3QPZA

Crystal structure of the n59a mutant of the 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKAARSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESPLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 84
structure length 251
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qpzA00
1H5YA 2VFIA 4LS2A 5I3FA 2RH9A 1KM5A 2GQ8A 1FDJA 3W7IA 1PS9A 4PFMA 3UPWA 1I2PA 3EXRA 3NQGA 1OYCA 2DU2A 1TTQA 3ABSA 4JY8A 3IIXA 1Q6QA 4O0KA 2FB3A 1XBYA 1KM6A 3M9YA 3F1QA 2ZZ7A 1ZENA 2G97A 2X1SA 4NJIA 1ICPA 1HTIA 2J6XA 2QKFA 3O05A 4UFIA 3NM1A 4AH7A 1OHLA 2GPTA 1DQXA 1OG0A 4NZJA 4R7JA 4ORIA 1TSIA 2JGQA 4IJBA 3TAOA 3LLDA 4FF7A 2ZA1A 3WK1A 1W31A 2QCDB 3UWWA 4K37A 5F2LA 5E0KA 3L66A 1GQNA 1DORA 3TX9A 1WQ5A 3S1XA 4O50A 3N34A 5FF3A 5IBXC 1Y0EA 1R2SA 3G24A 4MYXA 3OG3A 3RLUA 1PV8A 1OFAA 2FJKA 2ZTKA 4MPQA 2WPBA 2FPTA 4QISA 4Z08A 3W1LA 4TMCA 4N9CA 2C16A 4RV8A 3W23A 5GVJA 1THFD 3FYPA 5AYZA 4AWTA 3M6YA 4UTWA 1YPIA 3LB0A 3S5NA 3U2OA 5LNUA 5IM51 1DL3A 5AHIA 2G96A 2Q8LA 3IIZA 4AHQA 3NQAA 4N9EA 2OCZA 2CZDA 1GVRA 4ZQPA 2E6DA 1TCDA 2YZRA 1GG0A 2YDAA 1F5ZA 1XDMA 1FWSA 3INPA 5C55A 2A4AA 3QF0A 3K30A 4D2JA 4IXXA 3TJLA 2QF7A 2ZRYA 3UWYA 3LX9A 4N6FA 3C2OA 3CT7A 4MZ1A 3GK0A 5D05A 5EMUA 1P4CA 1KBJA 3G1FA 2Y7GA 3EWWA 1EB3A 3PY2A 1OFEA 2V2HA 2E5CA 3LCFA 3UXAA 4UTHA 1VGAA 4NNCA 4LT9A 4NX5A 1TPC1 5AC6A 2AAMA 1EWEA 3HGOA 4K6AA 1LLZA 3CLMA 2IQTA 1OK6A 3M5VA 3NQDA 1LRQA 4O54A 5I3HA 3B03A 3GB6A 1ZALA 2BTMA 3SGZA 5FEXA 3T40A 1K7EA 3S1WA 4ZZ9A 3W1PA 2CWNA 4FXRA 3W3OA 2E77A 3EWXA 4EOUA 4ORMA 3TMLA 1B4EA 3O6DA 1NF0A 2H8XA 1W5NA 2DJXA 2Y88A 4JXCA 2NWSA 3W7EA 3A24A 3HMJG 3O16A 3E96A 5K4XA 3W7LA 1KFBA 3DAQA 3SW6A 4FEZA 1RV8A 3W1UA 4JTKA 2ZRWA 4U4MA 2QUUA 3MI3A 5K7JA 3G1HA 2C14A 1RQBA 2OJPA 4MFDA 3ZS4A 2RDTA 1Q6LA 3LCLA 1H62A 3CC1A 2QCFA 2WNNA 3RLVA 3T44A 1LBFA 4ONVA 2NV1A 4UTTA 5HUPA 2J9XA 2PE4A 2NX9A 3LHTA 2WSYA 4PEKA 4WY0B 3G8EA 4HIBA 3N14A 3NR0A 4C1KA 1UCWA 1BWKA 2J27A 1JR1A 1QFEA 2OX1A 3EX2A 3GR8A 4BF9A 1RZMA 3M43A 2Q3RA 4R53A 3GR7A 3MYOA 3VE7A 3CHVA 3W22A 2YXGA 1QMLA 3L5MA 3LTSA 3TXVA 3W84A 4UTUA 1IXNA 1JCNA 3GDKA 3W2NA 5HWMA 2Y6ZA 2A1YA 3TA6A 5C54A 2EPHA 1QNVA 1WOAA 2Y7EA 3H53A 4BI7A 4RCXA 5D2XA 1IGSA 1NFBA 2ZYFA 1LM1A 4DO4A 4IQLA 2F7FA 5LNRA 3H54A 2HSAA 4M7SA 3LV6A 3CEUA 1F7BA 4WUIA 1XFBA 1IXPA 1OX5A 3KRZA 1GVOA 4QAIA 1LOSA 2B7OA 3HO8A 3L21A 1OVDA 4YL2A 2DORA 4UFHA 5D2YA 3ZWTA 4ZL1A 3C61A 3W1XA 1WXJA 1Z41A 1AL8A 3FYOA 1OX6A 4U28A 2WV8A 4FNTA 1PHQA 3TC6A 2NX3A 4WJEA 1G7VA 1I4NA 4UMAA 3RF9A 2VFFA 1LTDA 1P0KA 1BEUA 4BWLA 2C13A 5AFDA 1A5SA 4OWGA 3O15A 1XBZA 1FCBA 3P5YA 5G5IA 2H3DA 5G4WA 4GFSA 5K2ZA 2DJLA 2NUXA 3ABOA 5LZLA 1J2WA 3I68A 3GKFA 4MLJA 2E5DA 4I7VA 1H1YA 3GZ3A 3GAKA 1S3HA 3L67A 2CZEA 3LXCA 2GOUA 1JUEA 2I1OA 1OYBA 4S1FA 3NVTA 3PULA 4OHQA 3TFCA 4NT0A 3UZ5A 2A2IA 3BLFA 3FKRA 2QAFA 3C3NA 3PF3A 4JNMA 1JCJA 1RR2A 2J9YA 1JRBA 3EB2A 4HT3A 2Y85A 4M7TA 1SO6A 5BRBA 2ZDRA 3G0SA 1R2RA 4XKYA 2CLKA 3W76A 2CLIA 5CSRA 3B0PA 4TX9A 4GE8A 4S2CA 3E12A 4IPJA 1M5WA 4DPQA 2A21A 1RVGA 2V9DA 3TAKA 4OT7A 1S5TA 3KX6A 3OEXA 3LBCA 2FPVA 1EP3A 5BNKA 3DHDA 3NQ6A 3G3MA 3N73A 3BW4A 1CI1A 1KV8A 4LS1A 1SU5A 2GUUA 4EWND 3LI1A 4CNPA 3N3MA 4ADSA 3FEMA 4EF8A 3F4WA 5G2WA 4A2RA 1ONRA 5KSWA 1QPRA 1H7OA 2NUWA 5CZSA 4UTJA 2PRLA 1KFKA 4LUIA 3HPSA 1SZFA 1W5QA 1ZNNA 4JX4A 3UWUA 4JTLA 1SFJA 3IGXA 5I3GA 5HINA 2FB2A 2ZRZA 3GXNA 1YLVA 4RZ6A 2E6YA 3NDOA 1GEQA 1GTEA 4K39A 3W70A 1Z48A 2FFCA 3M7WA 3TE9A 3W2KA 4IX0A 4A21A 1KM3A 3E02A 1ALDA 4FX7A 1TPEA 1XDLA 5EY5A 3EWYA 1VCFA 1R30A 4IXHA 2V81A 3B8DA 4GBUA 4K7VA 1XI3A 1EA0A 1QR7A 4E38A 4E0CA 4H6KA 4O1AA 1QPNA 3BW3A 3E49A 3HBLA 1U83A 5H91A 1QAPA 1Z42A 3L65A 1TTIA 1IXOA 2ZRXA 3NL3A 5CGQA 1K8XA 4AHOA 4O4VA 3PB0A 3SECA 2QCLA 1T8XA 3CPRA 1H7WA 3NL2A 1VQTA 1ADOA 5AHLA 5FF0A 3C4UA 4N2YA 4JYEA 4NJJA 2ZQ0A 1GPWA 3O6YX 1LZOA 1L6SA 5KMYA 1MXSA 1VYRA 1LDCA 3C0JA 4FNUA 1FCQA 2X1RA 3GIYA 2CLHA 1JQXA 2WKJA 1L6YA 1PHWA 3RK8A 1X7FA 3W7JA 1YADA 3M5YA 1TV7A 2OMAA 1QCWA 2A7NA 3GNNA 3KVLA 4NVTA 1SO3A 4XUGA 5EL1A 4PC8A 4UFJA 1SQ7A 2I14A 3TSDA 1KBIA 2ISSA 4HHPA 3DBPA 4HNUA 5H2ZA 4AAJA 3N9RA 3OIXA 1H60A 2TMDA 1DJNA 3L2IA 3D0CA 3HQ1A 3EWZA 3B06A 3GDTA 1JJKA 1KFLA 4O1BA 3SIZA 2Y89A 1DBTA 1YYAA 3NYZA 4Y90A 4MFEA 3GXPA 1TJPA 2NZLA 2B7PA 4LW7A 2X1UA 2DP3A 1SSGA 4UFKA 2FTPA 1FBAA 5DY2A 4XKYB 3TQKA 3VE9A 1YTDA 2Y70A 4IX2A 3WK0A 5D30A 3HPZA 3I7RA 3UWQA 1AW2A 1BTMA 2VFEA 3H55A 1ZJIA 3G8RA 5AHMA 4FHAA 3WJWA 3STEA 4FNSA 3QMRA 3LLFA 5DELA 4M19A 4LV4A 1W56A 3S0CA 2EAWA 4QJ1A 4HPXA 3DFOA 6ALDA 3DHFA 4YXGA 4FX8A 5ABTA 1TPFA 3W2UA 4GUJA 3JR2A 3VKJA 1OX4A 2E68A 2F84A 2ZZ3A 4A29A 2VENA 2CLFA 1TPDA 3UD6A 1RPXA 2BX7A 1TPUA 4JYDA 3T78A 4MUZA 3NL6A 1OJXA 4MKNA 5J5DA 3W9ZA 3T7VA 1JCXA 3THQA 3RU6A 2V30A 5CPMA 4XZ9A 3R12A 1ZAHA 4YCOA 1RD5A 5KZDA 2HS8A 4KWWA 1NF7A 2ATSA 2FQIA 1EWDA 2R8WA 2UV8G 2RDWA 4IMFA 5K4ZA 1ME9A 3TU9A 1K03A 3P7YA 4C1LA 3KRUA 1ZAJA 1O95A 2P0OA 2GQ9A 3MJYA 1D3GA 3W1MA 1KFJA 2DZSA 2ALDA 3QPZA 4LC6A 4O19A 2VKZG 1VCVA 3SY5A 2W79A 8TIMA 2PRHA 3W74A 1SUXA 1XM3A 2AGKA 2E1DA 