3W2KA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-165
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-165
rcsb
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2kA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2kA01
3CT7A 4JDBA 3C3NA 5BRBA 3NZRA 2Y7DA 1DOSA 5F2GA 5G5IA 5CZ0A 5G2WA 2HS8A 3F03K 2NX1A 5KTLA 1QCWA 1W5NA 1K03A 3W85A 1W56A 1EUAA 1ME7A 3TFCA 4Z1AA 3QSRA 3WJXA 3UWZA 1SO4A 3MJYA 1I2OA 5EY5A 2CLHA 4HNTA 2RKXA 3C2FA 3UNDA 4HHPA 4UTHA 5HWNA 1TJPA 2ZA1A 1SZEA 4RCXA 2C0AA 4MZ1A 4O14A 3HO8A 3BG5A 3PF3A 3W2JA 1H63A 1NFBA 4MZYA 1CW2A 3LCLA 3MI6A 3QF0A 3NQDA 3KAOA 3NR0A 3O16A 4Z1CA 5FF0A 3N9SA 4QM1A 1PIIA 3FFSA 1H7WA 3S1XA 3B4UA 3G24A 5BW6A 1SW0A 4K39A 3KRZA 5LHFA 3FS2A 4FNQA 3IVTA 1U83A 3NM1A 3W2NA 2RFGA 3W74A 1KM4A 1YTDA 2A7PA 3W7GA 4Y90A 3W1RA 5C6MA 3W1MA 3HOJA 1V5XA 2GQ8A 2ZZ6A 1TV5A 1I2NA 2E1DA 3G1SA 3C56A 4NNBA 2DJXA 4UTKA 3DFPA 3L68A 4ZMGA 3P8JA 3C8FA 3TSBA 3W7QA 4PODA 4H6KA 5E1QA 5D02A 3LCHA 2Y85A 4IMCA 2C1HA 4QITA 1OF6A 1ME9A 5CG7A 4ORMA 3G1VA 3ZWSA 1O5KA 3TXZA 4UTMA 1EPXA 1SO3A 4UMBA 1P4CA 4QSHA 1VR6A 1L9WA 1YXCA 1DJQA 2QCMA 2VXNA 3Q94A 2H3BA 4DEFA 2YYTA 1TPUA 2QCDB 3P5ZA 2QUUA 3NQ7A 1LRTA 1FX6A 1TREA 3ZFHA 3FYOA 2H8ZA 5IM51 3CB8A 1WA3A 4CNPA 3GDRA 4WY0A 5TBOA 2OJPA 4O50A 1G4PA 2V2HA 1TPDA 1LBMA 1QNVA 1FWRA 3EKZA 3STFA 3PUOA 5LGXA 2QCHA 2VEIA 3JS3A 1KM1A 4O17A 3TSMA 4JYFA 1ZY9A 4MIMA 1DKWA 4FXSA 3QMRA 4K6AA 4UTJA 1TV7A 1PVNA 3I65A 3SIZA 3THQA 4N9BA 3S6DA 2JKEA 3KVLA 2CLMA 3TIMA 5MHBA 1VPXA 1YPIA 3MYPA 3W1AA 4LC6A 3T55A 3DFQA 1EUNA 3ATZA 5F4SA 2WNQA 5G2HA 2NLIA 1KW1A 2Y7EA 4E0CA 4HSNA 4AH7A 1H51A 2YR1A 4IOTA 2NXGA 4DO6A 2C13A 3NAVA 3JR2A 4OGZA 1LOSA 4LW7A 4MFEA 3BLFA 4JYDA 1FDJA 1XBVA 3EEGA 1K02A 4JICA 3EXSA 2RDTA 3L5LA 1M6JA 4MFDA 1S5WA 3FA5A 3CTLA 1SSGA 4DBEA 2DZVA 4OV4A 2R91A 1H62A 5FEPA 1DL3A 3PY2A 3HGJA 1OJXA 5F2IA 1KLYA 4LTSA 3TAOA 4JTTA 3GIYA 2EF9A 4MLJA 5DCEA 2V82A 5HWMA 3W70A 1QO2A 5CPNA 1GVFA 2E77A 4UNLA 3PVFA 1GJPA 1MXSA 1SW3A 4IWWA 4DF2A 1TPH1 3T4CA 1WQ5A 2QDGA 3N19B 1OHLA 1PCWA 3M5XA 2Y70A 4Z1DA 2XN2A 3MWAA 3W1PA 3P5YA 1GPWA 5DXYA 4KWVA 2J88A 4GBUA 4DO4A 1B57A 1W5MA 4NXSA 2FIQA 5AYXA 3FIGA 4AF0B 3TMLA 1EIXA 2BLEA 1LRNA 2KZHA 3DU0A 3E02A 3LHYA 3VCRA 2ISVA 5D2YA 4AWTA 3HQ1A 2X16A 2RHGA 2QAFA 2GVGA 1KTNA 4JTSA 1OK4A 1TIMA 3UXAA 2NWSA 3IVSA 4RR4A 1F05A 1N8FA 4A29A 1GEQA 4HIBA 3N2XA 1VYSX 4OU1A 3NVTA 5D2TA 2NUYA 4HNVA 4M7SA 2YDAA 1IXNA 3C0JA 3NQ8A 2ALDA 3Q2DA 2TYSA 1I2RA 1SZFA 4RV8A 3M5ZA 4DELA 4WXZA 1N55A 3G1FA 3NQMA 2EGZA 5AHFA 3MW7A 4O1CA 1W54A 3PC0A 3L0KA 2A6NA 1I8JA 1AL8A 4NQ1A 5AHEA 1XDLA 1FUYA 3NPWA 1O94A 5EBUA 1W3IA 3IRDA 1XM3A 1OFDA 2ZA3A 5BOOA 3GK0A 1RD5A 1OX4A 1MEHA 4K8HA 5CZJA 1G4TA 3NOEA 1H50A 2E68A 1UB3A 2WO5A 4RKAA 3EX2A 1P0NA 1OYAA 2CW6A 3FEMA 2QUVA 3HG4A 4JTJA 5I3JA 2A6LA 4LT9A 2YZRA 3H55A 3SW6A 4JIPA 1OFEA 5FF7A 2ZZ5A 3A5FA 3G18A 3QSTA 3W6YA 2X1RA 5AHNA 3IIPA 4I7WA 1LDCA 3OEXA 4QNEA 5IBXC 2AAMA 5CPLA 2EHHA 3GDMA 3WJYA 1XBZA 3KVMA 3G3DA 5D04C 3OBKA 1P0KA 2VFEA 3R13A 4M6VA 1D9EA 1L6WA 3PBYA 1LTDA 1X6UA 4UTLA 2VEPA 4LRSA 3LI0A 3H54A 2TSYA 4M19A 2V8ZA 3LTYA 3R5EA 3P74A 1BEUA 1HO1A 2WSRA 4MJMA 1WOAA 1D3GA 1KFLA 1XBYA 3QYQA 3LB0A 1W0MA 5CPMA 2XN1A 4E2BA 4NNCA 5EYWA 4XQ6A 5AYZA 2HTMA 3HGOA 1WYIA 4FNRA 1GVSA 5D33A 3NO5A 4IMEA 5TIMA 3E96A 3CIXA 3M5YA 3B0UX 4UC5A 2V2DA 5LSMA 3THAA 4IXXA 2GUUA 2OCZA 5G1TA 3T44A 2NV2A 2V9DA 3MI3A 1ZNNA 4UTWC 4Z0SA 2Y61A 3W1TA 3AO0A 4LS1A 3EX4A 2J24A 4Y8FA 1H1YA 4POCA 2XFWA 2IQTA 4AMAA 5KZMA 2NUXA 1LBFA 3UZ5A 4O12A 3M44A 4MKNA 1KM5A 1PV8A 1JJKA 1XKYA 5DXXA 2V2CA 3LCXA 5FI8A 4KFPA 3LRLA 3SZ8A 5D37A 3TK7A 2RDWA 4KFNA 2J9YA 3TW6A 2ISWA 3N14A 2ABBA 4Q32A 5HMSA 4IX2A 1OABA 1Q6QA 3NM3A 1T8XA 1DORA 1VC4A 2B7OA 4YLWA 1VCFA 1TQJA 3W2KA 2A0NA 3A9IA 4ZQOA 3HIJA 4Q33A 2OT1A 5CZTA 3O05A 3W23A 4IXHA 1QWGA 3HG3A 3DHFA 5SWUA 3OVQA 4LY8A 1TV8A 3W7CA 3GDLA 5DN1A 1A5SA 4NXKA 2VENA 2ZRUA 4JIQA 2J27A 2VC6A 3MO7A 3CWNA 1JCNA 2W79A 3SSJA 1YDOA 3N3MA 3BGGA 4N2YA 4LU0A 4AHOA 5IBXA 4IQLA 3VE7A 5T26A 3L0GA 1QPRA 2DZPA 1EA0A 4UCGA 4PL1A 4UUIA 3UY7A 3ABOA 2GQAA 4JTUA 1F76A 1LOQA 5J5DA 4JX5A 4PA8A 3GYEA 4NZFA 5LNUA 5F4XA 3QMTA 3QJAA 3TH6A 3NNTA 1W5PA 1FWTA 2C6QA 2VFHA 3TJLA 5HULA 4YCOA 3BLIA 2VFGA 5K9CA 3MHGA 1PHWA 4RXGA 5DLCA 1AW1A 3O1NA 1BKSA 2ZZ3A 2AQWA 2YSWA 5K4XA 5F4WA 4U4MA 4CQ8A 4L4MA 1GG1A 3SGUA 1VLWA 4NT0A 3G3MA 3GZ3A 1XI3A 3DXIA 4BR1A 3W88A 4NX5A 1GTEA 3KRSA 3R8RA 3L5MA 3R2GA 2ZA2A 4FX6M 4IMDA 1XBXA 2ZRVA 2Q8ZA 3ZS4A 4KKXA 5K9DA 3PBVA 4IX0A 5DBTA 3EX1A 3VE9A 1SZNA 1R2TA 4GUJA 4UFKA 3CEUA 1FQ0A 1I45A 1QPQA 1AW5A 3G1DA 4CCCA 1XDMA 2ZYFA 3V75A 2A85A 2H90A 3KVJA 2I14A 2VOMA 4H3DA 4MY8A 4QAIA 3Q37A 1KLZA 4HNUA 2H8XA 1A50A 3BG9A 4Z08A 1N7KA 4WY0B 4BI7A 1TPVA 3C2VA 2DZTA 4O1AA 4DF1A 1EP3A 3LCFA 3IIZA 1BTMA 3QH2A 2BWGA 3I7RA 1YYAA 4JX6A 3DFNA 1TPWA 4CLMA 4DBDA 2E6FA 1OYBA 3GXPA 1H7XA 4IPIA 5D2WA 5AFDA 3C2EA 1R2RA 5HWJA 3HJZA 3TAKA 3P80A 3RNDA 2DZWA 2GPTA 4O52A 4X22A 4HN4A 2YX0A 2HS6A 3UWUA 1IXPA 3NQGA 3HG2A 4O0ZA 3NA8A 1R30A 1XL9A 3W1LA 