1V79A

Crystal structures of adenosine deaminase complexed with potent inhibitors
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Structure-based design and synthesis of non-nucleoside, potent, and orally bioavailable adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1v79A00
4QROA 3PAOA 1ONWA 1YNYA 3OJGA 2D2HA 1VFLA 2W9MA 2Z29A 1A5NC 4J2MA 4IG2A 4CQDA 2YZ5A 2O4MA 4C6MA 4C6FA 2D2JA 1EJUC 3TNBA 1KRMA 3DUGA 2A3LA 3OOQA 1PSCA 3LSCA 1ITUA 2GZXA 2FFIA 4L9XA 1YRRA 3URQA 1O5RA 3EWCA 2Z7GA 3WMLA 1K70A 3GG7A 2R1KA 4E3TA 3WZ0E 1EJWC 2AMXA 3IRSA 1FWDC 4QSFA 2VR2A 4G2DA 4BJHA 3S2LA 3CJPA 2OODA 4R85A 4DI8A 1M68A 4EP8C 3RCMA 2Z26A 3QGKC 4EPKA 4KIRA 2CZVA 3UPMA 3E2VA 4HA0A 3URAA 2DVUA 4INFA 3ID7A 2PGFA 1EJXC 3T8LA 2EG8A 4KEUA 1XRTA 4ERGA 1J6OA 3URNA 1S3TC 5CH9A 4CQBA 4KQNA 3E0LA 1EJVC 2QVNA 2DVTA 4DO7A 2GOKA 3PNZA 4B91A 1NDVA 3MVTA 1K6WA 3SFWA 2GWGA 3HM7A 3NQBA 4XAZA 1V4YA 3GTIA 3GIPA 2WJFA 3GTXA 3V7PA 1J79A 2ICSA 4CEUC 4ZSTA 4LCQA 4C6PA 4LANA 4NI8A 4GOAA 3IPWA 4V1YA 4C6BA 4ICMA 3PNUA 1YBQB 3GTFA 2ZC1A 1PO9A 1EJRC 1YIXA 2PUZA 4BKNA 4Z42C 1GKQA 4DNMA 2D2GA 4PCPA 4IH3A 1KRBC 3UBPC 4RDWA 2Z24A 2HBVA 1RJQA 4GY7A 4AC7C 3HTWA 3CAKA 1W1IE 4ERAA 4DLMA 1FWEC 3A3XA 3E38A 4C6LA 3HPAA 3IV8A 3FEQA 2BGNE 3B0XA 4F0SA 2WJEA 4HK5A 4ZSUA 2P53A 4XAYA 3LNPA 3N2CA 3CS2A 2AQOA 3F2DA 2F6KA 5HMEA 3LS9A 2HNHA 3OQEA 3LGGA 4PE8A 4QS6A 1P1MA 3F2BA 3NURA 2FVKA 5AKQA 4GK8A 4C6EA 4BY3A 2HPIA 3OVGA 1FWCC 3TN6A 1DPMA 1EZ2A 3GU9A 2WM1A 1POKA 2I9UA 2GSEA 2DVXA 3S2JA 4GBDA 3S2NA 4V1XA 2GWNA 4DLFA 4H01A 4EPDC 4CNUA 1QXLA 2Z4GA 4QS5A 1PTAA 1EJTC 1IE7C 1E9ZB 4RDYA 4WVXA 2Z25A 4I6VA 1A5MC 3LSBA 1FWFC 4H9UA 4DZIA 3MSRA 1FWGC 1K1DA 4KETA 2P50A 4TQTA 4IQJA 3E3HA 4IFOA 2Y1HA 4G7EB 4UBPC 1KRCC 3C86A 4DI9A 3F4DA 4R88A 1RK6A 3K2GA 4M51A 4WHBA 3LU2A 4HK7A 2VC5A 4H9ZA 3MPGA 1V77A 3E74A 3OODA 2YB1A 4GY0A 3PBMA 4GYFA 4C6IA 4DZHA 4MUPA 1A4MA 1FKWA 1A5KC 1YBQA 3KM8A 1FWJC 3B0YA 2YXOA 3IACA 4NG3A 4H9MA 4IGMA 5LXXA 4LCRA 4KERA 2Z27A 2UZ9A 4LAMA 3RN6A 4C5YA 1POJA 2G3FA 2VM8A 3LY0A 3TN3A 5HMFA 4IFKB 4J5NA 3S4TA 4CNTA 4P5UA 2OB3A 3D6NA 2O4QA 4I6KA 4B3ZA 4AQLA 2QT3A 1I0BA 1NDWA 3OU8A 4KEVA 2Q09A 3GTHA 3MVIA 4LAKA 2KAUC 1R9XA 2Z28A 1EF2A 2Q01A 2Z2BA 3MTWA 1FWBC 2VC7A 1O12A 2HQAA 2AQVA 3URBA 3FDKA 3R0DA 4H9YA 2Z2AA 2ADAA 4IGNA 3UR5A 4F0RA 4C6KA 1GKRA 1WXZA 1NFGA 2OQLA 3LA4A 3NEHA 2R1MA 1M7JA 2OGJA 4EPBC 1GKPA 2ANUA 4GC3A 2E1WA 4QTGA 1RK5A 2QS8A 1EJSC 1HZYA 1QW7A 2PLMA 1V51A 3QY8A 4CNSA 3K5XA 1KRAC 4C5ZA 4IF2A 3LGDA 4R7WA 4C65A 4C60A 2EG7A 3GU2A 1R9YA 3O0FA 4EPEC 1UBPC 3IGHX 3JZEA 1ADDA 4NP7A 1XWYA 4G7EA 4LFYA 2OOFA 2QPXA 4C6CA 1NDYA 1RAKA 5G4HC 1RJPA 2XIOA 4RDVA 4C6JA 4LEFA 3DCPA 3TN4A 4GX8A 2EG6A 3MDUA 1XGEA 4LH8A 3O7UA 4C6NA 2RAGA 4YIWA 2FTYA 2R1LA 4ERIA 1FKXA 1EYWA 1UIPA 4L6DA 3MDWA 3S2MA 3E0FA 1RA5A 2WJDA 3TN5A 4D8LA 1UIOA 1J5SA 1JGMA 4GZ7A 4XAFA 1V79A 1ITQA 1FWIC 3MJMA 4IFRA 3ISIX 3DC8A 4IFKA 4F0LA 2VHLA 3F4CA 3RYSA 4XD4A 1YMYA 5A6TC 1I0DA 1M65A 4IG2B 3IJ6A 1A4LA 4WGXA 1XRFA 3T1GA 4C6OA 3AUOA 3EWDA 4RE0A 1RA0A 3GUWA 1E9YB 1RJRA 1ZZMA 3PANA 4PBEA 3GIQA 2R1NA 4JOMA 3QY6A 2E25A 4DYKA 1BF6A 4H00A 4J35A 3GU1A 1R9ZA 4RDZA 1J6PA 4HK6A 2IMRA 3F2CA 4PBFA 4PCNA 4XD6A 2FVMA 3BE7A 3IARA 1P6BA 2I5GA 3AU6A 3EGJA 1WXYA 2Z00A 2PGRA 4C6QA 3SO7A 3FDGA 4LCSA 4H9VA 3UF9A 4C6DA 4DIAA 5FSEC 2BB0A 3ORWA 4QRNA 3GRIA 4UB9A 2R1PA 2PAJA 4LALA 3B40A 1ONXA 4GX9A 3ITCA 3ICJA 1UMLA 5FSDC 2VUNA 3G77A 1A5LC 3AU2A 3MKVA 2HBXA 4H9TA 4HJWA 4XAGA 3A3WA 4XD5A 1A5OC 3UR2A 4RZBA 1V7AA 4GXWA 1P6CA 2HPMA 4CQCA 1NDZA 2UBPC 3RHGA 4KESA 1PB0A 3WYZA 1FWHC 1KCXA 3A4JA 3T81A 2FTWA 3K4WA 5E5CA 3QY7A 4LAOA 4H9XA 5HMDA 2YB4A 4CEXC 4XD3A 4KEZA 4KF1A 4GY1A 1FWAC 3QGAC 4OFCA 4B90A 4B92A
chains in the Genus database with same CATH superfamily
3AIBA 1R3QA 4OOZA 1TCMA 4QNEA 2XIIA 4TUFA 3RK8A 1R3TA 4URIA 3W2JA 1TWSA 4O1BA 1JAEA 1OC6A 1U1JA 3UU0A 4C7DA 1EGVA 3VD9A 4GQQA 2C7FA 3ARTA 4IOTA 1PIGA 3C2VA 2A3HA 3NQ7A 3CZGA 4WKHA 1WA3A 3EDFA 1K70A 3GG7A 3DU0A 1TA3A 2BASA 3K8KA 5E6YA 5DY2A 3L5LA 1HGWA 3ZT5A 1A53A 3C61A 1AMKA 1Q65A 4HTYA 2OODA 4O13A 1M68A 2EJ1A 2DW7A 3W7CA 4AXNA 4A22A 1J0KA 4AMCA 4UFLA 6CGTA 1MW3A 4YPJA 1LTDA 1GZJA 4I9JA 7TIMA 2DU2A 4KRZA 1W5MA 1OF6A 1F73A 5KINA 5M2FX 3ITGA 4Z0JA 2L5HA 3ZIZA 1PUDA 3C2RA 1R46A 1FHDA 4GWEA 2CIPA 1MWOA 1TCDA 1EDTA 3ANVA 1KGUA 1OX4A 1W9XA 1BHGA 3W1AA 1C9WA 4AMAA 4WIWA 3UG5A 3ONCA 4GJIA 2NQHA 2GOKA 1KM2A 3C6CA 2Z6JA 5G2WA 1FWRA 1XINA 1VFMA 4UQDA 2PWEA 1XJBA 5I24A 3TW6A 4X9SA 1UD8A 3CWOX 1S5TA 4GNKB 3GTFA 4P7LA 3TEVA 1JPDX 3VIKA 9CGTA 3DFTA 3BG5A 3QHNA 1U5HA 2X0YA 4PTVA 4NYYA 3WJSA 4DLMA 1J10A 2AKZA 3UVIA 5LYRA 5K4XA 1EWEA 3MY9A 1Z32X 2C3ZA 3HIJA 3NQCA 2O92A 4IP5A 3JUGA 2WNWA 3M47A 1RBLA 4HPXA 4E2DA 4NIRA 3G5EA 3GDKA 3VINA 3Q94A 3WNMA 3OZMA 4C7GA 2OWCA 3WLSA 5E93A 2EPHA 3TMQA 3UZZA 4A2SA 2E40A 2DVXA 3S2JA 3PZIA 4TV5A 1CTNA 4HN8A 3MCOA 1CGTA 1KBLA 3GKAA 3R8HA 2WHJA 1CLXA 5K3VA 4DI9A 3G1YA 1SO6A 5ABGA 4QEEA 3TC6A 2PU1A 3IJLA 1KXTA 3LU2A 1UR1A 2BDQA 2PF0A 3E9AA 3OODA 3ANUA 4M80A 4GQBA 