1V79A

Crystal structures of adenosine deaminase complexed with potent inhibitors
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design and synthesis of non-nucleoside, potent, and orally bioavailable adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1v79A00
4RDWA 2Z28A 4UBPC 2YZ5A 3ITCA 4KEZA 1VFLA 4GXWA 2D2GA 2R1LA 2PUZA 4G7EB 2PAJA 3MVTA 2YB1A 1RK5A 4KF1A 4MUPA 1KRMA 3PNUA 1QW7A 1FWIC 2GOKA 4XAFA 4WGXA 4C60A 1P6BA 2BGNE 3TN5A 4RDVA 2RAGA 3E38A 2QPXA 1EJTC 3QY6A 5LXXA 4XAYA 3EWCA 3GTHA 4H9YA 1YRRA 2VUNA 2R1KA 4C6DA 3BE7A 3LGGA 3RHGA 4ZSUA 2Z24A 1V51A 2HQAA 4KQNA 4GY7A 2XIOA 2W9MA 1UIOA 1R9XA 4J35A 4IG2B 4C65A 1J6OA 1PTAA 1M68A 2FFIA 4J5NA 4PBFA 3MPGA 4F0RA 4F0SA 3AU6A 4LCSA 1EJRC 3GTFA 4J2MA 3WZ0E 3MSRA 1FKXA 2Z4GA 4C6IA 4GOAA 4DO7A 2AQOA 4JOMA 3TN4A 4LEFA 4WHBA 4UB9A 1K6WA 3S2LA 2ICSA 1RK6A 1YIXA 2OQLA 1V77A 1EYWA 4QROA 3MJMA 1A5MC 2DVUA 1KRAC 1S3TC 3DC8A 5AKQA 1P1MA 4XD5A 3T1GA 3NEHA 4RZBA 2OODA 2D2JA 2PLMA 1RA5A 4HJWA 1FWDC 3HM7A 2FTWA 3RYSA 1J5SA 4HK5A 1W1IE 3LY0A 3S4TA 1J79A 3MTWA 2GZXA 1EJXC 2Q01A 1ZZMA 4ERAA 2E25A 2OOFA 4DI9A 1GKPA 5HMDA 2O4MA 2ANUA 1O12A 4ICMA 1EJVC 1ITQA 4PCNA 4QS6A 4C5YA 4BKNA 1O5RA 1POJA 4Z42C 4C5ZA 3S2MA 4CEXC 4B91A 3K2GA 2IMRA 3CJPA 4GK8A 3E2VA 4DLFA 1FWJC 1I0BA 2ADAA 3MKVA 4LANA 3UR5A 3HTWA 3GUWA 2VC5A 3F4CA 2I5GA 2P53A 3OODA 4XAGA 4LCQA 4TQTA 3LU2A 1A5OC 1J6PA 3QY8A 4RDZA 4LAOA 3GU2A 4YIWA 1WXYA 4HK6A 4I6VA 2A3LA 4GBDA 1EJUC 3LNPA 1JGMA 1RJQA 4C6KA 1PO9A 3R0DA 2QT3A 3MDUA 3E3HA 3NQBA 3PANA 4C6MA 3URNA 5FSEC 4DIAA 3OU8A 4RE0A 2PGFA 2BB0A 3IJ6A 2Z25A 4KEVA 4BY3A 2YB4A 1NDWA 1M65A 3B0YA 4CQDA 3FDGA 1UIPA 4PBEA 2Z2BA 4XD3A 2O4QA 2WJEA 2D2HA 3GIQA 4AC7C 3IPWA 3KM8A 4CNUA 2FVKA 4IG2A 1RA0A 2YXOA 1V7AA 3QY7A 1FWGC 4XAZA 2FVMA 3OQEA 4E3TA 2WJDA 1A4MA 3RN6A 3B0XA 4INFA 2G3FA 4DZIA 4DI8A 3NURA 3ISIX 2VR2A 1XRTA 4H9VA 1PSCA 2I9UA 4KETA 3IV8A 4KEUA 3PAOA 4ZSTA 1ITUA 2PGRA 4NG3A 3F2CA 4ERGA 2DVTA 4C6OA 2HBXA 1GKQA 3GTIA 3E74A 3K4WA 5E5CA 4BJHA 3URBA 1A5LC 4H9XA 2Z00A 3ORWA 4ERIA 1NDVA 3PNZA 4R7WA 4QSFA 4C6PA 1XWYA 4IF2A 4G7EA 1KCXA 4G2DA 4IFKA 4CQCA 4V1XA 3FEQA 4DZHA 4IFKB 1FWEC 3WMLA 3CAKA 4H01A 3S2JA 3F2BA 3D6NA 4V1YA 2VM8A 1I0DA 1FWHC 3URAA 4RDYA 3GRIA 2Z26A 3HPAA 2GSEA 4WVXA 3UR2A 1FWBC 3F4DA 4EPEC 4QS5A 1BF6A 4R88A 4EPDC 4EP8C 2Y1HA 4KESA 3MDWA 4H00A 4C6FA 1DPMA 4CQBA 4C6EA 3SO7A 4H9UA 4QTGA 3DCPA 2WM1A 1XRFA 1HZYA 2R1PA 3UF9A 2R1NA 3SFWA 1FKWA 2GWGA 4F0LA 4EPKA 4C6LA 3AU2A 1RAKA 4HA0A 3LSBA 3AUOA 3TN6A 3IRSA 3RCMA 4H9MA 4QRNA 2EG8A 4IQJA 2KAUC 1E9YB 3WYZA 1YBQB 2WJFA 3S2NA 1YNYA 1KRCC 1FWAC 3GU1A 4H9ZA 4DNMA 3GU9A 4CEUC 1K1DA 3MVIA 4XD4A 2UZ9A 4IGMA 4PCPA 3E0FA 5HMEA 1NFGA 2QVNA 3OJGA 1PB0A 2P50A 4LALA 4P5UA 4C6BA 4GZ7A 1KRBC 5HMFA 2AMXA 4C6JA 3GG7A 1A5NC 2Z2AA 3LA4A 1XGEA 3GIPA 4LFYA 2ZC1A 3UBPC 2Z7GA 3A3WA 2OGJA 3OVGA 3F2DA 4NP7A 2HPIA 3B40A 1P6CA 3OOQA 3T8LA 1YMYA 4IFRA 4AQLA 3QGAC 2R1MA 4GY0A 4HK7A 3EGJA 4CNTA 3CS2A 4KIRA 1FWFC 1R9YA 3K5XA 3TN3A 1RJRA 2FTYA 4C6NA 1R9ZA 4NI8A 1EJWC 1UMLA 1EF2A 3EWDA 3O0FA 3G77A 3IARA 5A6TC 4LAKA 1POKA 3E0LA 3FDKA 2HPMA 3LGDA 3DUGA 2EG7A 3N2CA 3O7UA 3QGKC 5G4HC 3ID7A 3A4JA 1WXZA 3PBMA 4GX8A 1ONXA 4I6KA 4EPBC 4OFCA 1YBQA 2DVXA 2EG6A 3V7PA 2OB3A 3IGHX 4L9XA 1UBPC 2CZVA 4B3ZA 4DLMA 4D8LA 1ADDA 4IGNA 1EZ2A 1IE7C 4PE8A 3UPMA 4LCRA 4B90A 2E1WA 4B92A 1A4LA 1GKRA 3IACA 1NDYA 3T81A 4C6QA 5CH9A 4C6CA 1EJSC 3A3XA 4GY1A 3LS9A 4LAMA 2Z29A 4GC3A 2Z27A 5FSDC 1FWCC 2HNHA 2GWNA 3ICJA 3LSCA 1QXLA 4IFOA 1V79A 4H9TA 4DYKA 4GX9A 1E9ZB 2HBVA 1K70A 3JZEA 4GYFA 4KERA 4M51A 4XD6A 4IH3A 2Q09A 1NDZA 4R85A 4CNSA 2F6KA 1M7JA 3URQA 4LH8A 1ONWA 2UBPC 2VC7A 1V4YA 2AQVA 1RJPA 3GTXA 1A5KC 3C86A 4L6DA 3TNBA 2QS8A 2VHLA
chains in the Genus database with same CATH superfamily
2PP3A 1UR9A 3T0CA 3VE9A 4H3DA 2H8XA 4AC1X 2Y5SA 4TU1A 1KB3A 3W3OA 2OO0A 4E2OA 3IGSA 4FNSA 1DJYA 4P7QA 2YLLA 2PDYA 3QPZA 1B4EA 1XFCA 2POTA 1E71M 3CMJA 2Y6ZA 1J93A 3GTNA 1ITCA 4Y9PA 1KV8A 4E4UA 3NVTA 2OWCA 2QCLA 4KS0A 4E2DA 4P7RA 2D20A 3P7YA 3TZNA 3BE7A 4JR5A 3LGGA 4ZSUA 3SADA 3WQEA 4F2UA 4KGLA 1KD0A 3CEUA 2OCZA 1BQGA 1IZCA 1TRIA 2PI6A 3NPWA 3WN6A 4A8LA 4IIGA 3UVAA 3IJIA 3AS1A 3FKRA 4FF5A 4AZCB 1SW7A 1BSLA 1XPYA 1KGWA 3BOLA 2ZQ0A 4WK9A 4IPNB 3SUWA 3ZMRA 4LB3A 4JGDA 3CWOX 3SURA 5KMYA 2W5FA 2DZVA 1DWHM 4BHYA 1IHIA 4IISA 3AHZA 5I77A 1WXJA 1W5OA 3L0GA 1I9CB 3PPFA 1JAKA 3T9PA 3WY1A 1O5QA 4HTYA 2I14A 4IL0A 2GZXA 2QJJA 4MADA 1QI3A 4V15A 3DHDA 2OOFA 2VCCA 4UZSA 4MTVA 2R91A 3ALFA 2VOMA 2WV8A 4Q6XA 1JZ8A 3TP4A 3VKJA 4WRHA 1QNVA 9CGTA 5C9ZA 3LTPA 5HANA 4IUOA 3NJ3A 3K2GA 1M53A 4M6PA 3WQFA 5E09A 3APTA 4LANA 2BVTA 4P7NA 4XAPA 1WAUA 1WX0A 1NP2A 1K4HA 1GPFA 1RP8A 2J27A 1DWAM 1LQ2A 4MM1A 1AZ1A 4O12A 3FIGA 4ONVA 1WXYA 4L7ZA 2JKPA 3LNPA 3TEVA 5C70A 1KFJA 1BHGA 1HJUA 3AALA 1W9VA 4CNPA 5BMWA 4YHEA 4HU3A 3IJ6A 3LCXA 3QQ0A 1J0YA 3ABQA 4QJ4B 2PGEA 3AJ7A 5FJPA 2CERA 5H6HA 2ZWYA 1K03A 3EDJA 2OU4A 3EX6A 3FAWA 5EY5A 3L0NA 4UQAA 1TCDA 1W1PA 1OSEA 1GOWA 4NZJA 2JF6A 3GZAA 4DWSB 1H5VA 4PUJA 3CGTA 3WLIA 1MFVA 5I02A 4GFIA 