1QPKA

Mutant (d193g) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFGFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MALTOTETRAOSE-FORMING AMYLASE)
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 145
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qpkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qpkA01
2JFEX 1JL8A 1ECEA 3W38A 5IHRA 1B3XA 2YOCA 5C8BB 3BSHA 4JKMA 2UY4A 5D9OA 3VD5A 5I0DA 3T2PA 1CTNA 1A47A 1QW9A 4JAWA 2J78A 4GZIA 4UR9A 2WMHA 3WNLA 1V3KA 2X0YA 1MFVA 1H09A 1HL8A 1ISYA 2JE8A 2CBUA 3K8MA 1HN1A 1AQHA 1XH1A 2C7FA 4AIOA 3VIIA 4W85A 7A3HA 2UY5A 4Y7EA 5CPQA 4JFUA 1VIWA 1GQIA 1CLXA 2XIIA 1C7SA 2DSZA 1UH2A 4N0RA 2CBIA 4M81A 3CV5A 3VGFA 3THCA 4LX4A 2WKLA 3PZVA 5D9NA 3OGSA 1C91A 4GI9A 3WF0A 1GQLA 2E0PA 1PX8A 3ARTA 4C7FA 5E70A 4N42A 1EOMA 3NCOA 3GTNA 4TVCA 1QPKA 3BUBA 3H55A 2W92A 2YDQA 3G6LA 3WIJA 4W87A 3WQ8A 3QHMA 8A3HA 4DO6A 3POCA 2ZIDA 3SURA 4FNRA 5GNYA 4CU7A 4ZENA 4J3VA 3AXHA 1SR0A 4MJ4A 2XVPA 3ARSA 5A8MA 2O9PA 3AIVA 3A3HA 4MADA 2CBVA 3DHUA 1TFVA 3PZIA 2GSJA 2W61A 3HG5A 1WCGA 2CEQA 2J7EA 2VCAA 4B3KA 4CGTA 3WL0A 3MMDA 1JD9A 4AZCA 4MB3A 4GI8A 1GOIA 5BXTA 4E4PA 4NZJA 4BQ4A 1HL9A 3WMSA 5GNXA 1TVNA 5CXPA 3OGRA 3A4AA 1PX4A 3E1F1 1GQJA 1UR4A 5I77A 2FE0A 3EBVA 4WKHA 2VJXA 5HPOA 1QNSA 1V6UA 3SCUA 1CDGA 2A3HA 3PHAA 1AQ0A 3FY1A 2FGLA 1PS3A 3BAJA 1EDQA 3BLBA 3BUPA 3D50A 3ZJ7A 3AMLA 3WF4A 3A24A 2OYKA 4JCMA 3K4DA 2XWEA 3VDCA 3WD3A 4NF7A 3U7BA 1M53A 5A8QA 2WCGA 3QR3A 4AEEA 4P8VA 7CGTA 4FNSA 3VTRA 1E5JA 3ZJ6A 4MTVA 3CBWA 5EFFA 4NX0A 4HU8A 1CEOA 2YDRA 4W89A 5CZKA 3N17A 1W3HA 3QOMA 3WD2A 3O9NA 2VZOA 3ZOAA 1HXJA 3FNDA 3EDJA 1R46A 4BF7A 1W9UA 1H2JA 1G94A 4FMVA 2J8FA 3LPOA 1HKMA 5CLWA 5DFAA 4PTVA 2VRQA 1NH6A 3AISA 1E4IA 3AS3A 2ZX8A 1UQYA 4DUXA 1B31A 4ACZB 2WC7A 3CZGA 1GW1A 3RPMA 5CGMA 6TAAA 4HTYA 3AROA 3WQ5A 2FHCA 4AEFA 1KWKA 4QLKA 4ZEPA 1KGXA 3DX2A 4HZ6A 4GO8A 1V3HA 4TVDA 2J7CA 1UUQA 3KZSA 2V3DA 2OWWA 2D24A 4L4PA 1HP4A 4W93A 1UKSA 3VMPA 3W53A 1T0OA 2EAEA 4BQ2A 3OLIA 4J3XA 5CSUA 1UWRA 3SCVA 3ZT6A 4V2XA 1QX1A 4JFVA 1KQYA 1W9PA 3IAQA 3MI6A 3SIMA 2Z1SA 3VIHA 2J7GA 4MAZA 3PN8A 5M17A 2ZX6A 2QPSA 4PCTA 3NIYA 1BFNA 2X0HA 3SCNA 3BVVA 3AIQA 3KL3A 2NT0A 2EQDA 5HNNA 3WH8A 2G8ZA 1VF8A 1NWTA 1OGBA 4KMQA 1BYDA 2DIJA 2PF0A 3LXCA 3W6LA 3AMCA 1XD0A 2DQXA 3NYDA 1B2YA 1CGTA 4D6CA 3MKKA 1WP6A 3JUGA 1HKKA 4AIUA 1OWQA 4P7NA 3KWXA 4P7QA 2V3EA 5BXPA 1BSIA 3WUFA 3CO4A 3T08A 5HDRA 1EO5A 1GZJA 4MJ2A 2BVTA 3UR8A 3GH7A 1W3JA 3WD0A 2BY0A 1ITXA 1ZBCA 1E4NA 5D4YA 2CKSA 1GUVA 4D6FA 3QHOA 4OIFA 2G3MA 2XVNA 1LJYA 1C90A 3K1DA 5CPSA 1EDGA 3AMDA 3MUIA 3AYRA 3THDA 1XCXA 2B31A 1TMQA 1CXFA 4B9YA 2GDUA 1JG9A 1V3LA 4XX6A 1C7TA 1E0VA 3SUTA 1H11A 1E0WA 4DO5A 1GOKA 2OW6A 5A95A 3CZJA 5JBFA 3WY4A 2VOTA 2IUZA 4FNPA 2YKKA 1I75A 3L4WA 5A6AA 5A6JA 1BPLB 1SFSA 3SCOA 4ATWA 3WFLA 1HIZA 2BS9A 3A21A 4FLQA 1K9TA 3MV11 3ZSSA 1EIBA 2J77A 1V3MA 4D6DA 4YN5A 4XB3A 1OB0A 3BUDA 1KWGA 1E6PA 1H5VA 2VCBA 1UD5A 3VU2A 2WMKA 1JNEA 3CZ8A 3L4ZA 2Y4SA 3ARWA 1UD3A 2PC8A 4ZXOA 5EBAA 2EPKX 2ZXBA 1NP2A 1V0MA 4U2YA 2XUCA 1BLIA 1P6WA 4JL1A 1GVYA 3WENA 3VD7A 4CN4A 4AMWA 3AXXA 1UD6A 4W8LA 3TV8A 1JFXA 4M80A 1J9YA 1HJXA 3ARYA 2WVVB 2YDSA 2DEPA 2ZICA 1H3GA 4D6EA 3BUQA 2CETA 3HG3A 1GONA 3II1A 3GH4A 3T0BA 1EDTA 4P8XA 1PJ9A 1B3WA 4TTGA 1O6IA 3WH5A 1CXIA 4PUEA 5CQ1A 1VBUA 4K68A 4P7RA 2PWDA 3OLDA 2WKGA 1VBRA 3CHCA 1BYAA 1JZ8A 2WZIA 1H4PA 4GQRA 3UESA 1CLVA 4X9YA 1BYCA 4CU8A 3NUKA 3PBGA 1CXKA 4DWSD 3WL1A 2VR4A 4B16A 4NZCA 2C0HA 1CGVA 1ZL1A 1UKOA 3SCSA 4ZFMA 5A8PA 1QI0A 4PSRA 3EDDA 3MUAA 3RM8A 4AIEA 3LRMA 3W81A 1QNPA 3HJEA 2Y8KA 3WY2A 4H04A 1UOKA 3A4WA 3VX1A 2WSKA 5E0FA 3AHVA 4HZ7A 4AD4A 4XZBA 2D22A 1W9XA 4GQQA 3POHA 2JEQA 3EMZA 1O7AA 1J01A 1UWTA 4CCCA 4AD1A 1VFMA 2IGTA 3BUIA 4UNIA 4URIA 3UR7A 1CNVA 4DO4A 4D6JA 1QI2A 1RH9A 3AJ7A 3FHQA 1MXGA 4IPLA 1KFWA 1UWQA 3PTMA 5BRQA 1MW2A 4U3CA 1NOUA 4EANA 3VDHA 3FXYA 4Z2JA 4UZUA 2WW5A 2E9BA 3CUIA 3VPLA 4Z2IA 1E5NA 1KCKA 2FHBA 2D20A 3BSGA 4J3WA 2WMIA 3D52A 3RMEA 4WJXA 3TTOA 3FN9A 4CN6A 3ECQA 1GOWA 4PMYA 4FLOA 3WQ4A 1FH8A 4HU0A 3GXTA 1ZBWA 3AICA 1GOOA 4UOJA 1J10A 3LX9A 1HKJA 1ZJBA 4UZSA 4AYSA 1UZ1A 3BVWA 3HG2A 1XD1A 1W1PA 3UCQA 3TONA 2G3NA 3T2QA 5CPTA 3APGA 2JIEA 1KTBA 2WWCA 5DF0A 1UH4A 5EB8A 3WF3A 1A3HA 2VC9A 1UKQA 2XYLA 4NXSA 1M7XA 1FH7A 1J18A 2J62A 5AYBA 1ITCA 2BXYA 4HMCA 2ZUUA 3SEPA 2ZUNA 3OGVA 1FFRA 5IXEA 4JL2A 1FP8A 4QDMA 1CECA 1ODUA 2GK1A 3BVTA 2E8ZA 2V38A 4OBSA 1MWOA 3WDQA 1M01A 2J7HA 3B9AA 4V28A 1JZ6A 2WMFA 1UWUA 2CIPA 2BVYA 3GZAA 1PIFA 1UR2A 2OWCA 1HJWA 1JDCA 2E9LA 4UFHA 1J12A 1U33A 1JNDA 3VDAA 1GJWA 4AD0A 3I3EA 1UWIA 4LQ1A 5AC5A 5A6BD 2WXDM 2DSWA 3TOPA 2IXVA 3VNYA 1FHDA 4AZCB 3OBAA 1KBBA 2DSUA 1HVXA 3VD9A 4JZ5A 3K46A 1FH9A 2EABA 4PTMA 3DX3A 1KR0A 4OOZA 4W8AA 2F7OA 3BC9A 1W1YA 3AZSA 1B3VA 3ZMRA 4Z2LA 1JYVA 3A22A 4KGJA 2WMGA 2YIHA 5GNZA 5BCAA 4HPGA 1JZ3A 2AAAA 1U30A 4GXPA 3WELA 5IDIA 5ABHA 4ZXLA 3GH5A 3VM5A 1IV8A 3LMYA 3SCPA 2WC3A 1HJQA 4UFLA 3VOCA 4TX8A 3AHTA 2XPKA 3BXWA 1MW0A 2J25A 1CZ1A 2J7FA 4JFTA 5M3WA 1JGIA 1GPFA 1IT0A 3VIJA 