2OT1A 4FOKA 4QX4A 4XSLA 2IXVA 5FF7A 4U10A 3TWBA 1XI3A 3L5MA 3NO3A 1PL9A 1VHNA 5BZAA 2NSOA 2PD9A 4O54A 4HNOA 5HNTA 2DUXA 1W5QA 3VNJA 4B3ZA 1KTNA 3TYAA 4IQLA 2VR4A 1S3HA 1R0MA 2V81A 3GO2A 2PPGA 3SQMA 4GXPA 3EMQA 4H6EA 4NXKA 3N11A 4ZBCA 2OG9A 1NVMA 2Z2AA 1UROA 4O1DA 3KDOA 1ME7A 3EOSA 3LA4A 5DF0A 1F4HA 4JKMA 5DANA 5DN1A 1OF8A 5A6KA 3TCEA 1R7AA 6XIMA 4Z2JA 2QS8A 4L4LA 1UD5A 5C0QA 2A5HA 1V51A 5A2CA 2FZDA 5JBFA 3O0FA 2IXUA 1H49A 5AC7A 1JUEA 1XWYA 1ISWA 2BHZA 3OEXA 2QIWA 2CEQA 1JCNA 3ABXA 2I56A 5E1QA 1RAKA 4FP1A 1F8MA 1LLWA 3MDUA 4DJDA 3DYPA 3BG9A 4YVVA 4TVUA 4LX4A 2OCZA 1B57A 3P5ZA 4GBUA 3B0VC 1RA5A 1U2YA 1GG1A 4D6EA 5ABTA 2QDHA 4IFRA 4IFKA 2WZEA 1XCWA 4RV3A 2DFAA 2QCFA 3RILA 4LV9A 1QHPA 1ADOA 2GGIA 3G0SA 1TV4A 3S5OA 1GTEA 3QW4B 3BLOA 2Y88A 4RE0A 1I6NA 5FAJA 1PZ3A 4WCJA 5D2WA 3W2UA 3B8UA 4N0RA 1J6PA 3UPBA 3AIWA 5LA1A 2V68A 2J47A 4RR4A 5DCBA 3GR4A 2YFOA 4Q7BA 3EGJA 4HD5A 1C7SA 4M7SA 2JKAA 1UQYA 4NASA 1LM1A 1QU4A 4Y9NA 2VGGA 1OT1A 1UKQA 3EOLA 4WRHA 3H2FA 3G3DA 3UF9A 4DIAA 4O17A 2BHUA 3VGHA 1TIWA 2XH7A 1M5WA 4GYPA 4CD8A 3NM1A 3O06A 3VIFA 1B0IA 2NVAA 1TO3A 5M3WA 4DZAA 3ANYA 3BWWA 4PBGA 2PDWA 3CB8A 1GPFA 4JIEA 4KCVA 1F6PA 4UCFA 5CG0A 3EZ4A 1PB0A 1KCXA 1SZNA 2DH2A 1W3IA 1NF7A 2A79A 2QCLA 3S1WA 5DCEA 1MFVA 3BLPX 3FYOA 1PCWA 4AWEA 5JUVA 5JXQA 4A8RA 2QF7A 5EGRA 8CGTA 1RH9A 1MW0A 2PDHA 3PAOA 1NTHA 1F6KA 3OHIA 3W27A 2PBOA 2Y7EA 2OQHA 4EWJA 3UFYA 4GIRA 4FNPA 4DXKA 1QPNA 3TQPA 4DWDA 2AL2B 4GFSA 2WQPA 1L2QA 2V69A 4US6A 1HKWA 3LSCA 1RHCA 3PSVA 4L9XA 3EWCA 4HZ8A 3OZOA 1WQ5A 2VWTA 3UJ2A 2V5BA 3OPSA 3KZSA 4G2DA 3P6LA 4KFNA 3W1MA 1X6NA 4CCZA 3SCSA 4EP8C 3TONA 4FALA 4EPKA 2BTMA 3G6MA 4DWSC 3HGOA 4KWWA 4S3CA 5GNXA 4GYKA 5AFDA 3W7GA 3C52A 2WC3A 4W86A 1RLDA 4Y9AA 2WZHA 5H1WA 1J6OA 3MMUA 3NGFA 2QQ6A 4YJ5A 4O0ZA 4KGLA 4ZOBA 1WKEA 3I3DA 4Z1CA 4RPQA 4HJFA 4Y6GA 1EQPA 1LOSA 5E9XA 4WSKA 1T40A 4S23A 3NQBA 5DBUA 1TPEA 1GVSA 3BW3A 5CBJA 4C6PA 1GHRA 3M5XA 5C55A 4GOAA 3N15A 4KBXA 1XLIA 5FL1A 2NLYA 2Q3OA 2PRHA 1MXGA 1ZHAA 4R34A 3WLKX 1YXYA 1KTCA 3COTA 3APYA 5TIMA 1X1OA 5FF4A 3KE0A 6ALDA 4LYKA 3KW3A 1KLZA 3ARXA 4UFIA 1S46A 3E38A 3ZR5A 1TFVA 1ML1A 4UTJA 1US0A 2PWVA 2HISA 2V0TA 4MNKA 1OFEA 3U57A 4W4QA 4E4FA 1H0GA 3SRFA 4J1OA 2Z6IA 4DBSA 4O10A 5EBUA 4MWAB 4FXFA 2EHHA 1ZBKA 1B9BA 3S46A 1JDDA 3ARRA 2ZUNA 2BXZA 1IIGA 3OVPA 3GU9A 1MI3A 1G7UA 2GGEA 2VDHA 3K4DA 4ZCWA 1TJPA 3P60A 4WVXA 1MXSA 4IIBA 2J7EA 5XINA 1FCUA 2X1UA 4UXDA 4TQTA 2YBTA 4NYUA 2EO7A 1B3WA 5BOEA 2OPJA 3CMFA 1TPWA 5FACA 1UR9A 3SRKA 2AL1A 2HVMA 1E5NA 3EX3A 3H23A 1FKWA 3GR8A 3B0YA 1W3NA 2VXNA 1XSKA 3VNIA 4LCRA 5CPLA 1E0UA 2E67A 5EU9A 3VNYA 3NYDA 3W23A 3PZGA 3W1UA 2E5CA 1W1PA 3UZXA 1YPFA 3BJFA 1M7XA 4MNMA 5EMUA 4W87A 1K02A 1JL8A 4LAKA 4XV0A 2Z28A 3DFPA 4MY1A 2DZBA 5LGXA 1JEZA 2YBUA 3LPOA 3JS3A 2AQVA 1JRCA 4H9YA 1L8PA 3R0DA 4XKYA 3IUIA 5JBDA 3M16A 1GQLA 4G7FA 3M0YA 3ZS4A 4GMEA 1OEPA 3AJXA 4IJCA 1KCZA 1PTDA 1GKPA 2E6FA 3SAZA 1UG6A 3U3HA 1ITXA 1DQXA 3JVAA 4P7QA 5IFPA 5IRPA 2YA2A 5KZDA 2Z2UA 2G97A 5C2GA 4OTKA 5CJNA 4W88A 3OBKA 4HNNA 4WLCA 2CERA 4JAWA 3CO4A 4G8TA 1ICQA 1KC7A 3OGRA 2HWGA 1JCYA 4IIEA 1RJPA 1J93A 4H1ZA 3DCPA 2PF8A 1CPUA 1TX2A 4QQUA 3LM7A 1Q7MA 4HN4A 4ZO8A 1ZRQA 4IX2A 4EKJA 4L6DA 4NZJA 2WSQA 2WMIA 4DAIA 3S2MA 1OK6A 4JHZA 5I3DA 3QFWA 3SB0A 1ESWA 2WHMA 4AXKA 1P0DA 4TU1A 4QJ3B 1ZBCA 3N4AA 3ISIX 2SFPA 5LIUX 2OO6A 1CXFA 5D30A 1V3KA 3II1A 1OYCA 4W89A 3B03A 1RJRA 1AVAA 1O6IA 3CL7A 2V5CA 1AUSL 1GQKA 2GK1A 2WZMA 3L0GA 1IXOA 4XD6A 3PY2A 1TA3B 3O8AA 4LUYA 5F1UA 1S1PA 3DESA 4P8UA 1S5NA 4MTVA 4FR6A 3SO7A 1ZNNA 3PBVA 2ATMA 1VHCA 2J13A 4HZMA 4IPLA 3AYTA 4B4FA 1MZHA 1JZ2A 1CXHA 4NRSA 2WKGA 3FJ4A 3SGZA 2Y7GA 1HO4A 2PP3A 3W38A 3KP1A 4I9TA 1NJJA 1KM1A 1WKYA 5EMMA 1OX4B 3KDNA 3OB8A 1IEIA 3B9DA 4JIQA 3G77A 3B9OA 3KCOA 4TIMA 1DEDA 4OBSA 3GY1A 1W3JA 5E09A 5G4EA 1NSJA 1FWTA 3WMBA 3AYSA 3VDAA 3KVJA 2NX9A 3KWXA 3WNOA 5HMDA 1EGMA 2IQDA 1JQXA 1XF0A 2HNEA 3CT2A 2CNCA 4Q8UA 1XISA 2XVGA 4PULA 3MO7A 1X6UA 4DQWA 2GJLA 1AZ1A 4RNIA 4GPNA 5U4NA 4JTIA 2JBMA 3I7SA 2HMCA 1FTXA 4QG9A 2O4MA 3BLFA 4FR1A 4JXCA 1OCBA 3T07A 3RG6A 2BGQA 4ZB0A 4I5RA 3CLMA 5B7ZA 3NPVA 3BSGA 1O5XA 3KCJA 4O16A 1SSDA 5CG7A 4IQDA 4R85A 3R1ZA 3QYSA 4LUSA 3QHMA 2BMBA 2RH9A 3LOTA 4GHRA 1WPCA 3R13A 4JTHA 1K7XA 5FJPA 4Y9PA 3ITTA 1IR1A 4IMFA 4WDTA 5A8GA 3P74A 3W7PA 1QWGA 1LQ2A 1XRTA 2YDAA 4CQBA 4JD4A 4IMDA 2W66A 4PMQA 3SRHA 4GABA 1THFD 4N9EA 5DMMA 4L4OA 3AZSA 3LHYA 3MQTA 3G1AA 3W7LA 1E6PA 1IEWA 3ARQA 3CZ8A 1J79A 3C0QA 4N02A 1V0NA 3RM8A 4HTBA 3PNUA 3VIOA 1PJ9A 4AIOA 1B3VA 1R2SA 2WQDA 2C0HA 1WDWA 1WZMA 1J4EA 1XL9A 3ERPA 4LY8A 4UTUA 2WCGA 1BYCA 1KRBC 3UBPC 2W27A 4HPHA 1Z48A 2ZE3A 3L9CA 3GC4A 5KETA 4ZENA 1ZAHA 2W5FA 4TX9A 1FWEC 1OFOA 1R85A 4PGLA 4JTLA 3Q67A 3F4VA 4B9ZA 2ZTJA 2P53A 3LNPA 3B8IA 1HKIA 3F2DA 3W76A 1TWWA 4NX0A 3SZ8A 4MUZA 1KNWA 4FNSA 3M5YA 2A2IA 2GJPA 1UD4A 3F1QA 4DPPA 1CGXA 1ZJBA 3DOPA 1ZB5A 2Q71A 4GK8A 5FJIA 2OO0A 3LCLA 4JTJA 2OWXA 1FWCC 1FXQA 3TVAA 1DPMA 3VE9A 1POKA 4UOZA 4GQ0A 4GIYA 1RD5A 1DKWA 1A3XA 4L56A 4H01A 3QVQA 1QNQA 3SCVA 1B5TA 2OMAA 