5I5RA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Will be disclosed later
rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Hydrolase
total genus 161
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5i5rA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i5rA01
1CNVA 2PBGA 2VT0A 6A3HA 3W27A 2J7FA 2WC7A 1GNXA 4ATWA 4UFKA 1JYXA 5FD0A 1WCGA 5DEZA 1CXFA 2XJ7A 1UH4A 4X0VA 2FYVA 2WMGA 3PZVA 4HOXA 1EOMA 3WF2A 4NXKA 4C7DA 3W24A 3NCOA 3GDBA 3IK2A 1XSKA 4TXEA 2C0HA 2JALA 2HVMA 5I6SA 2ZE0A 3IGUA 1V6WA 1J10A 2F8QA 1HVQA 1OGGA 3QOMA 4GXPA 3L4VA 1UR1A 1O7AA 3SCSA 1UD5A 1H41A 1OB0A 1HT6A 3LRKA 1VJZA 4XX6A 4D6FA 4W8AA 2E9MA 1V3IA 2XYLA 5CLTA 1QI3A 3RILA 1UQYA 1Y7VA 4PYSA 1TE1A 3SCNA 1JZ3A 3FAWA 2ZICA 3ZMRA 3L4YA 2V5CA 1E71M 3D3AA 4P8VA 3EBVA 2CCRA 3WL0A 2DT1A 3N13A 3WD0A 2ZXDA 3VGHA 2OWXA 2CYGA 1G01A 3DC0A 1VFFA 1W2PA 5A94A 3G6LA 4FNPA 4HMDA 5HPCA 1VEMA 4X0NA 3WFZA 1RH9A 2CBIA 1JD9A 1GOKA 3L4XA 3T08A 5M5DA 4TUFA 1VAHA 2J7GA 5M03A 3CZNA 2VVSA 3B8SA 3GZAA 3CZSA 4GI6A 1JNEA 4EAMA 1TZ7A 2CESA 2G3NA 1W1YA 1FH9A 2OYKA 3WY2A 4UQCA 3K1DA 3QHNA 1G1YA 1HL9A 4HPHA 4QLLA 3WUBA 1E0XA 3AHZA 1BYDA 5A8QA 4BQ4A 2J7HA 3WF4A 1Q6DA 1HP4A 4MADA 1B1YA 3KWXA 4J28A 1BGGA 5BXTA 4ZENA 3BXWA 5A6JA 1HKIA 3ZOAA 5BRPA 4R27A 4B15A 2WMHA 3MMWA 4P7OA 1KTBA 4NI3A 4WIWA 4L4OA 2ZIDA 1UKOA 2PWHA 3AZRA 3OB8A 3LXAA 4MNKA 2YL5A 1E6PA 4BF7A 4YPJA 4Z2JA 4WJXA 1WDRA 1FOBA 4UQEA 4AD5A 1VBUA 1H0IA 1Q6GA 4W8BA 3OG2A 2CETA 3L4ZA 3VD9A 1JAKA 1H11A 3SIMA 2BHUA 1FHDA 2YA2A 2PWDA 4IPLA 4CVWA 1ECEA 1PEZA 4UQDA 3N1AA 1DEDA 2WZIA 4XV0A 4CU7A 2CBUA 1KCLA 2FGLA 2J79A 2XSBA 3NDZA 2D1ZA 3CUHA 1CGVA 7A3HA 1JZ7A 4QCEA 1GVIA 2FHBA 2ZXAA 1U2YA 4D6IA 2WMIB 3T0AA 2QPUA 4DO5A 1E4LA 2WVVA 3DX2A 3D51A 2ZUSA 3VX1A 1UHVA 3CMGA 1RD6A 2J7BA 5GNXA 4MJ4A 2GJPA 5A8MA 2Y4SA 4AZIA 3IAPA 5DT7A 1QOXA 2PWFA 3AMKA 2AMGA 5C8BB 3AS3A 3BVVA 2V3GA 3N17A 1L0PA 4P8XA 3GBEA 1H1NA 2EBNA 1JZ2A 3TOPA 3WSUA 2ZUMA 1B0IA 2OWCA 3L4WA 2PC8A 3BAIA 2YDSA 4UFMA 1C7TA 4AZBA 2WPGA 2EPOA 1TR1A 3GH7A 3NIYA 4XZBA 1JXKA 2WBKA 2PB1A 1EGZA 1GHRA 1TVNA 2EPKX 4BS0A 3ALFA 5A8OA 4HA4A 2NT1A 4U3CA 1XGZA 4UFJA 1QPKA 1QHPA 1XC6A 4XB3A 3SCUA 3SUWA 1B30A 2ZUVA 1FHLA 3MU7A 2GJXB 1XSIA 4OZOA 5JBDA 3AI0A 1J0JA 3A5VA 2JF7A 3BUIA 2O9PA 4QAWA 3WD2A 3CPUA 1I75A 5E6ZA 1HJVA 3AXHA 3BMWA 4H04A 5FKYA 1QHZA 7CGTA 3ARWA 3MSGA 1NARA 3WN6A 4PMRA 1CGTA 1QBBA 1V3HA 2WHLA 5A3HA 3WNNA 2DQXA 3W53A 4JAWA 2VZUA 4MB1A 2O92A 2XUCA 2BV9A 3AIUA 3AS1A 4BQ3A 3TP4A 1ITCA 3PTMA 4PMVA 4B9ZA 2CIPA 1E6SM 1BSIA 2WW5A 1JYWA 4JL1A 3CHEA 4NF7A 4CD8A 5IHRA 1KFWA 3WDPP 9CGTA 1NP2A 1UWUA 3PTKA 3BH4A 1TQUA 3AIBA 2E9BA 4CCDA 1J0IA 3VIFA 3QHMA 1R75A 1M01A 4U2YA 5A6AA 1R85A 2JIWA 2NT0A 1HL8A 1V6XA 2YFOA 1PBGA 2DSWA 2X09A 2WHMA 5BCAA 1OD8A 1QBAA 5E6YA 3ZIZA 4AIOA 3WDQA 5C71A 4WSJA 2VZVA 4QLKA 4UOQA 1IZKA 3NSMA 1KXQA 3I3DA 1RP8A 5A2BA 1UH3A 3VD5A 1TQWA 1E55A 3A4AA 4J7RA 3PZTA 5FL0A 1IT0A 1J0KA 2GDVA 2X0YA 4E8CA 1GOWA 1UR4A 2Y5EA 3EJSA 5C70A 1DWIM 1B3VA 4JHZA 1V02A 3AYSA 3W29A 4HZ6A 2BY1A 2WMIA 4W5UA 1UWRA 3BVUA 2VX7A 1ZJBA 2RGMA 4UOJA 5DT5A 3ZT6A 2VL4A 5TD4A 2D23A 4J3UA 1LQ0A 1BG9A 4A4AA 3MUAA 3W38A 2ZX7A 4E8DA 1LG2A 3AHXA 4D1JA 3TTOA 4AZCB 1LLOA 1O7DC 3NDYA 1DWAM 1G0CA 3TA9A 3PTQA 5F7UA 1Q6EA 4N42A 3GXDA 4HPGA 1MFUA 5AYIA 2XVNA 5AY7A 1JZ8A 1QWUA 4AW7A 2X0HA 3SCVA 1E43A 1UR8A 3KL0A 4H8UA 4CN6A 1WO2A 3PZQA 1HP5A 4GPNA 3OA5A 1ISVA 1W9DM 4HP5A 1HKJA 1KWKA 2X2JA 2VRJA 1UWSA 4KH2A 2V5DA 1UD8A 4GZJA 2YLAA 1TG7A 5ABFB 1WZKA 1UG6A 3VINA 1MQQA 3VIMA 5A69A 4UR9A 1E70M 3TTYA 2HISA 2J7DA 2GJRA 5EBAA 4BZYA 3VM7A 1W1PA 1BTCA 2GJXA 1E15A 3VD3A 4OBSA 4PTWA 3BLPX 1OCQA 4AEFA 3N15A 1FP9A 3O9NA 4ACYA 3AHVA 1E4IA 5BRQA 4QFUA 1W32A 3ARRA 3EJQA 1LWHA 3WELA 1GJWA 2CXGA 3ZSTA 1FFQA 2ZX8A 1PX3A 1VENA 5CPQA 3CZKA 5DF0A 4PMDA 1MXGA 3BVTA 2GDUA 1EIBA 3WQ4A 2FDMA 4TVCA 3ZR6A 4N0RA 4TTUA 2A3CA 2WXDM 2ZUTA 5CJ5A 3AIWA 1V0MA 5HNNA 3F4VA 3PZNA 1EQCA 3T2QA 5IDIA 3AIQA 3BSGA 1DTUA 3DHPA 4GQRA 4HU8A 2BY2A 1M7XA 2JIEA 3QR3A 1J0HA 1PIGA 3MO4A 3F5KA 4P7LA 2DT3A 2XGBA 1HNYA 3DECA 2EPNA 2OYLA 5A6LA 2XHYA 4C7FA 3LRLA 3LPFA 1BYBA 1HX0A 1GQKA 1W91A 5DO8A 3VGBA 3RMEA 3VSVA 4JZ5A 3VGGA 3F5LA 4DO4A 3VDHA 1PZ2A 2G3MA 3K8KA 6TAAA 3PZOA 2X05A 3ZJKA 1XHGA 3WQ5A 1RP9A 3W37A 2GVYA 2W91A 4W8LA 3FAXA 2YDQA 1ITXA 2XPKA 4AZHA 1JDAA 1BF2A 3GH4A 3TTQA 3WDRA 3ARUA 5D9MA 1B2YA 2WSKA 4GQQA 3CMJA 1JZ6A 3VIOA 4FNUA 1WZAA 3AHYA 2J75A 3AIVA 4DWSD 3TV8A 4Z2GA 3QGVA 2J77A 1JXJA 4PTXA 4NSBA 2DEPA 1LL6A 1HJUA 3VDCA 1DWFM 1WDPA 4HZ7A 2VCCA 3OGRA 4AZCA 4MB5A 1EA9C 4GZEA 1NP0A 1BVZA 4V28A 2BHZA 3B9EA 4D6JA 2YKKA 4M56A 1LJYA 5EFFA 1H09A 5E1QA 2PWEA 3AISA 3MS8A 1R7OA 4H41A 1R8LA 3UR8A 2QPSA 1I1WA 2AAAA 1HF6A 1QI0A 2DGAA 4AYSA 4FNQA 3MSDA 3AFBA 3B9AA 3N11A 1CEOA 4J3VA 1ZBWA 2VX4A 1MYRA 2JEPA 1UZ1A 2WZHA 1ISYA 1QNOA 1LL7A 4W7WA 1EXPA 3A3HA 1GOOA 2X2YA 4AXNA 1JF5A 1EDQA 4PUEA 3VVGA 3CLWA 2OSXA 1ZS2A 3DX4A 1XYZA 1WB0A 4D71A 4AMCA 1PJ9A 4MB3A 3LRMA 3IJ8A 4LPCA 1J18A 3ARYA 3GXFA 2BXYA 1GQJA 3FN9A 4ACZB 5CXPA 1NWRA 1NQ6A 2WLZA 4F9JA 