5I5RA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
publication title Will be disclosed later
rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
total genus 161
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5i5rA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i5rA01
4JCLA 2OWWA 2QLYA 1JZ2A 1W3KA 2DPEA 1QNQA 1J0ZA 1BGAA 4PMNA 5AYIA 5A8MA 1MW2A 5IHSA 4KGLA 3AS3A 1WE5A 2RGLA 4AIUA 1CXLA 4UQBA 4F9JA 1WDRA 3S2CA 3HU7A 1JGIA 2YFNA 2PBOA 1H1NA 4J28A 3N15A 4PTVA 2W91A 3GZAA 3D4YA 4GZEA 3ZJ7A 1KGXA 4ZE4A 3SCNA 2XYLA 4TVCA 1XSJA 4NZJA 5EFDA 3WDJA 1ZBVA 2XIBA 4CCEA 1NQ6A 5A2CA 3F5JA 1W2VA 5I3DA 5A6BA 3EDKA 1JXJA 2WYSA 3THCA 3OLGA 2VCAA 1W1VA 3A5VA 3RM9A 3M6DA 4PRWA 3BUBA 4AY1A 2EO7A 1V6UA 2VMFA 2EEXA 2W63A 4Y7EA 2VRQA 1R33A 3IAPA 3AZTA 1BVNP 3BLBA 4WKHA 1OT1A 1O7DC 2DSZA 2D3LA 1CZ1A 3WNOA 4C7FA 1E6XM 5HNNA 1JYVA 1QW8A 2CHNA 2VNCA 3A6OA 1V08A 1W9XA 2YLLA 4Z2JA 3D52A 3LX9A 2W66A 4GZJA 3T0BA 3QGVA 2XSBA 3I3EA 3AMCA 1VAHA 2PWEA 2UY3A 4H2CA 3L4WA 2EPNA 1C93A 3MU7A 2WM0A 1PS3A 3OLDA 2CETA 1M01A 4PYSA 1NOWA 1V3IA 2QV4A 1GZJA 1MWOA 3AIVA 4AD5A 1AMYA 1GOQA 1KWGA 1GOWA 5AYBA 1XC6A 4V2XA 3W24A 1CDGA 4CVUA 1PEZA 1PX3A 4PMOA 4YHGA 3EJUA 1UA7A 3VX0A 2YIHA 1E4IA 1LL7A 4ACZB 4Z2HA 1JYWA 3SURA 2ZUSA 1BG9A 1ITXA 1B3VA 3H54A 2VZUA 1WZMA 4PCTA 2PF0A 3EMCA 5FL0A 1WP6A 3CZNA 4C7GA 4F9DA 1W9PA 5A8QA 3SUTA 4BA0A 1JAKA 1SMDA 4K68A 2A3EA 4OGZA 3O9NA 2TAAA 1LQ0A 2JALA 2NT1A 3NDZA 4AIOA 4HZ8A 1JDCA 3DHUA 1B3XA 1X6LA 2A3BA 3WL0A 2YJQA 2CBIA 4J3TA 2VL4A 2JEQA 3H53A 3L4XA 5JBDA 4BZYA 3UG5A 1V02A 3L4UA 2G4FA 3DYMA 2J7DA 1CXKA 4HMDA 3EMZA 1VFMA 1JZ4A 5A8OA 5HBFA 1DEDA 2DT1A 1KBBA 4XV0A 2VZOA 4FNPA 2F7RA 1XV8A 3W0KA 3FAWA 1JZ3A 3SCTA 1KXHA 3CZGA 1PX4A 5DT7A 4UFJA 4PMQA 3F5LA 2X2IA 1BHGA 1BG4A 1W91A 3RJXA 3WUBA 2OYMA 4PN2A 1V03A 4NRRA 7A3HA 2XJ7A 1LL6A 4JFWA 4YHEA 3W29A 2V3EA 5IFPA 3DX3A 2BVDA 4D6GA 3E1F1 3SCSA 4A3HA 1UKQA 3CHFA 1V6XA 2G3JA 1JI2A 4DM1A 3AQUA 4HMEA 3KZSA 1B30A 2VCCA 3PZNA 2X05A 1UR8A 3KLLA 2ZXDA 4J3XA 4AWEA 3OLEA 2DEPA 4GI6A 4W87A 1UWTA 1H11A 3WEZA 2CNCA 1KWKA 4AXNA 2D0GA 2Y5EA 2XM1A 3N04A 4NX0A 3AHTA 5A94A 1MVYA 2OSYA 4NXKA 4B9YA 1ECEA 1OIMA 1G01A 2VOTA 4CD5A 2OW7A 3GH5A 3WNNA 3WMBA 3CTTA 2YKKA 3PZ9A 3CUGA 4GINA 1FH8A 4LQ1A 5CPTA 3WH6A 4CCDA 4J27A 3T2PA 2BY3A 1TQWA 2E8ZA 3MUY1 4ZE5A 3RILA 1XCXA 2DIEA 3FNDA 3VIHA 3NCOA 5CLTA 3VSVA 2PC8A 4MNJA 1MQQA 1HJUA 4CKQA 2BY1A 3PZVA 1WDQA 1WDSA 3WIJA 4CN1A 2WHJA 5E9AA 3AIQA 1EH9A 1EOKA 4CVWA 4MJ2A 1UA3A 1GQIA 5CLWA 5IXEA 5BCAA 2A3HA 2X2YA 1R8LA 3SEPA 5I6SA 3M7SA 2XVGA 1S46A 2WHKA 2WHMA 3QHOA 2ZX5A 5BYWA 1G5AA 2W92A 4M81A 4AD0A 2O9PA 1V0KA 3WQ6A 1J0JA 3VIPA 5HPCA 4QFUA 4B16A 5HDRA 4DO4A 1J0KA 4GIAA 3W37A 2XHYA 3WMCA 4MB5A 3S5ZA 4NZCA 4PBGA 1KGUA 1GOOA 1VEMA 1E1FA 5FD0A 2C8NA 1BYBA 1CECA 1L0PA 2VC9A 2YBUA 3UEQA 1I1XA 3VDBA 3EBVA 2UWFA 4LGXA 2ZUTA 4ZFMA 1GJWA 3F4VA 4U5KA 4RE4A 5KEZA 3M46A 1KB3A 4EANA 2XVKA 1TVPA 1UZ4A 2J62A 5A3HA 4ZXOA 3LPOA 4HOWA 2FHCA 4JKKA 3L2MA 1CXHA 2OLHA 2XFRA 2V3DA 5C8BB 4RE3A 1TE1A 2CXGA 3GBDA 3CZLA 3I3BA 2PBGA 2CEQA 3EDEA 1EO5A 2CYGA 4HP5A 2ZX9A 1GW1A 4OBRA 5D9OA 3U5YA 3SUSA 1W2PA 5IHRA 4WSJA 4BF7A 3I3DA 2VR4A 1FP9A 4JCMA 1KCLA 3DHPA 1OB0A 4GKLA 1GNXA 4W5ZA 4BQ4A 2XSAA 4UFMA 3CZKA 1GHSA 2ALWA 3BCDA 1VBRA 2QMJA 1MW0A 3GM8A 2WMIA 1C90A 2DT0A 1UD4A 4D1JA 3J7HA 1QPKA 1AQ0A 3WF0A 2VX4A 4H8VA 3DDFA 1V02E 4PMRA 2ZXAA 1W1PA 1K9TA 3AIUA 4W8AA 4J7RA 4BS0A 1GOIA 1U33A 2GJPA 2J25A 1HF6A 1OD0A 4GI8A 1Q6FA 2WC3A 1PPIA 1JG9A 3UR8A 4AZCA 1DWIM 2UY5A 1TMQA 1SZNA 2GDVA 4MB3A 4CN6A 4M80A 1VEPA 2V5DA 3FAXA 1CNVA 3CH9A 2IXUA 1NWUA 3VD3A 4EKJA 1EHAA 2J7CA 1WZLA 3BVUA 4KRTA 4YN5A 3BMVA 8A3HA 3IK2A 1VJSA 2Y2WA 3EJTA 1GJUA 1ISVA 4HMCA 5LYRA 2YL9A 3BXWA 2VQUA 2J8FA 3RO8A 1UYQA 1G1YA 1NP2A 2BHYA 2ZUVA 4WIWA 3VD4A 2G41A 3ZJKA 2VX7A 3VDCA 2YOCA 5D9PA 4D6FA 1EQPA 2ZXQA 2FHBA 2GFTA 4MAVA 3ARZA 3WNMA 3WF2A 1EOMA 1IV8A 3OA5A 2UY2A 1JF5A 1CEOA 3T08A 3BUQA 2DH3A 3OGSA 1V3KA 4BCEA 5A1AA 3OZOA 1M04A 1E4LA 3OZPA 3O2LA 4GQQA 3QHNA 1XYZA 2QMKA 4PUDA 1E43A 2EAEA 2RGMA 4HU0A 1V6VA 3POCA 1KTBA 4FNUA 1K9EA 2GDUA 3BC9A 4ATDA 1HKKA 4N0RA 1OINA 2F7QA 4QCFA 1JFHA 1NP0A 2WMKA 5ECUA 3VNZA 1CGYA 3ARXA 1ZBWA 1LG2A 2YDSA 3VIMA 2YDRA 4JAWA 3PHAA 3KL3A 4DWSC 3AYSA 4P8UA 1CPUA 3RJYA 3W82A 5A6AA 4FLSA 3MMDA 2DSWA 2VJXA 2DGAA 1PAMA 1HXKA 1QHZA 3ZQ9A 4JKLA 2A3AA 5BXPA 4TVDA 4TVUA 3WH8A 3A21A 4KGJA 1KTCA 4UQ9A 6CGTA 4JL2A 3ZMRA 3WL1A 4PTXA 5BRQA 2QHAA 3CLWA 4TX8A 2WXDM 1VFOA 3W81A 3GH7A 1A3HA 4P8VA 5A2AA 3PZIA 2WMHA 3WDRA 3CZ8A 4CD6A 2X0HA 3CHEA 4AW7A 4A3YA 1SMAA 3ARYA 1WB0A 5E0CA 1UASA 3BAXA 3LXAA 4QP0A 3WUGA 4M82A 4DUXA 5JUVA 3A24A 3VU2A 1J0IA 1OSEA 2XPKA 1WCGA 4QAWA 2HISA 1ZJBA 4HA3A 4UQEA 2D2OA 1K9DA 4UNIA 3WDPP 1QI5A 1UWSA 1GONA 4MADA 4P8XA 1ISWA 2J8GA 3CZEA 1Q4NX 4S3KA 1CLVA 2GK1A 4HOXA 2NSXA 1KXQA 1TUXA 1E6SM 4CU7A 3CIVA 4KRUA 1D3CA 2PI6A 1QI0A 2EABA 3CZSA 3TTYA 5A2BA 2C7FA 2ZX7A 1B31A 1UWQA 1IZJA 3EYPA 2YFOA 1R86A 2WMGA 2W4XA 1TR1A 3UERA 1MW1A 4D6HA 4MB4A 3VPLA 1C3FA 2WBGA 3FXYA 4M8UA 4D6DA 5ABFB 