A 1HF6A 3QOKA 4PTXA 2VC9A 5A2AA 4BCEA 2F7RA 1KWKA 4URIA 1MQPA 1WDQA 1K6AA 1DWIM 1QX1A 2XYLA 4DWSA 4V28A 4TX6A 3CV5A 5FL0A 3DX1A 4NX0A 4W88A 3W26A 2RGMA 2XIBA 3BXWA 5A8PA 4GKLA 3CMJA 1AVAA 3D3AA 3UR8A 2EPOA 2DIEA 2OSYA 2BV9A 3ARYA 1R85A 2CKRA 3SCNA 4Y7EA 4P8WA 3ZR6A 3VILA 4OJYA 1W9XA 3WUFA 1BVNP 1M7XA 1MW0A 2MANA 1B90A 2VL4A 4NI3A 5AY7A 1HX0A 4HU8A 2JF7A 4GO9A 3U5UA 4JFSA 2CERA 1S46A 4J3UA 2G3IA 3WMBA 1V0KA 4DUVA 3VO0A 3IAQA 5A6BA 2VX7A 4PN2A 1EHAA 2XG9A 4HPHA 3WEOA 1EHNA 4JIEA 2CYGA 3WQ6A 1RD6A 1K9TA 2YLAA 4GQQA 2J7BA 2WM0A 5HOSA 2CNCA 2E8YA 2ZXDA 3L4ZA 3THCA 2DQXA 5BWFA 4HOWA 5TD4A 1PPIA 5IHRA 2Z1KA 1M03A 4CD6A 5E6ZA 3RDKA 1HKKA 3W53A 3PZGA 3EJQA 1NH6A 1WPCA 1WB0A 2XWEA 2WHJA 1JXKA 1BG4A 2EBNA 4UOQA 1NOUA 1FFQA 1E6RA 5E1QA 1V6YA 4BS0A 1MFVA 5FD0A 2J78A 3RM4A 1G94A 2ZXAA 5IHSA 3WBAA 1EDTA 3VVGA 1UWUA 3AXXA 3VDBA 4R5EA 3WUGA 1KGXA 3AQUA 1B31A 3MUY1 1V0NA 1UUQA 4HA1A 3CZNA 5A8OA 1UR4A 1QNQA 4IISA 3RJYA 2WMJA 4AZ6A 3VNYA 3AHYA 1EGZA 1RH9A 4L4PA 1JZ3A 1Z32X 4U3CA 2D24A 3PBGA 4QCFA 3SCUA 1H49A 2F7QA 4HPGA 1W32A 4D6JA 4B3LA 3IJ9A 5ABFB 2OW6A 4CD4A 4HU0A 3VD7A 3AHTA 3TTYA 4ZEPA 1HJVA 2XWDA 2YL6A 1A47A 4JHOA 2ZXQA 3H53A 5KEZA 3T09A 1BTCA 3AYSA 5JBDA 1C3FA 1XSIA 4UQ9A 1B3ZA 2DDXA 4KH2A 4UQAA 4QLJA 1BVZA 1JD9A 1H2JA 4FMVA 4PUEA 1GVIA 4WKHA 1HJQA 4UOJA 1TE1A 1OIFA 5IFPA 2BVDA 4TXEA 1HP5A 2WVVB 3ZM8A 2VVNA 1ZS2A 3PZ9A 1TFVA 2WBGA 1RP9A 2WLZA 1KTBA 1JFHA 1R47A 3NDZA 1G5AA 5ABGA 1CECA 1J0HA 2X09A 3DDFA 3A23A 4MB3A 1BYDA 2W92A 3CH9A 3WELA 4EANA 5DF0A 2CBJA 4PMZA 2D20A 3N1AA 4ZENA 3BGAA 1W9UA 4H41A 3SUVA 1FH8A 5ABEA 4JL2A 1TA3A 2JFEX 5FKYA 1BGGA 4Z2IA 3BC9A 3ZJ7A 3VGDA 4D6CA 1AQ0A 3MUZ1 2JE8A 2ZIDA 3BSHA 5JBEA 2J8GA 3BAWA 4ZFMA 4FNPA 4QCEA 1R7OA 3POCA 1KFWA 1XH2A 1VFFA 3UEQA 3WKZA 3WH5A 1Y7VA 4W8LA 4CVUA 4P8XA 3SCRA 1NP2A 1UD4A 1WNOA 1CXHA 4BA0A 3OLIA 1MXDA 4PMQA 1F4AA 4QDMA 1ISXA 5A6MA 3LXBA 4S3KA 2NW0A 1CGUA 4J3XA 3AHVA 5I23A 1WDPA 1BAGA 2PWHA 1QI0A 3LX9A 4W93A 3MMWA 2X8RA 1M53A 4M1RA 3LRLA 1GORA 5A8QA 3FNDA 2GSJA 3VMNA 1H5VA 3A24A 2XN0A 3OB8A 1R7AA 7CGTA 2EPLX 3WF4A 3VIGA 2YIHA 1W1TA 3WQ4A 1AMYA 2EACA 1KCKA 2GK1A 3T2PA 1GOWA 1TMQA 1GONA 1GOKA 7TAAA 1V0LA 5DFAA 2WVVA 1GNXA 3AMKA 1ZU8A 4OIFA 1BQCA 2C7FA 1CZ1A 2WSPA 3MI6A 3WY2A 3BVWA 2J62A 3BVTA 4OUEA 3BUPA 1V08A 3DC0A 4JFWA 2VURA 4P7QA 1VFUA 4KRTA 4BZYA 3GNRA 3WQ5A 3ARSA 1J12A 4B15A 1JF5A 1FHLA 1MW1A 4D6HA 2AMGA 4WJXA 3L4VA 4F9DA 1UKSA 3AICA 2YL5A 3A22A 3CHEA 3ZT5A 3OZOA 3UR7A 5ABHA 1OM0A 3AZSA 3WQWA 1B2YA 2E0PA 1CEOA 1LL4A 4P8UA 1BLIA 3LXCA 3DX2A 1O7AA 3PZOA 1E6XM 4AEEA 4KRUA 3EJUA 3A5VA 1CBGA 4D1IA 2CEQA 5E09A 3A4WA 2J7CA 1QHZA 1HKIA 4DWSC 3GDBA 3HG3A 3QHNA 4MDOA 3VDAA 1G01A 1O6IA 2Y8KA 4PMYA 2ZE0A 3WNNA 1E6NA 2CKSA 3PZTA 3W25A 2Y5EA 3DYMA 1ZBWA 1KGUA 2EPNA 2QPUA 1X1NA 1ISYA 4E4PA 3DDGA 4DWSD 1C93A 2WWCA 2VR4A 4UCFA 4KMQA 3PTQA 4TVDA 5CJ5A 2F18A 3M07A 1JYVA 2DT2A 2ZX9A 3GBDA 1Q6GA 2X0YA 3EMZA 1LL7A 3CHDA 3DECA 3W82A 5HPCA 4U3AA 1GJUA 1LF1A 3VMPA 2A3CA 4B9YA 1E0XA 1HKMA 2BY1A 2YA0A 3UESA 1OT1A 3B9EA 4CU7A 1MQRA 2JEQA 3AIUA 1H0GA 4H8VA 5HXMA 4W87A 1I1XA 3T0BA 3WNLA 5C71A 3M46A 3CUGA 1UASA 1WCGA 3NSMA 4M29A 3MV11 4OOUA 3WDJA 3W0KA 1Q6EA 4UNIA 1Q6DA 3AISA 2VRJA 2XHYA 4XUYA 5GNZA 1FFRA 5DT7A 4DM1A 5LA0A 4NZJA 1NWRA 5I3DA 3EDKA 2VCAA 4AZCA 4QAWA 4LYRA 3RO8A 3U5YA 4H8UA 4AD3A 1JDCA 5A3HA 1JDAA 4PCTA 1EDGA 3K8KA 3SUUA 3MSGA 1BG9A 5BROA 1UQYA 4NF7A 4PMRA 3I3DA 3EMCA 2ZXBA 3W6MA 1TZ7A 5D8WA 3IK2A 1EQCA 3RJXA 1US3A 4CN1A 4Z2KA 2IXVA 2WYSA 3GXDA 3WBEA 3LPGA 1J18A 3N9KA 5HBFA 2NT1A 2D23A 1XRVA 3GXIA 4FNUA 5HNNA 1MQQA 5D9OA 4HMCA 3N12A 2VZTA 3BAJA 2AAAA 4PMUA 2DT3A 1H0IA 2J47A 3GNOA 4KGLA 4BQ4A 3TOPA 2BFGA 4RE2A 1EO5A 1CTNA 4OBRA 2FHCA 4AISA 1CDGA 3ECQA 1FH9A 2VI0A 4WSKA 3ARWA 1CXKA 4MNKA 2A3HA 3MV01 3A4XA 1V3HA 1ITXA 1HJSA 1HVXA 1C90A 1GCYA 2J74A 1W2PA 1UA3A 1UQZA 1YHTA 4UR9A 2GDVA 3UG5A 1X6LA 2D22A 4BQ5A 3BCDA 1CYGA 1UD2A 2J7DA 1G9HA 3VMOA 4LPCA 1JNDA 1SZNA 4NRSA 3AS3A 4CUCA 2Y24A 3QOMA 5I77A 4AIEA 4E8CA 1HN1A 4CVWA 2OYKA 2J8FA 1NOWA 1TR1A 2GJPA 3CIVA 4X0NA 4F9JA 2CBIA 5JBFA 4N42A 1WZAA 1XHGA 1M01A 2Y8VA 4RE4A 2HVMA 1VRXA 3BUDA 1B3XA 3IANA 4J3TA 1ZBCA 3MMUA 4EAMA 3WIJA 1UR0A 2E8ZA 2XFRA 3VTRA 1H41A 3O6AA 4B16A 1P6WA 2WHMA 4GI9A 3ZSTA 4UQEA 3WDHA 1QHPA 3EBVA 1B1YA 2QMJA 3VM7A 3A6OA 4MJ2A 1UD6A 1UD3A 2OYMA 3ZO9A 3PTKA 1KQZA 2XGBA 1ODUA 2DPEA 4WKFA 5E9AA 5A94A 2VOTA 1UA7A 2E40A 2BVTA 1OIMA 2UY3A 4BQ3A 3TTOA 3N17A 2G3JA 4PUDA 2VUYA 1O7DC 3KE0A 1EIBA 1D2KA 4PYSA 1K9DA 2WMIA 2XM2A 2WPGA 3VGGA 2CHOA 1OD0A 1EA9C 1QW9A 1DP0A 4OOZA 2WW5A 4NXSA 4PSPA 1UYQA 4AD4A 2Z1SA 4LYPA 2V3GA 5M17A 3VNZA 