1JYVA 3BC9A 1TQVA 3DX3A 3M6DA 4M82A 1MWOA 4Q7NA 1UKQA 3SCPA 4NRSA 5A95A 1OGSA 1ODUA 2VUYA 4RE4A 3A4WA 3CUJA 3BUQA 4U5IA 4HOWA 4M80A 3DYMA 1A47A 3CTTA 1GW1A 3G6MA 4MDOA 1SZNA 2O9RA 2EADA 3AOFA 1W9XA 2ZUWA 1BQCA 3WDHA 2GFTA 2XN0A 2F18A 1UD4A 4U31A 2J78A 1CXHA 3L4TA 4UQAA 1VF8A 2QMJA 3QHOA 3WMCA 1CGWA 1E5JA 1KWGA 1JFHA 1W9PA 3M07A 2VR5A 3VIIA 4AEEA 1VEPA 2XVLA 1PX4A 3ARZA 1AQMA 3VU2A 2VZTA 3NSXA 4W88A 3T09A 1R46A 4YHGA 3VD4A 5DMYA 4F9DA 1UKPA 3SEPA 3AMLA 2V3EA 4JKLA 3A47A 3BGAA 3S6TA 1MFVA 2W62A 2WKLA 3WIJA 1AQHA 1HN1A 1WNOA 1XH0A 3ZT5A 1ODZA 2OLHA 1CXKA 4OJYA 1U33A 1HJWA 3U5UA 2QF8A 2EO7A 2UY5A 2BVDA 1EHNA 4PMQA 2CPUA 3IJ9A 4OIFA 3WUGA 1CDGA 1E1FA 3W6MA 1JZ4A 2VC9A 3BCDA 3TONA 2WB5A 3H53A 1K9FA 1TVPA 1W9BM 5D4YA 3ARVA 1IV8A 1TMQA 2BFGA 3WF3A 2X2IA 2WLYA 2EPLX 4IISA 3ZJ8A 3WFLA 1ZL1A 3K8MA 4B3LA 1VBRA 4JFUA 2O9TA 3U5YA 2J74A 4P7RA 4UNIA 4MNJA 1CZ1A 2DIJA 4PMUA 3F5JA 5HPOA 1W9VA 2XWDA 3WEOA 4LX4A 3MMUA 2X2HA 3HG5A 4TVUA 5CZKA 2BVTA 2WC3A 4EE9A 2EEXA 3N18A 3VGDA 2DDXA 1NOUA 3S5YA 1MQPA 3RO8A 4AD4A 3AS0A 4NZJA 1E6QM 3WH9A 2J7EA 3WUFA 1JI2A 1FA2A 3OZPA 4BQ2A 4XUYA 4IM4A 3GTNA 3W6LA 1V6VA 1FH8A 3BLKA 1T0OA 2IXUA 4U33A 1G5AA 3ZT7A 4P8UA 1JIBA 2WHJA 2OSWA 5M17A 2WC4A 2DIEA 1KXHA 2VZSA 4JFTA 3LPOA 3PZGA 2E8ZA 3POCA 2F7PA 2DT0A 3CZGA 4DWSC 1BHGA 3WEMA 5GNYA 4J27A 2VOTA 2J4GA 1JDCA 1US3A 3WNLA 3SCWA 4CVUA 3VIHA 3WDIA 1ZBVA 1NOWA 2A3AA 1VEOA 3OLDA 3E1F1 2WAGA 1DWGM 4F66A 2W66A 4UFHA 3UERA 1HXKA 2D3LA 3AZTA 1V3LA 3GXNA 1WP6A 3WQVA 3WL1A 1VIWA 2WWCA 2GK1B 3UG3A 2OW7A 3WBAA 3SUSA 2VQTA 3I3BA 3AROA 1EO7A 1UKSA 1J01A 8A3HA 2XN1A 2UWFA 2FGZA 2NW0A 2C8NA 3J7HA 3HG3A 4NZFA 3APGA 3A6OA 3IANA 3PBGA 4B9YA 1XH2A 1F4HA 4F8XA 1ISXA 1SR0A 4HA1A 3VX0A 3D5HA 1CPUA 2PBOA 3MUZ1 3EDEA 2D2OA 3CV5A 3EDFA 4FLRA 1EOKA 3KZSA 3LPPA 4AD3A 2W67A 3VIPA 3WH7A 1TFVA 3AMCA 4ZE5A 2VX5A 3U7BA 1CLVA 2DH3A 3FXYA 1GZJA 1EHAA 4FMVA 1G9HA 2YBTA 1QX1A 1UD6A 3II1A 4D1IA 4ZXOA 5LYRA 2VRQA 1QHOA 4QP0A 4D72A 2D3NA 1UZ4A 2XFRA 2W61A 4GKLA 2YOCA 1W1TA 2XG9A 2E4TA 5CGMA 3AMGA 4IUGA 2J7CA 4D6EA 5IHSA 4CD4A 2PI6A 4JIEA 2ALWA 2BY0A 3SCTA 5A1AA 1KR0A 4AZGA 1KXTA 2Y24A 3FW6A 2WCSA 3VKKA 3WQ6A 1A3HA 3HG4A 2EAEA 4MAZA 1KXVA 1GOQA 3CZEA 4J3XA 1TQSA 1KTCA 4AIEA 1UKTA 2E0PA 2YLLA 4DWSB 4C7GA 3PZ9A 1TCMA 5A6BA 3K4AA 2J8GA 2NSXA 2E8YA 1MXDA 4CN1A 1QNPA 1CENA 3HJEA 4PEEA 3ZJ6A 3DDGA 4AMXA 4FLQA 2C7FA 1J9YA 1WDSA 3L4UA 3LXBA 1WZMA 3D50A 4CKQA 3WNKA 2WMFA 3WENA 4GI9A 1VRXA 2WCAA 1C3FA 3NSNA 5BYWA 1C90A 2XIIA 1W3JA 5FL1A 2W4XA 4FLSA 1X6LA 4KGJA 4CN4A 2QMKA 1SMDA 3HMCA 3S5ZA 1HJXA 5D8ZA 4PCSA 2WWDA 1E40A 2W63A 2QV4A 4U3AA 1V6YA 1D3CA 5IXEA 2CHOA 2WMJA 3BUBA 5LA2A 2JF6A 1KGXA 4B3KA 4D6CA 1GOMA 2VZOA 3O2LA 3WEZA 4CD5A 5FCZA 2BNJA 4EANA 4P8WA 2G4FA 4D6HA 1BPLB 2FHFA 1XV8A 2Y8VA 1HVXA 1JAEA 4ZFMA 4UZSA 3UCQA 4HA3A 3T2PA 3VNYA 1AQ0A 2J62A 1TQTA 2TAAA 3N9KA 4M8UA 3CBWA 4ATDA 4KRUA 4PMYA 4GO9A 4Z2KA 2JEQA 3N12A 1OT1A 4H2CA 1JD7A 3VGEA 4URIA 4L4PA 4CU6A 3A23A 4UTFA 4YN5A 2Y2WA 2XTKA 1KB3A 3IJ7A 1J12A 3SCRA 4J3WA 3AQUA 4M81A 2UY4A 3PZUA 4OOUA 2FHCA 3B9DA 4V2XA 4H8HA 3U7VA 3W81A 1G94A 2YDRA 2XVKA 4HMCA 5CGTA 3D4ZA 2CERA 1WKYA 5CLWA 4MAVA 2DH2A 1XRVA 1EDTA 5D9PA 5ABHA 2XM1A 1QI5A 1K9DA 2F61A 2E40A 3OGSA 1PZ3A 5A6SA 1R87A 1OWQA 2VQUA 5EFDA 2WZEA 3CH9A 3VDAA 3VILA 3EJUA 4ZE4A 3WY1A 1MQRA 4E2OA 1CWYA 1Q6CA 3RM8A 3WKZA 3BCFA 4P7QA 3DDFA 3HG2A 1OM0A 3WF1A 3BAYA 1Q4NX 3MI6A 5HDRA 4S3JA 1MW0A 1NWTA 2D0GA 4WK9A 3VMOA 1C7SA 4A3YA 3CC1A 4NXSA 1HKMA 5CQ1A 3OLGA 3EJTA 2Q8XA 2X8RA 3WMBA 1R47A 8CGTA 2WNWA 2WK2A 3ARQA 2CBVA 2B31A 4JFSA 1TUXA 1B9ZA 1B3YA 3WD4A 3T0DA 4MNLA 4XZWA 4QDMA 4PCTA 3NJ3A 3W28A 3WNOA 1ZBCA 3ARSA 3WH5A 1XD1A 3WQ8A 4PMOA 1AVAA 2E3ZA 2OSYA 2E9LA 2IUZA 4K68A 3PN8A 1W2VA 3BAWA 3ZJ7A 5I0DA 3MUY1 3MANA 2O9OA 1F4AA 5GNZA 4FNTA 3MV11 1K9EA 2XSAA 1PS3A 4MTVA 1V0NA 1L8NA 1CGUA 2WVSA 3UETA 3WY4A 4KRTA 1M53A 1H49A 3AJ7A 1B31A 2WYSA 4Z2LA 5E9AA 1WPCA 5CG0A 1CECA 1XYFA 1BLIA 3L2MA 5ABFA 3UR7A 5A2AA 4TVDA 2FH6A 2EABA 3HZ3A 4WSKA 3JUGA 1DWHM 1UA7A 2YFNA 3BSHA 3T2OA 3CIVA 3CUGA 1NOFA 5AC5A 1B90A 2QHAA 2Y8KA 3CUFA 4UFLA 4PMZA 3RJXA 4TTGA 5JBFA 1VFMA 3D52A 4PMXA 4JHOA 2IXVA 3CHCA 3VNZA 3A4XA 3WY3A 1E56A 1E1EA 2YA0A 1HWWA 4PUDA 4PBGA 4M1RA 3W26A 1DWJM 5I2UA 1QW8A 3DX1A 3ARTA 3D4YA 3CUIA 1H4PA 2ESCA 2D0HA 1C92A 4HZ8A 4OKDA 1NWSA 1SFSA 3U57A 3BAKA 5HBFA 3OZOA 1CGYA 3ZR5A 1K9TA 2WVVB 1MVYA 1E73M 5EB8A 3WQWA 1PPIA 4ML4A 2G3JA 1D7FA 1E72M 1OIFA 1JGIA 3RDKA 2G3IA 3I3EA 2CITA 4RE2A 2VI0A 3ARXA 4OBRA 5GPRA 2ZXBA 3VPLA 1O6IA 4Y7EA 3DHUA 1UYQA 1V0KA 2CKSA 3POHA 3S2CA 2F2HA 1LL4A 2PF0A 2F1BA 2VCBA 2OWWA 2CHNA 5I78A 3EMCA 5HXMA 2VR4A 4E4PA 3DYOA 1UASA 3BUPA 1HJQA 3L2LA 2WCGA 1HKKA 2V38A 4MJ2A 3RJYA 2BVYA 3WH6A 3NUKA 4AZ5A 5DFAA 2VX6A 2FH8A 1GORA 3GH5A 1UWTA 1US2A 1UWQA 2J8FA 3AIEA 3EDJA 4W89A 3UG5A 1OBAA 1H3GA 3CZLA 1LG1A 3OIHA 2XM2A 1CTNA 3W82A 2UY3A 1OSEA 3K4DA 1B3ZA 4CCEA 1TA3B 3AS2A 1LWJA 1UR9A 3VMNA 2DSZA 1NH6A 2OYMA 5ABGA 1GHSA 4DUXA 5I5RA 3DX0A 4EKJA 3MUIA 3KL5A 4AC1X 1CLXA 1GJUA 2VNCA 4FK9A 4B16A 4WF7A 