5I5RA

Crystal structure of a bacterial fucosidase with iminocyclitol (2s,3s,4r,5s)-3,4-dihydroxy-2-ethynyl-5-methylpyrrolidine
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
440
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Will be disclosed later
rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 161
structure length 440
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5i5rA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i5rA01
1UKSA 2VURA 4JKLA 1CDGA 3UESA 2XSAA 1UWTA 4AZHA 5IFTA 3OBAA 2Y4SA 1B30A 3S6TA 3SCOA 4HZ8A 6CGTA 2WVSA 5AC4A 1ZBKA 4IM4A 2F7PA 3ZR5A 4PSPA 2VX4A 4JAWA 3W28A 1X6LA 4URIA 4KWUA 1Q6CA 3HG5A 3S2CA 3D3AA 3QR3A 4U33A 1JNDA 5CPQA 3VM5A 1V3KA 5A2BA 3AOFA 3WL1A 4EKJA 1UKPA 2WBKA 1G9HA 5ABFB 2FH6A 1RH9A 3EMZA 2F18A 1E55A 1R34A 3OZOA 4FNRA 2WCAA 3L2LA 2AAAA 2J62A 5I0DA 3CMJA 3PZQA 4ACYA 1WNOA 1XHGA 2X09A 4UFHA 3ZO9A 2DDXA 3J7HA 3AICA 2V38A 4LGXA 1JDDA 1UUQA 1BHGA 1NOFA 2XN1A 2HISA 2YLAA 2VZTA 3RDKA 1KTBA 4QCEA 2UY5A 2X2HA 1LQ0A 2EPOA 3BH4A 1GQIA 3DX4A 3ARSA 3NSXA 3D5HA 3QHNA 1EIBA 1VFOA 3RILA 4ZE5A 1MXDA 3CBWA 2BVDA 1PS3A 2W62A 1G5AA 2CNCA 2WM0A 1E5NA 4PTMA 3T0DA 3OG2A 1JNEA 1OD8A 2D73A 4UQEA 4BCEA 1TZ7A 3GYCA 3WBAA 1JXJA 4CU6A 3DYOA 2VX7A 4GO9A 2XVNA 4OOZA 3VMNA 1ESWA 2PWDA 3AIRA 5BXSA 4DM1A 2DH2A 3CZNA 2HVMA 4W7VA 3AZTA 1CXLA 5EB8A 2WVVB 1OGBA 1UWUA 5FIPA 1PIFA 4PMNA 5A94A 2XSBA 3LPOA 1V3LA 2YBTA 2CXGA 4FMVA 4OIFA 4H7VA 3RO8A 1JL8A 3AMCA 5FCZA 2O9OA 3BMVA 2ZXDA 1GONA 1QI2A 1Q4NX 4WKHA 2JF6A 1WDQA 3WQ4A 1ZBVA 1MFVA 4MNJA 1OT2A 3GXMA 3L4YA 4JL1A 4NF7A 1W1YA 3ARVA 3T0BA 3BAIA 3ARTA 5HBFA 4UZUA 2FHCA 2ZUVA 1QVBA 4J28A 4DO6A 3PHAA 3MKKA 4LYPA 1V3IA 3D50A 4Z2IA 3WNMA 4W8BA 4AW7A 2PC8A 1Q6EA 2VC9A 1VJSA 3PZGA 3DHPA 3OGVA 2V5CA 2WMHA 4MAVA 1GOOA 4AYSA 1QW8A 3CH9A 1W9PA 3MV01 1V0LA 1CXKA 2XVGA 1TVPA 4HZ6A 1UR8A 1J0JA 1GQJA 1E3XA 4UOZA 4JKMA 1TG7A 1K9FA 3KLKA 1BF2A 2WMIB 4UFLA 4MJ2A 2BY1A 2GJXB 3GXTA 4RE2A 1TA3B 3AI0A 1VEPA 4CCCA 2DSUA 3K46A 3BLPX 5EMYA 4J3WA 3VILA 1QI0A 3EJRA 4M80A 5JIPA 3FHQA 1J0KA 4P7OA 1HJVA 3SCPA 4R27A 4CU7A 2JEQA 4UR9A 1E0WA 4UQDA 2WKLA 5I6SA 3LX9A 1MW3A 1QNSA 2VL4A 2BHZA 2OYKA 3AZSA 4WSJA 3BAWA 1B1YA 1KQZA 2CEQA 3VD3A 1E71M 2O9PA 1TA3A 1VFFA 3ARRA 1AMYA 1EA9C 1MW0A 2E8YA 3ZT7A 1V3HA 4JIEA 1IT0A 1WB0A 1IZJA 1B3YA 4KH2A 3WNPA 2J74A 1GPFA 4JL2A 2J7DA 3BUIA 2GK1B 3QHMA 2YFNA 2DSZA 4MB3A 1WZMA 1UD3A 5DMYA 4TVCA 1OD0A 4F9JA 3OGRA 3OLEA 2WSKA 4CVUA 1BSIA 1VENA 5D9PA 1QHZA 1C7SA 2XIIA 3A23A 3T2PA 4D6JA 9CGTA 1RP9A 1W9UA 5D4YA 3CTTA 3UCQA 3ARQA 1TQTA 2FE0A 3A24A 3CUGA 3WNLA 2J7GA 1UD2A 4J3VA 4QFUA 2VZSA 3VIJA 1QOXA 4MADA 2C8NA 5I79A 1HIZA 4H8UA 5I23A 1E6SM 3CZJA 3AIEA 5E70A 5M03A 1HF6A 4BQ4A 2PF0A 7A3HA 4PMYA 5I2UA 2D20A 3O9NA 3VO0A 2CIPA 3APGA 2WC4A 1XCXA 4DO5A 3EJTA 3AIWA 5LYRA 3ECQA 5GNYA 1HP4A 4B9YA 2X0YA 1E6QM 4HZ7A 3GNPA 5D9MA 1GNXA 1PZ2A 5E9AA 1HL8A 3ZSSA 2VZUA 2XPKA 1T0OA 3W81A 4U2ZA 2J8FA 3BLKA 1V6UA 3RMEA 1BFNA 3CMGA 2A3HA 2JF7A 2G3NA 3WY2A 2YL9A 4WK9A 3WD1A 4TOQA 3VGGA 1N82A 2Y5EA 3T2QA 4YN5A 1WE5A 1BLIA 1J10A 4GI9A 1HX0A 3VD4A 4GI6A 4PBGA 5I78A 3MU7A 1GHSA 1MFUA 3MANA 1NQ6A 4PMUA 1EGZA 1GORA 4AZGA 1B0IA 1FP9A 1UD4A 3U57A 3PZIA 2CHOA 3WUFA 2ZUWA 2FHFA 3TOPA 2DEPA 2J77A 1KGXA 1TCMA 5A6JA 2ZXBA 1UASA 4U5IA 4BQ3A 2BY2A 3VDBA 3VIPA 2BXYA 2V3DA 2VCCA 4GINA 1RD6A 2XVKA 3A21A 1WO2A 1LJYA 1R46A 1BYBA 3O2LA 1CGWA 4S3JA 3DECA 1UG6A 1R86A 4AEEA 4N42A 4PMVA 5HPOA 3WH8A 4DUXA 5KEZA 1H1NA 3IJ9A 5AYBA 3TTOA 3POHA 3WL0A 2CETA 1D7FA 1J12A 5CPSA 2QF8A 2XVLA 5A6BD 1K9DA 3ZJ7A 4D6GA 4M56A 2J79A 1B3XA 1GZJA 1UR4A 5JBEA 1OCQA 2Z1KA 3QGVA 1C92A 1GQKA 5CJ5A 3W82A 4ATLA 4AZ6A 2VZVA 4IPNB 1Q6DA 1V0KA 2FDMA 4MTVA 3VOCA 4AWEA 3W37A 4V27A 3QOMA 3SURA 2PI6A 1FH7A 1A47A 1MVYA 4FNTA 2CBIA 5GQBA 4NXKA 4QAWA 2VRJA 1IV8A 1EHNA 2J75A 5DT5A 1ISVA 1GOKA 2F1AA 1I1XA 1BQCA 3N12A 3WH6A 2IGTA 1GW1A 1HWWA 4HMDA 1RP8A 1H3GA 4MNMA 2GDUA 1I1WA 4Z2HA 3HG4A 1GQLA 4XV0A 1C91A 1BPLB 1E43A 1QNPA 1JYXA 4W89A 5A8OA 2ZUUA 2DT3A 1W3HA 4GPNA 2ZUTA 4EK7A 1NOWA 3VDCA 1ZJBA 4AY1A 5BRPA 2WMGA 2VRQA 5CQ1A 3DYPA 2BV9A 4MNLA 3HJEA 1UD6A 4OKDA 3VMPA 3T09A 3GBDA 2B31A 4UTFA 4NXSA 2WLYA 5FOOA 1GHRA 2W92A 4L4OA 3F5JA 4TX6A 1E9LA 4MB1A 2YA2A 4YHGA 3VINA 4U5KA 5I24A 5I3DA 1G94A 4AISA 2WNWA 3AS0A 3EMCA 4ZENA 2IUZA 4HA3A 4GQQA 2WZHA 3EJSA 4OJYA 4NRSA 1KGUA 3UR8A 1UWIA 4MDPA 4W84A 1W9BM 1EHAA 1HXKA 1SYTA 1UQZA 4W86A 2XFYA 1KTCA 1CBGA 2DT0A 5F7UA 1EQCA 1XSKA 4DWSA 4B3LA 1PPIA 1VF8A 2GJPA 2OW7A 1P6WA 3EJQA 3ARWA 3GXFA 1UZ1A 3SCWA 4A3HA 1XSJA 3KL5A 1E4MM 2ZOXA 4AZ5A 3OB8A 5IHRA 2YL6A 2VCBA 3ALGA 1EOKA 2XN2A 3W29A 2OYMA 4JFVA 3L4TA 5HDRA 3A4AA 3AMGA 2X2IA 2EEXA 5C8BB 1GVYA 3VMOA 4C7FA 4GXPA 4N0RA 4UOQA 2CESA 1Q6GA 3JUGA 2XTKA 3WSUA 3PZNA 5E09A 3CZGA 3AYSA 3CUIA 4DWSC 2VZOA 3SUSA 1ODZA 1MXGA 5BYWA 4M29A 4PTWA 1JFXA 1EDQA 1EOMA 1C93A 2VX6A 3N18A 1JDCA 2FGZA 2AOSA 3WY1A 4TX8A 3K8KA 3NDYA 2V5DA 3NSMA 1UHVA 3B8SA 4H8HA 3SCQA 3TP4A 1QBAA 2ZWZA 2WZEA 2VQUA 1UZ4A 3BVTA 3L4VA 1ZU8A 2X8RA 4JCLA 4NZFA 3BSGA 3TV8A 3OLIA 4UFKA 4F66A 2ALWA 5M5DA 1UD8A 