3SIMA

Crystallographic structure analysis of family 18 chitinase from crocus vernus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
275
Chain Sequence
TLFVEYIGYPLFSGVKFSDVPINPHITKFQFVLSFAVDYTASSPHTSTNGKFNVFWDSSILGPDQISAIKSSHPNVRVAVSLGGASVGSNTVQFQAASVDSWVSNAVTSLTRIIQRYNLDGIDIDYEHFQNTDKNTFAECIGRLITTLKKNGVISFASISPFPSVDEYYLALFNEYKNAINHINYQFKAYDSSTSVDKFLGYYNNAASKYKGGNVLISFSTGPHPGGLPVDKGFFDAATSLKNKGKLHGIAVWTADTSKSSDFRYEEEAQAFLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein, Family 18 Chitinase
publication title Crystallographic structure analysis of family 18 Chitinase from Crocus vernus
rcsb
molecule tags Hydrolase
total genus 95
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3simA00
3F4VA 3WH9A 4P8VA 2NSXA 1VFOA 4W89A 3M7SA 3ZT5A 4W87A 1AVAA 4ZXOA 4GQQA 2Q8XA 3VIHA 3ZJ6A 4ATDA 2WCGA 2XYLA 1JXJA 5A6MA 3OLDA 3WBAA 4Z2HA 5AYBA 8A3HA 3OA5A 1ITXA 3WH6A 2CYGA 1V02E 4GI6A 2VUYA 1VJSA 4PTMA 4FLQA 1FFQA 2CHNA 1R86A 2WYSA 1BQCA 4HPHA 4MJ4A 3UG5A 1NOWA 5EB8A 5CGMA 3L4TA 5FOOA 3BH4A 3SEPA 5HPOA 2DT1A 2XFYA 1J10A 3N1AA 1C91A 3GH5A 2XSBA 5BXPA 3SUVA 4CD4A 2DSWA 4YHGA 3WF0A 3K8KA 2VZUA 1J0IA 3L4ZA 2XM1A 3K4AA 1BAGA 5A95A 4CGTA 2JE8A 4W8BA 1J0JA 5CPSA 2VOTA 4HZ8A 2GJXB 2RGLA 1BFNA 2VX4A 4UQAA 4BQ4A 2BY3A 3W38A 3JUGA 1MVYA 1UD8A 5CQ1A 5IDIA 3WNMA 2W66A 3J7HA 1D2KA 3MU7A 3ZO9A 2VX6A 1V3HA 1C8XA 3RM9A 2J78A 5DT5A 2YDRA 2FGLA 3AIUA 4PSRA 1WZLA 3WFZA 1ISXA 1IV8A 3NDYA 2YA1A 3N9KA 1OWQA 2F2HA 3POHA 1TCMA 1YHTA 2EPMX 3AS1A 2D20A 5A8PA 4J27A 2XWDA 1OINA 1H09A 1QNSA 4B3LA 1JDAA 4M24A 2YA0A 5HNNA 1WO2A 1EA9C 2PC8A 3EDFA 3VUPA 1XSJA 2WK2A 2YL5A 1ZJAA 3F5JA 4WKAA 3AMKA 3ZJKA 1CGTA 3A4AA 3II1A 2PWFA 4MB5A 4GO9A 3BC9A 1ODZA 4D6DA 1E4IA 3AROA 4OZOA 4TVUA 3NSNA 4AD4A 5M03A 5ABHA 4AEFA 3MSGA 3UR7A 5A2CA 1UR1A 3FNDA 4PBGA 1E6PA 4CVUA 2YL9A 3MMWA 2WM0A 2Y4SA 1XH2A 4E4PA 1E0XA 2PWDA 1V3IA 2E8YA 5D8ZA 2W4XA 1TG7A 2YBUA 2J47A 2WHLA 3PZGA 3TTQA 2X8RA 4AIEA 2DDXA 4CD7A 3B9EA 1E43A 3VIFA 4HA1A 2BVDA 4MB4A 1E55A 4HTYA 1RPKA 4MJ2A 1J12A 3MUZ1 3GM8A 1DTUA 2BY0A 3VM7A 4UFHA 3OLEA 1GJWA 4HOWA 1E0WA 2VCCA 4W86A 3W53A 1WZAA 1GVYA 1G1YA 2IXUA 2A3EA 4JKLA 3CUHA 2VZSA 4ZENA 1HKIA 1EDQA 1NWTA 5A8NA 3GXMA 3FXYA 3LPOA 4F79A 4D72A 1HVXA 1TZ7A 1H0GA 2VVNA 4AD1A 3BCFA 4MDPA 1LWJA 4QLJA 1HP4A 4W5UA 1R87A 2BV9A 1G9HA 4BQ3A 4HMDA 4LX4A 4F66A 3UCQA 2RGMA 3ARPA 4PTVA 2EBNA 4AIUA 4AZ6A 3SCTA 6A3HA 2VT0A 1W32A 4XUYA 1EQPA 2ZIDA 5EMYA 1HKJA 3ECQA 3EMQA 3BAYA 3NSMA 5IHSA 2C7FA 2WCAA 1SR0A 3RILA 1UZ1A 3DYOA 3NCOA 2AAAA 3OZOA 2GK1A 2V3GA 1CIUA 4XB3A 2QF8A 3IJ7A 7CGTA 2XJ7A 2DPEA 3EYPA 5M5DA 4MNKA 2WW5A 4E8CA 5E6ZA 1UKTA 2J7HA 3TTYA 1JFHA 1D3CA 5BXTA 2PWHA 2Z1SA 3QOMA 3RM4A 3A4WA 3BAXA 2W61A 2ZXQA 4UFMA 1E72M 1QNRA 3VKKA 2VTFA 2XVGA 1CLVA 3VOCA 3N18A 1ISVA 4QLLA 3SCWA 3ZT7A 4MB3A 1KWGA 5CPTA 2GJRA 5F7UA 3CPUA 3U7BA 3CLWA 2IUZA 3A6OA 3OGVA 3AOFA 1IZJA 3DHPA 1GOKA 1W9UA 3G6LA 1HN1A 2J79A 4P7OA 5D8WA 4GKLA 4J3VA 2XVPA 4ZFMA 1JZ7A 5A8MA 3QHOA 1CGYA 4AZGA 4EK7A 5C8BB 1QBBA 4AC1X 1QOXA 1I1WA 3AIEA 2E40A 1VEOA 2YIHA 1UH3A 1K9FA 1LL7A 4PYSA 3AYSA 3VD7A 2G41A 1VFFA 1XH0A 3IAPA 4A4AA 4MNMA 1QVBA 1QI3A 3CUFA 2O9PA 3WD2A 4LYPA 1CXLA 2JALA 1KXTA 3NYDA 3BXWA 1UD2A 4U3CA 2XPKA 3K46A 1TVNA 1CECA 5JUVA 4AD2A 5A94A 1UR9A 1JZ8A 1DP0A 1RP8A 2NT0A 2WLZA 1E6QM 2ZX6A 1EDGA 1GNXA 2UY4A 1J18A 1QBAA 2FHCA 1QHOA 2D0GA 4DWSD 2WMIB 1E70M 1BTCA 2WZEA 1E15A 4OOZA 2YL8A 3GBDA 1UKSA 1PIGA 3BSGA 1J0KA 2EPNA 3L2LA 1H0IA 2OWCA 2BNJA 5A2BA 1JYXA 2G8ZA 1JZ6A 2AMGA 3B8SA 2WHKA 1HL8A 5E0FA 2GDVA 3WEMA 2BXYA 2ZWZA 1UA7A 3FW6A 1BGAA 3E1F1 4UQDA 2CETA 2VZTA 4HU0A 1UQZA 1XC6A 3ARQA 4OJYA 4A3YA 1EHAA 1I75A 4HPGA 1NP2A 1PJ9A 3OBAA 4JFTA 2D3NA 1Z32X 1XRVA 4MB1A 1GPFA 5BXSA 1X6NA 1JDCA 3S2CA 3ARWA 5HOSA 3T0DA 2WBKA 4IUGA 2YL6A 1LG2A 2X09A 1EOKA 4AWEA 2X0YA 3THCA 4AYSA 4B9ZA 4CN1A 2WLYA 1BYDA 5D9OA 2CEQA 3EBVA 4CCDA 3LPGA 3MUAA 5CXPA 1VJZA 3LMYA 1ISWA 2WKLA 1E56A 4V28A 3BMWA 1N82A 3VNYA 1D7FA 1OD8A 2TAAA 2XM2A 1W2PA 2MANA 3NJ3A 3S6TA 3WIJA 4BA0A 5JBFA 1CENA 1O7AA 5ABFB 2DQXA 1MW3A 4W84A 4D6FA 3K4DA 3TA9A 3OB8A 3K1DA 1WKYA 5A6AA 3VD4A 1DWGM 4GZIA 3VIGA 3WH8A 4AZHA 1XHGA 2ZUSA 4UZUA 1WDSA 4TTUA 3AZTA 5CSUA 3WH5A 1VEMA 4NZCA 3MS8A 4FMVA 1LL6A 4KH2A 1OM0A 1VFUA 1M03A 1NQ6A 1JF6A 4M82A 1RH9A 4FLSA 1EDTA 3KL3A 4WKHA 1CXHA 3B9DA 4FF5A 2OLHA 4AZCA 2V5CA 2J7EA 1CLXA 5JIWA 4UQCA 4JFVA 2J75A 1E3ZA 1TR1A 2HVMA 1CEOA 3IJ8A 2YKKA 3WDRA 4N42A 3WF1A 1CBGA 1HKMA 3FAWA 4FLRA 1E6XM 1J0ZA 1GQJA 4JKKA 2F8QA 1SYTA 5I77A 2GUYA 3GBEA 2GSJA 4AXNA 3ARSA 4JL2A 4WJXA 1E3XA 5GQBA 3GXIA 1K6AA 2ZUWA 3KL0A 2VL4A 3UG4A 1WPCA 1HL9A 2IXVA 3AS2A 3ZR5A 2J7DA 1FA2A 2BVYA 1M01A 5FIPA 1P6WA 3W0KA 1B31A 1E6NA 4QCFA 1KGXA 2Z1KA 4PCSA 4UOZA 2VRJA 4WKFA 2E8ZA 1SMDA 1FH7A 4W88A 1B3VA 2W63A 1GOMA 2G3NA 2Y8VA 4H8VA 3ALFA 3RPMA 2D0HA 3CIVA 4PEEA 5AYIA 1PX8A 5M3WA 1V6XA 3D5HA 4HU8A 5A6BD 1H4PA 3DYMA 2EPOA 2JFEX 3SUWA 2W5FA 2JEQA 4U31A 1PAMA 3RO8A 1H1NA 3PBGA 3RIKA 1V0KA 4H04A 3L4UA 1MW2A 1W91A 1JXKA 3SCVA 4XX6A 2A3HA 1UWUA 4UTFA 2ZUMA 3CZLA 4ACZA 4P7NA 3VPLA 5D9NA 3FAXA 2XHYA 4PMOA 2FH6A 1MXDA 3AXXA 