1U5JA

Propionibacterium shermanii transcarboxylase 5s subunit, met186ile
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
471
structure length
470
Chain Sequence
REIEVSEPREVGITELVLRDAHQSLMATRMAMEDMVGACADIDAAGYWSVECWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNLLGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTISPVHTVEGYVKLAGQLLDMGADSIALDIAALLKPQPAYDIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAIEAGVDVVDTAISSMSLGPGHNPTESVAEMLEGTGYTTNLDYDRLHKIRDHFKAIRPKYKKFESKTLVDTSIFKSQIPGGMLSNMESQLRAQGAEDKMDEVMAEVPRVRKAAGFPPLVTPSSQIVGTQAVFNVMMGEYKRMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQRPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVAPVFFEHRAEGPHSVALTDAQLKAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords transcarboxylase 5S subunit
publication title Transcarboxylase 5S structures: assembly and catalytic mechanism of a multienzyme complex subunit.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
total genus 185
structure length 470
sequence length 471
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF02436 PYC_OADA Conserved carboxylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1u5jA01
1XBVA 4NX0A 1ADOA 4IOTA 2ZFAA 1LRNA 2QUTA 4KFOA 4YMZA 3H55A 3AJXA 5HUPA 2VFFA 3P61A 1KBIA 3N2XA 1KV5A 4TMBA 5BMWA 4B5NA 4Z0SA 3V75A 3PBWA 1R30A 2GUUA 1LBFA 1W5MA 3G1FA 3W2UA 3LHTA 5K9DA 4L4LA 3DXIA 3MYOA 4BWLC 1GOXA 2E6DA 1ME7A 3VNDA 1HFBA 1OFRA 1WBJA 3C2OA 1M7OA 4WY0B 2PC4A 4MFEA 4WX2A 1BTMA 3TAKA 3UZJA 5HR6A 1W37A 2ABBA 4JYFA 2WV8A 2NXIA 4WUIA 2Z0IA 3S1UA 4JTGA 2G95A 3MI3A 4GUIA 4BR1A 1TPVA 3UWUA 2AGKA 4UTKA 4MLJA 4AVFA 1UUOA 4O12A 1F05A 4X22A 1H1YA 4JXCA 3EXTA 1O5KA 3W07A 1RZMA 3NZ1A 2QCDB 1DV7A 4DF1A 5G1YA 1TTIA 3TA6A 1TPWA 4LVAA 4RZ5A 1QMLA 5FEPA 2A1YA 1VHCA 8TIMA 1VS1A 1WDWA 1TRDA 3W73A 2E5BA 1KLYA 3RLUA 2WSRA 4A29A 4DO5A 1LCOA 3ZWSA 4EVZA 2YFNA 4XBKA 4UTUA 4WJEA 3TROA 1TYGA 3NL2A 1FWSA 3W2NA 4CLMA 4K8EA 3GXPA 4QIUA 3KX6A 2X16A 3UYCA 2P1FA 3DKLA 3NGJA 3HOJA 1EEPA 4M7SA 2V0TA 3DENA 2CZ5A 2ZA3A 1SW3A 3LXAA 3PVFA 4H3DA 1LTDA 3KXQA 3ABQA 1JCJA 2QAFA 4UTMA 2VFEA 4GFSA 2DORA 4ZZ9A 3S5OA 1YXDA 3DH7A 3W86A 2YZRA 1LM1A 4O11A 1PCKA 1CW2A 4PODA 3OHIA 5H91A 1FCQA 3BG5A 3LERA 1W8SA 2FIQA 1G7UA 3NQEA 4IMGA 2Y70A 2ZCGA 2ZTKA 1A5CA 4JY8A 2FJKA 5HJLA 2WO5A 4UTWA 3G1YA 1JULA 1VCGA 2XN0A 3WJZA 1QAPA 2P0OA 4Q4KA 1J2WA 4NX5A 5AHLA 2A85A 1JJKA 3H54A 5EA9A 3R89A 3SIZA 3KAOA 3C2RA 5HULA 5LHFA 1BEUA 3DGRA 2X30A 4AB4A 3P80A 4O4WA 3LCFA 3NQMA 3L66A 3QMSA 4WOZA 2VFGA 3LLDA 2NWRA 3KHJA 3IGSA 1F74A 2RHGA 1K02A 4OWGA 5EL1A 3SI9A 5F4SA 1XDMA 3N3MA 1H62A 4NT0A 2X1RA 2Y7DA 3W87A 2TMDA 2QCFA 4UMAA 1UB3A 2NUXA 1FBAA 1HUVA 4O10A 3WJWA 2R91A 4OGZA 4AEOA 5LSMA 3RLVA 5CSSA 4RK8A 4UNLA 3TDFA 1Z44A 2E09A 5K7JA 2OCZA 5BNKA 4ADUA 3S9YA 5C6MA 5IBXA 1DJQA 2DZTA 3BGJA 3JR2A 5SWUA 4UFMA 4HKPA 4MPQA 1VYPX 3NQ8A 3NQVA 3WK2A 3LHUA 5E0KA 1H1ZA 1FXPA 1AL7A 4UFKA 1BWLA 3GYEA 3W70A 5HWNA 2GJNA 5EMUA 3CIWA 3TW7A 5EYWA 4DBEA 4JGDA 1U5JA 3WK0A 3G3MA 2X2GA 4PL1A 2NWSA 3R5EA 5LNSA 1V7YA 3CT7A 5MHBA 2CZDA 2ZRYA 2ZRZA 2RDTA 1VYSX 3TQ0A 1PV8A 4NNAA 3HG5A 5DCEA 4ZVJA 1GPWA 1ZAIA 4PA8A 4JTUA 3YPIA 3TMLA 3MMTA 1WXJA 2BXVA 1DBTA 4FHAA 4C1KA 1N8FA 4JICA 3SSJA 3PAJA 3I6RA 1UASA 1KW1A 1FCUA 4QQ3A 1PHWA 1FUYA 1I2QA 4FNUA 1RR2A 3U8GA 3LTPA 1KM2A 2NXGA 4AHQA 1OF8A 5FEXA 3BW4A 5K4XA 3EWYA 4JX4A 5TBOA 3FYOA 5D2TA 4M6QA 3NM3A 4Q32A 3B0PA 2O7QA 2QUUA 3M16A 4O4VA 5D04C 4JTIA 3BPWA 4RZ6A 3S1WA 4XQ6A 4CNOA 3LBMA 1MEIA 2VOMA 3EX3A 3FLUA 4FNSA 4TMCA 3G8EA 3QPZA 5BW6A 3IVUA 3BW2A 3G24A 1KM4A 1GVSA 2VFDA 4AH7A 4Q33A 4JTJA 4MZ1A 3LGEA 3R12A 2J88A 2G97A 1SZNA 3BG9A 1VZWA 1P0KA 2JKPA 3G0UA 3M0ZA 1OHLA 4M6PA 1I8JA 1Z42A 1A5AA 5G5IA 3CLMA 2PRLA 1H7PA 3EXSA 3JRKA 2YSWA 3C0JA 1X1OA 5D02A 5C54A 4WY0F 1L2UA 3E9AA 5ABTA 4PFMA 2FLIA 3S5NA 4PCFA 1XM3A 4QNEA 4KFPA 4DEFA 1SZGA 2CLKA 3LCIA 4N4PA 2QUVA 4CCEA 1KTNA 1JUBA 5TIMA 