1HGYA

Cel6a d221a mutant
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
363
structure length
363
Chain Sequence
b'TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPASLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
publication title The Active Site of Cellobiohydrolase Cel6A from Trichoderma Reesei: The Roles of Aspartic Acids D221 and D175
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase (o-glycosyl)
total genus 134
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1hgyA00
2BVWA 2BOFX 4AX6A 1HGYA 1BVWA 3A9BA 2BODX 1OCJA 1QJWA 4AU0A 1QK2A 3VOFA 1DYSA 3ABXA 3VOGA 1OCBA 3A64A 1OC7A 1UOZA 4AVNA 2BOGX 2BOEX 1CB2A 3VOJA 1UP0A 1UP3A 4B4HA 4I5RA 4AVOA 1OC5A 1OC6A 4A05A 3RPTA 4AX7A 1TMLA 1GZ1A 4B4FA 4I5UA 3RU8X 1QK0A 3VOHA 1HGWA 1OCNA 1UP2A 3VOIA
chains in the Genus database with same CATH superfamily
4FNQA 2ZVIA 1YW1A 3MSGA 4GWEA 2E3ZA 4AMAA 1TTJA 2YKKA 4E5TA 5D9NA 3ZWSA 3QSTA 5DXXA 1W1A1 1EX1A 2TYSA 4IFOA 2NT1A 4AD1A 1TR9A 1XPYA 5CQ1A 5HJXA 3NDZA 1GVSA 3POHA 5EKYA 3UW6A 1M5WA 2P50A 1GOXA 2J7DA 5FI8A 1OYAA 1Q6OA 2PD9A 5IBXA 1CNVA 2QMJA 3QGVA 1JCNA 2PDYA 4ZE4A 1RLDA 5JBFA 4Y9MA 3ZT5A 4JZ5A 3M0XA 2PU0A 1XH1A 2DP3A 3F4WA 2CESA 3K13A 1BD0A 5G4HC 5EMMA 3H7UA 1G4SA 4AWUA 1E4NA 2NQJA 3AI0A 3P8IA 3MA8A 4GH3A 1NF0A 5PTDA 1E3XA 2BSLA 1JYVA 1TTQA 1CEOA 3LPFA 2HXUA 3VOIA 4RV3A 1Q8AA 4MAZA 1UD3A 3I68A 1C8XA 4HIBA 3VGGA 4N4PA 4O13A 2XH7A 4S38A 1LJYA 1G5AA 9XIAA 1J0HA 1OADA 1R7AA 3HGRA 3MANA 1EHAA 3MO7A 3NQ6A 5B7ZA 4H04A 3LBMA 4Q4QA 2Z4GA 3FA4A 4LYKA 4QSHA 1BYBA 4H9TA 3LTPA 3PPGA 4JEJA 3NQ7A 3W74A 1J12A 5HWJA 3WEZA 4U3CA 2WMIB 3W3OA 4LALA 5C9RA 2OLHA 2EKCA 4PTNA 1K8XA 3W7MA 1VFSA 1ISWA 3JZEA 1KFJA 1IF2A 2Y0FA 5HWMA 3W38A 3LRLA 2QCDB 4XAGA 3L12A 1GG0A 3RR1A 3KL3A 9CGTA 2CETA 1CTNA 2X8RA 2HVNA 3U6WA 3EBVA 2CLEA 2VR5A 4MDPA 2PDPA 2ATSA 4RDZA 3QKEA 1E43A 2IQDA 2XIJA 3WZ0E 3MWAA 1XYCA 5G1YA 1Y8BA 2WNNA 3IUHA 1XFBA 3N6QA 1ZAJA 3PVFA 4OTKA 4NASA 4NQ1A 4GMEA 3W6MA 1J0KA 3URNA 4C6QA 2ZKMX 2FZMA 3G77A 4IPPA 1VAHA 4UQBA 1P4CA 3SCUA 1SZGA 5DFAA 1JCYA 4IUGA 3BURA 1XICA 4AZHA 3WF4A 1CGWA 1E6RA 4Z2HA 4I5RA 1QBAA 1W5MA 3CJPA 3O0FA 5MKGA 1W5QA 3W07A 1NP0A 3SO7A 7TIMA 3USZA 1NY1A 3S2NA 4X0VA 4LY4A 3O63A 3GBEA 4DJDD 2PF0A 1XF0A 2J75A 3VC6A 5C9WA 1IXNA 5AHFA 3STFA 2ALRA 3A4JA 3P7YA 1F3WA 5AYXA 1IEXA 3SR7A 1K9DA 2J7EA 1I1WA 4O1DA 1HKWA 4EX4A 4GNKB 3UZ5A 2HS6A 1U1UA 5A6MA 3TEVA 1JFXA 4FALA 4JTGA 3LV5A 3B8WA 4ZOBA 4TXEA 4WY0F 3KLLA 1M68A 4ES4A 3AS1A 4HA4A 4F8XA 1G0CA 1R5YA 1K9TA 3H7RA 3GO2A 2Z1KA 3EX6A 2NX3A 3ERPA 2ZRUA 1K7FA 2R1KA 1H4PA 1MQPA 1UA3A 3UERA 4GZJA 2HSAA 3DFNA 2ABAA 5LNVA 3NQBA 3SCQA 3E5PA 1CT5A 1UOZA 1SJAA 3OTRA 2WWCA 4PB5A 3TC3A 3C56A 4HU8A 1UP0A 2YYTA 3CB8A 3MQTA 4IQJA 3OZOA 4TVCA 4UCFA 3H12A 2V30A 3IARA 4S23A 2E9LA 4UFJA 2PCEA 4PZVA 1EC9A 1O7AA 1H49A 4YCPA 5BXPA 4DXKA 1US2A 4D1JA 4RL3A 2BVTA 3BG3A 1JZ3A 4KPLA 1BXCA 2O9PA 1AFSA 3N4AA 1BXNA 4FAMA 4M82A 3S1UA 3BOFA 3S2LA 5I24A 5LSMA 2VVNA 3L7RA 5DEZA 3A24A 3MSRA 3ZM8A 1WOBA 5EMJA 3EZ4A 1TWSA 3UJRA 3RLUA 3DDMA 3SCPA 2ZUUA 1V6TA 4ZXLA 3DU0A 3OG3A 1GHSA 3OZPA 3HGOA 2YYUA 3CIWA 4WDXA 4WXZA 4UUIA 3QXBA 5CPSA 2ZRVA 1MEHA 1XISA 4H6RA 4W5ZA 3VU2A 1ELSA 2G3IA 3BXWA 4Z2LA 1UWAA 2PFHA 1OY0A 1IEQA 3EKGA 1KGXA 2EEXA 1VYSX 2VHLA 5F7UA 1UMLA 1ODUA 2IPJA 4X63A 2VELA 2CWNA 1NFPA 3NQVA 3CUZA 4L9ZA 1BVZA 4M81A 3KRBA 3EB2A 4S3KA 2RDXA 3FJLA 1RJPA 1T99A 4NZ5A 5CSSA 4NZCA 2VZTA 3PBVA 3BLIA 2BHYA 5TIMA 1QCWA 5DBTA 2VFDA 1QO2A 4P7LA 3GC4A 3TYZA 2V2CA 1F4HA 4MJZA 2UY3A 4AF0A 2YGYA 3SRKA 4GYFA 2J7CA 3C2EA 2Y88A 4IMGA 5BRPA 3SADA 2DT0A 4BF9A 2E8YA 3GHRA 1W0MA 1EJVC 2G0WA 3H26A 3T05A 2HVOA 3TYEA 4JTKA 5D2WA 1YNQA 4M56A 3TW7A 3M0ZA 2WHJA 3OBAA 1FY6A 4XD4A 4YWSA 2VT0A 3NJ3A 2I5IA 1US0A 2Y8UA 5HR6A 3QLLA 5M3WA 1VPXA 3CQJA 2PWUA 4QTGA 1P5BA 2DZUA 3G2GA 1H0IA 4RZ5A 2WHKA 1RHCA 1E4IA 5MKGB 2HNEA 2C91A 4UCGA 2VZSA 3WMCA 4ZQNA 5DCEA 1RP8A 2ZA3A 3G18A 3BO9A 5J04A 3EX1A 5BYWA 1ZRQA 1QI3A 2RDWA 4NZ4A 6TAAA 4LJ3A 1TREA 4AIUA 4J5NA 3P61A 3TCEA 4MB1A 4U5IA 1A5OC 1UCWA 1E0TA 1NJJA 4HK7A 3V16A 1GQNA 1PV8A 2AOSA 3LSCA 2PPGA 3N14A 3A4WA 4P2VA 3IVUA 4KESA 4QQUA 2VD9A 3BSMA 4F9DA 5TBOA 3CLMA 1BKSA 1XLKA 3CZEA 1EF3A 3LHVA 2J7HA 4U3AA 1JDAA 1PEZA 6XIAA 1F76A 5K7JA 1NIUA 1XP3A 2WSQA 4HMEA 4MVAA 2PE4A 1V3IA 4M24A 4LTSA 4MMWA 1SZNA 2CKSA 3IAQA 1W5OA 2DW6A 1ZJHA 4CN4A 5C71A 1W2VA 3LENA 2Q71A 3WCZA 2QZRA 1I2QA 3GZAA 1HVXA 3TR9A 2TRSA 4QHRA 1KFWA 3MVTA 2AQOA 1TPC1 2XN0A 2Y7DA 3N34A 4GG9A 2DH2A 2PUZA 4G8TA 5K4XA 3BMWA 3N11A 2NVCA 1NDYA 1UWUA 4ENLA 2JF7A 2V2HA 5FF2A 1CGYA 3MYOA 4S3DA 6ENLA 2E5BA 4ZB5A 1KV8A 3VK5A 1XCXA 1H50A 1OFOA 4ASTA 4Q4PA 2D2JA 1I2RA 4HPHA 3SI9A 1MZRA 1AW2A 3GE7A 3HBLA 3MMTA 3CO8A 4LH8A 4BY3A 1UWTA 3PR2A 1MEWA 5BW6A 1XFCA 4QBXA 3VZYA 3TH6A 1EBHA 4PSRA 3SFKA 8XIAA 1HXJA 3WFLA 4AEFA 2YCLA 5LNRA 4PMVA 1H62A 1R38A 3LG3A 2VOTA 3G1AA 1K6WA 4U4MA 2OKTA 3OGSA 2V3FA 3FIGA 3TR2A 3HPAA 3A5FA 2CZ5A 3W23A 3UNDA 1XIBA 4ZO9A 5KZMA 3CUJA 5XIMA 2GDUA 1OZQA 4C90A 2C0AA 4HMDA 3ZIZA 1L6YA 1ZBVA 1OWQA 4IT1A 4IX2A 2VEKA 4RNJA 2G3FA 