3QPZA

Crystal structure of the n59a mutant of the 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKAARSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESPLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
total genus 84
structure length 251
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qpzA00
5KSWA 3R2GA 2C18A 3R13A 1W31A 3TJXA 2O7SA 3BG5A 4RLIA 3IVSA 4GNJA 4UFJA 2Y7GA 1YTKA 1VQTA 5EMUA 2F7FA 3HG4A 3PS7A 4FF7A 3UWWA 4DBDA 5G4WA 3P62A 2CLKA 1XUUA 3P80A 2QCGA 5C54A 4JTEA 3NEVA 3R89A 4UNKA 2QJHA 1T96A 2EHHA 3FKRA 3QSRA 4NJHA 4DEFA 3HIJA 1O95A 4N02A 1H5YA 2CLEA 4O11A 4TX9A 1OFPA 1KW1A 1LOLA 3TFCA 3MBDA 2WPBA 1AW1A 3CTLA 4FIRA 1T99A 1SSGA 5BNKA 1YXYA 2Q3OA 4O13A 2JKEA 3GNNA 3PUOA 1L6WA 6ALDA 3ANYA 1VH7A 2Z1BA 3P74A 1K7XA 4AWTA 2ZRWA 4KFNA 4NNAA 4DELA 2BX7A 1CI1A 1C29A 5D2TA 4BFAA 2YSWA 2FFCA 3PB0A 4NUWA 3MJYA 1A5CA 3BVJA 2XN2A 5FEZA 3EWZA 5I3JA 1X1ZA 5F4WA 3W83A 4BWLA 5TQLA 4CNPA 3C2OA 3UQNA 2H3DA 3G18A 1TTQA 3CWOX 4KFPA 5HWNA 2NX9A 4M6VA 3PBWA 1R2SA 5EYWA 4G1KA 3NPXA 1XM3A 1XUZA 1GOXA 1Q6LA 5L9FA 2VELA 2OT0A 3IV3A 2FQIA 3W7CA 1W8SA 4PEKA 2QR6A 1XBXA 2A7PA 1A5SA 1JCXA 2ZRVA 3GDKA 3NVTA 5BW6A 4QQ3A 1TMHA 2WOQA 1LTDA 3S1UA 1G4PA 2EKCA 3P8JA 1OG0A 4KKXA 5DBUA 3EXTA 3QYQA 1SZFA 3WJWA 5AN7A 2BZNA 1M7OA 4QNWA 1N55A 1LOQA 1THFD 1TPUA 4DPPA 2GQAA 1O5XA 2ALDA 3PG9A 1GG0A 1KFBA 4HPJA 1GT8A 1LBFA 2VFIA 2FB2A 3NG3A 4WZHA 4EIVA 4KFOA 3W1QA 1P1XA 1MEIA 3ATZA 3WFAA 1FY6A 1LCOA 2X1UA 4D2JA 1WXJA 2YDAA 4LT9A 4KWVA 2OT1A 3WK0A 4MVAA 4MZ1A 3WJZA 4LS1A 3TX9A 3BW2A 4B5NA 2EGZA 5T26A 3HPZA 1ZY9A 2FLIA 4GUHA 5EBUA 1H61A 4I7VA 3YPIA 3FS2A 1B4KA 1RV8A 1QO5A 4UTMA 5HWMA 4MFDA 1BWLA 3MUXA 1R2TA 1F6KA 1PCWA 4XBSA 1RPXA 2XN0A 3HPSA 1CW2A 5FEXA 3M1ZA 1TTJA 3TW7A 4HSNA 2C0AA 5LGXA 1OK6A 1OJXA 1VHNA 2FTPA 1SZGA 2A6LA 3PSWA 5K2ZA 1WYIA 1TB3A 1VRDA 4Z0SA 1N7KA 1H1YA 4JTGA 4JDBA 2CLIA 4R7JA 1AL7A 2GPTA 1FWWA 2QDGA 1KM3A 1M6JA 3BW3A 3C56A 5CKSA 2VFGA 1GPWA 2QCEA 4JTIA 3UZJA 3W7HA 3NA8A 4HN4A 3QW3A 2Q8ZA 1HFBA 2DZXA 4ADSA 1OF6A 3EKLA 3W70A 4LS0A 4UMAA 3MP4A 3AJXA 1V5XA 2ZRUA 3W7RA 5FF0A 2ABAA 2ZZ1A 4JTHA 3N19B 2A6NA 3W74A 4O17A 4QSHA 1YTDA 2TMDA 4NQ1A 3GKAA 3LTPA 4MY8A 2QCMA 3TSMA 3O1NA 5LNRA 1OF8A 1G4TA 3BK0A 5LGZA 3TSDA 3O6YX 4O15A 3LTSA 4C1KA 4RZ4A 2OCZA 2DORA 1WOBA 3BGGA 5EY5A 4O1BA 2CLOA 4AVFA 3PF3A 2NXIA 2YYTA 3DI0A 5AYXA 3LRKA 1KFKA 2IQTA 4MZ8A 4AMAA 2P1FA 5F1VA 4JTLA 2VEIA 1SUXA 5A5WA 3CT7A 4IMFA 2ZTJA 4ZQCA 1DOSA 4OV4A 4CCEA 2CLHA 4Z1CA 5LNSA 1K8XA 1IXPA 3GXPA 3TAOA 2NUXA 1ALDA 3LRLA 5KTLA 5DN1A 3ABOA 1I4NA 3GR8A 1GTEA 3S8HA 1JULA 5HULA 4A29A 1JCLA 3HGSA 4Z1BA 1M7PA 4X9SA 1UUMA 1GWJA 1HO1A 3LLDA 4IXXA 1O60A 1WA3A 1J4EA 4PH6A 2Y6ZA 2VKZG 5KITA 2B0MA 3B4UA 1KM0A 3LRMA 3MI3A 2HTMA 4FIQA 2JK2A 3DKLA 5K9DA 4YWIA 1P0NA 3S1XA 4O4VA 4AHQA 1TTIA 1LRTA 1ZALA 3I7QA 1P4CA 3NYZA 2A7NA 1UJPA 4NZJA 4AF0B 1SO4A 3PUEA 1VHCA 3QQ0A 4X2RA 4AWSA 2VEKA 3VNDA 5E93A 3F4WA 3MHFA 4FX6M 4ZMGA 4X22A 1DQXA 2C14A 3BARA 1DQWA 5KZEA 4O52A 3FFSA 2NWSA 1DHPA 1VYPX 1ZNNA 2H3BA 1RQBA 4LC8A 5CZSA 2GQ9A 1H7OA 3SI9A 5AB3A 3N2MA 1VC4A 1MO0A 4CNOA 5DCDA 4DQWA 3MP5A 3OVRA 4FNTA 1AW2A 5G5IA 4NNCA 1YTEA 4NVTA 1KFJA 3KVJA 3WJSA 1FDJA 3S5OA 4H6KA 1DKWA 4EF9A 3W6YA 5HUPA 3G8RA 4NX0A 3W7LA 4FNPA 1TV8A 1MEHA 1LBMA 3QPZA 1W3IA 2BWGA 5J5RA 2E5DA 4MYAA 3WK1A 3W2UA 5DLCA 3SSJA 1IIGA 2ZRYA 4Q4KA 5F2IA 5DCEA 1W0MA 3L9CA 1VCVA 5U7SA 4WQ6A 5CSSA 4MYXA 1ZFJA 4FB7A 1JRCA 3BLEA 2Z2UA 1WBJA 1ZAIA 3B05A 1X6UA 3E96A 2E09A 3ZS4A 3W9ZA 3CIWA 3PULA 4BI6A 4K7YA 3SR7A 4UR7A 3TFXA 4WJEA 3HPXA 3ZWSA 2Y7FA 1WOAA 3EWYA 4IX0A 3WJXA 4MOZA 5AHEA 4UTIA 5LNUA 1W3NA 2DZWA 1X1OA 3RLUA 2V5LA 5KZMA 3LCHA 1YPIA 1OK4A 3INPA 2DZVA 3BW4A 3M44A 3W2MA 1H50A 1I2OA 1GZGA 4OWGA 3KHJA 4RCXA 4JIPA 1Z44A 1T8XA 3M5YA 3UZ5A 3BGJA 5EA9A 4JNMA 5EKYA 1GTHA 3B04A 1VYRA 3MI2A 4NXSA 5LSMA 2WSRA 3QSTA 3MYOA 3IIPA 5IBXC 4LVDA 1RR2A 1SO5A 3GAKA 2ZRZA 1K03A 2EF9A 3PSVA 4GRSA 4WY0F 3EXRA 2QUVA 2X16A 4DF2A 1O5KA 5MHBA 4JTTA 3W7MA 1OFQA 5F4XA 3W7GA 4OU1A 1QPNA 1HL2A 3S42A 4UMCA 3DGRA 2NUYA 4GC4A 5LNVA 1BTMA 2C1HA 2NX1A 3JR2A 3SY5A 1ZJIA 3TSBA 4NNBA 3N3MA 3TMQA 1GVFA 1JCNA 2DZTA 4A22A 3SZ8A 3CWNA 5LZLA 5D2XA 1BKSA 3RNDA 1OVDA 5BRBA 3LCIA 2H8ZA 2C13A 3UXDA 1XKYA 3M47A 4N9BA 1OABA 1W1ZA 2W0UA 2A1YA 3O07A 5C5YA 3HG3A 4LV9A 1TREA 6TIMA 3LXCA 3HGOA 3MP3A 5CZTA 1RQHA 5HUOA 4O1DA 4Z1DA 5GVJA 2YPIA 4ALDA 4O18A 4QM1A 2KZHA 1B57A 3HQ1A 1IXNA 4HSOA 4JX6A 2V81A 3C3NA 1KV8A 5I3FA 3NZ1A 3IEBA 3W7OA 1TPDA 4BR1A 3N2XA 4MFEA 2A85A 2Z6IA 3GDTA 2VXNA 4LW7A 4Y8FA 5CPMA 3QM3A 2QUUA 4PTNA 5C2XA 4OBTA 3W7KA 4POCA 4ORMA 1I2PA 4RX0A 3VI2A 3LHTA 2PRLA 3B03A 4GUGA 3FYOA 1DORA 3NOEA 5HWJA 1IXQA 3G1HA 1UB3A 2E1DA 1W5PA 4NU7A 2X2GA 3ZR4A 3SW6A 2CU0A 2G96A 1NVMA 4A21A 5CG7A 1G7VA 3EEGA 3U2OA 4C1LA 4UTTA 3CEPA 3CHVA 3UWUA 3GVGA 1DJNA 3E02A 3KRZA 3O6CA 2OJPA 3KXQA 4K38A 2A7RA 4Z1AA 3RMJA 1QAPA 1F2JA 4N6EA 4AAJA 1FQ0A 2C3ZA 1VR6A 3DZ1A 4CQ9A 1S5TA 4JICA 4OT7A 1H7PA 1BEUA 2C6QA 3S1WA 4NXKA 5KINA 3O16A 4HHPA 4R33A 4O19A 1A53A 3Q2DA 1JJKA 2YX0A 5KZDA 