1QPKA

Mutant (d193g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFGFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MALTOTETRAOSE-FORMING AMYLASE)
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 145
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qpkA01
4TVDA 4CD8A 3NCOA 3PBGA 2VR4A 1WKYA 3BUDA 4A3YA 2FHFA 2V3DA 4AZ7A 4M80A 4UTFA 1J11A 1QI3A 1GOOA 4FNSA 5I6SA 3AHYA 4ML4A 5ABHA 3AZTA 1OSEA 3RJXA 4E8DA 3LPFA 4W87A 1E5JA 3W26A 1JIBA 3AIVA 2WKGA 3EBVA 1G9HA 3AZRA 1IZKA 1CIUA 4P7RA 1BG4A 3VILA 2V38A 2DGAA 1XH2A 1KXVA 2XVNA 1HL8A 5HNNA 4F9DA 4D72A 4E4PA 1BVZA 3OGSA 4UNIA 2XFYA 3H55A 1RP8A 2WBGA 4JL2A 3ARYA 4J3TA 1HKJA 4PMQA 3GBEA 1XD0A 2E0PA 3OZOA 1JZ3A 3AIRA 5DMYA 2QPUA 1UH4A 4PSRA 5BXSA 1LWJA 1EDQA 1HP5A 4UOZA 5C8BB 2XSAA 3EMQA 1XCWA 1GOQA 2ZXBA 1EQPA 1Q6FA 5AY7A 3PTQA 1HJQA 3BAJA 3GXPA 1BYCA 2J7BA 1BTCA 1V0KA 3MKKA 4PMNA 4AEFA 4URIA 1HNYA 2BXZA 1GVIA 1CZ1A 5D8WA 2EO7A 2JF7A 2WC3A 1BPLB 1JI1A 4UZSA 3T08A 5HBFA 3VDHA 3VIJA 3W4RA 3AYSA 1O7DC 3L4TA 4R27A 2DQXA 3AIUA 4M81A 1C90A 2Y2WA 2QF8A 1UD5A 1F4AA 1CLXA 2J79A 3AIBA 5GNXA 1Q6DA 1TA3B 1QHZA 3UR8A 1KXTA 1NP0A 3W6LA 3D3AA 4AISA 3SCRA 2OYLA 1Q4NX 2X0YA 4YPJA 5CGTA 1B2YA 3ZIZA 1JF5A 3ARRA 3LPPA 1V0LA 2XYLA 3BLBA 1JYWA 4HOWA 1LQ0A 3SCNA 3WDIA 2DSVA 5A3HA 2IXUA 1E56A 3BSHA 2YFOA 2PI6A 5GNZA 1V6XA 3TTOA 3VU2A 2Q8XA 1W2PA 3SCQA 1E4NA 3OLGA 1CYGA 1MFVA 1KXQA 5I0DA 2JIWA 4FF5A 1Q6GA 2WZEA 2DT2A 3WY3A 4MB4A 5BXTA 1TCMA 3A5VA 1GQIA 1TVNA 1CXHA 1DWFM 4PMRA 3TA9A 1SMDA 3AIWA 4UCFA 4GINA 2EACA 2PWGA 3SCPA 3WQ8A 2VQUA 3GXIA 4X0NA 5E9AA 3SCTA 1DWHM 3DDGA 4UQCA 5CJ5A 2VZVA 1JZ6A 3APGA 4M82A 4MB3A 3H53A 2BY0A 5LA0A 3N12A 3T09A 3A4XA 2RGMA 2VTFA 1BQCA 4CCCA 1ZU8A 1V3KA 2OW7A 3W38A 3FXYA 4PTVA 4D6DA 3FAXA 4AZIA 1CXLA 1W3JA 3UG3A 2ZUVA 3A6OA 3H54A 5CQ1A 2ZE0A 3EJQA 3N18A 2F61A 3A23A 1E6ZA 3G6LA 1MYRA 3SCWA 1QNOA 1UKTA 1WZMA 1TQUA 4QLLA 2ZUMA 3A3HA 3CC1A 3VDCA 1ISVA 4UQEA 1GOMA 2XGBA 1UR2A 3OLEA 3BMWA 4LYRA 1R75A 4P8VA 3VGFA 3BAKA 2VI0A 4AD2A 2WHJA 2EBNA 3B8SA 3HG5A 2GJXB 1EIBA 1HJUA 1K9FA 3BLPX 3GXMA 1QHPA 1JDDA 3RM9A 2MANA 3S5YA 2OW6A 1UH2A 1C92A 3HMCA 3EJSA 1JXKA 4PMDA 4H8HA 1TR1A 2CBVA 1QW9A 4H2CA 1QI0A 3SUVA 3VKKA 4WSJA 2D0GA 1B9ZA 4U3CA 3VIKA 4W8BA 1K9TA 1QNPA 1UWQA 2WBKA 1QI5A 4HZ8A 3VIHA 2WANA 1JYNA 3LXBA 4W88A 4HA3A 4JL1A 2EEXA 8CGTA 2XWEA 1VEPA 2WXDM 4XB3A 4MNJA 3PZIA 4DO6A 2A3AA 4W89A 4KGLA 1U33A 1QVBA 2B31A 2BVDA 1BF2A 3VMOA 3WQ5A 4BF7A 2XGIA 2GUYA 5TD4A 1XHGA 2XFFA 3AMGA 3BVVA 3O2LA 5HXMA 2XIIA 1EGZA 2W62A 3WMCA 4AD5A 1E0VA 3MU7A 1OIMA 4GI6A 1H41A 4GQQA 3ZSSA 1UA7A 4OOUA 2JFEX 1NOWA 1WE5A 2DIEA 1UWIA 3LXAA 2O9RA 1GZJA 4UQ9A 3VMPA 4WF7A 1MVYA 2GFTA 2D1ZA 1KGXA 3VVGA 3ZJ8A 3AJ7A 3HG3A 4M24A 1JZ8A 2WLZA 1UUQA 1CGXA 2W92A 3BXWA 3DX0A 2WWCA 1SZNA 2XVLA 1HP4A 3L4ZA 3ALFA 1VFUA 3L2MA 2HVMA 3ARVA 4DO5A 1W9UA 1VEMA 1K6AA 1B3YA 1JNDA 6A3HA 1QWUA 3K4AA 2X1IA 4AIOA 4AZHA 1CDGA 3ZJ6A 3W0KA 4QP0A 1O7AA 2D0FA 2F7RA 3UERA 1PS3A 2PC8A 1C8YA 3WDJA 4AD1A 4DM2A 1LG1A 3MUY1 2VZTA 4B16A 3SIMA 3AS1A 4ZE4A 1XH0A 1EH9A 1QX1A 3CZ8A 4AY1A 3T2QA 4D6EA 3BVUA 1R85A 1UWTA 4K68A 2OYKA 1HTYA 1TA3A 4GI8A 1VBUA 2O9TA 3VPLA 3GH7A 3WD3A 5I79A 4CN6A 2X09A 1J9YA 4OBSA 5A8MA 3SUWA 3ZR6A 2ZICA 5I78A 3ZR5A 2YL8A 1KWGA 3PZGA 3VNZA 3UEQA 4HMCA 2QPSA 4IM4A 3D4YA 2E9LA 4OZOA 3D52A 1V0MA 1KWKA 4PSPA 2CEQA 3VIMA 3EJPA 1E73M 2BV9A 3SCUA 1QW8A 1E3XA 3WDPP 4JFTA 2XN2A 3PHAA 4W8LA 3PZUA 3WF0A 3QHMA 4W7UA 2XN0A 4ATDA 4JFUA 1AQ0A 1JI2A 2PWDA 4IPNB 5ABEA 1E40A 5FKYA 1HJXA 5ABGA 3NDZA 1V3JA 5A8OA 2VQTA 4AYGA 2J7FA 2D24A 1D7FA 1M01A 5A6BA 5CXPA 3WNOA 1C7SA 1E6NA 2EPMX 3D51A 3I3BA 3AHZA 3K4DA 1BYAA 1D2KA 4LX4A 2FDMA 2F1BA 1WZLA 4C7DA 2XWDA 4HTYA 1MW2A 3WUGA 2VURA 4B3LA 1HKMA 2ZIDA 1R34A 1XCXA 3EJUA 3WFZA 3I3EA 5DT5A 1JD7A 1CLVA 5EB8A 2YL5A 1W91A 4FLOA 3AFBA 5LYRA 1EQCA 1JFXA 4WLCA 1JAKA 1DWGM 2XM2A 2YFNA 4UFJA 3AXXA 3RMEA 1Z32X 1FOBA 2YDSA 1J0HA 4AD4A 3L4YA 2D23A 1VFFA 5BYWA 2BVYA 4PYSA 2G3NA 4RE3A 5CPSA 1V6WA 3S2CA 3WY4A 2ZX9A 3WUEA 1JAEA 2WMGA 3M6DA 4ZXLA 3KEHA 2GJXA 3CUGA 1W1YA 1VB9A 1H5VA 4MDOA 5GPRA 2WZHA 3PZMA 3GYCA 1OT2A 3CPUA 3NSXA 2QHAA 3AISA 4PCSA 1M03A 5DF0A 3K8KA 3W81A 1WZAA 3WQ4A 3IJ8A 2D0HA 3VIGA 3AXHA 4D6HA 3GM8A 4E2OA 3POHA 3K46A 1JFHA 1QI2A 1SYTA 1JXJA 3VM5A 3SUTA 1KCKA 3WQWA 2AMGA 3WELA 4CU7A 1JYXA 3A4AA 4PMOA 3BCFA 1ESWA 1ZL1A 3CZNA 3HG2A 1KTBA 1V3IA 2DEPA 4P7OA 3WDQA 1CWYA 5AC5A 4JCMA 1WZKA 1VIWA 3LX9A 1W3LA 4FLSA 2F7OA 4JKMA 2FHBA 3W37A 5E1QA 3CZLA 3F5KA 1E6SM 1CGYA 4LPCA 1X6LA 3A4WA 3SCVA 3CLWA 3EDEA 3BAWA 4OBRA 3ALGA 2ZX7A 4FMVA 3SUSA 5CLWA 2ZUUA 1NWTA 3OA5A 1HJWA 3HN3A 1EA9C 2BY3A 5HPCA 4NX0A 3VGGA 3W24A 1EO5A 5CGMA 3A21A 4WKHA 4QLKA 1WAWA 3JUGA 1UR1A 1F4HA 1Y7VA 1I75A 1J18A 2PF0A 4BQ4A 1ODZA 2CITA 3WH8A 1B3ZA 4D6GA 2XG9A 3N15A 4PMXA 3WNPA 2VOTA 1C91A 2A3HA 1SR0A 2J7GA 1HKKA 3CZGA 3NSMA 3UG5A 1MQQA 1H0IA 1MXDA 3EJTA 2CCRA 1QBAA 1LF1A 1TE1A 2EJ1A 1JGIA 2TAAA 5E70A 2JE8A 5A1AA 2QMJA 2D2OA 4NZCA 4DWSD 3OGVA 4HA4A 1QI4A 3VNYA 4JHZA 1E6XM 1W3KA 1HKIA 4AMXA 5D9NA 4J3VA 