1EJTC 1E9ZB 5FEZA 3DEQA 4A3HA 2GUUA 3HFTA 3UCCA 4NJHA 4F0KA 4YMZA 1P4CA 4A21A 4UBPC 1KRCC 3VOIA 2X42A 1KM4A 1Q45A 4L9ZA 1EXPA 3IJ7A 5JQ9A 1IWPA 4ZE4A 2Q3RA 4LNCA 4ZL1A 4DM1A 2PDBA 3MUZ1 5T9CE 1IWBA 2O7SA 4UOJA 1V0KA 3S6TA 4GISA 4AWUA 4XTIA 4FXRA 4O19A 4XVEA 4AHOA 4LNYA 3W25A 4IFKB 3PVFA 1IV8A 5EFDA 4FNTA 2CHOA 4I6KA 2OT0A 4DWSD 2OSYA 4GC4A 3G22A 1NQ6A 2H9AB 3ABZA 3H4GA 4GZJA 3P14A 1BKSA 4AZ7A 1WAWA 5GVJA 1E1FA 1PIFA 1O12A 2A1YA 1OGGA 1LWJA 3A24A 3WQEA 3FDKA 3KVLA 4RE2A 1V3MA 5C9ZA 3NDYA 4B2DA 3TROA 1SJAA 1TPB1 4DM2A 3F5KA 5H8MA 2PEVA 3N19B 1Z8AA 3PTDA 1A3HA 4DUXA 4GFIA 4UQBA 1QW7A 4LU0A 5FCZA 3K5XA 3RJXA 5I3GA 5FESA 3FCPA 4IXXA 1UR8A 3GU2A 2FHBA 4W7VA 1TV5A 1VB9A 4NP7A 1G7VA 5BCAA 1VYSX 1YQ2A 2QZRA 3N2XA 5A6SA 4MIMA 1K7EA 1LL7A 5LNRA 3WLJA 1UKSA 5DT5A 1X8FA 1OCQA 3MHGA 1QWKA 4PMVA 2O9OA 1I4NA 1F76A 3NQAA 2OEJA 3TYUA 4D8LA 4YN5A 2X2GA 2INEA 3DBNA 3DAQA 4HNVA 3PJUA 3VOJA 3A4AA 2VD8A 5C6MA 3S1VA 1GOMA 2QUVA 3U4AA 4ROQA 1NU5A 1TKKA 1U30A 3LQLA 1EF3A 4DYKA 3DIPA 3HMCA 4PUUA 1XIHA 4RDZA 4DUVA 2XN1A 4P2VA 3RX4A 3FFSA 3MP5A 4FIQA 1XUUA 3CHEA 3IJDA 1LQAA 2Y89A 2P0IA 5F4SA 3MC5A 3VU2A 2J7GA 4D1JA 3QZ6A 3GXFA 3SECA 4DAFA 3V0TA 4GE8A 4B3KA 1CYGA 3WD0A 1JR1A 3KL5A 3STEA 2D23A 1BGAA 4AVOA 2A6NA 3LB0A 1JZ3A 4QHRA 4M7TA 4MADA 2GFTA 3ELFA 1AJ0A 5A8MA 2DY3A 2Y7DA 2E9LA 4WZHA 4K8HA 3QTGA 5J5DA 2VI0A 3UR2A 2DSKA 5CC6A 4OBTA 3E2QA 4BF9A 1UJQA 1S2CA 1OT2A 4TX6A 3TOYA 3ECQA 4AF0A 3BARA 1E43A 1CWYA 3S2CA 3RDKA 3BCDA 2Y85A 1JNEA 1KBJA 4E3VA 4G56A 3QGAC 1C93A 3DHDA 2OTDA 2C8NA 1JJKA 2MANA 5CSYA 3UT0A 4IICA 1XPYA 4GNVA 3ITVA 1U1HA 2XINA 1HL2A 3VMPA 2IQTA 3TWAA 5F2IA 3PG9A 3WH7A 1NY1A 1XBYA 3CC1A 3S0CA 3MYOA 2WCAA 1PSCA 1X7FA 2DGAA 3D46A 1W37A 1VFSA 2YL5A 5D33A 3T0AA 1QTWA 2ALDA 4RV8A 1FP9A 3SY1A 1KLYA 4RE3A 4IIDA 1OK4A 2PDGA 3BAYA 2XZ9A 2PFHA 2VJXA 5D04C 3W86A 2Z26A 5AYZA 4Q32A 2NT0A 1JAKA 1HIZA 1RCOB 4LRSA 4KIRA 2PGEA 3PPHA 5C9RA 1OY0A 3BTNA 3SUSA 3VD4A 4BI7A 1I9CB 1MDLA 2D3NA 3ZWTA 1E71M 2ISSA 2D69A 2XUCA 4RKAA 3MW7A 2J8GA 1P0EA 2FPTA 3L0NA 3BSMA 4KWOA 4IM4A 3USZA 5LXEA 1ONRA 3CQJA 3DERA 2GL5A 4EIVA 3ATYA 2XH0A 3T4WA 5IBXA 3E0LA 1S5VA 1DHKA 1EJVC 1Q6EA 4AD0A 5DY3A 4DO7A 4D72A 1RCQA 1BYAA 4YYFA 4XBKA 2PDJA 1Q7QA 4GZEA 2GJRA 2CC0A 3V7PA 3IEBA 3KBSA 3ABQA 4LANA 3TFCA 1E9IA 5CZJA 1ZP4A 2FQIA 3GVWA 3PB2A 4ILSA 2ODOA 4MYAA 1YPXA 1YIXA 3FOKA 1WYIA 4E38A 4C7FA 3PZVA 2D2GA 1B31A 3AXMA 2HBVA 4ZXLA 1HKKA 3W3OA 4EXBA 3L2LA 4ERAA 2CFFA 2PCEA 3B0UX 2Y5JA 1QNVA 2OR2A 3PPGA 5CPOA 4HK5A 3OA5A 4JNMA 3VPLA 1CBGA 1M7OA 1TR9A 3W7IA 3BG3A 3H2EA 4XKYB 4N4QA 3VOHA 1MDRA 2CITA 1PXGA 4DJEC 2QJIA 3LM3A 1Q5MA 2C15A 5M03A 1HJVA 1AQ0A 3NURA 4ZE5A 3LBCA 4DJFA 3WEZA 4HYVA 1QI0A 3BL3A 4RLIA 4AVFA 4W5UA 2Z4GA 4MM1A 1PTAA 2GGGA 4H4IA 1XG4A 4LS2A 3G1HA 2Z25A 2C1GA 2DT1A 3TK7A 3VD5A 4Q8PA 4LUIA 3SUVA 1XD1A 3TOPA 3C5QA 3ARSA 3CZLA 1L9WA 1J0YA 1RK6A 1W3HA 4WHBA 4L5ZA 1DL3A 2ACQA 5AHIA 2V3EA 2G3JA 3SY5A 3QRHA 4GYFA 3GH4A 3KHJA 2WMIB 3FXGA 1A5KC 4IGMA 1XICA 2G41A 3BLLA 3RFAA 1UWTA 2VRJA 2DZXA 2NQ5A 2WNZA 5I02A 3CPRA 2XTKA 4M5PA 3CZJA 4OUIA 4E8GA 2Y62A 1MW1A 1NDWA 3W75A 1DJIA 2Q09A 3MVIA 1SYTA 1H0IA 1EF2A 3S6DA 1TPH1 3MTWA 3AOFA 3HMJG 2GK1B 2PDLA 3CUFA 4K8GA 2QCNA 3O16A 1NWRA 1BG9A 4RX0A 3B8WA 3KOXA 3RJYA 2ADAA 1V0LA 3BMVA 3PWAA 4CNNA 1AH4A 4E8CA 5CAHA 3D3AA 4UMBA 1LWHA 4H7ZA 2OQLA 2E6DA 3R8GA 2OFJA 2Z1SA 4KRTA 2GUBA 5I77A 3WQFA 3CV1A 2E1WA 3LPGA 4Y8FA 1UJPA 4GCAA 4AYSA 4PUJA 3UP8A 1DWFM 1R47A 3PZ9A 5BU9A 3Q65A 1W3KA 4D6GA 2CZEA 3K8LA 4WX2A 5HXMA 4W8AA 3ENLA 3L4WA 4E8DA 1CI1A 3UCQA 3RMEA 3GM8A 2WMGA 5LNVA 3GTNA 3W2MA 2QXWA 1E56A 5FI8A 2VGIA 2XWDA 3UETA 4LS0A 1L2UA 1X1NA 2WMJA 1PE1A 2R1LA 2IW0A 3VD3A 5A6BA 3UJEA 3VILA 2DORA 4WR3A 3W28A 3VAVA 3WF4A 1G6CA 2Y24A 3KWSA 3S3GA 2F6UA 4W7WA 1TPC1 4YTTA 1AL8A 4NI3A 1WP6A 2G37A 5A6TC 2JIEA 4L4PA 1DORA 1SZRA 1XRFA 3IWPA 1OGBA 2V67A 3W85A 3G1FA 3WNPA 7REQA 1OX6A 1BF6A 5A6JA 3OVRA 4MPKA 1VGAA 2IPJA 4IMGA 1MYRA 3GDRA 2VEFA 3PZOA 3A12A 4PCNA 1UOZA 1F6YA 4QJ4B 4H6RA 1EIBA 1FQ0A 1JQVA 3VIPA 1QPQA 2PWGA 1YEYA 1XBVA 1CGVA 1WXYA 4XIMA 3F4WA 4LUSB 1EO5A 2UV8G 4CCDA 5A2BA 4HOZA 4H9VA 3AWNA 4K38A 3CL8A 4RNFA 4QNWA 3ORWA 1Q6FA 1HGYA 3N9KA 4IUOA 2X09A 2R8WA 3ARUA 1LOLA 2DZTA 3OLEA 1S2TA 3LLXA 2BV9A 1LDCA 1K4HA 3BOFA 3MKVA 4H9TA 4HJWA 1GEHA 2HPMA 3EB3A 1XCXA 4HKPA 1TE1A 2DIEA 1E1CA 4XO6A 3GNNA 1XLCA 5I3FA 1G01A 3ZM8A 2PS2A 4RZ6A 4PTWA 3G18A 4QDMA 3P82A 2ZFAA 3A5FA 4A3UA 4H6QA 3WLOA 4I5UA 2NZLA 3O6CA 1DWGM 1GVOA 2ZZ2A 3S9IA 4HHMA 3CTTA 1W1VA 4JR5A 1ZJHA 1XCFA 2I5QA 2VZTA 2AGTA 2X0HA 3TYEA 4Q8OA 1XLAA 3AS3A 3L4XA 5HPCA 3S9YA 4AEOA 1TVLA 2QYGA 1GONA 3SI9A 1EO7A 1O5RA 2TMDA 4UTFA 3LK6A 3WZ0E 1VIWA 2RDTA 4MB4A 4AIBA 3CJPA 3M43A 4BQ5A 1IZCA 3N1AA 2PD5A 2ACSA 3WQPA 4JN6A 3KRSA 2QHAA 1ELSA 1GOWA 4B5SA 4TTGA 3URAA 5F4WA 3TU9A 4JYDA 2DSWA 4PSPA 2C91A 7CGTA 5F2LA 2C0AA 1Q85A 4IPPA 3GS6A 3SBFA 4PC8A 5C2XA 4FSAA 4KQNA 1EQCA 1V02E 3VYLA 1B4EA 3GD6A 4B91A 4AC1X 5MF5A 4K39A 1K6WA 4DO6A 3TP4A 3GUGA 2HE5A 1V4YA 1HVXA 3TSDA 1ICSA 2PODA 2WJFA 2YDSA 3CUGA 4FX7A 