3W2KA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-165
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-165
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2kA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2kA01
5D2XA 1UASA 2Z6JA 5K9DA 3MYOA 2G96A 3SW6A 1HUVA 2HS8A 5U4NA 1A50A 2QCMA 4EWND 5F1UA 3WK2A 4EIVA 1JCMP 1HTIA 3TUUA 3ANYA 3PAJA 2OMAA 4Y96A 2Y7FA 1DBTA 2VFEA 1RD5A 4N9CA 3DKJA 1AK5A 2CLKA 3UYCA 3SZ8A 1OFOA 4FIRA 1TSIA 3T78A 3OBKA 2PE4A 2EPHA 1DHPA 1MO0A 2ZZ4A 2ATMA 3OVQA 2C13A 1U83A 3AJXA 4MUZA 1JUKA 1ME7A 2Q3OA 1AG1O 3TX9A 4R34A 4JN6A 1OX4B 2PRMA 1Q6QA 4K39A 4LS2A 3P82A 2VFFA 5C6MA 3N34A 4LUIA 3LHWA 5LNWA 4RXGA 5D32A 1BEUA 5I3HA 4IPJA 1N55A 1VCVA 1TPH1 1TV5A 3W84A 1QCWA 4MLJA 1U5JA 4O0ZA 1WBHA 2AGKA 1T0OA 1A53A 2KZHA 2QUTA 3O8AA 4MJZA 1W5MA 4MJMA 4ZVJA 3S6DA 4O8RA 2WNQA 2V2DA 1M7PA 3EX3A 1LM1A 3M7WA 5KSWA 3R2GA 4E0CA 1VZWA 1R2SA 2Z2UA 1EP1A 2YZRA 3TQVA 2YPIA 3O16A 4JYEA 5I3KA 1OFBA 4O1CA 3HGOA 1IXPA 3FS2A 1SO4A 4JX6A 2C15A 4N4PA 3PG8A 1JRBA 2ALDA 1VYRA 3I65A 4CQAA 4HPJA 1LRTA 1KFEA 5FEPA 4L4LA 2FB3A 2QCFA 3SJ3A 3WJSA 5KMYA 1W56A 2AAMA 4LWWA 1D3GA 3CEUA 1LOSA 2PRLA 1F76A 4LU0A 1QPOA 2C19A 3CU2A 3M5ZA 2HSAA 4WOQA 3B8DA 4ZQPA 1OK4A 5AHLA 5D2VA 5C54A 3O1NA 5CGQA 4N6EA 3SR7A 2R91A 5CSSA 3VFLA 1MEHA 5K9CA 2QCCA 3IGUA 4FNUA 1JCYA 3IEBA 3TKFA 1ZAHA 2NUWA 2H6RA 3PSWA 3PM6A 6ALDA 1KM1A 1XC4A 1VR6A 5F2LA 3W83A 1W8SA 3P61A 4O4VA 3E02A 3NL5A 1YTEA 2CLFA 3STGA 2DZPA 4Q33A 2ISVA 1DV7A 3NQ7A 5G4EA 3UPWA 4W9TA 3N2MA 3GNDA 1EB3A 3RNDA 3UWVA 2JK2A 4TR9A 2DP3A 3L5AA 4FNRA 3GKFA 3QZEA 4LVGA 2Z1BA 1SZNA 4H6KA 2FPVA 5K2ZA 1WDWA 3ZS4A 4EF9A 4JDBA 4FNPA 3S8HA 4XKYB 2X2GA 3INPA 2CLMA 1EEPA 1JCNA 2WOQA 3GXPA 5AHFA 5LHFA 5BMXA 3A21A 2ZZ1A 3L0GA 1T8XA 5EMUA 1BTMA 3C2RA 4UIOA 3CLMA 2NWRA 3FEMA 3DHFA 1QOPA 5CZSA 2OJPA 3W71A 1DJNA 4MZ8A 1ME9A 2X1UA 1V5XA 3DI0A 1XM3A 3LCWA 1O4UA 3P7YA 1KV5A 2EGZA 3NQCA 3LRLA 3N9RA 3NQMA 4UNLA 4NQ1A 1TTJA 3TQKA 4KWVA 2Q8LA 3QMRA 1I2QA 3I68A 4O4WA 1FXQA 3EXSA 3DFPA 3NVTA 3M16A 3W6YA 2Y7GA 2VEMA 1K3UA 1B4EA 3UD6A 1QO2A 2CFFA 3PBYA 3PUDA 1OJXA 3I7SA 4UTKA 4QNWA 3QJAA 5CZJA 4MIMA 5F4WA 1BKSA 4K7VA 5KZDA 3CB8A 4H4IA 1YXCA 2VFIA 1EP3A 4L4MA 3BLFA 5BRBA 3HF3A 4IXHA 3LV6A 1EA0A 2ZZ5A 4Z08A 1UUMA 5AC7A 1QO5A 2A2IA 4DF2A 7TIMA 3ABSA 1W3IA 3RLUA 4HIBA 5LNSA 5HULA 4GUFA 1EP2A 4O52A 1SFLA 1OX6A 3O6DA 3NZ1A 2ZZ2A 3C3NA 3W7CA 1VYSX 4I7VA 3QMTA 3NPWA 1IXNA 3N3MA 4JYDA 1F6PA 4GJ1A 1R47A 4OV4A 1FDZA 3Q2DA 1LORA 3L21A 1Z48A 3LHTA 1LP6A 3PB2A 2GQAA 3M5YA 4RZ4A 3GXNA 4IMFA 4NNBA 4HN4A 4O17A 5BOOA 2FJKA 1GOXA 1PVNA 1LOQA 4CQ8A 4DXVA 1HO1A 3LV5A 3W7EA 3BG9A 3MHFA 2GUUA 4JTSA 4IUOA 4NZJA 3N14A 3S1UA 3TSBA 1HO4A 4XWUA 1OYCA 4LNYA 3LXAA 1N8FA 3C2VA 5FF4A 2PURA 5L6UA 3EWUA 2OT1A 4R7JA 1H63A 4G1KA 2ZRUA 3LTPA 1KV8A 2PCQA 5EA9A 4JTTA 5D02A 1DVJA 3C4UA 4JX4A 4DQWA 1AMKA 2A5HA 1JRCA 1K7EA 3TW6A 1ME8A 4GE8A 4O12A 1W5OA 1X8FA 2IQTA 1D9EA 3S5NA 5BW6A 2EKCA 2Q3RA 1YDVA 3BK0A 3A5VA 1P0NA 4CCEA 1NEYA 4TO8A 3GB6A 1G4TA 1JCJA 2G5WA 3DFQA 3GR7A 4UFHA 1Q6LA 3DI1A 3PB0A 3NQ6A 1RV8A 4S2CA 3PBWA 4UR8A 1ICPA 3MP5A 2E5CA 2BTMA 2DZVA 5EKYA 4FB7A 5FEZA 4I7WA 4JIQA 3SGZA 3RU6A 2TYSA 3ATZA 4JIPA 4PTNA 4NJKA 4NJIA 3LXBA 2NXHA 1GVSA 3W1LA 2YFOA 3DXIA 3UXDA 1O5KA 1OABA 1L6YA 1DQWA 1A5CA 2W0UA 2E6DA 3W23A 4JEQA 1G4EA 5AN7A 4CLMA 2QAPA 4WY0F 4N02A 2YW3A 4ZZ9A 4JICA 3G18A 3T40A 4LC8A 2YYTA 3KVMA 3KFTA 4O1AA 1FY6A 4CNOA 3NEVA 1H7OA 1V7YA 4MPQA 5AC8A 2FDSA 3MW7A 4GBUA 5FF7A 1LYXA 2Y63A 5AOUA 5HWJA 2NLIA 3QMSA 1XUUA 2B7QA 2QUVA 1H7WA 3W7PA 4U28A 2ABBA 2JKPA 1VLIA 3HMJG 3LHZA 1G6CA 3TIMA 1S5TA 2CLOA 4N9DA 4QNEA 2QDGA 5FI8A 1G69A 4RCXA 3TC6A 1YLVA 3GX9A 3S1XA 3SFKA 1TPC1 3NQ2A 4IMCA 3OVRA 1H61A 1OFRA 2CZFA 2C6QA 4O28A 2X1SA 1TRDA 3IIVA 4ALDA 3EWWA 2BZNA 4A2SA 2QCDA 3PSVA 3ABQA 2I14A 2WO5A 1T96A 2CLIA 2ZDRA 1FCBA 1K7FA 2JGYA 4K37A 3A5FA 1KW1A 1K8ZA 2E6YA 3W3OA 1M5WA 1A5SA 4LVBA 2V8ZA 1OX4A 1KM0A 3W2LA 1HFBA 1XFBA 2E5BA 3RF9A 4ADSA 3DFNA 4XQ6A 2DZSA 2A7NA 4RV8A 2Y61A 3UWQA 1VGAA 3TR2A 1ZHAA 1SU5A 4OHQA 3LBMA 1H1YA 1XDLA 2CZ5A 2ZYFA 3PF3A 4LC6A 3LI1A 3STCA 1LROA 3NL3A 4N9BA 3A9IA 2Q8ZA 3N2XA 3TA6A 4JTJA 1W31A 3W1QA 3B05A 4O1BA 3TJLA 1KFLA 3MUXA 3QC3A 4TX9A 4AB4A 3I7QA 3S5YA 3G1XA 4HT3A 3W75A 5KTLA 1SO6A 2ZFAA 1H60A 3DAQA 4M6QA 4LY8A 3G3MA 3TSDA 5AC6A 4ZQOA 2DZTA 1GWJA 2RDUA 3B06A 4LS0A 4U4MA 5D38A 3GYEA 3SI9A 5FF3A 4NNAA 2BXVA 4XUGA 2GQ9A 3B4UA 4DBEA 1LLWA 2RKXA 3G8EA 3ABRA 4A21A 4UFKA 1PE1A 4BWLA 1BWKA 6TIMA 3QFEA 1OFAA 2A1YA 3R8RA 1VJIA 4RXFA 4Y90A 4MLRA 1LTDA 5AHMA 5LSMA 1TO3A 1GJPA 1LBMA 3IGXA 3C8FA 4RK8A 1YTDA 3Q94A 1F5ZA 3QPZA 1G67A 4JTHA 4A2RA 3CT7A 4E2BA 2WKJA 2E77A 1HG3A 1XBZA 1AW1A 3BLIA 1R46A 4O0KA 4GUJA 1LCOA 3U6WA 3TFCA 3V1PA 3L2IA 4KFOA 1W0MA 3E49A 5D09A 3LLDA 5LGZA 1RQBA 3DENA 5AYXA 4RLIA 4PODA 4Y9AA 1C8VA 5FEXA 1O95A 2QR6A 3BARA 5J5DA 1GEQA 5HUOA 5KITA 1LRQA 3D0CA 3TH6A 3DU0A 4HPXA 3H55A 1FDYA 2FB2A 3MI6A 1LBFA 4UCGA 3WJYA 3PG9A 3W7QA 2H3DA 1W3TA 1MSSA 4NJJA 4LW7A 4NNCA 4BI5A 4B5NA 1FQ0A 4GUHA 5D37A 1SSGA 