2QCEA 4HCLA 2DZTA 3N4FA 4M6VA 3B97A 1LLOA 1MZHA 1VBUA 1V3JA 2I5GA 3MHFA 3EXRA 5I3JA 1EJ7L 1V77A 4D6FA 4PUJA 1XCWA 3NNTA 3WNOA 1XYMA 3WQOA 1DE6A 3BAWA 4HCDA 1W1PA 3VA8A 1KO0A 2IKGA 3H7VA 4AF0B 4GY7A 2GSJA 3R8RA 4TVDA 3RLGA 1VFFA 5FJIA 2NV9A 3WQVA 1AL8A 5IOBA 3LTYA 3KBVA 1JVNA 5C9ZA 1E6PA 3HG3A 1EXPA 2P1FA 3W1PA 3O1NA 4FS9A 4MY9A 4Y7EA 4Q8MA 4JIRA 2ZZ1A 4MWAA 3GR7A 3EOOA 3DI1A 3QW3A 1CYGA 3W2NA 4UTIA 3IV8A 4DEFA 2WOQA 3E74A 2Q8LA 1ESWA 3GB6A 2PGFA 4OVXA 4ZOAA 1TV8A 1LROA 2I14A 2V82A 3RN6A 1M7PA 2XWEA 4EK7A 5K3VA 1E56A 1LWJA 5E9AA 4W86A 2XFYA 5I07A 1C90A 4IP7A 3WLQA 4Q8VA 4L4MA 2PA6A 1WX0A 2X0HA 2WZIA 5GNYA 2PDIA 1JPDX 3AS0A 3LNPA 1Q8JA 2QVNA 3S6DA 3UVIA 1CXKA 2BOFX 1CLVA 4DWSD 2DIJA 1X6LA 2ZX9A 1DORA 2J6XA 1MDRA 5EB8A 1OIFA 5CKSA 4HSHA 5A6TC 1JPMA 3KEHA 1FFQA 3N3TA 2VM8A 3UJ2A 2ZVRA 5HMEA 4URIA 2C79A 1XW8A 3ABSA 4AHOA 3W1AA 1H2JA 1Q6FA 2QCHA 2CZVA 3RHGA 2A5HA 1JPHA 3ECQA 1YE4A 1AUSL 3LCXA 1UD4A 4DM1A 3NQ2A 4QP0A 3VCRA 4B4HA 2G4FA 1TWDA 3I7QA 2DSWA 3NZPA 4BQ5A 3ALFA 1Z44A 2FZNA 4HK5A 3V18A 4ZB0A 1WKFA 3PZGA 1YXDA 2FGZA 3E5BA 2ZC1A 4G56A 3R0KA 2PD5A 4H6QA 4AH7A 4G1KA 1AH4A 5JMUA 3NYDA 3E0WA 3KM8A 2PDQA 3QMTA 1KM4A 2QCLA 3QYQA 3SUSA 4P8XA 3B8TA 3DEQA 5H8MA 4MFDA 4HTBA 3GUGA 4OHQA 2Y7FA 1BLIA 1S5NA 1VCGA 4GUHA 3KTXA 1J01A 3A3XA 1UJQA 4JTFA 2NXGA 3FDKA 2PLJA 1JDEA 3VZXA 3COTA 1NFBA 2YCLB 3NDOA 2B0MA 5HATA 4JTJA 3IRSA 3KBNA 3GFZA 3ARYA 5E1QA 4DVOA 4L56A 4L4LA 4C6LA 2HPMA 3T0CA 4NF7A 4E6MA 3TN5A 3M5ZA 1ALDA 3CL8A 1VFUA 3WNMA 1UR2A 3EXSA 4MLJA 3UY7A 3UXKA 2I16A 2VC9A 2A6NA 4LEFA 4WIWA 1VYPX 1V7AA 3WQ8A 3E0LA 1FWDC 4BKNA 3TYAA 4KEVA 3TTSA 1XBXA 3WQDA 1T7LA 4DJFA 4O18A 1GKQA 3M43A 3GIQA 5D05A 2QF7A 4WDUA 1JUEA 3MKVA 3L0GA 2F9RA 2BVYA 1TB3A 1OG6A 1QBBA 3A6OA 4OBSA 1E4LA 1XLFA 1EDTA 3UFYA 3WH7A 4B92A 3NTYA 1JG9A 5TAOA 1GOMA 1A5AA 3ITXA 2VR2A 2PWHA 1RY8A 1FWGC 3C52A 3WD1A 4JIQA 4H8UA 2FMNA 3P82A 3O7UA 3PZMA 4EVZA 2OWXA 3WF1A 4P7QA 3GDBA 4LUIA 5J5RA 2QCNA 1VRDA 4QEHA 3STGA 1O6IA 1PB0A 3KTSA 2PB1A 4YTTA 1LT8A 3TZFA 2QJJA 1X39A 2YFNA 3E0FA 3RX3A 1G69A 1PCWA 5CZSA 1Z48A 3NQMA 1ZBWA 1RZMA 3TV8A 4RE4A 1EFZA 3F03K 4CCDA 1XLIA 3E12A 5A69A 4JTEA 2GQ8A 4O0QA 3SJ3A 3WLTA 3NVTA 3T9PA 2IMRA 5H2ZA 3S5SA 4B2DD 1L8NA 1E51A 3EOLA 4IGMA 1FWIC 3WD0A 1UKQA 3LZ5A 4M6PA 3DC8A 3B0VC 4DY1A 2I5QA 3T0AA 4CU7A 2D0GA 1CXEA 4X22A 5I78A 3A13A 3SURA 1J96A 3W24A 1TJ1A 5BOFA 4EXQA 4PFHA 3AICA 3MP3A 4LCSA 1W1ZA 6ALDA 1PWLA 4ZFMA 2YL6A 1JYNA 2VEPA 4RZ4A 1M41A 2J9XA 2V67A 1RR2A 2AL1A 4EPBC 1E4MM 1KLZA 3LN3A 2Y8KA 1KM3A 1XLEA 4DB7A 3ABOA 5DCBA 3EKLA 4WKFA 1IEVA 4ONVA 1XLHA 4BJHA 4OZOA 4AYSA 4D6CA 1W5PA 4OGZA 3AUJA 4GGBA 4WSHA 3RPMA 1HG3A 1QNVA 4NZ1A 3HF3A 1L8PA 2J47A 1VYRA 1OFAA 2A3HA 2AAAA 1DTUA 1V6WA 3CEUA 4NJJA 3BLFA 2KAUC 3NO3A 3NZQA 3BZJA 5D2TA 4I7VA 3BH4A 3IUIA 4ZEPA 3GX9A 4H9XA 1OYBA 2ACQA 3VX0A 4ZBCA 3A4XA 4UXDA 2ANUA 4PTMA 4JFWA 3BL3A 4QDWA 2F61A 1DBTA 4J35A 2NUYA 2DIEA 4P7NA 3W00A 2FKPA 4JX6A 4XO7A 2YL5A 5A95A 1SMDA 1AQHA 1B2YA 4PTXA 2WAGA 3RLHA 3UR2A 2PRHA 4DPQA 4AD3A 3N9RA 2OQLA 7PTDA 1IWBA 2B4GA 3C2YA 3QTGA 3LUTA 2GK1A 3ABZA 4G2DA 1M9HA 2YB4A 1Q63A 2Y62A 1A5UA 4NIRA 3U2CA 2ISWA 5FEWA 4JHZA 1O1ZA 4DXXA 3K4AA 1I6NA 4KGJA 1TR1A 1WP6A 1HT6A 4RK8A 1FH9A 4JGDA 1OFRA 1H11A 3ZT7A 4BI7A 2OB3A 3T0DA 3V5FA 3P5ZA 1AH3A 2FB3A 1MRAA 3VD4A 5DXYA 5A6LA 5KETA 1AD1A 3AISA 2ZRWA 2Y24A 1S5TA 3TOPA 1GEQA 2EGZA 4KWSA 3AJ7A 3M0LA 3M5VA 5I3DA 4AVNA 3CUIA 2OCZA 4D2JA 3R79A 4LAKA 1A5SA 3B9NA 4L6HA 1FDYA 3TCSA 3K5XA 2PBGA 2PDKA 2GUYA 4KWUA 3IJ7A 2YPIA 3NL5A 3W76A 2BV9A 3NDYA 2H9AA 2PWVA 1A5KC 3PZVA 3A47A 4S3CA 4S2BA 1PTDA 1A50A 4S3AA 1O60A 1OSEA 1KBJA 2VZOA 1MXDA 4A8NA 1OFPA 1XIIA 3B3DA 3DUGA 1OVDA 2G5WA 4LFYA 3VNLA 1JZ4A 2NV2A 2X0SA 4Q7BA 3TYDA 3HPZA 3S6OA 1UUQA 1S2WA 1IYXA 4CLMA 1DXEA 4DPPA 2C6QA 3ZVIA 2DVUA 1B3OA 2AKZA 4CVUA 4US5A 3UPWA 4HNTA 4LF2A 4E3TA 3UD6A 4DZIA 3FK4A 1XIHA 1XLGA 4GXWA 1J0IA 2QQ6A 1BQGA 3EKZA 4XZNX 4A21A 1W9DM 2AGKA 3W2MA 4QM1A 5FKYA 1Z42A 4KKXA 4PGLA 1ENUA 4N4QA 5A6KA 4ERIA 3DFHA 1FHVA 3HOJA 2HCVA 3S1VA 3DXIA 5LNUA 3HO8A 5BMXA 3PBMA 1T5AA 1CCWB 1KFBA 3BG9A 2OSXA 3WLIA 4EKJA 3RJYA 1XLDA 4KW2A 1QNSA 3B04A 4NILA 4L9XA 3E49A 1LQ2A 5CZKA 2E4TA 2J7BA 4UQEA 4HPGA 4L6OA 4Q33A 5DO8A 3VNZA 5AKQA 2C1GA 3RO6A 2C19A 2WW5A 5AVHA 2VXNA 3WELA 2YA1A 1VC4A 1W56A 3PZOA 3HQOA 4GJ1A 1UD8A 4E3VA 4AC1X 2DQXA 3KDOA 3IJ9A 4LWWA 4KWOA 3NZ1A 3JR2A 3MKCA 5JU6A 5LYRA 2X1SA 1BTMA 1HJVA 3ONCA 4I5UA 1RV8A 4CN1A 2AMXA 2OMAA 4K39A 4U2YA 3WMSA 5ABGA 4IQDA 4GIRA 2HPIA 5CJMA 4AIBA 1QK2A 1HL2A 1WBHA 1KR1A 3JRKA 5AB3A 1BPLB 4OWGA 1NELA 3GRIA 1D8WA 2NX9A 3NL3A 3T6CA 3EWYA 3IACA 3QZAA 3M07A 1C8VA 3VDBA 4XZMX 1PKLA 2B81A 3KVKA 2AMGA 5GVJA 1AL7A 1JQVA 4GBDA 4GI6A 1GK8A 4K1GA 1O4UA 4PEKA 3DIPA 3JU2A 4MB4A 4WJ8A 3BAIA 4AG0A 4IICA 4AQLA 4H2CA 4HOZA 3N2OA 1H60A 4WGXA 4C6IA 3U7BA 4MGGA 3D3AA 3CO4A 4DNMA 4ROQA 3WUEA 3S83A 1V6VA 4TX6A 3HQ1A 3HV8A 2GK1B 3NPVA 1LOLA 1QAPA 3CHFA 3PG9A 2WZEA 3R5EA 4RXGA 2FJKA 4TVUA 1V6XA 1F3EA 2WV8A 4LW7A 1ZCCA 4JFVA 1C8QA 2ZX5A 1LM1A 3ID7A 3DHDA 3GC2A 1NWUA 4I3GA 2E77A 1B3YA 2E1DA 