3FA4A

Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, triclinic crystal form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
291
structure length
284
Chain Sequence
PMVTAATSLRRALENPDSFIVAPGVYDGLSARVALSAGFDALYMTGAGTAASVHGQADLGICTLNDMRANAEMISNISPSTPVIADADTGYGGPIMVARTTEQYSRSGVAAFHIEDQVQTGKILVDTDTYVTRIRAAVQARQRIGSDIVVIARTDSLQTHGYEESVARLRAARDAGADVGFLEGITSREMARQVIQDLAGWPLLLNMVEHGATPSISAAEAKEMGFRIIIFPFAALGPAVAAMREAMEKLKRDGIPGLDKEMTPQMLFRVCGLDESMKVDAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3-dimethylmalate lyase
publication title Structure and function of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Lyase
total genus 100
structure length 284
sequence length 291
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.32: 2,3-dimethylmalate lyase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 3fa4A00
1Z6KA 3PP7A 1JDEA 3QTGA 4TV6A 1OQFA 4JPGA 4B5UA 2V5KA 3GG8A 4HYWA 4MF4A 3EOEA 3E0WA 4QG6A 4QG8A 3FA4A 1DXEA 2DIKA 1F8IA 1S2WA 5TAOA 1F61A 3BJFA 3T0TA 1S2TA 2VWSA 4IQDA 3I4EA 3QZ6A 3LG3A 1F8MA 4YJ5A 1VBGA 2HRWA 1S2UA 3KHDA 2QIWA 2ZE3A 3T07A 3QV9A 1XG3A 1GGOA 3SRFA 5JVLA 4WJ8A 2XZ7A 3GQYA 3IS4A 4G1NA 2VGBA 1O66A 2HROA 1E0TA 1IZCA 1DIKA 1MUMA 1U5VA 4L80A 2G50A 1PKNA 3H6OA 4L7ZA 4TV5A 2WQDA 3M0JA 3MA8A 1M3UA 1O5QA 3QV8A 3B8IA 4FXFA 1F3XA 1E0UA 1F3WA 3E0VA 4B5XA 4QG9A 3VAVA 3QV6A 3ME3A 1A3XA 2VGIA 3R4IA 4FXJA 3QQWA 1AQFA 1O68A 3P0XA 1A3WA 4QGCA 4ROQA 1SGJA 1PKLA 1DQUA 4KCTA 3FA3A 1S2VA 4RPPA 3SRHA 4B2DA 4L9YA 2DUAA 3HQOA 3G2GA 2KX9A 4LSBA 3EZ4A 3U2ZA 2XZ9A 4B2DD 2V5JA 1M1BA 4B5TA 2XDFA 2OLSA 3HQNA 3OQ8A 4IMAA 4IP7A 4KCUA 1PKMA 3T05A 3SRDA 4KRZA 4KCWA 1ZLPA 2VWTA 1PKYA 3GR4A 2X0SA 1ZJHA 3M0KA 1XG4A 2VGGA 3E5BA 4L9ZA 3BJTA 3KTXA 3N25A 2VGFA 1DXFA 4IQEA 4DRSA 3EOOA 4KS0A 3SRKA 3OYXA 1U5HA 2HWGA 3QV7A 4MG4A 2R82A 3OYZA 3HQPA 4HYVA 2HJPA 3PUGA 4YNGA 4B5SA 1A5UA 2BG5A 1KC7A 4B5VA 1VBHA 3LYEA 4B5WA 4KCVA 3EOLA 1T5AA 1PYMA 2E28A 2L5HA 1OY0A 1UJQA 1A49A 3QLLA 1IGWA 1KBLA
chains in the Genus database with same CATH superfamily
4JFSA 1ICQA 4Z1DA 4DXKA 4JD4A 5JIPA 2I1OA 4QJ3B 3CHEA 3W9ZA 3OBAA 2D69A 3RO8A 3GM8A 2W79A 4PODA 2ANUA 7ENLA 1ITXA 2VL4A 1S1PA 1WA3A 3SADA 2A7NA 1FTXA 3MUAA 2RHGA 4F40A 3WQPA 1NDZA 2GVGA 1DEDA 3OHIA 4N9BA 4QBXA 4XZWA 3TQ0A 3WK2A 3ZVIA 5C2XA 1NFGA 3S2MA 2QNEA 1UD3A 1L6WA 1WZKA 1UP0A 4JY9A 1P0BA 4RNIA 1WZLA 1HJVA 4ZGYA 4ADSA 3HMCA 3FS2A 1ODZA 2XSBA 4NIRA 2Z1BA 4HSOA 2HXTA 2ZXQA 4XAGA 1PZ2A 3URQA 3WEMA 3OG3A 4CQ9A 2PE4A 2FHFA 4ERGA 3W7CA 1JUKA 1OYAA 3VILA 4G5DA 4J3ZA 5DO8A 4E2VA 4V1YA 5M5DA 3DU0A 3HGRA 4GUIA 3ITYA 1QHZA 1CXIA 1ICSA 4RXGA 5IDZA 1MDLA 4NF7A 3INPA 1JGMA 2GJPA 2QYGA 4L1GA 3UY7A 2ISSA 1ZAJA 3MVTA 1E4LA 5LA2A 4H6QA 1KFJA 1OCBA 3CAQA 2V5BA 2WO5A 2ZCGA 3T7VA 1XPYA 2PGRA 1RLCL 1KBKA 3WENA 1H60A 4BEUA 1S2UA 3CYJA 1R3TA 2E25A 2QVNA 3FOKA 4PCNA 1CW2A 5G4HC 4O0QA 2CETA 1C92A 5FJTA 2X0HA 1HL8A 1UKPA 4MLRA 4ZBCA 4QNWA 3WZ0E 1EJXC 4L4PA 1LG1A 2QT3A 4EPBC 3PFMA 1JZ4A 3GHRA 2J7EA 4KWSA 4GJIA 5BOOA 1E9IA 4C6OA 4F0SA 1ZU8A 4M82A 3SSZA 4JNYA 1ZBKA 4MKNA 1OFQA 1KFWA 3KBNA 2E5BA 5A69A 2WMIA 3AS3A 1FH7A 2OYMA 4EPKA 3BPWA 3QSTA 4H01A 1EWEA 1IWBA 4W5UA 1CGUA 2XVLA 4H83A 3TYDA 1J0ZA 1ISWA 1CWYA 2WKLA 3C0QA 3HFYA 5F7UA 5H8PA 4LCRA 1KR1A 2WXDM 4LGXA 4AZ5A 4LEQA 1CCWB 1XINA 2AMXA 1XKJA 4RNJA 4CU8A 1PXGA 3FXGA 1JDEA 1Y0EA 4Y9MA 4PH6A 3U57A 1LUCA 1BYDA 1OX6A 1U1HA 3HG5A 2CFFA 2IQDA 4D1IA 2D20A 3U48A 1M68A 3B04A 3PK7A 1ISXA 1XLJA 1X39A 3QV9A 1JCJA 2B31A 2QJIA 2NX9A 4LAMA 1GQIA 5A2CA 3ZR5A 4PTWA 1M01A 1NF7A 4JKKA 2GUBA 3Q45A 5A8PA 1FRBA 2FQIA 1F74A 1A5BA 4L5ZA 3BMXA 1X7IA 3XISA 4NZCA 3R2GA 1I2PA 5D9PA 4AHQA 1NWRA 1AZ2A 3ME3A 2XG9A 3W7JA 2YJQA 3LNPA 2DEPA 3UNTA 2WBGA 4ZO9A 1CXHA 3DFYA 3PBUA 1W56A 1XFCA 1MW0A 2ZZ3A 4GBUA 1K4GA 1DL3A 3WQ4A 2YYTA 4XD3A 2PMQA 9XIMA 4EACA 1TA3A 2Z27A 1ZQ5A 4K6AA 4S23A 4I6VA 1YYAA 3N9SA 1FQ0A 2KAUC 3G1FA 2CZ5A 1VPXA 5DXXA 1UWQA 3AJXA 4PMDA 4AD5A 3V3WA 3W1RA 3L0GA 1E0VA 1EGVA 3RCMA 2Z25A 2VEGA 4JR5A 4GIYA 2XSXA 2GJRA 1NFBA 4HU0A 1PX4A 4Z2LA 8A3HA 3DBNA 1V3JA 4LVBA 1V93A 1W3IA 2JBMA 3UPMA 5I02A 5DMNA 5DFAA 3BDKA 3E49A 4IH3A 1QK2A 2OEKA 4PBFA 1R3QA 3EOEA 2BVWA 5FJPA 1F8IA 2DIJA 2GPTA 3TSBA 1G9HA 4DF0A 1F8MA 4IPLA 4RL3A 3FYPA 2PI6A 4F0KA 1HGYA 3EB2A 3TW7A 4DI8A 4EAYA 1O66A 1IXQA 3TYAA 3I7SA 1W1A1 4LAKA 1W9PA 4GXWA 2YCLB 2PBGA 1SZEA 1ZRQA 3R13A 4H6RA 5I06A 4J1OA 3VNIA 2QJGA 1J8VA 1W2PA 3P0WA 4AWTA 2R1KA 4EXQA 3B8VA 3VE9A 3QJAA 2E9LA 3SQMA 4B3ZA 3WEZA 1VENA 1YE4A 3ZLFA 4UTUA 4DWSA 5AFDA 5BOEA 5HWJA 1V0KA 2OLSA 3RUBL 1Z8AA 2A3BA 2A1YA 4TX8A 4YTRA 5EMUA 1EIXA 4AY8A 1IT8A 3PFRA 5FEZA 1J01A 3MSYA 3WMLA 2E09A 3GFZA 4O10A 3S1VA 2D0GA 4JQAA 5FCZA 4ML9A 3F2DA 3ECQA 3HB9A 3ZJ8A 3B0PA 1W9DM 3UCCA 3EOLA 2H9AA 2O92A 1KFCA 1VLIA 4DBWA 2VXNA 4Y7EA 5HNNA 3VTRA 4AIUA 1YEYA 3QLLA 1QNOA 2RAGA 4PCPA 4GY0A 3VZZA 4QCFA 4RZ4A 5AC7A 4C6FA 1LF1A 4BQ3A 2GUYA 1UD5A 1JCXA 2OCZA 3NM3A 2GYIA 3ARXA 2A7RA 1Z3NA 3TN5A 3PANA 4JFVA 1V0MA 2OZ3A 2XFFA 4PB4A 5LA1A 5BYWA 3VIIA 3OEXA 4O15A 1YNYA 3VINA 1F2JA 1WYIA 1VPYA 1J5TA 3FAXA 2PS2A 4NU7A 2YA0A 4FOUA 1A0DA 2J6VA 3THAA 