4PH6A 3CIWA 3RLVA 3PULA 5CZTA 2QJIA 3B04A 1Q3NA 3G22A 2D73A 3MBFA 2EF9A 4ADTA 2J6XA 3FYPA 3P81A 3NZRA 1W5PA 1JQVA 3E0IA 4UNKA 3KRSA 5IBXA 3M47A 1QOQA 2ISSA 2JKAA 3HQ1A 3TJXA 4CCDA 3L66A 3L68A 1AW2A 3P5ZA 5C55A 3CWNA 2CZDA 3PBVA 4O13A 2B4GA 2ABAA 2FPTA 2A4AA 5HNRA 3KVKA 4FX8A 2WSYA 1KTBA 4O50A 3K30A 1UB3A 3UXAA 1K7XA 5K4ZA 1W5NA 3KX6A 1OFEA 3S9YA 1GZGA 5FESA 1TPVA 4YLWA 3W7MA 4NVTA 3W7IA 3W1XA 4WJEA 3RK8A 1TV7A 2JGQA 4JYFA 1GTHA 4YWIA 4M7SA 1NF7A 2VELA 1IF2A 2C14A 2A6LA 4UTTA 1TPEA 2QUUA 1IIGA 3KXQA 1OFPA 2GOUA 5DELA 1VRDA 3JS3A 3V75A 2ZRVA 2WNZA 5HUPA 4DF0A 1GPWA 4JTIA 3L65A 4LRTA 1JCXA 5K7JA 4QIUA 4X2RA 2RFGA 1KM5A 3GAYA 2UV8G 5DXYA 4GRSA 4HNUA 2VOMA 2GVJA 4UR7A 1FWWA 3TMQA 2AQWA 3L5LA 4LV4A 5TQLA 3W07A 1WA3A 2DJLA 1SW7A 1VQTA 4ZQMA 1X7FA 2QF7A 2YDAA 1NVMA 2P10A 1YDOA 1I8JA 1OHLA 3FKRA 1Z44A 1FCUA 2QEZA 2V2CA 4LVAA 4DO6A 3GLCA 3UY7A 3NA8A 3G8RA 4BF9A 1I2NA 2ZTKA 4BR1A 4Z1DA 2TMDA 4EOUA 4IOTA 2XFWA 3MI2A 3W9ZA 2ZRWA 4IWWA 5G1YA 3G1DA 3FFSA 3TU9A 4HSNA 3N19B 3W2KA 2G97A 3HPSA 1O5XA 4XTIA 3W2JA 2NUYA 1O94A 3LCLA 3QSRA 3DH7A 1KTNA 1M6JA 3LHVA 1FBAA 2GQ8A 4O11A 3H53A 1I2PA 3M5XA 2ZRYA 2E5DA 2V2HA 2TPSA 2BX7A 4Z0JA 3P80A 3TAOA 3IVUA 2YGYA 4GUGA 4MFDA 3C2EA 4NZFA 1TJPA 1Q6OA 5L9FA 1QFEA 3LBCA 5A8GA 2B0MA 5BNKA 3S1VA 4JTEA 1SQ7A 2P1FA 4X9SA 2C1HA 2CU0A 3LCIA 1TQJA 1GG0A 1VCFA 2ZA1A 4UTTC 5D05A 3E9AA 4AHQA 3BGGA 4K38A 3SECA 1YDNA 2H90A 1OK6A 1T99A 3HJZA 3F1QA 2VFHA 5LNRA 3O15A 3C52A 4NU7A 5KINA 3WJZA 3TROA 1KFJA 1K02A 4GFSA 4K8EA 1ICSA 2Y7DA 4N2YA 3T44A 4M5PA 3GK0A 1OF6A 2JKEA 1PV8A 4M7TA 2VEIA 2DORA 3M9YA 1P5BA 3LERA 3EX4A 3W73A 1W3NA 1SR9A 1RQEA 3CEPA 1MXSA 4UTWC 3TFXA 5DY3A 3G1SA 3OEXA 3HPXA 1YADA 2ZZ6A 3KHJA 5H91A 2WJZA 3O6CA 1LDCA 2OZ0A 3BGJA 1IXQA 3C61A 1TPWA 5F4XA 2LLEA 2ZQ0A 1TTQA 4NX0A 5I3FA 3FLUA 4M6VA 4WZHA 3W7OA 4JX5A 3NQEA 1S5VA 4YXGA 4ONVA 5HWNA 3PVFA 1KFBA 2Y89A 3EX6A 2YR1A 3C0JA 3LLFA 4YCOA 4NJGA 1TPUA 2YX0A 2NV2A 1OX5A 2OT0A 4DELA 1ONRA 4ADUA 2WSRA 4O18A 1I2RA 3A23A 4PCFA 5D30A 4GWEA 4JDYA 3DGRA 4XBKA 3UWUA 2DU2A 4OE7A 1B57A 5KZEA 2H8XA 4UTWA 1KM6A 1YYAA 1ML1A 1YTKA 3QQ0A 4AHOA 3GDMA 3FKKA 1QR7A 3GDTA 3CHVA 4O14A 1P0KA 3NL6A 5G1TA 4UFMA 4UFJA 1H7NA 3PS7A 3G24A 1KTCA 3VE7A 4DPQA 5KZMA 2DJXA 2EAWA 2ZRXA 4DPPA 4PA8A 3P8IA 5EY5A 4UTLA 5A5WA 3M43A 1KBIA 3S42A 5I3GA 3T55A 3ABOA 1R30A 2PC4A 1K8YA 2ZZ7A 3TW7A 5AYZA 1TYGA 1TMHA 2ZBTA 4WY0B 4HHPA 3U2OA 2FIQA 3L9CA 5E93A 4TMCA 5LNUA 4UMCA 1YPFA 4OGZA 5D04C 3GVGA 4RKAA 2X1RA 4QSHA 2V30A 4R33A 1Q45A 1L6SA 3IIOA 1EUNA 3NDOA 4JGDA 3QYQA 3EX2A 4PL2A 2GPTA 5HWMA 4ML9A 1D3HA 3N9SA 3IIXA 1XKYA 4JY8A 5AHNA 1JJKA 5DCEA 1YPIA 3BLEA 3EX1A 4WY0A 1SUXA 2J9ZA 3LHUA 4BFAA 1L6WA 4Q4KA 4FNSA 1JCLA 3N73A 1QNVA 3BO9A 3PWAA 3TK7A 3TCEA 3NM3A 3VE9A 3LB0A 2VEPA 1GVFA 4A29A 2QAFA 2QCNA 3W7NA 1XI3A 2VC6A 3WK1A 4XTDA 3NAVA 1BWLA 2VEKA 4UMAA 4Z1AA 4MY8A 4FX6M 2V82A 1QDSA 3M41A 4E2DA 3CPRA 1TREA 5F2GA 1F7BA 2Z0IA 3C2FA 1ZJIA 5LZLA 3UWWA 3B0VC 4PFMA 1VC4A 3JRKA 2HS6A 4LUJA 3YPIA 1NFBA 2CW6A 1R2TA 3CTLA 1F74A 2WPBA 1LBLA 4NX5A 3CC1A 1ZAIA 1J5TA 1LOLA 2DZWA 2G95A 3NPUA 3LM7A 2NX9A 1WQ5A 2FLIA 1CX9A 4WXZA 3NM1A 1WOAA 1LRNA 3DFOA 1VH7A 3P8JA 4EF8A 4AWUA 3HB9A 2NUXA 3PR2A 3OA3A 2I9EA 3GAKA 2GVLA 2FQIA 4O1DA 1FCVA 2H8ZA 3MHGA 1Z42A 4FXRA 1XUZA 4MVAA 4KFNA 4HKPA 3U8GA 3G0SA 1H5YA 3LRMA 5E1QA 5C5YA 4RX0A 3QEZA 2CLHA 4JTFA 4O10A 1XBVA 4UUIA 2YSWA 1RPXA 3G1HA 2A0NA 1P4CA 4HNNA 4GUIA 4IPIA 1J2WA 3NQVA 1LZOA 2BWGA 2R8WA 3SIZA 3MO7A 1EPXA 2QJGA 1I45A 1QPQA 2Y88A 1OG0A 2I1OA 1GVQA 3NL2A 4MYXA 5HQEA 3M1ZA 4X22A 3EKLA 1FDJA 4Z1CA 1TCDA 3NYZA 5I3IA 4XKYA 4ZQNA 1F73A 2ZA2A 3W70A 3TNOA 2VENA 2X16A 1L2UA 3LTSA 4CNPA 4A3UA 3SY5A 5T26A 3IGSA 5CSRA 3W7LA 4RZ6A 3M0ZA 4FO4A 3EWBX 3G3DA 3HO8A 5DCDA 1SZGA 3GXTA 4KFPA 1TPB1 3HG5A 1ZFJA 1OF8A 1QPNA 1PCKA 1RR2A 3BG5A 3HGJA 1VPXA 2XN0A 4IJBA 3NQ8A 4MOZA 2X30A 1VYPX 2YW4A 3B03A 2NX1A 3EEGA 2ZZ3A 3W86A 3W87A 4EVZA 2Y6ZA 3IIZA 2O7QA 3CWOX 3IRDA 4HNVA 5MHBA 4IGHA 3PBUA 4OQVA 3TE9A 4AVFA 4ZMGA 3S5ZA 1KA9F 2A21A 2F84A 4FNQA 4I7UA 4LVDA 4NUWA 1PL9A 1KM3A 3P62A 3GR8A 5DN1A 1FXPA 1PIIA 3WJWA 1K03A 3NQDA 1KLZA 1Y0EA 3IVTA 1UUOA 4TMBA 4XBSA 2DZXA 1OVDA 1PCWA 3LGEA 5D33A 3NXFA 4HSOA 5CPNA 5EL1A 5FEWA 3MMTA 4AEOA 2QCGA 3L0NA 1KBJA 1Q6RA 4MKNA 1VHNA 1TB3A 4AMAA 5F1VA 4JS3A 1DQXA 2QCHA 1RZMA 3CM4A 1SZFA 3FIGA 4FIQA 2J9XA 3TDFA 4RR4A 1P1XA 1WOBA 4QM1A 2CLLA 3MBDA 3OG3A 3KVJA 1UJPA 4N4QA 4JTGA 3LRKA 1TIMA 1H1ZA 4MYAA 3W1PA 4O53A 2FTPA 3W7KA 4AXKA 4ZQRA 4QJ1A 2PRHA 4DBDA 3NPXA 4HNTA 3BW3A 1GG1A 4PL1A 1ZY9A 5K9XA 4K7YA 2QCLA 2V0TA 3P74A 3W7RA 1H7XA 3UPBA 4O15A 3EKZA 4I9AA 1VHCA 1H62A 4OV9A 1J4EA 3EB2A 4LRSA 4PC8A 1VS1A 4TIMA 4DO4A 3USBA 5D03A 2RDWA 2GVGA 4UC5A 3G1YA 5CPOA 3WK3A 4AWSA 3TSMA 2BLEA 5LGXA 4K8HA 5D2TA 4NT0A 2X1TA 4OU1A 4MZYA 1CW2A 5HR7A 4UMBA 3TV8A 1GYLA 5AFDA 4UXDA 2XN2A 3DFSA 3G1FA 1G7UA 1SO5A 4IQLA 2RHGA 3F4WA 3W1AA 4IX2A 3KOFA 3GNNA 4X3ZA 3ATYA 1JQXA 3JR2A 4CNNA 3UWZA 5J5RA 2A7PA 5EPDA 4IMGA 3WFAA 1X1OA 1R2RA 1I2OA 4JR5A 1B4KA 2QCDB 1UCWA 3EXTA 3W88A 