1QPKA

Mutant (d193g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFGFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords PROTEIN (MALTOTETRAOSE-FORMING AMYLASE)
total genus 145
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qpkA01
1E70M 1OBAA 1H5VA 1E3XA 5C70A 4U3AA 2ZUNA 4P8VA 4F66A 4DM2A 1XV8A 1KXTA 3VU2A 5FD0A 4MB1A 1V02E 2DPEA 4MNKA 4OGZA 4R27A 4JKMA 4AWEA 4UTFA 4IPLA 3GH5A 2WMIA 2XUCA 4CU6A 1E0WA 4UQBA 3G6LA 2ZX6A 5I23A 4EANA 5A8QA 3VDHA 5A8OA 4CGTA 4AZCB 2GJXA 2XSBA 2VMFA 4PMVA 5DT5A 2OYKA 2A3AA 2X8RA 1HNYA 3W25A 1D2KA 2XFYA 5A2BA 1SMAA 1QWNA 2XN2A 2C0HA 4J3VA 3EJUA 2D23A 4PTVA 2YDRA 5A8NA 4OJYA 4W5UA 1TQSA 1NOUA 1LL6A 1UWUA 1R34A 3GH7A 2ZXAA 4UFLA 4CD8A 3D52A 3LXBA 3CUIA 4AY1A 1V3JA 1LG2A 1UD5A 1NOWA 4MAZA 1G94A 4YN5A 1HWWA 2GVYA 1RP9A 2XIBA 3SCOA 2X0YA 1JZ7A 2B31A 1QI3A 3AFBA 1XD0A 3PZVA 4AD1A 5M5DA 1QW9A 5AC5A 2FE0A 3EJRA 5IDIA 4D6JA 1J0JA 3MU7A 5A94A 1B90A 2YFNA 4DUXA 5A69A 3VMOA 1TVPA 1GUVA 3AI0A 2UWFA 2VZUA 3VOCA 1V02A 4CU8A 4XZWA 4GQRA 4J27A 2XN1A 1H41A 1HVQA 2WBKA 3GZAA 2YA1A 5BXPA 5D9NA 1QHPA 1CLVA 4FNPA 4CD5A 3RDKA 1B3YA 1WPCA 4J3XA 5M3WA 2J75A 2BHZA 4ZXLA 1E1FA 3QHMA 1CGWA 2DQXA 3SURA 4ATLA 1W2PA 3WD3A 2ZUWA 1OINA 1BYAA 1BG9A 1HN1A 1NQ6A 3B9DA 1NP2A 4CN4A 2WBGA 2XHYA 3AHVA 1E5NA 2FGLA 5AYIA 4EK7A 3WDJA 1EQCA 3L4YA 2WWDA 4GZIA 3HG4A 3B9AA 1RPKA 2ZXDA 1XYZA 1QOXA 2F7PA 4NZJA 4Q7NA 5CLWA 1UKPA 1J0YA 3VKKA 3F5JA 2EQDA 2GDVA 1M03A 1G01A 4M29A 4P8WA 2YLAA 4IISA 1W9PA 1CWYA 3VIHA 3VIMA 2X09A 4E8CA 1MQQA 4BQ4A 2VZVA 4TX6A 1JDCA 1UG6A 3BVVA 2W91A 5E70A 3WELA 3T0DA 1WKYA 4FNSA 1E4MM 2XG9A 1H11A 4F9DA 3GM8A 3N04A 4KH2A 1UD6A 3UEQA 1W91A 1JYXA 1FH7A 4TVUA 4C7FA 3AXHA 1W1YA 1WNOA 4Y7EA 3GXIA 1O7DC 3QHOA 5AY7A 1VB9A 3L4VA 2C8NA 5BROA 3WNPA 1GHSA 1HJVA 5FKYA 4BQ2A 2W4XA 1VFMA 1CGXA 4V27A 1CGYA 3S5ZA 4MAVA 1EHAA 1M53A 4W85A 4LPCA 2ZUTA 4MB3A 3SUVA 3BUQA 3WUEA 2BY0A 4AZ7A 3VVGA 3KE0A 1BYCA 4P7LA 4W7VA 3O9NA 2VZSA 1E72M 4DO4A 3BC9A 2V3EA 5KEZA 1IZJA 5DMYA 2Y24A 2CESA 2VR5A 1Q6EA 3W0KA 3VD3A 4CU7A 2WMGA 3ZSSA 4ATWA 3D5HA 5JBFA 1M01A 1R47A 3IAQA 1JXKA 2OWWA 5I78A 1JZ8A 3L4XA 1HP4A 2J77A 4CCCA 4MNMA 4M1RA 2A3CA 4H8VA 3L4TA 1IT0A 3KWXA 5D9MA 3NSNA 2O9TA 1BVZA 2PWHA 2XWDA 1E6SM 2QPSA 5C71A 4ACZA 5EFDA 2J47A 3LX9A 1VEPA 4FMVA 3MV01 3CHFA 5BXTA 3NSMA 4WLCA 1LWHA 3GNPA 3W26A 3WY1A 1VRXA 2QV4A 3OLDA 1J0KA 1UZ4A 1NH6A 5IFPA 2GFTA 3ECQA 1HKJA 1PEZA 3IAPA 2CCRA 1WZLA 1BFNA 3WEZA 1XH1A 1OD8A 1OGGA 3VDCA 3EDEA 2F7RA 2VOTA 3LXAA 2F7QA 3M07A 3OLEA 4LX4A 2V3GA 3VIKA 1K9EA 3PZIA 3SCVA 1DWFM 3GDBA 4F9JA 3BXWA 4AMWA 3MV11 4D6FA 4GZEA 2WW5A 4M80A 4EAMA 2BV9A 3ARVA 1GPFA 2CXGA 1GOQA 2JF6A 2WMFA 1Q4NX 5I0DA 3WF0A 4UZUA 4TTGA 2JALA 4W5ZA 1W2VA 4GKLA 2RGLA 2NT1A 2WNWA 4P8UA 5CPTA 3T2QA 2PWGA 8CGTA 1FH9A 3GXTA 3DDFA 1E4LA 4HU8A 1ISXA 1C90A 4D71A 4HZ6A 3CPUA 2XJ7A 2F2HA 3BLPX 3KL5A 4MADA 3W53A 3JUGA 1YQ2A 3BVTA 2J7DA 1UWSA 4AISA 1H0IA 1WDPA 5CG0A 6TAAA 2FGZA 5A6BD 1XSJA 1MXGA 5GQBA 2ZICA 4QLKA 4KGLA 4GIAA 1E56A 1J18A 2F8QA 1FFQA 3CUFA 3A4XA 4OBSA 4PMYA 1WZMA 4D6HA 4ACYA 4U5KA 3QR3A 1PX3A 3SUTA 2Z1KA 1VFFA 3CZ8A 1VAHA 4QDMA 1HKMA 2YBTA 1TA3A 4ACZB 2WCAA 1GOWA 4OIFA 3D3AA 3RO8A 2WHLA 4BQ3A 3BMWA 1JZ5A 2PI6A 1CXEA 1E15A 5BXSA 1UKSA 5HOSA 1VFUA 1M04A 1I1XA 3U5YA 2O9PA 4AD2A 4UQCA 1CXLA 3CLWA 1W9BM 2VRJA 3CHEA 3MSGA 3GBDA 3PZUA 4KWUA 4W8LA 2PC8A 4F79A 1WDRA 4WKHA 2VCAA 3VGBA 4D6EA 1CGVA 1KBKA 3GH4A 3EDDA 1ZL1A 3GXNA 2YL9A 3N1AA 1CXFA 1V3IA 1FP9A 1OIMA 4W87A 3WUBA 1GJWA 4MTVA 3WDHA 1W3KA 2WK2A 2RGMA 4TUFA 3MSDA 5D9OA 1FH8A 2EACA 4IPNB 3CZNA 3S5YA 1LJYA 1E0XA 3PN8A 3WF1A 4Z2IA 1SYTA 2XTKA 2DSWA 2YL6A 3TP4A 1MVYA 2EPNA 1C8XA 3FHAA 4W7UA 3IJ8A 5A1AA 1JZ6A 2EPKX 3HG5A 4J3UA 3KL3A 2VR4A 4MJ4A 3N9KA 3AIUA 1GJUA 3ARXA 2ZE0A 3GXPA 3LRLA 3ZT5A 3CV5A 5EB8A 1GOIA 3VSVA 5A6BA 1J0ZA 3VMNA 1MFVA 5E1QA 2J74A 3D4YA 2ZX9A 4AD5A 1CEOA 5JIPA 1CNVA 2IUZA 4U31A 4KGJA 3EJTA 1ZBKA 4BS0A 1R7OA 4UOQA 5CPSA 2DT0A 4X0VA 5ABFB 1HJSA 3LPPA 2VC9A 1KTBA 3DX0A 1QWUA 1G0CA 4HMCA 3MANA 1UD3A 2V3FA 3AICA 2BVDA 3CZSA 3QHNA 4IUGA 1O6IA 3DX3A 1SFSA 4WSJA 2CBVA 5CQ1A 2VCBA 3H54A 2WMJA 3K8MA 3AXIA 3NIYA 2VT0A 3SEPA 3VNZA 4FLSA 3W24A 4AZCA 1MW2A 3ZSTA 3QOMA 1LG1A 3ARPA 1GQIA 3VM7A 2ZUSA 3ZJKA 1EGZA 1X6NA 2X1IA 4FNQA 3AMCA 2YA2A 2X2JA 3CIVA 1PBGA 3OGVA 3AHXA 1JFHA 2OW7A 1US2A 3WDPP 2YDQA 1G9HA 3AS1A 5A2CA 4AZGA 4U3CA 1GQJA 2OYMA 9CGTA 1PX8A 4MJ2A 1LWJA 1C3FA 2WLYA 2E8ZA 4QLLA 2AMGA 2VZOA 3WDRA 3WD0A 4BF7A 1DHKA 4UFIA 5HNNA 1R75A 3L2MA 2YIHA 2OSYA 2PBGA 1QNQA 2FHCA 1WDQA 4JHZA 4NRRA 3A3HA 3QOKA 1JXJA 4V2XA 1G5AA 2NW0A 4UR9A 2G8ZA 4AIOA 4IM4A 1ECEA 2NSXA 5ABFA 3O6AA 3B9EA 2YLLA 1DTUA 1NM9A 2VJXA 1VEMA 1J01A 4W84A 1OWQA 3VINA 3CHDA 3MI6A 1E1EA 3WH5A 2ZXQA 1UWRA 1ZBVA 2CHOA 5ABHA 3RIKA 1R86A 1K9DA 2WXDM 3LRKA 2PF0A 1C8YA 2YA0A 3LMYA 2AOSA 3HMCA 1KQYA 4NRSA 4AXNA 3W6LA 2D3LA 4TOQA 3KZSA 1KXQA 3VDAA 2YL5A 4HMEA 5HXMA 1NOFA 2HISA 1U2YA 1PX4A 3PBGA 1V6YA 1E40A 2WCSA 4OUEA 1GQKA 4X0NA 1FP8A 1UYQA 3DYPA 1GVIA 2VTFA 3L4ZA 1HXKA 1HJWA 1UR4A 1A3HA 4GO9A 