3SIMA

Crystallographic structure analysis of family 18 chitinase from crocus vernus
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
275
Chain Sequence
TLFVEYIGYPLFSGVKFSDVPINPHITKFQFVLSFAVDYTASSPHTSTNGKFNVFWDSSILGPDQISAIKSSHPNVRVAVSLGGASVGSNTVQFQAASVDSWVSNAVTSLTRIIQRYNLDGIDIDYEHFQNTDKNTFAECIGRLITTLKKNGVISFASISPFPSVDEYYLALFNEYKNAINHINYQFKAYDSSTSVDKFLGYYNNAASKYKGGNVLISFSTGPHPGGLPVDKGFFDAATSLKNKGKLHGIAVWTADTSKSSDFRYEEEAQAFLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein, Family 18 Chitinase
publication title Crystallographic structure analysis of family 18 Chitinase from Crocus vernus
rcsb
molecule tags Hydrolase
total genus 95
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3simA00
1GW1A 3CLWA 2EPMX 8A3HA 5A6BA 4Y7EA 4PCTA 3CUJA 1V6YA 4CCEA 3RJXA 4EANA 1JDCA 2DSZA 1DWJM 2XM2A 5AC5A 1E6QM 2ZUNA 1FH9A 3RMEA 1E56A 3NIYA 3WBEA 1E6XM 1X6NA 3M46A 1DHKA 3KL3A 1HJSA 4D6IA 1R7AA 4GO8A 3ARQA 4GKLA 5CGTA 4J3VA 1V02A 3ZT6A 3D5HA 2VI0A 4CGTA 2VCCA 5KZ6A 2XM1A 1C8QA 3WY1A 2OWXA 4KRTA 1JG9A 3NYDA 4OZOA 1XHGA 5FKYA 3T2QA 3ARTA 4MDPA 3N1AA 3ZM8A 5A8MA 5HNNA 3EDJA 1JL8A 2W67A 3WDPP 4UFKA 2BY2A 2GK1B 1E3ZA 1HN1A 1UKOA 4D6CA 1UR4A 3WUEA 4D71A 4P7RA 1Q6EA 4PMVA 4BS0A 5I0DA 4C7DA 1C92A 2DSVA 1HKMA 3N17A 1BYBA 3EDKA 4KRUA 1LWHA 2A3EA 4M8UA 2J4GA 1FP8A 3WH9A 3CZKA 1VJZA 1XSIA 5E0CA 1JYXA 1YHTA 1GHRA 3SCNA 1Y7VA 4XUYA 1AMYA 2ZXAA 1V3HA 2FHFA 1JYNA 3MMWA 3RM9A 2XTKA 2J7EA 4D1JA 4XV0A 3GH4A 1BAGA 4UOQA 3WH5A 3B8SA 1XH0A 2WWCA 1VRXA 1H0GA 4AD4A 2DPEA 2DH2A 2J8FA 2PC8A 3AIWA 4E4PA 4DUVA 4OIFA 1B31A 1MXGA 1TMQA 1BVZA 5I23A 4JHOA 2CCRA 3SUWA 2B31A 3OLEA 1NQ6A 3SCOA 2DH3A 1J0YA 2WC4A 3U5UA 4NRSA 5D8ZA 4N0RA 3AS1A 3CMGA 1KGUA 3BAYA 1D3CA 3VIFA 3AXXA 4JFUA 3WUGA 4W86A 5A2AA 1UR8A 1LF1A 3MV01 3BMWA 4F9JA 4GQRA 1M53A 4S3KA 3GM8A 4XZBA 2GJXB 1OIFA 1GZJA 2X0YA 2CYGA 1IV8A 3FNDA 3SUUA 1V3JA 3POHA 4UTFA 3GNOA 1C7TA 2BS9A 4WSKA 4AEEA 2YLLA 5IHRA 2VC9A 4HPHA 3GDBA 1PX8A 3CPUA 1EO7A 3PZ9A 1UKPA 2WBGA 3KEHA 4EAMA 3L2LA 1KWGA 3WDJA 3GTNA 4TOQA 3DHUA 3VILA 2WVTA 2YA1A 2W61A 4M82A 2E4TA 2WKLA 1CNVA 5IHSA 1VENA 3VD5A 1B3XA 1JXKA 4WKHA 3OA5A 3B9AA 3W6LA 4KH2A 3LPFA 1OINA 3ALFA 3I3BA 3W82A 4TUFA 3ZR6A 4CN4A 2XPKA 1UA3A 3AZRA 5BXTA 5HDRA 4FMVA 4MNMA 2TAAA 1EXPA 2PI6A 4PTXA 4UR9A 3WH7A 1GJWA 2EQDA 4FLSA 1PBGA 4OOZA 4AIEA 1EOMA 1KCLA 4PUEA 2JEQA 4P7NA 4AMCA 4V2XA 1HKKA 1TA3A 2WC7A 1JNDA 3K4AA 3VU2A 1WZMA 1SYTA 5BXRA 1B2YA 1MYRA 3AIBA 2D3NA 4HP5A 1LQ0A 2CHOA 1J11A 1CXLA 4UOZA 5A8NA 1NP2A 3ZOAA 3FHAA 1WE5A 1M04A 4LXFA 1HJXA 3VVGA 1B90A 2WMIA 4GPNA 4D6HA 4WKAA 5CZKA 2VO5A 3M6DA 2CITA 2ZXBA 1ISXA 3VGDA 3CTTA 6A3HA 4U3AA 1W1YA 1VEMA 3AMDA 3UR8A 2JF6A 3T0BA 1V3IA 3WD2A 3OIHA 3BH4A 2GSJA 4HZ7A 2DEPA 1DWAM 1MQRA 2VX7A 3RM4A 2XVGA 4RL3A 1HIZA 1KBBA 1CTNA 4WLCA 1R85A 2E0PA 5A6LA 5A6JA 3CH9A 1J0ZA 3FHQA 2HISA 2J79A 1EA9C 4H41A 4QLJA 3CHDA 3VD4A 5AY7A 1RP9A 1ZB5A 3VX0A 3GXDA 2CKSA 4AD2A 4A4AA 2J7DA 4CCCA 5CG0A 1G0CA 3AYSA 5CJ5A 1KR0A 4D6DA 5IXEA 4M29A 3VPLA 3AHTA 3CIVA 4FLRA 1C93A 1KXHA 5DF0A 1E1EA 2E9LA 2V3DA 4OUEA 1B3WA 2JEPA 3NDYA 1W91A 5A95A 4AWEA 4H04A 4WJXA 2WHKA 3SCWA 4PMUA 1UKQA 5JBDA 2OLHA 2YOCA 1OBAA 3WNLA 2QF8A 1J9YA 1GOQA 4AC1X 4U5KA 2O92A 4W5ZA 2F61A 1UWRA 1W32A 3UETA 1UH3A 4W8LA 1B3VA 2DT3A 2NSXA 3WDIA 4QLLA 2QPSA 2WHLA 2VL4A 2CXGA 3A4AA 1HP5A 2ZX8A 3L4UA 4RE2A 3WF2A 5C8BB 5AC4A 2V3GA 3L4VA 1V6WA 1UH2A 4CVUA 9CGTA 2G4FA 3GXIA 3WFZA 1HKJA 1N82A 2O9PA 4P7OA 3EMZA 5A94A 2OSYA 3OGRA 1OGBA 3LMYA 2ZUVA 5ABFB 1WCGA 2C7FA 2VZUA 1QI4A 3VMPA 3QOKA 3SCUA 2BHUA 4AISA 3JUGA 2NT0A 4W88A 1QW9A 2VVSA 3TP4A 4J7RA 1KXTA 2PWGA 5EBAA 5CGMA 1L8NA 2G3MA 5CPTA 1E0WA 5CLWA 1NOWA 1AQMA 1KXQA 4AD0A 4ACZB 3APGA 1E6PA 3I3DA 2W91A 2DT0A 4BZYA 1EDGA 2E8YA 4CD5A 3D3AA 1NWUA 2WKGA 4DWSA 4W7VA 3AISA 2A3HA 2E8ZA 3B9DA 4PRWA 1ZS2A 1C7SA 4GQQA 3WNKA 3HMCA 3WN6A 1CGXA 1H11A 3WUBA 1H1NA 4JCMA 4YHGA 2WVUA 1PIFA 1XYFA 3OBAA 3MSDA 4AZ7A 3VDCA 5JIPA 7CGTA 1UOKA 3WEOA 1LL4A 4TTGA 4UFLA 2F8QA 6TAAA 2EBNA 4YPJA 1U2YA 2ESCA 1ZBCA 3L4YA 3GNRA 3MMUA 5ABEA 1UD3A 3B9EA 3K8MA 1QBAA 4V27A 4W5UA 1DWGM 3SCPA 3T0DA 1JFXA 5GNXA 2YA2A 3PZNA 2VTFA 1BSIA 1CXEA 1E6ZA 2WSKA 3HU7A 1E6SM 3VDAA 4W85A 2CKRA 2JIWA 1OCQA 2G3JA 3GH5A 2EPLX 4BQ5A 3W4RA 1EQPA 2GJPA 2CPUA 3GBEA 4IM4A 3W37A 2ZXDA 1HXJA 2J25A 3EBVA 1GOKA 2EPNA 2VURA 2X05A 4B15A 3AQUA 1W1TA 4PEEA 4UFMA 1ISZA 4W8AA 3WUFA 1C90A 4JFWA 1HJQA 1JAKA 1FP9A 4HPGA 5A8PA 2VZOA 3AS2A 1P6WA 4M24A 3U7BA 1WDQA 3NJ3A 4P8VA 4UNIA 1ZJAA 3AHZA 4JIEA 4WK9A 4ZEPA 4AZ6A 3CBWA 3WF1A 3NUKA 1GPFA 1O6IA 3VIGA 1TR1A 2ZX5A 1KBKA 1CWYA 2GK1A 4PMDA 4W87A 3LPOA 3BSHA 3UERA 1Q6CA 1UKSA 1K9FA 3OLIA 1WDSA 3WNNA 2W5FA 6CGTA 2EXOA 3KE0A 4UQBA 4WF7A 1HP4A 3UG5A 1I1WA 3PZVA 4BF7A 2WYSA 1UD6A 2OWCA 2OYLA 1VF8A 1KFWA 4LYQA 3VOCA 1W1PA 5HPOA 5M03A 1BFNA 2WM0A 5A6SA 1PX4A 5JIWA 1ISWA 1W9PA 4Z2LA 2QMJA 4BA0A 2VNCA 2O9OA 4HMCA 3KL5A 1EHAA 4HU8A 1C3FA 2YLAA 3EMCA 2J7FA 3THDA 3AOFA 1UH4A 1LL6A 4HZ6A 1BHGA 1XC6A 3WSUA 1BTCA 4KMQA 1M01A 2JIEA 3K4DA 3T08A 4H8UA 1PX3A 1VEPA 3QGVA 3VIMA 1E4NA 2ZUMA 3N11A 2XVKA 3BXWA 2GUYA 4Z2KA 2X0HA 1G01A 