3QZ6A

The crystal structure of hpch/hpai aldolase from desulfitobacterium hafniense dcb-2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
259
Chain Sequence
b'AMFLKKKLSAGKSVVGTMLNLVYNPDIVRIYAEAGLDYFIVDCEHAAYTFREINHLVSVAKNAGVSVLVRIPQVDRAHVQRLLDIGAEGFMIPGVQSAETMRETVRLAKYPPLGERGVGGSIVTDFKPVNWAEWVQERNDEIFIMAQIEHVKAVEDIDSILAVQGVDAVIFGPRDLSNDLGIIGQTEHPKVYECYEKVYRAADRQGVVKGFFTAADAAKMGWAVERGAQMLLWSGDVAALQTYTAKGVKTIKELPGFNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HpcH/HpaI aldolase
publication title The crystal structure of HpcH/HpaI aldolase from Desulfitobacterium hafniense DCB-2
rcsb
source organism Desulfitobacterium hafniense
molecule tags Lyase
total genus 83
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3qz6A00
4QG6A 1T5AA 1GGOA 1OQFA 1AQFA 4KS0A 3HQNA 1PYMA 3QV6A 3SRHA 4QG8A 1F8MA 3I4EA 3ME3A 3KTXA 4B5TA 4YNGA 1O68A 1DXFA 3SRKA 3EOEA 1M1BA 3N25A 2KX9A 1ZLPA 4KCUA 4YJ5A 2VWTA 3P0XA 3QLLA 1MUMA 4ROQA 4G1NA 1ZJHA 4RPPA 1OY0A 2HJPA 4HYWA 1U5HA 2V5KA 2ZE3A 1IGWA 3M0JA 3QTGA 1F61A 2BG5A 3HQPA 4DRSA 3GR4A 3IS4A 3QV8A 3OYXA 1UJQA 4KCVA 2VGGA 3E5BA 4LSBA 1VBHA 1IZCA 2L5HA 1PKMA 2XZ9A 4KCTA 1A49A 1F3XA 2QIWA 2VWSA 1U5VA 2E28A 3QV9A 3SRDA 3B8IA 3LYEA 3KHDA 4QG9A 1PKNA 4FXFA 3E0VA 3MA8A 4L9YA 1KC7A 3G2GA 3QZ6A 3T07A 3U2ZA 3FA4A 3QQWA 1S2TA 4IQDA 3OYZA 1SGJA 3T05A 2HROA 3EOOA 1PKLA 1DXEA 3T0TA 1E0TA 5TAOA 1O66A 4MG4A 4B5WA 1O5QA 1F3WA 3BJTA 4KCWA 3PP7A 1DIKA 3QV7A 4L9ZA 1A3XA 4WJ8A 4QGCA 1S2UA 1DQUA 1XG4A 4B5UA 2XDFA 1S2WA 3EZ4A 1A3WA 3BJFA 4IMAA 4B5SA 4TV5A 4IP7A 2OLSA 2XZ7A 1F8IA 2VGIA 4TV6A 3VAVA 4IQEA 3SRFA 1XG3A 2DUAA 4JPGA 2G50A 4FXJA 3E0WA 3OQ8A 1E0UA 4MF4A 2DIKA 3HQOA 4KRZA 3M0KA 4B5VA 4B5XA 3GG8A 3H6OA 1Z6KA 1KBLA 4B2DD 3EOLA 1VBGA 4L7ZA 2VGFA 1M3UA 2HWGA 4B2DA 1PKYA 2V5JA 2R82A 2HRWA 5JVLA 4L80A 1JDEA 2X0SA 2WQDA 1A5UA 3PUGA 3FA3A 3GQYA 4HYVA 1S2VA 3R4IA 2VGBA 3LG3A
chains in the Genus database with same CATH superfamily
3M4HA 2PP0A 2YCIX 3PZQA 1TIMA 1TE6A 4WY0A 2YBUA 3LD5A 3AXHA 1RAKA 4AAJA 3RF9A 2RJHA 1Q6DA 2EPMX 4OTKA 5MHBA 2QVHA 4KFNA 1UIPA 2B31A 3L65A 3LBMA 4AH7A 3OW1A 4NZJA 1J10A 2QKFA 2D22A 3IRDA 2QJJA 1EZWA 3NOEA 4GQRA 3SIZA 1XLMA 1YKWA 1I0BA 4UZSA 1W5OA 4WF7A 1CXIA 5I3JA 1JFHA 2PDCA 4BCEA 2JIEA 4H9VA 3ZYZA 4Z2HA 3CAWA 2XIJA 3SSJA 3M6YA 3UBPC 3MP3A 2R1PA 4Q4MA 5FSDC 5I2UA 1CEOA 3KOFA 4FNSA 4OECA 3AJ7A 1TWIA 1PJ9A 1KCKA 1X38A 4WKAA 3EMQA 4ZA0A 2P3ZA 3RX4A 3VNYA 3TNBA 2G3FA 4JPGA 3NYZA 3LS9A 5FF3A 5HINA 2XSXA 1EJWC 3QHOA 3R0UA 2DZUA 1PWLA 3E2QA 1N8FA 3WLHA 4Z2KA 1UWRA 3M0XA 1T5AA 2OEKA 3P84A 3LY0A 2H6RA 1V3IA 1JYVA 5D32A 3U3HA 3WLRA 4F66A 5CC7A 5DT7A 1UR2A 1S39A 1UWQA 1R0MA 3W73A 2V2DA 2NUWA 1BQCA 3SRDA 2WC7A 3UY7A 1KCZA 2HXUA 1TV4A 1SZNA 1W3KA 3CK5A 1VEOA 3O6CA 3FK4A 4A3HA 1QW9A 4RX0A 4JEQA 4R3UA 1OGBA 1IR1A 4K7YA 4O8RA 3C2YA 1IEXA 3KS5A 1JNDA 3KFTA 4LUTB 2D20A 4ML9A 4QE5A 3DEQA 3V18A 1F8IA 1IHIA 3ARUA 4Q4KA 3UD6A 1OCJA 2X1IA 2C1GA 2DP3A 1ZBVA 4PGLA 1GG1A 4A3UA 3PULA 4AIOA 2GQ3A 2QCMA 4NAEA 2VUNA 4Y90A 1R85A 5D9NA 3VIGA 3W71A 2YDQA 3O16A 4YTUA 1JYNA 3GTXA 1P1XA 3AHZA 2RUSA 4UFHA 4AFYA 4IICA 2XGZA 3UEQA 4UNIA 1BAGA 5TBOA 2PEVA 4O52A 1V93A 2CNCA 3L4WA 2YSWA 3KCLA 3O9NA 5EA9A 1ZCOA 3GDMA 3LUTA 4AX6A 1EO5A 3E3HA 3HPSA 1PO9A 1E1FA 1QBAA 3ANUA 3I3EA 4JNMA 1EXBA 1RY0A 2C79A 4GMEA 3B04A 1EBHA 3BSHA 4DX3A 2A7PA 4F9JA 2EXOA 3TJ4A 4DWSD 5A6TC 4YCOA 4HK7A 2O4QA 5FOOA 4IQDA 1YHTA 4DBUA 3ZJ7A 1F7BA 1YBQA 1BG4A 4JIRA 1MEIA 1WZAA 3O15A 4WR3A 4D6JA 3BJTA 3QV7A 1UZ4A 3HG3A 3CT2A 3W82A 3EKZA 3BOLA 1R9YA 3WK3A 3S2JA 3DG3A 3G1XA 4Z42C 3EPOA 5FKYA 1QPRA 1K4HA 3CUFA 3VX0A 3TQVA 1E0UA 4NX5A 4GPNA 4HHLA 3TX9A 4RZBA 3WLNA 5HATA 3Q94A 5CSRA 2GLKA 2WQDA 4FA3A 1NF7A 1EPVA 5H2ZA 3ITCA 5I24A 4GX9A 3GXNA 7REQA 4CU8A 1O6IA 5FA5A 3T78A 2AMGA 2PDUA 5CAKA 4XO7A 1DE6A 4M1RA 4WXZA 1ITXA 3HO8A 3OPSA 4UFMA 4FMVA 3O6YX 3S5OA 1V0KA 4N42A 3UXDA 1E6RA 1IWPA 3E5BA 1K6AA 1GOOA 2IKGA 1XIJA 4IIGA 4Y9MA 3BMXA 1XD0A 3OGSA 3F5KA 2WVVA 3AIUA 3JZEA 2GGGA 4AQLA 1W3LA 1G4TA 3WDRA 3WUBA 1VP5A 1FWRA 3W7KA 1I2PA 2QCNA 4X60A 5D9PA 3A12A 1ZAJA 1A5NC 4TXEA 3P81A 2EEXA 2ZRUA 3RGTA 4HNUA 2WOQA 1J2BA 1YW1A 4JL1A 3KTCA 4GC4A 4QISA 1YE4A 1RV8A 3C56A 3P14A 3VGGA 1R9ZA 2BHZA 3CZ8A 1VKFA 3K13A 4ZE5A 5E09A 1XBVA 1Q65A 4NX0A 1DQWA 3AMCA 3VUPA 4HSHA 1HL8A 2NXIA 4CU7A 3FS2A 3IARA 3V4BA 3BSMA 4LOCA 1A50A 3LXCA 2V2HA 1Q4WA 1H09A 3NDZA 1VF8A 4LFYA 3DFNA 4I90A 3G3DA 3WF4A 2YA2A 1YIXA 4YTQA 3VIKA 2PF8A 3WLJA 5GNZA 3ORWA 3BV7A 4H00A 4ATDA 5JBFA 5I3HA 4QAIA 3M5XA 3H55A 2E5DA 3M0ZA 2IS7A 4Y96A 1VD6A 4DI8A 4GC3A 4R7OA 4F2BA 5BOOA 1JCYA 3T7VA 4TQTA 2BY1A 2NW0A 1EJXC 4K37A 1J18A 2P3EA 4Y9PA 4BF9A 4GKTA 1A5BA 4YTTA 3GFXA 2C15A 4UNKA 2OX4A 2FTYA 3WEZA 1FFQA 4FNTA 1OABA 2Q09A 3N15A 1DIOA 4QJ4B 1EPXA 2X0YA 3LPPA 3VAVA 4PMUA 3USZA 1JEZA 3WQCA 1IE7C 4WKHA 3CGTA 3BQ5A 3UG5A 3O0KA 3BDKA 1UA3A 1QNQA 2J9XA 2RHGA 3TKFA 1UKPA 4C6NA 1JG9A 1GYLA 3PWIA 3QHMA 3NQ8A 2ZZ3A 3CZGA 4C6CA 4PCFA 5REQB 4QLKA 2QDEA 3KL0A 7XIMA 3KRSA 4QG6A 3S42A 4H6RA 1SZGA 3S9ZA 6XIAA 1RJRA 5HULA 1FWDC 4WDTA 1B3ZA 2ZFAA 2HS8A 1A5LC 2BGQA 4YJ5A 4UTIA 3NPVA 