3SIMA

Crystallographic structure analysis of family 18 chitinase from crocus vernus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
275
Chain Sequence
TLFVEYIGYPLFSGVKFSDVPINPHITKFQFVLSFAVDYTASSPHTSTNGKFNVFWDSSILGPDQISAIKSSHPNVRVAVSLGGASVGSNTVQFQAASVDSWVSNAVTSLTRIIQRYNLDGIDIDYEHFQNTDKNTFAECIGRLITTLKKNGVISFASISPFPSVDEYYLALFNEYKNAINHINYQFKAYDSSTSVDKFLGYYNNAASKYKGGNVLISFSTGPHPGGLPVDKGFFDAATSLKNKGKLHGIAVWTADTSKSSDFRYEEEAQAFLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein, Family 18 Chitinase
publication title Crystallographic structure analysis of family 18 Chitinase from Crocus vernus
rcsb
total genus 95
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3simA00
4OKDA 2BS9A 4IPNB 3ZSTA 1BTCA 1C7TA 2WWCA 1ZB5A 3U5YA 4LYRA 1E6SM 3GM8A 2DIEA 1W9XA 2E40A 1PPIA 4QCFA 1MQPA 1TR1A 4CN6A 2AAAA 1KXVA 2YBTA 4UFLA 1QHPA 3T2PA 1JI1A 4UQ9A 1HF6A 1Q6CA 4ACZA 2ZUMA 2VX7A 4ACZB 2HVMA 3WF2A 1DWFM 3VOCA 1CDGA 4NRSA 4HPGA 1V6UA 2OSYA 1F4HA 4MJ2A 1DWHM 4UTFA 1G9HA 3TP4A 1QNQA 3MSDA 2X0HA 3VGDA 4GO9A 3WD1A 3DYMA 4KRTA 3VX0A 1XV8A 2J77A 3EDEA 4M8UA 2ZUTA 3UCQA 4D1JA 4KGLA 3W29A 2BHYA 2XYLA 3WBEA 1LL7A 4AD4A 2FGZA 1H3GA 3BH4A 1CWYA 3FY1A 4PTWA 1UZ1A 3VX1A 4AYSA 4JL2A 2VX6A 1LWHA 1VENA 1GZJA 3W24A 1KWGA 1JF5A 5IFPA 5CSYA 4WKFA 1C90A 3VNZA 5A8MA 1E6ZA 3ALFA 4CCCA 3POHA 3RM9A 2CIPA 5KZ6A 4H8VA 1EQCA 3FHAA 2DT2A 5HDRA 4Z2GA 1GOQA 1B30A 4CD5A 3VKKA 1B90A 1WAWA 4PEEA 3AMGA 1RPKA 1IZJA 4DUVA 2A3HA 1RP8A 4A4AA 1GONA 2O9RA 1M53A 2DSVA 3VD9A 4GXPA 1BFNA 4CU7A 3CHCA 2OSWA 1V02E 2CBUA 5AY7A 3F5KA 3VTRA 4UCFA 1US2A 1H0IA 1ZBCA 2XVLA 1W3HA 1AVAA 2VL4A 2XHYA 4TTUA 1KB3A 1J0YA 3DYOA 2PWDA 2ZX8A 3GXIA 1E6PA 5I2UA 4CUCA 1JD7A 4W7UA 4V2XA 2EPLX 3MMDA 3QHNA 4BQ3A 3ZIZA 3WH8A 4B15A 1XCWA 2YL9A 1MVYA 2D1ZA 2WHLA 3PZMA 4W8LA 1LJYA 1MW1A 3N18A 2J7BA 2DT1A 3AZTA 3W4RA 1JDCA 3KL3A 1DWJM 1R87A 4H8HA 3ZJ6A 4AMCA 3WEMA 3QHOA 3GNOA 4D71A 2J79A 3A47A 3CH9A 4HTYA 4UZSA 3PZTA 1JIBA 5LYRA 3ZOAA 3BCFA 3POCA 1UG6A 3MMWA 3VGBA 4M29A 4E8CA 2WKGA 1UWSA 2OLHA 4GKLA 1UD8A 4HOZA 1BYAA 2ZX7A 2A3CA 5I24A 3B9DA 4U31A 4V28A 4B3LA 3AHXA 1GPFA 4AXNA 3MMUA 5FL1A 2V3DA 3OB8A 2ZUUA 1OD0A 5JBEA 1PZ2A 3VDCA 2XSAA 4X0NA 1GVIA 4MB3A 5A69A 2J8GA 3BAWA 5CXPA 4W7VA 4PBGA 4TVCA 4UNIA 5D9MA 2CPUA 3KL5A 3BSHA 1C93A 3AYSA 2CBIA 4E2OA 2CITA 1PBGA 1QNSA 1XHGA 4AZ5A 4D6DA 1X6NA 2OYKA 2UY2A 1CGUA 2XWDA 1E15A 2WMGA 2OYLA 3VMPA 4MTVA 4WJXA 3F4VA 2FHFA 1EDTA 4D6CA 1W1YA 1CLVA 1VFOA 3TONA 5AC4A 5BXSA 1E4MM 3AS3A 3VM7A 2DPEA 3GH5A 2X05A 1HVQA 4ZE5A 1E1FA 2UY5A 2JFEX 4GINA 1ISXA 1E6XM 4GI6A 4H2CA 2VURA 4PCSA 3G6LA 1VEMA 4L4PA 1BYBA 1RD6A 1S46A 3DC0A 4GI8A 1UR4A 4P7RA 1OB0A 4TX6A 5BRPA 3VGGA 1E3ZA 1V6WA 3PZVA 5BRQA 2XIIA 2XVGA 1JFHA 4UOZA 2Y4SA 4P8WA 3WQ8A 2PWEA 2OYMA 4J3UA 1DEDA 3MUY1 1UKQA 5CJ5A 5M3WA 2G3IA 2C7FA 1HJUA 1EA9C 1HJVA 4CD8A 5IDIA 3DHUA 4S3JA 3UR7A 4MADA 1EDGA 1FA2A 2XPKA 2D3LA 4HP5A 3GBDA 1E6NA 3THDA 3A4XA 1ZBKA 3RDKA 3WH9A 1V0MA 1UH2A 4J3SA 3UG5A 4WSJA 1OD8A 5DEZA 2F8QA 4W7WA 1KGWA 3AQUA 2XUCA 2VCCA 5ECUA 2WB5A 3AMDA 4ACYA 2WC7A 3W6LA 3BAIA 2DT3A 2J7DA 4GPNA 4YHEA 3NSMA 3A6OA 1PX4A 3VPLA 4PMUA 3OGRA 1JYNA 3WNKA 3QOMA 1EH9A 2Y8KA 3WKZA 2D2OA 3SUSA 1DP0A 1W3KA 4P8XA 1UKTA 3VGFA 4W8BA 4F9DA 4MNMA 1UHVA 5D8WA 1E56A 3CTTA 3OG2A 3L4VA 3VDAA 1EDQA 4TXEA 1GQLA 3WFLA 3AIWA 1CZ1A 4XZWA 2YL8A 3WSUA 1KXTA 4XX6A 4UOJA 4MPKA 3VIFA 2E8YA 3VIOA 3ZR5A 3WDIA 1C8YA 1CGTA 3APGA 4W5UA 1G94A 5GPRA 2XGBA 4BQ5A 3VUPA 5C70A 4MB5A 1I1WA 3VGEA 5JIWA 1CBGA 1BQCA 4J3TA 5A6AA 3WQWA 3NCOA 3L4XA 4OUEA 3IAQA 1PAMA 4JKLA 3KZSA 3TTSA 3GZAA 2PI6A 1G01A 3AI0A 2Y24A 3UEQA 4E8DA 1E40A 3M7SA 1W3LA 2XWEA 1NM9A 3VIMA 4GZIA 3ZM8A 1JYWA 1CGWA 3K8LA 4JHZA 4YHGA 1TE1A 3UETA 1HKMA 2VC9A 2DSWA 5I23A 2WMIA 1K9TA 2WMIB 1UA7A 4TUFA 3SCTA 3PTKA 2OWXA 1W2VA 3FNDA 5E70A 4ZXOA 2VTFA 1R7AA 1K9FA 1W2PA 4B16A 4PMOA 1UD5A 1C8XA 2WANA 2D0FA 2V5DA 3GDBA 3ZMRA 1W9VA 4V27A 4M56A 1VFFA 4PMRA 3U7VA 3M07A 3AXXA 2GSJA 1HJQA 3AIVA 2CEQA 2DH2A 4FF5A 4ATWA 1VEPA 1E70M 4UFJA 1G0CA 4B9ZA 2DGAA 1QBAA 1U2YA 3BAXA 2EPKX 4M1RA 2EPNA 1GOKA 3SEPA 4AZGA 1QVBA 5DO8A 3WDRA 1J0JA 1IV8A 3VD7A 4ZFMA 1H41A 2VR5A 1UWTA 4XV0A 1QBBA 3HN3A 4UZUA 3SCOA 4J3WA 3WDJA 1OBAA 5A3HA 5IXEA 1B9ZA 1M7XA 4C7DA 4LYPA 3B9EA 4Q22A 1TVNA 1XSJA 1DWIM 2J7CA 1V3LA 3CHEA 1B31A 1GQKA 3OLGA 4JHOA 2J7GA 3OIHA 1CYGA 1H49A 4HU8A 1XRVA 3VMNA 3PZUA 1UKPA 1WE5A 1JZ5A 1OWQA 3TTQA 2WZEA 1FHDA 3UR8A 5A6BD 1Q6DA 3T09A 2NT1A 3CIVA 2FH6A 3W25A 4Z2LA 2G3JA 4UQEA 4AZ7A 1BHGA 3CO4A 1UD3A 5BWFA 5A2CA 2TAAA 1UD4A 1XH2A 4A3HA 2CHNA 1NOWA 1CENA 1JG9A 2DH3A 2W91A 2J47A 4S3KA 1GJUA 3N1AA 2X09A 1GQJA 5I77A 1E73M 1B3YA 1QPKA 7CGTA 3WD4A 3ARWA 4C7GA 2E8ZA 2E9BA 3DHPA 3ARQA 5E0FA 3RPMA 1ZJAA 1WZMA 4R27A 2EJ1A 3PTMA 1UQYA 4K68A 1HJXA 1WDRA 1NWTA 3J7HA 2CXGA 2D20A 3S6TA 1JZ6A 3AS1A 2XIBA 3N15A 4H41A 1E3XA 4UOQA 1W9PA 5A6MA 4RE2A 3WH5A 2XG9A 1R8LA 3MUAA 3VMOA 3WMBA 4UQBA 5LA2A 2VRJA 5FOOA 3TTYA 3CPUA 1QHOA 1JFXA 2J25A 1U33A 4J28A 3T08A 1UR8A 3UG3A 1JI2A 3IJ8A 4MB4A 4CCEA 4EE9A 2CHOA 2G3MA 1VIWA 1UWQA 1SMDA 1SMAA 5A8OA 2O92A 2VO5A 4NZCA 4UQAA 3WIJA 