3W2KA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-165
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-165
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2kA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2kA01
3LXCA 1ME9A 2NX3A 1CX9A 1FDJA 3E96A 1A53A 3TJXA 2B4GA 1VYSX 4AHPA 1A5BA 4IX0A 1YDOA 3W07A 1SUXA 3EKZA 3W7HA 2R94A 4PC8A 3BVJA 2QF7A 5DCBA 3THQA 1GWJA 4JGDA 2X2GA 3S5ZA 4RV8A 3G8EA 1OVDA 3FKRA 1Q45A 5HR7A 2C16A 4UTWC 4ADTA 3QSTA 1YTEA 2GVLA 4JN6A 2OZ0A 5LGZA 1YLVA 3LDVA 4TMCA 3FIGA 2A6NA 4TX9A 2GQ8A 4NX0A 4BI6A 5AHEA 2NX1A 1SO6A 1MEHA 3MYPA 2G95A 4XTDA 4UC5A 5E0KA 3OIXA 3PVFA 1LLZA 2C1HA 4HNUA 3JS3A 4N9EA 2J88A 2CZFA 1AW1A 3GDLA 3NGJA 1DORA 4MY8A 1VCVA 4Z08A 2NUXA 3W1UA 3O63A 1W5QA 3UZJA 1QPOA 1KM3A 2A4AA 3JR2A 3PM6A 4JX6A 5F2MA 1EEPA 1G67A 1A5SA 3O1NA 1V5XA 3PB0A 2HSAA 3G24A 4CNOA 1OFBA 2VFDA 1D9EA 4QISA 4M7TA 3BV4A 3KVMA 1OFEA 3TAKA 5FEWA 4JICA 3W83A 2Y7GA 2A7PA 5DY3A 1KTNA 3P81A 1H7NA 1SZGA 2TSYA 3W1TA 4LC6A 1SQ7A 3W2MA 1SPQA 5EA9A 1LCOA 4PEKA 1GZGA 4UMBA 3GDTA 4GUJA 1XC4A 1FXQA 2PURA 3HG3A 4Y9AA 3ZS4A 4JTUA 2EF9A 1GVRA 3QW3A 1UBSA 3FLUA 4P61A 3CM4A 3FKKA 3W1MA 2Y7EA 3TH6A 1QAPA 1R30A 1KFLA 1N7KA 4EOUA 1ZNNA 1W5MA 1DL3A 3WJXA 3TROA 3BGGA 1GEQA 5HQEA 4ALDA 3P74A 5IBXA 2H3BA 1SFLA 4Y6GA 1XDLA 1TPWA 4PH6A 3DZ1A 4NX5A 4EWND 3PR2A 4NQ1A 2WKJA 4EF8A 4MFDA 3TW7A 5KINA 3GR7A 1EP3A 3W1XA 1ZJIA 3MWAA 2HS6A 4HNVA 2FFCA 5D2XA 4TO8A 4MZYA 3SR7A 1TPC1 1QNVA 3GB6A 3S5NA 5K4XA 3C8FA 4S2BA 4Z0SA 3G1DA 2QAFA 1OK4A 6TIMA 4JXCA 2PCQA 2JKAA 3HPSA 2ZZ5A 3WK2A 1CW2A 3W2KA 2QKFA 1AK5A 5BNKA 3NL3A 3QC3A 2VOMA 1ZENA 3W87A 1DJQA 2EGZA 4N4QA 4YLWA 2YX0A 1KM2A 1H63A 1H7XA 2RH9A 2FPTA 3MHUA 1L6YA 4FNTA 3GZ3A 3DI1A 1ALDA 1B57A 1KM4A 3QMSA 2CU0A 4ML9A 5D30A 5LZLA 4JTEA 1N8FA 4XUGA 1H61A 4UTWA 3OHIA 2F7FA 2NXGA 2HS8A 3TSMA 3HMJG 3STCA 1RQEA 3W3OA 3NQDA 3PAJA 5FESA 3BW2A 1TRDA 5D37A 4WX2A 3NA8A 3CC1A 4JY9A 3LCWA 4QITA 4LUIA 1GTHA 4KFPA 2ZDRA 4XWUA 1OHLA 5G2WA 1TQJA 3LM7A 3CLMA 4NZFA 4ZQCA 1EUNA 4GC4A 2VFFA 3C6CA 3CQ0A 4LVGA 4GWEA 4OQVA 1UCWA 7TIMA 1Y0EA 4JIPA 3CPRA 3UXDA 3ANYA 3PC0A 2DJLA 4IMCA 4O1CA 2ZZ7A 2V8ZA 1WYIA 2FQIA 4DF1A 4QAIA 1B4EA 3FFSA 3HPZA 1TSIA 4K8EA 3NQ2A 3IIXA 5LNSA 3HGRA 3S0CA 4UMCA 3PSWA 5K9CA 5I3KA 3QJAA 3VFLA 4M6QA 4ADUA 4IXHA 1SFJA 3ABSA 2WQPA 2J9YA 1KBIA 2X30A 2ZYFA 3B06A 4RXGA 3LI0A 4QNWA 4UTIA 2PRMA 4EIVA 2X16A 4DBEA 2TMDA 3LLDA 1QOQA 5IM51 3W76A 3N2XA 5KMYA 4A22A 5LHFA 3E12A 2ATSA 3A22A 3N3MA 3E0IA 2WSRA 4M6PA 3BG5A 3LCHA 1NVMA 2QCNA 1XXXA 1UB3A 5EYWA 3G0XA 1JCJA 2WJZA 4D2JA 1H50A 2BWGA 1FDZA 3UQNA 3M41A 1QOPA 3RLVA 5H91A 2NUWA 3E02A 1LZOA 4A29A 4LS2A 3NPWA 3W1RA 3L0GA 1IF2A 2JK2A 1DHPA 4N9DA 4N6EA 3HBLA 3DKLA 1G4TA 5D04C 4FX6M 1ADOA 3L0KA 1KV8A 4YCPA 2NZLA 4FIQA 1OFQA 5DXXA 2RDWA 1TCDA 1C29A 1IXPA 4HIBA 4RR4A 1MZHA 3EEGA 2P0OA 1JUBA 4KFNA 3CT7A 1W3NA 1WBHA 4FB7A 4BR1A 4LY8A 4JTGA 4NVTA 4S1FA 4XKYA 3TUUA 1ML1A 1FBAA 3IGSA 2ZZ1A 3T4CA 3CEUA 2ZA3A 2BTMA 4GRSA 2Y85A 3A23A 3G1FA 3IVUA 2Y62A 4X3ZA 3K30A 1AG1O 3C2FA 2NWSA 5CSRA 3LXAA 1TB3A 3GKFA 4ZQOA 4NNBA 1GQNA 3PULA 5D2YA 3T40A 3TW6A 3B03A 1DV7A 1VLIA 4N9BA 3TV8A 4UR7A 5C54A 4HKPA 5L9FA 4Y8FA 1YDNA 4FNUA 2E5DA 3C4UA 5DBUA 1S3HA 4LU0A 4JTLA 4N2YA 1I2OA 3NPXA 3GAYA 1TV7A 3NXFA 1ICSA 4UNKA 1F6PA 2CLOA 5AB3A 3TAOA 5CPMA 3C3NA 5J5RA 5J5DA 2V81A 4C1KA 3GLCA 1ZAIA 3W7GA 3PUOA 3O07A 1Z44A 5KZMA 3NM1A 1FQ0A 4O0KA 1L6WA 1SZNA 2BLEA 1MEIA 1T0OA 2EHHA 2VXNA 3LTYA 3GDMA 2Y88A 3NQ8A 4LV9A 3DFQA 1T99A 3OG3A 4OBTA 3EX6A 2V0TA 4JYDA 2JBMA 3PBYA 4I7WA 1JRCA 1SR9A 3QPYA 1R2SA 1XBYA 3CTLA 4R33A 1DVJA 1JUKA 3IIPA 2ISSA 1EB3A 2X1UA 4HNNA 4WY0A 2G96A 1RD5A 5AC8A 1P0NA 4UTMA 3RMJA 1ZAJA 4JDBA 3E49A 3M5YA 8TIMA 2J6XA 4NJIA 1XBZA 2WSYA 3LLFA 1H60A 2E6YA 4DQWA 1WXJA 1FWWA 3NZ1A 4RXFA 3STFA 3TQ0A 2YPIA 3DU0A 1KM6A 3PG9A 4DEFA 4UCGA 3B8DA 1XDMA 3W75A 1J2WA 1R46A 3ATZA 1JQVA 2CZDA 3UYCA 3NM3A 3UPBA 4RZ5A 4M19A 4MIMA 2PE4A 3LV5A 3IVSA 1FCUA 3G3MA 1W1ZA 2KZHA 1RQHA 3TMQA 2QCFA 2E6FA 1A5AA 1G69A 1H7RA 1T8XA 4LVFA 4IQLA 4IXXA 1H5YA 1TPH1 3IEBA 2ZRVA 1EA0A 1ME8A 2TYSA 3N9RA 3W7JA 1TPDA 2P10A 4FNPA 2WSQA 4JTJA 1VCFA 1P5BA 3DAQA 3MUXA 4FNSA 2GOUA 2JGYA 4HPJA 3W2LA 5CPNA 3H55A 1GYNA 3I7SA 1PL9A 5BMXA 3OVPA 4NU7A 1WAUA 1OK6A 2YFNA 3S9YA 1TV8A 1R47A 3N73A 2QCDA 1X8FA 4RZ4A 3NQGA 3TU9A 4AF0A 4ZQPA 3W72A 4GBUA 1F5ZA 1XCFA 1XKYA 3OVRA 3UZ5A 5HINA 1ICPA 1KFEA 5AC7A 2QJGA 3W7LA 5G2HA 3O15A 5I3JA 4S2CA 1MSSA 5D05A 1X1OA 1KFJA 3C52A 3GX9A 5HR6A 5HJLA 1KW1A 3NDOA 3HGOA 2NWRA 3LCLA 2VEIA 4O17A 1TPUA 2DZPA 2XN0A 2P1FA 1SW0A 3DBPA 5F4WA 1GVFA 5F4XA 3I7RA 2CLHA 4NXKA 2V5BA 1BWLA 4OV9A 3ZWSA 3Q2DA 3CB8A 2CLMA 3UY8A 2PRHA 3ABOA 2H90A 5LSMA 5FF0A 1FWTA 3A21A 4TU1A 3UWZA 5HWJA 4O15A 4OGZA 3CWNA 5AN7A 1LDCA 5HWMA 3OVQA 2YR1A 2O7QA 2YGYA 3SJ3A 1GOXA 4WD0A 5DELA 4AWUA 4AEOA 3R2GA 1W31A 4WJEA 1KBJA 2C15A 3EXRA 1SO4A 3LRLA 3UWVA 2QCMA 3R89A 4O28A 5BW6A 3LERA 3S1UA 4IWWA 2E5CA 3KOFA 1FXPA 4EF9A 3L9CA 4R34A 5G2IA 1LRTA 4NT0A 1HL2A 2QCHA 3U8GA 4O13A 3L2IA 3M7WA 2IQTA 1X6UA 2PRLA 