1QPKA

Mutant (d193g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFGFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (MALTOTETRAOSE-FORMING AMYLASE)
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
total genus 145
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qpkA01
4YPJA 2BHYA 1E1FA 2CERA 2J62A 4UFKA 3O9NA 3VOCA 2ZUTA 1C92A 3AMKA 1JZ6A 1WDQA 3PTMA 3D52A 3CZLA 3AXHA 3WNMA 4WF7A 4X0VA 4HTYA 5A6JA 4NRRA 2D24A 3L4TA 1K9DA 2EPOA 1EOMA 1M04A 1XV8A 2BS9A 4UFJA 4W5UA 1IZJA 5A95A 4BQ5A 1UR4A 1OT1A 1PEZA 4UFMA 2VZOA 2F1AA 3E1F1 3AS0A 3KWXA 1J0JA 3RILA 4N0RA 3WQ8A 1B2YA 4JHZA 1BPLB 1GOMA 5LA1A 3A23A 1KXTA 4DO6A 3DDFA 1XH2A 1YHTA 3DYOA 1VBRA 3AZTA 1EDTA 1D7FA 5A8QA 3D5HA 2JIEA 3T0AA 4HPHA 2VVNA 4CD6A 4QDMA 1DWFM 3WQVA 3L4WA 3BGAA 1MFVA 1K9FA 5CJ5A 4PTVA 1M01A 1JL8A 5FD0A 2WWCA 1KXQA 3WNOA 2XFRA 1C8QA 1E72M 2X2HA 1GOKA 1W9BM 2J75A 2WZHA 3AMCA 3LRKA 2E0PA 1FH7A 1NWSA 3NUKA 1UR2A 4DUWA 2E9BA 1UA7A 2FHBA 4PMDA 1EIBA 9CGTA 4CD8A 4B9YA 1GCYA 2PWGA 2F2HA 4QAWA 2Y5EA 3HG5A 2F7OA 3VD3A 1BYAA 1V0LA 3VINA 1R7AA 1M53A 4QCEA 4HZ6A 1XRVA 1B3WA 2J7EA 2VMFA 3MU7A 1NWTA 1A47A 1W2VA 5E70A 2XUCA 2TAAA 2YDQA 1QI5A 4OGZA 2CIPA 2QPSA 1OGBA 4M80A 1CPUA 1DWHM 3ZSTA 1TVNA 1M7XA 3D50A 2FH8A 3A21A 4MB1A 1VFUA 3NSNA 1GVIA 1LF1A 3K46A 4ACZB 3G6LA 1XSJA 3ZT6A 4FNSA 2IXUA 3GYCA 1L0PA 3AIWA 3WUFA 4TVDA 1BG4A 2WSPA 1K9EA 2WK2A 4WSKA 1EA9C 3CLWA 1JF6A 3OLEA 2OWXA 3BAXA 3EBVA 1WZMA 1KWKA 1JZ8A 4EK7A 4AMWA 1UZ1A 1E43A 3N9KA 2YFNA 4FLOA 3TOPA 4E8DA 5DFAA 1PAMA 2WMFA 1X1NA 1KCLA 1CGYA 3SURA 3VIOA 1TE1A 4HOZA 3HJEA 2WVUA 3BVVA 3MANA 3CHDA 3NCOA 4UZSA 1XD0A 2C0HA 5F7UA 3N11A 4Q22A 3WL1A 4WKFA 1WE5A 2NW0A 4D72A 1GOWA 4W84A 5TD4A 1GZJA 2VZSA 1NARA 3VIFA 2E4TA 1J18A 1GVYA 4LGXA 3CHEA 3ZSSA 1WCGA 1HL9A 3QR3A 4C7GA 2WM0A 1HJVA 1LL4A 1W3KA 1FOBA 1JFXA 1E9LA 3PZTA 4AD4A 2X2IA 3CH9A 3WQ4A 3H53A 3A22A 3VDBA 4P7QA 4OKDA 1B1YA 3LX9A 2CXGA 2VCBA 1CGXA 3PTKA 1VEOA 4ACYA 1MXDA 1ITXA 3LXAA 3GNPA 3MMUA 2E3ZA 2CHOA 2DQXA 2AAAA 2V3GA 5LYRA 2XN0A 1QNQA 1TQSA 4S3JA 5E09A 2PWEA 3PTQA 2JEPA 3SCOA 1PX8A 1QBAA 4U2ZA 4A3HA 2W63A 5DT5A 3ARWA 3BLKA 5JIPA 3KEHA 1WKYA 4PTXA 2A3BA 3H54A 4B9ZA 3CGTA 2X05A 1OD8A 2XWDA 5A6SA 5A8NA 1BSIA 3VGBA 4GXPA 2J79A 3GNOA 3HZ3A 4D6CA 4FLQA 1HJXA 1BYBA 2ZUWA 1BGAA 2VZVA 5CSUA 4P8UA 3BH4A 2PWFA 1YQ2A 4V2XA 3WH6A 2CKSA 2D73A 3LPOA 2ZX5A 3CIVA 1XYFA 3VIKA 2D20A 3SUVA 3T2PA 3WMBA 3EDJA 3QHOA 5EFFA 1M03A 3VSTA 1VIWA 4U5KA 1SMDA 4J3WA 3MMDA 1J0HA 4CN6A 2VI0A 2BNJA 1J0YA 4AZHA 1WPCA 3MV11 1X6LA 5AY7A 4BZYA 2YDRA 4PTMA 3WH9A 1BF2A 3WFLA 4P8WA 2BXZA 4B3KA 5KZ6A 4J3XA 3U5UA 1E5NA 1V3LA 1J01A 1V03A 2WW5A 3CZKA 4LXFA 5HXMA 3EMQA 4U3CA 3VIJA 4OUEA 7A3HA 2OSWA 1V3MA 1E6NA 1R8LA 2VZUA 4MDOA 4PYSA 2Q8XA 4J3UA 2Z1KA 2A3AA 2WBGA 1VBUA 2YA1A 2ZX6A 5GNZA 3HU7A 1WB0A 4MAVA 1UH3A 4XX6A 4CCCA 1UWIA 2FE0A 2WMHA 5CPQA 5CQ1A 1AMYA 8CGTA 5ABFA 1UQZA 4PCSA 1XSKA 2BVTA 2WC4A 2FDMA 1VENA 3S5YA 4KRUA 4AZIA 3AHTA 4HMDA 2CCRA 2YA0A 3IAPA 3FHAA 2WBKA 2E8YA 1UD4A 1WDSA 1EOKA 2Y24A 2J8FA 3CUJA 1GHRA 5CLWA 4DWSA 3GXTA 5A2BA 1MW0A 3I3BA 4UOJA 1OB0A 1R47A 3VM7A 1NOWA 5FOOA 4DO5A 3VD4A 4PRWA 2XVLA 4M24A 2ALWA 1E6PA 1JYNA 2VCAA 2W62A 3T0BA 5JBFA 1OGGA 2VZTA 1WDRA 3W0KA 3ALGA 3WIJA 5I6SA 3BVXA 1GQJA 5A6LA 4FK9A 3M6DA 2DSUA 4UOZA 2DIEA 1B3YA 2WMIB 1QOXA 1R46A 2VQUA 3BMWA 3L2MA 4AZ6A 1V08A 3WD2A 3WEZA 5CXPA 1V3IA 3PBGA 4PMOA 2XTKA 4LYRA 3K4DA 4MJ2A 3T08A 5E9AA 3AZRA 3MUZ1 2W5FA 4D1IA 3WDQA 3ARXA 4JFUA 3FAWA 4DUXA 4FLRA 5HPOA 2OWWA 1NWUA 2Y2WA 1O7AA 3DHUA 2X1IA 2OLHA 1Y7VA 1KR0A 4HPGA 3WQWA 4MAZA 5A2AA 2JFEX 3RIKA 3N12A 1CECA 2BY1A 1OGSA 4ZFMA 3L4ZA 4GKLA 1UA3A 2DSKA 4RE4A 1CXIA 2IGTA 2JEQA 2CETA 3EJSA 1JD9A 4AMXA 3WD4A 1DP0A 2DDXA 1D3CA 2OSYA 1NP0A 2J7HA 3SCTA 4UFHA 1C7SA 4P7LA 4HA1A 1UKOA 1W3HA 2VL4A 3CUGA 4ZXLA 5HPCA 1JNEA 1RD6A 5DT7A 2DH2A 4MNMA 4LYQA 3HN3A 1MVYA 3EDDA 4GO8A 3B8SA 3L2LA 2BHZA 4Z2JA 3D51A 1GNXA 4A4AA 3GBDA 4AIEA 1TQVA 1CGVA 2VX4A 2YJQA 2V38A 1W1VA 1HXJA 3VX1A 3WUGA 1GONA 4PSRA 1BVNP 3ZM8A 1TFVA 2VVSA 3ARSA 5A8OA 2W91A 1Q6EA 1HXKA 2J7BA 3HG2A 5D8ZA 3ZJ8A 1ZBKA 4HMCA 1PBGA 1JZ7A 1NM9A 4U3AA 4QLKA 5D9PA 2CBUA 4A3YA 1BGGA 3B9EA 1W32A 2WLZA 3WBAA 1LJYA 1GOOA 4ML4A 2ZWYA 1G01A 1C3FA 1JI1A 4FLSA 1T0OA 1XCXA 3WUBA 1FP8A 4L4PA 3MV01 1C8YA 3VGFA 2D23A 3MKKA 1JDDA 4JL1A 3W29A 1QNPA 3M7SA 4C7DA 1UD8A 1EH9A 4P7OA 1AQMA 1LLOA 2EPMX 1PZ2A 3A6OA 3ZR5A 2C7FA 1J10A 2YDSA 3N1AA 1MYRA 4AD5A 3JUGA 3PZOA 5JBEA 1V02E 5M17A 1B90A 2D1ZA 3OA5A 4UFIA 4E8CA 4UQEA 4PEEA 3LPFA 3PZNA 3UETA 5BCAA 3CTTA 1W3LA 1UKPA 4QFUA 3MSDA 1SZNA 2AOSA 1JZ4A 2J25A 3T2QA 2YA2A 4NRSA 1JAEA 4GQRA 4D6JA 2X2YA 2XVKA 4MTVA 1BYDA 1KWGA 4F8XA 1BLIA 2G3NA 4ZEPA 4CVWA 4OBRA 1OWQA 1E3XA 1CGUA 3N17A 2OYMA 4AD2A 2ESCA 3ZIZA 4PMYA 3MS8A 4HU0A 4W7VA 3ARZA 2WCGA 1ISWA 3CUFA 4NF7A 5I77A 3B9DA 3OBAA 2VNCA 1GPFA 1W9PA 3FN9A 3ZJ6A 4J3VA 4UZUA 3AIUA 1CGWA 2QHAA 3NDYA 1H4PA 1QHPA 4D6HA 2ZIDA 1HNYA 5A6KA 5AYBA 5AC5A 2HISA 1GOIA 3D3AA 3KL5A 1E55A 1IZKA 3KE0A 1C90A 4XV0A 1I1WA 1JF5A 3O2LA 1Q6CA 3AIVA 5M5DA 