1TO3A 3LOTA 1TQXA 4IMCA 3B4UA 4WD0A 3I65A 3NO5A 2ZFAA 3S1UA 3LHUA 4XTIA 1OYAA 3M5XA 2B7NA 3WFAA 2Y7FA 2ABBA 1PCWA 2WJZA 3HGSA 4ZMGA 4RZ5A 1CW2A 1LRNA 2GVJA 2VEKA 3W1RA 4AF0A 3HGJA 5FEZA 3CWOX 1MEIA 5CPOA 2D73A 4K7YA 3W73A 3JS3A 1QO5A 3MBDA 3W7RA 1H7NA 4O4WA 3UZJA 1J5TA 4EIVA 3NQ7A 4JTHA 1KFCA 4Z0SA 3W88A 2E09A 2B0MA 1F6KA 4ZQNA 4I9AA 1XXXA 3TH6A 2QJGA 1SZNA 1KM1A 1G67A 3BV4A 3PR2A 1BWLA 4N02A 1R47A 5LKYA 2C19A 3GYEA 3NXFA 3R89A 2HS6A 1YTEA 5DXXA 1SSDA 2YYTA 3SI9A 5IBXA 3EKLA 3MP4A 3OA3A 3SSJA 1MSSA 4UTMA 4Z1CA 4NQ1A 4L4MA 1LOLA 3DENA 2GVLA 2H6RA 3ZFHA 1KV5A 3MHUA 4UTIA 4NNBA 4HSOA 1W5PA 3RFAA 4IMDA 4GUGA 3LHYA 5AC7A 3NNTA 3RNDA 3DKJA 3PBWA 3EWUA 4O18A 1PE1A 1DJQA 3O6CA 3TUUA 4LTSA 4NXKA 1K7XA 3L0NA 4O13A 2VELA 3W7GA 2NWRA 4ZQRA 3EXTA 5LHFA 3WK2A 1JVNA 3EX6A 3WK3A 3MYPA 2QCGA 1VYSX 3KVKA 1PL9A 2WSQA 5CKSA 3STCA 1YDNA 1LCOA 4XBKA 3PBUA 2RKXA 4W9TA 3S5OA 1FY6A 3DH7A 3Q58A 3MHFA 2VEMA 2FIQA 3SZ8A 4YMZA 3W7PA 5AYXA 1K3UA 5DCBA 5EYWA 1TPB1 1JULA 1OX4B 2P10A 1TRDA 5I3JA 5FF2A 4DBEA 1GG1A 1TV8A 3ATYA 4Q33A 4EF9A 2XN0A 4CNNA 2B4GA 3W72A 3SFKA 4XBSA 2QCMA 3ZR4A 3FA5A 4PL2A 3TR2A 3P5ZA 3W83A 4DO5A 4UXDA 5FF4A 4UC5A 4Y6GA 4GRSA 3LV5A 5AHNA 4MIMA 5CPLA 1KLYA 5EBUA 4FX6M 2PRMA 4KFPA 5F1UA 1WDWA 4L4LA 2ZBTA 2Q3OA 3G0UA 4ZQMA 3LXAA 2NXGA 3W71A 3NPUA 3P74A 5BMXA 3NQCA 2DZUA 7TIMA 1N55A 3LDVA 4MY9A 1GTHA 1B57A 1M6JA 2W6RA 2DZWA 4R33A 3M47A 4Z1AA 2HMCA 3LHVA 2G95A 3S42A 3BLIA 5EPDA 3FJLA 2YYUA 3PWAA 5D2TA 1OFBA 2H3BA 3FKKA 5A5WA 4AVFA 1G69A 3EEGA 3P84A 3QQ1A 4MOZA 1S5WA 5AHFA 4O16A 1YDOA 3CIXA 1LBLA 4LOCA 4DEFA 5F2MA 1MZHA 4N6EA 5TBOA 3B04A 5T26A 3A21A 5F4WA 4PH6A 3KOFA 3GKAA 2C15A 3CQ0A 3PUOA 3DKLA 3F03K 1SFLA 3B05A 4GXMA 3G3DA 1C9DA 1JRCA 3L0KA 1YXCA 4JTSA 1OK4A 3OVPA 1OFDA 1G4PA 3LCIA 3UY8A 5HUOA 4TU1A 1G4TA 3MHGA 4MZYA 2H90A 3MW7A 4AF0B 3R8RA 1LP6A 2XFWA 4UMBA 5DY3A 1EX5A 3C8FA 4ALDA 3W2MA 1SW0A 3HPXA 3TDFA 1FDYA 3M1ZA 4JTJA 1Q45A 4UUIA 4DXVA 5I3KA 2YW4A 1RQHA 3M44A 4JIQA 3T55A 2QDHA 1WV2A 4OV4A 1I2NA 4Z1BA 1JUKA 1DKWA 5DN1A 4LS0A 4QIUA 3TROA 5EA9A 1LBMA 3JRKA 3FFSA 3LTYA 3O07A 4O12A 3C52A 2Q8ZA 3NQVA 4HSNA 1C8VA 1FUYA 3G1VA 3W7CA 1ICSA 3FS2A 2YFOA 1KTBA 4JTTA 1DVJA 3IEBA 4E2DA 3DGRA 3S5ZA 4O14A 2A6LA 3I7SA 1IIHA 2V2CA 3CM4A 1W3IA 3STGA 1GJPA 1I2QA 3MI2A 2DZVA 5LHEA 1NVMA 4JY9A 1SW7A 5LNVA 2A6NA 3MWAA 3C56A 2V2DA 4NU7A 1E51A 5D38A 1XCFA 2I9EA 1JCMP 2FPYA 3E9AA 3IGUA 1SO5A 3DU0A 5L6UA 2X1TA 3G22A 2CU0A 1UUOA 3KVMA 1F74A 5KINA 3Q94A 3B0VC 5G1YA 2QDGA 1DHPA 2CZ5A 3R5EA 1TV5A 3S6DA 3LBMA 3IVUA 4KKXA 5DBTA 3BLEA 4CCEA 4GUIA 3DXIA 2ISVA 4HPJA 2A7PA 5AN7A 2HTMA 4CQAA 1H63A 3S8HA 3ELFA 1GWJA 4I7WA 2LLEA 3UQNA 3V1PA 3L0GA 4IUOA 3LCXA 3DFNA 2ZCGA 4OU1A 5AYYA 5KZEA 3W7NA 2RFGA 1ZCOA 3HOJA 3BW2A 1AK5A 4N4PA 1HFBA 2ZZ6A 1TTJA 2QUVA 3L68A 4JTGA 4RZ4A 3NZ1A 2VOMA 5BMWA 4LWWA 3RMJA 4O10A 3QC3A 2NLIA 1YXDA 3A9IA 4CCDA 1VHNA 3G0XA 4WOZA 2AQWA 3O63A 3WJSA 3TIMA 1D9EA 1P0NA 3BO9A 2ZZ1A 4NJKA 2PCQA 5CSSA 3GXTA 4PTNA 4AHPA 3P82A 1GT8A 3KFTA 4IMEA 5DLCA 3NAVA 2X2GA 4JTUA 3CWNA 1I2OA 3QZEA 3OBKA 4FO4A 1YDVA 3LI0A 3N2XA 3NM3A 4MZ8A 4O11A 1KM0A 2QCDA 1O94A 4AMAA 3QSRA 3Q2DA 2YPIA 3NQEA 3PBVA 3LERA 3ATZA 4WXYA 4CCCA 3C2RA 3DFSA 3CU2A 2ZA3A 2CFFA 3NQFA 2YCEA 3KHJA 1MO0A 5AB3A 4JICA 2VC6A 1TPWA 4WXZA 6TIMA 4MY1A 2WO5A 1SR9A 5C2XA 1H50A 2ZZ2A 1R46A 4KFNA 5U4NA 2QJIA 1FWNA 2VXNA 2NXIA 2WNZA 1A53A 2G5WA 1QPOA 5CZ0A 3W1TA 4AEOA 2Z1BA 2ZA2A 4LVBA 4Q32A 5AC8A 3P61A 3EX4A 4Y96A 1HO1A 4ZQOA 1YXYA 3TFXA 2E5BA 3A5FA 3G1XA 1IF2A 2B7QA 3LCWA 3R2GA 3VNDA 1EP2A 4IPIA 3ABRA 1PIIA 4O52A 3BGGA 1W3NA 4O1CA 3N19B 5U7SA 2QCHA 4NXSA 3TC7A 3UWZA 3FJ6A 3A22A 4FIRA 2EF9A 3TCEA 2CLLA 3P67A 1K8YA 1GYNA 1UJPA 2YSWA 4H3DA 1SPQA 3QMSA 1B3OA 4AB4A 5HJLA 5AHEA 2J9ZA 2ATMA 4JTFA 1GYLA 4LVDA 3C6CA 1T0OA 5KZMA 4X3ZA 1TMHA 5D2WA 1VC4A 5BOOA 1DQWA 4LRSA 4N9DA 2GQAA 4M5PA 3GAYA 3YPIA 2W0UA 2Z6IA 3QYQA 4Z1DA 2TPSA 4FNPA 1VR6A 2E6FA 1GOXA 3W7QA 4H4IA 3NL5A 5D04C 4DO6A 4TIMA 1LOQA 3PBYA 3W7KA 2JBMA 5KITA 2OT0A 5E1QA 5HQEA 4LY8A 3TNOA 1XL9A 1NSJA 5K9DA 4XWUA 4LC8A 5CZTA 3NQMA 4FNRA 3M16A 1W0MA 3BG3A 3S1VA 4KWVA 2VEIA 1D3HA 3TW7A 3DFTA 4NX0A 2C6QA 3NPXA 5D37A 1LLWA 4UR8A 4RXGA 1QOQA 4RK8A 3G1YA 1C29A 2V5BA 4JDYA 1G6CA 1A5CA 3E0IA 3W87A 2VFHA 3QQ0A 1WYIA 5G2HA 3ZWSA 4MJZA 4JEQA 3HG5A 1JQVA 4JTIA 4GNJA 3G18A 3NG3A 4MVAA 5DXYA 5D2VA 2E6AA 3MMTA 4WY0A 4UTWC 4O28A 2Z2UA 1FWWA 4DF1A 1VRDA 1FXPA 2OT1A 1Q6OA 5DBUA 1F76A 1OFQA 3UPBA 1UBSA 5LGXA 1HL2A 4R34A 1ZFJA 3QSTA 4DPPA 3DI0A 3STFA 3I7QA 3QFEA 2FLIA 4UMCA 3NGJA 2DZPA 3QW3A 4Z0JA 1T96A 3HF3A 4BR1A 2QUTA 2ZRUA 1JUBA 4FNQA 4M6QA 4UTLA 1QOPA 3LCGA 3BG9A 5LSMA 1P5BA 3QMTA 1JCYA 2YGYA 4IWWA 1DV7A 1H1ZA 4O8RA 5D09A 1KM2A 5KTLA 2ABAA 4DELA 2FDSA 1X6UA 2C18A 4OGZA 5F1VA 1CX9A 3BG5A 3NPWA 2WNQA 3PVFA 3W6YA 3EKZA 3PSWA 1KLZA 2X16A 4JYFA 3W85A 4AWSA 4FB7A 4LVFA 4WY0F 3T4CA 1YTKA 1P1XA 3G1SA 1GVSA 1FQ0A 1M7OA 4CQ8A 2P1FA 4JX6A 2J24A 2V5LA 3MO7A 3WJXA 5D02A 4MY8A 5L9FA 1A5AA 1GZGA 3W07A 4NZFA 1XC4A 3V75A 3W1NA 1O4UA 2QCNA 3OVQA 3PG9A 1X1ZA 1WA3A 1VYPX 