3FA4A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, triclinic crystal form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
291
structure length
284
Chain Sequence
PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3-dimethylmalate lyase
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
total genus 100
structure length 284
sequence length 291
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa4A00
4HYWA 1U5HA 4IQDA 1VBGA 3BJFA 3QV9A 5TAOA 4KCUA 1S2TA 3QV8A 2WQDA 1JDEA 4L9YA 4LSBA 3SRFA 4YNGA 3H6OA 1MUMA 3VAVA 3M0KA 3QTGA 1F61A 4KRZA 4MF4A 2KX9A 1UJQA 5JVLA 3PP7A 1SGJA 3M0JA 4B5TA 2G50A 4QGCA 3HQPA 4L9ZA 3IS4A 1KC7A 1O66A 1DQUA 1E0UA 3OQ8A 3BJTA 1IGWA 3PUGA 4B5VA 1IZCA 4B2DA 4L7ZA 3SRDA 4QG9A 4WJ8A 3HQNA 1Z6KA 2X0SA 3N25A 1ZLPA 1U5VA 3T07A 1DXEA 3G2GA 3QQWA 3MA8A 3GR4A 3B8IA 4YJ5A 2HJPA 4B5SA 4HYVA 3EOLA 2VGGA 4B5XA 1XG4A 4MG4A 2HRWA 1F8IA 1AQFA 1PKMA 2VWSA 2DUAA 3E5BA 3R4IA 1PYMA 2ZE3A 3EOEA 3LG3A 2VGFA 1F3WA 1OY0A 3P0XA 2HROA 1O68A 1PKLA 1F3XA 1A3WA 4G1NA 2VGIA 1VBHA 2HWGA 4QG8A 3ME3A 2R82A 1A5UA 1A3XA 4IQEA 3EZ4A 4TV6A 1PKYA 1DXFA 4QG6A 3T05A 3SRKA 2XZ9A 3FA3A 1M3UA 3SRHA 2XDFA 4L80A 1F8MA 1KBLA 1A49A 2DIKA 4JPGA 4IMAA 4KCWA 2V5KA 2BG5A 3U2ZA 4B2DD 1DIKA 3FA4A 3EOOA 3E0VA 1M1BA 1OQFA 3KHDA 4RPPA 3OYZA 3KTXA 2L5HA 3GG8A 4FXFA 2V5JA 3I4EA 2VWTA 4ROQA 3QZ6A 2QIWA 1S2UA 3LYEA 1S2VA 1T5AA 1E0TA 4KCTA 4IP7A 2XZ7A 3GQYA 3T0TA 4FXJA 4TV5A 1ZJHA 3QV6A 3QV7A 3E0WA 2E28A 3OYXA 1XG3A 1O5QA 4KCVA 1PKNA 4B5WA 3HQOA 1GGOA 4B5UA 2VGBA 3QLLA 4KS0A 4DRSA 1S2WA 2OLSA
chains in the Genus database with same CATH superfamily
1W1A1 1US3A 3K8LA 4P8VA 4H9UA 3TCSA 1B2YA 1WXZA 3CB8A 3GVGA 4NX0A 2TODA 4Z0SA 3UWQA 4JHOA 4D1IA 1FWAC 3CH9A 2YXOA 4YN5A 2PC8A 2HV5A 1NH6A 3TNOA 2WK2A 3PM6A 3V5OA 3KBJA 3GNOA 2QAPA 1K8XA 3S1WA 3OPSA 3WK1A 4A2SA 1EIXA 1W9BM 1J0YA 1MZRA 1TWDA 3W7QA 3T08A 4KERA 3UG4A 3E12A 3IVSA 2GSJA 2O92A 3A3WA 3UWYA 3WDQA 4E0CA 4V2XA 3C86A 3ZQ9A 3S5OA 2Z6IA 3NFUA 3NQCA 2DORA 8XIAA 4X61A 4GI8A 1EB3A 4QTGA 3ABOA 2QF7A 5E6ZA 4HHHA 2XINA 3H4XA 4DEFA 3TE9A 5JIWA 2VUYA 1A49A 1ECEA 3RXZA 3A13A 3WD3A 8RUCA 1OFAA 4KEVA 4UR7A 1CGTA 3FVMA 4H9TA 3V1HA 2UY2A 2FFCA 4AZGA 1FY6A 1GYMA 4YWSA 3GQYA 5I6SA 1BRLA 1QI0A 1ZY9A 3QW4B 4MKNA 3PB0A 2WNZA 5BXPA 4LX4A 3MI3A 3A9IA 1DHKA 3EMQA 4C1KA 1H60A 3WLIA 1XIIA 4CD8A 4YCOA 4NZ5A 3TROA 2PTZA 5GJNA 3B0UX 3C4UA 3WQEA 4QS6A 3C3UA 1F73A 3W6YA 1FWJC 1D8CA 1JCLA 4AIOA 4XIAA 3EB2A 3A23A 3G2GA 4OOUA 2A6NA 4MNMA 3LUTA 2Y70A 1TKKA 4NVTA 3PF3A 2PDPA 1J96A 3I7RA 5DO8A 5JU6A 1OD8A 2FHBA 3CUXA 2VWSA 3KL3A 3SGZA 4GQRA 3OZPA 4MADA 1K6AA 3EOEA 4AWTA 4I9JA 4Z1AA 4UFKA 1EF2A 3P0XA 1O68A 4LTSA 4PMRA 2CZDA 2ZRUA 1HQTA 4CQBA 1HKVA 4AC1X 3O6YX 3RR4A 3HG3A 3NIYA 1SW3A 3HOJA 3DI1A 2QJIA 1I0BA 4JPGA 3R10A 4YU1A 4GC3A 1BF6A 1K3UA 2PDNA 3IVUA 4PRTA 3KVLA 2YA0A 1N7KA 1H7NA 1KKOA 3LU2A 3KUMA 4AD3A 1UKOA 3VIJA 4ERGA 3GXNA 2XHYA 4O52A 4GI9A 4ZQNA 1LBFA 3NTYA 4KCUA 2QCGA 3QV8A 4HPHA 3E0IA 5XINA 3EWYA 3RK8A 2D0FA 1I9CB 2KX9A 1BTMA 4JN8A 4DAFA 1SUXA 5I09A 1UWUA 4IGSA 4O28A 1YBQB 4O0QA 5CKSA 4HIBA 4I90A 1DP0A 3HQNA 3TW7A 3CWNA 1K4GA 4JOMA 2X2YA 4JTQA 3VGEA 4DUWA 3VGFA 2FZMA 4HNOA 4MB4A 4Q32A 1K8YA 1NQ6A 1F3WA 2GQ9A 4JKKA 2V63A 3DFTA 4H7VA 1UR2A 2ZWZA 1JR1A 5H2ZA 2QDHA 2YCIX 4M24A 4K7YA 2NX9A 1YLVA 3WBXA 1E4LA 3NPXA 2YX0A 3PG9A 5EGRA 5CAHA 3SBFA 1VBRA 3RYSA 4HYRA 5MKGB 5D09A 5JMUA 4GQBA 3CUHA 4JTTA 3S2JA 1U33A 2CZFA 1EL3A 3IACA 3VI2A 4ORIA 3CQIA 1WBHA 4GACA 1XD1A 3BJSA 1MFVA 2W79A 3N4AA 2CC0A 4Q7BA 1SO5A 3IIPA 1VBGA 3OODA 4AWEA 4DUVA 5FSEC 5F4SA 1TPDA 3ZJ6A 4DWSA 4IIEA 3W7RA 1LZOA 4QROA 2XISA 3V3WA 1SQ7A 2F6KA 4NYUA 3PTDA 2H90A 4Z08A 4GJ1A 1NFBA 1AFSA 4IMEA 3AUOA 4B5VA 5D38A 3TSMA 2BXYA 4QR6A 1SZGA 1OABA 4U33A 3U8GA 2FQIA 4CD6A 5I24A 1M7OA 1PIFA 2BXZA 1TZ9A 1AH0A 3URNA 4CGTA 1B0IA 1LWJA 4MZYA 4UTFA 4G1NA 5AYZA 4JEQA 2W63A 4O1EA 3URQA 2QZRA 3D46A 4XBSA 1J0KA 4UTTA 1DBTA 5DLCA 2AL2B 3DC0A 1KBKA 3ALFA 1JDAA 2FKPA 2VX7A 1VZWA 3PULA 2WKJA 1X6LA 1S2UA 3PJTA 3JZUA 4CD7A 3QM3A 3PUEA 1R9YA 1M6JA 2VDIA 3WD0A 5C8BB 1KO0A 4EAMA 3KAOA 3F4NA 1U30A 1R7AA 3L4VA 3N2BA 2EPOA 1Q6DA 4R34A 3QPZA 3TMLA 1YADA 4FIQA 4M6VA 4KEUA 4O1BA 4QJ3B 5GVJA 4S39A 1XS2A 4C7FA 2CU0A 3BGJA 1RA0A 3HGRA 1BVNP 1W9DM 4KIRA 3T1GA 3ZVIA 2A21A 4XO6A 4DF0A 3IIOA 3UWEA 1A47A 3GZAA 3T9PA 3A3XA 1EJWC 3N6HA 2BHZA 4MG4A 2FVLA 4EPEC 2QYGA 1Z32X 4GX8A 2PWDA 2PODA 5MHBA 2J9ZA 3NR0A 4Y8FA 3VDAA 2E67A 1UKPA 1R2RA 2PWGA 1XH1A 2W4XA 3GNXA 1HN1A 1KXTA 1QPNA 3LOTA 1J6OA 5C9UA 3SRKA 4H83A 3L21A 4P7OA 2VKZG 1JD7A 3PJXA 3TJIA 4Q8UA 3UZXA 3WL0A 3L0GA 4CNSA 3MMDA 4ZQRA 1PZ0A 2GGGA 1TE6A 1NF7A 1XV8A 5E0CA 4IUOA 3R6IA 2CLMA 4GFIA 5J8LA 4RV8A 1WZMA 1UHVA 1QK2A 1QNOA 3TYBA 3PVFA 3EWUA 3NQBA 1VR6A 3W84A 1GGOA 4LALA 4REQA 2PBOA 3C0SA 1Q7MA 4L9XA 4FLSA 3ITOA 5CSRA 1FWEC 2CBUA 1V77A 4AZBA 3KVKA 1MUMA 3KDNA 1H4PA 3VE7A 4FF7A 3HZ3A 1FWIC 3MP5A 2AMGA 2R9RA 3KLLA 5EU9A 2VRQA 2Q8LA 3R8RA 5CPQA 4BQ2A 4E8CA 3QRHA 3GVRA 3SRDA 4MB3A 4V33A 5C9WA 4CCEA 1DYSA 2ACRA 1EXPA 5TD4A 2Z0IA 2Z25A 2FGZA 1F8IA 