3W2KA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-165
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-165
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2kA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2kA01
1ALDA 5K2ZA 3KAOA 1OX4A 2ATSA 3LLDA 1FXPA 3T78A 2ZQ0A 1IXOA 5CZSA 4CNNA 2WNNA 4DF1A 4LV9A 4JDBA 5AHMA 3TV8A 1AW2A 1FCBA 1WBHA 2BXVA 1ZAIA 1VHNA 1VCFA 3CEUA 3PWAA 5G4EA 4Q33A 2V2DA 3KVMA 1X6UA 1FCQA 4FB7A 3HGJA 2EPHA 2FFCA 3NZRA 4MUZA 3LTSA 1FXQA 4N4PA 4S1FA 4Z1CA 4FHAA 5K9XA 2Q8ZA 5DY2A 1K7FA 1DJNA 4LVFA 5HINA 1JCLA 3SGUA 5AHNA 3O05A 3MHFA 4WQ6A 4A21A 2V2CA 2RFGA 3TMQA 5IBXA 3PSWA 4LV4A 1SO5A 1R2SA 1MXSA 5LNUA 1H7XA 3SSJA 5DELA 1JJKA 1VYRA 1TTQA 3STGA 4J9JA 2NUXA 4IXXA 5AB3A 5LNSA 3S1UA 1KV8A 2Y85A 3M5ZA 3S6DA 3T44A 4RZ4A 4ORIA 3G8EA 3TA6A 2PCQA 3OA3A 1Z42A 4U4MA 3MI6A 3IRDA 4AF0A 1HL2A 3UWQA 1TB3A 1TJRA 4O1DA 3N14A 2I1OA 5AN7A 3T4CA 3WJWA 2QDHA 4RXFA 3R2GA 4NQ1A 2W0UA 2CLFA 4AWTA 3STFA 1I2NA 1KM0A 3UZJA 1PVNA 5HWMA 3W1AA 2QCMA 1H63A 3NZ1A 2V9DA 3QF0A 1Q6OA 1LM1A 5HR6A 3EKZA 4EOUA 4DEFA 4QNEA 3B0UX 2ATMA 3DBPA 3DI1A 5BW6A 1ZENA 2NV2A 2JKEA 3DHFA 1XUZA 3DGRA 3W07A 3EWWA 5I3KA 5EYWA 4AWSA 3TMLA 4HIBA 4UFHA 4JN6A 2CW6A 1LBLA 3A21A 3Q2DA 1LBMA 3WK1A 4A2RA 4UNLA 5LNVA 2J24A 2Y7GA 4AF0B 3DFSA 4HNVA 1I2OA 3VNDA 4N9BA 2C1HA 3W1QA 2ZZ1A 3W7MA 3N73A 1DV7A 1FDYA 5D03A 4TMCA 1CW2A 5D2TA 1XL9A 4Y6GA 3PUOA 1OYAA 1AMKA 4K38A 1YTEA 3F03K 4Z0JA 3G24A 2DJLA 1SPQA 3DAQA 3BW3A 5AYXA 3G18A 2QCFA 1EWEA 3HGOA 3LCWA 3TIMA 1GVRA 1SFJA 1B9BA 3NPXA 2FPVA 4TR9A 4RKAA 3H54A 1H7RA 4MLJA 5HWJA 5L9FA 5LKYA 3JRKA 4UFIA 1RQBA 1PHWA 4RR4A 4MY9A 1RD5A 2TSYA 4O54A 5BOOA 2NWRA 2Y6ZA 3QRHA 4O28A 3I7RA 1N8FA 2HTMA 2OZ0A 4PC8A 1F73A 3RMJA 1AW1A 2WKJA 2CLIA 3MHUA 2B7NA 2CU0A 4H6KA 4GWEA 1WXJA 5HULA 1SFLA 3AJXA 3TU9A 2H3BA 3ZR4A 3W7OA 3BGGA 3GX9A 4O11A 4I7WA 1HTIA 1W31A 4JXCA 1H62A 1JCMP 2A21A 3S5OA 3O16A 4GC4A 2HS8A 2GJNA 1W3NA 3GXNA 3HF3A 3DHDA 3LRKA 1SSDA 1DORA 4JS3A 3HPXA 3FLUA 3W1XA 5FF3A 1X1ZA 3TH6A 2Y62A 1WX0A 4NJGA 3HG2A 5FEPA 3CIWA 3CEPA 4AHOA 1Y0EA 3NL2A 1TREA 3QEZA 1GTEA 2B7PA 1LDCA 2A5HA 1JQVA 2E77A 3O6CA 4UR7A 5BRBA 3A5VA 3NOEA 4O14A 1LZOA 1K8YA 3DFNA 3MBFA 4N2YA 3THQA 1FCVA 2WJZA 3UPWA 4UTWC 3RF9A 3NA8A 1TIMA 3BVJA 4JDYA 3TQVA 5DCDA 3EWBX 1K7XA 1TMHA 1B57A 3PR2A 3U6WA 1DQWA 3GAYA 4DO4A 4Z1DA 3WFAA 1W5PA 4TX9A 4K7VA 4R7JA 1M5WA 4OT7A 4CQ8A 4LWWA 2XN2A 4TO8A 2ZZ5A 4YCOA 1FDJA 1IIHA 3QJAA 1G7VA 3W7CA 4KWVA 4Z1BA 4YWIA 3QC3A 2QCHA 1LLZA 3BK0A 2G96A 3PY2A 2QEZA 2G95A 2GQ9A 3PF3A 4XZ9A 2GPTA 4DPPA 5D2WA 2CLOA 4WOZA 3ANYA 3E12A 4RX0A 3QW4B 2WSYA 1TPUA 4QQ3A 4AXKA 3DFQA 4H4IA 1ME7A 1W0MA 4M19A 1TPVA 1YLVA 1XBVA 3L66A 1A5BA 2NX3A 2DJXA 3W73A 3G1HA 1J5TA 3P5YA 3GR8A 1WOAA 5D30A 2YSWA 2FTPA 3GDMA 4WXZA 4GUHA 4O0KA 1BTMA 3VFLA 3JR2A 4OGZA 3P74A 4XQ6A 1H7NA 3IGXA 5HNRA 2A6LA 4MZYA 2H3DA 1NF7A 3GR7A 3LXBA 1B4KA 2GVGA 1BKSA 3C3NA 1HFBA 3MHGA 4LRSA 4DXVA 3B0PA 3MW7A 3G0XA 3PG9A 4O57A 4UR8A 1FCUA 2TRSA 3HB9A 4PA8A 4UCGA 1UJPA 3TC7A 5IBXC 3IIXA 3G8RA 3S1XA 3GXTA 4KFOA 2D73A 3Q94A 1RZMA 4OHQA 3ATYA 4DPQA 5LGZA 2PC4A 4BR1A 5DBTA 3CHVA 3LOTA 2VEMA 3TSMA 3HMJG 5AHEA 5D38A 3WJSA 2OJPA 4CCCA 5G1TA 3V1PA 2OCZA 3PG8A 4FXRA 5MHBA 3MI2A 2YYUA 3L0KA 1W5OA 4UMAA 5CZJA 2VEIA 4WY0F 1SO4A 5K3VA 1JCYA 1GYNA 1EUAA 3QMRA 4FNSA 3W2LA 1OFDA 2BTMA 3BLFA 1BWKA 1W5MA 3P80A 2C13A 4JTFA 5D2VA 1DQXA 3BPWA 3LHVA 3GZ3A 1YDNA 4AMAA 1WOBA 3OIXA 4NXSA 1NFBA 2ZBTA 5G5IA 3S8HA 3GB6A 3W86A 3HPSA 1I2PA 2NXIA 1UUOA 3ZS4A 4EF9A 5D2XA 3W7LA 3B06A 4LTSA 3LCFA 2Y89A 4XUGA 5K9CA 1Z41A 4LS0A 2FB3A 3PBWA 4RJEA 3VCRA 1G69A 5F4WA 3KRUA 3G1AA 1KFBA 4GUIA 5DBUA 1DVJA 3IIZA 2RDUA 1JULA 1KBIA 3EWXA 5KINA 1K02A 1N55A 2ZRZA 3W7EA 4GUFA 4JEQA 5CPNA 5CSSA 2BSLA 2FLIA 2Y7DA 1QCWA 1QPRA 3V75A 3NVTA 2HMCA 2ZA3A 3K30A 4E2DA 1EB3A 4KFPA 4O1CA 3ABOA 1OFOA 3P8IA 4MLRA 3S0CA 4UMCA 1CX9A 3TQ0A 1MSSA 4JTLA 1RQEA 1KLZA 1VC4A 3P81A 4QIUA 1L6SA 4RK8A 3UY8A 2QCDA 1VCGA 4O0ZA 2V5BA 4WOQA 3MI3A 4NX5A 1GQNA 1T8XA 3R89A 4Z08A 4FX6M 1VRDA 3PBYA 4WY0A 2QUVA 3LRMA 3L68A 3EXRA 3QPYA 2ZZ7A 1V5XA 3BG9A 2TYSA 1P0NA 3OEXA 6TIMA 3HG3A 3NR0A 5HUOA 3R8RA 3A22A 4GRSA 1C8VA 1LOQA 1KBJA 3NG3A 1F6KA 2VENA 3L0NA 1GJPA 4M6VA 2QJHA 3O6DA 1DHPA 3QQ0A 5D37A 1F76A 1LORA 3SECA 3L0GA 1XKYA 2QJIA 3P62A 3TFCA 4DELA 4R53A 4ZVJA 1LRTA 3EX6A 4JTJA 5DLCA 2W6RA 4IXHA 3LI1A 5LNRA 2Y63A 4OBTA 3FEMA 1SZEA 3QQ1A 3SJ3A 3NGJA 4O50A 4PEKA 3G1SA 4YLWA 5HWNA 1KTBA 1T99A 4LRTA 1P0KA 2VKZG 2CLEA 3W71A 4RZ5A 3QSRA 5FEZA 4WUIA 1FWNA 5E1QA 3C2VA 5AHIA 3OVRA 1PCWA 3LXAA 1M7OA 1A5CA 4GJ1A 1QWGA 4WJEA 2V81A 4LT9A 2Y61A 4GXMA 3TAOA 3RLVA 3NQDA 3W1LA 4NJJA 3PC0A 1LCOA 1R47A 1Q3NA 2O7QA 1G4EA 3PS7A 2QCGA 1TPDA 3TDFA 3GIYA 5D33A 1IIGA 3DU0A 4FNUA 2Z6IA 3EX4A 4LUIA 1GT8A 2NUYA 3EKLA 1K3UA 3NQGA 3W1NA 4Q32A 1QPQA 3N34A 2YDAA 2NX1A 1F6PA 2CZFA 3WJZA 5E93A 5EBUA 1XBXA 2E6YA 3TK7A 1ADOA 2J27A 4EF8A 1OHLA 2ISSA 4NNCA 3NQCA 2ZZ3A 1QAPA 4TMBA 2JGQA 4IGHA 1RV8A 5H2ZA 5I3JA 3W9ZA 1XDMA 2VEPA 2VC6A 3PULA 1YADA 2A1YA 1VR6A 4MFEA 1XUUA 