3V5OA 3UWZA 3WH7A 3FX4A 4H9ZA 1HUVA 1EP1A 2VD8A 3VIGA 3SI9A 1E0UA 1XFBA 3BW3A 3SSJA 3A5VA 1Q6FA 4QCEA 4FNRA 3GH4A 3NO1A 2HISA 4B2DA 4Q8QA 1B4EA 4HMEA 4LTSA 3I4KA 2PTDA 3KP0A 3NQ2A 1BD0A 2EAWA 4ZVJA 2WJFA 2D3LA 4KCWA 4H9TA 3HURA 3ARTA 2BDQA 1MQPA 1K3UA 1S5WA 2YBTA 1V8EA 4HHMA 2Y85A 1V77A 4H7CA 1FHDA 1P0DA 4GIEA 4N9DA 1YW1A 4A35A 1CI1A 5C2GA 2ZYFA 2YB4A 3SCRA 4O0ZA 1S46A 3O0KA 3ANYA 1JDCA 5FKYA 3LX9A 1A49A 3II1A 4GYJA 4MWAD 4HYRA 3ZZ1A 1XDJA 4IJRA 3HV8A 1C8QA 1V79A 3B0YA 3OLIA 1FVPA 3PZQA 3T0TA 4OKDA 4IQDA 5DXYA 4Q8TA 3WLPA 2VYOA 9CGTA 1FWEC 4MUZA 2BXZA 1VH7A 3A3HA 1XH1A 1E1CB 1VBJA 2RDTA 5G1MA 3W1TA 2GQ9A 3GVWA 1H49A 2BODX 6REQB 2OGYA 3GKFA 3GTHA 2J74A 1F3XA 3MB9A 1WOAA 3MKCA 5JBFA 4P7LA 3ZM8A 3SO7A 4RDWA 1JFXA 2BVDA 3NQDA 3KUMA 4ROPA 1DIEA 1AH4A 4XAFA 2GJLA 1XC6A 4DF2A 2C1HA 2EHHA 5I3JA 5BW6A 3BOXA 4Q8UA 4IMAA 2E4TA 3KTSA 1PO9A 4D9PA 4ADUA 3GLCA 2IXVA 1PWMA 5HATA 1AD4A 2C1IA 1CGVA 4MKVA 1UA7A 3SY5A 1TYGA 3KP1A 4QDWA 3LZ3A 3QFWA 3R12A 2OYKA 1OZMA 4P7QA 4IG2B 3E1F1 3KTCA 4GCAA 3CWOX 1Y7VA 3GG7A 3UJSA 3ZIZA 3TMLA 4LQ1A 2UY2A 5IHRA 3LN3A 2E5CA 2FPVA 1T40A 2XIOA 1N8FA 3LY0A 3M5VA 3WQVA 4XG1A 4BR1A 1A5NC 2HVNA 5I0DA 5J5RA 2QIWA 2D22A 1XG3A 2C8NA 1SO3A 3DHDA 4K8HA 1Q66A 5BXSA 3N04A 4AB4A 2WHJA 1GOMA 1V03A 4US5D 5KZEA 4NILA 2XINA 3P8JA 3VAVA 3SCWA 2X2YA 4M6PA 1BWKA 3ZR6A 1TWIA 1JCLA 4FR1A 3VDCA 1UH3A 3WBWA 2YBVA 4MYXA 4PMRA 2Q02A 4LUTB 4H2HA 3AISA 1SJAA 4LY8A 2DUXA 2VFIA 4PCFA 2CZVA 2ZUUA 2DJLA 1E6QM 4KIEA 4AAJA 3VCNA 4WSHA 5GNZA 4AMCA 4HCLA 5CPTA 3NXLA 3CZ8A 2WZHA 2GZXA 3BSMA 1GUVA 3RLGA 2MUCA 4O1EA 4JEQA 3EOUA 2GK1B 3C56A 4MNMA 2PDYA 2VI0A 5EMJA 2OODA 2ZUWA 4GXMA 4V15A 4NX5A 3OB8A 3C61A 3D46A 4IZGA 4U2ZA 3WLTA 1UQYA 3BW4A 3GUWA 3PHAA 5FOOA 5AYZA 1SO6A 3CS2A 1MDRA 1OQFA 4D8AA 3S2NA 4QLKA 4FNQA 3VIMA 3WNOA 4E2DA 2PSNA 1MWOA 3G8EA 3V5CA 1KRMA 2Z2BA 3E3HA 4IMFA 3VKCA 2GDVA 2WVSA 4BHYA 4YTTA 1AK5A 1E6XM 1KNWA 3FVDA 2NV2A 1DIKA 1N8WA 3KOYA 4M6VA 1OFAA 2GJXB 1GZ1A 2ON3A 5K4ZA 4HP5A 1HKIA 2PDHA 3EYPA 3W53A 1US0A 2MANA 3AS1A 1SFTA 5LA0A 5E0FA 1Y5XA 3W38A 1REQA 2J9YA 3WDHA 1TV5A 4OT7A 1I2RA 3KCLA 3T81A 3AHTA 4B90A 5HMDA 1OEPA 4C5ZA 1L2UA 2JQXA 4UFHA 2O4MA 4GWEA 3MSDA 1A5CA 4GA8A 1RLDA 4RDVA 4W86A 1TTIA 4XO7A 3MHFA 1J6PA 2YB1A 2C18A 3W23A 1ZB5A 5CXPA 2WCAA 1DWHM 3GW0A 2YCKX 4R34A 1GOXA 4X3ZA 4IIEA 2QCDB 2PGWA 3BGGA 3GRIA 4GQQA 1AQMA 3P82A 4MDPA 3ICJA 2UY3A 3KDNA 4B5SA 3HIJA 2ZZ7A 3NOYA 2G3MA 4GI4A 3ZSSA 3ES8A 3F5JA 4JIQA 3OTRA 3IIZA 2VMFA 5FF7A 4A3QA 1LBLA 1LWHA 3RHGA 1AQ0A 2QHAA 4BKNA 4HMDA 1DWAM 2V3DA 4DM1A 3EX4A 1T96A 1DJNA 1EYWA 1E0XA 1ADDA 2BX7A 3CNYA 2TSYA 1BRLA 3LG3A 2JE8A 4MAZA 2ZZ6A 4XZIA 1YTEA 3RITA 2A2IA 2EEXA 2XZ7A 2J27A 3E38A 4KRUA 3CV7A 2G96A 1IWAA 2DUZA 4O1FA 2CKSA 3WQOA 5I5RA 1OFDA 2CLKA 3H4GA 4UZUA 2SFPA 3E0VA 4F0MA 3LHTA 3STPA 2W5FA 1EJTC 3U3HA 4WGXA 5HR6A 2WHKA 5FEXA 3A4JA 1SJBA 2UWFA 1L6GA 2FJKA 5AVNA 3NQFA 2QKFA 3AFBA 1KLZA 3T42A 1GVSA 1K9FA 8XIMA 2XVGA 3XINA 2X09A 1QPKA 1X6LA 3H2CA 2CLLA 3U0HA 2QDDA 3E5PA 3LTPA 4LVGA 3NAVA 1F9CA 2E7FA 3C5QA 5D37A 4LW7A 3PZVA 2I7GA 2VFEA 4UWMA 3QOMA 4DJDC 1QJWA 3DERA 3TIMA 4A05A 4OIFA 1VJIA 2CITA 1H5VA 2WCSA 2J79A 1BVNP 2V0TA 3A3WA 3GU2A 2YXXA 4C6LA 2H8XA 1E70M 3W26A 2YXOA 1MEIA 1EC9A 2G37A 4ONVA 4ECLA 4ZOBA 1JPKA 1PJ9A 4PUKA 4GVIA 3APYA 2DT1A 3QR3A 2Q71A 4Q6XA 3ANVA 4U33A 1QBAA 1CB7B 4UQEA 3MU7A 4DXXA 3N2XA 2TYSA 4WRHA 4LF2A 4NKCA 4OGZA 4PN2A 2HROA 4DJFC 1B31A 1KA9F 3GR7A 5ABFB 4S2CA 4XQ6A 3CLMA 3ZXWA 1V6XA 5HNTA 1XF0A 2PURA 2C0AA 3GNNA 5FF3A 4YTSA 1DHKA 1L9WA 4N0RA 1IT0A 4XK2A 3IRDA 5BRQA 2AQOA 5DRIA 3RX2A 1VPQA 1EX5A 1AL8A 3HPFA 4HHPA 3BG3A 2PCQA 4NY2A 3UESA 3W7NA 4RDZA 4FF7A 1L0PA 4X63A 4JQ2A 1YADA 4WY0A 1F6YA 1W3JA 3QR0A 4PC8A 2XVKA 4C6DA 1AD1A 1HJQA 3IJLA 2QUNA 4O1CA 3G1HA 3GC2A 1X6NA 1ME7A 1EO7A 3SGGA 1P43A 3QHNA 2NUYA 2A3EA 4H9YA 2R9RA 5KITA 2VNCA 3OOQA 3AUJA 3BLKA 1P0NA 4D71A 3FYOA 3W76A 4ATDA 3ZVHA 4CD6A 1CLVA 3QGVA 1Z48A 3MDWA 3LK6A 3W27A 1KCKA 1R46A 3AIVA 1UUOA 3KOXA 1TKKA 1W9BM 4DJFD 4MB5A 4RK8A 3NZRA 5D32A 4E2OA 3GDKA 3GXIA 4J40A 1ITQA 4K68A 4CQ8A 2WSKA 3WLLA 3LMZA 1TPB1 3AMGA 1I1WA 1R7AA 4XZHA 4A29A 1KCLA 2XPKA 1FXPA 1X96A 4Q6JA 3M16A 4UTTA 3WLRA 9RUBA 1OWQA 2YL9A 1IXOA 1TJ2A 4GQRA 1WOBA 3M44A 3F2CA 2OJPA 2VFGA 2ZUTA 3BG9A 1L6FA 5FA5A 4RUBA 2QJNA 4AHPA 4TX6A 3LD5A 1KM6A 3F7JA 4Q4QA 3F5KA 3N25A 1IE7C 5B80A 1DXFA 1GQNA 1BG4A 3AAMA 1VFOA 5J8LA 1RXOB 4O57A 2WVTA 5ABHA 3CYVA 4C60A 1US2A 5HQEA 4P5UA 1T5AA 1LQAA 3P8IA 3DAQA 4FI4A 5EMMA 3WH6A 5BNKA 3WD0A 2WMGA 1RQEA 1UWTA 4W8LA 4X2RA 4PUUA 3EEGA 2AL1A 4HYWA 3UBPC 3MVIA 4GIAA 5BU9A 1LZOA 1BSIA 1R3VA 2AQVA 2V5CA 2V68A 5FF2A 4W8BA 4AG0A 4HQVA 1UASA 1W3LA 3CBWA 4W4QA 1VR6A 1XIIA 2IW0A 2ADAA 1EP3A 3P67A 6ALDA 2DZPA 3S5YA 3MJYA 3NDZA 3MS8A 2WSQA 2FPYA 4MNLA 4WR3A 2BOEX 3CQIA 4JTFA 2W6RA 1WUFA 2C71A 4FEZA 2PA6A 2O7SA 1M7PA 2G3JA 3PM6A 1PKLA 2JKEA 3EA3A 3MV11 4P7OA 1EJWC 3W02A 3TXVA 3EZ4A 4NJKA 4LRSA 3W29A 5CPLA 4S1FA 4WOQA 1H41A 4QJ4B 1NQKA 1YTDA 3VIHA 2REQA 1HKWA 4WD0A 1RD6A 2OLAA 5D33A 1RA0A 1VYSX 4A8RA 3AIQA 4BF7A 4ERIA 4G6CA 1UD4A 4GINA 2HQAA 3AMKA 3M0YA 1O94A 3IGSA 