1HGYA

Cel6a d221a mutant
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPASLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (o-glycosyl)
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
publication title The Active Site of Cellobiohydrolase Cel6A from Trichoderma Reesei: The Roles of Aspartic Acids D221 and D175
pubmed doi rcsb
source organism Trichoderma reesei
total genus 134
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1hgyA00
2BOFX 4AX6A 3VOIA 1QK0A 2BOGX 3VOFA 1OC7A 4B4FA 1UOZA 1OCJA 3VOHA 4AU0A 2BVWA 1OC6A 2BOEX 3ABXA 4AVOA 4A05A 1DYSA 3VOJA 1QK2A 3A9BA 4AX7A 1HGWA 4I5UA 1UP3A 1QJWA 1OCNA 4I5RA 4B4HA 1CB2A 1OC5A 1TMLA 1HGYA 3VOGA 3RU8X 1GZ1A 4AVNA 1OCBA 1UP0A 1UP2A 3A64A 1BVWA 2BODX 3RPTA
chains in the Genus database with same CATH superfamily
1F8IA 2OSWA 1N8FA 2YBUA 5BU6A 3B4UA 3GWQA 3GUGA 4QLJA 4R9XA 4LYQA 1M7XA 2R1KA 2G37A 4PMJA 2RDXA 2NQJA 3W27A 3THAA 1S1RA 1FWFC 4KRTA 1MDLA 3L5AA 4YYCA 3WQ6A 5FJRA 2GSJA 3VOFA 4P7NA 4H3DA 2XGIA 2X42A 3BW4A 2A7NA 3I68A 2E68A 2XHYA 3S9YA 1ZAJA 2QAFA 1EUAA 1OGBA 2XSBA 1KTNA 2OYMA 3ABSA 1U5VA 2TAAA 1QI4A 3CLWA 2WZMA 4DF0A 3MP4A 3B9DA 1DVJA 4ERIA 1FWEC 1GJPA 2WWDA 2XN1A 3WQEA 3EB4A 5K7JA 4DI9A 4HU4A 4G2DA 3P8IA 2IPFA 3WBWA 2VNCA 4LYPA 4LF1A 4IG2B 2DUXA 3UWZA 3M47A 4CQ9A 3LS9A 4H00A 2D2OA 5AC8A 3P62A 3WMBA 4I3GA 4EF9A 3MP3A 3U2OA 1OFAA 2FHBA 3EWWA 3QV9A 2YW3A 1JR1A 3EDKA 3N2BA 4JKMA 3W85A 5ABEA 5E70A 1S38A 4B16A 3W1UA 5I02A 3C3UA 4DYKA 1V8EA 3DI0A 4H41A 3UEQA 2VGFA 4IHCA 2CLMA 1EGZA 2DP3A 4AWEA 3DFQA 3OGVA 3ANVA 2WZTA 1LDCA 2Q01A 3H53A 1FHDA 4C6OA 2WQPA 3NSXA 4NSBA 2IXVA 5CGMA 3ZQ9A 1VBHA 1F6KA 1UR1A 1WX0A 5CBIA 3MSYA 5I7GA 3UFYA 4FXSA 3KBNA 1EC8A 2RAGA 1YXDA 1UD5A 1ZGDA 4TVCA 4US5A 3WG6A 1W17A 4DJFA 3HQ1A 4UOZA 2IUZA 2GFTA 1OY0A 4V28A 1NQ6A 2OWWA 1DQWA 2ZCGA 4UZSA 3PC0A 2QW5A 8TIMA 5EA9A 2JEPA 3TJLA 2ATSA 2VR4A 4K3ZA 4P8VA 4EE9A 3MPGA 4J3UA 1XF0A 3WLHA 1YXYA 4F2UA 4FMVA 4GQRA 4WY0A 4A2RA 2OMAA 2XIMA 4A8IA 3F5JA 2QCLA 3WDPP 4Z2GA 4QCFA 1Z41A 3QZAA 3L23A 1IHIA 2RDTA 1MRAA 5E9AA 3P82A 3M41A 2XPKA 2VFGA 4UFHA 2C71A 3ARUA 5CZSA 3G1YA 5I2UA 3ZJ6A 3VA8A 3MQTA 4GZEA 4QXIA 3PJUA 2NQLA 4JFTA 3LX9A 4HNVA 1WDWA 3GR7A 6XIAA 2E8YA 4DM2A 3V18A 4O50A 3V35A 3V5OA 3QFEA 4O10A 1IZJA 7ODCA 4YIWA 2QJIA 2XWEA 1RVGA 4QR6A 4IGMA 1FQ0A 3KVLA 1FWRA 4NNBA 2BY3A 3L68A 2NVAA 5CKSA 3ANUA 3TN3A 3VD9A 3NL5A 1A5CA 3RHGA 4O15A 2YX0A 3NM3A 4LJ3A 1TELA 1DOSA 3UWWA 1RCQA 3QQ0A 1ZBVA 4TVUA 1XGEA 4PTDA 3BAJA 3MUIA 1LLOA 3E74A 4FPSA 2Y8UA 2BV9A 5D8WA 1N55A 2BVTA 2GSEA 3CU2A 3W74A 4E5TA 3M5ZA 1FDYA 3FYPA 3KL0A 2ICSA 2HV5A 1U1UA 4CCDA 3FVMA 4FR1A 5EU9A 2ZE0A 1UCWA 4DXVA 1EOKA 2WO5A 2WCAA 4GH3A 1QNRA 3WX7A 2O55A 3CIWA 3GE7A 3CHCA 1J18A 4H7VA 3IJIA 3H7RA 5FAJA 1WKDA 3QC0A 5A6JA 1DJIA 4ES4A 1BG4A 3NQ2A 4JYDA 4PN2A 1JZ7A 4GCXA 1R8LA 2QF7A 1GORA 1HFBA 3SRHA 2QZRA 1B3OA 1KM1A 2DGAA 4U3AA 4FLOA 1NWUA 4UNLA 4DBUA 4IXXA 2AKZA 2QMKA 2C91A 4HHPA 1FP9A 2EO7A 2G41A 3L5LA 2W79A 5LHFA 1LG1A 1SW0A 1XRVA 4L9XA 4ATDA 1FWCC 1DORA 5IFTA 1P5BA 4GZIA 3U4FA 5JXQA 1JCJA 1AG1O 4DXXA 3RFAA 1JF5A 1EX5A 2OQHA 3BV4A 2CHRA 3R0UA 1W1YA 2J8FA 3BOLA 5ABGA 2WVVB 1DJHA 3NNTA 1DL3A 2O4MA 4I90A 1NF7A 2DUZA 4AG0A 4AVOA 5HJXA 1ZJIA 1PTAA 2NT0A 4PYSA 3W0KA 3CUJA 1ZB5A 1GNXA 1IYXA 3HJZA 4UB9A 1V93A 4PUJA 4PE8A 2IKHA 2EG8A 1WDPA 1MFVA 3UZZA 5HBFA 1HJXA 2XN0A 3C52A 3IPWA 2PSNA 4S3KA 4GNKB 4JIPA 1XUUA 4E4PA 2VL4A 3NM1A 1KM0A 1R3SA 2E28A 1FBAA 1FH7A 1UP2A 4L56A 2C1GA 3WELA 3V16A 2Q02A 1V3HA 2GWGA 2DDXA 2FPTA 4Q4SA 2D3NA 1ZBKA 2ZX5A 3RX2A 2OZ3A 4OIFA 3A3HA 1JPHA 1U83A 2EPMX 5EBAA 1HQTA 3G1XA 4IT1A 4IIEA 3NSNA 1KCKA 5HQEA 4L1XA 4I9JA 2BXZA 3TXZA 1EFZA 2PLCA 4MWAB 2NQHA 3ATZA 3W2JA 2TMDA 4XKYB 1LCOA 3VAVA 4JTLA 2BVDA 2E6YA 2OQLA 2ZDRA 1JRCA 1EQPA 2WBGA 4Q8OA 2GJXA 3NO5A 1DPMA 1KQZA 4MB3A 2DU2A 3MKVA 1UWRA 4HN4A 1GVEA 2A7RA 4GQGA 4Y9OA 2PC4A 5A8QA 5D04C 4PMDA 2B7QA 5E5CA 5FJOA 4IJCA 3VE9A 2X2YA 1XLBA 1DV7A 2FQIA 4D6HA 1E6NA 3AHZA 4U2ZA 1LLZA 3QV6A 3BLOA 3TCSA 1BGAA 1VLIA 2V2CA 3QGVA 1QRQA 3SUVA 3ARPA 3LTSA 1PIGA 4Z17A 4FIRA 2OXNA 3SO7A 2QMJA 1Q3NA 3FLUA 4R7OA 5CC5A 2DZUA 4R88A 3CLMA 1K4HA 3N9RA 3HPAA 1T7LA 5AHIA 2OSYA 1XDLA 4ZOBA 4W84A 4I5XA 4XZMX 2EPLX 3BZJA 1TPVA 3BJFA 4F8XA 4P61A 2PA6A 4GA8A 3PP7A 4AF0A 2AAAA 3LOTA 3W71A 3LEPA 3V5FA 4WKFA 4AZCB 4F2TA 5M2FX 1AMKA 1CBGA 4NKCA 1LBFA 1U22A 3GNOA 3WQVA 2WKLA 4H01A 1EP1A 3IIOA 4GBUA 4GPNA 4L6HA 1HKMA 5KZEA 1H5VA 1CXLA 2PDXA 5LIYX 3MO4A 1YTDA 1UZ4A 5H8MA 4UTFA 3VNLA 1EDQA 2EF9A 2GLKA 3SUSA 4HD5A 1PYFA 1EX1A 5A8NA 3ALFA 2J74A 3OEXA 3VGDA 3N4AA 3NEHA 2QF8A 3QM3A 3PAJA 3LNPA 1JUBA 1O1HA 4GVGA 1JEZA 1LWIA 3EA3A 1F3XA 4MY1A 3H2NA 3R58A 3CMGA 4XZIA 4GO8A 1Q8JA 3GBEA 3W22A 1OGSA 1Q7QA 4W8LA 4JIIX 4MVAA 3WUFA 4XTIA 2WC4A 3TW6A 1V0LA 1RD6A 2VDGA 2IS7A 2YDAA 1RD5A 2Z1VA 2GJPA 3TONA 2OG9A 4WJEA 5CAKA 2E8ZA 3LV6A 6TAAA 1GVFA 4K37A 2GGIA 5HPOA 4U3CA 1QNPA 4YU1A 2JKAA 2PE4A 1OCBA 2OODA 4DO4A 2RDWA 5HMDA 2W0UA 1XJBA 3W7HA 4QE5A 1BF6A 4K1GA 3GB6A 2CNCA 3KRBA 4QEEA 1P43A 2QPXA 3TC3A 4XQ6A 3TYZA 2YCKX 5SWUA 3I3BA 