5CPSA

Disproportionating enzyme 1 from arabidopsis - maltotriose soak
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
517
structure length
517
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 185
structure length 517
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cpsA01
4WK9A 3WENA 2ZUVA 2OWWA 2WHJA 5A2BA 1V0LA 3GZAA 2CHOA 1R85A 1KGUA 1WDPA 2VRQA 2CBUA 1G01A 3AIRA 4LPCA 1GQKA 2XYLA 4J3VA 3QHMA 4EKJA 1OCQA 3VGBA 2ZXQA 4P8VA 1HF6A 3CUJA 1XYZA 5I79A 1LG2A 2YKKA 4S3JA 4PBGA 4BCEA 3WQVA 5JIWA 1AQ0A 3UG5A 4P7LA 3L4XA 1UUQA 3SCSA 5LA1A 2W62A 1R8LA 4AD3A 4MJ2A 4PUDA 1C3FA 3VNZA 4CUCA 4KGLA 5KZ6A 4W5ZA 3GTNA 1MXGA 3L4TA 4UQBA 1Q6DA 1H0IA 4TTGA 4MPKA 3RM8A 1NWTA 2PWGA 4M1RA 1UR8A 2E8ZA 3WH8A 1BVNP 3BGAA 2J7CA 3SUSA 4AD1A 1E56A 3BH4A 4TVUA 4FLQA 7TAAA 1GOMA 2WPGA 1C93A 4JFTA 2JEPA 3AMDA 1VBUA 1V3JA 3LPFA 3TP4A 1CBGA 1TVPA 3ZJ8A 4QLLA 5AC5A 4D6HA 1PZ3A 2WC7A 3N17A 5D9PA 4FF5A 1JZ2A 1V0MA 2J47A 3UR7A 3WFZA 4MAZA 1XD1A 3UESA 1UD5A 2ZUUA 1BGAA 2JF7A 3MUIA 1V3KA 3GH4A 4R27A 5LA2A 3AXXA 4XZBA 2RGLA 1XC6A 4N42A 2WVUA 5E9AA 4UFMA 4GQQA 2EPMX 3BMVA 4U3AA 3T0DA 3BAIA 3ZSSA 4HOZA 5A8OA 1CGWA 4AZ6A 3TTQA 1JFXA 4D71A 1XSKA 3GM8A 3CZLA 4DUXA 4M81A 1CXLA 4H04A 1LL6A 4XX6A 2WZIA 4EK7A 2ZWZA 1VFMA 5A6BD 5HNNA 1TUXA 2J7BA 3NSXA 1UH2A 2XFYA 3N12A 4P8XA 1B3VA 4FLSA 4C7FA 8CGTA 3LPPA 4ML4A 1JZ3A 2VX4A 4MADA 5E6ZA 2XSBA 1NOUA 5DT5A 4MB5A 2VZSA 4KGJA 3CUIA 1OM0A 1VAHA 3FHQA 5I5RA 4QDMA 4HA4A 3J7HA 2GJXA 1E0WA 4W7VA 2GDUA 4CD4A 4OJYA 1XH1A 2W63A 2JF6A 3QGVA 1V0NA 1DWIM 1GQJA 2DH2A 2XVPA 1DWGM 1FP8A 1XCXA 2CESA 1E3ZA 4U33A 3BLPX 3ARSA 3O2LA 1UZ1A 1DWAM 1K9DA 4D6DA 4CD7A 4BQ4A 1C7TA 4KWUA 4HZ6A 3DC0A 2WKLA 2E9MA 4TTUA 1WCGA 1J0HA 2GDVA 3AI0A 3AHVA 3LPGA 3QHOA 5A8PA 3AS0A 4UOZA 5M3WA 5I2UA 5A69A 2PWEA 1OGSA 4H8UA 3MV11 4AXNA 1IT0A 4Z2KA 3PZTA 2J7DA 3WH9A 1UD4A 1CECA 1JDDA 4MTVA 3T2OA 2EXOA 1UA7A 1KQZA 2E9BA 2J8GA 3VDBA 1B3ZA 3IJ8A 1ODUA 4ACZA 2W61A 3WUEA 4JHZA 4B3KA 4UFLA 4E8CA 2J74A 4FLOA 4JFWA 3WNOA 6TAAA 4JKMA 1UA3A 4RL3A 1QI0A 6CGTA 1KR0A 3ARVA 2OSWA 3OLEA 4NI3A 4HPHA 5ABHA 5CGMA 2BV9A 1WP6A 2Q8XA 1W9XA 4AZIA 1M04A 2YDSA 2DH3A 1UZ4A 1Z32X 3OGRA 1JDCA 2J75A 3UERA 3TTSA 2GK1B 2VCCA 4D6FA 2VI0A 1E6XM 4B3LA 4WKFA 1E4MM 1GONA 1V6YA 2ZOXA 2JALA 3AROA 1OIFA 4CN6A 4W88A 5EFDA 1I1XA 1Y7VA 3HN3A 4W8LA 3WH5A 4HMEA 3WN6A 4ZXLA 4AZ5A 1XYFA 3BCFA 4LYQA 1HIZA 5CSYA 2DSVA 2XIBA 1QW8A 3GNRA 1PIGA 3IJ7A 5I0DA 5JBEA 2W5FA 1RH9A 2ZXDA 5A2AA 3FN9A 1HT6A 4CVWA 2BHYA 1ISYA 3WD0A 1OT2A 4CKQA 1BAGA 4BF7A 3OIHA 3WDIA 4WSJA 3WIJA 4H2CA 1BYAA 5EFFA 4MNJA 1KGWA 4KMQA 2WHKA 2VVSA 2ZUNA 3EBVA 3A4XA 3O6AA 3AXHA 3BMWA 1JIBA 3HMCA 1EHAA 4GO8A 5HXMA 2VUYA 1D2KA 2A3EA 1CLXA 2GJRA 2AAAA 4UR9A 3AMKA 1UR4A 5I24A 2D0HA 4UOQA 1FH7A 3GXMA 2W92A 1RP9A 3K4AA 1HKKA 1G9HA 3G6LA 1W3LA 1AMYA 3AIWA 3WF2A 1TR1A 5FIPA 3U57A 1ZU8A 2IUZA 2J77A 2X8RA 1ZBCA 4YN5A 3BAXA 3DECA 3AZRA 3WDPP 1W9PA 4AZ7A 2EPKX 2G3JA 4C7DA 1NQ6A 1V08A 2XFRA 3OB8A 1US3A 1AVAA 4M80A 2QMJA 3AYSA 6A3HA 2ZX9A 2B31A 4DWSD 3RILA 2YLAA 5A6KA 3WD4A 5CLWA 3AXIA 1QNPA 5KEZA 4LGXA 3AICA 2V3GA 3SUWA 4QCFA 4B9ZA 2O9TA 1I1WA 1NWRA 4OBSA 5GQBA 3WNNA 1UQZA 1CXFA 4JIEA 3L4VA 4Z2LA 3NDYA 1GNXA 3SCWA 3ZT7A 5D9NA 1K6AA 3CPUA 3CMGA 3WEMA 3UG3A 2J79A 3W53A 2D3LA 3ARRA 2J7EA 3MO4A 3ZJ6A 2NW0A 1FFRA 4BZYA 1VB9A 2VX7A 3UCQA 1FA2A 1H1NA 1AQHA 2CERA 3AIUA 2AMGA 5BXPA 3CIVA 4M82A 1KCLA 3FY1A 1QHPA 4ZXOA 5BYWA 1W9UA 1OIMA 1VJSA 3PTMA 3WFLA 4UQCA 3L4YA 4E4PA 1QI5A 1UWUA 2WCAA 2OLHA 3OLIA 2QF8A 1JI2A 1KBKA 1NP0A 2VX5A 1CXKA 2OSYA 5BROA 4W87A 1JYWA 1G0CA 2VURA 3T2PA 1JZ7A 2CHNA 3FXYA 2WZHA 5D9MA 1TA3A 2J78A 1JZ8A 2CITA 4N0RA 1E5NA 1LWJA 1WZLA 4BQ3A 3ARUA 2WLYA 4KH2A 4JAWA 4AEFA 1W1YA 1JF5A 2ZX8A 2BY2A 1LJYA 2G41A 2WMIA 2GFTA 3VOCA 1IZKA 3MMDA 1S46A 5M03A 2VCAA 5JIPA 1BYCA 4UNIA 3UEQA 2W66A 4GI8A 3U7BA 1WDSA 3ARXA 3CUHA 1VF8A 2VZUA 5BWFA 2WMKA 1VFOA 4RE4A 3WELA 2WWDA 1VEPA 1JZ6A 1I75A 4ATDA 1B3WA 4TX8A 5C8BB 2XM1A 3TONA 3BSHA 1E4NA 3AZTA 4D1JA 3ZM8A 1C8XA 1LLOA 2X2YA 4CD6A 4JZ5A 1W32A 3GH5A 3NSMA 3MSGA 1UKQA 1KXTA 2WB5A 2YDQA 4U5IA 5A1AA 1H3GA 2V5DA 3WSUA 1GZJA 2D2OA 3SEPA 2O9PA 1W3JA 1MXDA 1RPKA 2PBOA 2V5CA 1E71M 3RM4A 3RDKA 2CBIA 1HNYA 3PZVA 1D7FA 2VL4A 5HDRA 1BTCA 4PMZA 1HJWA 5BRQA 1JYNA 4PCSA 3FNDA 1PX3A 3IK2A 4AW7A 3CGTA 2ZXBA 5BRPA 4IM4A 5FL0A 3A4AA 1ZBVA 4OBRA 2YIHA 2A3HA 4NRRA 3L4ZA 1CZ1A 3W4RA 3WNMA 1WB0A 1SR0A 3PTKA 4PN2A 1CPUA 1JD7A 4PMRA 4EE9A 1UD2A 2ZUWA 3WY1A 1NWSA 2UY2A 3W37A 1WO2A 2D1ZA 3WUBA 1MWOA 1HJVA 1TVNA 3B9EA 3HJEA 4GO9A 5A94A 1V6WA 4CU8A 3ZO9A 2VCBA 1QNRA 1A3HA 3T0AA 3BCDA 1E40A 3S6TA 2X1IA 4IPNB 3SCNA 2WM0A 1V3IA 2WWCA 2FH6A 3T0BA 5A6JA 3WBAA 3ARTA 1W9VA 3M7SA 4U2YA 4LX4A 1L0PA 4BA0A 1GQLA 2VVNA 4TXEA 5HOSA 4W85A 3CH9A 2QPSA 3VD5A 2W67A 4OUEA 4ATWA 1E1FA 2QPUA 1TMQA 4CVUA 1SFSA 1GOQA 1XSJA 1QOXA 3ZOAA 3CHDA 1JI1A 2CKRA 3FHAA 3W24A 2BY3A 3GXFA 5DMYA 1H41A 3VD7A 3W82A 2WSKA 2Z1KA 2G8ZA 4AZHA 5CPTA 4PUEA 5I78A 3WF4A 4D6IA 4PEEA 2PI6A 4Z2JA 4ZEPA 3K1DA 1PIFA 4H8VA 1V6VA 3MV01 1M01A 3QOKA 2W4XA 3D3AA 