3RM9A 5M3WA 1TA3B 3G6MA 3A24A 3EYPA 1FH8A 4HA3A 3DX4A 1GHSA 1KGWA 2WPGA 1V6VA 1VFFA 2EAEA 1E1EA 2FYVA 3EJQA 3GM8A 1KXHA 4M8UA 2YBUA 4C7FA 1KBKA 4J7RA 1B9ZA 4CUCA 3M07A 1LL6A 3VIMA 2XVGA 4PN2A 5EMYA 2ZUVA 3N15A 1ZU8A 1LG2A 2CPUA 5I78A 2GJRA 3VDAA 2NT1A 2CBIA 2BXYA 1OD0A 2W67A 1TVPA 2GFTA 5E6YA 3AYSA 4F66A 3IJ7A 1QI3A 1RP8A 3AI0A 1GORA 1KCKA 4M81A 3EDEA 2Y8VA 3QGVA 4PMNA 5D9OA 3K8MA 3N04A 1JGIA 3SUUA 1KFWA 3RDKA 3UR8A 3DECA 3UR7A 3T2OA 1UZ4A 3GDBA 4H41A 4R27A 1TZ7A 3RJYA 4QCFA 1HX0A 2WVTA 1W2PA 3W38A 1TQTA 1A3HA 2EPNA 1OBAA 3GTNA 2XVPA 4DWSC 5CGTA 3AOFA 5CZKA 4PMVA 4GI8A 4Z2KA 4RE2A 1VFOA 3IAQA 2EADA 2AMGA 2WAGA 2DSZA 1V02A 1EHNA 5M03A 1U2YA 1E4NA 2D22A 5BROA 3K4AA 3W24A 2FGLA 3A3HA 4U2YA 4BF7A 1H1NA 2O9OA 3FXYA 4MDPA 2E8ZA 2CBVA 4YN5A 1HF6A 1G94A 1R7OA 3VSUA 1V0KA 3BLBA 3LRMA 1VJZA 1E0XA 3OGRA 1TR1A 2BFGA 3EDKA 1HL8A 3CBWA 3BAYA 3KLLA 4AC1X 4TVCA 1JZ5A 2HVMA 4NXKA 3KL0A 2UWFA 2QV4A 1UD3A 4OIFA 1MW2A 1HP4A 2W66A 1EO7A 1O6IA 4D1JA 5BXTA 3BUPA 3ZO9A 3AXXA 5CPSA 3K8LA 5ABHA 1J9YA 2DEPA 2VR4A 1HJUA 5FL1A 3BSHA 2WCAA 5A6BA 2VX5A 1W1TA 1J0IA 2ZXDA 4U31A 3RJXA 4QLJA 2WHJA 1SR0A 3PZMA 1UH2A 2ZX9A 2YLLA 1B3ZA 1E6RA 4AEEA 2J78A 1QI4A 4K68A 1BVZA 1C93A 3AZSA 4AWEA 4AZCB 2A3EA 3HMCA 1XD1A 1PZ3A 4GINA 3UG3A 4R5EA 1JXJA 2PC8A 3VMOA 1HN1A 4AXNA 2F7PA 3B9AA 2XGBA 3TTOA 2QMJA 3F5KA 5JBDA 1E0WA 2QPUA 5CG0A 1CXLA 2PI6A 3TTQA 4ACZA 1K9TA 3GXIA 2GJXA 3EDFA 1I1XA 3O6AA 4H7VA 4F9JA 1ZL1A 4HOXA 3UCQA 4DO4A 3W6LA 2DT1A 3FAXA 2XFYA 2ZUNA 2ZX8A 4WSJA 3LPGA 5IFTA 1ISXA 3ZQ9A 3APGA 3FNDA 4PTWA 1J12A 1HP5A 2WMJA 1NWRA 1CENA 1UWTA 2Y4SA 3PZVA 1R33A 1H5VA 5GPRA 2EEXA 2VUYA 1PX3A 5E6ZA 3AROA 2WVSA 3GXDA 1E3ZA 1ISZA 1BG9A 2WZEA 1XH0A 3CZSA 4X9YA 2JIWA 4CU6A 7CGTA 2ZUSA 1QVBA 5GNXA 3AIEA 5I5RA 3AIRA 1KB3A 2NSXA 3T0DA 8A3HA 2WYSA 3W53A 1FA2A 3AISA 1UKTA 5IXEA 3ARVA 3WF0A 3WNNA 1KXVA 2ZUMA 3WH7A 1AVAA 1HKKA 3VO0A 4W8LA 2D0HA 2OSXA 2J74A 4ZENA 2X2JA 2IXVA 5C8BB 5ABFB 3H55A 2J47A 2EJ1A 1E0VA 1SFSA 1H3GA 2DT3A 1NH6A 4HU8A 3UG4A 4OZOA 3BAJA 2G4FA 1QPKA 5HBFA 2YIHA 4H8UA 1WZLA 1ISVA 1H41A 1QBBA 1GQIA 3IJ9A 1E6QM 4Z2LA 3LXBA 2NT0A 1HJQA 1TQUA 2BVYA 3ARQA 5CSYA 3WL0A 3F4VA 2GJPA 1OM0A 3I3DA 1CLVA 3WENA 1QWUA 1QNRA 5EFDA 3OLDA 3SCUA 2GUYA 4JIEA 5ECUA 1OCQA 1CTNA 3WMCA 3L4VA 2O9PA 3W27A 3VNYA 3L4UA 3A47A 4LPCA 1LQ0A 2VX6A 2WVVB 4JFTA 1V3KA 4ATLA 2VQTA 4WIWA 4CU8A 3HG3A 4E2OA 4ZE4A 1H49A 3WNLA 1E5JA 4AISA 3ZJ7A 3U57A 2EQDA 1WP6A 4EKJA 4FNQA 3PZ9A 4D6EA 1ZBCA 3POHA 4PCTA 1G5AA 4QLLA 1F4HA 2YL9A 4UTFA 3OG2A 1E6XM 3K8KA 1Q6GA 2VURA 4D6FA 2CYGA 3TONA 4WJXA 2V3EA 3PN8A 4OOUA 4B16A 1UKQA 2PBGA 1V3JA 2GK1A 1F4AA 3KZSA 2V5CA 2C8NA 3MI6A 4UQ9A 1BQCA 2XGIA 1FFRA 3D4YA 4NZFA 1WZAA 3DYMA 4W8BA 1HVXA 3BAKA 5E1QA 2RGLA 5FKYA 3WY2A 3RO8A 4AMCA 2FHFA 3ZR6A 3N18A 4ZXOA 4EANA 5A1AA 4JKKA 2XJ7A 3DX1A 4AZGA 4PUDA 2JALA 2EXOA 2XSAA 2G3IA 4KRTA 2XM2A 3CUHA 2DT0A 2WHKA 4JKLA 3VDHA 4W88A 4AYGA 2EPLX 2WZIA 3NJ3A 3QOMA 2XIIA 1VF8A 1PPIA 1KQYA 2DGAA 1B3XA 4D6IA 4BA0A 1CXEA 2E9LA 4JFSA 4XZBA 4MPKA 3II1A 4MB5A 4CKQA 3BCFA 4FNTA 1QI0A 3W26A 3AYRA 4UNIA 1LL7A 3VIGA 1NP2A 4FMVA 3PHAA 1AQ0A 5I3DA 4ATWA 3LRLA 2W61A 1K6AA 2FH6A 4CD7A 3N13A 1MQPA 3SCQA 4CCDA 5LA0A 3SCPA 3VGHA 4AEFA 2E40A 4P7NA 1BHGA 1VFMA 1EGZA 5BYWA 5CGMA 3WKZA 3D4ZA 1FFQA 1US2A 3TTSA 4W7WA 2PWHA 3MUY1 3ZT7A 3GXPA 3LXCA 2MANA 4UR9A 3CZGA 3BLPX 3IJ8A 1VEMA 1N82A 1XGZA 1V3HA 1OT2A 5A2CA 3AQUA 3ECQA 3QHNA 3DX0A 2CNCA 4U33A 2BV9A 4B3LA 1UQYA 5I23A 5A6AA 3AIQA 1KTBA 1ODUA 2VRKA 3VKKA 4CCEA 1C8XA 1UR0A 4HP5A 2O9RA 3TA9A 1JIBA 3AS3A 5DO8A 1VB9A 1IV8A 3OLGA 4M56A 1CXHA 1CNVA 5IDIA 1UKSA 2VOTA 5DEZA 3KLKA 1PIFA 5A8MA 1KQZA 2XG9A 3EJTA 2PB1A 3THDA 5D9NA 1KGUA 2EBNA 4TVUA 4W5ZA 3L4YA 6A3HA 1Z32X 4GIAA 3PZUA 1LWHA 4F79A 3OLIA 3FW6A 1UD6A 1MW1A 1L8NA 1C7TA 4PMXA 1EDGA 2V5DA 1NOFA 4JL2A 1V0NA 6CGTA 1FHLA 2F7RA 4H8VA 1EDQA 3NSXA 4TX8A 3CHFA 3BVWA 1VAHA 1UOKA 3A4XA 5E0CA 4HZ8A 1C91A 4TUFA 3QHMA 3CZJA 1UUQA 4UQBA 3AHZA 3U7BA 4CU7A 2UY5A 4GI6A 3UEQA 3CHCA 4PUEA 1BYCA 5A6MA 2WXDM 5ABEA 4AW7A 4KWUA 3MMWA 5JUVA 3AMGA 1UH4A 2PBOA 1W1PA 4CD4A 3BMVA 1J0ZA 2XVNA 2WHMA 1E71M 2ZOXA 3OGVA 1CZ1A 4H04A 2F18A 4J27A 4CGTA 3SUWA 3BUBA 3QOKA 3OZOA 1NQ6A 2Y8KA 1EHAA 2WKGA 3ARYA 1MWOA 1WNOA 3CZEA 1GW1A 1S46A 1ODZA 5AYIA 3VIIA 4IPLA 2F7QA 5BRPA 3W25A 2A3CA 2CBJA 4XB3A 4W87A 2UY2A 1J0KA 3VSVA 4NSBA 4QP0A 1LWJA 5BRQA 3CMJA 2EABA 1VRXA 3GXMA 3OB8A 1JAKA 3BXWA 2WANA 4UQCA 3VIPA 1MW3A 1W9UA 1V6WA 3AICA 4AD3A 3UG5A 3OZPA 3AHVA 4MADA 1W9DM 2WSKA 3EJUA 2WB5A 1ESWA 2G3JA 1CWYA 3WMSA 1PS3A 4LQ1A 1JDAA 3K1DA 2XHYA 4IPNB 2UY3A 1BFNA 2J7GA 3WNKA 3OIHA 4FF5A 5BXRA 4KH2A 4CD5A 3AS2A 3UERA 3ARTA 4N42A 4M29A 2GVYA 2X09A 1WO2A 1LG1A 1ZB5A 2O9TA 3VMNA 4UOQA 3GNRA 4IM4A 5IHSA 3WDPP 3IANA 2CHNA 1OINA 1DEDA 2FGZA 1HKMA 4J3SA 4FNRA 1HTYA 1XYZA 2QLYA 1E15A 4AIUA 1DWAM 4OBSA 3CO4A 4YHEA 5D9MA 2OYLA 2OW6A 1W9VA 4GQQA 2YFOA 3VIHA 1CXKA 1GQLA 2YL5A 3VMPA 1CXFA 3WNPA 3J7HA 4NX0A 1CDGA 1E6SM 1B31A 4B15A 1H2JA 3CV5A 1PJ9A 2IUZA 4AZ7A 1ZJAA 4Z2IA 1ECEA 2XM1A 2WMGA 3DHPA 3VNZA 