3FA4A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, triclinic crystal form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
291
structure length
284
Chain Sequence
b'PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3-dimethylmalate lyase
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
total genus 100
structure length 284
sequence length 291
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa4A00
4QGCA 1A49A 4IP7A 3U2ZA 4B2DA 3QV6A 3T05A 3KHDA 4HYVA 1AQFA 1XG3A 4KCWA 2KX9A 4B5UA 4B5XA 3M0JA 2XZ7A 3EOLA 1T5AA 3EZ4A 1PYMA 3R4IA 3HQOA 4IQDA 4KRZA 2VWSA 1XG4A 3QZ6A 2VGGA 4TV6A 5JVLA 3SRFA 1DQUA 2DUAA 4LSBA 1ZJHA 1VBGA 2VGBA 3HQPA 3OQ8A 3BJTA 3E0WA 1O66A 3QV9A 4KS0A 2VWTA 4KCVA 2R82A 3ME3A 3QLLA 4DRSA 1IZCA 4B5TA 1F3XA 4L9ZA 3GR4A 2HJPA 1A3WA 1F61A 3P0XA 3H6OA 3QQWA 4L80A 1F8IA 1Z6KA 2VGFA 3E0VA 1S2TA 4FXJA 2WQDA 1O5QA 4L9YA 3QV7A 4KCTA 4QG8A 2X0SA 1U5HA 4KCUA 4B2DD 1KBLA 3B8IA 2V5KA 4L7ZA 1KC7A 2QIWA 3FA3A 2XDFA 3I4EA 1ZLPA 2L5HA 3KTXA 1S2UA 3M0KA 2HROA 1A3XA 4FXFA 4RPPA 4YNGA 2XZ9A 1A5UA 2DIKA 2V5JA 3SRDA 3VAVA 3QV8A 1DXFA 4WJ8A 3GG8A 4ROQA 1F3WA 1E0UA 4B5VA 1PKMA 3BJFA 1S2WA 2HRWA 5TAOA 2VGIA 2OLSA 3LG3A 3LYEA 3SRHA 1O68A 3E5BA 4B5SA 3QTGA 1OY0A 1PKLA 4QG6A 1GGOA 1OQFA 4HYWA 1JDEA 1U5VA 2E28A 2ZE3A 2HWGA 4JPGA 3PP7A 1S2VA 3HQNA 3OYZA 3T0TA 1M1BA 1UJQA 3T07A 1PKNA 4IQEA 3N25A 3EOOA 1PKYA 1IGWA 3PUGA 3GQYA 1F8MA 3SRKA 1E0TA 1VBHA 4TV5A 4G1NA 3MA8A 1SGJA 4MF4A 4QG9A 4IMAA 1DIKA 3FA4A 4MG4A 3G2GA 1M3UA 2G50A 4B5WA 3IS4A 3OYXA 1DXEA 1MUMA 2BG5A 4YJ5A 3EOEA
chains in the Genus database with same CATH superfamily
1XGZA 1UMYA 1OX5A 2ZXAA 4WDTA 4ZTXA 5F4WA 1EBHA 4PUEA 2XIQA 3PAJA 4IMCA 3REQA 4CN1A 1XIFA 3QPZA 3SRFA 1X96A 1TE6A 2WHLA 5A3HA 5C7HA 2RDXA 1TJRA 2HNEA 5LHEA 4LYRA 1KBJA 3UF9A 3QHMA 2HZGA 1TQJA 1ALDA 3C86A 1HTIA 3W86A 1TFVA 1TZZA 3G3DA 4PEKA 4K38A 3KVKA 3WD2A 1YNYA 2PCEA 2RDWA 4E2VA 3VOHA 4UB9A 3WNNA 2QJMA 3U9IA 1UJPA 1OG0A 3AIEA 4P7RA 3I7SA 3WLLA 1KRBC 4JICA 2QZRA 2BVDA 4JQ3A 5HNRA 4DYKA 2NQJA 1OFRA 4KFNA 2ISDA 3LU2A 2OQYA 5DMYA 5FI8A 7ENLA 1QVBA 3GBDA 4IICA 3QQ0A 4M1BA 4H6KA 3UJ2A 4KBXA 2DW7A 2PP3A 2V2DA 1OINA 4TX8A 4LT9A 3ECQA 4HIBA 1I6NA 2A3HA 2BMBA 5DMNA 1E0XA 5DANA 4HHPA 5LNSA 4GHRA 4D8AA 3S3GA 1UQYA 3IV3A 4AWTA 4QS6A 1R0MA 3KOWA 1BFNA 5JH2A 1N8IA 3W9ZA 4RV8A 5J04A 1TIMA 3EZ4A 2QDEA 3F4CA 4KWSA 2WNWA 2W9MA 1CIUA 4O54A 4LAOA 3PFRA 5EY5A 5I7GA 5JBFA 3K4DA 4HA0A 5DFAA 3PPGA 2OVLA 2CHRA 4QLJA 5I23A 3QTPA 2C71A 3ZO9A 4FLRA 3WUBA 3P81A 8A3HA 3M47A 4B2DD 4ZQOA 4HNUA 1OG6A 1OFPA 3MSRA 5HWMA 3KBJA 2VHLA 1XRTA 3SW6A 3E5PA 3LXAA 3W7PA 3TXVA 3M0XA 3L4WA 3IAQA 2OWWA 4FAMA 4PBGA 3S2LA 1ITUA 1EA9C 2VRJA 4PB5A 1VFOA 1XI3A 4JTAA 2DT3A 1KA9F 4GO9A 4DN1A 5FSDC 3RAOA 1KCKA 5JMUA 2B7QA 2CZVA 2RGMA 5HK4A 2JKAA 4GYPC 3KTCA 1TWSA 1JYNA 4A3YA 4UMAA 4H8NA 3EWUA 3ARPA 1W1VA 3QR0A 1C9DA 1GVQA 1EEXA 3OGSA 3LXCA 1J8VA 2WW5A 4B92A 4DXVA 4JTRA 5XINA 3T42A 4D8LA 1UIPA 2X42A 1MW2A 3FHAA 1UCWA 1KFKA 1A5NC 2HS6A 1XXXA 4IXXA 3IIZA 4CD7A 3Q45A 2GGHA 1VLWA 5JVLA 4HK7A 4UFKA 4NF7A 4Y2WA 2WANA 1YMYA 1R7AA 1AQHA 2E25A 4O15A 5DCDA 1W17A 1TJ1A 3H4XA 5PTDA 4XB3A 3MUY1 4EF9A 3UWQA 1QHPA 1LBFA 1JZ5A 1RJQA 1KBLA 2VCCA 1CXFA 2PLMA 2YLAA 2EKGA 3M0YA 2L5HA 1LLZA 4U2YA 1C8YA 4EXBA 4H4IA 3DFNA 4XD4A 1HFBA 2WZEA 3S5OA 4RZ5A 2E1WA 3BAKA 3DHUA 2OLSA 3SQSA 1GGOA 3SUVA 5C55A 5JH1A 5LXXA 3CB3A 4JQAA 1UA3A 2F6KA 3PAOA 3PPCA 2PPGA 2WHJA 3USBA 3PTKA 4WXYA 5LA1A 2WQPA 4UIOA 2R24A 4E2DA 4WY0A 2YIHA 3PZQA 2GDVA 1YE6A 4WCJA 1VIZA 2EHHA 2GVJA 5D03A 4HHLA 1P43A 2EG7A 2JBMA 3I3BA 3AIVA 3QR1A 1UUQA 3WNLA 3PUEA 1CXLA 3W26A 1OZQA 4INFA 2G3MA 4GVFA 4YTRA 3TMQA 2DUAA 3GIYA 3IJIA 1OT1A 1J93A 1KO0A 4DJDD 1UH2A 2QGHA 4WZHA 3NZQA 2ACRA 5I77A 1GYMA 3EGJA 1WKEA 2BTMA 4PZVA 4L65A 2D2HA 3KLLA 3BCJA 4JTFA 1XCWA 1ZS2A 4W84A 3KOYA 4HJFA 2YKKA 2ISSA 4PL2A 4NZCA 2TPSA 4US5A 3KP0A 3LBOA 4EPEC 5HAOA 3O7UA 3O07A 3VIPA 3CIVA 3KFTA 5E0FA 2DIKA 1TSIA 2JF6A 1JD9A 4EIVA 5KMYA 1JCLA 3RMEA 3Q65A 3BE7A 4FA3A 3M16A 3OGRA 3E5BA 2AQVA 3AJ7A 3KDOA 3ARUA 2A3LA 2EQDA 2DZBA 1AFSA 4O4WA 5AYIA 4ZXLA 5BU6A 3UZYA 4CD8A 2V8ZA 2D2JA 3B0VC 3DHPA 4ENLA 1SYTA 2XFWA 1FQ0A 1FWJC 4BF9A 3MYPA 4NAFB 2UY5A 4KGJA 3ES8A 4ACZA 3RHGA 3AXMA 1LL4A 4O52A 1DV7A 1TWZA 5EMLA 3WN6A 4HQVA 1KM6A 4ZEPA 1DQXA 3QY6A 3BLIA 2D2OA 2WK2A 4S3FA 3CO8A 5AC7A 4Y9NA 2EG6A 3G0UA 3OVPA 2IUZA 4JN6A 1UW9A 3DECA 4LAZA 4C6DA 5BWFA 5E70A 3E0WA 4KGLA 2VT0A 4S3GA 3MV11 4XAGA 1DE5A 1DHKA 2ODOA 3NA8A 4DF0A 4MYXA 2GGGA 1W9UA 1IR2A 3CZLA 3FN9A 1P0DA 1QPRA 3S2NA 3IRSA 4JHZA 1Q6RA 1O7AA 4IIGA 5LYRA 5CSSA 3FGCB 2TYSA 4RXFA 3AU6A 2PF0A 2YA2A 1V0LA 6REQB 3RJXA 2E3ZA 1FWCC 3W7KA 3MY9A 3W23A 1T7LA 4HHMA 4PA8A 4B5NA 2NT1A 4PUDA 3MDUA 2QYGA 3BWWA 3QOKA 2Y1HA 4KWVA 3EEZA 1DJHA 4BZYA 1O60A 4K7VA 1OC7A 4LRSA 3W38A 1WV2A 3POCA 3ITOA 4GZEA 2XVGA 1OYAA 4QG9A 1GK8A 3M7SA 5I6SA 3SUSA 4Z0SA 4AWEA 4A35A 1GHSA 1JZ7A 4MADA 1ME9A 1F4HA 4XO7A 1DPMA 5J5DA 1TKKA 1W3JA 4X2PA 1TPB1 5BWAA 1XLKA 3T0CA 1H5YA 1CX9A 1EJUC 1G69A 4X2RA 1EP2A 4KWOA 1O6IA 1SMDA 3WDJA 3O63A 