2FJKA 4M7TA 2P10A 1FWNA 3P81A 2G5WA 3G0SA 3BGJA 1FDZA 4J9JA 1SZGA 2YGYA 4FNPA 3W84A 4FX8A 3WK1A 3BW4A 2UV8G 2E6DA 1JRBA 1W3NA 5FF4A 1WX0A 3RFAA 1JRCA 1JR1A 2PE4A 2QJHA 4BWLC 3MYOA 3TUUA 2NWRA 4XWUA 4NZJA 2V81A 4R53A 4CQAA 3VKJA 3GNDA 1YPFA 2Z1BA 5HJLA 1KFJA 4A22A 1RPXA 3S5OA 2ZZ4A 5LHEA 3QMSA 2H3DA 1B4KA 2JKPA 4JXCA 1QDSA 4GUIA 1JULA 3B04A 3F4WA 3M16A 1ZAHA 4IMGA 3WFAA 4JY8A 3CM4A 1XUUA 1SU5A 2A21A 2ZZ7A 3C4UA 3L65A 2DZXA 4OHQA 3ELFA 3A22A 1RQEA 2FQIA 4UFIA 1ICSA 2I1OA 3SJ3A 2QCEA 3GKFA 3UWYA 1TJRA 1KV8A 3S42A 3W9ZA 4IPJA 4MZ8A 2C14A 2DU2A 4MVAA 4ONVA 1Z42A 5BMWA 4UTUA 1D3HA 4ZQRA 3TFXA 4MY1A 4Y9AA 2Y89A 1UUOA 3IV3A 1VGAA 3BW3A 1O5XA 3LRKA 3QQ1A 2ZRWA 3OHIA 2E5DA 1RQHA 2X1UA 2CZEA 4MJZA 2E5CA 1PS9A 3DI1A 3CWOX 4ZQMA 1IIHA 5CSRA 3TX9A 4BFAA 5EL1A 3KX6A 4HPJA 1H5YA 3G8RA 3W07A 3W7RA 3S0CA 3HGRA 1VYPX 3EWWA 1GQNA 3E0IA 4KWWA 3F1QA 3TC7A 1OX6A 1WBJA 3WJSA 3LERA 4O1BA 4JNMA 4EF8A 3GKAA 4MYAA 1S5TA 4LVGA 4O13A 3IGXA 3LLFA 3DI0A 3NL2A 1XC4A 1VS1A 3TW7A 3RK8A 5BNKA 3QW3A 4LVAA 1VYRA 1RVGA 3BARA 5HUPA 3STGA 3TMQA 4TMBA 5U7SA 2CU0A 3M1ZA 5KINA 1OG0A 1GVQA 3B06A 1F7BA 1UJPA 4CNOA 3KFTA 1FY6A 2NX3A 1TB3A 3QPZA 1JUEA 2QCLA 2CLIA 3FOKA 4IGHA 1JCXA 3UQNA 5D03A 3EXTA 3BW2A 1YXYA 4O57A 1P1XA 3L21A 1H7PA 3M7WA 4FHAA 4TIMA 4O0KA 3L2IA 5EA9A 3W75A 3CC1A 3S5ZA 2HMCA 5CGQA 4LVFA 2LLEA 4LS2A 1K8XA 3L0NA 4M6QA 1HL2A 4I7VA 4X3ZA 1M5WA 2PCQA 2ZBTA 4O16A 2FPTA 5EMUA 1YTKA 4DQWA 4N9EA 3TJXA 8TIMA 3CPRA 4N9CA 3W7JA 3ZR4A 2OT0A 4O10A 3TC6A 2FTPA 3W83A 1ZJIA 5DY3A 4LOCA 1HO4A 3B0PA 4QQ3A 1EP1A 2VFIA 3LXCA 3A21A 4IUOA 3EWXA 2QCDA 3QRHA 3N2MA 4WQ6A 4OV9A 3UYCA 2Q3RA 5I3FA 1VHNA 4MOZA 4FNTA 5EPDA 4N9DA 3MP3A 2VEMA 4EF9A 1H7NA 3O6DA 1RR2A 5LGZA 2BXVA 4FO4A 2YFOA 4Y96A 3W2MA 3ATYA 5K7JA 2G96A 5L9FA 3QPYA 3W1NA 3CEPA 4XKYB 1TPC1 5GVJA 3NQEA 2GVJA 2ABAA 4GWEA 4JTHA 4S1FA 2PRLA 4RLIA 5ABTA 4QNWA 3WJWA 1H61A 1E51A 4JTLA 1IIGA 4WD0A 3O06A 2FFCA 4FXRA 3W22A 3DFSA 1JQVA 5K9XA 5LNSA 3L67A 4NJKA 2QCFA 4M6PA 1TTPA 4ORIA 2FLIA 5FF2A 1ZFJA 1TPFA 4ZZ9A 1JCMP 1IXOA 1G4SA 3NL3A 4O28A 1KFCA 1RV8A 3RLVA 4NJGA 3QQ0A 1ZENA 1FXPA 1R2SA 1IXQA 4N4QA 3W3OA 4LS0A 3NQ2A 3W72A 1QMLA 3MHUA 1ZAIA 1QOPA 1TTQA 1KTBA 3O15A 4RZ5A 2YYUA 2GQ9A 6TIMA 3MBFA 3W7EA 3QM3A 5CZSA 1RZMA 4JTKA 2B4GA 4GUHA 2F7FA 5G2IA 1J2WA 3GR7A 4LUIA 1SPQA 4K7VA 3GX9A 2YW4A 1K7XA 3NPXA 4UFJA 4OE7A 3ABQA 3BK0A 2P0OA 5H91A 5F1VA 2DP3A 1QPNA 3JRKA 4UTTA 3Q58A 1XCFA 2QAPA 2ZZ2A 5EKYA 2Q8LA 3M43A 3NQFA 2R14A 3PUDA 3WK3A 3LV5A 3QEZA 1T0OA 2ZCGA 3EXRA 2QDHA 3N34A 2OX1A 2C3ZA 5DBUA 2B7QA 1H60A 3B0VC 1EWEA 3T78A 1Z44A 3G1XA 5G1YA 4GXMA 3LBCA 3DENA 3I6RA 3NL5A 3LHUA 3NXFA 3GDKA 4X9SA 1K8ZA 2VKZG 1LM1A 2HSAA 3KHJA 1LLZA 3MP5A 3S5NA 3DAQA 4QIUA 1OFPA 3M47A 1MEIA 1Z48A 3RU6A 4CCDA 1C9DA 1A5AA 2CFFA 2B7NA 5DCDA 2C19A 2RDUA 1ME8A 1FCVA 5F1UA 4JR5A 3UPBA 1L2UA 4ADTA 1GG0A 1LYXA 4EVZA 2FB3A 3IGUA 3NDOA 3FJLA 4LV9A 4CNNA 3PM6A 1T96A 1NF0A 1SO6A 3GLCA 1K7EA 1JCLA 3HPZA 4LNYA 4L4LA 3W7OA 1EB3A 2FDSA 3B05A 2PURA 3W1UA 1B3OA 4DPQA 3TROA 1CX9A 4YCPA 4GFSA 5HQEA 3FLUA 5C2XA 4FX7A 2OMAA 3CHVA 3QW4B 1R47A 4PCFA 4AHPA 1TTIA 3VFLA 1VRDA 5D38A 1GYLA 5TQLA 4WXYA 4AXKA 4Q4KA 1TQXA 2CWNA 5E0KA 3W73A 3LLDA 4O53A 4XTDA 2Z6IA 1YDVA 3U8GA 2QCCA 2CZDA 1SSDA 1VHCA 4LRTA 4QJ1A 3LCGA 1PL9A 2GOUA 3NYZA 4LUJA 1YDNA 3TQ0A 1BWLA 4WZHA 5L6UA 1L6SA 1FXQA 4YXGA 4A2RA 3OA3A 3LOTA 4JGDA 5AN7A 1Q6RA 1G7VA 4RJEA 1F6PA 1GT8A 1LLWA 1K7FA 2WSYA 4Z1BA 3UWQA 4AHQA 2QCNA 2ZDRA 1SFLA 3I68A 2NUWA 3UD6A 3LHWA 3P67A 4O19A 4EWND 1DBTA 3TNOA 2WSQA 4HT3A 2NXIA 1ZHAA 4JD4A 3MHFA 1DHPA 2ZTKA 3FKKA 4JTGA 4OBTA 1H1ZA 3NQCA 3SR7A 2X30A 1FCBA 3LDVA 3CLMA 3LV6A 2A1YA 2YPIA 2JKAA 3IGSA 4M5PA 1PHQA 3KVKA 3LI1A 1JQXA 2YW3A 3A5VA 4UR8A 4UTIA 2J9XA 1B4EA 1HTIA 5FF3A 4DO5A 1LP6A 3P61A 4FB7A 5F2LA 2O7SA 2YFNA 3L66A 4C1KA 4N4PA 1IF2A 2QCGA 4K8EA 3STEA 2VFDA 4GUFA 2CLEA 4JN6A 3UPWA 5HR7A 4PL2A 3ZWTA 4AWUA 3NPUA 2D73A 3TQKA 3S9YA 3OVPA 4RK8A 1L6YA 5HNRA 4E2DA 2OZ0A 3W7NA 4K38A 1TRIA 2ISSA 2A5HA 1XXXA 2JK2A 1AW2A 4NJHA 2I9EA 2CZ5A 1TRDA 1OYCA 3TE9A 3DZ1A 5J5RA 1DQWA 2F84A 1NSJA 1HFBA 2J9ZA 1Z41A 1G7UA 2J6XA 2QJGA 2GJLA 1U5JA 3MUXA 1X7FA 4FIRA 3INPA 1OVDA 1S5VA 4UIOA 3BG3A 2WQPA 4UFMA 4ZQNA 3TKFA 4ZL1A 3W1XA 1KFBA 3UXDA 1F2JA 2JGYA 1QOQA 1WAUA 3TU9A 2E6YA 1A5BA 4GUGA 4ZQCA 5C5YA 5D2VA 4KFOA 4NX0A 4PEKA 1J5TA 3MMTA 1F6KA 3M5VA 3LXBA 5D2XA 3WJZA 4AAJA 3SGZA 4O1DA 1WOBA 5D30A 1NVMA 3M9YA 1SQ7A 1JCYA 1QR7A 3TA6A 2G95A 3OIXA 4XUGA 3C52A 6ALDA 1I2PA 1GYNA 3LRMA 1FWWA 1OFRA 2AGKA 3P84A 4DXVA 4EOUA 1KTCA 1UUMA 4A21A 1OFQA 3A24A 4UTWA 1LCOA 2PC4A 4N02A 3QFEA 1GTHA 1IGSA 1AG1O 3G8EA 4N6FA 5A8GA 3GNNA 4BI5A 5HR6A 4FEZA 1OFBA 2QKFA 1QFEA 2P1FA 4ML9A 5H2ZA 4UTTC 3BPWA 4QISA 3SI9A 4JY9A 3HGSA 3R89A 5AC7A 2XN0A 1GOXA 2DZUA 4TO8A 3LXAA 3IIXA 3W1QA 4XKYA 3IIOA 3NGJA 3O63A 3PG9A 3G0UA 1K3UA 2O7QA 1LBLA 4YL2A 2NXHA 3C2RA 4ZVJA 3W7IA 4FNSA 1SW7A 3GDTA 3I7SA 2CLLA 5HINA 3LCWA 5I3HA 3YPIA 1SO5A 4HKPA 1C8VA 5G4EA 4S2CA 5AC6A 3PB0A 4EIVA 3LBMA 2WNNA 5AC8A 4ALDA 3IEBA 1R46A 1KM3A 4K36A 