3QPZA

Crystal structure of the n59a mutant of the 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKAARSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESPLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 84
structure length 251
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qpzA00
1RD5A 3L68A 4LC6A 4LUIA 5DXYA 4QNEA 4UC5A 1EUNA 2E5CA 1ZHAA 3W87A 5I3FA 5K9DA 1XXXA 4J9JA 3MI2A 1SU5A 2X30A 2CLMA 5HWMA 3NQ8A 3NQMA 5G2IA 3OVPA 4GXMA 2E6DA 5LHFA 2A7RA 2RHGA 2Q8LA 2TYSA 4NNBA 4PCFA 4RCXA 3NG3A 2NUXA 5AYXA 2V2CA 5DBUA 3O6DA 2RDTA 3A21A 4W9TA 3TC6A 3G3MA 1PCWA 3QSTA 4MKNA 2C19A 3M5YA 1D3HA 1J5TA 3W7LA 5IBXA 2ATSA 4O8RA 4HNVA 1OJXA 3NQ2A 4PEKA 5DCBA 3MHGA 3TKFA 1XUZA 3QJAA 2A0NA 1SQ7A 5DXXA 2FB2A 1I45A 3CPRA 1F6KA 4IMCA 3W1LA 1Z48A 4MLRA 5LGZA 3T78A 1JJKA 4C1KA 2EF9A 3A22A 3BGJA 1IXOA 5D2XA 3UXAA 1ME8A 3G1XA 2V5BA 3LRLA 1YTKA 3I6RA 4LVAA 5CPLA 3LCWA 4MFEA 4WXYA 2A6NA 5SWUA 1DJQA 3S6DA 3TA6A 1R2RA 3N9RA 3IIPA 4YCPA 4UMCA 3IIXA 3GDTA 2HTMA 3HG2A 3QQ0A 3NQCA 4JTIA 4JYDA 2X1UA 5AHNA 3M6YA 3G3DA 4KFNA 4CLMA 2WSQA 2O7QA 1A5CA 1W3IA 4ALDA 2QCNA 1FQ0A 3M5VA 1GTHA 3L66A 1WX0A 2B4GA 2ZTKA 3S8HA 1VC4A 3LXCA 4XWUA 4RZ5A 4RZ4A 1O95A 3DHFA 1OFEA 4WD0A 5J5DA 3W7EA 1HTIA 1XBXA 4UFMA 1I2QA 1YXDA 1LTDA 4ZQRA 2X16A 3TXVA 4M7TA 1YADA 3BW3A 5CZSA 4M19A 3M9YA 1WOAA 4PTNA 1OFRA 1G4TA 2A7PA 5HJLA 3NL2A 4HNUA 1GVFA 4FXRA 5IBXC 1XBZA 4GUGA 5G4EA 2NWSA 3EWWA 1P4CA 3RF9A 1M7PA 1X1ZA 1VCFA 1KM2A 2QDGA 4RR4A 3O16A 4JTUA 1MEIA 4R34A 3P61A 1LRTA 2ZZ1A 4NX5A 3MP4A 1IXNA 4IPIA 5CPOA 2P0OA 4M6QA 3GKFA 3LDVA 1ZCOA 3CC1A 3R5EA 4JTLA 3BARA 2NX3A 1LZOA 4PL1A 2WV8A 3W84A 3IIVA 1EWEA 4UFJA 1QO5A 3A9IA 3HBLA 3BW4A 3G22A 2G97A 4NJGA 3Q2DA 3GDMA 1W5NA 4AVFA 1UUMA 5F1VA 2C16A 1GJPA 2VELA 3LLFA 4JTHA 3KVMA 3KOFA 5A8GA 2YCEA 3W70A 3OBKA 1N55A 3LOTA 3W2MA 3MJYA 2Y63A 1ME9A 1GT8A 3VE9A 3R89A 5D32A 4UCGA 4GUFA 4K39A 1YPIA 3BO9A 2A5HA 4NNCA 4N02A 2CLHA 4YLWA 5K4ZA 1DQXA 4Q32A 4JIPA 3HPZA 1PS9A 2DZTA 2TSYA 4KWWA 3FYPA 4WOQA 5AFDA 1Q6QA 1A5AA 2FB3A 2Y7DA 3TSMA 4FB7A 3WK0A 2DP3A 1K03A 1R30A 3HF3A 3B8DA 2QAFA 4O11A 5AC8A 4H4IA 1FUYA 3MI3A 4FHAA 3ABRA 1LORA 1P0NA 1M7OA 3HG5A 4XTIA 3BGGA 5EA9A 1C9DA 1Q6LA 1DV7A 3TQ0A 2X1RA 1G4SA 3W22A 4WX2A 3QYQA 2QCDB 3UNDA 2Y89A 1GVRA 1LBFA 4IXHA 1DVJA 2I1OA 3QQ1A 3E02A 3GXTA 5DLCA 1ONRA 2C15A 3B0VC 3RU6A 5LNWA 1VCGA 3PM6A 4LVGA 2Z1BA 3GNDA 4O52A 4O12A 5K2ZA 3W7IA 2CLLA 1RQBA 4DF1A 2NLIA 1I2PA 2V5LA 2YDAA 5U4NA 5K9CA 3CEPA 1SPQA 4AF0B 4DPPA 2OMAA 2BLEA 4MZYA 1WV2A 2CZ5A 3LXBA 3LB0A 3ABQA 5KMYA 1YYAA 3EX3A 3C2RA 1GPWA 2JBMA 3LHZA 4HN4A 3O05A 2CLKA 5F1UA 2R91A 3C6CA 3ANYA 2E68A 5HMSA 5J5RA 5LHEA 4JYFA 3ATZA 1SSDA 2WSRA 2C14A 1TV5A 4K8HA 3EKZA 5K3VA 3GYEA 1KM4A 2EAWA 2ZA1A 4R33A 4MIMA 3FOKA 3MYOA 1TQXA 6TIMA 3MHUA 5FEZA 2ZYFA 2Y7FA 3QC3A 3IVUA 3W7MA 2V0TA 5EKYA 4FX7A 2YPIA 3LI0A 3BLEA 1I2NA 3R2GA 2J9XA 1KBIA 2QCMA 3NL6A 4UTLA 3GKAA 4EOUA 2VFFA 1E51A 4N6FA 1AG1O 1O5XA 3NQGA 1WXJA 1TPWA 3LTYA 4LRSA 2Z6IA 2YYTA 5F4WA 3LXAA 4N9DA 4ADSA 3CU2A 1SO6A 1GVSA 3OIXA 3S5YA 3OA3A 4TU1A 3H54A 4LOCA 1OFAA 2X1TA 2YX0A 3LCXA 2Z0IA 5DCDA 1CW2A 3FIGA 1DHPA 1GZGA 2JKAA 2FIQA 4UR7A 3RNDA 3A5VA 1DOSA 2DJXA 3F4WA 1A50A 1LOLA 4GUHA 3WFAA 3Q58A 1Z42A 1ME7A 4NJIA 3HG4A 2HMCA 3EWYA 1TPEA 3MHFA 3G1VA 5C2XA 2H6RA 1FCQA 3E96A 2DZXA 2GUUA 4GNJA 4GBUA 4O1BA 1PVNA 1OX4B 4K37A 4AEOA 4E2DA 1LYXA 2DORA 3O07A 4LWWA 2H8XA 3OEXA 2GVJA 4XUGA 1EPXA 1GYLA 4FNQA 1VCVA 1WAUA 2O7SA 4Z08A 3UXDA 2NUYA 1RVGA 4BFAA 4UMBA 1LLWA 5LNVA 3EX1A 2EHHA 4TX9A 1TO3A 3EWBX 2E6FA 2R14A 2YW4A 2X2GA 3QPZA 3RMJA 1TPC1 1FBAA 2A4AA 3FFSA 4WQ6A 1GTEA 1IIGA 1EX5A 4P2VA 1VYSX 1NF0A 4S2CA 2WNQA 3MP5A 4N9CA 3IIZA 2ISWA 1TQJA 4AHQA 1T99A 3W23A 4WY0B 4IQLA 4LNYA 4MYAA 1IGSA 1JUKA 3FEMA 1TRIA 1X6UA 2ABBA 3CHVA 1H62A 2V81A 4ZL1A 1F5ZA 1K8YA 5G1YA 4AB4A 3G8RA 3W1XA 5HUOA 5F2GA 4RKAA 4A29A 3GXPA 2E5DA 1W1ZA 1F76A 5CZ0A 1B57A 3KX6A 2G96A 2QCLA 4IPJA 3LV6A 1GQNA 4QITA 4XKYB 1VYRA 4UTTA 5CZTA 3LCIA 2YXGA 2H8ZA 4OBTA 2UV8G 2RFGA 4OU1A 4PH6A 4ZQPA 3IVSA 5KTLA 3C2VA 3B0UX 2ZA3A 4O50A 4FNUA 4HNNA 4WY0F 5F2MA 4Z1CA 4JTGA 4LY8A 4HKPA 4A22A 5KZEA 3O06A 4K6AA 1BWLA 3TUUA 4MYXA 1T96A 1IXPA 2ZTJA 1PE1A 3SZ8A 1ZAJA 2DZUA 3LTPA 1TIMA 3DAQA 4WOZA 4MPQA 1DQWA 3MMTA 1S5VA 3S42A 2WKJA 1GG1A 3NQ7A 3G0SA 5EBUA 4MFDA 3LHVA 3RLUA 4O28A 2BTMA 4YWIA 4RX0A 3TROA 3G18A 2A7NA 1G69A 4PL2A 3QH2A 1R46A 3PR2A 4XZ9A 3SSJA 1MXSA 1VYPX 3S1UA 4O57A 4X2RA 2NXGA 3MI6A 4UTHA 2J9YA 3A5FA 3PWAA 4FNPA 4M6PA 3ZFHA 4E38A 1KV8A 1GVOA 2R94A 2Y85A 3NZ1A 1EP1A 1OFPA 1UBSA 2CLOA 4Y96A 3BW2A 1OF8A 4DQWA 3M1ZA 1SO4A 1JCYA 3R12A 5AN7A 3QF0A 1W5OA 2WOQA 1LLZA 2Y7GA 2C0AA 1KFJA 2G5WA 2QF7A 3KHJA 5BNKA 3W2JA 5F4SA 2ISVA 2CZFA 4HIBA 1KBJA 3NM1A 3PG8A 4WXZA 1JCLA 3QMTA 1OFDA 3O15A 4IMDA 4AHOA 4UTTC 1SO5A 3ZWSA 2CFFA 4FIRA 2ZDRA 4O18A 2PRLA 4OHQA 5F2IA 1TYGA 4FNTA 3UWUA 2H3DA 1QFEA 4AWUA 4MY8A 2W6RA 3TU9A 3DFSA 1H7WA 1K7EA 2QCHA 3NYZA 1JRCA 4KFPA 2PC4A 2GQ9A 2TRSA 1VJIA 1O94A 5DY2A 2NV2A 3W7GA 4MLJA 2DJLA 3STEA 4EVZA 1TSIA 1MSSA 3P81A 3B06A 