1DP0A 2E0PA 1EDGA 2D3NA 2WBGA 1GW1A 1W1VA 4R5EA 4AZBA 3IAPA 2YDRA 3GNPA 1V0KA 4AIOA 3WNKA 2VX6A 4J27A 4GZJA 1C8QA 3KZSA 1VIWA 5A8MA 3VIJA 1BG9A 2C8NA 1E15A 2BHUA 2EPOA 4Z2HA 1QI3A 1HKMA 1F4HA 2D0GA 4AZCB 2EO7A 4Z2IA 3AS3A 3I3DA 2FH8A 2GSJA 4P7RA 1V3HA 3AYRA 3PTQA 1OSEA 1MW1A 3EDEA 3SUTA 2CKSA 1H2JA 3WNPA 3ARZA 1GPFA 2YLLA 3BLKA 2OWXA 1E4LA 1W2PA 3CHFA 3PZ9A 3LPOA 3NDZA 2Z1SA 4AD4A 1HVQA 2DT1A 5EBAA 5E09A 3WEZA 1OBAA 3PZNA 1W3HA 3TTOA 2DSKA 3N13A 3QOMA 4MAVA 4PRWA 3W6MA 1MFVA 4YHEA 2BFGA 1GOIA 1J18A 2XVKA 3OZPA 4AC1X 1QBBA 5FD0A 5FKYA 4AD0A 5DT7A 1ZB5A 4PMOA 3ARPA 4FMVA 3VGFA 1YHTA 4D1IA 4P7OA 1LQ0A 2WANA 4GI6A 5ABGA 1UH3A 3WKZA 2WMGA 3GBEA 4F79A 1V02E 1ODZA 3S2CA 1JYVA 2ZX7A 3N11A 5CPQA 1XD0A 3JUGA 3CZJA 2JE8A 1GORA 3IAQA 4NSBA 1E4IA 5IHRA 5D8ZA 1EO5A 1LG1A 5C71A 1UWRA 4TUFA 3WMCA 1J10A 1FOBA 3B9DA 3ZT6A 2DT2A 4H7VA 1CWYA 4LYPA 3NJ3A 1CIUA 3VDHA 2F8QA 3AOFA 1O7AA 1R86A 2DT0A 4OZOA 1W2VA 3WF1A 4KRUA 1UHVA 1R7AA 4WJXA 1JZ5A 3F4VA 3T2QA 3RMEA 2UWFA 1QI2A 2XUCA 4AYSA 3FW6A 4MNLA 2E40A 3SCQA 3VIPA 2YJQA 1B30A 2ZICA 3A47A 2XJ7A 4F9DA 3LMYA 1EH9A 1XV8A 1UQYA 2WC4A 4UOJA 2OSXA 3U5UA 4UQAA 2GUYA 3WDQA 1LL4A 2XPKA 4D72A 2WKGA 1QVBA 4V27A 1O6IA 3T09A 1CTNA 3A6OA 1UD8A 1KR1A 2J62A 1A47A 4GXPA 4WIWA 1GCYA 1DEDA 3RPMA 5CXPA 1BGGA 3SCTA 4RE3A 4F66A 2PWFA 2CETA 2ZXAA 1UG6A 4PMVA 4XB3A 3WUGA 4ATLA 1KWKA 1JNEA 1EDQA 1LF1A 2XVNA 1NM9A 1XHGA 4CD8A 5CPSA 3ZIZA 1FFQA 3VUPA 4W86A 4QAWA 1XH0A 5LYRA 1BPLB 5GPRA 3CUFA 4A4AA 3KL3A 4A3YA 3F5KA 1MW0A 3POHA 1IV8A 7CGTA 3AIQA 1G94A 3WDHA 1BF2A 3VX1A 1X1NA 3PZUA 5BXSA 2WMJA 3EYPA 2BVDA 4WKAA 3N04A 4QLJA 3EMQA 2VMFA 1IZJA 4IISA 5DF0A 3B9AA 2EPLX 4P8UA 3MU7A 4AEEA 1CGTA 4HU0A 5CSUA 2J7HA 2EQDA 3WL1A 3WUFA 2GVYA 3VIMA 1UD6A 1XGZA 1ESWA 3PZIA 2UY5A 1KXVA 1CLVA 4UCFA 4PMDA 5CLTA 4W7UA 1JGIA 2V38A 3W29A 1U33A 2O9OA 3CMJA 3MSDA 4WSKA 1H11A 1KFWA 2E9LA 3OZOA 4RE2A 3RO8A 5TD4A 3ZR5A 1PBGA 3SURA 5M5DA 2O92A 2X0YA 4NF7A 2DIJA 5D8WA 4UQDA 2FGLA 1ZS2A 3W0KA 4FLRA 2BNJA 2FHCA 4EAMA 5GNXA 4MJ4A 1OD0A 2PC8A 4YHGA 5CZKA 4URIA 3CHCA 2TAAA 5E0FA 4J3TA 1ISVA 3ZJKA 3KWXA 3DYMA 4BQ5A 3M46A 4GZIA 1CXEA 2CIPA 3WD2A 4HA1A 3NYDA 2VR4A 1PJ9A 1Q6CA 1PX4A 3CZEA 1NP2A 4UZSA 1GHSA 3WL0A 5IFTA 3AQUA 3DYPA 4QLKA 3VTRA 4AY1A 1WKYA 5EMYA 1HKJA 5A95A 4Q22A 2OYMA 3W26A 4AMCA 1FHLA 4B15A 2J7GA 2WHMA 3BAKA 1ZJAA 4M56A 1GOKA 1E72M 3IJ9A 3AZSA 1B3XA 3GYCA 1CNVA 1EIBA 4HZ7A 5A6SA 2Y5EA 4DWSC 1OWQA 1TE1A 3VIFA 1KB3A 1DHKA 2VO5A 3UG4A 3E1F1 2EPNA 3VVGA 5A3HA 1JL8A 1OD8A 4PSPA 4LQ1A 4JFUA 3WQWA 4PTMA 1VEOA 3SCOA 3WF0A 1JG9A 1XH2A 4HOXA 2WK2A 2WNWA 1TG7A 4W7WA 2YL8A 1HKIA 1GJUA 4OIFA 2V3FA 3ZJ7A 4CN4A 1XRVA 1CGVA 2IXUA 4HMDA 2D22A 4PMQA 2OYLA 2ZUSA 2YBTA 1HJXA 3WD3A 3K4DA 3UETA 2VTFA 5E70A 4AZCA 5AC4A 3WQ4A 2BVTA 4JKLA 2XGIA 4PYSA 5C70A 3OG2A 4F9JA 2WAGA 4H8HA 5F7UA 5E6YA 1JAEA 3T08A 1EA9C 4HP5A 5CQ1A 3W27A 4K68A 1OINA 1VJZA 3AS2A 2UY3A 4J3XA 1E55A 3A3HA 1ZBWA 3ZT5A 4AISA 9CGTA 3F5JA 3ZMRA 3DYOA 4HPGA 4GINA 4M29A 4PCTA 5DFAA 4DWSB 4J28A 3ZR6A 1BYDA 3CBWA 1WPCA 3WDRA 3M07A 1UOKA 1UR0A 5HPOA 2ZUTA 3U5YA 5A6AA 2DSWA 2JIWA 3EDJA 1W91A 2EEXA 1KQYA 3MS8A 4D6GA 2VZOA 2HVMA 1WZKA 1H49A 3AIVA 1VFUA 2QLYA 1TZ7A 3N15A 1W1PA 1X6LA 4PMXA 1CGUA 1UKPA 1YQ2A 1JFHA 2PB1A 2BY0A 1ITCA 2FGZA 4DM2A 1KWGA 2XGBA 2VOTA 2ZE0A 3APGA 3DHUA 4P7NA 1PEZA 3EMCA 4HA3A 2FDMA 1G5AA 2VC9A 1J9YA 4MDPA 2A3CA 2FHFA 4JL2A 1HJQA 3NUKA 3VU2A 4B16A 3NCOA 3CO4A 3ECQA 5ECUA 3U7VA 2GK1A 1FP9A 2O9RA 1ECEA 3KE0A 5CJ5A 1BG4A 3SCUA 2WVVB 3THDA 3W6LA 5BXRA 4DM1A 2ESCA 2V3DA 3VGDA 3BAJA 2PBGA 3M6DA 2UY4A 3WF3A 1MYRA 1E9LA 1VENA 4Q7NA 2FHBA 2JIEA 3VX0A 2RGMA 1UH4A 5JBDA 1HN1A 1MQQA 3W25A 1MQRA 1QNOA 2D23A 1CDGA 5A6BA 4KRTA 2XTKA 1EOKA 1GOWA 2X0HA 1C91A 2XSAA 4W8AA 3SCRA 4IPLA 3VMOA 1EXPA 3CZKA 3AHTA 3CZ8A 4IUGA 4PMYA 1C8YA 3EDDA 3GXIA 2D0FA 2DPEA 1QW9A 1E0XA 2WLZA 2V3EA 4QCEA 2WW5A 3TTYA 2EBNA 1R87A 2A3BA 4CCEA 1KXHA 3TA9A 2WYSA 3ARWA 3PZMA 1DTUA 2DDXA 2J7FA 3AFBA 5D9OA 2CBVA 4J7RA 4NRSA 5M17A 3VM7A 1W9DM 3GXDA 4S3KA 8A3HA 1NWUA 5HBFA 4E2OA 5ABFB 1HXJA 4DUVA 3WQ6A 1FHDA 4CN1A 1OB0A 4J3SA 3VIIA 2CEQA 2CYGA 3OLDA 1OT1A 3SUVA 1NARA 3WDJA 1HP4A 3N1AA 4ZFMA 4V28A 2YA0A 3VINA 1GUVA 1UWIA 2VQUA 2XVLA 1LL7A 1MW3A 1TA3B 3CHEA 1B1YA 1VBRA 1UWSA 5CGTA 5IFPA 1E1EA 2VT0A 3BC9A 2DGAA 1P6WA 2OWCA 4HTYA 3K8KA 1D3CA 1QBAA 4J3UA 4QFUA 3THCA 1JYXA 1K9EA 2WMIB 4WF7A 3POCA 3KEHA 2VJXA 4QP0A 4Y7EA 2ZX5A 5I23A 1U2YA 1E43A 4LXFA 2D24A 5AY7A 3N9KA 4U31A 1PZ2A 1VFFA 3MKKA 3K8LA 1Q6FA 1B3YA 3GDBA 2BVYA 2YL9A 1ISZA 1ITXA 2NT1A 3CTTA 4MNMA 5I77A 2G3IA 2XHYA 2NT0A 3W28A 3MANA 3ALFA 3BXWA 4NZCA 1CXIA 2PWDA 4YPJA 1J12A 1W9BM 3K46A 2YOCA 1NH6A 4GI9A 5E0CA 3VMNA 3MUAA 5JBFA 1E6NA 1W1TA 3AS1A 1GJWA 1MW2A 1E70M 2GJPA 1OGBA 3GBDA 1V02A 2VRJA 1VEMA 1MVYA 1B90A 2DQXA 3VGGA 1QHOA 1JXKA 4W84A 4HU8A 3SCVA 5A6MA 1E6QM 3L2MA 4U3CA 4MB1A 1V03A 3KL0A 3VILA 1B2YA 3RM9A 1HVXA 4Z2GA 3VKKA 3SCPA 3VGHA 1HX0A 3W81A 1QI4A 2VZTA 2J8FA 4GKLA 4P7QA 4V2XA 2Y4SA 4C7GA 4EANA 2E4TA 1J0ZA 4PMUA 4LYRA 1UKTA 3AMLA 3NIYA 2AOSA 3IANA 