5D09A 5BMXA 1JCJA 2VEKA 4MYXA 1W5QA 4H4IA 2WV8A 5C55A 3G1HA 3STCA 3M0ZA 2CLFA 1EX5A 4NUWA 1THFD 2X1SA 3LX9A 4NNAA 5KZDA 3W7DA 3GAYA 4XZ9A 5I3IA 2Z2UA 4JS3A 4JTIA 2Z0IA 2BTMA 1QPOA 1X8FA 3TCEA 1TCDA 1OX5A 3KXQA 3TR2A 4B5NA 4LV4A 3P8IA 1TYGA 5DELA 3S8HA 3MP4A 5LNVA 1JUKA 1OFOA 2E09A 1O95A 3A23A 4LVDA 3LHTA 3NL6A 2EPHA 3EKLA 1ICQA 2PRHA 2C16A 1S3HA 4K37A 2NV1A 2NX9A 5CKSA 1W31A 5LKYA 4AWSA 3V1PA 5CSSA 1GZGA 1NEYA 2C15A 3T7VA 4RZ4A 3UY8A 1VJIA 3PSWA 2TRSA 2A2IA 2WJZA 4K7YA 4GE8A 4UMCA 2ATMA 4BI6A 3W2UA 2W6RA 3NZ1A 4PH6A 2JGQA 4JX4A 3BO9A 1PCKA 4G1KA 3GAKA 3R12A 4O11A 3HPSA 1MEWA 1HG3A 3DBPA 5AB3A 2QR6A 4WOZA 1LOLA 5AHMA 4U28A 1VCVA 4TMCA 1SUXA 3T40A 3S5YA 2ZTJA 3QC3A 4UFLA 4XBSA 5CPOA 2ZZ1A 1UASA 1Y0EA 3ABSA 1ONRA 3DGRA 5K2ZA 1J4EA 2CZFA 5D05A 2H6RA 1XFBA 2JBMA 4O8RA 3TQVA 3PULA 1DJNA 1V7YA 3PWAA 1WXJA 3EWYA 2R8WA 1KFEA 2V30A 3DFTA 1EEPA 2YXGA 3GXTA 3TSDA 4C1LA 1ALDA 1LROA 4PC8A 2ZRXA 2BSLA 1VZWA 4LVBA 1ZCOA 2Y88A 3BV4A 2Z6JA 1JVNA 3E9AA 4O54A 1WV2A 3G1YA 1TMHA 4WY0F 1GVRA 4W9TA 3W7PA 1DQXA 3PR2A 4ZQPA 3LHVA 4HPXA 3WK2A 1M7OA 5I3GA 4NJJA 3PBUA 3L5AA 4S2BA 3UZJA 4IMFA 4N6EA 1KV5A 4WUIA 4JYEA 1TTJA 4GJ1A 1KFKA 3VI2A 2BX7A 1F5ZA 3CIWA 1K8YA 4FF7A 5KSWA 2CLOA 3FKRA 5C54A 1TPB1 2X2GA 4Z0JA 1MO0A 4BWLA 3WK0A 2WNZA 1TO3A 5K4ZA 3EX6A 1CI1A 4RX0A 3NQVA 1VLIA 1TPEA 4O4VA 3H53A 3P62A 2Y6ZA 1F73A 5FEWA 3PAJA 2WPBA 1ML1A 5LNRA 1LORA 1SFJA 1YXDA 2Q3OA 2Y7FA 4WJEA 2Y62A 4MUZA 1A5CA 1W5OA 4TU1A 4I9AA 1KA9F 4ADSA 1WBHA 1B9BA 3B03A 1FBAA 2QJIA 1G69A 5LZLA 1ZALA 3EWBX 2E5BA 2V5LA 1AK5A 2CLKA 1F74A 4TR9A 1DVJA 3PBWA 5DCBA 4A2SA 4NVTA 4ADUA 5AHIA 4RXFA 1EP2A 1C29A 3CU2A 1YTEA 3HG5A 2DJLA 4E38A 5HUOA 1W3TA 5LNWA 2QUTA 3NPVA 3LHZA 4I7UA 4OWGA 1P5BA 3UWWA 4NU7A 4A3UA 3LCIA 4MY9A 3G0XA 3GXNA 3W7KA 1I2QA 2B0MA 4FIQA 4BK9A 1HUVA 2A7RA 5U4NA 3MBDA 1LZOA 4R33A 3K30A 1M7PA 3I7QA 3O8AA 3M6YA 1OF8A 4OT7A 3SFKA 1OX4B 2GVLA 1YLVA 3HBLA 1BWKA 4YMZA 4PFMA 2ZRYA 2GJNA 4XTIA 1Q45A 2G97A 3U2OA 4UFHA 4X2RA 1SR9A 4MLRA 3W76A 1A53A 4NJIA 3RLUA 1KM0A 2WKJA 2V0TA 3HB9A 2Y7GA 4GC4A 5FEXA 5AHLA 2NZLA 1FWSA 4PTNA 2RH9A 4P61A 1YADA 1KM2A 1AL7A 1Q6OA 2QF7A 1FDYA 3E49A 3P82A 1LRQA 5DY2A 3HPXA 7TIMA 1EWDA 3O6CA 3GR8A 2C18A 1OFAA 4R7JA 1VQTA 3D0CA 4DPPA 5FESA 2YCEA 4IJBA 1H7OA 2BZNA 2R94A 1KBIA 1PE1A 4D2JA 3O6YX 4JDYA 4AF0A 2ZRZA 2ZQ0A 3EWZA 5K3VA 3TXVA 3RMJA 3ABRA 3SECA 3DHDA 3LTPA 1QAPA 4LC8A 4O18A 3W7HA 2WOQA 3W87A 3DFOA 3S1UA 4ICNA 5AOUA 1H7RA 1KBJA 2VELA 1ZAJA 3TV8A 4TX9A 3TDFA 1X1ZA 1XUZA 3NG3A 3PB2A 4WX2A 1T99A 2FPVA 5A5WA 3PSVA 1JUBA 3PG8A 2PRMA 3L9CA 4JEQA 4UMAA 1Q3NA 3MI2A 3E12A 2DORA 5FEZA 2A7NA 3NEVA 4HSOA 3LM7A 2W0UA 1O4UA 4O4WA 4AEOA 4XBKA 1DV7A 3B8DA 3NQAA 3KOFA 4MPQA 2FB2A 4YWIA 2ZFAA 4AB4A 5KZEA 1W37A 3U6WA 4RZ6A 4OQVA 3IIVA 3OVRA 3HMJG 5KITA 1GVOA 3BLEA 3W71A 3EWUA 1W1ZA 3LGEA 4GNJA 4DF0A 4UNKA 2E6AA 1MSSA 1X1OA 4CQ9A 3RF9A 1TSIA 3N73A 3C61A 3W7LA 1QO5A 3BVJA 1NF7A 1VCGA 3VNDA 3W2LA 1G6CA 1OK6A 3W7MA 2QEZA 4LWWA 2EKCA 1G4EA 3DH7A 3ANYA 2EAWA 5F2MA 5AYYA 4AVFA 1O60A 2DZSA 2V5BA 3G22A 3EX3A 2B7PA 5E93A 3M41A 3HF3A 1I4NA 1KM6A 1MZHA 4GRSA 2VFFA 3KRUA 4JTFA 3LTSA 3USBA 3IVUA 3G1AA 3GB6A 4UR7A 2TMDA 4Y6GA 3UWVA 3PS7A 3DKJA 3DKLA 3FYPA 3FJ6A 5D32A 2FPYA 1RQBA 1GWJA 1Q6LA 4BF9A 4FNUA 3W86A 3F4NA 3P60A 5KMYA 3CQ0A 4P2VA 3C2OA 3N9RA 1FCQA 3C6CA 3GVGA 1FCUA 1WDWA 3SY5A 1UBSA 3PUEA 3QZEA 3NQ6A 2TPSA 3P7YA 4HNNA 5I3KA 4CCEA 1W8SA 1G67A 4JTEA 2ATSA 3EB2A 4WOQA 3S1WA 2A4AA 5G4WA 3S1VA 2Y63A 1UCWA 1NAL1 3OG3A 4O15A 1ADOA 4R34A 1AMKA 3O07A 1ICPA 1VH7A 4UXDA 2X1TA 3AJXA
chains in the Genus database with same CATH superfamily
3C3NA 1DOSA 3SY1A 4A35A 4LCQA 2ACQA 3VK5A 1DYSA 3BGAA 1K03A 3TFCA 1EUAA 4HTYA 1SO4A 3C2FA 2OSXA 4UTHA 1TJPA 2ZA1A 4DJFD 5C7VA 4HBKA 4MZ1A 3HO8A 3BG5A 4H8NA 5HATA 2NQZA 3MI6A 3N9SA 1PIIA 4MB4A 5LA1A 1SW0A 4MM1A 4K39A 4AWEA 3N6QA 4JAWA 4TVUA 3FS2A 4FNQA 1U83A 4PCNA 3W2NA 5BRPA 4W5UA 1PO9A 5C6MA 7PTDA 3SUTA 3HOJA 1VP5A 2GQ8A 2RDXA 3AALA 1WKFA 1ADSA 4GZIA 1F07A 5D8WA 2DJXA 1JDEA 1R3VA 1XIFA 3L68A 4ZMGA 3P8JA 4CCZA 3C8FA 3W7QA 3LCHA 4W7UA 4WDXA 3CZGA 1UHVA 4IMCA 1UUQA 3KEHA 5CG7A 4HHMA 1O5KA 4LUYA 1SMDA 3W00A 1WXYA 3T9PA 1JPKA 2VXNA 3Q94A 2W67A 2QCDB 2WHKA 4JHOA 3ZVHB 1EBGA 3CTTA 5LXEA 1Q6FA 2QUUA 1R3TA 1TUFA 3N4EA 1FX6A 3NQ7A 3ZFHA 1BSIA 2VHLA 2FZMA 5IM51 3CB8A 1L8PA 1JL8A 4C6EA 1MRAA 3APTA 3QV7A 1G4PA 2ZC1A 2V2HA 2ON3A 1QNVA 1FWRA 3PUOA 1JYNA 2QCHA 3JS3A 3TSMA 1A4LA 3GNXA 5C7HA 1ZY9A 2GWNA 4ECLA 1DKWA 3GD6A 5C9RA 3EDFA 3QMRA 4K6AA 4AD5A 1PVNA 1R9YA 3SIZA 3WLSA 3THQA 4N9BA 1PX3A 3CUZA 5MHBA 3LLXA 2PDWA 1S2CA 4KETA 1WP6A 4F0SA 1WO2A 5AY7A 3GG8A 3DYMA 3K5XA 1J5SA 4HNCA 2WNQA 2FKPA 3DUGA 1KW1A 2Y7EA 1X39A 4AH7A 3WF3A 4I5RA 4EPBC 4DO6A 3NAVA 4Q4QA 4LW7A 4MFEA 4DUOA 4JICA 2XISA 1V79A 3AMDA 4MFDA 4ERIA 4ACZB 4EACA 1GJUA 4MKSA 4V33A 1YX1A 2R91A 3RXZA 3PTKA 1V3LA 2BODX 1AH3A 1XLBA 2PC8A 3M46A 4CEUC 2ZE3A 4JTTA 3T4WA 1EFZA 5DCEA 2V82A 3MV11 1VENA 5BXRA 4UNLA 2E77A 1R6WA 1AD1A 2NQLA 3PVFA 2CKRA 4UOJA 4LAZA 1J0ZA 1GJPA 2Z1WA 1R85A 4GK8A 