2EQDA 2GJXA 4GO8A 1H41A 4MAZA 1EQCA 3BMVA 4L4PA 1W3JA 3CHDA 3VINA 2B31A 1CXFA 4S3KA 2G3IA 4W7UA 4NF7A 4UOJA 1C8QA 4DWSB 4X0VA 1HJWA 4JIEA 3IAQA 4UFLA 1E73M 3WQVA 5JBDA 1EO7A 2DH2A 3CHEA 1DWAM 3W27A 1UYQA 3IJ9A 2J74A 4AZIA 1X6LA 1M7XA 3PZUA 1MXGA 2JIWA 5KZ6A 4Y7EA 4TUFA 4K68A 3WD4A 3WMBA 2OSWA 3UG3A 4J28A 4D71A 1C7TA 4QDMA 1B30A 1WAWA 3WUBA 1GOQA 1MQPA 1DWFM 2VX5A 1CZ1A 3QGVA 4V2XA 1MQRA 3N13A 1ZL1A 3OG2A 3CHFA 1CPUA 1GHRA 1W3KA 1A47A 1KFWA 2ZUNA 3WN6A 4KRTA 2VURA 1JD9A 1L0PA 3GXDA 3TTOA 4HA3A 2CITA 4J7RA 1B90A 3WBEA 4HA4A 4M81A 5AC4A 1QW8A 1W1YA 3N17A 3WEZA 1V03A 5CG0A 4IM4A 2V3EA 4YPJA 3VGEA 1DWHM 2EPKX 3VDAA 5IFTA 3PTKA 1ISZA 1MFVA 3AHZA 1SMAA 5CLWA 1J0HA 2BHYA 2WVSA 3T2PA 4PMDA 2XTKA 1KGUA 2BHZA 2WVVB 2CBJA 2DT2A 2UY5A 1W3HA 5KEZA 3CO4A 3UEQA 4PMUA 2BY2A 1TA3A 2V3DA 3QHMA 1JG9A 2W62A 1EOMA 3FHAA 2VQUA 3N11A 1RP9A 2E3ZA 3MMDA 2DT0A 1DHKA 4JFSA 1E6ZA 1NARA 5LA2A 1JF5A 3WUEA 1E0VA 1A3HA 3QHNA 1WDRA 2ZICA 3KE0A 3ZIZA 3VGBA 1GW1A 2ESCA 1WCGA 3AZSA 1UR8A 1UA3A 3VD9A 1E1EA 1NH6A 4XZBA 4R5EA 5LYRA 3CMGA 1X1NA 2J8FA 1OT1A 1W9DM 3CZGA 5CZKA 4CN6A 4PSPA 3NSXA 3KZSA 3PZ9A 1FOBA 2ZX5A 4BZYA 4JKMA 2VQTA 4D1IA 1VRXA 3BAKA 3CBWA 7A3HA 3AIWA 4URIA 2FDMA 3BLKA 4QFUA 4Q22A 5BXRA 2WHJA 4LGXA 1WNOA 1R8LA 3WNKA 2WSPA 3PHAA 5I24A 4Q7NA 1MW0A 5ECUA 3N15A 1HKKA 1V3JA 2ZXDA 4MTVA 1UKQA 4V27A 4Z2JA 1UD5A 3B9AA 3W28A 5DO8A 3PZQA 1XH1A 2BS9A 3VDBA 1HIZA 1J01A 1OIFA 1BPLB 1VAHA 3ARYA 3MUY1 4DM1A 1C92A 1CDGA 1QHZA 2C0HA 3WQ4A 1JI1A 1B1YA 4PTXA 1MFUA 1EGZA 5E09A 3DHUA 2A3CA 2D1ZA 1V0NA 2DIEA 3F5LA 3N12A 3ARRA 4RE2A 1MWOA 2ZX8A 4B3KA 3AS3A 3A4XA 1QNQA 2VR5A 1PX4A 1B0IA 3VD5A 3ARXA 3WKZA 4H8UA 3O9NA 3WF3A 1UWRA 3KWXA 5E70A 2CKRA 2ZXAA 1LG1A 1UR4A 5EFFA 5DF0A 2WB5A 4JCMA 1EHNA 4LYQA 1W9BM 2Y5EA 3WUGA 2Y8KA 5E0CA 1VBRA 5DFAA 4HZ7A 3VD3A 1JDDA 3VIKA 1OGBA 1B3XA 5D9PA 2GK1B 1GORA 4J3XA 3VO0A 4RE4A 3CUJA 3A47A 4E2OA 5GNZA 3DECA 1OB0A 2J7FA 4DUXA 1CNVA 2CESA 4Z2LA 2GDUA 4XV0A 1E71M 2ZXBA 3SURA 1PEZA 1PX3A 2VVSA 3PTMA 1UG6A 3CZ8A 1OCQA 3EMZA 3WEOA 4WSKA 3AFBA 5EFDA 5IXEA 3LPPA 3WNOA 2XUCA 2Y24A 1PPIA 4J3UA 3WY1A 4W85A 3CGTA 3W37A 5AY7A 1BHGA 4GXPA 2J7CA 3A3HA 4UFIA 1GQKA 4DUVA 2BVTA 1MYRA 3FY1A 4QCEA 2GFTA 1Q4NX 2O9TA 4HZ6A 1C8YA 2W91A 2XVLA 2VCAA 3I3DA 4W5ZA 1OIMA 1XGZA 2XSAA 1AQHA 4PMQA 2HISA 3ZJ7A 3OGSA 1V3MA 2W92A 1UZ4A 2DT3A 1EH9A 3KEHA 2ZE0A 2OWXA 5FKYA 1XD0A 2ZUUA 1NOUA 3WDPP 4DM2A 3WDIA 2XIBA 1JYWA 3PZMA 2OYMA 1UR0A 3CHCA 4L4OA 4TXEA 9CGTA 1V0MA 4M1RA 4HOXA 1G94A 2VRKA 3GTNA 1XV8A 4F9DA 1TVPA 1JZ5A 4OBRA 4M29A 4IPLA 2ZWYA 4PRWA 4PMNA 2A3BA 1H3GA 1EO5A 1HJSA 3VIMA 1QNPA 2EJ1A 2WWDA 2Y2WA 3SUTA 2QPSA 2YDSA 3RDKA 4BS0A 4LPCA 3T2OA 3W26A 2OSXA 2JIEA 3AICA 5A2AA 2J62A 3NDZA 3ALGA 1LJYA 3AIRA 2BXZA 2GVYA 2WANA 4U5KA 5D4YA 5CSYA 1AQMA 1ZBVA 5I79A 5I2UA 1M53A 1XSIA 2CNCA 3VMOA 1B9ZA 2YLAA 2DIJA 2J4GA 2JEPA 3DYPA 1QI4A 5M17A 4NRRA 3VGDA 3L4YA 3WDJA 3ZOAA 2XVNA 4ATWA 1U33A 2WC3A 3RJYA 2G3MA 3T0AA 4DUWA 2WCSA 3ZQ9A 1W9VA 2VI0A 1U30A 4MADA 4TX8A 5A3HA 4AD0A 3T08A 2YBTA 3WMCA 1F4AA 2E9LA 1JZ2A 2XG9A 3N04A 3VM5A 2WPGA 1BVZA 2JF6A 2WHMA 4E8DA 3O6AA 5CPQA 5A8QA 1HP5A 4MDOA 2EPLX 1CWYA 3VGGA 1V3LA 3UR8A 4OIFA 3TOPA 4PMYA 4JCLA 2JF7A 1O6IA 5DEZA 1XD1A 3AXIA 4UQEA 3AZRA 3CTTA 2BY1A 4PMXA 3WSUA 5I5RA 1VEPA 4LYRA 3WDHA 1ITCA 1TMQA 3BCDA 4JFWA 1FHDA 1H49A 1EIBA 5AC5A 2J7BA 4GIAA 4YHEA 4U5IA 4C7DA 5A69A 1NWRA 2EEXA 4ACYA 1QHPA 1NWSA 5A6SA 5LA1A 2V5DA 3GNPA 5DMYA 2CIPA 3CUGA 4OKDA 1HVQA 2VNCA 4ML4A 2VCBA 3QR3A 2PWGA 2J25A 1M04A 2ZX9A 4PUDA 4J3SA 2D24A 4YN5A 2WVTA 5I6SA 1B2YA 2NW0A 4JHOA 4H41A 4AZCB 3ZSSA 1KB3A 2WNWA 2XGIA 3ARVA 1YQ2A 4BQ2A 3HN3A 1FP8A 1UD3A 3VILA 1HX0A 4P8WA 3HJEA 1UH4A 1WDQA 4GI9A 4CD5A 3WD3A 1GQIA 2XFFA 1DWIM 1BYAA 4AMCA 2DSVA 3U5UA 3EDKA 3WH7A 4F8XA 4UFKA 3IANA 1JD7A 2PBOA 4KRUA 3GDBA 1TFVA 1UR2A 1HNYA 2BFGA 4TTGA 2D2OA 1HXJA 2DSUA 2XFRA 4DWSA 4GZJA 5HBFA 3HMCA 1HJQA 2PI6A 5BROA 2QHAA 3AIVA 1ECEA 2FHBA 3AXHA 1GUVA 1RD6A 3SIMA 5I78A 1DEDA 1KXHA 1FP9A 4AISA 3VDCA 3VNZA 3VIPA 2OWWA 2X1IA 3MV11 1BYBA 2VZVA 3PTQA 4WIWA 1BSIA 3W25A 4OBSA 2O92A 1BGGA 1US3A 4B9YA 5IFPA 2XWEA 1K9EA 1OBAA 1QI0A 5HPCA 2CBIA 3GZAA 5A6JA 1W1VA 3FN9A 1GHSA 3EDEA 2EO7A 1S46A 4Z2GA 4CCCA 4ACZB 3W82A 3ZSTA 4TVCA 4P8UA 1AMYA 3UESA 1K9TA 1NWUA 4OUEA 4JHZA 1IZKA 2DH3A 2WXDM 4Z2KA 2WAGA 1SFSA 2X05A 1LWHA 4PTWA 5FL0A 2AOSA 1QI2A 2W67A 2WMJA 1KQZA 8CGTA 4HOZA 3AMLA 1DWJM 1HT6A 5ABEA 4EE9A 3ZT6A 1VF8A 4QLKA 1PZ2A 4MPKA 2ZUVA 2DEPA 2A3AA 4HMCA 4RE3A 4BCEA 1ZJBA 1BF2A 5C71A 2WVVA 3OLGA 4QP0A 5EBAA 3TTSA 2DSKA 1WP6A 1E5JA 2J77A 4AD5A 2ZOXA 3L2MA 3W29A 1UWSA 5A8OA 4D1JA 1TUXA 1CGXA 1QW9A 2E9BA 4AD3A 5BRQA 5DT7A 2VMFA 4FLOA 1WDPA 2QV4A 3MANA 4P7LA 4UCFA 3SUSA 3WQ5A 1W2VA 4HMEA 4N0RA 1J0YA 4JFUA 3EDJA 5GPRA 1LL4A 2V3FA 4UFJA 3BLPX 4AIOA 1ODUA 1C93A 1KBBA 1VENA 3WNNA 2BHUA 1GJUA 4MNLA 1R85A 5JIPA 4TOQA 3PZNA 4NI3A 3VVGA 1XYFA 3U7VA 4U33A 1JZ3A 3DC0A 4PMRA 3THDA 1GONA 1JI2A 4X9YA 3WDQA 5A6KA 5FL1A 1V6YA 4HP5A 1JAKA 3WNLA 3ZR6A 1UQYA 2J8GA 4AW7A 2YDQA 3T09A 5CGTA 5BWFA 1KXVA 1BG4A 3O2LA 3W6MA 3D3AA 5E6YA 3WL1A 3AI0A 3G6MA 1G5AA 1CXKA 