2V63A 4CN6A 2G41A 4E4PA 4WGXA 7CGTA 3L4VA 5M2FX 3WDQA 2JEPA 3EDDA 3TLLA 1QK0A 5CC5A 4IMFA 4DJED 1XLKA 3BAJA 1NEYA 4GX8A 4GY0A 3U7BA 3ZT6A 3M1ZA 3V35A 2DQWA 2QQ6A 4AG0A 5IFTA 2D73A 4FB7A 2DEPA 2J8FA 5E0FA 3BOFA 2PLCA 2AGTA 4PTNA 3M44A 1BQGA 4EIVA 4CNSA 1K7XA 3C61A 3LQLA 4XKYA 1JI1A 1BKSA 2QAPA 3R0KA 3T40A 3VI2A 4B5UA 3THUA 1GEQA 3H2EA 3VIPA 1NDVA 2XVLA 4PMYA 4NZ5A 1ZGDA 4XIMA 3V5FA 5D2VA 1G4PA 3H6OA 3RPTA 1TREA 2CXEA 3CJPA 4CQCA 4MKVA 1XLAA 1RSCA 5LIWX 2A6NA 3WBXA 2ZRYA 3R79A 4B2DA 1L0PA 3FY1A 2V2CA 3RCNA 4RDYA 1F6KA 1OC5A 3U2OA 4Z1BA 2D1ZA 3TTQA 4GZEA 5D2TA 1HT6A 5G1YA 2DT2A 3IEBA 2P10A 1JYXA 3W1XA 4Z1DA 1ZBWA 4C91A 2H8ZA 1BTCA 1QHZA 2DJLA 4D6FA 2GGHA 5FJPA 4W9TA 1E1EA 1MUWA 3HGOA 1X1NA 4CCDA 1PWMA 2BG5A 5A6LA 2B7PA 1TUFA 5CPLA 4HHHA 4LSBA 1EQPA 3B9EA 1XYBA 1RQBA 2Z1BA 5K3VA 1SFLA 2YYUA 3PBGA 4H6KA 3DC0A 2GOKA 2H3DA 1KD0A 3UWQA 1HO4A 3A9BA 2QUVA 3S2LA 2I7GA 3JUGA 3QR3A 5GNXA 5AB3A 4AEFA 3W7PA 1EA0A 3C5QA 2V3DA 5DCDA 1VYSX 2PODA 3FHAA 4AZ7A 5KSWA 2FB3A 3TAOA 4WLCA 1LDCA 2WC4A 3GXDA 2OPJA 5A5WA 3APGA 4IM4A 2BOGX 3N2MA 3RLVA 4U5KA 3T1GA 4FXJA 3E0WA 3O6DA 1ICSA 4KRZA 3B8TA 1TO3A 5FF0A 4B16A 1WBHA 3RMEA 2FGZA 1FWBC 1I0DA 3L4ZA 2I57A 5IHRA 2J8TA 2NQLA 4WD0A 4J3UA 4HA3A 4JNYA 1Q6FA 1ODUA 1EC9A 2GK1A 3GTHA 2Z6JA 3F7JA 2GDQA 5AVNA 4Z0JA 6XIMA 2CLIA 4QM1A 4QX4A 1NF0A 4IJRA 4D1IA 4JTLA 2A3CA 3L2LA 2EHHA 3T42A 4ZQNA 3WLIA 3MP4A 3MKVA 3NO5A 3CMGA 1TV7A 2XVKA 4XSMA 3UYIA 2FZDA 4IPPA 1I2QA 1JD9A 1RH9A 1XP3A 3H2MA 5FIPA 4LV4A 1YYAA 3ITLA 4YU1A 3U2ZA 4JHOA 4QNWA 4BF5A 6REQB 3MSGA 4PL1A 1A5AA 2QUTA 5HUOA 3E49A 2OT1A 4B3KA 3KCOA 3ARQA 1H1NA 3W70A 4WJ8A 1JGIA 1GEHA 1S2WA 5BRBA 3QR1A 4MYAA 1W1YA 2R91A 2ANUA 2ZX6A 5D9MA 2G0WA 3VK5A 3E0IA 1FXPA 4UQ9A 4NAFA 1B3WA 3OBAA 3GO2A 5BXSA 3N2XA 4ZOCA 3WQ5A 5AC5A 2DVUA 2FB2A 1AODA 4LNYA 3HPAA 2ZZ4A 1W0MA 2G3IA 3IGHX 4HHPA 1O5RA 3T0DA 1YX1A 4LWWA 2HBVA 3ARTA 3MHFA 4O8AA 1H7XA 2JQXA 1OD0A 1OYBA 1UKOA 1F73A 2XPKA 3W2LA 3MPGA 4PZVA 4CCCA 4TTUA 3CZJA 1F3TA 4AD1A 3HPZA 4Q8OA 4KRUA 1RBAA 1TE1A 4JS3A 3FJLA 4BEQA 1KM4A 5E93A 2VI0A 2VJXA 4W86A 1BHGA 4QNEA 1QT1A 1KKRA 3LV5A 3F5LA 1W8SA 4DUWA 4O54A 3ZQ9A 2QMKA 2CU0A 3LCGA 4PTWA 1NIUA 3WQGA 1UH3A 1CI1A 1QPOA 5D38A 1EDGA 2Z2BA 2W66A 4IPJA 4ZL1A 4HB7A 1DWFM 1DIKA 3APYA 4FIQA 5AHNA 3BG5A 2QF7A 4QAWA 1RLDA 2ZXAA 3H24A 4F48A 4DWSC 3BJFA 1S5WA 1XIGA 5DXXA 3GDTA 5A8PA 1IV8A 3BK0A 3M6DA 4O50A 3WLLA 1XGDA 3OIHA 1HIZA 1UWIA 3NL5A 4YHEA 3AMLA 4L9XA 4Y8FA 1PUDA 1J0ZA 2W9MA 4LALA 4UFJA 1PCKA 1JUBA 1GOKA 1E0XA 5AYIA 2DU2A 4LUSA 3I6TA 1IZJA 2CZDA 2Y5JA 4HMEA 3WF3A 1QJWA 2WZEA 3HMJG 1KFWA 1CLXA 1B3YA 2J7FA 2WMJA 1QRQA 2WBKA 3M0JA 1J93A 1YDVA 3U8GA 1E1CB 3GDLA 4MB5A 5IBXA 5H6HA 2G3NA 1JDDA 1OSEA 2QUMA 2XIQA 4LS2A 6ALDA 5AHMA 1JL8A 4Z2LA 1XI3A 3PAOA 4NQ1A 3B8IA 3SUSA 4ZBCA 4J3WA 4CVUA 3BLPX 1WPCA 5LA2A 4EE9A 2XH2A 2CITA 4QEEA 4DUXA 2ISWA 3A5FA 4DPPA 4Q7BA 4EPKA 1ZRQA 2QCCA 4W8LA 1BGGA 4YS1A 2QF8A 4WVXA 2V0TA 5I79A 4FIRA 3O07A 3BC9A 4HCDA 3IACA 4O57A 4N0RA 3E5PA 4IXXA 4BFAA 3UWZA 2AKMA 3DOPA 1K7EA 1S1PA 2DVXA 4BR1A 4MF4A 2X1RA 4GVGA 4FR1A 2G4JA 4G1KA 2GQ8A 2XHYA 3MCOA 2A6LA 4KFOA 2NV2A 1WUFA 1ZB5A 1HZYA 2YXXA 5J5DA 1SFJA 3PJTA 2ACQA 2QV4A 4DLFA 1LL7A 1DJZA 1UOKA 2XIMA 3FVDA 4S3CA 2HK0A 4I5RA 3VD5A 2Y61A 3SRHA 3QW4B 2EKCA 2VEFA 1TQXA 4PYSA 1UIOA 2XN0A 5I5RA 1UUOA 4K8EA 1GVYA 3BMVA 4WQ6A 5CZTA 5EYWA 3KVMA 1C29A 3P5ZA 4PCTA 1GOQA 1PKMA 5FAJA 3FIGA 1FTXA 3G1DA 5DEZA 1XSJA 1T7LA 1WX0A 3B8UA 2XH0A 3NAVA 4PMJA 1FKWA 5BU6A 3L68A 3PPCA 4H9TA 4IIEA 4F2TA 1EA9C 2WANA 3GU1A 1ZNNA 1POJA 2I1OA 2OT0A 3T05A 4QDPA 4PR4A 4AX7A 1UP2A 3BGJA 2Y5EA 1TTIA 1BVZA 1WO2A 3W87A 1DQUA 2J47A 3MVTA 3W1LA 1L6SA 3UZ5A 5CLTA 3PJUA 1UKSA 3TWBA 2E9LA 4YVXA 3WJYA 1LWIA 3CUGA 1GQIA 4IX2A 4M0XA 1V03A 3ZSTA 1IQ8A 3QLDA 3I4KA 4O0ZA 1JD7A 4D71A 3SUWA 3EDEA 4A3QA 4ZB2A 4S3AA 3CUIA 4AC7C 2JF7A 3PJXA 2TMDA 4JFVA 1XCWA 3OBKA 4C1KA 4DZAA 1XH0A 1NTHA 2CERA 3QQ1A 1R9XA 4D2JA 5G2HA 3CZKA 4LCQA 3CHVA 5CBIA 4YCPA 4GYPA 5D03A 3UFYA 4PTXA 2PTYA 4ADTA 1NARA 4MWAD 2XISA 4EX4A 3S5NA 3LENA 3ZOAA 1XLGA 2ACRA 3N17A 7TAAA 1HFBA 2XN1A 2WWDA 4GK8A 3AISA 2NX3A 1O4UA 3WQEA 2CLLA 3GSMA 4QEHA 5C7HA 4FNRA 4KGLA 4RW3A 4TR9A 1UJPA 4TMCA 3KDOA 1P4CA 2QJMA 5T9CE 2QCDB 3ABOA 2FZNA 4JN6A 4O16A 4XVEA 3S5ZA 4DJEC 2VEPA 4A8NA 4N2YA 2EPLX 4HK5A 3CUZA 3ECQA 2QYGA 2OLHA 4FNPA 3IIPA 4FOKA 3D46A 2R9RA 3WNPA 4ENLA 2HVOA 2A4AA 5D2YA 5T91A 3G5EA 4A2RA 1QI4A 5DN1A 2GSEA 2WMKA 2QLYA 1OD8A 3NM3A 3BG3A 4V33A 3ES7A 4DBDA 4GO8A 4Q4RA 5FESA 3G8EA 1LTDA 3PBWA 4AWTA 9XIMA 2QCLA 1HTIA 4EWND 3WENA 4MFDA 1XBZA 4MNMA 3UXAA 4HNNA 3EOEA 1R2SA 4Z08A 5TNVA 3AHTA 5DLCA 3L4YA 3ZVHA 2OZ8A 1SJBA 3N11A 3E0LA 1OZQA 4P7OA 2ZCGA 1OF6A 2BB0A 3IS4A 3NL3A 3QV8A 2Z7KA 2MUCA 2ZRXA 3UVAA 5F2GA 2YCKX 5LNRA 2E6DA 4LRTA 3FYPA 4O1EA 5HMEA 2OEJA 2OO6A 1R30A 1QW7A 1SJCA 1RJPA 3C2FA 3WQPA 1PTDA 3G2GA 1JZ3A 3KOZA 1VFMA 3L21A 2YLLA 4QR6A 5LYRA 2A3BA 1TPUA 3XISA 4XUYA 2Y1HA 1DXEA 1XS2A 3EDJA 5JBDA 1W9BM 5AZ1A 1XYZA 3GIYA 1NOUA 1W1IE 3M0MA 3NIYA 3W7CA 4K68A 1JUKA 4MKSA 4IG2B 3OG2A 2WZMA 5E6YA 3RJYA 1XQKA 4FHAA 1OFRA 5DXYA 3GVQA 2PGFA 4GIYA 