3FA4A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, triclinic crystal form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
291
structure length
284
Chain Sequence
PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
molecule keywords 2,3-dimethylmalate lyase
total genus 100
structure length 284
sequence length 291
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa4A00
2V5JA 1KC7A 1DXFA 1S2VA 1AQFA 1O68A 4IP7A 3EOEA 1OY0A 1F61A 3ME3A 4LSBA 3OYXA 2HRWA 2XZ7A 4QG9A 3FA4A 3QV7A 2XZ9A 1PKMA 3LG3A 2E28A 1S2WA 3KTXA 1UJQA 2VGFA 3KHDA 3HQOA 4DRSA 1MUMA 2HWGA 3PUGA 4FXJA 3MA8A 4KRZA 4TV6A 3GQYA 3U2ZA 2VGBA 4L9YA 3OQ8A 4QG8A 3VAVA 1GGOA 4MF4A 1XG4A 3BJTA 3G2GA 4ROQA 5TAOA 4IQDA 2BG5A 4G1NA 4L80A 1E0UA 1PKYA 3SRKA 5JVLA 4YJ5A 3T0TA 3QZ6A 3E5BA 3EOLA 4HYVA 4B5XA 2L5HA 2ZE3A 4MG4A 1F3WA 4KCVA 3QV9A 4B5SA 1PYMA 4KS0A 3P0XA 2OLSA 1U5HA 3QV8A 2G50A 1M3UA 2R82A 4HYWA 2DUAA 2XDFA 1XG3A 1O66A 2KX9A 3QLLA 4L7ZA 3I4EA 4JPGA 3B8IA 1E0TA 1VBGA 4B2DA 3E0VA 2X0SA 4L9ZA 3QV6A 2VGIA 4IMAA 1JDEA 1IGWA 3FA3A 1M1BA 3QTGA 3T05A 3HQNA 1PKLA 3PP7A 4B5UA 3OYZA 3SRHA 3BJFA 2VWSA 1A5UA 3H6OA 4QG6A 3LYEA 3SRFA 4KCTA 3GR4A 2VGGA 1DQUA 1F8IA 3M0JA 1OQFA 2VWTA 1F8MA 1U5VA 1O5QA 1ZLPA 1VBHA 3SRDA 1A49A 3M0KA 4B5VA 4B5WA 3HQPA 3T07A 4TV5A 1SGJA 1S2UA 1PKNA 3E0WA 4RPPA 1T5AA 2HROA 3R4IA 3N25A 4B5TA 1IZCA 4IQEA 2WQDA 4YNGA 3IS4A 1A3XA 2QIWA 4KCUA 3QQWA 2DIKA 3GG8A 4B2DD 1DIKA 1F3XA 1KBLA 4QGCA 1ZJHA 2HJPA 1A3WA 1S2TA 4WJ8A 4FXFA 3EOOA 1DXEA 2V5KA 1Z6KA 4KCWA 3EZ4A
chains in the Genus database with same CATH superfamily
2PPGA 3NZ1A 1EH9A 2VEMA 2D24A 3O6YX 2DGAA 3L9CA 4P7LA 4J3UA 1L6GA 7TAAA 1JPKA 3ENLA 3GYCA 2Q02A 4MOZA 4QHRA 5G4WA 5G2IA 5DBTA 1UKQA 2DU2A 2A4AA 1H1ZA 1XH1A 3IARA 2GDUA 4B9YA 1BYCA 1X6LA 4I6VA 3MHGA 1FWFC 4M6VA 1GW1A 3S83A 2PBGA 3SUSA 4F66A 1HKMA 3ABRA 4URIA 3NYZA 3ABSA 3NL5A 2FZDA 2D3NA 4P2VA 1QASA 2HE5A 3BV4A 4N7QA 4IPIA 1R2SA 4M6PA 3P6LA 4CCCA 2YOCA 4IX0A 1JDEA 3LB0A 1JI1A 1JUBA 4LS0A 3BJFA 2G96A 3MVTA 1H41A 5HJLA 3SQMA 4QQUA 2BHYA 4IJBA 1CXKA 1MXSA 2F61A 2Y6ZA 1KXQA 1CI1A 3N3TA 2EEXA 2VQUA 1HIZA 3IEBA 1FWDC 3WF4A 1Z48A 4OIFA 4B4FA 4FI4A 3VNIA 2R1MA 5FAGA 2ZX7A 4I8DA 4AIEA 3VD3A 1NTHA 2VDGA 5LNSA 2TMDA 3O0FA 5T8GA 5BOFA 4EPDC 4J3TA 1TTQA 4HVXA 5IHRA 1UR8A 1TX0A 2P0OA 2FHCA 2VNCA 4H04A 1NQKA 2WVTA 3UA3A 2GDVA 4EPKA 4XO7A 3CBWA 2ATSA 2JKEA 5E6ZA 5HUPA 2J7DA 1CZ1A 1GG0A 5LNRA 4AG0A 3K8KA 3TYBA 4PTWA 3UGRA 4AZBA 5AZ0A 2WC4A 1GONA 5IFTA 1RD6A 1NP0A 4JXCA 1W17A 3QKEA 4QQ3A 1NDWA 3GE7A 4XZNX 4WJEA 1LG1A 2TODA 5FJRA 1B1YA 1B3ZA 1J8VA 4OV4A 1F4HA 3TTOA 3TTQA 4NAFB 4MUPA 1PCWA 3HG3A 3OO2A 1BF2A 1PDYA 5XIMA 3W7NA 1TA3B 4BHYA 3LGEA 2Z6IA 2QAPA 1HFBA 3PZGA 4PR4A 1RPXA 3V35A 1ZU8A 4B16A 1VPQA 3O63A 1C9WA 4DJED 4O1EA 2GJNA 3ABXA 5GQBA 4DZ5A 1IZCA 4B15A 2GOKA 1X1ZA 2IXVA 2X1TA 2OLAA 5A95A 1GTHA 1XV8A 3OPSA 3CM4A 4OBRA 2VEPA 2O4QA 2XH7A 1J2BA 3SW6A 1LQAA 4RXFA 1KBLA 5JBEA 2CNCA 2FHBA 4FMVA 1KKOA 1O68A 4UFJA 1W54A 1WXYA 4FNSA 3UXIA 4JQ3A 1BKHA 1XBYA 2VRJA 2MUCA 4H8HA 3R7MA 4J27A 2ZA1A 4NKCA 4GQGA 3SN4A 3B40A 4F0HA 4GVHA 1A80A 1XRTA 3NSNA 4IT1A 2DY3A 1LQ2A 2QYGA 3MV11 1W9PA 3GVGA 4ROQA 1KFKA 3GUWA 3M7SA 4NJGA 3QZ6A 2NVDA 3H4WA 3UYCA 4C65A 2ZX8A 5FEWA 3NIYA 1T96A 4POCA 2FZMA 3PFRA 2GL5A 3IVUA 1JZ5A 1VF8A 4MIMA 3AHYA 1REQB 3L5AA 2IPFA 3L12A 2P3EA 3W82A 2CPUA 4O15A 1CT5A 2V63A 3R5EA 1GORA 3H2NA 4GFSA 3N6JA 5KEZA 4G6CA 1ZLPA 3CEPA 1K7EA 1TTPA 1JF5A 1SUXA 3OZOA 3WNNA 1UOZA 2PDJA 4PGLA 4YMZA 3MC5A 3Q94A 4DJFD 1HZYA 2V8ZA 4MB1A 2XN1A 3W73A 3KBJA 1UHVA 2BVYA 4PMDA 2AL2A 3FEMA 1JPHA 4L6OA 1Y5XA 2PA6A 2PP1A 4QLLA 1XGEA 5M17A 4CEUC 2DT0A 4HMCA 1PAMA 2VC7A 1VGAA 3BK0A 3RR4A 2J6XA 1P43A 2VFFA 4YCOA 1H7XA 3LDVA 4O1CA 2PUZA 3S2MA 2XN2A 1WPCA 3QMSA 2W63A 9XIMA 4O12A 3SURA 4Q32A 3LZ3A 3R25A 4JBRA 2QZRA 3MKCA 1I9CB 2QUNA 5G2HA 2XVGA 3VI2A 2DP3A 3REQB 1M3UA 2BASA 5ABTA 3W81A 3LGGA 4M0XA 3PWGA 2J6VA 2DSVA 1XD0A 3WQWA 3T55A 4IQLA 2PSNA 1UCWA 2XIMA 1RY0A 4OZOA 4J3ZA 1FWEC 3T81A 1SZFA 3W2KA 2CKSA 1TCDA 1XLHA 3PTDA 1PIIA 1H7RA 2ZA3A 5A6LA 1Q6OA 1W32A 4LAOA 4G8TA 5LNUA 2PDHA 4FO4A 1UP0A 1WKYA 3OJGA 3F4VA 3L65A 3WLPA 1VBJA 1ELSA 2WMFA 3RLVA 4F2UA 3TYEA 3R8RA 1QI2A 3FJLA 1CB2A 1BVWA 1NWSA 3QSRA 1X1OA 3L2IA 5LXEA 5D05A 1Z8AA 4HJFA 3D47A 1BGAA 4C6OA 2GGHA 5I24A 3WX7A 1OF8A 1F07A 3E2QA 4AWTA 4J2PA 4HCLA 3OVGA 5LGZA 4JEQA 2DJLA 1QK2A 1YADA 3MI3A 1JZ2A 1JGIA 3B8UA 1JYVA 5CC6A 4XD5A 4C6KA 3VC6A 4PFHA 2YXGA 4S3AA 3FOKA 3PULA 4J2MA 1EXPA 1D3GA 1R46A 4IXXA 2OZTA 4OWGA 1XICA 5C9XA 4YWSA 3TNOA 3WY1A 3THUA 2XN0A 4IMCA 5XINA 3GHSA 2Z27A 2YXXA 3WLOA 4MYAA 3BZGA 3HURA 4KEZA 3VD4A 3DFHA 3W1NA 3T7VA 3PP7A 1S5VA 3OLGA 1EJTC 2PDQA 3IWPA 2XGBA 4RPQA 3WQPA 1DIDA 3TR2A 2ZTJA 1OQFA 3CEUA 5D2WA 1GOWA 5AHNA 3W87A 1Q7ZA 3HMJG 3GHUA 3A3HA 3R4IA 4H6KA 2QUVA 4BF5A 4JEJA 2KZHA 4C6EA 4E0CA 4JKKA 1XI3A 4M24A 1DWGM 3CMGA 4XAZA 4XAGA 1SW0A 3N1AA 4NJJA 3TN6A 2BWGA 1P0KA 5C7VA 1QDSA 4Q6JA 2A1YA 4GI8A 2CERA 3SEPA 3MSDA 2WB5A 5HBFA 4JY9A 3T0DA 2GYIA 1UOKA 3LHZA 4FSAA 1OZQA 3PFMA 1BRLB 2VEGA 1HN1A 