5ABTA 2ZCGA 1OX6A 3FA5A 4ML9A 1FCBA 2JK2A 1RZMA 1EP3A 3L5MA 3PY2A 1THFD 3L9CA 3LX9A 2HS8A 3LCLA 5AC6A 4C1LA 2J24A 2ZRXA 1SZEA 1J4EA 3E0IA 3W7JA 2DZVA 3VE7A 3G1HA 1C29A 2WO5A 4MUZA 3P62A 4O14A 4GUIA 4LC8A 3TXZA 4O19A 1G4PA 3CT7A 3PF3A 4JTKA 3W71A 2B0MA 3S5ZA 4OT7A 2Y6ZA 3IRDA 4M5PA 1RQEA 3P84A 4ADUA 1ZAIA 1KW1A 2W0UA 2VXNA 1HO4A 5DN1A 4POCA 1W3TA 3NEVA 1PIIA 2XN0A 2QKFA 2AQWA 3DFOA 4ZVJA 5AHIA 3TE9A 4JXCA 1K7FA 1JUEA 3M0ZA 2J88A 3TFCA 3F1QA 2B7NA 1K8XA 5AC7A 1O4UA 4LU0A 3I65A 3IEBA 1KLYA 4RJEA 3C61A 3U8GA 5D30A 1W54A 4N9BA 1EB3A 1DBTA 1WYIA 1KTBA 4NU7A 1ALDA 1U83A 3MYPA 4NNAA 1GWJA 1G4EA 5HULA 4CNOA 5CPMA 3SJ3A 1LRQA 5H2ZA 3TV8A 4O13A 3DFTA 3P74A 3EX6A 3HIJA 1NFBA 3VI2A 2ZBTA 1AW2A 4LVBA 2VFGA 4U28A 5C5YA 5HWJA 3N34A 3W6YA 1JQXA 3BPWA 1OG0A 3GR8A 1W37A 4MY1A 2Y70A 5K4XA 5LGXA 3T4CA 4JY8A 3L65A 4BR1A 3EKLA 1FWRA 4S2BA 3VKJA 2Y88A 4ZQCA 1DORA 5D03A 4DEFA 3ATYA 2RKXA 4JICA 1KFCA 4EF8A 3I7QA 4K7YA 4BI5A 4DO6A 1EP2A 4B5NA 1Z41A 4YXGA 3NR0A 1H1YA 4LVFA 4FX8A 4NUWA 2ZZ5A 1PCKA 1FCVA 1TPDA 4OGZA 3PB0A 3MBDA 4R7JA 3LHTA 3UZ5A 5EYWA 3W07A 5A5WA 1EUAA 3EX2A 1BEUA 1SZNA 4FNRA 4WZHA 4OV9A 2B7PA 1KM1A 3P60A 5DBTA 4JDYA 2VENA 4IJBA 2QCEA 3SI9A 5FESA 2XN2A 3DENA 4EF9A 1KTNA 4UFKA 4UTJA 3HGJA 1XBVA 5EL1A 5G2HA 3NPWA 1IXQA 5AYYA 1KFLA 2ABAA 3KAOA 1YPFA 3B03A 4TR9A 3UY8A 1OK6A 4RZ6A 4HNTA 2ZZ3A 3L67A 1HO1A 3JR2A 2QJHA 2W79A 1SZGA 3OVRA 3NL5A 3T7VA 1D9EA 3UWQA 1WBJA 3LRKA 4DBDA 3E49A 4GRSA 3M7WA 5CKSA 1TRDA 1VQTA 4IOTA 3C2FA 1JCJA 3NQAA 4FO4A 4U4MA 2GQ8A 3PUDA 3NQ6A 1LP6A 1H60A 4QJ1A 3G1SA 3G8EA 4AHPA 3W7OA 3F03K 1X8FA 3N2XA 1FDZA 3BVJA 4JTFA 3GZ3A 3UWYA 3K30A 5D2VA 3LLDA 3W74A 1ICSA 3LERA 4LVDA 1T0OA 2I14A 1KFEA 5T26A 1AK5A 1YDNA 2WJZA 1TPVA 7TIMA 4LS1A 8TIMA 3NXFA 4N6EA 3KFTA 2EGZA 4OQVA 4OWGA 3SFKA 3PBYA 1TV7A 1W56A 1ZAHA 4HPJA 1LOSA 1SR9A 3WK2A 1K8ZA 1FWWA 3R8RA 1L6SA 5E1QA 3W2NA 2VOMA 2FJKA 2XN1A 1ZNNA 4H3DA 2QUTA 4UR8A 3S9YA 5HNRA 2ZZ2A 3SY5A 5I3KA 4AH7A 1JQVA 3SIZA 4O1DA 2KZHA 3PBVA 3W86A 1HL2A 3O63A 1QPRA 4UTIA 1KA9F 5D2YA 1K3UA 2PE4A 3TQKA 3TAOA 2NX9A 2BSLA 4G1KA 4UUIA 1FXPA 4A2SA 1ZJIA 4DO4A 2Q3OA 1B3OA 3G1FA 5MHBA 2IQTA 3D0CA 4LV4A 1XUUA 1VR6A 3HG3A 1VGAA 1ZALA 4A21A 5AOUA 4IMFA 1YXYA 4D2JA 3DKJA 3QFEA 2HS6A 1I2OA 4NQ1A 5D05A 3A24A 1UJPA 1XC4A 3W72A 3QM3A 3W1NA 5G2WA 1HFBA 2GVGA 2NXHA 5L6UA 4JR5A 3NOEA 2V82A 1S5TA 3LHWA 3TJLA 2QJGA 5E93A 2BWGA 3LRMA 3SECA 4BF9A 2WPBA 3TK7A 4UFIA 2OZ0A 3O1NA 3ZR4A 1KM0A 3NM3A 4E2BA 2VEIA 1UASA 2WNZA 3BK0A 1PV8A 3R13A 1ZY9A 2GJNA 4CQAA 3DZ1A 3LCHA 3THQA 4ZQOA 5I3JA 1XI3A 4A2RA 4QAIA 2VKZG 3PBUA 1LOQA 1X1OA 5LNRA 1OABA 1KLZA 1SUXA 1KV5A 2CW6A 1PL9A 3OG3A 5L9FA 3TMLA 4LS0A 4K7VA 3BG9A 3NNTA 1W5PA 1ZENA 4L4LA 1OHLA 1ADOA 2ZZ6A 2QUVA 5FEWA 1JVNA 1DL3A 4O4VA 4GE8A 1PHWA 3QEZA 1Q45A 1GVQA 2A1YA 3CM4A 3EXTA 1L6WA 2VFDA 3W2UA 5FF7A 1KM6A 4DPQA 1KM5A 4O15A 3YPIA 1OYCA 3NL3A 2VFIA 5G1TA 5BMXA 3CTLA 4IMGA 1Z44A 1H51A 2ZZ4A 3W2KA 3UWZA 4NVTA 3NGJA 1FDJA 3NQDA 5FF4A 3GIYA 2ZRWA 3GVGA 3TQVA 5CPNA 5HQEA 4O53A 3P67A 2A2IA 4JX5A 3IGXA 3P7YA 1AL8A 1TJRA 4I7WA 5FI8A 5CG7A 1ML1A 4UTKA 1DJNA 4GWEA 2ATMA 2YGYA 2QAPA 1OYAA 1F7BA 1J2WA 4TMBA 1I8JA 3C2EA 1ICPA 2E6AA 3TCEA 3B05A 1NAL1 4JYEA 5F4XA 2H3BA 5LNUA 3NPXA 1LBMA 4UXDA 5HUPA 1A5SA 5DY3A 2PRMA 3W7HA 3NDOA 1JCNA 3V1PA 1Q6OA 2BX7A 1B9BA 3NPUA 3C8FA 3BG5A 2QCDA 3W7DA 2A21A 3W75A 4ADTA 4I7VA 4EWND 3W7KA 3PS7A 3LI1A 1W5MA 3FKRA 3ABSA 1BTMA 2NZLA 3JRKA 3QMRA 3DFPA 3GDRA 3I68A 4IMEA 1GOXA 1W31A 4TIMA 3N2MA 2VEPA 5HINA 4AF0A 1WBHA 3G1YA 4ZZ9A 3DXIA 3GX9A 3UPWA 1W8SA 1RR2A 3L21A 5C6MA 1TTJA 1QCWA 5D04C 3TDFA 1SW3A 4CNNA 2DZPA 2JKPA 3STGA 4TMCA 3OVQA 1S5WA 3QW4B 4ZMGA 4FXSA 1FXQA 3LCGA 4IX2A 4CCCA 1FDYA 2GJLA 3BLIA 2QDHA 4HT3A 5LSMA 1F05A 3EB2A 3G1DA 1JR1A 4ICNA 1P0KA 5CSRA 2A6LA 3W1RA 3FYOA 3TW7A 1JRBA 1FWNA 1JCMP 5AYZA 4N4QA 3WJYA 5TBOA 2NX1A 3TSDA 3M44A 4O10A 2NWRA 5H91A 2CZEA 3UD6A 1QPOA 3CIWA 2G95A 4MVAA 5AB3A 3C3NA 4O54A 2FQIA 1VZWA 2YSWA 3P8JA 1SW7A 1VPXA 3NQFA 3SW6A 1KM3A 2QCFA 4BI6A 1H1ZA 1WA3A 2QCCA 1CI1A 1A53A 4IWWA 1MEHA 4O1CA 4Q4KA 4KFOA 3UWVA 1BWKA 1MZHA 3W83A 4XQ6A 3P8IA 2P10A 2JGQA 5CSSA 3QSRA 6ALDA 5LZLA 1L6YA 3PG9A 1OX4A 1KFKA 4OE7A 4MZ8A 3PBWA 4MJMA 4QSHA 2DZWA 4Y90A 4CQ8A 4AWSA 4FEZA 1H5YA 2E5BA 4N4PA 1RV8A 2JKEA 3TSBA 3TW6A 3GDKA 4UFLA 5LNSA 4JTJA 1JCXA 1VHNA 2AAMA 4HHPA 3BG3A 4R53A 3L5LA 4X3ZA 4O0KA 2BXVA 3IVTA 4JDBA 1QOPA 3Q37A 4AAJA 2ISSA 3DU0A 3LHYA 3W1MA 5KZDA 2H90A 2OCZA 3CEUA 4NJJA 4K38A 4MY9A 5U7SA 1NF7A 2Q3RA 2C18A 4JGDA 4UTWA 1TV8A 1DKWA 2C6QA 2OT0A 1F73A 2Y7EA 4O1AA 1H7RA 3VNDA 3WJSA 3PB2A 4CCDA 1IIHA 3INPA 2C3ZA 2CLFA 3W85A 3C52A 1W0MA 2D73A 1TREA 3N19B 4QIUA 5CGQA 3M5ZA 2RH9A 2EKCA 3ELFA 3VCRA 3DFNA 2FPVA 4WY0A 4FIQA 4LRTA 4Z0SA 1LCOA 1SFJA 2R8WA 3DHDA 5AHEA 1BKSA 1FY6A 1L9WA 1FWSA 2PRHA 2QEZA 5LKYA 3HB9A 4LT9A 2WQPA 1YLVA 2P1FA 4NJHA 4JTSA 3GLCA 4LW7A 4ORIA 5D09A 3HJZA 3TC7A 4UMAA 5GVJA 2Z6JA 4HSOA 3W1PA 3GAKA 3C2OA 4XKYA 3W76A 2OJPA 3LHUA 3W1QA 1H7OA 4MJZA 5KSWA 4PFMA 3TR2A 2C13A 3IIOA 3M43A 3NQEA 5FF0A 2QR6A 2VC6A 1LBLA 