4UZUA 1Q6EA 2C0HA 4MB3A 2WSPA 3OBAA 2JFEX 1EOMA 3FAXA 2XWDA 1CXHA 3VNYA 3W38A 4UFHA 3RIKA 4E8DA 2YBUA 2WMHA 1PAMA 3KL5A 4XUYA 1J0JA 2ZWYA 3VDAA 3L4UA 3WBEA 3I3BA 5I3DA 1GQIA 1DWJM 1J01A 4J3WA 2G4FA 3N18A 2WVTA 4AWEA 1M53A 1X6NA 2Y8KA 4AZGA 1BLIA 1JDAA 3VMPA 4CU6A 5A2CA 1CENA 3B8SA 1WDRA 2HISA 1CGXA 4JHOA 2CNCA 4HMCA 1KGXA 1B31A 1ZL1A 2X09A 1BHGA 3OGSA 2XWEA 1H0GA 3AMGA 3DHPA 3F5LA 1HJUA 4B9YA 3WNLA 4DWSA 1B9ZA 2NSXA 2YL6A 1WAWA 3VM5A 2PWHA 3I3EA 1JF6A 4CCCA 3MMUA 2E3ZA 4PTXA 1E73M 2YA2A 1HP5A 1J0YA 4L4PA 1EQCA 3AISA 4ZENA 2DT3A 1NOFA 1CGYA 2CXGA 4M24A 2PF0A 3TOPA 3VIKA 1XCWA 2QMKA 2XFFA 4OOUA 3EDKA 3ALGA 1E5JA 3OGVA 1VRXA 4CD5A 1H4PA 1Q4NX 3NSNA 2OYKA 4F8XA 1SMAA 3WMBA 4PMNA 4JFVA 4UQEA 1WZAA 5A8NA 4GPNA 3AIEA 3O9NA 4WKHA 2DIEA 2DSZA 3BAYA 4JKKA 2C7FA 1MQPA 4AIEA 1V6XA 3VIOA 1U30A 4JCLA 1UKSA 4JL1A 1PX8A 1UWQA 2QV4A 1US2A 5BXTA 2DSUA 2Y24A 4CCDA 7A3HA 2XG9A 2WXDM 5D4YA 1EGZA 2VR5A 1WE5A 3QHNA 1SMDA 1C90A 4AD5A 5IHSA 1EDTA 1KXQA 2BY1A 3EDFA 2WVVA 3ZSTA 3AHZA 1WDQA 1E6ZA 1GVYA 3WD1A 4XZWA 3PN8A 1GVIA 3G6MA 2JEQA 1QNSA 2GJXB 2E8YA 1UD3A 1XSIA 2ZUMA 2Y8VA 4MB4A 1V3MA 1M03A 4GZEA 3ARYA 4D6CA 5FCZA 4A3HA 3L2LA 4W8BA 3VD9A 5JUVA 2G3NA 4UFJA 1UKOA 5AYBA 3PZQA 1FH8A 1HL8A 2VZVA 5GNYA 3CUGA 3CZGA 1AQMA 2W91A 2MANA 3HU7A 1H09A 4H41A 4X9YA 4W5UA 4D6JA 5DO8A 5FOOA 4HOWA 1UR1A 5IXEA 1QNQA 3AJ7A 1C92A 5CG0A 2VNCA 3CLWA 5GNZA 1EO7A 2X05A 1BSIA 3GNOA 3MUZ1 2BS9A 1QPKA 3AIBA 3OLGA 1EHNA 4ZE4A 3BAWA 4MNKA 4D6EA 2IXVA 3PHAA 4JCMA 1FH9A 2J4GA 1E0VA 1DWHM 5DEZA 3BSGA 3ZQ9A 2D20A 2WBKA 3VD3A 4BS0A 4ACZB 2F2HA 5ABFA 3ARQA 2J25A 4U5KA 3RCNA 1BVZA 3VIGA 1JZ4A 1H5VA 1Q6GA 1V3LA 4PTVA 2CCRA 4PSRA 4UFKA 3A4WA 1M7XA 4WLCA 1BYBA 1KCKA 4GIAA 1RP8A 3AHYA 1TCMA 2XM2A 4X0VA 4UFIA 4ACYA 1R7OA 3OA5A 1JAKA 3VO0A 4W93A 1E6SM 1HJSA 1ZBKA 3VIHA 1E6PA 1UWTA 1DWFM 2WCGA 1K9FA 1N82A 4XV0A 1GOOA 1ISWA 4TVDA 2YL5A 1SYTA 1NOWA 1CEOA 1CYGA 4CGTA 4UQ9A 3UR8A 4DUWA 1UR9A 2WHLA 3EMZA 1PPIA 3RJYA 4W89A 2ZX6A 1V6UA 3VDCA 1KBBA 5EB8A 1QHZA 4UTFA 1ISXA 2BHZA 4PTWA 3VGEA 4AD2A 2XVGA 3VD4A 1MFUA 4CU7A 2CPUA 1UYQA 3WH7A 3QR3A 1HL9A 3VPLA 2ZIDA 3FAWA 3MMWA 3AHXA 2WVSA 3PZGA 2WZEA 2VQTA 4OOZA 2WMFA 3MUY1 4ZE5A 1K9TA 4X0NA 3PZOA 2VRKA 3SIMA 1GHRA 4HZ8A 2DEPA 4GQRA 3II1A 2XIIA 1C7SA 1EQPA 3WQ8A 2WC3A 2BXYA 3K8MA 1W3KA 5A8QA 1RD6A 4MDOA 2F61A 3GH7A 2WCSA 4L4OA 5ABEA 3WMSA 2G3MA 1J0IA 1WNOA 1J11A 3D5HA 1E6RA 1OGGA 1UR2A 1BQCA 1JD9A 3AMCA 1TFVA 3WEOA 1F4AA 4OKDA 3WQ5A 1B0IA 4FK9A 4P8WA 1ZJBA 1G1YA 5A6LA 1J0KA 1WZMA 2YA1A 5AYIA 5IDIA 2CBJA 5FL1A 4TX6A 3WH6A 4TVCA 3L4WA 4U2ZA 2Y2WA 1BFNA 3RJXA 2QHAA 5I6SA 2A3AA 1JNDA 4TOQA 1JXJA 5HPCA 1L8NA 4M8UA 5BCAA 4BQ2A 2EJ1A 4AIUA 1E3XA 3SUUA 3PBGA 4JFSA 1LWHA 2BXZA 5LA0A
chains in the Genus database with same CATH superfamily
4GLEA 2OWWA 2WHJA 3N2OA 4AWSA 2VC5A 5DLCA 1DIEA 1DIKA 3PM6A 3HMJG 2R14A 4KEZA 4AVFA 3UJSA 4O18A 3NQVA 4RLIA 1Q45A 4O1BA 3SGGA 4JN6A 4EKJA 3HFYA 4JR5A 4ZCWA 5I79A 4S3JA 4BCEA 3TUUA 3REQA 5FI8A 1XGDA 1R8LA 4AD3A 3WLKX 4MJ2A 2W9MA 1C3FA 4PUDA 1RCOB 1G67A 4M1BA 3PWIA 3CWOX 2OELA 1XQLA 1VLIA 1H0IA 1FWWA 4K38A 1NWTA 2PWGA 2BX7A 3WH8A 1BVNP 1FWCC 3T81A 3SUSA 3CHVA 4AVOA 3ORWA 2ACUA 2ZZ5A 1GOMA 4L6DA 3TAOA 4JFTA 3M0KA 3GDRA 4YIWA 2JEPA 1MEIA 3AMDA 1V3JA 3LPFA 4I8DA 4D6HA 1PZ3A 1N8FA 2AQVA 5D9PA 1TV4A 1V0MA 1XLIA 2J47A 4FP1A 4LEFA 4MAZA 2XZ7A 1XD1A 3VOIA 3MUIA 2PUZA 4R27A 2QUMA 3GAKA 1H1YA 1IEWA 1IXNA 4FIQA 2WVUA 3BJTA 2QCDB 4UFMA 2EPMX 3BMVA 3NQMA 4AHOA 3QY8A 3NQ7A 4HOZA 2QZRA 1CGWA 4AZ6A 4ASTA 3CU2A 4D71A 1SQ7A 2QDHA 4H9YA 5D33A 1CXLA 1YXYA 3W7PA 4EK7A 1VD6A 1XL9A 2J7BA 1XIHA 1UH2A 1EFZA 3LYEA 4P8XA 2G50A 8CGTA 1JZ3A 3N3TA 4HNCA 3URAA 4XBKA 1BF6A 5E6ZA 3AUOA 2XSBA 4YVPA 3ZYZA 2VZSA 2HJPA 3FHQA 5I5RA 3N6HA 3TN4A 1TE6A 3J7HA 4MZYA 3WO8A 4CD4A 3OVGA 5FEZA 3W76A 1EJWC 1XH1A 4N9DA 4ERAA 2JF6A 1V0NA 4PUKA 2AMXA 1DWIM 2J24A 5AHNA 4I5XA 5HQMA 2QGHA 1FP8A 4R88A 1E3ZA 1SW7A 2VGGA 1QTWA 1VCFA 1ME8A 1S2UA 3V5OA 3O2LA 1UZ1A 3RLVA 3R1ZA 4CEUC 3Q2DA 1UR3M 5HMDA 1K9DA 3SN4A 4BQ4A 4HZ6A 2WKLA 2E9MA 4TTUA 2GDVA 4JTFA 3E38A 3QQ0A 4YTTA 2I9UA 3CEPA 4ES4A 4Y8EA 3KTSA 1E1CB 5A69A 1Q66A 4Q8UA 1IT0A 1XFBA 3PZTA 1OFBA 1SZRA 1M1BA 2R1PA 3FS2A 1KQZA 1FWEC 2E9BA 3P74A 5EMLA 5CPOA 1FHVA 3A24A 5FEXA 4ACZA 3UQNA 5DCBA 1GVSA 2W61A 4KS0A 3WQFA 3G3DA 4HSHA 4IFRA 2J74A 1KFCA 5FF7A 1OJXA 4NJGA 3V0SA 3EKZA 1VBHA 4JX4A 1S1PA 4HNNA 3OW1A 3ABOA 4JKMA 3O6DA 2OSWA 3OLEA 4NI3A 1NJJA 2BV9A 1W9XA 4WGHA 4AZIA 2YDSA 1UZ4A 4NNAA 2WJFA 3UERA 3TTSA 2GK1B 3P5YA 1IQ8A 3PY2A 2CLOA 1G6CA 1PUDA 1BD0A 1F8MA 4B3LA 1P48A 4D8ZA 4C65A 4EXQA 3C86A 1V6YA 3WK3A 2X16A 1OIFA 1EF3A 3HN3A 4AZ5A 3BCFA 4LYQA 4HK5A 2DSVA 4IP5A 2QCNA 3R25A 3IJ7A 4XK2A 1W0MA 3OA3A 2C1GA 4GNJA 5KETA 3L68A 2CLPA 3H2OA 5A2AA 4PUJA 4Q32A 3S2NA 3W7RA 1ISYA 2YDAA 4OE7A 1ZHAA 4BF7A 3GG8A 1AH4A 2VFDA 3LM7A 1G4SA 4MNJA 2WHKA 2ZUNA 3EBVA 2A85A 4AH7A 4GIYA 3O6AA 5JH2A 3VZXA 3AXHA 3NZQA 1JIBA 3HMCA 1EHAA 2VUYA 3G1VA 2GGIA 4IMGA 1CLXA 2DP3A 2GJRA 1W5OA 4QG9A 3AMKA 4QJ4B 3UY7A 4G7EB 1TPUA 2ZVRA 2W92A 3WCZA 