4ZOCA 5JIPA 4LWWA 3SQLA 4DRSA 3KRBA 2GSHA 3S2CA 3R13A 3W7LA 3BLDA 1EGZA 1Q63A 4OBRA 3MT1A 2WAGA 3W1UA 5LHFA 5A1AA 3ZWSA 3GXIA 1BVWA 2JGQA 2CU0A 1DJWA 1K03A 2PDPA 3MTWA 1XDMA 5I79A 3WMLA 2OFJA 4FR1A 2WMJA 3EWDA 2YDQA 3MS8A 5ECUA 1CGXA 1TCDA 1PKLA 1UR9A 3TC3A 3TCSA 3TYAA 3CV2A 4HPXA 3AFBA 1S2VA 1DJNA 3ARRA 9CGTA 1BD0A 2G3FA 4YWSA 3T8QA 5DMLA 3N2TA 1KRMA 3M64A 1MZHA 1E9YB 1UB3A 1UUMA 2ALRA 4WJXA 5AOUA 3SEPA 1S39A 3EWCA 3R0KA 3EDFA 3EDKA 2XVLA 4QS5A 5A6AA 1M3UA 5KITA 1Y5XA 1VAHA 3AO0A 2EAWA 3P61A 2C6QA 2VX6A 4DF2A 3TXZA 3PY2A 2FPTA 1YXDA 3AHVA 1EDQA 4Y9PA 2A79A 1U1UA 4UMBA 2OYKA 1MDRA 4KRZA 1BKSA 2OSXA 2VWSA 1JPMA 4BI5A 3CO4A 3T7VA 4QR6A 4YXGA 1SSGA 1QBAA 1VBGA 4OJYA 1LG1A 1KFEA 1NWUA 2XIMA 4Q4PA 4M6PA 3UWVA 3SFKA 5CAKA 1QAPA 1EYWA 1EBGA 1KXHA 4MY1A 1TPDA 3GK0A 1TPUA 4A2SA 3C56A 3LTPA 1LRQA 3V5CA 2GQ9A 2PTXA 3UWWA 4F2UA 3DI0A 1UD5A 5FJIA 2I1OA 2Y8VA 4EAYA 2WKGA 2YA1A 1KM3A 1WXYA 2NQHA 3PJUA 4FS9A 1P6CA 4ZXOA 4RX0A 3SUWA 3STCA 5CJNA 4DX3A 3JU2A 1TJ0A 3CV6A 3VPLA 4C5YA 4Z1YA 4QQUA 1FA2A 3VM5A 3N1AA 3N25A 3WY1A 4DY1A 1GKQA 1RLDA 2CLHA 3GDKA 5I3KA 3Q67A 1LROA 3CL7A 3B0YA 4IMFA 2Q01A 2OX1A 3FA4A 3NR0A 3EA2A 4BWLC 1MI3A 4BA0A 3SCVA 2YCLA 2ZXDA 3H2NA 3UD6A 4EPBC 1JI1A 1ZZMA 2A3BA 3PSWA 3WQ6A 4JZ5A 1G4EA 1FWRA 1KGUA 1XBVA 3OLIA 1MYRA 2W4XA 3BZGA 4C6BA 1XFCA 3MQTA 4U33A 3QV9A 1EJRC 1CDGA 5CH9A 1IV8A 1EWDA 1WDSA 3CAQA 1NFPA 1U83A 4BF7A 1N2VA 1W3TA 4LEQA 1R2RA 3UERA 5C6MA 3EWZA 4FF5A 1TG7A 2GJNA 3QHOA 3K8MA 3NWRA 1TZ9A 4B15A 2OLHA 4YNGA 1LJYA 5H91A 3HFYA 3LV6A 2R1MA 4WGHA 4NRRA 4C6CA 4AH7A 3BH4A 4A3UA 5LIKX 1JXKA 1LLWA 2PDBA 3B40A 3FJLA 3G1AA 4WF7A 1WUEA 5M1TA 4H7ZA 1PCWA 3UZXA 4C6KA 1XRFA 3GKAA 1MMFA 1JIBA 1RSCA 3CZ8A 3K8KA 4E0CA 3STPA 1M6JA 4A4AA 1KTBA 2VCBA 4R33A 1X1NA 1KXQA 4HCLA 3NXLA 2XH7A 2R1KA 3N12A 3H53A 2A0NA 2FIQA 2PZNA 8XIAA 4QJ5B 1G94A 2J7HA 2DEPA 1OJXA 2ZDSA 4UTIA 2QCDB 4QE1A 1UOKA 3LPOA 4W87A 3LSBA 2Y8KA 5D04C 3DH7A 5BMXA 3PTQA 1AZ2A 3CQ0A 4GO8A 3MMWA 3UJFA 1R3WA 3H7RA 5A6TC 3M41A 4F40A 3HF3A 2CBUA 1NH6A 5E9XA 4YYCA 1IEXA 2V63A 3CPGA 5LNWA 1QFEA 1TCMA 1RV8A 3WL0A 3HPSA 4NASA 4GBUA 3NO1A 4KH2A 4IQJA 1YTKA 3G8EA 4PULA 1AD1A 1PZ1A 1YDYA 4HNTA 1ME7A 1C3FA 1WZKA 3L2IA 3FOKA 1SM9A 4NYUA 3P82A 3S8HA 1UH4A 2VEGA 1FUYA 3QPEA 2O9RA 4OHQA 2MNRA 5LNVA 2I57A 3WH7A 2AOSA 5I09A 1BYCA 4HNNA 2YB4A 3GU1A 2CZ5A 4GQQA 1QTWA 4MKVA 1OY0A 4DJEC 3DKJA 4KEVA 2PRLA 5EMMA 4PRRA 3GWQA 1OT2A 5C8BB 3VIIA 2NV9A 1ICQA 2G3JA 1FH8A 3POHA 3UESA 2H3BA 3SN0A 4S38A 4YMZA 2PU0A 3SECA 2OZ3A 4TU1A 3UVAA 4OUEA 2HNHA 4YJ5A 1RVGA 1WZAA 3WDQA 2ZX6A 1H09A 4EPKA 2YOCA 4RNHA 3QY7A 1JUEA 1GEQA 1QNSA 1KFJA 4OV4A 1BQCA 5I3HA 4NZ1A 2X05A 4KKXA 4H6QA 4B9ZA 3PNZA 2HEJA 4WJEA 4PE8A 3GVQA 4PL1A 3VGHA 2WHKA 2OEKA 1S2TA 3CC1A 1DORA 1LORA 3ZM8A 3GC2A 1VHCA 4H00A 1LTDA 4UUIA 3R25A 3GE7A 4GJJA 3C2RA 2NVDA 3CUXA 4ES4A 3ES7A 2C0HA 1Q6LA 3URQA 3VNJA 3PZOA 2F38A 4D6IA 3JZUA 4A3QA 1MQQA 1UR0A 1NWTA 2E8YA 3GS6A 1EYEA 2CLEA 1FFRA 1RZMA 1TTIA 3ZVHB 2V69A 2CLFA 3AC0A 2GJRA 4LVDA 1OYBA 3EB2A 3FVMA 4RDVA 1Q6FA 3KUMA 5M03A 3KWSA 2JEQA 2WMFA 1G0CA 1C91A 4AEOA 5I03A 2FB2A 4BQ5A 3BCDA 2CERA 3P8IA 2W6RA 4I5UA 4LVFA 4A8LA 2GGJA 3FJ4A 2A3AA 4UTJA 1XC4A 3AXIA 3S6TA 5CSUA 1BSLA 2WV8A 3EKGA 4EWJA 5D9NA 4AZ7A 6XIMA 1FRBA 3WMCA 3M0ZA 4HA1A 2G4JA 4GIRA 1IXQA 3O6YX 3UNTA 1B1YA 1JJKA 3WELA 5C70A 3AOFA 1W6TA 3H12A 1A4MA 1M65A 1OHLA 3SZ8A 2WNZA 1EX5A 4AWUA 1ISZA 4JQ2A 2QJGA 2BFGA 3RMJA 2JEPA 4O0ZA 3A13A 3QV8A 4UCGA 4M82A 4O53A 4FF7A 3I6EA 3QFWA 1C90A 3JW7A 3W1AA 3FV9A 3KZSA 2ACSA 3T78A 3UVIA 2IKHA 2GZXA 3L0GA 2XIJA 4WKAA 1H7XA 1B54A 2FPYA 4NP7A 2C3ZA 4ZO7A 3IIVA 4J3XA 1PEZA 2RH9A 1LRNA 1XC6A 4A2RA 3W1LA 1R9ZA 4NX0A 3AZSA 3W2KA 4AISA 4AD2A 4ECLA 3WBAA 4GVIA 5JUVA 1NDYA 5FJOA 1XD1A 5D37A 3RPMA 2NVAA 1VHNA 4L1XA 1HVQA 2QAPA 5K2ZA 4RDZA 2XZ7A 1Q6OA 3ITGA 4TUFA 1M7OA 2FVKA 1P4CA 1NELA 4CVWA 4JNYA 1WBJA 2F2KA 2VGBA 5I0DA 1V03A 4C6IA 3GVRA 2VKZG 3IJ7A 1TV7A 1UKPA 4V27A 3KXQA 4Z08A 3MHFA 4W7WA 2V3DA 1AL8A 1KQZA 3F5JA 4KCUA 2ZC8A 3QYSA 2BXYA 3CAWA 2ZZ5A 4ZBCA 4GFIA 1Q65A 4QBXA 3HTWA 2WWCA 2VEMA 4WGXA 3DOPA 1TV3A 3ZLFA 4LUJA 4N0RA 3WBWA 1TPVA 1UA7A 3W1PA 3U2CA 1WX0A 1Z7AA 3LDVA 3E02A 4Z0JA 3EX1A 3S83A 3TQ0A 1MFVA 4HYWA 1JZ8A 2R9RA 2CLIA 3TLQA 2Z0IA 4OU1A 3N9KA 3WNPA 4L64A 4M29A 1CEOA 3TROA 3QMTA 3M7WA 1OFEA 3S1UA 4G56A 5LKYA 3WDIA 1W3NA 1A5CA 3FIGA 3KRUA 4E3VA 4XTIA 3LTYA 3P84A 4H6RA 3LGEA 3VX1A 3NM1A 3SCWA 4YVXA 3W7GA 3WLSA 5M3WA 3K30A 1TMHA 3JRKA 4R7OA 4Z2IA 3A3XA 2ASHA 4K6AA 3DI1A 3H7UA 2BBFA 3CWNA 4H9MA 5CPMA 2P0OA 3BOLA 5IHRA 2OODA 3GW0A 1JDFA 1E6RA 3R2GA 1ICPA 3M43A 4D71A 4J4KA 2QVNA 3VKDA 2DZWA 4ATWA 2VOTA 3A4WA 3QQ1A 3TYUA 1UZ4A 3TH6A 2J9XA 1H1YA 3WG6A 4GZ7A 4F2BA 2TAAA 1V6XA 5B7ZA 3QMSA 1DP0A 2Q71A 2HVMA 3V0SA 3VABA 4YLWA 4Z1AA 4ERIA 3UA3A 2WCAA 3AMDA 4KMQA 1ONXA 3PBYA 2DSZA 3H23A 1VYRA 4MAVA 4R9XA 1JFXA 3REQB 3GVWA 3PJWA 1O68A 4XUGA 1QT1A 5D30A 2GFTA 2PTDA 2Y5SA 4E2BA 2VDGA 3JVAA 4UTMA 3CZJA 3NUKA 2D3NA 1T8XA 4MTVA 5CZJA 3GXPA 3VOFA 1E15A 1IEWA 5C7VA 2XGIA 3NDOA 3PJTA 4NVTA 4Y96A 3ATYA 1ZGDA 2PGEA 