4WX2A 3PS7A 4LUJA 1W1ZA 3OVRA 5G2IA 3I6RA 1G7UA 5HMSA 2R14A 3IRDA 4OV9A 3TV8A 1KM4A 3P60A 1W8SA 4WOQA 2Y7DA 5J5RA 3VCRA 1FXQA 3O8AA 3LRLA 3HGRA 3B0UX 4K8EA 2JKPA 4JS3A 4UTTC 1LRTA 4JIPA 3W7DA 3TQ0A 3OHIA 2GJLA 2GVGA 1WAUA 3NOEA 3THAA 3QJAA 1O60A 4IMGA 5HWNA 2PURA 1B9BA 3C2VA 5FI8A 5HR7A 2KZHA 1SO4A 4G1KA 1TPH1 4ZQCA 5LNSA 4PL1A 5G4EA 3IGSA 2YR1A 1S5VA 4LU0A 2QAPA 3KAOA 2V0TA 1ML1A 4RKAA 3QRHA 3W1AA 4NUWA 1VLWA 4QNEA 2TSYA 5FEPA 3SJ3A 5BW6A 3PM6A 5CZJA 1KFEA 1RQEA 2C1HA 2BSLA 1B4KA 1H7RA 1I45A 1WBHA 2A5HA 4JGDA 1NEYA 3IV3A 4JN6A 3P80A 2A0NA 1J4EA 4X22A 3GVGA 3PB2A 3U8GA 4EVZA 4J9JA 4N4QA 1FWRA 3EWBX 2O7SA 3IIVA 4XQ6A 1OFPA 4MYAA 5CG7A 1KW1A 2CZFA 3LRMA 5K9CA 3P8JA 3QW4B 3UXDA 2EHHA 3UNDA 5HULA 1IXQA 1FCUA 3M41A 4BWLC 4B5NA 1KTCA 3IIOA 1O5KA 1F2JA 2YW3A 3PUEA 1L2UA 4IOTA 3NQ2A 1KA9F 3C2EA 3MBFA 1SZEA 3GLCA 3GDLA 1UB3A 4LVGA 2EKCA 3N9SA 2VFDA 2BLEA 2RDUA 4JTEA 1EIXA 2QR6A 4QQ3A 4GUHA 4ZVJA 3HJZA 4N9BA 1SW3A 4Q4KA 1F05A 4HNTA 1TTPA 5F4SA 2BXVA 4HKPA 5I3IA 3M5ZA 4A22A 1YPFA 3GDRA 3L5AA 4GC4A 1TREA 3S9YA 1AG1O 1GVFA 2V82A 2ZRVA 4DF0A 1NAL1 1L9WA 1X1OA 1AW1A 4YWIA 2R91A 4UFLA 3U6WA 4OE7A 4HNVA 3PC0A 3R13A 5HWJA 4CQ9A 3TK7A 1FCVA 4YCPA 2BWGA 4BI6A 2TYSA 2A7RA 4BK9A 4LRTA 4UR7A 1K8ZA 4LNYA 4LV9A 1TJRA 3QM3A 3LHZA 4PODA 1ZHAA 4TO8A 1WX0A 2ISWA 4DBDA 3L5LA 1K7FA 4X2RA 2EGZA 4TMBA 3BPWA 3G1AA 4UIOA 1VPXA 4MLRA 1PCKA 2O7QA 4WQ6A 3M0ZA 4JDBA 1U5JA 1AW5A 3WJZA 5F2GA 1H7PA 4FXSA 1TQJA 1Z44A 5TIMA 4UCGA 1EP1A 1A5BA 1WOBA 2X30A 4RX0A 1TPVA 1W3TA 4DQWA 4UNLA 3F4NA 5AOUA 4O53A 2H8ZA 1QDSA 4MJMA 1I8JA 4QNWA 3O1NA 4Y8FA 3TJXA 3GNDA 5FEWA 5LNWA 2Y62A 3TXZA 1UASA 3QEZA 1ME8A 1VH7A 3BARA 3PUDA 1VLIA 3LM7A 1H7XA 4GWEA 3VI2A 4RR4A 3W2LA 4O1DA 3BGJA 4BFAA 3TSBA 1MEHA 1Q3NA 2YFNA 1FX6A 4AXKA 1HUVA 1M7PA 1VHCA 3W2JA 3NZRA 4WZHA 4XTDA 1VJIA 1VS1A 2WSRA 3CIWA 4ADUA 3PG8A 3TMQA 2CLOA 5TQLA 1L6WA 3W86A 1WBJA 1N8FA 4Y9AA 3SGUA 1EUAA 3A5VA 3C2FA 1O5XA 4O0ZA 1XBVA 1GVQA 2GJNA 1TYGA 1W5MA 4RXFA 1VZWA 1R2TA 5LGZA 2Y63A 3NEVA 4M6VA 4CNOA 3SR7A 3PAJA 5HNRA 3HG2A 5C6MA 3QPYA 3CB8A 4OBTA 2Y61A 1G4SA 2JK2A 3HG4A 1LROA 1EPXA 2DZXA 4O57A 5CPNA 3P8IA 1AL7A 5FF7A 3LTPA 3KVJA 3QH2A 3DFQA 3FIGA 1QO2A 3EX3A 2CW6A 3VFLA 2ZZ5A 1ICQA 2C0AA 1LORA 4UTKA 5A8GA 3W7MA 2CLEA 2NUYA 3BK0A 4P61A 3DI1A 5FESA 3HG3A 3DZ1A 5E93A 4HN4A 4ADTA 2NV2A 2NX1A 3G1DA 4NJGA 3FOKA 3TKFA 3ANYA 1OFRA 3WJYA 3W75A 2VFGA 4LVAA 3EX1A 4ML9A 3KRSA 1SZGA 5EKYA 2ZZ4A 2VEPA 5K3VA 5F2IA 1XUZA 2Z6JA 2QEZA 2JKAA 3MP5A 3UWVA 4OQVA 4DF2A 3P62A 1ME7A 4POCA 3USBA 4E2BA 2Z0IA 4YLWA 5DCEA 3W1QA 1W37A 5D03A 3HB9A 1XBXA 5DCDA 3FLUA 3EXSA 1UUMA 5C5YA 1VCGA 4QSHA 3LCHA 2ZTJA 1TIMA 1OABA 3MUXA 3NA8A 2QJHA 3NQ8A 1KTNA 2J88A 2JGYA 4RLIA 4NNAA 5F4XA 3MI6A 1DOSA 1QWGA 1XKYA 3L9CA 3LXBA 3PSVA 5D33A 4CLMA 1I2RA 3LRKA 1Q6RA 1QPQA 1ZAIA 3BVJA 4JX5A 4X9SA 1F73A 2QCCA 2TRSA 4NJHA 3UYCA 3DFPA 2QCEA 1MEWA 1XUUA 1W54A 1FWTA 1OF6A 5SWUA 4A3UA 3KXQA 4GUFA 1TB3A 2DZTA 4QITA 4I7UA 1AMKA 1PVNA 4PCFA 3TW6A 3UY7A 2WOQA 3Q37A 3CEPA 2YX0A 2BZNA 2R94A 3GDMA 4O17A 1V5XA 4GJ1A 1W5OA 1OF8A 3S5YA 3AO0A 4O15A 4S2BA 4TR9A 4KFOA 3HIJA 1F6PA 5K9XA 3MP3A 3LHWA 3O06A 1X8FA 1FDZA 5HR6A 1T99A 4BI5A 1V7YA 4P2VA 3IVTA 1HG3A 4IGHA 2NXHA 2OZ0A 1LYXA 1BKSA 2CLMA 3ABQA 1G4EA 1N7KA 3P81A 4A2SA 4ICNA 1H51A 3N2MA 4K36A 1JCLA 1OFOA 1TRIA 3GX9A 1K02A 2A85A 4HNNA 2C3ZA 2RHGA 4M6PA 2V8ZA 4QM1A 1A50A 4FIQA 1IIGA 4PA8A 3LGEA 4JD4A 3W7HA 3IIPA 1HO4A 3NPVA 4AWUA 4JR5A 2PC4A 3TQVA 4UFMA 3W7OA 4K38A 3A23A 5MHBA 4UNKA 5D32A 1H61A 2XN1A 3TSMA 1EEPA 3CTLA 3IVSA 4RJEA 1EUNA 2JKEA 2XN2A 4K8HA 1ZY9A 3AJXA 2WQPA 5G1TA
chains in the Genus database with same CATH superfamily
3OZPA 4LS2A 5LA0A 1FDJA 1XP3A 1LQ0A 4DO7A 3NQGA 2DV0A 3A4XA 1IT0A 1E55A 1VPQA 3VIGA 2FB3A 4GFIA 3K8LA 2ZZ7A 5HDRA 2ZDSA 2G97A 1V6TA 4LGXA 2QKFA 3NM1A 3KTCA 5GJMA 3LY0A 1OG0A 1DTUA 4NZJA 1O6IA 3DYPA 3GH5A 4R7JA 4ORIA 2JGQA 4IJBA 5HMDA 4FF7A 2ZA1A 1CEOA 3AXIA 2CHNA 3GU2A 5TD4A 1E6QM 4R27A 1DORA 1WQ5A 1QHOA 3OYXA 1A49A 2FJKA 2ZTKA 1HJUA 4MPQA 1KR1A 2C16A 2DSVA 2E0PA 4H41A 4HU0A 4AWTA 1HJQA 3RLGA 2D2GA 3LB0A 1W17A 5AHIA 4OUIA 3IIZA 1D7FA 4N9EA 5ABGA 2OCZA 1GVRA 1LT8A 4NAFA 4L65A 2YDAA 2NQHA 1XDMA 3NO1A 5IHRA 4GXPA 3CK5A 3CAKA 3EWDA 1QTWA 3I6TA 2QF7A 4WGXA 4B90A 4D8LA 5TNVA 3RILA 3AC0A 4MZ1A 3AZSA 5D05A 3GFXA 3BOLA 1HVXA 1KBJA 3G1FA 1DJWA 1FWAC 2Y7GA 3RCNA 3LCFA 6REQA 2DH3A 4UTHA 3BAIA 4LYRA 3HGOA 1LLZA 1UR0A 4IFRA 2OYMA 4PTVA 2NVAA 3VNYA 2YCKX 3SCNA 4R9XA 3BCDA 3GB6A 3XINA 3WDJA 1VPYA 4HU8A 5HATA 1NDVA 1RBAA 1K7EA 5CH9A 1GHRA 3FXGA 4D6IA 4ORMA 2W62A 4FLRA 5H8UA 3WENA 4GVHA 4ERIA 1W5NA 1FWDC 2DJXA 3CIVA 3NWRA 4W7VA 3E96A 3W7LA 2GDVA 1UR8A 4PMJA 3I3DA 1RV8A 1XIHA 3FA4A 2ZRWA 2QUUA 4ZA0A 3G1HA 2J7BA 2OJPA 1Q6LA 3LCLA 4NILA 1C93A 3CC1A 1UZDA 2QCFA 1H41A 2OTDA 3HV9A 4BZYA 4S3BA 2CPUA 4UTTA 5A6AA 2PLJA 4LEFA 1K6AA 2WSYA 2GUBA 4HIBA 3N14A 2PDXA 4GX8A 1DP0A 2J27A 2WC3A 4EACA 2Q3RA 3GG0A 5M3WA 4NP7A 3HQPA 1GZ1A 3HN3A 3GR7A 3VE7A 4WIWA 4S38A 3UG5A 2YXGA 4YJ5A 3S3GA 4JHMA 1AQFA 3W84A 2XINA 1IXNA 1JCNA 