1W3NA 4PTWA 4JDYA 3Q4DA 3LHTA 3BAXA 4KEUA 4CN6A 1NOFA 3TCEA 1QPNA 4X9SA 3G0UA 4IIHA 3DHPA 1KFLA 3UFYA 4KCTA 3SSJA 3E5BA 5FJUA 3R2GA 4Y2WA 3SI9A 3UZXA 4DAIA 4K8HA 3URBA 3WH9A 1JZ4A 3W87A 1UH2A 5ABEA 4HPHA 2GVGA 3WLNA 1OG0A 1V3KA 4DZHA 3F2BA 1LQAA 3ZT6A 2V81A 2JIWA 2CLPA 3N18A 1JFHA 3S1UA 3VOFA 1HN1A 5EMLA 4UR8A 3W2UA 4CCDA 2VEKA 3S1XA 3AQUA 1QMLA 4D9PA 3H7UA 1Y65A 4MGGA 6TIMA 1BSIA 4AZGA 4H00A 4C6FA 1CXEA 1DPMA 3RGTA 2DH3A 2REQA 2WBGA 3INPA 1TJPA 3R25A 3ES7A 1KM4A 2R1PA 4A3UA 1K8XA 4AZHA 2ACSA 4ZXLA 4HNOA 1CB2A 4L65A 4KPLA 3IRSA 1J8VA 4D1IA 4EOUA 1UZHA 1V6UA 4V33A 4XBJA 2VT0A 2WJFA 2YXXA 2FB3A 5H2ZA 4ICNA 3GU9A 1IGWA 3W7JA 1W37A 2BMBA 3BMWA 1V0KA 1IEVA 3KCLA 5HNNA 1JCJA 8XIAA 3K30A 3PVFA 3KVJA 4PH6A 5CZSA 4GUJA 4LY4A 5AYXA 1W31A 3CT7A 4IIDA 1ALDA 4GPNA 2Y7DA 2OTDA 3F2DA 2QULA 5KZEA 4LUSA 1OFAA 2VYOA 3WK3A 3NDYA 1IYXA 5JBEA 1VLIA 1GTEA 4PUUA 3NQMA 2PU1A 4HU8A 4YYCA 1BYAA 2BY3A 2XSAA 2VFIA 2C3ZA 1W1YA 4F2TA 1O1HA 3E12A 4Z2LA 1T99A 3O6AA 1LRQA 3VNMA 4RNJA 1JPDX 2W4XA 1EP3A 3NL2A 3ME3A 1ONXA 1W54A 3O0KA 4Q4PA 4AU0A 3OZYA 5K9XA 1B1YA 4HQVA 5HA7A 3M9YA 3CUZA 1SMDA 1PHWA 4B3ZA 3LRMA 2E6FA 3GFZA 3PZNA 4LW7A 3USBA 4XIAA 3WQVA 4XUYA 3N13A 2IPJA 2W0UA 3WK0A 2CFFA 5I78A 5KZ6A 1W17A 3MMDA 3OEXA 5CH9A 2WHMA 4EVZA 1F3TA 5JBFA 4DBSA 5CJ5A 3G0SA 1VYPX 2UY3A 3WD4A 2DU2A 2AKZA 4ZOEA 3GDRA 6A3HA 3MI2A 4HZ7A 4LVAA 4K7VA 4QQUA 4PCTA 4OBTA 3IGXA 1V6YA 4UTTC 2AAMA 2VC7A 4A3HA 1V4YA 1RJPA 2OLAA 3RIKA 4Q4SA 4R5EA 4ZQMA 1UR8A 1Q4NX 2XVNA 4MPQA 3ABXA 3NOYA 3H23A 1PTGA 3QW3A 4PUWA 3TW7A 4LYQA 4LUYA 4GI8A 4GXWA 3K4DA 2WMHA 5JVLA 3MZNA 2ZUTA 3LBMA 3UCDA 3CNYA 4M6QA 2OELA 1HJVA 3WDJA 1ZL1A 2QR6A 1R3RA 5XIAA 1P0DA 5DX7A 1NWSA 2UWFA 5C9RA 1JZ7A 2FZMA 2RAGA 2QPXA 3DFTA 3EXSA 3TVAA 1R3QA 4GVGA 3OB8A 1R2TA 3NL5A 4LUTA 2JEPA 1SO6A 4AX7A 3C2OA 1E6NA 1CPUA 3R79A 3Q67A 4ZFCA 1F5ZA 2HQAA 4KQNA 1CXHA 3T05A 3QR1A 3WBAA 1VCVA 2BX7A 4MNMA 1CGYA 1KCLA 1SGJA 4LPCA 2Q71A 4C90A 2INFA 2VCBA 3WZ0E 1FKXA 3AIEA 4DO7A 1XCFA 3WLRA 3O63A 1XHGA 4LEFA 4Q8VA 5I09A 3S2CA 3UZZA 3W25A 5AOUA 1M7XA 4RNHA 5FACA 3W7QA 3TA9A 3B8UA 4U5KA 4QDPA 4DX3A 1DKWA 4W7WA 3NDOA 5EU9A 1BF2A 4QE5A 4FMVA 1BGGA 4LXFA 4XVDA 3OYZA 5IHRA 4QJ1A 3P3BA 2OWXA 4O54A 1C8QA 4Y6GA 3BJFA 1C7TA 1QASA 5BRQA 4NUWA 4MWAA 4LS0A 4C5YA 4Q33A 3MUAA 4GIAA 3OZMA 3EKLA 1F07A 4JFTA 1HP4A 3RM4A 4JTIA 3GXFA 2CKRA 2MNRA 3W07A 2V2HA 3NIYA 1XDLA 3MY9A 2G41A 4HJFA 1PL9A 1B3VA 4DWSC 4NYYA 4XAGA 4TQTA 2YW3A 3RPTA 1IEWA 4ZQRA 2XUCA 1W3HA 4LU0A 3PR2A 3VOIA 4GBDA 3M46A 1FCUA 1HP5A 1G7VA 3DH7A 1VIZA 5CZJA 5C55A 1R47A 3OU8A 1NOUA 2A6NA 4GVIA 4J3VA 4UNIA 4LB4A 4MNJA 4CQDA 4MKSA 3THQA 4GRSA 1OX4A 1D7FA 4IG2A 2GJPA 3IJ7A 3B8DA 2ZDRA 4IL2A 5G2HA 3B0UX 1RQEA 1GYLA 5G4EA 1XRTA 1UWUA 1SR9A 3DECA 3ITOA 2V5KA 4ZQCA 1CLVA 3GH5A 1RBLA 2TODA 2QV4A 3VABA 1FOBA 4ERGA 3WUGA 4JYEA 3C0QA 3RLUA 1OHLA 4AXNA 2YCLA 4HMCA 4PMYA 5FEPA 4NZ5A 1HJXA 1KKRA 1NDVA 1A3HA 3VKAA 3LM7A 1KCXA 4P8VA 3DG3A 4IFKA 4NZ1A 2PBGA 5HAOA 1B5TA 2J62A 1I0DA 5FJRA 2JQXA 3LI1A 1J5TA 4X0VA 1EIBA 5E0FA 2Y5JA 3WK2A 1RCOB 4ROPA 2WMIA 3DIPA 4Q8TA 2ZUUA 4H04A 4N02A 3TV8A 4HMDA 3HJZA 3SM0A 3MP3A 3SN4A 2J25A 3F5LA 1L0PA 5REQB 1RAKA 1KBKA 1GNXA 4RV8A 1WDPA 4ZO6A 3UJFA 4PB4A 3P2VA 3NO1A 3UY7A 1UR2A 2YCEA 4GI4A 1UWAA 3HG3A 1GQJA 1PV8A 1PX3A 3N29A 4KFNA 1R3SA 3GU1A 4GH3A 1W6TA 2X7VA 2XFRA 1H7OA 3VIKA 3U2CA 4AZ7A 2GJXB 4IMAA 2J74A 3KWXA 3OGRA 3THDA 3FHAA 2Q8ZA 3BW4A 2J7HA 1H7RA 1I2QA 1VBGA 1OYCA 3VGHA 4PEKA 2ONEA 4PMNA 1SFJA 3PB0A 4E4FA 2RDTA 3WCZA 2OEJA 1U5VA 3YPIA 2OT1A 1BXNA 2C13A 3R8GA 1ZHAA 3IK4A 2P76A 4QLKA 2V3FA 4NT0A 1LG2A 3L2LA 4O0QA 3RM8A 1FWNA 1ZU8A 2E28A 4RX0A 2PTWA 3NNTA 2WWDA 1OX6A 3O7UA 2TSYA 3SY8A 1AW1A 5F4XA 3SY5A 2JF7A 3CQHA 4XUGA 3P67A 3DG7A 3CMGA 1HO1A 3BZGA 3RMEA 5EL1A 5XINA 5E1QA 7A3HA 1R2SA 2OB3A 3PG8A 4M80A 2JKAA 3BTNA 2WSQA 4O13A 2OYKA 4O52A 4XZIA 3GDMA 2WNZA 1UC5A 4JQ3A 1TX2A 3DGBA 1M01A 4DJED 3EDKA 2OX1A 3HU7A 1TR9A 5IBXA 3TA6A 4KIEA 2ZRWA 3G1XA 1EX1A 5A8GA 3TK7A 3WLKX 3U7BA 3TR2A 3A6OA 1E6QM 2DZWA 5LNWA 5LSMA 2YPIA 4IH3A 3TQVA 3MS8A 4IMDA 4G7FA 4X2PA 4A05A 1YPFA 1VS1A 2V2CA 4V27A 3SCRA 2EPLX 1A5KC 1A0CA 4OVXA 4X63A 4DB7A 5ABFA 4O14A 4RDWA 2PWEA 2HSAA 1ZJBA 1YXYA 4AF0A 3N19B 1E51A 3HO8A 3K4AA 3V36A 4KF1A 2OVLA 1SM9A 2ZICA 3LXBA 5HUOA 1Z48A 3KCOA 3STPA 3ZVHA 4JAWA 1M6JA 5FEZA 1UA7A 2V6AA 1P6BA 1Z3NA 3NQ7A 5CZTA 5LXXA 1EJTC 5DXYA 3B9AA 4HHMA 4E38A 4H9YA 3AXIA 3RF9A 1TUFA 2YIHA 3ZZ1A 1K7FA 3CLWA 1OFQA 2OZTA 4KEMA 3SUSA 4HNCA 1W2PA 2R9RA 3WMBA 1R9XA 4GNVA 3EMZA 1J6OA 2FFIA 4I8DA 4R7OA 2E9LA 4WD0A 3C61A 1DV7A 1OZQA 2GVYA 1BVWA 3B8TA 4B5SA 3S47A 1OX5A 3DGRA 1IWPA 2D0GA 3RILA 2DVUA 4KRTA 2BODX 1VJZA 5TBOA 1XX1A 2CLHA 3NEHA 1AH4A 4FX6M 3U8GA 3B9OA 3SJ3A 1Z6KA 2H3BA 3LCIA 4V2XA 3IIOA 4OBRA 1NFPA 4AD2A 4PUDA 4TVUA 4DO6A 1OB0A 4M82A 4GBUA 1EP1A 3E9AA 5FD0A 2W63A 1SZRA 4GH1A 2SFPA 4GUFA 1S38A 1KR1A 3O15A 2ZFAA 2H9AB 3NQAA 3E2VA 1I0BA 2VRJA 1RH9A 2HCVA 2C6QA 2DIKA 1M03A 4TUFA 5JU6A 1N82A 1W91A 3M64A 3I7SA 1GHSA 2QUTA 3VOGA 1DIEA 2X7WA 3I10A 1GZ1A 1Z89A 1UPMB 2P8BA 