2B31A 5ABGA 3VILA 3VUPA 1JZ3A 1WZKA 1WDPA 2D2OA 3ZJKA 1U30A 4W93A 1GJUA 1W9XA 1H11A 3SCWA 1GQKA 1TA3A 1R75A 1E70M 5BXPA 5I79A 1HKJA 1UWUA 3VDCA 4AD1A 3WDJA 1MQQA 4EE9A 3WBEA 3TV8A 3NSMA 3WN6A 4WKAA 3MUAA 4GPNA 4RL3A 3GXFA 1GUVA 3W37A 3I3EA 3SEPA 7TAAA 2GJXB 3NDZA 2YOCA 5FL0A 1XH1A 4X0NA 1G9HA 2VTFA 4YHGA 5DMYA 1EQCA 1SYTA 3VVGA 4GZIA 3GH7A 3ALFA 1IT0A 3A4WA 1R85A 4HZ7A 3BC9A 4H2CA 1E56A 1UR8A 3NIYA 3ZMRA 4DWSD 2V3DA 3IK2A 1DHKA 1QHOA 2XIBA 4GO9A 1H0GA 3ARPA 2F1BA 3VD5A 4D6GA 5A69A 2XWEA 4W85A 4UQAA 3AMLA 4MJ4A 2VRQA 1TCMA 1VJSA 2BVDA 3A5VA 4BQ2A 2PF0A 1KR1A 3M46A 3WF4A 2XN2A 1ZBWA 1CEOA 4BCEA 4P7RA 4V27A 1JYVA 3CUIA 3A4AA 2X0HA 3WH8A 3FY1A 3FHQA 1OSEA 4AYSA 2CESA 1UD2A 2G41A 4J28A 1PIGA 2FHCA 3WDRA 2WKLA 4Z2HA 1R87A 2BY2A 2XN1A 1Q6DA 3AXIA 2J7CA 2WNWA 3WEMA 3WF2A 3WDHA 2VRJA 3WD0A 4LYPA 2DSWA 1UG6A 3NYDA 4KGJA 4CVUA 1JNDA 2JE8A 4JZ5A 4GZEA 2G8ZA 2VCCA 2CEQA 3WF1A 4AIOA 3GBEA 1E4MM 3SCSA 2DIJA 1CLXA 2OYKA 3ARRA 4DM1A 5D8WA 2JF7A 3U7VA 4TTGA 1R86A 2WLYA 3GH5A 4IUGA 2ZWZA 2DH3A 4JFWA 5JIWA 2QF8A 4BQ3A 2W92A 1CYGA 1WAWA 3AFBA 1QX1A 1HJSA 5A3HA 1H09A 5E0FA 3SUSA 1QWNA 1G0CA 2A3HA 1W91A 1E4LA 4Z2GA 4URIA 1B0IA 5KEZA 2VJXA 4JKMA 2VO5A 1HIZA 4AZCA 3LMYA 1ZS2A 1TQWA 4NXSA 3WSUA 1DTUA 4HOWA 5I2UA 4PMUA 3SCNA 3VD7A 1DWJM 4PMRA 1JI2A 3F5JA 1QNOA 1FP9A 3WF3A 1I75A 3VGDA 1DWGM 2XPKA 1E73M 3ZT5A 2GSJA 3VTRA 2YL6A 3BUDA 4MNJA 3MO4A 1JDCA 2EO7A 4W86A 3CMGA 1QW8A 4DWSB 1RPKA 4M1RA 5GQBA 3S6TA 4PSPA 2GK1B 4WKHA 1G1YA 5IHRA 1XSIA 5EBAA 1W3JA 3VM5A 1CIUA 3CZ8A 2VR5A 4D6DA 2D3NA 4CN1A 3KL3A 4GZJA 5EB8A 1QW9A 1AQHA 3AJ7A 4UFLA 6TAAA 2CKRA 3CPUA 3WY3A 2YLAA 3W4RA 2WWDA 4NI3A 4TOQA 2W4XA 3MUIA 4LX4A 5A8PA 2J7FA 2GDUA 2VT0A 4GI9A 1NOUA 1QNSA 1V6UA 3WFZA 2WC3A 1KTCA 4F9DA 2D3LA 2RGMA 4H8HA 4IISA 5CPTA 2OW7A 1XHGA 3RM4A 1GOQA 1Q6FA 3DC0A 4NZCA 1BTCA 3VU2A 4RE3A 3EMZA 1JD7A 3OGSA 1QI2A 2XYLA 2ZXAA 3VX0A 1B30A 3AMDA 1JFHA 2G3MA 1HKIA 3F5LA 1EO5A 3SIMA 2J77A 3RMEA 2PWDA 2DT2A 2XFFA 1RP9A 4EAMA 1SMAA 4Y7EA 2ZXQA 4CN4A 1FH9A 4KGLA 3W6MA 5CLTA 1UYQA 4DUVA 3VD9A 4UCFA 5FCZA 3WY4A 4NZJA 2X0YA 1EXPA 1CGTA 5C71A 5A94A 4L4OA 4AD0A 3WELA 3THCA 1OIFA 1JYXA 5HOSA 4KMQA 1ZJBA 2XSBA 3WDIA 4M82A 3CC1A 3EJRA 1U33A 3GXNA 4MNLA 4P8XA 3VGEA 4HA4A 4WLCA 2ZE0A 4JCLA 1JZ2A 1US3A 1PX4A 1R34A 1E40A 2VX7A 1Q4NX 2WHLA 3WQ6A 4PBGA 1QHZA 5BXSA 2WVVA 1UWRA 2YBTA 4MB4A 1B3VA 3CZNA 1UASA 2BY0A 3TTYA 3RM8A 5C70A 2YKKA 4JHOA 4AZ5A 3DX2A 2VC9A 2ZX7A 1RH9A 3SCRA 3BUQA 1KGXA 3GZAA 3HG4A 1JG9A 1XCWA 4P8VA 4XZWA 4JFVA 3RPMA 2D0GA 1HWWA 3POCA 3W82A 4TTUA 1DWIM 4UQDA 3ZOAA 2J7DA 3EMCA 3UESA 3DDGA 1UR1A 1MXGA 4V28A 4ATDA 3WH5A 1V6YA 3SCVA 1XC6A 2V3FA 2DSVA 3BCDA 2WMKA 2X8RA 2EACA 1EQPA 4U5IA 4TX6A 4W7UA 1UWSA 5I0DA 5IFPA 2Z1SA 3PZIA 3AHXA 2F61A 4WK9A 5GNYA 1CBGA 1TUXA 4DM2A 1KBBA 3VGGA 3BSGA 5AC4A 1VEPA 4BS0A 3S2CA 3W81A 4S3KA 1FHDA 4MNKA 2BHUA 1GJWA 4JAWA 2D0FA 5I24A 1UD5A 1X6NA 5D4YA 4BQ4A 2YL8A 5FIPA 2WMIA 1TG7A 2EPKX 1W1YA 3TP4A 1UWQA 4XUYA 1ZBVA 4PMZA 2WC7A 1HT6A 2JF6A 2OWCA 4HMEA 3BAIA 3BAWA 3LPPA 4JCMA 4AZBA 3AHYA 3U5YA 4MB3A 4Q7NA 2F8QA 4W89A 3WUEA 1J11A 1V0MA 3WD3A 4OJYA 4ZE5A 2ZUUA 1HJWA 3L4XA 1ISYA 2J8GA 2J4GA 2E9MA 3DX3A 5HNNA 3S5ZA 1JXKA 1BAGA 1UHVA 2GDVA 4TXEA 4W8AA 1UR9A 3IGUA 4PMQA 3GH4A 3EJPA 3AIBA 1JYWA 4FNUA 3SUTA 3MSGA 1MFUA 1D2KA 4D71A 3PZQA 3PZGA 3DYPA 5LA2A 2ZICA 3RCNA 3ARUA 2QMKA 1MQRA 3BVTA 1O7DC 3WEOA 4J3TA 1E6ZA 2O92A 2BY3A 5A6BD 1H0IA 1OIMA 5DF0A 1E4IA 3VPLA 2WCSA 2ZXBA 1TMQA 4E4PA 3BVUA 3W28A 2CITA 2UY4A 3WQ5A 1HVQA 3WD1A 4AY1A 5HDRA 4FNPA 1P6WA 3AS1A 1ITCA 5BWFA 4OOZA 1V6XA 3WY1A 2DPEA 3T09A 3BUIA
chains in the Genus database with same CATH superfamily
4GFSA 2BHYA 1EJSC 2WXGA 4HHPA 4XX1E 3D52A 2JKAA 4HTYA 4UMSA 5I8OH 2HG5B 1A5LC 3B43A 1EOMA 1XF0A 2A6DA 1UM6H 3KPPB 4MNQA 3LCYA 3TO4A 4K0OA 2JKIS 3ULUC 1U6AL 4CC0A 1YHTA 3FVMA 4PVMA 4LB4A 3MUCA 6REQB 2H9AB 4V2CB 2J3SA 1A0QL 5GVJA 3OKLB 1HZYA 3VYPA 4PTVA 1ZLSL 1SJMA 1SM9A 4JYDA 5D7LA 1FNSH 1FWTA 3ML8A 3QPQC 1F05A 5F0MB 4DUWA 5E8OA 2PKDA 5JW5A 4PMDA 5D8JL 2J4WL 4PE8A 3OMAB 3QGKC 1V0LA 1M53A 3THML 1BZ9B 1ZLUH 3QRGH 2P80A 4OBTA 4QHNA 2VFIA 3NABL 4YMPA 3ECVA 4AYEC 3MYPA 5DMMA 4ONVA 5D71L 5AAPA 3FO9B 1M7XA 5FGSA 3LGEA 1JGMA 1PCWA 3DBNA 2QAFA 2Q01A 4NRYB 1YYLL 5I09A 2E74C 1R38A 3W7RA 2BP3A 2WKOF 1DN2A 1VFAA 5G4OA 4XMXA 1BXAA 4WK4B 1OAZL 4NNXB 5B39A 3N9KA 3TT3L 2FMOA 1W72B 2YLKA 4IGBC 2FNWA 5T33H 3MANA 2C0HA 4FMKA 4D0DA 3HPAA 3QUYC 1VCGA 2ACUA 4XP4H 3MLUL 1FX6A 4CVZA 2FQDA 5I6LA 5C0IB 4OZGA 5CD3B 4WW1A 1HUVA 1OF6A 3WX7A 2WNXA 4LAUA 3NAAL 1LZOA 3NQCA 1IU1A 3FJNA 4N2DA 5BZAA 3BUVA 1JWMB 3ABOA 4TUKL 2J6WA 1KB5B 4O2FB 3S96A 1QDSA 1NBZB 5H8DA 3T3MB 3ZE0F 2CC0A 2BS8A 2WBJD 1G9NH 5KJRH 1XQLA 1SW0A 4B9ZA 2VW6A 4X2UA 2UY7B 4LRTA 1ZP4A 5INDB 1KENH 3FOMA 4J8RB 3VFUB 3G77A 3BH4A 1RUQL 3FT3B 3G0UA 4N2NA 2XBDA 2ZCZA 3W00A 4Z7UE 3WMBA 4QSHA 1UA6L 5I76B 3O6DA 4NHCH 1U36A 4HHAB 4ZNEA 3NK3A 3WO8A 4X63A 4JHVA 3MRRB 5AY7A 3ZGIA 3WMLA 2BXZA 5JMRA 1J01A 1NFBA 1PG7L 1CYWA 4NC2B 3DA0A 2B1OA 2B14A 1XZ0A 2EVJA 4OJEH 4KK6C 