4Z2GA 2EACA 3W27A 4D6EA 1DWHM 1JF6A 2G4FA 4HP5A 5I5RA 1YQ2A 3EDDA 3RJYA 2ZUSA 5DF0A 2DSWA 3ARUA 5A1AA 1XYFA 2GJRA 1W1TA 4BQ5A 4M8UA 4UOJA 4ATDA 1HJSA 1UR9A 3VU2A 1H41A 4PYSA 2E0PA 5I77A 2ZX6A 4NSBA 4ML4A 3DC0A 5ABEA 2VCAA 1XH2A 2XUCA 2VO5A 4D6IA 1JI1A 4AD5A 3AMKA 5LA1A 3A47A 1WZLA 2XIBA 1PX3A 3CPUA 1VBUA 3K8LA 2QMKA 3BAKA 3EBVA 5D9NA 4RE3A 2UY2A 2DH3A 4CU8A 3VUPA 1ZJAA 3FAXA 2CBUA 4A3YA 1WPCA 3DX0A 3VGHA 3DX3A 3BAJA 3A4XA 1H2JA 4P7QA 4XZWA 3ZJ8A 4M81A 4OUEA 1DWJM 1H49A 3AZRA 1NM9A 4H41A 1UKQA 3ZSTA 3WUBA 1VAHA 2F7QA 3CZKA 1E6ZA 3IK2A 2JALA 2J7EA 3WY3A 5GPRA 3EMQA 1PZ3A 4P7LA 4D1IA 3VIHA 1L8NA 1NARA 5EBAA 3UG4A 4GZEA 1NWRA 3M7SA 4J7RA 1C3FA 2VT0A 2ZX5A 3AS2A 4AYGA 4WIWA 1KWKA 3PTMA 4NZJA 4GO8A 1CZ1A 2WMKA 1J18A 1UOKA 4E8CA 1VFMA 4QLLA 4CN6A 1B2YA 1WP6A 4HOWA 3ZMRA 4UNIA 1EQPA 3N15A 1OT1A 2EQDA 2WB5A 5IHSA 5LA2A 1V08A 3DDFA 1A3HA 2WBGA 3VX0A 4YPJA 3GM8A 3GXIA 4KGLA 4W8LA 1GOWA 2W91A 2PWGA 3MSGA 4WLCA 5BRQA 2DIJA 2OYLA 1KXVA 3GH4A 3VSUA 1UYQA 3WIJA 1C8XA 3W53A 2WWDA 2XJ7A 3TTQA 3RJXA 1B3ZA 5BCAA 2VOTA 5D8WA 2YL5A 4L4PA 4D6CA 5AC5A 4WSKA 2GUYA 4W7UA 1HVQA 4QP0A 2YIHA 2WVTA 1M01A 4PRWA 1B3VA 3G6MA 3AXIA 4J3XA 2E9MA 4QDMA 4MDOA 2DSVA 1JF5A 1CEOA 2O9TA 3SCNA 3TONA 1TFVA 1JYNA 3OLDA 1UH3A 1UWSA 3VM7A 1BYCA 3N1AA 3WEZA 4JFTA 2J7FA 1E0XA 2VI0A 1SMAA 4PUEA 4B16A 3ARPA 1WDPA 2PWHA 3VIMA 4FF5A 2F7RA 1YHTA 4PCSA 3CZ8A 1BYAA 2J7BA 3THCA 2WW5A 2WKGA 1ZS2A 3B9AA 3ALFA 4P8WA 1O7AA 2Y8VA 4OBSA 5ABGA 3A22A 1UR2A 1FFQA 3KL3A 3CV5A 3A3HA 1SZNA 1FHLA 4GKLA 2PWEA 2CITA 1TQSA 4AD3A 1JI2A 1QX1A 8CGTA 1UKTA 1E4IA 1GOIA 3F5KA 2WMIA 4LYQA 3ZM8A 4MAZA 2VX5A 1LL7A 3ZJKA 3MUIA 1ZBWA 3UR7A 4AMCA 1WKYA 1JZ5A 1CGTA 1JZ3A 4B15A 4X0VA 2XFFA 2NSXA 1G01A 1XSIA 1CNVA 1HKIA 1W91A 4CN4A 5CLWA 1WZKA 1E6PA 4K68A 4D72A 3RM8A 3WQVA 5A8MA 1DWFM 5JUVA 3S5ZA 2NT1A 1MQPA 1HJQA 1DTUA 1FOBA 5A6AA 3EJPA 2W67A 3K1DA 5DO8A 4D6FA 4DWSD 2G3IA 3ARZA 2EPKX 2EO7A 1H0IA 4U31A 1HJUA 1OIMA 3NDZA 4J3SA 3GH7A 3TTSA 3WEOA 2DQXA 3PZTA 3IJ7A 4IPLA 3EDFA 3UERA 3IAPA 1MWOA 4QLKA 4CN1A 4U3CA 5A2AA 5DEZA 2J78A 2A3AA 2XYLA 4GZIA 4IISA 1EH9A 1J0IA 3HZ3A 4W87A 1M04A 3SUUA 4AC1X 1C7TA 4DO4A 3W38A 3W4RA 1UA7A 3H54A 4QLJA 1X6NA 3EYPA 2W63A 2XVPA 4YHEA 5IFPA 4NRRA 2WVVA 1J11A 3MV11 2J4GA 1QNQA 3WUEA 3M6DA 3N9KA 4AZCA 1QWUA 3BLBA 4LXFA 3WQ5A 5M3WA 2F7OA 1ISWA 1ZB5A 5HPCA 3LPPA 2XGIA 2J7HA 4H8VA 4Z2JA 1DP0A 1JGIA 2OWWA 1JXKA 3BUDA 4JHOA 3U5YA 3VX1A 1I75A 4GIAA 3GXPA 3LRKA 5E0FA 1MW1A 2TAAA 1V0MA 3WN6A 5KZ6A 1V6WA 1ITXA 1H5VA 5HOSA 2D0GA 3FHAA 3ZT5A 3VD7A 3B9EA 1W32A 1TQUA 2OSYA 3UG5A 3LMYA 4RE4A 1KXTA 1EO7A 3QOKA 5A6BA 2BS9A 1V6YA 2DSKA 2ZE0A 3EDJA 1V02A 3VIKA 1B90A 3CZEA 1PBGA 3AJ7A 4P8XA 1NOUA 1W9VA 2WHKA 3ZJ6A 1HVXA 5A95A 1HKKA 3WDPP 2E8ZA 2EPNA 3ZR6A 2QV4A 5ABFA 2OLHA 1NWUA 4P7RA 2BY3A 3UEQA 3WY4A 5A8NA 3U5UA 1VEMA 3ZOAA 3AFBA 2DGAA 2D3LA 1R87A 4P8UA 2JIWA 3THDA 1CPUA 1GCYA 5TD4A 1R47A 3BCDA 1E4NA 3WQ8A 1LWHA 4MB4A 3WD2A 3F4VA 3NUKA 3W24A 4HMEA 1EXPA 2E40A 3A4WA 1V02E 2FYVA 3AIUA 1DHKA 3L2MA 5E1QA 1QHOA 3QHOA 4AIUA 2CERA 4ZXOA 3WKZA 4GQRA 4W8AA 3KE0A 3VGDA 2VQTA 1TVNA 3SIMA 3PZ9A 1VJZA 2EPLX 4LPCA 2YBUA 1Q6FA 4U2YA 1JAEA 2EJ1A 1K6AA 5CSUA 2D22A 4D71A 5HNNA 4AZCB 2D2OA 4CD6A 3FY1A 4W5ZA 2BVTA 4XUYA 3ARXA 3SCUA 3N11A 1UWQA 4CD8A 4DM2A 4OOUA 1R33A 1U30A 3H53A 3I3EA 3WF2A 4KMQA 3PN8A 4Q22A 2ZICA 4AMWA 5A2CA 5C71A 5DFAA 1HTYA 2J8GA 1E15A 1TUXA 1HNYA 5A8QA 4AMXA 1CLXA 3NYDA 5CG0A 2XN0A 2XWEA 4ACZB 1AQ0A 2EAEA 2YDQA 1O7DC 4M82A 4AD1A 4HPGA 4PN2A 2OSXA 1H09A 4AIOA 1BGAA 2DIEA 3MUY1 4FLQA 3IJ8A 3WH9A 1KGWA 2BY0A 1QI5A 4CGTA 2WHMA 2WLZA 1BG4A 3DDGA 4F79A 1V3JA 3WMSA 2Q8XA 1XGZA 2MANA 4H04A 2BNJA 1V0NA 1JD9A 2BHYA 3HMCA 3WF4A 3L4WA 3I3DA 2ZX9A 3AQUA 4JHZA 1KQYA 3D4YA 1QHPA 1FP8A 3MMWA 1E3ZA 2QLYA 4UZSA 2WYSA 5A6SA 3GXDA 3GZAA 3N17A 5BXPA 4W93A 4XB3A 1J01A 3RCNA 2AMGA 1XCWA 1NWSA 4PMXA 1VEOA 4M1RA 1NP2A 4FNUA 4AD4A 1FHDA 3S5YA 1GVIA 3WUGA 2YLLA 4WF7A 2CHNA 5A8PA 3WQ6A 1SFSA 2ZX8A 1OGGA 2FGLA 2E9BA 2EPMX 3TA9A 2ESCA 1JZ8A 3HG2A 4J3UA 1XYZA 2X2YA 2VNCA 3IANA 4OGZA 1BVNP 3MMDA 3LRMA 4UQCA 4AXNA 4C7DA 4WKAA 2ZUNA 3RM4A 1G0CA 1OB0A 1LG1A 2V3GA 4X0NA 4HTYA 3K8MA 3T0AA 5CPTA 3VVGA 2CKSA 2BXZA 2J7CA 3TTYA 1VB9A 2UY4A 1X1NA 4Y7EA 3BAXA 1TQWA 3VIFA 2EADA 2YJQA 2CYGA 4W5UA 4OZOA 3BSHA 1BTCA 2WMFA 3W6MA 3WF3A 2WK2A 4CD5A 4WKFA 1FH9A 5IXEA 4J3TA 3NSNA 2GDVA 4FNQA 1E0VA 3WELA 1QNRA 2E4TA 1QWNA 4LQ1A 3PTQA 1TR1A 1E73M 2BVYA 4MJ4A 1HKJA 2PB1A 4FLRA 1HP5A 3FAWA 4KRTA 2DT1A 2YA1A 2VTFA 4PUDA 3MI6A 2CKRA 2VVNA 1W9DM 4NZCA 4KGJA 4PMOA 2OSWA 5A6LA 4R5EA 2D3NA 1KR1A 2V3FA 1R7AA 2UY3A 4F8XA 1AQMA 1S46A 3LPGA 4E2OA 5CGTA 4MPKA 3WF1A 2WWCA 1W9XA 2XG9A 2EABA 1W2VA 2O92A 2F1BA 1D3CA 2E9LA 2D24A 3LXAA 1EDTA 5D9OA 3GDBA 2PBOA 3MS8A 3IGUA 2A3BA 1E5JA 1R7OA 1DEDA 4A4AA 4HMCA 5EFDA 1OGSA 1CXEA 1ISXA 1XD1A 1JFHA 3SCTA 3VNYA 3FXYA 3DHUA 3VGEA 3AHXA 3MUAA 1EDGA 2F8QA 4PMZA 5FL1A 5FKYA 1OBAA 1U2YA 4PMQA 1ITCA 3II1A 4V28A 2NW0A 2G8ZA 5LA0A 1R75A 4UFJA 4ATWA 4CKQA 4Z2LA 2DPEA 2FH8A 2GSJA 2CPUA 2YFOA 1NWTA 3K4AA 3U7VA 3FN9A 1V6VA 4Z2KA 5CLTA 