4QBXA 2INEA 1EJUC 1D3HA 1UG6A 4C6KA 1PO9A 3N04A 4GJ1A 3E3HA 3VZXA 3BMVA 3URNA 4DXXA 4JL2A 5M5DA 1OCNA 2XVKA 3WQ6A 1LUCB 1QK2A 1XYZA 1JDDA 3BAKA 1AQMA 4FLSA 1V8EA 4IUGA 3DG6A 1HUVA 4JTCA 4XTIA 2PRMA 3ARQA 1K9DA 3H22A 3QHOA 4Y9NA 3CM4A 2PFHA 3AS2A 3Q2DA 2A6LA 4BCEA 1FCVA 3E6EA 4AIBA 2GLKA 3N34A 4S1FA 1UASA 4O1AA 4FOUA 1FH9A 2CXGA 1CGXA 5HNUA 3C2EA 5K2ZA 3W4RA 3L4TA 1YE6A 1Y8BA 3REQB 4JS3A 3GTIA 1RV8A 1VEOA 1BAGA 5DBTA 4O1CA 3KVLA 1H63A 4ERIA 3U0HA 2H9AA 4JNMA 3RO6A 4HZ8A 4G2DA 2V2DA 2P5NA 5CBBA 3R0UA 2HNEA 4HBKA 3N9SA 4LYRA 1QBBA 1UUQA 3H8AA 4DZ5A 4FX8A 3SRHA 4KESA 3T7VA 4CCCA 4YTUA 3PWGA 4H8VA 4O8AA 2BHUA 1WQ5A 2Y8KA 4B15A 3RRXA 4TR9A 1UOZA 6REQA 3PTQA 1UB3A 4J40A 1XLMA 5DY3A 4JKKA 4MFEA 1R6WA 1JF5A 1CYGA 1B90A 1YBQB 2D2OA 3VDHA 4GYKA 1OYBA 3U2OA 3N6JA 3EXRA 2BDQA 5A6KA 4EX4A 5HJLA 1EF3A 4E8CA 5A6MA 5KETA 3E2RA 3R6IA 1EQCA 2VZTA 3HGOA 4NRSA 1F4HA 1KM2A 1UKSA 2ZVRA 2QCMA 1SZEA 2WPBA 4KFOA 3ZXWA 4KWWA 4YMZA 2BV9A 3L5MA 1KTCA 4ASTA 4IFRA 2R1MA 5FF2A 3W7OA 1VIWA 2UY2A 2Y24A 4FLQA 3IV3A 1V93A 4AVOA 1SQ7A 5A95A 2YL9A 1WZKA 3KP1A 1PAMA 1QRQA 3SZ8A 3W2LA 2UV8G 1E3XA 2EG7A 2DW7A 3W23A 2DFAA 4U28A 2VO5A 3RDKA 4QAIA 5HPCA 4RNIA 3WLQA 2X1UA 1ZAHA 2J7CA 4L9XA 5KZMA 4Z17A 3BV4A 4AMCA 2OZ0A 6PTDA 2XVPA 1F76A 8RUCA 4PE8A 3ENLA 1K8YA 3M0IA 4GKTA 3VZYA 1RP9A 2WSYA 1TVPA 3M5VA 3MI6A 2XTKA 1W9PA 1UZ1A 1XUUA 1V6WA 3CTLA 4AYGA 1VPXA 4HSNA 3L2IA 5ABHA 3NSMA 4L6HA 1KM6A 2XFYA 3FCPA 3KOWA 1R30A 1AFSA 2KZHA 4R85A 4Q7NA 1XSIA 2V67A 4PULA 4LH8A 4OWGA 4RNFA 1DL3A 4QG8A 5IXEA 1XC4A 1V6TA 4JQ4A 3P0XA 3GQYA 5CQ1A 3WDIA 5A5WA 3TNBA 2DJLA 4IP7A 4UBPC 2VR4A 3T4WA 4KMQA 4MJMA 4PSPA 3QKZA 4KEZA 1DXEA 4H7VA 2PWVA 2DQWA 4CU8A 2R1LA 2E1DA 4AHOA 4Q8NA 3BCJA 1NF7A 2QV5A 3RNDA 2YCKX 2FYMA 4BF9A 2WZMA 5CGMA 3GXTA 5EFFA 2BGNE 3NOEA 1DWFM 4HZ6A 1JCXA 3ZWTA 1OY0A 4TVDA 3EWCA 2YBTA 1VEPA 3BO9A 5EFDA 2ISDA 5I6SA 3CC1A 1EEPA 3BANA 1OWQA 2F7FA 3U4AA 2NVAA 5CLTA 4IMCA 1E4LA 8XIMA 1YE4A 5IHSA 1EO5A 1OJXA 2VDIA 4JD4A 3M0MA 1P6WA 7PTDA 3CL6A 1F3WA 3ZM8A 4A3YA 4M6UA 3AC0A 5D02A 2QGYA 1DWGM 5AC6A 1K6WA 3S2LA 4A6GA 5FJTA 5AECA 4N9CA 4PC8A 3QMSA 2QDDA 3VAVA 4RZBA 2YBVA 2VL4A 1FWDC 3N25A 3AMGA 2FTWA 3BAWA 2AL1A 2QCHA 3SGGA 3LY0A 3RLGA 2WLYA 1QAPA 1OK6A 3SCPA 4AD3A 3AIQA 2YBUA 1U1HA 3T78A 2GGGA 3RR1A 2XWDA 1H7NA 3ANUA 3B4UA 1R3TA 2OFJA 2OQYA 2POZA 4NI3A 3H2MA 1FQ0A 2EAWA 2A5HA 4O1DA 3A9BA 1FXQA 1CT5A 3QEZA 1X8FA 1ODUA 1ZTVA 2ZX5A 1W3JA 3FJLA 4WX2A 4BWLC 3HMJG 3RAOA 1TPDA 1JCNA 2VZVA 5FF0A 2FDSA 1J6PA 3B9NA 3VGEA 2BXVA 1SSDA 2QIIA 3TYUA 4C1NA 3WKZA 4IIEA 1CB7B 1CI1A 1DEDA 1XLFA 1UUOA 4HK6A 1F8MA 1VFHA 1QDSA 4O15A 4O18A 4A2RA 3PPCA 1GOKA 3NQBA 4H7CA 2NQJA 2J47A 1QPOA 1EHNA 2OKOA 2AL2A 3ELFA 4IQLA 4EE9A 4DWSD 4GXMA 3W7DA 3LG3A 3LXCA 2WJEA 3LN3A 3W84A 1ZS2A 1CXFA 2WXDM 4H6EA 3PG9A 4CU6A 3UXDA 1E1EA 4TVCA 3UZ5A 3BLOA 3OQEA 3WBYA 3RU8X 1C7SA 2XIMA 3KOZA 2PTZA 3OBEA 4H6QA 4ZCWA 3WEMA 2NQLA 3PZQA 3RG6A 2BOGX 2PPGA 3UXIA 1UQZA 1ZP4A 3KHJA 1XLDA 2ZE0A 3L68A 3NUKA 4R7JA 5M2FX 5AHEA 3ATYA 3PUOA 5IDIA 5E5CA 1KM3A 1TCMA 1HGYA 3T44A 4MSSA 1XLHA 4WDTA 3COTA 3PNZA 4AY7A 3TSBA 1LBFA 3KDNA 9XIMA 3B03A 4V1XA 1HKMA 1QOPA 2NWRA 3ALGA 2WQPA 4RPPA 3CAWA 3H4GA 2VEPA 3HPAA 1EB3A 4LYKA 2WOQA 2X41A 1YQ2A 3CUXA 4HNTA 3U5UA 1FP8A 2C91A 3HPSA 1TV8A 4CQBA 1RD5A 3LUTA 4LAUA 3SO7A 4QTGA 5F1VA 4UMCA 5AZ1A 4DUOA 1AW2A 4AX6A 2R1NA 3SFWA 4LC6A 1WZMA 4DJDA 3QGVA 2OJPA 3W7MA 4N6EA 3WJXA 3RCMA 3PZUA 2Z6JA 4FLRA 4QM1A 2OKTA 4RCXA 2ABBA 5AHNA 3M0LA 1YNYA 4HCLA 2ZUWA 3B9EA 4YHGA 3MVIA 3STCA 3ABZA 3GDLA 3OJGA 3PFRA 2OYLA 4GZ7A 3LENA 1A5NC 1XGDA 4J1OA 3VC5A 4P7OA 2WC4A 2R94A 1KKOA 2ZC1A 3ABOA 3QYQA 2Y88A 1OVDA 3M5ZA 4AYSA 1DJWA 3RCNA 3UWQA 1EA9C 3BG5A 4LVFA 2C16A 3LD5A 1KO0A 2WB5A 3PZIA 4MJZA 3SDOA 5CSSA 1LT8A 5D8WA 2F2HA 5JMUA 2C18A 4ZO7A 3OPSA 3L5AA 1KXHA 3W7GA 4JFUA 4R3UA 1TV2A 3N2MA 3CU2A 1SJAA 5J5RA 5LZLA 3R12A 1H61A 4KFPA 3TFXA 1HIZA 5AYZA 1TWZA 1FH8A 2GL5A 1HVQA 1YBQA 3V7PA 5HXMA 2PODA 1KGXA 1P7TB 4ZMGA 4CN1A 1FHUA 4IGNA 4LWWA 1Q6DA 3TX9A 4IQDA 3KHDA 1KXVA 1DIOA 2V5CA 2Y8UA 2P3EA 3OIXA 1NDYA 3T81A 3TOPA 1LL4A 1PKLA 5D05A 3G5EA 1PCWA 4C7FA 2PDPA 5CJMA 3WL1A 2VXNA 3M44A 4K6AA 4WSKA 2Z27A 4OUIA 2WM0A 4DQWA 3GNXA 2LLEA 9RUBA 1ME7A 1Y7VA 3TH6A 1KW1A 1PIGA 2G5WA 3VMOA 4IPLA 5M1TA 4LNYA 2RDUA 3WH7A 1LL7A 1AMYA 3TXZA 2AQVA 4JHOA 4A4AA 2EPMX 4PMRA 1Q2SA 1X98A 2RH9A 3FLUA 4C7GA 1UWRA 4HMNA 1GQKA 1QO2A 5CPSA 2GVEA 1VFMA 3SIMA 1JD9A 1Q6EA 1CXIA 4B3KA 1NWUA 1XIMA 2DZUA 2IQ0A 5EKYA 2XPKA 4XWUA 1K8CA 1US2A 3MT1A 2HXTA 4TO8A 2ZXAA 3TN5A 4RDVA 4A22A 1Q8AA 3C2RA 4B2DD 4DELA 3P6LA 4L61A 4GFSA 4OUEA 5CCZA 1E4NA 4Y9OA 2ZXBA 4C6DA 4WKFA 4N0RA 2EKCA 3WMSA 1ISYA 1NFBA 3WF2A 3QKEA 4IG2B 3AHVA 2OSWA 3MPGA 5HUPA 5CPQA 3V1HA 4KWVA 3PJXA 4B4HA 2YGYA 3LPGA 3QPEA 3NO5A 2JALA 2YA2A 2YL5A 5DMMA 1F6PA 1R7AA 7TAAA 3NQEA 3MANA 2CZDA 2GGIA 2ZRXA 1GVSA 2ACQA 3QSTA 1R7OA 4EXQA 3CQJA 2O9RA 4AXKA 2AGTA 1VBUA 4D2JA 3ZJ7A 1OBAA 1QPKA 1VBRA 2V9DA 3IIVA 4O4VA 3WJWA 3W0KA 3G1FA 1S2UA 3F1QA 1X6UA 1AZ2A 3ZT5A 1ZZMA 1UD5A 2Y62A 2A7NA 4DI9A 1CIUA 