4R9OA 3S1XA 1EGMA 1FXQA 2PWEA 5G1MA 4DBUA 1E9LA 4GD0A 4MKSA 4UQBA 3GW3A 1OIFA 3L5AA 3AALA 4O18A 1TVPA 2F84A 1V3LA 1DQUA 3C3UA 4J2PA 4Q32A 3NZPA 5A8QA 5HXMA 1DBTA 5C0QA 1A3WA 2QR6A 3AIQA 1O5KA 4U2ZA 2R94A 2EGZA 1W5MA 3FK4A 1XH0A 1UKTA 1GYNA 1RBLA 3C5QA 2WCGA 5AFDA 3AHTA 1ISWA 4KCTA 2QUTA 2VEPA 2Y5EA 3N17A 3DUGA 5H2ZA 5H1WA 1EIBA 1AZ1A 3DESA 2XG9A 4NQ1A 3W00A 3R58A 4V28A 2FZMA 1E73M 1L6WA 2ZUNA 4LTSA 3SCUA 1HJQA 3W7EA 4LU0A 4B5VA 1YBQA 4OGZA 2Y24A 4RCXA 3UWZA 4RZ4A 1EUAA 3UZWA 1VPYA 3NQ7A 2A21A 4UFIA 4H01A 1RCXB 4GVGA 1GJPA 1BF2A 5ABFA 3VNLA 4IIFA 4NJKA 4DWDA 2DT2A 5EFDA 3RLGA 1E1EA 2BHYA 3ABXA 3RRAA 2OX4A 1WQ5A 1TMLA 1E5NA 3QKZA 3AAMA 4U4MA 1WDQA 1JGMA 3AHYA 1QATA 2AQWA 2NWSA 2NVCA 1PV8A 1PJ9A 4LS0A 4HSNA 2IQ0A 4HA3A 1UG6A 1XKJA 3TNBA 2WSKA 3N11A 5HNNA 5CLTA 1PTAA 1NU5A 4GNKB 4DIAA 4UOZA 3OHMB 1EUNA 4JHOA 3TTQA 4M0XA 2J7EA 1D8CA 4LANA 2J75A 5A69A 1V3JA 1XYBA 1ZAJA 3WQWA 4F2TA 4L9ZA 5GNZA 3QY8A 4S3JA 1FWFC 4ZQMA 2UWFA 3MO7A 2WLZA 3VU2A 5CZKA 3RFAA 2Q8LA 1RA0A 5CBIA 2GUBA 4V33A 4ICCX 3CYJA 1R8LA 3ITCA 3FW6A 4G7FA 3NEHA 1TJPA 5LIYX 2R1LA 2O4QA 3P14A 1EOKA 3AU2A 1QRQA 2NQZA 1RBOB 5FD0A 1ITQA 2DQWA 4CU8A 3L4ZA 4FNRA 4HTYA 4TIMA 4BY3A 4YYFA 3C0QA 3SGUA 3VIKA 3A3WA 1PX3A 2J74A 3T07A 1SO5A 1YPFA 3AYRA 1F2JA 1NQKA 1BVNP 1EJ7L 2PTWA 1B5TA 3PANA 3PG9A 2VRQA 2DSVA 4MF4A 3TYEA 1H0IA 4LVAA 1H2JA 1R7OA 3A64A 4NKCA 4WX2A 2YCJA 4EXAA 4K7YA 3WK0A 4PMZA 2ZX5A 3G24A 3BV4A 4CNOA 2QJHA 3CUFA 5E0CA 2KX9A 3KL3A 3C2YA 1TWIA 3GFZA 2NSXA 1P1XA 3H24A 1XLCA 4KFPA 3HPFA 2ZQ0A 1X1ZA 2BZNA 4MWAA 4CEXC 1L8NA 4GH1A 1TRDA 1C92A 1N82A 3S2MA 3F4VA 4IZGA 2WCSA 2V30A 1B0IA 1SZNA 2Z1WA 3BG5A 4ZFCA 1UBSA 1H41A 3MV01 4POCA 4MPKA 4WY0B 1F07A 2XGZA 2ZRXA 3DFSA 1H7OA 1P48A 3EDJA 4G2DA 4IM4A 3W6YA 2HROA 1J6OA 4YPJA 3EXSA 1CYGA 1YXYA 3W7QA 4IQLA 1E4IA 3RM4A 1E4NA 3FY1A 3H4WA 1GONA 4MB5A 1S2WA 5CC5A 1W9PA 4FNSA 3N6JA 1W54A 3E49A 4F9JA 1QUMA 3LYEA 1EB3A 5HWJA 4O14A 2V82A 4AIEA 2XSAA 6PTDA 1CZ1A 1VEPA 4JPGA 4GH3A 3WQ8A 1U1JA 3BAJA 2ZX9A 3TX9A 1F8MA 4H8HA 4JN8A 3FYPA 1THFD 1FY6A 4AAJA 1GVSA 3ITLA 1LL7A 4AQLA 4U31A 2DP3A 3PN8A 1SO6A 4CCZA 2V3EA 1IWPA 3G1HA 5G2WA 3UW6A 4UNKA 3QW3A 1J11A 1CB2A 3AMKA 4GNVA 3R43A 1PDZA 1HJSA 4NZFA 4KETA 4JX6A 1VBJA 1HXJA 3W7IA 1NJJA 3EPOA 4I5XA 3GG1A 2ZRZA 2ZKMX 4RNIA 1VJZA 1B4EA 3MKCA 4XIAA 2G37A 4LUYA 3PB2A 3WNKA 4Y9MA 3U3HA 2H3DA 4TMCA 1TTJA 3M6YA 5CPTA 4Q33A 3RO8A 2QNEA 3VMNA 1YDVA 1KFWA 1CGWA 6ENLA 1UWUA 1K9TA 4ACZB 1XYCA 4GQ0A 1VYSX 4L61A 1X6NA 2ZUUA 3HGSA 1W56A 3SFWA 2E4TA 4ILSA 3DFQA 4ORIA 3ALFA 1FWHC 2DIJA 3TNOA 3WIJA 2O9OA 4F0RA 2V68A 4XD3A 4C7GA 5ENLA 3CLMA 3F5LA 3HURA 4JEJA 3I65A 4C5ZA 3RM8A 3WLPA 4JKMA 5F4SA 5B7YA 1FFQA 1TVLA 1A0EA 1EO7A 3O0KA 3ZMRA 1AMYA 1Q7MA 4IJRA 3MKKA 3H26A 4QNEA 1K6AA 2OELA 2QCMA 1A5SA 3OB8A 4JXCA 2RDUA 2PDGA 3EOEA 4M56A 4I5RA 3BQ5A 1E55A 4J3VA 4NI3A 3RU6A 4Q4MA 1T5AA 2ZWZA 3V0UA 1GPWA 2GQ3A 4C90A 3WKZA 4K3ZA 4MOZA 1MEWA 5I00A 1MFUA 3NNTA 5GVJA 4GYKA 4FR6A 3R89A 3ANYA 2FVLA 3NG3A 3SB0A 3CV1A 1MRQA 2YXGA 5A8GA 3VCCA 3L7RA 1TV8A 4LYPA 2G96A 1OC5A 1XIBA 3TIMA 3BMVA 1JD7A 4JIEA 3W3OA 2H90A 2X8RA 2CNCA 1O95A 1VRXA 5CPSA 3WH9A 2W91A 3CM4A 3R12A 1UWAA 3NOYA 3QM3A 3OG2A 3EMCA 5T26A 3HG5A 3QZEA 4O1DA 2Q02A 1DJYA 1KXVA 1VBRA 5AN7A 3ZJKA 3GTFA 3FX4A 3ATZA 1SGJA 4N6EA 4CNSA 2HXUA 2HTMA 4HNOA 1Q3NA 3W87A 5IFPA 3CHDA 4WSKA 5BW6A 5HQLA 3ZSTA 1XICA 2GUYA 3ONCA 2YPIA 2PBGA 1CGVA 3CU2A 2DUZA 3ELFA 4CQAA 3WL1A 4RE2A 3E2RA 3WLTA 4RE3A 4Y6GA 1W31A 1M5WA 3HO8A 4DNHA 4JFUA 3VIGA 2XPKA 3GUWA 1IYXA 3LM3A 3KBWA 4W85A 1KD0A 4WK9A 2GVEA 5D9PA 4MJMA 1N8FA 4PB4A 4B16A 1G01A 4LRTA 2PDMA 4TR9A 3ONBA 4E2OA 1HKWA 1QASA 1RK6A 1H7PA 1TPH1 4XBKA 4QEEA 5FJPA 1UWRA 2XN0A 1HVXA 2VZVA 5C9ZA 4AZCA 7XIMA 2QCCA 3R7MA 1JPHA 2PBOA 5FCZA 2ZUMA 1DVJA 1Z9AA 1XWYA 1JEZA 4EPDC 2Y62A 3IGXA 1A5MC 4Z2GA 2EEXA 3UETA 2WKLA 1AMKA 3TC6A 1XRVA 3B0XA 1BXCA 2VR2A 2QF7A 1OFOA 4XZLX 2PS2A 3G1DA 1XX1A 2DJLA 5F4XA 3HJZA 4R7WA 1HX0A 3EMZA 5A6MA 1T0OA 2C7FA 2QIIA 4BI6A 3VVGA 4DJED 1JFHA 2PAJA 5DY2A 1J0JA 4IIEA 5HDRA 3EXRA 4PCSA 1RQEA 4Q7NA 1ESWA 1HO1A 4HZ8A 2C8NA 1Z89A 2DZXA 4GNJA 4S3DA 1B2YA 2DFAA 6XIAA 3UPMA 4AY8A 5DEZA 3ZOAA 5DELA 2JE8A 2UZ9A 1Q85A 2JQXA 3PSVA 5D8ZA 1CTNA 3G6LA 4ZZ9A 4ZENA 4M3PA 4ZO6A 4Z1CA 4JNZA 2ON3A 1RY0A 4ICMA 1W2VA 1ONEA 3C8NA 1MWOA 3AIBA 2XIIA 4UQ9A 3T08A 2NV2A 1I4NA 4IPNB 4ZB2A 3N04A 3TYZA 2DZUA 2X0SA 3OG3A 4IGSA 1ZJIA 4JFTA 1XV8A 4DHGA 4ZOEA 2YCLB 2FGBA 3R94A 5GNYA 4FP1A 5EMYA 3VAVA 4QLKA 1RXOB 1V3IA 1UOZA 1J5TA 2NQ5A 2NT0A 1BKHA 1ZBWA 3BLPX 1FDJA 4WDWA 1GEHA 1JF6A 3CWOX 2OKOA 3W6LA 4DNMA 2XIOA 4MLJA 4Q4QA 4XAFA 1RP9A 5CGTA 4O11A 3IVUA 2CLMA 3PUGA 3DENA 3KE0A 2H9AA 1H1ZA 1XDJA 4MDOA 4H7CA 1FH9A 2FZDA 2J7GA 8RUCA 4OQVA 5EGRA 1KM4A 3B8WA 3MYOA 3A5VA 1GTHA 5DY3A 1BG4A 3G5EA 3STFA 4B91A 4M19A 1H7WA 3DYOA 1WKFA 4MWAE 1AODA 1XLHA 1AQ0A 1F3XA 5AB3A 1HGYA 2PDWA 2OSWA 3G18A 4E6MA 5IBXA 4BKNA 1LQ0A 3EPMA 1MUCA 4W8AA 3KZPA 4RV3A 1IZKA 1KC7A 3OLGA 4NAEA 2GDUA 4XQ6A 3THUA 1PCKA 2BOEX 4X0NA 5IXEA 2Y7FA 2C19A 5I3DA 1ISVA 4WJ8A 3IJDA 3TAKA 4V2XA 5FF7A 