4HJWA 4W87A 1XV8A 1EXPA 2J25A 3S2CA 2HROA 2NX3A 2JK2A 4DXKA 5J5RA 5DCBA 1V6WA 3C4UA 5LGZA 4KWOA 2WMIA 3W1MA 2G95A 4GUHA 2X8RA 1QR7A 3GH4A 5BOEA 4IM4A 3EDJA 1F4AA 1LQ0A 5B80A 3ITVA 5AFDA 2H8XA 2Q8ZA 4GIYA 3LYEA 1E6SM 4JHMA 1IR1A 3W9ZA 1VEMA 3W07A 3NZRA 2ABBA 2CBJA 1NDZA 3LCWA 4UC5A 2J79A 2WHKA 4V1YA 3CUIA 4AW7A 2PB1A 1OK6A 7TAAA 5I78A 1H7XA 4WRHA 1NU5A 4O18A 1XLDA 2ZUNA 5CJMA 3OO2A 4HMDA 1HW6A 1DYSA 4E3TA 3RCYA 3FA5A 3DFHA 1E43A 7REQB 1CLKA 5LXEA 2DEPA 3MJYA 3U9IA 3M0ZA 4Q4PA 4ZOAA 2VJXA 4AY1A 4H2CA 3UG8A 3N3TA 4JIEA 1ONWA 3LCFA 1L8PA 1DJQA 3RM8A 1SVDA 4HOWA 3LCLA 4JKLA 5E6YA 5CPTA 3RX3A 3W7KA 1A47A 4Z2IA 1V6YA 4XX6A 2CWNA 3NO1A 2BODX 3W7RA 4GMEA 4GQBA 2DJLA 5CG7A 3WLSA 1QCWA 3UXDA 3VIPA 2QHAA 3KOZA 1M03A 1ISZA 4HA4A 5HMFA 3POCA 2I56A 3IUHA 1EP2A 1K7XA 4AAJA 3SSZA 2QKFA 2ESCA 2FGZA 4JTDA 3RUBL 3PULA 3IACA 3GYCA 1GUVA 4X60A 5IOBA 4MKNA 1JGIA 1TE6A 2QDGA 2XIOA 4DUOA 1KFCA 4AEEA 4FIQA 2P76A 2VQUA 5GPRA 3I3EA 2OZTA 4PCSA 4W9TA 1KCZA 2EKGA 4X63A 4DBWA 3W00A 3TW9A 1W3NA 1IIHA 4JL2A 4PSPA 1HTIA 3O6AA 1QASA 4CVUA 3QPYA 2KX9A 4LAZA 4TV6A 3NGJA 3W83A 4NX5A 3DHPA 3MANA 5EYWA 1JI2A 2YCIX 3LBCA 2I14A 1O5KA 4IQEA 1W3IA 4XTDA 2DFAA 4C6JA 1CLXA 2Z28A 3NOEA 1TPC1 2XIBA 3GDLA 1R2TA 3N2XA 4M51A 2RH9A 3LLXA 3ARZA 2RUSA 3OPSA 2I5QA 2YFNA 4D8LA 5C9RA 4CVWA 1LJYA 3BW3A 2ZWZA 2QDDA 3S6OA 4AFYA 1SFJA 4LRTA 5FKYA 3RMJA 2NUWA 1VFLA 3BLIA 3P84A 3V75A 2VRJA 1RJRA 2CWXA 3WMLA 1VS1A 3BMWA 1Z89A 1CB7B 1EJVC 4WOZA 5DY2A 4JN8A 3VABA 5IBXC 3GHTA 1HGYA 3MUXA 2PDFA 3SIMA 3MA8A 4RL3A 1CZ1A 1V7YA 1RBAA 1S2VA 1OHLA 3E0IA 3A12A 3CIXA 2R1NA 4K39A 1G4EA 1FA2A 1K8XA 4C1NB 2WZEA 3OTRA 1BSIA 3UWEA 5CZKA 1MW1A 1J12A 4R85A 2SFPA 3ME3A 2PD5A 1TE1A 5JMUA 5G4HC 3GTNA 4B3KA 3OOQA 4YMZA 2OOFA 2WC3A 3KL3A 1T99A 1TWZA 3AMLA 4UR7A 5MKGB 1B57A 5CPMA 3LQGA 3TU9A 1M5WA 4C6NA 1HP5A 4GK8A 3RO6A 1J0JA 4CD5A 3EEZA 3R2GA 4JQAA 4GBDA 1LF1A 4FS9A 4IIDA 3JVAA 1TG7A 2H6RA 3OG3A 5BNKA 2FFIA 5XINA 4JFWA 4ZMGA 2H8ZA 3VNJA 4AYSA 3M9YA 1FWDC 1X39A 4R27A 3PFMA 1QHOA 5D4YA 4GUGA 1YDYA 1VD6A 1Q7MA 2DVUA 4ZQMA 3T81A 2QJHA 3AICA 2ISFA 3UCCA 1W5QA 4J2MA 1G67A 2Y6ZA 1LOQA 3QJAA 1PHWA 1IR2A 1KFEA 2HK1A 2H3DA 1QDSA 4ZO6A 4ALDA 3FDGA 1JZ3A 3RR1A 4DF1A 2R1LA 4ATWA 3TLQA 1TREA 4AU0A 4MB4A 4PUEA 4C6KA 4HMNA 2GOKA 3LXBA 3QKEA 3APTA 1NEYA 3A4JA 3E0LA 3UPBA 1E1CA 4AHQA 1TCDA 1GVQA 3LM7A 3K4WA 3KRUA 1HJQA 3W6LA 5KZ6A 5HA7A 1RCOB 2ODOA 3PPFA 1C29A 1AH0A 1LUCB 2ZZ4A 2DW6A 1PTGA 3CH0A 3GDRA 3G2GA 2Y5JA 1AD4A 3N2CA 3XIMA 4FSAA 3STGA 2ZRUA 3AOFA 4HPXA 4H9UA 4I7UA 3AIWA 3NZ1A 2RJHA 1WBHA 4NJHA 4KBXA 1Q4WA 2HJPA 4JS3A 3PY2A 3O8AA 2QJJA 1JAKA 4D71A 1TTJA 4PC8A 4QDWA 1JCLA 1AFSA 3ZJKA 1QPKA 1X8FA 3WF3A 3FKRA 4HIBA 2NXGA 4PEEA 5BMWA 4PZVA 3A23A 1J5SA 3FW6A 1MUWA 1ODUA 4P8WA 4H9MA 5DBUA 1FRBA 2GGEA 2J4GA 3OU8A 4FZIA 4KW2A 5C9WA 3VDBA 2DZBA 3TTYA 3CZKA 3WYZA 4KERA 3KVKA 5I00A 2YDQA 3MZ2A 3BLFA 1OD0A 2GGGA 3WDHA 5I06A 2EKCA 1JYVA 3CL6A 2PGEA 1EHNA 2VDHA 2HK0A 4GC4A 2FFCA 4UTLA 3CTLA 3MKCA 5EMKA 3COTA 6REQA 1BWVA 5C7HA 1P0BA 1PUDA 2WV8A 5I79A 4DZIA 3GC2A 5BWFA 3NL6A 2WLYA 3ZLFA 2E5BA 4EXAA 1EWEA 4K2SA 4QAWA 3CHVA 1HJSA 4PB4A 1E6XM 1VC4A 1QWKA 3SFWA 4WQ6A 1VFOA 3UWYA 5A8PA 3WY1A 2A2IA 1JCTA 2PTXA 3WO8A 1UASA 3U7VA 3O0FA 4B2DD 4UTTC 1E9IA 1WPCA 3V5CA 3HG5A 3PZIA 2QDHA 1YNQA 3NGFA 1EJUC 1EGVA 4HKPA 4FXJA 1UIOA 1VBUA 3TE9A 3PAOA 2DT0A 2DIEA 3PZTA 1TIWA 3VIJA 1UMYA 3M64A 2WK2A 3O0KA 4YWSA 1XLEA 4X0VA 2VX7A 3UF9A 5A5WA 4FX8A 3H22A 4DZ5A 1V5XA 2CFFA 1PX8A 3LD5A 3EMCA 4O0KA 1IEIA 3O63A 4HHHA 3P6LA 4M80A 4DWSD 3G1SA 2PI6A 2OLSA 4TXEA 4DJEC 4OV4A 4H6QA 3A24A 4KGJA 2DZWA 4O1FA 3W75A 1E51A 1I2PA 5EMLA 4RJEA 5FJUA 2QJMA 4GE8A 4DELA 5JBDA 3WH6A 4BF5A 3C8FA 2J9ZA 4GUJA 4IP4A 4OWGA 1O7AA 1X96A 5C70A 4O53A 2XH7A 1WE5A 1TJ1A 3H54A 2B31A 3NPUA 3DFNA 1XSIA 1W3KA 2E1WA 5EMJA 4W5UA 1ZAHA 3NFUA 3IUIA 2VMFA 4LS1A 3SB0A 2TODA 4B5WA 1EJXC 1JXKA 1DIOA 4O1EA 4MB1A 4AZ7A 4TU1A 3TDFA 4JHOA 3MSDA 2C0HA 1N7KA 4M56A 2HXUA 4KKXA 5F7UA 4PL2A 1PKNA 1H7RA 4QBXA 1FXQA 1YX1A 3BVJA 2INZA 3S1XA 4WXZA 4EACA 2BXVA 4LNCA 2VT0A 4C6BA 3EX3A 1FOBA 3EYPA 3GDKA 1HL8A 4UCFA 3S47A 3FV9A 3DGBA 3QZEA 2VM8A 1WKEA 3FNDA 4ICMA 2BGSA 1UD4A 4PUUA 1GZ1A 3H7UA 1Q6DA 4BY3A 2CBVA 4BA0A 4AIOA 3S2LA 2W63A 4AHPA 2HBVA 2PWUA 3GQYA 2F6KA 2V0TA 1NELA 5F2MA 5BW6A 1KV8A 4LUJA 1CNVA 5JQ9A 4O16A 1JL8A 1D9EA 5CBBA 5EB8A 4BWLA 3E5BA 2GL5A 4GY7A 4M0XA 1YQ2A 6A3HA 3KVMA 1QNVA 3VX1A 5A95A 5GNXA 3W23A 3T78A 3W2KA 1PKYA 1OFEA 1GTEA 4WR3A 2BWGA 2F9RA 5HATA 3GS6A 2EQDA 4FNSA 4XSLA 3N12A 4ZTXA 1I2QA 1J01A 1E4LA 1W9DM 3SCSA 5HR7A 5DMYA 3GU2A 1K8YA 1MXDA 3KUMA 1W32A 4IPIA 3DG6A 1LRTA 3IARA 3NDOA 4RX0A 3EPNA 5HR6A 5A6LA 3M0MA 1J2BA 1ALDA 3CEPA 2FB2A 3EWZA 1D3CA 4QE1A 1UR9A 4Y90A 1XLMA 3FN9A 5DX7A 2O7QA 3AJXA 1CWYA 2IW0A 2VURA 5KZDA 2ZRXA 4IFKA 1REQB 2V63A 2XH2A 4HSHA 3KX6A 5I3FA 4F40A 1JZ8A 3NQ6A 4ZXOA 3RMEA 3OIXA 1CGUA 4M5PA 4NX0A 1A5NC 2DVXA 1BYAA 1I2NA 3VIHA 2W27A 4H7CA 3N04A 1LT7A 1MRQA 4CCZA 1AQFA 4CU6A 1UB3A 1X6NA 2V3GA 4MOZA 4MWAE 1W8SA 1EWDA 3SGUA 5FI8A 3LHZA 1YNYA 4CU8A 3TNBA 1H61A 3MYPA 2VZOA 