3EWWA 3PF3A 1JNEA 4QS6A 3MHFA 1VH7A 4OT7A 4J9JA 4JFSA 4JTDA 1DXFA 3U9IA 1LWHA 1H1NA 4US6A 4GK8A 3TUUA 4J2PA 1VB9A 1FTXA 3GR4A 1KGUA 5LHFA 1AQ0A 2P53A 5CSUA 2NWSA 1GZGA 3WQWA 3V35A 3VX1A 3LU2A 1FWSA 3OVQA 4Q7IA 1PUDA 1FCQA 4YWIA 4QE4A 2REQB 3KTCA 4MY9A 1KQYA 5U4NA 1T40A 2J8TA 1XYAA 1I2RA 2VGIA 3AIVA 5LA2A 4DF0A 3R0DA 3VA8A 3BUVA 2BP1A 1QVBA 5E9XA 3NGJA 2G4FA 3UA3A 3RX2A 3WLHA 4RZ5A 2GDVA 3QC3A 1A3XA 1Z41A 2RDXA 2VR5A 1GVEA 1W8GA 3AMCA 4Y9AA 4AISA 4QG9A 1XBVA 4RLIA 3QC0A 3QY7A 2FLIA 4YLWA 3L21A 4W8BA 3RN6A 2QF8A 3LPFA 4FR6A 3T0AA 2DQXA 1ADSA 4DI8A 3S5ZA 4JTJA 4HN8A 4XKMA 5ABGA 4WY0A 4K36A 1DJIA 4EACA 3ZR6A 1CEOA 2AOSA 2XG9A 4IM4A 5EB8A 5FOOA 4AIEA 4JTLA 4F9JA 3DFQA 3GXDA 2EBNA 3VIOA 1YEYA 3IVSA 2YCIX 1TA3B 2DVTA 4LX4A 1EUNA 2E40A 1DIKA 3A5VA 2XU2A 4LBRA 3IJ8A 1Q5MA 1JYVA 3GC5A 1VFSA 1NSJA 2P10A 1BXBA 4S3BA 1LROA 4PFHA 3BQ5A 2DZPA 5D2YA 3GW0A 1EL3A 1K3UA 3URAA 3TQPA 4S3GA 2FPTA 5DANA 2VDGA 5I2UA 3UR2A 3F4DA 2V38A 4JX5A 3DI1A 3SUTA 3MU7A 2IKJA 2WM1A 1NAL1 2QF7A 5D8ZA 4D6JA 5CBIA 1PZ2A 3AWOA 3PTDA 4CNOA 1HJWA 1FKWA 2PSNA 3N2BA 4S3DA 5JXQA 1E72M 4MWAC 2J77A 4NZ3A 3C2YA 4JKLA 1GVQA 2DIEA 3NZQA 3NZRA 3BLKA 4IQJA 4X22A 1I6NA 3ARZA 4CVWA 4QEEA 2VX7A 3PTMA 1P1XA 1V3MA 4GCAA 7TIMA 4I9MA 4CEUC 1EO7A 4HPGA 4N9BA 4D6IA 4Q3MA 4XD4A 4OZOA 4GI9A 4L5ZA 4NHVA 5A2AA 3E0FA 1AA1B 3KBWA 1HL8A 4ZODA 3M0JA 4WDUA 4CLMA 2P8CA 3CV2A 3LA4A 2P1FA 4HSOA 1XGEA 2XFWA 2NUYA 3W27A 3DKJA 3BVJA 4BQ4A 3A3WA 1J10A 1HGWA 3B40A 3PUEA 4NNBA 4JTTA 3VNKA 4ZZ9A 2XIBA 3PJWA 4MYAA 3QGAC 3GG0A 3MWAA 1FWFC 2XH4A 1CGUA 2FTYA 4C6NA 2O7QA 4JQAA 5BROA 3Q37A 1UMLA 3MP5A 3W7EA 5G1MA 1WB0A 2QUNA 2G4JA 4G6CA 5LNUA 3W71A 4LF2A 5DBUA 4CNNA 3LGDA 3R0KA 1KWGA 4WXYA 4YVPA 4QDWA 3WMCA 4A2SA 1SO3A 5D2XA 3EOEA 4ALDA 4DUWA 4EPBC 4NJJA 4K8GA 1UJQA 3LDVA 4GJIA 3MA8A 4BA0A 1WKYA 3IUIA 1QU4A 3IAPA 3UPMA 3IJLA 4IHCA 1GOOA 4S3CA 1TPEA 1H7XA 3NAVA 1E4IA 2PC8A 4C6CA 3A3XA 3CHDA 1LYXA 2HNHA 2GWNA 3VGFA 4UFKA 5G2WA 4ATDA 1XLAA 3GVGA 1S3HA 4MDPA 5LA1A 3P80A 5DEZA 1EDTA 1Q7ZA 4TV6A 5XIMA 1HVXA 5FA5A 3S5OA 1UWSA 2AGKA 4NVTA 5LYRA 3NZGA 1GOXA 3GTXA 1AK5A 3C86A 1HL9A 4PUNA 2FZ9A 3FHQA 3A4WA 2NVDA 1QNQA 5A6JA 3W1PA 3VIMA 1A80A 4G7EB 2GSHA 1THFD 3GKFA 3KW3A 2WNWA 2VENA 3GKAA 2EPOA 1Q6OA 4PGLA 2FZ8A 4US5A 3MSDA 4D6FA 3HV9A 3CWHA 3FSUA 1LT7A 4C60A 1F2JA 4DNHA 1X96A 3NYDA 2BXYA 3G1AA 1VBHA 5TAOA 1TRDA 1XG4A 4XAYA 2B7OA 4GZIA 3TWBA 3RHGA 2Z24A 3VUSA 1A49A 1VYRA 3GM8A 4C65A 2A3EA 2R8WA 3VOCA 3UXAA 3M0XA 1J9YA 5DLCA 3M5XA 3FV9A 1L6GA 1O66A 4H2HA 3S6OA 2XN2A 1EJRC 4J2MA 3O07A 3W1NA 1GT8A 3MO7A 5FAGA 4DO4A 4JOMA 4FX7A 1AD4A 3VGGA 1K9FA 1PX4A 2E6AA 1RK6A 3PBGA 4BQ5A 1V77A 4QROA 5G4WA 2PURA 5F2MA 2Z2UA 3UT0A 2X8RA 2GJXA 2QXWA 5GNZA 1E0UA 3M6YA 1W1IE 3GBDA 1WDWA 2ASHA 5GNYA 4WKHA 1P48A 2Q01A 3A47A 3HB9A 4GUIA 2GPTA 2E77A 4XV0A 2W62A 1YW1A 2O4MA 3T2PA 5BXTA 4J7RA 3Q58A 1O5RA 3GXPA 3HF3A 3HGJA 2XISA 1VLWA 3WF0A 3CJPA 4FEZA 1TWWA 3UR5A 3CO8A 5L6UA 4PCSA 4Z0JA 3E5PA 1OGBA 2GUBA 2WC7A 4NAEA 2VD8A 3CZGA 1FP9A 5TD4A 3BC9A 2RHGA 1H62A 3OIHA 4C1NB 1KA9F 7CGTA 5I3DA 1RXOB 2GJRA 5D38A 1TELA 2OQHA 1GOQA 1DJHA 2A3LA 3MO4A 1B3XA 3ARTA 3PANA 3CZEA 4RE2A 4JBRA 2Z1SA 4ATLA 1U2YA 1UD6A 3LQLA 2ZBTA 3PP7A 3BAJA 3ONCA 4BY3A 1CECA 1C92A 1NDWA 3STFA 1VGAA 3R7MA 1YADA 4GACA 4YN5A 4TX9A 2CLLA 2WJZA 1GUVA 2J4GA 1I2NA 3FKKA 3CZKA 1HKJA 2QQ6A 3CL8A 1F7BA 3I3DA 4MZYA 2G96A 2IKIA 3VINA 1R5YA 1ADOA 4UTHA 3EZ4A 3ZVIA 4YVVA 4FXFA 1B4KA 1PSCA 1D7KA 4DJDD 2QW5A 1Z8AA 4QFUA 3A64A 1OC6A 3NSNA 1YKWA 1TPH1 3HZ3A 3XIMA 4FZIA 1TPC1 3GR7A 3POHA 4PTXA 4QJ3B 3BSGA 1QATA 3JZUA 1EOMA 3E74A 5T91A 3KBSA 4EWND 1IXOA 3A23A 3W73A 1I60A 4GABA 1VC4A 4DF2A 4ORMA 4IGHA 1LOSA 3ZS4A 1JYNA 3WMLA 3CAKA 1I1WA 4XG1A 4BR1A 3QV8A 5I3GA 2Q3RA 2PE4A 3TNOA 3VOJA 1KC7A 3TYZA 2QUMA 3E0IA 4IPPA 2ZRUA 4DHGA 1LBLA 1BF6A 5LGZA 1F05A 1AJ2A 3EDDA 5AYIA 1S39A 2PB1A 2CBVA 3FVMA 3TC6A 1GJPA 1EGMA 3ZYZA 3KRZA 3HBLA 1UD8A 4M6VA 1EWEA 3AXXA 3KAOA 1A5AA 4O0KA 1UP3A 4DBDA 1ZB5A 1PKMA 4LTSA 3DN5A 4MAZA 1XF0A 1F3XA 4Z2HA 1E9YB 3N4FA 2YLAA 3GHSA 3CZLA 4ADSA 1FFQA 4JKMA 3U48A 4PMVA 3W83A 2QCDA 1OM0A 2CC0A 4UTJA 4RE3A 2VNCA 1O94A 3CAVA 1GVOA 3AUJA 3OHMB 4AD0A 4D6DA 1V5XA 3I65A 4BFAA 3LXAA 4PCPA 3WO8A 2J6XA 5AN7A 1H3GA 3PZ9A 4EF9A 1NFGA 4EWJA 3WQPA 4RPQA 2Q3OA 4WUIA 4Z1AA 2VJXA 5IOBA 4MUZA 2PTYA 2BS9A 3CYVA 1LL6A 5CAKA 3TYCA 1KNWA 1RBAA 3A12A 4TOQA 1WBJA 3AISA 1YMYA 3Q65A 2DH2A 3H2FA 3IANA 4TXEA 4HK7A 3EGJA 5CG0A 5FKYA 2CZFA 4EAMA 4JIQA 1RJRA 2EQDA 3CV1A 4H6RA 4MZ8A 2NW0A 2J9ZA 3WJSA 4IP5A 1POKA 3G1DA 1UWQA 1XIGA 3QGKC 4Q4OA 2J66A 1JUKA 2CWNA 2DEPA 4E6MA 3W88A 5CC6A 3UZYA 4WZHA 1JQXA 1BVNP 2VP8A 2DVXA 2VKZG 1AODA 4IMEA 3JS3A 1FFRA 1PBGA 3VCNA 1ZBKA 4JY8A 2Y70A 4M1BA 1C8VA 1SPQA 1UBSA 4KWSA 1A4LA 2Q8LA 2VZUA 1X1ZA 2D22A 3BLDA 2QCDB 4DUXA 4I5UA 3I6EA 4C91A 3F7JA 1EJSC 1K7XA 4NX0A 3VNJA 3TW9A 3HURA 4UTMA 3UJSA 4E5TA 1QBAA 3UG5A 1ISXA 4DYEA 3LCGA 4JTRA 1TTQA 2PDQA 4AD5A 3GUGA 1TJ1A 3W38A 2PDMA 1XIHA 4WSJA 3DZ1A 2DIJA 2QDEA 2X2GA 5DRCA 5GQBA 1Z32X 4M29A 2NT1A 2OX4A 1XBYA 2VFHA 