3W7CA 1P4CA 5C6MA 1SSDA 2ATMA 3G22A 2A7RA 2ZA1A 3I6RA 1W54A 2V30A 4QNEA 1Z42A 3S1XA 1SZFA 2A85A 4IGHA 3DFNA 1NEYA 2Z1BA 2TPSA 2NLIA 2QCLA 2Z2UA 4PL1A 4BK9A 3UNDA 2D73A 1ZY9A 2Q8LA 3WK0A 1DKWA 2NXHA 1UUOA 4GFSA 1G4PA 1GVSA 3M16A 1VS1A 3WJZA 4PTNA 2ZFAA 5HUOA 4ORIA 3LCXA 1OF6A 3C2RA 3FYPA 3M6YA 3GXTA 2VEPA 1EP2A 4JY8A 2E68A 2QUTA 4ZVJA 4GJ1A 1YXDA 3QRHA 4Y96A 4NZJA 3W7EA 2H3DA 4LRSA 2RHGA 3DFPA 4PCFA 1YPFA 3W86A 1LP6A 4O18A 3EWYA 4O1DA 3W7IA 1P0KA 1FWRA 3D0CA 5KTLA 4H4IA 3QQ1A 4HPXA 1JQXA 5KZDA 5F4SA 1EWDA 3QQ0A 5F1VA 1EUAA 5AHMA 5G1YA 3HG5A 1K7EA 2J9ZA 4UFHA 5EPDA 2Q3OA 1LM1A 2VEKA 3GVGA 4R53A 3O8AA 4K8HA 3NEVA 3KXQA 2DZTA 2EPHA 3PSVA 1EP1A 1GVOA 3DKJA 1VYRA 4IUOA 4LWWA 3S5YA 4ZZ9A 2CFFA 3KVLA 4YCOA 3L5LA 2C3ZA 2CLKA 4WOZA 1YTKA 1QPRA 4IJBA 1YYAA 4AAJA 1CI1A 3SIZA 2VC6A 5HNRA 4U28A 2FB2A 1W56A 3SSJA 2QJIA 4AB4A 4JTFA 3IVTA 1OYCA 5EY5A 2A5HA 4ZQNA 4KWWA 1Z48A 4GUIA 4WXYA 1VYPX 3M9YA 3EXTA 3LOTA 3W71A 1QR7A 3B0UX 3L5MA 3GAKA 3C2VA 2DZWA 4LTSA 1NF0A 1ICQA 4XQ6A 2GQ9A 4BWLC 5G5IA 3LHVA 1W5PA 4X22A 4FHAA 2ZRZA 4MZ1A 3A5FA 4GE8A 4TR9A 3N34A 3L67A 2OT0A 1JCMP 3H54A 5LGXA 3LV6A 4I9AA 3B0VC 1MO0A 1WOAA 3STGA 4PA8A 3LRMA 1JCYA 3DFOA 4NUWA 5CGQA 5LKYA 4ORMA 1PHWA 4RX0A 1TV5A 1XM3A 3MP5A 4UR8A 2NV2A 4CNNA 2A21A 4HN4A 1J4EA 2GVGA 3G8RA 4PODA 1FDYA 3PWAA 4RK8A 1K7FA 1VH7A 2BXVA 3P8IA 3RF9A 1IXNA 4QSHA 1WX0A 4AXKA 1SO3A 3RNDA 1SW7A 1OFPA 3DGRA 3PUEA 4DXVA 1XFBA 4UFLA 4K36A 3R5EA 5EMUA 3GYEA 3MW7A 3N9SA 5D03A 3USBA 4ADSA 3FA5A 1R2RA 3AJXA 3KHJA 1B3OA 4FXRA 1ZCOA 3LCFA 3UWWA 3LHUA 5D33A 3RU6A 4O52A 3QPZA 2JKPA 2ZRUA 2NXIA 3V1PA 5AHIA 2ZRWA 1SSGA 4CCDA 1FUYA 3BGJA 4M5PA 3AO0A 4CQ8A 1G4SA 1QCWA 1KFKA 4IX2A 2ISVA 1ME7A 1E51A 1W37A 3GIYA 1LYXA 2EKCA 3NQCA 4MJZA 3VI2A 4JTIA 3G1XA 3B0PA 2ZZ6A 4PFMA 3EWBX 3P62A 2ISWA 2GJLA 2B7QA 3LCIA 1FWNA 4YMZA 3NPUA 3W88A 1IGSA 3LHZA 4UTTC 4XBSA 4O50A 1ONRA 2WV8A 4QQ3A 5D2VA 2A0NA 3F03K 1I2QA 1G7UA 3EX2A 3B05A 4LUJA 3T7VA 1WDWA 4OHQA 5K4ZA 3RFAA 1V7YA 4DF0A 3ZWTA 2VFIA 2C13A 2CW6A 2HTMA 2W6RA 1VJIA 3HGJA 3LB0A 4O10A 4MFEA 1BTMA 3F4NA 5I3HA 3O06A 3M47A 4FNQA 4JS3A 2YXGA 3TXVA 3SZ8A 3S42A 3W74A 3MO7A 5ABTA 1VHCA 4JTTA 3W85A 3UWQA 2QEZA 2X1SA 3WFAA 4UTJA 3NL6A 1GJPA 4XBKA 1WOBA 3Q94A 5FF2A 4GUHA 1S5VA 3SI9A 4K39A 1VLWA 2HMCA 1OFDA 1JULA 3WJSA 3SFKA 3QEZA 5AYYA 4AWTA 4G1KA 4K7VA 4K7YA 3P7YA 1W3IA 4YWIA 2I9EA 3BW4A 5AHNA 3OA3A 4L4MA 3PS7A 2GUUA 4JIQA 1UJPA 3DH7A 3UWYA 4RJEA 1RQBA 3STEA 3C2OA 4JX4A 2AQWA 4Z1BA 1O5XA 1QWGA 5A5WA 3RLUA 1YXCA 3PUDA 4Z0JA 4X9SA 1TO3A 1O4UA 1HTIA 4M6VA 3SY5A 4ZQMA 1EPXA 5U4NA 4HSNA 1PCWA 4FO4A 3S6DA 2QUUA 2V2DA 3CHVA 4MVAA 1OX4A 4AHQA 2ALDA 3BLEA 3N14A 3P5YA 3B04A 5KITA 4J9JA 3P67A 2RFGA 1BKSA 1WBJA 3C56A 2GJNA 4ZL1A 1HFBA 2A6LA 5C5YA 5AYZA 5T26A 3L65A 3GKAA 3LGEA 3W73A 4O12A 2YW4A 5D38A 1GT8A 1L2UA 3C61A 3NOEA 2WNNA 3EWWA 4GUFA 1XL9A 5D09A 5HULA 5AHLA 4E2BA 1NF7A 2OT1A 1LRQA 1XUUA 3BLFA 3G3DA 1RVGA 1IXQA 3GR8A 3T44A 1MEWA 3TQKA 3W7DA 4KWVA 4LC8A 1K8XA 3EX4A 1K8ZA 1B4KA 3IRDA 1OFRA 1ZALA 2R14A 3UXAA 3TQVA 1OF8A 2B7PA 3MBDA 1KA9F 1F6KA 4UTTA 3O6CA 4JNMA 3BW3A 4MPQA 2AGKA 3NQ7A 3P84A 1VCGA 3R12A 1FCQA 4LRTA 4DO4A 3HIJA 3Q58A 1FCBA 3F4WA 1TIMA 4O4VA 2Z6IA 3P80A 1KM5A 3HO8A 3W70A 2E1DA 1SO5A 4ONVA 4WOQA 2ZRXA 4O1BA 5LHEA 3EWXA 4DELA 1Q6OA 4UTUA 1C9DA 4DBDA 3M5ZA 2E5BA 3A24A 3NQVA 5KZEA 1IXOA 2CZEA 1KTCA 5D2TA 1BWKA 1ZHAA 4MLJA 3FS2A 4UFIA 3E9AA 1DJNA 4DPQA 5DLCA 2J9XA 3NNTA 2OX1A 4GUGA 4Z1DA 5CPOA 4UIOA 1LBMA 2ZA2A 3GDRA 4P2VA 1YXYA 2PC4A 2VFHA 4JYEA 3IGXA 2ZCGA 1M7OA 4IMEA 3UY7A 5CZ0A 4RLIA 3TFCA 5K9XA 3TDFA 1NAL1 3L68A 4ZMGA 1Q3NA 4LV4A 4ZQRA 2QCCA 1Z41A 1K3UA 3S8HA 1Q6QA 1EWEA 4NJGA 1JVNA 1M6JA 1MXSA 3O16A 3TR2A 4B5NA 4OU1A 5BRBA 1IIHA 1K03A 4BI5A 1K8YA 2V9DA 2BX7A 1H51A 1PE1A 3HB9A 4XKYB 5K7JA 1OABA 4MZ8A 3G0SA 3KAOA 3NQAA 1D3GA 3L5AA 4FF7A 4WZHA 1K7XA 1I2NA 4LVAA 5HWNA 2CLFA 3NPVA 2ZTKA 4WUIA 1OFOA 4FIRA 4AVFA 3DENA 3QMTA 2QAPA 3MI2A 1HUVA 1AL8A 4Q33A 3QYQA 2Y61A 1XI3A 2VELA 3HJZA 1TTPA 5FF4A 4DO5A 3BO9A 2ZZ3A 2VFEA 2H6RA 4CQ9A 5A8GA 1FCVA 3GXPA 4MOZA 1M7PA 4RKAA 3BARA 1G7VA 5AYXA 4O16A 1W3TA 5LNWA 1FY6A 3QM3A 1AMKA 1VGAA 4K37A 2DZUA 1A5CA 1JR1A 1LOQA 2VEMA 3O6DA 3R8RA 1UUMA 2Z0IA 2BSLA 3EWUA 1YADA 3DFTA 3W1QA 4IMFA 1HO4A 4IPIA 5KSWA 2G97A 1OX4B 2YYTA 3YPIA 2WNZA 3BPWA 5D02A 1O95A 3CU2A 3M43A 5SWUA 1HO1A 2R8WA 3LBCA 5CZSA 3ATYA 1YPIA 3GK0A 3HG4A 3NL2A 3SW6A 1KTBA 4Q4KA 4TMBA 5AOUA 3TIMA 4FXSA 3HOJA 3TE9A 1LROA 4NXSA 5CZTA 3HG2A 5GVJA 5AFDA 3NL5A 3QFEA 3QZEA 3TKFA 3TC7A 2FDSA 4UMAA 3NQEA 3W23A 3LTPA 3MP3A 5K2ZA 4WY0B 3EWZA 2DZSA 4NJJA 1VQTA 2ZZ2A 4CCEA 5F1UA 1TMHA 1JRBA 1L6SA 5TIMA 3TCEA 3FJLA 3LCGA 4WXZA 3GNNA 5FEPA 5DCEA 2VFGA 3EX1A 3G1YA 3TK7A 4Z1AA 3CIWA 3QW4B 3OEXA 1THFD 3LXBA 2C0AA 1OYBA 1M5WA 2DZXA 3ELFA 3FOKA 2W79A 4QM1A 3W6YA 4ICNA 3NO5A 3QMRA 4UTHA 3HF3A 3SECA 2AAMA 3W22A 1QO2A 5DXYA 5G4WA 4FEZA 4JEQA 1FWSA 1KLYA 5C2XA 1VC4A 2ZRYA 1O94A 1W5OA 5EKYA 4N6FA 3N2MA 3VKJA 4NJHA 3HPXA 3KFTA 3TXZA 4LS0A 4JX5A 3A9IA 4R7JA 1P1XA 1X7FA 4HSOA 1TPFA 5LNUA 