3W2KA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-165
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-165
rcsb
source organism Trypanosoma cruzi
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2kA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2kA01
3GB6A 5F2LA 5EBUA 2J24A 1RR2A 3LHTA 3EX2A 3M41A 3QFEA 4NNAA 1G7UA 4NNCA 4S2BA 3QZEA 2GOUA 2UV8G 3QQ0A 4N6EA 3B4UA 2NXIA 3TFXA 4UNLA 1DJNA 3TAOA 3PAJA 3ANYA 2I9EA 4RKAA 2Y89A 5CSRA 3EB2A 5EY5A 1FDYA 3L65A 5HQEA 1VH7A 4E38A 1Q45A 1GYLA 1TTPA 3NQ7A 1MEWA 2QCFA 1I2QA 5G4WA 1XI3A 1OYAA 3P74A 2JKPA 5FF7A 3NQVA 3QSRA 2ABBA 3L0KA 4O54A 1FCBA 4LC8A 5F1UA 2QCLA 1LLWA 3GKFA 3EX6A 1WAUA 4QIUA 1XDLA 5DCBA 4IPJA 4IJBA 5HR7A 1H5YA 1VR6A 1ICQA 3NL3A 4X3ZA 4GJ1A 1SFLA 1J2WA 4NNBA 3VFLA 1DBTA 2BZNA 3OVPA 1OG0A 5CKSA 3GDMA 3NA8A 1DVJA 3G1VA 4BFAA 1W5NA 1FDJA 3GAYA 3UXDA 1TV5A 1XC4A 4EVZA 3UWZA 3GNNA 4AF0B 1KM6A 5LKYA 5F1VA 3NXFA 3PG9A 1ZALA 2V5LA 3LI1A 5D33A 1F74A 3PBWA 4AWSA 3LRMA 3TR2A 4JIPA 3W23A 3S5ZA 4YL2A 2VEKA 4AWUA 4EIVA 1VRDA 2C6QA 2Z6IA 2EHHA 2A4AA 1XM3A 3BLEA 1MO0A 5F4XA 1G7VA 1W5PA 2WO5A 2YPIA 2WSRA 3U6WA 3L2IA 2YSWA 4PA8A 1T96A 4U28A 2J88A 3L5AA 4UTMA 1W31A 4JTKA 1O5KA 4AAJA 1Y0EA 4XUGA 4HKPA 2BTMA 1YADA 4GUFA 3TH6A 2OX1A 1N7KA 2E77A 3PY2A 2V30A 2A7NA 4XTIA 5FEXA 4MY8A 4ADSA 5HINA 3EWBX 1W3IA 3G8EA 2YYTA 3LHUA 3W85A 4AEOA 2Z6JA 3N14A 2CZFA 2QCEA 1JQXA 3P61A 1XUUA 4LVAA 3QPYA 1LROA 3MHFA 4WJEA 5CZJA 3C2OA 1NVMA 1A5AA 4Z08A 2CLEA 1Q3NA 3TAKA 3TUUA 3M5YA 5EKYA 5H2ZA 3AO0A 4JDBA 4AVFA 1X1ZA 3C61A 2A7RA 2V0TA 1TQJA 2ZQ0A 4JTHA 4A2SA 3LV6A 2V5BA 3W7QA 1DV7A 1V5XA 4Q32A 4CNNA 3N34A 4K38A 4CQ9A 1TPDA 5BNKA 1PIIA 2B0MA 2GVGA 5BMWA 4NX0A 4NJJA 3N73A 3FJLA 1TYGA 1P1XA 3VKJA 4ZMGA 1GYNA 3B03A 3L5LA 4LUJA 3NDOA 2QF7A 3BK0A 3F4NA 3N2XA 2ISWA 2VFDA 3CIXA 5A5WA 1JVNA 4LS0A 1AK5A 3G22A 4LTSA 4ML9A 1Z42A 4FEZA 3ABSA 4NJKA 2DZPA 1J4EA 4O1BA 5J5RA 3W7PA 4RJEA 1LBMA 2YFNA 4JY8A 4O16A 3OEXA 3TNOA 2DJLA 3ZFHA 3LRKA 3S1VA 4EWND 3S1XA 1KLYA 2ZTJA 3W3OA 3SIZA 1MSSA 3STCA 2QR6A 1KFBA 1G4PA 3TSBA 2ZFAA 5EYWA 4OQVA 3W73A 1Z41A 3KHJA 4UFIA 3BPWA 4ADTA 3W07A 3GR8A 2E6YA 5E1QA 4MZ8A 1W37A 1YTKA 4NU7A 2QDGA 2RDTA 1JULA 3C8FA 1NEYA 1ME9A 1VCFA 4JTSA 1WBHA 3TXVA 1O4UA 4HNUA 3LHVA 4UR7A 5K2ZA 1FWWA 1P4CA 3EWZA 3W72A 1H7OA 1OX4B 2C0AA 3E12A 3EWYA 2QKFA 1AG1O 2CW6A 3T44A 5U7SA 1VC4A 2QCHA 3W1LA 1XDMA 2FPYA 1P0NA 5D09A 3FFSA 3W1QA 3NQDA 3NG3A 3N9RA 3UZ5A 1LBFA 4FNTA 3W1PA 2B4GA 1Q6RA 1H7RA 1LP6A 2DZUA 1ZJIA 1B4EA 2WOQA 1G4EA 4N4QA 4AHQA 4XTDA 3G1HA 1G4SA 4O57A 1XBYA 4TMBA 1QMLA 1IXPA 4O11A 2FB3A 3TU9A 1QR7A 2V81A 2A5HA 2VEPA 3M5VA 2EAWA 1LYXA 1SZNA 3QW3A 4JTLA 2NX9A 3HPZA 4LOCA 3NL6A 2Y63A 2C19A 1GVFA 1OYCA 3SZ8A 2Y7FA 1SUXA 4YCOA 2A21A 1JQVA 2G95A 3B06A 1I2RA 1VZWA 1EWDA 5FI8A 4JD4A 2HSAA 3DENA 4YLWA 4Y96A 1L6SA 4QITA 1NSJA 3WK0A 4HNTA 4Z1DA 3W7CA 2X1TA 3H53A 3LI0A 4MZ1A 3FYPA 2C14A 3ATYA 2NUWA 1C9DA 2Y7DA 2R14A 3FIGA 3TROA 1J5TA 4I7VA 2TRSA 3EXTA 5HNRA 1DORA 5D30A 4O13A 3ATZA 5CG7A 4X2RA 3P82A 1H60A 2CWNA 1JCYA 1XL9A 2BLEA 4Y8FA 2J6XA 3RK8A 2PE4A 2FLIA 4GXMA 3DAQA 1QNVA 3G0XA 3CC1A 2A6NA 2OZ0A 1KFEA 4LV4A 4CCEA 4IX2A 4KFOA 2GVLA 5LGXA 2A1YA 5SWUA 2WNZA 3MI2A 1G6CA 2F84A 4O1DA 3OIXA 1KM5A 4CCCA 1NFBA 3NQAA 5DCDA 1BWKA 1PE1A 5CSSA 1CX9A 5D2WA 3UQNA 4QNEA 2E6AA 3TW6A 1W0MA 3CWOX 3R13A 1FWRA 3HG2A 4LVBA 3TSMA 1VGAA 2ATMA 3HO8A 1IIHA 1SO5A 1VQTA 1D9EA 3KXQA 3A23A 3TFCA 4LVGA 1SO6A 3CT7A 3O6DA 4G1KA 2CLOA 5D02A 4NVTA 3OVRA 5D32A 1T0OA 3P8IA 3BG5A 3LRLA 3TKFA 1OX6A 3I6RA 4QSHA 4Z1BA 2CLKA 2VEMA 4O4VA 1WYIA 1M7OA 5G4EA 1SW0A 3R89A 2JKAA 4NXSA 3TC7A 1OX5A 1KV8A 1OHLA 3W2KA 2E5CA 3G8RA 3I7QA 3KVKA 3W7OA 3A9IA 2QCCA 4PFMA 1O60A 3INPA 3CQ0A 5D2XA 3ZWSA 1K02A 1JUKA 4JTTA 2VENA 5D38A 1OFBA 3ZS4A 4E2DA 3W71A 4R7JA 4WQ6A 4A21A 3HJZA 2VC6A 1L6YA 1OJXA 3DHFA 1ONRA 2RDWA 3OBKA 4JYEA 1KM4A 1KV5A 5CZ0A 4UFMA 3OVQA 4TU1A 3GK0A 3A21A 1SW3A 4JTGA 4DF1A 4JX4A 4RK8A 2FPVA 3G1XA 3A5VA 3TW7A 5DXXA 1F6KA 1EIXA 3LTYA 4R34A 3P8JA 4FXSA 3O6YX 3GKAA 1O94A 4LUIA 3C6CA 4N9BA 3QMTA 3LX9A 4MYAA 1FUYA 3BW4A 3HMJG 1GZGA 4N02A 4O12A 3UY7A 3BO9A 4K6AA 4FXRA 1YDOA 2IQTA 5DN1A 4OE7A 1SZFA 1LBLA 2FDSA 2JGYA 2QUUA 3MP3A 2FB2A 2FIQA 4RZ5A 1H7NA 3OA3A 5KTLA 4H3DA 4FF7A 4UMBA 4BWLA 3F03K 1ALDA 1N8FA 3MP4A 5FF0A 3C56A 5E0KA 4FIRA 4PL2A 3GIYA 4GBUA 2Q3OA 2QAPA 5FF3A 3M43A 2NUYA 2WNQA 5KZDA 2WSQA 2ZDRA 3W88A 1FXQA 3EKZA 1RPXA 1TO3A 5HUOA 3HOJA 1P5BA 2VEIA 3BW2A 3G1YA 4WY0F 2ZZ2A 2V2HA 4FO4A 1ICPA 2Y62A 3DI0A 1VCGA 3NQMA 2NXHA 2J27A 4I9AA 4UFJA 3N3MA 3HQ1A 4JY9A 3HF3A 4LWWA 1RQBA 5AHNA 4NJGA 1LRTA 1F6PA 3FJ6A 1ZAHA 3O07A 5G1TA 4ZQPA 1KFCA 3QM3A 3S5OA 1WV2A 4QNWA 1TQXA 3QPZA 5IBXA 4ORIA 3P84A 3JR2A 3G3DA 5TBOA 2ZZ3A 5C5YA 3IGSA 4NZJA 5I3FA 3L67A 3LCHA 5AC8A 3NPVA 5LNUA 3PB2A 3L9CA 2JKEA 2QJIA 3F4WA 2ZZ7A 4GFSA 1F73A 5D05A 4MKNA 3C52A 1SO3A 4FX6M 4W9TA 3NZRA 3M16A 2D73A 3GYEA 4ZQRA 3WJSA 1OX4A 1AW5A 3BARA 3TSDA 5LNSA 4ZQOA 2B7NA 4LY8A 5CPOA 4EF9A 4L4LA 2ISVA 2EPHA 4LV9A 2GQ9A 1DKWA 1I2PA 3W1UA 1EA0A 3SR7A 4GUIA 1M7PA 