3S0CA 1ADOA 3LDVA 2WQPA 3TC7A 4QAIA 3LCGA 3HPZA 3W1NA 4YMZA 3WJXA 8TIMA 1M7OA 1HL2A 3B0PA 5LNVA 4ICNA 5H2ZA 1WXJA 3FJ6A 1H50A 3DFTA 1OYBA 2V5LA 1KM4A 5DXXA 3O06A 3G1VA 5ABTA 3O6YX 2FFCA 2QDHA 1WX0A 2P0OA 4P2VA 3O07A 3G0XA 2A7RA 3R12A 4QITA 4MZ1A 3NPVA 3UZ5A 3BVJA 4FEZA 2TRSA 4DEFA 5DCBA 5F2MA 3P5YA 3MWAA 1FUYA 2E1DA 1S5WA 4OT7A 3W7GA 3EXRA 3O63A 1NF0A 3HOJA 1W37A 3C2OA 3P84A 3M6YA 1I4NA 3UNDA 2F7FA 1LLZA 2J27A 5TIMA 4OWGA 4O54A 5DY2A 4BWLC 5SWUA 4OBTA 1S3HA 3C6CA 4JTUA 2NX3A 3T4CA 3ZWTA 1OFQA 1QWGA 4S2BA 4UTHA 3A22A 1EIXA 1OFDA 3DKLA 4RJEA 3BPWA 4XZ9A 1X6UA 3QQ1A 4O57A 1XL9A 1A5AA 2XN1A 1FWTA 4WD0A 4Z0SA 3MJYA 3W7HA 1TTIA 5CZ0A 3HGSA 3G0UA 3VCRA 1XCFA 5I3JA 1C9DA 4S1FA 4R53A 3QW3A 2NV1A 1TJRA 2ZCGA 3O05A 1TPDA 3HG4A 1JULA 3CQ0A 3PC0A 3R13A 3L5MA 3C56A 3GIYA 4WQ6A 5CPMA 4M19A 4H3DA 1K8XA 1JUBA 3P60A 3VKJA 4LS1A 3W76A 3GDRA 1SW3A 5CPLA 2R14A 3STFA 1B9BA 3FOKA 3S1WA 4KKXA 1NSJA 2C18A 4LVFA 4LOCA 3VI2A 1IIHA 3LOTA 3PUOA 3Q37A 3M44A 2NXIA 2Y62A 5IM51 1NAL1 3W2MA 1PHQA 1SZEA 2HMCA 1ZCOA 4JNMA 3DBPA 5IBXC 1FX6A 3M5VA 1XBYA 2J9YA 4K6AA 1AL7A 5G2IA 5HMSA 3ZWSA 2J88A 3UWYA 3QPYA 5HJLA 3BW4A 1Z41A 1XXXA 3THQA 1SFJA 4M6PA 1C29A 4AH7A 2E68A 5D2WA 3Q58A 1KM2A 2YYUA 4NJHA 3DZ1A 5EYWA 1YXYA 3ZR4A 4AF0A 4MFEA 3FJLA 1F05A 4FF7A 1GTEA 4NXKA 4N6FA 4IXXA 1G7VA 1WBJA 3HG2A 3L67A 1IGSA 3MP3A 4C1KA 4WX2A 1SPQA 4UTMA 3S5OA 3W1UA 2YXGA 4C1LA 1KFCA 4A22A 4QISA 2TSYA 1ZENA 4KWWA 5DLCA 3I7RA 1UBSA 4JTLA 4MY1A 4LV9A 4LT9A 3LHYA 1W1ZA 5CKSA 1G4PA 4AAJA 2C0AA 1FWSA 2NZLA 3IVSA 1EUAA 3W72A 1F2JA 4ORMA 3HG3A 3UZJA 4BI7A 3FA5A 1G4SA 1KFKA 1MEWA 5AB3A 1F6KA 2RH9A 3PUEA 5K4XA 2ISWA 3KAOA 5LKYA 3W2UA 4JY9A 3G1AA 2HTMA 1H7RA 2Y7EA 3QRHA 5CG7A 3KRUA 1VLWA 2B7OA 1DKWA 2E6AA 4AF0B 3LI0A 3R89A 2YCEA 4WUIA 4AWTA 4Y8FA 3BV4A 2QJHA 2O7SA 5TBOA 1MZHA 3THAA 3LCFA 1IXOA 4IMEA 2V9DA 3EWZA 1N7KA 2WV8A 2QKFA 1OYAA 1FCQA 3RFAA 3F03K 2WNNA 5C2XA 1DJQA 1L9WA 5G5IA 1GQNA 4P61A 1DORA 4JXCA 3QF0A 4IMDA 3W22A 3LTYA 5HINA 1DOSA 3T7VA 3LCHA 3W1TA 4NXSA 5G2HA 3BG3A 4DF1A 2Z6IA 3KRZA 2VFDA 3MP4A 3W1RA 3NNTA 5G4WA 3GDLA 3ELFA 2WSQA 5DBTA 2ATSA 5EBUA 4JTKA 4UTUA 3B0UX 5F2IA 5AYYA 1SO3A 3W85A 1QAPA 4JD4A 2J24A 2Y70A 3E96A 4PEKA 2R94A 3EWYA 2V81A 4UFIA 1GVOA 3SGUA 1JUEA 4TU1A 3I6RA 3VNDA 5LHEA 1ZNNA 4LTSA 3MHUA 2W6RA 2YFNA 5G2WA 3ZFHA 2H3BA 5AHEA 2E6FA 3TQ0A 1SSDA 1H7PA 1TQXA 3CIXA 3GKAA 1TPFA 1ZAJA 4E38A 3E12A 5BMWA 3QM3A 1XDMA 4DO5A 2JBMA 2Y85A 1XBXA 3HGRA 3NG3A 2W79A 4UTJA 3W74A 3W1MA 3NO5A 3KVLA 4UTIA 1PHWA 3R5EA 3FYOA 4MY9A 4O19A 2VKZG 5D2YA 2RDTA 2B7PA 5DBUA 2EHHA 3F4NA 3BW2A 3QW4B 1QPRA 5FF2A 4UFLA 5U7SA 4FNTA 3QH2A 1B3OA 4Q32A 1ALDA 2ZTJA 1X1ZA 1GT8A 1EX5A 4IX0A 2B7NA 1JVNA 3GDKA 3NOEA 4WXYA 2OX1A 4ZQCA 1ICQA 1O60A 3GZ3A 1EWDA 1VCGA 3AO0A 3NQFA 4CQ9A 3RMJA 1W54A 1AW5A 1WV2A 1KLYA 4WOZA 4N9EA 1WYIA 5F4SA 5K3VA 4QQ3A 1FWRA 1A5BA 3TXZA 1W5QA 2CZEA 3WK0A 1TRIA 1CI1A 2VXNA 4K36A 3TAKA 4AHPA 4BK9A 1AL8A 2ZRZA 3OIXA 4Y6GA 2OCZA 3SSJA 3OVPA 5GVJA 2E09A 3LCXA 3HIJA 4YCPA 2C16A 1ZALA 4CCCA 2VFGA 3QSTA 3TXVA 4RZ5A 4GNJA 1WAUA 2FPYA 2CWNA 1SW0A 1TTPA 3H54A 2C3ZA 5AHIA 3IV3A 4GC4A 3UY8A 3IIPA 2NXGA 4J9JA 1RVGA 5E0KA 1FWNA 5FF0A 3NGJA 4FX7A 3W2NA 2A6NA 4Z1BA 1EWEA 4ZL1A 3EWXA 1TV8A 3W7DA 1YXDA 4O16A 1E51A 4GXMA 3UQNA 4FXSA 3NQAA 4POCA 1PS9A 1MEIA 1GVRA 1QMLA 1THFD 3DHDA 1DL3A 3NR0A 3LXCA 2ZA3A 2DZUA 3OHIA 4BI6A 2GJLA 4ORIA 4YL2A 3W7JA 2BSLA 5HR6A 2V5BA 2A85A 3HBLA 2CLEA 1RQHA 1JR1A 3MYPA 3STEA 1H51A 4D2JA 1GYNA 2NWSA 4FHAA 3MI3A 3TMLA 3LX9A 3NQGA 3A24A 2QCEA 2GJNA 3PY2A 3L0KA 3P67A
chains in the Genus database with same CATH superfamily
5D2XA 4CU6A 1TVLA 1DWAM 3WQGA 4JEJA 1UR8A 1UYQA 2EJ1A 1J2BA 4GISA 1HUVA 1KQZA 3ANUA 5H8PA 4EWND 4PCTA 1IEWA 3ANYA 4C1NB 6CGTA 4J3WA 3SZ8A 3PWGA 1OFOA 4LSBA 4FIRA 3ES7A 4CQDA 1EF3A 3T78A 4NI3A 3GG8A 1CBGA 2EPHA 3CH9A 2ZZ4A 2ATMA 2DSKA 2C13A 2WSKA 3AJXA 3A6OA 4QBXA 4GINA 4PTWA 2PRMA 3BUVA 4S3EA 4K39A 2VFFA 3TOYA 4LUIA 2IKHA 3WQPA 3VD7A 4GH3A 4L9YA 2AGKA 1E0UA 2KZHA 2WM1A 4QG9A 1AJZA 2NQLA 2V2DA 2BB0A 2BXZA 3OOQA 2Z2UA 2VWTA 1P0BA 2YZRA 3MJMA 4CD5A 4HGXA 1ZJBA 4DUXA 1VEPA 3SCWA 4JX6A 1G9HA 4JFTA 3W00A 3GHTA 2CCRA 5FEPA 2FB3A 2QCFA 3B9OA 5KMYA 1W56A 3MZ2A 3CEUA 1LOSA 4LU0A 4ZR8A 4MWAC 2W9MA 3FY1A 2C19A 4J28A 4WOQA 1XICA 2OYKA 5CGQA 4GGHA 2R91A 1XSKA 5CSSA 4FNUA 3IEBA 2VGBA 2INFA 2H6RA 2E25A 1KM1A 4AY1A 3W83A 1W8SA 3C0QA 3VIKA 4O4VA 3NL5A 3WD0A 1YTEA 4AIEA 2DZPA 4Q6JA 3GG0A 1XPGA 4JTAA 5G4EA 3UPWA 3N2MA 4KIEA 2Y5SA 3W6MA 3UWVA 3EOUA 4US5A 5FJOA 3LM3A 4C6JA 1PJ9A 4KT2A 3GKFA 2PUZA 5K2ZA 2FPVA 2WQDA 3CUFA 4KEUA 4EF9A 5PTDA 3INPA 4MKSA 5G4HC 3S9ZA 3WQEA 2D69A 3ZQ9A 1T8XA 3HQPA 3CUHA 3VKCA 4UIOA 4WDTA 1CLKA 4GA8A 1DJNA 4MZ8A 1V5XA 1XM3A 1QJWA 3LCWA 4QXIA 3N9RA 3EDKA 1R3SA 1ODZA 2Q8LA 3VU2A 4DYJA 1HL9A 1O66A 1B4EA 3UD6A 4J35A 1J12A 3W27A 1FHLA 4GNVA 5CZJA 3N6JA 3JZUA 4MIMA 3TTEA 3EMQA 2G3JA 1LL7A 2W92A 1US3A 2WCSA 2XIIA 1S2AA 2NQZA 4JHOA 4Y9OA 3SIMA 5C7VA 1LWJA 1E9YB 3GTXA 3BLFA 5E70A 5BRBA 1R7AA 1EA0A 1X1NA 5A6TC 3TTSA 4WKFA 3I10A 4I90A 