1V79A

Crystal structures of adenosine deaminase complexed with potent inhibitors
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine deaminase
publication title Structure-based design and synthesis of non-nucleoside, potent, and orally bioavailable adenosine deaminase inhibitors
pubmed doi rcsb
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1v79A00
1YBQA 2PGFA 1RK6A 3B0XA 3IJ6A 1I0DA 4G7EA 4HK7A 4J2MA 4BJHA 4H9ZA 4C6CA 2VR2A 1O5RA 1ZZMA 2PLMA 4R85A 1POKA 4I6VA 4HJWA 4QTGA 2GOKA 3O0FA 2YB1A 1A5KC 3LGGA 4XD4A 3LS9A 4C6OA 1FWDC 4GY1A 3MVIA 4J35A 4OFCA 2PAJA 1M68A 3IV8A 3CS2A 5AKQA 4B91A 4B90A 4GZ7A 4C6EA 4C5ZA 3ORWA 3A3XA 4LAKA 4F0SA 1ADDA 2WM1A 3FDGA 4GC3A 1V4YA 5HMEA 1YBQB 2Z2BA 4XD6A 4DO7A 3UPMA 2AQVA 4RDVA 5HMFA 3GIPA 4YIWA 4CQCA 2YZ5A 1E9YB 1V77A 3IRSA 4ICMA 3LA4A 1UMLA 3HPAA 1EJWC 1I0BA 3DC8A 3T81A 3E3HA 4RDZA 2W9MA 3NQBA 3FDKA 3E38A 2A3LA 1GKPA 4C6BA 3S2LA 1KRAC 3A3WA 1EJRC 2R1PA 2XIOA 4GY7A 3GG7A 3EGJA 2GZXA 2RAGA 2WJFA 4UB9A 4D8LA 1PTAA 3S2NA 3TN4A 3E2VA 4IFKA 4DZIA 1XRTA 5LXXA 4LALA 4ZSTA 3PANA 4ZSUA 2CZVA 5FSDC 4HA0A 4DI9A 4NP7A 4WVXA 3GTFA 2OODA 4QROA 4XAFA 3K4WA 3MVTA 4MUPA 3ITCA 4QS6A 1FWBC 4LCQA 3NURA 4C6QA 3LGDA 4XD5A 3C86A 2UBPC 4H01A 3NEHA 2PUZA 4PE8A 4C6MA 2IMRA 3WYZA 4B3ZA 3N2CA 4EPBC 2DVXA 3MKVA 1FWEC 3T1GA 2FVMA 1M65A 4KESA 1PSCA 4LFYA 1EJSC 3AU2A 4UBPC 3RHGA 2ICSA 4F0RA 1V7AA 1J6PA 2FTYA 2Z28A 1A5MC 2Z25A 4PCNA 2R1MA 4KEVA 1NDVA 1NDWA 2I5GA 1YIXA 5CH9A 4P5UA 3GTXA 4C6PA 1YMYA 3PAOA 1M7JA 1UIPA 2UZ9A 4H9TA 2QS8A 2O4QA 3MDUA 4ERIA 4C65A 4GY0A 1RJRA 3SO7A 4IFOA 1J6OA 3F4CA 4GX9A 1A5LC 4H9XA 5A6TC 3UF9A 4XAZA 3TN3A 4ERGA 4L6DA 1P6CA 4EPEC 4LANA 4ERAA 1K70A 3QY8A 4KERA 2OOFA 2GWNA 4QS5A 4DI8A 4KEUA 2YB4A 3IGHX 2P50A 4KEZA 1XRFA 4H9MA 1K6WA 3JZEA 2D2JA 1V51A 2BB0A 4CQDA 3OQEA 4V1XA 4G7EB 1ONWA 4EP8C 4IGMA 4PCPA 2FTWA 3F2BA 2VC7A 4C5YA 3BE7A 1RK5A 4I6KA 2HPMA 4QSFA 4IH3A 3PNUA 4EPDC 4INFA 4WGXA 4RDYA 4GX8A 4DZHA 3PNZA 3TN5A 3S2MA 4H00A 1FWFC 1EJXC 4LCSA 3GU1A 2YXOA 1NFGA 2ANUA 2F6KA 3CAKA 3RN6A 4AQLA 3MTWA 2WJDA 3QGKC 1NDZA 1EJTC 2VUNA 3GUWA 3GU9A 1PO9A 3K5XA 2DVUA 4IFRA 1FWGC 4WHBA 4NI8A 1FWCC 4PBFA 2I9UA 4Z42C 3F2CA 3QY6A 4E3TA 1BF6A 5HMDA 3MDWA 1A5NC 4GK8A 3UBPC 4CEUC 3MJMA 3E0FA 3URNA 1IE7C 3GIQA 2HNHA 4XD3A 2Z7GA 1FWHC 3LSBA 3OVGA 1DPMA 1FWIC 1K1DA 4GOAA 4C6LA 3RYSA 1FKWA 1W1IE 3ISIX 1A4LA 2HQAA 4H9VA 3ID7A 1PB0A 3B0YA 3URQA 1KRCC 4XAGA 3B40A 3G77A 2E25A 2QPXA 3O7UA 1RAKA 1XWYA 3AUOA 4GYFA 4M51A 2HBVA 4KETA 4DLFA 4C6JA 2D2HA 4IFKB 3FEQA 2GSEA 1FWJC 1KCXA 2HPIA 3F2DA 4LEFA 4LCRA 1E9ZB 1GKQA 2O4MA 2P53A 4J5NA 3LNPA 1A4MA 2R1KA 3QY7A 1GKRA 1UIOA 2Z26A 1V79A 3OJGA 2EG6A 4C6FA 4QRNA 1O12A 2DVTA 2FFIA 4CQBA 4HK5A 2EG7A 3R0DA 1YNYA 2Z4GA 3E74A 4KQNA 4CNTA 3GTHA 3K2GA 2Z27A 4LAMA 1R9ZA 4C6IA 3URBA 1RJPA 2Z29A 4RE0A 2R1NA 1J5SA 3HM7A 2Q09A 4C6DA 4IGNA 4TQTA 3D6NA 1XGEA 1EF2A 4B92A 3GRIA 4V1YA 2EG8A 3OODA 1S3TC 1KRBC 3SFWA 2G3FA 5G4HC 4L9XA 3RCMA 1FWAC 4F0LA 3S4TA 3DUGA 2OB3A 3F4DA 4HK6A 3UR2A 2QT3A 1UBPC 2Z2AA 3LY0A 3KM8A 1EJUC 1NDYA 1WXYA 2Y1HA 4DNMA 1ONXA 3AU6A 4C6NA 1JGMA 3IARA 3IPWA 2AQOA 1FKXA 1POJA 4BY3A 4C60A 3GU2A 1R9XA 4DLMA 2VM8A 3EWDA 4IG2A 4LAOA 3LU2A 2BGNE 4G2DA 4GXWA 3MSRA 3ICJA 1A5OC 4H9YA 1ITUA 5FSEC 1RJQA 2PGRA 3WZ0E 3S2JA 4KIRA 1VFLA 1QW7A 1EYWA 1QXLA 3HTWA 2Q01A 2VC5A 4GBDA 2QVNA 4R7WA 1EJVC 2Z00A 4RDWA 3WMLA 4C6KA 1KRMA 4CNUA 4PBEA 4BKNA 2Z24A 1P1MA 2KAUC 2D2GA 3TNBA 4IQJA 1R9YA 3A4JA 4R88A 3QGAC 2WJEA 3TN6A 2FVKA 1J79A 1P6BA 3UR5A 3DCPA 3URAA 3LSCA 4IG2B 2R1LA 4IF2A 1YRRA 1HZYA 3PBMA 3MPGA 4CEXC 1WXZA 3GTIA 4DYKA 2VHLA 4RZBA 4DIAA 4LH8A 2ADAA 2GWGA 4H9UA 3OOQA 3T8LA 2OGJA 3EWCA 3CJPA 4EPKA 1RA0A 2HBXA 1ITQA 3IACA 1RA5A 4AC7C 4CNSA 4KF1A 4NG3A 3E0LA 2OQLA 4JOMA 5E5CA 1EZ2A 3OU8A 4XAYA 3V7PA 2AMXA 2E1WA 2ZC1A
chains in the Genus database with same CATH superfamily
3OG3A 2GL5A 2QDEA 3VMOA 4E8DA 1IHIA 2DIEA 3SQLA 3QMSA 1F5ZA 5I3KA 1YTDA 4LVDA 1P6WA 2FZNA 1O5RA 4RPQA 4I6VA 4GUFA 4HJWA 1A5KC 3KFTA 3W37A 1BQGA 4N2YA 4UZSA 1M1BA 2AGTA 3H7UA 1SFLA 1FWDC 4GY1A 3W71A 5JH1A 4XBSA 2BDQA 1M01A 4GJJA 3ZWSA 3MI2A 3ORWA 2NV1A 2OWCA 4AG0A 3HG2A 3BJFA 5M3WA 2AQVA 1UG6A 1TV5A 2UY5A 1XBZA 4YIWA 5HMFA 4MZ8A 2Y8KA 2YZ5A 2HISA 1P0BA 3BLOA 1H5VA 1KM6A 4BF7A 3DFNA 3UZZA 3E3HA 1ZBKA 4JPGA 3D0CA 3E0IA 3SCNA 4CD8A 1GVFA 4Z2KA 3S5YA 1B4KA 5KETA 3W7HA 4C6BA 1HJUA 4F4RA 4RX0A 3BC9A 4PB3A 3NFUA 3B4YA 2XISA 4S3DA 3S8HA 5MKGB 3WF4A 4IFKA 3MO4A 5G1TA 2OYLA 4POCA 2XN2A 2PC8A 3SDOA 1EO7A 2PWEA 1UKOA 2UWFA 1VCVA 2ZX5A 3DHDA 4GKTA 4C6QA 1A80A 1B3YA 2RKXA 3LERA 1BHGA 1V6UA 3N29A 3T1GA 1OC7A 3G1DA 3WJXA 1W1ZA 4PODA 3TZFA 4ZO6A 1KTNA 3ZR4A 2ICSA 2J7DA 2FFCA 5CC5A 1M7PA 4GUIA 2AL2A 2YBTA 4KEVA 1NDVA 2WV8A 4BR1A 5KZMA 2PC4A 3WFZA 7CGTA 4C6PA 2E77A 2PDFA 1H0IA 4AHOA 4OE7A 2HMCA 1UH3A 4IFOA 3ARXA 3QFEA 1A5LC 3N4AA 4GJIA 1E0XA 3UP8A 5AYXA 2TYSA 3B0PA 3WBYA 3L0NA 2DP3A 3LQGA 3D5HA 3WLLA 4HA1A 3KDOA 4CU6A 1JEZA 3CGTA 3FJ6A 4DI8A 4HZ6A 4Z2GA 4QEEA 2PTDA 1DWJM 1XRFA 4H9MA 4CN6A 5I02A 4Z1YA 2QCLA 1ONWA 2YOCA 1ZQ5A 4QDWA 