3K4AA 5LXEA 3LLDA 4GX8A 4Q8QA 1TR1A 3PJXA 2J77A 2X8RA 3MCMA 4K3ZA 3UWWA 1W9PA 2EPKX 2JGYA 4C7DA 5MKGB 1V08A 2UZ9A 3W7EA 3OB8A 1P0EA 1ZZMA 2R91A 4HZMA 3BOLA 4S3EA 6A3HA 2QCMA 3ZLFA 2B31A 1YXCA 5IM51 2V0TA 1QNPA 3ABQA 2O9TA 1EPXA 1I1WA 3RRXA 5LHFA 3CNYA 1UQZA 2J13A 2A79A 3HBLA 4E2VA 4YVXA 1GNXA 3ZT7A 1PTDA 3UXLA 4AQLA 2NLYA 3SADA 4GUFA 3W53A 3WLPA 2D3LA 4KCVA 2J7EA 3N2TA 3ZJ6A 3BV7A 1FXQA 1OY0A 1FFRA 3UCQA 3IK4A 4JIRA 1FA2A 5AVHA 3C0LA 1MRAA 5BXPA 3VI2A 3B9NA 4LUTB 4H83A 2D73A 1SJAA 3LV6A 3LMZA 5BYWA 5C7VA 3MI6A 3VKDA 3TNBA 4UQCA 2Y5JA 4E4PA 4RW5A 1QI5A 2WCAA 4B5TA 4IPJA 1TWWA 2ZC8A 1XKYA 4H6RA 4FNQA 3TWAA 2VURA 3DI0A 1JZ7A 3THAA 3GK0A 2TRSA 2CHNA 2CLFA 4OBTA 1DE5A 4MY1A 2QCDA 1W1B1 1P7TB 4RR4A 2CITA 5CZSA 1WBHA 4N0RA 3OEXA 3RMJA 2ON3A 1RJQA 4AX7A 3FJ4A 4RV3A 3TJIA 1W1YA 1GGOA 4H4IA 1JF5A 2HSAA 2XIJA 1LJYA 2G41A 2WMIA 2VFGA 5BWAA 1GTEA 2FB2A 5AHEA 4DIAA 5M03A 4UNIA 1QK2A 3ONBA 4US5D 3LGDA 2W66A 3U7BA 1TYGA 1WDSA 3ARXA 1VF8A 2WMKA 1VFOA 3IWPA 2V5KA 3XISA 1VEPA 3FV9A 1JZ6A 2OQYA 3H53A 1H7WA 5C8BB 2KAUC 2E5CA 3AZTA 3I6TA 2HWGA 3ATYA 3DEQA 4D1JA 2ZZ7A 1LLOA 2X2YA 4JIIX 4RDWA 1UKQA 1Z44A 1KXTA 1PKYA 2H90A 2WB5A 3W73A 1DQUA 4N9CA 3EWDA 2I5QA 4JQAA 3SEPA 3S83A 2O9PA 1W3JA 1JPKA 5BOOA 2ANUA 2UV8G 3UZZA 1QASA 1E1CA 3RM4A 7ODCA 2ACQA 5I03A 1TJ1A 2PCQA 2FFIA 3ABSA 4G1NA 4O19A 3D3FA 3IK2A 3MWAA 4JQ3A 3LG3A 3RX3A 5G2WA 5BRPA 1DXEA 3LCGA 3A4AA 4QRNA 4R33A 4IGMA 4NRRA 1CZ1A 3H12A 3COTA 3WNMA 3PTKA 4PN2A 3TW6A 1HKVA 3QY7A 2UY2A 1HL2A 1TREA 1XFCA 3W1QA 3O07A 2ZA3A 3WUBA 1MWOA 1TPFA 3E3HA 3HJEA 2X1UA 2PGEA 4GO9A 2PDFA 1UP3A 1V6WA 4CU8A 3S2LA 4IIBA 1A3HA 3TYDA 1G4EA 2X1IA 5DXYA 2WWCA 2FH6A 3WQCA 1Q8JA 3M7SA 5FEWA 1DJGA 3FYYA 4OFCA 4DELA 4W85A 4JN7A 1NELA 4AY8A 1CB7B 4JTKA 1QCWA 1XIFA 1XSJA 3OQEA 1H7XA 3K4WA 3ZOAA 2A0NA 3TSBA 2GQ3A 3USBA 3W24A 5DMYA 4O0QA 3V1PA 2WZMA 1ITQA 4AZHA 1I0BA 3N29A 3WF4A 3WQDA 4D6IA 4Z2JA 1K8ZA 1PIFA 4L64A 2C0AA 2P3ZA 3GUWA 2ACRA 2Z7GA 3MV01 5DMMA 5IBXA 2E0PA 2D3NA 3LCIA 4R5EA 5BU6A 4UNLA 2CZFA 4A6GA 5LGXA 5CBJA 1XQKA 4NZ1A 1SW0A 5H8PA 1E15A 3OVRA 1GKQA 2HNHA 1F2JA 4HPJA 4Z2HA 4JTSA 4ONVA 1F4HA 4WXYA 3DIPA 4R7OA 3R13A 2YYUA 1EX1A 4UTHA 1QPOA 2GSJA 3LQGA 1AJ2A 8XIAA 1SO5A 3QLDA 3S9ZA 1H2JA 3WNPA 2OWXA 3BLOA 4N4PA 1W2PA 4JX6A 3B4YA 1HVQA 1F5ZA 5E09A 2YZ5A 3MCOA 1OBAA 2Z4GA 1OFEA 3PZNA 3N13A 3STGA 4QQUA 4PRWA 4MG4A 4EACA 2XVKA 3Q67A 4LWWA 2P50A 5FKYA 5J04A 3UVAA 1J2BA 4ZO8A 5LZLA 4Z1CA 4AD0A 2YZRA 4O1FA 1ZB5A 3G1YA 4PMOA 2QJGA 3ARPA 4FMVA 3LZ3A 1YHTA 4D1IA 5AHFA 4P7OA 1UH3A 1XP3A 4LUTA 1SJBA 3WKZA 1V02E 1ODZA 5FJRA 2NQ5A 3QN3A 1A5KC 1XD0A 3KRSA 4HNVA 4NSBA 1DQWA 1GJPA 2OZ8A 3TR2A 3WMCA 4L6OA 4H7VA 3R89A 4H6QA 2DT0A 4OZOA 1W2VA 2AL2B 2B7NA 4KRUA 4ZFCA 1R7AA 3GS6A 1TELA 3T2QA 1P7TA 3M0LA 2UWFA 3DFHA 4AYSA 2Y89A 3FW6A 4MNLA 1V4YA 2R6OA 2A2IA 2ABAA 1RY0A 3TA6A 3C0QA 4JNYA 3TLQA 2CLIA 2C1HA 2OSXA 2PP0A 2FLIA 3U5UA 4UQAA 2XPKA 1O6IA 4DJFA 3T09A 4QJ1A 3A6OA 5EY5A 1KR1A 5K7JA 4H7CA 4GXPA 4WIWA 4WZHA 1PVNA 4RE3A 4YWIA 2QEZA 2QIWA 3PPCA 3QV8A 1G4TA 4L9XA 1KWKA 3WLQA 2ODOA 3TN3A 3TQ0A 1EL3A 1LF1A 5CPSA 1EB3A 1F76A 3ZIZA 1FFQA 4QM1A 2GQAA 5LIUX 2J27A 3H21A 2YBVA 4HYWA 4W86A 3LXCA 1XLLA 4QAWA 1UJPA 3INPA 5GPRA 3CUFA 3KL3A 4XO6A 3POHA 3EX3A 5JU6A 4C6PA 1GYNA 2Y70A 3VX1A 2JKEA 4DAFA 2CXEA 2JKPA 3Q4DA 1WA3A 3GVQA 3BGJA 3VNKA 1IZJA 5D37A 2HEJA 4A22A 3O7UA 4X2RA 3B8IA 4UTLA 3WL1A 3NQBA 3SSZA 3GIPA 1XGZA 4Z0SA 5HJYA 4UCFA 1XC4A 3W7HA 5EMUA 3UZJA 3ZR4A 4JYDA 2V38A 3D6NA 4TQTA 3RU8X 3MSDA 3BLIA 4KEVA 1J6OA 3O16A 3ZR5A 1AL7A 4WD0A 3OOQA 3UR2A 4CLMA 2DIJA 5D8WA 4FLRA 4CQBA 4DAIA 2BNJA 4LSBA 4EAMA 3GDTA 4BWLA 2YCEA 1JEZA 1S5WA 3PB2A 3BPWA 4MJ4A 1OD0A 4YHGA 3GHTA 3M6YA 3NFUA 3ES8A 4FS9A 5BMWA 3DYMA 3M46A 4GZIA 1UBPC 2X40A 4KFNA 2CIPA 4HCLA 3IIOA 4HA1A 2VR4A 1Q6CA 1X38A 5AC6A 1B4EA 4HKPA 5IFTA 3IVTA 3H4GA 2JKAA 3BG5A 4AY1A 1HKJA 5A95A 4Q7IA 2Q6ZA 4M0XA 1Z3NA 4LF2A 4V1YA 3A64A 2I57A 1FCVA 4B3ZA 4M56A 1R3SA 1Q6QA 5JH1A 4RX0A 3AZSA 1B3XA 1X6UA 1EIBA 4JGDA 2OO6A 1GVRA 3IJIA 4DWSC 5DELA 4MZ1A 1XYLA 1ZAIA 1TE1A 4XSMA 1E51A 3VIFA 2VO5A 4FOKA 1SZFA 2EPNA 5A3HA 1OC6A 4LCRA 4PSPA 1TMLA 2OX4A 5LHEA 2VM8A 4JFUA 2NUXA 1VEOA 3WF0A 1IT8A 4DZIA 3RNDA 3EOSA 3A22A 3ZJ7A 1OABA 1XRVA 1CGVA 4HMDA 2PAJA 2D22A 3JW7A 1HJXA 1KNWA 4MWAA 5CBBA 3UETA 2WQPA 4Y6GA 5E70A 4GZ7A 5AC4A 3E2QA 3H26A 2QJJA 4QX4A 4M6QA 4RCXA 3T42A 3OG2A 4O4VA 2WAGA 1R3WA 3M1ZA 4K39A 2ZZ2A 3HTWA 2VOMA 1OINA 1VJZA 3FSTA 4J5NA 4BKNA 4IHCA 3ZT5A 4AISA 3GU2A 3F5JA 5REQB 3ZMRA 3C2YA 3UCCA 4GINA 3TQVA 3I7QA 5HR6A 3GG0A 3PNZA 1BYDA 4H9XA 2BSLA 3G1SA 1N2VA 2FDSA 1UOKA 1UR0A 3OBEA 5HPOA 4LUYA 3U5YA 4LV9A 1ECQA 4O54A 1EYWA 2GL5A 4K2SA 4P61A 3LHYA 2EPHA 1RJPA 3KFTA 2PDJA 3MW7A 3AIVA 4OUIA 1VFUA 4ML9A 4XTIA 5D05A 1VR6A 5D09A 4NASA 1TZ7A 3NOYA 2OT1A 1X6LA 4ZQNA 4I5UA 1XIDA 1UKPA 3PBUA 5CCZA 3RGTA 5RUBA 4V1XA 2EKCA 4BI6A 2AL2A 2QQ6A 4FNUA 3DHUA 2X1SA 1NF0A 4HA3A 3L23A 1TPEA 1J9YA 4MDPA 1PKNA 4JL2A 3NUKA 1N7KA 4PRRA 3CO4A 3ECQA 2DUXA 1FKWA 3KE0A 3C5QA 5CJ5A 4XIAA 1PS9A 4GWEA 3W6LA 1A49A 