2IQTA 1H5YA 2WKJA 1JRBA 5D2XA 4AF0B 4K39A 3W7CA 1PE1A 3S42A 3FJ6A 4NQ1A 1PVNA 4BI5A 4UC5A 3BLIA 1L6WA 5IM51 3ABSA 1OG0A 1LRQA 1P5BA 1GVFA 2V2DA 3TQVA 3EEGA 1GG0A 2EPHA 5F2LA 3W75A 2Y61A 4FX6M 3W7EA 4CCDA 2CZEA 1AK5A 5CKSA 3QEZA 3NR0A 1OYCA 4UMCA 3UWQA 4RR4A 3MP4A 3QMRA 3A5FA 3LCWA 4DELA 5L9FA 3ZS4A 1A50A 3CTLA 3PBVA 3ZFHA 1KM3A 3I65A 4ZQCA 4E0CA 1VGAA 3ZWTA 5CPNA 3G22A 4M19A 2E6AA 4R34A 4WD0A 2V81A 3RU6A 4NJHA 4K37A 3T7VA 3W9ZA 5K9CA 2BWGA 1F6KA 1LOLA 4EOUA 3G1DA 3W3OA 2A4AA 3GX9A 1HO4A 4UCGA 2Z2UA 1F7BA 2CLEA 3E49A 4QNWA 1NFBA 4QAIA 1ZNNA 3E0IA 4KWVA 3UWZA 3G1AA 5I3GA 2Y7GA 4LV4A 1KM0A 5AYXA 4JTLA 2CLMA 3P60A 3P74A 4UTWC 3HIJA 2A7NA 2B4GA 3TFCA 4QITA 3UPBA 1QOPA 2GJLA 2VEKA 5CPOA 3G1SA 1QCWA 3LHVA 5D2WA 3NOEA 1WBHA 5AHFA 2C18A 3TSMA 2OJPA 3GDMA 2VKZG 4EF8A 2PCQA 1M6JA 2QDGA 2GQ8A 1ZCOA 1R2TA 1GVRA 4LS0A 5G4WA 1TQJA 3NQ7A 4WZHA 5AHNA 4I7UA 3HF3A 2YCEA 5U7SA 1B4KA 2ZRXA 2C0AA 4ADSA 1GVOA 1FCBA 1O4UA 4O15A 1VC4A 3A23A 2ZDRA 1YXYA 1KFLA 1U83A 3FEMA 1EUAA 2V2CA 5DXYA 3ATZA 1P1XA 1B4EA 3L67A 2DP3A 3N19B 5HWMA 4X3ZA 2H6RA 3A21A 5AHMA 3DFSA 3NPXA 3EX2A 4BI6A 4ORIA 2ZZ2A 1LORA 5IBXC 5F2MA 4O28A 2VXNA 5AC6A 4NJGA 1EP1A 3QZEA 4IJBA 4OBTA 3W1QA 5AC7A 3GZ3A 1YTKA 4JS3A 4K7YA 3RFAA 2H90A 2E1DA 1Q6LA 2I14A 5CZJA 1AW2A 5H2ZA 1LBLA 3CWNA 1SO5A 2AAMA 5CG7A 2CLLA 3A24A 3EWWA 1AL8A 3QW4B 1WV2A 3N9SA 4MY9A 1V5XA 2XFWA 4JN6A 3P8JA 1D9EA 2BTMA 3OBKA 1SZEA 1NF7A 3QJAA 1TPUA 4WY0A 3INPA 1G4EA 3GAKA 3THQA 3P7YA 4I7WA 4MYAA 4Z1CA 5KMYA 3DHFA 2RKXA 2HS8A 4LU0A 5CZ0A 1FY6A 4O1AA 1W5QA 1WQ5A 1C8VA 2PRMA 2B7NA 4I7VA 4HNUA 3MJYA 2C1HA 5BOOA 4H4IA 1K7EA 4S2CA 1R47A 5CGQA 1JQVA 5G2WA 4FEZA 4S2BA 2ZZ6A 4O8RA 2ZZ4A 4O53A 1TJRA 2WPBA 3I7SA 1JUEA 4UNKA 1I45A 2ISSA 5AHIA 2ZTJA 1SR9A 4EF9A 5FF7A 3C52A 1DHPA 3T78A 3GR7A 1SU5A 1GG1A 4OU1A 4MIMA 3UWVA 3GAYA 3TH6A 1TMHA 3ANYA 3FKKA 5L6UA 3T40A 3ELFA 4FXRA 4O1BA 4UR7A 2CLHA 2FFCA 2C6QA 4OQVA 3T4CA 3CPRA 4YCPA 1AW5A 1T0OA 3DAQA 4XTDA 2Y88A 3GDRA 2J24A 2YW4A 3FJLA 3NQ6A 5AN7A 5I3JA 1JRCA 3PWAA 1TPH1 3O1NA 3EXRA 3FS2A 1WX0A 4MZ8A 1DQWA 1PHQA 2QCGA 5G2HA 4ONVA 3W1XA 3QF0A 1S5VA 4JIQA 1YPIA 1XL9A 2QJHA 4O14A 1X6UA 2J9YA 1A5SA 3MP5A 1D3GA 4R7JA 3IV3A 2ATMA 2QCLA 4YWIA 3LHYA 4UTHA 4FNTA 4CNNA 5KTLA 3TW6A 1JQXA 1PCWA 3A5VA 4IMFA 1KBJA 1FXQA 4HSNA 1GVQA 2Z1BA 1MZHA 1HG3A 3U6WA 4NJJA 1BWKA 2ZA1A 2ZQ0A 3VCRA 2B0MA 2FTPA 3LDVA 3O16A 1VLWA 2GPTA 3MI2A 4N9DA 5D2YA 5EPDA 2Z6JA 1GYLA 1RPXA 4LNYA 4I9AA 3KVKA 4LC6A 4LVDA 2H8ZA 2F7FA 2Y7EA 4RCXA 1OFOA 5D32A 4AXKA 1EP3A 4FXSA 4N02A 3GLCA 2I1OA 3NG3A 2CLFA 2ISWA 2WJZA 3W1LA 1VCVA 4O18A 3NPWA 2XN1A 1LZOA 3TQKA 3DFOA 1SW7A 4DO6A 2C16A 1QWGA 1JCXA 1OFBA 4IGHA 2QJGA 1F76A 3NQGA 5F4XA 3Q37A 1WAUA 4TU1A 4NVTA 1DVJA 4IMEA 1BKSA 5FEZA 3FIGA 2V82A 5D30A 3CEPA 3LI0A 2VELA 2OT0A 1TPC1 2VFHA 3NNTA 2ZRUA 4O0ZA 3K30A 4KFNA 4MYXA 1PS9A 5FF2A 1LOSA 3M43A 4RKAA 3VKJA 3O06A 3GR8A 3C2VA 3F4NA 3VFLA 3W85A 4NXKA 4O0KA 2AQWA 5LHEA 1OFPA 3MHGA 3O6YX 3BV4A 2VEIA 5HR7A 3JS3A 2Q8LA 3W7DA 4LT9A 3IRDA 3M47A 3DFNA 3MYPA 5CPLA 4E2DA 4WOQA 4NU7A 2E77A 3G0SA 6ALDA 4OV9A 2BZNA 2TRSA 3IIVA 4ZMGA 3HJZA 2QJIA 1FDJA 3CU2A 3OIXA 1LRTA 4ORMA 1FDZA 3BW3A 2G96A 2Q8ZA 5AYYA 1VPXA 1XDLA 3UD6A 4K8HA 1DOSA 2JGQA 2NV2A 3A22A 1MXSA 1W31A 4UTLA 1OX4A 1QR7A 2J6XA 4LC8A 4ZQMA 3UY8A 3VE7A 4JDYA 5F2IA 1FWWA 3GXNA 3PUDA 4GE8A 3LV6A 4GUGA 4KWWA 1RD5A 1DORA 3NO5A 3UQNA 3NQFA 2ZYFA 3S5ZA 3B06A 1VJIA 3IIOA 1QDSA 3QW3A 4POCA 3KVMA 3E96A 1ZAJA 3GIYA 1P4CA 1ZJIA 2A21A 3W72A 3NPUA 1G67A 3NQCA 2V2HA 2X1UA 1SZFA 2FB2A 3M7WA 3M5YA 1KFKA 4XKYA 3W2KA 4ALDA 3DHDA 4CNPA 3TSBA 2GOUA 4UTIA 3E12A 2EGZA 2WNQA 3WJXA 2QCHA 3O07A 4UFJA 4PL2A 1VRDA 1F2JA 1H60A 2YR1A 1G6CA 3N9RA 3Q94A 4NNCA 3OVRA 3NL3A 4O13A 4K6AA 4ZQNA 1RQEA 3WJYA 3CEUA 3P82A 4HHPA 1ZENA 3M9YA 4DF2A 1I2OA 5K9XA 5KZDA 1WA3A 4GRSA 4NUWA 1OK4A 4JY9A 3NZRA 2B7PA 3KVJA 1K8ZA 1PIIA 2WSQA 3TXZA 3P5YA 4Z0JA 4R53A 4HNVA 2HMCA 2D73A 1GJPA 3M5VA 3PG9A 1JVNA 