1NM9A 3RLUA 1F3TA 4LAZA 4ENLA 4GUFA 5HNNA 4O52A 3AHVA 1BSIA 1OX6A 3O6DA 1QW8A 3NZ1A 4IGSA 4AZCA 1IXNA 1O1HA 1JAKA 1F6PA 4IGMA 2J7CA 3LHTA 3MDUA 1LP6A 3MMDA 4D8AA 3GXNA 4IMFA 3B0XA 4IFKB 1GOXA 4UOJA 1K4HA 4NAFA 1LOQA 1NFPA 4CQ8A 4DXVA 1HO1A 4F40A 3PZNA 2W62A 4GQGA 1GKRA 4JTSA 4IUOA 3S5SA 4EAYA 1OD8A 4B5TA 3WH5A 2ESCA 1OYCA 4IT1A 4HSHA 2F38A 1JF5A 3H2MA 2QJJA 5L6UA 3QHNA 1MDRA 2PCQA 3HFTA 5FKYA 4ZO6A 1AQHA 1AMYA 1DVJA 3ZJKA 3VGFA 1RLCL 1QK0A 1J0YA 3GU2A 1NTHA 1AH4A 2IQTA 4D1IA 5AC5A 2Q3RA 1EYWA 3WLPA 2PWVA 3H4XA 5FD0A 1JCJA 2AOSA 2BHZA 1Q6LA 4B9ZA 1UR9A 3NQ6A 1RV8A 5CC3A 1HKKA 4KETA 4UR8A 3VNIA 3BH4A 2DZVA 5FEZA 4C65A 3SGZA 2DEPA 2TYSA 3ATZA 4PTNA 4IP4A 4NJIA 2NXHA 1GVSA 3H7VA 3W1LA 4GJJA 1HL8A 3WMSA 2W0UA 2E6DA 4G7EA 3LD5A 4WY0F 3SQLA 4N02A 4ZZ9A 3QXBA 3T40A 3UCCA 1BPLB 1TE6A 4IIBA 4EPBC 2YYTA 4QAWA 3KVMA 1UD6A 3KBWA 2IUZA 2J78A 4CNOA 3RYSA 3NEVA 4DWSD 2SFPA 1H41A 3IV8A 3MW7A 2VGIA 3VNZA 4B5SA 1X8CA 5HBFA 4XVDA 5LXEA 1W1TA 3QYSA 3HTWA 2Y63A 1KO0A 5BCAA 2ZUMA 3SRHA 1XUUA 2QUMA 2QUVA 3A4XA 3CMFA 4NILA 3HMJG 1S5TA 2VD8A 1E1CB 3IARA 3LGGA 3TC6A 4PRTA 1YLVA 1IR1A 3TOPA 3NQ2A 4ZCWA 2J7GA 4C6KA 3ANVA 6PTDA 1OFRA 2IQDA 3W81A 2X1SA 3EOOA 3THUA 3PSVA 3ABQA 2I14A 3O9NA 4IQEA 3VIJA 4YTSA 2WO5A 1T96A 5BXPA 3OZMA 5T9BG 2YJQA 1EGZA 2ZDRA 2Z29A 2CLPA 3CH0A 1H2JA 5ABFA 1KW1A 1EEXA 1TX0A 2HROA 2FZNA 4MKVA 1A5SA 1C7SA 2V8ZA 4YU1A 4H2CA 2HJPA 4HCDA 1HFBA 5C2CA 1MRQA 1K6AA 1H11A 1VGAA 4BKNA 3A3HA 1UKQA 3C0SA 1ZHAA 4H9VA 4OHQA 1EFZA 1XDLA 2ZYFA 4AVNA 6ENLA 3THCA 4AIUA 3STCA 4R27A 5HAOA 3GVQA 1WDPA 3K4WA 3N2XA 1XLDA 3N12A 4JTJA 3W1QA 3U7BA 3MUXA 4AB4A 3S5YA 2PDKA 4DXXA 4ATDA 4MHBA 5KTLA 1SO6A 2DIJA 3DAQA 3G3MA 5AC6A 2PB1A 4ILSA 3RPMA 1YIXA 5FF3A 4NYUA 2BXVA 4ACZA 1VFMA 3ABRA 4HPNA 2J8GA 2XTKA 4XZNX 6TIMA 2FH8A 1UZDA 2A1YA 1VJIA 3H6OA 3A9BA 4Y90A 1J96A 3GZAA 3S2LA 1DJHA 1GJPA 1P7TA 1E9IA 3IGXA 5LIXX 4DUOA 3C8FA 2O92A 3OU8A 1P1MA 5CCZA 1XLKA 4UR9A 3BGAA 2E77A 3R7MA 1XSJA 1EJXC 2DUZA 3R25A 1XBZA 4A8NA 3UPMA 3HA1A 4GUJA 1KC7A 2VQTA 2A3EA 5E9XA 1XYMA 1D3CA 3NO1A 5TNVA 1RP9A 3ZZ1A 2I5GA 1W0MA 3H2CA 3DENA 1HJSA 3I3BA 4LB3A 1GOWA 5FEXA 1O95A 1OG6A 5J5DA 3D0CA 3TH6A 4I5UA 2OEKA 4ZOEA 4HPXA 1UWSA 3T0AA 5I0DA 1JZ8A 2FB2A 1OGBA 2BY3A 2QDEA 3HZ3A 3AZRA 1EH9A 4ZA0A 3N17A 4NJJA 1MSSA 4LW7A 5IFPA 1FQ0A 4GUHA 1DWIM 3WH8A 3RLVA 2QJIA 3G22A 2D73A 4ADTA 3NUKA 4YTTA 3MV01 2G3IA 4XK2A 4OFCA 4HK7A 4UNKA 5HNUA 1SFTA 3T81A 2E1WA 5CBJA 2ISSA 4IF2A 3LSBA 3TJXA 2FTYA 1CGXA 2CZDA 2WVUA 3KVKA 1C92A 2WSYA 4O50A 2I57A 2CC0A 4Y2WA 2EG6A 1UD3A 5FESA 4YLWA 3TLQA 4Q8VA 3BXWA 3W1XA 4WJEA 2JFEX 4JYFA 5GJPA 2VELA 1IF2A 2VR2A 1OFPA 4WSKA 5AYBA 1R0MA 1VRDA 3JS3A 2ZRVA 1F3WA 1ZJHA 4NAFB 3L65A 3ONCA 3CUJA 4XIMA 3PTQA 1JCXA 3CJPA 1X6NA 2UV8G 3PZUA 3TMQA 3N3TA 1A3XA 4AXNA 2BVTA 1SW7A 4WK9A 1DEDA 3TVAA 3IS4A 2YDAA 1SR0A 3IJ8A 1OHLA 1Z44A 1FCUA 2V2CA 3CMJA 4LPCA 3IACA 2Q01A 3WLRA 2Q8XA 3GLCA 4WJ8A 3NA8A 3SBFA 1I2NA 4P7RA 3VOFA 2XFWA 2QV5A 3GVWA 2QW5A 3H2OA 2GLKA 3N19B 3PTKA 2YA0A 4XTIA 2C91A 3EYPA 4HU0A 3GC2A 1QPKA 1M6JA 3LHVA 2GSJA 2V2HA 3LY0A 3NJ3A 3C2EA 2NT1A 3DCPA 3PJXA 1JZ7A 3PN8A 2C1HA 3ZJ6A 5LIKX 2C71A 3Q65A 2R6OA 1NDYA 3T0CA 1TJ0A 1UUQA 2J77A 3E9AA 1QBBA 1U1UA 3TTOA 4AHQA 3BGGA 1JXJA 2OKTA 1ISXA 5BROA 1C7TA 2D3NA 1OK6A 4CCZA 1J01A 3ABXA 5I00A 4Y9NA 2VFHA 2PBGA 5KINA 2X05A 3WJZA 2WSPA 3TROA 2Y5JA 1KFJA 2OX4A 3DECA 4M5PA 3S3GA 1OEPA 4J3VA 4GH1A 2CITA 3LERA 4F0KA 3CEPA 1JF6A 1WE5A 3SCVA 3UG5A 4TTGA 2VURA 5DY3A 3FVMA 2DSWA 2ZZ6A 3KHJA 2OZ0A 3BGJA 5A6LA 3MUY1 4HU4A 4JOMA 1TPWA 2FYMA 1MYRA 1Q7ZA 3VIIA 2ZXQA 2J6VA 2INZA 2GGEA 2Z1KA 4NX0A 4BQ3A 5I3FA 1LQAA 4WZHA 4IIGA 4WJXA 4PMNA 4CNUA 4YXGA 1SFSA 3HJEA 5HWNA 3VMOA 1EBHA 2YR1A 1GK8A 4NJGA 3K8KA 1UWUA 1ONRA 2D23A 4O18A 3LUTA 1J0IA 5JVLA 2FZDA 1UR4A 4MMWA 2KX9A 3UWUA 4GX9A 5KZEA 2H8XA 1KM6A 4J3SA 2ADAA 4ML4A 3GXFA 3TTYA 1D2KA 1RVKA 1P0KA 3D47A 1L0PA 3WL1A 3F2DA 1VEOA 2WKGA 5J04A 1FWGC 3R0DA 2QYGA 5M1TA 3O6AA 5KZMA 2DJXA 2EAWA 4DPPA 1QOXA 4PA8A 3P8IA 2VRKA 1KBIA 4GG9A 2ALRA 3EEZA 5FSEC 1ZQ5A 1K8YA 1X39A 3TW7A 1VBHA 3EDFA 2C79A 1E55A 3U2OA 2FIQA 2QDDA 3WH7A 4QJ5B 5LYRA 3NXLA 4MWAD 5D04C 3CV7A 2V5JA 2Y0FA 4QJ4B 5JQ9A 4JGDA 3UU0A 3C3UA 5FAJA 3WMLA 3W28A 3EX2A 4XZHA 2GPTA 4ML9A 3N9SA 1RK5A 4MGGA 1UC4A 3FK4A 4JY8A 4IP7A 3BLEA 3EX1A 2J9ZA 2BVWA 4KCTA 7A3HA 3SCPA 4FOUA 4FNSA 2WMGA 3BQ6A 1KGWA 3VE9A 3KS5A 1R3WA 3U4AA 1GVFA 1AQFA 3LNPA 1TMQA 1XI3A 3QOMA 4I8DA 2VC6A 3RN6A 2E3ZA 3WK1A 4XTDA 2E67A 3SUVA 2VEKA 3CZEA 4XAPA 3M41A 2QGHA 4Q8OA 2OTDA 1CB7B 4HJFA 3A4JA 5LZLA 3UWWA 4PFMA 5I7GA 2NSOA 3Q45A 4WDUA 3YPIA 3PPGA 1FP9A 1RK6A 1H1NA 3KBJA 3OG2A 4IICA 2P8BA 1JDDA 4E8GA 2WPBA 2GJXA 2GJRA 3NPUA 3Q4DA 4F48A 4QJ3B 2IMRA 1X6LA 3BSHA 4WXZA 4L9ZA 3AHYA 3CUIA 4D8ZA 2ZXBA 1SJDA 4GQRA 2WVVB 4EF8A 3OA3A 4O1DA 1DJIA 3MANA 1ZLPA 4H01A 4WVXA 4TVUA 4MF4A 2PDCA 3BOLA 4PGLA 4YNGA 4HKPA 2VX6A 4R9XA 1DIEA 1H5YA 1ECQA 3VM7A 2DPEA 5C5YA 3ZLHA 4JTFA 1F4HA 5FJTA 1WDDA 1P4CA 4IPIA 5BOFA 2WM0A 2OSWA 3NGFA 4MB3A 1A0CA 3MO7A 3NDYA 2PLKA 1QPQA 2Y88A 