2AOSA 1GQJA 4YPJA 1V6WA 3WH9A 1VIWA 5EB8A 1QNPA 1KQZA 4AIEA 3IJ9A 1WPCA 2CERA 1E0WA 4RE2A 3APGA 3GXIA 4XB3A 2F8QA 3CHCA 1MQRA 1O6IA 2BY0A 3ZT6A 3NSXA 1XD0A 1HKMA 4JFUA 2WVVA 2W61A 3TTSA 3D5HA 4J3VA 3OIHA 1B0IA 2QF8A 4FK9A 1XSIA 4D6JA 4CU8A 1R85A 1JFXA 3OBAA 3WDHA 1D7FA 3QHMA 1AVAA 3SCRA 4DWSD 3BVXA 4P7QA 3WEOA 4AD2A 4NSBA 2OW6A 3VINA 3M07A 2DIJA 2VZSA 4UR9A 1B9ZA 3WQWA 3TA9A 4Z2LA 1C91A 1UR2A 2WMJA 3PZGA 1BSIA 3BUPA 1VF8A 4AYGA 3CUIA 1H09A 3ZT7A 2X1IA 1JD7A 1UD2A 2XFFA 2GJXB 3A3HA 1T0OA 3D51A 1B1YA 1E15A 1BYAA 2ZX8A 2J78A 2BVTA 3DX0A 1UH4A 5M03A 4XX6A 4R5EA 9CGTA 3AXIA 1WNOA 3FN9A 2E9BA 4CU6A 3S5YA 2XVLA 1EQCA 1UR9A 4IPNB 3VNYA 1KXVA 2DH2A 4FNTA 4IPLA 1TQTA 2WWCA 5CXPA 2ZOXA 4PMYA 3N17A 3WY2A 1C7TA 5D9MA 1UH3A 3WEMA 2J4GA 2VI0A 4UQDA 3AISA 5A6LA 1HN1A 3VD5A 2VRJA 3CO4A 1QNSA 1WZKA 3K1DA 1FFQA 3T09A 2WZEA 2GJRA 2XM2A 4H7VA 3BVTA 3VM7A 4P7LA 4FNSA 3FHQA 1GPFA 3RCNA 4F79A 1SYTA 1HJWA 1HVQA 3N13A 3WKZA 2VRKA 1GUVA 1UWRA 4DUWA 2YBTA 4KH2A 1H3GA 3CMJA 1QWUA 4PTWA 3VGHA 1IZKA 3WD3A 3GBEA 2ESCA 1JXKA 1FH7A 1CXEA 3RDKA 3D50A 1V3LA 1EHNA 3BMWA 3L4TA 1W9UA 1JDAA 3ZM8A 1YQ2A 2YL5A 3LRMA 5I77A 5D8ZA 5CGTA 3WQ8A 5DF0A 1TQVA 2D0HA 4JKMA 3TTOA 2PWGA 2FH8A 1HL9A 1OT2A 3EJQA 3LXBA 3DC0A 1EXPA 3OG2A 1E0XA 1R34A 4B3KA 2ZE0A 3KE0A 2XN1A 4JFTA 1J0HA 3EDJA 1UWUA 2XN2A 3MUIA 4HTYA 3DDGA 1PZ3A 5LA0A 3WH5A 3IJ7A 5CZKA 4MNMA 1R46A 1JZ5A 1DTUA 1GOMA 3SIMA 2CHOA 3HN3A 4PMUA 1CGTA 3W6MA 2JE8A 1X1NA 2XVPA 1US2A 5GPRA 3FW6A 5D9NA 4QCEA 3JUGA 1C8XA 1FOBA 1J0YA 2C0HA 1E0VA 1Q6DA 3AI0A 2X2HA 1JIBA 1TQUA 4MB1A 3AIRA 3WNLA 4E8CA 3NYDA 1OCQA 4UTFA 2BS9A 2G8ZA 3CPUA 5GNZA 3S6TA 3L4VA 3PBGA 2WBKA 3OB8A 4NRSA 4GO8A 5C70A 4AZBA 2Z1KA 3DX2A 3WDIA 3WENA 4MNKA 3B9DA 3RM8A 3UG4A 4H04A 1MXGA 1EA9C 4TUFA 2WANA 5LA1A 3EDFA 4H41A 2FHFA 1HNYA 3WSUA 3CUJA 4L4OA 5EMYA 1RP9A 1ZBCA 2WK2A 2J77A 3MSDA 3MKKA 3GH4A 5FOOA 5CSYA 4AISA 1JDDA 2FE0A 4MAZA 8CGTA 2J7FA 1MW3A 1MFVA 2BXYA 1PIFA 2F1BA 3LMYA 3HG2A 2D23A 1MQPA 5FKYA 3KL5A 2D20A 4HA1A 1B3YA 3W25A 3T0DA 1H49A 2JIWA 4PTMA 4CD4A 2EJ1A 4Q22A 3ARQA 3LPFA 4Z2GA 4AC1X 2OSXA 2ZUNA 1R47A 5C71A 3AYRA 1ODZA 4CN4A 1E3ZA 2YL8A 1UWIA 1E55A 1EDGA 3WFZA 1E4NA 1W1YA 5ABGA 3AHYA 3PZUA 3ALGA 1UR4A 3GNPA 3LPGA 1XH0A 4ACZA 1DWAM 5HPOA 5A6SA 1E6RA 2O9RA 4CD8A 1ISXA 1RD6A 1PX8A 1CYGA 4CUCA 4QLLA 4D6IA 1E6PA 4HU8A 3PTQA 1MXDA 3VIKA 1CIUA 2GK1B 4TTGA 2PB1A 3SUUA 3KL0A 4AZGA 2DT3A 1QBBA 2ZUUA 3VGEA 4ATLA 3ZSSA 1YHTA 1QNRA 3CMGA 4MJ4A 1XD1A 2FH6A 3QOKA 2CBUA 2WCGA 1VFFA 4KMQA 1XH1A 1HVXA 3VIJA 3PZQA 4W7UA 4OKDA 1H2JA 2CPUA 2DT2A 3HJEA 2VT0A 4EAMA 3CGTA 3ARPA 1JZ7A 4F66A 3CBWA 4UFIA 4GXPA 3VO0A 1N82A 4QLKA 3SCOA 2PWDA 4OIFA 5BXSA 2ZUWA 3PTKA 4GQRA 1HWWA 2XVNA 1UD5A 3K46A 1IT0A 2E9LA 3CHDA 2CKSA 5F7UA 1HP5A 4F8XA 2J75A 2CKRA 3CV5A 1HJXA 1DHKA 1QW9A 3N18A 1CENA 1UD6A 3WNKA 5LA2A 1AQMA 4DWSA 3VIIA 1H5VA 1DWHM 3MUAA 3II1A 3W53A 3VIOA 2F1AA 2YL6A 1ITCA 2GUYA 4JHZA 4EE9A 3EJSA 4D72A 1BLIA 3QR3A 3NJ3A 1BTCA 2YA2A 2V3GA 3VTRA 2V3FA 3DX4A 2WMFA 4HPHA 1EDTA 1Z32X 1RPKA 4GI9A 1DWJM 5JIWA 2DSVA 4D71A 5CG0A 3WQ5A 3VSTA 2FDMA 4HZ6A 3A23A 1GVIA 4AEEA 2JIEA 1QX1A 1G9HA 4LXFA 3N11A 2EADA 5E0FA 1BYDA 3GXMA 3MI6A 2EXOA 4JFVA 3WD1A 2BHZA 4WF7A 1E56A 4OOUA 2XWDA 2WAGA 2VX6A 2QPUA 4AZIA 5I78A 5I5RA 1EDQA 2WWDA 5E6ZA 4U2ZA 5M3WA 3G6LA 3NUKA 4V28A 3WF1A 4E4PA 3BSGA 2XGBA 3K4AA 2VVSA 3VMNA 2WLZA 3TV8A 5I0DA 1W3JA 1JYXA 1HT6A 4HA4A 4V27A 4W89A 3EMQA 2BHUA 1US3A 2BY2A 3WELA 1NWSA 2F7PA 1AQHA 4C7DA 4B3LA 2WC7A 5CGMA 1UG6A 4UCFA 4W7VA 3WF3A 3BGAA 3MO4A 1D2KA 5BROA 1TVNA 4AZ7A 4FLOA 2IUZA 3UCQA 3ZOAA 4PSPA 4W8BA 4OOZA 4AD1A 1J9YA 3BSHA 4LYRA 5FL1A 3VMOA 2J7HA 5E1QA 3K8LA 4UQAA 5A69A 1W3LA 3ZJ8A 1QBAA 3U57A 2WVSA 2V38A 3WY3A 1NM9A 3HG4A 3WY4A 1W1TA 4DUVA 1P6WA 3F5KA 4EK7A 2E0PA 2F18A 4W84A 1QHOA 2DSUA 3WH7A 4UZUA 1H41A 3AMDA 5M17A 1E6NA 2X2JA 1KBKA 2VQTA 3NDYA 3VIFA 1PZ2A 3GTNA 2Y4SA 5DT5A 4PSRA 2WW5A 1QWNA 1LWHA 3AS0A 1UR1A 1F4AA 3SUVA 3GXDA 4X9YA 3TONA 1UD8A 4LYPA 2PWHA 5I24A 1NARA 5A95A 2EPOA 3GNRA 3WMSA 1JD9A 1FHLA 3L2LA 1BGGA 3WF4A 3NSNA 1ODUA 2D24A 1SR0A 3T2QA 5I23A 4R27A 2UY4A 2XN0A 3BAJA 3AZRA 4AZHA 3B8SA 1PJ9A 2AAAA 5EFFA 4B9ZA 4PMDA 2OYLA 3PN8A 1WAWA 2DSKA 1R87A 1BFNA 3BLKA 2YLAA 4MDPA 3U7BA 3EDDA 1NWTA 1UUQA 3VGDA 1R7OA 1UHVA 3N9KA 1ESWA 3RMEA 3BH4A 4PCSA 1J18A 2DQXA 1FHDA 1C8QA 1KR0A 2O9OA 4WJXA 3LXCA 3BAYA 3AIBA 5GNXA 5A6KA 5KZ6A 3GXNA 5A6MA 3K8KA 2ZX6A 2V5CA 4CGTA 2WSKA 2BXZA 1JZ6A 3KEHA 3OGVA 4AZ5A 1E1EA 4E8DA 1W9BM 5I79A 3T2OA 5HOSA 4J3SA 3ARTA 1XCWA 2E8YA 3BLPX 3AS1A 3OLIA 2CCRA 3VUPA 1V6YA 3LPPA 1CGWA 2BNJA 1GORA 4IUGA 1CGVA 2VTFA 4U3CA 4CCCA 3VVGA 4X0NA 1VB9A 1C8YA 3UESA 4U3AA 2Y8VA 2VX5A 3VX1A 2OWXA 3A4XA 1E71M 2VZTA 1CWYA 1L8NA 4MTVA 1HJVA 1X6NA 3MANA 2CIPA 2WVUA 2BFGA 2EPMX 4M24A 2WZHA 3QOMA 3NSMA 1GCYA 6A3HA 3UR7A 3A4AA 2ZUMA 3WUFA 2ZXBA 1CGXA 4WSKA 4W5UA 4BQ3A 1LWJA 1WO2A 2WCSA 4RL3A 2FGLA 2XIIA 4UOJA 1LLOA 1JZ8A 3RIKA 1DWGM 2J7GA 3MV01 2VVNA 4AMCA 1Q6EA 2VCBA 3CUFA 4W85A 3VKKA 3WBEA 1VENA 2BV9A 4JHOA 4PMZA 3WFLA 3BUIA 5D4YA 7CGTA 2YDQA 