5I5RA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title Will be disclosed later
rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Hydrolase
total genus 161
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5i5rA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i5rA01
1K9FA 1WCGA 1H49A 3GXMA 2W63A 1P6WA 1JYNA 3AS2A 1QBAA 4DWSC 1EDQA 3CH9A 2J62A 4CU6A 4C7FA 4B9ZA 4TVUA 3BAXA 5LA2A 4JCMA 3PZMA 4JHZA 1CYGA 2ZUUA 4XV0A 3AIWA 3KL3A 1Q6DA 2D23A 3AHTA 1VF8A 4ML4A 1VRXA 2EPKX 4QLKA 3SCSA 5CSYA 1UWSA 3POHA 4XZWA 1KWGA 1E5JA 1K9DA 2WWDA 2XM2A 1KGUA 4IPLA 1TA3A 3PZOA 3PZQA 1DTUA 4QAWA 1UWQA 3VGHA 3BSHA 2WM0A 1E72M 4DO4A 1TQWA 3WFZA 1BYBA 4KH2A 5ABFB 3ZO9A 1R7OA 5M17A 2ZXQA 3F5LA 3L2LA 4UZUA 4R5EA 1UA7A 4XB3A 1KXTA 3WMSA 4MNMA 2Z1KA 1E4LA 4CCCA 5F7UA 3WH7A 1FH7A 4PMDA 4B15A 2CPUA 1OIFA 2G4FA 3W28A 5HXMA 3A4XA 1MW2A 2BY3A 4ZE4A 1RH9A 1O7DC 3U7VA 2WMJA 1GNXA 2IGTA 1OGBA 4LX4A 4JFWA 3ALGA 4IM4A 1SR0A 3AISA 3PZTA 3ARUA 4MB1A 2PI6A 3CMGA 2FYVA 4P7LA 1T0OA 2DEPA 4S3JA 3AJ7A 1BYCA 1JNEA 2F7RA 2YA2A 4WK9A 3CHFA 3VVGA 4UCFA 4NSBA 2OSXA 1JZ5A 3GH5A 4R27A 1UKOA 4HA4A 3SCUA 4V2XA 3AYSA 3WNNA 5LA1A 3CUGA 4WKHA 2CXGA 3WELA 4TUFA 1AQMA 2X2JA 5D8ZA 4D6JA 2QMJA 2O9TA 1CENA 1UR4A 1U2YA 3BLBA 1GQIA 2WC4A 1OBAA 5E0CA 1EGZA 2JIWA 3S5ZA 1GJWA 3OIHA 4KRTA 4WF7A 3D52A 1XYZA 1TG7A 2XJ7A 4M81A 1M01A 4D6FA 2VOTA 4AZ5A 1V6VA 4D6GA 2E9MA 2DH3A 3VM5A 1QX1A 2D0FA 4J7RA 4PEEA 3KL5A 2YA1A 4D1IA 5BCAA 3BSGA 2DSVA 2WLZA 4AIUA 2DT2A 2V5DA 1M7XA 3T0DA 1RD6A 3BCDA 3VIMA 1OGSA 2CIPA 4W7WA 1CIUA 1HX0A 3BUIA 2WPGA 2WMHA 5I79A 1MQPA 1ZL1A 1UZ1A 2YDSA 5CGMA 4AD4A 3IJ7A 2F2HA 1W9PA 1ZBWA 1E1EA 2V38A 3LPFA 2QPSA 5A6MA 4A3HA 1US2A 3RIKA 4XUYA 1BHGA 1FFQA 2CBVA 4KRUA 2BY0A 3T2PA 5DFAA 4UTFA 3VIPA 1NQ6A 1QVBA 4MB4A 3U7BA 3SCNA 5A6JA 3DECA 4PMUA 2WYSA 5GNXA 2ZUMA 3KE0A 4AMXA 3IAPA 4ZFMA 3DYOA 1BYDA 4TOQA 2JF7A 3GXNA 2XIIA 3ARSA 4YN5A 1OWQA 5HNNA 3APGA 1IZJA 1BLIA 2XVPA 2AOSA 3VD5A 5BRQA 4JL1A 3MKKA 1KXQA 1GHRA 1CEOA 3S5YA 3PZ9A 1CLXA 3NJ3A 1OIMA 1R46A 2FH6A 1KCKA 1KTCA 1KR0A 1PX8A 3VIIA 3ARXA 3NSXA 2XWDA 4HU8A 1B3ZA 3L2MA 3MUIA 1K9EA 3K46A 1GOKA 3ARPA 3LPPA 2ZUTA 4U31A 5D9OA 1W91A 1UUQA 3CZGA 3VM7A 1UWTA 2WLYA 2A3EA 2ZXAA 1UD3A 4UFLA 4AZCA 2RGLA 1G01A 3ZR5A 1JYXA 4W85A 1QI4A 2FE0A 3QGVA 1XCXA 4UFHA 1WDPA 3WEZA 1C92A 1JD7A 3KWXA 4BS0A 4UQCA 3T08A 1HVQA 5AYBA 5E1QA 3IJ8A 2J78A 3ZSTA 4NRSA 1PZ2A 3SIMA 3CHEA 1EO7A 3T2OA 4RE2A 5A6AA 1K6AA 3NSMA 3B9AA 1C93A 1F4AA 4PUEA 2OWWA 2XUCA 2FHFA 1UH2A 1TQUA 2J47A 3DX4A 1XV8A 3W37A 3F5KA 1QNSA 1QWUA 2W92A 3ARQA 3FHQA 4W89A 2EABA 3A6OA 2V3DA 4GZIA 3CO4A 4PMNA 5BYWA 3RJXA 1C8YA 4L4OA 6A3HA 5HDRA 1AMYA 4W8LA 2VO5A 1JDAA 1JF5A 1ZBCA 5M03A 1JZ4A 3AZSA 5GPRA 2WVTA 1V3IA 3CZEA 2UY2A 1UD8A 2J7HA 3TOPA 3KEHA 2W62A 2C8NA 1VJSA 4F66A 3AIBA 4D72A 4MNLA 4MTVA 2O9PA 4OIFA 3OGVA 3WNPA 4WJXA 4RL3A 4W8BA 4Y7EA 3GXIA 4D6EA 3CZJA 3OBAA 1E6QM 1YHTA 3A4WA 3VGGA 1QI5A 2CKRA 1V3MA 4GZEA 4ZXLA 1UQYA 1E9LA 1HJQA 1D7FA 2CITA 3DYPA 2XSAA 3H53A 4UFIA 5FCZA 4NZFA 2ZWZA 1V0NA 2J7FA 2UY5A 4AC1X 3U57A 3SUUA 1CXHA 1NWRA 4UFMA 1M04A 3VILA 3WDQA 1M53A 3OGRA 1HJWA 3SCOA 3WDJA 2XTKA 2EPNA 5BXSA 4W5UA 2WHLA 1EOMA 8A3HA 3UR7A 3DHPA 5FIPA 1X6NA 2W4XA 1UA3A 4NZJA 3W53A 4H8VA 1ISXA 2ALWA 1V0MA 3CHDA 4MB3A 5LYRA 2VNCA 1FP9A 1US3A 1W3LA 2WC3A 3AFBA 2JIEA 1C91A 1UD2A 2VX6A 1UR0A 4BQ5A 2CBJA 3II1A 1PEZA 2QPUA 1H0IA 1E70M 3RM9A 4GI8A 3AIQA 3DDGA 4PCSA 2Y8VA 3IK2A 4OOUA 3WNLA 1TQTA 2WCGA 4J28A 4UQEA 3EMCA 5BWFA 4UNIA 3TTYA 3A24A 1KFWA 1YQ2A 2XSBA 4AZIA 4UQBA 5A95A 3ZSSA 2QLYA 4U33A 4AD5A 3HG5A 4AZ7A 2F7QA 2FHCA 4LXFA 4PCTA 3O6AA 4Z2GA 3I3DA 5CPQA 1D3CA 1B90A 3O2LA 1HL8A 5A8NA 4GQQA 1XH0A 1EQCA 3W38A 4DWSA 3WMBA 1EIBA 3SUWA 1M03A 1Q6EA 1W9DM 2A3HA 1VFFA 3MMUA 3BVVA 2OLHA 5ABFA 5I3DA 4W7VA 4KGJA 2XN1A 2GK1B 3ZT6A 1JL8A 1E4NA 3NDYA 5HOSA 2F1BA 3SCQA 2FH8A 1HL9A 3A22A 2Y8KA 1VJZA 3WQ6A 4FLOA 2RGMA 3EDKA 4MJ2A 3EDEA 2W66A 1ISVA 4WKFA 5GNYA 1B30A 3BH4A 1KCLA 4CCDA 2WXDM 3N1AA 1R34A 4M1RA 2ESCA 2XN2A 5A2AA 2D20A 3W6MA 3W27A 4ATDA 2JEQA 2GJXB 1HP4A 4OJYA 4U2ZA 2WVVB 1JZ8A 1CXLA 2ZWYA 3CPUA 3U5YA 1C90A 2XPKA 3SCPA 3M46A 2FDMA 1DWIM 1ZB5A 1HKKA 1CXIA 4J3TA 4BCEA 1MW1A 2WMIB 4HU0A 3OLEA 1R33A 4JL2A 4W93A 4U3AA 3BAYA 4H8UA 5HPOA 4BZYA 1JF6A 5BXRA 1MQQA 2BVDA 3N13A 4P7QA 1BF2A 1RPKA 1TVPA 2WWCA 3FNDA 2WNWA 4M56A 1UOKA 4AIOA 2X2IA 5EMYA 2XFFA 3BVWA 4OOZA 2J77A 2NT0A 4HZ8A 1W3HA 4M24A 1QOXA 4AYSA 2CETA 1RP9A 1OGGA 3VDHA 1ISZA 1CGYA 3WNOA 2GUYA 4UQAA 3ZJ7A 3UG4A 1OM0A 4P8XA 2VZUA 3EJQA 2ZX9A 4HA1A 1QNOA 2A3CA 2W5FA 3UR8A 1JZ3A 3G6MA 2F7OA 2ZUVA 5IFTA 1R47A 4HOWA 2J8FA 3E1F1 3FXYA 3N17A 1TFVA 4X9YA 1L0PA 1NOUA 1H09A 1W3JA 4H7VA 1GQJA 5IFPA 1J12A 3CUHA 2F7PA 3THCA 1BAGA 4DO5A 1SMAA 2EXOA 3LXAA 3WNMA 3WFLA 1VB9A 3ZJ6A 3B8SA 4MAVA 4D6HA 3L4TA 5ABHA 3OLGA 2CESA 2J79A 1XSIA 4HA3A 3TONA 2DSWA 4CD4A 4WIWA 4PTVA 3EYPA 1O6IA 2VT0A 1LQ0A 1SZNA 2D22A 1W9BM 4U3CA 1CBGA 2BFGA 3BC9A 3AXXA 3VIHA 2CNCA 3WQ5A 1E6ZA 3OB8A 3CMJA 1UR8A 3PHAA 2X2HA 3UCQA 1BTCA 4GIAA 3CV5A 1UH4A 1FFRA 3TTOA 