2G5WA 4UTLA 3MJYA 4LS1A 1H1ZA 3WK3A 4QJ1A 3G1SA 4O0ZA 3EB2A 1XUZA 1GTEA 4MYXA 2FTPA 2QCDB 1QMLA 3MHGA 4AF0B 1YTDA 1KV5A 3M1ZA 1QFEA 3FYOA 4K38A 1I2RA 6ALDA 2X1RA 1VPXA 3WJYA 4M7SA 2RDUA 2QDHA 5DCDA 2LLEA 5DBTA 3NZRA 3PBUA 4UXDA 1LOLA 2FJKA 4E38A 3P5ZA 2NUYA 4NJKA 3WK1A 1O60A 5HUPA 3LHTA 5LNRA 4IMGA 3O05A 1T96A 3T55A 3LHWA 1EX5A 3IIZA 1R2TA 1WV2A 2UV8G 4HHPA 3BK0A 1JCNA 4UNLA 3H53A 4BFAA 5FF7A 4JTHA 1TPVA 3MYOA 1LBFA 4W9TA 4OT7A 2FB3A 3RK8A 1QO5A 1GG0A 3MMTA 3EKLA 1I2PA 2F84A 2H8ZA 1LBLA 4KKXA 1RZMA 2XN2A 3I68A 4MY9A 3VCRA 1PV8A 1TPB1 1TTIA 1I8JA 2CLEA 1KFBA 5E1QA 4MYAA 4X2RA 3R13A 3B4UA 4OWGA 1G4EA 2Y63A 4A21A 4UFKA 3W84A 2I1OA 4O11A 2V82A 1SU5A 4MUZA 1H7OA 4IMDA 3MI6A 1TQXA 3OBKA 4U4MA 3BG9A 1DQXA 4FNRA 1VZWA 4OE7A 1PS9A 3VE9A 1TTQA 4I7VA 4JTKA 1TYGA 3S1VA 2OCZA 4HT3A 3W7KA 4JTSA 1YDVA 3M44A 2B7NA 4H3DA 2CWNA 2ZTJA 2W0UA 4N4PA 3HQ1A 2Y7DA 3G1VA 1KM1A 3UD6A 4IPJA 2ZBTA 1SZEA 2C6QA 4TIMA 4BI7A 1I45A 1S5TA 3GNDA 4A2SA 1TTJA 1WQ5A 4K6AA 2GPTA 1JUEA 2FIQA 5CPLA 1W5NA 3P82A 1OG0A 3ABRA 5FEXA 3NVTA 3TA6A 5CG7A 2YYUA 3LX9A 3V75A 3LTSA 4UFJA 1PVNA 4C1LA 3VE7A 1X1ZA 5I3FA 2YZRA 1N55A 2CLIA 3G1AA 3W9ZA 4WY0F 5H2ZA 1C8VA 2Y6ZA 4LOCA 2YW3A 2WPBA 2JGQA 2C19A 1QDSA 3CIXA 3VNDA 3IGUA 4AH7A 4MKNA 5HMSA 5D32A 2JKEA 3THAA 3WJWA 2YCEA 3TNOA 4N02A 2FPYA 4GNJA 1TPEA 3NAVA 4EVZA 1JJKA 2NV1A 5TQLA 4DF2A 3ABQA 4UTKA 4JR5A 3UWUA 2E6DA 1F76A 4XTIA 3U6WA 4BF9A 2H8XA 1WA3A 1G6CA 4O1AA 5F2GA 2E6AA 1H62A 5AC6A 4FX8A 2VKZG 3NQFA 3FJ6A 1I4NA 2QUVA 2BZNA 4O4WA 4MLRA 2Q8ZA 3KRZA 4O14A 4BWLA 4LVBA 1TREA 2ZZ4A 3P61A 2V2CA 3DHFA 2E77A 1LTDA 1Q6RA 5FI8A 1Q6LA 2FLIA 2QR6A 3MI3A 4MY1A 5F2LA 1U83A 1XBVA 2B7OA 4IOTA 2YSWA 1TJRA 3QF0A 2WOQA 5CKSA 5I3IA 5I3GA 4LT9A 1QPNA 5CSSA 2GVJA 2Q3RA 2RKXA 3TJLA 1GPWA 4AMAA 3LBMA 3W1AA 3W1PA 5TBOA 1H1YA 2Y89A 3PB2A 3LRKA 3DHDA 1LOSA 4CCCA 3NQMA 3MP4A 2YFOA 4A2RA 3NYZA 3SGUA 4I7UA 1ZAHA 1AW5A 1BEUA 5U7SA 1F74A 2QCEA 3BLIA 4H6KA 2QCGA 4OV4A 4RCXA 3NG3A 3IIVA 1OX5A 4NNCA 4LNYA 4Q32A 3MHFA 3NR0A 3LI1A 1DOSA 1GG1A 1OJXA 3L66A 4Z1CA 4NNAA 5L6UA 3CEPA 3W7NA 1B9BA 2QDGA 3M5XA 4CQAA 5K9DA 3INPA 2EAWA 3KRUA 3KVJA 4KFOA 1RPXA 3TMLA 5LNVA 3S1WA 2I14A 3ZFHA 3G18A 5MHBA 2XN1A 3KRSA 4O19A 3PG8A 4WQ6A 3QH2A 5EL1A 1F7BA 3DXIA 2QJHA 3C0JA 1L9WA 1EIXA 3A5VA 3I7QA 3L0NA 3W1LA 2OJPA 3TSBA 4RZ6A 1NFBA 3W7QA 3CWOX 4DO6A 2ABBA 4UUIA 1H7WA 3ZR4A 3I65A 1F05A 3FEMA 3PF3A 4AWSA 4YXGA 3W2JA 4JD4A 3W7PA 1RR2A 5BOOA 3KVKA 2O7SA 1PHQA 1DQWA 2DU2A 1TRIA 1W8SA 3DFSA 4CLMA 3UPWA 4UFMA 3S5OA 2V5LA 4HNTA 3L21A 4DPPA 4Y90A 3W7OA 5G4EA 1OX6A 1VHNA 2Y70A 4GXMA 5DN1A 2A1YA 4O57A 1LLWA 3W2NA 2DJXA 3DI0A 3M0ZA 3JRKA 1KM0A 3TFXA 3P60A 1TJPA 3KX6A 2R91A 1O5KA 2CLLA 3U2OA 3F1QA 1JCLA 3NQ6A 2RDTA 2DORA 4JYFA 3M5VA 1LORA 2ABAA 4O53A 4E2DA 5D2WA 3G0UA 2DP3A 1DBTA 5DY2A 3PBVA 2ZQ0A 3QSRA 1KFCA 3EXSA 1LRNA 1JCXA 1KLZA 1VRDA 1PCKA 1W0MA 3SGZA 2J27A 4JDYA 4L4LA 1QPQA 3W1NA 1A50A 3W7MA 3BG3A 2A7NA 1RV8A 4YL2A 1J5TA 2Z6JA 5EBUA 3W7RA 3C2EA 1XBXA 2Y7FA 1F73A 1PIIA 2DZVA 3PY2A 2XFWA 1K02A 1U5JA 3T78A 3MBFA 3W2UA 3Q37A 1AW2A 3N19B 4AHOA 4PL2A 1D3HA 4FX7A 2E09A 2OMAA 2C18A 2J24A 1HG3A 2A2IA 1OYAA 3P8JA 3GXNA 4CNPA 3GDKA 3IIOA 2V2HA 1H7PA 2VENA 1IIGA 5F2IA 1F2JA 2NX9A 3IV3A 3O6YX 5IBXC 2GQAA 4QIUA 4LVDA 5C55A 4POCA 4LW7A 3LHYA 4O54A 5CZJA 1UASA 5G1TA 1FX6A 1AL7A 3G1HA 3HGSA 2WO5A 3TX9A 1SW3A 3TC6A 4N9CA 4XZ9A 3EX3A 1VR6A 1OFAA 4E0CA 5FEZA 2C14A 1GYLA 4MJMA 5E93A 2FPVA 1NSJA 1S5WA 3TSDA 4O8RA 5BMWA 1GVQA 5FF3A 3PBWA 5K3VA 2TRSA 2B0MA 1ZFJA 2WNQA 2X1TA 2CZ5A 4A3UA 2YDAA 5AHFA
chains in the Genus database with same CATH superfamily
1CX9A 2RUSA 4PSRA 2CHRA 1UUQA 4IIBA 3RILA 2B4GA 3AUJA 3T8LA 1VYSX 4AVOA 1SUXA 2V3EA 3MKVA 2ACQA 3T8QA 3VMPA 4PC8A 2J75A 3THQA 1GWJA 1L0PA 4JGDA 4RV8A 3L4UA 3NTYA 4H9TA 4ASTA 4C60A 3K8LA 4ADTA 4YHGA 3W24A 2GVLA 5BXSA 5LGZA 4E5TA 3FDKA 4TMCA 3FIGA 2GQ8A 3KDNA 2NX1A 5D9MA 4DJEC 1V6VA 1QNQA 2G95A 4XTDA 2V6AA 5E0KA 5A2CA 3TJIA 3OIXA 4HNUA 4IFOA 3MU7A 3GDLA 4IQEA 3WNKA 1CXIA 4GVGA 2VQUA 3LM3A 4S39A 1ISXA 4JX6A 2IQDA 3O1NA 3LMZA 4DLMA 2Q02A 1W9VA 3AZSA 1EJXC 2VFDA 3VOFA 4L4OA 2GJXA 3L4XA 2R1MA 3SCPA 1MUCA 3RX4A 4C6EA 4JICA 3RAOA 4XZWA 1QATA 2Y7GA 1KKRA 3P81A 4DWSA 1IR1A 5EA9A 4PEKA 1GZGA 2VC5A 3ONBA 5EBAA 5HAOA 3IARA 1FXQA 4XIMA 1VRXA 1YNYA 5D8ZA 1SYTA 1GVRA 3N2TA 1UKSA 4XD6A 4XZHA 5FACA 1CB7B 4I8DA 2X0YA 4RE0A 4EOUA 4W8BA 1YRRA 2PDPA 1XLAA 3WJXA 4GZIA 1GEQA 5IBXA 4XAZA 4DJED 1XDLA 3B8IA 5DMLA 1FH7A 3PR2A 4MFDA 4YTTA 1UZ1A 3GR7A 4PRTA 2WZMA 4YVPA 2OKTA 1FWCC 4MSSA 1C8QA 4HNVA 4MZYA 1WKDA 3GB6A 3KW3A 3RO8A 4S2BA 1D2KA 3A9BA 4DM2A 1XQLA 2JKAA 1X97A 2ZZ5A 3GG1A 4LB3A 4PN2A 2EGZA 4JHOA 1CGVA 2V3FA 1H63A 2PDKA 2RH9A 3EWCA 3SRKA 1EL3A 3DI1A 4ZE4A 5IDZA 1E40A 3QMSA 2QUMA 2WVUA 1XGZA 1MNSA 2PUZA 1RY0A 1FWIC 4H8NA 4E6MA 4B9ZA 2D0GA 1WUFA 4Q8MA 3W3OA 3NQDA 5FESA 1JD7A 1W1A1 1TRDA 1BYAA 4DJEA 4QITA 1E70M 3B8VA 1FFQA 3ZJ6A 2X2YA 3KTCA 2XPKA 3H4GA 1TQJA 4XSLA 1OB0A 3QHOA 1K9DA 4JKLA 1FP8A 1QBBA 4PMQA 2VFFA 5XIAA 4GWEA 2XYLA 3ANYA 2DJLA 3A3WA 1QW8A 