4A2DA 3CDZA 2NLIA 4LBUA 4IMCA 5JQ6H 4K55A 4C60A 5I8CA 4PMFA 1Y6MR 2XU2A 5L4IA 4MA7L 3OVPA 4AX3A 4POUB 5F89B 1BZ7B 5EC1A 1NAMA 4PS4H 4AXWA 5HI5C 1UD4A 1WDSA 5F9OH 2J8FA 5MEPA 3MA9L 2PSNA 3FQWB 4IS6B 4RDQF 5I6PA 5BZWB 1OGPA 1TNNA 3QZOA 4ZZKA 3F4CA 2ALWA 3T0BA 1CDJA 4FK9A 2RH0A 5LXGH 1MDLA 4WI2A 1KF9B 4R9HA 5JMUA 1NCHA 2H2PC 2DQJL 1T3FA 3QQ0A 3L2MA 4AZ6A 4Z42C 1E3FA 1ASQA 1V3IA 3FZUC 3GAKA 1OCWH 2XTKA 3R10A 2XBTA 4MJ2A 3QHFL 3R0UA 1F3EA 4MXVF 4IJBA 2NXHA 1XGDA 4J6RH 4L3CB 1HH9B 3M0YA 3RDTA 4GKLA 1UXWB 3TN0C 5GJNA 4K3DL 3NJVA 1QKZH 2PYEE 1XIBA 2NSQA 1UUOA 1TPEA 2QSTA 3B4NA 5E03A 3MPCA 2BNRD 4KV5E 6FABH 3CUGA 4FHJA 3CFBB 4MX7B 3SW6A 5F7DB 3UGRA 4O4WA 4NZTL 3ABQA 3LN4B 4Y8EA 2AK4A 4ODUB 2NY0C 2F5BH 4ZO7A 2H26B 4QYAA 3U4FA 1RFDH 1HHHA 4N2LA 4CJ1A 2R0WL 1IIGA 2J24A 3BANA 3EKZA 3BDKA 1EWHA 1E6OL 2H32B 15C8H 1XIJA 4XR8C 5E8NB 5MEQB 2HFGL 2LHAA 1ADQA 1GYVA 3SKMA 3SE4A 5A40E 3GS0A 3D12B 5DS8A 3T65A 4UXDA 4UC5A 5E4IA 3TBTA 4JFXA 4PGCA 1U22A 4H25B 1LLOA 2EPMX 3U4EA 4AV0A 4L8CB 2J57A 2QHLA 5E08L 2VC7A 3EWYA 3FA4A 1X5MA 3FTGB 3PJUA 5FKPA 2YZ8A 2YA2A 4UTKA 5BMFH 5C0DA 2ARJB 2P1FA 1E9QA 5I1AA 1JZFA 3VFVB 3SDOA 3Q45A 1WGOA 1LNUB 3GZOA 1LO3H 5SWZE 4PMYA 5J5DA 3GUFA 4YDMA 1NCWH 1A65A 5KAQF 2R2EB 3B9DA 1Y0LB 1MDRA 1JCKA 3QMTA 3K6NA 4GUHA 5C8JB 3BGFB 3QTGA 2HISA 3VXRA 3ARFB 2WUBH 4P23C 3DPBB 1SEQH 4ETYA 3FKUS 4ETQA 4UT9L 1MHHB 4I2XE 3GG1A 1AR1B 2CKBA 3A6CL 1ZGLA 2YBUA 1EEXA 2PW2B 1AD0B 1LK3H 4Y2NA 1IGJB 1I7ZA 3X3FH 2OTWB 2GJNA 1GOHA 1NUGA 4G6JH 2Q71A 4P49A 4EKXA 4K38A 3BQUD 3HI1B 3QGVA 3BI9X 4MPQA 2N7AA 3T2OA 1X9UA 4R27A 4OLZL 3Q6GH 3RJYA 4PHZA 2ZZ3A 4PRPD 5CINL 2AK1H 2X41A 5SX5H 1VFOA 2VFDA 5LXXA 1JXGA 3KVLA 1Q9LA 4AQOA 4DAGH 4IGNA 4QG8A 3RWGB 4WXYA 5I15H 4CW1B 1BMZA 2V63A 3KCPA 3WJMA 5DZJA 5K9JL 1G7UA 4X6DF 1V0KA 2SEBB 4W4OC 1F73A 1E0XA 1R3JA 5EORH 2PTTB 3GMOB 1MCSA 4N6RA 1MHCB 1RUKL 2DQGH 4DNLA 2GIMA 4YXGA 1XM3A 1ZMYA 2JCCF 3I10A 2Z29A 4Y7MA 2YSSB 3O16A 5DZOA 2BP0A 1J9YA 3NDOA 3WK1A 4FXGC 3L7FA 4S1DC 4KXZH 3E1ZA 4U31A 1AIFA 2AJYL 4RMSA 1KFCA 4F7KA 3D6GA 4R5EA 3GW3A 1XG3A 2QPUA 1AKPA 1YPZA 2FD6H 4KZCA 4MD4A 4F9JA 4GUQA 1PSKL 1O95A 1R9YA 1DE4B 2XFYA 1F4YL 1RK6A 4PTWA 5AG9A 3QRLA 2Y4SA 5BPPA 3AROA 5CHNA 4XVDA 3MOBH 5I75B 1JDFA 2BIOA 4F7PA 1ADDA 4X9YA 2NVDA 1IC5H 3SBWA 4KNSA 1QOQA 2VM8A 3NCYS 4U1IA 1NJ9A 3WF0A 3FQ1A 4U6VL 4DX3A 3BEWB 4TV5A 1KLFB 4PGBA 1ASPA 4E6MA 4O51A 1TYJA 4JFDD 4LPTA 1V4YA 2WNZA 4WNJA 6PAZA 4LDCA 3H7BB 3TEWA 1DQDL 3FTWA 4GRWF 1FCBA 4C6FA 4HAGA 4YGVA 2VDKL 3BV4A 1E6QM 2ITEA 4BWTA 1COBA 3T07A 3WXVL 5PCYA 5LNGA 4EE2A 1F2QA 2GJPA 1MREL 2QADC 1RSFA 5FA4A 3TCSA 3F05A 4H9XA 3UJRA 4EAEA 4YS1A 3VNYA 1A1OB 3LS9A 1RUML 2VQTA 5DC2A 2IQTA 1F1AA 1Z9OA 3DVGB 1ACXA 5GGVH 4D6EA 1PWMA 5F1OB 1DR9A 1G5AA 1T89C 4UTFA 3L5AA 1GC1L 3SQRA 5JW4M 4MXQC 1HL4A 3FRUA 4PV9B 3RWJB 3H4GA 3GI9L 3X17A 2XQBH 2XGIA 1UJTA 2XPZA 4LRIC 4RR4A 1NIUA 1QPNA 4AMCA 3NJXA 4GBXD 4JKKA 4AZGA 3P02A 2E7LC 4PH6A 1G4RA 1UQSB 1U58A 2JB6A 3CXOA 2Z1XA 1AD9B 4UTHA 3HG1A 3GC5A 1V5JA 4GKNA 1B3XA 1GVFA 4E8GA 4LSBA 2QDEA 5C09E 3QLDA 5KZEA 4MPKA 4BK4A 4B50A 4CKQA 2PXYA 3X3GL 2X70A 1AQ0A 5AYZA 4N2IA 3KTCA 4QTIH 2WZMA 1BOGB 4JB9L 1ZLVK 4QRRE 1HINL 3NIDB 4NNAA 2GVGA 4F58H 3NRQA 1FFQA 3D4ZA 3MUY1 5DMKA 3P4OA 3S3SA 1XGZA 4XXCC 5FYKD 4JN1L 1KYDA 4NHUB 3BP5A 1EX5A 2ED7A 1MCEA 2HVJA 4OW6A 4QRNA 4UTWA 3UZQA 4DP0X 4UV4H 2X3AA 3B1TA 2E9WA 2VDRH 1Y6NR 1NAL1 3W7QA 4XAKE 4OFCA 4OQTA 4XTRD 3LEPA 1IQWH 1FRGL 3LKRA 1SMOA 3TSMA 5HDBE 4AHOA 3LYRA 4QS5A 1NFDA 1EAPB 3M4HA 4MLSA 3BZ4B 4UANA 1M9WA 1MW1A 1HI6B 3QIUA 1C7TA 1J1PH 3BIAX 2VXQL 2VM4A 6CGTA 4MDJA 5AYUL 1XEUA 4XNXH 4G8GE 3A4XA 4TUFA 1UUQA 1CO1A 1ZE3H 3RX8A 5FAJA 4EXBA 5D2XA 3TR9A 4L7ZA 1BVKB 1KJ2H 1T66D 3GTXA 3W7HA 1DJXA 2WHMA 3GX9A 1CZ1A 1F3JB 2F18A 4FQQB 1S7WB 4LHUD 4LIQL 5CNHA 4ZQCA 5CFHA 2NY7L 4NQ1A 3GMLA 4DZ5A 1YEFL 5FO8B 4KO5A 4BEUA 1AO7B 2DL2A 4JE0A 3KWWB 4DPAX 4ZYKA 3F2BA 1Z0MA 1UPPA 2CLZA 2Y3AA 1UZGA 3IVKA 2IPWA 2WQSA 3KPSE 1ZEAH 2ZSVA 4X5LA 4JYFA 2GSGB 2EDRA 1W0VA 3LMJL 1SM3H 2FVKA 3BAEL 3VQMA 4XNMB 3DI0A 1XDTT 3OL2A 2FWOB 2GTQA 1P7BA 5DY2A 5ADPH 1BP3B 4FF5A 3FV9A 5JHDA 2X09A 4NRXA 4UOQA 2C1PB 2R0LL 2D2HA 2E6PA 1W3NA 5JHBA 4BXSV 2AEWA 4OGXH 2OW6A 3C2AH 1W9VA 3HMXL 4A2RA 5D1XE 4NX0A 3CJPA 3C08L 3ZE1B 1CC3A 1PDYA 4P2OD 2FQGA 5KSAC 2ITCA 1S7QA 4Z2IA 2Q20A 1TVLA 1HOCA 2VDQH 3HUJF 3QUZA 4P9ML 1GQKA 2A7PA 1HKLH 1JCXA 2MHAB 3TC6A 4H6KA 1A7QL 1UWUA 1MAJA 3UBXA 3V35A 4DN1A 3D2UA 2IPTL 1F8TL 3GSWA 1EGJL 2CK0H 4X0NA 2VTFA 4ZL1A 1EQCA 3WIIL 5LG6A 2HWZH 4DAIA 4NAFB 1K2DA 4EPBC 5D6DC 5JIHA 4HZ7A 5I71B 3ES7A 4WW2A 1BQLL 3RURA 4RSVA 1T2QL 2F1BA 3FFOA 2XWEA 3IRDA 2ICWB 2FUQA 4WJ5B 3QJVB 4GUIA 3V1PA 4DK5A 1FFNA 1QSFA 1WUZA 4E3TA 1YZZA 1Q94A 2ZCHL 2FBOJ 2NX5A 2J43A 4FQHB 1EXGA 2FHCA 4XCFL 5GISH 4FTVA 4R2GB 2DSWA 1JNHA 2JE8A 1O0VA 2X6MA 4A55A 5C0CD 1RLWA 1HEZB 4HNTA 4I89A 3NGFA 4HWZB 4UI2A 4Y4HB 3V5KB 3C6LC 2WLYA 2GOUA 1URIA 2WIMA 1AGFB 4RGOL 4HBCH 2W92A 3WLBA 4G9FB 4FR1A 3E9UA 1LBLA 2A3HA 2G50A 5KS9A 2VO5A 3PNWB 1HIZA 3LMYA 