5CPSA

Disproportionating enzyme 1 from arabidopsis - maltotriose soak
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 185
structure length 517
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cpsA01
1E6PA 3F4VA 4AZ7A 4PMOA 2Y5EA 3N17A 1OIFA 2VUYA 1G9HA 2J74A 1HX0A 2E9LA 1W2VA 3I3DA 3T08A 1VJZA 4W87A 3O2LA 4CCDA 2EJ1A 1EOKA 5HXMA 1Q6DA 4LPCA 3CZJA 2CETA 4QCFA 1CGVA 2G3MA 2XVNA 3CZKA 4UFIA 2VNCA 2C8NA 1QI5A 4UQAA 4Y7EA 5HDRA 5M17A 4GZIA 1WCGA 4F79A 1BF2A 1UWSA 4UR9A 1U30A 4M8UA 1V0KA 1ISWA 3PZTA 3ZT6A 2G8ZA 4FK9A 2YKKA 3AYRA 2J7FA 3MU7A 3WMBA 1DTUA 2XGBA 1ZU8A 3A4XA 3NCOA 2A3BA 4W5ZA 4U33A 1W1PA 5JBEA 1AQHA 1TUXA 3WH6A 1UR2A 2A3HA 4MAVA 3N1AA 1ITXA 1J0YA 3PZIA 5EFDA 3KL0A 3D3AA 1MWOA 3SUTA 4MNKA 3F5KA 1B90A 4OOUA 4JKLA 1QHPA 3GBDA 1FP9A 3M7SA 4TVUA 1NWRA 3BLPX 4KGJA 1HJSA 3FHAA 1JYXA 1V08A 3MANA 1WP6A 2VC9A 2X0HA 4MJ4A 2X09A 4J3SA 2WVVA 3WF0A 4HZ8A 4BCEA 4P8WA 2XUCA 3CBWA 2ZWYA 3UG4A 1JDCA 3KL5A 3WNKA 3WNPA 4EANA 2WANA 4JFTA 1RPKA 3VIGA 3PZQA 3SUVA 2AOSA 2QPSA 1H41A 2WZEA 1I1WA 1JL8A 3WD0A 1US3A 2X0YA 2D2OA 5GNZA 3J7HA 2PWHA 5E9AA 4GI9A 1ISZA 2J7GA 2W61A 2XSBA 5FCZA 1ESWA 1HN1A 3MKKA 4PMVA 1WE5A 1B3VA 1C8YA 5A6MA 3U7BA 2BVTA 5CXPA 1AQMA 5C70A 3AS0A 3IJ9A 2WW5A 3S2CA 3CHEA 1B2YA 1E6SM 4PYSA 1JF6A 2VO5A 4L4OA 3VM5A 4UZSA 1XCWA 5GNXA 1MW1A 1JFXA 4B3LA 1H09A 1UWUA 3VVGA 4CU7A 1V6UA 5DFAA 1GQKA 1MFUA 4FLQA 2OWCA 4KRUA 4ZFMA 3JUGA 1JGIA 4MNLA 3WENA 1E72M 2CIPA 4L4PA 2VZSA 4P7OA 5HNNA 3ARQA 1MW3A 4GO8A 3NDZA 2WKLA 3W29A 1Q6FA 1CIUA 4PMXA 2XJ7A 4UQCA 1W9XA 4W5UA 1KQZA 4AZ5A 2GK1B 1E0VA 2G3IA 2UWFA 1BLIA 2J7EA 4E2OA 1QI3A 3ARUA 3L4TA 3RMEA 8CGTA 1CXIA 2PC8A 3BAWA 4GO9A 4W7VA 4QAWA 5A6SA 5LYRA 3WUGA 3W25A 5AC5A 2FH6A 2DQXA 3BXWA 4V27A 2BV9A 1WDPA 1J10A 2V3GA 4AIUA 3ARSA 4C7DA 3SUUA 4Z2GA 1VBRA 1VEOA 1LWHA 4AZGA 4FLRA 3CUHA 1V0NA 3CUIA 2XPKA 3WNLA 3GXIA 2V3DA 3AS3A 1CEOA 4AZIA 4RL3A 3WFLA 5A6BA 1QNPA 1EDQA 3MMWA 3LPFA 1J0KA 2ZE0A 3WUFA 1J12A 2X8RA 3L4ZA 2NT0A 1CLVA 2YDSA 5CPSA 2WVSA 5JBDA 3WMCA 3UR8A 4GI6A 4HTYA 1VRXA 2GJPA 1PZ2A 3W28A 5D4YA 3VOCA 2EPNA 4U5IA 1H5VA 2VMFA 1KXHA 4P7LA 3W53A 4JHZA 2BY0A 4AMCA 4CKQA 4U2YA 4AW7A 1B0IA 1E6RA 1WDSA 2A3CA 2Y8KA 4MADA 3VNZA 2EQDA 4M80A 1CPUA 2J7HA 3PZOA 4CN4A 2XFRA 4B3KA 4UOZA 2E8YA 2DSKA 1FHDA 1PBGA 1W9VA 3CZEA 3VGHA 2WM0A 2PWEA 3HU7A 4PTMA 1HL9A 1JD9A 2YBUA 2C0HA 4NI3A 4HOXA 4MDOA 3QOMA 1XRVA 1UYQA 1NOUA 1W91A 3ZIZA 1UWRA 1UR0A 1GQIA 3WIJA 3BH4A 2BVDA 3TP4A 3CHFA 1VIWA 3W82A 1V02E 2DSUA 2YLLA 3WSUA 1HT6A 4D6CA 4CN6A 4CD4A 1B3WA 4BZYA 1DWHM 2Y8VA 2Y24A 1UWIA 1HF6A 1JZ6A 4W7WA 3WEZA 4C7GA 4XV0A 5CZKA 1UD4A 3GZAA 5A2AA 2AAAA 2C7FA 3B8SA 1QBAA 1UR1A 1OT1A 3PTKA 1NP0A 1OT2A 3ARVA 4HA3A 3FAWA 3IJ7A 1GQLA 3L2LA 1Q6EA 1UA3A 4UNIA 1RP9A 3QR3A 4GPNA 3SCSA 1BVNP 2EPLX 1SYTA 3BLKA 1D7FA 5I3DA 6A3HA 2J8FA 2G3NA 5ABFA 1UG6A 1UKSA 3WY1A 1XYZA 4MB1A 5A6AA 1GJWA 3A3HA 1C7SA 3ARYA 1LLOA 2ZUSA 4CD5A 1G1YA 4YN5A 3I3EA 4PSPA 1K9FA 2DH3A 2DSZA 1HNYA 3MUY1 4WKAA 3W26A 1HVQA 4UFLA 1PIGA 1OD8A 2OSXA 3SUWA 5CG0A 5ABFB 5I77A 2X2YA 1G94A 1WZKA 1H1NA 2WSPA 2ZUNA 5I79A 4DM2A 1MXDA 1Y7VA 5TD4A 1E70M 2JIWA 1WZLA 1ISXA 1W3KA 4JKMA 4ATWA 3CGTA 4W7UA 2YDRA 4U5KA 2ZXDA 3AMKA 1W3HA 1DHKA 4TX8A 5BCAA 3M6DA 4B9ZA 3SCTA 4PSRA 1JG9A 2ZUUA 4S3JA 4D6IA 3PZ9A 5IFTA 2J75A 1JYWA 4BQ2A 1K9TA 2FHFA 3CTTA 2Q8XA 1GPFA 1VEMA 2WLZA 1E0WA 3VINA 4BS0A 2VZTA 3N04A 4D1IA 3IAPA 5M03A 1BG4A 1E4NA 4IPLA 4Z2KA 1JI1A 2J7CA 3L4UA 4XZBA 4PMUA 4PMDA 2VRQA 1QW8A 3QGVA 4AD2A 3GBEA 3W6MA 1V3KA 1ISYA 2CKSA 2ZUMA 4JAWA 4PMNA 2PBGA 2GSJA 3SCRA 4X0VA 1KCKA 1HKKA 4JKKA 2D24A 2YDQA 4JCLA 3BGAA 3AHXA 1ZBCA 3WEMA 4ACYA 4OBSA 3W81A 3TA9A 3VGGA 1YHTA 3PTQA 4HOZA 4AISA 1QPKA 1KBKA 1E4MM 1TCMA 3KL3A 1H49A 1BGAA 3K46A 1B30A 1E6NA 1V6XA 4W85A 1U2YA 1HIZA 4GXPA 4UOJA 1G5AA 1ITCA 2GDVA 2WCAA 4XZWA 3AIBA 3WQWA 4AD3A 2F8QA 4D6JA 1BYBA 3WDPP 2XWEA 3TONA 4U3CA 3WQ4A 3W24A 3TTOA 1VENA 1GQJA 1OGBA 3AZTA 1QI0A 3OLGA 3VIJA 4HZ6A 3T0DA 1EO5A 1CYGA 4LGXA 4AEFA 1E5NA 1DP0A 3M46A 1EDGA 3ECQA 1UQYA 2VZUA 4RE4A 3ZR5A 4AZCA 1V6VA 2WC4A 2V5DA 3WQ5A 2BY2A 4W89A 1KBBA 3FN9A 1JZ3A 4W8BA 3AIQA 3QHMA 3OG2A 2DT2A 1NWTA 3S6TA 4J3WA 4AYSA 1IZJA 1V6WA 1CGXA 3TOPA 3BSHA 3K1DA 3VDCA 5I24A 2JALA 4WJXA 3SEPA 4Q7NA 4UFJA 2WVTA 2ZXBA 2GVYA 2OSWA 1RP8A 1XSJA 1E3XA 4W93A 4Z2LA 1GVYA 4M82A 5BXTA 1FFRA 1J0HA 5CSUA 3W6LA 5A6LA 1MFVA 2WZIA 4RE3A 3UEQA 3MV11 1FH9A 2WMGA 4F9DA 1I1XA 2F61A 4P8XA 4HPHA 3NSNA 2WSKA 1XH0A 2JFEX 1MYRA 1ZJAA 1GNXA 3O9NA 5AYBA 1HXJA 2D22A 2DT0A 4UQ9A 3VGDA 1PEZA 4CVUA 3L4WA 2QMKA 3L4YA 5D9MA 1UA7A 4HU8A 4DUXA 1OGSA 2EO7A 2BS9A 2WHMA 3AQUA 1EH9A 4ZE4A 3UERA 4F9JA 5GNYA 4DM1A 1W1TA 3WH9A 1EDTA 1W3LA 5ABHA 4NRSA 5BRPA 1K9EA 2BHUA 3ALGA 3SUSA 2GJRA 3EDDA 3NUKA 3CHCA 1DEDA 2W66A 2VQUA 2HISA 1X6LA 5HOSA 1BYAA 4ACZA 1Z32X 4M29A 3PZNA 3VD7A 4D6GA 2E9MA 1LL7A 4GKLA 2ZX5A 2FGZA 2G4FA 4TTUA 4ATLA 4AY1A 1MVYA 2J4GA 2DPEA 1CWYA 4PEEA 3KZSA 1DWFM 1TZ7A 4DWSA 2CNCA 2WKGA 2PI6A 3L2MA 3PZGA 5DEZA 2Y4SA 1H0GA 4PMRA 3VDAA 2XYLA 1X1NA 3AMDA 2CHNA 1J9YA 3II1A 