3QZ6A

The crystal structure of hpch/hpai aldolase from desulfitobacterium hafniense dcb-2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
259
Chain Sequence
AMFLKKKLSAGKSVVGTMLNLVYNPDIVRIYAEAGLDYFIVDCEHAAYTFREINHLVSVAKNAGVSVLVRIPQVDRAHVQRLLDIGAEGFMIPGVQSAETMRETVRLAKYPPLGERGVGGSIVTDFKPVNWAEWVQERNDEIFIMAQIEHVKAVEDIDSILAVQGVDAVIFGPRDLSNDLGIIGQTEHPKVYECYEKVYRAADRQGVVKGFFTAADAAKMGWAVERGAQMLLWSGDVAALQTYTAKGVKTIKELPGFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of HpcH/HpaI aldolase from Desulfitobacterium hafniense DCB-2
rcsb
source organism Desulfitobacterium hafniense
molecule tags Lyase
molecule keywords HpcH/HpaI aldolase
total genus 83
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3qz6A00
4KCWA 1F3XA 1A3XA 1JDEA 1AQFA 1A5UA 2X0SA 3LYEA 4B2DD 5JVLA 3GG8A 1F61A 1A3WA 3PP7A 1DQUA 3SRKA 2HROA 3P0XA 2DIKA 4B5VA 1ZLPA 2HJPA 1A49A 4TV6A 1E0UA 3GR4A 3ME3A 4WJ8A 4IP7A 4KCVA 4IMAA 1M1BA 1DXFA 2VGBA 3OQ8A 4FXFA 3EOLA 2VGIA 3IS4A 3OYXA 2L5HA 1E0TA 3LG3A 2HWGA 4IQEA 5TAOA 3OYZA 3VAVA 2HRWA 1S2TA 1F8MA 4KS0A 3PUGA 3M0KA 2BG5A 4KCUA 1O66A 4ROQA 4QG6A 1GGOA 3MA8A 3QV9A 1XG3A 3BJTA 3QTGA 3QZ6A 1DXEA 3T07A 2G50A 2VGFA 3E0WA 2XDFA 1SGJA 4L80A 3T05A 1IZCA 3SRDA 1MUMA 2R82A 1ZJHA 3GQYA 3QV7A 3HQPA 4B5TA 1T5AA 1S2UA 3FA3A 1PYMA 1OQFA 4L9YA 1O68A 4B5SA 3HQOA 3U2ZA 4IQDA 3QLLA 2WQDA 1IGWA 3G2GA 4B5WA 4RPPA 1VBGA 2ZE3A 3QV6A 4YNGA 4B2DA 1PKLA 4LSBA 1S2WA 2V5JA 4KCTA 1DIKA 3HQNA 1S2VA 4JPGA 4MG4A 2VGGA 1VBHA 3H6OA 3QQWA 3E5BA 4L7ZA 4B5UA 2E28A 3KHDA 1U5HA 4HYWA 1KC7A 1F3WA 2V5KA 3BJFA 4FXJA 1UJQA 4DRSA 4QG9A 2QIWA 3EOOA 3B8IA 4QG8A 1M3UA 3N25A 4G1NA 2VWSA 1OY0A 3I4EA 4B5XA 4QGCA 2KX9A 2DUAA 4TV5A 2OLSA 4KRZA 1PKYA 3M0JA 2XZ7A 3EOEA 4HYVA 3SRFA 3SRHA 1PKNA 1O5QA 3QV8A 4YJ5A 3FA4A 1KBLA 3T0TA 3EZ4A 3KTXA 4L9ZA 1F8IA 1U5VA 4MF4A 1PKMA 1Z6KA 3E0VA 3R4IA 1XG4A 2VWTA 2XZ9A
chains in the Genus database with same CATH superfamily
3GDBA 4V27A 3MMTA 3UQNA 3MWAA 3WFZA 4PEKA 2OQYA 3F5JA 4OU1A 2C18A 2PTXA 1SW0A 3NDYA 1SW7A 1FH7A 1VBUA 2O56A 5G1MA 1TPVA 4WVXA 3AIQA 4Q8OA 4GVFA 4HHLA 2P8CA 4B3KA 1A5KC 5CBBA 4GO8A 1HL8A 3V4BA 4NX5A 3GZAA 4GBDA 1GORA 2R1LA 2Q71A 4YPJA 1R38A 3I65A 1JCYA 1EIBA 1EX1A 1R87A 3PTQA 4UC5A 4GINA 2XHYA 5M03A 1GQIA 1JXKA 2J7DA 1C8YA 1WP6A 3AHZA 1CW2A 1G7UA 3GVWA 1WXJA 1K1DA 1VBGA 3VIFA 4AWTA 1F07A 2BBFA 3ITGA 3FSTA 4A8IA 3GFYA 4G1KA 4KCTA 3W27A 1VEPA 1C29A 4C6MA 4TQTA 3SCRA 4UOZA 1U5HA 1LOLA 4FF5A 4QM1A 1DJHA 3GNOA 5H1WA 5C8BB 4HQVA 3LD5A 3UWQA 3MV01 4Z2KA 4G9PA 3EBVA 4XWUA 1ZBWA 3AJ7A 3SAZA 1V0LA 1WZMA 3URNA 3SDOA 1JCXA 4RK8A 2PF8A 2WLYA 3KS5A 2VWTA 1PSCA 4F48A 4PTXA 2C6QA 1WAWA 4K68A 1CYGA 3E2VA 3VNIA 1KTCA 5HJXA 5I06A 4Y9MA 3C86A 1RVGA 1V08A 3N19B 2X2YA 1TPEA 1GEQA 1Q8JA 1T7LA 3GH4A 1J11A 3JR2A 1UD4A 4F0KA 4ONVA 1AH3A 3VOFA 2CETA 3C8FA 3IANA 1G0CA 4DJDD 1OX4A 2EKCA 1F6YA 3EA3A 2Z2UA 5CQ1A 4Q4KA 4B91A 1RVKA 1VHNA 3B8UA 5A94A 2DH2A 1XWYA 2VENA 4CD5A 2OEMA 2DT2A 4CNTA 5HA7A 1E6RA 2J62A 3BAJA 4B5WA 2ACSA 1JEZA 4TMBA 1GWJA 5DMMA 3ZXWA 1F3TA 3QQWA 3KVJA 3TE9A 1BVWA 1WDDA 4RXGA 1KD0A 3CO8A 3HGRA 3REQB 2WANA 5EL1A 2NQZA 4YWIA 1XS2A 1BKHA 4TR9A 3G3DA 3M7WA 1XJBA 4DJDA 2IKGA 3B9OA 3E74A 2Y89A 3G24A 1EZWA 2Z7GA 3USBA 2QNEA 3FA4A 3VZZA 3F2BA 2YX0A 2HEJA 1FH8A 1SFTA 1KR0A 1VFTA 2ANUA 2WZTA 3EKLA 1HVQA 3TW6A 3WH8A 4D8ZA 4MUZA 1UD3A 1A3XA 1W3HA 3L5AA 3W82A 4UTTA 2EPMX 4JIIX 4GQRA 3YPIA 1EP1A 2PU1A 3SURA 3GIYA 3NZQA 2VQTA 1EXBA 3LMYA 1SR0A 3WLKX 3F4NA 1UP2A 5IBXA 1QBAA 4M0XA 1L6SA 3S9ZA 2YL6A 5D38A 1IXPA 5DMNA 2V5CA 4AEOA 1EJ7L 3ARTA 1TA3A 3PPFA 1YW1A 5D30A 3O3RA 1Q6LA 3KBNA 2E5DA 4HB7A 4L4MA 1K9EA 2EPOA 4PEEA 2B7PA 1R2RA 3VIIA 3P2VA 2E8ZA 6REQB 2UY5A 3OU8A 4CNUA 4FOJA 5FEPA 1UR9A 3UXAA 5EMKA 1KM6A 3AQUA 3UGRA 2WNWA 3UA4A 2E7FA 1UKQA 2CITA 3LV6A 1GPWA 1Q65A 1DWHM 2W4XA 2I9UA 1RZMA 3KP1A 3DOPA 2OFJA 1XC4A 3S1UA 2ESCA 3NVDA 3HPSA 4DBDA 2BVDA 1YE4A 4ZOCA 1EJUC 4QDMA 1Y7VA 1XYBA 2D2JA 5AHEA 5T8GA 5HXMA 3DU0A 1DJWA 3QY6A 4I3GA 3K4WA 5D2XA 1YIXA 2ZYFA 1OD8A 3BAYA 3M41A 3S2CA 3T7VA 4OFCA 3K1DA 1KB3A 4CQ9A 4LYKA 1DKWA 3RO8A 1P7TB 3FS2A 5CSYA 4LS2A 2Y24A 1UC4A 4W5ZA 4OBTA 4AFYA 3RX4A 3GTHA 3EMQA 3T42A 3PPCA 3U57A 5AB3A 3EB4A 4O50A 4O1CA 4C6FA 2PDBA 4F9JA 1Y0EA 1GVRA 1EJVC 2VD8A 1EP2A 3TQPA 2B0MA 4E4UA 2IQDA 3TJ4A 4H9VA 1BYAA 2XIBA 5CPQA 3EWYA 3SI9A 1FHLA 2IXUA 4D6FA 2GYIA 1TR1A 1TCDA 4P8XA 2F9RA 2ZXQA 1V0KA 2A6LA 1JYXA 2A21A 2OYLA 2YA2A 5MKGA 3CB8A 3RN6A 1LJYA 3TYEA 3AC0A 4GY1A 1G69A 4W88A 3F4WA 3GR8A 4PTNA 1REQA 3B8SA 2V5JA 4P7QA 1I8JA 1B57A 4PCSA 2P50A 3A4WA 2VFIA 4JTHA 1MEIA 4R7JA 2Y6ZA 3K8LA 1K7XA 2VOMA 3WL1A 3WL0A 2CZVA 4OJYA 3H23A 4JDBA 1BLIA 1XYLA 1GQNA 2TYSA 4G2DA 2QGYA 3MKVA 5C0QA 2VZOA 3HPZA 3AIRA 1PKMA 4KGLA 2XSAA 3SCTA 1TJRA 1ADSA 1KRMA 5HMSA 3C0JA 3GU9A 2DZTA 4O4WA 1X1OA 3AYRA 1XRTA 2JF7A 2GDUA 4Y8EA 3GKAA 4KCVA 4DAFA 1SZNA 5LNRA 3OQ8A 1K8CA 1XP3A 4A3QA 1E6ZA 3A5VA 5LNSA 1BEUA 3W7OA 3EPNA 2YDQA 3CLWA 4IXHA 3AXHA 4AU0A 4KS0A 3RMEA 4PMNA 1CNVA 3APYA 2EBNA 1QU4A 5BOOA 1EJSC 3OTRA 3R10A 4YHGA 2O4QA 3NDZA 4D6CA 2OZ0A 1ZP3A 2W61A 4I8YA 3UR2A 3VDGA 1XL9A 5DMLA 1V7YA 