1AQFA 3O6AA 1IEQA 3USBA 3NL6A 3AXXA 3N1AA 4GGHA 1OFEA 4JTSA 1XIDA 4HPXA 1CECA 2BSLA 1V3KA 2VEIA 4UXDA 3GDKA 3FIGA 4HZMA 3RMEA 5AHNA 1B30A 1WX0A 1PTGA 4M5PA 4TVUA 3T42A 5G4EA 1W37A 1WXJA 3G24A 3ANUA 3KOXA 2YYTA 1LL4A 4CVWA 3OBKA 2PURA 1WBJA 3OHMB 5CGMA 1OQFA 3BH4A 2ISSA 3TXVA 3NQDA 4IX0A 4S2BA 1V93A 4BQ5A 1VIWA 1EWEA 4EE9A 4RNHA 3K2GA 3CV6A 3C5QA 3TYZA 4ZOAA 3WMCA 3C0LA 3L0KA 1V08A 3VNYA 3EEGA 1QRQA 3B0PA 3HV9A 2Q71A 1FH7A 3DYMA 3EX3A 2JEPA 1UWAA 3U5UA 5DBTA 4J3XA 1RV8A 1YNYA 1JCTA 3DBNA 2VR2A 5A8PA 1MDLA 5IFPA 1EGVA 1WXYA 1XLBA 1O5RA 5U4NA 3LLDA 1JUKA 1A3HA 1US0A 5DXYA 4XUYA 3GIYA 4H6KA 4NU7A 4QSHA 5FEPA 3OLDA 2GDQA 3QQWA 2WSYA 2O4QA 3GUGA 1UR9A 3VZZA 5HWJA 4H6RA 5D8WA 2C8NA 2C14A 4OBRA 3RN6A 5I3IA 2W62A 2C91A 3TUUA 2BVDA 2OT1A 4M19A 4NZ1A 4GIRA 3BDKA 3RLVA 1Y8BA 1IT8A 3LCFA 3PJWA 3GHTA 2WVTA 3A4JA 2V3EA 4ZE5A 3W27A 2WVVA 3K8KA 3KOFA 2BOGX 2WHJA 1UWSA 4LF2A 4FAMA 4EPBC 3F2CA 1A0CA 3QC3A 3FYYA 2W91A 3IGHX 3C8FA 2VXNA 3G8RA 3UZZA 3V1PA 1EP2A 1DJZA 2HBXA 2W9MA 3KRSA 1XSIA 4XSMA 1L2QA 4JX5A 5GPRA 3VKBA 1C8VA 3S2MA 3UF9A 2ZA1A 4PN2A 1MO0A 1RD6A 2PDBA 2H8ZA 3SRFA 4GQ0A 3OBAA 3AMCA 2WC3A 2G4JA 3FS2A 3TZNA 2BVWA 5K3VA 2XVNA 2Z24A 3MP4A 1CNVA 1MSSA 2IS7A 5AC6A 1DJYA 3LDVA 4WQ6A 2DPEA 1LQ0A 3DHUA 1SM9A 4GH1A 1VEPA 4S3KA 2BTMA 1LG2A 3LCIA 2UWFA 3MP3A 3L7RA 5M1TA 2CCRA 1PYMA 5CBIA 1FWGC 3WLKX 3HPSA 4KW2A 1ZS2A 3UGVA 1BYBA 1BYAA 4C6EA 4WDUA 5FEWA 1Q7QA 4C6PA 1VEMA 1Y5XA 3PANA 1QNRA 3M6DA 3HO8A 4O8RA 1YX1A 5HK4A 1FHUA 4XTIA 3VOCA 4ZOEA 2B0MA 1LORA 3EOOA 5HMDA 1FHDA 4AYSA 3RAOA 3AHVA 4CNOA 5C2GA 1SO3A 3QZ6A 5LNVA 4EPDC 3BLKA 2Z1XA 2QPSA 4ZOBA 1UR4A 2F6UA 3EEZA 1W1IE 3QLLA 3JZEA 2W67A 3GIQA 3IUDA 5AN7A 1M53A 4HA0A 1L2UA 1X8FA 4AIBA 2ASHA 1E5JA 2CKRA 4LCRA 3QKEA 3R94A 1FHVA 4W9TA 9RUBA 3NL2A 2JGQA 3UNTA 4ZSTA 3F5LA 9XIMA 1JYNA 1WV2A 1MI3A 1D7KA 1FA2A 1E4MM 1F07A 4UTWA 5HJXA 4Q8OA 5C2CA 3VUPA 3AIBA 1JPIA 3PFRA 3KBVA 1PKLA 2VR5A 3ONBA 4KFOA 4D6HA 3GE7A 3TYEA 2V82A 1UMLA 2WHKA 2OZ0A 3VMPA 1A5OC 1HVQA 1V51A 1RH9A 4MAZA 1QNSA 1R3RA 1XSJA 1A0DA 5I77A 3FA4A 4HN4A 1J0JA 3EBVA 1XRSA 1VFSA 2QJNA 1PO9A 4OIFA 1RZMA 7XIMA 2XIMA 1MQPA 3F5JA 3PBGA 3T09A 3PR2A 1SYTA 3UWZA 1YYAA 3PSWA 2DT2A 3GC2A 4AF0B 3G0UA 2J24A 2E9MA 3IIZA 2WQPA 1RBAA 2J79A 2D0GA 1I1XA 2BVYA 4AD2A 1XSKA 4RXGA 2XG9A 4LSBA 4AAJA 4X2RA 2J47A 3P5YA 3SCUA 5AHIA 4DO5A 4XB3A 1GTHA 3CYJA 1AJ0A 3LZ3A 1KD0A 2VEMA 3W29A 3IUIA 4HCHA 2X0HA 3CTLA 4PSRA 4NYYA 3WNNA 3WMSA 1TG7A 4YTQA 4PEEA 3JUGA 4XAYA 4HTYA 4PMZA 2A3CA 2DEPA 3W4RA 5BRQA 3DDMA 2GSHA 1W31A 4ML4A 3R4IA 3FYOA 4WLCA 2VGIA 1V6WA 1OYCA 3WY1A 4YWIA 2XYLA 3OZMA 1JAEA 1GHRA 1JPMA 1IGSA 2CERA 4UTJA 3C56A 3CZLA 3HA1A 4Q8NA 4IPJA 4MWAA 4FALA 1R47A 2EPKX 4O54A 3E74A 2A3LA 4I8DA 2C1IA 2HDJA 2C13A 2D3NA 4MMWA 4F66A 2VL4A 3RIKA 1W54A 3N2MA 5LIXX 1QNQA 3VKDA 2ZX8A 1IF2A 2D22A 1VYPX 3QV7A 1JGMA 4K7VA 5M03A 1J5TA 4S3AA 2Z1WA 5HULA 3OG3A 4FNQA 4US5D 5IBXC 4ZO8A 2YJQA 2D73A 2YBTA 3W2MA 3ZZ1A 2ZTJA 2G8ZA 3S4TA 5IHSA 4M51A 3ARSA 5C9XA 3FKKA 4UOJA 4GYFA 4IUGA 3CBWA 5FI8A 1IYXA 1RR2A 4Z2IA 4H8HA 4JTRA 3V75A 3CV1A 3HN3A 3BOFA 4PBFA 1HG3A 3MCOA 5ABFB 4IIDA 7TIMA 3LTPA 4XZNX 5BWFA 1FX6A 3AHYA 1ZAJA 3TJ4A 5CBJA 1FFQA 2QCNA 3MMUA 4UCGA 4WKAA 1OX5A 1XIGA 1SO6A 1TV4A 2G3JA 4ZFMA 4P7QA 2VGGA 3CHDA 4C6FA 5CZSA 4XISA 1S46A 3CLWA 4H9VA 3QR1A 3MWAA 4TVCA 4CU6A 3OIHA 4GZ7A 3IAQA 2VEGA 4D8AA 3CAKA 6XIMA 4A8IA 1YMYA 2E5CA 2RGLA 2BG5A 1VHCA 4UFIA 1F9CA 1SJBA 3E38A 5CG0A 4H2HA 3VO0A 1R9XA 3BW4A 4E2BA 2XFWA 3R2GA 5A94A 2DZPA 2DDXA 3LY0A 4AY8A 4W5ZA 3O16A 3VOJA 1TWSA 2JGYA 1QOQA 3BZGA 3DFPA 1U1HA 2XUCA 3NL3A 2ZVIA 4Y9MA 5K4ZA 2XIBA 5CLWA 1IXPA 1DVJA 4WGXA 2OSWA 4TO8A 3CGTA 1VJZA 4I3GA 4J3ZA 2ZUUA 3TTEA 2FH8A 5DT5A 3QMSA 4PEKA 3AJ7A 5A2AA 1YHTA 5D2VA 1QMLA 3AC0A 4PL1A 4E5TA 5D9MA 1PBGA 3WH6A 5K4XA 3CIVA 3PB2A 4AY7A 1PWLA 2ZDSA 3DHFA 4KMQA 4UOQA 1KFCA 1BSLA 3ZLGA 4KETA 1NFGA 4CCCA 2ZRZA 1V6VA 4IP5A 1RLCL 2NWRA 1R3QA 3IJDA 4H7ZA 4NY2A 1XYZA 3WNOA 2PTDA 2GYIA 3AXHA 2KZHA 2BOEX 3HMCA 2VFGA 3C0QA 2VQTA 3NEHA 5HBFA 1XIBA 1E6SM 1OIMA 2B7QA 1SPQA 2XH2A 4L1XA 5IRPA 2WPBA 2NZLA 4W4QA 3XIMA 3L67A 1T96A 1E0TA 1EKOA 2J7EA 3MO7A 1PX3A 4JTEA 3TAOA 3ABQA 1ZZMA 2DSUA 2IQDA 2G3NA 3CC1A 4LUJA 3RILA 4YCPA 4Q8PA 4LVFA 1KRMA 3AISA 4UNLA 3N2TA 1EHNA 4MLJA 3S1UA 4Z2HA 4AMAA 3P6LA 2RAGA 3GAYA 1PTDA 4NI8A 1ML1A 3TOPA 1XIJA 2DSVA 3GTHA 1VBJA 3WK3A 2X2GA 1JEZA 3EWXA 3AICA 1V5XA 3EWCA 4UQDA 2WVSA 3TJXA 1KB3A 3WF4A 2MNRA 4HT3A 1JI2A 1QPOA 1A5KC 2ZA3A 3MJYA 1MW1A 4NX5A 2PDGA 1DXEA 2WMIA 4Z1YA 3A4WA 5AYBA 1EJUC 4NG3A 1GJPA 2C1HA 2PU1A 2QNEA 3FJLA 1QFEA 1CXEA 5BROA 3WJSA 2VRJA 1D3CA 1ECQA 3AIEA 4JICA 2OXNA 4E3TA 3S9YA 2ZZ5A 2QPUA 1NWSA 2CZ5A 3EKZA 1PKYA 3FJ6A 4Q8VA 2VHLA 3PUOA 3ANYA 4TTUA 2Z28A 4UQCA 2A0NA 1OFDA 3S2LA 1K8CA 1TTQA 1P6WA 1R30A 3IANA 3EGJA 4MB1A 2G3MA 3B04A 1S3HA 2MUCA 3F1QA 2BMBA 2QHAA 4WIWA 2GOKA 4F8XA 4DN1A 4JTUA 4KT2A 3RDKA 3B0XA 1X1NA 1UWTA 8CGTA 5DMMA 4WOQA 4W5UA 1GQIA 3PBUA 4D6DA 2A3AA 4W8LA 1P5BA 3M6YA 2O7SA 4B16A 1TWZA 1QBBA 2FHFA 1FFRA 3QYQA 2ZZ1A 3DYOA 4XWUA 1VC4A 5AZ0A 5G1YA 