3OZPA 2WZIA 3A21A 4PN2A 4M80A 2FHBA 2G3MA 4V27A 3AMCA 3T2QA 4JAWA 2VURA 4UOZA 5DF0A 3WQ8A 2JEPA 2NSXA 3MSGA 3WQVA 1WDSA 2VX5A 4QLJA 2WMFA 3PTQA 4M8UA 5I23A 1KWKA 3JUGA 3PZNA 5A8MA 5CPSA 4F9DA 5IHSA 3B9EA 4LGXA 1KBKA 1ITCA 3EMQA 4W88A 1QNPA 3N18A 3DYMA 2PWDA 2WHKA 2BV9A 4CD6A 1GOQA 3GXDA 4NI3A 3CZSA 2OSWA 3EJTA 4CKQA 1UR1A 3RM4A 3BLKA 5FL0A 4EE9A 4W86A 3UEQA 1QHPA 1ZBVA 2YA0A 3RILA 3TTSA 2Q8XA 1J10A 4JKMA 4U5KA 1BG4A 2BHUA 4MDOA 1QHOA 1E5NA 2EBNA 5AY7A 2E9BA 2XGIA 3WEMA 1VBRA 2WK2A 3RCNA 3SUTA 3BCFA 3AZRA 3RMEA 1G5AA 2ZOXA 2VR5A 2PC8A 4DUWA 3AI0A 1E0WA 4Z2KA 1FHDA 4QDMA 4WKAA 4E2OA 3OA5A 3WUBA 3VTRA 3WQWA 3AIUA 4HOXA 1JDDA 3CUIA 3WY1A 4CU8A 2CHOA 3DX3A 1FP8A 4W7UA 4CVUA 3QR3A 3H54A 2V3EA 2X8RA 3N15A 3WSUA 5BXTA 3W4RA 1C8QA 2B31A 4RE3A 5JIWA 1GONA 6CGTA 1H1NA 3BAJA 4X0NA 3N12A 1K9TA 1BGAA 1H41A 2W61A 4FLRA 3WIJA 3D4ZA 1GW1A 5EBAA 2O9RA 5DEZA 3THDA 2VZVA 1ESWA 2VVNA 1PX4A 1X1NA 3SUVA 3BVTA 2GSJA 3VO0A 3AHYA 3QOMA 1CLVA 1VEMA 3PZIA 3VSUA 3NYDA 4PMYA 2J74A 4M29A 5AC5A 4JHOA 1XH2A 1DWHM 3UETA 4PTXA 1XD1A 2GVYA 2A3BA 2E8ZA 4D6IA 2QHAA 1BGGA 4A3YA 1XC6A 4D1JA 2F18A 3L4YA 3AMGA 4P8VA 3WKZA 1KB3A 1J0KA 2ZX7A 2YIHA 1JYVA 4OUEA 2BXZA 2YKKA 4JCLA 4AEFA 2Y5EA 4H04A 4E8CA 4CN4A 3WUGA 2YFNA 1NOFA 3KLLA 3N11A 3WD0A 3WUFA 3RJYA 3VSVA 2MANA 5D9MA 4V28A 1CGVA 5FD0A 2PF0A 1PJ9A 2DT3A 1XCWA 1KXVA 1TA3B 3QHNA 3GBDA 3SCRA 3BUBA 2UY4A 1E55A 1HKIA 4BA0A 3FW6A 4HOZA 3DX1A 2EJ1A 2PWGA 4XZBA 2ZUWA 1CXEA 1J11A 1J0IA 3OG2A 1OB0A 4XX6A 2CYGA 3VD3A 3EJRA 5DMYA 3L4UA 2ZIDA 4TTUA 1E3XA 1GQLA 2EADA 4JFUA 3ZT5A 3AROA 3N04A 4N42A 3GYCA 5A6SA 3CUJA 3AHVA 4F8XA 4ACZA 1MWOA 1DWJM 4HMCA 1CXKA 4PUDA 4JFVA 2GJRA 1D2KA 4IISA 3AMLA 1DWAM 4CGTA 1WAWA 1ECEA 3WEOA 1LLOA 4DWSD 3HZ3A 1XH1A 4AISA 4FNSA 3ZJ8A 1QPKA 3IANA 3J7HA 3MUY1 4JKLA 4KWUA 2D3NA 4MAZA 1NWUA 5D8WA 4NX0A 1WE5A 2VCBA 2DGAA 3B9DA 4AIEA 5LA0A 4PMRA 1RP8A 5A6KA 1WZMA 5CLWA 1TVNA 4FNTA 1WPCA 3CUFA 5JBDA 4HP5A 1GORA 3UERA 3MI6A 2FGZA 2GDVA 1LJYA 5A69A 1E6PA 1OSEA 2BY2A 3I3EA 4AMWA 1KGWA 1GOMA 2WVVA 3WBEA 3GZAA 1C7SA 1BYAA 4J3XA 1L8NA 1PAMA 1MW3A 1BSIA 1UWIA 4RE4A 4L4PA 3VDBA 1GOOA 4TVCA 1E40A 1XD0A 3FY1A 3W81A 1TQVA 1PIFA 1EDTA 2XHYA 3BMWA 1EOKA 1E4MM 2DIJA 1E1FA 2G3IA 1BVNP 3AZTA 2X0HA 3GNOA 1TQSA 1VEPA 3VD4A 5JBEA 1G0CA 1HP5A 4JFTA 3FAXA 2CKSA 1V6YA 2JALA 2WW5A 2DSKA 3BAWA 1LWHA 2YJQA 4ZE5A 5KZ6A 3PZGA 2XN0A 2Y4SA 1J0JA 2WVSA 1MFVA 3GTNA 2J75A 1UD6A 1JG9A 1PS3A 4JKKA 1CTNA 2V3FA 3M7SA 1ISWA 2WMKA 4GQRA 2D24A 4LPCA 4FNUA 4UZSA 1HKJA 1B31A 2VZTA 3VMOA 1WZLA 1V02E 5A8QA 5A2CA 1HT6A 4PSPA 4PMVA 4FNPA 1W1PA 3TV8A 3ARYA 1PX3A 2UWFA 1ZBKA 2PWEA 1CGWA 2DIEA 2DT0A 1LG2A 2XWEA 3I3BA 1UYQA 1HJUA 5E9AA 2HISA 3WQ4A 4CN6A 2VQUA 1BVZA 2WCSA 2YLAA 1HWWA 2WC7A 4CUCA 3WD2A 3ARVA 1UKQA 1I75A 5D9NA 3BGAA 1UR2A 2CEQA 1VFOA 3A5VA 3MANA 3EDFA 4H2CA 4QP0A 4EAMA 1LG1A 1QNQA 1HN1A 1OD8A 4CVWA 2A3AA 2O92A 3W82A 2E0PA 1HTYA 4F79A 2UY3A 3F4VA 2PB1A 1EXPA 4HZ7A 1JDCA 1AQ0A 3WF3A 1V3LA 1XSJA 5A8PA 4AW7A 3CZNA 1E6SM 2C7FA 4OBRA 3DDFA 3NSNA 1H5VA 8CGTA 1MXDA 2YDQA 1C7TA 4P7NA 1BFNA 3RPMA 3WENA 3ARZA 2DT1A 5C8BB 5IDIA 1WP6A 1IV8A 3WBAA 1QI2A 2VQTA 2DSUA 3GH7A 1TE1A 5CGTA 1E15A 3BUPA 3AS1A 1UWUA 5I77A 2XFRA 3D3AA 1UKTA 1JI1A 3A23A 3RM8A 2TAAA 3W6LA 4DUXA 7TAAA 2YBTA 5IHRA 4OGZA 3L4ZA 3VDCA 1NOWA 1BG9A 1UD5A 2WHJA 1W1TA 2E9LA 4TX6A 1QW8A 2E4TA 1FA2A 4BQ3A 3QHOA 2F8QA 2OYMA 1GHSA 3VX1A 3VMNA 5I78A 3KLKA 1LWJA 1XYFA 1FHLA 2JE8A 1KXHA 5GQBA 4E4PA 2WB5A 3NDZA 1AQHA 1B1YA 1U30A 5CLTA 4EANA 1VIWA 1HIZA 3NIYA 4KGLA 3BUDA 1B9ZA 4LYPA 4URIA 2D1ZA 1QBBA 4PTWA 1E0VA 4UFKA 1V6XA 1W32A 1G94A 2VX4A 3VGBA 5JUVA 3CZLA 3CLWA 2OW7A 3VIKA 3K8KA 4PMQA 3T09A 1W1VA 2FGLA 1HF6A 1NWTA 2NW0A 4AD3A 1I1WA 3HU7A 5EB8A 4NRRA 2ZX5A 4J27A 2YDRA 2GDUA 1MFUA 4LQ1A 3U5UA 1B2YA 1HJSA 1CGTA 1V6WA 2CCRA 5M5DA 5E6YA 3D50A 4TVDA 3ALFA 1Z32X 3WDPP 4YHGA 5I2UA 3PN8A 4LYRA 4J3UA 3VDAA 2Z1SA 5D9PA 4AEEA 4MNJA 4DM2A 3S6TA 4WSJA 3CZKA 1HVXA 1KQYA 3WMCA 1Q4NX 3SEPA 3GM8A 4Z2LA 1ITXA 2WMGA 3GXPA 3L4VA 5I24A 1JNDA 2WANA 2X05A 1ODZA 5E70A 1NARA 2XGBA 5JIPA 3BLPX 1R86A 4A4AA 5C71A 1UH3A 2X0YA 4JFSA 4AZGA 3WY3A 4QFUA 3H55A 1GJUA 1B3XA 3VGEA 3WDRA 3BVXA 1JFHA 3MO4A 4HMEA 2VI0A 1CGXA 1E6NA 4B3KA 3W29A 2J7EA 3WD3A 2EAEA 3FAWA 9CGTA 3VGDA 4H41A 2OYLA 1UZ4A 1V0LA 4Q7NA 5I0DA 1E43A 2C0HA 1ISYA 5BROA 1TUXA 4OKDA 1A3HA 1WDRA 3VPLA 2YL8A 2ZUNA 4HPHA 1WO2A 2HVMA 4FMVA 3CC1A 5AC4A 1MVYA 1J18A 3WY2A 2EPLX 4P7RA 1UWRA 3VIFA 1HNYA 2Y2WA 1E56A 3CTTA 1I1XA 1WDQA 1NM9A 2OYKA 1R75A 1VEOA 1S46A 4CN1A 3AS3A 1OINA 2BVYA 2J7GA 4KMQA 2YOCA 4DUVA 1MQRA 1E4IA 2CERA 1B3WA 4PMOA 3EJUA 2BS9A 1R8LA 4AY1A 2J4GA 4NXKA 1PBGA 1B3YA 1DWFM 4DWSB 5A6BD 4C7DA 1CNVA 4CD8A 4Z2JA 4FLQA 2J8GA 1W2PA 5CSUA 2WBGA 4AZ6A 1NWSA 2J7BA 4PSRA 4S3KA 1EDGA 5GNZA 2VL4A 3WH9A 1HXJA 1V6UA 2BHYA 4GKLA 1WKYA 4B16A 2XM1A 3LRLA 3D5HA 3K8LA 2V5CA 3HG4A 3IGUA 2XG9A 4W84A 4JZ5A 2G41A 1MXGA 1GQKA 4ZENA 1CECA 1DP0A 1V0KA 3N9KA 5M3WA 2YL9A 4TTGA 3GNPA 1GUVA 1XSKA 3MV01 5DT7A 5E09A 3VIJA 1JFXA 1CDGA 5EFDA 3T0AA 1UG6A 3ARWA 4OBSA 4NXSA 