4GIEA 4C5ZA 1OVDA 2G96A 4IICA 2PBGA 2ZE3A 3S6OA 3M0XA 1E9LA 1VENA 2HVNA 5FJIA 2JIEA 3VX0A 3CXOA 2I5IA 2RGMA 1S5TA 4DPPA 3C0SA 5JBDA 4DF2A 5LNRA 1CDGA 2AL1A 3T05A 4CEXC 1I2RA 4LEQA 4RUBA 2X0HA 3HV9A 4LVBA 1C91A 2XSAA 1KM6A 3VOFA 2RKXA 1D3HA 3EX2A 4ZB2A 2IMRA 3WK0A 4QEEA 5AKQA 1K77A 4IUGA 1C8YA 3GXIA 3N4FA 5HWNA 2TYSA 5G1MA 2WW5A 3TTYA 3CL7A 2EBNA 1M5WA 2ZRUA 5D2TA 1KXHA 4CQAA 3ARWA 3ITOA 2W3ZA 5E5CA 2Z2UA 3MVTA 5HBFA 3LHUA 1EP1A 1K1DA 2QCHA 1RQHA 1DOSA 3ITYA 5XIAA 5G4WA 4J3SA 3H7VA 2OOGA 3OLDA 2C91A 3B8VA 3QF0A 3UU0A 3SUVA 1AH0A 4X2PA 1MEHA 2YA0A 3VINA 1GUVA 5CJMA 4ZMGA 1KTCA 1Y8BA 5T26A 3B9OA 2H3BA 2PP3A 1D3CA 3D0CA 3THCA 2HK0A 3QPYA 1K9EA 4O14A 3KEHA 2ZA1A 3FOKA 1VHNA 5I23A 1U2YA 1WOAA 3ZVIA 5E9XA 3U2CA 3CPRA 4BI7A 1TIMA 2QV5A 1BXCA 2BVYA 3LNMA 1ITXA 1VLWA 2NT1A 3MPGA 2I5GA 2G3IA 5LIXX 5LNWA 4QJ3B 4NZCA 2PWDA 5CBIA 3CQ0A 1W9BM 2IPFA 3S1WA 3DENA 2YOCA 4GI9A 4RNHA 3G0SA 1GZGA 3MUAA 4GI4A 4GX9A 3THQA 4LYKA 2GJPA 3OVPA 4MFEA 3GBDA 5F2GA 3UPMA 1A0CA 3VGGA 1QHOA 4HU8A 3L65A 4ZBCA 5A6MA 2P5NA 3L2MA 4MB1A 3R79A 3KL0A 4QEHA 3VILA 2X7VA 5AC7A 1R0MA 2QJNA 3HQ1A 2VEMA 2GVEA 3VGHA 1HX0A 3TYCA 1QI4A 2VZTA 2GOUA 4U28A 4GKLA 4V2XA 2Y4SA 4GH1A 1J0ZA 4PMUA 1RLCL 3L2IA 4HVXA 3SW6A 3FIGA 3RYSA 1UC5A 2PMQA 4MB3A 3L5LA 2WSPA 4YJ5A 3OBAA 2OG9A 3FAXA 1ENUA 2XWDA 3W38A 4L1XA 2YBUA 2OZ3A 2HQAA 3KL5A 1G7UA 3LRMA 3HGSA 3VDAA 3L4UA 4G56A 3SN1A 3I3BA 1XDLA 1O4UA 5EBUA 4H9ZA 1IIGA 5HANA 1US0A 2W27A 3FYOA 4Q4PA 1XPYA 3H2EA 3LX9A 4LNYA 3PWAA 3NVDA 4B5SA 1X6NA 3KZPA 4AZGA 1H51A 3K1GA 4GACA 4PL1A 3ITVA 3UYIA 4JHOA 4DZ5A 3W87A 1OFDA 2CNCA 3KLKA 4LH8A 4HMCA 1KGXA 2X09A 3PBWA 5REQA 2OTDA 1A53A 1H0GA 3AMGA 3DHPA 1HJUA 3WNLA 2JQXA 5K4ZA 4LT9A 3AUJA 5D04C 3UA3A 1ZSXA 1OC5A 2PWHA 1PTGA 4O4WA 3EKGA 1TO3A 3KP1A 4UTKA 2YA2A 3CQHA 4L4PA 1Z6KA 1EQCA 3TZNA 3AISA 4A29A 2DT3A 2YGYA 2G97A 3VIKA 1XCWA 1XUZA 2OZ0A 3FX4A 3GQYA 4ZO9A 3ALGA 1I0DA 1OEPA 3NSNA 4F8XA 2VEGA 4KQNA 3E0LA 4JFVA 4UQEA 1WZAA 5A8NA 1W54A 2A3LA 3OQ8A 3GR7A 1V6XA 2NUWA 3VNLA 3W1XA 1NDYA 1YPXA 2DSUA 7A3HA 4CCDA 2WXDM 3W1RA 2XIMA 5C9XA 1WE5A 3AWNA 1SMDA 4L6HA 5CG7A 4GUGA 5HINA 3PTDA 3EDFA 3BCJA 4BF9A 1WDQA 4F0SA 1NF7A 3CYVA 2W6RA 3V18A 1QOQA 5I3IA 1UD3A 2ZUMA 3KXQA 3VNDA 4MB4A 2Q3RA 4O1DA 3GXNA 3WLOA 4W8BA 3MC5A 4UFJA 3LOTA 4NZ3A 1FH8A 3CZGA 1XLGA 3DDMA 1JPMA 2W91A 4US5A 3ME3A 5FOOA 6ALDA 1UR1A 5H8UA 4LCSA 1QPKA 4G1KA 3OLGA 1EHNA 3CMFA 4PODA 1SO6A 2P3EA 4D6EA 4I7WA 1FH9A 2PP1A 4HBKA 1VBJA 1LUCB 5I07A 2PDNA 4QNWA 1U83A 2D20A 4BS0A 1E0UA 1BVZA 3VIGA 4A2RA 3SRKA 2YYTA 1RP8A 3AHYA 4ACYA 3SI9A 2HE5A 3VO0A 3B8TA 4FPSA 1E6SM 4RXGA 2PSNA 1GKRA 2CLMA 1RK6A 1SW3A 2OGJA 2OVLA 4DBSA 3T0CA 1LT7A 3H2CA 2YL5A 1L6FA 1NOWA 1CEOA 1CYGA 5KTLA 4CGTA 6ENLA 4XG1A 5B7YA 4AYGA 1RY8A 4Q33A 3UGRA 4NZFA 1PPIA 1KV8A 2Y6ZA 2REQB 1QHZA 4UTFA 4XUGA 3NAVA 2PDHA 3EWXA 1VYRA 2BZNA 3TYAA 1P5BA 2CPUA 4CU7A 3WH7A 3QR3A 3FVMA 3VPLA 3MMWA 4ROPA 4XSLA 3VKCA 3PZGA 2VQTA 2OGYA 2AGTA 2WMFA 2GGJA 3PZOA 4IJRA 5GJMA 1GHRA 4G9PA 1RD5A 4XAZA 5JMUA 4QDWA 4DO7A 1EQPA 4IMFA 3K8MA 4MDOA 3N19B 1CCWB 2WCSA 4F40A 3IVSA 1WNOA 4GXMA 3YPIA 3EWBX 3GNNA 1K03A 1OGGA 1A3WA 4IWWA 1YADA 1Q2RA 3BLLA 4C6JA 1F4AA 1B0IA 2J9ZA 1NDVA 3GNXA 4A3UA 1ZJBA 1G1YA 5A6LA 2C79A 3LTPA 1WZMA 3JZEA 5AYIA 1MDRA 5IDIA 1DJXA 4FF7A 2Y2WA 1BFNA 5AZ0A 1JNDA 3RHGA 2NWSA 2EJ1A 3GU1A 3SUUA 2AKZA 1LWHA 3B40A 5LA0A 4WK9A 3WENA 4LNCA 3HGJA 1V0LA 2FJUB 4MY9A 1KGUA 3KW3A 1K8CA 1GQKA 1IYXA 2XYLA 3DFTA 1S39A 4P8VA 1GT8A 3PF3A 1KTNA 3RLUA 3GHSA 4A8RA 1LG2A 4S2BA 1OCJA 5JIWA 3NL3A 5DRCA 5BMXA 3B8UA 2BTMA 3PJWA 3L4XA 1DJWA 2W62A 3L0KA 5HQLA 2F9RA 2VENA 3DZ1A 3URBA 4XISA 3G22A 5HJXA 3GTNA 1MXGA 2O55A 3GVRA 1JCYA 1YTDA 3B03A 4MPKA 2W0UA 1ZALA 3G18A 1W3IA 3BGAA 1KD0A 4FLQA 2WPGA 1W1A1 4UTIA 2Y5SA 3TP4A 2PLKA 1TVPA 4DHGA 4QLLA 1TJ2A 1EC8A 4RZBA 4E0CA 3LRKA 1EPVA 2DUAA 4S23A 5DMNA 2ZUUA 1BGAA 1LRTA 1QT1A 2A5HA 4IQLA 1EJSC 4ILSA 3GH4A 5LA2A 3AXXA 4XZBA 5E9AA 2BMBA 4YXGA 4N9EA 4GQQA 1RXOB 4V15A 1EXBA 4NXKA 1M65A 1YDYA 8RUCA 1IIHA 3V5FA 1JFXA 1XSKA 4DUXA 4XX6A 4ZSTA 2WZIA 4HK6A 2ZWZA 1VFMA 5A6BD 2O0TA 3MUXA 1B3VA 1QJWA 1EYEA 4C7FA 3LPPA 1HG3A 4ML4A 2VX4A 4JIHA 1A0DA 4MADA 3ITCA 1NOUA 4GYPA 4QNEA 3W1LA 4IP4A 3G0UA 4KGJA 1W3NA 1QFEA 4IQEA 4UNKA 1NFPA 2GGEA 4EPBC 1NFGA 1E0WA 3C8NA 4OJYA 2W63A 4LS1A 2PRLA 3LUTA 1GQJA 2XVPA 4IL0A 2CESA 3MZ2A 4U33A 3BLPX 2FZ9A 4IL2A 3FDKA 3ARSA 1JJKA 3C2VA 4P5UA 1V6TA 2Z7KA 1C7TA 3TROA 4KWUA 3EAUA 2JGQA 4JTRA 3AI0A 3LPGA 3QHOA 3NQ2A 4DYJA 4UOZA 2BB0A 3SQLA 4V33A 4H8UA 4DWDA 2HDJA 1D8CA 3VCCA 3WH9A 4XAYA 2EXOA 5M2FX 1UA7A 5CAKA 4HSNA 2J8GA 1LUCA 1B3ZA 3IJ8A 1ODUA 3MZNA 1UP2A 3WUEA 4JHZA 4IT1A 1ZY9A 3U2EA 4F0RA 4FLOA 1XM3A 3I6RA 1NDWA 4PH6A 3BOXA 6TAAA 6XIMA 1TX0A 1UA3A 1SFLA 2VEFA 4RL3A 3SM0A 5B7ZA 6CGTA 5AHLA 3GFYA 4HPHA 4WY0B 2YCKX 5ABHA 2YCJA 4PB5A 1M04A 2RFGA 1Z32X 1V7YA 1JDCA 1EIXA 2C6QA 3KUMA 3KTXA 4GOAA 2VCCA 6XIAA 1PWLA 4MKNA 4MHBA 3W9ZA 5F1VA 4M19A 3B0PA 2REQA 5CEWA 1E4MM 4MJMA 1GONA 5H91A 3AROA 3M5YA 4CN6A 5EFDA 1Y7VA 1UBSA 3WH5A 4ZXLA 1XYFA 1HIZA 