3FA4A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, triclinic crystal form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
291
structure length
284
Chain Sequence
PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
molecule keywords 2,3-dimethylmalate lyase
total genus 100
structure length 284
sequence length 291
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa4A00
1E0TA 2KX9A 3VAVA 3SRDA 4IMAA 4RPPA 2HROA 3E0VA 1XG3A 1A5UA 4YNGA 2X0SA 3EZ4A 1O68A 4L80A 3GR4A 3B8IA 1O5QA 3BJTA 1ZJHA 3E5BA 4HYVA 4B5UA 1S2UA 1S2TA 2HRWA 3T05A 3EOLA 3QV7A 4MG4A 1JDEA 4QG9A 1U5VA 3SRFA 1M1BA 4IQDA 3LYEA 1E0UA 3SRKA 3BJFA 2HJPA 1IZCA 2ZE3A 3QQWA 3I4EA 4TV6A 3EOEA 1SGJA 2E28A 4HYWA 3T0TA 4B5VA 4JPGA 1O66A 2V5KA 4WJ8A 4LSBA 1XG4A 3KTXA 3T07A 1PKLA 1OQFA 3P0XA 3QV9A 3LG3A 1PKYA 1F8IA 2OLSA 1F3WA 1F3XA 4KCVA 4L9YA 1S2WA 4FXFA 1GGOA 3HQPA 2WQDA 3R4IA 3G2GA 3OYZA 1KBLA 1DQUA 3QV8A 2VGGA 1AQFA 1M3UA 4IP7A 3IS4A 4KCUA 1F8MA 1DXEA 1PYMA 3H6OA 3QTGA 4B5TA 4TV5A 3QZ6A 1T5AA 4KCTA 2QIWA 3U2ZA 2XZ7A 4L9ZA 2R82A 2DIKA 1A3WA 3MA8A 3KHDA 3OQ8A 5TAOA 1ZLPA 4QG6A 1DIKA 1KC7A 3HQNA 1VBGA 4L7ZA 3N25A 2XZ9A 1A3XA 4G1NA 4QGCA 3PP7A 4B5XA 1IGWA 3EOOA 2VGIA 1MUMA 4QG8A 3GG8A 1A49A 1U5HA 3M0JA 4B5SA 3SRHA 2L5HA 1DXFA 1UJQA 2XDFA 3FA3A 1F61A 4FXJA 2DUAA 4DRSA 5JVLA 1OY0A 3QLLA 2VWTA 4KS0A 3QV6A 4B2DA 3GQYA 3HQOA 2VGFA 4YJ5A 3FA4A 4B2DD 1S2VA 2G50A 3ME3A 4KRZA 3M0KA 3OYXA 3PUGA 2VGBA 1PKNA 1PKMA 2BG5A 4IQEA 4MF4A 3E0WA 2VWSA 4B5WA 2HWGA 1Z6KA 4ROQA 2V5JA 1VBHA 4KCWA
chains in the Genus database with same CATH superfamily
3C8FA 1OC6A 1AH3A 5K7JA 4P7LA 3BK0A 2ZRZA 4JIQA 1JEZA 3IEBA 2W9MA 2XH7A 1QU4A 5DY3A 1JCLA 1XRFA 4PH6A 3VIOA 3QV7A 1I1WA 4ZE4A 1QK2A 1GJWA 4DX3A 2QVHA 3I10A 2QDHA 1GOWA 4RDYA 2ONEA 4MDPA 2J9ZA 3TQPA 4OT7A 2DH3A 1DTNA 1SW7A 2Y7DA 1OFDA 4HNUA 2E09A 4IGHA 4GZ7A 1VC4A 4XBJA 3T4WA 2H3BA 3FW6A 4C6JA 2WAGA 2IKIA 1M7PA 2E6YA 3RG6A 4NVTA 3EEZA 1W1VA 2I17A 1AQFA 1ZQ5A 3QM3A 4M80A 1CZ1A 2UV8G 3GUWA 2XIQA 4KCTA 4OV4A 1UWIA 4C6LA 1E40A 2WCSA 3IGXA 2Y0FA 2GJRA 2WZHA 3FA5A 1TPB1 5CBIA 3MS8A 3SRHA 2G8ZA 1WDQA 4K39A 3CO4A 3MANA 3SQMA 3T09A 2R9RA 4IFOA 3LXAA 4V1XA 2BGSA 4JFVA 1XIDA 3PPHA 3CQKA 3G1SA 3GD6A 3FXYA 4YHEA 1V6TA 5FKYA 4QJ4B 1BXNA 3UXIA 4ROQA 5DMNA 2J27A 4UFKA 4C6OA 1Q6GA 2VFGA 5D04C 1TQXA 1XL9A 2R14A 4UTUA 3N14A 3BICA 3B0YA 1FWWA 3SURA 4A3YA 1XISA 3CZJA 3TTYA 3CPUA 1OX6A 1SZGA 3SCSA 4JY9A 3KLLA 1A0EA 1Q45A 1SW0A 5D2TA 4Z17A 4WCJA 4AD5A 6XIMA 3LHYA 2QDEA 1VIZA 4AY1A 1LBFA 3G0XA 3DHFA 3L66A 1OZMA 1A3HA 3S0CA 1KGWA 3LCLA 1BF6A 1JIBA 1MRAA 3QZ6A 3M0YA 1O94A 4GJ1A 3NQDA 4PRWA 3SCVA 2EKCA 2QUUA 1XFCA 1E1CA 5JIPA 1ZBWA 5AHFA 3CWNA 3W1MA 4M6PA 2J47A 1UC5A 4UQDA 2L5HA 5F2GA 1CXKA 3E49A 1WCGA 4XVDA 4GX9A 1M03A 3Q94A 9CGTA 3GW0A 3AXXA 1Y0EA 2PPGA 2PI6A 4MLRA 1RJPA 3MKCA 4O14A 3RRXA 2OT0A 3T0DA 3QMSA 3MUIA 4J3SA 1Q6QA 3G8EA 1GWJA 4DBSA 3E12A 2F7FA 1K9EA 1IXNA 2XSAA 3EX3A 3DIPA 3R5EA 1NOFA 3VDHA 1LUCA 1XYFA 3S5YA 4ZO6A 4Q4KA 1H1ZA 1TVLA 1SR0A 2P88A 4GKLA 4FR1A 3MUXA 4QG9A 1AZ2A 1RPXA 1KTNA 2YCJA 3AWNA 3KXQA 5LHEA 3G0SA 2O9PA 1UP0A 2JGQA 1CW2A 2VC7A 4O1BA 1ITQA 4AD2A 4WF7A 1KM2A 2DIEA 4K3ZA 1YNPA 4ENLA 4A21A 4OJYA 2OU4A 2V68A 3RNDA 3W1XA 3VIFA 3AICA 1BQCA 2FTPA 4J3ZA 3SO7A 3VFLA 5KZDA 2V38A 4HN4A 1DVJA 3H21A 1AA1B 2QCCA 1PCKA 3W38A 2XH0A 3S5NA 2ZUSA 4QJ5B 4U5KA 3TFXA 1WAWA 4YPJA 4LYPA 4NILA 4ERGA 1S3TC 3GU2A 1VBJA 4MYXA 1NF0A 2ZC8A 3NXFA 3UZWA 2FZMA 3CV2A 1L6FA 2DUXA 2INEA 4JHOA 3GTXA 4Q8WA 1G67A 2XGBA 3V18A 1BXBA 3KZSA 2PMQA 3CNYA 5T26A 2OODA 4KBXA 4LEQA 1F05A 2R1MA 2VWSA 3B05A 2XM2A 3E0LA 1XYZA 4FXRA 1JI2A 2FB2A 2DZTA 3P93A 5HULA 1TWDA 1V51A 1RPKA 5F4XA 2A21A 3IJLA 4AZCA 3NQFA 1R2SA 2FVLA 2WZMA 2E4TA 5D9MA 3M07A 3ISIX 2NSXA 3AIEA 2YKKA 2R94A 3NYDA 1SZFA 3QHMA 3RO8A 3QY7A 1QT1A 4JD4A 4JPGA 3IGUA 2UBPC 3CIXA 2QNEA 1PSCA 3ZVIA 1QNOA 1ISYA 3QKEA 2PURA 3F4VA 3DERA 2PA6A 4PCSA 5I24A 1XIFA 4PMZA 4IP7A 4JFWA 4HOWA 1EC8A 4AHQA 4W4QA 5CPNA 3MBFA 2WJFA 5D38A 5I78A 3QY8A 3APYA 7REQA 2J6VA 3GXNA 3NR0A 2QIWA 4QISA 1FDYA 4S3EA 2Z1BA 1SFJA 1KTCA 2O9TA 4J1OA 1UKPA 3TKFA 3OVRA 4JTFA 4Y8FA 3W25A 2TYSA 2J7HA 5DLCA 4Z1CA 1K03A 5FF7A 1DQWA 4WEVX 3AIQA 4LOCA 5TD4A 5CLWA 4I3GA 2CBJA 1BWLA 1QPRA 4ZEPA 4MPKA 3OA5A 1NEYA 3CLWA 4GBDA 4ORIA 5CPSA 4MTVA 3HOJA 3WUEA 2X8RA 3E2RA 1LP6A 2P0OA 3BOLA 1QI2A 4TXEA 4QQ3A 1UD5A 2F6UA 2FHFA 1ZENA 2JE8A 2A1YA 3WUFA 4Q3MA 3OO2A 5DRIA 3WK1A 1TELA 1V0LA 1Q6EA 1RK5A 3OIHA 1UJPA 1CLVA 1E6ZA 1OG0A 5HJLA 3UETA 2OEMA 3N4AA 3ZR4A 1AH0A 4LUTA 1IYXA 3GVVA 3PF3A 1XFBA 1Y5WA 4NSBA 2X1RA 3JZUA 3MHFA 4Y96A 1PIGA 3WQPA 3WLHA 3OLEA 3PBYA 4OFCA 2OG9A 1HZYA 4DO7A 5BNKA 1AJ0A 1XBVA 2IUZA 3I3BA 3P6LA 3EKGA 4DY1A 4DHGA 1YRRA 4ATLA 3E0IA 2NVDA 1UD6A 2QDGA 4DWSC 3IJ7A 1QW8A 5H8MA 3BXWA 1QBAA 1XQLA 2J13A 3O6YX 3IGHX 4RW5A 2Z0IA 2AL2B 4W5ZA 3VOCA 3GO2A 4UMAA 1SVDA 2Y5SA 1IEVA 2E68A 4XTIA 4GUJA 2PODA 4KWOA 2JEQA 2VWTA 3T7VA 2CKRA 2GWNA 3MKKA 2GSHA 3S5SA 1ZU8A 2ZUUA 1BTMA 2QZRA 3QMRA 4N4PA 3PUOA 1KXTA 4B5WA 3SUUA 4CD4A 3CL7A 1TV4A 3GNXA 2C71A 4BJHA 2P3EA 