3MUXA 1OFQA 1SFLA 3CB8A 2ZA2A 1XL9A 2Y62A 2DU2A 2WNNA 1VLIA 3HPXA 5I3IA 3I7SA 1QOQA 1M5WA 3IV3A 4DO5A 3CWNA 1OFBA 5FF3A 3E9AA 1N7KA 3CIXA 1W5QA 4UTUA 4UTWC 3B0PA 4N2YA 2V30A 1LDCA 4RK8A 4JNMA 2CWNA 3P5ZA 4UNLA 4JX4A 3EWZA 1PHQA 3EXRA 1QPQA 2F84A 3S0CA 4K36A 3LM7A 4YCOA 3P5YA 4LTSA 3N73A 4QQ3A 2V8ZA 1KTCA 3F4NA 4P61A 1I2RA 3UWWA 1XM3A 3T44A 2Z2UA 3TIMA 1YTDA 4MOZA 4NZFA 5HWNA 1L2UA 3NA8A 4UIOA 3P80A 1WOBA 4KWVA 3MWAA 1XBYA 5DCEA 3B4UA 4EIVA 4ORMA 3W7CA 1VHCA 3JS3A 4ZQMA 3RFAA 1JUBA 2RDWA 4FF7A 1Y0EA 3GXNA 3USBA 1R2TA 1G7UA 1G6CA 3N9SA 2B7QA 3UPBA 1O60A 1AW1A 1TTPA 2OX1A 3LTSA 3WK3A 3TMQA 4JN6A 3OHIA 2PCQA 5E0KA 3M47A 3NVTA 1H63A 1KFBA 4NT0A 3WJZA 3UYCA 3LBCA 4BK9A 2VEMA 4CCEA 2E1DA 5D33A 1EWDA 3TNOA 5BOOA 5KITA 2ZQ0A 3TFXA 3I7RA 5C55A 3G0UA 4Q33A 2E77A 4IUOA 5FEXA 3MP3A 4NZJA 2NV1A 4UFHA 1UCWA 4KKXA 4LUJA 3HGOA 3MBFA 4M7SA 3NAVA 4JIQA 5F2LA 3DBPA 2FPYA 3KVLA 4Z1BA 1U5JA 5D37A 2NXIA 1XDLA 2VEKA 4PA8A 4XTDA 1B4KA 3HGSA 4X9SA 4BWLA 4IGHA 4FX6M 1GG0A 3KXQA 1H61A 2Q8ZA 1HG3A 3BLFA 1NVMA 3W2LA 1TCDA 3A23A 5I3GA 3MO7A 3QZEA 3PUOA 3STCA 3FJ6A 4AXKA 1QNVA 1TTIA 2VFEA 2CU0A 3DFQA 1T8XA 1IF2A 3EWUA 4HSNA 4CNPA 2HSAA 1EEPA 3HOJA 3HPSA 4Z1DA 4JTTA 3BV4A 2YYUA 2FDSA 1WDWA 1X7FA 4Y6GA 3IGUA 3L0GA 3KVKA 1VLWA 2F7FA 4UNKA 1OVDA 1AMKA 4K8EA 3H53A 3LV5A 2BZNA 3TX9A 4GC4A 1H7XA 1TJPA 2ZRYA 1QO2A 3QW3A 4XBKA 5HR7A 3TH6A 1EA0A 2AGKA 4I7UA 3RLVA 1N8FA 1SW0A 3STFA 3ZWTA 1AW5A 2YZRA 4E0CA 1MEWA 3GR7A 4MZ1A 3W88A 5TQLA 4GFSA 3PC0A 4BI7A 1GEQA 1WQ5A 3SGUA 3CQ0A 5G4WA 3GAYA 1QMLA 1NSJA 1O5KA 4Z1AA 4OV4A 3EWXA 2NUWA 1QWGA 3W7NA 4JS3A 1LROA 2VFHA 1M6JA 3QRHA 4Y8FA 1Q3NA 1ICQA 3QMSA 4JTEA 4X22A 3PULA 5EMUA 3PSVA 2YFOA 1FWTA 4DF0A 3EEGA 3W1TA 4BWLC 4DXVA 3P82A 2I9EA 4Y9AA 3M5XA 2E6YA 2EPHA 1S3HA 5D02A 3GB6A 2CLEA 4XBSA 3S1VA 4PODA 3NZRA 2Y61A 1TTQA 3NQVA 5K7JA 4O17A 3AJXA 3W7RA 3DH7A 3DI1A 4AMAA 4IX0A 1P5BA 4WJEA 2OT1A 1QPNA 3W3OA 4GUJA 4ZQNA 2TMDA 3WJWA 1AL7A 3UY7A 3SGZA 1H50A 4UTMA 2YW3A 2C1HA 4JX6A 4QISA 1OX5A 2ZRVA 1QDSA 5TIMA 1ZFJA 4YMZA 4JY9A 3TAKA 4FNSA 3CWOX 4DELA 1I4NA 5IM51 1QR7A 2CZDA 1UB3A 2J6XA 3HMJG 3AO0A 3TJXA 5I3HA 3C4UA 5FF2A 3S1XA 3LGEA 3FJLA 5HR6A 5C54A 1B4EA 4NXKA 1YTEA 1JULA 3C0JA 3U6WA 4NX0A 5AHMA 3DGRA 4PC8A 3G1AA 4O4WA 5EPDA 1XFBA 1XDMA 1QAPA 1MO0A 2YR1A 3GDLA 5EY5A 3GNNA 2FLIA 1YDOA 4DF2A 4S1FA 1A5BA 3VFLA 1SSGA 4L4MA 4NJKA 3EXSA 1OF6A 3FKKA 1OK4A 4YL2A 3N14A 3THAA 4H6KA 3PAJA 4LS2A 1RPXA 3W1UA 3L0KA 4TO8A 1Q6RA 3G24A 3WK1A 1XCFA 4JEQA 3WJXA 1G7VA 5K9XA 1TPFA 3H55A 3B04A 5BMWA 2FTPA 1LRNA 2XFWA 3ABOA 3S5NA 4CQ9A 2QUUA 5AHLA 1HUVA 5KINA 3HQ1A 2J27A 5D2TA 3ZS4A 4AWTA 3S5OA 4IXXA 1GYNA 4NXSA 1TPB1 1SO3A 1VRDA 1H7PA 3PUEA 2ZRUA 2GOUA 2GVLA 1K02A 1SZFA 3UQNA 1FX6A 3DKLA 4A3UA 3KRZA 3FS2A 3UZJA 2JGYA 1F6PA 1H7NA 3C56A 5D38A 1FCUA 1CX9A 1V7YA 2E09A 3M41A 2ZZ7A 2PURA 3S1WA 1P1XA 4HPXA 1V5XA 4GJ1A 1XKYA 2ZRZA 3FLUA 3KRUA 3MW7A 4M6VA 3KVJA 5FEPA 3O8AA 2ZFAA 2B7OA 2LLEA 1F2JA 3O6CA 3NO5A 2V9DA 3NPVA 2X1SA 5CZJA 4JD4A 3RK8A 3V75A 1D3GA 2GPTA 1TB3A 1C8VA 3W73A 1R47A 4O0ZA 1YDVA 3QPYA 5DELA 3L0NA 3N3MA 4N9EA 3SR7A 1RQHA 4LV9A 2QJIA 3IGSA 1K7XA 1LM1A 4RV8A 3HO8A 3E12A 3W1AA 1VH7A 2CLIA 2WSYA 3L5AA 3O6YX 3L2IA 1UUOA 4QNWA 2V2DA 2FFCA 5KZMA 3Q94A 3T40A 2FPTA 3PSWA 3GK0A 3W7QA 4DBEA 2YFNA 2RDUA 2DZSA 2ALDA 1F74A 3CLMA 3KRSA 4O16A 3G0XA 1OYBA 2J9ZA 1TPUA 5BW6A 4RXFA 5BRBA 4I9AA 3HGRA 1TMHA 3M16A 1YXCA 4RLIA 4RXGA 4QM1A 4Z0JA 2A85A 3W7PA 3T55A 3LCFA 2V2HA 1G67A 1W3NA 2TPSA 1NEYA 3W9ZA 1VS1A 5G5IA 2QCGA 3DI0A 1TPH1 4ONVA 3U2OA 1OFOA 3EX4A 1R2SA 4WUIA 5D2WA 3PVFA 3LBMA 2GQAA 5AHFA 1EIXA
chains in the Genus database with same CATH superfamily
1BKHA 3VU2A 4LC6A 4GKTA 4QNEA 4JIRA 2P5NA 2E5CA 1SGJA 1WDQA 3RAOA 3MI2A 2CLMA 2CHNA 5HWMA 2WMKA 1NWSA 1VEOA 1PX8A 3NQMA 2A7RA 2DW6A 2RHGA 5A95A 3NG3A 2NUXA 1XLDA 4XZWA 5DBUA 4EPEC 2RDTA 3H26A 3O6AA 4QE4A 3QSTA 1ITUA 4QFUA 3R11A 3QY6A 1J5TA 3DERA 3W7LA 1VJSA 4QAWA 5C9ZA 3R25A 4PEKA 5I23A 3WBWA 3GTFA 1JXKA 2OEJA 4S3KA 2FB2A 1I45A 3CPRA 4NAEB 4FXFA 4YU1A 3BJTA 3MSGA 3AYSA 2O0TA 3OGVA 2EF9A 3A22A 1IXOA 3UXAA 3V5CA 3N18A 2CC0A 1XIFA 4CN1A 1EO5A 2X1IA 3TA6A 4DZAA 5I5RA 1PDZA 1R2RA 4KWUA 4TQTA 3GNRA 3PBMA 4K1WA 3BAYA 1VFOA 3N9RA 4GX9A 3JW7A 2HTMA 1JAKA 4JTIA 5A2CA 2ZWYA 1HIZA 2WSQA 1A5CA 3I6TA 3QBUA 2F38A 4IGSA 4IJRA 3KBVA 2QCNA 3H7RA 1T7LA 1GTHA 5A3HA 1WX0A 4DB7A 4HCLA 3VOCA 5GQBA 3ZSTA 1VC4A 3TTEA 4RZ4A 3DHFA 1OFEA 5J5DA 3W7EA 3AALA 3OW1A 2Z1SA 2E1WA 2D0FA 2QIIA 3PZUA 1YADA 4JHZA 1AQ0A 4PTNA 1IR1A 1W3KA 3GZAA 3NL2A 5HJLA 3BLLA 3T07A 1MZRA 4UCFA 4HNUA 3EDEA 4FXRA 4GUGA 3DESA 2Z1XA 4Q8QA 3EWWA 1KQZA 3WQ4A 2WHLA 1M7PA 1X1ZA 4D6EA 4JTUA 3ZLFA 1PX3A 1FHUA 3GG7A 3AZRA 2MUCA 1IXNA 1TJ0A 4HMCA 4M6QA 4U5IA 3LDVA 3ZT7A 3OZYA 4FOKA 3ZVHB 3DHPA 4HGXA 3QHOA 3IIVA 1QO5A 3FXYA 2DUZA 3MMWA 4ERAA 4H9VA 3ZT6A 4D6HA 1UUMA 1F3WA 4F0LA 3KOFA 4DBSA 4DXKA 1BXNA 3OBKA 1SZRA 3W2MA 4AIOA 1NU5A 4TTGA 1C9WA 4Y9OA 1M3UA 4HTBA 2WCGA 2J66A 1AD1A 2EQDA 1NTHA 1R3QA 3GS6A 1EF3A 2RGLA 1S3TC 4BQ4A 3FYPA 4NZ3A 4E8DA 1P1MA 4FB7A 