1JCMP 4Z0JA 4JX5A 1WX0A 4TR9A 3LBCA 1TPWA 1IXOA 2VENA 2X1SA 4UCGA 4WY0B 2GOUA 4UTTC 3W1LA 2PE4A 2X30A 1TQJA 3G1DA 2ZCGA 2ISVA 1OYBA 3GAYA 2FB3A 3W1UA 1TYGA 1I45A 1ME7A 4DPQA 3L68A 1H1ZA 2J88A 1SO6A 2BSLA 2RH9A 3GB6A 3O8AA 3IVTA 3NXFA 3LCFA 4UTWA 1H7NA 4MJZA 1KTBA 4DF0A 1HUVA 4MIMA 3NDOA 4E2DA 1G4EA 2B7OA 3WK3A 1EP2A 1FUYA 3F03K 1QOQA 4UFLA 3GR7A 1AG1O 2LLEA 1LOSA 4IGHA 4ZQOA 1FCUA 3TUUA 1GYNA 2QKFA 1O94A 4JIQA 1I2QA 1NF0A 3W2KA 2A0NA 4Y90A 2B7QA 3MI6A 1OFOA 4PCFA 3DFPA 4H4IA 3CM4A 3TXZA 5HINA 1KM1A 2C19A 4N9CA 3I65A 2GJLA 2D73A 1J5TA 2VFDA 2PRHA 4LU0A 2RDTA 4UXDA 3W7PA 1UBSA 3LERA 5D2YA 3F1QA 1CX9A 1KTNA 1R46A 1NSJA 2E6YA 3LHYA 3GXNA 2Y85A 4IXHA 2QCDA 3C61A 3HO8A 3NQAA 3PVFA 1PHWA 3G0XA 4OHQA 3HB9A 1AL8A 3TW6A 2G5WA 3W7QA 5KMYA 1Q6QA 1XC4A 4UTJA 4QITA 1I8JA 1XL9A 1ZCOA 2B4GA 4IMEA 1EPXA 3KOFA 4O0ZA 1TPB1 4XTIA 2JGQA 4GXMA 1SZEA 1GYLA 5CGQA 4JYEA 4HT3A 4PA8A 1KFEA 4CCCA 1KFCA 3QH2A 2V2HA 3W1RA 4A2SA 5CZ0A 3GZ3A 4E38A 3GDLA 3WK2A 4AEOA 3EWUA 2QCHA 4DO5A 2DJXA 3W7DA 1FDZA 3HJZA 3MHUA 2Y89A 3PUDA 1FCQA 5D02A 1ICSA 3KFTA 4LRTA 3W2LA 1DVJA 2YYUA 4CQ8A 2XN1A 3LHZA 2ZZ6A 5K4ZA 1KV5A 1A50A 1UCWA 5AC7A 4PC8A 1YDNA 4JTSA 1YDVA 2QEZA 5D03A 1ZAJA 1MEWA 1PL9A 4O12A 1PIIA 3W88A 3DFOA 3L66A 4K37A 4ORIA 4S1FA 2ZYFA 3QFEA 1FWRA 1LLWA 3M43A 1XCFA 3STEA 1VGAA 3OVQA 3A24A 3A23A 4OGZA 4UTUA 4DF1A 7TIMA 1K8YA 1PV8A 1SO3A 5AHFA 3ATYA 3HGRA 3C0JA 4CQAA 3EX4A 3RU6A 3DENA 3LXBA 2QCLA 4TU1A 1W5QA 1EUNA 3NL6A 5EL1A 3W3OA 4DXVA 3OIXA 5IM51 3LCLA 1KM6A 3USBA 3RF9A 3QW4B 4JYDA 1Z41A 3NR0A 2RFGA 1EP3A 4IUOA 3S5ZA 1WDWA 1W3TA 3NQVA 4XBKA 3S5YA 3W1NA 4ADUA 4MPQA 1FCVA 4LTSA 3W75A 3UYCA 5ABTA 4ZQNA 4RXGA 3ZFHA 1WV2A 1YDOA 4QAIA 1U83A 3RFAA 1Y0EA 3CLMA 3E49A 3LX9A 4N6FA 3LV6A 2Z0IA 5HNRA 3MMTA 3I68A 3G0UA 2E6DA 1PE1A 2ZA2A 4JEQA 3C2FA 1QDSA 1W37A 3QC3A 3NM1A 1S3HA 3MHGA 2ZZ7A 4JX4A 2YFNA 3PWAA 3W7JA 4FNUA 5AYYA 4MLJA 3UWQA 3UWVA 3KRSA 2J6XA 5F2GA 2CLFA 4YCPA 2QF7A 4IX2A 2H8XA 1Q3NA 4NJGA 3R12A 1KLYA 4HIBA 1JVNA 3GK0A 3QMSA 4LNYA 4ZQPA 4HNTA 3QQ1A 3CQ0A 3I7RA 2Y7DA 3G1FA 3CPRA 4HPXA 1G7UA 2WSQA 2QUTA 3TE9A 5FI8A 3P84A 3W22A 5FESA 2DJLA 3C2VA 1GVRA 1TV7A 2PRMA 3TNOA 3RK8A 1FBAA 3LHWA 1FX6A 5DELA 1W54A 1C9DA 1OYCA 5D38A 3OEXA 4ZQMA 2E6FA 2ZRXA 1GVQA 2E77A 4X3ZA 2JKPA 2V82A 1PHQA 3TU9A 3QPYA 3IGXA 2CZEA 1XDLA 4GJ1A 1RD5A 5HQEA 4S2CA 3W7IA 3NQ2A 5AHNA 3LGEA 3TQKA 4ML9A 3DFNA 3NPWA 1TPC1 2F84A 1W5MA 3Q37A 3LOTA 3QRHA 3BPWA 1F74A 2R14A 3CU2A 3P5YA 4M5PA 3LCXA 5F4SA 3TK7A 3T44A 2NZLA 5E1QA 2QCDB 3KVKA 4LY8A 5G1YA 1G4SA 5K3VA 2WNNA 1Q6RA 3TIMA 2GVGA 1ZAHA 4WOZA 4RR4A 2VC6A 2I9EA 2NUWA 1H60A 2YW3A 2OZ0A 1LDCA 4JR5A 3P60A 3ABSA 5G2IA 1HG3A 3W1AA 1LRQA 2WQPA 4AB4A 2G95A 1LYXA 3O63A 4LC6A 4ZL1A 1KLZA 1TPH1 1H63A 1SW0A 3FLUA 1G69A 4LWWA 3T78A 2V30A 4M6QA 2C16A 5FF3A 4OE7A 3TA6A 2ZZ4A 1SU5A 3NQ8A 3QJAA 1YADA 3P5ZA 3P82A 2TRSA 3NQCA 4FEZA 4GUIA 3A22A 3DXIA 3UPWA 4O1AA 3W1TA 3S0CA 2NLIA 3NL3A 4QISA 2O7QA 3SECA 2V8ZA 1J2WA 1SFJA 1B4EA 2JGYA 4LUIA 3HG5A 3B8DA 3ELFA 3IGSA 3IRDA 5D05A 3FEMA 3M5ZA 4XTDA 4Y96A 3M5VA 1Z42A 5H91A 4EVZA 5K9CA 3GX9A 4O54A 4AHPA 3VKJA 3C6CA 5D32A 3T40A 4HNUA 3PBUA 8TIMA 3G0SA 4WOQA 3L5MA 3CC1A 5AYZA 3C2RA 2AQWA 5LHFA 4WY0A 1S5WA 4O14A 1TPEA 3SGUA 4NJIA 2E68A 3IGUA 3GKFA 5L6UA 2I1OA 3D0CA 5FEPA 1A5AA 1DJQA 1PS9A 1S5VA 3NAVA 4FNSA 1JQXA 1GEQA 1F76A 1K7FA 5AC8A 2G97A 1EWEA 3N9SA 2QCCA 3PY2A 1GVSA 1R2RA 3TV8A 2YR1A 1XBVA 1NEYA 1W5OA 4K6AA 1F73A 4LVFA 4L4MA 2TYSA 1TQXA 5CPLA 3TMLA 1TJPA 3HMJG 3M0ZA 2DZUA 1MSSA 3W72A 4R34A 3UY8A 2RKXA 3KX6A 2JKAA 4OV9A 1Q45A 1AW5A 3DH7A 4PODA 4IMDA 1PCKA 1C8VA 2YW4A 3SFKA 3A21A 3FYPA 4CLMA 3F4NA 3LHUA 1L2UA 3G1XA 1JCJA 3CEUA 4QIUA 1LRNA 4JTJA 1VS1A 4Q33A 2W6RA 1TRDA 3EX2A 4XKYB 1NAL1 4OQVA 2QCNA 3JRKA 3GDMA 2UV8G 1IGSA 2FPVA 1RZMA 4MUZA 3A5FA 3LCGA 3S5NA 4JXCA 1ME9A 3NO5A 5G1TA 2FJKA 4FO4A 3M41A 3HOJA 2NXHA 1NFBA 3P67A 3BV4A 5HMSA 5K7JA 2A2IA 4MKNA 1F7BA 4I7UA 4QNEA 1VYSX 1B9BA 5D37A 3EXSA 1ME8A 2BTMA 3SJ3A 3R5EA 4RZ6A 1EX5A 5CSRA 4WUIA 2V0TA 1YPFA 3O6DA 3G1AA 5AHMA 3L5AA 3W2JA 4WXYA 1FWTA 2PCQA 3THQA 3TKFA 3IIOA 3MWAA 2R94A 1OX6A 2TPSA 4EWND 1T0OA 2YGYA 3LI1A 3NNTA 2Q8LA 2YXGA 1Q6OA 4XUGA 3TQ0A 4LVBA 3NQGA 4WD0A 4YCOA 1XBZA 3NQDA 4TMBA 5DCBA 1EB3A 3QEZA 2Y88A 4PL2A 3WJYA 1K02A 4GUJA 2ZFAA 1JUKA 1W5NA 3GXTA 5D2VA 3N14A 2HMCA 4YLWA 4J9JA 1OHLA 1GJPA 3LLFA 3TJLA 4EF8A 4ZQRA 4BF9A 2Y70A 1EP1A 4PL1A 2B7NA 1F5ZA 5D33A 1R47A 1UUOA 2DZSA 4U28A 2GVJA 2TSYA 4UTKA 3EWWA 1LZOA 1QPRA 3UWYA 2R8WA 3QMRA 5I3KA 3OVPA 4CNNA 3TXVA 1AK5A 3L0GA 3EX3A 3NQEA 1OX4B 4UIOA 2H90A 3UNDA 4ADTA 3G1YA 2I14A 4AWUA 3KRUA 2V5BA 1VPXA 4GWEA 5C6MA 4A3UA 3Q58A 1SW3A 2NV1A 4O53A 4NJKA 3W23A 3TAKA 5TBOA 1O4UA 4LUJA 3E9AA 2OMAA 2CZ5A 4AF0A 2ZZ5A 2FPYA 1H7XA 4JY9A 2FPTA 3S6DA 3S9YA 2W79A 4M6PA 5AC6A 5BOOA 2Z6JA 4JN6A 4YL2A 3B0PA 2ZQ0A 2QAFA 1OFBA 4GUFA 5DXYA 3A9IA 4NX5A 2WV8A 4GFSA 3BG3A 5E0KA 3ABQA 2JBMA 3UPBA 1EEPA 1E51A 3O05A 1OX4A 1ICPA 1KA9F 4LRSA 4PFMA 3R8RA 1KFLA 4ONVA 1JUEA 4O16A 5FF7A 1TO3A 4S2BA 1ICQA 1VCFA 4FHAA 4IMGA 3M7WA 2CW6A 