3TYDA 3SI9A 4F0HA 1R3TA 4F0SA 1TPEA 3UP8A 3KL0A 1Z7AA 3MZ2A 5CAKA 3UT0A 3DBPA 5HNRA 4GUGA 3HGJA 2PCEA 3ISIX 4ORMA 4ZB5A 3EA2A 4F2TA 1W5PA 2VZSA 3T07A 2Y8UA 3WL1A 3B3DA 2CW6A 2QXWA 3G1VA 1VYSX 5M3WA 1RXOB 3KOWA 2FTPA 2ZRWA 1UWRA 1JYXA 3LN3A 2DVUA 1QXLA 2ZRVA 3PC0A 2VC9A 1QUMA 1KBIA 4H9ZA 4PMNA 2VQUA 3ARPA 3N2XA 1E73M 4J35A 2V5CA 2QGHA 1SSGA 4M82A 3QR0A 2GGJA 2QJMA 4U31A 5HNUA 4QJ5B 4Y9OA 1GW9A 4NAFB 2Y8VA 4YXGA 3P2VA 1QK0A 4EWJA 5IHRA 1PAMA 1BGGA 4ECLA 1CX9A 3EXSA 2ZXQA 4BJHA 1THFD 1IT7A 2QEZA 2QV4A 4HNVA 2NXGA 1QOXA 1C9WA 1H0IA 2CBVA 2QJGA 5ECUA 3LNMA 1B5TA 4LAZA 4UQBA 1UBPC 3W6MA 9XIAA 2PI6A 1E1FA 4AF0A 4A35A 4LY4A 1XQLA 1BEUA 2XFFA 3PUGA 2VZUA 4GQGA 1EWDA 1XLFA 2PAJA 3K8MA 5F4XA 3HIJA 1YQ2A 1NU5A 3M64A 1UA3A 4CQ9A 2O9PA 4XD5A 1ESWA 1YTKA 4GYPC 3T7VA 1MEIA 3SSJA 4C7GA 6ALDA 1AH3A 1HNYA 3BG3A 4TQTA 3A5FA 4A3QA 2OEJA 1F3EA 4LV9A 3ELFA 3BLFA 3ABZA 3PZGA 2E9LA 1LBMA 1KQYA 1LT8A 3S2NA 2ATMA 3WDRA 2BV9A 4Q4RA 2D23A 3SECA 3HMJG 1ITCA 4LVGA 2B31A 2OZ8A 3WQGA 1A50A 2BWGA 1WAUA 1MQQA 2X1UA 2FTYA 4IP7A 3UJFA 1TQXA 3GUWA 3JS3A 4N6EA 2FIQA 1YPFA 3VDGA 3NSMA 1FKWA 5FCZA 4UTUA 3MKKA 1PZ3A 3VKAA 1JPHA 1Y7VA 3LS9A 2NQZA 4Y9NA 1VJIA 5CLTA 5AYIA 3WH7A 2HTMA 3TV8A 3C2YA 4JQ4A 4HB7A 3DX5A 2ADAA 1B54A 1OT2A 1AVAA 4WSJA 3LV6A 4B90A 1F6YA 3U2OA 3UXIA 4JGDA 3LCWA 3N6JA 4M1BA 4QQUA 1BQGA 4WKHA 3WNMA 3STEA 1Q6FA 3I3DA 4NZ3A 2VM8A 1PCWA 4J2PA 4JKMA 4NAEB 3RLHA 3TN3A 2XIIA 1JD9A 4N0RA 1TMHA 2PGFA 4FA3A 4GVIA 1RCXB 3MYOA 1UZDA 2PA6A 2NVAA 4L1GA 2PTXA 2DZVA 4KWOA 4RKAA 7ENLA 2AQVA 1UD4A 1VFFA 3N19B 3QKZA 5TIMA 1XCWA 4MNLA 5DY3A 1B9ZA 1G4SA 4OFCA 7TAAA 2P10A 3FA5A 4EX4A 1A5MC 3W1RA 4DPPA 5BNKA 4RCXA 3H4WA 3BSGA 4B15A 4R33A 1K77A 4Q8WA 5M17A 4LW7A 4CEXC 3M41A 4AZCA 2OG9A 3G1RA 1W2VA 2JIEA 4D6JA 4GC4A 2I16A 1XG3A 5AECA 1HKIA 1CCWB 5LA1A 4DRSA 2SFPA 3QSTA 3AMGA 2VC5A 3GIPA 2WQDA 5IBXA 2B7PA 1GVFA 5HUPA 2GQ8A 4L65A 5TBOA 2WYSA 1WQ5A 3G0SA 1IR2A 4GYKA 3TLLA 3GNDA 4LT9A 3ZVHB 2ZZ4A 4PCFA 1RPXA 2X7WA 3FHAA 1HJWA 1JFHA 3RFAA 3Q2DA 3UA3A 5BXSA 3P93A 5D9OA 1UUMA 2HJPA 3LXCA 3WQOA 1T8XA 4JN6A 4MAVA 4I9TA 2DZBA 5FJOA 3EDDA 3LQGA 3NDZA 2PLKA 3W2UA 2PZ0A 3E0LA 3VCCA 2Y4SA 4K3ZA 2HE5A 1FDYA 5JQ9A 1UQZA 3PG8A 1W3KA 1PHWA 1R38A 4JY8A 1XIFA 2CFFA 3S2CA 3SM0A 4FNSA 1Z41A 3M1ZA 4S3CA 1ISVA 3MY9A 3M9YA 1P1XA 1A5LC 4HSOA 3THDA 6A3HA 4B2DD 4R53A 4IFOA 3BANA 4AZ7A 2CZEA 5D4YA 4DZHA 4FX6M 1KBBA 1JZ7A 1VGAA 4M1RA 5CGQA 3GXFA 5EPDA 3A21A 4QDMA 1NELA 2ZRXA 5D03A 4Q8QA 4LUIA 1S3TC 3GBEA 3V7PA 3VOGA 4YTRA 3MUY1 1FUYA 2PB1A 1TZ7A 3GTFA 2PDMA 1XIHA 3KVJA 4UTLA 2AOSA 2POZA 3OU8A 3UD6A 5KEZA 3AHTA 4AW7A 3NWRA 3THCA 4UTKA 2E68A 2PDQA 3KP1A 3CLMA 2C6QA 1O6IA 2VRKA 3CAVA 4A4AA 4LVBA 2WC7A 1A4LA 4ZQMA 1GOMA 3SAZA 5KINA 1NQKA 2A3EA 3IJ9A 4ZGYA 3SCPA 2QGYA 2QDDA 1PVNA 1F74A 4HMDA 4RNJA 4JTCA 3ZSSA 2FZBA 1KFKA 4IQLA 2E77A 5C70A 3ZLHA 2NXHA 1TPFA 4RK8A 4AX6A 5DANA 3BLOA 5JH1A 5FJIA 3UG5A 1XLJA 4HA1A 1KV8A 5LNUA 5I00A 2OEKA 2WZEA 2EKGA 1Q65A 3LSBA 4AFYA 4J3TA 3NZQA 4H9MA 5FKYA 3K46A 1EQPA 4IFRA 1R8LA 4WF7A 3SEPA 4CEUC 4EF8A 3RUBL 4AHPA 4XVEA 2Y5EA 4C65A 4PMDA 3SRHA 4RPQA 1QATA 4UFLA 3TWAA 5FESA 1LOLA 2DIKA 2EJ1A 2QMJA 4GOAA 3E2VA 7ODCA 1UKSA 2XM2A 3PY2A 5D2YA 5D2WA 1BQCA 3S5ZA 4O57A 5T8GA 1I6NA 4ROQA 1SW0A 4GQQA 4NQ1A 3TN5A 1R7OA 1NJJA 1QWKA 3CU2A 4IM4A 2V2DA 1BSIA 5ABGA 4PUMA 3NQGA 1ZJHA 4GISA 1D3HA 3O8AA 1O5QA 1NIUA 1K1DA 2CETA 3WF3A 1UD2A 2WC4A 4A05A 3NL5A 1WZKA 3W7KA 4A3RA 2BZNA 1Q5MA 3QMRA 1J0ZA 4PUWA 2WMKA 3JVAA 4PUEA 3L4ZA 1QR7A 4JQ3A 4OWGA 3SFKA 1FCUA 2VC7A 3BSMA 3EOUA 5D37A 1HJSA 2HVOA 3C6CA 4G6CA 2BBFA 1UR3M 1FWCC 4MJ2A 4W88A 4NZJA 4MDPA 4LY8A 3NQFA 3QW3A 2PEVA 2DUAA 2RHGA 3O7UA 1I2OA 2PRMA 3GW3A 1BWLA 2IQTA 5T9CE 1T8QA 3V4BA 2V5DA 3GVQA 2YFNA 4W7WA 3HFTA 3N4FA 4CQCA 2EBNA 1GQKA 2AL1A 2OO0A 2XVKA 3IRSA 5BRBA 1EXBA 1Z9AA 3AYSA 2XFRA 3LBCA 1WCGA 1DJIA 2Q01A 3DG7A 2A85A 5BOFA 3THUA 2Y2WA 1EQCA 3PZNA 3SQSA 2QCEA 3G1XA 2OCZA 3BARA 3VE9A 3OW1A 1A5AA 3ZYZA 4XBJA 2GVEA 3VK5A 2GJPA 4QAWA 1ADSA 2HBVA 1EC8A 4O16A 3BLLA 3K4AA 3LD5A 4Q33A 4ILSA 3UZ5A 4XZHA 1WDPA 3LGDA 1A5NC 1TE1A 3VD9A 3QEZA 4JX4A 4UR8A 3U5YA 1OK6A 4IHCA 3BZJA 1KM2A 4AHOA 1M41A 2OT0A 3TFXA 1E15A 1KCLA 4DHGA 4GNKB 1O4UA 3PZIA 3HURA 3SIZA 3LHTA 1FKXA 3PP7A 3MUXA 4W7VA 2D2GA 1TVLA 2E40A 1EHAA 4WHBA 4PFMA 3F4DA 3HQPA 2OTDA 4FHAA 1X7IA 5BOEA 2OFJA 2YFOA 4OBSA 1UZ1A 4XAGA 3W26A 1F4AA 3M0MA 3AMDA 1OM0A 4MPQA 4AD4A 1XIEA 4KWUA 5EKYA 3QHMA 3SGUA 1AMKA 1KM5A 3L2LA 4KFNA 2X40A 4DI8A 2RDXA 2WW5A 1L6GA 3B03A 4MVAA 2HMCA 3KBMA 2A7NA 4J3VA 1H09A 2CEQA 1XLHA 4TX9A 2OYMA 3PPCA 1H7OA 1ZBVA 1V0MA 4O50A 2XDFA 3HPAA 1RK6A 4HPJA 2Y89A 3RITA 1JZ8A 1XKYA 1MZHA 4G7EA 5LNWA 3E0VA 3CPGA 1DKWA 4OV4A 3ATYA 2J8TA 5C6MA 2E6YA 1MRAA 2E1DA 3G3MA 5JBEA 3JW7A 2IQ0A 4AD0A 4FOKA 1RVKA 4FLQA 4ZVJA 3TEVA 4YTSA 1W56A 4WD0A 5RUBA 3BTNA 1KFEA 2Y6ZA 8TIMA 3VA8A 2CLKA 1KA9F 2C79A 1CXFA 4B9YA 1PXGA 4ML9A 5JVLA 3ARTA 2WHLA 3P67A 1CT5A 4RZ4A 3MV11 3E2SA 1OC5A 1VPQA 4UWMA 5EMYA 3VIHA 4PB5A 3U3HA 1B57A 1XI3A 3D5HA 3LPOA 4M80A 4K38A 3AYRA 3W7HA 3AIWA 4RE3A 2PPGA 4IICA 