4WLCA 3WNKA 1H4PA 3MS8A 5E6ZA 1LL4A 4BF7A 5ABGA 2ZXDA 4GI9A 1WZAA 3WD1A 4EK7A 1DEDA 1HJXA 1OCQA 5BXPA 2YFOA 4W5ZA 4U2YA 3OZOA 3ZR6A 3WF4A 1X6LA 5EFFA 1GPFA 1UQZA 3POCA 1H11A 3AXHA 1JI2A 3ZJKA 1FH9A 4B3LA 1VBUA 1UHVA 1W9XA 3WD4A 3QHMA 1EQPA 1W9UA 3VIOA 1B3VA 2G8ZA 1GVIA 1PPIA 1EO5A 3AQUA 4Q22A 1E0XA 3TA9A 4N0RA 4CU7A 3EJSA 3CBWA 3VIGA 2DQXA 1W1YA 5CJ5A 3HG2A 3D4YA 3W0KA 3D51A 1WB0A 4CD5A 4P8UA 4P7OA 3ZIZA 1W3KA 1V3KA 3L4WA 4GPNA 1QI0A 3LMYA 3NCOA 3VSTA 1PZ3A 1CXFA 2DH2A 3AYRA 2PBOA 4E8DA 4HPGA 4MDPA 2X09A 3ZQ9A 3T0BA 1UKSA 4GINA 3MU7A 4OZOA 1MYRA 1KQZA 1UASA 3PTKA 1KGXA 2WVUA 3BVUA 4IPNB 1Q6GA 2D2OA 2JFEX 3WL0A 3DC0A 2WCAA 3W25A 4D6DA 1PIGA 2WZEA 2QMKA 1JGIA 2IXVA 4JIEA 4BQ4A 3BMVA 3VINA 4UQDA 5A6BA 1JXKA 5KEZA 3GXTA 2EPOA 1W2VA 3RDKA 4K68A 3VGFA 1V3JA 4FNRA 2VUYA 5DO8A 1JAEA 3IJ9A 2XFYA 1ZJAA 2DDXA 3PZVA 4MJ4A 3W24A 4D71A 3KL0A 1GVYA 2E8YA 1AVAA 4MB5A 3TTQA 5TD4A 2E3ZA 3IAQA 2IXUA 3RO8A 3M6DA 1HJVA 3LRMA 1ZS2A 3VU2A 2PWFA 2X2YA 2NT1A 4J3VA 4M82A 2VRQA 2D0HA 4PYSA 2J7CA 1JAKA 1KTBA 1CZ1A 2CBIA 1QHZA 1OT2A 4AXNA 3SCVA 3MMWA 4DO6A 5ABEA 4Z2IA 2VX7A 1FOBA 3EDJA 2YL5A 4PBGA 5CXPA 3MUZ1 3A47A 2VMFA 3MV11 1TZ7A 2QV4A 1GOWA 4AMCA 2GK1A 4W8AA 1UD4A 3VUPA 4W87A 3BXWA 5CPTA 4MPKA 1JZ7A 2AAAA 2YL6A 5A1AA 2X1IA 1NP2A 1CWYA 2GFTA 3EMZA 4QCFA 2VR4A 5JBFA 1A47A 2G3JA 5FL1A 3MUAA 1G9HA 3ARTA 4YHEA 1SYTA 3VNYA 2WAGA 3W26A 1BQCA 3GNRA 5A8OA 2ZE0A 4ATLA 4GO8A 4P8WA 4PMXA 1E6XM 2WBKA 2F1AA 2CHNA 3PTMA 2GJXA 1J9YA 3VKKA 1E71M 1E6RA 1LL6A 3OGSA 4YPJA 2WKLA 3LPGA 2ZXBA 3WH6A 3LRKA 2EQDA 1CGUA 4AWEA 1DHKA 2IUZA 1EHAA 3CHCA 4ZXOA 3CGTA 4BQ2A 2WMIA 5ECUA 3AIEA 1G1YA 1JIBA 1N82A 1ZU8A 1WNOA 3WH5A 3UESA 4B9YA 3KZSA 4TX8A 1GCYA 3BAIA 3HMCA 3UG3A 2ZUSA 2GJPA 3AIRA 2WZHA 1DWGM 3A3HA 4QLLA 2XVGA 3O9NA 1V3HA 1GOIA 2VC9A 1JZ2A 4PTMA 3AICA 3DHUA 2PBGA 3K8MA 3AIVA 3A4AA 1Q6CA 2CBUA 3AMKA 7CGTA 1JZ6A 5DT5A 1VAHA 2XVKA 4LYQA 3K4AA 3M07A 3WF1A 3SURA 2YBUA 1O7AA 2QF8A 3K1DA 1QNRA 1OT1A 5A94A 4AD1A 4TXEA 4UOQA 2ZX8A 1E3ZA 1JD9A 1C8XA 3ZOAA 1LL7A 1Q6FA 2G3NA 4DM1A 2W91A 4GO9A 3VOCA 4IUGA 2EACA 5IXEA 4HTYA 2WKGA 2Y24A 6TAAA 3MSDA 2EPMX 1V02A 4GZJA 1B0IA 2XIBA 3PBGA 4FNQA 5C70A 3WF0A 3WDHA 1JXJA 3WF2A 1UKPA 3EDDA 1VENA 4MADA 1IT0A 1MW0A 3ECQA 3WN6A 5CG0A 3GH4A 3BUQA 2F61A 1V03A 3SUSA 4FK9A 1IZKA 4MNKA 1H0GA 3ARRA 4J3SA 5A3HA 1V08A 1J0YA 5FOOA 1J0HA 2E40A 1XGZA 3G6LA 5CQ1A 4Z2HA 1Y7VA 1QI3A 3VD7A 1R87A 1BPLB 2AMGA 4FF5A 3CIVA 4UOJA 3ZMRA 4U5IA 3GDBA 5CZKA 2WHMA 4H8HA 1ZJBA 3S2CA 2VRJA 3UG5A 1UR9A 3HJEA 3VX0A 3EJPA 3AOFA 2VJXA 5AYIA 1ODUA 4AZCB 2WSPA 5FKYA 4WSKA 5D4YA 2BY1A 4AZHA 3AS0A 1OD0A 4UQ9A 2OWXA 5BRPA 4J3WA 2XYLA 3AHXA 4ACZB 2YLLA 2D3LA 4HMDA 1KBBA 3OLIA 4AZBA 5E0FA 4PRWA 1F4HA 4NF7A 1R7AA 1TR1A 1EH9A 4D6CA 5HBFA 1U33A 3GXFA 2BVTA 2VVSA 1H2JA 1KR1A 2PWHA 2VTFA 7A3HA 1E73M 3VNZA 2EO7A 3AHZA 3LX9A 1W9VA 1QWNA 3FHAA 3WH8A 2VCAA 4HZ6A 2V3GA 3WUEA 2DPEA 2DSZA 3ZM8A 2VCCA 1NH6A 3PZUA 3WDIA 3SCTA 2BNJA 3HN3A 2WSKA 1SMDA 3DX2A 1QW9A 2OSYA 1WZKA 3AXIA 1HXKA 2JF6A 1JYWA 1J0ZA 2EEXA 2VRKA 4AD0A 3MMDA 1VFMA 3ZT7A 4PMZA 2ZX6A 2D73A 3NUKA 2XVNA 4C7GA 4GI6A 4AD2A 1XRVA 2J7DA 3FN9A 2BHZA 4FLSA 3BAKA 3F5JA 2BXYA 4CD7A 3CZ8A 5I6SA 1XHGA 2OWCA 3SCWA 4CCEA 3QOKA 5I5RA 3LXCA 2D0GA 2ZICA 2VZSA 2VZOA 3GBEA 2J25A 3EBVA 1H3GA 1NP0A 1LF1A 4NZCA 4ZEPA 4QCEA 4UFJA 3WY4A 3LXBA 2OW6A 4ACYA 5A6LA 1TCMA 4ATWA 4GXPA 1EA9C 1J01A 3OLDA 3DX0A 1VFUA 3TP4A 2XVLA 4AYGA 4UR9A 5HPCA 3VD9A 1CPUA 4EKJA 1SFSA 1HKMA 3HG3A 1C3FA 1FH8A 3VMPA 2O9OA 3WL1A 5A2BA 1TMQA 1R85A 1GZJA 3K4DA 4F9JA 4X0VA 3LPOA 3L4XA 2W67A 3AMDA 1EHNA
chains in the Genus database with same CATH superfamily
4GAAA 3GJFH 2X5PA 1P6WA 4WCYL 4IJ3C 5CPNA 4PJDE 4DWSC 4L37A 1E8YA 3BQ6A 3RAOA 3FO1A 3MGTB 3KYKL 3B2VH 3G24A 4XAGA 4OLZH 3L0KA 3FUIA 1QVOA 2G95A 4UI2A 3SCSA 1BF8A 1T7ZA 4QG6A 2MNJB 5GGQL 2E7DA 3RTQC 3MOAH 4HH9B 4EIGB 4F7TB 1NDGA 4JN2B 3B6SA 3F4DA 4ZUWB 3RFAA 4YXLL 2EDDA 1DBAH 1UA7A 3WMSA 4L6OA 5LHDA 1BWLA 4U6TA 3UPMA 1ZAGA 4W9LC 5JA9A 4U3SB 2HMID 4JFWA 1ONXA 1SR0A 3MCG1 3LZOA 3P1VA 3RWJA 1OFOA 5BZWB 4UBDD 4GUPB 4H25A 1FL3A 3STLA 1UKOA 4UNLA 1EJOL 5KINA 3FMGL 4M61A 5D1XA 4RZBA 4RRPA 3K5XA 3VTTA 3S1VA 2OMTA 4AEIH 5ACLA 4HU3A 4RAUA 5LNDA 3S5ZA 3LIUA 2AKRB 3EAUA 1RA5A 3ZWTA 4TV6A 2WGXA 3KL5A 3ISIX 1E0TA 2ED7A 5IFAL 2DT2A 2QAFA 4LUTA 3MUCA 1FZMA 2ZZ5A 2WPGA 1FZJA 1IGTB 4M5ZL 1SHWA 5H4YA 1JR1A 2ZTKA 2XG5A 3LN3A 3S2AA 4O15A 3MJ8A 1XIWD 1G9MC 2DL2A 3RUGB 4RNRB 1A3XA 4PJIB 3C2AH 3VI3A 2Y06H 4U6HA 4B2DD 3VNLA 5EZIH 3TFBA 2Y7GA 1AOHA 3KE0A 3QNXB 3QUZC 1BLIA 3VD5A 2D3JA 1KXQA 3BKJL 2DY2A 4HS6B 3SDDD 3B9VA 4Q9RL 2KI6A 1OV8A 4WENB 4HWUA 3O8XB 4N2MA 4D8OA 2VR8A 4FTDA 2WZPA 3O2DL 3HUJB 2ZUTA 2IOIA 2WLYA 1UWTA 4EO5A 1IAKA 4TVPD 1LNUB 2OMUA 5AC7A 4ZUVB 2WMPB 3ZDWA 3KPRE 1AFVH 1E9PA 4QG8A 4BR1A 1ZUAX 3ZSTA 1GYUA 4G6ML 4QLRA 1L9TA 3IDGA 1I1FA 1CF8H 4ODTH 4HNOA 3DX4A 1XV8A 4MKVA 4W89A 5E8PA 4WWOA 2PUZA 1C8YA 1VLXA 1Z9LA 4ZFQA 1N8WA 1P2CA 5KBKA 1V3IA 2NNXA 1DJNA 1FNHA 2MPAH 2NXYC 2OTPA 2DWDA 2YHGA 4LSQL 5EC2A 3NCCB 3D06A 1E7UA 2XNAB 