3FW6A 2W66A 3WF0A 3WNNA 4TTGA 4ZXLA 4E4PA 1E1EA 3SUWA 1F4HA 3RIKA 4D6DA 2YL8A 2WC3A 2C0HA 4W85A 4AD0A 2VR4A 4AZ7A 4JCMA 4CD7A 1QI3A 3CC1A 3D52A 3OZPA 2WSPA 2W5FA 6A3HA 1BG9A 3WNKA 2Y24A 2BFGA 3B9DA 1KB3A 3AMLA 3WDIA 1JZ6A 1W3KA 1QNOA 1W1VA 1IZKA 4B3KA 4HU8A 5DT7A 1TMQA 4EANA 1VBRA 4HU0A 3AS3A 4RL3A 5E6ZA 2RGLA 1LWJA 2X0HA 1JYVA 3LRLA 5BROA 2WVUA 4UQAA 2VVSA 1UR1A 2GK1A 2WXDM 2VR5A 2Y8KA 3GBEA 1E40A 5CZKA 4D1JA 1UQYA 3UG3A 3CHFA 4M24A 3EJUA 3VGFA 1VFUA 1XD0A 2ZUMA 4FLSA 2UWFA 2G3JA 1O6IA 3AHVA 3SCVA 2YKKA 1CLVA 1E72M 4HA1A 1OSEA 4TTUA 3WD3A 1KCLA 3VIOA 4ACZA 4TVDA 3VD5A 1F4AA 2X2JA 2WCSA 3BC9A 4CCDA 2QPUA 2F61A 1KXHA 4AZBA 1FA2A 1TE1A 1US2A 3EDEA 2GJXA 1HJXA 3T08A 2XWDA 3BUBA 1DWGM 1PJ9A 3HU7A 5BWFA 5JBFA 1C90A 3M07A 3GXNA 3SUTA 2XM2A 4FK9A 5ECUA 3ZIZA 3I3BA 3RPMA 5AYIA 3BUQA 1UKOA 1UWRA 4FNSA 2YA0A 1WCGA 4W88A 3ZT6A 3D4ZA 4AEFA 3MO4A 4JKKA 2D1ZA 3CHCA 2J25A 2OWXA 1EO5A 1OWQA 2F2HA 3CGTA 1JYWA 4BQ2A 3AYRA 1QBBA 2D0HA 3CZSA 1R85A 3AIVA 3SEPA 2X05A 3LPFA 5HXMA 1J0ZA 4AZIA 3M46A 3O6AA 2G41A 3WENA 3GTNA 1CENA 3KWXA 3WDQA 3HN3A 4PTXA 4LYRA 4ZFMA 5C70A 3BGAA 1CYGA 3WFLA 1ECEA 2WHJA 3PBGA 1KFWA 1BAGA 1JG9A 1KR0A 1GJWA 1E6RA 1LF1A 2VUYA 2J47A 1K9EA 1M53A 4BF7A 3LXBA 2PBGA 3WFZA 1CECA 2WMJA 3T2OA 3OA5A 3FNDA 1UH2A 2XGBA 3DX1A 3SCRA 3HG3A 5JIWA 1AQHA 1ISYA 3BVVA 4UQBA 3KZSA 5CXPA 3KEHA 3VGBA 2YOCA 1UH4A 1ZBCA 1FH8A 3AISA 4E8DA 3KLLA 4DUWA 2ZX7A 3IAQA 4UQ9A 1LG2A 2QPSA 4GZJA 3WH7A 2W4XA 1KXQA 3CO4A 1HL9A 3CIVA 1J0HA 1W1PA 4HA4A 1OINA 5IDIA 5A3HA 1CTNA 5M17A 3W26A 3AHTA 3BVWA 3CUFA 2EBNA 5E0CA 1VRXA 3A5VA 1M7XA 4HOXA 2ZXAA 3GNOA 2D0FA 3BUPA 3K4DA 1H11A 2OW6A 3DX2A 1UA3A 5CGMA 4TUFA 1XC6A 1CGXA 1DWAM 1V3MA 3CHEA 4PEEA 3DYMA 4XX6A 1E56A 2WZIA 2D23A 2IXUA 1L0PA 1LLOA 3MSDA 1CXIA 1PX4A 1J9YA 1HN1A 4W7WA 3VIGA 2VRKA 1K9TA 5BXTA 2QHAA 4UFIA 5A6KA 1M03A 4Q7NA 1XH1A 5D8ZA 1OM0A 4JFWA 3WMBA 2JEPA 3LXCA 1U33A 1G1YA 1UD5A 3AROA 2WHLA 3CUJA 1C8YA 4LX4A 2ZWYA 1B3WA 1MQRA 5FL0A 1BVZA 1HXJA 3AXHA 3AIQA 3U7BA 2A3CA 1WDSA 2CBJA 4DUVA 2JIEA 3VPLA 3L4XA 3AMDA 2YDSA 4P7NA 3UETA 4QCFA 4MB5A 3WH5A 1ODUA 3BAYA 5E6YA 4JZ5A 5JBDA 3KL0A 5ABHA 1CXHA 4X9YA 2X1IA 3WEMA 1E6XM 5FD0A 3WBEA 4B9ZA 1C8QA 1XH0A 1UR0A 4MNKA 1PX8A 1NH6A 3W6LA 4TXEA 4GI8A 3WD4A 3MMUA 4AIEA 4KRUA 3W0KA 3VSVA 1R8LA 4F9DA 1W3LA 1HT6A 1KBKA 4OBRA 1KWGA 4FLOA 1US3A 2W61A 1MQQA 3VD9A 3PZUA 1E70M 6TAAA 2YDRA 2V3EA 2IXVA 3VNZA 4CCEA 1XV8A 2VJXA 5A69A 2C7FA 3E1F1 2Y2WA 2BHUA 2JFEX 1ISZA 1PAMA 4HOZA 2PWFA 1HJWA 3AXXA 2WANA 4V2XA 1H4PA 4PMRA 5AY7A 7TAAA 1AVAA 1JD7A 1BGGA 1WDRA 3WDRA 2FHBA 1W2PA 1V03A 3VIIA 2EXOA 1E1FA 4H2CA 2NT0A 3BCFA 1PEZA 3VTRA 4HPHA 1JZ4A 2G3MA 2CBVA 1ZL1A 4S3KA 4BA0A 3RM9A 1RPKA 2XHYA 4BS0A 2GVYA 1D2KA 3WNOA 4EAMA 4NX0A 3BXWA 2VMFA 1CGUA 5GNXA 1TQVA 1KBBA 7CGTA 2QMJA 5BXRA 1XRVA 3ZQ9A 3G6LA 5EFFA 5GNZA 3CZLA 4FNPA 1FFRA 3AS1A 3ARYA 4PSRA 3WQWA 3NJ3A 4J27A 3SCSA 4JFSA 4UFMA 3AIBA 2CCRA 3H55A 3L4ZA 1Y7VA 1B31A 2A3EA 4AD2A 3L4UA 1WAWA 3VSTA 1MW2A 3N13A 1JIBA 3PZVA 1MYRA 3WD0A 2XFRA 4CUCA 2O9RA 3CUHA 2WC7A 4IUGA 4DWSB 2Z1SA 4EE9A 3PZMA 1W3JA 1LL6A 2ZXQA 4PCTA 3AHZA 1CWYA 4C7GA 3OLGA 2WAGA 3BVUA 1CIUA 1H0GA 1QPKA 8A3HA 1DWIM 1GUVA 3AHYA 3BMWA 1NP0A 1B9ZA 4ZE4A 3OGSA 3WDHA 1GOQA 1HKMA 1CGVA 3CLWA 3W25A 2E3ZA 3CHDA 4NI3A 1VIWA 1CXFA 3MUZ1 2WCGA 3SUVA 2XM1A 4PTVA 3NIYA 2GFTA 1SMDA 4JFUA 1KCKA 1WZAA 1BYDA 3A6OA 3N04A 5A6MA 1GOMA 3NCOA 2RGMA 1GJUA 1V6XA 4U3AA 1OIFA 2DT2A 4CVWA 3OIHA 1JZ7A 3POCA 2WPGA 3WMCA 1J0YA 1LL4A 3GH5A 3VDHA 3GNRA 3PZOA 1QW9A 4CD4A 4XZBA 3PTKA 3EDKA 1JAKA 4UCFA 5CSYA 2JE8A 3WDJA 2OWCA 3F5LA 1E4LA 1CGYA 4ZEPA 4BZYA 4D6HA 4WJXA 1E6NA 1PIGA 1JZ2A 4P8VA 2ZIDA 1SR0A 1JDAA 3VDAA 1Z32X 3VKKA 4TVUA 3BVXA 1QI4A 4PMDA 3D51A
chains in the Genus database with same CATH superfamily
3FSTA 4N2NA 3HG1B 2IKIA 3RNDA 5KSWA 3HUJB 4JKLA 5IHUH 1CDGA 4YXLH 4O53A 4JW3A 4A8NA 4EPBC 1A5BA 1O95A 4W5ZA 3U30B 4C6CA 4PRNB 1KTDA 4ZBCA 3TEXA 2ZNXA 4YHMH 2OO0A 1TVHA 4MXWL 4EBQL 5DN1A 4L4JA 1U2HA 4IGSA 3I9PA 1SN2A 4G6MH 5CSZA 4GXWA 4JTHA 5AZ0A 3WQDA 2I60H 2F7PA 3UABA 1X6LA 4QY8A 2KDYA 3O3AB 4FXLA 7REQA 2E74C 2BNUB 2DM7A 3EJZD 4LSPL 4KWUA 1ZGLA 2UZXA 2EVJA 3S2CA 3D3AA 3IPEA 2DQWA 1OP4A 1WKFA 5ICZB 1GG1A 5CPQA 1P5VA 1M9HA 3WL1A 3OKOB 4H25A 5A2BA 2DP3A 3TBCA 2E7LA 2EDLA 1RH9A 2DM3A 5FXCH 2IANE 3UZQA 3EMZA 4YBLC 4DQAA 1E55A 3TBVA 4OU3A 1BXCA 2GYSA 1OCOB 4IMLB 4N25A 2WCAA 1NPUA 1WF5A 4ZMTA 3LRGA 4IRSA 4HKPA 4CMHC 1QLFA 1T7ZA 2AAAA 4HV8A 3BPLB 5I0DA 5KS9A 1UOLA 2J62A 3CMJA 5MEQB 4LOUD 1C5DB 3TYUA 4ACYA 1WNOA 2IANB 2X09A 1XHGA 2VEMA 4ZMPA 4KUZL 3J7HA 3K91A 5TK2A 1B0RA 3UIYA 2G5WA 3LM3A 5HHVL 2FNBA 4JTAA 4X98B 4JTUA 3S4SA 4X4ZA 5FO8A 4F4RA 1D5MA 4HLZG 3ARBC 1KC5L 2ENYA 3GR8A 2ZFAA 4LGXA 3TURA 4XODA 2AQWA 1NOFA 3B8WA 4WWPA 3C5QA 1OG0A 5I74B 3UO8B 4F7EB 2R7EA 3B7SA 2YLAA 3FB5A 1UYWL 3MV8D 3RDKA 1E4WH 1SSDA 3JW7A 1T89A 4DEFA 3NAVA 1LQ0A 1O6TA 3S48A 5BQ7B 3GD6A 3OW1A 3VFOB 5FYKH 4MNQE 1GQIA 1NAMA 2NY0C 4O2FB 2EVFA 1NCUA 1KJVA 2ZZ1A 1T2QH 3RYMA 2RH9A 4MWAD 4XSLA 1W31A 2C13A 4O16A 4K23L 1U3ZA 4FOMA 1Z9OA 1EX0A 4CBPA 