4ALDA 1TX2A 4UQAA 2DH2A 2BLEA 4GYPA 1A3WA 2VCBA 4JFSA 1I2NA 3KDOA 1XR2A 3T4WA 1OYAA 4PTNA 4QS5A 3E96A 1VF8A 3EPMA 4GXMA 4IPLA 5FJTA 3VIOA 1ZBWA 2Q02A 2Y7GA 2NVCA 1AA1B 3GS6A 4IMGA 3HF3A 1YRRA 5CZJA 4M29A 5A8GA 3HQ1A 2VX4A 3GU2A 3NQ2A 3KRZA 3LA4A 3SCNA 3ZT5A 3HPFA 3RU6A 1HP5A 4R9XA 1WZLA 2EPMX 4G7FA 4ERAA 5C9ZA 4E6MA 4M8UA 2CXEA 3E3HA 1XYFA 3WYZA 2FZ8A 3B9OA 4P7NA 3GXDA 4HYWA 1XLIA 3F5KA 1EX5A 4JN7A 2DIEA 4AIUA 3GG7A 1RY0A 2FVMA 2J8FA 1XCXA 4YNGA 3HPXA 4DJFC 1HJXA 3SADA 2B4GA 1XBVA 4B5TA 3CEUA 3G18A 2WPGA 2C0AA 2PP3A 2YKKA 1JZ2A 3HU7A 2AAAA 4ZCWA 3GR4A 4HPNA 4RDVA 2XN2A 1VBUA 3TC6A 4AEOA 1AQHA 3VNKA 3OVPA 4LFYA 4OBTA 4O1FA 3VM5A 4PB3A 5LYRA 1GOIA 1KRCC 4KQNA 4DWSD 3ZVHA 2XIJA 2J25A 1A5UA 2QMKA 4B3LA 2PDJA 1J4EA 4WXZA 2BASA 1DTUA 4GZJA 5CC7A 4GFSA 3VNDA 3GC4A 4GY0A 1D8WA 3SJNA 4LCSA 1RQBA 2DIJA 1W3IA 3PWGA 3VX1A 3QN3A 4IMFA 3VPLA 1ZBKA 2O9RA 4MY8A 4ZE4A 2IPJA 4YTUA 3SCOA 5BW6A 1GW1A 4OHQA 4P8XA 3TC7A 3KBSA 2BY3A 4NXSA 1DPMA 3MTWA 1WKFA 4GVHA 3F4VA 5K7JA 5FSDC 1Q6EA 1IEIA 1NWUA 5G5IA 5A69A 1V3LA 1TV5A 1Z3NA 2PDYA 3MV01 4CCDA 3WF1A 1XBZA 3UWUA 5F2IA 2RDTA 2F38A 1ICPA 3W28A 2DUXA 4QEEA 1KLYA 3RCMA 1O1ZA 3W2KA 3LRLA 1G4TA 4HNTA 4LJ3A 4OT7A 4B92A 3EB4A 4X3ZA 5H91A 2J74A 2CBIA 2VMFA 4D8LA 2WCAA 1ZP4A 1BRLB 3H8AA 2GUYA 5HWMA 4CU7A 3W7JA 1HIZA 2AKZA 2OYLA 4LAKA 5I2UA 1J2WA 4P61A 4XZWA 2GDUA 3TAKA 3U2CA 2R1NA 2OGYA 2ZDRA 3AIUA 3LHZA 2PF0A 1J18A 2NUXA 1ONRA 1EBHA 3MSRA 3QYSA 1JDFA 4P5UA 3WKZA 1JG9A 1M68A 1W17A 3TX9A 5BYWA 4DZAA 3WJXA 2WSRA 4CVUA 5CBBA 2G3IA 3GSMA 3AWOA 1NP0A 3DUGA 3VD7A 4Y8EA 5EL1A 3NO5A 3LLXA 1M7XA 2OX1A 5E0KA 1J10A 2PDKA 4C5YA 3QJAA 3WQFA 1IZKA 5KMYA 3K30A 2HK0A 2Z1KA 4IQDA 4I6VA 3B0YA 3BVJA 5GJPA 3HG4A 1CB7B 1H7WA 4JTKA 4RDZA 1PIIA 2ZA2A 2CHOA 4DXKA 4FZIA 2OLAA 3ARUA 3R0UA 3H70A 3BJTA 3QY8A 2HVMA 3PZMA 3H2FA 4RDWA 4HNUA 2ZTKA 4FNUA 4QCEA 1AW2A 3L2MA 3RM4A 3W3OA 1XLDA 2GUUA 3FOKA 1GEHA 4U5KA 1JI1A 3V0TA 3QGVA 2J7HA 4JTHA 5I03A 3WFLA 5DCEA 4HZ7A 2INEA 4QHRA 1UH2A 1E0VA 1Q6LA 3VZXA 4X2PA 3ZWSA 1GORA 1C90A 5LSMA 4ZQOA 3MQTA 3STPA 3T44A 2YSWA 4F0RA 1CIUA 4J40A 2ON3A 2EAWA 4R3UA 4MWAE 1W2PA 3GBDA 4DWSC 1R86A 3FV9A 4AHQA 2QIWA 2W66A 2YBUA 2ALDA 1VH7A 1WA3A 1GOOA 2H3DA 3WFAA 4RUBA 1O5XA 5ABTA 4QQ3A 4ROPA 4N4QA 5B80A 1QPQA 4US6A 2TAAA 3FXGA 3APYA 4WK9A 5G1TA 4Y9AA 3FW6A 3SN4A 1X1ZA 3P3BA 4W7UA 1YDNA 1OK4A 3DECA 3VVGA 1W3HA 3UYCA 4F0MA 5JIPA 2OELA 3B9NA 5EMLA 2GDVA 3L68A 4ZO9A 3OOQA 4KGLA 3BAYA 3M7SA 4QEHA 4UTTC 4QG9A 3TA6A 3MUAA 3PK7A 4L5ZA 5AC8A 1KCXA 1UASA 1R2SA 1R3WA 4LEQA 3UCQA 2ZC1A 2EKCA 2DVTA 1NWRA 1GKPA 1VBHA 4DWSB 5GNYA 1XLGA 4IQEA 4P8WA 4PGLA 3EPNA 1H50A 4NZ4A 3GXMA 4QRNA 4V27A 1KRAC 1S5VA 3W1UA 5C55A 4AZ5A 1O60A 1E3ZA 4IIBA 4PRRA 4EOUA 3FSTA 4I5RA 3R11A 4JIPA 4W87A 3IK4A 1EFZA 2HS6A 2NV1A 1XDMA 1YTEA 3BAWA 1ISYA 2AGKA 2XJ7A 2JKAA 4TR9A 4IT1A 2QPXA 3DFYA 4YTTA 1BKHA 1LBLA 4K2SA 1B90A 1S2WA 4GD0A 4NRSA 1ZUAX 2OLSA 2X8RA 2FMOA 1BWVA 1YIXA 3C3NA 5DF0A 5CJNA 5C54A 3UJSA 3GU9A 4DF1A 3VNMA 4RDYA 2B81A 3TW6A 1AZ2A 3IJ7A 1WO2A 1OFQA 1QNVA 2NW0A 4DB7A 3S1GA 1J93A 1GTEA 2X1SA 3M0ZA 4GCAA 1XLLA 2O9TA 1TMQA 1E3XA 3OQ8A 3WJWA 1ME7A 2I5IA 3WQCA 2IW0A 2J77A 4WDXA 2I1OA 2BGNE 2ZUVA 3IGUA 3VZYA 2DT3A 4PULA 3UNDA 4KIEA 4OUEA 5CSSA 1EJTC 4ACYA 5BOOA 3OHIA 4CNTA 2PZNA 4S2CA 1XRTA 3UW6A 3SY5A 1FBAA 1EP3A 1FWRA 3SUUA 5FEXA 5HOSA 3NAVA 3VGHA 2ANUA 1KM0A 2ZRYA 3T0BA 4PCNA 1ZAIA 4J7RA 3NO1A 1ONEA 5E09A 2YA2A 1D7FA 1I2QA 3QZEA 4DQWA 3MWCA 3B0VC 9CGTA 2QIIA 2E4TA 2GGEA 2WM0A 1HW6A 2Z2UA 3QLDA 4PMJA 2CLEA 3VOFA 4PCSA 4QISA 3F4CA 3TIMA 2I9EA 4IXXA 4DO6A 1HFBA 1GK8A 1MDRA 3G22A 5I3JA 3KVMA 3Q65A 1GOQA 4NJHA 3BMXA 6CGTA 4QITA 2FPVA 2HXTA 5FD0A 4O12A 3UZWA 3KS6A 4IMDA 4AZHA 3HV8A 5LKYA 2UY4A 4WY0B 4QJ1A 1UJPA 1BYCA 4M7TA 1KCZA 3ITTA 1UJQA 1FCBA 1BPLB 2OSYA 2B7OA 1Z89A 4XZBA 3H2EA 1Q2SA 2QDEA 5M2FX 1IGWA 3OGSA 1CXKA 3AAMA 1XICA 2IXVA 4N42A 4NL1A 1CWYA 3GH4A 4IG2A 1JQXA 4PC8A 1XRVA 1WUEA 2HSAA 4YJ5A 1TRIA 2DVXA 4J1OA 5DCBA 3UPWA 3CV2A 3PBMA 2E5BA 3VTRA 4AVNA 5LA0A 1YKWA 3FK4A 4UC5A 2WJFA 3K5XA 2X09A 5FF4A 3W1XA 3V0UA 1GONA 4H1ZA 1BTCA 2ACQA 3CM4A 2I5GA 3FJNA 4GVGA 1DIEA 2P50A 3PN8A 5A6AA 3GTNA 3R8HA 3UR8A 3CXOA 3I3BA 4KCTA 4NI3A 1U1JA 3HPZA 1HKJA 4C6DA 4C91A 5DRIA 1PKNA 3FEMA 3MC5A 3K1GA 4BY3A 4AEEA 1Q8AA 2QUMA 3UFYA 4GYJA 4RR4A 2ZCGA 3VOIA 4JIEA 3KHJA 1HTIA 5KETA 3AS1A 4AY1A 4ICNA 4BI5A 2I17A 4CD5A 4GI4A 3GAKA 1G69A 1PV8A 4DJFA 3R0DA 4Z42C 3PZ9A 1ELSA 3WUBA 2R91A 3P80A 4QLKA 5ABEA 2OGJA 2RH9A 3CO8A 4MNKA 4EKJA 3MA8A 2RGMA 2VFIA 5HNTA 3RO8A 3OLGA 1IWAA 4C6OA 1LLZA 3KE0A 4PMQA 4YIWA 3MZNA 1XDLA 5F2GA 5J04A 4HKPA 3ITGA 4OU1A 4TXEA 4L64A 3WUEA 2DUZA 3ITCA 3ZT7A 2P0IA 2NV9A 1DWHM 2XVPA 3WBYA 1T40A 4BF9A 3W76A 1TVNA 3GM8A 3S6TA 4H04A 5A5WA 5CPLA 2OWWA 3FKRA 1YEYA 3QR3A 1EC7A 5I3GA 3J7HA 4U28A 2PRLA 3ARWA 1GQLA 4C6KA 4B5UA 3KCJA 4BQ4A 3L65A 3ITVA 1EH9A 3DERA 3U48A 1OB0A 1WDSA 2BHUA 3WD4A 5A6MA 2V67A 1H1ZA 3H12A 5HQEA 3K1DA 3HGOA 4K6AA 1SJCA 4XTDA 4F9JA 4D9PA 4OOZA 4QE4A 2WVVB 2WBGA 3OBEA 4L9ZA 2WZIA 2D1ZA 1ZENA 4MNJA 4IISA 1AK5A 1LG1A 4K36A 