4IIDA 1VFOA 2A3CA 3A3XA 3L4WA 2PTYA 5IFTA 1F3XA 2UY4A 1F73A 3TNOA 1DQUA 4CNPA 3SY5A 5T26A 3IGSA 1MUMA 5E09A 1XRVA 2Y8UA 4FO4A 4GKLA 1S5NA 4HMEA 1SZGA 4XZBA 3D3FA 3HG5A 1KRMA 4QCFA 3S4TA 1VAHA 1OF8A 1PCKA 1RR2A 3OPSA 2HCVA 3HGJA 3W37A 2OLHA 1VPXA 4M81A 3NQ8A 4GIEA 1QI3A 3LQLA 2WJEA 3VNKA 1DIOA 1PZ3A 2P5NA 3W87A 2YCLB 3II1A 4S3DA 3MUIA 4GQ0A 1J5SA 1H3GA 1W6TA 3TE9A 7XIMA 3S5ZA 4FNQA 4I7UA 5H6HA 3QKEA 4OBSA 4NUWA 2XFRA 3UWEA 3P62A 3WJWA 1PIIA 2VNCA 3MU7A 1ZSXA 2F9RA 1UUOA 4TMBA 4AD5A 3TN4A 5FEWA 2OZ8A 4AEOA 4ATWA 1FWJC 3UJRA 2X0YA 3H70A 1RZMA 3UEQA 3FIGA 4UZSA 4FIQA 2J9XA 2DVTA 4DM2A 2R1LA 3MBDA 1UJPA 2BGQA 3OGRA 3AS1A 4K8GA 4MYAA 1K4GA 5I2UA 4P8WA 3W7KA 2HISA 4Q8UA 4ZQRA 3P0WA 4DBDA 4HNTA 4LCSA 1GG1A 4LFYA 2WVTA 3KBVA 1ZY9A 1UWIA 5K9XA 1W1VA 3AXKA 3P74A 3W7RA 5A69A 4AQLA 3K8MA 4WDXA 2JQXA 3EB2A 4PC8A 4EKJA 4TIMA 2RDWA 4LXFA 4UC5A 1CGUA 3VKAA 3IWPA 5CPOA 4LBSA 4GYJA 4LH8A 8CGTA 3BZJA 3M6DA 5D2TA 4IFKA 5CG0A 3VDHA 4PMQA 3TV8A 1GYLA 2X2YA 5AFDA 3RR1A 4ECLA 2XN2A 3DFSA 5AZ0A 3RG6A 1QI5A 3E2SA 4O1FA 1Q2RA 3BAWA 2XG9A 2OO6A 3ATYA 4CNNA 1Y5WA 3AICA 1Q7MA 3GFZA 3LSCA 2V6AA 4MPKA 2QCDB 4C6NA 1F8IA 3EXTA 1A5OC 3W88A 3S0CA 1XLFA 3TC7A 1OCNA 3W1NA 4JIRA 1M7OA 1MQQA 1XRSA 1MNZA 3FJ6A 4QRNA 3DFTA 2YB4A 1VD6A 2R1KA 3O06A 3G1VA 5ABTA 3CWHA 3OO2A 1EIBA 2PF0A 4C91A 1Z7AA 2RJHA 4P2VA 2GJPA 1CGWA 4FLSA 4GLEA 5REQB 3BVJA 5F2MA 1FUYA 3DUGA 2PWDA 1YX1A 1GZJA 4OT7A 3CPUA 3W7GA 4LYRA 4MUPA 3HOJA 1QI0A 2Q09A 3AMDA 1LLZA 2W27A 3OJGA 1K1DA 1VPQA 5TIMA 4OWGA 2WK2A 4GXWA 2VHLA 3C6CA 4ZTYA 4JTUA 1S2WA 5D9PA 2INEA 4H7CA 3A22A 3MVTA 4XZ9A 1EO7A 1R5YA 1GHRA 4TX6A 4O57A 1PXGA 2EO7A 4H8UA 5HQLA 5CSUA 3H7UA 4LUSA 4Z0SA 3WLSA 1TMLA 1XG4A 4W7UA 1MW3A 3G0UA 4P5UA 3VCRA 5CQ1A 1KR1A 3VXGA 2Y4SA 1VFHA 1T6MA 1IEVA 1TPDA 2QXWA 1KRAC 3WDHA 4RNJA 4V1XA 3C56A 3GIYA 3PUGA 1DYSA 2DW6A 1K8XA 1XQLA 1POKA 4LS1A 1DTNA 1RY8A 3ZVIA 5JBDA 5CPLA 3OLEA 4ZOAA 1E6RA 2W66A 2YL8A 2DFAA 4LOCA 4KWUA 4RW5A 3PUOA 4C5YA 2NXIA 2Y62A 1ZTVA 3ITCA 2PZNA 1BXCA 1FX6A 1XBYA 2J9YA 5G2IA 2ZX8A 3STPA 2J88A 3UWYA 3VM5A 1Z41A 2PLCA 1ZL1A 3DIPA 2X7WA 3GM8A 1VFSA 4IZGA 4AMCA 2PD9A 7REQB 2E9LA 3L4TA 3MMUA 2XH2A 1E15A 1F05A 2HDJA 3LLXA 3HG2A 3L4VA 1TUXA 1E1FA 4PUEA 3MP3A 4C1KA 4WX2A 3T05A 3G6LA 3AXHA 3JZEA 4M8UA 2TSYA 1UBSA 3TYAA 1J0HA 1M9HA 3GC4A 4KMQA 3EDJA 3LHYA 1HJWA 4O8AA 3AQUA 5CKSA 1KBBA 4AAJA 2G41A 1FWSA 1VJZA 4PTDA 3I4EA 4YPJA 3AIRA 3W72A 2VX4A 1AUSL 7CGTA 1S2TA 1ITUA 3HG3A 3ARVA 2QGYA 1KFKA 3UNTA 3QHOA 1UD8A 2RH9A 5K4XA 2HNEA 4NRSA 1UH3A 4P7NA 5DT7A 4URIA 1RPKA 1A5NC 3KRUA 2ACUA 1O5RA 4AF0B 3LI0A 2VR4A 2YCEA 4S3CA 2PWEA 3U2CA 1I1WA 1OC5A 3THAA 3POHA 3RAOA 1WKDA 1N7KA 2WV8A 3RM8A 1V02E 4XAZA 2WNNA 3QPEA 3WQVA 3A13A 1GQNA 4P61A 4KH2A 3L2LA 3A12A 1OINA 5GPRA 2WANA 3F4VA 3F4CA 2QULA 3W1TA 1RCXB 2FTWA 3MCMA 3NNTA 4DHGA 3GY1A 2DGAA 2XGBA 4QE4A 2P3ZA 3WKZA 2CPUA 2OQHA 3B0UX 4XZLX 2PDNA 2J24A 2Y70A 2R94A 3D46A 1PAMA 2V81A 5AZ1A 4J40A 3WEOA 3GNXA 1JUEA 5LHEA 1ZNNA 2PDMA 3MHUA 3GTNA 1TZ7A 4N7QA 2H3BA 3VOIA 3NZGA 1SSDA 2OZTA 4D72A 1TQXA 3GKAA 3EPNA 4XAGA 3ITTA 4H9MA 1XDMA 3ZJ7A 4GIYA 4Q8WA 4WLCA 3HGRA 4JQ3A 3W74A 4DJFA 3NO5A 3KVLA 4UTIA 1PHWA 4XV0A 1GKQA 2DUAA 5D2YA 4D6DA 2JEPA 4IP5A 1EO5A 2NLYA 3WELA 2X09A 2EHHA 1OBAA 1XV8A 5U7SA 3AWNA 2ZXAA 3DGBA 4R3UA 1WUFA 5CLTA 3W4RA 3QH2A 4C6FA 4AZBA 1ALDA 1ZPTA 1RHCA 2GGIA 5XIMA 3OVGA 3NOEA 4WXYA 4ZQCA 2ZUUA 3AO0A 4H9UA 1E0TA 4E5TA 1MXDA 1E4MM 1WV2A 4N9EA 1LL4A 3GSMA 5F4SA 3QLLA 3TXZA 2CZEA 4C6EA 5DRCA 4N0RA 3BTNA 5HA7A 4AHPA 5EFFA 4RDYA 1TWZA 4HZ7A 3S2NA 4EACA 3GFYA 3LCXA 3SCQA 4Y9MA 4Z2IA 3HIJA 4YCPA 4X9YA 1WAUA 2FPYA 1UR1A 2CWNA 4QE5A 1PB0A 5AHIA 3IV3A 4IISA 3M0IA 5A8MA 3T8LA 3IIPA 2VUYA 2BVDA 5FF0A 2WMIA 1VIZA 1EWEA 4ZL1A 4EPDC 3ARRA 2GUYA 3W7DA 3RJXA 1E51A 2X0SA 4RUBA 1BTCA 5BXTA 1K9EA 3SM0A 1P43A 3T07A 3LXCA 2FVLA 3OLDA 3OBEA 3B8TA 1HVXA 1L8PA 3CZKA 4JIHA 1ELSA 4C6QA 1JYNA 4OUEA 3TMLA 3WQOA 4XD4A 2GJNA 3PY2A 2CHNA 2WZIA 3CS2A 2Z28A 1UASA 1C9WA 4P7QA 3MYOA 3U9IA 3ITLA 3B9EA 5IHSA 2G96A 3KWSA 1Y65A 4S23A 4YTUA 1AFSA 2WJDA 4P8UA 4EIVA 2EG7A 3UZZA 3TUUA 2HEJA 4M3PA 1RD5A 3DKJA 3W02A 2CLKA 1RP8A 2DDXA 2Q6ZA 2PE4A 1DHPA 3IANA 4F4RA 4MUZA 1JUKA 2Q3OA 2R1MA 4D6JA 3K13A 3TX9A 4R34A 2DV0A 4JN6A 1E0VA 1OX4B 4IQDA 1OC7A 3P82A 4RXGA 5D32A 5FJJA 1B30A 5I3HA 1W3LA 1N55A 4UB9A 4D6HA 1TPH1 4MLJA 3W84A 3URBA 2FDMA 4O0ZA 1UOKA 1WBHA 2OVLA 1T0OA 3TYCA 2QUTA 1W5MA 3VKKA 1TJ2A 4Q4OA 2D0FA 2WNQA 4C6PA 3EX3A 5HNTA 1QUMA 1MMFA 1W8GA 4E0CA 4I6VA 1PKYA 2PPGA 1EP1A 2YPIA 1OFBA 1HJUA 3HGOA 1TVPA 4HPHA 2C15A 1C93A 3F5JA 1EZ2A 2ALDA 1GQLA 4HPJA 4DVOA 4L4LA 4HNOA 5D8ZA 3WJSA 1B31A 3BJSA 2AAMA 4LWWA 3OBAA 4QX4A 4DZ5A 1F76A 4PMXA 5LIYX 3TCSA 1E6NA 2HSAA 1KXVA 3GR4A 2PDFA 1OK4A 5D2VA 2CKRA 4N6EA 3SR7A 3SO7A 1FRBA 1ISZA 1MEHA 4GO9A 3CAVA 3IGUA 3GW0A 3ARWA 1ZAHA 2YCIX 2I5IA 4UTFA 2NUWA 3WD1A 4ZE4A 3PSWA 3QY6A 3RCYA 4AY8A 3UA3A 1LQ0A 1VR6A 1LUCB 1MFUA 3KHDA 3CQIA 4KRZA 4JPGA 4UWMA 3STGA 2CLFA 2QUNA 1JGIA 4H04A 1DV7A 3LEPA 3GNDA 4Z1YA 2A3BA 2JK2A 4AZIA 4TR9A 2JIWA 