4OBRA 2BY2A 3AROA 3O2LA 4U33A 3AZSA 1HL9A 3RIKA 1BF2A 3VD4A 1E72M 1ECEA 3N13A 4AD0A 5A6BA 3PN8A 2BHZA 8A3HA 5CSUA 3WL1A 3EMZA 2WW5A 3RILA 5EMYA 4BS0A 3AICA 4AIOA 4X0VA 5LA0A 2E9MA 2YA1A 4D1IA 4U3CA 1U30A 5DF0A 1L8NA 4CVUA 3L4UA 4F66A 1HP4A 3WD0A 4LXFA 1W9DM 4X9YA 2XFYA 3VD5A 1NWSA 1H4PA 2WK2A 2VRQA 5HPOA 4DWSA 4W86A 1KGUA 2XJ7A 4DWSB 4LQ1A 1OGBA 2ZX5A 4CU8A 3U57A 3LPOA 1CNVA 1LLOA 1JZ7A 2D22A 4RE4A 2ZXBA 5TD4A 5IHRA 1ITXA 1KWKA 4J3XA 3N11A 3CUHA 3WNNA 4JIEA 2VX5A 1J01A 1QI4A 2XVPA 1Q4NX 3B9AA 1FHLA 2JF6A 4DM2A 1HL8A 1WP6A 1P6WA 2GDUA 4W88A 1BYCA 1QOXA 3CHDA 1C8QA 1EHAA 1OGGA 4PMNA 1UUQA 4P7NA 2WMFA 3IK2A 3OLIA 3VO0A 4W8AA 4Z2HA 4OJYA 1J12A 4PMQA 4TX8A 7A3HA 4FK9A 1UKSA 4C7FA 3VIKA 1J0ZA 1VAHA 2J78A 3AIBA 1J18A 2XSBA 3ARYA 4NSBA 2PWFA 2VVNA 1ISZA 1UWIA 3OLEA 2WVVA 5EB8A 4GO8A 2WVSA 1E9LA 2WVVB 1C91A 2VVSA 5JBDA 1ISYA 1GOOA 2DDXA 4KGJA 2Z1KA 3L4TA 2CBJA 1WKYA 3NJ3A 4ZENA 3WNOA 2WYSA 3RM8A 1CTNA 1PZ3A 2WMKA 4WKHA 1JD9A 1W1VA 3BLKA 2CKRA 1V0NA 5AYBA 3WNPA 5CQ1A 1ISVA 1W1TA 2VZVA 3N12A 1ODUA 1MXDA 1EQPA 3AXIA 3GTNA 4QLJA 5HNNA 8CGTA 3WUBA 2ZX9A 1XC6A 3AIRA 4CVWA 2VQUA 2WVUA 2F61A 2VZOA 3EMQA 2GUYA 1V6VA 2YKKA 1UR0A 1I1XA 2WXDM 3GNRA 2GJPA 5FL0A 2PB1A 2C0HA 2XVKA 1GOWA 3T2OA 4M82A 3FHQA 3QGVA 4AEEA 1VJZA 5D9PA 2W66A 3SUUA 2XM1A 4AZBA 4EK7A 1MWOA 3SUVA 1E55A 4AISA 3K8MA 1JDDA 1L0PA 1CLXA 1DTUA 3PZGA 3MUZ1 3K4AA 4PYSA 2O9PA 2VZSA 2CETA 3TTOA 2CYGA 1PIFA 1NH6A 5DFAA 2EPOA 1M01A 2XFRA 4LYQA 1KGXA 3AIEA 1UWRA 3AS2A 3W53A 4MNKA 3ZSSA 1JAEA 3NDZA 1H09A 2PWHA 1CXLA 2WLYA 4UFIA 4D72A 3MANA 4KH2A 4PMDA 3WQ6A 1EXPA 4NI3A 2J4GA 5M17A 3OGSA 3OZPA 3VDHA 3OA5A 3DYPA 5BROA 4URIA 1D3CA 1VFMA 1V3KA 3W81A 1CXKA 3WH6A 3VU2A 4PCTA 2JEQA 4Q7NA 2DIJA 3M6DA 4AD1A 4H8UA 3U5UA 4TVDA 1NOUA 3WMCA 4Z2JA 3EDKA 1C3FA 4HA4A 1TFVA 1CGYA 5JIPA 3PZNA 1QNRA 4BQ2A 1KCKA 3NUKA 4AWEA 3CUJA 1RP9A 1IZKA 3ZJ8A 1OIFA 2XGIA 1HN1A 4WKAA 1K9EA 3AJ7A 4HOWA 1JYVA 2E4TA 4TOQA 4U5IA 2XM2A 1LG2A 4BQ4A 2JE8A 5DMYA 1JDAA 3GBEA 4EANA 4NF7A 4HU0A 1OCQA 1NP0A 1KR0A 2WMJA 4MDPA 4GIAA 1BVNP 4TVUA 2VMFA 3PZ9A 3ZO9A 2EPMX 3WMSA 5CG0A 5IFTA 1V6XA 3I3DA 5CZKA 3PHAA 1UQZA 4LX4A 1UR1A 1JZ8A 3S2CA 1V3HA 3CZKA 4FLOA 1TMQA 3MV01 2JEPA 2CESA 3SCUA 1HNYA 2FHCA 4JCMA 5BXRA 3W38A 2ZXDA 4B3KA 2WNWA 4AD3A 1LL6A 1NWUA 4HMCA 4L4OA 3KE0A 3WL0A 3AHTA 4LPCA 4QLKA 3ARRA 4XB3A 1NWRA 1HKIA 1UA3A 1OT1A 2VOTA 2J62A 4AZCA 1WNOA 2J75A 3CUGA 4D6FA 3A3HA 4AZCB 1V08A 1AQ0A 3OGVA 3CZLA 2ZUNA 4JKMA 1XGZA 4N42A 1JGIA 1VBRA 1HXJA 1QI0A 1WO2A 2G8ZA 2WBKA 2PC8A 1H1NA 5F7UA 4F8XA 1XYFA 2YDSA 2V3EA 1TG7A 7TAAA 4CD7A 1JZ3A 3N04A 2X2YA 1DWGM 4PMYA 1FH9A 1HKJA 2XTKA 1W1PA 4IUGA 2EO7A 3AYRA 3QHMA 2IXVA 4MAVA 2ZWZA 4HZ8A 3PTQA 5DT7A 5HXMA 3BCDA 1H11A 4GQRA 4A3YA 3L4YA 1XD1A 3RM4A 4CN1A 4WF7A 1V03A 2V3GA 3EDJA 2YA2A 4JCLA 2VUYA 1HX0A 2JIWA 1AMYA 2AOSA 4YN5A 4CU6A 1E0WA 4P8VA 2WVTA 1VFUA 3WENA 2WBGA 1V0KA 1B3VA 3WUGA 1QW8A 2EBNA 3NIYA 1W32A 1E6RA 2E0PA 2FGLA 3I3EA 1MW2A 3WD2A 3AMLA 6A3HA 5BYWA 1Y7VA 1NP2A 3UG4A 4AC1X 4BA0A 1FP9A 4W84A 3VIPA 2XVNA 1VEOA 4W85A 3K4DA 2CERA 5LA1A 3EMCA 3HMCA 3LPFA 3WD3A 4DM1A 1VF8A 3FW6A 2O9TA 3AIUA 4AW7A 3SIMA 3CMGA 4HA1A 4JFWA 1JZ4A 4IPLA 3AHYA 4NRRA 4D6JA 2DSKA 2YJQA 2ZICA 4QLLA 2EQDA 2BHUA 3W6MA 2BY1A 3QR3A 3RJXA 2D3NA 3PBGA 3WN6A 1LWJA 3D3AA 2WHKA 1KBBA 2WCSA 4WK9A 4JAWA 4U2YA 1PIGA 4CD6A 1ZU8A 1WDPA 2WC4A 4OIFA 1ESWA 4XUYA 3VM5A 4MNLA 2HISA 2WC3A 2RGLA 1GOIA 4YPJA 1D2KA 1E4LA 3GXFA 1KCLA 4AY1A 1B2YA 3SCVA 3W37A 4FLQA 1WDQA 4PSRA 5BXPA 2X8RA 3FAXA 2YLLA 4EAMA 4PMZA 4J27A 2CCRA 3TA9A 3WF0A 4BZYA 3CUFA 4HA3A 2YOCA 4P8UA 2QPUA 1LL4A 1K9DA 3SUTA 3ARPA 1QW9A 3F5LA 5BXTA 3HU7A 4WSKA 5I6SA 2E9LA 2PBOA 2JALA 3VIGA 2BY3A 3MSGA 4F79A 1HP5A 1VB9A 2W5FA 1D7FA 1J0IA 3VILA 3BAYA 4QCEA 1V3IA 1R86A 2BXZA 1JXKA 3F5JA 1OGSA 3B8SA 3WH7A 1G1YA 3WNLA 5M03A 1G5AA 3FN9A 5CPSA 2FHBA 3ALGA 2YIHA 1QI2A 1E5JA 4WIWA 1BYDA 2NT0A 1O7AA 1IT0A 5KEZA 1TZ7A 2CBVA 5FCZA 5GNXA 1FFRA 2A3EA 1UH3A 1X6LA 5FKYA 3VDBA 3A4WA 2AMGA 3GNPA 1GNXA 4JL1A 2BXYA 3CZJA 3RO8A 1B0IA 4M24A 4P7LA 1VJSA 1GUVA 2WCAA 2PF0A 4OOUA 1EHNA 1CXFA 1E0VA 4DUWA 5D4YA 1KFWA 4P7OA 5EFDA 1TCMA 1UWUA 3ZJKA 2A3AA 5A8NA 4ZEPA 1NOFA 3G6MA 1GOMA 2DEPA 4M81A 1H0GA 2DQXA 1J11A 4ML4A 2Z1SA 1UZ4A 3D5HA 2WSPA 3SCSA 9CGTA 1UR2A 1CPUA 4KMQA 1YHTA 3ARZA 3CGTA 2EXOA 1UYQA 5A6LA 5CLTA 1B3WA 1GJWA 4B9YA 4RE3A 1MYRA 1JXJA 4PTXA 3VVGA 4U3AA 3W82A 2BFGA 2YDQA 2YBUA 2VCAA 3CZGA 2JIEA 1C92A 4AZ6A 4H7VA 1ZBVA 1Q6GA 2GJRA 2D0HA 2G3NA 2D23A 4IM4A 4W89A 1A47A 5HOSA 2VZTA 1XD0A 2D24A 1CGXA 1N82A 1US3A 3MV11 4GI9A 2WHJA 1X1NA 4QFUA 5ABFA 2NW0A 5ABFB 1KXHA 2ZWYA 2VJXA 3L4WA 2WLZA 3VIIA 5GQBA 1DWAM 3GH4A 5A8QA 3ARTA 2GDVA 4ZE4A 3SCPA 1GHRA 2WMHA 2Y5EA 1BVZA 2OWWA 6TAAA 5CPTA 4M80A 3NSXA 1B3ZA 3WDQA 2ZXQA 2MANA 1FOBA 2W4XA 4CGTA 2BY0A 1WZLA 4PSPA 6CGTA 3CBWA 4DUXA 1JL8A 3MUIA 3T0AA 1Q6EA 1B1YA 1BAGA 4U5KA 3AHZA 3EDFA 3WF3A 4HPHA 4R5EA 1KBKA 4J7RA 2ZUVA 3WNMA 4TTGA 5I0DA 4HZ6A 4E4PA 3IAPA 2PWGA 4HMDA 5E6YA 2YLAA 4P7QA 2V3FA 3THCA 2J7EA 3W27A 2VZUA 4JFTA 2ZUSA 1AQHA 4KWUA 3AIQA 4GZEA 5IHSA 2CKSA 1KQZA 4PMXA 1GORA 2BV9A 1SR0A 