2P10A 3UXAA 1XDMA 4RV8A 2FIQA 2R91A 2WJZA 3TC7A 4YXGA 4R53A 4JTFA 1WQ5A 1QO2A 1JR1A 1LLZA 3LI0A 3E0IA 3KAOA 3KVLA 2CZFA 3G3MA 1N8FA 4K7VA 2GVLA 2NXGA 2OX1A 2XFWA 3M6YA 3G22A 1SPQA 2WNZA 4LVGA 1VZWA 1OX5A 1U5JA 3AO0A 3TC6A 3LXAA 1H62A 3W73A 1G67A 1H7RA 3HGJA 5C55A 1R30A 3I7SA 1RVGA 1DL3A 2CLMA 4FX7A 4N2YA 1FDYA 1FCBA 4DO6A 3DFSA 3IIXA 1TCDA 3PC0A 2PC4A 1YYAA 3DBPA 4IQLA 4XKYA 3NZRA 4AXKA 4BWLC 3L5LA 3W87A 2Y61A 5LHEA 4MLRA 3UY7A 3N73A 2QCFA 1JRBA 2AGKA 3W85A 1EIXA 1K8ZA 4Z08A 4N9EA 1F6PA 1OFAA 2X1TA 3NQFA 2Y7EA 4M7SA 1LP6A 3P61A 5D09A 2RHGA 2WSYA 4JY8A 1HO4A 3SIZA 3C4UA 4WXZA 3EKZA 3RLVA 1EA0A 3B06A 1SSDA 1NF7A 2E6AA 3ZWTA 3MO7A 1K7EA 5LKYA 2CZDA 3EX1A 3NGJA 1I2NA 2E5CA 5AHIA 4H3DA 3L21A 4U4MA 4UC5A 5FF2A 3THAA 3LTYA 4NZFA 3O15A 4ZZ9A 4K8HA 5I3HA 1VLIA 4TMCA 3MBFA 3TH6A 3N34A 3G24A 1H51A 3VFLA 3LBMA 4O1CA 2YFOA 4DBEA 4UFHA 3GIYA 4ICNA 1H7WA 2AAMA 2J9ZA 3M16A 2GUUA 2NV2A 3U6WA 3LDVA 3W1XA 1HTIA 1ML1A 3JS3A 2ISSA 4UTHA 1KTCA 4MZYA 1WBHA 3GDRA 3W86A 4JTKA 4O28A 4W9TA 5DY3A 2NX3A 3G1SA 5H2ZA 1JUBA 2YCEA 4A2RA 4P2VA 2DU2A 1P5BA 3PR2A 1XFBA 4Q32A 2J9YA 1B3OA 1JCYA 4JS3A 5IBXA 5BMXA 2EAWA 1V7YA 3EB2A 5CZJA 2VOMA 3I6RA 4UMBA 3LHVA 1X8FA 3H53A 1OFRA 3Q94A 1D3HA 3LB0A 1FWNA 3FJ6A 2X1RA 2VEMA 3DU0A 3STGA 5HJLA 1OYAA 2VFEA 3IIZA 3VE7A 3T4CA 1D3GA 5U4NA 4HNNA 3T7VA 1FXPA 1LBLA 1OFDA 1QOPA 3W1PA 4O8RA 1KM5A 3MYPA 1VCGA 1Z48A 5CPOA 2FDSA 4O57A 4IOTA 3IVUA 2DZPA 3FJLA 1K3UA 1LROA 2ZZ2A 5FEWA 1KM4A 5BMWA 2EPHA 2QDHA 3PM6A 2YZRA 3TQVA 3W84A 3DHFA 2ZA1A 1SFLA 4IJBA 4P61A 3EX6A 3FKKA 3PG8A 4HNVA 1SQ7A 1ZENA 4FXRA 3KVMA 4XWUA 2C15A 4BK9A 4JGDA 3FOKA 4JD4A 1ZHAA 4L4LA 3EWXA 5J5DA 4MJMA 1P0KA 2BXVA 2VFHA 4FNQA 4FX8A 4JDYA 3NQ7A 3NQ6A 2V2CA 3U8GA 1QFEA 5K4XA 3C2EA 1DV7A 3FIGA 3C52A 3O06A 2RDUA 1FXQA 3ABRA 4UTLA 1KBIA 2CWNA 3PAJA 1TTPA 5FF4A 3VE9A 2V2DA 2B7PA 4MY1A 4I7WA 1LORA 1UASA 3TCEA 3OA3A 2HS6A 4K36A 2CFFA 4LVAA 1QWGA 2QAPA 3DI1A 3G3DA 1TSIA 3K30A 3N9RA 4RK8A 1OFEA 3S1VA 2A21A 1TIMA 1GVOA 3OBKA 3P81A 1QCWA 3P8IA 3UD6A 1L6YA 3IIVA 1TPFA 3CB8A 3BO9A 3UWZA 3NPUA 3OG3A 4IWWA 2VEPA 1VJIA 5AFDA 3FA5A 4Y9AA 2WO5A 1TRIA 4NT0A 2GJNA 4QJ1A 5SWUA 1RQEA 1LM1A 2J27A 5I3GA 5TIMA 4GBUA 1QPQA 3BLFA 2CLLA 4E2BA 1GQNA 1IIHA 3G8EA 3HF3A 4UUIA 4E0CA 3HBLA 3W7EA 4UTWC 1FWSA 2V9DA 5AOUA 4IPIA 5DBTA 4UNLA 3L67A 4KWWA 3BG9A 4M7TA 1XBYA 1XI3A 3DFQA 1TJRA 1GG1A 3B0VC 2PURA 2QJGA 2ISWA 2Q3RA 3TDFA 2ATMA 3MW7A 5AHLA 3BLIA 4M19A 1MXSA 1MZHA 3STFA 4O4WA 2RDWA 4TIMA 4XZ9A 1ADOA 2VFFA 1L9WA 3A5VA 4BI7A 4LS2A 4FXSA 1A5BA 4IPJA 4UFMA 3TROA 2ZTKA 3PBYA 3L65A 3TR2A 2HS8A 2WNQA 2ZZ3A 4LV4A 1TPVA 5CPNA 4XQ6A 1QMLA 5I3IA 4RKAA 1DBTA 2ATSA 3P7YA 1IF2A 3DHDA 4RZ5A 1YLVA 3DAQA 3DFTA 4JTUA 1F05A 1BWKA 4UFKA 3M5XA 2GQ8A 3GLCA 3DKJA 1ONRA 1SW7A 2BLEA 4TO8A 4RXFA 2DP3A 1PVNA 3M9YA 3PBVA 4CCDA 2ABBA 3QMTA 1YXDA 1AMKA 4N9DA 3W76A 3VCRA 3PB2A 4YMZA 4LOCA 4K8EA 4O0KA 1WAUA 5G4EA 1YXCA 3GYEA 4NJJA 1KBJA 3W7NA 3LCWA 3W07A 5F2LA 1KM2A 2A4AA 4I9AA 3T55A 2ZA3A 3LV5A 4O10A 3NM3A 5G2HA 3SGZA 4O50A 3G1VA 1L6SA 5LNWA 1D9EA 1W56A 5EPDA 3EWBX 4RJEA 5D04C 4WX2A 5F2MA 1XXXA 4N4QA 4Y6GA 4AHOA 3OHIA 2Y62A 1JQVA 4DO4A 5D2WA 3LM7A 1VLWA 3H55A 3QZEA 3L0KA 2P0OA 4EOUA 3NPVA 4BI5A 1QPOA 3E12A 2A5HA 3GNDA 1M5WA 4N4PA 3V1PA 4ZVJA 1TV5A 3C8FA 5DXXA 1SR9A 1SZNA 1QNVA 2Y63A 4AH7A 2ZDRA 2QJIA 3L2IA 3W1MA 4HKPA 3L0NA 2WKJA 1EUAA 5K9XA 1X7FA 4FNRA 2HSAA 3V75A 3NQMA 3W2NA 1G6CA 3STCA 5HR6A 4UR8A 4JYFA 2J9XA 2ZBTA 2J24A 3H54A 5F1UA 5G2WA 3NL5A 3HG2A 5A8GA 4K39A 4GE8A 2H6RA 5D30A 1EWDA 3QF0A 3CIXA 4IMCA 3W71A 2NWRA 1I2RA 4MY9A 4UFIA 5DY2A 2E5BA 3B0UX 1QR7A 3NL2A 5HR7A
chains in the Genus database with same CATH superfamily
1ONXA 4WVXA 2IW0A 3UR8A 2O7SA 3BG5A 4UBPC 4RLIA 3OO2A 4US5A 3FAWA 4ERGA 4UFJA 1VQTA 1MMFA 4FF7A 1KR0A 4NHVA 4LUSB 5HMDA 2CLKA 2G8ZA 1XUUA 3DOPA 3EGJA 2E7FA 4JTEA 3R89A 2OEMA 1T96A 5HK4A 4N02A 3FVDA 1X6NA 4TX9A 3TFCA 1TR1A 1KCZA 3F4DA 4HHLA 1AW1A 1T99A 3DYOA 5BNKA 1NQKA 2CNCA 4MMWA 3BOXA 1L6WA 3ANYA 1VH7A 1NELA 4ES4A 3WH6A 3RJYA 1CI1A 5A3HA 2PBOA 3ARQA 1BRLA 4CNTA 1B0IA 4HOZA 3NO1A 3MS8A 3KEHA 3AS0A 2ACUA 3BVJA 1M9HA 2XN2A 4UZSA 1X1ZA 4B4HA 4JQ4A 1YPXA 3CPGA 1TTQA 4KFPA 2F6UA 4G1KA 1XUZA 3GIQA 4TV5A 3S2MA 4DO7A 2OT0A 3IV3A 4MWAE 1W8SA 5E5CA 1XBXA 3AYTA 1JCXA 2GDVA 3GDKA 3UF9A 4GI9A 3APTA 2RJGA 2J75A 2EKCA 3R25A 3WEMA 2YLLA 1H5VA 1HKJA 1QOXA 3DECA 3SUTA 1QJWA 1WZKA 3EXTA 3VKDA 5HBFA 3WJWA 1XIEA 3OQ8A 4NI8A 2BZNA 1E56A 4GI8A 4MM1A 4DPPA 1O5XA 1BGAA 1J0YA 1GG0A 1KFBA 1GT8A 1LBFA 2VFIA 3ZJ7A 4P8WA 4KFOA 3AMLA 1P1XA 3ZZ1A 1MW2A 1FY6A 2X1UA 4QLJA 3WL0A 4AG0A 3BJTA 4MVAA 3WJZA 2HPIA 1AFSA 5T26A 3AU2A 3HPZA 4DBWA 3XINA 3R0DA 3GVQA 4P7QA 4DUVA 3YPIA 2NW0A 3FS2A 1V8EA 2JALA 4GYFA 3N17A 4AZGA 3NYDA 1RV8A 4MFDA 3IJQA 5JVLA 1AH0A 3MUXA 1F6KA 4XBSA 2YCLA 3B0XA 1UP2A 3IJLA 2VRJA 3EDFA 3VKBA 1U33A 1LG1A 3TW7A 1W9UA 4GG9A 4F48A 1VHNA 5CCZA 4GNVA 3PSWA 1TB3A 4KF1A 5GNXA 1HJXA 4JDBA 1FP8A 4GCAA 2GPTA 1AA1B 4R9OA 2VFGA 1GPWA 2YL5A 4RDYA 1RSCA 2P88A 2DSVA 4IT1A 2OFJA 1T5AA 4UMAA 3AJXA 1HKKA 1V5XA 5FF0A 