3GQYA 3NZRA 4GY1A 4MKNA 1FWJC 1ME9A 1R3WA 1WZLA 1GZJA 4IJRA 4BI5A 4DBSA 1QHOA 3LD5A 1BWKA 3W85A 3NEVA 2QDGA 1LOQA 1G01A 3AIRA 1GZ1A 3R89A 2DVXA 4E4FA 3TW7A 4W86A 5G2WA 3C2EA 4O0QA 2R94A 3PG9A 4P61A 4TTUA 4QCEA 4JX6A 3NYDA 3FYOA 4RNJA 4QSHA 1X39A 3LS9A 2NQJA 1NF7A 5H6HA 1EHAA 1PWLA 2HNHA 4PMQA 1UZ4A 4OU1A 2IPJA 4HB7A 1M9HA 4C1NA 3CUHA 2VQTA 1WDRA 3L23A 3IGUA 3BO9A 5D38A 1XC6A 2UV8G 4ZOCA 2BY3A 2FKPA 3SADA 4OE7A 3CV1A 4KMQA 4TVCA 1ODUA 3GTFA 1H5YA 4TOQA 1TCMA 2WHKA 5DRIA 1POKA 4Q7IA 2RGLA 1JCNA 3VMNA 4DWSA 1ZGDA 1V4YA 1O1ZA 5AHFA 3PZUA 2YBVA 3DHUA 3L21A 1ISWA 3RU8X 3W4RA 4JFSA 3W7PA 1I75A 4QDWA 1DQWA 3N9SA 2QUMA 3AFBA 4BWLA 2WMIA 4LQ1A 4PMUA 2YYUA 4B5SA 1EC8A 5A6BA 4IGMA 3A5FA 2BOGX 1A0CA 1ZZMA 5C2XA 1PX4A 4CGTA 3H53A 1WE5A 2PRMA 4JTUA 1HJQA 4L9ZA 3KAOA 2Z28A 4HJWA 4NXKA 2PC4A 3XISA 3CO4A 3VDBA 5CBIA 2PD5A 4RL3A 3M4HA 4JIHA 4KCTA 2I7GA 4BA0A 2Q01A 3VIMA 1HJUA 4ZFCA 3PBGA 3TQ0A 4UTJA 1PKNA 3SIMA 2ISFA 5IBXA 3ZLFA 3G8EA 3PB2A 5DBUA 5CAKA 2PDUA 1HQTA 1FDJA 1DTUA 3W2NA 3ZT7A 1C92A 3LMZA 1WDSA 4LV9A 3OA3A 1XUUA 3R43A 2V0TA 3LERA 3D6NA 3ALGA 2GK1B 2X0HA 1EP1A 1MVYA 3BSHA 5CPQA 4JTDA 3TCEA 2D2HA 2KAUC 1V3LA 3TA6A 1FFQA 3WDJA 5LIXX 2VM8A 3B06A 2WQPA 3UJRA 1R87A 3C86A 2GLKA 3CGTA 1SZNA 2P53A 1P7TB 4PMNA 5FEZA 1HKIA 1XYZA 5I23A 1SPQA 5JVLA 1VFTA 1PB0A 2ZVRA 3ZIZA 3T0TA 2GFTA 2YB1A 2I57A 3DFPA 1W0MA 1AL8A 3PG8A 3VIPA 1D8CA 1JZ6A 3TZNA 1B9ZA 3ZO9A 5HDRA 1ITUA 1J01A 3MHFA 3H2MA 5C8BB 3OZMA 5AC7A 3V5CA 4K7VA 5FL0A 1MEHA 1V3MA 3NL3A 4F40A 3WF3A 2B31A 3CPUA 1XWYA 1G0CA 3TOYA 3WYZA 1TTIA 4JL1A 3VOCA 4S3DA 1HVQA 4UTTC 4Z42C 1W3LA 4HD5A 5HJYA 4DYKA 3GH7A 2Y5JA 3VMOA 3V5FA 3GX9A 3SCWA 2WNQA 3AMCA 4Y90A 5A8QA 4IMDA 4Q8NA 3U3HA 4Z1DA 3S0CA 1W5QA 1UYQA 3D3AA 1GHRA 1PDZA 4QSFA 4YTRA 3TFXA 3WL0A 1WBJA 1FWSA 4WCJA 4PN2A 4GKTA 1K8XA 1HL2A 1SSDA 5L9FA 4AZCA 2PP3A 4GQRA 4S3EA 2E1DA 3O15A 3WK3A 2EPNA 3W37A 1TR9A 3C6CA 3WH5A 3A6OA 3LCFA 2W62A 1C91A 1HF6A 3H4XA 4HTYA 2J7FA 4A35A 3UG3A 2FJUB 2O55A 2OXNA 3VZYA 1F76A 3GDMA 1T41A 3R0KA 1SJCA 1DVJA 1UW9A 3NJ3A 2BX7A 3NGJA 5KTLA 7ENLA 3S9YA 2DIEA 4C60A 5IFPA 4D1JA 1A5CA 3CZ8A 3FNDA 2XIJA 1Q2RA 4DUOA 3G24A 4NYUA 1OK6A 3DH7A 3G6MA 4PUKA 4M1RA 3F03K 3SCUA 2A7NA 1WDQA 1EGVA 3DYOA 2FZNA 3W75A 4LAKA 2V9DA 4WZHA 2BP1A 5E0FA 3LA4A 1P4CA 3GK0A 4JYFA 1KFBA 5BMXA 1KV8A 4GINA 4L1GA 1S3TC 4UCGA 1QWGA 5T9BG 2XIBA 2EPLX 1UD5A 2PZNA 3A22A 5GJNA 4LXFA 4F4RA 3CO8A 3C56A 2QAFA 2OX4A 4DBDA 3NEHA 3QMRA 3QFWA 1E1EA 3AYVA 1A3HA 3VCRA 4C6FA 2J8GA 1K9DA 3G22A 1XYLA 3WLTA 4YTQA 4KEUA 1VHCA 2NZLA 4MM1A 5I3JA 1K02A 4ZQMA 1PKMA 3H26A 4GC3A 4E5TA 3KHDA 1PHWA 3VDAA 4ZENA 4QJ4B 3AHVA 4Z1YA 3ALFA 4EPEC 1C7TA 1PCKA 2HBVA 2CU0A 4NZFA 4IL2A 4N4QA 3UZWA 2J79A 3E3HA 4H9TA 4D6CA 1IWBA 3FKKA 3TTEA 4M6QA 2XVPA 3TMLA 1NM9A 5G1MA 2XGZA 1P0NA 5CPLA 3BAWA 4N9BA 2HVMA 2GJPA 1HKJA 3A64A 1GQKA 1K9FA 3KBSA 3BE7A 4Y9MA 4C6NA 3NDYA 1GVQA 4HNTA 1JNDA 3A23A 5CCZA 5HXMA 1D3CA 3B0PA 5AHEA 3ZVHB 4FLQA 4CU8A 1VD6A 4AQLA 4WKFA 1A0DA 3C3NA 3T07A 4WX2A 2H3BA 1QOQA 4UFHA 1F2JA 3L4UA 4W8LA 3IGSA 1B3YA 1UD2A 3K8MA 3EMZA 2EF9A 2GJXB 2ODOA 3BG9A 3ZYZA 4HCHA 4UMBA 4Y9NA 3QQ1A 1QPQA 3W1QA 3MDWA 3LHVA 2X2GA 2E1WA 2VZVA 1ADSA 2ZUVA 1FWRA 3GNNA 4PTNA 3FA5A 4UFKA 1OGBA 1YW1A 1XBVA 3NCOA 1Q6QA 3OW1A 3S6DA 5A8NA 1J5SA 2NVCA 4DRSA 5CSSA 4CQ8A 3UY8A 2FPVA 4M81A 4XKYA 3W22A 1T6MA 4XAFA 1H49A 4HNVA 4REQB 3JZUA 4UCFA 3CWHA 2ZE3A 4C6MA 1PSCA 1HW6A 1J93A 1XIDA 2E68A 4Q6XA 2ZZ4A 3WK2A 1A5SA 3U2OA 4FIQA 4RE3A 1JYNA 4PL2A 3T0CA 4JPGA 1PHQA 2BOEX 4Y9PA 1WZKA 1EP2A 1DJWA 3T0AA 4IMAA 4GUFA 2IS7A 1Q6CA 3GU1A 1J0IA 3M44A 2WSYA 5A3HA 4EXBA 1AJ0A 2Y89A 3N14A 2FMNA 2OKOA 2XJ7A 2QCLA 2DZWA 1EDGA 5FF2A 4W8BA 4C5ZA 2PDPA 1JG9A 1ISVA 1XLCA 4M56A 4Y9AA 3OGRA 2HROA 3VINA 1OWQA 5TQLA 1US0A 4GC4A 1UKPA 1W9DM 3IIOA 4LUYA 2EO7A 3OU8A 4JIQA 3GW3A 4HZMA 2VYOA 2WYSA 2X2YA 4Q22A 4ACYA 4DZIA 2PTYA 3BLPX 4DWSC 1D9EA 1UJPA 1QWKA 2ZZ7A 3OVRA 2XM1A 5HOSA 2NXHA 3IJ7A 4D6IA 1J0YA 2O92A 3SCTA 1WNOA 4ZSUA 1UD3A 2J13A 1MNSA 4UR7A 2WMJA 3BLKA 3GM8A 3TNBA 1JAEA 3GFZA 3QGVA 1VFHA 2EPKX 4CN4A 1Z89A 5EMMA 4XX6A 5AY7A 3B9DA 4BKNA 4MJ4A 2PFHA 1XHGA 2CZDA 4PC8A 1G4TA 2QMKA 5BU9A 4MSSA 3HB9A 4IZGA 4JNZA 1RBAA 3T40A 1EX5A 5EMJA 5ECUA 5FF0A 5C70A 1GW9A 2IQDA 3SRFA 4KPLA 2I1OA 1EO7A 1UWSA 3W1MA 2WMGA 3TLQA 1M7OA 1OG6A 3ABZA 3FKRA 4CQ9A 5FJIA 2POTA 1Y5WA 3D5HA 1Q4WA 5I79A 4S38A 3WD4A 3BMXA 3AS0A 3WH6A 2I16A 1M01A 3IIZA 2CXGA 3UJ2A 3TYAA 3THDA 1GQJA 3TQPA 3GXDA 3NUKA 2ACRA 4MHBA 1GPWA 2V5LA 3S5YA 2Z6JA 3U7BA 4AXNA 1ZJBA 1JD9A 1PX8A 2E8ZA 3FYYA 4EXAA 3QH2A 1QPNA 4IPLA 4D6FA 4FF7A 3J7HA 1F73A 2ZRZA 4QS5A 2VENA 1G1YA 1UA3A 1PXGA 1WKDA 3UZJA 2CLPA 1UZDA 3GO2A 1IWPA 3N2BA 4UNIA 4ALDA 2YZRA 3ECQA 3RUBL 4QP0A 3LLFA 4X9YA 1UBSA 4PMRA 3UJEA 4AVNA 1WAUA 2PB1A 3G1RA 1TPVA 1B3OA 2ZUTA 2QVHA 3QHOA 3WH7A 3TTSA 1C90A 4NZJA 3LNPA 1R86A 3EA2A 3C2VA 5HNRA 4I6KA 2X0SA 4PUMA 4PRTA 5AYZA 3EB3A 1RA5A 3AMLA 3OYZA 1K4HA 1SO5A 2F6KA 2QGYA 4J3VA 1J6PA 2NQZA 3LSCA 4ORIA 4HNUA 3HGJA 3BGGA 3LU2A 4Z2GA 1SZEA 3S1XA 4JHMA 4ERIA 1Q5MA 1TG7A 4R34A 1FQ0A 