1UWTA 3L4XA 4JAWA 4D6EA 1MW1A 1K9DA 1UH2A 1OD0A 1TA3B 3W6LA 2UWFA 3NIYA 4CU7A 1PZ3A 3AHXA 4XZWA 3APGA 3NUKA 3L4VA 4W93A 1ZB5A 3CH9A 3SCPA 1R7AA 5ABGA 2UY2A 4TX6A 4MAVA 1B3WA 5A6BA 3WD1A 3VU2A 3WELA 3K8MA 3VX1A 1WB0A 2ZX7A 4AZ5A 3I3EA 4D6IA 4AZBA 1UOKA 4NSBA 1KXQA 4CUCA 5I3DA 1QNOA 2CHOA 3U57A 1NOFA 1Y7VA 1HJVA 4ZEPA 1H5VA 1KQYA 3SCNA 3TP4A 1B3ZA 1BLIA 1JFXA 3UETA 1KR1A 1J11A 4X0NA 3M46A 4NRSA 3ZMRA 4D6HA 3WQ8A 4KGJA 4JL1A 2CKSA 4GI8A 1OT2A 2UY3A 1E4LA 1HJXA 1V0LA 4ZXLA 2QPUA 3WFLA 4GZEA 1H11A 4D6GA 4CVWA 2J7GA 4W7VA 2O9RA 2XIIA 2V38A 3CZKA 3SUUA 4UR9A 1JYNA 2D22A 2PBGA 4CN4A 1KGWA 3AQUA 3GH7A 4EAMA 4H8HA 4WF7A 1R7OA 3M6DA 2X2YA 3GNRA 2YA2A 2YLLA 1ZBWA 1UUQA 1PBGA 3ARTA 1L8NA 3WUFA 1HJUA 1PIFA 1QPKA 1Q6GA 4UOQA 1Q6DA 1W1PA 1ZBKA 2G4FA 2QMJA 2WVUA 1HF6A 2WZHA 3OZPA 1GOWA 1F4HA 3VDHA 3GNOA 1BVNP 2D3LA 1V6VA 2VRQA 4EANA 2FGZA 4H2CA 3ARUA 4GINA 1E5NA 2C8NA 4TVDA 4U3AA 3RMEA 1OGSA 3MKKA 3CZJA 1Q6EA 3AIBA 4LXFA 3WD0A 1C3FA 1WE5A 2WMGA 2WMIA 1CGVA 1V08A 2F61A 2OYLA 2O9OA 3POCA 1UKPA 1UKOA 1UWIA 2QMKA 3AMGA 3UERA 5E9AA 1LF1A 1J9YA 3OLIA 1VIWA 1JNEA 3VMPA 3BAWA 4UZSA 1OGGA 1KR0A 2E4TA 1I1XA 2WBGA 1XCXA 2DGAA 4DWSC 7TAAA 1UD4A 3WENA 1UD6A 1FH9A 3VIJA 3AHTA 1W3LA 4B15A 3MO4A 3EDDA 5CJ5A 4C7FA 2WMKA 3VIIA 4M80A 3WF2A 3LPFA 2YOCA 1TE1A 1Q6FA 1LLOA 1CXIA 3VX0A 1JYVA 2DSZA 4U2YA 3ZJ8A 4UNIA 3VGHA 4M8UA 3MUIA 2WMHA 3PZOA 1V3KA 3GXFA 1H2JA 3U5YA 4P8XA 4J3TA 3W81A 4AY1A 1BYCA 1V6UA 4ZE4A 4B16A 4IPNB 4U2ZA 3SCQA 1U2YA 4MNJA 3CMJA 5TD4A 6TAAA 3BSHA 3VMNA 3ARZA 2CPUA 3CZEA 2QLYA 3MMUA 3AMDA 3QOKA 3T0BA 3BAJA 3KL5A 1CGWA 3EMCA 2WC7A 5ABFA 1KWKA 2CBUA 1G01A 2X0HA 1E4MM 1KCKA 1XCWA 1WZMA 4UQ9A 1V6WA 3AJ7A 3AHYA 4H7VA 1CXEA 1US2A 4J3WA 1W1TA 4FK9A 4KGLA 3AIQA 5D9MA 4S3JA 3BGAA 4D6JA 1VFMA 1UWQA 4GQRA 2E9MA 4UQBA 1CTNA 4W8AA 3F5KA 4F9JA 3SCSA 3GH4A 2VX7A 4P7QA 1XYZA 4PMVA 3AYRA 2VZOA 2CERA 1C7SA 1JGIA 1KCLA 3TONA 3WNPA 2PF0A 5I23A 3CUIA 4Z2IA 2WKGA 1JL8A 4KMQA 1VB9A 1C90A 1E6RA 5BCAA 1GCYA 1Q6CA 1EXPA 1WZKA 4W8LA 3FHQA 3W24A 4WK9A 1BG9A 4PMZA 5HXMA 4WLCA 2CBVA 3MSDA 2VJXA 4PN2A 1GOIA 5JBEA 3MV01 1JZ4A 1ZU8A 3K8LA 4OOUA 4CCEA 1AQ0A 1G0CA 3W4RA 2XGBA 4A3HA 1UHVA 4AZ7A 1OSEA 4CKQA 3WQWA 2G3JA 3AS0A 1E4NA 1FHLA 1ISYA 1GVIA 1FFRA 2FH8A 4EKJA 4JZ5A 2GJPA 2WMFA 2WZIA 3VTRA 3M07A 1E1FA 3OGRA 3SCUA 3PN8A 3PZTA 5CLTA 4QAWA 2PB1A 5HDRA 1JIBA 3AISA 1GOOA 5FD0A 4CU8A 2D23A 2D0FA 1B3YA 1W9PA 2PWEA 3RJXA 3OIHA 4CD6A 2OYKA 3PZIA 4P7RA 4RL3A 3BAIA 2E0PA 2VO5A 5BYWA 4BQ5A 2WWCA 1CYGA 3GYCA 4W7WA 2FHFA 3L4WA 3VIOA 5BRPA 4KWUA 1ZBCA 2VR4A 1V02A 3WMSA 3AMCA 3RM8A 1IT0A 3ZM8A 1E40A 3SCRA 1JNDA 3IK2A 3VGFA 5GNYA 2ZUTA 4D6CA 2EXOA 5A6LA 5LA0A 4WSJA 3HU7A 2WC4A 1XSKA 1ZS2A 4M56A 5I0DA 1QI5A 3RCNA 3AHVA 4C7GA 2CCRA 2CXGA 3WL0A 1ESWA 1E6SM 2NT1A 5IHRA 4CD8A 4IISA 1JAEA 1KBKA 4PCTA 1CGUA 2WSKA 5A1AA 2YJQA 1LQ0A 1E9LA 1GQLA 1GZJA 3WF4A 1W9XA 1VBUA 4ATLA 3WQ6A 3SCOA 5C70A 6CGTA 4CU6A 3I3BA 4ZE5A 3PZVA 4R27A 4PUEA 5GNXA 4BF7A 4GPNA 1FH8A 2VC9A 2XVKA 4LQ1A 3T2QA 1MQQA 1NM9A 4AEEA 1NP0A 5FCZA 2OSYA
chains in the Genus database with same CATH superfamily
3F4VA 3WH9A 3NQAA 4DLFA 1VGAA 3ZT5A 2V67A 2QZRA 3VIHA 3ZJ6A 4ATDA 2QDHA 5A6MA 4K1WA 1XISA 3PJUA 5AYBA 8A3HA 1MUMA 2DZVA 3PM6A 2NLIA 4GI6A 2ZC8A 2VUYA 5A5WA 2PS2A 1FFQA 3NQGA 1SZRA 2WNQA 4S3DA 1QUMA 4LAMA 3D3FA 5CGMA 5FOOA 1V6TA 3BH4A 5HPOA 2DT1A 2HNEA 3GH5A 2XSBA 4CD4A 2DSWA 4YHGA 1XKJA 1L6SA 1WV2A 3K4AA 4MWAE 1BAGA 2JE8A 3L2IA 4ZQMA 1TUFA 4KF1A 2VOTA 1I6NA 3VDGA 2GJXB 2RGLA 4UQAA 4X9SA 4DYKA 4WGHA 5CQ1A 4NVTA 3WNMA 3CUXA 4Q8PA 4F4RA 1C8XA 2J78A 1IXPA 4S39A 5DT5A 3AIUA 4G7EB 3IIVA 2QJMA 1IV8A 2E5BA 2P3ZA 3SJNA 1OWQA 2F84A 1ME7A 1MDRA 2YYTA 3GE7A 1VBJA 1OINA 4AWTA 1WQ5A 3KBNA 1O95A 2YA0A 3O07A 5HNNA 1WO2A 1EA9C 2PC8A 3EDFA 5HJXA 2Q01A 4IPJA 1DPMA 2A7PA 3GU1A 1ZJAA 2V2HA 4WKAA 2X1SA 3G77A 3AMKA 3TC6A 1A4LA 3II1A 4O1AA 4PUWA 4MB5A 3IJIA 4GO9A 3BC9A 4D6DA 5LNVA 1D8CA 1AG1O 1DYSA 3AROA 1NY1A 2KX9A 3P93A 3M44A 2VFHA 3UR7A 4DBUA 1AZ1A 1XDJA 4PBGA 4NJHA 3MP3A 1VKFA 1E0XA 3SJ3A 1ZP4A 1W0MA 1XLMA 3UJEA 2I16A 4N9CA 4GNKB 3LXAA 3PZGA 5EA9A 1KRAC 3TTQA 4AIEA 1UUOA 4WOZA 3H70A 3VIFA 3R43A 3DFPA 4O10A 1GVQA 4MJ2A 1OK4A 1J12A 3GM8A 2BY0A 4GZ7A 3NOYA 1EC7A 2AAMA 2NQ9A 1IWPA 3KDOA 2VCCA 1FWEC 1O5QA 1WZAA 2A3EA 2Y61A 3CUHA 1HKIA 1WUEA 4XISA 1REQA 3GXMA 3NZGA 3LPOA 1DE6A 4F79A 1G7VA 1TZ7A 1T40A 1XL9A 1JQXA 3DKJA 2HROA 3TKFA 4DBWA 2VFFA 3GNXA 5HNUA 3OYXA 5E1QA 4L9YA 1R47A 2O7SA 1G9HA 4C90A 4BQ3A 4OU1A 2ZADA 1F3TA 4RR4A 4PTVA 3SCTA 4XUYA 1TWDA 2ZIDA 3WK3A 3GC5A 3WQEA 1FWHC 5IHSA 3RILA 3DYOA 3CS2A 1ZENA 1CIUA 4XB3A 7CGTA 5AN7A 1QATA 1KRCC 2INFA 3TTYA 3KVKA 4DYJA 2PWHA 2Z1SA 1Y0EA 3HGOA 3H4WA 3G1RA 1E72M 1QNRA 2VTFA 1XBYA 1CLVA 3JS3A 2BOGX 2O7QA 2PRLA 2G37A 1P0EA 1KM6A 1PL9A 3DI1A 5CPTA 1HQTA 3U7BA 2V2DA 4UBPC 1F2JA 2YCLA 4QNWA 1IZJA 3SB0A 2CLOA 3R8HA 3G6LA 4FXSA 1GW9A 4YTSA 3EX3A 4ZB0A 3TUUA 3B05A 4ZFMA 1I2QA 3PBUA 1DJXA 3KZPA 4AZGA 4EK7A 3SSJA 1KTBA 3OBKA 4PEKA 3GFYA 4GFSA 4I90A 2YIHA 1UH3A 3LHZA 1LL7A 3NPWA 3JR2A 4DZHA 3ELFA 3LY0A 1OYBA 3NGJA 2G41A 2FMNA 1QVBA 3FOKA 3B03A 5FEXA 5DRCA 