3TTQA 3F5JA 1M7XA 4QLJA 1J18A 1W1VA 3AMCA 3DHUA 4H2CA 2WHLA 1GJUA 4GQQA 2WVVB 3MS8A 1WDQA 3CMJA 2PWFA 2A3AA 4PUEA 1E6XM 1TA3A 1QI4A 1EOMA 1JAEA 3WD4A 3WQ6A 2J47A 5A6BD 1ZJBA 3W0KA 3GH5A 1HJWA 5DF0A 3WMSA 2IUZA 1EHNA 4J7RA 4QDMA 1C91A 5M5DA 4JL1A 2W63A 5BXSA 2JIEA 4M56A 2VCAA 1UH3A 4TX6A 2CBUA 2CYGA 2EPOA 7A3HA 4CCEA 5IFPA 5AYIA 1ZL1A 3ZT5A 1UD3A 1OB0A 1CGYA 1GOKA 4CUCA 1QHZA 1J0ZA 4GI8A 4AEEA 5BROA 5A8PA 1QNRA 3QHOA 3OB8A 3OLIA 2XFYA 2PB1A 3VDBA 3VMOA 1V3HA 1QNOA 4UQBA 2WMFA 4HMDA 5CJ5A 5A1AA 4KRTA 2BHYA 3MUAA 2BHZA 2XM1A 2E4TA 2ZUWA 3VGEA 4P7QA 3WKZA 3DECA 4AC1X 2XIBA 4H8UA 1V3IA 1I75A 3THDA 1DWAM 1V03A 2J25A 1CDGA 2O9OA 4KGLA 1ZBKA 3ARTA 5CQ1A 2WMJA 3B9EA 3VTRA 5CLWA 1XH2A 2CITA 4JZ5A 3ZM8A 5I0DA 3PN8A 1RH9A 2CESA 2YL9A 2D0HA 1JZ4A 4P7RA 1W3JA 3K4DA 4W84A 3RJYA 4YPJA 1BQCA 5E0CA 3WDQA 3BAYA 1PIFA 1V3MA 2J78A 3POCA 3CZ8A 5A8NA 5FL0A 4WKFA 2QMJA 2D23A 1LJYA 4OOZA 3VIIA 4PTVA 5IHSA 2OWXA 5A95A 3RPMA 1C8QA 5A2CA 5E0FA 3WDIA 3BCDA 3AISA 2RGLA 2DSWA 3GDBA 1KB3A 5CLTA 4IM4A 3MSDA 4TVDA 5C8BB 1NOFA 2WC7A 3M07A 1B3YA 2WVUA 1M01A 1CGTA 3AXIA 5F7UA 2A3EA 1A47A 1US2A 2WZHA 3AHYA 1UUQA 3WL0A 1EO7A 1GOIA 2WBGA 4KWUA 4W8LA 4A4AA 4M81A 1UD2A 3DYMA 5CGMA 2WK2A 1GW1A 2CERA 3AI0A 2YL8A 3VD3A 2ZIDA 1BPLB 1NWSA 2VZVA 1B1YA 3U5YA 1UD6A 2XVPA 1E9LA 2Y2WA 3UETA 3WELA 5E6ZA 2X05A 3BCFA 3VIKA 4HMEA 1HKMA 3HN3A 4R5EA 3VGFA 4AD1A 1GOMA 4QCEA 2E9BA 2NW0A 2D20A 2VX5A 2W92A 1TVNA 3SCQA 4JCMA 1GONA 1C92A 3ZSSA 1NARA 3LPGA 1GZJA 3ZMRA 5A94A 1E6ZA 4B9YA 4HU0A 3SURA 4MTVA 4UTFA 1WO2A 4LXFA 4URIA 2VRKA 2QLYA 4U3AA 4AD5A 1BYDA 1XV8A 2E40A 4BA0A 3VILA 1NQ6A 3EYPA 1WDRA 1UKTA 3VPLA 4CVWA 1VFMA 3BMVA 3AMLA 4BQ5A 4B16A 1OINA 3AYSA 5EBAA 5JUVA 2J8GA 3APGA 5A3HA 1FH7A 1GCYA 4H41A 1SMDA 1XYFA 2HVMA 2BXYA 4EKJA 1BTCA 3AHTA 3EMZA 4E8CA 4X9YA 4ZE5A 2QF8A 5KEZA 3W37A 5ABGA 4MNJA 2OYMA 1UKOA 1E1FA 2G41A 3MMDA 5I2UA 1DWJM 2W5FA 1NM9A 3T2QA 5HBFA 3AICA 3WH7A 2DT3A 4H8VA 1R86A 5GPRA 1G0CA 2VVSA 3BAKA 3EDFA 3WFZA 1PAMA 3WUEA 2UY5A 5EFFA 1H3GA 2W67A 1UQZA 4RE2A 3UESA 3ZQ9A 1D3CA 4JFSA 3RM8A 1TFVA 1XD1A 2WHKA 4XUYA 4MB4A 5I23A 1V0LA 3QOKA 4GIAA 2WPGA 3DHPA 4IPNB 2IXUA 2WBKA 1W9BM 5BWFA 1HJVA 6TAAA 4XB3A 3D5HA 1UZ1A 2DIEA 5A2BA 4TOQA 5DT7A 4J3VA 1V02A 3U7VA 1JXJA 3LPPA 3WNMA 2BVYA 4UFMA 2WCGA 4F8XA 1E73M 3PBGA 2VRJA 2VTFA 3VD5A 1TG7A 2YIHA 4HZ7A 3VIFA 8A3HA 2VT0A 3AS1A 2D0FA 1UH4A 3OZPA 3AXHA 5LA2A 1IZKA 1PPIA 3OA5A 2WB5A 4HA4A 1TMQA 1FP8A 2VR4A 1NH6A 1E55A 1ODZA 1ZB5A 2ZWZA 3A6OA 1E71M 2WLYA 1YQ2A 2PF0A 4QLKA 5HPCA 3NYDA 3N15A 3AIVA 3VKKA 3PZMA 3VX1A 5A69A 4N42A 1W9DM 3AIUA 1E43A 1F4HA 4CD6A 3FHQA 2DSVA 1F4AA 4P8UA 4UFKA 4D6DA 4HOWA 2XM2A 5I6SA 4E8DA 3G6LA 3IAQA 1VFOA 4CGTA 4EAMA 2OYKA 1QBBA 2WHJA 4FLSA 1OSEA 3NSXA 3WBAA 5BRQA 1X6NA 1MQRA 1M53A 1QHOA 3RM9A 1QOXA 1UWTA 4KH2A 1V3LA 2V3EA 4PMZA 3RJXA 2CPUA 3VMNA 4FLOA 4JHOA 1C90A 3OBAA 3ZT7A 2OSYA 3IJ8A 4DWSD 2XVGA 1CXHA 4PMQA 1UWQA 1KR0A 4MB3A 2WC3A 3GH4A 1JZ7A 4OUEA 1W9PA 3OGSA 4ML4A 5EMYA 2F2HA 3A47A 1FH8A 3VDHA 1U33A 4F66A 5HPOA 1JNEA 5D9NA 4WSJA 3MUIA 2YL5A 1LL4A 2WXDM 2XWDA 2QV4A 4AZ6A 1CENA 1GOWA 2UY4A 2XSAA 4A3HA 1ZBVA 2VR5A 2GFTA 3VD4A 2J77A 2VL4A 2WAGA 3GXFA 2CBIA 4YHEA 2YL6A 2ESCA 3WF1A 1WAWA 4Z2HA 1JNDA 1SMAA 5A8MA 1B3XA 3EDJA 4D71A 5DO8A 3SIMA 4AZCB 2Z1SA 1SFSA 3RDKA 1HL8A 2XG9A 3CUJA 3SCNA 1CZ1A 2ZUVA 3FXYA 3L4VA 3NIYA 1ZS2A 3WEOA 1CNVA 4BF7A 3VIHA 3AJ7A 3N18A 1JAKA 2NT1A 4D72A 7CGTA 1KR1A 3CUFA 4AZHA 5M3WA 3FW6A 5CPQA 3N9KA 1BVZA 1GOQA 3O6AA 4AIOA 2EBNA 4H7VA 1CXKA 4TTGA 1D2KA 1QVBA 1ODUA 4R27A 4ATDA 2WMIA 1LG2A 1EA9C 1ZBWA 4JFVA 4OIFA 4AD0A 4UZUA 3LMYA 3F5LA 1JDAA 4QLLA 2CKRA 5CPTA 3ZOAA 1JYNA 3KEHA 4PBGA 2WWDA 3IK2A 4AXNA 3NSMA 4LYRA 1JZ5A 3WDJA 1H11A 2E8ZA 1TE1A 2E0PA 2OYLA 2J7DA 3K8KA 1L0PA 1NOWA 2BXZA 2WMIB 1XH1A 2OWWA 1E5JA 3EMCA 4J3XA 4EE9A 4B15A 3VNYA 2DDXA 2VI0A 1KGUA 2VQTA 4HMCA 1UD5A 4HA1A 3WF3A 4PCTA 2ZX6A 1CGUA 2JE8A 1H0IA 4Z2JA 2XGIA 3PTMA 3BAXA 3TTYA 4UCFA 4ACZB 3T0BA 1GUVA 1H2JA 1GHRA 3WDRA 4C7FA 4LYQA 1AVAA 1XSKA 4JL2A 3GNPA 4LQ1A 1VBUA 2WWCA 5D8ZA 1MXGA 5A8OA 4ZXLA 2XHYA 1WKYA 5E70A 2UY2A 4PN2A 3WQVA 4D6HA 2X1IA 5D9PA 2VCCA 4MPKA 2GDUA 4DWSB 5IXEA 3VIMA 1R8LA 1WZMA 4WLCA 5GQBA 3RCNA 4HP5A 3AZRA 1R7AA 4AIEA 2Z1KA 1CXLA 2CHOA 1KXVA 2VURA 1KXTA 5ECUA 4OKDA 3K8MA 1QI2A 3BSGA 9CGTA 4PTXA 3SCOA 4JFUA 4K68A 3CO4A 1CBGA 1CLXA 2TAAA 1FFQA 3AROA 1B9ZA 1E15A 2FGLA 1KGXA 2YOCA 1HKIA 3AZSA 4NF7A 1EXPA 1J11A 5AY7A 4OZOA 2W62A 4PCSA 2XTKA 3IANA 1MW0A 1TA3B 3T0AA 1JZ2A 1MQPA 4JFWA 4A3YA 3U57A 1OCQA 1PX4A 3UG3A 1K9DA 4GINA 1GOOA 1N82A 3OLDA 3MSGA 3GNRA 1UZ4A 2W4XA 3GM8A 4NZCA 3VO0A 2D0GA 5CSYA 1GORA 1O7AA 4EK7A 5D9OA 1R87A 3RILA 1G01A 4U31A 3WUBA 2CCRA 3WL1A 4KMQA 1W1YA 4J3UA 1OWQA 4GZEA 1GVIA 2ZXAA 1BGGA 3RO8A 3WN6A 3AIWA 2WCSA 1KXQA 2GK1A 1PX3A 2G3JA 2VJXA 1BSIA 3EMQA 1HVXA 3SCPA 1UKQA 4ZENA 3WQ8A 2D3NA 4WF7A 1AMYA 1PX8A 5LA1A 3I3BA 1V6YA 1CTNA 1JI2A 2XVKA 2J62A 3EDEA 2E3ZA 1FA2A 4FMVA 1NWUA 4WKHA 1P6WA 2B31A 2QPUA 2JEPA 3GNOA 1AQ0A 1EQPA 3ALFA 1XHGA 3FY1A 4D1JA 2EPMX 