1Q4NX 1LLOA 1V7AA 4CEXC 4RUBA 3RIKA 1EF2A 4KRTA 4IIDA 3E0WA 5LNRA 2F7FA 3AS1A 3UESA 4X2PA 1EKOA 3M0LA 2PUZA 4P8UA 1QVBA 3GZAA 3UJFA 1XFBA 1O1ZA 3OA5A 1KQZA 1YE4A 2GL5A 4HA4A 2B7OA 1CXLA 4XB3A 2DORA 3FN9A 4YL2A 5BWFA 2ZX7A 4DUOA 3CLWA 1AL8A 3KBVA 2O92A 1CPUA 4FNTA 1PHQA 1HN1A 4REQA 2NX3A 1XLKA 1LTDA 1HIZA 4G7FA 2C13A 4NRRA 3N6JA 3NZQA 3MVIA 5K2ZA 4N42A 1LUCA 5LZLA 2E5DA 2VR2A 1YPXA 1G1YA 3AISA 3S9IA 4HZ6A 1OYBA 1JIBA 1VBGA 3PULA 3DERA 1BPLB 3UZ5A 4MGGA 3ARQA 1RR2A 3EB2A 4HT3A 2Y85A 4M7TA 5EMKA 5BRBA 3B0PA 4IFKB 4LX4A 4IPJA 1M5WA 2A21A 1VKFA 1RVGA 2W66A 4OT7A 3KX6A 4ILSA 1LQAA 2QIIA 3C0SA 4XG1A 7A3HA 1S3TC 3H70A 4B5SA 5BNKA 5LIXX 3BURA 4HNCA 1ZJHA 2NSOA 3OO2A 2GYIA 4RDZA 4PZVA 2GUUA 1X97A 1XSJA 4AEEA 4NSBA 3LI1A 4ADSA 3FEMA 4R85A 1C8XA 1E0UA 4EF8A 3F4WA 4ZO7A 4A2RA 1ONRA 3SADA 3KWSA 1A5KC 1H7OA 4DBWA 1EDQA 2QT3A 1TA3A 3RUBL 5CGMA 4LUIA 4PN2A 2WJEA 3VOGA 4PMVA 3T08A 3A9BA 3GW0A 2FB2A 3W4RA 1HX0A 5BU9A 4LYKA 1GTEA 3FSUA 4K39A 1RJPA 1UQZA 2ACSA 3TE9A 3W2KA 4GYJA 4GQQA 1XLLA 4WHBA 1AJZA 5M5DA 3SO7A 2XH4A 3B8DA 4A3HA 5MKGB 1EA0A 4E38A 1FWEC 4H8UA 2CITA 3HBLA 1QAPA 2ZRXA 5CGQA 4HOZA 1EJRC 3ISIX 5JBEA 2O9OA 4LAZA 1IV8A 2GSJA 3B8WA 2ZQ0A 1GPWA 1LZOA 2J78A 1MXSA 1LDCA 3C0JA 4FNUA 1FCQA 1I1XA 2X1RA 4E2VA 2CERA 2WKJA 1L6YA 3M0VA 3R8HA 4ZE5A 5M03A 3L4WA 3GHTA 4H6RA 1NDWA 1X7FA 3TOYA 3W7JA 1AFSA 3RRXA 4H9TA 2G0WA 4JAWA 2CKRA 2XTKA 2MNRA 2VCAA 4RW5A 1SQ7A 1E15A 4A8NA 1GOOA 3WMBA 2DIEA 2EPKX 3D0CA 3EWZA 5BYWA 4O1BA 4C6QA 2FHCA 2Y89A 1DBTA 4Y90A 5FAGA 2AAAA 2B7PA 1GK8A 4FXFA 3K2GA 2DP3A 3A3WA 1A5MC 4QS6A 1MW2A 3WZ0E 4BJHA 3VE9A 2Y70A 4QXIA 3HPZA 3UA4A 1CDGA 4HMNA 2J7CA 3G8RA 4J3SA 4FHAA 2WMKA 2VC7A 4HHMA 3WJWA 5FACA 5DELA 4M19A 2BVYA 4CU7A 3S0CA 4QJ1A 3Q45A 4HPXA 3DHFA 4DJDA 2HVOA 3N13A 2VX5A 5ABTA 3AYTA 3CV1A 4GUJA 3JR2A 4UWMA 1OX4A 2F84A 3A3HA 1DHKA 4A29A 4GQ0A 1R0MA 3ZR6A 2AOSA 4QROA 3TNBA 3OG2A 4Q6JA 5BROA 1R3SA 3W6LA 1TPDA 3SN1A 1OGBA 3HFTA 3CXOA 3PFMA 3NUKA 2WZHA 1OJXA 2J7DA 2PWHA 1QI5A 1TVPA 3T7VA 1JCXA 5CPMA 4XZ9A 3R12A 4IIGA 3L2LA 1EPVA 3N1AA 4I8DA 1QW7A 5DFAA 1ONWA 1RD5A 2PU1A 2X0YA 1OADA 3U7BA 2P3EA 2RDWA 3VGFA 3VGBA 1ISWA 1ME9A 3TU9A 3P7YA 4CEUC 3R7MA 4C1LA 1HJXA 4ACYA 1KFJA 5FCZA 4O19A 2GGEA 1VCVA 3XIMA 3E3HA 1XM3A 1XFCA 4EKJA 4X63A 1OCQA 3VABA 5I6SA 2E1DA 1TO3A 3LOTA 4L64A 1PYMA 3FK4A 3RPTA 3NO5A 1D8CA 1VEOA 1HL8A 2B7NA 2J8TA 1KCLA 1B5TA 3D6NA 4MNJA 1UKPA 3HGSA 1CW2A 2GVJA 5C9WA 1H1NA 3GVWA 3UGRA 1UMLA 2XSXA 5FEZA 3PAOA 2EEXA 3CWOX 3W37A 4K7YA 3W73A 3VM7A 2OLSA 3O3RA 4WLCA 2WZMA 3W88A 2Y4SA 1Y5XA 3GM8A 4I9AA 2XVKA 4XAZA 1PKLA 1UR9A 2QJGA 4DUWA 1SZNA 5GQBA 2PAJA 3BV4A 3PR2A 3GUGA 3UXLA 3NEHA 3UG3A 1W1YA 2BY2A 4G8TA 3T81A 4CD4A 3DENA 2GSEA 1KV5A 3MHUA 4B2DD 3W26A 1AD1A 4GIYA 5FIPA 3LHYA 5AC7A 3NNTA 3RNDA 2EPNA 2Q02A 1OIMA 4O18A 1PE1A 1YKWA 1DJQA 4LTSA 4PMZA 3QOKA 4KCUA 3W7GA 2NWRA 4W7UA 5ABFA 3BSGA 2E28A 2FGBA 3W01A 3AIQA 3MYPA 2QCGA 3M7SA 1VYSX 2PBGA 1RY0A 2V68A 5CKSA 3STCA 1YDNA 3QV8A 1ITCA 1BXCA 3S5OA 3KLLA 3DH7A 1X39A 3D3FA 4Q8OA 1P0DA 3L4YA 3MHFA 1OCJA 3UXKA 3SZ8A 4DVOA 3VOIA 3FGCB 1JZ2A 5AYXA 4HOXA 3WLJA 5REQB 1JULA 5A6BA 1GG1A 4UZUA 2I56A 3E0VA 4YPJA 4Q33A 3W72A 4JQAA 5EB8A 3P5ZA 4QDPA 5FF4A 4UC5A 2EBNA 4GRSA 3SN4A 3WQ6A 4JQ2A 5CPLA 2ZUUA 4P7NA 3P6LA 1KLYA 2PRMA 2Z27A 1WDWA 4YNGA 2ZBTA 1XCWA 5A2AA 1TWSA 2XUCA 5BMXA 3M6DA 5CQ1A 1MZRA 3U5YA 7TIMA 1N55A 5T9CE 4GPNA 1M6JA 2DZWA 1OGGA 2HMCA 4NZ1A 3S42A 4MWAA 3BLIA 1X6LA 5EPDA 1F07A 5D2TA 3FKKA 3EEGA 4RNHA 4MOZA 1C7TA 4HMDA 2GFTA 4M24A 4QLKA 5JBDA 4N6EA 1E4MM 2XU2A 5T26A 1UUQA 3THCA 4PH6A 4QG8A 3GBEA 2OSYA 3CQ0A 5FJRA 1Y5VA 1SFLA 3BL3A 4GXMA 3G3DA 1C9DA 5AZ0A 1OK4A 1MUMA 4AZIA 4TU1A 2ZOXA 2IUZA 3CV7A 2BVWA 2H90A 3MW7A 4S3CA 4AF0B 4DY1A 3R8RA 2XFWA 3KOYA 2WC7A 3TP4A 3DHUA 3M64A 4B16A 4BF7A 1EX5A 4HPHA 4ALDA 3H2AA 5JQ9A 3HPXA 2X0SA 1FDYA 1Q45A 4WVXA 1JGMA 2PLCA 1RQHA 4LUTB 1TG7A 3MO4A 4JIQA 2QDHA 1OB0A 4QP0A 3ID7A 3QTPA 3RAOA 1XGZA 4Z1BA 4RDWA 5DN1A 3CHFA 4LQ1A 3D5HA 3TROA 3UJSA 1LBMA 2HNEA 3JRKA 3MWCA 3LTYA 4S39A 4HK5A 3E38A 3C52A 4IQEA 4IL2A 3GUWA 3S83A 4L1WA 3T0CA 4J2PA 1QRQA 3W7CA 1ICSA 3EDEA 1DVJA 3IEBA 3FW6A 2XG9A 4A8RA 2HDJA 4LALA 3OBEA 5FJTA 1Q65A 4ATDA 1NVMA 3MUAA 4PBEA 4NAEB 3MTWA 1UR1A 1QWKA 4NU7A 3UETA 1VJZA 1KD0A 4XIMA 3DU0A 4P7OA 2OYKA 5L6UA 2VWTA 3GC2A 3TN6A 1CYGA 1XYZA 2PP3A 1UUOA 2VZVA 1F74A 5KINA 3Q94A 1DWIM 5G1YA 2QDGA 3A3XA 3CZLA 3R5EA 3OZYA 5JBFA 3S6DA 1QW9A 3LBMA 2PZNA 3BLEA 2XFRA 3CMFA 2ON3A 3DXIA 4GQBA 2ISVA 3K46A 3GXMA 2Y5EA 3AHZA 4PEEA 4Q7IA 3BLPX 3DYOA 4OU1A 3C86A 3ME3A 1SMDA 1ZCOA 4TVUA 1JDFA 3EKGA 3GHRA 1EC7A 3NZ1A 2O4QA 4HNOA 3RMJA 3A9IA 4CCDA 2IQDA 2PDGA 2AQWA 1VEPA 4OFCA 3E2QA 2WWDA 3II1A 4AY1A 6XIAA 4PFHA 4K68A 4NJKA 4YHGA 3OZMA 4LB4A 3ZXWA 3P82A 2KX9A 5D9PA 3NAVA 1I2OA 1NP2A 3OBKA 3ZR5A 1YDVA 3LI0A 4O11A 1KCZA 1WDPA 1LWIA 2P88A 3H4WA 2I5IA 6TAAA 2YPIA 3NQEA 2AQOA 4B4FA 5AC5A 3WD0A 4WXYA 4CCCA 1PIFA 3DFSA 3CU2A 1QHPA 3NQFA 3V7PA 2WPGA 2VOTA 5AB3A 2P0IA 1ISXA 2VC6A 1TPWA 4PE8A 4U5KA 4K3ZA 5A3HA 6TIMA 3MUY1 1SR9A 2ZZ2A 