4HNNA 4JTKA 3W1TA 4M6PA 3CC1A 5CZTA 3UXDA 2B7OA 1OFAA 3NQ6A 1VPXA 4A29A 1KFJA 4RLIA 2QJGA 1L9WA 1PHQA 2YX0A 1MEHA 1H7OA 3O1NA 4IMFA 4FIRA 1Z44A 2JKAA 3TSDA 3W7PA 3N2MA 4JX4A 1C29A 1WA3A 2I14A 2E5CA 4X22A 3T55A 2Y7EA 2B7QA 1UBSA 1TPC1 4IMDA 4EVZA 1VH7A 1EIXA 4RCXA 4MYAA 2QR6A 2VELA 3O15A 1O94A 1GG1A 1QO2A 2V2HA 1FY6A 4M7TA 4ZQMA 1EUNA 2R94A 3QMTA 3NPUA 1P1XA 1DL3A 2EKCA 4HPJA 1UCWA 2NLIA 3NEVA 3O63A 2ZRUA 4XKYB 1I45A 4XBSA 1ZFJA 2WNQA 7TIMA 1M6JA 4NJIA 2W79A 4ALDA 3MP4A 4Q4KA 1ZAJA 5C5YA 1FX6A 1TPB1 1ML1A 4AB4A 3IGUA 4YMZA 4BF9A 3W74A 1I8JA 1KM1A 3BARA 1YXDA 5L6UA 3UXAA 3HIJA 2YGYA 4MFDA 5J5RA 1VGAA 3QW3A 2QCCA 4FNRA 1KM5A 2A7RA 1G4SA 4LY8A 1C9DA 4LS1A 1OK4A 3L2IA 2P0OA 2Q3RA 4QISA 1UB3A 3C56A 1A53A 1KM6A 2ISVA 3RLUA 3HO8A 4ZZ9A 5LZLA 4O52A 3SGZA 5FF4A 3BLIA 2ZA1A 2WV8A 3W83A 4JYEA 4DQWA 4JTSA 4I7VA 4MOZA 2R14A 2C14A 2QUTA 3LCXA 3Q58A 1WAUA 2C15A 3W85A 1WV2A 1SW0A 1CI1A 4NNBA 3U8GA 2A85A 1T0OA 2VFDA 4U28A 2JK2A 1WYIA 4N9EA 5FEXA 1VZWA 3QH2A 2F84A 1JCNA 4IX2A 2IQTA 1QMLA 5I3IA 3WK0A 3R12A 2AGKA 1H7WA 5I3GA 5EL1A 4ZMGA 4LUJA 1QOQA 2CLHA 1HG3A 3W7DA 4PODA 3U2OA 3SI9A 1RPXA 2VFEA 3HG5A 3B03A 4KFNA 4BWLA 3NQAA 1EX5A 4GBUA 3GYEA 1W3IA 1OX5A 3F4WA 3TAKA 4MVAA 5CGQA 1L6WA 5F4SA 1TQJA 3LRLA 4UTIA 1WBJA 2ZZ2A 3HQ1A 3LERA 5T26A 1GEQA 2H90A 3ATZA 1IGSA 5KMYA 1AL7A 1JUEA 3GDLA 4NNAA 1OYBA 3NQFA 3RK8A 2ZYFA 4DF0A 2B0MA 3G22A 2QAPA 3P67A 2YCEA 3P84A 4FNPA 1IF2A 2WNZA 5CG7A 3QYQA 4DO5A 1FQ0A 3IIPA 1S5VA 5AHFA 1YYAA 3M5YA 4UFMA 5BMXA 2A2IA 5HUPA 3TE9A 4UTJA 2WOQA 5G4WA 3HPZA 2YW4A 3G3DA 5HR7A 2VXNA 3W70A 1IXNA 1KFLA 2DZSA 4GUGA 3E9AA 1BWLA 3NYZA 1I2QA 2DORA 5F4XA 3M16A 4ZQCA 3GDTA 5DY3A 4ORMA 5AOUA 3T7VA 5C55A 1Q45A 4H3DA 1DBTA 2VFHA 3NO5A 4Z0SA 5KSWA 2BZNA 1KFCA 3C2FA 3RNDA 2Z1BA 3HOJA 3MUXA 2ZRVA 5CZ0A 3IV3A 4FIQA 3FFSA 3KOFA 1T96A 4JIPA 3TW7A 3M5XA 2C0AA 3EX2A 3A23A 4POCA 4LS2A 4O13A 4K8HA 3W72A 2PRHA 3GNDA 1XDLA 3GDKA 4JX5A 3NDOA 4O10A 4K37A 5EKYA 3GNNA 1H50A 2P1FA 4ZL1A 1Z48A 1TO3A 2WO5A 3RU6A 3O6YX 2H8XA 2ISWA 1OX4B 3LTPA 4E0CA 5E0KA 3CWNA 2QCLA 3EWUA 3W1PA 3EB2A 1PV8A 4X3ZA 4N6FA 4R34A 3CIXA 1QNVA 3MYOA 4JX6A 5TBOA 2WQPA 5DN1A 1S5WA 3CT7A 3TSBA 1FWRA 1H5YA 1L6YA 4JY9A 2F7FA 4CQ9A 2E68A 4OQVA 4UFJA 3SY5A 3W1RA 2YZRA 1S3HA 4C1LA 4OV4A 1ONRA 2PE4A 3LCLA 1J4EA 3EXTA 2Q3OA 3G0SA 1YDVA 1TPFA 4O12A 3AO0A 3TJXA 5K4XA 1B3OA 3GLCA 2OMAA 1TYGA 2CZEA 3IIVA 4XKYA 1P5BA 1R46A 5CPOA 5LHFA 4M5PA 1F7BA 4FX8A 4NUWA 3LHZA 1MZHA 5CSRA 4AEOA 4GNJA 4AVFA 3B05A 1QPOA 1L2UA 3KVJA 3S42A 1TPEA 5EY5A 1GWJA 2V8ZA 3LHWA 2ZZ6A 1FUYA 3IEBA 3L65A 3DXIA 1NSJA 3LBCA 1KM4A 1ZJIA 2DZWA 4LVAA 4CCDA 4B5NA 3C52A 2V5LA 4HKPA 5G2IA 2YYTA 1K7EA 4O15A 1YPIA 4HNTA 4HN4A 1TV5A 3P7YA 3M1ZA 4OWGA 1EP1A 5AYYA 3YPIA 1PL9A 4GFSA 4JTTA 3H55A 5KZEA 5D04C 5G1YA 3TW6A 2E6AA 4KWWA 5D02A 1TV7A 3W84A 1G67A 3UQNA 1QPNA 2KZHA 3FA5A 4YL2A 1OABA 3VKJA 3UWWA 2NV1A 1H7PA 1MEIA 2QKFA 2J88A 4BWLC 3FKRA 3F1QA 1TJPA 3H53A 1OF8A 1E51A 1XBZA 1A5SA 4P2VA 3W7QA 4NT0A 4JTGA 4W9TA 5HMSA 5GVJA 4UTHA 1ME8A 4FX7A 1TPWA 5D32A 2A0NA 2V30A 2FDSA 3LTYA 5A5WA 3TXVA 2RDWA 2X16A 3FS2A 3UWZA 4D2JA 3W2MA 1QDSA 3LBMA 3NPVA 1K03A 2RHGA 1SW3A 3QM3A 1JCJA 3TR2A 4NXKA 1ICQA 3UD6A 1PIIA 4JICA 3MBDA 1GVOA 2C19A 3FYOA 1TCDA 2Y7FA 3W2UA 1H1YA 4FF7A 1VJIA 2P10A 3BLEA 1DJQA 3KRZA 4G1KA 3S1WA 3W2NA 3CU2A 1W37A 3L21A 3DFPA 4O1AA 3C61A 3WK3A 1SUXA 3QPZA 4OE7A 3I7QA 1H51A 2A6NA 3HGSA 2XFWA 4XTIA 4NX0A 3BG5A 5G2WA 5FF2A 2CLLA 2DZXA 4JTEA 3KX6A 1D3HA 1W54A 4IJBA 3R5EA 3S9YA 5KITA 3DZ1A 3LDVA 4I7UA 2C3ZA 1XXXA 1OF6A 4JTIA 1TV8A 5U7SA 2GVLA 4UFLA 4PH6A 2GJLA 1YXYA 4S2CA 4FEZA 1EP3A 2RH9A 3DI0A 2GUUA 3WJXA 1ZY9A 4K6AA 1ZNNA 1LRNA 4Y96A 3M9YA 4MPQA 3UYCA 1XM3A 1V7YA 2DP3A 3A24A 3TROA 1UASA 1MO0A 3FOKA 2E5BA 5FESA 1JUBA 3KVKA 3W2JA 3TXZA 2UV8G 4E38A 5I3HA 2E6FA 4PFMA 8TIMA 1ZHAA 4Z1AA 4UTKA 3EWZA 3TKFA 4JNMA 4KKXA 5F2GA 1GZGA 1VQTA 1SR9A 1I2RA 5SWUA 4OV9A 1O4UA 1VYPX 2EF9A 4R33A 4LU0A 1AL8A 4BFAA 3W88A 1TTJA 2NXHA 3NL5A 3W23A 5AC8A 5G2HA 4IUOA 4IPJA 4CNPA 3G1YA 1LP6A 4ICNA 5HJLA 1TPH1 4MZ8A 3S5NA 1WQ5A 4CCEA 4JIQA 3GDRA 1KLYA 1RR2A 4N6EA 4N4QA 3UWVA 2X30A 3BV4A 5AYZA 1AW5A 3SZ8A 3OBKA 1ICSA 4HNUA 3PAJA 4Y9AA 2J9XA 3C2OA 1FWWA 1U5JA 2E6DA 1OFRA 5C2XA 1G6CA 1HO4A 3G1FA 1LRQA 3UY7A 2ZDRA 2DZPA 1W3TA 4XWUA 4E2BA 3IVSA 1YTKA 4RZ6A 3W76A 2Z0IA 2FPYA 2QAFA 5F1VA 3CQ0A 5BNKA 3BO9A 1M7PA 5LSMA 1AK5A 2AQWA 3F4NA 3NQ7A 3UWUA 3THAA 1U83A 4UTTC 5I3FA 5J5DA 1KFEA 5D05A 1OK6A 3L5LA 5H91A 1ME9A 5DXXA 2LLEA 2ZA2A 1NEYA 1FDZA 5FI8A 4IQLA 4M6QA 3HGRA 4AHQA 2FPTA 1GVSA 2YPIA 4ADSA 2CWNA 1JRCA 2DU2A 2YW3A 3NQ2A 2QCEA 2BWGA 1EWDA 3A5FA 3LX9A 1H61A 4AAJA 3NAVA 3W75A 2JGYA 1SZNA 4O53A 2GVJA 2ZRXA 1A5AA 4RXGA 1KTNA 3ABRA 2A7NA 1PE1A 3TCEA 1B4EA 1KW1A 4XTDA 2DZTA 1W5QA 4UIOA 1QFEA 2GQAA 3CTLA 3OVPA 3M0ZA 3TNOA 3NXFA 3ABQA 4JGDA 3GVGA 4K7YA 3LM7A 2X1UA 2GQ8A 1JCXA 1OFQA 2ZZ4A 2TMDA 4NZFA 3M44A 3KFTA 1TRIA 3KHJA 5DCEA 4FO4A 1SW7A 3VE7A 1ZALA 1S5TA 2X2GA 3N9RA 2CFFA 4QJ1A 1EEPA 3NNTA 3INPA 4BI5A 1TTIA 2WPBA 5DXYA 4EIVA 4LVDA 3C2EA 