1TPDA 3BE7A 4UNKA 4B5VA 3AZTA 4NAFB 4N6EA 4RDYA 3S2MA 1ZCOA 4L4MA 3O8AA 3MUAA 4MHBA 1X97A 1GVRA 1NFGA 4LQ1A 3AHYA 3WQFA 1C8XA 3GVGA 1RHCA 4D2JA 1Z3NA 3BURA 1SSGA 3GW3A 2QF7A 4OV9A 2I9UA 3M64A 1H1YA 2XN1A 3GFYA 5FJOA 3TK7A 5G2IA 5CGMA 3B8VA 4ZQPA 4YPJA 3EX1A 5DMLA 5DY3A 3HG3A 3ID7A 3VD5A 4XAGA 1OFPA 1UW9A 2DSZA 1XWYA 3P5YA 3VD7A 3L4YA 3S47A 2G3NA 2X40A 4X60A 3WQWA 4K1WA 3P8JA 3DG3A 1N8IA 2C1HA 4Q8OA 4YYFA 2V69A 1G0CA 4RNIA 3MUCA 3NSNA 1V0MA 2DZXA 4R53A 4FLSA 3W1RA 5U7SA 2XIIA 1T0OA 3NWRA 3GK0A 5LXEA 1YPXA 3IJIA 4Q4MA 5FF7A 2OJPA 5XINA 4Z1CA 1MYRA 1NTHA 4IM4A 1EJ7L 3VDAA 4CNTA 3K2GA 1XM3A 2BTMA 2V81A 3CZGA 4MY9A 1XDLA 3TSDA 1KD0A 4ZMGA 1E5NA 1PDYA 1VFUA 4K36A 5F4XA 3NZQA 3TFCA 4NX0A 4K37A 3VOFA 6PTDA 9XIAA 3H2EA 3PG8A 2BVYA 1EBHA 1D7FA 3KRZA 3GDTA 3QV7A 3ZLHA 1I45A 4AWTA 3RCMA 1REQA 3UWVA 4GCXA 5IHSA 3BOLA 3KZPA 3S4TA 2KX9A 1CCWB 4AEFA 2A85A 5CZJA 3VD9A 2QAFA 2QT3A 2PBOA 1S1PA 3IK2A 1EDTA 3U48A 3M44A 2BZNA 4YWIA 3LRMA 1AG1O 1UWTA 4NYYA 2A3AA 5I78A 1JAEA 5FESA 2AQOA 3SB0A 6CGTA 4CQAA 2J9ZA 3MP3A 4FOUA 4NUWA 4IG2A 4OT7A 1EPVA 1TTQA 1PKLA 1EOMA 2ZFAA 1A5OC 3UCQA 1H7RA 2GLKA 4DAIA 3IVUA 3EZ4A 4I5XA 4C6KA 3VM5A 4AWUA 1V6VA 4J2PA 1Z89A 3VINA 4DWSA 4O1AA 1EUNA 5F2MA 3QPZA 3QGAC 1KFCA 3H4WA 1RY8A 3I6RA 3QC3A 1OYBA 1NARA 4MKNA 2Y2WA 8XIAA 2A0NA 2VGGA 1AFSA 3M6DA 3NZGA 2DJXA 1HZYA 1TUFA 2CU0A 4FSAA 3EBVA 2GWGA 4MZYA 3T8LA 2OGJA 3EWCA 4K3ZA 2VGFA 4PMRA 5D32A 1UD8A 4R3UA 4L6HA 1Q2RA 2HS8A 2VEKA 1N8WA 2FJUB 3UPBA 4XB3A 4HZ8A 3AYVA 1ZSXA 3HPXA 3OEXA 3CUJA 1DQWA 1OFRA 3PZ9A 1R3VA 2VMFA 3N34A 4ATLA 3KHJA 2QR6A 3T7VA 3AYRA 1FHUA 4RKAA 1VBRA 1KBKA 4HIBA 2D0GA 4HNTA 1KR1A 3NQEA 4RUBA 1DEDA 3CNYA 4PMOA 1TE6A 2GGEA 2QCFA 5AC4A 1RSCA 5HWNA 1YE4A 1ICSA 2GGGA 1CLKA 4W9TA 3VGBA 3W7CA 1R46A 5K9DA 1V0LA 3ABSA 3ARTA 3LBMA 3TYZA 5H8PA 4J35A 3RLHA 1IZKA 1E6RA 5CSYA 3EMCA 5AHFA 3P7YA 2ESCA 4GZ7A 2PB1A 1UWUA 3GBDA 4DO6A 5E09A 1V4YA 3DECA 4U2YA 4QR6A 1OIFA 3O16A 1RPXA 1OHLA 2VJXA 4GQBA 2ZZ5A 4FF7A 4GD0A 3WJWA 3GLCA 3KCLA 3U5YA 3M5XA 4K2SA 3GNNA 1H1ZA 4J1OA 1XPYA 1IT8A 2Q6ZA 4M1RA 3AAMA 4O0KA 3C2VA 2DT2A 1QVBA 1V6XA 1EX5A 4PFMA 4GC4A 3ARWA 4CD4A 4IQLA 2FZ8A 4N4QA 2YA0A 3PULA 3PBYA 2YX0A 1WUFA 2J74A 2X0SA 1XBYA 1BKSA 3TYDA 1TQJA 3W82A 4ZENA 4GVFA 3F5KA 2NQZA 4L61A 1QPOA 3B9NA 4DUXA 1KLZA 2H6RA 3QYQA 3L4XA 2QEZA 4WUIA 4TTUA 1NFBA 1XIDA 3R58A 1EA9C 1D8CA 2JGQA 2W27A 2G97A 5A8QA 3A9IA 5H91A 4L4OA 2OQYA 1HO4A 1XISA 3C0JA 3L4TA 3EOUA 1HKKA 3HO8A 5AC6A 2X8RA 4LB3A 1VLIA 2V5BA 3AJ7A 5LNRA 3WK2A 1FQ0A 1OVDA 2E5CA 3EA1A 1I75A 1OYCA 3N6JA 1CECA 3OIXA 3WDHA 3ES8A 3VE7A 2G8ZA 4ERIA 2NV2A 5E9AA 1VEOA 2XH7A 4H9XA 1W1B1 3WNKA 4LJ3A 1AK5A 1V0KA 2WMFA 1C92A 2AL2B 1GW9A 4JN8A 4XUGA 2A1YA 1DHKA 2J13A 3LHTA 2CIPA 3P60A 2R6OA 3S1UA 4V1XA 1UWRA 3AROA 3I3DA 2GYIA 3LRKA 3F2BA 5IDIA 1KGXA 4I6KA 1F07A 4QSFA 5C2XA 1RBLA 4GISA 3B9DA 4INFA 1V08A 4LGXA 2CZFA 1FWFC 3GU1A 2DSVA 3N25A 3H7RA 4DJEA 4JX4A 4Q8TA 2FDMA 1W5QA 3UQNA 4DBUA 1TFVA 1FWCC 1QPQA 4PBFA 5DMNA 4JGDA 1EPXA 4PUUA 1S5WA 3W7NA 1QNOA 1TQXA 2Y5EA 5E0CA 3KDNA 3WQ5A 5CKSA 5FEPA 1G7UA 2DW6A 3AXKA 1BKHA 1DPMA 1K1DA 5A2BA 1GONA 2OT0A 3W7OA 5A6SA 5C7HA 1G4TA 2JBMA 3TE9A 1NVMA 3W22A 3THDA 4R7JA 5BRQA 2I14A 4LOCA 2HBVA 3BICA 1V6WA 4UTIA 4IUGA 3VDHA 2TMDA 1JPKA 1TV3A 3PTMA 2CHNA 2E4TA 2QUTA 3AMKA 2AGKA 3BL3A 4B5NA 2EG6A 4JX6A 2CYGA 3WF2A 4F40A 3WSUA 4EOUA 3IK4A 5HBFA 3E74A 1P7TA 3GR4A 3I6EA 2C19A 3KVKA 1W9PA 4IUOA 4JN7A 4B5SA 3L12A 2EPOA 1JUEA 4Q4PA 2WZHA 2X41A 2ZXAA 3LM3A 2YLAA 4EK7A 4Q6JA 1LF1A 3NXFA 3EWWA 3M0KA 2ALRA 3PY2A 4MY8A 3SFWA 2RHGA 1DJGA 1TELA 4Y8EA 1OX4A 1PX3A 1XIBA 3C8FA 2AQWA 1I2NA 3QFWA 1FFQA 1TCMA 3FS2A 2ZA2A 2RGLA 3MUIA 4V33A 4MVAA 1EX1A 1MDLA 3WK3A 3IARA 3LDVA 4V28A 3AS1A 3E2SA 3NYDA 3UU0A 3NQDA 4RXFA 2VRJA 5EMKA 1POJA 1MW0A 2PDMA 3N15A 3OA5A 4TVUA 2ZRUA 4WDTA 2Y70A 2BY1A 1ITUA 2BLEA 1REQB 2XH4A 4O18A 3C6CA 1HJXA 3NO1A 2QGYA 4HU4A 5FJPA 3G1VA 4BKNA 1CXIA 1CZ1A 3PPCA 4KW2A 3N2BA 1F2JA 3MMDA 4R88A 4IISA 5G4WA 1JCTA 4CVUA 3TQVA 3W27A 3WH7A 4IG2B 4PMUA 3GSMA 2G3IA 1YRRA 1AA1B 6REQA 3PC0A 1WXZA 4LH8A 4F2BA 3TWAA 4GGBA 3BK0A 2QHAA 1V8EA 3IGXA 2ZUSA 3QW4B 3LCWA 3B4UA 4DBDA 4MYXA 1IXPA 1W56A 3RMJA 4O1BA 2NLYA 4XTDA 5G5IA 3UA4A 2ATMA 3OU8A 1KWGA 4R34A 5FJRA 4TUFA 3UXLA 3IJ9A 4MF4A 3WF1A 3CU2A 4GNJA 1H7WA 1S2VA 1NIUA 1H7PA 1GYMA 1O95A 1QI3A 3DGBA 1BSIA 5A8GA 4QTGA 3OO2A 4HMNA 1S46A 3W7EA 4FOKA 4KIEA 1XLHA 1ICPA 3DXIA 4R9XA 3O07A 4LBUA 5LKYA 3MMTA 3NQCA 1JUBA 1P4CA 4XD6A 1UC5A 5I79A 4HHLA 4UTKA 3VGEA 3H7VA 3GG1A 3VE9A 2XZ7A 3I4KA 2J7FA 1FCBA 4MJ2A 4WSJA 5FACA 2FPTA 3LCLA 3RO8A 2WJZA 1J2BA 4AWEA 4GQGA 4RW3A 1WKYA 1XD1A 1XDJA 1P48A 4LYPA 4GYPC 3TN4A 4HSHA 2GDQA 3LI1A 2CZVA 3V0SA 4A8NA 4C91A 3NAVA 3RLVA 1V3LA 3CL8A 2PU0A 4CNPA 1J18A 3ITCA 1DBTA 3RAOA 1R85A 2PDPA 2ZZ2A 3R7MA 2Z6IA 3N2CA 5CPTA 4O52A 4AXKA 2YL9A 1OD0A 5C54A 4JTRA 4S38A 1WOAA 1R3QA 3MC5A 2H3DA 3NM3A 3ZOAA 3AO0A 3DGRA 5I2UA 3NXLA 4AY7A 3NG3A 2PZNA 3JR2A 4HHMA 2XSAA 2JFEX 2ZZ3A 3U3HA 5D4YA 2XM2A 1B54A 2Z25A 2R1MA 4Q32A 2CPUA 3YPIA 3UT0A 1I1XA 3STGA 4NILA 