2E8ZA 3HF3A 2RAGA 3PFRA 1NH6A 4FHAA 3ABRA 4TTUA 1CXLA 1PJ9A 3VDAA 3CAKA 1P0DA 3TQ0A 1DV7A 1PKYA 3PBGA 1E4NA 2HEJA 1LBFA 3CK5A 2FFIA 1DVJA 3OQ8A 3QQ1A 1ONRA 4UZUA 5LNWA 1VCGA 3PM6A 4H00A 2CLLA 2NLIA 1I2PA 2V5LA 5K9CA 3CEPA 3KBNA 1WV2A 3TYCA 1TWWA 2BXYA 3CMJA 2WM0A 5B80A 7XIMA 4ZOBA 1PB0A 1OGBA 3ANYA 2E68A 5J5RA 1XCWA 1RALA 5I00A 4JYFA 1SSDA 4Q8NA 1NDYA 1TV5A 2IQ0A 1KM4A 2HE5A 2EAWA 4Q8UA 4R33A 4MIMA 3WD1A 1TQXA 2HWGA 3QC3A 1EGVA 3IVUA 3ARZA 2XIIA 2V0TA 5JH1A 2FDMA 3AXHA 2PB1A 1UBPC 3LQLA 1I2NA 2ZDSA 2GVYA 4UTLA 4EOUA 2PODA 4Q22A 1OG6A 3LTYA 4LRSA 1OGGA 2Z6IA 2DGAA 4JFSA 3TLQA 3T2QA 4N9DA 4ADSA 2IUZA 3OIXA 3S5YA 5G1MA 6REQA 3AYRA 3ZLHA 1VBGA 3IK2A 3OODA 4LOCA 1CEOA 2YX0A 4GGHA 3ONBA 2Z0IA 1CW2A 1H3GA 3KLLA 2FZ9A 4ASTA 2A3BA 5BROA 1GHRA 3A5VA 4GIAA 3Q58A 1EH9A 4HU4A 4JQ2A 4NJIA 4QEEA 5IHRA 1TPEA 1R85A 1B3ZA 3UXIA 3BL3A 2DZXA 4GNJA 4AU0A 4GBUA 4LPCA 1QK2A 3URQA 4K37A 5JVLA 2VQTA 3PN8A 4DWDA 1EPXA 4H8HA 1VCVA 2O7SA 3K8LA 3AOFA 5ABEA 3VNLA 1RVGA 1T8QA 4JL1A 2CHOA 3EX1A 2YBVA 3C2YA 2R14A 1V4YA 2X2GA 3GNXA 4JPGA 2UY5A 4LF1A 1LQAA 1GTEA 3IJIA 3VD5A 4LAKA 4LBUA 3UR7A 4IQEA 2VZOA 1VYSX 1QVBA 2A3EA 4EPBC 2QJMA 3IIZA 2P0IA 1KXQA 3L4VA 1FH9A 3OTRA 1GQLA 1TQJA 2ZUUA 2YIHA 4B16A 4MYAA 4LNYA 3VC5A 1IGSA 1VF8A 4PCNA 4E6MA 3CHVA 1XDJA 5AVHA 1JI2A 4JCMA 1P43A 1UKTA 1X7IA 4KW2A 4AB4A 3G8RA 2J4GA 4Z2KA 2DY3A 1JZ5A 3WNMA 6A3HA 1VPQA 3GXPA 4FALA 3L4ZA 1W1ZA 3LZ3A 1B57A 2YXXA 1GQNA 3WBYA 4QITA 3H2FA 3UGRA 1VYRA 1N8IA 1M01A 5CZTA 2H8ZA 4I3GA 1W2PA 3G1RA 3SAZA 4QCFA 2RFGA 3ZSSA 3IUDA 5GNZA 1TG7A 3B0UX 2ZA3A 3QN3A 4FNUA 4HNNA 5F2MA 1V3IA 3OBEA 4JN8A 5CBIA 5DMLA 4B5VA 1JGIA 1XJBA 4H8UA 1V0KA 1Z7AA 1E6PA 4A3RA 3QR0A 4WOZA 2VZTA 4ERIA 4W4QA 1CNVA 1E4LA 1KRMA 1S5VA 2WKJA 4PZVA 4X63A 3NQ7A 4MFDA 4DM1A 1HP4A 2X09A 2GSEA 3OLIA 3W28A 1G69A 3POHA 1R46A 1RCXB 2H9AB 4JQAA 4MAVA 3GO2A 4O57A 4X2RA 2J9YA 3A5FA 4C6FA 3ZFHA 4E38A 3B9OA 2VDHA 1GJUA 1UBSA 1UR4A 4Y96A 1PX4A 4DQWA 1UKOA 3W24A 1W5OA 3H2CA 1E6ZA 1LLZA 5BNKA 2GK1B 2FGZA 1A5NC 1ZJHA 2CZFA 4L1GA 2Y0FA 4REQA 2I9UA 4FIRA 4O18A 4AZ7A 5C2GA 4FNTA 4GISA 2WLYA 5KZ6A 2BVDA 1KCZA 3CT2A 3TU9A 3DDMA 5CJNA 3NYZA 3QOKA 3PANA 2TRSA 1PO9A 2ACUA 4XAYA 5I24A 3E6EA 3BTNA 5FKYA 5DF0A 5DY2A 2J7DA 2NV2A 3H2AA 4JTCA 1KRCC 3W7GA 3STEA 4EVZA 1V6WA 3P81A 1MSSA 3HURA 4F0KA 2ZCGA 1OX6A 3FA5A 1OWQA 1ZBWA 4S23A 1RZMA 1YRRA 1ZUAX 3L9CA 3JZUA 2J24A 3TOPA 2PTZA 5JH2A 1EPVA 1JZ2A 3M0LA 3VE7A 3G1HA 1C29A 4IL2A 2V69A 3P62A 4LAMA 3TXZA 3T42A 1LL6A 4O19A 3RCNA 1TUFA 3KL0A 3PF3A 1EZWA 1TJ2A 3W71A 3M0MA 4OT7A 1F8MA 1KGUA 1MXDA 1RQEA 1ZAIA 4HK6A 1KW1A 1HT6A 4C7FA 3CUXA 5DN1A 1W3TA 3AIQA 4LB4A 1JF5A 3OLGA 2YJQA 3V5FA 3WF3A 2E40A 2EPKX 5AZ0A 3GTXA 4GJIA 7TAAA 1XH1A 3WQWA 4LUTA 1O4UA 3SRKA 2DSWA 1VENA 4PRRA 5CAHA 3I65A 1KLYA 4RJEA 2PFHA 3PTDA 2VOTA 3RITA 3U8GA 4KMQA 5D30A 3K5XA 4K1GA 1DBTA 1KTBA 3ITXA 3BCJA 1ALDA 5C9WA 3N4AA 4NNAA 2PP1A 4IM4A 2PZ0A 1G4EA 2KAUC 3ZLGA 1XSKA 3SJ3A 1LRQA 3D6NA 3TV8A 2XGBA 4XO6A 1ODZA 4XAPA 1XYCA 3P74A 1NOWA 4GOAA 3N6JA 4F0SA 4HSHA 4LVBA 4KCVA 5EFFA 3ZYZA 5HWJA 4HU8A 3IV8A 1OG0A 1ZRQA 3BAIA 4MY1A 5K4XA 4KIRA 4GY1A 4PCSA 3VKJA 4HA1A 4GXPA 2HQAA 3POCA 4ZQCA 3ATYA 1KXHA 2J7EA 2RKXA 1UD5A 3KM8A 4K7YA 4P8UA 4AC1X 1RXOB 3F4VA 2CETA 3BMWA 2XTKA 2ZXQA 1ZPTA 3KWXA 1PCKA 4A4AA 4UQEA 3IRSA 2YLLA 1V3KA 3VYLA 1WDPA 3W07A 3L4WA 5A5WA 5CC7A 5CLTA 3P60A 1GPFA 5DBTA 4AZCA 2VENA 3TTQA 1R3VA 4AX6A 1BVNP 5FESA 5ENLA 3WLQA 1SFTA 4EF9A 1QNSA 4UB9A 4LGXA 1H0GA 1JPKA 4HA4A 3MUAA 4C5YA 4AY7A 3MSYA 1CWYA 4KPLA 5A6SA 4Z2JA 2QJHA 2XFYA 4DRSA 1D9EA 3UWQA 4D8LA 1C92A 2V5CA 3GUWA 4MJ4A 3M7WA 1TRDA 4IOTA 3C2FA 3VKCA 2Z7GA 2VGFA 2GQ8A 3NQ6A 6CGTA 4ACZB 3N2BA 4AHPA 1KBBA 3W7OA 3GVVA 1RHCA 5D2VA 2FMOA 2DVTA 3UGVA 2Q02A 3APYA 4EXBA 5T26A 2QPSA 4JNZA 1AK5A 1I1XA 1Q6FA 2WJZA 1TPVA 7TIMA 3NXFA 4N6EA 2EGZA 1F3EA 3HPFA 1VEMA 3PBYA 2QDDA 2OOGA 4FI4A 1TV7A 3BQ6A 4QCEA 1SR9A 4W5ZA 1HX0A 4M1BA 3R8RA 3B9DA 3LPGA 1B3YA 2FJKA 2FZNA 4KWOA 3ITOA 3SRFA 4UR8A 4B15A 3SY5A 4AH7A 1XCXA 3UW6A 2OO0A 1QPRA 4U2YA 3OYZA 1K3UA 3GC4A 4EP8C 3T0TA 4LFYA 3TAOA 3CPUA 4H1ZA 2FZBA 4OVXA 3UJ2A 4PUUA 3G1FA 1ITQA 5JMUA 3D0CA 1F3XA 4C6QA 1VR6A 3VINA 1ZALA 1OY0A 3E2QA 2TAAA 3LSBA 4IMFA 1YXYA 1XYBA 1XD0A 1I2OA 4NQ1A 3A24A 4V33A 3W72A 3W1NA 5G2WA 2E7FA 1HFBA 3K46A 4H7CA 4JR5A 2V82A 2D20A 4YIWA 5FAGA 5BRQA 3B4YA 1EFZA 4E3TA 2WPBA 4ZXOA 3MTWA 1H2JA 2OZ0A 1KCXA 2W91A 1KKRA 3FK4A 1LUCB 3GHRA 1GGOA 3LCHA 1V77A 4MNJA 3CZGA 2BBFA 1LL7A 1BGAA 1ITXA 2PWEA 1OT1A 3HQPA 3F4DA 4IG2A 1ONEA 3S2CA 2V67A 3H8AA 1CLXA 1KV5A 1PL9A 4WR3A 1JCTA 1DPMA 5HMDA 1FVPA 1ZJAA 4K7VA 8A3HA 2EEXA 4QROA 1W5PA 1OHLA 1R8LA 5BXSA 1QRQA 3GSMA 4MUPA 4GE8A 1PHWA 3BSMA 2OLSA 4F3HA 3CM4A 2ZVIA 5FF7A 1W1B1 4DPQA 3LD5A 1KM5A 2WB5A 3YPIA 4LYKA 1VFSA 1H51A 2O9RA 2B81A 1HW6A 1YQ2A 4NVTA 1VEPA 5FF4A 3GIYA 1RH9A 2ZRWA 3GVGA 3HMCA 3P67A 4JX5A 3P7YA 1AL8A 4GWEA 2OYMA 4M6UA 3L2MA 1RBLA 3KBSA 3MZ2A 1F7BA 2GWNA 2XFRA 1I8JA 3C2EA 4DHGA 1ICPA 2XUCA 4DYEA 3TCEA 3B05A 4UQAA 4JYEA 2H3BA 3N29A 5HXMA 3NPXA 5GNXA 3I3EA 5T9BG 