3PUDA 3E02A 4O16A 3TC6A 1A50A 5K7JA 3DKJA 2Z6JA 3E0IA 4HPXA 2H6RA 1EPXA 1ZCOA 3PSVA 2EGZA 1OX6A 2O7SA 3PB2A 1GOXA 3VE9A 3W7GA 1NAL1 5D2YA 3VI2A 3B4UA 3EEGA 4MJZA 1THFD 2ALDA 2C6QA 3STCA 3GXPA 3E96A 1SO3A 4LVBA 4GE8A 3GKAA 1QR7A 5LGXA 3W7KA 2NXGA 3M6YA 4WY0B 4UUIA 2H8ZA 4O1BA 5FF7A 4IPIA 2J6XA 3FJLA 4TIMA 1GVQA 4QITA 4X9SA 3W7NA 1N7KA 3IVTA 3KRSA 3LV6A 3LCHA 5CKSA 2CLMA 1GTHA 4ML9A 3PM6A 2X1RA 4P61A 1K8ZA 4Y8FA 3ABSA 1R2TA 1OYCA 5K4ZA 4MY1A 3P61A 2ZCGA 3LHTA 4PTNA 2J9YA 2YFNA 5C6MA 1HO1A 3NQ8A 4C1KA 3G3MA 1W1ZA 4DO6A 4HT3A 3NM3A 1EP2A 4O4VA 1KTCA 1R2RA 5CPMA 3EXSA 4CQAA 3S1VA 2R8WA 3P5ZA 4FXSA 1LROA 1IXQA 2Z2UA 3LI0A 3ZWTA 3EWYA 4BI6A 3EX3A 1EA0A 1DOSA 3E49A 2ABAA 4UTUA 1SZGA 4HSOA 1GVFA 4IMCA 2OT1A 4O17A 3FIGA 3PVFA 3M7WA 5BMWA 3NQMA 2X1TA 3DFOA 3W3OA 4JYFA 4MIMA 3IIOA 4MY8A 2PURA 1PS9A 4CNOA 3M43A 3C4UA 4K8EA 3W22A 4L4MA 4DBEA 3EX1A 3W7HA 3S5YA 4ADTA 1X8FA 3QSTA 1VYSX 4ADUA 4WZHA 4AWUA 3NPWA 4UNKA 4LC6A 3W7RA 2GOUA 3N2XA 4O4WA 3A9IA 3DENA 3P82A 2NX9A 3NM1A 1R30A 3IVUA 1SQ7A 5FF0A 4YCPA 1QOPA 1TRDA 2OT0A 3I7SA 1TSIA 3FYPA 2Q8LA 1O60A 5TIMA 1X7FA 4PCFA 2FB2A 1IXPA 5TQLA 3W1MA 2DZVA 4IX0A 3PB0A 1UUMA 5EPDA 3DKLA 1XI3A 2VFGA 4FNQA 4X2RA 3S5ZA 1SZFA 2XN0A 4MKNA 3G0UA 3WK2A 4A22A 1OFEA 3Q37A 4UXDA 3TQKA 4LC8A 4AH7A 3LLFA 6ALDA 1DKWA 3IGSA 5A8GA 1VLIA 4RV8A 1OVDA 3C0JA 4MZ1A 3I65A 1Q6RA 2E5DA 2FIQA 3SR7A 1NVMA 3UNDA 5AC7A 2CZDA 3OG3A 1D9EA 5F2IA 2WSRA 1LOLA 1JQXA 4BK9A 1F05A 1YXCA 2ABBA 3UWYA 4NZJA 3FKKA 3HJZA 1YDOA 1JRBA 3O07A 1LYXA 1JR1A 1KM3A 1XFBA 2NWSA 3QZEA 3MWAA 1W8SA 3LV5A 5ABTA 1TQXA 1H60A 3M47A 4NJHA 3C8FA 4PL1A 3C2RA 4WX2A 4N02A 1FWSA 2YXGA 3TFXA 2JBMA 2PRMA 4ZQPA 3O06A 2JKPA 1OG0A 3UZ5A 1LBFA 1GPWA 3HBLA 1RVGA 3R13A 4N9DA 2ZRYA 3MJYA 1YPFA 5C54A 2A4AA 3FJ6A 3M41A 2E09A 3D0CA 1GG0A 1KM2A 4QM1A 3ZWSA 1BEUA 4EWND 5AC6A 4JTUA 1RQHA 2C16A 3G1VA 3LCGA 5IM51 3BW4A 2ZTJA 4QSHA 4DBDA 3CPRA 3CM4A 4K36A 1KV5A 2QCDB 4O19A 5CPLA 4L4LA 4QNWA 1VCVA 4YXGA 1FBAA 3NQEA 5D09A 2G97A 3LB0A 3W6YA 3BW2A 2QDGA 3DFTA 2V82A 3W2KA 3N9SA 3MMTA 4LVGA 5KZDA 3WJYA 3GKFA 3CLMA 4A2SA 2QF7A 1OFBA 4MYXA 1F2JA 4DF2A 4MJMA 3MO7A 4UC5A 3TUUA 3RFAA 5DCBA 3N3MA 4ZQOA 2WSQA 3B0VC 1VS1A 1ICPA 1D3GA 2YR1A 3USBA 3KVLA 3GAKA 2DZUA 3L5MA 1AG1O 4UTTA 3NQVA 4LNYA 4UFKA 2HS6A 1I4NA 1X1OA 4JYDA 3L9CA 3LHYA 3SW6A 3LGEA 3MP3A 3W7IA 4NJKA 3ELFA 3NL3A 3JS3A 1OFPA 3I68A 4JTHA 4HSNA 2J9ZA 2RDTA 3B8DA 3SIZA 1YTDA 4NU7A 3LXCA 3QMSA 1VHCA 1Q6LA 3TX9A 1OJXA 1LOSA 2RKXA 2CZ5A 4LOCA 1GYLA 1JVNA 2ZFAA 2EAWA 1LLWA 3I6RA 3B04A 1MEWA 1PCKA 3CWOX 4IMEA 4WD0A 1VLWA 2A7PA 2PRLA 2TPSA 2Y70A 2E1DA 1LTDA 3PBVA 3T40A 1TTPA 2ZTKA 4FNTA 5LNWA 1XBYA 4O18A 1SU5A 5F2MA 2ZRWA 4TU1A 1G7UA 1SSGA 4S2BA 2BLEA 1P4CA 2YFOA 5LHEA 1H1ZA 4LW7A 1K8XA 2VFFA 2NZLA 4M7SA 3OVQA 3G1XA 1G4PA 2BX7A 1W56A 3W87A 1J2WA 2VEKA 4GUJA 5EA9A 3SFKA 1KA9F 4JY8A 1Q6QA 4ONVA 3LCIA 2QUUA 4JD4A 4QAIA 3HG4A 1O5KA 4Y90A 5F2LA 2XN1A 1SO6A 4IMGA 2I9EA 3STEA 1O95A 3PUEA 3W1UA 3QFEA 3NL6A 2FJKA 5KZMA 2G5WA 5AHLA 1O5XA 3M5VA 3OHIA 2EHHA 3L5AA 3C6CA 3KXQA 3ZFHA 1ZAHA 3LHUA 4A3UA 3PBUA 5FEWA 1HUVA 1W5NA 4UMBA 3TJLA 1F5ZA 5F1UA 4K39A 4N9CA 3MP5A 3P60A 3UPBA 4ZQRA 4PL2A 2VFIA 2V0TA 4UTLA 2AAMA 1G4TA 5K9DA 4IWWA 3BGJA 2OX1A 4AHPA 3W7JA 1JUKA 1NF0A 4I9AA 2B4GA 4JR5A 5KTLA 3DH7A 3GK0A 2C18A 3P8JA 2NUWA 4OU1A 4HHPA 3BG3A 1WDWA 3N19B 3MYPA 2R91A 2X1SA 4XBKA 3O8AA 2Y88A 4UTMA 4UTWA 3L67A 5HQEA 5U4NA 3CB8A 4NVTA 4WXYA 4BI7A 2FQIA 2HSAA 1F74A 2CLKA 4ZQNA 1FWTA 4CLMA 2QCNA 4O8RA 3G1DA 1XCFA 2VOMA 1KFKA 1QO5A 4IOTA 5EMUA 5AFDA 1XC4A
chains in the Genus database with same CATH superfamily
1ALDA 2NQLA 1OX4A 2ATSA 3VX0A 1XG4A 1FXPA 2W63A 5A6KA 2ZQ0A 4RE4A 1UROA 3VD7A 3K4DA 2QGYA 3TJIA 1OCBA 4KBXA 3MSYA 3T2QA 1WDSA 4QRNA 4HOZA 5AHMA 3VO0A 1FCBA 1WBHA 2CESA 1WUFA 5E09A 5G4EA 4Q33A 4GH1A 2V2DA 2QUMA 2XSAA 3KEHA 3KVMA 3CZJA 1JF5A 3HGJA 4S39A 4S1FA 3RO8A 4HZ8A 7ODCA 4H00A 5K9XA 3TW9A 3QQWA 1EHNA 3K4WA 1XC6A 3E0LA 5HINA 2ACQA 5AHNA 5E0CA 2QW5A 2WWCA 4Y9NA 3KBMA 4FK9A 4HMCA 4MWAC 3GM8A 3HMCA 1KRCC 1OGSA 4A4AA 1SO5A 1MXSA 3SSJA 1JJKA 1VYRA 1TTQA 1TUFA 2NUXA 3ZOAA 3S1UA 3S6DA 1E72M 1Q4WA 1V3JA 1E56A 3PZQA 2QT3A 2VZTA 1Z42A 3GUWA 3REQB 1HL2A 2BXZA 3FK4A 3R0DA 3AS3A 3PZOA 2QDHA 1HVXA 3CL6A 3R2GA 2CLFA 3CB3A 4UOZA 1I2NA 1PDZA 1IZCA 4XBJA 1ZBVA 3NZ1A 4NIRA 2V9DA 2YCLA 5AC4A 2DPEA 3BSHA 3SCSA 2XM1A 4EOUA 2ZXDA 4DN1A 5AVHA 3R10A 2GJRA 3DI1A 4EXAA 3H4WA 3GU9A 2JKEA 4PMYA 1V02A 1XUZA 3DGRA 2IKIA 3IPWA 4MF4A 4GFIA 1HP5A 3TMLA 3WNPA 4D6DA 3WK1A 1H0IA 4UNLA 2J24A 2PDJA 4NAFA 4QBXA 4HNVA 1I2OA 4N9BA 2C1HA 1DJHA 1N8WA 1V6TA 3NGFA 2ONEA 5BXPA 4WEVX 3PUOA 3R6IA 1OYAA 5T9BG 3ZSSA 1SJBA 3IUIA 3HGOA 2A3HA 3LCWA 3QR1A 2VT0A 4S3KA 4DJFC 1B9BA 3NPXA 4TR9A 4EXQA 2NSOA 2Y5JA 5HWJA 5LKYA 4UFIA 5AY7A 3QV9A 4MY9A 1XPYA 4O54A 2NWRA 2OZ0A 1AW1A 3GG8A 2WKJA 4QAWA 1E73M 1WXJA 5HULA 3VNLA 1SFLA 6A3HA 5H1WA 3ZR4A 3SO7A 3UZXA 2G8ZA 4O11A 3CPUA 5HMEA 3SBFA 1I1XA 3OQEA 2A21A 4GC3A 3O16A 3AWNA 3HF3A 5HJXA 4MAVA 3FLUA 3A4XA 3IGHX 2WZIA 2WB5A 2GGEA 1QBBA 3WBAA 