5A2CA 1PYFA 8RUCA 4KFNA 1FWNA 2VT0A 3C8NA 4M51A 5CZ0A 3AUOA 2FHFA 4AEOA 2ZA2A 3SCVA 5CBIA 3CT2A 3BQ5A 4BS0A 4QGCA 3VIFA 2MUCA 4XD3A 3PFRA 2XWDA 2PDBA 3R2GA 2HCVA 3VNDA 4AC7C 2HEJA 4Q7NA 1T40A 3ABRA 3GG8A 1PIIA 4AFYA 1UZ4A 5U7SA 3IJ9A 5C2CA 2WJFA 3UWZA 3WUGA 1YW1A 3FJ6A 1TZ9A 4QR6A 3TCEA 3P67A 1K8YA 2UY5A 4H3DA 1XX1A 5JUVA 1UWUA 3LPFA 1MFVA 3TTSA 1B3OA 4F0KA 4DWSD 1S2CA 1P43A 1XV8A 5EGRA 1JF6A 2J9ZA 4LVDA 1E3ZA 3C6CA 3PZUA 4X3ZA 4MPKA 5T91A 1ZRQA 4KIRA 5D2WA 5BOOA 1JGIA 1ZQ5A 4M5PA 1JFXA 1WUEA 3BZJA 1VR6A 3WY1A 3NL5A 4O0QA 3CZ8A 3GC5A 4DO6A 1DXFA 1KGUA 3WN6A 1SJAA 5KITA 2OT0A 4LY8A 3TNOA 1A3XA 4JZ5A 1TVLA 4LC8A 3BG3A 2EJ1A 4KWVA 4C1NA 2OEMA 2VEIA 3VKBA 2DT3A 3BTNA 3BLOA 1KGWA 3CO8A 4GINA 4UR8A 3BGAA 2DVUA 3GTXA 3V1HA 4C7GA 2V5BA 3S5SA 1A5CA 1NWUA 3E0IA 2Z7KA 3QQ0A 1PKYA 1FWFC 1WYIA 3LMZA 2YBTA 3HG5A 3CJPA 1E1CB 4JTIA 3V4BA 4GNJA 2PDCA 3G18A 1EBHA 2WLYA 1LJYA 2KAUC 4UTWC 4IPNB 1F3EA 4LYQA 1VRDA 1FWJC 2OT1A 4KW2A 4Q7BA 2QUNA 3S2JA 2TAAA 3GD6A 1UP3A 3QSTA 4DPPA 3JZUA 3K1GA 3QFEA 2WHKA 4J7RA 4CU6A 4QLJA 1XCXA 3WQDA 1EYWA 1ZZMA 2H9AB 1WKFA 1QOPA 1NH6A 1AD4A 4IJCA 4WF7A 1XLDA 3BG9A 3H2FA 1P5BA 4NY2A 3WF3A 1JCYA 2YGYA 2WHMA 1DV7A 1H1ZA 3VCCA 5KTLA 4DELA 1XH0A 1X6UA 2OEJA 1CX9A 1MRQA 3EKZA 4IFOA 1W9VA 4JOMA 5E6YA 3PSWA 4JYFA 2QDEA 4FB7A 4WY0F 3GH4A 3T4CA 1YTKA 1P1XA 4GNKB 4I9MA 3EZ4A 2WHJA 2C0HA 3EPNA 4MKVA 4NZFA 1XC4A 3W1NA 3CQHA 3I3BA 1A4LA 4WJXA 3AMCA 1RK6A 4ATLA 1Q66A 1WA3A 3CZGA 1KGXA 4ZB5A 2VL4A 3PS7A 2INFA 3CASA 1W1ZA 4IPPA 2R14A 3IRDA 2EG7A 1KM4A 4KWOA 4HU4A 1W8SA 1J0JA 1FHUA 3GXFA 2J62A 3CAQA 3KCLA 3EPMA 4C5ZA 1N82A 2GVGA 1IT8A 1PKMA 1XHGA 4IFKA 2Z1KA 3KL3A 3OVGA 4AQLA 4LAUA 5FI8A 1SO4A 4G1KA 5LNSA 3GTFA 5G4EA 1UA3A 4IP5A 4D6DA 5HQMA 1FFRA 1ZGDA 1WXZA 1MW1A 3SY1A 3SCSA 3QRHA 5BRQA 4NUWA 3EOLA 4IG2B 3K13A 1B0IA 2A3BA 3W81A 3RX2A 2QS8A 2BSLA 1B4KA 1ISVA 1H7RA 1V02E 2REQB 4B5UA 3P80A 3VDBA 2C79A 4X22A 4AD3A 3ITVA 2AL2B 4GA8A 4EVZA 2GGGA 4OIFA 4AZ5A 1G5AA 3WNOA 4PBFA 4ZR8A 4MYAA 5CG7A 2D0GA 1KW1A 3GXDA 4B3ZA 3BAWA 1A5OC 4WKAA 1FCUA 3M41A 4B5NA 1KTCA 1LL7A 3SRDA 1E56A 1XLFA 1KA9F 3C2EA 4D6HA 3MBFA 1PDZA 3ITYA 1UB3A 4LVGA 2EKCA 4JL1A 2VFDA 1HJVA 2F6XA 1EIXA 2QR6A 4GUHA 4XAGA 3VX1A 5BU6A 3O0FA 1ELSA 3ZLHA 1R87A 2J7FA 1KB3A 3LPGA 3MUCA 4AX7A 1N2VA 3GDRA 1A47A 3L5AA 2O9RA 4GC4A 3ARTA 2J7EA 1TE1A 4DF0A 1FOBA 1N8WA 4RNFA 1CLVA 2WMHA 1OCBA 4QJ5B 1RJRA 2D2OA 4Y9OA 2FHBA 3PNUA 3PTQA 1QT1A 3W38A 4CQ9A 5I00A 2TYSA 2OSXA 4LRTA 3FSTA 2G4FA 4E8DA 1K8ZA 5C8BB 3NJ3A 3VUPA 4XZMX 1WX0A 5B7ZA 5GNYA 3XISA 3G1AA 1PX4A 4FXJA 3VDHA 1VPXA 2HE8A 4E8CA 2WZTA 2DUXA 4JDBA 3WD1A 1U5JA 5F2GA 3ZSSA 1Z44A 3P93A 1EP1A 2X30A 3EA3A 4YN5A 2R1KA 1JYVA 1W9UA 2HROA 1XRTA 3MANA 1GKRA 1W1B1 3GNDA 3TZFA 1E70M 3FX4A 4FK9A 1VH7A 3BARA 2VDHA 1TJ1A 5EMJA 4C90A 1VLIA 1H7XA 3C0QA 4NG3A 1Q13A 4BFAA 1JDAA 2OU4A 1D2KA 4DX3A 1FX6A 3UJEA 3WBXA 2CCRA 3FJ4A 1VJIA 3CIWA 4ADUA 1PZ2A 4G1NA 1C92A 2CLOA 1TKKA 3KTSA 1WBJA 1K8CA 4DWSC 1R3WA 3BICA 1PZ0A 1N8FA 1TV3A 4NZ4A 3A5VA 1VB9A 4RXFA 1VZWA 1OGSA 4J3TA 2Y63A 4WDUA 3SY8A 4HJFA 3PAJA 2DT0A 5C6MA 3PWIA 3QPYA 2EPMX 3WL1A 3WH7A 2OXNA 3WLIA 3HG4A 1I6NA 4QQUA 5G1MA 4KBXA 2L5HA 2YDRA 3KVJA 3WDPP 5AECA 1XGEA 3BJSA 3DFQA 5ECVA 4GVFA 3VFLA 1ICQA 3DYMA 2DDXA 3KHDA 4HN4A 2QVHA 5DT5A 3G1DA 3G6LA 3N6QA 3N25A 4S3FA 3FOKA 3TKFA 4PULA 3EOEA 1OQFA 2GUYA 3ANYA 3WJYA 4G5DA 3WQGA 2V5CA 4F0LA 2QUMA 2J13A 2Q71A 1NARA 4YLWA 1KXTA 4KS0A 4MB1A 3L4TA 3NZPA 1QNPA 2E9LA 4JIHA 3FLUA 4TXEA 3FAWA 1BGAA 3NFUA 5C5YA 2Q6ZA 1EA9C 4AEFA 2WQDA 1TIMA 1OABA 2ZVIA 3NA8A 3LM3A 2CHOA 5BXSA 2ZADA 3GSMA 2J88A 2OWWA 4RLIA 1OY0A 1O7AA 5C9ZA 1AQHA 2GVYA 4IGMA 1TFVA 1ZAIA 1QPQA 1HGWA 4JX5A 4QG9A 3E0LA 1QUMA 2TRSA 3UYCA 2XFFA 3T09A 1W54A 1NIUA 3QVQA 2DZTA 1GYMA 1R86A 5F7UA 5CLTA 3Q37A 2YX0A 4F0HA 2C8NA 4NHVA 3GDMA 2QMJA 1ZPTA 4P7QA 1HF6A 3S5YA 4E4PA 2V5JA 4DLFA 2WSPA 1L6GA 4BQ2A 2ACRA 4IGHA 4QCFA 3N2TA 1J0IA 1H51A 3BAKA 4F2BA 3R0UA 1E0VA 2DUAA 4XD4A 4F8XA 3LNMA 3G2GA 1Q7QA 4JD4A 2I9UA 2PC4A 3TQVA 4UFMA 2FYMA 3GFZA 4OOUA 4UNKA 1EO5A 3I10A 1U22A 3SBFA 3L23A 2JKEA 3ZVHA 3MQTA 3QBUA 1CT5A 1ZY9A 3AJXA 6XIMA 2WQPA 5AVNA 5I3FA 4IF2A 4AUBA 2PS2A 1P7TB 3FDGA 3DEQA 1E6PA 4GY1A 4C65A 2HQAA 3ZT7A 4O0KA 1KM6A 2PTDA 1FP8A 4J3XA 2X1SA 4GYKA 4NJIA 4UFIA 2PDKA 1QK2A 1PZ1A 1H3GA 2GPTA 4DYKA 2W5FA 1TSIA 3F4CA 3LLDA 3TAOA 3WBWA 3WK1A 3UWWA 3MS8A 4E5TA 4GY0A 1V8EA 3HQOA 4O50A 5IBXC 1B1YA 1Y0EA 3SCPA 4HZMA 4K2SA 4J3VA 1OFAA 4M29A 1QPKA 4QISA 1VBJA 4NKCA 1THFD 3QHMA 1O68A 3FYPA 2BXZA 3WLKX 5IM51 3VZZA 1DL3A 4AHQA 2ICSA 1QXLA 1IZJA 2XZ9A 4UZSA 2E6DA 2BHYA 1GG0A 1XYBA 2F61A 2YLAA 4D6GA 1F5ZA 3FCPA 1FWSA 3INPA 5C55A 3FVMA 1XJBA 3KTXA 4GZEA 2ZRYA 4MTVA 5FKYA 4GCXA 3C2OA 3CT7A 8CGTA 1PDYA 1IZCA 2CXGA 3CWHA 4XAPA 7ODCA 3BSHA 3TN3A 4G7EB 2AL1A 2PDHA 3PY2A 2VMFA 2V2HA 2QV5A 2D24A 1I60A 3UXAA 3NXLA 4NNCA 4AVOA 4NX5A 1TPC1 1F4AA 2AAMA 2XSBA 1EWEA 2IQTA 3M5VA 2PPGA 5I77A 3IGHX 5E70A 5I3HA 4FOKA 4DJFD 4Q8MA 3ECQA 4B3KA 5JH1A 1EZ2A 4ZZ9A 4NAEA 1K4GA 3W3OA 2CBUA 1Q6GA 4E8GA 1NF0A 1XW8A 4PSPA 1AUSL 