4WV1C 5IKCA 1NEPA 1EAPA 1VZWA 4P2AA 4IHBA 4XODA 3M0ZA 3TPKA 3FCGA 1OP3H 4DWHA 4P5MB 3OPSA 1I8AA 3SFKA 4DBSA 3BWZA 4HIIA 5BVJA 3EX6A 3TZVA 4M1GH 1MRFL 2HLAA 3MUGA 1FDZA 1JWSB 4AWUA 3TN3A 1W0WB 1Y1UA 4FKHA 1EOMA 2JMRA 2VCOA 1JE6A 4CMMA 2DD8H 3V0GA 1N8ZB 3NA8A 1EFXA 5LNEA 2D2CC 2CO1A 4F0HA 1FP9A 4YHZH 3RVTD 1ADOA 1TZHB 3CN4A 2PYED 3TNOA 2QKSA 5KS9A 3T0EC 3GX9A 3NZSA 4O58L 3ENLA 2XBZA 3CQKA 1YQ2A 4UQBA 1AL8A 4E5XA 3RU6A 3QCUL 4YDIL 1FFNA 3V6ZA 2CIIB 2J4WL 4GQQA 2DQDL 1AR1C 1EIBA 4Z23A 2OJEB 2EVGA 3V0EA 3V4UL 1HYSC 4ZBCA 1EXUB 4XCCH 1AR2A 5EU3A 4NN6B 3ZHNA 1JCXA 2IG2L 4JDZB 1ZT1A 2R4RH 3S98A 3U4FA 4F7PB 3V35A 1PBYA 3LCFA 4G7RB 3MKGA 2J8TA 1THAA 5HJGA 1GSMA 2PC4A 2WJZA 5IG7B 3PUGA 3UO8B 3CVCA 4RGMB 3DIFA 1R3HB 3DVGA 4KJPD 4KY1L 2FDMA 2F53B 1CXIA 4X6DF 4J3TA 4L4TA 4W93A 2XWJA 4NB7A 5HPOA 2V68A 1F41A 3ES6A 1WRFA 5CJ8A 5AKSA 1BF2A 5MEND 2PMQA 5F7NC 5DMMA 4ZX6A 3VE0B 4A8NA 2ZOUA 3UWWA 5J5RA 1Q1JL 4CNSA 4HWNA 1JGMA 1FL5B 5KTLA 4QIRA 2O5YL 2VOMA 3G9VA 2AAMA 3N06B 3G6JA 1OM0A 3LV3B 1TKWA 5B80A 1I1AC 4RMVA 1F4WL 4I1PA 3N17A 4C6MA 4JQ2A 3CL7A 1J12A 1YYMH 4Z7UE 2EXOA 3LXAA 4XCEB 4YK4C 5CCHE 3WFLA 2XH4A 2R23A 2NQ9A 2NW2B 5E94A 2DTMH 3SIKA 2HWZL 3V52H 5ALBH 3KWWA 2YWZA 1GVFA 4CD4A 1URZA 3TYGL 1Q9LA 4LAMA 4K8RL 2GTZB 2I60H 2UZYA 5D5MA 2CNCA 4Z3IA 1Q94B 2IPKA 2WLLA 3OB8A 3N3MA 2AFNA 3KHQA 4KTDL 3CV5A 4DFHA 2N4IA 4R4NC 5HMFA 5D55A 3UD6A 2FHBA 3SBWA 2ZPKL 1MZYA 5TH2B 3WCYA 1TZAA 4YTTA 1E5AA 2VX5A 1LEKB 2W0FB 4HAGA 3WFBH 3X12B 1NAKH 3F5WA 1FKWA 3QJOA 5AYXA 3DYMA 2WHKA 1YN7B 4FP8H 4HJSA 4EN3C 5C9ZA 1X5GA 1G4MA 3UPWA 5CINL 4JKMA 4DRSA 5AY7A 32C2A 1MDLA 2DPKA 3B2XA 5C7XH 4TVPH 3W3BA 2PC8A 4DUWA 5KTEH 3RFZB 1AQKL 5AZUA 3AIUA 4L56A 1RR2A 3Q2LA 3T0TA 4Z7QB 4C58B 1JPIA 4R7XA 3NL2A 3KTCA 3H54A 1GKOA 3EO9H 4PJEF 1E67A 4Y2LA 5A6TC 3IPEA 2Z31C 1OANA 4DESA 4JFQA 5KOVC 2HVKA 3K72B 4F24A 4U6VL 2VZVA 1A2YA 2DZEA 1PX4A 5KSBF 4CQDA 1P69B 1CLVA 4UQ2A 3W2LA 4JHOA 2ITFA 3TDFA 4P5UA 3KYOB 4N9GA 3SFWA 3HGOA 2YLKA 2G9HB 2E59A 3UPRB 4BSWA 4QO1B 3ZIMA 4HZMA 1SN5A 4OE7A 2E7LC 2VISB 4E8CA 4HVBA 4KWWA 2VDKH 4KUCF 4X83A 3RJYA 1TXKA 3CV2A 3HBGA 4LSRH 3D69A 3FW6A 5INCA 3TIMA 4HJGB 5CJBA 4P4RB 3RI5F 2WNQA 3ULVD 4JTQA 4X6FB 4WY0B 4XZ4A 2QGHA 3AHVA 2IPUK 4F8XA 1QMLA 5FEBA 1I53A 4NO2B 4UNUA 1RZKH 4IBQA 1DFBH 5LIYX 3L7EA 4MVBC 4ZB0A 4UM9D 4MUZA 2IPTH 1AMXA 1OIOA 5HYQA 3ENEA 3C6LA 3TJIA 3ABGA 2FGZA 4NU7A 4LPWA 2NY1D 4AG4L 3CMFA 3KBVA 1H15A 1BRLB 4L4PA 1NBZA 1IC4L 2UY6B 3FY1A 4PB0H 2XHYA 3KVMA 2DIJA 4M9PA 2R39A 4WEVX 2NSQA 1DQVA 3SGDH 2B3IA 3JWDH 5F6HI 4X7EC 2R91A 2BP0B 5IDZA 3AXMA 4RDBA 1SF3A 3FQWB 1T7WA 3DURA 4M5YH 2M2DA 5H8UA 2AV1A 2J6EA 5E8NA 5TQ2H 5AOUA 1TTBA 3GG1A 4H1LB 3JWOH 4LCYB 4O51A 4M7JH 1EXGA 3L65A 5HJYA 3M0JA 1PX3A 3KPQB 2Q6WA 2DIEA 1M7UA 1I9RL 3U82B 3P0YL 1KRMA 3EOBB 1RERA 2HMIC 3ARVA 3WIAA 4X6EA 3N43B 2KUTA 3A5VA 1KM0A 2ZXCA 4TVPE 5HD8D 4O4YL 4QXUL 3FVMA 3V5DB 1IU1A 3RITA 1THCA 3U0TA 4UBDC 3WEXB 3GWQA 2INZA 1NGWB 4OBRA 4PUNA 4GUQA 8CGTA 1BQLH 3TX9A 2PW2A 4RDWA 1AQ8A 3PIQA 4EOWL 4O8AA 5KYXB 4XNXH 1WP6A 5E1GA 4ZQKA 2ESVB 3GH7A 4O4WA 3SGGA 3OB0K 1D5RA 1ETA1 5D6CB 1PKLA 4XNUH 5I77A 3UABA 3D3AA 5AECA 1JI1A 4FA6A 3BWUF 4DP1X 1MIMH 2X0UA 1NCUA 4X6CB 1Z6JT 5DZPA 3UO1H 4TX6A 3FHEA 5EMLA 3QHOA 1ZANL 1DQMH 4HS8H 2RHEA 3G9AB 3WUWB 1OCJA 3ZE2E 1B1YA 4EZMA 2V2XB 4XIMA 2P8CA 1XIWC 4PGDA 1Q85A 1ZHLA 1FLRL 1X7IA 1N5YH 4URIA 2D1ZA 3MLVH 3C8NA 4DCQB 2VX4A 5J06A 5JUVA 4DYJA 5EZPA 2G4GA 4E9WA 3VIKA 3IDNB 1JRHL 4OZHA 5FJUA 4AD3A 3EF4A 1I1WA 5I0YA 3ETTA 1F97A 2FTYA 1CF1A 4HUWB 4AH7A 5ITFA 4MMYB 3SDDC 5E5MA 1N59A 4TULH 1Q0XH 5B21A 1MQKL 1J5TA 1LO3L 3WQPA 2PYEE 2AV7B 1BKSA 3L2IA 1JFHA 4DPRA 3L45A 3ECBB 1E6NA 2ANUA 4NQSA 3NPSC 4N2FA 1JJKA 5HVGB 1JPMA 1IF2A 1WZ1H 1UWRA 4U1MB 3KBWA 3QI9B 1NA8A 1YPZB 1VEOA 5C1MB 2BVYA 5LQBL 3HFTA 4N8VG 4L1DA 2YOCA 1E4IA 4C56B 3D25B 3LN5B 4AXWB 1E4KC 1CNVA 1P5UA 4FQXA 1AI1L 4RETB 4IIEA 1P4UA 1B4LA 1DIOA 4FQHA 1HXJA 4XOCA 1PJWA 3QQWA 2CO6A 5EIIG 4UV7H 3QZWB 1TPWA 3NK4A 4RMTA 1F9CA 1CLOH 2AEWA 4HPXA 4LUIA 3PV6B 4OLEA 3TYEA 1I45A 1JPTL 1ICQA 1Y18A 3IS1X 4XP9L 3IU4L 5ESAA 1UC5A 4WJ8A 5MENE 5D7LB 3I02B 1DBTA 1SW0A 3GSWA 1FAIH 2X1UA 5D7JD 1YY8B 3UYRL 1WZAA 4MRBA 3ULVH 4UB0H 4WDXA 2J8UB 2ZOKA 3FU7B 3ZR6A 2Q8ZA 1GPFA 1RZKC 2MQCA 2KQMA 2WD0A 2ZZ2A 5KMYA 3RVTC 5HSFA 1S6NA 4NZTH 2IAAC 4YHYC 4GMSH 3FQUB 2KHAA 3CCHB 3FTUA 4P5RA 5IMMB 4CSPA 5E4IA 1EHLH 1SFDA 4RCXA 3J2PA 4Z7AA 1WUFA 3NQBA 2F6KA 3RWIA 4WRLA 3NQGA 4Y2WA 2WO5A 4WEUD 4LLVB 3NM3A 4OZOA 3TZFA 4RE0A 1UASA 3CFJB 4AGMA 1FWBC 1VD6A 4WU5A 4ZX5A 2JFEX 2I24N 1AP2B 1MWAA 5FB8B 1A65A 4BQ4A 1NGPL 3LNEA 4KCUA 2B0SH 4XWGH 4PW4A 2YBVA 3WZ0E 1MN4A 1XDTT 3V0WL 3A4EA 2FWOB 1W3NA 2X2YA 4H40A 4PREB 2CKBA 1RK1A 5HHOA 4XUGA 1JGUL 3WLRA 4E38A 2YW4A 2E67A 1TCRA 1K4DB 1YEHL 4Z2IA 4NZ8A 5CJXC 4AQAA 1H1YA 1PVHA 2I5IA 4MMXB 4JM2F 4IM8A 4X7CC 4ZMGA 4IGBD 3O9WD 3GHEL 1JFQL 2IPGA 3ASWA 4NP4L 4H8PA 4FQ1H 1KY6A 2WSRA 4W9EC 3QXAA 1E6XM 3QIBB 3BCJA 5F3BB 4BKLA 4NKCA 5AYZA 3LPGA 1A7RL 5D72L 3RWDA 1MVFA 2XWTA 2VDNL 1E9OB 3OF6A 