2VFGA 5K9XA 4GRSA 1GT8A 1EX5A 3SFKA 2Y6ZA 4HPJA 3UNDA 3RLUA 4A29A 4IMCA 1WBJA 4OV4A 2ZZ1A 2XN0A 1OK4A 1H50A 1TJPA 1JCLA 1ADOA 3EWUA 3HGRA 1VLWA 4FIQA 1AL8A 4FNPA 5G1YA 1TTJA 1W3NA 2HS8A 5D37A 1OFDA 5F4WA 1XFBA 1TRIA 1ZCOA 3IGUA 5AB3A 5LHEA 1I2NA 1NF0A 3STGA 4FNSA 4AWTA 4RXFA 4JIQA 2GQ8A 4JTFA 2ZRZA 4JS3A 3NQ6A 4LS2A 3W6YA 3S5NA 2Y70A 3W7MA 3G0UA 2Q3RA 3QJAA 4UTWC 1WOBA 4PCFA 3KAOA 3GDTA 1UASA 2ZRXA 1ZENA 5MHBA 1PV8A 1YPIA 2ATSA 4YCPA 1QWGA 2ZRYA 3GXPA 1FY6A 3NO5A 4HN4A 4QQ3A 2X1RA 4XBKA 4YXGA 3I68A 4OHQA 2QJGA 1I45A 3THQA 4AHPA 4RLIA 3LCIA 3FYOA 4LRSA 5K7JA 4RZ4A 4IXHA 1QPNA 3GXNA 3W76A 3EWXA 5DY3A 5F4SA 2Y61A 2YCEA 3PSVA 4D2JA 5AC7A 2ALDA 3QF0A 3CLMA 1SFJA 5J5DA 4ZZ9A 3PULA 6ALDA 1QAPA 3IIZA 3W1TA 3ABRA 3P7YA 3TMLA 1F5ZA 1HTIA 1I4NA 3IVUA 3TJXA 1SSGA 1G69A 1ICSA 2G97A 3P5ZA 4AHOA 1S3HA 3FKKA 5BOOA 3LBMA 3SI9A 4OBTA 1VHNA 1KTNA 3NGJA 4UTTA 4QISA 3MWAA 2A85A 2C3ZA 2VFIA 3NNTA 3UPWA 4R53A 2X1SA 3CM4A 3OHIA 3W7EA 1FWTA 3CWNA 2QUTA 3NVTA 4LW7A 1KTCA 2PRLA 4MUZA 4XKYB 1W8SA 3HPSA 4IXXA 4DXVA 2VFFA 1SSDA 1Z48A 3GR7A 3MMTA 1LDCA 3DGRA 3M44A 3NQFA 4UTLA 3GAKA 1DQWA 4JX5A 3P67A 1W1ZA 4U4MA 3DU0A 4RXGA 3W87A 4O0ZA 3L5MA 3NM3A 5G2WA 3S5YA 3FKRA 2I14A 1LCOA 4KKXA 3W86A 3M47A 2RKXA 4MY1A 2V8ZA 4HIBA 1SPQA 4UTHA 1VJIA 4R33A 1UBSA 2C15A 1SU5A 2V82A 3TQKA 1EP3A 2PRHA 5CPNA 3SSJA 1HG3A 2JK2A 2XFWA 1OFAA 1VLIA 5HWMA 2X2GA 2G96A 3IGXA 4O28A 3GX9A 4UFLA 3W22A 2EF9A 5DCEA 4UTKA 3W1MA 2ZYFA 1BEUA 2XN2A 3LCGA 1AW2A 4IUOA 5HR6A 5FEPA 2ZA2A 3EX1A 2BXVA 3LDVA 5T26A 4K39A 1QO2A 2BSLA 3QSTA 1OABA 1KFKA 4CLMA 3W7IA 1KTBA 3ELFA 1XUZA 2ZZ5A 3Q58A 2CLMA 2CLHA 3QMSA 4MVAA 2AAMA 4X22A 2WV8A 3NOEA 4KFPA 4I7WA 1GVRA 1X7FA 4LT9A 3VCRA 2DP3A 8TIMA 2YXGA 1QPQA 1AL7A 1GG0A 1LTDA 2NX1A 3U8GA 3VNDA 2X1UA 1SZEA 4BF9A 3CPRA 4MZYA 3SJ3A 3W7JA 5L9FA 1SO4A 1R2RA 3UWYA 4NT0A 2E6FA 3PVFA 2WJZA 3PBVA 4M19A 4UTIA 1JCJA 3LV5A 1RQEA 5LGZA 3YPIA 1DQXA 4N9DA 2OT0A 1QOQA 4DQWA 3KRSA 5I3KA 3NL2A 3UWQA 4JTEA 3FS2A 1MZHA 3B05A 3TA6A 2CZ5A 1MEIA 5A8GA 3NL5A 4O10A 2VKZG 4N4PA 5DBTA 2RH9A 2FTPA 3S0CA 1BWLA 1WDWA 2Y7EA 4N9CA 3H54A 1A50A 2E68A 1HL2A 1TIMA 3G1DA 4TR9A 4WD0A 1FDZA 2YX0A 4FNRA 1VYPX 2A0NA 1YXCA 1LOQA 1LRQA 2E09A 5BMXA 2R8WA 2C13A 5AYXA 4KFNA 3LCXA 3STFA 2GUUA 1F7BA 3DFSA 3EX3A 3W9ZA 3W1RA 2TMDA 1LZOA 5CGQA 5K4ZA 4GE8A 3WJZA 4B5NA 2FJKA 4WOZA 4O15A 3HG4A 2WNNA 2WQPA 3QMRA 1NAL1 5DY2A 3ABQA 3G18A 3LLDA 1TPEA 2H3DA 4M6PA 4QM1A 1QOPA 1YDNA 1V7YA 2RDUA 2AGKA 5AYYA 2VFHA 3DHDA 3MBFA 3PR2A 3GDLA 1K8XA 4Y9AA 2OT1A 3MBDA 1H62A 2B7QA 3P80A 4MPQA 3PBYA 3B04A 4L4MA 5HMSA 2VFEA 4N9EA 2P1FA 4IGHA 1F05A 3BGJA 3RF9A 1Z44A 2TSYA 3EEGA 3NEVA 4S1FA 1LLZA 1B9BA 3W1NA 4Z1CA 5L6UA 4NX5A 3BVJA 4P61A 1TV7A 5F2MA 1TPVA 3S1WA 4MY9A 3T4CA 5LNVA 3KRUA 1HFBA 5K3VA 1XKYA 3UD6A 3PG8A 4ZQNA 1K8YA 1TTIA 2GJLA 4IQLA 4M6VA 4C1KA 5LHFA 2G5WA 4ONVA 1W5QA 5HWNA 5D03A 4IMEA 4BI6A 3PM6A 2EKCA 4BI5A 3TQ0A 1SQ7A 3P60A 1VYSX 3WK3A 3UWVA 1TREA 3USBA 1B4KA 4DO6A 5AHEA 3G24A 2VXNA 4RR4A 4WOQA 4UC5A 1W56A 2ZZ4A 2C18A 1QPOA 3I7SA 2QCDB 3NZ1A 2O7QA 5IM51 3N9SA 2AQWA 1JCMP 3MYPA 2WKJA 5GVJA 4CNPA 1GVOA 1W54A 3D0CA 1MXSA 3S8HA 4ZL1A 4MFDA 5I3HA 3NPWA 4IPIA 4HSOA 4DF2A 4NJIA 4K8HA 3N2MA 1EB3A 3NR0A 1X1OA 2A6LA 1FCUA 4O17A 1GOXA 4O8RA 4FNUA 1FCQA 4M7TA 1OYBA 2X16A 3LM7A 4O19A 1HUVA 4UTJA 3TMQA 1IGSA 3O6CA 4MOZA 2ZZ6A 3NQ8A 1RQHA 5EL1A 4A2RA 1KFJA 1CW2A 3Q2DA 3LHYA 4X9SA 5F2IA 4NXKA 4UMCA 5G5IA 1FXPA 3P62A 4DELA 4K36A 2NX3A 1AMKA 1H7WA 1IXOA 4HNVA 4PEKA 1D3HA 3IV3A 3TIMA 4IMDA 2O7SA 1ZAJA 2ZCGA 3VI2A 2V2CA 3IIOA 5D2VA 3I7RA 5K9CA 2Y7GA 3UYCA 3NQ2A 3O05A 4JR5A 3SECA 2DZXA 1IXQA 1Q6OA 5EMUA 4UIOA 5K9DA 1YPFA 3VE9A 3VE7A 3DH7A 5KMYA 1IIGA 4XKYA 3L66A 3S6DA 4JYFA 4NZFA 4ZQMA 1M6JA 4HT3A 3FOKA 3KRZA 1YLVA 1ML1A 2GVJA 4DF0A 3G0SA 1TB3A 4JNMA 3TXZA 3W2LA 2P0OA 1KFLA 5AC6A 2GJNA 3W7DA 3B0PA 1WX0A 3I65A 3B8DA 3KX6A 5HJLA 2CZEA 1TPB1 4ZQCA 1UJPA 3EXSA 4RZ6A 3W2NA 2R94A 1EP1A 4BR1A 1SZGA 3GZ3A 1YTEA 3P5YA 1GVQA 4H6KA 1L2UA 3TJLA 2H3BA 4K7VA 4MYXA 1Q6LA 3ZWTA 5CPLA 1DOSA 4MLRA 3WJWA 3W1XA 1WXJA 2E5DA 2NLIA 5D04C 4AH7A 3ZR4A 4NUWA 4I7UA 4OT7A 3M1ZA 5KITA 2ZA3A 3AJXA 3SGUA 1FBAA 3HBLA 3UPBA 1G4TA 3OG3A 2Q8ZA 1AW1A 2FQIA 1D3GA 3W7LA 4JTJA 1O95A 1XXXA 2OJPA 5E93A 4O18A 3QH2A 1QCWA 1TCDA 1GQNA 4JDYA 2H8XA 3HPXA 3W70A 3M0ZA 1OFEA 4WX2A 4K8EA 1W3TA 3M5ZA 1KM2A 3LHZA 3T78A 1K03A 3G1AA 3W7GA 3KVJA 5G2IA 3DZ1A 5HUPA 3HGOA 2QUVA 1E51A 3QW4B 2DZVA 1L9WA 3R2GA 4ALDA 1JCXA 1S5WA 3KFTA 3N19B 1L6WA 4HHPA 3NPUA 1JRBA 1VYRA 3MW7A 3IVSA 3WFAA 4HPXA 4DPPA 2NXGA 4AXKA 3LCWA 4Z0JA 3LB0A 2WPBA 1JR1A 3B0VC 4PH6A 4DBDA 3M5XA 2CLLA 1H63A 3THAA 4OV9A 4WUIA 4MIMA 2P10A 3TDFA 4WY0B 3MP5A 1TJRA 1KBJA 3TCEA 3E49A 3W74A 3DFNA 4HSNA 3B0UX 4E2BA 2B7OA 5HWJA 1YTDA 3HG3A 5FF4A 3C2EA 4N2YA 1I8JA 2YW3A 3DXIA 1CI1A 3LLFA 1TPFA 1T8XA 4LU0A 4RCXA 1K8ZA 3DKLA 3A5FA 1QFEA 3V75A 1SR9A 1GEQA 2NV1A 4WXYA 3C2VA 3H55A 3HB9A 1LRNA 4JXCA 1OFQA 3T40A 1A5BA 4NJHA 4MFEA 1F76A 2YGYA 5LNRA 4Z1AA 3RU6A 4C1LA 5I3GA 5DLCA 1YXYA 1U5JA 3W7HA 3LBCA 1U83A 4O1AA 3KVMA 