3NSXA 1E9IA 1E1EA 3WK0A 2WMHA 1FXPA 5CC5A 1TJ2A 2CLFA 3V36A 3CZJA 1PEZA 3IPWA 1HP4A 3VFCA 1TR9A 3TZFA 4GO9A 1I0DA 3NQEA 3A64A 1LWIA 1P7TA 1B9BA 4WDWA 3LERA 2WBKA 2OLHA 3UYIA 5LIWX 1CLXA 3R25A 1F3XA 5DX7A 3VD5A 3H7RA 2NQHA 2R24A 4EF9A 1IWPA 3KLKA 4PTVA 1UZ4A 1TQJA 2OX4A 3GXTA 2J4GA 2ZICA 4Q4MA 3RGTA 3VNLA 4ZQPA 1Q63A 1AL8A 3FGCB 4B4FA 1L0PA 3VFLA 3W22A 1V0NA 2F9RA 3KRUA 4FSAA 4I7WA 4MJ4A 1UH4A 4GJIA 1T7LA 1JCJA 4LXFA 1ZBCA 1KM4A 2CZVA 1NARA 3ZT6A 4WJEA 2H8XA 1ZRQA 4DJEA 4U2YA 3LI0A 5T26A 4QX4A 5HQMA 2F2KA 3SIMA 4PE8A 3OYXA 2PD5A 1R2TA 5A2BA 1QASA 3VNZA 5C71A 2F8QA 1GZGA 2BNJA 4JBRA 4K8EA 3ZOAA 4OKDA 1BXBA 2DZSA 1H7RA 2HPMA 1HXJA 4D6CA 1Z48A 2G3FA 2VZVA 3BAKA 2Y5JA 4L61A 4G56A 2Z4GA 3QPEA 4UTWC 4H6QA 4HK6A 4KRZA 2GQ3A 4D6EA 5D02A 3CL7A 5BU6A 2VR4A 3USZA 4DYEA 3G1DA 1OFOA 4XSLA 3VC5A 1ZFJA 3I65A 1OFRA 4UR9A 4AD1A 3OLEA 1G5AA 4H8VA 1L6FA 1DV7A 2PDUA 2EEXA 3QMTA 2CIPA 2DSWA 2YL8A 4C6IA 1B3YA 3NCOA 1E43A 3M0XA 2DU2A 1XIMA 1BG4A 1JAKA 2ZE3A 1K02A 1VYRA 1YXDA 3LXAA 5FJUA 4LS0A 3I10A 2XSBA 1YNPA 1RBOB 1S5TA 5A1AA 4RV3A 4QDWA 2P8BA 4O15A 3IGXA 5E5CA 1H7XA 1XC4A 3E2QA 1EA9C 4NJGA 4LUYA 1C7SA 4PUJA 5B7YA 1D9EA 4FNTA 4KGJA 5FACA 4U3CA 4IJRA 1QAPA 3KBNA 4D8ZA 3G6LA 3GXPA 3GG8A 1EDQA 1WDRA 3Q67A 1LT7A 2V3DA 1CXLA 1IXOA 1CEOA 1KM3A 2VNCA 1MMFA 1N82A 5HR6A 1OF6A 2Y24A 1VPXA 3EWDA 3BLEA 3VU2A 1X39A 3BV7A 3TYUA 4TTGA 3LTYA 3P60A 1OG6A 4CCZA 1T6MA 2NX1A 3M0LA 4UOZA 1U5HA 4ZMGA 4EXBA 2Y7EA 2DQWA 5LA2A 2A1YA 3IAPA 4AG0A 4DIAA 1K9EA 3EX1A 1UIPA 4C6CA 3NQVA 4XBKA 2P76A 3GU1A 3T78A 5BMWA 1EPXA 2DV0A 3HBLA 4YS1A 4L7ZA 4F0KA 4NT0A 3S3GA 3KZPA 2F2HA 4MWAC 3EKLA 4EAYA 2WZTA 1IEXA 2C18A 1A4MA 4S3FA 4NNBA 3POHA 5ECVA 3WD2A 5LIYX 1UBSA 3GNPA 1LDCA 3ARRA 4DUOA 2JKPA 1SVDA 2QDGA 2BB0A 1H62A 4JIHA 1TWIA 2BY1A 1GZJA 5JBFA 5AFDA 1QU4A 5LZLA 4GCXA 3V5CA 3L4XA 1RQEA 4F0LA 1ITQA 1H63A 3W7IA 2RDUA 4EK7A 4X9YA 3MBDA 1IZJA 3O1NA 4UFHA 4I6KA 3RU8X 1JQVA 2OKOA 1S39A 1YDYA 3AZTA 3OG2A 1B31A 4E2DA 4ZB0A 5H1WA 1PE1A 3VCRA 3TNBA 2JQXA 1YE4A 1WUFA 5D2XA 3H7UA 2VD9A 2ZZ3A 4PBGA 3BJFA 4HK5A 4KH2A 5DELA 1GVIA 2QR6A 4MWAB 4CQ8A 3Q58A 3UXDA 1HJUA 2F7FA 1UWQA 3IV8A 3QTGA 4GX9A 3GZ3A 3W82A 5HWNA 1GWJA 3ARXA 1P43A 1XXXA 5EA9A 5GQBA 2ABAA 1UC4A 1OCNA 2OYKA 3SN1A 3FDKA 4WY0A 3EDEA 5CZTA 4UTIA 3MYPA 4H9XA 2VDHA 2R1PA 4C5ZA 2O55A 1P6CA 5LGZA 2R94A 4UTHA 4WOZA 3WQWA 1DJQA 1E55A 2Z1VA 3H54A 3WJYA 3O6CA 3VKCA 4Q22A 4R7WA 4JTDA 4GKLA 2FPYA 1J0IA 2WCGA 3W81A 4Q3MA 3DXIA 3ID7A 3L4TA 4YHGA 3S5NA 2GQAA 1CENA 2RKXA 3QOMA 3CQJA 1W5MA 3EXRA 3N73A 3T0TA 5HPOA 2V9DA 3AOFA 4WY0F 1VFHA 1V7AA 4Z2JA 3MKVA 1V4YA 3I6RA 3B9DA 4GXWA 4RZBA 3G8EA 3RCNA 3DIPA 3CQKA 1TJRA 1LLWA 1UP2A 5I78A 5LNSA 3BW3A 1I75A 4TMCA 2CPUA 4AWUA 1R46A 4NRRA 3FCPA 4GIEA 1UKTA 2YCLB 5CXPA 4DNHA 5D2TA 3KL5A 5BU9A 1SJDA 2J88A 4EPKA 1FTXA 2NSOA 1IR1A 4YYCA 5HXMA 3WMBA 1F4HA 2V30A 3GB6A 3NO3A 1FWHC 3VGGA 1EJXC 4FOUA 1WE5A 3DFSA 4YL2A 3OA5A 4NHVA 3PJUA 5E70A 1EYWA 1IIHA 3APGA 3NXFA 3BUVA 4Y9PA 1XYAA 3LG3A 5EFDA 4L56A 3BLDA 3TSBA 3W38A 1X1OA 3FAWA 3B8SA 3B8WA 4CNNA 3ZWTA 4GUHA 3LPFA 4CN6A 2CITA 4PSPA 3EWWA 1E9LA 2GJXB 3ZMRA 1NDVA 1DWGM 1XCFA 2A3HA 2D2JA 1DIKA 2PDLA 4JQ2A 3M0VA 3KTXA 4BI7A 3Q4DA 4C90A 3EA1A 3LYEA 3DG3A 4F9DA 4POCA 2JIWA 2W6RA 4HA4A 3TJLA 1TR1A 3CK5A 1FQ0A 4AXKA 4IQJA 1E4IA 1VKFA 3R1ZA 1J0HA 4S3DA 3TTOA 1QWGA 3MKCA 1GVSA 1QHZA 4LBUA 1UR0A 3LI1A 5CZKA 3QV9A 5HMFA 3LM7A 5EMKA 3QVQA 4LNCA 3ZO9A 3VDBA 1XBYA 3ZM8A 1OZMA 3AIRA 1M9HA 2X41A 4PH6A 4RL3A 1R87A 1BAGA 3BGAA 2PDFA 1ZAHA 5FJJA 3O6DA 3W7CA 3KCOA 1OBAA 3WQVA 4LYQA 3W1LA 1KM1A 3JRKA 3WIJA 3SCRA 3CL6A 2FJKA 1JPDX 1L8NA 3ZSTA 4AD5A 4B91A 4H7CA 3RJXA 1E72M 4XD3A 4JXCA 4QG8A 3PPHA 3OEXA 1T0OA 1IT0A 4BF5A 1JNEA 4R7OA 1I60A 4A8NA 5LXEA 4Y90A 5I3HA 3U2ZA 1XYBA 5F7UA 3CO4A 1UW9A 3M07A 2NQJA 3EA3A 1XC6A 2QCLA 3WLRA 3SCWA 3LSCA 5REQB 1Q3NA 1S2VA 4HP5A 5LHEA 2WMIB 1HL9A 1G7VA 4I8YA 1PDYA 3FDGA 3UETA 1KW1A 1AD1A 2XIQA 4W84A 5CPNA 4ASTA 1AG1O 4KWWA 1UOKA 1UOZA 1HUVA 4YVXA 3HB9A 3FGCA 4FR1A 3AUJA 1KBJA 5DT7A 2CLLA 2QW5A 2J8GA 4M3PA 3SDOA 3WLOA 5LIKX 3B4YA 1ADDA 1HGYA 4I7UA 4IIGA 1RPKA 4WSHA 4XV0A 4ATDA 4UQ9A 5I79A 1REQB 1XJBA 4S3BA 4K1GA 1WYIA 1H1YA 1VFOA 1YW1A 1OSEA 5D8ZA 2YDAA 5BZAA 4NZFA 1UMYA 5IM51 4TX6A 1KV5A 4WUIA 2E1WA 2FTWA 1YPIA 1UIOA 1JFXA 4A3HA 1DIOA 1MXSA 1RHCA 3ITYA 4A22A 4DO4A 4AB4A 4FLOA 4Z0JA 1UZHA 1M65A 1ZJIA 4MY1A 2PTYA 2QJJA 4HGXA 3TN4A 1GPFA 3AIVA 1A5CA 2VOMA 3SCSA 1P0BA 1DJNA 1GOKA 3ZS4A 5A8QA 4DJDA 1XLEA 5BWAA 1VFMA 3PAJA 1H5VA 1K9DA 2QLYA 2HZGA 1V3IA 3ITLA 2OKTA 2X05A 2VZTA 3UVIA 4DPQA 3W7DA 4UMBA 2GJNA 4J3WA 3S9IA 4DUXA 3S0CA 2XZ7A 1DTNA 3H2OA 3L66A 2E7FA 2WJDA 1AZ1A 4P7LA 4QM1A 4DELA 3MSDA 1Z69A 1OT1A 1UR8A 2GVGA 5CPOA 4C60A 2FFIA 4BZYA 4NP7A 1KXVA 3BW2A 1UP3A 4ZZ9A 1TREA 3W2NA 1ZPTA 3MMTA 3ENLA 3AHXA 1LRTA 1ODZA 4M6PA 3ZJ7A 2O7QA 3L12A 3MHGA 3VXGA 1TPC1 1LQ2A 3PZUA 1ZQ5A 1Z8AA 4Z1CA 4JQAA 1E6QM 3SUSA 1P0KA 1U2YA 4PR4A 4WJXA 2GLKA 2WSPA 4ZENA 4IZGA 4J2MA 3WLSA 1MYRA 2ZZ7A 1UD6A 3QY7A 4AEFA 4D71A 1D2KA 4LGXA 4F4RA 3ARYA 3N6QA 3I4KA 1GVYA 2PWUA 2RDWA 1EJ7L 