1I1XA 2G3NA 1U22A 5FSEC 2OEJA 4XZ9A 1DJYA 4KCVA 4L65A 4DO6A 1XL9A 3UW6A 2FB2A 4ASTA 1K70A 4J2MA 1H4PA 3RU8X 1VHCA 3N4EA 3B0XA 3ZJ7A 3HV9A 2JALA 3DZ1A 4QS6A 4JTRA 3KLLA 4R33A 3VOGA 3QC3A 5CZTA 2QIIA 2XVNA 5HINA 4QITA 4Q4MA 5D30A 3S5NA 3UZJA 5FIPA 1EEPA 1DJWA 1I2NA 1UZHA 1U2YA 3WMCA 1QOPA 2CYGA 3UWEA 1E71M 2A6NA 4NSBA 3OZMA 5IBXA 3O0FA 1R2TA 5BRPA 2QQ6A 4GQBA 3L67A 3WN6A 1KO0A 5CSYA 3UA4A 1CXKA 4LRTA 4QLLA 3GW3A 2QMKA 1GORA 1NDYA 2OSXA 3MKVA 3SRDA 4AC7C 4M7TA 2FMNA 4TTGA 4I5RA 3VKAA 4W87A 3FEMA 4B3LA 2NQ5A 1OC5A 5PTDA 4QE4A 3W1UA 2PDJA 4ZSTA 1AJ2A 4HMNA 2J7FA 1FX6A 4QM1A 5CCZA 4RE0A 2B0MA 2ZZ1A 4AH7A 1S5NA 2P0OA 3E0IA 2OU4A 4EKJA 1RVKA 4GNJA 4ES4A 3VD5A 3CZJA 3PTDA 3MBDA 3LBCA 1LRNA 4A22A 4M6QA 3CPGA 4O0KA 3MSGA 3H12A 5TAOA 1Q65A 1QWGA 3F5LA 2BVTA 1YRRA 4RZ5A 3QQ1A 3QQ0A 3L68A 3FDGA 2YW3A 3GIPA 1RD5A 2DGAA 1PCKA 1XLDA 2PTZA 1KXVA 2W67A 1IZCA 4X0VA 4GH1A 3S1UA 3OGVA 1ML1A 1K03A 1R5YA 1FWBC 3CPUA 2XHYA 5EPDA 4YL2A 5CLTA 1N2VA 3GU9A 3W37A 4YCPA 2H3DA 4XSLA 1JUBA 1TO3A 1RV8A 2VD9A 1WDSA 2X16A 1OF8A 3TQVA 1XGEA 1D3GA 1B3VA 5G1YA 2E8ZA 3EB3A 3L7RA 1QNSA 2H8ZA 5JXQA 3DC8A 1RQBA 4S3JA 3KX6A 2QF7A 2W63A 1UZ4A 2GVLA 5EFFA 4P7NA 3IUHA 3LPOA 4OHQA 4GFIA 3K13A 3PVFA 2C13A 2B4GA 5H6HA 3EWXA 4LUSB 6XIMA 3FAWA 3G3MA 4XBSA 1JZ8A 4FLRA 2HS8A 3H4XA 3UZWA 1W3NA 4FX8A 2YDSA 4OOUA 1KXTA 2I5QA 2VKZG 3CIWA 5AN7A 3LYEA 2PDPA 4PRRA 2RUSA 4J3XA 2Q6ZA 4UTLA 5ABEA 1D2KA 4I8YA 1S1RA 3GZAA 3MWCA 1UWUA 1XS2A 4REQA 3GDMA 3UR5A 1IYXA 3GS6A 1CPUA 3GVGA 1A3HA 1GK8A 4JTTA 5DMMA 3N11A 3GKAA 4GHRA 4YJ5A 1DTNA 3SY8A 3ERPA 4AC1X 3NQ7A 4HU4A 3PG8A 4M81A 5D03A 5D2VA 1E73M 1JQXA 4S38A 5D9MA 3UA3A 1AA1B 2I56A 1LL6A 3BLFA 1GOOA 5I78A 5E5CA 3LHUA 1SSDA 1MNZA 2FJUB 2NX1A 3BV7A 3PSWA 2VEFA 2VDIA 4Q4RA 4R7JA 1XBZA 3VGFA 3IAQA 1NF0A 1IEQA 5CJNA 1V5XA 3ZLHA 4A3HA 4KFPA 1V08A 3LA4A 1TMQA 2FZNA 1DJIA 1N55A 5BRBA 2I17A 1D3HA 1KR0A 4IIFA 1UCWA 3OBKA 4UTKA 1K02A 2I9EA 2ABBA 4JIIX 4B92A 4UFJA 4MNJA 4LX4A 4CEUC 3WD3A 2WKJA 4R3UA 4H9VA 1DJZA 2A3HA 1Z41A 2AMGA 3GXDA 1TQJA 3QPEA 5D2XA 4C65A 4AIBA 2ZRUA 3PUGA 1B90A 3VABA 4N7QA 1TPH1 4NXKA 4PUEA 3RGTA 1QASA 3TAOA 5D02A 4WVXA 4HT3A 4FS9A 1BAGA 4GPNA 4MPQA 3VA8A 5C7VA 2WM0A 2P88A 1XYZA 5TNVA 3DHPA 1LP6A 3BE7A 1UR2A 5DEZA 1GQJA 2YZ5A 3RPMA 3G1RA 1ICPA 2DT2A 4FF5A 5DT5A 1QW8A 3GHTA 4JTCA 2IPFA 1B3XA 4ZTXA 4LBSA 1WKDA 3R0UA 4JOMA 3UG5A 3RRXA 4BWLA 3GC4A 3PAOA 1W1TA 3TSMA 2DZUA 4PL1A 3W2LA 3E2RA 4JEJA 5JBEA 3REQA 4TVDA 1TWDA 1RPKA 1U33A 3M6YA 5LHEA 3I65A 4IQLA 3B8IA 1ZL1A 1LT7A 3GD6A 3OJGA 2WJZA 1W32A 4DBUA 1VFMA 3Q58A 3DUGA 4LAUA 3S83A 1VD6A 1TE1A 1KGUA 2PFHA 3VYLA 3QC0A 2V9DA 5F4WA 2DZAA 4IP7A 3PBMA 5LGXA 2A79A 4PULA 4A4AA 1B2YA 1P0EA 3MUIA 1ZCOA 1VB9A 4F48A 4TX9A 2NUXA 3N15A 1O1ZA 5HJXA 4GQGA 2YXGA 4O54A 4NX0A 1U1JA 4HZ8A 3URBA 3M0XA 3WQ6A 2DH2A 3CASA 1I60A 1KBLA 3QTGA 3UETA 2GL5A 3QZAA 1NH6A 2GSEA 1HN1A 3BAYA 1CGTA 2OG9A 5HUOA 4X0NA 3LB0A 3G1AA 1G7VA 3L2IA 1KLYA 3TTEA 3O06A 3EEZA 1FBAA 2GVYA 2DIEA 1G7UA 1RA5A 2DPEA 3NDYA 3K1DA 2NSXA 4G1NA 4H1ZA 3WQCA 5E0KA 3E6EA 2BXYA 1KRAC 3R8HA 2HE5A 4GUGA 5LIYX 4AEEA 4BQ5A 1ZALA 2QR6A 3IIXA 1TMLA 2POTA 4ZB0A 4CQCA 5AHMA 1VEOA 2IKIA 5BXRA 3PJUA 1XCXA 3T44A 2Z4GA 1EZWA 3MI6A 3RLHA 4Q8OA 3VNDA 3GVVA 3TV8A 1UMYA 2Q3RA 1E6NA 5BMXA 3CHFA 1LT8A 1H3GA 3ZFHA 4Z1AA 3AWNA 3W74A 4DWSC 1VRXA 2PWEA 3M46A 1DQXA 3MMUA 3EWBX 1NOUA 1AJ0A 1J79A 3G77A 2ZX5A 4FMVA 3V0TA 1E9ZB 3URAA 3OLGA 3LSCA 3N6JA 3QGKC 3W00A 3RDKA 3F1QA 1OX5A 4MNKA 2ABAA 3DHFA 1HF6A 4GYKA 2WZTA 3DHUA 3ZLGA 2VRQA 3I3DA 3HJEA 3TQKA 3W71A 3I4EA 2WNNA 3THDA 3NGJA 4XZMX 2NSOA 3S42A 1OCNA 5KEZA 4DPPA 4ACZB 1X1NA 2XN0A 1RCQA 4XKMA 4P2VA 3C8NA 2XGIA 3VIKA 1J2WA 1IEWA 3RNDA 1OX4B 2AGKA 4R88A 2W9MA 1WBJA 3KBWA 1TJRA 5HWNA 2VEPA 3CO4A 2E6YA 2V67A 4NZFA 5I07A 4XTDA 2G4FA 1ECQA 4IL2A 4I7UA 1R85A 4RPPA 2VUNA 1GVEA 3HGJA 1QT1A 1UROA 1DQWA 2VJXA 3WF2A 3N3MA 5CZKA 5HQMA 3KL3A 5D8WA 4IGHA 3GUGA 4MWAA 4QDPA 4ZA0A 3CUJA 3GXPA 2HSAA 3B9EA 3OO2A 4WY0F 4IXXA 3VKBA 4DN1A 3DG7A 2XUCA 3EMCA 3RCYA 4YS1A 1GNXA 4HGXA 3B03A 3KW3A 3VCRA 1FWDC 4HPJA 3WH9A 3DEQA 4KWUA 4JN8A 3S8HA 1PX8A 3ZWSA 2VELA 5AC6A 1EJRC 3TWAA 5LXXA 3H2OA 1S39A 1UKSA 4ZZ9A 4UNKA 2Y61A 3HA1A 4GJJA 2G95A 1R2SA 2CERA 1S2TA 3VCCA 2WC3A 2YFOA 2QCNA 3W7GA 3NPWA 3QPZA 3WNLA 3KWXA 1IEVA 2OVLA 5JMUA 4UCGA 3W7HA 3TJIA 4BA0A 2VCCA 1TSIA 3GVQA 3VC5A 1JCTA 4WJXA 3UVIA 3TUUA 4JNZA 1FWSA 3W2NA 1D8CA 3W70A 4QDMA 1ODUA 5TF0A 3SGZA 2R6OA 2O0TA 1FWTA 3GTFA 1UOZA 4GZEA 2OOFA 3T0DA 3JZUA 1SGJA 1Q45A 2FHCA 1W1ZA 4H7VA 3TROA 2CLPA 4I9AA 2CLMA 4M6UA 2AL2B 2A3CA 4B2DD 5BOFA 2WJDA 3FGCA 1MZRA 2PGFA 2ACRA 5A5WA 1GJPA 2XSAA 4CD8A 5K2ZA 3FCPA 3UYIA 3TC7A 5AHEA 3VOJA 3U5UA 4GC4A 3C52A 1PTGA 2BXVA 1JYXA 3DI1A 4HN8A 5G4WA 1RJPA 3SW6A 3WDPP 3FKRA 2GSHA 4ZQOA 3OQEA 2ZXDA 3WJSA 2XIBA 1VKFA 4UCFA 4L4MA 1TQXA 3IJQA 4XD5A 3DKLA 4ZO8A 2FMOA 1KKRA 3PWGA 1F05A 4TV6A 1QPRA 2XGBA 5CZJA 3LCIA 4JQ4A 2Y63A 1LOSA 2WYSA 1WZMA 4US5A 3QZ6A 4PUWA 4UNLA 1VBGA 1MEHA 3M41A 3MPGA 4CD7A 2CBVA 5D9NA 2PDMA 5FL0A 4Z2HA 1PB0A 4US6A 1Q6RA 1J0HA 2AAMA 1RUSA 4PB5A 4PMZA 5DLCA 5CSUA 2CESA 4L4LA 1EA9C 2X42A 1QOXA 3BWWA 