3W7IA 5E70A 5D9PA 1G94A 4Z1BA 4C6LA 3RJXA 1J79A 3GH7A 2UV8G 3OGSA 1V79A 4Z42C 2W66A 2FZ8A 4IFOA 1JCMP 1UQZA 5C55A 3NQAA 4DYKA 2HE5A 3DZ1A 2I14A 2IKJA 1EOKA 2O55A 3HG3A 3N73A 2FJKA 2RDTA 1H7XA 3EOEA 3NQ2A 1W9DM 1WXYA 3PUEA 5AY7A 2FKPA 1FFQA 3ZSSA 5EMJA 3AMKA 4A3RA 2H8ZA 2BGNE 1F2JA 5CPSA 1TMLA 1LBFA 5G4WA 3PP7A 5LHFA 5L9FA 3EDDA 1KO0A 3M43A 4C1LA 3T78A 3VZYA 2P76A 3IJQA 3UWEA 3NQ8A 3UXIA 3LM3A 5K3VA 2PGEA 3UNDA 3I7QA 3S9YA 2OCZA 5KITA 1ISZA 4URIA 3GM8A 4B9ZA 2XVKA 4C5ZA 4LPCA 3WQWA 3V5CA 3KX6A 1V3LA 4S3GA 4Q4RA 3NCOA 1K9TA 2X0YA 1W32A 4HT3A 2ZKMX 1IZCA 3ZR6A 1TE6A 5C9WA 4M81A 1FXQA 3VGFA 3KOFA 5LNWA 3EB2A 4CQDA 5ABFB 4MKSA 2XINA 3TYBA 4XAZA 1XQLA 3KAOA 4LEQA 1X39A 3V75A 3H7VA 3SEPA 2OZ8A 4FS9A 2AOSA 1TCMA 4KEVA 4JFWA 4LVDA 3O05A 2OR2A 5CC7A 1YHTA 1NOWA 3CTLA 4Q8TA 3LQLA 2HVMA 3VMPA 4J3UA 1K4GA 1HT6A 2NLIA 2ISVA 5C9RA 2TMDA 4UNKA 1QXLA 1MSSA 1WNOA 4BI6A 3NSNA 4Y9AA 4XD3A 5I2UA 4LNYA 1F76A 4HZ7A 4R5EA 5FJUA 2R9RA 3NO1A 2NQ9A 5A2CA 3C56A 4Z2GA 2H3DA 3MKKA 3VIJA 3W1XA 1QATA 1F61A 2C79A 1ADOA 3BOFA 1W3NA 3T2QA 1F6PA 3WQOA 2PD5A 4HPGA 5EMUA 4BHYA 4WJ8A 1UQYA 3HA1A 4H19A 3W53A 4LVFA 1FHUA 2BVTA 4PUDA 2W27A 3S5ZA 4MOZA 5FD0A 1CPUA 3MP5A 4DVOA 5MKGB 3W1TA 3GXMA 1WBJA 1IF2A 3E2RA 2DSWA 1FH9A 2J7HA 1YLVA 4QISA 4WRHA 2VYOA 3V35A 3W70A 1HZYA 3KBWA 2VR2A 1QMLA 5AC6A 3TLQA 4JZ5A 2CXGA 3RHGA 5DN1A 3DESA 2PWVA 3WD0A 1YTDA 3VD3A 1KM1A 1VC4A 2Y5SA 3M6YA 1F5ZA 3ES7A 4LS0A 1SYTA 1D2KA 4IMEA 3SCSA 4MPKA 1PX4A 3ATZA 1LTDA 3CAQA 3Q58A 2OT1A 2FZ9A 4H8VA 1NY1A 3VVGA 4WX2A 1RXOB 3LA4A 2Z1VA 5H8UA 2CKRA 3IIZA 4J3SA 4XSMA 3GW3A 2PPGA 3SGUA 3K5XA 3KLLA 4J35A 4INFA 3RRAA 4O13A 3WLOA 1S5MA 4UTLA 1M6JA 1U30A 1FX6A 2PBOA 5I3KA 3BGGA 5AOUA 4O12A 4DI8A 1KWGA 1XRSA 3GNPA 3ICJA 2CHOA 1CGVA 3NVTA 4AHPA 1QT1A 4J3XA 1Q66A 3QTPA 4F2UA 1XD1A 1AJ2A 1W54A 3NFUA 4OOUA 2DU2A 4ACYA 5A6MA 2PDUA 4D6IA 5ABTA 1NDWA 3KFTA 1W1A1 5CPLA 1GW9A 2V82A 1TREA 1ISYA 4QG6A 5E9AA 2Q3RA 4ZENA 3B3DA 2D24A 4PMQA 1A3HA 2YDAA 4RZBA 3ABSA 2OZTA 4IFRA 3OW1A 4ZFMA 1XBZA 1TMQA 4MM1A 3VILA 4BJHA 2YW3A 1C90A 3CZGA 1E5NA 3CB3A 3U4FA 1J01A 2VEKA 4GQQA 1TJ0A 2WPGA 3TEVA 4AIBA 1Y65A 1S5WA 2CBJA 3SSJA 2WWCA 3SY5A 3AMCA 4I9TA 2XFWA 5G1YA 3RIKA 4AD4A 1V6YA 3ZR5A 4JTGA 2Z1XA 1X38A 3QHNA 3NL6A 3AUOA 4KKXA 4QBXA 3L4UA 4X3ZA 5HUPA 4HHPA 4L5ZA 4XZ9A 2ZIDA 1U2YA 1GW1A 1MQQA 1U5VA 2ZTKA 3GC2A 2FH6A 1OBAA 4KQNA 3L7RA 1X97A 4MY8A 3WJZA 3QC0A 3OLDA 1F05A 2XN0A 2PTZA 3UPBA 1QOQA 4CVUA 1S3TC 1GOOA 3CHFA 5CZSA 1PTAA 4LV9A 4ATWA 2V8ZA 3QEZA 3VD7A 4D72A 3SCQA 2Y70A 3LOTA 1UUMA 1EPVA 1REQB 4OE7A 3SR7A 4CQAA 4DJDC 3CO4A 3MP4A 2VNCA 4CVWA 4FR6A 2EG7A 1OFDA 3U6WA 2XH7A 4QJ3B 1MXSA 3HQPA 2WZEA 1D3GA 1ITCA 1EA0A 1D9EA 2E4TA 1WDSA 1KBKA 1YDOA 1BYDA 4LYQA 1ADDA 4GPNA 3B8DA 3I3DA 3W86A 3NQMA 4O1DA 4XZNX 1XKJA 5GJPA 5AC4A 3PFMA 4Q8UA 1RY0A 3A23A 4DPQA 4M29A 3WJYA 3UZZA 4H83A 2NSOA 2V5KA 5HWJA 2EHHA 3SUVA 3AIVA 3SZ8A 2OT0A 2XGIA 3VCCA 3FNDA 4MJ2A 3NGFA 2QEZA 2RH9A 3M07A 4NY2A 3P0WA 2I56A 4O1BA 4U3AA 2ZA2A 1KW1A 1FQ0A 4W84A 1LBMA 4MUPA 3IGXA 5T9BG 4J5NA 3PANA 1DOSA 1Z89A 2ALRA 4IPLA 1DJIA 1VCGA 3FCPA 1YPXA 1DQXA 2FMNA 4JTQA 4UR9A 3WSUA 1UR0A 2OKOA 1HKWA 2VFGA 1K4HA 4HKPA 1XHGA 1AODA 1RUSA 2XVLA 2ZZ6A 1HL2A 4DB7A 3M0LA 2VURA 4DBUA 4GYPA 3KM8A 1LUCB 4N9DA 3LZ5A 4U5KA 5D32A 5E0FA 1CGXA 3ZZ1A 1E0XA 3WQEA 4HN4A 2V3FA 3CMJA 3CHCA 4XZIA 4GFSA 4QDPA 1RBOB 2QVNA 4QQUA 3HQ1A 3AFBA 4F4RA 4U28A 3QPZA 4AY1A 4V15A 4Y90A 3WJXA 3BTNA 4IP5A 4JTUA 4HNTA 4KEUA 3WDRA 4ZTXA 3SUTA 1N2VA 1OK6A 4DO4A 4KRUA 3OO2A 1I1WA 1BAGA 4ADSA 3HQNA 3SN0A 4JPGA 1N55A 1AVAA 3WIJA 5LZLA 2OO6A 2H9AB 1PTGA 4U2YA 2D0HA 4AH7A 1EBHA 4YCPA 1TKKA 5FJJA 4PRTA 3CL6A 2GJPA 4RDYA 3NR0A 2YL9A 1HW6A 2C15A 1TSIA 5FEWA 4BFAA 4JIQA 4H7CA 1D3CA 4R7OA 5IDIA 1TX0A 1O5XA 2X16A 3BUVA 4AW7A 1H5YA 4S38A 5LIWX 4IQLA 1B3YA 3O2LA 2WYSA 4QJ5B 1TVNA 3V3WA 4JX5A 3TXZA 2GSJA 1XSKA 4G7EA 1VYRA 5E6YA 1KRAC 3VPLA 5LYRA 2YA1A 2D1ZA 2VZTA 3IVTA 2ZUTA 4DZHA 2VTFA 3HV8A 4KFPA 3PBYA 5CGMA 3NSXA 1H7OA 4DLMA 3AXKA 1CCWB 3DCPA 4NJKA 1CENA 1NOUA 2Z25A 3MA8A 3V1PA 1TG7A 4DZIA 1FCQA 3LU2A 4H1ZA 5BOFA 3FA3A 1TV7A 4LAKA 2V63A 5ABGA 5AKQA 3TSMA 2DUXA 4FIRA 4GX8A 3TP4A 2IUZA 3UG5A 4JR5A 4N42A 4O1AA 1ISVA 1CECA 1UASA 4ZXOA 3B05A 4ZR8A 2R1PA 1GVQA 3QQ0A 1L8PA 3G1RA 2ZX9A 3CQIA 3NA8A 1A80A 2PDLA 5LNVA 1BG9A 3GO2A 3P67A 1XIFA 3W22A 2EO7A 1A0DA 2VX7A 5I02A 4QE4A 5KSWA 3VOHA 5D2WA 4FOKA 2OLSA 1P6WA 2XWEA 2JIEA 4LXFA 1XDMA 4MZ1A 4B3ZA 2J77A 3P5ZA 4HOZA 1ZFJA 5EPDA 3ARVA 1VPXA 2WOQA 3N2CA 4UIOA 1ZJAA 3COTA 2CIPA 2POZA 2OYMA 3VD4A 2HJPA 3HJEA 2WM0A 1Z42A 4MJ4A 4WIWA 4LVBA 1GZ1A 3FJNA 2CNCA 1S3HA 1OWQA 2H3BA 1CGYA 2PP0A 2P8BA 4WSHA 3W6YA 1YBQA 2CLEA 4JEQA 3BURA 2TODA 1OINA 1GJUA 3N6HA 3SUUA 3EWZA 2GGEA 4F0MA 3BCJA 1ALDA 4IMGA 4CD7A 2CFFA 3DHDA 1UROA 2PE4A 2FVMA 4S2CA 1CLVA 4M6PA 1LLOA 4L1WA 4TVCA 3HQOA 5DO8A 3DKLA 4BEUA 1Q4WA 2ZADA 4NRSA 5F2LA 3VABA 1YXCA 2GVLA 4GYJA 3H21A 4XIAA 3VD5A 1JPIA 2XM1A 4ZOAA 3QW4B 3HGOA 1WDWA 4EX4A 4UOQA 1E6QM 2C71A 2Z28A 4QNWA 4GXMA 1I2PA 3W1QA 3B0VC 4HPNA 1BGGA 4F9DA 4QGCA 2E6FA 4V2XA 5I79A 3LDVA 4AZGA 3BLDA 3MCMA 1EF2A 4IZGA 