4UFHA 4AZ5A 2EPKX 1QOXA 1XYZA 5BWFA 4WSJA 2J7GA 3QR3A 1GCYA 1RH9A 1W3LA 3LPGA 5E70A 5GNYA 4PTVA 1Z32X 2DSWA 4PMNA 1UR1A 1ZJBA 4MAVA 4MDOA 3MSGA 1H0IA 4CN6A 1FOBA 2FHBA 2PWDA 4J27A 3FY1A 1W9XA 1JDDA 1V6UA 2BHYA 3O2LA 3CZEA 1DTUA 3MUIA 2GJXA 3G6LA 3DECA 2D0GA 1W2VA 3LPPA 2V3EA 3MUY1 4MJ2A 3KZSA 3E1F1 2O9TA 1RP8A 4OBSA 3PHAA 1D7FA 2DIEA 1XGZA 5C70A 1OGSA 3ARUA 3KWXA 1V02E 4FLQA 3TONA 4AD5A 2WHJA 1NWSA 2DT1A 4AW7A 1AQ0A 1UD5A 4MB1A 2WVVB 1JD9A 2AAAA 4PTMA 1CECA 1ISVA 5CSYA 1OGGA 2UWFA 4JAWA 3CZ8A 2ZWYA 3BCFA 2CERA 4AZIA 2WAGA 1HVQA 1NWRA 5LA2A 5ABGA 1CGTA 3OGVA 3ZR5A 1B3ZA 1UQYA 3GXFA 2PWFA 5M3WA 1A47A 1UR0A 1E73M 3A47A 1BYAA 1V3MA 2GFTA 4LGXA 1I75A 1MQQA 3WQWA 2QHAA 2ZX7A 4ZE5A 1WDRA 2Y24A 3WQ5A 2V5DA 1U33A 4W7WA 4DWSD 4CCDA 1BYCA 2XHYA 3AHXA 4JL2A 3WDHA 1UUQA 1QHZA 2VZSA 3T0AA 1JAEA 2G3IA 3VDHA 4PMXA 4P7LA 2D23A 4U5IA 4UQ9A 3MMDA 1UD2A 1G94A 1ZBWA 3WELA 3DYPA 1ZL1A 5KEZA 1MW1A 1TFVA 1Q6FA 1E72M 1DWHM 4OBRA 2V3FA 3SCRA 1UR9A 3EDEA 2EJ1A 2VQTA 4QCFA 3OB8A 3QHMA 2WMJA 3F5LA 4BQ4A 1J12A 1E3XA 4LYRA 1W9BM 4URIA 1BQCA 1UA7A 3RDKA 1PZ2A 3ARPA 4DM1A 4D6JA 5M5DA 4AZGA 1R7OA 1GOOA 1M7XA 3MUAA 4XZWA 4LPCA 3SUTA 2OSXA 3WF3A 1TVNA 4C7FA 2J62A 3AICA 4FF5A 1HT6A 1B0IA 3WD1A 3N9KA 3VD7A 1JIBA 3PZMA 3A4XA 2WWDA 3OZPA 4J3XA 1V3KA 3RILA 4GIAA 1WZKA 3G6MA 1JFHA 1E1FA 2WZEA 2ZUWA 4PUDA 5JUVA 5A2BA 3L4XA 3WQVA 2W66A 4H8VA 2ZICA 3ZSSA 3THCA 4KGJA 1BVNP 5BXSA 1MVYA 3BCDA 5I2UA 1WP6A 5HOSA 1E55A 3VNZA 3TTYA 4B16A 2J8GA 1E40A 4AZCB 5A6AA 1SR0A 1UQZA 4BCEA 1MW0A 5HBFA 5EFDA 3VIJA 1UYQA 3WL0A 4HA1A 4CU6A 2XGBA 2ZWZA 3CHCA 1J01A 1BG9A 3I3EA 3W38A 2MANA 1JZ3A 4JZ5A 4W8BA 4V28A 2XVLA 5A6MA 1WO2A 2BNJA 2D1ZA 1JZ6A 3WFLA 3WQ8A 1V0NA 4UCFA 1NH6A 4FLOA 3W81A 2J7CA 3BLKA 1PPIA 1U30A 2UY3A 1SFSA 3FXYA 3VMNA 5ECUA 2A3CA 1HL8A 2YIHA 2X1IA 2A3BA 3EDDA 4IPLA 4UQCA 3M07A 3GH7A 4WKFA 3FAWA 4GI6A 4P8WA 4Z2IA 1E6RA 4MB4A 4UQDA 1JZ4A 1GHSA 2JFEX 4DM2A 3PZQA 1QW8A 5DO8A 1R86A 5ABFA 1DEDA 1XCXA 3AIUA 1M03A 1UWUA 4E8DA 4MTVA 4HOWA 2WVSA 2YBUA 5CSUA 3U5YA 1WZLA 2E3ZA 4HMEA 3VKKA 3ARSA 4JKLA 2GJRA 2W92A 4MADA 1CYGA 4Z2GA 4YN5A 2WB5A 5DEZA 3AIQA 4UQAA 1ITCA 1NP0A 1GQIA 1FH8A 1V0KA 1KQYA 1CXKA 3RM8A 4ACZA 1OD0A 2E9BA 2FDMA 3VTRA 2BV9A 4ATDA 4QLKA 1MW2A 1TG7A 1E0VA 2VQUA 1OWQA 4JFTA 2V38A 1UG6A 1JXJA 3BMVA 3W53A 4F66A 2YA0A 4F8XA 1B1YA 2VRQA 2YL5A 1CBGA 1Q4NX 1PZ3A 4M1RA 1KR1A 1QI5A 4PTWA 2OYKA 1JDAA 3WNMA 4YHEA 4U3CA 1HNYA 3L4WA 5I24A 2YL9A 1PIGA 1JYVA 3NSMA 1VFUA 4M81A 1HJUA 2G3NA 3WD3A 2IXUA 3AHVA 4UZSA 3PZUA 3VGGA 1PEZA 3F5JA 2FHCA 3TTQA 1JZ8A 1IT0A 1MXDA 1W9UA 5A3HA 1GONA 1DP0A 3BAIA 2XYLA 3IJ8A 3VMOA 1FA2A 5E0FA 3POCA 3WF0A 5LA0A 4W7UA 1UD4A 3ALGA 4TX8A 3RCNA 3CUGA 2E9MA 1XV8A 1TZ7A 5EMYA 2BXZA 2RGLA 3CUFA 1J18A 1LL7A 3W29A 4A3HA 4DUXA 1I1XA 3PTKA 4MAZA 4OOUA 1W3JA 1W2PA 4L4PA 1HL9A 1C91A 2YDQA 3AMGA 4NF7A 3VNYA 2GDVA 2VCAA 1CZ1A 4L4OA 2W4XA 3ARRA 2XIIA 4EE9A 4BQ3A 1QHOA 2VRJA 1H09A 2CESA 4B9ZA 3AI0A 1G5AA 4PMZA 1LLOA 2DDXA 1JI2A 3T2PA 2XSBA 1WNOA 1EGZA 3CMJA 4QP0A 5D4YA 4JFVA 1UZ1A 2XUCA 1FFQA 3MO4A 4ZE4A 1E0XA 1HF6A 3N18A 2QPUA 4TVDA 2WANA 3WEMA 3WMCA 4ZXLA 1KGWA 2BVYA 3AXIA 1KXVA 1V08A 4DUWA 2XVPA 4NI3A 3VIKA 4ML4A 2WMHA 3IJ9A 3A6OA 2WLYA 2CBVA 2ZUSA 4A3YA 5FL1A 1UR2A 4PBGA 1E4IA 4GZIA 1CGYA 3M7SA 5CQ1A 1CGVA 1SMAA 2ZOXA 3EYPA 4MNJA 2J7HA 4MNLA 2CIPA 4WIWA 4RE4A 3AYRA 5A6KA 1CGUA 5CPQA 1FHDA 1BGGA 1CGWA 1EO5A 1RD6A 2YL8A 2QMKA 3ARYA 4UFJA 4F9DA 4PSPA 4ZFMA 2D2OA 3W26A 4GI9A 1QBBA 4IUGA 3F4VA 2QV4A 2ZX6A 5CPSA 4ACYA 2PWEA 3OG2A 3UCQA 3PTMA 1OB0A 2CETA 1W1VA 2D0FA 3KL0A 1HVXA 5I5RA 3W27A 5DT7A 2IXVA 3BAKA 1LWJA 3GXMA 1E9LA 2XFRA 5IFPA 2BY0A 2VT0A 2PWHA 3J7HA 4KWUA 3F5KA 3WQ6A 3CZGA 1JZ2A 1XRVA 3W28A 3WIJA 1V3LA 2XWEA 4D6EA 4J28A 3WDRA 5D9PA 4JCLA 4X9YA 3RIKA 1FH7A 1CLVA 4N42A 4NRRA 3S6TA 1JD7A 2YKKA 3S2CA 2VMFA 4Q7NA 1R87A 2J77A 5EFFA 3AS3A 1VB9A 2YBTA 3AFBA 3OGSA 5DMYA 4F79A 4HU0A 1KCKA 3NSNA 5LYRA 4PMOA 2DT2A 2VRKA 1OD8A 2UY2A 2BVTA 2WVVA 1MWOA 2GDUA 2YDSA 3TTOA 3UG3A 1D2KA 1XCWA 1W3HA 3CGTA 1H41A 3K1DA 5FCZA 2YDRA 3ZJ6A 4HOXA 1XSJA 4CU7A 2C8NA 1BGAA 1K6AA 3PZIA 2J75A 2DSUA 1BG4A 2WZIA 4HA4A 1K9DA 1EHNA 2VVNA 2ZUTA 1YQ2A 1E4MM 4UQEA 3ZMRA 4MB5A 3WNPA 4CU8A 3BSGA 5FD0A 3ZQ9A 2VR5A 5BRQA 4JHZA 3T2OA 1QNSA 2FGLA 3WMBA 4AIOA 2YL6A 3CUHA 3CZJA 2E40A 4H8HA 1GQKA 4KGLA 3WL1A 3CO4A 2J78A 2VX6A 4U33A 1AVAA 1QHPA 1F4HA 3WMSA 2XWDA 4K68A 1FFRA 1UWQA 3W25A 2Z1KA 1TVPA 3VM5A 4CD6A 2D20A 1UWTA 1ODUA 3AMCA 3BGAA 3PBGA 3UEQA 3IAQA 3RO8A 3MANA 1BLIA 4QFUA 2X8RA 4P8XA 5EB8A 2RGMA 1H3GA 1V6VA 3UG4A 1XD1A 2UY4A 4PMYA 4HOZA 1WKYA 4D72A 1BYDA 1WZAA 4CUCA 3FW6A 4AIUA 3A3HA 1WDPA 2CHNA 3AMKA 2W62A 5D8WA 4BQ2A 3ARZA 3DYOA 1X6LA 3WD4A 4P7QA 3VD3A 3WEZA 2J7BA 3WKZA 5A2CA 3ZJ7A 4D6FA 2VOTA 5A8QA 4P8UA 4C7GA 3CHFA 1K9EA 4EKJA 1Q6DA 2VR4A 4HA3A 4J3WA 4XB3A 1CDGA 4D6GA 2OWWA 1QNOA 3SUSA 2DGAA 3HN3A 2X09A 4CVWA 4MPKA 4ZENA 3IANA 4HMDA 1E6NA 2VX4A 1OT1A 3BAJA 5D9NA 3II1A 1H49A 2WNWA 3ZJKA 2XGIA 4HZ8A 1E70M 1VBUA 3AIVA 3VD9A 4LYPA 4AZCA 3W6MA 1VFOA 1GOIA 3O9NA 4MB3A 5C71A 1E5JA 1JGIA 5F7UA 1KB3A 2IUZA 5CXPA 1K9TA 1C8XA 2EPOA 2Y5EA 