1HG3A 3FNDA 4HSOA 4G7EB 2WNZA 4QSHA 1JPHA 3AHYA 1Q85A 4KEMA 4O4VA 1F9CA 1TPVA 1XF0A 5JU6A 1TQJA 3R4IA 4L1WA 2VC7A 1UPMB 1CGTA 1T41A 1A4LA 1GYNA 1BXBA 4XX6A 1PPIA 4CCZA 5FF2A 3JZUA 1LYXA 2YA1A 3B3DA 1RA5A 3N2TA 5BROA 1TA3B 4QCEA 4HU3A 3A9IA 3C0LA 3AZSA 1XLEA 1M7PA 3T0AA 3VO0A 3MHUA 3OBEA 3ONCA 3H7UA 3IGXA 3DBNA 1EFZA 4DXXA 4M1BA 1BWKA 4Y7EA 2ZUNA 2MANA 4TO8A 5EMUA 3BZJA 3LYEA 3HIJA 3TW7A 3GE7A 3U2EA 2B81A 3LXBA 4XVDA 3QH2A 3OHIA 1AJZA 2VKZG 1Y5WA 1ZY9A 1AMKA 3OJGA 2R1MA 3TR2A 1AQ0A 3OQEA 5EFDA 1K9EA 4AD5A 4B4HA 3N3TA 4GNVA 1Q6RA 1JGMA 5J5RA 1ZAIA 3AUJA 2FIQA 4C6FA 1WXJA 2I5QA 3TA9A 1T6MA 4F2UA 4DYKA 3FX4A 2VYOA 3VKBA 4Q8QA 5CGMA 1C91A 1DOSA 5HXMA 3URNA 2RKXA 4FALA 1KBKA 1ZJAA 4RV3A 5D33A 3TK7A 4LVFA 3L0KA 5BWAA 3RYSA 2GSHA 4F0KA 2QR6A 3BVJA 3MY9A 4DZIA 1KBBA 5A95A 3TEVA 3TZNA 1REQA 4OKDA 1GOIA 2AL2B 2YZ5A 3RK8A 1S5VA 4L6DA 1H60A 3VC6A 4EP8C 1QAPA 1VFUA 4KCVA 4F8XA 5GJNA 1EDQA 3GU2A 1TRDA 2XH7A 3BARA 1ZBKA 3AXXA 1W56A 3NQ6A 4XTIA 3WQ8A 3VTRA 3OU8A 2HBXA 2F2HA 1TJRA 3LRKA 3EWCA 1VCVA 4KEZA 4N4QA 3TC6A 2YYTA 4AZGA 4LV9A 5AYBA 2G96A 1HXJA 3WMCA 1TV5A 1L9WA 3V3WA 2REQA 1RUSA 1WZMA 4B3LA 3RLGA 5AYXA 3GG7A 3QY8A 2BY3A 2JKAA 5HDRA 3GAYA 2OG9A 1FCQA 3ICJA 3C3UA 2VRJA 1SW0A 3SCOA 5KTLA 1PZ3A 3OQ8A 1BXCA 2ZUMA 2QJGA 1H2JA 1ZP4A 3LSBA 4FOJA 2FZMA 2OWCA 3IV3A 4HGXA 2WJEA 4MB1A 1LT7A 4BA0A 5GQBA 5FCZA 1LUCA 2PB1A 4JTCA 3NSMA 4NT0A 2ZRVA 4LUYA 1ITUA 4JKLA 4CD6A 8RUCA 1X6NA 3SFWA 4ACYA 4AIEA 1DKWA 3PPHA 1PIGA 4YMZA 4IX0A 2HSAA 1M9HA 4HK6A 3FYOA 4F79A 4RXGA 3S4TA 4XAYA 4R34A 2ZXDA 1XKJA 4ZENA 3PWAA 1J96A 3WELA 3SIMA 1W17A 2RAGA 4HU8A 4RCXA 3VNKA 2I5GA 2D3NA 1B90A 4C6QA 4P7LA 1F76A 3R6IA 1S46A 3CT7A 4NJIA 1H50A 3R11A 3B4YA 4JY9A 3VFLA 3A47A 3TP4A 4E0CA 1JAEA 1NWSA 6CGTA 3ARYA 5DY3A 3YPIA 3I3DA 1A0CA 1H7RA 1MEWA 4JL2A 4H19A 2BMBA 4S3KA 4DQWA 1QI2A 4IIFA 1I6NA 4J3TA 5EL1A 3A4XA 1GORA 1C9WA 4H4IA 3CL6A 2VFIA 2OQLA 5BU9A 4J40A 1E0VA 3WIJA 5F4WA 3II1A 3DHFA 1UC5A 3CV2A 1RCOB 2A3AA 4UUIA 1ISWA 3UNTA 1BEUA 1KR0A 1V6VA 3PTKA 4J3XA 3C8NA 1XXXA 3MUZ1 3KXQA 5CAHA 1YTEA 4Q33A 3G1YA 1EH9A 1OFBA 2YCLA 3NL6A 5HAOA 2P8CA 4NJHA 3IJLA 3B8DA 2OGYA 4JTHA 4K1WA 1SPQA 3B9NA 4MSSA 1Q5MA 2DSZA 3SAZA 1ENUA 1EXPA 2QPUA 3IK4A 5H91A 4US5A 2WCGA 5FI8A 1IGWA 4QRNA 4MAZA 5CQ1A 5BXTA 8XIAA 3TYUA 4RLIA 5CZSA 4WXYA 5DBUA 1BWLA 1OGGA 1JAKA 3L66A 1OM0A 3F4WA 1P0NA 3SN4A 1UZHA 2QJHA 2VFFA 1ZJIA 5M03A 1AQHA 4J7RA 3V16A 1R7AA 1EUAA 3AIEA 4DUOA 1ONRA 1VS1A 3Q65A 3VKKA 4H9MA 3SCTA 1QNVA 1EP2A 1D3GA 1SZEA 4DJFA 2J7HA 2FPTA 2VZSA 5MKGB 4U5IA 2ZA3A 3QKZA 1QHPA 4MUPA 5DT5A 4LC6A 4HPNA 5FL0A 4D6EA 3EX4A 2BY2A 3T08A 2Y4SA 3W4RA 3O63A 1MDLA 4IFKB 3RN6A 4F4RA 2H90A 4G7FA 5CZKA 4GA8A 1S5TA 3RUBL 3B0VC 4GUGA 3C0SA 4JTAA 3HGJA 1EP1A 4AD4A 4GJ1A 4LF1A 3NA8A 5SWUA 4M3PA 2X05A 1J0KA 5F2IA 1M03A 4ZR8A 4A8RA 3VOCA 4IWWA 2B7OA 4CNUA 4JTDA 4BWLA 1YPIA 4KEVA 4LANA 3KBWA 1R2RA 4UCGA 3BCFA 1F8MA 3MMWA 5EB8A 3HG4A 3PZGA 1GVEA 2HNEA 4RL3A 1U83A 3SI9A 4OOZA 1LBFA 1XLDA 2RDUA 1MYRA 2DZTA 4ZTYA 3NCOA 1DXIA 2P0OA 3PAJA 4ECLA 4A3YA 3WQ6A 2WMHA 1LCOA 1LWJA 2NV9A 1UD3A 3VXGA 1LOQA 4MNJA 5JXQA 1AK5A 1SU5A 4Z1YA 2NQ9A 1UBPC 3RDKA 4UTUA 3S8HA 3W1PA 4MWAC 4KWUA 1FRBA 1LP6A 3DFOA 3VOFA 2Y85A 1PKLA 4JQ3A 3OIXA 3T4WA 3O05A 4Z17A 2WHJA 1I9CB 4MM1A 4H8VA 1FY6A 1W1PA 4MNKA 4P61A 1XPYA 1KLYA 1H0GA 1TPEA 3NPUA 2WV8A 4IMAA 4U3CA 4GI6A 1UKQA 4OQVA 3E9AA 2G97A 5CBJA 4KRTA 1ECQA 1QCWA 8A3HA 3MQTA 3DGBA 4M5PA 1M7OA 4GINA 3DECA 4OOUA 3M7SA 2VELA 3RLHA 3LMYA 1JQXA 2WB5A 5T8GA 4WOQA 1JRCA 1L6WA 3PUEA 3UU0A 3DU0A 4KWOA 1E56A 2FH6A 1TX2A 4HNCA 3UWUA 3TSBA 3WK2A 3CASA 3TN4A 1DIDA 3ABQA 1M53A 4U3AA 3SRKA 2XM1A 1GOXA 3PBVA 1E6PA 2P50A 1R3WA 1YADA 3NDYA 3EX6A 1E73M 1CXKA 1OJXA 5KZDA 1DBTA 4HOWA 3W6MA 5HBFA 4AHQA 2WYSA 3W6LA 1OHLA 4IIHA 4LT9A 4CKQA 2ZC8A 3GUWA 4ACZB 5JBEA 7ODCA 3QOKA 2C1HA 4CQ9A 1JCLA 1KGWA 2CBIA 3NNTA 5JUVA 2XM2A 1P7TB 3PZMA 3VIFA 3NZGA 1F6YA 2C18A 5AECA 4YXGA 3LA4A 1KFCA 3ITGA 1BPLB 3AS1A 2AMXA 4DBEA 3QEZA 1XH2A 5IBXC 3VM7A 4UTTA 4IISA 3V36A 5CH9A 4IPNB 3RCYA 1ADOA 1Z7AA 2PC8A 1E0TA 2VGBA 4DJDD 4D6GA 1G9HA 3PZOA 4WJXA 4Z2GA 3UJRA 4AMCA 5C5YA 3WLOA 3GKFA 1JVNA 1ZZMA 1TVLA 3W26A 4ZEPA 3KDNA 4X0NA 3IAQA 4L4PA 3S2CA 3AS3A 1ZJBA 1QO2A 4A05A 5I78A 4FEZA 2NSXA 1AVAA 3VABA 2NXHA 1D9EA 4A22A 3VOJA 4BHYA 4JYFA 3FXGA 4IPLA 2OFJA 4GI8A 4LJ3A 2VZTA 1W31A 3MUAA 4GI9A 4B92A 2VNCA 3OB8A 3P3BA 4JCLA 4PE8A 3PZUA 1WP6A 3U7VA 3K2GA 3SBFA 3P93A 3HJZA 3MUCA 4IQJA 5DX7A 1RPXA 3URQA 2ZUVA 3T0TA 3EPMA 2VZOA 4FS9A 1YNPA 3GXIA 2ZVRA 2EJ1A 4GY1A 1EKOA 5LSMA 3R58A 1I60A 3DDMA 3IJ8A 3H8AA 3FOKA 3SURA 1V6TA 4ZO9A 3KBNA 2WQPA 1ZQ5A 1HNYA 4V28A 2OWXA 3JRKA 1EJ7L 2BNJA 3LX9A 1JZ8A 2OZ3A 3EDFA 4Q32A 2P53A 5C9WA 1B3XA 1AQMA 1X39A 4NSBA 4OV4A 1GQNA 1WBJA 3W1UA 3FJ6A 1RHCA 1X8FA 2J6XA 3N2CA 5DMNA 1GW9A 1VJSA 1IIGA 3CQKA 3EOUA 3WDHA 2BVWA 2NSOA 5CSUA 2DJXA 1I75A 3MV11 3QC0A 3HV9A 1WZKA 3ABRA 4BI7A 5HK4A 4QIUA 3H23A 2ESCA 1AZ2A 3QLLA 1P43A 3JU2A 1HKKA 2OR2A 3SCNA 1GOMA 1KQYA 3LHYA 3HZ3A 3OODA 5H8MA 1XINA 2F6KA 3SFKA 1EC7A 2JIWA 1N8IA 2OKTA 2V8ZA 3RCMA 3B40A 3KHDA 3SGUA 4MUZA 1BSIA 1G7VA 4WY0B 