1QPKA

Mutant (d193g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
418
Chain Sequence
b'DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFGFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MALTOTETRAOSE-FORMING AMYLASE)
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 145
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qpkA01
3UR8A 4WKFA 4HMEA 4FMVA 4MNJA 2VR4A 2Z1KA 3KLLA 4OJYA 4L4PA 2XIIA 3VPLA 5ABEA 1GNXA 2IUZA 4HA1A 3TA9A 2VVNA 3S5ZA 3W0KA 5CXPA 1GJUA 3AIRA 3WIJA 2ZWYA 2VJXA 3EJUA 1FHLA 3OLGA 2VZSA 1ZS2A 4GI9A 1D2KA 1V6VA 3AXHA 3CMGA 2FH8A 3LXAA 5D9MA 2BHUA 1H49A 4GO9A 5E0CA 1DWAM 4P8UA 4D6IA 4GQRA 1EXPA 1RH9A 1JL8A 2JEPA 2DSVA 1GPFA 1E9LA 1VFMA 4UQBA 3WF3A 3UCQA 3AS3A 1EDQA 2ALWA 3K8KA 4AD2A 1R47A 1KBKA 1WZAA 1ODZA 3A4WA 1XRVA 3SCSA 1A47A 2XPKA 1KGUA 5A6JA 1HKIA 2YL5A 7CGTA 1MQRA 1CGUA 3GXPA 4UQAA 2EPMX 3NIYA 3WQVA 3ZR6A 4CKQA 4KH2A 1HF6A 1NM9A 2CKSA 3D50A 3PZGA 1IT0A 3MUZ1 3OGSA 4B9YA 3WUEA 1JI2A 1HJXA 2X2IA 2UY3A 3CZGA 1CDGA 3VOCA 4PMQA 1OGBA 4ATDA 1YQ2A 1HT6A 3A6OA 1EHAA 3O9NA 1J10A 1UQZA 1UZ1A 3CZJA 4HOZA 3PZ9A 2JALA 3BUBA 1BG9A 2VVSA 2F2HA 5IFTA 1NH6A 3THCA 1HX0A 5GPRA 4CN1A 2VL4A 4HZ7A 3EMCA 1GVYA 3W53A 2GJPA 4PMYA 1CENA 1GONA 1CPUA 1XSIA 2V3EA 5CSYA 3GH4A 4BS0A 4UFMA 4ZXLA 2WZIA 1VEPA 4AW7A 3A22A 3NYDA 3LPOA 2A3HA 1DHKA 3DX4A 1Q6DA 1UKQA 3DX1A 3F5JA 4MNKA 5CPSA 3CZLA 2X05A 1H1NA 3M07A 2WMGA 4M1RA 2V38A 4CU6A 2B31A 1Y7VA 5BRPA 1PPIA 2ZX8A 4CN4A 1HVQA 5A6BA 1JF5A 1HKMA 5IHSA 1CXIA 4B3KA 1QI0A 5ECUA 2J7FA 1E4LA 4MB5A 4UNIA 5CPQA 2OSWA 4YHEA 2ZUNA 3BLBA 4MJ4A 1VEOA 1V08A 3WKZA 4AY1A 1G94A 2F18A 1OD0A 3WNPA 3RILA 3BAJA 4FNTA 1EO5A 4JCMA 4H7VA 1OGGA 3RPMA 4ZXOA 1UWQA 5E09A 4XZWA 2G3NA 4E8DA 2PC8A 4J3SA 4AEEA 2WHMA 2BXYA 1Q6FA 2XM1A 2WVVA 2J7HA 4D6CA 5DMYA 1W9PA 4AZ6A 1TA3B 3KL3A 1V3LA 5HBFA 3KE0A 3AIBA 1PIFA 5DT7A 2BHZA 2J7EA 1C8XA 1JYXA 2X2YA 3WUBA 1US3A 4H8VA 5IFPA 2EPOA 4BQ2A 2WMHA 1NWTA 1J01A 2YDSA 1PBGA 2GK1B 4CCCA 3W37A 5ABGA 4IUGA 3VIJA 3WF2A 1BVNP 1W3HA 1WE5A 4U2ZA 1BFNA 3AYRA 2JF6A 3S2CA 3WBAA 5A6KA 1UYQA 2YFOA 3VINA 1FH8A 1JDDA 3D4YA 4W8LA 5A3HA 3AFBA 1B9ZA 3CH9A 2F1AA 2EPLX 1MWOA 1B0IA 2PWDA 3EDFA 2J77A 3AICA 4NRRA 1ITXA 2BVYA 1GUVA 4XUYA 5FOOA 2GDVA 5AYBA 3BUPA 4D6DA 3AMCA 2XVPA 4W88A 4U3AA 3FAXA 1C90A 4MJ2A 4CU8A 4PN2A 1KQZA 3LMYA 1HXKA 1EH9A 3AS1A 2YOCA 2J7BA 4MAVA 1WO2A 3CC1A 1C91A 4W7UA 2DT0A 2FDMA 1QI4A 4OOUA 3B8SA 3GXIA 1C3FA 4UFKA 1H41A 3FHQA 1SMDA 2ZX9A 2F7QA 1R8LA 3AQUA 1OGSA 1CBGA 1LQ0A 1UKTA 2VX4A 3FN9A 2CESA 4N42A 1LWJA 2JFEX 4H2CA 4FNPA 1GJWA 2WKGA 2DQXA 2YDQA 3LRMA 3PBGA 5I77A 2HISA 3H54A 4HA3A 2PWGA 4W85A 2CPUA 3L4UA 4PSPA 1E5JA 4MB1A 4F8XA 3WNNA 5LA2A 2DH2A 2E9BA 1C8QA 2G8ZA 2XVNA 5HDRA 2XSAA 1EDTA 4KMQA 1QBBA 1TVNA 1QOXA 2WZHA 3WMSA 3N9KA 3EJRA 5A6AA 1UR0A 1JDCA 4UQ9A 1BG4A 2WANA 3U5UA 3ECQA 3QOKA 3ZT6A 5JBFA 3NSMA 4EKJA 2ZXAA 3CMJA 3BMWA 5I23A 5C70A 3CUIA 4WJXA 4PMZA 2UWFA 1TUXA 1J0KA 3ZJ6A 3TV8A 1UR9A 2ZICA 1YHTA 4AIOA 5CLTA 3UEQA 4WF7A 1NOWA 1FH7A 4CCEA 3ARUA 3POCA 2XUCA 3BLKA 1Q6EA 1GVIA 4P8WA 1V3MA 3KWXA 2WCSA 3IJ7A 1ZB5A 3F5LA 2E8YA 2WVTA 5A8PA 2FYVA 2X1IA 3VGDA 4U3CA 4K68A 5BXRA 1ZBWA 3UG3A 1XYZA 3RJYA 1N82A 1UD4A 4V28A 2NSXA 3CZSA 1B3YA 4ATLA 1UWUA 3OB8A 1LG2A 1OSEA 1GW1A 4JFVA 2QMJA 2V3DA 5I79A 4V27A 3W26A 4D6HA 5BXSA 4UQEA 3VGFA 3A3HA 4P8XA 5EB8A 1CLVA 3D52A 3MO4A 1IV8A 1VBUA 3EDEA 5HPOA 3BAXA 3WD1A 4JL2A 1GOIA 4NI3A 2QPUA 3AMGA 4J28A 3OGVA 4UR9A 1G01A 3T09A 4AZCA 1BGAA 2VX6A 1PIGA 3A23A 3VSUA 3WUGA 3SCUA 3WDIA 2OYKA 4GXPA 4U33A 3ZJ7A 3GXMA 4CCDA 1ESWA 3AHTA 5A2CA 1WDPA 2XSBA 1WCGA 1H0IA 3PZNA 4HU8A 5A8QA 3BVUA 2VZVA 1E1EA 3NUKA 1JAKA 3UETA 4AWEA 5DFAA 2BS9A 2CBVA 1U33A 1UQYA 2WCGA 3MMWA 3AISA 3N13A 1AQMA 1UR2A 4TVUA 2RGLA 3SUVA 3VDBA 2CHNA 4KRTA 1WZLA 2VURA 2EBNA 1XD1A 3GM8A 2VZOA 4URIA 2Y5EA 4L4OA 1ZBVA 3PZMA 3CHFA 5C71A 4H41A 4GIAA 4MPKA 1QWNA 3AMKA 1HKKA 3AHYA 2WVUA 1FA2A 2WB5A 1DP0A 3IAPA 1C7SA 3W25A 2IGTA 2CXGA 5I24A 2WLZA 4BZYA 1OWQA 2WKLA 2QPSA 5DT5A 3U57A 4D1JA 1R86A 4ZEPA 4RE2A 4Y7EA 2VX5A 5GNZA 3CZEA 3T2OA 3NSNA 3SCVA 3EDDA 3GYCA 3CPUA 3QHOA 4PYSA 3AYSA 1CECA 1MW2A 2PBOA 5LA0A 3ARYA 3ZR5A 3LPFA 3PZVA 2EABA 1K9FA 1E6QM 4FNSA 1EOKA 4UFLA 4WSJA 4AZHA 1Q6GA 4QAWA 2CKRA 3CBWA 4WK9A 2HVMA 1R87A 2E9LA 3ZIZA 1GQJA 1NOUA 3BCFA 5A6SA 3N15A 4W8AA 2W5FA 2VCAA 6TAAA 1CXHA 1JXJA 1HNYA 1TMQA 3N17A 1CXEA 4UFJA 4AZ5A 1OIFA 2YKKA 1X6NA 1VEMA 3BVXA 1CXKA 4J3WA 2YFNA 1QNPA 1O7AA 3VNZA 2X2JA 1D3CA 3BLPX 4PSRA 2FGZA 2DPEA 1KBBA 2BV9A 4B9ZA 1WAWA 3W6MA 4DUWA 5BYWA 2F61A 4KGJA 3U7BA 3KZSA 1V3KA 4ZENA 1W1YA 2PWHA 1E72M 4GZIA 1VBRA 2DT1A 2J62A 3VM7A 3KL5A 2XYLA 5DF0A 3TP4A 2WW5A 1UA3A 4D6FA 4PTVA 1XSKA 3L4TA 1DWHM 1H09A 1SR0A 2E4TA 2J74A 1BSIA 2YA2A 3JUGA 2WC3A 4CD4A 3TONA 2E40A 3MMUA 3BMVA 4PEEA 5I2UA 2TAAA 2BXZA 2DSUA 2D2OA 3MS8A 2OW7A 3ZSSA 1NARA 1JZ5A 4W5ZA 4E2OA 1DWGM 2BY2A 4FNQA 4DUVA 1PZ2A 4WIWA 5I6SA 1VJZA 2J7DA 1QI3A 3W28A 2DSZA 3RCNA 1VFFA 2RGMA 1PEZA 3W4RA 4X9YA 1OT1A 2ZUWA 1DWIM 1HJUA 1UWTA 1JZ2A 3A4AA 4TUFA 5A69A 3IGUA 2X2HA 4J27A 