1FXQA 3MLYL 4GNVA 4I90A 2H41A 4CMHB 3OO2A 4JZJB 1G67A 2YXVA 4WQOA 4P46D 1V4YA 4WDUA 2Y8UA 2IH3A 2KLTA 3QBUA 2XVGA 3STCA 2OCFD 3L23A 3T40A 2CLRB 4I0PA 2NZ1A 3KPTA 3DXAA 2GAZB 3LQLA 2EH8L 3IWPA 4F58L 3D2UB 3O3AA 2DDQH 2Y62A 4AMKH 5IW6A 3MLTB 4OVXA 1A49A 4PJGE 5FF6B 2YAPA 2R24A 4P9HL 1B0IA 1US0A 4HEMA 1JXJA 5D7IA 4ZMQA 3WN6A 2E6DA 5FCSH 4G42B 1IGSA 2DQJH 4OFCA 3D85D 3ULVE 4LP8A 2OMZA 1H3VA 5BJTB 2AQVA 4Z95H 1YMHB 3EGDA 5E1AB 1A25A 4FF5A 3CIVA 2OS7A 1OE3A 1CFTA 4JX6A 1YNTA 5ESVA 2G60L 5B38G 1WJ3A 3P60A 5DFVD 3EUDA 4EF9A 1TJHH 5LIUX 2Z00A 4BZ2L 4K1WA 4U1LA 4ZO9A 1DZ0A 3HQ1A 2R29H 4EDWH 1ANUA 1WBZA 1BQUA 2NQDA 4U1KA 1BOGA 3ESVF 1RPXA 3L12A 3LM3A 5LBGA 2VTFA 5K9DA 1P9MC 3RWEA 3V7AG 3QAZB 2EE6A 1WCBB 4HKJA 4CQAA 2OEMA 1E1CB 1P7QB 3BE7A 3PWPB 3ARGB 4DQAA 1CVSC 2P8MA 3DHMA 4J4KA 2VCCA 3PZUA 2FZMA 2D8KA 2WSKA 2HRWA 3MJ9A 1TV8A 3IS0X 2Y7LA 2OMYB 3QHZL 4C7GA 2XWBA 2HMCA 2VEGA 2A85A 3A67L 1IJ9A 3H3PL 1E27B 2WXFA 4V1YA 1YDVA 1AD0B 5I5RA 1F8IA 5DJDB 1BJMA 2J25A 1OXYA 4ZNEE 1H3GA 3VC6A 3L9RB 5FO8B 5SWSD 1TCMA 4B97A 1NDMB 2WOBA 4YSTA 3OAUH 3TH6A 1CPUA 1SFSA 5G4WA 4Z77A 4ZS7H 3BUVA 3ULVC 1EBGA 4IIBA 3GSNL 1B0GB 1GWJA 3SQOH 1OQXA 1NCDL 2X3AA 4V15A 3KHOA 4ZR8A 1RH8A 3GNOA 1F05A 5T3ZL 4GRWB 3AS2A 1DJXA 1SVZA 2CR6A 4TNVK 2LVEA 4PJCF 4Q4QA 4C7FA 3DHFA 2HJLB 3VCLA 3ROLB 3CV7A 5ILTL 2VDML 1S7TA 5AN7A 3T4YA 3LS4H 5I00A 3NO5A 2RFXA 5CSYA 4TRPL 2A6JA 3EYQD 4BWLC 1TA3A 4HJWA 4JRFA 1Q5MA 3CTLA 4OQTA 3ARFD 2WYHA 4MS8D 1HJBC 3ZO9A 3CEPA 2NY1C 4R5EA 3L95B 1N6QL 3T71A 4HCHA 3TXZA 2CPUA 4ZE4A 1SQMA 1AAJA 4K71B 4F15C 3A6BH 3CFBB 1EEZB 3LN4A 1H1ZA 2V5KA 3U4EB 4WI7A 5F7DB 3V7AE 3MLUH 3W1TA 2VH5H 5C7HA 3N6JA 3SY6A 1AZBA 2ZAHA 3RWHA 3H56A 5DUPL 2QXWA 4KZEH 4JKWA 1T0OA 3T6QC 3T1GA 3CHFA 2XYCA 3BEWB 5U7SA 2Z35A 2I26N 1WXZA 5AHLA 3BESR 4OJFH 4KRZA 1N6UA 4TNEA 5IVZA 3I9GH 3VAEA 3CUGA 3W9EA 4XISA 5AZ2L 4LB4A 1LE5A 1M1XB 3K0YA 5CZRA 1TR9A 2O9TA 3CM4A 1HH6A 3FTSA 1UR4A 1Z2KA 2WC4A 5E0CA 4YHKH 2WAQA 1UMYA 3T4CA 5E8OB 3SOTA 3T7VA 3IFLH 3O6FA 3RB5A 5HD8C 2JTDA 4GQGA 4NKDA 4XPFH 3NAVA 1FVDA 3EZ8A 5JHDD 2WMHA 1SLVA 4NHUA 3UWYA 1CICA 3NYZA 3S4SA 4EBQH 2BOEX 4OLVH 4Y4KD 4NM8L 4EZLA 4AWTA 3TVAA 2QPSA 4F5CA 4IJRA 1G7LB 4KDTC 3VXRA 3B5GA 2Z2AA 3UXIA 3FU0A 3PWVA 1SZEA 2ZUMA 4AMXA 5CCJA 2GUOA 1NPJA 5IQ7L 4N8PA 3APGA 3NABL 3S5YA 4WI2A 2UWEE 3O6KH 3PWLB 1Z0MA 1CLXA 3KDNA 3MQTA 3VCNA 1ZENA 3WLMA 4AY8A 1A3QA 1TTQA 3LGGA 2PTTB 4N5ED 4W4OA 1QOPA 2AK4D 3MUIA 2O5ZL 3K46A 4XPAH 4YEEA 1D7CA 1T8XA 1I7ZA 1UW9A 5CD5D 2XHNA 4AZCA 1MFMA 5AKRA 1OPGL 4AENA 4YSAA 2A79A 1XCXA 1N0LA 2FYYA 3T08A 5E1QA 1SFJA 1N3NB 4JZOB 4KFZC 4GIYA 5FFLA 4NJKA 1KCZA 3TBYA 3H0TA 1NFIB 1MIEH 2VDNB 2O4EA 2KERA 1TZZA 4IPIA 1QNSA 1JZHA 5IZ7A 4OLYL 2P43B 5AD0B 3BZEB 1I7TB 1XDJA 1AKJB 1J79A 3ABRA 2A3TA 1RZJC 2WVTA 1PZBA 3GMMB 3TOPA 1J5IA 5A43C 4JPKL 2PWVA 1MPAL 2WQAA 1F6FB 4F1SA 3QPZA 1FNGA 3HURA 2YUWA 3HS0A 1TUPA 2VUOA 3FJNA 4GZEA 1K7FA 3SKMB 1KENH 1U8JA 3DKHA 4JB9H 3S3JA 3DOSB 4NWTL 1NWRA 1RHFA 2AF2A 3OGRA 5LWYL 5SX5H 1OF2B 4IRJB 2YD3A 1R3LB 4BH7A 1XGUA 3P3SA 3QY7A 4GT0A 2VWEC 3NOYA 1US3A 2JKRM 1TPFA 1WISA 1UR0A 4P23A 5GGTH 1W6LA 1ML0A 4X5WA 3R4DA 2UX6A 2XA8H 3WS3A 3KLAA 4J28A 5I0WA 3DI0A 4WXZA 3OAZK 3GMOB 2QSCH 4KK9D 3HM7A 4XTRD 1YXDA 4AZ7A 3RP1A 4LJ3A 3ZE0F 5D7JC 3TN5A 1EGJA 4PTDA 3KS6A 2KKQA 3R11A 4WUKL 3PHOB 1FSKC 3BVVA 1O9ZA 1T7XA 4QE1A 3GBLA 1XLHA 1JRHI 4G9FB 4FFWD 5ITBH 5CZ0A 5HMDA 5I03A 4Q6IB 3W2KA 3OKLB 4N4PA 1EGMA 4M43H 3V6FB 1JV5B 1ZGLB 1RURH 3W1XA 4L3AA 5IEKB 3B03A 4N5UA 1GAFH 2WBWB 4HKPA 1ZB5A 1QPQA 2A7PA 4XCFL 3OC8A 5GJMA 3FQRA 5JPNA 4R26H 4EPBC 1KSRA 3CPLA 1BEYL 5FYJL 5FUCC 2DI7A 3MZTA 3TQKA 3N9GH 3OV6A 2J44A 3MJ7B 4GX9A 3LZFH 2WNWA 4M56A 4A2SA 2X0VA 4NZDA 5JXED 3GSNB 5JQ6L 5DQ9A 3Q2CA 3PUEA 5E56A 1IWPA 1HKLL 5E51A 4GBXB 5IVXB 4PRAB 3B5HA 3HZYA 2VZUA 3TMLA 3ZXAC 3U83A 4V1DA 4Y88A 2VDMB 3AITA 2FL5B 4W9DC 2HN7A 4B60A 1Q7QA 3KDOA 5LIWX 3FKUS 1RHCA 1NLDH 1H3PL 4UTAA 3Q94A 3N73A 1QSZA 1VB9A 1FGNH 4BCZA 3STFA 3O9WC 3MRMA 3KEDA 3V4PA 1JTTA 3IF1B 3C08H 5BZDB 2UV3A 3S8WA 3EYPA 4NWUH 2P0IA 3HG1E 3IKKA 4ZMWA 3FU9A 1IBGL 4U3CA 1W9BM 2OSLA 2IXQA 4ABQA 3ZE1B 4MA3A 2X6CA 3FN0L 5JYMA 4B3VA 1ZT7B 2Z0UA 3TEUA 2Y7SA 3S34L 1H8NA 1UG9A 4GW4B 3T8QA 2HVJA 3X17A 1IGWA 3TZNA 3WQ8A 5C0AD 4A3QA 1I8IA 4WOQA 1WDSA 4P46C 2VABB 5BO0D 2VEKA 3BO9A 3UNDA 1UM6L 2FB4H 2XINA 1O5DT 2VW7A 3WTUA 5E99H 3NK3A 1KMGA 3H70A 2YR3A 1NF0A 3WOVA 3GXDA 2X4SB 3T0ED 3GMQA 4CKQA 5HATA 1YNLH 4QRRD 2I1OA 3TTSA 3MRRA 3UZEA 1LQBC 4LCIL 2E9BA 3WEMA 2I5YL 4J23A 3PJUA 2O61A 1AR1D 3QFJB 5FC9A 4YDKH 3PWAA 4DKFL 3IETB 5E00B 1IAOA 2R1KA 4E2OA 1XGRB 1HYSD 3E6EA 1MCOH 3NP3A 5I30H 4LH8A 4G71B 4I9TA 1QBLL 4IPPA 2WNXA 3VXUA 1NCAL 3HNTL 3WK2A 4BK5C 3TAOA 3EO1A 4IQHA 3B7UX 3NFPB 1TREA 2V5YA 2QGDA 4UNKA 2V2TB 5DFVC 2GSJA 3AHYA 4F1ZA 4B4FA 3KYMB 5I3JA 3RNQA 2F1EA 3D39D 4ONHB 3WXWL 4PTXA 3RLUA 3W73A 1FWSA 1QWHA 4NPJA 2BSTA 1ZA3A 2IWEA 1RJZA 2HEJA 5CR1A 4FXLA 3KNBB 4LRIC 4K15A 1LVEA 1RIUL 4LLYA 4AEFA 4E9YA 1FGVH 2FECL 1UJ3A 2WTRA 2NY0B 4QISA 3KLLA 5C55A 4JOMA 