5FD0A 3STEA 2H9AA 4HD5A 7ENLA 4PCSA 5C54A 4OUIA 2V5BA 3H4GA 1U1UA 1BFNA 3TXVA 4HOXA 3B9OA 5BXPA 2WJDA 5K2ZA 3ARPA 3NSNA 2X1SA 1Y65A 5A2AA 3L23A 3KRBA 2YB4A 5CJ5A 3KW3A 4V2XA 1W5QA 4GZIA 4Q6XA 3BANA 1U30A 3WLSA 3TW6A 2FTPA 4O1DA 5I09A 1AL8A 1H51A 1WDPA 4ZQCA 4JNZA 1HJXA 3HFTA 1EL3A 1CXEA 1XYLA 3SW6A 4R27A 4KFPA 3TN3A 1M6JA 3QVQA 1OX6A 2HWGA 3DFYA 3MANA 1R8LA 4MPKA 2BX7A 2P5NA 4H8UA 3MP5A 3LG3A 3KBSA 4UTFA 4IH3A 1U22A 4LF2A 2WMFA 4OZOA 1WKFA 1VFOA 2PURA 3QV6A 2YGYA 4O14A 1D8CA 4JD4A 4JKMA 3REQB 1LJYA 4F0LA 2NVAA 3VMNA 3C3NA 1WUEA 5K9CA 1ZLPA 1QOXA 1PXGA 3WF1A 5A6BA 3R2GA 1F61A 1NDWA 3BTNA 3VOHA 2D23A 3D47A 3H2AA 3IVTA 4J4KA 1O60A 4JFTA 3IGSA 3W6YA 3SUVA 2DZAA 1K8ZA 5FJUA 2D0HA 4L64A 1W9UA 3BCDA 1V6WA 4HSNA 3LEPA 3T07A 1C92A 2E4TA 2HCVA 1QU4A 4JCMA 1SGJA 1YE6A 4D6DA 4LW7A 5LNWA 3PTMA 3SCWA 2F7FA 4HIBA 1AJ2A 1E4IA 3B9AA 4MJMA 1E5NA 1OADA 2R94A 4WJEA 5ECUA 1OYAA 1JZ4A 4TV5A 1XDJA 4R7WA 2Z2UA 3GR8A 3CXOA 4QE4A 3AHXA 1HJWA 1ITQA 4EPBC 4TU1A 5HNRA 5BZAA 1V3MA 4P8WA 1SM9A 3GW3A 1OB0A 4V27A 5FEXA 3S2MA 2QDDA 1V6XA 4L6HA 2R1KA 2PP1A 3GXMA 2BGSA 3GTIA 4L6OA 3I7RA 3B0YA 3TR9A 4M81A 3KE0A 3KRUA 1ZENA 3KWXA 3B9DA 2E9MA 1A5KC 3E12A 2B7NA 3T0BA 3B0XA 4GIEA 4IP4A 1B1YA 4KCUA 1DJYA 1PDYA 3GDBA 3T55A 1X7FA 4M6PA 1FX6A 5C2CA 1EJTC 1VYRA 4RE0A 1H0IA 2CKSA 2INZA 4AVNA 3KZSA 4NAEB 2GQ9A 1C8QA 1NQ6A 1F3XA 3SUTA 3QV9A 3VCRA 4HZMA 3WNOA 1P48A 2PBGA 3GIPA 1KC7A 3BJSA 3BPWA 5I23A 2Z1XA 4JTFA 4HZ7A 1BYBA 1VAHA 1FCUA 2J9ZA 4O0QA 4DYJA 1M65A 2Z4GA 3ITXA 5F1UA 3WH8A 3U9IA 4PB5A 4DZ5A 3QFWA 4JTKA 2VR4A 1SJDA 1W1B1 3G22A 1ELSA 2PDBA 1XG3A 3T9PA 3PANA 2PWEA 4LNCA 2OVLA 2A7RA 5LGZA 2Y7FA 2O7QA 1IXPA 1YBQB 5JVLA 2VMFA 3DHDA 2IXVA 2V69A 4S3JA 4WSJA 4HYVA 2D2HA 1A0DA 1XCFA 2PDMA 4I7WA 3A3HA 3G8RA 1GGOA 2IPFA 3N34A 1E40A 3FAWA 1GZJA 4QG8A 3T44A 3R0DA 2C14A 3BLOA 4H2CA 5AHEA 2RDXA 2Y24A 1QFEA 2OYLA 4QITA 3EAUA 2YOCA 1UH2A 5A6KA 3KP1A 5A69A 3DFHA 1TRIA 1X96A 2W62A 1DWGM 1G4EA 4E3VA 3WCZA 4CN4A 5CCZA 1FDYA 2O9PA 2GWGA 1EP3A 3W3OA 1Z9AA 1PX3A 3NPWA 2F38A 4QG9A 7REQB 4YTSA 4MY8A 4AHPA 2CIPA 3DENA 4MPQA 2WCAA 4LQ1A 3R89A 4OBTA 1Q6LA 4JIIX 2FZ8A 5AZ0A 2PLJA 1SO3A 4IFOA 2G5WA 4C6PA 2ZXBA 3VZXA 4ZSUA 2UY5A 1DWJM 1LBMA 3HM7A 3TC3A 1P6CA 3E2SA 5CPSA 5A8GA 1IIHA 3BMWA 5D09A 3QPZA 5H8PA 2VTFA 4UQCA 2DIEA 1TX0A 3R1ZA 2NQHA 3E02A 2WVVB 1OX5A 3TFCA 1H62A 3H12A 3P0WA 2W4XA 3ITOA 3VDBA 1WV2A 2YBTA 2GVLA 3AIQA 4AIBA 1IEWA 3Q4DA 1YXDA 2YL8A 1DTUA 2B7QA 3WG6A 1NQKA 3N14A 4NZ1A 2XYLA 4FO4A 1TPH1 3RITA 3OG3A 1M1BA 4XD4A 3S5SA 2BVYA 1VLWA 3R25A 4NYYA 3H4XA 1ZPTA 3A23A 4C65A 2XFYA 1T8QA 3Q2DA 2XUCA 1D3CA 3WKZA 4RZ5A 3NQAA 2O0TA 1PB0A 4G8TA 3WBEA 1AH3A 2CWXA 1BRLA 3EEGA 2QIWA 1XYMA 2ZDSA 4W8AA 2QS8A 2FKPA 1O94A 1RLCL 4JQ4A 3WNKA 3EWWA 6REQA 1VJZA 3UR8A 1LG2A 3QQWA 2ISFA 4PMXA 2PDYA 4DI9A 3W24A 3WD2A 5FL1A 1EHNA 1QMLA 3NQ2A 1VFFA 1JRBA 2WKGA 1R38A 4KETA 1G7UA 1LBLA 3ABZA 4WGHA 5EKYA 2PDPA 4U4MA 4PRWA 1QNRA 4LPCA 1XQLA 2Q8ZA 1UUMA 2WPBA 3AJXA 4JGDA 1OFQA 1WNOA 1EZ2A 4YVVA 1ONEA 2DIJA 5G2IA 4XKMA 3BQ6A 4ZQOA 3CS2A 1S5MA 3ID7A 2WMIA 5K9XA 5FF4A 1F4AA 3W7MA 2J6VA 4PUDA 4PH6A 4XG1A 2PPGA 3LCIA 1WAWA 2D3LA 1AMYA 2DT0A 1TWZA 1R46A 3R94A 1HKVA 1GPWA 2YL9A 3NO3A 3ZWSA 1JXJA 5HQEA 3QGKC 1XSIA 1CB2A 1VFHA 4M8UA 4IL0A 4AYGA 2TYSA 4S1FA 3POHA 3DYMA 3QHNA 1UJQA 5C9UA 2Y8UA 3JS3A 4DJDC 1NWUA 3CV1A 4WDXA 5I00A 3RRAA 3AZRA 1AW1A 2DZSA 1DWIM 1HP4A 3N4EA 1CECA 3FSTA 5BXRA 4J3SA 5ECVA 3GC5A 1RQHA 3PVFA 4QTGA 3ABXA 3W22A 1V3JA 4QFUA 1XUUA 4REQA 1EIBA 1HW6A 3W01A 5GJPA 1FWTA 3UR7A 4PBFA 2NVCA 4G6CA 1HUVA 1Q45A 2PRMA 1S2UA 9RUBA 1UR0A 1WOAA 4WOZA 1OT1A 2ZYFA 3WN6A 1TZZA 4AISA 3BLIA 4C90A 5EMJA 4ERGA 3K5XA 2F6XA 3WH6A 4DO5A 3LTYA 4POCA 5IOBA 3AIWA 4JR5A 2NVDA 1J8VA 4YIWA 2Z1WA 1NY1A 3ZT5A 4L7ZA 2VX5A 1DWAM 3W7JA 1IEIA 1IEVA 4U10A 1ICQA 5LIUX 3IAPA 1UKTA 3DG6A 2QPXA 4MGGA 4AF0B 4JHMA 4BQ3A 4U28A 1BWVA 2DGAA 3SGZA 4DJFC 1Y7VA 1DXFA 4Y9OA 4W4QA 2EPNA 3EPNA 3WDPP 1RR2A 1JR1A 4H04A 3WD3A 4N9BA 1C7TA 4PB4A 5C71A 2XN2A 4JIPA 5EGRA 2PDLA 2WC3A 1TG7A 4GRSA 4X2RA 2CLFA 3FYYA 3GTFA 1OFPA 1C8VA 1OF8A 4IP5A 3A3WA 1E3ZA 2CLMA 1KRAC 1VHNA 2A3LA 1UB3A 3SCRA 1KGXA 3UGRA 1EJUC 1HN1A 1UYQA 5PTDA 4XQ6A 1RD5A 3I10A 3K4DA 2G8ZA 3GNDA 4BWLC 2I14A 3RLUA 4JTSA 4E8CA 3AZTA 1BD0A 1XUZA 4ZB0A 2OO0A 3W1RA 1PX8A 3CHFA 5I77A 3FVMA 3TYDA 1UMLA 4HT3A 3DIPA 2ABAA 2NQ5A 3UPBA 3PNZA 3WEMA 1CGVA 3VKDA 3MKKA 4W7UA 3SRFA 3MDUA 3LPFA 3E2RA 4LVGA 1UR1A 2F6UA 1U2YA 3M0KA 4CCEA 1JZ6A 4HNOA 4OIFA 2W79A 3IV8A 3JR2A 4N9DA 4PMQA 4LXFA 5CPQA 2JALA 1DE5A 1S2VA 4IQLA 4Q4SA 4W5UA 1H63A 4Q22A 1UH4A 1RY8A 3HG2A 1PYMA 1Q6CA 1IEQA 4ES4A 3DI1A 3TQPA 2FFCA 3LNPA 4U33A 5D04C 4OFCA 3TQ0A 1L2QA 4BQ2A 5F1VA 1MUMA 1KFBA 4JQAA 4HHMA 1B9BA 3GVWA 2EF9A 1KXHA 2QPSA 3GRIA 3L0NA 4M6UA 1V02E 3CUXA 3CC1A 1TPDA 4DM1A 2ZRWA 5CG7A 4L4MA 5CLWA 1GJUA 3R5EA 4PUEA 2GK1B 4GO9A 1KGUA 2ZZ6A 3E96A 3TYCA 1SO4A 3W07A 2C91A 1UHVA 1FDJA 1TVNA 3G6MA 1VZWA 3MJMA 1US2A 1TKKA 4HNTA 4XWUA 2FDMA 3WUFA 3WMLA 1C9DA 3C2OA 4MADA 5F4SA 4UTHA 1QOPA 3VKJA 2XGIA 5H8UA 1TTQA 3KLLA 3QGVA 3VM5A 2BVDA 3NDOA 1JCJA 2RJGA 1A4MA 3QYQA 3WQDA 2XDFA 2OYMA 