4W4QA 1HFBA 2UZ9A 4OVXA 4DYJA 2X41A 4YWSA 3VX1A 4WUIA 1KM4A 4HOXA 2GVJA 4X9SA 3DI1A 3UG8A 4GLEA 1KBBA 1DQUA 4JQ4A 3QZAA 1PE1A 3RR4A 4RW3A 3HBLA 3C2YA 1GKRA 3FEMA 4RZ4A 2C16A 1CBGA 3AS3A 4JN7A 3BARA 1OZMA 3WUGA 1HJSA 2WSRA 1EYEA 3USZA 1EIXA 6XIMA 3SY1A 5HWMA 1I6NA 4H8HA 5L6UA 4RR4A 1WKFA 3FYYA 4F2TA 2A3AA 1XLKA 3MW7A 3E38A 3M4HA 2DVTA 5FSDC 1A47A 3R43A 4O18A 4W8AA 5LSMA 1HKKA 5BYWA 3WNNA 3TZNA 3CYVA 1OQFA 1UZDA 3UWWA 3PHAA 3FJ4A 3S2LA 1KFEA 3MVIA 4UWMA 1GQJA 4H9TA 4DO6A 3I10A 2OVLA 4JOMA 3L23A 2J75A 1ZL1A 3D5HA 5AYXA 1DIDA 3J7HA 3PBWA 4ZB5A 1L6WA 3O1NA 4H9ZA 2IMRA 4MYXA 5EMMA 3AI0A 2PP1A 4ZO7A 4RL3A 3KVKA 4FXJA 4IJRA 4I9JA 1M53A 3G1XA 2BMBA 1ZJIA 4RE4A 1SO4A 4FI4A 1Z69A 1G4PA 4JCMA 1ICPA 3SRFA 4RW5A 2DORA 3OOQA 3T6CA 3W1MA 1J6OA 4JKKA 4RZ5A 2X1TA 3VYLA 1QHZA 2NLYA 4IX0A 4B92A 4Y6GA 3WEMA 3WBYA 4GISA 4FLRA 3TTQA 5KTLA 2J47A 3H24A 3L12A 4PFHA 5D02A 4R9XA 3IV8A 5D03A 4BI7A 2WZIA 1OC5A 3W4RA 2L5HA 1LRTA 2B7NA 4PMRA 4Q8NA 3R0DA 2J24A 4EACA 4MY9A 5DT7A 1TPWA 3PC0A 1NVMA 3WK0A 2EJ1A 1IWBA 4IPPA 1UD8A 1B3XA 4RNJA 1XV8A 3I3BA 4W8LA 5F1VA 1H0IA 1Q8AA 3WLSA 1FWNA 1S2UA 5C2GA 2WC7A 4FNUA 1HGYA 2VFHA 2XWDA 3JS3A 3CJPA 4XUYA 1YDVA 4FX6M 1KR1A 3GXDA 4M56A 1B4KA 3UFYA 4TUFA 1J8VA 3CWNA 2A1YA 1MFUA 1J96A 3CU2A 1TPDA 2Q01A 4QITA 4UCGA 5AYYA 1Q7QA 3LX9A 3CWOX 4L7ZA 5XIAA 3PTMA 4PC8A 1VJIA 1KC7A 2WMJA 4ALDA 2P1FA 2PDMA 4ZBCA 3DG6A 5D05A 1GVFA 4CQCA 3U48A 2DT1A 2GDQA 1AA1B 2VVNA 4B5XA 3KOZA 3FGCA 3WLLA 4NQ1A 4NL1A 1KQYA 4DM1A 2DSKA 3TN4A 3W7NA 3LPGA 4ZQOA 1RCXB 1XIHA 3NJ3A 3IEBA 1EHNA 3R4IA 4A05A 3TQKA 1ESWA 3EPOA 3OVRA 2WO5A 3MUIA 2HE8A 4J40A 3LYEA 3IV3A 4ASTA 3IJ6A 1VJZA 1W2VA 4IUOA 3JRKA 1VS1A 1JPKA 2VC6A 2IKHA 4PL1A 3EDFA 4IGNA 2FLIA 3L4ZA 2DFAA 4UTHA 5JXQA 3O15A 2O9TA 1XCWA 2CLFA 3HGJA 1V6UA 4LYPA 2F38A 1JYWA 1QI2A 3EAUA 2RDXA 1R85A 3O63A 1PV8A 1HO1A 3E0FA 3CPGA 3T4CA 5FF4A 3GY1A 1KRCC 1RR2A 1QI3A 1YDYA 4O28A 3A4JA 1KFLA 2YOCA 3KUMA 4KWWA 1OFBA 4ECLA 2OGJA 1QK2A 1TV8A 4HK6A 1J0HA 1JDFA 4QS5A 3E9AA 4C6PA 4EAYA 3KHDA 3UD6A 1O1HA 3LCHA 2W9MA 2YCLB 3A24A 3B06A 4CGTA 2BVYA 1V4YA 1Q7MA 4FF7A 2JF6A 2G3NA 4X9YA 1UIPA 3KEHA 5IRPA 3KWSA 1IEVA 3ZJ7A 1QJWA 4DI9A 3LTYA 4HA3A 4XD5A 1RLDA 3CM4A 1L9WA 4N6FA 3EDEA 4TIMA 4B15A 1FWTA 1C93A 1SR9A 1EEPA 1TV2A 2F2KA 2F6KA 4ZL1A 3ARWA 1Q6RA 2FIQA 3KRUA 6A3HA 1XICA 1QUMA 3VU2A 4H6RA 4XD6A 1T99A 5BZAA 1G9HA 1U33A 1LWJA 3VD9A 1J18A 4MTVA 1DWFM 1UKOA 1ZS2A 3GTNA 4LF2A 3NL3A 1PUDA 3N2XA 3L2MA 3IK4A 4YU1A 1A4LA 3IIVA 4O15A 4KWUA 5LIYX 3L68A 1MYRA 3MJMA 2PDPA 3IIOA 2QUMA 3AYVA 3EA2A 4DUXA 3C2OA 4EP8C 2Q02A 3ZS4A 2DY3A 4WD0A 5A5WA 2R1NA 1TTJA 1W3KA 4WDXA 2HBXA 4LCRA 3B97A 2IQ0A 3WNOA 2PBGA 3W76A 3W00A 3WUFA 4NVTA 3SJNA 3ZOAA 3L4XA 4R85A 2BHUA 2QAPA 1EQPA 1ZALA 1K3UA 3H4GA 4XAPA 1MQRA 5DCEA 5FL0A 3LBOA 4C6NA 4EPEC 1Y5WA 1W9XA 4O14A 3AAMA 4Q32A 3B0PA 5HOSA 1JULA 1SW3A 1W1VA 3M0XA 3A5FA 4C1NB 2P10A 5XIMA 2AGKA 5KZEA 4IL0A 4HJFA 1HGWA 4WF7A 3CZJA 4IGSA 3LCXA 4L64A 3EZ4A 2CYGA 1V51A 3GG7A 2B31A 5AC5A 1JG9A 1RP8A 3HU7A 4Z2JA 4BWLC 4QRNA 3CUGA 2QS8A 4H4IA 4P7LA 3R94A 1X7IA 3N29A 5A6KA 1KFJA 3M5YA 2Z2BA 1EFZA 4ZE4A 3QN3A 1AJZA 5JIWA 3BCFA 3W07A 5FEZA 1JZ5A 1XISA 1TQXA 1ICQA 4GGBA 4PCTA 4P8WA 2BG5A 2ISSA 2QUTA 5GQBA 3MZ2A 3QTGA 3P82A 3SN4A 3WDQA 1CGWA 2YCJA 4U2ZA 3WQGA 3S8HA 4JL2A 3TTEA 3QOMA 1K8YA 4NJHA 4JTJA 1NU5A 3UYCA 2OJPA 1KGWA 5FIPA 6TIMA 2Y8KA 3UCCA 1R46A 4S1FA 3CPUA 3FV9A 4GUIA 3H7RA 2YCEA 9XIMA 3G1FA 3QH2A 1BSIA 3BW4A 3AZTA 1F4AA 4WDUA 1J93A 3M44A 2Q8XA 5M2FX 2C13A 4KRZA 1WDRA 5DLCA 5E0CA 1XD0A 2QJNA 2HDJA 3OHIA 2OTDA 5GJMA 4OHQA 3U9IA 3E49A 4MZYA 4NYYA 2C1HA 4GC3A 4QNEA 3A6OA 4Q8VA 5KZDA 1IR1A 3PTDA 1HNYA 1M03A 1V6XA 3H70A 4JTEA 1YEYA 3Q67A 3OGVA 4LH8A 2Q09A 3NL5A 3T0CA 1IEIA 2PDWA 1JYNA 1GOWA 5C9XA 4DF0A 1QPOA 3AU2A 4FHAA 4J3TA 4LAOA 3L5LA 4IMDA 2FHBA 2ZZ3A 1EC9A 1JZ8A 1CXIA 2CXEA 4NXSA 2F84A 4NNAA 5HULA 3WQVA 1QFEA 1QNOA 4LB3A 5FJTA 4DPPA 4RX0A 3HJZA 3F5KA 2DSZA 2WB5A 2WSPA 4PE8A 4PUUA 5C9ZA 1XFCA 1VFSA 1UR2A 3S1XA 5A69A 5D09A 2HXTA 5AYZA 3UP8A 2YW4A 2O9PA 1EDQA 4N4QA 1XIMA 5A6LA 1JRCA 3SCNA 3THQA 4CD6A 4L4PA 3GXFA 4NAEA 1M7PA 5D04C 4TV5A 1AW2A 3A21A 2FVLA 3UWVA 4ZA0A 5A8GA 3P93A 1CIUA 1P1XA 1CI1A 1EJTC 3SRHA 1JDAA 2VR4A 4O52A 1TA3B 2Z1WA 1WKEA 2IPGA 2GK1A 1IT0A 2JK2A 1UR3M 4B9YA 4LU0A 1JGIA 5HR7A 1AZ1A 4UFLA 3QQ1A 1V3JA 3DG3A 4Z17A 3N13A 4W9TA 2AGTA 3D46A 4EPDC 4O0QA 3VKKA 2ZXAA 1NH6A 3GC5A 4AD0A 1LL6A 2DSUA 4LBUA 2BOGX 1W17A 3NOEA 3A22A 3W26A 2FHFA 3GNRA 2HPIA 4RDVA 4IQEA 2ZUMA 3T09A 4NZ3A 5CPTA 4X2RA 3S5NA 4ERGA 3EEGA 4S3EA 1ISXA 2VDGA 2J7FA 4Q22A 1U1HA 1LBLA 2A0NA 2ZZ4A 3N14A 1Q6EA 2E68A 1KNWA 1YNQA 4JYDA 1TE1A 3OBEA 4C6CA 4GJIA 4K8EA 4QX4A 4YMZA 4UQEA 2QF8A 4HSHA 3VOJA 4AEEA 2NSXA 4MB3A 1L8NA 3JW7A 4JTSA 4ROPA 1K7FA 1KM2A 1AH0A 2QW5A 3AMLA 5HQLA 2YCLA 4P7NA 4N6EA 2PMQA 3ZQ9A 4FR1A 2ZDSA 2BNJA 4WKFA 3A9IA 4W8BA 2PGWA 5TNVA 2XGZA 1GOXA 3GU2A 1OF8A 3GVGA 2C0HA 4IFKB 3HM7A 5I0DA 2PAJA 2FZMA 4KF1A 2BODX 3TC6A 4MB5A 1Z7AA 1PWMA 1RPKA 1A5AA 2CLLA 4AVFA 1CGUA 2VC7A 3NQ6A 3HFYA 2WHJA 5BXTA 5IM51 4KWVA 4W89A 4PBGA 3UJRA 4WJEA 4QR6A 3ITTA 2JQXA 5F2GA 1TMHA 