4PJXF 2PF0A 3E7JA 4APXB 2DMCA 4K23H 4BJLA 1OD9A 4LNYA 2CBMA 3LHTA 1OLLA 2CJSA 3B0UX 2WUBL 2NRDA 5IHBA 1H8SA 3WLPA 1S7RB 1J0IA 2I9TB 5DMYA 3L4UA 2ZIDA 4LDLB 1GQLA 3OZMA 2LU5A 4N8UA 1C5BL 4ZQCA 3EWWA 1WBHA 2NY6D 4KBXA 1B4RA 2V6AA 3CAQA 3RLGA 1LLOA 1V7MH 3M0LA 2NPLX 3WFAA 4MAZA 1MHHA 4DVBB 1I8KB 3RX3A 3B9DA 5LA0A 4PMRA 1DLHB 2PYFB 1FWAC 3FJ6A 1JWMB 3SE4A 1CDHA 4FFZL 4C4KO 3L8QA 3VWJB 4Q8VA 3TPUB 1KGWA 1DQTA 5JHDE 5GJSL 1UXWB 2O55A 3BUYB 3FA4A 1I60A 1U8MA 2X0HA 2W0LA 3BOFA 4RX0A 3EG9A 2I57A 4YDLB 4XGZB 2X4QB 2J5LC 2TRYA 3EYQC 2Z91A 1LOSA 3FRPB 3M1OA 2E6JA 1UVQB 2QADB 4ZFCA 4JKKA 4Q4PA 2NY4B 3ARFC 4IMDA 4GG6A 4H9MA 4RPQA 2D4FA 2VEMA 2PP9A 1Q2SA 4GRLB 1V02E 1R3TA 4FNPA 1UXMA 5GIRB 5FLVA 4XNZC 4IKJA 2VQ1B 4LLQB 4CN6A 3RDTB 4NNCA 2AK4E 3RLHA 3V0HA 2ISWA 4LVNC 2ODOA 3EDFA 7FABL 4YYFA 1KG0A 5GS2D 3EPMA 4JICA 3GXUB 3APCA 2E0PA 1S9VB 2BWQA 2PDBA 1XSJA 3QW4B 2ADYA 2J88L 1T6WA 2R0KL 4IMKC 2Q9OA 3IRSA 3OPZL 4YL4A 5M95B 5C8BB 5EMUA 5IDIA 2Y0SA 4LWWA 4UTBL 3LTSA 2VQTA 4YBQD 2C13A 1M71A 2ATAA 5HVWA 2UXVA 4AT6A 2JIXB 1RJCA 4O28A 4PJ8B 4NENA 1ASOA 3AB0C 1W1TA 2Y6SD 4R7WA 1JCYA 4Z3JA 1Q8JA 2B5IB 1FA2A 3VX1A 2BSEA 2E3VA 3VMNA 4LVOB 5GSVA 1MREH 1B2WH 5AUMA 1U30A 1J8SA 4ERIA 3BUDA 4LYPA 5TE4L 1LP6A 2ZWNA 4PGCB 3QUYA 2VFHA 3UR2A 1E0VA 3SDAD 5I1EH 4BGLA 4B90A 4J3OD 1G1OA 4N20A 1MFDH 1P7HL 4XAWH 3SDXB 4J39A 1NWTA 4ZBJA 2ID5A 4K37A 4J27A 3WLSA 3PV7A 1LLAA 2I69A 4KZCA 2X28A 3HMWH 4YFEA 5HY9A 3U1SH 2ARJQ 4MVBD 2X89D 1RFDH 3ITVA 3UA3A 4FXTA 3VVVA 1HVXA 3S88L 4OZIE 4N5EC 1B0WA 3KRBA 4GUFA 4DB7A 5I0ZA 1ODZA 3ILEA 3TC7A 3GZQA 1WYIA 4DIXA 1R86A 4PZVA 4H00A 5CD5C 3MO4A 1GZHC 3AAZB 1VADA 2WN3A 4FHJA 4RFEA 5FA4A 1XR8B 4RDYA 5SWZD 4AUUA 5DJCA 4KXBA 4OKDA 1LRQA 1FDLL 3UPBA 3HPFA 5FYKL 1XR2A 2G30A 3BFQG 3N9RA 3WY2A 3QZNA 1KIQA 3HW7A 3U30B 2AJ3A 3RQ3A 5JPMA 1R6WA 2AZAA 3TT1H 4CN1A 2BNRD 3T77B 2NWRA 1XTLA 1MQRA 4AH2A 1M9WA 2YLHA 2X7LA 4JKPL 3PGCA 3VNDA 1T0MA 1ASQA 4MLIA 5JO5B 4XVTH 4ZYKB 1L6FA 2R27A 3S5NA 3H26A 1WS8A 1JN6B 4XBEH 3CVHL 1DV7A 1XCTB 5J89A 2YBRA 3HG4A 4JZ5A 3BP7B 1N19A 1MXGA 4QI3A 4DF1A 3OKNB 3X1BA 1WFOA 2EIZB 4GVGA 3L9YA 5M3WA 5DJXA 4IP4A 1RUQH 3LGDA 4FXGC 1WDWA 2AABH 1KCXA 2O56A 4LLWA 5TF1L 3OXSB 5AOLA 3LS5L 5CWSA 1HJXA 5BXPA 4B9PA 3H6OA 4YAQA 1HQRA 4EWJA 2WO4A 3CZUB 5EFFA 1PFCA 4GUHA 4GEIA 1D3GA 4Q2ZB 5G4NA 1WH0A 1JK8A 5KSVB 5EZOH 4CSTA 1EHKB 1EQPA 3N19B 1HHGB 4HWBA 3B1TA 4Z7OE 1EMTL 2QDHA 2BDQA 3AQUA 3K91A 2WBJA 5C6WH 2WZTA 1HO1A 1PYMA 4KK9C 3RXZA 4XTRC 2FJHA 4AV0A 4M4RB 5HGAB 3W7IA 4HNLA 4NKMA 2AQ3A 3VTMA 2IPUG 5AW3B 3ZZLA 2Q76A 4OTXH 1EO8H 4E8DA 1IE5A 1RVGA 4WRHA 3LYEA 1G0XA 1GT8A 2ADGB 5KYYB 2Y70A 2CUHA 2OCJA 2GLKA 4FFWC 3J8F7 5GRVL 1WSST 4TUKL 2V30A 5CZVL 3INUL 1O4UA 2RQEA 3BL3A 1MI5D 2BGSA 5I16A 4Z8FH 1W5OA 4BCXA 5I76B 1W37A 3W71A 1U42A 3QG6B 4QAIA 2DEYX 4JGJA 4PU2A 3U6XS 2HUEA 1PL9A 1A80A 4GY1A 2J7CA 5L2KD 1U8LA 4FHKA 3T0EE 3TNNA 4QRRE 3MODL 3OB0H 1BYNA 3GUTA 1EC8A 2WXMA 5ADPH 3EMZA 5IJCC 3S37L 1A47A 5JXEC 3N4FA 1QO3A 2JI3A 5GS2H 1EKOA 2YC1A 5IJVA 1SHXA 4Q8BA 1U1HA 5E6UB 4X8JB 2X4NA 2A9ML 2KPWA 4GO8A 4ATLA 2FSDA 4ICWA 5D6DC 3VKKA 2OR9L 1WV2A 3UWQA 3ARDA 4MNHA 5AG9A 4L1BA 1XYMA 3NQCA 5F8RC 4NJHA 5JA8B 3JTSB 3Q9PA 5LGJA 1GCYA 4LVHC 4A67A 3D39E 4CSZA 2CJUL 5IQOA 1GC1C 1YTDA 3DHUA 5AAMC 2PBGA 4U1HA 3VFSB 1M68A 3TJEL 4OSUH 3V0AC 2AJUH 3BZDA 4TS6A 3S3SA 4MDJB 4ZTPH 2VAAB 1K2DA 4WU7A 3QC0A 4GUGA 3AQYA 4DO7A 3C60D 5I8KL 4J3OH 4TLSA 5DC2A 1AC6A 3WN5B 6TAAA 2EPMX 3WFDH 3REVA 3SUSA 2QJMA 1NKRA 4BK9A 5AB3A 1S7XB 4KU1A 2BC4B 3HIZA 1QI3A 4QPEA 1BPLB 3FJLA 4UOJA 1URIA 1ZJBA 1DL3A 1AACA 3S2CA 4JY8A 3PUDA 3HJEA 3EJPA 4XD3A 4AHQA 4N9OB 3GPEA 1M65A 1ODUA 3D47A 2WSPA 3T3MB 3QZEA 3U7WL 1ONWA 2DQIL 3MA9L 1KBBA 4K8EA 3RBSA 2YPLA 3GZOA 1F4HA 2EYTB 4HIXH 2OZ8A 1BIHA 2F68X 4DXXA 1UYWL 2F54D 5D2LA 1P4LB 1ZGDA 3QP3A 3I6EA 4J3OG 3WUEA 1P4IL 2DPEA 2ZVRA 5U4NA 4KUZL 3G1XA 3HN3A 1W31A 1YDYA 3OU8A 4LAZA 3GHSA 3L5LA 3MLWL 1FQ0A 2NX5D 1S3KH 4Z1CA 4U05A 2QS8A 1H50A 1QRNA 2QDEA 3TWYA 4CD7A 4HCIA 3B2VL 3UCCA 1XHGA 3SCWA 3N2BA 4OLZL 1SVBA 3MRLB 5CLZA 4FTVD 1XBDA 4QRUB 2NY3C 2PTUA 3MOAL 3N0PB 2OVLA 4UFJA 1AZVA 5T1LA 4ACYA 4MNQB 1XLCA 2PLCA 2WQUA 1C16A 3DX0A 4CQ8A 1A3RH 2QAPA 3A64A 2NY6C 3HE6A 1U95A 3L4XA 2QPXA 1GYMA 4YVVA 5C07D 1FWDC 4LL9A 1EDQA 5JDSA 1YMMA 4YLBA 1POKA 3TEZA 3KGTA 3PZMA 3O6DA 2F0CA 3AIWA 4ML4A 5LCVL 4PQXA 4IPLA 4Z7WE 2PWUA 1QLFB 1XL4A 4IJ3B 2CALA 3CVHB 1DTUA 3IN0A 5DYOA 5J1SC 3BSHA 3THQA 3ROOA 1M9HA 4HHAB 4AEIL 5F6HJ 3KDPB 9RUBA 4S3EA 4ZUSB 4GH7B 1OIFA 4YDVB 3L3GA 1RH9A 3RTQB 3LOTA 4MWAA 4CQBA 1OCRB 1ZHAA 1MUMA 3WJJA 4CVZB 3BVNA 1HCYA 4XNMB 2WXQA 2HB0A 4F7EB 4ZB2A 5MERB 5LGZA 1U8HB 5F44A 1XLLA 4FX7A 1W8OA 4HA4A 1J96A 3QZPA 3C2AL 5F9AC 2Y06L 3AYSA 2GABA 1S5TA 4G8EB 5EZIL 2F6XA 1U5VA 3T6VA 4M81A 3B8UA 3LNGA 2AJZB 2DH3A 4OU3A 4D1IA 2R59A 2DJLA 2V6HA 5SWZE 1VFBA 2FECI 1QWKA 5GS1C 3EZ4A 3MRHA 3HE7D 2V8ZA 4RZCB 2YGOA 2YDSA 1SUHA 4P2RA 4W9ZA 2XGZA 3U0WH 3TC3A 5GSRB 3TOYA 3CFEB 4WJG3 3H1ZA 1BHGA 1IBZA 2WPBA 2BNRE 5FI8A 4YBQC 4MB4A 1AFVL 1HCVA 4E41D 