3WDRA 5AHMA 2WNNA 4JIQA 3W76A 3HPAA 1Y5VA 5A6JA 2EF9A 1XM3A 2WYSA 1JDEA 4H9TA 5BOFA 2E28A 3I3DA 3BAIA 3W75A 3HIJA 2INEA 1V6YA 1ZJBA 2E1DA 3W02A 3B05A 3PZIA 1W8GA 5FEWA 3ZZ1A 1FCUA 3RPDA 2XU2A 1V77A 1F3TA 3IS4A 1QPNA 2FZ8A 4GABA 4OVXA 4Z17A 3AI0A 4L6DA 2OO0A 2YL6A 2YR1A 3QRHA 1U30A 1YQ2A 1JCTA 1WDRA 2WVTA 4PCTA 3IJLA 4OWGA 2AGTA 4CNNA 5CBJA 4W5UA 2ZZ3A 3ZJ8A 5AHIA 4EAMA 1DWJM 2P8CA 2CPUA 1CGTA 1O1ZA 1IIHA 3KCLA 3TSMA 4XZHA 1A50A 2UY2A 3O6CA 1JPIA 4GI8A 3WEOA 2Y2WA 5FKYA 1TWWA 3WH5A 3M5ZA 1K8CA 1OD0A 4L7ZA 2OYLA 3W1XA 3F2CA 3CQKA 3GG0A 3TAOA 3R11A 1ONRA 3BAYA 1FCQA 2BXVA 1YW1A 2QS8A 2YW3A 2J24A 1QI4A 4PMYA 2X7WA 1M68A 4ZR8A 3B8UA 1PHQA 2HSAA 3HOJA 1FVPA 1EJWC 3UR7A 1R3TA 2HWGA 2G5WA 4RZ6A 4Y9OA 3UFYA 3ARSA 2G3NA 3W29A 3OLEA 1VBHA 3CHVA 3GHUA 5DXXA 5M2FX 1EOMA 1V6UA 4QHRA 3VD4A 1P0NA 1PXGA 3R8HA 1ODUA 1JCMP 4G6CA 1LL6A 4WY0F 4KF1A 3DEQA 2E6DA 4ZO8A 1SMAA 1W1TA 3N15A 2J6XA 2JKEA 2XVNA 1FBAA 3W2JA 2WJZA 5D2YA 4CQ8A 4XSLA 4XZ9A 1YEYA 4YS1A 3AYVA 2IPWA 3C4UA 4Q8NA 1HP5A 3NEVA 1OF6A 1V51A 4GWEA 4M1RA 3VZXA 1NFBA 3ABZA 1OWQA 4FXJA 3PZVA 3PG8A 4XVDA 1RH9A 1Q45A 1UPMB 3CMFA 5G4HC 5E6ZA 3KDNA 2P5NA 3M5XA 3KW3A 5M17A 3KS5A 4YCOA 1KKOA 3ARWA 1M7PA 3GYEA 3N6HA 3DC0A 5AECA 3LQGA 4MLRA 3IIOA 4MB4A 4ICNA 1TTPA 1LYXA 1PWMA 2A1YA 4RKAA 1UZDA 2XJ7A 4C91A 3M6DA 5CEWA 1SFJA 3RYSA 1R9YA 1XYAA 4UTTA 2WBKA 4AF0A 4AHQA 1BVZA 3RUBL 1WP6A 1CW2A 3UG5A 3IK4A 2O9TA 3V5OA 4Q22A 3WEMA 4YTTA 4UTWA 1IWAA 3ANUA 1ZAHA 4IGNA 4G8TA 1P0EA 3BW3A 2PZ0A 3F2BA 3U2ZA 2X16A 2ZFAA 4LC8A 4XAYA 3OJGA 1N55A 5F1VA 3LLFA 1Q6QA 1E1CA 4DELA 3ARXA 3NXFA 5KZMA 4QLLA 3QMRA 1ZRQA 2DY3A 1W32A 1VB9A 6TAAA 3E0LA 1EF3A 5KZDA 3C0LA 3CHCA 5D2TA 4YVPA 4ZQRA 3L4YA 3U5UA 4ZB5A 4AVFA 4K8GA 1H5VA 3UJRA 1MW0A 4XZWA 3TOPA 4HKPA 4M81A 5A6BD 1P1MA 2J78A 2OZTA 3CMJA 2DZAA 1JAEA 5D8WA 1G1YA 5CPQA 1LM1A 2QMJA 1OCNA 3QW4B 4IFKA 4UQDA 3U6WA 3CTTA 4AUBA 2VFIA 3HU7A 3ARTA 3WK2A 3CUZA 1AW2A 1JCNA 3GNRA 1UBPC 1FKWA 2ISVA 1HW6A 1W1B1 2QV5A 3TN5A 1K6WA 3NJ3A 2PF8A 3OLDA 5K9XA 1KFCA 2VEKA 3J7HA 1WKYA 1IGWA 1RPKA 2W79A 1OIMA 2NXGA 3NQBA 5K7JA 4FLOA 2IW0A 2YBVA 4L6OA 4IMAA 4UMCA 2PU1A 1PTDA 3SO7A 2J7BA 3V5FA 3PUDA 3CGTA 5DCBA 1QHOA 2V3FA 1DWAM 1EH9A 1VCFA 2X1UA 3VD5A 3E9AA 5D09A 3EAUA 3MP4A 4IT1A 3SIZA 3UXDA 4FIRA 5LA2A 3VOCA 1BEUA 1XPYA 3H2AA 3IIPA 4AWSA 3W2UA 3GH4A 1P5BA 4E38A 2CYGA 1IE7C 3ARZA 1IT8A 2JF7A 3LV5A 4WUIA 2O7QA 3N29A 4GXPA 1J0YA 2OKTA 3THCA 1EO5A 4OE7A 3PC0A 3D5HA 4MZ8A 4CD4A 4GMEA 1VQTA 5CGQA 2OWXA 3OIHA 4N4QA 4Y90A 4JCLA 4ERGA 2OR2A 3NFUA 4A05A 1RLCL 2IMRA 3B8DA 2X0HA 1Q5MA 1XIJA 1F76A 3AXXA 3GIQA 1OD8A 2CBIA 3OBEA 2IQDA 2ZE3A 2NSOA 3DGBA 4JTTA 3BXWA 3EWXA 3E3HA 3XINA 1GOQA 2OT0A 1FCBA 1S5NA 3U4AA 3C2EA 4PCPA 3LUTA 4IGHA 3WNMA 3LZ5A 3H2MA 1BGGA 1JDDA 4A29A 3GTXA 2D1ZA 3RPTA 2DPEA 1C8QA 1Q6EA 3EPNA 3ARVA 5LXEA 4EKJA 1QK0A 2J8GA 5IDZA 1H7RA 5EMUA 4PBFA 5JU6A 1W37A 4PMNA 1XIDA 2XYLA 1O66A 2AKZA 3B0PA 1JR1A 2C1HA 4MJZA 3MCOA 4PUMA 4HOWA 3H6OA 4NIRA 3GB6A 1Z6KA 1LLOA 4NZ5A 2XN1A 1W1IE 2PC4A 4L9YA 2VC7A 4AFYA 4QG8A 4DBEA 5AC4A 3CZKA 3KTXA 3V16A 3C2FA 4QRNA 2B7NA 3UXLA 2HISA 4ZCWA 5D32A 4F0HA 1OF8A 1IIGA 3L0KA 4KQNA 3CHFA 3T0DA 3BG3A 1PDYA 2FJKA 1QHZA 3ABRA 3VGDA 2QW5A 4MKNA 3S1GA 2ZICA 3VNKA 1FTXA 3V1HA 3P8JA 1ADDA 1ECEA 2G41A 1WDDA 3KEHA 4NSBA 3C0JA 2G97A 4H2CA 4H3DA 1RR2A 1SJDA 4C6LA 4DZAA 3IARA 4MUZA 1XH2A 4I9TA 1PBGA 3UP8A 3FDGA 3E38A 4A8IA 4O50A 2EPLX 4UTHA 4PMQA 3FHQA 3F5KA 3HA1A 3SN4A 1C93A 4P8XA 3THDA 3B9NA 2POTA 3FLUA 3RK8A 3LBCA 1YBQB 4J2MA 1NWSA 4ALDA 5C9WA 3VKAA 4Q8QA 1FDZA 3FDKA 1I2RA 5AYBA 4ATDA 3MSYA 5MF5A 3CAVA 4GACA 3UA4A 1E9IA 3BLLA 3BARA 5XIAA 3TFCA 3F4NA 5ABFB 2Z1XA 1NAL1 4LUTA 4HTBA 3PNUA 1O94A 3EBVA 3KOZA 3I6RA 1M9HA 3UCDA 4LS1A 5FEXA 4S3AA 4S39A 3SDOA 4V1YA 4N9EA 3FA5A 1R85A 1QNQA 1WNOA 5IDIA 4GG9A 3N34A 3G6MA 2J7FA 4D6FA 3NGFA 1IEQA 3K4WA 3P62A 3CQJA 1PS9A 4TOQA 4AX6A 5T8GA 4F4RA 2Z6IA 3LCHA 4I3GA 3TTEA 4J35A 3AS3A 1DXIA 4GFSA 5DRCA 3C0SA 1SVDA 2VTFA 2HQAA 1AH4A 1XSIA 4MNKA 2WC4A 2F9RA 3NIYA 2A7PA 1XINA 1GOOA 4LX4A 3DFPA 2NX9A 3H54A 3IV8A 3SIMA 3K4AA 1V8EA 1VRDA 5LIXX 4BCEA 4Q8OA 3OHIA 2B0MA 2WM0A 3PJXA 1H62A 1YNPA 2V5BA 4JTHA 4B5UA 3ITYA 1IEVA 2I14A 4RW3A 5GJMA 3KS6A 4IIBA 2R82A 3B06A 4PUJA 3VIMA 2ACQA 3OPSA 1CXKA 3GR4A 4DBWA 1W5PA 4XTDA 5CQ1A 3W24A 4H8UA 3M44A 4P2VA 1TUXA 1EP3A 3PBUA 4R34A 2HV5A 3CEUA 1X7FA 2XH0A 4HU3A 1CBGA 4OECA 5GNXA 1H7NA 3LPPA 1GJUA 3SSZA 5FL0A 1VFHA 3D3AA 1GG1A 4C1NA 2I5QA 3I3EA 4ZODA 3WZ0E 3VNIA 4H1ZA 4EK7A 2D2GA 3UYCA 5BYWA 3VE9A 5HWNA 4UFLA 2C79A 1XRSA 1L6YA 4F0LA 2ZUTA 1IT7A 2J25A 3DGRA 4MWAB 4Q4RA 1E0VA 1LWHA 1LWJA 1VFFA 1E3XA 5I3JA 4WDUA 3TLLA 1GOKA 4LCQA 4JD4A 2VFFA 1GVRA 1ZSXA 4DB7A 2DU2A 5G1YA 4I7WA 3U7VA 2PTYA 3K13A 3STEA 1XDLA 3ICJA 5EPDA 2J79A 2ZDRA 4LH8A 1RQHA 1G4TA 5A8MA 2VQTA 4LF1A 1HZYA 3AISA 3LRLA 4DWSA 2B31A 3FS2A 2VGGA 3UCQA 5GPRA 2DZSA 1IXPA 4U3AA 3TCEA 4RPQA 3PHAA 1FWIC 3VD3A 4XKYA 5GQBA 1TVNA 1NFGA 1RJPA 1AG1O 4MM1A 1OABA 5H6HA 2X0YA 5HANA 2W61A 4NNCA 3HN3A 4KWUA 3RCMA 4NJGA 5M5DA 1C8XA 4YTUA 2PP1A 5D9MA 2ATMA 4PRWA 