4NF7A 3BC9A 3OGRA 4WJXA 1G5AA 1XV8A 3EJRA 1FA2A 2VZUA 5EBAA 2NT1A 4PMUA 3TTSA 1LWHA 2CBIA 2Y8VA 3WF3A 4CD4A 2DT1A 2J75A 5JBDA 3HJEA 2BY2A 2J77A 4AXNA 1JYVA 2DT0A 1BG9A 3S5ZA 4FNRA 4LQ1A 1OM0A 3QGVA 1VEOA 3QHOA 1E71M 1L0PA 4R5EA 1GPFA 1HIZA 3PTKA 3WH9A 1GHSA 5BRQA 3N13A 3DHPA 3LRKA 3KLKA 2VNCA 1H3GA 5M3WA 1DWAM 1B0IA 1ZB5A 2D73A 5A6JA 4AW7A 4U2ZA 2FGZA 3KZSA 4MNMA 5IFPA 2WVSA 4HOZA 1B3XA 1NP2A 2G3IA 2W63A 2VT0A 3CMJA 3KL0A 1KGUA 3OLIA 3ARZA 2W66A 2WB5A 1WDRA 3RM4A 3RILA 2W4XA 1GOIA 3AIQA 4C7FA 1H4PA 4KRUA 4L4OA 3T0AA 5C71A 3B9AA 1ZJBA 1WDQA 1FFRA 4YHGA 1M53A 2GK1B 3OZPA 3DX2A 3ARQA 2A3CA 2WC7A 2WZIA 1GONA 3AMDA 1HL9A 1MXGA 2YA1A 2VRJA 3N9KA 2X0HA 5DEZA 4A4AA 4JCLA 3WY1A 4UOQA 3FY1A 4NRSA 1FH7A 1GNXA 4W7WA 2YIHA 7A3HA 1OGGA 1R7AA 3DX3A 1UD3A 3BLKA 1E5NA 2FYVA 4FNQA 3MUZ1 2XVGA 1NOFA 2J7DA 2C7FA 3N17A 3OBAA 3VGHA 2DIJA 3KE0A 3KLLA 1CXFA 2A3EA 1TQVA 1QPKA 3IK2A 3DYOA 5D4YA 4ZENA 4XV0A 4N0RA 4XZWA 1E6RA 3VM7A 3D50A 3W29A 4EANA 2X8RA 3CZJA 1MQPA 1QHOA 2VZOA 1OD0A 5BCAA 2OLHA 3CTTA 3WBEA 1E15A 2VCCA 1GQJA 5BXRA 1KQYA 3WMBA 1VJZA 1XH1A 4LYPA 3CO4A 5D8ZA 4X0VA 3M07A 3UR7A 5JUVA 1TMQA 4ACYA 1OT1A 3LPOA 3ZT7A 3LRLA 3ZMRA 3GNRA 1RH9A 4D6CA 3CUJA 3AMCA 1GOWA 2VRKA 3L4WA 3NDYA 1QBBA 2E9MA 1IT0A 4HP5A 1W1VA 4L4PA 4U2YA 5EMYA 3VOCA 1RP9A 1BLIA 2EPLX 4MB5A 3AHVA 1CPUA 1K9EA 1UD4A 3VGEA 2IGTA 1UKOA 1LJYA 1LLOA 1J0ZA 5DFAA 1C7TA 3ARUA 3BCDA 4BA0A 2EPKX 5FL0A 3AHTA 1UG6A 3AS2A 5E0CA 1PX3A 1CXIA 3WD2A 4OGZA 1OBAA 1ZS2A 2F7QA 4TVUA 1ZBCA 4Z2LA 1G94A 1WP6A 1OD8A 3VX1A 5D9PA 2CKRA 1V02A 2WK2A 5A95A 2ZUSA 1S46A 1HXKA 1PAMA 2XFRA 4D6FA 1H2JA 1P6WA 1PZ2A 4UFIA 2O92A 2V3GA 4TUFA 4HPHA 1H1NA 4NXSA 2OWWA 2J62A 1ISYA 4KRTA 3F4VA 3KL5A 1ECEA 1G0CA 3WSUA 4B15A 2WAGA 4PN2A 2CXGA 1VRXA 4X9YA 5BWFA 1J0JA 5IDIA 3WNLA 3A22A 4DUWA 5AC4A 1ITCA 2VX6A 2WMFA 3VSUA 2YDQA 4KH2A 1NQ6A 2Y4SA 2VC9A 1ITXA 4H8UA 4CN1A 2X05A 3W6MA 1W9DM 3WF1A 4M29A 2J7EA 4ATLA 1UASA 1TUXA 4EK7A 3O6AA 3WH7A 3WF2A 2XUCA 3T0BA 1EDGA 4JAWA 1DEDA 1HJVA 3WNKA 4ZEPA 3ZQ9A 4H7VA 5LA1A 1WNOA 5AYIA 1OIFA 2ZWZA 1W2VA 2G4FA 2CIPA 1LL6A 3EYPA 3BUPA 1CECA 4CKQA 2F7PA 1UQYA 3WD1A 5A94A 2E3ZA 3EDKA 1GW1A 3RO8A 1W1TA 1QWNA 4MB1A 1JZ2A 2E4TA 1DP0A 3MANA 2PWHA 3ZO9A 1B30A 5A8PA 3E1F1 2J78A 2V3EA 4IISA 5IHRA 3VD9A 3ARXA 3WQ6A 4D71A 1FH8A 2C0HA 5A8QA 3BUQA 2D3NA 1DTUA 3NYDA 4MJ2A 3UETA 4PBGA 1JD9A 1VFMA 2UWFA 4HMEA 4W93A 4JZ5A 3SCSA 5E6YA 3J7HA 1UR9A 2GJPA 4QCEA 3WUBA 3VO0A 1E70M 4PRWA 1U2YA 1ISXA 3DECA 4NXKA 1FP8A 1CBGA 4CD7A 2EPOA 1UZ1A 1W9PA 4QLJA 5CSUA 4ATWA 3CHEA 1OB0A 1PBGA 1PX4A 4AC1X 1T0OA 5E6ZA 3AXIA 3BAYA 2DSKA 1V6UA 2DDXA 4IUGA 4BS0A 1A3HA 3O9NA 4TOQA 1KFWA 2VJXA 5AYBA 4PEEA 2RGLA 2GK1A 3AYRA 4W84A 1TQWA 3WBAA 1K9DA 1PIGA 4DWSC 3N1AA 3N04A 2VX7A 4B9ZA 3AZSA 3VD4A 4S3KA 4AD0A 1HJSA 2XJ7A 3RPMA 3BUIA 3EDDA 1R8LA 3PZ9A 4UQDA 1NARA 4EE9A 4HMDA 5IXEA 2DH2A 1CEOA 4MTVA 1EHAA 5GQBA 1O6IA 1FHDA 3LXCA 3CUIA 1PIFA 3DYMA 2GDVA 2BHZA 3VGDA 2E8YA 2OWXA 2ZWYA 4RE4A 1M04A 2V3FA 3QOMA 4YHEA 2BFGA 2E8ZA 3PTMA 3WNMA 3TONA 2WVUA 1RPKA 4TVCA 4AWEA 4PUEA 3IAQA 1R46A 4Z2KA 3MMUA 4D1JA 3NJ3A 2YDRA 4WK9A 1UR4A 1UD6A 3OIHA 4M1RA 1E4IA 5FD0A 4J3XA 1J12A 1KB3A 2ZX6A 2F8QA 1EXPA 1OWQA 5IHSA 4Z2HA 4BQ5A 3AHXA 4F9JA 2NSXA 1LL4A 1R47A 4KMQA 2OSWA 5A6LA 1V02E 4GIAA 2CERA 4WKAA 3WY2A 3DYPA 1BYDA 1E3ZA 5I5RA 5CPQA 2VO5A 2UY4A 4HU0A 3DC0A 1J0YA 3AS0A 4PCTA 1UKSA 3SURA 2D20A 2GVYA 3TTYA 4Y7EA 1E0XA 2W91A 4W85A 2IUZA 2HISA 3WDRA 4J28A 1UWRA 4CCEA 4EAMA 3U7VA 2J47A 4GZEA 3W82A 4AZBA 3MO4A 2WHMA 3NIYA 4OKDA 4WSKA 1JL8A 1NM9A 2YKKA 3GDBA 4D1IA 1UZ4A 3SUUA 2EAEA 1GJWA 3GZAA 2EXOA 2Y24A 3WD0A 2WMJA 1OINA 1V6YA 3A24A 1UD2A 3VINA 5I2UA 1JZ7A 2ZUNA 4ACZB 4GPNA 2YLLA 2YLAA 4MAVA 4Q22A 1CGUA 3T2PA 2J7HA 3SEPA 4U31A 3VX0A 1H09A 4AMWA 4CVWA 2UY3A 1UKPA 4UFKA 3CV5A 3W28A 8A3HA 4IPLA 2WKLA 5JIWA 3WL0A 2YOCA 4UFLA 2OSYA 2QLYA 3CGTA 5I77A 3CZEA 1UWUA 4PTXA 6TAAA 1JDAA 1OGBA 3M46A 2F1AA 3U5UA 3WH5A 4H8VA 2WVTA 2ZUWA 3MMDA 1UYQA 4V27A 1H0GA 2G41A 4DWSB 4M8UA 1C3FA 1MWOA 4AZCB 2Y8KA 4BCEA 4DUXA 3WEZA 3GBDA 4UQAA 4RL3A 1YQ2A 2WCGA 1G1YA 3CUFA 4GXPA 4YN5A 2BS9A 3FN9A 4AZ5A 1FH9A 1EDTA 4HOXA 5JBFA 2C8NA 3RJYA 4Z2JA 1NH6A 3NUKA 3MMWA 4UR9A 1CGVA 2XHYA 4H41A 3UG4A 3B9DA 1HT6A 5EFDA 1V03A 3L4VA 4AIUA 4CU6A 3OLDA 1BYBA 1J10A 4UFHA 3EMCA 5A2BA 2PWFA 3TOPA 2WNWA 2GJRA 4GO8A 3ZJKA 2VX4A 3S6TA 4AMCA 3RM8A 1DHKA 3IJ7A 3IGUA 4FLRA 4NRRA 1VF8A 1ISWA 3IAPA 3K1DA 2G8ZA 4RE2A 5M03A 2DH3A 3AMLA 5A2AA 1UHVA 1C8XA 2XTKA 5GNYA 3BAXA 5CZKA 1H49A 4C7GA 3L4UA 1IV8A 2EPNA 2NT0A 3AIEA 4JIEA 3BMVA 5F7UA 1LG2A 1CXKA 3UESA 3MV01 2J25A 3VDAA 2XPKA 2W61A 4P8XA 2VVNA 2FGLA 4FNTA 2YL6A 3EDFA 5CLTA 5KEZA 4CUCA 1ZBKA 2YBTA 4DM1A 2ALWA 2FE0A 1FP9A 1V6VA 1E43A 2CNCA 3IANA 4Q7NA 2FH8A 3VSTA 2PBOA 2W5FA 4MPKA 4S3JA 4AYSA 3CHCA 1JF6A 5BRPA 4P8WA 2BHUA 1EO7A 1E72M 3WH6A 2CKSA 5A6AA 1B3WA 4PMVA 4U5IA 1W32A 3KL3A 5IFTA 4W8AA 1UA3A 4OIFA 1LL7A 1C8QA 1ZBWA 1VJSA 1GQLA 1V3MA 4J3UA 1EHNA 3LRMA 3WL1A 1KQZA 2W67A 3U57A 2PBGA 4AEEA 5HPOA 1KR0A 1W9VA 1UWSA 2CESA 2JIEA 5ABFA 