2XWEA 4UOZA 4E2OA 1UQYA 2O9TA 1HJQA 2VURA 3ECQA 4TXEA 4AMWA 4M29A 5M5DA 3LRKA 4J3WA 2X09A 3AICA 4MPKA 3ZT5A 1NH6A 4W8LA 2HVMA 2XTKA 4TOQA 1OGBA 1UOKA 5HXMA 3CZJA 4TTUA 4BQ2A 3PZMA 2Z1SA 2E9MA 1ISZA 3MMWA 1G94A 1H0GA 1TA3A 2JEPA 1Q6CA 3PTMA 4FF5A 1E6ZA 2W5FA 1V3JA 3HG3A 2X0YA 1VBUA 1GOKA 2AMGA 1CXIA 5ABEA 3BAKA 1HTYA 1RP8A 3CC1A 3ARUA 5AY7A 3B9AA 2J47A 3W6LA 2WMIB 1A47A 3HMCA 3SUWA 4AD4A 4Z2KA 1JNEA 1UD3A 1ZBKA 3VILA 1OD8A 3GNOA 1QI4A 3BAIA 4HOZA 1K9FA 4ATWA 2WSPA 2WCAA 3ARWA 1EGZA 3OGRA 2WNWA 2OYKA 3AJ7A 3AIEA 1O7AA 5A8NA 3WNPA 1HKIA 4AZCB 1VJZA 3D4ZA 3BUDA 3ARVA 4IM4A 1TZ7A 4XZBA 2JF6A 5FIPA 4W86A 4Z2IA 3GXFA 3AOFA 4HZ7A 3ALFA 3EJPA 4DWSB 2JFEX 4S3JA 1UR0A 2MANA 1OIFA 1PBGA 4Q7NA 4UZSA 1UKOA 1ZB5A 2EACA 1VEOA 4XZWA 3IJ8A 1KR1A 1R7AA 2VR5A 4WLCA 3ZSTA 1QI3A 4P7RA 3W26A 1LG1A 4DO6A 1LJYA 3W4RA 1DP0A 4W7WA 3ZR6A 2FGZA 1E9LA 3ARSA 2J7BA 2QPSA 4JIEA 1OBAA 1E4MM 4WKFA 3VDHA 4M1RA 5DEZA 1FFRA 5AC5A 1W3HA 3BVWA 5GQBA 1U2YA 1HXJA 1J12A 1G0CA 2CBJA 3AMLA 2WKLA 1HP4A 1XRVA 3VSUA 4JL1A 3AMKA 1E5NA 5ABFA 1NOFA 3WD0A 4U33A 3WDQA 1F4HA 5BRPA 2ZWZA 2PWFA 1TQSA 3TTQA 2XFYA 1MYRA 3GXTA 3DECA 3MUZ1 3PZOA 1E70M 1XYFA 4MDOA 3FHAA 1CXFA 2ZIDA 4FMVA 1KQYA 1V3HA 4TX6A 4LX4A 2D0FA 5CSUA 4U31A 4CD7A 1OGGA 4WK9A 5A6BD 1QVBA 1WZAA 2G3NA 3CUHA 3O6AA 5GNYA 1QNOA 4X0VA 4JFSA 1HIZA 1UKTA 5DFAA 4D6EA 3AFBA 1KGWA 2FYVA 2WPGA 3VDAA 2E4TA 1FP8A 1TG7A 2BVYA 1ZS2A 2F2HA 1HKJA 2J74A 1RH9A 1KFWA 3AHZA 3DX1A 1BVZA 3AMGA 4PMXA 4LPCA 4D1IA 3DYOA 1HX0A 5E09A 4XUYA 4W88A 1TFVA 1W9DM 4URIA 2GJXA 3MS8A 3SCPA 5JBFA 2YA0A 1V0NA 4LYQA 1WDPA 4A4AA 1OM0A 4DO5A 5CPQA 3W27A 4QLJA 1EO7A 1BQCA 3VGFA 4ZEPA 1DWFM 1E40A 4NF7A 2VUYA 1LF1A 2W67A 1K6AA 1QI2A 1JYNA 1C7SA 1NWRA 5I2UA 1VFUA 3BVVA 2D73A 4UFLA 3ZR5A 1JL8A 3W38A 3G6MA 1GQLA 1M03A 2W62A 3IGUA 3NIYA 4D6CA 3DYPA 3ZJ6A 5DMYA 1BF2A 4AMXA 2D1ZA 2OWCA 1J11A 1XHGA 3AHXA 3W28A 4FNQA 1E3XA 5AC4A 3HZ3A 1M7XA 3FY1A 3U5UA 4N42A 2WKGA 3POHA 1UKSA 3UG3A 3A4WA 3SCUA 4B15A 3TOPA 2Y24A 4U2YA 4WKAA 2GVYA 4J3UA 4L4PA 1E73M 3GDBA 3VD7A 1PIGA 2G3MA 1B3WA 4OZOA 2J7EA 3IANA 3T0AA 3AROA 4OBSA 3UETA 4DM2A 2NT0A 3EJRA 1FA2A 3SCVA 3WD2A 2WC4A 2IGTA 4AD3A 1GVYA 3WBAA 4P7OA 2X8RA 4JZ5A 1Y7VA 3MV11 5JIPA 1ZJAA 1OWQA 3K8MA 3WD4A 1W32A 1NOUA 1XGZA 3VGBA 2F7OA 2WVVB 4M56A 1XSKA 2B31A 4U5IA 3N12A 3KWXA 2EPLX 5IDIA 3LRLA 5CQ1A 2XUCA 4GPNA 1OGSA 1E6QM 2E40A 1UQZA 4OJYA 5EBAA 4UOQA 4IISA 4GO9A 5A6JA 3MMUA 1Q6GA 4UQCA 3H55A 1M53A 3B9EA 1JI1A 2EBNA 4FLRA 5BXTA 4ACYA 1CLXA 1H4PA 2EPKX 5A8PA 5CJ5A 1QHPA 4AYSA 3AHVA 6TAAA 2CESA 1V3MA 4FLQA 1GHRA 2A3CA 2YA1A 1KXTA 1J01A 1EIBA 1VRXA 7TAAA 1HL8A 2WLYA 1UH2A 1J10A 1MFUA 1WKYA 4AZ6A 2IXVA 5BXRA 1JF6A 1R75A 2ZICA 4PEEA 3THDA 2XG9A 3VMPA 3VOCA 5ABHA 4H8HA 3PZTA 1B2YA 2GSJA 2XGIA 2VO5A 3ZIZA 4H8UA 4PMVA 4MNLA 3MSGA 1TCMA 3A22A 3K4DA 2E3ZA 4BQ5A 4P8WA 1JAEA 1E5JA 3SCWA 3WY1A 2DDXA 1JNDA 4ZXLA 1ZU8A 2F61A 1U30A 3ARRA 3GYCA 3TP4A 1B3ZA 2VZVA 2D22A 4ZENA 5E70A 1TA3B 5DO8A 3WQ4A 3BCFA 3D3AA 5JBEA 1CTNA 4P7NA 4NXSA 5TD4A 4AEFA 1XH2A 2G3IA 1B90A 3AXHA 1ZL1A 4W93A 4NZFA 3HG5A 5CPSA 3RPMA 2Q8XA 3L4YA 3IAQA 4ML4A 3RM4A 1CBGA 1HJSA 4NI3A 2J79A 1BAGA 4QDMA 3VD9A 2CBVA 1I75A 3BAWA 2WB5A 3A47A 5FCZA 2NW0A 3VM5A 3GXPA 1LL4A 3N1AA 3AZSA 2ZWYA 2OSWA 1V0LA 5E6YA 2WZIA 5D8WA 2WVTA 1C92A 2Y8KA 4PUEA 1BPLB 1ISYA 4FNRA 3WUEA 3KLKA 3L4ZA 3ZO9A 1E72M 4HPGA 1FH9A 1GQKA 3WN6A 4UFHA 1BYCA 3WQVA 4OUEA 1H0IA 2D3NA 1UZ1A 3AS2A 4GZIA 1KCKA 3VGGA 2EQDA 5BWFA 4KWUA 3SCQA 1QOXA 1UKPA 3U7VA 5IFTA 1V0MA 1W9VA 3AXXA 1CGUA 1I1WA 2WHLA 1SFSA 2CITA 2JF7A 4UFKA 3AIWA 2O92A 3VIGA
chains in the Genus database with same CATH superfamily
4HD9A 4JFZL 4PLKC 4OTXH 5D6DC 2VDRB 3AGWA 2FFIA 4YGVB 2FIKB 3RPDA 3CFMA 1V93A 7PCYA 2XTLA 2C26A 4IT1A 5GGRB 4MZ2A 3ABQA 2VKWA 2XTJB 2EYRB 3NA9H 3MGTB 4CEXC 3GZAA 4OLYL 2XDHA 2NZ9D 2VJ8A 3T6WA 4I8YA 3F7RA 3L3JA 3LQLA 4OM0H 1TVDA 5MERB 1MQKL 4CCEA 5AWNL 2EXSA 1NWPA 4WI9A 5J6GA 2J1KA 3NA4A 3PP4H 4YS4A 4UTBL 4F24A 4MG4A 3LV3A 4AMKH 4Y19D 2APSA 5I82A 4BZ2L 1CMOA 2C3VB 3D0VA 4LSBA 3BGFC 2YARA 4F15B 3GSWB 3R0NA 5K9QI 3S46A 2J7LA 1CT8B 1U8QB 4UXDA 2YLLA 2W66A 4PE8A 2Z31C 3TJEH 4EI6B 4XAFA 2JLLA 1M01A 4PYSA 4QEGA 1GOQA 3MHGA 4M3JA 2CLEA 3D3VB 1M6OB 2IH1A 2YIHA 2F5AL 4A3UA 3ZGIA 3DI0A 2AHIA 2BTMA 3RA7L 3QFGA 4A2HA 3T3MB 1JV5A 2PDJA 2OXHA 1RUQH 3CZNA 4F9DA 3MUXA 1W9PA 5FLUA 1FRGH 2MKWA 1T2XA 2H26B 1DBTA 4R4FH 2ZOLB 1CDCA 4FZEL 4XVTL 3MV9D 5I1KL 1S7VA 4RDYA 1ORSB 1I2QA 3SDXF 3O2VL 5JBDA 4DTGL 3EOOA 1QSEA 2J7DA 3OP2A 4K4KA 5AAWA 1F3RB 5LNEA 4YCOA 1FYTE 1KFEA 3NZSA 1IEVA 2Y6TE 3F5LA 1EHKB 1BHGA 4G43B 3ULAB 3ZTDC 4ETYA 3LDBC 2PDCA 1R3HB 2OX4A 4CNNA 4QAMB 1XEUA 4U0QB 1QO2A 2F5BH 3LUTA 4QAIA 1WKFA 1KXVC 5SWUA 5DHYA 4Z7VF 3CHFA 1W1ZA 4J3XA 1J88A 3W84A 1U8HB 1KKOA 5BJTA 2FJGB 5F0LB 2VQ1A 3E0VA 1G01A 3R10A 4EDWL 4I9AA 4RV3A 3T9PA 4D9LL 1M3UA 3PZ9A 5CPTA 2C3GA 3NSJA 5GGSA 2J6XA 2B39A 1KBLA 1IGYB 2Z6FA 1WBZB 2YSTA 2PC8A 3DK0A 1TVBA 3CIXA 1Q9LB 4IL0A 5B3SB 2NNFA 1R8LA 1OWWA 3AVEA 1TKWA 3WN5B 3JWNE 1WWBX 4B0MM 3NG3A 3WQ6A 4UUJB 3N3TA 