4W88A 4YHGA 3SCUA 2DEPA 3EBVA 3ZJ8A 1K6AA 1KCLA 3N13A 3T2OA 3ARZA 4PUDA 1WPCA 3GYCA 1KWGA 4D6FA 3N12A 3AMGA 2WMKA 2J79A 4LYPA 2GUYA 1LF1A 3VGBA 2J7BA 2BY1A 5CGTA 3WH8A 1HP4A 5JIPA 5D8WA 1DWIM 2FH8A 4CD7A 5DMYA 2ZXQA 4JIEA 4U2ZA 4AZBA 3EDKA 1JF5A 1A3HA 1XC6A 3ZJ7A 5I78A 2YA2A 3WD3A 1CECA 1CXFA 3DC0A 3WD2A 1S46A 3ARRA 3U5UA 1Q6CA 2W91A 1EQCA 2O9PA 2BY3A 2PWDA 2V3FA 4Z2IA 3OZOA 1EGZA 2O92A 2BFGA 3VIOA 1OIMA 4BQ3A 2GJXA 3VMPA 4P7NA 4PTWA 3WD1A 2DH2A 2ZICA 1E56A 4H8HA 1W9UA 4IISA 4J27A 4HPGA 1WNOA 2V38A 3SCWA 4PMYA 1XD0A 4UOQA 1LWJA 2UY3A 2YLAA 2JF6A 1QNQA 5C71A 5A6KA 1OM0A 1BHGA 2JEQA 4ZEPA 4CD8A 1MQQA 3W4RA 4N0RA 1HJXA 1VF8A 4WK9A 3OGVA 3WNNA 4IUGA 2DIJA 2GJXB 4UQEA 2XIIA 1DWGM 4AWEA 3CZLA 4MNMA 3CZGA 3RIKA 3A4WA 1WZAA 3VUPA 3VIPA 4ZXOA 2FHBA 1O6IA 1M04A 4QFUA 3GXDA 3AIEA 3G6MA 4Q22A 1TR1A 3FAXA 3AXXA 2YA1A 4CU8A 2FDMA 2D1ZA 2XVLA 3POHA 5FOOA 3NJ3A 3ARWA 1XSIA 3OLEA 1IV8A 1VAHA 1C7TA 1NP2A 2EPKX 1BFNA 3WBEA 3VX0A 3CHDA 4FF5A 3VM7A 3LPOA 1JFHA 3CPUA 1VJSA 3NDYA 3GXMA 1BYCA 1R7OA 5BXPA 1JIBA 2VX6A 3KE0A 3WNOA 4CN1A 5LA0A 5IHRA 1B31A 1BG9A 1JD7A 1UH2A 1ECEA 1LQ0A 3K4AA 2VX4A 4J3TA 4DWSC 5ABEA 1JYVA 1Q6GA 4QP0A 2WNWA 3PZUA 1QNSA 3B9AA 3RM4A 3CMGA 3CLWA 2RGMA 1UR4A 1SR0A 5FD0A 4X0NA 1CGWA 3ZJ6A 3L4XA 2WYSA 2VCBA 1XCXA 3GH7A 4MB5A 2VOTA 3ZO9A 3BMWA 2JF7A 3DYOA 3ARPA 2D3LA 4OBRA 1E0XA 1FOBA 1E4IA 1UD8A 1M03A 4TXEA 3THCA 4V2XA 5JBFA 2DGAA 4WIWA 2PWGA 3AIRA 3WF2A 2EXOA 5EB8A 3ZR6A 1KFWA 4NRRA 1J0JA 1FHLA 4P8VA 2NSXA 1XGZA 3W27A 1L8NA 5E09A 4GQRA 3A4AA 1E1EA 3FNDA 4MDPA 4TVCA 3MO4A 2VVNA 5KZ6A 4UFHA 3WF4A 2CEQA 1C3FA 1UHVA 5FKYA 1C93A 1HJQA 2CXGA 2QHAA 2ZX7A 3AS2A 1ISVA 4GZJA 1MW2A 4V28A 1UOKA 5E6YA 2O9TA 1OD0A 4CCCA 1J01A 7TAAA 1E3ZA 3DYPA 4CU6A 1BAGA 1HP5A 2MANA 6CGTA 1QW9A 3VD9A 4XX6A 1W2PA 3T2PA 4DUVA 2CBJA 4S3KA 3MMUA 3W38A 2ZOXA 2O9RA 4W8AA 2ZUTA 1IT0A 2DT1A 3HMCA 4LX4A 1J0IA 3KWXA 2VZOA 5FL1A 1KQYA 4E4PA 2YA0A 3OGRA 3CIVA 3UG5A 2ZX8A 2ZX9A 2YBTA 4W86A 1HJUA 2WMHA 4DUWA 1EIBA 4UQDA 3UR7A 1VEPA 3MUZ1 5AC4A 3N11A 4MJ2A 1VFFA 2FHCA 5I5RA 1Q4NX 1VFUA 5A6JA 1KWKA 2AMGA 2V5CA 3ZSTA 3MV01 1EHAA 2YJQA 1JZ8A 1R85A 1JXKA 2OLHA 3PZVA 4H04A 2CBVA 3CUGA 4MAZA 3HJEA 5JIWA 1TVPA 3AHVA 1HKJA 3B9DA 3AHZA 4D6EA 5DT5A 1H4PA 1V0MA 3CH9A 1UR8A 4TUFA 2IXVA 5BYWA 3ARXA 1B3ZA 1E40A 1C8XA 1E4LA 1CXEA 4WSKA 3BAIA 4PRWA 1KGWA 1RD6A 3PHAA 4M24A 3TTSA 3K8LA 5IDIA 1OBAA 4J28A 4AD4A 3OIHA 4M1RA 3WDHA 1WB0A 1VB9A 3QHNA 4OJYA 5FIPA 3VU2A 1V3JA 4NSBA 5BXRA 1UR9A 4BQ4A 3WH5A 1JDDA 1LG1A 2EEXA 3AOFA 1E6QM 2BNJA 3ZJKA 3SCVA 1PJ9A 3E1F1 2VX7A 3BC9A 5A8QA 3T09A 2XFFA 1GHSA 1W32A 2PBOA 1LL6A 3BAJA 1OGGA 3AFBA 3UCQA 1PZ3A 1UKPA 3GTNA
chains in the Genus database with same CATH superfamily
4QSHA 4OE7A 1J5TA 3GKFA 5I02A 3UFYA 2E9LA 1W2VA 3I3DA 2FVMA 1VJZA 3H7VA 4NJIA 1Q6DA 2CETA 4S2CA 1XICA 2G3MA 2XVNA 2VNCA 2C8NA 1QI5A 3WBYA 1RLCL 3N29A 5DANA 3VZXA 4M8UA 3ZT6A 1ADOA 3HG5A 2PEVA 4OTKA 1KKOA 1ZU8A 4AIBA 4DJFC 3S1WA 2NWRA 3B8WA 3T78A 4QJ4B 3BE7A 4MAVA 3H4XA 3P61A 5EFDA 2YCJA 1MWOA 3D3AA 3LXBA 4HJFA 3F5KA 2Z2BA 4OOUA 2EGZA 4GGHA 1FP9A 3M7SA 2Q8ZA 4QNEA 3BLPX 4KGJA 4LVAA 1V08A 1PZ1A 3MANA 1XP3A 3DESA 4GHRA 1V5XA 2WVVA 4O4VA 2GQAA 3WLMA 2CU0A 1B5TA 3BV7A 4HZ8A 2OX4A 1HO4A 1AQFA 4IQEA 4DNMA 3G3DA 1TREA 5CC5A 1S1PA 3QVQA 3WNKA 3WNPA 2QCDA 4RDVA 4EANA 3UWYA 1RXOB 3WJXA 1RPKA 3BLEA 1JJKA 3G8EA 2AOSA 4BF5A 4I9AA 5T8GA 5HMEA 3HPAA 2D2OA 4RV3A 3J7HA 1H7XA 3KP0A 3R0KA 9RUBA 3IPWA 2F2KA 1IT8A 3NG3A 3TXVA 1ISZA 1HKVA 1ESWA 1HN1A 2YPIA 3PP7A 1TVLA 2A4AA 3STPA 4A22A 3R7MA 4Z1BA 4K36A 3W7OA 2XIJA 2BVTA 2V82A 1AQMA 2PDGA 5CXPA 5C70A 2GQ9A 1XQKA 3QRHA 2Y88A 4C5YA 4DXKA 3PB2A 4XZIA 4LB3A 1FWRA 2TPSA 4D2JA 1UP2A 3VM5A 1XIEA 3IGXA 1MW1A 1VZWA 1TPB1 4DF1A 2CZDA 1V6UA 3UPWA 1FWAC 3B40A 1F6PA 3O07A 3NWRA 4KEUA 4KWWA 5C2XA 5HR6A 2VZSA 3H8AA 2J9ZA 3R10A 5HNNA 3ARQA 4GO8A 4DPQA 2WKLA 1TV8A 4Z1DA 1Q6FA 4QQ3A 1PXGA 1CIUA 4JTCA 3VABA 1O68A 2ADAA 3N4AA 2XN1A 1W9XA 4UR7A 2GK1B 3OPSA 1P0NA 1K7FA 3SRHA 1A5MC 1O5XA 3VKAA 3ARUA 1QFEA 4QAWA 4OFCA 2INZA 4E2VA 3MYPA 3GX9A 5LYRA 3WUGA 3W25A 4FNRA 1FCVA 1GK8A 1H7NA 1IWBA 4YIWA 1P4CA 1W8SA 1R47A 2FH6A 2DQXA 2PUZA 3RYSA 4O19A 3OTRA 1WDPA 2HQAA 4Q4RA 3ARSA 5F2LA 2Q6ZA 4C7DA 1VCGA 2GLKA 1GZ1A 2VP8A 1GW9A 3QC0A 3B8IA 2C91A 2V3DA 5JU6A 3MYOA 4ZA0A 2QCEA 3UNDA 5A6BA 4HYRA 5I3HA 1QNPA 1EDQA 3DG6A 4BI7A 1J12A 1L6SA 2GZXA 1CLVA 2YDSA 5FF0A 1JCTA 1R38A 3HQOA 1SZGA 5C55A 3W28A 1H7RA 3E0FA 4U5IA 3WMLA 1LROA 2FMNA 3W53A 4LALA 1QW7A 2HV5A 1P0EA 4AMCA 4U2YA 1E6RA 3WG6A 3U48A 3VNZA 2Y8KA 1BXNA 2XFRA 3NQAA 4QG9A 3RG6A 1YKWA 3T1GA 1KM1A 1W9VA 3CZEA 4QG6A 4AF0A 3NTYA 4R53A 4HOXA 3ZR4A 4MDOA 4GIEA 1T8XA 3W74A 4L1GA 4WHBA 3DC8A 2Q09A 3WIJA 3MHFA 4DNHA 2VC7A 4D6CA 1HT6A 1MRQA 4WXZA 4CN6A 1B3WA 2FJKA 2W9MA 3L0GA 3V1HA 2EG6A 5HJLA 2W0UA 3WEZA 4C7GA 1C8VA 3P0XA 2X1UA 5LGZA 3GXPA 1UD4A 1OCBA 4U10A 1UR1A 3PTKA 1NP0A 3PK7A 1SR9A 1MXSA 1OT2A 4QBXA 5GJPA 4QITA 3IJ7A 3QV6A 1Q6EA 3KOWA 3UPMA 5CJNA 1SYTA 1OX4B 3O15A 3GHUA 3WQCA 6A3HA 1G4EA 3QKEA 4FNSA 2C0AA 