4XAPA 4WXYA 1WKEA 4LYRA 4DX3A 3H4GA 4RW3A 3RR1A 3G6MA 4HQVA 3CQ0A 3ME3A 1DE5A 2DT1A 2OVLA 4WRHA 2FH6A 2JE8A 3AS0A 1F05A 1P4CA 4J5NA 3UU0A 1QI5A 3CHCA 3FYPA 1WPCA 1ONXA 3O05A 4EVZA 1E1CA 4J4KA 2AGTA 2IMRA 3S6DA 1R3VA 1XRFA 1H49A 1TIWA 3VKJA 1NDYA 3H24A 4DVOA 3MHUA 2BY0A 4Q4QA 3P7YA 1HL8A 4DNMA 3ES7A 4BKNA 3WH8A 4KESA 2X7VA 2P3ZA 4R9OA 1S2CA 1OG0A 4IL2A 4FIRA 1DWFM 4XX6A 4M56A 2C3ZA 2ODOA 4Y2WA 3PTMA 3H6OA 3NDOA 1H61A 1EGMA 4FX7A 1F61A 4MF4A 3BV4A 1C29A 2C71A 1HF6A 5LIUX 2AQOA 3QPYA 1JDCA 3M5VA 4IP4A 3UY7A 2FB3A 3T4CA 4UUIA 1NWTA 3WQPA 3TTSA 3IK2A 3BSHA 2V68A 1WNOA 2VCCA 4AQLA 3HGSA 1JVNA 3RX4A 4JKLA 2FVKA 5AC7A 2ZUSA 5F4WA 3GTIA 4FXRA 1VPYA 3C2VA 4RE4A 1XYCA 2J27A 1RJQA 4MJMA 4MPKA 3B8DA 2ZQ0A 4EP8C 3NURA 2XH0A 1JYVA 1W8GA 1EZ2A 2XSAA 2XVLA 3UERA 2IKHA 3GYEA 3R89A 1DL3A 3U57A 2E8ZA 1AMYA 2ZE0A 3U4AA 2E6AA 3FN9A 5CQ1A 1A5SA 3THQA 4Q6JA 4NSBA 1VENA 2VFHA 1A5BA 1CTNA 4LV4A 3T55A 1TCMA 1T41A 1XGEA 2YCJA 5KZMA 3UCDA 1CB2A 2EGZA 1HJVA 1OF8A 3LV5A 1JZ5A 2J66A 1U1UA 4IJCA 4C7DA 5CPTA 4H6EA 2G96A 3MS8A 1ZP3A 4LAOA 3RLUA 3A47A 3ARQA 4D6GA 5HINA 3WD1A 5U7SA 1OX4A 1FWSA 2I9UA 3GKAA 2JF6A 1ZALA 1XYMA 1OJXA 3RPMA 4DWDA 4AZCB 2VVNA 4EANA 3W1MA 2E9BA 4MDOA 3L4YA 4MUPA 1RSCA 4W8BA 1TV7A 3TSDA 2C7FA 3TYAA 4CU8A 3DGBA 2YCLA 3RM9A 1EEPA 3MANA 1F2JA 3W2JA 2PWVA 3LK6A 3VDCA 4GBDA 4MUZA 1W1PA 3U4FA 4WVXA 4LPCA 3MVIA 3UXAA 4H19A 4PTDA 5ENLA 3PWIA 3TW9A 1DJHA 2R1MA 3URAA 3R43A 4NJKA 4IFKB 4O13A 4W93A 3H53A 2HPIA 4JFTA 3MI2A 4HTBA 4RPPA 3M46A 1XLAA 4KRTA 2VFFA 3KCLA 3S46A 3S83A 3MDUA 4RNFA 3BGGA 4PTMA 3RHGA 2VZOA 3OTRA 5EMJA 2GJXA 3S8HA 3CNYA 4R88A 2NSXA 4DM2A 4E4UA 4XZIA 2CXGA 3H2AA 1FWWA 1KGXA 2OMAA 1V0KA 4L6HA 4PRWA 2PSNA 3IIXA 2ZC8A 2I5QA 2Q3RA 3WNPA 3LZ5A 1TELA 4GG9A 4WX2A 4NILA 4XD4A 5KZDA 2ZFAA 2OZTA 2YBVA 1IEWA 2ISFA 3PSVA 1GPWA 4C6NA 2PTWA 1RBLA 1R0MA 3FJ4A 3KX6A 4GUFA 3P84A 1UROA 3L23A 4M6QA 1F6PA 4TMBA 1JRCA 4JTGA 2XM1A 1GYNA 4AVOA 4QNWA 1CLVA 5BXTA 2D0HA 4B5XA 1PSCA 1UPMB 3DZ1A 2XH7A 2OSXA 3TR9A 1TTIA 3CWHA 3W85A 4C6LA 4DLFA 2V3FA 2FHCA 4TOQA 3TU9A 5GNXA 1M7JA 1L9WA 3EOSA 1XDJA 2AAMA 1NM9A 4FOJA 4A21A 1B4EA 3MPGA 3W01A 2NX3A 1BGAA 4JTAA 3SFWA 1RCOB 3W75A 3POCA 1G67A 3B8VA 2O0TA 3P62A 4BCEA 1UG6A 5AVHA 1KLZA 3ONCA 1RQHA 1W5QA 2X16A 1IXQA 1PB0A 7REQB 4I9MA 2XSXA 4CUCA 1KFJA 4IGMA 1EZWA 1K7EA 3R13A 4FPSA 4YVVA 5BXRA 3W53A 2ABBA 1H51A 3HJEA 4XO7A 4G1KA 1MW0A 4UMCA 6REQB 5REQA 3VAVA 3WLMA 5KZEA 2ZIDA 5H8UA 3WNKA 3W1NA 3QTPA 4N9DA 1CXHA 3QF0A 1FP9A 2Q09A 4HMEA 1TA3B 2OR2A 2X0YA 1XFCA 4PYSA 1KKRA 2G4FA 1U5VA 3UGRA 3V16A 1MNZA 2P3EA 4DBDA 3LX9A 3CAWA 1S5WA 2G41A 4NXKA 2TSYA 3B06A 6ENLA 5BMXA 5TNVA 1CW2A 1REQA 3OIXA 3VIFA 1YE6A 3L4WA 1J01A 2C1GA 2R8WA 5I5RA 2C19A 2DJLA 2Z1SA 1W1YA 4U5IA 3MU7A 3W7LA 1E71M 2JKEA 3WENA 4KFPA 4H8NA 2HEJA 4WEVX 3GDLA 3KXQA 4UNIA 1JGIA 3W02A 4FNRA 3WDPP 1B4KA 3LHWA 3PS7A 1QI4A 3VNJA 3MVTA 2G0WA 3NQ7A 3NZGA 4L4MA 4LUTB 2DZWA 3O3RA 5EBUA 3I7QA 1EC9A 4LEFA 4LVAA 3URBA 2XN1A 4HMCA 1XYLA 2QJHA 1DJWA 4HHLA 1DWIM 2FMNA 1QVBA 3H26A 3RPTA 4HNCA 2XN0A 3VIGA 4V1YA 3M0IA 1PHQA 4NASA 5H6HA 4PBEA 1XLCA 2Y88A 1B3XA 1ICSA 3IVTA 3LMYA 4PUDA 4MGGA 4PUKA 1VCFA 3TDFA 3WBWA 1CI1A 4K39A 1DWAM 1PDZA 3W86A 2KAUC 3TYCA 3VIIA 1AW1A 4Z2KA 3VM7A 4A2RA 4E4PA 3GG0A 1LOQA 4Z1DA 3B8IA 4B5SA 3F03K 2V3GA 2VENA 3LGEA 5DBUA 3H2CA 1E51A 4X0NA 2GGIA 2MANA 3QBUA 3EWBX 5H8PA 4MJZA 1GQNA 5KITA 4XIMA 3P81A 3E5PA 2BX7A 4O1AA 3T2QA 2WB5A 1IHIA 1YXYA 2OQLA 3BC9A 3DFOA 5L6UA 1R3YA 3C8NA 4A6GA 2QAFA 4MM1A 2WAGA 1H0GA 4GK8A 3DN5A 1Q6CA 4N9BA 4LBRA 4IF2A 3QH2A 4V28A 3WEMA 3ABSA 1QI2A 1Q45A 2Y62A 3GVWA 4JL1A 3KZSA 5F2MA 3W7MA 4M6UA 3RG6A 3HQOA 2EO7A 3NZ1A 2WJEA 1DXIA 1J5SA 1B3VA 3WQDA 6TAAA 2E6DA 3R58A 2NQ5A 2ISWA 5HDRA 1DWJM 4E2VA 1POJA 4OV9A 3W6LA 3W1AA 4G7EB 3NPUA 3U2EA 3JU2A 5DMNA 1KWKA 5AB3A 4RZ6A 4H2CA 1CGXA 3KRBA 4D6FA 1DQUA 1WP6A 1LJYA 3FLUA 1EPVA 1VFUA 2YCKX 3DOPA 1Q13A 4O0ZA 1XM3A 1FCQA 1GVRA 3AXMA 1P0EA 3DKJA 4MZ1A 5FOOA 1G4PA 1ISXA 3A22A 4PMVA 3GG1A 1LUCB 3P14A 4LH8A 2JFEX 5E1QA 4XZ9A 4LC6A 4ADSA 3FXYA 2WANA 3M5YA 3N12A 3B9AA 3L9CA 1QHPA 5B7ZA 2D3LA 4ZBCA 3ICJA 3N04A 4BHYA 3HTWA 1V3HA 5HAOA 5HATA 3WMLA 2ZX5A 1K7XA 4RLIA 1XUZA 2VEPA 4GGBA 4PTXA 4DZ5A 3TXZA 2XVGA 2ZZ6A 1RY8A 3H23A 3UWWA 3BQ6A 1K7FA 1Q85A 1XFBA 1CGYA 4GMEA 1ICQA 3I3EA 2PP0A 4LF1A 1NOWA 5G4WA 1XLMA 1ZJBA 3C2RA 3QC0A 1GVQA 1K6WA 5BRPA 2G5WA 1O12A 3N3TA 1C7TA 3ANVA 2IPFA 3RRXA 2J78A 3AU2A 3W9ZA 3CT7A 2YR1A 4QNEA 4ZXLA 4QE5A 4LB3A 1EA0A 3LNPA 2J62A 4HK7A 4Q7IA 1UR1A 4DO7A 2GOUA 5EYWA 2A3BA 1SZRA 1O7AA 4JNMA 3ABRA 3PPFA 1N55A 1SJAA 2VEFA 4E8DA 3GTXA 4AMCA 4ZODA 3CT2A 1E56A 1N8IA 5AZ1A 3VCNA 3C2EA 4DBUA 3GO2A 3IJ6A 2ACSA 4NF7A 3DC8A 3OZOA 3UBPC 5FAGA 2ZUMA 3DHDA 3MI6A 3REQB 3PBWA 1EDGA 1QI3A 2HWGA 1UD5A 1NFPA 4JCMA 5E9XA 1EEXA 2PGWA 2Y7FA 4G9PA 4JL2A 2YLLA 2ZX9A 2G37A 4E3VA 3DFQA 4P7RA 3C61A 1JNDA 2EG6A 4AXNA 3N34A 4U4MA 3W1TA 4WZHA 3LEPA 3ABXA 4MHBA 3PZQA 5MF5A 3GHSA 3QOKA 1EJRC 3TQVA 2Y8KA 3N17A 4UNKA 5G2IA 3BAXA 1QT1A 4J3SA 3V0SA 3GLCA 4IFKA 4RXFA 3CMGA 3Q94A 5HMEA 2OODA 1W1B1 3WLHA 