1RVKA 4WLCA 3OW1A 1WV2A 1GZ1A 2WWCA 4P7OA 3PAOA 1M7JA 3W70A 1SZGA 1X7IA 2OLAA 2O4QA 1AD1A 2FPVA 4RNHA 3SRFA 3IRDA 2DQWA 1NP2A 3WY1A 1LT8A 2ISSA 3BLEA 4HVXA 3LNMA 4D1IA 2OELA 3QY8A 4KERA 4XTIA 4JFUA 2VFEA 4F9JA 4MAVA 2XVPA 3L0KA 1J0YA 3UWQA 4JICA 1QI4A 3A12A 4EIVA 1H1NA 2XFRA 4N42A 4EPDC 3G2GA 3PNZA 2GGJA 1GVSA 3VU2A 4LCSA 5JVLA 1K9TA 3MTWA 1HO1A 1JL8A 1A3WA 2DVUA 4K8GA 4Z42C 4DUWA 3NYZA 4FNPA 1A5NC 4GK8A 4UTWC 1K9EA 3CQJA 4UMAA 1SMDA 1OFEA 3VABA 2P3EA 4WDXA 3ZVIA 4CD6A 4B3KA 4HMCA 1THFD 2QJJA 1NM9A 5K7JA 1MZRA 2PMQA 5C9XA 1RP8A 3B0YA 5KZEA 4JYFA 3SQSA 3K30A 4H8UA 3MO7A 2X05A 4NHVA 5A94A 5DXXA 5CPLA 4KGJA 1JPIA 2PRLA 2Y7EA 3DI1A 1O5QA 2X2GA 3F03K 4C6JA 2X1SA 4TV5A 4TVDA 4Y8FA 2VFIA 4CQ8A 3DFSA 4LCRA 3OZPA 3F5LA 4NJKA 3N1AA 3TQ0A 1S39A 4J5NA 3S9YA 3LNPA 1XIHA 3HQPA 3GFXA 3N12A 1Q6QA 1RLCL 4IIGA 2WPGA 1DJIA 1MZHA 4LB4A 2OYMA 3KOZA 3AWNA 1XLFA 2JALA 5CPOA 5XIMA 1VCGA 5CQ1A 4G6CA 2DZSA 2YXGA 4BFAA 4U5KA 4A3RA 3QRHA 4EXBA 2QZRA 1R6WA 3EDEA 1R2TA 1TVLA 2QUNA 4ZO9A 2DIKA 2C7FA 1UUMA 3WH8A 4UFLA 3NQVA 1F74A 1AQMA 3W7LA 1FVPA 3P81A 1VBUA 3CXOA 3ZO9A 5DELA 1UR1A 5G1MA 2B7QA 1U1HA 1R47A 1KCLA 3OGSA 3LPOA 1EJUC 1NDYA 1P7TB 3B8UA 2OKOA 2V5CA 3MP5A 4JKKA 2HCVA 4C6NA 2F8QA 3WK1A 2OZ3A 4ZB5A 4FHAA 1Q4WA 3V36A 3QXBA 5I07A 3EX6A 5AOUA 4M6PA 1TWIA 1YQ2A 2OSXA 2VZTA 3BGGA 3ITYA 1QW8A 1H2JA 1OX4B 3LOTA 2NX1A 2VC5A 9CGTA 2P8BA 1EJVC 4IIDA 1VEMA 4D6DA 3OBAA 4KCUA 4L80A 1KLYA 3XINA 3ZT7A 2V3FA 4XG1A 2D2GA 1JAKA 2R9RA 2PLJA 4EWJA 3WLJA 2GFTA 1UZHA 1KV8A 1TPFA 3SJNA 1ZAHA 2EPLX 1OY0A 1JYWA 3OZOA 4P61A 5DBUA 1W6TA 1SSDA 1G9HA 1EUAA 5E0KA 3OOQA 3HGJA 4EPKA 2YW4A 3EEZA 5DT5A 2MUCA 4P7NA 2JF6A 1CPUA 4A22A 1SMAA 3M5YA 1T41A 1XH0A 5AHMA 3CAWA 4IL0A 4BEUA 1J10A 1HW6A 3AISA 3K4DA 2ZC1A 2C91A 3ZR6A 5HA7A 2UY4A 1OX6A 2QMJA 3B0XA 1ZY9A 3BMVA 4I8YA 3CO4A 4BJHA 5EPDA 1JGIA 1WZKA 3GG0A 3FA5A 2QUMA 3FYPA 2WZMA 1XYZA 2VGIA 2A79A 5ECUA 4YTRA 4C1KA 3TW9A 2BV9A 4LS1A 3MW7A 4LNCA 5BWAA 2YLLA 4OFCA 1E55A 1DIKA 3PTQA 1E4IA 4DJFA 1M68A 3FAWA 1O5XA 2QJGA 2BBFA 3B9OA 1JF5A 1KM0A 4DO7A 4ORMA 1S5VA 3STPA 4OWGA 4JAWA 1YDYA 4FLQA 3S9ZA 3MBFA 2A7NA 3A6OA 4H3DA 4GABA 3GYCA 4MB3A 3W07A 2ZRYA 4XO7A 2WVSA 2C1GA 3T81A 3W1QA 1TTJA 1R86A 1O60A 3LCXA 4W4QA 3SRKA 1EJRC 3GHRA 2DDXA 3WDRA 1KBLA 4JX5A 3HPZA 3R10A 3INPA 4QJ3B 2FPYA 1KQYA 1OG6A 4DZIA 1XRVA 5EA9A 1E0VA 4ZQNA 1F6KA 3VGDA 4K6AA 3UG8A 3TA6A 1GUVA 4MDPA 3PUGA 1H61A 1QUMA 1H7NA 1HGYA 5LNVA 2PBGA 2X1UA 4IJCA 4O53A 1PZ2A 1LJYA 2NSOA 1FDJA 4ZE5A 4ILSA 1IXOA 3SRDA 2W79A 1R7AA 3SCPA 4CN1A 4R33A 2FGZA 4FB7A 3FLUA 2QIIA 3EOOA 5DXYA 5MF5A 4M29A 3PBWA 1R30A 3U2ZA 4LW7A 1JYNA 3TMQA 5A1AA 4IPIA 4MB4A 2ZKMX 4JKMA 4PUNA 3NO5A 2DT1A 3UJ2A 7ENLA 4ML9A 1YMYA 4S3EA 2VR5A 4AVFA 4PR4A 3W7IA 4ZA0A 4C65A 2PLKA 2GVGA 3AC0A 7REQA 3LHWA 2QJMA 1LZOA 3EDJA 5M1TA 1F4AA 4RNFA 4MPKA 4DHGA 4F2UA 5CSRA 2GWNA 2A4AA 5GJNA 1EC8A 2Y63A 1QK2A 5TQLA 2Y0FA 1UA3A 3SUSA 4KRUA 2PDJA 1VR6A 3W7KA 4CQDA 1MEIA 4PRRA 2I9EA 1ISXA 2J4GA 3QR0A 3PVFA 5C9UA 4L9ZA 1M3UA 1XIIA 4BF9A 3VNDA 2YXOA 4FNUA 3MHFA 3TOYA 1EP1A 4MDOA 1TMLA 2VCCA 3QGKC 3ANUA 1AW2A 4J3TA 2OFJA 3O05A 1LORA 4E3TA 1KO0A 1TR1A 3M0XA 4UOQA 1FWHC 1GVYA 4UNIA 5DT7A 1LWHA 3NQAA 1UHVA 1CXEA 1WDRA 5C2CA 5C8BB 4AMAA 4EXAA 1TE1A 1GJUA 5F1UA 3KRBA 1HJWA 3FCPA 4MLJA 1UP3A 4QM1A 3B8SA 3OPSA 4M51A 2ZUMA 3FGCA 3LPFA 4NZ1A 3T8QA 2WW5A 1LOLA 1E3XA 1Q6DA 2J6XA 3LLFA 1EXPA 3OBKA 3SCVA 4MZ1A 3BG9A 1QW9A 2INEA 2NWSA 3MYOA 4JHMA 3C2RA 2A7RA 5C0QA 1EC9A 4XZ9A 1GVOA 4FNQA 3QY7A 1HKMA 1V79A 3GNOA 4OGZA 5GJPA 1O5KA 4WCJA 3LK6A 3CT2A 3R0DA 2IKIA 1R3TA 2OO6A 4YCPA 4A3UA 8CGTA 1E73M 2CHRA 3VOHA 4YJ5A 2FKPA 1S5NA 2IQTA 1QOPA 3P84A 1SJDA 3QBUA 4WY0A 1CI1A 2QULA 5CGQA 1AH3A 3RR4A 3WDQA 3TSBA 3CB3A 1T5AA 4FIQA 2J24A 1XYFA 3L2MA 4FLOA 4W7WA 2ZADA 1E15A 4H6RA 2NVCA 4KCTA 3CPUA 3KS5A 5KZ6A 3GTNA 1QT1A 3TR9A 1HL9A 1M5WA 2Y88A 3CWOX 3R79A 3RO6A 2XIQA 4PULA 4GI8A 4JTIA 5I77A 1TG7A 2CNCA 4RE4A 5BMWA 4UR8A 3STFA 4GXPA 1XYLA 1HG3A 3HV8A 3WNMA 1YHTA 4CCCA 3WQDA 2ZWZA 3ZT6A 2X0YA 3Q67A 1W3JA 2ATSA 3BV7A 1IQ8A 3PN8A 3WBAA 4KH2A 3BSHA 3PR2A 1XIMA 4QDMA 4O8AA 1FOBA 4PSRA 4DPPA 1BTMA 1E0UA 3QTPA 2BG5A 1VC4A 4JTEA 3WCZA 4GINA 3U9IA 3VKCA 3II1A 3VIOA 4MFEA 1A53A 1P0NA 1HL2A 3W81A 1BWVA 2V2CA 4Q4OA 1EZWA 3TN6A 3Q4DA 3LYEA 5CZ0A 2WBKA 4PTWA 5BW6A 3CO8A 1FH8A 1NOUA 3B06A 4U28A 1M9HA 4IPLA 2VI0A 4JFVA 1C90A 3MPGA 2PF0A 2P10A 2VCBA 1LBMA 3C2YA 2Z1BA 3CJPA 1J8VA 3GXTA 3VOJA 1G4PA 3WLQA 1B0IA 4H8HA 2BHYA 1BXNA 4GQ0A 1CENA 3BANA 3FHAA 3M4HA 4HPHA 5HPOA 1IYXA 4KWWA 1KC7A 3JRKA 3IEBA 3EKGA 2YBUA 3BW4A 1GJPA 4AX6A 3S83A 1QK0A 5CGTA 3KEHA 3IJDA 5HATA 4HN4A 4IX2A 3C61A 3PWAA 3VIGA 3EWZA 3H24A 1OF6A 4M56A 3OA3A 4S2BA 3LENA 2OXNA 3WNNA 4ES4A 3D46A 4AX7A 3MA8A 3KBJA 2B31A 1TJRA 3V4BA 1KTCA 2H9AA 4MFDA 4XD4A 1XBXA 2WQPA 2DZUA 3SCRA 2FTPA 3BAWA 3QZ6A 2XPKA 1Q65A 4JXCA 1LBFA 2DSKA 2J7GA 1G6CA 2WSPA 4W88A 3CTTA 1X39A 3FDGA 1EHNA 2VZOA 1HKJA 2YA2A 1UBSA 1OC6A 5F4SA 1T99A 3MUY1 3CZLA 3LA4A 3RU6A 1RD6A 1FTXA 3JS3A 1RD5A 3W3OA 4RDZA 2OEMA 4KFPA 2DSUA 4LUTA 3O9NA 2B7OA 4KS0A 