1C7SA 1M03A 2FH8A 2D0GA 1BPLB 3AISA 1UH4A 1W3JA 4CN4A 4JKKA 4J3VA 1DHKA 1SFSA 4QP0A 3RJYA 4LGXA 3ZR6A 3I3BA 4JFSA 5EBAA 5AC5A 5I79A 2YA0A 3MO4A 1ZL1A 4D6IA 1A3HA 1KXQA 3W0KA 2IUZA 3K8KA 2ZOXA 1E1EA 5JUVA 4GZJA 1CXIA 3MS8A 1WDSA 1LG1A 1MFUA 2W62A 4PTMA 1BLIA 2C8NA 2BVDA 1EOKA 1HJWA 1PEZA 3EBVA 2ZX6A 2V38A 1TA3A 1W9BM 1V6YA 2DT0A 3W28A 3WELA 1TA3B 3AHVA 5CGMA 4PUEA 4Y7EA 1H5VA 1R7OA 1MFVA 1UD6A 3T0DA 3WF4A 3E1F1 5A94A 1OINA 4UFMA 1HT6A 1CGVA 3AOFA 5ABEA 3MKKA 2YDRA 4XZBA 3CMJA 4FMVA 1KQYA 1XSIA 3TOPA 2J7FA 1BG9A 4MJ4A 1ODZA 1CECA 3VNYA 3ECQA 2J7HA 1LQ0A 3ARUA 4MAZA 3AFBA 4D6HA 1XCXA 4UQDA 3WUFA 3NDYA 2EEXA 1E71M 4W93A 4AD2A 1NQ6A 3OLDA 1KR1A 3JUGA 2X0YA 1WCGA 3KL0A 1J0KA 5CPQA 1XYZA 3ZJ7A 2QHAA 5EFFA 1MQRA 1E4NA 2CNCA 2G4FA 4BCEA 1TVPA 3SCQA 3BMWA 1M04A 1HJSA 3BMVA 5FIPA 3LPPA 3L2LA 4N0RA 3K1DA 5D9OA 3ZT6A 1V3JA 5BCAA 5CLWA 3FXYA 3CUIA 2IXUA 2O9OA 1F4AA 2V5CA 3CZ8A 3OBAA 2OSXA 1E5NA 1MXGA 4BF7A 3L4ZA 5A6KA 5I5RA 2PBGA 1QI3A 5M5DA 2DSUA 1VRXA 1ISWA 3M46A 1OM0A 2GFTA 3AMCA 2YL6A 2ZUWA 2QV4A 3GYCA 1RH9A 2WPGA 5A6SA 2VRKA 1WZKA 3VGHA 4AIUA 4F9JA 1CXEA 3BSGA 4D6EA 1JNDA 1FH7A 5C8BB 3LPGA 3CZEA 1H2JA 2UY3A 4QAWA 1FP8A 4W5ZA 2Y8VA 1I75A 5JBFA 3WEOA 1J9YA 3SCNA 1WB0A 3UESA 1GCYA 2RGMA 3RCNA 1O6IA 5I3DA 3N9KA 2BVYA 4OZOA 2J74A 1HVXA 1R85A 5D8ZA 1GQIA 3AXHA 5AYIA 3T0BA 2UY4A 5E9AA 3WQ4A 2UWFA 2WSKA 4MNJA 3WQ5A 1B3XA 4FLSA 3ZT7A 3O9NA 3PZIA 3HJEA 1HKKA 1W91A 2GVYA 3IANA 1XH0A 2ZXAA 2YL5A 4AD5A 1VBUA 2DSZA 1PX8A 4PUDA 4JZ5A 4CCDA 3OZOA 3GXDA 1EGZA 3ARSA 1JF6A 4AEFA 3WF1A 2ESCA 3T2QA 3WFZA 1JYXA 2E3ZA 3SCRA 1JAKA 5GNYA 2A3BA 2W92A 2Q8XA 1QI5A 2WZIA 1ITCA 5HPCA 1EIBA 4WLCA 4U2ZA 2WCGA 1W9UA 1J0HA 3EDDA 1MW3A 5A6JA 1CXHA 2VNCA 2ZE0A 2NSXA 3PZOA 4UFHA 3EYPA 3ARXA 3BXWA 3W26A 2VQTA 2W67A 1BGGA 1QNOA 3CLWA 2WM0A 2WWDA 4Z2KA 3CHFA 5A95A 4AZHA 1Q6FA 2WKLA 5CGTA 3SUWA 1E0XA 4HMEA 4ZXLA 3UERA 1GW1A 1JNEA 1UOKA 3WEZA 4RL3A 1EO7A 3N17A 3KEHA 2F2HA 3AS0A 3FAWA 2JF7A 2QMJA 3PZQA 1UKOA 5I78A 1BGAA 2ZIDA 4HZ7A 1BG4A 1LF1A 1NARA 1QHZA 2GJXA 3ARVA 1MW0A 3WDHA 1FFQA 2B31A 2GJXB 5A2BA 3II1A 3WUEA 2W63A 1XH1A 4ATLA 5A1AA 5ABHA 2G41A 4OOZA 4DWSC 3VD3A 2VX4A 1PX3A 1TUXA 4MB1A 4GQQA 3RMEA 2X1IA 1FH8A 3WDPP 4AIEA 4CD4A 5DT5A 2XFFA 3IJ7A 3KWXA 3L2MA 4H04A 1QNPA 1E6QM 5C71A 3LMYA 2QPSA 4Z2IA 4W87A 4FLRA 1V3MA 1E43A 1J10A 4KRUA 2VT0A 3WY1A 3K46A 4JFVA 3BGAA 1SYTA 3NSNA 1UR9A 3BAJA 1E4IA 3GH7A 4EKJA 1EOMA 5E0CA 1V0LA 1BSIA 1GVYA 5ABGA 5E6ZA 3WBAA 3IJ9A 2VCBA 2GK1A 5GNZA 2GK1B 4PRWA 1CEOA 1OSEA 5E09A 1V02A 4JFUA 1ZJBA 3GXMA 4OBSA 3QOKA 3AMKA 3ZQ9A 3ZT5A 1JZ2A 2BNJA 3BLPX 1PJ9A 2WHMA 3VIJA 4AZIA 3SURA 2QLYA 5HBFA 3BC9A 1GHSA 4ATDA 1XSKA 3MU7A 1K6AA 3BAKA 1ZS2A 2WAGA 1WPCA 1CIUA 2BVTA 4PN2A 4PTVA 1WZAA 3VIHA 4DWSD 2VI0A 4D6GA 3NYDA 2FDMA 4UFKA 2W61A 4QDMA 5D9NA 1OIMA 1UD2A 1YQ2A 4MDOA 1EO5A 3U7BA 4IISA 4PMVA 1HIZA 1ZBWA 5A8PA 4UQCA 2QF8A 1AQMA 4HOXA 2WZHA 2OWCA 1MQQA 1Z32X 4UR9A 3WQVA 1OT2A 2VR4A 3VINA 2QMKA 4CKQA 3DECA 5FD0A 3A4AA 3AZRA 3O6AA 2J8FA 3SCWA 5A2AA 2Y2WA
chains in the Genus database with same CATH superfamily
2BS9A 1L2UA 4PCPA 1A49A 2PP3A 3IWPA 4I9TA 7REQA 3U5YA 3R25A 1X97A 1S1PA 4H83A 1BWKA 4QISA 1US0A 4CN6A 3KBMA 2V0TA 3NZ1A 2OR2A 1VJIA 2Y7DA 1N8FA 4ACZB 3RMJA 1DWFM 1O68A 4J40A 1CDGA 4HPGA 2PDIA 2IQ0A 1DWHM 4UTFA 3IK4A 1G9HA 2YFOA 5HMSA 1QNQA 3O07A 3R1ZA 3R89A 3WD1A 4KRTA 5C5YA 4KIEA 4M8UA 4NAEB 4WY0B 4FF7A 4D1JA 1XW8A 4KGLA 5C0QA 2BHYA 2BODX 1TPH1 1O5KA 4IPIA 4JS3A 4GI4A 2FGZA 1CWYA 3FY1A 5KSWA 1RQEA 1UZ1A 4AYSA 4ML9A 2VX6A 1LWHA 3UZXA 1VENA 1GZJA 1C90A 1VIZA 1E6ZA 1JQVA 4CCCA 2YGYA 2H3DA 4L64A 1BF6A 4H8VA 2D2JA 4EOUA 2DT2A 4NAFA 5HDRA 1GOQA 3GWQA 3JW7A 4CD5A 2ACRA 4FIQA 1WAWA 4PEEA 1RPKA 1W8SA 2A3HA 1Z7AA 2REQA 1GONA 1RQBA 3O15A 2DZSA 1FWNA 2VD8A 3QBUA 3VD9A 5AY7A 5RUBA 4Y8EA 4HT3A 4UCFA 1US2A 1A0EA 1EJVC 3M64A 1ZBCA 3Q65A 3L5LA 4NXSA 2XHYA 2I14A 1FTXA 1KB3A 4G5DA 4ALDA 1E6PA 5I2UA 3ZIZA 3WH8A 4LTSA 4DBWA 3STCA 1WDWA 2XH7A 2PC4A 4FALA 1UROA 3MHUA 1LJYA 1MW1A 3FCPA 3ONCA 2C1IA 2J7BA 1I0DA 3W4RA 4XKMA 1UOZA 1DKWA 3QSTA 2BGNE 1TTIA 4D71A 4Q4OA 4ZMGA 4EF9A 1G67A 2QCCA 1MEHA 1ZY9A 4PB4A 3TWAA 3POCA 1YNPA 4GHRA 5I03A 2WKGA 3ITVA 1UWSA 1UD8A 3AWOA 4HOZA 4DUOA 2ZX7A 4ADTA 2NX9A 4LH8A 4RJEA 3AHXA 1EJWC 2PURA 3V1HA 1MDRA 2ZUUA 3H8AA 1PZ2A 3Q58A 2PDXA 1GVIA 3TZNA 4MB3A 1WKDA 5A69A 1O95A 4TV5A 5F1UA 4PBGA 5K4ZA 4TVCA 3N3TA 1POKA 2BASA 1M6JA 2RHGA 3BSHA 1JJKA 3AYSA 2W3ZA 3V0TA 3H24A 3TE9A 2CITA 3KBWA 3RX4A 3S83A 1PBGA 1QNSA 1H7OA 2XIJA 1X6NA 4K7VA 3DGRA 2BLEA 3PBYA 1X6UA 2A7PA 1EDTA 4JIRA 1CLVA 1VFOA 3A3XA 1IGSA 4JQ2A 3WK1A 3AS3A 5FI8A 4C6OA 3G1YA 2UY5A 2XGZA 3B8WA 3KXQA 3GG7A 2VURA 3O6YX 1BEUA 1BYBA 5CJNA 5LIWX 4G8TA 1UR4A 1OB0A 4LUSB 5BRPA 1P6BA 2Y5JA 4M7TA 4E0CA 1YNYA 3GX9A 1V6WA 3PZVA 2XVGA 3B40A 4LALA 1UZDA 2OYMA 1RJQA 2E5BA 3F4DA 1K8ZA 2G3IA 3NG3A 2BX7A 2DZWA 4N02A 5IDIA 1RBAA 2KX9A 3I7QA 1GG0A 2V69A 4J5NA 3LOTA 4PRTA 3AO0A 3KDNA 3EOUA 1OFRA 3UG5A 2ZZ7A 1OD8A 2F8QA 4D8AA 3KCLA 2PDJA 1L8PA 4AU0A 3W2LA 4POCA 2ZYFA 2AKZA 2DT3A 1ADOA 1JYNA 9XIAA 3WKZA 2D2OA 2DZPA 5HUOA 3SUSA 3B04A 3LLFA 