3INPA 2XN2A 1VHCA 2XVGA 2BFGA 4DN1A 4F40A 1JUEA 4DWSD 3HIJA 3WNKA 1UHVA 2PD9A 1UKSA 3KTCA 3WX7A 3URBA 1MUCA 3II1A 4MDOA 5FSEC 2PLCA 3GG0A 2HSAA 1KA9F 5I77A 2WQDA 3ANYA 4MAVA 4OZOA 2DZWA 3ZSTA 1JR1A 3LBMA 1NDVA 1KLYA 4UOJA 4W85A 1KM5A 1WO2A 1HUVA 3C2VA 2Y8VA 1FHDA 1EC8A 4NRRA 4JFTA 5FJRA 4BI5A 3VUPA 1P0DA 1JQVA 4OTKA 3QW3A 2VCBA 1XIDA 3GVQA 5I6SA 1W5OA 3W0KA 1Q85A 2ZUSA 4MF4A 3NXLA 3LN3A 4TX6A 4F79A 4AYSA 1M7JA 3OA3A 4QDWA 2AAMA 1NTHA 1NF0A 4H8UA 3FA5A 1U1UA 1ZU8A 3WG6A 2PRHA 2RDWA 4LUSA 2XVPA 1G4EA 5ABHA 5EB8A 3WDPP 4HU8A 2YL5A 4W5UA 3EB3A 2Z0IA 2X1SA 4LY4A 3NQDA 3WF1A 3MMDA 1H49A 3CAVA 1Z32X 3ZVIA 4G56A 3T08A 4QQ3A 1IEWA 2X8RA 1FWAC 2YL8A 3L0GA 2P0OA 1OVDA 3LRMA 4EF8A 3PBGA 2J74A 4ENLA 4PCFA 5REQB 3MHFA 2PFHA 1R9ZA 1FDYA 1VYPX 3BANA 1Q63A 3ARPA 1B3OA 3GDKA 5I23A 3G1DA 4HPJA 5EBAA 4AD1A 3DBPA 4OUIA 2PDYA 3CUXA 4LRTA 2XIOA 6CGTA 4EWJA 3JU2A 1NP0A 4ICCX 3CZLA 4OQVA 4XTIA 2E6AA 4O0ZA 4PMUA 2GSEA 2YJQA 1IT8A 2QJMA 3KL3A 4O17A 3GDTA 4YS1A 1WV2A 2ZUVA 5CLWA 2WBKA 4Z1DA 4C7FA 4UZSA 5CC6A 4H9UA 5A95A 5DBTA 4G7EB 1VEMA 2V5LA 3O06A 4RXFA 2CZFA 3EWUA 4H9XA 4Q8PA 4YVXA 4JS3A 4JQ2A 4EAMA 2DT3A 4CU6A 1ODUA 1RPXA 5EYWA 3UWUA 2E25A 4ZO6A 4IJCA 1V03A 1J0KA 1AD4A 3NO5A 3OGRA 1C7TA 1R3VA 2BHZA 7REQA 1NWTA 3WMCA 4ACZB 2F6UA 4MFDA 4RKAA 4TV6A 1B0IA 4AHQA 4ZFCA 1BF6A 1TZ7A 2RJGA 2VX6A 3W3OA 3KWXA 3E6EA 3CL8A 5G2IA 3CK5A 3MUCA 4XTDA 1TWSA 3BSGA 5T26A 4OWGA 4J3VA 3BE7A 1H0GA 4M1RA 4X63A 3W2KA 4E8GA 3IAQA 5AN7A 3H2FA 1PYFA 3EX1A 1V3HA 3KBJA 2PWGA 2B4GA 4GZ7A 4ML9A 2JEQA 5DEZA 1J5SA 2I7GA 4AQLA 1RA0A 4YTQA 1ZBKA 2W5FA 1EYWA 4AIOA 4K7VA 3G3MA 1J6PA 4AZCA 4BQ2A 3L65A 2ACRA 3QZEA 4KETA 3PBUA 1GQKA 2HCVA 1XIGA 3I3EA 4C1KA 3BC9A 1ONRA 1EJWC 3P84A 3PAJA 2BOEX 2FFCA 4BCEA 5EFFA 2RHGA 3CHDA 2AQWA 4UTUA 2CLIA 1NWUA 2HS8A 1XBVA 5KEZA 2ABAA 4KRTA 4LRSA 4AHOA 1H09A 3A47A 2DSVA 2FDSA 4OOZA 3LSCA 2DUZA 4S3KA 4HCLA 4Y9PA 5ENLA 1HL9A 4HVXA 2A7PA 1VJSA 1DXIA 2ZVRA 3GRIA 2PDCA 2VZUA 3IAPA 2GPTA 4Y7EA 3GB6A 3ZM8A 5ECVA 1VPYA 1MXDA 2DT0A 2OQLA 4KCUA 1WE5A 5A1AA 2ABBA 1OYBA 1D8CA 3R8HA 1BFNA 3C2EA 4FNQA 4C6EA 4DUVA 3W7EA 4ZGYA 1UWAA 4FALA 6XIAA 3N17A 4NJGA 2D2HA 3BOLA 3AHYA 2JBMA 2NUWA 3VKCA 3WY1A 4RNFA 4QJ1A 3E02A 4P7OA 7XIMA 3CASA 4K6AA 5CBJA 1IIHA 5U4NA 4XBJA 3N18A 2DJXA 1SSGA 3W9ZA 3R11A 2QVHA 4A21A 1H2JA 4O57A 3STCA 1TUFA 4GK8A 3LNPA 3RFAA 3H8AA 4R9OA 1PBGA 3CWHA 2CU0A 3UG3A 1SM9A 1A3WA 1XF0A 2CZEA 3CTTA 5LGZA 2WVUA 3H2EA 2FFIA 1XLEA 4WSKA 4A22A 2IW0A 2YFOA 4K3ZA 4A2RA 2GUBA 1E0TA 1XGDA 3E2QA 3A3HA 1UOKA 1MRQA 1A5CA 1FBAA 3QPEA 4GWEA 3DFSA 3WLTA 4S3DA 4GZJA 2CCRA 2QZRA 3TJXA 2FPYA 3V0TA 1S5NA 1RQEA 1QOPA 4HA1A 4ZO9A 1E55A 1V0NA 4WGXA 1EDTA 1BHGA 3I6EA 5JQ9A 4UTIA 4AMAA 3WQCA 3NQCA 2I17A 2V68A 4J7RA 3MANA 5F1UA 2BGQA 1H7PA 4EIVA 4Z1AA 4QSHA 2C91A 1J0IA 4NAEB 5TQLA 5LNUA 4W87A 3W71A 4UMAA 5A6AA 2J8FA 1DTNA 4GABA 3MB9A 1KFWA 1F6KA 4CNOA 2E67A 3FFSA 1E1CA 2GJXA 3L2LA 3S1VA 3WD2A 1EO7A 1WOBA 3B0YA 1QNQA 4YJ5A 1EL3A 2OODA 1DEDA 2I57A 4ZODA 4AVOA 1LG2A 3W7RA 1QDSA 5K2ZA 4KESA 1JF6A 4RUBA 4UFHA 4DJED 5F2MA 3E0IA 4AY8A 3WQ6A 3H53A 3AROA 3WNLA 3VKJA 3T55A 2ICSA 4KERA 1E1FA 1H11A 1DP0A 3M47A 2Y7GA 4HNLA 3LCWA 3GBEA 1PIFA 1YKWA 1UR8A 3VNDA 4MWAE 1H60A 1OC7A 3NQFA 1EJRC 1GHRA 4JKMA 4YVVA 4XV0A 3I6RA 4L80A 2G3IA 3QPYA 2R8WA 3VKDA 1YX1A 4L9YA 1W5PA 3QLLA 3V16A 2LLEA 5CPNA 4IHCA 1KXVA 3OG3A 5B80A 4GH3A 4B2DA 2ZE0A 1WKYA 3MQTA 1EH9A 4S3FA 1P43A 4CCCA 2H9AA 3KOYA 3TWAA 3E5BA 2Y2WA 4XISA 4O4VA 2E28A 4BS0A 4ZQMA 5C5YA 3BJFA 2AL2B 3S4TA 2MNRA 3DENA 3OLEA 1N82A 3DFNA 4EXAA 3KDOA 1T96A 4AD2A 5A6BD 1EA9C 2PWEA 3LK6A 5JBEA 1LOQA 2PCQA 4KEZA 4YYFA 3SFKA 2A7RA 1OG0A 2MANA 1YBQB 3W24A 5IFPA 4YHEA 5MHBA 5LIKX 1W2PA 2TAAA 3G18A 3ABRA 1I2QA 1XLBA 5G2WA 4GCAA 4H9MA 4XBSA 5GNYA 4NASA 2VRKA 4X0VA 3GHUA 3E2SA 3OODA 1YXDA 4IGHA 1UD2A 4IFKA 1VFLA 2GUYA 3L21A 1NARA 2E6DA 3L5MA 2R1MA 1ZCCA 1JZ2A 3M0KA 3ARRA 5M5DA 5TIMA 4LNCA 3VI2A 3ERPA 3R5EA 1W5QA 1QHPA 1NWSA 4HNOA 4E38A 1WBHA 3NUKA 2QKFA 1UWUA 1Z3NA 4GBUA 3O6CA 4J3WA 1X6UA 2FZDA 4AISA 1M9HA 4IL2A 1TELA 3QYQA 3V0UA 5GPRA 1KXHA 3EOSA 2G8ZA 1DL3A 4GFIA 2PTDA 4PCPA 1VENA 3MSGA 1OX4B 5F7UA 2WK2A 3QR0A 4HIBA 1XPYA 3HF3A 3KE0A 3FEQA 1G7VA 4WKHA 1JJKA 2BXVA 3OLIA 2X40A 2YCIX 2XYLA 1W1B1 1W1TA 4W7UA 3TYDA 1QW9A 2HXUA 4WEVX 2VT0A 1S2AA 3CUIA 2RGLA 5I3IA 5KINA 1M5WA 1X8FA 2YBUA 5TD4A 3NZRA 3CV1A 2H6RA 3ABQA 4JGDA 3KDNA 3WUBA 4MDPA 1YADA 3WH6A 1I0BA 3RLHA 3UG4A 1JDEA 2DZVA 4L9XA 4WZHA 1TIMA 3BK0A 4R53A 3WBAA 1RA5A 2DZAA 1US2A 2GOUA 1E9ZB 2CEQA 2A79A 4PUWA 4GIRA 5B7YA 1EGZA 2ZRWA 1XH0A 1O7AA 3CHEA 5TAOA 3UW6A 2CESA 3DFTA 3HGSA 2QCDB 3QSTA 3W01A 4UMBA 4LUIA 1XG3A 3IVUA 4ZE5A 3I68A 1I45A 3GHTA 4JY9A 1QPRA 1Q6GA 1W8SA 3OPSA 3UVIA 5A3HA 3TUUA 1S5TA 5CSUA 3BQ6A 2A6NA 1EEXA 3BPWA 1QBBA 3WFLA 1R2SA 4B5SA 1ODZA 3VFLA 4GGHA 1CLXA 5DQPA 1HJXA 4LW7A 1S38A 2NXIA 5C9UA 2WNZA 1AUSL 3WLRA 3D0CA 3LV5A 3GFZA 3VIHA 2C0AA 4FA3A 3W7PA 1F74A 4XO6A 4E8DA 1YNPA 1VBHA 5CBIA 1PHWA 1UPMB 1QW8A 1RSCA 3I7SA 1WXZA 2FB3A 3O8AA 4NYUA 1XLMA 4GI9A 1ZNNA 4AB4A 2QIIA 3WQPA 2E5BA 2DDXA 3IGHX 3QFWA 1ZP4A 1FDZA 2OZ3A 1QRQA 3LCLA 