1NOWA 3PPFA 4F0MA 1EC7A 2QCEA 2J9YA 5FESA 5E09A 2AGKA 4QG6A 6TIMA 3GH7A 3MBFA 3IEBA 3CV7A 4E4PA 1ZU8A 4LY4A 3WQEA 4DUVA 2ATSA 4US5D 2R1NA 2PDKA 3SJNA 1Z42A 3NQ6A 1AA1B 3WUFA 2ZX7A 4EXQA 4TTUA 1WOBA 5DO8A 3DU0A 3ANVA 3M5VA 3MBDA 1RBAA 3QC0A 2YBTA 1DIKA 3O16A 3UWUA 1US3A 5J8LA 1R2SA 1NVMA 4HSHA 5E93A 4BHYA 1XLJA 3HG4A 2FTWA 2C0AA 4HPJA 2CW6A 1S1PA 2YDRA 3CXOA 4H8VA 1XG4A 7REQA 3GRIA 5LA0A 3GO2A 5EL1A 3WJYA 3U2EA 4L5ZA 3FXYA 2XVKA 3EOUA 1XFBA 3CIWA 1SPQA 2PC8A 3IACA 1A0DA 4HPNA 5DBTA 3BPWA 2QPSA 1NOFA 1JNEA 2ZXQA 3VC6A 3S47A 2VUNA 4DYJA 3QEZA 1OB0A 4C6JA 3NO3A 1HUVA 2XIBA 3WUEA 1O4UA 1JZ3A 4IP5A 4Q4SA 4IIDA 5IRPA 1ZHAA 1HJWA 2YCEA 3H2FA 3NAVA 1AH3A 3MHUA 1JNDA 2EPMX 1LOQA 3PBGA 3W53A 4UQCA 1QW7A 2VYOA 2DZPA 2QJIA 3TJIA 2VP8A 1GTEA 4MJ4A 3VXGA 2WPBA 1FWDC 3II1A 1DWHM 3H8AA 4PMRA 2EBNA 2RDTA 4HZ7A 4R7JA 3BOXA 4FNQA 1J12A 1WDWA 5HOSA 3U2OA 3LSCA 3SAZA 4B9YA 3UR5A 1YADA 4UBPC 3VZZA 1E51A 1YX1A 3HBLA 1IR1A 1MDLA 4YIWA 1O12A 2RHGA 5D38A 1KR0A 7CGTA 1TRIA 3DFHA 1NDWA 1UZ1A 1QK2A 2GL5A 2HCVA 2HDJA 4P8WA 2MANA 3C2OA 2PP0A 1S3TC 4IPLA 3U57A 2WZTA 4O1BA 1XLGA 4PTWA 1TTQA 1YTDA 4ATLA 3EWBX 5C2XA 1TWDA 3KCOA 5B80A 4KEUA 3AS0A 4X61A 3E2SA 1IEIA 1QJWA 4EWND 2V38A 1C8VA 4TTGA 3UU0A 2Z1VA 3NQMA 3UZJA 3LB0A 3N3TA 2OGJA 1WKDA 4PTDA 2PI6A 2BY2A 3PS7A 2P0IA 3W71A 8CGTA 3CJPA 1UIOA 4LBRA 5DF0A 1J01A 5KTLA 4MWAC 1B3OA 1SJBA 1EJXC 5BXTA 4QROA 4RXGA 2FZNA 5DT7A 3DIPA 4S3KA 4CNUA 2NUWA 3AQUA 4AY7A 1HG3A 3HM7A 2FPVA 2WKJA 3NQ8A 1V0NA 2BVTA 3TOYA 2PDYA 1SFLA 2PUZA 1PX4A 3L67A 2GGEA 1ITCA 1XIEA 1E0WA 3CQIA 3VOIA 3TW7A 3DG7A 2VFDA 1XLFA 3WFAA 4DO7A 4GKLA 1E4LA 4DZIA 3LNPA 3H21A 3UGVA 1OK6A 3GU2A 3I68A 3IUIA 4GLEA 4MFEA 4AZCB 4UTFA 3S5YA 1BLIA 1S5MA 3W1QA 3W25A 1A49A 1UC5A 4NJHA 3ZFHA 3VMOA 4K1GA 3MVTA 5F2MA 4JS3A 1OGBA 3LTSA 4KIRA 3MMDA 3MI2A 4TV6A 1X98A 3TZFA 1VFUA 3OQ8A 2Y6ZA 4AD5A 5D02A 3OQEA 3VIOA 1XIGA 4I6KA 1J79A 3E96A 4HOZA 3QYQA 1X8FA 5KINA 3W72A 5CLWA 1WE5A 5D2XA 1ZNNA 4EP8C 3DERA 2Q8ZA 2D69A 4PUUA 2JGYA 4N42A 2GJLA 1R2TA 4M5PA 2O9PA 3S9YA 3ARYA 1W3IA 1K8YA 2GQ8A 1DJZA 2ADAA 4I8YA 1UKOA 4OKDA 1WO2A 3N2XA 4Q3MA 1VGAA 4BS0A 2D0HA 4ZFMA 2J13A 4ZL1A 1Y5WA 1UPPA 3MUXA 1V3MA 4KWWA 2VDHA 5FAGA 3V18A 3R1ZA 4JTUA 2O0TA 3O0FA 4DZHA 1SUXA 1JL8A 3DG6A 4IWWA 2Z25A 5D2WA 1JRCA 4FX7A 1POKA 4HCHA 3QKEA 1OC6A 1QW9A 1RA5A 2V67A 4A3RA 4RDWA 2XGBA 4GYJA 4XV0A 4WRHA 2WJEA 1W9BM 2OTDA 2V0TA 1XG3A 1GZGA 4YWIA 3RITA 4U5IA 3R8GA 2HK1A 3EDEA 2VR4A 3W70A 2DW6A 1I2OA 3CB8A 1K4HA 1K1DA 1GQJA 3CAKA 3TU9A 1XYFA 2YBUA 2BGQA 1JXJA 5AVNA 3ZQ9A 3FNDA 3CMGA 1OX6A 3B8VA 2DT0A 3S42A 4OBTA 4HN4A 2JIEA 4W88A 2YDSA 3A6OA 1OGGA 3AZTA 1SO3A 2H9AB 1TV2A 3RU8X 4QNWA 1GOMA 2XM1A 1UWQA 2WPGA 3MMUA 5CZSA 3WQDA 3KCJA 2NLYA 2OZ8A 2WZMA 3T81A 1S1RA 4PSRA 3A4JA 5REQA 3KWXA 2FVMA 2O56A 3SRDA 4S2CA 1BPLB 1DWFM 3P6LA 3HV8A 2OT1A 2RKXA 3ZWTA 2XH2A 1GZ1A 4C6NA 1EDGA 2DVXA 1UP2A 1YIXA 4JQ4A 1XBXA 2PLCA 4DJFA 3ABSA 4HHHA 1VF8A 2BVYA 4NNBA 3T44A 4G7EA 1PKNA 1M03A 4NXKA 4MAZA 3TE9A 4Q8VA 3OOQA 4MDPA 1KRCC 3PPHA 3MA8A 4J3ZA 3NQCA 1HNYA 1MQPA 3HFTA 1US0A 4OZOA 2XFFA 3Q58A 4NAEB 1V79A 1L0PA 2DVTA 4C1LA 1E40A 3M46A 1GPFA 3V4BA 4KESA 4ADUA 4PCFA 4JKLA 2AMXA 1F4AA 5HMSA 1ZJHA 1DIEA 4KS0A 2OEMA 3ZR5A 3GBEA 3RM9A 1QI3A 1XL9A 3KRSA 2CZFA 4B4HA 3AWOA 5HULA 1B31A 3NDYA 3SCTA 6CGTA 2VFEA 2W3ZA 4EE9A 3CH9A 4I9AA 2BGNE 2WMIA 3CUHA 3P93A 3O8AA 3H2CA 4UQAA 1R47A 1FOBA 2Z26A 1CT5A 1XQKA 5E5CA 3T0AA 4MZYA 3CHEA 2XHYA 4IGMA 2E0PA 3K8LA 5LZLA 4LVBA 3U5YA 1XSJA 3GHRA 3KAOA 3PK7A 5FJRA 4GXMA 5DN1A 1Y7VA 3LA4A 3PWIA 3W2NA 2PDIA 4TMBA 3WQ5A 4XAPA 3WD4A 1JDCA 1H1NA 4MY9A 3O6AA 3F7JA 2VOMA 3L21A 4AZ6A 3GXDA 4DQWA 2WVSA 1UD3A 2ZADA 2A2IA 3XISA 1EC8A 1XLEA 3VINA 3BLEA 1SZFA 3DYMA 4QGCA 1L6FA 3L68A 4Q6XA 3CPRA 1WDPA 4CN6A 5EFFA 1LP6A 2QLYA 1UZHA 1FWSA 4H6EA 3PTMA 1FDYA 2BASA 3BV7A 4FI4A 4LSBA 4X3ZA 3UBPC 4HPGA 2BSLA 1GNXA 1VFSA 3WQOA 3NYZA 3KBNA 1UP3A 2W0UA 1OADA 3ABOA 1EX1A 3H2OA 1PWLA 5HMEA 5CPLA 3L4VA 3SADA 1L8PA 3WF1A 4IX0A 2R1PA 5I02A 4US6A 4P8VA 4HPHA 5FSEC 1MEIA 4R27A 3W83A 3WYZA 1UP0A 2E9BA 3PZMA 4GI6A 1TPEA 4TX6A 1RAKA 3KHJA 1YLVA 3WQGA 1JYXA 4S3BA 3P3BA 3VA8A 1TPFA 2VZOA 2WZIA 3WDHA 1NDVA 4J5NA 3IVTA 2Z6JA 1H63A 1J10A 4BF5A 1GG0A 4HD5A 4NJJA 2QCGA 3KP1A 1E6ZA 4DPPA 2EPKX 5BMWA 4W4QA 3LZ3A 1QPQA 1DWGM 5AYYA 1UR3M 3GAYA 2QPXA 4QQ3A 1SU5A 3W88A 5I07A 5CXPA 4AD3A 1KB3A 4B3LA 1UR2A 4AYGA 1XKYA 4IP7A 1RD6A 3IANA 3CZEA 3L12A 3W7NA 4O1FA 1CPUA 3F1QA 3EOLA 5C54A 3QZ6A 3BANA 2GUUA 2Q3OA 4YTSA 1Q8AA 4BJHA 2VC9A 3HQPA 5K4XA 2OMAA 3L4TA 4O28A 1AW1A 4B3KA 4JQ1A 1UWSA 2ZXBA 1A5KC 1WYIA 3OODA 4U10A 4AF0B 1NEYA 2Y61A 2XFYA 3AROA 4KT2A 1NDZA 5CGMA 4RUBA 1U5HA 4YL2A 2Q8XA 5I24A 2PWGA 1J4EA 5HUOA 3IUHA 3BL3A 5BNKA 4GUIA 1YTEA 1KCZA 1QI5A 2X40A 1KBKA 1XGDA 5IBXC 3WQCA 1LQ2A 1NWRA 3G1YA 1S3HA 2FGZA 1E1CB 2F2HA 2ICSA 3AXHA 4LC6A 4YTQA 2WSPA 1I2QA 4AIOA 3SUTA 3URNA 4HMDA 4GC4A 3B9DA 2Y63A 4GCXA 1JPDX 3ZYZA 1AL7A 1WPCA 5AYZA 1ZTVA 3ZIZA 2VNCA 3CL6A 5LNUA 3W84A 1UASA 1NARA 4I8DA 2Q09A 1ISYA 4GGHA 1WAUA 4PRTA 3NURA 1W9VA 2D73A 3UY8A 4LNCA 