3CUGA 1J0HA 1H4PA 4WJXA 3BAKA 3EMCA 3GBEA 2W5FA 2X2YA 4AEFA 2QMKA 1UWTA 2GK1B 3ARSA 3O2LA 4ZE5A 1HL8A 3ZOAA 2GJPA 2YDSA 5A3HA 2XVNA 3BH4A 3L4UA 4UCFA 3FW6A 2D24A 5A8PA 1VBUA 1PZ3A 2XGIA 1XCXA 1XSKA 3WN6A 3SCUA 3WUGA 2WC3A 1NWUA 2A3EA 3NDYA 2ZUVA 1V6XA 4MNLA 1KWKA 3TTYA 5ABGA 4H41A 3BCDA 4UFKA 5GPRA 4PTWA 4CN1A 1QI4A 1VBRA 4W7WA 1MQPA 1EIBA 1FFRA 4GO8A 4WF7A 1H49A 1W3JA 2IXUA 3UETA 2GK1A 3NUKA 3UG3A 3AROA 4LGXA 2O9OA 1GQLA 3A47A 3M6DA 1OGBA 4WSKA 2BHYA 3EMZA 4XZBA 1GVYA 1OM0A 4W89A 5EFFA 3BUDA 3WNOA 3H55A 2EAEA 4W8AA 3SCNA 2ZX8A 1RP8A 2W63A 3OGSA 2BXYA 3ZR5A 1GCYA 1HJUA 1JZ2A 2ZX7A 2V5CA 5A6SA 3WNKA 4ZFMA 1TUXA 2WB5A 1DEDA 3ZQ9A 3WQ5A 3SCWA 1FHDA 3BAIA 4W88A 1T0OA 4AD4A 1E9LA 1KCLA 2WVUA 2CHNA 2JEQA 5BWFA 3K4AA 3EJPA 2GJRA 4J28A 3HJEA 1JYNA 1E6QM 3KEHA 3THDA 2E9MA 1UR9A 1V3MA 1W3LA 3CMJA 5A6KA 4XUYA 1HT6A 3WDQA 1CXKA 3OLGA 1JNEA 1PZ2A 2J8GA 3WL0A 1F4HA 3WBAA 1W9VA 3IGUA 3WENA 1VEOA 3BUPA 4TVDA 4RE2A 4UQEA 1TFVA 4GI9A 3I3DA 4CUCA 3LPFA 2J7HA 2DDXA 3AMLA 3WD4A 4JFSA 2WAGA 4CCDA 5HDRA 2GSJA 5IHSA 2BS9A 3S2CA 5AC4A 5CGMA 3WKZA 4JKKA 1DWAM 5A8MA 4JFUA 1R7AA 4RL3A 6A3HA 3W6MA 1UA3A 2J7CA 3G6MA 1H0GA 3PZGA 2E0PA 1C7SA 4ATDA 4K68A 5FCZA 4CVUA 1B3VA 1JAKA 1CBGA 4EKJA 3SUSA 2BXZA 2D0GA 2XVGA 1TQVA 3DX4A 1BVNP 1OB0A 2BY1A 1XSIA 3DYOA 1GORA 2EBNA 2FH8A 2VX6A 3IJ9A 4M56A 4JFVA 3VTRA 3AIQA 5M17A 4FNTA 1TR1A 2UY4A 5E0CA 4DWSC 1OT2A 5I6SA 5LA2A 1UR1A 5IXEA 2YKKA 3QGVA 3AISA 3NSXA 4JCLA 4JZ5A 1UOKA 4PTXA 1MYRA 4PMZA 2WM0A 3WMBA 4D1JA 3FAXA 1D7FA 4D1IA 4DM1A 3MMUA 5BXRA 3D51A 2BNJA 3BCFA 2ZXBA 1ZS2A 4HZ7A 5LA0A 4JIEA 1NARA 3ARRA 1D3CA 1AQMA 3WF4A 5BYWA 4KMQA 3T0BA 3VIGA 1WDSA 4XB3A 3DHPA 3BSHA 1V0LA 4YHEA 4AZ6A 3VIJA 3VMPA 1TZ7A 4JCMA 3PZ9A 2Z1SA 3PHAA 4D6GA 5DEZA 5I3DA 1OGSA 4PRWA 2XVPA 3TA9A 2DH3A 1ISVA 1UR2A 3AJ7A 3U7VA 2QHAA 4M24A 4JL1A 2V3DA 1V6WA 2CNCA 2OSWA 1JDDA 1EDQA 4CN6A 3GXMA 3TOPA 1DWJM 5I79A 2WVVA 3TTQA 3AHTA 5CLTA 1XH0A 2VRKA 2WHKA 5DF0A 1BYBA 1LL4A 1TQTA 4UOJA 3F5LA 1TVNA 3ARWA 3T0AA 4BQ5A 1EOKA 4PMNA 1GOMA 2F1AA 4GXPA 1GZJA 2E3ZA 3AMKA 3DX1A 4C7DA 4HA1A 4HOZA 1QVBA 1XCWA 2E9BA 1ZU8A 2AAAA 2XFFA 3SCSA 4Z2GA 5I77A 1EHNA 5LA1A 1UR8A 3TV8A 5DFAA 3OZOA 1OSEA 1EO7A 3T2PA 3W4RA 3BVWA 2JFEX 3RJXA 1PIFA 1WE5A 2W62A 3EBVA 1MQRA 5A6LA 3GYCA 2XVKA 3FN9A 3ZJ6A 2E8YA 1LLOA 5D4YA 2WSPA 1LL7A 2Y8VA 5HPOA 4A3HA 1V3KA 4W93A 4D72A 3ARQA 3WBEA 2VX7A 1QI5A 3NCOA 3SUUA 4NXSA 1U30A 1BTCA 5A2AA 4AYSA 3N18A 1UASA 1ZB5A 3E1F1 2FHFA 1VJZA 1U33A 2OYLA 1IZKA 1BPLB 3BAJA 1UKQA 1DWIM 2VL4A 3WF3A 3WEMA 3GNOA 1KGXA 1QI0A 4AIUA 1WO2A 3U57A 2FHBA 1W9XA 3POHA 1PPIA 4HA4A 1X1NA 5TD4A 1ISWA 4U33A 1QBAA 1CTNA 1JYWA 4AIEA 3WNLA 2XYLA 3K46A 4PN2A 3VUPA 4M81A 1AMYA 1I1WA 1ZBWA 1UKTA 1MW3A 1OIFA 3ARZA 3PTKA 4PCSA 4V28A 2E9LA 3PZQA 3VGFA 4UFMA 1QI2A 1E6XM 1TA3B 3AS3A 5A6AA 3CMGA 4PSRA 3FHQA 3FNDA 2J79A 3A4WA 1L0PA 4DWSD 5ABEA 5I2UA 1W3HA 1E3ZA 1E55A 4Z2HA 1CXHA 3TTSA 4MNJA 3OBAA 4QLJA 1Y7VA 2DSUA 3T09A 4P7OA 1PS3A 3WMSA 1KTCA 4JFWA 4J3WA 1J9YA 3PZOA 1C93A 3AIBA 3K8LA 5GNZA 1GOOA 3K4DA 2DSKA 2EPLX 2WKLA 1KGUA 3ALGA 3HG3A 2XGBA 2DEPA 3UERA 1V3HA 1BLIA 1L8NA 3CZKA 1KB3A 4B9ZA 2O9RA 4Q22A 3N15A 1PJ9A 4CD6A 2WVTA 1VJSA 5EBAA 2E40A 3LXCA 4BZYA 2D2OA 3BAWA 2Y8KA 4QP0A 3BLKA 3W28A 2Q8XA 4AZIA 4NXKA 2J8FA 1VF8A 4L4OA 4DUVA 2D73A 2PWFA 1VFOA 4PYSA 4FLRA 3IANA 2CBIA 1JGIA 5HBFA 1HXJA 1G1YA 3D4ZA 4J3SA 3VGEA 4RE3A 4J3TA 1AQHA 1KR0A 1BQCA 4OKDA 2IGTA 5FL0A 1BF2A 3WH9A 1HX0A 1JD7A 2DSVA 2UY3A 4HOXA 1A47A 4N42A 1W1VA 1I75A 4JL2A 1K6AA 2ZUMA 3AZTA 3FXYA 1E4IA 4URIA 3L4WA 4LYPA 2A3HA 1CECA 4WKFA 3BVXA 5EMYA 3U7BA 1ISYA 1Q6FA 5CGTA 4ZENA 4HP5A 7A3HA 3OA5A 3T2OA 3EJQA 1QPKA 4L4PA 3RM9A 4P8XA 1CZ1A 1Q6GA 2HVMA 3RJYA 2EPOA 1JI1A 4NZFA 3GXDA 1Q6DA 4NF7A 3ALFA 3AMDA 1MWOA 3CZLA 1R33A 1BAGA 1KGWA 4PUEA 2VNCA 3FY1A 3I3EA 2YBUA 1B2YA 3M46A 1V0KA 1NWTA 4CD4A 1HJXA 1QW8A 1X6LA 1W9UA 4E4PA 1WP6A 3A23A 1UD2A 2X2HA 2PBOA 1EDGA 1GOKA 4PEEA 3AIVA 2GUYA 1CENA 2WANA 3GTNA 3LRMA 4B15A 4UNIA 3UR8A 2WC7A 2OLHA 3DYMA 3DECA 4OZOA 3UR7A 2QF8A 2EABA 1EXPA 3AOFA 3N17A 4OOUA 1CGTA 2PB1A 3PZTA 1P6WA 2EADA 1UUQA 3RCNA 3WEOA 4PMQA 1WB0A 3VIPA 4PMXA 4ZXOA 3OZPA 3KLKA 3SCQA 3HN3A 4PMRA 2DSZA 1MXDA 1C8QA 4Z2KA 1JZ4A 2VURA 4Z2JA 1QNPA 5I24A 2PWEA 2XWEA 1TQUA 3WH7A 7TAAA 3WH6A 2ZOXA 4YPJA 1JF6A 1V6UA 1QBBA 4CKQA 3ZIZA 2E4TA 4AZBA 5BCAA 4CD7A 1HKIA 3CBWA 2VZTA 4W8BA 3WH8A 5AYBA 1IV8A 1MW0A 3L2LA 4OOZA 4PBGA 3BLBA 3WMCA 1BG4A 4BA0A 1KXHA 1GW1A 4AD3A 4AZHA 5FL1A 1EDTA 4B3KA 1R87A 3CZEA 3VDBA 5JIWA 1RD6A 1HIZA 1QNOA 2F61A 3GNRA 1XGZA 7CGTA 1GONA 2CEQA 5BRPA 3A24A 1N82A 2WMKA 2EXOA 3W29A 1V03A 1UZ1A 4UFJA 4ZE4A 3VGDA 3CHCA 1KFWA 3OIHA 2DIEA 3AZRA 3VNYA 1K9TA 1XYFA 4QCEA 2XIIA 3WY4A 2YFOA 2VUYA 1B30A 4GZJA 2C7FA 2QLYA 2WC4A 3NYDA 4A3YA 3A5VA 3VM5A 4E8DA 3ZM8A 5E6ZA 2W66A 3EJSA 4OBRA 3VX1A 3WQ4A 2CBUA 4NZCA 2CBJA 5JBEA 2Y4SA 3AIWA 1HVXA 4XV0A 2UY5A 1E6ZA 2X2IA 1JFXA 4YHGA 4KRTA 2DT1A 1ODZA 4AYGA 3VGGA 3I3BA 4UQAA 1DWGM 2W61A 2QPUA 5DO8A 3MUZ1 1C92A 1H2JA 1BHGA 1Z32X 3N12A 4WKAA 2DIJA 2A3BA 4RE4A 