4GCXA 4JHZA 3RLGA 4O8RA 4PBEA 4KGJA 4GUGA 4L4LA 3BGJA 3NL2A 1FWWA 3MI3A 3CAKA 3BLEA 4JTDA 1ZLPA 4NNCA 1TWIA 2WJEA 3UERA 4XAGA 3S6DA 3BV7A 2DW6A 1F73A 3DFPA 4M6QA 2VGIA 3BG3A 2J4GA 3M0HA 4O8AA 4JIHA 3RRXA 3CUJA 1O4UA 2X42A 3JVAA 1JRBA 1DXEA 3NZPA 3BL3A 1MDLA 2QXWA 2E9MA 1DYSA 2F8QA 1ONWA 2OEKA 2ISWA 4JIEA 4UTTC 2VFEA 1TUXA 4YXGA 3BAKA 4A6GA 2YR1A 3RK8A 1BG4A 4U33A 3LMZA 4KMQA 4UQCA 3SCWA 1UYQA 3UNTA 3PVFA 5MF5A 3TOPA 1OX5A 4HOWA 2ONEA 4LUSB 4GY7A 3NQBA 4IUGA 3GNNA 1N8WA 3TC3A 2YCKX 1IV8A 2V5DA 2KZHA 2GQ3A 2ZUUA 2QCHA 3SN1A 3WLMA 2QPUA 3P3BA 1P4CA 3PZUA 1I2OA 3IRDA 1CZ1A 1M7XA 4GVIA 1L0PA 2OLHA 3OA5A 3KL0A 3G1VA 3RX2A 5DRCA 1F3XA 5HNUA 2ZC8A 3LTSA 3A64A 3TU9A 1TV5A 3T0AA 3DDMA 3SRKA 4D6DA 4NJIA 3GIQA 3K4DA 3UXLA 4TMCA 4HTYA 3GR4A 3UF9A 2ZXBA 1E9LA 1MW3A 4AG0A 4MVAA 2DP3A 3C3NA 4RPQA 3TC7A 3VGGA 1RALA 5I24A 3VAVA 1X98A 2HRWA 1QTWA 1CB2A 3SUSA 3R6IA 5U7SA 1XR2A 4CNPA 3O9NA 4HZ8A 2NX3A 3PG8A 2WKGA 1HJVA 1OD0A 3GSMA 2CLHA 1R8LA 2RUSA 2CHNA 2JFEX 4S3CA 3WLJA 3GLCA 3LQGA 4LC6A 4CD8A 3ECQA 4EANA 3W02A 2WJFA 4G6CA 1DV7A 5K4ZA 3M46A 4RE3A 2BXZA 2INFA 3ZLFA 3ONCA 1V6TA 2GJLA 1NQKA 1SMAA 1CXHA 4DYEA 2G95A 4IF2A 3MSRA 2OLAA 3TFCA 3C3UA 4QCFA 8TIMA 1TTQA 4FNPA 5LA1A 1ITXA 2SFPA 1E5JA 4MNLA 3FJ6A 1O5QA 1W3IA 1QNVA 4UTWC 5C2CA 4H8NA 1P0NA 2GVYA 5BROA 2GQAA 4B2DD 3W1NA 5KZ6A 3QXBA 2X09A 3TA6A 4GUHA 3S1GA 2OX1A 1G4SA 5LXXA 1OIFA 3PZ9A 1TRIA 4WY0B 3CZ8A 1RY8A 3WLHA 3ZFHA 4NSBA 4C7GA 4HNVA 1TVLA 5J04A 4C1NA 1IEQA 4IXXA 1XDLA 2PGFA 4E4PA 1NELA 3ZO9A 3T07A 3QR3A 1ZRQA 4Q4OA 1DBTA 3WQ4A 1NFGA 2NVCA 3D3FA 3V18A 3H55A 2A7NA 3VE7A 1VLWA 1D8WA 3CUHA 1PS9A 2INEA 1QR7A 5PTDA 3V5OA 2VM8A 2QJJA 5DXYA 4UZUA 3G2GA 3WNMA 2YXGA 4XZLX 4E0CA 2V0TA 4NX0A 1OG6A 1IQ8A 2PWUA 3BQ5A 4LOCA 5EA9A 1VCFA 3GC4A 4ZMGA 3GE7A 4NZJA 5I7GA 3AXXA 3AS0A 3O16A 2IPJA 3WK2A 3PFRA 2VEMA 2MUCA 1T6MA 3RR1A 3MY9A 3KOWA 4XZWA 1UD5A 1KXQA 4JCLA 4S2BA 4AD3A 5C6MA 3LLXA 5I3HA 5G5IA 1R9XA 2G37A 2OPJA 3RITA 4X22A 1UH3A 5EBUA 5CAKA 4POCA 2VC9A 2WVVA 3SUWA 5BXRA 3NPUA 1H7RA 2X30A 3GWQA 1U5JA 3EOLA 1KBJA 1R5YA 4WDTA 3KL5A 4Q8MA 4LUTB 2W6RA 4NF7A 2O9OA 3N2TA 2G96A 1PZ3A 3PTKA 3WF4A 1P0EA 2Z1SA 3GDMA 5HDRA 1B90A 5EY5A 1M41A 2E09A 4DXVA 3AIEA 1LL4A 2DQWA 2E8YA 2WKLA 1GJWA 2ZE3A 3GX9A 2PA6A 1E9YB 3NIYA 2QCFA 3NQGA 1K02A 5A6TC 1H50A 1L2QA 4GKLA 2G4JA 1FUYA 3A4AA 1EGVA 1H51A 4MGGA 1EC7A 4HHMA 1WQ5A 2R1KA 3TN5A 2DZXA 2NQHA 1J2BA 4HSOA 2HQAA 4L4OA 1PKNA 1X6NA 5A6SA 4A3YA 3WFAA 3WQ5A 3VDHA 4P61A 4OKDA 3L4TA 1UZ4A 3Q4DA 1V5XA 2OWCA 3T0DA 4TVUA 2HVOA 1PZ0A 3G1YA 3ALGA 3G5EA 4UUIA 1DPMA 2WJZA 5BWFA 1XUZA 2PUZA 4PMZA 1MNSA 1RH9A 4DJFA 5DFAA 3NEHA 4IH3A 3MO7A 3BCDA 1AMYA 1CTNA 1SZFA 2C14A 3ISIX 4D2JA 3UESA 5DMYA 4Q33A 1WYIA 3NTYA 4B4HA 6REQA 5HNRA 3SCUA 2YFNA 1LT8A 3F03K 1DJQA 2X05A 3ITYA 4J2PA 2G0WA 3CMFA 1IZKA 2BTMA 1QCWA 4GA8A 2WV8A 3UXDA 3HPXA 1ME7A 2V69A 4DBWA 2ACQA 3L0NA 3WLQA 4PSRA 3T0BA 3VC6A 2AQVA 1DQWA 1XUUA 5D4YA 2J13A 4C6OA 1SO6A 1ENUA 3VNYA 8XIAA 4FNRA 2FMOA 4M7TA 4KFOA 5FESA 4M7SA 1VYSX 3TVAA 2QDHA 1KXTA 4IM4A 4HGXA 1ME8A 4IT1A 3S5OA 1BGAA 1OEPA 4PR4A 2Q6ZA 3P8JA 5CSRA 3AS2A 4A8LA 4H2CA 4P5UA 4DXKA 5JU6A 1UWSA 7TAAA 3G1HA 1E4LA 3ZWTA 2DV0A 3STPA 4IMFA 4DX3A 4B5VA 2D23A 1IWPA 4BQ3A 3CYJA 3S5SA 1L6GA 2BHYA 2O0TA 1Q6FA 3N2MA 3CBWA 1J10A 3EWXA 3K1GA 1X8CA 1M65A 3N9RA 2VRJA 3TQ0A 3BICA 2EPHA 2AQOA 1QPKA 1EOMA 1XH2A 4PL2A 2A3LA 4Q6XA 4O16A 4YL2A 4ZTYA 3MMUA 4DWSC 2G97A 4MPQA 1XINA 1H62A 3G8RA 1C9DA 1DJNA 2HVNA 4NZ5A 3LHZA 5HJYA 1QI0A 1G6CA 1LCOA 1W8GA 3TTOA 4W7VA 3Q2DA 1JZ6A 1F9CA 3FDKA 3CNYA 3N34A 3SFWA 4GD0A 1S2VA 3PJTA 2X1IA 2VGGA 3CV2A 4K38A 5I3DA 4C6BA 4AEFA 2X7VA 1V93A 1F3WA 3UJ2A 1A50A 1AZ2A 4QG9A 4K37A 5GVJA 3PNUA 1FWGC 2KX9A 4C7DA 1XPGA 1KKRA 2QMJA 3PZQA 3MSYA 3S5YA 2PLMA 3IVSA 3N4FA 4PULA 2GLKA 4Y8FA 1FWDC 2JEPA 3NQEA 2OELA 1SPQA 2TSYA 2YYUA 3LTPA 4GNVA 1OFRA 1GZGA 1MW1A 3FKKA 3MDWA 3U4AA 4JFSA 5ECUA 4Q4QA 1JCNA 1FKXA 1E0UA 3I7RA 1GYLA 1X7FA 4W86A 4KWOA 4AC1X 3XINA 1WX0A 1RJPA 3UJFA 1VD6A 1VKFA 3CGTA 2WJDA 1HIZA 3SW6A 1DJYA 2XH2A 3V7PA 4QLKA 3KCOA 3P61A 2ZX8A 1FWSA 2XDFA 3T81A 3L66A 2GDVA 3TK7A 3THAA 4TX9A 1NEYA 3GXPA 4DY1A 3BOXA 3R0UA 5EMYA 1HX0A 3BXWA 3KVMA 2QCEA 2XIIA 1XLCA 1OC6A 4WJXA 3ARZA 2CW6A 4OUEA 1PIGA 1RBLA 5FI8A 4H01A 5G4HC 2Q3OA 3QF0A 3UZ5A 4HZMA 2QAFA 1WOAA 4TX8A 3ONBA 4MWAD 3QY7A 1KLZA 4UTWA 2INZA 1BD0A 3UXKA 1X96A 4D1IA 4ZB2A 4NILA 5K9DA 3WNPA 2V2HA 1XYMA 1C8QA 3ABXA 3GTFA 4KWSA 1H7WA 2ZRYA 1WDPA 1XYCA 3HG5A 3BSMA 4E6MA 2GL5A 3LERA 3N6JA 1A5UA 5GJNA 1BXCA 3FVMA 1PX3A 1FCBA 1G67A 1BYCA 4C91A 1H41A 3WLPA 3BLKA 3NZ1A 1UWQA 3CEPA 2QULA 4GX9A 4JXCA 4AUBA 1JCTA 2VELA 3HG2A 4Q8QA 3BMXA 1GYMA 3DI0A 1BKSA 4HU4A 1VF8A 4W7WA 1P5BA 1XM3A 3S47A 3WQDA 1TPB1 4FXSA 5IHSA 4JTIA 1C91A 3MI2A 4XUGA 1NP2A 5I78A 1FP9A 3LM7A 4UCFA 4AWUA 3QHOA 1HJUA 4V33A 2ZA1A 9XIAA 2NVDA 1HJWA 4OV9A 3VIOA 3EKGA 1X1NA 4GE8A 4Y2WA 3POHA 4I5RA 4F0LA 2O7SA 1Q3NA 4GMEA 1XLHA 3MVTA 4UR7A 4O1FA 1K77A 1MNZA 3HB9A 3W7JA 2V30A 1A0EA 2QDGA 2VWSA 4JHMA 1TRDA 3W38A 5FAGA 2XJ7A 4GRSA 3UZJA 1K03A 3IJ8A 3SIZA 1H63A 4YLWA 1T41A 2X7WA 4JIPA 5JIPA 4PRRA 3PS7A 