4DF2A 2Y70A 2XN2A 1E4MM 1OQFA 3EB3A 3W1PA 3MWAA 3P5YA 3PNZA 2XH0A 1P6WA 3ITTA 3EPOA 2DFAA 3WNNA 1B57A 4NXSA 2GQ3A 5DQPA 1GQLA 4AF0B 1RUSA 1LRNA 4WDTA 3E02A 3VCRA 1VFFA 1E9ZB 3RIKA 2X16A 2OWWA 4B5SA 3KLLA 2GVGA 3M64A 4DJFC 3UXAA 3WD0A 3WMBA 5JQ9A 3VINA 3NDZA 1GKQA 4HIBA 3N2XA 1XLCA 3NVTA 3CT2A 1VKFA 5H8MA 2YDAA 3CAKA 4GFIA 4B91A 3KLKA 2ALDA 2IXVA 3H4GA 4PCSA 4NAEA 4DJDA 1JFHA 4MADA 5BWAA 4BQ3A 4D8ZA 3ZM8A 4GJIA 3G1FA 2EJ1A 3NQMA 2OLAA 5LIXX 4O1CA 4GLEA 1ZB5A 3SCNA 3VNMA 4W85A 2XWEA 1I8JA 1AJ0A 2YA0A 2OYKA 3WEOA 4GXWA 1UD6A 1XDLA 1FUYA 3JU2A 1R3RA 3NPWA 1O94A 3AJ7A 3IRDA 4ZTXA 2ZA3A 3GK0A 2YIHA 3VOIA 3TZNA 1MEHA 1VBUA 4ACZA 3NOEA 2E68A 1W9DM 2PI6A 3FEMA 1CXFA 2QUVA 3T0DA 4LT9A 2DUXA 4GACA 3AIVA 3SCPA 3SW6A 4AD1A 1OFEA 5FF7A 3D5HA 2ZZ5A 3A5FA 1PPIA 3PZMA 3QSTA 3WNOA 3W6YA 1BRLA 5AHNA 1RAKA 1LDCA 5AECA 5IBXC 2AL1A 3LUTA 3ITCA 3KBWA 3H7UA 4BZYA 5D04C 3WQ5A 4MJ2A 3R13A 4M6VA 1D9EA 3WDHA 3WY1A 2WCSA 1L6WA 2H9AA 4HNLA 1X6UA 2V63A 3QBUA 2AMGA 3LI0A 2DY3A 1LWHA 4QLJA 2J62A 2PEVA 2V8ZA 2PLJA 2WSRA 3MSGA 4K1WA 6XIMA 1XBYA 1UWQA 1VIZA 4GINA 1A0EA 3WUFA 1SFSA 3LB0A 1V0MA 3VZYA 4TTGA 4E2BA 3IJ7A 4NNCA 1TX2A 4XQ6A 4MB5A 1CB2A 2ZWZA 2IPJA 3MDUA 4WDUA 3R8HA 3WD4A 5LSMA 1WCGA 4YNGA 2EJAA 3EBVA 2NV2A 4PBFA 4XV0A 1ZNNA 3W1TA 4LS1A 4DWSB 3EX4A 2DIJA 1QI5A 1TFVA 1H1YA 2PSNA 3DG6A 3UZ5A 1CYGA 1AVAA 4O12A 1JJKA 3PPGA 5FI8A 4KFPA 1SMAA 2C0HA 3HN3A 4AC1X 3TW6A 4YPJA 2W91A 1Q7QA 1DORA 3REQB 3UXLA 1TQJA 2A0NA 1J9YA 4L9XA 4R7OA 4Q33A 1DJZA 2OT1A 4JN8A 2DH3A 4IZGA 3BSMA 4XAZA 3EAUA 3K2GA 3N4FA 4EX4A 3VKBA 5CGTA 2VENA 2ZRUA 4M29A 2J27A 4GH3A 4ZODA 4Q8VA 3E1F1 3BE7A 4UQAA 1HW6A 3BGGA 1D8CA 1R3QA 5CPTA 5CBBA 1LUCB 3CB3A 4GBDA 2J7BA 5I7GA 2PDIA 4QDWA 2DZPA 3IWPA 4Q8PA 2VWSA 4UUIA 3UY7A 4CU8A 1RY0A 5D9MA 1LOQA 3THDA 2WWCA 1NWTA 2E3ZA 2VFHA 1FWTA 4MNLA 3TQPA 3PP7A 1EOMA 3BLIA 1PHWA 4RXGA 5DLCA 3O1NA 2YSWA 9CGTA 3S2NA 2I5GA 1GW1A 2YDRA 4AZGA 3AISA 4NI3A 3GHSA 1R8LA 3UERA 3GZ3A 2FZNA 4JFVA 3UF9A 3DXIA 4F0HA 1UC5A 1OCQA 2VVNA 3L5MA 2ZA2A 3R2GA 3GDBA 4H9XA 1K6AA 1XBXA 1U1HA 3PTMA 5DBTA 1R2TA 4NYUA 1FHDA 5A2CA 4YJ5A 5T9CE 3GU1A 3WIJA 2VOMA 4H3DA 4MY8A 1IZJA 1KLZA 2G37A 2VL4A 3C86A 2D1ZA 3BG9A 1F6YA 1Q4WA 2DZTA 4O1AA 2ZX5A 4NAFA 2PODA 4B5UA 2BWGA 1YYAA 4Q6JA 4JX6A 3K4WA 3DFNA 1BD0A 2QUMA 3GXPA 1H7XA 1E3XA 1MNSA 1Q6GA 1YQ2A 1E56A 3NVDA 2XZ9A 3DCPA 3J7HA 4QQUA 1P7TA 3LPFA 5KEZA 1PKLA 1XLHA 3W1LA 1KR0A 1TV4A 5AZ1A 1RXOB 2G5WA 1AZ2A 1Q7ZA 3O2LA 2HVOA 4HYRA 4CUCA 1UKPA 3L4YA 1LL4A 3W84A 4F8XA 3SN0A 3OA5A 5HJXA 1M1BA 1N8WA 4ZO6A 3ZYZA 1BHGA 2QJHA 4EAYA 1CB7B 4DZ5A 2XH2A 1RK6A 4V15A 4NZ5A 2V3FA 4XD3A 3NYDA 1IZCA 4AVOA 4D6HA 3WH9A 1V93A 4QG6A 4CQAA 3VKJA 2XIOA 3GNDA 1KCKA 4HMNA 1RPXA 3VMOA 4AZCB 3KBSA 1LWIA 3S5OA 3RJXA 2H3DA 1B4KA 4F2TA 4ZEPA 3KP0A 3TN6A 3ALGA 7REQA 4XSLA 4IMGA 3BJFA 4F0KA 4GXPA 2GGEA 3FCPA 4UFIA 3GFYA 1LQ0A 5RUBA 4IIHA 4J3VA 3WEMA 2G4JA 1MDRA 3XIMA 3S42A 3GU2A 3P6LA 2DU2A 4ONVA 1NWUA 5D8ZA 2F9RA 3TFXA 1UUOA 4E2OA 5I0DA 2FFIA 2OTDA 3RILA 2CZEA 4AIUA 2E5CA 4ICCX 1IIHA 3VUPA 2EG6A 6TAAA 5EL1A 3EWCA 5CEWA 3W7RA 3S0CA 3HGRA 3LPGA 2Y4SA 4KWWA 3TC7A 3WH6A 1E72M 3WLRA 3VIPA 4EF8A 3GKAA 4HU3A 4WK9A 1CGVA 4O13A 3TTOA 3QLDA 4ZOBA 1Y7VA 3TW7A 3QW3A 3BARA 3TMQA 3OTRA 1YW1A 3GC5A 2Z2BA 3GBDA 5BU6A 4TMBA 2CU0A 3M1ZA 1YKWA 3CQIA 2PBOA 3NSMA 1PX4A 1UJPA 4J1OA 2SFPA 4E4FA 1JUEA 2CLIA 2VM8A 4W84A 4I9MA 4TQTA 5A95A 1GQJA 1QK0A 3BW2A 3R8GA 4XO7A 5EMJA 3L2IA 3RM9A 2HMCA 1UC4A 4LS2A 1K8XA 3L0NA 4M80A 3UG5A 2X09A 4QP0A 1LLOA 1BXCA 1UJQA 1XIMA 3CPRA 4N9CA 1POJA 2VTFA 1FA2A 2QXWA 3AHVA 4O10A 3SGGA 3OOQA 2FTPA 3W83A 1A5MC 3VGFA 3B0PA 3VOJA 1OY0A 3R1ZA 3SBFA 1X96A 2VFIA 3LXCA 1ITQA 3QTPA 3DFYA 3N2MA 3VKDA 4WQ6A 4OV9A 3PFMA 3H70A 5M1TA 4Z2GA 2XFRA 2VEMA 1HVXA 1XISA 1RR2A 1OGGA 3WCZA 3AIRA 4FO4A 2YFOA 3W2MA 3ATYA 1V77A 3VFCA 4P8UA 2G96A 4KQNA 1HJUA 5D9OA 3KZSA 3UA4A 4NZ1A 2PDUA 1TPC1 4QS5A 3QOKA 2GVJA 1A5OC 3EMZA 5E0CA 3L12A 1MUWA 2PDXA 1IIGA 2QGYA 4X2PA 3F4CA 5LNSA 5A8MA 3L67A 1XLFA 3TR9A 3MMUA 2D2OA 1TTPA 2I57A 4ORIA 1XIJA 3C2YA 1J93A 3T0TA 1U33A 1G4SA 1VFLA 3NL3A 5ECUA 3MMWA 4O28A 2P8CA 1S5MA 4BY3A 2BGQA 4PTDA 1EQCA 1W9XA 4N4QA 4XBJA 3SFWA 4S38A 3W72A 9RUBA 4A3YA 3MHUA 2W9MA 3CV2A 3DG7A 1QOPA 1TTQA 3R0DA 1N8IA 6TIMA 3QM3A 2YDSA 2E25A 4JTKA 4GUHA 1EYWA 3L23A 3GR7A 3SRKA 4K7VA 3WFLA 4W8BA 4UQ9A 4UFJA 2WJEA 3ORWA 4Y9NA 3WN6A 2REQB 2PA6A 2DP3A 3CAQA 4W88A 2AAAA 4EWJA 5A8QA 4H6EA 2WNWA 1HL9A 4PB4A 4GCAA 3M43A 3NQFA 4DIAA 4DBWA 2XVKA 3LV5A 3EXRA 2OX1A 3VNZA 1B30A 2C3ZA 4ZB0A 3B0VC 2JQXA 1KD0A 4JTDA 3G1XA 5G1YA 3LBCA 2FGZA 5HPOA 4X9SA 3NL5A 3GDKA 1M7XA 2WZHA 3MP5A 3S5NA 2GGJA 3WDJA 1KR1A 3M47A 1A49A 1Z48A 4CCDA 4RPQA 1C9DA 5T8GA 1A5AA 2OZTA 5DCDA 4G56A 1ME8A 1BXBA 1EGMA 5DT7A 1Q4NX 4U5KA 1L2UA 1YRRA 1I0DA 3R58A 2CEQA 3N12A 1HX0A 3CO8A 1ZJBA 1ONEA 3NDYA 4AZ5A 1T96A 4GOAA 1SO6A 1ELSA 1PXGA 1Z6KA 1JCLA 3BCJA 2P3EA 4GVHA 3VIKA 4QGCA 1EB3A 2FDSA 5DMMA 3B05A 2BGNE 2PURA 1JGIA 1CX9A 1IWAA 3CHVA 3QW4B 4PCFA 1VRDA 4IISA 3F2CA 3WF2A 2YBTA 4H01A 5XIAA 5E0KA 3CLWA 