3QZAA 1P0DA 1CI1A 3MYPA 3DI0A 1UKTA 5C9RA 4W8BA 3PFMA 5CZ0A 5KITA 1H7RA 2NSOA 5XIAA 1AZ2A 4OVXA 1RA5A 1FUYA 5E9XA 1XBVA 3CTTA 3VDAA 1XL9A 1GQLA 1ELSA 2PWUA 5HNTA 2ALRA 4UB9A 2YL8A 2G5WA 1KXTA 4XX6A 2DU2A 5CCZA 4KEUA 4JGDA 2Z29A 3MT1A 1KBIA 4GD0A 1Y0EA 5CBBA 1WOAA 2YYTA 2XGBA 2WZTA 4BQ5A 5C70A 3GU1A 1IZCA 3M0IA 3VGEA 5JIWA 2WNQA 1XLLA 4GGHA 4O8RA 4Z1YA 1Q3NA 1YDVA 1QMLA 2Y7EA 3L4XA 3A5VA 3IAQA 1PWMA 2NQLA 4XIMA 4CQCA 3F4NA 3GZAA 2PI6A 4IMGA 1L6SA 3UEQA 4CCZA 1EJUC 3F03K 3VIMA 4DNHA 3NL2A 1JYWA 3FDGA 1MI3A 3ITOA 3WLSA 3BO9A 3AYVA 2WMIB 1EYEA 4HSOA 5LIUX 2ISFA 4K1WA 2GJNA 5CKSA 5E70A 1H7XA 1K9FA 4B16A 3WQOA 3I10A 4RZBA 3P81A 1IXPA 1QOPA 4GX8A 4M56A 1E9IA 4TR9A 3U7VA 4BJHA 3AXXA 2OMAA 3GVRA 4Z42C 4XZMX 1HJQA 2GJLA 5F2IA 3VYLA 2HQAA 3TR9A 4UFJA 4ZQPA 2F6UA 1N7KA 1FWHC 1U2YA 3QXBA 4J4KA 2C6QA 1P0NA 2CLFA 2EPKX 2FPYA 1NIUA 3KLKA 3XIMA 1GOKA 4HYRA 1XM3A 3VE9A 3P0XA 5K9CA 3U4AA 1J0JA 5HQLA 2PEVA 1UWTA 3SCOA 4J3WA 3C61A 3WDJA 5A3HA 3SI9A 3TN3A 3W2KA 1W6TA 3LU2A 5LGZA 3UWQA 3DHDA 4KWOA 3IV3A 4M7SA 3OVGA 4RE0A 2J7CA 4R7WA 3IGXA 3CHEA 3OLGA 3N2TA 3OIHA 1TELA 3B9NA 3PZUA 1WE5A 1IEQA 3RG6A 3TTQA 1FWAC 2TYSA 2WZEA 5A6BD 3T09A 2NT1A 5FF7A 3W25A 4Z2LA 2G3JA 3KVLA 4ZCWA 2GZXA 3HQPA 2ZZ2A 4LBRA 1IIGA 3NL3A 1R6WA 5FSDC 3ONBA 2CHNA 1NOWA 3MP5A 3KZPA 4S3KA 4K8GA 4BR1A 5EMJA 1A3WA 3RRXA 3W76A 4H6QA 2YXOA 1T8XA 2HK0A 4Y96A 2E9BA 1SW7A 2FZDA 3DHPA 5E0FA 3L67A 3RPMA 1KM6A 1FXPA 3PAOA 1WZMA 1TWIA 1T99A 4WJ8A 4QHRA 1TPC1 2Z24A 2P88A 1C8VA 1UQYA 3S6TA 2FPVA 1F3XA 2XIBA 3CS2A 4MOZA 3H23A 3BWWA 2D69A 1NDZA 4Z1DA 2C19A 4PUKA 2V5JA 3FYPA 2HWGA 2J25A 4UTTC 3G0UA 3Q94A 1DIOA 3T08A 1HKVA 4YLWA 3TV8A 1XRFA 4WGXA 1VIWA 1SMDA 4KRZA 4F2UA 2VO5A 4CNSA 1PKLA 4UQAA 2BY2A 4S3AA 4LWWA 3RIKA 2VEMA 1TIMA 3S42A 1ECEA 3GO2A 4MJMA 5A6BA 3PN8A 3M0JA 2BHZA 1LRNA 3ANUA 2QZRA 4GYFA 4PUWA 2VC7A 1ZLPA 1XLBA 4D1IA 5FESA 1Y8BA 3CAWA 1HP4A 3WD0A 4X9YA 3KFTA 3NOEA 1PHWA 4PB5A 3CAKA 3P60A 5AHIA 3T7VA 5CH9A 4W86A 3B9OA 4LQ1A 2BOFX 1XG4A 3WLQA 1CNVA 3PUGA 1AL8A 5IHRA 3N11A 1T8QA 1PV8A 1J01A 1QI4A 3ABRA 4CNOA 2Z28A 3B9AA 1VHNA 3QGAC 4Q6XA 2GDUA 1F07A 3ORWA 1EHAA 1GVFA 1W1B1 4TO8A 4B5TA 1UUQA 1XBYA 4W8AA 1F6KA 4G1NA 4H7CA 4FK9A 4C7FA 4O1FA 3EWWA 2HJPA 1J0ZA 2HXTA 1VAHA 3QFWA 4GLEA 1A5NC 1KM4A 2Q71A 3ARYA 4NSBA 2PWFA 9RUBA 4W4QA 2XH2A 3OLEA 5M1TA 3H2NA 2GGJA 1PUDA 4IH3A 4HN8A 3L21A 1DIKA 1C91A 1ISYA 3SAZA 4LNYA 1Q6LA 4KGJA 4XAGA 3L4TA 5EU9A 4C6EA 2NV9A 3V1PA 2CBJA 2I9EA 2I57A 1HZYA 2PTYA 3RM8A 1CTNA 3MA8A 4AAJA 1QO2A 1L9WA 1JD9A 1XG3A 3O05A 3BLKA 1EP3A 3H2FA 4ES4A 3BLLA 1IQ8A 2VZVA 1GYMA 1ODUA 4ZO8A 3U48A 1EQPA 1P5BA 3AXIA 4QLJA 3WUBA 1P7TA 2ZX9A 3AIRA 1QPQA 2GVEA 2GUYA 1I1XA 3IJDA 2OELA 2GJPA 5CPOA 4O10A 2VD9A 3FHQA 1OX4B 3B8UA 3VNIA 4GGBA 3FLUA 1WV2A 2E67A 4HNVA 1Z48A 2XSXA 3SUVA 1E55A 5HMDA 3IGUA 1DTUA 4RUBA 1PKNA 1RCOB 5HR7A 2VZSA 3O3RA 5HJYA 2CETA 4E4UA 3HM7A 4LVBA 4B5SA 1TVLA 1AK5A 3AIEA 3G1AA 1UWRA 3W53A 4QROA 1RVGA 1BVWA 1TE6A 2PWHA 3MWAA 2R82A 4GE8A 1B3OA 2WLYA 4UFIA 1DJIA 1H63A 5C55A 3BMXA 3WQ6A 4K1GA 5I3JA 4JIIX 2HNEA 2J4GA 2OX1A 5M17A 3WQEA 3OZPA 1UC5A 4FIRA 5PTDA 2OEMA 4TMCA 2QXWA 5I02A 1LUCB 4GMEA 1CXKA 2NQ5A 2JKAA 5DY3A 4I8DA 2QJHA 1EYWA 1XQKA 1ME9A 4C65A 5C7HA 3YPIA 4TVDA 3WMCA 1YTDA 2CU0A 4GACA 2TPSA 4RNHA 1C3FA 3GU2A 2PLCA 4HA4A 5J5DA 1CGYA 1Y5VA 4BQ2A 2V68A 3NUKA 4AWEA 3VA8A 1XI3A 3TN4A 3IUIA 4CQ9A 2AL2A 1XYMA 3KTSA 5TQLA 4IXHA 4WXYA 2E4TA 3WJWA 1LG2A 3EB3A 5DMYA 3HV9A 2PDQA 4DAFA 4EANA 4YTRA 2A85A 3NQBA 1OCQA 3GRIA 1I9CB 1NP0A 4IJBA 3DEQA 3EPNA 3GDMA 5FF0A 4V1XA 2CZDA 4MWAB 3E2QA 2EPMX 3WMSA 5CG0A 3R0DA 1V6XA 3PY2A 3QQ1A 1PB0A 1OYAA 4LX4A 1PCWA 1LWIA 1TMQA 3MV01 4UTKA 2GQ9A 2OOFA 3UGVA 3S6DA 1KTCA 2ZXDA 4DXXA 3B8VA 4B3KA 3W88A 4LUJA 3T81A 5D2YA 2ADAA 2ZTJA 3ANYA 2DZBA 2NQJA 1CCWB 3AAMA 4X63A 4BEUA 2P10A 2OXNA 3LXCA 4AZCB 3GXPA 2PSNA 1B54A 1LOSA 4YL2A 4JKMA 4N42A 1EJSC 1VBRA 3K5XA 1WO2A 2G8ZA 1W8GA 2Z27A 4LRTA 4ZSUA 5F7UA 3BZGA 1LYXA 1C9WA 3UP8A 4CD7A 2X2YA 3WQFA 3ZYZA 2IQTA 2XTKA 5LNWA 4IUGA 4S23A 5C9UA 1VBJA 3GAYA 1Q8AA 3G18A 1GGOA 3QHMA 2PTDA 1GKPA 2J9XA 3EB4A 5BU6A 4GQRA 4CN1A 1XD1A 3BE7A 5B7ZA 2BGQA 2V67A 4MKNA 3EWCA 3EDJA 4MMWA 3W7KA 4JCLA 4HHLA 3GNXA 4Q7IA 1J4EA 2VGBA 2GGIA 4YN5A 4CU6A 1E0WA 5HANA 3CLMA 4I8YA 3WENA 2WBGA 1B3VA 1XBZA 4WDXA 3WUGA 2RKXA 5AHNA 1CW2A 2EBNA 3KTCA 3NIYA 4S3CA 1W32A 4YTTA 1LCOA 2BOGX 1E6RA 2FGLA 3WD2A 3AMLA 3WQDA 5K9DA 4UTIA 3NZGA 5IRPA 1D8WA 3PULA 4GUIA 1Y7VA 5BYWA 3PNZA 3STEA 1IEVA 1VCFA 2XVNA 3K4DA 2CERA 5LA1A 1OFOA 3EWYA 2PZ0A 4NNBA 4JN7A 5I3IA 3W75A 1KD0A 4UWMA 3NZQA 1VF8A 3G22A 1SSGA 2O9TA 4NZ5A 3CV1A 4HA1A 4JFWA 2GOKA 3NZPA 2SFPA 4MLJA 1MO0A 4NRRA 3RHGA 3ITTA 4LFYA 1VPQA 2QNEA 4CQAA 2ZICA 2XINA 3TQ0A 2BY1A 3R11A 3QR3A 1SU5A 1S5WA 1OK6A 4QIUA 3MY9A 2CLPA 4JAWA 4X9SA 4US5D 4HTBA 3ME3A 2WC4A 3W86A 4OIFA 4DBDA 4H6EA 4UC5A 4XUYA 4QITA 3FKKA 8RUCA 2HISA 1BSLA 4NZ1A 1VHCA 4YPJA 1D2KA 1E4LA 3GXFA 5EL1A 2PMQA 3TFCA 2J6VA 3D6NA 3S1XA 1OFBA 3SCVA 2FLIA 4FLQA 1WDQA 4GBDA 4XBJA 4DB7A 4EAMA 3BUVA 4IQEA 1TMHA 4HA3A 4R34A 2YOCA 2QPUA 1LL4A 4GJ1A 4C90A 1O1ZA 2PDHA 3V0UA 1LTDA 