1OD0A 2VZVA 3K8KA 4DM1A 4AC1X 3VILA 1K9DA 4PMZA 4CD8A 1R75A 3AIEA 4JKKA 3WDRA 5I23A 4D6GA 2BXZA 2ZUSA 2DH3A 4WKAA 5F7UA 3DHPA 1GHRA 1K6AA 1GVIA 3BVXA 3EDKA 1NWRA 1FOBA 1LWJA 4OBRA 1PX3A 5HBFA 2BY2A 2WYSA 1QWNA 2OLHA 4AZ6A 2IXUA 4E2OA 2QMJA 3VGHA 3VMNA 1FHLA 1H49A 2XIBA 2WK2A 5I6SA 5IFPA 5JIWA 5A6KA 3OLGA 1ISZA 4AZIA 2XFRA 4U31A 3AS2A 1BGAA 1UD8A 1X6LA 5I78A 4FNQA 2OYMA 1H0IA 2EPLX 3IANA 3GXNA 2W91A 3A4XA 3BAIA 1V0KA 4OZOA 2WM0A 1R85A 3M07A 4MDOA 4UQ9A 3NSMA 1MFUA 2F2HA 3WQVA 1SMAA 5BXSA 6A3HA 3DYOA 2EO7A 3W26A 4C7GA 3AFBA 3ZM8A 3RO8A 2O92A 4B15A 3ZJKA 1W2VA 2D0GA 3BAYA 4UFIA 2ZWYA 4UQDA 3VUPA 2FHFA 4LPCA 1CGYA 1G1YA 4TVUA 2Z1KA 1E3XA 2EADA 1E55A 4R5EA 2OYLA 3BH4A 2PBGA 3RJYA 1BVZA 1GCYA 3N18A 3W82A 2OSXA 4CUCA 4PEEA 3VO0A 4MDPA 4WK9A 1UD2A 1JAEA 1E73M 2YL8A 4LGXA 1NP0A 1MQRA 1JDAA 1E72M 2NSXA 1MXDA 2CHNA 1ZB5A 3ARRA 1WDSA 4WIWA 4JCLA 3WUGA 4GPNA 3ARXA 1B0IA 1Y7VA 2WB5A 1QNOA 4P7LA 3PZNA 1CGWA 3CLWA 4CKQA 3HG4A 4HA4A 1J0HA 1C8YA 3CMGA 2DIEA 4W7WA 1US3A 5C70A 2F18A 4H2CA 3WNOA 2CITA 4CVWA 3DX1A 1FA2A 1H41A 2WHKA 2PWGA 5ABFA 3WDIA 5DT5A 1I1XA 3ZQ9A 4BS0A 3SCRA 3UG4A 3ZIZA 4CCDA 3S5ZA 3EJRA 4E8CA 2ZXDA 5DO8A 2F61A 5CG0A 3SCQA 4LXFA 1V02E 2YLAA 4GI6A 4AWEA 4P8UA 3MO4A 2OWXA 2GDVA 2J7DA 1QHPA 1ESWA 1B3YA 3IAPA 4TXEA 3CZKA 5DMYA 3GXPA 3D4YA 1MQQA 2ALWA 1KB3A 2VRKA 2EJ1A 4JHOA 3VKKA 2Y5EA 4D6IA 1M03A 1V6VA 2ZXAA 4UOZA 5E6ZA 3GXIA 5A6LA 2YA0A 3M46A 1V0NA 1V02A 2WWDA 4MPKA 4PMUA 2CCRA 1EHAA 5HOSA 3ZSTA 4HP5A 4QCEA 2ZUVA 1KBKA 3WD1A 5M03A 5KZ6A 2ZX7A 4IM4A 3I3BA 1DWGM 3B9DA 4KRUA 2PI6A 2WZEA 4WSKA 4M56A 4PRWA 2PWFA 2YL5A 3D5HA 3VMOA 4EAMA 5FKYA 2WSPA 4AYGA 4EK7A 2CYGA 3CPUA 3B9EA 2WC4A 1ZJAA 3ZO9A 5A3HA 1KXVA 4S3KA 1CGUA 2D3NA 3AHZA 1MVYA 3DX4A 2E8YA 2VQTA 3W4RA 3D3AA 4M82A 1QHZA 1O7DC 1WZMA 1B9ZA 4RE3A 4D6HA 1VJSA 2FGZA 1VB9A 4AW7A 1F4HA 4U2ZA 2QPUA 1PBGA 3CUJA 5A6SA 3RILA 1OM0A 3BGAA 2BHZA 3O6AA 1R47A 2WLYA 4TX6A 1PIGA 1OSEA 3VM7A 1CBGA 4PMRA 2XN2A 3KLLA 1R8LA 5FOOA 4WKFA 1OIFA 3PTQA 3AZTA 1HT6A 5CSYA 1LF1A 1G0CA 1MYRA 2AMGA 1ISXA 2WVUA 3N12A 4U33A 1MW3A 1SYTA 2XGIA 5LA0A 1CWYA 4M29A 3VIFA 3CIVA 1Q6EA 3BMVA 3H53A 1J11A 3IK2A 3LXAA 1TQSA 1H0GA 1W32A 4PMOA 1D3CA 2J47A 1HP5A 4H41A 1KR1A 1K9FA 3N11A 4ATLA 7TAAA 1OCQA 2FDMA 2XTKA 4PYSA 1WZAA 4AZHA 2RGMA 2VMFA 2GUYA 1UKPA 4KH2A 1JZ2A 3W28A 1XC6A 3PTKA 1JZ5A 2XM1A 1E3ZA 2EPNA 3U7VA 3GNOA 3HN3A 5LYRA 2XM2A 3BLKA 4ZE5A 1TCMA 1IZJA 3OZPA 4AD2A 4ATDA 1QI5A 2E40A 3SUUA 5CJ5A 1NARA 3SUVA 4U5IA 4AD5A 1EQCA 3MSGA 2C8NA 4JKLA 3T2OA 3OB8A 3O2LA 2YBTA 1UKTA 1CXLA 2V5DA 1CENA 4GZJA 2D1ZA 3U5UA 3WMCA 3N9KA 2X2HA 3W27A 3WY1A 2WBGA 4PBGA 1WKYA 5E0CA 4L4OA 1LLOA 1ZU8A 1XH2A 2DT1A 1R33A 2CHOA 4UQEA 2WHMA 1QVBA 4JIEA 4TOQA 2WMIB 3WBEA 1E6NA 5I2UA 3AQUA 1QW8A 1AQMA 4MB4A 1KCLA 1NWSA 3L4XA 2E3ZA 2XN0A 2DGAA 1BG4A 2J4GA 3M6DA 3T09A 2XJ7A 1OD8A 2X1IA 3DDFA 4H8VA 3WNNA 3F4VA 1TR1A 4E8DA 1YHTA 1E4MM 1XSJA 3N15A 3TTSA 1KXTA 1SZNA 1QI4A 2YLLA 4B3LA 3MUY1 4M24A 4D72A 4FNTA 3HU7A 2W63A 5ABGA 1WE5A 4LYPA 3UETA 1UG6A 2DDXA 4A3HA 2MANA 1N82A 1V3IA 1HTYA 3LPGA 1Q6GA 1JYXA 4AXNA 1XV8A 3K8LA 1HX0A 1LWHA 4GIAA 3GYCA 2J7BA 4RL3A 1E56A 5M5DA 2UY3A 4CU6A 3AMKA 2XVKA 3HZ3A 1K9EA 3GDBA 1U2YA 4J27A 4W86A 4A4AA 3DECA 1Q4NX 3ARQA 4F9JA 5AYIA 3RCNA 2WHJA 1DWHM 1R86A 3MANA 3L4TA 2XSBA 3WH7A 3NDYA 2X8RA 2J74A 1GOQA 2GK1B 3PZUA 3DYPA 4PMVA 1LQ0A 2XFFA 1JI1A 5E6YA 5E9AA 2OSWA 4MB1A 1G01A 1JDDA 4H8UA 3A47A 5DT7A 2X2IA 4CN1A 1UWSA 2VX4A 2VQUA 3SUSA 4Q7NA 3WNKA 2WPGA 4AZ5A 4RE2A 2A3BA 4IISA 4MNLA 1WAWA 2W5FA 4W8BA 2E9MA 3D51A 3WFZA 2EEXA 2CERA 4HMEA 4V27A 1IZKA 1DWAM 3VIPA 4D1JA 1J0YA 2F7PA 1V6WA 3VIOA 1NM9A 1Q6CA 2OSYA 2Y24A 3MS8A 4HPHA 1CIUA 4J7RA 2V5CA 1JF5A 2FH6A 3GXFA 1JZ4A 2VL4A 5FL1A 1QOXA 2NW0A 1E9LA 1US2A 5A2AA 2X2YA 1E0XA 3W24A 3WSUA 1OGGA 5BRPA 3CMJA 1KGWA 3PZTA 3WEOA 1L0PA 4NSBA 1BAGA 3UEQA 2CKRA 1PZ3A 4OJYA 4Z2GA 2BHYA 4UFMA 1EH9A 1E4LA 4Z2HA 1UR8A 2O9TA 3AZRA 9CGTA 1W1VA 1B30A 1WB0A 2VR5A 2WHLA 3N04A 1BGGA 1VEMA 3TA9A 3VGDA 3SCTA 1TA3A 4HOXA 5FIPA 2HISA 2VNCA 3AYSA 1VFUA 1J0KA 1VFFA 3NSNA 4FLRA 2WVSA 2EPMX 4DUVA 4P7OA 4AZBA 2V3GA 1RPKA 1R7AA 1UHVA 2JIWA 4WF7A 4BZYA 1E1FA 3VIMA 1EOKA 4CD6A 1EA9C 3CGTA 1WDQA 1GHSA 5JBEA 1GNXA 1FP9A 2VRJA 3OA5A 2O9OA 4OGZA 1CXHA 2VUYA 3CC1A 1D7FA 3M7SA 4DWSC 1XHGA 1Q6DA 2PWHA 2VCCA 2OW7A 1TVPA 1PEZA 1LG1A 5D9PA 2E4TA 5D8WA 3AIUA 3GBEA 2WNWA 5FL0A 2FH8A 5IFTA 4AMCA 1BHGA 1VJZA 4HOZA 3I3DA 2ZUTA 4EKJA 1OBAA 4FK9A 3FAWA 4M1RA 1V08A 4PMXA 4W7UA 1TQVA 5CLTA 1C3FA 1EHNA 1V0LA 2BHUA 2GJXA 2JF6A 5BXRA 3U57A 3EJUA 5HPCA 1B3ZA 5EMYA 4J28A 4HMDA 1E40A 3EJSA 3CUHA 5BROA 4F9DA 3VDBA 2ZE0A 3BAKA 2JF7A 1PAMA 1E70M 2X05A 2WZHA 1F4AA 3WD4A 3BAXA 4FF5A 3BAWA 3EYPA 4BQ5A 4DUWA 1HJVA 3LPPA 1XYFA 3WEMA 3TP4A 3VIKA 5FD0A 5GPRA 5BWFA 3ARPA 4F79A 1WO2A 1KTCA 3OLEA 4CD4A 1G9HA 4TTUA 1GJUA 4WSJA 1UA7A 4BQ3A 2BY3A 3GNPA 2NT1A 4IPNB 4KRTA 2TAAA 1TUXA 3MMUA 4AMXA 5ABFB 3OZOA 4X0VA 5A94A 6CGTA 4H7VA 4MB5A 2AOSA 4AZ7A 2J8GA 1E6QM 4W88A 3UG5A 3BLPX 2CXGA 3KE0A 5E1QA 1E71M 4GO9A 3CUGA 5BYWA 4AY1A 3AMGA 