4QDMA 3MS8A 1QI3A 3QHOA 1E15A 5BCAA 4MNKA 4X0NA 1R8LA 1V6XA 4PN2A 3NSXA 2BFGA 3OLDA 4LX4A 3BAXA 3EMQA 2CBUA 2A3AA 5BYWA 1RPKA 1H2JA 5FOOA 4TTUA 2G8ZA 1W9DM 4M80A 2V5CA 1JZ5A 1QPKA 3SCQA 5A69A 2CBIA 2CBJA 3QOMA 3SEPA 3ZT5A 1C8YA 2JF7A 3ARXA 5A8OA 3PZTA 1A3HA 3A4WA 4QAWA 1V0LA 3VIPA 1KQZA 4CN1A 1QI2A 5IDIA 1GOMA 4OJYA 2XFFA 1GUVA 2WCGA 5M17A 1MFUA 1J0HA 2QLYA 4UOJA 2NT1A 3WH6A 4D1IA 5AYBA 2C0HA 4E2OA 1TE1A 3U7VA 3K46A 4U2ZA 4QCEA 3NDZA 2ZE0A 5BROA 3WDQA 1ZBKA 4HTYA 5JBFA 1BPLB 4U31A 3MU7A 1JI1A 2ZX9A 3EDFA 5D9MA 3N04A 1B30A 3VINA 5GNZA 1J10A 1W9VA 4AZBA 3GBDA 3AS0A 4GINA 4GZJA 4B3LA 3FAXA 1US2A 4J3TA 3GZAA 1X1NA 2BHZA 5GPRA 5BXPA 2Y8KA 4TXEA 4AYSA 4MJ4A 5I77A 3N13A 1PJ9A 2VZVA 7TAAA 1LG1A 3CZLA 3QHNA 1TUXA 3AJ7A 3RJYA 3TA9A 3TOPA 3MV11 3AIEA 5E09A 2WMGA 3K8LA 2Y4SA 2XVNA 3AZTA 4W84A 1AQHA 1XSKA 5GQBA 7A3HA 3AMLA 3WENA 1IZJA 1MW3A 2BXYA 4PCSA 1WB0A 4J3SA 1ESWA 4GO9A 2O9RA 4AD3A 2CEQA 2NW0A 3WD0A 1JZ7A 1ECEA 2Q8XA 3IAPA 3ECQA 3CUIA 4TX6A 3L4TA 5A6BD 1CEOA 3ZO9A 1QI0A 4OKDA 1XD0A 4ATWA 1GQJA 4NSBA 1GORA 3K8KA 1QNQA 1NWTA 3HJEA 5E6ZA 1WPCA 2Z1SA 2W63A 3DC0A 2WPGA 3VIHA 2X2YA 2WMFA 4EK7A 4J3UA 1NOFA 1JNEA 2PBGA 4FK9A 3W0KA 1OM0A 2FH8A 3PZGA 2HVMA 1E5NA 1UWSA 2WHMA 1E43A 4XX6A 3VDBA 4CD7A 3CHEA 1UWIA 1O7AA 2VCBA 3T09A 1MQPA 2JE8A 1SMDA 3AXHA 3NCOA 1ITXA 1GVYA 3VGEA 2PB1A 3N12A 4DWSC 3PN8A 2J47A 3VM7A 2XJ7A 4LQ1A 3AROA 1DWIM 2VJXA 1G9HA 4H7VA 1LJYA 5AYIA 1H5VA 1GVIA 3VGBA 1TA3B 4GXPA 1L0PA 2PBOA 4W89A 1H4PA 3AZSA 3ZIZA 1QNPA 3U57A 2Y2WA 1VAHA 2CNCA 2ZUUA 1QVBA 1J0KA 2WMIB 3MUZ1 4W93A 4AY1A 2WW5A 4AXNA 1NARA 1WAWA 2J74A 4RE3A 1LG2A 5HPCA 1EDTA 2DSKA 3VIIA 4X0VA 5DT5A 4U2YA 2G41A 3L2MA 3MKKA 5I6SA 1MFVA 3WNOA 2XIBA 2D22A 5D9OA 1ISYA 2UY5A 3OZOA 5CLTA 3N15A 2WSPA 1EOKA 4TVUA 4GI8A 1CXFA 3UR7A 3W24A 3SCVA 1NOUA 1OSEA 2BY1A 1ODZA 3ARVA 1PAMA 3SUVA 3ZT7A 2XG9A 1QNRA 3BC9A 4AEFA 4AD1A 2VZTA 4M56A 3AHYA 3SIMA 1E71M 2D24A 1UD8A 3BLPX 2ZIDA 4B3KA 2EO7A 2WK2A 5A1AA 5HXMA 1US3A 4H2CA 4S3JA 5I3DA 1ZBVA 1CXIA 4CD4A 1Q6GA 3RPMA 2FGZA 5ABHA 1VEOA 1VIWA 5I78A 3VGFA 1VFFA 3UESA 4TVCA 4Z2HA 1UKTA 1OIMA 1B9ZA 1B3YA 1JF6A 4PMQA 5TD4A 1JYWA 2DIJA 4ATLA 2PF0A 2AMGA 2OSWA 3WF4A 5FL0A 5BRPA 3TTSA 4Z2JA 2XSAA 3BAWA 1OT2A 2Y8VA 4PMRA 2JALA 1V0MA 3VX1A 4B9YA 5I79A 5FIPA 2ZXQA 2WXDM 3PTQA 4UFIA 4CKQA 1UZ4A 2F2HA 1GNXA 1NM9A 3DYMA 4PSRA 2VX5A 2YJQA 1EIBA 1DWFM 3VO0A 1HJVA 4CD8A 3FN9A 1EQCA 3GYCA 1XH1A 1V03A 8CGTA 1CIUA 1S46A 2WCAA 2GVYA 2WMKA 3SURA 1BF2A 1F4AA 5DFAA 1GJUA 4Q22A 1IZKA 3SCSA 1J0JA 5IFTA 4JKKA 2D3LA 4ZXOA 3ZJ8A 4PYSA 2WCSA 2AOSA 1CENA 1FHLA 3DHPA 1EDQA 3PZOA 1XH2A 4IISA 2BVDA 3O6AA 2XFYA 1JF5A 4E8CA 1HX0A 1CPUA 1W3KA 3OLGA 2WLZA 3ARWA 3IJ7A 3ZSTA 1GQLA 5E9AA 4JKMA 1GOWA 3GNPA 4NZCA 1UHVA 2OYMA 3AIRA 1KGXA 1EH9A 4GZEA 1CXHA 2BY3A 5E6YA 2WC3A 2WZHA 1KWKA 3L4ZA 2EEXA 3WQ4A 1TCMA 1E4LA 4UZUA 3VUPA 4IPNB 2FH6A 4DWSB 1VFMA 5LA1A 3VGHA 1VJSA 4JL1A 3WH8A 4R27A 3WBAA 3VIOA 5JBEA 4AZHA 3IK2A 1CLXA 1HKIA 4R5EA 2WBKA 3SCTA 1G1YA 1ZU8A 2D0HA 1J0IA 1VBRA 2DQXA 4JFSA 1HJWA 2VUYA
chains in the Genus database with same CATH superfamily
1GW1A 1JCLA 4EIVA 3CQ0A 4GACA 3F4WA 3M0MA 4CCEA 4ZFCA 1X1OA 3S5OA 1EZ2A 3OOQA 5AOUA 3RMEA 5I3HA 1Z41A 5T26A 1TV2A 1X6NA 3RR1A 1AMKA 3KL3A 4JTAA 2R1KA 3NGFA 2ADAA 5BOFA 3HMJG 4E0CA 2A4AA 1R7AA 3ARQA 3VOHA 1V02A 2GVLA 3OHIA 3D5HA 2VI0A 3IPWA 3CASA 4GVFA 2XM1A 3W87A 3CL8A 1W5OA 3P6LA 1X38A 3M41A 3EWWA 1M41A 4KRTA 1OEPA 1YDYA 3MI2A 1QJWA 5LGZA 3MYOA 4PH6A 1ELSA 3TWAA 1IEXA 2Z1VA 2ZRZA 2RDWA 3ITVA 5HNNA 5D09A 1S5TA 4GG9A 4B4FA 5E9XA 2BY2A 4LUSA 2VWSA 4GBUA 1HN1A 1QCWA 4D6CA 7REQB 1Q6EA 4PMVA 2QUTA 1AZ2A 1KV8A 4C7DA 1JRCA 2RAGA 3WH9A 3CZKA 1FWRA 1VJZA 4AIBA 1JYXA 1YHTA 1GHRA 4RDYA 1Y7VA 1AMYA 3KBJA 1SR9A 1SO3A 2I5QA 3RLGA 3NPUA 4L9YA 3UXIA 5E0KA 4PUKA 3RM9A 2J7EA 5T9CE 2VDIA 3STPA 4JN6A 4LJ3A 3SN0A 1UBPC 3SAZA 1X98A 3PJTA 3SSZA 2J8FA 3AIWA 4PUWA 4EF8A 5HWNA 1MXGA 1TMQA 1BVZA 4DJEA 3L5AA 2CCRA 3OLEA 4HK6A 1RZMA 4CNPA 2DH3A 3ZWSA 4IIGA 4K1GA 4XK2A 2OZ3A 2IKHA 2JQXA 1KGUA 1D3CA 3AXXA 4JFUA 4W86A 3AU2A 2PODA 5LZLA 3T6CA 3MV01 1S5NA 3TK7A 1GZJA 3B8IA 2P53A 3MKVA 3DXIA 3TU9A 3P14A 1W6TA 3U0HA 2YLLA 4IX2A 1XF0A 2VC9A 1Z3NA 3U2OA 3O63A 4HPHA 2NV1A 3GDBA 3CPUA 3S2NA 4Z08A 3LHWA 4FXSA 4AMAA 4PMJA 3KEHA 4JTHA 1MXSA 4JN7A 3CAVA 2JKAA 3DHUA 3HURA 3IGXA 1KM5A 2WKLA 2VEFA 4IL2A 2C6QA 4DBDA 3SGZA 3SO7A 1J96A 1HGYA 3HG4A 2ISDA 4HHHA 4KH2A 3LPFA 3ALFA 3I3BA 2P10A 1TV3A 4WUIA 3ZR6A 2OCZA 4DJFC 1UA3A 2GGHA 3VKJA 4PTXA 2NVAA 1HO4A 3E5PA 3PWIA 2EQDA 3GTXA 4FLSA 3F2CA 1WXJA 1PKLA 4LVBA 4UMAA 1I9CB 5I00A 2I1OA 1TPUA 4WOZA 3MC5A 4EXQA 4MWAA 1XRFA 2VP8A 4DZIA 1E51A 1HKKA 3S4TA 4C6OA 3S1UA 3LOTA 3DGBA 3WQFA 1OG0A 3AIBA 3BO9A 4HP5A 5B7YA 1LQ0A 1CXLA 1H50A 2OMAA 4RJEA 3SRHA 1WE5A 4GKTA 4WGXA 1WUFA 1WDDA 3VE7A 4DBSA 2WJFA 3DFHA 5CZKA 2VO5A 1OQFA 3CTTA 3CO8A 4U3AA 2CU0A 2P88A 3QKEA 2JF6A 3GD6A 1V3IA 2QW5A 3BJTA 3LGGA 3WD2A 4HVXA 1ITQA 4F2UA 3VKAA 2BMBA 1BXCA 1KFCA 1HIZA 3BURA 4HSNA 4WLCA 1SFTA 4CQ8A 5A6JA 3CH9A 2Q02A 1Q6LA 3CHDA 3LSCA 3V35A 3VD4A 4DZAA 4JTGA 4NQ1A 3ES7A 1ZB5A 2CKSA 1QPNA 1QOQA 3MB9A 