1H7PA 1SZNA 1VFSA 2VDGA 3M0JA 2YGYA 3A21A 1AQHA 1W3TA 5E0CA 4IMDA 3TYCA 1TTQA 2J7HA 2EKGA 4FXJA 1UA3A 4EPEC 5L6UA 2VENA 3WNPA 3R11A 1LORA 1OFRA 2P8CA 2YA2A 5U7SA 1VGAA 3TA6A 4AF0B 1IEIA 1ESWA 3AUOA 3BANA 3NNTA 5TBOA 2OZ8A 3UXDA 2P10A 2R8WA 2WCGA 1PKMA 1S2AA 3B4YA 3C0SA 4YVXA 4V27A 3LLXA 5BMWA 3NQCA 5HWMA 5I09A 1KCZA 3PZNA 4J28A 1GKQA 3N3TA 2D2GA 2QDHA 3SRKA 4E3TA 4A3UA 5LNRA 1GOWA 3QV7A 4MG4A 1CEOA 5C2CA 3BZGA 4IFKA 4N2YA 3VIOA 1MQQA 5I03A 1XC4A 3NQVA 2DFAA 3VGHA 4HHHA 3G6LA 2L5HA 3W87A 2X05A 4HNNA 3PBGA 3IRSA 1DKWA 2FPTA 4BFAA 2ODOA 3H7UA 1GTEA 3N2CA 3NCOA 1BEUA 3EPOA 3WLHA 1YTKA 1SW7A 1UWAA 3UWUA 3H2FA 3ABOA 5D9OA 1FXQA 1VFLA 1VHNA 4A8IA 4BQ2A 1TWZA 3G6MA 1BVWA 4JYDA 4DO4A 1QK0A 3QPYA 1F76A 2INFA 1E43A 2GUUA 3K8KA 1A4MA 3KRSA 3HM7A 3D3AA 4XKYB 2F84A 3P5ZA 1XQLA 3LI0A 4NJJA 1M7JA 3L5LA 3LCLA 1DJHA 1O5XA 4UMCA 3G2GA 2XZ9A 2OT1A 4BJHA 5JIWA 4E4FA 3ZJKA 4W93A 4DZAA 4KRZA 2HNEA 1QI3A 3I7RA 5I77A 2G3FA 3E5BA 1IQ8A 2DZVA 3CWHA 5I23A 5TD4A 2XFWA 1YIXA 4WDXA 3CC1A 4GVHA 4ORIA 2OX4A 2RFGA 5D2TA 3UWYA 4Q33A 1ECEA 4WIWA 1DWJM 4I5UA 1AW2A 2J25A 4AD4A 1Q6DA 4UB9A 1J96A 5DMYA 4JCMA 1FWGC 5E70A 1XIEA 3ITTA 3WL1A 1HP5A 3L2LA 1TCMA 3DI0A 1Z6KA 1UB3A 1W1IE 4YMZA 4BF9A 1Z9AA 1ZBWA 2DZBA 4HOXA 1ISVA 1PCWA 1SZRA 3G3DA 4ZQRA 1DORA 2EPNA 3E2VA 3WMBA 1M53A 3T40A 1EZ2A 2J4GA 1LLZA 3MUZ1 4XBKA 1SR0A 1J9YA 2NV1A 3WQ8A 1F3EA 1QWKA 4J2PA 1B30A 2GVEA 2QXWA 5GPRA 1BWVA 1K1DA 4A3RA 1EQPA 1W1VA 3NEHA 1JZ3A 4ML4A 1NFPA 5LXEA 3QV6A 1XD0A 3OZPA 3DFPA 5DBUA 1NWTA 1FWCC 1H62A 3IJ7A 4C7GA 5JH1A 3CUFA 1R3SA 3O07A 7TAAA 1QUMA 4M1RA 3NGFA 2EPKX 4GGBA 3CMJA 1F3TA 3MT1A 4Q8WA 1OGSA 1FWHC 2ZX6A 4E8CA 3MANA 2X0SA 5C70A 1ONWA 1RK6A 3IIOA 2VC5A 3EX6A 3EWDA 1GYLA 4DJED 3TW9A 4DX3A 4JX6A 1XICA 3L5MA 4IX2A 2BVYA 4H9XA 5MF5A 2X7WA 3GU1A 4Z2IA 4DZHA 1PYMA 2XN2A 2CBIA 1OY0A 4E0CA 5EBAA 2X0YA 2VX7A 4LBUA 3CZGA 1L8NA 3MYOA 1RPXA 1W5NA 1IXPA 2E6DA 3QY6A 3W28A 3G18A 3PJWA 3B9NA 1ITCA 1RBOB 4ZO6A 3VM7A 4K7VA 1WKYA 1V02A 4CU7A 3H24A 3FHAA 3UP8A 3PUDA 2A3LA 4UNIA 3SCQA 4IIHA 1ZFJA 1NDVA 4PUJA 1HJWA 2ZX8A 3P60A 3D5HA 5C6MA 4QISA 1KM4A 3W1QA 3SQLA 2VGIA 3WLIA 3OVPA 4BCEA 1R7OA 3RILA 3IJIA 3Q67A 4YWSA 4IWWA 3TYEA 4JDYA 2ZDSA 3M7WA 2PDFA 2Q8XA 2F61A 3K8MA 4DBSA 1TWWA 2I5GA 2UY5A 4JTIA 1WP6A 1CYGA 2V5DA 2CLEA 1J12A 1W37A 3PZMA 1P1XA 3PG9A 2ZWYA 1TZ9A 2P53A 2WMIB 3B97A 3UGRA 4YNGA 1SPQA 4TR9A 1GEQA 2YW4A 1XIMA 2ZTJA 4KETA 3WBYA 3TTOA 1FWWA 1KM1A 3AHYA 3DIPA 5ABTA 3T0CA 1PEZA 5LYRA 4TTUA 4WDTA 2F7FA 3GFYA 2YL8A 2NVAA 1B3OA 4XAYA 3QGAC 3H2AA 1X8FA 4KBXA 1TMHA 2VZOA 4GXPA 2WVVA 1GGOA 2Y8KA 4KIRA 1HKVA 3M5YA 5D09A 3RM4A 2P3ZA 4M19A 4A6GA 3IGUA 1FP8A 3RO6A 3VIJA 3LCWA 3ZSTA 2PEVA 3IV3A 2WW5A 3TU9A 3WY1A 5EBUA 3UEQA 3VU2A 3MP5A 5IM51 3MSRA 3WUEA 2Y4SA 2PLJA 2ISVA 2J66A 4GE8A 1HL2A 4UTTC 1E3XA 5KZDA 4H7ZA 3KWSA 5CZSA 3WMSA 1E72M 1JGIA 2GDQA 2XU2A 5DBTA 2FZ9A 4BF5A 3W85A 2ZOXA 4L4OA 3R79A 4HK7A 1SR9A 4W8AA 1TA3B 4MMWA 5A6AA 4QEHA 2NQHA 1VBHA 3THQA 3RX4A 1S5VA 5E9AA 2FTYA 3KCOA 1UZ1A 4HNCA 4W89A 2JFEX 1TIMA 1Y65A 3IWPA 4S3KA 3KHJA 3N2TA 4ZFCA 4GY1A 1VFFA 3WK0A 2C3ZA 4MB3A 3RU6A 4JYEA 2XTKA 1XIJA 2PCEA 1W1B1 2DP3A 4W7VA 2IPJA 3KHDA 3CT2A 5J04A 1BPLB 3WUGA 1IV8A 3GQYA 3IK2A 2GGIA 1MUMA 5LHFA 1YKWA 3FV9A 3ZT6A 3AMCA 2PU0A 3NTYA 4Z0JA 4A8NA 4GKLA 3IVTA 1DWIM 5H1WA 4OU1A 5AZ1A 3IARA 3V7PA 4XAPA 1KFKA 4O1BA 3W7QA 3NO3A 3EDKA 4O19A 3KFTA 3CH0A 1GT8A 4D6DA 1KFBA 1D7FA 2X40A 5CJ5A 4JDBA 4L64A 4CU6A 2VWTA 3AYRA 3Q94A 3BJTA 1LDCA 3GNRA 3KTXA 4Q3MA 3H2NA 4WUIA 3SCVA 4DWSB 5FJOA 4FO4A 4UTJA 3EOOA 2QUMA 1XW8A 5HPOA 1FUYA 2BHYA 3V0UA 2QAPA 4Q22A 1H09A 1T8XA 3LHVA 2QZRA 1EBGA 1QXLA 3TDFA 2PP1A 2V38A 3OHMB 2Z7KA 3AIUA 4CQDA 4F79A 4OFCA 1YXYA 2XJ7A 4YYCA 2KZHA 4GX8A 1XDMA 1TJ1A 3VOCA 2H9AB 3GDBA 5G2IA 1DJXA 2DSKA 2PTXA 2HV5A 2YL6A 1NIUA 4LS2A 3N9KA 3PN8A 3PZ9A 1RP8A 1KKOA 2GVJA 4OBSA 2CZEA 4PMVA 3WNMA 2INZA 2A7PA 1ISZA 1GKPA 4GJ1A 4K3ZA 4MM1A 3ES7A 4HCHA 5REQA 4MYAA 4N6EA 3DKJA 2NXGA 3L5AA 4AD0A 1A5LC 4FLQA 3NVDA 3ANUA 4O17A 1OD8A 1ZS2A 3BAWA 4NG3A 4UR8A 1Z7AA 1NSJA 2XIJA 4AX7A 2WNZA 4L6OA 1EB3A 3MC5A 4QSFA 3LNMA 2DQXA 2IPGA 3SUWA 5CPMA 3BH4A 3TJ4A 2XYLA 1OF6A 4XVDA 3QY7A 5F4SA 2C0HA 2P76A 2YYUA 5IBXC 2PTWA 1J6OA 1Q5MA 3B40A 3D0CA 3HQNA 4MPKA 4KCUA 3B8UA 3K5XA 3SFWA 3BQ6A 5E9XA 4E8GA 4ZQNA 4EF9A 3WG6A 1OIFA 3EWYA 3OBEA 1JG9A 4NAEA 5E6ZA 4S3DA 3CQJA 5AHIA 1G4PA 3M64A 4GG9A 4HYVA 3TMQA 1LRTA 2IS7A 4X2PA 2C91A 3NZPA 1V3MA 1PVNA 4PSRA 3WD1A 4MAVA 4D8LA 1XJBA 1UPPA 4JFWA 4QFUA 4C6IA 4CQBA 3CUZA 1EP2A 1JZ6A 2ZXBA 1Z89A 1VYRA 3M0IA 1JVNA 3CHCA 1XGZA 3AU2A 1JXKA 1AMYA 1QI0A 1XYCA 1EHAA 4AVNA 4C7FA 2WBKA 3ARSA 4WJ8A 1XQKA 1A5SA 4C6KA 1HO4A 2FFIA 6ENLA 5AYIA 2CZDA 2BY2A 4Q4PA 4UTHA 2PDNA 1R0MA 4FHAA 3TQPA 5LSMA 1E3ZA 1M3UA 4OV9A 4FIRA 3S1WA 2GWNA 3PBVA 2V2HA 3ARRA 2EBNA 1EJVC 1NTHA 1PIGA 2PWHA 1MW1A 2FGBA 3L4UA 2ZE0A 2YFNA 4Z1BA 1MFVA 4JIPA 1UD6A 2O56A 3L2MA 4UQBA 2INEA 2D2JA 3U6WA 4F2BA 4EK7A 3BSGA 4CGTA 1GPFA 1M9HA 1Q8AA 1CLXA 3N18A 3KM8A 2OXNA 2DSVA 2VX4A 4WLCA 2OTDA 3OA5A 3W1AA 2P50A 3S5SA 3MUY1 3VX1A 4FLOA 3CQHA 3UGVA 2R1NA 4O28A 4JQ3A 1RCOB 4J35A 2DVTA 5B7YA 