4V1YA 1XM3A 2E09A 1VJSA 2PCQA 3AIRA 3WX7A 3PN8A 5CGTA 3W29A 1DJHA 2J8TA 1B4KA 2ZCGA 2PBGA 3E2SA 4DJDD 4JTGA 1KM6A 2DUAA 1R3WA 3A3XA 5AYIA 3IV8A 3QPZA 3PZMA 1HJWA 1QNPA 1VJIA 4KT2A 4DYJA 2YL9A 3CH0A 2B7NA 3VX0A 1VFHA 2HNHA 4EOUA 3LUTA 3NZGA 4PMUA 3M4HA 1EHNA 1GVRA 1OYAA 3TN6A 3B4YA 2I9UA 1F07A 3FAWA 2H3DA 4UTKA 4EPDC 2YR1A 3CAWA 4JIIX 2RUSA 3WBAA 1A5MC 2B31A 1KD0A 4DZIA 2CLLA 1O68A 4Q8VA 2H8XA 2PURA 3QR3A 3NPUA 1CGWA 3IK4A 3CWNA 2NUXA 4P7OA 3CZKA 1MNZA 3MPGA 5EYWA 2XYLA 5DXYA 4UNKA 1NM9A 4PN2A 1ZS2A 3BMXA 3S47A 2DZWA 3CGTA 2ISFA 5LXXA 2CLHA 3RN6A 1POJA 3M6DA 3LY0A 4AZHA 3PFRA 1EX1A 4ONVA 4IP7A 1GEQA 3V1HA 3AHYA 1JZ7A 4AY1A 2YL6A 1KFBA 2VVNA 3B9EA 1SMDA 4IMAA 3EAUA 2XIBA 4Z1YA 3WQ5A 3QBUA 4WOQA 4UZUA 2VC7A 1QVBA 4QE5A 9XIAA 5KITA 3V5CA 3WJWA 1KV8A 1W5PA 1XIIA 2C13A 1GKRA 2ZYFA 4KMQA 4FLQA 5E70A 3VKBA 2YXXA 2F38A 4AG0A 1XIJA 3DHPA 1PX8A 4OV4A 4B3LA 4KPLA 3BV4A 1XLBA 1W9PA 1BG4A 3NL3A 3WEOA 1OIFA 1R38A 1RZMA 3QW3A 1U33A 2RGMA 1A5SA 4O28A 3W2NA 1J9YA 2WLYA 3WKZA 1V3HA 4J7RA 2QGYA 3GB6A 1Y7VA 1NDYA 3RUBL 2XIOA 1V5XA 3QV8A 4MGGA 3BUVA 5CKSA 2HVOA 2CLEA 4DB7A 4AF0B 1JPHA 1S5WA 3LRLA 1KFEA 2HVNA 1LP6A 4JDBA 3NCOA 5FIPA 4IISA 1E72M 2JE8A 1C91A 1GUVA 4XD4A 1EPVA 1YMYA 2HTMA 2BY2A 1YDNA 1A4LA 3GG8A 4AWTA 1FX6A 1UWAA 2Q02A 4JOMA 3L12A 4H00A 3D3FA 3N04A 1UWUA 3DFHA 5CPMA 4H8UA 1J2BA 1QI5A 3VIHA 1JUBA 2C19A 4ZODA 5U7SA 2CLFA 2QCDA 2VO5A 1TTQA 2XU2A 4GIAA 2PSNA 3GZ3A 4ALDA 3UZ5A 1KM5A 3MSDA 4UR8A 4B5XA 1GJUA 2E1DA 2C16A 4OECA 1E3ZA 4PUMA 4QR6A 1Y65A 5AVHA 1M01A 3UESA 4LBRA 2BY0A 2VUNA 3UXAA 3VDHA 3U4FA 1VFOA 3UA3A 3WBYA 1M1BA 1U5VA 2BHYA 3W73A 1QATA 1F3EA 3LCWA 2PC4A 2UBPC 3C0JA 4KESA 2RKXA 3BPWA 1S1RA 4HBKA 5E5CA 3EEGA 3RLUA 1BWKA 1TJ2A 4XD3A 4ZB5A 4KEZA 1XC4A 3YPIA 1NOWA 5ECVA 4B90A 2RJGA 3M5ZA 5HATA 4B5WA 3NXFA 5I0DA 2NXHA 1LBFA 4DXVA 1SFSA 4P8WA 4IG2A 3Q45A 1A0DA 3WLNA 1ZENA 1K3UA 3E0VA 1E6XM 3WQWA 3W7DA 2A3LA 3B9NA 3T42A 1R5YA 1OIMA 1OX5A 1OGSA 3URQA 2ZBTA 1QDSA 2ZKMX 1L6YA 3LTYA 1P48A 2GJXA 4X0NA 2D20A 4Z08A 1XKJA 2PLCA 1HFBA 4Q7IA 1KCKA 2DH3A 4ACYA 4IL2A 2R94A 1UR3M 4HCDA 1EP3A 1AW5A 3EWWA 3MUXA 1KTBA 5A8OA 3RR1A 1XFCA 1QK0A 4KEUA 4LY4A 1SJBA 5D9PA 4GQRA 3R89A 3W53A 3G8EA 5GJMA 3UWUA 2QCEA 4JTUA 5DQPA 3LNMA 2WZTA 3SQLA 1TMLA 4XZ9A 4P8XA 1REQA 4IX0A 1T0OA 1W1B1 3I65A 1M53A 5CLTA 4LVBA 4L4MA 2DZUA 2P3ZA 1RY8A 3WF0A 3W7KA 4FX8A 3TJLA 1R87A 5AYXA 3FA5A 2JEPA 2HEJA 1V02A 3SEPA 3VZYA 1W9UA 2XSXA 3PWIA 3RMJA 5D8WA 3KOYA 3N4EA 4GYJA 4MWAE 2FMNA 3M0KA 4CCCA 1V6VA 2R91A 1EKOA 4DNMA 3W81A 4CU6A 1VENA 1AQHA 2ZADA 2G8ZA 1EFZA 2WCSA 1IGSA 1IGWA 1DE5A 3GXNA 2GDUA 3FYPA 5L9FA 3ITYA 1UZ4A 3BLKA 2F9RA 3M41A 2G0WA 3P8IA 4B5VA 4C6LA 4LVGA 1H3GA 4KCUA 3QEZA 4MJ2A 5CAKA 3GK0A 1XLHA 4AISA 1SZFA 3QV7A 1AQMA 3CS2A 2WVVA 1WNOA 3KBWA 4H6KA 4LBUA 4PE8A 2C18A 1E6RA 1AH3A 2WMKA 4OKDA 3M0IA 5E9AA 1TSIA 3D5HA 5LZLA 4HMNA 1AW1A 3PUDA 3EXSA 3TC3A 2FH6A 1SFJA 4WGHA 3RPDA 3KRBA 1R2RA 3WF2A 5KZEA 2GOUA 3W87A 4HZ7A 1ADSA 3QH2A 4S3AA 4RDYA 1KFCA 3BAJA 1K1DA 3L67A 4GI6A 4PRWA 2VFIA 3W1QA 2V5LA 3V16A 4LEQA 1UA3A 3BGJA 3PBGA 2R6OA 1XLKA 1MQQA 1GG0A 1OG6A 5GNYA 3DKLA 5CJMA 1UR2A 2DW6A 1XG3A 3RU8X 3LMZA 3AHTA 3IACA 3B0PA 2JIWA 3FIGA 2GQ8A 3Q2DA 1YYAA 3H12A 2XVKA 4D2JA 2VM8A 3VDGA 5LGZA 3ALFA 1XKYA 3H7UA 4FMVA 1TWDA 1H62A 4O52A 1ITCA 4GUJA 4LUTB 2G96A 5HR7A 5C7VA 4AQLA 3FW6A 1YXDA 3GW3A 3S8HA 2X2YA 2CZFA 7REQB 1FXPA 1MEWA 1GOOA 3WO8A 1FP8A 1Q6CA 1XGDA 3FVDA 1QAPA 3V0SA 4PUWA 1K7FA 2YCKX 2Y7FA 4Q4KA 4O57A 1O1HA 3AALA 4ML9A 2INZA 4U31A 4K1GA 3ABRA 1FDJA 3KP0A 2WWCA 2R1MA 3CLWA 4CNPA 2DEPA 2VRKA 4J3SA 2WC4A 4LVAA 3HJZA 1O1ZA 4Q4RA 1HG3A 1X8CA 4A4AA 4AH7A 4PRRA 4ZR8A 5BOOA 2IKIA 3IVTA 3G1RA 2EQDA 4S38A 2XFWA 1D3CA 1VFUA 2DDXA 1UUQA 1OFDA 1RVGA 7PTDA 1EGZA 5LNUA 2WPGA 3CHDA 3MI6A 5G4HC 1TB3A 2WVUA 1E1CB 3AXKA 3VKKA 3RO8A 4LQ1A 3AJ7A 4ENLA 2YW3A 4ERIA 3TN5A 1H1ZA 4H8HA 1Z41A 4F4RA 4UQCA 4JCMA 3P0WA 4DY1A 1EXBA 2O7QA 5LIXX 3F4CA 1QW9A 5A69A 5LKYA 4C91A 3GYEA 2E68A 5F1VA 5HQLA 5L6UA 3M0HA 3VIMA 3GIQA 4ZA0A 3LRMA 3KUMA 3G8RA 2Y8UA 3FYYA 5CCZA 4Q4QA 2ATSA 2MNRA 1WXJA 2ON3A 2EXOA 5D9MA 2PGRA 1BTCA 3RM4A 2UY5A 1E4LA 1KM3A 3GHRA 2VELA 5CSUA 2PDKA 2JF6A 4QDWA 3UWWA 3O9NA 5BOFA 3HQNA 2DZPA 3GZAA 1KBKA 4H04A 4JQAA 3GRIA 3DG6A 2E77A 2RGLA 1YLVA 2ZXAA 1UMLA 3CYVA 3AS1A 4IIGA 2BXVA 1W3LA 1MSSA 4PUEA 1UB3A 3UW6A 4TR9A 8RUCA 1HO1A 2QULA 1D9EA 2YDRA 1LWIA 1ZBVA 3VNMA 4N9BA 4O0KA 2QCHA 1H7PA 2EPOA 2G3NA 3P61A 5KZMA 3K4AA 5H8PA 2FMOA 4MAZA 1LROA 2B7PA 3ZSSA 3B97A 4MHBA 4N6EA 1H5VA 1YE4A 4FLRA 4JKLA 2PTWA 4DEFA 3OGVA 5DT7A 1G5AA 5I3IA 3UZJA 1J2WA 3VCNA 1GYLA 3VKDA 1FCVA 1H7XA 1VIZA 3ONBA 2WXDM 3IRSA 4M6PA 3CUXA 3O63A 3TYBA 4MYXA 2PRLA 2P88A 4ICCX 3THCA 1NFBA 1I2QA 1IIHA 3ZLHA 1AQFA 3CQIA 4MY8A 1YTKA 5DELA 1DXEA 1CGUA 4RNJA 4LYRA 3O1NA 4FNQA 3LCGA 2V5JA 1E4NA 4L9YA 3IJIA 2VZUA 2J7DA 4B2DD 3U5YA 4J3ZA 1G4PA 3SUUA 2DJLA 2BVTA 4A3YA 2NWRA 5D9OA 2OLAA 5CPTA 1Q2SA 1ZJIA 2DUZA 4XVDA 2AGKA 3CUHA 3UYCA 1ZTVA 1E0XA 3DC0A 5DX7A 3P5YA 4C6BA 1R86A 3SIMA 3WUBA 3ZFHA 1PX3A 1SUXA 4F9DA 4W93A 