4U2ZA 3BUBA 2X0HA 3MO4A 4AEEA 2WLZA 5IHRA 4PTMA 1OT1A 4HU0A 2J7GA 2G4FA 1MW1A 1CGUA 1LF1A 1V08A 1C7TA 1UWIA 1UQYA 4QAWA 2VI0A 3W38A 4E2OA 1EA9C 3RM8A 4B3LA 1E4NA 4FNUA 1WZKA 4HOWA 1SR0A 2JIEA 3ARYA 2CITA 2ZIDA 1DP0A 1QHZA 1W1PA 5FOOA 4QCFA 5E0FA 4X9YA 3DDGA 1JDAA 2XM1A 3RM4A 3TTOA 1KCKA 4C7GA 1QX1A 4TXEA 3VX0A 2JIWA 4DWSA 1HP5A 2XPKA 3VD5A 1CIUA 3VSTA 1UHVA 3PZNA 4NX0A 1KXVA 3F5KA 3VIIA 3UCQA 3BSGA 3AS2A 4S3KA 1SMDA 4AD0A 1CDGA 4JHOA 3WQ8A 3MUY1 4FLOA 2BHUA 2ZUUA 4MDOA 3A4AA 4ML4A 3UG5A 2BVYA 1CXIA 3NJ3A 3ARTA 2Y5EA 3POCA 1WAWA 3VD9A 1R85A 3WQ6A 1BSIA 1M7XA 3ARUA 4PMDA 4HPHA 3W82A 3RILA 4KRUA 4M8UA 1LQ0A 4R5EA 1EOMA 1S46A 4FLQA 1E6PA 1V0NA 3WY2A 1C91A 4D6CA 5JUVA 1MFUA 1JG9A 2G3JA 3AMGA 4HZ8A 1VIWA 3WDIA 4PMUA 4FNRA 3T08A 1UH3A 1EO5A 4S3JA 5I5RA 1Q6CA 4MDPA 3VO0A 1JZ3A 1UD8A 3OGRA 1GHRA 1V3LA 4XX6A 3CUHA 2ZX5A 5BRQA 4M82A 3UESA 1SZNA 3AHYA 3K8KA 2CKRA 3CC1A 3WL1A 5LYRA 4PMOA 1BGAA 3PTMA 2JE8A 3DC0A 3VIOA 3EDJA 2MANA 3THCA 5M03A 1QNSA 4H8HA 2UY2A 1UA7A 2G3NA 2VCCA 3WF2A 3EDKA 2JF7A 5CXPA 1B31A 1FA2A 1NWSA 4B16A 4PCTA 6CGTA 4HPGA 5E9AA 1HL9A 1E71M 2G3MA 2J7FA 3U5UA 3ZJ7A 3KL0A 1B3WA 3CUJA 2VRQA 5E6YA 3SCTA 3BAYA 2WSKA 1E5JA 3VD7A 3KLLA 4W86A 1J0IA 2ESCA 1HJQA 3ZO9A 3A22A 3HG2A 4UFHA 2J7BA 1B0IA 3VPLA 2D20A 3MUIA 2V38A 4AMXA 3RMEA 2WYSA 1W32A 4AW7A 1UR0A 2TAAA 3VILA 4H04A 2WHMA 2GJXB 2WWCA 2WKGA 2EPMX 2D22A 5A6JA 1R46A 1XHGA 2VQUA 1UKOA 2ALWA 2DGAA 1ZJBA 1HTYA 1PIGA 1B9ZA 3AYSA 4NSBA 3WUFA 2ZWYA 4DWSB 4UZSA 1JI2A 2F1BA 4DO6A 1RH9A 3AS0A 3VGHA 4TVCA 3AHZA 1E73M 2FDMA 3S6TA 1E6NA 2WVSA 1UD4A 1JIBA 1AQ0A 1KBBA 5D8WA 2VO5A 4B9YA 4ZEPA 2X05A 2WCGA 2OSXA 2J62A 3SCRA 3PZMA 5FIPA 4GI8A 1J10A 3AYRA 5F7UA 4DUWA 3EMQA 4MB5A 3BGAA 3CZJA 2J25A 4HMDA 1BYDA 2VVSA 2FYVA 1XH2A 3BMVA 2CPUA 5A95A 2QMJA 2WPGA 1WZAA 2YL8A 3K1DA 3OLIA 2XM2A 4JAWA 2O92A 5E09A 3ZR6A 2J4GA 2DT3A 1XC6A 3AIRA 1E6RA 2BY2A 2XFRA 2EO7A 1CLXA 4HA3A 4BCEA 3IJ7A 3TONA 3W81A 2EEXA 2F18A 3WFLA 1R8LA 1UWQA 1EH9A 3SIMA 4GI6A 4JFTA 1W1TA 2W92A 4LXFA 1H09A 4FK9A 1FOBA 3WQWA 1TMQA 5D8ZA 1ITXA 2CYGA 1W9DM 1KWGA 1XD1A 3D50A 2WMHA 3SCPA 2VX5A 3M7SA 4U5IA 4LYRA 1NWRA 1O7AA 3WIJA 4HTYA 3DHUA 2G3IA 1CPUA 2WZEA 1ISZA 1OCQA 4FF5A 2JEPA 2GDUA 2F7OA 2WZHA 4D6IA 4N0RA 2CIPA 4WIWA 4LYQA 2J78A 3H53A 3ZT7A 3EDFA 1JD9A 3WSUA 3MMWA 2DH2A 1EQPA 5C8BB 4WK9A 2OWCA 3BAXA 4PSPA 3WQVA 2FH6A 1JNDA 2D3NA 2XN0A 4AZ5A 2Y2WA 1B3ZA 1FHLA 2CETA 4CVWA 1UH4A 4EE9A 1UQZA 4MPKA 2IXVA 4H8UA 5KZ6A 3WFZA 3CH9A 2WVVB 3LPOA 1B1YA 2VQTA 2D0HA 4PUDA 3VSUA 2D0FA 1HF6A 1US3A 4QFUA 1CYGA 1KQZA 2XVLA 1F4AA 3FAWA 2BVTA 3APGA 5DT7A 1ZBCA 2NT0A 1JF5A 4AC1X 4TX8A 1KR1A 1XRVA 3F4VA 4F8XA 4GQQA 4GINA 5A6MA 3MS8A 3CZGA 2CKSA 5CSYA 3WNMA 3AZSA 3AXXA 5GNXA 3A21A 3J7HA 4LQ1A 1V6VA 2YJQA 4P7NA 1ITCA 2V5DA 3AQUA 3MKKA 2CERA 4H7VA 5IFTA 5JBDA 3B8SA 4A4AA 2BFGA 1OD0A 4MB4A 3AIEA 3MMDA 3OG2A 3WNNA 3N11A 4D6DA 2W67A 4P7RA 2PWDA 3WD2A 4GPNA 4UOZA 3BVUA 4AMCA 1UH2A 1QHOA 1ZJAA 3N13A 1AVAA 4P7QA 2G41A 3W27A 2J7EA 3ZMRA 1VENA 2OW6A 4TTUA 2EJ1A 3CTTA 1K9FA 3WY3A 1H3GA 5CZKA 1YHTA 3DX2A 2XSAA 2VX4A 2ZWZA 2OWXA 1QNRA 3IK2A 3ZJ8A 3UG4A 1DWHM 2VVNA 5CJ5A 3VD4A 1TG7A 5CSUA 3SUWA 1BGGA 5ECUA 1E0VA 1J11A 3NDZA 8A3HA 2BY3A 3HZ3A 1PAMA 1TQWA 3RPMA 4UQ9A 2WMIB 4CCEA 1H1NA 4U2YA 3WD1A 1V0MA 3A6OA 2D1ZA 4JKLA 2WZIA 3CGTA 3VIFA 3MUAA 1ODUA 1JAEA 4UQDA 3PTQA 2YOCA 1HKKA 1E43A 1J12A 2WHJA 5CPQA 1GNXA 4H2CA 4DO5A 2DT2A 1WCGA 5D9PA 1NP0A 1JYVA 4J7RA 3LPGA 1TCMA 3CO4A 3BUIA 3W37A 3GXFA 3OB8A 5HPCA 3HU7A 1TE1A 1B3XA 3II1A 1ESWA 4Z2LA 3EYPA 5GNYA 1JL8A 4NI3A 3ZT6A
chains in the Genus database with same CATH superfamily
1F3WA 1U8IB 3EFOB 2VJ8A 1OBAA 1H5VA 4KMTH 5K2ZA 3QNZA 4XPGL 4I90A 5L4FA 2FPVA 2GYSA 3U0HA 2C0AA 4TR9A 2VMCA 3GIZH 3ZTJH 4HNCA 4JIHA 5C3IA 5BVJB 2OCJA 4QHMA 2PLJA 2DPEA 1DSWA 4B3EA 1HHIB 2R27A 4OGZA 1VKXA 3X3FL 2BSED 3O6CA 1YEGH 1BXCA 4MGGA 4Y2DA 1A6AA 3O05A 2GAZB 3RF9A 1L7TL 1CD0A 3GRWA 3QN3A 1E8XA 4NZTL 1FKWA 4A7GA 5D2LA 1GKQA 1OFBA 1BREA 4QNPF 2YZRA 1OGAA 4RZBA 1A5FH 4JRYE 4UQBA 2V2WA 1C16A 5HHNB 4LDEB 3J2PA 3UX9B 3IIPA 4Y2OB 1J9QA 2CLRB 3AT9A 2GJ6B 3QJXA 2XN9D 2X89A 5ITBL 4ZL1A 1OAXL 4GQ0A 2MTPA 2A3AA 3SKOB 4BEQA 4WEVX 3TROA 2XFYA 2AAVA 3BW4A 3FO9A 5LJYH 1ZMYA 1YYML 1SMAA 2F15A 2X4RA 4EI5A 5A2BA 1RLCL 3OQ8A 1S7WB 1TZGL 4MA7H 5FDYA 3STBA 2XN2A 4Q4SA 4JLRB 3EJUA 2H8PB 4NENB 2LHAA 2FIKA 2NZLA 4PTVA 4DXKA 4UTWC 2YDRA 2B5IC 3P11H 1S9XA 5E95B 5LAXB 5BV7C 3S6CA 2JIXA 1ASQA 2CM5A 3VH8B 1NOUA 1R2TA 3LD8B 3WYZA 3ABSA 3OW1A 5DCBA 3KWSA 1YEJH 3ZY7A 3QAQA 2VEGA 4OTXL 3QW3A 1GC1L 4JG5A 4PWFA 4LBAA 5FF7A 3IDNB 1UYWH 4KJYA 4UBDC 4Y9BA 2W0UA 3PRZA 3G08B 1UD5A 2YAMA 1MI5E 5AAWA 3GO1L 4MRBA 1HWWA 4HQQL 2XIBA 3LSOB 3AWOA 3AFBA 1RVFL 4GOSA 3UP8A 2PSNA 4ZMYA 3L12A 1O9ZA 2GJ6D 3VSQA 3BARA 3DI2B 5I00A 1JHKH 1Z9PA 3EFOA 4LF1A 3EJRA 3OO2A 4JNZA 5GSVA 2XG5B 4HK3N 3EFDL 1A9EA 1DOSA 5IK3A 5A94A 5A69A 4NUGL 3VMOA 4BKLA 2NY5C 3KPOB 4QHUB 3BVNA 2PU0A 3G1DA 3ARGB 3G24A 1TVPA 2G5RA 4ZD3H 4XPAL 1GUVA 3AI0A 4KERA 4W9JC 1I8JA 4KWVA 1Q66A 1IT9L 