3W29A 4RE4A 1WNOA 2X09A 3RIKA 4R27A 3WDJA 1OT1A 4J3TA 3CHDA 4UCFA 1HF6A 1HNYA 2J79A 1QWUA 3AI0A 3WY3A 1TQTA 5A69A 2D3LA 1HXKA 1RP8A 1RD6A 1GOMA 3B8SA 1NOFA 4LYQA 1E15A 3PZMA 4DWSA 2CESA 3A23A 5A8NA 4QP0A 1X1NA 2ZUWA 4MNMA 3AIRA 4GZEA 2VVSA 3AIBA 4CCEA 4NRSA 5JUVA 1L8NA 1GORA 3VGBA 1UR1A 4H8HA 3VGEA 1OGSA 1UQZA 3NSXA 3DDGA 1G5AA 1MW1A 1OT2A 3LPFA 3G6MA 2VX7A 1VENA 3J7HA 1ISWA 4QLLA 3F5KA 3U5YA 3S2CA 2VZSA 1PZ2A 2ESCA 2XN1A 3L4VA 5C71A 4QFUA 1B1YA 4W84A 5I79A 4IUGA 2QV4A 3RJXA 3PZOA 1M04A 3CHFA 1BF2A 2GFTA 2QF8A 3LXBA 3GXDA 1UASA 1UR9A 1AMYA 1QBBA 4HZ8A 1XH0A 4PMDA 3RM9A 3HMCA 3F5LA 2CNCA 3GM8A 4AZGA 1C92A 2Y8VA 4CD7A 2VZTA 1BVNP 1TQWA 2W66A 3WBAA 1DP0A 1R34A 4YPJA 3D4ZA 2WCAA 3W0KA 2YFNA 5HXMA 4JHZA 3VGGA 2ZUMA 1EGZA 4XUYA 1XSIA 1QBAA 3GXMA 4HOWA 5A2CA 5A8OA 4D1IA 3EMCA 1TZ7A 3VD3A 1E1EA 2F8QA 3AOFA 1DHKA 1QNRA 3IGUA 4U5KA 3LRKA 3CH9A 4PMQA 4KWUA 2VO5A 2CPUA 3ARUA 3S6TA 4GKLA 3WMBA 2QHAA 4PCSA 2JALA 1E6RA 3WDPP 1FFQA 1HJSA 3GNRA 3WH9A 4UOQA 3UERA 2BNJA 2VVNA 3IJ8A 3LRLA 5AC4A 2XVGA 3NDZA 4JFSA 5TD4A 1UR0A 3EDEA 3WNPA 2G41A 2ZOXA 1E6XM 1S46A 4NXKA 2G3JA 3AS1A 1HKIA 2YL6A 3VSTA 3AHYA 5FCZA 1W1TA 3IJ7A 1BYBA 2VX6A 1Z32X 2BY1A 4QAWA 4J3UA 4AD3A 3CZLA 1BQCA 3OIHA 3IJ9A 4J3SA 1R7OA 1BTCA 2D0FA 4FNUA 2A3EA 1W9BM 5CGTA 2X2JA 1WZLA 5IHSA 3MU7A 5ABEA 1QNQA 5A2BA 2ZWZA 4UQCA 1AVAA 3WN6A 1EQPA 5A6BA 1PPIA 2W67A 2DT0A 4LYRA 4UFKA 3VSVA 3KL0A 1E6ZA 4HA3A 3DX0A 2F7QA 1HVQA 2F1AA 1WPCA 3AXIA 1WZKA 2VURA 2W4XA 3VX0A 4FLSA 2VTFA 3VSUA 2W62A 4PSPA 3BCFA 4Q22A 4GINA 3WNMA 3L2MA 3ZT5A 3AIWA 5JIPA 3EMQA 4C7DA 8CGTA 1SMDA 3VVGA 3VD4A 4ML4A 4ACZA 2DSVA 4UTFA 1LG2A 3ARVA 2ZX9A 1DWFM 3FW6A 1DWJM 3F5JA 1LL6A 1CGXA 3A5VA 3L2LA 1NOWA 3TTQA 2WCSA 3DC0A 4YHGA 2BVDA 2XSAA 5I5RA 3WQWA 4DM2A 1VEOA 4B9ZA 4JFWA 3ALFA 1CPUA 5LA2A 1EO7A 3AS0A 1KXHA 1RP9A 5E09A 2GJRA 3RDKA 5DEZA 2DT2A 1UD4A 1UYQA 1UH3A 3ZT7A 3KEHA 4NZFA 1C8QA 1XCWA 5I24A 4PTWA 3K4AA 4PTXA 1DWIM 1JAKA 1JYWA 4QLJA 3OG2A 4ZE4A 4OUEA 2DSKA 3L4UA 1JYNA 4UQBA 3W6MA 3H54A 3VIGA 1JD7A 3WUEA 3CZSA 1E6SM 1V6XA 3EDFA 3EJQA 1OIMA 1B90A 2D2OA 1TE1A 3WF1A 4U3AA 3FHAA 3EJTA 3CHEA 1BG9A 1JXKA 1QHOA 3BCDA 2EXOA 4UFJA 1V3JA 2EBNA 4EE9A 4BCEA 1GQKA 4W5ZA 2YFOA 1J0JA 1NQ6A 2UY2A 2WAGA 3VNZA 3WDHA 3PZQA 1VEPA 4BA0A 3MSDA 2QLYA 1JI2A 1OINA 2XVLA 1ZS2A 3N13A 1LL7A 2Q8XA 2F7RA 3N1AA 1TA3B 2DT3A 1KXQA 2VZUA 2PBOA 3KL5A 1W9VA 4HA1A 1W3KA 3TTYA 2QMKA 3UG3A 3WF2A 1HJUA 1XRVA 3W25A 1ODZA 2HVMA 2EPOA 3CUFA 2ZX5A 5I3DA 1X6NA 1TG7A 2JEPA 2BV9A 4CVUA 2RGLA 3SCWA 3WKZA 2GVYA 3KLKA 4NI3A 1J0IA 3QHNA 3A6OA 3ZJ8A 3BMWA 2BFGA 2YL9A 1QI3A 2DPEA 3PZ9A 3QOKA 1KQZA 5EFDA 3DYMA 2YA1A 2J75A 5AY7A 3ALGA 4D71A 3MMWA 3W37A 2YJQA 4PUDA 1MQPA 3MV01 2CBJA 3GBDA 2UWFA 2YBUA 3L4YA 1CYGA 4UQAA 4F66A 1V03A 2GJXB 4W5UA 2F1BA 2WBKA 4OOUA 4TUFA 1YQ2A 3RM4A 3WEZA 1UA3A 4CD5A 4YHEA 2XHYA 1WDRA 1I1WA 1V6YA 5D8ZA 5D9MA 1W2PA 2PB1A 2D0HA 1VFOA 1XGZA 4Z2KA 4A3YA 1NWUA 2WVVA 4MNKA 2WANA 3BVUA 3AHXA 3ZR6A 4OKDA 1ISVA 3WH6A 2G4FA 4ACYA 2G3IA 2WLZA 1XSKA 1HWWA 2ZXQA 1CXEA 4MNJA 2VT0A 3SUWA 2WMJA 3CZEA 5A6MA 1C93A 4PN2A 2A3AA 2PWEA 4S3JA 5A1AA 1D2KA 1KGUA 1Q6FA 4KGLA 4XV0A 1XYZA 1W91A 2VI0A 3WQ6A 1LL4A 5KEZA 2XG9A 5LA1A 1C8XA 4X0NA 1JXJA 2XGBA 3CTTA 2D23A 3S5YA 1E43A 3FAXA 2O9RA 3PZGA 5GQBA 1UZ4A 3MUZ1 1TQUA 4AISA 1JZ7A 2EACA 2XFYA 4QCFA 2V3FA 3T0DA 1WDPA 3CZNA 4WLCA 4PMNA 1DTUA 3QGVA 2VX5A 3NJ3A 1W9DM 1J0ZA 4P8WA 3T0AA 1JF6A 4NRRA 1JFHA 4XZWA 4F8XA 1ZBVA 2A3CA 3ARZA 1W3LA 2WVTA 2Y2WA 3EJPA 1VAHA 4M8UA 1JIBA 2DH2A 3ZR5A 1H1NA 1ZBKA 4DWSB 1R87A 2GJPA 2FYVA 2D73A 2YA2A 1DEDA 2XWDA 5ECUA 1EXPA 5JBDA 3VINA 4W7VA 4MAVA 3WUBA 1VRXA
chains in the Genus database with same CATH superfamily
2FYMA 3QYQA 2ITFA 4H9TA 5IHRA 1GKRA 3TLLA 3KG5A 5CC3A 3VFGH 4CNUA 3M17A 1A47A 3ARGB 4UR9A 4JN2A 4QXTA 3GSNB 1J5OH 1TETL 1XBVA 2ZRXA 4APQA 1SXBA 4KETA 1HGWA 3BW4A 4YSDA 5F2LA 2HA1A 4AIOA 3IXAA 3LCLA 2BOFX 4Y7EA 3FU9A 2UZYA 4IKKA 3BP7B 4LSTL 4IJRA 3WQCA 4L29B 4DUOA 3GI8H 1VZWA 1A1OA 1IGIL 3UTTE 2R59A 4MJMA 3VGFA 4YTUA 3OGSA 2DIAA 3WF0A 4JFEB 5DCBA 2AKMA 4DZHA 2DW5A 2ORBL 3A6BL 1EBGA 2F53B 4M6ML 3PNRB 5CEZH 4OZIE 3FTSA 2XVPA 1SGKA 2QBWA 5DJAB 4HCHA 4O1EA 4KHTL 5F9WB 1F6LL 4KI5D 3CVBA 2DW7A 3HG5A 1PKOA 2Z6IA 3NZ1A 3UTPD 5C2CA 2IMMA 4KS0A 4AY0A 4GI8A 3I2CH 4E4PA 1K3ZA 3QLLA 1P5UC 2BNRA 3A4AA 5I77A 2CE6A 1XIJA 2W95A 3U2IA 1CG9A 2HT2C 3CFJB 1BV8A 3FY1A 3EHBC 1ROWA 4AMKH 1NCCH 5TIMA 3MV7B 4QRRB 1J1PH 2E4FA 4ZODA 2APXA 2QPEB 3FSZA 1IM3A 5EU7E 3THUA 1E9ZB 1TPXB 1CEOA 3RYMA 5GS1C 3L1FA 2VM4A 2RQEA 4CMMB 5ABZA 5K33A 1RVFH 1SJCA 1NH6A 3KM1A 3NQKA 1C12B 2XQBL 4MKNA 4E9YA 2ZX8A 2QZQA 1N7KA 3RPMA 5DJDB 2EUWA 4ZEPA 5I76A 4L9LC 4R7DB 2VSMB 4UF7C 4WJ5B 1T0OA 2CLLA 1XGQB 4L8SB 1WF5A 1QSFA 3P30H 2NCMA 4JGJA 3VFWA 3ZDYB 2L7EA 1T4WA 4X4XB 2YD9A 2X0HA 3RR1A 5JIKA 3VCLB 2X2GA 2A6IB 4HCGA 2HJLB 3BPOC 3FTGA 4EN3C 1BYDA 4GCXA 5LGXA 3O7UA 2Z4QA 3GX9A 3MKKA 4FG2A 5TBOA 1KV7A 1EAOA 1J8HE 3M5VA 4DZIA 3CDGA 3SDXF 3FQNB 1T99A 2OL3H 3TBWA 3UC0L 3BZDA 5AAPA 1OAYH 1GUVA 3N73A 4U0RC 2VR3A 3RXZA 