2FH6A 4PUDA 1W9XA 4KGJA 1WCGA 3B9EA 4A3HA 2ZOXA 2DSZA 1QOXA 2BHYA 1XSJA 1UD8A 1G01A 1L8NA 5D9OA 5C70A 2UY5A 3ZOAA 3BGAA 1V0NA 3KWXA 2WLYA 1BGGA 5CPTA 1CTNA 1QNRA 3MSGA 2VZSA 4CCDA 1EOMA 3D5HA 2UY2A 4GI9A 1E0WA 1J0IA 1WB0A 2Z1KA 1OGSA 2VR5A 3GXNA 4XUYA 1NWRA 2AOSA 2O9OA 3VD5A 1KBKA 4MNKA 1W3HA 4P7QA 1JG9A 1GORA 2J74A 2X2JA 3POCA 2BXYA 4TTGA 4QAWA 4PMYA 1JDCA 5DO8A 1Q6EA 1CNVA 5A6BD 3WDHA 3BVWA 3WKZA 3VD7A 4PTMA 2WWDA 3CZKA 1US2A 3WUFA 4WKFA 1GQKA 2WMIB 2OYMA 3QR3A 3VMNA 3MSDA 3GXTA 3VDBA 1FFQA 1UH3A 3PZTA 1CGTA 2CBJA 2WYSA 3BSGA 3MI6A 1AVAA 1WPCA 3BVXA 4D6IA 4DUVA 4EKJA 4MDPA 3ECQA 2WM0A 2J8FA 3WIJA 3MS8A 4B9YA 4F79A 3PZVA 1YHTA 5D9MA 1XD1A 1RD6A 5I3DA 3WN6A 2VCAA 2WVVB 3I3DA 4MNLA 3ARPA 4NI3A 1DWIM 3PZOA 3CMGA 3ZM8A 5A6MA 1AQMA 5HOSA 2WPGA 1J01A 3VD3A 2X2HA 4J27A 4LGXA 2EQDA 2J4GA 1I1WA 2YA0A 4LYQA 2VL4A 4E8CA 1OCQA 4GO9A 3ZSTA 2JALA 2D3LA 1PPIA 4W7VA 2OWCA 3WNNA 2WMHA 2YA2A 3VSVA 3HZ3A 4CVUA 2WSPA 3MV11 1IZJA 3U7BA 1H11A 2ESCA 2AAAA 2DPEA 3TP4A 4UFMA 1JZ5A 3BUBA 5A6KA 4FLQA 3L2LA 1E6PA 2CHOA 2CHNA 2WMKA 5ECUA 4W5ZA 2QV4A 1E6QM 3LPGA 1V3LA 1TVPA 1SFSA 2VUYA 4W86A 3ARSA 4ACZA 3BH4A 4BZYA 3GNOA 4NSBA 1HWWA 3N11A 2YL9A 4PMZA 2D22A 4V28A 3GTNA 3K8LA 1DWJM 3LMYA 1M7XA 1GCYA 2YJQA 1NWSA 2V5CA 1HN1A 5A69A 4QFUA 1KTCA 1R86A 3ZT6A 1GVYA 4N42A 5HDRA 3W25A 4GQRA 2DSUA 3VIPA 3VTRA 1AMYA 3DDFA 1U30A 7TAAA 2GDUA 3MUAA 1WO2A 2XSBA 3ZJ7A 4DWSA 1PJ9A 2ZXQA 1FHLA 4TTUA 1N82A 4XX6A 4AZCA 2WW5A 1C93A 4Z2IA 2BY1A 4MAZA 4UQBA 3AMKA 3WQVA 1A47A 2X2YA 2CBUA 1XC6A 4TXEA 3PZNA 1W9BM 1XRVA 1CENA 3NSNA 1E55A 3AOFA 4FNPA 6CGTA 3VIIA 1W1PA 1XSIA 2OSXA 2XIBA 4ZXOA 2WCSA 2E9BA 3OG2A 2DSWA 1KBBA 4HA1A 1MW3A 1XSKA 3AICA 4OUEA 4FK9A 3VIFA 3EMZA 1SMAA 1E1FA 2DT3A 3WFLA 2BNJA 1ISZA 1JNEA 4XZBA 5BXPA 3EDJA 4GZIA 3BAIA 1D3CA 1B1YA 3GXFA 2VX5A 3ZT5A 1UR8A 4CD6A 1B90A 2WSKA 4UOJA 3GH5A 3CIVA 2GSJA 3CH9A 5CSYA 4D6JA 1PEZA 3ARTA 4KWUA 3AI0A 1HVXA 5EFFA 4WIWA 1HX0A 2WHLA 4JFVA 3FHAA 1HF6A 2IXVA 1TG7A 3PZQA 2ZUTA 4HZ7A 3WENA 1TQSA 4BQ2A 1US3A 3DX4A 4TX8A 1KR1A 3CHDA 3AROA 1E9LA 4ZE5A 5KZ6A 1VFOA 1NWUA 1MW1A 3RIKA 4P8UA 5I23A 1R87A 4J7RA 1BAGA 4NZJA 4U3AA 1V08A 1R33A 1VBRA 3WEOA 4JHOA 1HXJA 1BHGA 3GNPA 1KXHA 5LA2A 3RDKA 4HU8A 5JBEA 1ZJAA 3BVTA 3SCOA 3WF4A 4OJYA 3VUPA 2NW0A 1KGWA 3QOKA 3W27A 3ARWA 1E4MM 2XVPA 3THCA 4AIEA 3F5LA 3THDA 5CG0A 2VRQA 5ABFB 1NOUA 2E40A 3T2OA 3W53A 2XVKA 4LXFA 1EOKA 4JFSA 2F18A 4FNUA 7CGTA 4HZ6A 5E09A 5A8NA 5JIPA 5FL1A 1BFNA 4UZUA 1UKQA 4BQ3A 2Z1SA 5M17A 3IJ9A 1UR0A 4Z2GA 3TTQA 3MUIA 5M5DA 4F66A 2FHCA 1WDPA 1BVNP 1GJUA 3WEMA 2PWEA 2XM1A 1GOKA 4M56A 4J3SA 1Q6CA 3GXDA 3HG4A 1CGWA 3FHQA 5A6SA 3GH4A 4GKLA 2J8GA 3U5YA 3HU7A 4QCFA 3VGBA 4U5KA 1X1NA 2CETA 1TZ7A 4AD3A 4MJ4A 3K8MA 4JKLA 1BGAA 1TFVA 1AQHA 1B31A 1GUVA 3M7SA 1ZBVA 3AQUA 2ZXDA 4ZFMA 2ZXAA 3PN8A 5DT7A 3AS3A 4V2XA 2PB1A 5FOOA 4U33A 4NZFA 2WC4A 3VIOA 3L4XA 2XN1A 3CHFA 4HPGA 4GZJA 1JZ4A 2JEPA 2J7CA 2WMIA 5I24A 1B3VA 1UOKA 4J3WA 1I1XA 1MQRA 4OOZA 9CGTA 5E0FA 2ZX5A 4H04A 1VENA 3WD4A 3CUHA 1QNSA 3A47A 3II1A 4W5UA 1BSIA 1ODUA 2X2IA 4DO4A 4AZGA 1PZ3A 3RCNA 2CPUA 3TV8A 2O9PA 2EADA 4TX6A 2A3BA 2JF6A 1TQTA 4QDMA 1WDSA 2WVVA 2EABA 3DX1A 4CD5A 4CU8A 3G6MA 4CGTA 1X6NA 3FNDA 2G3MA 1KCLA 4AZ6A 4F8XA 1QNQA 3D4ZA 2VMFA 1VAHA 1UQZA 1HVQA 2VCBA 2QMKA 2VVSA 4CN4A 1V3HA 3FAWA 4B3KA 2JEQA 1E1EA 5FIPA 5BROA 2Y5EA 2WCAA 1MW0A 3F5JA 2WHKA 3CZSA 2ZX8A 3CBWA 1XYZA 3QHNA 3OB8A 2G3JA 3FW6A 4MADA 1GHRA 1R7OA 1CXEA 2F2HA 5A2CA 2V5DA 4P7NA 3WMSA 1PX8A 2CYGA 1MFUA 4JFWA 3T0DA 1XGZA 1XYFA 2YBUA 3DHUA 1J0KA 1E4LA 4PTWA 4JKKA 4P7LA 5FCZA 2BVTA 3UCQA
chains in the Genus database with same CATH superfamily
3KPOB 1MCKA 4CD8A 4L8DB 2GJ6D 1L7TH 4TSCL 2GT9A 1HOCA 3QFJE 4A38A 3CC5B 1ZLSL 1E5JA 4DHLA 4MMZC 4P7RA 4X7SL 3CAWA 1NIUA 2V5JA 1A50A 3BK0A 3UGXA 3DXAD 1MVFA 2HE8A 1ZDSA 4ZMQA 2QADB 1RZJH 1QUMA 2WBGA 4X9SA 1XD0A 4BM7A 2Y7MA 1CE1L 3C5ZC 4RMQA 1KTKE 2QPUA 1B4JL 3LGDA 5CSBA 1S9VA 2VLRA 1U8JB 1UATA 2P45B 3VD1A 2VR6A 2J7BA 3BE1L 1NCCL 3OA3A 2Y7NA 5D8WA 2HN7B 2W94A 4N1EA 2PURA 6TIMA 4LVOB 3GDTA 3EH2A 4FEZA 1C90A 1UD5A 3CHRA 4LKCA 1I1CA 5GNXA 1YEHH 1S5VA 3URAA 4YZFF 3D3AA 3DC8A 2CK2A 1OC6A 2AVFA 3QV7A 4K94C 1IGIH 4KNUA 3JWOC 1KM1A 1IC7L 4XAGA 2CXEA 1WAUA 2HPMA 1GZQB 3LPPA 4HUXA 3CFTA 4Y4FA 1M3UA 3UBGA 4M5YH 4X6FA 1E56A 5FWRA 3I2CL 4LIQH 3W22A 5IB2B 4FIRA 3LM3A 4F0LA 3QUYA 2WZEA 4Y9PA 1TCMA 2R1LA 2DWSA 1IQWH 3SCPA 3W2DH 3V0VA 5TDPA 3KDPB 5PAZA 1DWHM 3D0LA 3O4OB 1SN5A 2C9XA 3MI2A 3A4XA 1X5AA 3UH8A 3PYCA 2OW7A 4C4BA 3FXYA 2V2CA 5I8EA 4K7YA 3SM0A 1PMYA 5H8MA 1RJLA 5AOUA 3WBXA 5J9PA 3A23A 4U7KA 3TM6A 4L0PB 2I9UA 3DI0A 2OMYA 1SNRA 1NWPA 4LVFA 3R0KA 3DHJA 2NTFA 2GJXB 1EIBA 3RVXC 1VKXA 2KL6A 3O15A 1KY6A 3RM9A 2MANA 2K4AA 4WI2A 2R7EB 2QS8A 2VEIA 1CLYH 3HQNA 3GUFA 3F84A 3TJHC 5C6WH 1QI0A 1IEWA 2X10A 1S3TC 1U1UA 3WCYA 4I0PB 4Y1AB 1YCSA 2ICWA 1HCZA 1LQAA 3B2UC 3PLYA 1CK0L 1CGSL 1GKEA 1GOHA 3R4RA 4JFYA 1Z9OA 1F3TA 5GS0C 2XA3A 4KGLA 5MP6H 4HUWB 3QCTL 3IXTB 1FORL 1ZHNA 2I85A 2BC4A 4BF7A 3ZKSD 1DBAL 4ZTPL 1XHGA 5IVXA 