2YXOA 1FH9A 4KERA 5C6MA 3R0KA 1NDZA 1TPH1 4NXKA 4B92A 1FWFC 1JCJA 1S2UA 3CU2A 4E5TA 2CZEA 1ZS2A 4UTTC 5CZTA 3IJQA 3WSUA 1Q65A 3DFSA 3A4XA 1SGJA 2WKJA 5REQA 2NVAA 3ARSA 5K2ZA 5JU6A 4YU1A 2R91A 4GVIA 2PTYA 2ZUVA 3ZVHB 1BYDA 3LA4A 3IJ6A 3RU6A 3ZJ8A 3E0FA 1EO7A 1PX4A 2GGGA 3BURA 1I1XA 2YA1A 3ENLA 1VRDA 4C6CA 2AOSA 3HG5A 4RNFA 1KCXA 3KHDA 3OHIA 3WL0A 4D9PA 2W0UA 4J5NA 5HPCA 3TYUA 1EJWC 4LBSA 2CFFA 1KBKA 3G18A 3ITLA 3TN3A 5IOBA 2G3NA 2DP3A 2OLHA 5HK4A 3DAQA 5F7UA 4BA0A 2AQOA 4KRTA 3C3UA 1H11A 1PIIA 2WZTA 4LCSA 1DJZA 1XD1A 2QJJA 4JQAA 3FDKA 5M17A 4YLWA 2NQJA 3HBLA 1TWZA 1VYRA 1Q3NA 2DUZA 4N7QA 3QTPA 3W87A 3B8SA 3OP2A 3PBVA 2WPGA 1PB0A 1DJIA 4O54A 5HINA 1JZ8A 1E1FA 3TN4A 4KWVA 1KFBA 4C1KA 4EK7A 4F0KA 3F2CA 1WE5A 3QQWA 4K7VA 4UTMA 3I4EA 4JX4A 4BK9A 2EPLX 2YX0A 4A05A 4IZGA 3CZEA 3CQ0A 4Z1BA 3HJEA 4Q8MA 2Z4GA 4UTFA 3K4DA 3THQA 4C7FA 3FDGA 4ORMA 1VS1A 2ZX6A 4I8DA 1YDNA 1FWRA 4AMCA 3W75A 3SCPA 4HA0A 2BOGX 3OZYA 1BGAA 3UEQA 5LNWA 4WSJA 1U22A 3T55A 4MIMA 4XVEA 1GW9A 3LNMA 1LJYA 1OYAA 4BI6A 1NQKA 1BG9A 3HURA 5A8PA 1M04A 4DJED 3MSRA 2PRHA 3P62A 3BG9A 3R6IA 4JCMA 1QPKA 1RD5A 5LSMA 3DESA 3QV6A 4LUYA 1YDVA 1MDLA 3H26A 3KWXA 3UESA 4AF0A 2PWGA 2BY0A 3FCPA 3U6WA 3TJXA 4G9PA 5AC6A 3SCWA 1NFGA 5I3GA 2OQLA 4JTQA 1V0NA 3GG1A 4TQTA 4C90A 2Y85A 3HPFA 2D2JA 1N8FA 2C91A 2OO0A 2DU2A 3LCHA 1JAEA 4HOXA 1XLDA 4YTUA 4Y8EA 1IXPA 3CH0A 1JRBA 3OLIA 2IXVA 4RZ6A 2BP1A 3NEVA 4LT9A 2HVMA 5DMMA 3TJ4A 3BW2A 3LHUA 1HF6A 2XGZA 2UWFA 1F3EA 4IGNA 3I4KA 4EF8A 3PZQA 3BLDA 4QCFA 4IXXA 5REQB 5I6SA 4QRNA 2EG8A 5CH9A 4LS0A 4AZGA 1LF1A 5A6AA 3CAVA 3VXGA 3T2OA 3TTSA 4F8XA 1KQZA 1ME8A 1QHZA 4C6QA 4PMJA 1OCBA 1BYCA 3WJSA 3CZ8A 3HGSA 1DIDA 2VVSA 2VGIA 4NL1A 1TO3A 3NPUA 4IFRA 4X2RA 5FACA 2BVWA 2OEJA 4LNCA 2W5FA 1I4NA 4NUWA 4NZ4A 1V5XA 4QE5A 3SW6A 1P7TA 4PL1A 5HJYA 4MM1A 2NXGA 4O1CA 5L6UA 2J78A 1R47A 4AXNA 5HJXA 2GWGA 3LM3A 1TPFA 3NYZA 2PDQA 4V1YA 4EXBA 4O1EA 4W7WA 4A8NA 4P8UA 4O1FA 2DZAA 4H6EA 3W7PA 1S39A 1UA3A 3OGVA 3B0PA 3SFKA 1ZBVA 1QW9A 3CWHA 2O55A 8XIMA 5PTDA 1E9IA 5A6SA 1BKSA 3A6OA 4AXKA 1EZWA 2H9AA 4O19A 2BVYA 1VB9A 3H4XA 4HK5A 3C2OA 1PUDA 1TR1A 4GVFA 3EWDA 4R7OA 2NLYA 3PULA 4HHHA 2YXXA 4OQVA 2QLYA 4AVNA 3Q37A 4M6QA 2WQDA 4A3QA 4DQWA 1X96A 1Z42A 3QTGA 3V1HA 3OVPA 3BAWA 1FWEC 3H8AA 1NM9A 4PRTA 4JYEA 2YBUA 1I0BA 4CCCA 2CBUA 3KVKA 1X6UA 1UP2A 2NQ9A 4K68A 3AXIA 4TOQA 3R25A 5H8PA 4TTGA 2FTWA 4GPNA 2BGNE 3ZWTA 1NH6A 3S6TA 3B97A 4Z2KA 2OOFA 2WMFA 5AHIA 1GPFA 4HNVA 4S39A 1FWIC 3C61A 3EB3A 1EOKA 3WLKX 4XUGA 1MNSA 1M7JA 1KRMA 2NWSA 3WLOA 4DNMA 3S46A 4O18A 2QJGA 3T9PA 1US3A 1F07A 4AX7A 2XG9A 4DZIA 2VUYA 4LVBA 3WNMA 4LX4A 2GZXA 3FVMA 4DEFA 4ZQOA 1KNWA 1LROA 5CSRA 1JYNA 3PTDA 1XM3A 3L9CA 1CTNA 3ABZA 3L0KA 1I9CB 3DHDA 4RKAA 2X0SA 2XWEA 2C79A 3GHUA 3LCIA 1XD0A 1RSCA 4HNTA 5HMSA 1KFCA 2VEMA 3MP5A 1FKWA 3ZOAA 2CU0A 4WJ8A 5EFFA 4UTJA 4J2MA 1W5QA 3GDLA 4V28A 4PULA 3K4AA 5GNYA 4EE9A 5LIXX 3NG3A 1YE6A 4ROPA 3M5VA 4ZGYA 1OFPA 2VCBA 1C7SA 3SIZA 3T0CA 3VD9A 2YCLB 3NSXA 2QCHA 1R3TA 3A3WA 2ZWYA 3G1YA 3BARA 4HTBA 2J7CA 2QHAA 1AQHA 3VKKA 3PR2A 4KMQA 1CXLA 1C8XA 1JL8A 1AG1O 3FNDA 4NXSA 2B7QA 3NL3A 1IT0A 3KL3A 1J0IA 1CIUA 5KMYA 1BYAA 1ZRQA 4FZIA 2QQ6A 4JEQA 2WJZA 4O13A 5K9XA 2JKEA 4XKYB 5D05A 1TV3A 3VKJA 4RX0A 1ZZMA 4GINA 4EWND 2WCAA 3VC5A 3G1HA 4V27A 1W32A 1M6JA 1P0BA 5IFPA 5E1QA 3E0WA 3O0KA 3PAOA 4US5D 1H49A 3SN0A 2RGLA 1BPLB 2W61A 3W3OA 4R85A 4Q4QA 4Q4MA 5FF2A 1GZGA 1XIHA 4UQEA 2GVLA 1DP0A 2CLEA 3Q2DA 3TZNA 4U33A 5KSWA 3IVUA 3PC0A 1LQ0A 6PTDA 1NDYA 3FYOA 3IAQA 3TROA 4O1DA 4FNSA 4K8GA 4LU0A 5M3WA 1GG0A 4I6KA 3AXHA 3QOKA 1P4CA 4FLSA 2Y63A 1DQUA 4GC3A 5FD0A 7CGTA 2A6NA 3ATZA 4PE8A 1VFLA 4GUFA 1UD2A 3CEPA 4GBUA 1S5TA 4XAZA 1YDOA 2QCDB 2D3LA 3I7QA 3TXVA 5TAOA 1LRNA 3RILA 2WKGA 1F6PA 2VTFA 2WHLA 3GAYA 3VUPA 1R3QA 3N2MA 3PWGA 4GISA 3VKAA 3LZ5A 3MI2A 4ZOBA 1PHQA 1RAKA 1TPEA 1X6LA 1W1ZA 2PDUA 3WD0A 1Z89A 5E0FA 1QNQA 4KS0A 5E70A 1OFAA 3JVAA 4L4OA 3NDZA 3ZT5A 2QVNA 5E6ZA 1JG9A 2GDQA 2J75A 1FX6A 1V0MA 5I3HA 2CNCA 2TRSA 3GG0A 1XICA 5E0CA 5EBUA 2RJHA 1TJ0A 1RVGA 2A79A 4IMAA 4LVFA 4DUOA 4W89A 1YXCA 7XIMA 1EC9A 1Q85A 3GH5A 3S9IA 3NCOA 2ZE3A 4AZ6A 1CDGA 4N6FA 5FF0A 1TTJA 3QH2A 4HYWA 3BLOA 1VH7A 3A9BA 1FCUA 3CJPA 3V5OA 3MUAA 3Q67A 1EYWA 1PAMA 4NNAA 3UVAA 2OJPA 1I0DA 2VD9A 1DORA 1FWDC 1VLWA 3WD1A 1J11A 3L2IA 4J2PA 3MWAA 4L4LA 4J3XA 5EMMA 4US5A 2XU2A 4PTVA 1K8YA 1HJWA 4IP5A 2E5BA 5C7HA 4D6HA 2ZKMX 3LHZA 3NNTA 4JTJA 3ZT7A 2VX4A 1JZ4A 1DJNA 1G7UA 3RRAA 5BCAA 4GIRA 4OHQA 4UNKA 2ABAA 2D73A 2I14A 2GJPA 4F0SA 2YCEA 1A5MC 2OGYA 4M19A 3CL6A 1J0JA 3FSTA 3W28A 3THUA 3N11A 3CL8A 1TREA 1FDZA 4H83A 3GE7A 5I3DA 3U7VA 2WVUA 2WNQA 3H55A 3PTKA 1RALA 4QITA 4DBUA 1V6XA 1T8XA 4FIQA 4ZR8A 1XIIA 3TCEA 4EOUA 1GVOA 3N2CA 3HZ3A 4MJ2A 4WKFA 1X7FA 3EMZA 3K1GA 2V82A 3ARWA 5CC3A 5BWFA 1F73A 1KM4A 2VZVA 3IACA 3NQ2A 3CPGA 1DXIA 2XVNA 3OGRA 2ANUA 4Z0SA 4IP4A 2X05A 2KAUC 2D0GA 4NJHA 3RR4A 3GBDA 3QV9A 3P8IA 3T0AA 1KGXA 1UH2A 2D23A 1AQ0A 1JULA 1PWMA 3LX9A 3UW6A 1V7AA 4EAMA 1GZ1A 1TUFA 1ZAJA 1BKHA 1E6SM 2OWWA 1TV5A 3W2NA 2CHRA 1A53A 3PM6A 