4RZ4A 2ALDA 1EP2A 4HN4A 5EBUA 1ZHAA 1IXPA 1KFEA 2C3ZA 5LNRA 1OF6A 2H8XA 4MY1A 1QPQA 4UUIA 2YXGA 1W5PA 1FWNA 4IX0A 5FI8A 3DI1A 2QDHA 1GZGA 1ALDA 3KRUA 3W23A 3CWOX 4MKNA 3VI2A 3C6CA 3TAOA 3CIXA 3STCA 3TMQA 1TTJA 3C3NA 3GKFA 3W7LA 3TNOA 4ML9A 4OE7A 2VFIA 1L9WA 2J27A 3FFSA 2X1TA 3PUOA 4JX6A 4FNPA 2ZZ5A 3QRHA 4IMDA 4N6EA 4HNNA 4OT7A 4CCCA 3QYQA 3FKRA 1AMKA 1K3UA 2RH9A 3DFPA 3W1UA 3QMTA 3UZ5A 3O8AA 5I3IA 4G1KA 4Y6GA 3EX1A 2Y63A 1DQXA 2FPTA 2ISVA 5KITA 3W7PA 4DBDA 3QH2A 4YL2A 4MOZA 1OFEA 3EWUA 3L5MA 4QSHA 1H50A 3RF9A 1RQHA 4O1DA 3NDOA 5K4ZA 7TIMA 1TV7A 2OX1A 3W7JA 4K36A 4DPPA 1Q45A 1Z48A 4IWWA 2GVLA 3M5XA 4GJ1A 6TIMA 3O6DA 4N2YA 3B8DA 1LP6A 4MLRA 1W56A 3RK8A 3QC3A 3LHZA 4WXZA 4K38A 3WK1A 4JR5A 4MY8A 1N7KA 1GYNA 4AMAA 3UNDA 4BFAA 5FEWA 1SUXA 3PC0A 1PL9A 1NVMA 2V8ZA 4LRSA 4MJZA 3C56A 4E2BA 3OVPA 1YLVA 4QM1A 3SECA 1TJPA 2NX9A 3PUEA 5F1UA 2YDAA 3W7GA 4XUGA 5D09A 3DBPA 4CQ8A 2BLEA 3EKZA 4DO4A 4ZQOA 3TC6A 4N6FA 2NV1A 5FF0A 5EY5A 4N4QA 1KFBA 1TV8A 4C1LA 2QR6A 4P2VA 3KRSA 1SO6A 1W0MA 1ONRA 1WOAA 2E68A 5D05A 4ZQRA 1F5ZA 3IIZA 1G4SA 3I68A 3ABOA 2B7OA 2NX1A 2FB3A 1CI1A 1I2PA 1KM1A 4M5PA 3B03A 3W1TA 2A0NA 4FIRA 4IXXA 2WOQA 2QKFA 4JYEA 1VH7A 5C5YA 3W7MA 3SJ3A 3TXVA 1YTDA 3NL5A 4TO8A 2DZVA 2NZLA 5AOUA 3THAA 3T44A 1LBMA 1JCLA 1DJNA 1ME9A 3HO8A 4ICNA 4EWND 2ZZ1A 2A2IA 1GQNA 5C2XA 3EWZA 1JCNA 3BLFA 3LCHA 3GVGA 1MEHA 1UJPA 3PS7A 3B0UX 1OFAA 5DXXA 3BG3A 1IXNA 4WQ6A 1XCFA 3R2GA 2ABAA 1OK6A 3L65A 3PY2A 3BVJA 3NYZA 3PG8A 2CU0A 1W5OA 2VC6A 3SGZA 5KZEA 1JR1A 2YYTA 2V5LA 1KLZA 3UXDA 4UMBA 3M44A 2RDUA 4X9SA 3GDLA 1YYAA 5HINA 2TSYA 3W1MA 2VEPA 4UTJA 1R46A 3CM4A 4O57A 3HGSA 3IGUA 3C2EA 3TR2A 1ICSA 4UTTA 3LCLA 2GQ9A 3O6CA 3MP3A 3STGA 2C13A 4NNBA 2FPVA 3LRMA 3C4UA 3P8IA 3O63A 3BARA 4IXHA 4JD4A 3PM6A 5F4WA 1Y0EA 3WK3A 4XWUA 4YLWA 3LCXA 3HG2A 1QPRA 4N9CA 1RV8A 3L0GA 1TREA 1XI3A 3P84A 2JGYA 3DKJA 1RQBA 1LOQA 1RVGA 1T96A 4N9EA 4QJ1A 4GWEA 3MBFA 3MUXA 3NL6A 5LGZA 1XBZA 3IIPA 1P0NA 2LLEA 1ZFJA 5AYZA 1H7RA 1UUMA 1C9DA 3MW7A 3W74A 3QFEA 4MZYA 3H53A 2C14A 3G1HA 2YYUA 1XKYA 2A5HA 1QPNA 3EWBX 1TQXA 1LDCA 4RXFA 5G4EA 2GVJA 4LW7A 5HUOA 5LNUA 4MUZA 3C2FA 2HS6A 2VEMA 1Q6OA 1X8FA 3L21A 2EHHA 1OVDA 3MI6A 5EKYA 1H63A 3G18A 1ZAHA 3LV5A 3W1NA 3HG4A 2QCDA 4D2JA 4ZL1A 3KRZA 3QM3A 5F1VA 4M6VA 3U2OA 3S0CA 2OT1A 3S8HA 5HQEA 5K3VA 2PURA 3SR7A 5LZLA 3HMJG 3GXTA 3SFKA 2FQIA 3STFA 3STEA 4QISA 2YX0A 1AW1A 2QEZA 2X1SA 1KFCA 3IVTA 1JUKA 3BGGA 1OYAA 1K8XA 4PH6A 4U4MA 4JDBA 3NEVA 2ZBTA 5LKYA 1J4EA 5I3KA 1HO1A 4NXSA 2GVGA 1SW0A 4LS1A 4M7TA 2EAWA 3OVQA 1ZY9A 3SW6A 4GBUA 4DF0A 3TCEA 3W1RA 1KM5A 3W1PA 2CW6A 5AHEA 3TSDA 2F84A 3HG3A 3N14A 4FB7A 1YDNA 2E6YA 2R94A 3MHUA 4O54A 1T8XA 3PBYA 2OZ0A 4JIPA 2H3DA 2ZA2A 5D33A 2QAPA 1H7XA 2HSAA 1CX9A 3M6YA 1W5NA 3UY7A 1GT8A 4LWWA 3F4WA 3W7QA 3LX9A 4FIQA 5F2GA 1ME8A 3W7RA 3AO0A 4YCOA 1IXOA 5KSWA 1XUZA 4Z08A 4DPQA 4FNQA 3GB6A 3W76A 2A7RA 4FNRA 2H3BA 3TE9A 4IQLA 1MO0A 2Q3OA 1YDVA 3L5LA 4IUOA 3W7IA 1FWRA 1YADA 2DU2A 4X2RA 3B04A 2JK2A 4ZQPA 2OMAA 3CHVA 3L2IA 4FF7A 3PULA 4Y96A 4YXGA 1Z41A 3NAVA 2QCCA 3M5ZA 3L0KA 5HNRA 3N34A 4A2RA 3T55A 2BX7A 3S6DA 4CQ9A 1XBXA 4XZ9A 1B9BA 3FYPA 2R14A 5J5DA 5DCBA 1Q3NA 3W83A 1I2RA 3GNDA 3I7QA 3O05A 1EPXA 1A53A 4AAJA 5G2IA 4MVAA 3TV8A 1ZALA 1HTIA 3A9IA 4HT3A 3LTYA 1IF2A 5CZSA 4GXMA 2WSYA 2Y6ZA 4BF9A 3P5ZA 3R8RA 5J5RA 3NM1A 5U4NA 1K03A 1QFEA 1H7OA 2ZRVA 5BMXA 3LCGA 3L9CA 3IEBA 1TRIA 4TR9A 3LTSA 1KA9F 4MJMA 4LUIA 2FDSA 5DY2A 4A21A 2CWNA 5CZTA 1SSDA 3F03K 4JX5A 5K2ZA 1L6SA 1F6PA 3QSRA 4UFIA 2ATSA 2E5CA 4JNMA 1DL3A 5AFDA 4AHPA 4HNTA 3PSWA 5C55A 3NVTA 1W3NA 3UWYA 3C61A 4O50A 5AB3A 4JYDA 3W7KA 3UPWA 3W7HA 3UXAA 1G69A 4Y9AA 2BSLA 4AHOA 3OEXA 4GUJA 2DZPA 2ZZ3A 2FPYA 1MSSA 5T26A 3KFTA 2W79A 3KOFA 3N2MA 3PBUA 3B4UA 3ABRA 5DCDA 1G4PA 2WNNA 2DZUA 2EKCA 5DELA 4AWUA 1VHNA 3HPZA 3G0XA 3TK7A 1YDOA 3LLFA 4FX7A 4LV9A 1LLZA 4J9JA 3EKLA 1H7WA 3CC1A 1LYXA 3G8RA 4UXDA 4PC8A 1TPFA 3EWXA 3S1XA 4P61A 1EWDA 1K7XA 