3O2LA 4NDMA 2OX4A 4GRLA 1OIMA 4G9FD 3IJSA 5MEND 2IMNA 2MOQA 2AS5M 3OKKB 4MNQB 1CQYA 3CJJA 5HYSG 3D30A 2EC8A 1VESA 1T0MB 4ZMLA 1PG7L 4AIZA 2UY7B 1HSBB 4PW4A 3F7QA 4YR6B 4OCNC 4MX7A 1BQ5A 3ZE2F 2DQGH 4KQ3L 4R8WH 1F9CA 3MUGB 3EWXA 3NO1A 1JPFB 1UR3M 4XWOC 4PD4J 4X7FC 2GJZA 1HQRB 1KCRH 2BSED 4GNJA 1C8YA 2FJKA 2VZTA 4HNTA 3X12B 5F6IB 1EQWA 3EADA 4D6EA 1A4KB 4K68A 5D02A 2Y2YA 1TSHA 5DZJA 3NWRA 3LS9A 2X09A 3ZR6A 1FX6A 4Y16A 3NP3A 4HYRA 1HC1A 1J05A 1GVEA 3HE6A 4ALAH 2Z1VA 1S5HB 3EFDL 4PJ7F 4UMCA 1QW8A 2K4WA 1TWWA 4BJLA 3SKNB 4K5OA 2WYTA 3QHMA 1AQ0A 4HCFA 2PWDA 2A0LD 4Q4EA 2AQQA 1V3JA 1MAML 3P9MA 2GAZB 4JD4A 2VMEA 4NO5A 3D51A 5GZNC 2XWDA 3JXAA 1YMYA 3FJTA 4HTYA 4LMQE 2OXHA 4H5SA 4JTEA 5DT5A 2X30A 4GW1A 3TN0B 3VZZA 4HNLA 1A7RL 1YY9C 3PL6C 3BW4A 2JKRM 3MRCB 3EYVB 5D1ZC 3A4FA 3RNQA 5KAQF 2ADYA 3WO3B 5TDOA 4APQA 1V6WA 2VM4A 1JZJA 3FU5A 4W6WB 1PDKA 1KB9K 1R3YA 4F7PB 5D7KE 2UWEE 1MWAA 4ZRGA 3EUDA 4TMPA 3ZYOA 3O2DL 4GH7B 1MPAH 4HWNA 4GLEA 3W7IA 4IKLA 5H8DA 4F37K 4GD0A 3TVMD 1XIEA 3MNWA 1WICA 3GM8A 1UIOA 2GJ6B 3QBTB 3RG1C 2OCZA 3CLMA 2ASHA 1GOXA 2CJTA 3TBVB 1NAMA 1IR2A 3KVPA 3NJXA 3QCUL 4LVGA 4RZ6A 5I30L 3INPA 5E1QA 1MI5D 3DXAB 3QJQB 4Q6IC 2GPZA 1XF5A 1BEYL 4IRSC 4XBEH 1FL6B 2QCGA 1BZQK 3N5AA 5CLWA 4LCUB 3EZ4A 3SO5A 4OLZH 3X3FL 4HJJH 1KIPB 1NLBL 1DXIA 3MSPA 1OSZB 2J7GA 1Q5MA 1E4XH 3UG5A 5D7IF 4OZHA 1MXDA 2PR4L 3H2QA 3TESA 1TE1A 1JGIA 5DRCA 3MLYH 4C4KT 4ZX4A 1ORQB 4IJTA 5A1AA 4EN3D 4DWSD 3HE7C 3PK7A 1QKZH 1XPYA 2YWYA 1XV8A 3ZTDC 4OF0A 1XCTB 3J8F7 4L0ZA 2QQQA 3MJ9H 3TQKA 4DT2A 3BWZA 2NCMA 1BRLA 1MUWA 2E86A 4Y5YB 4FGMA 3L1OH 2I27N 2CR3A 4WW2F 4WI5A 2PUZA 1NUFA 1GPFA 1YLBB 2CNYA 3UMTA 2FWSA 5JH1A 3SSGA 3II2A 1AG6A 3QW4B 1AGFB 1XGQA 3MHZA 2IDSA 3GHTA 1NTDA 5DGQA 2FGZA 4YDLC 5IFPA 4LVNC 2VJ8A 2IPJA 4PJ9C 1C5DA 2W63A 3PPHA 4G7VH 2WB5A 1U91B 1XWYA 4DY1A 4PJBA 2PTYA 1MEXH 2ZZ4A 5AC7A 2Q7YA 2NY7H 4DN1A 1XM3A 5EBMA 2CM6A 3KYMA 4U1IB 4ZSOA 3WEAA 4ES4A 4JCLA 2CLRA 1GNXA 3FSUA 5LQBH 1L0XA 2FYVA 3TW7A 1J8VA 1TX2A 3QJVB 3GAYA 3PXJA 1MCWW 1FLTX 3MO1B 4AYMC 5M7QA 4TLTA 3AUWB 1Z69A 3RY6A 5AW3B 3OXSB 1UOVA 2VZOA 1OD0A 1PLBA 1G9NH 4J1UA 4JPIB 2DQ6A 2Y9RT 5DXXA 2AEIT 1DVUA 4OZFA 3W2NA 4NHVA 5CGYC 2L7EA 4X0VA 2BNRE 3OD3A 4O52A 4U1MA 5CMAB 2IH9A 3LV3A 1ULVA 3S9YA 1IBGH 1NEZB 1T83A 3O3DB 3L4WA 5HNTA 1JPTH 4U2YA 2WQUA 3FQTB 4C6LA 3B0VC 4BXSV 4Q89A 1ME8A 1S78D 1LJYA 1E51A 3UAFA 3FPXA 5DFAA 4D9LL 3T71A 5E0CA 4ZXBC 2PO6A 1OBAA 4DPCX 2ICCA 4OTXH 3G5EA 3G8RA 3FU8A 3ITTA 4G9FB 5JOPE 3LMJH 2CKRA 3AC0A 3CMOL 2IKHA 5J1SC 2R8SL 5MENB 3T77B 1XI3A 3ULVC 3M7FB 1XYMA 1F4WL 4QRUA 3E74A 1MIMH 2AJ3A 3FFDA 1GVOA 3F4VA 4YO0B 4BUHA 2GY5A 4PG9A 2J55A 3ECBA 2VX6A 3BQUC 3SY0A 1SEBA 3OG4B 2DQCH 2NQDA 2IXQA 3O6AA 5HYQB 3DX9A 2IFFH 4JAWA 4XAWH 3WNKA 1XUZA 2AQPA 4YDVA 3R8RA 5C0EA 4Z7WB 3VNLA 2PTTB 4IGHA 3EYFB 4YHKH 3KOWA 2Q20A 5GS1C 2JB6A 2AQ3A 3V4VA 5AOJA 1NBZA 4Q7BA 3NCFB 4QHNB 3RO8A 1KGCE 5E8OA 2H9AB 1DP0A 1TVBA 5CBIA 2VR7A 5JR1L 1LROA 1ZHKB 2DZWA 2XG4A 2QJDA 4IISA 2OI9C 3MGOB 3VFUA 1H1ZA 3PY2A 1MHPL 2UWFA 2I17A 4JZ5A 3NQAA 4XP6H 2W9DH 3U0TA 1LT8A 4OGXH 2O5XL 4BQ9A 4L7ZA 3DURA 5CKGA 3ABRA 2P9RA 1GIGH 3NGFA 2JJWA 2C3HA 1KB5B 3GK8L 5IBTL 3TWYA 2XIQA 4IGSA 3DI1A 1AY1H 2IPUG 1GTNA 2FECL 4BS0A 5FO7B 3O6CA 2DIAA 5AZEH 5FS5A 2GUOB 3BH8B 1VBGA 1YHPA 2DB8A 4PI2A 4YTRA 2ZAIA 3JW7A 1TEYA 1U8IB 3QXDA 1FZJA 1T22B 3UABA 2YK1H 4E9TA 1TZZA 4HT1L 3HPZA 1A7NL 5DQDH 4J4PD 5JXED 1FN4B 3HPFA 3GKZA 3LB6C 4L5ZA 5B4MC 2CRYA 4QI3A 4TQTA 5D1QD 3RAJL 2VLKD 3FU9A 1M7IB 1N3NA 4Y4HD 4UQIM 2VM9A 1JGEB 1R3KB 1QLEH 3OPSA 4BQ5A 5DHVH 3QRLA 2OMZB 3TVMB 3WY2A 1ZJHA 2ZG1A 1XVSA 3ATBA 1UKSA 4BRJA 5B38A 3VW3L 1E0XA 1YNKH 4AX3A 3ARED 4N6RB 4LSSL 2X6VA 3MLRL 1GOGA 4FL4C 1ZHBA 4EAMA 4NO3A 1YTDA 4JKNA 4I5XA 4NFDA 4MZ3A 4E36A 5BZWB 1GJWA 3MA7A 1MI5B 4N1HB 4UT9L 4RH4A 3LNEA 4MAVA 4FP1A 3ZDZB 5AW7B 3IDUA 4EDXB 3ZUCA 3CV5A 3SRDA 1YMMA 4HJTA 5L4JA 3MRIB 5T5FA 3DSFL 4HHWA 1NGXA 5AB1A 3W1LA 1OGBA 1T03H 1DQQA 1PAZA 2WVTA 4CQ9A 4EN3B 2CCWA 4DWSB 4PWHA 3RVUD 1RPQA 3QZBA 3VA6A 4UNUA 2NW3A 3W9EA 4NP7A 3OWEA 3RL1B 3DBNA 3LZRA 5DRXA 5F96L 5A6IA 5IESL 4G80A 3FT2A 4GABA 3GFXA 4Z7NF 3ZLQC 5DVLA 4O51A 1CB7B 4P8QA 2WNWA 4FG6C 5HI4C 3CHVA 5F4SA 4PRAB 4C6JA 5EEZA 4N9BA 3MR9A 2XDHA 3K1DA 3OJDA 1XZ0A 2FX7H 4WO4A 4QE1A 3O8XC 2H2SC 1P69B 1EXBA 2D69A 3IVTA 5LDSA 4NNCA 4HK0A 4C54A 1TE6A 4KXCA 3IANA 4N8VA 3SOBL 1FGNL 3QG7H 4J3OH 3D5OF 3L9RB 1OAJA 2YPVH 3KM1A 4G5DA 3KL3A 4U1NB 5BOOA 4G5ZH 3TBBA 5IB3A 4A22A 1RHCA 2XZZA 5IMLA 1UFUA 4DLFA 1WCGA 4A3HA 1BWVA 3FQUA 2X28A 3WNIA 1XSJA 5D9OA 5F97E 2VDQL 2BXVA 1YYAA 2NY0D 4MAYA 1CTNA 1MCWM 4LPUA 2VEKA 4H26B 2O93L 5T1MA 3PWJA 2AOSA 3R7MA 4MNKA 1G7VA 4XBJA 5L0QC 4LLAA 3ZTEA 4IMGA 2H9GA 1QTPA 3S9ZA 5JHDD 1NCAL 2VELA 2WMIB 1WAPA 1F90H 1FFQA 4RXGA 1R19A 4MJ6B 1I4FA 3ZDYE 2MQGA 3MI6A 3NOEA 4LB4A 4P5UA 2WLNA 4U6XB 2D4DA 4EIUA 3N85L 4NSKA 4NI3A 3LBMA 4S1DD 3MKVA 4J27A 1RJPA 2VB5A 5DS8B 2JTYA 2B1AL 1ZGLP 3SDYL 2BFVL 4XXCC 5JLZB 5HJ3A 1D9EA 1Z44A 4CVUA 4JDEB 4N86A 2FO8A 2WNNA 3QJTB 2CHNA 1RXOB 4PU2A 