3L4YA 1NWTA 1Q7MA 3IUDA 1CW2A 2G3IA 2WVTA 4H4IA 3EDFA 4JIEA 4HCDA 3W28A 4M0XA 1H7WA 1A3WA 1XKJA 1LF1A 4WDWA 2OWWA 2D2GA 1JCLA 1RK5A 1XYCA 4MUPA 3GVRA 1KRMA 1RUSA 3OLDA 3DYMA 1L6SA 5CGQA 2PZ0A 3P14A 3G1VA 3A5FA 3FXGA 1E73M 2C7FA 2WMIB 4UZUA 4NKCA 3RLHA 3D0CA 2Z0IA 2GSJA 3WUFA 2R1KA 1E0TA 3TC3A 4L9ZA 4RW3A 1MYRA 3QV9A 4HYWA 4JEQA 5F1UA 2WCSA 2CLEA 3T8QA 3AIUA 2NUWA 3OG2A 2INZA 3FA5A 3AU6A 1JGIA 1W3KA 1CENA 4W86A 3E0VA 3HIJA 3UR7A 4KWUA 1P5BA 4L56A 3E02A 1I2PA 1YYAA 4RZ6A 3VMPA 1BYBA 1XYLA 1J11A 1TQXA 4GINA 1M1BA 4UC5A 2GGHA 2CITA 4ZTYA 2DSKA 1RVKA 5EMJA 4AHQA 1OFPA 5FF7A 3M4HA 5CKSA 2ZUNA 2FKPA 5G1TA 1UQYA 1RZMA 3DYPA 4N4QA 2A1YA 4LRSA 1GG1A 1UH4A 2V69A 4UQEA 3TJIA 1FVPA 3I6RA 2ZRZA 1LLWA 4FB7A 1MUWA 3S2MA 3B06A 2Y5EA 1S2TA 3ATZA 3CMFA 3QFWA 4GZEA 3QN3A 1XIDA 3TSDA 4MYXA 2X05A 2C1GA 3UEQA 3VDAA 4DBUA 4ACYA 3OODA 1LP6A 4FXJA 2J13A 4LCQA 1PZ1A 4NXKA 3QY8A 2HK1A 2PLJA 1BYCA 4LAOA 1K8ZA 3GU2A 3UXKA 1O6IA 1HO4A 1R2RA 3LQGA 4AZCA 1H1ZA 1E4MM 1TVNA 2QMKA 2JK2A 1VJSA 3CIVA 4LV4A 2ZRVA 2PGFA 2I17A 3EBVA 4KEVA 4WJ8A 2QAPA 2J7EA 3L12A 1M65A 2HV5A 5DRIA 3RLVA 4JQ2A 1W5MA 3P5ZA 3THAA 3VIFA 2O4QA 1XSJA 2YA1A 4JZ5A 4CNUA 5C7HA 1SR0A 3SY1A 2PWHA 3B8IA 1KBIA 4MLJA 4HA1A 4E3TA 1A5BA 2B0MA 3J7HA 1H4PA 1A5CA 1JJKA 1S1RA 2B4GA 1XL9A 1YDNA 8CGTA 5PTDA 1DYSA 3TIMA 1TTIA 4TTUA 3DFNA 3RU6A 1OT2A 1NTHA 4DJFC 1Q13A 1V03A 4NG3A 3AHXA 1XIJA 3CAQA 1XH2A 3ZJ8A 2RGMA 1FH7A 4JTKA 4PTMA 2BTMA 2DSVA 3OZOA 2WNNA 5FEWA 1A5LC 4I9JA 3PC0A 4NF7A 4LS2A 3AHYA 4DJEC 1CWYA 7REQB 3WQOA 1TREA 2GVJA 1J12A 1T41A 3WD3A 2CESA 3H54A 2O92A 3T2OA 3DENA 1FWEC 4IFKB 3S2JA 3KP0A 1D9EA 3W01A 3VKDA 1Q7QA 2BG5A 4LQ1A 3KBNA 3G3MA 5H91A 1EBHA 3RPMA 1XW8A 5JQ9A 4GA8A 5FEXA 2VVNA 4U4MA 4JTHA 1TKKA 1TUXA 1WUEA 1KFEA 3TMLA 1Y5XA 3BJTA 1A5SA 4CUCA 4IIBA 1DTNA 4QR6A 1XRSA 1QO5A 2HVOA 4YCPA 2VQTA 1WDSA 1EYEA 2F6UA 2J8GA 4D72A 2X0SA 2ZX7A 1K1DA 1UZDA 3O9NA 1EFZA 3QLDA 1QK0A 1W8SA 1MDLA 2FZBA 3EX2A 4MPKA 3HPZA 1KRBC 4Z1BA 4O1FA 2AMXA 2QNEA 2IQTA 3W26A 2EPKX 3NPVA 1XXXA 1MW2A 4M3PA 4WKAA 1LLZA 3LTYA 1HX0A 1BRLA 1RBOB 2YCLB 3WFLA 4GY0A 3VGDA 1I75A 3T40A 3K5XA 1K9EA 1VAHA 2E67A 1H0IA 2I56A 1G6CA 2DORA 2W3ZA 1XI3A 3VIIA 3G22A 3EB4A 4HYVA 4YJ5A 5I3JA 5A3HA 2GQ3A 5FI8A 3L9CA 4U10A 2YX0A 2PD5A 3LMZA 1BWLA 5G4HC 4XB3A 4JIHA 3A4JA 3WUBA 4MKVA 3CPGA 1X1NA 4KH2A 1JD7A 5DMNA 5BOOA 2BHZA 1KFCA 4NAFB 2WMFA 4UR7A 5I79A 4QJ5B 1U30A 4W8LA 3N11A 5H8UA 2PA6A 1TZ7A 1AL7A 1WPCA 1O60A 1ADDA 4UIOA 5KSWA 2ZOXA 3VYLA 1G0CA 1VZWA 1IE7C 2R14A 3THUA 4WOZA 3WD1A 1R46A 3WDQA 1GKRA 3IACA 2Y89A 1KLYA 1SFLA 2NXHA 1LOQA 3IIXA 4US5D 3S9YA 3ZLGA 2D1ZA 4CGTA 4UQDA 1FWCC 3GNNA 4AMAA 3PS7A 3DESA 1V79A 4UMBA 4B16A 3NVDA 4FXSA 1MEIA 3S3GA 3WDPP 4E2VA 3TJLA 4S3EA 3BDKA 1VCGA 2PBOA 4GXPA 3LRKA 4MIMA 1J0HA 2Y0FA 2PDXA 4GI6A 4QHRA 4CVUA 3HMCA 1TIMA 3FNDA 3G2GA 2HWGA 2OEMA 3PAJA 3VKBA 3LI0A 1JR1A 5LIUX 1XG3A 4L4MA 2BHYA 4W89A 1ZP3A 3QW4B 4HB7A 4JICA 2WZEA 1JZ2A 2BFGA 1MNSA 4JNYA 1FWIC 1PE1A 4AIOA 3FJ6A 1DWJM 3H4WA 2AQWA 1E40A 1F6YA 3DFYA 2VC6A 4DF1A 3GK0A 1M7PA 3TYAA 2CXEA 2DW6A 1QPRA 4OECA 3BWWA 4GIRA 3GNRA 1PTAA 2AL2B 3S1GA 3TYEA 1UOKA 4GIEA 4R34A 1ZQ5A 3F5KA 3KOXA 4ACZB 2EXOA 2VI0A 3RITA 1VPQA 5A8PA 3EWZA 4HNNA 4BQ2A 1CLKA 1P0NA 2L5HA 3LGEA 2NQHA 2B7QA 3VDBA 3WBEA 4MB4A 1EPVA 5HQLA 4O8RA 3A4AA 3LRLA 2NX1A 3AMKA 1W1ZA 4LGXA 4ERAA 1GHRA 5C9XA 1NEYA 4JN8A 2HE8A 1GKPA 4R33A 4WGHA 3QM3A 2OGYA 1O12A 2X1SA 1EJVC 3SQLA 4WF7A 3P8IA 5C9WA 4FAMA 4A8NA 2QEZA 4C5ZA 4UQ9A 1H7PA 5LXEA 1JDCA 2IMRA 1U22A 2ZA2A 1WP6A 4DLFA 3G3DA 4L4OA 4JTFA 3K8MA 3E1F1 2XFFA 3ZQ9A 4J28A 5I3KA 5EBAA 3LHUA 3GXMA 3UGRA 4Z2IA 3N73A 1X97A 5HBFA 3GXIA 1VR6A 2IW0A 5LHEA 1TG7A 3N17A 1Q2RA 5T26A 3KXQA 4RE0A 1LQ0A 3IRDA 4HU4A 3EB3A 1KFWA 1T8XA 3APGA 3MCOA 4GCXA 3VD3A 2ISSA 1GEHA 4AC7C 3AYTA 1IEXA 1QI0A 2YXOA 4DM2A 3DOPA 2CETA 2FH8A 4XSLA 5M17A 5FF4A 3G6MA 1PYFA 3AOFA 4DZIA 5IRPA 4CD4A 1T8QA 3GNPA 3TE9A 3W2NA 1V0MA 1B9ZA 3KOFA 2XVGA 3CUHA 4R9XA 4ZSTA 2HS6A 3TLQA 3F2CA 4GYPA 1TE1A 2ACUA 3B8VA 4C6OA 3QHMA 2PGWA 3V18A 4A35A 2FJKA 3EOOA 3WF4A 4N6FA 4M5PA 2X0YA 2ZZ2A 4QSFA 2J9YA 4AEEA 2NV2A 4CQCA 1TPVA 4N4PA 1KFKA 1DHPA 4A8RA 3PZGA 4A8IA 1DJGA 4S2BA 4OOZA 4PB3A 2A4AA 1RSCA 4GO9A 3OA5A 3GG8A 3D46A 3BCFA 1TMHA 2E4TA 2WC3A 4J3ZA 4EPEC 4EPDC 6XIMA 1PKNA 3W2MA 3TTQA 1ZLPA 3NDZA 4ZOBA 1IR1A 5HWNA 2G3MA 5CZ0A 3AHTA 1DVJA 2NV1A 1VCFA 3N15A 1XYMA 3OO2A 2NVCA 3RUBL 2PLKA 3BQ6A 3RO8A 3TFCA 1CDGA 4F8XA 1S5TA 5A6AA 4UFIA 3S9ZA 1MI3A 5CC5A 2OSXA 2VUYA 1ZRQA 3CTTA 5LIXX 4H9ZA 5E6YA 3LTSA 2E9BA 3S1VA 2J7FA 1A0DA 1YNQA 4HOWA 5FJJA 6XIAA 3QTPA 4HSHA 1XFBA 4IQEA 1PB0A 4S2CA 1IXPA 4NJIA 5JUVA 3ITGA 5AZ0A 5HMFA 1UWTA 3KEHA 2DZAA 3GG7A 1UYQA 1HFBA 4HGXA 4UFJA 2VGBA 1ZPTA 3KE0A 5I24A 1MEWA 2CHOA 2F8QA 5D9PA 2ISVA 2Z7GA 3I68A 5CC3A 3GH4A 4NP7A 2OT0A 3TW6A 4QIUA 4PZVA 4R9OA 4MB1A 3NEVA 4DRSA 4X9YA 3CS2A 1PX8A 3NXFA 1QW9A 1S2VA 4NRRA 5D2WA 3EYPA 1S2WA 3ABSA 3VI2A 3OLEA 3LYEA 4D6HA 1ISWA 1F6KA 3WNMA 2WK2A 1J2BA 4PR4A 3P84A 3TAKA 1E43A 1C91A 2ZUSA 2C14A 1Q6GA 4HNUA 1DWIM 1J4EA 1FWTA 4X61A 