2EKGA 4ORIA 3AHZA 1TJ0A 5LHEA 1K9FA 1V03A 5D02A 1YKWA 3IJ8A 1H41A 2VFGA 2Z1XA 2D3LA 2HS8A 4MZ1A 3LXAA 3DH7A 3R11A 4AZGA 2BLEA 1Q13A 3DYOA 2OYLA 3N2CA 4XO7A 2QUUA 4D1IA 5HMEA 3UZWA 3LS9A 4FA3A 1TRIA 3M6YA 4LRTA 3N29A 3QQWA 4C6EA 1IXNA 1BSIA 2EPMX 4LC6A 3P0XA 2J8FA 3OLDA 1GTHA 4W8BA 2E3ZA 5HULA 2VEMA 1KW1A 1TTPA 1DYSA 4XZWA 3VFCA 3LSBA 1LRNA 1ZY9A 4NNBA 3S1UA 1EWDA 1IEXA 4UWMA 3EWUA 4RK8A 2XDFA 3WQVA 4JQ3A 2VC5A 4Z1BA 5AC6A 4CUCA 2VTFA 4MFEA 1BFNA 3AMGA 4C6IA 1QO5A 4Y8EA 3J7HA 4XAPA 3HN3A 1DJQA 3H6OA 5D37A 2ZUUA 2VX6A 2OZ3A 3ITLA 4PUKA 4OBRA 1AG1O 2VX4A 4M0XA 1NOFA 2OB3A 3LI1A 2ZXBA 5EMLA 3FKKA 4U2ZA 2W79A 2QT3A 4DBEA 2V5KA 4AX7A 2A85A 4PA8A 2OXNA 2VWSA 5H2ZA 1EL3A 2FJUB 5HUOA 2HQAA 1NP2A 3S1GA 4FXJA 1TV2A 2ZICA 3T55A 4DXXA 4QCFA 1QPRA 4TVDA 2D2OA 5I00A 3WLMA 1H63A 1VZWA 2ZX8A 1VH7A 2QCDB 3R58A 1SMAA 2PTDA 1K8ZA 1XIEA 2XVLA 2ANUA 1H11A 2EPLX 4CN4A 4FNUA 1JI1A 1PKNA 1UMYA 1PS9A 4AD1A 3AXIA 2FHCA 2PWFA 1JXJA 1HZYA 1ZCCA 3W7OA 3NOEA 1RP8A 2H3BA 3CL6A 2QMKA 2VCBA 1KGXA 5A1AA 3APTA 1AL7A 1E40A 3U5UA 1QNOA 4YCOA 3EB4A 2DQXA 4LEFA 2BX7A 3KCLA 1XLLA 1UBSA 2VC9A 3HBLA 1DP0A 1H51A 3QLDA 3REQA 1WUEA 4B5UA 1J5SA 2QF8A 3PB0A 1VQTA 1IWAA 1ITQA 2FDMA 4O12A 4MPQA 2VMFA 2NLIA 2Z7KA 3KEHA 4F0LA 3PULA 4IG2B 2RDWA 4K6AA 3NJ3A 5C54A 4CD6A 1DXFA 3ALGA 2QVHA 3FLUA 3U2CA 1I8JA 2JK2A 3FX4A 4JQ4A 4F9JA 1GYMA 4J35A 1JCMP 1GNXA 1Q6QA 1UA7A 3LHVA 1XYCA 4HK6A 4AD2A 4ZO7A 4FZIA 1DIKA 2IMRA 5D2YA 3F2CA 4ZEPA 5F7UA 3SCUA 3VK5A 2V2DA 5HANA 2GJXB 3CUJA 1UYQA 3ES7A 5CZKA 3WJZA 5LIWX 1QOPA 3ZLGA 3I6EA 1DIOA 3ZWSA 3W6LA 3WIJA 1BXCA 3FHQA 1E73M 1RUSA 3C56A 3GAYA 1SW3A 1R3RA 2R1PA 1YNPA 2VCAA 3LXBA 4EX4A 1REQB 2XISA 3U9IA 4BEUA 1JPMA 3GFZA 4PUDA 1UR4A 3LXCA 3MYPA 2FTWA 3BCFA 1XIGA 4HCHA 2PMQA 5J5RA 1MQPA 4YU1A 4XZNX 1TJ1A 1OADA 2V2HA 1SJCA 1OSEA 3IV3A 2INFA 5IDZA 1ONWA 3OJGA 5SWUA 3LG3A 1T41A 2BY1A 4FPSA 1HQTA 2YZ5A 2ZTKA 3WQCA 4LYQA 1JFXA 1NQKA 3SCQA 3DUGA 3EB2A 1A49A 3OOQA 4ZO6A 2V3DA 4TOQA 5I79A 2ZUTA 5CBIA 2BG5A 3VE7A 4CGTA 3IGXA 4PMRA 3AMDA 2WKJA 4EE9A 1X38A 5HQMA 1V7YA 2WVVB 2NV9A 6A3HA 4MJ4A 2YXGA 3S6OA 4MKNA 1KFWA 3QR0A 2VFEA 3T0TA 3W1LA 1SPQA 4JNYA 3NAVA 3IRDA 2P8CA 4M82A 2QUTA 2ZUVA 3NDOA 1SM9A 3QPYA 1L6GA 2W3ZA 3AC0A 3R94A 5DRIA 2DT2A 3KZPA 1TELA 5A8NA 4JFUA 3NQFA 1D2KA 2ZA2A 1R6WA 4ZTXA 2FB2A 3VCRA 3A4XA 2QVNA 4YS1A 1FHLA 3VMOA 3QSTA 3MUCA 5FL0A 3KS5A 3HOJA 1OG0A 3HM7A 4K3ZA 4XK2A 3TJ4A 3BLIA 2FKPA 3T2QA 3B04A 1EOKA 4UIOA 3BO9A 3FJNA 1EA0A 1TV3A 5D03A 4JS3A 3XINA 2V5DA 2DIJA 1EJRC 1CDGA 1YW1A 1F3WA 3H24A 1YADA 1ZPTA 1JNDA 5BU6A 3WCZA 4QE4A 4NX5A 4JTAA 2OJPA 1HTIA 2F61A 1PZ1A 1UZ1A 4KW2A 3DG7A 4Q7NA 4CNOA 3BSHA 4AC7C 2WWDA 4GH3A 2DSZA 3I6TA 1JFHA 2PU0A 3BMWA 3LX9A 1LJYA 1Q8AA 3H7RA 4FLOA 1G0CA 3HQPA 3LV5A 4J3VA 3WH9A 2F6KA 2VRQA 4D6JA 2BFGA 3OQEA 1KM0A 3CNYA 4MNLA 1TIMA 1E6ZA 3VMNA 3N17A 4QITA 4I7WA 3OVGA 4BR1A 4NY2A 2WM1A 3DYMA 1OWQA 4NAFA 5A94A 3EWZA 3R25A 3VC6A 1VLWA 3CT7A 4HZ6A 3POHA 2FFCA 1R30A 1BSLA 1IE7C 4M6QA 3EOUA 1FWFC 4H9UA 2Z0IA 5PTDA 1W5NA 2FDSA 1TWIA 2GGJA 2P50A 5EPDA 3THQA 5AECA 3MHUA 3VNLA 1TUXA 1TMHA 4XISA 3GR7A 4QE1A 3IAPA 1GK8A 3SCWA 1XSJA 5BMXA 3NZPA 4Y9MA 2VC6A 4X22A 4XSMA 5CC3A 3PBMA 5IHRA 1C90A 3H22A 2H9AA 3ARZA 1XS2A 1FOBA 4LVFA 3UJSA 2G3IA 3KM8A 3BXWA 4NG3A 4W84A 3M0ZA 3HGSA 4LAMA 2AAMA 3EWBX 1W0MA 4KKXA 3S4TA 1QHZA 3CXOA 4OOUA 4PYSA 1UH3A 1I0BA 3OU8A 1M3UA 1TYGA 2YIHA 4A8LA 2D73A 3SCRA 3QXBA 3WLRA 3B9AA 1R9XA 3JU2A 1RALA 4CQ8A 5JBEA 2Y2WA 5K9XA 3CEUA 3E1F1 5E0FA 3QJAA 3ZVIA 1AD4A 4FNRA 1G4TA 1WXZA 1GW9A 3N4FA 1PWMA 1E3XA 3N3MA 3STGA 4FF5A 3P3BA 4QTGA 1RK5A 3WELA 4QQ3A 3EX2A 1MO0A 1ZJAA 4HSOA 4N7QA 2QJHA 9RUBA 3C2EA 3W7MA 2CXEA 2BY3A 2JGQA 1X98A 4R7WA 4C60A 3VX1A 4EPEC 3DXIA 3HG2A 1QCWA 1JYNA 3LZ5A 4G7EA 2WMHA 1W8SA 4AYGA 1VD6A 1ZQ5A 2OOFA 4H8VA 1OFBA 3TN4A 3UA4A 2TSYA 4K7YA 3G3MA 3SCOA 2PE4A 3AHXA 1OBAA 3LTPA 4AZIA 5G1MA 4X0VA 3LDVA 2NV1A 2BVWA 3MUY1 2A7PA 5BW6A 5BWAA 1HNYA 2GUYA 3RX3A 3CPGA 2DQWA 3T1GA 3BAXA 1ZZMA 3LPFA 3VIIA 1ALDA 3K1GA 4W5ZA 3AFBA 1R9ZA 3QYQA 5DLCA 2QR6A 3VCCA 3ZOAA 4MF4A 4QGCA 3IARA 3G0XA 3S83A 5AOUA 2KZHA 2DJXA 4YYCA 4H19A 2E5BA 3TTEA 4GNJA 5IOBA 3MI2A 4JIHA 1Y5XA 1VYPX 3GVRA 2HJPA 4P7NA 3LTSA 3L68A 5I2UA 2HXTA 3PUOA 1Z9AA 4MOZA 4P8VA 4BQ2A 3ABOA 1LUCA 5E6ZA 2E4TA 3UZYA 1D8WA 4NF7A 5FSDC 4J3TA 3CV7A 5HINA 1GVFA 1K8XA 1VFFA 4FX6M 4GXWA 3LGEA 3W7HA 2ABAA 3SSZA 3A64A 3TDFA 3NNTA 2BGSA 1KXVA 1C8XA 3HZ3A 3UR8A 1QO2A 3HV8A 1E5JA 3T81A 3VTRA 1NP0A 4BQ4A 4DRSA 3M64A 5LA2A 4BCEA 3L4YA 4QBXA 2CLKA 4F48A 3ITOA 3R7MA 1A47A 1JPKA 1KQZA 4JTTA 4HU4A 4S3BA 1XYMA 5FJUA 4PFMA 3OYXA 4JTKA 1YNYA 4L1WA 1FFQA 2XM1A 3R43A 1N2VA 1KO0A 2W4XA 1TPUA 2G3MA 3N6JA 5AHLA 5HWNA 4LVDA 5TNVA 3UWQA 2VENA 1S2UA 1WDDA 2CCRA 4A8NA 2NT1A 1OM0A 1YRRA 3NOYA 3FSUA 3S9ZA 5IM51 3CK5A 1GW1A 1EJWC 5JH2A 3WDIA 3IUHA 4AEFA 3UWVA 4RZ4A 2XSAA 2FGZA 3HGRA 4N9DA 3TUUA 1ENUA 2DZVA 4IPNB 2DVUA 3W7JA 3S1XA 4QAWA 4PTNA 5KZ6A 4H2CA 4BF7A 1XLEA 2I1OA 2JEQA 2ZWZA 1XFBA 3L2MA 2CU0A 4V27A 2VEGA 4IGHA 3R6IA 1EEXA 3F4NA 3OYZA 3NSNA 2ACRA 1MRQA 