2KX9A 3RRXA 1ZSXA 3A3XA 1YDVA 4CQCA 2QCCA 4AYSA 5C8BB 4LRTA 1XJBA 1ODZA 1XICA 3VM7A 3QR1A 5JH1A 4LUJA 2XH4A 1YDNA 3TQ0A 1LG2A 3WQDA 4A2RA 3B0XA 5HDRA 3N2OA 1Q6RA 1G7VA 2YCLA 2ZXDA 1LLWA 1GT8A 4FA3A 2WSYA 2J7HA 2WJDA 3U2EA 1OB0A 1RVKA 3UD6A 4CD4A 1UWIA 1HKJA 1G9HA 3MHFA 1XGEA 3LEPA 3CYVA 2XM1A 3NQCA 1IEVA 1QK2A 1JF6A 3POHA 1UZ4A 3IGSA 4AXNA 4M5PA 4YYFA 2JE8A 5J04A 1ZRQA 4Z2JA 2J9XA 1B4EA 2POTA 3ARZA 2HISA 4FB7A 2YFNA 4B5XA 4C1KA 1BSLA 4I5XA 4HZ8A 1IF2A 3UW6A 4K8EA 1FFRA 4EK7A 3STEA 4BJHA 3UPWA 1OEPA 4PL2A 2BHUA 4JBRA 1NFGA 1VIWA 3TQKA 1XW8A 3NWRA 5HNRA 4E2DA 5M2FX 2ACRA 2OZ0A 3M0LA 3W7NA 2OKTA 4GYFA 3S3GA 1XRSA 4AG0A 3URQA 1XXXA 3UG8A 3OLIA 3TYEA 4FXFA 4D8AA 8XIMA 3CL7A 5T91A 5IDIA 3RN6A 3EMQA 8RUCA 1K9DA 2GOKA 4J7RA 1AMYA 2J6XA 3SSZA 4H9VA 4L56A 1U5JA 3O7UA 4FIRA 3NEHA 3INPA 1D7KA 1S5VA 3BG3A 2WQPA 4TVDA 1RJPA 2VWTA 4DI8A 6XIAA 4UCFA 4KCVA 1UKTA 3KOYA 1JI1A 3GHRA 1ISZA 1Q65A 3KBNA 3ITGA 1HP5A 1QWKA 3WJZA 4F0RA 3SGZA 2BBFA 3TWBA 3MKVA 3UCCA 3JZEA 3V1HA 1K9FA 3KCOA 4XUGA 1KNWA 3C52A 1I2PA 3E2VA 2V69A 4C6DA 4A6GA 2PDKA 1MUMA 3F5JA 3OZOA 1W3JA 3KP1A 2PC4A 4N02A 2XGIA 2XFYA 3B8WA 3CMFA 5FJIA 4AISA 5DF0A 2QKFA 5DX7A 4ML9A 5H2ZA 5I2UA 4DI9A 3BPWA 1CWYA 4KS0A 5AC7A 3GIQA 3LXAA 3ERPA 1M41A 3G0UA 3PG9A 1K3UA 3WLJA 2GGIA 2NXHA 2R1KA 3ID7A 3DGBA 3QHOA 3IJDA 1DEDA 2V3GA 1EZWA 1UR3M 2VC5A 2VRKA 2BY0A 3CV6A 4S2CA 3PB0A 4EIVA 2WNNA 5A6KA 4LSBA 2CBIA 1W5QA 4Q6XA 4HK7A 1S39A 3AIEA 1AJZA 4V27A 5FACA 4NUWA 1THFD 1Y8BA 1YE6A 4NNAA 3UT0A 2WYSA 3MJMA 4LQ1A 2Z2UA 2PDLA 4NP7A 2BTMA 1QPOA 3PZQA 3WBWA 2VDHA 3LGGA 2IW0A 3TR2A 5EFDA 4B5NA 2ZX6A 3PJWA 2INFA 4AD2A 1TYGA 5DELA 3S8HA 1JPMA 4H00A 3ZJ8A 4D6GA 4KEMA 4XAGA 3NL6A 2EPHA 3VVGA 1UIPA 3PZGA 3G5EA 3GSMA 7TAAA 1S3HA 5CKSA 2J77A 5XIMA 1D7FA 2CBVA 1RCQA 3V36A 3AUJA 2GJRA 1GZGA 4QTGA 4QCEA 3W2UA 4HHHA 3E2SA 4JTRA 4JX4A 4G1KA 3GAKA 3R12A 3HPSA 5AB3A 5PTDA 5JIWA 5FAGA 3CH0A 2VC9A 1T41A 4U28A 1RD6A 4TMCA 1BVZA 2ANUA 4QSFA 3VNYA 1V8EA 2V6AA 3CPUA 1P6BA 3LSCA 3RDKA 1UASA 4DUWA 3ABSA 5K2ZA 2DDXA 5D05A 2JBMA 4PR4A 3TQVA 3PULA 4AY7A 3PWAA 3SRFA 2R8WA 2V30A 4ZBCA 2EBNA 3DFTA 3GXTA 4C1LA 4LAMA 4KEZA 1I0BA 4GYKA 5BXSA 3BV4A 5IFPA 4J40A 3VTRA 1WV2A 1UOZA 4XK2A 4IT1A 4GZ7A 4W9TA 3W7PA 4ZOAA 1SGJA 4XSMA 3CASA 3T2QA 3BZGA 3TW9A 3EEZA 1QHZA 1J6PA 1M7OA 1JEZA 4B15A 3HTWA 1P0DA 4IMFA 2XHYA 4INFA 3CO4A 2BX7A 1X98A 7ENLA 5KSWA 3LM3A 4P8XA 3FKRA 1TPB1 1WZKA 4C6MA 1AQMA 4IUGA 2VCCA 3EX6A 3P62A 3TJIA 3EOUA 1BF6A 3QZAA 1OZMA 4WJEA 3KTCA 1KO0A 3FSUA 4I9AA 1WBHA 3DHUA 4WVXA 1B9BA 4PUUA 2QJIA 1J11A 3EOSA 3VGBA 3CZEA 1KGXA 3M0MA 2V5LA 1F4HA 4AIBA 3QXBA 1F74A 4L5ZA 2WZEA 4HU8A 3PBWA 4NVTA 5AHIA 1P6CA 2C1IA 3PZVA 1JZ4A 1E6RA 3KOXA 2GJXB 2D24A 1YIXA 3NPVA 3WEZA 1V6UA 4NU7A 4MY9A 3W7KA 1I2QA 3VD7A 3GG0A 1XWYA 1PZ0A 1XH0A 3RMEA 1FKXA 3TTEA 1JDDA 4WKFA 3M6YA 3CUHA 1Y5WA 3THCA 3TC3A 3MSDA 1UR4A 2PGRA 1LG1A 4DYKA 3RR4A 4MLRA 1UOKA 3AIUA 3RLUA 1KM0A 2G3JA 1ZQ5A 5HQMA 2PAJA 2V0TA 4UOQA 1JZ3A 3U4FA 2FZ9A 3BAIA 5AHLA 3V18A 1QI4A 3WKZA 2RH9A 4P61A 3H4WA 3N2TA 2XJ7A 5JMUA 3E49A 3P82A 3ZOAA 2CETA 2ACUA 5I79A 4US5D 4L6OA 2V3EA 1OFAA 1VQTA 5A6SA 3CK5A 1EPVA 2WLZA 5BWFA 1PZ2A 4PCPA 2QULA 1KBIA 4CU6A 2DZBA 4AF0A 2ZQ0A 3EWZA 4IFKA 5LA2A 4LUTB 3RMJA 3VO0A 4RNFA 2PF8A 4DWSC 1JNEA 3BJTA 2DVUA 3DFOA 4ZFMA 4KPLA 2R1PA 3PZNA 4Q8WA 3S1UA 1FWJC 2YCJA 4XZIA 2VELA 1KBBA 2VZUA 1EHNA 5DRCA 4XUYA 5HMDA 2FPVA 1R3SA 3PSVA 4AIOA 4KRTA 1Q3NA 3QV6A 2W5FA 5FEZA 3T0AA 2DSZA 4HSOA 3LM7A 4O1FA 2W0UA 4O4WA 2YKKA 4AEOA 1DV7A 3KOFA 1IEXA 2PMQA 3H23A 4MPQA 4YWIA 1JPHA 4RUBA 2Q6ZA 2OWCA 2HCVA 4MB3A 5EB8A 2P5NA 2ZFAA 3UXKA 4AEEA 1MUCA 3IIVA 1W3LA 1R5YA 5JBFA 4GHRA 5C70A 3HMJG 1GVOA 3S6OA 2OLSA 1UD4A 2QJJA 4GQGA 1QASA 4OBRA 4EPDC 4UNKA 1X1OA 1XHGA 1EQPA 2OSYA 3N73A 3C61A 2OQYA 3E5BA 1W17A 3UJSA 3VNDA 3W2LA 3W7MA 1TMQA 3EA3A 1YBQA 2WKLA 3BAKA 4AVFA 1CXEA 2DZSA 4P8WA 5E93A 1C90A 4JN7A 3WENA 3WBXA 4JTFA 2AGTA 1X7IA 1Z89A 1S2UA 3G1AA 3UWVA 1VBHA 3FYPA 3FJ6A 5HNTA 5GJMA 1GWJA 1OC5A 4ZGYA 1E9IA 1QPKA 1GYMA 3VIFA 1Q6LA 4GKTA 3GG1A 4FNUA 3TONA 2HQAA 2JF6A 3W86A 3BLLA 3F4NA 4PRTA 1FWDC 2J8TA 5AVNA 4EXAA 1FCQA 2C91A 1FCUA 2REQA 3BLOA 2WBKA 2TPSA 3K4AA 3KL0A 3OZYA 4S3DA 2V5KA 1MW3A 3PUGA 2ATSA 1E6QM 4IJCA 2OPJA 4YIWA 4WOQA 3S1WA 2A4AA 2JFEX 1V3KA 3VOGA 2Y63A 3FGCA 1MXGA 1AMKA 4HZMA 1UMYA 2HNHA 2X1TA 3AJXA 4DJEC 1V02E 5K3VA 4HQVA 1LL7A 5F2GA 3SAZA 5CZ0A 3FAWA 3F03K 2NX1A 3CNYA 1VBRA 2ZXBA 3U7VA 3MKCA 1RJRA 1JFXA 3UWZA 2CLHA 3C0SA 1MWOA 4DO7A 3QN3A 2RKXA 3UNDA 4HHPA 2VX4A 2J66A 4O14A 5JXQA 1NFBA 4MZYA 3ANUA 1CW2A 5AYIA 3LCLA 2XU2A 4HD5A 4JL2A 1E55A 3NR0A 3O16A 4Z1CA 2ZUNA 5FF0A 5I09A 2Z1SA 3FFSA 3S1XA 3B4UA 3G24A 4L4PA 3KRZA 3OP2A 3IVTA 1AH4A 1YTDA 2G3MA 1RJQA 1UD8A 5DRIA 3M4HA 2AQOA 4PGLA 4Y90A 3W1RA 1HJWA 2DW7A 3KRBA 1V5XA 2ZZ6A 3BV7A 1I2NA 3IK2A 1LUCA 1XD1A 1WB0A 2BY2A 3C56A 4L64A 4JIRA 1PDYA 2EEXA 3PJTA 2CCRA 4GJJA 1ME9A 1LL6A 1UWUA 1ISVA 3ZWSA 1W1YA 3TXZA 4UTMA 1R3WA 4HB7A 4A05A 2VJXA 3KCJA 1QNPA 1B3YA 4TTUA 3MUY1 3N13A 1VR6A 1HKMA 3KCLA 6ENLA 1U1UA 