1RVKA 1VIZA 2ABAA 2ZZ1A 4XO6A 2A6NA 3GFXA 3L4XA 1W1VA 4O17A 3O0FA 4GXPA 3VGHA 2BNJA 3TSMA 4C1NB 5LGZA 3THUA 5BYWA 3CMFA 5CGMA 5CSYA 2OXNA 3U9IA 1MUCA 5JQ9A 3ME3A 4HU0A 2NXIA 1HJWA 3HFYA 3UFYA 1KFKA 2IQTA 2J6VA 1MDLA 3RX3A 4HK6A 4QRNA 5F1VA 3FHQA 5DEZA 4L56A 2VEIA 3UJRA 3SBFA 3N04A 4ZOEA 4GXWA 3CT7A 1V3MA 3UJFA 3WMBA 3GU9A 4OV4A 4DM1A 3IUDA 5I02A 3AMGA 3GXPA 3TAOA 4ZE5A 3LRLA 4GBDA 5KTLA 4BY3A 5FIPA 5CAHA 1I4NA 1GTEA 3M7SA 5HULA 6XIAA 4Z1BA 3GBEA 4X9SA 1GWJA 4IXXA 3KS6A 4E6MA 5KITA 3UZWA 2B0MA 3MI3A 4FIQA 2JK2A 1N8IA 1P0NA 2DSZA 3PK7A 4O4VA 4AF0B 1J10A 5HOSA 1VHCA 3CUHA 3PFRA 3QQ0A 4AWSA 3MZ2A 2VEKA 5A8QA 4QCFA 4CVWA 4L1XA 4FX6M 3V0UA 1H3GA 1EC9A 3BARA 5KZEA 3FFSA 1K9TA 1ZNNA 4WDUA 4GZJA 1Z32X 1DWHM 4JCMA 4L6HA 5CZSA 2GQ9A 4W7WA 4IQJA 3OBEA 3E0VA 4DQWA 3A9BA 2WJEA 3IUHA 1SM9A 1BXBA 5G5IA 4NNCA 2AL2B 1YTEA 4NVTA 3KVJA 4KW2A 3S5OA 4H6KA 4Z2LA 3A13A 2QZRA 4YS1A 1LLOA 1I60A 3COTA 3QPZA 4IPPA 5J5RA 2E5DA 3W2UA 1G94A 3SSJA 3ENLA 1IIGA 4Q4KA 2ANUA 2Y2WA 3NVDA 3QLLA 1Q7MA 5CPTA 2CBJA 1S38A 5A6KA 1LQAA 5CSSA 4MYXA 4L1GA 2Z2UA 1WBJA 1P0EA 4R9XA 3H7RA 4RNHA 4DRSA 4XV0A 3PULA 4BI6A 2UWFA 3MMDA 3UXKA 3TFXA 4DLMA 2VCAA 2NQHA 3HPXA 3DUGA 1BFNA 1TWIA 4M6UA 2Y7FA 3OG2A 1YNYA 2UY5A 3WJXA 4J3XA 3N4AA 5LNUA 3GU1A 1EJTC 1P48A 1AH4A 3BMXA 3RLUA 4GIYA 5KZMA 5LIYX 1YPIA 1E70M 3M44A 1CECA 3VTRA 1I2OA 4C6CA 2EO7A 4OWGA 1Z44A 4YTQA 3M5YA 3BGJA 3D47A 3RUBL 3W81A 1J11A 1V3IA 1VYRA 3QSTA 1NWRA 5A2AA 4RDVA 3IIPA 1O1HA 3O7UA 4S3KA 4Q8PA 5CPQA 4X9YA 4X0NA 2PD5A 3JU2A 1QWKA 1Z8AA 1IWAA 1UOKA 5F4XA 2GK1B 4OU1A 2PWUA 4CGTA 4UMCA 1LUCB 2OSWA 5FJPA 2O9OA 4XIMA 2OLAA 5CH9A 3ZQ9A 1VFMA 2NX1A 1ZBCA 3TSBA 4NNBA 3BCDA 3H7UA 3VIFA 5LZLA 1OVDA 5BRBA 3KL0A 2ZIDA 3GNOA 2GSEA 4C6MA 5C9RA 1XKYA 3M47A 1RLDA 4NRSA 3MTWA 1ZSXA 1L6GA 1MZRA 4NAFB 4FPSA 4IL2A 5BWAA 4Z1DA 5GVJA 3V4BA 3WBYA 2YPIA 4C6NA 4IG2A 5M1TA 3W28A 3O6AA 1KD0A 3QOMA 3P14A 2YLAA 1IWPA 3IEBA 2PD9A 1TPDA 2FZBA 3BURA 1BSIA 1H1NA 2QUUA 1EJ7L 3VCNA 4CU7A 4MSSA 1PZ2A 4YJ5A 1TJ1A 4CD5A 1V3LA 3G1HA 2E1DA 4OBRA 4INFA 3GRIA 3KTXA 1FWIC 1V02E 3AI0A 4PB4A 4A21A 3EEGA 4KIEA 4D8AA 3KRZA 4DJDD 5DO8A 2XINA 3N4FA 4ZSTA 2C3ZA 1VR6A 1D2KA 2BG5A 2VCCA 2CIPA 2J8TA 4TVUA 4AEFA 3S1WA 2WW5A 1KCKA 4NXKA 4ZSUA 3O16A 4B9YA 1XLBA 1A53A 2PTYA 1H2JA 1JJKA 2YX0A 4GZEA 1BG4A 2FMOA 3GFYA 3QHNA 1WX0A 3LBCA 2YCLB 1FWDC 1TPWA 1IXOA 4WY0B 3CGTA 1E4NA 4WSKA 3W1LA 1W1B1 4MG4A 6REQB 1OYBA 2FB3A 3W25A 4X61A 7XIMA 4IGNA 4ZCWA 4L9XA 2PLCA 3OLIA 3LCFA 4UTWA 1H7NA 4MJZA 1JDAA 3R8HA 2XH7A 4DF0A 4AD3A 1HUVA 1UZDA 2CCRA 3GXFA 4V1XA 4E2DA 1G4EA 2D2OA 2B7OA 3PZUA 1JCTA 1FUYA 1TUXA 4J2MA 2EXOA 3C0QA 4AZIA 5A6LA 1O1ZA 1GYNA 3T2PA 2QKFA 1O94A 1NF0A 2XSAA 1R7OA 1Q5MA 2A0NA 7CGTA 1XG4A 3EA3A 3RIKA 3P6LA 4N9CA 3I65A 2GJLA 4C65A 1J5TA 1HZYA 2VFDA 4WCJA 1DQUA 4H04A 1F61A 2Y5SA 7A3HA 3HURA 2OSXA 2Y85A 3GG0A 4XBJA 5IHRA 3VGFA 3C61A 2BOEX 3CH0A 4HK7A 6PTDA 3PVFA 4MNKA 3G0XA 3HB9A 1AL8A 4L4PA 4RNFA 1Q6QA 3E0WA 4D6GA 3DEQA 2W67A 1PUDA 3K1DA 1XL9A 2B4GA 3LYEA 1B30A 5A8PA 3FK4A 3A4AA 4XTIA 4KCWA 3BAKA 5H8MA 1S2CA 4M1RA 4GH3A 4AY1A 4CCCA 1KFCA 4PUKA 3QH2A 5CZ0A 1BQCA 3GZ3A 4S3AA 1A47A 3WK2A 4AEOA 3GBDA 1QI3A 2V3GA 6REQA 4HZMA 2DJXA 2YIHA 4DUWA 1EJSC 4LANA 3PUDA 2PGRA 4QFUA 4A8LA 1WAWA 3BLLA 3IARA 4AISA 3IAPA 4LRTA 3UG3A 3LHZA 2IXUA 2ZZ6A 1A50A 2F2HA 1XISA 4F8XA 3MPGA 1C90A 1T8QA 3R8GA 1YDVA 1A0DA 1ZAJA 1MEWA 3H23A 1PL9A 4F9DA 2GQ3A 3WLOA 4O12A 1PIIA 3DFOA 2XH2A 4LUTA 3FJNA 3MB9A 2XVPA 4EAYA 1DE5A 1BXCA 2OO6A 4OGZA 4DF1A 1K8YA 4FLRA 2HBVA 3HGRA 4MGGA 4HNOA 2A3EA 3OBAA 2CXEA 3U2EA 3SUVA 2PP0A 5EL1A 3W3OA 1JDEA 3A4XA 1Z41A 2WHMA 3S5ZA 1WDWA 1O12A 3W1NA 3AALA 2WZHA 2PTWA 3WH7A 3VXGA 3W75A 1PYFA 4ZQNA 1WV2A 1YDOA 4QAIA 3LX9A 1E9ZB 2Z0IA 3QKEA 2ZA2A 4JEQA 3LGDA 3VIJA 1IEXA 3N11A 2E28A 5TNVA 3T07A 3D6NA 4JKMA 1QHOA 4PTDA 3W7JA 2PDXA 3LNMA 3OW1A 5AYYA 4D8LA 4RW3A 2BOGX 3UWQA 4U33A 2FZ9A 5T91A 5F2GA 2H8XA 4B90A 3PJXA 3ZSTA 3G1FA 4I5UA 1G7UA 2WSQA 3QHOA 4JAWA 5FI8A 3SCRA 1TV7A 3VGGA 1QASA 1W54A 3C86A 5DMNA 3BMVA 1HGWA 2ZXQA 5D8ZA 1AJZA 1FH7A 3WDPP 1B3YA 1YRRA 3H4GA 4D6HA 1V0MA 3LSBA 3QPYA 4GJ1A 3KHDA 4DXKA 4FS9A 3NQ2A 2CXGA 4KCVA 1TPC1 5IFTA 2X42A 2R14A 1VD6A 5HJXA 3M0YA 4WF7A 3G6LA 2GGEA 2ON3A 2XZ9A 2V6AA 4ZXOA 4A3QA 1DPMA 2VRKA 3PP7A 3WFZA 4DHGA 3WUEA 1Q6RA 1RHCA 3CQIA 4RR4A 4NZ1A 2NUWA 3RR1A 4JR5A 8XIAA 5G2IA 1LRQA 2WQPA 4AB4A 3CXOA 3O63A 3K8MA 3AIUA 3QY6A 1DJHA 1KLZA 4XD6A 1IT8A 4NG3A 1VAHA 2ZADA 4GY1A 3QGAC 5IHSA 5FF3A 1SU5A 1WB0A 1W9VA 1JPMA 4NL1A 1M65A 2TRSA 3WDRA 3WNNA 4FEZA 4GUIA 3A22A 3DXIA 4MAVA 1JD7A 4HJFA 1S2WA 3USZA 3S0CA 4FP1A 3S2LA 1XG3A 4QJ5B 3THCA 3S83A 1FVPA 4Q4PA 1B4EA 4LUIA 5AVNA 3H8AA 3EWDA 4A4AA 3DHUA 3IGSA 1V7AA 3ORWA 3M5ZA 5HQLA 4DWSA 4LH8A 3K13A 3U2ZA 2BVYA 3QQWA 4EVZA 5K9CA 4O54A 4AHPA 2IPGA 2C79A 1XDJA 5D32A 4UQDA 3AWOA 4NASA 4OUIA 3PBUA 4AZ7A 5AYZA 2F8QA 1V03A 1S5WA 4Z17A 3H7VA 3GC2A 2BY1A 3GKFA 2DVTA 1OWQA 3TYBA 4DN1A 3MKVA 1JQXA 5AC8A 5LA0A 3RCMA 1R2RA 2YR1A 1XBVA 1NEYA 1XIDA 3GH4A 5C8BB 3KTCA 1F73A 4L4MA 1S2AA 1SJCA 3LMZA 