3GW0A 2DT3A 2GOUA 3ATZA 1NF0A 3EWXA 1OVDA 2BY0A 2QJNA 1S1RA 1M41A 2E3ZA 4IXHA 1H4PA 3DG3A 4D1IA 1Y8BA 2B0MA 5BU6A 2V5KA 1H0GA 1DHPA 2QXWA 4F0LA 3DZ1A 1ISZA 2QV5A 1DWIM 1EF3A 4JYDA 3C4UA 3CQIA 4HZ8A 2CLKA 2WJDA 4GA8A 3SY1A 2WMIB 4MZ8A 1ADOA 1XR2A 2GGJA 2YA2A 5KINA 1QT1A 3IVSA 4RZ5A 3W3OA 4GI9A 2BDQA 4MJZA 4WQ6A 4F48A 1JQXA 1E6ZA 2WNWA 5F2GA 3N18A 3WQ8A 2Y7EA 2Y5SA 1YXDA 1D8WA 4JTRA 3TEVA 2QCDB 2QEZA 4IOTA 3UG5A 1L0PA 4W5ZA 3IACA 4IMGA 2YCIX 4FK9A 2ABAA 3SZ8A 3P5YA 2P8BA 3UW6A 1BD0A 3ONBA 2VWSA 5JXQA 5BMWA 1EKOA 4UBPC 3ORWA 4F9JA 3RM9A 4B92A 4LYQA 5EL1A 1S38A 3Q37A 4KETA 4OHQA 3H70A 3V1HA 3EX6A 4F3HA 2XSAA 4UTFA 3UWVA 1W1VA 2DUZA 5G4EA 4KIEA 1GCYA 4GJJA 1GYLA 4AB4A 1TIMA 2GGIA 2VTFA 1LLOA 2D69A 3DX5A 3ARYA 3RRXA 3GFXA 2RKXA 3B9AA 2TRSA 1TMLA 2WSRA 3BLEA 3LPPA 4OUEA 2QV4A 1XH2A 2WMKA 1GZGA 1H0IA 3UR7A 3EOEA 4GABA 3ARRA 4LPCA 4AZIA 5EA9A 4RR4A 1LTDA 2V81A 4LS2A 2OEMA 3L68A 4HK7A 1UJQA 4DXXA 2EJAA 4ECLA 4J4KA 3M6DA 5D2TA 3MP4A 1CX9A 3ABOA 4O50A 2J9ZA 3AROA 3MB9A 1SQ7A 4I9MA 4M7TA 4FOJA 3VGEA 3B8VA 4JTEA 3RR1A 2HSAA 1YE6A 1ZQ5A 4X2PA 2JF6A 4HU4A 4LC8A 4O57A 5F2LA 2EKCA 3MP5A 1ZALA 3P0XA 2YR1A 2XG9A 1LT8A 3TIMA 4P7OA 3BWWA 4L5ZA 5K9CA 2ZZ2A 4TX6A 4C6QA 1KGXA 2YFNA 2DUXA 1PPIA 3N4EA 4E2VA 3LHTA 1EYWA 1I1XA 4M19A 3EDKA 1GUVA 1RV8A 4U28A 4CD6A 3S9ZA 3KEHA 2OT1A 3LOTA 1GHSA 2CLOA 2OCZA 4QXIA 2VGGA 3AALA 1K7XA 3DU0A 4FX8A 2GPTA 3VFCA 3G1XA 2AMGA 3G8RA 1EOKA 5BWFA 1PZ3A 3WZ0E 1Z32X 3P5ZA 2EPHA 4UMAA 1TWSA 1BEUA 3TKFA 1TR1A 3VMPA 2V38A 3KVLA 5A1AA 4MZYA 4FAMA 4GH1A 5D8ZA 3LI0A 5BYWA 4ZO7A 7TIMA 3BZJA 3UZYA 3QXBA 4M1BA 2CLHA 4OBTA 2NQ9A 3OODA 4OBSA 3LTPA 3BL3A 3FIGA 1HTIA 3QHNA 1AQMA 2O7SA 2V5DA 3GR7A 1VHNA 3UY7A 4ZSTA 2PDCA 2CLIA 3BW4A 1DKWA 1LWHA 4MB4A 4CD8A 3VCCA 4CLMA 4LVFA 2BGSA 2BV9A 4XAPA 1O6IA 1R3TA 1VIWA 3PJUA 2OU4A 2ASHA 4PULA 1I0DA 4C1LA 3N29A 6TIMA 1TV4A 3KOFA 2R1LA 1XFCA 2EBNA 1J10A 4WRHA 3B4UA 4HPXA 3ANVA 2EGZA 1H62A 4GXPA 1X1NA 1UR2A 1XRSA 4GQBA 4IP5A 4OQVA 1EUAA 3WFLA 3TYDA 4ZXOA 1P5BA 3WJZA 3AHXA 3ZJ7A 2ZX5A 4E8GA 1X8FA 4MGGA 3MZNA 1Z42A 1QU4A 3PB0A 2BGNE 2QIWA 3A9IA 4KCUA 1DYSA 4DWSB 4LU0A 1WZAA 1EB3A 3L0KA 3LTSA 1T99A 4AZCB 2CW6A 2VC6A 3VIFA 4BK9A 5BXRA 1MO0A 2ISSA 5EU9A 1PO9A 4CD7A 4KH2A 4AU0A 3VNLA 2V30A 3MKKA 3VU2A 1AH0A 3L4WA 1UKOA 3CHEA 1CLXA 4LRSA 1BG4A 2DZPA 3LEPA 3U4FA 2XINA 3ZR5A 4O16A 3KOZA 2YLAA 5JIPA 3UVIA 1DEDA 1JCMP 1CB7B 1BSLA 2GQAA 1H2JA 2PDBA 2PLKA 3CIXA 1SO6A 3PSVA 3SBFA 3MJYA 2NSOA 5DY3A 3G3DA 3UR5A 1E0WA 4EF9A 3AUJA 1RAKA 3UNTA 2ZRUA 2Z26A 3GBEA 3TA9A 4NJKA 4I7WA 3W2JA 1NDVA 1QCWA 3IIXA 4NF7A 3POHA 2R91A 1ODZA 1UUMA 1F8MA 3QMTA 5CJMA 3RHGA 1OCQA 3TV8A 4X2RA 1GVRA 4I90A 4R88A 3AXXA 4WF7A 4PBFA 3F4DA 4TQTA 4PTVA 1E9ZB 1DORA 1MW3A 4MADA 4LAUA 3P2VA 5KSWA 1XL9A 5D9OA 2QCHA 1Q65A 1F3XA 4V1YA 4Q8OA 1AZ1A 2WZIA 1UKSA 4WSKA 3OLDA 5K3VA 3UD6A 2J7HA 4NZ4A 3ARXA 3MMTA 3UG8A 3EB4A 3LQLA 3E0LA 3SQLA 1R6WA 1G6CA 4DWDA 3R13A 1LF1A 4FF5A 3GDKA 3QPYA 1H7OA 3ZWTA 4N9CA 3WG6A 1D2KA 3O6CA 2GQ9A 4I3GA 3N2XA 1G94A 4U4MA 4AX6A 2CCRA 4HA1A 2CWXA 4MNJA 3AIEA 2C1GA 1YE4A 1ZB5A 4AMCA 1M7PA 4YS1A 1L6YA 1JCYA 1FWNA 2RDTA 3LN3A 1DE6A 4XUGA 1ZFJA 1S5NA 5K7JA 1ZY9A 3SCSA 1W37A 3U48A 4GIEA 1VLWA 1QNVA 3DHDA 5FF4A 4XZMX 2X7WA 4OECA 4IIBA 1CNVA 4ZA0A 2FVMA 3B4YA 5A6MA 1P0DA 4R7JA 3CQKA 3EX3A 1LWJA 1YQ2A 1KCKA 4K8HA 1K4GA 4ATWA 1XXXA 3AXIA 4N6FA 3N11A 4UFLA 4GIRA 4Y9OA 1NDYA 3VNKA 4L6DA 1RJRA 2J74A 3WIJA 1XGZA 1KFCA 1F4AA 5M5DA 3PUOA 1IXOA 1HX0A 2G3FA 3PBMA 3WF0A 2VC9A 3S6OA 5D09A 1YTKA 4PH6A 1S2WA 1Q66A 1SYTA 4AHQA 4IIEA 3CUFA 4FX7A 4L9YA 3VAVA 1K8CA 3H12A 1P7TA 1E6SM 4DEFA 5DXYA 4IGNA 1W5OA 1B3XA 4DJDC 3VILA 2CHRA 3UVAA 1UC5A 2GJRA 1CW2A 2VR2A 2E09A 1ONWA 8XIMA 5KITA 2FH8A 4ACZA 4J35A 1Q8JA 1VIZA 2CBIA 4JQ4A 3DG7A 4WR3A 2XHYA 1N8WA 2V3DA 3AHTA 2IKGA 4U31A 5M1TA 2WWDA 5XIAA 5A8GA 4GI4A 2C19A 1P1XA 1K3UA 2DH2A 3IUHA 4CNNA 3CTTA 4D2JA 5AVHA 4I5RA 4QJ5B 3WMSA 4CU6A 4WKHA 3WFZA 5D2XA 1J2WA 4OUIA 1Q6FA 4XB3A 1RPKA 4PUEA 4JKLA 1EJSC 1X97A 2ZRXA 3DBPA 1UROA 4E2BA 5HMDA 4DPQA 2NSXA 4XQ6A 3WJYA 5FF3A 3E9AA 3GVVA 4LOCA 4ENLA 4PYSA 3V7PA 1NDZA 4DF0A 5CKSA 3NL2A 4GISA 2FJKA 4MLRA 1E1FA 1A4LA 1AG1O 2IKIA 4IIDA 4GYPC 4M6UA 4BQ3A 3DFTA 1KCXA 3F5JA 1FDZA 5D32A 2WVVB 4LB3A 3LM3A 3LV5A 1AW1A 2FPYA 4HNLA 1V79A 1JXKA 2DW6A 1J11A 4K1GA 4NVTA 4X63A 1TJ1A 4JTKA 3ITYA 4NRSA 2W91A 3GHRA 1PIFA 4MFEA 3T05A 4HOWA 2HQAA 5BXTA 3VOJA 1XLDA 4FR1A 3A3XA 1KWGA 8A3HA 2B7NA 4E3VA 3M0JA 4BEQA 1Q8AA 2E5CA 3NOYA 4JN8A 1OZMA 1AH4A 3GH4A 4A8IA 3CV7A 1FWHC 1TWZA 2ZUSA 1I4NA 5HINA 1Q45A 2OQHA 1RQBA 4AD0A 3IS4A 2A5HA 2E40A 1ME7A 2VR5A 4S2CA 3CPRA 2A85A 3SRHA 1M5WA 1TO3A 4LVDA 5CH9A 3URAA 5H8PA 3EAUA 2NVAA 1QW7A 4UFIA 1OF6A 3GKFA 4C5YA 4O13A 3F4CA 4A2SA 2NT1A 2V67A 4KW2A 2FMOA 2C0HA 4JTGA 1CIUA 2QVNA 3IV8A 4CCDA 5E5CA 3OBKA 4L80A 3O2LA 4OV9A 3PWIA 4IUGA 4JNMA 5D37A 4MG4A 1PYFA 3QV9A 1E6RA 1J79A 1TX2A 1XIMA 4DUVA 4F2BA 3HBLA 3HIJA 5FOOA 1DWJM 4R9OA 2H6RA 1H3GA 4GYPA 3W7RA 5F1VA 4ICMA 3HFYA 3GY1A 2D2JA 2QJGA 3D0CA 4NSBA 1VFUA 1BYDA 1BXBA 2Y8KA 5ABFA 3NQ2A 5HMFA 2FYMA 