1GOXA 3DKJA 4WSKA 3KVJA 2HBVA 4JYEA 3RPTA 4F79A 1LP6A 3S1VA 4AX6A 3K2GA 1A5OC 2B81A 2R8WA 4QE1A 3FVDA 3WNLA 1W0MA 4YYFA 3FN9A 4GWEA 1TRDA 4GY0A 2NVDA 3ALGA 2YIHA 2HTMA 2NT0A 2P76A 3UWVA 5KEZA 3HZ3A 1N8IA 3WQCA 3JZEA 3EOSA 2Q8ZA 4ORMA 3PS7A 3AC0A 2HVOA 2AMGA 3EEGA 4GCAA 3DX5A 3CZJA 1B0IA 4QG9A 3E9AA 4LANA 4PFMA 3S9IA 1M68A 1KFWA 3KCOA 3HFYA 5A8NA 3P84A 1SW3A 1ZAJA 2PDYA 3MZ2A 1GOMA 2DEPA 4M81A 4LS2A 4ASTA 1J11A 4A22A 4ML4A 1UZ4A 2WSPA 3LRLA 3V16A 4S3GA 9CGTA 3QZEA 1ITQA 2VR2A 3M0HA 1XLHA 2EXOA 5H91A 5A6LA 4LB3A 2VFHA 4HCHA 5CSRA 1JXJA 3NOYA 2VDGA 1GVSA 1CB7B 4I5UA 3QYSA 2PDUA 1C92A 3LSBA 4DF0A 2G3NA 3QRHA 2D23A 4GUFA 3O0KA 4GUJA 3I6TA 1J2WA 3NQCA 1XD0A 4Z08A 1UIPA 2VEIA 1US3A 4KBXA 4J2PA 4HJWA 3RX2A 4ICMA 1W54A 4X60A 3C2FA 1KXHA 1UIOA 3B0UX 4LVDA 5GQBA 5A8QA 2UV8G 2WMHA 2Y5EA 4N6FA 1BVZA 3AU6A 1QWGA 2VC6A 3GQYA 3NO5A 1B3ZA 2I17A 4GC3A 1XKJA 1U1JA 2C1HA 2MANA 4O11A 4PBEA 4CGTA 2B7OA 5H8PA 1WZLA 4JN6A 1VLIA 3HURA 4JQ4A 4C91A 1IE7C 3UQNA 4LY4A 1Q6EA 2WQPA 1K7XA 3WF3A 1OFDA 3MVIA 4IMFA 4R5EA 4J7RA 1V7YA 3IAPA 5D2VA 5FAGA 2AGTA 2PWGA 1TUFA 4HMDA 3WLRA 4F4RA 2IPFA 1EJXC 2YLAA 3W7OA 4P7QA 2GGEA 1Q5MA 3M47A 4JEQA 2O4QA 3W27A 2VZUA 4E2BA 1AQHA 1K3UA 3CNYA 4DHGA 5CC6A 4GZEA 5IHSA 1VYPX 1V6TA 4B5VA 2CC0A 2BV9A 5LZLA 2OGYA 3G1SA 1UH4A 2ONEA 1ECQA 3WJYA 4JTQA 4QDWA 3LI1A 4MUPA 1DHKA 1SFSA 3RJYA 2Y6ZA 4L80A 5AC5A 5TF0A 3RU6A 3WJSA 2F7FA 3MHGA 4QNWA 1D3HA 3QW4B 3D46A 2YW4A 1ZPTA 4D6IA 2IUZA 2J27A 5GVJA 1E1EA 4HB7A 4ZB2A 1BXNA 4IHCA 1MFUA 2GL5A 2W62A 3NXFA 1F6PA 2BVDA 1LT8A 4BF5A 2V38A 3M1ZA 4PTDA 3C0LA 2DT0A 3OVQA 1JGMA 3CQKA 5JMUA 3WBYA 4LW7A 3I7RA 5FEPA 3WQPA 3T0DA 3WF4A 2QUVA 4P5UA 5HJLA 4GQGA 5ABEA 4IFKB 1KQYA 2X7VA 2J7FA 5EMMA 4J1OA 4IF2A 3OU8A 5REQA 3BICA 3ECQA 1DXFA 2WOQA 2OZ0A 3AFBA 4D6HA 2DZTA 3NQ6A 4EX4A 3NDYA 2NVCA 5F1VA 3H12A 2PDCA 4TU1A 4KWVA 4B2DA 1XYZA 1H51A 1Z41A 4BCEA 3HA1A 3RK8A 1JPKA 1JPMA 1V7AA 4GA8A 3UR5A 4R85A 1RV8A 4HIBA 3W70A 2X1SA 1DV7A 3LPPA 1EBGA 3MCNA 5FJTA 3K1DA 5D9OA 3APYA 4DPPA 1V77A 3QQ0A 2V5CA 4RXFA 3CZ8A 3FFSA 3W84A 1BTMA 3NYZA 3M0KA 4BF7A 3QFEA 1O60A 5E1QA 2V5BA 5A6KA 5M5DA 3ENLA 3A4JA 4NVTA 1OCBA 3MBDA 1ISWA 3R94A 2GFTA 2ZUWA 3GYCA 2QCFA 1RH9A 1WZKA 4K39A 3M0ZA 3VGHA 4AIUA 4F9JA 1XP3A 1FBAA 2X1RA 4D6EA 1IEXA 4JTSA 1YDOA 4C60A 2Y8VA 1J9YA 3OQEA 3SY5A 4X3ZA 1WB0A 3RCNA 4JICA 2A2IA 4RKAA 1ME8A 1HVXA 4GYPC 5TNVA 5D8ZA 3P6LA 1W5QA 2FTPA 4XAFA 3ITCA 3VFCA 5FF3A 3T0BA 4DEFA 2PDNA 5E9AA 3WQ4A 2UWFA 5JH2A 3WQ5A 3LG3A 3IANA 2VDHA 2GVYA 1Z6KA 3E0FA 1XH0A 3UYIA 1VBUA 2DSZA 4HPJA 5FF4A 5FEWA 3OZOA 3GXDA 1EGZA 5DN1A 3UPWA 2ANUA 1FDJA 4AEFA 3T6CA 1JYXA 3O06A 3WFZA 3TU9A 2W92A 1QI5A 3CEUA 1ITCA 5AOUA 5HPCA 1JCXA 3CWNA 4JPGA 3HG5A 1V51A 2PTWA 2DP3A 1J0HA 4B3ZA 3EDDA 1R30A 3GK0A 2C15A 3PZOA 4UFHA 3ARXA 4L9YA 2GDQA 3NNTA 1QUMA 2VQTA 4XKYA 2GUUA 4XBSA 1AJ0A 2A7RA 4Z2KA 4AZHA 4GFSA 4GOAA 3S1GA 3SUWA 1JCNA 5C54A 2IKIA 3UERA 1JNEA 4NT0A 3VNKA 4REQB 3N17A 2ATMA 2JF7A 3FAWA 4Y2WA 5BOFA 5BU9A 2F6KA 1UKOA 4DZHA 2A0NA 1U22A 4JBRA 2LLEA 2P1FA 2OQYA 4O0ZA 1LF1A 3N2MA 4WCJA 3BLEA 1MW0A 4L1WA 2ACQA 2B31A 2FIQA 2W63A 5A1AA 2QYGA 1C9DA 4W9TA 3VFLA 3CPGA 3WDPP 5I3HA 1OX5A 3GVVA 3L2MA 4LUTA 3AALA 1EFZA 3LMYA 3LGDA 1MNSA 3H70A 3PP7A 3GVQA 1V3MA 4GIYA 3EX2A 2VT0A 3I4KA 3K46A 3BGAA 1UR9A 3LHTA 2WNNA 3KRSA 3OYZA 4K36A 4EKJA 1BSIA 1FWDC 3M0LA 1MEIA 4DIAA 3WBAA 2H3BA 2GK1B 1CEOA 1GG1A 4I9MA 1LQ2A 4JFUA 1ZJBA 1CB2A 3GXMA 1FKWA 5G4EA 4OBSA 3AMKA 3CV2A 2EKGA 1T41A 4LBUA 4NJJA 4GK8A 1SFJA 2WPBA 6ALDA 3SURA 4EPDC 1RY0A 4K8EA 4EWJA 4ATDA 4RZ6A 4HHPA 3MU7A 3QC0A 1WPCA 2JKEA 3QMSA 3VIHA 4DJDA 2VI0A 2E5CA 5BMWA 5D9NA 5F4WA 3GLCA 4M6PA 1YQ2A 1HIZA 4Q8VA 3TVAA 1RSCA 5FACA 2QF8A 1AQMA 4HOXA 2OWCA 3N6HA 4UR9A 1O94A 3W2MA 3CASA 4HZMA 3PTDA 4NX5A 2E1WA 3A4AA 3DHFA 1LBFA 2J8FA 4BHYA 3M16A 3A24A 3ZSTA 1C29A 1ZB5A 3WK2A 4LYRA 1ZENA 1E6SM 7REQB 1ZALA 2DIEA 3UYCA 1VKFA 1PPIA 4EAYA 2FTWA 1XLDA 1KM0A 1MQPA 1TR1A 4M5PA 2YBTA 3T2PA 2CXEA 1HF6A 3TAOA 2ZUMA 1R9ZA 4RCXA 3TYCA 4NRSA 4QSHA 2OSYA 3EOEA 3MSDA 3MI2A 3ZWSA 4GO9A 4NG3A 1K70A 1AD1A 1XR2A 4CNTA 3UCQA 3VC6A 1PYFA 2V81A 3BG3A 3DG6A 2QCLA 4Q4RA 1H3GA 1EL3A 2FJUB 1KRMA 4JL2A 3E02A 4V1YA 4AYGA 1JF5A 5IFPA 5CSYA 3TJIA 2CIPA 4CQBA 1O1HA 1XIJA 5KZ6A 3FYOA 1T0OA 1EQCA 2JGYA 3FHAA 1B30A 4NAFB 1TJPA 3VKKA 1GVOA 4QAIA 3E6EA 4H9YA 3OVPA 5DCEA 3R12A 3N4AA 4DUVA 3O1NA 2O9RA 3UY7A 1M53A 2REQB 2OSWA 2CBUA 3GXNA 3F5KA 3VTRA 3LTYA 4DZAA 2X2GA 4OECA 1EC7A 3RFAA 3MW7A 2VL4A 1AVAA 1F76A 4H9ZA 1LRQA 3TSDA 3RCMA 1J0YA 4JTFA 4HJFA 3TH6A 1DL3A 4CUCA 1W3IA 1JD7A 4V2XA 2DZAA 2XN0A 4B15A 4FHAA 1XCWA 2O0TA 2D1ZA 2YL9A 3W1UA 1XPGA 3PZMA 3TZFA 1TTJA 2QDDA 4W8LA 3WLPA 3I65A 1W31A 3LK6A 3LS9A 5EYWA 1V8EA 2V2HA 3FSUA 2R1MA 4DNMA 2IKHA 2DT1A 1PS9A 2IPGA 3E0IA 1JDCA 4J2MA 5DCDA 4AMCA 5K7JA 3GNOA 4OFCA 2J79A 3A47A 4UBPC 4UZSA 2NQHA 1PTGA 1UG6A 3MMWA 3CQHA 4L61A 3EKLA 4H01A 3PJUA 2OLHA 4GKLA 4A29A 2I56A 1RAKA 2E5DA 3B9DA 1Z44A 3IACA 4Q8QA 4I7WA 4HNLA 3UJSA 1GPFA 4A05A 5AB3A 4Z0JA 3MMUA 2NUWA 4K8HA 1OD0A 5CXPA 4HNTA 4UNIA 2Q01A 2CPUA 1S3TC 2G37A 3KL5A 3SQLA 3COTA 1M7OA 4MWAD 