1L9WA 3L4UA 1A3XA 1R7OA 4ZE4A 4LANA 1IR1A 3WO8A 3FYOA 2PU0A 4JQ3A 3W29A 1US3A 1WA3A 3VMPA 4CNPA 4WY0A 5TBOA 2OELA 1JNDA 1TPDA 3STFA 3EKZA 5LGXA 2YL5A 4RE4A 3RGTA 4JIHA 2G50A 1S2AA 2BVWA 3CZKA 1JAEA 3AHXA 3N6HA 2ZKMX 1XSIA 2JKEA 2G0WA 3G77A 2P50A 4KCTA 3KZPA 2PDGA 1XLIA 3UBPC 1EC7A 1Z7AA 4D6FA 1W9PA 1TJ0A 2BV9A 5G2HA 1W8GA 4E0CA 4HSNA 1H51A 2NXGA 2C13A 1JG9A 2HVNA 5CSYA 1FDJA 2PDYA 2RDTA 3L5LA 2D69A 1M6JA 3V35A 5B7YA 1PDZA 5CLTA 3SIMA 1SSGA 4LB3A 1H62A 1DL3A 3PY2A 4X0VA 1OJXA 3KL5A 4LTSA 1RLCL 2L5HA 3GIYA 1HJXA 4MLJA 3GXDA 2G3NA 3W70A 1QO2A 1AUSL 4IFKB 1E6XM 1TVLA 4NYYA 2ONEA 2QDGA 1OHLA 4AX6A 4Z1DA 1H0GA 4HU4A 4GIYA 3CAVA 4MGGA 2Z1KA 4KWVA 3VDGA 2WVSA 4DO4A 4LGXA 4FLQA 2FIQA 2QDDA 5D2YA 4U3AA 4AFYA 4P7LA 1K6WA 3OG2A 1OK4A 1S3TC 3HU7A 1N8FA 4A29A 3ZZ1A 2VI0A 4OU1A 1ISWA 2VRQA 3W24A 4J3TA 3VIIA 5A94A 3RG6A 3NQ8A 5HJYA 2PP3A 3W81A 3CHFA 3RX3A 4CNTA 1SZFA 4L1XA 3PANA 4S3FA 3E0FA 3M5ZA 4DELA 2EGZA 5AHFA 3PC0A 1YHTA 3L0KA 3MT1A 4FLOA 5A6BA 1W1B1 5AHEA 3UXIA 1W3IA 3VDCA 5I6SA 2FH6A 5CZJA 4JHZA 1G4TA 3B9AA 1H50A 3AC0A 1UB3A 2CERA 1OYAA 4YU1A 4JTJA 2A6LA 2YZRA 2FHBA 1I1WA 1EDGA 2DT3A 3S46A 4LNCA 2X1RA 4H8VA 4LCSA 3IIPA 1XPYA 2VO5A 3OEXA 4QNEA 3GDMA 1JDFA 4RDYA 1VPYA 3T0CA 3WJYA 1GKRA 4J3WA 1A5UA 2XG9A 4C7DA 3VCCA 1ZP3A 4W4QA 2P3ZA 1LTDA 1PX8A 2IQ0A 3DOPA 2A3EA 3P0WA 3LTYA 1CCWB 2OOFA 1G0CA 2E9MA 1HO1A 2I9UA 4MJMA 4M24A 1XG3A 4JFSA 3UEQA 5BZAA 4ZO9A 4LXFA 3U57A 5EYWA 2O4QA 4S3EA 3HGOA 5REQA 5I3DA 4C65A 3NO5A 5TIMA 3E96A 1G1YA 3CIXA 5DANA 4GKLA 6REQA 2F8QA 3B40A 2ACSA 4IXXA 3GFXA 3FY1A 3FV9A 1PIFA 1EBHA 2Y61A 3AO0A 1JZ2A 2HV5A 2J24A 3WG6A 1UD2A 2IQTA 2NUXA 1WAWA 3RCNA 4V2XA 1LBFA 2Z2AA 2PLMA 5FCZA 1KM5A 1XKYA 1GUVA 3R10A 4JQ1A 3SZ8A 3TK7A 2RDWA 5E0FA 2J9YA 1XD0A 3DN5A 2ISWA 2ABBA 4YTSA 3L4VA 2J7CA 1Q6QA 3NM3A 3AXXA 1VC4A 1BG9A 4NG3A 3B0YA 4YLWA 3NZPA 2J6VA 3W2KA 1DPMA 3S2CA 3RITA 1BRLB 3A9IA 4ZQOA 5AVHA 1KCXA 2XDFA 3MVIA 4GY0A 1QWGA 1FH9A 2QVNA 3DHFA 2NW0A 5A8NA 3QGAC 3W7CA 3GDLA 5DN1A 4IG2A 3CMJA 1R87A 1XP3A 4JKMA 3CWNA 4GVFA 1Q6EA 2X0SA 2RGMA 3SSJA 1YDOA 3N3MA 2FZBA 5LIWX 3H22A 4B3ZA 5CBIA 4LU0A 3ZSTA 1PYMA 3UR5A 3VE7A 3P14A 3DC0A 2GSHA 4AZCA 1M03A 1QI0A 4PA8A 3OODA 4J3SA 2PD9A 5LNUA 3BAJA 3MO4A 3NNTA 3CQHA 3N15A 4AC7C 3NGFA 3DYPA 2YJQA 1Q6CA 2VFGA 5K9CA 3WD3A 2ZZ3A 4AD0A 1B9ZA 2AQWA 1IYXA 4Y9OA 5K4XA 4FMVA 1U22A 4U4MA 4L4MA 1GG1A 3W38A 1MQQA 3GTNA 4NT0A 2HE8A 2GWGA 3CV7A 4NX5A 1A47A 3R8RA 1CIUA 4FX6M 4LALA 2ZRVA 2Z25A 5K9DA 3PBVA 4DWSD 3EX1A 1SZNA 3T8QA 5M03A 1BTCA 1I45A 4XZMX 4WJXA 5E70A 3G1DA 1JZ8A 1XDMA 4HNUA 3IK4A 4LH8A 2BHYA 4WY0B 3K8MA 1TPVA 3EPNA 3HJEA 3C2VA 2VOTA 4O0QA 1EP3A 3W0KA 4NHVA 1BTMA 3QH2A 2XSAA 4J3UA 4CLMA 3TYUA 2E6FA 3TCSA 1O68A 4IPIA 2HK0A 3R11A 1L8NA 5HWJA 3TAKA 4KWUA 2OOGA 2GPTA 1CGYA 4CN1A 2PFHA 4XD6A 2IPGA 2FTWA 2YX0A 4G6CA 1A4MA 1IXPA 1KXTA 1EJ7L 3ZO9A 2OR2A 2FJKA 2P10A 3P81A 2J7GA 4KRUA 3G0SA 2OODA 2JIWA 4IGSA 1SZGA 4RPPA 4KEUA 4LY4A 1CTNA 3BW4A 2E6DA 1JRBA 1W3NA 1WX0A 1JRCA 2PE4A 4AQLA 3KDNA 4C6BA 3TUUA 2OG9A 1ZS2A 2WMHA 1JXJA 4WF7A 2F6UA 4ATLA 1YPFA 2C1GA 2Z1BA 1S46A 2GSJA 1KFJA 4A22A 1V6XA 2FVMA 3U5YA 3QMSA 2ZADA 4JXCA 5C9XA 1QDSA 3H2NA 4MWAD 4GO9A 3SCQA 1PB0A 2VX5A 3B04A 3QV8A 3CUIA 3M16A 1NOFA 1VEOA 3WFAA 3I3DA 2EPOA 4H7CA 2ZZ7A 2DZXA 4OHQA 1EJRC 3ELFA 3B8IA 1IT0A 2WSKA 1JDCA 4MTVA 5E9XA 4X63A 4WSJA 3UWYA 1VD6A 1KV8A 4Q8QA 1UIOA 1Z42A 1LJYA 5BMWA 4UTUA 4ZQRA 3SUSA 4MNMA 2OB3A 1VGAA 3H4XA 3BW3A 4C6NA 3LRKA 1RQHA 1ZLPA 5CSRA 3TX9A 1NU5A 3SUVA 4A4AA 1W9UA 3UVAA 2BASA 3G8RA 3W07A 4S39A 1VYPX 3E0IA 2HDJA 4L65A 3IPWA 4GABA 3QFWA 4O1BA 1E0XA 4PMVA 4HCHA 4LVGA 3DI0A 3V16A 1DIDA 1VS1A 4H9YA 4HCLA 3AROA 2UZ9A 4GGBA 2VQUA 4XVDA 1AQ0A 1OG0A 4IF2A 1F7BA 2OGYA 4CNOA 3CUXA 1OIMA 3KFTA 1ZGDA 1XPGA 4M8UA 4UR9A 3GUWA 3QPZA 2QCLA 3FOKA 1IWBA 1UR2A 4IGHA 2HXTA 3WQGA 3EXTA 3WLTA 1EHAA 1YXYA 2PDQA 2YL6A 2IKJA 3M7WA 4MNKA 2XIJA 3CC1A 1DWHM 2VUNA 3AXHA 5CGQA 1ZBVA 3VOFA 5CAHA 2ZXAA 4LVFA 1MXDA 1OG6A 1RCOB 4YVXA 4OOUA 2PCQA 2ZBTA 1EDTA 4O16A 3NO3A 3BMVA 4CVUA 4V1XA 3TJXA 4NRRA 4HJFA 1XLKA 3W7JA 4YWSA 3ZR4A 1E1EA 2CNCA 2I7GA 1JXKA 1PIGA 1ZJIA 4HZ7A 1RP9A 4I3GA 4FP1A 4QQ3A 1P0BA 1E3ZA 1HJQA 1IE7C 4JIEA 4IUOA 2WVTA 3ARRA 1UD5A 5I3FA 1VHNA 1UH4A 1RBLA 4N9DA 4P7RA 3AMCA 3LQGA 1T8QA 3VIJA 4XO6A 4QS6A 1QHOA 1RP8A 1DJWA 3QPYA 4XKYB 4LF1A 5GVJA 1NM9A 2YDQA 3GHUA 5ABFB 4JTHA 1GHSA 1Z8AA 1PBGA 4RLIA 5ABTA 3QQWA 4X0NA 1E51A 2FFCA 3W22A 1XYMA 1NP2A 3GTXA 3UZZA 3RCYA 5FKYA 2QCFA 2XH7A 5FF2A 1TPFA 4Q7NA 1RV8A 3RLVA 3W53A 3QQ0A 3ZMRA 3H21A 1R2SA 4LS0A 1J01A 3NQ2A 1EL3A 2OYMA 3O15A 3T81A 4RZ5A 2WBGA 4WKAA 2GQ9A 5AZ0A 5CZSA 3FYYA 1RZMA 2B4GA 2X1IA 3G6LA 1H49A 4PMJA 4EP8C 4GQ0A 2YW4A 1K7XA 3NPXA 3SEPA 3ABQA 5F1VA 1E5NA 4F9JA 3Q58A 5IXEA 8CGTA 1XCFA 2Q8LA 2R14A 3PUDA 2NQ9A 1T0OA 2PS2A 3IARA 4OIFA 4BQ5A 1GJWA 3FSTA 1S38A 4CNSA 2EG8A 4XAPA 4GXMA 3I6RA 3NXFA 1X6LA 4GMEA 1ZL1A 2VKZG 1LM1A 4IICA 1LLZA 1HKKA 1PWLA 1UWTA 3TLLA 2R9RA 4DB7A 1OFPA 4C6QA 3RU6A 4IGMA 1REQB 3U48A 2CFFA 2B7NA 2RDUA 4PUEA 1FCVA 4LAUA 4MDOA 