3KX6A 4X8XA 1MJJB 2PP3A 3R94A 3EG9A 3V0GA 1CF8H 5CJNA 3ARFC 1NCBH 4OY9A 1IZCA 3SOBL 2XWRA 2BSSB 2RDXA 3GNML 3K2MC 4O5LL 5JBFA 1S7TB 4O1CA 4QRBA 1KDIA 3Q2CA 3SBRA 2BS9A 5FOBA 1IR2A 3DEQA 2J77A 4P57B 1IIKA 1HGYA 3CSBA 2ROXA 3NZSA 1E6PA 5I06A 1NC4A 2WZMA 3X14B 2Y4SA 5DVKA 3ARWA 3D9AL 2ZXBA 3VQ2C 3RGVB 1NP2A 4XNUH 3QRGH 5CKAA 3NIDE 1FJ1B 3WENA 3CVHH 4CNPA 1AYOA 3TWCH 1I9CB 1UD6A 3TV8A 3RJOA 4PS4H 2J6VA 1KB5H 4WKZA 1DQJA 3NYKA 3U46A 2H26A 3II1A 1PJ9A 5AHFA 2AVFA 4NWTL 1NF7A 5L0QB 3LM7A 2IANA 3G6JB 2B1AH 1X7IA 1MRCL 4JFXB 1BYAA 5H94B 5EG6C 4IFKA 2G9HB 1QT1A 2FVLA 4K3EL 5JQ6H 3EA2A 1MJ7L 5DVOA 5MHBA 3UY7A 3CXHJ 3NCEB 4K73A 4IHOA 1BFTA 1QO2A 3B8IA 5AOLA 4WV1C 2HT3C 1PL3A 3LHZA 2CR6A 3TA3A 4D0BB 1K2DB 2A6NA 4I9MA 4HJJL 4D6JA 5DFTA 1PKYA 1TG8A 1EJWC 5BRQA 2YJLA 2QSCH 4QGTA 3CSPA 4J40A 4MJZA 4X7TB 1JVOA 3D52A 1TPDA 2ZG3A 4K38A 1KRBC 4MRCA 3WQ4A 3MUGB 3PUDA 5JO5A 5T5FA 1AZBA 4HU0A 3MXWL 1G87A 3DHMA 3GO1L 5FKPB 2BDNH 1J10A 1QRNA 5IVXF 1VZGA 3NPXA 1FORH 2NNAA 2IH1B 3BPLB 4PUUA 2BSRB 1UTDA 2JIXB 4OI8A 1UKQA 3H9ZA 3PP4H 4NXSA 3N1QC 3QAZC 1PHWA 4OCLC 3D4CA 4ZDHB 4N2CA 2PO6B 4OQTA 5HHMD 2XI9A 3BVTA 5B80A 2V38A 1M01A 1RVGA 1UWUA 4POCA 5ES4B 2GJ6E 3RAOA 4JYDA 4XXCC 2ZF8A 5EMLA 2V5KA 5E9DD 2DSWA 4PY7B 2WQDA 3PXHA 1OGAB 1BBDH 5KS9A 1FP5A 1X5LA 1W0VA 4HBCH 3H7RA 5I1DA 5EN2B 5GS0H 3IFNH 2FB4H 1MHEA 1AI1H 1ZHBB 2DWEA 1KJMA 5IDIA 4H5SB 4L18A 4JJHA 3Q9PA 4CD8A 1R75A 3FHEA 1V7NH 1J9SA 4JHMA 3QEUA 5E5CA 4QHNA 2OLHA 1ZT7A 1IKNC 2FJGB 4LLVB 1JGMA 2P42B 15C8L 4YCPA 1S7XB 3IMTA 1G7JA 3DXAB 3IFOA 1EC8A 4P3CL 4L5FE 4ZT1A 4MVAA 3BX7C 2G5BB 4LCSA 5I1GL 2A74B 5J8OA 1KJ2L 3K0WA 2AZAA 4DEUA 4ASTA 2XFWA 3LU2A 3V2AR 5BXSA 4HNOA 3DYOA 3MB9A 2R4SL 2EO7A 1MREH 4R2GD 4MCZB 3EUDA 4MKTA 2FZMA 4BYHA 2Z1KA 1JFQH 3PG8A 1UCBH 2AEQL 4YWGH 3DUHA 5HI5D 4Z6AT 1RBOB 3M5XA 3T2LA 1NP0A 3WOVA 2C9UA 1KM3A 1YDPA 4HHHA 5D96B 3LHPH 1B4JL 5T5NG 2V2HA 3EAUA 3WUGA 2AGTA 1E30A 1BA9A 1GOXA 1QNOA 4P7LA 4ZS7H 3HN8A 4UDTA 3S48A 3O4LE 4GRMB 2FIQA 3BVJA 3D2TA 4U1NA 4Z1DA 4AKPA 4BS0A 3BEVB 2F61A 4PJXA 4Q2ZB 4Y19E 5BVJA 1TYEB 3T8LA 5ID1A 1ETZA 3O6LH 5DMYA 3A0OA 2GFBB 1TELA 3MJ9H 4RZCA 1KFBA 1BQSA 1EJ6A 1H6TA 3GF8A 5DD6A 4AXWB 5XIAA 3H4FA 2UVFA 5I5JA 3ZO0A 1UXSB 3M45A 3V0TA 1OF6A 5BS0B 4KRUA 4WEUD 4LKCB 1ORQB 3VMOA 4AYGA 1WVZA 1R0MA 1GYNA 3B9EA 1HCFX 2R2HA 3JUYA 3V0SA 1QHZA 3SPCA 1WBXA 3EF4A 5HDQL 3BLIA 3O2DH 5INDA 2RFXA 4MA1B 3FCBA 1Z42A 4M19A 2IG2L 2DYPA 3LTVA 3HNVH 1CI1A 5AYZA 1P5VA 4QTIH 3FDGA 4X9SA 2XGIA 4D3CH 3MRQB 1Q6EA 1DE6A 4B5VA 1NGQH 4IX0A 5SX5K 4OTKA 5F9AC 1Q9LB 2HG5B 5C07D 4TU1A 5H8PA 5ECJE 3GTHA 3IDMB 1OFOA 3UO1L 3IGKA 3UZVA 4HJ1A 2E27H 1S7QA 3NDOA 3CSGA 4NQED 1IZJA 3WXVL 4LLAA 1IL1A 4NQQA 3N0PB 1MCOL 1URZA 4XNXL 3IDYC 4U5IA 5T1KA 3UTSA 2Z4TA 1BVKB 2MQCA 1CXLA 4ZQOA 2D1ZA 4ZMXA 1UP2A 4MDJB 5I1AB 1W54A 2HNEA 4GBUA 3ATEA 3S47A 2CHOA 3IJYB 4E41E 1YBQB 1EJVC 2EDWA 1UP0A 4N0UE 3ABOA 3O16A 4X63A 5I2UA 4X9GA 3U4BH 1KYDA 1GYVA 4M48L 4FYRA 4DYKA 2DGAA 1HQRA 4M1CD 5IHLB 3HR6A 5I8EA 4PTTB 1SZNA 3P0VH 3OZKA 1FC2D 4M24A 3G1SA 2MANA 2Q76A 1WICA 3RWIA 4LVOC 4GIAA 1LO4H 3TIMA 1T04A 4R83A 1BBJA 4I87A 3MLRL 3OMAB 3OG6B 1J48A 3QI9D 2WXKA 4XTRD 1R86A 4JEQA 3EGDA 2IPGA 1KTKE 1QLRA 4IRJC 1Z7AA 3C0JA 3ZKSD 1MWAL 4H8UA 3HE7D 3VWKA 1VFTA 2YR1A 3NRPA 2PDKA 1IC4H 4L48A 1SBSL 3VRLF 4DB7A 5EDXA 4O1DA 3GTFA 2WPGA 2CIKA 2ADIA 3EOTH 3V6FB 5FW8A 5KSAC 4PWIA 4ZW5A 4QQUA 1NIUA 1DWAM 1UJQA 3BMXA 2NX1A 4D1JA 2F7PA 3G77A 3B5TA 1FFTB 4DBSA 4D0CA 3LEYH 4XHQA 2X2YA 2EYRA 3G08B 3W24A 1K8IA 1SFHA 2Z7GA 9XIMA 1XB3A 2OCJA 4ERIA 3B7RL 2YGOA 1W1VA 3N85L 5D7SH 1BGGA 2YGVA 1F4WH 1PD0A 4KTYA 1MJ8H 3AYSA 3MV9A 4QGYA 5B1AB 3P6LA 1SQ7A 4QDPA 4ZR8A 2HE8A 2DL9A 1R7AA 3QUYA 5D1QE 3CQHA 5ETUB 2CNZA 3QWQB 2OCCB 5F97E 4X6CB 1REQB 2CUMA 4TULL 3O8XA 1P4CA 5REQA 1E51A 3CXDH 2EYSB 4AMCA 1BHGA 1QFWL 3W7OA 3OPUA 3MQIA 3UJIL 1CWVA 4FK9A 2JKPA 1FL3B 3PPCA 3H56A 1JGEB 1M42A 1XISA 2DQJH 2QVIA 3QVQA 2VGGA 2X05A 4Y9MA 1RVKA 4P2RA 4N9CA 3DUUA 2R0LH 1EEZA 3SGUA 4A55A 1ZLSH 3KHOA 3DK2A 3OLEA 3F05A 4LP5A 4LCIH 4AY8A 5F88A 4PC8A 4CSZA 4RPPA 2C9PA 2VWEE 1WTGT 4W88A 4JANA 1UG9A 4IEFA 1DE5A 3CWNA 2ZA3A 3V7PA 5KSBF 4C65A 3W29A 4JVUA 2J8UE 5HI4D 1QWUA 1KV5A 3GPSA 3OAUH 1JGVL 2VFDA 5EO1A 3P02A 4JEGB 2CESA 1XZWA 2A99A 4ZMQA 2QT3A 3AIBA 2P53A 4G5ZL 3L5XL 1S5HB 3VXUE 5DJXA 3DDGA 1JPMA 5EU5A 3H7BB 3WE1A 1T0NB 4AV0A 4ORGA 5DSCB 5DMGC 4PR5B 4UIKL 1JNNH 4N8CL 3MFFA 4RW3A 3VFPA 3NAAH 2ON3A 3WK1A 2OBGA 2FTAA 3GM8A 4AJYV 3OKEA 2JI2A 3HAEG 4IF2A 5MKGB 4Q9RH 3DCPA 5EF1A 1PLGH 5A2CA 3B3IA 3S35L 3IU3A 1I53A 3H1ZA 2ZZ6A 3TC6A 4NFBA 3WMBA 2YUVA 2HX8A 2FIKB 3C60C 1FFQA 5JVLA 1OY0A 2J2ZA 4IBVA 4OH2A 1YEHH 1KCXA 4PW4A 4HUVA 3U7YH 3EA3A 3V0UA 3FF7A 2XVGA 4X2UA 2PTWA 4S2BA 1LMIA 4W9GC 4S2CA 3AG4B 5IMMA 4L3FA 2YL6A 1HWGB 2V0TA 3VCCA 3DA0A 1BYBA 2VX6A 1K72A 3MBWB 1ZTVA 1CLZH 2YUXA 4RQQB 2D0FA 1KELH 4UQCA 3VFVB 3C8NA 1TZGL 1KBGH 1Q9KB 4MQTB 1GVSA 3VKDA 2KLSA 3VX0A 3MGOB 4FLSA 3SFWA 4MA8L 2X6VA 3V5DA 1L3WA 3OMNB 5EZJB 5SWSB 3P69A 3DN5A 3EOAA 3AIWA 2J56A 3MODH 3VVGA 