5HPOA 3SRDA 3P14A 1H60A 1SFJA 4DHGA 4D6EA 3WBXA 1JD7A 1WQ5A 4QJ1A 5DLCA 3AU6A 1E9YB 2IKJA 3HGSA 3S47A 3BICA 3B03A 1E1CB 4GVGA 2QPSA 3BCDA 1XSKA 1JFHA 1WXJA 2QR6A 1LL4A 3RMJA 5BOEA 3N3MA 1WDWA 3OBEA 1QVBA 1SVDA 4WVXA 3HPSA 3AYSA 1DJZA 2PDYA 3QR1A 1J18A 1ISXA 4UQBA 3BG5A 1SO3A 2OWXA 4GNKB 3SY5A 1MW2A 2YDAA 3H2EA 1E72M 4PTXA 1EJVC 3DC8A 3CUZA 2V3EA 3TUUA 4W93A 3WLNA 5TAOA 2FHFA 2OZ0A 4PUNA 3ZVHA 1PJ9A 3O6AA 3LNMA 2YCEA 2O9PA 3QJAA 2FVLA 4G7EA 4KGJA 2GJLA 4H6EA 5I07A 3M5XA 3SUUA 3JUGA 2G50A 1ZJAA 4D8LA 1F9CA 3JR2A 3SCOA 1WAWA 2KX9A 2XIOA 5DELA 5HA7A 5CLWA 5EYWA 4GE8A 4RDYA 3FFSA 4XBSA 4XD3A 3NDOA 4JGDA 3CH0A 3TYCA 1WP6A 2CWNA 2V5BA 3W7EA 4H8UA 1CBGA 1E3ZA 3QY6A 4JZ5A 2Z2AA 4MJMA 1IT7A 1N8FA 1ONEA 4UQAA 4OOUA 3I10A 2BY1A 2G4FA 1XRVA 4QDMA 4DI8A 4YVXA 3MYOA 1EIBA 4UTUA 3UA4A 3MYPA 3W1TA 4YNGA 3MSYA 1Q6GA 2QF7A 1R3YA 4UQCA 4LYRA 4RK8A 4KWVA 2CKRA 4OKDA 5I5RA 3A13A 3SFWA 4ROPA 4KKXA 1OADA 3EOOA 1EJWC 1Z6KA 4GG9A 5JMUA 2JKAA 3OHMB 5FAJA 4ERAA 4DAFA 4UTLA 1GWJA 4GIAA 4S2BA 2QCDA 4HPGA 2ESCA 3BOLA 3H21A 2ZXQA 3POCA 1SJBA 3UZXA 5DO8A 3TN4A 1FXQA 2REQB 2F9RA 1PKYA 2WCAA 4FNTA 1RVGA 4MDOA 4AD3A 4D6JA 5LIUX 1PTAA 3LY0A 4R7OA 1JL8A 3N2CA 2R24A 2XDFA 3KVJA 2VP8A 1OT2A 2INEA 4ATLA 4PZVA 5SWUA 5CZJA 5BRBA 3LMYA 2PF8A 1QRQA 2I9EA 3E49A 3C2FA 2C15A 4C6JA 3UPMA 1JI2A 1UKTA 4YWIA 4GGHA 3KRUA 4PB3A 5BNKA 3DKLA 4C1KA 2H3DA 1CECA 3MCOA 1J12A 3MW7A 3UR8A 3V75A 2UY4A 1V0MA 4XSMA 2YGYA 4XUYA 3L4XA 2I17A 4H8NA 4NZ5A 3UWZA 2WZEA 3JRKA 1AD1A 4UIOA 2MNRA 1VEPA 5T91A 5CG0A 3TXVA 5KETA 4NXSA 1E6XM 3W7GA 4Q4PA 3GBDA 5HR7A 3NQAA 1DIOA 1TJRA 5IDIA 4NZ1A 4DJDD 4ICCX 3DOPA 3GXTA 4DBWA 3NQVA 4LSBA 3WLRA 4WDTA 3KE0A 5DN1A 1UZHA 1LDCA 1KQZA 2CLLA 4MKVA 3KBVA 3VD9A 3PZTA 1TVLA 3LCLA 4S3FA 2OB3A 4ZFMA 2BNJA 2ZADA 1NH6A 3AMGA 4W9TA 2V3FA 1VZWA 4QNWA 1QOPA 2E7FA 1OG0A 8CGTA 4RE0A 4EE9A 3GG1A 3C5QA 2OYLA 5BZAA 3DUGA 1MXGA 3GC5A 5FESA 3CT7A 3WLQA 3TMQA 3HU7A 3S5NA 4KFOA 1JZ7A 2UY5A 3EDEA 3MJMA 2PWEA 3WDQA 2ZRVA 3SECA 2I5IA 1TV2A 4ADSA 3CAWA 1I60A 3H6OA 2ZXDA 3GVRA 1QI4A 3AI0A 3W23A 4AY7A 2QQ6A 3EPOA 9CGTA 4YHGA 5G4HC 1KM4A 1O95A 3WQDA 2Y88A 5D9PA 3PR2A 4S3GA 1CCWB 1EXBA 1EQPA 5GVJA 4F0KA 1T40A 4TU1A 4W84A 4OOZA 4JTFA 2VEKA 3PANA 1UR0A 4MUZA 1LQ0A 3QOKA 2OEKA 1XDJA 4HIBA 2Y7GA 4MB3A 1VRXA 5F7UA 3CTLA 1GYNA 1KD0A 2ZKMX 4QS6A 3KP1A 3MDUA 2Q8LA 2A3CA 1KBIA 3TE9A 1YDOA 3R10A 4HU3A 1EP3A 4Q8TA 4PUJA 3GLCA 4XZHA 3L5MA 4DN1A 5E09A 1Z7AA 1CGYA 2WKGA 1JPDX 3A47A 3LHWA 4KRZA 1EIXA 2OYMA 4NJHA 1HJXA 2Z1VA 2ACUA 3WJWA 1M53A 2C18A 3TJXA 4J5NA 3U9IA 4P7RA 5CC5A 3LCIA 1TB3A 4RUBA 3SRKA 4DPPA 2VMFA 3N2MA 2D0GA 1MEIA 4BQ2A 2L5HA 3A4JA 4JDYA 2JKPA 2W9MA 1BPLB 4GXWA 3RLGA 4ILSA 3ARTA 2FQIA 6REQB 1D7FA 3U2EA 3BQ5A 3AYRA 4LEFA 2YCKX 1L2UA 3NZQA 1LORA 1V6YA 1GQLA 1PL9A 1W31A 5PTDA 2ZIDA 3ICJA 5AN7A 1O5QA 3GWQA 5C54A 5CPNA 3N13A 3GTIA 4OT7A 2W6RA 1V93A 3A21A 4TVUA 3W88A 1G7VA 3U7VA 1JDAA 3IJ8A 1HGWA 1A5BA 3ZVIA 4B3ZA 1UIOA 3P67A 1IWAA 3AS3A 4O14A 5C9ZA 2WNNA 5BXPA 1I1WA 3EGJA 4NZCA 3WEMA 2GVLA 3FDGA 2ZRYA 3PVFA 4DM2A 3WQ5A 3R0UA 4MPKA 3WELA 3N6QA 4G56A 1HL9A 2A79A 1VR6A 2DEPA 3MHUA 1ZSXA 2NV1A 5CBBA 3RNDA 2GWGA 1KTBA 1ML1A 2Q3RA 5D30A 1Y65A 3WUGA 3H2CA 3NSXA 3ES8A 3SCPA 2F6XA 4HSOA 3UESA 1TQJA 1P0EA 1IIHA 3QFEA 2PGWA 2VZUA 1JAKA 1VBRA 1BF6A 4G1NA 3CLMA 1FA2A 2WPGA 2NXIA 2ISDA 4BEUA 3N9RA 3TYZA 3VGBA 1R8LA 5CSYA 1F3EA 2PLJA 3TP4A 4US5A 3NQBA 3M0LA 4HA4A 2ZUWA 3VGHA 3VZXA 4PE8A 1JVNA 4QLJA 1IZJA 3NQDA 5C9RA 4LF2A 3ITOA 4UQEA 2INZA 3W7HA 1BKSA 2RDUA 4U10A 2A7RA 1MXDA 1VBHA 3M0XA 2HE8A 3TWBA 5C9UA 4KEMA 1OGSA 1UIPA 4QFUA 3E0WA 3IJDA 2ZZ6A 3OZPA 4FPSA 2PDXA 3W24A 1EO5A 3TYUA 1T7LA 2GSHA 2WLZA 4L56A 2DIKA 1HKKA 5IBXC 2HXUA 5F4WA 4JTHA 5D2VA 2QJJA 4H9ZA 3P8JA 2TYSA 5LZLA 3W74A 3HG4A 2WM1A 1LOLA 4WOQA 3AXHA 1W3HA 3RILA 1B54A 1DIEA 1MWOA 2QKFA 3W7CA 3W9ZA 2A3BA 3T44A 4FXJA 1F3TA 2CLMA 1TVPA 2E0PA 4QG8A 5M3WA 1T8QA 3LLXA 1V0KA 4X60A 1W8GA 4LH8A 2DSWA 5A2CA 4HYVA 4B5XA 4AZ7A 4RXGA 2QCEA 1MYRA 2ATMA 2YFOA 2RJHA 1R9ZA 4GZJA 3APTA 4QBXA 1BQCA 3W27A 2AQWA 1YYAA 3I7SA 1L6FA 1ISYA 3NO5A 5D04C 5A6JA 4R33A 4ZB2A 1KQYA 4L65A 4X3ZA 1PWMA 3ID7A 4IM4A 1AMYA 3M7WA 2BSLA 2A21A 2AQOA 1E56A 1BVNP 2G97A 1JDDA 2V68A 3BCJA 4AY8A 4M3PA 1KA9F 4GCXA 4B91A 4JIRA 1KRMA 1GOQA 1XW8A 1NP2A 5I3GA 4M29A 1TWIA 1I2PA 5KZEA 1LRQA 1ECEA 4BQ4A 4YYCA 3DENA 1CXIA 3WMCA 2ZX9A 2EAWA 8RUCA 1QNRA 2OT0A 3H23A 4XVEA 5C0QA 3S46A 1UWQA 4JX4A 4XTDA 4AF0B 2EQDA 2GJXA 4IPJA 2B81A 4WK9A 1KKRA 1XLIA 1KLZA 2VGFA 1YDYA 1AJZA 4PEEA 2GVEA 4G2DA 4FNRA 2P3ZA 3DI1A 1OX6A 5H8MA 1E4LA 2QGHA 1MFUA 3T2QA 2OTDA 4H7VA 2F8QA 1O5XA 2VFHA 1AQ0A 2Q3OA 1HKVA 3THCA 1Q6EA 3WLSA 1RR2A 1X7FA 3IAPA 1B4EA 4AZ5A 7REQA 3P0WA 3P84A 4ZOBA 3T8QA 3G0UA 1TUXA 3I4EA 4IF2A 1KFWA 2ZZ5A 3VUSA 3M16A 4AY1A 4L4LA 5D9MA 2ZUUA 3ANUA 1GNXA 4KWSA 4ZB5A 4KF1A 3E38A 3EA3A 1CXLA 3SSJA 1K8YA 2NUYA 3E02A 1GJUA 5HQEA 4AIUA 2AOSA 1J96A 3VGFA 5A8OA 5C2CA 2WCSA 1RXOB 1Q85A 1W5MA 2W79A 1OIMA 3DESA 5D03A 3WQFA 3UYIA 1FWBC 3M41A 1RCXB 3ZJ6A 4RKAA 1PIGA 3WNMA 1B90A 3AOFA 1A53A 1NOUA 2C7FA 