3S8HA 1TMLA 1XDMA 1IEXA 2Z2AA 4JTQA 3THUA 2I9EA 3TYEA 4G9PA 3UA3A 2PLKA 2FZNA 1AD1A 2P3ZA 1BXNA 3RILA 5D33A 3SM0A 5DF0A 1EPVA 2ZIDA 1PZ1A 3SGZA 2PWHA 3CNYA 2QVNA 4B4FA 1MZHA 2OQYA 4MLRA 3GU9A 3EMQA 1MYRA 1YE6A 2CCRA 4LX4A 3MMUA 3LGEA 3L7RA 2CPUA 2QUUA 2OZ0A 3P5YA 1U5HA 3WKZA 3HQOA 2ZFAA 4B2DA 2WXDM 2PCQA 2JKPA 3CAQA 1JGMA 2FDSA 3HU7A 5G4EA 4ADSA 1NFPA 9CGTA 2OT1A 5ABTA 4NAEB 1GOIA 3KTXA 4WY0B 4MB5A 5REQB 2LLEA 3T0DA 4KFPA 2PRMA 5EL1A 1VYRA 4Z08A 1JDDA 2VX6A 3ARTA 2VX4A 1ZAIA 1E1FA 2YDRA 5HWNA 4E2VA 4Z0JA 4TX9A 4ONVA 3B06A 4I8DA 1UBSA 1TFVA 5DXYA 3W53A 1EHAA 1B4EA 4IMFA 3STFA 1WZAA 3MUAA 4L4OA 1R38A 3GHUA 4HOZA 1NVMA 3CJPA 2YZRA 4AD2A 5RUBA 3IIXA 4IFRA 3DC8A 4JICA 1MW0A 1K03A 3UR5A 3BICA 1OGGA 4B5UA 3VCCA 3GAYA 4HMEA 3UYCA 2HS6A 4HQVA 4KWWA 3SCQA 1RLCL 4WJ8A 3VDAA 5G1YA 4S39A 1AK5A 3VX0A 1ZRQA 1CGYA 5AYXA 1J0IA 5GJPA 3RIKA 3B8IA 3VK5A 5JH2A 2GWNA 2DQWA 3WDQA 1GQNA 2ZYFA 1TVLA 1BQGA 1UW9A 4S1FA 4EIVA 4KH2A 3IGUA 2ZRWA 2TYSA 5HMEA 5MF5A 3PPGA 2WHMA 1DE5A 1R2RA 3SQLA 1HKJA 1KRBC 3LHUA 3MUZ1 3S2MA 1HX0A 3VFCA 4HA1A 3EAUA 2V30A 5HWJA 3EPMA 3CPGA 3TXVA 4RUBA 3ZWTA 3H4GA 2BLEA 5A6BA 1KGUA 3CH9A 3LZ5A 3HMJG 3AFBA 1FWHC 3GVRA 1IQ8A 3ALGA 1XP3A 2OX1A 5A2AA 3TFXA 3CBWA 1AW5A 1HUVA 1YPXA 5G2HA 1GG0A 3WCZA 1JCXA 2NLYA 3SY5A 3BGGA 1VFHA 4JZ5A 4NU7A 3IJDA 1E0VA 4H19A 3DDMA 3MUCA 1GKQA 4ZFMA 4BCEA 4UFIA 3GXIA 4EF8A 4X2PA 4I6KA 4O54A 4QNEA 3U2ZA 2J7FA 2XIQA 4JTKA 2Q09A 3TOYA 1THFD 5A94A 1VCGA 4UQAA 4G7EB 3LN3A 2PDWA 1V77A 1BLIA 3P0WA 2QUMA 3N17A 3NZPA 3GIYA 1RP8A 3P93A 2VR5A 3W7MA 1VHCA 4QJ1A 2Y4SA 4HPNA 4GJIA 1E3XA 4GX9A 4S38A 3E96A 1R30A 1L6WA 2YB4A 3MB9A 3SCPA 3FVDA 2GJNA 1RHCA 2GJLA 3VIFA 4TX6A 1ISYA 4YHEA 3M1ZA 2BOFX 4OZOA 3WD4A 3WDIA 3ZR4A 2RGLA 1E6PA 3WLPA 4UQDA 2NT1A 1L2UA 3CASA 1RK6A 2W62A 3APGA 5HQLA 1XRSA 1VIZA 3C56A 4GWEA 1JDAA 3D5HA 3T2QA 2CKRA 4L6OA 5D05A 4LU0A 5HNNA 3CPRA 3T42A 2J78A 1E9LA 4BR1A 2QIWA 4L64A 1R47A 3LV5A 1W9VA 2OKOA 4M82A 3NO3A 4ZGYA 2Y5SA 3R43A 1T6MA 1M7JA 5HNRA 2PP0A 5C55A 3TV8A 5K4ZA 4HK6A 1W91A 2P0OA 3H24A 5LIXX 4HHLA 3ZSSA 3VD7A 5HJLA 1UG6A 2NQ5A 2DV0A 4FEZA 3IAQA 3QMRA 3BANA 3ZM8A 3OBEA 3TIMA 3DH7A 5F4SA 4L1GA 4A8RA 2OEJA 3KZPA 3GTFA 3NAVA 4TR9A 1VRDA 4PUMA 4I7VA 3WUEA 4A3HA 3E0WA 2WVVA 1EJ7L 3LERA 2QCCA 4YVVA 1VRXA 5CSYA 1OFPA 1L8NA 3LDVA 4GISA 2GJXB 3GZ3A 3Q45A 4H9YA 2XZ7A 1V3MA 4XZ9A 4F9JA 2CZ5A 4DX3A 4J7RA 3KTSA 4V1XA 1FDJA 2Q8LA 1H50A 1Z32X 2XYLA 4MZ8A 3F03K 3S3GA 1KC7A 4HU3A 4IUGA 1KFLA 2Q3RA 1V03A 2OGYA 3UZJA 4AXKA 1J0ZA 1Z3NA 2J7GA 4NP7A 3F4DA 1W6TA 4CQCA 1I8JA 3CB8A 3NTYA 4M6QA 3U7BA 2REQB 3R8RA 3MYOA 2Y7EA 4XAPA 4PSRA 4ZFCA 5C71A 3SJNA 3GTHA 3G24A 3BH4A 3R8HA 2VKZG 1JPKA 4B5SA 4M6PA 4JDBA 1E5JA 2D23A 4RZ6A 1DWFM 5FSDC 5AKQA 3I65A 3VINA 2QCHA 5BXTA 1JFHA 1KFBA 3LRLA 1SR0A 3WQGA 4CQDA 3AO0A 3UWQA 2BFGA 4K8GA 4DM1A 4LUTA 4XKYA 4DRSA 4ZODA 1OFRA 4JD4A 2OR2A 3STPA 1Q4NX 3ABZA 1WBJA 3VGFA 3WBYA 3NG3A 2NV1A 2QS8A 1Q2RA 1ZFJA 4QDPA 3ICJA 3SJ3A 3EXTA 4KCTA 3AWNA 3IJLA 4MUZA 3BO9A 2PDMA 1WZMA 3WK1A 3MSRA 4E4UA 2FGLA 3FDKA 4WKAA 1UKOA 3T9PA 1F5ZA 1UOKA 4K1WA 1X38A 1HL2A 1OG0A 4D6GA 1TR9A 2EJAA 4B91A 5BRBA 5D2XA 4QSFA 4NUWA 4FOJA 4QLLA 3JRKA 5E93A 3OG2A 3UESA 3GC4A 2QIIA 5H6HA 1RPXA 5E0KA 3VNDA 3ITYA 3HF3A 1V3LA 1GOMA 3MVTA 1FCQA 3MW7A 1VKFA 2VRQA 4I5UA 4NL1A 3WFZA 1Y7VA 1UWQA 3TJIA 2IQ0A 4LRSA 2IPWA 5JU6A 2VUNA 2R94A 3WN6A 4GXPA 4Y2WA 1XL9A 5CCZA 1EUNA 2VFEA 2BHUA 2BMBA 1NFGA 2GOUA 2VZSA 1UZ1A 3P5ZA 2QUVA 2G3FA 3IGSA 4HYWA 4GGBA 1QI0A 3NOYA 2XH0A 3F5KA 4K38A 1Q63A 5K4XA 2E25A 5LIKX 1EGMA 4XVEA 2CYGA 1F76A 2X1TA 4X22A 3V0TA 2VEFA 1EBGA 3KS6A 2YA1A 1YDOA 4CD6A 3QW4B 1FCBA 1S5VA 3NIYA 3EWCA 2OFJA 1QT1A 1BXCA 2GVJA 4O19A 3GDTA 4MFEA 2EPOA 3WFAA 3CV1A 5M03A 3RPTA 2Y5EA 5U7SA 1GKRA 1U1HA 2FPYA 2ISWA 2VWSA 2HVMA 3ITOA 3M6YA 3WJYA 4AC7C 1YNPA 2YCLA 1AQ0A 1XYAA 4IF2A 5HMSA 3KM8A 2H3BA 5KINA 4IFOA 2Y0FA 3TC7A 2BY0A 3C2OA 4WSHA 4UFMA 5F2IA 3EWXA 3IVSA 4KEVA 5K9XA 3WUGA 2Z25A 3SCNA 4PCNA 3UJ2A 2A3CA 4A2SA 4FI4A 1B1YA 4LV4A 4QFUA 4WCJA 1Q6CA 1QHZA 2PZNA 3BWWA 1RALA 3W82A 1Q13A 3QY7A 3PFRA 4KS0A 4PR4A 4DLFA 4G56A 1DIEA 2RFGA 1GYNA 4ZENA 2X1IA 3THQA 1PYMA 1HVXA 1NDVA 1HGWA 3WQDA 1UZDA 3W38A 1D3GA 4O52A 4MJ4A 4LBRA 2CBUA 1BRLB 4O0ZA 1A5UA 4XD6A 1LOSA 4AWTA 1TV3A 1QBBA 3M0KA 4GNJA 4B92A 3G0UA 1G5AA 2PBOA 5T9BG 2W9MA 5H91A 4FALA 1K8ZA 3H26A 4D9PA 1DJGA 2AQOA 4E6MA 4N4PA 1Q6FA 2C14A 4TX8A 4O14A 1NSJA 1TZ7A 5FEPA 3IS4A 4CLMA 1XIEA 4X9YA 1SQ7A 2Y24A 3CZJA 2VFDA 4H6KA 3VM7A 3S9IA 2XJ7A 4RPPA 3FA4A 7REQA 4XG1A 1XHGA 3LY0A 5LA0A 2OEMA 4ML4A 4QM1A 1US0A 4U4MA 4MKVA 1LG2A 4DJED 2PWFA 3RX4A 3WQ5A 5CH9A 3G3MA 4UBPC 3GXNA 3E0VA 4LY4A 2ALDA 3TW7A 2VVSA 5HUPA 2RGMA 3H23A 2QJNA 4L61A 5CSSA 5CXPA 3Q4DA 3M0IA 4YN5A 4LT9A 2ZRYA 2WHJA 1D3HA 3PZQA 1JZ5A 4CEUC 3KHDA 4UFJA 5IBXA 2P1FA 4KWVA 1WA3A 2O56A 3AMCA 4C1KA 2A79A 4GXWA 3TN5A 1E4NA 3CIVA 3UVAA 1CGXA 3K1GA 2QYGA 4C1LA 1OC6A 4TVDA 6ENLA 4HTYA 5JH1A 2WWCA 4UTHA 1XC6A 3NVDA 1A0DA 1E0UA 2JIEA 4JTHA 1TPUA 3K30A 1TJRA 2NWRA 4IJBA 3PK7A 2DT3A 2HEJA 3DHDA 4GI9A 3QOMA 3OBAA 2VO5A 2H90A 1DJWA 