3MZGB 2GAZB 2PYFA 1V27A 1DWJM 4LUTB 4NHVA 3B7UX 4KDWA 4KNTA 2CJ3A 4X4YA 1ODAA 2DL9A 4B0MM 1DBJL 4IHOA 3SPJA 1OAQL 1XIIA 3BUDA 2PW1A 4URKA 5K9OA 4GQBA 5J4MA 1VPXA 5ITBH 2XFWA 4N9GA 4F8LA 4OJCA 4HZLB 3WY3A 3HI6H 2NY5C 4BFNA 4BHUI 4FHKA 3ZDXF 3TW6A 4Y19D 1NOUA 4L3EA 4ERAA 5SX4I 1LQ2A 5BXFB 3QJOA 4PJ5D 1VPOL 1S7XA 2V9TA 5BS0B 3QFDA 1RZ8A 1B30A 2WXQA 2G3MA 4NZ8A 4IP5A 4XPGL 4WO4D 2PLCA 1HU8A 1OP4A 3U2SB 3H12A 2P24A 2E6DA 3TNOA 3WELA 3GBNH 2CRIA 1FJ1B 4EDXB 4GKTA 4O0QA 3WDIA 3FHEA 4WQOA 2WLKA 4MNLA 2DQFB 3QUXB 3G1RA 3B0UX 3UGVA 4Z95H 5I66A 4OI7A 1XUZA 4KU1A 5D2LF 4ZFGL 5B38G 3B9KD 4HVBA 5I3HA 4GRSA 4HIBA 4PBGA 3MYZA 3H0TB 5HI4D 1NPJA 4X5PA 5K3VA 3LHAA 3C5SB 4K7FB 5AUMA 3EO9H 5F2FA 1PV8A 3ITCA 1MRCH 4V1YA 1CE6A 1EX0A 1TWSA 3H3BC 5C0AB 4FA3A 2OMZB 4XZWA 4JY4A 4A66A 4M8RA 4FD0A 3PXHA 3GDRA 2ZRVA 3ZZLA 1T20A 4IGBA 4V28A 4Z7WA 3VYLA 1EF2A 3AACA 4W7UA 2KYIA 1GY1A 1MLCA 2FPVA 4XUGA 3QUYA 5CKSA 1Z9NA 4NJAH 3B5TA 4PJBA 4PP2B 4DF9A 1G6VK 1JXFA 1VEPA 4NZ3A 4Q56A 4AT6B 4MMZC 3RTQB 1FHDA 2XPGB 4AQ8A 1EO8L 2VKWA 4ABVA 1S39A 3N9SA 3BN9D 1BYNA 4EUPA 2B1AH 2YL8A 5FHAH 3M6YA 1UWQA 3FQXB 1UWXK 1N4XH 1HT6A 3SO7A 2VEIA 4K2SA 4MXWH 3UPAA 3U5YA 1MCFA 3KR3H 4W89A 5JLZB 3TT1H 5I2IB 4XO7A 1JHTB 4OQ1A 1M9HA 3U3HA 1EJXC 4WJ8A 2BIQA 2GUOB 5A2IH 3LTVA 4GSDL 3WTXA 1JVNA 1IBHA 3N2TA 4ZSTA 2D7TL 2OOGA 1T7LA 3P7YA 2YPKA 1WISA 3WEOA 3FPXA 3OG4B 3L6FA 4ZMOA 1OIMA 3P67A 5IF0B 4W9TA 3N44B 2CITA 1X5LA 2DM7A 1P2CB 4OOZA 3KBNA 4EVNA 3A67L 5FCUH 4W9ZA 1AIZA 4N9DA 1W2KT 1U8OB 4RGNB 3R12A 1A4LA 1H3WM 4A8RA 4JDEB 4TTDD 4HA0A 4RZ4A 1C92A 1KTRL 4L64A 4AGLA 1PKLA 3GSQB 5K4XA 3CFCH 1PKOA 5J12C 2DKUA 3N6QA 5EUOE 5FM8A 3S48A 2EKSA 3L81A 1UCTA 3KBVA 4RXGA 3CXDH 5LA1A 4O12A 2OMVA 1VBRA 4X6EB 5F9JA 5ACLA 4LOUC 1CDYA 2FB3A 4P2RD 2VGGA 4B2DA 1XMEB 2QKIB 4QRBA 1F5WA 3MRNB 3V1HA 1V7ML 2YXMA 5IW6B 2R6OA 2XZ9A 3O3BB 4N6QA 3HG5A 3CBKB 4J4PC 3PBUA 3QPXL 1XAUA 1I9CB 1ROWA 5D5MF 3DARA 2DOCA 1P1MA 3BP4B 3N9RA 5BO1H 1XRTA 1GA2A 4O4VA 3GUGA 4U1MA 3TN0A 1WJ3A 3H2AA 5IFHL 3HB3C 3WYRA 1YEJH 1T40A 3GDLA 4FYQA 2QGDA 3C12A 1UZ1A 12E8L 1OVDA 1U3JA 1B0RA 2GUBA 4DOHE 1T7XA 1T1YB 2NXYB 3ARGC 1A4JB 3HJEA 4OJDH 4HMNA 3BEVA 3CQJA 3RDJA 4FQJL 3DMMB 4QHMA 1L9PA 2FGBA 5EBMA 4ODWA 1XLLA 3KWSA 2X6AA 3UAEA 4LYKA 1G4PA 1LT7A 3JV6A 1AKJD 3RA7H 4K3HA 2I27N 5GRJL 4I88A 5I8KH 3D47A 2NW3B 3PY9A 4RMTA 5TE4H 4FIRA 5E09A 1ETJA 4R8WL 4I3SL 4YBQD 2WXIA 3MUGA 2OZ4H 4GNKB 1ITBB 1MFEH 1IM3B 2FX7L 2Q86B 1OAKL 1BQGA 2J79A 1GGUA 3S5LA 5BZDA 1TITA 1BZQK 1BYBA 4MJ6B 1H7PA 2J12B 2X3CA 3TU6A 3IK4A 3SGZA 4Y6GA 4JDVA 4A2HA 3EJYD 4DERA 3BSMA 3UPBA 1I9JH 4CC1A 4BCXA 4WD0A 3IKCA 2FB4H 4P23A 3WV0A 1DJHA 2RHEA 4FQ2L 1KFBA 3BLDA 1BF2A 2G3XA 3WFLA 2VDOH 5DXWA 4PWEA 3ROOA 3U5UA 3DHFA 4WI6A 1XRFA 2GCYB 5E7FA 3T8VA 4R7NB 1E6NA 3ZR4A 2VELA 4RNRA 1WK0A 3EGDB 4XX6A 1UWIA 4F2UA 4GPVA 3I6EA 4UQ3A 4CEUC 5I0ZA 4WFHD 4XP1H 5FJOA 3GHPA 2H1LM 4L4TA 5EEVA 4NQEE 3FU3A 1CF8L 2GI7A 3QI9C 4M6MH 3GWQA 1MW0A 2MMXA 1J9TA 2XSKA 5DTFA 1I3UA 1GZGA 4DO5A 3MMEA 2NDFA 1YADA 3WSQH 4QLWA 1QAWA 2VABA 5T9BG 5DRXA 4IIQB 4ZFCA 4AHPA 2OMUA 2ZG2A 3QV6A 3IJSA 1E30A 2GK2A 4W4OA 4P4KD 4DLMA 2JK2A 2DSUA 2DIEA 3S88H 1E9OA 4BBWA 3QIBB 4H26B 4PMOA 3ZHFA 1E8XA 2JF1A 4X99B 5FW6A 4D1IA 4GP4B 1J8HB 3W22A 4LSSH 4DUXA 2OWWA 2YS4A 1B4EA 4NPYA 1OC7A 4LEFA 2YMTA 4MAZA 4XD3A 1FV1A 1YRRA 2OTPA 4NAEA 4LW7A 2VLJE 2VAAA 1JD9A 4AMXA 4L29A 1U8MA 4DKFH 2WWMC 5T1LA 4YZFF 4F1ZA 2I24N 5JNYA 1AQDA 1YN6B 6PCYA 2COVD 2FSEA 4AIEA 1NSJA 3PLYA 4KDVA 1W1VA 1BVNP 9RUBA 3QW3A 4AUBA 1XTLA 4GMTH 3VQ1C 2XZCH 5HGAA 4X42A 4H0LC 4CMHC 4L1DA 1NC4D 3B9EA 2N0MA 2TSBA 5G5DB 3VZXA 4RX4A 4HALA 2R2HB 4FLSA 3RYSA 2KLRA 5D2VA 2N0KA 2PCXA 3HHMA 3RVVD 5CCZA 4PEKA 3P3TA 1H8LA 4QHLA 3UTZB 5D1XC 1CLYL 1YMMA 1NFIA 2I5YL 3M7SA 2QDWA 4NKOA 1B9BA 4TNWF 3T3MF 5D05A 2C3GA 1B90A 1LEKB 1ONRA 4PUWA 4PEEA 3GNML 3STCA 2H7WA 4BUQA 1A5MC 5KYWA 3G1FA 1W15A 2YMXL 2J25A 3LOTA 3WKQA 4FQXD 4Z0SA 1A66A 2PGFA 4IGSA 3LY6A 1G4SA 5FM4A 2IPFA 1KWGA 4OBRA 2XU9A 1XYBA 3L4CA 3GS7A 3GLZA 3IS4A 4ZAKD 1NIBA 1O5QA 2ZZUT 4WUKL 4ZFOB 3IEBA 4HG4J 1FWGC 3ZJ6A 3AIUA 5F70A 2EJAA 2VE6A 1FHVA 4G11A 3D3AA 2F19H 2Z92A 1P0NA 1I1WA 4PJGB 3O2LA 4C6IA 1LROA 1T89A 2V7NA 3S37L 3V0WH 3EYPA 1Q7QA 3FQUA 2YAHA 2F08A 2XYCA 1OK8A 4K23L 4NIYE 1LL6A 2E76C 5TF1H 1PDZA 4LRIA 4ODHH 1FZMA 1NEZG 4BFFA 4X80H 4XAYA 2E7LA 2ROYA 1N3NB 2AAVA 4HT1L 2Z35B 5TQ2H 4I7ZC 2Z4QB 7FABL 3S97C 1W2PA 4I6KA 4XTIA 1M1BA 3BVNA 1RIUH 5CGTA 2I07B 4LO9A 4OFPA 4RE2A 4FF9A 4ZS6C 4G8FB 1YNLL 3DXAA 3WGVB 2AMGA 4PJ7B 1OB1B 1PDKA 4XSMA 5KW9L 4K07A 1GYAA 3GNNA 2CZEA 2JJWA 3RPIA 3QPEA 3PF3A 4XXCA 3CHPA 1TR1A 4XNBA 1R3SA 5DJCA 3PQYE 4U1GC 2QV4A 1HP4A 4IPPA 3PG2A 2FCBA 5GGSB 4D1JA 1D6VH 1U3YA 3GPEA 1A1MB 3BISA 4GQ0A 3NJNA 1J8VA 4K5NA 5E94B 5BOJA 1FA4A 4NQTA 4QLJA 2WHJA 1MCWW 1T0MA 4JZOA 5D30A 2WQRA 5EU6D 1B3ZA 1LK2B 1QI4A 3ABLB 1JXJA 2IQ0A 3ALXA 3VMOA 5DGQA 4AXNA 2NY2B 4LVEA 5CG0A 4IBYA 1VLIA 3E12A 1I1XA 3AG3B 3OV6A 1A6VH 3UCQA 5T1KD 2ZUNA 5I1CH 5DY3A 1MAMH 3SJVD 4E5TA 3U36A 3O6MH 4D2NA 2AV7B 