2QCFA 3A21A 2PTWA 2CITA 4H9VA 3H4WA 1AH0A 4HNNA 3WBWA 1QDSA 3FN9A 5CAHA 1WZAA 2OFJA 3PAJA 3UXDA 1R9XA 2WC7A 2QIIA 2VL4A 2X42A 1GJWA 1LBMA 1KFLA 2XWDA 3FSTA 3J7HA 3UR7A 3UYCA 5CPNA 1K7EA 4CU8A 2H9AB 2C3ZA 3MWCA 3L4ZA 1XSKA 3BZGA 4B9YA 3TE9A 4CCCA 1I45A 2E5DA 2QUMA 3T55A 5DMNA 4TTUA 5FSDC 1UKSA 4HOWA 2CLHA 1NU5A 1DHKA 4PUEA 1HGYA 2DUAA 2IUZA 4H8NA 3CMJA 1UOKA 3UXLA 4H00A 3PM6A 4UFKA 3OVRA 2QLYA 3FSUA 2Z1SA 5BWFA 1BWVA 1TMLA 4GYKA 4LUSA 1ZAIA 4IQEA 1RSCA 1YXYA 1FKWA 3CIVA 2XVGA 1VD6A 4HMNA 4LU0A 3REQA 4Y9PA 2J4GA 5BCAA 4O8AA 1M7OA 3NQAA 5TD4A 5C2CA 3AMGA 1XLAA 1IZKA 4HMCA 1J10A 4Q6XA 2ZDSA 3SIZA 2E68A 3QV9A 4JTCA 4MJ4A 5C5YA 3BPWA 4KETA 3OIHA 4NG3A 1YQ2A 5EMYA 4RDYA 4J3ZA 1KQZA 3QQWA 4YTQA 3MYPA 2ZDRA 4HT3A 1YMYA 1EYEA 4EAYA 2Z1VA 4UIOA 1C7SA 4PTWA 3HZ3A 2QNEA 4HYRA 5EGRA 3LI1A 4AXNA 3GH5A 5C55A 4ZODA 1X1NA 4FX7A 2DZVA 4UR7A 1Q66A 1SM9A 4C1NA 1JJKA 1NOUA 1GOIA 1DJHA 4HPJA 4DYEA 2X1IA 5HJYA 5CCZA 1L2UA 1DQUA 3A64A 5FCZA 2Q6ZA 1I2NA 5DRCA 4FOKA 3MMDA 2O56A 4NZFA 1OGGA 2Z28A 4Q4RA 3LRKA 2HTMA 3P8JA 1XYBA 3CXOA 3LDVA 4NY2A 3RFAA 5JBEA 1WZLA 2GLKA 4PUMA 4UB9A 4UTKA 8XIMA 4KBXA 2XISA 3A3WA 3EDKA 3GDLA 3PP7A 8RUCA 1UR9A 2EJ1A 1DKWA 3CLWA 2BNJA 4HSNA 4D71A 4E4PA 5U7SA 3LLDA 4MFEA 4JN8A 1VLWA 5BMWA 4FI4A 4QG6A 2NQHA 1W9PA 3VVGA 1QPKA 1SJDA 2BODX 3TN4A 4OBTA 3W7KA 1CXFA 4RNHA 3DFPA 4R5EA 2YCIX 1NDWA 3EPNA 3TTOA 4IFRA 1A3WA 3POCA 3HA1A 4KRZA 3H2MA 2C1HA 2ZX7A 2DUXA 3CB3A 2OZ3A 3S1WA 4XAYA 3B9OA 4TTGA 2Z1XA 2BVDA 3P14A 4E2DA 1B1YA 3G1VA 3CPGA 1T41A 3Q58A 2KZHA 2ONEA 1PX8A 3TIMA 3P62A 4RDWA 5LNWA 4IXHA 1AW5A 1Q4NX 3CWHA 1H51A 2WKGA 4IGHA 2YZ5A 4L9YA 4JYFA 2D3LA 3ARVA 1OJXA 2PDWA 4QS5A 5E93A 1SQ7A 3UWWA 4FOJA 1I2OA 1VBJA 4JIEA 3KS5A 1WBJA 3SM0A 3W86A 3GG8A 3MSYA 3NG3A 1C93A 1E72M 1EKOA 1MRQA 4FO4A 1RALA 4QNWA 3AHTA 3THUA 3WBXA 4EXBA 3B8VA 1AW1A 3OVPA 3C2RA 2O9RA 3C0QA 4L61A 3MT1A 1NOWA 1KCKA 3STEA 4ZENA 3VKAA 1QJWA 3RM8A 2G95A 2VOMA 3OP2A 1QNOA 4QE4A 3Q94A 2GL5A 2WMHA 3V5OA 1UB3A 4BS0A 4K37A 3MJMA 1HL8A 5T9BG 3WN6A 2UBPC 2PDBA 2PU1A 4G9PA 3UWVA 4FEZA 3OZMA 1X7IA 4DJED 4IH3A 4R3UA 4GH1A 2YCJA 3WJWA 3ZS4A 4P8VA 4UTWC 2INEA 2GVEA 3LQLA 5LXXA 1XRVA 2J24A 1K4HA 3THAA 1N8FA 4FR6A 4KEMA 1ADOA 4IIHA 3PB2A 4E8CA 1H41A 4WZHA 3IS4A 4CNOA 2YXOA 4AZIA 2Q3RA 4LUSB 2J8TA 5I3IA 3B8DA 2YR1A 4EF9A 1HVQA 2QHAA 2Z25A 4LX4A 3ONBA 1J0YA 1R86A 2PODA 3N19B 3REQB 1UYQA 1EC7A 3BW4A 3VMOA 2Q8XA 1H61A 4H6EA 4C1KA 3OEXA 1EO7A 3KFTA 1L6FA 1W32A 3HFYA 1QPRA 3BUVA 4M3PA 1E5JA 1CXLA 2YLLA 4HJWA 1S2AA 1EL3A 1PSCA 2E7FA 5D4YA 4E8GA 1JL8A 3G3DA 2RUSA 4DAFA 1FHLA 4QJ3B 1G94A 4IPJA 3NGFA 4GCXA 3R8HA 2WSRA 3TLQA 2GZXA 4W9TA 1HTIA 2PSNA 4Q8WA 2J88A 2JKAA 3U4FA 2CC0A 1G9HA 3TWBA 3QC3A 1A80A 4H9YA 4KRTA 1OINA 1JUKA 3CMFA 1YNYA 1JDFA 4PCFA 3MTWA 3RLVA 1W9UA 2O7QA 3RK8A 4RXFA 3ISIX 2HV5A 1U83A 1XV8A 2O9OA 1FWWA 1CXIA 3HJEA 1F7BA 2GWNA 3W70A 2OXNA 4XD3A 1US3A 5M2FX 1F61A 4LQ1A 5A8OA 1ZTVA 1ZALA 3L5AA 2D73A 1B9ZA 2VX5A 4DJDA 4C1NB 5TNVA 2BZNA 3AXMA 1QNRA 1QTWA 3G3MA 2CXGA 1H7NA 2E8ZA 2VQUA 4J3WA 4GIYA 3YPIA 3CHVA 1CZ1A 3GSMA 4JDYA 3WNLA 3GUWA 4MLRA 2PP0A 1C7TA 3PTQA 3ARQA 2RAGA 3HPXA 1AQ0A 3TXVA 3LYEA 1C9WA 2D2OA 3MV01 5DBUA 4JNMA 3CAVA 1ECEA 3PWIA 5F4WA 1WZMA 1VBRA 4MG4A 3USBA 4P8UA 4B3KA 3E96A 1TSIA 2CWXA 3QY6A 3QQ0A 1W3NA 2C8NA 4KEZA 2FFIA 1RH9A 1QHZA 3BARA 5FL1A 1YDOA 2FZ8A 4HSOA 3MHUA 5FSEC 1R3TA 5AN7A 3JW7A 5EA9A 3ENLA 3KWSA 2J13A 4WJEA 2IPWA 1EBGA 3RMEA 4H6KA 2V5CA 1W3TA 3LM3A 3GQYA 4HA3A 3OPSA 2BGQA 2BVWA 3GXPA 3AXIA 3DG6A 4R7WA 2ZOXA 3W1RA 1SO6A 4BA0A 4MY8A 4Q8NA 4Z0JA 3VNIA 5FF3A 4N42A 3S5YA 3MKKA 3O0KA 4JS3A 3C0LA 1C92A 3EWUA 3R94A 4KFPA 3EMZA 4NT0A 1UR8A 3ZR6A 3LCHA 3MHGA 4QAIA 3OW1A 2RKXA 1NWTA 4M29A 4MADA 2O4MA 2XIIA 1P6BA 5KZDA 2Y5EA 1UWQA 2E6DA 3I7SA 1KTBA 5CGTA 3GWQA 4IJBA 1TIMA 2A0NA 1LRNA 3VKCA 4D6GA 4RX0A 4RZBA 3L0KA 5LIYX 5SWUA 3DX5A 3SRDA 1HJXA 3ALGA 3GU2A 3VKKA 3GDTA 4W7VA 3L21A 2R1MA 4GNJA 4JYEA 1OCQA 2PZNA 1OD8A 4BFAA 4AY8A 2PGWA 4AWTA 3P81A 1YADA 1OM0A 4KMQA 2ZZ6A 3BAYA 1HO1A 4KEUA 1LL4A 1KTNA 3U4AA 2Z6IA 2MNRA 4K8HA 4PH6A 1S2TA 2CLKA 5AZ0A 3GKAA 3GK0A 4PMQA 3UA4A 1UZDA 2CU0A 4W4QA 3W7JA 2PRLA 3BLLA 4A3HA 3G0XA 1EGVA 3CZ8A 1FWAC 2OEKA 4P8WA 4NHVA 1MI3A 1W1VA 2WZTA 1AMYA 1BYCA 2YW3A 3KL5A 1KLYA 1H7PA 3K30A 3QZ6A 2WHMA 1A4MA 3E2VA 1NAL1 3GDMA 3BQ5A 4DYKA 2R91A 1KD0A 1JULA 1CPUA 4TIMA 1SZEA 5CXPA 1EB3A 1Z8AA 1HUVA 1QRQA 1E0XA 3BQ6A 1Z89A 1RK6A 3KL0A 1JRBA 1OFDA 4Q8UA 4GXPA 4JTLA 3GXMA 5CSYA 4LAOA 1FWEC 3I3DA 4JN6A 3B40A 2QXWA 4FP1A 4L6DA 3GH7A 2WCSA 4KFNA 4PL2A 1YNPA 1S5WA 4W7UA 4YHEA 1KM5A 5EBAA 3BAXA 1XSJA 2NLIA 3XIMA 5F4XA 4Y96A 2QCCA 2ODOA 2OSYA 2NQ5A 2E67A 1S38A 3O9NA 1EJRC 1VR6A 1TMHA 1E1EA 5KINA 1I8JA 3VOJA 4MKSA 4JN7A 1ISVA 1XG4A 1CBGA 4F2UA 2ZUVA 2GQ9A 3I65A 3VNYA 1TIWA 2AQWA 4EOUA 2QW5A 2OTDA 2UZ9A 1PXGA 3ARTA 4MF4A 4IWWA 1YDYA 4O28A 2FPYA 3S2JA 1QPOA 3LX9A 2E9BA 3RXZA 5HUOA 3C0SA 2EHHA 3UG5A 1S39A 2F6KA 4GRSA 4NI3A 3GY1A 1VF8A 1P7TA 3L2IA 3TMQA 1ZP3A 5KITA 1SFLA 2DUZA 3IEBA 3RX4A 4IIGA 2A7RA 4OE7A 1IQ8A 3R2GA 3WG6A 4FMVA 2YSWA 3B0PA 2QGHA 2Z2BA 