1TKKA 3E5PA 1H7XA 3SUVA 4CCZA 2WOQA 4B5WA 3BG5A 1OFOA 3EA2A 3TW6A 2BS9A 3ANVA 4QG9A 4E0CA 1DXEA 4TO8A 2BGQA 1UC4A 4IZGA 4ZSUA 4GHRA 3CH0A 1KXHA 2OCZA 2TRSA 3BW3A 1V0NA 1TPUA 3CUFA 4HYVA 5BCAA 1SW0A 5FJJA 4MUPA 4QS6A 1QNRA 3PZMA 2GDVA 2XFYA 2UBPC 4CGTA 1E5JA 1HJSA 4QIUA 5JH2A 2X1TA 3AXMA 3W2JA 2VCAA 3H4XA 1VFTA 1FX6A 3HG4A 1UPPA 4KWOA 2P8CA 1GCYA 3NGJA 3PPHA 5E93A 4UBPC 1XRSA 1J6PA 1LCOA 1QASA 4ICNA 3J7HA 3NPXA 4D1JA 2VEGA 3IJ8A 1QJWA 4U3AA 5FAGA 5DANA 4JQ2A 5HAOA 2VQUA 4DWSD 2QS8A 3WNLA 1OF8A 1PUDA 3RJXA 3ZLGA 1TV4A 1GVEA 4CCDA 4GX9A 3FJLA 2EPNA 1YPIA 3RPTA 2CXGA 4GNVA 4EPEC 1PPIA 2Z2UA 3WG6A 4RZ4A 2ZVRA 1E6SM 1MUCA 3MUZ1 3SRHA 4KEUA 3NTYA 1SGJA 1DWGM 1HIZA 2EAWA 1LRQA 3BG3A 2INFA 1RBOB 1TCDA 1TB3A 1JCNA 2GK1B 2RDUA 4RZ6A 2I17A 3QKZA 1PJ9A 2Q8XA 7REQB 4DZHA 3BAYA 2YPIA 3GC4A 2F6KA 1IEQA 1GJWA 2J6VA 1L6YA 3GE7A 4OZOA 4GZEA 5JIPA 1KTBA 5I3IA 1XHGA 1S2CA 4EKJA 1JRCA 1OQFA 3H55A 1QBAA 3BW2A 4CEUC 1NWSA 4PSPA 1NJJA 3STCA 2C15A 3FW6A 4O10A 3W7JA 1AJ2A 3LXAA 3M6YA 3VTRA 4HU8A 3S5OA 2XINA 1AL8A 1LYXA 1G4SA 1XGZA 1U2YA 2OWXA 1M03A 3CLMA 3M07A 4HJFA 1E6QM 4IQEA 3UWWA 1S1RA 2CLFA 2QDDA 3NZPA 5D2XA 2VURA 4U10A 2D2HA 2L5HA 3P82A 3EX4A 3ZS4A 3MKKA 4Q8NA 3G8EA 3LXCA 4H83A 3UXKA 3TAOA 1WDSA 4FNRA 5HMSA 4OOUA 1V3HA 3A4XA 3NOEA 4AD2A 3KL3A 5EYWA 3DKLA 3CQKA 3CC1A 3CTLA 3FGCB 4UUIA 1XG4A 4RV8A 1RJPA 2J47A 1BLIA 3N6HA 3QMRA 1YNPA 5GNZA 4C6DA 5JBDA 1SFTA 3VDGA 4FZIA 4MPQA 3FOKA 5AC7A 4L9XA 1QI5A 4M3PA 2E7FA 2GPTA 3TAKA 1AH4A 1T8QA 2Z0IA 1Q7QA 4ACZB 3OGRA 3WX7A 3E1F1 3GXNA 3GQYA 1T8XA 4D6EA 3CZ8A 2GSJA 2Y4SA 1KM2A 3AMGA 4JS3A 1VIWA 2FHCA 2QCMA 4QITA 4MWAB 4KWVA 1VBGA 2VP8A 4UCGA 2O55A 4YTQA 3VNYA 3EWBX 3L68A 4GIAA 1JZ5A 4DLMA 3M7SA 3WQPA 4JN6A 1NP0A 4R27A 3U6WA 3G1AA 1ML1A 4H9YA 1XLJA 3TJXA 1TV7A 4HCDA 3PSWA 1W32A 5AHNA 3OLEA 3WDJA 1EYWA 2PCQA 2QVNA 4FK9A 3TCSA 4HNLA 2QIWA 4L1GA 1E1CA 2CKRA 1FY6A 3M0HA 1X1ZA 5ECVA 3IV3A 1A5BA 3TTOA 3KWSA 3SI9A 5CPSA 3DHPA 2CZEA 3DCPA 4QNEA 2IQ0A 3PBMA 3TTEA 2CBVA 3VOCA 4CEXC 3GTIA 3VX1A 1FH7A 4S3GA 4AIEA 4IHCA 4TVCA 5IFPA 1Q13A 1ICQA 2WHLA 2V5KA 2OKTA 3CQIA 1Z41A 1F7BA 3EB3A 1C3FA 1E0WA 1ZGDA 1YYAA 3SCUA 1L6FA 3FN9A 3G1YA 3MU7A 1OFDA 2I57A 1A5UA 2YCJA 4XWUA 4KFNA 4QGCA 3AICA 4XAYA 4FEZA 2E8YA 2AMXA 2C79A 3NQFA 4MMWA 1RCQA 1Z32X 5H8MA 1JCYA 3QR1A 1XYMA 4PMQA 2VO5A 4A3QA 3MUXA 4LUIA 4G7EA 1XP3A 5KTLA 4FAMA 5G2HA 4DF1A 3VZYA 1S5TA 6A3HA 3QHMA 3D3AA 1H5YA 1KGUA 1F6PA 3S42A 4TV6A 4M7TA 1WBHA 5LNSA 4GYKA 4W5ZA 1HJVA 2GOKA 2NVDA 1GYLA 3REQB 2WYSA 3R94A 4X0VA 1YDOA 1NELA 3SM0A 4JTAA 4W7VA 5FAJA 1ZUAX 1EQPA 2EJAA 1S2UA 3UJEA 1ADDA 4GACA 4V2XA 1O6IA 3NQ8A 1Q6GA 2YDQA 4JIIX 2VFGA 3UESA 2PD5A 1FA2A 3T40A 1E9YB 2FQIA 4H41A 5T8GA 4ICMA 2WNQA 3AS0A 4KEMA 3QV9A 4CD5A 3W02A 3R25A 4NJIA 2PD9A 5IRPA 4YTTA 3BXWA 3B04A 3CHEA 1VEPA 4LC8A 4ZO8A 1LLOA 2RAGA 3V5CA 4Y9AA 2O0TA 3P67A 2BNJA 1US2A 8XIMA 1US3A 1OM0A 3TROA 3L5LA 3Q2DA 4K8EA 3BLPX 3EWXA 3U7VA 4QE5A 1LUCB 2QNEA 3EXSA 4ZXLA 3UVAA 1M41A 4GI4A 4I5RA 4YN5A 4FI4A 4QROA 3ZJ7A 3AIWA 3MB9A 3GAKA 1OEPA 1FWBC 3I7SA 2D0HA 3NURA 3RITA 1X8FA 1TJ1A 1C9WA 3DN5A 4WD0A 3R8GA 1TIWA 3TKFA 1E0TA 2EPMX 3K46A 4LYRA 3RHGA 2DU2A 4J4KA 2ZZ7A 1XLEA 4DRSA 2VC9A 4G1NA 1QI0A 1WDQA 7TIMA 5A3HA 1W8GA 5CH9A 3T78A 2WCGA 3CB8A 5A6JA 5KEZA 3HPFA 2ZA1A 4TR9A 3VNLA 3VYLA 4H9TA 2BGSA 3W83A 5ABFA 3TU9A 3UF9A 3HBLA 3EYPA 4TU1A 3CUIA 2V3EA 3N14A 2G0WA 3WLMA 2EGZA 2YL6A 2EEXA 3IGHX 5A6BA 1UUOA 2RJHA 2BB0A 4Z08A 1ZB5A 4ZEPA 2QGHA 1XBVA 1VQTA 4LAZA 5BWFA 4I5UA 1V7YA 1T40A 4HA4A 4US6A 3VIMA 1ME8A 2ALDA 5A8OA 4DX3A 1VRDA 4NNCA 1EOKA 3GKAA 5HJYA 3M9YA 1BQCA 3HB9A 2B4GA 5G1YA 1H4PA 4DWSC 2REQA 2ZXDA 1IE7C 5IDZA 2DZAA 2F9RA 4OJYA 4U2ZA 3W29A 2ZQ0A 4B4HA 1AODA 2H8ZA 2ZZ6A 5REQB 3URQA 4O1EA 1UWIA 1V3MA 2BASA 4JTTA 1XG3A 1PHWA 1J9YA 3WL1A 1W1A1 3AUOA 3UD6A 3QH2A 3VGGA 5C7VA 1UMYA 3UJSA 4S3KA 2HJPA 4O13A 1GG1A 1MRQA 4YLWA 1XLDA 3CT7A 4I7WA 5AB3A 3E2RA 3S1WA 2WNZA 3F2DA 4M24A 5E9XA 2O4MA 4H6EA 4O54A 3APYA 4AYSA 3BLDA 3BLFA 2Z1VA 2VEPA 4AD1A 1EEXA 1OJXA 4IMFA 4KMQA 4P8UA 1V02E 5CJMA 1G1YA 5D2TA 5FL1A 3CM4A 4Z1AA 4MUZA 1JUKA 3EPMA 1JNEA 3LGEA 3RGTA 1MFUA 1MUMA 2V30A 1C29A 2JQXA 3GTHA 5BROA 2OSYA 4TTGA 2HDJA 4BI7A 3FYYA 1W2VA 2R82A 4M80A 4FX7A 3ZJ6A 2ZRXA 3N19B 2NXGA 4O19A 1ITXA 5KSWA 1DIOA 4EF9A 3SCWA 3UJFA 2ZXBA 1K7FA 3IJLA 2ZRWA 5T9CE 3B8IA 2Q3OA 4LBRA 4F0LA 4H04A 2HVNA 3F4DA 4HK6A 4UTJA 2WSKA 3L7RA 1VFOA 4BQ4A 4CCEA 5TIMA 1DTNA 1KNWA 1ONXA 1LLZA 5MKGA 2QCCA 2BOGX 1ZENA 4ZVJA 3V1PA 2V2HA 3FEMA 2ZRVA 3E12A 3G1HA 3EDKA 3DFOA 3NJ3A 5EGRA 3L2IA 3NVDA 4QLJA 3BCFA 3OVQA 1RJQA 4KKXA 2PGRA 1FP9A 5CG7A 2J7EA 2FGLA 4PTVA 2Q01A 3BMXA 1YPFA 4CNUA 1JIBA 1CLXA 2W0UA 4WOQA 3M46A 3G3DA 1R9YA 4OIFA 2I5IA 1DTUA 3S3GA 4I9MA 3GUGA 3WEZA 1W2PA 3AS3A 4FNSA 3RLUA 1Q8AA 1JG9A 1GTHA 2YYUA 1TPC1 4OTKA 4NF7A 2XIJA 5HR7A 5CZKA 2IW0A 3S6TA 4QJ1A 3EWUA 3P61A 4YWSA 4GIRA 2HBXA 1XSIA 4AC7C 1E1CB 3RCNA 4QXIA 4L64A 3W1PA 4Z0SA 1NOFA 4JHZA 1W5OA 3DENA 1MO0A 4KCWA 1GEQA 2NT0A 1SQ7A 1OADA 3BZGA 1CX9A 1W9XA 3CUGA 1W1PA 2PGFA 4AZGA 3PSVA 1LOQA 1RQBA 