4IQJA 2J7DA 4I9AA 9RUBA 3VPLA 3AHTA 3CIVA 5DF0A 2V3DA 5FJPA 2JEPA 2OJPA 1AZ1A 1TIWA 5JBDA 2AQVA 2YOCA 1LBMA 1SQ7A 1KW1A 2GVEA 4DZHA 1OBAA 5I09A 1XGDA 3WNLA 1L6YA 2F61A 4YYFA 3PWGA 3ELFA 4QG9A 4I5RA 4W8LA 4IOTA 3STEA 2DT3A 2NSXA 2YFNA 4PTDA 2DZPA 3CU2A 1YIXA 3LSBA 3CMFA 3L66A 1P7TA 4X3ZA 5D2TA 2PMQA 5C8BB 4RXFA 3NZPA 1A80A 3KX6A 3GXIA 3WFZA 1HL2A 2I56A 3FGCB 1PWMA 4UTHA 4GWEA 2ZA2A 1Q3NA 4O1AA 5A94A 3LMYA 2XH7A 4LUYA 4KFOA 2ZUVA 2NLYA 2C7FA 1QI4A 2PGFA 2WNZA 3QOKA 2BHUA 1W54A 4AISA 3PC0A 4Q6XA 4W88A 3LMZA 1QW9A 3G0UA 3H22A 2VVSA 3TP4A 2W3ZA 3TYCA 4LSBA 4DJDD 5CGMA 5CPTA 4GQ0A 3UWQA 1V7AA 4GHRA 3ABSA 1E6PA 2W91A 3KFTA 1XLAA 4CD5A 2F9RA 1LM1A 3C56A 5JVLA 3VOFA 2DQWA 1H11A 3HV8A 4YHGA 2WVUA 3MSDA 3UZZA 4AZ7A 1A5UA 4ONVA 4ALDA 3TTEA 4O4VA 6TAAA 4JY8A 1G69A 2FTYA 4YPJA 1U2YA 3N14A 1U5VA 3GR8A 1ZBCA 4XBJA 3L4YA 2IPGA 1UD3A 1EXBA 4W5UA 2C18A 3SCPA 1ADSA 1H7WA 3R43A 2VTFA 2WSKA 4R7JA 3V7PA 4A8IA 1K8CA 1E6SM 4JN8A 1HZYA 1OCQA 2G3JA 3GH5A 4S3FA 6PTDA 3I6RA 3W4RA 1Z8AA 2GJPA 1BF6A 3PANA 4FO4A 4IM4A 3HQOA 3W37A 4Z1CA 5G2HA 3EBVA 1JVNA 4S38A 4DPPA 4AFYA 1KM6A 3EEZA 2X05A 4HHMA 3QZ6A 3IWPA 1NFPA 4O53A 3WUFA 3W7OA 3TA6A 3QPYA 4HPGA 4DBUA 4Q8QA 3HGJA 4V1XA 4M24A 1IXQA 3NJ3A 3PAJA 1XFCA 1ZJAA 4KPLA 4AZ6A 4Q4KA 4UMBA 1SFLA 4KFPA 4RZBA 1W3TA 4J2MA 2ZX5A 3W6YA 1A50A 1KBKA 2GK1A 2V63A 2AKZA 4LW7A 3B0PA 3LS9A 1L8PA 5FF7A 5LHEA 2PWVA 3WNNA 5K3VA 5JU6A 1GK8A 2DZWA 3SECA 3KLLA 3B0YA 4WF7A 1UJPA 2RDXA 1I1WA 4BF7A 2WYSA 1UD6A 3E6EA 2OWCA 4NXKA 2Z00A 4DN1A 1EYWA 3VOCA 1L6FA 5D05A 4GOAA 4XD3A 3UWZA 1ISWA 3QPEA 4Z2LA 1EUAA 3M4HA 2VNCA 1ONRA 2O9OA 3IUHA 4UXDA 3KL5A 3W83A 4NNAA 5HQMA 1UH4A 1YRRA 1SW3A 4HA0A 3N29A 3BK0A 5LIXX 3WSUA 1VH7A 3T08A 4FPSA 4F0KA 1PX3A 3VIMA 1E4NA 1DIOA 4YWSA 1RJPA 3WJXA 3VC6A 3WBWA 2QCFA 4ERGA 1OX4B 2TYSA 5BWFA 3CQIA 3URQA 4L56A 5D38A 5D02A 4GJIA 5GNYA 3TKFA 4O15A 1Z32X 1FY6A 1TB3A 1MUCA 3G3DA 4MDOA 6REQA 1H0IA 3H54A 4IGNA 1U83A 2FHBA 3KVKA 3BOFA 4JEJA 1O66A 2OGJA 3W76A 3LM7A 2BHYA 3O2LA 2PWUA 3UYIA 1A5AA 1QR7A 1QNVA 4DF2A 2D0GA 3FS2A 3ZZ1A 3MUY1 1RP8A 3QRHA 4OBSA 3IIVA 1D7FA 1W37A 3LCHA 2DIEA 2F6KA 1TO3A 3HGOA 1XLFA 3M6YA 5C70A 3KWXA 1V02E 3FYYA 2WHJA 3PJUA 1DE5A 3B40A 5JQ9A 3MUCA 5EL1A 5CSYA 1OGGA 2UWFA 2PURA 4UNKA 4O17A 1K77A 2WAGA 4AHPA 1NWRA 4GA8A 2O4QA 1F8MA 1UQYA 4WXYA 4DNHA 2PWFA 4AF0B 1E73M 1V3MA 3R94A 2ABAA 3TZFA 1I75A 1VPQA 1F76A 1IIGA 3BLDA 3LHYA 2C91A 1S2CA 1UR3M 4JTIA 4XIAA 2B0MA 4DRSA 2OKTA 3KRZA 4ZB2A 3E9AA 2VDGA 4FR1A 4DWSD 2XFWA 4ENLA 2G95A 3AHXA 4NZFA 2VZSA 4PMXA 4C6EA 4U5IA 1UD2A 4HYVA 3TVAA 5AHNA 3HV9A 3DYPA 5KEZA 2D2HA 4OQVA 3VDGA 4OBRA 2V3FA 3I7QA 1ZAJA 1UR9A 2EJ1A 3S9YA 4K7VA 1WYIA 1Q66A 4TV5A 1EP1A 4Q4OA 4LVDA 1UA7A 4YYCA 4FHAA 3RDKA 1EJTC 3BW2A 1R7OA 1LDCA 4H3DA 3VK5A 2CLFA 4CLMA 5CBBA 4EX4A 2C3ZA 4LPCA 3UY7A 3KUMA 2OSXA 3GNXA 4C7FA 2Y7DA 2O4MA 1HT6A 1B0IA 1JIBA 2V68A 3TJ4A 1DQXA 2QZRA 5M1TA 2PTDA 4NXSA 3RILA 3G6MA 1JFHA 3SFKA 2WZEA 4LYKA 4GGBA 1EPXA 4PE8A 2C15A 4XD4A 5JUVA 4GC3A 4K8EA 3ABXA 3IV3A 2NXGA 2J6XA 4HMNA 3UGVA 2IKIA 2RH9A 3QYSA 1MVYA 5BZAA 5I2UA 1Q4WA 1WP6A 3HPSA 1LRQA 3PPGA 1W17A 2Y63A 4JIRA 1JJKA 1OJXA 5HMFA 3RPDA 3IGUA 4LH8A 3ZXWA 1KFBA 4G2DA 4BCEA 4U4MA 5DELA 5HBFA 3GU1A 3EOUA 4HA1A 1J01A 1BG9A 2BGQA 4CNUA 4U10A 1ZLPA 1TV7A 3UZXA 1WO2A 2Z0IA 3GG7A 2BNJA 2D1ZA 3EA2A 3H4GA 1BRLA 1V0NA 4MOZA 5GJPA 4H00A 3W81A 2J7CA 1PPIA 1R3YA 2UY3A 3ZWTA 1HL8A 3R8HA 2YIHA 5A8GA 4PB5A 2X1IA 3BARA 2HNEA 3WYZA 1E9YB 4MWAE 2PZ0A 3KHJA 4X63A 3M07A 1UZHA 4GI6A 3V0UA 4Z2IA 1JZ4A 1IEIA 1GHSA 1M6JA 2JFEX 4B5SA 1BWVA 3MCNA 3E12A 1DEDA 3W2JA 1M03A 1UWUA 3TSMA 4HOWA 3KM8A 3T4WA 2YBUA 3WQOA 2NQ5A 3VKKA 3CIXA 4LALA 4JKLA 5AZ0A 3IGHX 3V1PA 4QROA 3GK0A 5AHLA 1VR6A 3M16A 4PZVA 1OY0A 2WJZA 1KO0A 1CXKA 4ACZA 3DERA 1OD0A 2E9BA 4IXXA 4LCQA 3H2FA 4QLKA 4HCLA 1W8SA 1TG7A 2PLJA 1TZ9A 3HIJA 2IPJA 4F66A 4JQ4A 2ZYFA 5BOEA 1Q4NX 1XDMA 1ZSXA 1KR1A 1QI5A 1P0KA 3W1UA 1XIJA 1JGMA 4ROPA 1LLZA 2A7NA 7TIMA 1QXLA 3JZUA 5I24A 1XLCA 1O1HA 1JYVA 5U7SA 1R9YA 3REQA 3EOLA 3C5QA 3WJYA 5DCDA 3AHVA 3TYBA 3EAUA 2PZNA 1JZ8A 1IT0A 4BJHA 4S1FA 5D2VA 3QQ1A 5AB3A 3POCA 2OR2A 1UD4A 2O56A 4LAUA 2HEJA 3PBVA 1OZMA 1YPFA 4O16A 3EX4A 1FWGC 1R3WA 1TZ7A 3E0WA 1GZGA 4GMEA 4N4QA 2BXZA 2RGLA 3N2OA 3UZYA 3HPFA 3GKAA 4F2TA 5EMMA 2BOEX 3E5BA 2TPSA 4XAZA 3PTKA 4MAZA 4IIEA 4CNSA 3NL2A 1PKYA 2VC6A 4L4PA 1A5KC 1HL9A 1DTNA 3AMGA 2ZC8A 2UZ9A 2YCKX 3CIWA 1CZ1A 2ZKMX 4Q8NA 1JUBA 4WHBA 2VRJA 4PL2A 2R9RA 2OLAA 3B3DA 1XYLA 1XIDA 4PMZA 1GYMA 4IHCA 5K7JA 1JI2A 4ZL1A 2ICSA 1ZQ5A 1EGZA 3CMJA 4FI4A 2XUCA 4AB4A 2YXOA 4ZE4A 1RBLA 5EY5A 2QPUA 4TVDA 4E8GA 3WMCA 1TYGA 4ZXLA 2PTZA 4YMZA 1HG3A 2BVYA 3AXIA 3CTLA 1KXVA 3LEPA 1OFAA 4XZ9A 4DAIA 2XVPA 4B2DA 3L0GA 4ML4A 4O4WA 2WMHA 4I8DA 3A6OA 5H91A 5HQLA 1O5RA 4D8LA 2ZUSA 4A3YA 4HNCA 3GZ3A 4PBGA 3BDKA 3W07A 5K4XA 1SMAA 3MCMA 5AVHA 4MNLA 1NJJA 4WIWA 1KBLA 4ADUA 1DVJA 1UP3A 1GG0A 3LQLA 1FHDA 1CGWA 3TR2A 1RD6A 2QMKA 3ZLFA 3UBPC 3W9ZA 2GWNA 5IRPA 1PDYA 2WNQA 3V5OA 4J2PA 4NVTA 4BI5A 1PIIA 3OG3A 4HGXA 2ZX6A 5FSEC 4ACYA 3OG2A 3UCQA 1RA0A 3U4AA 4MG4A 2ALDA 4GYJA 1HVXA 1EJWC 2TSYA 3AYTA 