5DELA 2QCGA 5CZTA 5AFDA 1S5VA 3DFPA 1THFD 2PC4A 4LVDA 5BRBA 3PF3A 3W2MA 1LOLA 1PHWA 3M6YA 5U4NA 4BK9A 3L68A 4JYDA 4FHAA 1X6UA 4ZVJA 5FEZA 2DJXA 4IMGA 2B7PA 2BWGA 2DZTA 2J9ZA 4OWGA 4AB4A 1PCKA 1TTQA 5KSWA 3CB8A 4J9JA 1A53A 3G3MA 4LRTA 1K7EA 5AYZA 2Z0IA 3G1FA 2RHGA 3WJXA 2HS6A 1TSIA 4JGDA 4ADUA 1ZY9A 2J9YA 4JEQA 3R8RA 1EP2A 3KVLA 5DBUA 1ZAIA 4ICNA 3RFAA 3BLFA 1A5SA 1FWNA 5C54A 2YW4A 3Q37A 4RV8A 1H1YA 3BG9A 3O63A 3O1NA 2E1DA 3NQEA 1EUNA 2J9XA 4LS1A 4GUGA 1TPH1 4M7SA 1B3OA 1YXDA 2E5BA 1MEHA 4A22A 2Y85A 4KWVA 4N6FA 4O52A 3WK1A 1H61A 1VHCA 2QCDA 1ME7A 2DU2A 1KM0A 1UUMA 2LLEA 4PODA 3E0IA 1JJKA 3HGSA 3W7NA 4FB7A 1X8FA 2DZSA 3FEMA 3NYZA 3S9YA 1QDSA 1KM3A 3GNDA 3F1QA 4IWWA 4GUHA 1Q6QA 2W6RA 3MO7A 5AHMA 3EX4A 3DKJA 1KBIA 3QRHA 2ZRVA 1OF6A 1FCVA 2HMCA 1KM1A 1RVGA 1RZMA 2A2IA 1ZHAA 1GTHA 4K37A 3IRDA 3W83A 1H7PA 4BI7A 1GVSA 3LXAA 4M6QA 1LM1A 3GDKA 3ABOA 1ZFJA 2E6DA 1B57A 1P0KA 2CLFA 3PS7A 2R91A 3O16A 4Z0SA 5EPDA 3W75A 1QO5A 1W5MA 1KLZA 4BWLC 3S42A 1UB3A 2NUXA 2VELA 3DBPA 5D2TA 3SW6A 1TPUA 3PB0A 2V9DA 3R5EA 3TK7A 3MYOA 5F2GA 1C8VA 3GVGA 3R12A 1H1ZA 4JICA 2DZWA 4S2CA 1JUBA 1RV8A 1R2TA 3TQVA 3UZJA 3KOFA 3BV4A 1TRDA 2A7PA 2W79A 3TX9A 3UWWA 4K7YA 1YYAA 4JTUA 2CLIA 3C2FA 1H7XA 1OFRA 2NV2A 4O14A 3L0GA 3W7RA 3M9YA 4P2VA 3FA5A 1GPWA 2OCZA 1R46A 3RMJA 2TYSA 4O1CA 4O53A 3HGJA 4IOTA 1VS1A 1BKSA 3C3NA 3TE9A 3RLVA 2DORA 5K4XA 1O5XA 1K3UA 3WJYA 4XZ9A 1WQ5A 1XBZA 3LERA 5ABTA 5CZSA 1OFPA 5BW6A 2PCQA 2ABAA 2V2DA 1EWEA 1ZNNA 2NZLA 1OVDA 5IBXC 5I3JA 2ISSA 1LOSA 2W0UA 2YR1A 3O15A 5TQLA 5FEWA 1K7XA 5C55A 4DBEA 1GG1A 3L21A 2CFFA 2ZA1A 1GWJA 3W2JA 2NWSA 3MHGA 4UTWA 4YWIA 4JX6A 4GWEA 2H8ZA 2KZHA 4XBSA 3GLCA 1W5OA 3SGZA 2PURA 1YDVA 3NM1A 4WZHA 4UXDA 3LXBA 3LOTA 3IIPA 3W84A 4LC6A 3DI1A 1N55A 4UFKA 1LORA 1PL9A 3JS3A 4DO4A 3MI3A 5C2XA 3NAVA 4Q4KA 2C1HA 3T7VA 2CZDA 3CIWA 3LHWA 4DEFA 4UFHA 1R2SA 5LSMA 2BX7A 4O0KA 4UNKA 2ZRUA 3EKLA 3DFQA 3QQ1A 3U2OA 3MJYA 5AN7A 1WA3A 5FF2A 2JBMA 3FLUA 4MJMA 1XBVA 4PTNA 4JTIA 2H90A 3GDRA 4GC4A 4FX7A 4FNQA 1PHQA 4UCGA 3QEZA 1R47A 5G2HA 1FQ0A 3TC6A 4NQ1A 4UUIA 4KWWA 1KA9F 1JCNA 4GNJA 1OFOA 2C16A 2ZTKA 4LVFA 3IVTA 4UTUA 3W2UA 4IMFA 4QJ1A 1NF7A 4XWUA 4XQ6A 3NQGA 2VOMA 3T55A 3K30A 3A22A 3MHUA 2NWRA 1C29A 2F7FA 1DL3A 4O50A 1T99A 4DPQA 1TPC1 1DJQA 2OMAA 1OF8A 1PCWA 2WSYA 5DXYA 3M7WA 2HTMA 2QEZA 2Q8LA 4M5PA 4IX0A 3LCLA 1TMHA 3V1PA 1F2JA 4TMCA 1HO1A 4CQAA 1A5CA 3GXTA 3WK2A 2RFGA 3JRKA 4UMAA 1DHPA 1UCWA 3IIXA 4Y6GA 3C2RA 3RNDA 3BG3A 4WY0A 3IEBA 3NQCA 4HNNA 2YDAA 5KINA 2ZBTA 4YMZA 1R30A 3PC0A 4AF0A 1EUAA 3HIJA 1SW7A 1TV8A 4Q33A 2Z1BA 4GUJA 3MI6A 2QAFA 3L0NA 1EPXA 2GQAA 3BW3A 3W7KA 2CU0A 3UY8A 1UUOA 2JGQA 3CHVA 3QC3A 2X30A 3E02A 4CCDA 5C6MA 1K7FA 4PL1A 5H91A 3MUXA 3PUEA 1VPXA 1G67A 4EF8A 4POCA 5TIMA 1ME8A 2ZRWA 6TIMA 2FFCA 2GPTA 3EWWA 1VCVA 2YYUA 3CU2A 3E96A 4Y90A 4AMAA 5FESA 3LCFA 2XN1A 3PUDA 1TPWA 3DFTA 3CEPA 3PWAA 3C4UA 5I3IA 3HG5A 4WXZA 5D2YA 7TIMA 3W1AA 4UTTC 1BTMA 1KW1A 5AHIA 3LXCA 1EEPA 3SY5A 4MLJA 4E0CA 2I1OA 5AOUA 4ORMA 4LNYA 3Q94A 1JUEA 2QDHA 5KZMA 5AHFA 4TX9A 3LGEA 2TPSA 1PVNA 3P81A 2QCMA 5KZEA 4QAIA 3C0JA 4CQ8A 1XCFA 2Y88A 3CTLA 4O4WA 4EOUA 3IIVA 4JN6A 1JRCA 4FX8A 3UXAA 1PS9A 2EGZA 1M5WA 2PRMA 4PC8A 1RD5A 3CEUA 1GJPA 4OU1A 1QPRA 3STEA 1IXNA 3PSWA 2QCNA 4OGZA 3S1UA 1HO4A 3DFOA 3BLIA 5AHLA 1I2OA 4MJZA 2FPTA 1WOAA 3BGGA 1XBXA 3EXRA 4CNOA 3E9AA 4UR8A 2H6RA 3PBUA 5LNWA 1IF2A 1H51A 1S5TA 5CPMA 3PUOA 3A24A 2QJHA 5EA9A 3NPXA 4H4IA 1FX6A 4TIMA 4A3UA 4TO8A 2Z2UA 4RX0A 2YZRA 3LTSA 3G1SA 2YFOA 3QYQA 1GTEA 3UWUA 3LTPA 1OK6A 4DO5A 3O8AA 5HULA 3O06A 5LZLA 3TV8A 1FWSA
chains in the Genus database with same CATH superfamily
1Q8AA 2J24A 3VNIA 3M41A 4NNAA 4C6BA 1TV2A 1Q4WA 3RPTA 1WDDA 2NXIA 3TFXA 3TAOA 4JIEA 3PAJA 3EPMA 4RKAA 2Y89A 3EB2A 1EYWA 5EY5A 4CU8A 3L65A 1VH7A 1Q45A 1QI2A 1UWUA 2EXOA 1TWIA 4GQRA 4QR6A 4PTDA 5LA1A 2PU0A 1XIBA 3WMLA 3WD1A 4YYCA 3LPPA 1I2QA 3URQA 3S1GA 3EB4A 4PCPA 3ZZ1A 3HTWA 1XI3A 3P74A 2JKPA 3NQVA 4LCSA 1FCBA 2X0SA 4DJEC 4GI4A 2YLAA 3VCNA 3OBEA 1WAUA 4IGNA 4DNHA 4IPJA 5HR7A 1H5YA 1VR6A 1JZ8A 4BS0A 4X3ZA 2OFJA 1J2WA 2XYLA 1KB3A 3VILA 1OG0A 2HZGA 3MDUA 1W5NA 1FDJA 1HN1A 2INFA 4DAFA 4FAMA 2WMIB 4JFTA 3HFYA 3GNNA 1KM6A 4MSSA 5LKYA 3N2BA 3MUZ1 2R1KA 1AQMA 4H2CA 3P0WA 3U4AA 4XUYA 2WVUA 1BSIA 3LRMA 2CYGA 4YL2A 2VEKA 4D6GA 4QHRA 2XSXA 4IPPA 1Q6FA 5IXEA 3BANA 4JEJA 2YZ5A 1S2AA 1XWYA 1OCBA 2NW0A 3QLDA 4HZMA 2WSRA 1T7LA 1TV4A 4PA8A 1JFXA 1E9YB 1Q65A 2J88A 1XPYA 3EOOA 5LIXX 1YADA 3TH6A 1N7KA 1RBOB 4KRUA 4XTIA 4KEVA 4MY8A 4PUWA 1C8YA 5HINA 3EWBX 1W3IA 1EHAA 2YYTA 2Z6JA 3N14A 1J5SA 2X09A 2PDLA 3LUTA 3QPYA 5CG0A 4LB3A 5CZJA 4H19A 2ZE0A 3C2OA 3RRXA 5BZAA 4C90A 1DIOA 3E2RA 4Q4QA 3OB8A 3L7RA 2W9MA 5AYBA 7ENLA 4K1WA 5T91A 2V5BA 4Q32A 3UERA 5HOSA 5BNKA 8A3HA 1J10A 5CPTA 2GVGA 1JDEA 1REQB 5A6SA 3VKJA 3VIFA 3B03A 3HV9A 2VEFA 4IIHA 1XGDA 3QV7A 3QV9A 4MF4A 3G22A 1M41A 4ML9A 3U2EA 4FEZA 3TVAA 4CD6A 3W7PA 3ARUA 4JY8A 3BC9A 5EBAA 3TNOA 4NG3A 2DJLA 3LZ3A 3UXIA 1B90A 3MCNA 3S1VA 1KLYA 3STCA 1UA3A 4DX3A 1XINA 1EC7A 4OQVA 5EYWA 