2Q02A 4QGCA 1R8LA 2CXGA 3RPMA 1XC4A 1QI3A 1MUMA 1XCXA 1UD8A 5BOOA 1DTUA 3W7GA 3FGCA 5IBXA 2PC8A 1Z7AA 4W86A 2NT1A 4X9SA 3KW3A 3TJIA 4AIEA 3TYDA 3BMXA 4IFKA 4WSHA 3RITA 3WO8A 3O6AA 2CWXA 1IT7A 4BKNA 4UQ9A 4J3UA 2PDIA 4JNZA 1UW9A 4U5IA 1EYEA 4XD4A 3WH9A 3F7JA 4AH7A 3TLQA 3W23A 3RJXA 3HMJG 1DJGA 4JS3A 5FESA 2VHLA 2PTZA 4B15A 1JRCA 2P8CA 4MZ1A 3FKRA 1K9TA 4ZQMA 5EY5A 2Q8ZA 2A5HA 1GHRA 3SECA 2JFEX 4QQUA 3VGHA 1J93A 1JGIA 2D1ZA 4P5UA 4AYSA 3M0LA 4IMGA 1W1B1 1CGUA 1V3LA 1TKKA 4YTQA 2PF8A 4S2CA 3C52A 1RY0A 2GJXA 3ABOA 2DZUA 4U4MA 2XZ7A 2FJKA 1GNXA 3M5ZA 3URNA 8CGTA 2ALRA 3LCFA 4XKMA 4DELA 1ONEA 4ZO8A 4ZODA 1OG6A 1XBZA 5EBAA 4QS6A 2X2YA 4J3WA 3UJFA 1SO6A 4MY9A 3WMLA 4E8DA 3LCXA 5A6KA 4X63A 4RNJA 2F6KA 2QMJA 1QBBA 2Y7GA 3A5VA 2W4XA 3D47A 3NAVA 4HPGA 1ODUA 1V02A 3W7CA 4IPLA 4G8TA 3BWWA 2WHKA 4S3FA 3VAVA 1DYSA 1OBAA 4NYYA 5AHNA 4LPCA 1X8FA 2WNWA 3GFXA 4OU1A 4O0QA 2ZC1A 1O5XA 3GNNA 3R10A 1WUEA 4HMEA 4H6RA 2PS2A 3DDMA 3VM5A 4I8YA 4GNKB 3WX7A 4MYAA 4OGZA 1DE5A 2VDHA 3W7HA 4A3HA 1H51A 5MHBA 3LG3A 3EKZA 1CX9A 3WLNA 1S2WA 4K1GA 1TE6A 2XFYA 2Z25A 3PK7A 1VFOA 3PZMA 2PCQA 4QE1A 4M5PA 4CU7A 2AMGA 2OEKA 4DVOA 2Z1SA 2PP1A 3UBPC 4S3BA 4QFUA 3HQNA 4M6UA 1EJTC 5BU6A 5U7SA 4CU8A 4W8BA 1KRCC 4M24A 1LG1A 4GIAA 5A94A 2J8GA 3AMLA 2Z1KA 3TNBA 3ITCA 4FOUA 5F4WA 3LTSA 1UROA 4BFAA 3H12A 2HTMA 3SCUA 3VGEA 1WZAA 1GVQA 1RK6A 2OLAA 4LF2A 2DDXA 3BG3A 5AC7A 4PFMA 1LBLA 4EPDC 3EA1A 1LWHA 1FOBA 2GLKA 1I75A 3WLPA 1G4TA 4XUYA 3AS2A 2RAGA 2C14A 3N2OA 1Q6OA 1ADSA 3O8AA 1R2RA 3AFBA 4A4AA 5E5CA 1T0OA 3GB6A 4B4HA 3PG8A 3NZQA 4IF2A 2E5DA 3ALGA 3VO0A 3HIJA 4DZAA 3BE7A 3WH7A 1B3VA 3DZ1A 3M5YA 3BCJA 4CQ8A 3T42A 4UNLA 4ZFMA 1WXYA 2QIIA 3BQ5A 1AQMA 3H23A 1VBRA 3WLQA 4KEVA 2OZTA 4IPJA 3MO4A 3ANUA 3RM8A 1XCWA 4FLQA 2REQB 4KEMA 1ZHAA 1N2VA 2DQXA 3L12A 2VX6A 3OBAA 1UR9A 4JTEA 4ICNA 1OY0A 2HK0A 4RNIA 5AN7A 4E38A 4R9OA 3G1FA 1PIFA 1O7AA 3VGFA 4R9XA 3EX6A 1NP2A 2HV5A 3W6MA 3GXIA 1CBGA 4AD1A 2E7FA 3W84A 2FPVA 4JIRA 3AIVA 3SRDA 5KTLA 1KV8A 5XINA 3GR4A 4CNSA 3SGGA 2FZ8A 4LYKA 1AMKA 2VEPA 3DOPA 2B7NA 4JGDA 5LGXA 1JZ3A 4C65A 1MUWA 3RM9A 1QATA 3ITGA 3W83A 1A0DA 3KOXA 5G1TA 4N9BA 2V3EA 4L1WA 1JCNA 2VX5A 4GQBA 4L56A 1V79A 4GXPA 3LPFA 2C15A 2WMKA 1XDJA 4FLOA 3S2CA 1TZZA 4O53A 1WDDA 1JYVA 2V5CA 6REQA 4EPBC 1XKJA 2D24A 5CG7A 4E2DA 6TAAA 4KEZA 1QWKA 3LQLA 4AISA 3G5EA 3QZAA 3VTRA 4IPNB 2FDMA 1D8WA 1A49A 1XSJA 1PEZA 3P2VA 3WUGA 2NSOA 2G3JA 4ZOAA 1XIMA 3ITTA 1GOXA 5D32A 1A5LC 3TONA 4JTRA 2DT1A 2J25A 3HQOA 2VC9A 2PTDA 5BU9A 4PUJA 3BSMA 3VMOA 1I6NA 3DFNA 3PBMA 1P43A 1DBTA 2F6XA 3S4TA 2AL2A 1BGGA 2RDWA 1W31A 3MDUA 3ZR5A 2CEQA 1FUYA 3WQ8A 4Z0JA 1FHVA 3VCNA 1HJXA 4IH3A 1MXGA 3V7PA 3SSJA 1FRBA 2VC5A 4LAOA 2CCRA 3APTA 3GWQA 3M7SA 4LXFA 4RDZA 1O12A 2H8XA 4IIDA 2X30A 2Z27A 4HOZA 2Z6JA 5AYIA 3LBCA 3NEHA 4OKDA 2E9LA 3NDYA 3W86A 1UR8A 4J35A 2PDKA 3LMZA 2QYGA 1XKYA 1UQZA 1F3WA 1K4GA 2QCDA 3AAMA 2QCFA 4QLLA 4MNLA 1V6UA 4ATWA 3QLDA 1EIBA 3WEZA 1J6OA 3CT7A 1F74A 3LTYA 3NZRA 1XLLA 4TO8A 4EWJA 4FNPA 4UTWC 4HB7A 1EKOA 1XLCA 4C6DA 5XIMA 4R53A 4QG6A 3P74A 1E15A 2QDDA 3VI2A 1L0PA 3ZJKA 2E8YA 5FF3A 1EF2A 1W37A 3ZVHA 3MMWA 4EANA 2B7OA 1LG2A 5D2XA 5BXSA 2VEKA 1NF7A 2OZ3A 5AY7A 3M9YA 4S1FA 4UTLA 3BSGA 4R88A 1R7AA 4XBKA 6REQB 3WY1A 2VGBA 3NDOA 1TTPA 4NZCA 2Y8KA 3M5XA 3KBVA 3W00A 2DJXA 4X60A 2FVKA 2C0HA 2PF0A 4G7FA 3LU2A 4HCHA 5FEWA 2EO7A 3A23A 5KZMA 1GQLA 1HXJA 3OHMB 5HNNA 5DBTA 3R58A 3GNRA 3OOQA 4CQAA 1KXHA 1K02A 3R0UA 1YMYA 1I2QA 2ZE0A 3ZXWA 3WK3A 5G4EA 2VQTA 3LOTA 5FJPA 4IISA 4MADA 5FA5A 4KGJA 3N4EA 1OIMA 4H04A 5I0DA 3B06A 1HVQA 1E3XA 3VFCA 3QGVA 1ECEA 5FL0A 1P48A 1CNVA 5CPTA 5LA0A 4AIUA 1FFRA 3A47A 1UBPC 1XIGA 1G1YA 1IEQA 2DT2A 4Y2WA 4DUVA 2E8ZA 2PE4A 4AVOA 4IIFA 3PP7A 4RDVA 3NURA 1E5NA 2F38A 5DCDA 4Q4RA 1W8SA 1MI3A 4JIIX 1TPDA 4B5SA 5L9FA 2GGEA 1QJWA 2P1FA 1SJCA 2V3DA 2W91A 4Y9OA 2ZUNA 5TNVA 4PTMA 1J0YA 3CHDA 3RM4A 1QUMA 3BAKA 4UOZA 3O07A 3S9ZA 4IIHA 2GGHA 1WDSA 1JPKA 4DN1A 3OZOA 3CIVA 1NELA 2CZVA 3CMFA 3TMQA 5FEZA 4PMOA 2INZA 2XN1A 3G0UA 4OTKA 2HPIA 3GVRA 1RXOB 3SRFA 3DECA 1WKDA 3L4TA 4U2ZA 1JD9A 3V36A 4O12A 2GUBA 2E5CA 4NJKA 5LKYA 1O66A 5AKQA 3WMCA 4Y7EA 4FNQA 4W85A 5JBDA 4JEJA 2IMRA 1L2UA 2WSPA 1K8ZA 3DKLA 3SB0A 3QVQA 2WANA 2ASHA 5CC6A 3PTMA 5KZ6A 4RE3A 1Q6CA 1ALDA 1SU5A 1KD0A 3B8DA 3F5LA 1GOQA 2PFHA 1QI5A 3UXAA 1VFSA 1MEWA 4KWUA 4P8XA 4A3UA 1E70M 4S2BA 4LFYA 3PZOA 3CO8A 4AD3A 4PMXA 3N12A 1FP8A 2D3NA 2E1WA 5ECUA 4CD8A 4JTHA 3WQOA 4KQNA 3JRKA 4OBTA 4LBUA 1HG3A 2E3ZA 3M47A 3NZGA 2X09A 2ZZ7A 3F03K 3MZNA 4NI3A 3O6DA 2ZTJA 1OGGA 2YL8A 1W9XA 3GHSA 5HDRA 2Z1WA 3BW3A 2C19A 3RLVA 4AZ5A 1XSKA 3D3FA 4A3RA 2GPTA 2HROA 3WLIA 4F3HA 3GZAA 1HTIA 2OMAA 3B4YA 3E5BA 1W17A 3T4CA 3CTLA 1XPGA 4FS9A 4AEEA 2G3IA 1G94A 3CH9A 2PDBA 2SFPA 5A2CA 4D71A 3G6MA 4AW7A 2E6DA 2QPXA 5CC5A 2CLPA 1UR2A 2ISFA 3MTWA 3RPTA 1I2PA 4JQ2A 4IMDA 4AWUA 4XG1A 3TSMA 1PKYA 1E0VA 5I06A 4DBWA 3I6RA 3MP4A 4FEZA 4HPHA 4NZ1A 5DN1A 2IW0A 3EWBX 4YL2A 2ABBA 3SCTA 3OZMA 2VENA 3FXGA 1W9VA 2BZNA 4M3PA 5LXEA 2V8ZA 7A3HA 4RLIA 3M6YA 2Y1HA 2PLKA 1VR6A 2GDVA 4TVDA 2WHMA 