4ACZA 1WDAA 4F0RA 3R0UA 4UTUA 3E0LA 3ILQD 2CH8A 1FZMB 1XINA 2R4RH 2BP0B 1LL6A 3GSWB 2IQ0A 3AUOA 4UAOB 4WVXA 4DM2A 1A9VA 1LT8A 1IAOA 5B38B 1P84J 4OCNC 5LGHH 2W60A 1XIWB 2MQ0A 2Z65C 1XWYA 3NCXA 3ECWA 4HZ1A 4WI5A 1UYQA 4RX0A 3SCMB 1FQ9C 3HBPA 1C8QA 4LSSH 4J3OC 4U1IA 3K4AA 2OXNA 4Y7OC 4QLJA 1O1HA 1CN4A 2CDFB 2X4SB 3UZYA 4BH8B 3W6MA 3H54A 3B97A 4QXWA 5HVWA 3P67A 4LLDB 3MTRA 4N3UA 3EA1A 1GVEA 3BQUA 2BSLA 1BG9A 1A3QA 1XR8A 3K6NA 1WT5C 4UFJA 3HQOA 4QE1A 3LYEA 2ICWJ 2ZVRA 5CZJA 5K9KA 3ABSA 3C6SB 1IO4C 3VQ1C 2QLYA 2Q8XA 1U91A 1UENA 4DNHA 5F1SA 1L9PA 1X6UA 2QVNA 3WBXA 5GGTA 1V93A 1OF2B 1BGXL 1NKGA 5CSGA 4AM0Q 2XETA 1NMBH 4O17A 2EXYD 1CL7I 4G43A 2D7OA 5IEHA 4JM4H 2EPOA 3NCYP 1SY6A 1UUSA 4JZJB 1QSVA 3HIZA 4JM2C 3HS8A 4HD9A 4KKZA 1UJ3A 1LP9F 2FTPA 5KYYB 3ORWA 5IBUB 1RK0A 2XG5A 4G7VL 1PIIA 5IR1B 3M0HA 5EU6E 1HAUA 3OF6D 5JPNC 4A68A 3LZFH 3KBSA 7ODCA 1RI8A 1ZGDA 3ZYJA 1KZQA 4KX7A 2VXVL 5D9MA 3IT8D 5DJYB 5IB5A 4OJAA 4XH2B 1IIIA 1ZAJA 4P2QA 4AEHL 2AXHA 5G5DB 3KXFA 3AHXA 4DPPA 12E8H 1ISVA 3U6RB 1R19A 4JTLA 4F92B 1R3IL 1BRLA 3ROLA 2ICWB 1GZHA 3QV8A 4BUQA 3PF3A 2QV5A 3PWPE 4FQJL 1QFUL 4QRQA 5AAWA 1UGKA 2HPMA 3QUZB 4BJHA 5DD1H 2GCYA 3DOSB 2MSPA 1UZ4A 3RY5A 3C2OA 3DZ1A 1U8LB 1F56A 1U3HD 3T3ME 4QCFA 5FGBC 1SJVA 3BOLA 4NLAA 2ARJA 4ZFZB 1JFHA 1N7MH 4G6KH 2Y9RT 3SODB 3W3BA 3DIFB 2WVTA 5HGDB 5LGJA 3ZLHA 2VMDA 4EOWH 1W8GA 4XMKL 3A6CL 1R87A 2GJPA 2FYVA 4H1LH 4WEEA 3SPIA 3CZFA 1OTTD 2XWDA 3X1EA 5A2KH 2A9ML 3TIDB 1A7NH 1UZ8B 3LRSA 1DBAH 3QYNA 3QJHA 4N8UA 3JWNH 3R4RA 3W38A 4OD1H 1FZOA 4YBQD 2POTA 1E8YA 4XIMA 4OFDA 4RMUA 4IRZH 1MAMH 4YR6A 3OKNA 3WNJA 1HOEA 3MOBH 5J8LA 3K8MA 4LFHG 3BQ5A 2WWMC 4NQSB 3TBBA 2XBZA 3VI4A 2P3ZA 4LJ3A 4FA8A 4F7TA 1KTLB 5F1VA 3CV5A 3THCA 3MO1A 3RZCC 2UXFA 2Z29A 4RWYH 1BFOB 3MXVH 2AI0H 1A1MB 1D3GA 5EO9B 2YSSB 4OFIA 4DO6A 2FDBP 3CDZB 4PGCA 2DQMA 1SW7A 3L3OA 1S7WB 2O9PA 2XPYA 3QV9A 5D2LB 3QUXB 3MI3A 2W61A 3QIWD 5E2WH 2AQWA 1UM5H 5TH2A 4NZJA 1Z3GL 1ONWA 3N50A 1SHSA 3QA3B 4LMQI 3PJSA 2G96A 3L3HB 5CBIA 3CMFA 1PS3A 1Q7QA 1U8QA 4Z7OF 3D50A 2XKUA 3H4HA 4YC2B 3SO3B 3VFTA 3U7BA 5DLLA 2C4FT 3KZ8A 7CGTA 1K85A 4PRID 3H2EA 4MTVA 4C6OA 4OZHA 2GGHA 2R0ZL 3UR2A 4JAMA 3GHTA 4DOHE 5CZKA 4Z3GA 3N17A 5J1AB 5JZ7D 3KVPA 3O6FA 1FL6B 1A5MC 5DFAA 2JB5L 3T4YA 1T2XA 1IILE 3CDFA 1YMMB 4OM0H 4P2VA 4A35A 4QR6A 3BZ4B 3K30A 5DD3L 3OGCB 3K6IA 3W86A 4C6LA 2AV7B 3GKAA 3D12B 2J7CA 3KVKA 2DQCL 4NNCA 5FJOA 2YS4A 3V5CA 3V4PB 1S9YB 3HZMA 3L9RB 3VB8A 2QYGA 4JFVA 4Z7VF 4HWEL 3GI9H 5M17A 2RHGA 3NEEA 1BFNA 2MEJB 4LHUB 1RZIB 3K91A 1XGUB 4ZPTA 3UZQB 3DVNB 3ARDA 4DN3L 3KNBB 4MNQA 4YFEA 4M4RA 1U92B 3N44F 3IKCA 4KX8A 3A3WA 2V4LA 3EB2A 3LNMA 2YGPA 3LTPA 2WXPA 1T7VA 1GGBL 3SDDB 4P7QA 4EVNA 2XFGB 4MAUL 3U7WH 4UTIA 2OMZA 2MNUA 4J1UB 1MZYA 3OR6A 4P5UA 2C4FU 3THDA 1U5HA 3RTQA 4FXLA 3K6SB 1KCRH 2PDMA 3GPEA 4XX6A 5HGBA 4AG4L 2AERT 5HDLA 3UAJD 3EGXA 4PCYA 4FOJA 3TNMB 5A95A 3CZJA 3F6LA 3KP0A 3EKLA 2H0FA 2W6RA 1YX1A 2BGSA 2XZCH 2YKKA 3NVDA 1L9OA 3WLOA 2QCGA 3WXWH 4ZD3H 2DPKA 1YEDB 3V18A 4ZQKB 3OKKA 3VH8A 5E2JA 2C3ZA 3WFHB 2FB3A 1EHXA 4JZOA 1A6PA 2BIHA 4BXVA 3HM7A 4L1SA 3GJEB 1ONQB 2QEZA 1XF5B 2ZZ5A 1Q85A 1PKQE 3VD7A 4GUGA 4ELMF 3W7HA 3LS5L 4M80A 1NIBA 3S4TA 1B57A 4GCAA 4KBXA 1ZV9A 4MAYC 2JELL 3TBTA 2G5WA 3G3LA 3MRFA 1VBUA 2J7LA 3L13A 3KWTA 3LQMA 1JZIA 5G5IA 3QIUA 4ZW7A 4CU8A 4CSPA 5EDSA 1CGVA 1YN6A 3F64A 4ZFMA 1HZHL 4WEBL 5F7WC 5IOPB 2ZDRA 4L3EE 4ZMWA 2QKIB 5E0FA 3CIAA 1WS7A 3MJYA 4X8CA 2JEQA 2FQEA 4MVBC 2X4PA 4URIA 1MNZA 1KLFB 3S0CA 1QI2A 5KW9L 4PJ7F 2ZYIA 4IPLA 4TUOB 5GJNA 5AZEH 1E9QB 4NUJB 3A3YB 3EBHA 3QJZA 5IV2A 2P8CA 3CUIA 4J3WA 1E90A 1KMGA 1WGOA 2Z64C 4FLOA 3FPYA 2AJSH 4PJIF 5MEQB 4JE0A 3ENLA 4HA0A 3S5LG 4IMEA 4UZSA 3I50L 4EPKA 1IGCL 2G3NA 4GSDL 3GS4A 5CPTA 1TSIA 3OKMB 4KFPA 5JNYB 4HKJB 3OKYA 3IRPX 3NA9H 5B3JF 4AMAA 3SIZA 1ITCA 2I60H 2AJXL 3S8WA 1A53A 4C6EA 2MTPA 3LEXA 4HNCA 1ODUA 1GOFA 3OG4B 4J3BA 2CWRA 2PU0A 1PG7W 4V28A 2PDQA 3G6AB 1N5AB 4G8TA 1EAPA 2E9LA 4UFHA 1MO0A 4M8QB 2PPCA 3QEZA 4H1LG 4ZAKD 1D5RA 2FL5B 3TDFA 2E6FA 2NY3B 3VNYA 1FHDA 4BI5A 3OBAA 5EGRA 3RIFF 4MDRA 4LBSA 2NNFA 2B0SH 1SZGA 4QG6A 3MUXA 3G5YA 3ID7A 2F6AA 3AU0A 3JWNG 1A1NB 5DD5H 4OOZA 2F84A 3W75A 4R33A 1JYVA 3IGAA 1CBVH 2BC4B 3HE6A 2D7QA 3BXWA 4HIXH 1GPFA 4BCYA 3CFKA 4BHYA 2YQGA 4PMZA 4HKXA 2FLMA 3NP4A 5DS2A 2UY7A 2YPIA 3EEGA 1X98A 5D1ZC 5RUBA 4OBRA 2CRIA 2G5UA 4ADUA 5IFHH 2EYTB 2IGFL 1BAFL 4JHUA 1GG1A 4LPUA 2AK4A 5E94A 5K7JA 3NO3A 3NIFB 4BSWA 2F2HA 1RUQL 3WUZA 2ZD0A 3FV9A 1TJGL 2R23B 3UAAA 1IC7H 4ZK8A 4GBXC 2OEJA 2OTWB 2WB7A 2QADB 3GG1A 3N6JA 4MY9A 4UMGA 1ZQ5A 4HALA 2DOCA 1AXTL 2NY7H 3QHTC 3QQ3B 2VAAB 1HU8A 1E73M 1R3SA 2Y0FA 3BSZH 3HNSH 1AKJA 2PCPB 4R7NB 1MI5A 2CAKA 2XINA 3GHSA 4BFRA 3V6ZB 3CAWA 3DSNA 1PZUB 4HA4A 2WIIB 3MZTA 5IMKA 1EZLA 4CVWA 3QSKB 1MRDL 5BUGA 5IFJA 3WG7B 5JU6A 1P7TB 1GGIH 3N5AA 4CQBA 3TR9A 4FQXC 4H6KA 4HH8A 2HS6A 3PQYD 3L0KA 3SQBA 4Y16A 4UTAH 3VKKA 3FGCB 4JJ5A 2Y3AA 4A38A 3NDZE 2B59B 3Q2NA 2OR9H 1A3WA 4PJ8A 4IRSD 3L1OH 2ISFA 5AVTB 3OWRA 5E8NA 3T0EA 3P9MB 1O7DC 1XAUA 1OOWA 1RSFA 