1LLWA 3CT7A 5CSYA 3CO8A 5BNKA 2XIBA 4H1ZA 4NU7A 5MHBA 3T1GA 1PIGA 3E0VA 2W5FA 4JNZA 2P0OA 2FZMA 3LXBA 4CVWA 1ICSA 1K3UA 3VCRA 1OT2A 3B0VC 4ORMA 4H2CA 5EFFA 1KGWA 1GWJA 4AMAA 4YCOA 3OP2A 2VVSA 4JTLA 3A4XA 2YB1A 3BMWA 2PDKA 4GO8A 5HXMA 4DBUA 2A3EA 1OFRA 1R9ZA 1XBXA 2AAAA 4G5DA 4UR9A 3PK7A 4ZQPA 1JPIA 1B9BA 3ZVHA 1QPQA 4UOQA 1FH7A 2J9YA 4MYAA 3P81A 3SDOA 3GXMA 1S3TC 3KTCA 1F3WA 1RP9A 3OODA 4LAUA 3G6LA 4HJWA 4O50A 4XTDA 3IVUA 1VYSX 3STFA 2GVLA 3URNA 2Y63A 1AMYA 4RNFA 3FA3A 5FIPA 3U57A 2V2CA 2FVKA 3KBNA 1IEVA 5LIWX 4UUIA 4L56A 2V69A 3TAKA 2RDXA 2TMDA 4Q8OA 2QGYA 2PTWA 3BAXA 3WDPP 1IWPA 1VGAA 2G3JA 1R3RA 3B8DA 1ALDA 1QAPA 2PD9A 3UPWA 4M80A 3DGBA 1K4HA 2QMJA 3AYSA 1H63A 4XAFA 3P6LA 5A6KA 5CLWA 5KEZA 5EMKA 2OU4A 3AICA 2Q3OA 2HS8A 3SUWA 4QCFA 4B9ZA 4OBSA 2D2HA 4UTTA 3S1VA 4DJFC 2R24A 4REQB 3NZ1A 2GJLA 3CMGA 5I3JA 1K4GA 2B0MA 3WEMA 1XGEA 1FCQA 2PDXA 1FWAC 2ACSA 2RHGA 3JR2A 3FXGA 4LBSA 3SIZA 2CERA 5AHMA 2AMGA 2FZDA 3PBYA 5C0QA 9XIMA 3HV8A 3R6IA 3NM1A 3KAOA 3ZFHA 5F2MA 3MO7A 1VJSA 4JTEA 1LDCA 3WFLA 4Q8PA 1FWHC 5HAOA 2DJXA 2FPYA 2RDTA 3LD5A 3GAYA 4OGZA 2QF8A 1F6YA 2VX5A 1CXKA 5BROA 4W87A 3OTRA 4YTSA 2JBMA 5L6UA 3SRHA 1TSIA 5CKSA 3FXYA 2NX9A 1HQTA 3UPBA 2WZHA 1JZ8A 2QCGA 4R3UA 2ISDA 5G1TA 4I6VA 3QYSA 3EZ4A 1Z42A 1E5NA 1LWJA 2PWUA 4XKMA 1YNYA 3OPSA 2BWGA 4GC4A 4BK9A 4AEFA 2AQOA 2QUNA 1R2RA 2ZX8A 2BY2A 5C54A 4IFKB 1JR1A 3MMDA 3M5VA 4LC8A 3WMLA 2KZHA 2QCFA 4GI8A 2VZUA 5BWFA 1DHPA 4BWLC 3HGOA 5CSSA 2Z29A 1EUNA 3WELA 1I75A 3RPDA 1E4NA 3WZ0E 3MA8A 4YVVA 4CNOA 3GH5A 3NSMA 4YMZA 3MSGA 2ADAA 3CL8A 4G6CA 4U5IA 5A1AA 3FLUA 2FMOA 3SGZA 3C3NA 4H19A 3VE7A 2D2OA 3W7IA 4IF2A 1PE1A 1S2VA 2V2HA 2DW6A 1HNYA 1I6NA 5HDRA 4PMZA 1K8XA 5T8GA 3SGUA 3P8IA 1JYNA 1I8JA 3CC1A 4PCSA 2WJZA 3UYCA 3S42A 3UZXA 4IM4A 5FL0A 1NIUA 2GYIA 2WZTA 3A3WA 4OBRA 3LQLA 3W4RA 1JD7A 1C29A 1Q6LA 2FMNA 2I14A 4PEKA 2ZUWA 3WLRA 1OF8A 2HVOA 3FCPA 2OXNA 3IPWA 4KCWA 1PXGA 2VFFA 4ALDA 1ADOA 2FPVA 4I6KA 2PZ0A 4HNLA 2Y8UA 3QVQA 4DXVA 4JN8A 4PB4A 1ZCCA 2PDCA 2VCBA 4ZZ9A 3R8RA 1QNRA 4Q4MA 3BCDA 4IPNB 2GPTA 3LI0A 2GSEA 3T0BA 3M4HA 4BI5A 3F4CA 3W7OA 4AIBA 2BOEX 4U2YA 1M7OA 3W1AA 4BA0A 4H9VA 3CJPA 4JTDA 2VVNA 4JQ2A 3L0NA 4KEMA 1YKWA 3CH9A 2W67A 3VDGA 2NV9A 4OUEA 1UIOA 1FRBA 5D2XA 2QPUA 1TMQA 1E9YB 1GOQA 1XCFA 4EF9A 3CV1A 3GDLA 4N6EA 1IE7C 4J35A 5FF0A 2OEKA 3QZEA 1IR2A 5CPTA 4PUEA 4S3FA 3DHDA 4RXFA 4ZEPA 2G3FA 3K1DA 3QV9A 4H8VA 1V6VA 3G8EA 3QOKA 1UASA 3CQIA 1DP0A 4N2YA 3TMQA 4E8GA 1GW1A 4GUIA 4ZB5A 1Z7AA 1QNVA 1TZZA 4H9UA 2PODA 4OT7A 1KFJA 4KKXA 3IAPA 4POCA 3IARA 5AECA 2YX0A 1MMFA 2GUUA 4K8EA 1C8QA 1MUCA 3KZSA 1VIWA 1T96A 4ENLA 3QZAA 3C52A 2C8NA 1HTIA 4ZO6A 3NQCA 3QR0A 3KOZA 2EO7A 2QJHA 3MP4A 4Y90A 2FZNA 3GZ3A 2XINA 3P8JA 4ZVJA 5HNTA 4WHBA 3SRDA 4MMWA 3ITLA 1H1ZA 1OSEA 3SUTA 2CKSA 1DJNA 3MI2A 3ARZA 4A05A 2QDDA 3NDZA 5I02A 2DT1A 4OHQA 5EBAA 2VWSA 2B4GA 1OF6A 3GC5A 3PS7A 2OLSA 4MAVA 3W6MA 1MFVA 4NG3A 2Z1WA 4IPIA 4X9SA 1ZP4A 2BFGA 1GOIA 1J18A 4CQ9A 5FD0A 2F84A 1BRLB 4NYUA 1WV2A 3EWWA 3WBXA 3VOHA 1XRFA 3LLFA 3M0HA 1TWSA 3VGFA 5I00A 4DUOA 3C61A 1LQ0A 4GI6A 5ABGA 3TMLA 2WMGA 3GBEA 4F79A 5LGZA 1UC4A 4FZIA 1JYVA 4N4QA 5CPQA 3JUGA 1AODA 3IAQA 2VDIA 1NQKA 1EO5A 5C71A 4GJIA 5I06A 2CZ5A 3B9DA 2WJEA 2DT2A 3AOFA 4JTAA 3CS2A 1O7AA 1R86A 5FEPA 3EB3A 4IX0A 3G1DA 2CLHA 1UHVA 4QDPA 4WJXA 1JZ5A 3WQEA 4GUHA 5FJPA 3F4VA 4LTSA 3RMEA 4Z42C 1LLZA 2XUCA 3SCQA 2CFFA 3QTPA 3QQWA 3A47A 3UJFA 2XJ7A 4F9DA 1L6YA 3RAOA 2IQTA 1EH9A 3HG4A 1XV8A 4HNTA 1DJHA 2VDGA 5A5WA 4IFKA 3K30A 4Q8NA 5CZJA 3F1QA 3G1FA 4NP7A 3LY0A 3EXTA 4V27A 3HPSA 1CTNA 2ZZ3A 3F2CA 1T5AA 1A47A 2DQWA 1DEDA 1ZJHA 3EWUA 3ABRA 1BGGA 3SCTA 4F66A 3REQB 2PWFA 2CETA 2VXNA 2CW6A 3PANA 3HQPA 4S3BA 4QXIA 4ATLA 2P1FA 2XVNA 3KRUA 2I7GA 1XHGA 1P0DA 2Y62A 4B92A 1XI3A 3E49A 2PDWA 1O1HA 1M6JA 2R9RA 1IXOA 2QVNA 3DBPA 5D32A 1R5YA 3NG3A 2NV1A 4XD5A 1MW0A 2DW7A 3WDHA 1RALA 5EKYA 1X1NA 4L80A 3U2OA 2BVDA 3B04A 1N55A 4QLJA 4WJEA 3PFRA 3NQGA 4IISA 5DF0A 2EPLX 2H9AB 4BJHA 4AEEA 4HU0A 2XGZA 2J7HA 3CV2A 4HMNA 4L61A 1WQ5A 1VS1A 1EWEA 3WUFA 2GVYA 1Z69A 3W1PA 1UD6A 4PFHA 1C9DA 1KXVA 3T9PA 2GVGA 1V77A 3W29A 5CPLA 5C9UA 3CMJA 3C8FA 3KM8A 1OX6A 1H11A 1P6BA 2J6VA 3OZOA 6TIMA 4GY1A 1VFHA 3B05A 5M5DA 2X0YA 3CAWA 4E6MA 1ZS2A 1A5UA 2DY3A 2FHCA 3ABXA 4CNTA 3P82A 2YCLA 5ENLA 1OHLA 2X1TA 4LC6A 2TAAA 3NL6A 3W2NA 3NQ8A 1W8GA 4ERIA 4J3TA 3ZJKA 1P1XA 2VC7A 1DORA 3KWXA 3LU2A 1DYSA 3RFAA 3NYDA 3QW3A 1PX4A 3CZEA 4YS1A 4C5YA 4UZSA 1XF0A 3BMXA 2NX1A 1S5MA 4O1EA 1GHSA 4NVTA 3QLLA 3TU9A 1WKYA 5EMYA 4UXDA 3A9IA 2RDWA 2OYMA 2C18A 1FHLA 2J7GA 2R82A 1ZJAA 4DO5A 2TSYA 3EWCA 3CIXA 1CNVA 2EGZA 4HZ7A 2B7PA 1H7PA 2OFJA 4NZ4A 4F2TA 3RX4A 3SQSA 2ZRVA 3NL5A 5KITA 4AC7C 3GSMA 1X96A 1JL8A 4WDUA 1OD8A 3AALA 3KDNA 1J96A 3P2VA 4PTMA 3DXIA 1VRDA 4ZR8A 4HOXA 2WK2A 1XXXA 3EEGA 2VD8A 1YYAA 2V3FA 5EMJA 3WLNA 2PGWA 2OYLA 1BWKA 2ZUSA 3GXTA 3NURA 3WD3A 4JTUA 3BLDA 4Z1AA 1GQNA 4GVGA 2FJKA 4DNHA 3HG2A 4F48A 2E7FA 3UJRA 1HW6A 4JKLA 1IWBA 4PYSA 5C9RA 2YCIX 1ZRQA 3N14A 4JQ4A 1O5XA 4F9JA 1YNQA 4ZOAA 3GR8A 5E6YA 3GTFA 