4RDZA 2PWGA 1RJPA 1WXZA 3HMJG 4J4KA 4EXBA 3ARSA 4R34A 2O9PA 2WKGA 4D9PA 2XVNA 4WHBA 4PODA 1SJAA 4IMDA 4K2SA 4MB5A 3UERA 1WZAA 4Q8TA 3CZJA 3ZOAA 3N2TA 1CGYA 3A47A 4CLMA 3F4NA 1L2UA 1UH2A 1V6XA 3VUPA 2DIKA 4GYJA 2BB0A 4KGLA 1SMDA 3CEUA 1EGZA 4QIUA 4JTJA 2W6RA 4M24A 4HNLA 2W91A 3JRKA 1BXNA 4Q6XA 3GDMA 1W3JA 4Q8MA 3ITYA 4Q8OA 1P6BA 4AX6A 1BLIA 4DZIA 3LCGA 4H41A 3AS2A 4JXCA 1SVDA 1VBHA 3NZPA 1C8QA 2FJKA 4L1WA 3MZNA 4FO4A 3HOJA 1DTNA 4F0KA 2NXHA 2W27A 3RYSA 4K3ZA 4F0SA 5I79A 1P0BA 4I7UA 3SRHA 4JN8A 4QX4A 1B9BA 4JHOA 2HPMA 4O1FA 1Q65A 1W1YA 4U5KA 1EX5A 5CSRA 1MXGA 2J4GA 1ITCA 4WUIA 1RBLA 3O6DA 2A3HA 3TKFA 5IXEA 4IJCA 1ONWA 4ACYA 1QNSA 1T0OA 4JHZA 4XUGA 1Q6OA 1EDTA 3TQ0A 1W2VA 1E0TA 4LVBA 3NQGA 4YCOA 1UJQA 1XBZA 2PZNA 4TMBA 3VGEA 4NY2A 5AECA 4A35A 2HDJA 1C91A 4LPCA 1XRVA 2ZFAA 3GXTA 2ZVIA 4AD5A 2HMCA 2C7FA 5D33A 4U28A 4PYSA 4W88A 1QPRA 4QG6A 2R8WA 2BMBA 1UWIA 2XIIA 1O66A 2XIMA 4CNNA 3TXVA 1CIUA 1AK5A 3L0GA 2FHFA 2X40A 3NQEA 3FYYA 4WGXA 3UNDA 2VZUA 4Q4RA 4AWUA 4ZGYA 3KRUA 4A3UA 3Q58A 4L9YA 2F38A 4Q8NA 2NV1A 4O53A 3W23A 4URIA 2XHYA 3OODA 2C8NA 1YMYA 3PJWA 4LUJA 4ACZB 5REQA 4I9TA 4AF0A 4Q8QA 1IZKA 1IHIA 4EACA 3WBWA 4JY9A 3QY7A 2FPTA 2NQ5A 2Z6JA 2Z00A 3DFHA 2VR4A 3A9IA 4NX5A 1F8MA 4U3CA 1B9ZA 3E0LA 3UPBA 1KA9F 5C2CA 4XAFA 5A69A 5JBDA 5E70A 1UC5A 4XAYA 2FIQA 4ZFCA 3TC7A 1TUFA 3AHXA 2E9BA 4R53A 4JTFA 3LI0A 3JZEA 4UQCA 3E0IA 1N8FA 3M0HA 3G22A 1SPQA 2WNZA 3U2CA 4IICA 2XYLA 1M7JA 2AMGA 1G67A 1H7RA 1MQQA 5C55A 1QW7A 4ECLA 1DL3A 3H2EA 1I75A 4ML4A 3GNRA 1QTWA 2PEVA 3IIXA 3H2NA 2BVTA 4ZB5A 4XKYA 3NZRA 1E1CB 1XLKA 4BWLC 2Y61A 1IGWA 1P7TA 3UY7A 3N73A 2HJPA 2J66A 1RJRA 2WWDA 2YXXA 2Y7EA 2YJQA 1VFHA 3APGA 3P0XA 2IKGA 1R9ZA 1Z69A 3QPEA 2G41A 1UH3A 2G4FA 1MDRA 2RHGA 7REQB 4JY8A 3VNZA 4XG1A 1Q6FA 3EKZA 3RLVA 1EA0A 3B06A 4CQBA 2E6AA 3E3HA 3ZWTA 3VD3A 3MO7A 2VNCA 5D9PA 5A95A 5LKYA 2PB1A 3EX1A 3RCNA 3BLOA 2E5CA 5AHIA 3VAVA 3I6TA 4PMNA 1XGZA 1DXIA 3LTYA 4HD5A 4NZFA 3O15A 3BJFA 4K8HA 5I3HA 1VLIA 3ZR6A 3MBFA 3FA3A 1TCMA 1VFOA 2ODOA 3LBMA 3R10A 1RJQA 2YFOA 4JKLA 1MRAA 3RXZA 3WF4A 3GIYA 4ICNA 1BKHA 5I0DA 4TXEA 2J9ZA 3M16A 2GUUA 4QLKA 1K8CA 3W0KA 3BOLA 4EKJA 2RUSA 4W9TA 2ZUSA 3MUIA 3VNKA 2PU0A 2EEXA 1XLAA 1FWFC 4RNIA 2FH8A 3AIQA 4W85A 2OODA 1JXJA 4JS3A 5IBXA 3OJGA 3PANA 5BMXA 2J7DA 3EB2A 4E4FA 2DSUA 3LHVA 4D1IA 1MW1A 1E4MM 1FFQA 5E0FA 4WEVX 1Q2RA 3GTXA 3OYZA 1FWJC 2ZX7A 2VFEA 1DIOA 1R7AA 2GJXA 2O4QA 3L4WA 1G9HA 1A5LC 1FXPA 2E1WA 3CHFA 1OFDA 1QOPA 2PA6A 5DT5A 3ARRA 1V4YA 4Z42C 3VUSA 3MYPA 3T1GA 1TZ9A 1KO0A 2ZZ2A 2D0FA 1EC8A 3PN8A 2PDUA 4B5SA 3MANA 1WKYA 4MKSA 4GCXA 2YL9A 3DHFA 2ZA1A 1SFLA 4IJBA 4M3PA 4P61A 3PG8A 4HNVA 2BVWA 4J3WA 5HAOA 1B3VA 4FXRA 3VILA 3AZSA 5DMMA 4JGDA 1ZHAA 4L4LA 4NZCA 4MJMA 3GHUA 3ZVIA 4FX8A 3EOUA 1HL8A 3MDWA 3KTSA 2XGBA 3K5XA 3WF0A 3C52A 1FXQA 3ABRA 3PAJA 2CWNA 2MANA 2HK1A 1EEXA 3PPFA 2V2DA 3EPMA 2E4TA 3SN4A 1EBHA 3PAOA 3DERA 2ZKMX 1US3A 3ZYZA 3VNJA 3OA3A 4AU0A 1BVNP 4K36A 1X96A 1YX1A 3DI1A 4U2ZA 2VD9A 2G4JA 3K30A 3N9RA 2QPUA 4Y9PA 2PBGA 3EDJA 1GVOA 3OBKA 2ZE0A 3BWWA 2G3MA 1XLHA 3PFMA 2YA2A 4JN7A 1RQEA 2FVKA 5HDRA 1W91A 3BLFA 4GJIA 1PTGA 4UUIA 4UTWC 5FSDC 5CXPA 1VFLA 4IPIA 5FJRA 1A0EA 4NYYA 3AIVA 3S47A 1JYVA 2D0GA 3DFQA 1S2VA 1XLLA 4PRRA 2PURA 4GIEA 2Q3RA 2ATMA 5B7YA 2OLSA 1QK0A 3MW7A 4JPGA 5AHLA 5ABFB 4M19A 1MZHA 5EFFA 4W5UA 2YCIX 5CC7A 2DGAA 2CHOA 3H2AA 1ADOA 2VZSA 4QDPA 3KUMA 1L9WA 3MSDA 1A5BA 4FXSA 1CXFA 4IPJA 4V1YA 1WKFA 2HS8A 3V5CA 2XH0A 3M46A 5CPNA 3ZT7A 1ECQA 2ATSA 4XSLA 1IF2A 4Q4OA 4RZ5A 3DHDA 1UD4A 3KLLA 2A3BA 1NJJA 3KCLA 3T0AA 1ONRA 3GG7A 2E9MA 1SW7A 2DP3A 3TTQA 3PBVA 4CCDA 4AC1X 3AIBA 3AHVA 4GVGA 3VCRA 4R7OA 4P7LA 4YMZA 1HF6A 4K8EA 4G5DA 2VD8A 5I5RA 1GW1A 2OOFA 5KETA 3LCWA 3VKAA 4GVIA 3MUAA 2DIEA 4JCLA 2F61A 4I9AA 3LV5A 3LY0A 1U1UA 3WD0A 1NWUA 3BTNA 2VMFA 4HCDA 4D6CA 2QPSA 1ELSA 4O50A 3SCWA 1L6SA 2REQB 3EWBX 4S3DA 4WX2A 5F2MA 1XXXA 1Q7QA 5D2WA 1HXJA 1SFTA 3KBJA 4PCPA 2REQA 3SRFA 2P0OA 4MNJA 3WNPA 2EPNA 4BI5A 1A3HA 1QPOA 3GNDA 4ATWA 4N4PA 4ZVJA 1TV5A 3C8FA 1QNVA 2Y63A 2W62A 3W1MA 4JTCA 5I7GA 4XZMX 1GOOA 3CT2A 4FNRA 1M04A 3NQMA 3BAXA 3QV8A 4UR8A 3WLMA 1UMYA 3H54A 3WYZA 1QT1A 1LWJA 5F1UA 5REQB 1BYDA 4H7ZA 4GE8A 1VP5A 3KBMA 1XH2A 3PPGA 1KQZA 4W4QA 1IEVA 4KMQA 4AVNA 1I2RA 3PZTA 3T0DA 2Z1VA 7REQA 2VC9A 3IGHX 1QR7A 3NL2A 2NQZA 4CD7A 5KSWA 1B90A 4P8VA 1YEYA 2XIQA 3DBNA 1EKOA 1VBJA 3FW6A 3IVSA 4GNJA 4BA0A 1YTKA 3CNYA 5H1WA 4OOZA 5G4WA 2QCGA 5C54A 3NEVA 4UNKA 4NJHA 4W87A 4OKDA 3DG7A 2OGYA 2OQHA 4HTBA 4AD4A 1OFPA 3CAVA 1R86A 1KW1A 1LOLA 2X05A 3ZM8A 3EMCA 3CTLA 4FIRA 4MB1A 2XVGA 5JUVA 4S23A 2Q3OA 4O13A 1Y5WA 6ALDA 3LQLA 3LS9A 2Z1BA 4HPGA 4WSJA 4KFNA 4NNAA 4DELA 2BX7A 1B3WA 1C29A 5D2TA 3WNOA 2OX4A 1JZ2A 1GKQA 4GIRA 2PGWA 4GD0A 3A4JA 3PB0A 3T09A 3GVVA 3MJYA 2R1LA 1E0UA 5FEZA 3EWZA 4MNMA 2Q8XA 3AZTA 3TN3A 4GPNA 2X7WA 1BQGA 2BGSA 3ZR5A 5HWNA 1TV3A 2NX9A 1V0NA 1P0DA 3SIMA 1Q6LA 3VKCA 2BODX 3APYA 4ICCX 3WMLA 3VX0A 1W3HA 2A7PA 1PZ3A 3M64A 2ZRVA 5BW6A 5JIPA 2WOQA 4XD5A 1LTDA 3S1GA 5AZ1A 3N4EA 5DBUA 3EMQA 5AN7A 1M7OA 1LOQA 