1THFD 1I2NA 3QQ0A 3HBLA 1OX6A 4FX8A 2DJXA 3EB2A 1G7VA 1UCWA 1O60A 3N73A 1M5WA 1X7FA 2CLIA 4UTTC 3M1ZA 3HQ1A 1QO2A 1VR6A 5D03A 3TC7A 3GK0A 2TYSA 1Q6QA 3RNDA 3TJXA 3W88A 3QSTA 3ATYA 4Y8FA 1IXQA 4HIBA 3FA5A 4RX0A 3DFTA 3IVSA 2W0UA 2Y7FA 4LY8A 1X1ZA 5DN1A 1TO3A 1TPB1 4IPIA 1SSGA 1KM6A 1E51A 5AC8A 1TIMA 3DFQA 4H6KA 4S1FA 5FF3A 2Y85A 3GKAA 4DXVA 4LVBA 5E1QA 3BK0A 5TQLA 3LBCA 3WJSA 1H61A 4BK9A 1XC4A 1OX4B 1WOBA 1ICPA 1S3HA 3W71A 4U28A 1M7PA 4PEKA 3W2LA 3B0VC 2TPSA 4LS2A 1O94A 1W1ZA 3HGJA 4UFHA 4GC4A 4GUHA 1VLIA 3LHWA 5BRBA 1QPOA 1TPEA 4DQWA 5CSRA 3CB8A 2QCNA 1SO3A 4UIOA 4BWLA 4AF0A 4N9BA 1A5BA 4GUFA 3L5AA 5LNWA 4XKYB 2KZHA 3ZR4A 4CQAA 4XTIA 5G1TA 1NSJA 2A6LA 4OHQA 1T99A 3M41A 3PB2A 2J9XA 1EX5A 3TFXA 3W22A 1J5TA 1G4TA 1B3OA 1FDYA 1IIHA 2P10A 4IMCA 3OG3A 1OYBA 5A8GA 3G1XA 3L0NA 2DZWA 4O16A 1TPDA 3LRLA 3CQ0A 4FO4A 3EX6A 4UR8A 4JTFA 3P81A 3W2JA 2YPIA 1SFLA 3LRKA 4NZFA 4BI7A 3SGUA 1H7NA 1EUNA 2G5WA 3HPSA 3E02A 3SZ8A 1L6YA 4A3UA 3LXCA 1VYRA 3V1PA 4RV8A 3RMJA 3W7OA 2I9EA 1NAL1 1FQ0A 2NUYA 1XBYA 1W54A 2Y89A 1D3HA 5I3FA 4O1CA 1YPFA 1TCDA 3F1QA 2UV8G 2YW3A 3PSVA 4LUJA 3W2MA 4OV4A 5A5WA 2W6RA 3UWWA 1TSIA 5FF4A 3HPXA 5I3HA 1DKWA 5D38A 1XFBA 3EX4A 2R8WA 3O15A 1GTHA 4PTNA 5D2VA 4UFLA 1S5WA 4MFDA 4RJEA 1LROA 4AWTA 1SFJA 2ZRWA 3DZ1A 1TTPA 2ZZ7A 3PR2A 5KZMA 1FWTA 5DY3A 1IGSA 4JTKA 4IX2A 2PRHA 1KFJA 1JCMP 1EA0A 3MO7A 2CFFA 1FCVA 5HMSA 3LM7A 1SPQA 1ML1A 1K7FA 1FX6A 2A6NA 4JTEA 4HPXA 1NEYA 1S5TA 5GVJA 3FOKA 2RFGA 4ADTA 2B7QA 3OA3A 4HPJA 1QO5A 2NXHA 2YGYA 4JTHA 1C29A 1OABA 3S1VA 2DZSA 1R2RA 1QOQA 5DBTA 3W7NA 2Q3RA 2GQAA 4GNJA 4JTSA 1W3TA 2VENA 3C8FA 1O95A 2CLOA 3LB0A 4E38A 3VE9A 3DU0A 2NLIA 4Z1DA 1O5XA 3PB0A 2C15A 3SY5A 2JBMA 1TV5A 4NZJA 4O17A 1OX5A 2QCMA 3P62A 5LNVA 4NJIA 3TKFA 1TTQA 4Y90A 4AWSA 5E93A 2V5BA 5LGXA 5HWJA 1SQ7A 2RDWA 2QF7A 1SO4A 3S5YA 4HSOA 1LLWA 2WNZA 5KINA 3G1VA 4LOCA 4TIMA 1MEWA 5DBUA 2JKAA 3WFAA 3PF3A 3GNNA 1UBSA 3IIXA 4Z1BA 3L68A 2J9ZA 4TX9A 4NJKA 3LI1A 3NQAA 1KTCA 3Q58A 2NX3A 3HB9A 4L4MA 2A7PA 2XN2A 3P67A 2QCEA 1OFDA 2NUWA 2DJLA 1Q6RA 1HL2A 3KVLA 4KKXA 3W1AA 3TU9A 3NQDA 3MWAA 4LVFA 4A2SA 3Q2DA 3I7RA 1VCFA 1YXCA 3TIMA 5DLCA 5FESA 4EIVA 1OFQA 3QQ1A 2E6FA 4IPJA 3HGRA 2CZFA 2DZXA 3MHFA 1VQTA 2O7SA 1R2SA 1W3IA 3TX9A 1GTEA 3R13A 3B05A 4LVGA 3W6YA 2Y62A 2C19A 3LOTA 1I4NA 2V9DA 1OJXA 1XXXA 1EIXA 3NPVA 1WYIA 3NXFA 1IIGA 4WXYA 3IGXA 1K8YA 4JEQA 4JTTA 1KV8A 2PE4A 4R33A 3USBA 1GWJA 1GEQA 1YTEA 1N55A 3TUUA 5CPMA 1EB3A 3HGOA 2YFOA 4Z1AA 2JKEA 1XUUA 2EF9A 3D0CA 1ICQA 3G3DA 1QNVA 4RLIA 4RXGA 5D37A 4LTSA 3W84A 4XBSA 3MBDA 3NQ2A 1AG1O 4K7VA 3BO9A 1KTBA 1TB3A 1JCYA 3DI0A 2E5DA 4W9TA 2HTMA 3NA8A 1NF0A 3GDTA 2WQPA 2Z6IA 4LRTA 3GDKA 1H51A 1B57A 4O52A 2V30A 1EWEA 3LXBA 3QPYA 4A22A 3TJLA 1F73A 3BLEA 4O19A
chains in the Genus database with same CATH superfamily
4NX0A 1L8NA 4IOTA 4DAIA 3H55A 3BQ5A 2VFFA 3P61A 2GWGA 5BMWA 4B5NA 4TTGA 1LBFA 3LHTA 3MYOA 1JCTA 1J6PA 4DI8A 1HKVA 3C2OA 1M7OA 1UR8A 3WNPA 4WX2A 2F2KA 4FXJA 3TAKA 5HR6A 3OVGA 3N15A 3LY0A 4NAFA 3FHAA 2WVSA 1CB2A 3CV6A 3M0VA 2G95A 3MI3A 1SZRA 1VFSA 1I1WA 1TPVA 2Z25A 3BAWA 1US3A 2A3LA 1FVPA 4KW2A 2EQDA 4AVFA 4E3TA 4O12A 4JXCA 1XFCA 3EXTA 3VOCA 2ZVRA 1RZMA 3VGGA 2Y24A 4DF1A 5G1YA 4LVAA 1TRDA 4M6UA 4DO5A 3VNZA 3ES7A 1LCOA 3ZWSA 1WO2A 1L6GA 5I03A 4QDPA 1W3LA 4JTRA 3P2VA 3EPMA 3W2NA 2F8QA 1UWIA 2J74A 6REQA 1KB3A 2PAJA 3NGJA 2INZA 2V0TA 3V35A 2WVTA 5DFAA 3VOHA 3W28A 2EG8A 3K4AA 3VA8A 1P6WA 2XWEA 1BYCA 4LFYA 1JAEA 2FTWA 4DHGA 5JBEA 2PLCA 4PODA 5H91A 3AXIA 1SMDA 5JBDA 2I16A 1A5CA 4JY8A 4ZEPA 3MMUA 4UTWA 3G1YA 3D46A 3W4RA 5JIWA 1IEIA 2O9TA 1VCGA 2XN0A 3TN3A 3OW1A 5LHFA 1B3YA 3S83A 4AIBA 3EB4A 3LCFA 1GNXA 1HL8A 4JQ1A 3RN6A 4BZYA 3QMSA 1K70A 3CV7A 3OZMA 1DXEA 1F74A 3ABXA 2RHGA 4H6EA 4OWGA 2JALA 5M5DA 5HDRA 1H62A 4NT0A 2X1RA 4Z2HA 2Y7DA 1T5AA 1IHIA 1HP4A 1UB3A 4F2UA 2PA6A 2XFYA 3VNMA 2OU4A 1HUVA 4J3TA 3APGA 2R91A 2WMHA 4AEOA 1US0A 2PZNA 4V1YA 3MWCA 3HFYA 2Y5EA 2Z1WA 