2VZSA 3SIMA 1HXJA 2NT0A 3CZLA 1E0VA 2F7OA 1J0IA 1NOFA 1JAKA 4MADA 2BS9A 5BCAA 2WKLA 1W2VA 5BXSA 1R34A 2YBTA 5M03A 1ZBVA 4H8HA 4PTMA 1EDQA 1C92A 2OWWA 1EO7A 3SUWA 4CD8A 3BVUA 1I1WA 2GDUA 4UTFA 4XZWA 1VIWA 3AIWA 1UD5A 2W4XA 4AZ5A 4E2OA 4Z2GA 1J11A 2QMKA 2D1ZA 3LRKA 3LPFA 5M5DA 1T0OA 3SURA 3LRMA 2YL9A 2GJRA 2WMKA 2YKKA 3AXIA 1HJUA 2V3FA 4F8XA 1V02A 4AC1X 3WH8A 3KL3A 3BLPX 1KGWA 5JUVA 5C8BB 1HNYA 4MNMA 3ALFA 3PN8A 5CPQA 1Q6FA 1V6UA 2ZX6A 1E1FA 4DO4A 1E5JA 4GI6A 4Q7NA 4Z2HA 3BUQA 3BVXA 3D50A 2X2JA 1DEDA 4CU8A 4AYGA 2VR5A 3M6DA 5GPRA 1MW2A 1B3WA 1SR0A 1JAEA 2XSAA 1GHSA 3VGBA 5CPTA 5C70A 3SCSA 2FH6A 4HOXA 4DO5A 5KZ6A 1MVYA 2G4FA 3EJTA 3A21A 1XV8A 3WD4A 1TQSA 2Y2WA 3OZPA 4D71A 2WCAA 1CGWA 1E4IA 1QOXA 5CGMA 3VGEA 3WF3A 3WH6A 3T0DA 1W9BM 1JDDA 2DGAA 1OBAA 3DX3A 3O2LA 3WQ8A 4CU6A 3CPUA 3RPMA 5BXPA 7A3HA 2GVYA 2FYVA 1V6XA 1AQHA 2BXYA 1XCXA 3AIQA 1H11A 2W61A 3SCOA 3B8SA 2QV4A 4MNJA 3THDA 8A3HA 1TVNA 3SCWA 2ZOXA 3ZQ9A 3G6LA 1KR0A 4Z2LA 1GOMA 2O9RA 1JYNA 3UCQA 3VDCA 3AHZA 4AZ7A 3DHUA 4Z2JA 1PX4A 3PZMA 5IXEA 3KL0A 3IJ8A 3RILA 3VDHA 2XPKA 4MNLA 1GUVA 3EDJA 4TUFA 1LQ0A 5A2BA 1IZKA 5LA1A 4F66A 3BAYA 2AOSA 1WDRA 3DYOA 1UD8A 1VFOA 2WCGA 3AI0A 1JZ4A 1QPKA 4AD5A 3WENA 4J28A 1J0KA 3H55A 1ITCA 4A3HA 2ZX8A 3AOFA 3AXHA 4TVCA 3VM5A 3AS1A 1SMAA 4HMEA 2DEPA 2D2OA 4JKKA 1CXEA 2G41A 4DM2A 3VUPA 5A69A 4NZFA 2RGLA 4FNRA 3FAXA 1J0JA 1OWQA 4X0VA 1UG6A 2PB1A 1OGSA 1WKYA 5A6BD 2BHZA 2F61A 4FLOA 5ECUA 5HPOA 3ARTA 4OGZA 2D3NA 2J4GA 1OD8A 3FW6A 4WK9A 3WSUA 4AWEA 1HJWA 9CGTA 1DWJM 3BLBA 1PBGA 4YN5A 4FLRA 3TTQA 4M24A 1W1YA 2GUYA 1E72M 3SEPA 3WEMA 2X2HA 3OGSA 3OG2A 4JKLA 5EBAA 1VBRA 5D9NA 4MDPA 4J3SA 3DYPA 5CSUA 1QNSA 4EK7A 2ZUVA 4TOQA 3U7BA 2PWFA 4TTGA 3L4TA 1VEMA 2NSXA 1XYFA 3TONA 4D6FA 1W1VA 4GXPA 4PMDA 4AZCB 1OSEA 2VRQA 1GOQA 5JIWA 4PSRA 1GJWA 4JL1A 1CWYA 2EPKX 3GH5A 3FN9A 4JAWA 1PS3A 4W8AA 1LJYA 4NZCA 3WMSA 1FH7A 5F7UA 2G8ZA 3AZRA 4AXNA 5ABFA 3HU7A 2O92A 2ZUSA 3CMGA 2ESCA 5GNXA 1KCLA 3ZJ8A 5FCZA 2C0HA 1G0CA 4GPNA 2F7PA 1XC6A 4WSJA 3WD3A 4AW7A 1BFNA 2PBGA 1EQPA 1E6ZA 3EJPA 4PTWA 1BYBA 5AC4A 3AMLA 3K1DA 3B9DA 1HVQA 2DH3A 4GIAA 4MB4A 3AZTA 1J9YA 5I5RA 1PIFA 3AJ7A 4LXFA 1E43A 1J0YA 1MXGA 3JUGA 1U30A 3PZVA 2E9MA 1HKJA 3GXMA 4ML4A 2G3MA 3FHQA 4AYSA 1E4NA 2B31A 2WK2A 2DT1A 4QFUA 2D0HA 4ATDA 2WSKA 1DWFM 2QPSA 3L4UA 4U2ZA 2E4TA 3ARZA 1E4LA 1JZ5A 4B9ZA 2QLYA 4H7VA 2EJ1A 1PX8A 1UZ4A 1JNEA 1OGGA 1HP4A 3CGTA 1W3LA 4PTVA 4NSBA 2V3DA 3J7HA 2VCCA 2WANA 5CLWA 1ZJAA 2XVKA 1VAHA 3ARRA 3EDEA 1JD7A 2WVTA 2XJ7A 2W62A 1XSKA 3L4XA 3WNPA 4N0RA 3BVVA 1PZ2A 3GXNA 2O9PA 4AY1A 4DWSB 1E5NA 3MANA 2YFNA 5D4YA 4CD7A 1NARA 3NCOA 1V02E 1HTYA 3OGVA 1CLVA 2W63A 2VZUA 2YLLA 1QWNA 4CN6A 3N13A 1HWWA 5HDRA 3VX1A 3CZJA 1J0ZA 1W3KA 1H3GA 8CGTA 3VIKA 1JZ6A 3F5JA 1QI4A 2EPMX 4F79A 4WF7A 3FXYA 3W4RA 1E40A 4K68A 1E3XA 1QBAA 2PI6A 1W9VA 2O9OA 1MWOA 2WC7A 1MYRA 1JZ7A 5A95A 3W38A 1Q6CA 1UKTA 3VD9A 4ACYA 3VOCA 1B9ZA 3DHPA 3W37A 1XSJA 5JIPA 2D3LA 3IGUA 5CPSA 4V2XA 3POHA 4FNSA 1XD0A 3IAPA 5D8ZA 2BHYA 4W84A 3GBEA 1C8YA 3VINA 4CCCA 1J10A 3BSGA 1NM9A 4ZE4A 1E1EA 4EKJA 2OWXA 3AIBA 4J3VA 4IPLA 4JFUA 1CXLA 2WMFA 3ZT7A 4P8VA 1R87A 3NYDA 1CENA 4MJ4A 2J7HA 2J7GA 1UR8A 3VU2A 3RIKA 4P7LA 1QWUA 3AS2A 1UWRA 3BUIA 3VGHA 3WD1A 3CTTA 3WD0A 3VSVA 3MSDA 3I3EA 4TVUA 2GFTA 1IT0A 3AS0A 4M80A 1C8XA 4WIWA 3S2CA 5CZKA 3WNOA 3F4VA 1L0PA 2EAEA 4U2YA 1BHGA 5BRPA 1TCMA 3L4WA 2XVNA 2XVPA 1JYXA 1E56A 1TA3B 3EJRA 2WMHA 3S6TA 2WVUA 2G3NA 1KTCA 1XCWA 5E70A 3PZNA 2OWCA 1MW3A 4MB5A 2BXZA 4FNQA 2XVGA 4H2CA 3ZMRA 4YHEA 3CZ8A 3ZT6A 1OB0A 2VQTA 1CXFA 3WH9A 3NSXA 4M81A 2V5DA 1PZ3A 4HTYA 3KL5A 1UWSA 2VNCA 2YL8A 1ZJBA 3W29A 3L2LA 1U2YA 1H1NA 1V6WA 1JFXA 1CGVA 2VQUA 1LG2A 5LYRA 3K8LA 1VJSA 2J7FA 5IFTA 3VSUA 2OSWA 3A4AA 4ATWA 3ZSSA 1CGYA 2YDSA 3VIJA 1JIBA 1JL8A 2O9TA 1R8LA 3CUFA 3MKKA 3ARVA 4UQDA 4HZ8A 4LQ1A 3MO4A 2PWEA 3CZGA 2VCBA 4AEFA 2W5FA 1R33A 4XB3A 3CUIA 1KXVA 4AMXA 4V27A 1FOBA 3RCNA 4Q22A 3W27A 4JHZA 5A8NA 1KB3A 1OCQA 3B9AA 3AIVA 1E55A 1H4PA 2DIJA 3CC1A 4PCSA 3WH7A 4GO8A 3KEHA 4BQ2A 1UH4A 3RM8A 3NUKA 3EJSA 1HXKA 4GZIA 1E0WA 3AMCA 1E9LA 4W5UA 1UR9A 1JYWA 1WZMA 1UHVA 2BVYA 2DT0A 1RP8A 4CGTA 2Q8XA 3CHCA 1QW8A 3CO4A 4PBGA 3UG4A 4D6GA 2WZHA 1CGXA 5EFFA 3RMEA 2X05A 2XM1A 2OSXA 3MS8A 2ALWA 1E73M 3SCVA 5AYIA 3WQVA 4HP5A 4LX4A 4ZXLA 1VF8A 2C8NA 4B3KA 3HJEA 3ZIZA 3OA5A 4OBSA 1BF2A 4J3WA 4GI8A 2F8QA 2W67A 3II1A 4CCDA 4AZBA 1J01A 1JXJA 5DT5A 4ZE5A 1JI1A 3L4YA 1JI2A 3TV8A 3VIHA 1FA2A 5I6SA 2WNWA 1B3VA 4JKMA 2F2HA 3D52A 2PBOA 1KBKA 3GXPA 3TTSA 4UFIA 3FAWA 2Y4SA 3VD4A 2FDMA 3PZUA 5I79A 1UWQA 5BYWA 1WE5A 2QF8A 4WLCA 2OYLA 2CIPA 4E8DA 2W66A 1HL8A 