3BLLA 3B8WA 4REQA 1HF6A 4DNHA 4K8EA 3NJ3A 3S0CA 1HL8A 3HQNA 4BQ3A 3VFLA 3ONCA 4M6QA 1WZAA 2ZYFA 3B06A 2FJUB 3LI0A 4EIVA 1LQ0A 3R0UA 3V3WA 1QOQA 1M04A 3VCNA 1OGGA 4PB5A 3GNOA 3H4XA 4AD5A 5D4YA 4ZODA 3VGGA 2VYOA 4O1FA 2WSRA 1NVMA 3VGDA 1HVXA 3ARVA 1JNEA 2WJZA 2BWGA 2VUYA 3M41A 3E02A 4U10A 4A29A 3GG0A 3W1RA 3AS0A 3SCTA 4IQDA 1F61A 4U31A 4AG0A 3L0KA 4HP5A 1KV8A 2RDWA 1TCDA 3NYDA 1JYXA 4RR4A 5I7GA 3PNZA 2P0OA 1YKWA 4LY8A 3SN4A 4PTWA 3TN5A 4UQBA 1BVWA 3IGSA 4IG2A 2JF7A 1V0KA 3CYJA 3ARPA 2PDXA 4JCMA 4YTQA 4PCSA 3RRXA 4ATLA 3ARUA 4UWMA 4L6OA 4X3ZA 5JVLA 5CSRA 4D6JA 1R8LA 3ZXWA 3LXAA 2D3NA 1TB3A 4ZQOA 1WXYA 3ZO9A 2Z27A 3PULA 3TW6A 3B03A 4IGSA 4UR7A 5M17A 4MWAC 3UJSA 1E0TA 4Y8FA 4GHRA 2E5DA 4ERGA 1TJ0A 1CT5A 1MQPA 1E15A 1VP5A 2ICSA 1I2OA 5C9UA 1W32A 3NPXA 1FRBA 3GAYA 3NXFA 4J28A 1HJQA 4UNKA 2CLOA 3L2MA 5J5DA 3O2LA 3FY1A 1TV3A 4KETA 2WLZA 2VGFA 1Z44A 4ZBCA 4HTYA 3NM1A 3QLDA 3LNPA 2ESCA 1L6WA 3VKCA 1MEIA 3MO4A 2WK2A 3LPFA 3RPMA 4OBTA 2DGAA 4PB4A 2BNJA 4W87A 4F66A 3GTXA 3ITVA 1TWDA 1R2SA 4JCLA 3ENLA 1OT2A 1DVJA 1JUKA 3DECA 1M7JA 1PJ9A 1KGXA 2HPMA 1VIWA 3RMJA 4W5UA 3M5YA 8TIMA 4NSBA 1ADSA 5C9WA 3B9OA 4CQDA 2DSVA 2OGJA 3PPGA 5C70A 4CNSA 4UCGA 2BVYA 1R46A 3ATZA 4AYSA 1V6TA 4IQJA 3UYCA 3O3RA 2EPOA 3UPBA 3PZGA 4RZ5A 4M19A 1XRTA 3VAVA 3QOMA 2QJNA 3IVSA 2SFPA 3KBWA 3KUMA 3TMQA 2E6FA 2V38A 2YDQA 1IHIA 3PNUA 4IXXA 1TPH1 3IEBA 3GRIA 5H1WA 2TYSA 1E4LA 3N9RA 4HMNA 4OBSA 3SO7A 2WSQA 3IGHX 1IWBA 1DYSA 5G1MA 4HPJA 7CGTA 2REQA 2CHOA 3H55A 1GYNA 3ZVIA 1N2VA 3N04A 2CXGA 2PTDA 4NU7A 1WAUA 4PMDA 3PTKA 2E9BA 2YB4A 3V7PA 3DFYA 3TU9A 4AF0A 3W72A 2PP3A 1U1UA 8CGTA 1XCFA 3OVRA 1Q6EA 4PMOA 4JQ3A 2D20A 1R9ZA 1FA2A 3W7LA 4HPGA 1H3GA 1W2VA 4MWAA 3S1GA 1KFJA 3GX9A 2E9MA 1KW1A 4UQCA 3NDOA 4CUCA 4O17A 3GVRA 2DEPA 2CEQA 1DJXA 3PZIA 3PZVA 2XN0A 1CLKA 1BQGA 3WYZA 4IHCA 1U2YA 2OU4A 1GVFA 3ZR5A 1X96A 3ZWSA 4ZB2A 1U1HA 4IFKA 3BWWA 3EEZA 2H90A 5LSMA 3OG2A 3ZQ9A 3UWZA 4GCAA 4DYJA 2I7GA 3CWNA 5I09A 1S5NA 1OM0A 3LGDA 1XLLA 1W31A 4WJEA 1KBJA 3NIYA 1SO4A 3UWVA 2QCMA 4LUTB 5BW6A 3LERA 4IWWA 3KOFA 3NZPA 3CB3A 3BCJA 2A3EA 1LRTA 1UWUA 1O12A 2P3EA 2PWDA 2QCHA 4O13A 4PULA 4PMZA 1X6UA 2PRLA 3W7CA 1GNXA 3CLWA 2ATMA 4EPDC 2B81A 5JUVA 1AZ1A 3S47A 3H2NA 1H11A 2ZA1A 3TTOA 1W54A 3G6MA 1BXNA 4HMEA 4DWDA 1SZFA 4IGHA 2A85A 3DFNA 1A3HA 4PL1A 1H5VA 4KS0A 1NH6A 1FHDA 3H7RA 4GZ7A 4DUOA 1UUOA 5HUOA 4AD4A 1OF6A 3GXTA 1ECEA 4JY8A 4ZVJA 4CKQA 4WJXA 1B9ZA 2X41A 3QRHA 4WSJA 5J8LA 3W7EA 3DFPA 5LA2A 1IE7C 3W86A 1LP6A 4PBFA 3EWYA 1W3LA 4B3KA 3W7IA 2P5NA 4KW2A 4DXXA 2OELA 3QQ1A 3WLPA 1ENUA 4GQBA 3H6OA 4E4FA 4NHVA 5JIPA 2L5HA 5IHSA 4J3ZA 4N7QA 2JIEA 3VM5A 3XISA 5B7YA 3O8AA 2PAJA 1UIPA 2D1ZA 2XH2A 1Z32X 3QGAC 2WZHA 3WN6A 1TFVA 3B8SA 2DZTA 3PSVA 2W67A 3Q67A 4AZBA 2W62A 4WRHA 1JZ8A 1GVOA 4IUOA 2GSHA 3P2VA 3S5YA 3VZXA 3L5LA 1H1NA 3TA9A 3SJNA 1SJBA 5CAHA 4IJCA 3R58A 1QPRA 2AL1A 1YYAA 4AAJA 3E74A 3DUGA 4MDPA 3KBNA 3SSJA 2QJIA 5H8PA 1BQCA 3RU8X 3H26A 4KWSA 1OYCA 5EY5A 3CT2A 2DT0A 1Q4WA 1Z48A 3M9YA 3W71A 1MW2A 3N11A 3B0UX 1D8CA 2HXUA 5C8BB 1ZTVA 1ICQA 4BWLC 4H9YA 5G5IA 3W0KA 4KEMA 2W9MA 3SBFA 4WSKA 1BG9A 4PMNA 4MZ1A 4DXKA 4HU4A 3K2GA 2XTKA 3WQGA 5IHRA 1SMAA 2X0SA 3KZPA 4F9DA 4HJFA 2OT0A 1XIIA 5LGXA 3LV6A 7PTDA 4I9AA 3STGA 4KCTA 4WEVX 4U2ZA 2RGLA 3T6CA 4D6IA 3TZFA 4GX8A 2NV2A 3E2VA 2A21A 4PGLA 1FDYA 1P43A 1UA3A 2BXVA 3P8IA 1O66A 4GY7A 3VABA 3BUVA 1G94A 1NDWA 3MMWA 5I5RA 1RSCA 2JQXA 3VYLA 4RNIA 1OFPA 5I2UA 1XFBA 4LALA 1EJWC 2ZDSA 2V5DA 3A4XA 1U5HA 2HK1A 1NFPA 1XLIA 1XCXA 1HT6A 3A3XA 3MDWA 3WH7A 4OJYA 3LHUA 5D33A 4O52A 4MF4A 3W02A 1UROA 4CCDA 2UY2A 3BGJA 1QCWA 4IX2A 4MJZA 1ZB5A 3VI2A 2XVGA 4L6HA 3GO2A 2Z29A 4PFMA 2TODA 3P62A 2GJLA 1UMLA 3QR0A 4WIWA 4ACZB 2B7QA 3WLHA 3DYOA 1DJGA 4UTTC 5M03A 1V0MA 1C9WA 3KEHA 2A0NA 3SRFA 1B5TA 3W25A 4H7ZA 5C2GA 3H22A 2ZUVA 4OHQA 1OWQA 2GLKA 4LYKA 2C13A 2J25A 1MRAA 1VJIA 1FWJC 1H4PA 2QS8A 3AYTA 4I90A 3F4NA 1Q63A 3T42A 4FNQA 4QJ5B 3GS6A 2AQOA 2X1SA 1PZ0A 1GJPA 5ECUA 1WOBA 4J3UA 1UKPA 1JDAA 3SI9A 3NXLA 1VLWA 4K39A 3S6OA 2HMCA 3TTSA 4QE1A 1QBAA 1BTCA 4QFUA 4NYYA 1AJZA 3SFKA 5AYYA 4S3AA 3CAVA 3EMZA 4ROQA 2VP8A 3MVTA 4YWIA 4DNMA 3OA3A 4L4MA 3PS7A 2GUUA 1UJPA 2Z7GA 3AXMA 3DH7A 3P0XA 3UWYA 1ZP3A 1OEPA 3WD0A 3DHUA 4XG1A 4KWUA 4Z1BA 2YDRA 3AIBA 1O5XA 5CPQA 3FW6A 4D71A 2HXTA 4ZOBA 3PUDA 4Z0JA 4ZQMA 5U4NA 3AIWA 4GIYA 4AC1X 3UXLA 4WDXA 1MFVA 4MAZA 4WGXA 2QUUA 2J4GA 3CJPA 1QHPA 1YPXA 1ZBWA 3N14A 1A5KC 3P67A 3FVDA 1BKSA 3PPFA 1JDDA 1NY1A 4ZL1A 1JZ2A 3FJNA 5BWFA 3L65A 4EXQA 3GKAA 5C0QA 1IEVA 3W73A 2PDBA 4H1ZA 2ACUA 5D38A 3VNIA 3TYAA 1PTDA 1GT8A 2VCBA 3M0YA 3C61A 3NOEA 1WNOA 2VNCA 4GQGA 3PTQA 2GDQA 4PUKA 5ABFA 3MSGA 4B5WA 5E09A 1IXQA 3QGVA 4G7EB 2PGFA 1K8XA 3EX4A 1OFRA 2WM1A 4RDZA 1KR0A 1AQMA 2VCCA 3GXMA 3UXAA 1AQFA 5T8GA 3BDKA 5XINA 1JPHA 4UTTA 4PMVA 4IP5A 4AYGA 3M46A 3MCOA 3NQ7A 1FCQA 1FWEC 1KC7A 4EAMA 3Q58A 2V5JA 1FCBA 2A3BA 4JFVA 1V3HA 3AIEA 3CUGA 4RZBA 1VEMA 1J12A 4LCRA 4TV6A 4WLCA 1JI2A 3CUJA 4AFYA 3SCUA 2E1DA 3EPOA 4L5ZA 4V1YA 3URQA 2ZRXA 3EWXA 3JZUA 2VRKA 1Q6OA 