2CBIA 5I3KA 4E2OA 1XHGA 4AZ5A 4PMJA 2UY2A 4DVOA 2OEKA 1CGUA 1RK5A 1TPWA 2XWDA 2J13A 4WJXA 3F4VA 2WO5A 3KP0A 3TONA 1UUOA 2ZRZA 5BXSA 3CYJA 3E96A 1X8CA 1KCZA 3DG7A 2OQHA 1KFCA 3PUDA 3H6OA 2JFEX 4GINA 4U10A 1ISXA 3L65A 4PCSA 3G6LA 4PUMA 3C86A 1GZGA 4I3GA 1RD6A 5C9ZA 1S46A 4DLMA 2OLAA 4TX6A 3TYUA 2ZZ4A 4DRSA 3VGGA 4QDPA 5I09A 3EOLA 2FZMA 3BURA 3C6CA 1GK8A 2FJKA 4P8WA 3C2OA 3BJFA 5AZ0A 2AMXA 4AFYA 3P3BA 1H7WA 1EA9C 1V93A 1HJVA 4XBKA 3T42A 2OZ3A 2VELA 4YWSA 2A21A 1HTIA 3UR7A 1DIDA 4O0KA 2DZXA 3AJXA 3GFXA 3NQMA 1KLYA 5KZDA 3V7PA 1E6NA 2NQZA 5E5CA 3SRDA 4DO6A 1KV8A 1ZBKA 1R2SA 1SFLA 3DI1A 3HPZA 2HK1A 4WSJA 5DEZA 4JTHA 1G4SA 2XUCA 2VCCA 2X40A 3H7VA 3NQGA 2WB5A 3W22A 4JIHA 3RR4A 4MFDA 3W6LA 3BAIA 2A1YA 4YHEA 3F1QA 4C1NA 3KDOA 3A6OA 1PX4A 4L6HA 3OGRA 3FIGA 3W6YA 3S5ZA 2Y8KA 3NAVA 4HK7A 4P8XA 1O12A 3BOLA 4JQ1A 4F9DA 1M3UA 2B4GA 2R1KA 4FR1A 3TA6A 1EJ7L 5D8WA 4Q8UA 1K77A 3WFLA 3OZYA 3GTXA 1CZ1A 4RDZA 4XZWA 1NF0A 4UOJA 4HCDA 4DXKA 2E8YA 3PPHA 1Y65A 1JCYA 2GOUA 3WDIA 1C8YA 4W5UA 3APGA 1G94A 4EWND 3G0XA 4XAZA 3TYEA 4MZ1A 3VUPA 4NZJA 1I1WA 5HAOA 4JNMA 3T44A 5A6AA 3T0CA 3WQWA 3KOXA 4OUEA 3KZSA 2BBFA 1A5AA 4IPPA 5C2XA 3AI0A 2OZ8A 2Y24A 4E8DA 4BF9A 2XWEA 3PPCA 3VOJA 4B5UA 4GZIA 4GZ7A 2OVLA 2OFJA 1QT1A 4YHGA 1OFEA 1TE1A 2WSYA 2VC9A 5I23A 2DSWA 5DMLA 1K9TA 5KZMA 1M41A 4ZOCA 5DMMA 2Z1BA 3PTKA 2OWXA 4G2DA 1A80A 4LRSA 3BZJA 3FNDA 2EG6A 2VTFA 1AH4A 1R7AA 3HPFA 3PB2A 4XD4A 8XIMA 1W2PA 1VQTA 1DQUA 4PMOA 1XISA 1UD5A 3VKJA 2V5DA 1DJHA 1VFFA 1M7PA 1L6WA 3KS5A 2GSJA 4O16A 2Y70A 2CEQA 4E6MA 4FF5A 3DERA 2CHRA 1YKWA 2ZE3A 1G0CA 4JHMA 1QBAA 4OT7A 3STPA 3BAXA 4US6A 1G69A 3NTYA 5CJMA 2NV2A 2Y1HA 3QKEA 3L5AA 3SEPA 1GEQA 4UIOA 5MHBA 3TLQA 2VR5A 1QBBA 3HN3A 1THFD 1VFTA 1EKOA 3TJ4A 2Z2BA 1OBAA 4GCXA 1M7XA 3LHYA 4C7DA 4LYPA 5HQMA 4Z1BA 1A5KC 3B9EA 4Q22A 3S46A 4R53A 1XSJA 3WBWA 2YCEA 3JS3A 3N29A 4MWAE 1HGWA 1VLWA 4JNZA 2VEKA 2J7GA 1TPEA 2YPIA 1CYGA 1Q13A 3C2YA 1EBHA 4BFAA 1XRVA 3VMNA 5LHFA 3SR7A 3TCSA 1RD5A 1FHDA 3MKVA 2J24A 5LNVA 2CLLA 4AZ7A 4I5RA 3WJZA 3HQNA 1Q7MA 3P82A 3OZMA 1F73A 4F0MA 4U4MA 2DZUA 1GJUA 4KQNA 4PR4A 2ASHA 3N1AA 3XISA 1E73M 5EMKA 3RPDA 1SJBA 4A8LA 4Z1AA 7CGTA 3WD4A 3PBUA 4C7GA 3C2VA 1BRLA 1RZMA 3A22A 1R9XA 4HVXA 1GVEA 2FZBA 1KFEA 2XH4A 1DE6A 2NVAA 3GTIA 3T07A 3J7HA 4GNKB 2CXGA 3QZ6A 1Z69A 1JZ6A 4DLFA 3GR4A 3VABA 3AS1A 1XPYA 4JTDA 1A4MA 5CAHA 2O4MA 3CL8A 3BARA 3EX3A 2VGFA 4WZHA 4O1AA 1TTQA 1JFXA 1XUZA 1U33A 4LS0A 3SRHA 2YCLA 2XIQA 3IJ8A 4MB4A 3USZA 2ZTKA 1UBSA 3QPZA 4EE9A 2G3MA 1SMAA 4MPQA 1B4KA 3PBVA 4H9UA 2O92A 1IT7A 3NO3A 3WIJA 2EHHA 3EWBX 3NQEA 3O2LA 3AZSA 1HL9A 4NQ1A 5G2IA 4O14A 4AD0A 4DO5A 3QV8A 3LBMA 3WL1A 2VGGA 4BS0A 2PU1A 4ORIA 1AD4A 1H60A 2XN2A 4Q8PA 4U3CA 1U30A 4CVUA 3IJQA 6REQA 3L4UA 1TJRA 5F4SA 1FY6A 4IT1A 2QJNA 2QVHA 5H1WA 1S2UA 3PPGA 1NWSA 2QJIA 1H4PA 2WK2A 3V18A 5CBJA 4TX9A 4ZO6A 4DWSA 1KGUA 1R3TA 1YDYA 2FPTA 2H6RA 3NL5A 2ZXBA 5D02A 5TD4A 1ITXA 1KM1A 3U6WA 1KWKA 2Y88A 3DENA 3WNNA 3E3HA 1D7KA 2XVPA 3C8NA 3TYBA 1Q4NX 4E3TA 2QCDA 2Y62A 3RF9A 3CPRA 2JF6A 4HPXA 1P6WA 2IMRA 4XVDA 3CHDA 1C8QA 3C0SA 3URNA 3LB0A 1J79A 2WMFA 3LTSA 3STFA 1TV5A 4LSBA 3BJTA 4IMCA 4TX8A 3QMRA 5SWUA 4LCQA 3VIKA 3FXGA 1PTDA 5CC5A 3PJWA 5KETA 1L6GA 3AIBA 1J18A 1UCWA 1OC7A 2VVNA 3SW6A 4QG6A 5G1TA 3HGRA 2WVVA 5EB8A 2V9DA 5JBDA 2FMNA 1R3WA 2DDXA 2Z1KA 2O7SA 1TX2A 3NJ3A 4ZENA 1PZ3A 2OOGA 5F4XA 4L7ZA 3TQPA 3PSVA 4IXXA 2P3ZA 1W1VA 1XYCA 1V0NA 5AYBA 2CFFA 3N12A 1VFSA 1VFHA 2NXGA 4GUHA 3GTNA 3IGHX 1IXNA 8CGTA 4L5ZA 1P7TB 3IV8A 2PLKA 5DBTA 5LIXX 2VQUA 3REQA 2WXDM 4V33A 1RPXA 2PB1A 2BSLA 1NDVA 1RCQA 4FS9A 4O15A 4ZA0A 4QJ1A 1K8XA 2B7PA 3H2OA 2XM1A 1H61A 1MWOA 4RW3A 4O19A 3NXLA 4Y9OA 4FOJA 3K4AA 3VKDA 2J9ZA 3THQA 2DJXA 1R9YA 1D9EA 1EC9A 3UJEA 4LYQA 1XUUA 4FR6A 3AS2A 1JAEA 4Q4QA 3QQWA 2Y7GA 1H09A 4O13A 1CXLA 4ZL1A 1KBLA 4MFEA 4IQJA 4D72A 4KH2A 2VEGA 1FCBA 2E7FA 4QS6A 3OGSA 3RLGA 5EKYA 4AWSA 3OA5A 5BROA 2VM8A 1D3CA 5IOBA 3MMTA 1MRAA 3WH6A 3LUTA 3VU2A 1Q6QA 2X1UA 4HHHA 2DIJA 4XD6A 4JIPA 4AD1A 2ZZ1A 3DFQA 5K9XA 2Q3RA 3U5UA 3OO2A 1ZFJA 3W07A 3WX7A 4AH7A 3LV6A 1TFVA 1KFLA 1QNRA 3PFRA 1CLKA 4ZOEA 3PAJA 4MKSA 2AQVA 3N9SA 3G8EA 1RP9A 1IZKA 4GBUA 1OIFA 2AL2B 2OGJA 4H00A 1H1ZA 4GIRA 3AJ7A 1YRRA 4BQ4A 4AUBA 3O7UA 3GBEA 1JCTA 3M9YA 4NF7A 6TIMA 3QV6A 4AXKA 4GIAA 1JDEA 1BVNP 2VMFA 3UVAA 4BK9A 1T96A 3GIPA 2Y8UA 4M3PA 5A5WA 4LUIA 3HJZA 1LDCA 5G5IA 3L66A 3CZKA 2JEPA 1KLZA 4JCMA 3W38A 2GGGA 2GQ8A 4N7QA 4L4OA 3KE0A 3GVWA 4H6KA 1TO3A 3AHTA 3ARRA 4XB3A 1HKIA 3ATZA 3W1LA 3NO1A 2JBMA 2VOTA 3PWAA 2Z25A 4LCRA 4D6FA 4GH3A 3A3HA 2V2CA 1XGZA 1JGIA 1HXJA 1QI0A 1GPWA 2PDKA 3FJNA 4KETA 1JRBA 3QSRA 1O5XA 1H1NA 3NEVA 4ZGYA 1S2WA 1VYRA 1E1CA 3W7RA 3UZYA 3N04A 4AVFA 1DWGM 1HO4A 4PMYA 3KCJA 1FH9A 4IQLA 4CNUA 1UJQA 2EO7A 2ZZ5A 3AYRA 8TIMA 3VCNA 2IXVA 4C6NA 3H54A 1Q7QA 1GW9A 2QAPA 5CGQA 1FQ0A 4A3YA 3L4YA 3AXKA 1V03A 2E1DA 3W1NA 4M6QA 2VUYA 2PDMA 4IFOA 3H4WA 1AMYA 4MZ8A 4P8VA 4L56A 3V4BA 3MPGA 2B7QA 3H21A 5HQEA 1Q63A 2ZDSA 3DBPA 4XZIA 4EP8C 3I3EA 1MW2A 2PS2A 4DXVA 3U2CA 1NP2A 3ITYA 2XH0A 2V8ZA 3EMCA 4FNSA 4YTSA 1GKQA 3WD3A 3MTWA 4DM1A 3WLJA 2ACSA 