1ZL1A 7ODCA 4POCA 2GWGA 3WK1A 1A5AA 5C71A 3KHDA 1YTEA 1TVNA 2ICSA 3MV11 1XIDA 2VNCA 7ENLA 1XLMA 3IPWA 3NXLA 3AS2A 3M1ZA 4I5XA 2WMFA 1O4UA 3MP4A 3TYDA 4I7VA 4ICNA 4NZFA 2BBFA 3BDKA 4JHMA 3LN3A 3PUGA 1BPLB 1PDYA 1MUMA 3WSUA 4A29A 1F2JA 3NA8A 1JYVA 3NO5A 1AA1B 2EJAA 4U3CA 4K1WA 2TRSA 1K8YA 3EWYA 4YVXA 5CXPA 3HPAA 3U2ZA 1FA2A 3TX9A 1C8QA 3PK7A 1BGGA 3OO2A 1HT6A 2WJEA 4J3WA 4ZSUA 2W61A 1UHVA 2VFDA 1LF1A 3PTMA 1XRVA 4TO8A 3ZJKA 2OLHA 1QOXA 4GKTA 4I3GA 5I23A 4WXYA 1VP5A 3T05A 2MUCA 3TIMA 3IAQA 4PRTA 4QS6A 1P1MA 3F2BA 2YCIX 3N2TA 4A8IA 2XVNA 4EACA 4ZFMA 1DJNA 2WSRA 2HPIA 3OG3A 4UMCA 3CMGA 1A5UA 1ME8A 3E5PA 2V9DA 3I68A 5HQEA 4DF1A 1TTJA 1EX5A 3E02A 1CB2A 4RUBA 5T91A 4CNUA 3D47A 5E0KA 4QS5A 3WNNA 1FWGC 3SIZA 3S42A 1J18A 4Q4PA 4UQAA 3OW1A 3Q37A 4MWAC 3AZRA 3NM3A 4XZIA 5JIPA 3UNTA 3K2GA 1LL4A 5M5DA 1RBAA 4C1KA 4ZXOA 3W00A 4N4PA 4HA4A 3HA1A 3REQB 1A4MA 2UY2A 4S3EA 1ZAIA 2UZ9A 2DT0A 1KB3A 1V3IA 3R8RA 4BF5A 4AD3A 1EH9A 3OBAA 1K6AA 1RP9A 1RVKA 2XJ7A 1Y5WA 1LQ0A 4HA1A 1MUWA 3O2LA 2VZVA 3EKGA 3GXIA 1XX1A 3WENA 1VCGA 4EWND 2Z2BA 2TYSA 1PKMA 3KRUA 3N2MA 3GC5A 2VGBA 3L0KA 2GDQA 3A21A 4FOJA 4EXQA 4R9XA 4U5IA 4MKVA 4WK9A 3NQVA 4BWLC 1KWGA 1CIUA 4X60A 4R3UA 4LWWA 1B3YA 3EDJA 3XISA 2WNNA 1HJUA 2FZ9A 3L4ZA 3G1VA 4JTQA 3QFEA 1B3XA 1AMYA 1U83A 4Z17A 5HWMA 3UNDA 1JDFA 3GNRA 3DGRA 4PL2A 4WKFA 6XIAA 1XQLA 1XDLA 4ZZ9A 3TH6A 1C8YA 3KBNA 1FH9A 4RDVA 4Z2GA 1HP5A 3R5EA 4LH8A 5K2ZA 2P3EA 4HPNA 1CXKA 4MSSA 1UIPA 1K8CA 2WBGA 2WJDA 1UIOA 4I8YA 2WHLA 2Q8LA 4WDWA 2DV0A 4H83A 1ZGDA 5GPRA 1HUVA 5HJXA 3SCPA 4NNAA 3U8GA 1DWAM 3M0XA 4DUWA 4WEVX 3AUOA 2J77A 3EWDA 3PANA 2R1NA 3QY6A 4AU0A 1LOQA 2PTZA 2CBVA 4HMEA 3I4KA 2FGLA 4LB4A 4JKKA 2V2CA 3GIYA 1E6NA 2FVMA 3BE7A 2OYMA 4RZ5A 1P6BA 4LBSA 3B8DA 1CENA 1VEOA 1ZAJA 5AHNA 5BWFA 1XYBA 3BVJA 4MFDA 2WYSA 4HIBA 3QV9A 1VEMA 3L2IA 1T6MA 3E96A 5AVNA 2PDPA 1O66A 2V30A 3INPA 4M8UA 2EBNA 1V6YA 2DZAA 4QRNA 3OA3A 2J4GA 3WNLA 1XRSA 1JDCA 4F79A 4Q8QA 1L8NA 5BRQA 3VZZA 1WE5A 3WN6A 3PG8A 2V63A 1G67A 3AU2A 1PHQA 4XAGA 2HBXA 3CPUA 3FEMA 4JICA 2P76A 4XD5A 1W2PA 4P7RA 4RZBA 3IJ9A 3EKLA 2NVCA 3DFOA 1C92A 1PDZA 1SFLA 2FJKA 2D0GA 3QY7A 1GOQA 5D38A 2QUNA 3QMRA 3DENA 3F7JA 2V6AA 2Z1BA 5FF2A 1JGIA 1QMLA 1I2NA 3MUAA 3STPA 3M0LA 4YTSA 3T0CA 5BXPA 2OLSA 2F7FA 4K7VA 1Q6OA 4XUYA 3EEZA 4B4HA 5DCDA 3WLPA 6REQB 2QAFA 3APGA 5HDRA 4CLMA 1ITUA 2GZXA 5K7JA 2CHNA 2Z7GA 3WMLA 1DTUA 7TAAA 5FKYA 1FWNA 4QM1A 4JQ1A 4DVOA 4A3QA 2PWDA 2CKSA 4PB4A 4D9PA 2ONEA 2BOGX 5A2AA 3QC0A 4EK7A 1L6FA 3EA2A 5JIWA 4AFYA 4HA0A 3VIGA 2I57A 4DELA 4NAFB 4GXMA 3T8LA 2EG8A 4P61A 2QUMA 3WD1A 2R14A 1P0KA 1MXDA 1TE6A 4K36A 4HOWA 5CH9A 2VFFA 2CBJA 1VR6A 3MI3A 4GCXA 3ZMRA 3PNZA 2PDUA 4GGBA 5BROA 2A6LA 4ZQRA 3AWOA 4JZ5A 3SFWA 4F3HA 3QOKA 1Q63A 2FB3A 2DP3A 3VM7A 1D7KA 4F2BA 5KEZA 4QEHA 1MFUA 3EOEA 5EMKA 1TRDA 4XG1A 3PZTA 5BNKA 2QCMA 2NQJA 4IPJA 4EF9A 2FPYA 3BW4A 4J28A 2XN0A 4QLKA 2QCCA 1O94A 3AYVA 3R0UA 4PCPA 2CWNA 3KOFA 1G69A 4JX6A 3W4RA 1RJQA 4I9MA 3PC0A 5FF3A 4LXFA 2QAPA 2ZX9A 3I3EA 4AAJA 2BGNE 5FJTA 1JVNA 4NILA 3KVMA 5FOOA 2ZX5A 2BODX 3BAWA 4B5TA 1Q7ZA 4IJBA 2Y5SA 4UTIA 4NU7A 3VOCA 2I9EA 4L7ZA 1FY6A 4M81A 2BZNA 4JTSA 4ZQNA 3K8MA 1GJPA 5HR6A 1XIBA 2VKZG 3I3BA 1XYFA 1J8VA 1CLKA 3K30A 2ZRYA 2NV2A 2GVJA 1X97A 2QV5A 1U5JA 3GH7A 5BMWA 2W67A 1EZ2A 4ADUA 4GBDA 4HB7A 1G9HA 4KH2A 1RBOB 4U5KA 1TV8A 1UP0A 3OLIA 4KWUA 3NL6A 3WD2A 1SW0A 4US5D 2GVGA 4G7EB 1IHIA 4AIEA 1H1YA 1H7OA 3NYZA 5HPOA 3CQ0A 4JQ2A 2J6XA 2YDQA 4TVCA 4EAMA 4WJ8A 5KSWA 2YB1A 3WFLA 3WF1A 2GSHA 2Y70A 1LT8A 1R3VA 4S3GA 5A8QA 2QJNA 2ZXDA 1QR7A 3N2OA 3SW6A 4ROPA 4RW5A 1XLDA 4DHGA 2G3FA 1KA9F 3L65A 3BGGA 3LYEA 4YTRA 3VXGA 4P5UA 2A3BA 2FLIA 2CWXA 4OV9A 3FXYA 1A0EA 3M5VA 1GORA 4HNUA 2WW5A 4UR9A 5LIYX 5G1YA 1AJZA 4AIUA 4WOZA 4DJDC 4QLLA 3H70A 4ORMA 3HB9A 2W91A 2VUYA 1W6TA 4QG8A 1FWBC 2R9RA 3VZXA 2J88A 4IHCA 1EC7A 4PR4A 4WJXA 4BEQA 3URBA 3SRDA 4Y90A 3AS0A 4ZOAA 3HQOA 4M1BA 1GQNA 2I7GA 1LG1A 4IUGA 2AQWA 3IGSA 5AHFA 5I09A 4EPBC 3CV2A 3D0CA 4F8XA 4UOQA 3NQMA 2ZRWA 3VD7A 4BK9A 3FNDA 3L23A 1S5MA 5C5YA 3WG6A 1LUCB 1YTDA 4PMXA 4IF2A 1K9TA 3LGDA 3CBWA 4N2YA 4NUWA 1T5AA 3PAJA 2P1FA 5CPQA 1AH0A 3JZEA 3TKFA 4XWUA 1LCOA 5F2GA 3TMLA 4C6CA 2YCLB 1PV8A 3NQ6A 1Y0EA 3TSBA 3VGFA 4C6NA 4YIWA 1DV7A 1E6SM 1HJXA 3V35A 2PP0A 2GYIA 1E1EA 1OC5A 3WLLA 2F6XA 1DJYA 4GYPC 1MQRA 3W07A 1D3GA 1V3JA 3C0SA 4TX8A 4CN6A 1PTGA 2ZVRA 1V79A 3N18A 4YXGA 1FWIC 4PMJA 1DHPA 5D32A 3SFKA 1JYWA 4LTSA 4UNLA 4WGXA 3G24A 1RA0A 4PBEA 2ZRUA 2E25A 2WSYA 2DZSA 9XIMA 3W7QA 5I07A 3H2MA 4S3KA 1UUMA 1Q8JA 4IT1A 4HHLA 1J01A 3LHUA 1CXLA 2I5GA 2WB5A 2C79A 3F5LA 2NQLA 3T2OA 3WF3A 3AUJA 4N6FA 1FDYA 4BI5A 4MWAD 3ZR4A 1CEOA 5H91A 2XGIA 1C9DA 3P8JA 2FIQA 3N34A 2YYUA 5ECUA 1NFPA 1J0HA 2YGYA 3LI0A 4QP0A 4HCLA 1FUYA 1KKOA 4UB9A 1L6WA 3VC5A 4CCEA 1MRAA 3B40A 2DT3A 3N14A 2VZSA 3BGAA 1ONXA 4JFTA 3RRXA 4KGJA 2NSXA 2J7BA 4ZQPA 4X61A 3P67A 3W72A 2XSBA 1PZ2A 1RXOB 2DSUA 5AHEA 5I06A 1QI4A 3I7RA 1E70M 3A4JA 3ITXA 3O6DA 4LYPA 2CZ5A 1W5OA 2YA1A 4H9XA 2LLEA 4EF8A 6TAAA 4OFCA 4HSHA 5RUBA 3NG3A 1XH0A 4MG4A 