3WH5A 3UR5A 3C4UA 4PFMA 1U1HA 2WK2A 3H2CA 3AZSA 1MSSA 3D0CA 4ICMA 2CBIA 3CUFA 4PCNA 5H1WA 1PS9A 3WO8A 4NJIA 5DLCA 1DPMA 1GUVA 3JZUA 1WA3A 3H2NA 3GXNA 2V81A 2PURA 4LVGA 3LQGA 3U57A 1XM3A 5IFTA 1YPFA 3U8GA 1REQA 1XQKA 5DELA 4XD6A 3GAYA 5JIWA 3U2ZA 3H2OA 1TV4A 2QJNA 4M7SA 2TAAA 2RJGA 3B03A 5LHFA 3FVDA 3N6HA 3QMRA 1OFBA 3SN0A 1WUEA 3AYTA 4GI4A 1D3GA 1FWFC 3KE0A 4GUFA 3T81A 3G1XA 2F6XA 3THCA 2E6FA 3MUCA 4C6EA 2FZDA 4CKQA 3RCNA 2VC5A 3A22A 4Z2KA 4JYDA 4C6CA 2GUUA 3W7CA 4FPSA 4LC8A 4IG2A 2XZ9A 3H24A 5EFFA 1LTDA 3EX2A 3CUHA 4CCEA 1AA1B 2HBXA 5A6BD 1A5LC 1W8SA 3TDFA 5JVLA 2O4QA 1PBGA 3TVAA 4S3GA 4UFHA 4GVIA 2D3NA 7REQA 4RNIA 4RW5A 3VIJA 2I57A 2DORA 3G8RA 2HJPA 4N02A 2ZXBA 3R8GA 2BY2A 5I0DA 5I03A 1R3YA 4WRHA 3TQPA 3LHWA 4WCJA 4G1NA 4X60A 1VJZA 2OQYA 3LCLA 2BXYA 1R85A 2PGRA 4XUGA 2EPOA 3NL2A 2XIMA 2BY1A 3PUGA 1EJUC 2A3AA 4XBSA 3HTWA 4XSMA 5E70A 1HL9A 2WSKA 3EEGA 4H19A 4A22A 1QW9A 2ZA1A 4WVXA 1NDVA 3LRMA 5K9DA 4H8VA 5C7VA 1VCFA 3UG3A 3KW3A 5I2UA 2YB1A 2B7OA 2ZUWA 5C6MA 3T2PA 4CQAA 2V5LA 4OFCA 2A1YA 1ZPTA 3BVJA 3CWOX 4EP8C 3V0TA 1DOSA 6TIMA 3DCPA 1YHTA 5G1MA 3AMKA 3G5EA 3PUOA 4XO6A 2G96A 2VGIA 4BQ4A 3DYMA 3TN3A 4NL1A 3HMJG 1KKOA 3O15A 2G41A 1X1ZA 4NYUA 3O6YX 1HP5A 3TOYA 3LPGA 1O5KA 3LMYA 2RH9A 3NSNA 3TA6A 3W1UA 5DMMA 4BEUA 3M4HA 4MZ8A 4B91A 2OLSA 2R24A 4HNCA 4UTJA 4HPXA 1JR1A 1IT0A 1JCXA 2OO0A 4ICNA 2HROA 1IV8A 4C60A 3VNMA 5EMKA 2E09A 2I7GA 2GVJA 2Q09A 5CH9A 1E9YB 4H7CA 1A5NC 1P7TB 2O9TA 3B4UA 1D9EA 5M1TA 3UZWA 4F0SA 3G0SA 4DWSA 1XIDA 5A8GA 4AMCA 4I5XA 2NQ9A 1PHWA 3EPMA 4GVHA 1QOQA 5A2AA 4DF2A 4ML9A 1O66A 4CEXC 1QXLA 2CLLA 3S47A 2OEJA 2YLAA 1GEHA 2VRQA 3LBOA 3FOKA 4Y9OA 5FJUA 3N04A 2OEMA 4GE8A 4A8LA 4HK6A 2DT2A 3KRSA 1FRBA 4K8GA 1REQB 6XIMA 2DVXA 1PAMA 1XUZA 4N6FA 2OU4A 4DELA 2VWSA 2Y2WA 1LL7A 4O57A 1S2VA 3VKDA 5D8WA 2AGTA 1OC7A 5C0QA 1PDYA 5C7HA 3V0SA 4GZEA 3LA4A 4X61A 3LERA 4CNNA 4GYJA 3CT2A 1XYFA 1UR0A 3H53A 3QEZA 3WK2A 1V3LA 1VRXA 3WD3A 1SMAA 4XZBA 3CL7A 1UWRA 3L23A 2OYLA 1H63A 4XUYA 1TCDA 3WY1A 1TTPA 3BDKA 4ZQOA 4DRSA 4YVPA 4B5SA 2F38A 4IG2B 3LS9A 3WL1A 1NEYA 3L68A 1L6SA 3WLPA 4RNFA 5AC6A 3FNDA 3HGJA 5FACA 3V7PA 3C86A 2B7QA 3ZJKA 3ORWA 2WPGA 5HQEA 4ZQPA 3SJNA 1B5TA 4IPNB 5BXTA 7REQB 4EWND 1FWSA 1RBOB 3MUXA 1Q7ZA 1QW8A 3SIMA 3IIVA 2QUNA 4YMZA 3H23A 4RW3A 2Y7EA 1EWDA 3M9YA 3GR8A 5DF0A 1DJZA 4PL1A 3BW2A 1S46A 4NJGA 1IZCA 3GDKA 4PYSA 2B7NA 4ZOEA 2ZXDA 3RILA 3AIEA 1K4GA 4JIIX 3SCOA 3ITVA 3TROA 3PFRA 2VX7A 3W83A 2FPVA 1UPMB 4N6EA 1TUXA 1W3KA 1X96A 3FEQA 3ZLFA 1JIBA 3CZJA 1L6WA 2ZTJA 3WUFA 3OLEA 4OKDA 1WOAA 3IIXA 3TMLA 3MJYA 1F8IA 3G8EA 4OJYA 2PDCA 4B5NA 2H3BA 4W8AA 1VFMA 1J18A 1EDQA 4L4PA 3LGGA 3M7WA 4GIEA 4X9YA 4HNOA 1R8LA 5D9OA 4CQDA 3JVAA 5GJMA 1XYAA 4RUBA 5DRIA 3VE9A 4LCRA 1C3FA 1V3KA 4Z1DA 2CLFA 2V8ZA 1WKEA 1MXGA 2PDLA 3TZNA 3TYBA 4QR6A 3NQDA 5LXEA 2Z6JA 2ZXAA 3BLKA 5FAGA 4JTIA 1IEIA 3W73A 4LNCA 3L4UA 1UD5A 5CEWA 4NZJA 4YYFA 3CGTA 1GZJA 3BV4A 4ZTYA 4E2OA 1T8QA 2PTDA 3IUDA 1ICQA 3E38A 1V6UA 3S9ZA 1EHNA 3B05A 4F2BA 3I6EA 1QWGA 3VOFA 4QSFA 4PBFA 3DECA 1DP0A 4D72A 4B2DA 4WX2A 4JEQA 3HFTA 4Z1CA 4NSBA 1POJA 2VUNA 3I4EA 7ODCA 1XIJA 3M5XA 3L4YA 1S5VA 1WB0A 4XIMA 3SY8A 3WMBA 3FAXA 2L5HA 3OJGA 3EOSA 3S2CA 1KGUA 3MCMA 1GWJA 2AAMA 1MO0A 5E0CA 3SEPA 2YBUA 4LUTA 3NWRA 2DSKA 1RCXB 3WLLA 3AIVA 3R13A 1JFHA 2Y70A 3ZMRA 4J9JA 4DWSB 2BMBA 3OHMB 3SQLA 3TLLA 3L67A 5IHSA 1R2SA 2W79A 1BG9A 4D9PA 5KZ6A 3STCA 1RD6A 4B9ZA 3FAWA 1TWZA 2I9UA 3PZ9A 3GAKA 4PUNA 3U9IA 4LB4A 3UBPC 2FPTA 4CVWA 4HB7A 2JGYA 5F2LA 3FYOA 3DYOA 3WNNA 1X8FA 3VGEA 4S3EA 4IMCA 1B9BA 1DWHM 3EDDA 2CYGA 3I6RA 4FXSA 1T96A 4FNRA 4PTVA 5A6JA 4F0RA 4MYAA 1VH7A 3LHUA 4A3YA 1H7XA 4LS1A 1KXTA 3TW9A 2FHFA 3BAKA 2R14A 4LBUA 1R87A 4P7OA 4Y6GA 1KB3A 3NFUA 1QU4A 4MSSA 4UTTC 4QLKA 1WE5A 1O5XA 1XH2A 2QF8A 4UNLA 2CZEA 4UMAA 2OG9A 3EWWA 3KXQA 1GNXA 1GVQA 3TQ0A 1FH7A 2R9RA 3OHIA 1IEWA 3W9ZA 5JQ9A 2ZYFA 4UFIA 1ML1A 1EWEA 3UNTA 2J25A 1OX6A 2FZ9A 5D37A 1YBQA 4O4WA 1GTHA 4I6VA 3VKJA 1UBSA 5HULA 1PIGA 4C5YA 3DN5A 3TC7A 3S5ZA 3P5YA 1V51A 3W27A 2GJNA 3ITGA 1OT1A 3XISA 1QVBA 4L4OA 1Q3NA 4JX5A 2YBVA 5F2GA 4IHCA 1HZYA 3IJQA 7XIMA 3QMSA 4NX5A 2ZIDA 3VUSA 2C7FA 4O17A 3SY1A 3CHDA 1RXOB 1UH3A 3KRZA 1X6UA 2O92A 1VS1A 5AY7A 1OK4A 4FB7A 5BRBA 1WDRA 5C8BB 3UA3A 2DIKA 3OA5A 3F4VA 5HANA 2P10A 3EDJA 4J1OA 3QN3A 1GVEA 4KWVA 2E6AA 5F2MA 3NAVA 1XS2A 3RRAA 2EPLX 4MNJA 9XIMA 2F84A 4GQBA 3H70A 2SFPA 5AHNA 4ACZA 4F3HA 1OEPA 1QW7A 1JEZA 3N15A 1JDCA 4OU1A 1VCVA 1IE7C 4H1ZA 3GLCA 3W29A 3QOMA 1TE6A 3LD5A 3LY0A 3KP0A 3UCDA 2VFFA 1ICSA 1OCBA 1VJSA 3SGGA 1SU5A 4GYPA 4P7RA 1UQZA 1XKJA 3FS2A 4C6JA 4L7ZA 5BOOA 4ZA0A 4M8UA 2YL9A 4JTRA 3PJXA 3MMUA 5F2IA 2OGJA 3LHZA 4Z42C 3DFQA 2FIQA 4HVXA 2P3ZA 1W3IA 2V38A 4FNUA 3R0UA 2VUYA 3L4TA 2XFRA 4FF5A 5FESA 1TPUA 1RJQA 1JAEA 1ZSXA 5CZJA 2P0IA 4ZQRA 3AAMA 1S2UA 3PANA 4W8LA 1TE1A 1Z69A 3EEZA 3W4RA 3NM1A 1OBAA 3MVIA 2XVKA 1GT8A 2FVKA 1O1HA 2ZZ4A 4PTDA 4Q8PA 2BWGA 4PMUA 4FK9A 2QEZA 1Q85A 2YCKX 2FMOA 1LBLA 3KTCA 3T2OA 3NQCA 1YPIA 3AUOA 3DYPA 3MS8A 3WBAA 1PO9A 1J2BA 3PS7A 4GQQA 1GONA 4GQRA 4LUTB 1QNQA 3C3UA 1R3VA 