2E47A 4ELDA 2MH4A 3TIEB 2BHZA 2OPCA 5IBTH 4HIJB 1QQDB 2YMTA 4W6YB 3WFDL 5DO2D 1JPSH 2VE6B 2X88A 3VACA 3LB6C 1PDZA 1N8ZA 3GUFA 2DZBA 5E6IC 5DCEA 1FHUA 4YFLF 1IEXA 1K9FA 4PRHE 1KR1A 2VLMD 1NBYA 3V35A 4YFDB 3RL1B 3OJDB 1DJWA 1XC6A 1YLVA 1E67A 2WUBL 3ZE0B 1P6AB 5GGUA 2Z93B 3KBEA 4I2XE 2NUPA 4I3RH 3C3UA 2IQTA 4C5YA 1MI3A 4Y4FC 1QCWA 4DTGH 4GZJA 4UV4L 1L9SA 3O3EA 2PCFA 3GNDA 2C4XA 1JGUL 3WO8A 4ZW3A 4PJ5D 2ADFL 1K4GA 2NDGA 1NSNL 5TNVA 2YPLD 5KAQG 3KPRB 2XJ7A 5FB8A 4NN6B 5ESQB 3B4YA 4K3HA 1C5BL 1G9ML 1KGYE 2Q20A 3PWAA 3MLWL 4FD0A 4DGIL 1V3IA 4XP4L 1C8VA 5J6GB 1KC5L 1JYXA 3TJIA 5K9QI 1E56A 4JREC 3BW9A 4OV6F 5J57B 2OMYA 2WXGA 4C56D 4B0MM 3KRBA 3DTDA 3MANA 4XO9A 1JI1A 4NKOB 3AXMA 2E9IA 1G01A 1JDDA 2FATH 3G1RA 3R7QA 4QHPA 3QULB 2NXYC 3RVVC 5EA0H 1RJYA 1ZTXL 2LTQC 3HAEA 3X12A 1GKPA 2W5FA 5DRXB 3FTWA 2E6PA 2FX8H 3VIPA 4IKNA 4R5XA 5IB1A 4LRSA 3C3NA 2VL4A 5FL1A 4PI0A 4ICXA 3IXAB 4HVBA 1EH9A 1E4LA 1D7KA 1WDDA 1Q0XH 4JTQA 1JMXA 4LC6A 1A1OB 5LNUA 4EEEA 1H60A 2B4CH 3M16A 2HXAA 1F2QA 4TNGA 2FJUB 3FUKA 4P7OA 4P3DA 3U30B 2JIWA 4WF7A 1RZKH 3CGTA 1GYMA 2Q3XA 1GNXA 2PW1B 2VJ8A 2VRJA 3UTZA 4A1RA 4XXDB 3A5FA 3S9YA 4NZUH 4B9GA 2A0LC 4OLZL 3ORJA 1FG2B 3OMIB 1PEZA 3DIVA 5I66A 1VERA 2I14A 4HOZA 4ANVA 4BFKA 3EOBB 2EKSA 3GFXA 2BNRB 1YDVA 1MHPL 4WZHA 1YA5A 5DS1A 3GSXA 4RUBA 4FEZA 3RWFA 3WO3B 3MRNA 3QW4B 3PWLB 4PJHA 1B88A 3K4ZA 3BAWA 4DUWA 1IM3B 1XYFA 2WQSA 4L0PB 3RKDD 1D6VL 3ARPA 4F8LA 1KTCA 3UJJL 4AM0A 1GJUA 3L45A 3AUWB 2GJNA 3GNPA 3SKNA 3UJTL 1MELA 3LKQA 2B7NA 1DQVA 2VKZG 3UYPB 4K23L 2N1TE 2IAMA 3V1HA 2YAHA 1RUAH 4YDZA 4PVBA 3FFDA 3EFOA 2D31B 2PETA 4K0OA 4HGXA 4NZ1A 2HP4A 4Y6GA 5DFWH 3GR4A 2BZ7A 4GLEA 2PABA 4NJGA 4O58L 4OZGA 4NPYA 3IETA 5A69A 1W2KT 3CB8A 5FHAL 4MMXC 3KHQA 2WINB 3VFWB 2ATKA 3REWA 1X1NA 3ZXWA 4O10A 2VDMB 3G9VA 3UFYA 1IVTA 3VGBA 4H8HA 4ONGL 4QHMA 4QG8A 5HVHB 1MW1A 4LBEB 4GXUN 1TSHA 3VKAA 3O2WH 3ESPA 3MCG1 2XN1A 2IF7A 4B5ZA 4HNNA 5CLZA 1OG0A 4KNQA 3KBJA 4ZBCA 1XXFC 2Q5BA 2Y7LA 3ZDXF 3OM3B 3VNIA 2FJHA 1XLDA 3TBWB 5F0MB 2OMTA 4GUHA 3TYZA 2QTEA 4Z7OE 4H25B 4Y9BA 4IHCA 4HWBL 3FYOA 3K2UL 1GY1A 3G22A 3VYLA 1MCHA 3MV8E 3SDCA 3VGGA 4WXYA 1WEJH 4LSPH 4BZ2L 4HOWA 2WY3B 5A8OA 5G55A 3VD3A 3H2PA 4PREA 1F3DH 3LRKA 4P4KA 3T81A 1GS8A 5HHXL 2OMVA 4BQ9A 1VPQA 3BPNB 2ZCZA 5FOBB 3AAZA 2CA4A 5EBGA 1U5JA 2QHRL 4OM1L 4JFDE 3T0CA 4NERA 3UERA 1IQ8A 2BNJA 2YAMA 4J4PC 5JOFA 5A16B 4QWWD 1CFSA 3JWDH 1SJMA 1BFVH 3WJSA 2R2CA 3G6DL 4J3UA 5BZDA 3CZLA 3DENA 4UCGA 2HKAA 3TX4A 4TV5A 3LQAC 4WKZB 1XDLA 1GG0A 1ADQH 4FTVA 1OT4A 4Q8WA 2H26B 5HGHA 3WN6A 5A6BA 4JX0A 3WN5C 4LYRA 3JYCA 2CMRL 4O1AA 1B4TA 4Y8AA 2ALAA 2F1AA 5BMXA 4YHLH 3QDHA 5LNGA 1LO3H 3TO2B 1SLXA 5BJTA 4MA7L 4C6IA 5T8GA 4RGNC 3C09B 1AS8A 1J9QA 4B5EA 1ZV5A 4OGQC 2VB5A 2QUNA 1T89A 1XS2A 2DSVA 4UTFA 2FKPA 2GSMB 2CZEA 1DE4A 5A5WA 4E9LA 3WKPA 1ZEAH 4F4RA 2XSAA 1TZIB 3USZA 3HPSA 1EF3A 3TA3B 5MENE 5GJSL 2VEPA 1CQYA 1MG3C 1UH3A 4KEUA 4AIZA 5GHWL 1JCJA 1R38A 1XCWA 1X5AA 1I2OA 1Q45A 5L7XL 3OR7B 4YSRA 2GITB 3BGJA 1FVEA 2A85A 5HMDA 2RJHA 3GSNL 1F97A 5DLCA 3IMVA 2J88A 2X6AA 4INFA 3TZVB 3NPZB 2V8ZA 5KYWA 1QRNB 2ITEA 4JFYA 1WAAA 1VEPA 4KY1H 2B7QA 4LU5H 2QIIA 4GAYB 4D9QD 3LN5A 3RLSA 3R4IA 3VYOA 5A2JH 2DQGL 4KRPD 3OVQA 1W0WB 3DIDA 4F5CA 3MRDA 3BEWA 4XWOC 4OCRL 4Q4SA 2C71A 3IMUA 4QNPF 5FO2A 3IDXL 1EGVA 3KDMA 4I9JA 3D2UD 3ZJ8A 5F21B 5E2VH 3UD6A 4GW4A 2IPTH 2DPEA 4WSHA 3ETSA 5EFDA 1AO7A 2J75A 3LKRB 5D5MA 3DETC 2O56A 1WITA 5DUJA 1BWLA 3B8UA 1KBJA 5KS9B 2R1WB 4BK5A 2JQXA 4M7JL 3LIZA 3RM4A 3HZVB 1YYMH 4TVSa 1CMOA 5D8ZA 2DQIL 4XCFL 4AYFA 2DWEB 4HJTA 5EUOF 5EZPA 3QFWA 4JDTH 3SY0A 5I6XB 1PVHA 2C5DC 3WH6A 4ACYA 3WFCH 2AKRB 5GZNA 1ICPA 2OZ4L 1SDYA 5I30L 2ZYSA 4XC1L 1C93A 1D2KA 4GMTL 1YTKA 2XZAH 4DBEA 4WRHA 2ZRYA 5TE7L 1A7PH 1TMHA 3IFOB 4Q4KA 3GZPA 1D5IH 1LVEA 3C8KA 4N2NA 4ZXBD 1Z48A 4C6PA 1JF6A 2AVGA 2Y2TA 5A2IH 3QXBA 5KETA 3BZJA 2KAUC 2IDUA 4FN0A 5J9PA 4Z3FA 2H8PA 1AGBB 5CCZA 3FQTB 3OYZA 2FAUA 3UP8A 5DFVD 5AUMA 1E4HA 3WUBA 2F68X 1JDEA 5FUOL 3IVTA 4JLRB 4Y5YC 2O26U 1CTNA 2BFVH 4IMCA 3UJSA 1EBHA 2XBTA 2WMHA 2BVOB 2NXGA 2ZCKL 4ATTA 1P0EA 7FABH 2LGNA 5DHVH 3MR9A 1XH1A 4AVFA 4MJ5B 4G7EB 3Q67A 1D2OA 2CR0A 2O55A 1B0RA 1P53A 1VIWA 4JN6A 3VFMB 2WJEA 4HKZB 2B1HL 4FKHA 1TEGA 2FUQA 4PJXB 3MMTA 2DTML 4WFGE 1ETZB 2XLLA 2P5WA 3GTNA 5AFAA 1P0DA 1VF5C 4FNLL 1E6OH 3W1UA 4J2MA 2O6CA 5GNYA 2NR6D 3NGJA 1A22B 3DAQA 5AB0A 3VGAB 1R2SA 1YECL 5DR5L 3RX9A 2PXYD 3ALXA 1AY1H 1ZAIA 4YO0A 4FXRA 4ICWA 2JJSC 1JNHB 4YHPA 1CE6A 3QRLA 1AQ0A 2AEPL 1T8XA 1DQIA 2VD8A 3QZWA 3BICA 1I3RA 1VLIA 3A24A 2DYPB 1X9RA 5KYUA 3WD3A 1OPOA 2WCGA 4GRWH 4AEEA 1K8ZA 4P8VA 3E2SA 4Q89A 4OUOA 3VTRA 1PFOA 1ID5I 4CL7A 3T4AA 5HR7A 3ZOAA 4LY4A 4YSUA 4I5RA 5F1OB 4LEQA 5CNHA 2OU4A 4Y1TA 4JGNA 3UP6A 2H1PH 2H6OA 1UWGH 2J1XA 4OCYH 2LU3A 4FQ2H 3S5LA 3MWAA 1HQTA 5C8JA 1SM3H 4TVDA 1S7QB 1JUBA 3ABZA 2PA6A 3K72A 4L9ZA 1T7YA 3F58H 3LS4H 1N4XH 1BLNB 1QX1A 3QB7C 4NRYB 4HPJA 5IWLC 5IQ7L 5PTDA 1IE5A 1S7VB 1ZE3H 3NIYA 1M4KA 4LAQL 3IDIB 2N0KA 3FSAA 3IUIA 1T7ZA 4LQFH 4A2HA 1BEUA 4HW6A 4D6CA 5BRBA 2I27N 