4H7CA 1TPUA 2GQAA 2QJJA 2ALDA 3O2LA 4GQ0A 3NG3A 2Y5EA 1VEMA 1JYWA 4HYVA 3WFAA 1WXJA 2YDAA 1BWVA 3T2QA 3VOCA 1XIIA 4B5NA 2EGZA 3AHTA 2OOGA 2FLIA 2XIJA 2ZWYA 1E5JA 2PTDA 5EBUA 3ANVA 1H61A 3MKCA 3B0YA 5E6YA 4AIOA 1UR3M 1H0IA 3WLIA 3G1RA 1BWLA 5LIKX 1PCWA 1RPXA 2XN0A 5E9AA 2GVEA 3S6TA 3IJ8A 4HSNA 4WK9A 3VOIA 1VF8A 4GLEA 5LGXA 3H22A 1UWAA 2FTPA 2EPLX 1SZGA 2E67A 1WP6A 3RLHA 1EJRC 1FWWA 4P7OA 1OGBA 1XYAA 1OGSA 3ARPA 4TUFA 4JTIA 1W3LA 3W7HA 3NA8A 1RD6A 2VVNA 1WCGA 5IFPA 1QHZA 3EKLA 3CZKA 1A0CA 2VUYA 1S39A 1E6PA 4JTHA 4WJ8A 2WXDM 5HNTA 2ACQA 1QU4A 3W74A 4QSHA 2TMDA 4ZO6A 4TVDA 4DJED 7TAAA 1EXPA 2WLZA 1UA7A 2QCMA 3F4VA 1OF8A 1OBAA 1G4TA 5M2FX 3BK0A 3Q45A 3SSZA 3TSDA 1NOFA 1OCJA 4W7UA 4XISA 1FHVA 1AZ2A 2OCZA 4IPNB 5EY5A 2CLOA 3PF3A 1PKYA 2R1MA 2XGZA 4UB9A 4G2DA 2Z1SA 2Z2BA 7ODCA 4AMAA 1I1XA 2EKGA 1DWFM 5T8GA 4CKQA 4QDMA 4IMFA 2ZTJA 4CCEA 4Z1CA 5LNSA 5D9OA 3CK5A 3VDHA 2NUXA 3AWNA 4E3VA 3I6EA 3ZIZA 4M80A 3ABOA 1EGVA 5FJOA 3LLXA 1KBBA 1JCLA 1M7PA 1A5MC 1ZRQA 1O60A 4PH6A 3GQYA 2VKZG 3NEHA 2WSPA 5C9ZA 4RE0A 1KM0A 3U7BA 2HTMA 3PBGA 3DKLA 2VR2A 1Q4WA 2E8ZA 1LRTA 3I7QA 4HTYA 3NYZA 1L6FA 1WPCA 1YDYA 4NZJA 1SO4A 3PUEA 3VNDA 3ARVA 4MAZA 3URBA 1QNPA 1CENA 3BL3A 4X22A 1DQXA 1DE6A 2C14A 1DQWA 3T08A 4O52A 1F6YA 3OVGA 1EH9A 2H3BA 3WUBA 1RQBA 4LC8A 4DY1A 1R0MA 4S38A 5AB3A 3CV7A 1QATA 3MP5A 2VT0A 3UG5A 4GGBA 4W89A 1DKWA 2V63A 1KB3A 3SQLA 1MEHA 1LBMA 4UTFA 5EGRA 1WDSA 5DLCA 1UKTA 3T9PA 4ERAA 2G3FA 1UIPA 1WUFA 3WNLA 2V5CA 4WQ6A 3NDYA 2BY2A 3FXGA 1KQYA 4XIAA 3WNMA 1ZAIA 1AH3A 2PDMA 2PZ0A 3E96A 4H83A 2E09A 2DT0A 4JIEA 2G37A 1BVWA 3W9ZA 1X1NA 3AYRA 4WJEA 5A1AA 4NI3A 4YNGA 4PMQA 2WVSA 4JQ3A 3EWYA 5CBBA 4IX0A 1A5UA 4AD1A 4GQQA 3GG1A 3S2JA 5IDIA 1UPMB 1BG9A 1X1OA 1AQMA 3TOPA 1O7AA 3LCHA 1OK4A 3INPA 3EEZA 1EQPA 3W2MA 1GZGA 3QY8A 1W1TA 3LM3A 1EHNA 4AZ5A 4E4UA 4G9PA 1DWAM 5EA9A 3MYOA 1HL9A 4GZ7A 3U48A 1ZS2A 5BZAA 2XVKA 3H2FA 1RR2A 1SO5A 4NRRA 1VKFA 4JTQA 2ZRZA 1K03A 2EF9A 1HIZA 1MNSA 4GRSA 1UA3A 2OB3A 1JYNA 4JTTA 3S2CA 1HL2A 3S42A 1XD1A 1PBGA 4J3SA 1BTMA 5A6TC 2CZVA 1EQCA 3SY5A 4JL2A 1DIDA 2R24A 5DX7A 4OJYA 5AC4A 2DZTA 4A22A 2DT1A 3T8QA 4PR4A 3CWNA 1BKSA 4N7QA 3W24A 3VMOA 3LCIA 4PB3A 1ZJAA 4YIWA 1I1WA 4N9BA 3EZ4A 4LV9A 1TREA 3ZT6A 1OSEA 5CZTA 1RQHA 3M0KA 1WDPA 4A8NA 4O18A 4AFYA 3UGRA 1IT7A 4GO9A 5JIWA 3UW6A 1ADDA 1IXNA 4BHYA 3C3NA 1KV8A 1OG6A 1HX0A 5BXRA 4BR1A 4PMYA 4MFEA 2A85A 2Z6IA 3GDTA 2VXNA 1KRCC 5CPMA 1MW0A 1A5NC 3C8NA 1NFGA 4S3CA 3WLHA 1I0BA 3OOQA 5C2XA 2OKTA 3W7KA 1E72M 4CD4A 4MB3A 3LHTA 4KPLA 5DF0A 4H1ZA 3FYOA 1IXQA 2AL2A 3DHPA 1W5PA 3B9NA 4A05A 3R79A 1G7VA 2D3NA 3FNDA 1NDWA 3M0JA 1GGOA 4AC7C 3UWUA 1DJNA 3O6CA 2FTWA 1KC7A 3KXQA 4K38A 3FGCB 2A7RA 4Z1AA 1F2JA 4N6EA 4A8RA 4AAJA 3THDA 4WDWA 1AJ0A 4JICA 4AD2A 2FHCA 2YXOA 3L4VA 2WJDA 2WM0A 2F9RA 2JE8A 1RALA 4HHPA 4R33A 2X0YA 1EOKA 5GNZA 5BOEA 4TR9A 1D3CA 2CPUA 2VENA 2X1SA 3BH4A 4UCGA 4PUNA 1C7SA 2PE4A 2X30A 4L65A 1TQJA 2ISVA 2CWXA 1TYGA 3WLKX 1XGDA 5E6ZA 2J88A 4GINA 1SO6A 2DFAA 4UOZA 1P6WA 3IAQA 1KTBA 4I5RA 2GSJA 3TW9A 4B5XA 4EXQA 2G3IA 4GH1A 2J79A 3AISA 1YNPA 3WK3A 3VKKA 1EP2A 1DXFA 3F03K 4UFLA 3GR7A 3TVAA 1AG1O 4GIAA 4LCRA 4LYRA 1XLIA 3C3UA 4I9JA 3GG8A 4JIQA 1I2QA 1HJVA 4IP5A 3OLEA 3A3XA 1NARA 2B7QA 2EJ1A 3MV01 4H7VA 1KGXA 3R6IA 1OFOA 4PCFA 3KE0A 2PMQA 1FWCC 3H26A 4EAMA 4RPQA 5CC3A 2P50A 4UQEA 2PRHA 5CSUA 3AOFA 2RDTA 1V6WA 1UBSA 3LERA 4EXAA 1NSJA 5I00A 3LHYA 3GXNA 4IXHA 4GY7A 4LBSA 2YDRA 1F8IA 1PHWA 2I57A 5B80A 2HXTA 1EF3A 1XKJA 3TW6A 2G5WA 1XJBA 4LYPA 2ZUUA 1ZCOA 4FXJA 4ZOBA 5I6SA 1DJGA 1V0KA 4MUPA 3MJMA 4LFYA 2VC5A 4W93A 1TPB1 1VFFA 1JFXA 2JGQA 1SZEA 1ENUA 2J7CA 5T9CE 2RGMA 1EO7A 4PA8A 1PWLA 3IJ7A 2J77A 4GKLA 2V2HA 3W1RA 1B5TA 4E38A 1T40A 3IK2A 1JPDX 2VX6A 3GDLA 4UQBA 3EWUA 4QS6A 4DO5A 3OA5A 1FDZA 4ATDA 4LAOA 3ONCA 4WR3A 2Y89A 1GYMA 2PWFA 2WMHA 1ICSA 4HN8A 3KFTA 3C2YA 3RRAA 1YBQB 1ZLPA 4RNJA 3W2LA 1DVJA 4IP7A 4CQ8A 5K4ZA 3VO0A 1T41A 2CETA 4CN1A 1YDNA 1E6QM 3UA3A 2CYGA 2ZUWA 3L66A 4K37A 1L0PA 2ZYFA 4M29A 4C91A 3RPTA 1VGAA 3OVQA 4LAKA 3A23A 1CDGA 3QGKC 4UTUA 2OWWA 5AHFA 4ZFMA 3C0JA 4CQAA 3EX4A 3RU6A 3LXBA 2QCLA 3R11A 3E5PA 1R6WA 3NL6A 4GFIA 1TKKA 1JPKA 3LCLA 4XK2A 1PIFA 3QFWA 3TTOA 3CQHA 3RU8X 1W3TA 2AAAA 3NQVA 4HMNA 4PRWA 3S5YA 1XIHA 1FCVA 2J8FA 1M7XA 4LTSA 4RXGA 1GJUA 3RFAA 1Y0EA 3CLMA 4N6FA 3LV6A 5HNRA 1LWIA 3G0UA 1PE1A 3UZYA 2QVNA 4QROA 1KFWA 4PBGA 3NM1A 1S3HA 4DIAA 3MHGA 4JIHA 4XVEA 1BF2A 4FNUA 1A4LA 4MLJA 3SCQA 3KRSA 2J6XA 3VDAA 3AYVA 4MKVA 2CLFA 5GJMA 1OCNA 2VRQA 4NJGA 1KLYA 3RO6A 4HNTA 2IUZA 3VOGA 9XIAA 2UY3A 3CQ0A 1OIMA 4JFUA 4HPXA 1J0KA 2PDCA 3OGVA 4JL1A 2P8BA 3TE9A 3W22A 3P84A 4NP7A 1ZCCA 5FESA 2DJLA 1XINA 1OB0A 4N0RA 3WQ5A 1EPVA 4ZQMA 2E6FA 2CITA 1AQFA 4FOKA 4B3LA 2E77A 3W02A 4X3ZA 4FR1A 2JKPA 4IFOA 3RHGA 1PHQA 3W53A 2CZEA 1XDLA 1RD5A 2FZDA 3WLPA 4S2CA 1L8NA 1F3XA 3LGEA 3NPWA 2F84A 3LOTA 3QRHA 3WQ6A 3BPWA 4H9MA 3CU2A 3O9NA 4HGXA 3TQPA 3P5YA 4M5PA 1EL3A 1F4HA 2DIJA 3VNMA 3BLDA 1U5HA 5DANA 4QE4A 1EA9C 3K4DA 3KVKA 2WNWA 2WNNA 4QLLA 3TIMA 2GVGA 1ZAHA 4WOZA 3U3HA 4Q7IA 1CB7B 