1F74A 5M03A 5E9XA 2EG7A 5E9AA 3WDRA 1AVAA 2DQXA 3BGAA 3EZ4A 4G7FA 3CB3A 2H9AA 4LUJA 3STCA 1CGXA 6ALDA 4ZTYA 1KRBC 3T2OA 3GC4A 1JQVA 3PNUA 3EWDA 1X8CA 3NQCA 3WH9A 3W71A 4DO7A 1PTGA 2WBKA 4A4AA 4K2SA 4UOQA 3BURA 4GZEA 3PUEA 4IQJA 3VNJA 4V1XA 3M1ZA 4FLRA 3WLMA 4HTBA 4IIGA 5FIPA 1M65A 4QITA 4MLJA 1TMHA 4AWEA 1HJVA 4LW7A 3VFLA 3G1AA 1SFLA 3HA1A 2CITA 4MWAA 2E9LA 3S6TA 4LVGA 4O4WA 3PM6A 4PCPA 1NFGA 3M0VA 1W1IE 4IFOA 2WZMA 3ITVA 4RJEA 1U1UA 2D2GA 3JW7A 1WBHA 2PWHA 4S1FA 1N82A 4K8EA 2HVNA 3FDKA 3KZSA 1XCFA 1HUVA 3AHZA 4Y8FA 3RCNA 1OD8A 2QPUA 2A3LA 3DN5A 1BQGA 1OC6A 1A5MC 1IEVA 3EMCA 3UBPC 3W07A 1VB9A 1E1CA 3VPLA 4Q4QA 1L6SA 3WCZA 5H91A 3PAOA 2CYGA 3E6EA 3DAQA 2WBGA 3USBA 3MUIA 3PPFA 5J8LA 3N2OA 3O7UA 3Q2DA 3QV7A 4ZQNA 2VOTA 4XKMA 4J3SA 5DMNA 2OYKA 4C7DA 1LLZA 3KS5A 1IXQA 3G1HA 2VHLA 1DJHA 4QE1A 3LM7A 3M43A 4S3JA 3VNYA 4ZBCA 1XSJA 4XZIA 4PODA 3OBAA 3NG3A 4BI7A 5C2GA 1MDRA 4JYEA 3QOMA 3RPTA 3GUGA 4MNMA 1UD4A 3TWAA 3FW6A 2OMAA 4EF8A 4A8LA 3QN3A 3W25A 3R12A 1NVMA 1S5WA 1QI3A 4O4VA 1W3TA 3PTQA 3GC2A 1M1BA 1Q7QA 1KR1A 3VX1A 3L2LA 3ZQ9A 1X6UA 5HMSA 5MHBA 3RRAA 2YIHA 3LYEA 2XVNA 3FLUA 1OINA 1FHUA 1KRAC 1GOOA 2YB4A 3F4NA 2WHJA 1SMAA 5A6TC 1XYFA 2HXTA 4KWUA 4B5WA 1LJYA 4AD4A 3KL5A 3SAZA 3GU2A 4HNNA 1CGVA 3UQNA 3MMDA 3JZEA 5CZ0A 2H8XA 1KTNA 1MEWA 4J1OA 3S1VA 5EB8A 3B8DA 3PPGA 4UTWC 1EJXC 1XKYA 1UUQA 3LPGA 2G5WA 1FXPA 3GNXA 3KRBA 2FFCA 2V69A 3VIGA 1J6OA 2ZA2A 1F61A 1W1ZA 4RV8A 3H24A 2YCLA 4C90A 4W7UA 3FY1A 1B3WA 1X6NA 5EKYA 3KTXA 4XG1A 3I6RA 4KFNA 1MNZA 1SW7A 2WXDM 3S2LA 4Q8UA 1FHDA 3ZJKA 1NFPA 1SZRA 4HHMA 5AKQA 4MF4A 1VFSA 2XFYA 1BXNA 3ERPA 3Q65A 3GS6A 3MT1A 4GHRA 2Z1WA 3UXKA 3NGFA 3KDOA 1OYBA 3F4WA 3STPA 4NAFA 3UJFA 1DWAM 3CWNA 2WNZA 4MZ1A 3UWQA 3ARPA 3QVQA 3PNZA 4HN8A 1TELA 4RW3A 3WMBA 3IGHX 1WYIA 1XS2A 2YDQA 1XCXA 3K4DA 4ZXLA 3BGJA 1EDQA 3QW4B 2P5NA 3ZM8A 2NV9A 1OBAA 3RN6A 3KFTA 1E40A 3W70A 1ZUAX 2A3HA 2ZTKA 2YXOA 4D72A 1E5JA 2BS9A 4NL1A 3VNZA 4FLOA 4RDWA 5K9XA 4B5TA 2AKZA 3SUTA 3TOPA 2XIIA 2JFEX 3AAMA 1EWDA 3AC0A 3MY9A 4H9UA 2EPMX 3CIVA 1EPVA 1DIKA 2GUBA 1BFNA 3MUAA 4GPNA 4IGHA 3BW2A 1MQQA 2PRLA 3EPMA 4WJ8A 2CZEA 3FAWA 1EFZA 1GOKA 7XIMA 1H7PA 3NZGA 3EXRA 3HPAA 3H4GA 2I56A 4GACA 1VP5A 1A5LC 3LHUA 4IG2A 3GNOA 3C8FA 1MI3A 1M03A 4AEOA 1PUDA 3NO3A 1JGMA 4WDWA 1J0ZA 5FL1A 2GSJA 2R8WA 1TE1A 1H50A 3IJIA 5AECA 3LXAA 3RM8A 4A05A 4M51A 2E6AA 2DZBA 3EOLA 4CNTA 1JF6A 1XLFA 4EANA 1G9HA 2JBMA 1GEQA 2XWEA 3U5UA 2ZC8A 4BJHA 1VRDA 4L7ZA 4R7WA 1VKFA 1XGDA 3W1RA 2GQ8A 2W92A 3I6EA 2PDGA 3L67A 5HATA 5HNUA 4HU8A 1IEIA 3B8SA 4X61A 3G77A 4ZZ9A 2IPWA 2VFIA 2YL6A 2AGTA 4MFDA 1KM6A 3GRIA 5AC5A 4DM1A 3W6YA 3MCNA 5I3KA 1AJ2A 1S1PA 1S2UA 3A3WA 5C6MA 1LUCB 1R7OA 1ZL1A 2VRKA 1E6QM 4P8VA 2ZZ3A 3HMCA 1EEXA 3OGVA 2O0TA 4GUJA 1JEZA 4MWAD 1K1DA 2BHZA 2J7GA 1O5KA 3GNRA 2G8ZA 1AW5A 3O06A 4LX4A 3VE7A 2YCLB 4DYEA 3FSUA 2W0UA 1SW3A 2P8CA 2AMXA 1W1YA 3QW3A 1NJJA 3U6WA 3DXIA 4YXGA 2PRHA 3AIVA 2FTYA 2NLYA 2IMRA 3MUY1 3WKZA 1HL8A 3B3DA 1JCTA 1GGOA 4NP7A 4MAVA 3CMFA 4FIRA 3KW3A 1M68A 3B0YA 2BG5A 1JDFA 2WSQA 1XYCA 4ZOAA 4ZE5A 1HJWA 3GXIA 3CPGA 5FSDC 4F0SA 4QE4A 4XIMA 3DGBA 1EWEA 1O4UA 3P61A 1XBXA 1TJ2A 1NFBA 1O7AA 1KGUA 1OFAA 1RP9A 2D22A 4OGZA 2EG8A 2I14A 1YNYA 1IR1A 3FS2A 1JRCA 5F2MA 3BW3A 3RF9A 1ME8A 1ITQA 4BI6A 3TQKA 3GAYA 4WLCA 4HPNA 2O56A 3FYPA 3RITA 3F7JA 3VIJA 2VL4A 4LT9A 1P6BA 4CQAA 3RCMA 4Y8EA 2R1KA 2CHOA 1JULA 4AIOA 1UPPA 2ZXAA 3RJXA 4U2ZA 5CPTA 3GG0A 4AFYA 4AX7A 2X0YA 1ZAJA 2J88A 5HMEA 2PD9A 2QPXA 3R1ZA 4MY9A 1W1A1 1ZBCA 3L66A 5EY5A 3LSBA 2XPKA 3O07A 2FPTA 4EAYA 2A7PA 4FHAA 1FCUA 5HQMA 1VJIA 2DPEA 3FGCA 3W1UA 3TSDA 3ZOAA 3W1LA 3TFCA 3CHCA 1QNSA 1E15A 3KBNA 1XG4A 3OHIA 4P7QA 1GG1A 3IJ6A 3WDHA 2VOMA 2IQ0A 2Y7FA 6A3HA 3DYPA 3CUIA 1XLJA 4C6IA 3MI2A 1Z69A 1VJZA 1V5XA 3N17A 4LNYA 4YVVA 2P88A 5CXPA 2YDRA 1KRCC 5REQA 2PDNA 3EWZA 1PKLA 1TMQA 2DJXA 3MWCA 5DY2A 2J25A 3NQ6A 3PZ9A 3AXMA 3BDKA 1XF0A 4AUBA 4TIMA 3TAKA 3AU2A 1W5NA 3VDCA 3W7LA 4PCTA 2XH2A 1OX4B 3MSGA 4QEEA 3FHQA 1UWIA 1AK5A 2QCMA 1E3XA 3UWWA 1YDNA 3SJNA 3PBYA 2REQA 1FFRA 2WO5A 2D20A 3HGRA 1DP0A 4JNYA 2E25A 3KP0A 4J9JA 2AKMA 5CQ1A 4MKSA 1CENA 1VYRA 1QNPA 2D23A 2IXUA 4X22A 3ZZ1A 3NPVA 2C13A 4O19A 5LNWA 5I6SA 3HFTA 3VD5A 4HNOA 4QNEA 4F8XA 1XLLA 4L4OA 4NAEA 1LUCA 1Q7MA 3EXSA 4NUWA 3NQEA 4BCEA 3C2YA 1XX1A 3T9PA 4JIIX 3D46A 1EC9A 3M0HA 2YL8A 1BGGA 4PCFA 4EVZA 4J3WA 1F05A 1Q3NA 5DF0A 4E2OA 3FXYA 4CQBA 1B2YA 1EQCA 2PCEA 2FZBA 1XBZA 3P81A 2PLCA 2XH0A 4JN7A 4RCXA 1B31A 2UY3A 1LLWA 2PURA 3AXKA 3WNLA 4U5IA 3AUOA 4HMNA 4W88A 2Y63A 1EA0A 4YTUA 2NLIA 4NJIA 2WPBA 1W3IA 6CGTA 1GKQA 2OGYA 4RV3A 4TTGA 2B4GA 4CQDA 1MQRA 4O18A 3B0XA 3EKLA 1PS9A 4IFKA 4EWJA 3RFAA 2ACQA 3HPZA 3NDZA 1UG6A 5AVNA 2A6NA 2HZGA 3HPXA 4LVBA 3T1GA 9RUBA 1XRFA 3SFKA 1UB3A 2EG6A 4AYGA 1RA0A 1TPFA 2HJPA 3UZ5A 1ZP4A 2Z7KA 3HV8A 4S23A 8TIMA 1TV8A 2FTPA 3SJ3A 4IP7A 2C3ZA 5CSUA 3EDFA 3N19B 2G3IA 4JFUA 5LKYA 4EKJA 2PAJA 1TPUA 2H8ZA 2IW0A 3BOXA 1NARA 2ZXBA 2Y61A 4LANA 5HNNA 1QTWA 3V18A 1U1HA 4GX8A 3LBCA 1V03A 4PRWA 2ISVA 1TRDA 3WUFA 5A8PA 3F1QA 5A69A 4RNFA 4H1ZA 1H1NA 