4C6CA 2PDKA 3O06A 5HWMA 4WSHA 3E9AA 3T6CA 3PWGA 4NAFA 4NXSA 3O0FA 5M03A 2CBIA 1VLWA 3SW6A 1BAGA 5A6MA 2FDSA 1AD4A 1ALDA 4E8CA 3UWUA 1Q6EA 5ABTA 1E4NA 3USZA 2E6AA 1EGZA 2YBVA 2WK2A 3K1GA 4MJ4A 4WK9A 2BP1A 4UQBA 4FXRA 4ZOAA 4DJEC 2PWDA 3N04A 3H2MA 2WC3A 4PMDA 4RDVA 4CQCA 1BVNP 1KCZA 4ZQCA 3AXXA 3GHUA 2EXOA 3QV8A 2IS7A 3UY8A 1V02A 2PGWA 2V63A 3SN4A 1PDZA 3MKCA 1BWKA 2QVHA 1GQNA 4H4IA 3T44A 1D3GA 4D8LA 3CV1A 1Q85A 2D3NA 2V67A 3G3MA 3S2NA 3GAYA 4JTSA 1S3HA 1XUUA 1K7XA 4LALA 1B9ZA 5DMYA 4XKMA 4S3AA 1RUSA 3CHFA 1SR9A 2ZX7A 3W7GA 3GXDA 2R91A 4GGHA 4Y9NA 3BO9A 5D9OA 1DQUA 1QPNA 1ESWA 4X63A 3E6EA 1WZLA 3DKJA 1IEWA 4IL2A 3ARVA 1FP8A 2PURA 4EPBC 1YTEA 2V5LA 2EBNA 2DVXA 2W5FA 3L2LA 2FVMA 3CAVA 1SO3A 2XGBA 4OUIA 2OSWA 2J27A 4PH6A 4AW7A 1XKJA 5LGZA 4DZAA 1PZ1A 1YIXA 4P5UA 3WBWA 3L67A 4WXZA 1EIBA 3LN3A 2VZVA 4J3XA 2UZ9A 3GC2A 1B31A 2P88A 1TMQA 3SCQA 3SO7A 3MMWA 1J6OA 4H2CA 4GPNA 2RDXA 4TXEA 1DWIM 5CSUA 1P6CA 1H63A 3H21A 2HROA 3BAJA 3LBOA 3SQMA 1JYXA 4HNCA 1EWEA 3WD3A 3Q58A 2IPGA 1E6NA 2VC6A 2VC7A 2PTYA 4HTBA 1B2YA 4ATDA 1TTIA 3GH5A 1JZ7A 2ZRZA 5DCDA 2MNRA 1TO3A 3VIFA 2VWSA 3QPEA 1EJTC 4XZMX 3THAA 2X30A 1DL3A 1FRBA 4XKYB 1VB9A 1CT5A 1C9DA 3VD4A 1TUXA 3MCOA 4QNWA 3GIQA 4QJ4B 4XVEA 4JYEA 1JQXA 1AW5A 3WENA 3CHVA 3ISIX 5K9CA 1FFRA 1EGVA 1PB0A 3GW0A 4GO9A 1V03A 2ODOA 1KRCC 4DJFD 3UXIA 1RXOB 3M0YA 1EIXA 2VENA 4WX2A 4WF7A 2NW0A 1QFEA 4WKHA 1CXLA 3UZWA 1SO6A 3Q45A 4P2VA 3CL6A 3AIQA 1OINA 3CV6A 5FEWA 2REQB 2G4FA 4MM1A 4W84A 4GUGA 2GUBA 4ZFCA 1XYCA 2Z1XA 1UH2A 1Q63A 2P53A 1B3VA 4GZIA 1XD0A 5E0FA 1K4GA 4J40A 1WB0A 2Z26A 3AXIA 4QRNA 3AHTA 2YKKA 3C3UA 4RZ5A 3D47A 3SAZA 1CEOA 4X61A 1WDDA 2EPHA 2ZE3A 2Z4GA 4GA8A 3UZ5A 4DXXA 3L21A 4FX8A 2Z27A 4L5ZA 3RR1A 1GHRA 2E5DA 2YXXA 2OTDA 2R1NA 2ZOXA 1J5SA 5IBXA 4ECLA 3A4WA 3QOKA 4TQTA 4LS0A 1JJKA 1VFFA 3TTSA 1PIGA 4HNOA 3RXZA 5HQMA 4NASA 3LHUA 5HJLA 1R0MA 2V0TA 1KWKA 2BXYA 1Z69A 2A7PA 1ME9A 3FA4A 3C52A 3MCNA 4QBXA 2QF8A 3C2OA 5D33A 2OB3A 4S2CA 1QI2A 2Y5JA 3LY0A 5EMLA 3W84A 4FXFA 1YXCA 4LAUA 4PMVA 3E0WA 4JIEA 1VZWA 5E70A 3W23A 3QOMA 3IPWA 1ZCCA 1P0DA 5D2WA 1RALA 1LRTA 4G2DA 2DZPA 3MSRA 1UROA 3MANA 1AJZA 3W75A 1Y7VA 1GOWA 3TYCA 3IUIA 5CBBA 4J3SA 4KIRA 3C0LA 1QXLA 3K8KA 5JXQA 2Z1WA 4RDWA 3GM8A 5EBUA 1X96A 1ZJBA 4GYPA 5DEZA 1UOZA 4HU0A 3VIIA 3BDKA 3PBUA 2FVKA 4PYSA 4UFIA 4ZOEA 3ZJ8A 1TWSA 2GVJA 2X1RA 4DPQA 3SZ8A 1P43A 2X42A 3NQ2A 3NZ1A 2VHLA 1HN1A 4O50A 5A6KA 2DH2A 2BODX 3I3BA 3KE0A 1N82A 4MADA 2OEKA 4JCMA 4TIMA 3WDIA 1WAWA 1UR9A 4NL1A 2ABAA 3S46A 1DV7A 2VD8A 3K4AA 4OBRA 4HSNA 3T9PA 1W3TA 1Y5WA 3P0WA 3WUBA 1TPH1 1OCQA 5D38A 3V5OA 3H2OA 1VFSA 1YBQA 2DZVA 2WHJA 4P8XA 4DVOA 3VFCA 2OWWA 3ZT5A 4WJ8A 4H9ZA 1Y0EA 4GLEA 1HKVA 2ZCGA 1QPKA 2PLMA 3IJ7A 2PDHA 2ZUNA 3TOPA 4X2RA 3QW3A 3LGGA 1KXVA 3CPGA 4JHOA 4UQCA 3W1XA 2VXNA 3P74A 2O9OA 4TOQA 3NR0A 1R38A 4UFJA 4C6EA 4D6JA 2RJGA 4NZ3A 3MS8A 7XIMA 3M7WA 1OGBA 1LRNA 1WKFA 3OG2A 3UERA 2VZUA 1D9EA 5AHLA 4Q4SA 3AWOA 1I9CB 2V82A 2CITA 1CGVA 1WUEA 3IJQA 2XIOA 1U83A 4GY7A 3WUEA 2ASHA 2CERA 1GGOA 1Z44A 1W31A 1PTAA 4XQ6A 1DWFM 3MCMA 3GS6A 1JZ3A 1UKPA 2Y5SA 2WCSA 4HA0A 3PFRA 4JY9A 1I2QA 4UOZA 3PF3A 2ACQA 3KS6A 3VC5A 5I06A 3O1NA 4I90A 2W3ZA 5KMYA 5BXRA 3PG9A 1ENUA 4M82A 1K9FA 1OD8A 2NQ5A 1TVPA 1XLBA 3FKKA 4IMAA 5C5YA 2FJKA 3HMJG 1W9DM 1BG4A 2IKGA 2IKJA 5DQPA 1KR0A 4QCEA 2BVDA 1OX5A 1V93A 1TWWA 3OYZA 2P0OA 3UGRA 2NXIA 5I09A 1A5MC 4UR7A 1F61A 1GVIA 3UEQA 4CQ9A 2C71A 3PHAA 2DPEA 2VX6A 3QN3A 2R8WA 2ZX9A 1XL9A 4PMNA 3MDUA 5D30A 4Q8PA 2RUSA 2QCDB 4XAZA 3FJ4A 2ACSA 4HT3A 4LANA 4ERAA 3DIPA 4IP4A 4P7QA 1CGYA 1KKOA 1CIUA 2YB4A 1ZJAA 1DIEA 1F3TA 3QF0A 5AZ0A 1YDNA 1V51A 3NA8A 2OYKA 3UWEA 3LTSA 4S39A 3W1LA 1TRIA 4IH3A 5AVHA 3TUUA 5FF2A 2YCLA 4PFHA 5DO8A 1XYAA 1H0GA 1QR7A 2GQ8A 1L0PA 3RN6A 1BTCA 3W7RA 1EP3A 3W25A 2YR1A 4FNTA 4NI8A 1IWPA 5HMDA 2JF7A 3KOYA 2VX5A 5D8WA 1Q66A 1GWJA 1CB2A 4US5D 1XJBA 2HNHA 4K7VA 1LP6A 2YIHA 4NQ1A 4GOAA 1HKWA 1WZMA 2P76A 1MXGA 1JDDA 3DERA 3ABOA 4G5DA 3R6IA 4NZFA 3V0UA 3T09A 2X09A 1ME7A 2YDAA 4XAPA 1KGWA 2E6FA 2P3ZA 2XFFA 2C18A 2V9DA 4ZB2A 3GH4A 4DJDA 3W2LA 4DO4A 5HJXA 4GH1A 3M43A 2F7FA 3QSRA 4OECA 3RJYA 3WLRA 2PP3A 1HVQA 4L4PA 4NKCA 2WMIB 4KPLA 4L65A 4AWSA 1GKQA 2JGYA 1F4HA 1JPDX 4DY1A 3W1TA 4PUDA 4PMZA 1HL8A 5TF0A 4JY8A 3SJ3A 4NZJA 3V1HA 4OBSA 5T91A 3UG4A 1ISYA 3DOPA 5LIYX 5CPQA 3IAQA 4ZQOA 3L5AA 4E8GA 4FF5A 1QBBA 1GPWA 4XBKA 1BG9A 2Q09A 5A8NA 3S5NA 2D1ZA 3D6NA 4AMCA 1U22A 4DJFC 3BZJA 3CK5A 4J3ZA 1W3NA 4RNJA 3T4WA 3UR8A 1LTDA 3A23A 4OV4A 5A6AA 1W9UA 2QV4A 2VL4A 3QZAA 5IOBA 3C56A 3R0UA 1FWAC 2ZE0A 4QG8A 4AISA 5F2IA 2WWDA 3IIOA 4KT2A 3T0TA 5DMMA 3BMWA 3KM8A 2GGIA 4JYDA 1NAL1 5HOSA 1A0EA 1G94A 1HTIA 2CBUA 5AYYA 1KKRA 2ZZ1A 3GU2A 3EDDA 3LCGA 1ZP4A 3R11A 3H4GA 4XBJA 4O57A 1S2AA 4HYWA 3TTYA 4IPJA 1XPGA 2WPBA 1J0ZA 5H2ZA 1IR1A 8TIMA 3UWYA 3S1VA 3HTWA 4GBDA 4DEFA 4N6FA 3DC0A 4R7WA 2ONEA 1P1MA 1VFMA 3BCJA 3UXDA 4IIFA 1J01A 4W8LA 1AZ1A 5AVNA 4GI6A 4BCEA 4URIA 3N6QA 3VKJA 2DT0A 5DX7A 3N18A 3T4CA 3SCTA 1KXQA 3PUEA 3NPWA 5DF0A 2WSRA 3M1ZA 5LIWX 1H11A 5LA0A 1TV2A 4GCAA 1ITQA 1PX8A 