3WUEA 4JX6A 1VFFA 5BRPA 1TWDA 2XGBA 3R10A 3SAZA 3OHIA 2ZADA 1VENA 2XIIA 1YPIA 3VDCA 2GGEA 2VMFA 1AJ0A 1OD0A 3FEMA 4F0HA 1QWGA 3PPGA 3NQDA 4OGZA 4PMZA 1FHVA 4ZFMA 4JXCA 2ZIDA 4Q32A 1I2OA 2QPSA 1UJPA 1QXLA 2BVYA 4O57A 1UKOA 4XD6A 4W8AA 4IXHA 1BWVA 4J27A 2MANA 4KT2A 5J8LA 2OR2A 1PYMA 1M7JA 3AI0A 3H2CA 4JYDA 3T55A 1R0MA 2NLIA 4Q4KA 5I3HA 4AWTA 4JHMA 5H8MA 3KRBA 4FF7A 4ZOCA 5DF0A 5C5YA 5K4ZA 4XQ6A 1XV8A 3AIRA 1R3VA 1XC6A 5DN1A 2YZ5A 1OADA 4L4LA 1XJBA 3I4EA 2J79A 2V0TA 1TPFA 3VKKA 3EKZA 1F61A 2BOEX 3ZJKA 1RY8A 1EGZA 1Z44A 3QMTA 1JFXA 1UP0A 3DU0A 3XISA 5BZAA 4XAFA 1B0IA 1GOMA 1O5KA 1UD2A 1QT1A 2J75A 3RJXA 4NYUA 1DJQA 2UY4A 4NILA 3RM9A 1U5HA 3CUFA 2O55A 4PFMA 2Z1WA 3G8RA 1O7AA 1TFVA 2Z1KA 3D5HA 1H51A 3GNDA 1GORA 4O10A 4F0RA 4DAFA 2CLOA 3GC4A 2A21A 4ZR8A 3UW6A 4FHAA 3QPYA 2WW5A 5HOSA 3H55A 4F9DA 4UB9A 4WQ6A 1HKWA 2ZX8A 3I7QA 3PUGA 5E6ZA 3P81A 1A5MC 3EKGA 3B0VC 2V3DA 5A94A 1SJBA 2V63A 4FNRA 3GDBA 3SN1A 3LHWA 4D6CA 3SGUA 4E8GA 4Z1YA 1SYTA 3S6DA 1C29A 1T96A 3WIJA 3MUZ1 4PMXA 2ZRYA 2E25A 5MHBA 3WLLA 1TPWA 4LUSB 4GKLA 3WLPA 1XLCA 2HXUA 4UFMA 4ICMA 2ZXDA 3BPWA 2GGJA 4BKNA 1DE6A 3P61A 3HFTA 1MQRA 4QNWA 3WQCA 3NL6A 2HJPA 3LCHA 3MYOA 2PU0A 3WD2A 4N2YA 3LBOA 5I3IA 5CLWA 3SB0A 3HGSA 1NM9A 4IT1A 1MFUA 2BBFA 3AYSA 1UC4A 3P5YA 1QNRA 3AJXA 1X7IA 1ZALA 1MZRA 1Q66A 4YS1A 1WDRA 3UD6A 1QI5A 1P7TA 3SQSA 2VRQA 4J3SA 1ZBVA 3DEQA 2ATMA 4WJXA 2DGAA 2PDBA 5D2VA 4ECLA 3QF0A 3TTSA 4PB5A 1QWKA 4ZGYA 1JRBA 3PPHA 3FFSA 1DJNA 3V0TA 3HG2A 3G1SA 3H26A 3ZWSA 1ZBCA 4W84A 3O8AA 5HR7A 2YYTA 1OGSA 4HYRA 2WLZA 1LDCA 3AMDA 3NG3A 2FZDA 1KLZA 1NF0A 3ZSTA 4B5NA 5I06A 3NQ6A 4WY0F 3H7VA 3BG3A 4ADUA 4PA8A 3TWAA 4L80A 1E1FA 3WD0A 3WFZA 3BAIA 3RRAA 4M24A 2EGZA 2D69A 1L2QA 2VX6A 2X40A 2PDIA 4PCFA 4H01A 4DJFA 4LOCA 4TMCA 3KCJA 5C2XA 3AXKA 2OZ8A 4RDYA 3GRIA 3ITXA 1FWWA 3AIBA 3W7RA 3P82A 4O50A 3C8NA 4EP8C 3FA4A 1ICPA 1E55A 1N8IA 1X6LA 5JBDA 2PD9A 5A1AA 1M9HA 2R6OA 3UF9A 4AWEA 2ZZ6A 3MUCA 4EPKA 4MMWA 1TYGA 1JI2A 4H8UA 3DERA 3MUY1 3HQ1A 1OF8A 3TN6A 3UWYA 5HJYA 3GH7A 2EG8A 3UR8A 2CBJA 2FH6A 3OTRA 5RUBA 4RJEA 3MW7A 3KS5A 1TV5A 5FJOA 1BXCA 3C5QA 3GFYA 3VXGA 1GGOA 3I7RA 4GQQA 4ZENA 3FJ4A 1XR2A 3TTEA 2XGZA 4MLRA 4LAZA 3TQKA 1GW1A 1ISVA 5BU6A 1V08A 3MUIA 3P74A 3CV6A 3C56A 4LALA 3G1RA 1OT1A 5CC7A 4K2SA 1IT0A 5AHLA 2W6RA 3GHTA 2OYMA 2O0TA 4XBSA 2XWEA 5GJMA 2PTDA 3LHZA 4U31A 3BICA 2ZX6A 1HKVA 2QCEA 1XD1A 3ARYA 1KR0A 5A6TC 3NQ2A 5BNKA 2ESCA 2C0HA 3OA3A 4I5RA 4XSMA 1OFDA 3UPWA 4M7TA 3R8RA 3H2AA 2HEJA 1IXQA 1QUMA 4B9ZA 1T5AA 1TO3A 4MF4A 1DORA 1EZWA 1AL8A 4FNTA 4S38A 3TMQA 4J3UA 4AZ6A 3JVAA 1ESWA 1NARA 4HPNA 2HMCA 1H60A 1G4TA 5A6SA 3EDEA 4K68A 3BGAA 4MNKA 1ME9A 5EMMA 1GQNA 3MSYA 3LS9A 4EIVA 1UR4A 1WYIA 3ICJA 4Q6JA 5EBUA 4XO7A 4DYKA 2YOCA 1UPPA 1Z69A 2WO5A 4HA3A 3GG1A 5C6MA 2WCGA 4WY0B 4PMDA 2YDQA 4I9TA 1T0OA 3HG5A 3V0SA 2OZ3A 1ONWA 4UQBA 5H1WA 4Y8FA 1OCJA 3L4VA 3G6LA 4G8TA 3AS0A 3LX9A 3UYIA 1ISZA 1XSKA 2QS8A 4YL2A 1UR3M 2ZZ7A 3VIJA 3EWBX 3S1WA 1VFLA 4DJFD 2QCCA 3G24A 1NWRA 1E70M 4OE7A 2FZNA 3GDKA 3LPOA 2PAJA 3G18A 4JFWA 1TTPA 2V30A 3C4UA 2YB1A 2YL6A 4NIRA 3MC5A 2WZTA 1OCBA 1H41A 3CL7A 3NM3A 1KFBA 3T0BA 3U4FA 4TIMA 2V5LA 2X1RA 4M19A 2VEMA 1IWBA 3JRKA 2VUNA 1JDEA 3PZTA 4MJ4A 4ZB0A 4E3VA 3GD6A 4NL1A 3VC6A 2Z1BA 3B8SA 4GY7A 3FGCB 4K38A 4FLOA 1N7KA 2FTPA 2WKJA 2O9TA 3WLMA 3HPXA 4PBFA 2CHRA 3GLCA 4E0CA 3BAYA 3GTFA 4WDXA 2WQDA 4AZBA 2BASA 1MMFA 2CBIA 1RALA 4PMQA 1R3YA 2OQLA 4QSHA 1X8CA 1EH9A 1QHPA 4OTKA 5A6BD 3W1LA 3T1GA 4NJHA 1LUCA 1AH3A 2C79A 1OC5A 1DQUA 2CPUA 3VU2A 2PCEA 2PWFA 3NPUA 1OC7A 1S5MA 3LV5A 3W1AA 1VBJA 3CWNA 1TMQA 2JBMA 3W1UA 3RFAA 4PEEA 4NZ4A 3IIZA 4HP5A 2ANUA 2TMDA 2PMQA 3K13A 1QHZA 4O1EA 4B9YA 1UCWA 3ZOAA 3M43A 4TX8A 2GFTA 1KCKA 2QGHA 4ZEPA 3GWQA 2NXGA 1C90A 4K7YA 3V4BA 1EA0A 7XIMA 3MHGA 1QNPA 4GVHA 2VC5A 2FJUB 4GISA 1IZJA 3RK8A 4AWUA 1A5OC 3H12A 4EAYA 5CGTA 4FNPA 1TJRA 1ZGDA 3NZPA 1RQHA 5C0QA 3C2VA 1RJQA 3WF1A 4UFHA 1Q63A 3SRDA 4C6MA 1XLJA 4DIAA 1EHAA 4UQCA 3GHUA 2EHHA 4GVFA 3FYPA 3FDGA 4PMOA 4Q22A 1XIFA 4XD3A 2DZSA 4IOTA 3C3UA 1ZUAX 3KM8A 1RLDA 2OXNA 1TV4A 4W85A 2RGLA 1M7OA 2FVKA 4O19A 2DSUA 2GUYA 4LBUA 2OEKA 3RMJA 9XIAA 1JXJA 3ZIZA 4ADTA 3BL3A 1R87A 2XHYA 4GGBA 1WDQA 1WUFA 4UTIA 2ZZ5A 2OLHA 1WCGA 1REQA 4FS9A 1VP5A 2JGYA 3QJAA 5E70A 5A8OA 4LBSA 1IWAA 1JIBA 3E96A 2X30A 1GPWA 2F6XA 3UWWA 4JN6A 2E0PA 3G0XA 4BEQA 4Z08A 3W72A 3GSMA 3DFSA 4BJHA 3SQMA 1B57A 2Z00A 3ORWA 5D9OA 1Y5WA 1WOBA 3T2QA 2VZOA 5IDZA 3NQFA 5CXPA 3BLIA 3H21A 5AC7A 3T07A 3T0DA 2VM8A 3UCCA 2HVNA 5AYBA 4AF0B 2RDWA 1UW9A 4BI6A 2QUUA 3C8FA 4AUBA 3HN3A 4BS0A 1DIDA 5HPOA 2PC4A 4C6EA 1H09A 4YPJA 1LZOA 1B9BA 3UWUA 1W1A1 4MFDA 3TR9A 1F3EA 3FYOA 4JEJA 4DY1A 4QDMA 3M07A 2YDSA 5IBXC 2XVLA 2BLEA 1S2CA 3WENA 4QP0A 2I5QA 5A6BA 4GC4A 4PUMA 3WNKA 3A24A 1L8PA 4NJGA 1JPHA 3CK5A 2BVWA 2CIPA 4XKYB 1CXLA 1K7EA 2XH7A 3M1ZA 3PSVA 3OZPA 4DZAA 2P50A 2YJQA 4C6JA 2DSZA 3QLLA 2CNCA 2A0NA 1HTIA 4QX4A 2BY2A 3LNMA 4PTVA 3A3HA 4IJRA 2C1HA 3OVGA 1JF6A 1OK4A 4ZB2A 3T42A 3OOQA 3N6QA 1O95A 1XLEA 2B81A 4H41A 4GO8A 1E56A 3TN3A 3C3NA 5DO8A 