1Q94B 3R1GH 3FQXA 2OOGA 3HZYB 1AR1D 2WXLA 4XZWA 4GQRA 2VDRL 4R6UA 4YYCA 3BE1H 1Z9SA 4JPQA 2XN1A 4P57A 3MA9H 3EBIA 4LEXH 3PWLB 4PB9H 3VYNA 4KZDL 1HVQA 4HHGA 1UQSA 3NQ8A 3R10A 4GXUM 1YYAA 4HN8A 5DQ9A 2B8OT 4O9HL 4KKRA 4A2HA 1BQKA 1LQBC 4HWEL 1CLVA 3GSNL 4JQ3A 1G5GA 1KB5B 1NGPL 2OK0L 4KRZA 1KBGH 1CLZL 3KM1A 4ZXBD 3U30B 5M3WA 3FU0A 4US5D 1AJ7L 3I9IA 4JPWH 2J75A 1V5JA 2R29L 3VI4B 3GS6A 4O4YH 1MZYA 2NSMA 2OL3L 1RQ5A 2VDNB 4R7LA 1NC4D 3SDAC 2CA3A 4GUOA 4R3SA 2DQXA 3BW9A 3N85L 3WD3A 2OR7A 5DZOA 5DK2B 1JVNA 1BYAA 1BG9A 3DCPA 3LTVA 2FZ8A 3I7QA 3BFWA 4EEEA 3L45A 3BFOA 3S5SA 4GUFA 5HGAB 4UNLA 4BKNA 4DGYL 3ZW3A 2J1WA 1CLOH 1M4KA 3CVHL 4XNUH 5TE6H 2Q71A 3QI9A 1F97A 3PFUA 5KINA 1MLBA 1MN4A 2VW7A 1UOVA 5DD3H 4JYEA 2XQ0A 4WGXA 3ILPA 4MA1B 3V0IA 3ZTEA 4H1ZA 2FGLA 2ATKA 4J4PD 4HSHA 1S7QA 3VCLB 1FDZA 1T80A 5ICZB 1TETH 3K6SB 1EUNA 2PTWA 4EK7A 1LNUB 3WDJA 5CGQA 4NKIH 3L4YA 4C5ZA 3US1A 4RFEA 1SW3A 2WWDA 3GD6A 2WZ0A 4MMYB 3B9AA 4EE2A 1HCYA 5DHVH 5CPOA 1BM3L 3BFQG 3PUEA 4NZJA 1AXIB 5TDNB 5CLWA 4PY7B 3TX4A 3WUWG 1ZGLM 2YGQA 2R0WL 4Q8TA 5K4ZA 3F5JA 3FT9A 1A4KA 2EQDA 5LNVA 1S7VA 4OF7A 3H9SA 4AH2B 2ADJA 1QHQA 1NDGA 3QNXB 4G5ZH 4GW5A 4IISA 5AVHA 3Q3GB 1FVDA 3H2NA 3BH8B 2ZE3A 2YPVA 5E8PA 5IK3B 3H9HA 3VIMA 5D1ZI 4E8CA 2F54E 3N2XA 3HG1E 3VW3L 4BQ4A 4IOFC 1AOHA 1KGCE 4A6YB 2VENA 5F4XA 3WQEA 2BSBA 1D5IH 2VZVA 5LGXA 5FR3A 5DQJA 2R69A 2W0FB 2WSQA 1HINL 4Z7UE 3UXKA 3FRPA 1GSMA 1DPMA 4O52A 1JDCA 1UG6A 5DUPH 3TBVA 4MJ6A 1A1OA 4FQIL 3ZDZE 4NHUB 3B7YA 4FYRA 3P9WB 4LSQL 4X4XA 2JKAA 2BWIA 4XWGH 3LLXA 1E4MM 3PANA 1SY6L 3VA2C 1T96A 4F9DA 4KCUA 3GMPA 5F3FA 2I69A 5CU5A 1WA2X 3GM8A 1YEEH 2R4RH 3MRNB 3QY7A 3UBXA 5B8CC 1A3WA 3UEQA 3VXUD 3MBFA 4PB5A 1L9RA 1NFKA 1R5VA 5I1JL 1OFPA 3DHFA 4I1RA 4TVUA 1NCGA 4C7FA 1W1YA 1N6QL 3VKDA 3WG6A 2CDFB 2D9CA 1S39A 4EZJA 4LW7A 2Z8VC 3DJ9A 4NRYB 1O7DC 4YN3A 1H6TA 4ZQCA 2J8OA 4I89A 3KLAA 4DJFD 2HFEA 3WE6B 1HKWA 1XTLA 3SKOA 4MZYA 3S8HA 3ALXA 1M1XB 2Y2TA 4WWKA 2C8NA 2IOMA 5KBMA 4H9YA 5KYYA 3T1WA 3H2CA 2D7QA 3R0NA 1HJVA 4Q2ZA 3H56A 3N1FC 2P46B 1FL6A 1CT8B 4YSUA 4CMHB 1PTDA 4LY8A 4N6FA 2VEMA 5ICZA 2FQFA 4NNPL 1CGYA 2CIKB 2EE9A 4HH9A 4HYWA 3HR6A 4MY1A 1OB1B 4Y4KB 2DVUA 4Q8UA 5GRJH 3CUPA 3VFMA 2F5BH 4ZUSA 2A4ZA 3R19A 4LOUC 5BW7A 1AKJA 3L21A 4INFA 3S88H 4W85A 2E7CA 4M5YL 3B2UC 2IANE 3GSOB 2BG5A 3FUMA 3NFPA 1TO5A 5DR5L 2I85A 1S7TB 3LY6A 3VFSB 4MB3A 4UDTB 5DRXA 3NZRA 4LLDA 3SUVA 1VFBB 2BY0A 3B4UA 5EB9A 3MJ9H 4EQ3A 1OAZH 3U0TB 3DEQA 2Z35B 4P2OD 4NC2B 4CADA 4L8SA 4P7LA 1IBDA 3O9NA 4R7OA 2VZSA 4V1DD 2AK1H 4YFDB 1BZEA 4DO4A 1RZFL 5AALA 3ZKMD 4DGWC 3R11A 2DI7A 2HLFC 1ETJA 5FA3B 1IZJA 4BKLB 1JQXA 2YLHA 1OYBA 3CJJA 3B8UA 3M17B 5REQB 2VR5A 3LEVL 4AU0A 2PEVA 3VD3A 3EWUA 3GTVA 2OEJA 4MJ6B 3MTWA 5AB1A 4TLKA 4ZW6A 2I5YL 1AGCB 1GZHA 4F0LA 3URBA 3FCBA 2DQMA 4ATWA 4B7IA 3D5HA 2NY7H 5JBFA 3HS0B 4O8RA 1FH5L 2VDMB 3DUSA 3O11A 4GVHA 5IROD 1ZLPA 1JZ8A 2OWWA 3B43A 1HP4A 5C6MA 4IKKA 2VLJD 1ZGLB 2J77A 2QXWA 4CLMA 4M8VA 4CCCA 1QNZH 1KBLA 1NCAL 2A3CA 1EFXA 2D2CC 2OJ1A 1IE7C 4TLTA 4X9FA 5B1KA 2BTMA 3QUYC 4FXFA 5D9MA 2FR4B 4JFPB 4K07A 3WUWB 4YIQA 4NRYA 1KM0A 3C8KB 1Z48A 4BCYA 1KV8A 4RZ5A 4JIIX 1H5BB 4F0RA 3SBFA 3IEAA 3K6IA 3NVQA 5JQHC 3RNQA 1NIBA 2AK4B 3E9UA 3ZE0B 3CHFA 5D7IF 3HEIB 1J8VA 4PBXA 5LB1A 1ALDA 2IFFL 1F61A 3TXZA 2Z6IA 3VI3A 3F64A 5BXFB 2TYSA 1KO0A 1I3RB 4BFIA 1HDMB 2P3ZA 1ETB1 3DHJA 4QTGA 4G1NA 5BZXA 4Y5XC 1VRXA 3QIUB 4DAGL 1J0KA 2QCLA 3RLHA 2J4WL 3FS2A 2YSWA 3O2WH 1VCBC 3PFMA 1HKJA 4CC1A 4DJFC 4IOIB 2G37A 3GSWA 2C1PA 3DK2A 4LPWA 1MNUH 4OKVB 4XCNA 5DHVB 4DEPC 1GOXA 1HO1A 2PDUA 5M2FX 1BFNA 4Q6IC 4WI7A 1XH1A 5I1CH 4L7ZA 4QAMB 4XHJD 2OJZL 5AHIA 2ENYA 3LS5L 2F7RA 3MODH 5GGQH 5SWZD 3LXAA 2EILB 4OZFG 5ICXB 3T0VA 1L7TH 4OGAC 1ONQB 2XXCB 4MZ8A 5KSBF 2QYGA 3GSRA 4JGMA 2AQOA 3F2DA 4XZNX 4XNZB 3LLFA 4R7VA 3GHEH 3QEGH 4LX4A 5HYFA 3FCGA 1HEZB 1MAJA 1ICPA 3VIKA 1Q7MA 3VE7A 5EORH 3EXRA 4XP5H 3SYPA 1K9EA 3PZIA 2JK2A 2JKTM 4MJIA 3TF4A 2PDLA 3GJEA 1QUNA 3HV8A 4F9JA 3QEQD 4NFCA 3KDMA 3RDJA 2AQNA 2V82A 1ZE3C 3M1BA 5FYLH 1SW0A 4IXXA 3KS0H 4I7VA 4QMEA 4Z1AA 4Y19E 1A3LH 2VE6A 4L4VB 3RVWC 4GZEA 4M80A 3L13A 5FKPB 2PGWA 2OZ4A 1GPFA 3QSRA 1CE6A 5ID0B 2JF6A 5HY9A 1XLEA 3CFDA 3SB0A 3P11L 3ZKQD 3IPBA 3WF0A 2QPXA 3TYZA 1NFDA 4N1EA 4UZUA 2HVBA 2JALA 4ZFCA 4P3DA 3KWWA 3RFAA 3G18A 3H23A 3P3SA 1W2VA 3OAWA 4LCUA 2ATSA 3M64A 4NG3A 3PP4L 4L3EE 5I0YA 3BL3A 1N4XL 3W7MA 3ASNB 1G7LB 2BB0A 2QVNA 3L3OA 2DWEA 3WJXA 3WJSA 5CSRA 2OMZA 3T2QA 2WXFA 3EXSA 3M0IA 2CJSA 3NH7H 4L0PB 4HUVA 3QUYA 4H0HB 3MO1A 4LVBA 4DPPA 1KCVH 1ZRUA 2VZ3A 1NMBL 3MJ7A 1E4LA 3E5PA 4NIRA 1KBPA 3ETBF 4IRSD 3BQUC 2PYEE 2OFQA 5E23A 2YCKX 4D71A 3TCLB 2G0KA 3CPUA 2PF6A 4RGMB 3GFXA 4ZFGL 3GU9A 3KCWA 2Y61A 3IJEB 4NUGH 5D4IA 1FPTL 2KBGA 1E4XI 2G4EA 3KDNA 3IS4A 4PRBB 3W53A 2PC4A 3SPGA 2DM7A 4MHHI 4L5FE 4X8GA 1UWSA 1M7UA 3CAVA 4XPHH 1BZ8A 5I1EH 2CQVA 3TEVA 3CZFA 4KC3B 3PYCA 5E1AB 1GQNA 5A6BD 4JZNA 2IF7A 4C6DA 3EA2A 1F6AA 4HJ0D 1CJYA 4GQ9H 2YXGA 4PGLA 4MZIA 2BWDA 4KGLA 1A65A 1W16A 1ZLDA 1LDCA 4RR4A 5JVLA 4F5CE 3VABA 