2B81A 3ZSTA 1VFLA 3DBPA 7A3HA 1OHLA 3OHMB 3MCNA 2OX4A 3TYZA 4DWSB 1ZU8A 3GE7A 1EJUC 2ZIDA 1LZOA 2VQUA 4O50A 2ISDA 1ZSXA 2VOTA 4AVNA 1PHWA 2GPTA 3E0IA 3HG4A 1UWIA 2O55A 4GVHA 3E49A 1O60A 4QJ5B 1W56A 4E3TA 1JCJA 1A0CA 3QZEA 4IZGA 4PCSA 3HO8A 1UD3A 4ES4A 1QBBA 3AI0A 4I8DA 1FRBA 3CAVA 3VVGA 3W7NA 1I1XA 1S2VA 4NHVA 4GUFA 2EGZA 3RXZA 3NZ1A 1SR0A 3BCJA 1EJXC 2GJNA 4XBSA 4DYEA 4KCWA 3W83A 3URNA 1P7TA 4LV4A 2OSXA 2PGWA 4MJMA 4J3UA 3C8NA 1D7FA 3IVSA 1PKLA 2DVTA 1BD0A 2NUYA 1CB7B 2CLIA 3STFA 3SJ3A 1Q4WA 4D6IA 4ACZB 2P10A 3KVKA 5AB3A 5I78A 1WAUA 3BW2A 4ZSTA 1EDQA 4GJ1A 3HFYA 3HU7A 1JZ6A 4W7UA 4PCFA 3T4CA 2ZC1A 1YX1A 3PTKA 2PUZA 4OVXA 2BVDA 2ZE0A 3W1TA 4MAVA 4D6CA 2RJHA 4FAMA 3GVGA 4JL1A 4GY7A 1Y8BA 2QJGA 1FWSA 4LT9A 3HQ1A 1W1IE 4PH6A 4GH1A 5TD4A 2WVSA 4R5EA 1JD9A 5ABFA 2DIKA 4D71A 4MB5A 1CGYA 1IXPA 4GVGA 1HKVA 1OCNA 2J66A 3NO1A 2NQZA 4CD7A 1W3TA 4M1RA 1YE6A 4YTQA 1OD8A 1WCGA 3QC3A 3DX5A 4UTTA 1NWSA 1XXXA 4FI4A 2ESCA 2FVKA 3A22A 3RM9A 2I14A 3TJXA 3RLHA 1RQHA 3NQDA 5M17A 2VX5A 5HOSA 2GSEA 2OZ8A 2VCCA 4O8AA 1SQ7A 4FS9A 1QXLA 2RFGA 3S5YA 4QJ1A 3I4EA 2NVDA 1YNQA 3MSRA 1O7AA 4IQJA 1DWHM 4LSBA 4NSBA 1JZ4A 4IFOA 4MY9A 2Y1HA 2YLLA 8XIAA 3NDZA 4FLSA 2QLYA 4MLRA 4LUTA 3TXVA 2HCVA 2RDXA 4WD0A 4WSHA 1TV7A 1FHVA 1JCLA 4MUPA 4C1NA 1JUKA 1GHSA 2YXOA 1UKTA 2X16A 2CESA 4L61A 4GUIA 1N82A 4Z2KA 4DJEA 2IUZA 1PWLA 2ZUWA 3NZRA 1F5ZA 3IJQA 3EX6A 5EA9A 1I75A 2O4QA 1XYZA 3ZVHB 4S39A 5KMYA 1SFTA 2A3CA 1XHGA 2Z1VA 2GVLA 1GVQA 3BC9A 1X1ZA 4TTUA 1W9BM 1N8FA 2F2HA 4O8RA 3U2OA 4W9TA 1UKPA 3NQEA 1IZJA 4JIRA 4ZFCA 1Z89A 4F0RA 1W54A 5AC8A 3NSXA 4GINA 2CPUA 1WKFA 2E5DA 3KBVA 1H1NA 1TG7A 2ZA1A 2V3GA 3GNXA 4PCTA 1PIIA 1GZGA 4ASTA 5B80A 1LYXA 4M6VA 4LAUA 4IIFA 1H5YA 4FEZA 3WBEA 1EA9C 2ZRXA 3V0UA 4XBJA 5IDIA 1EJ7L 3THUA 4H7VA 4PMYA 1EIXA 1RCXB 3IGHX 1Q66A 1J5TA 4LAZA 3MHFA 4LFYA 4HA3A 1K77A 2QDEA 3B06A 2VEKA 4JEJA 1H2JA 2TODA 4GX8A 2EG6A 4WY0A 2WM0A 5DBTA 3DFNA 4BI6A 1J0ZA 4A05A 2XWEA 2Y61A 3EMCA 3MDWA 1QBAA 1CW2A 3GHSA 2B4GA 3T0BA 3MB9A 4GI8A 4HNLA 4HHPA 4ZVJA 1VCVA 1PCKA 2VVSA 4GZ7A 4XAFA 1FCQA 4HMDA 3MJMA 3OZYA 4NJKA 4GI4A 2G4FA 2QJMA 1W32A 3VUPA 1SZGA 5EMJA 1CX9A 4S1FA 1VEPA 3W7RA 1E9YB 2DPEA 5BRPA 1C8VA 3ZJ6A 2JKPA 2ZXQA 3GU1A 4DF2A 1RR2A 1T8QA 3N13A 4UFHA 3CUIA 4PBFA 4UTWA 4G6CA 3W0KA 4RW3A 3VDBA 1WKDA 2YLAA 5FEPA 4ZOEA 1FWWA 1QI3A 4UZSA 1HXJA 3WL0A 3OVQA 1US3A 4CD4A 1VPXA 3VOGA 3JR2A 4ZQMA 2J62A 2GQAA 2PDNA 2X1RA 4JFSA 1W1YA 4Q6JA 2Y4SA 4JN7A 3PZNA 4AWSA 4EXAA 1CLVA 3EDEA 3SSJA 2O9TA 4GX9A 4RE4A 2NQ9A 5CGQA 1KGWA 1BKHA 3TJIA 3SUWA 2VL4A 3SADA 2UWFA 5LIKX 1Q6LA 4WF7A 2BOEX 5CEWA 1IEVA 1ECEA 4KS0A 4JYFA 4HQVA 1IQ8A 1GOKA 5C2CA 1T96A 4PB3A 1JCTA 3H2NA 1XH2A 5LNWA 3OQ8A 4Z1AA 1E4IA 3LRKA 4AZCA 1VRXA 1XYLA 1GZ1A 4M29A 1F4AA 1GVYA 1XW8A 4DBDA 3V75A 3VA8A 3QM3A 1M9HA 2B0MA 3LLFA 2Z29A 1Q2RA 1IT8A 4LW7A 4CQDA 1UASA 3TZNA 3EPNA 3UG4A 3UWYA 3QTPA 4NZ5A 4C6FA 3SUTA 3A4WA 5I3HA 1KRMA 1P0NA 3VIJA 3LCFA 4A3RA 4XB3A 4MNJA 1HW6A 5DO8A 1XP3A 3BQ5A 4TMBA 3UXIA 3WQGA 3HF3A 1ME9A 1UUOA 1F3XA 4J3XA 1VBUA 3W6YA 4XIAA 2HE8A 2BNJA 2O9PA 3S2LA 2XFRA 1M7PA 2E6AA 3W01A 2YA0A 1IT7A 1LORA 3LBMA 3TA6A 2V38A 2QPUA 4HYWA 3HPZA 5AHMA 3MMWA 2VQTA 3PSWA 3H54A 1KR1A 1EC8A 2TAAA 4G1NA 3WDHA 4MB3A 5HUPA 4ATLA 1OB0A 3E0WA 1P43A 3ZT7A 4EVZA 2BOFX 4HU8A 1T8XA 4L1GA 5I3KA 2POTA 2CXGA 3W2LA 3UERA 3RLGA 5D9NA 3ZYZA 4UUIA 3MVTA 3AMCA 1E4MM 3MWCA 3A5VA 2YSWA 3H4WA 3R4IA 3SN4A 4JBRA 3CYJA 3U7VA 3TQ0A 3GG0A 4XUGA 4GUGA 1BXNA 3V36A 3KOZA 1QOQA 2YW4A 4NI8A 3EBVA 1B30A 4KEMA 4ICMA 4HOXA 5EL1A 1XBZA 3BV7A 1SJDA 1DJZA 3TV8A 3NR0A 4S3DA 4ATWA 1VAHA 1VS1A 4DO5A 1RLCL 4IH3A 3VO0A 3B3DA 4RDWA 5BXSA 1JPIA 1GWJA 1W2VA 3RCNA 4L6HA 4WJEA 3V5OA 4NRRA 1SVDA 3FEQA 1TVPA 5CLWA 1B1YA 3WK2A 4D6FA 2YZRA 1EUNA 3O6YX 3H7VA 4UTLA 3KOWA 3LBOA 4J4KA 3EX4A 2P8BA 3L7RA 3O05A 2ZDRA 3TSMA 5A6AA 5A3HA 1BXBA 1VFTA 2QMJA 3M0VA 1O5KA 2JQXA 3LGGA 2JALA 3CH9A 5J8LA 3WBWA 3TTYA 4Q4SA 2J9ZA 1YDVA 3GNDA 5T8GA 1WBJA 1X7IA 2H8ZA 3VI2A 2NX3A 4UC5A 3RIKA 1CNVA 4E0CA 4XKMA 3NEVA 1MVYA 5FA5A 1Q3NA 4XZBA 1W31A 3GNPA 5HNUA 3C86A 3BJTA 4UFJA 2IQ0A 2D24A 2Y8KA 2ZVIA 4H9ZA 4AB4A 3QOMA 1OVDA 8XIMA 5CSRA 5JMUA 2VDIA 4DNHA 1CT5A 5I03A 2J79A 3LQGA 1KKRA 4H9MA 3AMLA 4Z0SA 1FFRA 3WQDA 1SO4A 5CQ1A 3TA9A 2PRMA 5G4WA 4PTMA 1UZDA 3IGUA 1Z44A 3WJXA 2ZUSA 3TYCA 4RXFA 1JYXA 3NFUA 1H7RA 4JFWA 4LC8A 3L4UA 3VFLA 1PPIA 4H3DA 1SO5A 3KAOA 2VX7A 1VBHA 2A7NA 3VNZA 3CEPA 2Y5EA 4HVXA 4M3PA 1HP4A 3CUZA 3TCSA 3WQ8A 1M6JA 1W9DM 3CO8A 1XLFA 3WBXA 3UR5A 1HF6A 3PHAA 4C6KA 3ABSA 3UD6A 3C2YA 3A3HA 1HN1A 3KX6A 4BS0A 3RPTA 3C4UA 3AYRA 4NT0A 2QEZA 4O1AA 3GXMA 3T8QA 2VDGA 1BTMA 1YDYA 2GVEA 3MT1A 3VABA 4E5TA 3T9PA 3TAOA 5DMNA 5EFFA 1XPGA 3OBEA 3W02A 3FY1A 1EBGA 5TBOA 5JU6A 4M19A 4MDOA 2EG7A 1GJWA 3AIEA 2CETA 2PWUA 2PB1A 5AC4A 5J04A 3HG3A 4H41A 4HYRA 3ARWA 5HK4A 3WL1A 5C70A 4B16A 3MUIA 2OQYA 4GG9A 3CQHA 1WV2A 3T40A 3M7WA 1IYXA 1Z69A 5A95A 1U1UA 5D8ZA 1H7NA 1VYRA 2DSVA 1M04A 1DOSA 1MUCA 4KIEA 3AIVA 2EAWA 2WJZA 4AY7A 4KCTA 4NKCA 4TMCA 1XC6A 1C29A 1EEPA 3M9YA 3ZZ1A 1I0DA 1M65A 