4RXGA 4OV9A 3R11A 5AHNA 1UJQA 4TO8A 1RVKA 3QSRA 2ZXAA 1ZS2A 4AWUA 1TZ9A 1W54A 5TIMA 1NM9A 3CAVA 1C7SA 3T4CA 1PEZA 1ZPTA 5AN7A 1TRIA 2UBPC 2GVYA 2YXOA 3N9SA 1J10A 2ZA1A 3BJTA 4BEUA 3MV01 3UY8A 4AUBA 2C7FA 3DESA 4ROQA 1A5OC 4QTGA 5KETA 2ZXQA 3VXGA 1WYIA 2HXTA 3E1F1 1M7PA 2ZX8A 4RW5A 2DZVA 2FMOA 1OC7A 3RLGA 7ENLA 2WNZA 3P0XA 4RE0A 1C9DA 3WQFA 1NWRA 4PA8A 3II1A 4ICNA 3QV7A 3RPDA 3UBPC 1PE1A 1J96A 2VRKA 3ITGA 1GQKA 1XLKA 4RNHA 4MPQA 3W3OA 4H83A 4H8VA 1OBAA 2G3MA 1KBJA 3GW0A 4F48A 1XH2A 3E2SA 3LBOA 4C1NA 2J47A 4D1JA 1FH9A 4L5ZA 2PTDA 3DKJA 4QS5A 1XICA 1A3WA 5DO8A 1O12A 3Q2DA 1TQXA 1W37A 3WSUA 4WVXA 3QV8A 3UA4A 3AHVA 3W1RA 2J66A 4HNNA 4FX6M 5C9UA 4L65A 1IT0A 4UOJA 4U28A 2XVKA 3TUUA 3IJQA 1GZJA 1XSKA 5MKGA 3B8VA 4RE4A 4A29A 3PB2A 1PZ3A 1MZRA 4GZJA 3RO8A 3LK6A 3ES7A 2DT1A 1W9BM 5C54A 1XLJA 2WSKA 4XSMA 4NASA 1SO6A 1O95A 2GK1A 2QCMA 1WXYA 1F74A 3BW2A 2Y70A 4R7WA 3WQOA 3EDFA 3W2MA 4L9ZA 4O17A 1HIZA 2IPGA 3M0HA 4W7WA 4Y96A 1KA9F 1FCUA 4J35A 1QFEA 3ZR6A 5LNVA 3TN6A 1E72M 5D2YA 3EX4A 3D0CA 4A6GA 1O94A 3CQJA 3SGGA 1QBAA 4NG3A 1FDZA 4C6FA 4GI6A 3EX6A 3M6DA 3QH2A 4YLWA 4DUWA 4LB4A 1K7EA 5L6UA 4RE2A 2L5HA 1UWSA 4A3YA 2WPGA 3WQ4A 3VKKA 2WLZA 2EG7A 2X1SA 4EPKA 3VYLA 1PTDA 1RAKA 3DU0A 3M5YA 1TRDA 1YLVA 3QGAC 2NX1A 1V3JA 4KF1A 3FHQA 2ZC8A 4GFSA 1FH8A 3L0GA 3ZFHA 4HJFA 6REQB 2O92A 3UNDA 2PGFA 1LUCA 3EWBX 3A3WA 3IRDA 3FSTA 3QVQA 1DWGM 4RE3A 3AYVA 4DF2A 1ZHAA 1VZWA 4BK9A 4HPGA 2WMFA 1PB0A 2Z4GA 4EWJA 1QAPA 3WLJA 3VGBA 1J0HA 5AC5A 3AHYA 4B5VA 2NV9A 3T8LA 2BDQA 4JL1A 2GDUA 4F0HA 3KP1A 3P80A 3MCOA 2DSWA 4XB3A 4JTAA 5T9CE 1UBPC 4NZ5A 3CUHA 1QW7A 4BHYA 3B03A 3TN4A 4C90A 1V0MA 3T0BA 1X98A 3WLRA 4DJEA 3OIHA 4ADTA 4UTMA 4GIAA 1YADA 3W7GA 2R6OA 3ITCA 3V0SA 4X0NA 4D8AA 2ZX6A 4LS0A 4IWWA 1JNDA 2Z2BA 3EWUA 3HG2A 2XH4A 3AS3A 1XBZA 2OO0A 1UWAA 1E73M 4MJZA 1Q66A 2DW7A 3INPA 4YCPA 3YPIA 4XAGA 1OX5A 4LWWA 1M1BA 2YLAA 4UMBA 3HGRA 3PZUA 2WNWA 1LYXA 3KFTA 4Q4MA 4H2HA 4FNTA 4CUCA 1AUSL 1QOPA 4GHRA 1XC4A 3LA4A 4C7DA 3T2OA 3GVGA 3S6DA 3VKCA 2BOEX 3AU6A 1EEPA 4LANA 5DEZA 4XZBA 4PB5A 2EPKX 1G9HA 3KOXA 4URIA 1QJWA 4ATLA 2QPSA 1GOWA 5DMLA 1UWIA 4OU1A 3N25A 5DQPA 3QYQA 2DSVA 5BCAA 2YOCA 4XUGA 1VHNA 3HIJA 3W6YA 5D09A 3BLEA 4GI4A 4GYJA 1DQUA 4WOQA 2X7WA 4EP8C 3W76A 3C2VA 3EX2A 1B0IA 2OWCA 2QCGA 2HS8A 3FK4A 2XTKA 4GCAA 4J28A 5JBEA 4MZ1A 4HVXA 3RRXA 4XAYA 1VENA 3LENA 4L1WA 4RW3A 2C6QA 4GVHA 3F2BA 2C19A 1B31A 1XIMA 4XD4A 3HGSA 1WUFA 3DCPA 1K02A 3WNPA 1E56A 3CB3A 3SURA 3WUBA 3GX9A 4LVAA 4LAOA 4LAMA 4FNRA 4D2JA 4JYFA 1PJ9A 5J8LA 5CG0A 3KZSA 3GD6A 2PTWA 1CGTA 5LKYA 4C6CA 1IEVA 3ZXWA 1PWLA 3RXZA 1O5XA 4FF7A 2J24A 3MT1A 1L0PA 3ARRA 1C8XA 1R9XA 3ZO9A 3P60A 3GLCA 3U5UA 1G7UA 4W4QA 4F0MA 3PS7A 3QBUA 2FDMA 1XIIA 4O1BA 1XQKA 3LQLA 4N2YA 3PBUA 3NZQA 3QN3A 1EB3A 2WANA 2GUBA 3MC5A 2ZUVA 3FAWA 4CGTA 4W8BA 2RJGA 3WH8A 5I3GA 1V7AA 1HJVA 3AMGA 1SJDA 3GDBA 3PJWA 2IKIA 1H0IA 4JNZA 2CLKA 4FOKA 1R3WA 1EH9A 1R9YA 2GPTA 1WDRA 1G0CA 3WH7A 3ZJ7A 4OVXA 4IFKB 1MQQA 4AD0A 2I57A 1EF2A 3TR2A 4HZ8A 3W1LA 1Z9AA 3WF0A 4BFAA 3TNOA 1S39A 3DHUA 3GXPA 2EPNA 3VTRA 1K70A 1SR9A 3IGHX 1WDQA 4ECLA 1VYSX 3LHVA 1T5AA 4F0KA 4OFCA 4X3ZA 4C91A 3MI2A 5DMMA 3IVTA 2QUNA 1S2CA 4LCRA 3TYBA 1OX4B 2I16A 3PR2A 2XFRA 1P6CA 5G5IA 1HKWA 5XIAA 2VHLA 2YL8A 2Z7GA 4LF2A 1G69A 1MQPA 4EXBA 1N2VA 5LNSA 5DT5A 4XZHA 3NQBA 4LNYA 3AROA 2GUYA 4RZBA 3LXAA 1XIFA 4FR6A 4HOXA 4IQLA 5H8UA 1TYGA 2ZX9A 1ZJBA 4K68A 4Y8EA 1KCLA 2W61A 1RSCA 3S5ZA 1BPLB 1XLFA 3SAZA 2GVLA 1XKYA 4HA3A 1AJZA 4OHQA 3SRFA 4FOUA 2VFHA 3N13A 1WZKA 1REQA 4QISA 3FFSA 3WF4A 2F38A 1I2OA 1T8XA 5AECA 1AVAA 1GGOA 3ARXA 1MNZA 1PVNA 2BBFA 2CZVA 3AIEA 2QJGA 4KEZA 4N6FA 4RZ5A 3NQCA 2YR1A 3TTQA 4Z2KA 3TOPA 1EC9A 5D38A 3HV8A 3CUXA 2C3ZA 3NEVA 2XIJA 3IJ7A 4DJDD 3CV7A 1XGDA 2WAGA 3DIPA 1X7FA 1KR1A 4DWSB 1ODZA 3VO0A 3QY8A 2Y62A 2W6RA 2POTA 1X6LA 2MANA 2PRHA 3QTGA 4W5ZA 1RQHA 4MDOA 5BROA 4KWSA 1JFXA 3RJXA 1SZFA 2PDHA 4C6EA 4GUIA 4YVPA 1HG3A 2EAWA 3SUUA 2EHHA 1NP0A 2J8TA 2WMJA 1TPFA 1CCWB 1Q85A 1V3IA 1W5NA 3C86A 4IGSA 1TWSA 4OT7A 2XGZA 1PAMA 3SSJA 4QSHA 2VOMA 4ZO8A 2CLHA 3UYIA 4AZ5A 2XVLA 3TYCA 1SZEA 4KGLA 1E0XA 2I9UA 3LG3A 3K5XA 3GHSA 3H21A 3FAXA 2V3EA 3IRSA 4K7VA 4C6DA 1KM3A 3S6TA 2ACUA 1WV2A 3MS8A 5FEWA 1IIGA 4AISA 3U8GA 2E7FA 2DORA 5A6SA 2J6XA 4W7VA 1KBIA 4NAEA 4CD4A 5REQA 2J9XA 3GNXA 1VEPA 4PUNA 3F4CA 1XLAA 3AXMA 2BTMA 2QEZA 1DP0A 1BD0A 2ZUTA 4L80A 3LCGA 3SZ8A 3UWUA 4RR4A 4GRSA 3CMFA 3E12A 2HE5A 3QTPA 3CPUA 3CZGA 4EXQA 2YPIA 4UTUA 2OCZA 2VUYA 4UWMA 2OYLA 1UC5A 3DEQA 1DJXA 3ITXA 2A21A 4PMXA 4EANA 4P8UA 3VILA 3T6CA 1XD0A 4L4LA 3TA6A 4DWSC 2F2KA 5HWMA 1UJPA 1V0NA 2E9LA 1S2WA 2OOGA 2XDFA 3VIMA 1GT8A 3CUZA 2JQXA 1E4MM 1RV8A 3CQHA 1L6YA 1U2YA 3RR4A 4JX6A 1W1A1 2Y7GA 5J5DA 1YMYA 1MW3A 4ROPA 4KCUA 1BYDA 3S1VA 4AXNA 4B3LA 4ENLA 4IMEA 2BHYA 4IIFA 3GG8A 3C6CA 4IICA 1K9EA 2WNQA 1A0EA 2PU0A 2YFOA 1IXNA 3JUGA 2VCBA 4AVFA 5LZLA 3DYPA 1K6WA 3PZGA 3AJ7A 3FS2A 4J3SA 4ZVJA 3QEZA 2HVOA 4JDYA 1H09A 1H5YA 1JJKA 1UMLA 1WCGA 4J2PA 1VCVA 3QLDA 4IISA 1BYBA 1OADA 2E9MA 2AQWA 2NV2A 3WL0A 4U33A 1PZ0A 5CLWA 1MEHA 