4ACZB 1TVPA 1KO0A 2ZDRA 3CUZA 3NPXA 3I6TA 5HNRA 1ISVA 1DWJM 1RCOB 4RL3A 1UH3A 3NL5A 4MB3A 3DG3A 4R7WA 2OWCA 4H7VA 2XSXA 3TAOA 1A5NC 3DHUA 1J12A 4C60A 5BMWA 2VVNA 2V3GA 3EPNA 1JPDX 4LJ3A 2ZWZA 2QMKA 3WH8A 1W3KA 3NSNA 4BEUA 1W5MA 4D6DA 3QJAA 1J9YA 1Z41A 5A8NA 3EZ4A 4YTTA 5A69A 1N8IA 3AOFA 1ZALA 3NM3A 2J62A 4JKLA 3QQ0A 4GXMA 1M1BA 1ODZA 5CBJA 3THAA 3C0LA 2OZ8A 3OBEA 1UWAA 3W0KA 1H61A 3POCA 1OVDA 2IPFA 3C4UA 4GQRA 3V0SA 1MRQA 3MZ2A 4DJFC 1F8IA 4X61A 4TR9A 3S2NA 2A3BA 2R8WA 4DF0A 1ADDA 2QPSA 2WOQA 4LS1A 4B9ZA 3WDHA 2IXUA 3VDGA 5A8OA 1BF2A 1UR4A 1WBHA 4MY1A 1YADA 5FSDC 4MNJA 1GONA 1KBBA 5ABHA 1E1EA 2O0TA 2XTKA 3ARUA 3KTCA 3P7YA 1PXGA 3MI6A 3TXZA 1N8WA 1HP5A 5HQLA 2F61A 1V3KA 4WXYA 4QTGA 2V6AA 3VZYA 3K2GA 1MFVA 4XV0A 5A8GA 4QSFA 4BI7A 4FF5A 4M0XA 1OT2A 2FYMA 2Z28A 1TMQA 3QZEA 3NOEA 2DZVA 4YYFA 3USZA 3W7NA 2KX9A 2YZ5A 3TTEA 4M29A 1XG3A 1XLJA 1B0IA 4C5ZA 1UQYA 2OQYA 3N04A 5D9NA 4DXXA 4HCDA 3GSMA 2WXDM 1S2TA 3T8LA 1OZQA 2O4QA 3LLXA 4G2DA 1CXFA 2OYKA 3TYBA 2XIIA 1CWYA 1R2TA 1FCBA 3P0WA 4RDWA 4A22A 1VEPA 2EGZA 2CZDA 4OOZA 4GRSA 4XSLA 1HKJA 1G0CA 4BHYA 5IFTA 3QHOA 5LZLA 1DXEA 4IHCA 3PSWA 4CN6A 3PB2A 4L1GA 3UP8A 4E6MA 3MWCA 4YYCA 2YCKX 4FOJA 1HKKA 2ON3A 2JQXA 1UA7A 2PRMA 1MQQA 4U10A 4US6A 3CUIA 4WR3A 1K9DA 1GOOA 1KFJA 4E4FA 3OTRA 4K36A 1XJBA 1XSIA 1OF8A 1HQTA 1G4EA 2R24A 1H5VA 3DI0A 3NM1A 3GVGA 3U4AA 4YXGA 6TIMA 5LHFA 1GYNA 3DG7A 4JFUA 2JKAA 2TAAA 4PB5A 2VI0A 1SSDA 1I2OA 4GCAA 2YB1A 2REQA 3L0GA 3VOFA 4NF7A 4ICMA 1GOIA 2XFFA 3OU8A 2WMIB 3ZS4A 3AROA 2J74A 3TSDA 4Z2GA 5M03A 3CUJA 2VFIA 3NUKA 2BXZA 3M4HA 1V7YA 3COTA 3SN4A 2ZFAA 1WV2A 1TWWA 1QRQA 3D5HA 3U57A 2FVMA 1AJ2A 3UXKA 1SPQA 1OABA 4V33A 4FR6A 4IQJA 1IHIA 3A3HA 2OVLA 3B8VA 4Q8OA 3EPMA 3WJYA 4H9UA 3IAPA 1AMYA 1S5WA 1HKMA 4OOUA 2I9UA 2XN2A 5BW6A 2QULA 5HATA 3W1LA 2FMOA 2O9OA 2LLEA 3LCGA 1WYIA 4UQBA 1V3HA 1YPIA 4W7VA 3C2FA 3SJ3A 2I57A 4ASTA 4B91A 2GFTA 4U28A 1VJZA 3CZKA 3RUBL 3ZIZA 3ZFHA 1TMLA 1U1JA 4UFJA 4BI5A 3U48A 1EUNA 4U3AA 3CQHA 3M16A 5G2IA 1B3XA 4H4IA 4R27A 2YFNA 3BOXA 1MQPA 1W3LA 3ECQA 2PDNA 1DXFA 2X0HA 2ALDA 3DXIA 4ZMGA 1Q6FA 5JVLA 3FK4A 3WKZA 3VMPA 4I90A 5FOOA 1OCNA 4LUJA 2RGMA 2J9XA 3HFYA 3SCNA 1HJVA 2NWRA 1Q63A 4JX6A 2BDQA 2ADAA 2G97A 4PR4A 1OX5A 1FHLA 4GUHA 4UIOA 1AVAA 4HHLA 2DZXA 4L1XA 4XIAA 1KCZA 1EJVC 1S1PA 3LPPA 2E0PA 3IIOA 2RDUA 4PMQA 3ZSSA 1QHOA 3QY6A 1B54A 3LPOA 4JNYA 3LYEA 1L2QA 4DNHA 1JCTA 4R5EA 2J7DA 1R3SA 4KWWA 1LLZA 3LLDA 5CJMA 4AUBA 4AC7C 3K4WA 2FZDA 2Y62A 2P3ZA 4JTIA 3EXSA 1ZB5A 1E4MM 3H4WA 5E09A 3LGDA 3QV8A 1DL3A 3M0VA 4PGLA 2Z00A 4B5TA 1J2BA 1SZNA 4GHRA 2EPOA 3EWYA 3N9KA 2VXNA 1ONWA 4DWSA 2QCLA 2A3CA 3OPSA 1BG4A 2OELA 5LNRA 3AUJA 4H7ZA 2Y5JA 3W7LA 3O0FA 3N18A 3ARPA 1D3GA 3FV9A 3M0JA 1MQRA 4HPXA 1YX1A 3C5QA 5DCBA 3FAXA 1SZRA 1VFMA 4ZCWA 3KTSA 4C91A 2RFGA 2DZPA 2XHYA 4REQA 2ISDA 4UFIA 3GRIA 2DPEA 2I5GA 3BH4A 1YIXA 3XISA 1EC7A 3CIWA 3AJXA 1XWYA 4CCZA 3WJWA 2GQAA 3WNKA 3A9IA 5AYYA 1KA9F 4HD5A 3MMUA 4H6QA 3QEZA 2ZICA 3M44A 2FTYA 3TOPA 4IJRA 5CPLA 5G4HC 1CGWA 4HT3A 2O7QA 4Z1DA 2Y70A 1RJRA 1W3TA 1ADOA 3ES8A 3P5YA 3CGTA 7REQB 4OUIA 5J04A 1W1IE 3IK2A 4Q8PA 3T07A 4NAFB 4F9JA 2JK2A 4GZEA 4K1WA 2AQVA 4JTSA 2YOCA 1J18A 4RCXA 2XVGA 4LWWA 5AOUA 2VL4A 2C3ZA 4GZJA 1EA9C 1WXJA 4L6OA 3WBXA 1VCFA 4I9AA 5D9OA 3LSBA 1Q4WA 1QPNA 5ABGA 1QDSA 4BWLA 1XDLA 2VRJA 3W7KA 4MKVA 1MWOA 5EU9A 1EP1A 2V5BA 1XV8A 3C3NA 1XW8A 1R86A 3GH7A 1EJ7L 1OJXA 2R1LA 1EGVA 3V35A 4LNYA 1QMLA 3NTYA 1TQJA 1IEXA 4Q8NA 1XLHA 5FAJA 2V3FA 3OODA 2HBVA 3REQB 3WL1A 2GJXB 1E73M 1ICPA 5D2WA 5CBBA 3PZTA 3PZNA 3JW7A 3QBUA 1VZWA 2DORA 9XIAA 3GXFA 4Z08A 4NZ3A 1E3ZA 4DBDA 2V81A 3VD3A 2QUTA 1TCMA 1W9DM 3DFOA 5EMKA 4PFHA 3RF9A 4M81A 3CPRA 1G4PA 1AD1A 2QJHA 3GH4A 2ISSA 2CBIA 1US2A 3WQWA 4FMVA 1XINA 1ZAIA 4JQ1A 1M5WA 4MY8A 2C1HA 4HBKA 3ZYZA 1V93A 4H41A 4AHPA 4Q7IA 2FKPA 4AY8A 3ARTA 4QS5A 3W53A 1CECA 3B03A 4D6EA 3PJWA 3NQCA 3GY1A 5D2YA 1L6WA 4GI9A 1SZEA 1YTEA 4GOAA 2E9BA 4HA4A 3CQIA 2P0IA 1J5SA 1KLYA 2F9RA 6XIAA 5ECVA 1GVEA 5TQLA 3CK5A 4OZOA 3MO7A 2YB4A 1F2JA 3DENA 3VKBA 2X1TA 3N13A 3FOKA 2X7VA 9XIMA 4JTCA 3CMGA 2XH2A 4AD0A 1RA5A 3BLKA 1SJDA 1BXCA 2XIOA 1TUXA 3LI1A 5M5DA 3RLGA 1HO4A 5LNSA 5HOSA 4XO7A 3MPGA 1FY6A 4CQDA 1YE4A 4QDMA 1JQVA 3ZZ1A 5DT7A 2G4FA 4P7RA 5D4YA 3V0UA 2ZZ6A 1NVMA 1Z6KA 1TJRA 1KFEA 2VD8A 3KAOA 4NAEA 1FTXA 1CCWB 5BWAA 2WJDA 3GDTA 4YMZA 4NIRA 4QDWA 4MNMA 1H7XA 3WK2A 1E9LA 2ZCGA 1LM1A 2O56A 3ZWSA 1T40A 2OSYA 2PDJA 2C8NA 1KM3A 2PLCA 1SO5A 1JF6A 4DBEA 4NYUA 4MKSA 3HJZA 2OQHA 3EWUA 1RCQA 4CNNA 3CT2A 1TJ2A 5EL1A 3TWBA 3POHA 4F2BA 3G1RA 2W62A 1H2JA 3ZMRA 3HPZA 3B8TA 4H3DA 1OK6A 1RV8A 1T41A 1UKTA 1DJHA 2Y7FA 4IG2A 4UR7A 5C9UA 2FGBA 2DVUA 3OG2A 3SI9A 2PP3A 4O11A 4YCOA 4DUXA 5EMLA 3MB9A 1AUSL 4PB3A 2JIWA 4CKQA 4LV9A 2GQ8A 1HNYA 2P5NA 1Q7MA 1VCGA 3KS6A 4H7CA 5CZJA 2VEIA 4TX8A 1VAHA 1R3WA 4Z2JA 4B2DD 5CPMA 4JYFA 5HMDA 1C9WA 3B4UA 3LRMA 4HP5A 3PPGA 3GXMA 4WRHA 2W3ZA 1K7EA 4DLFA 1Q6DA 3T2PA 5EFDA 3EX1A 3W1NA 2NXHA 3SUTA 4HYVA 1S3HA 4OE7A 4XZWA 1ZGDA 1ZFJA 1JR1A 1IT8A 2VYOA 5AZ0A 4JTLA 1GHSA 3ABRA 2OR2A 1D3CA 