1WX0A 4NJGA 1TV4A 4WCJA 5FEPA 4PUNA 2G4FA 3CIWA 1RALA 3OLDA 1TREA 4KGJA 1JQVA 2E77A 4UR7A 5BRBA 3ZVIA 3NOEA 2D23A 3RJYA 1R3TA 3UPWA 3ALGA 3BVJA 1EPVA 1UKOA 4G56A 4NRRA 3VPLA 1B57A 4Z1DA 5PTDA 3UA3A 2XSXA 1M5WA 3WY1A 1FDJA 1IIHA 4XVEA 1G7VA 4Z1BA 4YWIA 1LWHA 1M04A 4Q8NA 2GQ9A 3PF3A 1AD4A 2VCCA 4DPPA 2ZXQA 3E12A 1JDDA 4QHRA 1XICA 4PBFA 4AXKA 1Z9AA 1TPVA 1YLVA 5LYRA 1A5BA 2DJXA 2VWSA 1EQPA 1J5TA 3GR8A 4DUWA 1WOAA 2YL9A 3M0JA 3VFLA 2C8NA 3OODA 4A05A 4AC1X 4OGZA 1H7NA 3C0SA 2QPSA 3CUGA 3NCOA 1XLIA 4PUDA 3C3NA 1HFBA 4LRSA 3B0PA 4IF2A 4BZYA 4PN2A 3PG9A 5JBEA 4O57A 1IEIA 3HB9A 2TRSA 4QEEA 2WK2A 3ARVA 1XRFA 3S1XA 1TE6A 3GXTA 4GGBA 3ZT5A 4KFOA 2D73A 3N4EA 4Y8EA 3Q94A 4YYFA 3NUKA 1KQZA 3SQLA 2DGAA 2OTDA 3CHVA 5AHEA 4CCCA 2WMIA 1FA2A 4EPEC 1D8CA 3GC2A 2YYUA 1LG2A 1W5OA 2V3EA 4JKKA 4DBWA 1EUAA 2PD9A 3BLFA 3GR4A 2VGFA 5JH1A 1DQXA 1NJJA 3PJWA 2BGSA 1JGMA 4HZMA 4EXBA 1VFLA 4F0HA 3VIPA 1Q7ZA 1WOBA 1BPLB 3PNZA 4NXSA 3RDKA 3S8HA 3HPSA 1UUOA 1CLKA 1JFHA 3W7LA 3B06A 3LCFA 1BVNP 3VIOA 2Y89A 5CBBA 2PA6A 2PODA 4X60A 4QROA 3K1DA 4J3SA 1W91A 3W29A 4MJ4A 4GUIA 3DG7A 1NWRA 1KXVA 3FHQA 3R11A 3U7VA 5KINA 1IV8A 1N55A 2ZIDA 4JEQA 4UQ9A 4GH3A 3GIPA 3TZFA 2FLIA 1PKYA 1QPRA 3U0HA 3K46A 2HMCA 1ENUA 4KIRA 3IWPA 4O1CA 4ZSTA 1OFOA 3KZPA 5A6JA 1WDPA 3S0CA 1LWJA 3PZNA 4JTLA 4Q6JA 2E28A 3M07A 1L6SA 1FH8A 3OP2A 2XVPA 1BGAA 3MUAA 5FACA 1R3WA 4Z08A 5I3DA 3RLGA 3B40A 1AQHA 1ISYA 3PBYA 1K9EA 3FAWA 3L68A 3EXRA 1V5XA 3WELA 1P0NA 3OEXA 3HG3A 1R9ZA 1VFHA 4GRSA 3QHOA 2PS2A 3L0NA 4M6VA 4W8LA 3E1F1 3AFBA 3QQ0A 2FYMA 2Z1XA 3SECA 1XKYA 2QJIA 3VNIA 3LGGA 4WGHA 1A3WA 2W6RA 2D24A 5FJTA 3N6JA 4J2MA 4M1RA 1KTBA 1T99A 4LRTA 1P0KA 2CLEA 4K2SA 4RZ5A 3B8TA 4TX8A 1XLHA 4WUIA 1XLCA 5D9PA 3K13A 4P7QA 3DG3A 5IFPA 3C2VA 1K9FA 3E0VA 1NWUA 1UKPA 4GJ1A 1AQMA 4J5NA 1RPKA 2V81A 1XH1A 2Y61A 4GXMA 3ARXA 3N2CA 4HTYA 3RLVA 3H23A 3MT1A 2Z26A 3PC0A 3CZEA 3AHYA 1V4YA 5H8UA 1R9YA 2VQTA 4GYPA 5JBDA 2DH2A 4YVVA 1R8LA 1GOIA 4EX4A 4LANA 1WKYA 2PDYA 1BYBA 1O5QA 3EKLA 4E4PA 1K3UA 3W1NA 3CHCA 2YDAA 2CZFA 3WJZA 5E93A 3CAQA 2HNEA 5CZKA 5EBUA 3LK6A 1ADOA 1POJA 5C9WA 2HRWA 3S1GA 3AXKA 4IIFA 3FSTA 4TMBA 4X61A 1HJXA 5H2ZA 3W9ZA 1EJVC 3MSGA 3WLTA 5ECUA 4IIHA 2HJPA 3VNZA 4PUUA 1XLJA 1XG3A 3EDJA 3KOZA 4M6PA 5CZTA 3ITGA 1LJYA 1IR1A 3B0XA 3GHRA 4JIRA 3G5EA 4JFSA 1PHQA 1DQUA 5LIYX 3AOFA 4TOQA 1MEHA 4IMFA 1RP8A 1EJWC 1Z44A 3TSDA 4JX4A 2PTXA 3CIVA 4E8CA 2VCAA 3PFRA 2G0WA 3T55A 3WLKX 3GZAA 4BEQA 2YB4A 4RV3A 3IV8A 2CKRA 4KCUA 4EVZA 4RCXA 2QR6A 3N29A 1P6CA 2V2HA 3O3RA 3UCCA 4ZQMA 1EUNA 3NPUA 4RE2A 3MVIA 2YB1A 1ZZMA 4W5UA 4XKYB 4IPLA 1IE7C 4NJIA 3MP4A 4Q4KA 4Z17A 1ZB5A 2ZWYA 1AD1A 2XYLA 1V3KA 3NO3A 3U9IA 1FX6A 1JEZA 1ML1A 4PE8A 4BF9A 2PDGA 3ISIX 1KM1A 3GHUA 1S2CA 2GDQA 2E8YA 1VGAA 4FNRA 4LY8A 2DUZA 4PMJA 2PFHA 4EKJA 3RLHA 3R7MA 4JL2A 2OZTA 3LPOA 1UJQA 4I90A 1KM6A 2GVYA 4ZZ9A 5I06A 1X1NA 1PB0A 4F0SA 3SGZA 5FF4A 1A5NC 4D1JA 3W83A 1E6PA 3VMPA 4G7FA 2JIWA 2PP1A 4MOZA 2R14A 2R1LA 2QUTA 2XH7A 4CD4A 3Q58A 3G6MA 2I17A 4JQ1A 1WAUA 5D9NA 1WV2A 1CI1A 4NNBA 2MUCA 4AFYA 1LT8A 1DTNA 3FAXA 4GQGA 1WYIA 4U2ZA 4S3DA 5FEXA 1D3CA 3Q4DA 1ZP3A 4IX2A 1QMLA 5H8MA 3WK0A 4X63A 1MXDA 3R12A 5ABFB 2SFPA 1H7WA 2GJPA 3FDKA 1W32A 5I3GA 4LUJA 1QOQA 3CZKA 4MG4A 4JFWA 2VFEA 2OYKA 3GYEA 1OX5A 3TAKA 5CGQA 3MV01 2WZTA 4PB3A 1HJSA 5C71A 1TQJA 3CZ8A 1WBJA 2ZZ2A 3HQ1A 2H90A 1S46A 1H49A 1I6NA 2QAPA 1T40A 2OFJA 3WLLA 3PK7A 3IANA 5CG7A 3XINA 3II1A 4JHOA 4H7VA 5AHFA 1YYAA 2DFAA 3M5YA 1M7JA 3S9ZA 2IXUA 2WOQA 3G3DA 3AU6A 1KFLA 4GUGA 2E40A 3MCMA 1KWKA 1I2QA 2DORA 3UR8A 2OX4A 4ZQCA 1KKRA 2P88A 5DY3A 1R3SA 1XYAA 2Y8UA 3PHAA 1Q45A 4BKNA 4IT1A 5KSWA 3D46A 4DAIA 3RNDA 4P8XA 3HOJA 3OA5A 3MUXA 4C6DA 5CZ0A 1O66A 4GZIA 1S1RA 3THUA 3R1ZA 4A3HA 3KOFA 4IM4A 1T96A 4W5ZA 1CGWA 2C0AA 3EA2A 3MB9A 4IH3A 7TAAA 3OZYA 4DLMA 4O13A 5E70A 3W72A 3WQ4A 1TA3B 1BD0A 2GOKA 4JX5A 3NDOA 1M1BA 1KC7A 1K6AA 3GNNA 4IGMA 3B9OA 2P1FA 4ZL1A 1Q6GA 3R58A 5JH2A 1J18A 2WANA 4Z2JA 4GK8A 2QULA 3GXFA 3MTWA 2GZXA 3CWNA 1BXBA 1EKOA 3PBGA 3TN4A 3RX4A 2J77A 3DC0A 4Q8UA 1UC4A 4LAKA 1TZ7A 3MMWA 2GJXA 4X3ZA 4R34A 2QV5A 1QNVA 4GQBA 3MYOA 4HPNA 1S5WA 1OADA 3EOSA 2D0GA 4QLKA 3ES7A 3TSBA 3HU7A 2F7FA 3GH4A 3ZO9A 2YZRA 4OV4A 2Z29A 1DWJM 5FAGA 3LCLA 4XISA 2Q3OA 3W6LA 2FJUB 2Z4GA 5K4XA 2OODA 2ZX9A 2VDGA 3VOHA 4UNIA 4W8AA 4U5IA 3BMXA 5CPOA 5LHFA 5A2AA 3NSXA 4AEOA 1ZSXA 4LPCA 4D6FA 4HNCA 4C6JA 3TA9A 5FCZA 2DQXA 3S42A 2H9AB 1FWEC 3KOXA 3WL0A 2QNEA 4LAMA 3BWWA 3BCJA 3T2OA 4E5TA 1NSJA 1DWIM 3LBCA 4F4RA 1X97A 5LA0A 3ZJ7A 5CH9A 3W25A 1U30A 4F2UA 3QY6A 4Y7EA 2KAUC 2V5LA 5E6YA 1K7EA 4AZCA 2OVLA 3E0WA 3P7YA 1H41A 2PDFA 1RK5A 4H1ZA 4JTTA 5G1YA 5BWAA 5D02A 1IEWA 5BU6A 1TV7A 4QG8A 4U2YA 1NDVA 3PZGA 2PUZA 4ZE4A 2EBNA 1TE1A 1MWOA 4JQAA 3WFZA 1G0CA 3CAWA 4HA4A 3H53A 1OF8A 4NT0A 2WBKA 3RAOA 5C9ZA 1ME8A 4FX7A 1TPWA 5D32A 3GUGA 2GK1B 2PWFA 2V30A 3VD5A 2RDWA 4HZ6A 1F3XA 4AX6A 3EB4A 1BYCA 3L4ZA 1K03A 2RHGA 1VIWA 1CGXA 1JCJA 1GOMA 3TR2A 1EBHA 1C8XA 4NXKA 2X7VA 5EMMA 3FYOA 3H8AA 5AVNA 1P0EA 3W2UA 4KW2A 1JPKA 3NDYA 5IOBA 