1KKRA 4AW7A 3SIMA 3CMGA 3GIYA 5AVNA 4UR8A 2R14A 3F2CA 2VYOA 4LYKA 1E9YB 2BHUA 1OEPA 2XFWA 4Y9AA 3TNBA 3WN6A 1LWJA 1W17A 3D3AA 2WHKA 4NU7A 3LCLA 2DIKA 4ERIA 2WCSA 4WK9A 3FEMA 3E0LA 4DJEA 2QIIA 1MEWA 1AZ1A 4CD6A 3SM0A 1K8YA 1ZU8A 4FP1A 3H2EA 3GW0A 4AY1A 3W37A 1P0BA 4PSRA 3HO8A 2X8RA 2YLLA 4JYDA 1OCJA 4IWWA 5AZ1A 3VDGA 3UJRA 2BB0A 4P8UA 2W9MA 1ZUAX 1I45A 3F5LA 5BXTA 5D38A 5I6SA 2PBOA 3W2UA 1E0UA 2I16A 2HBXA 1SPQA 1O5RA 1D7FA 4Q8NA 2XIOA 3LV5A 1V3IA 3I7SA 1XF0A 2BXZA 4Z17A 2NX3A 3GR8A 3CO8A 2QUMA 3F5JA 3SO7A 3T8LA 5HWMA 3CUXA 3TMLA 3GC5A 4DY1A 3CT7A 1ADDA 3LGEA 3VI2A 1Q4WA 1TZ7A 3FOKA 4FXSA 2CBVA 4TMBA 3THUA 5GNXA 5CEWA 5FKYA 2PRHA 4IPJA 3LHWA 3GNPA 4NKCA 1GNXA 4IIBA 3EKZA 3N6QA 3RO8A 2UBPC 1GUVA 2WCAA 1EHNA 1QAPA 1TMLA 4NL1A 3F2BA 1TCMA 4PE8A 1LQAA 1JPDX 2A3AA 2VENA 2ISSA 4ZEPA 2DUZA 3PJXA 5FEXA 2DQXA 4XAPA 1PE1A 4FOKA 3D5HA 3SCSA 4IICA 3L7RA 1NDYA 1CPUA 2YCKX 3W7IA 4N4QA 3WG6A 3ARZA 1MDLA 4J35A 4FPSA 1SJDA 1GJWA 4GJIA 4B9YA 3W02A 3AYTA 4AX7A 2AGKA 4JY9A 3VVGA 2ICSA 4BEQA 3C0QA 3W82A 3B8IA 1IF2A 2BFGA 2QEZA 2YBUA 4QGCA 1ZCCA 4AF0A 2VCAA 2JIEA 3C3NA 4AZ6A 3TYDA 3UFYA 4H7VA 2GJRA 3LGGA 4YJ5A 3HQOA 4O52A 2VZTA 4GH1A 1E9ZB 4KESA 1DE5A 2D24A 1N82A 2TMDA 3E2RA 4JEJA 3MV11 4GI9A 3S2LA 4GY1A 2DY3A 4ZR8A 4AEOA 1DJNA 3L4WA 1DWAM 1H62A 2L5HA 3TWBA 4ZE4A 3SCPA 1AW1A 2OWWA 6TAAA 4M80A 1XDJA 3NSXA 4IOTA 3LXBA 5D2XA 2ZXQA 4LC6A 2NLYA 3QY7A 2BY0A 4MWAC 2Y85A 1BD0A 4PSPA 3CK5A 4OQVA 3MUIA 3HPAA 3WLIA 2Y89A 4O57A 4R33A 4G7EA 4NY2A 4HPHA 4XISA 5AYXA 2OEJA 5LKYA 3WNMA 5I0DA 1R3RA 1KNWA 2CZEA 4GQBA 2J8TA 2GLKA 3L23A 4EPBC 3NQDA 1OK4A 3R8HA 4ZTXA 1XC4A 4X22A 3GHTA 4D2JA 4LNCA 5H8MA 3T0TA 4JKKA 3ZZ1A 2GUBA 3FJLA 4UCGA 4QP0A 3IIZA 4LGXA 1QFEA 2HVNA 1RLCL 4LU0A 4GFIA 1SW0A 3MO4A 2Q8LA 1ZL1A 2WSQA 1UPMB 1KXQA 1Z42A 2Y7FA 4AY7A 2POZA 5JUVA 4Y90A 2C13A 1WDSA 1A5CA 1LG1A 1ICSA 3CV6A 3M7WA 4NX0A 1EOKA 1PEZA 3B0VC 3MVTA 1XIIA 1IHIA 2P50A 3WELA 3RXZA 4PUEA 1H5VA 1R7OA 5AECA 1UD6A 3PR2A 3UY8A 3OW1A 3KS6A 3MKKA 3CMJA 4DBSA 2ZFAA 3TOPA 4UTWA 1XRSA 1CECA 5FAJA 3JZUA 1JQXA 2J7HA 3LRKA 1AQFA 2ZC8A 5REQB 4CQ8A 3GR7A 4MAZA 3IRDA 1NVMA 1XCXA 1FWGC 3ES8A 1TREA 3WUFA 1A4LA 3BSMA 1E71M 4W93A 2FMOA 1NQ6A 3C56A 1KR1A 3QV7A 1YPXA 1WCGA 5CPQA 1TVPA 5HUPA 4DN1A 3BMWA 4H8NA 1IXQA 1Y5XA 4C6CA 1XQLA 2A4AA 2PLMA 4Q33A 2I5QA 1AL7A 1XLMA 1M04A 4DI8A 1ITUA 1HKWA 3H7UA 4N0RA 5IBXA 3ZT6A 3S0CA 4NJHA 4CQDA 4C5YA 5CLWA 5CZTA 3T4WA 1BKHA 3CUIA 4ZQMA 3SZ8A 4WVXA 2O9OA 1F4AA 3G3MA 3OBAA 1E5NA 3OJGA 3W7EA 4HQVA 3L4ZA 3NM3A 2PBGA 2DSUA 4RDVA 3BOXA 1WXYA 3AMCA 1DQWA 2QV4A 4JOMA 4L4LA 1CXEA 3BSGA 3TK7A 1JNDA 1RBLA 5C8BB 3VOHA 3CZEA 4YCPA 4QNEA 1XYLA 1FP8A 3C2EA 2YFNA 5JBFA 5HULA 1KA9F 4R88A 5LHEA 1O6IA 4RR4A 3WZ0E 2QPXA 2BVYA 1EUAA 4OZOA 3A23A 3IARA 5H8UA 2ZA2A 3QN3A 5FJJA 3NPVA 1TIWA 3AXHA 3CV7A 3HQ1A 4O1DA 1U5JA 1QRQA 2RDUA 3NVTA 1B3XA 3PBWA 3ZT7A 5DLCA 3N2OA 3PZIA 3BLFA 2ZXAA 5LNRA 2YBVA 4AD5A 1RA0A 2PP0A 2FTYA 3P62A 3DN5A 4PUDA 2JKPA 4FO4A 3UG8A 4JZ5A 4CCDA 3APTA 2HEJA 4J3ZA 3A9BA 1XX1A 2HS6A 4YVXA 2E3ZA 5A8GA 1SR9A 1FDYA 1P1MA 1VPXA 2FVMA 2P5NA 2A3BA 2Q8XA 1EIBA 4WLCA 3P93A 1UPPA 2WCGA 4BI7A 3LX9A 1MW3A 3SY8A 5A6JA 2OO0A 2ZE0A 1FX6A 3EYPA 3BXWA 3E49A 3G1VA 2GQAA 3RITA 4OE7A 2W67A 4PL1A 1BGGA 4ZQCA 3CLWA 1OFQA 4XKYB 4IP4A 3FEQA 4JNYA 2VFEA 4WEVX 3H2AA 2OX4A 2WKLA 5CGTA 1F2JA 4ZXLA 4IMAA 3SFWA 1UOKA 3RCYA 3KEHA 3AS0A 4XG1A 3PZQA 4I6KA 2Y5SA 1S5NA 5I78A 3KRUA 1UWAA 3NQAA 4PRRA 3P7YA 2NQ9A 1BGAA 3GDRA 4UTMA 2ALDA 1NARA 3NA8A 3UZ5A 5EBUA 3WDHA 1W1IE 4B4FA 3S6OA 3WUEA 4ATLA 4GY7A 2G41A 3VCCA 4DWSC 1WUFA 1MRQA 2VX4A 4AVNA 4KERA 5HR6A 1PX3A 2PDLA 4GQQA 2X1IA 3UA3A 1QNPA 2YXGA 4LUTB 2QPSA 4Z2IA 1UZHA 4W87A 1U1HA 4FLRA 3EOOA 3WY1A 2X1TA 3NSNA 3TIMA 3GU9A 1PDYA 4N9DA 3GH7A 1EGVA 3CU2A 4HA0A 1SM9A 1EOMA 3H4GA 1G4EA 1GVYA 1O4UA 3GS6A 4Q8TA 1YTEA 3VXGA 5LXEA 1KTBA 4PRWA 1V02A 3LZ3A 3G24A 5D2TA 3VE7A 2FVLA 3L12A 4MY9A 4FI4A 4KEVA 1I4NA 3GXTA 5TAOA 3E5PA 2OTDA 1QWKA 2J66A 3W2NA 1A5UA 1S38A 4AZIA 5FJRA 4QE4A 1P0KA 1XLKA 3F4CA 1GHSA 2OQLA 3PNUA 3UXAA 5I06A 2BTMA 3E2SA 4M6VA 3DFPA 2R6OA 3BAKA 2Z1VA 2WAGA 2DZVA 2X41A 1CIUA 2BVTA 4PN2A 3FX4A 4PTVA 5FSEC 3VNDA 1WZAA 4BI5A 3NYDA 4UFKA 4EIVA 3K30A 1FCQA 3B05A 4MDOA 1WKFA 3QVQA 4HNCA 4K3ZA 3WQVA 4HBKA 2VR4A 1VRDA 4XWUA 4H2HA 5BRBA 3DECA 3KBJA 5FD0A 1XIHA 3TW7A 6XIMA 3AZRA 3OA3A 1UP0A 4IPNB 4UTJA 3SY1A 1C7TA 1X98A 3N4FA 3GM8A 2E40A 3DXIA 4QCFA 4ZB5A 2DVTA 3GYEA 1OG0A 1QHPA 1JI1A 1MZRA 4B5WA 1R0MA 2VEPA 3QV9A 1KFJA 3QR1A 3WF2A 1ONEA 1NJJA 1TPVA 3NGFA 3NURA 3O63A 3R79A 4HU4A 3VOCA 1V6UA 4MJ2A 3TP4A 2I1OA 2X0HA 3DYMA 1G4PA 3PANA 4ZBCA 4PCNA 3LCXA 4XTDA 4ZQRA 1GZ1A 3SGGA 1IR1A 3UU0A 2Z2UA 2P0IA 1LL7A 2E6DA 4IL2A 3LENA 4QQ3A 4JDYA 1KFKA 3VX1A 1F3EA 1KFBA 4ICNA 1YE6A 3TSMA 4TIMA 4UMAA 3W24A 1KWGA 2INEA 4WKFA 4GJJA 2WSRA 1WA3A 3MDWA 3VNZA 5A8MA 3POHA 3MP4A 1JVNA 3GG8A 1X96A 2WJZA 1CT5A 1RHCA 3RAOA 4Z2GA 1B90A 5T9CE 2NZLA 1GVRA 4A4AA 4QJ5B 3W72A 2P0OA 4CU7A 1AJ2A 1DJYA 3CHCA 1V02E 3P67A 1YYAA 2Z6IA 4S38A 2PDBA 1EX1A 2GPTA 5ECVA 5BWAA 2XVLA 2OKTA 3W7QA 3B4UA 2PWDA 1J6PA 2GWGA 5G4WA 4QQUA 4I9AA 