2IXUA 6TAAA 3UETA 3SUSA 1AQMA 3WDRA 3BAIA 3GXTA 4AZIA 4JCLA 4DO6A 3GTNA 2VJXA 3HG2A 5I78A 4A4AA 1BSIA 3D4YA 3K4AA 1QNOA 1QI2A 1QHOA 2UY2A 4OKDA 1R86A 3DX0A 2X2IA 2CBVA 1VFMA 2XTKA 2WC3A 2IUZA 2XFYA 4PMOA 4J7RA 5GNYA 1BPLB 3VGFA 5GQBA 5D9MA 1W91A 4QP0A 5DEZA 2DH2A 3BLKA 3WNKA 3HN3A 3SUTA 3WD2A 2CHNA 1K9FA 2DSZA 3TA9A 3OGRA 2WKGA 3OIHA 3K8MA 1E4MM 2E9BA 1KR1A 4XX6A 4MAVA 1LL6A 2E3ZA 3ZR5A 2FH8A 1WDSA 3N11A 5E0FA 4W7WA 4UFHA 4L4OA 1LWJA 3VSTA 2YA2A 2WHKA 1KBBA 1EOKA 4TX8A 1HT6A 4RL3A 1C8QA 3WF2A 5AC5A 1BYAA 3W28A 1MFUA 4ACZB 2WMIB 1RPKA 2E9LA 4CCEA 1QNRA 1U33A 3KLLA 1VEPA 1PEZA 3KLKA 3HZ3A 2QHAA 3UG3A 1ECEA 2EXOA 2WAGA 4FLSA 1UOKA 2BY2A 3WNMA 1GOOA 1GQLA 4W8BA 1WZLA 3K46A 3S5YA 4AMWA 4UFLA 3U7VA 5FIPA 1SYTA 4C7GA 3SCPA 4M82A 5EB8A 4AIUA 3WDQA 3WY1A 1PJ9A 3WMCA 2PWDA 2VVSA 4W89A 3I3BA 2ZX7A 5LA2A 2JIWA 3VPLA 2VX6A 1VEOA 1W3JA 4U5IA 3KWXA 6CGTA 4GINA 2DSVA 5CQ1A 1F4HA 5DO8A 4S3JA 2YBUA 3CZEA 4R27A 3T2QA 2EEXA 1CPUA 1BYCA 1JG9A 1D7FA 3SCQA 3CLWA 3GNPA 3NJ3A 1V3JA 1GW1A 4W5ZA 4W86A 2WZIA 3VX0A
chains in the Genus database with same CATH superfamily
2KH2B 4DP0X 3RR1A 1R19A 2NQZA 5FS5A 4A04A 2WHMA 3MRHA 4MCMA 1UEYA 2DJ4A 4OFVA 1E2ZA 3ARDC 5T5NF 3O6KH 4XO7A 2GK2A 2DSUA 2OMZB 4H1LB 3FMGH 2VO5A 4NM4L 2WXDM 4XD6A 3TA9A 4HWUA 2QKIC 4JE4B 3U2IA 4BUHA 1L0XA 4DAGL 1MDRA 1QUNB 1PAMA 2XZCH 3CSPA 4LCWD 4Q2ZB 1ZK5A 1NQ6A 3AUJA 3S8GB 1CE1L 1RULH 1NUDA 1SGKA 3MMEB 4B0MM 3H7UA 1HAWA 3BP7A 4B2DD 4KMTH 4IHOA 4YJ5A 1JZIA 2F19H 3SCTA 1BM3H 4AB4A 3KBHE 1PY9A 4JHWH 2CXGA 2X70B 3MACH 5CEZL 3TF4A 2Y70A 3R5EA 3D2UD 4HUXA 3PY2A 3MRNA 3CFJA 4Z7WF 1X9LA 3VIMA 3W1NA 1A2YA 5SWSA 3QXUA 5H94A 3LKQB 4LL1A 4BEIA 1RL1A 2ITEA 4KK8C 2BODX 1KCVL 1VFTA 4KO9A 5L4JA 4UQBA 1OFOA 1FAKT 4FNLL 5HAOA 4OFYD 1VFHA 4FHKA 5J9PA 4IFRA 3ABGA 4GZEA 1CLKA 1ZCOA 2JKEA 5RUBA 3DVFA 3OR7A 4LKXA 4PJ7F 2V81A 4DF2A 2H6UA 1FLTX 2C7UB 4JZJC 3LOWA 1TV7A 2CCVA 3VKKA 4GUFA 5BZAA 1OARH 1OD9A 32C2B 2K3HA 4AGOA 2OEMA 2WJZA 5KETA 1BVLA 3NJGA 3LMJL 4GQPH 2OTPA 3BH8A 1JJUA 3OTTA 4OLWL 2JJVA 4XCYA 1OX4B 2VTFA 1UR2A 1Y18A 1YEIL 4LYQA 3SJVE 3T2OA 1XF0A 5AZ2L 1M1XB 5CG0A 3NPSB 3LEVL 1DQLL 3AVEA 4MNGB 4GUQA 2PWGA 4HF5L 4CVZA 3DX4A 4FF7A 1DBMH 5IT2L 1ODZA 3GZPA 1SJHA 1M1XA 1S7VB 1A3HA 4X61A 5F9DC 2CLLA 3EH2A 1AZNA 1BZQK 4AWTA 3X1FA 1DEEB 4RW3A 3GUGA 1XCFA 1TF4A 1OAYL 2J1WA 3PHAA 5I0XA 5TK2A 5IVXB 5D71H 1NWSA 2FYMA 4QEEA 4FQXC 4O1AA 4C7DA 2XPYA 4NHCH 3KYAA 3CUHA 3FPXA 3BD5A 5DJDA 5EU6D 3PANA 2P5ED 1XLHA 3UP8A 1L7TH 3OVPA 1SJMA 3V6OA 3LN4A 3FCTA 4JR9H 4HHMA 4UI2A 4H8WH 3QORC 2EDMA 2P8LB 1KBGL 2BM3A 1P69B 3R8RA 2O61A 1RVFH 2WLYA 2NYYC 4GBXA 4L4TE 1JGVL 4CKQA 1Z41A 3VDGA 4XXWC 4DZIA 3ZOAA 5G5DB 4YHMH 4KWVA 4EPKA 2AF2A 1AXIB 3BMVA 1N7KA 1FYTA 3ETBJ 5TJWK 4DGYH 1EJ6A 1HL9A 4JY4A 4M8VA 4HCGA 4XCNA 2QULA 4OZHE 1PKQA 4XNUH 3B06A 5GJPA 4F93B 1LO0L 2BP8B 4N6RA 1B4JH 3FFDA 1OYBA 3GRIA 5I2UA 2B9AA 4IL0A 4I7VA 4JDYA 4WWKD 4LT9A 4HT1L 1WO2A 5SWQA 4K94H 1KCBA 2E56A 4N0CC 4R3UA 1W5NA 3MR9B 3W7GA 3QM3A 1XG4A 4AZGA 4UFKA 4POZD 5EFIA 2H3NA 3IU4L 3FU7A 3O8XD 4WV1A 3WZ0E 1YDNA 5BRQA 2FIKA 5SWZE 4LNCA 3UAAA 4JQ2A 1B0IA 4FXGA 4XOCA 2HNEA 3LRHA 2YMXH 5KBKA 1CVRA 4ENZA 2FPYA 1O4UA 3I75B 1LP9B 2BLEA 3OQEA 4ZB5A 5KVFL 5KTEH 1NAMH 1QZ1A 3HV8A 4XZ9A 2CLZA 3VNIA 4S11A 2WIMA 4YCOA 4MA3A 5IBTH 1PDKB 1T5WA 4D2NA 4EIUA 3C2SA 2C1IA 2OLHA 4IS6A 4Y8EA 3GZAA 1BQLL 3N2CA 3LPOA 4N9OB 4PBXA 2F54D 4PJIA 2ZT9C 4U1GB 3SBPA 2FZMA 3O9WC 5FL1A 2OSLA 4HS3B 1WWAX 4JCMA 3CBWA 3DV4B 5CC7A 4HJGA 4EQ3A 4N0YL 3N1PC 2AXJA 4PIRF 1FNSH 2CPUA 3T3ME 3SPGA 3F7PC 4KKZA 3BRDA 4MMXB 1PIIA 5HHMD 3IM1A 4GAJH 4B27A 1LLOA 2WVSA 2GJXA 5EMJA 4NLHA 2VDGA 3P80A 2FZ9A 3QJZA 4MLIA 3FYPA 1V3MA 3EPNA 5I76B 5E6YA 1K3UA 4P3CH 2EDRA 1ONWA 1AP2A 3ULSB 4MCYA 5BOEA 1BD2A 3BJFA 4FABH 2A6IB 2J27A 3W70A 1LRTA 3UYRH 4AIOA 4HA4A 4O13A 5DELA 1P1ZB 3S8HA 2JKLA 1MHCA 2DQWA 3HC3L 4NRRA 1QI5A 1AZCA 2A6JB 3UOAB 4ZFFB 1EX5A 1JPSH 1KTNA 1BFOA 2JH2A 2F1BA 2GFBB 4HIEB 4JFEA 1WQVT 4G7RB 4HGWA 5EZIL 4DP5X 1V0MA 2WB5A 1P9MA 2R7EA 2HH0L 4Y7OC 3HGSA 1FUNA 2DSKA 3LSOB 1JGIA 3GSRA 2V5JA 1KPRA 4KWUA 1QBLL 2XA8H 3MV7B 4ZRGA 2Y36L 3RVVD 3ATBA 4MX7B 5JLZA 4JX4A 1K9EA 1SGJA 1BX2A 1KCZA 2CCRA 4ELMB 3JSSA 1FHDA 5HJYA 3I9IA 4J12A 3ARUA 1MHHA 1ZB5A 3WL1A 4P2YA 1BZ7B 4U6TA 3A3XA 5I07A 2HRPL 2IGTA 3IDJB 2JLPA 3QQ4B 4K7VA 2QSQA 5D03A 2MCG1 1T7YA 5EOCL 1A3QA 2VDKH 3QR0A 4XVUC 5D7SH 5DBUA 1QO3B 2E46A 4NYUA 2CLVA 2JF6A 1DWHM 5ABZA 1AI1H 4PGBB 2W91A 2PDYA 2R56H 4QF1A 2GK1B 4MAUL 5JA8B 1DHKA 4D6EA 4LU0A 2YS4A 4G2DA 2DKUA 2GAZA 3U7WL 3IUHA 2CO6B 1SEQL 4KRZA 3MA7B 3HRZA 3MMDA 1ZAGA 3C60B 3W5NA 5AVXB 3B8IA 1M1BA 