4ATWA 5G5IA 2X16A 5AYYA 1A5UA 4QCFA 5LGXA 3EWDA 3TJXA 2CLIA 4JIIX 2JFEX 3ABRA 4CN4A 3FXYA 2HPMA 1W9XA 3GIYA 3W7CA 3UXLA 3L67A 1FDZA 2PRLA 4CU7A 3HG4A 3D3AA 1CX9A 1E9IA 3PBMA 2DZXA 4I6KA 1XIEA 2DZBA 2EG6A 5DMYA 2IPFA 3L0KA 1BEUA 2FB2A 3W37A 2RFGA 1PKYA 3QYSA 4X3ZA 4UR9A 5BXRA 3N12A 1X7FA 3LMYA 3PULA 4ES4A 1GEQA 1REQB 2X42A 4LAMA 1OINA 4GC3A 5LNVA 4LRTA 4HOXA 1UR0A 4D1JA 2FDMA 3CT2A 4H9TA 4EK7A 1QNOA 5LKYA 4GQBA 3GZ3A 4AD4A 1BKSA 2F6KA 3BGJA 3WH5A 4XKYA 1J0IA 3A22A 3P0WA 3H2OA 4NXSA 5C9UA 1BTMA 5B80A 4C7DA 1ZCOA 1P0BA 3JR2A 2A85A 2QJMA 1MXDA 2HK0A 3JU2A 1O68A 3VPLA 2DSWA 1W3IA 4WJEA 4DJEA 3CZJA 3MKKA 4UNLA 3WNNA 2PDNA 2PRHA 4ZE4A 4WGXA 4I5XA 3MQTA 2RJGA 3IVUA 3PFMA 3GYEA 1EPXA 3KTSA 2GQAA 3RR4A 3UGVA 3M7SA 3VILA 2ZXQA 1YDYA 4MJ2A 1T6MA 2QLYA 1LWIA 2QJGA 2ZA3A 1S2AA 2XIOA 3PK7A 4AZ5A 4J35A 4Y9MA 4F4RA 1CXKA 1MRAA 1W5QA 4GWEA 3C2FA 1ODZA 3LERA 3GFXA 1CGTA 3MBFA 4GD0A 3MSRA 2Z4GA 4LVBA 1WZAA 3KWSA 4CQAA 4GQGA 3TN4A 1OCQA 3WQ5A 3BH4A 3MJMA 1S3TC 5AKQA 4J3XA 4XD5A 3L4UA 2BNJA 5KEZA 2DUZA 2OODA 5AHFA 2PLMA 3N2XA 1RA5A 4HJWA 3REQA 3B3DA 4N42A 4OV4A 1J5SA 3QZAA 1A50A 1JQVA 2NQZA 1UMYA 3K8LA 4EKJA 3CPUA 2V5BA 5TQLA 5LNRA 3IAQA 1SFTA 3S5SA 4J4KA 2BWGA 1MZHA 1HW6A 3W1RA 4LVDA 3VIGA 1NELA 1VHCA 4S3KA 2B7NA 3EPOA 5DCEA 4F40A 3TU9A 1C8XA 1E0WA 1EX5A 1OABA 3AS3A 1WA3A 4UTWA 4B5UA 1FWJC 1HT6A 3MKVA 1O1ZA 2V3GA 3F4CA 2H8ZA 3VK5A 4D8ZA 2C19A 2VWTA 3SJNA 1F8IA 2NLYA 4GZJA 4IPJA 5G2IA 3W2JA 5CBJA 4YIWA 1GVRA 1O5XA 4I6VA 4QCEA 1FHDA 1PCKA 1U1JA 3SRFA 1JGMA 3N1AA 1ITXA 5AHMA 4ILSA 4YNGA 1YDOA 1ZY9A 4RV3A 1XQLA 3PN8A 1JPMA 3R94A 3B0YA 3B8WA 1HF6A 3VCCA 4GUGA 1XM3A 2WNQA 5D32A 2Q02A 3KDOA 1LRNA 1FWGC 2FVMA 5BCAA 5HMSA 5I5RA 1TPB1 1TJ0A 3B9DA 3NURA 3ANYA 3ISIX 4MWAB 3E49A 4ZTXA 3TONA 3SCUA 3E2QA 3W6LA 1OF6A 5EGRA 3W70A 5D9NA 1CTNA 2G50A 4MVAA 3KX6A 3CLMA 1KV5A 3WBXA 5BYWA 1B2YA 1JPKA 2PDGA 4GIYA 5CJNA 3DFHA 1R8LA 4GMEA 4JIPA 4C6PA 3O6CA 4YXGA 1I1XA 3KBMA 5GJPA 4QQ3A 3SCOA 5FCZA 5DT5A 3S8HA 3MUXA 1FWHC 4Q8OA 2W92A 3QSRA 4K1WA 1K77A 1NIUA 1UP2A 1E6ZA 4EF8A 2Y1HA 3XINA 1V3HA 3UJ2A 2OMAA 2FQIA 2WZHA 3DCPA 3U6WA 1H5YA 2PDKA 4UMAA 2CCRA 2CU0A 1UA3A 5DFAA 5FL1A 2I16A 4W9TA 2DUXA 5AHIA 3CIWA 3GVWA 4QEHA 3WK1A 5D2TA 1AMKA 2CBUA 1QTWA 5ECUA 2P0IA 3VNZA 3G1HA 3UP8A 5HR6A 3KTXA 1BYDA 1A0EA 1I8JA 1MQPA 3SBFA 2CW6A 1EP2A 1NP0A 3C0JA 4REQB 1XCWA 4FR1A 4F3HA 4L9YA 4P5UA 3UWZA 3KL5A 1K02A 4LFYA 5A8QA 3M0HA 3O3RA 3HQOA 2HPIA 4UTUA 3W24A 3AFBA 3M0YA 4UTWC 3KS6A 1EJWC 1L9WA 4Q4RA 5D9MA 1EF2A 2V3EA 1XUZA 3O0FA 1W9BM 3GAYA 3WX7A 1SZFA 2VRKA 3KUMA 3W1XA 4NNCA 4PRTA 1IEIA 2DY3A 2YKKA 3WEOA 2IXVA 4XIMA 4HHLA 1VEMA 2J6VA 2ABAA 3A21A 1D2KA 3TKFA 1QR7A 4J3TA 3CQKA 3N6HA 4PMJA 4B5TA 2J7DA 1PZ3A 3IGHX 2CZVA 1B3OA 1ONRA 6ALDA 4UUIA 2I5IA 3H2NA 3PWAA 1SVDA 1MQQA 3S46A 5K3VA 4LUTB 4HTBA 5ENLA 4DVOA 2PCQA 4C6QA 5F2LA 4GY1A 2PDCA 2Z29A 1ZJHA 4D8AA 8TIMA 2G37A 1FHLA 1IR2A 4MY1A 3W9ZA 3O2LA 4L6OA 3RCYA 2V5DA 1KXQA 1ZAIA 3BV7A 1N8WA 3TOYA 4HN4A 2P88A 4J3WA 3EWUA 2EPNA 3STEA 3BZJA 4NJKA 3BOXA 5K7JA 1GYNA 3URQA 1J18A 3LHVA 4JIRA 3GC2A 3KZPA 1E5JA 1CZ1A 4M1RA 3G8EA 1FWRA 3H7RA 4RXGA 5C8BB 1JZ5A 2Z28A 3F4WA 3CPRA 3BOFA 4W87A 3ITCA 4UCGA 1XLIA 5BU9A 1W3TA 3NZ1A 5T8GA 4QNEA 3MMUA 4L1GA 3PNUA 2ZYFA 1VKFA 4A3RA 3VM7A 2QIWA 1JCTA 3ANVA 1SJDA 1B31A 1HKIA 3K1GA 4BQ3A 3E2SA 3GNOA 1M41A 1S5NA 5AVNA 3WH8A 4DXVA 2DT1A 4N9DA 2ZKMX 4JTEA 3W22A 1YRRA 2PP1A 3S5YA 3TZFA 4B5VA 1ZNNA 3T6CA 4P2VA 2JIEA 1P0EA 4HZMA 2W9MA 4H8NA 1UIOA 2HROA 2C0AA 4YTQA 3EX1A 1M68A 3W2KA 5A69A 4F0SA 1XH1A 3ITLA 1MNZA 1OIFA 4C1LA 3QV7A 4GOAA 2C8NA 3O06A 1JCYA 1YIXA 1EYWA 1WAWA 3ARPA 2OPJA 1V02A 3DC8A 2G0WA 1LWJA 3IVTA 3S6TA 3WEZA 1VJIA 4G56A 4FPSA 2A3BA 1TX0A 3BGGA 3V1PA 3N2OA 4QG6A 4W88A 4AB4A 4DM1A 3W6MA 4JNZA 1UKPA 5K4XA 3S4TA 3BSHA 4W5ZA 2WKLA 1ZFJA 1UROA 4KW2A 1PIIA 1V7YA 3EAUA 3UQNA 4XBKA 2HDJA 3WQ4A 2ZE3A 2ZZ4A 2Y8VA 4Z42C 4Q8PA 3IS4A 4CEXC 4WEVX 3MHUA 3CHCA 1K6AA 1J0KA 1DJXA 1VQTA 1YTDA 3CXOA 4CQ9A 3HPFA 2V8ZA 3GUWA 4HNLA 4QISA 2I5GA 5C7VA 3IGUA 3LHYA 4CCEA 1I45A 1TTJA 2J9XA 1N55A 1RD6A 2NUXA 1EGVA 3TYDA 4X0NA 1Q65A 4IMGA 4NAFA 1GTHA 4RZ4A 2QYGA 1NQ6A 4FO4A 2GK1A 3L4ZA 1Q85A 4DUVA 3B04A 3MDUA 2BB0A 4GQRA 3FA3A 4IP4A 3HQPA 2VD9A 4PBEA 2Z2BA 4PRRA 2O56A 4MWAD 4FXRA 2YFNA 1XICA 1V6XA 2J7BA 3W1MA 4IJCA 2W67A 2RUSA 3CUGA 2PZNA 3TCSA 4O0ZA 3SECA 1S5VA 2QMJA 4H9VA 4KGJA 5A2CA 4Q8WA 5TNVA 3RX3A 1BG9A 4LNCA 3TDFA 2PGRA 3HJEA 4Y7EA 5HULA 3SUUA 3WLSA 3MP4A 1V02E 2VEGA 2YW4A 2HISA 2FGLA 3FW6A 4ICCX 4XX6A 1KM0A 3DXIA 4ML9A 3P8JA 5A8NA 2FGBA 3MI3A 4Y90A 1BQCA 2E5DA 2V68A 1JRCA 3LLFA 5K9CA 2CYGA 3KVKA 2ATSA 1TR1A 4GGHA 5REQA 2Z7KA 4WVXA 3RPDA 3SRKA 1RPXA 1FWBC 4TMBA 3DDMA 3M0ZA 3MMTA 3K1DA 3DAQA 3U2EA 3TXVA 1QI2A 3NM1A 3ECQA 4MAVA 3MCNA 3B0PA 1OFOA 4F0LA 1FXPA 4W93A 3AUOA 4IPIA 2KAUC 2IKGA 1GVYA 3U2ZA 3PBUA 3S2NA 1JXKA 2CLKA 2PWGA 2A3HA 5A6LA 2QCGA 3EWYA 1S5WA 2XH2A 1QPQA 1E6RA 1YDVA 1R38A 1G1YA 3T4CA 3RX4A 1FUYA 5HMEA 4UNKA 4UTTA 5D04C 1SFSA 2Y4SA 2PDJA 3PJUA 3U7VA 4GNJA 2WMJA 1PXGA 1L6WA 1UHVA 2NT0A 1B3YA 