4OOZA 3VIJA 2BXZA 2XFFA 4W7VA 4J3SA 2YJQA 4H7VA 1RPKA 1UA3A 3UG4A 3UEQA 1IZJA 3GNPA 1DHKA 3FHAA 4AZ6A 3WH8A 5A2CA 1N82A 4CD7A 4J3TA 3VO0A 2OW6A 1GQLA 4WLCA 1CBGA 2ZX6A 1KBBA 3AXXA 5BROA 1KR1A 1I1XA 1M04A 3GBDA 4OUEA 3UESA 2ZWYA 4ZEPA 2RGLA 3VIGA 1UH2A 2G8ZA 4WKHA 1NM9A 1C8QA 2EPMX 1OGBA 3VGFA 5AYBA 4AD0A 1W1VA 3GXTA 1NWUA 2ZUUA 2ZX5A 4JFWA 3RM4A 5BWFA 1BVNP 3MMDA 2UY2A 5I79A 3QOKA 2YBUA 2J25A 3FHQA 5IFPA 4AY1A 3VM5A 3FY1A 3RPMA 4ACZA 4PMNA 4NRRA 2XWEA 4MNMA 1GCYA 4CD6A 5A6MA 1E3ZA 4W85A 4JKMA 3ARPA 4FF5A 3GNOA 3EMQA 1GONA 4D6DA 5I3DA 1V08A 2D0FA 5AC4A 2MANA 3M7SA 3MKKA 4PTMA 1OINA 4UQ9A 2VCAA 4UZUA 3FNDA 3BVXA 3OLIA 3ECQA 2ZUNA 1YHTA 2A3HA 2A3EA 4W87A 4GI8A 3AYRA 1XD0A 1C93A 1JNDA 4JFVA 3OGVA 4QCFA 1QVBA 5CSYA 3EJPA 1H0GA 1KBKA 1E4NA 1W3HA 4RE3A 1SMAA 2X1IA 3LMYA 2CEQA 1BG4A 2BHYA 4KMQA 1UD2A 2D20A 1B3WA 4DM2A 3PHAA 2ZWZA 4W5ZA 1QI2A 4JCMA 4EK7A 3WUEA 3AXIA 3MV01 3WNMA 4CCCA 1KGWA 3VSUA 4WKAA 2CNCA 1ZJAA 1VFUA 4NX0A 1K6AA 3EJRA 2DSVA 2CBJA 4PTVA 4W84A 4LYRA 2PWGA 5I23A 2YIHA 4CU8A 5LA0A 1KCKA 3W4RA 1JF6A 5CPSA 1XSJA 5E70A 2WSPA 4U2ZA 1Z32X 4AYGA 4A3HA 1V3MA 1R7AA 1TA3A 5JIWA 3WMSA 4KGLA 1CYGA 2XIBA 1JDDA 2JFEX 2YL6A 2D24A 4Q22A 3SCOA 1JG9A 4W93A 5FOOA 1X6NA 1X1NA 1D2KA 1XCXA 4R5EA 1GPFA 1HTYA 1GQIA 3CZJA 1B3XA 1HXJA 2W92A 4UFIA 3N04A 3SCQA 1V0LA 4BQ5A 4W7UA 2DT2A 2YL8A 3GNRA 3T0BA 4GIAA 3K46A 3M46A 1E6RA 2ZOXA 4QLJA 2A3BA 1E3XA 1E5NA 1OIMA 1EQPA 3OBAA 3ZSSA 4FNSA 3VTRA 1R34A 3VIKA 1PX8A 2F7OA 1UUQA 5BXPA 4BA0A 3GXMA 3GXPA 1E6XM 4MDPA 2WANA 3KE0A 4HU0A 4JKKA 4P7NA 5HOSA 1QNSA 1FP8A 3CGTA 2XGIA 4H8VA 1WAWA 2XN2A 4KWUA 4MB4A 2ZX9A 1V3KA 1BGAA 2BS9A 4DM1A 4GZIA 1J11A 1ISWA 3BMVA 2WKGA 1VFOA 5I77A 4AD1A 2EACA 4ATLA 1GVYA 1EO5A 2WVUA 3IAQA 5A8NA 1OT2A 3NYDA 5ABEA 1JI1A 1JYNA 1V3JA 4LYQA 2W5FA 3EDKA 4PRWA 3PZMA 1BYCA 3RIKA 3WD1A 3GXIA 1H2JA 2CKRA 1LF1A 1BAGA 1W9UA 1P6WA 3WF0A 3CZ8A 5CSUA 4TOQA 1U30A 4OGZA 3BUDA 3H55A 3A24A 5A8PA 1JL8A 1EH9A 1XH1A 3OLEA 4PSPA 3VDBA 4CUCA 1MW1A 4GO8A 1E9LA 5A6BD 7TAAA 2DSUA 4NZCA 2F7QA 3LXCA 2VTFA 2GK1A 2V3FA 4UOZA 2XVPA 1PAMA 1CGXA 4PN2A 3KLKA 4RL3A 4F79A 1CIUA 1HJSA 5FIPA 3TTSA 1BYAA 4V27A 1C91A 3KEHA 1W3LA 1VB9A 2F7RA 1CXLA 1WZLA 4U5KA 4S3KA 2J47A 3CHFA 3VOCA 1ZBKA 4HMEA 1DP0A 1GOIA 5CPTA 1HIZA 3VD7A 1QW9A 5D9OA 1H5VA 1ZU8A 3A22A 4W86A 1BFNA 1ZB5A 3WD3A 2ZXQA 3BAXA 3THDA 3BVWA 2GSJA 3AHTA 4PSRA 5M3WA 3SUVA 4YHEA 3CHDA 2EJ1A 3THCA 1UR0A 1QWNA 4AISA 5E09A 4AWEA 3ALGA 4JCLA 1JFXA 2VVNA 4DUWA 4UQBA 5BXSA 1QI4A 5GQBA 5ECUA 3SUTA 5IFTA 3AICA 4DO6A 2F1AA 2WBGA 2Z1KA 4M24A 2FE0A 4LQ1A 1V02E 1CXIA 3A21A 2VRKA 2BY3A 3H54A 1E6NA 1V03A 3CO4A 1ESWA 1E4MM 2YL9A 4LGXA 1JZ5A 1YQ2A 2EQDA 1FFRA 2D22A 2WMKA 5E0CA 2G41A 5EMYA 3VMPA 4UCFA 1E0VA 3BLBA 1W3KA 1V6UA 1SYTA 1VJSA 2GUYA 5D9NA 3BAJA 1KQZA 3ZO9A 4AZ7A 5JUVA 2DSKA 2JE8A 4IPNB 2Z1SA 1E0WA 3LX9A 3RM9A 3W0KA 3AIRA 3HU7A 2VURA 3EDDA 4FLOA 2IGTA 4DWSA 1OD0A 1CXEA 4AMWA 4JL2A 1FH7A 2WHKA 1S46A 3K8LA 3WNPA 1C8YA 1UQZA 1WDQA 3GM8A 4M29A 2VO5A 4FNRA 3ZM8A 1R33A 2YA1A 3WDJA 1KQYA 3ZQ9A 2VJXA 3VUPA 1J0YA 4TX6A 1QNRA 4TX8A 3AMDA 5KZ6A 2XFYA 1MW3A 2D73A 4HOZA 1MW2A 1UWIA 1AMYA 5E0FA 3HN3A 4LXFA 3W25A 1E6ZA 4AIUA 5A6KA 3PZIA 4HTYA 1UOKA 4BCEA 3AZSA 2XVGA 4Z2HA 1C8XA 5BXRA 1J0ZA 2QLYA 5JIPA 4ZXLA 3SURA 1UD3A 1R86A 4GINA 2VMFA 5I24A 5LA1A 3EYPA 2V3DA 1XCWA 5JBEA 4D6GA 1Q6FA 3O6AA 4X9YA 1EDGA 4LYPA 3SUUA 1M03A 3DYPA 2WM0A 3GYCA 1PIFA 1UR2A 5KEZA 5D8WA 2WVTA 6CGTA 2DPEA 2EXOA 4MPKA 3KL3A 3RCNA 4DUVA 4AD2A 3EMZA 4Z2IA 3LPGA 3WBEA 1ISZA 4CGTA 3VSTA 1GUVA 4WKFA 2AOSA 1QNQA 3KLLA 1KGUA 1WE5A
chains in the Genus database with same CATH superfamily
1CNVA 4IYKA 3U0WH 4MG4A 4GZ7A 4N68A 4ELMF 4OV5A 2AGJL 3H7BA 3TEVA 5I30L 4X0VA 1K4CB 5C0RH 3SOBL 3LD8B 5FA4B 3WF2A 1RHFA 1MWAH 4C7DA 5F6HJ 3C8KA 4R26H 3QPQC 3RWJA 4RXFA 1LE5A 1Q85A 4ADSA 2G97A 1NMAL 1E1CA 3X1EA 3B3BA 2Q71A 3IBEA 3L4VA 3T0CA 2AKMA 5I74C 3PNZA 1FG2A 1TEFA 4XCCH 5IJCC 5IVOA 4YXHH 3U4KA 5MHSD 4UYPA 1Y7VA 1I7ZB 1S1PA 3O3UN 3PTDA 5D4JA 4Y89A 5F4SA 3FUNA 2ZUXA 4BZ2H 3HZVB 1H6UA 4YIWA 3WD0A 3VG0L 3DC0A 1XINA 3OHIA 2I9TA 2EG6A 1FL3B 3OMNB 3KYOB 4NUJA 4M48L 3MRIA 3BDBA 3CMFA 5F4WA 2G3NA 1PZCA 4UQ2B 1TTRA 1WS8A 1KJ2H 3A6BH 1Q63A 4HPHA 1L8PA 3AHZA 3RQ3A 1JK9B 5G4OA 1U8OA 3VFGL 5DZNA 1MVUA 3F1QA 2J8UA 5BOOA 1UCTA 3BP4B 3TFBA 1R3HB 3H9ZA 4YZFF 4HEPA 2WXQA 4NO2A 1QW7A 2Y7MA 4X99B 1E6PA 1OGPA 4I3SH 2UV3A 2CZ5A 2INEA 1VBUA 3CFDA 4QGCA 4O58L 1BX2A 4AZ8A 4QRQB 4Y16A 4LHJB 2ZKHL 4N8PA 5C7HA 4IPLA 1T66C 1IBBA 1PEZA 4Q7IA 3L3JA 3SDOA 2I9LB 4JW3A 4I7UA 3NDZA 2X28A 1QSZA 4M1BA 4DELA 5IK3A 3BLIA 3I7QA 5IBUB 3GY1A 4Q52A 3CL6A 4JK0D 3PE9A 5F7LB 1FYTE 1QOXA 1JXFA 5JMUA 1S7UA 1UJQA 3FO1A 3FJNA 5GGSB 3DIPA 2QPEB 2J43A 2FJGA 4PN6A 3BLDA 1F4XL 1B0IA 2IADB 4K6AA 5F9AC 6FABL 1G9MH 3SBWA 3BZJA 2DVXA 2C3XA 3CFCL 1XGZA 3MJ8A 2EG8A 2KC0A 4J3OH 5D2TA 2OSLB 1S3HA 4OZOA 3AI0A 2OXHB 2AQ2A 1LRNA 1E8ZA 3O3AB 4HS8H 1ZT7A 3MSGA 3FQTA 3SE3A 4EF9A 5T3ZE 3AREB 3ZKSD 2VZUA 3ORWA 1EB3A 3AIUA 3PWPA 1ITCA 3E9TA 5DHVA 4X4ZA 2J72A 4B9ZA 2PDLA 1S5IH 2C1IA 