4LALA 2DZSA 4Y9PA 1XGEA 3WH5A 2WC7A 1WA3A 3NQ8A 1ITCA 1VP5A 2BNJA 4Z2IA 3MV01 4L9YA 1VFUA 2X7WA 3RHGA 2GDUA 4DI9A 3G2GA 3MBDA 3WCZA 3ATYA 1T5AA 4D6CA 1E43A 1ESWA 5LIKX 3W2KA 4MWAD 1PBGA 4ZO7A 3CWOX 4F0HA 4DF1A 3CV7A 3TYCA 4HMCA 5C70A 1BVZA 4GH1A 4RE2A 4XZNX 1E6PA 1VKFA 1SFSA 3PJTA 3SUWA 4ALDA 3P82A 3FY1A 3B9OA 3QC0A 4RE0A 4F4RA 5A6JA 1TWIA 3AHYA 2H6RA 3DHPA 5K4ZA 3KRBA 4PMYA 1TCDA 1OC5A 3T08A 3EDEA 2WMGA 3BVJA 1KTBA 3UG5A 1GTHA 4GE8A 1BSLA 3KUMA 3VE9A 4UBPC 2B81A 3RLHA 1CI1A 2PTXA 3KVMA 4LF1A 3W7RA 3KOZA 4NZ5A 2AL1A 1YPFA 4EXQA 1DOSA 3P81A 3GKAA 5E0KA 1ISZA 4D2JA 3B04A 1P6CA 4DJEA 1HL2A 4TV6A 4HK7A 3B3DA 1QXLA 3TYZA 4KPLA 3HPXA 1XG4A 4MVAA 4DPPA 3HG2A 4O8RA 3C8NA 3P5ZA 5ABTA 2JF7A 4HA3A 5ENLA 4BR1A 3LV5A 2VRQA 3VA8A 3WJXA 4FNUA 2VFDA 1OGSA 3R79A 5C9XA 3E3HA 4RXGA 1TV7A 3DN5A 3MUCA 3GG7A 4Q8VA 1WZKA 1ZCOA 4MNKA 3EOSA 1XYLA 2CLFA 1P0DA 4WVXA 5MKGB 5I07A 4LH8A 2Z2BA 5I00A 1FWJC 6ENLA 1S5VA 4XWUA 3DBPA 3H2NA 1J0ZA 3GR7A 5E9AA 1MW0A 3W2JA 2Z6IA 1U83A 3B0XA 1WKFA 2ZX9A 3AMGA 4GK8A 2ACRA 2ZADA 1NOWA 4IPPA 5DBUA 3PUGA 2VOMA 1R3YA 2IPGA 1VBUA 3T0BA 4H9XA 3G1DA 3GVWA 3KOYA 1S2CA 4RZ5A 1KGUA 3NSMA 2J9YA 2XN0A 1JNEA 3N2TA 4L9XA 2JEPA 4GJIA 4XZMX 4D6IA 1DJQA 3H7VA 4B5UA 4BQ4A 3GLCA 4PTWA 1U30A 5I77A 4H8HA 5CXPA 2FDSA 4FX8A 4MG4A 2AKMA 3T6CA 1RBAA 3SRKA 1GW1A 3GTHA 3PAJA 4WQ6A 3ZR6A 3TOYA 2IKHA 4AC1X 1IZCA 4LAZA 3R13A 2XSBA 4O8AA 1BAGA 4LSBA 5G2HA 3NVDA 1B9ZA 1X39A 3EMCA 4A2RA 2MNRA 1R7OA 3ONBA 2HNHA 5DEZA 4PBGA 4JIEA 4UOJA 1VIWA 3O05A 1EIXA 1QPOA 3QXBA 1RR2A 4GVHA 1YEYA 3I3EA 4J3VA 2D2HA 3INPA 1SJAA 2EEXA 1CGXA 5I79A 2QUNA 2DIKA 3GXPA 2J79A 1YBQB 4WOQA 4W7UA 2WV8A 1VBGA 3EB2A 4L6DA 5T9BG 1YYAA 3LY0A 3GDKA 3TMLA 3ERPA 3O6CA 3AZTA 1LOSA 1QI4A 4JIPA 1XP3A 3B9EA 3C0SA 3QF0A 3L4ZA 1QNRA 1M65A 1F6YA 1QO2A 5A5WA 3G24A 3PVFA 3GYCA 5CPOA 3CHFA 3U3HA 4DAIA 1JDFA 1KFKA 3W88A 2HXTA 3GX9A 4WDTA 1K6WA 3H2OA 4AIBA 5HUPA 2Z2UA 1JZ2A 1UD3A 3WJZA 3CS2A 3UNDA 3BLIA 1HJSA 1H0GA 3NXLA 4GY1A 3W70A 1MO0A 2GK1B 3FJ6A 4I5UA 4BEQA 2AGTA 5E9XA 3M0MA 7TIMA 1MDRA 4CQBA 5J5RA 2HXUA 1UWRA 1VFHA 1ICSA 5EKYA 2PDWA 1J01A 3KWSA 4H19A 5EYWA 5A6BA 3G1VA 1KQYA 3GYEA 3TCSA 5FSEC 1XLIA 1LL6A 1UIOA 2G41A 4PCPA 3H6OA 3UGVA 2EF9A 1U1HA 2YSWA 1RQBA 2QF7A 1E6XM 1GYLA 2V2DA 3VE7A 1VEOA 1S2AA 5SWUA 3KOFA 4DM1A 1GVIA 4QROA 3AMCA 5AC4A 1XLKA 3RDKA 3TN6A 2AKZA 2WW5A 2IQDA 4HZ8A 1VJIA 2PUZA 1U5HA 3O2LA 3UF9A 2A3LA 3NO1A 1D3HA 3RN6A 1YDYA 4XQ6A 1XYMA 1OIFA 3TC6A 5CAKA 3WH6A 4XD6A 4GG9A 1UR0A 3UJ2A 2G50A 4MWAC 3W7EA 3VCCA 2PDFA 5C2XA 1POKA 3Q45A 2GVGA 4OBSA 5GNZA 4S3DA 4N0RA 1FWAC 3MSYA 4AZIA 3N1AA 4LCRA 1ZTVA 4UMCA 3F4NA 5G5IA 4JKKA 4D6JA 1EHNA 4LUSB 2W92A 1HGWA 1BEUA 3KBSA 3CLMA 2RDXA 3QOMA 4KIEA 2QAFA 4WLCA 4S3AA 4FHAA 2ISVA 1AZ1A 1CXEA 2ZZ5A 1JPHA 3ALFA 3MP3A 1UOZA 4G56A 4KCVA 5HNTA 4FXFA 5D2VA 1HJUA 2GVEA 1GJUA 4GO8A 2ZQ0A 4NX0A 1EJSC 3TWAA 2EJ1A 3VC6A 3TA6A 4JDYA 1GPWA 1UUOA 1W9PA 4PB4A 3AHXA 4RZ4A 4H9MA 4UC5A 1I60A 1L9WA 3FFSA 1DIKA 1JCYA 3WDJA 5C71A 3MUZ1 3ANVA 4LYQA 4HJWA 2RH9A 3L21A 1F5ZA 1S5MA 5HANA 1KM0A 3GC4A 1TX2A 2OFJA 3SCQA 2WNZA 1C8VA 2ZX7A 3M0HA 3RCYA 5EGRA 2E25A 3B9DA 3SBFA 1NARA 1Z8AA 4QEHA 4C7GA 3ITYA 3CV1A 1LQ2A 3R7MA 2MUCA 3WF2A 4LY4A 2IS7A 4MF4A 3WN6A 1PS9A 3RXZA 2E67A 4YWIA 1WZMA 4BQ2A 1V08A 2ZOXA 3EX4A 4AWSA 4IGSA 2XYLA 4I9MA 2ZXDA 2W66A 2RUSA 3EKLA 5DQPA 1QOQA 4NRSA 3BJTA 3MVTA 4DJDD 4ICCX 5CZ0A 3IIPA 2CZ5A 1YBQA 2Y8VA 2FH8A 2NVCA 1W2VA 4IQDA 3DC0A 1W1TA 4BS0A 3DEQA 4JTUA 4FPSA 2C7FA 5A2AA 2WBGA 4LC6A 4JN7A 2POTA 4DAFA 5K9CA 3BZGA 4AAJA 1IEIA 1OQFA 1DWAM 5TF0A 2V0TA 1BTCA 1UPMB 3HQPA 3IS4A 3EAUA 1BSIA 4IGMA 4W93A 3H2CA 4ZXOA 2VT0A 1CGTA 2BGQA 2PU0A 1IGSA 2JGYA 1HX0A 4PUEA 1L8NA 1KR0A 1MUCA 5KZEA 3WEMA 3N25A 1AD4A 1EXBA 3MUY1 2OO6A 2AMXA 4UFLA 3MC5A 3XIMA 1CPUA 2GGIA 4E3TA 4CQ9A 3DG6A 4LYRA 2WQPA 4A35A 4LVDA 1LYXA 1W1A1 5MF5A 2F2KA 4RNHA 3BJSA 1NAL1 3MVIA 5D8ZA 3UG8A 3ME3A 1Z3NA 4UTKA 3S6OA 5H91A 1L6YA 3P8JA 4L65A 5D9PA 3E2SA 1B3WA 4ZQCA 3GNPA 1VYSX 2V5JA 4AY7A 1BRLB 2B4GA 1V6WA 4YCPA 3RPDA 3W82A 1CLXA 3RLUA 1VPYA 4GI8A 1O1ZA 1XLMA 3TC7A 1ZSXA 4KW2A 3NQ7A 3BJFA 4GFIA 3E6EA 1W56A 1XHGA 3LN3A 5EB8A 1JZ7A 4UWMA 3P0XA 1L6SA 2QW5A 3G8RA 3OJGA 1VYPX 1H5YA 1Y7VA 1WQ5A 2X2GA 2IPJA 3L4XA 1UPPA 2NQLA 4Q4SA 5FCZA 2BVDA 2WBKA 4JL1A 3W26A 4CQCA 5JIWA 3RIKA 4AZ7A 4ZOCA 3R8RA 3UZXA 3VNDA 4LANA 3W1TA 4HMNA 4Y9NA 3TIMA 5CC7A 1EXPA 1DJWA 3BL3A 3TSBA 5DELA 2BBFA 4GYJA 4UR8A 3KP1A 5I03A 3BAYA 4KETA 2VDIA 4XSMA 3EA3A 2IPWA 1R9ZA 4JBRA 1A5BA 3WDIA 4D1JA 4Q7NA 4GGHA 5BXPA 1RH9A 1QI0A 4Z2HA 3WZ0E 5IXEA 1TV8A 4RE4A 2BS9A 1PKMA 3RK8A 1KCKA 3SY5A 3DI1A 3S2JA 4PEEA 2XIBA 2VR5A 1NTHA 5A6BD 4CN4A 1AL8A 3PHAA 4CGTA 2XM1A 2X16A 3LS9A 2TMDA 2X41A 1P0EA 4W88A 5GJPA 4K37A 3EOLA 3G1AA 1XBYA 1G9HA 4FNTA 1ELSA 4B3KA 1A5OC 2WVSA 4O4VA 4TVCA 1YKWA 2QPUA 2AQWA 1RLDA 3SUVA 1VRXA 4XZIA 4EX4A 1H63A 1OEPA 4V2XA 1KFLA 2WMHA 4YTSA 1AW5A 4FSAA 3BV4A 4RW3A 3IGSA 4L9ZA 3V5CA 1OFQA 3PWAA 3MMDA 2QCMA 2YCLA 2B7PA 3VNLA 1VQTA 3L23A 1LL7A 2YBTA 3THCA 4ZVJA 3JUGA 4S3KA 6CGTA 1BD0A 2GSEA 2YGYA 1EBGA 3QMTA 