2YDAA 2C26A 3VFPA 1TVPA 3SE3C 1OFPA 1ZS8A 4P2RD 5DD0L 4D8ZA 4K0OA 2NQ3A 1AD4A 1KGYE 5ERWA 5CP3A 4ZYKA 4JDZB 5HGBB 5E8DL 4KI5C 5I8OH 1S8DB 4MD0A 4UUIA 5HDWA 2VLMD 1RZQA 3OAYK 2EUWA 3M45A 4Z78B 3O6FA 4JY6A 4FXGA 3HUJF 3EX1A 3MUAA 2GDUA 4YN3A 2ZXQA 3V18A 5D7SH 4ODUB 4MGGA 3CL8A 2OR2A 2MHAA 3B0XA 4S2SB 5C3IA 2XWJA 2R29A 3G3LA 4I7WA 4PGCB 1UWAA 3CHOA 4DGYL 3UPRB 5D72L 3Q65A 43CAB 1XLCA 4IHOA 1ZGLM 3JV4B 2DT3A 3LSBA 2OZ8A 4QT5B 3CBRA 3NN8A 2OB3A 5KG9B 2WSKA 3K6OA 5HD8D 4U10A 1G7JB 3JYCA 2W9EH 3RGVA 4PL2A 3L9BA 3WUWA 3DVIA 4AFYA 5EBLB 5EEXA 2ARJA 3L7EB 5F0PB 2ZVRA 2J8UE 3M86A 4MQ7B 2E9WA 2OR8A 2W38A 3KR3L 4M1CC 4TV5A 1SFLA 4KS0A 1VFOA 1NWUA 1MW1A 4LF2A 1EAPA 4PJ5A 5D2WA 1SBSL 1UEYA 4KFZC 2RQ8A 3GDMA 5GIRA 3ARWA 2X89D 2Y89A 1P6AB 2YSSB 3IPBA 1P5UC 5SWZA 1DQLL 1F1GA 2XPZA 4NQEA 3LD8B 1NOLA 1AGDB 5REQA 1QATA 3OAYH 3NZUA 1P0SE 4HBQA 4UDUB 2FMNA 2DWEA 2QSCH 1OB1A 3NCJH 3GH4A 3ZTNH 2XOTA 4L3AA 5D1QB 1YAIA 3NMEA 3BLEA 1NGZB 2X44D 2VLKB 3QPYA 3F5WA 1BGAA 4Y4HB 1N7MH 2W0FA 1Z9SB 2VDOH 4PWEA 1LEGB 1KRCC 1S2UA 3CCHA 4U33A 1F11A 3CK5A 3VIOA 1NCWL 4FXKB 2FGWL 5CZVL 1QTYT 3FO0H 3FMGL 3QIUA 4NC1C 1MCLA 3W3OA 4XI5C 2PP8A 5EDSA 4W5UA 2P5EE 4BY3A 2XZQH 1E9OA 3LTPA 1YY8B 3AREB 2QGBA 5DQ9A 2YCLA 4OY9A 1AC0A 4I3SH 3ECUA 3G6MA 3HTLX 4AZ6A 1UQZA 1HKVA 4KRMB 1M7DB 3DVGB 3S5OA 4XB7A 4NCC1 5DMJB 1NZRA 1UUOA 2JEQA 3HCVA 1E1EA 1XFBA 3CFJA 3NG3A 4W9IC 3FSAA 1GG0A 2F2HA 3TSBA 1EEUA 4MXQD 5GSRA 4P7LA 1T04B 3IKCA 3RNKB 1DO5A 2VR4A 1D5IH 4M6ML 1GYNA 3I9GL 4ML4A 3AQZA 1C1EH 5MKGA 4HH9B 3W26A 3WTUA 3AWEA 3SQOH 4BWLA 3B04A 2GTZA 1XSOA 3IYLW 1V55B 1WFUA 3I9IA 1YYMH 3FCTB 2VIRB 1H3VA 5DZOA 1S39A 5GJSH 3V95A 1B3OA 3AIRA 5HHVH 4XHJC 4R7OA 4R9HA 5H37G 2I32A 4UC5A 2QJGA 1Q6FA 2QVMA 3O6KH 3OKOA 4O18A 3BAJA 3QYSA 5DBUA 4N2CA 1BYCA 1X39A 5KBPA 2F58L 3ARGA 2YD9A 2WZMA 3QVQA 1BXAA 1EL3A 3CEUA 4YDIH 1I2NA 2X4UB 4FQLL 4E0RB 1W2KT 1J5DA 1C5CL 1ZAJA 3VFRB 3ALWA 1CLXA 1YECL 1I9IH 2XSXA 1A3ZA 2DKUA 4MNHA 5I3HA 3L66A 4WWOA 4H9UA 4GFSA 4JHWH 4PJCF 1UACH 1RU9L 4YPJA 1IGML 2XN9D 1RJRA 4IU3B 3PUOA 5DK0B 1KIRB 5CCHE 3WQEA 1CDYA 1EJVC 5C7VA 1RZPA 4F2TA 1AOZA 1FNLA 4DZIA 1PZDA 2NY0B 3GSOB 2V2TB 5L4FA 4XBPA 5HHQB 5ANME 4HWZA 2FZBA 4C58B 1BJ1H 4N9GA 2EECA 1EFXA 1IGWA 5KW9H 3GVGA 5JHDB 5CJ5A 1UM6L 2Z25A 1X7QA 5LA0A 3K30A 1KLFB 3HI1B 3TXVA 1XGRA 2FT6A 2QHRL 2VSMB 4XIMA 4ZQOA 2A9BA 1DLFH 3BO8A 1ET5A 2XQ0A 3BAKA 3VFWA 3WJZA 4N85A 3GKFA 2FBJH 2WO4A 4PE8A 3FUIA 3QN3A 3PJWA 1SM3L 3S5YA 1YZZA 1N64H 3ZHFA 1L3NA 4EIVA 1A5FL 4WSJA 2QELA 3Q1SH 4P2RB 2E25A 4DK6A 4GP8B 2BZDA 4QNPF 4QG9A 3M4HA 5D2NC 2RR3A 1WD9A 2XWEA 3MXVH 1IGTB 3VCCA 1IGCH 4W89A 3VWKA 3SCMA 2P8MA 1BXBA 1IBYA 4XPAH 3OP2A 4QHKJ 1PBYA 3FB6A 3BISA 3AMGA 3DVNA 3ZN6A 4UMBA 1U6AH 5DSCB 1TTFA 3TT3L 3P0YL 4OJEH 2DQDH 3D09A 4NRYA 2AK4D 5JMRA 5DJ2B 1JCMP 4LC6A 4M1DH 3O81A 2K6ZA 1R5IA 4NQDE 1CDHA 1EA0A 3PWNB 4M6VA 5CH9A 2OZNA 1F41A 1W16A 4M24A 4N0CD 3PC0A 3MJWA 1DJHA 3RVTD 2LFGA 3NBNA 2YS4A 4BZ1H 2WSQA 1E9QB 2QUUA 4ZUWB 2DPKA 3PCYA 3V8CA 1S7VB 5E23A 1YEDB 3MREB 5EUOE 4TNVK 1FNEB 5I6OA 4ZFGL 5ENWB 2VYRE 2I7SA 2HSIA 2DWDA 4Q8QA 3BKCH 1UJPA 2PDFA 4MQXC 3FO2B 1WBZB 1O7AA 2F7RA 3DK0A 2HKHH 1R0AH 2VDQB 3SIMA 3NPVA 3O11A 2WQAA 4HC1A 5XIMA 2DZSA 4CBZA 3NM3A 5KJ7E 4JX0A 3IU3B 3BVUA 3KRUA 1BQHG 1GGOA 1QNZL 1A0CA 1E2ZA 3U6XS 2CLEA 4WGWB 1ZSDB 2QV5A 2ZJSH 5FF4A 1H6UA 3CQFA 3QULB 3LRSB 3PZGA 2D9QB 2UYLB 4MMXB 1NQKA 2C1GA 1KWKA 3MGAA 1JCKA 2O0TA 4AF0A 3DBSA 4LVHC 4EI5A 3EGSA 1YJDL 3ASWA 3MHGA 3BT2L 4M4RA 1I2QA 3CXDL 5JUEL 4CW1A 5FYJU 1IZCA 3ULUF 4X9GA 1R5VA 4LRIC 3RWJB 3REQB 5CXPA 2EICA 2VC7A 2E47A 3AHZA 1MCSA 5FUOL 1X4YA 1DQTA 4ODXB 4H4NA 1MW2A 3WUGA 3FSTA 1V05A 3L23A 2VEGA 4C6EA 5IUCA 3HGSA 3UWZA 5E1HB 3DH7A 2K70A 1IWPA 2NNXA 4UUJA 4LAZA 4UBPC 4GW4B 1U8NB 5D93C 5LDUA 4LBRA 3WUEA 5D5MF 1TRIA 2PSNA 1OAUH 2A4AA 3ZE2B 3KCOA 2ZSVB 1RQBA 1G7HA 2VC6A 3GYCA 1S9XA 2DLGA 3IMVA 4PB0H 1GOFA 4HDIA 1LO5B 3W81A 5DHDA 2IBBA 4ZB0A 3D05A 4IQEA 4P57A 4KK6C 1FF5A 3WQWA 3U79A 3WELA 5JW4R 2QCDB 4FULA 4MYPA 2CUAA 3MRGB 3EJZC 3MRFB 4KNTA 4LU0A 4O4YH 3TBWA 1QEWA 4JCMA 5KZEA 1MKFA 1M65A 4UTMA 5GISH 4MD5B 3QPKA 3CZLA 1EJOL 3EDEA 2R1PA 4PGEA 3S8GB 1A80A 2WINB 4PJ7B 4HK3J 2E7FA 1I75A 3QHFL 3LQAL 4L4TE 3LKOA 1E50A 3KLAB 1HESA 1MQQA 3L3IA 2PRLA 3AM8A 1GRWA 3GWJA 3HJZA 3OGVA 4NN7C 1D5BA 1BWWA 5EU5A 2J43A 4E9LA 4Q2ZB 1CE6B 1TUPA 1K8IA 1VZWA 3SE8L 3TV3H 1NSNL 3UC0H 2LAGB 2DT1A 2I07A 3LKNA 3HJEA 4ZOEA 2BY2A 2NNAB 3F2DA 4RDYA 4DEFA 1RIHL 4JO4L 5I02A 2XN9B 2FDSA 3EOBB 3MCG1 5CCGE 4P2YA 1XTLA 1DBTA 3VRLE 4K2UL 2AXJA 3VNDA 4WZHA 3WH9A 1E28A 2FUTA 1J1XL 32C2A 4QXUL 1B0IA 1MJ7L 2KDYA 2JCCE 2PF6A 4N2DA 1SPQA 1QSEA 5FCSH 3WJJC 4PJGF 4UWMA 1I8IB 1ZJBA 3SGJA 3OYXA 3ESUF 5IJVB 1NJ9B 1WBYB 2HZHA 1MXGA 5TTRA 4XAZA 1TRDA 4BKNA 3NQ7A 3EF4A 3RDJA 3V0UA 2GWNA 3OBAA 3RK8A 1NFDF 3KE0A 2HXAA 3PJXA 2GBAA 3GMQA 5E24E 3QIWA 1KYUA 5C07A 3Q94A 3IBEA 2XCMC 3W29A 2YXWA 3VNMA 3NRQA 3ZLFA 4JR9L 3T4AA 1SZRA 5ICUA 4H9XA 2E5DA 5BRZE 3RU8H 5ID1A 2QQ6A 5CUSH 3CTTA 4R97B 3TPUA 4DXXA 2VCCA 4JGDA 2AJZB 