2ON3A 1JYXA 5AVHA 3QZEA 3ZSTA 1Q8JA 3ZS4A 1GJWA 3S8HA 4XKYB 2FZ8A 1A5LC 2X2GA 2CLMA 3APYA 3OYZA 4KW2A 3GXPA 5AHFA 3FYYA 5AYIA 3A21A 4J2PA 1BTMA 2IPWA 3EAUA 3C2RA 1BXBA 3CLMA 3FEMA 1QOPA 1NARA 5CZSA 3W71A 2ZX6A 1ME9A 1WPCA 4GHRA 1O4UA 1D7KA 1MVYA 1E40A 2B31A 1KV5A 2EGZA 3NQCA 4DO7A 3NQMA 1U33A 1PWMA 4NQ1A 1TTJA 1I2QA 1M53A 4O4WA 2PS2A 4XD6A 3URAA 3EXSA 5CPQA 5C9RA 3DFPA 9XIAA 2Y7GA 1D8CA 1K3UA 4B3KA 2CFFA 3PBYA 3PUDA 4CNSA 1TUFA 2OYMA 4G6CA 1QHPA 1K70A 4REQA 4K7VA 2BY2A 1LG2A 3CB8A 4GI4A 1RCOB 3PZMA 5MKGA 4QTGA 1KB3A 4H4IA 4W85A 2WLZA 1XRTA 3HF3A 2VTFA 4TOQA 2YZ5A 4EWJA 4Z08A 1UUMA 4S39A 1BVNP 2ZICA 3WQDA 3ABSA 2PMQA 4GI8A 5HULA 3AU6A 1SFLA 1V3HA 3C3NA 1ADDA 3EDEA 2YXOA 3QMTA 4UOQA 4YVPA 3N3MA 4KRTA 1QI2A 4OV4A 1RSCA 4GJ1A 4PYSA 3GVVA 3M0KA 3M5YA 2VZVA 3M0VA 3E6EA 3QR1A 3HM7A 2FZ9A 1PVNA 4IH3A 4S3BA 1XCXA 5DMMA 1DWGM 3F2BA 1PX4A 3W7EA 1IGWA 1XINA 1V77A 2VZUA 3N14A 3JU2A 3A64A 1HO4A 2MUCA 4XWUA 4LNYA 2XH4A 5FF4A 3EWUA 3EWDA 3LTPA 3FVDA 5D02A 5EA9A 4PB5A 1CGYA 4L4OA 2R1PA 3W01A 4LQ1A 1JRCA 4HYRA 3IGHX 1B1YA 2RAGA 2V3FA 3RM9A 1XLIA 1W5OA 2Z7KA 3CK5A 3VVGA 2EKCA 3BK0A 4LX4A 3CQHA 4CCEA 1NEYA 1X97A 3PTDA 1TG7A 3DYMA 4UFHA 4KRUA 2CZVA 2E5CA 2MNRA 4FB7A 2VDGA 4I7WA 3DC8A 3SN1A 4ZBCA 3RU6A 4JIPA 1KCLA 4NJKA 1Y7VA 1F4AA 2YFOA 3DXIA 2WMHA 1O5KA 2WB5A 1DQWA 3LZ3A 3E0FA 4CQBA 3AZSA 2QAPA 4DAFA 4LALA 2YW3A 3UGVA 1TFVA 5EU9A 2HE8A 1FY6A 3CHCA 4DY1A 1H7OA 2GVYA 2FDSA 4GBUA 2J7DA 1LYXA 2V3EA 2RUSA 1NWTA 3QMSA 1KXTA 4E2VA 2GWNA 2V5CA 5EMLA 2ZUSA 3FA3A 3QR0A 1U1HA 3W7PA 4FOKA 3RRXA 3CV1A 1F07A 4GCXA 4IFOA 2QDGA 3VNJA 4RCXA 5DO8A 3MV11 3R1ZA 1JDFA 3T42A 4IQJA 1H61A 2XDFA 2CZFA 4G9PA 1TRDA 3AS2A 4NZ5A 1I60A 2IQ0A 2QCDA 4BEQA 2OKOA 5H8MA 1MFVA 1FCBA 3PPFA 5CLWA 3MSYA 4K37A 1K8ZA 2D20A 4MNMA 1W9PA 2E6YA 2PC8A 3M0YA 1XH0A 4D6FA 2Y5EA 4XSMA 1KM0A 1OZQA 4QDMA 4ADSA 3FJNA 1RH9A 5J8LA 2A7NA 4RV8A 3UWQA 2V3GA 3W38A 1HJQA 5M17A 1SMAA 1PPIA 3M0XA 4E2OA 8A3HA 4E3TA 3WLJA 4J3XA 4H8NA 3NSNA 2J66A 3B97A 2DUXA 4LC6A 3ZT6A 4NSBA 3POCA 3P0XA 3A9IA 3LMYA 3CT2A 1A5KC 1UHVA 1UMLA 3TA6A 3TJLA 2B81A 3WLKX 1KFLA 3WBYA 4TX9A 3IJ7A 3MUZ1 3R11A 4HT3A 3W75A 4LJ3A 1JFXA 3PFMA 2ZFAA 3VUPA 3B8SA 4PUMA 2BMBA 4U4MA 4RDWA 3GYEA 3SI9A 4NNAA 3W29A 2PODA 1PBGA 1LLWA 3W82A 3TQPA 2RKXA 4UFKA 1X98A 1S5MA 3T8QA 1GOKA 1BWKA 2Y24A 4Z17A 5TF0A 4MLRA 1J0JA 5LSMA 4BQ2A 3G6MA 3VIMA 3GYCA 3UFYA 1YTDA 4E4UA 1A4LA 3QPZA 5XINA 2Z27A 2WYSA 4A2RA 4E2BA 2WKJA 3GQYA 3GG1A 1EOMA 2W67A 2WMFA 1R46A 4O0KA 5XIAA 3U6WA 5I06A 5EB8A 3WBWA 4L1WA 3TFCA 3B0YA 4AZHA 3V1PA 1R9XA 3CPGA 2O0TA 2PTXA 3GWQA 1C8VA 1GVYA 2ZC1A 4FLQA 1XLBA 5HUOA 1DJWA 3DU0A 1UH2A 2A3HA 2WBGA 4QP0A 3EWCA 4U2YA 1E9ZB 3W7QA 2H3DA 3PFRA 3W26A 3B9NA 1SSGA 3BOXA 1E4NA 2P88A 5GJMA 3PULA 4B5XA 3ISIX 4B90A 3MBFA 2EF9A 3P81A 1JQVA 2ZVRA 2DVXA 3M47A 1HJVA 1PKNA 1QOQA 3S83A 3HQ1A 4CCDA 3L68A 3COTA 3CWNA 2FPTA 3WD3A 2A4AA 3BE7A 3QV9A 3K30A 1WDRA 1UB3A 3UXAA 5K4ZA 3KX6A 4H9ZA 3S9YA 1GZGA 1NOWA 3P14A 3W7MA 3W7IA 2O4MA 1S2UA 1CLXA 1GTHA 1QK2A 3JUGA 2TAAA 3H26A 2A6LA 5FJRA 4UTTA 2QUUA 3ID7A 2JF7A 3KXQA 4LCRA 3SUWA 1DJZA 1TR9A 3E74A 4DF0A 1GPWA 4JTIA 3H2NA 3OZPA 1CNVA 1GJUA 2A3AA 5CEWA 4QIUA 2RFGA 3K8LA 2P76A 4U33A 1OCBA 4MWAE 3W07A 3CMGA 4B2DA 4HTYA 4ZQMA 1I8JA 1MDLA 1E73M 1BF2A 3NO3A 4DO6A 3QY7A 3G8RA 2ZTKA 1OZMA 2JIEA 5A8PA 2TMDA 4Q8MA 1KCZA 2XGZA 2VC7A 1AD4A 1FWIC 3GVRA 3HV9A 3MI2A 3W9ZA 3CHDA 5G1YA 1K6WA 3TU9A 5HMFA 3W2KA 3EMZA 3HPSA 1O5XA 2NUYA 3LCLA 2OPJA 3DH7A 4L6DA 1FBAA 4O11A 2YA2A 1M7JA 4GY0A 5F7UA 2E5DA 2OLSA 2PP3A 3TAOA 4F8XA 1Q6OA 2UWFA 1VKFA 3VO0A 3LBCA 2B0MA 4DNMA 3A4AA 3CB3A 3KM8A 4GZ7A 4PFHA 2P1FA 4X9SA 1ONEA 2CU0A 3REQB 1TQJA 4QLKA 2EJAA 2ZA1A 4UTTC 4G1NA 2AMGA 3H23A 1MUWA 1T99A 3LZ5A 4DRSA 1WZKA 1S3TC 1PYFA 3AWOA 5C0QA 5BYWA 3K4DA 1QATA 1HKVA 5FJPA 1ONWA 4JHZA 4E4FA 3OODA 1K02A 2DZBA 4K8EA 1ICSA 2ZVIA 2Y7DA 4H41A 3UCDA 3TONA 4HP5A 4L65A 4REQB 3N25A 4M7TA 3R79A 2ICSA 3W73A 3QGKC 3VIOA 3AMGA 1W3NA 5AC4A 1RQEA 5CH9A 1EGVA 4C6IA 2WKLA 2ZWYA 5M2FX 3O6CA 1LDCA 1HKWA 2DY3A 5DT5A 1TTQA 2PD5A 4V1YA 3OZOA 3W7OA 5D8WA 4JX5A 5C7HA 1IWPA 2GZXA 1GOIA 4EAMA 1E6XM 2XVGA 3PANA 1KFBA 1A5UA 5GNZA 4H9XA 3C0JA 3LLFA 1TPUA 2YX0A 1WAWA 2PU1A 4DELA 2WSRA 3B8VA 1M03A 3A23A 3LPOA 3DGRA 4TQTA 1B57A 1KNWA 1YYAA 1ML1A 4A3YA 2P8CA 3S1GA 3ZT7A 3GDMA 1UKTA 4KIRA 3BC9A 3UA4A 3GE7A 3MA8A 1E4IA 4L1GA 3VX1A 4B92A 3VDBA 3F2CA 1KTCA 1V51A 3VE7A 4DPQA 1MW2A 1UD2A 2DT1A 2ZRXA 4GPNA 3KTSA 4C6LA 3BMXA 5CJ5A 3S42A 3H2FA 5ECUA 4M82A 4F0SA 3ABOA 1EZWA 3VZYA 1TMHA 1CZ1A 3QV7A 3WQFA 3L4XA 1MRAA 3MKVA 2J4GA 4QSHA 2X1RA 4R33A 1L6SA 4Q4MA 1PSCA 4KEMA 3NDOA 4S3JA 4LYPA 3GTIA 4F2UA 4PL2A 5HWMA 4PBGA 3BANA 5B7YA 1XKYA 4W5UA 3CV6A 5DCEA 1JJKA 5AHNA 1YPIA 4QEEA 1GZ1A 3R43A 1L6WA 4NZ1A 3SN4A 5MKGB 2UZ9A 1QNVA 2FZBA 3TCEA 4PEEA 3B9DA 3NM3A 1TX2A 1GYMA 5BRPA 4Z2HA 4DI9A 2Z1XA 4AEEA 1MQPA 1KBLA 2VEGA 1KXQA 4ZXLA 2ZUTA 4LBRA 1KQYA 1UG6A 4FX6M 2F6XA 4CGTA 1CT5A 4W87A 2VCBA 1TREA 4D9PA 1F7BA 3VUSA 2A3LA 3T0TA 3ZIZA 2HS6A 4LUJA 1NFBA 5JH2A 1I0DA 3PAOA 1EX1A 