3GG8A 2DU2A 3W07A 4I9JA 1NY1A 3LBMA 5KMYA 3S4TA 2BHZA 2CBJA 1SFLA 3MW7A 4GI9A 2BNJA 2OR2A 3U4FA 1QI2A 1EFZA 4P8XA 3VE7A 3SUVA 4AZ7A 2B7QA 1ZHAA 5C7HA 1QVBA 3UERA 2PZNA 2WZEA 1AFSA 3SFKA 4J3VA 3QM3A 4WDWA 4LC6A 4HSNA 1E1EA 3E74A 1BFNA 4DAIA 4TQTA 1V6UA 4QAWA 1RH9A 3VMNA 4G7FA 1AG1O 3QTPA 3N2OA 3RPDA 4IL0A 3UWVA 4N9EA 3IK4A 3SM0A 1YLVA 1HP4A 3DFQA 4H41A 3AIWA 4K7YA 3ARUA 3U2EA 3L4ZA 3T2PA 3ZYZA 2QGYA 6TAAA 1MSSA 2X1TA 3W7LA 2BBFA 5RUBA 2Y6ZA 1JDFA 4PE8A 3B8TA 3FN9A 2ZBTA 1TTPA 1SSGA 1HZYA 4QE1A 1Q8JA 3A6OA 4UFMA 5SWUA 1TPFA 1GHSA 4S2BA 4B5UA 2P5NA 3ALFA 3FJNA 4EOUA 1QR7A 5EB8A 3OZOA 4K2SA 4MB1A 3ITLA 3G8RA 1C9DA 3B3DA 4MOZA 3BURA 4HA0A 5E93A 1UKQA 1NWUA 1KBIA 3F4NA 1ELSA 1YMYA 1BHGA 1EWDA 4LEFA 4X9SA 2A21A 5IHSA 4YHGA 3NPUA 3DENA 1VIWA 1AODA 2ZVIA 4AVFA 3PWIA 1EF2A 4IM4A 3JS3A 1KW1A 3R4IA 1DYSA 3BMWA 3I6TA 1GZGA 1GTHA 3T08A 4XVEA 1P5BA 1JR1A 2RDUA 3L23A 3O6AA 5CKSA 2R24A 1G4TA 1M1BA 1QAPA 5CG0A 1REQB 3WJYA 2Z2AA 1YPIA 3IV8A 1FHVA 4MGGA 3PF3A 1P6CA 4Z0SA 3M0KA 5LIWX 3P81A 4CNSA 1DOSA 3GX9A 3EB4A 4H8UA 3W88A 3M5XA 4KWVA 2TRSA 4HA1A 4B16A 1IT7A 5ECVA 3AXKA 3UCQA 1H0IA 2QCEA 2C14A 1GJUA 1L6YA 3M9YA 1K9DA 1BTMA 3OZYA 3IIPA 3LENA 5KETA 3M6DA 4O4WA 1M6JA 3CEPA 2Q01A 2PUZA 3JU2A 3QRHA 2V3EA 5C9RA 4ICMA 4QROA 1OM0A 2WM1A 4IJCA 3QW3A 1SMDA 4UTWA 3VDAA 2QULA 4JTLA 3S9YA 4ZE4A 3AXHA 3RG6A 4P8WA 3WQ5A 3I10A 4AXNA 1JYNA 1RR2A 2YCEA 2RJHA 4GVGA 3K4DA 4GCXA 1TUFA 1BRLB 3KVKA 2Y62A 3ITVA 2PODA 3NQMA 4PMNA 3GXNA 3P3BA 2HZGA 2PRHA 1Y8BA 3VK5A 2VEKA 2J62A 5DQPA 5BXTA 3MYPA 1GG1A 3LRLA 1FCQA 3LMYA 5F1VA 3GIQA 3AZRA 1IXNA 1AW5A 4GK8A 3M0HA 4F4RA 3U2ZA 4MWAE 3NQEA 3STCA 1NDWA 4BS0A 2F38A 3GH7A 2OELA 3EXSA 3T6CA 2VFHA 5LIUX 1FWNA 3NQBA 1V4YA 2FYMA 4CD4A 3N12A 5J5DA 2XWEA 2E68A 4YWIA 5L9FA 4B3KA 4F2UA 3MDUA 3ARZA 3FY1A 4GGHA 4HIBA 4V2XA 1K6WA 3N13A 1O5KA 1D3CA 3C0LA 3ZOAA 2NZLA 4I8DA 4LPCA 3ITXA 2VVNA 2F8QA 3VKDA 3F4WA 3IEBA 3CIVA 4CN6A 4XUGA 1AH0A 2Z24A 2CKRA 3TNOA 3B8DA 2BASA 1YXCA 3UU0A 4QG6A 1K8ZA 1TX0A 4R53A 5H8MA 3A47A 4M5PA 3DH7A 4W7WA 2WPBA 3NQAA 5T9CE 4JHZA 4ZE5A 3BLLA 4G7EA 4NP7A 3GY1A 4LANA 4FPSA 1XH0A 4WKHA 4MY8A 1QHOA 3CJPA 4XX6A 5KZ6A 4K36A 4MFDA 1G5AA 1NJJA 3NVTA 3RLUA 2PD9A 3GBDA 3S6TA 1M65A 4NUWA 2PPGA 3EXTA 1N82A 3WBAA 1B3YA 1QPNA 7REQB 3RLVA 1JULA 5M3WA 1O95A 3NUKA 1HJXA 3LHZA 3XIMA 3H21A 1JQVA 2X30A 4QS5A 1GYNA 4DELA 1EPVA 3AO0A 1CB2A 3ZO9A 4M0XA 1QPQA 2EJAA 3RPTA 1DE6A 1OVDA 3QVQA 2HBXA 2BG5A 4ZFMA 3SBFA 2LLEA 4MWAC 4WY0B 1ZGDA 3IUDA 1HTIA 3TNBA 3TN3A 1OK4A 5HMEA 4MHBA 3NZQA 4EAMA 2C7FA 4EWND 3MHGA 1W6TA 4B15A 2PD5A 3ZQ9A 1O5RA 1XYAA 4DUXA 3O2LA 3S6OA 4JNMA 2C15A 1MZHA 3WLOA 3VKKA 3ZVHB 4K37A 3PC0A 1AL7A 2NQJA 4F2TA 3AQUA 2TODA 2Z0IA 1SZGA 1E56A 3T0AA 5HOSA 1HIZA 3LERA 3MQTA 3VGGA 4LB3A 1GEHA 3L4VA 3WL0A 2VEMA 2A5HA 5E6YA 1MO0A 4PEKA 4LOCA 4ROQA 2VR4A 1WDDA 3LM7A 5CGTA 1UG6A 4J3SA 2IKHA 4LSBA 1XM3A 5LZLA 1JI1A 3AMLA 3H22A 4PB3A 4MZ8A 4GLEA 5KSWA 2ZXAA 3TC3A 4LC8A 1TPEA 4H9MA 3OGSA 4DY1A 2X2GA 1Q6GA 2Z6IA 3G1VA 4WCJA 5D38A 3GZ3A 4A2RA 4FZIA 3GC5A 1EGZA 3LHWA 5DCBA 5M1TA 2XIQA 2BY0A 3H26A 4DUVA 4XUYA 3UJFA 4CCZA 4UQ9A 3RR4A 3IVUA 4RDYA 4WJEA 4MTVA 2WV8A 4D6EA 4KFNA 4ZB2A 1Q6QA 1ZENA 3LBOA 3TX9A 3UQNA 3N4AA 3G0UA 2XM1A 2V5KA 3CAKA 1X1OA 3WLNA 1TR1A 2CW6A 3UT0A 3TJXA 4L56A 3GTXA 4JTQA 1L2QA 1QDSA 1ADOA 3SQSA 3THCA 2D3NA 4DNHA 4U2YA 1RCXB 3VFLA 5FL1A 3N6QA 3UXAA 3CK5A 4AISA 4NRSA 4Y8EA 2ISDA 4C6EA 4AHOA 4XV0A 3BCFA 3GTNA 1PDZA 4FIQA 3RK8A 2Y0FA 1YPFA 4UOZA 3SCSA 3VZYA 3S9ZA 1WXYA 4V33A 3CB3A 3TN6A 2XDFA 1KQZA 1N7KA 5FSDC 3VNMA 4HTBA 2QEZA 4E38A 3WLKX 1Q63A 5GJMA 2HK0A 4AMAA 2IQTA 3TVAA 1U5HA 4NRRA 2X1IA 1KV8A 2REQB 5I79A 3AXMA 3PULA 4LYRA 1SW3A 3MWAA 2QUVA 1RP9A 4JTKA 4C91A 2FZ8A 1ZP3A 4HZ7A 3AYTA 1BLIA 2WWCA 1EXPA 1Z69A 5F2MA 4Q4OA 1DXEA 1GVQA 4HBKA 1OG6A 2X1SA 3TOYA 4JTUA 1LRQA 3LPFA 2HRWA 5D4YA 4P8UA 3S0CA 2E1WA 1FDZA 4XISA 4XD4A 3LXAA 1BTCA 1TR9A 3TEVA 4LS1A 5FESA 4XZNX 5DX7A 1EA0A 3PJXA 5A6BA 5EY5A 4ZENA 5HULA 5FF0A 3OIHA 3SZ8A 4L61A 2WQDA 4H00A 2V5LA 2J6XA 1K7XA 3CV2A 3A9BA 1ITUA 1F3WA 1OD0A 1E6ZA 3AS0A 2CZFA 1JNEA 3ABQA 1CNVA 1OX4A 3GR8A 3MBFA 3TR2A 5HNRA 2WNWA 4JIHA 3N2MA 4IMGA 2VR2A 4GX9A 4GISA 2HE8A 5FD0A 1RJQA 3PR2A 1E5JA 1PKYA 1S38A 1CIUA 2VEIA 3AHVA 1QATA 3AHZA 4IIGA 2PP0A 4M1BA 1Y5WA 1P7TA 4ZOCA 1B3ZA 1JCNA 3VOFA 1PIIA 1EOMA 4L6HA 3RRAA 1GVIA 1R3YA 3NL2A 1JPHA 4IUGA 4GVFA 3W7IA 3QYQA 3HJZA 1C3FA 4FSAA 2VC6A 4PTVA 5A2AA 2XN1A 4I7WA 3K4AA 1V02E 1LTDA 1F61A 2FVLA 3VZXA 1R2RA 3CTTA 3VNYA 4AZBA 4MKSA 2FTPA 3TSDA 3AIBA 3NPXA 4B4FA 2NQLA 1OFOA 3PTKA 3BAXA 4Z2KA 1R9YA 2Y89A 1P1MA 4NZ3A 5H91A 2EG7A 3ATYA 2ZUNA 3GG0A 1TZ7A 2D0HA 3TH6A 1WB0A 4D72A 3IIVA 5LKYA 2Z1VA 1CGWA 4J3WA 1XYLA 4JTAA 3VOIA 4Z2JA 2QDEA 3DC0A 3LGEA 4KMQA 3NXFA 4S3FA 3FKKA 4NYYA 1E55A 3WYZA 4QE5A 2ZX9A 4PRTA 1CDGA 1UH4A 2AAAA 4S39A 4AWSA 4DJEA 1DQUA 2ZIDA 4P8VA 4L9YA 1X7FA 2QJMA 1SZFA 4B91A 4AD2A 3LM3A 5BCAA 3FJ6A 2FVMA 3OQ8A 4MLJA 2D0FA 2VZVA 2G41A 2ZX7A 4GNKB 4LWWA 2VDHA 1GJWA 3G1DA 1TPC1 3OODA 3IJ6A 5BWFA 4GACA 5A6SA 1W2VA 3R10A 4AY1A 2ZZ2A 1A5OC 4HMCA 4BZYA 2DW6A 4RV8A 4CVUA 3CLWA 4ZTYA 3TR9A 1C9WA 