1YBQA 4P8XA 1E0XA 4PEEA 4PMYA 1BAGA 4TUFA 1A5SA 2PRMA 3NDOA 3V1PA 1Q6OA 1A5KC 1US2A 3C8FA 4Y8EA 4J40A 3W7DA 3W75A 4ATDA 4E3VA 4I7VA 1EKOA 3VIHA 3PS7A 3W7KA 3FKRA 2NZLA 3QMRA 4L9YA 4CU6A 2PCEA 3U5YA 4IMEA 3EOEA 4OOZA 3TZNA 5EMJA 4AF0A 1A0EA 1PTDA 1RPKA 4AMCA 1OB0A 3L21A 3WENA 5C6MA 4AQLA 3AMKA 1SW3A 1U1JA 1POJA 2PLMA 5A8PA 2VZVA 4GG9A 1CBGA 4J3ZA 1MYRA 1YHTA 3BLIA 5LSMA 4GVIA 3FGCB 4CNSA 4X9YA 4QE1A 1XLJA 3W53A 3L4YA 3RPTA 1JCMP 2CBJA 5EU9A 2JF7A 4N4QA 4LSBA 1RA0A 1JL8A 2NX1A 3TSDA 3ZT5A 1Y5WA 3OO2A 1D7FA 2ZE3A 3M44A 1KBKA 1QPOA 3QR1A 2G95A 1UP2A 1QI0A 4O54A 1EOKA 4W8BA 1JXJA 2FQIA 5EB8A 3E0LA 3MKKA 2ONEA 1KM3A 1UR2A 1FTXA 4BI6A 1WA3A 2AGTA 4MNLA 1A53A 1ZJBA 5LIKX 1EYWA 2P10A 4GQRA 3QSRA 3PG9A 1OX4A 4OE7A 1R3WA 3PBWA 4PBGA 4FEZA 3VPLA 4N4PA 4L56A 3AXKA 2VRJA 1KRAC 3S9ZA 1JZ3A 2AAMA 3SCSA 3BG3A 2VL4A 4HZ6A 2BXVA 3AYTA 3LPOA 4WKAA 3Q37A 2W63A 2ISSA 2BXZA 1VKFA 2PTDA 4GFIA 3CEUA 1ISWA 5U7SA 2C18A 1TV8A 2Z25A 4MB4A 3WDHA 4PUDA 2WKLA 4GQGA 3T81A 2OQYA 1OEPA 1IIHA 2GYIA 3CL6A 1M68A 3C52A 3RGTA 1MW0A 2E25A 2VDGA 1TREA 3LUTA 4YTQA 3ELFA 2V63A 3SCOA 2OB3A 3DHDA 4C7DA 1FWSA 5LKYA 2HNHA 2EXOA 1XIHA 3GLCA 3NIYA 3WLHA 4ORIA 2VWSA 5D09A 4B5WA 3UJEA 4LCQA 3HJZA 4F9DA 1UR9A 2OPJA 4AUBA 5GVJA 1EJTC 2HK0A 2Z6JA 4HSOA 1R3SA 4S3AA 1DXIA 2F9RA 1JFHA 3AISA 3GDBA 1BG9A 4BF5A 3IIOA 3NQEA 4WSJA 2NV9A 1TWZA 1LLOA 1EEXA 1IWPA 1IHIA 1P7TA 4ZFMA 1XD1A 2ZA2A 1Q4WA 2Y62A 1OC6A 2EG6A 5REQB 4HB7A 2NW0A 1EA9C 1M5WA 1NFPA 4RUBA 1OFBA 3S1GA 1V0MA 4UTUA 2V30A 1SJDA 5HNNA 3P5ZA 4JX4A 1DTUA 3S0CA 3HU7A 1MW2A 1UKPA 2PWFA 3T1GA 2V8ZA 1I2RA 3BDKA 2R1MA 3S2NA 4HMNA 2GL5A 1E1FA 3A4XA 3ITYA 2Z2UA 3TIMA 3EPOA 2G50A 4HPNA 3B3DA 3FDGA 3C5QA 3R0UA 4JNYA 1KD0A 1EJRC 4HMEA 3EZ4A 5BCAA 2CKSA 4UWMA 1GOQA 3V0SA 3MWAA 3DG3A 1VHCA 4WVXA 3GU1A 2HK1A 3WMBA 3RFAA 3FSUA 3MUZ1 4GIYA 5HATA 2PDCA 4KEZA 4EXQA 4MKVA 3CQIA 3N9SA 1O60A 3TMQA 4LUYA 5FL1A 3VD3A 5E0KA 1B5TA 3KOXA 1UR8A 3LBCA 3VGFA 3AMGA 4BK9A 3QGVA 4GD0A 1OT2A 1A5LC 1FHLA 5BOOA 4BQ5A 3GTHA 3UNTA 1OSEA 3H7UA 3CNYA 3JU2A 5LA0A 4IUOA 1UCWA 4C6LA 2A3AA 2VRKA 4IIFA 3SCUA 4ICMA 3SY8A 3KVLA 1XDLA 3N15A 3HGSA 3O0FA 4V1YA 3EPNA 4IGHA 3E2SA 3P0WA 3PK7A 3WYZA 4XZNX 2JF6A 2I7GA 3BLFA 1NVMA 3A4AA 2CEQA 2J13A 3R94A 3MO7A 5A8NA 3QZEA 3PUOA 3ITGA 4HYRA 3DFQA 1T8XA 5E70A 1F3TA 4HSNA 3R0DA 1HVQA 1EEPA 3FX4A 4MPKA 3H23A 3BV4A 1R7OA 2FDSA 1X7FA 4Y6GA 3L0GA 3ES8A 2F7FA 2PWDA 3WLKX 3QVQA 3R0KA 3KCJA 1RD6A 4K8EA 3R79A 4GC4A 1H7XA 2ZRYA 4PMZA 4KWSA 5I79A 3ZM8A 4NYUA 3WG6A 4OBRA 4HZ7A 2X0HA 1POKA 4JTRA 4M8UA 5CJMA 3BUVA 3WBAA 4GFSA 3B8WA 5A8MA 2VX4A 1B0IA 4E4FA 2GGJA 1UWQA 4LXFA 3CQ0A 4US5D 2VGIA 4JS3A 1LROA 4QP0A 3N25A 1T41A 2YB4A 5JBFA 4JEJA 4QX4A 3NWRA 3ABZA 5EMUA 1KKOA 3PULA 4H41A 1QNPA 3PSVA 4DF0A 1E1CA 3IJ9A 3WNOA 4ZO7A 2I9EA 3I3BA 3CTTA 1UOZA 1VP5A 4DVOA 1GW1A 2EPHA 3A9BA 1K9EA 3F2BA 2Y61A 1TTQA 2VO5A 1DE5A 4JFTA 5E0FA 2OLAA 4ROPA 4IX0A 5B7YA 2OZ3A 3RR4A 1QPNA 2Q01A 1GONA 3VIMA 2D0GA 2C1HA 4QISA 2BHUA 3EGJA 1OX5A 4I6VA 3WNLA 4HOXA 1UP0A 4JY9A 4K2SA 4DELA 2CPUA 1L2QA 1FA2A 1QR7A 3GG0A 3W0KA 5FF2A 1X8CA 1JG9A 1TVNA 3RHGA 3SDOA 3EEZA 1E9YB 3C0JA 3AHYA 3CUZA 3U6WA 2QHAA 4PC8A 3P3BA 3SY1A 4O4WA 1XLBA 1TKKA 1QAPA 2VTFA 2Z2AA 3CYVA 3PZMA 4W87A 3CH9A 3OU8A 4S1FA 4XD5A 3P0XA 2V5KA 1V79A 4L4MA 4NJKA 4YVXA 5AECA 3EXSA 3FKKA 1OK4A 2VWTA 2QDEA 3THAA 4EKJA 3PAJA 3L0KA 4TO8A 2XU2A 3WK1A 4WRHA 2OGJA 1DJXA 1G7VA 5DMNA 3H55A 2HXTA 2GFTA 2XFWA 1C91A 4IQDA 3R8HA 2QUUA 5AHLA 1MRAA 1HJQA 3A3HA 2WZMA 3ZS4A 3S5OA 5DX7A 1CB7B 1XX1A 3CH0A 3AHXA 1H7PA 3PUEA 3C8NA 4NRSA 4KETA 4GHRA 3UQNA 4PMVA 1U5VA 4UTFA 3NSNA 5D38A 1FCUA 1CX9A 2QPUA 3LSCA 1QBAA 1V7YA 5A6BD 3M41A 2ZZ7A 3S1WA 1P1XA 2RJGA 1TV4A 1U2YA 3FAWA 2J8FA 1SMAA 2PTYA 3FLUA 3KRUA 3ZO9A 2G4JA 5DO8A 2HCVA 4GI9A 2B7OA 1EX1A 1F2JA 3NTYA 2V9DA 3WBEA 4DYJA 5CZJA 1AH0A 1KO0A 1UQZA 2WHKA 4WDUA 3RK8A 1JFXA 3V75A 1UWTA 2ZUWA 1TA3B 1ECEA 3QHNA 2GPTA 3QYSA 1KFWA 3W73A 1R47A 2JIEA 1B3WA 2QQ6A 4ZB0A 3T08A 4JN7A 3GBEA 3ZR5A 4PBFA 2DVXA 1VAHA 2GZXA 4Q3MA 4IPNB 1E5JA 1VH7A 2WSYA 2CKRA 3T2OA 1UUOA 2PGWA 5KZMA 2FPTA 3GK0A 3N17A 2YFNA 3CS2A 1M65A 2ALDA 4M51A 1EHNA 1OYBA 4Z17A 3PTKA 4F8XA 1TWSA 4JKMA 3CHFA 3LN3A 1A49A 3FVDA 3M16A 1YXCA 2PBOA 2B31A 1GNXA 3W9ZA 1VS1A 3AQUA 4DUXA 4JIHA 3SQSA 1S1PA 1OFOA 2Y24A 1JZ6A 3WF4A 3VDBA 3LBMA 2GQAA 1KNWA 1EIXA 3L68A 1VB9A 4CQDA 1ZHAA 3W87A 5K9DA 3IUIA 1A5OC 1Q6EA 1YNQA 3ARXA 9XIAA 5G2IA 1AFSA 3OVPA 1BVWA 1V3HA 5LHFA 3BOXA 2Q8LA 4NNBA 4RCXA 2GJXB 4O1FA 3TC6A 1JYWA 3G3MA 1E43A 4I5UA 3VIIA 4MKNA 2C19A 4DYKA 4HHHA 1K1DA 1GKPA 2EPMX 1GVEA 3NQ2A 5DCBA 2EPLX 4U3CA 1XUZA 2A0NA 1DJHA 5DXXA 2JE8A 4QEHA 4IMCA 5ABGA 4Q4RA 5BWFA 4FAMA 1XPYA 2ZUTA 4GY0A 1EIBA 3BGJA 4WSKA 3WLIA 1ME8A 2V5BA 2VCBA 1YTKA 3I6RA 4LVAA 5CPLA 1DQUA 5I7GA 4MFEA 4WXYA 3M0HA 3URBA 1UHVA 1DJQA 4FMVA 4JIIX 1QXLA 1XLAA 4A3QA 1RY0A 1QK0A 1O68A 1HKKA 1CZ1A 2E0PA 3GDTA 3PTMA 4JYDA 3BCFA 1W3JA 3DG6A 4KFNA 1B30A 4L80A 3CL8A 2XH0A 1CECA 1FQ0A 2R1LA 4LQ1A 3L66A 1EBHA 2ZTKA 1NARA 4M80A 3LXCA 4RZ5A 4WD0A 1R0MA 4KF1A 4JFVA 1YEYA 