1QASA 5LIKX 3GNRA 1V08A 3U5UA 2DUZA 3CZJA 3W7EA 4INFA 2P50A 3GU9A 5K4XA 1KFBA 4ROQA 5DQPA 2J7GA 5J04A 1W3KA 3MI3A 4YYFA 4DBSA 2C14A 1A5LC 1QNOA 2CC0A 3H22A 3WLMA 3T2QA 2OGYA 4WJ8A 2WNNA 4LUYA 1NOFA 3ZJKA 5LA2A 3TVAA 5CZKA 1US2A 5HMEA 1Q6EA 4JTDA 3ARPA 4PTDA 1BWKA 4XAFA 1JR1A 4JNZA 3EX2A 3U2ZA 1CB2A 1UW9A 4GGHA 3WDIA 2G8ZA 3M43A 5D4YA 3AU2A 2AGTA 3MYOA 5RUBA 3TLQA 4JFTA 4L7ZA 3W27A 4PMOA 2ALRA 4KEVA 4ZXLA 3GQYA 3GDKA 5HWMA 3IV8A 2Y6ZA 4HPNA 2QHAA 5C54A 3BMWA 1W1IE 3WD4A 4BI7A 5D2XA 2XH2A 3E1F1 2PSNA 1VFLA 3HFYA 3TOPA 3AHXA 1MI3A 4DO4A 4IQLA 3OGVA 1M68A 2HSAA 4US6A 2OLHA 3MJMA 3LV6A 1GHSA 1JYXA 1F7BA 2DT1A 1OX5A 3B9AA 2RGLA 4YWSA 2OZ8A 4PCNA 4W88A 3L21A 4E4UA 5D2YA 3ZWTA 4C6EA 3W1XA 2YDSA 3IK4A 4HJWA 4WJEA 3QR3A 3RF9A 4NAFB 1P0KA 1BEUA 2Z29A 4BWLA 4GO9A 3P5YA 1H5VA 4PUMA 5G4WA 4HYVA 2NUXA 3ABOA 3I68A 1KXVA 3GKFA 4JHZA 2OWCA 3HPAA 4XZHA 1WDQA 3LXCA 1JUEA 1O5RA 2FTWA 3WQ8A 3QOMA 4QE5A 3H4GA 3W00A 6REQB 3RO6A 1NJJA 1XSKA 1BSIA 3NSMA 3FKRA 4DZHA 4KF1A 4JNMA 1QBAA 1UKTA 1JRBA 3S47A 4AXNA 3ZJ8A 5CJ5A 5CSRA 5A8NA 3BLDA 4TX9A 3WF4A 1EJ7L 1GQLA 4AIEA 1L8PA 4QAWA 1XYLA 1TV2A 1S5TA 4QFUA 2V3DA 3IUDA 4L1XA 3LBCA 2FPVA 2PCEA 1EP3A 3WQOA 1TX2A 3NQ6A 3G3MA 1DE5A 3BW4A 1CI1A 4KEUA 3MA8A 5BOFA 1KV8A 1SU5A 1GOWA 1JPMA 4DM1A 4K1GA 3BAYA 1VRXA 3R43A 3CUXA 1EO7A 3WQVA 2WXDM 4UTJA 4FZIA 4CD6A 3VUSA 4U3CA 1U2YA 3B9EA 1SZFA 1W5QA 4JX4A 3UWUA 1KXHA 1VFMA 2ZRZA 4QRNA 2JF6A 1E1CA 1V79A 1GEQA 4D6EA 1E5JA 4G2DA 4ECLA 3PTKA 1ONEA 5BWAA 4FX7A 4ZEPA 1TPEA 1XDLA 1TWDA 3OYZA 3EWYA 4MB4A 4JN8A 1HKMA 4IXHA 1GJUA 3F5JA 1UWSA 4GBUA 5I79A 3MZNA 4CU8A 4RDVA 1YNPA 4DJED 4O1AA 4OTKA 2ZXDA 1TTIA 2DQWA 3CQJA 3VIKA 2Z2BA 3L7RA 4Q8UA 4AHOA 3SECA 2QCLA 1V02A 2DPEA 2H9AA 1QI2A 1VQTA 1VBRA 1ADOA 5FF0A 1E5NA 3AHYA 3BLKA 2GZXA 5C9UA 4XZWA 3AU6A 3N2CA 1JL8A 3QPEA 4OOZA 4REQB 3GIYA 4AG0A 4GI8A 2B31A 2FH8A 1TV7A 1XYFA 4RL3A 3B8TA 1YX1A 3GNNA 4XK2A 4D8AA 5EL1A 1R5YA 1LUCB 4AD1A 2I14A 2Y1HA 1KBIA 3OPSA 5D8ZA 2ISSA 4HHPA 3DBPA 3M46A 3WLPA 4Z1YA 1H60A 1DJNA 4Q8VA 3DECA 2ZX5A 4NF7A 5H8PA 3QKEA 3PTDA 4B5TA 1M53A 4MFEA 1TJPA 1NP0A 3HMCA 4CNSA 2A3LA 4LW7A 2X1UA 2X40A 3VFCA 3TQKA 1A4MA 1YTDA 4IX2A 5EMLA 3EA2A 3WH5A 1E71M 1AW2A 3BQ6A 1W9DM 1CB7B 2WVVB 1IEXA 2J66A 1IR1A 1S1PA 1W56A 1I0BA 4HA3A 2A3EA 3DFOA 2AMGA 1T5AA 1WKYA 2NV9A 4F0MA 2E68A 2ZZ3A 3WEZA 4UBPC 1PAMA 4MM1A 3AIWA 5C7HA 3GO2A 1L2QA 3T8LA 1BQGA 1JD7A 1G9HA 1RPXA 1S39A 2BX7A 4MUZA 1RPKA 3NL6A 4AW7A 4NYUA 4DZIA 2YCLA 3OQ8A 4IG2A 3TTYA 3CQKA 1XIIA 1PEZA 4XD5A 3R8GA 4DJFC 2ZC1A 1TA3B 3IK2A 3NSXA 3Q4DA 4YCOA 2IXUA 5KZDA 1KWKA 1Q6FA 4Z2JA 2ATSA 2UV8G 3VK5A 5K4ZA 4GI6A 2BS9A 4GZJA 1K03A 2D20A 1PTAA 2D3NA 3AIUA 3KRUA 1ZAJA 3RO8A 1O95A 3MJYA 4B2DA 1D3GA 3W1MA 4H7ZA 3VYLA 4Q4PA 4LC6A 2EPLX 2OOGA 2AGKA 1LF1A 1WDSA 2XPKA 3DN5A 3CS2A 1V77A 4L6HA 4WD0A 3VD9A 3I65A 2ZIDA 4YTQA 1WZMA 3LHUA 4XTIA 4JTAA 2ABBA 3K8MA 3A12A 1CNVA 4RZ5A 1LRNA 3SCUA 3MB9A 2VEKA 3W1RA 1UWAA 3HGJA 2OYLA 3SSZA 5GNZA 1MEIA 3UNTA 4HZ8A 5XINA 2QPUA 2OSWA 3W7RA 1Q8JA 2PTZA 4JCLA 4O4WA 1J5TA 4XZIA 3EDFA 1KFCA 4C6DA 2AKMA 3AWNA 3ANVA 2E09A 1LWJA 2YCIX 3D47A 1GGOA 4ZQNA 1OINA 3R6IA 3TH6A 3WLHA 1G67A 2GJXA 4N02A 1R47A 4ZBCA 5LKYA 2C19A 1YTEA 1SSDA 4UTMA 4Z1CA 3N4FA 2NQ5A 2VX7A 1T7LA 4KRZA 2GVLA 2H6RA 2CBIA 1BFNA 1W5PA 3RFAA 2INEA 3PPGA 4MJ4A 2ZWYA 2WM0A 3EWUA 4GQGA 2WANA 2O56A 2E25A 1K7XA 3WH8A 2VELA 4HK7A 2NT0A 4ZQRA 5LHFA 3UJ2A 1VAHA 3ORWA 1AMYA 1HKVA 2VVSA 1M41A 1XWYA 1LCOA 4XBKA 2YKKA 2Z25A 1UD5A 1QBBA 1YEYA 1FY6A 3HV8A 3PZGA 1OC6A 1TX0A 2FIQA 3APTA 3DFYA 5DCBA 5EYWA 3CH0A 1OX4B 2OLAA 1R7OA 3ATYA 3SCWA 3RM8A 2ZUWA 1ZL1A 3UPMA 4D72A 3FA5A 1SVDA 3EMZA 4PL2A 3WUEA 4DO5A 1DIEA 4V33A 4UXDA 1B3WA 2G3MA 2QJNA 4O1FA 4Y6GA 3LV5A 4KFPA 5F1UA 4L4LA 1FHVA 2Q3OA 3G0UA 3LXAA 3EEZA 1XKJA 5A8MA 3P74A 1WKDA 1PUDA 3ARVA 3LDVA 4HOWA 2CIPA 3THDA 3F4DA 3M47A 4PMRA 3NTYA 4FLSA 2G95A 1ISYA 5AVHA 1QNQA 1S5NA 2YYUA 4J4KA 3A47A 1UJQA 4C5YA 4EE9A 2H3BA 5A5WA 5JH2A 3QQ1A 1S5WA 1W1PA 3MUIA 1YDOA 3WMLA 5TBOA 1GOIA 2Y8KA 3A21A 5F4WA 4UOJA 5DMMA 3NO3A 3AMGA 3GKAA 4UQCA 2FVKA 1XH1A 3U7VA 3EGJA 3IUIA 2BY1A 3U48A 1IEWA 3OVPA 3A4JA 2ONEA 2VZOA 3UY8A 4IISA 5AC4A 1RVKA 3NGFA 3NOYA 3CQIA 3N18A 4WGHA 1H2JA 2QMKA 5BRPA 2PTWA 5DY3A 3W2MA 1OM0A 1Z3NA 3M1ZA 5E5CA 4DXVA 3UCDA 5IFTA 2VM8A 1GEHA 1EJTC 1WV2A 4DYJA 3MSYA 4DJEC 1FWBC 3AWOA 2DGAA 2Y2WA 3RM9A 1DKWA 4GK8A 4LS0A 4QIUA 3T1GA 3APGA 3WBAA 3FFSA 3W02A 3SEPA 2XJ7A 5DRIA 3KBNA 2QQ6A 2Z00A 3AJ7A 3KE0A 2JIWA 1EX1A 5M17A 1BVNP 4JTTA 4TX8A 1R9ZA 1WDDA 4GNVA 4ZOBA 3DGRA 4MDOA 3S5ZA 4O14A 1V6VA 1IIHA 3TJIA 3STGA 1I2QA 3MI2A 2D22A 2DZVA 5ABFB 4JY9A 2X7WA 5HJYA 4KIEA 4LF1A 1EDTA 3MWAA 3WH6A 3CAVA 2V2DA 1V3LA 3WF2A 4EANA 1AJ0A 1FWGC 4CQCA 2VGGA 3O9NA 3IGUA 2FGZA 2NQZA 2QDDA 1QI3A 2CU0A 2FZ9A 3VMNA 5FSEC 1ENUA 1B3VA 3B0VC 2CZ5A 2JE8A 1TV5A 5I09A 2QPXA 1BXBA 5FAJA 4KKXA 4GUIA 1V6YA 5HNUA 2DH2A 1J0YA 2HTMA 4CQAA 3ELFA 1CECA 4I7WA 3UQNA 1ONXA 4IL0A 4UCFA 4IUOA 4F40A 3LCXA 3DFNA 2ZCGA 5AYYA 3V5CA 1AJ2A 2RFGA 1VD6A 3N2BA 4MNLA 1NFPA 3HOJA 2XGBA 3IWPA 1EQPA 