3RNDA 5ABFA 4JIIX 3RU6A 1XYZA 2OZ3A 1UBPC 3RX2A 1TTPA 4Y9NA 3A3HA 5BOOA 3TC6A 1QTWA 1LLOA 4CD5A 4LSBA 3MJMA 3P62A 3R8RA 4FX6M 3I3EA 4PSPA 2ZDRA 2DSZA 3MUY1 4WKAA 1LYXA 4H9UA 3SUWA 3LBMA 1OD8A 1DJQA 1WZKA 2WSPA 3ABQA 5I79A 4BFAA 1FDYA 5TD4A 4WXYA 1XIJA 1WZLA 5AN7A 4LY8A 5LXXA 1QAPA 1TIMA 2JQXA 3CGTA 4U5KA 1IXOA 3PPCA 3AMKA 1IXNA 1RK6A 1HZYA 2ZRXA 3S6DA 4LS1A 1SW0A 3MCMA 1GVSA 3UXDA 1O12A 1JYWA 1AODA 1FKWA 2FHFA 1A80A 4XVEA 1YTKA 1VEMA 1VPQA 3PWGA 1K6WA 4CEXC 4UMBA 1GYMA 3N04A 3SM0A 3IAPA 3SBFA 3V4BA 4Z2KA 3RPTA 1VFSA 4PMUA 3W6MA 1ISYA 2ZUMA 4JY8A 4JAWA 2R6OA 2R94A 4X0VA 5DLCA 1XLCA 3NQ6A 2D24A 1H50A 2NXGA 3EB2A 4MZ1A 4MGGA 2NUWA 3WEMA 4CQDA 3VGGA 3WLNA 1XC4A 4HOZA 1TB3A 5GJNA 1QPKA 2V69A 1E4MM 3KL3A 3GU9A 3GFXA 4W85A 2PDXA 1U2YA 1W6TA 3MP5A 5EMMA 5LZLA 4XAGA 2QCFA 3PBMA 2OEJA 2F8QA 4D6JA 1BYBA 1S1RA 4Z17A 3WDPP 3UZYA 1OC7A 4TO8A 3TONA 3LRKA 3W24A 2HXUA 3TTOA 4EP8C 5BOFA 3OYXA 2GOKA 1S3TC 1SU5A 4HZ6A 3TJ4A 3LV5A 1KFLA 3VC5A 1R46A 4RNJA 2IKIA 1RLDA 2A85A 1DP0A 1FRBA 4MOZA 2PURA 1UQYA 3W23A 1R9XA 3EKZA 4RE4A 2DZXA 2V81A 2DVTA 1V6VA 1T7LA 2V5DA 3FSTA 4NYUA 3E2RA 3P8JA 1S5WA 3V16A 3W87A 1DQXA 3AXKA 1JZ3A 3AIQA 4GABA 1F3XA 3MVTA 1V6WA 2FIQA 2OFJA 3W2MA 4Y90A 1JCXA 4LV4A 3I65A 3VDCA 1TJPA 4C60A 3DFQA 3SEPA 4QJ3B 2OSWA 3GG0A 3MA8A 3ENLA 3K2GA 4OV4A 5AHMA 3O6DA 1VKFA 2V2HA 5BXTA 4MHBA 4I8DA 4ASTA 1FFRA 1Z41A 3ITYA 3W6LA 3UWQA 3UVIA 2V8ZA 4RE3A 4XZHA 1I1XA 4RUBA 2FPTA 4HPHA 3E3HA 1T8QA 2PDUA 1FWSA 1IE7C 3TYCA 1XYLA 1KLZA 4ERAA 5HWJA 1HXJA 4UQ9A 3VGDA 4Q8VA 1ZP4A 2QUVA 1QJWA 1DIEA 2J6VA 4QE5A 3SB0A 3AQUA 3HPSA 1EDTA 2BHUA 4O1FA 4Q6XA 2HPIA 5E0KA 3EDDA 4YCPA 4EOUA 2HISA 1X6LA 3CUZA 4I8YA 4Q8MA 3EWCA 2E6AA 1EYEA 4O15A 4FAMA 5DBUA 4IGMA 1MVYA 1CWYA 3KZSA 3KVKA 1H5YA 2GSHA 3FGCB 1MNZA 2WKGA 4GUIA 3HGSA 3PZGA 1MNSA 4PMRA 3USBA 3CB8A 4FHAA 1Q6QA 3VOJA 3S3GA 1SZRA 1EX1A 1J9YA 1XJBA 4PE8A 3II1A 4MLJA 3GC4A 2O4QA 4FEZA 4HHMA 3HM7A 3AMCA 3ZFHA 1F61A 1OYCA 4WD0A 3EOOA 4DYJA 2WVVB 4O1BA 3QTPA 4F40A 3KBWA 4UUIA 3M5ZA 1E6XM 1W31A 1QI4A 3WQ6A 4GVHA 3GNDA 1ZENA 5J8LA 3W0KA 1WUFA 1NTHA 2ZADA 3GH5A 3PNZA 3BOXA 3WMSA 1KFBA 3SJ3A 4C6OA 2X1RA 1C91A 2VENA 4JL1A 5BXSA 2EPOA 5IFPA 5FEWA 1R3VA 3ZT5A 1N8WA 3BVJA 3AYTA 1SVDA 3VFCA 2FJUB 4P2VA 4GI8A 4DHGA 3TC7A 2VXNA 4G5DA 1KTNA 3D46A 1BKSA 4IICA 1F74A 4DJDC 4GVFA 1TPVA 2XFYA 3VMOA 4AH7A 5BW6A 1QNOA 4UQBA 2WMFA 1TPH1 3FJLA 3O06A 5KZMA 4KRTA 3E96A 2BHYA 1RJPA 5HNUA 3VGEA 4H8UA 4DN1A 2J24A 1I75A 3THDA 1DWAM 1V03A 1CDGA 2OKOA 2YB4A 1QPOA 3NL3A 3ARTA 5CQ1A 2WMJA 4HKPA 4WUIA 3BW3A 5FEXA 3PN8A 1RH9A 3NVDA 2YL9A 1SZNA 4HK7A 1I2PA 1W3JA 4W84A 2I9EA 4MWAE 2OGYA 3QC3A 3GB6A 2CXEA 3RO6A 1BQCA 3BAYA 1PIFA 1V3MA 4ERGA 3CZ8A 3CAVA 4OECA 3EOEA 4PTNA 2X30A 1ZY9A 1V51A 4HPNA 5E0FA 1PKNA 1VS1A 5TQLA 3AISA 2RGLA 1REQA 1G6CA 5IDZA 4IT1A 4ZOAA 5C8BB 2WC7A 3DHDA 3UZ5A 2WVUA 1EZ2A 4RZ5A 1CGTA 5F7UA 3DN5A 3KOFA 1YNPA 1A47A 2WZHA 3C3UA 1E0TA 1UUQA 1EO7A 3TN5A 1S2TA 5FJUA 2DZBA 1ADDA 4V15A 5CGMA 2WKJA 1EUNA 4H00A 5I06A 3ABOA 3C2EA 5HQMA 3ITLA 3GUGA 1A50A 2OPJA 2FGBA 1UD6A 3L9CA 2XVPA 4LF2A 1JCJA 3WELA 4M7TA 2X05A 3CV2A 1VFLA 3BCFA 3Q37A 5TNVA 4MKVA 3SQLA 3TX9A 2QUMA 2PU0A 4LFYA 3A13A 1LZOA 3G0UA 3DU0A 3VKCA 3XIMA 3SCQA 1MZHA 1X96A 3BJTA 3JR2A 1C92A 4MFDA 1WDDA 2A6NA 3LPGA 3TJXA 1GZJA 4UTHA 2HVNA 2QJJA 4B9YA 1KRMA 4MTVA 3KRZA 2VEGA 3WZ0E 4URIA 4WY0A 4WZHA 1RVKA 4BA0A 2PRLA 3VILA 3EYPA 4DXXA 1VFMA 3BMVA 8TIMA 4PB3A 3AMLA 3QQ0A 3SRKA 4CEUC 3GFYA 5F4XA 3AYSA 4YTQA 2NXHA 4QTGA 1XIBA 3USZA 4WJEA 2Y61A 2X42A 4NYYA 4L65A 4MKNA 1FH7A 5A3HA 4Q3MA 3OHIA 4H41A 5HANA 3O7UA 1EB3A 4AHPA 2JGYA 1VFHA 3VOIA 2RAGA 2QF8A 5C2CA 2G97A 4MNJA 2FB3A 4GYFA 1UKOA 2Y85A 2XISA 3MMDA 1DWJM 5C7VA 1SFTA 3ANUA 4IGSA 2Z00A 1SUXA 5HBFA 4NNCA 2DT3A 5GPRA 1AK5A 1GTHA 2B7QA 5CGQA 1Q8JA 5EFFA 3GUWA 4O1DA 2FFCA 3B03A 3TEVA 4JFSA 3RM8A 1EPVA 1V0LA 4L6OA 1ONXA 1W9BM 1HJVA 5BOEA 3SI9A 1DJHA 3OOQA 3EZ4A 4O0QA 5A2BA 4TOQA 2OQHA 4JEQA 1V02A 3MCNA 1XM3A 2YW3A 1KC7A 3WNMA 1XLKA 3GVGA 4QS5A 2BVYA 4F8XA 1GQNA 3S1UA 4DJEC 3AUOA 4FA3A 4HZ7A 2CC0A 2BASA 3LRMA 3HFYA 4HTBA 2WB5A 1DIOA 3E74A 4XD5A 4W9TA 1E55A 3LGGA 1S2WA 2NLYA 4A2RA 4ONVA 1E71M 1AMKA 1YQ2A 5REQA 1F07A 3ES7A 3H2OA 3NYDA 3TSBA 3VKKA 1QDSA 2C1HA 5A69A 4DZIA 4N42A 4GGBA 1W9DM 1TRIA 1F4HA 4C91A 4P8UA 2GL5A 1D3GA 2XM2A 3ANYA 3INPA 3IAQA 2EKGA 4C1LA 2WHJA 1OSEA 1A5LC 1GEQA 2VWTA 4E2DA 8XIAA 4HNUA 1Q85A 1M53A 1Z9AA 3RJXA 4EAYA 4AFYA 2CPUA 2VWSA 1JQXA 1EBGA 1C90A 1YW1A 1FWIC 3TQPA 4M3PA 4LY4A 5D02A 1ZRQA 3IGHX 4INFA 4ML4A 3ZVIA 5EMYA 3W75A 3JU2A 3BG9A 5HPOA 2YL5A 3VYLA 4YS1A 4IX2A 4NZJA 2HS8A 4AZ6A 1GOWA 2I5GA 1PTAA 4LAOA 2VR5A 5E5CA 4MJZA 2YL6A 1WAWA 4FS9A 3IIOA 4Z2HA 1QPQA 1SMAA 2PTDA 5A8MA 1DPMA 3BG5A 3TR2A 3AYVA 4LBSA 1EL3A 3KRBA 2PP0A 1I2QA 2XG9A 3SCNA 1FX6A 2ZUVA 3UYCA 3RK8A 4NAFA 2C15A 3FXYA 4EF8A 3ID7A 3AJ7A 1JAKA 5AYYA 4AZHA 2RKXA 2E67A 3BV4A 1Q8AA 5CPQA 3N9KA 4RCXA 3R0DA 4H7VA 4GK8A 5LNUA 1QVBA 3W76A 4R27A 2H8ZA 4ATDA 2WMIA 4PR4A 2A7PA 4TQTA 3IVTA 5CZTA 3U6WA 4C1KA 4QLLA 1WXJA 3KEHA 1W8GA 