1J0JA 3WQWA 2C7FA 4PBGA 2VX7A 3HJEA 4D72A 1MYRA 3L4XA 3M7SA 3K1DA 2VC9A 3PZTA 2XHYA 4AZBA 1UD2A 1VB9A 1M03A 2WK2A 1CGTA 1V03A 4TVCA 3PZQA 2FE0A 1K9TA 2YL8A 2XVLA 4AD1A 3MMDA 4WKAA 5LA1A 2IXVA 1W3JA 1KFWA 1UA7A 2GUYA 4M56A 5HNNA 4HTYA 1UHVA 4F79A 3SCNA 4XV0A 2PB1A 3W27A 1W9BM 2WMKA 4ACZA 2W92A 3UG4A 3PN8A 3K46A 1PX8A 1H11A 3DHPA 4MTVA 5I0DA 1G1YA 2WMIA 2XG9A 2XWEA 1F4AA 1KGXA 3MV11 2EADA 4NZJA 1HL8A 1UD6A 4KRUA 1ISXA 1ZU8A 1GOKA 4GI8A 3G6MA 3EDKA 3AXXA 5FCZA 4PTWA 1SFSA 3N04A 4CD5A 3FHAA 1GOQA 1MFVA 1LJYA 3OA5A 3AROA 5E70A 2XWDA 1XD0A 4AZ7A 2ZUSA 4R27A 1UR4A 4TOQA 4DM2A 1TQUA 4JHOA 4AZCB 1JYVA 4B15A 2QMKA 3VX1A 2X09A 4AXNA 1KCKA 1EA9C 3BSHA 4D6EA 1W9XA 4OBSA 3AZRA 5JIPA 3EMQA 1W2PA 3D3AA 3VD9A 2QF8A 5ABHA 1H5VA 4DWSD 4C7DA 3RM8A 5BXTA 1XHGA 3PZOA 3WQ6A 1VENA 2F8QA 4MB4A 2YIHA 1ECEA 3AJ7A 1HN1A 3OZOA 3PTQA 3LXBA 4ATWA 2QV4A 3BXWA 3VTRA 3BSGA 3WMCA 3D51A 5IXEA 4HMCA 4GO8A 4YHGA 4C7GA 1JGIA 3ARXA 5CGMA 3WD4A 1BAGA 3OLIA 3BCDA 1ISVA 1TR1A 4U5KA 2C0HA 5CGTA 5A2AA 1QHOA 2Y8KA 1R85A 1W1TA 3WF4A 1E0XA 4PCSA 4PMDA 2WHJA 3GNPA 3ZJ8A 2GFTA 1UWSA 4FNUA 3VIFA 1GQIA 2ZX5A 1WZKA 4TXEA 3LPGA 3A21A 8A3HA 5CSUA 3GTNA 2VOTA 5AC5A 4M24A 1UH4A 2ZIDA 1IZJA 4QLJA 2JF7A 5A1AA 1QI5A 2CEQA 3AOFA 4AISA 5CZKA 1W9VA 3O6AA 4F9JA 1QBAA 3RIKA 3WMBA 4M8UA 1BYAA 1QI2A 4JHZA 3VSVA 3ARSA 4UTFA 3WDQA 2YJQA 2O9PA 1H3GA 3BC9A 4P7NA 3CZKA 4NX0A 5HPCA 3KEHA 3TTYA 3WUFA 4JFTA 2V3FA 1JIBA 1UH2A 4AIUA 2D0GA 2BFGA 3MANA 4PMNA 2XFRA 2YA1A 1S46A 2V3GA 1TG7A 1UASA 4C7FA 1KR0A 2UY2A 3IANA 4GPNA 3L4WA 3CZ8A 3EYPA 2YBUA 3AHXA 4KGLA 3OGRA 4M29A 1W1VA 4PUDA 1O7DC 3AIUA 1FHDA 1KXVA 4LQ1A 1XH1A 4OBRA 1F4HA 3I3DA 3GXNA 1R46A 2BNJA 3ZJKA 3ALGA 3VD4A 3BAYA 2DSKA 2Y2WA 3WY1A 1HIZA 4Z2GA 3EJTA 3RJXA 3OG2A 4M82A 3M46A 3W29A 3QHNA 3I3EA 5CPTA 4DUXA 4X0VA 1GOWA 3SCTA 2JIEA 1IZKA 3K4AA 4LYPA 1CXFA 1CWYA 1X6LA 5FIPA 1JYNA 2DT3A 1E3ZA 3DC0A 1WNOA 3GH7A 3T2QA 2MANA 4NZFA 3CV5A 3WH9A 3IJ8A 1E0VA 1RP9A 1VRXA 1E43A 2ZOXA 4MDOA 3S6TA 4HP5A 4Z2JA 5M03A 2D73A 3OBAA 2VTFA 4GQQA 3VD5A 1XSJA 3H55A 5GNXA 3ARZA 4DO6A 1JZ8A 2V5DA 3ALFA 1C7TA 1HJWA 4E8CA 4XX6A 4ML4A 4B16A 3MUIA 1CLXA 1B3WA 4HZ6A 2E8ZA 5JIWA 4LPCA 2NT0A 1KWKA 3LX9A 1V0NA 3BUIA 5JBDA 1DEDA 5BWFA 1OCQA 3OLEA 5I5RA 1E4NA 2W63A 2C8NA 3WH5A 2D3LA 4AZIA 4PMRA 1AQ0A 3LPPA 4HZ8A 2WBKA 3DYOA 2FGLA 1UKSA 3VIKA 5E6ZA 4PRWA 1W32A 1JZ4A 2ZUMA 1E73M 2ZX6A 1FFRA 2GSJA 3GBEA 1O6IA 4HPHA 3M6DA 1NP2A 4F66A 1GZJA 2VQTA 1KWGA 5EBAA 1M7XA 3CHDA 1GORA 5CG0A 2D20A 2ZUUA 1TE1A 4IM4A 3O2LA 1CGXA 3W81A 1J0HA 3QR3A 4S3JA 1E6XM 3CHEA 3KL0A 1W9DM 1M53A 2D0FA 3AIEA 1B3ZA 3MUAA 3F4VA 1BPLB 1EGZA 2OYLA 4RE4A 1BYCA 5GNYA 2OLHA 4JKMA 4JAWA 2WMIB 4HOWA 1I1XA 1UUQA 4U5IA 3B9AA 4MDPA 3VO0A 1JXKA 1VFUA 1J12A 3N1AA 1R75A 4Z2LA 3GH5A 1BF2A 2W67A 4MAZA 5JUVA 3ZT5A 4TTUA 2JEQA 1JZ7A 5KEZA 3MU7A 1H4PA 1OBAA 2YL9A 2UY4A 2GJRA 1HKJA 1W9UA 1TFVA 4LYQA 2WM0A 1HTYA 4BQ4A 1UZ4A 5E1QA 3AIQA 4OUEA 3VMNA 3RM9A 1LL4A 1MW0A 1OB0A 4DWSC 3WY4A 1NOFA 4AZGA 1WZMA 2WNWA 1R7AA 1JDAA 2EACA 5LYRA 1NWRA 1CIUA 1KTBA 3T2PA 3WF0A 3AHZA 3CZNA 5AC4A 4PCTA 1HJVA 4DM1A 4LX4A 4CD8A 3VD3A 6CGTA 2F7OA 4LGXA 1QPKA 3T0AA 1BGGA 4XZBA 3UESA 3MV01 3SCRA 3SUWA 3D4ZA 3I3BA 3BUQA 3VX0A 2WBGA 3UR7A 4UCFA 2WVSA 4GKLA 1TQWA 3WEMA 4CVUA 3EDJA 1J0ZA 3CLWA 5CLWA 3HG3A 1QHZA 1HJQA 3NDYA 3SUTA 4QCFA 2D3NA 1V6UA 3WNOA 4NF7A 5HOSA 3VSTA 2OSYA 4J3TA 4MADA 2O9TA 3WN6A 3MSDA 1JNEA 5DEZA 3DDGA 1B31A 2E3ZA 3MKKA 3VILA 3DX3A 1W91A 4PMUA 2WMFA 3RMEA 3AMLA 3WBEA 3VMOA 1ISZA 1FP8A 2WVVB 2OWWA 1ZJBA 1FH9A 2ZUTA 2PBGA 4EANA 1ISWA 4AMCA 1UWIA 2D0HA 2J25A 4QLKA 3EJQA 1E71M 4OGZA 3SEPA 3GXDA 1KTCA 3OLDA 1QHPA 4QDMA 1E70M 3A4XA 1H2JA 2WXDM 2WAGA 4TX6A 4D6JA 3SCWA 1HP4A 5D9PA 1PX3A 3VIOA 1PZ3A 2J7GA 5EFFA 4Q22A 3CUHA 3L2MA 1ODUA 4W87A 2Y24A 2OSXA 2ZUVA 1V3HA 2GK1A 2J78A 3ARVA 1EO7A 1MVYA 2BHYA 5ABFA 3WD2A 2WHKA 2VCCA 3FW6A 1J11A 1V6WA 3ZQ9A 1R7OA 2V5CA 1OD8A 1PS3A 2O9RA 1OIMA 3A47A 1V6XA 3AZTA 1U2YA 2QHAA 1CGWA 4CD6A 4QFUA 4NSBA 5A8NA 1QW8A 1MFUA 2VUYA 1HP5A 3WNLA 6A3HA 1B90A 4A3YA 3AS0A 3GNRA 1JD9A 1WPCA 1UR1A 4CD7A 3SIMA 1P6WA 4GINA 1PAMA 5GQBA 4MNMA 5FKYA 2PF0A 4J3XA 3RDKA 4UFHA 4ZE4A 5F7UA 5M5DA 4EAMA 3AHVA 5I3DA 1EQCA 1V6YA 4PMOA 3K8LA 1VJSA 4CGTA 2XVGA 2ZXDA 3PHAA 3VIPA 4AYGA 4UOJA 1RPKA 1TQTA 5A6LA 3ZSTA 1NP0A 1Q6CA 1GQKA 3U5YA 2XN0A 2ZWZA 1M01A 1XYFA 1CGYA 3VGBA 3ZM8A 5A2BA 1QWUA 4MNLA 4DO4A 3SCOA 4UQDA 3WDHA 2EXOA 1J9YA 2FHFA 4OZOA 2ZXBA 1E6ZA 4BQ3A 1KR1A 5KZ6A 4PUEA 2X8RA 4GZJA 3QOMA 3WQ8A 2PI6A 3U7VA 3VIMA 3LRLA 3WEOA 2GJXA 4OOZA 3N12A 3EJPA 2D24A 5D9NA 3RO8A 4FLRA 1GHSA 2DH3A 3E1F1 4DWSA 3A24A 3BVVA 3VUPA 1GHRA 3CUFA 1ZJAA 1HL9A 3PTKA 1RP8A 1JD7A 4IPNB 4WLCA 4DO5A 1CZ1A 2BY0A 3GXTA 3PTMA 3VD7A 3IK2A 3ZOAA 3HG4A 3ARPA 4OKDA 3VGGA 3ARWA 2W4XA 3J7HA 1V0KA 3MI6A 3BAIA 3HMCA 3T08A 3CUGA 4HA4A 1K9EA 2ZXQA 3KLKA 1G0CA 2VNCA 3VIIA 4JFUA 1LLOA 4U31A 3W38A 2JIWA 3WL1A 3OZPA 1K9DA 4FK9A 4HMDA 1PJ9A 1CXLA 1AMYA 4NZCA 2BY3A 3TTQA 2G4FA 3GNOA 1UD5A 5D4YA 1EOMA 2VO5A 3DDFA 3W6LA 4CU7A 5M17A 1E40A 1J0IA 3NCOA 4GZEA 3LXCA 