3DV6A 1MXDA 4XHJD 2J5WA 4QR6A 3GBML 3V0TA 4KJPC 2XVBA 1PS3A 2RA1A 4OAWA 4X7SH 1JCLA 2BVDA 5TQLA 1UM4H 1P5VB 3QPQC 4JTDA 2FUTA 2OMXB 4W9DC 3LHAA 4WGKA 1XHHA 1TWWA 4FQIL 2CRIA 2Z6FA 5IMMB 3GZPA 3MLXH 4BK5A 3M88A 3LCXA 1TZ7A 5F9WC 4ANKA 3KXFD 1JXJA 4HWZB 3QUZC 5HPMA 4L65A 3MRQB 5L6YL 4Q7DA 4IMGA 3CVHL 4P07A 4OOZA 5I02A 4U6HA 4F0LA 2DQMA 2GK0B 4HCRA 1FO0A 4UAHA 7XIMA 2FLIA 5BXSA 2ATSA 3EOTL 4OLWH 4Z7UE 5E5MA 3CSPA 2HSIA 3DO4A 3WS3A 1GEHA 4LBUA 4JTSA 4MX7A 3RN6A 2R14A 2Y85A 3BN9D 3AZTA 4GAYB 4GFTB 3WLSA 3ZO0A 1NL0L 1PSCA 3QWNA 2WVVB 1OGBA 3TXZA 3QA3A 1I1FB 1XGTB 4B9CA 1F4XH 5D04C 1UWUA 5A94A 1MFCH 3PDDA 4CDHA 2O7SA 4H2AA 2XSBA 5F3HA 3LPOA 1V3LA 2CXGA 2PPGA 4HCRL 3SKOB 3NZGA 1JUKA 4H88H 1SYVB 4Z77A 4Q0XH 1JL8A 5C2BL 1SFJA 5E8DL 5H37G 3AMCA 1ACXA 4PFEA 4ZW5A 3CB8A 1SM9A 4YIWA 3BJTA 5L4MA 1FZMB 3WEAA 2QUVA 1YPZB 1TCRA 3QQ4A 4LFHG 2JF6A 4HLEA 5FGCE 1TFHA 2OMZA 3CB3A 3QNXA 4OB5H 1MFVA 1AL7A 4MNJA 4NUGH 5HAOA 1S9WB 2K9UA 1S5NA 3W83A 2XKNA 3JZEA 3MLWH 4OSUL 1DQJB 1CG9B 1O5RA 1G9ML 3ARVA 3IE4A 5E5RB 5AB0A 3PFRA 2HX7A 3SBRA 4LH8A 4D6CA 4DXKA 1X9QA 3CDFA 4A6YA 1BFOA 3US1A 4R7JA 2HLEB 3BAIA 3H56A 4S0HA 1XFPA 4UZUA 1O5KA 1NEZG 3AUJA 3NQGA 3HS0C 1TTFA 2EUXA 1O68A 2QSCL 3ZS4A 1WUZA 1QVBA 2BSRB 4J28A 2P0OA 4WSGA 3DURA 2X4NB 5AAPA 4NJKA 3PHAA 4LYPA 5GS1B 3EO9H 3PWPD 4P9HH 2HB0A 4YHYC 3O3RA 2CNYA 1USZA 1MCBA 3MNZA 4ORZC 5IB5B 3UU0A 3WS6C 1FCVA 1I2PA 4A7UA 1L4IA 1DVZA 4Z5RB 4U1HA 2OEMA 2PC8A 2Y0SA 2QEJA 2VC9A 1EZSA 1EAOA 4G70B 4BD4A 4ZNEA 3PZGA 3TFBA 5HHXL 4JNZA 5C0CA 4ZZ9A 3DHPA 3N14A 3OGVA 4UB0H 1G7HB 4LVNC 5AW3B 4ZFOB 5C09D 5FA5A 1NDGA 4QXUL 2PYEA 2WMHA 2XU2A 3RDTC 5KS9F 4S3FA 3BH8A 3R06B 1GOOA 2X1WL 4Z7UF 3ERXA 2OU4A 4IOFD 3LH2H 1V0LA 1VLWA 4TUKH 3CAFA 1YDYA 4URTB 1N7KA 3B9NA 3ZVHB 2P8MA 1ETZB 1T21B 1OV8A 1E3XA 2J6WA 4JFDD 4MS8D 4GBXA 4JKMA 3MV7D 4LOVA 1JMZA 2PSNA 2IJ0C 2O55A 3IJYA 3NDOA 1RUPL 3BZEB 1PCXA 2HX8A 2QCFA 5GS1A 4LY4A 4OGYL 2JELH 3MP3A 5DZNA 4LKCB 2IH3B 2RAGA 4XZIA 2BOBA 5EBWA 3CFUA 4ALAL 4F5CE 2BY1A 1CC3A 5C0FA 3ARBA 2GJXB 2ADGA 3V5DB 1HO1A 1HZYA 4UIKL 1VEPA 4JFEA 4M1GL 4A55A 5E5LA 3G08B 3G1RA 1R17A 1OTSD 3G3LA 1ROCA 1GYCA 1Z9SB 5KTEH 1Q6RA 3M1ZA 3NM3A 4XCEA 5FEPA 4ENEC 3VILA 4U3SA 1LRNA 2YXXA 3CSGA 3I74A 2YB4A 4PWHA 4R4BB 5CU9A 5CZJA 3ESUF 3WEBA 3C60A 3EJRA 3HHRB 1HXYB 1QSZA 3PSWA 3TM6A 2LW3A 3VNKA 2J6EH 5FO7B 4HZLB 5AB3A 4KRPC 4ZX5A 3RIAK 4ZNEE 1OF6A 4LS0A 3HZMB 1S38A 4FTVD 5FO2A 3G5ZA 3SY0A 1DL3A 5F93C 2PYEE 4JANB 2I9LB 2J4WL 1IBGL 1MOEA 2JLPA 4UQDA 3NEHA 3ZX1A 2Q86B 3MRIB 1DANT 4DFIA 3NDZE 3PAYA 4GG9A 2EDEA 1MW3A 4ZS6C 4NIKB 5IVXE 1QNSA 3EH2A 1P4LB 2RKXA 4HIIA 4WSJA 1B1YA 1KB9J 1OF8A 25C8H 1HHIA 3AITA 2Y1VA 2XTJE 1JRHH 2ICES 3GBLA 4LEXL 3H8NA 4LZKA 4QHUB 4YGAB 3VD3A 3QA3B 4LC8A 3KPMB 1MW0A 3WGVB 3ETSA 4INFA 3E6HB 5CSBA 3COTA 2X4OA 3GIVB 3I6GB 5T91A 1WB0A 1XVSA 3WO3B 3BZEA 3KYMA 3TA4D 2XN9A 2V82A 4LVOB 4YWSA 3Q6GL 1UW9A 3WSQH 2YFNA 1WZMA 5DHYA 3MRQA 5JMRA 5D6CA 3E9UA 1ZLSH 4ACTA 1XBVA 2NY3B 2WSKA 4H44C 3HAEB 4I88A 3V10A 4A66A 1H5BA 4CVUA 4XKYA 2FECI 4KHTH 2Q7YA 4U1LA 4U6YB 4OZIB 4HKZA 2EH7L 2VDLL 2EDRA 3LEVH 1C7SA 4MSSA 2RD0A 5J9PA 3A23A 1Y18B 3PWPB 2E7CA 2Z7WA 3JZ7A 4D6JA 3FO0L 3P3RA 4G8IB 5D1QD 3P0WA 1UWYA 4X63A 2BO0A 5HDOA 1NCWH 1K4HA 2E77A 4YE4L 3SDCD 4OLUH 3WEXA 3WNLA 1THCA 1E67A 5EOQH 4KFZC 1Q7MA 2R82A 3KRSA 4OIIH 2VZSA 1F7BA 5HY9A 3GG1A 4QFUA 5CJNA 3N34A 5CPMA 1T83C 2F8OA 1E9QB 1P53A 5GS3A 4GE8A 3UYCA 2C9SA 5I79A 4H8UA 3SN0A 3LEYH 2OQLA 4H9YA 3RWGA 4PP1C 4A3RA 3RBGA 3AIEA 2VXVH 3KJ4B 3UW6A 4DTGH 5G4HC 5M03A 3PHOB 4ZQNA 1WWWX 2X3CA 1NLBL 3QHTC 2WZMA 3QPYA 7A3HA 4M43H 3EPMA 5HHNB 2GQAA 5LGXA 2QKIA 4Q8NA 1F5ZA 1BVLA 1T20A 1LE9B 3L1FA 1WQ5A 4OZHF 1AO7E 2WC4A 3I9GH 1XW8A 2X1IA 2AXHA 4LP4A 4W9FC 3QG7H 1NZRA 1OD7A 4WGWB 5DLML 4F33A 3DXAB 4ACPA 5F89A 4E9RA 4HZ7A 1VZIA 3JWDC 1FFNA 4WFFD 5C2UB 4HGMA 5D1ZD 5CKAA 1LTDA 1KNWA 4ZQCA 4ZO7A 3C6CA 1GNXA 5FYLE 1E9PA 1K8ZA 1BVNT 3UZ5A 3G5XA 4AWSA 1HL8A 5I00A 1O6SB 2VZUA 4WY7H 3VFNA 3TN4A 1TZIB 2W8CA 2DQEH 1QFUL 2MQGA 3TT1L 3D48R 4KMLB 4XC1L 3GU2A 4X6CB 4RRPA 3GTFA 3CMGA 1B9KA 3U9WA 5DYFA 3V4VA 3C2YA 4ICCX 3NABL 4EZMA 1YDOA 4WK9A 3T2LA 3WCZA 3WJLA 5SWQB 2BVPB 4J6RL 1H62A 3B97A 15C8H 3DFHA 1N82A 4Y1AD 3EBGA 4G56A 3NZ8B 1FRBA 3E3HA 4LBAA 5ICXB 1IIHA 1YXYA 5IRPA 3FS2A 1W17A 5I1KH 3WLMA 4QXWA 4FQXA 4GI6A 2ZQKA 4RLDA 2WKOF 1QP1A 3PAOA 2YMXL 1UPPA 2C3ZA 4PBGA 1DJXA 3W1QA 1T41A 3V7AG 3LHVA 1MJ8L 4JTLA 1B88A 1F11B 3U2ZA 1L3NA 2REQB 3TYAA 3ZL1A 5AKTA 1DLFH 1PDKA 1I8LC 4IDLA 5DJXB 5BZZA 1ADQA 3LS9A 4AZGA 1FP9A 1JGEB 1J5IA 1FP5A 1UD4A 1J9SA 3U57A 5HPCA 1H3TA 5I6OA 4KKQA 1G9NH 1TTRA 1VSCA 2ZUWA 3IMVA 4P23A 3TOPA 4EXKA 2R1WA 2Y2YA 2LU4A 4IJ3B 4OIAA 5FX3A 2OLSA 2ZXBA 4K55A 1UASA 3GSOB 3UTSD 3PXJA 3ZTJH 4PGEA 4Z76A 1JGLH 5IB2B 3UJJH 2A83B 3SDXA 3VIPA 2BXYA 2K8QA 3G5YB 4LLQA 2XETA 3C6SB 3MCG1 4GINA 4JPIA 4RZCB 2VCCA 1OGTA 3BP7A 1Z2KA 3IMTA 3ET9F 3K6SA 5LBVA 4U4MA 1R46A 5F2GA 1KOAA 4AC2A 1BYBA 4N90E 2VELA 3V1HA 1FZJB 1CGWA 3N2XA 4P3DA 3PGCB 2J12B 5JHAA 2ILLA 3LDBB 2PNDA 5TE7H 4AEEA 1XR2A 1VERA 2MNJB 