3KBVA 1VLWA 2VT0A 1JCTA 2PWHA 4MLJA 4KCWA 1TPH1 5IM51 1J8VA 4OWGA 1XRVA 4L4LA 4JCLA 4ES4A 3PK7A 3VZZA 1CLVA 2CZDA 4DQWA 4RR4A 5JH2A 1JD7A 3RR4A 2IMRA 2VMFA 3NL3A 1VB9A 3AFBA 1L2QA 2R1NA 2I17A 1RJQA 4F79A 4Z42C 2V82A 1W1A1 3H70A 2DT2A 3GVGA 4LFYA 3ID7A 3IACA 2UY2A 5AECA 1FWWA 2BVTA 1MWOA 3ISIX 4JXCA 4L7ZA 5I03A 2HBXA 3KP1A 2VGIA 2Y7EA 4PRRA 4WQ6A 4KCVA 3GQYA 3ZJ6A 2AQOA 2NQJA 2QR6A 1FWJC 1K6AA 3MZ2A 3TC6A 2DSUA 1SO4A 1BG4A 3V5FA 1UMYA 1O1ZA 1V7YA 2VVNA 2GQAA 4DJFD 1NDZA 4MB5A 2OVLA 4KESA 1YX1A 3BSGA 1KM1A 4JHZA 1Z42A 3W1PA 4E6MA 3FKKA 3EX3A 3QC0A 4L80A 3WMBA 1EF2A 1XIHA 1TPB1 2IS7A 4NP7A 3T9PA 1DJNA 1YDOA 3C2VA 3A22A 2B7NA 2VX6A 4U33A 3PUGA 1XIMA 1FWNA 2PRHA 3BGAA 3PBGA 4A2SA 3IAQA 2GUBA 3MANA 4QFUA 3PVFA 4O14A 2QCGA 4MY8A 2X2GA 3FYPA 1UASA 1XD1A 2UY4A 3Q45A 1WKYA 3URNA 3UA3A 1PB0A 4IH3A 3OODA 4LAZA 4AIUA 1WDPA 4KT2A 1BTMA 2BX7A 3AMKA 3GIQA 1DJIA 1EL3A 2W62A 5D8WA 3SRFA 1X6LA 3UA4A 4KWWA 3WKZA 1H7PA 3IJIA 3HG3A 2VM8A 1VFLA 3W7RA 3WBXA 3RLVA 3G24A 4EKJA 4HA3A 4J3WA 2X09A 4MPKA 3RCYA 4FX7A 4NZ4A 1E6NA 3II1A 3NPXA 3ZJKA 3DH7A 4RW5A 4HZ8A 1R3RA 4MIMA 3AIVA 3VD9A 2PUZA 4LYPA 4AZCA 3CC1A 3MHFA 3W6MA 2BZNA 5IBXC 4MB3A 1E5JA 1JGIA 2FKPA 2GGIA 5C2XA 2POZA 3W2UA 4FALA 5M2FX 3LZ5A 1A5LC 4BI7A 3LCGA 4X0NA 3NVTA 1V6XA 5DBUA 4PN2A 1KRCC 2QUNA 1HKVA 2BFGA 4P5UA 4QRNA 2Q01A 1UC5A 3NXFA 3BAXA 3EMQA 8RUCA 2A3AA 1AW2A 2C0AA 1AFSA 4TTUA 2G8ZA 3SCQA 3QOMA 2CBJA 3LENA 3ZT5A 4LVGA 1BSLA 2MUCA 3B9OA 3LRLA 3SJ3A 3ARXA 1V0LA 3IVTA 2X40A 4CN1A 1QI2A 1W3IA 4GZ7A 2QT3A 5IDIA 3R7MA 2JKEA 2XFFA 3GHUA 1MFUA 1J0HA 4UOJA 2C0HA 3GIPA 1M5WA 3QY7A 1XIEA 4X2PA 3WDQA 5BROA 1FKXA 3EB2A 4FIQA 3GSMA 1ZBKA 3TAKA 1H61A 4J35A 3EDFA 2ZDRA 3M44A 1FWTA 1B30A 3W7EA 3STGA 2AL1A 1DJHA 4AEOA 3PAOA 5GNZA 4O10A 4O1BA 3GBDA 1GKQA 3FAXA 2QJNA 2NLIA 2Y1HA 4FEZA 1A0DA 3GAKA 3LB0A 2NX3A 3GHSA 1X1NA 4ZODA 3TN5A 2BHZA 5BXPA 4TXEA 3SRDA 4POCA 7TAAA 1YYAA 3CZLA 3RJYA 4MVAA 4XO7A 2PF8A 1W5QA 2I9EA 5E09A 2NV2A 3M0ZA 1V8EA 4JTUA 1AQHA 7A3HA 1W1ZA 3H2AA 1ESWA 3TFXA 1T8XA 1S3HA 1XP3A 5C55A 2FZMA 2IKGA 2NW0A 5CJNA 4I8YA 3R89A 5CGQA 5I06A 3W2LA 2HXUA 1KM4A 1RQEA 1YPXA 4IMDA 1EP2A 3PPHA 4OBTA 2NQHA 3R25A 4NJGA 4GVHA 4YTUA 1GORA 4YCOA 3K8KA 2Z1SA 2W63A 2ZCGA 4MZ8A 1R5YA 3EWUA 2R1MA 4UTIA 2E6AA 2Y89A 5PTDA 2FH8A 3VDBA 3QQ0A 3R2GA 3W74A 3CHEA 1UWIA 3T09A 1MQPA 1ZZMA 5C9XA 3NCOA 4AU0A 4I5UA 4MJMA 1OFPA 4NILA 3WQPA 2PB1A 1TKKA 3VM7A 2XJ7A 2DIKA 3G1RA 1GVSA 5CPNA 2H90A 2FZ9A 1ITUA 1F6KA 1EEXA 1YDNA 2PDMA 4GLEA 1TA3B 3KTCA 4GXPA 1L0PA 2PBOA 4IQDA 3ZIZA 4C6LA 1QNPA 3U57A 1RVKA 5HWJA 3OYXA 3W7QA 2Z29A 3LX9A 4JD4A 4KEMA 2CNCA 1LROA 1Z48A 3TX9A 4A3RA 3MUZ1 4KRZA 4AY1A 4AXNA 1WKFA 3IJLA 4TMBA 3L2IA 1LG2A 2DSKA 3WLJA 3BPWA 4Q8OA 4EPDC 2OODA 1Q85A 3WNOA 1R30A 5D9OA 1WAUA 4JYEA 4YVVA 5CLTA 3N15A 3S2LA 2Y61A 1R3TA 2WSPA 3VABA 3W24A 3V0SA 3P8JA 2GJLA 5REQB 4NX5A 3ARVA 2C19A 2ABBA 4GIYA 1I2NA 4AD1A 3MJYA 3MA8A 2VZTA 3SIMA 2D24A 1UD8A 3SQMA 5H1WA 1RCXB 2VC7A 2ZIDA 1M68A 2D2JA 2EO7A 4Z1YA 3FFSA 3PF3A 3RPMA 4ZO7A 2QJIA 3TXZA 5ABHA 2XN2A 5AFDA 5XIMA 1IIHA 4IGSA 3PBUA 5C7VA 4ASTA 4GNVA 4NZJA 1I6NA 3IIZA 1WBHA 2QCDA 4NYYA 1G6CA 3QR0A 2EKCA 1GVQA 2OSWA 4J4KA 2XSAA 1OT2A 4XO6A 1A5MC 3GFZA 1IE7C 5I79A 2ZXQA 4FOKA 2WXDM 4QHRA 1UZ4A 3WLRA 2DW6A 1NM9A 1NFBA 2RJHA 2VX5A 2OZ0A 1Q7ZA 2YJQA 2R14A 3SN1A 1K02A 4CD8A 2EG7A 3AJXA 1PE1A 3GYCA 1XH1A 3QLLA 2ZRUA 1CIUA 2WCAA 3WK1A 4FAMA 3CEPA 3SURA 3LK6A 3TLQA 1BF2A 4UBPC 2IQ0A 4JTDA 3KAOA 5DFAA 1Z6KA 4PBFA 4Q22A 1KM3A 4GXWA 4REQA 3N2XA 5H6HA 4JKKA 2VFGA 4ICMA 1TJ0A 3ZJ8A 2WCSA 2AOSA 2R94A 2CFFA 1XH2A 3RRAA 2XFYA 3IRDA 3NZQA 1W3KA 3ARWA 5EMJA 2HK1A 4DBEA 4XAFA 3HG5A 3FV9A 1GOWA 1RQHA 4IJBA 3GNPA 5J5RA 2OYMA 1EH9A 2Z1WA 4LEFA 1CXHA 5TBOA 3U2CA 2DZVA 3QPZA 1Q8AA 3L4ZA 4GY1A 3WQ4A 1TCMA 4EVZA 3R10A 3VUPA 4YVXA 4HPJA 4PCFA 5CC5A 3S2JA 2FLIA 2ZTKA 1VFMA 3VGHA 1VJSA 3A24A 1TPDA 3EKZA 3WH8A 2JBMA 3TQ0A 4XKYA 3WBAA 3BVJA 4D8ZA 4D2JA 1ML1A 4UTKA 4R5EA 3EB4A 3I65A 3SY8A 1J0IA 1CW2A 4M6QA 4IWWA 1ZAHA 2EPMX 2CLKA 8A3HA 3QTPA 2J9ZA 2YR1A 3CUJA 5HULA 3UR5A 1V6YA 3RJXA 4IMFA 1JDCA 4EANA 1DWJM 1NEYA 1FH9A 3WBEA 3QN3A 4YXGA 1NAL1 4DYEA 1SPQA 5K9XA 3GXTA 4KWVA 4QR6A 2QVNA 2VXNA 2ASHA 2Z27A 4GKLA 2E6DA 3ZT6A 1JPDX 5KZ6A 4NT0A 5AYYA 2H8ZA 2RFGA 2JGQA 1NVMA 1J6OA 3W84A 1XHGA 3M0JA 3O6YX 4MDPA 1EKOA 5A8MA 2GPTA 3EDJA 3NAVA 1JL8A 2W67A 5DRCA 2PDHA 3WJWA 4MFEA 1UKOA 3UWYA 3D0CA 1UR4A 1G7UA 4P7RA 1Y5WA 3GB6A 4AUBA 1C92A 2GUUA 3UWVA 1HKMA 1AQFA 3MO7A 2CZFA 2VEIA 2A3EA 4M8UA 3H7VA 4LY8A 1I0BA 5CPMA 1Z89A 4YTTA 5EU9A 1OX6A 2FHFA 5H8PA 1JYNA 2H9AA 3WLLA 4Q32A 4K8HA 3E38A 4XV0A 1R2SA 3GH4A 1RLCL 3W01A 1VRXA 4DXKA 4AD4A 2DH2A 1KRBC 2ISFA 4OIFA 3RMJA 2PGEA 3I7RA 4O8RA 2F6XA 4WDXA 4A8NA 3SUWA 2B31A 3SCOA 1J0YA 2WC4A 1FWCC 2RHGA 4NRSA 1PHQA 5D8ZA 3SJNA 4N0RA 2QULA 3B8WA 4OVXA 1XPYA 3SY1A 2QGHA 1ICQA 1NDYA 3E49A 5A2AA 3C3NA 1UR8A 2YCEA 5FJUA 1TQXA 1XLBA 4KIEA 1J5SA 3USZA 3I6TA 4GQRA 4G7EB 3RX4A 1JPMA 4S3KA 1JCJA 2F2KA 2GJXB 1Q6RA 2X0YA 1X1ZA 1VIZA 2CXEA 3FNDA 3SUUA 1H7RA 3POHA 1TMHA 3QEZA 4AEEA 4LU0A 3H4XA 3O6DA 1K8YA 5FSDC 4L61A 1PX8A 1KTBA 3TNOA 