3G3DA 4I6VA 3PFRA 4C6NA 3M7WA 3MCNA 2ZBTA 1FA2A 3M0IA 3A4JA 4FXJA 1QFEA 2WYSA 1K6AA 3ELFA 4ZXLA 3UR2A 3ZLGA 3RR1A 2PD5A 3VKCA 1UG6A 3FHAA 3NJ3A 4U2YA 3S9YA 1R3RA 4FLRA 1WKYA 2Q09A 4IG2B 4GI4A 3WEOA 3W27A 2VNCA 1OGBA 1PWLA 4UTHA 3WDQA 2Y61A 1CXHA 1JJKA 3ZJ7A 2DV0A 3W22A 2J7GA 4MMWA 1QNVA 4C6MA 2PWEA 1J5TA 3M0ZA 1E71M 2ZVIA 3L67A 3CUXA 2DY3A 4H9VA 2X0YA 4WY0A 4I9TA 4ZA0A 4PMVA 2J24A 2VOTA 4B16A 4TMCA 3FJLA 2WSQA 3Q65A 1A5KC 1FH8A 1XYBA 4X2PA 4NZJA 4QSHA 4WXZA 3E2VA 3GFZA 1V6YA 4AHOA 1KW1A 3HGOA 4XZ9A 4GYFA 4KF1A 4GO9A 5HNUA 3W76A 1I45A 4BZYA 1P1MA 3UXLA 3BGAA 3CAWA 1Z32X 2NLIA 3OVGA 4HTYA 3W7DA 2PRLA 2VURA 3GM8A 4NAFA 3RCMA 1A3WA 3NO5A 4QR6A 4FO4A 4JFTA 1OD0A 4RR4A 1XYCA 5DXYA 3MYOA 4Z1YA 5CPQA 1H1NA 1LDCA 2FFIA 1HVXA 2Z7GA 4RV8A 3VGGA 4Q4PA 2ATSA 2YCIX 3EMQA 2BXYA 3PG9A 3VINA 1NY1A 4JOMA 1Z48A 5D33A 2V5DA 2DUAA 5CGQA 1TZ9A 1VPQA 3T2QA 3WDPP 4UMBA 4MDOA 3WQ4A 3GKFA 3WD4A 4WJEA 4DYEA 2Y89A 3WNNA 1RD6A 2NXIA 1H41A 3WNOA 5C54A 1C90A 2XIMA 1LT8A 2XJ7A 3SUSA 1IXQA 2VP8A 3SDOA 4GGBA 3LQGA 1A5UA 3GS6A 4ES4A 1QW7A 1KXQA 4IWWA 4PEKA 2NV9A 3BLEA 2EBNA 1C29A 4WY0F 2CHOA 3OLGA 4ZB2A 4C6EA 1U5VA 3TW9A 4A8IA 3K5XA 3T0TA 5DF0A 1J2WA 4NI8A 3PJUA 3I3DA 5AECA 1XIBA 1K8XA 1H7WA 1XUUA 3BCFA 1H7RA 4MB4A 2NUWA 1WBJA 3SGUA 5GJMA 5A3HA 1C9DA 7PTDA 1HP4A 3GK0A 3F2BA 3VABA 1VGAA 3SN1A 1ZUAX 1X8CA 1JGMA 3TDFA 1WX0A 1JNDA 2NX3A 4EAYA 2WVTA 4GQGA 2VZUA 3KL0A 3STEA 3V16A 2ACUA 4WDWA 7TAAA 4WGXA 1SQ7A 4E4UA 1UR1A 2QF8A 2EAWA 3JZEA 4OUEA 1A4MA 2UY4A 4TMBA 6A3HA 3STCA 1E9ZB 3WLMA 2EKGA 2A2IA 2W79A 3PPCA 1UKQA 3AHVA 1E6QM 3TJLA 2BB0A 3AS1A 4MB1A 1IZKA 4LB3A 3N3TA 3DFHA 4JQ3A 1A50A 4DO4A 3DGBA 1EPXA 1X97A 2YXGA 2OSXA 3IRDA 4UXDA 4W87A 1KR1A 2Q8LA 2Z7KA 3W2UA 4IJCA 5FI8A 2D0HA 2VZOA 1F4AA 5CG0A 3E0VA 1ZBCA 4NU7A 2ATMA 4UQAA 1GQJA 3T05A 1UBSA 1MXDA 1XLFA 4ML4A 1SSGA 1GG1A 3ZO9A 3BDKA 3LZ3A 5I7GA 1SW3A 1YTDA 2WLYA 3SFWA 1JYWA 1NWRA 3W73A 4LY8A 3BV7A 4DO6A 4ECLA 1GOKA 3QPZA 1AFSA 1A80A 2HBXA 2EJAA 1NU5A 4LAUA 1UHVA 2PLJA 1KBIA 4JXCA 4ZBCA 5AFDA 3HO8A 1VHCA 3BLFA 3H2AA 3QPEA 2O7SA 2YFOA 3KCJA 4JQ4A 1LOLA 2FQIA 1GUVA 2BWGA 1XLAA 3H7RA 1E9YB 3E02A 1CGVA 1EA0A 4WZHA 5C9ZA 3I68A 2BV9A 2CXEA 1JZ5A 1YXDA 3NGFA 1G69A 1E4NA 1GT8A 1UASA 5E93A 3GQYA 3TW7A 1JDAA 4KEUA 1J10A 1FBAA 1H60A 3EB4A 3TYEA 4GWEA 4HA1A 4NZFA 2DGAA 5AB3A 3BO9A 1A5AA 3LK6A 4FIRA 2GOUA 4ZE5A 3O06A 3IV8A 3PBUA 1E6RA 1W5PA 1E5JA 3BGGA 4E3VA 1JFHA 1MVYA 2HE5A 3NPVA 4PMUA 3O7UA 2UY2A 2PBOA 4XISA 4N9EA 2HJPA 1HKVA 1H50A 2G95A 4GI6A 4N02A 2G96A 1DE6A 3WNPA 4FI4A 3O15A 3IPWA 1SMAA 4FP1A 1JF5A 3H2MA 4XD5A 3KRZA 5RUBA 3B8WA 3MYPA 4MJMA 4FOKA 5HQMA 3SQLA 3VNJA 3K13A 4KGLA 1GYMA 3VVGA 4J9JA 4CD5A 1TX0A 1W5OA 1IV8A 2BHZA 1SFLA 4Q8QA 2ZXQA 4AMAA 4DJDC 1FWCC 4CCEA 2PDGA 3W7MA 3C2EA 1JCXA 1L6GA 2NX9A 3V5FA 1V3IA 2OCZA 4WJXA 3EDDA 2DT3A 2YDSA 3GG8A 3R1ZA 3SCRA 4Z42C 3WUBA 3W1PA 1LWIA 4MB5A 4ZFCA 1LLOA 3IV3A 2FPTA 4XIMA 4ERIA 2FGZA 5HMEA 2CPUA 1J0HA 3BAJA 1O5RA 2PWVA 1XRVA 5A8QA 3L65A 1GORA 1LZOA 3VD5A 3GBEA 1OX4A 4DLMA 3L4UA 1UZ1A 5AYBA 3CAKA 4HPNA 2XIJA 5IBXC 3GC5A 4LCQA 1MW2A 2Y8UA 3H24A 4DJFA 4BQ3A 1DQXA 2E77A 1H7NA 2WWDA 3N29A 3TVAA 4CD6A 1W9UA 4MPQA 4QJ3B 1QPQA 1GQNA 2J6XA 2ZTKA 2EQDA 5DXXA 1LCOA 3GAKA 1PZ0A 2YL5A 1SMDA 2VFHA 1TPUA 1IWPA 1Y65A 1F6KA 2J7FA 4KIRA 5HUOA 5JQ9A 4WX2A 4IUGA 4XAPA 1E51A 4OWGA 3IRSA 4UB9A 3HB9A 1EPVA 1O1HA 4AEOA 4WD0A 4QNEA 2ZDSA 3E96A 3WBYA 4YS1A 2C13A 4F79A 1XX1A 3F4CA 3PZUA 4D6FA 3QN3A 8XIAA 2XWDA 5LIWX 3U5UA 1JCMP 5DO8A 1TIWA 3L5AA 3T40A 4UFMA 1TMHA 1KCLA 1EQPA 2NUYA 4H9TA 3BLLA 2CITA 3CAQA 2ZRUA 3UYIA 1PTGA 1I2NA 2J4GA 3VIMA 1KWKA 4RUBA 3RYSA 2UY3A 2VZTA 3MI3A 4IXHA 2HS6A 4B5NA 1MYRA 3SEPA 1SUXA 3FN9A 3P60A 3WF3A 3UCDA 1VFTA 1OSEA 4K2SA 1O68A 3TNOA 4L80A 3VUSA 1FH7A 1GZJA 2JALA 4FX6M 5AC8A 1PZ1A 3F5KA 4G5DA 1ZJIA 1B3ZA 3O1NA 2Z1XA 4UOQA 3THDA 1OFRA 1T99A 1BFNA 3K46A 4PUDA 5DMLA 2PWUA 2WC3A 3URAA 1E72M 4N4QA 2OGJA 1RZMA 1KBJA 2GYIA 4UTIA 2OKTA 1SO3A 4J28A 1AH4A 1EWDA 3WMBA 2P53A 2A6LA 4IX0A 4UTTA 2CHNA 1JPMA 2A7RA 2YBVA 3VZZA 1UIPA 1PV8A 3OW1A 2R82A 3VDAA 5BRPA 1TB3A 3DKJA 4DYJA 4YIWA 1ISXA 2WB5A 3VIGA 3AWOA 4FA3A 3CHEA 4LGXA 1IGWA 4G6CA 3QRHA 4DUWA 4OVXA 3W72A 1PX3A 4R34A 2XDFA 5LNVA 2ZUTA 4H00A 2BODX 4HGXA 1EGMA 3A12A 2I7GA 4PRRA 2I56A 1E4IA 2GJNA 4HKPA 4IQLA 1BVNP 3PUDA 5D03A 3RGTA 2YLLA 4JHZA 3I6EA 1HUVA 3R43A 5FEPA 3VM7A 2FHCA 1W2PA 4PSPA 2XVPA 2HCVA 2INFA 2BG5A 2PD9A 3FIGA 1C93A 3PZVA 4OECA 2R6OA 3SJNA 1EOMA 1ZJBA 1J79A 2GUUA 1UD4A 4H9ZA 4G1KA 3ONCA 2TODA 4QAIA 3URQA 2R1KA 3UZZA 1S5NA 2DVXA 1R30A 4POCA 4AWTA 2J7BA 3AIBA 4D72A 4S23A 1V0KA 1MW3A 1A0CA 1EDTA 2OSWA 3TU9A 3WNLA 1QCWA 1B1YA 1PX8A 1ZL1A 2VDGA 2HNEA 1QNSA 3WFLA 4PMNA 4LQ1A 5I02A 3W7OA 3LM7A 3AU6A 3E2QA 4PUMA 3UJRA 4D8ZA 2WM1A 2E1DA 4XZLX 1PTDA 1YQ2A 3CEUA 3LHVA 4WIWA 3VDCA 4H8NA 1OD8A 5T8GA 3KCOA 3WQ6A 3VNMA 4DJDA 4ACYA 2BHUA 3W2MA 5CKSA 1TIMA 1W3HA 4S3GA 4ZTYA 4IMCA 1UP3A 2NZLA 4MKNA 2FGLA 4GJJA 3EXRA 3VZXA 3RX3A 4QCEA 1YNYA 1XH2A 1UJQA 2QXWA 3DYPA 3HFTA 3FX4A 4PL2A 2ACQA 4NG3A 5XIAA 2VGFA 4HMDA 1QAPA 