2CIPA 5E8PA 4CC4C 4JL1A 1BBJA 1F97A 4I18C 1U8KA 3VW3L 4ZUTA 1NIFA 3WDPP 3QUMB 3LPWA 5DMMA 5ISZB 1A6VH 1PD0A 3VIFA 4LC6A 3SRFA 5MKGB 4Y9AA 1DLHB 4K5NA 4H83A 4E42A 4X6DF 1HYSD 1XB6A 3SDAD 3FO0L 2Q6ZA 3T3PE 2WNXA 1IC0A 1QSED 1IZKA 4IOFD 3UZEC 4GOAA 4C8XA 5A2BA 3SO3B 3A4AA 5GRJH 3MA9H 4RLIA 5FL0A 1J0KA 1A80A 2WLHA 5SX5K 3MPCA 4RMRA 1S2TA 3WLLA 1AGEB 3QLLA 1EZSA 4MAUL 4Q8UA 3EO9H 1MPAH 1FO0L 3S34L 5DQJB 1N70A 3QKZA 3UNDA 1J2WA 2WXJA 4XPHL 1JZ8A 1QWUA 3B04A 1NCBH 3OA5A 1W9DM 2C9XA 2GY5A 4PRBA 3WFDH 2KI6A 1UWSA 4GZJA 4MIMA 1E70M 2WGXA 3PK7A 1E15A 2DV0A 3BLPX 4NUMA 3N15A 5D7KD 4GQ9H 1QPNA 3NQEA 3N42F 1Q45A 2YLKA 5CLXA 2VLLB 2V5BA 4K2UL 4HK5A 3CEPA 1A14H 2H9AA 5I1KL 5BV7L 1XF3B 3ZSTA 4A1RA 3NZ8B 4AH2B 1MFAH 1G7PB 5HMDA 5FWQA 4V1DE 2V82A 2AXGB 1T5XB 1OGTA 4ZW3A 2WXDM 1S9WB 3B6SA 4WU5A 4H1LB 3PBUA 4PRDB 4JIHA 5L9DH 3P3BA 3HN5A 2BY2A 1V7MH 1M7IB 1PIGA 2ZYRA 4UT7H 4F2MB 1WA2X 3LPFA 2BFVH 4LASL 4FMKA 2QJJA 3MRDB 4M03A 2Q86B 1IX2A 5IROA 2V8MA 3FPXA 4FQHB 2K1MA 4ZSOA 5D9MA 4ERSL 2ZOOA 3ELFA 3D39B 4XTDA 4KEUA 3HIZA 5FYKH 3C0LA 3TPKA 1AE6L 4E41E 1WYIA 1KYUA 1LO2L 1XG3A 5LXGH 3W7KA 1QK0A 2DZVA 1TJ1A 4O51A 2ZXEB 2YPIA 4H0IA 2O5ZH 1T7WA 1UXLA 2YKLL 5BZZA 3RDTB 4LCYB 4HV8B 3ZTNL 1HYSC 4JNXA 2AZAA 1KULA 3F7LA 4ZUSA 2OR8A 4ZNCD 5IMMB 3ZDXF 1EXPA 2DVTA 2JK2A 2WBWB 1NC4D 1FV1A 3G1VA 1YECL 3OXRB 1LEKB 4LPCA 2DLFL 4HIJA 1MJUL 3VI4B 4OZFH 5ABDE 5FKPB 5EU5A 3O63A 3Q58A 1B4EA 4B0MM 3R0DA 3ZPDA 4F80A 4AHPA 4UUIA 1S5NA 3CUJA 4U5IA 4S10A 2DI7A 5BS0E 3SSJA 1SZNA 1I7UB 3S36L 2EADA 3OZYA 3ECWA 4JVWA 2VITB 1W80A 3WTVA 4F57L 2P5NA 4M8QB 1D5BA 5FWRA 3MRBB 4RMWA 4QHLA 8XIMA 2PXYD 1R3YA 3OG3A 2P8LA 1AQHA 4NZUL 2C79A 3CK5A 1PQZB 2N01B 1RVGA 1FJ1B 3ZN6A 4HK0A 2B4GA 1UADC 4MCZB 1R3WA 1HJWA 5L2KD 1FXPA 43CAB 2PDQA 2XDHA 1J8RA 2VL5A 4EF8A 4A7QA 3LD5A 3LS4L 2HJPA 5D4YA 1IV8A 1GKPA 4FHKA 1RUSA 3SBRA 4ZTOH 3C2VA 3L3KB 3SGEI 3HOGA 4GS7B 2ZONA 1FWWA 3GS6A 4RQQB 3MCG1 1JXDA 4R4ND 1I1RA 3EH2A 5IJDC 1M7JA 5DURD 1MCHA 3AQYA 2DIBA 1KXTB 3HFMH 4CNNA 1CFMA 5TDNA 1OJXA 3S5OA 2QQLH 1A65A 2IXUA 1VGKA 2FJHA 2MCAA 4P8UA 1YRKA 4WOZA 4NKDA 2FUTA 4MQXD 5LGHL 3QRLA 3OL2A 1OAZL 4B53A 5LIYX 5DSCB 1DSFL 3W71A 4XP6H 2LFGA 1U5JA 2XICA 4NP7A 5LNGA 5LGJB 4EUPA 4JO1L 4LLQA 1NOWA 2A3LA 1LEGB 2HFFB 1ZK9A 1X6UA 1U8NB 3UWUA 2OZ4H 3FJLA 2AJSL 3ULVF 4HJ0D 1XIIA 2WWCA 4D0CB 4J35A 1UIOA 1UJ3A 4IRJB 3AROA 1E65A 3W7LA 5KZDA 2D31A 3JTTA 1BM3H 1K5WA 3V7MA 3BKYL 4POZD 3P8IA 1BAFH 4EDWL 2PLKA 4U1SB 1TTAA 4B4HA 2VC5A 1D7KA 3V95A 3WE6B 3KVQA 1UQSA 3PWJB 3PHQB 1AOZA 4HA1A 2XN9D 4DIXA 1C9WA 4FLRA 5D04C 4JPGA 4DW2L 2NQHA 1L9PA 3ARFC 3QFDB 2DH3A 3E8UH 1UJPA 1G7LA 2VWTA 3BN9D 2H45A 2ZXCA 2WYTA 3KP0A 2DQHL 5HYJA 1W1TA 1DANU 5AOZA 5DVKA 3P4NB 2C9QA 5K4ZA 4LPYA 5D96B 5HWJA 5A1AA 4QTHA 3D3VE 1A4MA 4JFEE 2I25N 3IKCB 4H0GA 3QWNA 2H8XA 3ASOB 3CDZA 1ML1A 4ANXA 2PXYC 4AIEA 1KTCA 1CICB 2E0PA 4ENEC 4GW5A 4IBLT 2FQFA 2H8PA 3NQCA 4S3CA 1KEML 3AUWB 2ATMA 2R56L 3VXSA 2XDFA 4ZMLA 1VKXB 4KRPB 1U95A 2VLRA 1GPWA 3ESUF 4W68A 5IM51 2ATPA 4BDVB 1IGJB 3SKNA 1JPSL 4R4NC 2ZAHA 5DD6A 1A6AA 3EPOA 3WLNA 3UYIA 3SRKA 2P44B 2VWSA 1E40A 3HE6B 4IIBA 3OKEA 3MRCB 3TZNA 5F72S 3W9ZA 4F24A 2E59A 1FRGL 4G7EB 5TDOA 2Q87A 4HVBA 4DI9A 2OX1A 1VSCA 2BNJA 5I06A 1A02N 1IF2A 4NZ4A 1XV8A 3OHMB 5DJZA 3VNYA 4WTZA 3AVEA 4MQXC 1OAUH 2C3GA 5C2UB 4M8UA 1IB5A 2V33A 5T8IA 4ZQTA 1U3YA 3V0EA 4LRSA 1QO3B 3P4MB 1I45A 2UBPC 4H19A 4LV9A 4HU2A 1OIOA 2OCCB 1REQA 3W9DB 3LENA 4H8HA 5B1KA 2FIQA 3BP5A 2Q8ZA 1N8IA 3IVSA 4X9BA 3D4ZA 3DX7B 1QOQA 2FDSA 4HJ0C 4S2BA 1K9DA 2YX0A 1IM9B 5DRNB 3H9SB 3DV4A 3B3IA 2Y63A 5EFDA 4POZC 4AXKA 4HIXL 3NCMA 3BOVA 5DC9B 2QUMA 2G50A 3WO4B 3WY1A 2DTML 4IRSD 4L8SB 3BCFA 3DVIA 3DDFA 1BQ5A 4TVPL 3FU6A 3WQEA 4ZTEA 1JF1B 3BDKA 3T81A 3DXAA 2X12A 4JEGB 2NY6C 3V4PA 4F0RA 3W7QA 3WMBA 1ZHBB 4MNGB 1NFDB 3PDOB 1A6TA 3GIVA 3N41F 4DGIH 4UQIM 4PJDB 3AGVA 1JNNH 4HNNA 4HHMA 4BQ8A 1PS3A 2NNAB 1V0NA 2NXZD 5K9QG 5J5RA 1AMXA 3CDGB 4FFYL 3EYUL 1B31A 4I77L 1FBIL 1U8QA 3QDJA 5GGVY 1OCWL 3UR7A 1UA7A 3Q4DA 4M7JL 3ZTEA 4N2OA 5BUGA 5DR5H 5AC5A 4KWWA 1TUPA 1SVBA 3K6FA 4CC4A 5GGRA 5AECA 3Q05A 4HF5L 1FL6A 5ESAB 1NEZG 2CFFA 2OJEA 5E5MB 2V5LA 5KBLA 1OGAE 2AF2A 4E68A 2XZQH 5AYYA 4IW4C 2WVVB 2WTOA 3MO7A 4PJGF 3UZEA 4PLJC 2C4XA 3NJVA 2YQ2A 4XHQA 3S2CA 2B59A 1EPVA 5L7XL 2AQWA 3N1PC 3L08A 2VM8A 3GTXA 1Z5HA 2DWEA 2VR4A 4WJG3 2K8QA 3ECUA 2BVYA 4IOSD 1ELSA 1NCCH 4AZ5A 1GKRA 2OMYB 1VLWA 1MG2C 4KX9A 3NQFA 1YTEA 4H9UA 1LROA 1OX4A 4QXIA 3TVMC 2V7HA 2J8OA 1R3KB 3AS2A 4PGLA 4HIEA 2ED8A 4DEFA 3KLAB 3RNQB 4TVSa 4UM8B 5FW8A 1MRAA 4ZFFB 3GYEA 4G9DA 5AW8B 5DD1H 3CXDL 2RACA 2F9BT 2FVMA 4IKJA 4ZMAT 3LH2H 2BP1A 1NMCC 3OPZL 4K55A 2EC9U 2P9RA 2Q3RA 3VNDA 2K3TA 2ZX6A 3AXXA 5D2NE 5LN8A 4XWGH 4DF1A 4IRSC 4MFDA 1AI1L 2XQ0A 1CDJA 2EZ0C 1M7PA 4FADA 4QM1A 3B0UX 4NJIA 4AUJA 3F7KA 2ZA3A 4J3OF 4DVOA 4DCQB 3O6FD 2R2HA 4OF0A 2MHAA 2E28A 1AJ2A 2ED9A 3RN6A 1LMKA 3FY1A 4M6NH 4GMTL 3IDGA 1W72B 4LCIH 5FGCB 4CD6A 4BSWB 5H37G 3F83A 3VSQA 1XLBA 1B6DA 1PY4A 2L4OA 1TNNA 1GZPB 3Q13A 3VABA 4Z0BH 3OX8B 5D7IB 