4QE5A 3G18A 3A64A 3TR9A 1EO7A 3VOGA 4PEKA 5G4HC 1AW5A 1KWGA 3V5CA 3GTNA 4TOQA 2WVTA 1SSGA 2W61A 3IV8A 2YFOA 3VNDA 2QS8A 3P5ZA 5DCBA 1ADOA 1VENA 4JTJA 1JXKA 3MI3A 1VD6A 1JCMP 3OA5A 3B9AA 3NOYA 1V4YA 1M7JA 5DMLA 3VNKA 4AX7A 2FZ8A 2B7PA 3L67A 3W82A 3G1SA 4CN4A 1SFJA 5HUOA 2TAAA 1QWGA 2Q8LA 4EAYA 1Y8BA 2FTPA 1RCQA 4QQ3A 3XINA 5D30A 3VZYA 1RY8A 3OVPA 4AIEA 4P7NA 4UTWA 1QUMA 1J4EA 3AALA 3DKJA 2DJXA 3N2TA 2O0TA 3RCMA 3K4AA 2PE4A 1UOZA 1SYTA 2D2GA 1SJDA 3W23A 1TX0A 4HSOA 4CQBA 4OV4A 4FF7A 1P5BA 4LXFA 1M04A 1HJXA 1FX6A 1MRQA 3CEUA 3FKRA 3EKLA 3H4WA 1W1B1 4D6HA 4G56A 4WKAA 1FCUA 2NVDA 1G67A 3M6DA 3H6OA 1US0A 2CITA 2ZXBA 1N8WA 1Q7MA 3VGDA 1W1YA 1VEMA 3AMDA 3CB8A 1O4UA 3QYQA 3T0BA 3S47A 3BH4A 5TF0A 1NDWA 3EEGA 5T8GA 1G4PA 2XVGA 2NXHA 1ZALA 1CTNA 2E0PA 4NI8A 5A6LA 5CZJA 4XSMA 1SGJA 4L4MA 1J0ZA 2E09A 2GGJA 2X7VA 2HISA 4H41A 2Y5JA 4DBWA 3Q2DA 4PUNA 3VX0A 5AC7A 4AD2A 4JTKA 4V15A 4ZA0A 1G0CA 1TE6A 2XZ9A 3C0LA 1EJSC 1TSIA 4M29A 4WJEA 2F84A 1C93A 4FLRA 1LQ2A 4Z1BA 1VYRA 5A95A 4AWEA 4H04A 1VBGA 2RDUA 3SCWA 4QISA 1EA0A 1EC7A 4O0ZA 2V81A 2A7RA 4U5KA 3PM6A 1XLGA 2YBVA 4I9JA 4JNMA 3M5YA 1P48A 1ADDA 1WBJA 3M0XA 3N2CA 3L9CA 2WHLA 2ZVRA 2VL4A 5F4WA 4ZSUA 4BI6A 3P5YA 1QU4A 7PTDA 3L4VA 1PS9A 1ONXA 4J9JA 4NNBA 4IG2A 3UZWA 2WKJA 3QV7A 1N82A 3EMZA 3UT0A 4YTRA 4UTTA 2VGFA 5ABFB 3FX4A 1XLEA 3MW7A 4BWLC 3JUGA 4KFNA 3BSMA 4Y8EA 1UP0A 3GLCA 1KD0A 4G6CA 3L7RA 3QH2A 2PWGA 4DLMA 3LLFA 4ZQOA 2G3MA 3LBMA 1TJ1A 1KXQA 3NG3A 4AD0A 1PYMA 3NQAA 5HA7A 3OEXA 1QPQA 3SGUA 3GG8A 3N25A 1UUOA 4QX4A 5KTLA 2Y8UA 2E8YA 4GYPC 3D3AA 2PDQA 2WKGA 3TZNA 2QV5A 3AISA 4ORIA 2A21A 1EZWA 2E8ZA 3B9DA 4PRWA 1ZS2A 4L64A 1MNZA 3HMCA 4UWMA 4YS1A 3WUBA 4JCMA 3FDGA 3URBA 3MT1A 1PIFA 1XYFA 2DUAA 2PEVA 1RY0A 1J79A 4JX4A 2HS6A 4A29A 1E9ZB 3WEOA 1LL4A 1GVOA 4Q8MA 2G0WA 2DVXA 4ZOEA 1MEIA 4C1NA 3GNRA 5ABEA 5D32A 3B9EA 3K8MA 5CBJA 4V27A 1FCBA 5FAJA 2G37A 1BSIA 4MUZA 4I6KA 1E6ZA 4DZ5A 2A3LA 3WCZA 3EXRA 1P1XA 4BQ5A 2Y85A 1P6CA 2CPUA 3GBEA 2OFJA 2FYMA 1HXJA 1O5QA 1XWYA 5EMUA 4O12A 3VI2A 4H6RA 3S5YA 1Y5VA 4H7CA 3AQUA 4M19A 1ISZA 1UIPA 4JY9A 4W8AA 1C90A 1XBXA 3UG8A 1YPIA 2VEKA 5HMSA 4DI9A 1FP9A 2B4GA 3IUIA 3LG3A 2H3DA 2ZE3A 3U7BA 3OZYA 4ORMA 4P8VA 4UNIA 1AD1A 3GX9A 2J9YA 3AO0A 3AHZA 4RDWA 3CBWA 4WCJA 3WF1A 1O6IA 3P81A 1TR1A 2PCEA 1UC4A 2DZTA 4PR4A 2EXOA 1WOBA 3W88A 1TPC1 3DBNA 7ODCA 5DLCA 4N7QA 3WLMA 4IFKA 4LYQA 1OFBA 2WM0A 3LCXA 4JQ2A 3B05A 1N8FA 1NU5A 2G96A 2ZZ5A 4MUPA 4BA0A 2FPYA 4HMCA 1C3FA 3XISA 3EMCA 3NEVA 3AOFA 1LL6A 4IGMA 4AVFA 1BHGA 5MKGB 4KMQA 1M01A 1MZRA 1YLVA 4H8UA 3LXCA 1SO5A 3UD6A 3N11A 1KLYA 2XVKA 4NU7A 4RNFA 5SWUA 1E0UA 1QOXA 3OU8A 3WQCA 4PTVA 4WR3A 2Y5SA 1DORA 2ALRA 4MAVA 5HAOA 3TDFA 4CN6A 4B5XA 3FY1A 1W9XA 4PRTA 3W85A 3O8AA 1JDDA 1SO6A 1XUZA 1XRSA 2F6UA 3CZEA 1DTUA 1W2VA 4UNLA 3LPPA 4MJ2A 9XIAA 3KZSA 2HZGA 3S2MA 1JPHA 2O9TA 4O0KA 4LRTA 3NR0A 4BEUA 1XGZA 4F0RA 4C60A 4FLQA 5G4EA 3TONA 1AH3A 1NWSA 1RV8A 2DT1A 2IPFA 2ZRVA 1UD5A 3NQMA 2QCLA 3QTGA 1KFLA 2P3ZA 2AAAA 4E5TA 2PS2A 3GG1A 3P0XA 4PTMA 4N4PA 1PHWA 3U9IA 3G0SA 3BG3A 3NPWA 2CERA 4RE0A 4ML9A 1HVQA 4R9XA 1T8QA 4L6HA 2Z2UA 2ZZ3A 1ZRQA 3M5XA 5ABGA 3RN6A 3NQ2A 1CGTA 1E0TA 4GVGA 4FS9A 4H2HA 5M3WA 2A6LA 3S5NA 1LT8A 3C2RA 3DCPA 4LGXA 1MQQA 3TW9A 2QHAA 3PBWA 3STCA 3KZPA 4ZE5A 2PP3A 4QJ4B 1W31A 1BWLA 2Y6ZA 1FWDC 3OBKA 2CLOA 1IEVA 1UPPA 1BYCA 1FXPA 4GX9A 1XI3A 2XHYA 4JL2A 4HZMA 4QM1A 1JAEA 1FDJA 1U5JA 2HV5A 3DFQA 4Y9OA 1T6MA 4A22A 4A8LA 3MMDA 1G94A 1P1MA 1ZBWA 1ZL1A 1MW1A 1TFVA 4E3VA 1OC7A 4GUFA 2P50A 3AWOA 3KRBA 2EKGA 2QJGA 3B03A 4S3BA 5BMWA 2VQTA 3OB8A 3QHMA 4GFSA 2WMJA 1B9BA 1E3XA 4LYRA 1W9BM 4HIBA 3R11A 1GTEA 3BUVA 4LUTB 3ARPA 4DM1A 4GK8A 1M7XA 3S1GA 1FWIC 1TVNA 4G1NA 4FF5A 4A3UA 3RG6A 3WD1A 3N9KA 1ZP4A 4JTQA 3A4XA 1M9HA 3OZPA 5BU9A 3WLTA 1V3KA 2I9UA 3K30A 5LHFA 1WZKA 3MTWA 2EJAA 5HJXA 4JR5A 4CCZA 4PUDA 1V51A 3L4XA 1O60A 3O15A 3WQVA 4IMCA 3R6IA 2ZICA 3THCA 5BXSA 3NM3A 5G2WA 3UXDA 1E55A 3A5FA 3TTYA 2J8GA 4NHVA 1E40A 1XDLA 4C6IA 3LRMA 4OU1A 1FWSA 1X8FA 1GTHA 4K36A 1UQZA 3IIXA 1UP2A 2VFDA 4L6OA 1MW0A 1XIIA 1LOQA 3VIJA 4JPGA 1UYQA 3E0FA 1NTHA 1OFRA 1A5NC 4MY9A 1S5MA 4JZ5A 4V28A 4QG6A 3LM3A 3CJPA 4CQCA 4US5A 1JZ6A 4PB3A 3B8VA 3W7LA 1NH6A 2QYGA 4FXRA 4GRSA 1U30A 3T40A 1G4TA 3FXYA 3EXSA 5ECUA 3NOEA 1F73A 3KS5A 4JIQA 3QC3A 1A4MA 3FAWA 4P8WA 4C65A 5EPDA 3NQ6A 3KTSA 1XYCA 1ONWA 3PZQA 2YYTA 5GJNA 2PGWA 1XCXA 1PCKA 4MTVA 2FMOA 5CSUA 3U5YA 1ALDA 1WZLA 3ARSA 3VNMA 2Z4GA 4MADA 4YN5A 3AIQA 1NP0A 1GQIA 1FH8A 1V0KA 4GBDA 3GVRA 3RM8A 3ZR4A 1X96A 1OWQA 2XZ7A 4JFTA 3UPBA 4ZQNA 2V38A 1UG6A 3BMVA 2GYIA 3QFEA 3W53A 2NUXA 1B1YA 4NAEA 2VRQA 5D2WA 3SI9A 2QEZA 1BQGA 3EWXA 4PTWA 1XKJA 1JDAA 3WNMA 1HNYA 3NQDA 3E2RA 3UWWA 1Z44A 1PIGA 1H62A 2HROA 2G3NA 3PY2A 4H9VA 2QJMA 1MNSA 1UPMB 2LLEA 4PULA 5CEWA 2Z1BA 1LOLA 4OGZA 1W5MA 4I7UA 3F5JA 1XFBA 5B80A 2NXIA 1OYAA 1GONA 3BAIA 2XYLA 3VMOA 5E0FA 3WF0A 3TXVA 1HKWA 4TX8A 1OFEA 3RCNA 3CUGA 2E9MA 3WQDA 1F7BA 1RQBA 1OCJA 5LIWX 1IWAA 4JX5A 3EOOA 3UU0A 2A79A 3IIOA 4S3CA 3W29A 4RNIA 3P7YA 2A5HA 3ITCA 1I2QA 1HGWA 2Z6JA 4D8AA 4JTCA 3CUXA 3GUWA 2OX4A 3VKDA 2A1YA 4EE9A 1QHOA 