2YLAA 1FOBA 3WDRA 4A3HA 4CN6A 3B9EA 1HVXA 1CTNA 4W84A 3DHUA 2GDUA 2NW0A 3FXYA 4NXKA 1CNVA 1EHNA 5DO8A 4AD0A 4JKKA 1E6PA 2F7PA 2G3JA 4M80A 4IPLA 4JKLA 2YA0A 1EDGA 4U2YA 1LL6A 4AEFA 1WDRA 2D22A 1ZBKA 1UH3A 3IJ9A 2XFFA 2E0PA 2AAAA 1BYBA 1W3KA 2J75A 1RD6A 5EFDA 3ZT7A 1DWFM 1JFHA 3WEZA 1JFXA 2BY1A 5BROA 3CO4A 2VR5A 5TD4A 3WNMA 1BQCA 3WELA 2A3AA 2A3EA 4W7WA 5HXMA 2EJ1A 4AD4A 2VRKA 4R5EA 4FNRA 1BVZA 4JFWA 1J18A 1KGWA 3VDAA 2AMGA 1B30A 2CETA 4W86A 1W1PA 1LL7A 3B9DA 4FLOA 3OIHA 7A3HA 3VDCA 2VRJA 2IXUA 1B1YA 1I75A 1E4MM 2X0YA 1AQHA 3GXFA 3VM5A 4HU0A 4H8HA 4FF5A 1E0WA 1KXHA 4YPJA 4F9DA 1DTUA 4Z2HA 3HN3A 1LG1A 4W5UA 2G3MA 2QLYA 2GVYA 2XIBA 5BRQA 5M3WA 2J8FA 3RM4A 3CHCA 1D7FA 2G3IA 2UY5A 4BCEA 1UD8A 5I78A 3SCPA 1B3XA 7TAAA 4Q7NA 4TTGA 5A94A 2EEXA 3POHA 1E6RA 2WLYA 5A8MA 2WHLA 3F5KA 1UD3A 2XN1A 5A8OA 1JI1A 3BUDA 3HG2A 3BVTA 3W24A 1E1FA 1ITCA 1SMAA 4NXSA 2O9OA 3HG5A 3CGTA 4M81A 3PZUA 3WDPP 1V3IA 4ZFMA 1BYDA 4LYRA 1SYTA 3IAQA 4CUCA 4B3LA 1E56A 1GOMA 1XH0A 3DYPA 5ABFB 2CCRA 3QHMA 3VGEA 2CIPA 5E9AA 2W62A 4E4PA 4P7OA 1CYGA 1QNRA 3NDZA 3AIWA 1GCYA 5A6BD 2DSWA 1WDSA 3AIVA 1UKOA 4IISA 2FHBA 2W91A 1E5NA 3VDHA 3THDA 8CGTA 1NWSA 4BQ5A 2YDRA 2CBIA 1E4IA 1V0LA 1US2A 2Y4SA 1KXQA 5CJ5A 3L4ZA 1TZ7A 3WSUA 3T0BA 1CEOA 1AVAA 1KB3A 2WZEA 1K6AA 3L4YA 2DGAA 2F7RA 1E15A 3EBVA 1NQ6A 1X1NA 4AMXA 3WD3A 4QLLA 3TOPA 5D8ZA 4WKHA 3VVGA 4Z2IA 3UG5A 1MW3A 2CNCA 1UR8A 3WF1A 5FL1A 4W89A 4W7VA 1I1WA 4NRSA 2Y8VA 3FAWA 2CITA 3APGA 2J79A 1QNQA 1UG6A 3DX0A 2XM2A 1W2VA 2YBTA 4GI6A 4H8UA 2WMJA 3G6LA 1XH2A 5FL0A 1L8NA 3GBDA 1E55A 3WQ5A 1TCMA 2YLLA 1VAHA 3QGVA 3WH7A 2GJXB 1QNSA 3MSGA 4PMXA 4DWSB 2F1BA 2J8GA 4AMWA 1B3VA 1WKYA 4AD5A 5D8WA 1U30A 4J3VA 3ZMRA 4P7LA 3WFZA 1FP9A 2CBUA 1A3HA 1J0YA 2ZE0A 4OIFA 2CERA 4TX8A 1R33A 4HPGA 1CGVA 2OWCA 1GOOA 5D9OA 4ZE5A 4JL1A 4ACZB 1QW9A 4UOQA 4XB3A 2VZUA 1BHGA 4PTMA 2FHCA 1ISYA 2DIEA 1UKPA 1W3LA 4RL3A 1QX1A 3VMPA 1LF1A 4MB3A 1JYWA 3FNDA 4UZSA 4PTXA 1QVBA 2VMFA 1B2YA 4JCLA 3AXIA 4UFIA 1V02A 5FD0A 1MQQA 2EPKX 3TTSA 3SUUA 3WY3A 1MQPA 4H04A 1Q4NX 3WH6A 1UWRA 1E6NA 3AZSA 3VNYA 2BVTA 2OWXA 1NWUA 4QCEA 3VKKA 1EQPA 4FLSA 1V02E 3SUSA 2W61A 3BAWA 2WYSA 4X0NA 4CVWA 5AYIA 1V0MA 1HXJA 1G9HA 3WY2A 2CHOA 1T0OA 2ZX7A 3ARQA 3WDJA 2CBJA 1V3JA 2EQDA 3WL0A 3VIHA 4AD3A 2BVDA 4EE9A 5BXPA 3S5YA 2AOSA 2EO7A 4P7RA 1C92A 2VI0A 2G41A 3GDBA 1BLIA 4UOZA 1JZ6A 3CIVA 2XN2A 3WH8A 3VIGA 2J47A 4HOXA 2VRQA 3H53A 1PX4A 4WSKA 1KCLA 4AIEA 3HZ3A 3A5VA 1EIBA 4V2XA 5IHRA 4ACYA 1E6SM 1TVPA 3GZAA 5C8BB 2WWCA 4P8VA 1JF6A 1HJSA 4JIEA 1Z32X 5A95A 2FH6A 1MW1A 2ESCA 1L0PA 2WC4A 1JAEA 1HWWA 2PWFA 4S3KA 3CUJA 2D23A 2WWDA 4J7RA 2A3CA 3DX2A 1XC6A 1JZ3A 4J3UA 2XFYA 1H0GA 3D5HA 1TQSA 3WENA 1KXTA 2OW6A 2VQUA 4PMVA 3WD0A 4D1IA 2XJ7A 2NT1A 3ZO9A 4N0RA 3BVWA 3L2LA 5CQ1A 1VIWA 3LRKA 2O92A 3WNKA 3EMZA 1VF8A 3SCQA 1XV8A 1M04A 4KWUA 2VZTA 4BA0A 1XCWA 2XGBA 3L4VA 4TVDA 2OYMA 2DIJA 2WPGA 3MUY1 1C93A 1QNOA 1TA3A 4YN5A 3WQ4A 2J4GA 4A4AA 3II1A 2XTKA 1FFQA 2WCAA 3NJ3A 3UERA 1MXDA 3ARTA 2WC7A 3ARRA 1WDQA 1XCXA 4UQCA 4W93A 2E9MA 1UOKA 1GQLA 2EAEA 1TQVA 2YL6A 1KQYA 2JE8A 3FY1A 2XVKA 2WSPA 3NSXA 2WSKA 3K8MA 4W8BA 4D71A 4P7QA 1BTCA 3AS2A 2Z1SA 2D1ZA 2EPNA 1ZBCA 2PWEA 1SZNA 1MXGA 3W82A 3VU2A 4JZ5A 2XGIA 5AY7A 1LWHA 1JNDA 1ZL1A 3BH4A 2X0HA 3WFLA 4AC1X 1OM0A 1WB0A 3DECA 2DDXA 4EK7A 2W66A 2VT0A 9CGTA 1DWJM 3N11A 3SURA 3PZIA 4JFSA 3AMDA 3TTOA 3CTTA 3K4DA 4RE3A 4QP0A 3T0DA 3AI0A 1VFOA 3VGHA 2CYGA 4D6GA 1E3XA 1JG9A 2DT2A 3BGAA 5IDIA 3HU7A 1C8YA 5E0FA 3EJSA 2DEPA 2J7CA 4FLQA 1R34A 4AYSA 4Z2KA 5EMYA 5A6MA 5BCAA 3N18A 5JBEA 3BAKA 3DYMA 1OT2A 2Q8XA 5E6YA 2A3BA 1XGZA 4BF7A 2VCBA 1WP6A 4LXFA 4UZUA 1OINA 1G5AA
chains in the Genus database with same CATH superfamily
4MRCA 5EGRA 1A0EA 2A6LA 4A2SA 1GJUA 2PTVA 1W8SA 5I6OA 2ENSA 3F00A 2I60H 2VWSA 1DVQA 1UBPC 3RUGE 3CBRA 1MUJB 5E0CA 4FQJH 3T8XB 5IEHA 4JQIH 1EXPA 1NCTA 4UQBA 3GMQA 3KFTA 3F2BA 5A7EA 3NGFA 5FV2A 2CJUL 3GYEA 1KBKA 3KGUA 2QVMA 1FQ9C 1Q5MA 2XPKA 3T6CA 5C0QA 3H8AA 5CEWA 2VE6A 1CGUA 4LEXH 3ZR6A 2R1NA 3HPAA 1MNNA 3ECVA 2FYMA 4ATDA 3RLUA 2XZQL 2XN9D 2Y5TB 5TF1L 3GIVA 2D2GA 1AH4A 2JALA 3OZ9L 4BINA 2XNAA 1QTPA 4U3SA 2ZWKA 3MI3A 4M93B 1LE9B 4OUUB 1V79A 1I9RH 4Y2DB 1F3JB 2WP3T 3MV9E 3K2IA 3PXHA 3NBNA 1RJRA 1R9FA 1K8XA 5IR1A 1IAKA 1VC4A 3V75A 2V38A 2P5WB 2R56L 2BMKB 2ZX8A 1T7ZA 2LU5A 3KLSA 1DANU 1WBYB 4KIRA 4P9HC 1QLFA 1UPPA 3OPSA 1PZCA 3KAAA 5F7EH 5F1VA 2J8OA 4AXWA 5DN1A 3ZK0A 1AG0A 1JK9A 2CG9X 1Z5LA 3IM1A 3BAJA 4XPAH 4ZQCA 5FJRA 4G7RB 1AAJA 3KRZA 3GSQA 1ONQA 5K9OB 1CBJA 5C7XL 3RITA 3P7YA 2WUBH 5DYFA 2NW3A 4NC1E 2FJSA 1JYXA 1L0YA 4KQNA 5FEZA 1A5FL 3QSTA 3DXAA 1RVFH 4QTIL 3W37A 4IUGA 3ITGA 1BFNA 3S2CA 3JZ7A 3HO8A 1JVLA 1OP9A 5FOOA 3A4DA 2GT9A 3VUAA 1BKSA 3ITLA 1P5VA 5FUOL 1FCVA 1NCNA 4KO7A 3JWDC 1U8IB 3WFEH 5T3ZE 3CC1A 1JGDA 4LL9A 3GSVB 5EB9A 2X38A 3LKRA 1QABA 1R8LA 1T5AA 3QKEA 4EPEC 1M41A 4H2CA 4HHHA 1XCTA 1Q8AA 3PREA 5KSBB 5B39B 3QFEA 2CPUA 4PSPA 3K1GA 5IBXA 4E2VA 2DH2A 5F2LA 3ZWSA 5J06A 4POZC 1B0RB 1WAUA 1QOXA 3PUOA 4Y9PA 5D6DA 1ZHNA 3CMJA 1E4WH 4Z3GA 2APFA 