5FAGA 4ZR8A 4XAFA 2VC5A 2BVWA 4Q4KA 3K4AA 3L2LA 4NI8A 1OSEA 4M6UA 3I6EA 1TX2A 2J27A 4IIHA 1WDDA 4DHGA 1FXPA 2HNEA 2VQTA 1ITCA 1CIUA 1GCYA 3OQ8A 1XD1A 3BOXA 4KCWA 1QPOA 1B90A 5KZMA 3KP0A 4H8NA 3V1PA 1F61A 1ADOA 1ECEA 4M19A 5I3DA 2WVSA 1I75A 1N82A 4CKQA 3LRMA 4JQ4A 2BXYA 2JEQA 1VFFA 3UG4A 2GDQA 4BI6A 1QPQA 2P50A 2G3IA 4L4MA 3HBLA 1XXXA 2Y7FA 5ECUA 4G7EA 3G6LA 1QNQA 4P7QA 4UQCA 1UROA 2PD9A 4H9ZA 3HFYA 4AMCA 1RJQA 4QRNA 1SPQA 4DZHA 4P5UA 3DENA 4GJJA 5FIPA 2A3AA 1FWGC 5I3JA 1M41A 2E1DA 2WZIA 4B9ZA 1XCXA 4J3WA 1P0NA 4IQDA 4PMVA 2NSOA 2CZFA 3SQSA 3B9OA 4M1RA 5LNRA 3O16A 5LYRA 4UMCA 3W88A 1JD9A 2QQ6A 3N2MA 3A5FA 3ZZ1A 5I6SA 4EVZA 3N9KA 1J4EA 1FWSA 2Y89A 3ARQA 2W5FA 3UXIA 1MXGA 4LSBA 4QROA 4HA0A 4M1BA 1P7TA 4MJ2A 1K9DA 1XH1A 1R3QA 3AXXA 4GLEA 1YKWA 1IWBA 1XSJA 3GFZA 3VD4A 1JQXA 4A4AA 3IK2A 3WD0A 1I45A 3S1UA 4H9VA 4C7GA 1XWYA 2V68A 5D9NA 3R4IA 2YZ5A 3EOOA 1HF6A 4PTXA 1QO5A 1CXIA 5FESA 2BG5A 3F5LA 2Z0IA 5BOOA 2PBGA 4O13A 2F61A 1UR2A 4D6CA 1KR0A 1HN1A 3NUKA 3OVRA 1I1XA 3T09A 4QIUA 3GTXA 1P0DA 1JI1A 1PWMA 1MMFA 3O2LA 2Y8VA 4LALA 4TQTA 3JU2A 1R46A 3IGXA 2GGJA 2INFA 2Y2WA 3QHOA 1MUMA 3TVAA 3ZS4A 4UR8A 1V3KA 2XGBA 4LUTB 4XD3A 1VBJA 3VMOA 2P5NA 1YHTA 2FTWA 4UQ9A 1GW1A 4ACZB 4GIRA 3MO7A 4KMQA 3HN3A 3FXGA 3WNLA 1QNSA 1C8YA 1Q6OA 5BRPA 1GVRA 3C61A 3TROA 3G1VA 4PULA 3A5VA 2PTZA 4Q8UA 2ZOXA 3WLKX 2AGTA 4WX2A 3R5EA 4F0RA 5CZ0A 5CPOA 3UJFA 3WBAA 2YKKA 2ZADA 4OBTA 4DI8A 2REQA 3WD2A 4HP5A 3BUVA 3ORWA 1RA0A 2CERA 4GY1A 4XBKA 1K6AA 3QR0A 2QCFA 3U2CA 3V7PA 3H2OA 1TJPA 2ZKMX 3UGVA 1F3TA 2PWDA 1KTBA 1PKLA 2PDNA 4CEXC 1WP6A 1TJ0A 4IQJA 1YIXA 1US3A 4CNUA 3FA3A 1VCFA 5F2GA 3WNNA 4UTJA 2CW6A 3FJNA 4O0QA 5HDRA 5FL0A 1P0EA 3WIJA 2GZXA 3VOGA 3DYMA 4K7YA 3GH5A 4Q8NA 1Q5MA 1ZJAA 3OODA 3UERA 3VD5A 3UG3A 1UD2A 1PDYA 3BGAA 1XH0A 1QNOA 1C92A 1IWPA 2DT2A 4C6LA 1XYZA 2VCCA 1J0YA 1ME9A 4AHOA 1TO3A 1LT8A 2Z2UA 3OHIA 3OHMB 2G4FA 3BLKA 2ZZ5A 3UPWA 2E09A 4PUDA 4Z1YA 2D22A 5AHLA 2X30A 3ZT7A 4XUYA 2FH6A 4WDXA 3W72A 4ZA0A 4F2BA 4MNMA 3L66A 4FK9A 5M5DA 1SSDA 3EZ4A 3OZOA 4BF7A 1K4GA 1Q45A 3F7JA 1XRFA 1MNSA 2B7PA 3JW7A 2A7PA 1R7OA 6CGTA 1S5NA 3KWXA 5BRQA 3PWAA 4YNGA 3N73A 1E70M 3NR0A 1EPXA 1BHGA 1K8CA 4J3ZA 4JTJA 1FKWA 1BEUA 4TV5A 2QCDB 1FWWA 3AIRA 2YCLB 2IKGA 4XKMA 1MEWA 2VX5A 4XVDA 5DCDA 1UQZA 1EEXA 2KZHA 1RJPA 4PMZA 3B0YA 3SW6A 4WIWA 1TUXA 3C2RA 4DNHA 3ZOAA 5C9ZA 2ZUUA 4GZ7A 4PBGA 5AC6A 1F3WA 3EKZA 3WEZA 1SW7A 4IX2A 3VUPA 3HZ3A 3GU1A 3OZMA 4WHBA 3RLHA 1OYCA 4ML9A 2VD9A 3TMQA 3TSMA 1IZCA 1CPUA 5CC7A 1O6IA 1OT1A 1QATA 3RU8X 3SBFA 4DUVA 3NQ8A 2ACQA 4CNPA 4POCA 5F1VA 2GQ8A 4PB3A 3QXBA 3KCLA 3WJXA 5IHRA 3BXWA 3JR2A 1U5JA 4HB7A 4JX4A 3VOJA 3T40A 3MHFA 2DPEA 4D72A 3GFYA 1UYQA 4Y9PA 3CUFA 3TYDA 1EJWC 4OTKA 3PUDA 5GJNA 5DT7A 4NILA 4GXMA 2UY5A 2CIPA 4XIMA 4FB7A 3A13A 1SJAA 3AUOA 4DUXA 4YS1A 3GTIA 3LMYA 2ZRZA 4HNUA 4I6VA 9RUBA 4QQUA 1EOMA 4IH3A 1IV8A 5CGQA 4MF4A 3RDKA 3WH5A 4GX8A 2VP8A 2QV4A 3MWCA 3C5QA 2WSPA 8XIMA 4MDPA 4JX5A 3LI1A 4YL2A 1FCVA 4LV9A 2AQVA 3S0CA 5F2LA 2XIIA 4FO4A 1QO2A 3OP2A 3GVVA 1BRLA 1T41A 1GPWA 2NXIA 2VVNA 1TMQA 5JIWA 2V5DA 1GJUA 2ZZ7A 4FNPA 2PF0A 3P8JA 4DO7A 3UZYA 5CGTA 2A3HA 3FJ4A 3HQPA 1JDCA 2Z6JA 2ISVA 2ZUMA 3AHTA 1DWHM 4NIRA 5IXEA 3NQMA 1HXJA 1PDZA 5DMNA 4FXRA 3QPEA 1YBQA 4NJKA 1W3TA 4YTUA 1IZKA 3PJTA 3OJGA 2UY3A 3NA8A 2R1MA 5EKYA 4Q7IA 5LXXA 3VZYA 1SO3A 4AVNA 4NZ4A 1X1NA 4AEFA 3R79A 4AZHA 1UC4A 5I0DA 4PCPA 4B15A 1P48A 3C0LA 2X09A 4WLCA 5G2IA 1ZENA 3WK0A 3DN5A 3NJ3A 3QF0A 3GC5A 1OEPA 3U57A 5XIMA 5AVNA 4Z1BA 4JCMA 2O4QA 4HPJA 1KD0A 3L0KA 2PP3A 3UR8A 4C5ZA 2ZC1A 3E2RA 3K13A 3Q65A 1DIDA 3PZNA 1XLLA 2Y7DA 4GVIA 1QI3A 5FF7A 3VCRA 3QOKA 3FEQA 3L4TA 5BXPA 1UP0A 1GOXA 3LU2A 3G1HA 3IUDA 1IE7C 3TJXA 4JQ3A 4KFNA 4PMRA 3KLLA 1H62A 3TEVA 4HSOA 4A21A 2VXNA 2QAPA 2WJDA 2DSUA 2E3ZA 2HVNA 1KXQA 1GJWA 1US2A 5IDIA 3NDYA 1A5MC 4HCHA 4LVDA 4AD4A 2CBIA 1B3ZA 1W9XA 4US5D 3U4AA 4DJFD 3CZLA 3PVFA 5AZ1A 1HKIA 3R1ZA 3ERPA 3MDUA 4LYRA 2B4GA 3KCJA 1A49A 4XZWA 3WH9A 1H2JA 3R0KA 2G5WA 2G3JA 3OBKA 2D73A 4D6EA 1JF6A 1NARA 5FEZA 3WLNA 2GQAA 1RA5A 1TWIA 3NQVA 4J4KA 1Q8AA 1FHVA 2WM1A 1F7BA 1XCWA 2A1YA 4MADA 1GHSA 3PSVA 2O9PA 1I6NA 1V0KA 4YTRA 2E6AA 4QJ5B 4AX7A 3M0JA 4FHAA 4UMAA 4QGCA 3UQNA 4A22A 3OZYA 3UETA 5CSUA 5HINA 2HDJA 3TAKA 1XX1A 1CW2A 2QUTA 5FJTA 1OFDA 2NQ9A 4HBKA 4WKHA 1KQYA 2W4XA 1JD7A 4KESA 2GK1B 4S3CA 1UUOA 1OT2A 3F2DA 3ZLHA 3WQCA 3L65A 3R25A 4KWUA 2Z1SA 3M0VA 3M0YA 4ZBCA 1XCFA 4EX4A 4J3XA 1E4IA 1E3ZA 2QCEA 3DOPA 4YXGA 4EPEC 2E40A 4HNLA 3T1GA 4D6JA 2F6UA 3B8WA 3HB9A 3WLIA 4A3UA 4CNOA 3BOFA 5AOUA 4WDTA 2QNEA 3DHFA 4LUIA 5FF3A 4W8AA 2NUYA 4JTEA 1CEOA 2DJXA 5U4NA 4MSSA 2W91A 1E15A 4KRUA 4HT3A 1EZ2A 4R3UA 4PCFA 4A8NA 2PCEA 2WZHA 2PDIA 9XIAA 3WEOA 1UKPA 1WQ5A 3G1RA 1P1MA 3MZNA 4ASTA 1W9UA 3S42A 4MG4A 4WY0F 4GI8A 4Y7EA 3ID7A 3BC9A 3A64A 3VNKA 3LXCA 1EO7A 3KBWA 3T8QA 3N3MA 1DKWA 4AIEA 1O1ZA 4LB3A 7CGTA 4MY8A 3AHXA 3ISIX 4MMWA 1OCQA 2V5JA 5FSEC 1XLCA 1Y65A 4A3QA 3QKZA 3T0CA 1F3EA 1QHPA 3N2OA 2WHLA 4E8CA 1ME7A 1GPFA 2RKXA 1CXHA 4CN4A 1I2RA 2X40A 4K8EA 1BYCA 4G6CA 2PMQA 2YW4A 4E38A 5DRIA 