3L4VA 4ADUA 1RJPA 2DZVA 1OD0A 3CMJA 4V28A 5REQB 2B7OA 3RDKA 4RX0A 2WC7A 3AISA 2GWNA 3NXFA 2VUYA 4B2DA 2V2DA 1S2CA 3NWRA 2X05A 1AFSA 4RZBA 3MUXA 5F1UA 5CGMA 4J28A 1OFBA 1K7FA 2BY2A 4JTIA 3TX9A 2XUCA 1WCGA 1HT6A 5CGQA 4WKAA 1QPRA 5I3FA 2JQXA 3KRZA 5TNVA 3HQPA 1DPMA 4JS3A 3AO0A 4YTTA 3I6TA 1MW0A 1T5AA 3RPMA 1NOWA 3SUWA 3SN1A 2QULA 1KM1A 1IGSA 2PS2A 1R7AA 2Y85A 1XIIA 1H63A 1MSSA 1I8JA 4BF7A 4Z1BA 5DCDA 1C8YA 3ARUA 3IJ9A 1GOXA 1BAGA 2CESA 3SCQA 3BMVA 4MMWA 1JPMA 3OYXA 5IXEA 1R9YA 1R3RA 4GBDA 4XO6A 2Y8VA 4XD6A 4PEKA 4ZQRA 4Q8QA 3Q45A 2BZNA 1S5MA 3W26A 3QSTA 3PZQA 5HNTA 3BJSA 4INFA 3W83A 1ZNNA 3T09A 1FCBA 1D3HA 1UC4A 1NQ6A 1V6TA 4HNCA 4NHVA 3CHFA 1YTDA 4HYWA 2A6LA 3FEQA 4GYJA 1DJIA 3M47A 1Q6LA 4WXZA 1K6AA 4ATDA 1QXLA 3ZSSA 1A5OC 3MUZ1 2QIIA 2D73A 1OM0A 1VQTA 4LBRA 4W8AA 3NA8A 1WX0A 4GY7A 4DF1A 2WJZA 4TXEA 1A49A 3NNTA 1TRIA 4O1DA 3M46A 1FKWA 2QLYA 1FUYA 1U22A 2PLMA 3C52A 2DVUA 3ES7A 4C7FA 2D1ZA 1KNWA 3V0SA 2VD8A 4QM1A 3S1UA 3SGZA 1C8XA 2SFPA 4HKPA 3PJWA 4W87A 4YYFA 1S2TA 1XYAA 3W6MA 4N9DA 2A3AA 4WJXA 2ZVIA 4R3UA 5BWAA 1FDYA 1PEZA 3O9NA 3QR0A 3MPGA 4D6GA 4LWWA 2MANA 4CVUA 1RCOB 3BG3A 3UWUA 1GT8A 1MRAA 3W7OA 3UNDA 4K8GA 3QR3A 3WJXA 1K03A 3GNDA 4L9XA 1IHIA 1OCJA 2B7QA 3BVJA 3G5EA 2NX3A 5HK4A 3VKBA 3KOXA 3P60A 1WO2A 3W7QA 3AMDA 2Z24A 2HISA 1TQXA 5JBFA 2BXZA 2RDWA 5F4SA 4I5XA 4ZCWA 3DEQA 3WBYA 1YEYA 3NPWA 3BTNA 3R11A 3W29A 4GK8A 5JIWA 2WMHA 1YPXA 1CPUA 4W89A 4HBKA 5DXXA 2QCCA 3GR4A 1Q6DA 3GTNA 3NQFA 1QMLA 5D33A 4DNHA 1I2QA 1SU5A 3DIPA 3VA8A 3GKAA 5CZKA 1QJWA 1EPXA 4DAIA 3LBMA 2YW4A 2C71A 3M0ZA 1EZ2A 2J7BA 1JUEA 3DI0A 2IQTA 4ERGA 1KO0A 4QGCA 4WEVX 1YDVA 1U1JA 3ZLGA 1E70M 2XFRA 1DXIA 1EF2A 2DFAA 1KWKA 2AQVA 4AF0A 1WXZA 1AMKA 5ENLA 3GXPA 3TJIA 3OVQA 1QO2A 2FTWA 1FH7A 1TIWA 5T9CE 4JCMA 4Q8PA 1C3FA 1LBLA 4JOMA 3I65A 3EB2A 4XBKA 3U2ZA 3B9EA 5HULA 1G5AA 2O9TA 3SO7A 4DJFC 4ICNA 4YJ5A 3ARWA 4YVPA 3E96A 4BY3A 2WZHA 1QK0A 1XPYA 3SGGA 5FA5A 2C0AA 4ZQCA 5G1YA 4H6RA 5FCZA 2OWWA 3NQGA 4CVWA 1H7WA 3TJLA 2HDJA 2CBUA 5K2ZA 1EJ7L 1G4EA 4UUIA 1VCVA 1BLIA 2J8TA 3MUCA 4FR6A 6TAAA 3EXTA 4Z2KA 4H8VA 1RLCL 2OZ8A 2Z1SA 3VIOA 1XISA 5CGTA 3AIWA 5AYXA 1OGGA 4DJDA 4H9XA 1WV2A 2IUZA 3ZSTA 1FH8A 1DQUA 2J8FA 4DO6A 3RMEA 1H11A 4GX9A 2VRQA 1JR1A 4WY0A 4IUOA 1QPOA 2W67A 1Z44A 1S46A 1UD8A 2PU0A 3WK0A 3LENA 4QAIA 4GYKA 1QW9A 4K1WA 4LAZA 2J9XA 2WZTA 2OWCA 3PBWA 1XJBA 1QW8A 2ZYFA 1AQFA 3H7VA 4LBUA 1ZP3A 1LWIA 3ME3A 4KERA 3PZIA 3PUDA 1OHLA 5EMYA 5A6AA 4FXRA 2NV2A 3ARZA 3GIPA 1PZ2A 3TVAA 8XIAA 2AGKA 2J7EA 2UZ9A 4Q4KA 3H2AA 4QISA 4GJ1A 2LLEA 3FK4A 3IVTA 3CL7A 1XIJA 1YHTA 3I3EA 3QZEA 3ITXA 3RIKA 4W7VA 1RK5A 3BLLA 3N4AA 1EHNA 4Q4MA 3CUGA 3LRLA 1W1PA 4NI8A 2YX0A 4JTLA 3V5OA 5L6UA 2INFA 3HOJA 1P1MA 2RDXA 3TN3A 1P0BA 5I09A 1BTMA 1U33A 4YN5A 2ABBA 1MUWA 5F2IA 3BLFA 3AS1A 3UWEA 2QHAA 1KFEA 4JIEA 4KWOA 3V3WA 3EYPA 2OO6A 4NI3A 2E77A 1KXVA 1OX5A 3LCXA 3QBUA 4H9VA 1KBJA 4TMBA 4HK6A 3PTKA 4Q4RA 2PWDA 3O16A 3WD3A 1A0EA 2ALDA 4LUTA 1TPDA 1GKPA 2YZ5A 3I7QA 3R0DA 4HOXA 4PSRA 3DG6A 3HG5A 2OSWA 3GZ3A 4IIHA 4C7GA 3LZ5A 3ARVA 2F2HA 3C0QA 4PUUA 3WFAA 1OFOA 3MWAA 2Y4SA 2V5CA 3BQ6A 5GJMA 3LXCA 3TC7A 1CTNA 5JH1A 4K38A 1KBBA 4PMZA 1TPC1 3BLOA 1AW2A 4HA3A 1ICPA 5MKGA 1XYMA 1ONRA 1JDCA 3P74A 1ITXA 5AHIA 3WENA 3QPZA 2WVUA 1H5VA 4UTMA 3VD7A 1YRRA 1BRLA 3FJ4A 2OO0A 5A2BA 1R5YA 1NWUA 3EBVA 4KS0A 3MKVA 4Y96A 3IIVA 4JFVA 3IK2A 2QW5A 1R3SA 2WHMA 3KCJA 3RX2A 3ZR6A 2O7QA 5HJXA 2ZDRA 3PAJA 3GSMA 1X7IA 3QF0A 5BROA 4JFWA 2YSWA 3S3GA 1IGWA 1E43A 2PDMA 3TH6A 4M5PA 4UWMA 4LB4A 4EACA 1RBOB 3SCRA 4TX9A 1G69A 4K68A 4AD5A 5DX7A 4H9MA 4GYFA 2Y1HA 3W1AA 2XVKA 1FCQA 1V6VA 1XC4A 1JZ4A 3W53A 3O6DA 3W7MA 1W9BM 4DXVA 1E71M 2HPIA 3P8IA 4HHHA 4IIFA 4IICA 1SM9A 1UWTA 1W9UA 3QQWA 3K1GA 1Q13A 3ZJ8A 1ZCCA 3CQ0A 3B0VC 2H9AB 4ASTA 1JXJA 3URQA 3WD0A 3CH9A 3OGSA 2X1UA 2WAGA 3KOWA 1XLAA 3R79A 2RUSA 3BCFA 5HANA 3ZS4A 2BTMA 2OOFA 4QG9A 4NNAA 1WDDA 3NFUA 3VVGA 3G0SA 3IRDA 1W1B1 4LBSA 3WLJA 5EBAA 3FJ6A 4LY4A 2X09A 3PF3A 1PYMA 3PSWA 1FWGC 2VDIA 1Z41A 2E5BA 1HXJA 3VCNA 3BSGA 2PEVA 4C6LA 3CUXA 3N9KA 2A0NA 4IFRA 2WJFA 1VBGA 4QROA 1EJUC 2J47A 3HG2A 3I3DA 4B5UA 5I3IA 2NX9A 5D8WA 3K30A 2B7PA 3GXNA 5FF7A 3HJEA 4WUIA 4Z2IA 1OC7A 1IQ8A 5FJPA 2E6DA 3WNPA 4KWWA 5KZMA 4DVOA 2R1NA 2OZ3A 3CV6A 3EOUA 3EX1A 1SO4A 2JF7A 5LA1A 5FJJA 3CQJA 4CN1A 4A3QA 3H7RA 3V1PA 2HS6A 3MV01 5HAOA 5G1TA 4B4HA 3NOEA 2RHGA 4HA0A 4HPJA 1JCJA 3H55A 4CD5A 3NM3A 4HYRA 1T8XA 2AL1A 3MU7A 4WSJA 4GQ0A 4ZOEA 4JHOA 3QZAA 3PY2A 4M82A 3W6LA 3SY8A 1G7UA 1MW1A 3W00A 4CKQA 4UR9A 5C55A 1MDLA 2FGBA 3KS6A 4LCRA 1K77A 1EX1A 4D6HA 3CAVA 1BG9A 3WLKX 4FALA 1J0HA 5IRPA 2WCGA 1V0LA 2G3JA 4US5D 2JEPA 4U5KA 2GSEA 3PPCA 3VOHA 1QHZA 1Z3NA 4KCVA 2PWFA 3AWOA 2OVLA 3NSMA 4GVFA 3VUPA 3C61A 1U5HA 2PDIA 4NIRA 4R85A 2CETA 3G0XA 4RNIA 1GVEA 2VZSA 3O8AA 2CLFA 3WDIA 2XWDA 3RO8A 3GAKA 2HVOA 3TTYA 4DELA 3E2VA 4L1WA 3VGGA 1KFJA 1A5UA 4YPJA 4PMXA 5CPSA 3M07A 5LGXA 2PI6A 4PUWA 4Z2LA 1XCWA 3B9OA 3HF3A 1OEPA 3NXLA 5TF0A 2ZWYA 1SR0A 3PZVA 2G3NA 1IE7C 5U4NA 3CAKA 1TPWA 1TPEA 3U8GA 3UPBA 4GBUA 3P80A 3U4AA 1E5NA 