5K7JA 2HVMA 3GVWA 1YDYA 1DWHM 1I75A 3JR2A 1POKA 1G5AA 1ISZA 4RPPA 3CH9A 4HMCA 1IE7C 3BICA 1IZKA 3BURA 3NQVA 5E0KA 1H1ZA 4I5XA 5AYBA 3S6TA 4LPCA 2GJNA 1Q2SA 1GONA 4G56A 5EMUA 1KR1A 4DBEA 4DUVA 4JGDA 1NWSA 2NWSA 3K1DA 3R5EA 4C7GA 4P5UA 5MHBA 1F3XA 2CZDA 4MNJA 2ZRYA 2ZRZA 3CB3A 2RDTA 2BGQA 2NT1A 1IT8A 4NNAA 4IGNA 5DCEA 5AZ1A 1ZAIA 4PA8A 3HMCA 4XISA 3CO4A 1Q5MA 1Q7QA 2DH2A 1QNSA 1WXJA 4FHAA 4E2OA 3PAJA 3BMVA 1UASA 1RCOB 2ZXQA 1FCUA 3PZQA 1XLCA 4AZ7A 1FUYA 2BFGA 3U8GA 1TR1A 1KM2A 1PDZA 5EU9A 4K2SA 1OF8A 5FEXA 4GQBA 1E1FA 1AZ2A 1FWIC 3WLPA 4Q32A 1E5JA 3GIQA 1HF6A 4HU4A 3L4VA 4MWAC 3BPWA 4RZ6A 4XQ6A 3LBMA 3AZSA 1MEIA 3PZGA 2J77A 2PDUA 2ZVIA 4PMDA 3EX3A 3CV2A 4G5DA 4FNSA 4TMCA 4UQDA 3RYSA 1BSIA 1NDYA 3LS9A 1EQPA 2VFDA 3DIPA 4RUBA 1HX0A 1F07A 4C6MA 4J3UA 3BG9A 3V3WA 3G0UA 3WQCA 1SJAA 2VGIA 1I8JA 2XH4A 1SJCA 2ZKMX 3E1F1 5G5IA 1I60A 7A3HA 4GKTA 2YSWA 5D02A 5LA1A 1RK5A 4LNCA 4KFPA 4DEFA 2CLKA 2YBTA 3LCIA 5CJ5A 2DW7A 3MKCA 5XIAA 3UWEA 1TA3B 1XIBA 3ZZ1A 3VD3A 3W7CA 3S42A 3D3FA 4NQ1A 4UC5A 4HNCA 4YTRA 3NDYA 3AHVA 3WNKA 4IQJA 4AZ6A 3TQVA 4OBSA 4NKCA 4X9YA 3Q4DA 2EPHA 1XQLA 3TONA 3W75A 4NAEA 1AK5A 3H8AA 1B54A 1R3SA 3UWQA 3H21A 3MP4A 3QMRA 1GK8A 3AWOA 4C6JA 1JEZA 1UOKA 4DELA 1UWUA 4LXFA 1VFFA 4K1GA 4ZQCA 1TKKA 3ZWTA 4HU0A 4R34A 4WD0A 4PUEA 3KL3A 8A3HA 1TE6A 3M0LA 3THDA 3W9ZA 4HK5A 1F6KA 3G1DA 3BLOA 3W3OA 4FLRA 1HO4A 1UG6A 2VR4A 1KCXA 2Z2UA 3IRSA 4LYRA 3IGHX 3MJMA 1AZ1A 3E0IA 2VOTA 2Y7GA 3CV1A 1MQPA 4YYFA 5EMYA 3AXKA 4M0XA 4JTLA 4PUJA 3H7UA 4BY3A 2A7NA 2HXTA 5CC6A 2FMOA 4F2BA 4CVWA 4J2PA 2ZX6A 5C0QA 3NOEA 4R85A 1ISVA 3TCSA 2OFJA 3GDMA 2CITA 2PCQA 1UKQA 1R2TA 4LS0A 4QE5A 3UETA 4I7UA 3RLHA 3SGGA 1B4KA 2ZRXA 2UY2A 3UCCA 3GFZA 2C0AA 2AGTA 4AW7A 4D71A 3FEMA 1FKXA 2JF7A 5DXYA 3L67A 3N19B 3FVDA 1U1JA 5AHMA 4IP4A 4OOZA 3DFSA 4HBKA 4BF5A 4QGCA 4M81A 1JG9A 1LORA 3SN1A 5IBXC 2VXNA 2Z1SA 3KM8A 1JYWA 4BEUA 1EBGA 3W1QA 4L9ZA 1YTKA 2HPIA 4H19A 4JS3A 3QY6A 4MNLA 1I9CB 4TX6A 5CZJA 4MNKA 1RUSA 1E55A 1WV2A 3U5UA 5H1WA 2WQDA 2XFWA 3ARWA 2BY1A 4US6A 1Z32X 2BTMA 1XV8A 5FOOA 2HV5A 3I3EA 1G4EA 3THQA 2DV0A 3GNXA 4Z1CA 1CZ1A 3WZ0E 3DHFA 4ES4A 1DIEA 2QUNA 4LU0A 5CZ0A 1FY6A 2J25A 4YVXA 1ZBKA 3EBVA 3WUEA 3H22A 3RR1A 4IUGA 4WKAA 2PDNA 2PRMA 3FDKA 4LCSA 3OLIA 2J4GA 1MI3A 3PZMA 2PDJA 4TV6A 3SRDA 1C8QA 3F7JA 2ZZ6A 3I7SA 2WMJA 1JUEA 4I90A 2ISSA 3CPUA 1SR9A 4EF9A 4S3BA 3T78A 1CWYA 1JNDA 4DNMA 3NSNA 5I79A 4MIMA 3UWVA 4G7EB 3TH6A 5L6UA 3I6EA 2Y8UA 4CKQA 5CJNA 2CKSA 3LQLA 2C6QA 3UJRA 1AW5A 3DAQA 1KKRA 4XTDA 3GDRA 2J24A 2YW4A 5AN7A 5I3JA 1JRCA 1TPH1 4F9DA 1WX0A 4HMEA 2XDFA 1PHQA 5G2HA 3W1XA 1S5VA 5IXEA 1XL9A 3ZT7A 2QNEA 2WJDA 3CPGA 4H2HA 3AU2A 3IJIA 3KE0A 1X38A 1W1IE 2BVTA 3NUKA 3VMPA 5A8PA 2BP1A 4IMFA 1KBJA 3GG0A 4HOZA 4REQA 3GY1A 4PRTA 2P53A 3AMKA 3SUWA 1F61A 4QTGA 2DSWA 3VCRA 1PX3A 3LA4A 2D0HA 3LDVA 1VLWA 4N9DA 4D6JA 3V5CA 3UYIA 1UWQA 2Z6JA 1GYLA 1RPXA 4I9AA 1KR0A 4LC6A 3RMEA 3D47A 2H8ZA 4WGHA 2F7FA 2OG9A 2V68A 1OFOA 1E43A 4UZUA 1EP3A 3GNPA 4FXSA 3W38A 1V6XA 3NG3A 5I78A 2CLFA 6XIAA 4GXPA 3B8TA 1VCVA 3O9NA 2F38A 4G6CA 3RJYA 5FAGA 1UC5A 1SW7A 4MDPA 1QWGA 1OFBA 5F4XA 4B92A 2FGZA 5CPTA 4NVTA 5EFDA 3IARA 1BKSA 3VIHA 4XZMX 2V82A 3CEPA 3E74A 2OT0A 4GI6A 1XWYA 3EPNA 3AS0A 1KXTA 4KFNA 4F0SA 3XIMA 3SQLA 1L6FA 5FF2A 3B97A 1LOSA 4RKAA 2QUMA 1X1NA 2I5IA 2PP1A 3IWPA 1ADSA 5IDIA 4NXKA 4GI8A 4GXWA 4XAYA 4O0KA 2DW6A 5LHEA 1V8EA 3GXFA 5C2CA 1BXNA 3NIYA 4GY7A 2Q8LA 3W7DA 4LT9A 1ESWA 3MYPA 4E2DA 1A5KC 1NQ6A 3ITTA 1REQB 1X7IA 3OZOA 2E77A 2Z29A 4GG9A 3WLNA 3DG3A 1V02E 4S38A 2DUZA 1UIOA 3H2EA 5HK4A 3WBAA 3CU2A 1AQMA 1LRTA 1XRSA 3BW3A 5AYYA 3TWAA 2BOFX 4EANA 3UD6A 2PSNA 2NV2A 3A22A 2QPUA 5LIWX 1VBJA 4E3VA 1VPYA 4HOXA 1FOBA 4BEQA 3UY8A 5F2IA 3PUDA 4GJIA 4KWWA 3Q45A 3WH5A 1R9ZA 4C5YA 3AQUA 3SCOA 3IIOA 2WMIB 3QW3A 3PANA 1GOOA 3AXXA 1ZAJA 3GIYA 1X6LA 3NPUA 1DTNA 1G67A 4ZBCA 3BUVA 3P0WA 3M7WA 4XKYA 3M5YA 4XIAA 4ALDA 3KBJA 4LBRA 2WNQA 3O07A 1VRDA 4NZ3A 1F2JA 