4ZVJA 5DX7A 1N7KA 3P60A 2J8GA 2YIHA 1OFOA 3GTXA 1EZ2A 3W7GA 2QDEA 3AO0A 2P0IA 2ZVIA 2FGBA 2PSNA 4DNHA 3JZUA 4WKAA 1KQZA 4FXFA 3NM1A 1AQ0A 1VQTA 3H12A 4ZOBA 5G4EA 4HA4A 4DIAA 4DUWA 1S2TA 1F8MA 1DJXA 2FZBA 4S39A 4JX6A 3GHSA 3PJUA 3E0WA 1ECQA 3QYSA 3BLLA 5FAJA 1HXJA 1XI3A 3GQYA 2PLKA 4PZVA 3UJSA 4DF2A 1HN1A 4RLIA 1SJCA 4L6HA 4I6VA 3NGJA 4NHVA 4HPXA 5CCZA 4XQ6A 1E3XA 3TWBA 1QASA 2OEJA 1DIEA 4U4MA 4QTGA 2PURA 3U5UA 1KV8A 5DT5A 2YKKA 1E70M 2NQ5A 3FAWA 2ZWYA 1OCQA 2BY0A 4DJEC 1I2NA 1FWFC 3VIPA 3BO9A 3W87A 1MEHA 4REQA 3M0MA 2F61A 3WUEA 4N2YA 3PJWA 3WJSA 4KT2A 2OMAA 4ADUA 3QMSA 3LXBA 3QV8A 4MYAA 2PP3A 3AICA 3LCIA 4L9ZA 2VXNA 4M82A 2WHMA 1UH4A 4ZQRA 1FCUA 5LA2A 1H1YA 3A12A 5CGTA 1O95A 3S83A 3WMBA 1GVOA 2BLEA 5CJMA 3RNDA 1CB7B 5AHLA 4KW2A 3SJ3A 4NXKA 2ZRUA 3FXGA 3S3GA 2GUUA 4TVDA 1VGAA 4K1GA 3GR7A 4WY0F 3EXSA 1OGBA 1UD6A 2YXOA 1SSDA 1XDJA 1E4MM 2J78A 7PTDA 4ACZA 2A85A 1PZ1A 3DECA 4N7QA 3LGDA 1M7OA 3FHAA 4AD5A 1EDGA 4DWSB 2E9BA 2X0HA 3OIHA 5BWAA 5HPOA 2XIQA 3OVQA 3E12A 4JYEA 3TIMA 4IIHA 3IUHA 4LEFA 4CKQA 2ZUNA 1WCGA 2EG6A 2QPSA 4MZ8A 1I0DA 5AC7A 1FRBA 2RDUA 4LALA 3TNBA 3CZKA 1US3A 2OQHA 2QCCA 4B3LA 1V6VA 2QIWA 2QLYA 1OY0A 4R7WA 4DZAA 3EOUA 5F4WA 4Q8WA 3D3AA 1I4NA 3ZLGA 1LYXA 2ZXDA 3WQFA 3PK7A 1BXBA 3FDGA 3I4KA 3KTXA 4RDWA 3SQLA 4MNKA 3AHTA 4TTGA 1RK6A 2Y7DA 1Z6KA 4S3AA 3A13A 3TCSA 1CXFA 1T40A 3OP2A 5HBFA 3VUSA 1XRFA 3BG9A 4C5YA 4AMCA 2JKAA 1FVPA 4A3HA 4LCQA 4E8CA 5T91A 2VGBA 4PBFA 2G5WA 5ABEA 1XLJA 1C7SA 2UY3A 3FKRA 1FWEC 4YTTA 3AISA 3VKAA 5CZ0A 2WCSA 3LLDA 2BXYA 1DE5A 1FOBA 2VEGA 4L1GA 1V02A 2J7GA 2ZOXA 3CIWA 4QJ4B 1UWTA 1A5OC 3DFOA 3BDKA 4GZEA 4D6HA 3W2JA 1VRDA 3M64A 3NSMA 2Z26A 1K6AA 3GHRA 3PUDA 2VVSA 1RJQA 3BAXA 1XKYA 4X2PA 2XTKA 1L6FA 1JZ7A 3U0HA 1W3LA 3UZWA 4HNNA 3PWGA 5A6JA 2C1GA 4PN2A 5CLTA 4C6KA 1GG1A 1RCOB 1C9WA 4IIEA 3ABZA 1MFVA 4FLSA 2W67A 3W72A 4XIMA 3ITCA 1EHAA 4ERAA 4WY0A 4J4KA 5E6ZA 3BVJA 4BKNA 6ALDA 5FF3A 3DN5A 2ZZ1A 1QI4A 2QCMA 1F3EA 2QJHA 3B9NA 4I8DA 1TJPA 3GTIA 3A4XA 3MHUA 1KBLA 3TKFA 5H2ZA 4KIRA 1U83A 3VIGA 2EPNA 3B04A 3RF9A 2PWHA 4HNCA 4MNMA 1DORA 2WMIB 3HMJG 1GVYA 7ENLA 3UR5A 3VMOA 4A8NA 2XM2A 4AIEA 4JNYA 4JQ3A 2W62A 2NV9A 3F4CA 3L67A 3PZOA 2FHCA 3OZPA 4F0RA 3RLVA 1BVZA 2PDHA 2C3ZA 3T8QA 1KWKA 1RAKA 2REQA 5T9CE 2GVGA 1NOFA 1GGOA 2ODOA 3BJTA 2GGJA 2IXVA 1FHVA 4H00A 2R82A 2DQXA 2ZX6A 2PLJA 4ATLA 5H8MA 4PRWA 4CUCA 4C6IA 3S9IA 2ASHA 2C8NA 2VI0A 3CZEA 4K2SA 4Y9OA 3PB0A 3W7QA 3RM9A 4JICA 2NWSA 3S2JA 3VIMA 3DHUA 2YXXA 4PODA 3U7VA 2VZVA 2PDGA 2WW5A 2Y5JA 4GXPA 4MJMA 4BQ5A 3BLFA 2XFFA 1HP5A 1TFVA 5TF0A 2Y61A 4Q7NA 4I7VA 5CEWA 4N02A 1ELSA 5D37A 1HF6A 2BP1A 3M9YA 4DAIA 3SADA 1K6WA 1ITUA 2TPSA 2WQPA 5A2AA 3CMGA 2VHLA 4IIGA 2EGZA 2UWFA 1VR6A 2X0SA 1QNPA 3KW3A 3QJAA 4KFNA 4AZBA 3DXIA 3PZNA 3TYZA 1LQ2A 3WEOA 4UFKA 3EMCA 1ZQ5A 1BWLA 3ZJ8A 3ZT7A 2CBUA 1ZB5A 3GDRA 3EGJA 1H3GA 5F4SA 4K1WA 5HMDA 4DNMA 2WKJA 1LM1A 3SGZA 3TW9A 3U3HA 3T4WA 4PUEA 4ORMA 3QZ6A 3VDCA 3P7YA 3T9PA 5H8PA 3H2MA 3TR9A 1UR1A 3T05A 1LOSA 4EXBA 3C2RA 4MWAA 5LGXA 4LTSA 1JF5A 1AW5A 3TTSA 2DZSA 1FWIC 2GK1B 4B4FA 1DE6A 3MC5A 1DVJA 3EX4A 3U8GA 2W92A 3SCVA 1O60A 4YN5A 1VFFA 4LBSA 1XXXA 4LSBA 7A3HA 1S2WA 1E4NA 1U22A 1TPC1 4PB5A 2W3ZA 3RGTA 2J79A 2FTWA 1PCWA 4WK9A 3PZIA 1XIJA 2J9YA 3GNDA 3LHYA 5I3FA 9CGTA 4TO8A 5XINA 3B8IA 4GNKB 4ICNA 4R33A 4Z2HA 1P1MA 4CQBA 3PSVA 3ARSA 2X1RA 4GJ1A 2JE8A 2BOFX 1Z8AA 4IOTA 2C1IA 1S46A 4UFIA 2V3DA 2HZGA 3B9EA 2NQLA 4FXRA 3M7SA 4NZCA 3ELFA 1JPMA 1YDNA 2HK0A 1S5VA 4YTSA 1LZOA 1A49A 2EPKX 3TSDA 5BRPA 2HNEA 1R47A 1KCKA 1K8XA 3T40A 4GI8A 1UPPA 4DO5A 3DEQA 3DHFA 3UT0A 3EXTA 1JAEA 1RCQA 3F1QA 3B4YA 4X0NA 4RCXA 5D9NA 4ROQA 1QAPA 3QV9A 1OFAA 3SIMA 3OIXA 2Q8LA 1QNSA 4X60A 2PC4A 4HMDA 3NPVA 5M1TA 1OT1A 5HANA 4NP7A 4LQ1A 3V0SA 2GGHA 2CWXA 3HV9A 3NO3A 3T2OA 4S3BA 1KFCA 2PDIA 3FVDA 2PRMA 3VNKA 1MW2A 3QMRA 3O6YX 5RUBA 1JCLA 2AKZA 5FJOA 4DJEA 5I00A 3WJWA 4YTRA 2HBVA 4TOQA 3N6QA 1E6XM 4IISA 5IDZA 2E77A 3W88A 4B5UA 3GVVA 4YIWA 1P7TA 2QUUA 3R58A 1LQAA 1GQLA 2UY4A 2FYMA 5CPOA 5BXPA 2EJAA 1DHKA 1JNEA 5TBOA 4JTCA 2WMIA 2OXNA 3SCPA 5AZ0A 2ZX5A 1P6CA 2Y8UA 3PB2A 4N0RA 1PTDA 2VCCA 2CWNA 3V5FA 3G6MA 3RM4A 5H91A 4JN6A 5DANA 1G1YA 1XH1A 4AZHA 3VKBA 1ZCOA 3N9SA 2WWDA 1U1JA 1W5NA 1OGGA 4QE5A 3MDUA 2XSXA 3EXRA 1UA3A 3IARA 1T0OA 2XH4A 2ZTJA 3M0VA 1W9PA 4PCNA 4J28A 2YBTA 5KETA 3ZJKA 1PAMA 1UUOA 4L61A 3LRKA 4GVHA 2VUNA 3SGGA 1SGJA 3BMWA 2ZRXA 2D73A 1X6LA 2A4AA 2EXOA 1JUKA 2Z24A 3NQVA 3L4WA 5A8NA 3FX4A 3PBVA 3GUWA 5IFTA 1Y5XA 3W7LA 4HPHA 4P7RA 3RCMA 3HPAA 2PS2A 3H4XA 3UY7A 3B8WA 2PODA 5EKYA 2A3CA 1OFPA 1AH4A 1O5RA 5LHEA 3DBNA 3Q45A 1HP4A 4ZQNA 3XISA 1IHIA 3LHTA 3S6OA 4AXNA 3IPWA 3LI1A 5AVHA 1O94A 2CZDA 3G6LA 5M3WA 1DJZA 2UBPC 4JTTA 2V9DA 2J7BA 1DWAM 2EKGA 4ZZ9A 1JPDX 1YTKA 4I6KA 4ZEPA 2BWGA 4WQ6A 3E5PA 3TJIA 1PIIA 2DIKA 4GIAA 4AC7C 1TZZA 4CEXC 4ICMA 1AJ0A 4A4AA 3AIUA 4O11A 5HWNA 2ZC1A 4PH6A 3GNXA 3ITLA 4C6JA 3GS6A 4CN1A 3CH9A 3KCLA 2B81A 1GEHA 2FVKA 3PJXA 3W7HA 5D9OA 4JFUA 3UY8A 2X1UA 1CXLA 2NUYA 3O6AA 4E2OA 1FTXA 6ENLA 1OGSA 2GQ9A 1JPHA 4MNJA 1ZAIA 1E15A 3D47A 1IR2A 4OECA 1W5MA 1PYMA 2FGLA 3B40A 4CNSA 