2POZA 4XUYA 1C7SA 4MNKA 4ZQRA 2DIJA 4M81A 3TXVA 1Y7VA 4A35A 3OZPA 2CIPA 5CZSA 3IUHA 3M9YA 1WOAA 3VILA 5JBEA 1A0DA 2Q6ZA 1KM2A 4CQBA 2NQZA 3B8SA 3VGEA 4IPIA 2P0OA 2MANA 3GKFA 2E9MA 3BARA 1FRBA 4PUEA 3W84A 3LMYA 1WKEA 4PMXA 1S2AA 2XH4A 4AVFA 4NRRA 1DXFA 2C16A 1GJPA 2VELA 1M04A 4QLJA 4RDYA 1PIFA 4QBXA 5A8GA 3KBWA 2YCEA 4ZB5A 3XISA 2CXEA 3LOTA 3MJYA 4FR6A 3VE9A 5D32A 1HKMA 4UCGA 3WLSA 3M6DA 2VC9A 4K39A 2NQ5A 4PBEA 4ZODA 1C8YA 3DC8A 3BO9A 1EJUC 4N02A 2GGEA 5K4ZA 1E6SM 1WKFA 1ZP4A 4JIPA 3HPZA 1CGWA 4K8GA 1Q6QA 1A5AA 2Y7DA 4XISA 1HQTA 4HU0A 3RRXA 3BLOA 2QAFA 5A6KA 4YN5A 3U7VA 5IOBA 4YTSA 1LORA 1XYLA 3V16A 3AC0A 3H22A 3TW9A 3HG5A 1NQKA 3BGGA 5EA9A 1C9DA 2X1RA 4RW5A 3S2JA 4WX2A 5C70A 2Y89A 1GVRA 3GH5A 5BXRA 3PZ9A 3F5LA 5A6JA 2L5HA 3E02A 2ZXBA 2C15A 2WMIB 5K2ZA 3GXDA 2YDAA 1O5QA 1RVKA 2Y1HA 2OMAA 3LS9A 1O12A 2Y8UA 1G1YA 2CZ5A 5I07A 1O5RA 3LB0A 2IMRA 1VFMA 5EBAA 3KRBA 4ML4A 1NELA 3DGBA 3C2RA 3IJQA 5CG0A 3O05A 1P0EA 2CLKA 5F1UA 3BH4A 2FVLA 2BGQA 2WMFA 3C6CA 3ZJ8A 5HMSA 1GVIA 5LHEA 1XW8A 2WSRA 4PULA 2C14A 3EKZA 4G5DA 3ZOAA 4E4UA 1Y5XA 3KBJA 1LWJA 5FEZA 2Y7FA 1OM0A 3QHMA 1JDCA 1HGWA 3W7MA 2WVVA 1ITCA 1E6NA 2FTYA 4W8AA 3ES7A 4GJJA 1KBIA 3WH7A 2QCMA 1TMLA 1E51A 4OBSA 4I8YA 4H9ZA 5CEWA 2PLJA 2OEMA 3CU2A 1SO6A 3VOFA 1EJXC 3OA3A 3H54A 3BZJA 2WNWA 2X1TA 4Q4SA 3KOWA 1GZGA 3MDUA 1UKQA 4UR7A 3RNDA 4GCXA 3AIWA 1CPUA 1DOSA 1WUFA 2A3CA 4IFKB 1A50A 3W29A 4GUHA 3GW0A 4FPSA 3ARQA 1HF6A 3HG4A 3D3AA 4EPKA 2JIWA 4AZGA 1FCQA 2VVNA 4NI8A 4O1BA 1PVNA 3FDKA 1CTNA 1IZKA 4AEOA 4CVWA 1AH3A 4C6KA 2DORA 3O07A 1ZTVA 2H8XA 2GVJA 1GYLA 1I9CB 2KX9A 3UXDA 8XIAA 4BFAA 1UWUA 4UMBA 3TCSA 1ISYA 5AYBA 2P8CA 2GGIA 4HHLA 3DEQA 4KBXA 2EJAA 4F2TA 2A4AA 1HGYA 3FFSA 4FSAA 3GXMA 3A3WA 4WQ6A 3W00A 3UESA 1EDGA 3ISIX 1BGGA 4P2VA 2TODA 1NF0A 1NFGA 4JOMA 4P7OA 1GOMA 2ISWA 4AHQA 1T99A 1RY8A 3UG3A 1JUKA 1WKYA 5LIWX 4JHOA 3N2CA 1QW8A 3P2VA 1QATA 4A29A 3UZWA 1F76A 5CZ0A 2FZMA 2G96A 4HA3A 3LV6A 1E9IA 4XKYB 4H6RA 5DMMA 3LGGA 3SSZA 4UTTA 4Q7NA 3UA4A 3LCIA 5E9AA 2W9MA 4IIGA 3EA1A 3GHUA 2PDIA 3CAVA 4ZQPA 3IVSA 3C2VA 5HQLA 2BOEX 4BQ2A 2NQLA 4O50A 3OA5A 4LY8A 1E6QM 5KZEA 3O06A 1BWLA 1E6XM 3Q4DA 1T96A 1IXPA 2ZTJA 1JPMA 3OP2A 3UJFA 3SZ8A 1OGSA 1BXCA 3VOGA 1TIMA 4NAFB 2PGFA 2VX6A 4LF2A 1GG1A 4XO7A 5EBUA 1BSLA 3LHVA 3RLUA 3R58A 1Y8BA 4YWIA 4GH3A 4B91A 4RX0A 4DUVA 1XG3A 2A7NA 3QH2A 4DM2A 3PR2A 2QS8A 4XZ9A 1EOMA 4QG9A 3S1UA 4XD4A 1E71M 2DSUA 2NXGA 3MI6A 4HZ8A 4DBWA 4UTHA 2ANUA 4M6PA 2I57A 1KV8A 4J7RA 3WD2A 2R94A 3RX2A 1DJZA 1KQYA 1EJ7L 3UVAA 3UG8A 3M1ZA 1SO4A 4D71A 3R12A 5AN7A 4JHMA 3WDQA 1FKWA 1QT1A 3LY0A 3C0LA 1X39A 3KHJA 5RUBA 3W4RA 2O4QA 1VBHA 1KBJA 4GMEA 1QI3A 1DJGA 5GJMA 1DWIM 1OFDA 3O15A 4AHOA 2Z1KA 4W5UA 4UTTC 1GCYA 3EA3A 3UWUA 3E0FA 1E4MM 2H3DA 1QFEA 4GACA 4M3PA 4MY8A 2OQLA 1JDDA 2BY2A 1F6YA 3LYEA 3DFSA 3GTIA 1K7EA 3W6MA 2HJPA 4CVUA 4XIAA 1K6WA 4GIRA 3DC0A 1VJIA 3WH9A 5AC5A 3PHAA 1TSIA 3B06A 3PJWA 5XIAA 3QQWA 1N2VA 1UWIA 1UP3A 2XVLA 1EP3A 1EYEA 2F6KA 3LCLA 2HS8A 2ZRXA 3GU2A 1KCKA 3UWEA 5A8OA 1J4EA 3E0IA 1XYZA 4C1NA 3UETA 1K4GA 4O14A 5CQ1A 4GUIA 1UC5A 1W3LA 1G4PA 3VIKA 3CT7A 4JTKA 2B0MA 2BHZA 2BGNE 1V3MA 3WLJA 5C8BB 3C86A 3DCPA 5I09A 4ADUA 4TVCA 2VXNA 3KLKA 1HO4A 6TAAA 4POCA 3SGGA 3G6MA 1XISA 2OELA 3G77A 3NEVA 3PPGA 5IXEA 2DT3A 2AQWA 4J3SA 2QF8A 3NVDA 3ZQ9A 4ZVJA 5AHIA 2ALRA 4JXCA 1K7FA 3LA4A 3M0ZA 2J88A 3TFCA 2B7NA 5FJJA 1K8XA 2C0HA 4URIA 2X0SA 4LU0A 2PC8A 3O0KA 1I0BA 1OC7A 3C61A 2NVAA 5DANA 1JPDX 1U83A 4Z2IA 1GWJA 4CNOA 2XIBA 3CBWA 5H2ZA 4XAFA 1E5NA 3SRDA 2PZNA 1KCLA 3EX6A 3HIJA 1XKJA 2D3LA 3VIJA 4GVFA 3PNZA 3APGA 3ARYA 4YNGA 3GE7A 2GDQA 1VFHA 5CPSA 3VNJA 3WN6A 9CGTA 4B4HA 3W6YA 3VUPA 1XIDA 1ZCCA 2RDXA 1FH8A 1PXGA 2REQB 1R5YA 3EKLA 1FWRA 3DYOA 4ZOCA 3ANVA 4P7NA 1BG4A 2Z26A 5KETA 5D8WA 1V6UA 4EF8A 4DO6A 3IJ8A 4B5NA 3AHVA 1Q8JA 2YA1A 1XC6A 4MMWA 2CITA 4NUWA 2EG7A 1XRFA 1TPDA 4XK2A 3VMPA 4L9ZA 3LM3A 3PB0A 1S2CA 1XIEA 3OVGA 2VX7A 3RCMA 2O9PA 1OIFA 3EX2A 1VD6A 1SZNA 3LNPA 1MUMA 5BXTA 1KM1A 4JDYA 3WUFA 2NVDA 4XD6A 2ZWZA 2QCEA 1FP8A 4D1JA 4UTJA 4UFKA 3HGJA 2PDHA 4XZBA 2F2HA 5G2HA 3GW3A 3H21A 2ABAA 3FN9A 1YPFA 2WHMA 4TR9A 3WBXA 2ESCA 1DXEA 1I0DA 3G5EA 3JR2A 4ILSA 5D9PA 3TONA 2XZ7A 2YB1A 3LRKA 1TWDA 4ZO8A 4KRUA 4AYGA 4R3UA 2PDLA 2GDVA 2HVMA 3RO6A 1JCJA 2G3MA 2PDKA 3PWGA 4HNOA 1EQCA 3N11A 4AZBA 1H60A 4QJ1A 4ZSTA 3LZ5A 5ECVA 1UR3M 1X8FA 5EMKA 5A8QA 1UPMB 4MKSA 3IJDA 4NZCA 5G4HC 3LERA 2V6AA 4LVDA 3OZOA 1MVYA 1T0OA 2I14A 4LS1A 1PZ0A 2J78A 4PUWA 3KFTA 3UYIA 4NAEA 1WO2A 2PP3A 3O2LA 3BMXA 4GGBA 5C7VA 1BF6A 1WKDA 3GNOA 1TVPA 1LOSA 2A3HA 3PZQA 3WK2A 1K8ZA 3B97A 1XQKA 4AIEA 1M03A 4W7VA 4P7RA 4WF7A 3QFWA 2DPEA 1ZNNA 4DN1A 4H3DA 4CCZA 1VIWA 3S9YA 1RCQA 2ZZ2A 1JQVA 3WDIA 2HDJA 4U5KA 3MJMA 4LY4A 2HE8A 3WQGA 1KA9F 5D2YA 2Z28A 3WY1A 2WLZA 2HVNA 1V02A 4UUIA 4G1KA 4GO8A 3QGAC 3NZGA 4H19A 4WK9A 1B3OA 4LV4A 1XUUA 3VCCA 3HG3A 3CGTA 1YKWA 4B5SA 1TCMA 3WNKA 3DKJA 5D05A 1Q66A 1UJPA 1UIPA 4UBPC 2G4FA 3WH5A 1UD8A 2BHYA 1CGTA 2PA6A 2QJGA 1Y5VA 5E93A 1EDTA 1GQKA 1XLLA 2INFA 2G0WA 4UFIA 1KM0A 3NM3A 2VEIA 