4QFUA 3LLDA 1FWWA 3WMCA 4MB5A 2IGLA 5DLML 1D5XA 1VEMA 2EP6A 4E2VA 2OQLA 5F4WA 4F1SA 4JRXD 5KEZA 2JJTA 4HPOH 1O66A 1BG1A 2RJMA 5C8BB 3VYLA 4H7CA 3PHQA 2PBGA 3UTQA 1ZVHA 2AW2A 4OQTA 4ERSL 5GRVK 1FUYA 4YDKL 2QKFA 3V0UA 2WAQA 4JVWA 2NZ1A 1INQB 3QORC 1ILUA 2XZ9A 1N0LB 1KJVB 5E4IA 4ODHL 2IDQA 1AQ0A 2VDOH 5AVHA 3HEIB 5F1KC 4PMRA 1F3DJ 2IQ9L 1I31A 1K9TA 1TV2A 1ZLVK 5I30L 3CEPA 1BMZA 3QJVB 3M0YA 3QIWB 1OF2B 3W9DB 4N0FA 2ADJB 4PRPD 3EKZA 1MZHA 4N8PA 6FABL 4M1CD 2V5DA 4IMEA 4DKAA 3QH3A 5I06A 2P24B 4EKJA 5GS0D 4ZSTA 3FKKA 3MRNA 5ICXA 8A3HA 4LAUA 3ZDZF 2O5ZH 5FOJA 4O8AA 1UYQA 4RRPG 3U7WL 3DO7A 6ALDA 4N6RB 4O5LL 4Q7BA 4JN2A 3V0EA 2PW1A 5HHXL 4WNQA 3EHBC 3A4DA 3LNEA 1F2XK 2JGQA 2FECL 1EOMA 3DHMA 1I8KB 2BB0A 2A9MH 1R9FA 3LHPH 5BOJA 5KSVA 3OZPA 2PRMA 4KKXA 3CN4A 4DXVA 2PF6A 3CPGA 3RU8L 2C1PB 4AUBA 5EFIB 4JO1H 3VNZA 2WGXA 2YXFA 1FWSA 1S2VA 4P5KB 3HMJG 1BOGB 5CINH 4BFNA 3FFOA 2ED6A 1MCHA 2ZXEB 1CPUA 1J86A 2XWZA 1RZ7H 1N4XH 1X3DA 5B3JE 6PCYA 2FVLA 1WZ1L 5IHWA 3IBEA 4A2FA 5AYQA 3RQ3A 5L7XL 1YHPA 4QRFA 3UNDA 5TDPA 1FZMA 4UDTB 4PHXA 3I9GL 1LP9F 3IBOA 5H94B 3LXAA 4QY8B 1Z3RA 4DUXA 1ZGLP 1T1YB 3W1UA 1CTMA 2YGQA 3IDYC 1YPZA 3SQLA 4KDVA 5CLZA 3ME0B 1EYWA 3QBTB 3KBHE 4JB9H 2B0SH 2QQKH 1ECQA 3US9A 5BRZA 2X4QB 2X88A 4ZB0A 1SVBA 1XP3A 2WSYA 2EABA 1M3IA 5BW7A 1F90H 4BDVB 4PJ5D 2AZAA 1G7LB 4BZ1A 1AJ2A 1KCRH 4QISA 4IRJC 4AM0B 2C1IA 1D2PA 1QD0A 4W9ZA 1FH5H 3IJ9A 1WPCA 4RE2A 3BN9C 5K4ZA 5IOPA 3PJXA 2H5UA 1MQRA 3PWNA 5DO2D 1IXQA 2X89A 3P5YA 5D2VA 3OKEB 1PTGA 5DEFB 4JUSA 4JM2B 3OBAA 3DXAE 2RHEA 1U8CB 4XE5B 3DBSA 5GJTH 3BVXA 4LY4A 2ZWKA 1X9RA 5EMJA 5IMMB 4EDXB 1Y5XA 4XTRD 3IIXA 3RRAA 2WN3A 3ZIYA 2IPFA 4LVDA 3BUPA 5IHLB 4TV3A 4FHAA 1YY9C 3SE4C 3KVLA 3VXTA 3U30B 4FXGC 4WUUB 4P2QB 2NLJA 2OTDA 3S47A 3DO4A 4NJAH 5AECA 3O8XC 1R3LB 2RJGA 3DOIA 3XINA 2UVEA 3OVUB 3DX8B 2ZKMX 3MVTA 1IC4L 3SQBB 4BGLA 3GW0A 4JDEA 3SDDB 4XVUD 4BHYA 3U79A 4O11A 3UDWA 1FA4A 3SJVE 2J4GA 4AKPA 4RZ5A 3ALWA 2I7OA 1TCRA 5KVMC 1GPFA 2RMNA 4ZX3A 3N13A 4OGYH 1W5MA 4PTWA 3QVAA 1K77A 3W83A 4B9PA 1V3LA 3H0TA 5I9QB 4FS0A 4NX5A 1BJMA 3MOBL 3VFNA 2P80D 3HUJB 1NDMB 4FYSA 1OFRA 2W0UA 2FH8A 1NUNB 5BOPA 1X4YA 4J8RA 1TSHA 1AAJA 4OZGA 4XVJH 3T4AB 3LS4H 1I1AA 2XXFA 5C0DB 3Q4DA 1ND0A 5I74C 5GRWA 3AI0A 3FB5B 2BGNE 4H8QA 8TIMA 5E9XA 3D0LA 2BWGA 3VWJA 3S2NA 3BUYB 5F1NB 1DJZA 2XDFA 5I75C 3OKKA 3MUUA 1W5PA 3DIVA 4FQPA 2FPYA 3KBEA 2XUWA 2NY3B 4I5RA 1YDOA 5PTDA 4MNKA 1B2WL 1J1OH 1U8IB 2HKHH 3ETSA 2WM1A 4M7JL 4TQ8A 3WL9B 3P73B 5EMYA 4LCIH 2FFCA 5LBSL 1MWAH 2JXMA 1TJGL 1P7BA 4MS8C 3MKKA 1FZOB 5FOOA 5HYSB 5IB4A 4NYUA 1MLBA 3C8KA 1MCFA 5KJRL 4QRUB 3SN1A 1SY6L 5HMSA 2WB1A 4HCGA 2CO7A 2FKPA 3ARQA 4Q6IA 4Z2GA 3TEXA 4JFEA 1BTMA 4XCFH 3RL1A 4JTIA 3BV4A 3HNSL 3W11C 3VTTA 3CHVA 4G6AD 4NQDA 5HVGB 3OJ2C 4OUOA 1RFDL 3RFZC 5A6SA 1UG9A 4MHHG 1QFPA 4OLVL 2R1XB 2IFFL 4KRPC 3NJVA 3LZRA 4KV5F 4WFEE 2OMYB 4TLUA 3VGEA 4WO0A 2DQMA 4KQ0A 2A6KB 3TEUA 3BN3B 3ET9F 4OKDA 3MZNA 3KJ6H 4YC2B 5BO1L 4EIZC 2CPUA 3NCMA 2OPJA 3CGTA 3O9WB 2QSVA 4AIBA 5I8OL 1F6AA 2PWDA 4Z0XB 1RD5A 5DHDA 2AMUA 5H8MA 1DHKA 4LLVB 4TQEL 4OCWL 1EGVA 3LH8A 3CFEA 5JUEH 5FAJA 3DHFA 4I0CC 1RQBA 4Y9EA 3EJSA 1JNNL 1V8HA 4BK5C 3H7BB 4WI0B 4HPHA 5C0AE 3FOMA 1DWJM 2EINB 3A3YB 1MLCA 4AEEA 3KDNA 1JPKA 3FYOA 4UT9H 1C08B 3JVFC 4YSQA 1I3GH 5EEWA 3UPRA 1XIMA 3RG6A 1P43A 3JS3A 3JV6B 5I07A 4P61A 3WKPA 1IKOP 3BSGA 4UT7L 5TGBB 4P46D 2P5EE 4S1SH 1JGLH 4HUUB 3HPXA 2Y6SD 4DLFA 4BWLC 2R9HD 1JRBA 3KGRA 4FLOA 4KWVA 4OOZA 1KRAC 3MLUL 3BPOB 4UOW1 4MKSA 1T22B 5IESL 1FDZA 2R59A 1W1B1 3FCGA 2VN4A 5BU9A 1T2QH 3F5KA 3TN0B 4HNLA 4YVPA 3AMDA 1XMEB 4LQFH 1KFAH 2WW5A 3BT2L 5EU4A 2YPVL 4N24A 4FXLA 1EO8L 3EEGA 3ATFA 4F0HA 2BIPA 3TCLA 2EIBA 3CU2A 1XGRB 2DKMA 3MP5A 4TO8A 4AZHA 4HPYH 2AS5M 4K3GA 2WLHA 5JA9A 5T5FA 3Q58A 2OMZB 3OZLA 1S7SB 3ZRFC 3FGCA 3GINA 3RMEA 3SR7A 3BH4A 3NFPA 3ECWA 4R9XA 1KC7A 5FYLE 2HJKA 2Q8BL 1FFNB 4WY0A 5B1JC 4X6EB 1C1EH 2EDTA 3MCYA 3U1SH 5CC3A 1FBAA 2ZZ5A 1CGWA 1BEYL 4W9EC 1L6SA 1QT1A 3UESA 5IBXA 1OE1A 4JTAA 4ZUTA 3KPTA 4NPKA 1ORQB 2OK0L 1S9WA 4BQ9A 2B15A 4XMUA 1NMAH 4JIIX 2ZQ0A 1I9RH 4ZFQA 2XWJB 3V5KB 1TVHA 5SWSA 1Z9OA 2PR4L 4RDQG 2OZ3A 3HQPA 3BUIA 5IJCC 7CGTA 4KW2A 2YDQA 4HUVB 4MXVE 4UOZA 3DETC 1QFWI 2VURA 4AMWA 2OKTA 3QQ3B 1LEKB 3WV0A 2C13A 4ROPA 3CTLA 2ZRVA 1WAAA 2HLFD 2VLJD 4TNVF 4BI6A 3H3KA 3LBMA 3O4OB 3T0EA 3EZ8A 3N06B 3TJHC 3PZMA 5DJXA 2BIQA 1NMCC 3H7LA 4BV1A 1F58L 2R0ZH 2FNBA 2DIAA 1V3JA 1GGCH 3IDJA 3N14A 1XLHA 3CC1A 5C5YA 1I7TA 2O6EA 3GNML 1IMHC 4B2DD 3B8IA 4GJ1A 4OZ4A 1MAJA 1SQ2N 4A6YL 1BXNA 3O0RH 4KFPA 4N90D 4IGBC 5HHOB 1A4BA 3NJGA 2A2IA 5A8NA 1DQIA 5MEPB 1JUKA 1IGFH 2D7QA 1YXCA 3M0MA 2B2XL 1X4XA 1JPIA 2JF6A 2ZVRA 5JORB 4RLDA 4IX0A 3GXFA 3N2TA 1UMLA 2YAOA 2POZA 1KENH 2DUAA 2BNUA 1BVWA 5FO8A 3L81A 1UKOA 4GG8B 4I18A 3PUUA 3ROLA 1FAIH 1R3SA 4RX4A 3NCCB 4AL8L 4QRPB 3TCSA 4XXCC 3OKDB 4WUIA 1HSBB 3P0YH 5IB3B 1S5IL 1MRFH 2GCYB 3D2TA 2VIRB 1GTHA 1E4MM 3LK6A 3B2DC 4U7MA 3G6DL 2C1OA 1S7QB 1YEIH 1Q2RA 1ZALA 1J4EA 3TZVA 3U36A 2FLRT 1JWMB 4LBEB 1T5AA 5I1LA 4BWWA 1RZKC 4G7YL 