3D39B 3UZQA 3W1ZA 3L1EA 4BFRA 4A3HA 1VB9A 2KL6A 4OLYL 4GAYA 3BMWA 3GRWH 5F2FA 2CJSA 3FTSA 3GM8A 2VDLH 4HXAL 1IT7A 1E15A 5CPLA 1EH9A 1PLGL 4JQ4A 1CG9A 4O2FA 2BGSA 3BP4A 3R43A 2WZ5A 4NQEE 1R3RA 3RJQB 4ZOCA 1XH3A 3L3OA 3R06A 4JDTL 3TXAA 1L3WA 1T6MA 3T3MF 1XTLA 3DI2B 1TQTA 4JW3A 3HE7D 1LDSA 3QYCA 1P1XA 2XGIA 2L4OA 2CA4A 1X4YA 1CGTA 3WOVA 1AZBA 4E41D 1Z3NA 2FGZA 2Z6FA 1QPOA 4BWTA 5JQ6H 1X4ZA 3HG4A 1I4FA 1OTUC 3BTNA 4B91A 3CXDH 3Q8AA 4GMTL 3CQPA 2NUPA 1TVPA 5LWYL 1WWBX 5HR7A 1GZ1A 5CJQH 1S8DA 2W80C 1ADQL 2VW6A 1WP6A 2QELA 1N4XH 2Z4QB 3KPRA 1S8DB 4GY4A 3SE9H 3G1SA 3CEPA 4ZQNA 4HWEH 2NUPB 4B6ZA 2NZ9D 5C0EB 2K78A 5EZOL 4XKYB 2KZHA 2FEDC 3RU8L 5CCHE 1YEFH 1G4PA 5ERWA 3BH4A 3SW6A 1D3GA 4UBDC 1IRAY 4ZOEA 5T1DH 5A8MA 3PWUA 3SZKC 2R6OA 2NUTB 2WXKA 5H2ZA 4ETQA 1ZZMA 4F0RA 1SUJA 5GGQL 2Y5TB 1H0DA 5T1LA 3ZKXC 5IM7A 1RD5A 2JB5L 3MV9B 4U3SB 2DJXA 2Z6JA 1G7IB 2ZUWA 1AQDB 3VIOA 1SYVB 3F6LA 5BU9A 1MCQA 4XAYA 1UH2A 2F74A 4BQBA 2J9XA 2FGBA 2ZONA 5FR3A 3EGSA 2FECI 1IKOP 3IGAA 2VELA 5ALBL 4X99B 4LVHB 1KFCA 5IQNA 1PLGH 4G1MB 5CU9A 1TO5A 4L48A 5I6OA 1T1ZA 2DD8H 3CB3A 1P84K 3T1GA 1MY5A 1GPOH 5KSVB 3A3HA 1FWGC 5BO1H 3S4SA 2PWVA 3MV7A 4YO0B 4OVUA 1YNKL 3RPIB 5K9KA 3M44A 3T0AA 2IALB 1YTEA 2VQ4A 3WSQL 4GPVA 3HOGA 4JZOA 3GU2A 4UFMA 2ZX5A 3M7SA 1E4XL 3H2WA 1NP0A 2KDYA 4DZBA 4W9EC 1UURA 4UZGA 1WAEA 3WY4A 4XMPL 4JNYA 4A3YA 1D7KA 3U2CA 3PQYB 2ZPKL 1GPWA 2W9MA 3PGDB 1E7VA 1MREH 1M41A 1FORH 2X3CA 2QCCA 3STPA 1GGTA 3MV7D 1A4LA 5C0RH 3BZGA 4FP1A 1FC2D 4F0LA 3UWUA 1YEFL 4AQ1B 1IGMH 2A3EA 3W88A 1B3YA 4AT6A 5DA0B 1OWRM 2RMNA 2D2GA 1H3PL 4H26A 4NCC1 1JDFA 3MUAA 3O9WD 4A7QA 4EUPB 2NXIA 2IGFH 5G1TA 1MHEA 2F58L 2G9HA 3BN3B 4NJKA 2JALA 4TSBH 1W9PA 1S5HA 3TV3H 4NBZB 1ICQA 3RDTC 5FM5O 1PL3A 4X4YB 3MOBL 4JKPL 1E70M 3M4HA 5LJYH 1IAII 5I1DB 2YAFA 1MHCB 4RESB 2GJ6E 4OZOA 1K2DA 1JPHA 4ZTXA 2UXFA 4P2OC 4F0SA 2E5BA 5BRZE 3IKKA 1AMXA 2D73A 4IUGA 5MHBA 1QUPA 5CSYA 4BHYA 4MJJA 2X4SB 4PVMA 1P84J 2MQ3A 1EMTL 4LGRB 1F6AB 2D0GA 3VD3A 3WFZA 4HQVA 4E5TA 3TW7A 1CNVA 1EJ7L 1I45A 5DHXB 2AJYH 3UH8A 5CC3A 2PXYA 5L2KA 3KZ8A 1XJBA 2X16A 2X0SA 3BP6A 3W56A 3WF0A 1W8GA 5CGYD 4RCXA 2BASA 4QYOB 3F3HA 4G8TA 1KLGB 2O6PA 4G7YH 3FCGA 4OCSH 2DBLH 1E6SM 2TSYA 2UZYB 4YEFA 5C9JA 3BCFA 2JKNA 4IRJD 5GRJL 1KWGA 4CNPA 4QT5B 4RGMB 4MKTA 4XE5B 5FJOA 3VCRA 2FHBA 3HVDA 1CTOA 1J8SA 3HE7A 4F80A 2NSMA 3IRPX 3G5XA 4QLKA 2QUUA 3QIWB 4IOSD 4AMKL 1P6FA 1DXFA 3RVVC 5KZEA 4BKSC 2VYRE 3CL8A 3GQYA 4AD0A 1XB6A 1DVXA 2IW0A 3ZE1F 5TBOA 1SM9A 3JS3A 1V93A 1TITA 4HMNA 4AD1A 2JI3A 3B0UX 2K8QA 1NAMB 3IFPB 4LSUL 5DK0A 2V0AA 4TQHA 4U6HB 3C2RA 5EMYA 2J66A 4LW7A 3GTFA 1M7OA 5L0QC 2BY3A 2VT0A 4MHHI 1NEZB 2KZKA 4N8CH 4ZZKA 5A2FA 5K1NA 3K4WA 1ZA6B 3MRPB 4N2AA 1WK0A 3AIEA 3LHUA 1FGNH 3WUBA 3PZIA 5LNRA 1LDPH 2XN1A 3IJSB 5J6HB 1ZWIB 4MSWB 4O02B 2Y2YA 1V6VA 2IXQB 3BAKA 2POTA 3F5KA 1SFSA 2GSEA 1F4WH 2IGLA 1BBDL 3N2OA 3ZS4A 1ZV9A 1LVEA 4QO1A 1NANI 4XT1C 3IV3A 1BQ5A 1G7IA 2GWGA 4MPQA 3DTXA 1J1PL 3JUYA 3H54A 4FI4A 5EORH 1T8QA 3QQ9C 1KG0A 1IT9L 3H42H 3PWPD 4GQRA 1F3JA 4HT1H 3BZ4B 1I1AA 4GAGL 4IKKA 1S3KH 2AI0L 2P5WD 4MJIE 4Z3HA 2GJJA 4Z3GA 3F05A 1S1PA 3GI9H 5EIVA 2P47B 2QGYA 4Q4SA 5DRIA 4X7SH 1OAYH 1KQYA 1V5JA 2IPJA 2RCSH 3CDZB 3FB5B 4G7VL 4WRLA 5DHDA 3WFCH 2QBWA 4FXTA 4XNDA 1B30A 2Q7NA 1RAKA 4N9EA 1FL5B 1EJ8A 3W81A 1GQJA 3JW7A 4APQC 4ORZC 1MHPL 1QTPA 1D5ZB 3PQYE 4AYEC 3M7WA 5G4EA 2A83A 1CLXA 4F7TA 2QQLL 1WH0A 4D9QD 3L68A 4U3SA 4AD2A 3UWVA 2C9AA 3CV2A 3GHEL 4QIUA 3FSVA 2NUTA 2QGCA 1W1IE 1PNDA 4X9IA 3SBWA 2BX5A 1KV7A 2D2CC 3SDYL 3DJRA 2ENPA 1SO3A 2P8MA 4PR5A 3QQWA 2ESVB 1FY6A 4BCEA 5D32A 5CJ8A 4DJEC 4YDJA 4GIRA 1QO5A 5HWJA 4NIKB 1F3XA 1WFNA 5AL0A 1K70A 1V03A 4R7DA 4NZ5A 5DC0A 3AROA 2PP9A 1A2YB 1NCUA 2TRYA 5E8NB 3C8KA 5SWSB 1AGBB 3GAYA 4AMCA 4HHAA 2EO7A 2HKHH 4AUJA 4P46D 4NUMA 3H4XA 4EP8C 43CAA 1MJ7H 2XVLA 1AY1L 3HG1D 2XDFA 2APTA 4HMDA 5BXTA 3GHSA 5IRPA 3TN0A 3D06A 3MLXL 4OGYL 1RZIB 1CFQA 5E2UH 4UOW0 1AGFB 1BEYL 3QQXA 5E6SB 1ML1A 1FNGB 2UY7B 1OF0A 3OKDA 2NY4B 4YAQB 1SFHA 2VLRB 4OGYH 5J12C 1L5GA 4MAZA 2CO1A 2F19L 3X12A 3LXUX 1GOIA 5EF2A 3GSMA 1I85A 3RPTA 4NO0B 3C6LB 5DJCB 4IJCA 3QOKA 3QQ1A 4PTXA 5A2AA 3SKNB 5C1MB 5E9DD 2IFFH 3F7LA 1BZ8A 2QKFA 4FFZH 1U5JA 2BTMA 4WI5A 2B4CC 2H6PB 2Z92A 1BEXA 2PTVA 3CT2A 4L64A 5J6SA 1QX1A 2HP4A 2XYLA 3AUVA 3H22A 4I6VA 5C09E 2Y3NA 1XX9C 2B7DT 3WO4B 3DX1A 5KVMC 3A4JA 1KBGH 3DG6A 5MKGA 2F54B 1I3UA 1FFOA 5C07D 4W88A 1L6ZA 3TNOA 4JO3L 4M4RA 1RALA 1Q94A 2YKLL 3DX7B 1CMOA 3FF8A 1PZCA 1QO3A 5AW4B 2J88L 4GKLA 1T96A 1YLVA 2XH7A 3CMJA 3EEGA 4WXYA 3LD8B 4XBJA 1DVYA 3C0SA 3QYMA 3DIPA 3QFEA 3FU0A 3O6FA 3UR8A 3O7UA 3AQDA 2OSYA 