4GT0A 3MA7B 1ENUA 4M7SA 1ZENA 3NJMA 3CG8A 2HSAA 6PCYA 5I1IL 1JPKA 4GI8A 1HE8A 2CUMA 2NXZC 1JNDA 3DRQB 7XIMA 4GJIA 4PWIA 4XR8C 4NPYB 1UD2A 3F7VA 2I56A 5A16B 4LNVA 2JK5A 2GGGA 3QDGE 5ES4B 5MEQB 2ZCLL 1A5OC 3KVJA 5JW3L 3EF4A 1QZNA 1WT5C 4DEPB 3E6HB 3UJ2A 2IQ9H 5BOFA 3SGDH 2NSMA 5C0AB 3NPSC 3WXVL 1OK8A 5L8LB 4KGLA 3CK0L 1FZJA 4HALA 2W88A 3NIFF 3TBTA 3VVVA 4NEHB 5AKTA 4W93A 1KFCA 4GUGA 3ESMA 3V4UH 5I5IA 4LBSA 4UIKL 4UU9B 4J2PA 1EV2E 1T8QA 4YTUA 2JWYA 3QRFM 3BPNC 4TUJB 4W7UA 5KANI 4GIAA 4MA8L 1UCBH 4E3TA 4K3JH 4Z8FL 1JRCA 4AM0Q 1QSEA 3FYEB 5HI4C 4DQWA 5JXAH 1JPDX 1D3GA 5EMUA 4TRPL 5JH2A 4XMKL 1CFNA 4J3ZA 2YO3A 4I85A 1MKFA 1QKZH 4UQ3B 2HCVA 4OZHA 4PLKC 3GIQA 1YNKL 4P5TB 1V3KA 1CD8A 4GZIA 4UC5A 3V35A 4PJBA 1C8VA 3RTLA 1LUCB 1EGMA 2EGZA 1DVFB 3PWNA 1S8DA 5FDWA 2PF8A 3N0PB 2E7FA 3UYOD 4H26B 5DI8A 2PO6D 1MAJA 3JWNG 3BUDA 4OWGA 1DFXA 4I0CC 5A8PA 3GSWA 3WTYA 1MW1A 4OGQC 4IJRA 2BOCB 4PTUB 3QW3A 5D9SA 1JCVA 1P5BA 3KLKA 4RL3A 1CIUA 3LKRA 4HK3N 4Z7OB 4OD1L 3O45B 3GFUA 1QQDA 4HEMA 3HE7D 1AC6A 3MNVA 3TNNB 4MCYA 2CLFA 2RQ8A 4GB9A 5CPTA 2YGVA 2OMZB 2DVUA 3LN4A 1LE9A 5LB1A 3BAXA 1HOCB 4ZCWA 3AJXA 4CA4A 1HXMB 3THCA 2B1AL 4WI6A 4WZHA 4YHOH 5LGYA 1JFXA 2OQYA 1L6FA 5C9XA 3WBYA 5D7JB 4UQBA 1A0QL 4BCZA 2K6ZA 4JTTA 1V03A 2D22A 4BZ1L 3VMPA 2ABAA 1CURA 2YPLD 1I4FB 3JU2A 7FABL 5AC6A 2VIRA 3VWKB 1E0WA 3BZFA 5KBPA 1KM5A 2G0WA 4WW1B 4FLOA 4ODBD 3LCGA 4QXUH 3T1GA 4N9GB 1UQZA 4K7PL 4R0LC 1DBJL 1GWJA 2YA1A 4TR9A 5DD0H 3QW9A 2DI9A 2W59A 4XP1L 1FWNA 5BMWA 4N8VA 4DPQA 4J4PD 4AIUA 3QVQA 1I1AC 5DJCB 1NFKA 1O95A 3RKDC 5AG8A 2PF6A 2XG5B 1J0ZA 3S4SB 5BZDA 2ICWA 3SURA 3ANVA 3MVSA 5LBGA 3PL6D 1NC4A 3SDYL 3RBSA 3LCXA 4O54A 3QULB 2A5HA 2O26U 5DVMA 2EXOA 4KPHH 2VUKA 2WQRA 4JYDA 1Q9KA 3ARFA 4F33A 3MYJB 2OL3H 5H2ZA 1LQ2A 1QNQA 2MKLC 4LVNB 1R2SA 3SCMB 2W79A 3N06B 3RPTA 4FXSA 4HOXA 3QUYB 2PO6C 5JHLH 3VCLA 4Y96A 3SSGA 1YYML 4U49A 1DDHA 4CNSA 3SHSA 2REQA 1J10A 2PXYA 2F8QA 3HG1B 2J6WA 3CO8A 3AITA 2KBGA 2NVDA 1XLKA 1IT8A 1KBLA 3BPWA 1FE8H 2E6QA 5L2KA 3TWAA 1V3IA 4NKOB 3ZKMD 2HH0H 3HE7C 5LNWA 2YPVL 2V5KA 5AUMA 4P61A 3VJ6B 5DUPL 3IDMB 3ZMRA 2CCVA 1JNJA 4B3ZA 4B7IA 2VN3A 3HC2A 5IHWA 2P28B 2NQZA 2I60L 1G01A 3QYMA 1OLLA 1IHIA 2P88A 3BQUB 1J5TA 5I8OH 2CBIA 2ZZUT 4KKAC 2O1AA 2F15A 1YEIH 2B3IA 3GSNA 1TTUA 1CI5A 1XF4B 4QY8A 2BP5M 3LKOA 1LNUA 3HAEG 1FWSA 4YIQA 4NYYA 1R5WA 2J8HA 1H3TA 4U3HA 2R1XB 3GSVB 5FYLH 3ZOAA 2I7OA 4PPTA 1OM3H 3ARGB 4JO2L 4NI3A 2ZIDA 1UKOA 3JWDL 3HB3D 1OC5A 3QR2A 4Z2JA 4KTYA 2ZJSH 2E5CA 1H0IA 2VDKH 4B41A 3H21A 1EYEA 5CU5A 4DN3L 4P57A 2PWDA 4CVWA 3W5NA 2G2RB 5LKYA 4KVCL 2GQ3A 5EYWA 1FWTA 4FYRA 4J4PC 3FK3A 1EP2A 3LYEA 3FONB 3ABRA 3BGMA 3HRZC 2QJIA 1XBXA 2A73B 4PV9A 5EH1A 2YSSA 3MODL 4NYLB 3D51A 3PL6C 3ZIYA 3JTSB 4DQOH 3O6KH 5FS5A 3D2TA 1BQKA 2VN7A 1IEBA 2FLRT 3WMQA 3BVVA 2V3GA 3N17A 1VZIA 1L0PA 1KN2H 2X1WL 3HLKA 3KS0H 2VKWA 2ZUMA 2YDSA 1LRQA 3PNUA 2OV0A 3MBXH 4EWND 4OLZH 1JXGA 1F18A 4N90E 1FA4A 1UM4L 4PJ7A 3C0QA 4EKXA 1XSIA 4I0PB 1LT7A 4ZMNA 2MKWA 3CWGA 1DN2A 4PMRA 3WNNA 1DBMH 4A2FA 4JAWA 5LUMA 3QCTL 1T2QH 5CCJA 3P82A 4JQ3A 2VDOL 3QZLA 4XNQA 3FB7A 2EDKA 2YB4A 3ME0A 3OVGA 3ZKMC 1QD0A 1UWUA 3DBNA 1Q8AA 3BISA 3BT2H 2GOKA 3GLAA 1EEYA 1H15A 3LIUA 4X4KA 3CD4A 4FX5A 2VFHA 1EZ2A 3TJHD 3RX7A 1A6ZB 5ACZA 2EVFA 4OLUL 1VADB 4A05A 2ADAA 2V6AA 3M1BA 3EFDH 5ANHA 4R83A 3RPKA 3O0RH 2VZVA 3BP7A 1UH3A 3KXFE 1E55A 3MHFA 4LLYA 4HN8A 2HTKC 3HF3A 2AV7B 4E8CA 2OQHA 5CS7A 2BY1A 4A7VA 3DXIA 3F7JA 4W5UA 3SQBB 3VFLA 1ZJBA 2IG2H 1B3JA 4JFOA 5HGHA 1TJIH 5JLZA 3NZUA 2GSIA 1G0CA 5B38B 2Y72A 3TR2A 3TVMA 1JZDC 3HB3C 4Z18A 2O5NA 3TBBA 1DUYA 1KFAH 4QS6A 5GXBB 2P7TB 3FNKA 4YDVB 3ZDYB 1JUBA 4L1DA 4PRHB 1DQDH 4Y0GA 4BEUA 5KETA 2R27A 2CDGA 3FEQA 1SFLA 3Q65A 5CO1A 1BYOA 2CXGA 3QJHA 4F8PA 3AUJA 3QORC 1BRLA 4IRSA 2ZPKL 4LSUL 4N2IA 3G0XA 4YSOA 2GVLA 3LZQA 1SEBA 4U7SA 4CRPA 3MNDA 3QPXH 3LN9A 5AYUL 1F76A 3M86A 1WJ3A 5KANG 5JHDE 3F4VA 1LRTA 3PZNA 3PJSA 1Q1JL 1GGBH 4BWWA 5F1NA 1UBSA 2VYRE 1HG3A 5DXYA 4DNMA 1FZMB 3T6VA 1K8XA 5KTLA 3RB5A 2HB0A 3JZUA 5FYJE 3RMEA 2WIIA 1OE2A 3NOYA 5AAMA 4OFPA 2BVQA 3RX9A 1JDAA 3M1CA 2OOGA 1UXSA 3AAZB 3GDKA 4HZLB 3LBOA 2QQNH 3LKQB 2WQWA 5E6UB 4UT6A 2AQSA 1S3KH 5C09A 5JPNC 1FHVA 1SUXA 2FLIA 1WT5A 4Q9QH 4B2DA 1ZD6A 1BVZA 5KVFH 4JR9H 4QRUA 4L1BA 3GE7A 5IROD 2ENSA 2XWTA 4IQHA 2AAAA 1HF6A 3VVWA 3AFBA 2XV6B 2CRZA 3Q1SH 4ZS7H 3TH6A 4H5SA 3L3IB 1IGIL 2CDEA 2WOYA 3EZJB 3TWBA 3VVGA 5AHMA 1JFQH 4LY8A 4KX7A 4L1TA 3HGJA 3TH4T 4PJCA 1L3WA 1S7WB 1Q94A 2WLZA 2D03L 1JYVA 2KAUC 3MRJB 4LP8A 3GR8A 3TOYA 2VFDA 1A47A 1X5HA 3AOFA 2UYLA 1EHXA 4BWUA 2YEZA 5K3VA 3VUAA 4UTAA 1INQB 5KSBE 1AQMA 1P7KB 4HWBA 1YDOA 2NQJA 5IJKC 2EO1A 3RWGB 2AEIT 3RCMA 1XH0A 4CSPA 3NFNA 3SJNA 4M93B 3EO1A 1NCWH 1Y1DA 2BHFA 3P4OA 1NAMB 3TBVA 2HTMA 4GAYA 4PE8A 1XLMA 4X4MA 5G4NA 1TMQA 3TEWA 5G2NA 4LCRA 2EPLX 4TSAL 3EJJX 3ZWTA 4KQ4H 1CR9L 4A2RA 4JHWH 3VZZA 2VAJA 4EBQH 4GFXA 3MRGB 3CAWA 2XFXB 4TVUA 4E2BA 1FGVL 1VHPA 2N4IA 4K1WA 1TPH1 1NOUA 4NOBA 5KJ7E 2OKTA 4XBSA 4CL7A 3WUFA 1N7ML 4IMCA 3RR4A 4I8DA 2H5UA 4R3UA 3FDGA 4NNXB 