3CFQA 2WZEA 4UNVA 3SN4A 5FO2A 1TF4A 4L9YA 5I5RA 1KB3A 4E42A 8A3HA 2Z2BA 2WYSA 3QIWC 4GG8B 3VXMB 4MS8C 4PWKA 4A29A 3U2OA 3DZ1A 2JIXD 2ED9A 1AE6L 2IXVA 2MSPA 5L6UA 4O54A 4C4KT 4OZOA 3BAJA 3CPLA 1QPKA 5T5FL 3WL0A 2CIIA 4WI9A 3WENA 4NQDA 3V4VL 5KYUB 4LVNB 3SGEI 2K7QA 2NTSP 2I32A 3W56A 3HMWH 1OP9A 3T4AC 3MROB 5A8GA 1N2VA 4CLMA 3EXLA 4S3GA 1D7BA 3K30A 3ABRA 1WAEA 3T3PE 2WMPB 3BH9B 1W5NA 2VDRB 3OQEA 4HAKA 4OAWA 4UIKL 3G04A 5LHFA 5KSAA 1YUHA 1F02I 2P5WB 2VYOA 2VURA 4HFUL 2L7EA 4V1XA 5E0QA 2CALA 3GTHA 4PCYA 4OUUB 3MI2A 3LB6D 2RGLA 3GSRA 4UB9A 3OKEA 1AD1A 3L1FA 2FHFA 2OMWB 3N18A 4HUXB 4PJ5E 3QEHB 3NG5A 3SN6N 4JKLA 2JLLA 4EZJA 4W88A 4GMEA 3FBQA 1NMCC 1KJ2B 1PPIA 3KPLB 1FYTD 3JZUA 5ESVA 3PV6B 5FGCE 4G7YH 2XN9A 3W26A 4UNIA 1MVFA 5EFIA 2PTDA 2R29L 4Z7UA 2DORA 4RKAA 5I3DA 5D6DA 2LT9A 2QPDB 1WH0A 3VUSA 1TV4A 1MQPA 5HDQL 4WDIB 1OSZB 35C8H 3WIHL 4F57L 2YEVB 3LGGA 3PBMA 3PWJA 4ACPA 1TKWA 4NUGL 1REIA 4Q4PA 4BUGA 1HKWA 2OX4A 2EIJB 2EC8A 3M8OH 3QXVA 3UOAB 1H3TA 2B0SH 2YXXA 1EK3A 3BP6A 4NEHB 3O1NA 1ZK9A 4P46C 4YFDB 2O9RA 1JIBA 4HYRA 1CNVA 2FB2A 4Y5VC 4OCSL 4NJGA 2VW7A 5EU7E 3V4PH 3C6LA 1Z5LB 4A7SA 1IAII 1BWLA 1FNEA 1LWHA 2BVUA 2GGHA 4ZMLA 3IGSA 1NOFA 4JL2A 3CV7A 1V0NA 4L0PB 2P3YA 3NSXA 4O0KA 3T40A 3CSTA 1X98A 4HZ8A 1DLHB 2PDMA 3FU9A 3DSNA 5LGJA 3DX9A 1OLZA 1RQBA 2Y7LA 1WCQA 3MMWA 3PL6C 1UH4A 3RP1A 3HPLA 2VDQB 3Q67A 3MX0B 2B59A 4BKTC 4MA3B 1AGEB 4F15C 3EYUH 2NXZB 1IWPA 4UM9D 2ENPA 4O17A 2B7OA 5KYYB 4XHJD 3W75A 5D1QE 2ZOLA 1O1HA 3VXSB 5E9DE 3VIPA 1R3KB 1XR9A 1V6WA 4Y9EA 3KS0H 3G0SA 4KQ3H 3QAQA 2X1TA 1TYEB 2WLLB 2CDEB 3WMSA 4F2MA 2XHYA 1OK4A 1IX2A 1OD9A 2GVYA 3VXTB 3TV3L 4Z8FH 3KPMA 5B38B 1LG1A 3N55A 4WSHA 1FO0A 1AZZC 3IDYB 3DJZA 4QX4A 1FWJC 1DWAM 4OBSA 4NZ1A 3VNJA 5D9MA 4MKVA 4EOUA 4OWGA 4YVUA 4YSQA 1KC5L 1AOZA 1IT7A 1PXGA 3R7QA 3LHTA 2I16A 4R7XA 3NZSA 3EFDL 1T2JA 2IUZA 5C2UB 3HC3L 4F37F 1NA8A 1CICD 5D7KE 4Z7NB 2ORBH 1MY7A 4OSUH 3H3PH 3B9VA 3C75A 1XDMA 3TFKC 1HKJA 4C8XA 2GEEA 1NGWA 3TV8A 1EEYB 1T4KA 3ZHLA 4ZX6A 3MUAA 4RL3A 3F58H 3FB8A 4N2BA 4ZPTB 3SE8H 4N1EA 3NDZA 5FL0A 4HGWA 2APWA 4XCEB 3ABZA 3MBEC 4S3CA 4MMZA 3ZE2B 4Z23A 1Y18B 1JERA 2Q3OA 2FVLA 2X28A 2NTFA 3LLDA 4XBSA 1GGOA 5B80A 3JW7A 3KPOB 3GZ3A 1UR8A 2PODA 3NCJL 5CO1A 3W84A 4Y4FD 1ZVSB 4AJYV 3NIDF 1UXLA 2VRQA 3SFWA 2ATSA 4WEVX 4TNGA 2ZRYA 4S38A 1WWAX 1DSFH 1TZ8A 3V6FB 5EZOL 4FE9A 4CVXB 4PB5A 5FV1L 3QDJA 4NZDA 1UD2A 4JFEB 4J28A 4KRPC 4PYGA 4OCYL 1PVHA 4Z2HA 4TU1A 4D7PA 3M16A 2DM2A 5AVXB 3CMOL 1YEIL 1BIIB 3H4FA 4MDIA 2VCCA 3PFUA 2F53B 5HJXA 4Z0JA 1PTDA 1BXNA 3F6LA 2VDLL 3ZKNC 4IUGA 4PRBB 4XMTA 4MG4A 5BRZD 4B5TA 2G5RA 4MA8L 5E0FA 4K3ZA 3WUWA 4K7PL 1E6JL 3XIMA 3GWJA 4O19A 1M42A 4X6BA 4O10A 4R7WA 3LI1A 1VFTA 3C0SA 3FO0H 4A8NA 1ICPA 2AC0A 4DQWA 4QGTA 4EXAA 4PY7A 4NX5A 2NUTB 1SFTA 3ZT5A 4GNVA 3MO4A 4JY8A 4HC1A 5GGSY 2BNQA 3OPUA 3P2DA 5I6XC 4OKVB 3UACA 4M1GL 3PFQA 3G8RA 4S0TD 1FXQA 3W4RA 3MLRL 5LQBL 4X6DE 1RIVL 4E9SA 5EOCH 3P6LA 4MHBA 2WC3A 4PRHB 5GGQH 5I06A 5EWIL 5AD0A 4IISA 2HJFB 3FK3A 5FUCE 5GGVY 3QISA 4F0HA 2JCCE 5D70L 4KK8D 5DJ2B 1LEGB 3FFCA 4ZFZB 4FFYA 4IRJD 3F5LA 3LGDA 3H9SA 5ESAA 2R2BB 4ZD3H 1SMAA 4JUTA 4OLYL 3QPKA 1CFVH 1UYQA 4Y96A 1OQOA 3EADA 4NZJA 4ZQOA 5AOJA 2H3DA 4KKXA 5A94A 3NIGF 3OVGA 3K72B 1UWEL 3RNKB 3NMEA 1OZMA 4MGGA 5IBXC 1NLBH 3PWLA 1UURA 3VI4B 4M6VA 3GDKA 4JCLA 1TQXA 1YY8A 2PDBA 1QO3A 1QHZA 5B1AB 5DZ9A 3ZE1F 4X61A 1R5VB 4OECA 2DVTA 1MNUL 2BY0A 2XH2A 5AVQB 5D72L 2HK1A 1VRDA 3MWAA 3H6AA 2VLRA 3LQLA 1SBSH 4KCUA 5F7MC 4PG9B 2R1NA 3V5DA 3ZOAA 1TETL 1WF5A 3ARGA 3MJWA 5DMNA 3NCCB 2F0CA 3V4BA 1K7EA 2AERT 1BTMA 1MEHA 5IFPA 4MMYA 1TZZA 1T6MA 3AHXA 2R0ZH 1A6AB 3OXRA 4S3KA 4Q8TA 1ML1A 1N5AA 3RBSA 1I3GH 3KYOB 5MP6L 2WMIA 2LQRA 1FBIH 2AEQL 4C1KA 3U6RB 2DQWA 4PMZA 4OTXH 4PRIA 2VDNH 4GUPB 2F6UA 4FIQA 1FBAA 4ZE5A 3H8AA 4KAQL 2G2RA 1EZSA 4OIIL 1NICA 4G6AC 5HYSA 1ONWA 1BAGA 3HN5A 4DVBB 1US0A 1UP2A 1A49A 4FX7A 5EH1A 1G7MB 4PMQA 2INEA 1CBVL 2AXGB 3OSVA 4ISVA 1TUPA 5I5JA 4YNYA 3G5XB 2QMKA 3IGAB 1E2ZA 1Q0XH 4QRSA 1M9SA 4HKBB 3FSAA 2Z1VA 3SSJA 1IHIA 2WIIA 2G2PA 2QJJA 1GAFH 4B90A 1ITQA 1Z9PA 1OAUH 5HNTA 1ZGLM 1B4JH 3QEGH 3BT2H 2OKTA 2CERA 4UFKA 2G4EA 3DX6B 3LD5A 3K91A 5GXBB 2OX5A 4Y9CA 4WKZB 3B06A 1NMAH 1NGYB 4JVUA 3LRSB 3UJTL 3YPIA 4Q0XH 1A4BA 5ICZB 1R9FA 4UFJA 3AW5A 4NT0A 3P73B 4MY8A 3MA8A 4IBSA 3DG7A 5A6TC 4HWEL 1KXTA 1ZJHA 4WI8A 1KM3A 4AZ8B 2DICA 3QI9A 2NUPB 4CMMA 1XGQB 1S2EA 1YBQB 4KY1H 5FD0A 5DMLA 3HS8A 3VFNA 4TVPL 4PJEE 2XJKA 3AMCA 2ZKHH 2CLOA 4JQIH 5JO5B 3C5ZC 2BSSB 4D0CB 2EXTA 3DSFH 5LG1A 5D6CA 2GJZB 5K59E 4B9YA 1AGDB 2YGVA 1NL0L 4YL9A 2OMYB 5AOIA 3TS8A 1WYJA 2Y5EA 4HH9B 2Z7UA 3VD3A 5FFGA 1CU4L 4KROB 4OF7A 3KP0A 3QXDB 5IB1A 5E70A 2BZDA 4DBDA 2DPKA 2CIPA 2AJVL 3HFYA 2DMCA 2JK5B 4K2UL 1D9KC 4CQ8A 2DYPB 1K8IA 5IUSA 4MZ3A 2P5EA 3GYCA 2XZZA 3CSGA 1MCWM 3T4YB 3N3EA 1DN0A 3KPSA 1MIML 3QNXA 5L2JA 4LOVA 4O0ZA 4HEPG 3DETD 3JVFC 4P5MB 5T3XE 5I28A 3IVTA 4GIRA 5AYTA 1G7QB 2VDOB 2A6NA 3V18A 3SQBA 2X1XR 1RMFH 4WTWA 4IMLA 1XD0A 1WE5A 2P8PA 2VZSA 3VIFA 5E23A 4WY0B 3HNSL 4ANXA 4N3UA 