3IJ6A 1BVNP 2F84A 4AHQA 3F03K 4YHEA 1GVEA 7XIMA 5H8UA 5K9DA 3W1NA 1RV8A 1WDRA 2JGYA 3VGBA 3WDQA 3UQNA 2AAAA 5DXXA 2VP8A 5KTLA 1OFRA 1PZ0A 1UOKA 4NJGA 5H6HA 3AIQA 1W1ZA 4HGXA 1GT8A 4DX3A 3WFAA 3AO0A 3PUEA 2I16A 5G5IA 1SZEA 3AXXA 3MANA 3ATZA 4L6OA 3BH4A 4JN8A 4LUJA 1R3YA 2FZNA 3CASA 3KTSA 4MKSA 3VGGA 4LCSA 4YWIA 1B9ZA 1QHOA 4Q22A 4Z1DA 4C6DA 2Z1WA 1S39A 4B15A 2OKOA 1YHTA 4W85A 5DMLA 3RLVA 1GQJA 4O4VA 3BQ6A 6TIMA 2Q8ZA 1NIUA 2VT0A 1P7TB 3T0DA 4AUBA 1VRDA 1CCWB 4W8LA 1TMQA 1A5LC 1RY0A 3A3WA 1A5OC 1V7AA 5G2IA 3T44A 3N9SA 3UGVA 4PMNA 4ADSA 1I2PA 2YOCA 1EHAA 1MZRA 1IT0A 1HJQA 3H2OA 4E4UA 4MZYA 2CHRA 5CJ5A 1B3OA 2WOQA 4E6MA 1VBJA 3GSMA 4R53A 3VM5A 1WOBA 4CVWA 4QROA 5IBXC 2OEKA 4PZVA 5CC5A 1BWVA 2V3FA 4PEEA 3GXTA 4M24A 3CHVA 1DQWA 2G50A 4F2UA 2E8ZA 1Z42A 4GVFA 3FHAA 4U2YA 4U28A 5ABFB 3L5AA 1VKFA 5K9CA 1QI2A 4OIFA 3WUGA 1UH2A 4N9CA 2O0TA 2J24A 1RQEA 3BLEA 1J0IA 4DI8A 5EKYA 3EDDA 3LV6A 3QGKC 3WMCA 2H90A 2W92A 3FA3A 4L64A 5AZ0A 3H8AA 3QF0A 2CZVA 4OJYA 1MNSA 3N6QA 3M7SA 4INFA 1LBLA 3FV9A 3C3UA 2CLMA 3P62A 5A6LA 3KLLA 4JFVA 4NL1A 3NZQA 4DPQA 2OGYA 4WQ6A 3CWHA 1JXKA 3JZUA 3I7QA 4NVTA 3KBJA 1VF8A 2WLZA 2WSPA 5CZSA 4JX5A 1ECQA 4GZIA 2VEPA 3ZJ8A 3P2VA 3GIPA 3KRZA 4BQ3A 3VNKA 4DJFC 1WZKA 3P81A 2NXGA 4FXSA 1AODA 1BWLA 3MMTA 2HK1A 4C1NB 4LJ3A 5T9BG 2X1SA 3JRKA 5TAOA 5GJNA 4L80A 3FSTA 1LBMA 1K9EA 2XPKA 5FF0A 4KFOA 3AMKA 2NW0A 3KFTA 4GD0A 2G95A 2Y6ZA 2XIJA 3A6OA 3UYIA 2OYKA 3VNDA 1H7WA 1BYBA 1J0JA 1HL9A 1X6LA 1LLZA 5JH1A 3B0XA 1ZLPA 2ZUMA 4JY8A 3GDMA 1CXIA 3NIYA 1MEHA 3PR2A 2ZZ6A 1OJXA 4HU3A 1JDAA 1BRLA 3DDMA 1XDMA 2WK2A 3DECA 3FVMA 3FK4A 5AKQA 3OGSA 3SQSA 4O1FA 5LNSA 2HS6A 2WC7A 4WY0F 3TC7A 2J7FA 2PWHA 3TFXA 1ISXA 3AZTA 2X1TA 1E0WA 1ZALA 3CM4A 3MBFA 5I5RA 1QW8A 5CPNA 2GWNA 3B8VA 4H8NA 3CQKA 1ISVA 3QLLA 3W71A 4MZ8A 3UPWA 2VYOA 3PPFA 1LG2A 4LF2A 1BVWA 3N3TA 5HMSA 2W6RA 3FGCA 3F4DA 5HJLA 3W2KA 3SCNA 3FA4A 4JTEA 1BQCA 1UPMB 2WPBA 4WY0B 3QMSA 3E74A 1O5QA 4XZHA 3MMDA 1E55A 1SW7A 2FVLA 2GQ9A 3B8SA 4B9YA 2VZOA 4UTTC 4IIHA 2X1IA 4YNGA 1B90A 3DN5A 4HHHA 2Z27A 2I5IA 6PTDA 4GRSA 1LT7A 3CIVA 3TN3A 1N8IA 2IKGA 3D6NA 1UZHA 3GC2A 4J40A 3ZLFA 4UCGA 2QJJA 4RPPA 3WUFA 3CV6A 1QPOA 3RITA 3EX1A 3V4BA 3OG2A 2E9BA 1DJGA 2ACUA 3UG8A 1HJSA 5REQA 2ZX7A 3IS4A 4GGHA 1S2AA 2D0FA 3RX2A 1YXCA 4IGNA 1TPFA 5D2XA 1JI2A 1UC5A 4A2RA 5GNZA 1WX0A 1NFGA 1UR0A 3NSMA 4V15A 2XN2A 4BFAA 1JF5A 3GKFA 4L1XA 4REQA 1N55A 2P0OA 3NTYA 3HPFA 3W70A 2PZNA 1C7TA 2A0NA 2QCGA 3NGJA 1XR2A 4NZ4A 2NUWA 4S3FA 4CNSA 4E2VA 4CD5A 1KRAC 1DE6A 4JGDA 2YCEA 4ZTYA 1XIMA 4I7UA 4IXHA 1ADDA 3IK2A 4R7OA 3GNOA 4AD4A 2QPXA 1ICPA 3ZQ9A 4ECLA 2E9MA 2XFYA 3Q4DA 5TF0A 3UY8A 1A5CA 4DBUA 2IPFA 2UY3A 4L65A 2QIIA 4AZCB 1FH7A 3UXKA 3OP2A 2GQ3A 1JGMA 1E6QM 4D6HA 1HVQA 2EF9A 1UQZA 3TR9A 5HBFA 1NARA 3QQ1A 4X3ZA 3DC8A 2VHLA 5DMYA 1XUZA 3DHUA 5CGMA 4DUOA 5MKGA 2Q8XA 3EXRA 2QKFA 3UJFA 3QZAA 4HT3A 1OABA 3C2OA 3IIVA 1BAGA 3RR4A 3GXDA 2F8QA 2REQA 3BAKA 1VBGA 2QDGA 1UD2A 3BOXA 3PZQA 4HMCA 1TZ7A 1AW2A 4U4MA 3G1XA 3C2FA 2PC8A 4JCLA 1ZP3A 3SURA 2X41A 2ALRA 5IHSA 1XH1A 5D2VA 1Q4NX 1QFEA 2J9YA 4H7CA 4M56A 1BF2A 1JIBA 3A47A 4GIEA 3TTOA 3IIOA 1W1TA 3BAIA 4Q8MA 1EZWA 3LENA 2YX0A 1F8IA 4GVIA 1R7OA 1GOIA 4HU0A 3GDLA 1DQUA 2OELA 4ZO9A 5BYWA 3OLGA 1NELA 4CQCA 4CQ9A 2JKEA 3RHGA 2FH8A 1R8LA 3LD5A 5A6MA 3TW9A 3HJEA 4JDYA 3K4WA 3PBWA 1UW9A 4UTWC 4LAOA 3BJSA 2YB4A 3LHWA 1M03A 4Q3MA 1FWAC 2AOSA 2J6VA 3NPXA 2HV5A 1OFPA 3SN0A 3T2PA 4K68A 1QPKA 2ZA3A 4YHGA 3WQ4A 3PTQA 1KWKA 2X05A 5AYYA 2XVPA 3GVVA 4F0HA 5EBAA 2D0HA 1ODZA 1P0BA 4X2PA 4JPGA 1TR1A 1S38A 4PTXA 2NX1A 3A13A 1PAMA 3L4TA 3S5SA 2C14A 4D6DA 5DEZA 4LOCA 1N8WA 2FFIA 3H53A 3NWRA 4H2HA 4GO8A 3CU2A 3G6LA 2R1KA 3MO4A 3UXLA 1PYFA 4IMEA 4QSFA 2PZ0A 2XZ7A 4S2CA 3WNKA 4CN1A 1UWQA 2OWWA 1PYMA 2EKCA 1KXHA 3AHVA 4R7JA 3S5NA 1XGZA 4JY9A 3HV9A 1S2WA 2TPSA 3WDPP 2VFHA 2HXUA 4OHQA 4K8EA 2HDJA 1Q6DA 4GUHA 3DKJA 3IUDA 2WHKA 2YPIA 1EBHA 1AJ2A 4XZLX 2JF7A 3UR7A 3EWXA 2XIQA 4ZGYA 3W9ZA 1UD6A 2CYGA 2WO5A 3SCTA 4KWSA 1OCJA 1BQGA 4LCQA 1V93A 3IANA 3G1DA 4PSRA 4KWVA 3C3NA 1A50A 2Q6ZA 1PEZA 1PO9A 2O56A 3W22A 1KXQA 2BWGA 2B7QA 2XM2A 1SO3A 4Z42C 1Q6GA 2OSWA 4DF0A 2WV8A 2ZZ7A 1GKQA 3FN9A 1Z6KA 4JTRA 4AZ6A 4FF7A 2YL8A 4UMAA 2Z24A 4V2XA 5C8BB 1YDOA 3A9IA 1VJZA 3HTWA 2E7FA 1KV5A 3TTSA 4Y9OA 4YCPA 1OZMA 1ZUAX 4F2TA 4RJEA 4F0SA 1NWUA 2FPVA 3WQ6A 1GGOA 4UR7A 3C8FA 1I45A 1L6SA 1IF2A 1TJRA 3I10A 4V33A 3QKZA 4MLJA 5BRBA 2AKMA 1T99A 1W9VA 1EP2A 1A80A 1FCBA 3RRAA 1OC7A 1FVPA 3EA3A 3PJTA 3MKCA 2HZGA 3O6AA 4IL0A 1G4SA 2ABBA 4O15A 3UJRA 3P7YA 2V8ZA 4RL3A 4NAEA 3THDA 4PEKA 4WDXA 2CKRA 1X39A 1GOXA 4Q4MA 3Q58A 4EANA 3GXPA 3U0HA 3AICA 1WDQA 4Z2LA 3LERA 1WOAA 1E15A 5C7HA 1Q6RA 2F2KA 4UQEA 3ZO9A 4HPGA 1N7KA 2B7OA 3H55A 4PMOA 1V77A 3TW7A 1KR0A 1WBHA 2EPNA 4WXZA 3FAXA 3IIPA 3PBYA 4QCEA 3PM6A 1UKOA 3P80A 2WANA 4IJRA 1HKJA 2FZMA 2FZ8A 1YBQA 1FWJC 1DWIM 1IEQA 4U3AA 2X8RA 4KERA 1F61A 4D8AA 3TQKA 1UH4A 3V5FA 2ASHA 1XD0A 3GHUA 4QIUA 1JULA 3LZ3A 5G1TA 1US2A 2GDVA 3LMYA 1ODUA 3DFYA 4KEVA 3GTHA 5CZ0A 1WO2A 2Y0FA 2Q01A 3EOOA 3RNDA 4LPCA </