3VCNA 3W7RA 3H2AA 3WDJA 1NFBA 1ZAJA 4PBFA 4M51A 2DJLA 1P5BA 3SY1A 4WEVX 3WLJA 1L0PA 5BZAA 3ISIX 4AWUA 2HJPA 5DRCA 3LX9A 4HNLA 3I6RA 1XH1A 4F0MA 4Q32A 2EG7A 1SW7A 3W00A 4J3XA 1ML1A 2VQTA 3T44A 3DERA 3TMLA 4DIAA 1WQ5A 2ZX6A 2X7VA 2PDFA 2YSWA 4XO6A 4B2DA 1H0IA 4Z2JA 3PTMA 2ZA1A 3GAYA 3WLPA 3DFTA 4C7FA 4LYQA 2VEIA 4I9JA 4DX3A 4XAZA 1TRDA 3FVMA 5CC6A 3M0MA 3KHJA 4S3EA 2XHYA 3W7JA 4JTLA 4PN2A 3KX6A 5CCZA 2X1IA 3FA4A 2WZTA 4L9XA 3B0XA 3VIMA 2OU4A 3LTSA 3TQKA 4WLCA 3MUXA 3OQ8A 1TQXA 1R7AA 4KFNA 1J6OA 4AIEA 1BWVA 2CHOA 3E02A 3GVQA 2PDJA 4OKDA 3NFUA 4KESA 4DQWA 1QI2A 3A22A 3BSGA 5HUOA 3L7RA 3LV6A 3LZ5A 3UJFA 1CLXA 4CLMA 3PWAA 3DG3A 3ZS4A 4ENLA 3IUHA 2E1DA 2WJZA 4PCSA 2XTKA 4Z0SA 3T0AA 5KMYA 1ME9A 1MQPA 4JFWA 4S3DA 1OCQA 3UG3A 1X38A 3BDKA 5KSWA 3OLDA 5LHFA 3MSGA 3GNRA 4NZCA 2D0GA 1O7AA 4EK7A 3LGDA 3UWEA 4QDWA 3UY7A 3LNPA 1K8CA 4KMQA 4O50A 4J3UA 2E6DA 1GVIA 2X2GA 2ZXAA 3RO8A 3WN6A 3FVDA 3H2FA 1NF7A 1PX3A 4O0ZA 4XAYA 1HVXA 4G7EB 3ZVHB 1AMYA 4FNUA 3QR1A 1C9WA 4NZFA 1CTNA 4I3GA 1CLKA 5BMXA 2XVKA 4FMVA 4WKHA 3LHWA 1AQ0A 1XCFA 2NV2A 1QO5A 1X97A 5A6TC 4O28A 4D1JA 2WPBA 4GQ0A 1PKLA 2RDXA 3BLLA 1XLBA 2PD5A 4HVXA 3W7KA 1TJ2A 3CASA 3SDOA 4Z1YA 5RUBA 1F7BA 4YCOA 4KRZA 2WMKA 1TO3A 3VGBA 1K4GA 4JTFA 2X41A 1HP4A 2AQVA 4JQ3A 4YLWA 5JIPA 5D8WA 3CV7A 1DWIM 2FH8A 3HGRA 4CD7A 4HNCA 5DMYA 2ZXQA 2YB1A 2G37A 3BLFA 1XC6A 5I78A 1XDJA 4B92A 4POCA 4RDWA 7TIMA 1OFDA 1CXFA 4OWGA 5LIKX 5FAGA 1S46A 3U5UA 3C61A 1HGWA 2RH9A 2PP1A 1S5VA 5G2WA 2BY3A 1BF6A 2QAPA 3SSJA 3W85A 4JYEA 3TV8A 1PV8A 3OZOA 3NL5A 4FI4A 3A24A 2BFGA 5EMKA 3EPMA 4P7NA 4PTWA 4H8HA 4J27A 4UTLA 1XD0A 1YDOA 1QATA 2WV8A 6ALDA 1LWJA 5A6KA 1OM0A 2JEQA 4K1WA 2WZMA 3VDGA 3W4RA 3KOZA 5K4XA 2R91A 1A0CA 3M44A 4DLFA 1JUKA 4IUGA 4FNTA 2OQYA 1QCWA 3CZLA 1WZAA 6XIAA 3VUPA 1NSJA 2Z6IA 4XAFA 1TJ0A 2CLFA 4US5D 3WJZA 5LXEA 3BGJA 4B4FA 3B4YA 5LNSA 3P8IA 4Q22A 1VLWA 3THQA 2YA1A 4CU8A 3QY7A 3POHA 3KFTA 4GE8A 5FOOA 2QAFA 1OFAA 1IV8A 2V2DA 3T55A 1NP2A 1YTEA 3TC3A 3VX0A 3SFKA 2ACUA 4Q8WA 3LPOA 1RBAA 4LUTA 3CPUA 3NDYA 1KBJA 2BOFX 1R7OA 3K30A 1JIBA 1SJBA 5LA0A 1YTDA 1B31A 5HWMA 3O1NA 3WK1A 2VX4A 4MYAA 3NDOA 4J2MA 3QKZA 3OBKA 1DIKA 2I7GA 4QP0A 4ORMA 1G7UA 3V5FA 1E0UA 1S2CA 3B9AA 3TNBA 1UR4A 5FD0A 3KP1A 2NVDA 1CGWA 3ZJ6A 3W7EA 2WYSA 3CAKA 2V9DA 1UCWA 2VCBA 3GH7A 1M1BA 3DYOA 2NXIA 5EYWA 3ARPA 3PS7A 1JCMP 4WIWA 6REQA 2D69A 3T05A 3MPGA 4Y2WA 3N25A 3IUIA 3EOSA 3GW0A 5EB8A 1KFWA 4P8VA 3WQFA 3HB9A 3BPWA 2NSXA 1XGZA 3VCRA 5E09A 4BJHA 3A4AA 3FNDA 2OO6A 4HU3A 3HURA 1QU4A 5XIMA 3MO4A 1X1OA 3OBEA 4UTKA 2YCKX 3PUDA 4KERA 4UFHA 6ENLA 3I7SA 1LP6A 2CXGA 1FDJA 4AX6A 4FX8A 1D8WA 4ZB2A 1EC7A 4HHPA 1ISVA 4GZJA 4NP7A 3F7JA 2R1NA 5E6YA 3WJSA 3VK5A 7TAAA 1E3ZA 3DYPA 1HP5A 3CV1A 3V0SA 2OZ0A 3QMTA 1EWDA 1QOQA 4W8AA 2DT1A 1J0IA 2VZOA 3L5LA 3RFAA 5FL1A 5FACA 1SFLA 3W2NA 3C8FA 4BK9A 2YA0A 3OGRA 1RY0A 1VCVA 2YBTA 5DN1A 1WKFA 3TFCA 4YVPA 4UQDA 4GYPA 3T0CA 4MJ2A 4Q7BA 1F3WA 5A6JA 3P74A 1KWKA 3ZSTA 1Q45A 1EHAA 2R1KA 1WXZA 4P5UA 2Y8UA 2OLHA 3PZVA 2WQPA 1TWSA 1X1ZA 1Q66A 4Q6JA 1OADA 4QE1A 4JPGA 4XVDA 4D6EA 1V0MA 1UR8A 3I6TA 4I90A 5BYWA 4JIHA 2GPTA 2P0IA 4Y8EA 4YXGA 4WSKA 2VHLA 4K38A 3GNXA 2IPFA 1RD6A 2J27A 3C5QA 4MY8A 3UZWA 3ZXWA 3CUXA 4J28A 4M1RA 4EXQA 2FZNA 3WDHA 3MHGA 4GOAA 1RJQA 3QHNA 4OJYA 4C6PA 5FIPA 2QT3A 5BXRA 4HSOA 4GCAA 5CAHA 1F3TA 1S38A 3NNTA 4PEKA 5HR7A 1E6QM 3R43A 2J13A 5HINA 2BODX 3T6CA 2POZA 4J4KA 3CWOX 5A8QA 3EWDA 3LCXA 1YPIA 1TWIA 2BMBA 3AFBA 4LS2A 5TF0A 3GTNA 1E6PA 3NR0A 3F4VA 4AZ7A 4PMOA 3N17A 4J1OA 2J74A 3U2OA 1MDRA 2QF7A 3S2JA 2UZ9A 3OQEA 1ICSA 2ZQ0A 2CW6A 2EJ1A 2PGRA 2PDKA 5HXMA 4J2PA 3CZJA 3LNMA 1JGMA 4QCFA 4A8IA 3WCZA 4C6JA 2P76A 3CZKA 1K02A 5T91A 3TR9A 4GWEA 4GUGA 3U0HA 4Y7EA 5HDRA 4D9PA 5J5RA 4F79A 1XIMA 1UWSA 3WJYA 3E2QA 2G0WA 2QCGA 4FK9A 4JTHA 4PCPA 2J7FA 3MU7A 4PUMA 2D2HA 4AMAA 2GQ8A 4ES4A 1UROA 2A3BA 5HK4A 3R2GA 3U8GA 1EA0A 4U33A 3W07A 1M7OA 1AQHA 2A3HA 3QR0A 4ZQCA 2ISDA 3M5YA 4J9JA 4TMBA 1EJWC 1J8VA 3HIJA 4G1NA 1YLVA 1JYXA 2ANUA 3MO7A 2VC9A 2X0HA 3VI2A 3GW3A 3HGOA 3MT1A 2PTXA 4IPIA 4P8WA 2IS7A 3CBWA 4JN8A 3ORWA 4ZB5A 1KKRA 1XG3A 3UG4A 4K2SA 4GZ7A 2PDNA 1EP1A 3KL5A 4LUJA 4LV9A 4L56A 1NJJA 2WANA 4CNOA 4EVZA 1W1IE 3VIGA 1LQ2A 3PZQA 4OQVA 3SUVA 2WZEA 2Q8LA 4K1GA 1US3A 3IJQA 1OY0A 3GHSA 5K9DA 3THUA 4EIVA 5E9AA 1XQLA 2CLHA 3BWWA 1GKQA 2J7GA 3QBUA 2QDGA 4XSMA 4PMVA 1WE5A 1A5NC 4Q4KA 3U7BA 5CG7A 4HN8A 1MDLA 3IJ9A 3B0PA 3WLLA 2CHRA 3KTXA 5G1MA 3S2CA 3O0KA 2A7RA 1E6SM 3GHTA 2PP3A 1W5NA 4L4OA 2YYUA 1B9BA 4UZSA 1JFXA 2DY3A 2XIOA 5AFDA 3TYBA 3VVGA 3GS6A 2HE8A 4LBRA 3W1NA 2Q01A 4PGLA 2NX3A 4ZFMA 5I3FA 3HMJG 3WENA 2DV0A 4L4PA 3TW7A 2VKZG 1JDFA 3NDZA 3W2JA 3W29A 1QMLA 2A79A 4PMXA 3W1XA 2PDHA 4XBJA 3S46A 4G9PA 4UQCA 4LEQA 4NZ3A 4W5UA 4F2TA 3MKVA 7ODCA 2UWFA 3M0JA 3SN4A 3U9IA 1Q7QA 4J35A 3RMEA 8CGTA 3BAWA 1PS9A 4GO9A 4W7VA 1HG3A 1VJIA 2WSYA 1OABA 1IWAA 1RV8A 3TW6A 2VEMA 3IJDA 3BXWA 2BV9A 2V3GA 3URNA 4FOUA 4LWWA 3SUUA 1VBRA 1DBTA 1VEOA 1X7FA 4IWWA 1B57A 1GJPA 1TJRA 4DY1A 3CUHA 4RNHA 2O7QA 3CUIA 3AS3A 1SO6A 