2XH2A 1AJ2A 3NYDA 1TJ0A 1G4TA 1UASA 3WJYA 2Z0IA 1RLCL 2G4JA 3WO8A 1K6WA 3QSRA 4ZBCA 3GKFA 1LOLA 1GNXA 3F2DA 3JRKA 3LENA 4M51A 2PGFA 5I00A 1VC4A 2Y63A 3AU2A 4DWSD 2WMIB 2PURA 3BLIA 1XIGA 4S3EA 3GBDA 4WDTA 1UKSA 2G96A 2HEJA 3W7PA 4PCPA 3G1DA 3L2LA 1H0IA 1W56A 2OWCA 4G8TA 1U5JA 2BNJA 3C2FA 1JYXA 3S9YA 2AMGA 2WHKA 5E0FA 2BXYA 3V5FA 1QJWA 4F2TA 1TV2A 2CETA 2IW0A 4WZHA 1EEXA 3E0VA 4ZZ9A 4OJYA 4A3YA 3AALA 3L68A 4R9OA 2V63A 1NP2A 1Z8AA 2BZNA 4JFTA 4JTJA 1GPFA 5BXSA 3S2CA 1T96A 3ARWA 2AL2A 2IS7A 5HOSA 3W1MA 4IWWA 3STFA 5I3IA 3T0DA 1BSLA 4K2SA 4IUGA 1A5BA 3GDMA 3ID7A 3W1RA 3TYBA 1ONXA 4JGDA 2Z2AA 4WCJA 3TXZA 4M6QA 4B9ZA 1KRMA 4MYAA 3GXPA 2WLYA 3KRZA 4JIQA 5HQMA 1P1MA 4UTLA 3LMYA 2CLEA 4V28A 3SIZA 3BMWA 1IEWA 4LAOA 1OD8A 3L0GA 5F1VA 2XM2A 3O0FA 3K1GA 2MANA 3WQDA 3NJ3A 2PLKA 3WIJA 4BA0A 1FWTA 3HG5A 5ABFB 2DQXA 4I9MA 2ZRWA 5EKYA 3K1DA 1QR7A 1G67A 2Z29A 1WKYA 5A6AA 1VRDA 3KBSA 3U6WA 3VIGA 1XRTA 3UJSA 1BWLA 3M0MA 3B8TA 5F2MA 4XSLA 5CSUA 3QMTA 1LL6A 1SZFA 4DX3A 1Y65A 4KH2A 1MXSA 1OX6A 1RH9A 1K8YA 3CQIA 3UJ2A 2V5CA 4WVXA 3CJPA 3LM7A 2HVMA 1BTMA 3NL6A 3WDRA 3WF1A 1CBGA 2CW6A 3FAWA 3EOLA 3M0VA 1XLLA 3LHYA 4JKKA 3VOHA 2F8QA 1Z9AA 5I77A 1E9YB 1VH7A 3GBEA 4GUJA 3DZ1A 4JL2A 3LQGA 3W7EA 4ZTYA 3FXGA 2PU1A 4IMDA 2ZUWA 4QJ3B 3M0KA 3UG4A 4I9AA 1GEHA 1FWNA 1W1A1 3W1NA 4QCFA 4GYPC 4Z0SA 4UR8A 1UUMA 4WKFA 5G4HC 1SMDA 1B3VA 4QQ3A 2VC7A 2W63A 2Q02A 3NQ6A 1A53A 4PEEA 4KWWA 1VHNA 1ZJIA 3D5HA 2OGYA 1EGVA 1PB0A 1TE6A 3DYMA 4GC4A 4IP5A 3OEXA 5AVNA 4Q4SA 3RO8A 1H1NA 1FBAA 3PBGA 1OG0A 1V0KA 4WHBA 1OYAA 1XG4A 3U8GA 1MW2A 4C6KA 5REQA 1W91A 4QXIA 3CPGA 4A3UA 1XR2A 3GWQA 3RPTA 4O53A 1UWUA 4UTFA 4QE5A 2PMQA 4ACZA 5DY2A 2Z2UA 2EAWA 3FAXA 2XHYA 2FH6A 2C1HA 1XIMA 3AXXA 4MAZA 1EQCA 4AVFA 4KESA 1W3JA 3Q4DA 1OYCA 5I3HA 3VINA 3GC2A 4KETA 2P8BA 3GTIA 4W7UA 3TOYA 3G3MA 1LT8A 4XD6A 4LF2A 1N2VA 2QT3A 3H2NA 3HQNA 3L5MA 3IAQA 1EZWA 1XYLA 3UA3A 4JNMA 4R88A 3W7JA 3BV4A 1DWAM 1NDYA 1NQKA 3RX2A 4GC3A 3T1GA 3W02A 1V79A 3IJ9A 2J74A 4UB9A 4AZIA 2QCEA 3QPZA 3TFCA 1MXGA 2JIWA 3W74A 2GWNA 3UGVA 4K68A 2W0UA 3BG9A 1YNYA 3IK4A 3MCMA 4H9VA 3GFZA 2MNRA 1KCZA 2FFCA 3NDOA 3G1SA 2FLIA 3LX9A 3CL8A 2PP1A 2O4QA 1WAWA 3IPWA 3MBFA 1KD0A 4FR1A 4NT0A 3TYAA 2VX5A 1CZ1A 3TW7A 3I7QA 2FPVA 3V0SA 3SI9A 1CPUA 4ZA0A 1GHRA 1FWAC 4GXWA 2P88A 3KTCA 2HE5A 1FHVA 3EX1A 2QAPA 3WBEA 4ADTA 3EKGA 3MPGA 4GIRA 3GUGA 1DWHM 2EPKX 3VDAA 4DJDD 5IFTA 2GQ3A 3PBMA 1P43A 4YNGA 3K30A 3A24A 2IPFA 3Q37A 2NQ5A 1SMAA 5CLWA 4KKXA 2BHYA 2DZXA 3T2PA 1YE4A 1KGUA 4IP4A 4UNLA 2CBJA 2GQAA 4NNAA 4O15A 4KRZA 1S5WA 1EOMA 1TWZA 3QR1A 2DT0A 4TX9A 1NARA 3M4HA 3DHDA 1OABA 5G1TA 1A3HA 1K77A 3KE0A 3M0YA 4EXBA 3KTSA 2VEPA 1LQAA 1GW1A 2ESCA 3CV2A 1UR8A 4POCA 1X1NA 4A8LA 2J8FA 5K9CA 1AW2A 4UTUA 4MLRA 3CZGA 5CZKA 1I2PA 1QPQA 2HWGA 2BASA 2YX0A 4BZYA 3T4WA 3BAKA 7A3HA 4XZMX 2OGJA 2HS6A 1A49A 3W3OA 2ATSA 1MNSA 3TQVA 5BXRA 4KQNA 2J6VA 3GNNA 3GU2A 3NL5A 1O68A 4O1BA 1PWMA 5ECUA 1V3JA 3DGBA 3BOXA 1UKQA 3DFTA 4FNSA 2HPMA 1EB3A 1NIUA 3VABA 3R10A 4Z2JA 2Y1HA 1UD5A 3W28A 2XGZA 1XH1A 1AA1B 3VDBA 1HIZA 4NILA 3NZPA 1XDLA 4JTRA 4DM1A 2FB3A 3ZWTA 1MFUA 2QCLA 4FNTA 4KWSA 5E9XA 1V0NA 2J66A 2FPTA 4RE2A 1XM3A 4MUPA 2ZX8A 4ERIA 3A4XA 1QNQA 2QJGA 1PX4A 3VD5A 3RAOA 3ARXA 3WKZA 3WF3A 3KWXA 3OA3A 4HN4A 2OO6A 5EFFA 5DF0A 3ZLHA 4H3DA 3OHMB 1EHNA 2TPSA 4PZVA 4WY0F 1W9BM 3C0LA 3A12A 4RDYA 4MG4A 4JOMA 1JDDA 3CYJA 4ZL1A 1GG1A 3VIKA 1TWWA 4M6PA 2ACQA 3H26A 4B90A 4RE4A 4K8GA 3A47A 5GNZA 3MJYA 4WSHA 4RE0A 4UMBA 5C0QA 3GVRA 4Z2LA 4XV0A 4QHRA 1E71M 4E2BA 3PR2A 2PGWA 1OCQA 5MF5A 2L5HA 4WSKA 4M1BA 1IYXA 1OHLA 1Q2RA 1PPIA 4PBFA 3W7MA 3ANYA 3CGTA 1BVWA 1DXEA 1BHGA 4GXPA 3LBOA 1YEYA 1GQNA 2YCLB 3IIZA 1NF0A 4DUVA 2BVTA 3BOLA 2IKJA 1MYRA 1Q4NX 2W91A 4ZB2A 2XVLA 1M6JA 1WBHA 1EYEA 3MQTA 5G2HA 1XGZA 4IMGA 2NVAA 2XSAA 4FX8A 4IPPA 4PMQA 2DT3A 2RDXA 1I45A 4PUUA 2ONEA 3KEHA 4C6FA 4XKYB 1J2BA 3G8RA 2OWXA 4ALDA 3EWZA 2ZUUA 3WDPP 4WJ8A 3VI2A 4DM2A 1SR9A 3U4AA 3WDIA 2ZFAA 2Z00A 3S5YA 1QPOA 1UR0A 4TXEA 9CGTA 1LRQA 4X2PA 3GTNA 4H19A 5CBBA 3GVQA 3STPA 4RX0A 4C6JA 1EZ2A 5HWJA 1X7FA 3H7VA 3KCOA 2V82A 3UD6A 2P76A 3NPVA 1FXQA 1LUCB 4PRWA 3BZGA 3P67A 4PMNA 2ZYFA 3STEA 4XVDA 1S2CA 3KRBA 1HJSA 4XO6A 2AMXA 2EJ1A 4AUBA 3WJSA 3MBDA 4F40A 4JEQA 3S2MA 3T2OA 3WK0A 5D32A 3SGGA 4LV4A 4H8NA 4F2UA 3GRIA 1EF2A 3AICA 4KBXA 5DXXA 3NDZA 2Y0FA 1XS2A 4HGXA 3F4CA 3BSMA 5D4YA 1B9ZA 2JEPA 1Y8BA 3G5EA 1QI4A 3WDJA 3L4YA 2FMOA 2XVNA 1U33A 2WC3A 4RV8A 1RD5A 2G3MA 1GZ1A 4DUWA 6ALDA 2INZA 4TX8A 4AD0A 2I5QA 3T08A 3IACA 4IX0A 2YBVA 2XIQA 3ONCA 4Q8OA 3C61A 4H01A 2AL2B 8XIAA 2WHMA 3NO3A 4KCVA 1S2VA 4H1ZA 1AJ0A 1PZ0A 1UB3A 3O06A 3PFRA 3W23A 4MDOA 2EPLX 1V3LA 2E77A 4LB4A 2OZTA 2FPYA 2WNNA 3UXAA 4UQEA 3C8NA 1GVSA 5I5RA 3I6RA 3OVPA 3GZ3A 4GNVA 1IXOA 3OYZA 2J7BA 4AG0A 4YHEA 3WG6A 2DQWA 1F8IA 5A69A 5FJUA 4ACYA 1QHPA 5LNUA 2V5DA 4QQUA 3GNPA 2HBVA 4FOUA 1G4SA 2I56A 1HVQA 4ML4A 3NGFA 3M5XA 3N73A 3QR3A 1P0KA 2J25A 3RHGA 4I3GA 3GX9A 1QO2A 1B2YA 5U4NA 4NAEA 5T9CE 4XAZA 3LCIA 2P3EA 4R3UA 4XD3A 4C1LA 3HN3A 3WCZA 1FP8A 1WXZA 1U22A 5KITA 3SGZA 4GI9A 4Y9AA 4QAIA 3H12A 1Q63A 2DSVA 1P0BA 1C9DA 