5HMDA 3U0HA 5GJNA 2OXNA 3QGAC 2V5DA 3W07A 3GR8A 1IEXA 5E1QA 3WLTA 1YTKA 3GHTA 2VO5A 4AIBA 4UOQA 3C8FA 1JDCA 1NEYA 4D6CA 3IWPA 5CLWA 1ME9A 3PBMA 4HTBA 3W82A 3V7PA 1FWWA 6XIMA 3MSYA 4PTXA 1FH8A 2WCSA 3ANUA 1JPMA 2MUCA 1F61A 3M4HA 5E09A 2DY3A 1VBHA 3W1LA 5D09A 1Q6RA 4ENLA 4J7RA 6REQA 4H8HA 1QBBA 1ZJIA 1B4EA 1XF0A 3Q45A 4N4QA 3GVRA 1XBYA 1GZJA 4JHZA 2FB3A 3BCJA 2DPEA 2A5HA 1POJA 4B9YA 4QBXA 3QW3A 4XX6A 2VZVA 3PJUA 6TAAA 4LOCA 2W3ZA 3NL6A 2WMJA 4LB4A 2C19A 2D0GA 3T0BA 4LBSA 3B8TA 8CGTA 1QWKA 1JQVA 3RHGA 1V03A 1SZRA 1QI4A 4YLWA 4U5KA 4TTUA 3AICA 4Z1DA 3W7CA 3CL6A 2X1TA 3LI0A 2F2KA 1JPIA 1PTDA 2XINA 3KRBA 3UT0A 3ATYA 2NUWA 2Y7DA 3FXGA 3FIGA 4PFHA 5E6YA 2IKHA 4I7VA 3GTIA 3EXTA 4O13A 4L6DA 1S2WA 4AD5A 4QP0A 3GXFA 4J4KA 5ABGA 3TTQA 5CJMA 3BQ6A 3N25A 4GXMA 3DAQA 1QNVA 5M3WA 1KFWA 1QATA 4LV4A 2VCAA 4CN1A 3C2YA 3BMVA 4KFOA 3UR5A 4ZOBA 5SWUA 4U5IA 1WXYA 3WLIA 3UF9A 2F84A 3WX7A 4O1DA 4JFUA 1EOKA 1KM5A 4CCCA 1BRLB 5DCDA 5EB8A 1BWKA 1KRMA 2XH2A 3GH4A 5CSSA 3UQNA 3QR3A 3ZLGA 3TW6A 1W0MA 4W7UA 3UZZA 3T9PA 1WZLA 3QOKA 3CWOX 4D1JA 1JPKA 3AFBA 1DJXA 4LVBA 3NDYA 3F2DA 3E1F1 1DYSA 3B9AA 3LS9A 2XZ9A 2Q8XA 1QI5A 1SO5A 3TR9A 1C8QA 3CHCA 1DJGA 2G3FA 4ECLA 4Q8PA 3TFCA 4B5WA 5D32A 3P8IA 3CQKA 1FH7A 3WLNA 3LRLA 4OUEA 3EOUA 1WYIA 4Q7IA 4HMEA 4JTCA 1J0YA 1OX5A 4JNYA 1KV8A 3W2KA 2E5CA 1PZ1A 3I7QA 3KVKA 1A4MA 1FWHC 1UP0A 3SCTA 2QCCA 2QVNA 2J8TA 1O60A 4DJFA 3UJ2A 1K02A 4XVDA 4PMOA 2OYLA 9RUBA 2REQA 5CGMA 1OFBA 3TWBA 3EOSA 1OJXA 1DPMA 3IV8A 4Y9NA 3EDDA 5E6ZA 1BSLA 1EBHA 1HGWA 4DZ5A 3S2LA 3ARYA 3KOYA 5DXXA 3LTYA 4R34A 4XSLA 3ARVA 3GKAA 1U30A 1CXEA 1RBAA 3PBGA 4LUIA 4N9BA 4MYAA 3BW4A 1GZGA 4N02A 1HF6A 3UY7A 4HA3A 5DN1A 3PZQA 4OE7A 1BD0A 2E8YA 3NSMA 1XFCA 4HCHA 1AD1A 3RJXA 4D6DA 2JGYA 2QUUA 1PKNA 3G6LA 4RZ5A 4UQEA 4ZO9A 2XFYA 4H3DA 1AQFA 4FF7A 2WJEA 4UMBA 1ALDA 3R4IA 2AGTA 3MP4A 5FF0A 2V3GA 1JNEA 5DEZA 5I09A 4XZMX 4PL2A 4DWSC 2X8RA 1B54A 2G3MA 1JEZA 3DFHA 4NZ1A 1KGWA 1RPXA 4PN2A 4YN5A 1JF5A 4L65A 3CO8A 3HOJA 1S5NA 4S39A 2VVSA 2VEIA 3N4EA 3WDRA 1NDWA 1ICPA 2Y62A 4MWAD 5EMKA 3B9OA 1X96A 1Q6DA 3W27A 4LH8A 3CZEA 1W17A 4GX9A 3I3EA 4DUOA 3M0IA 1HKJA 4NJGA 3BSHA 3O6AA 4GGHA 4X0VA 5M2FX 4NAEB 1TWDA 4F0MA 3RM9A 2FFIA 1ZCCA 1ZAHA 1VBGA 3TLQA 2PDNA 4DJFD 1TR9A 4S38A 1MFUA 3ZIZA 2YA1A 4ORIA 2DVUA 3M46A 4KCTA 5I3FA 1VKFA 1NARA 4EACA 4IIGA 2P50A 1Y65A 5ECVA 4MUPA 3EDKA 2QJIA 4EP8C 1XRSA 1I9CB 5FKYA 4C7GA 3ZVHB 4XK2A 2ZUMA 3C52A 3C0LA 1HL9A 4W9TA 1EA9C 2B81A 4XD5A 3A13A 3M07A 3MV11 2XIOA 3D3AA 2PTZA 1TCMA 1VFUA 4LY8A 4V1YA 4EF9A 4LV9A 4PSRA 2GQ9A 4E2VA 5IFPA 3W53A 3SR7A 3WH6A 3BZGA 1M7PA 4TVCA 2GGEA 2W67A 3SFKA 4HPJA 3VDCA 1VF8A 2J8GA 4OV4A 4WSHA 3WZ0E 4QLKA 2G0WA 1XQLA 1TZ9A 2QPUA 1VLWA 3HGRA 4FIQA 5H8PA 2HVMA 4FNPA 1UD2A 5F4WA 4H1ZA 5C2GA 2QYGA 3BLKA 4W85A 4LEFA 4JTFA 3SCQA 1YIXA 1ONXA 2ZRZA 4JS3A 3NQ6A 5C9UA 2Y70A 1Y5WA 2Q3RA 5KETA 1K9FA 1WOBA 1E56A 4MAZA 3KAOA 3GDTA 2ZRXA 4FA3A 3GFZA 1YPIA 4P5UA 2ATSA 4YCPA 1QWGA 1P6WA 4IICA 1K6WA 4HYVA 5LIUX 1GVEA 4GYPC 1CXHA 4HPHA 3THQA 4CGTA 2C91A 4RLIA 1YBQB 4Q4RA 1DWFM 1QVBA 4RZ4A 3GXNA 3W76A 4V28A 4AY7A 4QE1A 2YCEA 4IIEA 4D2JA 1PIGA 2ALDA 3QF0A 1VENA 3WD2A 3OLIA 3A4JA 3ZSSA 3P5ZA 4ATDA 1P6BA 3LBMA 1KTNA 4FR1A 4OUIA 5CCZA 3H4GA 2VFIA 3ZVIA 2X1SA 3CWNA 1F3EA 1C9WA 2CEQA 4MDOA 3WD0A 2QUTA 2O0TA 2JIWA 1KTCA 3UCCA 4R3UA 3EEZA 1LL4A 3FK4A 4WGHA 3UEQA 3DGRA 3M44A 4YIWA 4UTLA 5HMEA 3BAYA 3DU0A 4GCAA 5G2WA 4JIHA 3K5XA 4CKQA 3R6IA 2RKXA 4MY1A 4Q8OA 4Q8TA 3WQ8A 3VDAA 1VJIA 1CXIA 3FDKA 5GJPA 3OP2A 3GNOA 1UBSA 1E6PA 4UBPC 3OO2A 3DERA 5CPNA 1NY1A 4DXXA 5BYWA 2XFWA 1OFAA 2X2GA 3TN6A 3WEMA 3W22A 2QVHA 4B92A 4UTKA 2EJ1A 3W1MA 1BEUA 2XN2A 2XPKA 4G7FA 1W1IE 1C92A 4KPLA 1J8VA 2DEPA 3Q58A 4O8AA 4FXFA 4GYJA 2AAMA 1UH2A 3WG6A 1HJVA 3VCRA 3N4AA 2YDSA 2FHCA 1Z69A 3AXKA 1E0VA 3PTQA 5BRQA 1M03A 3CPRA 4MZYA 1HW6A 1MDRA 2VR4A 3AIQA 2YL5A 4P8WA 2E6FA 5FJOA 1PZ3A 2IPGA 1JCJA 3LV5A 1RQEA 1QT1A 1P48A 3I4EA 1DQXA 1IEVA 1NQKA 2VRQA 4DQWA 3UWQA 2CZ5A 5A8GA 5JBEA 4O10A 1IYXA 4I9MA 5DMLA 1WDWA 2Y7EA 4JQ1A 2I5QA 3H54A 4N9CA 1HL2A 1YNYA 3G1DA 3BGAA 2FZBA 4J40A 3AMGA 1VYPX 2D3NA 2YLLA 1YXCA 1JD9A 1GOMA 1LOQA 1BXBA 3EDFA 5AYXA 2V68A 1WZKA 1F7BA 2GUUA 3CZ8A 3DFSA 3IAQA 4M51A 3T2OA 5A94A 3W1RA 3N9KA 3WF1A 4V15A 2TMDA 5CGQA 1XLKA 1YE6A 4B5NA 5BXPA 2FJKA 4U10A 4WOZA 3HG4A 4PMQA 3QMRA 1NAL1 1EJ7L 3QV6A 4X2PA 4GNKB 3ABQA 1XSIA 3SB0A 1Z89A 3GBEA 4DBUA 2ON3A 4GYFA 4RW3A 3WLKX 4RL3A 1RXOB 3GDLA 5TNVA 1H62A 2B7QA 3PBYA 4N9EA 2P1FA 1Z44A 4PRRA 3WCZA 1DEDA 3K8LA 1PZ0A 3S1WA 3A4AA 4G7EB 2OYMA 4GI6A 3KRUA 1MDLA 3UD6A 1FH9A 3R0DA 1K8YA 1TTIA 4IQLA 5GNYA 4DWSB 3D6NA 3D47A 4ONVA 5D03A 2GQ3A 2QGYA 4IMEA 5BXTA 3CJPA 2OOGA 3HN3A 3UWVA 2KAUC 2KX9A 1B4KA 2VT0A 1YEYA 3EYPA 4UQDA 3UG8A 4A8IA 4NZ4A 4DXKA 3N9SA 3B8UA 3VD9A 4U3CA 3W02A 3CQHA 1Q2SA 2BVWA 5CGTA 2E8ZA 3EBVA 2XM1A 4P7RA 3OZOA 1HKWA 2BS9A 2XVKA 1X1OA 3NR0A 2XGZA 3AMCA 1DWGM 1GW9A 2D0HA 1FCUA 5JUVA 2Y24A 2OYKA 4JHMA 3MANA 4LBUA 1XG4A 3T05A 2X16A 1N2VA 3B0YA 3LM7A 4O19A 4UTJA 4A8LA 1UH4A 3WF4A 3VDBA 2O9OA 4I90A 