4HNVA 1E0WA 2BSLA 2O9TA 1P0BA 5KZ6A 4URIA 2XFFA 1ISYA 1EB3A 1Z8AA 2V9DA 5D30A 2BOFX 2HZGA 7A3HA 1MSSA 4KS0A 4NI3A 4RK8A 3UF9A 1HVXA 4HCLA 4XBJA 4D8ZA 5D9OA 1Y0EA 1TYGA 1ISXA 4IMDA 3WLMA 1DJQA 1XRFA 4UTKA 5E70A 4NAFB 5D37A 1LROA 3E1F1 4CUCA 4GIRA 1W1VA 4IT1A 1FCVA 4UFLA 3R8GA 1KFEA 3ARXA 3T6CA 4AWSA 1WDWA 3WUEA 1TMLA 4QROA 1Z69A 4MWAB 1GQJA 1QI5A 1XBXA 3KZPA 1CB7B 3RNDA 2CHNA 3NVTA 3UPMA 2WZTA 3TU9A 1ZAHA 4IIBA 4GXPA 2PGEA 5XINA 4NKCA 4NJKA 3FN9A 3HF3A 4FZIA 3FFSA 4HPJA 4MG4A 1UR4A 5AC8A 4WIWA 4W84A 1ODZA 3W38A 4DPQA 1RA0A 3AYVA 3O8AA 1S3HA 3NYDA 3ZLFA 3O6AA 4LGXA 2NQZA 3AIBA 3EMCA 3VIIA 3HV8A 1GVIA 3TJIA 2DUAA 1JZ5A 3OZOA 4O28A 3P8IA 4UR8A 3NGJA 1KNWA 2EG8A 1O5XA 4AZ5A 1XLIA 2QZRA 1HL2A 2ALDA 8XIMA 1UG6A 3TSMA 4AWUA 2NWRA 3ZLHA 1NELA 1UMYA 2DT1A 4F0MA 2DV0A 3VNIA 3VCNA 4JHZA 3LBCA 2PLKA 3H21A 2ZUTA 3FW6A 2YPIA 4LU0A 5KZEA 1UWUA 2V3FA 1DPMA 4P8XA 1LLOA 4MJ4A 1CWYA 1MW2A 2IQDA 5ENLA 3C86A 5F7UA 1QK2A 3W2JA 3NVDA 1CGUA 1EOKA 3GR4A 4LUIA 2PDXA 5A6JA 3WL1A 3W76A 4X61A 4MB4A 4C6IA 1XM3A 4XBKA 4QCFA 4UTLA 4R5EA 3QYSA 3Q45A 1MDRA 3SQMA 1NWRA 1OFOA 4TUFA 3MO4A 4C6DA 4H6QA 5CSYA 1WB0A 3QMSA 2PSNA 3FA4A 3QC3A 1ML1A 1KM1A 4BS0A 3P74A 5EMMA 3I6EA 3R43A 3SADA 1K9TA 2EG6A 4UMAA 4AXKA 4LAMA 1C8XA 1WKEA 3DUGA 1F3WA 1TB3A 3EDKA 5LIXX 4PMNA 3USBA 4E8DA 2XSAA 1B4EA 3UXIA 3W1TA 1ZL1A 2VR5A 3ZJ8A 1HJQA 4C6BA 1GONA 1FWNA 1A3WA 2RGLA 4B5SA 3NTYA 3CMFA 1O7AA 1DP0A 4N02A 1CXFA 4X0VA 3PN8A 1DV7A 3THQA 1JJKA 1UR8A 3FEQA 4Q8TA 4QDWA 2FDSA 1MQPA 3MU7A 3N18A 3ELFA 3OZYA 2Q71A 3T0CA 4FF5A 3W2UA 2DT3A 1DEDA 3EYPA 3H26A 2C71A 2J88A 2E8YA 1KCLA 1BKHA 4ZCWA 4WCJA 5D4YA 4UOQA 5AVHA 5FSEC 1TUXA 4B9YA 1LQ0A 4V15A 1TIWA 1FUYA 4AZCA 4FPSA 2VEIA 2BBFA 2E1WA 1QATA 2VX7A 3D0CA 2QJNA 4G1NA 3PPFA 4L5ZA 3EEZA 3OLGA 3P80A 3ITTA 3B0PA 1GZ1A 4GHRA 2QGYA 3UESA 3QJAA 1KCXA 1SQ7A 4GUIA 4JEJA 4R9XA 2ZWYA 4Y6GA 3LCLA 1RXOB 2X2YA 5IRPA 2Z7GA 3AXMA 1W1TA 2CLPA 4Y9AA 2DSVA 2JF6A 4AWEA 2ZVIA 2YDAA 3KBMA 3PSVA 3IUIA 2BHUA 1S2CA 1GKRA 4MVAA 4NF7A 1BLIA 1FWWA 3A24A 1MXSA 1GJPA 2BP1A 3GVRA 4E4UA 3MZNA 1U5JA 4JZ5A 3VYLA 4CLMA 4EK7A 1P0DA 3KX6A 4E2DA 3CLMA 2Y6ZA 3DYPA 5KZMA 2IPJA 1UWTA 4HYRA 3W84A 4NZ4A 5ABEA 2JKPA 2EGZA 1SFTA 3B8WA 2GSJA 3DFSA 3NR0A 1KFJA 3SJ3A 2WBGA 5AYYA 5G1MA 4CVWA 1TFVA 4PTMA 3W7HA 1GVRA 3PBYA 3B03A 3POCA 1TJ0A 4D1JA 4UB9A 5FEZA 3VNZA 1MRQA 4Q8PA 3STGA 3TXZA 4OE7A 3KHJA 1X7IA 4GABA 1E43A 3VD9A 3QTGA 1EF3A 4NZ3A 3EXRA 1H11A 2FFIA 3RIKA 3WNLA 1KM2A 5DO8A 2DH2A 3MVIA 4O10A 5CZJA 2NWSA 4ZGYA 1XYFA 4KESA 1AL7A 5KINA 4P8VA 4Q4PA 1PVNA 4UTJA 2EBNA 2GJLA 1DJHA 1N2VA 3W75A 1GOWA 4YVPA 3QZ6A 2A1YA 4TVDA 1KW1A 3RJXA 1KBIA 4UOJA 3H70A 1QBBA 2DZWA 2RFGA 3A13A 2J62A 1AW5A 1GKPA 1SW7A 2CESA 4TX9A 4LVAA 4LY4A 4Q4QA 2WW5A 4IP7A 1W3IA 4CN1A 1XICA 1RQEA 3WEOA 3RMJA 3LDVA 3N1AA 4S3FA 4B5VA 2BASA 3I3BA 1DWHM 4ROPA 2VR2A 4MNLA 1XYCA 1J0YA 4MB3A 2ZE0A 3PG8A 3E2VA 4W89A 1RCXB 2OZTA 2X16A 3C52A 1ADSA 4YYFA 1SMAA 4NJGA 5E6ZA 3NURA 4XB3A 1EGZA 2Z00A 2ZC1A 1GUVA 1OX4A 4M82A 3A4AA 3CO8A 1T8XA 1Q3NA 3E38A 3L4TA 1Q7QA 1KM0A 5HJYA 1UR9A 1MZHA 4L56A 4Y8EA 3VU2A 2W0UA 2P8BA 4AD2A 2OEMA 1TJ1A 2B4GA 2VWSA 1FXQA 1QASA 1QW8A 3S9YA 3WQWA 4ZQPA 1YPFA 1GPFA 3GW0A 3FJNA 3IJDA 2MNRA 3W2MA 2C3ZA 4B3ZA 3UGVA 3ATYA 1KWKA 2QXWA 3DFQA 3N9KA 5C70A 1FKXA 3OVQA 5BNKA 3ZVHB 4GVHA 2PDHA 4BF7A 2PTDA 4EXAA 3F5JA 3RFAA 4C7GA 3IJ9A 3VZZA 3VKAA 4JBRA 3TJLA 5AN7A 3RM9A 2W5FA 1Q8JA 4XZ9A 3M9YA 1QHOA 2PZNA 3WJXA 2J7BA 1ZSXA 2X1UA 3LZ5A 5G1TA 3FJ4A 1UP0A 3PZNA 5DMMA 3AO0A 3B4UA 3GG8A 4KWVA 1G69A 3S1WA 1GTEA 8TIMA 1G01A 1XIBA 5J8LA 2BDQA 3PZTA 1US3A 3VILA 3F1QA 5EMKA 1H3GA 4J3VA 2EO7A 1J4EA 3W25A 1JI2A 3COTA 1R3SA 1SR9A 4PBGA 4PBEA 1RP9A 2QEZA 4D8AA 1K7FA 4GZJA 1UD4A 1U5HA 3ENLA 2WSRA 4ERAA 4HCHA 2CEQA 3VX1A 2PDJA 1E15A 2J13A 3UYCA 4GFSA 3QZAA 5HJXA 1R7OA 2PDNA 3FHQA 4RE4A 4Y2WA 2VURA 4O1BA 4LUJA 3TTOA 3LTSA 3G0SA 3CWOX 3OYZA 4G5DA 3ALGA 1LZOA 3RO6A 1EGMA 3SO7A 1NAL1 5DCBA 1JF6A 1CZ1A 2GFTA 4WHBA 2E1DA 2FPVA 3M5VA 2D0GA 2PWHA 2PWDA 2R24A 1Z89A 1THFD 4RDVA 3WFLA 3I65A 2TSYA 3I68A 2X40A 1FH9A 4LBUA 2UY2A 2V5JA 4GYFA 2I16A 2XU2A 1G1YA 1JDCA 3KL5A 3UA4A 3PM6A 2PWGA 5HWMA 2O9OA 1VPYA 1A5OC 1HJUA 2R14A 1HO1A 3ZIZA 1OG6A 2PP3A 4JFWA 4S3EA 2PGRA 2ZIDA 4GBDA 4AHOA 1V7YA 5T9BG 2BLEA 2XIIA 2Z1KA 1XKYA 4UQAA 2ICSA 5A8MA 5I3KA 3WLTA 1JPIA 3NL2A 4RDWA 3WBAA 3P8JA 4YYCA 1UR3M 3H22A 1GVSA 2CWNA 1AUSL 3N73A 5LKYA 1WCGA 3S0CA 1FHDA 3GYCA 1Q7MA 3BH4A 3W1MA 3CQJA 3UJSA 3ZR6A 3GNOA 2I5IA 2QNEA 3NXFA 1W9DM 2V81A 4PMZA 1B57A 1JULA 4LB3A 4KCWA 2WKJA 3V5OA 5FAGA 5M17A 1LWHA 2QCGA 3FDKA 2CW6A 2WLYA 3P7YA 1OK4A 4Z2JA 3FLUA 2IQ0A 2UV8G 2QGHA 1XPGA 4MZ8A 3VNLA 5D2WA 2NZLA 3AMKA 3TYAA 3HA1A 3N4AA 4UMBA 4FXSA 1BVWA 4DAIA 4H8NA 3CYVA 4O1AA 4HJWA 1OYCA 2QUNA 2WWCA 2NQJA 1LOLA 4MZYA 1UC4A 2VD9A 3CB3A 2WHLA 2REQB 4XZMX 1PIIA 1GQLA 3QY7A 2VEMA 4GXWA 1BYAA 3SDOA 4GUJA 2CBUA 1F6PA 3UWVA 4BQ5A 4DYEA 4UTWC 1OK6A 4RPPA 5JMUA 4HYWA 3LLDA 4Q4OA 4Q8WA 1H7WA 3VMPA 4FLOA 4ATWA 2UBPC 1LUCB 3IUDA 2JK2A 4KWSA 4KCTA 3CQHA 1F5ZA 2CZVA 1TV2A 4IMEA 3TE9A 3K4WA 3T81A 2YBVA 2AL1A 3NOYA 4G9PA 5DCEA 1X1OA 3ZXWA 3G1AA 