3UWWA 4EE9A 4GYPA 4P7RA 3W22A 3AOFA 3ARQA 3ELFA 4DHGA 1U83A 1G4SA 2EPOA 4REQB 1WDRA 3DX5A 3KOFA 1KD0A 3SRFA 2OQLA 1J5SA 4RNFA 2TPSA 3TJLA 1OG0A 4IPJA 4O11A 1JUEA 3WUBA 4OBTA 3IAPA 5I3FA 2OQYA 5F1UA 1PZ0A 2R94A 2G4JA 3E96A 3BVJA 1A3XA 1YDNA 5A6JA 2EXOA 1QCWA 2FH8A 3M5ZA 4LJ3A 2E9BA 3KL0A 3FA3A 2WAGA 3D6NA 1O7AA 1AZ1A 1B4KA 1UWRA 4ILSA 2P1FA 1CGXA 3DFHA 1DWFM 5GJPA 1JAEA 2VM8A 1LYXA 3GVRA 5IDIA 3VVGA 3NJ3A 2WMJA 3LCXA 1VC4A 4Y96A 5CG7A 1F4HA 1RY8A 4B9YA 4KS0A 4NAFB 2OWCA 5H8UA 4GH3A 4JN6A 3A3XA 3CWNA 3POCA 2QGHA 3GDLA 3SN4A 4I3GA 2RH9A 3N6HA 3G5EA 4EXAA 5A8NA 1OZQA 4RW5A 3VMPA 4PUDA 1QBBA 4CCCA 2DZSA 4ZCWA 1XLBA 3GWQA 1BXBA 1QU4A 1R87A 2VOMA 4Y6GA 3NA8A 4QLJA 3N73A 2E6AA 1G67A 1A0CA 3R0KA 3WLMA 3WDJA 4G9PA 3TE9A 1M7XA 1NOFA 4MSSA 1BQCA 4TU1A 4D8ZA 5D04C 2PWGA 4L1XA 4WGHA 2TMDA 4GZIA 5HA7A 4B9ZA 2WSPA 2VGBA 4Y90A 5AKQA 2OOGA 1XBXA 1S3TC 1UBSA 3ZJ6A 2WHLA 4OVXA 3WBEA 3QV8A 3FIGA 3CHVA 1NELA 4YVPA 3WBXA 1BWLA 1V3HA 2DZXA 3OGRA 3REQB 3QQWA 1CGYA 1JIBA 3D47A 3CUXA 1PTDA 4AZHA 1QTWA 2VRJA 4H8NA 3UFYA 4UIOA 3QMSA 1QNVA 1G69A 4K39A 1C8XA 3DG3A 1KFLA 3AWOA 1J93A 1GW1A 5DF0A 1RBLA 6XIAA 2EF9A 4E4PA 2VP8A 5HR7A 2E9MA 4C6QA 3SN0A 4C1NA 4EX4A 3CUHA 3LRMA 4GRSA 3T09A 2R82A 2NXIA 2NXHA 1QFEA 4U4MA 2Y5JA 4JKLA 1R9XA 5AOUA 1K8XA 3AJ7A 4C6NA 3YPIA 5LGZA 3M7SA 2GGGA 3AXXA 3KL5A 5B7ZA 1S2CA 3EWCA 1UWIA 5CSSA 4H3DA 5CQ1A 1JYVA 1GOIA 4UR9A 2EPHA 2QAFA 1TB3A 4RR4A 1GZJA 3KS6A 2I5IA 3S5OA 2E3ZA 3FYYA 1VQTA 2HBVA 4S3CA 3CMFA 3LEPA 3L21A 1YBQA 1OFBA 3BLDA 2J8TA 3G0SA 1GOKA 3N9RA 2J75A 1Q6EA 1LQ2A 3TTSA 4CNUA 1TPVA 2X7VA 3PJTA 5EMLA 1P4CA 8CGTA 1NU5A 1R6WA 4S3EA 3KBJA 3M1ZA 4X60A 1H7XA 1MUWA 3IPWA 1O6IA 4QQ3A 3QXBA 4KCTA 4JX4A 2F6UA 1JPDX 4E8DA 3KVMA 4ZODA 3V1HA 2D1ZA 2X1RA 4Q8PA 3BGJA 3O05A 1P6WA 3HBLA 1W3KA 2UV8G 5A6MA 1ZLPA 4AZCB 1GQKA 3U5YA 1KM3A 2PP3A 1R9ZA 1VLWA 1YQ2A 4DRSA 2VQTA 3CZLA 1OK6A 3LOTA 2PDLA 2WJEA 4XZBA 1JRCA 4WOZA 2R1MA 3O63A 2PDWA 4HPNA 1SU5A 2PWDA 2Z1KA 3SECA 2QV4A 2ZRYA 3V36A 3MTWA 4OECA 3WQWA 2QCGA 3LZ5A 3T4CA 3ZWTA 1WDQA 4Q4SA 4QG8A 4JCLA 5T8GA 4M7SA 4JL2A 3NG3A 3TZFA 4H8VA 5AY7A 4IP5A 3L4YA 4U3CA 1IGSA 2Z7GA 4LV4A 4ZOAA 3SCTA 3TONA 1ONRA 3GDTA 4D6IA 1OB0A 1F07A 2OEMA 5AYBA 3SY1A 2HTMA 5CC3A 1H2JA 1P0KA 2PGEA 4B4HA 3MUCA 1HKJA 2QDGA 5K4XA 2QCHA 1HNYA 4AY7A 1I0BA 5AC4A 3U9IA 3L9CA 5BZAA 5H2ZA 1QO2A 3AIEA 1ADSA 4IQEA 3BV4A 4Q7IA 1J10A 2JK2A 2A4AA 4MWAB 5LNUA 2W27A 4GY7A 2O9TA 4GUHA 4NNCA 1D7KA 1V7AA 1V0LA 1PZ3A 1UJQA 5I24A 1GVYA 1E4NA 4V1XA 3GSMA 3KVJA 2GWGA 7CGTA 3CV6A 1OABA 2CHRA 3VO0A 3PBWA 1JF6A 1E9YB 3BMVA 3C8FA 1SJCA 3W2MA 4LH8A 2VZUA 2VFFA 5CC5A 1Q7QA 1EDQA 7XIMA 5GVJA 3KBVA 4ZEPA 2DT3A 1ZBCA 1MFUA 3S2JA 4BK9A 4OV4A 2DORA 3NSXA 4N6FA 3TW6A 4CQAA 4EXBA 2O9PA 3MA8A 5K3VA 3M0ZA 3QHOA 2QJHA 1ME8A 5A1AA 3MZNA 4DIAA 1JDDA 3PNZA 3P0XA 4FXRA 1OGGA 4J3UA 3PZTA 4PMXA 4IPPA 4TOQA 3GNOA 3P5YA 3CL7A 4HTYA 8TIMA 4LUYA 1G1YA 4YYFA 1W5OA 4NJHA 1WAWA 1BQGA 3LTYA 4FOJA 4IGMA 1EJUC 2B7PA 4S3AA 5HBFA 3QFEA 3VDHA 3K30A 4HJFA 3KS5A 4CVWA 3CO8A 4EF8A 2YDRA 3FGCB 3V35A 2HJPA 1XLGA 2VQUA 4KGJA 1WKEA 3NSMA 1JPIA 4ATLA 5TQLA 3JVAA 3L0KA 1J11A 2V2DA 4R9XA 7PTDA 1XLKA 1FCBA 1XYMA 2XM2A 3MP3A 2RGLA 1E40A 1S2WA 1MRAA 1XLHA 1OHLA 2NLYA 2ACUA 3TLQA 5I3KA 4FXSA 2OWWA 1SQ7A 3WDRA 3N4FA 3WJWA 3AU6A 1UP2A 4I9TA 1UP3A 4JN7A 1BYAA 5DMLA 4N4QA 4IIDA 1H1NA 2PWFA 5AYYA 3T9PA 3PPHA 4JTEA 1BSLA 5EKYA 5FJRA 1XLFA 3BCJA 3W7OA 3KRUA 4GZJA 2BS9A 2G5WA 4KWWA 3KBMA 2ZC8A 1UR0A 3LTSA 4CLMA 2OQHA 3VC6A 1VEPA 5HAOA 1UZDA 4HU3A 2X1UA 1F6KA 4AFYA 3A24A 4HZ6A 2ZRVA 2E40A 3PBYA 3P2VA 1WE5A 4Y9AA 1H63A 3NDOA 3STGA 2OSYA 3VUSA 1JD7A 1JI2A 7ODCA 4R7WA 4RX0A 3LQGA 2ZKMX 3GYEA 2VGFA 3P74A 4NI3A 2B81A 2YCJA 3Q37A 3CT7A 3PTMA 3SUUA 4S3BA 4IFOA 1VRDA 2YLLA 5DY2A 1JXJA 4LYQA 4FLSA 1LL7A 3GH5A 2XH4A 4PYSA 3VFCA 3LCFA 3NQ8A 1SFJA 1FWRA 3S5ZA 4IFKB 4GABA 5LIKX 1I4NA 1RHCA 2JGYA 1XIGA 1X97A 3FA4A 5GNYA 2OB3A 3WK1A 2QF8A 4HJWA 4QNEA 1EJ7L 3L0NA 3LPGA 5I3IA 3CU2A 2VZTA 2ICSA 4PTDA 1KGXA 5TIMA 4ZSUA 3F4CA 4AIOA 1J0JA 3WD4A 2R91A 4TMCA 2ZA1A 4UOQA 3HGOA 1CECA 4NNAA 1P48A 1WXZA 4IMEA 4WXZA 3ABRA 2NVDA 4U5IA 4LB4A 3RYSA 4J4KA 5FI8A 1PX3A 4D6FA 4GNVA 1KB3A 1XX1A 3A5FA 2WNQA 4GMEA 3AALA 1TELA 3WF3A 3WO8A 6TIMA 1XCFA 5A6TC 4GBDA 1ZUAX 3GNXA 5FJJA 3V1PA 3RX3A 3VNZA 4XTIA 1Y5VA 2F6KA 2F2HA 2BB0A 4MZYA 2FLIA 4LAZA 2WKGA 4XSMA 3W81A 3V75A 3BL3A 1UUMA 3W72A 2QPSA 3LHYA 4KQNA 4CEXC 3HGSA 1KV5A 3BW2A 1I75A 2ZTKA 3PUOA 3HF3A 3E12A 3R8RA 3HFTA 3P84A 1NEYA 5M17A 4D2JA 3KCJA 1FA2A 1VFTA 4NL1A 1AH3A 3ABXA 3TTYA 1VJZA 2NQZA 3W7EA 2X8RA 4JY8A 1XD1A 3W7RA 3A23A 1P6BA 3VNKA 1PHWA 1EDTA 3PPGA 1TE6A 1J4EA 2RKXA 2CPUA 1VF8A 4HU8A 3S47A 4YTUA 5FACA 3TYZA 4WSKA 1E0TA 1R30A 4RKAA 4UTWC 2J47A 4GC3A 3UR8A 1RALA 3IJ8A 3RM9A 2V2CA 2HCVA 4FXFA 4PR4A 2FFCA 3BLPX 3MY9A 2HMCA 5A8OA 3GXMA 2Q3OA 4HN4A 3Q4DA 3CAVA 3KOWA 3QMTA 1UKOA 3B0VC 1FDYA 5IXEA 4RV3A 1KTCA 4N4PA 3VX0A 1V6TA 1G0CA 3NYZA 1PIFA 2HPMA 1TVPA 4Y9PA 4JGDA 1XCWA 1BF2A 4J7RA 1DTUA 3MCOA 4M29A 1E4IA 1OSEA 1GVFA 3F03K 3HN3A 4CNPA 3W25A 4IJBA 2OKOA 1UPMB 1V6VA 1XH2A 4OUEA 5M2FX 1OFPA 2PDXA 3VOHA 4ALDA 3QW4B 