4GIYA 4AX6A 3E6EA 1CW2A 2OEMA 3LHYA 5G5IA 4AC7C 3A64A 1Z3NA 5FSEC 4HNVA 1IXOA 4N0RA 4AZ6A 3MB9A 3TIMA 1S38A 3VIMA 1VFFA 3IIOA 3AIBA 4PMXA 3KCJA 5BU9A 3THDA 2AL2A 1IXQA 2ONEA 1BYAA 1KWKA 1DTNA 4UZUA 5AECA 3DUGA 2C0HA 4XKYA 3L66A 3S6DA 2Z1XA 1UMYA 4ZQMA 4HT3A 1XLIA 2WANA 3KRZA 1YLVA 1ML1A 1TB3A 2P0OA 4WLCA 3PNZA 4PCNA 4WDXA 4CEXC 3RPDA 3B0PA 4JHOA 5AKQA 3B8DA 1E71M 2CZEA 1TPB1 4ZQCA 1UJPA 1W1B1 3PZOA 1V4YA 3W2NA 1EP1A 4EWJA 4JTQA 1L2UA 3TJLA 4K7VA 2WCGA 1KD0A 3ZWTA 4L56A 1DOSA 1MRAA 3W1XA 2ESCA 4MADA 3WNNA 2FGBA 3FYYA 2GYIA 5D04C 4ERAA 4ZA0A 1QW8A 1TMLA 4YVXA 2AAAA 3GG1A 4AZ7A 2BHZA 4YWSA 1FBAA 3HBLA 4J3TA 3OG3A 1UIOA 4GVGA 3VTRA 4JTJA 3ORWA 4O18A 1TWZA 1TCDA 2IKIA 1UPMB 3WNKA 4K8EA 3WDJA 3N11A 2PP1A 1P1MA 1OIMA 4KF1A 3E2VA 1UA7A 4C91A 1S5WA 1PTAA 4HHPA 2YDQA 3NPUA 1JRBA 3MW7A 4FZIA 3IVSA 3BMWA 4DPPA 4PRWA 2O56A 4AXKA 1W3KA 1QK2A 3E0VA 4PSPA 3B0VC 2UBPC 4PH6A 3M5XA 4KIRA 4GC3A 1ZRQA 1H63A 2Q09A 2VCBA 3JUGA 1GW1A 2D22A 1ODUA 3UZWA 2POTA 1ZP4A 3WLSA 2AKZA 1DWJM 1TJRA 5A8MA 3B0UX 4IZGA 2VD8A 3WMBA 4J3XA 1I8JA 3CAKA 2YW3A 1CI1A 4E3TA 2C7FA 3UR2A 1RCXB 1T8XA 1A80A 1TPFA 3A5FA 1QFEA 2NV1A 4KCWA 3C2VA 1LRNA 4GO9A 1IZJA 1OFQA 4JXCA 4NJHA 2WAGA 4LJ3A 1ZGDA 1A4LA 1JL8A 1GEHA 2O4MA 2YGYA 3L4XA 2W4XA 3U7BA 4C1LA 2J7EA 4GVIA 5DLCA 5D8WA 3EWCA 4O1AA 3CZJA 3LENA 5CZTA 3RYSA 1XJBA 2WWDA 1THFD 4J5NA 5BRBA 1ZL1A 3U57A 1YDYA 1A0CA 3ZR6A 3M6YA 5EMJA 3L68A 4UB9A 5IDIA 2GFTA 2J7HA 2JF7A 5FEZA 5CSUA 2BOFX 4DUWA 2BWGA 5KSWA 1TTQA 4J9JA 2E40A 3BSGA 4LRTA 5AYZA 2IQ0A 1KXVA 3QY7A 1E1FA 3LNMA 2FHFA 4E4UA 3BLPX 4G56A 1ZY9A 5DBUA 5CBBA 1VPYA 2VUNA 1EYEA 5CBJA 1FWNA 1US3A 3E0LA 3O63A 2V67A 3B9EA 5MF5A 1E6SM 2J9XA 4LS1A 2WJFA 5I24A 4ZTYA 4DJFC 1OY0A 3KDNA 1V3MA 5H1WA 1C91A 3H21A 4M7SA 1B3OA 4KWVA 3Q65A 3AS1A 4O52A 1JDFA 1E43A 4NL1A 1QI3A 1ME7A 2GOKA 5EFFA 4LAOA 5BCAA 4PODA 3E0IA 3GH7A 1CWYA 1QW9A 4G6CA 4GUHA 1GVIA 3RM4A 4B9ZA 3EX4A 1KBIA 1ZJHA 5CC3A 4DBWA 3SCOA 1OF6A 1FCVA 2HMCA 4WGXA 5GQBA 1KM1A 2A2IA 4PMRA 4K37A 3T0CA 4AWEA 3M64A 2WK2A 3EA2A 3W83A 1TJ1A 2F38A 1PAMA 4FR6A 3KZPA 4HA0A 4Y7EA 1LM1A 3GDKA 2E6DA 1B57A 3PS7A 2R91A 2ZUWA 4XKMA 5EPDA 3M0MA 5FL0A 3S42A 4O1FA 3V0SA 2VELA 1DJYA 2IPJA 3N18A 3AS0A 3RGTA 4XAGA 3NFUA 4GD0A 3VAVA 1H1ZA 4JICA 2DZWA 3T0AA 4KEMA 3N2TA 2P88A 4K7YA 3DX5A 3WBEA 1YYAA 3LSCA 3EGJA 1MXGA 4JTUA 3MUIA 1MQQA 3W7RA 3M9YA 4E6MA 2OCZA 1BQGA 2TYSA 3B8WA 4O1CA 3HGJA 4IOTA 3KTXA 2ZWYA 2E9MA 4GIAA 3VC6A 3LERA 5ABTA 1OFPA 1XYCA 2OX4A 3IS4A 3H7VA 4QRNA 1EIBA 2ABAA 4Q4SA 2BOGX 1EWEA 2DT2A 4NP7A 2J4GA 1LOSA 2YR1A 4JQ4A 4DM2A 1W2VA 1V3LA 2UY3A 5TQLA 5BRPA 4Z42C 2XFRA 1HVXA 3CUGA 2ZA1A 3W2JA 1K1DA 4UTWA 5HXMA 4YWIA 1PX8A 4JX6A 5FJIA 1JYXA 3SGZA 1R9ZA 4AD4A 2IPFA 4WZHA 4WR3A 3LOTA 3V5CA 2J7CA 4FALA 1L6GA 1RA5A 3F2BA 3PPCA 4GCXA 5A6LA 3MI3A 2BP1A 3T7VA 2CZDA 3VFCA 1CGYA 3LHWA 1WCGA 2WBKA 2BX7A 4O0KA 4UNKA 1US0A 5H6HA 4CQCA 4MJMA 1XRFA 1XBVA 4B4HA 3VIOA 2H90A 3U5YA 3VGBA 2POZA 4GC4A 4FNQA 4UCGA 1ZSXA 2Y2WA 4D71A 3SJNA 1WNOA 4KWWA 2D2HA 4B5XA 4UTUA 1MI3A 4QJ1A 3SSZA 3NQGA 1NDZA 4CU7A 1EXBA 3K30A 3MHUA 3URAA 4HTYA 2P0IA 2A3CA 1H49A 4O50A 1HVQA 3IANA 4DPQA 1TPC1 2FZ9A 3ICJA 3SUSA 2PGFA 5IHSA 1HP4A 4IX0A 3LCLA 5CAKA 2EQDA 2O9RA 3KLKA 4UMAA 3MSRA 1DHPA 4HMDA 5B7YA 1UCWA 3IIXA 4X63A 3RNDA 2Y5SA 2IXUA 3BG3A 4WY0A 4YJ5A 5KINA 1O66A 3PC0A 3VIPA 3AQUA 4Q33A 2YJQA 3L0NA 2XSBA 4HJFA 1EPXA 4ZO7A 1CGTA 3BW3A 1QU4A 3FJNA 4FPSA 1AFSA 1BF6A 3EMQA 3W01A 3IJQA 1VPXA 1G67A 4E5TA 1ONWA 5TIMA 3WBAA 3E0FA 2ZRWA 6TIMA 1VCVA 3E96A 4Q7NA 3BURA 5FIPA 3DFTA 3WO8A 3VKDA 3C4UA 3JU2A 3W1AA 3KE0A 1BTMA 5AHIA 3LXCA 6REQB 1W3JA 2I1OA 4EPBC 4KCVA 4ORMA 4PB5A 2VWTA 1DWHM 4IPNB 3LGEA 4J27A 2YOCA 3GBDA 3VA8A 2PGRA 4NILA 2PDGA 1PSCA 4O4WA 7CGTA 4PUNA 4FX8A 3SGGA 2WLZA 3NSXA 3OZMA 4OU1A 5C9XA 1QPRA 2QCNA 1HO4A 3BLIA 1AVAA 3DECA 4H2HA 2FPTA 3CLWA 3EXRA 1AJ0A 3L12A 1R3WA 3E9AA 4UR8A 2H6RA 4GYKA 3PBUA 4L9YA 1H51A 1IR1A 3AS2A 1CPUA 2QJHA 5PTDA 4R9XA 4H4IA 3CMGA 4ZCWA 3A6OA 1RY0A 4A3UA 1TG7A 1XLHA 1C93A 3LTSA 3G1SA 1GTEA 1ZP3A 3UWUA 3HU7A 1MUMA 1H09A 3O8AA 4WIWA 3PPHA 2NT1A 2OKTA 1X38A 1FWDC 3BJSA 2WZEA 1FWSA 3EOEA 3S2MA 1L8NA 4XAZA 3LHTA 3PTMA 4M56A 4NNCA 4S2BA 2GOUA 4N6EA 1V3IA 3B4UA 2XVGA 1DJNA 1FFRA 3ANYA 5HK4A 5FCZA 2I9EA 3T8LA 3F7JA 3BAJA 3PTKA 4Z2GA 1A49A 1FDYA 1VIWA 1XLAA 5LXEA 3CBWA 1GYLA 2OU4A 3ITOA 2DDXA 2QCFA 3ANVA 3E2SA 4ZO8A 2C79A 1TELA 1JPDX 1OYAA 3DC0A 4YVVA 5AC4A 3EDEA 1UWRA 2GGGA 5F1UA 1TVLA 3VOJA 2WMGA 5GPRA 2QZRA 3KS5A 2W91A 1XDLA 5DCBA 3QTGA 4IJBA 5F7UA 4MWAB 1JG9A 1OZQA 3OGSA 4NNBA 2AMXA 4NAFA 3GDMA 3NA8A 3CZGA 4PRTA 3G1VA 4C6LA 1VIZA 3VIKA 3BMXA 1XRVA 1XC4A 3CPGA 3DHPA 3FA4A 4GK8A 1UQZA 3UWZA 1NDYA 3SDOA 4AF0B 1ZJAA 4NRRA 1MMFA 2WKGA 2PP3A 1LQ0A 2R9RA 2REQB 3LI1A 5D33A 1EPVA 2G4JA 1EXPA 4H8NA 2J75A 3B97A 4NI3A 2ZXBA 4AWUA 1EF2A 1PB0A 4EIVA 1Q6CA 3LU2A 2EHHA 3GIPA 1XM3A 3OA5A 1KXTA 4O1EA 1XIFA 1G7VA 2OO6A 3T1GA 2YPIA 1KCKA 3K2GA 1B0IA 2Y1HA 3PWGA 4UTMA 4JTKA 4MTVA 4AAJA 2D3LA 4XUGA 4HKPA 2OX1A 2E77A 3PY2A 5DFAA 3ZT7A 5A2AA 4ADSA 3NXLA 2VMFA 