1LORA 2P88A 3HBLA 4C1NA 1K03A 4DN1A 3RPDA 4P7NA 4IGSA 5G4EA 5LA1A 1V02A 3VD4A 2J24A 1I1XA 2Z28A 2PTZA 1KRBC 2B0MA 4HTBA 3MV01 3CIVA 5IFPA 1JCNA 3NM1A 3A21A 4KH2A 1OC7A 2AAAA 1SW3A 3NGFA 2NV1A 4IGNA 4TOQA 1KBJA 5FJIA 3A4WA 4KWWA 1VGAA 1I2OA 1VFSA 3SEPA 1UQYA 4FLRA 2D69A 3DHPA 1I45A 1FWJC 3MJYA 1NFBA 1V0NA 4CEUC 4DO4A 4B2DD 1NM9A 3EOLA 3OTRA 3B0UX 3H7VA 4PN2A 3TSDA 3TNOA 4HMCA 4L4OA 4RJEA 5I3IA 5CC3A 1C7SA 3NZRA 5A8QA 1SUXA 3IIVA 3G1HA 1VB9A 2GOUA 4P7QA 1V8EA 3ME3A 3W7OA 1X6LA 2BHYA 3P5YA 3GG1A 4JIEA 3IIXA 2Z27A 1AG1O 4F9DA 3OGRA 1IZKA 4N4PA 4JDBA 4RNIA 4E5TA 1DQXA 1P0EA 4TX8A 3WLPA 5A2CA 2VGGA 1CNVA 1M7JA 2XIOA 2W27A 4YPJA 3WK0A 1MNZA 2E28A 1ZHAA 1MXGA 2OQYA 4DWSA 1XIHA 2DSKA 3CAQA 2BV9A 4NYUA 2Y70A 3L5MA 3OA3A 1VRXA 1GT8A 2JBMA 3DHUA 1X98A 2PA6A 2YZRA 2Q3OA 3VINA 1XBYA 4W93A 3TTYA 1B3OA 3WUGA 4K8HA 3ONBA 5B80A 3VA8A 3BLKA 3LCHA 4IHCA 1E5JA 4CNOA 4IUGA 4HN4A 3CLWA 4RXFA 5DF0A 3EA1A 4INFA 1L6GA 4JTEA 2WVUA 2OODA 2WKLA 2KAUC 1IYXA 2ZZ7A 5A3HA 4CU6A 1V51A 3BLFA 1A5SA 3GIQA 3O06A 4BZYA 3M43A 2PDGA 3KEHA 1S3TC 3PBUA 4J2MA 2ZTJA 3GQYA 5K7JA 3VNMA 1LQAA 3GH7A 1KQZA 1E6XM 3TIMA 3STCA 1NP2A 1ICPA 1ESWA 4GQQA 4DUVA 3BAXA 5F2LA 1J79A 3T4CA 1MXDA 3SCSA 4YLWA 1KWGA 2Y89A 3W02A 1C90A 2Q6ZA 1W1A1 3CHCA 2YCJA 1K6WA 3N6JA 3WK1A 4AC1X 3MC5A 4GVIA 1EQCA 1GNXA 3LCWA 2E8ZA 3MBDA 3NXLA 4LRSA 3NZ1A 3M46A 4OVXA 4LBSA 1TTPA 3UZYA 2O92A 1TPFA 5CGTA 3E0VA 2EPOA 4ZVJA 2CETA 3QKEA 4MKNA 4KPLA 1NOWA 3DKLA 3LB0A 5M3WA 2I17A 4ICNA 3F2CA 4B5NA 3TAKA 3LZ3A 1V6UA 1LOSA 2J74A 1RJQA 7TIMA 3BG9A 1XLFA 3FGCA 3TUUA 3ZVIA 2PZ0A 4Q3MA 2J7EA 2WSPA 3GNNA 1V4YA 4A21A 4U2YA 1R3TA 1PHWA 1JFXA 3LRMA 1TPB1 1IT0A 4PSPA 1K77A 3H4WA 2GJRA 3CMJA 4RW5A 7PTDA 3HQOA 3H54A 1H61A 2D2GA 4ZO6A 4PMVA 6TAAA 1UD2A 4C6OA 4MHBA 1EDTA 1D7KA 1S38A 1G6CA 2PS2A 3REQA 1EBGA 1TZ7A 2GDUA 2I56A 2OZ0A 3LSCA 3LLXA 4PCNA 2VUYA 2VZVA 4GISA 4QP0A 1DVJA 4LAOA 4WZHA 3HPFA 5CEWA 4AZBA 3N25A 3KVKA 4FNQA 4J1OA 1L6FA 3A22A 3W7IA 3MKCA 3G18A 4DRSA 3AICA 1V08A 2QCEA 3L2MA 1MEHA 2AGKA 5LGXA 1VCGA 2ZA2A 3EX1A 3P82A 1VPQA 1UOZA 3LQGA 3W81A 3A5VA 2Y2WA 4DY1A 1S5NA 3L4XA 4US6A 1NDZA 4RNJA 2VP8A 4F3HA 4R88A 4DO7A 3Q37A 4PULA 4RV8A 4B9ZA 3GBDA 1N55A 2NLYA 4UR7A 2D24A 1O66A 4B5WA 1M04A 1FP8A 3W1AA 3KVLA 4LYRA 3QPYA 3EWDA 3RM4A 4KF1A 1SJAA 3BAIA 3BXWA 3F4CA 1UZDA 5KETA 4OT7A 2HPIA 1A5MC 4LY8A 3TC7A 6ENLA 1O1ZA 1JPKA 5I06A 2WCSA 5KEZA 3N3MA 4XAGA 2DORA 3U0HA 3S6OA 2R82A 4W7WA 1SZFA 5BWFA 1A53A 4BJHA 3PNUA 1E9IA 1KXTA 4NL1A 3STFA 4JY8A 4R7JA 4XD5A 4Q6JA 2J75A 1W6TA 3LI1A 2O4MA 2CYGA 1O95A 3QPEA 3P0XA 4JQ1A 2V82A 1US0A 2PAJA 3SSZA 1B4KA 1OVDA 3CH0A 4MMWA 4GGBA 3RX3A 4JX4A 1GYMA 1NDYA 4DJEA 4WSHA 3BAWA 1XGEA 1BTMA 4FXFA 2F61A 2QUUA 1B3VA 4PUKA 1ONXA 2OQHA 2IKJA 4S2CA 3ANYA 2W67A 3ZFHA 4GH1A 1A5CA 3OOQA 4BQ4A 1CDGA 4PMDA 3MBFA 2PD9A 5LIKX 3J7HA 2YR1A 1Y5VA 2VC6A 3TCSA 5BMWA 4F40A 2V5LA 4DBSA 3PTDA 4C6MA 4MIMA 5DFAA 5HR7A 3ZZ1A 1OCQA 3M0IA 5CC6A 3M0VA 2V3GA 1GVFA 3RAOA 1D2KA 3S83A 5GVJA 4EF9A 3W7GA 1UWAA 3VGBA 5DANA 5LHEA 1B2YA 2GGJA 4IMCA 2X0SA 2V6AA 1YDNA 3PR2A 4WRHA 3CTLA 2OSYA 4UMCA 3UJ2A 4MOZA 4AY1A 4A2SA 1PIFA 3I4EA 3NPXA 3FDGA 1O68A 1VIWA 3LHWA 3M0LA 1FVPA 3ZMRA 3VUSA 3S6DA 3VGFA 2HJPA 2D0FA 2O9RA 3N6QA 1L6YA 1ZUAX 2A21A 2WM1A 2X7WA 3NQGA 4MLRA 4W8BA 3GX9A 1LM1A 3UZWA 3TOYA 3ZJ6A 1QR7A 2GJPA 2JKEA 4HMDA 1XX1A 5CPNA 3L67A 4M80A 1W3JA 5C6MA 3G3MA 4PEEA 3Q58A 2F2KA 3AOFA 4KBXA 3DXIA 3E6EA 2GJXA 4UZUA 5DMLA 1K3UA 4DO6A 1G0CA 1RK5A 1XIFA 2FHFA 3KBJA 3UZZA 1KM3A 4W7VA 3OZMA 2VHLA 1L8NA 2AKZA 3M5YA 4RDZA 2QJIA 3CYJA 3ARRA 1E6NA 2ATSA 4ERIA 5A6SA 5LNSA 2ZUUA 4I8DA 3CEUA 3VIHA 4N9EA 4EVZA 3O7UA 3W53A 3KCJA 1SMDA 1XCXA 3IGUA 3GHSA 1MMFA 4IUOA 3W1NA 2YDSA 8CGTA 2H9AB 1CIUA 3MYOA 2GQAA 4RNHA 3M0YA 2ZA1A 5I0DA 4HNLA 2E25A 2POZA 1YRRA 4R33A 3UJEA 2VVNA 1YTDA 2DY3A 4H41A 3K1GA 2PWUA 3KVJA 3AS0A 2HTMA 3UERA 3U4FA 3GTNA 5E0KA 5CPMA 2KX9A 4KEUA 5A6MA 1LRNA 4WSKA 4TX6A 3UZXA 1H1ZA 1H1YA 5FEWA 4UQBA 4LVBA 4BY3A 3W86A 1VBHA 1N82A 3GXTA 2NUYA 2C16A 1CGYA 2PUZA 4DZHA 2C13A 4I6VA 3LGDA 3LHUA 4JTTA 3MA8A 5FJRA 3UWEA 3SN0A 2ZTKA 1E55A 5HPOA 4IIDA 5ABTA 5A6AA 1FOBA 4ZE4A 4LYQA 5HR6A 3PSWA 1F07A 3QBUA 3FKRA 2XWDA 2E5CA 2FJKA 4GVFA 4FP1A 1OINA 2Y7DA 2J8GA 3WD0A 1FH7A 3HFYA 3NQVA 3MCMA 2OGJA 2ZX5A 2IQTA 5CPTA 4XZBA 4JTGA 1L2UA 2TODA 4NXSA 2IUZA 5G4HC 3ARVA 4KKXA 2YFOA 3LU2A 2ZX7A 3W83A 2FPYA 4EWJA 1PEZA 2YLAA 3IJ6A 2Y5SA 1RVKA 2HE8A 4FK9A 2FMOA 3WMSA 1VYPX 2GGIA 2PLMA 3BAYA 3P60A 3SY8A 2PF0A 2WZHA 2J27A 1G4SA 1K8CA 4JFUA 5D8ZA 2ZQ0A 3LERA 4MLJA 2OU4A 5G5IA 1E6ZA 1YNYA 4OHQA 1OY0A 2CCRA 4YTRA 2VDIA 2Z0IA 6A3HA 4QS5A 1CX9A 2HMCA 2WNNA 4JICA 4BK9A 1IZCA 5GJMA 5A2BA 1OCBA 4AIUA 3KOWA 2WM0A 2PDKA 2ZICA 1CW2A 1VFLA 2ADAA 1SR0A 1A47A 3NUKA 3PS7A 3PC0A 4FR6A 5XIMA 3VE7A 4QXIA 3IVUA 4RE3A 2Y0FA 1XRTA 3EB2A 3EXTA 4NXKA 3SY1A 3EWBX 4IF2A 3DG7A 4NUWA 1V5XA 1R3VA 3CPRA 1J0HA 2Z1VA 4H8HA 4D6HA 4IJBA 1E9YB 1KRMA 2WVSA 4NRRA 4L4LA 3AU6A 1Z41A 2EPHA 4UXDA 1HL9A 3FAXA 1J12A 1OFEA 4IQEA 1B30A 2XINA 5CJMA 5DRCA 5I02A 1W3HA 3WFAA 2VCAA 4BI6A 1X97A 1Z6KA 4ZSTA 4O15A 1M3UA 3PUDA 1KXQA 4AF0A 3WYZA 