1C8XA 3VIOA 2FJUB 2HBVA 3R13A 2GJNA 3DZ1A 2W27A 4PYSA 4ZQOA 5I3JA 1NWTA 5GJNA 3WL0A 1PWLA 5LNRA 4Q8VA 4MB1A 1SUXA 1V0NA 2FVMA 4Z2LA 3ZVHA 5L9FA 3OG3A 3RO8A 2VI0A 3TMLA 4LS0A 1NJJA 3CYJA 3UT0A 3R1ZA 3BG9A 4L9XA 3NNTA 2PD9A 4L4LA 1ADOA 3QOMA 5FEWA 3UZYA 2OR2A 1DL3A 1NIUA 4O4VA 2W61A 3S46A 3TNBA 3D3FA 2A1YA 3GVWA 4LH8A 2OOFA 3W2UA 4Q7BA 1OYCA 2VFIA 5LIYX 3CTLA 5HNTA 3DG7A 4GPNA 2ZZ4A 2IXVA 3GBDA 1YNPA 3SUUA 3U2EA 4WGXA 3NGJA 2PDJA 3NQDA 3FAXA 4ZE5A 5CPNA 3UA3A 3E38A 3RIKA 5BXPA 3IGXA 2WM1A 1IEQA 3N6QA 4UNIA 5CG7A 4FLOA 2ATMA 2XDFA 3TYEA 4JTQA 4NKCA 4QQUA 4C6DA 1OYAA 2PPGA 1W9PA 3W02A 1SFSA 2E6AA 4S3BA 5LXXA 1EBGA 3S6OA 5LNUA 4X61A 3THCA 4JIEA 1LWHA 3UPMA 4D6GA 2PLKA 3GM8A 3HJEA 5DY3A 4IGMA 5D9NA 1JCNA 3BG5A 3NPUA 2A21A 4F48A 3M7SA 4IIHA 7A3HA 3WDJA 1S5MA 3JRKA 3DFPA 2W62A 1GOXA 1W31A 1PKLA 5C2CA 2IKJA 3PZTA 1WBHA 3UPWA 4AVNA 1W8SA 3KDOA 1GZ1A 1RR2A 4IL0A 5BU6A 3IWPA 4WDXA 4CNNA 2JKPA 3HFYA 3STGA 1I1WA 3K8KA 4TMCA 4RDVA 4ZMGA 4AD0A 3VGDA 3ARTA 4PTMA 3B8UA 1FDYA 4GC3A 4H2CA 1JGMA 1CCWB 2POTA 4WDTA 3M0JA 3TTSA 4W85A 1PIGA 3RLHA 5DT7A 2OWCA 4P7LA 3CV7A 3TW7A 2QT3A 2O55A 2D23A 3G2GA 1OCJA 4LAUA 3WJYA 3VUSA 5TBOA 4DJDD 4GZIA 2NWRA 2PDMA 1V3LA 3HZ3A 2R6OA 2PDQA 3CIWA 2E28A 3RMEA 2OWXA 1DWJM 3OOQA 1DHKA 4W93A 3M0KA 1VZWA 3P8JA 1XLIA 1SW7A 4YTTA 1CYGA 1VPXA 3NQFA 2RUSA 1I75A 1XYMA 2AKZA 1G9HA 1DJYA 1YNYA 1CI1A 2QCCA 4C6NA 3AS0A 4XSMA 2ZX8A 4IWWA 4O1CA 4Q4KA 4E4PA 1E15A 3UWVA 3NCOA 1BWKA 5TD4A 2XISA 3O7UA 3W83A 3W01A 1O1HA 1L6YA 1XYAA 4MZ8A 1XLKA 2VD8A 4MJMA 4QSHA 4AWSA 1RV8A 3TSBA 4I5XA 4UFLA 4JTJA 3QLDA 2Y5SA 1VHNA 2G3IA 2DSKA 3BLPX 3TTOA 1AQHA 4B92A 4JDBA 3E1F1 3CAQA 4AAJA 3ZZ1A 3LHYA 3DU0A 5HMEA 4D72A 1S38A 4NJJA 3I4KA 2VEGA 1NF7A 2Q3RA 4LB3A 1EJVC 1T40A 2DEPA 1K4HA 4KERA 4O1AA 5I02A 2BVWA 2F8QA 3MO4A 5A6MA 1JIBA 1B2YA 1GYMA 3ME3A 5T9CE 1W0MA 5M1TA 3FHQA 4KEUA 3N19B 3M5ZA 1VBRA 3H4WA 3DFNA 3A3XA 4LRTA 5H1WA 4D8ZA 5AHEA 4R27A 1FY6A 1E3ZA 1YE4A 3GY1A 1L9WA 2QEZA 1OCQA 4J3VA 1ECQA 1RA5A 3RDKA 4UMAA 3PUGA 4L1XA 1U22A 3ABXA 2Z4GA 3CUFA 4FLRA 3GAKA 4QHRA 3C2OA 2BY1A 2OJPA 3W1QA 1H7OA 1RBOB 4PFMA 1BYAA 3P6LA 1CGYA 1YX1A 2C13A 3L4TA 1PTGA 3OG2A 4O0QA 5H6HA 1PEZA 1D2KA 1BLIA 2VC6A 1MMFA 1SFLA 4V27A 1EGMA 4RDWA 4W84A 4YWSA 4JFWA 2WNNA 4U33A 1CDGA 4WKFA 2GUBA 2NQ9A 5I3IA 1CXFA 2HRWA 3I7SA 4NZ5A 3IV3A 2VRQA 3CWNA 3E9AA 1N7KA 3VD4A 5BOEA 2CWNA 4UNLA 4IH3A 3EXRA 2C91A 5CBJA 4H8VA 2V5JA 3MV01 4K36A 4YCOA 1EZ2A 1ISVA 1PBGA 3P5YA 3OLEA 5LA1A 1IZJA 2ZUMA 4QQ3A 5FA5A 1KTCA 3I6EA 3TP4A 3KDNA 3UWWA 2H9AA 3T44A 1Z6KA 1YTDA 4V2XA 4NZFA 1L2UA 3EWCA 3S5SA 3P80A 5H8UA 1IT8A 1WOBA 4X2PA 4US5A 4P8WA 1OD0A 3B4UA 3HQNA 2OX4A 2FHBA 2YA0A 1JUBA 2I16A 2RDWA 3C0QA 2GK1A 5CGTA 3VKKA 2B7QA 1AW1A 3LTSA 2OX1A 4L64A 3WK3A 1JDFA 4JN6A 3LNMA 3OHIA 3M47A 3SEPA 4XVEA 2VCAA 1Z8AA 2IS7A 3QC0A 4NT0A 3UYCA 1E9ZB 2XIJA 4CCEA 2G3JA 2DIKA 3FJNA 3TNOA 1LL4A 2ZQ0A 1TZ7A 2WK2A 3W37A 3I7RA 7PTDA 1RK5A 2E77A 3E5BA 4GBDA 3MP3A 4NZJA 4UFHA 4B3ZA 4FZIA 3FNDA 3F5JA 3MBFA 5JIWA 3T6CA 4LCSA 1OZMA 2FPYA 4Z1BA 2XGZA 1U5JA 2NXIA 4PA8A 4XTDA 1W3HA 3KBMA 1GG0A 3KXQA 3W2LA 1HG3A 4NI3A 3A23A 3STCA 3WUEA 4LANA 4AXKA 1QNVA 2UBPC 5FACA 3RPMA 7REQB 2CU0A 1FWJC 1Q13A 1NDWA 3IJ6A 2W67A 4KCUA 4DZ5A 5TF0A 4CNPA 1XG4A 3N1AA 1LWIA 3UEQA 4IICA 1FFRA 1WDWA 1TV3A 3IGUA 3KVKA 1VLWA 3AXXA 3KP0A 1KRBC 3ANUA 1US3A 3BAJA 1AMKA 3WLNA 3GNPA 1UD6A 3H53A 3LV5A 4XBKA 1EA0A 1UMLA 4JZ5A 4J1OA 3VOHA 3ZWTA 1JYNA 2YZRA 5GPRA 3BE7A 3GR7A 3PC0A 2GGHA 4GX8A 2R9RA 3C3UA 1V6VA 5G4WA 2QGHA 1OCNA 1QMLA 3RRAA 5CPQA 1L8NA 4Z1AA 3EWXA 5BRPA 1QWGA 3W7NA 4M29A 2VDIA 4MG4A 1IWBA 4MB5A 4U2ZA 3VIPA 5A6BA 3M4HA 4JTEA 4JKKA 3IJLA 2X7VA 2YFOA 1FWTA 3EEGA 5JU6A 1Q2RA 1NP0A 1EC9A 2AAAA 2WKGA 3H2OA 3M5XA 4PRTA 1SJAA 1SJCA 5HJYA 3AUJA 3S1VA 1IEIA 4XBSA 2BFGA 3NQVA 4JBRA 3AJXA 3OPSA 3W25A 4FP1A 2TMDA 1Z89A 1AL7A 1WAWA 2YL9A 4UTMA 3CLWA 3NOYA 4JX6A 3K8MA 1RBAA 2P76A 1QDSA 3U0HA 3TA9A 1ZFJA 2HZGA 4JQ4A 3SQMA 1AJ0A 3MCOA 2QYGA 2ACRA 4ES4A 4GINA 4PMUA 1XQLA 3TJXA 2QULA 2IKGA 3S1XA 1XHGA 1XICA 1WE5A 5DRCA 3AFBA 3FJLA 5C54A 1B4EA 4HK7A 3E5PA 4N42A 6PTDA 1JULA 4FOJA 5AHMA 4YJ5A 1J12A 1T6MA 3G1AA 1NWRA 3KE0A 2Z24A 3GC2A 2YR1A 5EY5A 1M9HA 1A5BA 3VFLA 1SSGA 3O9NA 4NF7A 1OF6A 3M64A 4PTWA 4YL2A 3TN3A 3BJSA 3PPCA 4D6JA 4ACZA 3G24A 2BOGX 4A8IA 1SVDA 1ELSA 3V7PA 4MWAE 1LRNA 3ABOA 4ROQA 4Y2WA 3W26A 3HQ1A 4ZBCA 3KHDA 1B54A 4KQNA 4NXSA 3BSHA 1SO3A 4H9UA 1VRDA 3WD4A 1K02A 1TX2A 1FX6A 3DKLA 3ALGA 3KRZA 2EPOA 4IISA 2JGYA 4B3KA 4HBKA 5CSUA 3ARUA 2BP1A 2E09A 1WDSA 2XGIA 2BVYA 4IF2A 4QTGA 1UOKA 3HM7A 2ZFAA 5MKGB 2Z1WA 3IGHX 4DWSB 3AROA 1XIJA 2WAGA 2ZUVA 2G8ZA 2V3GA 4EK7A 2YCLB 2QNEA 1D3GA 1AODA 1TB3A 3UVIA 3TEVA 4ICCX 3QPYA 5DELA 3N3MA 5JXQA 1A47A 2QJIA 1A5UA 1LM1A 7CGTA 2NSOA 2CLIA 1US0A 1G01A 4WKHA 5FCZA 3Q94A 3T40A 4DBEA 1HXJA 1LT8A 1F74A 4KESA 4AY8A 3VM7A 2BNJA 2P3ZA 4IMAA 2J9ZA 1TPUA 5JUVA 3A47A 1UA7A 3V4BA 4I9AA 1LT7A 3BZGA 3KCLA 4RXGA 3UJRA 1MXGA 3T55A 1S39A 3RUBL 1G67A 3KL5A 3M0IA 3ARVA 1NEYA 3T8QA 1RJRA 4NZ4A 1OADA 1LUCA 4ONVA 1HJSA 