3NQFA 1UIPA 4PCSA 4HZ6A 1KXHA 1IGSA 2EKGA 3DHFA 3EXTA 3NYZA 4Q4OA 3RM9A 2PLKA 2XVPA 3N6JA 1JCTA 2FDSA 4UQCA 1KQYA 3CASA 1L9WA 3PWAA 1BGAA 1DE5A 2ZWZA 3TQVA 1JZ2A 2EPKX 4JQAA 2OYMA 4GLEA 1RD5A 3CS2A 2QDGA 5BXRA 2D24A 3HQNA 4IQLA 3WMLA 2PDGA 5JBDA 3WDRA 3CL6A 1LYXA 3PTKA 3P3BA 4K2SA 1OT2A 5FA5A 4MJMA 4M7TA 4PR4A 4Y90A 2PLMA 1EPVA 1KM1A 2W3ZA 4O4VA 1FWJC 3VGFA 3BLPX 4LYQA 1ZUAX 4L1GA 1O5QA 2HE5A 5AYIA 1G4PA 3MCOA 2QUTA 3QPZA 2Z2UA 3T4CA 2RGMA 4X2PA 1XLBA 4Z1AA 4QFUA 1ZS2A 1XYZA 4NNBA 3AHYA 1U1JA 1JCLA 3TTQA 2QUVA 1HKJA 1ME8A 1CECA 1TPB1 4O54A 1WXYA 2FHBA 2GWGA 3H4XA 1YBQB 3C61A 3GW3A 1B3ZA 3FKKA 1R3SA 1JPKA 3DC0A 4W5UA 3UJEA 4F0MA 3BAJA 1Q2RA 1MNSA 4E8DA 4JPGA 2DJXA 4NXSA 5CPQA 3V0UA 5HPCA 3V4BA 1DJXA 4HGXA 4CQ8A 3BCFA 2XUCA 3SRHA 3DHUA 3ARUA 3O6CA 3MBFA 4CQ9A 1F3XA 3GKFA 5CZ0A 2VURA 3BJSA 3QFWA 2GQAA 1QHOA 4LV4A 1BTCA 2JFEX 4Z17A 3QTPA 1EP1A 4D8AA 2CCRA 4D6EA 2GUBA 2V5DA 4JTTA 1SSGA 3QQ1A 3GNRA 2ISDA 4DBSA 2YXXA 3H2AA 4B3LA 2NVDA 1D8CA 4BWLA 1FCVA 2ALDA 2R94A 1I75A 1POKA 3ICJA 4J7RA 1ZL1A 4ACZB 3GTXA 3VNKA 1NM9A 3WDJA 5H6HA 2WBKA 2XIQA 4Q8OA 1TPFA 3KOXA 1MQQA 1E70M 3UQNA 5AHIA 5CPTA 4ML4A 1OYCA 3E02A 3M0HA 3UG4A 5EMLA 5IFPA 3FA5A 4D6DA 5D04C 2PTXA 4HD5A 2ON3A 5C70A 2IKHA 2WMJA 3F4DA 3PZIA 5M5DA 4GFIA 1G4TA 3N13A 3IIOA 3B4YA 4JL1A 4IIDA 1VLIA 2J7FA 3KDNA 1W54A 1GW1A 1SO4A 2ZZ2A 2O55A 4I90A 1HX0A 2PDHA 2ISSA 5ABHA 1PL9A 4V1YA 4JFSA 5AHLA 2IKIA 4AIOA 2PCQA 4XZLX 2XHYA 5CPMA 1OC6A 1K1DA 4GUGA 3GZ3A 4ZQMA 4WLCA 5HNUA 4JBRA 2XVNA 3WK0A 3AJXA 4IXXA 1W1YA 2VENA 1GOOA 4ICCX 3TW6A 4PBGA 2WLZA 1C8YA 3T2QA 3U48A 3LOTA 1TFVA 3TSDA 3EYPA 4MHBA 5IBXC 1Q6DA 4A05A 3ZYZA 2PS2A 2VZVA 2IS7A 3QW4B 3T1GA 4PUUA 2QV4A 4XSLA 1E71M 2DVTA 4AXKA 2NQZA 3R4IA 3AU6A 5ECVA 4PMJA 1OG0A 3W53A 1IT8A 3W7GA 1S1PA 2GQ3A 4BHYA 1ZQ5A 2GJLA 3EWCA 1E15A 3WEMA 4D6JA 1UR3M 4TMBA 3SCWA 4ZO7A 1PJ9A 1KCLA 5F1UA 2WJDA 3GVVA 5D8ZA 4O0ZA 4LPCA 3TUUA 4G7FA 1UUOA 4MPQA 1OCJA 1LL6A 1TX0A 3VOGA 2PDUA 5LIUX 1H1ZA 4QLLA 1XHGA 1XWYA 2VRJA 1ZU8A 5FJOA 3NA8A 1DWGM 1LRTA 3AMCA 3GM8A 1ITXA 3BOXA 1J11A 4DQWA 4CD4A 3R10A 4IIEA 2XIBA 2PDFA 4XX6A 2RDUA 5JUVA 3GIYA 2XYLA 3L5MA 2VO5A 2V68A 1U5HA 3SFWA 1W1TA 4PUDA 4TV6A 3THDA 3UJSA 1CI1A 2WMGA 2J79A 4OUEA 4NRRA 2FGLA 1FXPA 2XTKA 2WHLA 3I3BA 4F9JA 1PKNA 1BSIA 4CD7A 1O5RA 1GJPA 4LYRA 1PX3A 4F0HA 4GQGA 2QYGA 2VP8A 3EWBX 2CLOA 1VBHA 4UFLA 5A1AA 3CK5A 4XZIA 3IIPA 2XINA 1DWAM 1XRSA 3EMCA 5EY5A 2I56A 1V5XA 2DV0A 3N9KA 1M04A 2WZHA 3CPRA 5CZTA 3VM7A 3QY7A 1ZB5A 3IJLA 1A0DA 4RZ6A 5LGZA 4HHLA 2ISFA 4QG9A 2DT3A 3O3RA 4MIMA 2QT3A 4JY9A 1F8MA 1ONRA 1CB7B 4TQTA 4DBUA 3T07A 4A4AA 4EF8A 4LYPA 2FZBA 5HWNA 3M0IA 3KVMA 4RE2A 2DZAA 1EX5A 3AZTA 4G7EA 5AYBA 4J4KA 5J5DA 2JF6A 4O14A 2DZWA 1XLCA 3EWXA 4U31A 4AD2A 4Q7NA 3WLJA 5FAJA 3VFLA 5ECUA 3IJDA 3GTHA 4Z2JA 2VI0A 4DJEA 3NR0A 3GXTA 1QOPA 3MC5A 2VFEA 1EZ2A 2WWDA 1E9LA 4D8ZA 2D1ZA 3OQEA 2EJAA 1XQLA 2XIOA 1KFCA 4MWAE 4X2RA 1KRMA 4QAWA 1QUMA 4Y9AA 5I09A 3EA1A 1ZGDA 4INFA 1LQAA 2PC4A 5HNRA 5EMUA 3MP5A 2ZE0A 1QOXA 2X0YA 3ZJ8A 4EXAA 1GVRA 2J8GA 1ZP4A 3QSRA 4WQ6A 1IR2A 1G7UA 1Q45A 4JQ1A 3DGRA 1WV2A 1D7KA 1TPVA 4LVBA 2AL2A 4J40A 3K46A 1W9XA 3H8AA 3FCPA 4YHGA 5JH2A 3ITLA 3HGSA 3VABA 1M3UA 4JIHA 2V3DA 4H7VA 4PEEA 4QE5A 4ZO6A 4UTMA 3WNKA 3VPLA 2WMKA 2YFOA 3LGEA 3BANA 4W93A 1V08A 2PF8A 1AODA 4LUJA 4R85A 2QCGA 4Z2GA 2VJXA 1P0KA 2FQIA 4R7JA 3UF9A 3OVQA 1R7OA 4UBPC 3E0VA 2FDMA 3T44A 2GGJA 2Z1WA 3UVAA 3QKZA 3M5YA 4UTTA 3UWUA 2VFIA 4WGHA 3NIYA 3UETA 4WXYA 4EPKA 4M6QA 5DY2A 3DBNA 2ZUSA 4DO7A 2MUCA 2A7PA 2ADAA 3PJTA 2P53A 1V3HA 1L6GA 5KSWA 1D3HA 1MYRA 1J2WA 3UT0A 3UPBA 3L65A 3ZFHA 4ECLA 3PF3A 3IGSA 4LSBA 2QKFA 1QASA 5CSUA 3QV7A 5HMFA 3ITTA 4WF7A 3WDPP 2GGHA 1J8VA 5I23A 3I4KA 3TSBA 1TWWA 1XLJA 3WBEA 4ZSTA 1W6TA 4A2SA 4WOZA 1ZLPA 1MXSA 4CD6A 1E40A 3QHMA 3IVSA 4A35A 3P80A 1ISXA 3ITOA 3W7QA 1MDLA 3BGJA 2EG7A 2IQ0A 2Y5SA 1B3WA 2E0PA 2XJ7A 3AO0A 1UMYA 4KWWA 4GFSA 4YVXA 1PPIA 1TG7A 3WLOA 5LZLA 1KTCA 1A3HA 1TPDA 3TQKA 4I8YA 1WAWA 2ABBA 7CGTA 4AWSA 5DMYA 2PZ0A 4YCOA 2W92A 2Z1BA 1DYSA 4NZ3A 3TA9A 4WHBA 3V5CA 2IW0A 3G1RA 1K8CA 3GXIA 1NSJA 1UROA 2DZBA 2CHNA 3WLMA 4BZYA 4JTUA 3H22A 3N9SA 4J3XA 2FVMA 2OOGA 3HG2A 4GK8A 4JDBA 3K1GA 3W0KA 4IL2A 3RU6A 1BVNP 1WKDA 2VR4A 4JKKA 2GGIA 5CLTA 4TMCA 1GPWA 3MB9A 3EB4A 1U33A 1ZNNA 3KVLA 2E25A 3MP4A 3GNPA 4PN2A 3L2LA 3C5QA 2X1TA 5IDZA 3PSWA 5HUPA 3VMPA 3UZXA 4G7EB 3GYEA 4J3UA 2XZ7A 5G2IA 1SW0A 1Y7VA 3KAOA 1H0GA 3FLUA 1VPYA 4DF1A 3S0CA 1IIHA 4ZTXA 4LS2A 2OT1A 3VDGA 2YW4A 5JIPA 4QGCA 4CQCA 2OELA 4BR1A 3CYJA 3A23A 3CAQA 1XKYA 5KMYA 2BFGA 1BF2A 4UZSA 2RGLA 1W3LA 1PDZA 4WDWA 3VIMA 4BQ2A 1OF6A 3W37A 3QV6A 3F5KA 3ZR5A 2NLYA 3APTA 1SW3A 1AQMA 3QOKA 4XAPA 5D32A 3U2OA 2GVYA 1PX4A 4JTSA 3ABQA 3PULA 5LA2A 2J27A 1ICPA 3UZYA 2HEJA 4DIAA 3RJXA 2P3EA 4OOZA 3QLDA 4UR9A 3WBYA 3W2LA 3O07A 3PTDA 2DEPA 3P6LA 1XXXA 2AL2B 2OT0A 4GISA 1N7KA 1ONXA 1FDZA 1MVYA 3U0HA 5KZEA 1JAKA 1DXIA 3OG2A 4E2VA 4Z0SA 5FJPA 1VEPA 3NQGA 3U3HA 3VE7A 4OV9A 4XIAA 1BYAA 1SUXA 3IVTA 1BAGA 2JKPA 2NUWA 4R34A 4M1BA 1GYLA 4S1FA 1RAKA 1DV7A 2Y5JA 1GHRA 1ZENA 4C6OA 