3CTLA 3BQ5A 4NX5A 1NOFA 1F61A 1J5TA 1LOLA 2DZWA 1ECEA 3LM7A 1WQ5A 2O55A 3NM1A 3DFOA 4GGBA 3WNKA 2AQOA 5HJXA 1RJRA 4AWUA 2GDQA 3PR2A 3EB4A 1IZCA 3VCNA 3RDKA 4CVUA 4UNIA 3MHGA 1KBKA 2D2OA 1LF1A 1NU5A 1NQ6A 4I5XA 1XUZA 4LGXA 4KFNA 2YBVA 3G0SA 3I6TA 3AHXA 4YIWA 1W1IE 4O10A 7ODCA 2A0NA 4KWSA 1NIUA 4GUIA 3NQVA 3AIBA 3DDMA 3SIZA 4QGCA 4HYWA 2VI0A 1EOKA 3BZGA 2I1OA 1GVQA 4M0XA 1ZP3A 5D9MA 4IUGA 4GXPA 1TCDA 3VD3A 5I3IA 5RUBA 4XKYA 1Q4NX 2ZA2A 3W70A 5A95A 4S3GA 1QNOA 4RE3A 3LTSA 1CEOA 2OGJA 5CSRA 4H8HA 4RZ6A 3T08A 3RU8X 3M0ZA 4DX3A 2F2KA 5DCDA 4RE2A 3GXTA 3ARQA 2FVKA 3LN3A 1NH6A 5IDZA 3ARSA 2X30A 3ITXA 1UR2A 3L23A 1UZHA 5MF5A 3MDWA 4EVZA 3BJTA 3IJLA 4QR6A 3CWOX 4JKKA 1DXFA 3IRDA 3EDDA 3L4UA 4HNVA 4CQCA 4IGHA 4AVFA 3WQ5A 1QNSA 2VWSA 1BRLA 4NAEB 1JZ5A 1IEXA 4B4HA 4CUCA 1KLZA 1Y0EA 3IVTA 2RJGA 2JALA 1JPDX 1PCWA 3LGEA 4JKLA 3ITYA 4XVEA 3L0NA 1W1A1 4MKNA 1Q6RA 1J9YA 1XG3A 1XIBA 1TB3A 3IUDA 1WB0A 1DQXA 4GVGA 5I02A 4J3ZA 2D2HA 2GSHA 5ABEA 3M64A 4DYEA 1Y5VA 3VKDA 1P1XA 1WOBA 4QM1A 1OM0A 2CLLA 4G7FA 3SCNA 4N4QA 4BHYA 4YVXA 3TYDA 4E3VA 1C8XA 4GIAA 3WL0A 1H1ZA 4QS6A 4O53A 5BRQA 2EXOA 3V3WA 3GS6A 2VEFA 2PRHA 1YE6A 3BW3A 3TZNA 1V6XA 3S6TA 1EYEA 1PKMA 2QCLA 1H7XA 3VGGA 4O15A 3EKZA 1VHCA 2VCCA 1IV8A 4XZWA 2GVGA 2ACSA 1LL6A 4PULA 4BA0A 4MZYA 1CW2A 3S9IA 4MTVA 4IFRA 1SO5A 3W1AA 3NSXA 4RNFA 4IX2A 3KOFA 5A8QA 1XYFA 3GXIA 1YPXA 4Q4RA 1V08A 2A7PA 1E1EA 5EPDA 4IMGA 4HMDA 3F5KA 3ITGA 1I2OA 4JR5A 4KEVA 3U0HA 1UIPA 2WQPA 4HA0A 2DT3A 5FACA 4QAIA 3HPZA 4YMZA 4HZ6A 4FI4A 4ZOBA 2I5QA 3AALA 4BF7A 1WXJA 4PUJA 2V5LA 1KM4A 2OB3A 4GVFA 1EJTC 1GW1A 4AZ5A 4GMEA 2DW7A 2QDHA 3H4GA 4PB4A 3UR5A 1V3MA 3UESA 4A8RA 3G0XA 1XJBA 3MY9A 5DCBA 3P5YA 3WF1A 4JTCA 3MWAA 1K9TA 1I9CB 1RUSA 3RX4A 2YKKA 2WCGA 4LB4A 3PZ9A 3C2OA 3P84A 1UQYA 3GC5A 2DIEA 2OLAA 2F7FA 2DSVA 2POTA 1Q85A 4BWLC 2PF8A 5SWUA 5A2AA 1E43A 4OBTA 5CC5A 2NX3A 4DWDA 1NDZA 3LQGA 1W3KA 2X42A 1QWGA 1P0EA 1R6WA 2CIPA 4WKHA 4CN1A 3DKLA 2WXDM 4NY2A 1UP0A 3QZAA 1A5AA 1ZRQA 2AAAA 2YDQA 4B5WA 3FN9A 3VD5A 3MJYA 4MDPA 1JL8A 5G1MA 4AW7A 3HGSA 3B40A 1XCFA 3LG3A 1BGAA 2NV1A 4GVHA 1PX8A 3O05A 3KL5A 4G5DA 2QNEA 1JULA 4ZB2A 1I1XA 1NDVA 1XLAA 3R13A 4W86A 5CPSA 3VD9A 2CWXA 4ATLA 2PFHA 2C1IA 1IEQA 2FJUB 4M6UA 1VIWA 1JUBA 1RJQA 3VKJA 4DM1A 2G8ZA 2IS7A 3GDRA 1SW3A 1B9BA 4ICMA 2C18A 3VI2A 3LOTA 4LYKA 1XH1A 1NAL1 1PHQA 3V5CA 4XISA 2HMCA 3S46A 4K6AA 3N13A 1OCJA 3AROA 3BW4A 2PBOA 1XXXA 4KBXA 2EPKX 1HGWA 1SFJA 2I7GA 1C29A 3CAQA 1DXEA 1NJJA 1XYAA 2A79A 4HYVA 1IZJA 5EYWA 2HQAA 2XSXA 3K2GA 4Q7NA 3LGDA 3R4IA 4IIHA 1EGMA 2X7VA 4MFEA 4WDWA 1EXPA 3SY1A 5A3HA 2VM8A 4FF7A 1TWSA 4NXKA 4F66A 4IXXA 1WBJA 4EPEC 1OCQA 4UTMA 3AISA 2OQLA 2P50A 2YXGA 3TJIA 4KWWA 1ZENA 4Q4QA 5DLCA 3I7RA 4N42A 3TA9A 3UCQA 5HQMA 1E3XA 3PP7A 1TCMA 7TAAA 1E70M 1MW1A 3CV2A 3FAXA 3AFBA 3ERPA 3MWCA 4GZEA 1DE6A 2W91A 4U5IA 3MUCA 2NZLA 1XIMA 1JIBA 2D1ZA 2J47A 4BI7A 1G4SA 4AC7C 2I56A 5AB3A 3UETA 3PUEA 5HMDA 2G4JA 1W1PA 2V38A 4KCUA 3FCPA 3G1AA 4JY9A 1UD5A 3QFWA 2AL1A 2VMFA 1DKWA 2E6AA 3R89A 1PZ2A 2XIMA 4M29A 4AIOA 2PEVA 4AWTA 1NWRA 2XWEA 2QJHA 4HNCA 3RJYA 2VGFA 1MZHA 3IUIA 4IMEA 2V9DA 3H4WA 2I17A 4OUIA 1FCQA 1UKOA 3RFAA 4WHBA 1QT1A 5C2XA 4CD6A 4GY7A 1DJQA 1L9WA 5G5IA 1JAEA 2BHYA 3QF0A 4IMDA 3W22A 3F7JA 2NV9A 1DOSA 4XAYA 4AX6A 2G3MA 3T7VA 3DX5A 3PZGA 4NXSA 2PSNA 3BG3A 4DJDC 5I23A 4M56A 3W1RA 3W24A 5G4WA 2ZDSA 3NSMA 4Q8PA 3VA8A 1Q13A 2QVNA 4JTKA 4UTUA 5AYYA 3W85A 3HN3A 2G3FA 4JD4A 3E96A 1HP4A 1QASA 3EWYA 4TV5A 1DWHM 1V93A 3EMCA 3SGUA 1NWUA 3TW9A 1YW1A 2YDRA 4MWAA 4TU1A 3I6RA 4AD3A 3HURA 2EPOA 1V4YA 2YFNA 5AHEA 4DJFC 3TQ0A 2YCKX 3KUMA 2G3NA 3CIXA 1TPFA 4E38A 1BAGA 3E12A 1BYCA 3QM3A 3EB3A 2AQVA 4IGNA 5REQA 1W3JA 2HWGA 3NG3A 3FDGA 4UTJA 2GWGA 3W25A 3W1MA 4L4PA 1KKOA 2PI6A 2VKZG 3T09A 2B7PA 3J7HA 3GW3A 4ZB0A 2ZXDA 1FH7A 3MKCA 4FNTA 3KZSA 4Q32A 4XG1A 1X1ZA 1GT8A 4Q8QA 4G2DA 1EX5A 4IX0A 1CLVA 5I78A 2B7NA 3IK4A 1JVNA 1VBGA 1EWDA 3NQFA 1VCGA 3Q67A 3UJEA 2WVSA 5H8UA 1W54A 1AW5A 4H7ZA 1VBJA 3FNDA 4WOZA 3RX2A 5ECVA 1FOBA 2QHAA 4LANA 5DQPA 1FWDC 1W17A 1BKHA 1TRIA 1CI1A 3TN5A 1U5HA 4PCNA 4Y6GA 3OIXA 3AUJA 5GVJA 2QT3A 5HMEA 5JBFA 2YBUA 1ZALA 4DJEC 4CCCA 3QSTA 4W7WA 2PAJA 3ZMRA 4WSJA 2BBFA 4GNJA 1SW0A 3H54A 2BDQA 4PRRA 1ADSA 2IPGA 1UJQA 2A6NA 4HD5A 4MB4A 1QRQA 3PZOA 3EWXA 1TV8A 3NWRA 5HDRA 4MNKA 1ODUA 2E9MA 4DBSA 4X61A 3UQNA 4FXSA 4Y7EA 2OWXA 3BMWA 5JIPA 2W61A 1THFD 3OHIA 1ZCCA 1SYTA 3AU2A 4ORIA 3N11A 2AL2A 4YL2A 5CC7A 2BSLA 5HR6A 2CLEA 1XKJA 3H12A 3T0DA 4DBUA 4D2JA 3UG3A 5HOSA 3MI3A 1W1B1 3LX9A 3A24A 4PN2A 4ZO8A 3L0KA 3EZ4A 3P67A 5FJIA 4A35A 2DIKA 2YL9A 4ZENA 2O9OA 1OIMA 5U4NA 1PTAA 1F6YA 5F1UA 4RNHA 1DE5A 1AZ2A 1FFRA 2OMAA 2VC9A 2Y7FA 1DBTA 4W8LA 2VFEA 4N9CA 4DWSC 3H7RA 1BD0A 1P6BA 3UYCA 3R10A 1OB0A 3WNPA 1HX0A 5TAOA 1EPVA 4TVCA 1UPMB 1XIDA 3E5PA 3SQMA 2X0HA 1IHIA 4AD4A 3ICJA 5CXPA 3OVQA 1U83A 2REQB 3VGEA 2BXYA 1AG1O 1JZ4A 3OTRA 1UKPA 2CHOA 3C0LA 3RO8A 3KOYA 1XCWA 4WGXA 3WF0A 4Z2JA 5LNWA 3L2MA 9CGTA 3GXMA 3KW3A 1BEUA 4TTUA 4IPJA 1VCVA 3WF3A 2IKJA 5ENLA 2X40A 1XLEA 1A53A 