1IEVA 4WR3A 3RX2A 1VHNA 2C16A 2VTFA 1EDTA 1S2TA 3BXWA 2QCDB 3NG3A 1MWOA 4C6BA 2P0OA 3NOEA 1C8XA 2CBJA 4FLRA 5HR7A 4LAMA 2QUTA 2YCEA 1VFTA 3AS2A 3TR2A 4PMYA 4W89A 1MUWA 1XH2A 3M0HA 1LRQA 3N4EA 2WWCA 3UA4A 4H4IA 1E9ZB 2I7GA 3D6NA 4BWLC 4NJJA 4DAIA 1E4NA 1QNPA 4NNCA 3VOHA 3OA3A 3E5BA 4JQ1A 2DZUA 1OY0A 3AQUA 5ABHA 1TO3A 2VFDA 2Z7GA 4ZTYA 5FL1A 1VD6A 1SU5A 3MDWA 3KWSA 5A6KA 4E4FA 1BYDA 3M43A 4WKFA 4FMVA 2R1KA 4KCWA 5IFTA 3FEQA 1JCYA 3AXKA 3H22A 3PTQA 4PL2A 3MHFA 4GPNA 1WDQA 3B05A 2HK1A 2V38A 5A6LA 3IARA 2OEMA 2FGBA 2Y5SA 3W1PA 3CUIA 3YPIA 5I23A 2WKLA 2W61A 1TV2A 1FWNA 1HO4A 2V8ZA 4F3HA 3DI0A 1W0MA 2QS8A 4MKSA 1TTJA 3UESA 1CZ1A 3LRKA 4JDYA 1RA5A 1U22A 5DEZA 3UZYA 1J6PA 1F76A 4UFJA 5EBAA 3C2FA 3PZVA 7REQA 4BFAA 2V5BA 2YDSA 2FPTA 4IL0A 4CN4A 4U2ZA 1EOMA 5D9NA 2UBPC 4Q6XA 5G2WA 1E5NA 4LRSA 3L0NA 4LQ1A 1OINA 2W3ZA 3GWQA 6REQA 2QCFA 1N8WA 1V6YA 2HRWA 3GX9A 1ZL1A 4GI6A 1UWIA 4XZLX 2ZKMX 3N2CA 4AUBA 2VX6A 2HE8A 5A6JA 3PBVA 1C3FA 2ISVA 4CN1A 4AZ6A 1TA3A 3W07A 3W7GA 3KOYA 4DBEA 4QJ4B 3FA3A 2HQAA 1NY1A 1HL2A 1ZNNA 4QLLA 5DQPA 1EO7A 3QY6A 4IH3A 1YBQA 1DEDA 5E9AA 3R79A 5A6BA 1CDGA 1UUOA 1BFNA 1F6KA 3TC3A 4JIRA 1P1MA 4DM1A 1EUNA 5DFAA 1QW8A 3CHVA 4KS0A 2PWHA 1HJQA 3RNDA 3TOYA 3E02A 3W24A 1SFLA 6XIAA 4PB4A 3OO2A 1Q6RA 5I3FA 4GZIA 4JY9A 5LGXA 1SMDA 2ALRA 5CSUA 4OZOA 3LRMA 2B7NA 1XBXA 4F2BA 3E49A 2DQXA 4LUTA 3G1YA 4XKYB 3CZKA 4N6FA 1V7YA 3RMJA 3OP2A 5F1UA 1JDDA 4IX2A 3KW3A 6TIMA 1OFBA 1QPRA 1LROA 5MKGA 3FSUA 5FIPA 8XIMA 1ZGDA 1JXJA 1LP6A 4MB5A 2NLYA 5T91A 3LLFA 2GFTA 4JTJA 2DW7A 4XZMX 1R6WA 1HVXA 2C0HA 3SQMA 2RFGA 3L4UA 1L6WA 4FEZA 3QXBA 4AVFA 4DJFD 1HX0A 2DJXA 3QSRA 1JPKA 1HKKA 3LBOA 5CZ0A 2WSQA 3CMFA 5A6TC 2P5NA 2ZVRA 2FGLA 2VUNA 3MUZ1 2ISDA 3LCLA 1XPGA 2WMJA 2Z2AA 2GPTA 4JYDA 4M81A 1GNXA 1EJVC 4GY1A 2Y61A 3UG8A 3D0CA 3SSZA 1JCNA 4AC7C 3S1XA 3AALA 3LENA 4OTKA 2NT0A 2PP1A 4C6JA 1NDWA 5IDIA 4LRTA 1Q6QA 3G3DA 4UMAA 1WKDA 5HUOA 3O0KA 3BAIA 3LGGA 2W27A 3AZRA 4S1FA 4AYGA 2AL2A 4AIEA 4HCLA 2HXUA 3P8IA 3CZEA 3LCHA 3NOYA 1TFVA 3EWZA 1LWHA 4M7SA 4PMOA 5DRCA 3W23A 4JFWA 3W87A 4J28A 2VYOA 1BVWA 1V6UA 1O94A 4MYAA 3NVDA 1TIMA 4GNJA 4D2JA 1J9YA 4ZO7A 3MUIA 3AIQA 3M5ZA 2GWNA 3WQ5A 2F61A 1CYGA 3N29A 1VRXA 2PLMA 2V2CA 3TCEA 1V02E 4JS3A 4N9EA 1CBGA 1LUCA 5CPMA 3RM8A 2ZUWA 3WELA 3K4DA 1P0DA 1LRNA 4JEJA 4UIOA 2WLYA 5IDZA 3ALGA 2A79A 5DMLA 3NXLA 1TJPA 4TV5A 5C5YA 3O06A 4XKMA 3OLIA 1UH3A 5AYXA 3SCTA 5AHEA 1XISA 4FNPA 1GOWA 2PS2A 1Q4WA 2JF7A 1LCOA 3ZFHA 4A3UA 4QBXA 1DQWA 1OGGA 2YW4A 4K68A 3K4WA 4R5EA 2OJPA 2QULA 3RJYA 2J6XA 3ARVA 1KWGA 4BK9A 2E5DA 3BG9A 1FWTA 3OZYA 3TLQA 3LHYA 3UWVA 1J8VA 3TQPA 1QW7A 2D24A 4DJED 1G1YA 3NUKA 2WKGA 3BWWA 4LYPA 1IWBA 2X1TA 1GEQA 2GGHA 4ICCX 1KTCA 2F84A 2XWDA 1UP0A 4X22A 4URIA 3R12A 3CEPA 1MFUA 2WXDM 1ZSXA 2GSEA 4IJBA 1XWYA 2J7BA 2Y0FA 1MVYA 4A8RA 2OB3A 2CKSA 2VDGA 4GNVA 3UJRA 1NOFA 1ADOA 3NZPA 2YW3A 4GKTA 2WZMA 4DYJA 4QE1A 4IG2B 3TMQA 3REQA 4AWSA 4FXFA 4O1DA 1ZU8A 3XISA 4MKVA 1PTAA 5I0DA 3NQ6A 3W72A 3DCPA 2AKMA 2XWEA 3EAUA 2H9AB 1TPUA 2OO6A 2VGBA 1EX1A 1VB9A 3IGSA 4NJIA 3B9EA 4JR5A 3AMLA 4I5UA 3VNIA 5E6YA 1RJRA 2EPNA 1PYFA 2QVNA 3W88A 1F5ZA 2VFEA 3D47A 5CG7A 3EX2A 3NM3A 2IKIA 4HOZA 4O10A 5E93A 1OADA 1E6XM 3L5AA 4LVDA 4G5DA 1J11A 3SUVA 3S47A 3WUGA 3ES8A 3CJPA 3CYVA 4W85A 4Q4KA 3NQAA 4HOXA 4CLMA 3NA8A 4DI9A 1R85A 1GVOA 1V3JA 1ZLPA 1EJSC 1L6YA 2QCDA 2ZX6A 1RUSA 3IIVA 4C6MA 5KZ6A 1B1YA 4AZIA 4GY7A 3T0DA 1OCBA 3G77A 1EBGA 2HROA 3M0YA 3MUCA 4G8TA 4AISA 1LL7A 4JNYA 1A3XA 1H2JA 3I68A 2PLCA 3AXIA 3ZR6A 1KGUA 4TUFA 1A0EA 3VYLA 1P0NA 4KWVA 4QAIA 1N2VA 2V5KA 5M5DA 2BGSA 2YGYA 2VI0A 3EKGA 3G1AA 3QGAC 3DH7A 3UQNA 1E6NA 1JF6A 4I7VA 3BK0A 3EDKA 4IPNB 1KTBA 4XD6A 3V5FA 3A4XA 1TV3A 3VIKA 3FFSA 3RCYA 3SZ8A 4GO8A 3MCNA 1KGWA 2CWNA 3S1VA 3DEQA 1SFSA 4YPJA 2GVYA 3A5VA 5I7GA 3U9IA 4ATLA 4ZQCA 3ZIZA 2FDSA 3PHAA 4L6OA 1EO5A 2UY5A 4KEZA 2NQLA 4MZ8A 2ESCA 5HQLA 1KNWA 2Q6ZA 4HZ6A 2WCSA 4ZB2A 3S6OA 1ISZA 4BA0A 1W3TA 1C8QA 3QHNA 2OWCA 1O66A 3BCDA 3WG6A 1KQZA 4H9YA 3CHEA 5IOBA 3BMWA 4LC8A 4O53A 3VD3A 2X0SA 2GL5A 4YLWA 1GCYA 3AFBA 3SB0A 2ZX7A 1XL9A 2INFA 1OD0A 2OZ3A 4MSSA 4BWLA 3VC6A 1M01A 5AOUA 4MOZA 1I45A 5EMUA 3BQ5A 3UCCA 3N9KA 1YPXA 4CQAA 2QT3A 4DJEC 1S2AA 4Q4PA 3FY1A 1IIGA 1Y5VA 4HBKA 4EIVA 5HMSA 1MXDA 1PJ9A 4BS0A 4QG6A 4LWWA 1U5JA 2IKGA 1M3UA 4RJEA 1JIBA 2A5HA 2I56A 2DZXA 3U7BA 2FZDA 3CB3A 4JCLA 1IXNA 4KKXA 2QCMA 5DXXA 4JHZA 2VO5A 1AJ2A 2REQB 2V5JA 3MT1A 2VWTA 1VLIA 5D9PA 3IV3A 3M44A 2IXUA 1P7TB 2FLIA 2OWXA 2PU0A 5I02A 2AMXA 1BXNA 1O5KA 1G01A 4EACA 5FJRA 4OE7A 3TONA 3I6EA 3GKFA 3F2BA 4ZEPA 4NZCA 3UXLA 2AQWA 4S38A 2TYSA 5LHFA 3BLPX 3D3AA 4HCDA 1EYEA 4B3ZA 1HZYA 2BVTA 3DKLA 3MO4A 3T0CA 1ONWA 2J7CA 4X9SA 3WK2A 2YDRA 4PUNA 5HANA 1W6TA 3MSGA 3E6EA 3PAOA 3SR7A 4TIMA 4XG1A 3KM8A 2Z00A 3QQ0A 4HYVA 2ZXDA 1MW2A 1CGVA 4GIYA 4LAUA 3UR7A 2XPKA 3CUFA 2BY2A 4XKYA 1B3ZA 4AU0A 1J79A 3I6TA 2R82A 2Q8XA 3QHOA 3KOZA 3F2DA 3EZ4A 3CUJA 1AL7A 4O17A 1EIBA 1QTWA 1W5OA 1PZ1A 1ME9A 1UQYA 5JH2A 2XFYA 3LMZA 1WOBA 1LL6A 2RUSA 1JZ4A 5EFFA 1XD0A 3STCA 1YTDA 3E0FA 2VX5A 2EG8A 1V6XA 