2WLIB 3HS0A 3SKJL 1WD9A 4ADIA 1G9EA 1XKJA 1N19A 4YFLI 4MZIA 1B0RB 3WH8A 3D3VD 3DIFA 5KEZA 1WKDA 5AKVA 2V2DA 1QR4A 4MRBA 3D1MC 3W7HA 4K8RD 3TZVC 1B6DA 2BCKA 1A3LH 2CETA 1D7FA 4POZC 4OJEH 1MH5A 1FWRA 1J1OH 2PF6A 3B56A 3MUHL 3NH7L 4M03A 2QF8A 4LCIL 4HEMA 1BYPA 3VTTA 3PBUA 2AJ3A 4NUJA 1ED3B 3K5SA 4M56A 3CFNA 3IJQA 1RK0A 3IWVA 4JUTA 5AW9B 3ORJA 2ISDA 3TA3B 4JFXB 3WUWG 1WHOA 1B3XA 3WO8A 3SB3A 1NKOA 4RW3A 1F73A 2ZKXA 3C5ZA 4W68A 3FVMA 2WNXA 1ECQA 1GQKA 5CJ5A 3S1XA 3W82A 2EYSA 4G8EB 3WJXA 2X42A 2VWSA 3SM0A 3A0OA 1Q6DA 5E56A 4QHPA 2XFXB 1D7BA 5LIWX 3QWOB 4MTVA 2HVBA 1TJPA 1RJZA 3C2AL 3QOMA 4DAGL 5EMKA 1TXKA 1KLGB 1PFOA 1QUPA 3MRHB 2PI6A 2J88H 2HWGA 1NDVA 1MVYA 4PRNA 1QASA 1H61A 1GYNA 5IREA 1HFBA 4NXKA 4Q6IA 5E4OA 3VZYA 1IV8A 1EHNA 2X4RA 3HFMH 2J75A 4CW1A 5DT5A 4XPGH 5FFOA 3U2IA 3C2RA 2H0EA 5EWIH 1ISVA 1MCPH 5CEZD 5E08H 1M71B 2L7UA 1A0EA 3LOTA 4OLEA 2PZNA 1NCOA 2ATKA 2ADFH 3SE6A 1SUXA 4IPPA 4F8LA 1IBBA 1LK3L 1M4KA 2EKSB 3NFSH 1W5OA 1LEIB 4G80A 2GSHA 4XZNX 1QFHA 2IBBA 1ZT7A 5DANA 3IJHA 1CYWA 1CCWB 1MWAH 1XLDA 1YEYA 3V36A 1PUDA 2JKAA 5EO1B 1FY6A 2PPFA 2XG5A 3KDMA 2ZUUA 1NCCH 3IMBA 2EVHA 1FSKB 2DT3A 2R1YA 4GPNA 2HG5A 4NX5A 3L13A 1C12A 4RFEA 4EK7A 4L6HA 2Q8AL 2A4AA 4LEEA 3OIXA 4D8LA 1OAYH 1QSEA 1WK0A 4H8WH 3LQZA 4QNPF 4APQA 2WMGA 3A4JA 3ITGA 3O2VH 3FTUA 4ZMWA 1R5VB 2V2TB 3MLUL 3PRZA 4KRNA 4N1HB 1ZV9A 2IWEA 1DIKA 1ULVA 2FYMA 4MNLA 3WU1A 4OKDA 4TNWK 1P4BH 4X3ZA 4EPDC 4JQXC 5DLLA 1KC7A 1NC2A 4DBSA 4K7PH 4N0UE 1FWCC 2W79A 1I1YA 4NO2A 1JWSA 4DP0X 2Y6SD 3TN0D 2QVNA 4ZO8A 4S1DC 2W92A 2YPKB 1SLXA 2P7TB 4E9QA 4LV4A 2J5LB 4EWND 5GRVK 1DVFD 4GKZA 3EGSA 3QJFB 2QTVA 2O5XL 2Z7ZA 4HUMB 4Q9RH 4Q4KA 2F19L 4U5KA 1X5ZA 2WWNA 2WNWA 1IE4A 3AS0A 3EMCA 1QOQA 2UY6B 1LOQA 2LLLA 4U1NA 3VG0H 2EDFA 3Q8EA 1XLJA 2WZHA 3CQHA 4OJYA 3VRLF 3A12A 3NM1A 3RGVB 3T6WA 5DMLA 3LEXA 3A3XA 1WV7T 4C6DA 3KPQB 2J71A 4NFBA 1CQKA 3BP5B 2YQ3A 2G4GA 2HXAA 4P04A 3CJPA 2CFFA 2DYSB 1W9BM 4IX0A 2DI9A 1PCKA 4YSQA 1W3TA 1EHAA 2WWOA 3NTCH 4L4VE 4QRTA 3I2CH 1B57A 2OTUA 1F9CA 1XLBA 3CAWA 4HT1L 1FUYA 2WJDA 2HE8A 4QHNB 3T8XB 4N5ED 4IL0A 5JQ9A 2GJZA 4NI6A 2XFYA 5BO0D 2NX5A 1ZLEA 4QLWA 3TK7A 1KIRA 4QOKD 3W2UA 2P24B 2YK1L 3US9A 5C2CA 1DBMH 1J8HA 2BSED 5K9XA 2DT0A 4K3GA 4HZMA 1P2CB 3B2UD 4N0UA 4D0DB 4GIYA 2IG2L 3SDXE 3TYBA 4ZS6D 4IJTA 4XH2A 3T4AA 4EX4A 4NRZB 5CMAA 5IEHA 4KW2A 4B3LA 2D7MA 3CBKB 4WKZB 3KXQA 3UWUA 2GJPA 3NA9L 1NFBA 2XWBB 1UR3M 1PYWA 3SKNB 3ATBA 3OP2A 1ETJA 5FAGA 1P6WA 3KYKL 3ZWSA 2BIPA 3MN8A 3KXFA 3GXFA 2XLLA 1UZ1A 1G7JB 1HH6B 3FT9A 2FWLB 1VIZA 2Y62A 4QXUH 4A3HA 5IJCC 4PRTA 1MVFA 1FZOB 2DL9A 3MGOA 5FLVA 1UBPC 3UCDA 5K3VA 1Q0YL 2XOTA 1A4MA 5FK9A 1SFTA 2OZ0A 3TBYB 3TIEA 3SCMC 3HGRA 5B80A 1FLRH 4AZ5A 3OR6A 3FSWA 1VPOH 2RQ8A 2WAQA 5HDWA 2OEKA 3QKZA 3FRPG 4Y19E 3IYLW 3CAQA 5A8GA 5IHRA 3ALGA 1E1CB 4G6KH 3NQIA 1U3HA 3O41A 4E41B 3NXFA 4L9ZA 4PJCA 4RV8A 5HHOA 5B7ZA 4Z7VE 5B1JC 1UPMB 4WKXA 1D2OA 3MREB 1PY0A 3W29A 2OYMA 2SFPA 5JNYB 2X2IA 4EN3A 3LNFA 2EEXA 4Z7VA 4OUOA 4YHYB 1YJDC 3DTUB 2AOSA 2J6VA 8RUCA 3W1MA 3CIAA 3VMOA 1LEGA 1IJ9A 2QCMA 2B16A 2G60H 2FIKA 3GFXA 1TOXA 1XIWD 1LUCA 4FQXC 4GXPA 1UWXK 3PIQB 1CE6B 4N0RA 4TVPL 2PDWA 4UOQA 4ZAKA 3JUGA 1A9BA 1LO3H 4N1CA 4Y5YC 4V1DB 4D0BB 3X12A 1OAKL 1UWAA 3CXDH 4NHCL 3VXSB 3CZGA 4O58H 2M83A 4DP2X 3LQGA 1G7PA 1RJCA 4GRLA 1W56A 4W9CC 3OJMB 3I4EA 3GJEB 3FTWA 2XZ7A 5DC4B 1BQLL 4Q2ZA 3W01A 3YPIA 2NW2B 4PV1C 2AJXH 5AVYB 4PB9L 4F7KA 3MRNB 3SUSA 1AO7D 2Z93B 1IRAY 7TIMA 5C0DB 1EDQA 3GSOA 1C93A 5CHNA 2BVOB 2P5WD 4XCYA 1L7IH 3GFUA 3M1BB 1V10A 5FGCB 1GC1C 4MZ2A 3WXWH 5BOZG 1BVWA 3VYNA 4WFFE 3MJMA 1UMYA 3LK6A 1U8NB 1BEXA 4G83A 3NSMA 2J5LC 3IGFA 3B8SA 2DI7A 3SOBL 4L3FA 4QHMB 4MIMA 4S3EA 2PDYA 1K3IA 1KCUL 4N9EA 5KJ4A 4REQA 4WWID 3T0WA 1WV2A 3SCQA 5HWMA 1XLCA 1HHKA 2FQFA 4XPAL 1Z42A 2F19H 5G55A 4FQLL 5JO5B 3UXAA 2ZWZA 4HAFA 5AC6A 1G6RH 2M2DA 2ZAGA 3WTVA 3GMPA 2PP0A 3FOKA 1QNIA 4RAVA 5DVOA 5JDSA 3LCFA 5C0CD 3BVTA 2PC4A 4LLMA 2X8RA 1KELH 3AY4A 1ACYL 1KJMB 4ENED 3PJSB 3UYRH 5FYJH 1HAWA 3H24A 3SR7A 1OSPH 2ZWLT 1S7QA 3VTAA 3CMOH 4JM2B 1QFWL 4TQHA 2NY3D 1XL6A 3FQ4A 4WIQA 5ANME 3TV8A 3TZVA 3X14A 1EFXB 4NN6C 3UH8A 3RQ3A 1N5YL 3QBUA 1XF2A 1Z89A 3N0AA 2EVIA 3CBJB 3WLQA 3UPMA 4FP1A 2Z1XA 2OP4H 1DWHM 2VDMH 3MRHA 1JF6A 4MA7H 1IC4L 3OAZK 2RH0A 1PLAA 1TPXB 5DTFB 3P77B 2BSSB 2BDNL 4AB4A 2AXWA 3EDDA 3O3EB 5IQ9B 2CLKA 4H01A 1O6SA 3ARUA 2DSWA 2QR6A 4FSAA 4OI7A 2R59A 3FB7A 3QDGB 2IAAC 1WAEA 4ATDA 3GS6A 3V0EA 3T2NH 5EIIA 3TCLB 3BH9B 1MWAL 2J8TA 3BX7C 4FXJA 1CF8L 3I9GL 5KSBA 3RL1B 1KBPA 3CWOX 2E0PA 5I77A 1P5UA 2X4PB 3D0LA 4WO4C 2PWVA 2Q1EA 3HN5A 4RGNB 4TUOA 3DC0A 3P1VA 4KI5D 4NC2B 3CH8A 1CLYH 2MOVA 3GSVA 4WEUD 5KANG 2Q3RA 4N8VG 5IB3B 4X8CA 4IBYA 4XPGL 4ONHB 4O8RA 4X5QA 4JKWA 4IRJB 3BGGA 1CICD 1QRKA 2AF2A 2XIBA 2LOEA 4JM0A 4RFOL 4PRHD 1PTAA 1VBUA 2X44D 4NU7A 2H47C 4IBZA 5D9NA 1JV2B 1VCBC 2CR3A 3P02A 3P0VL 1S4IA 2ATPA 1JPGB 3S96B 1E0UA 3BMXA 3OBKA 5TNVA 3SRHA 3I6KA 1B4EA 5IW3A 1XC4A 3R12A 3V1PA 1G6RB 2KMWA 2VDQH 4WHYH 1TV2A 4EI0A 5BMFH 3D85A 3ZRSA 3KGTA 5DJZA 4DVRH 2WBJD 3DBSA 4A3YA 2DW7A 4GD0A 