5GNXA 4OZFA 4UT6A 4TOQA 5FECA 4PJDB 4G43A 2HPIA 3PG9A 5HNNA 5I02A 1XQKA 1A6AA 2Y6SC 5JOFA 1CF8L 4ODTL 2KYIA 4C6BA 3EJZD 3BPWA 2QL1A 1KBWA 2FH6A 1A0QH 1ND0A 5D1ZB 4QX4A 3NQVA 4Q6YA 1BWMA 2QUNA 2L0DA 1U8KB 5DJ0A 3QUZB 3QDAA 4E9LA 3SDAC 2I9LA 5FGRA 3DUUB 1O5RA 4J3OC 2MPAL 3QQ4A 4DP9X 5I15H 4YHIA 5ETUB 1S9XA 3UADA 3T9PA 3KOWA 1HVQA 1HOCB 2OMXA 1YSOA 1EO7A 2YDAA 3O3BB 2P8BA 3R8GA 4A7GA 1CQYA 3PWJA 3JVGA 4M1GL 3RGHA 3IUIA 1Z9NA 3HZKB 1I9CB 4L5FH 2CLPA 4XXWC 1DIEA 4GZIA 4MAYA 3GNMH 2DD8L 3SYCA 1FBIH 43C9B 3R7RA 3Q0HA 1W8SA 3CZEA 2HCZX 1BX2A 1UD8A 3W1RA 1GYCA 2APFA 4N0FA 4IG2A 4YHZL 4HKXB 2C8NA 2XXCB 4OECA 1A1MB 1S4IA 1QR4A 3VKJA 2PDUA 3P40A 4RL3A 3KH3A 3TYAA 3GB6A 3A4WA 3BT0A 3IGXA 2H26B 2ASHA 1INEH 3H53A 2NXYB 4O1CA 2OKTA 4DPAX 3H7VA 3D1MC 2VIRB 3WLBA 4GX8A 3HR5B 2XTKA 2YAMA 4KV5E 3OKOA 1MI5E 4FFYA 4XCCL 2PPDA 1V0MA 1P1ZB 1PG7W 2OA9A 1A1NA 3BRDA 2R4RL 3H4HA 2BW5A 4H88H 1K3UA 2OMWA 3LKSB 1TQTA 2A83B 2UYLA 3O81A 3LLXA 3MCNA 4F91B 2R2HB 1WHOA 3FT3B 1FRGH 5A95A 3ESOA 3G0XA 1D8WA 3LCXA 2QLYA 3SPGA 4LXFA 3O6AA 5IROD 2H5UA 1B90A 5IB5B 2WINB 4BSVB 3L54A 1D7DA 1HESA 1NFDE 3KPRB 1U41A 2BVOB 3QQ3A 1VJZA 1W54A 2MKLC 4YSQA 4B5WA 1VCVA 1CFVH 3S9ZA 4JUTA 1U8NB 1QRQA 3GJFB 3LKQA 2GDQA 3F2CA 4ODHH 2M1KA 5IB2A 2PS2A 2AL1A 4BFEA 3QPQD 5JW4R 2YEQA 3QV6A 2NZLA 1QFWH 1CXLA 2AJVH 2ZWYA 4FLHA 4ORIA 3DSNB 3BV7A 3NQIA 4AB4A 3D33A 1CFMA 1YYML 4FQQB 5DXYA 3UYPA 1YEYA 2DTML 2VHLA 3V52L 5ALBL 3QDHA 2XZZA 2GTWA 3T3PB 1OSPH 3U2JA 1XF2A 4H1ZA 2I60L 1L5GB 4OU1A 4JPGA 4TSCL 4QHUB 2ZP0T 1VFLA 2CETA 3VDHA 2YXWA 1CGYA 3RPIA 4ZL1A 3G6MA 2E86A 4FRWA 5CBAB 4HOWA 3GRIA 3BXNA 4KO9A 3WG6A 3PYCA 3OEXA 4L5FE 3F8UB 3UQNA 1BWVA 3UVIA 5J13C 4K4KA 1NAKL 4XNQB 1I1AB 4FP8L 3E9TA 3IU3B 2CESA 2XBDA 5A5WA 2PP8A 5ICXB 4YZFE 1LWIA 4QRPD 4XAZA 2H1PH 2W5PA 5FGSA 2XPZA 3VFTB 1U2CA 2FJKA 1J9TA 4PWJA 4YK4B 1E6JH 1A50A 5AB9A 4PS8A 2Y1YA 1U5HA 5F6IC 1EYEA 1XDLA 4PHZA 5C0CD 2DQMA 5KTEL 1OE1A 3B06A 1QSFA 3WE6A 3EYFA 3X1EA 2QCDB 3BZFB 1A9EB 2JEPA 1XQLA 3QVAA 5DD5H 3SY0A 5I23A 3EO9L 3UIZA 4DKDC 4DGVH 1CL7H 3JUGA 2IH9A 3V5HA 2NX5E 4WHTA 2X4RA 3TN0C 3SR7A 3D3VA 5DD6B 1QPOA 1WFJA 1UR1A 3SGJA 3FGCA 4AG0A 1BJ8A 1N0XH 4FTVE 1VBRA 4PJHE 4R7OA 2FLBT 4HHWA 3C60C 4BEQA 3LSOA 2H1LM 3CZFB 5HDWA 1B3OA 4EN3B 1BJ1H 3SGEH 5GRJL 2YD8A 3WQWA 4HOXA 1WGVA 2GW5A 5D1QD 4Z76B 2AJSL 3BPCB 2VDKL 4QY8B 2DKMA 1PZCA 5ANMA 4Q0XH 3MKCA 2CGYA 2X8RA 1GW6A 1WGOA 1RZ8A 4RE3A 3G5XA 5C07E 4HD9A 5DMJB 2WUCH 2CC0A 3VQ2C 3H4XA 1MCBA 3THDA 4OIAA 4HUVA 5J8LA 1OP5H 4O8RA 2VLRD 4ZXBC 3V2AR 1MLBA 2PF8A 4ALDA 3PABA 3VSUA 5TTRA 1ADQA 4PMYA 1QR7A 1DWHM 4P2OA 1RZKL 1NCTA 1DFBL 4PFHA 2Z31B 4UMGA 5D1ZI 3DGCR 2R94A 4DJFA 1JPGA 4CDHA 1TPC1 1F0LA 5DQPA 1FFPB 4Z7UB 1KBVA 5C0IB 2CLEA 5E2TL 2IPTL 4WGWB 4IMGA 4KNTA 1DJHA 3ZDXF 4C91A 3AJXA 2Z93B 1M42A 1DVSA 3WUFA 4V28A 1F56A 5DGRA 2H3XC 3E38A 5HVFB 4DJDA 3EA3A 3OAZH 4HDIA 2PWGA 1KIPB 4XZBA 1MHEA 3UBXA 1QA9A 3BO8A 5IJKA 1SOQA 3U2IA 3CSFA 4JM4H 1R3QA 2I7SA 2Q8AH 3DX6A 4PB0L 1HI6A 1AD4A 1DWJM 4HMCA 4BBWA 3LENA 4PUDA 2VM3A 3AMLA 1FPTL 2P8LA 3SHSA 1JTPA 2WXGA 3JWDL 3ATBA 3E5PA 4BQ9A 5I8CB 1UC4A 2WYTA 4D7BA 4PRID 4QIUA 4AYBA 4M5YL 1TVNA 1K02A 2QKIC 5TQ2L 5JBDA 2PPAA 3JWOL 4M7JL 4WX2A 4OCSH 3WG7B 4E4FA 4XR8C 2IO5A 1GOOA 2FIKB 1XIMA 4JNXA 5EKYA 1BFSA 1TQSA 1VEPA 2IOMA 1A9BA 1U4FA 4ZPVA 1HP5A 5DZAA 1Y8BA 3JUZA 4K2SA 5D7KD 4E41E 2I9UA 3E0WA 3ZDYE 1XF5A 5MEQB 1BQLL 2VENA 4LPCA 1ZLVH 1WZLA 4XNXL 3QJFB 4F0SA 3ANUA 1KIUB 4XNUL 4OF3A 3O6YX 1AANA 4IMLB 4I9WD 1MIML 1DOSA 1NSJA 5HJ3B 3UO1L 5EFIB 3MYOA 2KC0A 3MANA 5IT2L 3G77A 4HSNA 1DQML 5AVUB 4HS8L 5FUOH 4ML9A 5M2FX 2XZCH 5C8JA 4HIJA 1G6RH 3GIPA 4GBUA 3BIKB 3MRGB 4HUMB 1N5YL 5FA3B 3SI9A 3MLVL 1H5VA 4MX7A 3NFNB 3OM3B 4X5RA 4KKXA 4BINA 4MWFB 5EPMA 4YNYA 25C8H 1IGIH 3I6SA 1VGKB 1R19A 3LN9A 3COOA 5CN1A 1IQ8A 4GW1B 3VSQA 1GG1A 4UMBA 1J93A 1RZJH 4AM0Q 1EEYA 3EUUA 2IAMD 2E56A 4OW6A 4LFYA 2X1QA 5FGBA 2E9LA 2IDUA 1K1DA 2FYMA 4TULL 5F9WC 4YIQA 3HE7C 2C3WA 4NUWA 4H26A 1T03H 4UBPC 4JHUA 2OEJA 2D7OA 3HBZA 1EC7A 1VIWA 2BM3A 5J6GB 4F9PC 5INDA 2ZJSH 2G3ZA 5CEWA 3AUJA 4HVXA 2CO2A 5JXAH 2GEQA 5DA4A 2CK2A 1JERA 1WZ1L 3BWWA 4QJ5B 2G2PA 2ICEC 5B3NA 3QXVA 1IIHA 4KHTH 1EHXA 1V6WA 3EJZC 1Z32X 4NJ9H 4J3UA 3KCPB 1RPUA 4PJ7F 4APQA 5B3JF 4LF3B 2IS7A 1CD1A 1NL0H 2H8PA 2X10A 3QJUB 1WBYA 1IXQA 3UJIH 2C9XA 2PDXA 4KK6C 3CSYA 1CT8B 2A4ZA 3VGEA 3FH8A 1JGDB 2WTPA 4HMEA 2MCAA 3SDDB 3LZLA 4PJBF 4ANWA 4Z3FA 4ZX3A 1WDDA 1CLOL 3SPVA 4FMVA 1BFTA 4FEZA 2EPLX 3LERA 3VCRA 1VP5A 5KN5B 1E56A 4O1BA 3KOFA 3NPSB 4YL2A 3G3DA 2SEBA 1FAIL 4JEGB 3RNDA 2CERA 2E77A 4PMOA 3KBPA 1MEHA 4GI4A 1JGVH 4Y4HD 4UB0L 3KTSA 1ECZA 3KBFA 1VC4A 2Y0FA 3P81A 1FNAA 3L4CA 2NQ3A 4PSRA 2VGBA 4LC8A 1D8CA 5GGRY 3NQMA 4NZTL 1EEPA 4JKNA 4B7LA 1T6VN 4ROQA 4JK0D 2L8AA 3QNYB 4I3GA 4GMSL 1UUSA 2FD6H 3E1ZA 2OI9B 5IR1B 2Q7AA 1UP2A 2DL9A 3NGJA 4B9CA 3FU3A 3H3BC 1KJMB 3SQBB 3ZE2B 2EDJA 4DEFA 1UB5B 1UXSA 4KETA 3QDJD 1TZGH 4PM1A 3CX5J 2VDKB 3WD1A 1E8WA 3GQYA 2YFOA 4Z7VE 5F89A 4ZQRA 4HBCH 3WLIA 2QTEA 3POCA 3KS0J 3OKMB 3QV9A 2ICES 1DO5A 