2X7VA 3RCYA 4CQCA 1LROA 3NTYA 4AW7A 3A12A 5BRPA 4MNKA 1VCFA 3MMWA 4GIYA 4GMEA 3A4XA 5B80A 2IPGA 1E9LA 4PTDA 4E2DA 2Z0IA 3MA8A 5J04A 4FB7A 1YMYA 4L6HA 5RUBA 3B04A 1EC7A 1XLBA 1XM3A 2HPMA 4EX4A 2VD9A 4UOZA 3VO0A 1H61A 2ZWZA 2HBXA 4BWLC 2ISWA 3E5BA 2G41A 1MZHA 1WKEA 4QIUA 1ICQA 5FACA 1O94A 4AVFA 3QV8A 3BAJA 3VM7A 3CC1A 4GD0A 2Z1KA 1N2VA 4UTWA 3EWUA 1UH3A 1VFLA 3FN9A 2WJEA 1OCNA 4JN6A 5IHSA 1KM2A 1XDLA 4AZ6A 3DDMA 4ZVJA 2E6YA 3L5LA 4V15A 4GQQA 3PWAA 3UU0A 3FXGA 3GXMA 3HPFA 1GJWA 3EA1A 5M2FX 2DSUA 3UG4A 2YL9A 4TMCA 1H7NA 2D0HA 4AEEA 2PF0A 1VC4A 3HN3A 4LTSA 2DSZA 5E70A 3S5SA 1MQPA 3G1SA 4Z1AA 1A3XA 3APYA 4QX4A 3KL0A 3L0NA 1O60A 1KXHA 4PCNA 2PGFA 5LHFA 1XINA 1HVXA 1DQXA 1PBGA 3K5XA 1SFTA 4FXFA 1PV8A 4MPQA 3VTRA 2PTXA 3KLLA 5FEPA 2V5JA 4AZHA 2Z7GA 1FWCC 1FVPA 1UD6A 4WDXA 3THAA 2VCAA 4LUTB 2O4MA 3LCWA 3YPIA 4GJIA 1EGZA 1V02E 2I5QA 2OOGA 1JCLA 1XKJA 3BLIA 5A6BD 1SR9A 3MCMA 2BOFX 4ZEPA 1E6PA 3C8NA 1TTJA 5ECVA 2JGYA 3C2OA 1FWWA 4IMEA 3W72A 2PBOA 4D8ZA 1S39A 1H1YA 1OYCA 1LYXA 3B8IA 2C16A 2P50A 4IPNB 4BS0A 1OK4A 4GO8A 3ZWSA 1UA7A 2NUXA 1RHCA 2CFFA 3GR8A 2C14A 3IIPA 3RLHA 5JUVA 1FWIC 1EDTA 4AHPA 1W3KA 3N15A 3EDDA 5A6KA 4QJ3B 3M5VA 3Q4DA 1V51A 1B0IA 1W1TA 3G1FA 3KWSA 1THFD 2ALRA 3TLLA 4IHCA 3QY8A 3QYSA 1VEOA 5DCBA 5E0KA 1ECQA 4S39A 3F5LA 2W3ZA 4B2DD 3T8LA 2Z1BA 4A3UA 1ZTVA 2WC3A 5H1WA 1CEOA 4L1XA 2QMJA 2OQYA 3M0YA 1CXEA 4DBUA 2ZC1A 3GTXA 1OY0A 2YJQA 3ABQA 3RPDA 2DQWA 2DW7A 3TCSA 3WF1A 5GNZA 2VVNA 4KESA 1X96A 3KVKA 1MRQA 4GY0A 3F2CA 1I2NA 3JS3A 2EHHA 3K4AA 1TA3A 2J24A 4S3KA 1IT8A 5JQ9A 1V08A 1SSGA 3KCLA 1DWHM 4UTKA 2GDQA 3NPXA 1ZAIA 3RX4A 1F3WA 4QTGA 1AUSL 2BLEA 4IISA 2OX1A 1HO4A 1TJ0A 4MAZA 3W84A 1WUFA 2VVSA 4PB4A 1QI0A 2QDDA 1I45A 1ZRQA 1M04A 1JCXA 3BAIA 2CEQA 2NQ5A 4FNUA 4PMYA 1JZ8A 4NZ3A 3G3MA 2QJIA 4DJFA 1P6WA 4PRRA 3WBWA 1VPXA 4HN4A 1QI5A 4AAJA 3QM3A 4GNVA 3E5PA 2PE4A 4JD4A 3RJYA 1GVOA 5DFAA 2DT2A 1DL3A 4DJEC 5E0CA 1U5VA 5GNYA 4NRRA 4UQ9A 4NT0A 3UFYA 1CGUA 3VOFA 1FP8A 3BARA 2Y7DA 1BYBA 3EEGA 1K70A 3PHAA 5CZTA 5T26A 4MNLA 1ZBWA 3NR0A 2FGLA 3I4KA 3VKCA 2R9RA 3AICA 2J4GA 2A3EA 3H7UA 5LNVA 4PSPA 5FI8A 4V33A 4IJCA 1TZ9A 4UC5A 3USZA 2BMBA 3SCNA 2XZ9A 4NNCA 3THQA 4XWUA 3W01A 2VR4A 3G1DA 4NX0A 2Z29A 2HV5A 1O1HA 5E1QA 1V6WA 4KT2A 2W66A 3MO7A 3NVTA 3N4FA 1RD5A 4TUFA 1A5AA 1U30A 3PTMA 3JVAA 3S2JA 3VE9A 5CC3A 3WQ4A 1MFVA 1IXNA 3AZTA 4CNUA 1W56A 4V2XA 4HMDA 1E51A 1M7XA 2RGMA 2CBVA 4NASA 1JYXA 3DGRA 4B3LA 3AMKA 1ESWA 2C8NA 3SGUA 2VFDA 1BVZA 3EDJA 3M5ZA 3KXQA 2Z1XA 5AC8A 4CEXC 1VYPX 4Y7EA 1UR4A 2J77A 4RDVA 1F8IA 1V0NA 2Q8XA 2VURA 4MWAE 3BLDA 2DIJA 3HTWA 1BSIA 3TSMA 2PMQA 1KM3A 1DE5A 3WQVA 4UR8A 3P3BA 1REQA 2E67A 3HO8A 1TWWA 3TU9A 3Q58A 3FVMA 3PBUA 5GNXA 4XTIA 4MTVA 3M64A 3V0TA 4JX5A 2J27A 4O17A 5AYBA 1V77A 2BHUA 3WJSA 2VX4A 4GKLA 4DIAA 4EOUA 1R3VA 2OG9A 1A4MA 1XUZA 3QGAC 4B90A 3R8GA 3CZKA 4PUDA 3IK4A 1EBHA 1MMFA 3B8TA 1FH9A 4KQNA 1ZCOA 2PCQA 3N12A 1KTCA 3TXZA 1DV7A 1WB0A 2ONEA 1M7JA 4JQ1A 2WANA 5D02A 4LALA 3HM7A 4UNKA 1GVSA 4KRTA 1XIBA 3MBFA 2DUAA 1R9XA 3QLLA 4B5NA 4PA8A 1UP3A 2CBJA 4NY2A 4HPHA 4MYXA 1E9IA 4I7UA 4O28A 5BXSA 3BC9A 1Q6RA 1VH7A 4KFPA 3OIHA 3OLIA 4AIBA 1I2OA 3UF9A 3KZPA 3W02A 4QAWA 4QRNA 3GVQA 2GVJA 3WK1A 1WZMA 4XAYA 4LYKA 2WKLA 2VO5A 3CK5A 3QRHA 2X42A 3MQTA 3WBAA 1KB3A 3DFYA 1EUNA 4LUIA 3UGVA 2OPJA 5CBJA 1CDGA 4WHBA 3KBMA 4H2CA 3XIMA 2DZTA 1VENA 1FWAC 2NW0A 2DZXA 3VGDA 1S2VA 4W5UA 1KCZA 4JHZA 4AH7A 4DXKA 3W2MA 1YX1A 3GZAA 4JCLA 5H8UA 4BFAA 5A8MA 2XU2A 3VKDA 4X9SA 4ZO9A 3B97A 4GLEA 4G9PA 1GVIA 3U5YA 3O05A 3V16A 2EJ1A 3VKKA 4IQDA 2CLEA 4FEZA 3WEZA 5CJNA 5BW6A 2PC8A 5ABFB 2XFFA 2CZ5A 1HNYA 1LG2A 5EBUA 3PJTA 4UMCA 5I2UA 2NXGA 3FCPA 3UR2A 2OSXA 1XIGA 2EXOA 4LEQA 1LRNA 1NY1A 3IJLA 2UY2A 2PTZA 1XP3A 2AAAA 1GQNA 2GVGA 1HJSA 3VC5A 2QCNA 1GPFA 3FJNA 3FV9A 5I03A 4DB7A 1B30A 4RE2A 1TFVA 5B7ZA 3LV6A 2OLHA 4ONVA 3VDGA 1L8PA 4AVOA 1YIXA 3AIBA 7PTDA 4QR6A 1Q2SA 5D2YA 4JFTA 4IL0A 4O53A 3K13A 5IM51 1YXCA 4LC6A 4JIPA 1O5RA 3G1YA 3C0JA 3KCOA 3UCQA 2JALA 1DJNA 1R2TA 4OVXA 3ZMRA 1V3KA 4WD0A 3PJXA 4Z17A 1HO1A 3P62A 1Q63A 4K3ZA 4XBJA 3S9IA 4CNPA 3VK5A 5IOBA 4W85A 4H00A 3LHYA 3I7RA 4O8AA 4JKMA 2P1FA 4P7NA 5DMMA 4RW5A 3CU2A 1ITCA 2X30A 3ARQA 3FAXA 3PUGA 3RU6A 4EAMA 3W7DA 6XIMA 1NIUA 2TPSA 2DV0A 4AMAA 3CWOX 4CNOA 4DQWA 5C7HA 3STGA 1MUCA 1QR7A 3TQVA 2V2CA 4Q3MA 4DF2A 2P0IA 5MF5A 3HQ1A 3TW6A 3L4TA 2BBFA 3NM1A 1UP2A 4O0ZA 4M7SA 1NWRA 1SFSA 1V3IA 2VX6A 4MVAA 1J5TA 1YTEA 1YXYA 5E6YA 1H51A 3I3BA 3TROA 4HHPA 4WIWA 3B8WA 2QDEA 4GZ7A 2NWRA 2PU1A 3NQMA 3HV9A 5F4XA 3ANYA 4F0RA 1AA1B 3S5ZA 5I3DA 3CZLA 1GJPA 2YL5A 2J78A 4N2YA 1RSCA 1XLMA 1C8VA 2WM0A 3QLDA 4G7EB 1XYBA 3WBEA 5CEWA 2V82A 3WQGA 3CHDA 1EA9C 2NX1A 4GI6A 1VPYA 4W4QA 2F38A 1QAPA 2XGIA 3EX4A 4B9ZA 2JK2A 1LBFA 1OFEA 3SIZA 3FHAA 4YLWA 3IUIA 4HSNA 3IUDA 3KRSA 4Z08A 4LCQA 3QHMA 4XSLA 1R85A 1V7YA 3M0IA 3QC0A 1Z9AA 1W6TA 5AOUA 7REQB 1KFLA 2VFGA 5FEXA 3LCHA 4E4UA 2F6UA 4AHOA 3S5OA 1E0VA 3IRSA 3KWXA 4Y2WA 4XZLX 2HK1A 2Q6ZA 1IV8A 1EOMA 1RZMA 3DCPA 4C6DA 4AISA 1QFEA 2UBPC 2ZICA 3WL1A 2ZDSA 1XSIA 4DUXA 2JGQA 