2JALA 1VIZA 3ENLA 1HT6A 3L68A 4JTGA 1P7TA 4XSMA 1E0TA 4O10A 4F48A 3RU8X 3ZM8A 3G0XA 4MWAB 4YHEA 3UEQA 3O63A 5DF0A 1D9EA 3TIMA 4ZO9A 3BO9A 2BGSA 1K70A 2PCQA 3GXTA 4PTNA 2X2GA 1VFFA 4JTUA 2ZUNA 1W2VA 3UBPC 4B4HA 2Z4GA 2PDLA 2DIKA 4AMAA 3QSRA 2YL5A 3Q2DA 4XZNX 8XIAA 3K5XA 3PBVA 5M1TA 3LERA 2D1ZA 3C2RA 4DNHA 2CFFA 3T9PA 1BKHA 3UFYA 3LD5A 4JICA 4IMAA 1Q7MA 1A3HA 4WXZA 4PUEA 1JXJA 4MY1A 5C2XA 1GCYA 2QJIA 2VXNA 2NXIA 5FA5A 3AAMA 2G5WA 2J47A 2PI6A 2Z1BA 1YMYA 2P3ZA 1UIOA 3P61A 1XLAA 4W5ZA 2WC4A 3EX4A 4Y96A 3MKKA 3SQLA 5D9OA 5DRCA 1HO1A 5LIUX 2VCCA 2XIQA 3G1XA 1GW1A 1IF2A 2B7QA 4DAIA 2VCBA 3S2CA 3RM4A 2FJUB 4IPIA 1ZUAX 2VNCA 3BGGA 2ASHA 4C6PA 1W3NA 2QCHA 4LH8A 4X61A 4AVNA 2NW0A 3A22A 2WMGA 3WKZA 2P53A 2C1IA 2CLLA 4B5VA 1KC7A 4S3JA 4G7EA 2HWGA 3A4WA 5IHSA 4H7CA 3CMGA 5HJLA 2BFGA 4DAFA 3VNKA 1W3HA 1GYLA 4C6CA 1T0OA 2PDFA 4CQDA 4PRTA 1TMHA 5CBJA 1DQWA 4LRSA 2GWGA 2GQAA 4F79A 2Z6IA 3L4UA 1PPIA 5ECUA 2E6FA 4H4IA 4TIMA 1LOQA 2WHLA 1TR9A 4BEQA 1A5UA 1HXJA 5K9DA 3ONCA 4E6MA 4RW3A 2X7VA 3DC8A 2BV9A 4NX0A 1UKQA 1M3UA 4GIEA 3AALA 5TF0A 3UR7A 1B3XA 3AROA 1XIMA 1V3HA 1SMAA 5G2HA 1E0WA 3KBMA 1POJA 4FA3A 1E4LA 3NZGA 3MT1A 4TUFA 3NG3A 5D2VA 1UP0A 4JPGA 1U1HA 3KL0A 4WDXA 4EP8C 4YTTA 5DBUA 3H2NA 3K4WA 4ERGA 3FXYA 4PB3A 2G3IA 4AU0A 1MWOA 2RDXA 3PP7A 4MJ2A 3BC9A 3DI0A 2WK2A 3BMVA 4UMCA 3QR0A 1T96A 3RG6A 3NQBA 3GNXA 4GKTA 2QUTA 4DJDD 4PRWA 2DVXA 2RUSA 1IZKA 3OBAA 3L4VA 3ONBA 2ACQA 2IPFA 2FDSA 2QXWA 3IJLA 4E2OA 4OGZA 5F1VA 2GGJA 4FSAA 2GJRA 4AD4A 1E6RA 1F8IA 3F2BA 1EFZA 1UOKA 4ES4A 3AQUA 3G1SA 3MVTA 3PZIA 1FQ0A 1HNYA 4CQ8A 4ZTXA 2J24A 4F9JA 2Z7GA 2ZUMA 4MY8A 3DGBA 5L9FA 3WO8A 3AHTA 1OBAA 4NIRA 1O4UA 1POKA 2TODA 4UQDA 1X1ZA 3G1RA 4WX2A 2DW7A 3GVVA 2PGEA 3ZSTA 3RCMA 1BG9A 4OV9A 3P60A 3AIBA 2F2HA 1UIPA 1V6XA 4PUKA 3VCRA 1PXGA 1FXQA 3O8AA 1K9EA 3ALGA 3B0UX 3R1ZA 1JD9A 4UTTC 1JZ5A 3W7DA 1DJYA 3OHIA 3SFWA 1JEZA 3NOEA 4OECA 2YBVA 3WNMA 3QJAA 4GACA 4JFUA 3UCCA 4KETA 4EPDC 5IXEA 2XFYA 2PURA 2XIIA 3K8KA 4KCWA 2C1GA 3OU8A 2VDIA 3D3AA 4H83A 3MUZ1 2R1PA 3QGAC 3W6MA 4LU0A 4E3TA 2QAPA 1BWVA 1S1RA 3S9ZA 2X05A 2WB5A 3W1AA 4C1NB 4HQVA 4XIAA 1XINA 2I17A 3SJ3A 5CZJA 3JU2A 3AXHA 1RQEA 1MNSA 3TWAA 4I9TA 4LANA 4HMEA 4JGDA 2NSXA 2OQLA 2Y5SA 3TJ4A 1C90A 3U8GA 1FWRA 4UOZA 3EWBX 2O7SA 1OFPA 3G77A 2E3ZA 3EWCA 3ICJA 1AZ1A 3UXDA 1CTNA 2EHHA 4IHCA 4UNIA 1J12A 3AS2A 1W9PA 3B4YA 1O5KA 1F2JA 2WKLA 2YW3A 3OW1A 1UH4A 3T2PA 3GDLA 3C3UA 3AICA 5A6LA 1P6BA 2BLEA 2RDUA 1Y5WA 2PP0A 3VVGA 1UYQA 4ZVJA 3HJZA 1DEDA 1SW3A 3B3DA 1TWZA 1GQIA 2V69A 3V0TA 5F4SA 2A3HA 5I3IA 3PPCA 3V36A 5A6BD 4H9UA 1SZRA 2XH7A 3V0UA 1HJSA 1E43A 1NAL1 2X09A 2WZIA 1L9WA 1M01A 3AUJA 4QBXA 2PTXA 1EEXA 4P5UA 1XRVA 1XPGA 4YWIA 4IZGA 2VEFA 3M0XA 3A6OA 3U6WA 2F8QA 2POTA 4HNVA 1NY1A 3TK7A 1FCVA 4YCPA 1W9XA 5C2GA 3VOFA 4LUSA 2A7RA 4J27A 1XLJA 4UR7A 3R0KA 4QHRA 4LNYA 1FRBA 4EAYA 1F4HA 4MWAD 2ISWA 3VD5A 3L5LA 1K7FA 4X2RA 2EGZA 4K8GA 4CUCA 2JEQA 3PUGA 4W87A 3IJIA 4KWSA 3ARXA 4J2MA 3M0KA 3BOXA 4V28A 2V3GA 4MLRA 4WQ6A 1AW5A 3WJZA 4K1WA 1WOBA 1BQCA 4TVDA 1TPVA 4QCEA 4UNLA 5AOUA 1QDSA 1UR4A 1U1UA 3O1NA 5HJXA 3TJXA 3OLEA 1P0BA 3LZ5A 3QEZA 2W63A 3PZTA 3R94A 3VILA 1MDLA 3PBMA 2WVVA 6ENLA 5HAOA 5EMYA 3ITCA 3BGJA 4A8IA 2WJDA 5DANA 1HUVA 1JG9A 3W2JA 1ECQA 3UJRA 2BNJA 1J8VA 1NQ6A 3VKCA 2OWXA 1EOKA 1L6WA 4BY3A 3SB0A 1R9XA 3KW3A 4R88A 4Y9AA 1XBVA 1GVQA 2GJNA 1TYGA 5HMFA 5HNNA 5LGZA 4W7WA 1WO2A 3ES8A 3AZRA 3VNMA 1CGXA 3A4AA 1UD4A 2I5QA 3GR4A 4AISA 2ZE0A 4OBTA 4KMQA 1RCXB 2PDUA 3EOSA 2QNEA 3CUJA 3N9KA 2DZXA 5FF7A 1AL7A 4P8VA 2EG8A 2C0AA 4UTKA 5A8GA 1SJDA 1S2VA 1UR3M 2VUYA 3SGGA 4NZ3A 3W7MA 5FESA 3HG3A 1M65A 2BB0A 2GVEA 2NX1A 3TYBA 4B5XA 2G3NA 1OFRA 4HCHA 4RE0A 2VFGA 4LVAA 4ML9A 2VO5A 2DSKA 1SZGA 2ZZ4A 5FJUA 5K3VA 1XUZA 2FGLA 2QEZA 1B9ZA 2O9TA 3USBA 4ZOAA 3EMCA 4JIRA 5DCEA 2WMFA 8XIMA 5D03A 3HB9A 1UZHA 3T07A 3AYVA 4M6UA 5DCDA 5CC3A 1GJWA 1UUMA 3WDQA 3VZXA 4QSHA 3AOFA 3HU7A 3LCHA 2ZTJA 3LBOA 5CAKA 3MUXA 1H4PA 2WLZA 1QOXA 3VIJA 1MXGA 1UHVA 4A6GA 2QJHA 3N29A 1JPHA 2JGYA 4JKMA 5F4XA 3MI6A 4I90A 1WUFA 1QWGA 3KDNA 3LXBA 1RD6A 4GBDA 1VFUA 4UB9A 4U3AA 3W53A 3PWGA 1JAKA 2QCCA 4Q8NA 5I03A 1CCWB 3UW6A 5DO8A 4NASA 1MEWA 3H2OA 4XUYA 1FWTA 4BQ4A 2R24A 2O55A 5FSDC 1TB3A 1AVAA 1PVNA 4PCFA 2WOQA 3CEPA 4V2XA 2BZNA 2R94A 3VO0A 3PTMA 2DQXA 4ZENA 1BRLA 1E9YB 1OF8A 1VF8A 3AO0A 4O15A 4S2BA 3DBNA 2DW6A 1XRFA 2Z26A 1W8GA 4JBRA 4KFOA 3HIJA 3QR1A 1XF0A 1MQQA 1V0LA 1P6WA 3N17A 4DHGA 4QJ4B 5FL1A 4FOUA 1V7YA 1W3LA 3WYZA 3QQWA 5GJPA 2NXHA 5H6HA 1BKSA 3PZNA 2CLMA 3P81A 2V38A 3JUGA 1K02A 3VNJA 2A85A 2C3ZA 2FZDA 4W8AA 1VFSA 2RHGA 4M6PA 7CGTA 2V8ZA 4F3HA 1MMFA 4US5A 3RN6A 4PA8A 4GI9A 3CB3A 1HO4A 3NPVA 4AWUA 3U9IA 1C8QA 2HPMA 3RJYA 3W7OA 4L9XA 4Q4RA 5PTDA 3CHEA 1EEPA 4BKNA 1IT7A 1Q2SA 1R38A 4OJYA 1HVQA 4K8HA 5G1TA 2VFIA 1JYWA 1X8CA 2GQ8A 2BXYA 4AZHA 2BOEX 1F3TA 1V3JA 1MVYA 1PS9A 3UPWA 1LG2A 3EXRA 4AYGA 1NFGA 1OYCA 2GOKA 5IFPA 2DU2A 1TTQA 3VGHA 4JY8A 3IIXA 4JFVA 1TZ7A 1VBUA 4GZ7A 2UY2A 3UGVA 4HYRA 1DQUA 1NDZA 1ZENA 1ICPA 1TMLA 3F2CA 2J6XA 3ARSA 3O05A 4W89A 