4AZIA 2Z25A 2OOFA 3WFLA 3DDMA 3N3TA 4X63A 4O1AA 1LDCA 3ICJA 3WUFA 2ZE0A 2X8RA 4L6DA 4GG9A 3FYYA 4YNGA 2P50A 1JULA 5JBDA 3WMCA 3VOCA 2EPNA 1F5ZA 4MM1A 1H5VA 1KXHA 4P7LA 3GIYA 4AW7A 1B0IA 4CQAA 2F9RA 2A3CA 2C71A 2EQDA 4M80A 1XS2A 1PCWA 1SPQA 3IV3A 3OA3A 3L67A 4UOZA 2E8YA 2DSKA 1PBGA 3VGHA 3V0TA 2WM0A 5FJRA 3HU7A 4ECLA 1HL9A 4C5ZA 2YBUA 2C0HA 3WFAA 2ZZ3A 1W91A 4UTIA 3AWNA 3ZIZA 3HG4A 3KCJA 1UWRA 1UR0A 4YJ5A 4DJDD 1DXIA 1X98A 2BVDA 3M16A 4AEOA 2JK2A 4MWAA 4X61A 3G0SA 3CHFA 4FXJA 1CX9A 1O66A 1VQTA 4JYFA 4CD4A 3W70A 1NIUA 1DJIA 4BZYA 4XZNX 2Y24A 1UWIA 1HF6A 1A5KC 3FV9A 2HSAA 3CM4A 2QGHA 4F2UA 2AAAA 2YFOA 1PSCA 1J79A 1QBAA 1A5BA 1EEXA 4A21A 3C2OA 4JTTA 3FAWA 3N2CA 1GQLA 2FLIA 3NQCA 2OJPA 4EPEC 1UA3A 4BEQA 1XL9A 5KITA 2QNEA 3QR3A 1BVNP 2GOUA 1KM5A 5I3DA 3BARA 2Z28A 4CNUA 4GFSA 2J8FA 1QXLA 3GWQA 5G4EA 3GU2A 1FTXA 4L7ZA 5D2YA 3Q45A 1UUMA 1I8JA 4YYFA 1Q3NA 1L6GA 4YN5A 4IMGA 1XXXA 1GKPA 1HNYA 3W26A 1UMLA 1HVQA 1UJQA 2OSXA 3L21A 2X2YA 1G94A 1H1NA 1PDZA 3M5XA 4DM2A 1MXDA 1Y7VA 2PD9A 5FF3A 2Z1XA 3M0KA 4HCLA 1GVQA 4ATWA 5MKGA 1KFJA 4W7UA 2YR1A 2BVWA 4RK8A 1V8EA 4RZ6A 4AX7A 3DGRA 3H2EA 4RR4A 1SQ7A 2ZXDA 4GBDA 3NO1A 1DHKA 4TX8A 5BCAA 2QCCA 4B9ZA 1N8FA 3AUJA 1JG9A 4S3JA 1TV3A 4OGZA 2BGQA 3IWPA 4MZYA 4IFKB 4D6IA 2IPJA 3QEZA 2J75A 4WCJA 4BQ2A 4M6QA 3P84A 1KNWA 3MBDA 4ZBCA 1B3OA 3TQ0A 1FHUA 4D1IA 4R7WA 3PBUA 3UP8A 4FX7A 1QPNA 5CH9A 1T99A 4IPLA 1JI1A 3L4UA 4XZBA 3LHZA 2VRQA 1AD4A 3DEQA 4JNYA 2V30A 1H63A 1ONEA 3GBEA 1AFSA 4PMNA 2GSJA 1SFJA 3SCRA 4I7WA 1KCKA 1W5QA 3W02A 2YDQA 3BGAA 1ZBCA 2ISWA 4HCDA 3DGBA 4ALDA 4JGDA 4BWLA 4K3ZA 1NELA 1TMHA 3ITCA 1R3TA 3TUUA 3R5EA 3CB3A 1ITUA 1B30A 1E6NA 1FVPA 3U4AA 4UOJA 3GY1A 1RQHA 1IF2A 1WYIA 3WQWA 4IXXA 1PL9A 1KBLA 3WQ4A 1JEZA 2ZZ6A 1UB3A 1Z8AA 1VENA 1GQJA 3AZTA 4FPSA 1A4MA 3OLGA 3P67A 3VIJA 4MMWA 4PL2A 4WQ6A 4LUSA 4S3BA 3W7MA 1DQUA 4MF4A 2QVNA 1OK4A 1CYGA 3TDFA 4D8ZA 1Q2RA 4N4QA 2VZUA 3G77A 4IG2B 5FEPA 3AALA 4X9SA 3JRKA 5K4ZA 1M65A 3QHMA 4IF2A 1JCNA 1N8IA 1M6JA 2IPGA 4M7SA 1IZJA 3TOPA 3NQEA 3SGZA 1Q6RA 3BSHA 1K1DA 5I24A 2JALA 4JQ1A 2ZXBA 3OIXA 4K8GA 3QFEA 9XIAA 1E3XA 1O60A 2X1TA 3TROA 4JN7A 4Z2LA 3NM3A 4Q4OA 2RDTA 2GUBA 1LT8A 4DI8A 4PH6A 3ZWTA 5CSUA 5LIUX 4P8XA 4UB9A 3LN3A 2WSKA 2JFEX 4GJJA 4ZQNA 5AYBA 1RAKA 2DT0A 2DVXA 1PEZA 1NQKA 3H2NA 2QMKA 1LM1A 1XF0A 2EO7A 3QXBA 4KBXA 5ABTA 2BS9A 4GUHA 3UXIA 3NO5A 3GR7A 5GNYA 3PPHA 5BU6A 1YXYA 2Z24A 2QR6A 3WH9A 5ABHA 3RAOA 4AY8A 1H62A 5BRPA 3TJIA 4JR5A 3RX4A 2W66A 2VQUA 1BYAA 1Z32X 1ZP3A 3U2ZA 3PZNA 3EWUA 1OFPA 3VD7A 1LL7A 4A29A 1S39A 2FGZA 2ZZ2A 1XBZA 2LLEA 2IKHA 4PEEA 4NHVA 4IIDA 2WQDA 1TZ7A 1T41A 3G0XA 3PBWA 3NL2A 1L8PA 3KBVA 3LYEA 1EJTC 3L2MA 3UZXA 3T07A 3P82A 3NGJA 2DZAA 3VDAA 2XYLA 4S23A 1X1NA 2NQ5A 3AMDA 4FB7A 3N4EA 3S47A 4ADTA 3C52A 1M7XA 3S9YA 2YXGA 2PLMA 3DHUA 3F1QA 3LDVA 2CWXA 3B0YA 3QW4B 4GQQA 1GJUA 1PHQA 3TOYA 4R7JA 3GDLA 3FJNA 4RX0A 1XYAA 3LENA 4IFOA 2QJIA 3CIXA 2EJAA 2PWFA 4FSAA 4PUEA 1GVFA 1EOMA 1GYLA 5LKYA 2B7OA 3NQFA 3W22A 4EPKA 3OW1A 1RBOB 4IMEA 3TQVA 3TW9A 1Z42A 1HJWA 3TYEA 1EHNA 3W7QA 2DZSA 1UZDA 4M56A 1W0MA 2ZTKA 2BSLA 1WV2A 2A0NA 1TV7A 1F76A 1OB0A 1FXQA 4GC3A 1CGYA 1EJVC 1GOKA 2FPVA 1J6PA 2ONEA 3A3XA 2H3DA 3R13A 3S6OA 4CUCA 4ADSA 2YCLA 4AU0A 1I2NA 1IR1A 3QHOA 4HT3A 1UP3A 1T0OA 3PVFA 3VXGA 1GVEA 2PB1A 3VDBA 2X1SA 2OXNA 4M5PA 2PC4A 3LTYA 4HMDA 2BHZA 2XM1A 2OG9A 3DX5A 4P7QA 1DKWA 1SGJA 2XIBA 3CT7A 3EX2A 5IBXC 5FJPA 3LM7A 5CKSA 2O9OA 4O11A 2YX0A 4RKAA 3MQTA 1GT8A 3RITA 5FF4A 1ICPA 5EA9A 2FMOA 2CITA 2TYSA 2REQB 5I0DA 3W7NA 4N9BA 3NPVA 1Q4WA 5AHIA 4L5ZA 1X8CA 4UMCA 3K4DA 4CNNA 3V5OA 2B7NA 3C0LA 3N4FA 3NZQA 3CV6A 3F4CA 2J6XA 3SZ8A 5FL0A 5A8NA 4OOZA 3UA3A 4WDXA 3N19B 3O8AA 3G1SA 5A95A 5D04C 2DSWA 4IM4A 4XO7A 4TVDA 1HFBA 1B3YA 2GVGA 5T9CE 3RLUA 2XGZA 1MI3A 3AXIA 4JNMA 3GTXA 1PE1A 3EX1A 3OO2A 3WL0A 2WBGA 2C19A 1EUAA 2WK2A 3AI0A 2Z7GA 5H8UA 4PCNA 1IQ8A 1BD0A 2Q3RA 3U5YA 2NQJA 1E9LA 2Y2WA 4HIBA 5E6ZA 3MWCA 4V1XA 5M1TA 3VOGA 1EJRC 4O17A 4QCEA 3TWBA 2E9BA 2NW0A 2D20A 4LBUA 5AECA 2VX5A 4Y96A 2WSRA 4KWSA 2PS2A 3GIQA 1GONA 3STCA 4H8NA 5LIYX 1NARA 3ZMRA 4JN6A 2ZRVA 1TWZA 2CFFA 2X7WA 4UTFA 1DOSA 3E12A 4U3AA 4AD5A 2CZVA 4O8RA 4DJFA 1NQ6A 1RY8A 4DRSA 1UKTA 2Y7EA 3PB0A 2Y5JA 3VPLA 2MNRA 3H2CA 4HGXA 4W4QA 1TKKA 2Z27A 4LNCA 3LCHA 1OINA 3BW4A 2P10A 3R1ZA 5JUVA 2Y1HA 1DJYA 3LLFA 1UUOA 1P43A 1GCYA 5K3VA 1L2QA 1O5RA 2V5BA 1XI3A 4WX2A 4C6CA 2BXYA 2PWVA 1R30A 3AHTA 1EC9A 4YTSA 1THFD 3DFHA 3EMZA 1EC8A 4X9YA 1DORA 4JYDA 1O5KA 3KUMA 4UBPC 3BTNA 2G41A 1FCUA 1XIFA 5I2UA 4L64A 4WDTA 4BKNA 2GGEA 3STEA 2HK0A 4HK6A 1R86A 1TMLA 3DBPA 4IGHA 1ZFJA 3BAKA 3WFZA 1PAMA 4QNWA 2W67A 4RE2A 3RXZA 3UESA 1KBIA 4JTIA 1TFVA 1XD1A 2DUAA 2WHKA 4MB4A 5K7JA 2J9XA 1X7IA 4XKYA 1FCQA 1UZ1A 2SFPA 4QS6A 2DIEA 4J3VA 2YCEA 4HSHA 1US0A 1KCZA 4DO4A 1N55A 1BEUA 2Z1BA 1KV5A 1YIXA 2AQWA 3PBGA 3I4EA 2VTFA 1TG7A 2YIHA 2OMAA 3K5XA 3VIFA 1LBFA 2VT0A 3GFZA 4IOTA 4XD4A 2NSOA 1ZJHA 1PPIA 3G2GA 2EAWA 4F0RA 4HA4A 1FP8A 1NH6A 1ZB5A 3DFOA 1TZZA 3PFRA 3KTCA 5C2GA 4C1NB 2PF0A 4QLKA 4Y6GA 4OVXA 