2VCBA 1FOBA 4UTIA 1G4SA 4FP1A 4H83A 1X38A 1GK8A 4EXQA 1B3VA 3MTWA 2Q8ZA 1LP6A 1O66A 3TW9A 4RE4A 3H54A 3SSZA 3S2NA 2Y2WA 3VOIA 3WEOA 3TZFA 5BRQA 3AZSA 1WA3A 4DLMA 3FA3A 3B05A 4J40A 3VXGA 1CGWA 1JUKA 3UT0A 2OJPA 1FRBA 4HT3A 3AS2A 3P93A 2VXNA 4TR9A 4GUGA 3BAXA 4GXMA 7A3HA 3IV3A 1BTCA 3KVMA 1GKRA 1A5NC 2R1PA 2VFEA 3STFA 3T2PA 5I02A 2VUNA 2FH6A 3BPWA 4HU0A 1FBAA 4C1NB 3UCCA 4I7VA 3TN5A 5DT5A 1RALA 1WOAA 5K4XA 2NUWA 1C9DA 1TJPA 1VBUA 1B4KA 1PZ1A 3SCVA 1G67A 1HGYA 2WW5A 1DXFA 4X0VA 4YCPA 1LL6A 2QCGA 1PX3A 2XZ7A 1S5TA 5K4ZA 3WQ6A 3QEZA 2X41A 1FHLA 3GH5A 4IH3A 1UBPC 1OC5A 4UB9A 3S42A 4CU7A 3LRKA 3AIQA 2DSKA 3KTSA 2R82A 1BXCA 2XM2A 3G18A 1VAHA 2C1HA 2Y0FA 4N6EA 3RGTA 2G3MA 3KHJA 3S1WA 1RP8A 4ZQPA 2BGQA 4AZGA 1KM0A 4GCAA 3E0VA 4OFCA 3EWCA 2V2HA 2WSKA 2PP0A 5BCAA 1NEYA 3CZGA 4EWND 4UNLA 1AODA 3QYQA 4ZL1A 3EPNA 1A50A 3KLKA 3TK7A 4LVAA 4PMJA 1LBMA 1K9EA 3MP3A 1LL7A 3D3FA 3DHPA 4QE5A 4HMEA 1BWLA 3UERA 3NO1A 3SUVA 4NU7A 3N25A 2J9YA 2XH4A 4JDBA 4XVDA 5FD0A 4DYJA 6PTDA 2DZAA 4H01A 1NSJA 4UOJA 1LOSA 2VX5A 1FTXA 2VEFA 4DZAA 4LCSA 1XLEA 2D2OA 1F5ZA 4JTSA 2FFIA 2GVYA 5D4YA 3KUMA 2E6FA 2V6AA 2WVVA 2PODA 1WUEA 4AC1X 2XTKA 4ZGYA 4XZWA 4GUHA 3DC0A 4E8CA 4ADTA 1YNQA 3DFQA 4ZE4A 2O9RA 3N2TA 3LLDA 2FDMA 2ZBTA 4PB5A 2NQHA 3UZZA 1B9BA 3CNYA 1R0MA 3C0SA 4N42A 3A4AA 3WF2A 3VIHA 3DECA 4R53A 3E74A 4MB5A 3LCGA 3T6CA 3BAKA 3W2UA 3QV6A 5JBDA 2QF8A 2PWGA 3OG2A 5TIMA 1PVNA 3LUTA 2EPOA 1AH3A 2ZE0A 4MWAC 3W7KA 3BH4A 4IFKB 4Q8WA 1V02A 1K8ZA 5LSMA 1FWTA 5GPRA 2OODA 2Q09A 3BMWA 3PN8A 3H2FA 5FJUA 1WKFA 4JL2A 3ARSA 1CWYA 1L2QA 4Q4OA 3BV7A 3CIWA 2BFGA 3BOFA 5TD4A 3GU9A 1UQZA 3P7YA 2Z00A 3UCDA 1UZ1A 2E5DA 1IZKA 4P5UA 3SM0A 3ELFA 4AEFA 4LUSA 3GHTA 1EJRC 1TUFA 4GVIA 2WHLA 2NQLA 2PGEA 4C6BA 3KM8A 3KOYA 4RLIA 3W38A 1W2VA 9XIAA 2QNEA 1LRTA 2RAGA 4LNCA 4LGXA 4R9XA 3ITTA 1BHGA 3ITGA 4ML4A 3ZT6A 4ML9A 3GYEA 3WNKA 3E1F1 2DH3A 2VEIA 3Q67A 1BYAA 2XSXA 3CZJA 3S4TA 5B7YA 2Z4GA 3L4YA 4AD1A 4A6GA 4RZ4A 3GTHA 4MY8A 3WQCA 3II1A 3UJSA 3W7JA 3OP2A 1RJQA 3CZEA 3EX2A 2Y70A 2VGIA 5C5YA 3VIIA 3LRMA 2PDWA 2ZRWA 1L8NA 1RQHA 4JR5A 3DFSA 2Y5EA 1H09A 1Q4NX 3NQ7A 1Y5VA 1E73M 1R2RA 3QC3A 1US3A 4U33A 3PC0A 2ANUA 4HQVA 3CJPA 3RYSA 5LIYX 2DT1A 4NNBA 1KCLA 2OKTA 4H19A 2FB3A 2OR2A 3T78A 4XIAA 4Q8MA 4U2YA 1SJAA 3DYMA 4IQEA 1KW1A 2CXEA 4NQ1A 4O52A 2CZVA 2VZOA 1ALDA 1NU5A 3LX9A 4ZQOA 1ADDA 1X98A 4NAEB 1QOXA 1XLKA 3FX4A 1P6CA 4JTQA 1ZJHA 2ZX6A 3CASA 2FZ8A 5EFDA 4ZO8A 1GYMA 2CC0A 3W7IA 3SDOA 2W27A 2AL2B 2PDFA 3NQ8A 3KBWA 4H3DA 5EMKA 2GGEA 1V7AA 3OLEA 4JQAA 4ZMGA 4JICA 4XZ9A 2WKJA 1UWRA 3MVIA 2OEJA 3T4WA 2WVSA 5ABGA 4WGXA 4RDZA 1RK6A 5DCEA 1XDMA 2YA0A 3E2RA 1YBQA 4PMVA 3G2GA 2EKGA 4DZHA 1E0UA 1U83A 2BXYA 1XQLA 4O1FA 5TBOA 3IJQA 3GD6A 1GQIA 1OJXA 3N6HA 4JTCA 3G6LA 3VZZA 1KGWA 1XH0A 4K37A 3XINA 3BXWA 3WD1A 4CUCA 4C6PA 1QPKA 4CCZA 1XLGA 3GG7A 3WUBA 4NYYA 4HCDA 2XSBA 4UFMA 1C29A 1W3NA 3GB6A 2VWTA 1SZGA 1TREA 4QEHA 4X0NA 3LGDA 2PDLA 1KV5A 1TSIA 4K7YA 5LYRA 2GGGA 3CV2A 4LUSB 4HGXA 4LS1A 1DOSA 2CZFA 1FX6A 3W1PA 5LIKX 4OJYA 4HZ6A 4J3XA 2TSYA 1NWTA 1KLYA 1KC7A 2R6OA 4HK5A 4DWSD 1I0BA 1OFQA 4R27A 3LG3A 1RVKA 2WV8A 4IWWA 3FVDA 4L64A 3TR9A 2PWVA 2X1IA 3OEXA 4CN6A 4H4IA 3QPEA 1W9VA 3W0KA 3R8HA 5G5IA 5CSRA 2J75A 3UWYA 3BANA 5ABEA 2HK0A 2OELA 1KXTA 1XIFA 4ZODA 1AQHA 3DFNA 4E6MA 4E3TA 3PBVA 2D0FA 3WMLA 1N7KA 1TV3A 4LRTA 2VELA 1W3JA 1JJKA 4UTHA 1UR1A 4GRSA 4UTTA 4A8RA 2NWSA 2ICSA 1IXPA 2PWUA 1IEXA 1NOFA 3GDTA 4A3RA 3LPOA 1KR0A 2CIPA 1FP9A 4HOZA 3T0BA 1F6KA 3WLHA 4IMFA 5ABHA 3OZYA 1QNQA 4TV5A 2BB0A 4P8UA 1KM5A 3OB8A 3EWBX 4WSHA 4CCEA 2P76A 4DO5A 1UQYA 1R3QA 4XD4A 5A2AA 3ZR4A 4XISA 2GZXA 4DY1A 4M80A 1IT0A 3VNDA 2FDSA 2C91A 3IGXA 2VZTA 3STEA 4EP8C 3L0GA 4XZBA 3C2RA 1ZBVA 2C1IA 1IIGA 2AAMA 2H90A 1VCGA 2Z25A 3G1VA 2G95A 1DJYA 4I9JA 4P8XA 3DFOA 1SJDA 4TX8A 4WXYA 1UWAA 5JU6A 4FXSA 1AL7A 4A2RA 3F2DA 3OTRA 4R5EA 5DQPA 2JEQA 4AC7C 1MZRA 3S8HA 1UH4A 2VGBA 5CPMA 3DHFA 1OFRA 5C9WA 1E4MM 3SN0A 2YDSA 4GNJA 5HR6A 4KBXA 5I0DA 5LXXA 1PTDA 3C3UA 4AYSA 2O9OA 4PBGA 1ZS2A 3NZPA 1DJGA 1CLVA 3ITLA 4I5UA 1OCBA 2YA1A 1HP4A 1ZENA 1ZHAA 2RJGA 4YL2A 3K1DA 2FGZA 2X1RA 1TYGA 5LHEA 4H6QA 4DO4A 4PBEA 2XFWA 1YBQB 5AFDA 1LT7A 3CAQA 5I78A 3O3RA 3WQOA 1CXFA 3S1GA 4HZ7A 2Q71A 4KEVA 5BOOA 3L4ZA 3ITCA 2R14A 2WLYA 4ORMA 4RPPA 1DTNA 1E0XA 4ZB0A 1QATA 2I5GA 3MI6A 4UZUA 1U2YA 2QS8A 2W4XA 1FY6A 1VFFA 1CYGA 1M6JA 4IG2B 1B5TA 1E4NA 4XK2A 1N8IA 2BVTA 1QBBA 1S2AA 2JIEA 2BODX 2UWFA 4JTJA 1MUMA 2W5FA 2G37A 5FSEC 3WDPP 3INPA 3M5YA 1W5PA 1V3HA 2PTWA 4U3CA 3RXZA 3N04A 3PZNA 1D7KA 3GIYA 3I68A 1RH9A 1QNOA 4DX3A 1J9YA 1WDPA 1O12A 1OFDA 2E9MA 3K4WA 4WOZA 3EKZA 2J66A 1UWUA 3MBDA 2TAAA 3KX6A 4A22A 4MWAB 4IP4A 1L9WA 4A29A 1TE6A 1POJA 3CUJA 3GIQA 4MDPA 2V3GA 3COTA 5A6SA 3WLLA 1F7BA 4HP5A 4NILA 1OSEA 2ZUMA 4DUWA 5I3HA 3EWYA 4L61A 5FKYA 1QBAA 3B0UX 3P82A 1FKXA 4E8DA 4N9EA 2HMCA 2QUUA 3E2SA 3V0UA 5FJOA 1SGJA 3EOSA 4AD2A 3AWNA 4P8WA 4O54A 4AWUA 4Q8VA 3RAOA 5LA2A 3OG3A 3OIXA 4YTSA 5AC6A 4C91A 2YYTA 1UMYA 3R6IA 1RCQA 1RLDA 1A3WA 3RM4A 4US6A 3H22A 2FB2A 4O10A 1VJSA 2D3LA 1V8EA 4BF9A