4S39A 3MWCA 1H60A 5BU6A 4P7NA 4PEEA 4QAWA 1VEPA 4ZL1A 4UQ9A 3W6MA 3WN6A 5JBEA 4WKHA 3CH9A 1PKMA 2Y8UA 1SW0A 3FLUA 4GVHA 3T78A 2C16A 1YKWA 4OE7A 3REQB 2WC7A 2GGGA 3DX5A 3QJAA 1DTUA 1YADA 1DXEA 3MMUA 2ZE3A 4QCEA 4LBUA 4KRTA 3W1TA 2NLIA 1ODZA 1OGGA 2D3LA 1KGWA 3SECA 4MF4A 2V8ZA 5RUBA 1J2WA 4KWSA 4L9ZA 5ECVA 3B8DA 3L7RA 3WMCA 5D05A 1FKXA 1NFPA 4HPHA 1ZBVA 1YNQA 1EYWA 3WD3A 3WNKA 1F9CA 3IJDA 1R38A 8TIMA 4HMCA 1CXKA 1M1BA 3G0SA 4DNMA 3N29A 3L5MA 3CC1A 1POKA 2FGZA 2RJHA 4REQB 4OZOA 3C2RA 1BHGA 2Y8VA 4I5XA 1KXVA 4O14A 1TPEA 1FOBA 5EMMA 2I1OA 1HVXA 3U7VA 1AD1A 2C1IA 4FNSA 1V3HA 4EPBC 1RY0A 2PDYA 1EWEA 1GVSA 2PWEA 1W5OA 4K6AA 1TQXA 3T2OA 1JNDA 2J25A 5CPLA 3WENA 3M0ZA 3EB4A 4K68A 3KX6A 1AW5A 3VNIA 5ENLA 1PCKA 2PF0A 1E1CA 4BQ4A 1JFHA 3GM8A 3TLLA 2YW4A 1SJDA 2DT2A 3TYEA 3A21A 1ZU8A 2IPJA 2IXVA 3FYPA 3ARXA 3WLJA 4GA8A 2V5DA 1JIBA 3G1XA 1JCJA 1FKWA 1LRNA 1VS1A 4Q33A 1TRDA 2J8GA 4XKYB 1NAL1 4OQVA 1XH0A 1EZ2A 1WDQA 2CEQA 4H9XA 1C3FA 1IGSA 1TVLA 3GFZA 2FPVA 1RZMA 5MF5A 3S5NA 1TMLA 3ES7A 5G1TA 1NIUA 4AQLA 3BZGA 3MSRA 1XYZA 4GO8A 4H8UA 1NFBA 1ODUA 3HV8A 1UKQA 3BV4A 1J96A 3XIMA 4AZCA 4MKNA 4D1JA 2I5GA 1LF1A 4YTTA 1VYSX 5D37A 2I5IA 1E6ZA 1YIXA 3B8UA 4PUDA 3G1AA 5AHMA 3L5AA 2NQJA 2Q09A 3UCDA 2GWGA 3MSYA 4EWND 2YGYA 3NNTA 2Q8LA 2YXGA 2X0SA 1HKMA 3HU7A 4QEEA 2ZOXA 1Q6GA 2DT3A 4EPEC 3QEZA 4U10A 2TAAA 1K02A 3RILA 4TOQA 1JUKA 4IIBA 1W5NA 2VGBA 3MY9A 5D2VA 3N14A 1BYBA 1GJPA 3LLFA 3TJLA 3T05A 2EJAA 4BF9A 2Y70A 1EP1A 2B7NA 1F5ZA 1QVBA 3R0UA 4MTVA 1HJSA 1R47A 1TZZA 3LPPA 3IJIA 4MJ4A 2NT0A 4UTKA 2NV9A 3EWWA 1LZOA 1LG2A 3N6JA 3RN6A 4AIBA 2Q02A 2PDWA 3L4ZA 3QMRA 4B5WA 2PLKA 1UKSA 1EHAA 3G77A 4F0RA 2PDHA 3EPOA 1OX4B 2H90A 3OYXA 2EPKX 3GVWA 4ZO8A 4PTVA 4KWOA 4KEUA 1XH1A 1GOWA 4DX3A 4RL3A 4GWEA 1VFTA 3QV6A 3SN0A 3Q67A 2VGGA 4QTGA 2QJMA 4YWSA 2VEFA 2CKSA 3F5KA 4F0HA 3WG6A 1NU5A 4Q4MA 1TR9A 2FPYA 4F9JA 1H7XA 2QUNA 1XRSA 5BOOA 5AC6A 1JGMA 3L12A 4JN6A 1L2QA 2JFEX 2HROA 1A3XA 2J47A 2E8YA 2XM1A 3CHEA 4GKTA 5DXYA 1ZUAX 2JEQA 4BCEA 3TR9A 4DI8A 3P0WA 4DUOA 2Q01A 4L7ZA 1OX4A 1ICPA 4JQ2A 4PFMA 3R8RA 4ONVA 3MCOA 4O16A 1TO3A 3WQ8A 1VCFA 4FHAA 4PCSA 4RV8A 1EJXC 3RM8A 1QO2A 1JR1A 1LLZA 3S5SA 2XTKA 1SFSA 4I8YA 5IOBA 2CZFA 1R3YA 4MPKA 2NXGA 2OX1A 4PMDA 4LVGA 3EDDA 3S6OA 3LXAA 1H62A 1U2YA 2QGYA 3I7SA 4Q8WA 1AQ0A 1DP0A 2V3FA 1P1MA 1FCBA 2V3EA 3ECQA 3VVGA 3ZT5A 1TCDA 5FJIA 2QJNA 3DBPA 4IQLA 3Q65A 4G56A 1Q6EA 1A49A 3WH8A 4AXKA 5I09A 1TZ7A 3L5LA 3W87A 1UIOA 4MLRA 3TJ4A 2AGKA 2PGEA 4C6LA 3EDEA 4RUBA 3JW7A 3HPFA 1OFAA 3NQFA 4M7SA 1TWSA 5CLTA 3B9OA 1ZGDA 2WSYA 1RK6A 1HO4A 3C4UA 3W82A 1SSDA 1NF7A 3D3FA 3NGJA 1I2NA 2J7FA 4C7GA 3UR7A 2DZBA 3VIOA 2YBVA 5FF2A 3THAA 3VIGA 3C0LA 1I9CB 2J13A 3TH6A 1PX3A 5HNNA 1JAKA 1OC7A 1TE6A 3NJ3A 4DBEA 4UFHA 3URAA 4R85A 1PZ0A 2QF8A 4OOUA 1D8WA 4CQCA 2PWHA 2NV2A 3LDVA 3W1XA 2Y0FA 1HTIA 1E43A 3JS3A 4GVFA 2ISSA 3UJSA 4MZYA 4B5TA 2CBVA 4JTKA 3GNXA 3G1SA 1IYXA 3ERPA 3VD9A 3OIHA 4IQDA 4NZ5A 1TWZA 2PCEA 5AVHA 1UWQA 4Q32A 1JCYA 1J0HA 5CZJA 5M3WA 2ZUMA 3URNA 1E15A 3TN4A 1OFRA 3B9EA 1J8VA 3LB0A 1KRMA 2X1RA 4R88A 3DU0A 1F07A 1GVYA 2MNRA 2WZTA 3T4CA 4HNNA 1FHDA 1LBLA 2B81A 3R7MA 3F2BA 1NOUA 4NAEA 1KRAC 4O8RA 4K1WA 3TZFA 5A8MA 1VCGA 2BV9A 2WHKA 2FDSA 4O57A 1YQ2A 2DZPA 1K3UA 4TVCA 3T8LA 1KM4A 3GTNA 3UJ2A 3B40A 3LK6A 5BROA 4B5VA 5C7HA 2YZRA 4PMJA 3PZVA 1VJZA 1FWHC 1JZ4A 2ZC8A 1K77A 2QDDA 1V51A 4LCSA 1ZENA 2PI6A 4GQRA 1CLXA 4GMEA 1FHLA 1XIBA 3NDZA 3EWXA 4HBKA 2GGJA 3NQ6A 3FDKA 1UYQA 3GZAA 1DV7A 1EDQA 3FIGA 5HQMA 4E5TA 4UTLA 3K46A 3RAOA 4ASTA 5FF4A 4K1GA 2Z1XA 3KDNA 1LORA 1UD2A 1ITQA 3RPDA 1UASA 3CV6A 3TCEA 2HS6A 3PPHA 1IEQA 3UXIA 2CFFA 2BDQA 3WDIA 3I3DA 3S1VA 4J2PA 3LEPA 4HYRA 3AXIA 2I16A 3UD6A 2INZA 4HA4A 3CB8A 3BO9A 1KR1A 3UWZA 3WF2A 1S2UA 4KEZA 1MUWA 5FKYA 1VJIA 5LXXA 5AFDA 1J2BA 1ZJHA 4Y9AA 1B3ZA 1TRIA 3FX4A 1NDVA 2ZX9A 5I3GA 4J27A 1CLKA 3NSMA 1KGUA 4PUMA 4GBUA 4DUXA 2INFA 4DJEC 4E2BA 3HF3A 2PDLA 3E2SA 4QR6A 4ZR8A 1UZ1A 1W1A1 3FSTA 3WQCA 4JHMA 4TX6A 1GG1A 2WC4A 4H19A 3B0VC 3SJNA 1CGUA 2J62A 3N13A 2ONEA 3LA4A 3VM7A 1MXSA 2I9UA 2UY4A 4F66A 1GQKA 5G1MA 2VFFA 3A5VA 4LS2A 4UFMA 2ZTKA 3PBYA 1C93A 3TR2A 1GOIA 2W63A 2WNQA 4G6CA 1E0XA 4LV4A 1NWSA 2QIWA 4XZIA 1VPYA 1DBTA 1ISYA 3GH5A 3VCCA 3DAQA 4GNKB 1XPGA 4PSRA 2DH2A 4UFKA 3M5XA 3FVMA 2BLEA 4TO8A 4IHCA 1AMKA 3GHSA 2D22A 5HA7A 4UR9A 4ZE4A 5G4EA 3ITVA 2FHBA 5LIWX 3GYEA 4XO7A 3A12A 4MJ2A 4QGCA 3EOEA 3T55A 2ZA3A 3NM3A 5G2HA 3VM5A 4A3YA 3MV11 4IIDA 1J0IA 3VNLA 3SGZA 1E40A 4GHRA 4HJWA 4KEMA 4BEUA 1D9EA 5LNWA 4RJEA 4DJEA 1JF5A 1OD8A 1XRFA 4A3HA 3QR0A 3OHIA 1KWKA 2YB4A 4LALA 5XINA 3ISIX 3QZEA 1POJA 1D7FA 3ZXWA 3E12A 1M5WA 1Z3NA 3EBVA 4O0QA 3LPGA 2OYLA 4AH7A 3WQVA 3BXWA 4ZA0A 1HJQA 3W26A 4FR6A 1TFVA 4OVXA 4QJ4B 4DZAA 3UCQA 3W2NA 2GZXA 4LSBA 1J18A 4HSHA 4Z2IA 2J9XA 1UD6A 4DAIA 2ZBTA 3RO8A 2J24A 1OC5A 3KP0A 5A6BA 3W29A 5G2WA 3VPLA 3HG2A 3TEVA 3UVAA 3IJ9A 1M03A 3SRDA 2NWRA 4MY9A 4UFIA 1UOZA 3CO4A 3B0UX 4KETA 4WKFA 5DMYA 3R2GA 4H9TA 2C18A 3FXYA 3AHZA 4PBFA 4D8ZA 3WELA 1ESWA 1HKVA 1MRQA 5CQ1A 3SB0A 2F7FA 2WC3A 2Y24A 