1KLGA 4WWKD 1IM9D 1KCRH 3IGFA 4GP5B 3C8DA 1QR1B 1J5IA 2KT6A 2PUZA 4K8GA 3NRFA 3RLGA 1Y18B 4ORMA 3TR9A 3LHUA 4ACYA 4N8CL 4RBPH 3UCDA 3W7PA 4F48A 1XEDA 3SGKC 2HSIA 1V8HA 2CU9A 1PX3A 1LRTA 3A3WA 1VFFA 4KRPC 1VAHA 2VMJA 4PYHA 2OVLA 4YFLF 3UBHA 3DKLA 4JGDA 4BRVA 1X1OA 1T1ZB 2WY3B 4ZRGA 1O9WA 4HFUL 4M1GH 1RSYA 4A6GA 1LRNA 1WXZA 1GOWA 1RULL 3GS7A 5FF6B 4N0CD 2DMGA 3B40A 2P80D 3V0FA 2WHLA 3PVFA 4BQ3A 2B7NA 4HUXA 1UKSA 4ZUTB 5HOSA 2A77L 2WP3T 3HAEA 4XCYB 3NBNA 1OGTA 4G5ZL 3DPDA 5FCUL 5C0CE 3WKMH 1XF2B 3C9NB 3UAJD 1Q7QA 3GU2A 4REQA 5D7LB 4MX7B 4DEUA 4AD2A 4GMSH 2VDPL 2HPTA 3AREA 3JUZA 4NJHA 3BN3B 3CHEA 2PPFA 3UGXA 3MSGA 3GBDA 4PRDA 2PO6C 4K0OA 4XO8A 3PZUA 3U4BH 4KWUA 4PJ5B 4W8LA 5MHBA 4I85A 5GIRA 1Q6OA 1KJ2L 3IJYA 3CASA 3PM6A 4FHKA 3VGBA 2VCAA 1DFBL 2QELA 1P0DA 4Q8PA 4BI5A 1MDAA 3IJIA 1CGVA 1THCA 3UDWA 1ZPTA 4GUIA 3WIAA 5C0ND 1W54A 3T0WA 3LKQA 5TGBA 4QDPA 2NNAA 2B5IB 2F84A 5BVPH 1M5WA 5JQ6H 4I5RA 2YAEA 4P9HH 3FU5A 2PGFA 3WUBA 5I18L 4A22A 2CLPA 4IM8A 2QKSA 1J5CA 3T40A 3MRPA 2RGMA 4TUFA 3MBDA 2ZKHL 1NVMA 2PDFA 5I1IH 4F8LA 1NCWH 2KZBA 1NUGA 3D18B 3G8EA 3SO3C 5J1AB 2NQJA 5FF3A 3RKDC 3UA3A 2FB4L 5HNRA 1OTSD 1Q1JL 3TYFB 3WF1A 2WUBH 5CEXB 5GZNC 5I1JH 1SYTA 2WOQA 2YL6A 2QKFA 1S2AA 5D4JA 1RZKH 4BFEA 4ODUA 3G5XA 3FHAA 3LDBB 2EPNA 4KK5D 2VFEA 3IJ8A 4C4UA 3BPWA 4FQQA 2A3LA 5JIDA 3U0WH 4YCPA 3WBXA 2BNRB 2EPKX 5C0AD 1U58B 1VPYA 1NEZA 3FXIC 3URAA 2PPEA 4PJ9C 4RNIA 5AZ0A 4E9RA 3T65A 3GNDA 4F7MB 2QCNA 2YSSB 2A9ML 4N4YB 4OZFH 3UPRA 2ZE0A 4ZZKA 1HOCA 3CFUA 3Q6GH 2EDLA 3V9CA 1J05A 2CUIA 2X9XA 1CE6B 1MZHA 1ED3A 4EXBA 3O6ML 3LH2L 3NZ8B 1NMAL 3GTHA 4YSTA 4HSNA 1YEFH 1N7MH 1J0ZA 4DN1A 4XCYA 3WFEH 1Q9WB 1OAZL 1FYTD 4Z3EA 5DJ0A 1NDZA 5G4EA 2X4PA 4G1MA 3SI9A 3D4YA 1UB6A 3QFJB 4AD5A 1YAZA 1VPQA 4OCYH 4JN7A 1CEOA 3QY8A 4NILA 1E4HA 4U31A 5LCVL 4JNXA 2PCFB 1DJYA 3AREB 3GC5A 4EVNB 4KGJA 3MRRB 4PMEA 3L5WA 1CZ8H 5HJGA 1TPH1 1ZBKA 5J3HD 5D71H 4UOQA 3UBXG 3BUVA 3QJSB 2OT1A 2ZRXA 5CPSA 4Z95L 3P0VH 2G97A 2YRPA 5T1LD 4NZRH 4GG8B 4S0HA 2B15A 5ABFB 1RJYB 3C60B 3NJJA 2A6NA 1GHFL 2AQ2A 3FJ4A 1A1MB 5T91A 3NJHA 3WFDL 1KTBA 2J1ZA 1MEXL 2XFXA 1KNWA 4JS7A 4UMCA 1TPDA 1BOYA 1QWUA 2XQBH 2JWYA 3TBTB 3UIZA 4HMCA 3VG0H 1UD3A 1KZYA 2V3FA 3F58L 5G2NA 1EWDA 2QTVA 3P60A 2XZAH 3ZE1F 1MUCA 3RB7A 3PUUA 1UM5L 1DQDL 4AEIL 3F4DA 1G7PA 2X4SA 4DI8A 4IUGA 3QE5A 3WV0A 4JICA 5DT7A 1BZ9A 1SFSA 4FFZH 5CQ1A 4MXWL 5AC6A 1KFAH 1Y1UA 3O6LH 3FQTA 3B8VA 2HUEA 2NY1C 2P7TA 3CH8A 4L6OA 4NPJA 5K33A 4C57C 3C6LA 2DDQL 1E4JA 3M45A 1NJJA 1QR1A 4QHLB 5C0EB 3J07A 3NIYA 3PGCA 1JZJA 3NJIA 4FLSA 1MW2A 3H9SB 3O4OC 4JFDE 1JPTH 4JFDA 4M03A 2AI0L 4XOAA 3D3VD 5F72S 5B7MA 1IQ8A 1LG1A 2GWGA 4KK8C 4MMWA 1DJXA 1U8CB 2XZZA 5DK0B 2OSLB 5E4OA 4PRHB 1W2KT 5FJOA 3SDDA 4ODSL 4JX6A 3BXNA 4NCC1 1TPUA 3EOEA 3RBGA 4YX2L 5AN7A 2W60A 2NY2B 4ZPVB 2WGXA 4FNQA 3AMCA 1AFVH 2X2JA 2Z2UA 3CIVA 3OGVA 2ZCLL 1H8LA 1JFHA 3DBSA 3B2DC 1NSJA 2OW7A 2ZNXA 4OZHF 3TZNA 5K39B 2AITA 3P0WA 3SPIA 4O18A 3N9RA 4WY0B 4GE8A 2VGGA 3HC4L 1G9HA 5IJVB 5E2VL 4JN8A 1IGJA 3AS1A 4AZGA 2O5XH 3QZ6A 3ENLA 4G42B 1H3TA 4LT7A 4DH2A 4F7PB 1R24A 9CGTA 4YU1A 1PG7W 3OKOB 3FXGA 5LWYL 5LBSA 3W0WB 3MODL 1NGYA 1C3FA 1IQDA 1YYLH 3PAZA 3EX4A 4CC0A 3GBNL 3F01A 1ILSA 1DHKA 2N3JA 1TCRB 3NEOA 2WLJA 3UBXI 4UFIA 4NQCA 2HFEB 4JO3L 3PAVA 3US9A 5I6KA 3SYAA 3L2MA 4XP1H 1J1XH 1PLAA 4XOBA 5C55A 1FHVA 4ISVB 4A37A 3R0MA 2PBGA 3ABOA 4DF2A 4XP5L 4ES9A 1QNQA 4IFKB 5EBUA 4NUWA 5JPMB 1OC6A 5EMMA 3AYVA 5I28A 1U3YA 5EZLA 4ZW7A 3RWIA 4QRBA 3P3RA 3GKWH 3A3HA 4K2SA 1T2XA 3MBXH 3MRPB 5T33L 1XZ0B 3SN6N 1EAPB 4HS6A 4JFEB 4EF3A 2NW0A 2N1KA 4FCAA 3WIHH 3QIBA 1XG3A 3ULUF 4ZMNA 1VP5A 2XWRA 4AIOA 3QZOA 3FQTB 3R2GA 1SEBB 3F7VB 3BZ4B 4MXVF 4ZPTB 2NSXA 4Z7QE 4X7FC 1Q9OB 2J3SA 1R3YA 3O6AA 3LIZA 4IOSA 4LLMA 1YECL 2NQ9A 2Q86A 5KOVC 2MQCA 2VJXA 5F1NB 2BSSA 3KPRB 1YMME 4W84A 2WP3O 1PD6A 1ZJHA 3G6JA 3QUMH 4W9IC 1XIWB 5FOBA 3GK8L 3VINA 3MI6A 4EZLA 5HHXL 1Z3GL 1NEZB 4NJIA 2AW2A 3V0UA 1R3VA 1OM3H 2HZHA 1RV6X 4HKZB 3MRKB 2YXFA 1S7SA 2AJSL 2XZQH 2ZUXA 2ZXQA 4IMLB 1ZBVA 2W27A 1PKMA 4PJIB 4JX5A 5IHLB 4YDLC 3TM6A 4URTB 4IFOA 1QO3B 3L23A 4LFHD 3QXUA 3ABRA 1MQKL 2F54D 3CX5J 3UBFA 3RIKA 1KV5A 3A67L 1K9DA 4NP9A 5EN2A 5HULA 5K59F 3S3GA 1VA9A 2Y36L 3RVXC 5I1EL 5IFHH 2PF0A 4ZFGH 3QDJE 1ICQA 5IHZA 1I9IL 3RP1A 4C55A 4LPTA 3RVUC 2UY7B 2BGSA 1UB6B 1JNHA 2OMNA 3QFJA 2DZVA 1NSNH 2IAMC 1CG9A 3ATZA 3KZSA 2E59A 2P5ED 3L3DB 3VDAA 3PPFA 3CX2A 5LN4A 2E7LC 6TIMA 2X4TA 3WHE0 4PJEE 2CLRA 1NOFA 2MQ0A 4F93B 1SN5A 1PX4A 2WZTA 5E51A 2Y06L 3ULSB 1JVKA 4OLVH 3IMBA 1PYWA 3IIVA 2P80A 4H8WL 2MCG1 1TYJA 2E6YA 5L9DH 2W07B 4J8RA 4HSCX 2MWCA 5BQ7A 3W2LA 3CAKA 1S7WA 1QASA 4G9DB 1HDMA 3VXSE 1K70A 2R69L 3DYPA 1TLMA 2CO3A 4QE5A 5FO8A 4LK4A 3N42B 1T7LA 4S1SH 1UOLA 1VHPA 3ZL4L 2E27H 3RFZB 1AJ2A 1H4PA 1MUJA 3QZWB 1IM9A 1OF8A 2VGFA 4NC1C 2VL5B 2GY7B 5D1XA 1EJFA 1QZ1A 3MA8A 3FH8A 5FPIA 1TIMA 3LCYA 4GAJH 1D2OA 3ANYA 1WC7A 4WHYH 2QMKA 3RUGF 1DEEB 3APCA 3BK0A 2PXYC 2GK1B 3L5LA 1GYUA 1Q0YH 4YDKH 4WUUD 1F4YL 5EEVA 3NO1A 4YBQD 2IH3A 5A3HA 1VACA 3NIDF 3WKML 