3OLIA 4QNEA 4M19A 2F6UA 3N25A 5EU9A 1WDQA 2XM2A 5CC5A 1KRBC 4YXGA 1TMQA 2HBVA 4GXMA 1DIEA 2R6OA 3GHSA 4M6UA 2PEVA 5D9MA 3E0IA 3AXHA 4A29A 1OCNA 4FR1A 3V36A 1UH4A 2YZRA 3APYA 3M64A 3A9BA 3UWQA 4N2YA 2POZA 3ARXA 3H21A 1PE1A 3KS6A 1I9CB 2CXEA 1UWIA 3HG5A 2BOGX 1N8WA 1P0EA 1KV5A 3D6NA 1YDNA 4JX4A 4JTQA 3RX2A 1U2YA 3OBEA 4BF5A 4GHRA 4MWAB 3VNJA 4KIEA 4QJ5B 4JY8A 2VGBA 3QPEA 3N2BA 4AEOA 3KBSA 3BK0A 3PAOA 2NSOA 2QULA 2V3GA 1B30A 1PZ1A 1MQRA 1QWKA 3LGDA 5K2ZA 4IPLA 1XBVA 3HPFA 4YN5A 1HW6A 5GNXA 2NZLA 3LV6A 4J2PA 1JI1A 3CV2A 2BY3A 3WJZA 1LCOA 4TO8A 4GO8A 1K6AA 2CLMA 2ACRA 2A7NA 4JIPA 4FLQA 5HMSA 2DSZA 4I9AA 5D33A 1ADDA 1C9DA 2ACUA 3CYVA 4N9CA 1W3HA 5IXEA 1R0MA 1OK6A 3MMWA 2IXUA 2DJLA 2OVLA 4ZR8A 2UY4A 5B80A 3HMCA 4ATDA 3LPPA 5ABFA 3R7MA 1EJSC 3WQ6A 2REQA 3WH9A 3WF0A 4NVTA 1W91A 3GNOA 2XPKA 1TV2A 3DHPA 2GSEA 4GIAA 4HU4A 4O52A 3M47A 4M5PA 3CHEA 4ALDA 1H7WA 1MEIA 1MUMA 3CM4A 4BCEA 1OFQA 1X1OA 2WCGA 2E1WA 3MU7A 4XZ9A 1KBBA 4GPNA 4GC4A 4L64A 3ZJ6A 3G22A 3WD2A 2Z2AA 4Y2WA 1Z41A 3ES7A 1CLXA 2FVLA 1XINA 4HZ7A 5A6BA 1DIKA 3W82A 1AJ0A 1FA2A 4HKPA 4O1EA 4HNVA 3TJIA 2PWGA 4L80A 3LXBA 4FIRA 5HINA 3ZR4A 4GACA 2ATMA 1H5YA 2C18A 2HK1A 4MYXA 1OX5A 3TJ4A 1YLVA 1EP2A 4RKAA 2QJMA 2QS8A 4HZMA 3WENA 3QY8A 4MNLA 2V9DA 1S3TC 1XDJA 3KUMA 5TQLA 4C7FA 4FA3A 2FJUB 3GNDA 4IGSA 1CGVA 4OOUA 4CNSA 4TU1A 1JCJA 1VQTA 1WXJA 5D30A 3FYPA 4UTUA 4JQ4A 3UWYA 3FA3A 1LLWA 3PZTA 1W5NA 1HKIA 3CTLA 4HYVA 4LRSA 1V4YA 1QT1A 5KEZA 3WLHA 2OLAA 4HU0A 4LVDA 4AX7A 1MW0A 3N2TA 3AYVA 1GKRA 3RUBL 4PBEA 1B3VA 3IGHX 3VKBA 3HIJA 3SGUA 3NVDA 5HXMA 3PZNA 1E0UA 1IXOA 1ZAHA 2F8QA 3UYIA 1R2TA 2XSXA 4RLIA 4PSPA 4B3ZA 1THFD 1VFHA 2C13A 4HN8A 1EO5A 3FW6A 2P8CA 2W9MA 1WDDA 3G24A 3LPOA 4ZFCA 2CW6A 5I77A 2FGBA 4K1WA 2QMKA 4MB5A 4Q4KA 4C6MA 1I0DA 3N4EA 3Q67A 1NVMA 1JGMA 3SW6A 3QC0A 5CG7A 4PCPA 3S9YA 4Q3MA 3ME3A 3VIHA 4UQAA 3VDAA 4DI9A 4OBRA 4A2RA 6CGTA 2P0OA 1JZ7A 2VDGA 3TU9A 1GOKA 1UP3A 2GVLA 1NQ6A 3HU7A 3S2MA 4KERA 2J9YA 4QROA 4S3FA 1E1FA 3WIJA 4ZCWA 1DJQA 5D9PA 2WC4A 1LG1A 4YNGA 1A5BA 4POCA 3LCIA 1VB9A 2W61A 1YKWA 4O1BA 3WLKX 2XG9A 1N8IA 2DGAA 3W75A 5ABTA 2Z0IA 1SR9A 3FYYA 2A3BA 3MUAA 5AC7A 3G1YA 4GKTA 2BTMA 4I7WA 1R6WA 2QV5A 4E2BA 3XINA 3VIPA 4LGXA 3CPUA 2YDQA 3AMDA 5AHEA 1PHQA 4DJFC 1TQJA 1R2RA 3FX4A 5DY3A 1M01A 2J74A 2Y7GA 3VIFA 3NGJA 3W84A 4RPPA 3GS6A 1DTNA 1W1IE 2JKEA 5AHMA 4M80A 2VC7A 3UZZA 4EPDC 1LZOA 3H55A 1XD1A 3ZLHA 3AMLA 2JBMA 4GNVA 3QFEA 2GVGA 5CPOA 3C6CA 5ABFB 2REQB 2C15A 1TV7A 1NF7A 3VUPA 5IRPA 2E40A 1XIMA 4IPIA 1WNOA 1D2KA 3W1QA 3TKFA 3BSHA 5TF0A 5HNTA 4IMDA 4Z1YA 3D3FA 3G1SA 3HURA 1S5MA 2YA0A 2C1IA 3S9IA 2D0HA 3WQWA 2FYMA 4B5VA 1H09A 4H2HA 1A5MC 1DWJM 3KRUA 3DGBA 1SFSA 2OYKA 2ZTKA 4GO9A 1V3MA 4M1RA 1UZ4A 2WKLA 3N2MA 3F1QA 4YVVA 4JNZA 3LCFA 3URBA 1W1B1 3TP4A 1CDGA 4KQNA 1P48A 4S3JA 3K4DA 3RMJA 1P0DA 3KHDA 1OGBA 4IFKA 4H9MA 2J78A 3GC5A 4GY1A 4GOAA 5LKYA 5J8LA 3I3EA 1HF6A 2E9MA 4AZ7A 3QHNA 1RCOB 2GOUA 1JXJA 2JIWA 4LF1A 4AHPA 3CEPA 3F2BA 3LLXA 2KX9A 2OKOA 4O19A 1B90A 1U5JA 3DFTA 4LEQA 2CBVA 1JF6A 4GGHA 2QJIA 1I1XA 3ARPA 4ZQCA 2FTWA 2HK0A 1TZ9A 2D69A 4LS0A 3HG4A 2J8FA 5DT7A 1HKVA 4NRSA 3KWXA 3LBCA 3DG3A 3ZJ7A 4E0CA 1R9YA 5D03A 3O8AA 3VILA 3ITCA 5GNZA 3B9AA 4F40A 2BGNE 2J6VA 3KZPA 4P5UA 3MV11 2QAPA 3PWGA 3TYUA 1GZGA 5E6YA 4KCWA 3N17A 1DVJA 1J79A 4J27A 2WPBA 3W7RA 5CC3A 4ORIA 2XU2A 4H4IA 2A3EA 4LAZA 1QO5A 4C65A 1W9VA 2YOCA 4NKCA 1DJNA 1P1XA 4DHGA 2OOFA 3PNZA 1KRCC 4B16A 4GUIA 1QK0A 3OIXA 4JKMA 5I3HA 2W4XA 4H01A 3F2CA 3FVMA 3UY8A 3PN8A 3NZRA 3G1DA 1XR2A 4EE9A 5A8MA 1NTHA 3ATYA 3VDHA 1RK5A 2WYSA 4MY1A 2VNCA 1UKTA 1ZJIA 2BLEA 3WDHA 3DKLA 3IGUA 4FXJA 4AX6A 4R9OA 1AG1O 1GOQA 2V2DA 1GQKA 4UTLA 5A94A 3C2FA 3VO0A 2ZWYA 2ZRZA 3LXAA 3LM7A 4MNMA 3DBPA 1EXBA 4LNYA 3ZQ9A 1EJTC 4TV5A 2XFFA 3W1MA 2ASHA 4A3QA 3LLFA 3OOQA 1UPPA 2TODA 2NXIA 3N12A 3ITYA 3URAA 3TFXA 3M7SA 3NEHA 3N73A 4F4RA 1H7RA 3P84A 2OZ0A 3TAKA 5I79A 1V7YA 1KCXA 4XWUA 4PMYA 1J9YA 3CAWA 3U2EA 1T40A 1XRFA 5FJJA 1J6PA 3NQEA 2NT0A 1R9ZA 3EB3A 3MDWA 2XGIA 4HBKA 1WDWA 4LT9A 1QHPA 3RRXA 2CPUA 3WK3A 1TPEA 3OGRA 5HAOA 3GTFA 3W87A 4AHQA 5E9XA 5HA7A 4W7WA 3VCCA 1HN1A 2H3DA 4ZB2A 1KA9F 2GDQA 2EQDA 3SQSA 1T0OA 3CV1A 1WYIA 3FJ6A 4UFMA 2G3JA 2OWCA 2VC6A 4H3DA 1FKXA 2OX1A 2X2GA 3TNOA 3W6YA 4UQDA 4FNTA 1KRAC 3VOCA 4AYGA 4QEEA 3OLDA 3AHXA 1JGIA 1M1BA 2YL8A 1BKHA 3M6YA 2VFGA 5LA0A 3NL6A 2CLPA 2PMQA 4NNCA 2EG8A 1BGGA 3T7VA 3CQKA 3QHOA 3THQA 1JRCA 4IFKB 4FSAA 3GVQA 1RBLA 3M0VA 1HFBA 4ADSA 3EA2A 2X09A 4S39A 3EDEA 5I3FA 3SBFA 4DZAA 4D8LA 4NX0A 5HQLA 4H7ZA 3KHJA 3RF9A 1E73M 3N18A 1TA3A 1XJBA 4M0XA 3WJYA 3GVGA 2BASA 3S6TA 2Q01A 3UZJA 3II1A 1R3WA 1LWIA 2PC8A 2PRMA 2PDNA 4B5TA 4N9EA 4AZCA 1AQFA 3M16A 4XQ6A 2BBFA 3I7RA 3W02A 4AD0A 4PMDA 4G6CA 1IR1A 1F4AA 4I9TA 1XYLA 2WM0A 2NW0A 2GYIA 5CJNA 3VOHA 3P67A 1FTXA 4DN1A 3WFZA 2CHRA 3K8MA 2ZRYA 2NX1A 3SY5A 1RJRA 1XUUA 1V93A 1YE6A 1LP6A 1UZHA 1XI3A 5A6AA 1VFTA 5FEPA 3DERA 2WJFA 3NO1A 2VGGA 3P0WA 4IP5A 4HTYA 3IWPA 3C0JA 1TUFA 3TTEA 4L1WA 3TFCA 3AC0A 2WNZA 5DX7A 3UXIA 5T8GA 3ELFA 4TX8A 1CGXA 1N55A 4YYCA 1ZZMA 2XH2A 2JEPA 2W62A 