4OI7A 5EB9A 3R79A 1P2CA 1OWWA 3GTTA 3WKPA 3D39E 2XPYA 4X8JA 5D7IB 3MRPB 2EDKA 3JV5A 2VXUH 1WG3A 4KC3B 2C9QA 3N29A 4U1LB 4XVSH 1JUFB 4BZ2H 5DY3A 3WIFB 4JQXA 1RH9A 1NC4A 1KM3A 3OVUB 3ROLA 2ZSWA 4M8QA 1CW2A 2GOUA 3O63A 2O6CA 3C5JA 4MM1A 4BD4A 3LY6A 1L9OA 5EN3A 1QA9B 1UG6A 1A6WL 4R5VA 1PX3A 4ZD3H 4D0BA 3EOUA 4WW2B 2WO5A 2V7HA 2DQHL 4FTVA 2AK4B 1IR1A 3SFWA 2R6OA 4D6FA 1UB6A 4F2MB 4F8TA 2ZRYA 4TUFA 3SPIA 1H1NA 1SN0A 2Q01A 4FDWA 3RBSA 1JS4A 3WLWD 3JR2A 2B9BA 4X9YA 4OZIE 3H7UA 3T0VA 5E99L 4LCIH 3WNLA 3LI0A 4DI8A 4N2IA 4PWKA 4NAEB 4N22A 2HK1A 2DQUH 1H7PA 2QKFA 3LI1A 3HW7A 5JDSA 3W6MA 1TTUA 4XOAA 4ATLA 2QJNA 3FXGA 1BKHA 4BKTC 1TUXA 4FQJH 5CKSA 3L17A 2CO6A 3VA8A 3ZQ9A 3B4NA 3RB7A 1QMLA 5GRXG 1MLCA 3TO4C 1KPUB 2J13A 1JPGB 4TRPH 3QO0A 3B9KC 5BOJA 1W54A 4UIKH 2ZOUA 3IUHA 1DVFD 4H9VA 2F7PA 3QEQE 4OIIL 2E3ZA 1JZ2A 5AUMA 5TQ0H 2IBZY 2W07A 2W59A 3LHPH 1DDHB 1S5NA 4G6ML 2OZ4A 5D2NE 2P80D 2YPKA 4F5CA 3M0IA 1OX6A 3KD4A 5E6YA 1AMXA 3BOFA 5FJIA 4A55A 1ISXA 3RO6A 1U92A 4P2OC 3VFMB 3FV9A 1KCXA 3MRRB 3IDXH 1W1IE 1V8HA 1GJPA 4DNHA 3STEA 1HTIA 4HBCL 4QRBA 2ITDB 4O5LH 1XEDA 2Z65C 1J8SA 4JKWA 3BV4A 4J6RH 2GK1A 4NWTL 1IKNC 1KIUA 5D70L 4JHVA 1M68A 1PIGA 1OQOA 3T5WA 3SY8A 2XJ7A 3F7KA 2DP3A 3LKSB 1FNGA 4HMDA 3MZTA 3QEHB 5ID0A 4OV4A 3LIUA 5F2GA 4F7TB 2OWXA 2PTDA 2HE5A 1J1OL 3GSNL 4AWEA 1YNTA 5CILL 2Y1ZA 1RHFA 4M6NH 4JZJA 4NUMA 5IHHA 5IFJA 4ICXA 2DN7A 3P73B 2B3IA 2HNEA 2F84A 2V5MA 5D55A 1E3ZA 5C6TH 4A8LA 1FAIL 1NGYA 4HU0A 4XZUA 3AS0A 4IMLB 2YD3A 3FB8B 3DTUB 1YNPA 2OX5A 5SWQB 2G5BA 2Q8LA 4UDTB 1MH5A 4GZEA 2WHMA 4LHUG 5D6DA 1JN6B 3WQGA 3BO9A 5HJLA 2EAEA 2I26N 5I1EL 1FP5A 3A24A 3N19B 3QUXC 4G7QB 3V5HA 4FS9A 1FKXA 1EEYA 4ZX5A 3DTXB 5ITFA 4AMWA 2Q7NA 4IDJH 5JIWA 2F5BH 1BQUA 4YHOH 5IK3B 4QRRD 3ONCA 4P9HH 3QQ4A 4GRWE 4FALA 1T1WB 4AZCB 3NPSC 2XZCL 1OWRM 3G5YA 3EG9A 1CI1A 2RUSA 1G1YA 2ODOA 5HYJA 4OLWL 1YNLL 4H41A 1CT8B 1V03A 3OLDA 3EMCA 4X4YB 4DGVL 2ZKHH 1DJYA 4AL8H 3IGLA 3GJFA 4LSVH 4O19A 1ZT7A 2Q6ZA 3RM8A 3E49A 2DQIL 2YXVA 3QLLA 3HPLA 2F19H 1NFAA 1B54A 4WI8A 3CHSA 4KDVA 2AQWA 3L4UA 4JFQA 3GR4A 4GEJA 4NM4H 4W9CC 2R0LL 3WX7A 4YS1A 4Y1TA 4CC4C 3QYCA 5IROA 5G1TA 2MCPH 1VPYA 1ZBKA 5JW3L 2WXGA 1FP9A 3CXHJ 4C6FA 3SKOA 1RURH 4BJHA 1IGFL 4L5FH 1F3DJ 1E72M 5DHEA 4U5IA 3CN2A 4EVZA 4K8RL 5I8CB 1CLZL 3LH8A 1GTEA 4QHUA 3BEVA 1R3IH 4DJEC 1FH2A 2FZMA 7FABH 2C9UA 3LEVH 3LERA 4PUDA 3DERA 3MLVL 3AADB 1UD8A 5C70A 5C5YA 1E8YA 4XN7A 1I1AC 3K5XA 3NJHA 3QFDA 4XPGH 2IGFL 5CGQA 3W84A 1RBLA 1KJ2H 5DTFA 1E0WA 2XTJC 3Q01A 3ESVF 2QPDB 4KFNA 3QQDA 1MZRA 2FB4H 1XXXA 4AH2A 5KZCD 5IF0A 3NM1A 4IQDA 3CSFA 2WQSA 1PYWA 2EUVA 2ADIB 1DLHA 5B39B 2AEPH 4RAVB 3GO1L 3T4YA 3RIAK 4XZ4A 4JS7A 3BSMA 3W70A 1KB5L 1FYHB 3CQKA 3WIJA 4B9YA 5KVFE 3MV8D 4BEUA 2R39A 5I3DA 5HDBE 2X6UA 3YPIA 4Y2DD 2BWQA 3VXNB 3SKMA 3OPZL 2JKIS 3BPLB 4LYQA 3THML 2VL4A 4E8CA 3PQYD 5DDHA 3KLQA 1OY3B 1F5ZA 2JALA 1AFSA 5MHSE 1QLRB 2AAAA 1K4DA 3VQMA 3WI9A 5CZTA 1A1OB 4AGOA 1AO7D 2V7NB 2YYUA 4ACTA 4OB5L 2O1AA 3QFEA 2EVIA 3D18B 2VH5L 4RMRA 4O0KA 4XAPA 4TX9A 2ZYHA 2CLVB 3ABZA 1GCFA 4HQVA 3R0DA 4ZQNA 5DEGA 4X42A 4QFUA 4G7EB 1L6GA 3DFYA 5IJBC 4GGHA 3QJHB 3H9HA 3HZYB 2WW5A 2BSRB 1U8PA 2X2YA 1DQML 3P9WB 1CENA 1DVFB 3QJXA 1HSAA 1W1PA 1XGTA 3ANYA 1LLAA 4WJ5A 4PUBH 2KDGA 1XP3A 5FF3A 5CJQL 4MJ5B 1JNEA 4WJG3 1XT5A 3ASNB 2X3BA 3QJSB 4L8SA 4K8RD 1UR8A 4O02A 3T6QC 1I3GH 5CSYA 5E94A 1NGQH 4KF1A 5HHNA 3NGBC 4L48A 1Z89A 4H9TA 3SDCD 3WMLA 3QUMH 2IH8A 3PTDA 3GFUA 1TB3A 1QG3A 3DX4A 1YC8A 1LOQA 2DOCA 2EE0A 1N5AA 1CFNA 5I23A 1GZHA 4H1LB 4XPFL 4B9JA 2YKLH 2RHEA 4HWUA 3ULUL 1MCEA 3CVHA 3NA8A 3MLSL 3U2JA 1UM4L 1NOUA 3UZQA 4WFEE 4JFSA 4HZ6A 2J9YA 4OCLC 4UZUA 4J8RB 1AXSA 3AT9A 1EXUA 6FABH 2F53D 2I1OA 3WEMA 5DJXA 3FDKA 2IDQA 4XKMA 5KSBF 3BANA 3GXDA 5MEQA 2H90A 1S7RB 4PGBA 3VGBA 4DJFC 3ZVHA 2FJHB 4BFKA 5C0JA 2NSMA 1FWHC 2ZXAA 4JQ1A 3GNMH 5JOEA 1RZ8B 5LGXA 4U1KA 3HUJB 2CLFA 5IUSA 1ACXA 9CGTA 3TJXA 1JR1A 3OHIA 4XCEA 5F70A 1MCPH 1WT5A 1BD2D 1MRFH 2E6PA 1NKGA 2AKRA 3U1SL 5GVJA 2WNGA 4FN0A 4HIJB 2G30A 5DMNA 3S3BB 2NOYA 4OAWB 2L04A 1SJDA 3N6JA 2FEEL 2BIQA 1I9RH 2Y6TE 5F9AC 2D7QA 1L9NA 3DPBA 4KWWA 1U8CB 1V3HA 3HV9A 1XBYA 3EEGA 4P5MA 3GS0A 5DLCA 4XP5H 2A7BA 4W9JC 1MW0A 1NCOA 3FQRB 5A3ID 2E6FA 2VC2H 1FLRL 1P7TB 3FW6A 1ZVSA 1MF2L 1GHRA 4QRRB 4YXHH 2PPFA 5C0AE 2C19A 1J0KA 5K9DA 2E7LC 1KBIA 2Z0UA 3BUDA 2I9LB 4AQ8C 1YPXA 3KLHC 3DV6A 5FO9A 4FP8L 4W87A 3AIVA 3QA3A 2DVXA 2XVNA 4OGQC 4X6DE 3BP4A 3Q43A 4D9RD 4NQUA 1VGAA 5AHLA 4NKDB 4NOFA 1U8MB 4UT7L 1FBIL 3O6LL 2OEMA 4HIBA 2DM7A 1CIDA 4MCYB 1F2JA 3QUZD 5F9JA 4ADIA 1IJ9A 4HLZG 3P4MB 4TXVB 1MCBA 3ULUD 1KW1A 5E1IA 4GBXC 4UZSA 3LQGA 2BOCA 3M43A 3WQDA 1JGMA 5LCVL 2Y2WA 3HRPA 5I1GH 3CT7A 1YEIL 4H3DA 2IPWA 1Q6DA 3C4UA 3HFFA 3TFBA 3QY7A 1KENL 2LLLA 1HH6B 5EC2B 2HMID 3HNTH 1XR8B 4OF3A 5AOKA 3ARDA 3GSNB 1EHLL 5AHFA 1JF5A 2EG6A 5E8EA 1LK3H 5LIUX 1HH9B 1OVZA 2X4PA 5L9FA 4YHZH 1E6OL 2A6LA 5HDQH 3HG1D 4ABQA 3VI3B 4KUZL 5IEKA 1KTLB 2R1KA 3F7RA 1TQBC 4JQ4A 2POZA 3AWGA 2OLDA 4FF5A 5GRJL 1P4LB 3WY3A 2DW6A 1J1PL 4AWJC 1GQIA 