3GHBH 2E9IA 2WO2B 1E27B 3A4XA 2ZCLH 2A6NA 3ZJ8A 1IFHL 1QUNA 3LNGA 3UQNA 3NL2A 2NSMA 3UA3A 1NEPA 5JPMB 1MJ7L 2MWCA 1NM9A 4H41A 4J3OC 4O2EB 2WZPD 2VN6A 4U1LB 2Q7YB 3QXAA 3KWTA 2Y7MA 2HK1A 1VAHA 3D30A 3M7FB 3U2JA 4PGDA 1WUNT 5DURB 2ITEA 1KTJA 2R0WL 3WFEL 5EZJB 3WY3A 3VAEA 1WH0A 1F13A 1A4CA 4H1LG 4AGQA 1E50A 4GIEA 3MX0A 4JKPH 1OM3H 3RU6A 3X3GH 1FA4A 3MJ6A 3R58A 3ZFHA 4D1IA 5LQBH 3FJLA 3KWWB 4HC1L 3BKCH 4JTTA 2XWJA 3K2MC 4YDLB 4P5TA 4ZQTA 1NWRA 1MAML 1T5XB 1JGDB 1QXLA 1MEXL 4Q8MA 5T9CE 3S5LB 1E5BA 2ZX5A 3L3DB 3WMPA 1PF3A 6PCYA 1O5QA 3E74A 3H6JA 4D72A 1I8IB 4BYHA 1CZ1A 1PWLA 1TVBA 2WQPA 3L3DA 3NSJA 4MKNA 2QDVA 3TYFA 1J18A 1UOKA 1MI5A 4Z1BA 2TPSA 3KBSA 1Q66A 3AM8C 3BK0A 1P1VA 4HOWA 1H7OA 2OULB 4JANA 1LDPL 4UNIA 4JQ4A 3MLZH 2DWYA 4H9ZA 4JZOB 4WDIA 1RZFH 2UX7A 2DLFH 4LDLB 4C6EA 4Q8OA 3N41F 1RQEA 4M4RB 3CMFA 4O1EA 1O9VA 3GM8A 1W15A 5EU7C 4B4FA 2R0KH 4WV1C 5BRQA 2IPGA 3J2PA 3QO0B 1IXNA 2A38A 1UYQA 5HA7A 4MCNA 1C8XA 3WIJA 1GPOH 1IBDA 4GXUN 2WWDA 1N4XL 4BUGA 4CVXB 3W5NA 5HWNA 1YUHA 4LUYA 2XJ7A 3TTQA 1LBFA 4H2HA 4KQNA 3UPWA 5IW6B 5BCAA 3S6OA 5FYLD 3QJAA 4M48L 2FT7A 3MNVA 4MA3A 3ISIX 3NCYP 3EFFA 5D8WA 3QJVB 5C07E 1TCDA 3P2BA 4J6RH 3RWHA 2YL5A 3N4AA 2X0VA 4S3DA 2DLIA 5AC5A 4LHUA 3C5SB 2GUYA 5ECGA 3SGZA 1Q9LA 4QKXB 3FCUB 2YIHA 5KSAD 3DUSA 5MI0B 5CGBA 1CE1H 1AJ0A 1M01A 1U8QB 2IDQA 5ICYA 5F9AC 3TX9A 3GRIA 4M5ZL 2IPWA 1V27A 3G6MA 3TN0C 2A6KA 4L23A 4IG2B 4LVEA 4LCYA 1USQA 3B1TA 3MOQA 3APDA 5ANMA 2O5ZH 3PAUA 3PWUB 5A7BA 3IFNL 2E9MA 1U3HC 4MDOA 4WRHA 1AJ2A 3Q13A 5FOBA 3HBLA 1UJ3C 1EMTH 2B39A 4P9ML 1TFVA 5CZ0A 3UZZA 4P2OB 5T3ZL 1UWSA 4CSPA 3H6AA 1OO2A 4N2HA 3AXLA 2GUOB 3DOHA 1OCNA 1A21A 4H5SB 4US6A 12E8L 1P5UC 2CO3A 3WJJC 5JW3L 1Q1JL 3NACL 1E0XA 2VI0A 1WIPA 2CM5A 3DHJA 3COOA 1W72B 3VI4E 4BH8A 3Q1SL 3ZE1B 3QIWB 1PHWA 1LOSA 2WQSA 4HIXH 4QTFA 5K9OA 4JHWL 2Z8RA 2YZ5A 2H45A 2QJHA 3N2JA 3V5FA 4FF5A 1JZGA 4PCSA 2OMTB 4HUNB 5G5DB 3CZ8A 4CKVX 3R8HA 3THCA 3GSWB 2F5AL 5GSVA 2EHHA 1TZHA 1SEBA 2P88A 2VJ0A 2FR4A 1NGXB 4P8WA 2VLJD 4NWTL 4C83B 4PVNA 1KCXA 1O7AA 4KX9A 5ABGA 3FN0L 4GA8A 5IFAH 1YPZA 1RY8A 3D2UB 3W7EA 3RP1A 4YFEA 5K69A 4YBLB 3CN1A 4UWQB 5FECB 3DAQA 3TO4A 4AQEA 4XCFH 5ISZA 1UGKA 3AWEA 2O0TA 2N59A 3GHTA 3NIFB 4BV1A 2DM4A 2CITA 1TQSA 2EH7H 5B21A 2V63A 4QXTA 5DD6B 1QX1A 5CBAB 1D5IL 1ZSDA 2AJXL 8CGTA 5ID0B 1XIMA 1E4IA 1NL0H 1U8KA 1GOIA 4C6KA 5MENA 1S2CA 3F5KA 3V3WA 3O11B 3W2JA 4MAZA 2VX5A 1VPYA 4G6JH 2BSCA 1IAIL 1NGWB 2JKWA 2B3RA 2EIEA 3F58H 4PY7B 4AMCA 2AFNA 3BJSA 3EX3A 2JJVA 3CVHH 4PFHA 3BJ91 2EG6A 2BX5A 5F9WB 3NDYE 2XFFA 5KWYC 2HROA 3EJJX 1G01A 1MLBA 3ZE1F 5B3SB 1WXJA 1Q2SA 1OP9A 1A0CA 2A0LC 4U1GC 4M6ML 1VADB 1OK0A 4PJ7A 3WIIL 1W91A 1NBVH 3S35L 2FX7L 3L9YA 3PIQA 5HYQB 1CNVA 1CLKA 1S9XA 1WUEA 5HGGS 3LBOA 3R8QA 1U41A 1J5CA 2YCLA 1OPOA 5FJJA 1DWFM 1EWEA 1IGCH 4K1GA 2P8MB 1MQPA 2IF7A 1XFCA 4GKSB 1J5TA 2FJHA 3FT0A 5DD3H 3RVXC 3N2OA 3WMQA 1MJ7H 2O6PA 4LVHB 2W67A 1O60A 1LMIA 3LV5A 4RUBA 4UTWA 2D7NA 3QQXA 1OK4A 5FI8A 2FYYA 5DO8A 4D6FA 5LHFA 1LP9A 3JU2A 3AREA 4ANWA 3QNYB 4U31A 2I24N 2UXVA 4TV3A 5LGZA 3NDZA 4YAQA 2DKUA 4J3SA 4LRNL 5HULA 3AY2A 4XRCA 5BOEA 1D5XA 3ABZA 3EKCA 3WEOA 1PVNA 3HA1A 2YGQA 2IH9A 1U3YA 3C5SA 3IJ7A 3BFWA 5AUMB 3WN5B 1MVUA 1FH2A 2FTAA 3N73A 5A2LH 3V6BR 1YYAA 3EFFB 1I3RA 1YNTF 3MBXH 2ED9A 2P47B 3MNVB 3EYVA 4OUUA 3P0VH 4JRYB 43C9A 5EEXA 4Y4HD 3R7RA 4QLKA 1MAKA 5JMOC 2A3AA 4YUEH 1ZENA 1EH9A 1QSED 2DPKA 4AZUA 1OG6A 1YUHB 1TPB1 4EWJA 2D2HA 3KS0J 1IXPA 4TS6A 1BFOB 4ZD3L 4D9RD 1A1MA 1PV8A 3GC4A 3Q67A 5D9SB 4IPIA 4AC1X 4GWEA 4IOSA 1NGYA 3TE9A 2X0WA 3EOBB 2OT0A 2XINA 3LTYA 3WFHA 3RG1C 4G6FB 3EUDA 3LH2L 3OGCA 3BRGC 2Y1HA 43CAA 5I0VA 4QLJA 4NNYA 3RXZA 2P3EA 1K7FA 4XPHH 1FIGH 5ADOH 1L9PA 1IO4C 1MCNA 3AGVA 4ZL1A 3MO1B 2J4GA 2NZLA 4ZO9A 3OVPA 1JCNA 4G1NA 1SJEA 4P59H 5EUKA 3O9WB 1QNQA 1FL3B 5EA0H 5F6HI 3SJVD 1DXIA 2OMYB 4BR1A 5JQHC 4DP7X 3SSJA 4GLEA 2R1XA 4GKNA 2GTZA 2YD6A 4JRYA 43C9B 1QWUA 3LTVA 4I1RA 4D8AA 1SDAB 5E8PA 2F7OA 3HI1A 4L80A 4XCCH 3GJFH 4LUJA 4PL2A 1INQA 1YEKH 4H8VA 4MG4A 4NNBA 1MPAH 4Z2JA 4ABVA 1BWMA 2RAMA 4YAQB 1JGIA 3O15A 3BUDA 3OM3B 4RGMB 1XGRA 1FWJC 1OK6A 1YIXA 4DZ8A 1Z0NA 1LP9B 5D38A 4XO7A 5K9JH 1N26A 5EBMB 3SQOL 2NX3A 4WI6A 1WQVT 1O7VA 3RUBL 1WT5A 1F41A 2DJ4A 3DSNB 1GGIH 2R0ZH 4KI5C 4ZW6A 5RUBA 4AC4A 4GRWH 2FJHB 3TASA 4YXGA 3VRLE 4B2DA 3AADB 5T1LD 3GDKA 1KJ2L 4L9YA 3STFA 3HRZB 3GX9A 2W0LA 3QUMA 3D18B 3GDMA 1T0MB 3MV8B 4KVCH 2O5NA 5D4JA 3OKNA 1OPGH 1C16A 2IQ9H 5AVRB 2AXJA 3O4LB 2GEQA 1Q72L 2Q2EB 4XMKH 3SGDI 4G9FD 2WNZA 4DK6A 4QJ5B 2D0GA 3LQZB 1VGEL 2CDGA 3FHAA 2QJDA 5D7SL 3OJVC 4ZYKB 3VD7A 3B9EA 3DDMA 3ITTA 4YSDA 3VA2C 4ZB0A 5A5WA 4BK5C 1E27A 1IGSA 4Z0BL 3UG5A 4HXBL 4A22A 2RJGA 3LMYA 5DU7A 5SWSB 4B7LA 4PUUA 3A67L 4HHAA 2FEEI 4RE4A 1A7OL 2WQUA 2WXLA 4FQ2H 4Z95L 2HFTA 5EO1A 1PKMA 1VHCA 4PS8A 3MLVL 1PNCA 4NAJA 5A6BA 3MLRL 2DSKA 2EYRB 3BPCA 1NBQA 1ZT7B 2Q3XA 3V5CA 3BKML 3EDJA 1M7DB 4LCSA 4P3WA 4HA0A 3Q06A 3O8XC 3CZEA 5DUMH 4GG6B 3ECVA 1YEHH 2YOAA 3L1OH 3FB5B 5HHOD 5HWJA 5IKCA 2ICCA 3GSVB 4IP5A 3WDPP 5HMEA 3NIDE 3KBNA 4AOFA 4EN3D 4JM4L 2OL3A 