5ABEA 1HVXA 2W9MA 3Q94A 3WJYA 2P3EA 5I5RA 1IWAA 1ZENA 1MQRA 3CS2A 3DC8A 4MHBA 1I2OA 4C6OA 3H2NA 4Z2LA 1WA3A 3I10A 3TYCA 3TLQA 2IPGA 1PZ3A 1OK4A 4JY9A 3NZRA 1AODA 1F9CA 5HNNA 4IQDA 2V5DA 5CPSA 3RXZA 3MSYA 3A3XA 1FH9A 3RPMA 2OQYA 1JVNA 4RZ4A 4OOUA 2ALDA 2ZWZA 1DP0A 4D6FA 3VZYA 2FYMA 1TVLA 2MANA 1OF6A 3TTQA 3R79A 4Q8TA 2H8XA 1M01A 1PBGA 4LUSA 5A8MA 4A3HA 4JHZA 4CEXC 3UFYA 4DWSB 2GOKA 3GE7A 2BASA 4EXAA 2VZTA 1E0UA 1B3WA 4MKNA 4AEEA 3UGVA 4ICMA 3NO3A 3C8NA 4CN1A 4CCZA 1V3HA 2X41A 1BF6A 4ML9A 4EWJA 2NQLA 1Y65A 4M8UA 1LF1A 1KQZA 3FFSA 2X1TA 4FNPA 4PMYA 3CT2A 3AAMA 2P50A 4HA1A 3QRHA 3GTFA 4HNNA 4CCCA 1K3UA 1RLCL 1Q65A 5T8GA 4V2XA 2CBVA 4G1KA 5H8UA 3L7RA 3MANA 1CXIA 4YL2A 3PZIA 3L5MA 1UR1A 1LT8A 1RQHA 1RJRA 3S1GA 2OX1A 4DZ5A 3W7JA 1Q45A 4WDTA 3AJ7A 2GVLA 4GJ1A 2POZA 3B8DA 1CENA 5I77A 1Q2RA 3ARVA 4MLRA 2ZC1A 4PMZA 3B0YA 4D1JA 1PKNA 1NELA 4MB1A 1BXCA 4UOQA 4DIAA 4LRSA 4MJZA 4E2BA 4NYUA 3UU0A 3W7GA 3GU2A 3K13A 5D09A 2WZHA 4ZQOA 4IT1A 4N6FA 3BAXA 4WR3A 1ZRQA 2CETA 4GYJA 1KFBA 2DUXA 9XIMA 1Q6EA 3QQWA 5A6SA 1VBRA 4XAZA 5E9AA 3NJ3A 3GNRA 1SO6A 4HTBA 2XFRA 3MUAA 2E68A 5D05A 3RRXA 4HHLA 5A69A 2MNRA 1UH3A 2IKHA 2AKMA 4HSHA 4H83A 1KM1A 1UA3A 4H7VA 2HROA 3W7MA 1YTDA 1AJ0A 2NZLA 5AOUA 4ZE4A 1DJNA 3NCOA 1ME9A 3WO8A 1TFVA 1W17A 4G7FA 4ICNA 4PB4A 3FSUA 2ZZ1A 3K5XA 2FVLA 3LCHA 4RV3A 3M0MA 2CNCA 3F2DA 3B0UX 2J79A 3I3BA 3MKVA 4U5KA 1WKFA 4WQ6A 3GHSA 5C7HA 4PTDA 3R2GA 1OK6A 3JUGA 2PZ0A 1PTGA 4OTKA 4D8ZA 4GZ7A 2VC6A 3SGZA 5CG0A 2YYTA 2V5LA 1X6NA 3OGSA 4JHOA 5REQA 2RDUA 4X9SA 5EMLA 5A95A 2W92A 2E1WA 3W1MA 3VKAA 5JQ9A 3CM4A 1ZJBA 4WF7A 4FMVA 1ICSA 2GQ9A 3QLDA 3QV9A 2A3EA 4WGXA 2VVNA 3H12A 4QDMA 1DEDA 2FPVA 1RVKA 5FL1A 3QBUA 3WK3A 5DX7A 1O5QA 3I4KA 4DNHA 3OTRA 4ZXLA 4V28A 1MW1A 1TREA 2VURA 3P84A 4DRSA 3SAZA 1RVGA 2ZE3A 4N9EA 4GWEA 3MBFA 3KDOA 3ARTA 2V5JA 1UUMA 1C9DA 3W74A 3QFEA 1SVDA 3H53A 4W5UA 3FNDA 3G1HA 2YYUA 3ITYA 4L64A 1NFPA 5HUOA 1EJVC 2D2GA 4IISA 4ZO9A 1EGVA 4MB4A 4M80A 1X8FA 3L21A 4PMNA 2XVGA 3UG5A 5A6AA 1ZAHA 3LV5A 1KXHA 3HG4A 1ZZMA 3TP4A 1OGGA 1XD0A 3ZLHA 1XD1A 1YPXA 3N2CA 4ZL1A 2R1MA 3UR5A 4HZ8A 5F1VA 3CYVA 3RR4A 4M6VA 5DRCA 1JF5A 3WMCA 1D7FA 1HGWA 1J5SA 1GOWA 2X7WA 4LBUA 2PDWA 1FH8A 3STEA 4QISA 1HL9A 3WH7A 3OLDA 3BSMA 3L4WA 4PUNA 2XUCA 3KW3A 1UP2A 3VOJA 4W7UA 1KKOA 4PH6A 1XPGA 5I3KA 1HO1A 4NXSA 2PGWA 1SW0A 4LEFA 1W3HA 2YZ5A 1TX0A 1B3XA 4E4PA 2EAWA 4M1BA 3SW6A 1XICA 4HPNA 2GDQA 1KM5A 2CW6A 2PTWA 5LIKX 7REQA 4MB5A 2CZVA 3ARRA 4GFIA 3WL0A 3MMWA 2HSAA 4PCTA 1W5NA 4D6IA 3W7QA 1XLGA 4YCOA 2G3IA 4DPQA 4FNRA 2XIQA 2H9AA 4IQLA 4QDWA 1MO0A 2Q3OA 3VOIA 3URNA 1YADA 1NU5A 2V38A 2D1ZA 1GUVA 1J2BA 4WRHA 2JK2A 2CBIA 4PUKA 1FWEC 3SCPA 1XX1A 4Y96A 2HISA 2NVDA 4C7FA 1KRCC 2W62A 2HQAA 5J5DA 1Q3NA 3GBEA 3GNDA 3U2EA 1A53A 3F4VA 3V1HA 4RL3A 2CHNA 4JIRA 1EHAA 4EAYA 5C71A 3PJWA 3DDMA 3IJ8A 4GXMA 2Y6ZA 3ID7A 5E0FA 3NM1A 5J5RA 4HA3A 3N17A 4ATWA 3V0TA 1XH2A 3COTA 1EYWA 4DJFC 2OWWA 3IK2A 4UOJA 3IEBA 2R1LA 3MPGA 3MSDA 4A21A 1SSDA 4JX5A 1WKYA 3MDWA 4HU3A 4S3KA 1BYBA 3T07A 1M9HA 9RUBA 1L6SA 4MUPA 1F6PA 1GHRA 4U3CA 4UFIA 4ZO8A 2E5CA 2KX9A 5GNZA 4J5NA 1W3NA 2V3GA 3UWYA 3H7RA 1E72M 4O50A 5I23A 5LYRA 1Q8JA 4A8IA 3UXAA 2YLLA 1V02A 4V1XA 2QJMA 3N4FA 3RIKA 3GHRA 3RO6A 2FPYA 3CQJA 3MVIA 1MSSA 3KFTA 2EBNA 1GVIA 3KOFA 5A6MA 3EOLA 3PBUA 3B4UA 3A6OA 4H9UA 1G4PA 3A4JA 2RJHA 2EKCA 5C9XA 4D72A 4AWUA 3G0XA 1YDOA 2ISDA 4D8LA 2GDVA 2CXGA 3HV9A 3EKLA 1QVBA 2TAAA 3CC1A 2D22A 2XISA 1LYXA 4UXDA 1TPFA 3EWXA 3MSRA 3VNJA 2WHKA 1TZZA 2WCSA 3IANA 4O0QA 2P76A 2DJXA 1UZDA 4ZSTA 3VVGA 3N73A 4AD4A 2NSXA 2BG5A 4UTTC 4URIA 4ZA0A 1UR3M 1VFMA 2RJGA 3TC7A 1ITQA 2PDQA 3GK0A 2TYSA 3NXLA 3QSTA 3ATYA 1FWFC 3F5JA 3TQPA 4RX0A 1BRLA 3KLKA 2W66A 3EOOA 2W0UA 2PLMA 1TO3A 1LL4A 4JTDA 4H6KA 5FF3A 5LIUX 2Y85A 3Q65A 4JHMA 4CN4A 2YLAA 4DJEA 1K6WA 1NDZA 3CNYA 1A0EA 1OX4B 1UR0A 3VIFA 3W2LA 3B0VC 3ISIX 4LS2A 3UZYA 1HKKA 1Z9AA 1VLIA 3LHWA 1EJSC 4F40A 2CBJA 5CSUA 1TPEA 3V0UA 3ZVHA 