2CESA 1VS1A 4O1CA 5XIAA 3SADA 1DV7A 3FCPA 2BTMA 2XSBA 1E1CA 3W7DA 3JR2A 3SRKA 1VBHA 1FFQA 2G97A 1QT1A 1MZHA 3V18A 2QDEA 2OO0A 2PDCA 4GQGA 4UB9A 4DO7A 2P76A 3EWZA 2W9MA 1V08A 4DUWA 2J8TA 5U4NA 3M43A 3IJ9A 2WLYA 3RYSA 6TIMA 4AVNA 1KTCA 1CGYA 3M7SA 4NAFB 4N9DA 3FOKA 3TYAA 1RD5A 1REQB 3ITOA 5JH1A 4NASA 1JUKA 1CGUA 3UPMA 1EO5A 3DFTA 2YL8A 1DXIA 3ARYA 4UFJA 5E1QA 4B91A 1EX5A 4PSPA 3ZVIA 3PG9A 2QV4A 4B4HA 2PWEA 3GDMA 1OB0A 2QUMA 2CETA 3CV1A 1YNYA 1RHCA 3CYVA 3VFLA 4IUOA 2IXVA 2VENA 3GXMA 3J7HA 3OO2A 4HKPA 3LTYA 2NZLA 3WQ6A 5CZ0A 3MWAA 4AC7C 3MBDA 2YYUA 1V3LA 2XWEA 4HPXA 3WDRA 1VGAA 4AVOA 2ZZ4A 2VDHA 4NRRA 3S6TA 3S2CA 2YPIA 3PTDA 5EFFA 3AS3A 2YBTA 4DEFA 2E5BA 3FK4A 1VZWA 1KCKA 4JDBA 3UNDA 4PMOA 1X6UA 1OD8A 2WVVA 2JGYA 4XD5A 1D2KA 1AL7A 4FR6A 2GVGA 4NIRA 4WJ8A 4LOCA 4KF1A 1ENUA 4IL0A 3UF9A 5FCZA 3N4AA 3IUDA 4HBKA 2XU2A 4HOXA 4O0QA 2YDAA 3C2FA 1XC4A 4CU7A 1KFJA 3PZIA 2VEPA 4NX0A 1FCVA 4GGHA 5CJMA 4MZYA 1W5PA 4GFIA 2ZUTA 4PL1A 4DLFA 1YQ2A 1YTEA 4DF0A 3OQEA 3PPCA 4UQEA 3KP0A 5EMLA 2J66A 3WNPA 1R3VA 1KM2A 4FX6M 3R12A 5RUBA 1IXNA 3GTHA 4FNSA 3T2OA 4M3PA 4YU1A 4Q4QA 1YTDA 4ZVJA 3MBFA 1M1BA 3LNMA 4W9TA 3TW7A 4H8HA 1GQKA 3EB3A 3TN3A 3V75A 1ZUAX 4EXBA 1S38A 4EF9A 1AVAA 3PBYA 1QHPA 5ECVA 2XWDA 3GDKA 3QW3A 3BJFA 1FFRA 3W25A 2E7FA 3VM5A 4CD6A 3W1NA 2X8RA 1LBLA 5EB8A 2WJEA 1XICA 1V6VA 2H8XA 2XN1A 4H1ZA 3GFYA 1BYDA 4CUCA 1BXNA 4GX8A 3A3HA 2CHNA 3WD4A 3NQ8A 3ONCA 1CT5A 1SW0A 2V5LA 4D6FA 4C7GA 3CHFA 3DDMA 4XB3A 1CDGA 1QNOA 5GJMA 4CNTA 2AL2A 4CVWA 1G4SA 5CSRA 4HMDA 2G50A 1OT1A 3BAJA 5D9NA 2DP3A 3FYOA 4Q33A 1R0MA 3RX2A 1VFOA 1GOIA 2FVKA 5D04C 1A0CA 1KB3A 2IUZA 4RZ6A 3MSYA 1K9TA 1LWIA 1CCWB 3MS8A 5FAGA 3QHOA 1IR2A 5BCAA 4MNKA 1K6WA 1R8LA 1JPIA 4H7ZA 4YTQA 3HO8A 3OLDA 2FVMA 4LX4A 2PDPA 5L9FA 4RZ4A 3W7NA 4GNJA 4PUMA 4FNUA 1Z69A 3NXLA 1NSJA 4LF1A 2YZ5A 4M80A 3OIXA 2V5CA 4LUSB 1W0MA 1HO1A 3WLPA 2W6RA 1TMLA 3HJZA 5A8OA 1EGMA 1A3HA 3VZXA 5T91A 3DUGA 2A7PA 4Q4PA 2WCGA 5M17A 2IKJA 4G8TA 1UROA 1QPRA 4HHPA 5AYBA 3BG9A 1Q45A 1OF8A 3K46A 3NDZA 1HFBA 2PP0A 4YCPA 4U31A 1JI1A 2F7FA 2ZX9A 3N04A 3T7VA 3VINA 3CPRA 3GWQA 1CX9A 1S1RA 4B3LA 1TJ2A 1US2A 2YCLA 4AYSA 3KBWA 2FZNA 1LBFA 4MJ4A 5I77A 1PJ9A 4LUIA 1GQNA 2JKPA 2V2DA 1XJBA 2BASA 2FFIA 3QHNA 4AH7A 1FDZA 2ODOA 5KZDA 3FEMA 2B81A 3XIMA 1YDVA 3GXNA 4M7TA 3W00A 1ICPA 5I02A 4MJZA 2HE5A 3UGRA 3BTNA 1XSKA 3STFA 3WENA 1DJZA 2BXYA 3UPWA 4PCSA 1WB0A 4J3SA 3JRKA 2AGTA 2O9RA 4N02A 3WD0A 1CB7B 2XH2A 1XPGA 3CUIA 1XBZA 2HXTA 3H26A 4TX6A 5A6BD 1TWSA 4DAFA 2MNRA 3TCSA 3M0KA 4JBRA 3WZ0E 4OKDA 1PTDA 1KRMA 3QSRA 1GQJA 5C7HA 3FDKA 4P61A 4GC4A 1LRTA 1QRQA 2WSYA 4O52A 3G1DA 4PC8A 2WPGA 5F2LA 1FVPA 4JTRA 2WMFA 3A9IA 4EK7A 3LDVA 3PS7A 4QEEA 2Z2AA 3U2EA 3UQNA 2HVMA 4XVDA 1E43A 4XX6A 3W7JA 1H7OA 2GDQA 1YBQA 3VCCA 2VCBA 2KX9A 4L65A 2FDSA 1YMYA 2JE8A 4ERAA 2DW7A 3VGEA 3KOFA 3UCCA 4Z1DA 3N12A 3GS6A 3O3RA 2J47A 4V1YA 4IP7A 1I4NA 3SFWA 3BV4A 3TOYA 2P0OA 2Q71A 2VEGA 4MWAB 1H5VA 3VGBA 2FVLA 1S2AA 3N9SA 1WOAA 1LP6A 1PUDA 1Z7AA 3AZSA 5CSSA 4C6FA 1FWHC 5HWMA 5K9CA 4ZQCA 3NNTA 4NUWA 3K5XA 1SSDA 1RK6A 2ZUUA 4GD0A 1R3SA 1QVBA 1J5TA 1EF3A 4W93A 4KS0A 2J74A 1EDTA 2RDTA 3LXAA 3H53A 4A8RA 4S3GA 4LB3A 1EJVC 5I6SA 4QQUA 4QTGA 2XIBA 4FNQA 3QQWA 4XG1A 3GXPA 4C5YA 3S0CA 1ISYA 1R9ZA 3UJFA 1RUSA 4PUJA 1EOKA 3HQPA 1EP3A 4GI8A 1NOUA 1PKMA 1QO2A 1ODZA 3MI6A 4QS5A 2XG9A 4Z17A 1ZJIA 1NIUA 2X7WA 1JQVA 3A4JA 1FWEC 3BLPX 1POJA 4B3KA 1LRNA 1T41A 5HXMA 2GSEA 2ISVA 5I3DA 3E3HA 2UBPC 4C1LA 1CXIA 3M47A 1Q6GA 4R53A 5HJLA 2FGZA 3NO5A 5FF0A 1SZNA 1M7OA 3UESA 3UNTA 1JR1A 2HBVA 2DIJA 4ATLA 5KITA 3TLLA 3PB2A 4J1OA 4R3UA 3TTSA 1ONEA 1D9EA 2Y8VA 3Q94A 2GQ9A 5FIPA 1BEUA 1TX2A 2ZFAA 4PFHA 4A35A 1DJQA 3HG2A 4PSRA 1NF7A 3C4UA 3AXKA 1P7TB 1JEZA 3A21A 3M0LA 2DZUA 1MRAA 4FXJA 1V03A 1QTWA 3SSJA 5DX7A 3UCDA 2ACQA 4IJCA 3EX1A 3HOJA 1ZCOA 1F3EA 4HYWA 4IIBA 4ZXOA 3INPA 2OQLA 2BWGA 1G7VA 2OTDA 4BK9A 4E8CA 2WLZA 3C61A 1WKDA 2XGZA 3B4UA 4M6UA 3S6DA 5E9AA 4JKMA 3D46A 3HQ1A 3O0KA 1C9DA 3EWYA 3OZMA 3QM3A 2ZZ6A 1FWBC 3FIGA 2GLKA 4IPNB 2QCNA 1YXYA 2OG9A 1GVEA 4GCAA 3B4YA 3EWBX 3G3MA 2NUWA 3B06A 5LA1A 3ABZA 5FJTA 1Q8JA 3AAMA 2FJUB 3L0KA 3UXLA 1O5KA 4LS1A 4XBKA 5JBEA 5F1UA 5G1MA 1AW1A 3W7KA 4TX9A 3UJRA 3SCTA 2ISSA 3G1FA 4LS2A 4KERA 4MY1A 2PRMA 1MO0A 2E25A 1ZGDA 1TWIA 1HJWA 2X1UA 4ZSTA 3S5ZA 3QBUA 4K1WA 3G77A 3KDNA 3APTA 5A6BA 5EYWA 5DMMA 1D3HA 3CLMA 1MEWA 1TCDA 2DSZA 5AC5A 3PUEA 6ENLA 1LUCA 1E56A 5HQEA 3TC7A 4U28A 6XIAA 1E6XM 4MLRA 3OHMB 2G3FA 5H2ZA 1DHKA 1HJSA 4QJ3B 4D6IA 4GO8A 5KMYA 2OZ8A 3CV6A 4J3VA 1KKOA 4I3GA 4WDWA 3I4KA 4CGTA 4C6QA 4KWSA 3BGGA 5K4ZA 5C9ZA 4XAGA 3RLHA 2OWXA 3VE9A 4ZR8A 2ZTJA 4Z0SA 3S9IA 3NYDA 3ARTA 4JYDA 3HPAA 3N1AA 3EKGA 1RBOB 3G2GA 3O16A 4K3ZA 2NVCA 4GVIA 3LZ3A 4IIHA 3WDPP 4UFKA 1BWKA 4ZTXA 5A6TC 5LNWA 2GK1B 2WZMA 3QVQA 4X22A 1TUFA 4D71A 3WLQA 4H6QA 2DSVA 3EDKA 3W1TA 3NZ1A 4RDZA 1W3NA 2J4GA 1FP8A 3GVQA 2QDDA 1XSIA 9XIMA 1RK5A 3L5MA 5E0CA 5C5YA 1RJRA 3PPFA 2XH0A 4S2CA 4XUYA 1AK5A 1N8IA 1EIXA 1V3HA 4IF2A 1VHCA 2E1WA 3MMWA 2XTKA 4H19A 4D1JA 4HTBA 1F07A 3R8GA 3M0IA 1BAGA 3WH5A 5FEWA 1XH0A 4E4PA 3ENLA 4DUVA 3FLUA 5I23A 