3O8AA 1ZGDA 1JPIA 3PZTA 4ZVJA 3S6DA 2C0HA 3T4WA 4BCEA 1NP0A 1E4LA 1M7PA 2BHUA 1LM1A 3M7WA 4B91A 2NVAA 5KSWA 3GXDA 3TQVA 5JMUA 4JYEA 5I3KA 2QVHA 1IXPA 5JBEA 1LLOA 4GI9A 3FS2A 2PWFA 4S38A 2BGSA 5GJNA 3V36A 1JRBA 1A47A 1VYRA 2CNCA 4OJYA 1LRTA 1LUCA 1UC5A 1PIGA 4IIFA 5M5DA 4RL3A 2CHRA 1D3GA 2PRLA 1B3VA 1QPOA 3M5ZA 4ROQA 1CECA 1EJRC 3B8DA 4ZQPA 5C54A 1UD4A 2O56A 5DMNA 1XLCA 3VFLA 4OVXA 4JCMA 3H21A 2QIWA 2XYLA 2V3DA 5I77A 5HPOA 1JPMA 2NVDA 2GDVA 3LNMA 5CC6A 1KKRA 3AIWA 6ALDA 4HU8A 3AMKA 4C6MA 3BWWA 3E02A 1O12A 4Q33A 2ISVA 4X2PA 3WH6A 4W9TA 1XC6A 2HBVA 3FA4A 3GUWA 3V0SA 4QE1A 3MUAA 3VMPA 4DUVA 2DP3A 3MSDA 4XD5A 4H6KA 1SZNA 1WDWA 4JDBA 4NHVA 1BSLA 1EEPA 3EBVA 1TZZA 3ALGA 3QGVA 1JCNA 2WOQA 5LHFA 1EDTA 3GHUA 5BMXA 2ZZ1A 3L0GA 3ECQA 4PUUA 5EMUA 2BVYA 2HK0A 1PZ1A 3AXIA 2WC4A 3R0UA 2NWRA 1W32A 3FGCA 3DHFA 3NQBA 2OJPA 4AWEA 1ISWA 4Q8TA 5LIUX 3LENA 3DI0A 2JF6A 3AS3A 3LRLA 3QLDA 1VBRA 4UNLA 2FFIA 3UXLA 3TQKA 1Q6EA 4KWVA 3I68A 1J6OA 1NWSA 2PZ0A 3WBEA 1QHOA 3NVTA 3W6YA 1S2CA 2OGYA 2VEMA 6TAAA 2Y2WA 3MO4A 4PMYA 1QO2A 4Q7BA 2W5FA 4GFIA 4QG8A 3I7SA 2HPMA 1EDQA 4QNWA 3QJAA 5F4WA 2IW0A 3GU9A 3AJ7A 2C7FA 4JTDA 2VFIA 3RHGA 2J7HA 3HFYA 2WPGA 1AODA 4IXHA 3LV6A 1VFTA 2O9PA 3WQ8A 2FH6A 5AC7A 1QO5A 2A2IA 3GNPA 4HIBA 5LNSA 1XIEA 3P3BA 4KCVA 2D3LA 2ZZ2A 3REQA 3WUGA 3W7CA 2IPJA 3NPWA 1V6YA 3FGCB 1WUEA 4JYDA 4LAMA 1R47A 4NKCA 3SADA 3Q2DA 1E71M 3PB2A 1MZRA 1GNXA 3URQA 2GQAA 1CXHA 2D0HA 4CD7A 4NNBA 5D9OA 4HN4A 2CBIA 1WO2A 1EJWC 6REQA 4A3HA 5BOOA 5DEZA 3BCJA 4BY3A 2OWWA 3LV5A 4K68A 3BLDA 2KAUC 3MHFA 4JFSA 2HXTA 4NZJA 1AQMA 3GIQA 2WAGA 3S1UA 3TSBA 4FLRA 3CL8A 3LXAA 3AYTA 4J5NA 1N8FA 2D0GA 4JZ5A 4HVXA 2PURA 4DB7A 2EPLX 1AJ2A 2OT1A 1V3LA 8XIMA 1TR1A 4JNZA 5E6YA 1KV8A 4X63A 1QXLA 3VIPA 3C4UA 4NZ3A 3MSRA 4B2DD 1AMKA 4XO6A 4JN8A 4GE8A 3CUXA 4BZYA 4L5ZA 1UA3A 1X8FA 1XGEA 4K3ZA 2YLLA 1D9EA 3S5NA 9RUBA 1KRCC 1YDVA 1WDQA 1UWRA 4FF5A 1OT2A 2GGJA 1M7XA 1EXBA 3DFQA 3GR7A 4IHCA 3SUTA 3DI1A 4JNYA 3APTA 3ZT5A 3WLHA 1JPHA 3MP5A 1LT7A 2BTMA 5EKYA 2QPXA 4JIQA 1B3WA 1ITQA 4J4KA 4GD0A 1HNYA 3LXBA 3UXDA 1OABA 1EHNA 4KGJA 1L6YA 1SMDA 1G4EA 5AN7A 2PTWA 1UR0A 4JICA 3G18A 2OG9A 4DJED 1JZ6A 3KFTA 3O7UA 4MPQA 1V7YA 3QY8A 2QZRA 2WW5A 2J13A 5AOUA 5KETA 5HWJA 2NLIA 4U28A 5C9ZA 2ABBA 2WZTA 3AIVA 1ESWA 3AZTA 4HA4A 3TIMA 3ABZA 1Q63A 1HVQA 4EP8C 4QNEA 5FI8A 1VB9A 2GFTA 3GX9A 2P53A 3S1XA 1TPC1 2E40A 3H8AA 4IMCA 2BGNE 3WF4A 3WF2A 3NDZA 4X0VA 4ALDA 1R8LA 3EWWA 2BZNA 4Q22A 4L6HA 1YRRA 2CLIA 2DT0A 4AVOA 1K7FA 2JGYA 1H0IA 3A5FA 2X1IA 2VJXA 4WRHA 3TYUA 1W1YA 3W3OA 4MAZA 2XSBA 1M5WA 1SJCA 4H6QA 1R3VA 2XHYA 1ZUAX 3W2LA 1XFBA 2E5BA 3RF9A 3DFNA 4XQ6A 3UJSA 1REQA 2DZSA 2FMNA 2Y61A 2XIOA 4XSLA 1SU5A 4C60A 1H1YA 2CZ5A 2J62A 3LBMA 4GNKB 3PF3A 3U5YA 4LF1A 3TYBA 1P48A 3LI1A 2OSXA 1GORA 3AMCA 3TC3A 5EGRA 1Q6GA 3NL3A 4N9BA 2Q8ZA 3ZVHA 4H9YA 4O1BA 3ARXA 3CZ8A 3QC3A 5E0FA 4AYGA 3G1XA 3KOXA 3U5UA 5IHRA 3OA5A 4JFVA 2HV5A 4ZQOA 1NQKA 2DZTA 1AQ0A 2PGFA 1GWJA 2RDUA 3V16A 3B06A 2OEMA 5D38A 1ZZMA 4OTKA 4QHRA 3B4UA 4DBEA 4IMAA 3TR9A 3G8EA 4RPQA 4A21A 1PE1A 4BWLA 1OFAA 4XZIA 1R9YA 4RXFA 1SVDA 4U3CA 3CL6A 3AIUA 4GBDA 5AHMA 1LBMA 4AYSA 4RK8A 3GFXA 3Q94A 1F5ZA 5B7ZA 1S39A 1G67A 1R86A 3CT7A 1HG3A 3BLIA 4Q8NA 2WWDA 3UBPC 3SCOA 4CU7A 1LCOA 4HOXA 4X0NA 4KFOA 3SDOA 2CBUA 3DG6A 3E49A 3LLDA 1RQBA 4LUSB 4RLIA 4PODA 4Y9AA 2ZOXA 4ZO9A 1BGGA 3TNBA 3BARA 1GEQA 5KITA 1V8EA 1LRQA 2OR2A 3GH5A 4O0QA 2QJMA 3H55A 5JH1A 3ARPA 1FDYA 2OODA 2UY5A 3H2EA 3AIQA 3WJYA 3PG9A 6A3HA 3WD2A 3SY8A 1H0GA 4US5D 1W3TA 4BI5A 4B5NA 1P7TB 3WUBA 3ARYA 3CIWA 5CZTA 1Q3NA 4C6OA 3FYPA 1W5PA 4I9JA 2ZIDA 4JFWA 1WCGA 4IG2A 5A8NA 1YE4A 3LPPA 4KF1A 4W8AA 3V5FA 3WUFA 2Z1SA 2J74A 2X41A 5HPCA 1BYBA 3L4ZA 3L66A 4A3RA 1AW2A 3U7VA 4H9TA 1W2PA 5C55A 4AISA 2ABAA 5HNRA 4HU3A 7REQA 4RW3A 3CYJA 1V02A 1OFEA 4ZFCA 1TPVA 2BG5A 4NVTA 3KCJA 3RK8A 2ZE3A 4NZCA 3GIPA 4M7SA 1NF7A 3UXKA 2C14A 1QWKA 4UQEA 3N15A 1TPEA 2GOUA 1YEYA 2WNZA 2CBJA 5HUPA 3UVIA 3S6OA 5BXRA 5HJYA 4M1RA 5BWAA 1QW7A 2PLMA 1UWQA 2QPSA 4NYYA 5K7JA 2ACRA 1KM5A 4MADA 2VOMA 2GVJA 1FWWA 3P6LA 2AQWA 3IJQA 5DRIA 1WA3A 3UZYA 1VQTA 1X7FA 2QF7A 1K8CA 2P10A 1YDOA 3FKRA 4LVAA 4E6MA 4RDZA 3UY7A 3XIMA 4BR1A 4Z1DA 4A6GA 4DNHA 4EOUA 4IJRA 1NOUA 1P0DA 2E8ZA 4GX8A 4IWWA 4QDWA 4G7EB 3FFSA 4HSNA 4GABA 5A2BA 3A4WA 3G1RA 5CZKA 3W2JA 1O94A 4FALA 3UJFA 4S3KA 4UCFA 1I75A 1QW9A 3APGA 3H53A 1WNOA 1I2PA 1XQKA 3M5XA 2ZRYA 1LWIA 3T2OA 3TZFA 1IT8A 2BX7A 2O9TA 4GUGA 4MFDA 4DZHA 1TJPA 5L9FA 1QFEA 1FKXA 2AKZA 1TV2A 5A8GA 5BNKA 2XU2A 4IIEA 4JTEA 3M7SA 4AZGA 3E0LA 3LCIA 4OOZA 1XX1A 5D05A 3I4KA 4K38A 3KLLA 1OGSA 1V6UA 4HK5A 1I6NA 2XGIA 1OGGA 3O15A 4NU7A 4HNLA 4GFSA 5CAHA 4W89A 1K9FA 1W9UA 3XISA 2IKIA 1PV8A 5A6KA 2HXUA 4PTMA 1MXSA 1HKMA 1E1CA 4IL2A 4UTWC 3TFXA 3G1SA 3T9PA 3HPXA 4ZO7A 3VZXA 3OGSA 3IJIA 1YADA 2P3EA 3WLMA 3T1GA 4ZB5A 2QF8A 3C61A 2PDXA 2XVKA 5F4XA 2LLEA 2HVMA 1S5VA 3WSUA 4PCSA 3OHMB 2AGTA 3EX6A 3MPGA 4R85A 2WHLA 4KGLA 1V0KA 2NV2A 2QPUA 2ZUNA 2OT0A 1IT0A 4L6OA 4TXEA 3T2PA 1S1PA 4UQ9A 4PCFA 4JDYA 1Z8AA 4EXBA 2DU2A