4HS8H 3FRPG 3KPRD 3GQFA 2BV9A 5DMGD 1AD9B 3UXLA 4LUYA 4E36A 3M17A 4LLYB 4OZIB 1R85A 2CKRA 4H8WC 4Q4RA 4KXBA 4P8WA 3P0XA 3VILA 3HQNA 4LDCA 3WUFA 2V2DA 2NY7H 3CLEH 3RX9A 3TCLB 3T6WA 4A7SA 3OKLA 2Z34A 2CZVA 3CFNA 1MW0A 4R7JA 1O9WA 1VDGA 1DVFD 3OKKA 2KLTA 4PLJC 3X11B 1TTJA 4HSHA 4MYAA 3B9KD 4MJIB 3SE3A 3X11A 4HU8A 2JF7A 4GO9A 4WI7A 3U5UA 3NSJA 2CERA 5EO9A 1URLA 4J3UA 2EE0A 3WMBA 4PJGB 4W9KC 3IAQA 4XMZA 2NV1A 5K9JL 5A6BA 2UXVA 2PPDA 5IW1B 2VLMD 4EEEA 4UTUA 4ODVL 4PJCA 3P9WB 3JWOH 3U1PA 4HPHA 1RK5A 3MZGB 4GMEA 4JEQA 4YLBA 2YLAA 4F8QA 4CSZA 3ATZA 2XPZA 3L9RB 1NCJA 2J7BA 1P7BA 2Z0BA 4K3GA 3V0DA 2H2SC 4FG2A 5DVKA 3OR6B 3UROR 1KYFA 2BDNL 4E9QA 3LIZL 3L4ZA 4NENA 2NNAA 5IM7B 4LAOA 4KKBD 4YHOL 1BFVH 1Y5WA 4UCGA 4JRLA 3MRLA 3TBWB 5AAWC 2QQQA 1B57A 2Z2AA 1FE8L 5I19H 5TD4A 5M7QA 3V0GA 5IHRA 2B4CL 1YPZF 3P4MA 5J1SC 3MUXA 4EXAA 5I74B 3EWYA 5H8PA 1NF7A 1BAWA 1IYXA 2X10A 4FI6A 1I9IL 4GQ0A 4I87A 1NH6A 2Z4TA 5LNEA 3DRQA 2XWEA 3ILQD 1JXKA 4LNVA 1JQXA 1NKGA 4W4OA 3I50L 4X98A 1KJMB 2WHJA 2YCLA 1RU9H 1M57B 2CO2A 4QXGH 3T2LA 3MMTA 1LO3H 3S96B 3GLAA 12E8L 2FIKB 4QHPA 2L7EA 1V6YA 4M7TA 3QXTA 1QR1A 3C5QA 4BS0A 1JCKA 1YN6B 1HQ4A 1W8EA 4OFPA 4QHLB 1BQGA 4YU1A 3DFPA 3W71A 1G94A 2AERT 2YCJA 1JXDA 1PXGA 4C6CA 5J04A 2HN7A 5EA0H 4HZLA 4HHLA 3AXXA 3KCPB 4XQ6A 4WJ8A 1J8VA 3VDBA 3UBXA 4RNRB 1R9XA 4B4FA 2VIRA 3QRBA 3ROLA 3H70A 3WUGA 3IPEA 1F6PA 3C5ZD 2GGJA 1WIOA 2R1YA 2BC4B 5LNWA 3RIAK 2BOLA 2BSLA 4LBSA 2AQVA 3C2YA 1KLZA 4M5YL 5J3HC 4Y0GA 1D5RA 4PRNB 1JCJA 4XAWL 1OLZA 3ILEA 3N0PB 3I6KA 4X4MA 5KYUB 1GW9A 5IB4B 2IPUG 1R2SA 5C3TA 5IHHA 3P2BA 4L4MA 3X2QB 1FV1A 3OKOA 1GEQA 1Q6RA 3LKNA 5FCUL 3PABB 3VNYA 1SXBA 3NQIA 4ODSH 1RH9A 3ULUD 3GJFA 2XIMA 1P7QA 3LKOA 4PJEE 5JIHA 2QDVA 2J24A 3SN0A 1IFHL 1IM9A 1IGIH 2D24A 3PBGA 4PBFA 2DZBA 1VCBC 5IHSA 5K1JA 2QKIB 4JG0L 3HURA 5A6IA 4OF6A 5IP4A 1HILA 2AFNA 2F7QA 3VFGL 1PTAA 4N6EA 2EXWC 5B1AB 1W32A 2BB0A 3KPPA 4R9OA 4B3LA 2KT6A 4TF4A 4OM1H 2PDWA 5ABFB 5IJVB 1EUAA 4F8LA 4KEMA 3HVNA 3VD7A 3AHTA 3IS0X 2R91A 2EYTB 5D1XA 3AWFA 3ARBC 3UDWC 3F00A 3VVWA 4DPCX 5IHZA 2WUCH 3BQUB 3GEWB 1ACZA 2DM3A 1PL9A 2EDTA 1KT2B 4QE4A 2ZXQA 1AZVA 1HI6A 5GGTL 1A7QH 1FLRH 1XIWA 4JUSA 3BZEA 5LIUX 2WYIA 1SO4A 3I2CH 3MYPA 5JBDA 3KM2A 1XSIA 2GGIA 1M7IB 4FYTA 4UQ9A 4KH2A 1DJHA 1B3ZA 4CNUA 3SCMC 2A6IA 1TPFA 3D46A 4EI5B 4DVRL 1QFWL 1BAFL 3BRFA 1MCWM 3IPBA 4X9GA 1P4IL 5DS8A 1MEXL 4FZEL 5T33H 5BXFA 2WO2B 4HJEA 1MI5D 4JFOB 1AGDA 1OQXA 4MX7A 1JPFA 3LLDA 4WKHA 2ICES 1RJRA 3D3FA 1MFDL 2CLRA 3HPLB 3GS0A 4XWOD 3IFPA 5JZ7C 1U3NA 1NUFA 4LSPH 3MRQA 2DUAA 3STGA 1MFDH 3CVHB 3GFYA 1MCEA 3CFJB 3BQVA 3ZE2B 1AL8A 1JUFA 3QJSB 4J3OF 5DLML 5DA4A 2HKFH 4DK5A 1KJ2L 2HT3D 2WBGA 5I16B 1FGVH 1P4BH 3TZVA 3MRDB 4E8GA 1T66D 4HJJL 4EIBA 1Q9OA 2Y3AA 1TQJA 3NDZA 3BYTA 1EEXA 1T3FA 4P2CG 1R3WA 4DBWA 2ZAGA 4PJFB 3BWWA 4ICWA 4LS1A 4GYFA 4QRRD 2F53B 1WYIA 1YTKA 4DFHA 4P2QD 2WUCL 5EIIA 4M43L 1UOLA 3RX3A 1YEDB 4EANA 5DF0A 5DHVA 4INFA 4Q7BA 3BJ91 3ILPB 2AEWA 3BGAA 1KCSH 1ASPA 1A7RL 1NSNL 2EE2A 2IADA 3CBJB 4FYSA 4JG1L 4AM0Q 1IGWA 5ISZA 4N3UA 3WK0A 3CLFH 5EZOH 5EEVA 3V4VH 4LRIC 5HMSA 5IHUH 5BWAA 5EU6A 1I9JL 3SZ6A 1HYSD 3E2HB 4PJAE 3AFLA 3MX0B 4PJFF 3UBXI 4ZMWA 1ONXA 2JFEX 4J40A 3WIFB 3WTYA 3EYSL 25C8L 1N6QL 1K03A 4J8RB 3I7QA 3WFAA 3BC9A 1H3TA 1EEZA 2AXGA 5AW3B 1ZT1B 3FU8A 3VGDA 1L6SA 3ZJ7A 7XIMA 4MA3B 2RJGA 4D6CA 5GGRA 1AQ0A 2FQIA 2CDFB 3MUZ1 1A7PH 1DQJA 2F5BL 1F8IA 3ID7A 3RWEB 4HW6A 1DLFH 2F5AL 2BIQA 3M0LA 3UWEA 1UVQB 1RFDL 1G6RB 4UT6A 1N59A 4S2BA 2Y22A 4FNPA 3V55A 5CEZH 5CSGA 4KXDA 2X1RA 1UT2A 4G2AA 5K9DA 1SF5A 3C87A 4PRHA 3N41F 2P8LA 4RGND 3OF6D 1U91B 4AV0A 4BQCA 2A74C 4ZS7H 2J8UA 5JQHC 4GKSB 4OCXH 1QR4A 2FZBA 2UZ9A 4W8LA 3JTTA 4P5UA 4N02A 1PD0A 3UJJH 3IKCA 4OUIA 4P8XA 1FZMB 3N85L 1TVLA 3UDWA 3TJLA 1AGBA 3PJNA 4URTB 4QWWD 3WLKX 3MUJA 3BV7A 1E50A 4A8RA 2AMUA 3LPWA 2NW2A 2XN9A 3GM0A 4DVOA 3CU1A 4DGVH 1UR3M 5K39B 1K85A 4ISVA 4A2HA 5GSVA 2ZWSA 2FJFB 2JKAA 5IQ9A 4OCLC 3W11D 4GXVL 4S3KA 2NW0A 5AVTB 1HHHB 4X99A 3ZU8A 1N6QH 3O4LB 5I23A 4X6FB 1SNRA 3HI6H 4QXTB 3TYFA 1O1ZA 3AHVA 5A40E 1TYGA 4OE7A 3LHTA 5SWZD 4I48A 4RGOL 4NP9A 4WU7B 1GYUA 4DOHE 1D5BA 2O55A 2XV6B 1A4JA 1I7RB 4PLKD 3UXFA 4FOUA 1NGZB 1KPVB 3IMSA 3RVXD 4C5YA 3ZJAA 4WEVX 3U2SA 3I9PA 3P30H 1UXSB 3GF8A 3GMLA 4IBTA 2XN0A 1B3OA 1KO0A 1VPYA 1R7AA 2ALRA 4LAZA 3FZUD 4OGAC 5H37A 2I14A 2A7PA 1DZBA 3G0XA 5XIMA 1UB5B 4A05A 4RZCA 3ITTA 1LE9A 4UXDA 5D7LD 3IIPA 3KJ4C 4H25A 2IF7A 5EBWA 2BMBA 3H7VA 3V3WA 3E6HA 1N7MH 2PPAA 3CVHL 4BV1A 4H83A 1BVNT 5D2YA 4DYKA 1GSMA 3VRLF 3DROB 1QSZA 3TEWA 1GONA 1QUMA 2A9MH 3FXGA 3K2UH 7TAAA 3H2OA 2R2BA 5C3IA 4Y1AA 1DQUA 