5CSRA 1NDVA 3EEZA 3IUIA 3AHTA 3T0BA 3AIWA 4AF0A 2WCGA 1A5BA 3WF0A 3AU6A 4AXNA 2O0TA 2J6VA 3SIMA 1OCNA 2A6LA 1JFHA 5GJNA 5CBBA 2J9XA 1EX5A 3TFXA 1LL6A 3GTIA 4LQ1A 5ABFB 1FDYA 1IIHA 2P10A 3KTCA 1EL3A 4HU8A 1OYBA 3EDKA 4F0HA 4M51A 3L0NA 2GL5A 5MKGB 2DZWA 4DJED 4RW5A 2HBVA 2QGYA 3LRLA 4YTSA 3CQ0A 3EX6A 4UR8A 2DGAA 3W2JA 1H09A 4FAMA 4PUUA 3VDHA 4BI7A 1R3VA 1H7NA 4MB3A 2G5WA 3TJIA 4A3UA 1T8QA 2PWEA 1XBYA 4GO8A 2Y89A 1AJZA 4Z1YA 1XF0A 1VFTA 3VM5A 3PPCA 1Q6CA 2UV8G 3AXHA 4LUJA 2X42A 1CBGA 4PMRA 3AHYA 3O15A 2BGSA 4BQ3A 3FV9A 2DT1A 1YE6A 1NP0A 2ZRWA 4C6EA 3UNTA 2VQTA 2P88A 3TOPA 3KOXA 1E3XA 5A6BD 1V3JA 4JTKA 5CAHA 2FZ8A 2OEKA 1JCMP 1EA0A 3WKZA 4XVEA 3MO7A 3LM7A 2IQ0A 1ML1A 1RP8A 1S5TA 2VD8A 3HV8A 3LUTA 5C9WA 4PTVA 2Z2AA 1OABA 1R2RA 5DRIA 4D1IA 2Z24A 4L6OA 5FCZA 4GNJA 4JTSA 4JKLA 4HCHA 4DN1A 4XG1A 3VE9A 2ZUMA 4WDXA 2WM1A 3WUFA 4NZJA 1QUMA 1XW8A 3HPFA 2FDMA 4QQUA 1XYMA 4ROQA 5A6JA 3VFCA 1OGBA 3GW3A 3GC4A 2OX4A 1RALA 3MY9A 4NAEB 1ZUAX 5DMNA 2WNZA 3NTYA 4C6FA 1GGOA 3LMYA 4FLQA 3GNNA 1UBSA 1V6TA 3FSTA 2A3AA 4GIYA 2CLPA 5C9ZA 3L68A 2WVVA 2ZX8A 3FY1A 4RNIA 2PWHA 4NJKA 3T0CA 3QOMA 1R86A 3KVLA 1EGZA 1UR9A 2ODOA 4DBSA 1WNOA 2IKGA 3Q2DA 4GK8A 1YXCA 2QV4A 2YOCA 1H1NA 5FESA 3JW7A 3QQ1A 4DY1A 2E6FA 4X2PA 1JPDX 2WNWA 2R82A 3RCNA 1PUDA 3MTWA 1OM0A 3KCOA 3R13A 4PTXA 4IHCA 1WDPA 2C19A 5FSEC 2PBGA 1WYIA 3M0JA 2QLYA 4OKDA 2P3ZA 1K8YA 3F4DA 4H00A 4JEQA 1KV8A 2IKIA 1GEQA 2GJXB 1EB3A 1D2KA 2QS8A 3HGOA 2AOSA 2P8CA 3W00A 1ZPTA 3N11A 1XUUA 3D0CA 1ICQA 1E70M 4PEEA 2Q01A 3TN4A 4XBSA 1FWJC 1RH9A 2GYIA 3QTGA 3KHDA 1NP2A 2HCVA 1TB3A 4JL2A 2WQPA 2Z6IA 3EOSA 3ZJ6A 4Q6XA 4LRTA 1PWMA 3DHPA 4MWAA 5XIMA 1H51A 4AVNA 3LXBA 1EWEA 2OODA 1F73A 1IEWA 2HEJA 3R0DA 1TZ7A 2QUTA 1SFSA 2ZADA 3KZSA 5CGMA 1ISXA 5I02A 3N2OA 3N2XA 4YJ5A 2D3LA 3V75A 1VIWA 3UT0A 2YXOA 1GHSA 1GOXA 1OGSA 2E6DA 1ME7A 1QHZA 1HFBA 1OFRA 1P43A 5A8OA 3UJ2A 3CH0A 3TEVA 3VCNA 4I9MA 4W85A 2CCRA 3W6MA 4HHMA 1EDGA 4MWAD 1TUXA 1TUFA 3U3HA 1ZS2A 3KBVA 3G6LA 3N4EA 5GNYA 4AY7A 1YNYA 5E0CA 4C6CA 2Z0IA 2D24A 4JTGA 4HJWA 2AGKA 4UTKA 4MLJA 1UUOA 1Z89A 3ES8A 4EX4A 3T8LA 4X22A 1H1YA 1O5KA 2VX5A 5HMEA 1CT5A 4XB3A 3TA6A 4RZ5A 8TIMA 4B5VA 1WDWA 3GDBA 3W73A 2BDQA 1KLYA 4KGJA 3RLUA 4A29A 4F66A 3R4IA 1BVWA 2YFNA 4XBKA 3UA3A 1IR1A 4QG8A 2X16A 3UYCA 1E6SM 3WF3A 3DKLA 4CUCA 5JXQA 1UZ1A 7ODCA 3ZSTA 1EEPA 2INEA 3DENA 4HZ6A 2CZ5A 2E25A 3OU8A 5HANA 2DQWA 2GJRA 3VKKA 3ARZA 3LPFA 2VFEA 2DORA 3SURA 1TWDA 4ZZ9A 1CGXA 1VBUA 1PXGA 1GYMA 1EC9A 3DH7A 2YZRA 4LB4A 1DIOA 1NJJA 7CGTA 4REQB 1FCQA 2WYSA 3BG5A 1FKWA 1L8PA 4QSFA 3T4WA 4IMGA 1JDAA 2ZCGA 1QT1A 4ZENA 4C7DA 5E6YA 2PPGA 5HJLA 2WO5A 2PGRA 1A0DA 5IFPA 2WK2A 1J9YA 4Q4KA 1J2WA 2OWXA 4EK7A 3C2RA 3KCJA 1BEUA 2VHLA 1QATA 1VFHA 5I3DA 4I6KA 4I6VA 4PUDA 2BNJA 3QHMA 3RU8X 1GQJA 1CLKA 3NQMA 2WM0A 1DJIA 3N2BA 3GM8A 4LUTA 1EFZA 2NWRA 3KHJA 3CUHA 3K2GA 1K02A 1OCQA 3GYCA 1PX8A 2ICSA 2WKGA 3SN0A 3CZLA 3UR2A 4YHEA 1V3KA 2Z1KA 3W87A 3BSHA 2TMDA 3D3AA 2NUXA 3OQEA 1FBAA 5FL0A 4O10A 4PFHA 1HKJA 2CKRA 3B8WA 4RK8A 2IKJA 4J3WA 1JPMA 5BNKA 1OT2A 3U2CA 4B5SA 3D6NA 3ONBA 5IBXA 5EBAA 5DEZA 4UFMA 1ITUA 3PTDA 1VYPX 1CLXA 3WUGA 3R58A 1AL7A 2FZMA 2VX7A 3W70A 4RE2A 4FS9A 2HE5A 4GHRA 4C1NA 4NZ5A 3TW7A 5EYWA 1JNEA 4PR4A 3G3MA 2X2GA 3H70A 1CXHA 4YWSA 5LNSA 2WXDM 2DSUA 1E3ZA 1VEOA 1VYSX 1PV8A 4JQAA 1JI2A 4ACZB 5CBJA 5I00A 3URAA 1AQHA 1EZWA 3TMLA 3MMTA 3FXGA 3FX4A 3QVQA 4E8DA 3W02A 4RNFA 4UCFA 3VGBA 1JIBA 4AYSA 1ENUA 1CXFA 1RR2A 4H7ZA 3LTPA 3HQPA 3S2MA 1R3TA 2OYLA 4IF2A 5TBOA 5D2TA 4M6QA 2BODX 4IL0A 1MXGA 2QUUA 3M16A 3BOXA 2WJEA 1V08A 3G77A 3HFTA 4DB7A 3FLUA 1UYQA 4S3GA 3G8EA 4RNJA 5B7ZA 1X96A 5BW6A 4WLCA 3BW2A 1BSLA 1KM4A 4AH7A 3MT1A 5EB8A 1BVZA 4Q33A 4JTJA 5I7GA 5DT7A 1SZNA 2GSHA 2ACQA 3GFXA 4L4OA 1P0KA 2JKPA 4DXXA 3M0ZA 2XPKA 1V77A 1VIZA 4XAGA 4PZVA 2JQXA 4P8VA 2PRLA 3B9DA 3EXSA 1X1OA 4WY0F 1L2UA 4PFMA 1GVYA 1XM3A 4Y2WA 4N4PA 2R9RA 1GJWA 4IFKA 4TVCA 2QUVA 1XIIA 4LUSB 2ZICA 2ZE0A 