3W83A 2B3RA 4AL8H 4H40A 1SJVA 5B7FA 2H2SD 2G95A 2XG4A 3GM0A 2DT0A 3KVKA 2NY1B 4P9HH 3SGJC 2E75C 2VOTA 3HO8A 2R0LL 2BGSA 4N0YH 5EIIA 4PV8B 4R0LA 3PGCB 4P5MA 4OCWL 5LCVA 1MCOH 3ZKQD 4YBLC 1VIWA 5T1DH 3ESVF 4AG4H 4LWWA 1BZ9A 1OFRA 4S3BA 1G7MA 4LSRL 1UKSA 1A7PL 4RZ4A 1I1AA 4DWHA 2C8NA 5KVDL 4WJEA 2Q76B 2Y70A 3IUDA 4EQ2A 5ID1B 4JGNA 4F8XA 4MZIA 2AI0L 4LFHG 2LAGB 5J6GB 2PBOA 3KZSA 3O2VL 2R69L 3KPLA 1Q5MA 4AD3A 2W67A 1HS6A 5AVNA 3KWWB 4YLWA 2CR3A 5ALBL 4FMVA 2BSED 3GT6A 1NGWA 5DK2B 2WAQA 5TFSL 1D5IL 1GOXA 4LS2A 4D6EA 3E80A 3STZA 4YDJA 2P1FA 4S3DA 2NLJA 3CVHA 3RTQC 1TPC1 4A6YA 2PO6A 4NZRH 3HG4A 4FI4A 1BEYL 1MJJB 2JQXA 1N3NB 2A7RA 5HJGA 4R7LA 6TIMA 1IIKA 1TCMA 1BW8A 3TSBA 3UPAA 4CN1A 3T4CA 4PV1C 5HYJD 2NZIA 2BSSB 3ZJ6A 3L5XH 3DDGA 3FCPA 1CMOA 2H6PB 1U36A 1CL7H 4UB9A 1ERNA 1C3FA 5LGKA 2LHAA 4R7WA 3MJWA 3HE7A 5KOVC 3WFCH 3T1WA 2W4XA 1BQHG 1X6LA 4LESA 4KGJA 5AYXA 2R23A 3TBYA 3W7DA 3QPQD 2GOUA 1KYAA 2PYEB 1GTHA 5EBWB 1GZQB 4HFWB 3RL1B 1I8IB 3S5LA 4LB3A 3MLSH 4B3KA 4WO4D 5FO9B 3UABA 4Z17A 1U42A 5A2KH 3O2LA 3WEZA 1ZVHA 1T2JA 5HDQH 1XVSA 2X4TB 5KVGH 4PJFE 3MHGA 1W2KT 3LNHA 3A6CH 4GO9A 2LQRA 2Q7YA 1CLYL 2YPLA 2K0RA 3G3MA 4OW6A 2BP8A 3UW6A 1D7DA 1XUUA 4UTFA 4OOUA 1KIPB 4PBFA 3RLGA 3N4FA 3I85A 1KELL 2XVKA 1WKYA 4B5XA 4YEEA 3QEHA 5D9PA 3IDIA 4Z3HA 1EXHA 2YEVB 4BFBD 5C6MA 1R87A 2BCKA 3S98A 2P5WB 4J4PA 4IS6A 2FZ3A 1NUGA 4LUSB 1MQRA 2WINB 3RM8A 3HRZA 4LYKA 4LLWB 5D4IA 2YYTA 3PL6A 5DMIL 5I3JA 2CJUL 2R7EB 3QS3A 4JTFA 4LGSB 4IFOA 3IDYB 1R47A 3KPNB 2BSRB 2UXVA 1T66D 4D9RD 3KYKL 2CM5A 4B95C 2HWGA 4MNLA 4QDMA 4H9ZA 5F7BA 4Y5VB 1E67A 1BQUA 2XIOA 4F15B 5DWUL 1DQVA 3MUY1 4NM4H 3TA4D 3W1ZA 5HHXH 5U7SA 1LP9F 4FQJL 3H3PH 4NBYB 1N8ZB 1XYFA 2Y5QA 4XPAH 5CEZE 4TVDA 3FUEA 4KQ3H 4WSGA 3CDYA 3BEWB 5CKSA 2MSPA 5B1CA 3CIQA 3RJXA 3VH8A 1HH9B 5JDJA 3CHCA 4JAMA 4AKQA 2OXGA 4Y2WA 3N6HA 2CO7B 3G6JE 1WITA 5FEPA 4MY1A 2IANB 4RDZA 2F08A 4AV4A 1BVLB 1CT8A 2ED6A 1IE4A 3DX1A 3UAJD 5DC0A 3GSXB 3QDJD 2ICES 4IMLB 4U1HB 2EH8L 3FT2B 5EO1B 3FKRA 5I3GA 2G3JA 1D7FA 4OZGB 2RDUA 1T1ZA 4A3QA 1J7VR 3MHZA 4U6VH 1SM9A 3QXVA 3OVUB 4WO4C 4LSTH 3RWIA 3IPEA 4UMAA 3WSQL 2PF0A 5IB5B 1C1EL 2CHNA 2ZWNA 2BLFA 1HHIA 3T0XA 3M8OH 4XNYH 1N8WA 3L2LA 1DQTA 4KMTH 3RJYA 4TMCA 4MWFB 4YAQA 3NTCH 1XLCA 1RSCA 2NW2B 3AIEA 4XOAA 3EWXA 2I5YL 1QLFB 4KDTC 4XAKD 3QJXA 3MKCA 4DUXA 3CZFB 3W2DL 2X1OA 3VXUE 5J6SA 5LWYL 4B16A 3QUMH 4GKTA 3P73B 4J3SA 4P04A 3IFNH 3L3HB 4FRWA 1ICSA 1XRSA 5E1AA 4RWYL 5AVWB 5I8EA 3O1NA 4KNUA 1WCQA 3P30H 1XLEA 4HBCL 2PDHA 2VEPA 1XGTA 3REVA 4X9GA 1ZKAA 2ZX5A 4JFWA 4ZR8A 3WUWG 1FYTD 3O3BA 4PGEA 4A6GA 4ALAC 4JRYE 4JPIA 4IM8A 4YXLH 5FOBB 1TVLA 4LHUD 1XZ0A 2ZOLA 2QAFA 1N19A 2OMTB 2B4CC 1HQ4A 3D9AH 5IQNA 2ZE3A 1VHCA 3TIMA 4RNRA 1KZQA 4ANVA 3FN0H 5ILTH 6PTDA 3BVXA 2NZLA 3AYRA 3N44F 2D3VA 4OGXH 4O00A 4BHUA 1CF8H 4KMQA 2XZCH 5TPWH 3OWRA 4EK7A 2VE6B 5C3IA 4LUTA 3BJTA 1FNAA 5CJMA 3K81A 4Z1CA 1JK8A 5JPNA 4GSQA 2NXGA 4ODXA 2B14A 2YPKA 1HC1A 2CLMA 1V3MA 2EDQA 1R7AA 2F5BH 2DI8A 5ACMA 4FULA 5FB8B 4M43L 2QVIA 3UAJC 4BSVB 3V8CA 4XB7A 3BH8B 3O6LH 4H1LH 2WP3O 1HCYA 4XBMA 4FQ1H 2NUPA 1YPZE 3ZYJA 1AQ8A 1B4RA 1YRRA 3BEVB 3KPMB 2WO4A 4FNSA 5I8KL 2QEZA 3CUZA 3MV8E 2F7OA 4YE4L 3RUGE 5IM7A 4HU0A 2FATL 4X6CA 3VOIA 3NL6A 3NM1A 1DXIA 4HS3A 4OZIF 4MB4A 1RZ8B 3NPZB 3RI5K 1SBBA 3CFQA 1Q6QA 3B0YA 3TJ4A 4LQFH 1OF0A 3MCOA 4J5NA 3SYPA 2VB5A 1CGSL 5IR1B 1EO5A 5TIMA 3K6IA 4IGBB 5DO2C 2NXIA 4QHRA 4NC0B 4RZ5A 1F3EA 4KXZI 4KTDL 4MJIE 4F2TA 4YU1A 4ZB0A 2X9ZA 5D33A 4N6QA 1LF1A 3W2UA 3WF0A 4NC2B 1SQ7A 4TOQA 4TF4A 2CLZB 4QTFA 2VP8A 3UVIA 3CQQA 1GYUA 3ECBB 5KSUA 2Z1PA 2G5BA 5IJKA 4NZCA 1IXOA 3X12B 2GJZB 5E8EB 5I71C 5D1ZI 4JDEA 3RVXC 3AG4B 4NO0B 3E38A 1GC1L 2DDQH 3RU6A 4DP4X 3TVAA 4JQIA 4XMPL 2J47A 1E28A 1OP3H 4V1DD 1DP0A 1Z9LA 3OKLB 1ZLSH 3VD7A 3IJDA 1LDPL 3K1GA 3Q8CA 2PP1A 4MKTA 1WUZA 3OP2A 1XG4A 5E09A 4HKJA 3NCYP 5CAHA 2P0OA 4WFGD 1ETJA 3IRDA 3IF1A 4L0ZA 4ZMZA 5E24E 1I1YB 1AXSA 2HX8A 2FJUB 1RUPH 4C1NB 5IVNA 1U6AL 2H9GA 3V0HA 4A7GA 1GT8A 4M1DL 4GQ0A 3SGJA 4E41D 1J6PA 5FF3A 3NIGB 3K8LA 4FA8A 4M29A 5IMLB 2KDYA 2FD6H 3LKNA 3FU7B 2DMCA 4PJEA 3CFKB 1FWGC 2JMRA 3PS7A 2XYCA 4DZ8B 2XFYA 3D4CA 3MRRA 2A1YA 4G1EB 1AD0B 3O3DA 3K4WA 1ZHNB 1H9VA 2L8AA 3W25A 1J5SA 5M2FX 4BCEA 4ELME 1X4YA 4DJFD 2HP4A 5IQ9B 2VSCA 1TVBB 2C9VA 1XYMA 1R86A 1XBZA 4L3FA 1IT9H 4WTWA 3IDJA 4FEIA 3EYPA 5I6KA 3OKKB 4QF1A 3RWEA 4ZX6A 3CL7A 3IDNB 3UEZA 2CWNA 5A7BA 5DK0B 2IC2A 8TIMA 1P0EA 3D5OF 3FCSA 1VIZA 4IHOA 3RCNA 3TLRA 1JDEA 3QK0A 2X9WA 2XWJB 1RQEA 4S3AA 2VABB 7ODCA 2CK0L 5F88B 3E6EA 2DQUL 5AVYB 3ZVHB 5EZJA 1R9ZA 4B96A 4LGRB 2VDNL 1XO8A 5C9JB 4X7EC 1EOMA 1IQDA 3FO2A 1LDSA 5CMAA 3V7AE 3RTQA 4PUNA 4ZA0A 4BEQA 2Q6WA 3WLWC 1HHGA 1RALA 3FK4A 3ARFD 3KPSB 1E6OL 3MO1A 1OP5H 1EC8A 2F6XA 4P23C 1HZHH 2QUVA 3THQA 5J6HA 1UPMB 3JVGC 1PDKA 3B56A 5ABAA 1UQYA 5DT1L 4LT9A 4I2XB 1JZ3A 3K6SA 1PGRB 4YZFE 2PLJA 4OV4A 3I9GH 4Z0JA 4HDIA 3KX6A 4J9JA 4QIRA 4AM0B 1PCSA 5C0GA 4ENED 1VEMA 4LCSA 2Y6SD 2YQGA 3L1OH 3H2EA 3PAOA 1KJ3L 1G0YR 3CZNA 3N43F 4WU7A 3RMJA 2ZOKB 1M57B 1R5YA 4UQCA 