4KNSA 2DQDH 4KX9A 2YPLE 1XYFA 5H8PA 1V3HA 4XCNB 3TE9A 2IFGA 4U6HA 5AW6B 3LKOB 3E0WA 3GNXA 4AHPA 3EADA 1EZVX 1FC2D 1UC5A 1X5AA 2WPGA 2FLIA 2Z4GA 3GW3A 3AADB 3PJWA 3FQRA 2EH7H 2A7PA 5ICZA 4ONGL 1WDPA 4DO5A 2WO3B 3MLTA 4LCWA 4UFLA 5AL8A 2R15A 1MFDL 1MNZA 5LNGA 4C6JA 4JQ2A 4D9QE 1FHNA 4GG9A 3DK2A 3QC6X 1W0WA 2W65B 3DV6B 2Y24A 3VD7A 5D5MF 4ZPVA 3QWNA 3T0AA 5HVHB 2MNWA 3KD4A 4AD3A 1R1CA 1QSEE 5C09A 3RP1A 2Y06H 4OCSL 4LHUD 2FLBT 2E7BA 3BLFA 1TMCB 2B31A 1NM4A 1XSKA 3ARED 3ARGC 1HK6A 2GITA 4KHTH 3UJIL 2EPLX 2YD7A 3EYUH 3D0CA 2O61B 4G11A 4WEUD 2CK2A 4LSVH 3M0JA 1AG6A 3H55A 4YS1A 4HCRA 1VACA 2D9CA 4C1NA 3OKYA 4RX4D 2CCLA 3EOBA 1M68A 2ZDRA 1P4BH 2FRGP 4FQIH 4CQ8A 1PKYA 2ZA2A 3TQPA 3LHAA 1PZSA 4O19A 4PVMA 3TR9A 4RVBA 4RDZA 3S9YA 1KPVB 2JJWA 5D7LE 3P0VL 3GM0A 1TZIA 3OXRB 1FCQA 4ZFZA 1EEYA 3PPCA 4EOWH 4EKXA 4CC4C 4IIDA 3WY1A 2AQSA 4GNVA 3G5VB 1JNDA 3KH3A 3AW5A 3SDAD 4OAWB 3QXDA 5CPLA 4K3HA 1DVFC 1F7BA 2XI9A 3BE1L 1RK1A 2BP8A 4K94L 1Z9MA 3LB0A 1U95B 3UPCA 2ADYA 2PTUA 3PNUA 2ILLA 1GKRA 2Q02A 1C92A 1BPLB 4AIZA 4M4RA 2CJTA 1OKEA 3C2SA 4O02H 3FTWA 2EQDA 4ZMXA 3OJMB 5KINA 3U7VA 2OQYA 4H5SB 4KJQC 3AXXA 1CGUA 3PTDA 2CITA 3L8QA 3EH3B 2BCMA 3CUZA 4NZ4A 2OWWA 1XL4A 4DK3A 4A29A 5AKQA 4KJPC 4PMNA 1G4TA 4KGLA 1CF8H 1ICSA 1TEFA 3PHOB 4UQBA 4ZS7L 2F54B 1F8MA 1P5UC 4MUPA 2WKOF 1DCEA 2X4NB 3REQA 3US0A 1LXMA 1GVQA 1UC6A 4M6NL 3RVVD 4JIRA 3ILDA 4ZE4A 1EC8A 5EFDA 3TA3C 2V68A 1FO0H 3WJYA 4GRWB 1U91B 2WYSA 3AY2A 1IEXA 3WKQA 4AY1A 2CHWA 2VMFA 4NUQA 2VRQA 2Q2LA 1O7DC 1H9DA 4PBXA 4N28A 1UYWL 3QFJB 3RAJH 3MBWA 2CHNA 3F7VA 1XHHA 2JCCE 5AOIA 2EG6A 3R4DA 2NY2D 2P52A 5KTEH 3PB2A 2X6VA 4J3OD 4PR5B 1E6OL 3NH7L 2PR9A 5TE4L 4KEMA 1GKQA 3JV4B 1HQRA 4ZB2A 5ECJE 1AQDB 4U6YB 2YBVA 2PW2A 5CD3B 2DVTA 4XPGL 4ZZKA 1LK2A 4FQLL 5C9XA 5B7ZA 3BLEA 4O1BA 3L0GA 5EOTA 1YEHL 3V3WA 3S3SA 2Z0UA 2VL5A 4KVPA 2IPTH 2J88H 1FWDC 2SEBA 4L9DA 4WO4C 3OJDB 1AG1O 5C0IA 3WL0A 3UH8A 4J3TA 3PFQA 5D2LB 5BOFA 5F4XA 2EDDA 4CJ1A 2W79A 2EDNA 1INEH 5IQ7L 3GU1A 4UDUA 3OX8A 2BSEA 1BW8A 3N0AA 4HT3A 1FLRH 3HG0A 4XV0A 2YUVA 4PJHF 5IGXH 4Y5YB 3NCEB 1GGIL 4FIQA 1Q6OA 1URLA 1CIDA 2WOYA 2AMXA 4Z7WB 3CZGA 4X98A 3CVHH 1FYTD 4GUOA 4ABWA 3AU1A 2VN6A 3ZW3A 4BWTA 3SE3A 3GGWA 4JHAH 4PFEA 5HYEA 2BVDA 1XIDA 3EH1A 5LUMA 3C0SA 5HTSA 1QR4A 3U0TB 1D8WA 5C86A 3VFRB 1DQML 1BSLA 3QJRB 4I85A 3W1LA 3WEZA 1G7QB 4HJJH 3VOJA 3GMRA 2JB5H 1PLGH 1GHFH 3BW3A 3TU6A 3TESA 5DZ9A 4RFNB 5HGBB 2IDSA 1IM3D 1R3WA 1I2PA 1IE4A 2F2KA 2ZOOA 4M5PA 2P8MA 4OZHB 2AGJH 2BNRB 1GVSA 1JDFA 4CN1A 3U4EB 2CZNA 3MLYL 3HC0B 1EOKA 3MMEA 3ZE0E 2A3HA 2H3BA 3IMSA 4XCEA 2WHKA 3BISA 4J3OF 3HMXH 4MCNA 2I56A 2PYEE 1RERA 1WS8A 3ARDC 3GU2A 3M43A 3VAEA 1X7QA 5FF2A 1L0PA 1JHKL 2HSIA 4GW1B 1HO1A 4IOSD 4GBDA 3GJFH 4X4YB 3DMMA 1SLUA 1T0MB 1GZHA 3DUHA 3TIDB 3GBDA 3WMPA 1TTCA 2G96A 3TGXA 3L5XL 3UXFA 3QEHA 3TVMD 3HB3D 4AK1A 1ONRA 5GISH 3EPNA 3DHPA 2R4SH 4CEUC 2DWDB 4PUJA 1A7NH 3WIHA 3CZKA 3BCDA 2BVOA 4UMCA 5DZOA 4PP2A 1LGVA 4NILA 2Z7GA 4GWEA 3TA4D 5T1LA 4M6AA 2AEOA 4OHQA 4LARL 4W8AA 4X6DF 2RDWA 2OR7A 3RRQA 4ICCX 1HOCB 1TMQA 3IXAB 4M61A 3W57A 3BD5A 1TQCC 4AYFA 4V2CB 4QXTA 2VDNL 1BRLA 1ZT4A 3T4CA 3QYSA 4BJHA 5I8CB 3ASOB 1DFBL 3O41B 3DXAA 1LT7A 3ASNB 2HH0H 3KWVA 3STZA 3IDNB 1QSFE 2PPGA 3TIMA 2VXVH 2TSAA 4OZGE 4JDTH 2ZUVA 4H8WC 2YUXA 4B96A 1X96A 3QUXB 4OLXL 5K9JL 2H6UA 4U1MA 3OGSA 4LT7A 4GBXD 4DK5A 2JI2A 3OZOA 2BS8A 5EF3A 4LLWA 4GQQA 1M1XB 1V27A 3S48A 1ADWA 2RGMA 2VXTL 4V33A 3Q8CA 5KANG 2OZ8A 1DVXA 3T2NH 3VVWA 1M9WA 5CCKH 1OTUC 2A6LA 3PREA 5D6DA 3RDTB 4HZLA 1N8ZA 1IL1B 5D72L 2YD6A 3SJVA 2YDSA 1QAPA 1KBVA 2WXGA 3CQFA 3BZJA 3U4BL 2IWKA 3P2DA 1PAMA 3W39B 1QHZA 4WNSA 1SJDA 3CLMA 2A3AA 1P0BA 3QPQC 4X22A 3UZWA 3BSZH 2QHAA 2A38A 3EFFB 3D69B 3QNZA 4P8VA 1MUJB 1DVZA 3CHEA 4LH8A 2VGGA 2TYSA 2DB8A 5E0CA 3OZ9L 4QP0A 3JR2A 3WUGA 4C6BA 5SV3A 1GVOA 3WEXA 1ZEAL 2OODA 4G5ZL 1IT8A 1RA0A 2UY6B 1XF0A 1QRND 1M7UA 4NUPA 3NPUA 2MHAB 3RI5F 2ZF9A 2Z31A 4WHBA 2BWQA 1TUXA 2NXHA 2P3EA 2HT4C 5JLZB 3L7EB 3LZPA 1RH8A 1PE1A 2HTKC 5CU5A 2VM3A 3F12A 5K59F 2ESVD 5DSCB 2J8UB 5G4MA 1TR1A 3UERA 4XNBA 2HXTA 1J5OH 2WBGA 1W0YT 4HPXA 1IIGA 2GVEA 1FSKC 4DP8X 4JZJB 4YPJA 4M5ZH 1P1ZA 1YXDA 1Q63A 1E0WA 2Z7YA 3GXIA 4XB3A 4NZDA 4JN8A 2BY0A 5E94A 2W61A 2OXGA 1WDWA 3F04A 4J3VA 4NBYB 2P8CA 1JTOA 2Y2YA 4R6UA 3NFNA 4X7TB 1O9VA 4CAGA 5I0ZA 1R85A 4XE0A 4R9OA 4P7QA 3F7PC 4M7TA 5BMFH 5ACZA 4IRSB 3CMOL 5CCZA 1HHKA 4Y88A 1BVLA 4QHNA 2WBJD 5CKSA 1VF8A 3QJUB 3T0XA 5KYNA 4OF7A 4XUGA 2VERA 1T0OA 1B1YA 4LEBA 2J78A 3SQOH 2CLKA 1UH4A 1HCFX 5EU9A 1F4XL 2BPBA 1CR9H 1BBJA 2QJIA 4IPNB 3VNYA 1KXVA 3THQA 3TZFA 2C4FT 4BFIB 5TDNA 1KCVH 3OKMB 5ICYB 2GGEA 3O6DA 1DUYA 5H35B 2OO0A 1I8IB 1GAFH 2NX5D 3TO2B 4B27A 3IJIA 4MKNA 5D70L 3UAFA 2HEJA 1VSCA 5HVFB 3BK0A 5G2WA 3GI9H 2PPDA 3NMEA 3OPZH 4XZLX 5DUBA 4KRMB 3C9NB 5EORL 3APFA 3D9AH 2XH4A 5AYUL 4KI5F 1G6RL 2V9UA 4ADIA 4AAJA 5ALBL 4JRYD 1W9UA 5FGRA 3FC8A 1UJPA 3ZM8A 2WO4A 5I1HH 3EUUA 5EN3A 5E4OA 4IRZH 1O7DE 3QRFM 2NSOA 3NR0A 2PLTA 3RZCB 4JFTA 4KKQA 4NC1C 2C18A 3Q6GL 3OGCB 2HE8A 5ESVA 5C0AA 1OPGH 