5HPCA 3UWUA 3AIVA 3PZMA 1V6TA 1RA0A 1DXEA 3MC5A 4CD6A 3FHQA 1W37A 1F4AA 2JKAA 4HOWA 4QRNA 5I6SA 2HWGA 3G6LA 4UC5A 1HL2A 4EAMA 2OYKA 4QROA 3CNYA 1GKRA 4UNKA 3NSXA 5LIXX 1X6NA 4BI5A 3F2BA 1QHOA 5D2VA 4NNBA 5ENLA 4JHOA 3A21A 4DO5A 3LZ3A 1ME8A 2OSYA 2DW6A 1V7YA 4YWSA 4MB3A 1LRTA 4QGCA 3JVAA 1XBVA 2F2HA 3A47A 2NQLA 1XINA 1JNEA 1PB0A 1OJXA 1LL4A 1LQAA 1AG1O 4RNFA 5BWAA 2XWDA 4H4IA 1CENA 2XSAA 3IEBA 4A3HA 5D2WA 2GFTA 2I9UA 4Y8FA 2PLKA 4YHEA 2ESCA 3WF1A 1K8XA 1XLJA 2FTWA 1JNDA 2PDCA 1TIWA 1UMYA 1E9ZB 3IARA 8XIMA 3PJTA 4L9ZA 3TCSA 2O4MA 3KOXA 1CZ1A 4IHCA 3L4VA 3NIYA 2QW5A 1ZAHA 2YFNA 4GYJA 3CUFA 2NVCA 5FSEC 2V2CA 1OC6A 3N2OA 2EBNA 4AIOA 1LBMA 3EEZA 5DQPA 3T42A 3BJFA 1I4NA 4OIFA 2WNQA 4RJEA 3GDRA 1A3WA 4ORIA 1JDAA 1X6UA 4XD6A 4C6KA 1JYNA 2WWDA 3IK2A 3B9NA 3WYZA 3N6JA 3UG8A 4UTWC 1K03A 3MVIA 1VC4A 2E0PA 9XIMA 2UBPC 2OYLA 2I16A 4IFRA 2BXZA 4UIOA 2OWWA 1E5JA 3GG8A 3EMCA 3VNYA 3S5SA 2W27A 4HMCA 1TSIA 3VKDA 3FA5A 4HA1A 4PCTA 3TZFA 4LCSA 4NAEA 3MW7A 1VPYA 2B7PA 3B8DA 4PBEA 1K7EA 2XH2A 1H2JA 4MSSA 4BHYA 3WK2A 4IPPA 4ZFCA 4B5WA 1MXGA 1TPFA 4LF1A 5A8OA 1WKYA 5E70A 1R3WA 3GVRA 3WQVA 4NILA 3UD6A 4D6HA 4MPKA 4QM1A 5AHLA 5IXEA 1YPXA 1R8LA 4XIMA 4PUUA 2Z0IA 3M0YA 3G1FA 1OCNA 4C6BA 2Z1KA 2DW7A 3LM3A 1R2SA 2GGGA 4DWDA 1WKEA 5M2FX 1XDMA 4RW5A 4L9YA 3RLGA 3B8TA 1CBGA 2DORA 3MUCA 3SQMA 5FI8A 3APYA 1FFQA 4NX5A 2OLAA 1HW6A 4IIHA 4NF7A 5LHEA 1J11A 5AY7A 2E28A 4C6FA 4MLRA 1Z3NA 3MI3A 4NKCA 4XKMA 1AZ1A 1BRLB 3GC2A 4NIRA 4DF2A 3S5OA 3REQA 1XBYA 4ZQPA 1GOOA 2QGYA 2XU2A 3H53A 2E5CA 4NQ1A 1UZ4A 3GM8A 3VO0A 1FWJC 5D9OA 1FWCC 4DBSA 1R87A 4GIYA 3WUBA 3WL1A 3S9IA 3CAWA 5B7YA 3ITXA 3NQ2A 3AIWA 1TV4A 4ZO6A 2VJXA 1BSIA 1UKQA 5FJTA 4WF7A 1PX8A 3G5EA 3ITVA 3GR4A 5LA1A 2Z4GA 5FESA 1V6YA 3IIPA 4J5NA 4LRTA 4N9CA 1VHNA 1XYBA 3ITOA 2J62A 3EDEA 4LCQA 3UZZA 3QM3A 2JEPA 4PRTA 3ALFA 1XHGA 3N9RA 4DUOA 3LK6A 3MSYA 3T4WA 1F9CA 4HSNA 2KAUC 2EPMX 2DEPA 3FA3A 4ROQA 2BGSA 2JBMA 2TODA 4QQUA 3N13A 1DJZA 1WPCA 4UWMA 1KWGA 1EJSC 3AMGA 4ADUA 4DXVA 1U5JA 2WM1A 1L6YA 2FZ9A 2J7BA 3WH8A 3D47A 1E51A 3LRLA 4E2BA 4GXWA 5DCDA 1PTGA 4U2ZA 1H60A 4AZBA 1ZCOA 3UWVA 2PTYA 1UIOA 1TWWA 1WBJA 5DXYA 7PTDA 3DC0A 1POJA 4GLEA 1RD5A 3ARRA 2XN0A 3AC0A 5B7ZA 2E5BA 3OODA 1Q6CA 1WA3A 1GPWA 2Z26A 2BXVA 3PWIA 2F84A 4BY3A 5DY2A 2HE5A 3PPFA 4Z2IA 2OT1A 3DBNA 3VIOA 1OIMA 3M5VA 1XIIA 2GJXA 3VMPA 3WD1A 1XUUA 2DH2A 1IZCA 3HFTA 3SQSA 5I09A 4IISA 4IJRA 2X40A 4HPGA 4JTKA 2DVUA 4NL1A 1MEIA 3IRDA 4PMYA 2WNZA 3G24A 3BK0A 2UY3A 3PUEA 2YLAA 1QNQA 3CAQA 4PODA 3QPEA 4ZEPA 4CD8A 1IEQA 3E0LA 2VFEA 4O18A 1QK0A 3OHMB 3WNNA 3KRUA 4AXKA 2ZKMX 3W9ZA 1DE6A 2XIIA 2QZRA 1EX5A 4LAMA 4MNMA 3CZGA 4ZOCA 3A4WA 1I0BA 3VIPA 1XIGA 2CZEA 3S5NA 1O6IA 3GXDA 2YGYA 1IWPA 1W5OA 4GCXA 3S83A 2RUSA 2OQLA 2WO5A 3LI0A 2FDMA 4B5UA 3IIVA 3NJ3A 4LYKA 5AC8A 4HYWA 3OLEA 4U4MA 4F0LA 2FVKA 3FDKA 3EB4A 1A4LA 1DXFA 1XIDA 1XLIA 3C86A 1A5SA 4H6EA 3S0CA 3TA6A 3DXIA 4R88A 3GXMA 1BYCA 3BANA 3TZNA 4Q8NA 3KE0A 3WNOA 4CN1A 2PGFA 1SJDA 3RRAA 3W84A 1UH2A 1ECEA 3K4AA 4DWSC 2P0OA 4TV5A 1YDVA 3HBLA 1ZJIA 1Q6GA 2QULA 4O0KA 4L6HA 3PZUA 1WOBA 1YYAA 2RGMA 4QAIA 1SR0A 2A21A 1JPMA 1MUWA 2PGEA 1XCXA 4MB5A 5EL1A 2VOTA 3WLKX 3ZO9A 4DZHA 3GZ3A 2ABAA 3A64A 4OBRA 4C6QA 1UD8A 3BOLA 1M03A 4TXEA 1X39A 1TELA 4RPQA 1XFCA 2WJDA 3PNUA 2P88A 3CJPA 3VNMA 3WF2A 3QW3A 1TTJA 1AH4A 1J0JA 3QPYA 3SJNA 4I5UA 1L8NA 1K77A 3F03K 4H6KA 1E1EA 1VGAA 4C6DA 4TVCA 2VVNA 5KZ6A 4XKYB 1W5MA 1OF8A 4DJDA 4KCWA 3MSRA 4KEVA 4V28A 1UOKA 1B4KA 1I6NA 3MP3A 1J01A 4JX4A 1K70A 2MANA 6CGTA 3DOPA 4LUYA 3G1RA 4F0HA 1ZGDA 3T2PA 2CBJA 2GJNA 3GVVA 3MJYA 3W38A 2QCLA 1EEPA 3CS2A 4KS0A 5F4SA 2ZOXA 3TJLA 2O9RA 2ZUTA 2D2GA 3NZ1A 1IT0A 1QOPA 3Q2DA 3CPRA 2CLIA 2ZA2A 5PTDA 1KQYA 5TAOA 3CIVA 4WDUA 4W86A 1HJUA 2WMHA 4DUWA 3QQ1A 4E3VA 3UR7A 4GI4A 1VEPA 1NAL1 3MUZ1 5AC4A 3IVUA 1VFTA 2QUNA 2FHCA 5I5RA 4AB4A 2DUXA 4EX4A 4IIEA 3W1MA 3RX3A 1JR1A 3KBJA 1Y8BA 3H22A 4HN4A 1HQTA 2AMGA 2V5CA 4IXHA 4A3QA 3CL6A 1JZ8A 1JXKA 3HG3A 4H04A 2CBVA 1XR2A 1UBSA 3HJEA 4O53A 3AHVA 3PY2A 3ZZ1A 2I1OA 5BMWA 1H1YA 3ONCA 1RA5A 2PDBA 5G5IA 3AHZA 3W1AA 4QX4A 4TUFA 3WJWA 3EPNA 5GVJA 1XGDA 1E40A 2ON3A 3B3DA 3HGJA 1MUCA 2C6QA 2OEKA 3BCJA 3BAIA 3NPWA 1KGWA 3FXGA 4JX5A 3PHAA 4DAIA 3VNDA 3K8LA 3QMRA 5IDIA 4F0SA 3OIHA 2DZVA 3VU2A 4NSBA 1UR9A 3TN4A 1G69A 1JDDA 1LG1A 2HROA 4Q33A 5A8GA 3AOFA 3PAOA 3V36A 4KCUA 2BNJA 1RCXB 1BQGA 3PC0A 4DZ5A 3E1F1 5AHFA 2NWSA 3BC9A 4Y9MA 2XFFA 1GHSA 4MKSA 3UCQA 4LVGA 1UKPA 1Q63A 2JGQA 1LOLA 2Y5EA 1OIFA 3WLIA 1G9HA 2PRHA 2DZUA 1YXCA 2PCQA 3O2LA 4CCDA 1EOKA 1N7KA 3TXZA 3BZGA 1XGEA 3BURA 3P14A 2OLSA 4XZLX 3VNIA 3LCIA 4UQAA 5M17A 1WCGA 1XYMA 5F2GA 1VCFA 4AHQA 1U30A 3LUTA 3LS9A 1ISWA 1LBLA 4Z08A 3PZTA 3ITGA 1QRQA 2G8ZA 2YKKA 5D38A 3WMBA 2ZCGA 5HNRA 2XGBA 4W5ZA 3FKRA 5JBEA 1W1PA 4LVDA 4L4MA 4L61A 5E1QA 2A3LA 3N1AA 1KCXA 1J0YA 3KL0A 3BLOA 3WX7A 4XD3A 1B90A 4JKLA 1QHPA 3GBDA 4TVUA 1NWRA 4KCVA 1OCJA 1HJSA 3FHAA 2X09A 1S5TA 4ZR8A 2ZWYA 1NU5A 2W6RA 4S38A 4L1WA 3RHGA 1JDCA 2ZVIA 4AY7A 1XWYA 4DBEA 4WGHA 1YADA 1SJAA 4LT9A 1XYCA 