4BI5A 2XSXA 4MHBA 5C7VA 1J0KA 3ITLA 4DBDA 4U2YA 1M65A 1K1DA 1LBMA 2PLJA 3WNOA 2BNJA 2UV8G 1JDEA 3ZT6A 1AL7A 4BWLC 2DUAA 2JFEX 2Z1XA 4MIMA 1L2QA 4Y9MA 2NW0A 2QGHA 1XS2A 4MM1A 1XQLA 3FXYA 4OUEA 3ITTA 3GVWA 4HMCA 3PWIA 1NAL1 1GEHA 4XIAA 1MSSA 2B7OA 3UP8A 1NTHA 1P6BA 4MNJA 1KBBA 3VKBA 1KXVA 1V02E 3SN0A 3H7VA 3H4WA 4ADUA 3LHYA 1W0MA 3M43A 1U30A 3M0LA 4DO6A 1GK8A 5TQLA 3NQEA 3PHAA 1X7IA 4IL0A 4Y8FA 3C2YA 3H4XA 2CLLA 2ZA3A 4HK7A 3SI9A 2CKSA 2C1HA 1V6UA 1C90A 3IVUA 4JHZA 3UU0A 2FH8A 3MCNA 5A2BA 5CEWA 1W1B1 1E6RA 3N6JA 4I9AA 1C93A 3A4AA 3WQPA 5A6MA 4O8AA 3TZNA 3CAWA 2NUXA 4UOQA 4WJXA 1KFJA 5KTLA 5C9XA 4KIRA 4C6MA 3BDKA 2V5KA 1UR0A 2AOSA 3H2FA 4NZFA 1RQBA 7TIMA 1BFNA 4S2CA 3GNRA 3ABOA 4PMUA 1NP2A 1ISXA 3WLLA 1J6OA 2PZ0A 2PDYA 5GVJA 3SCOA 2P8BA 4RV3A 3O6YX 4DB7A 3EEGA 3P81A 2Z1KA 3WF1A 1VLWA 4PEKA 3W4RA 1VPYA 2BY2A 3F4NA 2QT3A 1FWTA 3AYTA 2ADAA 1Y5WA 1QTWA 5FOOA 1CTNA 3WLQA 3WLOA 3IAPA 5T91A 1GQLA 1H1YA 3KBSA 3I10A 1ADDA 2WMKA 3R7MA 4GY0A 2CLEA 3LTPA 2HISA 1H49A 4K6AA 3VGGA 4DIAA 3ANYA 3AIBA 2E6DA 3TSBA 3A4XA 4GKTA 3SY8A 6PTDA 5BYWA 3AU2A 4J5NA 5CAHA 2VEMA 3KVJA 4XAZA 5T26A 1A5LC 5DBTA 1WXJA 1R87A 3GK0A 1NQKA 4JOMA 4RK8A 5G2WA 4CQBA 4NHVA 1EIBA 3N6QA 4DAIA 2J6VA 2A85A 4KPLA 4Z1DA 1DXIA 1WOBA 3WD1A 2J7BA 2DZAA 3BTNA 2I17A 2FYMA 1JQVA 1S2UA 5H8PA 3GNNA 3IV8A 3LSBA 4DAFA 3AIQA 3VPLA 2BP1A 1W1VA 3VOHA 8XIAA 5DFAA 4PUKA 2XVGA 2FTYA 4H6RA 2X1UA 3UPMA 4H6EA 2XZ9A 5H1WA 2B7NA 1VF8A 1AA1B 4UNKA 3PSWA 5FF2A 4AZ6A 2B81A 4JQ2A 3N1AA 1OM0A 3R6IA 4S23A 4ZSUA 4G1KA 4ZXLA 4FNUA 4S3EA 3LTYA 3CL8A 4ZB5A 1O60A 4UFKA 2ZX7A 4I9MA 2E4TA 3HOJA 1UH3A 4PH6A 3BAWA 1G4TA 1PSCA 3D47A 2MUCA 4XV0A 1ICSA 5FJJA 5A69A 4WD0A 3WK2A 1S3TC 1PHQA 3EDEA 4PODA 2CHOA 2WNNA 3EB2A 1BTMA 1F73A 3O07A 1WNOA 4UNIA 4XZNX 2ZA2A 1C7TA 2KAUC 2PU1A 1KTCA 2FZ8A 2J88A 3URQA 1O5QA 3PNZA 2WSRA 3BG5A 1PO9A 3QMTA 3GY1A 4GYFA 5AC4A 3K1DA 2A3LA 1F07A 5HAOA 1ZP3A 3PUOA 3HG3A 1PX3A 3MI6A 2HCVA 5EY5A 3I7QA 3BK0A 2F8QA 4FLSA 1LQAA 5AHMA 5LIUX 2W67A 1HT6A 3SCVA 5CJ5A 1M01A 4HNTA 3ZVIA 3THDA 3QR3A 1V08A 3R94A 1R9ZA 3TQ0A 1PIIA 3N19B 3O9NA 2VI0A 3B97A 4E2BA 5A3HA 3S5OA 5HK4A 4DYJA 1SZNA 1OX4A 4FXFA 3TTEA 3W1QA 4LUSB 5CPLA 3NPVA 2NWSA 1H7PA 1BVNP 2A6NA 2HQAA 4I8YA 4EAMA 1GYLA 2C79A 3GZAA 3A4WA 3LCHA 1XIBA 5JBFA 2VC7A 3ARSA 3U0HA 3AXIA 2JF7A 5JVLA 1EYEA 3UZXA 3G3DA 4IZGA 1ADSA 1XBYA 3MU7A 4D6IA 2PGRA 1GHRA 5E09A 5CJNA 1M7OA 4N9BA 3FJ6A 1VGAA 3UW6A 5TNVA 1ME8A 2FJUB 4IOTA 4LAUA 1HVQA 3O06A 1QOQA 4L6DA 3PANA 1WAUA 1H7WA 3E02A 3NVTA 3OVPA 1DWJM 4V2XA 3GXMA 2PDGA 1Y8BA 2E67A 3UR7A 4NJGA 3W7OA 3W87A 4C7FA 3EBVA 4NZ1A 3MJMA 3UD6A 2XISA 4BJHA 3SFKA 3AUJA 1ZP4A 5I5RA 2HBXA 2OYKA 3WLMA 3KDOA 4WEVX 1EYWA 4YTTA 3OVGA 1WUEA 3G77A 4H8UA 2FTPA 3I7SA 4UXDA 1E9YB 4JFVA 1JPMA 3AYSA 2OPJA 3E6EA 1OB0A 2J75A 3B4YA 3XISA 2UZ9A 4GNVA 3WF2A 4LW7A 1PXGA 2J9YA 4IMDA 2C0AA 1U33A 2Z1BA 3RAOA 3G8RA 1R2SA 1CECA 3PTMA 1NJJA 4HPHA 4DWSA 1SO5A 1GVIA 5I23A 2ON3A 1Z42A 2I5IA 1JDFA 1ZNNA 3R12A 3VVGA 4QDMA 3GFXA 3S1WA 1K77A 1WAWA 2TPSA 3DFSA 3W1XA 3BCJA 3KOYA 2UWFA 4H9TA 4GC3A 4TUFA 1UA3A 4BEQA 1H0GA 3B40A 2GVEA 2P88A 2YXXA 2YL5A 5EFDA 4AWSA 3BCFA 3I6RA 1AH4A 4BQ2A 4O1AA 5AHEA 4RNJA 5EMUA 4Z2JA 3PUEA 2BHZA 1SGJA 2ZZ1A 3U48A 4AY7A 3TWAA 2IQTA 5I77A 3BZGA 5DN1A 1OZMA 5I07A 4WK9A 1TTPA 2IMRA 4DBSA 1MDRA 2BS9A 1V02A 2CU0A 3UGRA 4JAWA 2HPIA 1W1IE 3IIPA 1AMYA 4PMQA 3F4WA 4QLKA 1GONA 2Y61A 2DZXA 4CD8A 4P7OA 1S5MA 3BMXA 4IMAA 3VGHA 2VEKA 1RK5A 1TPH1 2RDUA 1TPEA 1B3WA 3W24A 1NFBA 5E1QA 2OJPA 4Q8MA 3STCA 5CPQA 2C18A 1S5TA 3LGDA 3TTOA 1B3VA 1A4LA 1HP4A 3L4VA 1JNEA 3T4WA 1RY8A 3MMWA 1RPKA 3O3RA 1V6XA 2X41A 4Z42C 2JGQA 5HUOA 1R3TA 3DGRA 2ZWYA 4IJRA 1XRTA 2CZEA 3M44A 4ORMA 4DYEA 3AS1A 1ZL1A 2JKEA 2H9AB 2FVKA 2D1ZA 5M3WA 2YLLA 3NPWA 4GINA 1SZRA 2VEGA 4DBEA 1PZ2A 4MAZA 3AWOA 4LC6A 1UD6A 3EXRA 1FTXA 3W29A 3V3WA 1R5YA 1T40A 1D2KA 3SADA 2ABAA 2PF8A 4Q32A 4MWAC 2HWGA 5F4XA 4UZUA 3URBA 1PCWA 4X2RA 1BSLA 4JFUA 1WKFA 2BZNA 1S5WA 1AQMA 2EG6A 2PWGA 4C6PA 1NY1A 1QK0A 3GNDA 5FCZA 1UWUA 2ZUWA 1K9FA 4AZBA 1JZ4A 3MV11 3N2TA 3UCDA 4H7ZA 1IXQA 3B04A 2C16A 4ZSTA 4RLIA 2VEIA 4M7SA 3B05A 4E2DA 4XBSA 3ZR5A 4UTWC 2DH2A 1TR1A 3QRHA 2FPVA 4P7LA 3M16A 4NAFB 5E9XA 4QG6A 2OX4A 1UPPA 3KRZA 3VKJA 3EA2A 4JFSA 3W73A 3WD3A 1E6ZA 1BKHA 1HL9A 1P6WA 2XM1A 4U5IA 1XBXA 3ES8A 4NRRA 5DLCA 1P7TB 2Y88A 1VFSA 3LHWA 3HURA 3W2LA 4YTQA 1G94A 3W37A 4GH1A 2F2HA 2PLMA 3F1QA 1X1OA 3W1NA 3D3AA 4B4HA 3DUGA 1AL8A 2Z26A 3C3NA 3L21A 1BVWA 2FGBA 3TTSA 1FKXA 4RNFA 1NWTA 3KBVA 3KBJA 4JXCA 4K36A 4Q8VA 1OD8A 3CL7A 5HOSA 2ATMA 4S3FA 3SCRA 1TPB1 3ABQA 1SO4A 1TKKA 3B8SA 4ERAA 3CMJA 2IPJA 3HV9A 3VKDA 2O9OA 1YYAA 1XIHA 5D2VA 3AI0A 4MTVA 3ZVHB 1POJA 3TYUA 4LPCA 1FWNA 4RCXA 3NQ7A 3L5MA 4ZCWA 4LBUA 2OZ8A 2W92A 1NDWA 3FIGA 4Q8QA 3PBYA 2R82A 1OWQA 3GXTA 4BQ5A 3KWSA 1A5SA 3M7WA 3WL1A 3IV3A 4CNNA 5C0QA 2J13A 1EO5A 3AMDA 1XW8A 1UHVA 5BWAA 2D20A 4BQ3A 5AYYA 1DJZA 5IHSA 2X7VA 1VPQA 3WMSA 1Q6RA 3TYAA 3LSCA 2DH3A 3LPFA 4LVBA 1MEIA 4J3TA 3UXKA 3LPOA 3MBFA 1I4NA 2ZUSA 2PWVA 3DKLA 5A8OA 1AZ1A 1SFTA 1F05A 3USBA 3TKFA 1GYMA 