3XISA 4F2UA 5F1UA 4JR5A 1GG0A 1P0EA 1PSCA 4RE3A 1ENUA 3ZVIA 3PNUA 2FB3A 4CNNA 3DECA 3N11A 3PM6A 3NSXA 1E43A 9XIAA 4S3BA 1K7EA 1MI3A 4H04A 3NO1A 3W7OA 4OJYA 3KOZA 1CXKA 3W1UA 4QJ5B 1B3OA 4G5DA 1P7TB 4GFSA 2UBPC 5HQEA 3FLUA 5C2XA 4FX7A 2OMAA 3VFLA 1GYLA 4AXKA 3KUMA 2R82A 4CKQA 4Q4RA 1WDSA 3W73A 4XTDA 2DZAA 2D0HA 5TAOA 3AXKA 3FGCB 1VHCA 3FN9A 3SUUA 3LCGA 2VGFA 2ODOA 4QEEA 1QW9A 1DIKA 5FJUA 1E4NA 3GU9A 1VBJA 5L6UA 3FJ4A 2WAGA 4ERGA 1FXQA 1WDQA 2YLAA 3LOTA 5GNYA 2MNRA 3IS4A 1JI2A 1FKWA 4H83A 2ZXQA 4Z1BA 3UWQA 1TR1A 4AHQA 4J35A 3I68A 1LT7A 1MDLA 3BH4A 3HQOA 5G1MA 5HOSA 1DP0A 1DHPA 4JTGA 3HFYA 4PUMA 4OBTA 1H1ZA 2NSXA 3CLMA 3S2MA 3AU2A 1JF5A 1PHQA 3LI1A 3CS2A 2YW3A 3VDHA 3SCOA 1HTIA 3P61A 4ASTA 1BQCA 1M68A 2CLEA 5HR7A 3ZWTA 3SQSA 3C0QA 3E6EA 4K38A 1TRIA 1CXIA 4RZBA 2ISSA 4IGNA 1AW2A 4NJHA 3B9DA 3UPMA 3PZ9A 3V0SA 4M51A 4W7WA 1PTGA 4PMRA 3MS8A 3VC5A 1A0DA 4DNMA 1DQWA 5E9AA 4MDPA 2J9ZA 1Z41A 2D2HA 5JIPA 3LN3A 3BOFA 5C9UA 1X7FA 1XGZA 1OVDA 4UIOA 4UQDA 3TN3A 4ZL1A 3W1XA 4JFTA 1KFBA 1F2JA 4XB3A 2ASHA 1WAUA 3RX2A 3VUSA 4UWMA 3TU9A 1JDAA 3IAQA 4PMUA 4ZQCA 4N0RA 7CGTA 5C5YA 1KRMA 4KFOA 5C2GA 4XAYA 1NOWA 1E4LA 3WUBA 3MMTA 3JZUA 3S5SA 5F7UA 3P0XA 1F6KA 2W61A 3E2QA 3LXBA 2V68A 2Z1VA 3I6EA 5D30A 1W1PA 3M9YA 4WEVX 1E6PA 1SQ7A 2VD9A 1TE6A 3VD9A 4FR1A 2Z24A 3TA6A 2BDQA 3OIXA 3WDRA 2INEA 2WKGA 1HXJA 1GYNA 4PEEA 7REQB 1OFRA 1HKIA 2AGKA 1MMFA 4IP5A 1HZYA 4NSBA 4A21A 3AZTA 5FJJA 3IANA 3MQTA 1AG1O 4JOMA 4N6FA 4DX3A 4PBGA 3UU0A 4FEZA 4C91A 1YMYA 1OFBA 5ABGA 1VAHA 2CHOA 4UBPC 3ZT7A 3SI9A 4JY9A 3HGSA 1T5AA 1GOXA 2DZUA 4C6PA 2O7QA 4IQDA 3UR7A 3W7IA 4FNSA 1SW7A 4CU7A 3GDTA 1A0CA 2CLLA 3TTQA 5I3HA 2J74A 1UP2A 1K9TA 1SO5A 3WMLA 1C8VA 1JYXA 2ZE0A 3L7RA 1F3TA 1M7JA 2HPMA 5G4EA 3ARUA 3URAA 4D6CA 3LNPA 3LBMA 1X6NA 4ALDA 3IEBA 5BMXA 2W62A 2PGWA 1TWZA 3S6TA 4MYXA 1I1XA 5C55A 3G1HA 3M0ZA 2W27A 2CLFA 1UBPC 1XCWA 3H6OA 4NI8A 1W2VA 5I3IA 3M0VA 3LBOA 4JTIA 5CC5A 3A12A 1X8FA 3EB4A 3TCEA 1OX5A 3F5KA 3R7MA 3K4DA 4LEQA 3DX5A 3WBYA 3APYA 3HZ3A 4MAVA 1JUKA 1OFOA 2DVTA 3VIOA 3A23A 4LVDA 5I24A 2YB4A 1Y5XA 3VILA 2Z7GA 3EKLA 1WZLA 1H09A 4HZ6A 1FH7A 2ALRA 1V02A 4AU0A 3HFTA 4G9PA 1TWSA 2VGIA 5E6ZA 4A8RA 2E40A 2PP0A 1W31A 5LKYA 2Q71A 3V1PA 1NEYA 2C15A 1OGBA 3WLMA 2Y2WA 3NZ1A 1REQA 3UZXA 3VABA 3U4AA 5A6JA 4PN2A 4Z42C 1CNVA 1E1CB 3MUAA 3AHYA 4GY7A 3DBPA 1U5VA 3R79A 3LSBA 4A8NA 4WOZA 4QDMA 2WZIA 3GHTA 2EO7A 4DXXA 1SUXA 2XPKA 2G41A 3T40A 4YHEA 3AMKA 3ABXA 2ZTJA 3QC3A 1DE5A 4UFLA 4BQ4A 4KCUA 3UZWA 1Y0EA 1WDRA 2JALA 3DGRA 4IHCA 1MRQA 1H4PA 2CZFA 2H6RA 4LPCA 2XVLA 1QNOA 4MWAC 1WXJA 3EWYA 5C2CA 1KFEA 1EEPA 1V3MA 2A3CA 1RBAA 4HSHA 3DYOA 4UTFA 1ALDA 3DEQA 4PC8A 4G7FA 2Z1XA 1VZWA 4GVGA 4IPLA 4LVBA 2Y88A 3M07A 4QFUA 2PDFA 4Z17A 4C6CA 4O54A 1TMHA 5JUVA 1DQXA 3ARXA 1S2VA 2WLYA 4NJJA 3ZXWA 3PBUA 2QZRA 3KWXA 2NQHA 1HVQA 4S2BA 3UZJA 1JPDX 3A3HA 4D1IA 4WUIA 3KDOA 4GJ1A 1K4GA 5FOOA 1F5ZA 1K8YA 5H8UA 1NELA 4S3CA 2CLOA 1TELA 3PZIA 2CYGA 2OU4A 1MO0A 1NQ6A 2PTXA 4HJWA 1TO3A 5K4ZA 2EPNA 2DSVA 3NQVA 1VLIA 1CT5A 2J13A 3CIVA 1NDVA 5FEWA 1ML1A 5LNRA 1XQKA 4U5IA 3POCA 1M04A 4ADSA 3AS1A 3NUKA 1G69A 2YL9A 4GC3A 1UWAA 1J10A 1AK5A 1QW8A 2CESA 2WCAA 1CENA 4R85A 2VZVA 4E38A 1W3TA 4E8GA 3EWDA 4M6UA 4TX8A 3UWWA 3GXNA 2GL5A 4BK9A 1HUVA 3U0HA 3MBDA 5EMLA 4UQBA 1LZOA 4MWAA 3U5UA 1ZTVA 2WJFA 4OT7A 3SFKA 3HBLA 1IQ8A 4ZB2A 5H8PA 2XIQA 2GJNA 3ANVA 1GOWA 2G97A 4CD8A 4G7EB 2OO0A 3NSNA 4NJIA 4GYPC 2FMOA 2XGBA 3UG4A 3AZSA 1F3XA 4Z2IA 2NZLA 1IT7A 1J0KA 2C79A 1GOIA 5CBJA 5HNUA 1C9WA 3GE7A 2Z29A 4WLCA 3T1GA 1LRQA 3HPXA 5D9NA 3AIWA 4E4PA 5A6LA 4JKKA 4F48A 3GR8A 1CXLA 4PMXA 3TNBA 4DBSA 2BZNA 4ZSUA 4HYWA 2E1WA 4Z1YA 1WKDA 3VMNA 2GSEA 1U30A 3C3UA 4TOQA 3W6MA 2XTKA 3GTIA 3EZ4A 3PZTA 3MTWA 3LGDA 2ZX9A 1W1VA 3DHDA 3LTPA 3K46A 1QAPA 4O18A 3W7HA 3W87A 2ZUVA 1V6VA 3I10A 3LNMA 4UB9A 4ICNA 4LUSA 5AOUA 1ZAJA 2O9TA 2QUNA 1QHPA 3LMZA 1XUZA 3WLOA 4WX2A 3SUWA 1T99A 5A5WA 1JUBA 1EEXA 3PG8A 2PRMA 3L9CA 1PZ1A 3E12A 3QHMA 4IPPA 3SURA 3PK7A 1GVYA 3V3WA 4CQDA 1O4UA 1EGVA 4XBKA 3NQAA 5EU9A 1O66A 1GOMA 2FB2A 1RH9A 4KESA 4AB4A 4B3LA 1AFSA 1W37A 3MY9A 4OQVA 1IGWA 4W86A 1SM9A 3FA4A 1W1ZA 3LGEA 3SCVA 4GNJA 4KERA 4LX4A 1HIZA 4CQ9A 4Q8UA 3RF9A 3EYPA 1EX1A 3W7LA 3BVJA 3KOWA 4R9XA 4B5TA 1G6CA 1OK6A 4DZAA 5AYBA 4C6OA 3QTGA 4M81A 4LWWA 1G4EA 4E4UA 2I56A 4BF7A 1O60A 3G22A 1DJXA 4WR3A 3Q45A 3FHQA 3M41A 3HF3A 1KM6A 3IAPA 2GUBA 4FI4A 4W8AA 2J25A 3USBA 1PKMA 4UR7A 4Y6GA 4DNHA 3PS7A 1AODA 3IJ9A 1MVYA 3WH5A 4S3GA 3CZJA 4E5TA 4L1GA 4BF9A 3BAWA 1HGYA 1HJSA 1GZJA 4X60A 1FWBC 3P60A 1B31A 1F8MA 1N2VA 1DXIA 4XAFA 3AOFA 3NXLA 3C6CA 3GVGA 1WDWA 1GOOA 3THUA 3SQMA 3NQ6A 3W6LA 1I75A 2DQWA 4U3CA 1G67A 4MPKA 3EB2A 4R9OA 5I03A 3EKGA 5G4WA 5ABFA 4R34A 1DJGA 2F61A 4UXDA 3OZMA 2H3BA 3CT7A 2Y7DA 2ZUSA 1QNSA 1R9XA 5G2WA 1J18A 5KTLA 2QMJA 1W5NA 3W85A 1W56A 1ME7A 4GYJA 1CGTA 4RDWA 4Z1AA 4Q8TA 3WJXA 4ZO7A 3MJYA 1I2OA 6PTDA 5EY5A 3N4AA 3FX4A 4RCXA 1ZJAA 4IFOA 1XRFA 1IEIA 1H63A 3B8TA 4QE4A 2HWGA 3NQDA 3KAOA 4DY1A 3W4RA 1H7WA 4W7VA 5BW6A 1RPKA 3IACA 1B3VA 4L6DA 1XLMA 