4A6GA 3MMDA 3QHNA 1P48A 2ISWA 2G4JA 1XLJA 3TCEA 3SQSA 3R58A 2WHLA 3TQVA 4HNUA 4YTUA 2PODA 3AZTA 1DWJM 1QJWA 3ZJ6A 3QTPA 3ES7A 1TCDA 4MM1A 4HTYA 3PZTA 3ZOAA 2ZRVA 3UWEA 2EJAA 2MUCA 5AN7A 4M29A 4ERGA 2FVKA 3QYQA 1X38A 2A3CA 4U31A 4HU3A 3ZVIA 4KS0A 3W1MA 4B3LA 1EWDA 1FWSA 5FL1A 1ZCOA 1SJCA 3OB8A 2BZNA 5JBEA 3VDCA 2XSAA 4X0NA 2J8GA 4ZB0A 3JRKA 3B0XA 1ZQ5A 5D9MA 3VKCA 1OYBA 1K7FA 2FDSA 3TC3A 3LCWA 5DANA 2OYKA 1E15A 3QM3A 2OYLA 4Q8MA 3VMPA 2AL1A 3GDTA 2HROA 4C6DA 1XLIA 5AC4A 1B57A 3BG5A 3VM7A 3KVKA 3GH5A 3S5SA 3UCCA 1HVQA 4ZE5A 1E1FA 3CUZA 3EA2A 4QM1A 3P5YA 1KV5A 1EUNA 3IPWA 3G5EA 2I7GA 3DC0A 3VC5A 4LOCA 4B4HA 3WLHA 4DJFD 1EGMA 3LM7A 3KOWA 4AVOA 2IKJA 2Y63A 3KP1A 1JFHA 3LY0A 4GYJA 4UOZA 3KRBA 2Y0FA 3WQ8A 4J3UA 3DGBA 5CJ5A 5M3WA 3SBFA 1HJUA 3EAUA 3W00A 4YVVA 2PRMA 1QPOA 3T9PA 2WNZA 3DHUA 4LV9A 4S3JA 3M6YA 3NL6A 4MADA 2XPKA 5GJMA 4HP5A 2F6XA 4DJEC 2DJLA 9XIMA 2E6YA 3GBDA 2JK2A 4LAMA 3RDKA 1OY0A 1V0MA 4FZIA 2D73A 1UH2A 4J3SA 2XU2A 1ONWA 1AG1O 4AHQA 3TMQA 1J96A 4W7WA 1KGWA 3AQUA 1QCWA 3SN1A 3S1UA 4ENLA 1BXBA 4GPNA 3NSMA 3R10A 3S47A 4KKXA 5LGXA 3VPLA 4PMUA 4C1NB 4AQLA 1RY8A 3QOMA 4WDTA 4JR5A 1XGDA 1EIXA 1W3KA 1R46A 3L5MA 3K13A 3VZYA 4H7ZA 4PCFA 2RDWA 3VGFA 3ATYA 4MNMA 3G1FA 4CNPA 1PL9A 3EX4A 3W73A 5D05A 1ZGDA 1TTPA 3SSJA 2POTA 3QPYA 1EDQA 4TXEA 3AIWA 1YBQA 1ADSA 3VIFA 3EEZA 2BWGA 3TUUA 4JDBA 4DJFA 1YIXA 1CGTA 3ZXWA 1YE4A 4MSSA 5GPRA 4PULA 2DV0A 1QATA 5AFDA 3CB3A 3U3HA 3GE7A 1NQKA 3MUCA 3W1XA 1W5OA 1BQCA 4J3TA 4JTAA 5F2LA 1XS2A 4MUZA 3NCOA 4O18A 1PAMA 5CC3A 4QSFA 3S5YA 3TTSA 1G01A 2I9UA 3OYXA 4K7YA 4PFHA 1T5AA 3N14A 4PH6A 4MJZA 3DH7A 3ZM8A 1KKOA 2DUXA 2YZRA 1CGWA 3K8LA 4XZ9A 4ADSA 1VCVA 1HKMA 4GVIA 1UA7A 4QRNA 3SB0A 4Y8FA 1RR2A 4JTUA 4ZQOA 4TUFA 3SCTA 3IS4A 5C6MA 4ZXOA 1NEYA 3ANVA 4Q7BA 2WANA 1SFTA 3A64A 3DFYA 4PUJA 3GDBA 1JCMP 3NPWA 4V27A 2QGYA 4PMRA 1EC8A 3QEZA 1XJBA 3LBOA 3IJ6A 4JX6A 4JQ3A 2DH2A 4ATWA 3UWYA 2G50A 3S9ZA 2DFAA 4LF1A 4M1RA 2EPNA 3SRKA 2ZVIA 4AZGA 1TYGA 3W2JA 2X42A 3CEPA 3CH0A 3VD7A 4ZFMA 5EMUA 5E93A 1H41A 4L9ZA 2O7QA 5DY2A 4UZUA 2C0AA 1PYMA 3WJXA 3HGSA 5AKQA 4GX9A 3G1XA 3HPSA 4PGLA 1FCVA 1TVNA 1DWIM 2F2KA 1NFPA 1QU4A 1V3LA 1B31A 1QO5A 3SADA 4JHOA 1S1RA 3G8RA 4IIGA 3T78A 1UKPA 3MKCA 3PG9A 3V0SA 3EPOA 2W27A 3M5XA 5CC7A 4JTCA 1YTKA 3UR8A 2YXXA 1SO3A 3CIVA 3IVUA 1TJ1A 4NI8A 1ME7A 5F2MA 4UQEA 3NWRA 4IX2A 1BHGA 3CO4A 3IIVA 3K4WA 1UD3A 1LBLA 3M5VA 2NXIA 1K03A 3W1QA 3WQGA 1QNVA 1UD4A 1KW1A 4F0HA 4A3HA 1MSSA 3CQJA 1CENA 1S39A 1JG9A 2DH3A 2W91A 3LXAA 3W71A 4ERAA 3LLXA 3QY8A 2Z2AA 4O1EA 3TFXA 1XFBA 2E8ZA 1OC6A 4IIEA 1T7LA 1XFCA 1BRLB 4KFPA 3E12A 1IT8A 3GW3A 1H50A 3W7JA 3BOFA 4F48A 4K68A 1ZNNA 1WDRA 3RN6A 4A2SA 2D20A 4UMCA 4YMZA 1I0BA 4H41A 5A6MA 1XINA 3VMOA 3TTYA 1I2QA 4YS1A 1QHOA 4J28A 4IG2A 3W1PA 1UR8A 3UG3A 4CCEA 2YCLB 4FSAA 1S5MA 2CHOA 4QX4A 3W7MA 3KW3A 5A8OA 7TIMA 3FS2A 1EP1A 3AROA 4K37A 4U33A 3QF0A 1BF2A 1E72M 4UTWC 3OBEA 1OZMA 8A3HA 5CSUA 3GKFA 4Q3MA 4IGHA 4GKTA 3AICA 1XYBA 3KHDA 4X0VA 2E9MA 2YA1A 4HYWA 1GTHA 1D8CA 5T91A 3MCOA 3IIOA 1L8NA 1FWFC 4HKPA 5G4HC 1W9DM 6REQB 3U4FA 3FGCA 3VOGA 1WUEA 2ZKMX 3CXOA 2VRQA 1XXXA 1FHVA 1VH7A 1NTHA 1N55A 4O0QA 4DWSB 4CU8A 3U57A 3LPOA 2D22A 4RE4A 5IBXC 3IJIA 3ABQA 5IDZA 3P8JA 4JIEA 2VX5A 4GISA 2QDHA 3PJTA 1FHLA 3GKAA 4DM2A 2QCDB 3JVAA 2C14A 1QOXA 1OGGA 4B90A 4P7NA 1DJXA 3OLIA 3VO0A 3AWNA 4Z2HA 1J12A 4PMQA 4S3FA 2PDPA 4QBXA 1UKSA 3RU8X 4DO4A 5KINA 2J78A 3MP3A 3S1WA 2XSBA 3A5FA 4RLIA 1I2RA 2YSWA 1ISZA 3ZWTA 3TXZA 3B4YA 1UWIA 4P2VA 4K38A 4XZNX 3N4EA 4H4IA 2WVSA 1E9LA 2WVVB 3D3FA 1GOOA 1EWEA 3BDKA 4B2DD 3WNOA 4IL0A 3LRMA 6PTDA 1TV3A 4GVGA 3RR1A 2INFA 1HO1A 4LVGA 3ITXA 1JCJA 3PVFA 1S2TA 3WNPA 5CQ1A 3TSBA 3W7LA 1UMLA 1SZGA 1EF3A 4EXBA 4S3BA 1FWRA 1TPUA 3A12A 3URQA 2FKPA 3C2RA 3NR0A 3KOFA 1WX0A 1RVKA 1XC6A 3GNNA 3DIPA 4CVWA 3P74A 2WVUA 2F61A 2VZOA 4B92A 3EMQA 2YKKA 1UR0A 3REQB 3GNRA 4C6LA 2EG7A 3V36A 5FL0A 2P53A 2C0HA 4WR3A 3T2OA 1FWBC 1TWDA 4A3UA 1A0CA 2MNRA 3CL6A 4ZTYA 1TPDA 2W66A 4EK7A 1OCNA 4AISA 3WLOA 3UR2A 1JDDA 1L0PA 3PZGA 4MY1A 3MUZ1 2O9PA 4O17A 3HBLA 2CYGA 1PIFA 1JEZA 2EPOA 1M01A 1MUWA 2XFRA 1KGXA 4MNKA 4UR7A 3IGSA 5AC6A 2NX1A 3NDZA 2ZZ3A 1JUEA 3R5EA 3MANA 4PMDA 2O55A 3BVJA 4NI3A 3A13A 1X7IA 3URBA 1W3TA 5FJIA 4AWUA 1Q6OA 1XIDA 2ZRWA 4URIA 1VFMA 1TV2A 2GQ3A 4NP7A 4PCTA 4EPKA 2JEQA 3M6DA 3BW4A 1AW2A 5ABTA 1TJ2A 4H9MA 1NOUA 2C3ZA 3M4HA 1QASA 4YIWA 2GYIA 5J04A 4PZVA 1F3TA 4Y9MA 5JIPA 3PZNA 3NQFA 4WDWA 3V35A 5JH1A 2R1PA 4G56A 4JTLA 1KCKA 2G3FA 1VS1A 3CUJA 3U8GA 3GG0A 3ZJ8A 2XGIA 5DXYA 3MYOA 2V6AA 3C4UA 1HN1A 3VKAA 4WKAA 1K9EA 3W7HA 4HOWA 4TOQA 4KEZA 4HMNA 2JE8A 2ZRYA 2PP1A 3KVMA 4GIEA 1KR0A 4MDPA 4JX4A 4ZOBA 4TVUA 3W7DA 1W1A1 1W37A 5C9WA 3I3DA 3PWGA 2PGRA 3PHAA 1QOQA 1UQZA 5G2WA 4NJKA 1JZ8A 1V3HA 3QLDA 4FLOA 2CESA 1Q65A 3SCUA 3DZ1A 1HNYA 2GWNA 1HW6A 3W7CA 4HNNA 3MI6A 3UXKA 3WCZA 4EXQA 3W7GA 1LL6A 1NWUA 1FWCC 4DQWA 2PGWA 4HK5A 2CLHA 3B0PA 4LPCA 1UA3A 4FNRA 1OT1A 1POJA 2J62A 2ATSA 1WNOA 3CUGA 4ZO9A 2V5LA 4O54A 1V08A 1U5VA 1UP2A 2OPJA 3S2MA 3LM3A 2E28A 3OGVA 2ZUNA 4IP5A 3CHVA 1AW5A 1AH0A 1XIGA 2PC8A 1A5BA 5DXXA 2QCHA 3EZ4A