4L64A 4UTUA 2YCLA 5HA7A 3A24A 1Z9AA 3NQVA 3WLKX 5KZEA 4HN8A 4BCEA 5AC5A 1BWKA 1KWGA 3C0QA 4Z2IA 3QLLA 4MLJA 2PWGA 2Z28A 2OWXA 4Q7BA 1DJNA 2WVVA 4JHZA 4G2DA 2FMNA 2PDGA 3QZAA 3FV9A 3UZYA 4DJDC 3FCPA 3QTPA 1DQUA 1NM9A 1CZ1A 1UWRA 4H9UA 2PC4A 1BYCA 2INEA 5CZ0A 1XYLA 4RLIA 3F5LA 3TDFA 4LV4A 3WDQA 4ZQRA 1Z41A 4GISA 1Q6QA 3CZJA 1EWEA 1SR0A 2HVNA 4OU1A 5BRBA 4J2PA 2PGRA 4XKYB 2PTYA 1TUFA 4HD5A 3L5AA 2PWHA 3MSYA 1K7XA 3WD1A 1PZ2A 2ZTKA 4WUIA 4FIRA 1J93A 5D9OA 4YNGA 3DENA 2D24A 4YYFA 4Q33A 2PB1A 1EH9A 1ZJHA 4G6CA 3L7RA 4AZIA 2Y61A 3T0CA 2QDDA 4B3LA 4DO5A 2ZZ3A 4A35A 3GXPA 4RKAA 1P6WA 2XIOA 3BARA 2OOFA 3WMSA 3RR4A 1TZ9A 2F6KA 3SCOA 1LWJA 4EK7A 2DZUA 3CQKA 3S2MA 4I5UA 3EA2A 5TNVA 4I5XA 3O6DA 5BOEA 1DJZA 5A8NA 1YE4A 3QKEA 1QT1A 4IPIA 3WBYA 2IPWA 2AOSA 1OX4B 2A79A 2YBTA 2CERA 1CGTA 2WNZA 4N0RA 1AVAA 1HO1A 3WBAA 1KBKA 1WCGA 1TWIA 1YMYA 1QI2A 1YPIA 2XZ9A 3GK0A 2NW0A 5CJNA 1CWYA 2XIJA 4F0RA 5A2AA 4Y9NA 4UTFA 3CQJA 3TE9A 2PTXA 2VZVA 3T08A 2PTWA 3QZEA 2ACRA 2J7HA 1WDRA 3BSHA 3ZVHA 2XFFA 3EWZA 1VQTA 1E1CB 4MNJA 1JRBA 3RITA 5TIMA 4JIIX 2VDGA 4LPCA 3GNNA 4WXZA 2W27A 4G8TA 1TWWA 5BRPA 4Z1AA 3FSUA 4KGLA 4X0VA 3RMEA 1FWHC 1P7TB 3O6AA 2HNHA 4S3CA 1XS2A 2DZXA 4ILSA 3ECQA 4MNKA 2GK1A 4F0KA 3NO5A 3QMRA 4DJDA 3C8NA 2OEJA 3QY8A 4ZO6A 4C91A 5G4WA 1P0EA 1TV4A 1W9PA 4F2UA 1KLYA 1D7FA 1XLGA 3CHCA 4GACA 3HFTA 3OZPA 1E6SM 4FOUA 3N3TA 1A80A 4X63A 2FHBA 4LX4A 3A9IA 1PO9A 3MA8A 1TPFA 3N12A 5C9ZA 2PZNA 1H1ZA 3G1SA 3URNA 4O0ZA 5CPSA 2QCDB 1QMLA 3MHGA 2W63A 1YTDA 4XAYA 2XSAA 4V15A 2HRWA 2RDUA 3NZRA 1O1HA 3F7JA 4QCEA 1XIMA 3PBMA 4NJKA 3K8KA 3WK1A 1O60A 3D6NA 4IMGA 1UKQA 4GI6A 4OZOA 4EE9A 4BFAA 5M3WA 1Q4NX 1LBFA 4W9TA 3RK8A 4GVHA 2BHUA 1I2PA 2FZNA 2WMIB 1PKYA 1V08A 2H9AB 4MY9A 3VCRA 4LYPA 4E4UA 4IPNB 3WFLA 4OUIA 1RBLA 3WD3A 3R25A 4QJ3B 1I8JA 1KFBA 4MYAA 1P6CA 4JFTA 4JQ4A 1AD4A 1KQYA 4X2RA 1JEZA 3W84A 2I1OA 4O11A 3B9NA 2ZUWA 1H7OA 3UR7A 4IMDA 1IT7A 1H09A 4U4MA 2E8YA 3BG9A 3VC6A 3DX5A 4OE7A 1UR8A 3BZGA 1PS9A 3PZOA 1CGXA 1TYGA 5IRPA 4ML4A 4HT3A 3W7KA 4JTSA 1YDVA 3WCZA 3K1DA 2CWNA 1OCBA 4N4PA 2BHZA 4B5VA 4TTUA 3UD6A 2ZBTA 3ZMRA 4JKKA 3T05A 3IUIA 3WEOA 4EXAA 4HQVA 4DAIA 4AIEA 1ISWA 1S5TA 2CBVA 1W9XA 4A2SA 4H2CA 1WQ5A 2PMQA 2V5CA 5CPLA 3BTNA 1OG0A 4F40A 4AW7A 2YYUA 1EC7A 1E6PA 1RJQA 3ID7A 3VE7A 1X1ZA 5I3FA 2CLIA 4MNLA 1C8VA 1J11A 5FJRA 2CPUA 3PWIA 4H9VA 4RDVA 3VKAA 3IGUA 4A05A 4GNJA 3DYPA 1JJKA 3S6TA 1EXBA 1UR3M 1KGUA 4DF2A 1Z6KA 4UTKA 4JR5A 4LYRA 3UWUA 1PX3A 2GYIA 1DPMA 1WA3A 1G6CA 3NDYA 1XSJA 4AX6A 2QUVA 1W1B1 4MLRA 4Q6JA 4LUSB 1WAWA 2E77A 1LTDA 1Q6RA 4V28A 1Q6LA 3S5SA 4MY1A 4AZ6A 4XVDA 5F2LA 2VEFA 3VCCA 2B7OA 1J79A 2W66A 4CQBA 3VIIA 1QPNA 5CSSA 1Q7ZA 2NSOA 4LEQA 2RKXA 3F5JA 4B2DA 5LIUX 3APGA 4AMAA 1DIDA 4HZ6A 4LXFA 2DUZA 1H1YA 1JGMA 2C91A 3WBWA 3DHDA 1LOSA 5I00A 2DW6A 3NQMA 3NYZA 4AZ7A 2HBXA 4M80A 2XDFA 4OTKA 5CSUA 1FVPA 1NFGA 4NRSA 2F2HA 2OGYA 3BLIA 1A3WA 2HBVA 4H6KA 4BF7A 4DI8A 4NNCA 3T2OA 2WVSA 1LUCA 4AVNA 3NR0A 1W91A 1U30A 2DT1A 3M0MA 1OJXA 3LU2A 4Z1CA 4D6GA 2INFA 5L6UA 1B9BA 6REQA 3M5XA 4CQAA 3D46A 5FAGA 3QTGA 3WDIA 3BZJA 4GIAA 1VBGA 3JW7A 2PPGA 3PG8A 2NQ9A 1XLKA 4C7GA 2DIEA 1GKRA 2V68A 3DEQA 3C0JA 1V3MA 4U33A 3I7QA 4JQ2A 1W1VA 1UP2A 2OJPA 3AALA 1EBHA 3J7HA 1NFBA 3CWOX 4UUIA 3ZR4A 2VWSA 4KGJA 1XLJA 4GO8A 3VIMA 4Q8TA 3KVKA 5C2CA 1TRIA 1W8SA 4MTVA 4AD3A 1E1FA 3UPWA 1RJRA 1ISYA 4ZOAA 3UEQA 3HV9A 1PDYA 3GW0A 2JE8A 4BQ2A 1KR1A 1WB0A 4JTDA 2CBJA 4DPPA 2J8TA 4KERA 1UZDA 2FYMA 2QT3A 5AY7A 2AAAA 5KEZA 9CGTA 1QTWA 4FXJA 1WZLA 3FGCB 2D2JA 1V79A 3NDZA 3DG3A 1UJQA 3N6HA 3TQPA 3F1QA 3NQ6A 3EDFA 4JYFA 3I4EA 1LORA 4O53A 3GBEA 4FLOA 1YQ2A 4E2DA 1YNPA 4JIEA 4B15A 5HQLA 1DBTA 1KFCA 1LRNA 5CQ1A 5BCAA 3UT0A 3SGZA 3PZUA 2QGYA 4QCFA 4JDYA 4AD0A 3W1NA 3GR4A 3VDCA 5AKQA 3W7MA 2A7NA 3QHMA 3RLHA 3W7RA 1J5TA 4D6FA 4ZO9A 1GQLA 5REQB 3MUY1 1PIIA 3W81A 4H8VA 4F8XA 1U5JA 3Q37A 4BJHA 3N19B 5CBJA 1IWPA 3VNZA 1HG3A 2A2IA 1HGYA 2PDWA 4WKHA 5EMJA 5CPTA 5A6JA 4QEEA 2V2HA 1FH8A 2VENA 3AXHA 1GCYA 2C1IA 4J40A 3NZQA 2NX9A 2GUBA 3O6YX 4IIEA 3T1GA 4UCFA 5C55A 4POCA 3ES7A 1DWJM 4O54A 2Y8KA 4M1BA 2WO5A 4O0QA 1SW3A 2PDHA 1FTXA 4BS0A 4C6MA 1OFAA 4EPKA 5DRCA 2C14A 1GYLA 3REQA 4WJ8A 2GGIA 2E7FA 3KBJA 4D8LA 2VZSA 2OQYA 5BMWA 3TW9A 1GVQA 3UYIA 4J7RA 1R3TA 4KEVA 3IRSA 3HPFA 1KO0A 3CHDA 3GE7A 4KWOA 2YCIX 4NL1A 4GINA 2TRSA 4KCWA 2WNQA 6PTDA 1ONEA 3KHDA 1BVZA 3WO8A 1B3WA 1JYVA 3T09A 4V27A 4RPQA 3E96A 3E2RA 3TJXA 4ZFCA 3OLGA 4AHPA 4E8GA 2I16A 4IX0A 3W7HA 1Y65A 4XD4A 3BVJA 1ODUA 3FKRA 5HR7A 2C16A 1XH1A 2O4MA 2OZ0A 1ZPTA 1WZKA 2A6NA 4BI6A 4NX0A 3VNMA 1EJSC 4PTVA 3CAQA 1KRBC 3GU2A 4LSBA 4DYEA 4N9EA 2GOKA 3QV9A 4C1NB 1ELSA 4MY8A 1VCVA 1B0IA 4Z08A 3RCYA 4QR6A 1MDLA 3W1UA 1X39A 3CUHA 3SUTA 1QPOA 1KM3A 2WJFA 4D8AA 1VFSA 1A5SA 2HSAA 4CNOA 4C5ZA 1XLBA 3IJ6A 7TAAA 1PB0A 4AUBA 3W4RA 1YNQA 4QISA 3BV4A 3KVMA 1W3HA 4IJRA 1ZBCA 4NYUA 3BH4A 3WF4A 1VPYA 2QIIA 2NQJA 2A7PA 5DY3A 4QS6A 3W1TA 4HNCA 4LC6A 1SQ7A 3W2MA 1SPQA 2DIKA 3AIQA 4UMBA 3GDTA 3LZ3A 2PURA 3HG3A 1GKQA 4PCNA 4JTUA 1EF2A 1OC5A 2ZX6A 3VINA 