3IJHB 4MD0B 1TPH1 1RA0A 3QN3A 2EO9A 2P7TA 3R0KA 3T1FA 5F7YC 2G8ZA 2B0SL 3P02A 3BANA 3BGFB 1UWXK 1INQB 4XWGL 1DL7H 2DZUA 2P5WA 1GTFA 5IROC 1KJVA 2PYEB 2QVHA 1T21B 1L6ZA 3Q5TA 3C6SB 2ERJC 3OHXB 4XVSH 1KW1A 4E0RB 3E0VA 2E7MA 4QRPE 1VHPA 3T0BA 5HDQH 3O0RH 1QTYT 5EUOA 1KGXA 1SGKA 5KYWA 3OSVA 1FNLA 2J56A 2IXVA 2J6VA 3DSFH 5EY5A 5C0CE 1JXKA 4GYBA 1RKRA 1XFPA 4PTTB 2A6IB 3W7DA 2VEFA 4FNRA 1AS6A 4FQ1L 3NL3A 5REQA 4D71A 2VWEE 3QPQC 1AVAA 4OGXH 2AJYH 3M6DA 2VZ3A 5E1IA 1GZPA 4DP0X 2OQJA 3SGZA 3GTTA 3HRZA 4YHOH 2G9KA 5ERWA 4JN7A 2GVGA 4OZ4A 2VXQA 2BS8A 3C4UA 3CH1A 1Z9SA 2Y36H 1Y5VA 4HB7A 3BLLA 4EI5D 1XG4A 3W2MA 4Y1AA 4M48L 5LNWA 2ZG1A 4NZ3A 1QFUH 3FSTA 3E3HA 1OGPA 4XNBA 4E9QA 1COBA 3VOIA 1LK2A 4JFFD 4L4VA 1VCAA 2WXOA 5D1QE 1SHSA 4RFOH 3MO1A 5MENB 2WBKA 4NO3B 2DDQL 5AW5B 1FUYA 4AMKL 3S3BB 3KUMA 1LL6A 4UTJA 4S0SD 2QIWA 4R33A 1ITUA 2HTLD 3MI2A 3CL6A 3ZHKA 3BZ4A 1KPUA 5MEOB 1WNOA 2DQJL 3VC5A 5CEZD 2VLRE 3BW9A 1SMOA 4PTNA 3W02A 4FQPA 4Z95L 1R5WA 1DWGM 3TYBA 4N87A 1EUUA 1CB4A 4XC3H 4UC5A 5LBSA 1XF4B 1VAHA 4MJ6B 1UZ8A 2CLIA 1O7AA 4QNPE 1OT1A 2QVNA 4MJIA 1TJHL 3DRQA 5FUCE 2R4SL 1T22A 4ZMOA 4J35A 2CUIA 4LCUA 2R29L 4EDWL 1TPB1 1NCHA 1QZNA 3CK0H 3OVRA 3MSDA 2QCGA 3R5EA 1AGCB 2JNZA 3WF0A 1NC2D 1DUYB 2DW7A 1F6KA 1YW1A 5FDWA 3MCMA 3F65A 4HHGA 5CQ1A 2HPMA 1LBLA 4Y9CA 2FIRT 1P1MA 4N8VB 5C0FB 4W4NA 4B5TA 4WW2A 3WFEH 2C9PA 4U6XA 3PWUB 3G0SA 5DRZA 2DEXX 4LHQB 4QOKA 3UC2A 4PRIE 3RHWF 4FI6A 2OWXA 5JMUA 3VB9A 2Y07H 5EIIB 3W11D 1SEQH 2ZONA 1PCXA 2PDLA 4MMWA 4MQSB 4O57A 5D1QC 3NL6A 3UTQB 2PDYA 3AYTA 5HBFA 2X0WA 1K8DA 1U33A 4YSOA 4V33A 3K5SA 2WAHA 3DK2A 4HLZH 1HK6A 1Z3GL 1ASPA 4MKTA 3FT0A 1E28B 1QWNA 3N9SA 3M1CA 2YUVA 3C8FA 3OAUL 3DVFA 2FVMA 4H4NA 4ZS7L 3ZM8A 1NH6A 3DGGB 2BNJA 3SQOL 4A2GA 1SMDA 3VCCA 4M02A 4AD0A 3PJLA 5D7KE 2ATKB 3T07A 2OQLA 1FCQA 3LHVA 2C0AA 4RFNC 4MYXA 2Y1HA 4AGQA 2DQCH 4FDWA 4LLDA 4I7ZC 2NW3A 2VZSA 3LS4L 5G2NA 5JW4Q 4D3CH 3W7EA 5C09D 4Q9QH 3ULUD 1LF1A 1B4EA 1LT7A 2FGWH 3MRPB 2Q2EB 1DQWA 4I9WE 1OF6A 1EZWA 5AYUH 1AGBA 4OZGE 4GXPA 5E2WL 4X2UA 2BMBA 2GSEA 2X4PA 2YD0A 3WO3B 3MTWA 1HC1A 1NTDA 3NCWA 3C5SB 3CV1A 1KTJA 3ZKSD 4J4PD 4QT5B 5LO7A 4HLZG 3IVUA 4Z1DA 4PJGB 4LVFA 3NN8B 3A6BL 4LE8A 2FWLB 5GGSY 3FQNA 3MLUL 4V11A 2N7BA 1OK8A 1UZ6F 2VH5L 1PNCA 4KZEL 5GZOD 4U0RB 2NV1A 2HAZA 3B7SA 1ACZA 1DE4A 2Y5SA 1KWGA 3C2EA 4OJFL 4MSWB 43CAB 3MUXA 2J7LA 4ZFZB 5L0QC 3I9GL 3AREA 5IHZB 4UIKL 3GMPA 2XPGB 2NDFA 1PCWA 4UM9B 1TQWA 4L3EA 2QUTA 3LEPA 3FK4A 4GUJA 4X98A 1H7XA 4YHKL 3WHXB 4BFIB 3ELFA 3SE8H 4JFXA 2LAAA 4ZW8A 2BY3A 1CBVL 3P9LA 4PCYA 3GDLA 3G3MA 2FQGA 3IFLL 2C1HA 4HIPA 3D6NA 4XPFL 4IM4A 3EOAB 1SYVB 2NY1B 3BQUD 2QR0A 4IRSD 2PCFA 4OLWH 1U8OB 3QXWA 2AQWA 4G80B 1AO7D 4EBQL 4OLVL 1LP9E 4WGVB 4U1SA 4HJUA 4UT9L 1C12B 1A14H 2ZSVA 4RAVA 2R15A 4F15B 2BW4A 3LQMA 1ZCOA 3KD4A 2CXGA 4XMXA 4NNPH 2AC0A 4TUFA 2EIEA 4XN4A 3K6FA 5BOPA 1G1CA 3MRJA 4KROC 5B39A 1GQIA 3GEFA 5SWSE 2XJ7A 4MDIB 3L5IA 5I66A 5D38A 3O6KL 3BSGA 1PS9A 3B97A 1LO5B 4XE0A 3QFDB 4F2ME 3NZQA 1IEAB 4C1LA 4XPAL 4AIZB 4OJCA 1HKVA 2C79A 4OD1H 3O11B 2VC6A 3K5RA 1T66C 4Y89A 1A6TA 1KKRA 1WT5A 3IDIA 1KPVA 2IAMC 1M7IA 2JF7A 5CEZH 1S5VA 4MFHA 4AMAA 2PN5A 4U28A 3SGDI 2HXAA 1CEOA 3VXNB 1MIEL 3APTA 1HZHH 2J1YA 1G7PA 4JFOB 1PX8A 3NJKA 3VIIA 3ARXA 2QW5A 3TW6A 1BFOB 5B38B 2NY3D 1HSBA 1VYPX 3N1MC 4HHPA 1IBBA 1TQBC 1TZ9A 4R4BB 5A3ID 4HIHB 3GTVA 3BIBX 3BLDA 2VSKB 5JW5A 5AYBA 3QDJE 4Z5RA 2J78A 1OB1B 3RK8A 3L9BA 4RWYH 3B9AA 1C93A 4G7EB 3T9WA 4JB9L 1V05A 4UYPA 1TO3A 4LCWA 4IFOA 1XGPB 3AU1A 3QF0A 3LKPA 5FV1L 1N8OE 1ZRUA 1U3HD 3QMRA 1T5XA 5M03A 3MA7A 1ETZA 2ZKHH 4C54A 4LCCB 1CTOA 5GGTL 3UGUA 4K94C 3O2VH 3SKJH 3MNWA 2ICWA 2BP8B 2ACSA 2XA8L 4YE4H 3HCVA 3GXIA 5FW6A 1V3MA 2QSCL 2GTQA 3MCKA 5CR8A 1WC7B 3FUFA 2HZGA 1N10A 3AUOA 2UY5A 1AIFB 3VILA 4Y4HC 1F3JB 4AQ1B 3QQDB 2A4AA 5MHBA 4MXWH 1XGTB 4AL8C 2HNHA 1KTLA 1MSPA 3H9SD 2JKNA 4IHOA 5CZJA 1W3LA 4E8GA 5ITBL 3KPLB 3L7RA 1BXCA 1E70M 4X5LA 3VFCA 3OVUB 3L21A 4R2GC 4XN8A 3PJTA 8XIAA 5DMIH 4H0IA 1T1YB 1FVEA 2UWEB 3ULUH 4M43L 1BVWA 1OFBA 4AZIA 5HYEA 3UWZA 1RURL 2JBMA 1GAFL 3BP6B 1JDFA 1EQCA 5I2IB 5ICZA 1Z9AA 3IRPX 4R26L 2ADIB 1VFFA 4MCMA 3GZPA 3IIZA 1Y5WA 5I3DA 5G4HC 3N9GL 4P9ML 2BP5M 2BNQD 3LZFL 1DSWA 4DAGL 4J3ZA 4X2RA 3WKNA 3EDEA 4DK5A 3FSAA 2CLZA 3CWGA 4J1UB 4K9EL 1R5VA 3GKFA 2CG9X 5CEZE 1GC1H 2XN2A 4KKNA 4ETQB 2D20A 4O9HH 1IFHH 4P5TC 3KCOA 1H5YA 3CLEH 5CFAA 2PMZA 2DZPA 2JJSC 2DLFL 4ZS6D 1NLDL 5HHQA 3MPGA 4GKNA 3W7PA 3PJNA 1FYHB 3P4LA 2GJNA 1FGNL 4PGZA 5D02A 5D1XD 4BHUI 3PRZA 5DCEA 2ZWKA 2ARJB 3N3TA 4P2YA 2JB6B 4NNYB 5FF7A 2OLDA 4NWUL 4WGKA 2YPIA 2VQ4A 1S5IH 5DJYA 3WQDA 3NRPA 3P82A 3PHQA 1K03A 4HS3B 3KH4A 1LTXA 5AZ0A 3H9YA 1QNOA 4HHLA 2F84A 4Q4OA 3LKRA 4QYAA 3Q3GB 2D03L 1JNHB 2X7VA 1L6GA 1NOUA 4WKZB 3GMNA 1XBXA 4EI5C 2L7EA 2UUDK 2ZFAA 5E99L 2X3CA 2DQHH 2ZXWB 1U3YA 2WWMC 4LIQE 4PY7B 3TONA 4MZ1A 1EEXA 3NZ8A 4WIWA 2JF1A 2C1PB 4XWOD 5K9JH 1T4KA 2CUAA 1YNLL 3L3OC 1LQ0A 1SZNA 4UTKA 1W0VB 4A2FA 1ZGLP 2P46B 1S5NA 1H7NA 4IGBB 3O9WB 3VFPA 3KLSA 2HTLC 1TTCA 3GU2A 1VIZA 1QFPA 1HG3A