1EA9C 3T7VA 4OWGA 1XIJA 5T9BG 1RQEA 2ABBA 4Q4KA 2Z26A 3G2GA 2UY3A 1E55A 3A3HA 1IR1A 3HPXA 4KCTA 4PULA 3MQTA 4U10A 2NXGA 1YDVA 3IJDA 2BGQA 4PCTA 5DFAA 2OKOA 2IPWA 3L21A 4J28A 3CBWA 1BRLA 1B57A 1G4PA 1DJIA 3NPUA 1EJXC 1SUXA 4HSOA 5DQPA 2FPTA 4DO4A 2ZUTA 2GJNA 4ROQA 3KBMA 2DSWA 1AK5A 2J9XA 2OKTA 3EDJA 5DBUA 1SZEA 4ADSA 2GUBA 3QGKC 2VZOA 2PDLA 2HVMA 3MKVA 1ME7A 5DX7A 3AYVA 3UP8A 5DRIA 3FKKA 1DXIA 3SY8A 4PMXA 3H2NA 3EOEA 2BY0A 4DM2A 2P0IA 4JYFA 3UF9A 1LM1A 4IGNA 2VOTA 3BSMA 4P7NA 1PEZA 1G5AA 4F0MA 1SGJA 2A3CA 1HJQA 5F4WA 3VU2A 4B5NA 4B16A 4MIMA 1XW8A 2PDBA 3NCOA 2NVCA 3U7VA 3R12A 1BG4A 2DORA 3SCUA 2WVVB 4LCQA 3UZYA 2YXOA 3M64A 3RUBL 2VELA 1VHCA 3VGDA 1EKOA 3WF3A 1MYRA 3LHVA 4C6CA 5ABTA 3S5SA 5ECVA 3LBMA 3BQ6A 3QBUA 5LIYX 1HN1A 2HNEA 3P93A 1MQQA 1K70A 2E67A 5A6BA 3C2RA 1EOKA 1GOWA 1BXBA 1ZPTA 3SCRA 1GG1A 3CZ8A 3BQ5A 1RR2A 4PMYA 4GYJA 1PZ1A 1U22A 1OFAA 1E0XA 2WLZA 1LP6A 1AG1O 2C71A 2QCLA 3M43A 3GTHA 4XD3A 2DDXA 2J7FA 4HGXA 4C6KA 4LVDA 4WOQA 5D9OA 2CBVA 1OX5A 5A8GA 1W9DM 4S3KA 1XLCA 1NWUA 3TJLA 3TH6A 1FX6A 2INFA 4E2OA 5ABFB 1HXJA 4KW2A 2H9AA 4QISA 3ENLA 3WQ6A 3W7GA 2BBFA 3PUOA 3TJXA 1MI3A 4CN1A 1OB0A 1OADA 1RAKA 1OT1A 4MSSA 2EG6A 1Q2SA 4IGSA 3WDJA 4E2DA 1HP4A 3KWSA 3N1AA 1EZ2A 3O6CA 4CNNA 1UWIA 1XLKA 4HN8A 3GHRA 3FJLA 4M3PA 3W85A 5IFPA 2GQ8A 1E1EA 3NPVA 2VT0A 4A8LA 2DGAA 1O12A 3WG6A 1H61A 4JTQA 1RCXB 2Q71A 3Q94A 4QFUA 1NTHA 2PFHA 2DZBA 2WMIB 1UJQA 4Y9AA 3LEPA 2ZX5A 1QWGA 5FF3A 1ZGDA 3CQKA 4ZB0A 4UMCA 1J2WA 1VFFA 3MKKA 1FY6A 2FZBA 1TCDA 1B3YA 2BP1A 1PYFA 2Q8LA 2AQWA 2XHYA 3P80A 2XN0A 2Q8ZA 2F2KA 3ALFA 5D2YA 1CXIA 4YPJA 1J12A 4JNMA 2B7OA 4C6QA 2PTXA 3PULA 1W1TA 3ITTA 2XN1A 1GJWA 3BVJA 3KVJA 3AU6A 3QGAC 3KOYA 1V02A 2VRJA 4GA8A 1VEMA 4UB9A 1FWDC 1KC7A 1JXKA 2OMAA 3OG3A 1IWAA 1ONRA 2OEMA 3Q45A 3T4CA 3TE9A 2RAGA 4Z2GA 2ZZ1A 3VKKA 2ZTJA 4DN1A 3EOUA 2J8FA 3HFTA 5LIKX 4IFOA 4EANA 2E4TA 3NYZA 5EGRA 1ZENA 2NQ9A 4XZHA 1UKTA 2H3DA 1SO3A 4UMBA 4FNRA 9XIAA 3NIYA 2AOSA 3IANA 1L6WA 1Q6EA 2C0HA 3P0WA 4JOMA 4K7VA 3BO9A 1CXHA 4LF1A 2AGKA 4UFHA 3EGJA 3HPFA 2QPXA 2WMHA 2Z1BA 4J9JA 1TPDA 3BW4A 4KCUA 3B8WA 3TYZA 4A2SA 1POKA 1XIGA 3WLIA 1FWFC 2GVJA 3CAKA 5G5IA 3QRHA 3EX6A 3QFEA 4AWEA 5CGQA 1W1IE 2ZQ0A 1YTEA 5JQ9A 3VMPA 3R43A 4QSHA 5J5DA 3KOFA 1EZWA 4GYPC 1CGXA 4ZA0A 1B31A 5HMFA 5KSWA 2Z1VA 4JICA 2RUSA 2VHLA 3O3RA 4AHPA 1B9ZA 2NSXA 2YL6A 1A5SA 3VOGA 4C6MA 1JRCA 3BG9A 3I3EA 4XVDA 4CCCA 3MMUA 4PTXA 1HP5A 2NQHA 1JUEA 2X1RA 4A35A 3T40A 3FA4A 1NOFA 4M24A 5IDZA 4QHRA 3EDKA 1LOLA 4DO6A 3QSTA 3W74A 1H4PA 2OYKA 1SMAA 2Z28A 3HURA 3CAQA 1NVMA 3M0VA 1OG6A 4GPNA 3AIEA 4WKHA 3ICJA 1ZUAX 3QFWA 4LRTA 5I3FA 3BAYA 3RRAA 1Y5XA 3SRFA 4AIEA 2C1IA 3VIOA 3W00A 4KT2A 1PHQA 4FX7A 3TN6A 4Q8MA 4GIRA 3LGGA 2XG9A 1EGZA 2VR5A 3ANUA 1R2TA 3DBNA 1TJRA 4FNSA 2GDQA 1OK4A 3TN5A 1DJYA 2J66A 2WVVA 3AHZA 3E0WA 1S2CA 4GVFA 1E6ZA 3CYJA 3WD1A 1XUUA 3G6MA 4Y9OA 2P76A 1QNSA 3EXRA 2DZUA 2Y8VA 3E5PA 1AD1A 4MPQA 1ZAHA 3ARYA 4D6CA 5FCZA 3NDOA 4DBDA 3L2LA 3VD9A 1K02A 5JUVA 3NO1A 1QPNA 3CUGA 3ZS4A 3C2OA 4W5UA 3UD6A 3ELFA 5IXEA 3KBSA 1TR9A 4GFSA 3OO2A 3P3BA 2X05A 4AUBA 3GNOA 3ONCA 1J93A 4ZE4A 4XBJA 3UR5A 4JY8A 3GVVA 3K5XA 3PP7A 4MNKA 4O52A 3UG8A 2VGFA 3PHAA 2L5HA 1RUSA 2MNRA 4JEQA 2J4GA 1E0VA 1DWHM 5AC8A 4LY4A 4QGCA 1LYXA 3TJ4A 3NGJA 5ABFA 2R1KA 4LB3A 3IV8A 4UFKA 2CCRA 4PSRA 1BYBA 1KCKA 3AU2A 4QR6A 2XM2A 4X0VA 5J5RA 4LBRA 2E68A 4W93A 1ZBKA 4L9ZA 1E6PA 3O0FA 1P0BA 2PDIA 3DU0A 1DWFM 2A21A 3EA1A 3TXZA 3NXLA 1R3QA 1KRMA 1I2PA 2Z24A 4WDTA 4TVDA 5DY2A 1SYTA 1TWIA 1UR9A 1EJUC 4FOJA 4S3AA 3UCDA 2NWRA 4HHPA 3GO2A 4MF4A 1U5JA 3RJYA 1BTMA 4CQ8A 2ZX6A 3VDCA 3LCHA 5EB8A 1BSLA 1ISXA 4PTWA 2E09A 3VD4A 1LBMA 3W22A 4IJBA 4XKYB 1UYQA 2WO5A 2VD9A 4NYYA 4XIMA 2WVSA 3KX6A 3CUZA 1L8PA 3TR9A 4ZE5A 2PPGA 1DJQA 3URQA 1TRDA 4OQVA 4JTIA 4OTKA 4UTTC 4QTGA 4RKAA 2V68A 4L9YA 4IUOA 3LK6A 5A8QA 4L4MA 1RD6A 1POJA 2F61A 3GH7A 1ZTVA 3VC5A 2Z2BA 3WMSA 1J0IA 1R30A 1AA1B 1TPWA 1ZNNA 4G2DA 1J11A 2QUVA 1GOXA 3D5HA 2NQJA 1W31A 5CZTA 2FIQA 4GNKB 1TFVA 3WEOA 2OX1A 1PKMA 2OCZA 1VP5A 4P8WA 1Q7MA 3HO8A 2YA1A 2CBJA 3W2LA 1J8VA 3L4WA 4U2ZA 4MLJA 2QHAA 1R9YA 4TOQA 5D2WA 5F4SA 5HPCA 4LAZA 4AX6A 1UWAA 5BCAA 4BQ2A 3PBGA 4JFSA 1QU4A 2X0SA 3T8QA 4HU3A 5A2BA 1M7JA 4KF1A 4B5UA 2E25A 1WDPA 2VRQA 2CBUA 5CC6A 4YWSA 3AIRA 4LPCA 5HMEA 4RNIA 4IXXA 4XZ9A 2PS2A 2PZNA 4J3VA 1OCQA 3VGBA 1I2QA 1HF6A 3CUJA 1XYZA 3MYOA 3WQVA 1AQ0A 4Q6JA 5LA1A 4BY3A 3EOLA 4GQBA 4KGLA 4W5ZA 3VKAA 3TVAA 1THFD 4QQ3A 3RM8A 4I9TA 4M1RA 2I17A 4Q4RA 4J1OA 4QIUA 2J7CA 3MHGA 4LVGA 4TVUA 3GW0A 7TAAA 2ATSA 3LA4A 5CC5A 4NI8A 3AJXA 4H00A 4GC3A 3ZJ8A 1UB3A 4C6FA 3PPHA 4QG6A 4GHRA 1EF2A 3N17A 3LI1A 1JZ2A 2BOFX 1JGMA 5CSRA 3BLFA 3IRSA 3UR7A 3MP3A 4LUSB 4GVIA 4WGXA 4K7YA 1KKOA 3P84A 1U5VA 1V3KA 4PA8A 3IGUA 1XC6A 1FVPA 4N42A 2DUZA 3O0KA 4U3AA 3OHMB 1GVEA 3ZSSA 4PGLA 3OZYA 1R3YA 2GLKA 3GM8A 4F4RA 1DPMA 3CZLA 4M81A 1IXPA 4H04A 2BGSA 5XIMA 1VQTA 3R8GA 4H9MA 3NSXA 4O0KA 4FNPA 3IGXA 4MWAB 4TV6A 3BLEA 4C6BA 3OYXA 3WLSA 4FLSA 2Y88A 4FEZA 4BF5A 5DT5A 3TKFA 3G24A 5I09A 3CUIA 1VAHA 1IGSA 4HA4A 