4Q22A 2P8BA 3OGSA 5JIWA 1W37A 4M1BA 4M29A 2JEQA 4O1AA 3QPZA 3JZEA 1UR8A 1FWAC 1BG9A 1DJXA 1CPUA 3BXWA 5G2WA 2BOFX 4JTEA 1L6FA 3R5EA 3S9YA 1BQGA 4QG6A 4NL1A 1TV8A 1NP0A 5U7SA 2I9UA 4B2DD 5EMYA 4PH6A 5J04A 1JD9A 5HNUA 4NYYA 3M0MA 3IUDA 4D8AA 3M9YA 3UYCA 1V7YA 3P93A 4XO6A 3A24A 5GJMA 3UGVA 3SEPA 3EMQA 1UASA 4TTUA 1W17A 2G3IA 1CB2A 3TQPA 4WSHA 3GTFA 3ITYA 3N25A 2E6FA 1ZHAA 3HTWA 4JNMA 1SZRA 3B3DA 3UEQA 5F2GA 1XYLA 1O4UA 1NFPA 2VR4A 4LU0A 2UY5A 1GZJA 3W88A 3W23A 2V63A 1BQCA 5AC8A 1K4HA 4AXNA 4CU6A 4IUOA 1NU5A 1VRXA 5HJLA 1B1YA 3B8IA 3S5NA 1YW1A 1WQ5A 3V5FA 3TTSA 2P3ZA 3GDRA 3BV4A 5AYZA 1AW5A 3SZ8A 5DRIA 4LUTA 4XIAA 3ZZ1A 1J93A 4MDOA 1G6CA 2X0YA 1AZ2A 1LRQA 2PF8A 1K70A 1V03A 1W3TA 4E2BA 3W76A 2Z0IA 3A4WA 3BO9A 4TVUA 4CVUA 1M7PA 1GCYA 2PLMA 3R94A 2QLYA 3EPNA 2JIEA 4I6VA 4ACZB 4BA0A 3UWUA 3THAA 1KFEA 1IHIA 3L5LA 5H91A 1ME9A 3WH6A 4W7WA 3EOLA 3EZ4A 1NEYA 4D72A 4ZO8A 3GHTA 4AHQA 3V0TA 1JRCA 2V5DA 4RL3A 1EL3A 3T0BA 2YCJA 4B5VA 1QT1A 3A5FA 1H61A 3CH0A 3GO2A 4AAJA 3W75A 2JGYA 1HKIA 1SZNA 3CQIA 5BOFA 4RXGA 4K68A 1TWSA 4B5XA 2A7NA 2OKTA 3MV11 3TCEA 1UMYA 4XTDA 1EZWA 4CD8A 1B5TA 1D7FA 1EDTA 1O6IA 1TWDA 2QV4A 5AC5A 4JGDA 3GVGA 4K7YA 2X1UA 3WF1A 2Z25A 1JCXA 1J12A 1QOXA 1B3WA 4NZFA 5HQMA 1TRIA 3UR5A 4L6HA 1ZALA 4HGXA 3KZSA 2XDFA 4QE4A 3QTGA 1EEPA 2WMJA 4JL1A 2OG9A 3NNTA 5CCZA 2EPOA 1SJDA 2QS8A 4P8UA 5K7JA 3FVMA 4HPXA 1ZCOA 4AZIA 1UWTA 5FKYA 2C6QA 1QW7A 2V38A 4HB7A 3GKAA 5LGXA 4JNYA 4D6IA 3ZVHB 3PUGA 4HU3A 4S23A 3GTHA 2J6XA 3QY8A 3EWDA 2NLYA 1VENA 1RBAA 3NYDA 4TIMA 1EJUC 4QITA 1M3UA 1VP5A 3IVTA 3LY0A 4M80A 2VR2A 4CUCA 1ODZA 2CLMA 1FFQA 4Y8FA 4MB3A 1UKTA 3ABSA 2GGIA 4GY7A 3JU2A 4PTNA 3SJNA 1HO1A 1W9DM 3NQ8A 2A3BA 4HT3A 1GW9A 3NM3A 3LA4A 5CPMA 4Q7IA 2VI0A 4E8DA 1IXQA 3ARQA 2EG7A 4BI6A 1TWZA 4DY1A 3F4CA 1HX0A 4IMCA 4E6MA 1JXJA 2D1ZA 4L4OA 3T0DA 5BMWA 3FIGA 2I16A 3NQMA 3W3OA 2WWDA 3OGVA 4MY8A 3M43A 3C4UA 3W22A 1V3HA 4NY2A 3EX1A 3S5YA 1NQKA 1X8FA 4GX9A 1AZ1A 1NDZA 3NPWA 4CQDA 4O0QA 2OSYA 3A9IA 3P82A 2NX9A 3NM1A 1R30A 2OT0A 3I7SA 4S3FA 3WUEA 2XGBA 4B5UA 4W8BA 4DJDD 1X7FA 4PCFA 2FB2A 5TQLA 1UD4A 1UUMA 4Z42C 3ITVA 2VGIA 3V0SA 4FNQA 3N9KA 5I23A 2QVHA 1SZFA 1R3QA 1VFMA 4MKNA 3ZQ9A 4P7LA 1E6QM 1XLEA 3LLFA 1DKWA 3WF4A 3VDHA 3C0JA 1D2KA 1A5KC 4J40A 4KPLA 4XZIA 3UNDA 1MUCA 3OG3A 4MUPA 5F2IA 1T41A 4HNLA 3PJTA 5CSUA 1EJSC 4BF7A 3VUPA 4GXWA 3KBNA 5HQLA 2W92A 1P6BA 2VZVA 3CBWA 1XFBA 3QZEA 2F61A 3CAVA 2YXGA 1R85A 2Q8XA 4B5SA 2JKPA 3M0YA 3CASA 1LBFA 2FHFA 2VC7A 3HBLA 1RVGA 4GKTA 1Q66A 4N9DA 4AW7A 5E0FA 3O9NA 5D9MA 2HPMA 2PDMA 3FJ6A 4AZ7A 4JOMA 3ZLFA 3M41A 4Q4SA 2DH3A 2OZ3A 4QM1A 3ZWSA 1BEUA 3K5XA 5AC6A 4C60A 2PTWA 3TYCA 1RQHA 3DHPA 5IM51 4QSHA 2CBVA 3CPRA 2QCDB 4M0XA 4QNWA 1VCVA 2J7DA 3LB0A 4MNJA 4YTTA 2PDKA 4FAMA 1KBKA 4GZ7A 1A4MA 3WJYA 1BSIA 1M9HA 3GKFA 4A2SA 2QF7A 3N6QA 4MYXA 2NQ9A 4DF2A 4DXKA 3T08A 1YHTA 5DCBA 3S5SA 3AZTA 3ANUA 4TQTA 2YR1A 3KM8A 1CGYA 1XLDA 3SRHA 1H09A 1MDRA 2DZUA 3L5MA 1FWCC 2HWGA 3AHXA 3DDMA 1UPPA 1QI2A 3GQYA 1WKDA 2WMGA 4MGGA 3LGEA 3W7IA 2F6UA 3ELFA 3NL3A 1S5NA 1CCWB 1OFPA 2GUYA 3GTXA 2J9ZA 4P8VA 3B8DA 2OEJA 2BVTA 2WVSA 4CD6A 2PDLA 2HE8A 4ZO6A 5A6LA 3RRAA 4LOCA 5A8PA 4DX3A 4AIUA 3N4AA 2O9TA 1LLWA 1E4LA 1CDGA 3WD2A 4C6CA 2A7PA 1JZ3A 3PBVA 1OB0A 2Y1HA 3B9DA 4FNTA 2FGBA 3MUIA 2O56A 4TTGA 3WLIA 2HK0A 3AICA 2ZRWA 4TU1A 1G7UA 2YCKX 2DT2A 2BY1A 1J5SA 2YFOA 1H1ZA 4QX4A 4LW7A 1BG4A 1IT7A 3CHEA 3ZJ6A 3W38A 4ZO9A 1TFVA 2EG8A 2OLAA 2NQ5A 4PRRA 4JY8A 1FHLA 4JD4A 3HG4A 1O5KA 4W7UA 4IMGA 1NARA 1O95A 3PUEA 1V02E 3W1UA 2WJEA 4P7RA 4DWSA 1HIZA 2ON3A 5AHLA 3M5VA 2VD8A 4ZR8A 3KXQA 3ZSTA 1ZAHA 3LHUA 1UA7A 3PBUA 4DXXA 5FEWA 1W5NA 3NOYA 3TJLA 4D6CA 1XIJA 1DJZA 1WDDA 3WLRA 5A8OA 4PCPA 4N9CA 2RJHA 3BZGA 4L9ZA 2Z27A 4UTLA 4NZCA 1YNYA 3WLHA 1UIOA 1GQKA 4AHPA 1NF0A 2VX4A 2X1IA 4JR5A 5KTLA 1QUMA 3D5HA 1OZQA 2NUWA 4OU1A 4HHPA 3N19B 2X1SA 3S4TA 1N2VA 3KWXA 4UOQA 5HQEA 3ZT7A 3CB8A 2UWFA 3RU8X 1FWDC 2GJXB 3L2MA 2DVUA 7A3HA 5A1AA 3F7JA 3UJRA 1UPMB 5D8ZA 1DIEA 3AROA 1KFKA 3OU8A 4QEHA 4HHMA 3AZRA 5AFDA 2BY3A 1FFRA 3AALA 4DJFD 5CZSA 4C90A 3WEOA 4JDBA 2CEQA 2PDIA 3WNOA 2BXVA 4W93A 2XVLA 1RA5A 2CC0A 3CEUA 3PWAA 2WNWA 3C86A 1X6UA 1FCQA 4FXJA 1J2BA 4IFOA 4GIAA 2FFCA 2WZMA 4XZBA 3T81A 4U3AA 5DT5A 2CERA 5DY2A 1DJNA 4LVFA 2OSWA 1VFUA 1JCLA 5DMNA 3FN9A 1IQ8A 1J11A 3K8MA 4GCAA 2PBOA 3AUOA 3TYZA 2YBTA 3M0XA 4LV4A 1R2SA 1UZ4A 3M6DA 5DELA 4GIEA 1AVAA 1R3VA 2YDSA 1C7SA 4IXXA 1KV8A 3M5ZA 2NQZA 5ABFA 2XPKA 1X39A 3QV7A 4KRUA 4ORIA 3A3HA 3OZPA 4IMAA 4U4MA 1A3XA 3MI6A 2QIWA 1OCQA 2VO5A 4HSHA 2ZC8A 4RXFA 4NQ1A 4YTUA 3STFA 1EJ7L 4KWUA 2ZICA 3UZJA 1PVNA 1H63A 4B5TA 4AZ5A 3QF0A 2QZRA 1WXYA 1Q6OA 3GTIA 2V5CA 2W61A 3BSGA 3KLKA 1S3TC 1DXEA 4A6GA 3B0UX 3S2LA 3DBPA 1EHAA 3NZPA 2NV2A 2PTYA 4JAWA 4JTAA 1BF2A 4C7GA 3W00A 3W07A 3WDJA 1KR0A 3JW7A 4HIBA 3N17A 2CW6A 1LBMA 4JHMA 4UQCA 2Y7GA 1QHZA 3VKKA 4DRSA 3N3TA 3CS2A 4GIYA 3N73A 1FDYA 1AJ2A 5D03A 4TMCA 1XL9A 4Q8WA 3TYEA 3FEQA 4ZOEA 2DJLA 1SPQA 4Y9PA 3VGDA 1EWEA 1SFJA 4KF1A 4GCXA 4G8TA 1H7RA 4LAUA 3VXGA 3JRKA 1PHWA 2TSYA 