3SQSA 4S1RL 2QIIA 4Y9PA 2O5YH 5JHLL 1ACYL 4JPKL 4MNHB 3LTSA 3WQ4A 5HGBB 4B9JA 5KVDE 1A2YA 5DD3H 3W39B 2NYYD 2QF7A 2V2TA 2CHOA 4OM0H 3G6JE 3IDIB 5F9WC 1KN2L 2B4CC 1S9VB 5K93A 2XVBA 4PODA 3DRQA 3ARWA 5T8IA 3RNDA 2J8UE 4HH8A 1WKYA 3IMBA 1IO4C 1M65A 4JUSA 2HT2D 4DELA 3W3OA 3OEXA 2IKGA 1GTNA 1L7IL 2XBZA 1U8QB 5D7EA 5IQNA 3DO7B 1F3DJ 1WUNT 3ICJA 3TVAA 5L88H 5FOBB 2EIMB 2ZX5A 4KKCD 3WAJA 4RWHA 2PP8A 3T4WA 1KIRB 1TTJA 3UWVA 1BA9A 1B2WH 1IGWA 4HIXH 4NNPH 2NSMA 3N44F 1GR7A 4PRNA 1XCQA 4BZYA 2YDRA 5D7SH 5IVXF 3OSKA 3USZA 1UFGA 4Z7IA 4DGYH 3NPSC 4OV4A 4N8VB 5J5EA 3WJZA 3MRDB 1GYUA 3L5XH 1QSEB 2ZX6A 4UDUA 5GNZA 5FM5O 3AVEA 5CR1A 1J5CA 2YBRB 5EF1A 3BKCH 3RTLA 1SLVA 2VUKA 4GVHA 1HYRC 1F8IA 3CFDB 3VW3L 3S5YA 3LS5H 5FYJE 2DY3A 4PM1A 1RBOB 3E38A 2Z31C 4MYPA 4KJQC 3OB0K 5EU7C 3TZNA 4ADUA 1QFWL 4FG6C 2XG4B 3QY7A 4CQAA 1NOWA 3V6ZA 3HCVB 5BU6A 4BK8A 1H9DA 1KTLA 5F88B 3QT2A 1PKQB 2JKSA 43CAB 1ZNNA 5KVFE 1NCJA 5IT2H 5CH9A 4ZQNA 2VQUA 4M61A 1V08A 5CBIA 4JTCA 3WD2A 1QTYT 3WEZA 4QKXB 1CWVA 3T08A 3O4LB 2W0UA 4C90A 3OX8B 1SDDB 1PTGA 2Q87A 1SSDA 1TQBC 3C60B 3V10A 2JFEX 1FDLH 3KHDA 2DW6A 4ZFMA 2DSKA 2IGTA 3JTSA 4MA1B 4XI5D 4XH2B 5TBOA 1NP0A 4A7GA 3HPXA 4U49A 4WY7L 2HKFL 5HHPA 4X5RA 3A4JA 3EXRA 4L2LA 2V9RA 5LBSL 1G7JA 3ARFD 3MRFA 2N56A 3C5QA 1FH2A 4U1NB 3WKMH 2BGNE 1CGVA 1ZHKA 4G42B 1HXJA 1OF2A 3RFZA 1AR1D 2BMKB 4EF9A 3ZJ8A 3ROLB 1J87A 1HIMH 2MQCA 3R58A 5D9PA 3OHMB 2I7GA 3C8DA 4OT1L 1ZWIA 5C7XL 3W1LA 2Y7FA 1FCGA 1OTSC 4FOKA 1LUCA 3TROA 2Y5TA 1J5DA 4NYLA 3WGUB 3GBMH 4IDJH 3OJ2C 4NKMB 2HFFA 3CXHK 1MFBH 1SN2A 1OTTD 4JGMA 1BBDL 4E8CA 1W3LA 2CLMA 1UKPA 2GJ6B 2A99A 1AW5A 2AOSA 4HDIB 1LRQA 4CL7A 5B3JF 3FB7A 2MPAH 3GUTB 5DR5H 4LY4A 4D9LH 5IHWA 3SO5A 2ZQKA 4PJHA 1Y5VA 4U10A 2HXTA 2R1WB 4Y2DA 1DQTA 3T4AA 2P5NA 3FB6B 2HJPA 4MZIA 3G7TA 4MYAA 4UZUA 1SQ7A 5DLCA 3O3AB 1E55A 1C90A 3VCLB 5CPNA 1Q6CA 5DMGC 3AIVA 2DI9A 4XC3L 1RZKL 3RM9A 3CD4A 4L5FL 1KGYE 3VA6A 4YHLH 4YWSA 3FN0H 1J6PA 3GVWA 1BFTA 2MTAA 1L5GA 4AM0A 4KQ0A 3QEUA 3QH2A 3U82B 5DRNA 3US1A 1XF4A 1JV5B 3NL5A 4JN8A 2EF9A 4AH2A 1XGPA 3UJEA 5IMKB 3WIFB 1KEGH 4AEIH 3UDWC 1KIUA 5FCSH 4KJWC 5J89A 4F66A 4PS7A 3IJ7A 3AI0A 1GPOL 3GS6A 1GORA 4X6FB 3ESMA 4UDTB 1WX0A 3R8GA 4I18B 2FATH 4RX0A 4RDYA 1HX0A 4LY8A 1N7MH 3C8KB 4TSAL 3UYIA 4R9XA 1A3XA 2X10A 1NDTA 4FYTA 3U1PA 1QWKA 5C9JB 4F40A 5TK2A 2VSDA 1F45A 4HJ1A 3FXYA 4KHXL 1G94A 4ODXA 3QG6A 2VDIA 4J39A 2X4PA 5TE6H 1WGVA 3G1XA 5I16B 1OOAA 1WAAF 4F8TA 2XV2A 2JQXA 3MNWB 1IKNC 3BL3A 5ITFB 1X1ZA 3UD6A 1P0KA 5BXTA 4P46A 1G7LA 1UZ6F 3HV9A 3BH8B 4Y5VA 3ITTA 4IQEA 4UQIM 4MCZB 4PUBL 1XF3B 2C91A 2NY4B 5J04A 5D1ZI 3PZMA 1EQWA 2EXSA 3E2HC 2VISB 1V55B 4H0HB 2YPVA 3ZPDA 5JBDA 4FFZA 5LZLA 2PI6A 4CNIB 1I9RH 1ND0A 5B8CB 2F74B 5DJDB 2GDQA 1BZDA 3LEXB 4RFEA 4U1LB 3O8XA 1NDGA 3PL6A 1BVLB 1F4XL 1J12A 2C7UB 1XUUA 4QTHA 3NO3A 2X1WL 4LCCC 1CENA 2R2CA 4HIIA 3RVTD 4HHGA 2VUYA 1YE6A 1QOKA 2A0LC 4TLUA 2IADB 1ISZA 3WLLA 4KZDH 7CGTA 1X96A 5F0JB 4AL8H 4QIRA 3SRDA 3ZKMD 2MOQA 3T0DA 5IBTH 1PLGH 2ZA3A 3BDBA 2EDTA 3ARVA 4FG4A 4U6YA 4U3SA 5IIEA 5EA0L 2NQCA 4OI8A 5L0QC 3O4OB 1K8CA 5GS0H 2PFHA 2IBZY 1FL5A 5I0XA 3N1QC 3B8WA 3UZZA 4NT6B 2YEQA 1RHFA 1WFIA 2KL6A 3PPSA 5D5ME 2NT0A 2GL5A 4NKDA 2FX9L 4LUSB 4YSPA 3KS6A 3B5HA 5IQ9A 2DV0A 1XC4A 3TEVA 3VI3F 3MYJA 5DFVC 3OLDA 3SCUA 4ZJ9A 3IWUA 1BXXA 4H0GA 1FP5A 1CTNA 1WBZB 3FA3A 1CL7L 3L4VA 2EH7L 1H3VA 1TXKA 3IVUA 5E1HB 3MCYA 1H49A 4X6CB 1AL8A 2FYMA 3UYRH 4PIRF 1WS8A 2MOVA 4K8GA 4ZUUB 4LP4A 3Q8CA 4JRXA 4PJGF 1I8MB 3GF8A 4L1HA 3WBXA 5FA3B 3LCWA 3V4PB 1VGAA 2GSMB 4P4RA 3IDXH 4CSZA 4B16A 1FZJA 2GK1A 4ZUWB 3MRIB 5C0FB 5HJLA 5DA0B 3BWAB 3QFJB 3T1GA 3WY2A 4WWOA 3VUAA 4TMPA 1CZ8H 3DX1A 4MJIB 2D7PA 1NDMA 2WWNA 3V3WA 3MBWA 3IXAA 2EPLX 3N50A 2VITA 3FDKA 1JBJA 5DXXA 1KNOB 4LSPL 3TN6A 1ZIBA 3EOTL 2RJGA 3I9GH 1QK0A 1T1WB 4FXJA 1A7RH 2W61A 5KSVB 1K6AA 1K8ZA 1NMBH 4YL4A 1H3UA 1XLBA 4PJ7F 3VGHA 1AO7D 3I84A 4I13B 1FDYA 1SSGA 3H6JA 3LXCA 1ZSXA 3Q3GB 3D46A 2EXYC 1M5WA 2HTLD 3IJ8A 3U7AA 4LS2A 4MSWB 2YD3A 1W8OA 2HPTA 3DX0A 2CNCA 2Z0UA 2P48B 2OZ3A 5G2NA 3SDDB 1Q6OA 2FZMA 2VRKA 2VHLA 3ATBA 3I02A 1DIEA 2G60H 3EJCA 4FXSA 4NRZA 5M1TA 5CZVL 5IDIA 4Z0XA 2V5LA 5DEZA 3BRDA 5D1ZC 3RB7A 2AJUH 1Z9SB 3T0EB 5F4SA 4NLAA 1T0NA 1A8ZA 3ELAT 2EBNA 2ALAA 4W5ZA 3L4YA 5SWSA 4XOAA 1T03H 3NK4A 3RUBL 4H9ZA 2QVFB 3OJVC 3URAA 1VBGA 5K9QI 4PV8A 1FHLA 1GKPA 3RFAA 3JR2A 4FAMA 3LN9A 4YHYC 3TNNA 2BNRE 4L1WA 1LE5B 4M6OH 3UEQA 4HUUA 4BELD 1BYCA 2XXFA 2IALA 1NAML 5F0LB 5A6MA 1RZ7H 5L8JB 3SPGA 2XVNA 4OT7A 4XMVA 4GYBA 3ARYA 4DI9A 1MWOA 4AQAA 3BO8A 3C9NA 1GGCL 2UZYB 2BW5A 1MLBA 4OB5L 4L8DB 4Q8MA 4XWGH 5ECVA 1VRXA 2QL1A 5T3ZL 4AE1A 1ZANL 2G4GA 4YHNA 4ZPVB 2CLPA 4PJDE 1EXHA 5I1HL 1MHPH 2QCLA 4ZI8A 4N85A 2ZE3A 1CBJA 5JH2A 4UAOC 3SY8A 1DYZA 4KH2A 3CZFB 3ARTA 3MODL 9XIAA 2QCEA 2O9TA 4MZ1A 4HCLA 3WFHA 3W01A 3IANA 1OINA 1HKMA 4KNUA 5C6WH 5FUZH 2VEFA 5ENWA 3NQ8A 2BVOB 4Z18A 1XGRA 3MV7A 2AQ1A 4R2GD 4E0RB 2IPUK 1QLFB 1QP1A 4QRTB 4K9JA 3O6FC 2VR2A 2YB1A 5ABGA 5CIPH 4Y4HD 1YY9C 4QRQA 2X6BA 3TQKA 4GIEA 5L9DL 1VP5A 3SCWA 