5K4XA 4ZQCA 5J8LA 3OBAA 5CC3A 5E09A 3B9DA 4YTUA 5I3JA 2F7FA 4JKLA 2DIEA 2OOGA 3ITXA 3R1ZA 1R7AA 3ES8A 5AZ1A 5FACA 4LUJA 3H6OA 3CQHA 1KV5A 2CBVA 1PJ9A 3VGEA 1BRLA 1N8IA 3O07A 4I7WA 1FKWA 3TW7A 1VFHA 3GXTA 3N25A 4AZIA 4H6QA 3UA3A 2WXDM 3M0JA 1VIWA 4Y9NA 2NXHA 4OGZA 2PZ0A 4FLOA 2FPTA 1C8VA 1LG1A 1GVSA 1BRLB 1CXEA 5BU6A 4PTWA 2YGYA 2G3MA 3EMZA 1UA7A 4H7ZA 1YPFA 3A3WA 2HROA 2PGRA 2GQ8A 3VNMA 1TR9A 3TYAA 2QCDA 3OZMA 1KTNA 5C71A 3AYTA 8RUCA 2A3BA 3LEPA 5BU9A 4UFMA 4WXZA 1GZJA 3DGRA 5LIUX 1TTIA 3UU0A 1HQTA 1QNRA 4H2HA 4ZSTA 5DXXA 5K9CA 3MI6A 3HG4A 3WBEA 3WZ0E 4DJFD 5D2VA 1ECEA 3AUJA 2VR5A 1ZJHA 1QI5A 3HMCA 4QFUA 3TX9A 1PDYA 3TMLA 3PY2A 4H6KA 1B9BA 4PTVA 3PZTA 3R8GA 4N4PA 3L0KA 5DF0A 3VCRA 3NDOA 2ON3A 2YBVA 5JBDA 2Y7EA 2OWXA 2TRSA 4OIFA 2AMXA 3FIGA 3VM7A 4M51A 3VGHA 1SJBA 3UZXA 4EVZA 4HD5A 3LNMA 4XBKA 2YDRA 2WAGA 1FFRA 6TAAA 4XKYB 3VGBA 2BVWA 4GC4A 2WSYA 5HPCA 2W63A 1SJDA 3NPWA 4DBSA 1VEOA 1NM9A 4J27A 3P80A 2Z1BA 2J6XA 1D7FA 1PL9A 3P5YA 3PM6A 4XZMX 3AYSA 3BZJA 1RHCA 1NFPA 3MV11 1ITQA 1DWIM 4B5NA 1WUEA 3N2OA 4IMCA 1LROA 4WOZA 3HO8A 8CGTA 2PEVA 4HMEA 3NZGA 3UWYA 2YB4A 3ZIZA 1UWIA 2GJRA 2HPMA 2V81A 3CT7A 4K39A 8XIMA 2XPKA 1ZPTA 2A3HA 3VNJA 1XYZA 1JAKA 4IICA 3M5VA 2ISFA 5IOBA 4JDYA 3VFCA 1EF3A 3ITOA 3H54A 2OSXA 3VX0A 1XBXA 2J8TA 2VGFA 1BWKA 1XYAA 3OEXA 1NFBA 2GGIA 2BDQA 4RNHA 1E1EA 5C2XA 1NDZA 3WDIA 3MZNA 1SFJA 4LAMA 4X61A 3ZMRA 4JTRA 1R6WA 2VEFA 4RPPA 3QV6A 4ZQPA 4HZ6A 3DKJA 4JEJA 2XH0A 1MQPA 4MB4A 3LZ3A 2O9RA 2HV5A 2WSQA 3I6TA 2D20A 1EP3A 3LXAA 2CERA 4UQAA 4NIRA 1Q6DA 1TO3A 4QIUA 3DYOA 2VEPA 3C4UA 1TV4A 2GSHA 3AMDA 3M5XA 1B4EA 1GPFA 1WA3A 1AD1A 2BSLA 3Q94A 5HNNA 1H61A 1MZRA 2ZICA 2Z6IA 1K8ZA 1SVDA 4GQBA 2GOKA 1AQMA 1PWLA 3CL7A 3VDAA 1WZKA 1K9FA 5FJPA 3VDBA 5DBUA 2V6AA 2Z7KA 4FNTA 4AWSA 3ARUA 2BY3A 1MO0A 3KCJA 1A5LC 5H6HA 1Z48A 3IUDA 2I9EA 1JCJA 2E1DA 1W9BM 2OG9A 2WM1A 2R94A 3BAWA 4AAJA 9RUBA 5IXEA 4AZ6A 6PTDA 4FEZA 2O4MA 3U2EA 1E6SM 2PDFA 4D6EA 4FNSA 5CH9A 4V1XA 3EWWA 3UR8A 3KBVA 4U5IA 3O6DA 3VXGA 1OCBA 1NIUA 4NAFB 4Z0JA 3VGDA 3M0YA 2DVXA 4GZIA 3WF0A 2Z1KA 4YVPA 4FP1A 3SQSA 4ERIA 2NWRA 3S42A 4R88A 3WH7A 3ANVA 2HK1A 2IPWA 1QWKA 4B16A 1E43A 4CQ8A 2YYTA 1MWOA 2FJUB 1GYNA 4PTMA 2VOTA 3SCOA 2PDNA 1JD7A 1T8XA 3XIMA 4AY7A 4D8LA 2GZXA 2XZ7A 2J27A 5I09A 4MB1A 3N1AA 4UTKA 1B1YA 1GOQA 3CUZA 4PMXA 5DCBA 2J6VA 1IE7C 2YZ5A 1B3VA 5F2IA 3R12A 1UP0A 3AOFA 1UP3A 3STGA 2XGBA 1UCWA 1WAUA 1YTEA 2OSYA 1SQ7A 4KH2A 2P3EA 2JGQA 3GDLA 2Y88A 4R34A 4G5DA 5CPMA 1A53A 1EUNA 3KRSA 3ZYZA 2XFRA 3VM5A 1VRXA 3PZVA 1WPCA 4EXQA 3OYZA 2I16A 3OVGA 4NG3A 2R91A 3GYEA 3DH7A 3SSZA 1IZJA 4LT9A 4GHRA 1BTCA 4GYFA 1XIIA 1HKJA 5CG0A 1W1IE 4GXWA 2G41A 4HN8A 4ML4A 3ARQA 2FH8A 4NT0A 4D8AA 4G7FA 2ATMA 3CUFA 2IS7A 3Q37A 2Z29A 3FHQA 3MSDA 3OLGA 3TH6A 4I9AA 4PMVA 3FYPA 4LS1A 1MI3A 3O7UA 4GUFA 3OVPA 2DGAA 3T44A 3ALFA 5AHNA 3T8LA 3W1RA 1W37A 1GNXA 5DELA 3W37A 2VKZG 4GNJA 3W1UA 3VC5A 1PEZA 3EOOA 4HCDA 1YE6A 3BW2A 1OSEA 2WNNA 1JYVA 3C61A 3C5QA 4MAZA 3CC1A 2DIJA 3HFTA 3DFHA 3GKFA 5CGQA 4AIUA 5BNKA 5C7VA 2WZHA 2WCGA 3GG8A 5SWUA 1AL7A 3FY1A 3K13A 3BH4A 3QBUA 5BCAA 3LGEA 2V2DA 3N15A 1QPNA 2QGHA 3KZPA 2AL2A 1CEOA 1RBAA 3C2FA 3ZR4A 2ZBTA 1I1XA 4M24A 1W1YA 3NWRA 5CKSA 2PC8A 3GK0A 4W93A 2C7FA 1THFD 4D6GA 1R2TA 3QFEA 3BW3A 3PUGA 3ZLHA 4QEEA 5FEXA 1Q4NX 3BLPX 5A2BA 3PZMA 3IUIA 4O53A 5AHFA 4UTJA 1LWHA 5FL1A 1E3ZA 4Q4MA 3H2NA 5AYBA 1IGWA 2BY1A 3TQVA 3RU8X 3NQ7A 2I5QA 2DJLA 1TVPA 3RU6A 2AL1A 2QCNA 4S23A 3LI0A 2FQIA 4H6EA 2VDIA 2PU0A 4O10A 1E0VA 3SQMA 4QLLA 3OBKA 2FPVA 4JBRA 4LF1A 1UJQA 5A8QA 4PFMA 4IP4A 3DG7A 4DELA 2HISA 4EOUA 1GOKA 3WMLA 3F5LA 4RE2A 1OHLA 3G1AA 4D9PA 4Z0SA 4AX6A 4F0HA 5HATA 3RYSA 4OBSA 4C60A 3AZSA 3NOYA 4GOAA 4JNMA 4JNZA 1X1ZA 4E2DA 1QW7A 3GAKA 3CV7A 3WLIA 1OFQA 1C3FA 1WB0A 2NQJA 4M6VA 7REQB 3F4VA 1GT8A 4PMYA 3PUOA 5JBFA 1OYAA 1E1CB 2GJXB 3TMQA 5FF7A 4PYSA 1RQBA 1RJRA 2FB2A 3WK1A 3SO7A 3WF3A 2ZRVA 3C0QA 3KOXA 4MHBA 4JTAA 1BXNA 1XBYA 3B8TA 1TYGA 3PN8A 1H5VA 2VL4A 3MP3A 4H7VA 2CPUA 2DPEA 2RFGA 2PI6A 5AC8A 3P62A 4JIRA 4MWAB 3S46A 1NAL1 4CD4A 3C52A 2I5GA 1UZ1A 1S2CA 3JUGA 3NYZA 4BEQA 2QJGA 4XZHA 4RDZA 3QY8A 5IBXC 1D7KA 1IT7A 4M19A 3TCEA 3TOYA 4HYWA 4JX4A 1W6TA 1JL8A 1RK5A 5FKYA 1HKVA 3TSBA 2PDKA 4H3DA 1ZGDA 4BF5A 4MLRA 3GZ3A 1PXGA 4GG9A 2E9LA 2D0GA 3UCDA 1TWDA 4DF1A 5FF0A 1R7OA 3AHVA 4O1EA 4PMJA 4UNIA 4US6A 4HMCA 4J2MA 3KRBA 4IIFA 3UR7A 1RQHA 3V36A 1PPIA 3BMVA 4WHBA 4UB9A 3S0CA 4PSPA 2XIJA 2IPFA 4FZIA 3MUZ1 4Z08A 1BPLB 3W2UA 8A3HA 2Y0FA 3GYCA 4JFVA 1XC6A 3GBDA 4IP7A 4O19A 2P88A 4ILSA 3R13A 4UQ9A 3KBMA 2CLMA 3UPMA 4A35A 3VOCA 1XSJA 1G4TA 2QPXA 1JI1A 3A9BA 4MSSA 3RXZA 1Z9AA 1EUAA 4B5TA 4OBRA 1QPQA 2VX5A 1Q2SA 3VOGA 2PDQA 1ZSXA 3W85A 4N9EA 4ZCWA 1OCNA 1LP6A 5FA5A 4MG4A 1Z41A 2UY2A 1KGXA 2D22A 3MJYA 3GIPA 4UQBA 1GOMA 1EGMA 1H4PA 3C6CA 3PSWA 3MT1A 5BRQA 4EPBC 1CXKA 3HPFA 3I4EA 4ORIA 1ISWA 3AWOA 2EG8A 1XIBA 3FOKA 3M5ZA 3ID7A 3RMJA 5E5CA 4DWSA 4IX2A 1JDCA 4AZ5A 4F2BA 5D2YA 4BA0A 3THUA 4KCWA 3DHPA 3THCA 1GTHA 3L9CA 3R25A 2XU2A 3ATYA 4HU3A 5I07A 3FAXA 3ARXA 5E9XA 3OQEA 1QO5A 4GACA 5BW6A 1A0CA 3GAYA 1B3WA 4Q6JA 3WEZA 4BF9A 3EX3A 4GVGA 