1A53A 3KOWA 3CYVA 4A8LA 3B9AA 1CENA 2ZICA 5HPCA 1FUYA 3PF3A 2JBMA 3ARWA 1Z44A 3H2CA 1M53A 4FAMA 2AMGA 3GUWA 2DVTA 2J77A 1JUKA 1S46A 3OZPA 1UKQA 1TA3B 3GBDA 4J9JA 3HGOA 3GR4A 5KSWA 3LCIA 3T0TA 1GQIA 1DXEA 3TLLA 1VYPX 3B0UX 3N4EA 1QU4A 3V4BA 1JCMP 4ZE4A 1GVYA 3WBXA 5C8BB 3H2AA 4H04A 4DJDC 3RN6A 3EGJA 3UVIA 2XINA 5FACA 3MP5A 1J6PA 1MFUA 3EOEA 1HO1A 5A6KA 1HKKA 3HGJA 4Q4QA 1JRBA 2PGWA 6XIMA 1ONRA 3UY7A 1PBGA 1KV5A 4ACZA 1JYNA 2D24A 3W26A 2FVMA 3T0AA 1LTDA 1KM5A 2FHFA 2JIWA 4JNMA 1W2PA 3C0QA 2F6XA 4XWUA 3ZMRA 1VJSA 3Q37A 1XFBA 3A9BA 4US6A 3FX4A 4P2VA 2WBKA 4GO9A 5C2XA 1GVOA 3L4XA 3LI0A 3IANA 2J8GA 3NCOA 3UWVA 3OGSA 3WNKA 1X6UA 1F6PA 5HXMA 3GO2A 3E9AA 3P7YA 4WGXA 5EMMA 1E0TA 3N18A 1RP9A 2J7EA 4G7FA 1LWHA 1UR3M 3C8NA 1DIKA 1HKVA 4LTSA 2QV5A 3R10A 3L2MA 3GKFA 3M5VA 2ZZ6A 2D69A 4KT2A 3TAOA 3GKAA 1M68A 3P74A 2PDUA 2EEXA 1FY6A 1IGWA 3VU2A 1A0CA 4AD5A 3W81A 1SMDA 2NLIA 4IPPA 3KEHA 3ZLGA 4JKKA 3NQGA 4F66A 3SRDA 1T8QA 2CEQA 2Y63A 1GOOA 3TCEA 2OSXA 2VELA 3UG5A 4GVFA 3MTWA 1ZSXA 4MNLA 2V9DA 4GIEA 1F8MA 3THCA 7PTDA 3SR7A 3B8UA 3ARVA 1LP6A 4JN6A 3REQA 3UJEA 3GNPA 4W89A 1F4HA 3OLGA 4NI3A 2GQ9A 4LAKA 2PODA 3KBMA 4AX6A 1KRAC 2GVGA 1OFQA 3LZ3A 1PL9A 4CNSA 4FA3A 4I7WA 1JCYA 4CN6A 4ZE5A 1ZY9A 1XYFA 3DG7A 1KBLA 4REQA 1ITQA 2G4JA 4OBRA 3A9IA 5I3HA 3I4KA 2ZTKA 1EJRC 2DY3A 3NXLA 2D3LA 5KMYA 2VZVA 4LS2A 4O28A 3VD3A 3FEMA 1FWAC 3VKAA 3VUSA 3MDWA 1H1ZA 2J7CA 2QCDA 1W3JA 1QWGA 1R85A 3TZFA 2PDJA 2BB0A 4TMBA 3FKKA 1D7KA 2VZUA 3MVIA 3TC6A 3WDRA 1NOWA 2CETA 3M7SA 4DNMA 3VMNA 2W3ZA 3WJZA 1AH3A 5D8ZA 3VDCA 3P67A 2QULA 2YB1A 4B5TA 1JZ2A 2HE8A 4Y6GA 2D0HA 3G0XA 4MFDA 4MZYA 1UR8A 1KM4A 1TV4A 1K7FA 4HU8A 5LHEA 4YPJA 3QC3A 4IPJA 1XKJA 4PRRA 3BAYA 1ZCCA 5C6MA 3W7CA 2QLYA 3FGCB 4O57A 3K46A 4QS6A 1EBHA 4JTCA 3W7JA 5AVHA 2PEVA 4U5KA 1W56A 1WKYA 1XGZA 3LNMA 1FWIC 2WCSA 4QG8A 1W31A 3H55A 4O4WA 3PJXA 4HNCA 4KRZA 4AIUA 1VH7A 2R91A 4OOZA 3U5YA 2E6FA 2VR2A 1KLZA 3S9ZA 3MMTA 1ITXA 5LGXA 1T96A 2QXWA 1LORA 1YBQB 4X9SA 1Z7AA 3SEPA 3N29A 2PRLA 4B5NA 2YA2A 2G8ZA 3QQ1A 4S3DA 3W7QA 3MBDA 5K9DA 1TPDA 2Q71A 4MY9A 3C0SA 1AZ2A 3MHUA 3OLEA 4HYRA 3RK8A 4GD0A 3BE7A 2FB3A 2OWXA 4MYXA 3LGGA 2ZDSA 1GZGA 1IF2A 4RNIA 1MW2A 5K2ZA 4W7UA 4JIRA 4Q22A 1UA7A 3D6NA 2GQ3A 1XR2A 2RHGA 2OB3A 1UZHA 2WMHA 1YPIA 8CGTA 2ALRA 2BSLA 2GGHA 4UR9A 4HSNA 5LIWX 3R0DA 1J11A 1FWJC 1FWBC 2ZQ0A 2VGGA 3W02A 4NNCA 1W5OA 4LY8A 2I1OA 3HTWA 2XUCA 1ZU8A 3AZSA 1KFWA 1Q6LA 1QUMA 4C5YA 1EXBA 1HJWA 3RM4A 3UZ5A 3ARYA 2JF6A 5FEXA 3PWGA 4JEJA 2V5CA 3K8MA 4A3RA 2X0YA 1YTKA 3U6WA 4GYPC 3SN1A 5E6ZA 4Q8TA 1E55A 2PDCA 1J79A 5ABHA 4R53A 6TIMA 2Z24A 2AGKA 2CLPA 4NXKA 1G01A 2Q6ZA 4Q7BA 3SRKA 4MKSA 4XD5A 1W9PA 5IRPA 3I6TA 2DZPA 3XINA 3BLPX 1VFUA 5AYZA 1LL6A 2E9BA 3DERA 1OJXA 1V4YA 1VQTA 1ELSA 3E5PA 2X0SA 1DWIM 4AZIA 3HQNA 4DEFA 5FL1A 2CXGA 1LLWA 2WVTA 4WZHA 1JULA 1XYMA 2PP1A 2V81A 4FF5A 1LL7A 4O4VA 4RV8A 2PWEA 1A50A 3MMDA 3RJYA 1CB2A 3HMCA 1TV2A 1C8QA 5ABFA 5K3VA 2YBVA 5CSRA 3USZA 4Q4RA 1DTUA 2OVLA 2CLOA 1V6VA 2Q3OA 2OU4A 4HCLA 2VWTA 4EAYA 2Q8XA 2WSQA 1SFSA 2AL2B 1NDYA 1W8GA 3PBGA 2TRSA 1TVNA 3OLDA 2DIKA 1CGWA 5AY7A 4DVOA 3BURA 3WQWA 3AC0A 3SUWA 2V67A 3TA9A 1KM2A 2BY1A 4YTSA 4BF9A 4UFLA 2P10A 1VP5A 1F6YA 1H4PA 2V6AA 4EOUA 1GW9A 5HANA 1J5TA 4HN8A 5G4WA 3N6HA 1DHPA 3Q58A 4HCDA 3VC5A 3O1NA 1H7OA 1LRNA 3N15A 4ZTYA 4E8DA 2AMXA 3RCMA 2YGYA 3N4FA 4OE7A 4PRWA 4AYGA 1E40A 1RY0A 4INFA 2VEPA 3BPWA 4N02A 4V33A 5I09A 3M5XA 3VIGA 1OVDA 1E1EA 4PTMA 2C1IA 3CEUA 1OX6A 3T44A 3CO8A 5A6BD 1XI3A 5I24A 3P2VA 2ZRVA 1W5PA 4U31A 5BXRA 2F7FA 3ZYZA 1LL4A 2G96A 3NWRA 1O5RA 2CC0A 3CZEA 4NF7A 2VC9A 4N4QA 1BVZA 1XG4A 3MWAA 1YDNA 4BQ4A 2NX9A 1YW1A 1VPXA 2P0IA 1BWKA 4UQBA 2XFWA 1TCMA 4N9EA 1L6SA 2CHNA 5LA2A 3GHRA 4A05A 3NYDA 3GAKA 1AODA 2DQXA 1HNYA 3VE7A 4PL1A 4N42A 1H63A 1PIFA 2WSYA 1TQJA 3BG3A 2PDQA 4ZB2A 2XVNA 3MKKA 5CZTA 1DEDA 1KLYA 2WYSA 3S2JA 1A80A 3BSGA 3PM6A 4HYVA 2X05A 2ANUA 3ELFA 5IM51 3H2EA 3SN4A 1DQXA 2WVUA 2WCGA 4NRSA 4Q8PA 3O7UA 4GQQA 4N9CA 5HNTA 3M46A 2BGQA 5BZAA 4N7QA 3S4TA 4BZYA 4Q6JA 1O68A 2P3EA 4D6FA 4NJIA 4E0CA 3VFLA 4PTWA 2A3EA 1LZOA 3CO4A 4IIBA 1AW1A 4QP0A 2Z7KA 2C15A 3CM4A 3ABRA 3WFLA 1KGWA 2I5GA 1IEQA 3LLDA 1L9WA 1TIMA 2GUUA 4G1NA 1BKSA 1GOQA 3O05A 1JYXA 4LGXA 2F84A 1ZALA 3FJLA 3B9NA 3QFWA 4UTTA 1SW3A 3OVQA 1S2AA 3QZ6A 4Z1CA 4WUIA 4DQWA 3EX1A 4MPKA 1W3HA 4E2OA 4DZAA 3URAA 3E49A 4Q8WA 5IFPA 3GSMA 3WDJA 4OQVA 2B0MA 3NL2A 1XPYA 3U3HA 2V5LA 3KW3A 4OKDA 5D32A 3J7HA 3W25A 4ZQNA 2V8ZA 4PCTA 5AHFA 3EMZA 2BGNE 4RXFA 8A3HA 4OOUA 1UUQA 3C2EA 7XIMA 3OYZA 3O6CA 5EPDA 4BI7A 1B3YA 1FVPA 3DFTA 4DPPA 4P7RA 4P8XA 3W7IA 1ZBWA 3RLVA 3KDNA 1K3UA 4FX7A 4JTSA 1W2VA 3A21A 5LA1A 1EA9C 3H6OA 4HZMA 4G8TA 4JEQA 1XM3A 1R86A 3EKLA 2E77A 3I3DA 4EPBC 1ENUA 3VNIA 4IXHA 3VOIA 1RBOB 4O1CA 1G7VA 1YRRA 3BSMA 4LOCA 3AALA 4WXYA 1GKPA 4JTFA 1CT5A 4C60A 1CXFA 1M3UA 3GR8A 4AIBA 3S5SA 5AYIA 2A4AA 3KTCA 4E8GA 1KRMA 2D0GA 3PZMA 1C8VA 1UKSA 4YYFA 2FIQA 4D1IA 1OCJA 4GABA 1W5MA 5C2GA 4MUPA 2XU2A 3MY9A 4QE4A 3BQ5A 4M3PA 3P61A 3PNUA 3PTDA 4EKJA 2V3DA 4MYAA 1YEYA 4NYYA 4ZEPA 3G6MA 1ONXA 1XG3A 