3EWUA 3RR4A 3SY5A 3TVAA 1HNYA 2BFGA 2XFRA 3HMCA 4JQAA 2DVTA 1ECEA 3VKDA 1GUVA 3VNLA 5HQEA 1RD6A 3SIMA 1WAUA 4PGLA 1KXHA 1XLFA 1GKRA 3TN3A 4AISA 3DG7A 2YZ5A 3VNZA 1TTIA 3N4FA 4IZGA 1OFRA 1BSIA 2GDQA 2O92A 4B9YA 1K9EA 2OQHA 1OF6A 5HPCA 4IFKA 3UGRA 1AMKA 5IBXA 5A6JA 2QCMA 5I3GA 1IF2A 2VHLA 1W1VA 3FN9A 2JKAA 3CV7A 4L9ZA 5FAJA 1EWDA 5FEPA 1VFHA 3EDEA 4BR1A 4ACZB 5HK4A 3WJWA 1DV7A 4JIHA 3H2OA 1K9TA 1NWUA 3KP1A 4NU7A 2QCDB 1O1HA 4WGXA 4IMAA 3GYEA 4PUKA 1SFSA 3LHVA 3KCLA 3F4WA 5FL0A 2HK0A 1KQZA 8CGTA 4HOZA 4FX6M 3AMLA 4R85A 4RLIA 5C55A 3CL7A 4EF8A 4MPKA 2DEPA 2PAJA 4GVIA 1ZJBA 4HCHA 1BF2A 1OFEA 4O0KA 2WVVA 2XINA 4HNTA 4BJHA 5EBAA 3TTSA 2DSKA 3V75A 1E0UA 3V7PA 2ABBA 4NZFA 2ZOXA 1SO3A 1T41A 4D1JA 1B3OA 4AD3A 3BZJA 3AUJA 3HV9A 4S38A 3T55A 2VMFA 1RALA 3CEPA 3ABQA 3QSTA 4G6CA 4NAFA 2X30A 4A21A 4DRSA 4N0RA 4JFUA 4MKVA 5GPRA 2V3FA 3GAYA 4GVHA 1ODUA 1C93A 2IPWA 4A05A 4JQ3A 1R3YA 4N2YA 1FWDC 1R85A 5CZSA 5JIPA 3WLPA 1S2TA 5FF3A 2WO5A 1EJVC 2Z24A 3NVDA 4CLMA 1Q6RA 4UTHA 4HP5A 3WLIA 4H7ZA 1WKEA 1NF7A 3STCA 1BG4A 4U28A 4K36A 3W1AA 1ZCCA 1CXKA 3L66A 1HZYA 1UWTA 2VWTA 4JAWA 3BO9A 1UH2A 1OD0A 3W6LA 3MUXA 2UWFA 5G1YA 5AHMA 3UWWA 3APGA 2OU4A 1RBAA 3S3GA 3Q94A 4W93A 3CH9A 2UY2A 4DXXA 2O0TA 3T9PA 2QDEA 1WX0A 3A13A 4UTIA 1B3WA 2GQ8A 3K8MA 1WB0A 2ZX7A 3I3EA 1EGMA 2ANUA 3UQNA 4ZEPA 1YPXA 1VZWA 5BOFA 3TP4A 1B3ZA 1BLIA 1JFXA 1NFBA 1H7WA 3ITTA 4NZ1A 4DYEA 2OB3A 3M46A 4JTUA 3ZMRA 4JL1A 5CAHA 4JEJA 3BE7A 3SN0A 3M0IA 2AKMA 2PDHA 2UY3A 1HJXA 2QPUA 3WJZA 3NO1A 2XIOA 3UXDA 3PB0A 4HK5A 4DZ5A 2J7GA 4XZLX 4W7VA 2XIIA 2BSLA 3HF3A 3BLDA 4AMAA 4UR9A 2D22A 3B8DA 2HV5A 5KZMA 4H8HA 1YYAA 2VKZG 4WF7A 2QGYA 3M6DA 3CQ0A 3GNRA 1UUQA 1KKRA 1OC5A 3WUFA 4AF0A 2UV8G 4UOQA 1W1PA 1ZBKA 2WVUA 5FJRA 4JNYA 2P10A 3LA4A 3OZPA 1GOWA 3VDHA 4GLEA 3R25A 1DJWA 4NKCA 1M7OA 3CPRA 5DCEA 3IJ6A 3ARUA 2PE4A 4TVDA 2OZ0A 1UBSA 1XRSA 3RMEA 3HPXA 4Q8QA 2B81A 3TN6A 3GVWA 3ORWA 4CEXC 1KLYA 4LXFA 1JPIA 1KBIA 1PXGA 1V08A 2GGJA 4RNFA 4GA8A 2OODA 4LEFA 1UKOA 3IS4A 1JUKA 3L5LA 5HAOA 2WV8A 1XKYA 3BAWA 5LHFA 4Q4RA 2E4TA 3W7CA 1A5NC 4DWSC 1UD4A 3L67A 4ADUA 3LB0A 1W3LA 1SU5A 4B15A 3MO4A 1LWIA 4NG3A 2WMKA 3R2GA 1OZMA 3EA2A 1TB3A 2CZDA 1MRAA 2XN1A 1LLOA 4ADSA 3PC0A 4UNIA 1H60A 5D2VA 4FXRA 1A5LC 2OZ8A 3MUIA 3RF9A 2WMHA 3QY6A 4GABA 1AH4A 4JX6A 2Z26A 2GVLA 1BYCA 9RUBA 4B16A 4U2ZA 2QJHA 4RNHA 1DTNA 2CPUA 3CZEA 3EB4A 3P81A 4WD0A 4KCUA 3LM3A 3DFSA 4PL2A 4HYRA 1KWKA 2H8XA 2X0HA 3TDFA 1W3NA 1GGOA 4GGHA 5I07A 5LGZA 2D2HA 1IE7C 1Y5WA 1US2A 4J3WA 2PRHA 1V7AA 4GH3A 1TV3A 4UQBA 3A4JA 3HPAA 1OX4A 4F9JA 4JIRA 5LIUX 3W7GA 4U10A 3GB6A 4PMVA 1PE1A 4ICCX 5C9XA 4JY8A 2HCVA 3AYRA 1C7SA 2E25A 1KCLA 5DRIA 3TONA 4JTTA 2B4GA 3CUIA 1FTXA 3LI1A 4O50A 5CJNA 2AGKA 3G24A 4KIEA 4L4LA 1E6RA 2Q71A 5J8LA 4OVXA 2OZ3A 3D46A 1XPGA 3PJXA 4QG9A 3NVTA 2ACSA 3TJ4A 5H8PA 4A22A 4EX4A 2QEZA 2DORA 3MSDA 4QROA 1FVPA 3C2EA 4OOUA 3APYA 4CCEA 1AQ0A 5CPLA 1AL8A 2NQZA 4E3TA 4AZ7A 3VCCA 4IH3A 1FHLA 2GOUA 2FH8A 2GJPA 5FI8A 4J2PA 1PTGA 1E1FA 4RZ6A 3RLGA 1J4EA 4RZBA 3EWXA 3R89A 4C6NA 2WZMA 3AISA 4CU8A 4QIUA 2D0FA 3HZ3A 2Y7GA 1RCXB 1W31A 4CD6A 2OYKA 3KBVA 1ICSA 3PZIA 4LYKA 2VO5A 5BYWA 3CC1A 4I5RA 2FHFA 2PTWA 3CASA 3L4WA 1EEPA 3TJIA 4ONVA 4KWUA 5XIMA 3UU0A 3CH0A 1F05A 1EPXA 1W54A 1YMYA 2OT0A 2A5HA 1GK8A 2DUAA 4XZHA 5I02A 1ZS2A 1BXNA 3AC0A 4GBDA 4GHRA 1M5WA 1QI5A 3RCNA 3W07A 3GY1A 3HFYA 3IUHA 5AHNA 1JCNA 3IV3A 1JAEA 1FDZA 4IJCA 5A8GA 1PHQA 1EF3A 1TVLA 3NZQA 2WSKA 1BQGA 4RV3A 4LC8A 5LNSA 1E9LA 1KBLA 1GZJA 5BMWA 1VBUA 3WQ6A 4CU6A 3KLKA 4QGCA 3SRHA 2I1OA 3T2QA 4NAEB 3NFUA 1MQQA 5FCZA 3B4UA 3B8IA 3ITCA 4P8VA 4Q8WA 1DORA 1T5AA 4W87A 1AVAA 2C79A 4YTRA 1LTDA 2WCGA 2XYLA 1LT7A 2PCEA 1RK5A 1XICA 2IQDA 4Z2HA 1HTIA 1N55A 4ZOAA 3GHTA 7ENLA 4RUBA 3CV6A 1X98A 2CYGA 1V02E 2VEMA 1VJSA 3UYIA 1C9WA 4NJIA 3MSYA 3UG5A 4MKNA 1YXDA 5LHEA 1J10A 1C91A 5BXPA 3K8KA 3L4ZA 3NM3A 3HBLA 3VZYA 2GSEA 4CGTA 1JPMA 3NZ1A 2VX4A 1M7PA 2PDFA 1X1ZA 4BQ4A 2VDGA 3JUGA 1MVYA 1EP3A 3C8FA 3J7HA 7REQA 1SUXA 1QOQA 1YXCA 3MYPA 1W5MA 1V3HA 4H9XA 1XLDA 3CQJA 2FGLA 5CPOA 2B7QA 5K9XA 1ISXA 4ERAA 1TPUA 1IIHA 5PTDA 4ROQA 3R6IA 3PUEA 3CU2A 3VNJA 2PDQA 2F2HA 2VEIA 4DJDC 2EPMX 2D20A 1I4NA 5AVHA 4C1NA 3N25A 3KFTA 4B3LA 1K03A 3R13A 1JDAA 3MVIA 3H23A 1RA0A 1AW5A 3GD6A 2DUXA 5HJYA 3A5FA 4HMNA 3VUPA 2WK2A 2PTZA 2ALDA 3R0UA 4MMWA 4FNUA 3BQ5A 2CLLA 4QEHA 3LBMA 1ODZA 2BWGA 3PPCA 4OZOA 3NSNA 4N9EA 4AD4A 1UR1A 3NL2A 2YL9A 1XPYA 2HSAA 4H00A 5TQLA 3TFXA 5CBIA 2WM0A 1EPVA 4E4PA 4EVZA 3W2JA 4NAFB 1P0NA 1V3IA 1ICPA 1KFKA 1TG7A 1NDVA 2X8RA 3B9EA 5JXQA 1DIOA 1ZP3A 4JDYA 1E55A 4C91A 5IOBA 5FJIA 2BVWA 3VM7A 3W1XA 4GXMA 4GUHA 4PE8A 2IXUA 4H9TA 4JKLA 4ZENA 1EDQA 3H2EA 5A8NA 5LNRA 5G1MA 4ZGYA 4MY9A 3WK1A 5ABTA 1FQ0A 1ML1A 4MDPA 1LWJA 1HP4A 4FNQA 4W5UA 4X2RA 1Q45A 2EG8A 3CNYA 3RG6A 3KLLA 3K5XA 3SGUA 3UCQA 1AH3A 2EBNA 3M41A 4J35A 4LS0A 4HBKA 5A6TC 1W32A 3O16A 3EMQA 2C7FA 1SR0A 3MI3A 3KRUA 4F2BA 4OECA 3RMJA 5F2IA 1HO1A 5CSRA 2R82A 4IMCA 2QIIA 3B3DA 4DJEA 5K9DA 3RM4A 3A4WA 3TYCA 3DG3A 3W73A 2ZXQA 1W8GA 1ZPTA 3C2VA 2XVGA 1MEHA 5CCZA 1TQJA 2ZTKA 1A0DA 2OXNA 1ISVA 4QLLA 2WJDA 1QO5A 