1T1WB 3TTEA 4LLMB 5E5LA 5B7YA 4IHCA 2WZMA 3SAZA 5A8QA 4US6A 2J7HA 1LYXA 4AHQA 4GI4A 1B1YA 1A6WL 4G6JL 1BGGA 4YHNB 2INFA 2E46A 4DKDC 1Z9NA 4OTXH 1O94A 5CJOL 4F7PB 4JRWA 4NNBA 3LXAA 4YPJA 5I1GH 3GHUA 3WBWA 3UGUA 3NT0A 3B03A 4HCRL 1H11A 4CSSA 2NX1A 2BHUA 3DTUB 2NVAA 3UGRA 3F7PC 5DMLA 5EF0A 1UW9A 2RFXA 3UZWA 3KDPB 4HXBL 4DJFC 4AQLA 2P0IA 4YCPA 2QJNA 1AGFA 4WHYH 3RX4A 1PKQA 4HT3A 1Y18A 2EECA 5DT7A 3HQPA 2DF3A 2QEJA 1F90L 1AAJA 3NOIA 3FYIB 5HYIA 2EBNA 5EOCH 3KAAA 5FAJA 3DI3B 5JVLA 3ZE0B 2BSEA 3L12A 5BOJA 1VZHA 2WBKA 2X0UA 4PAZA 4ZK8A 3C5SB 1WEJH 4LCUA 4FNLH 1L9OA 2JF7A 2VDRH 4R7NA 4X6DE 4H20H 3BMWA 3ABGA 4R97B 1G6RB 5BZWA 3PP3K 3AQXA 1QBBA 2NY6D 3QE5A 4L61A 4GMEA 5H4ZA 1RXOB 4GVHA 2MCPH 2FJFA 4HPOL 1A3XA 1SJMA 3LMZA 1ONWA 5HP5A 1WIUA 1XH3A 4K8RH 3TASA 1J0IA 3MVIA 5GS0L 3WJMB 4O4WA 3T55A 1J8HE 3CWOX 4R8WL 1KLFB 1JTPA 1G9NC 1KBIA 5T3XL 4NENB 2Y6SC 3DHDA 2G2NA 3NSMA 4OD3H 1W5NA 4MA1C 4FA3A 4WO4A 4DYJA 3QMRA 1L2UA 1UWRA 3GI9H 1TPXB 1BG9A 3L9CA 4HWEL 4TULH 1TRIA 3WLTA 4XVJH 3BPCB 1N4XL 1X7QB 4F7MA 1MHHA 5MERA 1A5SA 4F58H 1SZRA 1KCSL 5AY7A 3UD6A 4AJ0A 4KDTA 3FSVA 3QSKB 5H4YA 4PLJD 1M7UA 4JX6A 1PY9A 4YUEL 3RVUD 1KWKA 2FBJL 4M1CD 3KBHE 5BU6A 1CF1A 2PRLA 4LLDB 3LQZA 3AT9A 3VM7A 2GJXA 4NN5C 1FP9A 1PCKA 5BRQA 4BFNA 4QYOB 3THML 3TVMD 1LWHA 1PX3A 4JTGA 4NBZB 4X2RA 5IJVA 4P9ML 3VE7A 5CGYD 3GVRA 4TTUA 3PBYA 4Y5YB 3WFEL 3AIWA 4H13C 4PJ5B 4HJUA 3LJ3A 4MAYB 3BH9B 1J5OH 3ILPB 1HNYA 3VNJA 2NW3B 1T41A 2EPNA 4ORGB 4C7FA 3VD2A 1W91A 3ZY7A 4NP9A 2I85A 2EZ0D 3HPAA 4QTIL 1XHGA 5E6ID 3RNDA 1OG6A 1A1OB 1U8JA 2W91A 5C7XH 2XPKA 3EXSA 4WFEE 1A8JH 1I7TA 3ZDXE 4UTCA 4A8IA 1VQTA 1ZLVH 2DEPA 2W65A 3ISRA 3GB7B 4E6MA 3LDVA 4PMJA 2B8OT 3HMWH 4JNZA 1BDYA 4PJIF 2GGIA 1EEZB 3T78A 3PR2A 4O15A 3D34A 4D6JA 1LJYA 3QUGA 3AISA 3MS8A 1U3ZA 2WUBH 1P43A 2R0ZL 4GRLD 5IIEB 3KLQA 3ME3A 5EKYA 4FNQA 3ESNA 3R13A 2KMWA 3UAJA 3NWRA 1ZBWA 2ZZ4A 2GBVA 1OGAD 2E1DA 3MLXL 1EDYA 1R3RA 2PW2B 1W72H 1GOOA 2X2YA 4O1DA 1PVHA 1B2WL 2G3ZA 1ETZA 5C09D 3P3RA 2P8PA 3MUCA 2OSXA 1HNGA 4B2DD 4L4TB 1ZTMA 3MPGA 1DBBH 1PJ9A 1ZHKA 4I18A 5KG9A 3FN9A 4ACZB 1YUKB 3MOBH 1WUNT 5MENB 3QUXB 3TN0D 5E95B 4K7PY 5DQ9B 3G6MA 1W9XA 2ZUWA 3E6FB 3V18A 4JDZB 5IDZA 4DT2A 7REQA 3ID7A 2G75A 1KWGA 2Z6IA 4IDJL 5HI4D 4NHCL 2IOIA 2VR5A 5LNVA 4JICA 2A99A 1PX4A 3RVUC 3IMVA 4M1CC 3GSMA 1X5ZA 4H6RA 4JRYA 2JIXA 5ELIA 2DYRB 4PLKD 1W5MA 2C9RA 1ZA6A 1IGYA 4HUKB 4WUIA 3OHXC 5I6NA 4OJYA 5B4MC 4WJKB 1JDFA 3GMRA 4K23H 4BCYA 3O3EB 4TNWK 2HRPH 1XIHA 1X9QA 2J6EA 4LC8A 2CSPA 5L0QB 3LNIA 3OA3A 3S9ZA 4U6XB 3ZJ8A 5HHMB 1TXKA 4CCZA 4AT6B 5CGYC 2DQIL 1FYTA 4P7RA 4JXCA 1HXYA 3F5JA 1LQSR 4LHUA 4LAKA 3KD4A 2EC8A 4JG9A 4QHNA 1EJTC 3RO8A 2RR3A 1XGYH 2OR2A 4HKPA 2JJSC 2CW6A 4YL2A 2VLJE 4UILH 5I3FA 4UNVA 3ULVE 2XFGB 1PXGA 3HBLA 2B08A 1JPEA 1JIBA 4X6FA 1VLIA 5E6IC 4UTBA 4QRAA 2NX3A 1DFBH 1DE4A 2RQEA 3LN5B 4I5BB 1DBKH 4Z7UB 2HJLA 1BHGA 3BWUC 1MCQA 3QDGD 5HGBB 5KSWA 4FS0A 3S9YA 4C6OA 2Z2UA 3R4DA 3P2VA 2QJDA 1D5XB 1SJDA 2DZTA 4UFHA 3R8QA 5CZ0A 2G0KA 1X3DA 4JFZH 2JCCB 4GRLC 4BY3A 4L9LB 3SUSA 3ZUNC 3KTCA 2WKOA 1J01A 1FFTB 3RAJL 2XWBB 4UIMB 3UR2A 4NZFA 2BOBA 4RDQF 4W9FC 3UGXA 3L45A 4XCNA 3SE6A 1D8CA 4IICA 5IUSA 3CV5A 4PWGA 4F1ZA 2P8MA 1KKRA 3WH7A 2UUDH 5AAPA 1NCAH 2C14A 4L5FE 4ZFQA 1GG0A 1OM9A 3TN0C 3D30A 2YAFA 1ZANL 4HPYL 2HFGH 1I1AD 4D72A 3UZQA 1EAQA 3RKDD 2YEQA 4JFPB 1YDYA 4A35A 2BRRH 3ABSA 3ARBD 5KJ4A 4GACA 4UUJA 4NIYE 3VTAA 1L9SA 4WWPA 3F05A 3LEXA 1A3HA 2XWXA 4NI8A 2L3BA 1ECYA 3VI4F 1YBQA 1QNZL 3MB9A 3MLYL 3APNA 2GFBA 4X4YA 4NNYB 2LABA 4P07A 3I6LE 4P23A 4HJGB 1ODAA 5D2NC 4AMXA 5DRXB 3L4UA 4OLYL 3VXME 1EGJA 1ACCA 2NQ9A 3TK7A 3JVGA 3QNYB 4PTNA 3LVTA 4IP4A 1DQLH 1P2CA 5BJTB 4MXQD 4V1DA 3G0UA 3MMEA 4Q2ZB 1WAUA 1OYAA 4P5KA 5FECB 3FZUC 4KJWD 3VB8A 1EGVA 1BEUA 4ABQA 4N2DA 3WLJA 2BVEA 1T03H 4D9QE 1AYOA 3KJ4B 4ZG1A 1ONQA 2HYMA 2G4FA 4Y90A 1WBXB 3AB0B 4MOZA 2UXFA 4QRPB 4FTVE 2RMNA 3QMTA 3BQ5A 1RUML 5CFHA 4EZJA 4NAFB 4N6EA 1IE7C 3K3QA 2JEQA 4RPQA 3CUXA 4KJQD 1LHZA 4YN5A 5CLYA 3W1RA 3N1FC 2NQ3A 2XLLA 1BD2E 1A6UH 4E41A 4KKAD 5J5EA 3QF0A 3T9PA 3SDXF 3B5GA 1UP3A 2CGYA 1G94A 4KBXA 3PREA 4JKPL 1OG0A 2IMNA 3BDXA 2DJUA 4YWGH 4Y7OC 4Q9RL 2O72A 4P3DB 1VHNA 1AHWB 5TE6H 3CZUB 4TQIA 4NG3A 4UAOB 1MHCA 1PMYA 2WUCL 5SV3A 5FAGA 4DJFA 1I85C 2X4RA 4AITA 3B8TA 5KAQG 4A7UA 5DGQA 3SI9A 2HA1A 4F7TA 4Z42C 5ICUA 2GZXA 1MCPL 3N0AA 1OB1A 3MUGB 4O02L 3DPBB 3DV6B 1K5NA 4HC1H 4OT1H 4C6LA 4KXAA 2C3VA 1PZUB 4UV4H 2Y5TA 3I6EA 5SWUA 3WNOA 5BS0A 3RRQA 4K68A 4TS6A 3ZJ7A 1LOQA 4MX7A 3ARBC 5JPMB 5I17B 3WLSA 5ABZA 4IIQC 4DIAA 5FW7A 4PVNA 1CW2A 4UMGA 3L7EB 5KSAD 2ZYFA 5IUCA 1BLIA 4FE9A 3GW0A 3X17A 3A9BA 3QUHA 3JUGA 4PJGE 4RMVA 2MPVA 3CUGA 5C9RA 3PWVA 3GIYA 2WXLA 5G4EA 5HHOB 3QDME 5AKRA 3U4BL 2Z8RA 1OW0C 1N10A 2Y7QB 4KT2A 4OU3A 3LI0A 4JY6B 1MEWA 3S9IA 2YYUA 1WWAX 1QSFB 4P2CG 2GCYB 4LCWB 4MXQC 2GKIA 4L0PB 3CN1A 3CUIA 3ULUL 4MSWB 1V4YA 4FR6A 4TPRH 2W95A 1FKXA 4JTCA 4ONFH 3IRSA 3W7NA 1PSKL 4KJWC 1PTZA 4XD6A 4N87A 1QFWH 1CDCA 1KCVH 3F4NA 3LERA 4I7VA 3OJGA 3OAWA 2DYSB 3DUGA 3H22A 3LSOA 3II3A 