1V0KA 2WC3A 3QGAC 5MHBA 4UQ9A 1ADSA 1FVPA 1M03A 4L5ZA 4DZHA 2R82A 4ORMA 1FWRA 3T0BA 1IXPA 3CBWA 1RQHA 4JFUA 3VINA 1WQ5A 5F4SA 2J7GA 5G2HA 5FF7A 2YJQA 3H54A 4RE3A 3G1HA 3QH2A 2PGEA 1NQKA 2ZZ7A 1GZ1A 4AY1A 4C5ZA 3O05A 3RAOA 2IPFA 4QS6A 3LCGA 4JNYA 4QCFA 2NQLA 2B31A 2VEFA 4HPNA 2WJZA 5G5IA 2XH4A 5LIKX 1CXHA 4Q6JA 5FJRA 4PODA 3B0XA 5CC7A 3AHZA 4KCVA 3CQ0A 2C0HA 1B4EA 2J66A 3T08A 4GY0A 3MUY1 4PB4A 3UESA 4C6BA 1YIXA 2A4AA 4HHHA 1DWFM 4WJXA 2YX0A 5H8UA 2WMFA 2VMFA 1WXZA 4IIFA 4QQ3A 3G6LA 1X7FA 3OBKA 4NNAA 2BY0A 1AK5A 1QNPA 3AYRA 3O16A 2OPJA 3K1DA 3H2FA 3EWZA 1QI5A 3EX3A 4R33A 1VBGA 4QCEA 4CUCA 4AW7A 3CTTA 5U4NA 3VGDA 1EEPA 1PIFA 2P8BA 2UV8G 3NSMA 4Q4MA 4JAWA 4IUOA 1NH6A 3KVJA 2IKJA 3Q4DA 3WQEA 4MAVA 1VZWA 1BF6A 3HPSA 5K9XA 3LK6A 1XIEA 3WLSA 1UW9A 1Q6CA 2V5JA 2A21A 4EWJA 1TPWA 3AROA 4H9UA 1U30A 3ANUA 4ZXOA 4PMXA 1XG3A 3EDFA 4WKHA 3VIGA 4FZIA 3CV7A 2RJHA 1RP9A 1Z7AA 4KFOA 2PDMA 4XB3A 4PCTA 1EPXA 2GGEA 2VX6A 3UWZA 4KIRA 4DAIA 3ZVHA 3LSBA 4C7DA 1FXQA 1WCGA 2V69A 5HK4A 3W2UA 1NP2A 4FNPA 4V33A 3IRDA 9RUBA 1G7VA 4H41A 1PZ2A 1HO4A 2DT1A 5DMLA 1EGMA 1LOSA 2VKZG 4IP4A 3WQ4A 1OX4A 4K7YA 3ANVA 3CT7A 1SPQA 3GNNA 3SCTA 3T42A 5LHEA 5I7GA 1JI2A 4Q8TA 1TA3B 2GSHA 3E2SA 3EAUA 1KFEA 1EZWA 3OQ8A 1TELA 3W7DA 2XGZA 3PUDA 1W37A 4XV0A 4LAUA 5D2YA 2WVTA 4AZCB 1VPQA 4JTDA 4PC8A 1NDZA 2Q3OA 1FP9A 1LBFA 3RR4A 5XINA 3WH8A 1UP2A 2VCBA 1F73A 5GJNA 4WUIA 3Q37A 1JPIA 3UG8A 4DBDA 1A3XA 3F4NA 3WYZA 2OJPA 3UWEA 1LT7A 3IJ8A 5HMDA 3R0DA 3P0XA 4PMRA 4LVFA 3UJFA 3STPA 1QI2A 3C3NA 3PJUA 4DBEA 1HJUA 2YCEA 3KOYA 1XC6A 1QI0A 2WVUA 1KM0A 3UXAA 2FHCA 1BFNA 4ERAA 2OZTA 3S3GA 4J3SA 3ZSTA 3E9AA 1F5ZA 4UR8A 5XIAA 3BLEA 4EIVA 1U5VA 1YXCA 3IIZA 4WD0A 3LZ3A 4RCXA 1Q7QA 4F48A 1H5VA 2CIPA 4CNUA 3W28A 3WF2A 1FHDA 5E0KA 1Q7MA 3PY2A 4Q32A 1XL9A 3OYZA 3AXKA 2QAFA 3M0KA 4JHMA 2WKJA 2H8XA 3TJXA 5CC6A 3JS3A 3O6DA 1V03A 2YDSA 4AZ6A 3IJ6A 1VHNA 4PUWA 4DYJA 3FHAA 4AY7A 4B90A 2Y63A 2PWDA 2V0TA 5I00A 4DI8A 4E4UA 4QIUA 1F05A 3BMVA 1HJQA 3K4WA 1NWSA 3DFYA 2MANA 3BW3A 2Z27A 1E9IA 2EF9A 2HNHA 5A8QA 3CMGA 3RO8A 3EX4A 3VDCA 2WNQA 4F0LA 3R11A 1KXVA 1PYFA 3ES8A 4AZ5A 1DEDA 2EXOA 1DJGA 3QR1A 1KKRA 2G4JA 4FOUA 3FV9A 1UR4A 3WUGA 1SYTA 2C14A 3UCQA 3AIUA 3ZXWA 2QPXA 4IM4A 1B3XA 2CLIA 3AU2A 3GD6A 5AOUA 4CD8A 1I60A 3GHTA 4F79A 3CAKA 3W7NA 1VFLA 3BE7A 3NOYA 4PMZA 4GI9A 1KWGA 3AWOA 4REQA 2WANA 5HNNA 5BOEA 4WY0A 1KM6A 5ABEA 2P5NA 3QBUA 1JUBA 1HKKA 4I9JA 1BQCA 2Y1HA 3V35A 4J28A 3VCNA 3QVQA 4GBUA 3W7OA 4IIBA 1VEMA 1GGOA 3BOLA 1TJRA 3B0UX 1OGSA 1VENA 1E9ZB 4O1FA 2BB0A 3T8QA 4GX9A 4AZBA 2X1RA 1UKPA 3A12A 3PUEA 3QZEA 1OB0A 1ECQA 5EL1A 1UJPA 4IGNA 4DO4A 2F7FA 2CHOA 3E2QA 3SZ8A 4HA1A 3ZVHB 2DU2A 1Y65A 2WXDM 4QG8A 1BWLA 1HIZA 2ZUMA 4OUIA 1KBIA 1MW2A 2ICSA 4MKVA 8A3HA 1XDMA 4BI5A 4GD0A 3DI0A 1OX4B 3TTYA 1VIWA 3ZO9A 5HPOA 6REQA 2VEGA 2VCAA 2DW7A 2IQTA 3OODA 5L9FA 2WQDA 3L9CA 5BXSA 4DLMA 3A4AA 3ABRA 3AOFA 1EF2A 3FEMA 2POTA 4DJDC 3GBDA 3DFOA 2D0FA 5A8PA 4O16A 3VD9A 4JR5A 4DX3A 1MMFA 3MUIA 2HISA 2FLIA 3UGVA 1EIBA 2DFAA 3GFXA 1XBZA 3IAPA 3T40A 3ANYA 2WQPA 1R3RA 4LBRA 4FXFA 3DH7A 2C71A 4FLOA 2JK2A 1M65A 1UQYA 2WBGA 4GJJA 2VGFA 2QJHA 1PZ3A 4TOQA 4R88A 1UC4A 2GGGA 1UG6A 3EA3A 2HE8A 4YPJA 1H7OA 1HP4A 1VHCA 2YDAA 3ARWA 3CQHA 3F4CA 4HNLA 3VFCA 4TX9A 5K4ZA 3NPUA 1Y5VA 3DESA 2DH3A 1FBAA 3BGGA 2W0UA 3NO5A 3EOEA 5I3KA 3HV9A 3W72A 1JQXA 2WLYA 3IV3A 4CEUC 2XSBA 1J93A 4YU1A 1UHVA 4KT2A 4UMCA 1FWTA 1E6NA 2ZQ0A 4K7VA 1H1NA 1MFVA 1TV5A 4PUKA 4FIQA 2ZC8A 3BGAA 3D47A 3HB9A 5M03A 2VTFA 2HQAA 3P60A 1YTDA 5E09A 4GZIA 4YIWA 4J2MA 3W88A 2DZSA 4DNHA 3MBDA 2O7SA 2H6RA 3SCVA 1GVYA 4PRTA 4W85A 1SJCA 1WPCA 3AALA 1MW3A 1Y0EA 4XKMA 1FCBA 4HHPA 1ZJAA 3MCNA 1K77A 3VI2A 4O50A 3UGRA 4I6KA 4ZGYA 3WQGA 4Y8FA 3A9IA 1E5NA 3LHYA 1KFKA 5I5RA 1N82A 3LCWA 2QPSA 2JALA 4CD5A 2H8ZA 2GOKA 4MNKA 3SUVA 4XBKA 1HKMA 1BRLA 1ZFJA 3BCDA 5CLWA 2HZGA 2RDTA 4NUWA 1XBYA 1TTIA 3R12A 3MI3A 4CU6A 3APGA 4CN6A 3WX7A 1QATA 1TQXA 2XN2A 3M6DA 3T8LA 1JYXA 1SFJA 3C8FA 2PP3A 4IL0A 4V15A 3IGXA 3KCJA 2JE8A 3O2LA 2VD8A 3T78A 1IWAA 4HA0A 4AZGA 4GUJA 1CGUA 1CENA 3S42A 2DY3A 3MDUA 5CBIA 5GJPA 4REQB 2X40A 1W17A 4WY0B 2DQWA 5H91A 2Y6ZA 5C9UA 2D20A 4UNKA 5G4EA 1XGZA 4DUWA 4EANA 3WSUA 2BXZA 1UIOA 3BC9A 4MPKA 5I02A 1K70A 3PJWA 3AS2A 2QDHA 3M46A 2PAJA 1RLCL 2W6RA 4N9DA 1LLZA 1GYMA 1BEUA 1K8ZA 2PDXA 2QGYA 1AJZA 2OR2A 2BHZA 2W66A 2W67A 4Q8QA 2INFA 2UY2A 2ZCGA 2TSYA 3EMQA 2H90A 1OZMA 3FDGA 1JNDA 3LXCA 4ROPA 2OO6A 5FEXA 3R25A 3SCNA 3IK4A 5A8NA 1FUYA 2Z7GA 2J77A 1A4LA 3W2JA 1P0NA 1NFGA 2AKMA 3V1PA 2OX4A 4O15A 1V02E 3NCOA 2FFCA 3MZNA 6REQB 5GQBA 3WK1A 2HRWA 4UTWA 5JXQA 4E4FA 1YTEA 3AYSA 1MUCA 4MZYA 3S5OA 3DKJA 3R89A 4EPEC 3E1F1 5AECA 4HJFA 4PMNA 2JEQA 2NV1A 4A6GA 4IX0A 4GJIA 4MUZA 1V0MA 2G8ZA 5FF4A 3PTMA 1UBPC 3C8NA 3FKRA 3KLKA 2Z7KA 5FEZA 5EFDA 1FWHC 4AD5A 1DJYA 3K2GA 5I06A 4D6HA 4W89A 3AS3A 2DPEA 4IMEA 2ZX8A 3U7VA 1UASA 3TSMA 4D6IA 3B8IA 1GOWA 4YTRA 2XFWA 5T26A 3AQUA 2D22A 2NVAA 3B06A 1QI4A 5HBFA 1JZ6A 2ZRXA 4I8DA 3RU8X 1A53A 3W71A 4LOCA 3ARRA 2W91A 4W8BA 1Q13A 3V1HA 2G3MA 2HDJA 3SSZA 2ZZ3A 2Q02A 4AC7C 3GR4A 