1UR4A 3W1MA 2OTDA 4F79A 1Q65A 2OXNA 3TROA 1B30A 5HQEA 4PTXA 3WL0A 4RE4A 2H3BA 5FJOA 1BKHA 3DZ1A 3AHXA 4NX5A 3DC8A 1UR0A 3QV8A 4QROA 3TW7A 3H2CA 2OSYA 4HK6A 2BOEX 3GQYA 4XBJA 1ZJIA 3IK2A 1B3YA 3LK6A 4TO8A 1OIMA 1WPCA 2J8GA 3S5NA 2ZVIA 1O7AA 3A47A 2QAFA 1BG4A 1OK4A 2BOFX 5HJYA 4J2MA 1CTNA 1MZRA 3WK2A 3WUEA 1CW2A 5BNKA 3NL3A 2VOMA 1ZENA 2D2HA 3W87A 1TE6A 4YLWA 2YX0A 2Q6ZA 3GBDA 3CK5A 1H7XA 4OUEA 3N13A 4CU7A 1ALDA 4HK7A 1B57A 4ML9A 2YL9A 5LZLA 1QXLA 4QDPA 4CD5A 3HMJG 3STCA 3OVGA 1IEXA 2JEQA 4F0SA 2YBUA 2VL4A 4CQCA 4WX2A 3NA8A 3CC1A 1P1MA 1XRSA 4JY9A 4LUIA 2ZXDA 3RJYA 1GW1A 1GTHA 4KFPA 2ZDRA 4C6BA 4XWUA 5G2WA 3K13A 4INFA 4XO7A 1EJ7L 4DHGA 2Q09A 3C6CA 2XWDA 4HHMA 1UCWA 7TIMA 1Y0EA 4JIPA 4AY7A 4QRNA 3CPRA 4O1CA 1WYIA 4Q3MA 2FQIA 4DF1A 4QAIA 1XIJA 3FFSA 1MW0A 3WUFA 1TSIA 4LEFA 3NQ2A 2YL6A 4HZMA 3KCJA 5K9CA 1KXVA 1AJ0A 1V0NA 3HPAA 3N18A 4ADUA 4Q22A 3ABSA 4RNFA 2WQPA 1NDVA 3WD4A 2X30A 5GJPA 4W88A 3CS2A 4QNWA 4WDWA 1M1BA 2TMDA 5E9XA 4A22A 4Q6XA 3E12A 3N3MA 3E0IA 1CENA 3IAQA 3EGJA 3II1A 2QCNA 1UB3A 1PUDA 5EYWA 4G7FA 3C5QA 3G0XA 1H50A 5HPCA 3UQNA 2UWFA 1PTGA 3RLVA 2NUWA 1DJHA 3GG7A 4R7WA 4S3FA 1TA3B 3NPWA 2JK2A 1DHPA 5LA0A 1BD0A 2OLAA 3HBLA 3DKLA 3B40A 2GDVA 5D04C 2O9RA 3QXBA 1ADOA 3PBGA 3GH4A 5DXXA 4HIBA 1FP9A 3WL1A 3DGBA 3FNDA 2PFHA 1MZHA 1PZ3A 4B5XA 3EEGA 1EQCA 1ISZA 4E4PA 1J0HA 4BR1A 3EDJA 4NVTA 4XB3A 1IEIA 3QHNA 2ZA3A 1JPDX 2BTMA 2YKKA 4H7VA 4Z2LA 1Z89A 3G1FA 4HTBA 3K30A 3QOKA 3E3HA 4FF5A 3WBEA 3POHA 4NNBA 5D2YA 1DV7A 1K6AA 4N9BA 3T9PA 4FNUA 4EXBA 2BXZA 2WB5A 2YDSA 4QEHA 4H01A 5JBEA 1ICSA 5AB3A 3TAOA 3C3NA 2VJXA 4C1KA 3GLCA 3XIMA 5CAKA 2XIQA 3W7GA 3AHZA 3CIVA 3PUOA 2I9UA 1ONWA 4KRUA 5I06A 2EHHA 1QHOA 2UY3A 2AKZA 4QDMA 4P8VA 2NV9A 3LTYA 2Y88A 4LV9A 1T99A 1MI3A 2NVAA 4DN1A 3MC5A 4I7WA 1JRCA 1SR9A 5CC7A 1FHLA 3IIPA 4B90A 2X1UA 4J1OA 2BGQA 3E49A 2VMFA 4ECLA 1H0GA 1YW1A 3TONA 4ZOCA 2HVMA 1QUMA 2E6YA 3BURA 1S5MA 2PLCA 1KM6A 1UR2A 4DBUA 3PG9A 4DEFA 3B8DA 3UBPC 1I0BA 1MW3A 3W75A 1J9YA 2E4TA 4GMEA 4EWJA 5DX7A 1NU5A 2PWVA 3LV5A 3GD6A 4PTDA 1W1ZA 3KS6A 1XR2A 5A8OA 3D3AA 3ZJKA 4DAFA 3BLPX 2GGHA 4B4HA 4Z2KA 1G69A 1T8XA 1H5YA 1XKJA 1EA0A 1ME8A 3VD5A 2XIBA 4GIEA 3EB4A 1TPDA 3WQ6A 4JTJA 1VCFA 1P5BA 4NY2A 3M7SA 1CGUA 1PL9A 2PDYA 4K68A 4DB7A 4JTRA 3OVPA 3DOPA 4C6NA 1TV8A 4HMDA 3RN6A 2D2OA 2DH3A 1PPIA 3VTRA 1X6LA 3NQGA 1GPFA 3WFZA 1F5ZA 1OCNA 2DVUA 1AFSA 3ARYA 4PRWA 1KFEA 5AC7A 4HHLA 2QJGA 4C5YA 2PCEA 3EBVA 2MANA 2GZXA 4S2CA 3W00A 1CEOA 4JZ5A 4D8ZA 4QSFA 5HJLA 5DT5A 3HGOA 2NWRA 1TPUA 3AMGA 4S3BA 3SEPA 4CU6A 3WH8A 2WZTA 1X7IA 1SW0A 4DY1A 5F4WA 3WQ4A 2AMGA 5F4XA 4NXKA 2RJGA 2V5BA 3BCDA 2PRHA 3VKKA 1UR9A 3UJEA 3QZ6A 2YOCA 4TU1A 4OGZA 4U3CA 5AN7A 1CB2A 4FR1A 5HWMA 1T7LA 3PZQA 3WDRA 2PDMA 3BICA 1F3EA 1B90A 4WD0A 4JBRA 4AWUA 2V3GA 4GY1A 3WBXA 3KOYA 3VK5A 1E71M 3R89A 2VZOA 1FXPA 1N8WA 1XFCA 4EF9A 5C7HA 1XDJA 5G2IA 4PSPA 1CXKA 1HL2A 3BAWA 3U8GA 2D2GA 3KBSA 1P4CA 5C6MA 1OIFA 2G0WA 3G22A 5CXPA 4J27A 3BOXA 1GK8A 3BGAA 1CGYA 1Z42A 4QNEA 3GVVA 1NEYA 2QCLA 1PYFA 1R3RA 1ZY9A 2Q8LA 4LBUA 1Q6FA 3WK0A 4W8AA 3LZ5A 4GFSA 4Q8OA 3B9DA 2FDMA 3CO8A 3M6YA 2VEPA 1EP2A 3E0VA 3C0LA 4KCVA 2QUTA 4EAYA 6XIMA 4GJ1A 4JAWA 4Y96A 4NZJA 3ZIZA 3NUKA 2ZUNA 2QW5A 2ONEA 1YPFA 3NOYA 1POKA 4RNHA 3D0CA 5KTLA 1Q5MA 4LF1A 1JQXA 1EWDA 3S46A 5AHMA 3UR2A 3R0KA 1K7EA 3QC0A 4UFHA 5EPDA 2Q3OA 1LM1A 2VEKA 3TLLA 4PR4A 1GQIA 1VEOA 1ZL1A 3U2CA 3E0FA 3RJXA 3NEVA 2PWFA 3KXQA 2EPHA 4IUGA 4OBRA 2ZKMX 1EP1A 4WR3A 1REQA 4LWWA 1E5JA 1P6BA 1UWTA 3LS9A 2WHLA 3KVLA 1X8CA 2C3ZA 3S2NA 1W6TA 1GVIA 1PDZA 2BY1A 4WOZA 3VD7A 2XM2A 2YL8A 3PP7A 4GNKB 4IJBA 3OB8A 1CI1A 3SIZA 3N4EA 5JH1A 1LL7A 2ZUMA 2CESA 3IVTA 3TYUA 4LBRA 5CG0A 5FL1A 3IACA 2A5HA 3S2LA 4KWWA 4GUIA 3WD2A 4GCXA 5D8WA 3L5MA 3CPGA 4XQ6A 2GQ9A 1EHAA 3BJSA 4WK9A 4X22A 4LH8A 4W85A 1GJWA 2BVWA 4URIA 3N34A 1UG6A 1XIFA 2KX9A 1XYZA 4FOKA 2OO0A 3B0VC 1MO0A 1V3JA 2XSXA 4GH3A 3LRMA 3DFOA 5DANA 2GUYA 5LKYA 2PDNA 4ORMA 1PHWA 3N4AA 5A8QA 1LQAA 4UR8A 3M64A 4J3SA 4HN4A 2GVGA 4PODA 1UH3A 5H8MA 3GW3A 1NQ6A 3FHQA 4HZ8A 3VVGA 2OLHA 2Z1XA 1A5MC 4XD3A 2Y24A 3DGRA 4G7EA 4JN7A 1OY0A 3VNLA 1J96A 4K36A 3UXIA 3R5EA 4W89A 5EMUA 4AIOA 3SQLA 3WZ0E 4ADSA 3FA5A 2Z7KA 4Q7NA 3LD5A 3OLEA 3MUIA 1ZCOA 3UWWA 2XU2A 2J6VA 1ZU8A 3H8AA 3QPZA 2ZRUA 3LSBA 3V1PA 5AHIA 1SSGA 1LL6A 5A6LA 3AO0A 1KFKA 2ISVA 1ME7A 1JDFA 1LYXA 2EKCA 4XSMA 4JTIA 4XO6A 4HZ7A 1J0KA 3PZ9A 3LCIA 1FWNA 1PIGA 4ATWA 5I24A 4YYCA 3RM8A 1OD8A 4MJ2A 4XBSA 4UOQA 1ONRA 1HN1A 2WV8A 3NWRA 1T6MA 1G7UA 2YA2A 1XH0A 3KOXA 4DJFD 1R85A 2GJXB 1WDWA 1EZ2A 2BV9A 2CW6A 2ZWYA 1W3KA 3VOGA 3ORWA 3SUUA 1E73M 3BAJA 4DWSB 1HKKA 5I3HA 3KLKA 3SGGA 3M47A 3B8TA 3QYSA 3TXVA 4KMQA 3T0BA 2PLMA 2DVTA 5EB8A 4JTTA 2YBVA 3WFAA 3GC2A 3WLLA 3NL6A 4FLQA 4XBKA 4Y7EA 3Q94A 1US3A 3ZJ8A 1DIOA 1OFDA 4HK5A 5A95A 1A4MA 2XH0A 3QEZA 4G1KA 4K7VA 3MDUA 1K6WA 1W3IA 2I9EA 3BW4A 3GHUA 3C3UA 4RJEA 1RQBA 4AX7A 2QV5A 5BZAA 4AEFA 4QG9A 2G8ZA 1MYRA 4RL3A 1OGBA 1ZJBA 1DTNA 4HSHA 1O4UA 1OD0A 4FP1A 3SY5A 1EO5A 4ZCWA 1EPXA 4M56A 2DQXA 1E43A 1F8MA 4S3EA 1JAKA 