3BAIA 1RVKA 3ZLHA 3SY1A 3AI0A 3JS3A 1P0KA 3HMCA 1TVNA 5HA7A 1OX4B 3T1GA 4E2OA 3IJIA 1GKQA 1KM6A 4PCFA 3W29A 3FYYA 2DVTA 2PDMA 3WQGA 4RXFA 1XLGA 4C6BA 2WCGA 3TR2A 4ZENA 3WELA 3TH6A 1O5KA 2I9EA 4GVGA 1FHUA 2WO5A 2HQAA 2RDTA 3BG5A 3IJ9A 2W67A 1WZLA 5HBFA 1R9XA 1OCJA 3LNPA 4HNNA 3HG4A 1FFQA 1JYXA 1WOAA 2Z24A 4NT0A 1JXJA 2YZRA 1B3OA 2YDAA 5BYWA 4S3JA 3CHVA 3NQ6A 4CNPA 4JTKA 3DC8A 5JUVA 1NFPA 4ZTXA 1DV7A 4J4KA 3U2CA 2Q71A 1IEWA 3LTPA 3L7RA 2OT1A 3S8HA 4X0NA 2NQHA 3O9NA 1Z44A 2W27A 4ZQRA 1IZJA 1TPVA 5D30A 3C2YA 4YWSA 4XX6A 2JF6A 4IFKB 3WDRA 5K9DA 3WQCA 1XRSA 1V03A 3JU2A 4I9JA 2D20A 1HKIA 4LUSA 3S42A 1XXXA 2TSYA 3PUEA 3VOJA 1TJ1A 1DWGM 4PUWA 4JY8A 2OZ0A 5EMUA 1V3MA 3KRUA 1WXZA 1V3JA 4CNOA 1FKXA 3E74A 4HK6A 4UTWA 5EMJA 1MXSA 2X40A 4BQ5A 4WOZA 2BLEA 3TAKA 4QLJA 1GKPA 3M6DA 1ZCCA 1GEHA 1Z9AA 1S46A 2ZZ4A 3KBMA 3AYRA 1ZJAA 2BVTA 3R8HA 2A7NA 4N2YA 4G7EA 4IMFA 3WBWA 2GOKA 2FJUB 1C8YA 3ORWA 4KRUA 4YVVA 4C5YA 1GEQA 4PUNA 2QGHA 1SJBA 5AC5A 1N82A 4O1AA 2DIJA 3VNKA 1RY8A 4HSNA 1XGDA 3U7BA 4EIVA 2J66A 2XINA 1HL9A 2CKSA 8TIMA 5BRBA 3C2RA 4RJEA 3MDWA 4P8WA 2V30A 5FJIA 4GIYA 3N19B 1CEOA 1E4LA 3FVDA 5EA9A 3C0QA 4PN2A 1U2YA 3L4YA 8A3HA 1CLKA 4TUFA 1FVPA 5JH1A 1SO4A 2WKLA 1DWFM 3DU0A 4DZ5A 1MMFA 3TFCA 3EOOA 4ADUA 2D2OA 2DW7A 1QR7A 3HM7A 4QHRA 3FHQA 2VR2A 4E8GA 1MNZA 3UQNA 1TA3A 2WMIA 1I8JA 1HT6A 2A0NA 3GXDA 1GKRA 1B9BA 4CVWA 4M7SA 2D2GA 5A95A 3BMVA 4NJGA 3NZPA 4BCEA 3K1DA 5FJTA 1OCQA 1NP0A 2Q6ZA 4AG0A 1X6NA 4H8UA 3ZLFA 4KCWA 1B4KA 1GQKA 2ZYFA 3RAOA 2YL6A 2DSWA 2R1NA 4LUIA 2OX4A 2DW6A 2WSKA 3LUTA 4NNCA 2FFCA 4Y9MA 1B2YA 3UCCA 4Q4OA 1LL4A 4IIBA 3QKZA 4NQ1A 4W9TA 2E28A 4B5VA 4LC8A 1XYAA 1IIHA 1MZHA 3GIQA 5C8BB 2PWHA 3NL6A 2PZ0A 4ZB0A 3TLLA 3VK5A 4QBXA 5GPRA 4HYRA 3OVQA 1AK5A 1D7FA 3TUUA 4A2SA 4NASA 2QV5A 5ABEA 4B3ZA 3TQVA 4L5ZA 3FJ4A 4MJ4A 2PP0A 3I7RA 4B3LA 3UZYA 2V2HA 2ZA2A 3W7QA 3OEXA 2YDQA 3QSTA 2PGEA 4EVZA 5HR6A 2DH2A 5IDIA 1GQIA 4TVUA 2XFRA 3DX5A 2QV4A 3JR2A 1DKWA 2VJXA 3GVQA 2PDCA 3MV11 4XKYA 1IQ8A 4HZMA 1KM5A 1P1XA 4GFSA 1UCWA 2FZBA 3D46A 3DYMA 5TBOA 1X98A 3N3MA 3RJYA 4E0CA 3IARA 1DEDA 1JVNA 4LTSA 1KWGA 2AAAA 1ONRA 5KETA 2Q01A 4L6HA 4MSSA 1GVSA 4O0KA 1DPMA 1LWJA 4RPPA 5AVNA 2CLOA 2CWNA 3T81A 1WDPA 4O10A 3NFUA 1RBLA 3N9RA 3NL2A 1LRTA 3LXCA 1H4PA 1UWSA 2ODOA 3G22A 2HK1A 4PYSA 1GCYA 2YA0A 2VKZG 3FEQA 4DB7A 4K8HA 2I1OA 5K3VA 3OIXA 3E1F1 4HQVA 5DX7A 1W1PA 5KINA 5H1WA 4LUTB 4UCFA 3W1RA 4JTGA 2O9RA 2P10A 1TPWA 2WMJA 4XBSA 4N6EA 3CYJA 3MQTA 2CW6A 2CLLA 1LORA 4JYDA 4GIEA 2DJLA 1IIGA 2V69A 2YR1A 4J7RA 1JDCA 3F1QA 3FSUA 4FB7A 1EDGA 3M43A 1SYTA 2PBGA 5G1MA 3TA9A 1EJUC 3OQEA 3FA4A 4HVXA 3QW3A 3WQFA 3EWWA 4S3CA 1KRAC 3IIXA 1ZP3A 4ZZ9A 4DWDA 1W1YA 1MEIA 1PL9A 2G5WA 1HO1A 2D69A 2NUXA 1VBHA 3WQEA 3AUOA 3N2BA 4D8LA 4D1IA 3S1GA 1EX1A 4HZ6A 5MKGA 3AIRA 2A3AA 1B57A 1LRQA 3QFWA 3RU8X 2PZNA 4QXIA 2FZ9A 3A22A 5I23A 4R3UA 2QKFA 2ZUMA 5LXXA 3VMNA 1UMLA 4M56A 1KB3A 3AZRA 3EA2A 5CZSA 2OWXA 3L0NA 3STFA 1TZ7A 4INFA 4JAWA 2QJNA 3ICJA 3V1PA 3GDBA 3NIYA 2EPMX 3M0XA 3OB8A 3QW4B 2XUCA 4C1NA 4GYPA 3LBOA 3MKVA 3HPSA 2CLHA 3BPWA 3AMDA 4W8AA 3HV9A 4P2VA 3MCMA 3VD4A 5H8UA 1F7BA 1QHPA 3Q58A 1PPIA 4X0VA 3CUGA 1R9YA 4L64A 3LRLA 4IIEA 1W9BM 3ABQA 1NOUA 1CGYA 1UZHA 4A8LA 3H2FA 1POJA 4LAKA 4PMDA 3EPOA 2QR6A 1K3UA 4PBEA 4L4MA 1NFBA 3K8LA 3HTWA 1EFZA 3ES7A 4UFHA 4X9YA 4DYKA 1B30A 1S1RA 2WNNA 1K77A 1N55A 4HHMA 1XH0A 4M1RA 1BHGA 1ECQA 2CZFA 3VGDA 1YW1A 4TU1A 3TC3A 3PWIA 2HEJA 1Q7QA 4Z2LA 3DFQA 3UWUA 1M68A 3WG6A 4HSOA 4NHVA 2Y7EA 3RMJA 1WAUA 1DIOA 4WSKA 3W85A 3WQDA 3UWQA 5IRPA 1VEMA 3II1A 2BSLA 4P7NA 2A3HA 1EJXC 2WLZA 3FLUA 1LOQA 1QASA 4GNVA 5F2LA 1XLEA 1UWTA 2G4JA 2V63A 1AW1A 1EX5A 2YW3A 2XISA 1Q6LA 2H8ZA 3IUIA 3PANA 3HF3A 3N6HA 5CZKA 3VU2A 1EDQA 1XDMA 1VFFA 4N9CA 4GQ0A 2C16A 2OLSA 3VYLA 3GR8A 5AHEA 1C8QA 1GGOA 4DO5A 1PTAA 1ISWA 4O50A 1GVFA 4JX5A 1H3GA 1C7TA 4F66A 3RX4A 1D2KA 3LERA 3IK4A 3ITVA 2WPBA 3EX2A 1V6VA 1T8QA 3UT0A 2VR4A 3PNUA 3AXMA 2IKJA 2YYUA 1W0MA 5LIYX 1XF0A 4P8VA 1PE1A 3G1XA 1Y5XA 1OFOA 1VLIA 4HHPA 1HKWA 3DBNA 4WUIA 3L68A 1H09A 2OKOA 2X1IA 2VCAA 1TRDA 5CSUA 4E2BA 3ARRA 4KESA 3G3MA 4GMEA 4NRRA 3NQGA 4P7QA 1UH4A 3QR1A 1K8CA 4IQEA 2WSYA 5JBEA 2EG7A 3GUGA 4P7OA 1R5YA 5F1VA 1CENA 1QK0A 2WVVB 2YPIA 4K38A 1LBMA 1T7LA 3G77A 1UZ4A 4YNGA 3KRSA 5F2IA 5C55A 1FXPA 1OYCA 1K70A 1EH9A 3R11A 7ODCA 1VD6A 3DGRA 1Q66A 5C2GA 4MAVA 4I7VA 1CB2A 3IVTA 1EZ2A 1GOMA 3ARVA 1DJYA 1Q6RA 1PKLA 1ZP4A 4V15A 4Y9AA 5ABFB 1NWTA 5CAHA 4O17A 4UR9A 5I3IA 1NDWA 2GK1A 5HAOA 4GA8A 2OOGA 2VGGA 4LVAA 3ZJ6A 3A64A 4LVGA 1M01A 1KRBC 3U2ZA 2PDPA 4EXAA 1RHCA 3NQVA 3QHNA 3B40A 4NJIA 3W7JA 4AVFA 1EBHA 4L7ZA 1A3XA 4NAEB 3WFZA 2PDXA 1DJXA 1OC7A 3VIJA 3HA1A 4WKHA 3QSRA 4H6KA 3F4WA 1IR2A 3LHTA 3EDKA 3ID7A 5EPDA 3U8GA 1TG7A 3TV8A 2E6AA 3MHUA 2O4MA 3UG4A 1CT5A 4A8RA 3SCOA 4IMEA 3UPBA 1M9HA 2C1GA 3B9NA 1BQGA 2ZXAA 4DI8A 4IICA 3AJ7A 4IPIA 2OYLA 1YLVA 3PB0A 3IJ8A 4CEUC 2OXNA 2DQWA 3GIYA 4Q22A 3PBWA 2AAMA 2YL9A 1R3VA 3IIZA 3R0DA 4HNCA 4I5XA 3NGJA 1B3YA 3TR9A 1YTKA 2PC4A 5IHRA 1BRLA 1ZPTA 3SZ8A 3IANA 3OGSA 2QEZA 1REQB 3FEMA 