3RLVA 3BH4A 5JW4M 4K7PH 4GVFA 5A8PA 4KXCA 1VBUA 1PJWA 5D4QA 6PTDA 4TRPL 3I02A 1BF5A 2INFA 4DF9A 3L3KB 4HHPA 2ZDRA 2XGIA 2QJMA 3CV2A 3OXSA 2V68A 2ZZUT 2ZSVA 4Y5XA 1GGIH 5ILTL 1IIGA 1SDDA 2FBOJ 4HIXH 4P9HL 1PVHA 1TTJA 1RPXA 5EIVA 2EDEA 1NWUA 1SPQA 5HI3D 3LHPL 3NDYA 4DAIA 2ZUVA 2VLMD 3ARDD 2F19L 4P46C 1NEPA 3KJ6H 1RBAA 2QDGA 4IIDA 1IKOP 3NCBB 3MQTA 5LKYA 1IGJB 5C97A 4H41A 1E6OL 3BCDA 2BSRB 2XV2A 4J3OG 5GPRA 3RYMA 2ITCA 1P9MA 5CLYA 1QPNA 1S9KC 4O58H 4W7WA 1G67A 4PJFA 2X4TB 3RVVC 1WBJA 3QT2A 4GO8A 4NB7A 3UOAB 1XTMA 4FZEH 4Y2DC 1MUMA 3SO7A 3UWWA 1ET7A 1WJ3A 4QTIH 3T0EA 4AVNA 2KDGA 4C91A 5SWUA 3EB3A 3O6FC 4XVTL 5G4OA 1SFJA 4B9KC 4G80A 4JTLA 5T3ZL 2ZCZA 4LCUB 4XXWA 4ERGA 5FAGA 3O8XC 4QJ5B 3M6DA 4YDJA 3VRJA 1GQLA 4X8JB 1IWAA 4JFQA 2NLJA 4KPLA 4Q6XA 3ES8A 5EFFA 5IMMA 2PDCA 5FJJA 4UR8A 1NFIA 1DBBH 1R9YA 4EPSA 5I1DA 1AHWC 1MHCA 3GSNB 2P8MB 3QUXD 1OIOA 3H55A 4Z7WE 2A9CA 4TQTA 2XZCL 2PDGA 2VXUH 5KSBA 1NMAH 1S7QB 5HHOD 3QMRA 4ZMPA 3SCNA 3ML8A 3II3A 1C12A 2ZX8A 1TZ8A 4I0PC 1BRLA 1RP8A 4M0XA 1HSAA 1L6XA 4J3OC 2D8KA 4KUCD 4ZAKA 3RZCD 1VGAA 2NUTB 1H6FA 5DJYA 2ZX7A 4L48A 5GSRB 4LSDA 3ERXA 1XR9B 1UUSA 1SXCA 1WCBB 5GRVL 4ZFMA 15C8H 4FS9A 4XAFA 3QQ9C 4RGNB 3MJMA 4G8TA 4RAVB 1TTRA 1DEDA 3ZQ9A 3LCXA 3EJYC 3H21A 1VACB 5CZRA 2DMCA 1IE5A 4CQDA 3Q3GA 5BUAA 1H1YA 1ADQA 4AW4A 2Z93A 3SKUD 4KK6C 1FHDA 1PV8A 3BAIA 5C0GA 1RZMA 2NV1A 5E2TH 4RRPA 3H42H 4UMBA 4UNKA 4M1DL 4NL1A 4TPRH 3O07A 4G43B 4RE4A 4OTKA 2VM9A 5JOPD 5EKYA 2WVUA 3PBWA 2BFVL 3HE7C 3Q8CA 4WFEE 4MLRA 2DIAA 1JNNL 2VR6A 4FFZA 4MQ7B 3WFCL 4G8GD 2CHNA 5IT2L 5CJQH 1QFWI 4OCRH 2PP9A 4OLZL 5KTEH 1BG1A 1A5LC 2QCMA 3L67A 4AMAA 5BWFA 1MEIA 3BUYB 1AFSA 3GHUA 4F2UA 3MRFB 1B9BA 4U1NA 4IP4A 1ITBB 1OZUA 1RZKC 4LSVL 4HT1L 4XE5B 2OZ0A 2H3NB 4IHCA 2GJRA 3OXRB 3HJEA 4J28A 4PJGE 4PREA 4E4FA 2K8MA 4L80A 3THDA 2E9MA 1UR9A 2QGDA 3W76A 3VFPB 3UTTD 3WK0A 5C7HA 1BDYA 5A6KA 4I9MA 2OXGA 4ZW8A 4DIXA 4P99A 5INCA 4TV5A 4JB9H 1P7KB 2FEEI 3PGDA 2IG2H 5ES4B 3VXGA 1H8OA 4DEWA 1A3QA 5D8ZA 1W72H 2Y7MA 4G70B 4GYKA 3O3DB 4JTEA 2XOTA 3K71A 3ULSA 4YDJB 5DZJA 1XGPB 1PXGA 3C9NA 4MZ2A 4TVDA 1NCNA 1JXDA 4P2QE 4QRUA 5SWZB 1GS7A 2DZUA 3UXDA 1U8PB 5C07A 2AL2B 3W2KA 3QVQA 4UQEA 4RE2A 1TFVA 2WOYA 4MSWA 4R84A 5E4IA 3O6FA 1JEZA 3CM4A 4CUCA 3GSXB 4A8IA 4JFZH 1JPTL 3B8YA 3LPFA 3V4PB 1HQTA 2DDXA 3AMLA 3ISWA 4GKSA 2WAGA 3WD4A 4EMZA 4CCDA 4WFGD 5GGVL 5BJTA 4GRWE 4HH9B 4P4KC 4BH7A 2ZOWA 4DZ8A 3S2CA 3TFKD 1NLDL 1KM4A 1RY0A 3RFZA 4UC5A 1FNEA 1N64L 4MJ5B 1O6TA 3DX6A 1AS7A 1D5BA 3GSOA 3LKQB 1KBVA 5TGBB 1DWAM 5DJXA 1IHIA 3QM3A 4GNVA 5A8MA 4Q89A 1I9JH 3GG1A 5T1DH 3WLBA 3ELFA 2AXFA 3S37H 4ES4A 1R7AA 2IDCA 1IEIA 3N6YA 1E8WA 2X4NB 3K30A 3ZE2E 2O4QA 2GGIA 4HWBH 3V6ZB 5E0QA 1K5NB 1XB6A 1H9VA 2ZOOA 4IU2B 3VD0A 1H0GA 3LCFA 5G1MA 4YHKH 3FQYA 3QCUL 3X3GL 4DPAX 4K68A 4KW2A 4ATDA 3EXJA 2V2XA 5FCZA 2PO6A 1B3VA 2D31A 3ULVD 3V0DA 4U6VH 3H2OA 3EFFB 4EKJA 2E7MA 1YYLL 2Q7YB 2XVGA 1SXAA 4GP8B 5IHUL 3YPIA 1Y07A 1X5FA 1XCQA 1XT5A 1IGML 3QWOB 5CR8A 2A21A 5J89A 4Q8WA 4S39A 3CD4A 4XT1C 2BY1A 5HDBF 2FK9A 2JCCA 5DI8A 3QPKA 3KPRD 2BSRA 1K1DA 1OX5A 3G5VA 2FH8A 2VX6A 1W6LA 3ZDXB 4BM7A 3UZVA 2HROA 3D48R 1GJPA 1CR9H 3OR7B 3W01A 1E4XL 3RWFA 2JKPA 4YC2B 4LF3A 4HALA 3VXMB 1KPRB 5IP4A 1FDJA 2JV6A 4GKZA 3SGEI 2QDHA 2UY4A 5G1YA 5E0CA 1OWWA 5BZDB 4C6QA 4DWSC 5I6SA 4LHUA 3T4AB 1INQB 5F7EH 1XDJA 2G3ZA 1PHQA 2YKKA 3H2EA 5HWJA 4QRUB 2APVA 1WCQA 2X3BA 5SWZA 4V1XA 1R6VA 3SQRA 3DSNB 3W1ZA 4D2JA 1U22A 4PTXA 1MYRA 4RDVA 3HS8A 1F86A 3OD3A 4KQ0A 2QVHA 2BSCA 3CFNA 1AYRA 3KG5A 3OB0K 4OCWH 3ZHNA 1TV2A 1LDPL 1UMLA 3GTXA 2XVBA 2DN7A 5E5UB 1N10A 1UC5A 4L65A 4DM1A 1HWHB 1NANH 4XPGH 1R3WA 3UJFA 1MJUH 3QIUA 3FO2A 3BJFA 4RISL 5EOCH 2NMSA 5FW8A 3Q58A 2R9HD 3QFWA 2UV3A 5C9XA 3T0EC 4M7TA 3P0GB 4JIEA 3ARRA 4ONFL 4N0YL 4DGIH 2BCKB 3WI9A 2IANB 1D3CA 3I4EA 3SRFA 1MSPA 4OLXL 4LPYA 4OCMC 1ODAA 3VIGA 2X4NA 4QXIA 4XBGA 5E8NA 4GNJA 4H8NA 1K6QL 3DHPA 5A6TC 1ZA3B 2C4FT 2GVEA 4AZ6A 2X1OA 1GZQA 2JB6B 3PHQB 3N1GC 4H8PA 3VMPA 3P82A 3VKJA 5MKGB 1OF2B 1NSNL 1GXEA 4WHDA 3V8CA 2Z1SA 1IXNA 3PHAA 3BCJA 2HFFA 5D2XA 3EO1A 3NPSB 4NQXB 4D9RE 4DQAA 4ZW3A 4PJ7F 4LCCA 2CCWA 2FJHA 1YJDC 4PJ8B 4X6EA 3NT0A 4AK1A 2XVPA 3VFCA 4TTDD 4YDMA 1XCQB 5KVMC 1AI1H 1SVZA 1ISVA 2COQA 3LNHA 4XC3H 3L1EA 2E6FA 3V5DA 1FC1A 43CAA 3PAYA 1INEH 4Z18A 4Q0XH 4M24A 3GMMB 3P14A 5C0BD 1ZENA 5IY5B 1E4KA 2AJUL 2A9NH 4ZPVA 1T7XA 1CFVH 4WUUB 3COOA 3RWFB 4YL2A 5CBBA 2OU4A 1SFTA 4DTGH 1J5HA 2FX8L 4EWJA 2QQKH 2WNKA 4F15B 5EWIL 3TTQA 3B6SB 3IV8A 4XIAA 1B57A 3V6OA 3UXAA 4UU9A 2VRKA 3U2ZA 4NQUA 3VA6A 2FRGP 2WHKA 5DF0A 2IDUA 2A7RA 1GPOH 4OM0H 4P2OA 1BYBA 2EZ0D 4G6AC 3OKEA 2JKRM 4P59H 1MWAB 1WFUA 5AKSA 3ULUL 2VC2B 5F89A 1UM6H 3M0LA 3RGTA 3GSVB 4NCDA 4FXJA 4G7YL 4BQ5A 4ERAA 3ULVF 3D7PA 5BS0B 4PMNA 5HPMB 1UMYA 4BI7A 3ARDB 1GZJA 4JN6A 5GXBB 3KPPB 4APQD 2AJXL 2JLLA 2WTRA 4OZ4A 4RMRA 4R7XA 4WY7L 1MLCB 3UYRL 2JTDA 4NZ3A 2AABH 1OAKH 4GAFB 4YL9A 1KM2A 3AMKA 1R3RA 3GSQA 3UXLA 3SKNB 3DX1A 4HOZA 4MD5A 1YPXA 2EDHA 5JOFB 2HKFH 2QADC 3GLEA 2FEDC 4HBCL 1IGYA 1XCWA 