1PCWA 4FO4A 3S6DA 2V2DA 3CHVA 4NZ1A 4HNOA 1OX4A 1TJ2A 4AHQA 1V6XA 2ALDA 3BLEA 4P7RA 1NWSA 2ZX7A 5C5YA 3AAMA 1VBRA 4Y9PA 5IXEA 4NI3A 4PMXA 3VFCA 1Y7VA 3W29A 1OBAA 3OODA 1EGMA 2ADAA 3CGTA 3SY8A 3UP8A 2NLYA 4FR6A 3EWWA 3N2OA 4GUFA 4CVUA 3D5HA 1XL9A 1VBUA 3S83A 3G2GA 3BE7A 4E2BA 3OZYA 3UJRA 3G3DA 1RVGA 4FLSA 3GR8A 1K8CA 1MEWA 4RDYA 4V2XA 4Q4PA 3SAZA 2O55A 1K8ZA 2WVTA 1ZALA 2R14A 3TTEA 1OF8A 3VDAA 3UZXA 1VFLA 4GGHA 4JL2A 1EZWA 4REQB 3BW3A 2AGKA 1X1NA 3P84A 1VCGA 4LRTA 3OGSA 3IK4A 2BY3A 3F4WA 5E70A 3E38A 4O4VA 4NAEB 1KM5A 3W70A 4UOJA 2NQLA 2CIPA 5HOSA 4DELA 4ZSUA 3LPPA 4LY4A 1C9DA 4LAUA 2E5BA 5BYWA 2CZEA 1KTCA 5D2TA 2R9RA 2WCAA 3KP1A 3AZRA 1T41A 3GTFA 4UFIA 1IEWA 3ZLGA 5DLCA 1W9BM 2OX1A 3AHYA 4Z1DA 4I6KA 4JOMA 5LIWX 3EMQA 1WKEA 1LT7A 2VFHA 4JYEA 1M7OA 5A6BD 3TFCA 5AYBA 3H2OA 5K9XA 3A3HA 1Y5XA 3R8GA 4MWAE 4WF7A 1NAL1 5GJNA 3AJ7A 1Q3NA 2Y1HA 4FSAA 2QCCA 2QV4A 1E0XA 1E72M 1K3UA 3S8HA 4NJGA 4UZUA 1K8YA 2BX7A 1H51A 1PE1A 3HB9A 3GIQA 1O6IA 3G0SA 3KAOA 4FK9A 3UVAA 4M0XA 3NQAA 1E0WA 3GU9A 4FF7A 5EGRA 3SSZA 4DVOA 5F7UA 3FK4A 3NPVA 2O56A 1OFOA 1DJWA 3PFMA 1R5YA 3QMTA 3TWAA 3QYQA 1XI3A 4QLKA 3ZT7A 2CNCA 3HJZA 3BO9A 4GFIA 5DMNA 1VEPA 2VFEA 2H6RA 4CQ9A 1FCVA 4AWEA 1W3TA 2YXOA 1LWHA 1R6WA 1A5CA 2ZWZA 3CTTA 5GPRA 1C91A 3MKCA 1DWFM 1LOQA 2VEMA 4PEEA 3U2ZA 3E2QA 4IMFA 3MUCA 3TNBA 5KSWA 2VO5A 4JN8A 5A6BA 3BPWA 3MJMA 4W8LA 5D02A 4GABA 5SWUA 2HISA 5D9NA 1QNSA 5CZSA 2X0HA 4B91A 1YHTA 5FJIA 3MVIA 5AOUA 5AZ0A 3HG2A 4I9MA 3RX2A 3QFEA 3TKFA 2QULA 2OOGA 4I8YA 1J8VA 2WJEA 3ITTA 5K2ZA 4NJJA 3GH7A 2DSWA 2O9TA 4GZEA 1TMHA 2PDQA 2C79A 4YPJA 3LCGA 4IZGA 1OGSA 3SM0A 1CNVA 5FEPA 4AY1A 3WLSA 3JUGA 3TK7A 1MQQA 3CIWA 3QW4B 3V35A 3OEXA 1K4HA 4H83A 1WDQA 2PF8A 1XLCA 4QM1A 1DE5A 4ICNA 4XZNX 5G4HC 4UTHA 3HF3A 4ZENA 3UVIA 4ZA0A 2AAMA 3SECA 4EP8C 1QO2A 1M7XA 5DXYA 4FEZA 3SQMA 4KIEA 4DYKA 4Q4SA 3CNYA 2ZRYA 1O94A 5FAJA 1ITQA 3A12A 4N6FA 3N2MA 3VKJA 3BJTA 2WNWA 2D0HA 3A4WA 4JEJA 4V1XA 3TXZA 2JALA 4JX5A 4Q7IA 4G1NA 4LBSA 2REQB 2PEVA 3FA4A 4R7JA 1X7FA 4EX4A 5LNUA 1HVQA 1K77A 2WM0A 3MMDA 3IJ7A 5FD0A 1U5VA 1XUZA 1ZGDA 3BOLA 4AF0B 3M1ZA 4K38A 6ALDA 4ZB0A 1VPXA 4IM4A 2LLEA 4JKMA 3FVMA 1W9DM 2O4QA 3UZWA 4UXDA 4MWAB 1HIZA 4HU8A 1TV2A 3LG3A 3M0XA 2NUYA 5ECVA 5HUPA 1GJUA 3TJ4A 2HVOA 3LHTA 3O05A 5HMDA 1S2WA 9XIMA 3USZA 3T55A 3LHWA 4MADA 1R2TA 1WV2A 2UV8G 2X40A 3B3DA 5E6YA 4JTHA 1XSIA 3H24A 4IFKB 2F84A 2H8ZA 1SFSA 5A6MA 1LBLA 3IJ8A 4KKXA 1RZMA 2F9RA 1HKWA 1V02A 2IPJA 4LNCA 1M53A 3WX7A 1S2AA 2CLEA 3N9KA 3KM8A 4RE3A 4W4QA 3B4UA 1RP8A 4NKCA 4EPEC 4A21A 4UFKA 4MB3A 1XIDA 2V82A 4GBDA 1SU5A 4XIAA 1RALA 5B80A 3K4WA 2OEMA 1RCQA 2E25A 1DQXA 2POTA 4AXNA 4D6EA 3H7VA 2DV0A 1KD0A 1YDYA 3E1F1 2OCZA 1C7TA 2B7NA 4H3DA 2W0UA 3OJGA 1RK6A 3G1VA 1KM1A 1DIEA 5FKYA 2D0FA 4IPJA 1J10A 9RUBA 1SZEA 2C6QA 1UD3A 4I6VA 1I75A 4K6AA 1JUEA 1W5NA 3WG6A 5T9BG 3ABRA 5FEXA 3EDDA 5CG7A 3LX9A 4IL0A 1NELA 3LTSA 3MY9A 4UFJA 4XKMA 1XG3A 3VNJA 2QPUA 2W91A 4WY0F 1EYWA 2IQ0A 2YW3A 2WPBA 4EACA 1QDSA 3CIXA 3P93A 1BGAA 3SADA 3KL3A 3VMOA 5D32A 2XFRA 3M0LA 2JKEA 5FJTA 2BP1A 5MKGA 4J3XA 2EPKX 3VUSA 2NV1A 5BXPA 5TQLA 2PDUA 3ABQA 3W6LA 1GVEA 2E6DA 4DUVA 3U6WA 3BSMA 4O1AA 5F2GA 1KQZA 3BL3A 4FX8A 3NZGA 5I78A 4JFSA 1VFOA 4IP7A 5HNUA 3OPSA 1JFHA 3AHTA 2BZNA 4WHBA 4O14A 2XH7A 3W01A 3P61A 5FI8A 3CMFA 5ENLA 4H6QA 1VFFA 4JTAA 2YSWA 1TMLA 3R10A 3QF0A 4B3ZA 5I3GA 3V4BA 2Q3RA 1CPUA 3SFWA 4AIBA 2C7FA 1IR2A 3W1AA 4R27A 5I79A 1HP4A 3W1PA 2UY4A 3IPWA 3UG5A 1UP3A 1UOKA 4Y9MA 2YFOA 3SGUA 1ZAHA 1MRQA 2FMOA 5U7SA 3LY0A 1M01A 3AYSA 3LMYA 3OW1A 1CBGA 3EDEA 3AMKA 4LNYA 5GNXA 4GYFA 3RDKA 6XIAA 3RCNA 5DO8A 3MPGA 4IF2A 1GG1A 3VIPA 3ERPA 3WLRA 3L66A 4CN1A 3CEPA 4X61A 1KXHA 3MANA 2BVTA 2P0IA 2ZXBA 2GGJA 3NGFA 3INPA 1UC5A 1YBQA 5LNVA 2I14A 3VX0A 2ISDA 2XN1A 3CH0A 4O19A 1R7AA 3TP4A 1I9CB 1JGIA 1L9WA 1EDGA 3A5VA 3W1LA 3VUPA 3UU0A 4PBGA 4U3AA 1F05A 4NZ5A 1VIZA 2G4JA 4HGXA 5CLTA 2CYGA 3UFYA 3DFSA 2XVNA 2PP1A 4UFMA 4W93A 1EDQA 4MM1A 2V5LA 5GNYA 3M07A 2P53A 3L21A 4Y90A 2J77A 3SUSA 1VHNA 1R0MA 2A1YA 1DXFA 2DJXA 1UD6A 2ZOXA 4ATDA 2GVYA 1KM0A 4MKVA 1TJPA 2R91A 2I57A 2JIWA 3B97A 3U2OA 1JCLA 1B31A 2WC7A 3IAPA 3M5VA 3ME3A 5D2WA 2PDFA 1E6ZA 2DP3A 4IICA 4OOZA 5BU6A 3KZSA 1KLZA 3WMLA 2WC4A 4DRSA 1HX0A 3UG8A 2OZ8A 2O9PA 1Y5VA 3MCNA 5FIPA 4YL2A 1ZUAX 3C2EA 1XBXA 2DZVA 1R3WA 3MBFA 3E0LA 3W2UA 2VC7A 3PZNA 3DDMA 1R3YA 2GGEA 2VD9A 3CH9A 3EWDA 2J24A 4AD2A 3JZEA 3P8JA 1F3TA 3GH5A 3GXNA 1H7PA 2PDIA 1E4IA 1IIGA 5F2IA 3TYEA 1XC6A 2Z1KA 3F4CA 4GD0A 5BXTA 4QIUA 4LVDA 4L56A 2YB1A 4LW7A 3LHYA 4X9YA 5CZJA 5G1TA 2PBGA 1AZ2A 1KB3A 4N9CA 4XZ9A 3PK7A 4E0CA 5FEZA 5HJXA 1S5WA 3WLJA 4O8RA 3ALFA 5K3VA 3MQTA 4W86A 1BAGA 1TG7A 1ZFJA 4EANA 4F9JA 5C71A 2VC9A 2NVDA 1H41A 4ENLA 2J7EA 3LXCA 4I9TA 1NWUA 3ZLFA 4JIRA 1FDJA 3FYYA 4D72A 3CZGA 4NILA 2EQDA 4DUXA 1YDOA 1HJSA 4DM1A 1BRLB 2EG7A 1UPPA 3S5ZA 4B16A 3G8EA 1R86A 1XH2A 1OVDA 1Q45A 3UJ2A 4JIHA 4UTWC 3QSTA 1YTEA 2WKGA 4JN6A 7ODCA 2X7VA 5ABFB 5B7ZA 1YLVA 3KP0A 3AS2A 3LDVA 3HU7A 1LT8A 4TX9A 3BLDA 5AHEA 1J0YA 3DG7A 3TYBA 2P8BA 