3W27A 5F7UA 1XFCA 3P62A 3P80A 1YHTA 1R85A 4JQAA 3SCSA 2NVAA 3P93A 2EHHA 3FKRA 2GUYA 1ITXA 4DEFA 3F5LA 1H5YA 4O11A 2O92A 2W5FA 4QBXA 2BGNE 2WPBA 1HKIA 5I23A 1SSGA 1YXYA 1MXDA 2JKEA 3AIEA 1DJIA 3CQJA 3DC8A 3M4HA 3P74A 1K7XA 2ZRWA 3SCTA 4C6PA 2L5HA 3G6MA 4ERIA 4BFAA 2YSWA 1ZB5A 2QMJA 3PTKA 4NUWA 3WL1A 5I3JA 4RE3A 5F4WA 3O0KA 1JYXA 1EBGA 4F0MA 2OZTA 4BWLA 4CNPA 2H3DA 2WSKA 3CWOX 3B8IA 4M6VA 1CCWB 4NILA 1R2SA 4KS0A 5EMKA 1UUQA 5L9FA 3BAYA 4KESA 4KWUA 3PZNA 3W7CA 4PEKA 2QR6A 4NAEB 4R3UA 1Z6KA 3L4UA 1RXOB 3NVTA 4QQ3A 1TMHA 3S1UA 1FWBC 3MSGA 3P8JA 1EGMA 1OG0A 4KKXA 3QYQA 1SZFA 3UGVA 4QNWA 1N55A 3TJIA 1THFD 2OYKA 1GOQA 2VDGA 3AXHA 5CAKA 3NO3A 5AYIA 2VR5A 3W1QA 3P3BA 3VFCA 1MEIA 2QULA 1LCOA 4LT9A 2OT1A 4MZ1A 4LS1A 1S5MA 3TX9A 3RMEA 4G8TA 1DWIM 1ZY9A 1D7KA 1ZP3A 3T6CA 4I7VA 4HMDA 1B4KA 3WBAA 2AGTA 1CW2A 3FDGA 5FOOA 2D0HA 1TTJA 3EOLA 1OK6A 4X60A 5J8LA 5FAGA 4B2DD 2NVCA 5ABFA 2HQAA 2A6LA 5C9WA 5K2ZA 3E6EA 4YVVA 1KXHA 4Z0SA 1N7KA 1H1YA 3N25A 1NDZA 4JTGA 4R7JA 1AL7A 4ICMA 3IK4A 2QDGA 1KM3A 1M6JA 3BW3A 3C56A 3GW0A 1XCXA 2QCEA 3PZMA 1IT0A 2Q8ZA 1HFBA 1OF6A 1XSKA 3ZLHA 4M82A 4LS0A 1TWDA 4B9ZA 3MP4A 3W7RA 2P0IA 1NH6A 5MKGB 3N19B 2ESCA 1N82A 3TTSA 1YTDA 4H2HA 3GKAA 3LTPA 5CJNA 3OLDA 1W32A 3O1NA 5LNRA 4MWAB 4LEFA 3O6YX 3GTHA 3GD6A 4OTKA 3KDOA 2WZEA 2MUCA 3LTSA 3RM4A 3GUGA 4RZ4A 2NQ9A 2DORA 2HWGA 1TG7A 4O1BA 5AKQA 3NZQA 6TAAA 5AYXA 1MQRA 1X7IA 2Z7GA 8XIMA 3URQA 2P1FA 1SJBA 3FN9A 3VA8A 2WMIB 3UU0A 2VURA 3ZJKA 1SUXA 1CTNA 6A3HA 4M1BA 3HN3A 3CZGA 1TX2A 1DOSA 3BAWA 2CLHA 1DHKA 1IXPA 1ALDA 4DVOA 5DN1A 1GORA 1E0WA 2O56A 1J12A 3S8HA 2O9RA 1I0DA 3HGSA 2BBFA 1HO1A 1W1IE 3LLDA 2RAGA 1WA3A 2Y6ZA 4ZB0A 3N9KA 3ARUA 1Q6DA 3XISA 3B4UA 4KIRA 1IWBA 4FOJA 5K9DA 4YWIA 3KOXA 1P4CA 1UJPA 4C6FA 4QG9A 3H2OA 5GNYA 4Q8VA 3VGDA 5E93A 1Z89A 3F4WA 4M56A 4F0LA 3NIYA 4ZMGA 3MKKA 4A6GA 1QNOA 1RLCL 4Y2WA 1VYPX 4R27A 5HNUA 4W5ZA 1J79A 2CESA 5EU9A 2NSOA 1H7OA 1WNOA 1Z9AA 2F6KA 3SI9A 1UD3A 3N2MA 1MO0A 4CNOA 4FNTA 4TX8A 1AW2A 5BRQA 4CN6A 1GHRA 1WE5A 2HNEA 3AMKA 1MNZA 4CD6A 1E1EA 1FH9A 4WLCA 1ISZA 1Q2SA 2XM2A 1FDJA 3WQGA 1XLMA 2FFIA 2HE8A 3W6YA 4RPPA 5HUPA 1U1HA 3GSMA 4NX0A 5FL0A 3N2OA 4IG2B 3W7LA 1TV8A 1HKWA 3MCNA 5AY7A 4AVOA 4L61A 1W3IA 5EMJA 5LA1A 4MYAA 3WK1A 1CXIA 2ZRYA 4LGXA 5DCEA 1W0MA 2IMRA 2OTDA 1JXKA 2HV5A 5U7SA 3QBUA 3BUVA 1GHSA 4DM2A 1PWMA 2FZNA 1XYBA 1JRCA 3DGBA 3B05A 3VD5A 1HN1A 1DJYA 1TA3B 3SDOA 4H9ZA 3I3BA 4K7YA 3HPAA 3V16A 1HW6A 3GYCA 3ZWSA 2YA1A 4AEEA 1UR1A 4HZ8A 8RUCA 1ZQ5A 2H9AA 1W9XA 3MUCA 4MOZA 5AHEA 4UTIA 2A3AA 2EPMX 2DZWA 1JF6A 2D2GA 2OGJA 3AS1A 3VMPA 1G5AA 5A6AA 3BW4A 4GQGA 2C91A 2NLYA 2HK0A 1SYTA 1EDGA 3SUSA 1OQFA 2YCJA 1T8XA 4JNMA 4F2TA 2R1KA 2Q6ZA 5LSMA 2WSRA 1GQJA 1UP0A 3SADA 3K4WA 3HJEA 2AKZA 4XD4A 5IBXC 3T0BA 2Y1HA 3GAKA 4XZWA 3VYLA 1CGVA 4WY0F 3EXRA 2QUVA 4DF2A 1O5KA 5MHBA 1Q63A 1QPNA 4DJFC 2NUYA 3RX4A 2C1HA 3JR2A 1RCQA 1XV8A 3TMQA 4MHBA 1GVFA 1R3VA 5CZKA 1KCLA 4AZBA 5D2XA 1EC7A 2INEA 4EK7A 1REQB 1IR1A 2GVYA 3HQPA 2C13A 3UWEA 4KCUA 1OABA 1W1ZA 2V68A 1AZ1A 5G4HC 3SY8A 3HG3A 4U5IA 3SURA 6TIMA 4PMOA 1J5SA 3HGOA 3MP3A 3P2VA 4NIRA 4KGJA 1NP0A 2DEPA 1JGIA 1XLEA 3HQ1A 4HSOA 4JX6A 1DWJM 2V81A 5I3FA 2Z1WA 1GNXA 4D72A 4LW7A 4HK5A 3F5JA 3J7HA 3E74A 4PTNA 4POCA 5C9XA 3RPMA 1I2PA 4YHEA 2PRLA 3B03A 1MFUA 4WJXA 1DORA 1CXHA 2UZ9A 2ZWZA 3GUWA 3NGFA 4DI9A 3CV2A 4ROPA 2X2GA 3DCPA 2CU0A 2JF7A 1K9FA 4BJHA 4C6KA 3SCPA 3W4RA 4UTTA 3L4YA 3CHVA 2JEPA 4LXFA 3GVGA 2OJPA 3PTQA 1UPPA 3UYIA 2YDQA 1QRQA 3HA1A 2ASHA 2CERA 1FQ0A 3DZ1A 4P5UA 4CQ9A 1S5TA 4I9MA 1H7PA 1BEUA 2PS2A 5KINA 4O19A 4KH2A 2BFGA 4H6QA 3PZIA 5XIAA 1BD0A 1KBKA 1V0LA 3QLDA 3CTTA 2GGHA 4D6FA 2EG6A 1XLFA 3G1DA 3IWPA 1JPIA 1I45A 4DPQA 4Y9OA 3L68A 1H1ZA 2X0HA 3U0HA 4XKMA 2BSLA 3AAMA 3O8AA 3TYDA 3NXFA 2WYSA 2PWVA 1E0VA 5HMEA 1ISVA 2VDIA 1QOQA 3KL3A 2LLEA 1LOSA 1E9IA 1PXGA 4ZQOA 3QKZA 1FCUA 3TUUA 2PWDA 1HVQA 1FWEC 4H9UA 3VU2A 3WDHA 1JPHA 4PMZA 3W2KA 4Y90A 1OM0A 3MI6A 3DFPA 4LNCA 3CM4A 3TXZA 5HINA 1KM1A 2C19A 3WSUA 2D73A 4J28A 3QVQA 4QE5A 3A3WA 1L8PA 3GE7A 1CBGA 2QV4A 1NM9A 2GDQA 4LU0A 5M17A 2AKMA 2PDKA 2P3ZA 2W92A 3F1QA 1CX9A 1R46A 2E6YA 3UG4A 3BLPX 2FGLA 3KOYA 3HO8A 3IPWA 3NQAA 4OHQA 5KMYA 3ABXA 1XC4A 4QITA 1J93A 2XWEA 4GY0A 2OYMA 3KOFA 4O0ZA 4BQ5A 1A5OC 4MB4A 1E9YB 5A2BA 5CGQA 1GYLA 2YB1A 5A8NA 3M0LA 4HT3A 3VIKA 4EPKA 1KFEA 3MCMA 3VGBA 3KZPA 4A2SA 4J35A 1UROA 4LBRA 2PDBA 3W38A 1NP2A 4IF2A 2OVLA 2QCHA 3FCPA 1VJSA 4GI4A 2QMKA 3HJZA 1WXYA 1XIFA 3R94A 1FCQA 5D02A 1XHGA 4PMRA 2OO0A 3CUJA 3ITTA 1KV5A 3ALFA 5AC7A 3WZ0E 4PC8A 2XIOA 4JTSA 2QEZA 3A3HA 3GDBA 4RW5A 3DN5A 5DFAA 5D9NA 3S9IA 3H12A 3SCVA 3WLLA 2OZ3A 1FWRA 1KCXA 5BRPA 4E3TA 3A24A 4LYKA 5IDZA 7TIMA 1PV8A 1SO3A 4QJ3B 3ATYA 1E4LA 1MW3A 1W5QA 1EUNA 5JMUA 2E0PA 3REQA 4DXVA 3VX1A 1JDFA 3VZZA 3VIHA 4J40A 3QW4B 4JYDA 4ENLA 1W3KA 3T0CA 4E8CA 1OT2A 5FJTA 1E9LA 1GQLA 2XISA 1PYMA 1S2TA 4P8XA 4ADUA 4MPQA 3GTIA 3E2QA 2OQYA 3UYCA 5ABTA 3ZFHA 2OSYA 4M81A 3VC6A 1GW9A 3WLTA 4DZ5A 3E49A 4AZCB 3I68A 4H9YA 1DWGM 1W37A 3QC3A 4S3BA 2JQXA 2ALRA 2ZZ7A 2X41A 4JQ1A 4Q22A