1CXHA 2R6OA 3HU7A 1OIMA 1R2TA 3VDGA 1UD8A 4GQGA 4ASTA 1HQTA 1NH6A 3IJQA 1Z32X 4HZ6A 1CXLA 3TYBA 3PK7A 3GD6A 4GNJA 1QWGA 5C7VA 3C2VA 3N04A 4Q8UA 3ANVA 4MJZA 5ABHA 3RR4A 1CENA 5AHIA 2ZRZA 3ZR4A 4P7RA 1U1HA 4NI8A 1ITCA 3TJXA 3W37A 4I9MA 1UROA 1GVQA 2Q8XA 3R13A 3W74A 3L2IA 4DHGA 3NQ7A 4M29A 5D02A 3ES8A 4QJ3B 4LCSA 1AH4A 2YDRA 3EGJA 1AFSA 3KOYA 1KV8A 4WX2A 4GY7A 3W27A 2F84A 1TR1A 1VIZA 3R8HA 5RUBA 4UNLA 2VC5A 3OZPA 3AMGA 1G67A 3FSUA 3PP7A 2DW7A 4NZCA 3TCEA 3GUGA 4EANA 3ATZA 4GCXA 3A6OA 4ZODA 3WQFA 2X30A 1W2PA 4MFEA 5G4WA 2FVLA 3UCDA 2XVPA 2W61A 3PHAA 4IJCA 3IWPA 1IT7A 3LHTA 4HBKA 1K70A 1GQKA 2A79A 3P61A 1SYTA 4RUBA 2DPEA 4O12A 3PBMA 2Y62A 4QJ1A 1P5BA 2AQWA 3NQCA 4E4FA 4FAMA 2WZIA 4DM2A 1QPNA 2TPSA 4K8GA 2EQDA 4H9UA 5CGQA 3DZ1A 3INPA 1GW1A 2OOGA 3MDWA 1TV8A 3K46A 3W9ZA 3AYTA 1FFRA 3UY8A 1JZ7A 3K30A 2A3HA 4ZTXA 4JX5A 2WJFA 5DELA 2VFHA 2ZE3A 1QPQA 3N4FA 4TTGA 2G37A 1NJJA 3A4JA 1B5TA 1U1JA 2YB1A 4QE1A 5CPOA 4EACA 2PDQA 1AZ1A 1TELA 1UQZA 2V67A 1J5SA 5DMYA 2JFEX 2RGMA 4M56A 5CG0A 3CPUA 4JYEA 3SB0A 4GUFA 3UG3A 1Z44A 3WQOA 2FVKA 1CGWA 4D9PA 5KITA 3CL8A 3DESA 1E72M 4E38A 1EHAA 3WJZA 2CLOA 1GZGA 1H7NA 3AUOA 2ZX8A 4PUWA 1FWEC 2E0PA 1V3HA 5LNUA 5E9AA 2X09A 2BTMA 5M5DA 3EZ4A 1BRLB 4WDWA 4GXMA 2BXZA 3T2PA 5LZLA 1TWSA 1YTKA 4NJJA 3CL7A 4Q7IA 5ABFB 3A64A 1TZ9A 3TH6A 2GJNA 5C9XA 3VIJA 3QW3A 4L1XA 3FEMA 4C6JA 3TWAA 3EA2A 4PMRA 4K2SA 2HRWA 3PUGA 1XGZA 3G0XA 2NXGA 3CM4A 1ALDA 1OWQA 1NFGA 1HJVA 1YDOA 3QM3A 1EX1A 4LS1A 1K02A 2DZBA 2WPGA 4AVFA 1XSKA 3WBYA 2G95A 1SFSA 2VL4A 1W1ZA 1R86A 4RZ6A 4MWAA 2ISVA 1IR2A 3ZR5A 2ZZ1A 3HQPA 1KXVA 4LUTA 2WMIB 1PTGA 3MO7A 4HOZA 3HJEA 2E7FA 3NG3A 1TJPA 2HVMA 2TRSA 3VFCA 4E2OA 5HOSA 2G3JA 4GOAA 2UWFA 3T09A 1PKNA 5H1WA 4CQ8A 5AHFA 4PRRA 3GU9A 3PZIA 1P0KA 5EFFA 1DJGA 2HROA 1PZ2A 3IJIA 3S5YA 3WDIA 3GVGA 2CZ5A 4HZ8A 4C1LA 4A4AA 2C7FA 1FWSA 1Q63A 3CZEA 3NSXA 4ZXOA 1WA3A 1GVOA 4O18A 3TOPA 4PC8A 2I9UA 4UIOA 1OIFA 1BYCA 2UY4A 1JYWA 1P6BA 1ME7A 4QHRA 2DIKA 3I7SA 4IPIA 4RKAA 4O1CA 2YFNA 1EF2A 5C9ZA 4GQ0A 4REQB 1CYGA 1JUEA 1UPPA 3OGVA 4ICCX 3IIOA 2BOEX 5A8OA 4Z1CA 2HQAA 4W85A 2OELA 5EPDA 3UG8A 4AUBA 3W88A 1EUNA 2OB3A 3KRZA 4YNGA 1J5TA 2PDIA 4AD0A 2RDTA 1ZFJA 1VBJA 4UBPC 4US5D 3RG6A 3GXPA 4JIHA 2W3ZA 1V0MA 3TN6A 3WD4A 2BODX 3ISIX 2ZXQA 1BF6A 3G77A 2ZADA 4JDYA 3CB8A 5HQMA 3GDKA 2L5HA 3M47A 2VCCA 3WF2A 3WF0A 1KLZA 3G0UA 1WDSA 2DUZA 1U5VA 2NT0A 2JEQA 4MZ1A 1PZ0A 4AU0A 2FH8A 3DGRA 4GZ7A 4L9YA 1WDRA 4NP7A 3GFYA 4JN7A 5CBBA 4V1XA 2OJPA 3KS6A 3W7NA 1XC4A 4DJFD 4FX8A 3PG9A 5EMLA 4CGTA 3V5CA 1XHGA 4ORIA 2J4GA 3UQNA 2WHKA 3FV9A 4EPDC 2WO5A 4K6AA 1A3XA 3AI0A 1KTBA 1LT8A 4AEOA 2FMNA 1M41A 1ONWA 4QQUA 3BWWA 3G1SA 1QPKA 1EWDA 4DELA 3AROA 1FHVA 2PRLA 3AU2A 3HGSA 4EXBA 3LRLA 4AY7A 3EWZA 4JXCA 1KBLA 1WQ5A 4PTVA 1FBAA 1DJXA 5I3GA 4OBSA 3O2LA 1HP5A 4JQ2A 4DB7A 1UWSA 1J6OA 3EWYA 3UXKA 1XFCA 5LNVA 1VH7A 4KT2A 3AQUA 3GFZA 4CD8A 3AS2A 4GI4A 3TVAA 3MI2A 1OBAA 1WXZA 4H9ZA 4JX6A 1H7OA 3W23A 4K7VA 2WSKA 4A35A 4HN8A 1IWAA 1S1RA 2CC0A 3GWQA 5EMYA 1V0LA 2J25A 1XW8A 4GYPC 4HA4A 1B31A 4NNAA 1PYFA 1XRVA 1OFAA 4FSAA 4K39A 2O7SA 2XIBA 1NWTA 4UOZA 4XBSA 4GIAA 3QMRA 1EC8A 1LRQA 4EAMA 2XWEA 1PX4A 4NIRA 3VD3A 4GJIA 5HMSA 2DFAA 3VKCA 4A8LA 1LG1A 1WDQA 4FLSA 4NILA 3SQSA 4L61A 3UR2A 3URBA 2HDJA 3QSTA 4I5UA 5I07A 3B8SA 3O3RA 5CSSA 3JVAA 1XL9A 4PEKA 3KUMA 1MQQA 2OLSA 3GLCA 3SY5A 1QI0A 2ISDA 2WNQA 3GVVA 4JTJA 3PWGA 1NVMA 1WKDA 1YPXA 2Y63A 4B5XA 4UC5A 3DAQA 4I9AA 5TIMA 1TMQA 1F05A 1LQ2A 1RD6A 4XISA 1FWHC 1E4NA 2OXNA 1T40A 1YQ2A 3LK6A 3L0GA 2PE4A 1WXYA 1AJ0A 3OLEA 1W5MA 3VC5A 1JCXA 1XIDA 4HU0A 1DYSA 2C0AA 1QOQA 1QDSA 1F3EA 3U5YA 2H8XA 3M41A 3MUXA 3BE7A 3WLQA 3R8RA 5U4NA 5LXEA 3IANA 1SSDA 3GZ3A 3EMZA 3OVPA 2VQTA 5HWNA 1GJWA 4XAPA 4UTMA 1LLWA 2ON3A 3EKLA 3GHTA 2J9YA 4QSFA 3U4AA 1H5VA 5AKQA 2FGLA 3O1NA 2WAGA 2PWVA 5HNUA 1HJSA 3GB6A 4FI4A 2GVEA 4UR9A 3IJ7A 4J27A 5HNTA 1W54A 4DWDA 1VFTA 2A2IA 3BW3A 1MW0A 5REQA 2C6QA 4HP5A 3A3XA 2WXDM 2YA0A 4WY0F 4E8GA 2DSWA 1I4NA 1BSLA 1TPWA 2PU1A 3EXSA 2C19A 2WHMA 3IVSA 3BOXA 4O4WA 4H7ZA 4IGMA 2VT0A 2Q02A 1BYDA 3CEPA 1EJVC 1YLVA 2QDHA 3OHMB 4L65A 2X8RA 2OTDA 1UBSA 2IW0A 2V5DA 4JIQA 3OO2A 5HUPA 1E70M 4PMOA 3EB4A 3RM8A 4GQBA 1GCYA 1E6QM 1Q13A 1JCTA 3KP0A 1IXOA 4WDUA 2G3MA 5FJTA 2UZ9A 1W2VA 5M1TA 4ZB5A 3HN3A 3PFRA 3H2OA 3DBPA 2POTA 1IGSA 1T99A 3L5AA 1E3XA 4U31A 1YXCA 4QDMA 1TR9A 1MW1A 5A94A 4O1FA 5ABGA 4S23A 3BW4A 5A8NA 3UCCA 4TVUA 4U2ZA 2J7DA 1PBGA 2GPTA 1UD5A 1Q66A 4PFMA 1OEPA 4GKLA 2QVNA 4ICMA 2XFWA 4H1ZA 5BW6A 1MQRA 2WLZA 2VFDA 2PRHA 4PA8A 2V38A 2HEJA 4O53A 3VGDA 3S1XA 3BLDA 1UASA 9CGTA 5T26A 3N2BA 2W63A 3GXFA 3TYEA 3SGGA 4MDPA 3GM8A 3IPWA 3JW7A 2X0HA 3CWHA 4K3ZA 1XISA 4J28A 1UP3A 2HK1A 5IXEA 3BICA 1X8CA 2ZOXA 3VDHA 2CXGA 4M24A 4QLLA 3LV6A 4ADUA 2PGWA 1ZS2A 2ZZ2A 1ADDA 3SQLA 5BOFA 5LXXA 4ZQMA 4FNUA 1M68A 3ZWTA 4XIAA 4A3RA 3C8FA 1CGXA 4B91A 4KGJA 2XH4A 3L9CA 3KWSA 2ZKMX 4K36A 1FWIC 4DXKA 1ZU8A 5EBUA 1QNPA 3QQ0A 4O0KA 4H01A 2VOTA 2A0NA 2QT3A 2HXTA 3KAOA 5EBAA 5FEPA 4JKKA 4MDOA 4M51A 1VHCA 2I9EA 3URAA 4CNPA 3C2EA 4HKPA 1N8WA 3MTWA 3UG4A 3MS8A 2VVSA 3OP2A 1TVPA 4UQEA 3CU2A 4ROQA 4E2BA 