5IRPA 3BGFC 4JHUA 2REQA 4FZ8H 3OX8B 4YLQT 1XIWC 2H0PA 3GXIA 3HC3H 5KZCB 4WUUD 5D4HA 1NMCC 1ZE3H 5IJKA 3UR2A 1JXGA 3LXUX 1EUUA 1NMAH 4U6HB 4M1GH 3FFCD 1LEKB 3LQZB 3NQ8A 1UZ8B 4LCYA 2NVAA 3MV8B 3H54A 4XD6A 5DMIL 4IM8A 4S11A 4NUQA 4Z1CA 2X1UA 4M5ZH 1KC7A 4Y2DB 3C8FA 1RZKH 1WZMA 2ZKMX 3CC1A 4U1GB 1LK2A 4KJYB 4DW2L 3MROA 3PQYB 2JJTC 2CZ5A 2C1PA 4EXQA 4AVOA 1H1YA 3DFPA 2OTWB 4IFKA 5FJPA 1HKFA 2OW6A 4TNFA 4KX7A 2PCFA 4H2CA 3S8FB 3L3DB 1S9WA 1AO7B 4YU1A 4PRHA 2L7QA 1MDRA 5I6NA 2B7OA 1P0BA 4HA3A 1DANT 4L4JA 3Q4DA 5HYIA 4NQCE 3P3RA 2DV0A 1ZPTA 1BF2A 4PJCB 1JQVA 3WE6B 2MMXA 2YGNA 2R4SL 2NR6A 3CVIH 1FNHA 4AYID 3K81A 1AKJA 1E0VA 4R4FL 2RDUA 3INUL 4N3TA 5JIDA 3R11A 4M02A 1N19A 4FX6M 2XTJE 3MGTB 2QKIA 1NOWA 2DIEA 2KZ1B 4YK4C 1D3HA 3RGBA 2J8TA 4JRXE 4AYBA 2D1ZA 3ZWSA 4KO6A 3PWGA 3O2VL 1TQCB 2Z31C 3GIQA 1F4XH 4CBPA 4YBHA 4AMAA 3GBML 4K5MA 3KXQA 3UZWA 4JFPA 3LOTA 3LNPA 4IOIA 4XOBA 3ARVA 4KIEA 3NPZB 5FDYA 5LNDA 3HS0C 3IDNA 1BZOA 2BO0A 4X6CE 2FX8L 3SDCB 4M3PA 5KVGH 4BFFA 2VM8A 3LDBB 3MCLL 4CADB 1LG1A 4B16A 3QS3A 2NZIA 1MSSA 5K39B 3HRZC 1FQ9C 2WAHA 3F04A 1UWTA 3P0GB 3HTWA 1ZTXH 3GH7A 4LB3A 5CKAA 4MBOA 3WU1A 4GOSA 3VFOA 3IJHB 1DBMH 15C8H 1ETZA 3CM4A 1ZEAH 5A2KH 4BA8A 5JPMC 3JBG7 1Y6MR 1OK8A 5G55A 3MLXH 3ZDXF 4L0YA 2F53B 4UMSA 1ZLEA 1XBZA 1LRQA 1E9PB 4UNTA 3FSOA 1OKEA 4URTB 1OAKH 3HFMH 3SRFA 3L3GB 1F56A 3NSYA 3I7QA 5I1JH 1RI8A 3B0PA 2HG5A 1MCHA 2X38A 4JJ5A 3L68A 4XMUA 1ZWIA 4QTIL 1N8IA 3ASOB 2FKPA 3S3DB 1R6VA 4U6YB 3G1SA 3GG8A 4UYPA 3I3EA 1BD2B 4LAJH 1I8LA 3FONB 4FXFA 1KFCA 4AOFA 2AV1A 3AFBA 5DD3H 1IKFH 5D04C 5SWSD 1T0PB 3BN9D 2YFNA 3F12B 4M43H 1R9XA 1BBDH 1Z32X 4LF1A 3WHXA 3MXWL 4ZFFB 4I9WE 1RUMH 4ZOBA 2VLJE 3P4NB 4OIBA 4JJHA 2FB3A 4BEIA 4GKOA 5F7NC 3STFA 3ALPA 4DAIA 4PCSA 2KKQA 1CX9A 3GR8A 1G7IB 5FGBA 1DIDA 4C5YA 4ADJA 3SUTA 1IAIM 2P24B 1IQDB 4CU7A 3TH3T 4E41D 4ABWA 2WW8A 1WS7A 5HQMA 3HG2A 1JK8B 1LE9A 3GFYA 4RMSA 1COBA 4WRLA 3H12A 2A9MH 1Y8BA 4JKMA 3M7OA 2BIIA 4IBLT 3S0CA 2NPLX 4YCOA 4XBGA 4R84A 4Y7MA 3TOYA 3VQ2C 3BAWA 3AG3B 4ZZKA 1VIZA 4ZPVA 3T6WA 1T8XA 4RGOL 4XH2B 3QUZB 4JPWH 2K3HA 2Y5JA 1UC6A 4OLXH 1N70A 3C9NB 4N4QA 4KZDL 2VW4A 3WFDL 3P02A 4X2RA 2A1WL 3HMXH 4RGMC 2GQ8A 3AWNA 4DB7A 3EWUA 3VNYA 2V6AA 2DMGA 1W3KA 2ALAA 2W60B 2YBVA 2WXNA 1NDYA 5EBAA 4K3DL 3EW3B 3MKCA 4TPRL 1R2SA 1S9YA 2BVWA 4PV8B 4PGJA 2ETWA 2ROYA 5G4HC 4Y9GA 1P1MA 3TAKA 1E4WH 3OV6A 1F8IA 4ELME 4MIMA 2Q2EB 2R9HD 4IMEA 2P76A 3OKDB 2CR0A 1JGDA 3QGVA 3JWDL 1VEOA 2XZ7A 3QPQC 4Z76B 4G59C 1H9DA 3SBPA 1UENA 3K2UL 5EPMB 3V0JA 4HGMA 4PWJA 3FVDA 5AW5B 2BX5A 1ND0A 3HG1B 4BH8B 4RNRB 2BOFX 1GQNA 3EPOA 3UDWA 3AB0C 1CVSC 5D5MB 4HEPG 2GLKA 1B3XA 4XNZC 5KYUB 1XG4A 1FCQA 1JPSL 2J1ZA 1O1HA 3RM4A 2W4XA 1GOIA 1H4PA 1REQA 2MQ0A 2QCNA 1KIQA 4YHGA 4WUUB 3TWCL 5FA3B 3C75A 1LD9A 3L65A 4S1QH 3RUGE 1A6AB 3GHEL 4KRNA 4XAFA 3V6FB 4OU3A 3NXLA 3FFCB 1YNYA 3PBMA 5FEXA 3VE0B 1ZT4A 1ONWA 4POYA 3KLLA 2AI0H 5D4YA 3VC6A 4N0RA 1CFSA 4XB8A 4M62H 1O5DT 2R83A 4LEOB 1V5XA 4M6PA 5HDOA 1EERB 5BCAA 4PRTA 4ANUA 1U3YA 5CD5D 2ZWKA 4G6AD 4NFCA 2F74B 3KBVA 2OP4H 4NZRH 4PLJC 5F7DB 1DQDH 3S3JA 1JHKL 3G04A 5DJ0A 1QXLA 1TT6A 1H5BA 4HWBH 3A12A 4XBKA 3DFHA 4WKXA 3BXNA 1OT1A 1TZAA 3CFEB 3L9CA 2AQTA 5ICYA 1NU5A 3NDYA 5F1OB 2E9MA 4RSVA 1BLIA 5E95B 4KBPA 3UJJH 1W8GA 1OCWL 3IXAA 5LNEA 3EJYC 3TBSB 1QQDA 2UVEA 5L2KA 1B4KA 3LCIA 4Z2LA 2C6QA 1EX5A 1QFEA 4PTUB 3IFOB 4YEFA 4LF3A 1GYCA 2KHAA 1CBVH 4P46D 4OM0H 5K9JH 1PZ2A 5I18H 4RX0A 1Z6KA 1KLGB 3IF1A 3EAUA 2YRLA 2AMUA 3MSYA 1NCBH 3DX8A 4B15A 1PVHA 2HTKC 4DN4L 3F7LA 4PJGB 1HHIB 4JFFD 1R4XA 1L9QA 2NY1D 3GHBL 3H2WA 5TQ2H 1XGDA 3PHSA 5TH2A 1HL2A 3MYJA 3O06A 3RLVA 1HHKB 1VHCA 3MWCA 2C15A 1NFDB 1DEDA 1EJRC 3TSDA 1IL1B 1T1XB 5LAXB 1L6ZA 2CM5A 1SFDA 3LEYL 4ALDA 5C0FA 2R2EB 3O4LD 5AWNH 5AOMA 4HU2A 4XN9A 5A94A 3VFSA 5FYKU 5J56B 2ZCHL 1L6YA 2GI7A 2I60H 3VD9A 1LDPL 2X4RB 4LGRB 2G2RB 2V17L 1DTUA 1VFMA 1XIFA 3JTSB 5D7LD 1U3HA 3HQPA 2C7UB 4M61B 4YGAB 3NO3A 1YBQA 4MJIE 4MLSA 2Z93B 3ULVE 3WFEH 2IANE 3FQWB 4HJGA 3CHXA 2YC1B 3P9LB 5DJ8A 2NV2A 1AYOA 3KWWB 2OQYA 3H26A 2BPBA 1KN2L 4XRCB 4O1BA 4W9KC 2GJJA 5EOCJ 3AZSA 5DY2A 2Q2LA 2OTDA 3EDDA 2XZAL 25C8L 1IEQA 2CE6A 2P8CA 3LVEA 1UEMA 5SWSB 4DBEA 4QTFA 2NY4C 2JI1A 5J89A 2EEBA 2XVBA 4ZZ9A 1M4KA 1M04A 2I5IA 3MV9A 2FJGB 4YWSA 1QW7A 4PP1C 4QXGL 4ZMNA 5AVYB 4M6OL 2GK2A 3CFDA 2YDRA 4GXMA 3MRJA 3N6HA 4TLSA 1J12A 5D96B 5F88B 3QZNA 5F4WA 3FA3A 1A3LH 1K8DB 3V4UL 3V5CA 1YPFA 4X7TB 5IM7B 1GYUA 3LKPB 4QIRA 3DC0A 1W17A 3T0TA 3IVKA 2VERA 1FBAA 4E41B 2HISA 3EX6A 4M7KH 5F6HJ 5GS3A 3L7RA 5EZJB 4CCEA 5GGSA 4N25A 1RHHB 5K9CA 1KLYA 1TPEA 3ABXA 4IIQA 1GH7A 5I66B 1MIEL 4NGHH 1BWLA 3EX2A 1HDMB 4LOVA 2HNHA 3T2PA 4NO0A 3BCJA 3SEPA 2J88A 4UXDA 2OK0H 2BVQA 3ITCA 4EUPG 4PC8A 2WKLA 2BK8A 2QZ5A 4UFLA 4JRFA 5D1XA 2A6JB 4LCCC 4EOUA 2OU4A 5EZLA 4L4VA 4M7ZB 3GRGA 3UJIH 4OF8A 2Y36H 2XWTB 3KNBA 4ZFZB 3LCHA 4TSBL 5KOVC 1AANA 1FVEA 3F62A 4BHUA 1K6QH 4JQ3A 3HO8A 1QK2A 4RL3A 2C3VB 2R69L 4AEIL 1BMGA 1FH9A 4I18B 5H2BB 1CGVA 2RFGA 3L4VA 5K9QG 4EQ3A 5JO5A 4K7VA 1EWHA 2X2UA 2GABA 2OJZL 