3LHUA 3W0KA 3FAXA 4NKCA 2X7VA 3P61A 1UD5A 2PS2A 3ABZA 3H70A 4PBFA 4WJEA 2P76A 4URIA 1AH3A 4IUGA 2XISA 1BRLA 3VOFA 1UR8A 3TAKA 2WZMA 5H2ZA 2BV9A 4OOUA 4AVFA 2A7RA 3C61A 2ZXDA 2VOTA 1KXHA 3KDOA 3FX4A 2W61A 3OQ8A 3OHMB 5ENLA 1BXNA 1K4GA 4K38A 3ZJKA 4W5UA 5HAOA 3N04A 2OQYA 1ODZA 4NJJA 4XSMA 1Q7MA 4AXNA 4KETA 3VM7A 3VZXA 4LUJA 6A3HA 2Z26A 3F4NA 3N2XA 5TF0A 3CIXA 1W9PA 5LXXA 2WMKA 3IACA 3TYCA 2GLKA 3ABSA 4NJKA 5J5RA 1HJQA 4R27A 2YFNA 4O16A 4BA0A 1E0WA 2Z24A 3ZFHA 3QN3A 3BXWA 4YYFA 4MG4A 3S1XA 2ZTJA 1MSSA 1S2VA 4D8AA 2QR6A 1XLGA 2VC5A 2ZFAA 4GI9A 3W73A 3M0XA 3GTFA 4LYPA 1XRTA 1J79A 3VNLA 4ZXOA 4F66A 3BPWA 3IJIA 1XGEA 3MQTA 3KOZA 1IT8A 1CZ1A 4H9XA 4JTSA 4Y9OA 3SCNA 3ME3A 4HNUA 2WM0A 5I23A 4XAPA 3EWZA 3W72A 1H7OA 2B31A 1L2QA 3EWYA 1QNQA 3FN9A 2HE5A 2O9TA 1AG1O 3ZOAA 3T44A 2DSVA 5U7SA 1VC4A 3UVAA 1XDMA 1P0NA 3W1QA 3NQDA 2J47A 3H2AA 2PAJA 4L1WA 4AHQA 2OELA 4XTDA 1G4SA 1DP0A 3WQFA 1QK0A 1JYVA 2VZSA 1QMLA 1GQIA 1QR7A 1LYXA 1SZNA 4JTLA 4KRZA 1KO0A 2PD5A 2Y63A 4ZOCA 4I5RA 3LGDA 4AZHA 3SZ8A 4J3ZA 2Y7FA 4XG1A 1SUXA 3QPEA 3QBUA 2G95A 4Z1YA 3H7RA 1VZWA 1EWDA 1AH0A 3VK5A 1J6OA 3VD3A 2WLYA 1UYQA 5A2CA 1RPKA 4MZ1A 1IWPA 3FYPA 2C14A 3FDGA 4HU8A 1M65A 5BXSA 1QNRA 1YNQA 3TROA 2TRSA 4Y8EA 4TQTA 4ZE4A 1B30A 5A69A 2EO7A 3P82A 1H60A 2CWNA 1JCYA 1XL9A 1GOIA 4Y8FA 2OGJA 4NAEA 1J9YA 4GO8A 1A5LC 1QNSA 3K1DA 3WL0A 4FMVA 3SCPA 1DE5A 3AC0A 4HSHA 2FDMA 2GVLA 3GZAA 3DYMA 2A1YA 4RNFA 4LSBA 1G6CA 3FCPA 3PNUA 4XO6A 1NFBA 5FL1A 1F3XA 2INZA 4AX7A 2CITA 3S47A 2VWSA 3SCSA 1R3QA 3S6OA 3RU8X 2SFPA 5I79A 4F2BA 3WF2A 3DOPA 2VNCA 3HG2A 5D9MA 1EDQA 4LUTA 3HO8A 3M0LA 5LYRA 2P3ZA 1VQTA 1CGWA 1OSEA 3A23A 2GSHA 3SN0A 1FA2A 4NVTA 4JNZA 3HQOA 4YTQA 4X61A 4RNJA 1WXZA 3I6RA 3MVTA 4QSHA 2CLKA 2NT0A 2BFGA 4TV5A 4CD7A 4YPJA 2GGIA 3WLHA 4PFMA 4NRSA 3ZWSA 2OLAA 3MMWA 4AG0A 1P0BA 3H23A 5JMUA 4E2DA 3W71A 1ZTVA 3VMOA 1E3XA 1IHIA 1SM9A 3WFLA 3BOLA 4JYEA 4PCSA 1KM4A 1E5JA 4UFMA 1J12A 2BODX 4PTMA 2VEGA 4JX4A 1B3WA 2FPVA 1W9XA 1YRRA 3G1XA 3TW7A 1F6KA 1X98A 3VGDA 2ZE3A 1O94A 2DFAA 3NURA 4IH3A 1FUYA 3HMCA 1OQFA 3HMJG 4O12A 2VQUA 1UC5A 4TUFA 2X42A 2PP0A 4CUCA 4M8UA 3VD7A 1SZFA 3KOWA 4RZBA 3T07A 2FB2A 3MMDA 3CUHA 4V33A 3OA3A 1MYRA 8RUCA 4BWLA 1N8FA 2VZUA 2HDJA 5A6TC 2Q3OA 4W87A 2ZDRA 4OZOA 3RDKA 1ELSA 5M03A 1SMAA 1EJWC 4QE5A 1TO3A 5HUOA 4XAYA 2FZ8A 3BW2A 2VI0A 4TV6A 4FO4A 2DVXA 3PTDA 3WEOA 1CXKA 2NQHA 2PDBA 4I8DA 3TOPA 3HQ1A 2WMFA 3AXXA 1RQBA 4LGXA 5CEWA 3LEPA 3VOIA 3VGGA 1F6PA 4AU0A 2BASA 2WWCA 4JTRA 4QNWA 1TQXA 1O5QA 3JR2A 2YL9A 3I4KA 3IGSA 4NZJA 3KBJA 3LCHA 5FJRA 2BNJA 1XYZA 3AUOA 1SMDA 2GK1B 3IJ8A 3PB2A 2WVTA 1MW2A 1PEZA 3F4WA 1M1BA 3H6OA 4IISA 1J0KA 2PPGA 4PB4A 2DH3A 3BLLA 4DI8A 3GXIA 3GYEA 1V93A 1E0UA 2W27A 3BARA 3NGFA 1UG6A 3GWQA 5LNSA 2B7NA 4AD2A 5CPOA 2ZVIA 3RCYA 3FVDA 4MPKA 2J6VA 1DKWA 3W1UA 4GUIA 3WFZA 4EXAA 2VFGA 4IT1A 1CGUA 5EU9A 4A29A 4IMCA 5JH1A 4LF1A 5A1AA 5A6BD 1XLBA 3AMKA 1F6YA 1H50A 2VX7A 3SQSA 1ADOA 5D9NA 1AL8A 3VVGA 1TTJA 2WKLA 3ZLHA 1TRIA 3IGUA 5AB3A 3CUZA 3CMJA 1NF0A 3STGA 4AWTA 3VPLA 4RXFA 1VFHA 3IUDA 5I00A 1BQCA 4LS2A 2HNHA 2Z1KA 3B8SA 3JW7A 4UTWC 4FS9A 2CXGA 2GSJA 3CAVA 5CC6A 4BHYA 4FP1A 4NYYA 2ZRYA 3NO5A 1FY6A 1EGMA 1XV8A 2OG9A 4QQ3A 2VDGA 4GIRA 5CSYA 3AHXA 3AJ7A 1WUEA 1OINA 2CC0A 1V8EA 4S3GA 4KERA 4LRSA 4RDYA 4IFOA 2QS8A 4IXHA 1S2CA 3ONBA 1U5VA 4WRHA 3GRIA 3CAWA 3W1TA 3ABRA 4RPQA 3P7YA 3TMLA 1UJQA 1F5ZA 2PFHA 4TXEA 1EJSC 4WSKA 4W8BA 2G97A 1H1NA 3FKKA 3PANA 1EO7A 3SI9A 1JZ7A 3NGJA 4AYSA 4QISA 3WQVA 2PDKA 5DANA 2ACSA 2AL2B 3LYEA 3UPWA 3GVWA 1DXEA 3CM4A 3W7EA 2GVYA 4RV3A 5HANA 2CBJA 2IPWA 1XDJA 5E0CA 1OC6A 2PRLA 2VVNA 4XKYB 2CHOA 2HISA 3GS6A 2D0FA 1B1YA 4G7EA 1B3YA 3VMPA 3W81A 3AHYA 3MMTA 4JX5A 3P67A 3WLQA 3CMFA 3N15A 3L5MA 3NM3A 3JZEA 3FKRA 1G0CA 4JN8A 4KKXA 4FLQA 1NTHA 1MQRA 2V8ZA 2PWEA 4UTHA 1RJQA 2PZ0A 4AVNA 1A47A 4R33A 2C15A 1AZ1A 1AZ2A 3RO6A 3RM8A 2DUXA 3TQKA 1EP3A 3A3XA 1DQUA 2VC9A 1F8IA 1KCLA 1HG3A 3ONCA 4Y2WA 5HWMA 3MKVA 2G96A 2D2JA 2OQLA 4O28A 2EBNA 8XIAA 4YHEA 1LWJA 2R24A 3LCGA 3MSGA 5HR6A 5FEPA 3N6JA 2FH8A 3EX1A 2BGNE 3FNDA 3MA8A 4LPCA 5C9ZA 4AZCB 4QROA 5CQ1A 3QSTA 4XZNX 1OABA 3W7IA 1KTBA 1XUZA 2CLHA 3QMSA 1XYMA 2WV8A 1LG2A 4KFPA 2P3EA 2DP3A 3VNKA 8TIMA 1QPQA 2I16A 2PDUA 2DIEA 1GG0A 1LTDA 5DMMA 4XZWA 3VNDA 2VX5A 1SO4A 4K1GA 2PD9A 2HK0A 3PBVA 5LIKX 4M19A 4MDPA 1JXKA 2E9BA 1DTUA 7A3HA 5LGZA 3WEZA 1QOQA 3FS2A 4GA8A 3B05A 1MEIA 4DO7A 4DUXA 3EA1A 3PPFA 1A5NC 3S0CA 3TQPA 4AY8A 1A50A 2E68A 3APTA 1R8LA 1T41A 4WD0A 4FNRA 2OLSA 1E73M 2NQLA 3ISIX 4H7CA 1LRQA 1V51A 5BMXA 2R8WA 3B8IA 4TTGA 4KFNA 2AQOA 4F0SA 3STFA 3G6MA 1TA3A 4LAUA 1LL6A 1R86A 4GQBA 4GE8A 7XIMA 3IK2A 4IQDA 2JEPA 1EO5A 2IUZA 3RMEA 4GIEA 1S3TC 5DY2A 1H11A 2CBIA 1J11A 3LLDA 2PBOA 1BG4A 4QM1A 3CV6A 4JQ3A 1YDNA 3WLPA 2RDUA 5AYYA 2AGKA 1I1WA 2J7DA 4H04A 3ID7A 3PR2A 4QEEA 5JIWA 2OT1A 3OJGA 3MBDA 3FV9A 3HPAA 2QPXA 3SN4A 1UKQA 4RDVA 1KRCC 4L4MA 2XVPA 3BJTA 3BGJA 2YIHA 3NEVA 4IHCA 4S1FA 3W37A 2A3AA 1FKXA 1LLZA 2V5KA 2FJUB 3A4WA 1RLCL 1B9BA 2P5NA 3W1NA 4Z1CA 5L6UA 3BVJA 4P61A 3H2FA 4QE4A 