1WDRA 5BOOA 4O28A 3I7RA 1N8FA 1W6TA 2GLKA 1HN1A 3RMJA 3LZ3A 2B7NA 4MSSA 1SMDA 3KOYA 4C6NA 1UD3A 4PUMA 5TF0A 4UOJA 3AJXA 1HQTA 4JHZA 1LL6A 3GX9A 5EMJA 4US5D 4OUIA 3H21A 2V5JA 1H62A 3WDRA 7PTDA 4LFYA 2HS8A 4LYKA 2GJNA 1W3NA 3LENA 3REQA 3CUHA 3GXNA 1SJAA 3DHDA 3UESA 3LRKA 4JS3A 3HPXA 5FF3A 3WQCA 3TH6A 3W26A 5T9CE 2WM0A 2ACSA 4YTSA 1J0KA 2B7PA 1LDCA 1E4IA 2BS9A 3BANA 4AIOA 4LB3A 4N2YA 1HF6A 3THQA 1FH9A 2WJZA 3MZ2A 4UTWC 5M5DA 3TP4A 2TAAA 5DANA 4L6DA 3PR2A 4DO4A 2RDXA 1W5PA 9CGTA 3XISA 4K7VA 4ML4A 5TAOA 4OT7A 2QDDA 8RUCA 4CQ8A 3DUGA 4FF5A 4PMDA 3SCTA 1NQ6A 2ZZ5A 2R24A 4LEFA 4GACA 3BK0A 2QEZA 2G95A 1PUDA 2GPTA 1IZKA 3SCQA 5LIXX 3QW4B 1W2PA 2OSXA 3VDGA 4H4IA 1JYVA 1W0MA 4M19A 1XBVA 3W73A 3MSDA 2CITA 3GDMA 2PWGA 4GUHA 4O0KA 5EU9A 4DWSC 4PCSA 1UQYA 3JR2A 2WAGA 1U22A 3PWGA 1CXFA 3IGXA 2A6LA 2H3DA 2GVGA 4F48A 4O8AA 3G0XA 2ZXBA 3VOJA 4UR8A 2CHOA 1FCUA 4DM2A 1PO9A 2O9PA 4UCGA 1UJPA 3VAVA 3IIXA 3G8RA 4K1GA 3CTTA 3WNMA 5FSDC 1RZMA 5CEWA 3ATYA 2GQ3A 5LGZA 2VEMA 3LOTA 3TSMA 1XIMA 4XZMX 5D38A 1TVPA 2WJFA 5G1TA 2FH8A 1EC7A 2OCZA 3PG8A 3W0KA 4HK7A 3QZAA 4BJHA 3L0KA 3L4WA 3IJ7A 1CXIA 5CZJA 2QXWA 1C9WA 1GYNA 2PPGA 2QDEA 2ODOA 1BWKA 3SUSA 3P80A 3OYZA 2C13A 5D2VA 4RNIA 1NOWA 3BPWA 3SGGA 5CXPA 2QIIA 3LHVA 1U5VA 2V67A 3GZ3A 4AMAA 3GG1A 5G5IA 3IJQA 1TCMA 4W85A 1P43A 4H2HA 3QPEA 4H6EA 1P7TB 2DIJA 4J3ZA 5K9CA 4LS0A 3PBWA 1R7AA 4RJEA 1JZ4A 3VCRA 1GORA 1G69A 2Z7GA 1GKRA 2JF7A 3RRXA 1DVJA 1KBIA 2ZRZA 3W7EA 2VMFA 4B4FA 2DUAA 4GUFA 3ALFA 5CPNA 5BWFA 2BSLA 3WKZA 2DIKA 3NVTA 2ZA3A 4N7QA 2UBPC 1EB3A 4D6EA 1EC8A 4UMCA 3TQ0A 4U3CA 1VC4A 5ABHA 3LEPA 4RK8A 4J27A 4FXFA 5HK4A 2QCDA 5AECA 1CGTA 4WOQA 1GQNA 1XJBA 4GQQA 4FX6M 3WUGA 1VRDA 3ARTA 4WY0A 6TAAA 2QUVA 3I3EA 3LRMA 2OQYA 4IIBA 2PAJA 5FIPA 5B80A 3CJPA 3A22A 3FA4A 2PGWA 1EXBA 3C0LA 1LUCA 5E5CA 3VA8A 2QJHA 1DHPA 4RZBA 3NVDA 3H6OA 4WDUA 4GI9A 1XW8A 2P50A 1F76A 1LORA 4GISA 3L0GA 1L6GA 4DJEC 4DELA 5DLCA 2E4TA 2PLKA 3W01A 5LNRA 2ZE0A 4AZCB 2YZ5A 1SZEA 5CGMA 2VDHA 2ZUNA 2FZ9A 3NQBA 1OGGA 2BB0A 3KCJA 1POKA 3W71A 1E9LA 1P7TA 3QSRA 5E1QA 4HCLA 2VEFA 3BTNA 4PB4A 4NP7A 1GQIA 1M01A 4TVDA 4QFUA 1QWGA 2AOSA 4HYRA 1MVYA 3LYEA 4LT9A 3TAOA 1JDEA 3W1LA 1C93A 3FX4A 1W1PA 1LT7A 1RSCA 1R47A 1Q3NA 1UZHA 2Q6ZA 3WBEA 1DHKA 2O55A 3VGHA 4Q4PA 3BL3A 2PP3A 4L64A 3GIYA 2W62A 1IIGA 2BVDA 4I9TA 3VX1A 2EO7A 1GT8A 3WG6A 2VRQA 1EGVA 1HKWA 2H9AA 4KRTA 2WBGA 1QPQA 3N34A 4J1OA 3GHSA 2DSVA 2NX1A 3AIEA 1TELA 5EFFA 4PGLA 1XBXA 3FYYA 2E6YA 3TK7A 2NT1A 4S3CA 3RO6A 1I0BA 4Q8TA 5I03A 4AY8A 5CGTA 2JGQA 4W4QA 5I3JA 5CQ1A 1XDMA 2XGIA 3PULA 4DB7A 3ORWA 3VGBA 4QS5A 5ABEA 4C6EA 3UXDA 2B7OA 2YCIX 3EKGA 1UWQA 4A29A 4RLIA 3ARRA 3A6OA 2YX0A 3GG7A 1H7OA 2Q09A 4FIRA 3PAOA 3W7PA 3IJLA 3UG8A 2D20A 2RGLA 2I14A 3VILA 5C8BB 2B7QA 5CPSA 2PDPA 4OTKA 1VH7A 1PX3A 5A6BD 1EIXA 4RDVA 4WR3A 3SY8A 4MYAA 2X09A 2R1MA 1O94A 2HVMA 1FY6A 3N04A 4DZHA 3BE7A 1W2VA 1P1XA 2EKCA 4ERAA 1J0ZA 2NLIA 3E2QA 2ZRUA 1I45A 2ZX6A 3WH7A 3QV6A 2OOFA 3BAWA 1NH6A 5I0DA 4AIBA 4ATWA 1M6JA 2BDQA 4ALDA 3SN0A 1Q85A 1ZAJA 1HJQA 1XIIA 2RGMA 4A3RA 5C5YA 1TPB1 4AB4A 4OZOA 3W74A 3N2OA 3BARA 4M56A 1YXDA 5M1TA 3R8HA 3R8GA 4MFDA 1PZ3A 2VX5A 1KM5A 4TX6A 4HMNA 4LS1A 1T7LA 3HJEA 1FWHC 4HOWA 2Q3RA 4QISA 3U4FA 2V69A 3HO8A 3UBPC 4F2TA 4FS9A 3WF3A 3BLIA 1A5MC 1W3LA 2WV8A 4JYEA 2VUNA 4V15A 4DQWA 4I7VA 2PDWA 3TWBA 1BYDA 2ZXAA 3AS2A 4DJEA 3W85A 3TYDA 3U8GA 1PKMA 2F6XA 5T91A 3A13A 3WDPP 3PPFA 1VZWA 2F84A 3UG3A 4AG0A 2INZA 1GKPA 3ABZA 3VKCA 5EL1A 4ZMGA 2EEXA 1HG3A 2NT0A 3CL7A 4INFA 1S2UA 3HFYA 4PTMA 4BWLA 4WF7A 5FA5A 3RN6A 5F4SA 1KBBA 3LRLA 4XV0A 2HBVA 5J8LA 3AXMA 5KMYA 1JUEA 3NQFA 4KEZA 2QQ6A 3RK8A 2B0MA 2YCEA 1E6RA 3TOYA 1ZUAX 1IF2A 4DO5A 1FQ0A 2EPLX 1QBAA 4H9UA 1ITCA 4J35A 4UFMA 3ZM8A 2WCAA 3AHTA 4LUSB 5I07A 5HUPA 4HYVA 2WMHA 3UXLA 3S9IA 2YW4A 3HPZA 3CZLA 1FHDA 4CNUA 4FMVA 2DZSA 3UNTA 3E9AA 2IMRA 1RLDA 1UD6A 2E7FA 1WB0A 4G7EA 2Z28A 3GDTA 5AOUA 1Y65A 4A3QA 1GOQA 1DBTA 2BG5A 1O7AA 2Z1BA 1ZTVA 5A6SA 2YBVA 5E9XA 2QPUA 4GVFA 1JNEA 1E71M 4JCMA 2GGGA 4L9YA 3RXZA 3TW7A 2GGJA 1PTGA 3M5XA 2F9RA 3EX2A 1UOKA 3A23A 3EOEA 5GQBA 3WLMA 2MNRA 3P14A 2PRHA 1FWBC 1XDLA 1EJXC 1KCXA 1DEDA 4K37A 4XKMA 4IQJA 5E6ZA 1Z48A 1E15A 3KS5A 2WO5A 2H8XA 1OX4B 3CMJA 3B97A 1OD8A 1UR9A 3T05A 2OXNA 4NSBA 3OLGA 4M81A 1AA1B 3IUHA 4OOUA 4MJ2A 3HPFA 2WHMA 4JX6A 2WQPA 1J79A 3DECA 5DN1A 4BS0A 3CT7A 4XAPA 3PZUA 1FWRA 1H5YA 1ADDA 2QJJA 3KBJA 4JY9A 5CC5A 4JIEA 4ZBCA 3WX7A 2ISDA 1A5LC 3HQNA 3W24A 1S3HA 4CU8A 1ONRA 1OIMA 4WKAA 1J4EA 2WHLA 3EXTA 3A12A 3G0SA 3RG6A 1XLFA 3VM7A 5C2GA 3D3AA 1WDQA 1KB3A 1TPFA 1XLLA 1YNQA 3H2MA 4O12A 3VDCA 2OMAA 3ITXA 1P0DA 1NP2A 3IIVA 5M2FX 4NI3A 4PBGA 3TYAA 1OT2A 3LHZA 4AEEA 1BVZA 4XD4A 4AVFA 1XGZA 4AISA 1ECEA 3B05A 5AZ0A 3K8LA 4RW5A 4FR6A 5I24A 3HFTA 3TN5A 1XV8A 4DNMA 3U5UA 4PEEA 4C7DA 1X7IA 3K2GA 3L65A 1OC6A 4WLCA 3AMLA 4W87A 4ILSA 3BUVA 3S6TA 1QK0A 2BVWA 4JTRA 1P0BA 4HKPA 3GSMA 3ARWA 7REQA 1CTNA 3W81A 3RX2A 3H2NA 3RR4A 3UU0A 3CZGA 3DN5A 4LAZA 2R82A 3W84A 1G67A 3D6NA 3I3DA 3UQNA 1XRTA 2VTFA 5CC3A 4PMRA 1KGWA 