3L5JA 1T4KB 3TV3H 4H1LA 3QS3A 5I8EB 1BCIA 5HDRA 4JRWA 4RMQA 3FT0A 4U28A 2OT0A 3GH7A 1BVLB 2GGGA 2IDSA 4EWND 3AWOA 3OG3A 4MXWL 1E4NA 3QORD 3W01A 1R3JA 1L8PA 2G3MA 4ISVA 1BBJB 5D9SA 3KWWA 5ITFB 3MYPA 4PJBE 3MRMA 3TTEA 4QRPD 3R8RA 2PCQA 1LL1A 3HI5L 4Q8NA 1QLRB 1A6WH 4KOCA 3Q94A 3W1NA 4C4KO 4PL2A 3TCLB 3VWKB 3TT3H 1XGEA 5A6JA 4GRLB 3LY0A 4RZ6A 4LB3A 3BOVA 2WOQA 3MA9H 5HP5A 3SZ6A 1UT1A 4PBWD 2B0MA 1O7DE 4R7WA 4ZO6A 3BO8A 5H2ZA 3VJ6A 1I85C 1J9YA 2A83A 1CD0A 4QRAA 1M3JA 3W1ZA 4JK0D 1ENUA 2QPXA 3H3KA 1S6NA 5SWZE 2NY2D 1BVWA 2XRAH 3I4EA 4ERGA 3C0SA 4IIFA 4XBEL 3GIVB 1NFDE 3MV9B 1ASOA 5IM7A 1HHJB 1I2PA 2XZQL 1MEWA 1NF0A 3FSUA 1KY7A 4DWSD 5DC2A 4JDZB 4M7LL 1HKWA 4E0CA 1QOQA 1CDUA 1UOKA 3O8XB 2OR8A 1RLCL 4CGUB 4F37F 3MP4A 4M1DL 3CZUB 1W9XA 3O3DB 1NBZA 4HNLA 1CNVA 1TJRA 1J5HA 3BWWA 1NOAA 1XTLA 4GP4B 1ZHNB 1MW2A 3O2VL 3S34L 2X9WA 3VDHA 1NCOA 3GW3A 1XCQA 1KGCE 4P2RB 9RUBA 5IJKC 1KFJA 3IEAA 4MCMA 5CWSA 4FXKC 3OQRA 1A0CA 3BZFA 3D39A 1YYCA 1N64H 3WK2A 1NGYB 4J6IA 3ULUD 1ZBWA 1GOOA 4Y4HD 1TCDA 8PAZA 3S1VA 4GQPH 3QTGA 3WQPA 1W15A 5HR6A 3APGA 3F1QA 1S9XA 2ARWA 3M1BA 2P5EE 2M26A 5FA3B 3RLVA 4FP8L 5LUMA 4JANB 3DFOA 4FJ6A 1ND0A 4XP1H 3LN4A 3W1MA 1CI3M 3S96A 1GYLA 2GWGA 2J1ZA 5DEFA 2B14A 7PTDA 3BDXA 1X5GA 2BVYA 5EMMA 4Z77A 4RGOH 5A40E 1ID2A 4JKPL 1DQLH 4JY6B 4CBPA 1CQKA 1A14L 5ISZB 4I4WA 5KJRH 1NINA 1IC1A 4YS1A 4ORGB 1KR0A 3F4DA 2VDNB 3LZOA 4JTSA 1X97A 4KEMA 1Q1JH 4HPGA 3PJNA 3ITXA 3O6KH 4MYAA 4ZXLA 1M7DB 4RWHA 3LMYA 3FOMA 1N6VA 3PWUA 1NGXB 3DI0A 3LI0A 4X5RA 4AH2B 4AV5A 5LG6A 3O05A 1JWUA 2GK0A 1GHRA 2WZPA 2HRPH 3ILDA 3UPBA 4BHUA 1FOBA 5AZ0A 1TLMA 5BZXA 3TXZA 1QWNA 4AZ6A 2FQGA 2RIKA 2WK2A 1RHFA 1SJEA 1I8LA 3IU3B 3UGUA 3GD6A 5KZCD 3KDOA 3QPXL 3EB4A 1X6LA 2ODHA 2X40A 2OYMA 4WUUE 1ZGLM 3QY8A 4L8DA 1Q90A 3F2BA 4Z7NB 3CHVA 2HKFH 2DIKA 4LTSA 4HUVB 4IPPA 3BIAX 1WFJA 2W9LA 4B15A 3QC5X 1LD9A 2UUDH 2ICCA 4JFHE 4YUEL 2DORA 1PZ5B 2YD2A 5IMMB 3GWQA 2W38A 3WJLA 4N26A 2HKHL 4MWFA 2WXOA 2UZ9A 1JAEA 2EDTA 3TQ0A 1MQRA 4EI5D 2X10A 1E72M 4LVDA 2EEDA 4IQHA 3ARRA 1WDSA 2LVEA 3FT4A 4ZS6D 3B0UX 3LV6A 4NP4H 3RF9A 1DXIA 2CPCA 4XAKD 5AB9A 3OHXA 1ZGLA 3QDGD 2JKAA 4XP9H 3NWRA 4X80H 4W7WA 3L3JA 3RFZB 3IJIA 5IB3A 3ZPDA 3EOAB 2X1WL 1FYTB 5K39B 4BFIA 4V1DE 3ZDXE 3S5ZA 2ZXDA 3SCQA 4GI6A 1YY9C 3NJXA 4PGDA 4X50A 3QCVH 5ENLA 3BDYH 4D6IA 1IAOB 2QF7A 2XWBA 5DRIA 2SODB 5E1HB 1UXWB 3IGSA 1V02A 2WWDA 1YRRA 1WBJA 2ZUVA 3FOKA 2R8SL 4U1IB 3HLAB 4Q14A 4JO2H 4M56A 4NQCB 5DD0L 1W0YT 3S4SB 3Q9QA 4L8CB 3FQRA 1MHCA 5A3HA 4DW2L 1T80A 2E8YA 4NQXA 3SGJA 1OZUA 2A6DB 4NJ9H 1EQWA 3MLVL 3L2IA 5C0BB 1AL8A 1OE3A 3NEOA 1CDYA 4K94L 4ODUB 4ZPVB 3BQUB 4GAJH 3DPDA 3S88L 3IIOA 4L65A 4HPXA 1PBGA 3CUJA 1YEFH 5CBAB 3GC4A 4X6FB 4OD2A 2B8OT 1IB5A 2A21A 3PV6B 4NZRL 2D9CA 3VDGA 1LF1A 3ZDYF 3N12A 2Y06L 1T83A 5FC9A 3U8GA 3F7YB 4U6XB 3STZB 1TQSA 2X7VA 4G2AA 4R0LB 2GT9B 3OB0K 1ME9A 3N9SA 4ATLA 1DQDH 2OXHA 3SDXE 3IFPB 3U0PB 4PD4J 2X70A 1UFUA 2B4GA 3GS7A 3X3FH 1XGYL 1U8PA 1JZ5A 1G0DA 5KVEL 3M5ZA 3OW1A 4QE4A 1DIKA 3P40A 1LDPH 1Q66A 3GMLA 4YBHA 3EUUA 2INEA 2K6YA 4KKCC 4Y1AE 5AC8A 1FH5L 3CG8A 4B3ZA 2IKHA 4JTKA 1G1KA 4RLDA 3B5GA 4P46B 2Z1VA 1M7OA 5IB5B 5DK0A 1FE8H 3KXFB 4XPBL 2AMUA 2XN0A 3M6DA 4QJ1A 3NQIA 3ET9F 3F4VA 4XZHA 4E8DA 4LVAA 3N15A 3DX6A 3MCLL 1SJHB 3EOLA 5ABGA 4BDVB 4DZBB 2MCG1 4RGNE 4X22A 4AXNA 4XB7A 5KTLA 3BSZA 1TJPA 2QXWA 2GQ8A 1IAKA 3QWNA 3FCTA 1DQMH 3QDMD 4LRNH 2UY3A 3ANUA 3ZTNH 3VUAA 2Y69B 3D18A 4N1CA 2QW5A 2WHJA 3FO1A 1DDHB 2ARJB 3WH7A 3NDYA 5FXCH 1GOQA 2H0EA 1W0MA 1LQ0A 5LGJB 1U1HA 4N86A 3A47A 3LTYA 5FYLD 2VX4A 4BWTA 1HHGA 3G5ZA 5G4OA 1LE9B 5J56B 4RE2A 1BQLH 1WAWA 3LRSB 4K71C 4HHPA 1IQWH 3IVKB 5BV7H 1ICQA 2FMOA 2BOLA 1UOZA 1M57B 2DWDA 4TIMA 1IXNA 3PTDA 3WEBA 1J5TA 4MMZB 3VG9C 2APSA 3GXFA 1M56B 4AY7A 4FFYL 4Z5RA 2ZTJA 4PS8A 1KGWA 4Z3TA 3LYRA 1QOKA 1LLZA 3UEQA 4DPAX 1ZSHA 4PCFA 5HHOA 2O9TA 2JQAA 2EIZA 3MTXA 3VI4B 1VEMA 1FZJA 1E5CA 4GH7B 4IS6A 2HISA 4LL4A 3FS2A 3LH2H 2WVSA 1ZALA 2I07B 5LAXA 2R29H 2V3GA 4M8VA 4YQXL 3TN5A 3WL9A 1SW3A 3I9PA 4PGCB 3U4EB 5IVXE 1QEWB 2PMQA 3L3OB 3S36H 3TVAA 1DBJL 4PCNA 4US5D 3KFTA 5AOIA 1X7TA 2ZUTA 3UBHA 3QQDB 1A4JA 4ZI8A 4OUIA 4K9EH 3IM1A 4FQ1H 4G9FE 3C6EA 5C3TA 3UDWC 3VI3A 3DMMD 1XIGA 4WDIA 4EO5A 4TV6A 4PR4A 3LZ3A 2GOKA 3D3VA 3ATDA 3UTQB 4MZYA 2VQ1B 2WBJA 5IROD 1AIFA 3L2NA 4O9HL 1ZENA 3MVSA 4KMTL 3NFPA 5LKYA 3BGMA 3QJXA 4OZ4A 3L68A 3T8VA 3LBOA 1NC2A 4QXVA 4XIAA 4R84A 1I7TA 4L4TB 5HGAA 2XC8A 1ET7A 2HLAA 3A4EA 3GQYA 4JRXA 5BNXD 2ZPKL 2P28B 4OIIL 4WY0B 2E9WA 2EIKB 4LEEA 5DUPH 5E8EA 2GQAA 3WY3A 3FZUC 1X5MA 2F58H 3HZMB 3KPLA 3FUNA 4NOFA 4NNBA 3L3DA 3DKLA 5DUBB 5A8NA 1R3HB 1OCRB 2VVSA 3QFJA 4JQ3A 4O13A 2AXGA 3W0WA 1DXEA 4MNQB 4M4RB 1FHNA 3NJHA 3TYGH 3F5KA 3IXTA 1P69B 1LOLA 1B1YA 5FO7A 2A79A 3LGGA 1URLA 3FRPG 3LSCA 2OMZB 4NHCH 3H2OA 2VLRE 3RM9A 4JN1H 3UPWA 4GG6A 5I18L 3RTQB 3PXLA 3QEGL 3TESA 4RZ5A 2YQ2A 1R34A 4N68A 1MJUH 5HGBB 1X8CA 4JHZA 4WDUA 1OKEA 3SYPA 3LEVH 3LNHA 2WGXA 3CH9A 2QLVB 2CIIA 1G7IA 4N90D 1QDSA 2A77L 1HCZA 2GI0A 4KI1A 5EU3A 3EWBX 3FB7A 1S46A 2G3JA 3VSTA 