3ZTNH 4U6HB 5DHVH 1GYLA 2PO6C 4G9FD 1E70M 3WAKA 2JCWA 3WN5B 5IOKA 2IH1B 5H35A 2WZTA 3IUIA 2GT9B 5I1KH 3E9TA 3HAEH 1IBFA 5EZLB 4AIZA 3NH7L 3QYMA 2CJTA 3VH8G 2FT6A 5I19H 3QSRA 4PRPE 4RGMC 2Y6SC 3NZ8B 3OG3A 1CG9A 2X6UA 3RUGE 3RKDC 1YMHA 4OF3A 3A5VA 1I7UA 3P60A 4AG0A 1IZCA 1H6EA 3WH8A 1RZJC 4QJ1A 4XIMA 5JZ7C 5XIAA 3EO0B 2WAHA 3WBWA 5AW7B 1PIGA 2R56L 2WKLA 5EZPA 4HAFA 4HJGA 5BS0D 4XX5A 3QSKB 4BXVA 5MENB 2CKBL 1IAKA 5I74B 5F6HI 2ILLA 1E4MM 1JNNH 1TJGL 3JWOL 1OY3B 2H9GB 1P7TB 4DN3H 3SCMC 2HEJA 2APTA 3EGXA 4YXKL 1SJVA 2E3VA 2OMXA 3IJDA 1WAWA 5A3HA 3QUXD 3CLEH 3M5VA 1C1EH 3BLEA 5F4WA 3ZWSA 4ZQRA 3E2QA 3EX2A 1ALDA 4YBLB 4PMUA 2Q8AL 4EDWH 2PDPA 4M5PA 3PWNA 1AZ1A 2PCPA 5HAOA 3J2PA 1J5SA 2HMIC 3LKQA 5E8DL 4J3OH 2QDHA 5C0AD 4M62H 3W1NA 3IDMA 5JQHC 2PCFA 3MZNA 2YGQA 1X44A 3EZJB 4PSPA 2DYSB 2WWOA 4OGAC 4AE0A 3CZ8A 4CN1A 2HN7B 1R3IL 1AQHA 1C16B 4U7MA 2WWDA 3WEXA 3MUIA 4S2SB 1MF2L 2XWBB 5IESL 2DZEA 1NSNL 4QXUH 3RTQD 4EPDC 3VFSB 4JFDE 3ERPA 5DC4B 1TLMA 5CSBA 1WFTA 3RK8A 1YPXA 1MY5A 5E99L 4HKPA 3HAEG 3TBWA 5J9PA 3W9EB 3RLGA 3O2DL 3RU8L 1ID5I 5E4AA 4LCYA 3STEA 2VDNB 1OARH 4DJED 3EUDA 4ZMAT 3C8NA 4BWUA 3S0PA 2E9IA 5JR1L 3V7AG 2YZ5A 4WHTA 2GIXA 4WGKA 4YSEA 4RISH 2QZ5A 1D9KA 4LPYA 4LAJH 4I5XA 3QZMA 3CPRA 3M43A 4FQLH 2QQLH 3NA9H 1J48A 1AC6A 4GUJA 3MFGB 3VK5A 5AKTA 4PFHA 1UJ3B 3O2WH 3KCWA 1IKFH 3HF3A 4O57A 3DX2A 2ZX7A 5KYNA 1RH9A 1C8PA 3HG4A 4Z7NF 2G9HA 3JVAA 3MDUA 3FGCB 3KP1A 3POCA 1EERB 3MA7B 4U05A 2WPBA 3SIZA 1V6YA 4WFED 2V3FA 2OJEB 4FXGA 3UJJL 4RGND 3DHDA 1FH5H 5LGZA 3DRTB 4Q4IA 3S2CA 4YVXA 3W81A 2GGIA 3ZE2F 5G4EA 4N2CA 4MNKA 1J7VR 3L3DB 4ELMA 4JRYB 1OP3K 4AWUA 4K9EL 4F7EB 3ETBJ 3O3UN 1ORQB 1VBHA 3MSPA 1WEJL 5EBWA 4J3OG 3CSPA 1SN5A 5DT1L 3KLHC 1J11A 1YNKH 1HJWA 4Q4EA 3IJYA 1JPEA 5HNNA 3KVKA 5FYKE 3KBSA 3BLLA 4HCRA 4ZMNA 1YCSA 3E2RA 1BQHA 3IV3A 4M5SA 3UBFA 3KOXA 1FWWA 4D71A 4JIRA 1YNQA 1UVQB 5JDSB 3ARUA 1G7IB 1IL1B 2Z8VC 4XVTH 2OQLA 1FVCA 4YVNA 3IBOA 3RVUD 3NTCH 3BWWA 4LBEB 3BKMH 4NUJB 2BX7A 3KOZA 3P74A 4OVUA 4LEOA 2B2XL 3HC4H 2KQNA 4E4PA 3CHOA 1E27B 3GHSA 1GVQA 4FNPA 2CNZA 1P6WA 1RZFH 2Y06L 2V17L 5BV7C 2C6QA 4NBZB 1DBMH 3N6JA 1GW6A 1I6NA 4BDVA 3M0KA 4KIRA 3MW7A 3V55A 5IMLA 3WNMA 4WF7A 2X16A 3D0CA 1J96A 3AYVA 1M04A 2ZYFA 2ATMA 5I1IL 2BIMA 4XNUH 3H2WA 2K4AA 4ENED 2F1AA 5HNRA 4B27A 1GW0A 4DPCX 2NXYD 3KXFB 1BPLB 2Z31A 3U7YH 4BSJA 3SJNA 5A8QA 4XPFL 2UUDK 3D5HA 3HFML 4HPHA 3EFOA 4CD6A 1DWFM 4O1BA 2MEJB 1P7HL 1M01A 1VFSA 3DMMD 5FWRA 5DYOA 2J75A 1DVJA 4L1XA 2FQFA 1BFVH 4K71C 4JAMA 4IQHA 1EIBA 1TPVA 4CD8A 3CC5A 2E4FA 4QXTB 2RDTA 2XC8A 5I6OA 1ASOA 1EDYA 4HJUA 1F3TA 3NFSL 4C6OA 3KLAA 4XAGA 1SY6A 1IM3D 3VI4F 4X0KB 4J2PA 3BE7A 3ARBB 3UTSB 5A43C 1ZLDA 1CTMA 5TFSL 5L2KB 4HT3A 2WSPA 1UZHA 1PAZA 2VRAA 4JHWH 1IFHH 1DL3A 1A5NC 3BAXA 4IHBA 4P2VA 4K36A 4P9HC 2UY6A 1X39A 1WXYA 4AYFA 1H9VA 2W9DH 3QYCA 4O50A 4E8DA 2QR0B 3EB3A 1Z9MA 5DFAA 1RULH 2WBJC 5KETA 2OA9A 4ML9A 1KCLA 1UATA 3QSTA 3LLXA 1E28A 3F01A 4JK0D 2GVEA 2UWEB 4EOWH 4UT7H 2NW0A 4TQTA 4W84A 3N0PB 1QNVA 3FLUA 4LH8A 1JN6A 3QWRA 1GVYA 1YNTA 3CHEA 3VFGL 5GS1B 3MBXH 4MUZA 3F5WB 2H6OA 4YTQA 4X5QA 1FG2A 1QG3A 3THAA 1W3KA 3VFTA 3LHVA 1RK0A 1WQ5A 3BIKB 4ALAH 2J88A 3H53A 2VCBA 3MMUA 1VYSX 1QNQA 5CJ8A 2AGJH 2MCPL 3K74B 4NSKA 3US0A 4HS8H 3AG4B 3NCWA 2A3BA 2C3VB 3HBZA 4HJJL 4XBGA 1BSIA 3UZJA 2KDYA 1BQ5A 4M8QB 3O11A 2Z27A 5C6TL 1G6RH 1GVOA 2JELL 4HUVB 1INDH 1D5ZA 2VN6A 4P5SA 2XT1B 3QQWA 3M5YA 3LKSA 2H1PL 5C0CE 2D20A 3T2PA 1OQXA 3W9DB 3VSTA 5FUOL 3ZYIA 4ORGB 1JMZA 3L5MA 3TSBA 3QIBD 1SU5A 3BZFB 1J8HD 3OZKA 4AZHA 3OF6D 1Q6LA 2X4SA 3FUIA 3WH9A 1KBPA 3T8QA 4HPYL 4GAGH 4U3CA 4OLUL 2IMNA 2R4RL 3BE1L 1NF7A 4UTBL 1I60A 4I48A 4Y4KC 2BIHA 3PWIA 1PTAA 2WMHA 1L4IA 6XIMA 1W8EA 5EG6C 1GZQA 4AZIA 4KJYA 4OZFH 3NRPA 4KJPD 4NCC1 4N7QA 2IDSA 4Z3JA 3UJIL 3LTYA 1MUJA 3VXNB 3WTSA 1I3RA 3R4RA 5DD0H 5CLWA 3GXTA 1Q9KA 1DUZB 1CFNB 3I3BA 3NCEB 1KYFA 4Y19E 3IDNB 4LLVB 3WTWA 4PRWA 4R0LB 3RG6A 2XVLA 5FF0A 3EOUA 4D9QD 1TJ2A 3UXIA 5DMJB 5C54A 5C3TA 2AV1B 3FYOA 8RUCA 3DBPA 3W7LA 3S3DB 2Z93B 1FN4B 3MNVB 1TFPA 1KCRH 4FQ1H 3MRBB 3CSFA 1E4HA 3SY0A 1I3VA 1J9QA 4ATTA 4H8WL 3KPNB 1IKNA 3ZE0E 3NGBB 1EUUA 3MJ9L 1JOIA 5DANA 1SVCP 3ESVF 4H1LG 5L7XH 2AABH 3BPOB 4IQDA 4LFYA 1Z3GH 4PI2A 4KVNH 1UROA 4XD6A 2VW4A 4RE4A 1J05A 3T0TA 2GY5A 3EJSA 3L3HA 2DDXA 4JEQA 1Q13A 1QNZH 3OZ9L 4AM0Q 5CMAB 2Z91B 3PUCA 5FECB 5EU5B 1S2AA 4JQ3A 5BQ7A 3G3DA 4UU9B 4WV1B 3L2LA 3FXIC 3GBDA 5HHMB 1S7SA 2V38A 1GT8A 2ZOKA 2G95A 4U1SA 2KERA 3WL9A 3BFOA 4NNCA 2TYSA 4NG3A 3HG2A 5D8ZA 1JZ7A 3L3OB 1FCCA 2J5LB 3R5EA 4WY0F 1VCFA 4N0UB 1N70A 3CV1A 3GMMA 1G01A 4XN9A 1KM1A 1NEPA 5KYXB 5DI8A 3BJTA 3TC3A 4RCXA 1ZRUA 4DW2H 3Q2LA 1V51A 1JF1A 1SXCA 1HWHB 1UD8A 3E8UH 1HYSC 1RQ5A 3A6OA 1EVTC 2ACQA 3NIGE 4I1RA 2KHAA 3UETA 2CHDA 3BRGC 3CTTA 3VXUB 4OZFG 2ALRA 1CFQA 1G69A 3KDPB 3CHVA 3QFEA 1R24B 2WXPA 3NZHH 1DV7A 1PE1A 4FB7A 2HA1A 1UYWL 4U6XB 3SRFA 3DOHA 2J20A 4DAFA 4TQHA 1ISWA 2FIQA 1AK5A 3BQUC 5HHXL 3U30C 2PGWA 1EPFA 4MY1A 2P88A 2PYEA 3N5AA 4BSVA 4D6HA 3BYYA 5AC5A 5DJYA 2HKAA 2GQ9A 4LARH