3O1NA 3FU6A 3ARBD 1MREL 3ILPA 4UT6L 5GPRA 1MCRA 4P5TD 4HHAA 1FOBA 2J6EA 4N8UA 5DFWH 3Q2NA 1JIBA 2NR6C 4LS1A 3W6YA 4L5ZA 2VMEA 1BX2B 4WFGD 4HISA 3WJJC 1FWIC 2JELL 3GDTA 3L4VA 3PBGA 2NY7H 4N2DA 4XP5L 4NRSA 2P5EA 4XBPA 2DQCL 5C70A 3EFOB 3IDGB 5A3ID 1S7RA 5DU7A 2CR0A 4I1RA 1F18A 3F58L 2IDUA 1EA9C 2ZADA 4FG2A 4O51B 3QORA 2W0PA 4TPRH 3DHJA 3NN8A 1PD1A 1FGNH 4XD3A 3OQRA 2YWYA 1JCJA 1OCBA 3TN3A 5CZXD 4ML9A 1XRSA 4LU5L 4BJLA 5SWSE 4ZO8A 4CN4A 4PY7A 1E55A 3OSVA 4YZFE 3AHYA 3KVMA 4PUBL 1DWAM 3NT0A 4HWZA 2ARJQ 1RD6A 4YLWA 1CYGA 5F1UA 3U2SA 1E6PA 4GKNB 4NKOB 3HBLA 3OAUH 2WXMA 3CJJA 4J5NA 2GK1B 3FQTB 4TTGA 2PB1A 3SO5A 2DT3A 5CBEB 1KN4H 2R14A 3PYCA 4HK6A 3IMVA 1URZA 1E51A 4WW2B 5GS1B 1X5MA 5JQ9A 3N44F 4MCMA 4KZCA 2P5WE 4P9ML 1X7FA 3GVRA 2GGIA 1VHPA 3WNKA 4RFEA 3FBKA 1L6GA 2XXCB 4Z78A 4QTHB 1HFBA 3MXWH 2B59B 4J3ZA 4Y5VA 4C6KA 1V77A 3LYEA 5EWIH 3R12A 2FDMA 1MFMA 1PHQA 2V2TA 4NRZB 3NCFB 4UNUA 4G83A 1SF5A 4YL2A 3BDYH 1K6WA 1JFQH 2JTYA 4TX9A 5I78A 5I5RA 1DFXA 1PVNA 1P0EA 3V6ZA 1X98A 4QDWA 4BH7B 3QUZD 3H42L 4JTLA 3WG6A 1KULA 1HT6A 2HXUA 2O4QA 1WBHA 4Y8FA 4LLQA 1A5LC 4MLSA 5DJCB 2R0WH 2G9KA 2AK4E 3WJSA 3DXIA 2V7HB 5ECVA 3DFTA 1DLHA 3A4EA 3AWFA 3ZDYF 4IRJA 4G6FD 1RV6X 2X0VA 4AVOA 3H4HA 1XLFA 4DEPB 3ETTA 3CAFA 2X2JA 2VQTA 2H7WA 3DFNA 4TLKA 5C0JB 4PSRA 4LFHG 2BODX 1P7QB 3BAEH 3SPJA 4EBQL 2GG1A 2AJ3B 1PQZB 3GXDA 4PJAE 5A95A 4GSRA 1YEWA 1J1XL 3V5HB 3ESPA 3P4OB 1IC5H 2DWTA 1BM7A 4FAAB 4WHTA 1U5HA 2YZ5A 3EXRA 1FL6A 3XIMA 4YDJB 3HLAB 4O12A 2GLKA 2CJUL 4ZW5A 2QCHA 1XXDC 5AVVB 1C5CL 2CKBA 3ILQC 3SE4A 3MBFA 4BI5A 4WI3A 5D2YA 4FXGA 3LEPA 2MNRA 4NZRL 4CGTA 2FGWH 2QUVA 1ZUAX 4R4NC 5EEVA 2GT9B 2GOUA 4X7FC 3LB6C 5E0KA 3GZ3A 3EYVA 3HAEH 2YZ1A 1A65A 3KTSA 5I3KA 4XNQA 2Y5TB 2YPLA 5C09E 4LUYA 1M71B 3R7RA 4WTQA 4I5UA 4PJ8B 1AL8A 3IGLA 4OY9A 1L8NA 2P5NA 3V1PA 3FCPA 3O2WL 3C61A 3HS8A 4LLYA 2AEPL 3CVDA 1N19A 2V5LA 2J44A 2YMTA 5KTLA 1DBML 2FGLA 3C0QA 4HLJA 1ZVSA 4ENED 1TO4A 1LEIA 3CPRA 3QR2A 1FQ0A 3BZ4A 1Q94B 4GH3A 1G84A 2PU1A 4BKLA 4RR4A 1JGEB 1PZBA 1PDKB 1NH6A 4EZLA 4WKXA 3E3QC 1CUOA 1NA8A 4CGUB 2FJFA 5BZDA 3L0NA 1FIGH 4NM4H 3PQYB 1TIWA 3SKNB 3BFOA 2X0YA 3NJJA 1VBUA 2EG8A 4P49A 5CSBA 2E7FA 1EX5A 1XBXA 1VA9A 1ZBKA 5DVLA 3MLRL 1QI4A 5ESQB 1HU8A 3OVPA 4D2NA 1BF6A 4D8AA 2AJYL 4MQ7A 1HKIA 1P48A 3ARVA 4OB5H 4IOFC 3ITYA 5D1ZI 4JDBA 2IWGA 3MRPA 1E50A 1JK8A 5HANA 1UR0A 1QFEA 4ODXB 1WIUA 4GVHA 4R4BA 2EACA 1P5VB 3S5NA 3W4RA 2AANA 2UVFA 2PMQA 2Z3FA 3WQCA 4PCKA 2J7BA 3QUMB 2QPSA 5DD3L 4JTGA 3VXMB 3NO1A 4NB7A 2OKMA 5KZEA 1XYCA 3N40F 4X5PA 4IIQC 4FFZH 2Z1XA 4K3DL 4BQ8A 4AT6A 2Z7KA 3RFZA 4XC1L 5D7LA 3U9PL 4KQ4H 4MVBD 1NOFA 5CWSA 2ZSVB 3MROA 3VI4B 1SU5A 3PZOA 2WZTA 4TX6A 3WFHB 2VP8A 4L1HA 3QQ9C 4QJ5B 3VFCA 1WOBA 5I1JL 1KIRA 3E2HB 1G9ML 5IVZA 5GNYA 3FO2B 3TS8A 2Y61A 2XFXA 1H5YA 2I60L 2A7NA 5DFAA 2X7LB 2NX3A 1KV5A 3UX9B 2FMNA 1JCKA 1U8MB 2DQTL 3AHZA 3BIAX 1K8IB 4XPFH 2AERT 4MYPA 4XUYA 2W94A 4Z7NE 2BIIA 4PMJA 4BK5A 4NC1E 2W81C 5J1AB 4V1DB 5IK3A 1NWRA 1MCOH 3BVVA 4G3YL 2D73A 4BF5A 4WU5A 2NY1B 1M03A 1D3HA 4HF5L 1LNUB 2WNKA 1BF2A 1BDYA 1OD7A 1J11A 2CLZB 2REQA 3U5UA 5FO7A 3GTHA 4KMLB 1E5AA 4KZEL 1RUPL 4U2YA 4L4PA 2X1TA 1OP3H 2G3MA 5HP5A 1DOSA 4N4PA 2WQVA 4CSZA 2XIMA 4PJXB 2HBXA 3W71A 5K9KB 1MF2L 3CXOA 3UBXA 4Q33A 1SO5A 3CQKA 2G0WA 3QWOA 1JQVA 1QSED 1NGWB 3EO9H 3VGBA 1S2AA 4K5LA 3LH9A 5J89A 2KLRA 1JWUB 2WWMD 1Q6GA 4UQCA 3FT2B 2ZPKL 1F97A 2Y1VA 4YHIA 2JCCA 3X11A 1X7TA 1QLEB 1YA5A 3RWIA 3RIFF 3LV5A 1E9QA 3F2LA 4DPRA 3LBOA 1F8IA 5E1GA 4HU4A 1S2EA 4KEZA 2YD5A 1Q7MA 3RK8A 2K3HA 2XNAB 3RE0A 5D7LD 3MRLA 2E3ZA 4E9SA 3WBXA 1JAEA 4XCYB 1ZU8A 1HL4A 3RVWC 3ABOA 4FQHA 3L6FB 1A2YB 5B1JA 1B9BA 5JHLA 1L0XA 1IUZA 4Z7OF 1XF5B 1AO7E 1FPTL 2DRUA 2E46A 3P4NA 5FJJA 3CN2A 5XINA 3QZPA 3T3PB 2AJUH 1YYMH 2KUTA 3GXPA 1LL4A 3N1AA 4GT0A 3CHXA 2NQHA 2E5DA 3L4ZA 3RKPA 2BZ7A 4LVGA 3WN6A 2PRLA 1BYCA 3I02B 4OUEA 4WGHA 3Q44A 1A7PH 3BKML 2DQEL 2VDMB 3DGDA 3USZA 1FVDA 4KERA 4MAUH 2NQ3A 3JSSA 4U1JA 5AC6A 2W27A 1H15B 1W3TA 3TQ0A 1RK7A 1HXMB 1IQDA 5A8MA 3CO8A 5IHSA 3AS3A 15C8H 2AXWA 2X4SB 1OAUH 1TFPA 4JR5A 4HIJB 3N15A 1U93B 1V55B 4YBLB 1FZKA 3WXVH 1SYSA 3P9WB 1DV7A 4FFVD 4MZYA 2OZ4L 4MCYB 3O45A 3TWBA 4PRWA 3GUGA 1JHLL 3VCLB 2AK1L 4JMXA 4R97B 5C08B 4PPTA 1NCGA 2PTDA 5JXAL 4IGBA 1NEPA 2H0EA 1ZLWH 5J9PB 1QACA 2ZCLH 2QTEA 3NQ6A 1DL7L 3HQ1A 3T0BA 2PYEA 4F3FA 4YJ5A 2ORBH 3Q8EA 2CDFB 3GMQA 1GZJA 3KPRB 2XKNB 3L5AA 3O15A 1EK3A 2GY5A 4XXCA 1AHWC 3MBXL 4YHZL 1A7QL 1Z1WA 4BH8B 4UC5A 1QPOA 3UAAA 3GRWL 3QV8A 4JZOB 3IYLW 2QVHA 3F7LA 2A3BA 4UMBA 3BW4A 5BV7B 3A6CH 1PZ5B 4AGQA 4BZYA 4Z7QE 2ENYA 3TYFA 3E6HB 3MYJA 3G3LA 3QC3A 5D1XB 3KGUA 3W2KA 4QD2E 1BWWA 2YD0A 1BWVA 3VXPA 1WVZA 4QLWA 3HE6C 4DAIA 3F7YA 3N2OA 4MDIA 4PFHA 2RUSA 4UWQB 2XZAL 1IU1A 3NJXA 4FFWC 3I6SA 3FV9A 4DKEH 2OYMA 4O53A 3HMWH 1NELA 4JAMB 5E6IC 2KMWA 5EPMA 3WYRA 4KESA 2ON3A 4W9LC 1QSFA 2G3JA 3F7JA 4HMEA 1HKLL 1KTLA 4OJDH 4X4ME 4IMLA 4PY8I 1AP2B 4R2GD 3L1EA 4QCIA 2ZYRA 5I0YA 1ZP3A 5BRZD 1ECEA 3DVGA 4JFFB 2VOTA 2Z64C 2JKNA 2ENSA 4BEQA 5DD5L 3E3QE 4IWWA 3KXFB 4JO8A 