1W6TA 3CPUA 4G9PA 1K4GA 1BWKA 2IUZA 3A6OA 3AOFA 2I17A 3L21A 4HYWA 1EBHA 8RUCA 1W9UA 4CNOA 4DEFA 4PRTA 4C1KA 3F4DA 4GKLA 2XVPA 5A8MA 3QHOA 4JBRA 3WMLA 3MC5A 5C8BB 1QBBA 3UJFA 1O5XA 3GU9A 4X61A 3L12A 4YJ5A 1QOXA 1I1WA 1TWIA 3IJDA 4TU1A 3Q67A 1GG0A 1VEOA 3M0LA 4XD5A 1K9FA 2TODA 2QDDA 4PYSA 3H24A 4JTFA 5G4WA 3AYSA 1ZFJA 3JZEA 3IAPA 4A4AA 4MNMA 3EA1A 1S5NA 2O9PA 1UIOA 3WD2A 1CXLA 1YIXA 4TO8A 3G8EA 4AF0B 1KXTA 1SW0A 3RPDA 2F6KA 3K46A 1RHCA 5L9FA 3DFOA 1Z89A 1XLJA 5JUVA 2VYOA 4KCTA 4YIWA 5A94A 1JZ8A 5EBUA 2NT0A 5AHFA 2WLZA 1GKQA 3EWYA 1LP6A 1J18A 1QBAA 2CXEA 2FHCA 3QQ1A 1LORA 2R24A 3SFWA 2D0GA 1MDLA 3PB2A 3CWHA 2CLHA 3UCCA 4ECLA 1VBHA 3KVJA 4UTJA 4OOZA 1WXYA 3E02A 2FJUB 2EPNA 3KCJA 4S3CA 4OFCA 1I0DA 4CQAA 1H7PA 4DPPA 1JZ6A 3B8SA 1J5SA 4LUTB 2ZWZA 1UA7A 3FW6A 2ZRZA 3ANUA 1XXXA 1SQ7A 1BGAA 4UQDA 1XGDA 3EX4A 3MYOA 1I75A 4HPGA 4I7WA 1PJ9A 2D3NA 2AL1A 3WLQA 2J9XA 2QJNA 3HJZA 3N3MA 4IMFA 4IF2A 1QRQA 5AOUA 2X0YA 3THCA 2GUUA 4CN1A 3KM8A 1RA5A 5D9OA 4GCXA 1OC6A 1W3TA 3P6LA 4DXKA 3MUAA 2XZ7A 1VJZA 1ISWA 3MT1A 1E56A 4ZODA 1G69A 4C6QA 3ES8A 4HIBA 5JBFA 3GHSA 1MW3A 3XINA 4D6FA 3K4DA 4RNJA 1O4UA 3TA9A 4MLJA 4Z1AA 4WDUA 1FCBA 3N4AA 3VD4A 4GZIA 3IGSA 4LS1A 4Q4KA 4IPIA 4OQVA 4HPJA 4FALA 3E3HA 3KS6A 2QGHA 2Z28A 4TTUA 3N6JA 3M64A 4KW2A 4TR9A 4XTDA 4HPXA 1PIIA 1XLHA 2AQWA 1OM0A 4LVDA 4PULA 4M82A 3VZZA 3EA3A 2FB2A 1CXHA 2OLHA 1R3TA 3QV7A 5FF4A 3BLFA 3NWRA 5JIWA 4C6PA 4UQCA 1TR1A 1CEOA 4GIEA 3QC3A 1TWSA 3QPYA 3S2JA 4FLRA 1E6XM 1YNQA 2Z27A 1PCKA 4PRRA 5AFDA 2GGIA 1A5AA 2GUYA 3WLKX 2GSJA 4ZQRA 3QR0A 1XYCA 1K6AA 1RY0A 4LUJA 2CZEA 1UP2A 3KL0A 3NZRA 2CWXA 2Y5JA 1HL9A 1A3WA 2IXVA 3BJSA 2QJJA 1P6WA 4AH7A 2OO0A 1YPFA 2Z1KA 3B0YA 5M1TA 2E5DA 4PCSA 5MHBA 3PJWA 1E51A 3I4KA 3C4UA 1Q85A 3MSRA 3W7NA 3A5VA 2Y8VA 3FJ4A 4CNTA 5DMNA 4HU8A 2P8CA 2EPOA 3OP2A 1GYNA 3EWBX 3SUWA 2W5FA 1SM9A 1PAMA 1OVDA 4ZO8A 2Z1WA 3L4UA 4DJFA 1W5OA 4R53A 1JXKA 4OTKA 7XIMA 3MY9A 4FI4A 3I6EA 3CZLA 2PF8A 4FS9A 4B4HA 1RQHA 3C86A 3E0LA 1MXDA 2EQDA 2GJXA 4LT9A 1F73A 4L4PA 1SZEA 3PBYA 3KDNA 2B31A 1ME8A 2G3IA 2E09A 4X0VA 1QPNA 3M5YA 4UFLA 2ZBTA 2YXXA 3WQVA 3FYYA 1EO7A 1CB7B 1UYQA 4QG6A 1VPXA 3TSDA 2OCZA 3PZUA 1QASA 1XIJA 3DFNA 4NIRA 3S0CA 3A21A 4GJ1A 4ZSTA 4FNPA 4BHYA 3WBXA 3N6HA 3ENLA 4D71A 4MZ1A 1GOQA 2PWUA 1LM1A 1Q65A 4G56A 3UY7A 3W75A 2PU0A 3EOOA 3N13A 3OG2A 3CHFA 3P0XA 3WN6A 2DVUA 4HA3A 3WJXA 1EXBA 1LLZA 3CMFA 1B90A 4QEEA 1QW8A 4FIQA 3A3XA 1R9ZA 3N17A 3WEZA 1V03A 3E0IA 1R9YA 2DW6A 3VGEA 4HB7A 4KFPA 4O1CA 3W01A 3V3WA 3AHZA 3GR8A 3LMZA 2B7OA 2QVNA 2WVSA 1F61A 4NI8A 3N2OA 2CLMA 2DT2A 1EX1A 3CQHA 1OK6A 4PMUA 4E2DA 1TA3A 1Q7MA 5FJOA 4QTGA 3QHMA 4R7WA 3GG0A 1TTPA 3FHAA 1SFJA 1RXOB 1RP9A 2Z1VA 1E6ZA 3I7SA 3QPEA 5LKYA 3DC8A 4YVPA 5GJNA 5CBJA 3ITOA 3NL3A 4XZ9A 3AZSA 3V1PA 1UA3A 3VD9A 1E1EA 3ITXA 4J5NA 4R5EA 4XZBA 1VFSA 3KBJA 4UC5A 3S83A 2XIJA 1OT1A 1FWWA 2VP8A 4CN6A 3NSXA 1W3IA 2POZA 4JKMA 2VQTA 4L1WA 4XTIA 4QFUA 3OTRA 3HPZA 2PEVA 4E8GA 4LGXA 2NUXA 1WNOA 4OV4A 2OKTA 3FCPA 2C91A 5I24A 1ITUA 2IPJA 2POTA 3P14A 3N15A 3OIXA 2ZXDA 4O1EA 4BK9A 3PWIA 1ZNNA 4V27A 3W7QA 3BDKA 3PPGA 1SW7A 2ZA1A 3N2TA 3T78A 2C1IA 3VNDA 2QJIA 3S5NA 5DO8A 3PZQA 2VC5A 2BS9A 4US5A 3AWNA 1VAHA 2VD9A 3P2VA 1IT7A 1IQ8A 1QAPA 1W1IE 1EGZA 3Q2DA 3OZMA 4N6EA 4H9MA 4RJEA 1NU5A 2DIEA 4HSHA 5JU6A 1ITQA 4B3KA 1EUAA 2VR5A 2D73A 2QULA 4OE7A 3W00A 1BD0A 3O9NA 4IIEA 1GVEA 5E70A 3BTNA 3G0UA 3UZJA 1XJBA 3S9IA 1EKOA 2WB5A 4JCMA 3NO5A 3KTXA 1DBTA 3OVGA 3V5CA 4LYQA 3UWUA 4IL2A 4K3ZA 3RRXA 4S2CA 1AH0A 4JQ2A 3O6CA 4C6IA 1PKYA 1AUSL 2R1NA 3GQYA 3KW3A 4J3XA 3HIJA 4MIMA 3W87A 4E2OA 4XD4A 1RSCA 2OEMA 5CC6A 1IZCA 5L6UA 1V51A 3WLHA 5BRBA 2Y85A 5DMLA 2J8TA 3NOEA 1Q8AA 3LPPA 1Z3NA 2Y24A 3WQGA 3WY1A 1MSSA 3E6EA 3W37A 3LRMA 2GZXA 1VFTA 2J7CA 4UFIA 2Z4GA 4F0HA 1DQXA 3F7JA 2YGYA 4QCEA 1KM2A 1C8YA 3NPXA 2A2IA 3B40A 3CQKA 1SGJA 4QJ5B 3C5QA 4ZQOA 1AQHA 4RK8A 4LAUA 2HISA 3ZJ7A 3G1VA 3OGSA 5FF2A 3FKKA 2QCCA 4IGHA 1EIXA 2GYIA 2W92A 1UZ4A 4GRSA 3Q65A 5EGRA 3LCLA 1FRBA 2ZE0A 3TQ0A 5FKYA 1J2WA 1XD0A 2R94A 3IGHX 2XIBA 4LTSA 1V93A 1H61A 3RLVA 3CHCA 3E12A 1ZLPA 1H63A 4AY8A 4M1RA 2VRKA 1A80A 2X2GA 4F9DA 1VCFA 3W7DA 4RKAA 4Y9PA 4X22A 3W83A 1EO5A 1G4EA 3DKLA 1QNPA 4O1FA 3CT2A 1VJIA 3SUTA 2YDSA 4EF9A 3W26A 1WUFA 1I9CB 2Q8LA 3FV9A 4H9UA 5A2AA 4XQ6A 2BXZA 2GVYA 1HW6A 5F1UA 4JHMA 2OEJA 1I2RA 3QF0A 1CLKA 3DU0A 4GX9A 4NJJA 4U4MA 3EXSA 4Q32A 1AQMA 1ZBVA 1GVFA 4LSBA 2DIJA 2J4GA 3BARA 3DYPA 2BXVA 4Z1YA 1O66A 5E5CA 1THFD 2RJGA 3RJYA 3U0HA 3T0AA 4YMZA 2ISVA 1XBXA 1KRBC 2UBPC 4MADA 3TYUA 4F0KA 5LIWX 1JR1A 1XIHA 3M47A 2ALRA 5CG7A 4AWUA 3GLCA 3CIXA 1X8FA 2WPGA 2JF6A 4PTNA 2VFGA 4JDBA 1TKKA 3W84A 5A8QA 3PULA 3UWVA 4HHHA 2WOQA 4LY8A 1CWYA 2JK2A 3UR8A 4OIFA 3TOPA 1G7UA 4JCLA 3T7VA 4YCPA 3KWSA 1XD1A 2OPJA 3AXIA 4B5TA 3AZRA 2C1GA 1XLAA 4R9XA 4B5UA 4GI4A 1EFZA 3B4YA 4LYRA 4M7TA 1Q7ZA 3JZUA 3TTEA 1R0MA 3FA3A 3M7WA 2F6XA 4Y9OA 1EP1A 3TV8A 3DERA 1PO9A 4MZYA 4O8RA 4C7DA 2EEXA 2P5NA 2WJEA 4ZO6A 5A6SA 1SZNA 3BWWA 3IIPA 2PP3A 3CUGA 3S1WA 2VNCA 3HV8A 2G0WA 2H3DA 3PPFA 5XINA 2PWGA 5FA5A 2ZX9A 1TCDA 2E6FA 5I6SA 1Q8JA 2NW0A 2GUBA 4JHOA 4H41A 