1OABA 4OKDA 5CG0A 5CPTA 5HA7A 1TUXA 4J4KA 1WZAA 3WN6A 4AX7A 2QKFA 4DBSA 1TJPA 1E51A 1A5SA 4JTGA 4C5ZA 4W9TA 4DM1A 3CH9A 2PZ0A 2I56A 3LTYA 3TXVA 3UJFA 4GVGA 3WIJA 4QSFA 3A3WA 1QDSA 3CUFA 3NPVA 4LSBA 1NELA 1YKWA 5BCAA 1PIIA 4JICA 4LCRA 1S39A 1H1YA 1AQ0A 4NHVA 3WMCA 3BLEA 3W2NA 1UOZA 1EGZA 1XGEA 2JEPA 4DZ5A 3L21A 3C61A 1XX1A 3WK3A 1SUXA 2O9RA 1B3YA 3GRIA 4ZTYA 3LD5A 3URNA 3MANA 2A6NA 3EPMA 2HQAA 4XTIA 3WH8A 3ECQA 2XH4A 2CLLA 2DZXA 4WDXA 1W54A 4Q8MA 1DJIA 2DQWA 2C3ZA 2C91A 2WHKA 4JTIA 2CBJA 3KS6A 1D8WA 2GGHA 3AIQA 1F3WA 2RH9A 2VM8A 3VK5A 4BEUA 3I6EA 2NVDA 4X0NA 5EMLA 1ZNNA 4DYEA 1LRNA 1V8EA 4Y96A 3SY1A 1F61A 1J0JA 4MPQA 3UG4A 5A8NA 2DP3A 1G1YA 4IISA 1QNPA 2Y4SA 5HNTA 1DXIA 2V3GA 3UT0A 4UBPC 1JUBA 3KVKA 1KBLA 3W2JA 1CWYA 1V93A 4WRHA 3WMBA 4UR9A 3I3BA 2VNCA 3W6MA 1PKNA 3NURA 4HNOA 4U10A 4OOZA 3WLJA 1GZGA 2OLSA 1VQTA 5RUBA 5SWUA 1Q8JA 3N11A 2EF9A 4BFAA 4ZB5A 1YX1A 1ZS2A 4HHLA 1F6YA 3SDOA 1JNDA 4J7RA 4IPJA 1LP6A 3UJSA 3LNMA 4MWAE 1AH4A 1LQAA 4CCEA 4JIQA 4AD2A 4XB3A 4N4QA 3UWVA 5KZ6A 2AQVA 3OBKA 1ICSA 2IPGA 4Y9AA 4WDTA 2E0PA 3C2OA 4XZWA 4H01A 2YA1A 3VGEA 3G1FA 3UVIA 1DYSA 1XWYA 2INEA 3LGDA 2ZDRA 2DZPA 1UR1A 4XWUA 3IVSA 1CB7B 4XZNX 4UQDA 5C9UA 2FPYA 2QAFA 3CQ0A 1QJWA 5BNKA 1J9YA 3HURA 2FGZA 3TEVA 5LSMA 3RHGA 1XGDA 2AQWA 1ZJHA 3F4NA 4LUYA 1QW8A 4ATLA 5KETA 2WSPA 1A80A 1U83A 4UTTC 2QHAA 5D05A 1OK6A 3E0FA 3RCNA 2ZA2A 1CLVA 4GJIA 1VFTA 4IQLA 3ZLHA 3DBNA 2PWVA 1TX2A 1GVSA 2YPIA 4MWAB 4ADSA 4Z2KA 2DU2A 1WZLA 3KE0A 3NQ2A 2BWGA 1EWDA 3LX9A 4IPNB 2ZRXA 1A5AA 1A0CA 4GY0A 3U2ZA 5HJYA 5JXQA 1FKWA 3RPDA 2DZTA 1KGXA 3TNOA 1TIWA 3R0KA 1Z7AA 1MRAA 3ABQA 2R6OA 3KW3A 4GNVA 3GW0A 4XZHA 1U1JA 3LM7A 1VPQA 2GQ8A 3E2RA 4DIAA 2NW0A 1BKHA 2TMDA 4UCFA 1V3LA 3KHJA 4NAEA 3ZXWA 3QR0A 3GFZA 4KMQA 4RNFA 2YA2A 3N9RA 2CFFA 4LJ3A 4ERGA 3V3WA 4LUTB 3P0XA 4BI5A 4LF1A 1MQQA 4H9TA 4I5RA 4O16A 3TC6A 1A50A 4US5A 5JUVA 3IAQA 3CLWA 1BSLA 3PSVA 2FZNA 4LYQA 1OX6A 4N42A 1GOXA 4GJJA 3OVGA 3EEGA 1E1FA 3GXPA 1SO3A 4PTDA 3WQOA 1FWIC 3W7KA 2NXGA 1EOMA 4WY0B 2D3LA 4B90A 3CUZA 2DSZA 4IPIA 1MZRA 3ITOA 4EAMA 3UG5A 2GL5A 3POCA 3ARSA 1OBAA 2VDIA 4X9SA 1N7KA 3T2PA 3EOUA 4ML9A 1S2TA 4P61A 1R2TA 1OYCA 4L5ZA 1O12A 2OLHA 1WKEA 4MY1A 1JZ5A 1H4PA 2J9YA 3T4WA 2YFNA 5C6MA 3WQFA 4CD5A 4C1KA 3A4AA 4DO6A 3CQKA 1EP2A 1KTCA 1R2RA 3EXSA 4CQAA 6ENLA 4J3UA 3S1VA 3P5ZA 4FXSA 1LROA 2Z2UA 3LI0A 4QGCA 3M4HA 3EWYA 3GW3A 5DQPA 5FJRA 4UTUA 1UG6A 4W86A 2OR2A 4HSOA 1JZ8A 2XINA 2Z1WA 2OT1A 5BROA 3TR9A 3MY9A 5FJOA 4K3ZA 3VGGA 2BASA 5HMFA 4O17A 4C6QA 2EKGA 2X1TA 4NILA 1RH9A 2PSNA 4ZFMA 2I5GA 1ONXA 1R7OA 4K8EA 4L4MA 1OINA 4AU0A 3W7HA 3RIKA 3QHMA 5XIAA 1E1CA 3KBWA 4H9XA 4WZHA 3H70A 4UNKA 1AMYA 3W7RA 3N2XA 3IVUA 2R9RA 1SQ7A 1BLIA 1TRDA 1GQLA 1W9VA 1ISVA 3VOFA 4IX0A 2PZNA 1XI3A 4M6UA 2VFGA 3AJ7A 1GJUA 3G0UA 3WK2A 4MNMA 3H26A 3WD3A 4A22A 2YJQA 3GXDA 4LC8A 4GX8A 3GC5A 1VLIA 1UA3A 3I65A 1XQKA 3BCFA 3B0YA 3SR7A 1IWPA 2CZDA 3HV8A 1AJ0A 2GVEA 2WSRA 1LOLA 1JQXA 3UF9A 1F05A 4NZJA 3FKKA 1XRSA 1E3ZA 1YDOA 1JRBA 3O07A 4PB5A 1LYXA 1KM3A 3DERA 2ZUUA 4LCQA 3KTXA 3MWAA 1W8SA 5C7VA 3PZMA 4QQUA 4NJHA 1HKVA 4WX2A 4N02A 2JFEX 3UR7A 1OG0A 2FGLA 3UZ5A 4R5EA 1YPFA 4XUYA 3EGJA 2VX7A 2E09A 3J7HA 1KM2A 2JALA 3ZMRA 1RK6A 1B90A 4JTUA 2ZE3A 2C16A 2X0SA 3LCGA 5HXMA 4DBDA 3CM4A 1KO0A 1AFSA 2HPIA 4L4LA 3NQEA 1PIGA 1TJ2A 2DSUA 3W6YA 4DJFA 1YEYA 4EPDC 1E55A 3N9SA 4LVGA 1CZ1A 2BY2A 1JIBA 1F2JA 4MJMA 4UC5A 3TUUA 1W8GA 5BZAA 3RFAA 3PWIA 3N3MA 1VS1A 1D3GA 4YYCA 3KVLA 3GAKA 1AG1O 4JN7A 2OYMA 4FLSA 4LNYA 3WF0A 1I4NA 2QPXA 1OCJA 3IRSA 3SW6A 3TONA 2QF8A 3U2CA 2F8QA 1X6LA 2EJ1A 2ZX7A 1W3KA 5CC6A 1HGYA 1E5NA 3KTCA 4FALA 4HSNA 3VIMA 2RDTA 3SIZA 4Q4QA 1CXEA 1YTDA 4H9ZA 3QMSA 4LYPA 4H8VA 2QJMA 3GNRA 1GYLA 1YRRA 2EAWA 3OYXA 4QCEA 1VBHA 3B04A 2IKHA 1AH0A 2VL4A 4PCTA 4EWJA 4IMEA 2WVTA 1VLWA 2Y70A 3TYBA 2NVAA 2E1DA 1V6UA 3UP8A 1HKMA 2GDUA 3T40A 1U1UA 4M51A 3VU2A 2XWEA 3T1GA 5BRQA 2WZEA 3BAJA 3RM8A 1XBYA 4NRSA 2VHLA 1E0WA 2GSEA 1SU5A 4JBRA 5F2MA 3AHVA 3M46A 4LY4A 2WCSA 2PU1A 2BLEA 4ICMA 3QVQA 2BFGA 1TWIA 3V16A 1Y5XA 5A6MA 1UR2A 2NZLA 2PU0A 1DE6A 1PTDA 1G4PA 3G1XA 2BX7A 4R9OA 3W28A 1GK8A 1UQZA 3UZWA 3O0FA 3MC5A 2QUUA 4ZO7A 3TWAA 4Y90A 2J7HA 2XN1A 1SO6A 3LZ5A 5GNXA 1DP0A 4ZOAA 3NL6A 4OECA 2G5WA 1UD2A 3OHIA 2IPJA 2WJDA 3GVQA 1UMLA 2UY4A 3W27A 2YA0A 3MO4A 3ZR6A 4L6OA 4A3UA 1HUVA 1LWIA 3WMLA 4UMBA 2EPNA 5CJNA 2AL2A 3MP5A 3UPBA 4ZQRA 2YLAA 3DIPA 3IJ6A 2VFIA 1VEOA 1TMQA 1WUEA 1VJSA 2OX1A 3CK5A 2Q02A 1JUKA 1M03A 3ERPA 5GNZA 2HXUA 2Y2WA 2ACUA 3CV1A 3RR1A 3SB0A 3VKAA 4Q7BA 1B3ZA 3EBVA 3OHMB 1WDWA 1Q6FA 2R91A 3MYPA 3PFMA 1T8QA 1PX4A 4UTMA 2C7FA 4UTWA 3EA3A 3L67A 1ZL1A 1ZPTA 5FAJA 5DT7A 3TLQA 5U4NA 4Q8OA 3R0UA 3BV7A 3EDKA 1CECA 2OU4A 4GHRA 2FQIA 2HSAA 1GOWA 1F74A 1MFUA 2QCNA 3W02A 1WKFA 2VOMA 2Y8KA 1S2VA 4IOTA 4ZOBA 1XC4A 5K2ZA 3AS0A 3T78A 3EAUA 1XIFA 4DF1A 4KERA 3M0HA 3TV8A 4HJFA 1VHNA 2Z7KA 1VCFA 1X38A 2DV0A 1Q2SA 1PYFA 2C0HA 3DOPA 3RCMA 3V36A 4FB7A 4GQ0A 1XPGA 2EPHA 3NZRA 2NV9A 2GDVA 3LTSA 1FXQA 4N4PA 4Z1CA 4FHAA 4OVXA 1H11A 5HNNA 2Q8ZA 6REQA 