3T55A 1EGMA 1F5ZA 1I8JA 1QHPA 1YDVA 3TYUA 3FHQA 1EX1A 1H7RA 3GG1A 1B5TA 3S2CA 1PHQA 4FX7A 4I5XA 3G1YA 1G6CA 1TREA 4NI8A 4O50A 1JDAA 4AZIA 4UXDA 3WH5A 1W5MA 2ZUSA 4RZ6A 4Q8NA 3AZTA 1KXQA 3LGGA 1S5MA 1JZ7A 3SIMA 2VWSA 3L12A 2NWRA 4O14A 3P7YA 5DCDA 2V69A 4BY3A 1OFEA 5HNUA 4MUPA 1EO5A 3UY8A 4AYSA 2OT0A 2MNRA 4HPGA 1KRCC 1I0DA 3W7DA 2V81A 4MY9A 3GDRA 4FX6M 2XGZA 4UMAA 3CM4A 5EFDA 1U5VA 3HPAA 2NQ9A 3M07A 3H6OA 4L7ZA 3WQDA 1B57A 5K9CA 4H8HA 3A12A 3NQ6A 2EG6A 4NHVA 1MXSA 3N1AA 2G3IA 3W7MA 5HPCA 2NWSA 4J27A 1W1PA 1XRTA 2J9XA 2Y7FA 3BOFA 3PSVA 1YNPA 1S2VA 3NR0A 4RW3A 2WC4A 3VD4A 2YZRA 1X38A 3BLIA 3USZA 3R89A 3H4WA 1OT2A 3LPPA 4CD5A 1B54A 1KWKA 3DDMA 2W3ZA 4HA4A 4DEFA 1T8QA 1KM0A 2WPGA 4DZIA 1TRDA 1A5AA 3BARA 3UJ2A 1Q6OA 4Q8MA 4FA3A 4UMBA 5HQLA 1K8YA 2YSWA 4KF1A 4ORMA 4C6JA 1WBHA 4UQDA 4QAIA 4JTHA 3AZSA 3PZIA 3MUXA 3LDVA 3F4VA 4CNTA 2HVOA 2CWNA 2UZ9A 2FHBA 1W3HA 3C3UA 4WZHA 3CB8A 3B4UA 2XH2A 4F0HA 1OGBA 3STEA 3O1NA 2YDQA 1R47A 1C8VA 5MKGB 2VVSA 2ZDRA 4FNPA 1FOBA 3N17A 4MJ2A 4HNTA 2VFDA 3NEVA 2DVXA 2YDAA 5DCEA 1IR1A 3H8AA 4J5NA 2NLIA 2YLAA 1IF2A 2WVVB 3FXYA 2CEQA 2DJXA 4DPQA 4QJ5B 2HPIA 4ZO7A 2PLKA 4PEEA 3VGEA 2V8ZA 4KESA 4G2DA 4Q7BA 5EL1A 5ABGA 3TOPA 4LCSA 1SJDA 3BSHA 1JZ5A 2JEPA 4GIRA 4TUFA 3GB6A 1UD8A 3JUGA 2BGSA 3WNNA 2PC4A 4HA3A 1UR9A 4Y9OA 4HPXA 3VIPA 2YCIX 1I2QA 1BF6A 4M51A 5DRCA 2W66A 1IR2A 3Q2DA 4C6MA 2PF0A 4CN4A 2WMKA 5JH2A 1UR4A 2CLFA 2E5DA 2O55A 1UIPA 3LQLA 3EDFA 3S9IA 1KC7A 4CN1A 1L8PA 4NJGA 3CZKA 3H54A 4LBRA 5A95A 4O4VA 4A3YA 2B7NA 1GQLA 5E1QA 3TXZA 4JHMA 2B7OA 1UD2A 2JIEA 4IPIA 3RCNA 2R1PA 1JJKA 5HJYA 1FWAC 3WFZA 1HVXA 1KXHA 3NL5A 3WLSA 3WNKA 1HQTA 3A13A 1ME9A 3W24A 2ZZ4A 4IQJA 3R8GA 4KH2A 4N02A 2DDXA 1ZAIA 2ZE3A 1OC6A 3FSUA 2EJ1A 1EJSC 3RMEA 1Z42A 3R25A 5BU6A 1U30A 3MI2A 5CBIA 3JZEA 4P61A 3MHUA 1XUUA 1V51A 3BUVA 1K7EA 1YE6A 1KTNA 3ZMRA 2DV0A 4D6HA 1A3WA 2CLOA 4TMBA 3T1GA 4G1KA 4LXFA 2Q09A 3IGHX 3HPZA 2R1LA 4FP1A 2G0WA 2VOTA 4I7VA 3GNDA 3W01A 1H11A 4KKXA 3T2OA 1A80A 4OWGA 3QEZA 4PL2A 1SO5A 3ALGA 4QEEA 3OLEA 3EMQA 7A3HA 3SUSA 1ZBVA 4DM2A 4DQWA 3KAOA 2XISA 1RSCA 1YDOA 2POZA 4ICCX 2DZWA 1ZAHA 1VS1A 1R86A 4DYJA 1ZP4A 4BEQA 4U5KA 2ZICA 1C7TA 3UWQA 3GO2A 2VZSA 4MF4A 3RJYA 1FFQA 2ZADA 3EWUA 3TYBA 2VTFA 1S3HA 1RY0A 4K8EA 3SCUA 2OWXA 2H3BA 1W0MA 2YCLA 4NT0A 3B0UX 1V3KA 1BKHA 5HXMA 3TA9A 4V28A 2YA1A 4OJYA 5D8ZA 5DELA 4TIMA 1UBPC 2QVHA 4BI5A 3LLFA 4ZQCA 4KW2A 3N2BA 4D6GA 3TFCA 4BI7A 1O5QA 5ENLA 1EQCA 3C0JA 1XIDA 5REQB 4MZ1A 3R94A 5I3DA 4HVXA 2W91A 3W2UA 3H2EA 1VAHA 2NT1A 5G5IA 1QW9A 1O1HA 4UQAA 3ID7A 2W0UA 1EBHA 1W9UA 3BCDA 2YIHA 2PDGA 4MB4A 7REQA 1OADA 2AGTA 4A8LA 2ZA3A 3D3FA 2C19A 4I90A 4K8GA 1QMLA 4HOWA 3WD2A 3P62A 1OCJA 3MKKA 5HANA 4HNLA 1FHLA 5A6LA 3O6YX 4GUFA 1J18A 1V6YA 3CL6A 4NQ1A 4PCSA 3U2OA 3WEOA 3O6CA 1JAKA 1AJZA 1E0WA 1OBAA 5A8MA 4DB7A 4KFOA 4NAEB 4XD6A 1K6AA 4DJDD 3AROA 3SN1A 5D05A 1V3IA 3CTLA 2DSUA 5CEWA 3DESA 2VT0A 1VBRA 1VZWA 3G1SA 5E09A 2QW5A 2WQPA 4LF1A 4UTMA 1F4AA 3I7QA 1TX2A 1OINA 2ZWZA 4F9DA 5C5YA 1LOLA 3V5FA 3TK7A 1NP0A 3EMZA 3P80A 4AQLA 1R3WA 1PE1A 3PPFA 1Q7ZA 1RAKA 4L80A 1K9TA 2Y70A 3LS9A 1O60A 4TO8A 3U4AA 3QSRA 5A6BD 3APGA 3RJXA 3R0DA 2V82A 4PCTA 9XIAA 1UW9A 4AW7A 4HHLA 1K77A 3W7PA 4XO6A 4QG9A 4IF2A 1ZNNA 3HU7A 4ZL1A 1PTAA 4O16A 3E9AA 2GDUA 3C2EA 1JCMP 1E15A 1UC4A 2V5JA 4F9JA 3EX3A 3HTWA 3W2JA 1Q13A 1VBUA 4W84A 2V6AA 3NOEA 4DJEC 4MJZA 1VEMA 5F4XA 3AICA 4LAOA 2HDJA 2Z1XA 4PFHA 1LWIA 4KERA 3I6EA 1XBVA 3VIFA 1W5PA 5FJIA 1CTNA 4ZR8A 3APTA 1T41A 4FK9A 1DPMA 2WLZA 4X61A 4O8RA 4GYFA 3TC6A 5I7GA 1E1CA 2BGNE 3FJLA 1UC5A 1YHTA 3W75A 4LV9A 1TIWA 3VI2A 3HZ3A 4GQ0A 2GOKA 5C0QA 6REQA 3MI3A 5A8QA 3UZXA 2HVMA 2Z00A 3MMWA 1TCDA 2GGJA 3ITGA 4GYPC 4AZ6A 1J0KA 2P3EA 4LNYA 3U8GA 3SURA 4LUIA 4LU0A 2VO5A 3NWRA 3PUEA 3UG8A 2OO6A 3NM1A 1BG9A 2BMBA 3TKFA 3AHXA 1Q6CA 1VCFA 1F6PA 2YKKA 3G0XA 2QV5A 4PRWA 2AQWA 3NYDA 4O1AA 2ATSA 3GAKA 2VCAA 4C1LA 2YL5A 2Z1WA 3EPMA 3MO4A 4NVTA 4IOTA 2EGZA 1ZJHA 2PDQA 1EUAA 2XIIA 3K46A 1UMLA 4YVVA 5K7JA 4OQVA 3NZGA 4IG2A 1FKWA 4KEVA 4L1WA 2WOQA 1RQHA 4DBDA 2V3FA 2EO7A 3UXLA 2XIMA 4F0RA 3B05A 2E1DA 4IX0A 4RCXA 2PAJA 4O52A 3DYMA 2DZTA 3AYVA 4MY1A 5DANA 4IXHA 1NAL1 2CLHA 4LT9A 1XLIA 3ARVA 4QXIA 4WX2A 4ICNA 3CGTA 4LY4A 3BJSA 3J7HA 3N19B 1R3RA 1M5WA 6CGTA 5AECA 3LCHA 3SIZA 4JS3A 4QJ1A 3MV01 4TVCA 3G24A 2GQAA 3L4WA 2CHNA 3T07A 4C6CA 4DWDA 3MMTA 4EWJA 3FW6A 1DWGM 4H4IA 3BXWA 1TPWA 2DSZA 1I6NA 4F3HA 1WUEA 3AYSA 1NWSA 5F2LA 3PB2A 1H7OA 4C5YA 1PKNA 3U7VA 2YBUA 3EX1A 4LUTA 4L6DA 3WJZA 3E0FA 5CSRA 1GW9A 2QMJA 1R38A 1O12A 2VR5A 5JQ9A 2J8FA 3BAIA 4RE3A 3EA2A 2PWVA 2PB1A 1QNRA 2BTMA 4JFTA 1C7SA 1NP2A 4AVOA 5A6KA 3UG4A 4B5TA 2XVPA 5IFPA 4JAWA 5BXPA 2ISWA 2GK1A 1V7YA 2GGHA 1PWLA 4UFKA 5K9DA 4LUJA 4XZLX 1T99A 3QHMA 4QHRA 1HW6A 1W8GA 2QPXA 3POHA 1CZ1A 5F2IA 3N14A 1CXFA 1ZJIA 5K9XA 2D2HA 1B1YA 3OYZA 4HCDA 2X41A 2FB3A 4LALA 1YPXA 1GG0A 2QLYA 3O16A 1VIZA 2ZRWA 1LUCB 1KQYA 2PF8A 1AVAA 3VKJA 1IGWA 3W82A 2V63A 2CU0A 2WB5A 4E5TA 3OIXA 2FZDA 4DUWA 3A4WA 1OYBA 3QLDA 1W54A 1ONEA 3URNA 1JEZA 4AD1A 2YX0A 1H1YA 1IEXA 3H7RA 2GJXA 1TG7A 2W61A 5HDRA 2JKPA 2FDMA 3GBEA 3SR7A 3EDDA 