5GRUL 1QVBA 3ES7A 4JN1H 1BEYH 4AV5A 5KSAB 3TFCA 2C91A 1JPSH 3IN2A 1PGRB 4FP8L 3DPBA 3U6XA 4IS6B 4TUOA 4MM1A 2EYRA 5KTLA 2MHAA 1MJJB 3KLDA 3G6JF 4U6HA 4RZCA 5BXSA 4JJHA 4LWWA 5LA1A 1A9BB 4LPUA 4X8CA 2DYSB 4WCYH 5E4EC 3RWEA 1FCQA 2GPZA 2AEWA 1PZ1A 2POZA 4K3JH 3WFHB 4JZNB 1A25A 3EYUL 3I6SA 5CJOL 3O3AB 3RUBL 2VC5A 3F7KA 1FCGA 5FYJU 2A5HA 4CL7A 1XUUA 3S5OA 4AYID 1CC3A 3VH8G 4YHNB 2R29H 1WE5A 1TYGA 2XKSA 2ZVIA 3IFPB 3RX5A 4JDYA 1TZAA 2YMTA 4AVHA 1MQRA 3GYCA 1A21A 2XVKA 4ABVA 1AODA 4XVTH 2LLEA 1XQKA 4P2AA 1OO2A 4GEIA 4MNQE 2LAAA 4L1XA 3OAZH 3ZJ6A 1WT5C 3NA4A 4ORGB 4AMKH 5LXGL 3A12A 4FG6C 3RL2A 5AB0A 1FY6A 4K9EH 4BXVA 1NBQA 5JYLA 7ENLA 4K94C 5DD3L 2R39A 2VX7A 1TWIA 1OLLA 4LAOA 5BW6A 5JIMA 3ZVHA 2APTA 2P48B 4TMPA 5JMRA 4KWOA 4S1RH 2Z7UA 2ANUA 1FSKC 1NBVL 1OCWL 3RAJH 1BTCA 4HUCA 5A2AA 2XZCH 3PTDA 4IIQA 1Z6JT 1NAKL 1OKEA 2HVKA 3EKCA 4IDLA 1CX9A 1P43A 1KB9K 1TWDA 3BMXA 4HD9A 1EK3A 2PWUA 1EJUC 4ZDHB 3STCA 5KJ4A 5BZDA 2OP4H 4G8FB 1UACH 4TSBH 1VZIA 4KHTH 1G84A 3LHAA 1ZB5A 4MKNA 2FHFA 3C2RA 1U33A 3W86A 4OV9A 5SX4I 4YDIH 3NPVA 4YVPA 1PTZA 3BKJH 4IBSA 3WEMA 4EQ2A 3GNOA 1KGXA 3FQUA 1MDLA 3Q44A 4TLSA 1S8DA 1N8ZB 3OVRA 1BF6A 5KJRL 4PRIA 1PKYA 1B3OA 1WO2A 1M2OA 2VFHA 5CZTA 5F4SA 1VFHA 5D6CA 2FEJA 1RZQA 2FHBA 1FRBA 2WXHA 5D1QE 2A9BA 4PA8A 4XKYB 3K91A 1D5IL 4G7SB 3N19B 1I85A 1W72A 5TD4A 1ISWA 1CK0L 2XWTA 1HCVA 3I2CL 3M7WA 3A4FA 3N2JA 4LNRB 4M7ZB 4ZOCA 2VXNA 3IDXL 1L9NA 4O2FA 3CSPA 2JCWA 2BCKA 4YUEH 1CTMA 1HL4A 1CTNA 4FQIH 1JYWA 1EF3A 1XCFA 3PUDA 5LHFA 2NX5E 2ON3A 2FX9L 1X7SA 2CHZA 4TNWK 3ENEA 4QUOA 4LSVH 1XYLA 3KBNA 3QDAA 3K0WA 4CC4A 1ZTVA 2J6EL 3C8FA 2EXWD 3BWAB 4NPYB 5MI0B 3UGUA 1GYNA 1ZBWA 4Q8QA 4OV5B 5TAOA 4UQ3A 1XRFA 1JMZA 4TNVK 4MPQA 3OF6D 5D1XB 4P5TA 1RU9H 3TH3T 3BPLB 5HHQB 1YADA 5K59E 4IRJA 3EYSL 1SF3A 1AKJD 3IFPA 5D96C 4Z3JA 3EPMA 4JB9L 1E9ZB 4OQTL 2FQEA 2JI1A 3AQYA 4DKFL 4PJXE 3VFOA 3VXUB 5I2IB 1YY9D 1XYAA 3G1XA 5TFSH 2XWZA 4QQ3A 4N6EA 1IC7L 5A6AA 1M7DB 4F2MA 4IWWA 4KTGA 4WJG3 3D06A 4NAJA 1A14L 3T8MA 1WQVT 1UJ3A 3FNDA 1J5TA 2A5UA 3OKDB 4FXGC 3A4WA 4U3XA 2X0UA 2ZC1A 3B5TA 1QJWA 1XIMA 1FNFA 3BEWA 1MG3C 3EBHA 1UENA 1XL6A 3G5EA 4Z2HA 1CXHA 5HWNA 3OBAA 4L9LA 4NGHH 3TT3H 4GSQA 4JQXC 4L61A 3BN9C 4JW3A 3LQLA 1EVTC 2DSUA 3PJLA 4QLJA 4XP9L 1RL1A 2XTJB 3ULUE 2GUOA 1Q72L 5H91A 3QWQB 5T3XE 4O1EA 5DMLA 3WSQH 2VGLM 3ZHLA 3B2XA 4XHJC 3REWA 3PZOA 2C1GA 5DXYA 1KTDB 3FH7A 3QIBD 4PGEB 4Y2DB 5HD8C 3BDYL 3O2DL 2GAZA 4PJ9D 3VFNA 4NOBA 1CI1A 4AIXA 1DVFD 2WKLA 4LARL 4TSAL 1DE4B 3H9ZA 4UANA 2VSCA 1CCWB 2EPLX 1RPQA 4PHZA 4B5VA 4WUKH 4PLJC 4OT1H 4ZS6C 1KEMH 3V4VL 2PGEA 4ZTXA 2EIDA 2JKXA 1V3HA 2WJFA 1L8NA 3O2VH 4Y2OA 1PLBA 4HUWA 5F3BB 5B80A 1ZP4A 1U93B 2F8OA 4UF7C 3VOGA 2G60H 2NLJB 2R94A 3UJJH 2K7PA 4I5BA 2YEQA 2PUQT 2Z27A 3CL6A 4LESA 5EBAA 1WFOA 4NHCL 1WBHA 3BAWA 3D3FA 4QP0A 4AZIA 5I6MA 4MWAE 3DPBB 4YDNA 2J8FA 2VO8A 3HLAA 2EYRB 1JZFA 3DARA 3IDYB 4DUVA 4IMFA 3RO6A 3IVTA 1J96A 3EW3B 3S5NA 3KTCA 2CIIB 2WO5A 3IANA 2CBIA 2E75C 3G1HA 5HBFA 1KM6A 1XICA 5I74C 1BQHA 1G1YA 5KAQF 4RDYA 5CPMA 3F7YA 2BNUA 3D4ZA 2J88H 3JWNC 4K2UL 4ZSOA 3ATEA 5IF0B 3U4KA 3JWOL 2BVWA 4Q6YA 4O10A 1EZVX 1KIPB 3O81A 1OGAD 4J3TA 3NESA 1KR0A 3VNLA 4IOSD 4M4RA 1UM4L 5CEYB 3RNKA 4QRRA 4PBFA 4N90D 4GCAA 3WH9A 4MOZA 1DBJH 2Y07H 1XSOA 2X1XR 5FGCB 4Q6JA 2W60B 5LGZA 3UPBA 3H8NA 4PRPD 1R3IL 2G2PA 1RJPA 2DSVA 4F57H 4ZODA 4PTUB 4HOXA 1DL7H 2C7UA 3HMWL 5AYUH 2FTAA 2CLVA 2KPWA 2OXHB 4ELKA 5IB1B 1BD0A 1M6UA 3QISA 4OJAA 3LMJL 4W1TA 4MQXD 4ZS7H 1QRNE 3V6OE 1PIIA 4UZGA 2EDQA 2ZUMA 4WY0A 2HE8A 3AZTA 4AE1A 3LH9A 4URIA 1BQLL 2QLVB 1GYMA 4OVXA 1QFWL 3ME3A 3ESPA 4FA7B 2A3HA 4BDVB 5C2GA 2FZDA 5INCB 3L81A 5EYWA 5L4IA 3SIZA 3UPMA 1EDYA 3BVXA 3ECVA 2AANA 1I7RB 3LRSA 2OMTA 1IAIM 1MPAL 2W0KA 4PJ7B 3EUDA 4LAQH 4BK8A 4Y9NA 1V27A 3FUJA 5KMYA 4DP1X 2BK8A 4IYKA 4Z23A 7A3HA 2VDOB 3WU1A 3I9AA 5AL0A 1UWGH 4I5BB 1NWPA 3ERPA 5TK2A 1L9TA 1QSFD 4AL8C 1AA1B 1N8WA 3NEEA 2PYFA 2A9NL 4P8XA 1WSST 5DA0B 3W11D 4PRPB 3QUKA 4UTJA 1IEWA 4ZCWA 4EN2A 2GKIA 3KLHD 4C6CA 1P5UB 4PH8A 1HHKB 3QQXA 4W81A 1RKRA 2HMID 2EPOA 2FWLB 1A66A 1MCOL 3ILPB 4QY8A 3GAKA 1DIOA 1TQXA 4P3CL 1D5BB 3PDGA 1XGUA 5KUKA 3GDTA 3PPCA 3T0EE 1YTKA 4Q97A 2A7PA 1ZLUH 1M6OA 1R33A 3H2AA 5IREA 4H88H 3UTZB 1BAGA 1KGWA 4PUEA 4ZNCD 2OLAA 2A7NA 2VNCA 1W0WB 2DJMA 4CAGA 3ISIX 2JB5L 5CP7A 3BSMA 4EBQH 4F2FA 4AQAB 2CLZB 1REIA 3NH7L 4ODHH 4JREB 4WNJA 4UTBH 3DFTA 4F27A 3KMDA 1S7SB 4IMLA 3WTXA 2IAMD 5HDLA 3O6KH 1JWMA 4Y90A 2PO6B 1QSFB 4W9HC 2D31B 2DQWA 4JN1L 2O5ZH 2R2EB 1MF2L 4NKMB 4QG6A 1NWTA 1CD1A 5IB1A 1QW8A 4BEUA 4PV8A 1W9UA 3LNIA 3UACA 3VWJA 4G9PA 4XZIA 3QZAA 2JQZA 5AVRB 2W0FA 2FYYB 2P8PB 3EBAA 5IB2B 2OKOA 3BQ5A 4S2SA 2JCCB 3MXVH 2JJSC 4J2PA 3QR1A 2WANA 2OMWB 2C9XA 1AD4A 4N9EA 5GRZA 4JTTA 5C3LD 1LO2H 3LSBA 3TOYA 2A6DB 4UNIA 4RV3A 2QDVA 3PQYD 5FUOL 4E41B 4OZOA 4U0RC 3UC0L 2HG5A 3FUKA 2QF8A 5D2YA 4QD2E 2XG4A 5CHNB 5L88L 1MCDA 2EABA 3H7UA 3GMRA 1NCCL 3L5XL 3FQRB 3RIAF 3P7YA 2XC8A 2CDFA 1UJ3C 4G9FE 5EPMB 1UP0A 4K9EL 4QRTB 4QRPD 3VOFA 1MFDL 4I3GA 4MNHB 5KN5A 4DZAA 