3SGZA 2VEFA 4JZ5A 1Q5MA 3A24A 3ABSA 1RJQA 2GUYA 2PGFA 1EP3A 2VFEA 4ADSA 3TTQA 2E40A 2BOEX 5J8LA 1PJ9A 1SFTA 2XFWA 4QP0A 2V9DA 1AW2A 2B31A 2FH6A 4JIHA 3WENA 1IWBA 3R8GA 4FALA 3WYZA 1EL3A 4KFPA 1RQEA 1ME7A 4XD3A 1JXKA 5DANA 3EDJA 1U5JA 5C5YA 1XQKA 1XLBA 4GABA 5DT5A 4MWAE 2EPNA 4GNJA 1SM9A 4C1LA 4DZHA 6ALDA 4S38A 1IXOA 4B2DA 3TN5A 3VNIA 1FWTA 5BRQA 5BXTA 5A6TC 2Y24A 1U33A 3GIPA 3W1QA 3N34A 1T6MA 3KBWA 4DF2A 4AX6A 3PNZA 4MWAB 3WK0A 2XVKA 5IM51 1IF2A 2P76A 3NQAA 3VOHA 4CD7A 4CLMA 5I3FA 3STPA 3S2MA 3B8IA 2NX1A 4IM4A 3NO3A 3VX0A 1BYBA 1ZJHA 1F76A 1GVYA 3EEGA 5FJRA 4O16A 5F2MA 3IUHA 4Q6XA 5HMFA 3WLSA 1US0A 3R89A 1V4YA 3GW3A 5IHSA 1JFXA 4BY3A 2OPJA 3AYVA 2W6RA 3E5PA 3Q4DA 3M1ZA 1UYQA 1NDVA 5D37A 5AHMA 4PBFA 3M46A 2A4AA 5T9CE 3R2GA 1W3JA 3QR3A 1P0NA 1FDJA 3VNZA 3VKDA 4KCUA 1B31A 3KVLA 4J40A 3U9IA 2OYMA 5ABFA 2UY5A 4JICA 1ICQA 3TYAA 5CJNA 7ENLA 1PDZA 1X7IA 2ZUWA 2WVVA 1UOKA 5LGZA 4HIBA 1NSJA 3UR5A 1FP9A 2ZRVA 4Y90A 1BVWA 1M7OA 3KE0A 4GCXA 4BF5A 1K9FA 5M2FX 4XAYA 3VX1A 1C3FA 5U4NA 1XH1A 2J8FA 4REQB 3LD5A 1PVNA 5A6LA 3PN8A 3NQBA 2DSKA 3P80A 1G7VA 3CQJA 3GDRA 5F4SA 4XZHA 3UYCA 1AJZA 3STGA 1TA3B 5K4XA 3KL5A 2J7EA 2BX7A 3C2VA 1JDDA 4GYPC 4L61A 3UWYA 3LGEA 1WDRA 2BFGA 2BY3A 1Q13A 2IQTA 4Q32A 1QOPA 2ZX8A 1TV2A 4I5RA 1Y8BA 2Y88A 3GDMA 2GVYA 1O6IA 4JCLA 4F0MA 1WUFA 1PCWA 1EGZA 4MWAA 4WDUA 3DH7A 2XPKA 4U3CA 1KV5A 3W6LA 2FPYA 2DEPA 3W71A 3PJXA 4O15A 5I09A 3LXBA 4CNTA 1GVRA 4EACA 1J4EA 3GTNA 5CJ5A 1EHAA 1N7KA 4G1NA 4I7WA 4CVUA 5CQ1A 4WHBA 5I3JA 1MZRA 4AZBA 5DY2A 3VIPA 3LDVA 3N4FA 1XPYA 3HN3A 2H3DA 1ML1A 4QAWA 5AYZA 1OK4A 1UWQA 1E0WA 1YXYA 1B5TA 2QT3A 2BMBA 4EKJA 4F2UA 3UGRA 5D8WA 1H0IA 2NW0A 2ZRXA 3NQEA 5FAGA 5LA1A 3OG3A 4F40A 4LRTA 5GNXA 1TYGA 2Q3RA 3TTOA 1LUCB 3WD2A 4GX8A 3L5MA 3UZJA 1FHDA 2GGJA 2MANA 3UA3A 3PY2A 5HR7A 2W63A 2PDHA 3QPYA 4QEEA 1OT1A 3EWXA 5HWMA 2CBVA 3UR7A 3N73A 1OINA 2VELA 2PEVA 2A3EA 1K4HA 2P50A 4JTDA 3CASA 4JN6A 3IVSA 3UCQA 2C0AA 5KITA 1EEXA 3UG3A 5C7VA 3IWPA 4TTUA 2A7PA 2VO5A 3PS7A 2JIEA 3AC0A 1Y5VA 1UKOA 3QGKC 1W5NA 3VIHA 3WF1A 3ZSTA 4PMRA 4JDBA 3WMSA 3WFAA 4GUIA 3NQMA 4NNBA 4JL2A 3P84A 1ZAHA 4C6FA 5AVHA 4QX4A 5B7ZA 3D3AA 1RUSA 4LV4A 1KC7A 5A1AA 5CGTA 1REQA 3LENA 3D6NA 4H2CA 1G4SA 3U2EA 1J96A 3UY7A 1ZY9A 4D6GA 2WM0A 4O28A 1W3IA 3NZ1A 4AF0B 3SR7A 4UZSA 1X1OA 3N6QA 3UZ5A 4GZIA 2E6FA 3HGRA 4AZHA 3H70A 3UERA 2RKXA 3GU1A 3P61A 3OYXA 2G3MA 1UC4A 4CCDA 3PZGA 4NKCA 1R0MA 5G2WA 3GTIA 2EG6A 1XRTA 1EF3A 4PTNA 5AHLA 3N2XA 3BCDA 2DZBA 2PGWA 3WLRA 1A5SA 2FB3A 1V77A 4FXSA 4MUZA 4QNWA 3RO6A 1TTIA 4ZOEA 4OV9A 3HPAA 1HIZA 1JD7A 3EOEA 1EUAA 1XCFA 2QJMA 4LS2A 4LBRA 5C0QA 4W8LA 4H9YA 2B0MA 3H7UA 1VHNA 3UD6A 1H7PA 4YN5A 2FLIA 2PDLA 4AQLA 4AWEA 3R4IA 3L4WA 4WY0B 1OYBA 1UWUA 4O52A 2Y5EA 4XAFA 1PYFA 2F8QA 2PAJA 2FHBA 3ARQA 1RP8A 3FAWA 2JKPA 4OIFA 3AIUA 1XR2A 4O57A 4ZQNA 3PBGA 1Q8JA 1JAKA 3AS3A 4IT1A 1NIUA 4IJBA 4ZB5A 1R87A 1OADA 3AIWA 4QG8A 1Z69A 3VGBA 5CLTA 3CXOA 2CLMA 1H62A 2GJLA 5KEZA 5FJJA 2ICSA 2WWCA 4Q6JA 3N6JA 3VDBA 2FZNA 1OB0A 2J77A 5HWJA 4HNOA 5CSSA 2PSNA 2DSVA 2HPMA 1PKNA 4MAZA 4GQQA 4AU0A 3KZPA 2X1SA 2BASA 4E8CA 4HU0A 3FJNA 4FAMA 3LMYA 1ITXA 1ZNNA 1GTEA 2I16A 1HGYA 1KXVA 3WLJA 3W02A 3O3RA 2Y6ZA 5FJOA 3V0TA 4C6IA 3KEHA 3P3BA 3V4BA 5BROA 1XIJA 1X1NA 1E0UA 2X1UA 1JI1A 3AHZA 4HJFA 1TFVA 3A4AA 3D0CA 3VNYA 4W5UA 2DT0A 1SR9A 5E6YA 4XZBA 3TP4A 4GXWA 4TIMA 3KTXA 4HPJA 2NQZA 3MCOA 1B90A 1UR3M 3AALA 4CEXC 4G7EB 1MEHA 1TSIA 2CESA 4UZUA 3UPWA 1F4HA 5A6MA 3KDNA 1V8EA 4MZYA 3AXKA 4GUGA 2VZSA 1PZ2A 3KM8A 2ZRWA 1DHKA 3LGGA 3LB0A 1R46A 2DSZA 3I7SA 4GY0A 3S1XA 4F0LA 1OFBA 3P67A 2CIPA 2J8TA 3DUGA 3LRKA 4PZVA 1P6WA 4FF7A 5HXMA 1G6CA 4YTRA 3OZPA 4ZSTA 1EP2A 3V3WA 5H2ZA 3VOGA 3UA4A 3VIIA 3TQKA 3TQ0A 3C0JA 2HMCA 1C91A 5GQBA 4EF9A 2XH4A 4B9YA 1S2VA 2QAPA 4C6KA 2CLIA 1WO2A 3AHTA 4RZBA 1DWIM 3N9SA 4ADTA 3LEPA 4ERAA 1FCVA 1VJSA 3OBKA 5T91A 3WF4A 3WD3A 3UY8A 4XK2A 3CM4A 5HPOA 1CXIA 1O5QA 4ZL1A 3CB8A 4TX6A 4O4WA 1MSSA 3LPGA 1WPCA 3VD7A 1HFBA 4KKXA 3R94A 4JTTA 1R6WA 3LHWA 1J0KA 5D09A 2QCNA 2G0WA 4GC4A 4MFEA 1LT7A 3U5YA 4E2VA 2NV1A 4ZSUA 1B4EA 4PODA 1QOXA 3J7HA 4EPEC 2Q3OA 3EBVA 2FMNA 4LAMA 1M41A 4BF9A 4YVPA 3W1AA 1PYMA 4GKTA 1DWHM 1HL8A 1NJJA 3RCNA 1R38A 4PSRA 4CU6A 3SIMA 3URBA 1BLIA 2WZEA 1QVBA 3AQUA 3EWCA 3WLLA 4LRSA 3HV8A 3A3XA 3ITXA 4XO6A 1J8VA 3GHTA 3L5LA 1GJPA 3TE9A 4MFDA 5FIPA 3KHJA 3PZ9A 3MW7A 1UMYA 1UUQA 4GLEA 1AODA 5I2UA 3B0UX 4YVXA 2BTMA 5CGMA 2X42A 1RQHA 2I5QA 1PDYA 3UJEA 4DXKA 3TZFA 3WQVA 1TRIA 4QJ1A 5C2CA 3RX2A 1QNPA 4YHGA 3L2MA 4DWSB 2GL5A 3DCPA 3C6CA 1FWBC 3ARYA 1XI3A 4OBRA 3EDFA 2PLMA 1Q7ZA 4UCGA 1O60A 4A29A 3CUFA 3CTTA 4CNUA 1M53A 4NP7A 1E1CB 1RLCL 3AO0A 3O63A 1E56A 4HNLA 5C9RA 3ABXA 5LA2A 4IOTA 1U1UA 2Z1VA 4ONVA 1Q8AA 3KFTA 3MSDA 3A13A 1TR9A 3PFMA 4QIUA 1K7FA 3T8QA 4AYGA 4R7JA 4ACZA 3LBMA 3ITOA 4H1ZA 4PCNA 4HU8A 1KBLA 1H7OA 1F8MA 1L8PA 4C6PA 1OHLA 3W9ZA 1ZBKA 5IDZA 2C1IA 1CB7B 4JNMA 4Q8UA 1EO5A 4EPKA 3IJDA 2CC0A 4Y6GA 1ZLPA 1W54A 2Y4SA 2VMFA 1LTDA 2DFAA 4F2TA 3U4FA 2D22A 4XAGA 2PWDA 4H2HA 2YIHA 4KFNA 2WK2A 3SY8A 3W24A 2VEGA 2V67A 3QLLA