4UC5A 4LJ3A 4MPKA 3PVFA 1LLZA 4KQNA 2J88A 2CZFA 5DQPA 3NGJA 4M24A 1DORA 2VD8A 3U3HA 4MKSA 1XLFA 1J6OA 1HXJA 3VILA 3PJXA 5DFAA 3UZJA 2A4AA 3JR2A 4WVXA 3PM6A 1N8IA 3IUHA 5F2MA 1G67A 1V5XA 2WW5A 3PB0A 3TCSA 3G24A 3MS8A 4E8CA 3HQOA 1D9EA 3OZOA 3BV7A 1E4NA 1L6GA 2YCLB 1JPIA 3TAKA 5FEWA 4Y9OA 1KTNA 3GXIA 2V3DA 1H7NA 4GLEA 2TSYA 2WKLA 3Q65A 3ITGA 1LCOA 2BHYA 2WVVB 1JXKA 4GUJA 1XC4A 5LIXX 1MNZA 3ZS4A 3BAKA 2EF9A 4KPLA 3QW3A 1S46A 3VD9A 2CWXA 3CM4A 3QY6A 3FKKA 4XAPA 2Y7EA 3TH6A 1R30A 1KFLA 3D3FA 4PRRA 4H9ZA 1W5MA 3ARZA 1DL3A 3BGGA 1QNRA 1EOKA 1SFLA 4AZ5A 1UR1A 1YEYA 3ITLA 1NOWA 4PH6A 4NQ1A 1SVDA 5KINA 4P8XA 1ZCCA 3MWAA 1PX8A 5D2XA 2X09A 3SR7A 1RXOB 3RCMA 1Y8BA 3U7VA 4K1GA 3AIRA 5K4XA 4P8WA 3BCFA 3S2CA 7XIMA 3G1DA 1QK0A 2VGIA 4JXCA 4KRZA 3W2KA 2QKFA 3VM7A 1DJQA 2J47A 4N4QA 4Z2HA 5JBDA 4PB3A 3LLXA 3MHUA 1L6YA 4GKTA 4JL1A 4FNTA 3GZ3A 2ZX8A 3WLTA 2CU0A 4IT1A 3UPMA 3RHGA 1N8FA 4XUGA 1HKIA 4UTWA 2NXGA 5BU9A 3TSMA 1V51A 1RJPA 4NASA 3PAJA 1RLCL 2J13A 3H23A 1UD2A 5D37A 3VDGA 3LCWA 1JF6A 4P8UA 4JQ1A 1GOIA 4GGBA 4QQUA 1OHLA 1D7KA 3CLMA 1EUNA 4GC4A 4LVGA 3EPNA 3IJIA 4PUJA 4OQVA 1NTHA 4JHMA 1V03A 1HW6A 3UXDA 5CCZA 3PC0A 4IMCA 2ZZ7A 2V8ZA 2Y8VA 3WF3A 3WUBA 3IIXA 3ZVHB 3HGRA 1JDEA 4UMCA 3PSWA 4OFCA 5I3KA 4L80A 3R4IA 3U7BA 5E5CA 3UERA 1TE1A 2XH4A 4IXHA 4BQ4A 3ES8A 1HNYA 2AGTA 2DSZA 4XD5A 2DT3A 2J9YA 2CKRA 3HQPA 5A6TC 2PRMA 2RDXA 2X16A 3LLDA 3W76A 1GHRA 3CQIA 3MMUA 3D47A 3N2XA 5KMYA 1MW1A 2GK1B 3MCMA 1C90A 1DWGM 5LHFA 3AFBA 2WZIA 2ATSA 3BG5A 3LCHA 3JU2A 1W1TA 2XSBA 5M5DA 3AUOA 3ARWA 3SDOA 1JNDA 1FDZA 4US5D 4M1RA 1KRCC 1QOPA 2QUNA 3RGTA 3VOHA 5H91A 3H7UA 3BAXA 1LZOA 5DEZA 4LS2A 5I02A 1IF2A 2ASHA 4N6EA 5CC6A 1FHUA 1MMFA 3G1RA 4YCPA 2NZLA 4WKFA 2EJAA 1C29A 2Y5JA 3WNMA 1BF6A 1PXGA 2BVDA 2VR5A 3GFZA 4YTUA 4IMAA 4EKJA 3M4HA 4KFNA 3CT7A 1B2YA 1EF3A 5CSYA 4JTGA 4F0LA 3MV11 3TN4A 2ZZ1A 4GRSA 3HMCA 2Y85A 3A23A 3IVUA 2Y62A 3N6QA 2VX7A 1JZ3A 3C2FA 3W28A 2NWSA 4W84A 7A3HA 4YJ5A 1GQNA 4ERAA 3T40A 4MDOA 4QE5A 1VLIA 2G3IA 1E9IA 1R3SA 5C54A 1PWMA 4HKPA 5L9FA 1YDNA 4AC7C 3C4UA 1UKOA 3K1GA 3RX3A 5DBUA 1S3HA 3ABZA 4LU0A 1Z7AA 1XHGA 4JTLA 4N2YA 2FKPA 1PWLA 3UG3A 1GQJA 1HJUA 1TV7A 2NQZA 3H70A 4CU8A 5CPMA 4R88A 5J5RA 2V81A 4C6JA 3W38A 4PMUA 3V5CA 2QPXA 3A13A 4L1XA 3O07A 5KZMA 4O0KA 4XVEA 1SZNA 3KLLA 1T0OA 1EJRC 4B92A 3PANA 3UZZA 3DFQA 1ESWA 3EX6A 2V0TA 3PBYA 4ZE5A 1BXCA 1PKMA 3QPYA 1XBYA 3CTLA 2ISSA 4DUWA 1XLHA 2W3ZA 4WY0A 1DIKA 1ZAJA 4XAFA 1XBZA 1IQ8A 1PX4A 1VB9A 1WXJA 3EOUA 1FWWA 3STFA 2VTFA 3TQ0A 3DU0A 2J7FA 3RR1A 2G3FA 3LBOA 2ZICA 1JQVA 2CZDA 4W7VA 3NM3A 1RH9A 4MIMA 3UCCA 1HGWA 2PZ0A 5CBBA 3G3MA 2KZHA 2IPGA 4MAVA 2QCFA 5BROA 6ENLA 3SCNA 1A5AA 1FKXA 4LVFA 3SRHA 2VM8A 1GOQA 1UYQA 1E6XM 3W7JA 1UWQA 2P10A 1KRAC 3NSXA 2R1PA 1WE5A 1WP6A 3DAQA 1E55A 4FNSA 4WCJA 2JGYA 3W2LA 5CPNA 3I7SA 5C9RA 3QKZA 1KKOA 2QJJA 1OK6A 2YFNA 4IH3A 3VOIA 1R47A 2OZTA 3N73A 4HYWA 4GXPA 2WBKA 3CXOA 1LJYA 4ZQPA 4GBUA 1CXHA 3UZ5A 5EU9A 3PAOA 1ICPA 4HYRA 1TJ1A 1UH4A 3WLOA 2WMJA 3WLQA 1X1OA 2J8FA 3THUA 1CDGA 3URAA 2ZC8A 4GI9A 2ZE3A 5A94A 1ONXA 2OWWA 2VEIA 2WSPA 3P14A 2DZPA 3ZJ7A 4P7OA 3U5YA 2P1FA 1XRFA 1SGJA 3C2YA 2CITA 3I7RA 4OV9A 3Q2DA 3CB8A 2CLMA 2ZC1A 3GXFA 3UY8A 1BGGA 4Q8QA 5FF0A 3A21A 3U9IA 5HWJA 4O15A 3PJUA 2BY0A 2OQHA 3MSDA 3OVQA 5I0DA 3SJ3A 1S1PA 2EG8A 4HCDA 3RRAA 3GUGA 2PC8A 2IMRA 2HROA 3GU1A 4AEOA 1R3VA 3EXRA 3LRLA 6REQB 1WDPA 1QW9A 4MUPA 4PUUA 4R34A 4DWSD 2Y4SA 2IKGA 1BLIA 1XWYA 1GORA 1E5NA 1R87A 4NT0A 5FL0A 3L2IA 3M7WA 4IP4A 3CZLA 6TAAA 4M81A 4AMCA 1VD6A 2A7RA 3I6RA 4L6DA 3ZT6A 1QI0A 2TPSA 4XZBA 3T0DA 4C7DA 2Z2UA 4BK9A 4S23A 3U4AA 2NXHA 7ENLA 3CAKA 1G4PA 1GVSA 4PTNA 4GYPC 3LCXA 4IIDA 3FDGA 1UWAA 4A3HA 4J3WA 2E68A 4K1WA 3GNXA 4LRSA 1MDRA 4QBXA 3VIHA 3CHFA 3TWBA 4O18A 5DF0A 2GSEA 3KTXA 2DT2A 2HJPA 2CC0A 4HPXA 5F4SA 3QQ0A 5F1VA 7REQA 1S38A 5G1YA 1J0JA 3K4AA 3SUWA 1UW9A 2CZVA 3DCPA 3WMBA 4Z2JA 4ZO8A 3RXZA 3WDHA 1C92A 3GY1A 1EXPA 2FHFA 3DKJA 1VYRA 4RV3A 2CFFA 4DO7A 4YCOA 3L4WA 1Q6DA 5TF0A 3I6EA 3F2DA 3BSGA 1YTKA 4TX6A 5HNRA 2BY2A 4U28A 4DLFA 3H2EA 4AU0A 4JTFA 1S2TA 4QG6A 3DYMA 4A8IA 4ZQNA 4C6OA 1XQKA 4WXYA 2PDLA 3LOTA 1QR7A 2OEKA 5FOOA 1GONA 1Q2RA 2DZWA 1AODA 1A47A 3GVWA 3WLNA 2EKGA 5CZKA 3PTDA 5IFPA 2ZRZA 3A5FA 1EA9C 3NQBA 2R82A 3L67A 3WQEA 3UR8A 3H54A 2VR4A 3REQB 1U33A 2EG6A 1IZJA 1WOAA 4NIRA 4PA8A 1XSKA 3LQLA 3POCA 5CGQA 1JCTA 4RX0A 4QP0A 3MP5A 3S2JA 5FSEC 3UA3A 4CNNA 1J4EA 3PWAA 1C8YA 4RK8A 3URBA 4UQDA 3CZEA 2F61A 1KFWA 4H8HA 1TIWA 1FH9A 3HFYA 1CLVA 4QSHA 4NP7A 5HMEA 1I60A 1EEXA 1SO3A 3UXKA 2YCJA 1SW7A 1UA7A 3KOWA 4DXVA 1X98A 3LPOA 3CL6A 3WQOA 1HZYA 3FX4A 3MW7A 3N9SA 4GYPA 4YVVA 3AJXA 3KHJA 4JFUA 1G5AA 2HQAA 4OIFA 3LCFA 2A3AA 3RU6A 4AZCB 2NXIA 2CLPA 3SN0A 4S3JA 1MUWA 1FUYA 3DN5A 1K1DA 4NAEA 2WMGA 3WQWA 1E51A 1W37A 3KWXA 3WF2A 1B1YA 3OGVA 3G1XA 4LYQA 1ZBKA 3EWBX 3KTSA 4W7WA 4LCSA 2GWNA 3NPUA 3W88A 1IGSA 1GZ1A 2B31A 4O50A 2XGIA 3B05A 4C6LA 3C0SA 1UIOA 1VFHA 1IT8A 5K4ZA 3RFAA 2HPIA 2VFIA 3VDBA 2BOGX 3GDBA 4CD7A 2PU0A 1Q7QA 3OZMA 2W6RA 2FZ9A 1AUSL 3FN9A 3HGJA