2GBAA 2WXQA 3KVPA 1IXQA 3MBFA 4C6PA 5AECA 1IEWA 5KSUB 3UXKA 4J1UA 4LCQA 3TCEA 2C7FA 1OZQA 4ANWA 2XV0A 1CE6B 4R3SA 4PFEA 1L0QA 1S78D 5CZVH 1NPJA 3MRGB 4WEBH 2CXEA 5EN3A 2J62A 1QXLA 4TS6A 2VXVH 5SV4A 2VEGA 2QL1A 1PCSA 2VGLM 3DC0A 4XN1A 5J5DA 2MOVA 4IQHA 4C60A 4Z3TA 1JXGA 1VFUA 3SQOL 1FZKA 2Y07H 4JIRA 2RUSA 4KRTA 4LSTL 5CD5D 5J1TC 2VHLA 3GNRA 3FQWA 2J6EH 3GIZH 2J1ZA 3EGDB 2E7DA 4YDMA 1T1XA 3W9DB 1FX6A 4BH8B 1HE8A 5D6CB 1XGPA 3HB3B 3PHQA 2FR4B 2X70A 3L21A 3MCLL 3T8VA 1KT2A 2VMCA 2YL5A 3A22A 1KCXA 1R3SA 1GTHA 3R0UA 2VXUH 3ECWA 1UFUA 3QFJB 4KK6D 3ZKMC 3DK2A 1OM0A 3AZSA 4F7PA 4GI4A 4M7ZC 1A7OH 5C2CA 2MPAL 4DLMA 4AL8C 1CEOA 3TPUB 4LYKA 2H26B 4PGEB 4U3XA 3CSBA 4P8UA 1B3JA 1RIVH 3DX2A 4LNRB 4NN6C 1NQBA 2OMWB 1XGRA 2VLRE 3QRGH 1ZLSH 4A2FA 2Q7AA 5CD3A 2AJVL 2EXYD 2JJTC 3SKMB 4AEEA 1E6XM 3M41A 3SI9A 2XH4A 1A8ZA 1RV8A 3T4CA 3W1MA 3A5VA 2FX8L 4S3DA 3SY0B 4D1IA 1PTDA 3NQ8A 4C1NB 2TODA 3VXUA 1YMMA 5L4MA 3WQDA 4LVOB 1ZSHA 2YD2A 3W0WA 3GDBA 1QHZA 3HG3A 4GEJA 4MG4A 5KZDA 3NTYA 1LK3H 3FQNB 3K6FA 4NKQB 2WSQA 2R39A 2QQNL 3QDGB 3FQTA 2OXHB 4RXGA 7ODCA 5TE4L 3CPRA 4LUTB 2LFEA 2ZE0A 4OLYH 2WJFA 1ZFJA 2ROYA 4EOWH 1U95A 4G9DB 1RCOB 2B1HL 4OTXL 3T42A 3GLCA 4JNXA 4JR9L 5LNVA 1CLOH 2NY5L 1OAXL 1FH2A 2G2RB 3R2GA 3U4FA 1VADB 2WWCA 2VR4A 4Y1TA 1U8HA 3SGKC 2CJTA 5TFSL 3D47A 4W4OC 3SRKA 4KMQA 3W7DA 4DBDA 2ZD0A 3AM8C 4OZIF 4ILSA 4TNGA 3MRRA 2FUQA 2F18A 5CJ5A 1IILE 1U91A 3M07A 3ZYJA 1T1WA 3O41B 4H9UA 2GVLA 4W9DC 1LL7A 3I2CL 3S98A 1XF1A 2YBGA 2B0SL 3DU0A 3O3DB 3TEVA 4QTIL 4C65A 5AW8B 1RA5A 3QXAA 4HVBA 2ICSA 2A3CA 4EVNB 1DQJB 1HKMA 2IAND 3SDXB 5T5FH 1XF4B 4N2EA 3TEZA 1JVNA 3UCCA 2NWRA 3PXJA 1O5PA 4ZQOA 2ATKB 2BFVL 4OCYL 2WXGA 1IKNC 4MNHA 1AXTH 4U1JB 4F2FA 1QKZH 4GX8A 3T0BA 2BVEA 1PBYA 3EHBD 3M46A 2PYEE 4FQ2L 4HPOH 5JPNC 4GJ1A 2WYZA 3IFOB 4M29A 3HPJB 4QWWC 3BI9X 1Z5LA 3MV11 3NTCL 1PWMA 2I16A 2RD0A 3RB5A 1B5TA 5F6IC 3C86A 1IE5A 5EPMB 2VDLL 1VD6A 4G1NA 4NWUL 5AW5B 2XU2A 4ODWA 3AADB 4UNIA 4DQWA 3ONBA 5I02A 1ET7A 4FXGC 1HHJB 1EB3A 1BIHA 5DI8A 2VRJA 2Q7YA 3EFFA 1OFEA 4HHWA 2XHYA 5GZOA 1LNUB 4NC1C 2NXZB 4H3DA 2HTLD 3LCLA 3I02B 1TFHA 1CFVH 5IJKC 2CRMA 3JVGC 1FDLH 1HINL 4AZCA 3G5ZA 3CK0L 4TUKH 4PW3A 3ZE1B 1NEZG 3VABA 5I1CH 3BGJA 2EDEA 4H8UA 1DANT 1JDCA 2I07B 2EC9T 1JDAA 3DMMC 1OQOA 4LP8A 4NO3A 3ATFA 3BPCA 4OLEA 4PD4J 3CVHA 3GDLA 3FZUC 3K8KA 5FO7A 5IB1A 4FFTA 2LU7A 2I7SA 1RXLA 2NY7L 1BG9A 3RX2A 3BX7C 2ZQKA 1MNSA 1UYWL 1UQYA 2YK1H 4R0LC 4YFEA 5CC5A 1QLRA 3ETBF 1FNEB 3QHTC 1OFDA 1Q2SA 4UTBH 4OZIA 1I7ZA 1EEUA 1NAML 1RERA 3OXRB 4L4VA 2WTOA 3Q8CA 4QAMB 4R4FL 3QUXD 1TTPA 1XKYA 4MXWL 4TPRH 1I85C 2EKCA 4K8HA 3I50H 3IK2A 1EQCA 4AZ8A 1KRMA 2G3FA 3RJXA 1VA9A 2HMID 1M05A 1IQDA 4CN1A 1N18A 3DK0A 4Z2KA 3TO2A 3QMTA 1J1XL 5DRNB 5IMMB 1HH6B 5J5EA 1SDDA 1UB6A 2DQIH 2D23A 2J20A 4Z3IA 1E1CB 1YMMD 1EMTH 5GRWA 3K71A 5D9OA 3VA6A 4ONVA 1ZCRA 5DMNA 3HCVB 1F4YL 1MPAL 4HMCA 5BV7L 4I0KA 1L0YA 1R5YA 3LSCA 1NFAA 3CL6A 2G3ZA 3PHQB 3EBAA 2X7LB 3SD5A 3U2JA 1NCCL 2Z2BA 3BAJA 3SY5A 3BE7A 1TFPA 4E68A 4UTAL 4BDVA 1LJMA 2I5YL 3GNOA 1OTUD 3RKPA 3T4AB 3DZ1A 1FDLL 3FJ6A 4GG9A 3TOPA 5E0KA 4BQ4A 1G4MA 4JO1H 5HGHA 5IB3A 2QDHA 3V5DB 3B0XA 2AQRA 4RE2A 1DSWA 5DVOA 4AW4A 1TV2A 2FHCA 5I1CL 4AISA 1GVSA 4E9VA 4WSKA 1W31A 1CXKA 4MNKA 5J11B 5IK3B 1EJTC 4PD4K 2A3HA 1KIQB 2C5DC 2PTTA 1ITXA 5SX4H 4ZD3H 4N22A 2D2JA 1FORL 2QJDA 2WBJB 1GCYA 3BN9D 5H2BB 4ES9A 5J0BA 1DSFL 4K5NA 1P53A 1W2PA 1JHTA 1UA3A 2E6DA 3MA8A 5LGHH 1V10A 4B3VA 3VC5A 3U36A 3NSCA 1YHTA 3ZLGA 1DQDH 3W02A 1IXNA 3FRPB 3P93A 4UR9A 3TFKC 3BUYA 1X6LA 3QPZA 3VXMA 5IOPB 2LU4A 3MDWA 3FSZA 4LLMA 1CYGA 1UD2A 4R7WA 3EYVA 3IGHX 1TZHB 2JB6B 4D0CB 3PK7A 4MKSA 1JNDA 3NJHA 1NBCA 1PG7H 4G7FA 4WW1A 4BFIA 1IWPA 1W5QA 4PBDA 3GNDA 4NRSA 1OP5K 2Y24A 1DBKL 3C0QA 2CO7B 8XIMA 2A38A 1ZXQA 2ERJC 1NMAL 4ICXA 3MT1A 4J35A 3HKZA 4IK6A 2PD5A 3CIVA 2VFDA 3LQAC 3NFSL 3SZ8A 2H2PD 1BWWA 2NQ3A 4X4ME 5I6MA 3TLLA 4F9JA 3STBA 3TBSA 5A2IH 1ETZB 1MVUA 3TUUA 5CIPH 3TWAA 1AZZC 3H4FA 3U4BH 1W8NA 3OHMB 3KW8A 2Y85A 4F48A 1Q0XH 1WITA 3NJLA 2CE6A 4ODSL 1RUMH 4GEIA 1M01A 5C8JA 2OMVB 1ZPUA 3S2NA 1EO8L 1DVZA 4YNYB 1FVEB 2Y8VA 3WJJA 2P8PA 3I6RA 5ACLA 2V68A 2XZ9A 4EVNA 4X2PA 4XPTL 3RGBA 1WHOA 3RAOA 4PIBA 1UB5A 4L05A 1JZHA 1UUOA 5DCEA 3FB8B 4J3TA 4V33A 4RV8A 3GUFA 1XGQB 4CQDA 4DI8A 4EAMA 3PV6A 3CXFA 3ITVA 4X42A 1UADC 2R1KA 1H3WM 4KV5F 3JVGA 1H41A 3O6AA 4KBPA 4FXKC 4JICA 3EOUA 5FUZH 3RHWF 3UX9B 4AGLA 3NZGA 1EGJH 4OJFL 4GI9A 1NSJA 2AKMA 1RQEA 3M0XA 3TC3A 3GU1A 4UQ3B 3VM7A 3R89A 4XWGL 3EG9A 1OANA 2B7NA 4Y19E 4XVJH 3STFA 4K38A 4Y9MA 3C08L 3KW3A 3ZO9A 2FUTA 4JRWA 4Y4KA 3T0EB 4FC3E 4ODTH 4AGMA 2AKRA 4P5TB 