2FX9L 5D7IA 2E7LC 1ALDA 2HXUA 5HK4A 5ABTA 5ABFA 1UWEH 3G5VB 4P2VA 2QADD 3AU1B 1N8OE 2C3VB 2DFAA 5A8NA 4WK4B 1VEMA 3U5UA 4Y96A 3QRHA 2Q01A 1LBLA 2BBFA 1C5DA 4X4MA 2OJEB 4X7SL 2VC2L 1NPJA 1UJ3A 3L5XL 3ZHDA 3SYCA 1L8PA 4IXXA 2JIWA 4JY6A 4G8EA 2B1HL 9PCYA 3SJVE 4FHAA 1PLGH 4HDIB 1E4NA 3MRRB 3NQKA 3OJGA 1RUQH 1Q4WA 4IRZA 3WD2A 3VQ2C 4MJ6B 3FF7A 1FAKT 3P62A 3IXAA 4G43B 2F54A 1BD2A 2ZE3A 3L2IA 3BUVA 3NG3A 5ICZA 1Z7JA 4ES4A 5I17B 2G96A 3VXSE 4AGNA 3LVEA 3NA9H 2FYVA 4RJEA 4BZ2L 3OKLB 4ECLA 3AIUA 1DHKA 2RB8A 5E1QA 1HSBA 4GK8A 3DA0A 1XUUA 2TODA 3G1DA 4O1BA 4JN7A 5EC2B 4MWAB 2Y36H 5CNHA 3QQNA 3RKDC 4KZDL 2CCLA 4OCRH 4TRPL 1UXMA 2L0DA 4MD5B 2C91A 1X4XA 5SWZE 3VGDA 3DUHA 3O05A 1D7CA 2VQTA 1TVNA 4UM8B 3ID7A 2CU9A 1TX2A 3BPOC 1XGYL 2OQJB 1XF5A 3OB0H 1W0VB 3OG4B 1TV7A 4AYEC 2KQNA 3SO3C 1LO2L 2PLKA 1QNZH 1X4YA 3IRSA 1KLUB 1TJ0A 3ZE2E 5FACA 3MWAA 3V5KA 1T2XA 1MQ8A 3IMWA 5J5RA 2D22A 4D71A 3QIBC 4KY2A 2VN3A 1YN6B 5ESQA 4DH2A 2A2IA 4TX9A 3BKJL 3NZQA 2GHZA 1OGTB 2KKQA 2WZ5A 2V2WB 3BP7B 2V68A 3FY1A 1UM5H 2E7FA 1IKNA 2YGVA 3GMRB 3PGFH 4YSCA 2NVDA 2Z29A 1PU0A 4K7PY 4F93B 1BRLA 3R11A 1R4XA 3ARDA 5DHVA 4KY1L 4TUJB 4PGZA 3WBWA 2B4CC 4KO9A 2R23A 5F7EL 5B39G 2NZ9D 3ECWA 1WUFA 4OOUA 3F2CA 2RJMA 1F4WL 4PJEF 1U30A 3H53A 2YPVH 4N8VB 5FFGA 1KPVA 2A9CA 4OCRL 5GZOA 1BXBA 1J79A 1F2XK 2OMUB 1E6OL 2Q3AA 4HIHB 4RWYH 2WJ5A 3VXSA 3KXFE 4FFVD 4AMWA 3LS5H 1QWKA 3GWQA 3RHGA 1HTYA 1NBZA 1C5BH 3TNMB 1TUXA 3AYRA 4JGUA 3U25A 1M42A 1H19A 1NQBA 1CLXA 4IP7A 3GMMA 4KJWC 1X7TA 2ZADA 3D47A 3FRUA 4KVNH 4NN7C 2X6VA 5D1XA 1YY8B 4WHTB 4OW6A 4MD5A 5A3IC 5IW1A 1AQ0A 3GPSA 4BFKA 1KFJA 1RA0A 3QTGA 3DN5A 4MASA 4IU3A 4AC7C 1F74A 1PZ5B 3SADA 3OKLA 4J23A 1R5WA 3QDMA 4YPGA 2QGBA 1Z5HA 3T77A 4PJCB 3UJIH 4QWWC 1H09A 1BGAA 1P5BA 3PF3A 1W0MA 4QAIA 4WTXA 1TR9A 1W16A 2BJMH 1F07A 4OCYL 3PXHA 2ZG3A 3NA4A 1S5TA 1ZAIA 1H5BC 3V4VB 3BD3A 2EIBA 2F54B 2GEEA 3K1KC 4ONFH 3V8CA 2F9RA 4L5ZA 4D8ZA 5ALCH 2R9RA 4DJMA 2UZIH 3FTGB 3U4KA 2BMBA 1RULL 3AWNA 1ZV5A 4X8JB 1K8IB 1N5AA 2WBJA 4I1PA 4ZRGA 4OTXH 2XRAH 1ZWIB 4Y8AA 2Q8XA 3PWJA 3QZMA 4XHQA 1NY1A 1W5QA 4FOJA 3SKNA 4EXAA 4YTSA 1JPMA 5GS0D 1L6YA 1JD9A 3GVWA 4GRWB 1MCPL 3Q65A 2AXGB 4FQ1H 1AD1A 5C6TL 2AJZB 3V0FA 1ZMYA 5I6NA 4P46C 2FO4A 1J1PL 4KXDA 4D9QE 5AHEA 1QHPA 2GTQA 5D7IB 2QLYA 3BEWA 5A6SA 3GZAA 3N17A 3RI5F 2EE2A 2CJ3A 3QUXC 4KJQC 3LKOB 2W9MA 1I3RB 1J87A 3VFGH 2GCYB 3NIGB 3WE6A 4DAGH 3USZA 1OKEA 3VXPA 4UM9A 4F2MA 4W93A 3RTQD 3B4UA 5BXPA 3ATFA 1AZRA 3G0UA 1L9SA 1TZ8A 4PB0H 3P2VA 5I1DA 4KFNA 3ILDA 1XCWA 2ERJC 1BEYH 2PO6A 4XOCA 3BPNC 2P0IA 5FUOH 4CQ9A 2F2KA 1QCWA 3B9KD 1VEOA 3DJ9A 3T6VA 5MEOA 2XBTA 3FFDB 2Y7GA 1C1EL 1FFOB 1H7WA 3VFLA 1QRNE 5HY9B 4G8FB 5I76B 3MHUA 4N3UA 1ID2A 4M51A 5F72S 3WFDL 1TVLA 4ICNA 2A3LA 3HQPA 1QTSA 2OQYA 1EXUA 3KPPB 5E9DA 2CHNA 4OGQC 1QHQA 2VDKL 4Y9AA 5A8PA 4PCPA 3NFPB 4E5XA 2CLLA 4G8IA 2EPMX 4WI5A 2FSDA 3OKKB 4BSVB 1BKSA 1DYSA 2ESCA 3HG2A 3WTWA 1XYZA 2WSRA 3CASA 3NA8A 3QG6B 3N50A 3D09A 3F4WA 4IICA 2PTTA 1LO4H 3TSMA 3IANA 4OGZA 3BHBB 1F5WA 4JRXE 1EPXA 3GINA 3CUPA 1HJBC 4G7EB 2H9GA 3L3GA 4X42A 3SJ3A 2XX0A 4XNBA 5GZNA 2JJWA 4AE1A 4C7DA 3NJHA 3TKFA 1MHPH 1QQDA 4ZDHA 2FVKA 4F8QA 2NXZD 4Q89A 4RRPM 5BMXA 1S7XA 2ZOWA 4QRQB 1BF6A 1WAAF 5EF0A 5E1IA 1QSFA 3JTBA 2NTFB 5JXQA 2HT2D 4IMCA 4YBQC 1JZFA 2QFRA 3MC0A 2GIYA 5HNRA 2DYPB 4DJEA 3T0AA 5CPTA 2DIBA 3LQAH 2LAAA 1T7YA 3DTXA 1B9BA 2JCWA 1X8CA 2J7CA 2UXTA 3KNBB 1VB9A 1JCYA 3WBYA 3ZZ1A 4QM1A 1X1NA 2XV6B 3UXDA 3KPRB 2AKZA 4HPYL 1W0WA 4PBXA 4S1QH 4FMKA 3RIAF 2DZXA 4PTNA 1ICSA 2QCEA 2H32A 5F9JB 3ESPA 2YR1A 3VIFA 2YD3A 3VACA 4L1XA 3RRAA 3MRCB 2CYGA 3TIMA 4DN3L 2X1SA 2H3NA 3BSHA 1BTCA 3S37L 3JUYA 3BZJA 3W6MA 1CF1A 2PABA 3WF3A 3PLYA 3H2AA 4K37A 1E5AA 2DJSA 3FQTB 4ZUSA 2C4XA 1TV3A 2APXA 3LHPH 5E4IA 5IQMA 5ABDE 3RF9A 2VE6B 5IXEA 1EDHA 2WLHA 2D03L 3C6EA 5JO5A 5JQ6H 4HK3N 2Y7EA 1MFMA 5EU9A 3VCRA 3CXDL 4NHCH 1TX0A 4BQBA 4X6BB 2WN2A 1DUZB 2DZPA 4TVPH 3EXRA 1QWNA 1I3UA 2CGYA 5MP6L 3P3UA 3C2SA 2CO2A 1KLGA 2OZNA 1KB5H 3PJLA 3TR9A 3CHOA 3NJIA 4NNPH 4MJ4A 4BH8B 3N19B 4OCXL 4OFKA 2YD9A 3QIUB 2PB1A 3DGBA 3FAWA 4KRTA 4H19A 4OT7A 2VITB 5CAKA 3OXSB 3NAAL 4XXWA 4I90A 2EUZA 2UY7B 3AISA 5EFFA 1NCTA 2VZ1A 5F6HJ 3MI6A 1GW0A 2XTLA 3QEGL 4ZSOB 4U1KA 1OAZH 3CWHA 4Y19A 2CKRA 3E96A 3X1EA 3MW7A 3LGEA 3OPZL 4L6OA 1UJTA 2VR7A 4I77L 1FCQA 4YNGA 4KGJA 5KVEH 5AC8A 5CGQA 1OABA 1R3KA 1MRCL 3KPOA 3IBOA 4JVPA 3BT2L 4JO3H 5A6LA 1NELA 2NW3B 5L4IA 1CE6A 1KTLB 1CX9A 4NZ8A 1HHHB 2V3FA 4MQ7A 2NZ1A 5KYXB 5AOKA 2XYCA 2ZCKH 4NC1E 4KI1A 1S46A 3QGAC 3KBWA 4MRCA 4X6CF 4HK7A 1FV1A 1RK7A 3LPGA 4LCVA 3SDYH 4HNTA 5CGTA 4R4FH 1RXLA 2A77L 2J2ZA 4FABH 2WWCA 3S5NA 3EYOB 4NFDA 4AENA 3HI6L 3LV3B 4NQCA 1OXYA 5C7XH 4JBRA 2O92A 2PLTA 4YFDB 5FLUA 5IW6A 4S38A 4CNTA 2NY6C 4PJGE 2XA8L 2E9LA 2ZA2A 5KS9E 1MKFA 4FL4C 4LS2A 1IWAA 4C6PA 2D24A 2R15A 4CVXA 4IEFB 3VFTA 3G5WA 4MAYB 2E5CA 2ISWA 3A9IA 3LGDA 1THFD 3MS8A 1E4XL 1AI1H 2QW5A 4DERA 1SLUA 3QO1A 5BRZE 5LXVA 1DQUA 2G5BB 4KXZH 5ACMA 2PW1A 3CEUA 5FYKU 2QUMA 1MCLA 4A4AA 2CJUH 4C54A 1KFGA 3HO8A 2B1OA 4F2ME 3BV4A 4GFIA 4Q33A 