4K68A 2EBNA 4HJFA 3PVFA 4IXXA 4LUIA 1EUNA 5I3FA 3EA2A 1XXXA 4RPPA 1TV2A 3U48A 4J9JA 2XZ9A 5A6LA 4CU8A 1AA1B 3T0DA 1QOXA 1W9VA 3T0AA 5BU9A 4PCFA 4E5TA 1Z32X 1S46A 1VFUA 3UU0A 3A21A 4W9TA 1AQFA 1CGUA 2E8YA 3NURA 1AVAA 3M5YA 1D3HA 1TZZA 3WELA 1BXBA 3WLTA 5ECUA 4F9JA 1EDQA 2ATSA 4O8RA 2Q71A 1QNRA 1D8WA 3HFTA 3MHGA 3NQBA 3QJAA 6XIAA 2XWDA 3OGSA 3W1LA 1Z48A 1IGWA 1R9ZA 5I0DA 5LGZA 1NM9A 4YVVA 1A3XA 1KWKA 3WF2A 3WLRA 1C7TA 2XIQA 4B2DD 1EXPA 1E55A 4WJXA 2R1NA 4AZIA 3LCWA 3VAVA 4YVPA 4MM1A 5SWUA 2WSKA 4G9PA 3S6DA 1FWCC 4Z2HA 4XZIA 4RNFA 2DQXA 1YPXA 3IIPA 4UMCA 1HP5A 3IIXA 3HG2A 3NQCA 2X1UA 1AMYA 3II1A 4R7WA 3M6YA 4PGLA 3G3DA 3R43A 3FCPA 3RCYA 4I5RA 1W3IA 4XKMA 1V7AA 3REQA 4ALDA 1GUVA 2WCAA 1W1PA 3S8HA 4IT1A 4MAZA 3DUGA 5FJOA 3HTWA 4UFMA 4Q4MA 4W7UA 4M7TA 1M53A 3AIRA 1KC7A 2QLYA 1G0CA 3AJ7A 4M19A 4LUSB 4B5UA 3NJ3A 1OFRA 1G4TA 2A7PA 2J79A 1XBZA 3UF9A 1V6TA 2NWSA 1NDVA 1P4CA 2YL5A 3FGCA 5CC6A 1VCFA 4Z42C 4RR4A 2QDGA 3O16A 1L6GA 1ONWA 4TVUA 2ZKMX 3MP4A 2XPKA 2V68A 4M56A 3OGRA 2PDPA 2VR5A 3CC1A 3R5EA 2PLCA 3QZAA 5HDRA 1LZOA 6XIMA 4HNCA 1UA3A 2WV8A 4PL1A 4GI8A 4UFJA 1XGZA 3VKBA 3HBLA 3BW4A 3G22A 2G97A 4NJGA 2C71A 3Q2DA 4CD4A 4AD1A 3GDMA 1W5NA 4F79A 3DYMA 4MWAB 1XLHA 3LLFA 3LGDA 1CIUA 4LBSA 2YDQA 3GVRA 1BWVA 4D6IA 3HQOA 4O8AA 2Y63A 3R89A 3S3GA 4PE8A 4YTRA 3UCQA 2CLHA 4PUJA 3SUVA 1B90A 4DJED 2Y5JA 1DQXA 5JIPA 1PS9A 3BURA 2DZTA 2TSYA 1F4HA 4HPHA 1MQQA 3IK4A 1BVZA 2WZTA 2FB3A 1NY1A 2WANA 3TSMA 5A94A 1GJWA 2OGYA 3WK0A 1K03A 4O11A 4PB5A 1W17A 1W32A 1P0BA 4HNLA 4GNVA 4LNCA 3STPA 1F07A 4AVOA 1P0NA 1M7OA 1F8IA 4H7ZA 4X0NA 4J3XA 1Q6LA 4Q6JA 1QPKA 3QYQA 2QCDB 3UNDA 2AL2B 4H9TA 4IXHA 3GXTA 5DLCA 2X41A 3B0VC 3RU6A 5ABFB 3IARA 4LVGA 2Z1BA 3GNDA 3MS8A 4O12A 4S38A 5LIXX 1RQBA 4D6DA 4DPPA 4ZE4A 1XPGA 1H4PA 3MWCA 3CV6A 4FS9A 2PU0A 5KMYA 1GPWA 2JBMA 4KCWA 3LHZA 4HN4A 2PF0A 2R91A 2AQOA 2XHYA 3OB8A 1Q65A 4ATWA 3ATZA 2PDNA 4LYPA 1QBBA 1PTAA 1OCBA 4K8HA 5K3VA 1QTWA 2GLKA 3MYOA 3CUHA 3NZQA 3MHUA 3WDPP 2ZYFA 2Z27A 2OSXA 3KS6A 4JFUA 1KXVA 5H8PA 5EKYA 4XV0A 4FX7A 4Q8PA 3BLEA 5CXPA 4YS1A 3A6OA 3QR3A 4W88A 5KEZA 3NL6A 3GKAA 2VFFA 4N6FA 1AG1O 1O5XA 3NQGA 1WXJA 1UZDA 4C6PA 2EJ1A 2ZICA 5F4WA 3LXAA 5M5DA 2WZIA 3A4WA 1J0HA 5REQA 4GYJA 3CASA 3U7BA 5E0CA 4CNTA 3H24A 4RV3A 1DHPA 4I8DA 2FIQA 2XFFA 3OZMA 2HPIA 3F4WA 2DJXA 5HNUA 1LOLA 3WFAA 1Z42A 2GWGA 1ME7A 5BWAA 4OFCA 2VNCA 3JZEA 3HV8A 1MWOA 3MHFA 3G1VA 2H6RA 3E96A 2GUUA 2D2OA 2CBIA 3D5HA 3NXLA 4XBJA 4I9MA 4LWWA 4L6OA 4LYQA 3CZLA 4FNQA 1WAUA 4Z08A 3BMVA 3SCTA 2CLPA 5M17A 1RJQA 1X1NA 2JEPA 5LNVA 1CENA 2Y5EA 2E6FA 2GDUA 1ENUA 2GJPA 3QPZA 4HCDA 2DT0A 2IXUA 1TPC1 1FBAA 3MV11 3CMGA 3UXLA 3VX0A 4N0RA 4J2PA 4PMJA 4W89A 1IIGA 2OKTA 1B9ZA 3SN4A 2WQDA 2J62A 1PKMA 1ZBKA 3UFYA 2VCCA 4N9CA 4MF4A 5EMLA 3NSXA 4GZ7A 3W23A 2XIOA 2HISA 4WY0B 4IQLA 3KS5A 2XWEA 1TRIA 3EBVA 1JNDA 1X6UA 2ABBA 4AX7A 1H62A 2V81A 4ZL1A 5G1YA 3W1XA 3SCWA 3AICA 5F2GA 5A2AA 5FSEC 2IPFA 4ZOEA 2WZHA 4Q8WA 1GHSA 3WQCA 2E5DA 3MA8A 1LQ0A 1WDRA 3TWAA 4IPJA 1NP2A 1EGZA 3RXZA 2FH6A 3AAMA 4JKLA 1O6IA 1HJVA 2ACQA 2UV8G 4WGHA 5KTLA 4YPJA 4GI4A 1J9YA 3REQB 1WZLA 4WY0F 2CCRA 4HKPA 4A22A 3QKEA 4HOWA 1D7KA 4Y9MA 4AISA 4FF5A 1GQIA 2V3EA 4XAZA 3TUUA 3UJSA 3R10A 1ZAJA 1J0JA 2DZUA 3LTPA 3QPEA 1JI1A 2WPGA 4MPQA 5I06A 3HA1A 3TQPA 3MMTA 1PPIA 3W82A 3SUWA 3G0SA 1AZ1A 1OQFA 4PUKA 4O28A 4S3EA 3TROA 4PR4A 4GH1A 3G18A 3KUMA 4KEVA 3SSJA 1XIMA 1MXSA 1VYPX 3QY8A 3PWAA 1H11A 3VDHA 2DH2A 2YLAA 4HCHA 3BOFA 2XVPA 1WXYA 5EMMA 1OFPA 2OLHA 3BW2A 2YCIX 4O1EA 2J77A 2F6UA 5I03A 1HJXA 4Q4OA 2WJDA 3QF0A 2PGEA 5FJRA 1KFJA 2D2JA 3W2JA 5F4SA 2EKGA 4HIBA 1W6TA 3DBNA 3MY9A 2WBKA 3QMTA 2VMFA 4IMDA 2QMJA 1B31A 1O7AA 2ZDRA 4OHQA 1TYGA 4U10A 3VOJA 9RUBA 1MNSA 4BCEA 2PGRA 1MRQA 2AOSA 2GQ9A 2ADAA 4C90A 2P88A 1O94A 1PZ3A 4RE0A 3VNMA 1WZMA 1GVYA 4RZBA 3E0VA 1Q4NX 4ML9A 1FCBA 4GZJA 4J27A 3L5MA 4H9XA 3WQVA 1THFD 4HMDA 5AC6A 4C1LA 1XIBA 2X05A 4B3LA 7ODCA 2VYOA 1UC4A 2DZVA 2DFAA 4BQ3A 3ONCA 1ZSXA 4HU3A 3S5ZA 5T8GA 4M5PA 1Q6CA 2VC5A 4GLEA 4NSBA 3KTSA 3VIGA 3EMZA 1HL9A 2QUNA 4B9ZA 2XN0A 4XZHA 3DFOA 4ZSUA 3LQGA 1JUEA 4IP4A 1E9LA 2XVNA 5E6YA 3KZPA 3VZXA 3WSUA 4QRNA 2OYLA 3RM9A 2IW0A 4JCLA 2HBXA 3IEBA 1RP8A 3GXFA 4N9BA 1EB3A 3W81A 5ABHA 3RJXA 4NU7A 2OZ8A 3VOIA 3UBPC 4G7EB 4S3FA 3PTQA 3N6HA 5HULA 4JL2A 3KWSA 5I78A 5CPMA 1MW1A 1XRSA 4W8LA 4O13A 3DFTA 1NFBA 3VI2A 3VVGA 1AW2A 3GG8A 1U30A 4U28A 5C5YA 2V5DA 4QJ3B 4OJYA 2Y8VA 1V03A 1I6NA 3SFWA 2G3FA 2Y70A 4S3GA 1TA3A 4PB3A 1J93A 3GH7A 4JY8A 3V18A 1MUCA 1WUEA 4BR1A 4S2BA 3L23A 1GK8A 4DEFA 1DORA 3KW3A 1KFCA 3PWIA 4AZ5A 1EP2A 3BANA 3KEHA 4YXGA 4QLKA 1ZBCA 3NR0A 1H1YA 3ARSA 1MNZA 2ZZ5A 4UQCA 1FCVA 1W1YA 1HJWA 2YKKA 3SCRA 4QDWA 4TV6A 3MBDA 4PSPA 3GTNA 4R7JA 3C0SA 3DX5A 5EYWA 2OWWA 4CU7A 1EUAA 4FNRA 4WZHA 4OV9A 3R6IA 2B7PA 1XYFA 1F4AA 2D0HA 3SI9A 1FWDC 3DENA 1KTNA 3XINA 5EL1A 1G5AA 3NPWA 1IXQA 2Z1VA 1KFLA 5CC3A 1XH2A 3KAOA 3UY8A 2FGBA 4KT2A 1V51A 4HNTA 2OODA 4KIEA 4N7QA 3L67A 3WMLA 2ISDA 2W79A 3T7VA 1WBJA 2DSZA 3L4UA 2DQWA 4DBDA 3E49A 4GRSA 2OVLA 4BY3A 4X60A 5CKSA 3NQAA