1JRCA 1J8HB 1LO4H 1H15B 3HBQA 2CZFA 2X2GA 2BNQE 4GYJA 1S7XB 4MDIA 4XB7A 2YGQA 4WWNA 4XX1E 2OZ3A 5IUCA 2H9GA 5IFJA 4YSOA 1YMME 3MNDA 5CAYB 3QUMB 2A4ZA 2YD4A 3QQ3B 3VG9B 3EYFA 3V4VL 3C6CA 1IAKB 4YGAB 3PP3K 3TIEA 2PP1A 4N6FA 4Y5YC 1SW3A 3RB7A 3OKKB 5I73C 3DBPA 1UZGA 5KW9L 3QN3A 5FYLE 4HKBA 4OUUA 3QHOA 4UWMA 3R10A 1SEQH 1X5IA 3B7SA 4Y4KD 3VI3B 3CH1A 5FYKH 2WPGA 3H0TB 1ZGLA 2WGNB 3LERA 3D3VB 1EA9C 3DPBA 3Q43A 1T7WA 3W00A 3FB8A 3DIFA 3L48A 1SO5A 2OR2A 1OHLA 4WO0A 2WW5A 4XZMX 5B39G 4ELMF 5CFAA 1UYQA 1RK7A 1U42A 2EIZB 2WKOA 1WBXA 1GYVA 3L95B 3GZOA 4W6WB 3VNZA 1HXJA 1W54A 2V9DA 4NQVA 4QRRA 1DJZA 3EYVB 3ITGA 4ORGA 5HVWA 1TLMA 4TRPH 4E2BA 3S37L 4IOFC 5D02A 2WKLA 3MRDA 1HKWA 1KLYA 4H1ZA 5F9WC 4ADIA 1U9KA 2I85A 1ONQA 1P0DA 3QGAC 1M3IA 5F0PB 4C1NA 1QTWA 2HPTA 4YHPB 2GHZA 4P2OA 1E4KA 3SY0A 4YDLB 1EHXA 1IGJB 3GC3A 4ZI8A 1HEJC 3TEYA 1C92A 4N8PA 3HIJA 2Z7KA 3AZUA 4HKXA 4WU5B 1HZHL 1QPPA 2OWWA 5GGRY 2VAAB 3VXPB 3TA4D 2JJTA 1LTDA 3LTYA 2MOGA 2IKGA 3SQMA 5HTSA 4XZWA 1HO1A 3QJUB 1AFVL 3EKCA 1XRSA 2BCKB 2BG5A 4H6QA 2YPVH 1UYWH 4PJFA 4UNKA 2QKSA 3TIMA 1BF5A 4Z2GA 1J11A 2NNXA 2QMKA 1AFVH 1E2WA 4C91A 1OGAB 3VXNA 1T0OA 3T4AA 3MRJB 5CR8A 4FFZA 1AZ1A 1CICB 3USBA 2GJRA 3WTUA 4QCIB 3VOJA 3AXIA 3XIMA 2ALDA 4W9FC 4F8XA 1O7SA 1V02A 5LAXA 3HCVA 2HFTA 3L4CA 3NEXA 4UTIA 4RFOH 4WY7H 1EX1A 4IF2A 3BLPX 4BI7A 5FOJA 5HYIA 2CDGB 1FWFC 1AODA 1XKJA 4M3HA 5I0WA 5ITFA 1ORSA 3VKDA 4HIXL 4DERA 3D85B 3L16A 2V7NB 5KVFE 1O5QA 5GGUA 4M3PA 3PN8A 2JTYA 2WXRA 4UIKL 4LBRA 5CPQA 2NCEA 5T9CE 5EEUA 1E1FA 3L5LA 3RI5K 3FOMB 2A9CA 5CEZD 4K9EL 1FAIL 1AG0A 1QFUH 1E6OH 2H1PH 3IE9A 1E5JA 1NGQL 4N8VG 4BH7B 4YHPA 4XXDA 4Z2HA 1VHPA 3IXAA 1YMYA 3KS6A 1W3TA 5K59E 1P7QB 5C0BB 1DEDA 1A5MC 2BJML 2ZZ2A 4CU8A 4UNVA 1XBYA 3EKLA 5KVDE 2WNXA 2E25A 1DV7A 3WQCA 2VR5A 4J5NA 1KB5L 2EUVA 4A2GA 3HHSB 1MCHA 3M8OL 1NIEA 4JGUA 4XVOA 4B60A 5GPRA 2NQ5A 3D05A 3UTSA 1SR0A 4BZ2H 1AZ2A 1ZLUH 3QH3B 4I3RL 3SE6A 4CNSA 1IAMA 2BVQA 5EZJB 5DJ8A 1WAPA 5B7YA 2KERA 3QFJE 5LZLA 1HFUA 4M3KB 4HNVA 1OSZB 4JM4L 2BINA 4N20A 1FZMA 2NY1D 5I00A 2XZAL 4PJ5A 2FVMA 3Q7JA 3WYRA 1MVYA 4R9XA 4Q4OA 1EAQA 1MRAA 2ZXEB 1R9FA 1IGTA 4J23A 5EDXA 1VJIA 5GJMA 4QXTA 3TYFB 4JHVA 1QR7A 4GY0A 4XBEH 3H4GA 4ZQMA 4YHML 7REQA 1XV8A 3AGWA 4FQHA 1TQSA 2XPGB 4UIMA 1H7PA 3C61A 3WD4A 1KXQE 3ALPA 1RY7B 1XWYA 3QNXB 5E99H 5KBLA 4XBMA 4PJAB 4YTSA 3L1GA 2OL3B 4PGLA 1HINH 3PS6A 3RWDB 3KLSA 1J5SA 3VGEA 2WY3B 4MDRA 5LNDA 3II2A 4UV7L 1LE5B 4ZFGL 1PYFA 4C6NA 3SDDB 2P7TA 1P0SE 1W9BM 3A3WA 4LKCA 2FFIA 1E4HA 2DGAA 3JRKA 4FPSA 1P4CA 4GW1A 4QSHA 4YVNA 2L7UA 2QCGA 3S5SA 1FFPB 1AR1D 1VYRA 3WQ8A 4OT1H 1NL0L 1TNNA 3U9UB 4LAQL 5HNRA 5I30L 4PRTA 3NPZB 1RZPA 3S47A 2KC0A 1EPVA 4AGPA 1XCXA 4FFYH 2CR6A 5BW7A 5SWSD 2ADFH 1VFLA 4QYOA 5LVEA 3S3PA 1H11A 3TESA 4RA0C 3WUWA 4X4XA 4NCDA 4L29A 2AJZA 3S6CA 2BX7A 2W61A 2AV7B 4KJQC 3V0AC 4O12A 5AOZA 3GHEH 1R24A 3P0YL 5L2KB 3W1UA 4F57H 5CCZA 3SCWA 4QIRA 2ZOXA 3CXHK 4R26L 2Q8ZA 1J5DA 7TIMA 4AGQA 2O6EA 4MS8D 2VABA 3IVUA 3E1ZA 3UCQA 4FAMA 5L8LB 5AFAA 2EO9A 5FF0A 4H40A 3PP3H 1BMGA 3QORB 4LBEA 4NENB 4PRAA 2RGSA 1YY9D 4FI7A 2E6YA 4DN1A 3W76A 2LLNA 1PX4A 1XRFA 2FYYA 2OMUA 4FX7A 2YBRB 4WFFD 5L9DH 3VDHA 2L7QA 1T21A 3VWKC 3EOOA 3CFKA 4GAGH 4GE8A 5EC2A 4M7KH 1PSKL 5LA1A 1IEBB 4M5YH 3LEYL 1N10A 1L4IA 2W9EH 2YRBA 2AOSA 2D8KA 6PCYA 1L6PA 5T5FA 5DJXA 3PWGA 1MJUL 2OT0A 4JHWL 1NTHA 5CZVL 5DJXB 1J96A 1WDRA 3DYOA 4KXZI 1E9PB 2ZRVA 1T3FB 2YPLB 3NK4A 5IOPA 3O6LH 3B5GA 4YOKA 5BW6A 5HWMA 2B1HH 4HIBA 3QH3A 1J0KA 3H55A 3NQ7A 4RMVA 3EBGA 3N40P 3HZKA 3DX9B 3QK0A 3CHSA 2J6EA 3REWB 5BVPL 1YADA 3T8QA 3GB7B 1XF3B 3KZPA 4E5XG 3M64A 2PTWA 3W7JA 1T2JA 1A7BA 1AHKA 1S7WA 5IWLA 1SJDA 3LVTA 2VMEA 2XBTA 4RH4A 4JKKA 4LDOB 1DBTA 3H6OA 3GUWA 5INDA 5FB8A 1SZGA 3VUPA 4TUJA 2XTJB 3HLAA 5IBTL 3QEHB 2WZAA 1BFTA 5REQA 2A5HA 2IKIA 1XGDA 2RGLA 1J0JA 3WEAA 4Z7OF 1UG6A 2FATH 4HJ0C 4Z0BL 2VCOA 5B39A 1J88A 3M6YA 2AK4B 3EO1B 1J5CA 4MHBA 1EGVA 4FXGB 5I1KH 2PCQA 4P57B 1ZA3A 2F61A 5ECUA 3V6BR 1S9WA 4F2MB 4X6CB 4I2XA 1NQKA 4OGZA 1PD6A 3IWPA 2UV3A 2J4GA 3O2VL 5MKGB 9CGTA 1RHHA 1CDHA 1U8JA 1VQTA 1VCGA 5LG6A 3BZ5A 4MCZB 2FK9A 2P1YA 3GSUB 4QDWA 4YN5A 4YIQB 5CZTA 4KK9D 1F97A 5T3XD 3QISA 4G7EA 3UZXA 2GUYA 1KM1A 4RBPK 5D9SA 1JMZA 3ABSA 5IFHH 4N2IA 3LH2L 4IBYA 5E8NA 5E2TH 4ZFOL 1VYSX 3W6YA 5SX5K 3WGVB 1T6BX 3UYRL 2GDQA 2P5EA 2BLFA 3OG2A 4KIEA 4JKLA 3CSFA 5EBWB 4N8UA 5HDQL 5BVPH 2E27L 4IIQA 3QB7C 1SHWA 1RVFL 4Q9QH 2BSTB 4DOHB 3HFYA 2R0KL 3PDOB 6REQA 1F13A 1LO5A 3BSZA 4U28A 1FNGA 1CL7I 3DI1A 4NUWA 3URQA 1GVFA 3G18A 5L6YH 5EBMB 5AZ0A 1I82A 5CSUA 3MC0A 5HGGS 1WWWX 3ZTJH 3Q2WA 1A3WA 3QDJB 2O5NA 4S1QH 3TH3T 