1S39A 1NQ6A 1VCGA 3OYZA 3ITLA 1XG3A 4DNMA 3VCNA 1PO9A 4Y90A 1SVDA 2X1RA 4Y9PA 3BAYA 2VR2A 3VIFA 3N2MA 3TIMA 4Q4RA 6REQB 3LU2A 2ISWA 4DF1A 2D69A 3W70A 4Q3MA 4F9JA 2V5KA 4NY2A 4ZO6A 4DJDA 3GM8A 1IGWA 4XZBA 2PLMA 3Q4DA 2XH4A 3TC3A 1C7TA 3MZNA 1DIEA 5IHRA 3CUZA 2X42A 4R85A 5AC8A 4DI8A 1K7FA 3ANVA 3G1YA 1TTIA 4LUJA 1UKPA 3S9ZA 4ZGYA 4I7WA 3WDJA 3VILA 4JTFA 3P60A 7XIMA 2QCMA 2E4TA 3QFWA 5IHSA 2REQA 4PTNA 1EFZA 3R1ZA 4WKHA 3NQCA 3GIYA 3W6LA 3ONBA 2W27A 4ZB5A 1OINA 4RX0A 3DU0A 4O1FA 4TUFA 5BXTA 3AZRA 5HDRA 4MNMA 1EXPA 3WH7A 1OYCA 2PSNA 1KCLA 4PUEA 3FEQA 3LLXA 1D7KA 4V2XA 3VOJA 2QVHA 1JNDA 3VU2A 4O57A 5BXRA 1MYRA 5AKQA 1DJWA 1SW7A 4L5ZA 3LTSA 5A8NA 2DY3A 3ZOAA 4F0SA 4YTSA 1A53A 2KAUC 3VVGA 1B90A 3W72A 2WMIA 4HJFA 3TYDA 5J04A 2PC4A 4FB7A 4S39A 2BP1A 4OV9A 1ISXA 4LV4A 4I6VA 6A3HA 1ZPTA 2J9XA 2YB1A 3SIZA 4UTJA 4LVAA 3UR8A 1EEPA 2GSJA 1DWAM 3UY8A 2VX7A 1M65A 4RL3A 1KBBA 2VWTA 1XRTA 2GZXA 1R85A 2R8WA 1K4GA 5G2IA 3M1ZA 2J79A 3FSUA 5K2ZA 4CEXC 2QCCA 5AY7A 1RP9A 3GXDA 2DORA 1A3WA 4A4AA 3V1HA 1RXOB 5CG0A 1PTGA 2HNHA 4J3ZA 1OFOA 1YXCA 3W3OA 5CJ5A 1KR0A 4D6DA 1PZ1A 3KW3A 3GW0A 3KCLA 1KXHA 1E1EA 1M3UA 1B3WA 1W91A 2WHKA 4RKAA 4RPQA 4PMUA 1UKQA 4CNOA 4RCXA 2OLHA 3WG6A 3PWAA 2QF8A 3O07A 1LYXA 2GWGA 4AC1X 1MUMA 2O92A 1OC6A 2GGGA 1UWRA 3UETA 3NQFA 1B3VA 3ICJA 4LBUA 5DXYA 3F2DA 3WDIA 3FVMA 5JXQA 3HF3A 3I10A 3JS3A 2QPSA 3H24A 1BRLB 3OJGA 1OABA 3A4AA 3GC2A 1HP5A 2OEKA 1TWWA 2ZX8A 3L4UA 1RPXA 3CQJA 1KNWA 3TW6A 3DC8A 1P4CA 2O7SA 3NFUA 5EGRA 1UH2A 4R7WA 4DJED 9CGTA 2G4FA 1AJ0A 3CAQA 1HKJA 1IT8A 3EOSA 4P7OA 3OGRA 1WCGA 2VZUA 4MGGA 4M1BA 1SUXA 1TJPA 3VMPA 3HTWA 3SCUA 4GCXA 3LQGA 2I57A 2NT0A 3ITXA 3KBNA 4UTUA 4LY4A 4JTEA 1KXTA 4J7RA 1PWLA 4ZOCA 1L8NA 3QY8A 5CLWA 1AQMA 2J27A 4ACZB 3APGA 3SW6A 1MEHA 3GE7A 1V77A 3BZGA 3NDOA 2DT0A 4BZYA 1EDGA 1NWUA 3QV8A 2GVJA 4W7VA 4DWSA 1A49A 2A3HA 4E4FA 2PDIA 5DCEA 1VCFA 4GQQA 3WN6A 3UFYA 2XISA 3ZVHA 1CGXA 1T0OA 1H1NA 4HN4A 3OBAA 3OBEA 4K39A 3VDCA 5JIPA 3QXBA 2CLHA 1PKNA 1UOKA 3REQB 4LV9A 3P62A 2EBNA 5K9DA 4JIIX 2ESCA 1VKFA 1KCXA 4AHOA 1GOXA 3T0DA 5GNXA 4IIDA 2YA2A 2PDKA 3PZNA 3AXMA 1CXEA 3GO2A 1VHNA 2DUZA 3VDAA 4W85A 2CKRA 2JIWA 5I3GA 1F9CA 3H21A 2EPLX 3UYCA 3Q37A 1YXDA 3CNYA 5D2XA 2J25A 1GOKA 2VD9A 3MCOA 2PDLA 4QJ1A 2EPNA 3BG5A 2PDWA 4MWAD 1KRAC 4B15A 3LYEA 4UFMA 3TEVA 1HJQA 1JAKA 5A8PA 2VZOA 3CK5A 3PNZA 1XLMA 3MDWA 4CQ9A 4JIEA 4WK9A 3KDOA 1BXBA 1QW7A 4FZIA 1IWBA 3EOEA 3VIGA 3THUA 1CWYA 4C5ZA 4PMDA 3LPOA 2C1HA 3BSHA 3UERA 3UZ5A 1Q6CA 3W1MA 2FB2A 7REQA 2HRWA 1WDSA 4BF9A 2W5FA 3LXBA 4K2SA 6CGTA 1LOSA 3KE0A 4UQBA 1T40A 1HP4A 3UG5A 3PZVA 2OYLA 2CZEA 1VF8A 1WQ5A 2JK2A 1X97A 2FGBA 3DFSA 1BFNA 1PX4A 1W9PA 4BKNA 2QMJA 4QJ5B 2OELA 3A13A 3C2YA 1S2WA 2HK0A 2G4JA 4HU8A 4X61A 2J7FA 3GU9A 4HZ6A 4IMGA 1LT7A 1BTCA 3NQ7A 2JIEA 2EHHA 3YPIA 5G5IA 1VEPA 4MFDA 3QGVA 4IMAA 3WJZA 4UTLA 1K1DA 3BXWA 4Z2KA 2X0HA 1G01A 3L5LA 4QE1A 3PJWA 2R91A 3U6WA 2J7GA 2HVNA 1RH9A 3LPGA 4JS3A 1DXEA 2DSWA 2DV0A 4N9CA 3SR7A 4PMNA 4HNVA 1ZJBA 3A12A 4QDWA 3MSGA 3TJIA 3RNDA 5D37A 1EGVA 3T0CA 5FEZA 4J27A 3THQA 5F2GA 1I45A 3H2NA 3PUDA 3URAA 2PDUA 3MUIA 4Q7BA 3E1F1 4HN8A 3WBYA 3KRUA 2ZRYA 4GH3A 2AAMA 3ARUA 1TVLA 1RCOB 1XISA 4KQNA 4AW7A 2HPIA 3LHVA 3W86A 1LQAA 1JD9A 2D73A 4WDUA 1CECA 1ISVA 1LCOA 4JAWA 2OKOA 4QSFA 3RAOA 2ZWYA 3BCFA 4AZIA 3NVDA 1Q63A 4JEQA 3N9RA 4Y8FA 1XL9A 4KWOA 5D2YA 1GWJA 3QLDA 3OGVA 3GXFA 1F3TA 2I14A 1BVWA 1UR0A 2DZXA 4F0LA 1BYAA 4PUUA 4IMEA 4KETA 3WQWA 2ZX7A 5C9WA 2XIMA 3MP4A 5LIUX 2Y24A 3WQ5A 4TV6A 1U33A 4W7WA 3W7HA 3UVIA 2E5CA 4CCDA 4QNEA 2RJGA 1YEYA 1QHZA 2FMNA 1ZENA 2G3IA 3VDHA 3N3MA 1Q6OA 1SZGA 4P7LA 2D23A 1EWDA 4YJ5A 2GJNA 3TROA 3O7UA 3W1AA 1QASA 1IT7A 4LAMA 4AY8A 3N3TA 1Q6FA 1E72M 1DWHM 2HCVA 2ACSA 3VA8A 1AUSL 3EDEA 4YVPA 5FEPA 4QCFA 4Q8WA 4LF2A 4YL2A 4BQ4A 1J12A 4AYGA 3BW4A 5D33A 1BQCA 2FIQA 1PZ2A 1P0NA 1H51A 4D6JA 5M5DA 4AZGA 3CQKA 1OK6A 2FJKA 1XLDA 3C86A 4XZWA 2QAFA 3SUTA 4HU4A 3WF3A 1R2TA 3AICA 1XIBA 2OQHA 3VD7A 2WWDA 3TJLA 1KA9F 4S3EA 4KBXA 5FJRA 1XLHA 2B7QA 3QSTA 3FA4A 1E1FA 3E74A 3R58A 4UC5A 2HJPA 4NYUA 4M51A 4CEUC 4R34A 3TH6A 4YNGA 4KGJA 1POKA 1BVNP 3BCDA 4H6EA 5HOSA 5ENLA 1LZOA 3VNZA 2TMDA 2VGGA 4LTSA 4B16A 3AU6A 3T55A 3ANUA 4AZCB 5A6AA 1SR0A 3QGKC 1PVNA 3KHDA 3D3FA 3WL0A 4CU6A 2XGBA 1AH4A 1VC4A 3WLHA 4LCRA 2ON3A 4HNUA 1A0EA 1WUEA 3NZRA 3UJEA 4BHYA 4EPEC 1R6WA 4N6EA 1IWPA 2QJHA 4WX2A 1BKSA 1JCNA 1SU5A 3N4EA 2V9DA 3I6EA 1SFSA 3VMNA 2A3CA 4DX3A 2A3BA 1E9IA 1C8VA 2E77A 1YNQA 5CH9A 3FGCA 5J5DA 1E6RA 4MB4A 4UQDA 5MHBA 2R1PA 3EX6A 1O5XA 1QW8A 1R86A 3AIUA 1TJRA 4JTTA 3BOLA 3VOIA 1D8WA 3TYZA 5HMDA 1NF0A 2GJRA 2W92A 3L65A 1CYGA 2WB5A 1T5AA 4UQAA 4R33A 4H4IA 3VFCA 3QZAA 2OT0A 4EWJA 2BV9A 4H01A 4DJFA 1MW2A 1E0VA 2VQUA 4RK8A 1PZ0A 1JXJA 2YL5A 1CBGA 4NJJA 1PZ3A 4M1RA 3TE9A 1XG4A 4EPKA 3CAKA 3LCWA 2OYKA 4G9PA 4XUGA 3WLIA 2OO6A 4YHEA 4U3CA 3L4WA 2YL9A 1OZQA 5DY2A 3NSMA 1VFUA 1HJUA 3DEQA 3BOXA 3T1GA 3NQVA 2IXUA 1H1YA 3VGGA 4DXVA 3JU2A 2FHCA 2DVUA 3TTQA 1MXDA 4O19A 4GUGA 1W9UA 5HK4A 1DP0A 1LORA 3R79A 4JICA 3CM4A 1FA2A 3BMXA 3IJ6A 3CWNA 5LA0A 2BODX 3ALGA 2X1TA 4AHQA 2O7QA 3W7IA 3JVAA