3OYXA 3VOGA 1MUMA 3EWWA 2F8QA 1NP2A 2NZLA 1QW8A 2NQ9A 5CJ5A 4IFKB 3TSBA 3S2JA 2A6LA 4QDWA 2R8WA 4GVHA 4NG3A 3HQOA 2ABBA 1Z44A 3WLMA 1R3VA 5G1TA 5CCZA 1OFAA 3TTOA 1Q4NX 2E6YA 4PMUA 2I16A 3KBVA 2OGYA 4QE5A 1SW0A 2Q6ZA 2CC0A 2PDLA 1QNVA 5CSRA 4HK5A 3NQAA 3S5NA 1TQXA 1KNWA 3WJWA 1PB0A 3AJXA 4A8NA 4PMXA 1E56A 4J3SA 1SO4A 5EKYA 3VD9A 4J27A 1X97A 1PZ3A 1XW8A 2JK2A 4EACA 5EYWA 3A22A 2NWRA 3OW1A 3FXGA 1ODZA 3FEQA 4UXDA 1BWVA 2NW0A 1YPXA 4REQA 4DM2A 3GX9A 5FJTA 1DEDA 4TXEA 4LALA 1QR7A 3QXBA 1XQLA 3EOOA 3LX9A 1XUZA 3TN6A 4KIEA 4LEFA 1U33A 3PUOA 2QJJA 5LGXA 4QTGA 3G1FA 3WLNA 3S5SA 2WMHA 3MUIA 2QHAA 1EHNA 1H11A 1OZMA 2IXVA 3AYTA 3PZ9A 2O4MA 1F6PA 4I9MA 4JX5A 4FNTA 3L66A 2GQAA 1J6PA 1HKIA 4PEEA 2NUXA 4HNCA 1QPOA 2REQA 2HJPA 2ZZ1A 2PDFA 2H6RA 3U8GA 5T9CE 4DI8A 3VUSA 2P1FA 3ISIX 5JXQA 1EKOA 1VEOA 5F2GA 5I5RA 3RCNA 4RLIA 3T0BA 3EX2A 3FYOA 2X41A 4O1AA 1A3XA 1DHPA 3H7VA 3THAA 3LGDA 4PYSA 2GJPA 3RX4A 4CEUC 3FJNA 1KR1A 2Z27A 5A6KA 3NVTA 3Q4DA 1KFBA 2CWNA 4FOKA 1I2NA 4WXZA 2ZE0A 1W2PA 3MJYA 5K9CA 1J0KA 4HSOA 4HCDA 1UH3A 2FDMA 4NHVA 2Y85A 2A5HA 5GJPA 4I6VA 4L4PA 4KPLA 3UR8A 1D3CA 1M7JA 2NX1A 2ZTJA 5L9FA 1KLYA 1GQIA 1PKYA 1M41A 1PZ0A 5I78A 3FYYA 4H83A 1B57A 1ENUA 1W3HA 3K2GA 1CLVA 4PB3A 1WZMA 3A9IA 2WMGA 4IX2A 1TYGA 2QDDA 4JTJA 4UTTC 1QOXA 5U4NA 3VNYA 3FSTA 1VPXA 1W3LA 5HQEA 3QVQA 1Z48A 3F4WA 2ZVRA 4JBRA 3LNMA 1B9BA 3W2MA 2PSNA 5A95A 4HMCA 3CEPA 4UTWC 5MKGA 1QU4A 4Z1BA 4D2JA 1J96A 3RR4A 1EZWA 1FHVA 2XM2A 1K02A 2E40A 1NF0A 3GSMA 4D6JA 4CCDA 1HL2A 2XUCA 2QCNA 3NYDA 3GDLA 3SGZA 3N73A 2PDXA 1AK5A 2QGYA 3LMZA 4PODA 4QX4A 4FXRA 3IWPA 4U5KA 3BSGA 2WJFA 3WJSA 3JZEA 1VH7A 1RJRA 1NSJA 4UZSA 5DT5A 4XO6A 4R5EA 2PA6A 3ZT7A 4QXIA 1L2UA 4K39A 3N14A 1JCJA 2ZUWA 1XH1A 4AHOA 5FF4A 4IHCA 3RF9A 3WD0A 5DBUA 3GTIA 3BSHA 4LUTB 1MNZA 3W7MA 1BXNA 5JBDA 1QI2A 4BFAA 1XISA 3QGAC 1EJVC 3WK3A 2PD9A 4ZSUA 3RXZA 1FWBC 2BGSA 3WBEA 2HE8A 4G5DA 3DKLA 1EIXA 3MHGA 5D2VA 2J9ZA 3B9AA 3SBFA 4FK9A 4HN8A 1AQFA 3MO4A 1F9CA 2Z00A 3UPBA 5BOEA 5BRPA 5AY7A 3M0JA 4AB4A 1QO2A 4URIA 3MI6A 1PYMA 1QDSA 4GQGA 3W01A 1LBMA 2PMQA 4JDYA 4M6UA 2C16A 3T6CA 3WCZA 4F8XA 1W91A 3STGA 3TTYA 4DM1A 4GI4A 2RGLA 3SQMA 3B97A 2OXNA 3INPA 3LI0A 2WBGA 2B7OA 2V2CA 4K2SA 3HGOA 4YHEA 1CI1A 5T91A 5AZ1A 1EZ2A 1TR9A 2HPIA 1KM2A 2JALA 1G7UA 5RUBA 3UGRA 4HU4A 3UWYA 1QNPA 3NZRA 2X09A 3TN4A 4JTLA 1BRLA 2V5JA 4OOUA 4Y8EA 4D6EA 1YDNA 3GC4A 1DL3A 1YDOA 3R8RA 3DBPA 5I3GA 4FSAA 1MW3A 1ZAIA 4J3TA 3BCFA 1V5XA 2CZEA 3W6MA 2GOUA 4HB7A 3W2LA 1PUDA 4WD0A 3VIJA 4D6CA 2CXGA 2HE5A 1LDCA 2ISFA 4HK6A 1GT8A 3VGEA 1TA3A 3ITXA 4GUGA 1LQAA 3SI9A 2OPJA 4C6FA 3NL3A 3WQ4A 1HT6A 1ELSA 1VPQA 3FJ6A 2FMOA 1LT7A 3IUDA 2YFOA 4UZUA 5CSYA 1J0HA 4JYFA 4MG4A 2FLIA 1YYAA 5FF3A 3BTNA 2OCZA 4WSHA 4C1NB 1BG9A 4O4VA 3ZR6A 4QDPA 4B2DA 4XWUA 4LCRA 3IAPA 1BGAA 2QAFA 4D6GA 2VWTA 3ME3A 4DUWA 4O13A 3R79A 1GVOA 3QQWA 2EJAA 1KV5A 2VO5A 2CHNA 3G22A 2BHUA 1Q7QA 3B9OA 1VD6A 2BHZA 2RJHA 3L0NA 3TWBA 2XVPA 3FA3A 2Y7GA 4DUOA 3N13A 5DLCA 2FZBA 1Q2SA 2ZRVA 1BTCA 1LWIA 5H8UA 1ZBVA 2ZYFA 1W8SA 2J77A 4MWAD 3TQVA 4I90A 4XUYA 3HGRA 4DWSB 2P88A 3DN5A 1I8JA 1VP5A 1V6TA 4AC7C 3MCNA 3H4GA 1LUCA 2KZHA 4IJBA 3MW7A 4A22A 2HBVA 2E6AA 4XKYB 4YCPA 3D6NA 3RG6A 1UD4A 2IQTA 4OBSA 4L9XA 5LGZA 2C1IA 3TA6A 2FDSA 1JULA 1GUVA 2IKIA 1XYLA 1XLLA 3AYSA 1GW1A 1AJZA 3FAWA 3W7JA 3WNOA 1W9DM 1J5SA 4F79A 3EB3A 3GXNA 3VK5A 3UZ5A 1EXBA 2TRSA 1MRAA 1HQTA 5CZTA 4B90A 1PX8A 4D72A 2FYMA 1E1FA 3G0XA 4MSSA 1P6BA 4F66A 4QAIA 1EEPA 2UBPC 4AW7A 1R38A 2QPUA 2QCFA 3SURA 1D2KA 1XF0A 2PURA 3BG9A 4AG0A 1PVNA 3T55A 3I7QA 4CD6A 2CBVA 4IPPA 4H9ZA 2O55A 5HATA 1U5JA 4GX9A 3NPXA 3PZUA 2DGAA 4I9JA 3DX5A 2FFCA 5JBEA 1GWJA 3DFYA 2DZVA 1Z32X 3C52A 5G5IA 4PGLA 4X0VA 4CQCA 3T8LA 1UC4A 4X63A 1L6GA 1H61A 1KCLA 2WVVA 5CC3A 3OVQA 7REQB 1TMQA 3MB9A 3UNDA 5CG7A 1VFLA 2GK1A 4OT7A 1I0BA 4DF1A 4L4LA 1K9DA 4R85A 4JTGA 1W0MA 2GWGA 2VVSA 3GNOA 3WLRA 4Z42C 2H8ZA 1XYZA 1SQ7A 4DJDA 1XIHA 3S4TA 4AX7A 2PLJA 1K3UA 2VXNA 2VFHA 4TV5A 4Z2JA 1V0KA 4LUSA 1GVEA 1HJVA 3P5YA 3WX7A 1IGSA 5BRBA 4UFMA 2IXUA 4GJIA 3MCMA 5HINA 2D3LA 4N6FA 4TO8A 4JFVA 2CFFA 4NJIA 3T2PA 4RL3A 1Q6DA 1ME8A 1X39A 2PWUA 4N02A 3AICA 4MZ1A 3VTRA 1GJWA 3DAQA 4HU8A 2YCKX 5HMDA 2VR5A 4XIMA 3WMBA 2GYIA 1US2A 4QM1A 4QCEA 4OV9A 1ZJAA 4O0KA 3IGUA 1T6MA 1NF7A 1PZ2A 2VGFA 2Q3RA 1TR1A 3THQA 5F2IA 4LBUA 1AVAA 4CUCA 3T4WA 9XIAA 2YZ5A 1LBLA 4EF8A 4XZBA 2CLOA 4FXFA 2Z4GA 4UFHA 3OU8A 1CXIA 1DXFA 4GIAA 2FGLA 1YE4A 4D1JA 3OBKA 4Y7EA 5BU9A 2HRWA 4WR3A 1NM9A 3LG3A 3F2DA 2OSYA 1ZENA 1REQA 1EHAA 1HJUA 1RD5A 2GOKA 2DJXA 1EQCA 3GVGA 1VC4A 3W74A 3CLWA 3ZXWA 2OU4A 1I75A 3T9PA 1SZEA 5SWUA 1UR1A 1BTMA 1YXCA 4ZOAA 4GA8A 3NOEA 1I1WA 1K8XA 4GY7A 4LGXA 3W0KA 3VDCA 4PTXA 2QUNA 4QDMA 4MUPA 1N7KA 1K7FA 3E12A 3W85A 1ZCCA 3ZLHA 3DFTA 4RJEA 2XTKA 4J40A 4JTIA 3WH8A 3KVMA 3RGTA 2EO7A 2E9MA 4Q4KA 1RQBA 1GW9A 5HQMA 2R91A 2QEZA 2DV0A 3G1SA 1LG2A 1LZOA 3BOFA 3RJYA 5AC5A 3VIFA 2VZTA 4AZBA 1XCXA 3VC5A 5EU9A 1J0IA 1IWBA 2YFNA 4QIUA 1IF2A 3LY0A 1VR6A 3MU7A 4GUJA 3TVAA 3WLQA 3NQDA 3NSMA 4DWSC 4AVOA 1U22A 3MZ2A 4QSHA 3K46A 3VIHA 3B4YA 