2PWFA 1JNLL 1OP9A 4PJ5B 1XYFA 1LYQA 5JW4N 1W1VA 3BFQG 3KNBB 4GRSA 4AZCB 15C8L 3X17A 5EULV 5EU5B 3DRQB 3G04A 4QRSA 3SO3B 4PSRA 1GJWA 2YXWA 4JL1A 4RRPM 3ZHFA 3OYZA 2TSAA 3C12A 3KPRE 3OAWA 4ZSOA 3V7AG 3UP1A 3EA2A 3EGJA 1NICA 4JAWA 1NOLA 3QY7A 1W0VA 1HHJA 1FHGA 4AXNA 2O92A 5DQ9A 1TJIL 2ZUSA 1XXXA 3CMGA 3G6JB 3SY1A 3W74A 1M2VB 1KCLA 3NQBA 3QDMA 3OWEA 2F7PA 5KTEL 4FA3A 2AABL 4AW7A 2JV6A 5JZ7D 1W3NA 1UWXH 1CDCA 3ELAT 3SQBB 2FBJH 4L7ZA 1MFCL 2PBGA 4NQEA 3DXAD 4JFFE 3B2MA 1DLFL 5FHBH 1V5XA 2OQHA 2NR6D 2APXA 3ES6B 3IDJA 3QQ4A 4XCCL 3LIUA 1DLHA 2XNAA 3NOIA 4P23A 4PUUA 2ISWA 3AMLA 4YVVA 1E90A 1K8DA 2YWYA 3B9DA 2QF7A 4WRHA 5HGAB 1W16A 3MWCA 3QXDB 4QG8A 2UWEB 2YC1B 3WFBL 4H13C 1L9QA 4F8TA 3C56A 1X5JA 4XPBH 3G0SA 1FZOB 3GJFK 3H6AA 4OLZH 4GIAA 4MB4A 4XC1H 4ZAKA 5AVSB 3RJOA 2REQB 1PIFA 3LKQA 4TKWA 5ACMA 5C7XL 1OFBA 1V77A 1QFWI 3DV6A 4E3VA 3UFYA 2ZTBA 3LB6D 1CVSC 1MXGA 1U30A 4KVNL 3L5XH 1BXXA 4X5RA 2DEXX 1YEKL 4YXLL 4C4UA 4WNQB 3GXMA 3SE9L 4ML4A 4RIRB 4N9DA 1E2VA 3SDCA 5I28A 5JW4Q 3K80A 3JZ7A 2VSCA 4NNBA 4AYSA 3QJVB 5HI4D 4ZQTA 4F2UA 1F58H 1E4NA 1FXQA 1Z42A 1ZNNA 3G6AA 1XBDA 4MNQE 4ZYKB 2B31A 2YD9A 1DVUA 4J2PA 4ATDA 5D6DC 1DWFM 2EDFA 4MJZA 1NDTA 5HYQA 1YY9C 2LV4A 4GMSH 3U1QA 5B3NA 3DBSA 3QIUB 3L4UA 3T4AC 1GSKA 3B3IB 3CUZA 3QPQD 3RWIB 4REQB 3TA6A 5FUZL 5AAPA 1GJIA 4U2ZA 4GBXC 3MLTB 2E4TA 3OQRA 4BR1A 4W9LC 3TBVA 2J6WA 1WBZA 5HJ3A 4GH7B 3WHE1 4B9ZA 2QR6A 4AWSA 5G4HC 3WIFA 4UU9A 2DW5A 3W2LA 4G8GE 3TZVB 9RUBA 1TJRA 1AW2A 1OP3K 3NZ1A 1OGGA 3KUMA 4R5VA 1HP4A 4F40A 8XIAA 3T77A 1WG3A 2LQRA 2W0FB 1R0AH 5C54A 2BWQA 1BZ9A 1HSBB 5AEAA 1DL7L 3O0RH 4D9PA 4K3EH 2VCCA 2WANA 1RZ8A 5BRZD 4QY8B 3MRQB 1FAIH 1VAHA 1YLBB 2ICCA 2XVKA 3ARRA 3U6XS 5HHOA 5F1VA 1JD7A 4MKMA 4YDNA 1TZ8A 3IMWA 1RZ8B 2QZRA 5T8GA 3C6LA 1JCVA 1JRHH 4YBQD 5LBSL 5ID1A 1LZOA 1X6UA 2WM1A 3QUHA 4Y2WA 3V9CA 1G9NC 2DWEB 1YAIA 4NZUH 4QRAA 1BD0A 3KOZA 4O53A 3RA7H 5KVEE 2YCEA 4LOVA 3T81A 3BAEL 3GX9A 1NFDA 2E7BA 2Z3FA 1Q9LA 1TPB1 2DYPA 4AY1A 3NZQA 4O2EB 4YDIL 1IE4A 3ARGA 4TLKA 5EOQH 3QWQB 3QQ3A 3MLSH 2CWRA 2YFNA 1Z0MA 5ADPH 3OKMB 2DQGL 4O2CB 3BWUF 3NG5A 3THMH 1FKXA 3IDNA 1V02E 4E9RA 1V7NH 3FU3A 4P2VA 4WZHA 2ED6A 2OMYA 1JNHA 1K4DA 4ZUSA 2VZUA 3W5MA 2YLLA 3BSZL 4PV8A 4QROA 2P43B 1KGCD 2P8MB 4FEMA 2VLKA 4ZMLA 3TX9A 1K8DB 4DELA 1HWWA 3BGFC 1TMCB 4JPIA 5SWZA 6FABH 3BV4A 2J9YA 5E6RB 1X44A 5GRYA 3Q5YA 2DZAA 3MO1A 1J0ZA 4IRZL 7FABL 4B5WA 1W3KA 2EP6A 4XG1A 4ALAC 3JZYA 2XETA 1H3GA 4UTAA 4NNCA 1D5MB 3LU2A 3DXAA 3F5JA 2A85A 4KEVA 4HWBH 1UPMB 1AOZA 5LCVA 3FO9B 4ZS6C 3HI6L 2VDQH 3MFFB 1E40A 5CHNB 4IDLA 1XCQB 4BHUI 1A6VL 3P9LB 3N06B 1S78C 4YDJB 3TO2B 4JIHA 4LUJA 4GSDH 2EKJA 1RUAH 2O9OA 4IT1A 4Y9PA 2BSRB 5LIXX 2UZIL 2VFIA 2HXUA 4G83A 3W38A 2NY5C 4KTEH 4BQ8A 3Q67A 3LH2H 5DZNA 4BRJA 4IBLT 1SJAA 4ACYA 3VOCA 4KNTA 1GW6A 3K5SA 3ZMNA 1GS8A 4ELME 4EZMA 3L13A 3NABL 3RPBA 3B3BA 2C3VB 3CFIC 5HHQB 1XSJA 2NY0D 5FW7A 43C9A 1YEGH 3NCWA 1K3ZA 2C3VA 3LB0A 3POHA 1JCXA 2I07A 4OKVB 2GOUA 3R8HA 1XD0A 1ZHKA 2A9ML 3IAPA 4FX6M 5D2XA 1ZTXE 5D8ZA 1TTGA 4PV8B 3G5ZB 4W84A 1C8YA 3TSDA 4CCCA 5L2KD 4ZE4A 4PVNA 2R83A 2O6CA 4NQDD 4DGIH 4G7YL 4QRPB 5HDBF 4MNGE 4MWAA 3VSQA 2FATL 3JUZA 1JVKA 5CU5A 4Z0BH 4PULA 4AHQA 1MREL 5F2LA 5GRJH 2YGNA 1Z3GL 4J3VA 4OCWL 4IPLA 3TMQA 3RVWC 4N2GA 1WRFA 5I77A 1KENL 2V8ZA 2WBJA 3ZVHA 2OZ0A 4ZJ9A 3BG9A 4P8VA 5J6HA 2R8SL 3UTPE 3WLSA 2J7HA 4HAGA 5D7LB 2J7GA 9XIAA 1FSKC 1XH3B 3R06B 2YXXA 3WUEA 4E3TA 1TIMA 4L3EB 1UWRA 2XWCA 3CBKB 4X6EA 4JKPH 1OCZB 4NS0A 3ZO0A 4P2RB 2NW3B 4TVUA 4K7FA 1UM4H 2DQFB 4RNJA 7PCYA 1KLFA 4GLRI 3OAYH 2Z1VA 2PZ0A 4TO8A 3QY6A 1HCYA 2YZ5A 1BVOA 4WIWA 5CZKA 4FQ1H 2IQ9H 1T2XA 4KK5C 1L9MA 2OMYB 3S2CA 1RUQL 2EAEA 3F4VA 2FJUB 2NXYC 4AU0A 3QARA 5BRPA 3P11H 2XVPA 4LCCB 4ANVA 3FS9A 1HZYA 4UF7C 4MQ7A 3DFYA 5EU6B 2B3IA 4AEOA 2A1YA 3O3AB 4XPGH 3S6TA 3P11L 1PHQA 4O2EA 1U6AL 4O50A 1KYDA 4HS8L 4IM8A 4XVEA 3R94A 4JREB 3QI9B 4K8RL 5I17B 3QCVL 2DQDH 2WYHA 3HMXA 5DJ6A 2MWCA 3F83A 2W65B 5A16A 3B34A 2JVUA 1FHVA 1XIIA 1S1RA 4AVOA 3S9IA 4FZ8H 1GAFL 3S9YA 3VTAA 1YBQA 1FYHB 4OLVH 1C9DA 1EUNA 3US1A 5HQEA 4G6KH 3MLXH 1CXFA 4RGNB 1PG7W 2XFXB 2YAHA 3CIAA 3CQFA 3NSXA 3PDGA 4IRSD 5BS0D 2V5DA 3DFHA 3L1OL 4LCVA 5D4IA 4JFHE 1G7VA 1PZ3A 4RMQA 4LPXA 3R13A 1UZ6E 2EDJA 4LS0A 3I7SA 2YL8A 1MIEL 2K1MA 2XRAH 2YSSA 3HZKB 3L2LA 5C0AD 5TFSH 1ITUA 4OD1L 4A35A 4PYHA 4WQOA 1HXMA 5HGDA 1V6WA 3E74A 1BD2B 2K4WA 1C8VA 3ZDZF 1FN4B 1J9CT 4J3ZA 1KRBC 4MVAA 4LHJB 1VJSA 1E6JL 3LVEA 5DD5H 1RIVL 3M0MA 2VDHA 3BGFB 3MOAH 3GZ3A 1N64H 4Y7MA 3ZXAC 2FTWA 2DL9A 3N43F 3PIQB 2DEWX 4L8SC 3STLA 5B8CC 4ATWA 4N90D 3DO7B 3SYQA 3SKNA 2DZTA 1A7OL 3E2VA 1F5WA