3OLDA 1LWJA 1MW3A 5I00A 3W84A 2QUTA 1VYPX 2WC7A 4AWUA 3BLOA 3COTA 3KZPA 3P93A 3GHUA 3GK0A 2CHOA 1LJYA 3MO7A 2ZC1A 1KCXA 5CGQA 3NSNA 2Y1HA 3PAJA 1E4MM 5CLWA 1WO2A 1MVYA 2O9OA 4GO8A 3K1GA 4Y8FA 3E02A 4PMOA 5EGRA 2ESCA 2Y8VA 1VFUA 3W1LA 2QCDA 1LROA 2ZRXA 3GHSA 1N8IA 4K38A 4DNMA 2H90A 3NFUA 3WIJA 1QPOA 3KOZA 3MCNA 2A0NA 3GFXA 1TZZA 1A4LA 1GVOA 4U3AA 3SJNA 1SO4A 2CNCA 4HPHA 3RN6A 3QF0A 1HO1A 1QNQA 3C3NA 3CXOA 5M03A 3EDJA 4X9YA 4IHCA 2IMRA 4NZ1A 2J78A 4ZOEA 1U1UA 1XSIA 4JL1A 1X98A 4POCA 2QCMA 4FR6A 1H7WA 1MMFA 1QW7A 4N42A 3BK0A 3WKZA 4RPQA 2CCRA 3OVRA 1WNOA 3HG3A 1B9BA 3MMDA 1A47A 1EEXA 3KRBA 5I3HA 1FWFC 2UY4A 4MFEA 4F0LA 1BGGA 2Z26A 1KTBA 1B3WA 5CPOA 4W85A 2CLIA 2FVKA 2RDWA 2QCCA 1FH9A 1SMAA 2XH0A 4K1GA 3W1PA 4C90A 3I6RA 3QR1A 4R27A 4YIWA 1FHUA 3JRKA 3KBSA 2PDCA 3TLLA 1BVZA 5CJMA 4TV5A 4YPJA 2J7BA 2RDXA 4G7EB 1RVGA 3B8SA 4TXEA 5JBDA 1QI4A 4ZXOA 3BLEA 3KRZA 4XB3A 4MJMA 3LSBA 3R58A 3AXIA 5CGMA 3FJ4A 2E8YA 4NJIA 1K4HA 1RJRA 2I16A 5EYWA 3W83A 2QUUA 4JYFA 1XR2A 1CXEA 1UHVA 5C9UA 4NASA 4Y2WA 1PSCA 2VX6A 3ITCA 4LVAA 4AIEA 4UUIA 1G01A 1EKOA 1XRVA 3QOKA 4C6PA 4XWUA 3LXBA 3OVQA 4H6EA 4KGLA 5AHFA 3C2YA 2OKTA 4NAFA 1SUXA 3BZJA 2J8GA 4PSPA 3SCNA 1XLMA 3UZ5A 2ALRA 3VDBA 2E28A 3CUGA 4ZXLA 1RBAA 1XLLA 4IP4A 4DYEA 1HJUA 2WZMA 4UBPC 3E0WA 1XSJA 3UF9A 1EOKA 2Y2WA 2HNHA 2OZTA 4YCOA 1LBFA 5ABFA 1L6SA 2PDKA 1POKA 2OFJA 1XSKA 5JVLA 2J7CA 3SAZA 1OT1A 4E2BA 3CPRA 3TCSA 3CV1A 1I9CB 4ZQMA 3W4RA 4LCQA 1MXDA 3R6IA 4ZQPA 2QCLA 1FP9A 5FF4A 1X6UA 3WF0A 3EWWA 4DI9A 1Q4WA 4KEUA 1OJXA 1DP0A 2Z2UA 4DBEA 2J77A 4OUIA 4QGCA 3TAKA 2Y88A 4HOZA 1GYMA 3THUA 1E5NA 2A3AA 5G2WA 4IGNA 1YNQA 1ZTVA 4N9CA 2Z28A 1DXIA 1PV8A 3NIYA 3UG3A 2AOSA 2BY3A 4DYKA 2VGGA 3UZZA 4J3TA 3A4AA 4DZ5A 2ZZ5A 2WWDA 3STFA 2E6FA 2Y7EA 2HK1A 2F9RA 1PBGA 1C90A 3N29A 4R9OA 1Z32X 4YHEA 4GI6A 4LYPA 4QTGA 5CC7A 3RF9A 2ZUVA 2GFTA 1BGAA 3DECA 1AMKA 1TFVA 2D73A 2FTWA 4M3PA 2JF6A 1K7FA 3C2VA 3CIXA 2DIKA 3CL8A 4LFYA 3R5EA 1QOQA 2NT0A 3TFXA 4WXYA 4HKPA 3IUIA 4HSHA 3V16A 2PDBA 2YR1A 1XYBA 3LCGA 1J0YA 4BQ4A 2OMAA 5GJNA 3W1MA 4E4UA 1UWSA 3W1NA 2Z6JA 2OSWA 3KLKA 5CBJA 4D6JA 1WX0A 4HNOA 1CLKA 4B5XA 2YOCA 3DGBA 1XRSA 4GZ7A 1CENA 1LBMA 1MI3A 3T4WA 3VGDA 4DUOA 2GLKA 3BOLA 3TP4A 5A8GA 4ENLA 3UR2A 1ZY9A 1FCUA 1XPGA 2I9UA 4GKTA 3QYSA 4PMYA 3T0BA 2Q8ZA 1HKKA 1UR3M 3OA3A 1US3A 1MRQA 4FNUA 4Q32A 3DFTA 1LLWA 3FNDA 4S3GA 1LCOA 1XIHA 4OBRA 1ZZMA 2NV9A 3EOSA 4JTSA 1H5YA 4AZCA 1F7BA 3SB0A 1AUSL 2F2KA 3C2OA 1WPCA 4O1DA 3VUPA 2J7DA 3S3GA 1Q2RA 4BI6A 1XIFA 1OCQA 1DHPA 4HD5A 1KM5A 2D23A 3ZS4A 4JBRA 2J88A 5C55A 2F6XA 4WK9A 4AU0A 4R5EA 4J9JA 3K2GA 4XAZA 1GHRA 3BAKA 1HT6A 3WFLA 1UR8A 3SGUA 1VJSA 1RZMA 1B0IA 2BLEA 2A85A 1CX9A 2FGZA 4M80A 4WF7A 1W1YA 4X22A 1THFD 3B06A 2DY3A 1DBTA 3FVMA 4XIMA 5AB3A 3CH9A 5AC5A 5AHNA 3LV6A 4UTIA 2FDSA 2CBUA 4WEVX 3R43A 3V0SA 4PA8A 1TJ0A 4FB7A 4AXKA 3WQFA 4EIVA 1WV2A 1ZSXA 4H2CA 4AWEA 4NXSA 2EPMX 1V0NA 3O3RA 2C6QA 5D2YA 3GXTA 4JTDA 2ACSA 4O53A 2J24A 1PUDA 2O4QA 4GO9A 1J2BA 2Y7GA 2P8BA 1TWSA 3T05A 1MQRA 1XLCA 4AZGA 5C54A 1HKMA 1XG4A 5G2HA 4UTFA 1K9EA 2I57A 3IJDA 1HXJA 2HXUA 1UKTA 4JQ1A 4CUCA 3USBA 2WANA 2D24A 3DGRA 1SFSA 3VGBA 3UPBA 4DWSD 4FALA 3IVSA 4PMUA 4RE2A 5IOBA 3IJ9A 4LVFA 2BOFX 2Z1SA 1P7TB 1EH9A 2C79A 3JW7A 5U4NA 3KVLA 3DCPA 3C2RA 4YU1A 1H0GA 1XKYA 5EA9A 5T91A 4JHOA 3VD7A 4DVOA 2XFRA 3Q65A 4BWLC 1E6RA 3ONBA 2CWXA 1H61A 2UBPC 1W9VA 3P6LA 1C93A 1W31A 1UH2A 3RMJA 2A6LA 5AC8A 1GONA 3NO5A 1HG3A 4CNNA 1XXXA 4IMCA 4GOAA 3WK3A 3WQEA 2D2OA 3FSTA 3OVGA 3UJEA 2VRKA 1X8CA 3S2LA 2CC0A 4OTKA 3W2KA 2WHMA 5LNVA 3C2FA 2GGEA 1YXDA 4QSHA 4HNUA 3SCPA 4AX6A 3DN5A 4UC5A 1XYFA 1U5JA 2BHUA 2BZNA 3BQ5A 4WSJA 4UOJA 1S5TA 3AC0A 2XFYA 4I9MA 2DQWA 4B5NA 1LM1A 2Q8LA 2W62A 4EPDC 3CUIA 1JFHA 5LNWA 2OPJA 2PLMA 1XDLA 4YLWA 5CAKA 1UR1A 1UQZA 5EMKA 3QY8A 4GUJA 1TPDA 3WF1A 3WFAA 1OIMA 1A5UA 2FIQA 1XV8A 5FEWA 2ONEA 1FCVA 1XI3A 4B5VA 3ARYA 1XIBA 5F2GA 2PWUA 1WKFA 5BROA 1E9LA 4IPNB 3T2QA 2RGMA 4CNOA 2GJNA 2AKZA 4ADTA 2JIWA 2WLYA 3QH2A 2WSYA 1VFHA 4Z2GA 4H6KA 1IZKA 2CIPA 5AHLA 3BJFA 1TVLA 1XISA 4HK6A 3W73A 4PUMA 1EL3A 3BTNA 1FFRA 1SVDA 4Y9NA 1A5KC 1MNSA 4F66A 5HUPA 2PZ0A 4CKQA 3UZYA 5KINA 3A64A 1EYEA 2O9RA 3KDOA 3BGAA 5DT7A 3LU2A 1EUNA 1KBJA 3WX7A 1LL4A 3ORWA 3HQ1A 2J9ZA 4U31A 3R1ZA 4AYGA 6PTDA 4KWOA 4C7DA 2VC9A 1MUCA 4JKMA 3RAOA 4YXGA 3OU8A 1OYCA 4JFUA 4JIEA 3T8QA 2OGJA 4TVUA 4UFLA 4C1KA 4LUSA 5C9WA 4IISA 3FA5A 1DJQA 1ZPTA 4NZ5A 5AYXA 4QQUA 5C9XA 1MXGA 2GOUA 5JU6A 2WK2A 1JCYA 1Q2SA 1TV4A 1ZJAA 3V4BA 3NL6A 2EQDA 1HJSA 4IFRA 3ZT7A 2PC8A 3I3EA 1W8SA 5GNXA 3H55A 3CQ0A 3A4XA 4HK5A 1PL9A 4NYUA 5I3GA 3ABSA 3SJ3A 4GI8A 4MADA 4MJ4A 3NZ1A 4KEZA 4Q8VA 1CT5A 3SEPA 3DBPA 1DIOA 3HOJA 2FH6A 2QS8A 3I3BA 4IICA 3DYOA 1ISYA 3BG5A 3ENLA 3WF4A 2ZA2A 3K4WA 1EDGA 1UUQA 4NNBA 3VD9A 4Z08A 3R7MA 4JTGA 4PGLA 3FK4A 4DLFA 2BGQA 3U2CA 1TPUA 3IS4A 2E0PA 3ONCA 4RNHA 4EANA 1GVRA 2XWDA 1M41A 4JTJA 3ITOA 1SM9A 2EPLX 4W88A 4M8UA 1NOWA 1ZJBA 4UR7A 2ATMA 3QBUA 3GXFA 4NZ4A 5HMSA 1XBYA 3BO9A 1AQFA 4HB7A 3B9DA 2R14A 4DF1A 3CZEA 4OE7A 4JIRA 3W6MA 4G56A 4I6KA 1C8YA 3O7UA 2ISFA 2QCFA 3KEHA 4FNTA 3O9NA 1UJPA 3DFSA 4H04A 4MDOA