1F3EA 5HQLA 4BEUA 1I1WA 1JL8A 4JQ2A 3I7QA 4I9TA 4MVAA 1MZRA 5EBUA 2PWHA 5EMJA 2XSBA 2QCDB 1A5CA 1RR2A 3TYUA 4JTJA 1C8YA 2AQOA 4M1BA 1O1HA 4DJEA 3UXLA 3P2VA 2WW5A 1B54A 3FS2A 1LORA 2XN2A 3VKJA 3CHEA 5EPDA 4PYSA 1BWLA 3IIXA 1JF6A 1H09A 4CU7A 3DENA 1XX1A 1GQKA 1MFUA 3M0VA 3NPUA 3LERA 2OWCA 4NNAA 4FF7A 4KRUA 1JGIA 3JUGA 4DBDA 1OVDA 2CIPA 3UA4A 3L5MA 2PDPA 3T8QA 2I5IA 2QJNA 1MW3A 3HF3A 1CT5A 1LT7A 1ZHAA 3H7UA 3TYDA 4NXKA 2XJ7A 4MWAD 4Q8PA 1KQZA 3UJSA 3B06A 1E0VA 1UPPA 5TIMA 4BWLC 4H9ZA 2J7EA 4E2OA 4HD5A 1P6BA 2PC8A 5A6SA 3T0TA 1HUVA 5H1WA 5DELA 2B4GA 3GYEA 1VBJA 1M7JA 4FALA 3CC1A 2P8BA 2IMRA 4JTQA 3T4CA 4DF0A 5J5DA 5G4HC 1KM0A 4IJCA 4AIUA 1J10A 4FIQA 4KKXA 5DCBA 3R11A 3WQGA 1IIGA 4GVGA 1KO0A 4ZQRA 3HO8A 4CQBA 4Z2GA 1LWHA 4HHLA 3R79A 2VM8A 1IGSA 3PPGA 1P6CA 3WNLA 2VEKA 1CEOA 3CYVA 1C29A 3M0LA 1PKMA 1VYPX 4A8RA 3GNNA 2ISVA 4EXAA 1J0KA 4K7VA 3KM8A 3C2VA 5CPSA 4KFPA 3VZZA 3KW3A 4GI6A 4NT0A 3SADA 1PWLA 2GJPA 3BG3A 1XLHA 3UY8A 3QGAC 2VMFA 1Y5WA 4Q8TA 5DMLA 1QNVA 1NY1A 4JHZA 2BY0A 5EKYA 4A2SA 4CKQA 1PZ0A 2P5NA 4MADA 4ROPA 2J7HA 3PZOA 4CN4A 5LNVA 4B3KA 1GVOA 1BTMA 2EKCA 2PWEA 3A3WA 3C0QA 1P48A 4PTMA 2VR2A 1O5QA 1VR6A 4NI3A 3DFSA 1R6WA 1N2VA 3QOMA 1DJXA 4GX8A 1XRVA 3KDOA 1UYQA 3W72A 1GQIA 4JOMA 4NY2A 1YXDA 3NOEA 3VNJA 2ALRA 3S9ZA 1VIWA 3W82A 1V02E 1XISA 3KVMA 3LOTA 4AF0B 1DWHM 3ABSA 5E9XA 3NQMA 3W7IA 4NZ5A 2YBVA 4M6PA 4R33A 2W79A 2HPMA 3BO9A 3GZAA 5HNTA 4JX6A 1RALA 5A2AA 5IM51 1OT1A 3CHVA 1PVNA 3GG7A 4PFMA 4HA3A 1FWTA 5MF5A 1Z69A 1I2RA 3WBXA 3L2LA 2CLPA 1V77A 4UNIA 1RP9A 4LRSA 2OEMA 2EPLX 3BLKA 1D7FA 3GR8A 5LNRA 3O3RA 4CNTA 4O54A 5KZDA 5SWUA 3WY1A 3LLXA 4MB1A 5A6AA 1W3IA 1C7SA 4BI6A 3ARYA 3WQPA 4HHHA 3N3MA 4N7QA 1G1YA 1K9FA 1W5PA 1DHPA 1AW1A 1M41A 1U1HA 4UFLA 4G1KA 2FYMA 3TKFA 2XH0A 3UJEA 2C79A 5ABFB 5I77A 2ZUNA 4XSLA 5G1YA 5HUPA 4GMEA 4E5TA 3M0ZA 2JIWA 4MYXA 1W3KA 5H8PA 3CL7A 1QR7A 2YDRA 1V79A 4G6CA 4HA0A 1RK5A 3M6DA 3WQEA 3DFYA 3GTFA 3SCTA 1IXQA 1BKHA 2ZUUA 4AQLA 3BQ6A 3PZ9A 3VC6A 1K9TA 3PJUA 4J40A 3CTTA 2WLZA 1GPFA 4JTSA 5CPLA 4JIRA 1E0WA 4PUNA 5M03A 3L0KA 1E4NA 3A9BA 3QYQA 3V0UA 1L2UA 3S42A 1QW8A 3QGVA 1V3KA 4RXGA 5I00A 3DCPA 2GUUA 2PBGA 3Q65A 1HKKA 5HATA 1UC5A 3IGUA 3H7RA 4JCLA 1PHWA 3W1UA 1IEIA 5HWNA 3TA9A 1YHTA 4IIBA 4AISA 1TCMA 1BGAA 5T9BG 2R1LA 1YDNA 3VKBA 1YEYA 3NAVA 1V6XA 3F4NA 3QYSA 1G5AA 1ITCA 3E38A 2WCAA 1CB2A 3C4UA 3H24A 3AIBA 4AD3A 4GUFA 2XWEA 3P7YA 5G1TA 4LAUA 1V4YA 4KETA 3H12A 1QI0A 4K6AA 3QGKC 5FJOA 4ZSTA 1K3UA 1K8ZA 4Y9OA 3NXLA 1NFGA 2WJEA 3EOUA 4AEFA 3NM1A 3M46A 1EDGA 3ECQA 2FVLA 3ZR5A 1K7XA 2MUCA 2E1WA 4AZCA 2WC4A 3A4JA 2E77A 3P3BA 2ZZ5A 2BY2A 2XH7A 4W89A 3FN9A 5L9FA 4N4PA 3OG2A 1NWTA 3S6TA 1LOSA 3B8UA 3I10A 2QCHA 1SO4A 4J3WA 1CGXA 4RDZA 3K1DA 1V93A 2TRSA 4WJXA 1RHCA 4Q7NA 4NASA 4Q8UA 3GK0A 1JUEA 1XSJA 4OHQA 4W93A 4YL2A 1R2RA 3GIPA 1JRBA 2Y5SA 2YW4A 2NQZA 2XIQA 1JDEA 1TQJA 1MFVA 4NG3A 3UEQA 2ISFA 1FH9A 6PTDA 2WMGA 4F9DA 2Y70A 3R6IA 3S2MA 1MYRA 3LCLA 4Y9AA 1ZJAA 1GNXA 2D22A 2ISSA 1OZQA 3BICA 3L4YA 4GACA 3UGRA 5D9MA 1I45A 1UA7A 4NUWA 1ITQA 1OGSA 1ME7A 2WHMA 4DM1A 2ABBA 1W1TA 4QR6A 3FGCA 1W3LA 4NRSA 1K9EA 3KOYA 3ALGA 3KCOA 4UTTC 2GJRA 5CZSA 3U2EA 5B80A 2OX1A 1RPXA 3TE9A 3NUKA 3CHCA 5HOSA 2RHGA 3GO2A 4ACZA 1ZUAX 3QTGA 4D6GA 5AB3A 3L23A 4GKLA 4BF9A 2G4FA 2Y7FA 4AY1A 2J4GA 2DPEA 4GRSA 1Y65A 3S8HA 5CSSA 2PI6A 1FWWA 2Y4SA 5DEZA 4M0XA 1H0GA 2FFIA 1LLZA 3ABXA 1ALDA 4LEFA 5MHBA 4YTTA 3IVSA 4IP7A 1SSGA 3BGGA 3TTQA 1TZ9A 3F5JA 4QLJA 3FEQA 4L80A 3EWYA 2ATSA 4H2CA 1PDYA 2VDGA 3EB3A 4V1YA 3W7LA 3TMQA 2WHLA 4XIAA 2DFAA 3MS8A 4XZMX 3KHDA 3E5BA 1F6KA 1WDQA 4JTEA 1BXCA 1U83A 2X16A 2HXTA 2A3AA 4QJ5B 4WOZA 2ICSA 2J47A 1KW1A 3W1TA 6XIMA 5D37A 2QIIA 3HJZA 1NVMA 2IUZA 4J7RA 3UXAA 1BWKA 4AAJA 3OYZA 2JIEA 1KM6A 4WR3A 2VCAA 1UH3A 1RBLA 2CYGA 7A3HA 5AYIA 1UWAA 2R24A 2R14A 2CLKA 1I2OA 1UD3A 3P5YA 2V67A 3EX3A 5C9XA 1AZ2A 3H70A 1QHZA 1J0ZA 4CQ8A 1A53A 1QNRA 1XBXA 3NVTA 3OLIA 1NDWA 2ZZ7A 3RLHA 3PBVA 1V3HA 2JKEA 2V5LA 1XLDA 4B91A 5CJ5A 5A1AA 1DE5A 3MUAA 1NF0A 4EWJA 2E4TA 3GKAA 3L65A 4HPXA 3DECA 1V3IA 2XFWA 3R8HA 2J25A 4KGLA 2R1PA 5JQ9A 3M41A 4GY7A 5DCEA 5C9UA 3ONBA 4ZTYA 3ZM8A 3BQ5A 4DJFD 1EKOA 2D0HA 4GUJA 1T5AA 2J9YA 3WLRA 1V7AA 4YPJA 1YE4A 3TN3A 3VAVA 3ITTA 3WLQA 2J78A 3KVJA 3KCLA 2D23A 1LJYA 1DYSA 2OWXA 1S2VA 1C8QA 2F6KA 5A2CA 4RPPA 3BCDA 4XTDA 1PUDA 1CW2A 3MSDA 2EPHA 1AH0A 3M07A 3E0VA 1JQVA 3GDMA 1US2A 4S3AA 4PFHA 3AHYA 2HNEA 3SN0A 2OKTA 3FK4A 2A1YA 1QK2A 5HMDA 1F05A 4KWUA 5CPNA 3TLLA 4A4AA 2PLJA 3APTA 3IS4A 3P81A 1GW1A 4X2RA 1REQB 2YL8A 2CZFA 3VD3A 2RDUA 3IRSA 2ZIDA 3R4IA 3M47A 4YWIA 2VZVA 4LH8A 1B1YA 1T6MA 2I57A 3JS3A 3FYOA 1Q6OA 4R5EA 4IH3A 4AD1A 1GOMA 3LBOA 3LMZA 3IACA 3W01A 2VFGA 4BR1A 2DU2A 3K13A 2ACRA 2CLLA 2W92A 2Y7DA 4GA8A 2QKFA 2V6AA 3IIZA 5DX7A 5CPMA 3STGA 3SY5A 3LHUA 3QZ6A 3UZJA 1E6ZA 3NL6A 3SURA 5H2ZA 3D3FA 5AZ1A 5HJXA 2QLYA 4QEHA 3KS6A 1BYDA 1SM9A 3NZGA 3SAZA 3QQWA 4IL0A 3T81A 4CVWA 1XRSA 4GH3A 4BQ5A 2C3ZA 3IV8A 5FEZA 4I5XA 1FWDC 5EBAA 5I03A 4RDYA 2O0TA 4WY0B 1UIPA 1K8YA 3BW2A 1SMDA 1XYFA 2HVMA