5F6IB 3JS3A 3V0FA 3KCLA 3SDDD 3FTWA 1FAIL 2XKSA 3D2UB 1X1ZA 2GAZA 1UWTA 2ADJA 2NSOA 3EDJA 4KJQC 1NA8A 3GC5A 1H3GA 4YC2C 4MS6A 1CTNA 3OR6B 4MBRA 2JELL 3IEAA 3UAAA 4EKJA 3VE9A 3QFJE 2W9EH 2HTKD 4WF7A 3WFAA 1TYRA 1PHQA 1CG9A 4FQ2L 3UWZA 1S7TA 3KOWA 3UEQA 3Q2WA 1P0BA 3QEUB 1QRNE 4JG0L 4PJ8C 1FHUA 4NX5A 3S37H 5EO9B 3O6CA 1P0DA 2PDFA 5EEZA 1P4LB 4PUWA 3M6YA 4WKHA 3AU1A 2EPMX 5BMXA 4ZBJA 4AD0A 3GXTA 2K78A 1BVNP 1NL0H 3PJNA 2IQTA 1J9RA 2JKTM 4JY8A 1YJDH 3CMOL 1N2RA 4L29A 3DBPA 4FSAA 1E5UI 3B9KC 1TYEB 3VM5A 2QVTA 3APYA 2NY2B 4L1WA 4FG0A 2FWUA 2WLJA 3ARPA 4D6DA 5A3ID 3D85D 2G60H 2AABL 1HNFA 4RZ6A 1KPRA 3OLIA 3C6SB 4N90D 3NIFE 3QORD 1CLZH 5GRVL 2ICWJ 4UB0H 3OGVA 4QCFA 1MCJA 5F7DB 3PWAA 4X9SA 3S1XA 4YHLL 4RE3A 5KSAC 3D3VA 1SMAA 1IT7A 1J86A 4JFEA 2EIZB 5E6RB 3GFXA 2J44A 5EOTA 5T1MA 2ERJC 2WTRB 1TE6A 5FJUA 3T4YA 4HQQH 4NX0A 1JV5A 2WWMC 8XIAA 4QXTA 2CZDA 3UR5A 3WQCA 4YNYB 1SXCA 4AJYV 2YIHA 1Q3NA 3NEXA 2QCHA 3LNDA 4TUKL 5DBUA 1AW1A 4GXWA 5G2IA 4IRZL 1Q8JA 4L4VE 2JFEX 4TSCH 4AWUA 5FOOA 5GGQL 4Z5RA 3UWVA 1XCXA 4JGMA 2OJZH 4ZDHB 3CIWA 1A2YA 2E5DA 4JCWA 4UFIA 1NDZA 3DHFA 3MLWH 2GI0A 3B2PA 2LTQB 4ILDA 2BODX 3QRBA 2CLKA 3KXFD 3HURA 1R34A 1E0UA 1E42A 4OF6A 5ICZA 1E6XM 2K7QA 2WANA 4G5ZL 1FDLH 4DOHE 4MD0A 1QR4A 2OELA 3SDDC 2ZX9A 2GY7B 4X7FC 2AANA 3HHSA 3LV3A 1O60A 2YXXA 4ZFOL 3DBXB 4AX7A 3MA8A 1KN4L 2WVUA 4S1RL 4DAIA 1KEGH 2J1YA 1K6QL 4IEFB 3R89A 4Y9FA 3TH3T 1J05A 3ILQD 3PZMA 3VYLA 1KG0A 1FWHC 3N1QC 1I3GH 3BIAX 3QIWD 1BYNA 5DZVA 3OLEA 3NAAL 5A6BD 3L16A 5FYKE 1Q9WA 2VCOA 3NG5A 2YJLA 3FT4A 3DROB 1OCZB 5E8OB 1NDGA 3OHXA 3W7EA 1DYZA 4QNWA 1EUUA 3CLEL 4IK7A 1Y8BA 3TROA 3RG1C 4S3GA 3GSOA 5D72L 1TYGA 1LK2A 4HMEA 1GOIA 3PP4H 3A22A 1BFNA 1SGKA 4MDJB 3D6NA 3V5HB 1MFEH 1F07A 3UACA 4WI0B 1FZKA 5JHDD 4M62L 4KKRA 1NSNL 4ISVA 1KV8A 2GBAA 4LEOA 2VFIA 4JZJB 1XGDA 4JCLA 4K15A 1RIUL 1ZT1B 5GQBA 5F1OB 5A3IC 5C07E 5DJAB 4QI3A 1GIGH 2JJSA 2IF7A 2BY3A 1BVNT 3H54A 1E6NA 5PCYA 1RA5A 5FYJD 2L0DA 3CVCA 1JZ5A 4BM7A 3IARA 2ITCB 2G41A 3OAUH 4HHAA 1E0VA 1NCHA 5E6IA 4RRPG 1F8IA 1YYLH 3BV4A 4IPNB 3UZJA 2IGFL 4ZT1A 4KWVA 3S4TA 3UWWA 4HAGA 3AIRA 4XKMA 2EIMB 3ALXA 1OD0A 3EFOA 5I03A 3RKPA 1GYMA 3WTTA 2X0SA 1NAMH 3GKZA 4H2AA 3CIAA 5E4IA 3R7RA 3L13A 2XNAB 3GRWL 5D7IF 5C0CB 2WXHA 3PCYA 4GKNA 1QNRA 4XPBL 3EWZA 2AXJA 4KFMA 5KZ6A 1DLFH 4ANKA 4GQGA 3GMLA 4GRLA 2XVGA 3VK5A 1VPOH 1OGAA 5CR8A 2V8LA 1NU5A 3CASA 1EX0A 4WY7L 3MJ7A 3K13A 3HTLX 5HVWA 3IFLH 1DEEB 4R9HA 1A9BA 3SUUA 3EXJA 4HK3J 1P48A 1O9ZA 2A9NL 1G0XA 2DPEA 1Z41A 2X6UA 1F61A 5ERWB 1YX1A 4EF3A 1URLA 3LOWA 3TN0A 2TPSA 4LVDA 1RVKA 3VFMB 2BNUA 1JYXA 3RIFF 2EDJA 3WXWL 1A7RH 2HRLA 4CAGA 2WMGA 3ILQC 4L80A 5K9KB 1FNEB 2EE9A 5GSRA 4IU2A 3QIWC 4TXEA 5J13B 2IXQB 4O4YL 5DHYA 1ZCCA 3JQOB 4RMUA 3RCYA 4Q8PA 4HS6B 2ITDA 3KPQA 1B6UA 4JM2C 4I1NB 2V7NA 4C6DA 3L3DA 4XX6A 4D6FA 4JKWA 4OVVA 5D2NA 3UZXA 3M17B 4NQVB 1I8MB 2HVKA 3PNWA 3L54A 4N0CC 2E9IA 3RTQD 4A55A 3EBVA 1SM3H 2QZQA 2PW1B 4OBTA 1RUQL 1VRDA 4OVUA 5C0FB 2Q8AL 3WFZA 3U2CA 5LQBH 3T08A 1UC4A 5M5DA 4GNJA 4FG2A 4MLSA 3KNBA 4UM9A 4OR1A 4JM4L 3P3SA 4MD4A 3LQAH 2N0KA 1TZ7A 4FN0A 4MLRA 3G6DL 1L9NA 4GH3A 4RZCB 2EXWC 4Q8WA 3TLLA 2IQAA 3GBNL 1ZWIA 2BWGA 2DBLH 3QDGA 3AZRA 4B90A 4BF7A 3VKBA 4I9XA 2J5WA 1TPWA 4MA7L 2DU2A 1ET7A 1QFUH 4L0YA 1XMEB 2DEXX 3OJDB 4TOYH 5EG6C 2IQ0A 4CU7A 2BOGX 2DUXA 3D3FA 4EVNA 2PPGA 2J79A 3DOHA 1ACXA 1F3JA 2V2WA 4MQTB 5HHQA 3MLTB 1GVIA 1RZIB 3EKZA 1U8IA 4IU3B 4HKZB 1I85A 4TSBH 3GVGA 4K8EA 4AENA 5J7CC 2CRYA 4ACPA 2CWXA 3W39B 4RSYA 4ROQA 2F6UA 1RERA 3B06A 5EEYA 1J1OH 2CUAA 4LP5A 3STLB 1S5VA 5H8UA 1BKSA 5CN2A 4KROC 3STEA 4ADJA 4XZBA 1C5CL 2PB1A 4NSKA 1AMKA 3PPHA 1A3RH 1QABA 1QPKA 1SLUA 3SUWA 4JRXE 4XP4L 3ARBA 5DRWB 4KO6A 3S8GB 5F3BB 2QCDA 3FFSA 3I6RA 5DXXA 5D2LB 5HJLA 3ABXA 2VR9A 4N86A 2CJ3A 2G0LA 4GW4A 1HTIA 1HILA 1WIOA 1A4JB 4M02A 2A9CA 4UINH 3OV6A 1OW0A 4P2YA 3IJSA 1TETH 4M5YL 3BH4A 4RDYA 2WXMA 5I18H 3N40F 1N5AA 1K3IA 5GJTL 3QARA 2I17A 5LIXX 1ZTXH 1OCOB 4DKTA 4JS3A 1UWYA 2E74C 4LP4A 5CBIA 1UACL 4Q6IB 2ZOWA 4UOQA 5AALA 3NYKA 1OZMA 4YHYB 1LO4L 2YD4A 4KMLB 1OWWA 1CWVA 2D7OA 4Z7VF 5CWSB 1DJGA 2QR0B 3MACL 1DVUA 3TUUA 3S88L 2ESVB 3DSNA 3ISYA 3OODA 3T0WA 2VL4A 4KKLD 1RK6A 2D23A 3BPLB 3CQPA 2VYOA 4F0SA 1HW6A 3LHAA 5AD0A 2GQHA 2X0HA 1FWAC 5FA3A 4IMDA 5DDHA 3VCCA 3O11A 2MOGA 1KC5H 5IHLB 3PAYA 3ABOA 2CHXA 1MDAA 3VINA 5A69A 1HHJB 3TKFA 4AIZB 4PJ8A 4AEFA 1YCSA 2CO2A 1TX0A 5IFAL 3FTGA 2CO1A 2IS7A 1DSYA 4GIPD 4GG6B 2QFRA 2XQYK 4LSSH 2BVUA 1MJ7L 1A5CA 1O12A 2NWSA 2G4GA 1K8DB 1KTNA 5SWZE 1E9OB 2ZXWB 3H4FA 3SIZA 4FQLH 3B9KA 1C9DA 3WX7A 4J2XA 1S9XB 1TQBB 4WCYH 3DHPA 5CZJA 1ACYL 2UV8G 2JIEA 3BHBB 3F5KA 2QGCA 2DFAA 2ZRUA 2A4ZA 5A6LA 3BDYH 5G4MA 3CQJA 4CVZA 3VGBA 1LXMA 2IKIA 1PZ2A 5A2LH 3MXVL 3W0WE 1ITXA 4NCC1 5FEXA 5EBUA 5KSAA 1ITUA 5CEZD 5JIHA 3QGVA 2GC7C 1MZHA 4O52A 1LL6A 1DVJA 2VCCA 2YAOA 4KRMB 3TSMA 4FYSA 4G82A 3RWCB 2R15A 3GMNA 1UXWA 1NIBA 3B9OA 4NQEE 3Q2LA 4DKEH 3F3HA 1IBYA 4BFRA 2GPTA 2IPKB 2XTJE 3U2SA 4ONOA 4Z23A 5IW1A 4AVKA 3UL4A 2VX4A 4WGXA 1UZ1A 1SO6A 2Y36H 3PXHA 3M5ZA