3PHSA 4PJAF 1XD1A 4ZI8A 1BBDL 1U8PA 1ISXA 5AZ1A 4I0PB 4NUMA 1JFHA 3SCTA 1K8CA 4WSHA 2KLTA 1TJGH 5KVFE 3BVNB 1SYVA 4Z77B 4J4PA 1FN4B 4UT9A 1Z9PA 3NMEA 3GSUA 4ZTEA 4JN8A 3TYFB 3FCSB 1PZAA 2OAAA 4PMZA 4B92A 3O45A 1UZ4A 3ZLGA 5D2NA 1JHKH 5DFVD 3RJDA 3CFIC 5K9JL 3G6DL 4OZGF 3G1HA 3H0TB 4D8PA 3EO1B 3II1A 1TEGA 3L68A 1JGDA 4V28A 2NW0A 3W2KA 3WBDA 2C4FU 2NCEA 4HOMA 2G8ZA 1R75A 4H0IA 2EDJA 4OJCA 4D8PB 1M9SA 2BMKA 4FXGA 4UFJA 1UADC 4FRWA 1G7IB 4JFPA 1HFUA 4XNUH 2LU3A 1A5UA 1XF4B 4TF4A 2AKRB 4C60A 2GSJA 1PCWA 2ODHA 4NLAA 4K8EA 3K4AA 1MF2H 4OGXL 5J1AB 4N2CA 4GKZB 1H63A 3T44A 9XIMA 1I2RA 2V9TA 3LQAC 1HQRB 5C9WA 2FTYA 4E4PA 4P5MA 5CUSH 3L3HB 4PM1A 3GKAA 1T2QL 4G9PA 3RFAA 5F4XA 1Q65A 3SUWA 5C2XA 4O19A 1JWSB 3P73B 5IOKA 5L0QB 4DK3A 1YPIA 2WC3A 4Q4PA 2H9GB 2R4RL 2Z2BA 3R0KA 3DV6B 1S3TC 4NQDD 3GTTA 2O7QA 2EDKA 2XFGB 1I8AA 4KKLC 3OVQA 1KJ3H 1SOXA 5KTEL 3KAOA 3WLNA 2VGBA 3DO7B 4KZCA 4WD0A 4FCAA 1V5XA 3I6KB 4AZ7A 1B3IA 1HCZA 2ABBA 4ETQB 3KPPA 3T65B 2X12A 1HL4A 2YPLD 4JJOA 1WCBB 2QVTA 4GAJH 4ODTL 1X38A 2GC7C 5DJ6B 4R4ND 1O1ZA 1MLCA 5AVWB 1P6AB 5DR5L 6A3HA 1U8IB 2Y24A 5I76A 1I9RL 4H20H 4CQ8A 3VG9B 1SN5A 3V5HA 1JVNA 4Z23A 1RJYA 1YN7B 2VL5A 5E5UB 3NCYS 2B9AA 2EE0A 3GRWL 4JY5H 2ZCHL 4N2MA 3M7OA 3UMTA 2N3JA 4NZTL 3Q2NA 4JEQA 3WLKX 3UX9B 3P73A 2UUDK 1SO4A 2FPTA 3H2CA 2OJPA 4K3JH 4KTDL 1RZFL 4RA0C 4HCIA 2HN7A 4M7KH 3DFNA 4IFOA 3P84A 1NM4A 1YEWA 5E6ZA 2YGPA 4OFYD 2BIIA 3TQ0A 1RI8A 4HV8B 3MRKB 4Y7OC 1OE3A 1LWJA 4G5AA 4Y9MA 3O8XD 4JO4L 2CH8A 2Q7NA 3R4RA 3O3EA 1D9KB 1TO5A 4JAMA 1B4KA 3HAEA 1EWDA 1OVDA 3B6SA 3AC0A 4NWUH 2GBVA 4XMVA 3T5WA 4FI4A 1MRDH 3O6FB 4UQAA 4WUIA 4PGCA 1MFEH 2PRHA 1D7DA 5H94B 4F7CA 2GK1A 3KBFA 4PJ9A 3U9PH 2CIIB 4WDIB 2WNQA 2EPHA 2VDQB 5BJTA 3G6JB 1PB0A 2Y8KA 2Z26A 1J86A 3E5BA 1MHPL 1P1ZB 2ZWNA 1ID5I 3FSVA 3TEWA 3F7JA 1E40A 1KG0B 2IGFL 3C6LB 4JPKL 4D1JA 2H7WA 1R3HB 5CCJA 2PPAA 5FJUA 3EH5B 3CHFA 1TTCA 4JZJC 5I1JL 4OH2A 4KNQA 3IDXH 4XX1E 1YEDB 5T5FH 1POKA 3EWDA 2PTXA 4MMYA 4DAFA 3RI5K 1MZYA 2L7EA 3MROB 1LHZA 1IAIH 4FLSA 3MLSH 1GGOA 1AFVH 1O6IA 4NUGL 4ISVB 3AHVA 1N6VA 3FH7A 3MRIA 1CLVA 5DY2A 5K4ZA 2J66A 1MHEA 4GAGH 1OSEA 2NY1D 4PJXB 4L05A 3LD5A 4R53A 3VVWA 3GDRA 3BUYB 5HQLA 1VFLA 2NY4C 4ZPVA 4IOIA 5FUOL 4GRMA 5F1NB 1F4AA 3HR5A 3QXDB 3BKYL 2PW1B 3HPZA 2WCSA 4F0HA 1XRTA 5KYNA 2BASA 2HH0L 3HS0B 4O13A 4CCDA 2ESVE 2C1OB 4PRDA 4TO8A 5ENLA 4URKA 3L0NA 1KBGL 4UQ3B 2ED8A 5J6SA 4UILH 1KF9B 2NW2A 1HJXA 4LCQA 5CG7A 1XGQB 2XH4A 3P82A 5C07B 5MERB 3GFZA 3N9GH 4FDWA 3T3MB 1C90A 4H9UA 2BOBB 5BWFA 1R5IB 3UBHA 3GNNA 2QT6A 5EOTA 3ZBMA 4KDVA 4F7PB 2A5HA 4JIHA 3TQVA 1YEFL 3QQDB 4ZB5A 2YEZB 3CH1B 1CFMA 1D7KA 4LK4A 2F54D 1THAA 3IGAA 2HKFL 4FNSA 3M0KA 3SGUA 2R4RH 4KU1A 1S5VA 1IVTA 1TPWA 3GUFA 2GT9A 1YEIL 4AH2B 1AODA 4AUBA 4JFDA 2XZAL 1BYNA 5I1IL 3N3TA 4LSQH 4S3AA 4DJFD 3T8VA 2BG5A 2OWXA 3MGAA 5D02A 4KDTC 1N9PA 2WXMA 2EO1A 1KNOA 4BSVA 2IALB 1Y65A 4BQ2A 3NJMA 4O5LL 2PGWA 3S36X 5KVFH 4OF3A 5J5EA 2XV0A 2BVUA 5B39B 1R85A 2DD8L 3AIVA 3K2GA 3OHXA 1GGTA 3X1GA 3SDXF 4DWDA 2HLFD 1JRCA 3NZ8A 3PWAA 4ALAC 2OKOA 4HYVA 3FFCB 2VGGA 4G8FA 3TZNA 3LPFA 3QUYC 3W1UA 3E02A 5EMUA 1JV5A 3C8DA 4WNQA 1J0ZA 3T4AC 5I8EB 3IIVA 3O6AA 3IETB 3QBTB 4HJTA 3SHSA 2HNEA 2OTPA 1A7NH 1T4KB 2H2PD 3CFBB 3NEVA 2C79A 2P50A 2BS8A 4OZFH 3FUIA 3UYRL 1S3KL 4JG5A 4PTXA 1ZA6A 4ZMQA 5CILL 5DUBA 1A5CA 3LS5L 2OODA 4XVSH 4OWGA 1GMEA 5C70A 5KZCD 1PKQE 2VXVL 3PL6C 1J8HB 2Q6WB 3WFLA 2E5DA 1AHWB 1ECEA 4RZBA 4B5NA 2GAZB 1IXOA 1F4WH 4UMSA 2X6BA 2ODIA 1L6FA 1U1JA 4LQFH 2MKLC 2GIMA 1IJNA 3FTVA 4JMNA 5BOPA 1E7UA 1J7VR 1KBGH 1KFWA 5CJQH 4PTDA 3GUTB 3I50L 3QUYB 3LYRA 3Q0HA 4LBEA 1DSFL 1GHFH 2CUHA 2NY0B 3KJ6L 4MMZB 4XBGA 1L5GB 4XP6L 3UYOD 5E5CA 4JFHE 3MCOA 2VL5B 4DLMA 4E3TA 4XPFL 3LXBA 3IGSA 1H5YA 2FL5A 4N24A 2WSDA 4RBPH 5IEKA 3GMNA 4OCLC 3T2OA 1VPXA 2AI0H 3SKOA 2WKJA 2WMJA 4RAUA 1VGKA 2QJMA 2XN9D 3BI9X 4PW4A 1DHPA 5EN2A 2XGBA 3IVSA 3M4HA 4OHQA 2X10A 3D4GA 4P46D 1AHKA 3QY8A 2X1UA 3CXHJ 3TV3L 1K8XA 2G9HA 4ETQA 3HMWL 4LSPH 4XGZA 4G8AC 1XF3A 5IHWA 1DBBL 3UPRA 3KZSA 4H9VA 5IESH 1M1XA 4EUPH 4AGPA 3HRZC 5T1DH 3LN4B 5BRZD 2OFJA 5ESAA 1G6CA 3PWLA 1W3IA 2YPKA 4Y8FA 1O9ZA 4FXKB 1OT4A 1Q0EA 3BP4B 2OL3H 2PYED 5C0NC 1SVDA 2A77H 5I1JH 1XRFA 2QCCA 4QUOA 5IW1B 1TO4A 1FHNA 4IDJH 3RU8H 1QR1A 4DUWA 4LUSB 1PG7L 1Z9MA 1WEJL 4V1DA 4GUCA 3SDCC 1AXSB 4C65A 2QPSA 2W65B 1K72A 1TUFA 5C9RA 1AKJD 3GI9L 3U6RB 2W4XA 3H6OA 1RJLA 1OFQA 3CO4A 4HK5A 1HL9A 5GGTH 3HMXH 3MHZA 2ZZ5A 3CIVA 3HURA 3IDNB 2BC4B 5SWZD 2LABA 1T4WA 2MHAB 3HPJB 5AW8B 4ZFFB 5AAMC 1D2PA 4Y2DC 2P5WE 1CTNA 1BQKA 4D9LL 3AHTA 5DZVA 5A43C 1XLHA 1FYTB 5K93A 3CUFA 3UTPD 5ERWA 1FWXA 1I1AD 2ZCLL 3RFRA 4JS3A 4UIMB 1GIGH 2OA9A 4JRYE 2FZMA 4G80B 4JX4A 3P0GB 2V2WA 4JM2D 1PYMA 2A7RA 2YYUA 3A5VA 1M7XA 3LMZA 2ZXAA 1JPEA 2UWEE 2FJFA 2YWYA 4LKXA 1T83A 4UT6L 2D8KA 2D0FA 2EECA 3BUPA 3AB0C 4HJIA 1EEUA 4PBFA 1CZ8H 2Y5TB 3Q7JA 3F04A 5HVWA 1G7JA 1HH6A 2OW6A 4LFYA 2DQGH 4YNYA 4MHBA 4Q6JA 1TMCB 3JYCA 3OWEA 4TUFA 4ZBJA 1V3MA 4PEEA 2Q76B 4A6YL 5L2KA 2AERT 2CWXA 5D1QB 3UOAB 5J8LA 5DZPA 3MMTA 2R39A 2D23A 4XH2B 3PABB 3T4AB