3OMNB 4L80A 5KWYC 2ZICA 3D39E 2VM4A 3M45A 3NQ8A 6ALDA 1IFHH 1NOWA 2QDGA 3VXRA 2EVIA 2Y36L 2H26B 3L3GA 1XIFA 2YRBA 3H2MA 1PYMA 4AVIA 4U3CA 4K68A 3G5WA 1INEL 4H0GA 3WO3B 3UTPD 1GZQA 4S1DC 4YWGH 3WS6A 3K3QA 2FZDA 2FQDA 2OL3B 4GRLC 5KVFE 1CK0L 3QC3A 2Q6ZA 3ZL1A 1JPFA 4OT1L 4J28A 1MCWW 3COOA 1U41A 4S1QL 3D2TA 4QKTA 3BKCL 2E67A 1NICA 3P9WB 1BQSA 4DP2X 3NUKA 3TN5A 1O5DT 3QR2A 3MMWA 1TJ0A 3L45A 1A4KB 4XPTL 1R5IA 4HFWA 2R0KH 1E4HA 1XD1A 2Y5EA 4L4OA 1CBVL 4MPKA 1QWNA 1PFCA 2YEZB 2QCMA 5KS9F 3DFTA 3WUWB 4JFQA 5B1BB 1T6WA 2KLRA 3TJHC 1R3VA 3TH6A 1U9KA 5GRWA 1ZV5A 3FOKA 1CLZH 1NAMH 4FF9A 2VMJA 1CECA 3AYSA 4KTGA 3B5TA 3ULVF 3W7MA 1EV2E 4O1BA 2WXNA 1OY3B 1MCPH 1VCGA 3PANA 3RB5A 3F84A 4Y5XC 2BDQA 1EX1A 3PP7A 5D2LE 4L37B 3GZQA 4DKAA 4UTTC 3SY0A 4M4RB 3BN9D 2K4AA 2Y61A 5HJDA 3QIWC 3L67A 4AQLA 7XIMA 4ODTL 1H1ZA 4N6RB 5DTFA 3QEUA 3LCWA 5ID1A 2VC5A 3VNZA 1RUSA 4UT9A 4LAOA 1FE8H 5F9OL 4B9ZA 4US6A 3CB3A 5LN4A 5I1GL 1GMIA 3FCPA 2P5WD 1NPUA 4YLCA 2FR4B 1FWXA 9PCYA 3FQNB 2VITB 1JULA 2XWXA 2P8PB 1XF2A 2NNFA 4D0DA 3QORC 3DFPA 4YHOL 3GW3A 3MW7A 3P8IA 4MDIA 3V6ZA 1DWGM 3IJDA 2XN9A 5FFLA 1MI5E 1UVQA 4LUIA 3NQ7A 1MVUB 2NY3C 2WW8A 3GHRA 1CFTA 2XG4B 1DWIM 3RK8A 3ZU8A 3V0WL 4OM1H 4NJAH 1S3KH 5BQDA 4KW2A 4PA8A 2C1PA 5KUMA 4OECA 2LE9A 4JE0A 4IIQA 5JLZB 2B20A 1OB1A 4TVCA 3DI2B 1K9TA 5E6RB 4IIFA 4PP1C 1W3JA 1SJAA 4MNHB 4M56A 3VGAC 5MHBA 4J1UB 4G1KA 4EI5B 5F1IA 5FECB 4XRCB 1Z6JT 2AJVL 4TSCH 4HG4K 4QCIA 3BZFB 1UD6A 3V95A 1TVDA 4N9EA 1Q9WB 1OFRA 3G6JE 1UCBH 1KT2B 5HDQL 1BMWA 1UJPA 3FCTB 3LZRA 3I10A 4TOQA 3B5HA 2HUEA 3ME0A 4S3FA 1TTBA 1X9RA 5JIPA 4L65A 4PJXA 4L8CA 4G6JL 5JUEL 3S9DB 3L5XH 5FYJD 4A68A 4DWSD 1FWWA 2C3XA 4QRPA 3KHOA 1KM3A 4PWJA 3C09C 1G6VK 1JGLL 1GJIA 3O2VL 3LXBA 1AZNA 3GSNH 4GS7C 3KS6A 5KSBF 4M7LT 1YEFL 3SKOB 2QCHA 2VDNH 3WXWL 1MDTA 1OP3K 3QWOB 1I1AC 2MCMA 4I0KA 3QEHA 4ISVA 4AYEC 1BX2A 2DMKA 5A1AA 5AW3B 3AOFA 3U4BH 3UPCA 1UWGH 3WLMA 4H83A 4UOW1 1MCJA 2J88H 3LEXA 3I9GL 5HPCA 3CFKB 5CJQH 4GUHA 2BINA 4HWEL 2AXFA 2FFIA 3KOFA 1AR2A 4X7TB 1YTEA 3F7JA 3I7RA 4MJ6B 4FTDA 1NMAL 2RDUA 4IU3B 1G7QB 4PRAA 2YCKX 3UZVB 5LBSH 1FHDA 3BGMA 4YVPA 4AH2B 3I3DA 2CJ3A 1AS7A 1EB3A 2OOGA 3MRRB 1RURH 5CPTA 1TTFA 5CKGA 4XO3A 2JIEA 3OHMB 1FLRL 3SD5A 4HV8A 1ZEAL 3HC4L 1E43A 1T99A 4R7JA 2D73A 2E7LC 3H55A 3ARZA 2D03L 2V5DA 4ML4A 5KS9A 4NZRH 5F8RC 1Q9OB 1M1SA 4Z1BA 1O5RA 4GKTA 3HCVA 2BODX 4J35A 3SADA 2C8NA 3CAVA 2EDLA 3JT2A 2RDXA 1MUJA 4G2DA 3T8XA 5IBUB 3RP1A 3ZTCC 1E73M 5JZ7C 5HBBA 1NP2A 3G5ZB 1M7XA 4J5NA 2WZAA 1W15A 1EZLA 2QJGA 5HJBA 2Q86A 5ANME 3AIEA 3VFLA 4FQQB 4Z7QE 4QXWA 4MBRA 4CC4C 2BRRH 1Z7AA 2D9CA 2OL3H 1GEQA 4MAZA 1TTQA 1CLCA 3EJCA 2Y5TA 5HDWA 1TFVA 4PWGA 4L4VB 2IQ9H 1F90H 4UMCA 2E6QA 5E2UH 3HN8A 2OQJB 3ARDB 4Y1TA 3FK4A 2DTML 4RNIA 2LVEA 4OUUA 2CZFA 2GJNA 3KH3A 1MELA 1O5PA 4FFZA 2F6XA 1F3JA 5H94A 1J4EA 1D2OA 4ZS7L 2F7OA 1S1RA 4URTB 1NAKL 1GC1C 4U6YB 2ALDA 3W23A 3FT2A 3BXNA 4UCFA 4LHJB 2P5WA 2BMKA 3ZL4H 4X2PA 3F03K 2AJUH 4EI5D 3VOHA 4U49A 4Y8FA 1ZVHA 4QG9A 4PC8A 1HAUA 3DDGA 3NDYE 4XBMA 1XKYA 1AO7B 1DVJA 4JTHA 3PAJA 1OCWL 3FU3A 1NDWA 4C6MA 1TIMA 3PVFA 5K9OA 2H45A 2ZRWA 4LH8A 1H2JA 4JN6A 5L6YH 5AZ1A 1PZ3A 4LEXL 4EVNB 4FB7A 1TPUA 2QCEA 3NAVA 1FXPA 5G2IA 2OSXA 1URZA 3G2GA 5J8LA 2J78A 3TVMC 1JQVA 4GJIA 2XLLA 3LZNA 2Y1VA 2WAQA 3S1XA 1TPXC 4LC8A 2I16A 2XIJA 5H1WA 2JTYA 5IB3A 1JD9A 2N1TE 1U8IA 2YD5A 2VDKB 1FX6A 2CJSA 1JVNA 2PP1A 1OE1A 1HYSC 1K8DB 2W95A 1NMCB 1O0VA 3IS0X 4CGTA 4M1GH 1B4JL 3WO4B 3ZKXB 5A2BA 4CADA 4OLWH 3HQPA 2PD5A 2DQTH 4F2BA 1DJXA 1IEWA 4U6VH 2CCLA 5B39A 4WJ8A 2ZXBA 3HV8A 4FFWC 3L7EB 3U4EB 4GZJA 3O3RA 3JWOC 1DN0A 4LHQB 2J5WA 1RCQA 3ABSA 2IBZY 3P74A 4DWSA 4DJED 1XTLA 4ZDHB 1HHGB 3BVVA 3MLWL 4KO5A 2NY2C 5FW8A 5I0XA 5DRCA 3D3VD 3UCDA 4WW2B 4BSJA 3E49A 1DBBH 3INPA 4ZPVB 3RFZB 3VNJA 5FDWA 4PULA 4RWHA 3VKBA 3VXPB 1J93A 2E46A 2CSPA 4QE4A 1WXJA 3KPQB 1XZ0B 3BE7A 3IN2A 1ILSA 4FMKA 5FESA 2PGFA 3A6CL 4H2AA 3N44B 1CB7B 2PCEA 4PHZA 1J0IA 4U1KA 2ENJA 3J2PA 3DA0A 3B0UX 2C9QA 2AK4B 4Y5YC 1UJQA 3S96A 3WLPA 4BBWA 3VXQB 4IPLA 1QKZL 5EHFA 1QCWA 2J1ZA 3NCJH 2DF3A 1V05A 4IYKA 1BYBA 1O4UA 2EO1A 4JOMA 1CL7I 1DWFM 1AMXA 3TJ4A 1PDZA 2FX7H 1QUPA 5TD4A 2GLKA 5CKSA 4NKMB 4NKDB 5BOPA 3OHXC 3FRPB 3V8OA 3V0UA 4U6HB 5CD5D 4BCYA 3MRQB 3AW5A 3M0IA 1D9EA 2YEZA 5G4MA 3VDCA 5CN2A 1IGIL 3P30L 2JCCE 1LEIB 3IMUA 3GXFA 4H8HA 1F4YH 3EYOB 3ALWA 1P6CA 5EWIL 2Z1BA 5A2KH 5HNRA 4PVLA 4NO5B 2R51A 5GS1B 1D7FA 1D8WA 4I48B 5DLMH 5I78A 5EL1A 1RXOB 5E08H 2FVMA 4Y9OA 3WKMH 2VXQA 3FU6A 4O5LL 4L4VD 2NXZC 4L37A 1CD1B 1U3JA 4PLKD 4M4RA 2F6KA 4XPHH 4K8RD 4NC0B 2QADB 5HI4D 1BWMA 1JUFB 1U95B 1OK4A 4N6RA 3TEUA 2AW2A 1AKJB 2YAHA 3W71A 1WUEA 1D8CA 1DUZA 2ZFAA 2F7IA 3EO0A 4GUJA 2AQ1A 2IXQB 4ORGA 5EU5B 2FX8L 1OPOA 1QNRA 3NDZA 1ZKAA 3OJMB 2YMXL 3AU0A 3MBEB 4IISA 1CDIA 3ULUC 1A5OC 2YDRA 5T1MB 5E94B 4HJFA 4XMTA 3IEAA 1PF3A 3KBVA 1FGVL 4DQWA 3KMDA 3F3HA 4AMXA 1ACYH 1AO7D 3QG6A 4HH8A 4JG9A 1GYCA 3LS4L 3WF1A 5JXED 1YQVL 1MVUA 3J27A 4GPVA 4NNPL 4CNPA 3LU2A 1T20B 6XIMA 3HUJE 3IJYB 1VBJA 4A39A 5HI3C 2JF1A 2H8ZA 1NAML 