5FJJA 3ZSSA 4HVXA 1KTCA 3SFKA 3VILA 4IHCA 4Q8TA 1UH4A 1WDQA 4X60A 5BOOA 1LCOA 2QCGA 4JN8A 2XFFA 3QKEA 3LSBA 3U5UA 3NPUA 1FCUA 2E1DA 1VFLA 3UXKA 1AODA 3VE9A 4ERGA 3W7OA 3S5SA 1A4MA 2D2OA 4R33A 2QQ6A 2CU0A 3CK5A 3QV8A 2FDSA 3E2RA 2QHAA 3LLFA 1XG3A 1TSIA 1GYLA 3HOJA 5I78A 3E5PA 1KBJA 4L80A 4ZO7A 1M41A 4EAYA 4XZIA 4Q7BA 1EJUC 4YU1A 4O4WA 1U5VA 4WIWA 3W25A 5C5YA 1JRBA 5GJPA 3LLXA 4OBSA 1BGGA 3BCJA 1T0OA 1ZQ5A 4Q8MA 4DN1A 4DJED 1S3TC 3O8AA 3QFWA 5IFPA 4J9JA 5EMJA 4MOZA 1KM5A 3HA1A 4WDWA 1PYFA 4IP7A 3M0XA 4L4MA 1QXLA 2HBXA 4LFYA 1GHSA 1U1HA 4CQBA 2EO7A 2HDJA 3LXBA 1S46A 3G1XA 3W82A 3ZSTA 2WNZA 4TVCA 3HGJA 1IZKA 2PPGA 3FS2A 4P61A 2C13A 2X05A 1LWHA 4LNCA 2AOSA 1QI2A 2W67A 2WMJA 2Y7EA 3QJAA 1HT6A 4QX4A 3ZXWA 3PSVA 2PA6A 4EE9A 1K7XA 4QLKA 3W86A 3W1QA 4UTTA 1XIBA 2ZUVA 3CHVA 4RE3A 4HMCA 3TNOA 4BCEA 5C71A 2DP3A 2J77A 4AD5A 1UWSA 2OLAA 1TUXA 4K7YA 4LWWA 1QW9A 1TO3A 3BW4A 4QISA 2GJLA 4ORMA 2QV4A 1U5HA 2VGBA 4EWJA 4PR4A 3MANA 2VUNA 1W2VA 1M65A 1H62A 3BG3A 4UFJA 4AIOA 2UZ9A 3HQ1A 1DQWA 5D05A 1K8ZA 1KBBA 2GJNA 4B3ZA 3GXNA 1CB2A 4MNLA 2C18A 2E67A 1XCFA 2RDWA 1XYFA 3U7VA 3LGDA 4PMRA 3GG7A 1JI2A 5FL1A 1V6YA 4DHGA 1XC4A 3R5EA 2ZC1A 3WNLA 2J8GA 2YDQA 1ZGDA 4RXGA 3QKZA 1KXVA 1EJRC 3W6MA 3D3AA 5FSDC 3WL1A 4W4QA 3WYZA 3AI0A 3H7RA 2R1LA 3UWYA 3LBCA 3VAVA 4N9DA 3IIOA 1MW1A 3RX4A 3SAZA 1TA3B 4EPBC 2WSRA 3G2GA 1QWKA 1XBVA 1O5RA 4M6VA 3LCHA 3AHXA 1A5UA 4XZWA 1PWLA 3L4VA 2RUSA 1QTWA 1ZB5A 4AX6A 2ZZ7A 5ABGA 1OEPA 1L6YA 4TX6A 1NJJA 3TYDA 3S6OA 3IIXA 1A5CA 1K02A 3VX1A 3NQ8A 2G97A 4GE8A 1XF0A 1TIMA 4CUCA 5I3DA 3RCYA 1NOFA 1RPXA 3KS5A 4ICMA 4H83A 1F3WA 2E6DA 4TMCA 5TAOA 3A9IA 2GGHA 4LC6A 4LCRA 4D6HA 3WQ8A 4N6FA 2ZRUA 1NSJA 1EYWA 2F6UA 4FOKA 4NNBA 2RJHA 1ADOA 4BF9A 1V0LA 3PBVA 3N9SA 4BWLA 1LROA 4MZ8A 4D6GA 3OPSA 3W2MA 3GTXA 3IJLA 3SECA 5CZTA 1JYNA 4Z1BA 2PBGA 2R8WA 2ZCGA 1R7OA 4PL1A 2X2YA 2YA2A 3TWBA 2ZTJA 2XH4A 3W2NA 3ARTA 2A6LA 3B04A 3VOFA 1PIFA 3UXIA 3RR1A 2R9RA 1QPKA 3C2OA 5EMUA 1A0EA 1HF6A 2Y62A 1AL7A 1F4HA 3GNOA 1BVNP 1V77A 2V5BA 1QCWA 4GINA 5FF7A 5HWNA 3H7UA 1SO6A 4U3AA 1OGSA 4DBEA 1XLKA 3MKKA 3CZJA 3RCMA 4MGGA 3WBWA 4XKYA 4GGBA 4FEZA 1Q6EA 3WD0A 1JCLA 1WE5A 6REQA 2WMGA 2ISSA 5DN1A 4HJFA 5HATA 4MWAC 2F61A 2PWVA 1OCBA 1RBOB 3WZ0E 3YPIA 3JU2A 1D7KA 1W37A 3QRHA 4O57A 5BOEA 3OLIA 3TA6A 3VMPA 2PGRA 1LUCA 1RJQA 3EEGA 1RZMA 2XH7A 1UD6A 3VIJA 3TW6A 3NQCA 4D8LA 4GOAA 1W1B1 3EDDA 4XBSA 4WUIA 4M80A 3WF2A 3LPFA 1VLIA 4Q3MA 4NHVA 4DJFD 3PAJA 1JYVA 2DSZA 2NQHA 5KETA 3VGHA 5ENLA 4B4FA 1V3KA 1H2JA 4N4PA 5HJLA 1UP3A 4EXAA 2PRMA 4OBTA 3LYEA 3IEBA 3SCQA 3W7RA 1DXIA 4Z1CA 3RGTA 1IR1A 3TK7A 4B5XA 2ZZ1A 3VMNA 3ARZA 2QLYA 2PSNA 3LCWA 5ECVA 5IBXC 3LHUA 3MMUA 5EMKA 3C56A 2INEA 5DANA 2CBUA 5DMMA 4Q8UA 2E7FA 1WZMA 3O7UA 4KGLA 5CH9A 5D9MA 4S3JA 4GQRA 3F5KA 2EGZA 1EUNA 2NLYA 2VX7A 4P7QA 2YYUA 3SDOA 2Y88A 5HMSA 2VFEA 4B5NA 5I3FA 3WNPA 2VGFA 4GJIA 2PF0A 3M0ZA 2ATMA 2Z7GA 1Z42A 2DZPA 4O4VA 1JL8A 3AXKA 2EG6A 3SBFA 1GCYA 3FHQA 4NYYA 3CIWA 1OZQA 2OEKA 2YZRA 2CBVA 5KSWA 4YVVA 2A7RA 1RVKA 1JZ4A 1E1CB 3EZ4A 1XIDA 3S9ZA 4A3HA 4NX5A 1UHVA 1E4NA 4GIYA 3WLLA 1ISYA 5CJMA 4EKJA 3E0FA 1RAKA 1TZZA 2WMFA 2WZIA 4KEZA 2E6YA 1PZ1A 3UPBA 1K8CA 3B8UA 1V8EA 3NM1A 5CLTA 5K2ZA 2PB1A 5HDRA 1JIBA 3ICJA 4AQLA 2D23A 1ZAHA 2PWEA 2VGIA 4HNVA 5CPMA 3M16A 3QH2A 5C2GA 1CYGA 2PGEA 3VIOA 3VKCA 1ZBCA 2VR4A 1BKSA 3WMSA 4KERA 3UYCA 1B5TA 3EX2A 3STGA 5JQ9A 3MB9A 3ZM8A 2H3BA 4QS6A 1E40A 3SCRA 4UTMA 1HO4A 2X0SA 1UZHA 2ISFA 4PCNA 5HMDA 3HU7A 4M56A 4XIMA 5BMXA 2HK1A 3QMSA 3AHVA 4HYVA 4C7GA 1EBGA 2CCRA 1ESWA 1E6SM 5EPDA 4BEUA 2C15A 4IISA 4XG1A 3QGKC 5BU9A 2GGGA 1S3HA 3TR2A 4WX2A 1ZHAA 3VOJA 1PS9A 5A1AA 2YJQA 1TYGA 1Q6OA 4QM1A 4PUNA 5C70A 3PZVA 3QXBA 5GNXA 4IG2A 4BF7A 2VC9A 4EOUA 4AEEA 4C6BA 2OSYA 5EU9A 4HTBA 4W89A 3T07A 4US5D 4ZQNA 3CM4A 3M0JA 2FVLA 1BKHA 1B4KA 4GQQA 2Q8XA 3LTSA 3N6QA 3QTGA 1JXJA 4TMBA 3OLDA 1G6CA 1XLBA 3AU6A 5HUOA 3E74A 3OA5A 2W79A 3MHGA 3WH6A 1S5MA 1K7FA 3M1ZA 4PTMA 3QZ6A 4FLQA 3H2CA 4PTDA 2CHNA 2JKPA 1R86A 2QCDA 2P0IA 3I68A 4JTLA 4HPHA 4AVNA 3W6YA 1NOWA 5BNKA 3LGEA 2QCNA 3GSMA 3N1AA 3WF0A 1U83A 1WYIA 3R58A 2XM1A 1HKWA 4W8BA 1J0JA 4X63A 5DCDA 4A8NA 4HZ8A 1BFNA 1JVNA 1AD4A 1I0BA 2PDXA 1JULA 3KX6A 2BY3A 3W38A 5C7HA 4O19A 3AUOA 4UTWA 5IDIA 3PF3A 3MU7A 3ZO9A 2VX6A 3RM9A 3UCDA 3BGGA 2FVKA 1QNVA 3WFZA 1DL3A 4PB3A 3NDYA 3S47A 3N9KA 3PS7A 2FVMA 4MY8A 4JYEA 3IGXA 1JDFA 3POHA 3AS1A 3P8IA 3REQB 1OFPA 4QDPA 4J27A 1F76A 4MPQA 3W72A 2XWDA 1CI1A 3TCEA 1OX5A 5TIMA 1QNSA 5CC7A 4M24A 1I2NA 1W5NA 1VP5A 4DY1A 2JKEA 3KVLA 4CEUC 5LXEA 1RR2A 5EMMA 1DKWA 3F5JA 4Y96A 5HUPA 3L9CA 4LS2A 3ZJKA 4CNSA 5I06A 1CGTA 2BGQA 2PWFA 4L6DA 3FX4A 4TVUA 5M03A 5ABHA 3F03K 4AEFA 5C2XA 4PB4A 3ZR4A 5LZLA 3FNDA 4CVUA 3HM7A 4GQBA 3SQSA 1XH2A 3CAQA 3SO7A 5D30A 2PWDA 4PBEA 2QVHA 1P4CA 2E8YA 3W71A 2WHLA 3S1UA 4IFRA 4L1XA 2BDQA 2DDXA 4CD7A 1E43A 3ZYZA 2CWNA 4HA1A 3R0KA 4MB4A 4HTYA 1RPKA 1Z69A 1F6YA 3MUZ1 3UWQA 3OJGA 5HULA 3FJ6A 4UFHA 3OLEA 3ZVHB 1E0WA 3W53A 1GVYA 4DB7A 3V36A 2YXGA 2FJKA 1M3UA 3EWDA 5CZ0A 2YFOA 1H0GA 1O60A 4R7OA 4AD1A 4CQ8A 4L61A 2ASHA 4HSNA 2PP0A 4HMDA 4LX4A 1IXQA 5AHIA 