1CCWB 5AKQA 1NY1A 3AIUA 3UQNA 5HNUA 3VX0A 1S2UA 2INZA 2A3EA 3WF3A 2RAGA 4AC1X 4GQRA 4ZB0A 1OFQA 3UR2A 1ZALA 5A8NA 3OTRA 2X1SA 2AAMA 1SW3A 3JUGA 1UR8A 2YSWA 2YZRA 1SW7A 1RUSA 5TAOA 3GUGA 4U28A 3GM8A 4BQ3A 5LIUX 4ZMGA 4LUIA 1TELA 1YNQA 3W7RA 3T0TA 3TTSA 3BUVA 2XN2A 1VJIA 1W1A1 2AL1A 3CUJA 3D47A 5TNVA 5JIWA 3TONA 3MP5A 3GLCA 1A0CA 3EX4A 3M0MA 2A4AA 3UJSA 4BEUA 1UMLA 3BMXA 4BEQA 3DYPA 1R3RA 2CIPA 1DJQA 3UCCA 1KFLA 3E2QA 3AMLA 3LHZA 1CNVA 3H22A 3VKJA 2DUXA 2YGYA 4QISA 1T8QA 2P76A 4UOJA 2XWEA 1HL8A 2V5LA 4CD5A 4NY2A 4G9PA 3GXTA 2E8ZA 2E5BA 3JR2A 4FOJA 2YJQA 1ZP3A 3AMCA 1XIIA 3VILA 3QF0A 4MYAA 4ZE5A 2VM8A 1M04A 1MUWA 4NU7A 4FXSA 4DAFA 2BY1A 3WD3A 1FKXA 4LAUA 1Q6GA 1ZFJA 3WFLA 2I7GA 1U2YA 3PBVA 4HVXA 1XLMA 4HMNA 1JUKA 3NQVA 5FF0A 3L2LA 2FHCA 3AUJA 3HPXA 3BZJA 2V5CA 1TZ7A 3T2QA 3M0VA 1PIGA 3QOMA 1FH7A 2RFGA 3TR9A 1ISXA 3GDRA 1K77A 3LCIA 4RNJA 2IPGA 3CK5A 5D33A 3R5EA 2OB3A 2PGWA 3SCPA 4AZ5A 1E6PA 2E5CA 2DDXA 2NV1A 2INFA 1FP8A 3SRKA 3G8RA 4HA4A 4MY8A 4XSMA 1F74A 2PDHA 4LW7A 5A5WA 1P7TA 1G9HA 3DG3A 2CCRA 2Y7EA 3SCQA 1MEHA 2I56A 5REQB 3MWCA 3WBXA 1MZRA 3NGJA 3GFYA 5G2IA 4OUIA 4BR1A 4Q7IA 3TMLA 3SCNA 1JAKA 2ZA3A 4HOXA 1F7BA 4W89A 2VX5A 7A3HA 4B5TA 2PODA 1VZWA 3BLOA 3VNMA 1GOXA 1JUBA 3WSUA 2C1GA 2P50A 4G7EB 2ZUVA 4DEFA 5BZAA 3LHVA 5EBUA 3HG2A 3FSUA 1D9EA 1IXNA 1PE1A 3LPGA 4GRSA 2I9EA 1I1XA 3SGGA 2P10A 3LHTA 2EPHA 1JPKA 4HNLA 4LB3A 2PGFA 3EYPA 2QULA 2IKJA 3XIMA 3WF4A 4ROPA 4JY9A 1E72M 4P7LA 1EJTC 4JYEA 1VLIA 4W9TA 1EL3A 3NO5A 4MB1A 4N9BA 4E8CA 4B3ZA 3QGVA 4M51A 3Q94A 3FVDA 3OYZA 3D0CA 5C5YA 2D20A 2PFHA 5T9BG 3WUGA 3OGVA 1OX4A 3LHUA 2V6AA 1V6WA 3GD6A 4KRTA 3B0UX 1T96A 3N2OA 1JG9A 1V7YA 4NZJA 1JGIA 1W9XA 4D9PA 4G1NA 2G0WA 1C7SA 2WMIB 9RUBA 2G4FA 1BXBA 1QNOA 1QOPA 3RILA 4Y8FA 4C6EA 4B4FA 4Q8WA 1YKWA 4CNTA 1KWKA 3T05A 3U4FA 1VS1A 5ABGA 5A2BA 2IKGA 4D6HA 3V75A 1TJ2A 2A85A 2QCLA 3BJTA 2P8BA 4KCVA 1XR2A 2CETA 2ZZ6A 2E09A 2F61A 3OZYA 3MP3A 1UKQA 3GY1A 4OOZA 3WLKX 2ZZ4A 4EOUA 3OZPA 3MWAA 5AVHA 3LPFA 4C6MA 2X30A 1KLZA 2RUSA 1DJGA 3VGBA 1KTNA 1YRRA 1HKMA 2WC7A 3M0KA 4FB7A 1Z69A 4JHMA 3KX6A 3MSGA 4GOAA 4CU6A 2GWNA 3EKZA 1XPGA 1F3WA 1L9WA 2WXDM 3CS2A 1UD6A 4TX9A 1RY8A 4LV4A 2HVOA 1E70M 1OCBA 4DYEA 4JEQA 1ICSA 1QWKA 3LCGA 2Z1KA 1GVIA 1FWGC 1UR4A 2BV9A 3NL2A 1B3WA 3LRKA 2Y88A 5AHEA 5FACA 5G4EA 3CQHA 1UROA 5E1QA 2XSBA 3IJQA 4IXHA 3N9SA 1E0TA 4XZIA 4M24A 5A94A 1TO3A 2VD8A 3M4HA 3WQPA 3ZVIA 3YPIA 4WQ6A 5HR7A 3VI2A 2DVUA 4LAKA 1ZBKA 1KM0A 4J3WA 4S3EA 1OYCA 1CXHA 4OIFA 3N2BA 1V7AA 1WZLA 4M7SA 4F0KA 3KBMA 3LQLA 3NPVA 4MGGA 5F2LA 4H9UA 3L23A 3L4XA 4FX8A 3P2VA 4IOTA 4LYKA 3T2OA 2WWDA 3QJAA 4XZNX 3GR7A 1OFBA 2PDJA 4FPSA 4AZIA 1IZJA 1UYQA 4XBSA 3O05A 2J8TA 2UY3A 4C1KA 2QUMA 1SZRA 4FALA 3DZ1A 4HNVA 1B3VA 3OVRA 2WVUA 3A4AA 4QJ3B 3EOSA 3W37A 3GXFA 4P7QA 2B7PA 3QBUA 1GHRA 4PMJA 1CXEA 4K36A 3NQGA 4V15A 4XX6A 1VCVA 4IUOA 4CQBA 2JIWA 2OZ0A 1S38A 1OVDA 1WA3A 4MNLA 3CZGA 4D8ZA 3TR2A 3AIWA 1XBYA 3B9EA 3IVSA 5DX7A 5A8OA 3ZSSA 3KBSA 4ZA0A 3PBMA 5K9DA 4NX5A 5AYXA 1YPIA 5HBFA 2HVNA 1VYPX 1NOUA 4WEVX 3NQ2A 3N3MA 4PC8A 4HMEA 2QCHA 4LYQA 4ZQCA 3TP4A 1XLBA 1JCYA 4DJFC 1Y65A 3KOFA 4GC3A 4PTMA 3S5ZA 4G1KA 3W4RA 3QH2A 4YN5A 1YHTA 1SFSA 4IG2A 3EMQA 2Y5JA 3QV6A 1HF6A 3WK1A 4WDXA 3VYLA 3HPZA 1FHLA 1MO0A 3N18A 4IMEA 5FF2A 1PTGA 3RR1A 4O0QA 2CWXA 1R5YA 4N9DA 3WLOA 1XS2A 3QLLA 2X2GA 1OCJA 7ODCA 2DIEA 3GFXA 1FX6A 3QC3A 3DDMA 4FIQA 1F61A 1W5OA 2W67A 1EP1A 1XLIA 6A3HA 4RE0A 2FH6A 3QV7A 1I0DA 2QQ6A 4NZ3A 4AU0A 4UOQA 4GISA 3A23A 4BI7A 2YXOA 4FOUA 2X1TA 1EC9A 4BQ4A 1ADOA 2NX3A 2MUCA 3C61A 3P5ZA 1G67A 4ZVJA 2G8ZA 2W66A 1WAWA 2FH8A 4ROQA 5D05A 4XVEA 4ONVA 3GU9A 3W07A 2PRMA 2WSRA 4ZE4A 3LCXA 5EMJA 1H50A 2YW4A 1XLAA 3LGGA 3BW2A 4JIIX 4KEMA 4JY8A 3EA1A 1O5RA 1UJQA 3I10A 4L1GA 4QCFA 1O5XA 4BK9A 1E4MM 4L1WA 5DMMA 1W5QA 4PCNA 2ZRUA 1I9CB 1UD2A 2ACUA 3BLKA 4AIBA 3A47A 1R6WA 3IRDA 4DO4A 5BXSA 1JF5A 2AMGA 4UFJA 3PF3A 5CG0A 3NSXA 3GNNA 2FQIA 3VMPA 4AMCA 3CPUA 1XBZA 4RR4A 2WM1A 2G3IA 4WIWA 1K8ZA 5I3IA 2ZVIA 2R14A 2HS8A 3V3WA 2HPMA 1JDAA 2HXTA 4REQB 3GHSA 3BAXA 1G7VA 2ZIDA 4GKTA 2DSUA 4KERA 2E68A 4RZBA 4AY1A 1U1HA 1NTHA 1R3QA 4LQ1A 2I5GA 1FHUA 1QMLA 2R6OA 3EEGA 5FEZA 1FP9A 4UR8A 5IOBA 1TB3A 5FOOA 4DO5A 2XDFA 3I4EA 4IMDA 2PWDA 1IQ8A 1R3SA 5HNTA 4X60A 2ZRWA 4DZ5A 1H0GA 2QVHA 3H70A 1H51A 3LHYA 3VCNA 2Z2BA 2ANUA 4ACYA 4HBKA 5CPOA 1UWTA 1SJAA 3P74A 3ARQA 1KBIA 1LOSA 1D3HA 4JN7A 5CAHA 1P0KA 1H4PA 2QJNA 2REQB 2EG8A 2PDUA 4HYRA 4GCAA 3M1ZA 3PZTA 2QV4A 1S5TA 5C9RA 1SR0A 3GC5A 4KW2A 1NP0A 1UUOA 3V0TA 4LAMA 4W86A 3E0FA 2QT3A 1KTCA 4J3UA 3VDAA 3P60A 1KKRA 1X38A 4S2BA 4LCSA 3I6TA 5ECVA 3WF0A 5A6SA 4JFSA 3WLHA 2Y8UA 2GVGA 2XFRA 4TVDA 2PLKA 3CUIA 1DQWA 5FAJA 4M80A 1B4KA 4K8EA 2J27A 1T41A 3ABQA 1FHDA 4I7UA 1VKFA 4AD4A 2XSXA 2CKSA 3PM6A 4AXKA 1XLDA 1CECA 1GKRA 4CU7A 2EKCA 2DZTA 1GQLA 2PB1A 2WJDA 2CLPA 4JOMA 4E3TA 4HZ6A 1R46A 3FCPA 4FO4A 1CWYA 3SM0A 4C7FA 5I06A 4XBJA 1UQZA 1W1ZA 2F6UA 1DYSA 2WOQA 1M01A 3PULA 4LBSA 1SZGA 3B4UA 4ML4A 3VFCA 1KGWA 3AMGA 5HUPA 3LMYA 4GYPA 4CNPA 2LLEA 3LI1A 4WOZA 3BO9A 4M8UA 3CBWA 3M07A 