3DI3B 4NEHB 4ZMVA 1EPXA 5DUMH 3RILA 3P77B 1DIEA 4KTYA 4TMPA 3VIHA 5CLTA 1VF5C 1I1YA 4NKDA 3RNKB 4JFPB 5G5DB 2ED8A 5FGSA 2X89D 3B8DA 4NCC1 3M7SA 2FZ8A 3V8CA 4NZ3A 4LEOA 2W92A 3KWUA 2O9PA 1V0KA 1XLMA 1J0JA 1RI8A 4IOIB 5HDRA 1MCSA 4D9RD 1Q9KA 2BWDA 1IQWL 1MJ8H 5BVJA 2VUNA 2BX7A 4NKMA 1BYBA 3ARGA 2YBUA 2ZYIA 5K9QG 4JJHA 4N2LA 3KXQA 1AZBA 1AQKL 3DAQA 2E3VA 4F8TA 1DVJA 3ITLA 4RE3A 5EIVA 2CJSA 3K0WA 5HHMD 3PFRA 1HQ4B 2X3CA 4IIZA 3X2QB 3W2JA 4FEMA 3DV4A 2HBVA 3DOHA 1KB5B 3FTXA 4BF7A 2DZXA 3FX4A 2JK5A 1DN2A 5C0BE 4HFWA 1ZP4A 1YEKL 2XZCH 1RIVH 1C90A 3ZQXA 1QXLA 4F2TA 3DDFA 3NCWA 1UZ6E 2ZP8A 4CC4A 4M5SA 1VDGA 4F7TB 3CFUA 1AGCA 1AYOA 3U7YH 2CE6A 2DW5A 4HQQL 1M5WA 2CHRA 4JANA 1M7DB 4LVAA 1NWUA 1DVFA 5KBDA 1YPZF 4QGYA 4MAYB 2K8MA 3EJTA 3V0TA 1GJUA 3MBDA 2OLSA 1F4WL 2M1KA 4U1SB 2XPGA 1NP2A 2IAMC 4AUYA 3DG6A 2VLRE 3ZJKA 1EZ2A 3Q94A 2I9LB 3IRSA 5AHNA 3UBXG 1L9OA 3HFMH 3C4UA 2YRZA 2L0DA 3BWAB 3UGUA 1I1AD 3T1WA 1IM9A 1MJUL 1HC1A 2Z7WA 5I15L 3Q05A 1R3JA 3BC9A 5F3HA 2H1PH 2Y1YA 1FNLA 1HKKA 1OINA 3QULA 3VWJD 2CZDA 4GX8A 4RDQF 1XLAA 3VIMA 1DQXA 3BPNB 1P5UA 3O6ML 4M1GL 3RBSA 3EPMA 4JG0H 3OR7B 3PG2A 3MWCA 5GGVL 4L6DA 5EUOB 4TVUA 3WLWC 3A21A 1KTCA 5D7JC 3C5ZA 4NQXB 3CS2A 4N0UB 1OPOA 4DJDC 1A3HA 2PAJA 2CLIA 3RFRA 4UNVA 3ARYA 3DVFA 3ZLFA 5LXVA 4AKOA 1AKPA 1U8NB 2W0FA 3UBGA 4A7QA 4APQC 5MHBA 4JFED 5G4HC 3DTXA 4MADA 4L3EE 4S3KA 4NQDD 2H8XA 4LEQA 4U1NB 1OCJA 3ZHKA 2HYMA 5J06A 2ZYFA 4DW2L 2BP0A 5K39B 5BUPA 3TTYA 5HPMA 2C7FA 4FLHA 3P11H 3FU7A 5E2UH 3VABA 3OA3A 3V18A 1VLWA 2CERA 1KCZA 2FX8H 5D30A 3IFOA 4IOTA 3K1KC 2INEA 3CM4A 1CB4A 4JQ4A 4WO4A 3NBNA 2H1XA 5I7GA 2BJML 3BP7A 4OLUH 4Z1PA 2VGBA 4YQXL 4D6JA 4YSSA 3CSBA 3IIOA 2YEQA 4LJ3A 2PGEA 2XWTB 2D2GA 1QLFB 4K8GA 1J2WA 2Z4TA 3RWGB 3LKRA 3CSPA 4HBCL 2VWEC 2XPYA 1IGMH 2HKFL 2X1IA 1ME8A 1KIQA 3D51A 1BYAA 2WO5A 5DZAA 4C5YA 3CV2A 4C56E 5HHVL 1FGVH 4R5EA 4HGMA 5U7SA 2TSYA 4OI7A 3Q1SH 4PRBA 1TQTA 2WWCA 4TUKH 4XVSL 1FLTX 5MEQA 3EX3A 4NQ1A 3GLDA 4L5FH 1XIEA 3TF4A 2AKRB 4D9PA 4UZGA 3K1DA 2GJRA 1OGTB 4H7VA 1OSZB 4Q4RA 1H63A 4IFKB 2DQFA 3LS5H 3G3DA 3JTBA 4R0LC 1XM3A 4ZX4A 3CMJA 1QWUA 5F89B 1T40A 3C5ZD 1YBQA 4O9HH 2P5WA 2ESCA 4K5MA 5E4EC 3D50A 3DOSB 5T9CE 2VERN 5ILTL 43CAA 2QFPA 3AFLA 3LRMA 5I77A 1YMME 3C5SB 3N43B 1KEMH 4Z76A 2VDPB 4K9EC 2Z92B 3DC0A 4E4UA 4B3KA 3H4XA 3PUGA 3KE0A 5E00A 1J0HA 3LQMA 1PZ3A 1Q4WA 5EIQA 3ARDA 4GY1A 3PBYA 5J6HA 4S1DC 2I17A 5CCHE 1SO6A 1DR9A 3CN1A 4ELMB 1C8XA 5DI8B 3I4EA 1Q6DA 3HC3L 4PRAA 4LANA 4GQ9H 3HZYB 4RH4A 1ES0A 4ZQPA 3UZVA 3QEGL 2VITA 1QUNA 3S1GA 4AV4A 4CMHC 5B4MC 1U3ZA 1IFGA 4BE5A 5EEYA 2IOMA 1FYHB 3WSUA 5JXEA 2AK4A 4YXLH 2HX9A 5DXYA 5EIIA 4N2YA 3KYKH 3QCTH 1NKOA 3BHBA 5DK0B 4MY1A 4PRHB 4M7LL 1N7MH 4I7ZC 3LNFA 8CGTA 3GJEB 1MFVA 2F1BA 1J79A 4NUGL 5FKYA 2VO8A 1B3YA 3IMUA 4AE0A 4J6RL 3R11A 2EJ1A 3MVIA 3ELAT 3B03A 1K3IA 1YX1A 2WYTA 1ODZA 1RBOB 1LMIA 3OMAB 4PJAA 4ONHA 5F72S 5SWSD 1RZGB 1Z7JA 1XH0A 1WSST 3E49A 1ESOA 4NT6B 2O9RA 1U2HA 3QQDB 2YMXH 3QTGA 2D7TH 5DY2A 1TZHB 1WIOA 1QNZH 3IDUA 3FUDA 4CMMB 2EXYD 5GHWL 3T0ED 4GRSA 1QNRA 4M9PA 2P26A 3G08B 3K71A 2CJ3A 2PPEA 3PG9A 5IQ9A 3ZK0A 3M8OL 4K8RL 1U9KA 2AL2B 2IPUG 4F66A 3N6HA 2QCGA 2Y7DA 4B95C 5LXXA 3CX5J 2PKDA 1JBJA 3CHDA 1I1FA 3RPIB 2K9UA 4ZMYA 1CENA 3UJSA 1AQMA 3II1A 4UTJA 2NPLX 2VMJA 4ZYKA 2V7NB 3SY1A 3FT1A 1XIHA 2FTAA 4PGEB 3SGDI 1RPKA 1UZ8A 3F5WA 4IK6A 3N55A 5DT1L 1IBBA 2OV0A 2CLVA 1VADA 4ODUA 1XI3A 2FT7A 4WY0F 1U58B 1P4IH 4LO9A 1XGTA 4JDZB 4OV9A 4L8SB 2EKJA 2QUTA 3AZUA 4GACA 3UADA 4R83A 5M3WA 2C9RA 1AJ7L 4FS9A 1D6EB 2EYTA 2NW3A 3STBA 5ADPH 4PP1D 3TZVD 1U3HC 3CXHJ 1O7VA 2WC7A 2ZSWA 4Z1CA 1MCDA 2AP2A 4YHKL 4XRCB 5EDXA 5E1QA 4UQAA 4NS0A 2J5LB 1ZA6B 1ETZB 4HU2A 5JH2A 4AL8C 2XV0A 1QHOA 4AZ8A 5E8OB 2EDMA 3TLRA 1GS8A 1BZQK 1MI5E 3VIFA 2P49B 2OMAA 1MZZA 4GSQA 3I7SA 1UR1A 4NJKA 5I28A 2E5EA 2Z28A 3F00A 2EPOA 3GNRA 2YQ3A 4XN7A 4D0BA 4LSRL 1Q9OA 2WLMA 3PNWA 4G6CA 1RR2A 3IPWA 1IT9L 1TZ9A 3FSUA 4B9JA 4YDIL 4B90A 4XHJC 1R87A 4LCWD 3QNYA 4XZHA 3VXRB 2QYGA 3NXFA 1FHDA 3BAYA 5GNXA 1GSMA 2HNEA 3NAVA 2BXZA 4H4NA 4KK8D 1W9BM 5HOSA 4E5TA 3DJRA 3LNDA 3R1GL 1SBSH 4B6ZA 5I18H 1QR7A 2BVPA 1IYXA 1BKHA 3QW4B 4PC8A 1U8JA 4MPQA 4KO6A 3QB7C 4W6XB 2VDIA 5C09D 3HQNA 1UQSB 3QPXH 4G7FA 5DCCA 4CNPA 3FT3A 4EI5B 4X6FA 1DSFL 2WSDA 3UGXA 3UZZA 1UXWA 2CPCA 3G1FA 2J7GA 4BFRA 3KH4A 3LEXB 1HZHL 2H0PA 3TWCL 5CIPH 1JWSA 1BEXA 3ZKMC 1HHIB 2X09A 4MPKA 4LIQE 4S11A 4WUKL 4XR8C 2XTKA 2WXLA 1PLBA 1K6QH 1SM3H 1L9QA 3L3IA 3PXHA 2WWNA 1E0TA 2DQIL 3M1ZA 5K9OA 3WG7B 3L45A 4Z95L 4UV7H 5EHFA 2NR6A 3FUIA 2ADIA 1FG2B 5ABEA 2ICWI 2JF1A 2WMPB 3GRGA 3WJJA 1I4NA 4JY4B 5A8GA 3QSTA 5CH9A 2QAPA 1RL1A 5G2IA 1LO4L 3BW9B 1VQTA 3OYZA 5C9ZA 3ZXWA 4OD3H 4MJMA 4ZSOA 4E41B 4HVBA 1FRBA 4WDIA 2JFEX 4PULA 3NZ8B 3PWVA 3TYGH 2B7NA 4AQ1C 4O2EA 2ZKYA 2YBGA 2NW2A 3IMBA 3RHWK 4YGAB 4RLIA 2VWEE 5HWMA 1OBAA 3LY0A 3U0PA 4YNYA 1FFRA 3UYPA 2NXIA 3U9UB 1XRVA 4Y8DC 2OL3H 4XWOC 4JL1A 2NNCA 1W2KT 1U8OB 3GSXB 2YAQA 2ZWZA 1QR1B 1OX4A 4YHPB 2OFQA 4MDOA 2K7PA 1ZS8A 2ZIDA 1LQSR 5LDSA 5FKAB 3Q9PA 1G7VA 3HI5L 3TYBA 