3ARPA 1TIWA 4XAYA 5T9BG 4AIUA 1A5MC 3LD5A 6A3HA 3NQ7A 1EQPA 4KWOA 5EMYA 1LDCA 3NSMA 5KINA 2V30A 2WCAA 3HTWA 4DBSA 1UZ1A 3OZOA 1QWGA 3BG5A 2GK1A 2V3GA 4O16A 2QF8A 3IJ7A 1MUWA 3M43A 4LUYA 3TZFA 3S2NA 2XJ7A 2DPEA 1FUYA 2WW5A 4GK8A 4I5UA 4LRTA 5E6ZA 1UKTA 2ON3A 1HG3A 5BXTA 5AECA 3QOMA 2W6RA 3A23A 3BAXA 4GD0A 4WOQA 2PDMA 2V5LA 4K6AA 4LOCA 1JCTA 3VKKA 4GG9A 3VOCA 1MEWA 2QUUA 3SCWA 4GUFA 3ZT7A 4MB3A 1KWGA 2GJRA 5F7UA 5H1WA 3TYZA 2XIMA 3OGVA 3SQMA 4MY1A 2REQB 3DHPA 1DOSA 1XFBA 1HN1A 2J79A 4P7OA 5CGQA 3C0SA 1TX2A 4ZSUA 1XI3A 4NZ5A 5FSEC 1JZ7A 1PDZA 1CGYA 3UZZA 2H90A 3DCPA 4AC1X 1SJBA 3MKCA 3HPFA 1UP0A 4A6GA 2E40A 4LUSB 1ME9A 3ITYA 5D2WA 3LNMA 3VD7A 3HURA 1X39A 1VFFA 4WY0A 1XH0A 3SRKA 3UVIA 1PKNA 1UPPA 3NQMA 5J5RA 2YCEA 3NXLA 4LYPA 1WBJA 4PMJA 2HVNA 4U3CA 2XPKA 1H7NA 1DJGA 4LY4A 3GDLA 1UWAA 4O18A 3FJLA 6XIMA 1LQ2A 4ZQCA 1UR9A 3WQCA 1O1ZA 2Y70A 4W9TA 4YTUA 3ABZA 1JCMP 4Y8EA 1E6QM 3UF9A 1EDGA 2UY4A 3T0CA 4US6A 1UZDA 1FDYA 4H6RA 2TMDA 4RXFA 2NVDA 4YS1A 6REQB 3OQEA 3VKBA 1XIFA 1E15A 2FFIA 3FDGA 2DW7A 4WJEA 4O8AA 2YL8A 1PIGA 4IGMA 4DNMA 5A2BA 2GDVA 3S4TA 4XAGA 5AC6A 3RYSA 4QE1A 1WXJA 2FTPA 1A5OC 4YWIA 2VZTA 5AC8A 4HU0A 3G3DA 1XC6A 3ARQA 4NXKA 5I3JA 3S5OA 4I7UA 1OC7A 1XRVA 4MB1A 2I57A 1X6NA 2HJPA 1YKWA 2X42A 3NR0A 3S46A 4JYFA 3R4IA 1LG2A 1PKLA 1EOKA 4P2VA 2GGEA 4DWDA 2YW3A 4FPSA 3IWPA 3EOEA 1BYDA 2NV1A 3OHIA 2CEQA 4CCDA 3MI6A 4I5XA 5CXPA 1B9BA 4A2RA 2PDNA 1N82A 3VNYA 4Q8VA 3M5ZA 1R46A 1W2PA 3B8VA 4J1OA 5G4EA 1C8VA 2PLJA 3S6TA 1O7AA 1W1ZA 4W84A 5EMLA 1P7TA 3W2KA 4JTSA 3EOUA 4IGSA 5T91A 3DESA 1EP2A 1MO0A 1DWGM 3E38A 4IIHA 3UW6A 1US0A 4AZHA 1LOSA 4UZUA 3EB2A 3D0CA 3SN1A 2PD9A 3IRSA 3USZA 3WH5A 1FCQA 1VEMA 4NZCA 1GTEA 3B0UX 4LVGA 4K39A 2IPGA 4GJJA 1VFUA 4AFYA 1M03A 3CAKA 1YE6A 3ITVA 1TR9A 3QZAA 4L64A 3KL3A 4WKHA 2ACUA 2J7EA 1CLXA 3P84A 2J75A 3DX5A 1YDVA 2YKKA 3KXQA 3WBYA 4N42A 2FZDA 1HKMA 2BOFX 1NFGA 2WM1A 3R11A 4UWMA 1GQJA 1KTNA 2JGYA 4DZIA 2HE8A 2PZ0A 3TSMA 2X1RA 3WQFA 4DQWA 1DQUA 3DOPA 5GQBA 3GXIA 3UR5A 3VFCA 2AKZA 2YDAA 3LUTA 3N34A 1YW1A 1UR3M 1YXYA 2QAFA 5CEWA 3ZR5A 3TU9A 2J7DA 1FA2A 1M01A 3W0KA 1B31A 3VE7A 4IMEA 8XIMA 1UROA 4GYKA 5EYWA 2GVEA 3H55A 2VRJA 3GIYA 1Q6LA 1POJA 4W88A 4ZOCA 1XUZA 1GOMA 2G3NA 2GLKA 4H8VA 3DH7A 4R34A 3RPMA 3CIVA 4PUMA 8TIMA 3P3BA 1V6XA 1H4PA 2Y8UA 1MNZA 3CL6A 2JFEX 4L5ZA 4U31A 3RIKA 1I2OA 3G1FA 1FWGC 4L6HA 3HGRA 4Z1DA 3MVTA 3VXGA 4REQA 4DELA 3AWOA 4XX6A 2ZUMA 2OMAA 5D9NA 4PMOA 4DJEC 2AGTA 3IVTA 3WQPA 3CHDA 5TBOA 1CXFA 4S3KA 1MZRA 4Y2WA 3TJLA 3URNA 2PC4A 2QPXA 1GKPA 4NF7A 1RCOB 4IG2B 1C8QA 4DWSB 1HJWA 2IQTA 5I7GA 4JIEA 3QC0A 1DIDA 3CHEA 1RY8A 1JEZA 3OU8A 3W1TA 4N9BA 3B9NA 1M7XA 3I65A 3BK0A 3FVMA 4UXDA 4TUFA 4Y7EA 2AQOA 2ABAA 2OSWA 3DN5A 4J28A 1C7TA 4DZAA 2DZAA 1SJDA 1MQPA 3TYEA 4HHMA 2OLSA 4V2XA 1FWFC 1MQRA 2RDTA 1O94A 1LYXA 4O11A 3P8JA 3N19B 3FYOA 1A47A 1KFWA 4QE4A 2VURA 1L0PA 1P0DA 1JJKA 2GQ9A 1MEIA 5FESA 4J7RA 4O52A 3VKJA 4HA4A 1OADA 4E5TA 5CG0A 4EPEC 4DAFA 1F7BA 4H7CA 4YPJA 4WXZA 3I10A 3PTKA 4ZVJA 4RCXA 1SW3A 4LAKA 4HQVA 4PMDA 1PCWA 5C7VA 2XTKA 4YYCA 3M9YA 3GIQA 1QU4A 2UY5A 5KEZA 3CO4A 2ZDSA 2BY2A 1X96A 3UWZA 3A22A 1JG9A 2W62A 3KAOA 3N11A 1UC5A 5DXYA 2E3ZA 1DHKA 5LA2A 3UA4A 3W76A 3W7HA 1EJWC 4F0RA 1WDRA 4HD5A 3IGUA 3LTPA 4ZB5A 3T40A 3VGBA 1WCGA 1X8CA 2VDHA 1NH6A 3RXZA 3L0KA 5LYRA 3CMGA 4B92A 2FZ9A 2VDIA 4PSPA 2VFDA 1O5KA 3VOIA 1N8WA 3CO8A 2ZX5A 3H2AA 3WLOA 4GX8A 5KMYA 4ORIA 4K38A 4PB5A 2RFGA 4GCAA 1CX9A 3FEMA 4HNOA 3IRDA 3PWAA 3S1GA 3NEVA 3WNKA 4JY9A 2EHHA 2O4MA 4Q7NA 3V16A 1TV5A 1GTHA 2BLEA 4MTVA 4H6EA 2DFAA 4O0ZA 3BJFA 1HGYA 4Q4MA 3MJMA 3BLLA 3B9AA 1RVGA 1TMHA 1OIFA 1XLEA 2DIKA 2Y89A 3T44A 3BVJA 3P5YA 1CDGA 3FK4A 3WQ4A 3HG4A 1B1YA 4FAMA 2PD5A 3DAQA 3N12A 5AC7A 3EPNA 3WLRA 1WKDA 3LV6A 3AS3A 5CPNA 5LIYX 3AYVA 1CCWB 3FEQA 3O0KA 1S2WA 4H8UA 5HINA 1UWRA 2P53A 1XBZA 1LG1A 1UJPA 1UR4A 1M9HA 1YX1A 3V0UA 3GHUA 3BL3A 1LOQA 2EKGA 3NQFA 3ZWSA 4N4QA 4JS3A 3WUGA 4M5PA 3H22A 5E0CA 3G1AA 4BI7A 5XIAA 5EL1A 2BP1A 3FDKA 2QCFA 1YPIA 5D9PA 4AC7C 2GK1B 4N7QA 1BF6A 3OZYA 3DECA 1K3UA 4DUXA 1CNVA 1BRLB 5C9WA 1AZ2A 2ZXBA 4OT7A 4RW3A 1PEZA 1PX3A 2VVSA 4OWGA 4ZOEA 3APTA 3PTMA 4NUWA 1UG6A 1T7LA 4IIDA 3AFBA 4L1GA 5EFDA 5IXEA 1XWYA 2XUCA 4W85A 3SY8A 4YXGA 5C54A 3MHUA 4DVOA 2ODOA 3VKAA 3UXLA 3QVQA 2NXIA 3FY1A 4L6OA 3DDMA 2GFTA 5D2XA 1OG6A 1R3SA 3ES7A 2VCAA 3I3DA 3UFYA 3G22A 1OIMA 3P62A 3GTHA 1V3MA 4DI9A 2JQXA 3QW4B 4H6KA 4DJFC 4O1DA 4LUTA 3COTA 2C16A 2VEKA 1RQEA 3PZMA 4L4OA 2Y5SA 3ZFHA 4WY0B 1V0MA 4HOXA 2Z7KA 2VGGA 1GWJA 1GT8A 1XV8A 1YBQB 1TVPA 4DF2A 1JZ5A 1K4HA 3PP7A 4IPLA 3U48A 2O56A 2ZWYA 2A3BA 4K8EA 1H3GA 4MUZA 1PYMA 3VIMA 1RK6A 3W2UA 4Y6GA 2OQYA 2WWDA 3G1HA 2QPSA 2GVGA 3RDKA 4LPCA 3C0JA 1ADSA 2JIEA 4Q4OA 1IHIA 1NEYA 2ZRYA 3ALGA 1LJYA 5MKGB 3CAWA 2J6XA 4AVOA 2I7GA 1M7JA 5I2UA 2G95A 1M53A 1XSIA 1TZ9A 1NTHA 2YLAA 2Q3OA 1F74A 5G5IA 4XO7A 3LGGA 5M17A 4NRRA 3KOWA 3VGDA 5DBTA 4GUIA 4ATWA 1RCQA 2VM8A 3NQDA 1TQXA 2EJAA 4JQ1A 1W9VA 4Z0JA 2VI0A 4JN7A 5HMEA 1TRDA 3QYSA 2OOFA 2YBTA 1SFTA 4ES4A 3CB3A 3N2BA 1BVZA 2X40A 5F4WA 4FZIA 2OQLA 4E8DA 3O6AA 1HKVA 1JRCA 3EOSA 2Z25A 4QITA