4E2OA 1S38A 2INZA 3QV6A 3IRDA 2V2HA 4JHMA 3R8GA 2E8YA 4IIHA 5DMYA 4KRUA 4OECA 3RO6A 1Z44A 1WZAA 4Z2GA 4PZVA 4ACZB 4IOTA 4WDTA 3ARZA 4LUSB 1GZ1A 4F2UA 3WH5A 1D3GA 4BEUA 1QW9A 1J2BA 3L5MA 2G97A 4E38A 3WDJA 2JK2A 3RF9A 1XX1A 2YL9A 3ORWA 4O14A 2WWDA 1TMLA 1PWMA 2Y85A 1KC7A 4G2DA 4HHPA 1VIZA 3M16A 1M03A 4ZXOA 4E8GA 1BHGA 4V15A 1BLIA 2ACUA 3LCXA 1NTHA 4HMNA 1MRQA 1W1ZA 1SO4A 3AWNA 4S23A 4FO4A 1K03A 1ZHAA 1E40A 2YPIA 2PBGA 4EXQA 2ZWYA 1WB0A 1Q66A 1V0LA 1OFPA 1HO1A 4LBSA 4HA3A 4TV6A 2VC6A 4KPLA 3RLGA 5DCDA 2XGZA 4B9ZA 4HU8A 4GH3A 3DG6A 3VGDA 4C1NB 5I06A 3U0HA 1MQRA 3GYCA 4XK2A 1NAL1 1NP2A 1I2PA 4NIRA 1H41A 4WGHA 3OYZA 3VILA 4GXPA 3FVDA 1T99A 3MJMA 1RAKA 1R5YA 2GJLA 2NXIA 3PNZA 1G4EA 1FWDC 3A3HA 3CPRA 3G1HA 3GDRA 1FWFC 4FXSA 4ICMA 1L6SA 4PCTA 3DESA 1TVPA 3KFTA 3IJQA 4O4VA 1M04A 3O07A 4CD4A 3P82A 3O9NA 1PX8A 4TVDA 3DU0A 1P6BA 1OC7A 5J5RA 2NV2A 1W1VA 1GHSA 1PZ2A 4BEQA 3BICA 2GJRA 3VIPA 4LANA 4L4OA 4KEMA 4CQDA 1XGZA 3I7SA 4GVFA 1PPIA 4ATWA 3T6CA 1M5WA 3BAJA 3STFA 3AYVA 1E6PA 2CESA 5AC5A 3WEOA 3GR7A 2YLAA 4H3DA 4JTLA 3NJ3A 2P88A 4ZFCA 2X1RA 3W70A 3UR5A 3NPVA 4QSFA 4N4PA 2CLIA 3R7MA 5XIAA 2A6LA 3LHVA 4XVDA 4H01A 3SCQA 2X30A 5CC3A 3W7OA 3SUTA 3WF2A 3WQ4A 1X38A 3IJ8A 3ZR5A 5HJYA 5IXEA 3GH5A 3WLPA 3VUSA 4DXVA 4FS9A 5CJ5A 4K8GA 1SSDA 5ABFA 3AROA 2BOFX 3VMOA 1F7BA 2NUYA 1KR1A 2P1FA 2Z1BA 2PLJA 3LHUA 3H2MA 4JFVA 3WQ8A 2E25A 1GYLA 2V5LA 4N9CA 3UEQA 2CWXA 3W7EA 3MBFA 1XLKA 4ZO6A 1SZEA 1TTPA 1I1WA 1OCJA 1Q4NX 4JIIX 3N18A 2WNNA 1OEPA 4U3AA 1OYBA 3EYPA 2FB2A 3EMCA 1NOUA 3CQHA 2TMDA 2P8CA 3GXIA 2BDQA 5CJMA 4L9YA 5PTDA 3O63A 3VD4A 3OQEA 1CPUA 4DJDD 4CNPA 1JUEA 4F48A 4HVXA 3O2LA 1I2RA 2Y63A 3M0JA 4HD5A 4J3UA 2G50A 2H9AA 3G5EA 3KTCA 4I9AA 1TUXA 1H7PA 2O4MA 2J6VA 4JNZA 4UFMA 3EX4A 1PIGA 2CHNA 3QGKC 3RRAA 2EXOA 3A12A 1Z42A 4U10A 3EOLA 1GQJA 1W1TA 2ATSA 2OOGA 4RZ5A 3ZLFA 5EY5A 4P8UA 3WBAA 4GJJA 1CGUA 2HISA 1NF0A 4Y6GA 1B3OA 4GWEA 4HU4A 3B8UA 2OPJA 2NQ9A 4F40A 1TZZA 2CHRA 4QFUA 1SFJA 2D2HA 3SUWA 2R1LA 3LTSA 5K9XA 3UJEA 3KWXA 3WQ6A 2QF8A 2V81A 4C1LA 3VIMA 4IGHA 1QPKA 4IPIA 2BFGA 1UA7A 3DFNA 4O19A 3ECQA 4JX6A 1X97A 3UVAA 1ODUA 3NDYA 1H3GA 4MY9A 3E0WA 3PZOA 2YDQA 2GK1B 2DW6A 3WEZA 1OC6A 1XP3A 1SR0A 2WZHA 3CASA 2BHYA 5D04C 3AU6A 5KTLA 1FVPA 1VJSA 1YDOA 1KFWA 5DN1A 3M0KA 3TA9A 3TFCA 3LM3A 1BVZA 1AQMA 3VX0A 1KXQA 4PODA 2WV8A 3A6OA 1Q8JA 1G0CA 4ES4A 3CPUA 2CLOA 1U83A 1I4NA 1GG0A 2IPWA 5FJPA 3GDBA 4K37A 3WX7A 1KTNA 5C2XA 5AHLA 4HNLA 1TCDA 3WFZA 3ITXA 5HA7A 3W83A 4TU1A 2DH3A 4Y7EA 3P8JA 3BL3A 3LBMA 5I3KA 1TWWA 1VLWA 4LNYA 1MUCA 3IJLA 3UPMA 2TRSA 4LCQA 1SR9A 3WDIA 2FZNA 1XW8A 3N13A 4DY1A 4NNAA 3MCMA 3WNLA 4NUWA 4O0KA 1H1NA 1FH9A 3UXKA 4L80A 2VT0A 4Q4OA 2ICSA 1TPWA 4MTVA 1AH4A 1K70A 1K9FA 1O1HA 3EMZA 3VDHA 2WLZA 4MWAD 5XIMA 2J7DA 1CGWA 1DHPA 1AD4A 1JCXA 3GDMA 5A3HA 1AW5A 1C91A 2P53A 4ADTA 4H41A 2Z7KA 2OOFA 1QBAA 1W3NA 3M4HA 3GDTA 3CTTA 2GUBA 2O9OA 4HSNA 1RD5A 3SQLA 4PMUA 3ZJKA 2TPSA 3IUHA 2FYMA 1MEWA 3P0WA 5D30A 3A24A 1VS1A 2XH4A 1X98A 2REQA 3G1SA 1FDJA 4ONVA 2NUWA 2VELA 3H7VA 4M0XA 4UZUA 5FL0A 4F79A 4DLMA 2VP8A 1JF5A 1VCVA 3NYZA 5I3DA 4HN8A 1RP9A 2XGBA 1UC5A 4BR1A 5FAJA 2PRHA 3VGBA 3CIWA 5GJMA 3TN6A 4DJDC 2BS9A 4QLJA 5EB8A 3NGJA 2A4AA 1BG9A 4J9JA 4JFUA 4B4HA 3Q45A 4RNIA 2ZXBA 5G1MA 3LPGA 1EOKA 1YNQA 2O56A 5TF0A 3M47A 3W2LA 2E09A 4FX8A 4US5A 3ZR4A 3OVGA 2PF8A 3GNNA 1PCKA 3APTA 2A2IA 3U6WA 3GY1A 5HNNA 3R5EA 3NVTA 1KBLA 3T8LA 4H00A 4PUUA 2ZBTA 1C93A 1ZCOA 3EXTA 3GFYA 3EPOA 1XGDA 1GUVA 1W9XA 4ZR8A 1ALDA 2Y7DA 1M7PA 4C6QA 5A95A 1DOSA 3RPDA 4BF7A 2WHMA 1FXQA 2YIHA 1AODA 4RW5A 3XINA 1SZFA 1DJXA 5K9CA 3L5LA 3CZ8A 1LLOA 1TJ0A 1OGSA 1LTDA 3TP4A 4LU0A 1GKRA 3SJ3A 1PS9A 4TX8A 3CUZA 2W0UA 5FA5A 5I07A 1X8CA 3V35A 1TX0A 4Y96A 1SW7A 2X42A 4Q4SA 3UZJA 4ACZA 1W32A 1IZCA 4LUSA 2QUNA 4NAFA 1A53A 4N02A 2JEQA 4S3JA 1R3SA 3IEBA 5CEWA 2DY3A 2XIOA 2POTA 3GFXA 1TB3A 4JZ5A 3T2OA 3A9BA 4MLRA 4K1WA 5D05A 3G0XA 2UV8G 1PUDA 4R7JA 1RCQA 1OIFA 2X1IA 3DGRA 3T05A 3P74A 4QP0A 2Z6JA 5FEZA 1C9DA 5CPSA 3C2OA 1F8MA 4HJFA 3FAXA 2Z29A 4HNNA 1PL9A 2CYGA 1Q7ZA 1WDDA 3STGA 3WJZA 3RX3A 4JTIA 3LQLA 4OGZA 2FZ9A 1BF2A 5FF0A 4GINA 4AH7A 4DBSA 1TJ1A 3P5ZA 1IE7C 4C1NA 4LYKA 3NGFA 2VEKA 4KBXA 1OX6A 2D69A 3JR2A 1TUFA 2XGIA 4GABA 3Q37A 3KTSA 4OUIA 1KCKA 1JXKA 2EPLX 1QHOA 2PWFA 2YB4A 4FP1A 2YZ5A 1V8EA 1GT8A 4L4LA 3BCJA 1MW3A 1HGWA 4ZTXA 1E1CB 2EG7A 5D33A 3GD6A 1C92A 4LS2A 4PA8A 3E9AA 3SGGA 1ZB5A 4W8AA 2QQ6A 1R9ZA 4CKQA 1JJKA 3W74A 1PX4A 3WF0A 3W00A 5KSWA 1KRBC 4XAFA 1YXCA 4JAWA 4LOCA 1XH0A 2ONEA 1GKQA 4FK9A 3SY8A 5K2ZA 3T40A 1W9UA 4GRSA 4L6DA 3KBWA 1FWBC 4IWWA 1TRDA 2WOQA 1ITXA 1ITUA 4IMCA 4FB7A 5A8NA 5AHFA 2V6AA 4DBWA 2XZ9A 1X7FA 1F3TA 4HU0A 3WSUA 4Q8TA 2A7PA 2PDWA 4IMAA 2FJUB 3NYDA 2ZUTA 3NQMA 5AY7A 1QO5A 1M1BA 1N8FA 4BI6A 3K13A 4Z17A 1EP1A 3OGRA 3D3FA 5EMMA 5JUVA 1V79A 1WKYA 2DZAA 1W9VA 4L1WA 4NAEA 2WO5A 2VCAA 1QOPA 5A8MA 2Z26A 7CGTA 4QCFA 3T2PA 2PDHA 3BMVA 1SMAA 1DE6A 3WUFA 3BE7A 2RJHA 1W3JA 1LF1A 2GVLA 2NVDA 3C52A 1QCWA 4GUJA 3VINA 4XQ6A 1QDSA 4O4WA 1UD8A 2Z27A 3LB0A 5F2LA 1AUSL 4HJWA 2YL6A 1SGJA 4MIMA