1TITA 3N0AA 3BZDA 5BW7A 3WIHH 5IWLA 4TRPL 4LBEA 4XCYB 4FOKA 4PQXA 4DIAA 3WHE1 3QS3A 3GSOA 4F7CB 5SX4I 3HMXA 4J1UA 2VFDA 4EI5A 1X5MA 2C9UA 3LKQB 4XRCA 4PUBH 1IT9H 1Z5YD 2BWQA 3D5OF 1JCKA 3BZFA 2C0AA 4I5RA 5FD0A 1PKOA 3L1EA 5HQEA 1L6WA 1F61A 1Q9WA 1UWRA 4MBOA 1KT2A 4KDWA 3UTQB 3FCTA 3NEEA 3S4SG 4AEHH 4AD3A 3RI5K 4HS3B 1IJNA 1H7NA 4J2PA 4OGQC 4QM1A 12E8H 3WJLA 4UTLA 4ECLA 4G7EB 4YYCA 2CA3A 3AY4A 4PWHA 3QNYB 3VXMB 5GJSL 4XX1G 2Y07H 1Z32X 4QWWC 3KPOA 4X5WB 2OCJA 1L0PA 4FNLL 5L2KB 1ZVSB 3SPJA 4OM1L 3EXJA 2G2RB 3MLUH 4XSLA 3BDYH 4CAGA 1G7IB 1VIWA 4Z6AT 1KBWA 3ULVL 3O41B 1F3DJ 1XM3A 4BWLA 2WSYA 3CK0H 1HZHL 4YTUA 2HE8A 3DKHA 1MIEH 2WCAA 4WW2F 2AK4D 4CKVX 3H0TA 2WC7A 4ZW7A 2X1XR 3RKPA 3X11A 1P4LB 1FZMA 3CFKA 5KVDH 1I6NA 4L8SC 1WD8A 4OD1H 2VLMD 4DJEA 4X7TA 2Z1SA 5AKRA 1ZBCA 2UYLB 3UXFA 4MJ6A 3T6VA 4OLXL 4R2GC 4JFFE 5DJYB 3KPMB 3N44F 3D3VA 4KVNL 4RK8A 1UCBL 5H8MA 1CFVH 4I6VA 4MYWB 3GI9H 4AH2A 4MCYB 5T5FL 1TU2B 1XT5A 5DFWH 4GQZA 3QQ1A 3Q9QA 2VT0A 3SO5A 3RJQB 4DETA 3MRRA 3PAZA 4RE3A 3RLHA 1DIOA 2PZ0A 1UFGA 4OFDA 2VYOA 3RO6A 2X6CA 1UBSA 4KNQA 2CO2A 1C8YA 3BISA 4G7YH 2AQNA 4BK5C 4ZW5A 4IMEA 5DZNA 1XGZA 3NJVA 3ARBC 2YAMA 3U4KA 4MNJA 1GA2A 5BS0B 4LUTB 2BSBA 1Q9OA 3SFWA 3W0KA 1J1PL 4JR9L 4W4QA 3L5WB 3EJUA 1PKLA 1EPXA 2QADD 4GMTH 2N0MA 3JU2A 3H6JA 5D9MA 4EPSA 2GZXA 1AKJD 4A2DA 4RA3A 4JO3L 3HM7A 2DSVA 4GLRI 2YK1L 1A6WL 1A4JB 4AHPA 3G5ZA 2P50A 4M5TA 2ADAA 3RB7A 2YCLB 4RZ6A 1FAKT 1NM9A 3D50A 4FQLH 4FQQA 3EPMA 3ILPB 4OU3A 3CZGA 4Z5RB 3QQ4B 1OGBA 3HE7B 3IYLW 3GHTA 5LBSL 4E41B 4Q4SA 2FX9L 1J96A 4XZUB 5HHVH 4XC3L 1ICQA 4L4VA 1SO4A 5I30H 3OWEA 3QDMB 2XZCL 1G4PA 1LCOA 1XSIA 4X5XB 2V3EA 2NWRA 4ZSUA 1CW2A 5CSYA 5ITBH 5FGBC 1K7XA 1W0WA 5SWQB 2VDPB 5EOCJ 1M7IB 4QQ3A 3WAJA 3Q58A 4CN4A 3CFDB 4NAFB 1BWLA 3TJLA 3UPRA 1I4NA 4QRAA 3W0WE 4DGWC 1XYBA 2V8MA 4JEQA 2NTFB 4XISA 5FYJL 1OD0A 4F58L 3DESA 5E09A 1AO7A 3U2IA 2B81A 2J7HA 2LR4A 5JXEA 4TX9A 2DL9A 3AXKA 3JVGC 3AIBA 3WK3A 2Q7YB 3LD5A 5DT7A 4LPXA 2CJUH 1US3A 4HWNA 4LP4A 3ZLFA 2OTPA 1GQNA 1J01A 3FU8A 3RVWC 1JRBA 3DFSA 3VIJA 2P3ZA 1S2VA 4ZO9A 4KERA 3AYRA 2OJZL 2OL3L 3FO2A 2V5LA 4F2UA 2Z7ZA 2DY2A 2ED9A 2XZQH 3QDAA 2BCKB 2W07B 4M5ZL 1B0IA 1ITXA 3IJSA 1HTIA 1ADQA 5TF1H 4N1HB 2ZTBA 3OZ9H 2J9YA 1XGYH 2J7BA 1KCSL 4JR5A 3PUGA 4IK7A 2P0OA 1T7VA 2OR9L 1K8DA 4ODUB 4DXKA 1OVDA 4Y7MA 2QW5A 5BU6A 2DQXA 3IXAB 2FSDA 4XI5D 1Q1JL 2HISA 1XFPA 5GS2H 1NGWB 4LLQB 3S36L 1WA1X 5LA2A 3MCYA 4XBGA 2AJUL 4PUKA 2DBLL 1S2UA 3PFUA 4RSVA 4TLUA 4TNEA 1KZQA 5IEHB 1VERA 2A9AA 3VI3E 4H9TA 2OZNA 5C7XH 2OM5A 5KJ4A 1ENUA 4MXQC 3RIFF 3VXPA 1RLBA 1K3IA 1MRQA 3OVRA 4XNUL 5KYXB 1XYZA 2X7VA 2J8UB 2VE6B 3KPQA 3GI8L 2CHWA 1GVEA 4G5DA 4L1BA 4QTIH 2Y5SA 4YJZL 3CDFA 3KPSE 4YZFE 3MI2A 4F0LA 2IH8A 4EI0A 3P3UA 3GIVB 2AK4A 4FL4C 3EAKA 4MFDA 4RSYA 1SVBA 1ESWA 3KWVA 3VXQA 4U3SB 4AJ0A 2NSMA 5FUOH 2DD8L 5G5IA 1M71A 3VFTA 4CNSA 2R0ZL 2PTTB 3O6FC 3UETA 4HJWA 5DHVH 4YWIA 4HUNB 3N13A 3OJDB 1UR2A 4Z78B 1QSZA 4NKDA 2BSED 4OLWL 5CLXA 3QZWA 4U6HA 3AMKA 3MRQA 4X9HA 1WSST 2WB5A 1HHHB 1C7SA 4RNHA 4GP8B 5JQ6L 1OK8A 1OWQA 2WYTA 1QLFB 2KC0A 4WDIB 3TOYA 4F40A 2REQB 4RE2A 4AXWB 4NILA 4WO4C 3DDMA 4NO5A 1TT6A 3KPPA 1Z5LB 3CPUA 5JPNC 2VFFA 3HE7D 2OU4A 4I48A 4QD2E 2RJGA 1H3XA 3ABXA 1DBMH 4FHKA 3DX6A 1PBYA 1YEHH 2Y36H 1HZLA 5D5MA 2VJ0A 3HMXL 2X41A 3KUMA 4IMKA 5HHMB 2G95A 4W8AA 3QDMD 6TAAA 4YBHA 5HHOE 3V79C 1U95A 4Q4IA 1INEH 3NJGA 3HS0C 1OIFA 1X6NA 1AKJA 1CXKA 1JEZA 2IPFA 2FGZA 4ZTOL 2PLCA 1CK0H 4HQQL 2ITDB 4P23C 4OT1H 5E9XA 5I28A 4L3CB 3N50A 4S1QH 1M68A 2GT9B 3AUJA 2WW5A 1NC4B 3WLHA 4R6UA 3BKCH 4TN9A 1JZIA 5B3NA 2D2OA 5MENE 1JGDB 2X9ZA 3MS8A 5HATA 1GTHA 3VW3L 1KYDA 4XPTH 2MNJB 1D5ZB 2ZUWA 3GNXA 5CBAB 4YFLI 5DFVC 3HLAB 2PPCA 5D93B 1CBVH 2R29A 1T20A 1TG8A 3T8QA 1OK0A 5LNVA 1J8HB 3TBCA 2CXEA 5J13C 1VB9A 4UV4L 4HKJA 3NA4A 4K07A 2OJ1A 1SUXA 3W76A 4XZLX 4KPLA 3K2MC 4E9RA 3L3GB 4F7CA 4OVXA 3RWEA 3LKQA 1JPHA 5E00B 1KGXA 4PGEA 1FFOA 2H1XA 1S2EA 2YD4A 2CPCA 4RQQB 4P5RA 1BF5A 1X38A 1BXVA 3L12A 3TA4D 1MHCA 2P5PA 2XZAL 1B4KA 1URLA 1JPFB 5BPPA 1T40A 3UTQA 4R27A 4JHOA 5LVEA 4AXNA 2EH7L 2BIOA 4Q56A 5JHDB 3IJEB 2OEJA 4HS3A 5JDJA 2QIIA 4ILSA 3DETD 1H5VA 3ZE0E 1H6FA 1Z3RA 3RU8X 1CT5A 2NX5E 3QNYA 3L5HA 4KROC 2QV4A 1R5IB 4HFWB 4PLJD 3WMCA 1T7YA 4HC1A 1P0DA 3DMMC 1R2TA 4O54A 3PRZA 2DI8A 2G2RA 3V0WH 3EIFA 4N20A 3UYPB 3RDTC 4YBLC 1A5AA 4FNUA 3QR1A 1Y6KR 3RRQA 1G7IA 4X8XA 4DBEA 5CSUA 4JICA 2WQRA 5DK2B 3G1SA 1ETZB 4P46B 1M6OA 4D7PA 1OAYL 2O9PA 1NSJA 3BPNB 2ZCGA 1ZAIA 3LD8C 1P4LA 3K6NA 1J8KA 1TRDA 5IM51 1M3IA 4R97B 3GRGA 5DTFB 4C7FA 2J8UF 2UYLA 1AA1B 3FYYA 5DJYA 1YEDA 4M29A 1W1VA 1HAWA 1O7DC 1MHPL 1EAOA 4BGDA 1KXVA 2QLVB 5HDQH 4XTIA 1E9PA 1FWAC 4IBWA 4AEHL 2J6WA 3T42A 3RJXA 3M46A 3F12A 1P4CA 1ZALA 1XF2B 4TQ8A 3PG9A 2Q76B 4G6JH 5JUEH 4YLQT 4D0DB 1NFAA 3M1OA 4MDIB 4Z2JA 2XN9B 2VERN 3QDGE 3O2VH 4M8QB 3ALFA 1HUVA 3HBGA 4B16A 3SR7A 1J9CT 2P47B 5JBDA 5HHMD 1GYUA 4PV9B 4NYYA 1YEFH 3WXWH 1AH1A 4J6IA 3E3QE 3BDYL 2QZRA 5KANG 3UY8A 2FGLA 1O66A 2CCVA 2JI1A 1Q1PA 5IUSA 3KAOA 2BSEA 1XIEA 1OB1B 4OF6A 4HBQA 3CK0L 