5JUVA 4C7DA 3KRSA 2DEPA 1WYIA 3WJYA 1E6XM 1YKWA 3WLNA 2XGIA 3QC0A 3QPYA 2QPUA 4ADTA 3S1XA 3N17A 1KM1A 4PUJA 2VFHA 4P7LA 1GOOA 4J2MA 3TLLA 2VEMA 4F2TA 4UC5A 5AYZA 2QLYA 3ONCA 3EMZA 2C14A 3LEPA 3TVAA 5HANA 2WVVA 2GSHA 4MJZA 3LLDA 3BQ6A 5A2AA 4HQVA 3T2OA 1IZJA 3MVIA 4TMCA 1EHAA 3KVMA 1PL9A 1UYQA 4Z2LA 1G4EA 1F73A 5LSMA 3CUXA 3A3XA 5T9BG 3LCFA 1YBQB 4KCVA 5HULA 4L4LA 3VMNA 2IKHA 1Q4NX 3TZNA 3TLQA 3W7DA 1HGWA 3FYOA 4CU7A 3L4UA 1V77A 4UNLA 1MSSA 4Z17A 2ZX8A 2PTWA 4RPPA 4C7FA 4IJBA 2XTKA 1I60A 1F76A 2V2DA 1OSEA 2W9MA 5LNUA 1UB3A 3FDKA 6XIAA 2IXVA 1PAMA 2R24A 3TW7A 1EKOA 3WFAA 5BOOA 2F38A 2PODA 4QHRA 4I9TA 2X16A 2E09A 3HMCA 3E2VA 3T2QA 3ARUA 4XV0A 5I00A 3PJUA 1KFEA 3TH6A 4QCFA 4NP7A 3W72A 1Z9AA 3FSTA 1R3WA 3ZXWA 3WLKX 1MUWA 3WLTA 4ZB0A 1YXDA 3JW7A 2R94A 2CLIA 1XV8A 3WYZA 4E38A 2P1FA 2VX4A 2EO7A 1FWEC 4K68A 1NH6A 3DZ1A 2W63A 1S38A 1ISVA 1JD9A 1EJSC 4XIMA 3AZRA 3U8GA 3BCDA 3NGFA 4UTHA 3XIMA 2FTYA 4YXGA 1C7TA 4XZHA 2XVLA 3VFLA 1NDWA 3NVTA 1ZAIA 2I5GA 3BV4A 3SFKA 2AOSA 5HR6A 3VD3A 1A5AA 4F8XA 3W73A 4LBSA 2PWHA 3SURA 4EWND 2FYMA 3GWQA 4GY0A 5EBAA 1GEHA 1F8IA 3TC6A 2YA1A 4BI6A 1RLDA 2BFGA 5CJ5A 3TCEA 5EMYA 3W26A 3EEGA 3UNDA 4L9YA 1NEYA 1UD5A 4FOJA 3WD1A 5BOEA 1PV8A 4KEZA 2XJ7A 4L1WA 2J9XA 4U33A 1K6WA 3OQ8A 3F4VA 1JZ4A 1LQ0A 1PXGA 5ABHA 2EPKX 1D2KA 3VGFA 4YHEA 4A8IA 4WY0F 1CW2A 3QEZA 3BGJA 4D71A 4PL1A 4ACYA 4NX5A 4H00A 1I1WA 1U5HA 1IR2A 5GPRA 2GQAA 1MDRA 4QLLA 5A8MA 2SFPA 2KZHA 1IV8A 2PF8A 3UGVA 1L6GA 4HOWA 3Q94A 3HQNA 1W1TA 4PUMA 4BQ2A 3R5EA 2QUVA 4WHBA 1FCVA 4M6QA 4HNUA 3ITTA 5EFDA 1KA9F 3TJ4A 2V3GA 4N0RA 4QISA 2GVEA 4QLKA 3URNA 1RY0A 1K77A 2CLKA 2WO5A 3KZSA 3H6OA 3U2CA 1UKSA 2J78A 1EWDA 1X6LA 2DV0A 2HQAA 2HVMA 2YCLB 3F5JA 2BY0A 3VZZA 3B40A 1B30A 1OG0A 1KBBA 5EY5A 2ZDSA 3OLGA 2QDHA 3CQHA 3TONA 3AFBA 4UFKA 3AUJA 3ATYA 3UCDA 3NL6A 1LT7A 3I4EA 3CZJA 4UCFA 3ABQA 4RLIA 4NU7A 1IGSA 5I3GA 4JQ3A 1O1HA 4IGHA 4ASTA 3KRUA 4F66A 2Y7FA 1UWSA 1R7OA 4G1KA 3ARPA 2QPSA 2NUXA 4CQBA 4HK5A 4GYJA 4LVGA 4PUKA 3BVJA 3PZVA 3AOFA 1B1YA 1K8YA 2Z29A 2IXUA 4GVHA 1VRXA 4Q33A 3VNZA 4ZXOA 4J28A 1XCFA 4YTSA 4GIEA 3G8RA 4GBUA 3W4RA 9XIMA 2GJXB 1UD2A 2NUWA 1M7XA 3NM1A 1HKIA 4BI5A 1UP0A 4HMEA 4MGGA 4PMJA 5AYIA 3GH7A 4ZGYA 3SGGA 1DJXA 3TMLA 3ABZA 3L66A 4Y9OA 1K8XA 1TR9A 4Y9PA 1US0A 3AU6A 1TMHA 3H8AA 4O0QA 3CWHA 4ZL1A 3A5FA 4S3FA 2WSQA 4JTKA 3MWAA 4LAOA 3NSMA 4GXWA 2NUYA 2XVKA 4WKAA 2PTXA 4FLRA 3AMLA 4MKVA 4AH7A 5C6MA 2YFNA 2ZC8A 2ISDA 3USBA 3WMBA 2CBJA 3KBSA 3SR7A 1UP2A 1HFBA 2Z00A 5LIKX 3R43A 4PBEA 5A5WA 3W1NA 1VBHA 2KAUC 4AZCB 2QW5A 2PEVA 4I3GA 5A6BD 4W86A 1UJPA 4D6HA 3DFQA 2I1OA 1W5NA 3TX9A 5BXPA 3VPLA 2R1LA 3P2VA 1WX0A 3HGRA 4PTXA 3KP0A 1Q2SA 4M6VA 4RZBA 3A5VA 3CASA 3IIXA 1V5XA 5G4EA 1KBIA 2QYGA 1KW1A 1FH9A 5LIXX 3W9ZA 4B3LA 2CZDA 2TPSA 1RA5A 3T0BA 4KRZA 1U1JA 4DUVA 3B0VC 3ZYZA 4GIYA 4ZCWA 1GVQA 4B15A 3D3FA 4BQ3A 3ZSSA 4GE8A 2O56A 1B9BA 3BLLA 1PCWA 3M0IA 2RDTA 4QFUA 3AZSA 5HUOA 1DJYA 1I0DA 5AFDA 5M17A 3B05A 4XISA 4JR5A 1Y65A 4IMEA 1DIDA 5I03A 1T6MA 1EF3A 3RLGA 4N9BA 1XQLA 3WDPP 3KBWA 2G41A 3NL2A 4RL3A 3L0GA 2XHYA 3CUHA 2PAJA 4XZWA 1E51A 1FWWA 3TYEA 3A47A 4BWLC 4LAKA 3A13A 2FZDA 3AI0A 2HWGA 2C3ZA 4I8DA 2BXVA 3UPMA 4AVOA 4TX8A 5RUBA 2PLCA 3CL7A 1YNQA 4HA3A 3V5FA 1HP5A 4PRTA 2DH3A 1VIZA 1UR2A 1W0MA 3ITVA 1RCXB 2WVVB 1Q6RA 1KM5A 3EOSA 1CBGA 3A3WA 3B9AA 3AYSA 4Y6GA 3U4AA 5FJTA 4D6GA 1PZ3A 1E72M 1ZBCA 3CMJA 3ITGA 1ZLPA 4Q4KA 4GXMA 5LXXA 5FSDC 3MBDA 2OX1A 5H1WA 2Y61A 2DZTA 2FMOA 1FCQA 2WLZA 2VVNA 2PDYA 7ODCA 2OODA 4IWWA 4AU0A 1R2RA 3K4WA 1JYVA 2WMHA 1DQXA 3MV01 1PHQA 4S23A 1JVNA 3BLIA 5F1VA 1CNVA 4E2OA 4HOZA 5JBFA 4QEHA 4WJEA 1FWNA 1X6UA 3WO8A 1LWJA 4A8RA 2EKCA 4DB7A 1I6NA 2Y8VA 1VS1A 4W8AA 1DVJA 2I16A 3HA1A 4O1FA 3NQ7A 1BXCA 1JPMA 1LBLA 1TA3B 4DO5A 3IGSA 3GNRA 4IP7A 3WH5A 1Q8JA 4RE3A 3LI0A 3THCA 4K8HA 5LA2A 2ZICA 1XXXA 1Y5VA 4RV3A 1BRLA 4U5IA 1RP9A 1GK8A 1JCJA 3KOWA 5A95A 3IGUA 1DJNA 3PFMA 1B3OA 4Q7BA 3PBGA 2FZMA 1W3HA 5CLWA 4YYCA 1DKWA 3S6OA 2O9PA 1QNPA 3GKFA 3L5MA 3JZEA 4ZOCA 2D2JA 1J0IA 1J12A 2YW3A 3P3BA 3B97A 3G1SA 3OLIA 2CEQA 3Q37A 2VOTA 1IT7A 4IMCA 3PNUA 5D9PA 4HB7A 3DESA 1K4HA 3G18A 1C93A 1OK4A 3CZKA 2D2OA 3GUWA 3GU9A 1XICA 2G5WA 3PBVA 1O4UA 3HN3A 5C9RA 1GT8A 3EA3A 3N2OA 1P0EA 4YVVA 3TTQA 1OB0A 1OT1A 1S5MA 2YJQA 1UD6A 1HNYA 1L2QA 3WUGA 1KFJA 4MNJA 4GH3A 3BUVA 3QLDA 3RG6A 3UFYA 2QUUA 4NJGA 5HNRA 1BD0A 4UTLA 3VCRA 1W8SA 2VYOA 3CEUA 3LMYA 3IWPA 1GHSA 3FHQA 1E43A 2VX7A 1X38A 3PB0A 2F61A 3U5UA 1TPWA 2HXTA 4JQ1A 4JIHA 4AY8A 1UIOA 2Y62A 2WKLA 3ITXA 1O12A 2FFIA 4U31A 1HJQA 1YNYA 5BNKA 3S2CA 4CN4A 4JTCA 1TIMA 5CPMA 4REQB 3WF3A 4PEEA 3GNDA 5I3JA 1W1VA 3CUZA 4A8LA 4ADSA 4IIHA 2NX3A 2F6UA 1BYAA 3KVLA 1S3TC 4FO4A 2G3FA 4O12A 2BVTA 2ZUWA 3I6TA 1M04A 2E6DA 1VJIA 2ZVIA 2OLHA 2E9BA 3UR2A 3QQWA 5HQEA 1JCXA 1UZ4A 2A3EA 2V68A 3NDOA 1RCOB 3PZIA 1NFPA 3WH9A 3TYBA 3EWDA 3GDMA 3ZWTA 4UTTA 3T2PA 4JL2A 1FCUA 3RILA 2BSLA 2QCGA 1EDQA 1JDEA 4UQDA 3ARQA 1BYCA 2CESA 4PGLA 1BFNA 4XSMA 4ZODA 4DAFA 3IIPA 1EBGA 4MWAE 4PEKA 3AALA 4O0ZA 2PDUA 3DYMA 2PDWA 3DYOA 1W9VA 4OBTA 1HX0A 5CZTA 1G67A 