3ZYZA 1DWGM 1OWQA 3V1HA 1E9YB 3RPTA 3SGUA 5EBAA 4GZEA 2V2CA 2RFGA 1YPXA 4OIFA 4J2PA 2WC4A 3TMQA 3PSWA 4YWSA 3ID7A 3H7VA 1JPDX 1ZJBA 2FZ8A 5LNUA 1XDJA 5HBFA 2XFRA 1A47A 3EWCA 4H9VA 4J9JA 1GOOA 4HA1A 3UZZA 5AB3A 5D8WA 5LNSA 4V2XA 3U48A 1PSCA 2Y85A 2AGTA 4V27A 3T44A 1ZRQA 3MJMA 1TVLA 2Y0FA 3MS8A 2PCQA 3OA3A 4FOKA 1Y8BA 2B81A 2V6AA 3IRDA 3UWQA 1HJUA 3WL1A 1TB3A 1TJRA 3OPSA 3N14A 5DMYA 3N18A 3JZUA 1EF3A 2I1OA 3WJWA 2W0UA 1RUSA 3BLPX 2XU2A 3M0KA 4ACZA 3TLLA 3ANVA 4HPHA 1GHSA 1LM1A 3DFHA 3PZVA 2BY0A 3WUFA 4DEFA 3WD1A 4P7OA 5FOOA 1K1DA 1XHGA 3VIGA 3B9NA 3EWWA 5I3KA 5EYWA 4AWSA 4XX6A 4JN6A 3Q2DA 3A21A 2Z00A 5LNVA 1XR2A 4IFKA 1YBQB 2VEGA 2E9MA 1E6ZA 1KCKA 3TTYA 4JNZA 3KWSA 4L65A 3W7MA 2AKZA 1DV7A 1CW2A 5D2TA 2QYGA 3IACA 1AMKA 4HCDA 4K38A 2GK1A 4LXFA 3G24A 3CNYA 5IRPA 3DAQA 3BW3A 5AYXA 2QCFA 1V51A 2HDJA 3AMCA 3BAYA 1GVRA 2ZC1A 1XRVA 1V6VA 4C5YA 1RD5A 3UVAA 5B7ZA 4H8HA 3QRHA 1ZBCA 1A0EA 3DYPA 4JFVA 1Q13A 2E8ZA 3SCPA 3T07A 5I09A 5CAHA 2CLIA 3MHUA 2CU0A 4H6KA 4ZE5A 4ES4A 2Z24A 3QC0A 3TU9A 2H3BA 1ZJAA 3AMGA 4Q7NA 3W7OA 2FMNA 3BGGA 3GNPA 3BC9A 3WNNA 4I7WA 3CYVA 1HTIA 1W31A 2DT3A 4JXCA 4AD0A 5CLTA 3S5OA 2X8RA 3WYZA 1VFSA 2VCBA 3W1XA 4Q6XA 1X1ZA 2Y62A 3GXMA 4AHOA 1TKKA 4Y9OA 4ZENA 3NL2A 2P3EA 3QEZA 2A5HA 3O6CA 3A5VA 4O14A 4DI9A 3DFNA 3OIHA 4HA0A 1FCVA 3APTA 1XLBA 3SUVA 3RF9A 1V7AA 1BWVA 1TIMA 3NA8A 4G9PA 2XVKA 3UXIA 4JDYA 3TQVA 5DCDA 4JEJA 3EWBX 4ERIA 3KP0A 1DQWA 4YVPA 4BQ4A 1MW3A 3L4YA 4LH8A 8XIAA 5REQB 4R7JA 4G6CA 4LWWA 2XN2A 4TO8A 4YCOA 4NAFB 3QJAA 3W7CA 2CPUA 4KWVA 1H2JA 2QCHA 4XZ9A 3WQPA 1HJWA 3WH5A 3LS9A 4K8GA 2CLOA 4WOZA 3ANYA 4R7WA 4RX0A 5I02A 1BVWA 2XJ7A 1BAGA 2WSYA 1TPUA 2J25A 3DFQA 1TVNA 1X6NA 4ZXOA 3VVGA 3L66A 3OZOA 2X05A 2JF6A 3G1HA 3P5YA 5HOSA 2FTPA 3IAPA 4WXZA 4ROQA 4A35A 1BTMA 4XVDA 2ZOXA 5DX7A 4XQ6A 2XTKA 4MKVA 1ZGDA 4C6LA 4F3HA 5HNRA 4PSPA 4MZYA 3GR7A 4O1FA 4H8UA 1JPIA 3MHGA 1I0DA 4DXVA 1DJYA 1S2AA 2WMFA 5DEZA 5IBXC 4XD5A 3WBWA 3C5QA 1HL8A 1UP2A 4YHEA 2XFYA 1KCZA 2GWGA 1M65A 2PWUA 1TR9A 3CMFA 5DBTA 1VPYA 2F38A 2BBFA 3A4JA 4H19A 4IG2A 4FXRA 1AJZA 3OOQA 3MI2A 4EPBC 4F79A 3VDAA 5MHBA 4UMAA 4YS1A 1SO4A 5K3VA 1JCYA 4FZIA 4FNSA 3W2LA 1RLCL 1S2WA 1OFDA 2VZUA 3CWHA 2R1PA 3SUUA 1XSJA 1GOKA 4JTFA 5DF0A 1KFWA 3OW1A 1QI0A 4B9ZA 1UH4A 4HTBA 2CYGA 3MUY1 3OIXA 3V4BA 1NFBA 2ZBTA 4XK2A 3POHA 3OG2A 1JPMA 3KHDA 4EF9A 5D2XA 5HPOA 3PJXA 5LIKX 4LTSA 1GEHA 1LQ0A 3RYSA 4HD5A 4XUGA 1Z41A 3EYPA 4WJ8A 1MI3A 2Q01A 1EZ2A 4QDPA 2AMXA 1GJWA 5F4WA 3KRUA 4RPQA 1R9XA 3M0IA 3IIZA 2RDUA 4QXIA 1K02A 1UP0A 1N8IA 4YHGA 1F4AA 1EH9A 2HZGA 1JPHA 4HZ7A 3GVWA 1QCWA 3URQA 1VD6A 3K30A 3RPMA 4I6KA 2I5QA 2J6VA 1UKQA 4JFTA 1J8VA 1V6WA 4CN6A 2DDXA 3N2TA 1KLZA 3P81A 4QIUA 2E67A 2OEKA 1WZMA 2E25A 2XM2A 1VCGA 2EPMX 3E2SA 5GJNA 2DT1A 3CO4A 1EDQA 3MI3A 2A3LA 4AVNA 1KGUA 1T8XA 1E1EA 4FLOA 4HPGA 4X2PA 3OZMA 1MQRA 5C0QA 1HT6A 3NR0A 5HUOA 3R8RA 3N15A 4AEFA 3NG3A 2VENA 3B8WA 1GJPA 5A2BA 3ARZA 4MWAD 3HA1A 2NSXA 5D37A 2CNCA 3VIJA 3P62A 4G7EB 5TD4A 3UFYA 2CXGA 3G6LA 3TTQA 4ZVJA 3WD4A 1LRTA 2VRJA 3EX6A 4A8LA 3AQUA 1DXFA 3LI1A 2WMKA 4RNJA 1XH2A 1KKOA 3EA1A 3QQ1A 4TXEA 3VIKA 4B3KA 4PEKA 2ZADA 4YLWA 2PCEA 2VKZG 4ECLA 4S3EA 4CQCA 3FNDA 4UB9A 5FEZA 4B92A 1HJVA 3TN3A 4YNGA 1HW6A 3LXAA 1M7OA 1ONWA 2EJAA 3BURA 2XVNA 4WJEA 4PTWA 3NTYA 3CUJA 4NJJA 1B0IA 2FZDA 5H8PA 4B2DA 1LCOA 1QNOA 1NFGA 1G4EA 2GFTA 3ENLA 1EBGA 2QMKA 4ROPA 2PWDA 2QCGA 4O1EA 1TPDA 1CGUA 1J6OA 5D33A 3DU0A 4FNUA 2Z6IA 4B9YA 4ZSUA 4LUIA 1LF1A 4I3GA 2NUYA 1E4MM 2BMBA 4Q32A 5TNVA 1F6PA 3IK4A 4E2VA 1Q7QA 3IARA 1MFVA 1CEOA 3GVRA 3VNKA 4CQBA 3T09A 4ZODA 4EF8A 1MYRA 2ISSA 3WDIA 4NNCA 2OYLA 3SN4A 3NQCA 4GABA 3QGAC 4AD5A 4IGHA 2J7BA 3CUIA 2D2JA 4M82A 4UZUA 1DJWA 2A1YA 2ESCA 1A5OC 5AKQA 1JZ6A 4HNNA 2PP0A 4JTKA 3W1TA 4CKQA 1UZ1A 3NQ6A 1PX8A 1KFJA 4NG3A 5MKGA 1RJPA 3VD3A 1ISXA 3HM7A 3S6OA 4GG9A 3O1NA 4B5WA 2WM1A 2JKAA 3TYUA 3N2MA 1HL9A 1C29A 4ZCWA 2NQHA 5HDRA 4X22A 3UPMA 1UBSA 4C6BA 4IMDA 4UWMA 5IDIA 3VZXA 3VOIA 3SM0A 3NWRA 1CNVA 1JAEA 3B9EA 1QO2A 1GG1A 4M7TA 4A8NA 4AY1A 2ZDSA 4GY1A 3F4VA 4HPJA 1UCWA 3QGKC 1E3XA 3NEVA 3O63A 4XBSA 1ZFJA 1YDYA 2W79A 1OCNA 1D7KA 4RE3A 3VABA 3TJ4A 4KETA 4QR6A 5FJJA 3V5OA 3IGUA 1US3A 3CQHA 3W37A 3AIVA 1I8JA 1KRMA 1NIUA 2XIQA 4DUVA 3WDQA 3L4UA 1TV2A 3QY7A 3UXAA 3HIJA 2YGYA 4BQ2A 1N82A 5J5RA 1J10A 1LL4A 2PLJA 3FXGA 2REQB 4Q3MA 1C9DA 1OK4A 2J7EA 1O68A 1FWFC 1JZ7A 1UB3A 3EDEA 1CBGA 3RLUA 1O1HA 1ZU8A 1PWMA 1REQA 3AMKA 3F5JA 2DT0A 4JTSA 1UWUA 1H0GA 3BSMA 2C14A 3SAZA 1QI5A 3THCA 1C91A 4MNKA 3K1GA 2CCRA 2Z1KA 1SW0A 2POTA 2A85A 1UHVA 3SRDA 1E4NA 2VFDA 5KEZA 4U28A 5LXEA 1YE6A 3E5BA 2PDQA 4LEQA 3C3UA 1MUWA 2FTYA 4GD0A 1V77A 2XWDA 4YVXA 1E70M 3QH2A 4AC7C 2MANA 4A8IA 3GVVA 4XIMA 3IJIA 2CLHA 3W7DA 3U2OA 2UY2A 1E5JA 3NQAA 4DO7A 4GBUA 1W3IA 1YBQA 1E1CB 4MVAA 2J78A 2AQOA 4IG2B 1U5HA 2DY3A 3LERA 4GA8A 2HBXA 3SCNA 1IGSA 1AL7A 3GDLA 2ICSA 4NNAA 3PTKA 3P67A 1EXPA 3P84A 4FNPA 4F9DA 5BU9A 3QYQA 3VMNA 3MU7A 1E6XM 3IIPA 4E4UA 2CBUA 1S5VA 3E38A 3QFWA 1ADSA 5BMXA 4L7ZA 4YTQA 2HCVA 2A2IA 3MQTA 4UTJA 5G4HC