2ZD0A 1A6WL 5ERWA 3FSVA 3NQVA 1BYPA 4WXZA 4GAYB 1BFVH 1K2DB 5E08L 4M19A 4JYDA 4L6OA 1AO7A 3GSNA 3MLXH 2A83B 3P9LB 5IV2A 3S5LA 4RMVA 1S6NA 3EBGA 3VKBA 1L6XA 5IW1B 5I5MA 3MJ8B 4PJCE 3L5LA 4WJ5B 4LPCA 1FWTA 1DJGA 1A5OC 2I5GA 1QHQA 5HMEA 5EIIG 4OCYH 3W27A 5FJPA 1S3KH 1BQ5A 1G4EA 1KPRB 5KVEH 4ZA0A 4HN4A 5FFLA 2Y6ZA 4H9VA 2WBXA 5DZNA 2J57A 2FBOJ 1QVOB 2FQIA 3NIFE 2OWCA 3AHXA 5D7SL 2ZOKA 5F2MA 1Q7ZA 1M7XA 3UG3A 5DQ9A 2AFNA 3C0JA 2JKPA 2YR3A 2XKUA 5C97A 5LGKA 5KS9B 2YKLH 1P2CB 2YXXA 4GG6B 3WXWH 5DMGC 2L5HA 4Y2OB 1N5AA 3M0KA 4XI5D 3MJ9L 3T81A 4NCC2 3AWEA 4KK9C 1NOUA 2QDGA 4GK8A 2YW4A 3GLZA 3IEAA 2BSED 2R9RA 4UU9B 1XLEA 3FQXA 4DGVL 2NRDA 2XG5B 1PS9A 1S8DA 4OCLC 2YD2A 2Q01A 2TRHA 3B9EA 4H26B 1REQA 1SLWA 3EWBX 5LGYA 3RWCA 3TJIA 4JPIB 4UM9A 2EPKX 1RURH 4DZAA 1QHPA 2A85A 4WJKB 5E2WH 2YA1A 1ID5I 5I1AA 3GTXA 2VXQH 1J10A 4HWBH 2YQ2A 1ITUA 1DBJH 1Z9NA 2PS2A 4JTUA 1XQLA 1TT6A 1BQKA 3GYEA 5JPMC 2L04A 12E8H 2GB2A 4HKBA 3SCWA 4ZXLA 4C6OA 5FDWB 1HKWA 5HYJB 1B3ZA 2Q76B 3Q7JA 3BPLC 2AQTA 4LRIC 1FBIH 5E5MB 3CWOX 1DKWA 3IE9A 3RO6A 3QZAA 3EWUA 2JGYA 1YYLH 1K8DA 3RM4A 3HVNA 4ENZA 4IBLT 4MJ5B 1L6ZA 2BC4B 2X3AA 1UJQA 5TE7H 4F9LC 3EFDL 1D6VL 4PGBA 2AJZB 2OSWA 3PGCB 1TQBC 1A7OL 1LCOA 1HTIA 4IP4A 3WGVB 4OIIH 1H19A 3KLKA 1S2TA 5DFVC 1GZPA 4RGMC 4OF3A 5MP6H 4CNIB 4G7EA 3W1ZA 2B3RA 5EA0L 2YYTA 4OFVA 2VDLB 1EERB 5IFTA 2IADA 1W9VA 3V0JA 4X7SL 4DF1A 2WHLA 1KPUB 4EUPB 3RLHA 3DMMD 5HY9A 3UP6A 4JD4A 3INUH 3K2UH 4MD4B 4KKRA 1JVNA 4X4MA 5INDA 4OGXL 3GRBA 1RZFL 3I6GA 4JNYA 3FLUA 3QIBC 3NCJH 5ID0A 2IG2H 1M2VA 3RWJB 1NIDA 3MOAH 4PUUA 1FFPA 5HDOA 3SCNA 5EZJA 1NAMA 5EKYA 5T1LD 1JDEA 2VDKH 4WTZA 3N85H 2HJLA 4JBSA 1YDNA 2OB3A 4A55A 3LIZL 2A4AA 2QQNH 2LTQB 4KZ0A 4UILL 1OQXA 4F7CB 1YE6A 2EZ0C 3HI6L 1CZ1A 4CILA 3LGGA 5BVPL 2IXQB 1MUCA 5FA4A 3DXAD 4B9IA 3ESVF 5CPOA 2DWEB 4HW6A 3FZUD 2IOOA 2CBMA 5C7ZA 4L0ZA 1DJQA 5LN8A 4U3SA 1A6TA 3ONBA 1OYAA 1XC6A 3WIIH 3B7UX 2JJSC 1CDGA 3MNVA 4EP8C 5JW4M 4N8VB 5DVKA 2RQ8A 1ACCA 3OXSA 2DYRB 2B08A 4LS2A 2WXIA 2Q7NA 2CO6B 4IIQA 4PLKD 3IVKB 4PGZA 1LQ0A 2NT1A 3H2EA 4KDTC 4LFHD 5C0BA 1JDCA 1WWAX 4DBWA 4PJ9B 5CSRA 2DL2A 3SJVD 5B3JF 3HZVA 4P57B 1C16B 2JCWA 3IGAA 1KLFA 2CKNA 4M6OH 2UUDK 3UIZA 2ODHA 2VZOA 2PODA 2P8LA 4B41A 4U4BA 3TTEA 4YLQT 1Q5MA 5A6TC 2X2IA 3G1AA 2GJLA 1IEAA 1WA1X 3FTVA 3L1OH 5KVFL 1A6ZA 4I5BB 4M6MH 1K4CB 4L3CA 4L48A 4PVLA 4PWGA 1JTPA 5F88A 4XPAH 3S34H 3MT1A 2AC0A 4XX1E 2VLRA 1P5BA 2GBAA 4PJEB 1RHHB 1X44A 2EVFA 4W87A 3AXMA 2Z31D 1QFOA 4DQOH 3LV6A 4M5YH 4YHYB 4FFYA 4AEIH 2OW7A 5CGQA 5HGAB 1NFDE 4OM1L 3OGOE 4TQHA 1LM8V 2HFEA 2R0LH 5L2KB 2CM6A 1Q66A 5CSZA 3NCOA 5EC1A 1HJUA 3B6SA 5AN7A 4CKQA 2N7BA 4MSWA 4X80L 5E9AA 3AIQA 3UOAB 3DSFH 4LRSA 1WBYA 1GQIA 5CLWA 3JWDL 5BCAA 5LXEA 4NERA 3KJ4C 4DP5X 3BWSA 3HA0A 3CU7A 1I82A 4YE0A 1U8PB 1XR8B 2Y5JA 1X5LA 3MMTA 2XHYA 3KEDA 4PBGA 3LKNB 2OR8A 1QABA 3KPQB 1CFQB 4GLRI 1Y0LA 1RLBA 2ZUTA 4FOJA 5AYYA 1DQJA 1RZIB 1KN2L 4ZXOA 4S23A 3GHEH 2E27L 4LNRA 5KVGL 3BEVA 4AGLA 3G2GA 4L3EA 3I3BA 1ONWA 4R90L 4LAZA 1KM3A 4PWEA 2GIMA 1YRKA 3S5LG 1MCKA 1T8XA 3I6KA 4QM1A 4H1LH 3QDGE 1RUSA 3U5YA 4WSJA 5C2BH 3O2DH 1FP9A 4JCMA 3LNGA 4LCYA 2IAAC 3NDZE 3VRIA 1EBHA 2DT0A 5IM7A 2ZKHH 4WFED 5C0BD 3RX3A 2CNYA 1QG3A 4AV0A 4P0DA 1TRDA 4DFIA 1OEZW 5IG7B 2NX9A 2VABA 3QLDA 1PPIA 1JG9A 4UR7A 2XY1A 3SB0A 1Y1DA 3CH9A 4JM0A 2GHWB 2OTWA 3VD3A 4F8OA 2AQPA 3VW3L 3GR8A 3IK2A 2Y2WA 2NY6C 3EF4A 3MAWA 3CFJA 5AZEL 4R7DB 5D7KE 3VD4A 3ZUNC 2LFEA 4GRLC 4MAVA 2NYZA 1IV8A 5C0AD 1CEOA 4P06A 2J72A 1M04A 4FQJL 2HVOA 1AZ2A 4KJYA 1O6TA 2P45B 4C56A 3ZL4L 4L3AA 4XGZB 4ATDA 3T6VA 3OAYK 2FZMA 4JTFA 5DR5L 3MO7A 1SLXA 2CCVA 2W07A 2N7SA 4PGLA 2WMKA 3MDJA 4DKDC 3T55A 2P5ED 1WXYA 1HSAA 3RJYA 4BEIA 2P47B 3CJPA 4G8IA 1MSPA 5E9DB 1U36A 3GZQA 2Q6WA 3QORD 3ELQA 6CGTA 3CLEH 1BVNT 3BGMA 3HG1B 2ZWLT 5A2AA 4OD2A 2WTOA 1UASA 4GGHA 4Q4MA 3A24A 3TV3H 1YMMA 1CL7I 4E8GA 1HNFA 1Q0YL 1WV7T 3ZYJA 2D2OA 4L4JA 1L2QA 4IFRA 1GONA 1KGIA 3RLVA 1WK0A 4LEXL 1AH1A 3Q8FA 1BZDA 1QFHA 4NJIA 4JTQA 4KQ3L 1T1WA 3A6BL 5F71A 1AZVA 5K9DA 2VDRL 1DJXA 4LAQH 1NC2A 3EHBD 5FAGA 3S37H 5FUZL 2Y7MA 5FYLD 4LDLB 3O8XA 5EBGA 5CZVH 1RSCA 3QCVH 3VYOA 2PO6B 1AHWA 3SGEI 2ZF8A 2OLAA 3TN6A 3IFNL 1T7LA 3FT4A 3GUWA 4ZQRA 4KK5C 5ISZB 3D5HA 1XT5A 2PXYB 3MP3A 3TZNA 1SZFA 2COVD 1D7FA 2VC2H 1J9RA 1RJZB 1V7YA 3O0KA 1SRDA 1EGJH 3EOAB 1A02N 3WQWA 1C12B 5I73B 3GTVA 4JO4H 4DGYH 5F3BA 4BFJA 4HUXB 3PXJA 4WTZG 2XQBL 3HE6A 3OSKA 2CO2A 1KV8A 1MFNA 2R8SH 1AZ1A 1FWJC 1TJMA 4A37A 3THML 3C08L 5E6IA 2R29A 2ACSA 4XN4A 4N2EA 3E2SA 1EQCA 2PDPA 4M9OA 1PUDA 2ZUQC 5BZAA 4JX5A 3B3BA 1NGXA 4PMYA 3N17A 4E36A 4MRBA 2QV5A 2EE6A 5D9SB 1ZK5A 1DZ0A 3VD5A 4L18A 4E5XB 1O94A 3NIDB 1FFQA 1Q0XL 4KY1H 1DDHA 4PJGE 3V4PH 2FEJA 1A5NC 3WKZA 4DUWA 3O16A 4X4ZA 2HMIC 4PB0L 4GXWA 4MJZA 2Q8AL 4IRJD 4YDLC 4L1LA 3WJWA 3PM6A 3ORWA 1Q72L 1CXEA 1D5IL 2CDEA 4LUTA 3U2ZA 4Z3EA 2WXRA 3BN9D 4GW5B 3V6FA 5CGTA 5SWZE 1AXSA 1CCZA 2QW5A 3VFOA 3WK1A 4PW9A 1E0XA 5D96B 3CXDH 4TULH 3KR3L 3P2BA 2XN2A 1JXFA 5FYJH 3ZWSA 5CZKA 4MNMA 3JTSB 4OF6A 3QUML 4B50A 5C54A 2ITCA