4A05A 1P6BA 1MW1A 2CCRA 4B2DA 3NQGA 1XKYA 3RPDA 4IF2A 3G1RA 5JMUA 4JDYA 4MB1A 3S5SA 1RH9A 2CZ5A 2RFGA 2FZ9A 3I68A 2Y85A 4DIAA 1TJ2A 1XI3A 2C8NA 1JPHA 3NIYA 1U5JA 4H9UA 3GR7A 3W87A 2GVLA 4Q8VA 3VNMA 4DNHA 2OQLA 1OZMA 2WMGA 1RPKA 2C0HA 3V16A 5IHRA 3TDFA 5C9ZA 2XH2A 2FZBA 3PZQA 1NF7A 1OK6A 2CC0A 4B5TA 3M41A 4H19A 1RK6A 2NQHA 3IJ6A 3R8RA 2DSWA 5CSSA 1MNZA 4EAYA 2GK1A 4OUEA 3CLWA 2OU4A 3V3WA 4YMZA 4FA3A 5K3VA 1LL7A 3NOYA 1ZPTA 2NQJA 2YCIX 3WN6A 2QXWA 4XVDA 1YLVA 4PN2A 3FK4A 1UR8A 4B90A 4PB5A 3AIEA 4O15A 2G96A 3K1DA 3WLHA 1J93A 1JCMP 1GQLA 2WKGA 3LTYA 2D0FA 5DY2A 3AIUA 3BOXA 4CKQA 4Q8WA 1C91A 3KTSA 4QJ5B 5FI8A 1X6NA 1Q6OA 1WPCA 1I0BA 3DC8A 2DQXA 2CLOA 3KW3A 3UG5A 3W88A 1MWOA 3E38A 2NQLA 5D04C 4NNAA 3IIZA 4I7UA 1JR1A 3ZIZA 1RQHA 3TXZA 1RQEA 4DBWA 2W92A 3SEPA 2HE5A 4C1NB 4UB9A 3RX4A 2F2HA 1LM1A 1PKYA 3GVQA 3SECA 4DF2A 1K02A 2E0PA 1H49A 4IXXA 5KITA 1ZJHA 2GJRA 2QJIA 4WJXA 2JKEA 4JNMA 1OCBA 1JFHA 2ZA3A 3BQ5A 2G50A 5CC6A 1PE1A 4W7UA 2NSXA 2DUXA 3C86A 2J7HA 3NEHA 3VO0A 1DJHA 1D7KA 3HQOA 3ATZA 1DOSA 4HN8A 4KESA 3NNTA 4E4PA 4FX6M 2AKMA 1QWGA 1SYTA 4BEQA 4PC8A 3PK7A 3ENLA 4LRTA 1I4NA 3EXTA 1PTGA 3BPWA 2C0AA 2TAAA 1B3XA 3GTXA 5D9NA 3PPGA 4ACZA 1CTNA 1LWIA 1W3LA 5IXEA 4X3ZA 4J27A 2A21A 3APGA 2WC7A 2YCEA 4LV9A 4L6DA 2BMBA 3LZ3A 5HK4A 2V38A 3W1UA 4MWAA 4AEEA 3TFXA 2OOFA 1S2WA 1Q45A 4DN1A 1SFJA 2OPJA 1E9LA 1Z8AA 3W24A 1GTEA 1SJBA 3M0ZA 2V5DA 4N9EA 1YADA 3CMGA 1BEUA 1O1ZA 1RK5A 1XLKA 3KBVA 3ZSTA 4YCOA 2GQ9A 4YHGA 2AAMA 3W2KA 3WLPA 1EJXC 3R12A 4W87A 2JEQA 1BRLB 4AQLA 1RBAA 4AD3A 2VZSA 3UVIA 1PO9A 4LV4A 4DXKA 1FWGC 1AVAA 3F2CA 5BRPA 3T05A 3E0FA 2J77A 3DAQA 3ERPA 1AQHA 1JZ8A 3ZJKA 1CB7B 3OVGA 4WZHA 4X9YA 1FWIC 2J62A 1VPXA 2IUZA 4L1XA 3O15A 3HQ1A 3NEVA 3QTGA 1O68A 1PX4A 5M5DA 1UQZA 4LU0A 5F2GA 2Y8UA 4NVTA 2BY2A 4O17A 4XO6A 3AYTA 2ZZ4A 4GYFA 2TSYA 2X2YA 3MV11 3GVWA 3PB2A 5FF4A 1CGTA 3RRXA 2JIWA 1XIFA 4IFKB 2GSEA 4OU1A 4HNVA 2G95A 4F0MA 3QM3A 3GD6A 1IT0A 3KL5A 1A4MA 1IWBA 4JFWA 3REQA 1X1NA 3C8NA 5EFFA 2VR4A 4YTUA 1ZBWA 2E9LA 3ABXA 2DVTA 1ZFJA 5J04A 4GWEA 4HMDA 1J0HA 1XH1A 1IIHA 1FXQA 1UJQA 2UV8G 3RX2A 2QAPA 3GHTA 3URBA 3HU7A 5LNWA 3CPRA 1XF0A 1I2PA 3T07A 4QE1A 1DHPA 2J66A 3S0CA 4AZ5A 1XGEA 1G7VA 4YL2A 1XLGA 3BGAA 5CBJA 1K9DA 3OODA 1ECEA 1LLWA 4J3UA 4EACA 3U4FA 3WUFA 2C16A 4A21A 4MYAA 1Q6FA 5EB8A 2NQ9A 3XISA 1ZNNA 4PRWA 4R9OA 1PEZA 2XVGA 1W5PA 3TC7A 5CAHA 4YVPA 4NI3A 2FVLA 3DFYA 4LEQA 3G0XA 4AD5A 3TXVA 1LUCA 4O1DA 1FKXA 3E5BA 4NJHA 1R9XA 2YCKX 4LVBA 2WMJA 5B7YA 3N4EA 4JIPA 5B7ZA 1A47A 1B90A 3S2JA 2I56A 1H3GA 3QLLA 5LIUX 1QW7A 1WE5A 1XH2A 3M0MA 2POZA 3E02A 2YYTA 5D8ZA 1TWDA 2GUYA 5D02A 4MAZA 1YTKA 1UR3M 3C0SA 3WLSA 5DN1A 2OMAA 1I2RA 4IQJA 1PZ0A 4ZR8A 1L2UA 2H90A 5DCBA 3TP4A 4BK9A 1B4EA 3EB2A 4IP5A 3GFZA 3UR5A 1UZ1A 2BY3A 4HCLA 5BMXA 1MXDA 1A3XA 3DBPA 3AIRA 1EFZA 4FP1A 3E0VA 2ADAA 2O7QA 3AHVA 5BZAA 2Y6ZA 3DG7A 3ANYA 3P62A 1JXJA 1V3JA 1M7OA 1OGSA 3KOXA 3WFLA 1ZU8A 4QG6A 2OEJA 3LHYA 3E0LA 1B3ZA 3RCYA 3EMQA 3V7PA 4OOZA 4CUCA 4LXFA 4RCXA 4PTMA 2YFOA 4QX4A 1ZALA 1GQJA 4GI9A 1O7AA 2VR2A 2J8GA 4K7YA 4R85A 1NU5A 1POKA 4JNYA 4NSBA 2CLPA 4LF2A 4Q8MA 3KTCA 5AHIA 3LS9A 5K2ZA 4HD5A 1VJSA 4H8VA 3TJIA 4DJDD 1TX0A 1YW1A 3KWXA 3IV8A 5AKQA 1JXKA 4MNMA 4C5ZA 3V0TA 1VF8A 2WM1A 4GC3A 6XIMA 5I3HA 3WEOA 3P14A 3SGUA 4NZ4A 1LG2A 1W54A 2XVNA 2DFAA 1U1UA 2DT3A 1KFWA 1ISWA 3WNPA 3IRSA 4GUHA 2OQHA 3DDMA 1UMLA 1ADOA 1EJWC 4KFOA 3A64A 5REQA 3UNTA 3APTA 2CLLA 1JI1A 2A3LA 4Q4RA 1BYBA 3R2GA 5D05A 4K39A 1XLAA 1C8YA 3ARRA 5F2LA 2EKGA 1GZJA 1ONRA 2HS6A 2ZIDA 5IFTA 4JEJA 4UTMA 1LL6A 3PANA 3KAOA 3FSUA 4DI9A 1XSKA 3G1FA 3L9CA 1JDCA 1WXJA 1AL7A 4HBKA 4DZ5A 2DJLA 5HNNA 4Q4QA 4UQ9A 5A6LA 4KWUA 1AZ2A 2PUZA 3A22A 4PE8A 3RX3A 1SO4A 2Y89A 2HSAA 2B7NA 2E8ZA 5I24A 4MJMA 1PCKA 3LTPA 3VNKA 4WQ6A 3B03A 4D6IA 4DWSB 2VDGA 4IIBA 3H2NA 3EKZA 1DP0A 3RMEA 1UD3A 2WB5A 1FHLA 2W6RA 2HZGA 1XDMA 3H53A 3COTA 3VM7A 3C4UA 3MZNA 4Y9MA 1VENA 4Q8QA 4M6UA 3PZNA 5F7UA 2FB2A 1K03A 5IBXC 4QQ3A 4R7OA 4LVFA 3ES7A 3SGZA 2BWGA 3K8MA 1UIPA 3SCOA 4IIEA 3EKLA 4N02A 3HJEA 4IICA 3W0KA 3GNXA 2QMKA 3ONBA 2WBGA 3TN3A 1DXFA 3RPMA 1E6ZA 2PFHA 1WCGA 1OT2A 2P50A 3UG3A 5BOFA 4EP8C 1DE5A 3LG3A 1QU4A 1EO5A 4UWMA 1JFXA 4JDBA 2XSBA 4J3WA 1VYSX 3VKBA 3VZXA 1VGAA 1SW3A 1TJ0A 3EOLA 4ZZ9A 3MWCA 5HNUA 3SSJA 3CMFA 2VUNA 1FDZA 3GVVA 4F0KA 3DYPA 2JE8A 4H7VA 4MNLA 1PKMA 3QY6A 3FVMA 1A49A 1BF6A 4AZIA 3N2TA 4G8TA 4PMXA 3UBPC 3UZJA 1QHOA 3S5ZA 4IQDA 2WNWA 1M6JA 3JZUA 5A8PA 2OLSA 1CLVA 1R3RA 1GOMA 1VCFA 2HK0A 2WHMA 1XLMA 3W53A 1XIGA 5E6YA 4MNKA 1R5YA 3G77A 1W1YA 3THUA 5LZLA 5HUPA 4HTYA 1QOQA 4XSLA 1DJZA 1MRAA 2Q3RA 4KETA 4X22A 2D69A 3AS2A 4DLFA 3LZ5A 4P7RA 1GW1A 1YXYA 4ROQA 1E9ZB 1VBJA 5EKYA 1FWSA 3NPVA 3TNOA 2XZ9A 4DJED 1HT6A 2R1KA 9RUBA 4M8UA 3OZYA 1H09A 1KM4A 4TMBA 1NQ6A 3LCHA 1EH9A 3V75A 1N8FA 4JTQA 1NWUA 4Q6XA 2DZWA 4M81A 4KQNA 4QQUA 3H12A 1M53A 2WKJA 2UY3A 4K38A 4IGNA 3KL0A 4HP5A 1GPFA 2VTFA 1XFCA 4ROPA 3KBMA 3TYAA 4FR1A 1O66A 2EQDA 4F3HA 2EG8A 1TPVA 1KRBC 4JIQA 4GVIA 1RV8A 1L6WA 3CH9A 4S3JA 3QKEA 2QJHA 1DWAM 2J75A 2QCEA 5CPNA 3W85A 