3AHYA 3MRCA 2BY1A 1IEBA 3IJ9A 3GUTB 5I73B 2V7HA 3X17A 3ARBA 1DORA 3CDCA 3E9UA 1JXFA 5H8DA 3TBTB 3VOIA 2E5CA 4HU4A 1HVQA 3CMOH 4N7QA 2V82A 5DT1H 3EYUL 3GZKA 4PSPA 3GMQA 4FL4B 3N2BA 5DMLA 2WPBA 3UABA 4GX9A 4JTHA 4WU7A 4X6DA 1V6TA 3FFCB 2CLVA 3B9KD 3ARVA 1RKRA 1T22B 3QJFB 1DWFM 3FW6A 4O18A 4JKWA 3FYIB 5TDNA 3C2AH 1MCIA 2ESVE 1W72H 3DJTA 4GY4A 2FK9A 2KUTA 3PNWB 3H9HB 2VDKH 3ALFA 4NNYB 1RP9A 4JO4L 4P4RA 2H47C 2VEMA 1H7OA 4I9WD 3RBGA 4PTWA 5I5MA 5DZJA 5F4WA 4NAEA 4A8RA 1GPOL 1EXBA 2C91A 4OCWL 3CZSA 1E6SM 5K9JL 2NXZB 4N6EA 2OK0H 3BPCA 3NYZA 3HS0A 3N3MA 5EF2A 1FZKA 3TEVA 4MWAB 1QPRA 4DNMA 3OZ9L 5FUZL 5HHQB 4YXGA 1ANUA 2HAZA 2H6UA 1SU5A 2VZUA 5BO1L 5HYFA 1MHHA 3T6ZA 1CFNA 1AW5A 2F1EA 2BRRH 4HJUA 4G80A 4X9BA 3BARA 4KK9C 3TBSA 1QPOA 3EWYA 1L9WA 4MKSA 1RHCA 1MEXH 3PL6C 4FOUA 5I6MA 1QNZH 3TCEA 4G8EB 3O41B 4IFOA 5HTSA 4OGAC 3TNNA 2D2JA 4PJFB 3PC0A 5JPMA 3QCTH 1Q7ZA 2DBLH 1A3RL 3K7UA 3SADA 2QAPA 4YHOL 4UQAA 2ZOLB 3SE3C 4I0PB 1MCKA 4HPYL 2FFCA 2AJVL 5I71C 5GJMA 3W2DH 1TKWA 4QOKA 3BD5A 3V4UH 1QNVA 4E9TA 2D0HA 1UZ6F 4YSQA 4Z2KA 1NWUA 4Y5VA 3D1MC 3ULUH 1CB7B 3VRLE 2PPEA 3HE6B 3U2SB 3ZR6A 3HLKA 2BODX 3QYMA 2DQTH 3CFKB 1FX6A 5CZ0A 4HKXB 4JM0A 3VFOB 1XBDA 4GQ9L 4MMYB 2IC2A 3CZEA 5AHLA 5EZLA 2NX5B 5I8OL 3FA5A 2R56L 2Q6WA 1TFHA 3ABKB 4IBLT 4BWLC 4PJDA 3P60A 3Q2VA 3CTTA 1V4YA 4GUQA 5GQBA 1CUOA 5IHZA 1TQUA 4WQ6A 4UM8A 1TF4A 4LCVA 2F5AL 1HEZB 1OC7A 1Y6KR 3RFAA 3V4PL 3QGVA 3RDTD 1XLMA 4X60A 5MP6L 4PB3A 3GNNA 1ZBVA 2OL3A 1HHHA 5AQ0A 3OPZL 1G67A 2WO4A 4GQZA 4DN4H 2TRYA 3P4NA 3OXSB 3P54A 3UG8A 5IB2B 5EORL 2LLLA 3KCJA 1Q63A 4OFKA 3SZ8A 3RUGA 5HQMA 4JVPA 3L7EB 2W80C 1J8HD 4UDUB 5C8BB 1I1AA 4Z0BH 5D9OA 4M7KH 3V6OA 3VOFA 3MNWB 4IU2A 1ITQA 3WNLA 4JHAL 3TBYA 4LBRA 1WDWA 1RURL 4F93B 4E68A 3P0YL 4FB7A 3Q6FA 5IMKB 7A3HA 4ODTH 1MFCH 3SE4C 3KBPA 4JFUA 2NV2A 3VRIA 3QK0A 3DV4B 5T3XL 5JOPD 3SRFA 4YPGA 4M81A 3ULAB 2WKLA 3CVHA 3KCPB 3RVUC 4B4FA 5E70A 1ACYH 1PYWA 2V2DA 1V55B 1KW1A 1KB5A 2VXQH 4JJ5B 4XPHL 5CD5D 3E12A 3CU1A 4FOMA 2ZIDA 4LCCC 4J3ZA 1DQKA 2ZOWA 1R0AH 4UILH 3CPLA 5GGRA 4PWGA 1HAWA 1LEIA 4H9YA 4NQVB 4G11A 3W7JA 3F8UB 5E8NB 3T0EB 5KSBE 3A67H 1TV7A 1OAXL 4TQPA 2KZHA 3QXUA 4IU3A 5HPOA 1O75A 3M44A 3E9AA 3O63A 1LO2H 4I7VA 2Y07L 3GVWA 3C5ZB 3IU4L 4KPLA 4R4FL 2PDIA 2DY2A 1AGEA 4P5TD 4NQDA 3S2NA 1AHMA 1E5JA 2V2TA 1M7IB 4OLVH 5DC4B 5IBXA 4HS8H 1IUZA 1R46A 3CFDA 3HMJG 3LPOA 4K1GA 2PRMA 5CLWA 3CH1A 4YK4B 3G1HA 4H9ZA 5TPWL 4JFFA 1KO0A 4DX3A 3TN0A 1B31A 4HTYA 2CJTA 3WQ5A 2ID5A 1ZXQA 3H6JA 2L4OA 4P23C 5CD3B 1OABA 2DWXA 3T8XA 5BOEA 2EKGA 3HI1B 1AC6A 1KTDA 1BX2A 3SIMA 5DQJA 3WCYA 4HHAA 1H63A 1SM9A 1MCJA 5F44A 5CP7A 2IOIA 3AIQA 5GISH 1SHXA 3GBMH 3O3EB 1BVOA 4Q56A 4YX2H 5CFHA 3W7PA 2RR3A 1B2YA 1CGTA 2UX6A 2CCVA 1VPYA 4AIUA 1OK8A 5KVFL 3DRQA 1RFDH 5M1TA 2A9CA 3D25B 4YN3A 4OLUL 1J4EA 3U2OA 3O4OC 5BXPA 3G1YA 4CQDA 4LKXA 2X6CA 3HURA 2OSLA 1O66A 3FB5A 4S1FA 4D6FA 4O02B 4W9IC 2F9BT 3O9WA 1SXZA 3M0MA 3UBXI 5FJUA 3GKWH 3HR5A 3S9DB 3SUTA 5DHVA 1E0WA 4JS7A 4DO5A 3PWGA 1EZUA 3JWOC 3FNKA 1CFBA 1AP2B 3WY4A 3EXTA 4IIZA 1USZA 5IESH 3TC3A 4JRYA 3X12B 3A21A 4YDIL 2QFRA 1V3MA 4HUCA 2PR9A 2OG9A 5C0ND 2OMWA 1KWGA 2VCBA 1P4LA 1SEBA 3VU2A 4RESB 5EU4B 3H2QA 2BSBA 1R24B 2EH8L 5GZOD 3RGHA 1QR7A 3GBLA 1W5NA 4FFWC 3EYQD 2DP3A 4OGYH 4PJGF 5FAAA 5ITBH 1H3GA 3BUQA 4RCXA 4CNIA 2P8BA 1A49A 3FU7B 3P14A 4KROB 2VFFA 5EBMA 3I65A 5IJDC 3HRZA 5LHEA 3FONA 4HTBA 2JH2A 2PP8A 4B60A 4NRZB 3OLDA 4GUPA 1XDJA 1HXYB 5H35A 3S6CA 4O2CA 1TDQA 4P3DB 3G1AA 5E0KA 2DEWX 1A4MA 1ZL1A 4JIRA 3MJ8A 4Y2NA 1PY9A 2CJUH 4OT1L 4AIEA 4G6JH 1R4XA 5T1MB 4JR5A 5FYLH 2J4WH 5I66B 4LEOA 5CJQL 3NFNA 4XMUA 4ZSTA 5EC1A 4YXKH 1NDGB 5DJ6A 4I0CC 4KY2A 1VGEL 5BRZA 3D09A 5I6OA 1AGDA 2EG8A 4NKIH 5D7LA 4ODHL 3UBGA 5B7ZA 3VYNA 3NOYA 1MUJB 5BOJA 4BE5A 3P8JA 4EF3A 1LP9E 4U3CA 2CBOA 1ZRUA 4PJHB 4GQ0A 3MJ9A 3M17B 1Z66A 2WMIA 2AEIT 1MZZA 4IIGA 1ODAA 4JN2B 1SSGA 4QXTB 1JPTH 4MD4A 3FUJA 3O4LD 1RULL 1UB6A 2CJSA 2GDQA 1YC8A 2XA8H 4APQB 3AICA 1MQKL 1TV8A 3FU6A 4LHJB 2UZYB 5J11C 3LKQB 3E9TA 1XGTA 2XACC 2NQDA 2IAMB 4KQ4H 3T1GA 2JIEA 5C08A 3FFDB 2WJZA 2ZUQB 1JPKA 1A3HA 1J8RA 3NEHA 3O2DA 2YCKX 5GRJL 1XIHA 2BXYA 2VDPH 3T6CA 2ZUNA 2H2SC 3O07A 3NT0A 4KKAD 4EMZA 4G6FB 4OZGB 1TPWA 5LXGH 3SD5A 4M03A 4I5UA 4IX2A 3M0YA 3B06A 2GBVA 3GZAA 1PIFA 3REWB 3BD3A 4PGBA 1EDHA 4W9JC 4C1KA 1GJWA 4QGCA 5C2UB 3SB3A 2E7LA 5BQ7A 5AC5A 3UWWA 3TOPA 4FI8A 3DOPA 5L4MA 1AR1B 1OPGH 3MLXH 3DX3A 3BC9A 1CG9B 4MKVA 2YIHA 1RU9H 3ZKND 4XO5A 3P3UA 1I82A 3H2MA 4O02L 1TO5A 4M5YL 1YJDH 2ADAA 1ZT4A 1A9EA 1YNLH 1OD0A 4NJHA 2J12B 4Q4RA 3AIEA 2HJFA 4QXGL 1HKFA 3GMOA 3B2PA 2X1QA 1TNNA 1GC1C 4WJKB 1GS7A 1RZGA 5ANME 3SDCB 3VXRE 3LLXA 1JPGA 5GRUL 4V2CB 3R58A 4YHNA 1NPNA 4NO3A 2QMJA 3V7AG 2XIBA 1G4EA 1L9QA 4WK4B 4I7UA 4AYEC 1B5TA 3KRSA 4EVZA 2J1KA 2OMVB 2RB8A 4EPBC 4EQ2A 5I76B 4TVPE 1OZMA 1OFAA 3AY2A 1WCBA 3NZHH 2DM2A 1SZFA 3WQVA 3LGEA 1E5AA 2W9DH 3KS0H 4DJDA 4C7GA 4HSNA 4HNVA 2BIPA 1QSFB 2BHFA 3C6CA 5FLUA 4UAHA 2ZWYA 4E41D 1DJGA 3BKYH 4XPAL 5L88L 3GJFH 1VCFA 2BVUA 2G3ZA 4GH1A 2F7FA 4RPQA 4Z7W