4F66A 5EU7E 1CB2A 1A4JA 3Q2NA 2WXMA 1XWVA 3VFOB 3UMNA 4FXFA 1NC4D 5KBMA 5F1IB 4GH1A 5KVDL 3I9GH 2YCLA 4AKOA 4ICMA 3MRCA 4HWEH 1YNQA 3TT3L 4ODHL 4QCIB 1BWKA 2PLMA 4YIQB 3QQ4A 4O52A 3R8HA 1RZMA 3VI4B 4Z2LA 3HE7A 4XTRD 1NMAH 1P0SE 5KEZA 3ZO0A 2VKXA 1W9UA 3WO8A 3FDGA 1ADQL 1HTYA 3WLLA 1UZ4A 2ICEC 2Z91A 4O14A 1U8PB 3TE9A 3QDMA 1GH7A 3LM3A 1R7AA 2VDKL 2E9JA 4PJXB 4L8CB 4G70B 4X5XA 3CV2A 1J8HD 4NERA 4PCTA 4JN2B 1LMKA 1FLRH 4PBFA 4QRPB 2CD0A 5SWQA 3T0AA 4LRSA 4OVVA 1JZFA 3FT3B 2VW7A 5B80A 4DBDA 3HC4H 4RH4A 3K5RA 3ZZSA 1I2PA 1SJMA 4K7YA 4AM0Q 3SKUD 4TU1A 4NAFA 3EJYD 3HG3A 3D4GA 3KEDA 3SY5A 3E0GA 4DKEH 2ZRXA 3G1DA 3E0FA 4M00A 2XACC 1SDYA 4GHRA 4X8GA 2WMFA 3SDAB 1YMMA 4ISVB 3TTEA 2OWWA 4WI6A 4N2HA 1FH9A 4UM8A 4QLKA 5C0AE 4HAGA 2W65A 3FH7A 1TZZA 4F1SA 2Q7YA 2WXDM 2ICSA 4FADA 3TDFA 3LEXB 4N8UA 5JHDD 3NCBB 2J5LC 4WWPA 3A3XA 2AXFB 1DQDL 5IQLA 5CZJA 5ABFA 4Q52A 1T1XB 3C0QA 5K1VA 5PTDA 3LN9A 3ITOA 2BCKA 3BGMB 5JH1A 5L9FA 3WNLA 3OGCA 4Z17A 3APYA 4L3EE 2DTMH 3GIPA 1U8QA 3QQ9D 1EEPA 2ZXDA 3VIPA 5FGSA 4ODUA 1PTZA 4N90E 2IPGA 2XN0A 3IMBA 4Y19D 4KUZL 5HDLA 4ZS7H 3ZKNC 4P46D 1NAKH 4OZOA 3SQBA 5KZ6A 4LLQA 4QNPE 3VIMA 1M7DB 2GJLA 3W7CA 2QAPA 3HCVB 1ZLWH 2E6YA 5TAOA 3MYPA 3K6IA 1JD7A 1QPXA 2EO9A 3PTMA 3GXTA 3H4WA 1MCDA 4HNVA 4OKDA 5HTSA 2R39A 1OCWH 4ZFOA 3T08A 4F37K 4MMYB 4U31A 4DI9A 3SE3C 2Q86B 4NZCA 1EYEA 5KYXA 2J8UA 5ISZB 3PUDA 1PS9A 4PB9L 2Z31C 2R4RL 4ZMAT 2ZAIA 2OI9B 8XIMA 3IMSA 1EHNA 1UC6A 1ZMYA 3C5JB 3B3IA 5F7AA 2V4LA 3K6FA 1VHCA 3C8HA 1WGOA 1WIPA 1NL0L 1UH3A 1XGYL 5FF4A 3OAYK 3MKGA 2PTTA 5F7MC 2BSTB 3L0GA 5BROA 1EXGA 2OMBA 1XEUA 3OMAB 3F5WB 3WELA 5H94B 3OJDA 4H0LC 1B4JH 4FR6A 3IDMA 4Z78A 3TZNA 5CCZA 4HHMA 3RLVA 3FT2B 1DVFA 3BGJA 3BXNB 3VDAA 2A1WL 3ETTA 2GTZB 5FW7A 1AQDB 5DQDH 3UROR 2R14A 4UR7A 1HHHA 2R29L 2V5TA 4LQFL 1POKA 4WDIA 5D03A 1UJ3A 2REQA 5EDSA 2WOBA 5REQA 5HJGA 2BWGA 3MLWH 3CHCA 4IOFC 4IJRA 5ECVA 2AANA 1XRSA 5E1HB 3R79A 2XN1A 4JQ3A 2F5BL 3N6YA 2I9LA 3T4YB 4MVAA 3W24A 1UG9A 3ZYJA 5IROC 2ODIA 3KP1A 3OIXA 2AJSL 1TTIA 2IJ0C 3VFGL 4ZFMA 4HU4A 3A6CH 4QRPD 3SGKC 3VI4F 4ZZFA 3U1QA 4N9OB 3QKZA 2ITDA 2Y2TA 4L3CA 1FVCB 4FQXC 4KXZH 1LBFA 1N5YL 3HE6C 4Q7BA 1NC4A 1E4IA 5IB3B 1QKZH 3QPKA 1V0LA 4PJ8B 4ZX6A 2JVUA 5FEPA 3L08A 4AYID 3QY6A 3BQ6A 1VKFA 4PJXF 2FTPA 3MJ8B 3H9SD 3II3A 2V2XA 3SDAD 5D8ZA 1E4XL 3BI9X 4G8FA 1MW3A 2CNCA 3W83A 3O9WD 4OCWH 4I7WA 4CADB 1D5ZA 5B38B 1FYHB 2J79A 5EO0A 5CBAA 4E9YA 1UG6A 3U0PA 4IKNA 4FYSA 3HLAA 2YLLA 3FSTA 1IGIH 3P30H 1DN0B 1J8HA 4NUWA 3NACL 2P80D 3T81A 4DWSB 4Z9KB 2NCMA 5EWIH 5LNRA 3M16A 4NSKA 1XLLA 5AHNA 5JOEA 4LASL 2G5BB 2QELA 2BOLA 2BOBB 2ZE0A 4Q8NA 4TX8A 3H1ZA 3QH2A 1DBML 5D9OA 1YEHL 4O5LH 4XB3A 5FDWB 5EBWB 5FJIA 1QX1A 4E9TA 5E00A 3V0HA 5FGCE 3HA1A 3HJZA 3I6GB 5MEQA 3TCLA 1T80A 2J56A 4RQQA 4H9VA 1MQPA 4I8DA 1A7PH 4U1KB 1E6NA 3DBNA 2OCFD 2HSIA 3F7YA 2WYSA 2FX8H 2YMXH 3S96B 4KKCD 3S5YA 3CE1A 5JHDA 3IJEA 3JYBA 2EEBA 1JZGA 1XIMA 4ICXA 3U82B 4Z76A 1GW9A 3GTIA 2WQPA 2R0WL 3C6EA 4IG2B 3CDYA 2FNBA 4UI2A 1FGVH 1E1CB 3LV6A 4EUPG 3CLMA 2XTJC 4PCNA 4MZ3A 4R7NA 5DVNA 3E96A 4KRPC 3QPEA 4HJ1A 3LS4H 1S7QA 1YQVH 2O7QA 3CUJA 4NNPH 2D23A 4R5XA 4BK8A 2CHRA 4YHIB 1FY6A 5FLVA 1TQSA 3UYPA 2XJ7A 2DFAA 3KH4A 5ISZD 2BS8A 4LBUA 2VZTA 4N2EA 4NQEB 5DK2A 4Y19A 1O1HA 2DIJA 2WPGA 3EWBX 1ETZA 5HYJB 2ZC1A 2YMTA 4P46A 3IWVA 2YB1A 2IH1A 4TRPH 1CDUA 3NSFA 4PTUA 2LU4A 4HD9A 3VA2C 3LYEA 2ZYIA 4D71A 1E7VA 4HIQA 4WEMB 1UURA 1MXGA 4ZA0A 2G75B 5K9XA 1DUZB 2QGDA 3EO0B 2WKJA 4P2AA 3RNQB 3H7VA 4JTUA 3SRFA 1QYGL 1JNDA 4ORGB 4P59L 3I68A 1OM0A 2W66A 9CGTA 3DX7A 2O1AA 3AI0A 2FKPA 5CEYB 2WWMC 2B14A 4HLZG 2Q76A 5EU6E 7FABL 4BHUA 3DYMA 4LB4A 2VDPL 3I9AA 5EC2A 3MNVB 3QG6B 5GJSH 3UC2A 2W9MA 1A14H 1MCIA 4M8QA 1G5AA 2XV0A 4IBQA 4HMEA 3QHTC 3H2QA 4JTIA 4FNLH 3CWHA 2ZPKL 4PV9A 2EDNA 4DEFA 3AXHA 5DZLA 2YD9A 1ADWA 1E2WA 4D6IA 1JL8A 2JEPA 4A3QA 1WS8A 3ULVH 3MWCA 1VFMA 1TX0A 5IB2B 1HZHH 3RVUD 4LBEB 3PXJA 5E24E 3VFOA 2FQFA 5GJMA 3GSOB 4LSQL 2BSDA 1OFPA 2OELA 3QNXA 5A40E 5GRUL 4PJ8D 4LPVA 5T33L 1HJXA 3VOCA 4YIQA 1D9KC 3VI4A 4TQIA 1NIDA 4OLXH 2Y9RT 4KVNH 3CZJA 5I09A 2AQTA 1EP1A 5T5FH 3MRDA 1E0TA 2RDTA 5GPRA 1LP6A 5LCVL 1U8PA 4JTGA 2GQAA 3IRDA 2AMUA 4M6PA 4AIZA 2XCMC 4JY6B 5FJPA 2WZIA 1VEPA 4JN2A 2BIMA 2MOVA 3DX4A 3G5XB 1JUBA 1IVTA 1N7KA 3FT3A 4LALA 1YIXA 2VZ1A 3O81A 2Z2AA 4K3DL 5DHEA 3KPOB 4B3KA 4WV1B 5ECUA 1ND0A 3FEQA 1W72A 1N12A 4L0PB 4MJ4A 4AY1A 1J1PH 4JR9H 5HHPA 1JF1A 2N4IA 1CTOA 2I5QA 3H9SA 4ONGH 2NCEA 4XHJC 3SDAA 4JO3H 4ZNCD 5DMYA 4NRYB 3P5YA 2YK1H 3O9WA 1A6WH 1V3LA 3HV9A 1KC5L 4FCAA 3TIMA 3GKWL 4HKPA 3KZPA 3H0TB 2WMHA 3X11B 1OTUC 4PD4K 3N3EA 1FZMB 1T7LA 4FHJA 1PBGA 5AUMA 2P3EA 3LEVL 2P80A 1EHKB 3L65A 4NN7B 4W6XB 2VFHA 4P61A 3M7FB 4K23L 1T1XA 3JWNH 5EDXA 3BWUF 4ZAKC 4GSRA 3D3VB 3AFBA 1MRDL 3VOGA 2Q01A 3M0HA 1DHPA 1MWOA 1Z5HA 2FX9H 3VQLA 2QV5A 3GO1L 4PL1A 3UO1L 3PF3A 4AV0A 3IIVA 3MNWA 4XC3H 1XGUB 3AS1A 2XJKA 2XZCH 2E1WA 2F7QA 2Q87A 3AQUA 4JIIX 3THUA 2ADYA 4Y5VC 2PEVA 4NQED 3UYOD 3HQ1A 5GRYA 2YDQA 5HYJD 1USZA 1A49A 4HA3A 3MRBA 1PCKA 4N0UA 5DJ6B 4MQXC 