3C2FA 3VMPA 2B81A 2RGMA 3DHUA 3HPSA 2NLIA 3ALGA 5JU6A 4XZNX 1ADSA 2OZ0A 3VA8A 1O94A 2NZLA 3C2EA 3HFYA 4WGHA 4AYGA 2IPWA 3DEQA 1MEWA 3VIHA 2XGZA 5CEWA 1SM9A 3O6AA 3TYUA 1GZGA 4NAEA 2ZYFA 3WZ0E 1SZEA 3EWYA 1XSJA 2A2IA 5EMUA 4JTJA 3UYIA 3NL5A 4A4AA 3ME3A 3WMLA 3JUGA 3CHCA 3KCJA 3A21A 1EYEA 4O4WA 2ZWYA 3L4WA 1JI2A 1XINA 2WJEA 4M1BA 3N4FA 5CC3A 1E4MM 4OKDA 1VPYA 3ABRA 1UA7A 4J3VA 1QHZA 1PKNA 4S3CA 2A3BA 2GQ3A 2XUCA 4RJEA 3TIMA 2DW7A 2MANA 2E67A 3AMCA 3G22A 4Z2HA 1VHNA 3GDRA 5GQBA 3M47A 3FNDA 3NUKA 2W67A 4KF1A 5CZSA 5ABEA 1OCJA 3E2QA 1EZ2A 2PDCA 4BA0A 2WC4A 2E1WA 2IPFA 4Z1DA 1XCWA 4JFTA 4BHYA 4AD4A 4CD7A 2VFDA 7PTDA 5I3FA 1F3XA 2D22A 3RFAA 4MG4A 1JNDA 3PP7A 1GOQA 4KGLA 1VH7A 2FIQA 1D8WA 3DHFA 1FUYA 5D03A 4O1CA 2D3LA 4C6OA 1BGGA 4XZLX 2JEPA 1TTPA 1D3CA 3BSMA 3HURA 3BAIA 4F0SA 5D37A 4XKYA 3BJTA 3DFHA 4NXKA 2ZXQA 2JKAA 2B0MA 5DRCA 3GXPA 3C0QA 2V6AA 3CV2A 1E4LA 1QTWA 4KWSA 4UFMA 1TPB1 4JTUA 5CG0A 4MTVA 1ITCA 3ARYA 1XIJA 2BOEX 3WL0A 2J7CA 2E5BA 2R1PA 3T08A 3NPUA 1EXBA 1Y8BA 3UW6A 4WOZA 4IPNB 4Z2IA 2I5QA 1WP6A 4UQAA 6TAAA 3SUUA 3GZ3A 2Y7DA 3WJSA 1X8CA 1QRQA 2YDSA 1XRTA 3UR7A 3TWBA 1XCXA 3FY1A 4JQ4A 1PWLA 4WVXA 3W6YA 4DJDC 1FHDA 2NVAA 4E6MA 1XC4A 1ZL1A 2OT1A 3SADA 2XYLA 2D73A 1TWZA 2WSYA 1D3HA 5TAOA 4LCQA 1BVWA 2YL5A 1Z7AA 4JNZA 1LG1A 3POHA 3W7PA 4H01A 4AZHA 2WAGA 4LF1A 3KTXA 2DUZA 4B3ZA 1QATA 3R0KA 4HCHA 1JF6A 3RK8A 2HRWA 1G01A 4C7GA 4H2HA 4E3VA 1TPEA 1OC5A 1V7AA 2PZ0A 3FAXA 4GG9A 2E28A 2FH6A 5DCEA 3U0HA 4XIAA 3PAJA 1Q7ZA 3N2MA 5CC7A 2W62A 4AZ6A 3UCCA 1EGMA 5J8LA 6REQB 4JL1A 2CETA 1XLLA 3MQTA 1MW2A 2PP0A 4JTLA 3OVRA 1WZAA 1Y5XA 2EF9A 2DIJA 4ALDA 5DLCA 1AMYA 1KCKA 3F4CA 2F84A 4DF0A 2E1DA 1MQQA 2W4XA 3P8IA 2NV9A 1UUQA 3BTNA 3VX0A 4IGSA 3W6LA 3DG6A 4PUEA 3JU2A 3VDBA 2WXDM 3VNJA 2RDWA 1FXPA 1J0KA 2OZ8A 3IUHA 4PCPA 1IEVA 1P5BA 3TV8A 4AFYA 3LPPA 2HPMA 3RM4A 1ISZA 2O92A 4MIMA 1UR0A 5MHBA 3O3RA 3HG5A 2PP1A 3GX9A 4TX6A 3G5EA 1MQRA 2EHHA 5FEZA 5GJMA 4GZJA 1MNSA 3GR8A 4EANA 3K5XA 4R5EA 3AQUA 1L8NA 4YU1A 5HNTA 2CHOA 1H50A 1TX2A 2GDUA 2Q02A 3GDKA 3VK5A 1A0DA 1V6TA 5CXPA 3W76A 1NWRA 4JZ5A 2PRMA 3MJMA 2VRQA 4AHPA 2Z7GA 5C55A 5G2WA 3LSBA 3N11A 3CIVA 1ELSA 4C6LA 1FKWA 5C9WA 2O9TA 4AC1X 4X0NA 3WD0A 4H9VA 2PDIA 3MHGA 2PDQA 3GDBA 1GQKA 1SPQA 4I9JA 3O2LA 1NSJA 2E25A 2WMKA 1FHVA 3ZMRA 3AJXA 4MOZA 3FIGA 1BSLA 3CYJA 1E9IA 1VFHA 3AIBA 3SY1A 4EE9A 4XK2A 2HPIA 1JZ2A 3UPWA 2XWEA 1KXTA 5AECA 5HINA 7A3HA 4H6KA 4N7QA 1BWLA 1DJWA 1Z48A 1SUXA 1GKRA 4GFIA 1Q3NA 3BAXA 4KRTA 1CGWA 3WBXA 1PWMA 3HF3A 2ZTKA 3T42A 4W5UA 1EC7A 3UY7A 2PGEA 3IIVA 4HPGA 4NNBA 3MT1A 4DUOA 4C6IA 3WIJA 1P0KA 4RE0A 5FOOA 2VWTA 3HM7A 1QCWA 1EA0A 3W1MA 1UOKA 1MQPA 4AZBA 1OIMA 4LRSA 4ORIA 2Z1KA 3S9IA 5G4HC 5EMMA 1A50A 3PJWA 3HV9A 4P8VA 1GNXA 3U2OA 4DYJA 3DUGA 1ZAJA 1VAHA 3I65A 1RZMA 3GXFA 2WZEA 2ZDRA 1UBPC 2Z2AA 1SVDA 3N13A 3L65A 3G6MA 2Y1HA 1IF2A 2G3MA 2PDBA 3CHDA 5HDRA 1JGMA 4KBXA 4GQQA 5PTDA 3UWZA 4QDPA 4C60A 2FHFA 2PWUA 5D09A 3GB6A 1E40A 2BGNE 4D72A 4HSOA 3W2UA 3SCSA 1MFVA 3IVSA 1PYFA 3K13A 1OFAA 1UPMB 4B9YA 2E9MA 1RR2A 3WQEA 1VFLA 4IMGA 4N9CA 2E6YA 4NRSA 1B5TA 2VD9A 3OBEA 4E4UA 4WKFA 3AHZA 1K7EA 4WXYA 5I0DA 3AXHA 1F9CA 1XC6A 2A6LA 3TNBA 1SU5A 1W9BM 1XS2A 5GVJA 3WF0A 3C5QA 3NDZA 3B8TA 4GKLA 2PTZA 3N73A 1CWYA 3SN1A 1JDAA 3MSGA 4DYKA 3HGSA 3KBNA 4NAEB 1G69A 4J9JA 2QV5A 5IM51 3SUWA 4PTDA 1TV8A 3PZGA 4RXGA 3VUPA 4PL2A 1RA0A 4UMCA 1IIGA 4NZ5A 3I3EA 2A6NA 3BOFA 3QV6A 4ZFMA 3P5ZA 4AVNA 2QCDA 3I10A 2DZBA 3KX6A 5CJNA 3THQA 3VXGA 5TNVA 4AB4A 4B9ZA 3HJZA 2CWXA 1IXQA 2IPJA 3WJZA 1EL3A 4A3YA 4H1ZA 1OBAA 2PDNA 4RW5A 1G5AA 2PS2A 2J25A 3LB0A 3CIWA 2CLEA 3IANA 2JKPA 1VJZA 3EB4A 3KHDA 3O63A 3MY9A 5CLTA 1IWAA 3GVRA 1W17A 4UFHA 5CCZA 1V3IA 5GNXA 2WZIA 3LM7A 3W38A 2C1IA 4B91A 2XIBA 3OB8A 3WQGA 1SZRA 1NY1A 1QO2A 4P8WA 2Z2BA 1UH4A 4F79A 4YNGA 4O8RA 2Z1SA 4FXJA 3GG8A 4N4PA 1I2OA 4UXDA 5FL0A 1SJAA 1WKEA 3HPAA 2J79A 3QZEA 4J7RA 4FXSA 3CAQA 2JIEA 3CBWA 1WKDA 1U30A 1NQKA 4NIRA 4O14A 4DM1A 4LUJA 1NOWA 3G1XA 3FV9A 4NJJA 4N9DA 3EGJA 2OR2A 1HP4A 1UD4A 1ONEA 3MMUA 4HZ7A 4UTFA 3W28A 3ARZA 2WMIA 2QQ6A 3O0KA 3GTFA 3M0LA 3TC3A 3ELFA 2PE4A 4JTGA 1KB3A 1I8JA 1KFKA 3VOGA 2WM0A 4NYUA 1BYDA 5FD0A 5SWUA 1TZ9A 4HNNA 4CNOA 3QHOA 3SIMA 1OGGA 4C6MA 1L9WA 3WQVA 5BRBA 1GOKA 2OX4A 2J8FA 1IGWA 1PSCA 3UYCA 3PPFA 2XH0A 4LFYA 2AAAA 4W93A 3GIYA 4ZQMA 2BHZA 4F0HA 3EPNA 4QP0A 3VKDA 1XYBA 3SN0A 3LPGA 3WNOA 4F48A 4B5XA 2GJNA 1JD7A 5LA1A 5FJUA 3R8HA 1XIEA 1SZFA 2Q8LA 2F2KA 3RM9A 1Q6CA 4Y96A 2O7SA 1VKFA 2E68A 3FJNA 2VUYA 4US5A 4NRRA 1RJRA 4Q7IA 3ITLA 1JDFA 5U4NA 1DYSA 3A9BA 3SBFA 4FMVA 4X2PA 4B2DD 1TZZA 5FIPA 2A5HA 1K70A 1JCLA 5E6ZA 3CWNA 2ISVA 3UJRA 3VKKA 3KP1A 3WQCA 1L8PA 2XU2A 4LTSA 2ZTJA 3VCNA 4H7CA 4L56A 2WCAA 2B7PA 3LLXA 3DBNA 2FTWA 1XW8A 4LC6A 1W3KA 2GVYA 6ENLA 4QE4A 4WGXA 4GX8A 4M5PA 3TN5A 3BLKA 4DBEA 3QMTA 3VC6A 4LNYA 3CAKA 2C13A 1XUZA 2ACRA 4IFRA 3OYXA 3FFSA 5CBIA 1T96A 1C8VA 3MDWA 4A35A 1DJQA 2PDGA 3KUMA 2O9RA 4XD3A 1A5CA 3KOFA 5DRIA 4NY2A 4GMEA 5JBEA 4W89A 4QAIA 3F7JA 4LX4A 3RYSA 1KFLA 3B0UX 1YX1A 4Q3MA 1A4LA 3SSZA 3PTKA 2WQDA 3G6LA