2BVYA 3K2GA 3GVQA 4IG2A 4N0RA 4CCEA 4L9YA 1B5TA 4J27A 3A47A 4H4IA 1W1TA 1QMLA 5E0CA 1TV7A 1B9BA 3QQWA 2UY4A 1X1ZA 1TJ2A 2ZZ2A 5BXSA 3O6DA 2R9RA 1UD3A 2VTFA 1QVBA 3WBEA 5H2ZA 3CV6A 4QHRA 6ALDA 2OGJA 1OYAA 3VI2A 3HA1A 1E0WA 4S3BA 2VCAA 4GOAA 1RCXB 2WB5A 4D6DA 1M04A 4QCEA 3QPZA 3CV2A 2A3BA 3EB3A 1HJUA 4MAVA 3EOUA 5C2CA 1XIGA 2YBTA 4MWAD 3V0UA 1Z48A 2IKJA 1PKMA 1V79A 1SFLA 1DTNA 2NSXA 4AD3A 1FHLA 2OLAA 3E38A 3QHNA 1FP8A 3NQFA 3SDOA 4IPNB 3DECA 4O12A 3ECQA 3B8TA 2CLIA 1EQCA 4JN7A 3HPSA 4HNOA 3LHTA 3DFYA 1J8VA 4DWDA 3UNTA 3TMLA 3TR9A 1TTIA 4JR5A 3P14A 1AW2A 3GRIA 1GEQA 4W86A 2NVDA 3W28A 1MWOA 4W88A 3KE0A 3A22A 3UXLA 3OA3A 3ONBA 3CQIA 1H3GA 4KIEA 4QITA 5BU9A 4JTIA 2C13A 3AXKA 4DJFC 4R34A 4Z2LA 3T08A 1NF0A 3CWNA 3K8KA 1WZLA 3PUGA 1Z69A 3BL3A 4RKAA 5B7YA 5HNUA 1H7NA 3L4UA 5D9OA 1EA0A 4O8RA 2PTYA 3QR1A 3N14A 4PMNA 4GQ0A 5GNYA 1TVPA 5EFFA 3RGTA 1HZYA 2POZA 2YCJA 3OGRA 1LWJA 5AZ0A 4F0SA 1KO0A 1E6QM 2ZXDA 3PPCA 1XPGA 3IIVA 3WZ0E 3K4DA 3T7VA 3GYEA 4ZOCA 3AIVA 4OJYA 3SCTA 1XIDA 3DXIA 1RBLA 1CI1A 1GQJA 1U1JA 3SQMA 3C0JA 5FA5A 1GVSA 4EK7A 4X61A 2TSYA 3UXAA 5HJYA 3IK4A 3W6MA 1W1ZA 4LEQA 1M6JA 2V2HA 1OQFA 1CYGA 3BLDA 3UJRA 4R9OA 2D2GA 3ATYA 3G5EA 3T07A 2WMGA 3MSGA 3TP4A 3QMSA 4ZB0A 4QJ3B 3W86A 1TX0A 5HULA 1KB3A 4M81A 3UZWA 1QK2A 1FX6A 1FHUA 4LVGA 1EDTA 3V1HA 5M1TA 4ZL1A 1XIJA 4CN1A 3IJ6A 2ONEA 3OYXA 3TH6A 4PGLA 3R8GA 2JGYA 2JE8A 3CZ8A 3G1DA 2YJQA 4RDYA 2FLIA 1KKRA 3UR2A 2PURA 1RQEA 3CGTA 3S1GA 1Y5XA 3T55A 5A1AA 5CPNA 3BG9A 3CQKA 4UUIA 2XM2A 2WKJA 1OINA 2FMNA 4PBFA 1AJ0A 2BOGX 3AMKA 1CLVA 2ZZ3A 4ICCX 5FJIA 1OF6A 3DBNA 2AL1A 3CHDA 2DSKA 2WJZA 4JQ1A 2CLFA 1OK4A 4S3AA 1JVNA 5D9MA 4IGHA 3CHEA 3WENA 4NYUA 1NH6A 1DE6A 4S3JA 3L12A 3BAXA 3DAQA 1IXPA 4LUSA 2D2JA 1L6GA 3WMCA 2V2DA 3N34A 4Y9NA 2ACSA 4JGDA 4GACA 5CBJA 2E0PA 4IL2A 3GG0A 1CXEA 1VB9A 3G18A 3QY6A 2WJFA 3HJEA 4JTRA 2GYIA 3WQ8A 4ZQOA 4OBSA 3ONCA 1TWDA 1JZ6A 1B2YA 1JIBA 1OFOA 2Z6IA 4KCVA 1R3RA 1UP3A 4B5XA 3NL3A 3BAIA 1WOAA 5GJMA 3W7DA 4N9DA 3NURA 1N8WA 4NZ3A 4QNWA 1OG6A 5A8MA 1Q6QA 2VOTA 1VR6A 2J7HA 1A5AA 1FFQA 1PV8A 3E2VA 4IX0A 1UWTA 2NZLA 1VJIA 3Q67A 3RNDA 3AS2A 3LCXA 3L4YA 2VDIA 4FLQA 3G1AA 5J04A 3CUGA 3RU6A 1LQ2A 3EWYA 3NQAA 5FD0A 1L6FA 1CGVA 3SCUA 1R7AA 2CXEA 3TK7A 1Y5VA 3C2FA 4ILSA 2Z00A 3BAKA 2HPMA 1OIMA 2V82A 4OECA 3VNZA 4I5RA 4TMCA 3AAMA 3JS3A 1A3HA 3PN8A 4CNTA 3WNMA 4LC8A 1YXCA 4HHMA 3I7RA 1I60A 1VBRA 1WDSA 3CAKA 2WKGA 2MNRA 3ABXA 3VOCA 1Q7ZA 4KEMA 4IGNA 2Y85A 5I03A 1TPWA 3MI3A 3CWHA 3W2UA 3CT7A 2UY2A 1B30A 4GFIA 3QHMA 4AMAA 4AF0B 1FFRA 4TOQA 1K9TA 3LM3A 4MWAA 2OEKA 2XWDA 4XBJA 1MVYA 4XO7A 2E5CA 1VAHA 1VIWA 3PZOA 1A5BA 5AC7A 5TD4A 1WB0A 1RH9A 1Z8AA 2FZ9A 1YE4A 1EKOA 3W7LA 4O1DA 4PFHA 4GYKA 1HO4A 4UTWA 1XYCA 4IIGA 4AD1A 2IXUA 1OYBA 1ZJHA 1C9WA 3FOKA 1MXSA 1TMHA 3FSUA 1F9CA 3IWPA 2QR6A 5FJPA 3RG6A 3LB0A 3RM9A 5IDZA 2YL6A 3G8EA 5CLTA 4JPGA 4LFYA 3GDMA 1VFTA 1DJYA 3HPZA 3TQPA 5D03A 3FHAA 1IT8A 1CDGA 4RDWA 4ORIA 4LEFA 1NWSA 4Q7NA 4M7TA 4B90A 1LRQA 5FF0A 5BMXA 1J2WA 4EWND 1SZGA 3BARA 3BGJA 2H9AA 4AZCA 3CXOA 1LBLA 4B3ZA 3AS0A 3ZIZA 1QW9A 3DZ1A 2IQDA 4WSKA 1JG9A 1XLIA 3Q94A 3FCPA 4PTNA 2Z27A 3H12A 3LUTA 4C6QA 1OZQA 4ACYA 2GJRA 3JZEA 2G50A 1KFKA 3VGEA 1TWWA 2FKPA 4HGXA 3TJ4A 3HO8A 1KRCC 3HPXA 1D7FA 1OFBA 2HMCA 1EJTC 1XDJA 2WMIB 4HZ7A 4Z1AA 4QX4A 3CTTA 3KRSA 4Z2HA 1OF8A 1ECQA 3H2MA 3L2IA 4KQNA 5CC6A 3B9EA 3L4WA 4AB4A 3G22A 2XVPA 3ZJ8A 2GSHA 2HZGA 3BJSA 2W66A 1SJBA 1BXBA 4F0LA 2PDBA 1XYLA 4GUFA 4ZQRA 2QPUA 2D2HA 4UQEA 2FJKA 1X97A 3EDDA 4NAFA 1E71M 3UCQA 3DI1A 2PPGA 3BSHA 3HFTA 5G1TA 4LVFA 3D46A 1C91A 4LQ1A 2WQDA 2P53A 2J62A 3AXHA 5GQBA 5CZJA 2PDKA 2ZVRA 4V15A 2NQZA 4L4PA 1JPIA 4LXFA 1XBVA 2PDLA 1R0MA 1P1XA 1BGGA 1BQCA 3S5NA 5DRCA 3DFPA 4V27A 4OGZA 3M07A 2VGBA 5BOFA 3GH7A 2A6LA 3MCMA 4NQ1A 4AEOA 2DSZA 5AB3A 1XFCA 3UT0A 1UH4A 1UOZA 3PB0A 2YL9A 4JTUA 5AYBA 3R13A 4R33A 3F4VA 1XLHA 4IPLA 2FZMA 4J40A 1TB3A 3VCNA 5EGRA 4LYKA 1VFMA 3LBMA 5CPSA 4DJDA 1DXFA 4LCSA 3K8LA 5I3IA 3OW1A 3TQVA 4TTUA 1X8CA 2E5DA 4C65A 5A6AA 4RDVA 4PMYA 5F1UA 4FNQA 3PZVA 3ZVHA 5A2CA 3OB8A 1GWJA 3KHJA 1UQYA 1JCNA 2VC6A 4TTGA 3WJWA 2CZDA 5LSMA 1UKTA 1EJSC 2WPBA 3UJSA 1ITUA 3EKGA 1TV8A 4DPQA 4AY8A 1D8WA 5TBOA 4JTTA 4IMCA 4HTBA 3PBVA 4Q33A 3R89A 3CK5A 4ZQPA 4UIOA 2NVCA 2VGIA 5F4WA 4FLRA 1D8CA 1E5NA 1XUZA 2Y1HA 3GW3A 1KGXA 2HTMA 3VDGA 1OABA 4NZCA 3RPMA 3STEA 4MJMA 1J9YA 1XYBA 4CD7A 1P0KA 3EPOA 2INEA 1SM9A 3GG1A 2G0WA 4YHGA 1H1NA 1TA3A 4B9YA 3H70A 3CWOX 4F3HA 2V69A 1VBGA 3PG8A 1PCKA 2OKTA 4HU0A 2YIHA 4R5EA 2FHCA 3OA5A 1UR4A 1TTQA 2EBNA 1KXHA 1F2JA 2PFHA 4WGHA 4QG9A 2YDSA 4YWIA 4XISA 3T2PA 3TX9A 4W85A 3PTQA 1XINA 3B0PA 3W84A 4YCOA 4LH8A 5DANA 2YXGA 1Y0EA 2WJEA 1OC5A 1SJCA 3KL5A 4W93A 3EWDA 3OLIA 3CHFA 5JIPA 5T8GA 2EXOA 3MUY1 4JIQA 2I7GA 1BWLA 5G1MA 3PZ9A 3KOFA 1RZMA 4JIHA 1TV5A 1H41A 2ISDA 3REQB 1TUFA 3SIZA 3E2QA 3VNYA 1PPIA 2YCEA 1S2TA 3SECA 1ISWA 3H8AA 4GKLA 3GXDA 4D8ZA 4F79A 1XISA 1RUSA 3E3HA 4ZOEA 3FYOA 3CT2A 2PAJA 1KKOA 2J7DA 5PTDA 2BX7A 1JYWA 1B3XA 1MO0A 5DELA 3W70A 4JYEA 1LROA 3DBPA 2ZVIA 2PS2A 1Q6GA 4ZQCA 1G4SA 3TWBA 3B8DA