5E1GA 3W7EA 4GX8A 4HPXA 4XR8C 4J4PD 4ASTA 2G8ZA 5LXGL 1M7DA 4DKEL 5M7QA 5DUPL 5LUMA 4HUKB 4N1EA 2AGJL 5FYJH 4ORIA 1JWMB 3BMWA 3FSWA 4F58H 2I17A 5CLTA 4GD0A 1VH7A 4LU5L 3ARUA 1GVIA 4XNZB 1UWXK 3VOJA 3PAUA 3F5LA 4AAJA 4MMYA 4YSUA 3V0TA 3UG3A 3L4CA 1KCBA 2IFGA 1B4RA 4XO9A 3DFQA 4H1LG 4RFOL 5ISZA 1F7BA 1GW1A 3LN3A 4JFVA 3EZ8A 2EE0A 4Q4OA 3W26A 3G9VA 3RVTC 5SWZB 4KDVA 4HPNA 3TN4A 2Y8UA 2OJZH 5F88A 1N9PA 4GYFA 3OGVA 1R5WA 2CUHA 4W68A 4JW3A 3LB6C 4M5ZH 3C5JA 3SCUA 2BP0A 5A2CA 1WDPA 1CDCA 3ARGB 4B5ZA 2D69A 2V0AA 1FFPB 5AOUA 1SN0A 1AMKA 1GGIL 1KCSH 1G7HB 3VCCA 1F02I 1UQYA 2BSTA 4JTSA 2VEFA 2OR9H 3F5WA 2VLKB 1W0WB 2RGLA 5CP7A 4KRTA 1WZLA 5LIKX 4AVKA 5D4JA 4XZIA 3CVDA 5K39A 1HESA 3CHFA 5F21B 2ZNXA 1Q1JH 1SYVA 2GTZA 1AQDA 3FKKA 4I9MA 2CXGA 3UPRB 4L05A 3S36H 2H32B 2ICES 5T8GA 1Q8MA 2DBLH 2VUOA 3T2OA 1ZHKA 5CZXD 1J86A 4JPIA 1MW2A 2D7TL 4NWUL 1K9FA 3BPOB 1EOKA 4XAWL 1A6TA 2CWRA 5HGDB 4N2OA 4U1MB 3R7RA 1RIVL 1VJIA 43C9B 2E9LA 1QO3B 1GQJA 3TF4A 2EG6A 3T4YA 4F2ME 1BRLB 3IIXA 4ZQOA 4XNUH 3GDKA 3N17A 2HFTA 3SE4A 3GI8H 3K5SA 1KYUA 2JI2A 3G18A 3FO2B 4ENLA 4MS6A 5BYWA 3D9AL 1XHHA 4EDXA 1YJDH 1P0NA 3IJSB 1FVCA 3FQ2A 3KDNA 3NIGE 3TP4A 1UA3A 2QQ6A 1X96A 3MOQA 3OSVA 4PJ8A 2DD8H 1O1ZA 4XXWC 1TUPA 1RAKA 2R0ZH 1JZ5A 3GVWA 2WB7A 3MJ8A 1HCVA 2ZA2A 2X4PB 2J7DA 3HS8A 3NIDB 5B38A 3MJMA 5DQDL 1N8OE 4XBGB 2QCLA 2C7FA 5JQ6H 4TNGA 4D72A 2K7PA 4MWFA 2I7OA 2XHYA 4AZBA 2FD6L 4C1NA 3DI1A 4GRWE 4ETQA 2WMPA 2G5BA 2X4TA 2WB1A 1UA7A 3TJPA 2BOBA 4XGZA 2MRYA 1OSPL 1J5OH 3G6AB 1PNCA 4ALAL 4F2TA 4LW7A 4G6FB 4C6JA 1W9BM 3BFQG 3D85D 2J1KA 5EBWA 1PX8A 4LS0A 4XBSA 3SIZA 3HMXH 2XWEA 4IGSA 4IEFB 2NY6B 3I6GA 1N8WA 3W85A 3M41A 2KQNA 3SYPA 1ZV2A 3NFUA 5E70A 3HHSA 4UT9L 4ZTOH 2WINA 2YXFA 3N6QA 3CHXA 4HQQH 1EHXA 3DROA 3VG9C 3GZPA 3VRLE 2JXMA 3CXOA 2XKNB 1XL9A 3T07A 2QVKA 4KKZA 1J5SA 2C79A 1G1OA 3T0ED 1M71B 3VFTB 4P5TB 3HRZA 4MYAA 3B4YA 4F8QA 3FULA 4IG2A 2YIHA 2XTSA 2R1YA 1SJBA 1E1CA 2GTWB 3VW3H 4E5XB 3UTTE 4HMCA 4OCWL 2QT6A 4MZYA 1DZBA 3QZWB 3WD4A 4HBKA 4PYGA 3G77A 2KYIA 5CGTA 1X5AA 4I77L 2F68X 4YHIA 3GNPA 4LEOB 4PH6A 2FAUA 3MC5A 1IGSA 3KPPB 1G9ML 4QAMB 4NQEA 3R89A 5SWZD 4JUSA 5A3ID 4UV4H 5HYJA 1KBJA 4O53A 6FABL 4JHZA 3FKUS 3UG8A 1TJMA 4Q8UA 3LZLA 3OJVC 3DX6B 3KOZA 2SODB 4XOBA 3CZKA 3ROLB 5AYUL 4J4PA 1J6PA 2AQPA 3SSZA 3ARGD 5D5MB 2YD0A 4EZLA 5LB1A 1OKEA 3R7MA 2RGSA 5DJ8A 5GJNA 1TOXA 1IVLA 2V69A 1AG1O 3NPUA 1A7RH 3C3UA 3KPTA 3L4WA 4E38A 4P2CG 2VLKD 1A7PL 2G75A 4CEXC 3PWJB 2PUQT 3ZE1E 3RNQA 2DM7A 3C2SA 1R46A 2XZAH 2QAFA 3QV6A 3OZKA 1RZIB 4M82A 3U9PL 2EH7H 4LO9A 3LH9A 1I8LC 2QVTA 1F6YA 1XWYA 3B03A 4GIPD 4X4ZA 5CEYA 5T8IA 1X6LA 1E3ZA 2A0NA 2Z28A 4U1IB 3PC0A 2HTKD 3S6TA 2HXUA 4HP5A 4FA3A 5I3FA 1YSOA 3MNVA 4DZHA 1G87A 5D2VA 4UDTB 2X1SA 1B3WA 3TJEL 4AX3A 3LX9A 3N9GL 4ABQA 3CIXA 1TMHA 3Q3GA 5DC2A 4PMRA 4QHMA 5EIVA 3VIKA 2VDRB 3V7AG 1EAQA 2N7SA 4HKJB 1N10A 3U30B 5IB2A 1XBYA 2XV2A 3LB0A 1ZTVA 1OAYH 2B5IB 1FQ0A 1CGXA 4FTVB 4LCCC 1DJIA 2I07A 1W9DM 2D0FA 3RWEB 5FACA 3CV1A 4JS7A 3SYCA 1UUQA 3B9AA 2BG5A 2G96A 3VO0A 4PGEB 1JXKA 1VFUA 3F7VB 1FFOB 1J12A 2BOFX 3RL1A 3N1AA 4N02A 1HJCA 2IGFL 2W67A 5MI0C 3SE9L 1JZ7A 3RWHB 1F00I 4YAQB 1HK6A 1MHCB 1MHPH 1FWFC 3CNKA 4MHHG 4EXKA 1JDAA 1RBAA 3HHRB 4K8RH 1MCFA 1CIUA 3SSJA 2NXIA 1XLGA 3CZNA 4AU0A 4JY6A 1HL4A 1KJ2A 3N1QC 5INDB 4LGXA 1QPKA 3G5XA 3MKVA 4C91A 4AVJA 1OZQA 5J57B 3KBSA 3NOIA 4GKLA 2IKJA 1A14L 2EGZA 1DJHA 6ENLA 2XX0A 3NIDF 4WV1A 3MVIA 4G6FD 5EFIB 3CN4A 2PPAA 5E2JA 3LZ3A 5DEZA 2BNQD 1KV7A 5DVMA 1BP3B 2R24A 3V6BR 2GABA 2KPWA 4DYEA 4PMUA 2NY6D 5JW4M 4YC2B 2ZD0A 5AVRB 4BZ2A 2ZUTA 1T83A 2HMCA 1UWIA 4NRYA 1M6OB 3EBIA 2EG8A 4HXAL 4P2RD 2D7MA 2UY6A 2P7TB 3A4XA 3FCBA 1Z1WA 4ALDA 4WI9A 5K5YA 3IU3B 3UFYA 5C08B 1GSKA 3AWOA 4HEMA 2PYFB 3JSSA 4P5TD 1EO7A 3BHBA 4KFPA 3TT3H 1B4LA 4ODHH 1PZUB 4WI4A 4A2LA 2CRIA 3ZQ9A 1YEDB 4ONVA 1UGKA 1V27A 5B1JC 3MGOB 1N2VA 2Y1ZA 2NPLX 4AE1A 4ES8A 4H9XA 1BD0A 1YMHB 1E9PB 1IGJA 1ADQH 3D85A 2XXCB 1LGVA 3Q2CA 3X1NA 5LKNA 1XGUA 4J3XA 5HNUA 3RDKA 5M5DA 1Q7ZA 1RZPA 3F12B 3KPLB 2VDKH 4PMOA 4FFZL 2V0TA 2VDLB 2CDGA 1RQHA 3G1XA 3FUMA 3IIZA 4F7TB 5DJ6A 2YSWA 1IQDA 3QZAA 3T0EA 3V3WA 1NFPA 3OX8B 1A8ZA 4AK1A 1UZ6F 1JWMA 4ONGL 5C54A 2D7PA 5BJTB 3R2GA 2IH3B 1I0DA 1WKEA 4FX8A 3Q43A 1G0CA 2MEJB 2BX7A 1Y6MR 1QK2A 3P9LA 5IHWA 1LYXA 1AMYA 5HP5A 2G9HA 5FF2A 5D5MF 3CFCL 3DDFA 1VZHA 4CU7A 1KM2A 3MRCB 2VWEE 2QKIC 1TPWA 3WG6A 1DQDH 1U5HA 5SWZA 1EK3A 4ZQMA 1F8MA 4PJ5E 4I9WE 5FO9B 1EANA 4P8QA 4N68A 5HYEA 4MWAE 3TYDA 4TUOA 3GD1C 4TLKA 3OVUB 2UVEA 1QFWI 4ZI8A 4JRLA 1WTLA 3ARGA 2Z91B 1FFPA 1TQCC 1RPQA 5EFDA 4PW4A 3VYNA 1T66C 1T4WA 3WEZA 2Q8BL 3BOFA 1G7HA 3RX5A 1N6UA 3WNMA 4N9GA 4GCXA 2HZHA 2VLKA 3WTXA 3SY8A 3GG7A 3EB2A 1YNKL 4KUZH 4K94C 1NEYA 5DCCA 5DCEA 3NM1A 3MLTB 4FTVD 3FQUA 2H32A 1E0WA 1EBHA 3QUYD 3MMTA 3M64A 1R3WA 4L1LA 4P4KB 3RM4A 2UY5A 5KINA 5IT2L 1YMMB 4HK7A 2GUUA 4A2MA 4UM8B 1ACXA 4Q7NA 1XSOA 5EF2A 1P43A 2WHLA 2W65B 4FOJA 4X6DB 5HGDA 4U1MA 5GZNC 5T1DL 3FUEA 43C9A 1QO3A 4PR5A 1ITCA 3EWUA 2WQAA 2MNUA 3QDJB 1NLBL 1BRLA 3EJJX 2Y7FA 4M81A 