5DCCA 2H3XC 3KPLB 2CGRL 4MNGE 4TUJB 5IVOA 3BP4B 4B60A 3RX9A 2VDHA 4HVXA 3GZQA 1I0BA 2B39A 4X5XB 3A0OA 4WWKB 4KOCA 3HLAB 3WJLC 1IAIH 3KLKA 4Z7VB 1S2TA 4B3VA 1XPYA 1RI8A 1SYVA 3SCQA 3E80A 5AVSB 2WZPA 4AQEA 1BJ8A 1FL6B 2HNHA 2EDTA 5D72L 4PMRA 1C8QA 3G0SA 3MDWA 4FHBD 1RAKA 1FZOA 1MIMH 3FUIA 3M0XA 1NCTA 2NW2B 1QNPA 5K3VA 3SE6A 1OE1A 2XWEA 1MJ8L 3UTTE 1TQUA 3UTTA 4JM2B 2F7FA 4ORIA 2R0ZH 3IN0A 4UQ2B 5K9OB 3FU8A 3VOIA 4Y1AB 1V6UA 1QBBA 2WJ7A 2C3HA 3BIBX 4X5QA 4W9GC 5H8DA 2QV5A 3LSCA 4WXYA 2ZD0A 3ZIZA 4CNSA 4U6YA 2UWEA 5BCAA 4AZBA 1OQXA 2CMRL 3MI2A 3U0TA 5KYUB 1E90A 2QT6A 3LDBC 1HKIA 3GTFA 1M3IA 2ZXWB 5GS0H 1YMHA 5FCSH 1EB3A 5AYBA 1MW0A 3GRGA 3L2LA 1KDJA 3B05A 1M6JA 5DN1A 1AQFA 4QS6A 3BDXA 2AEQH 4PJ6A 1DXFA 5REQA 5F7WC 4HV8A 2GJZA 3IXAA 1FZMB 2CD0A 2CBQA 2EIZA 1TPXC 4PRID 1RR2A 1BXNA 1JTPA 1A7PL 1VYSX 1EDTA 1BQSA 3QS2A 1MI3A 1RVKA 2ITCB 5JIWA 1RD6A 1I2PA 1T8QA 2F61A 2DI9A 3HS0A 4K94H 5AVQB 5IQ9A 3RA7H 3DUSB 3WCYA 2BOEX 4AYFB 3NXFA 4XTDA 1IAOB 2FGWL 2ZKHH 4X42A 1T83A 5D1ZD 1L6FA 2FJGA 3NA8A 1F6PA 2CW6A 5IEKB 4PJEB 5HQEA 1ROCA 4Y9PA 2AQ3A 2WMKA 2ROXA 2QCFA 4FFYH 3RX2A 5XINA 3TIEA 1DVYA 1BWKA 4FABH 2GB2A 3ILQC 4LCWD 1Q7ZA 4UFJA 3E38A 4ZE4A 3MOBH 1IC7H 4NHVA 1WAAA 2WXOA 2Z31B 3NIFB 4G8IA 3D0LB 3H6JA 4NO3B 2GVLA 2EG6A 2AXHA 5IEHB 1K2DA 2BIHA 4M7ZC 3FA4A 3XISA 2HZGA 5I1DB 5D05A 2JGQA 3H70A 4GZJA 2PKDA 3N55A 2VQ4A 4HS8L 5TFSL 3CPLA 3N4FA 1SOQA 3JWNG 4A8RA 1UR3M 2ADIA 1DLFL 4KFMA 3UP1A 4GBXB 1JK8A 3QR2A 5B3JE 5JXEA 1DVFB 1L9PA 1Z9MA 4MHHG 1Q72H 4FERA 3CQIA 4QBXA 3WBYA 2NW2A 2ZONA 3BIKB 1YPFA 5KSAA 4DBWA 1WWAX 4WDUA 1PZ5A 3VXQA 4R2GB 1DVSA 1MCFA 5K9OA 4JG0L 1SVDA 1A3RL 3QWNA 3EEZA 3W1PA 4A35A 4HCRL 2HP4A 2APWA 3F83A 3BLEA 1T4KA 3DIFB 3ZYJA 1B0RB 4JRXE 1FHGA 1AZUA 1WAUA 4FSAA 1R5WA 3U6RB 3CJPA 3DMMD 3KPSA 4M6OH 3V5KA 3NGBB 4XV0A 1W2PA 4D9RD 3F6JA 2GCYB 3P4NA 5HSFA 1MRCL 3UADA 1GOHA 3BDYH 4YTSA 3FSAA 1J9CT 1ODZA 4AYGA 3LN3A 2R0LL 3CSYB 3Q05A 2WV3A 5E6IB 3JTTA 4UCGA 1DWGM 5HJBA 1NUNB 1CLCA 4IMEA 5ELIA 5CBJA 1LP9A 1IC5H 2W5PA 3MUZ1 3EOBB 1H60A 1A0DA 1YEIH 2AJZA 3DOHA 3IJHB 4L8BB 1Z32X 5TE4L 4HIHA 2AP2A 2WZPD 2CR0A 3ABKB 5JUEL 3IJSB 2VDNH 3VFPA 3C0SA 5I19H 4ZB0A 1KIRB 1MAMH 3BUBA 2XCMC 3L7FB 3ZL1A 3BO8A 4PTMA 4LCQA 4LKXA 4HU0A 4K2UH 1PDYA 3SGUA 1MW1A 2G4FA 2H45A 1V08A 2DU2A 1PKLA 1C7TA 1SLXA 1I3VA 2C3VB 2YKLL 4Z7NB 1QO2A 1W37A 2AMUA 3V0TA 3WQPA 3CFDB 5LXXA 3QH3A 1FZKB 2XG4B 4JQIL 2WWMD 5TDOB 2CA4A 3MT1A 2B7DT 3Q01A 5IJKC 2VI0A 4V1DB 3DHDA 1WF5A 3O2DA 4E2OA 5IQ7H 4OM1H 4PV9B 3H2FA 3IV3A 4QTFA 3W56A 1PTGA 1XQ4A 5KANG 4WK4B 4JTAA 4RIRA 1OANA 3EXLA 4ZOEA 3QNFA 3PWJB 1W1VA 2VWEE 2VDML 1BZDA 1WZKA 3AWEA 4BFOA 3L9CA 1CFNB 4UT7L 5AYUL 4D8ZA 2M83A 1K8DB 2K6ZA 4PI2A 4QRRE 2NX1A 3O06A 3CQHA 3V0HA 1AFVL 5BOFA 1PLGH 3SKMB 5IVXB 4PVBA 3VC5A 1G9ML 2JK5B 4ODTH 4UAOC 3UZYA 1DQKA 1ZIBA 4JY5H 4X9YA 3DDGA 3KVLA 1JDAA 2UWEF 2P5EE 3TTOA 1FL5B 2I17A 1F02I 1F8TH 4LUTA 5FYKL 3LEYH 3O4LA 2ZF8A 2XIOA 2AXFB 4FYQA 3QULB 1E6JH 1T89C 4XOEA 2DW5A 5E5RB 5MP6H 4BIKA 4ZMTA 2DQDH 2ABBA 4CCZA 1HP5A 3VD5A 3VXRA 5L2JB 1DE5A 2QCHA 3P73B 4ROPA 4ERSL 1XLMA 1YG9A 4QRAA 4PUUA 4KRNA 4NQDD 4M9OA 4OZFB 1FSKB 3DURB 1K5NA 1I8LA 3JTSB 1BMWA 1WD8A 3FTWA 1SMDA 4FNLH 4JQVC 2MJWA 4L5FL 1A49A 1D8CA 1CDGA 1K4CA 1DANU 2VAAB 5C2BL 2R8SH 1UP2A 1AE6L 2F53A 4HPOH 5J6GA 3EYVB 2BHUA 3A4AA 4XODA 3BT0A 2EDFA 4YVNA 1QTWA 5KETA 3S36X 4PRRA 4AITA 2BVYA 3CN1A 2B7QA 1RK6A 2J6VA 3IXAB 4YGVB 4LOEA 5TBOA 3POCA 2DTML 5AKVA 4ZTPL 1SO4A 4EXAA 2VH5L 1BSIA 4U0QB 3KCPB 1DO6A 2H6OA 2VSKB 3L7FA 1SOKA 1J8HD 3GKWL 3UZVB 4R5EA 4P3CH 5EEUA 1N8OE 3KAOA 1E6PA 1V0NA 3ZTCC 1GIGL 1KENH 2CPCA 1JTOA 1U95B 3DGGB 4YZFF 4EIUA 4D6CA 3IKCA 2ITFA 2YSTA 4ZSTA 3KPNA 3QH3B 4OFQA 4Z7OB 3QUGA 4XZ9A 3TJ4A 3E1ZA 3T04D 3L3JB 3O0KA 1ZKAA 4R4ND 5A3ID 2XUWA 4YO0B 3M1OA 5IHHA 5E99L 2E74C 5JDJA 2DYRB 5DZPA 5A7EA 3KS5A 4WHCA 2YRZA 5C07D 2F7IA 4MAUH 1IX2A 3SPVA 1RERA 2YCIX 3GUGA 3O9WB 1RVFH 3W6YA 2ADFH 5ERWB 2EJAA 1P0NA 2Z0BA 4X9SA 3RX4A 6XIAA 1QLRB 2Q8BL 5B8CA 1ZCRA 3DH7A 1UH3A 3AWFA 2VISB 3QORC 5C2UB 3D39D 4I48A 4OSUL 5M94B 4DIAA 3WLNA 1FDLL 4HPXA 1MFEL 3C2AH 1UD8A 3RWCA 4XX6A 5IQNA 3O0LA 1D6VL 4I18C 4OCXH 1NAMB 4IRJC 3LRHA 1BGXH 3MA9L 3U9UA 2QFPA 4ZMZA 1ME9A 2BGQA 4Z7WF 3HKZA 5FUOH 1AHWA 5EIQA 2CKRA 1UZ6E 4W68A 3OKMA 1WFNA 3W74A 1V55B 4OZFA 1P0EA 4IBQA 2C1OA 4G8GE 4RPQA 4PJCA 3P4NB 3UPAA 2J8UF 3EDJA 3LN4B 4OFVA 1DVUA 2MANA 4JTRA 5ALCL 4AWJC 1P2CB 2G3NA 4MY8A 4C60A 4UB0L 3GTIA 3WXWH 3LQZA 1HHJA 4IRSB 5ACLA 4X6EB 3DX9B 5K5YA 1B31A 4MAYB 2QCDB 2DM2A 4J2XA 3ZTDC 1NWSA 2NNXA 1KJ3L 3LB6D 1U8JA 3GYRA 3VXPB 3NZGA 6CGTA 5FO7A 4R97C 3I65A 1JFQH 3FA3A 4HPGA 1MIEL 4F1ZA 2E5BA 5C0QA 2XPYA 5E9AA 4LBUA 4LNVA 2G4JA 1OX4B 1YNLL 2HH0L 1MIML 3ZQXA 3U5UA 3PE9A 1FNHA 3KFTA 2MKWA 2XY2A 5EU3A 4S1SL 4YHLH 1B3WA 3SN0A 3PNZA 3BAYA 2VMDA 3UBGA 2OLSA 3VAEA 4BELD 5KVDE 3QSKB 5DGRA 2DUZA 2RKXA 3GBML 2XSKA 2FQIA 4LANA 1FZKA 4A2SA 5HHMB 5A16A 5SWSB 3OHXB 3M43A 1VRSA 3V79C 3ZVVA 1FZJB 1I3GH 1S9YA 1TMHA 4W86A 2HCVA 1ONXA 3A22A 3TA3A 5DGQA 1WWCA 3VG9C