1Z41A 5FJJA 1SFTA 1G7VA 2YXGA 2GDUA 4US6A 4NAEA 3QGVA 1PCWA 5CAHA 3E5BA 3LXAA 4GG9A 3QYQA 1UUOA 2A6LA 1PIIA 2PDQA 4CD7A 2ISFA 4D8LA 1GPWA 1T7LA 1AFSA 3AHVA 1F3TA 4I7VA 3AS0A 5M3WA 5I2UA 3B06A 1RVGA 2PWEA 1OGSA 3MV11 3S1XA 1H7RA 1UD4A 3GU9A 2Y7DA 4MTVA 2VUNA 2ZBTA 3N2CA 1J4EA 1LOQA 2POZA 1EGMA 2MUCA 1MNSA 1YE4A 4GH3A 4B3KA 2ZDRA 3ITXA 1V5XA 2FFCA 4L65A 4E8CA 4NZ5A 5D30A 3GC4A 3SO7A 3M7WA 1QW7A 1K6WA 3WNOA 1OYCA 3W1NA 1JULA 3HIJA 2P53A 1RQBA 5G2IA 3W01A 1KR0A 1VH7A 3ARVA 3BWWA 1P43A 3EB2A 1XIEA 5U7SA 2Q8XA 5BU9A 3I7RA 1Q6OA 2VR2A 1XYBA 3OGRA 3W2KA 2J75A 4GY7A 3FA5A 3BDKA 2VI0A 1EX5A 1E6XM 3WLHA 4HYVA 2XH0A 4WKFA 3O05A 4W4QA 2ZOXA 2WSQA 4W88A 1I1XA 3PR2A 4HMEA 3WN6A 3VK5A 2VFIA 4XKYA 3OJGA 2VP8A 3GNRA 5JBEA 1RH9A 2ZXDA 4KFOA 1UP0A 3FN9A 1HT6A 1IHIA 1BQGA 5I7GA 2GWNA 5C2XA 3WD0A 3R2GA 1A5LC 3LN3A 4WSJA 3WIJA 1BYAA 4F0KA 4KMQA 4XWUA 2B7QA 5D02A 4Q6XA 4S3CA 4EPKA 1LORA 3N25A 4AWTA 4R9OA 2E1DA 3V0UA 1XG4A 4B5VA 4PRTA 3CTLA 4QG8A 2DZWA 2D0HA 3U4AA 3H4WA 5DY3A 5TIMA 1G9HA 5DBTA 3TXVA 1CW2A 3KP0A 1R46A 2VFEA 3AIWA 3WF2A 2HTMA 4GKTA 1ZU8A 1M7PA 4K8GA 4UTWA 1SJDA 1JVNA 4OV9A 3AZRA 3N2MA 4U4MA 3R11A 1NQ6A 2XFRA 4Q4SA 1US3A 1AVAA 3S46A 1EJ7L 1H7OA 3RILA 1ONXA 2ALDA 3AXIA 4DZAA 4GE8A 4MUZA 1ZCOA 2V3GA 2V82A 2SFPA 1X7IA 3KCOA 1CXFA 1UUMA 3RU6A 3M0ZA 3MHFA 4JIEA 3L4VA 3PVFA 1K6AA 3R94A 1XS2A 2J79A 3TYEA 2EG7A 1EP2A 3S2MA 4KBXA 2GGGA 3ARRA 4AHQA 4QE4A 4IIHA 3SB0A 2NW0A 3W23A 3W1MA 2ATMA 1VB9A 1A5NC 3AC0A 1H1NA 2BOGX 1ONWA 4ECLA 3G3MA 4KERA 3PB0A 5IRPA 4HCDA 4DBWA 3CM4A 3CIVA 4ZXOA 1W9UA 1OIMA 2PDUA 5FSDC 4DPQA 3PTMA 3L67A 2ZYFA 3UW6A 4I7UA 3L4YA 1I45A 1X39A 3IIVA 2HPMA 5IOBA 1UWUA 4HK7A 3G1HA 4LUSA 2OLHA 1JI2A 3A23A 4EAYA 1JYWA 4RPQA 3T2PA 3W86A 5DXXA 1F3EA 1T8XA 1F07A 1VFTA 2QJIA 4PE8A 1TA3A 2J78A 3KLLA 4GUJA 4O17A 3B0UX 4Z0JA 3GR4A 1ELSA 1XLAA 1WZLA 3ARUA 2WLYA 4Z08A 1JPHA 2XDFA 4KH2A 1F6KA 3P0XA 4JAWA 3GDMA 3BARA 4HT3A 3B3DA 3VOCA 1F61A 1S46A 5JVLA 1T6MA 2VCAA 1BYCA 4UCGA 3UEQA 4PCPA 5AYXA 3DESA 3JVAA 2IKGA 5H2ZA 3PJTA 3NO3A 3BOFA 4BR1A 4XVEA 3UVIA 1CT5A 3WBYA 3W72A 1T0OA 1B3WA 1ZLPA 2PURA 3ABZA 4TX8A 4ATDA 4LV4A 3LS9A 1E9IA 3N73A 3P5ZA 3TCEA 3M41A 3ZM8A 1W32A 1WKEA 3WFAA 1IF2A 1U1JA 4C6LA 2YDQA 4LW7A 1Y5VA 4NJJA 1GZJA 3F4NA 4B2DD 2NSOA 2Q01A 2QNEA 1YX1A 1AMKA 1MXDA 2PBOA 1XLJA 1RK5A 4XD4A 5LNSA 3RDKA 2CBIA 3HGRA 2H6RA 2VL4A 3IIZA 1P6CA 1HJWA 3GIQA 3W88A 4HYRA 3H7RA 3FNDA 3SR7A 3STCA 4H8NA 2ZDSA 1YRRA 4LBUA 3CGTA 2FTYA 3GRIA 2ZXBA 4HTBA 1UW9A 1ZBVA 4OV4A 2PGFA 4EOUA 3L4ZA 1KM2A 4XZMX 1CPUA 4PMRA 4EE9A 1UD2A 1NWSA 2VWTA 3L5MA 3CUXA 1AW5A 3W37A 3P62A 3W7LA 1RBAA 2DU2A 1PDYA 2D1ZA 2WNZA 1HFBA 3B0YA 6REQA 1V51A 4Y9MA 2GOKA 4DJDD 3PBVA 3V5CA 3GTIA 4ZOCA 3UT0A 4ZSUA 3UY8A 3TTEA 1E40A 3S6TA 3SCNA 3W07A 1V3IA 3CB8A 3FGCB 1KA9F 3HG5A 1HKWA 1L0PA 2NVDA 1EC9A 1GQLA 5HOSA 2PDMA 3VD5A 4NJHA 4QE5A 4ATWA 1E1FA 9RUBA 3GX9A 4NZJA 4CVUA 1FWIC 1SFSA 3W02A 1QOXA 3TIMA 1FWRA 2ZADA 3TQPA 3CHDA 1P0NA 2BY3A 3GXFA 1H41A 3NA8A 4YYFA 3VD7A 3W82A 2WSKA 2Z1KA 3NL2A 1GKPA 4PB3A 5I78A 5AB3A 1O60A 2PI6A 4NQ1A 4IH3A 5C2GA 1D8WA 4X60A 2E28A 2XH7A 1XISA 3L7RA 3G1RA 3UJ2A 4MGGA 2INEA 3D3AA 1EDGA 2WBGA 4IIDA 3KCLA 3KBWA 5FF4A 1SPQA 1W1VA 4AZBA 1RZMA 2YDRA 3GYEA 1V0KA 4AIOA 3WNKA 2QCCA 4J27A 4GZJA 3L5AA 3RXZA 5A8MA 3GHUA 3VIJA 3MBDA 1BG9A 4DX3A 2Y0FA 1QATA 1PDZA 1QI3A 1A0EA 3A21A 1MZHA 4Z2IA 3UWUA 3AS3A 2FH8A 4Y2WA 5CPNA 3KVKA 3AYRA 1WAUA 3CL6A 3PTQA 3TCSA 3QMRA 1KRBC 2BG5A 3EDEA 4Q7BA 3W7MA 1GPFA 2YLLA 3DFNA 1E4LA 3LPOA 1UPPA 4PCFA 2Z1SA 2GSHA 2FB3A 3SFKA 2VDHA 3WEZA 4GCXA 5C2CA 1NEYA 3KHDA 1KTBA 4QSFA 3TTOA 2DSKA 3MY9A 3LHZA 1Q13A 4YHEA 3LCXA 3OZPA 4AC1X 2OQLA 1O94A 5DT7A 3LCLA 3F2BA 1IGWA 1TX2A 4YLWA 4R7JA 3GIYA 1DVJA 3RCYA 3S2CA 2ZX7A 4JD4A 3CZJA 2EF9A 4JEJA 3KBVA 2JE8A 4JY9A 3TSDA 2NXHA 1S5VA 4RE0A 4RZ6A 1LQ2A 5F1UA 5IHRA 5D8ZA 3WJYA 4TUFA 2IQDA 1ZFJA 3ZT6A 1CWYA 1IEQA 4IP7A 1LBFA 4JXCA 4EXAA 2F8QA 5F4XA 2I16A 4L5ZA 3WF1A 4DYEA 1PZ0A 2CLLA 4EVZA 2OLAA 1KFLA 1S2WA 1O5KA 2PF8A 1QI2A 3VIPA 1V7AA 3JRKA 1X97A 2ZICA 1ZJIA 1YLVA 3ZXWA 3LMYA 1OYBA 3UNDA 3MVIA 2WC4A 2HXTA 1Q8AA 1A5AA 4UOJA 3E74A 3BTNA 3BL3A 2F6KA 2GUYA 1LRQA 3QC0A 3QR1A 1LCOA 1QVBA 1AJZA 1UD8A 2J62A 4QS6A 4Q3MA 4L4LA 3CT2A 1GCYA 1KFBA 5CXPA 3USZA 4MOZA 2ZXAA 1UG6A 5TNVA 4IPPA 1LBLA 4XB3A 3WUGA 2F38A 4YTQA 4CCZA 4EIVA 3DG3A 4DLFA 1FWSA 1TJPA 4XZNX 4CD8A 1TV2A 2CZDA 3W7NA 3S0CA 3MCNA 1M41A 1FBAA 4JS3A 4MFDA 1BXNA 4A4AA 1PWMA 4EPDC 1IV8A 1PV8A 3AIQA 4FSAA 4PTNA 2BDQA 4O0ZA 3DC8A 5BXSA 3QC3A 3EYPA 3H2MA 4WKAA 1H62A 3RG6A 3N04A 1MNZA 4S3DA 4GXWA 3B9AA 3MU7A 1R47A 3W3OA 2Y1HA 1FWNA 2E5DA 5CSUA 4F0LA 2EQDA 4DJED 3I4KA 1TVLA 1VFSA 3ZLGA 5HWMA 1ESWA 3PZIA 3NM3A 1CLVA 2PD5A 2ASHA 4W7UA 1JGIA 2A7PA 1OFOA 1U33A 2O9OA 1J79A 2Q02A 3RO8A 1E9ZB 3W83A 2O92A 4LB4A 4NF7A 2QAPA 3NVTA 1D7KA 1YNPA 3W0KA 2RDUA 5GNXA 2PC8A 4IIFA 1PTAA 5E0FA 3E02A 1ISVA 1EEPA 3FGCA 3W7JA 1QPRA 2O4QA 1CXEA 3E2SA 4M51A 3WD2A 3S5NA 3ANYA 3SY5A 4M7SA 5KZMA 1NP2A 1EEXA 4E3VA 4R34A 3WL0A 3DYPA 6PTDA 3VTRA 4TX9A 3P61A 3T44A 3H70A