3FQRB 1VESA 1V3IA 3LQGA 1GXEA 4PB9H 3IRPX 2R4RH 3GAKA 5ABFB 4M7KL 1K85A 4K9JA 1IT7A 2K3TA 1UC4A 3V6OE 5ENLA 4DKTA 1MFEL 1PD0A 2DVXA 4NX5A 4BQ5A 3OHIA 3OGCB 4JFPB 3S2NA 3VE7A 3DOSA 3L4ZA 1NL0H 1HW6A 2NLYA 3KPRD 1U8QB 3TA3B 4YLBA 1FZOA 2X4PA 4FX7A 2Y8VA 3FAWA 4JJHA 1OL0A 1KO0A 2VSCA 4OI9A 3QIUC 4KVPA 2A1WH 3SQBB 4C59B 1CVSC 4IJCA 3OSKA 4CNNA 1E55A 4QRRB 2R29H 1R6VA 5C08D 4LQFH 4N2YA 2YPLE 4RMWA 5EZPA 2J8GA 1B3VA 3EPNA 1I8AA 2P43B 4P7LA 2CBUA 1A3HA 1SXCA 3G6AA 3MRMB 4ZFOB 1S3HA 2VXQL 3A4EA 4GA8A 3L95A 2DIEA 3FUFA 2DJUA 3MCG1 4BR1A 2Z7YA 4MB3A 2F5BH 1LROA 1IBDA 4LLAA 4UZSA 2BNQA 3BEVA 3CL6A 2HNHA 4HN4A 3SBPA 2AJSH 4IEFA 3VFGH 2ZOTA 1E28A 3TUUA 4P2RA 5TE6H 2OZ3A 1YJDL 5CNHA 1JRHI 3B3IB 3RGVC 4EEEA 4NQ1A 4AQ1B 1W1A1 4JIHA 2XKNA 3KDPB 1N5YH 3S8WA 2WHVA 4NENA 1EMTL 4P5TA 2EDHA 5AVXB 2NY1C 3AAZA 1NCIA 5FK9A 3IDMB 2GTWA 4KEVA 4E5XA 1E4XH 1Q6RA 3N06B 1EL3A 2DI7A 1ZANL 4RFNB 1DVFB 5IHLB 3K72A 2XOTA 3CQKA 3C5QA 2NLIA 3KVJA 4HC1H 4DP7X 1AXSA 3AACA 2NT1A 4LEOA 3HKZA 1UJ3B 5REQB 1M04A 3NACH 2RH0A 1XYCA 4LASH 4XVUC 2CALA 4GNKB 1PTGA 1AW2A 3UVAA 1J5OL 1BVLB 5E4IA 3VCRA 5AZ0A 3ARTA 4UQCA 4BEUA 3ROLA 2X4UB 5BZDA 2I9LB 1HZKA 3E8VA 3EOOA 5FHAH 2JB6B 2G5RA 1WFNA 1GIGH 3R8RA 4ZOEA 2LLEA 1SVZA 2DJMA 3PWJA 2YBGA 3IGKA 4J2XA 3D05A 3DERA 2PNDA 1DN2A 5B7EA 5K9DA 3BWAA 4XKMA 3AG1B 3ARFD 1DWJM 3OVGA 1RZIA 4JFSA 1AR1C 3CTTA 3Q1EA 5MF5A 4YDVB 1E9OA 3MCLL 3HPXA 4NC1C 4GAYA 3WFBL 4U1IA 2R0WH 4P4KD 2ZP9A 4OFCA 1TVLA 2V2XB 3ZE2B 5FW6A 2W38A 1I3RB 1YMMD 4G8FB 4OE7A 4ORZC 4U6XA 3UZXA 2ZUNA 4UDTA 3QXVA 2XIIA 4AT6A 5EO0B 2VVNA 3U0PB 1TYRA 2V5YA 5TF0A 2VAAB 4JYDA 5I1DB 3O6CA 3GFYA 3QDJD 2BHUA 1H49A 3B2UD 2ZCHL 1DWAM 3SYOA 1RH9A 4NSKB 5GRXG 4BZ2L 5AB9A 4P2VA 2PU0A 2ZYFA 1XRVA 3C6CA 3UP8A 4FTVA 1OCRB 4X6DF 3T3PE 4CKQA 3QUYA 3E8UL 2X2GA 3N25A 1E4KA 1KYAA 4PMQA 1BQUA 3UMTA 5MEQB 1A7RL 1YQ2A 3TCLB 3F7VA 4X6CA 3TA3D 4LVAA 4GUCA 4TV6A 4KEMA 3RWHA 3MXWL 2ZCKL 2V2TB 4YAQA 3D47A 4WTQA 2A74A 4HOZA 3PNUA 1QYGH 3SSGA 3F7YB 4P59H 2FO8A 1HOEA 4K38A 1HX0A 3ML9A 3ABKB 2B59A 1R3IL 1ZTXE 1GONA 4QRRD 1QFUL 4BFKA 4Z76B 3UL4A 4XX1E 4IGMA 3LCYA 1MN4A 2A3HA 5INDA 7FABH 4YDLC 2HWGA 3BGGA 3WBWA 2VDPH 4BEQA 2B31A 2E74C 3LQAL 3GDRA 4R7NB 1SQ7A 3CAWA 4GJTB 3NO3A 1S7QB 1UP0A 4XNYL 3O8XC 1VEOA 1DVUA 5EFIA 4O58L 5EOQH 2ZPKH 3KPRA 2EYRB 5AALA 1H8SA 3RVXD 4XZWA 1TJGH 5C2XA 2XIOA 4Y19B 5FAJA 1ME7A 3EOTL 3F65A 4F9PA 3B83A 3KE0A 5HD8C 1IGTB 2ZZ3A 2IH1B 3NXFA 2P7TA 1V51A 3FC8A 4FX6M 1XYLA 3EEGA 2EPOA 3C60B 4BQ2A 1JCXA 3ZKMC 3IU3A 4PTUB 4LSQH 5C08A 1H0DB 2X6VA 1H1YA 3W7RA 3NM3A 4KFMA 1Q0XL 3E74A 5GRUH 3VAVA 2PYFA 2BP8A 3PY2A 5L4IA 2CIKA 5T33H 2EZ0D 1KGJA 2R1LA 4EJ1C 5EIIA 1FH8A 3EYQC 4UWMA 4D8PA 5AZUA 3C61A 3MGOA 2GI0A 1NBZB 2XVPA 1NJJA 4C90A 1YMHA 1OYCA 1DVFD 5AW6B 3V0VA 3DX7B 5DA4A 5LCVH 1QI4A 4K8RL 5JO5B 4JYFA 5D72H 2ZX9A 3KPLA 3RG1C 4Z7VE 1GKEA 4K3EL 4WGHA 2QCDA 1ZA6A 3B1UA 3QJOA 3PBGA 5EC2B 1DTNA 4F7TA 3PYCA 4W85A 2XPGA 4NZ4A 4L4JA 3ZLHA 2YWYA 3OA3A 4K3DH 4GSDL 4ADTA 1P0BA 5DJ0B 3UYRH 1XG3A 1W6TA 1CI3M 4D7BA 3ECQA 5TQ2L 3OX8A 4TVSa 3NSMA 1SHWA 4H44C 2H2SD 2UWFA 4AQOA 3UEQA 4QEGA 1YLVA 3LZFL 4IKIA 5BJTA 2IH3A 2Z7KA 5L6UA 1A80A 1KC5H 3KWXA 5SWSE 2OX4A 1BQKA 3CX5K 1ZB5A 3GKWH 4ZQPA 1ZBWA 1S9YA 1VCBC 2Z6IA 3QNXB 1AUSL 3G3DA 1LG2A 3OB0H 2Q3XA 3QJQB 4V27A 3LEVH 4BKTC 4KRNA 1Q65A 1VBUA 1YEKL 3GKZA 4K23H 1AGEA 5FO9A 3INOA 3O8AA 1THFD 1MRDH 1PIGA 4Q4KA 1E2ZA 1QUMA 2QUVA 3MN8A 3GO1H 1B54A 2XSBA 1WCGA 3UO1H 3BIKB 1BQRA 3MRDB 3VH8A 3QMSA 4K3HA 5C07E 1W2KT 3BLDA 4B5EA 5DFAA 4IPJA 3UR5A 3MAWA 4AIZB 2Z35A 5E2WL 4FC3E 4TVUA 3GDMA 4F24A 4FSAA 1WZ1L 1YC8A 1RZQA 4MUZA 4G56A 1F56A 3ZE2F 2ICCA 3AHYA 3US0A 1OAZH 1F18A 3ARFA 3R4IA 1FA2A 3MLTA 2ZOKB 3K2UL 2FVKA 4I1PA 3N5AA 4UC5A 1ND0B 1W72B 4TVPE 2P4AB 3T05A 5LXGH 3JV0A 4MF4A 3R19A 3CZEA 3FFCB 4HA0A 5HHPB 1JF1B 5DUPH 2NRDA 1XBRA 1RZ8B 3CFIC 4PYSA 2AGJH 4B3VA 3WLKX 4FYRA 4P4KA 3HG1B 3H9SB 1ULVA 1HKVA 4CCZA 3VC5A 4QBXA 2YRLA 3O9WB 1U1HA 4LU5H 4E4UA 3QI9C 1NCAL 5EG6C 2HVMA 3BCFA 5AB3A 4X6DA 2CHXA 2DJSA 2VCAA 4OV4A 7TIMA 1XIGA 1HCYA 1ZPUA 3QDJA 4UNTA 1EEZA 3FQRA 5AUMB 4RFOH 1YE6A 1P6AB 2P45B 1FZJB 1QNPA 1O7AA 3N2TA 4MIMA 2WN2A 3PJLA 2PWHA 4L7ZA 3VM7A 3KL5A 3NPXA 3WD5H 3NVDA 3IDGA 4FQ1L 3MNWB 1H09A 3LERA 4JFPA 1M1XB 2HN7A 3TONA 4AGNA 5D9SA 3V35A 2VLJB 3IE9A 2H3KA 1GGIH 3W07A 2BVPB 3R0DA 2GI7A 3TA3A 2DSZA 4NZTL 1Y5WA 2DWTA 1OT1A 3JV6A 1VYSX 5XINA 3E5BA 1HJUA 4KFNA 3MRBB 4N0UB 2I5GA 3NJMA 2M26A 5AOMA 3C60D 4HS6A 4QRRA 1N8ZA 3W1UA 1KB5B 1IE7C 4WXYA 1VR6A 3CWGA 3DLQR 3V0IA 3W86A 2D7TH 4NWUH 2GKIA 2DQUL 4LYKA 1NC2D 2BIQA 1W5OA 1TJHL 3AB0C 3MRMA 4J23A 4XAWH 3GB6A 2WMKA 2JBMA 4S11A 4XOCA 4ENED 1RIVH 3VXSE 4Y16A 3MRKB 4NQDB 4GT7A 5HYIA 2XZ7A 3H2OA 4PJBB 5AB0A 3A0OA 3N91A 3C8FA 4WCJA 5F88B 4OF3A 4X7EC 4EWJA 1R5WB 3D9AH 2WNXA 2XWJB 2BP0B 4AQ1A 5BW6A 2QF8A 1M7UA 2PO6D 1X39A 3QYMA 3RM8A 2UX6A 3QY7A 3M17B 5ESAA 3WQ6A 5HVGB 2VR8A 1AH0A 1U8KB 4MNQE 1EJOH 5CP7B 2N01B 2VGIA 2XGZA 5LNDA 5K39B 1SYVB 1SU5A 4PGDB 2AQRA 4AF0A 3PBVA 1E0UA 3U2ZA 2QKFA 5D1XE 2ICWI 3PNWB 2WHJA </