1XKYA 3PG8A 4ZQNA 4M6VA 1UBPC 3G1RA 1XD1A 5LHFA 2BBFA 4XIAA 2VC7A 2X0HA 3TQ0A 4PUKA 4PTVA 3USBA 2FTWA 3OYZA 1VEOA 2DSUA 4CD5A 1Y5XA 1KCZA 3AISA 4UC5A 5JH2A 1NM9A 3KP0A 4WCJA 3I7SA 1N8WA 3V0UA 2RAGA 2AQWA 3CQIA 4HK5A 1ZPTA 3MTWA 4CNPA 2VRKA 1GVOA 1CXLA 3D0CA 3ARWA 2ZUSA 4HB7A 1UZHA 1MXSA 3S8HA 4WVXA 1TJ0A 4MFDA 2IKJA 2PI6A 2FMOA 2EEXA 4IPIA 4HSOA 3N2MA 4I3GA 4ERIA 3ZJ8A 3GFXA 4KEUA 4CN4A 4Q8QA 3RIKA 2PWDA 3OW1A 1VJSA 3QXBA 3WKZA 2XU2A 3SY8A 2VGBA 1V3KA 3VM5A 4M1RA 3M0JA 4M7TA 1OYBA 1F4HA 4JCMA 1CENA 2GDVA 3FA3A 1GQKA 1AJZA 1HUVA 3TMQA 4N7QA 1IGSA 2ZDSA 3O6CA 3M0KA 4WKHA 4CD8A 4A2RA 3Q2DA 1SFSA 4X9SA 4UMCA 3P62A 1UWIA 1H7WA 4PEKA 4GH3A 2PB1A 2FZMA 1OB0A 4IMDA 2ZCGA 3I7RA 5K9CA 3AHVA 3C0QA 2D2OA 4F0RA 3NQ2A 3O05A 4MHBA 2Z00A 4UIOA 1YPFA 2GL5A 3VE9A 4XB3A 1PTGA 4AD1A 5KMYA 3USZA 4JYFA 4NZFA 8XIMA 2GVJA 2WHMA 4DF0A 3VCCA 4C1NA 5C71A 2GJNA 1EZWA 1UPPA 3AALA 1SZGA 3E5PA 2H3BA 1CXFA 3NEHA 1Q6LA 3CO4A 4KCUA 4MLRA 3H2NA 4Q4PA 4Q6XA 2VJXA 4AH7A 1IEQA 2VDHA 3ZR4A 1KC7A 5EMMA 1FWGC 4L61A 1JAKA 4ZOEA 2VGFA 1QUMA 3PZUA 1J0ZA 1QI0A 1JF6A 3M1ZA 1GPFA 3VGEA 5KITA 3AXHA 2P8CA 1G4TA 3B9NA 3EMZA 2FQIA 4MNKA 1OCJA 1Z7AA 1DIEA 2OJPA 1RCQA 5E93A 3CUIA 4WF7A 1GQNA 4JDYA 1FFQA 3ES7A 3HPXA 4F4RA 1GOWA 5I5RA 3M0ZA 1ZB5A 1MNSA 1E15A 2PDCA 1W3TA 3M5ZA 1KM2A 4L4PA 3LHZA 3KVJA 3W7GA 3DZ1A 5HUPA 2QUVA 2PDIA 1DIDA 2DZVA 1V3HA 1Z6KA 4W7VA 2VZTA 3WFAA 4HPXA 1Z32X 2NXGA 4L7ZA 4B3LA 1CCWB 1JR1A 2OR2A 2CLLA 2EPNA 4GACA 4WEVX 3ZMRA 5D4YA 2P10A 4WY0B 3MP5A 3W29A 5FF4A 3C2EA 4AIOA 4N2YA 1FHDA 2F6UA 3DXIA 1LG1A 3R11A 1GVYA 4LU0A 3WBXA 4RCXA 1K8ZA 3CZLA 4OFCA 1R85A 2VURA 3PJTA 1HJWA 1QJWA 1Q66A 4O0QA 3VGHA 4FOKA 1A5BA 4MFEA 1F76A 3TA9A 3LQLA 5LNRA 3A12A 4Z1AA 5I3GA 5JBFA 4OBRA 3W7HA 3AMLA 1RH9A 2PWVA 1CEOA 2PC4A 2I5IA 4KS0A 3PF3A 1LOLA 3OG2A 5U4NA 1U33A 4US6A 3D3FA 2CKSA 2QLYA 3KL0A 3KUMA 4HU4A 3ARQA 2B7PA 2DZTA 2J9ZA 1PCKA 3KW3A 1S46A 1FWFC 3G3MA 4HOXA 3WSUA 1HKVA 1NP2A 1FWIC 3G1FA 3VDGA 2RHGA 2HS6A 1TR1A 3CB3A 4WKAA 1PXGA 2IW0A 1RP8A 2XJ7A 4C7DA 2J9YA 4JEQA 4LUSA 3DG7A 3S83A 3RFAA 1NELA 4DIAA 3XIMA 1R9XA 3B40A 1A5SA 4CVUA 5C54A 2YW4A 4RV8A 1XLEA 4X60A 1W1TA 1ZBVA 1QXLA 3RR4A 4WDWA 1XSJA 1TPH1 2R1MA 4GQQA 4HVXA 1ISWA 1MEHA 1NWUA 2V3EA 1KBLA 1XISA 1E4IA 3WK1A 2I5GA 2EPMX 3WN6A 1KM0A 2LLEA 1JJKA 4H7ZA 3W7NA 1E6XM 5HMFA 3FEMA 1IGWA 1B9ZA 1KM3A 1JZ2A 2PWUA 3H12A 2WCAA 4I6VA 3LZ5A 1Q6QA 2WVSA 4M3PA 1WKDA 2E1WA 4J1OA 4Z2IA 2J77A 4C6QA 1C90A 1PYMA 3S46A 3AIEA 1CLKA 3DN5A 1GVSA 1G9HA 3LXAA 4M6QA 3B3DA 1ZFJA 4JFSA 3NIYA 1FHLA 1H0GA 1ADSA 4FXJA 4DB7A 2VZOA 2DIKA 1TX2A 3R79A 2PDWA 1QO5A 1RJRA 1KLZA 4BWLC 5JXQA 1UB3A 2NUXA 1IZCA 3WLJA 3SW6A 1TPUA 3PB0A 4D6HA 5J04A 3T2QA 3TK7A 3R12A 3SUWA 1V3JA 4S3JA 4E4FA 3UZJA 5EGRA 3WLOA 5CPQA 1PKMA 4YS1A 3TX9A 3MZNA 3UWWA 2CLPA 3A9BA 3WNMA 2CLIA 3I3BA 4NAFB 3UP8A 2XHYA 2VP8A 2NV2A 4O14A 1CTNA 1ZJBA 1S5MA 4HA1A 1G1YA 1CLVA 3NTYA 1TVNA 1BKHA 4P2VA 4UZSA 3PZNA 3RMJA 4CQBA 1BKSA 2NSXA 3TE9A 4HHLA 3TN4A 3V16A 3M0VA 1A5MC 3L2LA 1O5XA 4QG6A 1K3UA 2HQAA 3WJYA 4DVOA 4XZ9A 3GM8A 1UIPA 5BW6A 1YE4A 1D7FA 1HJXA 1PO9A 1J2BA 5A95A 3H8AA 4PYSA 4Z2HA 3O15A 3TWAA 5C55A 2XIJA 2CNCA 2WZTA 1GWJA 2NWSA 1D3CA 4GWEA 3VIJA 2KZHA 2PDQA 3GLCA 1HKIA 1W5OA 4Z17A 3WUFA 5LA0A 2ZICA 4LX4A 1TX0A 2E67A 4XZIA 4EPDC 3IIPA 4QTGA 3UESA 3CASA 4ZEPA 1V7AA 1LORA 1X6LA 1Y8BA 1IWBA 5C2XA 1OIFA 4GY7A 3W26A 1R3YA 2GWGA 4DEFA 4UFHA 5LSMA 3R7MA 2ZRUA 1XIGA 3EKLA 5XIAA 3DFQA 3QQ1A 4F0HA 3MJYA 1WA3A 5FF2A 1E0XA 1YX1A 3FLUA 3THCA 4PTNA 2CKRA 3GDRA 4QCFA 1PHQA 1V0NA 3QEZA 1WB0A 5T9BG 3N12A 1FQ0A 2VL4A 1RUSA 4UUIA 3VKKA 4GNJA 1OFOA 2C16A 4LVFA 3ZT6A 2HEJA 3KEHA 1UMLA 1W1VA 3MZ2A 4L9XA 4LAKA 1J0JA 2F7FA 1XIHA 1KKOA 1ADDA 1PIFA 2RGLA 4MWAA 4DJED 3KLLA 3K4AA 4KRTA 4HGXA 2BY2A 4Q22A 4UCFA 4WSJA 2OMAA 1OF8A 2F6XA 3M7WA 2QEZA 5HPCA 3WQEA 1DHKA 1TMHA 1DE6A 1F2JA 4TMCA 4CQAA 3SN1A 2RFGA 3SY1A 4LAMA 4Y6GA 3PAOA 1E55A 2ZBTA 4AF0A 3HIJA 1TV8A 1H4PA 2W66A 2VD9A 3CHEA 3MI6A 1O68A 1F3TA 1BHGA 4OIFA 4Z2KA 2GQAA 3DC8A 4IFRA 3W7KA 4FF5A 3RXZA 1UUOA 3H2MA 3QC3A 4GI8A 5H91A 1JGIA 3L23A 2OQHA 1GUVA 3PUEA 3LGGA 4EF8A 4J3VA 3EWWA 3BL3A 2YYUA 3CU2A 2WC7A 4FSAA 3IK4A 4AMAA 5FESA 3PUDA 1TPWA 3JVAA 3CEPA 4JIIX 4NZ3A 3HG5A 4WXZA 5D2YA 1KW1A 1GKRA 4UOZA 1VFOA 3SY5A 4E0CA 3AXIA 3LLXA 4GVFA 4GJIA 3V3WA 2G8ZA 1JUEA 3TOYA 5AHFA 3TW9A 3P81A 1S1RA 4IPLA 4HZ7A 4QAIA 2Y5EA 4TX6A 2Y88A 5HNUA 4E4PA 1PS9A 1M5WA 4HCDA 4PC8A 3CEUA 1GJPA 3STEA 4OGZA 2EJAA 3CV7A 5HJYA 2BB0A 1W8GA 4OTKA 4ASTA 3IJ6A 5JVLA 3AOFA 5G1MA 4REQA 3I10A 1S5TA 4K8GA 3A24A 2DVTA 5GJMA 3WBWA 1RP9A 1ZQ5A 4HZ6A 1EJVC 4TO8A 1WE5A 2NQ5A 5D9OA 3LTPA 4DO5A 4A3RA 1EDTA 3TV8A 5EBUA 3WQGA 1AMYA 1FWJC 3EX2A 3QFEA 3QZEA 3UG5A 1XLJA 2UV8G 3QQ0A 4UNLA 2X40A 3P93A 4H9VA 4JPGA 4Q8UA 4QS6A 1TE6A 4C7FA 3M0HA 5HQEA 3LPGA 1R3RA 4HHMA 1MEWA 1A5UA 2E0PA 2YDRA 5ABFA 4EE9A 5FF7A 1PJ9A 1AQ0A 3LMZA 3AHZA 1FWCC 2ABBA 4LUTB 4O54A 2PTYA 2QCLA 1LLWA 1UKPA 3RN6A 2G37A 1V6VA 3EX6A 2EPOA 4DWDA 3NSNA 3TTOA 1TZ7A 5AVNA 3FVMA 4DRSA 1KRBC 1SFLA 5D8ZA 4HNCA 1DBTA 1XLFA 