1PKMA 1TPC1 3GDTA 3APYA 1DTNA 2VGIA 3WMSA 1Y8BA 4XAZA 2CZDA 2VI0A 2VJXA 5MKGB 3LS9A 4A6GA 4GIYA 5E6YA 1ADSA 3LHWA 2VC6A 1M1BA 2GVLA 1HIZA 2OYMA 5FEPA 2AL2A 2PWHA 2GJXA 4P61A 3WJZA 3P80A 4PFMA 3ITTA 2ZX8A 4MPQA 1F05A 5HA7A 3W1MA 4B5WA 3OEXA 4TQTA 1X6LA 3KM8A 3SY8A 1KGXA 2CKRA 4O57A 4MNJA 1OSEA 5CBBA 4IL2A 4QEHA 4XD6A 4UC5A 1C9WA 1Z3NA 4K37A 4RK8A 5MHBA 4YHGA 3C8FA 4XKMA 3BGAA 2ISWA 3L5LA 1KCXA 3TC7A 3UWEA 4PH6A 3VUPA 2ZA1A 4Z2LA 1HN1A 1VEMA 1K9FA 1PHWA 2VX4A 1BYAA 4DLFA 3HV9A 5A2CA 3NDZA 2XZ9A 1PYFA 4Q6JA 2BLEA 3KVLA 1F6KA 4JYDA 1ZPTA 3DHFA 4P7OA 4S1FA 1PO9A 4AHPA 1R86A 4KRUA 3WEZA 3E6EA 2ZWYA 1A4LA 4RW5A 3HG3A 3QSRA 4RDYA 2PE4A 3ZT5A 1OCQA 3PP7A 3UG8A 1RPXA 4Z1DA 3VM7A 3RLHA 4F48A 2ZBTA 2ZA2A 1PIFA 1X1OA 4GZIA 2FTYA 4GZJA 4C6OA 2BP1A 1POJA 1HKKA 2XISA 4FZIA 3UXIA 1AD4A 3A24A 4Z2KA 3SUUA 3CNYA 1AJ2A 1BRLB 1A5LC 2QUVA 5DXYA 3KHDA 1XYMA 4M6VA 2C14A 1GZJA 2EXOA 5F1UA 3NVDA 1VFTA 1PPIA 3RRXA 3EKLA 3S0CA 4JTEA 4BQ2A 5AZ0A 1BWLA 2YB1A 1A5OC 1WOAA 1TA3B 4ZTYA 2FTPA 2WHMA 3LK6A 1HL9A 3QPYA 4W5ZA 4AEFA 1KXTA 3EB4A 5KEZA 4O1CA 4GE8A 2QIWA 1BYBA 2YYUA 1ZUAX 4PMVA 3TW6A 1OM0A 3URBA 3RLVA 4R53A 1SFTA 2Y0FA 4RPPA 1Q6CA 3VKKA 1AUSL 3OA5A 3UYIA 3GTHA 3WDPP 4C7DA 1E0UA 3DC8A 3KL0A 5FA5A 3DHDA 2QF8A 2VQUA 3QTGA 3TJXA 3MUZ1 3SJ3A 3E2VA 2BWGA 2WMKA 3VNDA 4F3HA 4OTKA 1KV8A 1JYWA 5H8MA 2OOGA 2YXXA 3OZOA 2Z24A 1P0BA 2HK0A 3CT7A 2XWDA 4ASTA 2A7NA 1EPVA 2BS9A 2W62A 2Z7GA 3CL8A 1S5WA 1OGSA 3VZYA 3QN3A 3O15A 2QXWA 3EDDA 3JS3A 3BSMA 4IL0A 3EX3A 1TX0A 4NI8A 4HYVA 3TQKA 4LFYA 3RDKA 3S9IA 2VZSA 3C6CA 4FLQA 4J7RA 2AKMA 1X8CA 2PDNA 4LF2A 3W22A 1JVNA 4LS2A 4EANA 1LUCB 1NIUA 1A80A 3QZAA 5IFTA 3P0XA 4ZQNA 5BXRA 4DUXA 3L5MA 3MUAA 2J4GA 4WKHA 2W5FA 3PFMA 3MZNA 3E1F1 3WENA 1T40A 2ZUSA 3U48A 3BC9A 1QCWA 2BOGX 1QBBA 1CGYA 4ZO9A 4DWSD 4Z2HA 4CCEA 1JZ4A 4GJ1A 3HZ3A 1WXZA 4UQEA 4P7NA 2OQHA 3MUCA 1VIWA 2DQXA 3I7RA 1E71M 3G1RA 3RX3A 1PL9A 4GXWA 2ESCA 3E74A 3GDBA 2POZA 1HKJA 8TIMA 1R87A 7TIMA 3RO6A 1XIMA 1J9YA 4CCCA 3VCRA 5U7SA 1GORA 3W7HA 3V7PA 1DTUA 3GR8A 1TV5A 2GGIA 2GDQA 3TA9A 2OQLA 3SN1A 3AS1A 1E43A 3DFOA 2V3GA 2Z2AA 3LCFA 4P5UA 4HJWA 3FEMA 4QFUA 2ABAA 2FB3A 5K3VA 2XH4A 3B8SA 5FJJA 3L9CA 4AZGA 3AIRA 3LCLA 1OEPA 1D7KA 4PTVA 4QJ4B 3GNPA 4JTKA 4O12A 2WVVB 4IQDA 2V81A 3B04A 2QUUA 4TVUA 2PCQA 4PMDA 3R10A 1S5VA 3LCWA 1QOQA 2I17A 5KZ6A 2GK1B 3G77A 3PZNA 3WH6A 4Q8TA 1MQRA 3EWYA 5L6UA 1A47A 2D23A 2Z7KA 1VBUA 4IFRA 4NZ4A 1K4GA 3COTA 3NM3A 5E0KA 1FWEC 1QPKA 4CLMA 4L6HA 3D3FA 4LUSB 1EPXA 1J2BA 3OP2A 2W63A 1ZLPA 3K1GA 2FKPA 4H9YA 5TBOA 1VFMA 1W1PA 2BY3A 2O7SA 4KFOA 2BXZA 3GG8A 4CVUA 1J2WA 4UNIA 1CENA 2HBXA 3SCSA 3VDGA 1QO5A 3SRHA 4F9DA 5G4WA 2Z1BA 4PR4A 3GXMA 3H2EA 1V93A 4QAWA 3HQNA 3GH5A 1F6YA 2J88A 4IPIA 2ALDA 4UCFA 3HB9A 4GPNA 3P0WA 5BOOA 5BCAA 3TZNA 2VX7A 1E6XM 3W81A 3IJ9A 3HJEA 3L4UA 1CLKA 5FJUA 3N19B 4NRSA 3OVGA 1BHGA 3T4CA 1K7XA 3TSDA 5CKSA 4L56A 4GY1A 2YCIX 1GVYA 2VUYA 4KCWA 4JR5A 2OLAA 1F3EA 3A5FA 3F4DA 1G4PA 2DSWA 4NUWA 5ABHA 3LM7A 1EA0A 1J18A 1REQB 4Q8MA 4J1OA 4O16A 3C3NA 3TYDA 1IZCA 4E4UA 2ONEA 1ZP4A 3KRZA 4L80A 4IPJA 3UJEA 1Z41A 3DXIA 3IIXA 1TUFA 3LBMA 1HGWA 4N4PA 4CQDA 3R0DA 4NAFA 3BGJA 1XHGA 5HMFA 3VFLA 2B4GA 1V3KA 4MJ2A 3M9YA 3TUUA 4UR9A 4ZSTA 1JQXA 1VJSA 1KM5A 3APTA 4A3HA 1Q8JA 2WC3A 2Z1SA 5EMKA 3W7DA 4DXKA 2VL4A 4WSJA 2XINA 2FFIA 3IJ8A 1D7FA 1JRBA 1Z8AA 2BVWA 4O8RA 1ZY9A 4BWLA 4C6QA 1I60A 3MANA 3IK2A 2I9UA 2EPOA 3F03K 2J62A 4IQEA 1FWWA 1PAMA 1XD0A 1RALA 4XZMX 4MIMA 2CLKA 4M6QA 4V1XA 3GQYA 2I5IA 2UY4A 1H3GA 7PTDA 1SJCA 3CT2A 1FXPA 4JNMA 4XK2A 5DCEA 1RHCA 5EBAA 5EB8A 1EWEA 2GPTA 4W8LA 3BICA 5ABEA 4W7UA 3FGCA 3TN3A 3UG4A 4W7VA 2BOFX 3QHNA 6REQA 2PDQA 1BAGA 4PSPA 4B5XA 4DPQA 2FHFA 2V2HA 1D3GA 4H04A 3R0UA 3M0LA 1JI2A 5I3FA 2UV8G 3DCPA 3AWNA 1MXGA 3TK7A 4JX4A 4PUKA 4PN2A 1EDTA 1RCOB 2C15A 2VEFA 2DORA 3HQ1A 3UZZA 1TX2A 4ZOBA 3B3DA 2E9LA 2F7FA 5BXPA 1ZL1A 4H19A 3ITVA 3LXBA 3LD5A 3WLIA 1GVFA 4MNMA 1UHVA 4GQBA 4WLCA 3Q37A 4NILA 4LPCA 4CKQA 3USZA 1N8WA 4E8DA 3ALGA 2TODA 1D8WA 5C2GA 4W93A 3BVJA 5HPCA 3BJFA 3VGGA 3PBWA 5KSWA 3LEPA 1Q4WA 2YDAA 2D0FA 4JAWA 1OQFA 4Q7BA 4AYSA 5A8PA 1DE6A 4C65A 1G6CA 1W1YA 3ZS4A 1K9EA 1RK5A 3RX2A 4JIPA 2E77A 3TJ4A 4Q8PA 4JTQA 4JTSA 3N4EA 1XCFA 3N2CA 5TF0A 3A12A 4JL2A 2WLYA 1LF1A 2DH3A 3N4AA 2D22A 1ZQ5A 1CLXA 4LOCA 3OZMA 3GYCA 2OG9A 4X9YA 5C9UA 3BLFA 3CH0A 3PVFA 3N6QA 4HP5A 4DJDC 1EFZA 1PSCA 1VCGA 4NXSA 5D4YA 3WF2A 2P3ZA 3NPUA 5TD4A 7TAAA 2Y89A 5BRQA 1E6QM 4HU0A 2WNQA 4D6DA 3N2MA 1NQ6A 2E7FA 2YA0A 4S23A 5KZEA 2A6NA 3KL5A 2C13A 1G5AA 1EGVA 4Y9AA 5XIMA 2IPFA 3VDBA 3GG7A 2CLLA 3GZ3A 4QE4A 1R3YA 2BDQA 5E9AA 3KOXA 3N4FA 1SR9A 1HO4A 1B30A 3W28A 1P7TB 2OJPA 4DJEA 1C29A 4GBDA 1ITXA 2E6FA 3S1VA 3EA3A 3UXKA 8XIMA 4UTUA 2QMKA 1Q13A 3G1VA 3EXTA 1MVYA 3CTLA 1A3HA 3VOJA 5C2CA 3HMJG 4CGTA 1ZB5A 1QI0A 5HR6A 3G1XA 2CESA 2CITA 4MHBA 1S46A 4I7VA 1IT0A 3UT0A 3ID7A 4RNFA 3IJ6A 3DBNA 4C6PA 4GUHA 4N9CA 4AIUA 2YL5A 1DOSA 3LRMA 1K70A 3ZT6A 2DSKA 3PWAA 1M53A 3M5YA 1BQGA 4E8GA 4IFOA 1RCQA 4HT3A 4DJFD 5FIPA 5C9XA 3PZGA 3LENA 4GY0A 3MJMA 3MVIA 1A5BA 1V6VA 3PWGA