1W91A 3VD7A 1FA2A 1TV3A 1R3RA 3GKAA 5IHSA 2YL5A 3U2CA 1XRSA 3VGEA 1MFVA 2EG7A 3EOSA 1QUMA 2JGQA 4XAFA 3PUOA 4PUMA 1OG0A 4Z0SA 4OBRA 1K4GA 4MYXA 5L9FA 5AC7A 1K8XA 4LVDA 3MUIA 4L1GA 5TD4A 4BEUA 1XLJA 4CNTA 1M01A 2FGBA 2R1NA 4I9JA 3IRSA 1QWKA 2Z1SA 3UXLA 2BGNE 4AZCB 5AC6A 2VXNA 3CV7A 5FJOA 4GUHA 3NZPA 5LA0A 2Z24A 2QDGA 3WH5A 3DX5A 4QGCA 3TV8A 4N6EA 1L8PA 1N7KA 2Q8LA 4ZOEA 4AB4A 4G56A 1BGAA 1OZMA 3EB3A 2VD8A 1GWJA 2G50A 3U57A 4H2HA 1Z48A 2V68A 3M16A 1NFPA 3BAKA 1D8WA 1JDAA 3BCJA 3NQEA 3CZLA 2GVJA 4PUJA 3C2RA 3BGGA 4I8YA 2CPUA 1YNQA 3V0TA 1HGYA 4J35A 4P8UA 4LYPA 1AD1A 3DFPA 2FHCA 3ZM8A 2NX1A 1KFLA 3AAMA 3PJWA 5A6BD 6PTDA 2J66A 4DNHA 4KERA 3GNXA 3DC8A 2X7VA 1JIBA 3GR7A 4RE2A 4NRSA 3W0KA 4EAYA 3UNDA 4DXVA 1XLLA 3M5ZA 4R9OA 2ALRA 2OWWA 1D3HA 1Y5XA 3CTTA 4D8LA 3FXYA 3LPOA 1FWAC 4ZOAA 2IPWA 1BXNA 1BG9A 3P2VA 4O17A 4AW7A 4C6KA 1NP0A 3SCQA 3EOOA 3WFZA 3I7QA 3WD1A 4I3GA 2CHRA 3MI6A 2CZEA 3N9SA 2J79A 4X3ZA 2NUXA 3BW2A 2P0IA 3LCXA 4GYJA 3B8VA 4D6CA 1E6SM 1FHLA 1T96A 4HA0A 3MW7A 1J01A 3TA6A 4F0HA 1Y8BA 2DDXA 1MZRA 1UA7A 4PTDA 3LM7A 2PBOA 4MTVA 2Q01A 2ISSA 4HJFA 3VIOA 1WZLA 3M07A 4JTRA 4C7FA 2ACSA 3UWYA 1R5YA 2AAMA 3OEXA 4XSLA 2Z29A 4CD4A 4DBWA 3V1HA 4HVXA 3PY2A 3QZEA 5CKSA 4M7TA 1ME8A 3VDAA 5TF0A 4R53A 2VX4A 2E3ZA 4D6IA 1K8YA 4AVOA 1VCFA 4NZFA 2ACUA 4P2VA 4HTYA 3S46A 3UCQA 3WX7A 2VOMA 5CXPA 5I3FA 2P76A 3VCCA 1OC6A 1R3QA 4O13A 4J3ZA 4D72A 2ZBTA 2NT1A 4DF2A 5BRPA 2BXVA 1XC6A 1POKA 1JNEA 3LHZA 3OVGA 1KFKA 1XD1A 3L4UA 3MMTA 4J5NA 2E9BA 2XTKA 1EEXA 3RHGA 4ZFMA 3HOJA 4K38A 1OX4B 4GGHA 4I6KA 5TAOA 2YXOA 4I5XA 1V3KA 4B90A 3L12A 4AZ6A 4S3DA 4XD3A 3BGAA 1Q4NX 1W9VA 3GYEA 4ATLA 2FJUB 3R7MA 3CH9A 1MI3A 4XKYB 4H9YA 1XH1A 2A3EA 1OFDA 2DZXA 1H41A 3F4NA 3NZQA 1E9ZB 3LLFA 5J04A 3NO1A 3GNRA 2Y7EA 3K1DA 3L5LA 1VEMA 1E1CA 3S6TA 1ZBCA 2PCEA 3CUJA 4HPGA 3EA3A 3F4DA 2ZUWA 1Q6EA 3TDFA 4W88A 1JQVA 2HV5A 4DJDA 5I03A 1J11A 3HQNA 5C0QA 1XLHA 3G1VA 3KTXA 3LN3A 1SSGA 2VCBA 1EJSC 4RZ4A 3UR5A 1W32A 3K8KA 1G94A 4YN5A 5EY5A 3TROA 1P6WA 4GACA 4JFSA 4ZZ9A 4I7UA 1I8JA 2NX9A 3VDCA 5JIPA 3QN3A 2H3BA 2VM8A 2BFGA 4MY1A 2ZUSA 4C60A 3BV4A 3U6WA 3GDRA 4UWMA 1B9ZA 4OU1A 1DJNA 1QTWA 3N6HA 2XSBA 1ME9A 2OKOA 4JN8A 1DJIA 1H5YA 3P6LA 2VDHA 1HKWA 4DVOA 1XLBA 2WK2A 1R47A 3IUHA 5AY7A 5E9XA 2ZDRA 1A0EA 1EEPA 3W85A 3M0HA 3FCPA 3TQKA 3MHGA 4JTQA 3SUUA 3KLKA 4FX6M 4AMAA 3WQVA 1PSCA 4GLEA 3SCVA 1K9FA 1CT5A 1IF2A 4WUIA 3W7DA 1Q8AA 1XIMA 1Q6QA 2EJAA 1E71M 4MJ2A 3AHVA 4DEFA 2IMRA 1C3FA 4PB3A 3S1UA 2FYMA 3NQMA 3V0UA 5I6SA 1XLCA 4RR4A 3FA3A 1GG0A 1VENA 3APTA 4G2DA 1PCWA 4EKJA 1G5AA 5K9DA 3S9IA 2YIHA 4PFHA 4NASA 4PCPA 1LL4A 1NOFA 3ZT7A 1CLVA 1FWGC 3AFBA 5EU9A 2GL5A 4FOUA 4XK2A 1FQ0A 2VRQA 1OGSA 4YHGA 4GJJA 3H2NA 2BWGA 4FX7A 4ORMA 1LRTA 3PF3A 2O55A 3S3GA 4W5ZA 4HQVA 3UPWA 1VBRA 5LHFA 3DN5A 5JQ9A 3WZ0E 3GC4A 1VPXA 3W7LA 4ALDA 1E51A 1B54A 1BF2A 2VEGA 5HJLA 2CHOA 3VE9A 2WSQA 4UFKA 4E2VA 4N9CA 3U5UA 1VLIA 1EGVA 2DH3A 3PZ9A 1RP8A 1B0IA 3GY1A 2XZ7A 4IXHA 4HA1A 4AXNA 2GUUA 2R1LA 1W9PA 1XWYA 5C55A 3O0FA 5G2WA 4ADSA 2VFGA 3RR1A 2C8NA 1M7XA 4PODA 4S2BA 3WO8A 2GUYA 2ONEA 2X2GA 1PZ1A 4HU4A 3PPGA 3W2NA 3BZGA 3GHUA 2NLIA 4H7VA 1LL6A 1JXKA 1J6PA 4YWSA 3W29A 3T2OA 3V1PA 3BLEA 1I2NA 1YXYA 4NNBA 2OMAA 1FWCC 3VGHA 3ZO9A 5GPRA 1TTJA 3MB9A 2QCDA 4UTTC 3UW6A 4DNMA 3K4AA 4AD3A 2GZXA 4DF0A 4FLQA 4S3BA 3VOGA 4QBXA 2V5KA 1OCNA 1IXNA 1GK8A 3CHDA 2AOSA 1U33A 3OYXA 4E3TA 2QCFA 5MF5A 1C93A 4KQNA 1QVBA 5L6UA 3AYRA 5TQLA 2QIIA 3ABSA 5AFDA 1EIXA 2FHBA 3GK0A 5FACA 2CKRA 5HQLA 3KL3A 3PZVA 4KW2A 3LGEA 1M5WA 5I7GA 1DORA 3UJFA 2E6AA 2FZ9A 1W3NA 2KZHA 1ISZA 1IXQA 3SCUA 3ALFA 5BOEA 3OLDA 4AZHA 3W1QA 4GH3A 4KIRA 2Y88A 4M7SA 2PDWA 3C0QA 3ZSSA 1SVDA 3WJSA 1KB3A 2ZX9A 2XJ7A 5C2XA 5K4XA 3MWAA 2J7GA 4C1NB 3N19B 2J7CA 5XIAA 3QF0A 4IZGA 4M19A 4OGZA 1GHSA 1FDZA 1MFUA 3LXAA 3BL3A 3P67A 4LEQA 5D2XA 1WDDA 1J9YA 1EO7A 5DRIA 3PFMA 1YEYA 2ZZ5A 3CWNA 4IMGA 2CZFA 3MWCA 1CLKA 3RPMA 3H2FA 1KTNA 3TFXA 2OYKA 3ARZA 1RCQA 4LUSB 1KRCC 3GS6A 1JCMP 1MNSA 1MW3A 4CEXC 3WH9A 5U7SA 5HNNA 2IPGA 2PCQA 2Z2AA 3STPA 3WDJA 3RILA 4IG2A 3NWRA 3T8QA 4IFRA 3HGRA 4PL2A 3LGGA 4NU7A 2YW3A 5JH1A 2VO5A 1WYIA 3MT1A 3V0SA 1UW9A 2PWFA 2OSXA 2OX1A 1WAUA 3EX3A 2GVYA 3AALA 4G7EA 4J2PA 1PTAA 2ZWZA 4C5ZA 3CQ0A 1EWEA 5LIYX 4LC8A 2QULA 4GCAA 4OJYA 2GGEA 3U48A 3N2OA 3GNPA 4X2PA 4H3DA 1TJ2A 1KM6A 4A8IA 3LOTA 3NQDA 3ARSA 4Q8NA 1GHRA 3RU6A 2FVMA 4I7VA 4EF8A 4NY2A 4YL2A 1C8YA 3D5HA 1TA3A 4DWSB 4MAVA 4S38A 1HKMA 1HGWA 3GC2A 4C6LA 4CQBA 1MUCA 3CAKA 3MMDA 2CBVA 3TMLA 3UT0A 4LAUA 2UY3A 5HWJA 1MO0A 3B97A 3MCNA 2R8WA 5I3DA 1RPKA 2OCZA 4DLMA 1I2RA 5DQPA 3E0FA 2PDFA 5FJJA 5E0CA 4ONVA 1HX0A 2PI6A 3MSRA 3QOMA 1PHQA 3B05A 1VRDA 3ERPA 1TWDA 1W5NA 4GYKA 2A85A 2W92A 3N12A 3VOIA 4B15A 4LB4A 3RO8A 3RX2A 3VVGA 3HTWA 2XZ9A 2WSYA 4JYDA 1VC4A 3H53A 4ZFCA 2BXYA 4TMBA 3KOXA 5AYZA 2OLAA 3CUHA 6TIMA 3I6RA 3AIRA 3R12A 4HMNA 2E77A 1XDMA 1H7PA 5HANA 3NEVA 1ZCCA 4CQAA 2Q3RA 1O5QA 1O1HA 4E6MA 5KMYA 4Z2IA 4FF7A 1QXLA 2QHAA 3S2NA 3W7EA 1TWWA 2EAWA 3M64A 4I9TA 1H4PA 4R85A 1CBGA 1EOMA 1KM5A 4CQDA 2E09A 5C8BB 4AYSA 1GKQA 3W28A 3LMZA 4S39A 4TV6A 2AL2A 4A6GA 1Z42A 3HPXA