3GTIA 4GOAA 1OHLA 1Z7AA 2PBOA 2ANUA 1SM9A 5ABEA 4C6OA 2QCDB 4K37A 4FI4A 5F2LA 5E0KA 4JTRA 2E8ZA 3TX9A 4F9DA 3B40A 5FF3A 2W27A 1R2SA 2O0TA 3CO4A 2A3AA 5IDZA 1Z69A 4UQAA 4MNMA 2WPBA 1DWAM 2J7HA 2BASA 4Z08A 3W1LA 4TMCA 5C9XA 5GVJA 4OBSA 4Q4MA 3KBJA 1ISZA 5LNUA 2G96A 4AZCB 1R3VA 3VDAA 2CZDA 5E0FA 4D1IA 2VD8A 1TCDA 2YZRA 2PTYA 2FTYA 1DIOA 3CHDA 2CESA 4KESA 3QF0A 3K30A 4IXXA 3AHVA 3B0XA 3UR8A 3LX9A 4N6FA 1EXBA 1CXKA 3UR5A 4IP4A 3RR4A 1JAEA 3WLLA 3GK0A 4XO6A 4QX4A 2QV4A 4IIHA 2Z1VA 1XIFA 5EMUA 1R9YA 1P4CA 3EWWA 1EB3A 3VC5A 3LG3A 3CUHA 5AC6A 4K6AA 1D3CA 1BGGA 3UR2A 5IDIA 2Z28A 3NQDA 3SAZA 1LRQA 4O54A 5I3DA 3LN3A 4HMCA 4MNKA 1ZALA 5GNXA 2JFEX 2OKOA 3VZYA 2BODX 3K4AA 2BTMA 4HCLA 3SGZA 5FEXA 1KKOA 3T40A 4AIUA 3UZWA 2CWNA 3W1PA 4FS9A 4FXRA 3CAWA 2PEVA 4EOUA 3TMLA 1B4EA 3O6DA 1QW8A 2H8XA 4JXCA 1G0CA 2NWSA 1X96A 5JU6A 3A24A 3NDYA 3O16A 3GBDA 4V1XA 4H9VA 3HPFA 4FEZA 3GHUA 1E9LA 3W1UA 4U4MA 4ZE4A 3KCJA 5K7JA 4HA1A 4MFDA 3ZS4A 2OEKA 2BGQA 1H62A 1NWSA 4FAMA 3ZVHB 3RLVA 4GVIA 1PIGA 4ONVA 2NV1A 2O9PA 4HU3A 1ZP3A 4WDTA 2J9XA 2PE4A 3VOJA 4AZ7A 4WY0B 1ZCCA 1A80A 4FALA 4LCSA 1UCWA 3ALFA 1QFEA 2XSAA 4R7WA 2OX1A 3KBWA 4QE4A 5C7VA 2YIHA 1AH4A 2ZICA 3TN4A 3VIPA 1UQYA 3TA9A 2VQUA 2VURA 2PWEA 3CHVA 2PDMA 4A3QA 1QMLA 2Z1XA 3L5MA 3LTSA 3TXVA 2FH6A 4Y8EA 4UTUA 4D6CA 4PUJA 3W2NA 3KOWA 1V6UA 2A1YA 3TA6A 3AYRA 2EPHA 4S3GA 3ARWA 4RCXA 2OVLA 1NFBA 2O4MA 2ZYFA 3WQFA 3NCOA 2GDUA 3UCQA 1LM1A 1HP5A 2PDWA 3H54A 3IUHA 1L8NA 1Q6CA 1TVNA 2EXOA 3CEUA 1GVOA 1XGDA 2VYOA 4AMCA 2HK1A 4CCZA 4HCDA 4ZL1A 3C61A 2R9RA 3E0FA 1WXJA 4GY7A 1Z41A 3FYOA 2WV8A 4EPEC 3TC6A 1NTHA 1G7VA 4ZO8A 3GDBA 1I4NA 1GKQA 2VFFA 4AD0A 5FJOA 1A5SA 1CLKA 4OWGA 3WLQA 1XBZA 3R25A 4GH3A 5G5IA 2X41A 2H3DA 1S2UA 2DJLA 3UVAA 2OPJA 3VX0A 4HZ7A 1KFWA 2VP8A 3VINA 5A6JA 1YBQB 1H1YA 3RPDA 4L1GA 3GAKA 1S3HA 3WL0A 2WVSA 4JCMA 2CZEA 3O0KA 1XIGA 4S1FA 3RMEA 3SURA 4OHQA 1O66A 1QATA 3TFCA 2A2IA 3BLFA 4MDPA 2QAFA 1J11A 1JCJA 1HZYA 4DNMA 1IYXA 4JQ4A 2ZDRA 3G0SA 1R2RA 4XKYA 2CLKA 3W76A 4FPSA 1ITUA 4S23A 3ITTA 2HV5A 4S2CA 2XGIA 4DPQA 4DJEA 3OODA 2V9DA 3MZ2A 5LXXA 1V6WA 3TAKA 3F4VA 2YOCA 3TYCA 3OEXA 4QEHA 1PB0A 1OZMA 2E1WA 2WW5A 4GXWA 2R6OA 5I24A 3N73A 3MKCA 4W93A 1F8MA 3I3EA 4GVGA 3ARRA 2AMXA 4QEEA 1XLHA 4EWND 4IH3A 3N3MA 5BXPA 1ZLPA 5G2WA 3EDKA 1IQ8A 1QK0A 5KSWA 1QPRA 2BY3A 2J6VA 1HJWA 1JI2A 1UWRA 2NUWA 2PRLA 1J01A 2J74A 3URNA 3E2RA 5A1AA 2Z1SA 1C7SA 1ZNNA 2DZBA 2PDJA 2HBXA 3TC3A 1SFJA 1IWAA 3IGXA 1YLVA 2FFCA 3BAXA 3M7WA 3H2MA 1BG4A 2FZNA 4A21A 1KM3A 3E02A 3M4HA 3RLHA 4AWEA 1KBBA 5EY5A 1VCFA 3CH9A 3QFWA 3UA3A 1OC7A 1QR7A 1Z42A 3L65A 3QGKC 4YTSA 1XRSA 1OIFA 3AS0A 4GCAA 4PMYA 3PB0A 1W1VA 2OODA 1V93A 4TVCA 1EXPA 3CPRA 1H7WA 1GQJA 3NL2A 3JVAA 5AHLA 5CSYA 1UD8A 4MMWA 3C4UA 4N2YA 1E6SM 3QHNA 2IW0A 4JYEA 1JDDA 4NJJA 1L6SA 1AQ0A 1E1EA 5KMYA 3VD7A 2ISFA 3R58A 3CV6A 4WSKA 2E4TA 4L61A 1F6YA 3RK8A 1S2AA 4ATWA 3M5YA 1QCWA 2A7NA 4YS1A 4NVTA 4XUGA 2YJQA 4PC8A 4UFJA 3TSDA 4J35A 4HNUA 2VX4A 3N9RA 3OIXA 2PDNA 1XYCA 4U2YA 3L2IA 4D71A 3HQ1A 2XHYA 3WF1A 3GDTA 1KFLA 3SIZA 1RXOB 3VDCA 2C91A 5FJJA 3CHCA 3NYZA 5A8PA 3GXPA 2CLPA 2HXUA 3PHAA 4A3YA 3RPMA 4LBRA 1SSGA 4UFKA 2FTPA 3GYCA 2Q8XA 5DY2A 4PMQA 2VRKA 1M03A 3WK0A 1ZBVA 3I7RA 3UWQA 1BTMA 2VFEA 3ITXA 1ZJIA 1ZJAA 3AFBA 4GIAA 4HNLA 1KO0A 3QMRA 4LV4A 3OZOA 4MSSA 6ALDA 1R7AA 2VVNA 4YXGA 4KCVA 4FX8A 1TPFA 4ZSTA 3VKJA 2GK1B 4UQ9A 3U0HA 4KEMA 4AY8A 2VENA 1GONA 3UD6A 4PCSA 3BMXA 5CBBA 1TPUA 3T78A 4MKNA 3URQA 3U2CA 4KRUA 1NWTA 2EJAA 3ZZ1A 3BLLA 3CL8A 2V30A 4IJRA 3VM5A 1ZAHA 3FHAA 3AMDA 2VI0A 1YRRA 4KWWA 3CTTA 1BD0A 1BF6A 1NF7A 1TR1A 1BVZA 1EWDA 1TUXA 2R8WA 1Q8AA 4IMFA 3CPUA 4P8WA 4HP5A 5CSUA 4H9XA 2OQHA 4WK9A 4HYWA 2GQ9A 3HZ3A 3WQ5A 2CYGA 3POCA 2ALDA 1GVIA 4BCEA 1TZZA 1MQPA 2IXVA 3SY5A 2W79A 2PRHA 1SUXA 3RYSA 4A3RA 4RE3A 4WDWA 3MY9A 3VIOA 4QTGA 4P8XA 5I7GA 3B4UA 2DFAA 2ZFAA 3S1UA 2QPSA 1OYAA 1PJ9A 4MB3A 4LAOA 5CGTA 2WJZA 4JHOA 1ZSXA 3LPOA 4JTCA 4ZODA 3HJEA 1VJSA 5CPOA 2D73A 3LGGA 5C9RA 3JS3A 3MBDA 2WCGA 1H7NA 3UZJA 4EIVA 4JTHA 4WKFA 4H2CA 4Z0SA 1TJ0A 1H0IA 2NQJA 1J2BA 1F6KA 7ENLA 2X1IA 1CWYA 4EXQA 4PMNA 3V18A 1M7JA 1BWLA 3MV11 2XVGA 3NXFA 4Y9MA 3R89A 2HS6A 5DXXA 3EOOA 1WPCA 4C60A 3OA3A 1MSSA 4DWDA 1W91A 4Q4SA 4H1ZA 3VDGA 4UTIA 4NNBA 4HSOA 2J77A 3T0TA 4IMDA 4GUGA 3EAUA 1RALA 2VQTA 4H7VA 3O6CA 3TUUA 4GX9A 3L0NA 3WK2A 4JFWA 3EX6A 3WK3A 4MB5A 3KVKA 1PL9A 2WSQA 3BXWA 4DM2A 2WMJA 4DB7A 3PBUA 4EXAA 3MCOA 2VEMA 2JQXA 4YMZA 4Y2WA 3RCYA 2GQ3A 3VA8A 1MW3A 1GOMA 1TPB1 5I3JA 1EJVC 4V1YA 3E74A 2ACUA 3IJ8A 4IQJA 1NDYA 4EF9A 4CNNA 1EGZA 3JW7A 3H7RA 5ABHA 3KP1A 3UWEA 3V16A 2IPWA 4HB7A 3VGGA 5A8OA 3ZR4A 2YCLB 3TR2A 3UZYA 4M81A 5EBUA 4FX6M 2WCSA 5I0DA 4ZQMA 2NXGA 3W71A 3NQCA 3UXIA 3KOXA 3EB4A 1K4HA 1AQMA 4CNTA 2OFJA 4IGNA 1B57A 2W6RA 1GQKA 1H09A 3SIMA 1JXKA 3BSMA 2YL6A 2BBFA 2FFIA 3FJLA 2HVNA 3LA4A 4WSJA 5GPRA 4WRHA 3DFHA 1OFBA 1RLDA 4AVFA 5A8QA 3P84A 5B7YA 5AHFA 1GNXA 4DEFA 1LBLA 3KZPA 2XDFA 4V15A 3B04A 5TAOA 2XIJA 4O1EA 2C15A 1HKJA 3PUOA 3DKLA 3F03K 2CETA 3N11A 3U3HA 1XLIA 3B05A 4L56A 5H1WA 1JRCA