4OSUH 4XCNA 4JFOB 1DE5A 2FJFB 2WBJC 1O5XA 5H4YA 1FZMA 1MEHA 1OTTD 1MHHB 2EPNA 3RZCA 1I85A 5L2JB 3PHQA 5XINA 4MY9A 4ICCX 1CD1B 5DFVC 3P11L 1FJ1A 1ORSA 1EAJA 4LU5L 3Q67A 5IVNA 4RFNC 2FGLA 1M9SA 2VAAB 4QEGA 4Q7NA 4MSWA 3BZFA 4AQ1B 3VSTA 2W5FA 3FOLB 4PCPA 3GRWA 3UXAA 1SXBA 2CBPA 1IEIA 2E7BA 3EYQD 4HS3A 5CCKL 4KK8C 1RZFL 3VNJA 4XXDB 2RDWA 5E2WH 4LSQH 2WNKA 1EHNA 1PLCA 1F4YH 1GL4B 4N0UB 3DO7B 2PYEA 2PBGA 2Y62A 5HPOA 1NY1A 3W0WE 3K1KC 3ESOA 1T66D 2FB2A 3CT2A 5IB4A 4R90L 3BGAA 4F24A 2FIRT 1FNAA 2ZUQB 1EOMA 1G6RL 4L2YA 4I1NB 3GSMA 3UT0A 4N2NA 4WKZA 3TZVA 3VFNA 1S3HA 4NAMA 4ODVL 3D3FA 4Z3FA 1CNVA 5A6BD 3FQ2A 4PJEA 1OSPL 4F3FA 1V7YA 3MCKA 3G08B 3JZEA 3ZU8A 1P9MA 1A6PA 2GIMA 2WUCL 2X4OA 1TQXA 4NQQA 4JN7A 4MDPA 3DOIA 4WUIA 3FCGA 1E9YB 2A7NA 3Q6FB 3WN6A 1GS6X 1UVQA 1AC6A 3CMGA 3ZM8A 2IAMD 4F8QA 5EO9B 4Y4FC 4P61A 1FNSL 1BDYA 3P82A 3MKGA 4GO9A 1TZIA 2ESCA 4KWVA 3B8YA 5FB8A 4P46B 3AQYA 1CICD 5DUPH 2ZQ0A 2GC4C 1EPFA 3QUYC 5C0IB 2FLBT 3ESPA 3SJVD 1N67A 2VSKB 1R3VA 3LPGA 3REVA 1QR1B 3DSNB 2RH9A 3W87A 1C5BL 3RJOA 5DJCB 4A7TA 4JFFB 2YL9A 1QO3B 2D22A 3DNKA 1QSZA 5JNYB 1QDSA 4G9DA 3S9DB 5G4EA 3XINA 2NY1B 1G4SA 4L3ED 3Q1EA 1NWSA 4XT1C 3LHUA 5DUBB 5LNSA 4EMZA 5BNKA 1A9BB 5ESAA 1OX4A 4N0YL 1T0NB 4C91A 4HX1A 3CFQA 4N87A 4XP4L 5EOTB 5H35A 3KJ4C 4A1RA 1J93A 2E3VA 3PZNA 4FFZL 3O4LB 1UMLA 4G6CA 4WXZA 2L3BA 3OG2A 4O58H 2VABB 3DUUA 3HB3C 3CH1A 1A7PH 1T3FB 5F7WC 3EDJA 5D4JA 4P5KA 1SDYA 1N6QL 2YGQA 4H00A 5D7LB 4X5XB 3OKMA 3EWBX 3BG9A 3EXSA 3NA9H 4M7JL 3M0KA 5EFFA 1VCFA 4WIWA 4HYVA 2ZWLT 4OWGA 3FHAA 4JVWA 4G7SB 4DKAA 3KOXA 1G84A 3LV6A 4HISA 4NJIA 1Z6JT 2NUWA 4MRCA 4KWOA 2VZ3A 2G5RA 2YAFA 3PUEA 4YSDA 3Q48A 4GRLC 4HHPA 1I9JH 5ETUA 3SBWA 3IFNL 3F65A 1MQKH 2EYSB 4KI5E 5C0CA 2ESVE 3KCJA 4DP5X 5FYLE 2Y5TB 4LTSA 1UKQA 2CJUH 4GMSL 3N9GH 5CBEB 5T8GA 2ZF9A 4K71C 3WFCH 3IDIA 1P5VB 1GJUA 3DMMD 1INDH 1SVBA 4GC4A 3A3YB 4Y9CA 2HFGL 4NNPH 1A4JA 1WC7B 4IOFC 1PKQB 4D8AA 3O3RA 1RIVL 3K8MA 1LO2H 2YQ3A 2OL3H 4LUYA 1CU4L 1H3UA 1KCVL 1IT8A 4B0MB 2WXHA 3PN8A 1SJEA 3LCGA 1OYAA 4NZFA 1MVUB 4NKOB 2XN1A 2V6HA 1UYWH 5INCB 3K6DA 3PY9A 5BUAA 1MCQA 2BGQA 4ELKB 3GMLA 1OF2A 3IS4A 1BXXA 1YDPB 2G97A 3IJIA 4AZGA 5ALCH 5I76B 2GYSA 4FQXD 3WXVL 4WTXA 3S37L 4NZ5A 1GMEA 1WDSA 3V9CA 4Y16C 3UGUA 4F8XA 1A3RH 3HE6C 1NDVA 1W6LA 5J06A 1QRNA 1LXMA 3RURA 2Z2AA 3QNXB 5FM5M 3HN8A 3RGHA 3G1FA 3LKRA 3HM7A 1EC8A 2ZOWA 1MFUA 5C0QA 1OZQA 2CU9A 1A0QH 1A3WA 1TMHA 2OQJB 1W6WA 1F58H 1IZKA 5IW6B 1IC4H 2V38A 1GYVA 3FCUB 2R15A 3W7CA 3JZUA 1MNUH 3GBEA 3O3AA 3TYBA 2WQWA 2E46A 1FH5H 1LDCA 1UH4A 4PSRA 4NC1E 3B5TA 5KSBB 4UOZA 1QLFB 1D7DA 1XCWA 4NHUB 1RUPH 4R26L 3QNYB 1GZPA 5IMKA 1BVWA 2PLMA 3PWPD 4NNXB 1FY6A 3VFGH 4AVIA 1X5GA 4I77L 3SE6A 1S7UB 1HNYA 4PWIA 1BQSA 4JO5A 3H7BB 3AU1B 2WTRB 1K1DA 1QR7A 2Y7SA 5F72S 4PRPA 4N8CH 3GSRB 1LTXA 1F4AA 3N2JA 3GW3A 3GYEA 1NP0A 4E0CA 5J1AA 4QCIB 4Z1AA 3L95A 1O60A 1FWJC 2HUEA 2XYLA 5AZ0A 1JYWA 2OMWB 4ZT1A 4OFVA 2IXUA 1XBXA 1MCOL 3WO8A 2XPGB 3LNIA 2G3XA 5IHWA 5B1AB 4JFXA 1RLWA 1HEHC 2XQYA 5J6SA 2ATSA 1E30A 5PTDA 3L3KB 5GS2D 2ABBA 3I6SA 5E9AA 1QJWA 2ZRUA 2RDTA 4P5TD 1ZIAA 1KTDB 2IPKA 3M47A 4XVDA 1OL0A 4O0QA 3BZ4A 3ETSA 5EH1A 4I2XB 3J27A 1N4XH 2H1PH 5E0KA 4GAYB 4C6NA 2J1KA 1BFOB 1A8JH 3VUSA 3ERPA 1VBHA 3R7RA 2IAMB 3T6ZA 5C09A 1YEKL 2FZ8A 1UR2A 4KVPA 4P8VA 4KPHH 2CU0A 4AD2A 5JA8B 4QF1A 2EEDA 4Z5RA 4C83B 4Z7IA 4ZB5A 1CLCA 1NCIA 3GXMA 1VZHA 4GH1A 5AW8B 2OR9H 3TX4A 1CICB 4D7PA 3F2BA 3BZJA 3MRBB 4ZTOH 1WEJH 4S3BA 3SUVA 5HDLA 3UWYA 3SJVB 4JFED 1AJ7L 5KYXB 1C8VA 2OGJA 4OGAC 4L3EB 5C08A 3RU8X 3QWOB 4HQQL 1PKOA 5CEWA 1LLWA 1D5MB 2Z4QB 4UILH 3PGDB 2CZNA 1FHGA 3BVVA 3KPOA 4L8DA 5GGRB 2EIDA 4XC1L 2VLRE 3PU7A 4GI6A 5IOPB 3SPCA 3KPRA 3RY6C 3N40P 1WKEA 3ECVA 3C6EA 3F85A 4DN3L 1UT2A 1AGEB 4O2FB 4PEKA 1JZ8A 5FHBL 2PU1A 5AD0B 2ICEB 5CSZB 2WWCA 2XVLA 2OLSA 1HL4A 1PW3A 2N7AA 3CNYA 3GR7A 1TCDA 1L5GB 2BWIA 1WWBX 1NUGA 1QWUA 1T83C 1U8JA 3P14A 2X1IA 3QQXA 2AAVA 9XIAA 2DY3A 4HFUL 5EO0B 1OHQA 5HJBA 2NSQA 1SLXA 1XYAA 1P4IL 2HN7A 4NU7A 2J1WA 4KFOA 3WXWL 1G6RB 2PO6C 2IBZX 4JTHA 3S7GA 3G1VA 4GI8A 1J9YA 1OC7A 2YJLA 3RNDA 1LM8V 3UEQA 1A21A 1GZQA 5BZAA 1QPXA 4OZOA 2WNXA 5J12C 3DMMB 4PSPA 3TEXA 4F7EA 1FUNA 1UJ3B 3TASA 2I24N 5IB2A 5AYUH 4OGYH 1X1ZA 4TN9A 4JFZH 1ES0B 2H2PD 5EU3B 5I75C 2RKXA 3FTUA 1IHIA 1E40A 5HR6A 3GNDA 3GSVA 1T89A 4U3HA 4G8FB 1OGTB 2VQTA 3JT2A 2DL2A 4YL2A 4OCYL 2VDHA 4ZUUB 1JFQL 4UYQA 1BYAA 2R94A 4EE2A 3UYPB 4K94H 2BOLA 3N43F 5J3HD 2ZIDA 1R34A 3JWOH 4MVBD 2GZXA 1AHWB 2BP1A 4WI6A 4KK5D 4JN1L 4AKQA 4GAGH 4FQXB 3B2PA 2DTMH 4WFGD 3ILQC 3TCTA 2FVKA 2PLCA 2ED8A 2CUIA 4ELDA 2IMMA 4AD4A 3L4YA 5HYSB 5EWIL 5HY9B 4LLMB 4EZKA 2RA1A 2DBJA 3NQ2A 1LO3L 1SJCA 4JTLA 2GJXA 5LXVA 2OX1A 5DUML 5ACLA 4MCMA 4DP4X 3NQEA 4MDOA 2ISDA 4LLYB 1P84K 4WIQA 4O8RA 3QO1B 3UBPC 3Q8BA 4U28A 1JV2B 4Y1AA 3FQNA 1IT9H 3ZGIA 4FX5A 4LOUC 3EIFA 1XPGA 4U3XA 5JHMA 3BCFA 2XSKA 1ESWA 1E8ZA 4OUOA 3OOQA 3HI5L 4P7OA 3H8AA 3S88H 4HUWA 3B9NA 3LZOA 2PDYA 3IXTA 1RZMA 3TYGH 4EOWH 4IOSA 1WAAE 3W37A 3BW2A 4K7PH 1E6SM 3WLQA 1A4BA 3NCWA 2PP1