4IFKA 4W89A 1PDYA 3SUTA 2I56A 1JXJA 4BFAA 4R7OA 5IFTA 3I6EA 1TV5A 4EVZA 3CL7A 4F0KA 2BGQA 4UQAA 1U2YA 2ASHA 5F1VA 3NXFA 2YBVA 4ICCX 1OD8A 2C1IA 1ZALA 1J93A 1F74A 3KOXA 4ROQA 3TR2A 3W23A 3S5ZA 3TZNA 4HCLA 3PPGA 4I9JA 2VTFA 2FH6A 3TNBA 2Z6IA 1KQYA 1PYFA 3EPOA 2CETA 3PZTA 2AKMA 3BLEA 4M29A 1MO0A 4A05A 1W5PA 2PTXA 5FJUA 5T9CE 2YSWA 2CBUA 2F6KA 4U28A 1MUCA 4FLSA 4GG9A 3L5AA 1EJUC 3H2EA 3W28A 2PMQA 2BTMA 1JIBA 2V30A 4U31A 5FEXA 5LIWX 3MCOA 3SFWA 5A6AA 4PMJA 2WHKA 5I07A 3F4CA 4KGJA 4AEOA 4M80A 2QCEA 1UD8A 4C6NA 1XG3A 1W3LA 1XUUA 3HQPA 3MHFA 3UU0A 3GG0A 1O1HA 4AISA 1WP6A 3RILA 5A6MA 4Z08A 2CLEA 1CYGA 3TUUA 3NCOA 3M5YA 5EKYA 4JDBA 2CXEA 4HK7A 1X1ZA 1XLLA 5BU6A 1VFTA 3WUBA 4D8ZA 2V0TA 2H9AA 2GGHA 1HJSA 1UC4A 1TQJA 2J7GA 4JTHA 1DV7A 1V5XA 2IS7A 3S9ZA 4CNNA 5D9PA 1MNZA 4CQ9A 1TPDA 1PIIA 2B0MA 4GZEA 1W6TA 1P1XA 1GYNA 1X7IA 2VR5A 3GO2A 3NDOA 1XQKA 2ZUNA 3BK0A 5FAJA 2HPIA 1EHNA 3AU2A 2VFDA 5A5WA 4LS0A 2DQWA 4Z2LA 1WDQA 1Z42A 3KM8A 1J4EA 1LBMA 2CESA 4CNUA 1SFTA 3OEXA 1HQTA 4J3UA 4EWND 3NYDA 4KGLA 4LYQA 3TSBA 4EANA 1Z41A 2RUSA 4ZOAA 2QNEA 4UFIA 5CH9A 4L9ZA 1YKWA 2E6YA 3NDZA 1SJDA 1TJ2A 5CJNA 3TZFA 2RDTA 1JULA 5GNXA 4EXBA 5AYIA 3Q4DA 3H2OA 1L8PA 3SQMA 3P14A 3TXVA 3LHVA 6CGTA 1P4CA 3H2CA 2GJRA 3W4RA 1XYFA 3REQB 2BHUA 4KMQA 2C0AA 4B5UA 1ITQA 4H8VA 2QKFA 2CW6A 3F4DA 1XIIA 1X8CA 2FPYA 9XIAA 4DAIA 2FZNA 6XIAA 4W4QA 3FFSA 3NG3A 3UZ5A 2B4GA 3GIQA 1H7RA 4P8UA 1G4EA 2OZTA 3GC4A 3G1HA 3LBOA 1VEMA 4O57A 4TMBA 1VFSA 3BE7A 7REQB 2V81A 2VEPA 2INEA 2EAWA 3PZMA 2NX9A 5IRPA 4MM1A 1UWAA 4HPGA 1T8QA 1WZMA 3P6LA 2C8NA 4YCOA 3KTSA 2JQXA 2A21A 1KR0A 1RJPA 1ONEA 4Q7BA 4KH2A 1MQPA 3VX1A 1GOKA 1I2RA 4GABA 3DENA 4CU6A 3C5QA 2OSYA 2XGBA 4QITA 4CEUC 2PDMA 3H53A 1LT7A 2OZ8A 4C6IA 1C9DA 2R14A 1IR2A 5HNRA 1DORA 3E38A 5D30A 3ATZA 4C6CA 4X2RA 1YHTA 2BLEA 4ILSA 2XIBA 4W88A 2J6XA 3RK8A 3DCPA 2FLIA 1EZ2A 1YNPA 3G0XA 2OZ0A 4CCEA 1BGAA 4PBEA 4XVEA 4IX2A 3WD4A 2ZX8A 3GDBA 2QUNA 2WNZA 3MI2A 2OKOA 1XS2A 1Y5VA 4AY1A 3NQAA 4G9PA 3GW3A 2GK1A 4LEQA 4BF7A 5D2WA 1CX9A 3VXGA 3VGFA 4ZSTA 2ZWZA 5B80A 1WAWA 3V36A 3R13A 1FWRA 3QR1A 3SRDA 3AYSA 1MW0A 1VGAA 2ATMA 1R38A 1IIHA 1B5TA 3KXQA 1D9EA 2HBVA 3WQ5A 2BY0A 5FD0A 3CL8A 1UHVA 2CLOA 3AZTA 4MNLA 1POKA 3OVRA 1VFLA 3AIUA 1ISZA 4DJDA 4WJ8A 1XSKA 3BG5A 2EKGA 4YNGA 3RCNA 1OX6A 2VEMA 1M7OA 1ITUA 4P7QA 3R89A 2JKAA 4NXSA 3TC7A 1OHLA 4EK7A 4GQ0A 3W7OA 3A9IA 5I3DA 2PWHA 3TP4A 3CQ0A 3N1AA 9CGTA 1PZ2A 3PWIA 2VENA 5D38A 3ZS4A 3WDHA 2ZKMX 4R7JA 4WQ6A 1L6YA 4HJWA 4U2ZA 4IP4A 3DHFA 4RE2A 3TTYA 1W3HA 3WD3A 3LA4A 3IJLA 2RDWA 4FLOA 1W1A1 1KV5A 1UOKA 5CZ0A 1C8XA 4YTRA 3OVQA 3GK0A 1E9ZB 4NI8A 2CIPA 1EC8A 4PEEA 3A5VA 4DZHA 1R3VA 3D46A 3P8JA 1W9DM 4QG8A 2PEVA 3H4XA 3GUWA 3O6YX 1V6WA 1MRQA 3SCRA 1X97A 4GH1A 3LX9A 3BO9A 4K6AA 4FXRA 1YDOA 2IQTA 1MUWA 1JZ6A 4ACZA 1LBLA 3MP3A 2FIQA 1H7NA 1H5VA 5KTLA 4XD6A 3F03K 2ANUA 4BQ2A 3C56A 1I0DA 3KP1A 2QAPA 2NUYA 2A3LA 2YA2A 5KZDA 2GWNA 1FXQA 1M3UA 3SCUA 2HRWA 2BY3A 4L6HA 3A3HA 3AI0A 4ZXLA 1SR0A 3LMYA 1EBGA 2ZZ2A 3R43A 2V2HA 5MKGB 1VCGA 3WMSA 3NQMA 4UFJA 3N3MA 4ATLA 4DJDD 4B91A 2VYOA 4JY9A 1T6MA 4LWWA 3A4XA 5AHNA 4A8NA 3TC3A 4I5XA 3SO7A 1R7OA 2FGZA 5BWFA 1O7AA 3FSUA 3F5LA 1GJWA 4ZQPA 1TA3B 1WV2A 3IARA 3UJSA 5IBXA 2XIQA 2FHBA 3F2CA 5TBOA 1UWSA 3L67A 3TJIA 3NPVA 2FYMA 1TKKA 4GVHA 4JFWA 3T4WA 4F3HA 3PP7A 1JDDA 2GJXA 4JKMA 3FSTA 5LA2A 4P8XA 1F73A 3PZIA 4H8UA 4B2DA 1SO3A 5AC5A 3NZRA 4F9JA 4GZ7A 1HKMA 4ZQRA 3C8NA 1OX4A 5C2CA 2JALA 1C7SA 4AZCA 4ZQOA 4C6EA 4AEFA 1Z9AA 1JPHA 3KCOA 4DHGA 1OGSA 1P0EA 2EPHA 3BCFA 4B3KA 5ABEA 1QNOA 1I2PA 1EA0A 3WDPP 2QJMA 3VX0A 3R8GA 5K9XA 4GRSA 1QOXA 1GT8A 3CK5A 1EX5A 1UR1A 2Y6ZA 3UNDA 3CPUA 2HVOA 1WBJA 4C6MA 1R7AA 3QQWA 5I0DA 2XUCA 2XN0A 3H22A 1OK4A 1JCLA 5C9RA 5HNTA 1V6UA 2RGMA 5JQ9A 5M5DA 3WL1A 2E28A 1M53A 1E40A 5D37A 1XCWA 2HXUA 5LHEA 5DRCA 1V0LA 3FXYA 4DYKA 4FNSA 4MGGA 2GQ8A 2AOSA 5IHRA 3WH7A 3RAOA 3W6YA 1FTXA 4IIBA 3DDMA 2DUZA 7TAAA 2QV5A 3L4UA 2OWWA 4M82A 2DH2A 4HD5A 5DMNA 1UASA 3WLRA 4FOJA 5MHBA 2YKKA 3KWSA 1F9CA 1ECQA 4KBXA 3APGA 3GXPA 1GKQA 3VKBA 2X1RA 4R85A 3I68A 3NVDA 4YXGA 1O6IA 2BVDA 1BVNP 2Z2AA 4OHQA 4UTFA 1V02E 2CERA 4AHPA 2WZIA 4QDPA 3V5OA 4QQUA 3AIVA 3EAUA 5I06A 3VOGA 1QPNA 4PUJA 2RDXA 5F4SA 5DY3A 4ZE5A 1RALA 4I9TA 4J35A 4D6JA 3MWCA 3CHDA 5AC7A 3CLMA 4ZZ9A 1ITXA 6ALDA 1QAPA 5E9AA 3FHAA 3MO4A 1I4NA 4B5SA 3TJXA 1G69A 1ICSA 4AHOA 1S3HA 2OOFA 4AZBA 3V0TA 4B2DD 3N6HA 4OBTA 1VHNA 2WQDA 3BWWA 4UTTA 3MWAA 2A85A 2C3ZA 3NNTA 1NQ6A 4MWAC 3S6TA 1PPIA 3UWEA 3NVTA 2Z25A 4LW7A 4HOWA 4MUZA 5B7ZA 1W8SA 2W63A 3R94A 4IXXA 4DXVA 4R5EA 1SSDA 1Z48A 1A0DA 4C1NB 4G8TA 5DQPA 1LDCA 3UFYA 1DQWA 1W1ZA 4U4MA 4Q3MA 3W87A 3HPFA 5XINA 2I14A 3W86A 3PUGA 3WELA 1A5KC 4HIBA 1SPQA 4ERGA 2NQ9A 2ZX5A 4GZJA 1MW3A 3FJ4A 3OZYA 3ARZA 1H2JA 4HPNA 1S1PA 2V82A 3OLGA 4RDZA 1L0PA 1NFPA 3U9IA 1BGGA 1B3ZA 1SYTA 1VP5A 2PRHA 3SSJA 3SIMA 2JK2A 1NU5A 3K46A 3IGXA 1YMYA 3IUHA 1CBGA 3FHQA 2ZYFA 1XIJA 1JI2A 1AW2A 2DSWA 4IUOA 3WH9A 1J0IA 2J62A 2ZA2A 3LDVA 2BG5A 5T26A 4K39A 1KCXA 2J78A 4W8LA 2C1GA 2ZX6A 2BSLA 3EB3A 1KFKA