5HWJA 4G5DA 3OLIA 2IPGA 3FS2A 2QDHA 2OGJA 2X1IA 3O6YX 4GQ0A 5T9BG 4GLEA 3GB6A 1P6CA 1HG3A 5E93A 4QAWA 5KINA 4JYFA 4OOUA 4HPJA 3P60A 1GJWA 1W5NA 4IZGA 2WHLA 1H50A 4ROQA 2VZSA 3IARA 2E8ZA 4LAKA 1P0KA 5CEWA 4LVGA 2ZDSA 1ME8A 3N2CA 1GVIA 4HHPA 4RUBA 1E3ZA 2QPUA 2JE8A 1JDAA 3ZSSA 5GNXA 4GX8A 1PJ9A 1P4CA 3W7PA 3N3MA 1XISA 3R11A 4JQ1A 4NSBA 5AY7A 2PWDA 1SW0A 3IJDA 1E6XM 2YZRA 1JZ6A 3TYBA 2CLFA 4DPPA 2FMNA 2WHKA 1NQKA 5D09A 4D8LA 1SW3A 4GYJA 3NQVA 4L1WA 2JGQA 1QFEA 4GYPC 3IWPA 4HU0A 1DBTA 1N8FA 2HVMA 4JY9A 1XLKA 3W1QA 3M16A 3L7RA 3THCA 4CKQA 4PYSA 3P93A 1GW9A 4MDOA 1LM1A 4GX9A 1UZ4A 2W27A 3H70A 3OBAA 2FIQA 1TQJA 4CNSA 1G67A 1J96A 1ZJIA 5GVJA 4PBGA 4I90A 1B3ZA 3BXWA 4UTLA 3CHVA 5BWAA 1XYFA 2WVUA 1H2JA 1BRLB 3PHAA 3IEBA 4YU1A 1YXDA 2VFFA 2V5JA 2ZUVA 5DT7A 3WDRA 3PWIA 1BTCA 1EC7A 1JUBA 2GJNA 3R43A 3K46A 3QVQA 3PZMA 3MYPA 2QDGA 4BEUA 3PZOA 4LF1A 1X39A 5TF0A 4LC8A 1WO2A 4P8XA 3QRHA 5E9AA 1OIMA 4I7VA 3W7KA 1IGSA 3VDGA 1JDFA 2W66A 3LB0A 5LIWX 3LM3A 3P62A 3QY6A 1YLVA 2WVVB 2YCJA 2VFGA 2VGFA 3S83A 3MV01 3VIHA 2G3JA 2F2KA 3EX4A 1YNPA 3WNOA 3VNYA 4F79A 4PODA 3SCSA 2F84A 2WBKA 1GVFA 3NWRA 1TZZA 2PTXA 1EWDA 4KKXA 4QXIA 4LCSA 3V5OA 2GYIA 4TV5A 4GG9A 1PZ0A 4C6IA 2ISWA 3AXHA 3ONBA 3K8KA 3KBJA 4FI4A 1W9UA 3EMCA 1KXTA 4RR4A 4YTTA 4I3GA 1KRAC 3GVVA 3PZVA 2QZRA 3W00A 2R24A 8A3HA 2Z1XA 2D0HA 3R8HA 2CWXA 1VF8A 3HM7A 1QI4A 4DWDA 1HNYA 3H4XA 2Q8XA 3EEGA 5JIWA 3GS6A 3MTWA 3WBWA 6ENLA 5E0CA 2VEFA 5JIPA 3TTOA 1WKDA 3VGBA 2E8YA 2BY1A 1ITQA 2Y7GA 3OVPA 5LNSA 1UUMA 1NVMA 1C3FA 3VNLA 4JTUA 4HNVA 4PL1A 5DCDA 4AW7A 1EIXA 4K8EA 3GAKA 1X1OA 3TLLA 3V16A 5J5DA 4CCZA 4ZQPA 5EYWA 3MKCA 4Y96A 1D3GA 3ERPA 1JL8A 3OP2A 3LPPA 3ITVA 4B3LA 1Y5VA 2NSOA 1OG6A 3FOKA 3AROA 2IXUA 1JVNA 4ML4A 2XM1A 3SUVA 3WQGA 2GQ9A 1MRQA 1ZSXA 1QHOA 2X0HA 2IPWA 5CPTA 4AAJA 1UIPA 2D3LA 3M47A 2XJ7A 5AVHA 3BJSA 2YR1A 3UVIA 2D2HA 2GK1B 3IPWA 4DYJA 3UWVA 2YL8A 3LV6A 6REQB 1MW1A 1LBMA 2FPYA 3QXBA 1V7AA 3LOTA 1WKFA 2NSXA 2WJDA 1A4MA 2F61A 4BZYA 4Q8UA 2E5BA 1ZENA 2QCNA 1JG9A 2Y7EA 2I9UA 1S1PA 2JEQA 1AVAA 1V0LA 3PAOA 1VYSX 3N3TA 4LV9A 3I6TA 3SCVA 3AZSA 2W91A 3TROA 2HBXA 1GOIA 2CEQA 3L2MA 3OGSA 4RK8A 4ZB5A 1ML1A 2NQ5A 4R7WA 2W61A 3EMQA 3STGA 4OQVA 4FK9A 1PEZA 1TZ9A 2D24A 4XTDA 5F4SA 5FL0A 1XP3A 4L64A 4V1YA 5C2GA 3WG6A 1BWKA 1EJ7L 2VEIA 1M3UA 4Z2JA 1Q45A 3MWCA 4R88A 5HWMA 3SCQA 2GJLA 1X6NA 4NZFA 3MDWA 4HMEA 3PBVA 2GUUA 2Y63A 3R1ZA 4OHQA 2EPHA 2ZUMA 5AB3A 1EEXA 1OFBA 2GWGA 3AU2A 2A7RA 3M0KA 3CV7A 3SIZA 3IJQA 5CPOA 1GZJA 4QRNA 1OYAA 2A3CA 3UG4A 2WKGA 3L66A 3EA2A 3KVMA 5MKGB 4B5XA 4JCLA 5I03A 1F9CA 4DNMA 3PUDA 1R85A 3QFEA 3JUGA 3LCLA 2DDXA 3QR0A 1VRXA 3BG9A 4IGMA 5BOFA 5C71A 1NH6A 3W85A 4ZOAA 3F4VA 3EEZA 2QVNA 1FDJA 1KTNA 3FJNA 4B5WA 1RLCL 4HT3A 1BLIA 4C6BA 1WV2A 1PTDA 1KBJA 1W2VA 2XINA 4OJYA 4PUKA 2J24A 5ECVA 2HE5A 1G4EA 2WWCA 5K9DA 7ENLA 5BXSA 1GQIA 3I3EA 3Q45A 3UA4A 4KIRA 1L6FA 1HL2A 5IM51 1XDMA 2QKFA 1BFNA 2I9EA 3GO2A 4O53A 3N4AA 2GDUA 2J88A 4F0KA 4MHBA 3PSWA 3DUGA 1G01A 1XQKA 5I00A 4GE8A 3ID7A 1XPGA 2VQUA 1IEQA 3GDTA 2DT0A 2BVDA 4JL1A 3VE7A 1UBPC 5D03A 1JYXA 4L4PA 3CBWA 3O05A 4NAEB 2A3AA 3WLTA 1JNDA 5DCBA 3F03K 2H90A 4AVNA 2TRSA 1EUAA 2GOUA 3C0SA 3UETA 4S23A 2D23A 4JTQA 5HJXA 4PUEA 1U33A 1JEZA 3NTYA 3W76A 4H19A 1VHNA 1RHCA 4K1GA 1QNSA 4DWSA 1J0JA 3H2EA 5E0KA 1ZBWA 3VVGA 1IV8A 1TIWA 4Z2KA 4M51A 2Q09A 2DP3A 3KLKA 5I3FA 2PS2A 5CPNA 1DTUA 1J0ZA 1YTKA 2UBPC 2XM2A 3MJYA 4AHPA 4Z1DA 4H7ZA 1XYBA 3O16A 3C6CA 4QLLA 2H3DA 1JI1A 3QMRA 1V6VA 5I0DA 2IS7A 1XGZA 1BVZA 3W7NA 4TX6A 1B30A 1H1YA 2ZWZA 3KRUA 3EPMA 4A3QA 1ONEA 2PUZA 4QGCA 4A21A 1PDYA 1YX1A 1K4GA 3CZ8A 3MVTA 2E09A 4RL3A 1FRBA 4FNQA 2XIJA 4NQ1A 5CAHA 1JZ3A 4URIA 1KCZA 4E2BA 1RCQA 1JCMP 3NQ8A 4M81A 2BSLA 3FN9A 5FAJA 4U3AA 3VO0A 5I07A 1MWOA 4M56A 4MNLA 2C15A 3N9RA 5C54A 1IIHA 4R27A 3TQ0A 5D30A 3UG8A 4XZBA 1H49A 4DO5A 4J5NA 1T7LA 2VURA 1FY6A 5JH2A 5HINA 3VD7A 4RW5A 4HPXA 4Q4QA 2EKGA 3W7IA 3FK4A 2WANA 2HZGA 4POCA 4WHBA 5LA0A 1TJ2A 4DBWA 1US3A 2MUCA 1P1MA 3ARWA 4PTDA 4XK2A 3L4XA 4AVFA 3NO3A 1V3IA 5C2CA 1NU5A 1XINA 1XH0A 1SO5A 4U3CA 1MVYA 3CUJA 3FVDA 3EWXA 1OGGA 1RQBA 3DFOA 3QZ6A 2YYUA 3NGFA 1PHQA 4AFYA 1EC9A 1Q3NA 4MB5A 2ZX9A 3H53A 1V0NA 2P0OA 3F5JA 3PY2A 2EEXA 5M03A 5B7ZA 1Z7AA 3EX3A 1DXIA 3CB8A 3W82A 5AC8A 3GHRA 1SUXA 3M41A 3GE7A 2FHFA 2DV0A 4B91A 1YTEA 1U5JA 1Q6RA 2WAGA 3TTYA 4FALA 1TWIA 4C1KA 1IIGA 2ADAA 4I9AA 3H6OA 4LT9A 1DE5A 3VMNA 4AG0A 5DQPA 4PN2A 2ZCGA 2WVVA 2VTFA 2GDQA 3NR0A 1MSSA 3ZFHA 3D47A 3W74A 2DPEA 1G69A 4O1BA 3L23A 2ZA1A 4IX0A 2DZTA 1V3LA 4MWAE 1VFTA 1UR1A 2YB4A 2NZLA 4REQA 4E8DA 5ABTA 4XZMX 3SEPA 3GIQA 1W0MA 3IUHA 4H6KA 4CD7A 1RA0A 1SSGA 4HA4A 1EKOA 1W3LA 4Z2GA 5DELA 2VWSA 4INFA 2TAAA 2VDHA 2P3ZA 1MXSA 3VUPA 2VR2A 5B7YA 3A9IA 4G9PA 1F74A 4KETA 2ON3A 4JPGA 2CKSA 6TAAA 4I7UA 2XSXA 2ZC8A 1K9TA 2X09A 1E5NA 3DX5A 2XYLA 3NL3A 4XO6A 5KITA 2A79A 4MZ1A 3OBKA 1FA2A 2BXZA 3KL0A 4KRUA 2IUZA 3NCOA 1C9DA 3WFAA 1QCWA 3K4WA 4W5UA 1TMLA 3II1A 3VIPA 4IF2A 3CHFA 4G7EA 1HXJA 1N2VA 4QE1A 3A13A 3EOUA 3GBEA 5HDRA 2CHNA 4U2YA 5EMKA 1MEHA 2Z26A 1ZAJA