5LA0A 5I3GA 2FGZA 3EX6A 3PULA 2D69A 4I7UA 1W9VA 1R0MA 3PF3A 1EQCA 3MU7A 2CLPA 4BZYA 3CEUA 3EDJA 3DUGA 1H1NA 3POCA 3R2GA 1UW9A 3TYUA 4WOQA 2FTPA 3EWBX 3VO0A 3KZSA 1G01A 2D0FA 3ANUA 4AZCB 5CAHA 1HKMA 1Q6QA 1UIOA 3KP0A 1SZGA 2D3NA 1V0MA 3EX2A 4WR3A 4NUWA 2GWNA 2OX4A 4L65A 2ZZ2A 4BK9A 4NI8A 4CU7A 4C90A 2YPIA 4FOUA 2WSKA 3OB8A 1B2YA 3DFQA 4PMDA 3RPMA 4JQAA 2J7CA 4QE1A 5JMUA 1XLLA 4UBPC 4HK5A 4A29A 2XZ9A 3MHGA 5G1TA 4XK2A 4L56A 1UKPA 1FWRA 1TPUA 1NJJA 4AF0A 5EMLA 2ZCGA 3DC8A 4P8VA 3WMSA 4F3HA 1N8FA 4UXDA 4HA0A 1IYXA 1SZEA 1TX2A 3OHMB 2Q8ZA 3LHVA 3NM3A 3W1LA 4LAUA 2PDXA 4FB7A 4A8RA 1UB3A 4NI3A 1Q13A 1O66A 1J0ZA 3DC0A 2ZRZA 2G50A 2C19A 4CEUC 5HUOA 1B30A 3RAOA 3NXFA 1CLKA 3KRZA 2WVTA 4I90A 2V5BA 1LQ0A 1XQKA 1FXPA 5AHIA 3L4VA 4QCEA 3LB0A 5AHMA 4G8TA 3H22A 3L4YA 4IQDA 2EPLX 1ONEA 4QP0A 1SFSA 3VZXA 1ZZMA 3LGGA 4A3UA 1IXQA 2JKEA 4CU8A 1RD5A 2Z2AA 1VCVA 1FY6A 3TTYA 4I5XA 5A8PA 1UC5A 3K2GA 4XAYA 1R9YA 3DAQA 4L6DA 3D6NA 1V6WA 3CPRA 3M16A 3Q65A 1OB0A 2GWGA 3T0TA 1Q7ZA 5CJ5A 3TNOA 3U2CA 1E6NA 2OSWA 2BZNA 4B90A 4IPIA 3MPGA 3W74A 2REQB 3QVQA 1V3MA 1MDRA 3C0SA 4RV8A 1GKPA 3MUXA 1VBRA 1FWBC 2PB1A 1A5MC 2VDHA 4A2SA 2VEIA 5KMYA 1AL8A 4P8UA 1JZ3A 1YPIA 4CCZA 1QO2A 4JAWA 3SECA 4GYPC 4Q4PA 4US5A 5D33A 4DEFA 3WN6A 3KS6A 4H9YA 2E5CA 4E3TA 2WMHA 3LRLA 3VE9A 3GFXA 3THDA 4KBXA 4U10A 3N12A 5JH1A 2O92A 2V3EA 2XUCA 4F8XA 3JZEA 4AX7A 4DM2A 4GI4A 1UR4A 4WXYA 4LWWA 4LCSA 1T8QA 1JDDA 2RJHA 3P81A 1OABA 4UNLA 4UQDA 4QXIA 1JGMA 2J9XA 4M80A 1UH2A 1UBPC 3MCNA 3QGAC 4FIQA 3LENA 1E73M 1O5KA 2Y1HA 4LAZA 1ME9A 4IIDA 4CLMA 3CAWA 1EBGA 5HQMA 1VFOA 3MS8A 2YB1A 2J66A 4Z1YA 2ZWZA 3QLDA 2D3LA 3LHWA 3RILA 1EX5A 4ZSUA 1MEWA 3URAA 1H1ZA 1Z44A 2AMGA 3EEZA 4UR8A 1GKQA 2V2CA 1MXGA 4HTBA 3IJIA 4GIYA 4J1OA 3BGAA 2O7QA 4I9MA 3OJGA 5FF2A 3T2PA 3EWDA 3P0XA 4ZB0A 4FPSA 1I75A 3P8IA 3G1SA 1Q2RA 3NURA 1UJPA 1BVNP 7CGTA 4NZ1A 3REQA 1W31A 2NV1A 3B4UA 4GJJA 4HU0A 4DXXA 2G3JA 2NT0A 1J12A 4DBEA 1B3ZA 3PWIA 3B8VA 4NZ4A 3TA9A 4DO7A 1LLWA 2V3GA 4EKJA 4U31A 3RG6A 2NX9A 1AK5A 1FP8A 3W2NA 4MFEA 2PF0A 2DZBA 4C65A 1P0BA 4R3UA 2JIWA 5A8MA 1KM3A 1VIZA 1I9CB 1KCXA 3NEVA 3HTWA 4BF7A 3W25A 4LYRA 2V38A 4MKVA 1KTBA 4US5D 2HTMA 3ABOA 3AZRA 1W1PA 4CNNA 2VFFA 1DIOA 1B31A 1POKA 1GUVA 4O0KA 4RV3A 1GHSA 3IRSA 3AIWA 4DUOA 1FWCC 1CWYA 4Q4SA 3S1WA 3RPDA 2Y5EA 4Z2LA 3P14A 3IGSA 1OM0A 3IJ7A 5EFDA 3O0FA 1R86A 2BY2A 1I60A 4OV4A 1F4HA 1XGZA 2G4FA 3IIPA 2BS9A 3R79A 1XG4A 3RPTA 3AWNA 3H7UA 5J5RA 3N9KA 1AQFA 2WBGA 3QMTA 1XCFA 3CQJA 1BYBA 1DWJM 1A5BA 3KTSA 4QSFA 1BQCA 1GVIA 3QR1A 4HNUA 4XG1A 5HNTA 4LJ3A 2W91A 1DWGM 3MCOA 4KEMA 1JXJA 1R3QA 3GH5A 4EE9A 4XX6A 1XLAA 1V3KA 4MLJA 2QHAA 4PA8A 1TZ9A 1ZBCA 4LV4A 4NAFA 3W2MA 2Z00A 4M5PA 3RLUA 1PVNA 1Y8BA 1MZHA 1SMDA 4BQ4A 1HTIA 1OF6A 1Q6OA 2B7OA 1LLZA 4ADTA 4E2VA 1XRVA 4PUJA 1LWIA 2YLLA 1GK8A 2ZQ0A 2YDSA 3MYPA 1XGEA 2J7EA 3WF2A 3UZYA 1LUCA 1W3JA 3ENLA 3ARYA 4DLFA 1ZAHA 4JTLA 1JUBA 3WDJA 2RAGA 2WCAA 3VMNA 2WZMA 4ZOEA 3PZGA 3B03A 5HINA 2V67A 2XFYA 1XYFA 3MBDA 1F7BA 4TXEA 4RNIA 3SB0A 1EPXA 4N9CA 5CXPA 2H8XA 2PWDA 2DVUA 1V3IA 3HN3A 5DY2A 4OT7A 3KLKA 1HG3A 4LFYA 5CZKA 4K36A 3AS1A 1EB3A 1VLIA 5FOOA 4JY8A 4UFJA 3CLMA 3S2NA 4IPNB 2J9ZA 2QUNA 3F2CA 2QCGA 4XB3A 3UPWA 2DZPA 2WNQA 4DJFC 2WMGA 3QKZA 4AVNA 2Z6JA 2F2HA 4GIEA 2AAAA 2EF9A 4JD4A 1XX1A 4R27A 1JIBA 1S39A 4GQGA 3W83A 3PPGA 4V1YA 3BG5A 3UJEA 3DX5A 2YA0A 1XLDA 1WDQA 3NG3A 3FK4A 3HZ3A 4MWAC 1MUMA 2VCAA 1S1PA 1E9IA 3W7DA 3M0IA 4Z2IA 4UTMA 1NQ6A 3VINA 4YCOA 1SO3A 1UBSA 1EJXC 2BGSA 1TIWA 5HMFA 4JN8A 2VFDA 1M68A 3R0KA 2DW7A 3WELA 4QROA 3BWWA 2GGGA 4FAMA 5LXEA 4NJJA 1FA2A 3FLUA 1O6IA 2CC0A 5C7HA 1W56A 4XKMA 3M6DA 2NW0A 3TONA 2ZA3A 4AXKA 3RCNA 4BY3A 1OYCA 4GUJA 3TZFA 1OZQA 3DYPA 2HMCA 3IIXA 3F2DA 4FO4A 3W81A 1YRRA 2WC3A 3LPOA 2AKMA 3B9AA 2BB0A 2DZUA 4EF9A 1DJGA 1OADA 4XSLA 2Y4SA 3GU1A 3TXVA 3WH5A 1GJPA 1IGSA 4JTFA 3LCGA 1TJ2A 4WLCA 3SM0A 4PTDA 2QDDA 4DWDA 4PUKA 4MIMA 4Q7BA 4LUYA 3U7BA 3WCZA 3W6LA 3OZOA 1JVNA 1UMYA 3FYOA 5CSSA 1WZAA 4GH1A 1EO5A 3URQA 1ZHAA 3B0XA 1O12A 1S1RA 3LG3A 3UCQA 1D3HA 1P6BA 2QT3A 2WHKA 4C6QA 3TROA 3RO6A 3E96A 3STEA 1E0WA 3LSBA 2VD9A 3DERA 1JFHA 3W75A 2XVNA 1ZTVA 5BMWA 1XSIA 1OT2A 5K7JA 2BV9A 3TAKA 7ODCA 3AMGA 3AXIA 3UYIA 3CQKA 1GG0A 1E51A 2XG9A 2KAUC 2VJXA 3V1HA 2YSWA 4D6JA 4CN6A 4WCJA 1TV3A 1MW0A 2QV4A 4DRSA 1K70A 3N3TA 3VA8A 4LGXA 3K30A 2EEXA 5HMEA 5GNZA 4Q7IA 4RE0A 1K7EA 1PKYA 2OO0A 3N4EA 1LRNA 3UVAA 1AG1O 3BAIA 3TYCA 1AQHA 1NSJA 2CLKA 3WYZA 1M04A 4AWEA 2NVAA 2POTA 3K4AA 4GKTA 4M1BA 3TLLA 1UUQA 1VP5A 2QCLA 4HHHA 3IACA 3BSHA 1A5NC 4IMAA 1KBIA 2VO5A 1DXFA 3AJXA 3LS9A 4DHGA 3AHXA 1EWDA 1HO4A 3SY8A 2HS6A 3GUGA 4F66A 2VC5A 3QM3A 3DFYA 4FX7A 2ISDA 4E5TA 4RZ6A 1K9DA 1XW8A 1ZBVA 3KVLA 3EA1A 2FTYA 3TJLA 2E0PA 4MMWA 4GY0A 4N9BA 5CZTA 4AZ7A 1VFUA 5E1QA 1LF1A 4IQJA 3HOJA 3S2MA 2ATSA 2OU4A 1JFXA 4FK9A 4HYRA 5C54A 3W84A 4GI6A 1EXPA 2A3EA 3TDFA 1RLCL 1AW1A 1BF2A 4L6OA 2QF7A 3EKZA 4IJBA 2PZNA 3RCYA 1IIGA 1MUWA 4FMVA 1J5TA 1TJ1A 2Z27A 4M8UA 5D2TA 2QYGA 3K8KA 4LUTA 1VPQA 4BWLA 1TPFA 4PUMA 2VP8A 1GOIA 3QC3A 5EGRA 1F8IA 2P3ZA 4GQ0A 3EPMA 1PHQA 1VZWA 1L6YA 2VUYA 3M1ZA 4WGHA