3TN6A 3N2XA 3T4WA 1TZ7A 1W8GA 2EO7A 4Z2IA 1V79A 4R53A 3L4VA 1V02A 3IANA 3W7EA 5D38A 2FH6A 1GCYA 1TX2A 3OVGA 2R8WA 1A47A 2P88A 4XAZA 4WR3A 2XM1A 5A2CA 2BGSA 3AHVA 3AIRA 4S2CA 3MSDA 1LRQA 3CHCA 3I10A 4MUPA 3A3HA 2X05A 3N2CA 1XRTA 3RCYA 1DHPA 4GX8A 4NI8A 1BRLB 4JD4A 5IDIA 2G3NA 5CGMA 1ZBKA 1TYGA 4GVGA 5REQA 4XBJA 2CZFA 4LV9A 3ZSSA 3LHTA 3E2RA 1CLKA 2INZA 2EPNA 2WO5A 1B4KA 4IMFA 3Q45A 3URQA 3N29A 3CH0A 3TWAA 3GIPA 5CBJA 1EA9C 3MO4A 2QPUA 3C2VA 4XK2A 3VTRA 2VEMA 4LAMA 5AC5A 1AJ2A 1TZZA 1ODZA 2XVLA 3O6AA 3TJLA 2VWTA 4GVFA 1IZJA 1BWKA 1PVNA 3CIXA 3F5JA 1TJPA 3CNYA 3N3MA 4QRNA 3QM3A 4CGTA 4XVDA 2EG6A 4N9BA 3FHQA 4J3VA 5DT5A 4BK9A 3M44A 3MUZ1 4C6PA 3PBYA 1I0BA 2J62A 1X97A 3GG0A 1ME7A 1FCUA 2EPHA 2VRKA 2R1NA 4AIEA 3WJSA 1LF1A 1GG1A 4PRWA 4LUYA 3M41A 3EGJA 1I4NA 1FP8A 4O53A 1EYWA 1M53A 1PKYA 1HNYA 4EACA 3H2EA 1ONEA 2EAWA 2OODA 4MKNA 1TVLA 2DZXA 5CAKA 1KCZA 2QIWA 4CNTA 3C2OA 4PE8A 1HJWA 1I2PA 1S2CA 1XLMA 2GJXA 4DBWA 3PPCA 3MZ2A 1ZCOA 7A3HA 1ZHAA 2V3EA 3RNDA 4P61A 4IOTA 1XGDA 4XZWA 1XLLA 1WDPA 5BU9A 5M17A 3PNUA 1AD4A 4XZHA 3WQCA 5DCDA 4DLFA 1SZRA 2PP1A 1PTAA 4MJ2A 3LNMA 5AYYA 3WQFA 4GC3A 4Q4SA 5ENLA 4H83A 1M7XA 2CKRA 1GORA 2ZA2A 2X41A 5FIPA 3I6TA 4OECA 5EPDA 1JDDA 4PULA 1GQJA 1XDLA 1Y5WA 3W1XA 4V28A 4YLWA 1HGWA 3P93A 1YRRA 4DWSC 5K9CA 4FX8A 1BVWA 1YX1A 4DF0A 5AYZA 5A3HA 2OQHA 1ISZA 2YBTA 1EIXA 1R30A 3GFYA 5LIWX 3PPHA 3SUTA 1Z9AA 3G0UA 1ZBCA 4FLRA 3AIWA 3M0YA 1FX6A 3KCLA 2ZE3A 5HOSA 3R1ZA 3KBMA 4XAFA 3CUXA 3CU2A 1MUWA 3PHAA 1E6QM 1IWPA 2IXVA 1FHUA 1X98A 2PWEA 2XGBA 4FX6M 4F2TA 1O94A 3WD4A 2QVHA 3T09A 2GFTA 2Z26A 4JCLA 1DXFA 2QJGA 4U28A 3W6LA 1VFOA 2WNWA 1GKPA 4LBSA 2I1OA 2BX7A 1EOMA 4O0KA 4AWEA 3W7IA 1HQTA 4B15A 1F2JA 2NXHA 1Q4WA 3PBWA 2WSPA 3R43A 3K8KA 1ITQA 4WOQA 4LY8A 4ZL1A 4UC5A 4RJEA 1KXQA 1EC8A 1OFEA 4X0NA 2VQTA 1X6NA 2UY5A 1V0LA 2BS9A 1J5SA 4IJCA 3CC1A 3U5UA 2NWSA 1FH8A 1J5TA 1LOQA 2RFGA 4O1CA 4K3ZA 1QFEA 2NUXA 2VFHA 2HXTA 5REQB 4C6KA 3OGVA 1G6CA 2VDIA 3TK7A 4JHOA 1KBKA 4US6A 1TO3A 1SJBA 3SN1A 1UWSA 2G50A 1EGZA 1XD0A 5LA1A 3VAVA 3SB0A 4C6DA 3D46A 1XGEA 4AEEA 3BICA 5T9CE 2BP1A 3CH9A 3FY1A 1A49A 4HOXA 4IZGA 2ACSA 3ARZA 4KF1A 2I9EA 5BNKA 4RDVA 3UP8A 3RIKA 1OIMA 2E28A 1UA7A 3NPXA 4CQBA 2G37A 3BSGA 1YEYA 1WO2A 4Q22A 2QR6A 1DIDA 3PFMA 3TXZA 1W2PA 1B31A 4PRRA 1EQCA 3W26A 4L1XA 1Q6LA 5G1TA 3UEQA 1Q2SA 1U22A 2ZICA 1E0WA 1UR1A 4A3UA 1NARA 4W87A 4MWAD 1F74A 2WVVA 1RA0A 2ZZ5A 2NWRA 1P1MA 3GVRA 4TR9A 5BROA 3W1TA 4QISA 1NWRA 1VIZA 1KNWA 4U33A 4Y9NA 2PTYA 3OB8A 3QPYA 3CZLA 3GG7A 2GJXB 2JQXA 4U2ZA 3VX1A 3OLGA 3L4XA 1SVDA 2CNCA 3AIBA 1XCFA 4LANA 1LG2A 1XC4A 1GQIA 3B9DA 1IHIA 1OF8A 1TRDA 3H4GA 2VYOA 3GW0A 1K3UA 2JGQA 3DOPA 4QDPA 3VNDA 2XH0A 2VVSA 3S4TA 2V6AA 2ZBTA 5DANA 1D3CA 3AWNA 2ISVA 4PA8A 1M6JA 1LUCA 2V5KA 4YWIA 2AQVA 3L4WA 4MB3A 2D2HA 4OV4A 1PCKA 3VIKA 3KOWA 4M51A 4NXKA 2R1PA 4IJRA 1JYWA 1K9EA 3TC6A 5HR7A 1UD6A 2GDVA 4QE1A 4AVFA 3CQIA 3KBJA 2CZDA 1J0JA 3QRHA 5EBUA 3FXGA 3WLRA 1K7XA 5D2VA 4FXRA 1AMKA 3SAZA 5C9XA 3GNXA 3WQ5A 4ADUA 3W1LA 4DUXA 1JD7A 4Y8EA 1P6CA 2YA2A 1FDJA 7ENLA 3HM7A 5RUBA 4XTIA 3W7PA 1LDCA 1DIOA 4JL2A 5BRQA 2JIEA 3VD5A 1T6MA 3SECA 1DQXA 4DM2A 2E6YA 3D5HA 3H6OA 5AVNA 1XH0A 1PIIA 1J4EA 4B4FA 3NEVA 1RCQA 1E1CA 4UTFA 1Q6GA 4O1AA 2XN1A 4AD4A 1IGWA 1L2QA 4LXFA 1FWBC 3SCSA 2YIHA 2I17A 4GZ7A 4LCQA 1RY0A 3ZWTA 3SSJA 3GTNA 2FTPA 4YJ5A 2UWFA 4LC6A 1ITUA 3AZRA 1O68A 2YDRA 1BSLA 1VP5A 1KGWA 1RQEA 2WSYA 2GPTA 1KM2A 3EWDA 4FF7A 2FH8A 4AAJA 1AZ1A 2VX4A 4JXCA 1AVAA 2W63A 1K02A 1JXKA 1IT7A 1L0PA 1TKKA 3GVWA 4QX4A 2PWFA 1TVPA 3GTIA 3LI0A 1IIGA 1PYMA 2WJEA 2HS8A 3RYSA 3PB0A 1EA0A 3ZZ1A 4MM1A 4DJFD 3L2MA 2EPMX 3TONA 3G1FA 3FJ4A 4FNSA 2BDQA 4MZ1A 1H3GA 3NUKA 3WH6A 3F7JA 1Q6RA 4K68A 3AXXA 3SCRA 2X1UA 2A2IA 1ITCA 3VGHA 1MNZA 1R47A 4GQ0A 5G4WA 3RG6A 4UZUA 4MDOA 3PK7A 3Q2DA 1Q6EA 6A3HA 3OZYA 5C2XA 1G1YA 3BJTA 3VM5A 3SUUA 4CCZA 3WEOA 3BTNA 1JCMP 4K36A 1MFUA 4NYYA 2CERA 1NOFA 1O12A 4NJHA 3QJAA 3TNBA 1CWYA 4QITA 3NOEA 3WQPA 1GJUA 4JICA 1XSIA 3WF3A 5A2BA 1A0CA 5DN1A 2Y85A 3M1ZA 3M0MA 3BJFA 1EP3A 2WVVB 3P2VA 1W3JA 3B8UA 1A5CA 1BHGA 4GYPC 4BF7A 2Y8VA 1OC5A 5LNSA 3MI2A 4N7QA 1S3HA 1CIUA 1F6PA 3BMXA 3SGZA 2QDEA 3N1AA 2BG5A 1T8XA 4G5DA 4F0KA 1B54A 4B5UA 2XSAA 3PG8A 2QUUA 4DWDA 1BG4A 1DQWA 4WK9A 3LMZA 2A3CA 1OQFA 4UTHA 3MPGA 4WSKA 1UC5A 1GYNA 2VEIA 3ZT6A 1WDSA 1X38A 1E6SM 2V5BA 1UZ1A 3S1XA 5FL0A 2VCCA 4XKYA 4BEQA 3EPOA 1TWIA 3NQ8A 3NM3A 1LUCB 1RBAA 3WLNA 5H8PA 4ILSA 3TYCA 1UD2A 4HCHA 2OGYA 2X7WA 2FB2A 4BQ3A 1RQBA 3S5NA 1SO5A 3BLOA 3HQPA 1EJWC 1TRIA 2X16A 3R58A 3ARSA 2O0TA 4LVAA 4AUBA 4XTDA 4ZSUA 4KCTA 4S3BA 3KOZA 4ZZ9A 1UUMA 3GYCA 3U5YA 3FFSA 3L66A 2VZUA 1O95A 1Q5MA 1Q6QA 1FWCC 1LWHA 3ABXA 3PC0A 1V6YA 4Z1BA 1H1YA 3LB0A 5IM51 1UH2A 1EEXA 3IJIA 4O12A 2D23A 1EH9A 4C1LA 3GDRA 4U5KA 3PZQA 4W88A 3MI6A 1KC7A 3UCCA 3RPTA 1F6KA 1WKYA 2GJRA 2ESCA 5DQPA 1SGJA 1KW1A 4C6NA 3WNPA 3PBUA 4WSJA 1E1CB 7TAAA 1W31A 1MW1A 5G2WA 1JD9A 1S1RA 3QYSA 3NXLA 1K03A 1QR7A 4WEVX 4RR4A 4HYWA 3ZOAA 1P43A 4MOZA 4B5WA 4WKAA 4AFYA 4RPQA 4FLSA 5KTLA 1E6ZA 3LEPA 3Q65A 3TAOA 1ONWA 3NZGA 4E38A 1V0NA