4PUDA 4ERAA 5LHFA 1ECQA 3NM1A 2VD8A 1KM4A 4HOWA 2A7PA 4J3XA 3W25A 4PMDA 3GVRA 2JEQA 2DSUA 2XUCA 4HOXA 1EYEA 3N17A 2WVVA 3NTYA 3KBMA 1TWWA 4NNBA 1QNQA 4UTKA 2ZC8A 2VURA 3AU6A 1OT1A 3VIMA 3LENA 5HAOA 3L2LA 5HBFA 2C1HA 2DIEA 3TLQA 4QEHA 1OF6A 4ORMA 3G1VA 4ENLA 1NDZA 3KS5A 4AY8A 3WLQA 1EPXA 1OWQA 1SO3A 2OVLA 4G1NA 2PTWA 4HMEA 4QSHA 1Q5MA 3H12A 2Y8UA 2WPGA 4TV5A 2HK1A 3IGHX 4ZE5A 1YXCA 1DJQA 3QPEA 5T9BG 4F0LA 4ZOEA 2D3NA 3LK6A 4QRNA 1WUFA 1LRTA 1TREA 3GNRA 1E0TA 2H8ZA 1KKRA 3FDGA 1NDYA 2BFGA 1RSCA 3VKAA 1GZ1A 3VU2A 5FAJA 1VB9A 1VJSA 2VEIA 1KM1A 1Q13A 5B80A 2J7EA 4JYFA 4C6JA 1FWIC 4MIMA 4M0XA 3B4YA 4DVOA 2FVKA 1R3YA 4UTJA 1TV7A 5E09A 1OD8A 3TIMA 5FA5A 2WZMA 1YPIA 4C5YA 3W1AA 3UYIA 4LC6A 3DFQA 4LAKA 1IEQA 5FIPA 3BAXA 4DLMA 3H2OA 2AKMA 1IHIA 4OGZA 3BLFA 4JYDA 2DT2A 1XBVA 3EXSA 1KQZA 1BKHA 1S5WA 3FA5A 3B9NA 3ZVHA 1OIFA 3ITLA 4IL2A 3CTLA 2NVDA 4GZJA 4DBEA 4OV4A 5FEPA 1ZBKA 5F2IA 1KLYA 4IQEA 3TAOA 3SM0A 4F3HA 2EF9A 4V1YA 4D9PA 5HWMA 3PWGA 4PMYA 5CPNA 1GVFA 3WLLA 2GLKA 5CAKA 4IWWA 4Y8EA 1TPH1 3T6CA 1UR9A 3VGDA 4PYSA 3A4AA 1B54A 1WZAA 2V38A 3WNKA 1GPWA 5DXYA 4Q7BA 1UP0A 2J88A 4GBUA 2O4MA 3H2CA 3WQFA 2CITA 3FIGA 3TMLA 1EIXA 4TVCA 4OOZA 2WHMA 1QRQA 3HQ1A 4AWTA 4CQBA 1FWCC 2RHGA 2GDQA 3IUDA 4GNVA 4K1GA 3GH5A 2QAFA 2R1MA 4JTSA 4H8HA 2NWSA 4I90A 3R25A 1GEQA 3WF4A 2X8RA 3KBJA 1GPFA 1VYSX 2VDIA 3GRIA 5D2TA 3S2JA 1XGDA 4C1NA 1Z9AA 4M7SA 4DM2A 2FDMA 3C0JA 4RL3A 3RPTA 4H6RA 4PUNA 5C71A 2VP8A 4DLFA 3NCOA 5I23A 3OPSA 4LYPA 3MCMA 1BWVA 4WXZA 3DC8A 1N55A 4LCRA 1W54A 3BAYA 3CJPA 4JQ2A 1UD3A 2A6NA 1WUEA 4NQ1A 2WMFA 1XIGA 4QG8A 3EA1A 5EBUA 3GVQA 3WQ4A 1XLGA 5BOOA 1W6TA 2BG5A 4AW7A 3WNMA 6REQB 4LYRA 3UGRA 4AIEA 4RKAA 3MVTA 4X61A 3WLHA 5I3JA 1K8CA 4J2MA 4UNIA 5TF0A 2IXUA 3GBEA 2TODA 1GONA 1J0YA 1MNZA 3G18A 2FH8A 1W1A1 4B5WA 3M0HA 3MUIA 1DWIM 3PN8A 1H0IA 1R9ZA 2AAMA 5CPLA 3SCTA 2EHHA 4W87A 3CPGA 5C9WA 1DWGM 2IQDA 3B9EA 3PPHA 3ZT6A 4KH2A 2R1LA 3L4WA 3PBYA 4GY1A 4UTLA 4F40A 2HROA 4LRSA 2TSYA 1A5NC 1AD4A 3R5EA 4JQAA 1BEUA 2E9BA 1H2JA 1O5QA 1UWRA 1WOAA 2D23A 3ZIZA 1J8VA 2HZGA 3QYQA 4DJED 1W0MA 1GQKA 3A64A 4HMCA 2XN1A 3DERA 1D3CA 4D72A 3TTSA 2IMRA 5M5DA 5AYZA 2BY1A 1WYIA 4CEXC 5GNXA 4EAMA 3M5YA 3B0UX 4UC5A 4OTKA 1PAMA 3THAA 3MA8A 2OFJA 2WC3A 1T6MA 2GUUA 2OCZA 3IRSA 2V9DA 4GI9A 4RDZA 2J47A 4PCTA 4Y8FA 1LF1A 2ZOXA 4AMAA 2FTYA 2PDPA 5KZMA 3CBWA 1ONXA 4R27A 4PTWA 1XYBA 1AQFA 4GIEA 4MKNA 1PV8A 5DXXA 3UZYA 4A3HA 2V2CA 4QJ3B 3ALFA 2E8ZA 3MB9A 5IHSA 4H2CA 3ZT5A 3N14A 4Z2HA 5HMSA 3SY8A 4ZO8A 4HVXA 1T8XA 1QVBA 1YDYA 1KXVA 4FOJA 3FA3A 4E3TA 4Q4PA 5CZTA 3ES7A 2BHZA 4IXHA 3WLKX 3WD1A 4M3PA 3S4TA 5SWUA 3OVQA 1BLIA 4LY8A 3W28A 2PWHA 3ICJA 1SYTA 4U2YA 3H2MA 1M3UA 2I5QA 2VC6A 4XD4A 2W79A 1C92A 1A3HA 3T2PA 1CLXA 4D6IA 4ROPA 3L0GA 1QPRA 3UJ2A 2EXOA 3SCRA 3STPA 3QV9A 1EA0A 4UCGA 1G5AA 3ABOA 4RW5A 4JTUA 2DVXA 3ZLGA 5J5DA 4JX5A 3GYEA 4NZFA 3QR3A 1US0A 5F4XA 3QMTA 3QJAA 1NARA 5MKGB 3BURA 1FWEC 3MHGA 2CBJA 1JYWA 1EF3A 3GWQA 3MWCA 2ZDSA 5F4WA 4AD4A 1IR2A 4CQ8A 1C7SA 3SGUA 1VLWA 3V5CA 4BR1A 1MFVA 1GTEA 3NQBA 3L4ZA 3KRSA 1A3WA 3RYSA 1MYRA 5EMYA 1OCNA 2JEPA 4IMDA 2Q8ZA 3EDKA 4PB3A 4IX0A 2J7FA 4UFKA 3CEUA 3EPMA 4CCCA 3DESA 5IFTA 3PZOA 3V75A 2A85A 3VIHA 4QAIA 2I14A 2H8XA 2J4GA 3R6IA 1N7KA 4BI7A 2VVSA 1E6NA 2QNEA 3LCFA 4JTQA 3IIZA 5I02A 4KIRA 3I7RA 1TPWA 4DBDA 3N9KA 4XZHA 5D2WA 3C2EA 1LQAA 3M0XA 1R2RA 4O8AA 3HJZA 3P80A 3RNDA 1TWIA 2DZWA 4O52A 3VNKA 4DUVA 4X22A 2HS6A 3V0TA 2E7FA 2E8YA 3HG2A 2NQJA 3B8SA 1PJ9A 4HCDA 4O0ZA 3NA8A 5M3WA 1R30A 5I07A 4M7TA 1TUXA 4HNOA 2ZX8A 4BEQA 1F3EA 2CKSA 1EOKA 3UWEA 3BGJA 4FNPA 2UV8G 3WNPA 2YXOA 3RFAA 2Z7KA 3VNIA 2F38A 2QHAA 2YCLB 3MYOA 5FL0A 4MUPA 2NWRA 5DFAA 4FF5A 5EMMA 3COTA 2V81A 1QJWA 3H7RA 3WNLA 3W01A 5HJLA 4H9TA 3C0LA 2GGHA 3UP8A 3CAWA 4B9ZA 5LHEA 1XINA 1PZ3A 2IS7A 5KZ6A 1UPPA 4GUIA 1JULA 4H7ZA 2PB1A 1QT1A 3F4WA 1T7LA 1ZAHA 3KBVA 4JY8A 3BQ5A 1V7AA 3CM4A 1ISYA 3C4UA 3F2DA 2OZ8A 3RJYA 2WSPA 3A22A 1RQEA 2FQIA 4BHYA 1CGUA 3SJ3A 2QCEA 4Q22A 1RA0A 2HVMA 1TJRA 3W9ZA 3OGSA 2ZVRA 4IPJA 4MVAA 3UGVA 1EGZA 3IUIA 1FFQA 4MY1A 4Y9AA 4Q8NA 2Y89A 1DJIA 3IV3A 4AUBA 3GYCA 3GH4A 2OLHA 2PDCA 1O5XA 5A6MA 3QQ1A 3S9IA 3OHIA 4MJZA 3OGRA 3DI1A 3CWOX 4ZQMA 4HK5A 3SN4A 2PDBA 1XLEA 4M1BA 4GISA 3GUGA 4LBUA 2PD5A 5BRQA 3MC5A 3F1QA 1WBJA 4RNIA 3WJSA 2QLYA 4U2ZA 4FLRA 1AZ1A 2D3LA 3LERA 3ZLFA 3BJSA 1ZJHA 3H7VA 4GYPA 5LYRA 3IGXA 3IJLA 3LLFA 4J4KA 2WWDA 3MPGA 4N42A 1KQYA 1UR8A 1VYRA 5DEZA 3STGA 4MKVA 1E70M 2AL2A 2XSXA 2QGHA 1UA3A 4Y9PA 1GVQA 3B06A 1FY6A 2NX3A 1TB3A 2CZVA 2GK1A 3LD5A 2BOEX 1DJYA 4JTAA 2W92A 1JCXA 3UQNA 5D03A 1P1XA 1H7PA 3AHZA 1TJ1A 2WANA 3S5ZA 5DT5A 3PBGA 1UROA 4M56A 4DUXA 3SB0A 1W9BM 3VKCA 1FWFC 4TX6A 1HL2A 4X3ZA 2HBXA 1E0UA 3M0JA 1YTKA 4D71A 5EMKA 4UQEA 4WGXA 1RLDA 2VZTA 3D46A 3AS0A 4DM1A 2OT0A 1OSEA 3TC6A 2QYGA 2Y5EA 1E15A 2VMFA 2W4XA 4GX9A 4KBXA 3EWXA 2BP1A 3QLLA 2QCDA 1GOQA 3UYCA 1VF8A 2Q3RA 4MOZA 4P5UA 4FNTA 5EPDA 5CPSA 5A6AA 1O12A 3SJNA 1W3HA 5CCZA 5LGZA 4LF2A 5K7JA 4YTQA 4GO8A 1QBBA 5CLWA 3G6MA 3K8KA 3W1NA 1BQGA 3GIPA 3FXYA 2FGLA