2C8NA 2IQTA 2A3BA 1H5YA 2WKJA 2FGBA 1R3WA 3FJ6A 1G9HA 4B3KA 5HQLA 5HMDA 3BLIA 3GNOA 3WQOA 4HN8A 5FJPA 1R8LA 1S2TA 1A49A 2V2DA 3SY1A 1GZJA 3EEGA 1GG0A 5CPQA 5F2LA 1PX4A 2Y61A 4CCDA 3SRFA 4XV0A 4EXQA 4DI9A 1LG1A 4UMCA 4ZCWA 1EF2A 4C5ZA 3UG4A 3A5FA 3QFWA 3ZS4A 3PBVA 4Q8OA 4ZE5A 4JZ5A 3ZFHA 1TV2A 3K4DA 3F2BA 1VGAA 5CPNA 3G22A 4GZEA 5ABGA 4NJHA 2PWFA 3L4UA 2DSKA 1QTWA 3T7VA 5K9CA 1XHGA 2A4AA 5BU6A 4CU8A 3LU2A 4B4HA 2GLKA 4QNWA 2WKLA 3VAVA 1EDTA 1ZNNA 1XYBA 3UWZA 3B40A 5LA2A 3PAOA 1KM0A 1SGJA 3VX0A 2D20A 5AYXA 1LLOA 2CLMA 3P74A 1CB7B 1QOPA 3FK4A 1WBHA 3OO2A 1DE6A 3TSMA 2KAUC 4M1RA 3W53A 3WDJA 1W9BM 5G4WA 3PTQA 1W32A 4UR9A 4B16A 2PB1A 3E6EA 1FHLA 1GW9A 3VILA 1GQIA 1YIXA 3VPLA 2R24A 1O4UA 3A23A 3KOWA 4KEVA 4OECA 1U83A 3BQ6A 2V2CA 3OPSA 2PTXA 1PKLA 3VGFA 1B4EA 5GJPA 2H6RA 3LYEA 4HGXA 5I06A 2HXUA 2BBFA 1XIFA 3NPXA 3T09A 2OO6A 4TTUA 5AC6A 1R87A 2J7BA 1QK2A 5CGTA 3UG8A 4GNVA 3RM9A 4XVDA 1CXEA 2P0IA 5AC7A 4MM1A 4K7YA 2X8RA 2E1DA 2I14A 3EWDA 1KGXA 1LBLA 2AAMA 5CG7A 5DMMA 1AL8A 3QHNA 4X0VA 3VD5A 4LCRA 1YHTA 3N9SA 4F79A 1OC5A 4US5A 3S3GA 1PZ1A 4WY0A 2V69A 1UOZA 2ZX5A 1IWPA 4Q4QA 3WLMA 2VWSA 5REQB 1V0NA 2CHRA 2VRKA 3MB9A 2B7NA 1XLAA 4KEUA 5GNXA 4I7VA 2OKOA 3VMOA 4GY1A 8XIAA 4GI9A 2C1HA 3GQYA 4H4IA 4S2CA 5G2WA 3ARXA 4FEZA 5AVHA 1QPKA 3UCQA 4AG0A 2WPBA 2OSXA 3DHUA 1WXZA 4KWUA 4UNKA 1I45A 1DHPA 3SCVA 1TG7A 1GG1A 3WDPP 4ZODA 3AMCA 1TMHA 3FKKA 3U5YA 3T40A 4US5D 4LGXA 2F9RA 3E3HA 3ELFA 4AQLA 3FGCA 4O1BA 3A13A 3CPRA 4YCPA 2J8TA 4E8CA 4UTFA 3QR0A 3T08A 5HQMA 3FJLA 3NQ6A 3O1NA 3EXRA 4MZ8A 1XG4A 1D8WA 2QCGA 5DANA 3ANUA 4KCVA 3CWHA 1XIHA 3UP8A 1EHNA 3AYRA 1F3WA 2QJHA 3ALGA 1X6UA 4CD5A 1HGYA 3AXMA 1A5SA 3SM0A 3IV3A 3S47A 3GHTA 1H0GA 4YWIA 4FNTA 4CNNA 5KTLA 5GJMA 3TW6A 1JQXA 4Q3MA 2Z1BA 1MZHA 4Y9OA 2B0MA 2FTPA 3TYUA 1PYFA 1VD6A 1BFNA 2GK1A 2GPTA 3N04A 1NY1A 3MI2A 1ZBWA 3BOLA 5EPDA 1PAMA 4Q8VA 4LNYA 4GX9A 2INFA 2F6KA 4Q8WA 4LVDA 3WDRA 3FAXA 3FYYA 4KWSA 3GHUA 3HN3A 3E2SA 5IRPA 5D32A 2B31A 3UVIA 1U1HA 3M46A 3LG3A 3GG1A 4DJDC 4A35A 2YB1A 3ARYA 3SUUA 1MUCA 1QRQA 2ISWA 2BXYA 3CHFA 4DLMA 4B91A 3W1LA 4O18A 3NPWA 1JYNA 3DFOA 4DO6A 1JCXA 2QJGA 3NQGA 1UD4A 5JUVA 3Q37A 3HU7A 3ANVA 3HQNA 1F8MA 5FEZA 3FIGA 3HM7A 1FRBA 3CZEA 1E1CB 3NNTA 3K30A 1PS9A 4JEJA 2YKKA 4GYPC 4G9PA 3GR8A 3C2VA 3F4NA 2Y8KA 1EBHA 4AD1A 1OFPA 3H4XA 3CZGA 1E6XM 4G2DA 5HR7A 3IRDA 3DFNA 5KETA 2W3ZA 4NU7A 6ALDA 2BZNA 3TW9A 3HJZA 4QFUA 1NWUA 2J47A 3EAUA 3W26A 4K8HA 1DOSA 2JGQA 3E0LA 1PB0A 1W31A 3VZXA 4EP8C 2HNHA 2J6XA 1TWWA 4HYVA 1CEOA 2XZ7A 4JDYA 5DT5A 3LV6A 1YEYA 3UQNA 3NQFA 3VIPA 2UY3A 3B06A 1VJIA 4LCQA 2DSZA 3KVMA 1XYAA 2F6UA 4BF7A 1GZ1A 5HMFA 5E09A 1ZJIA 2JFEX 3W72A 3AWNA 1K77A 3NQCA 1SZFA 4DXKA 3JZEA 3W2KA 4LF1A 2GOUA 4FOKA 2EGZA 2QCHA 1RJQA 1G6CA 3MC5A 2EJ1A 4GIEA 3N9RA 3RPTA 3MMDA 4NNCA 4XO7A 3OVRA 3CEUA 3P82A 3WEMA 3IAPA 1E0XA 1M41A 1WDQA 5IHSA 1D3CA 1QW9A 3WNOA 4IQEA 2POTA 1AJ2A 1QJWA 1EA9C 4W84A 2QPXA 2A3CA 2B7PA 3AIBA 4P8UA 1XRTA 1K4GA 2WSQA 3TXZA 4Z0JA 2OTDA 7PTDA 2HMCA 1C8XA 2D73A 1GJPA 5T9BG 1VPQA 3PG9A 1CPUA 3OG2A 1EP2A 2L5HA 2E28A 1K8CA 2HRWA 4HB7A 2IPFA 3W29A 5FAJA 3AIRA 1W5PA 1AMYA 1ZU8A 4LBSA 3DI1A 3SUTA 1SM9A 3W24A 1U1UA 4GISA 3KRUA 4XD3A 1Z69A 1QI3A 3CWOX 3VI2A 5TNVA 3STCA 1XIMA 3LNPA 3GKFA 3W7LA 3MDUA 3KEHA 5DF0A 2YL9A 4OE7A 2J27A 1S2UA 3EB3A 4GPNA 2WZEA 1H5VA 2PD9A 4JX6A 3GIPA 4C90A 2CHOA 1WXYA 4RNHA 1XLBA 2ZZ5A 4IMDA 3M6DA 2QW5A 2XZ9A 3FKRA 3QYQA 3DOPA 3W1UA 3VOGA 4B2DA 3O8AA 3AIVA 5I3IA 2D0FA 3N13A 5KITA 3W7PA 3EWUA 4MAZA 1BWVA 4O1DA 3NDOA 5K4ZA 7TIMA 1NOWA 2YCLB 1ZL1A 4K36A 4DPPA 2FZ9A 4IWWA 3KZPA 2VX6A 3M5XA 6TIMA 2VEGA 3LPPA 1DIKA 4C6QA 1M65A 4JR5A 3O7UA 1YRRA 4U3AA 3NDZA 1W6TA 2V8ZA 1TVPA 3C56A 3OVPA 4GCAA 3APYA 3IS4A 1OC6A 1TJPA 2FKPA 3DX5A 1WZMA 4QS5A 1B1YA 4E2VA 4XUGA 3PPFA 4ICCX 3DBPA 4CQ8A 5C8BB 2NV1A 4IM4A 2J78A 2Z27A 3KL0A 4IIEA 5HA7A 3KTSA 1UWSA 4QAWA 4C1LA 1WPCA 4DJFA 4P2VA 3KRSA 3CO8A 1RA5A 3MVTA 3VDAA 4E5TA 2PF0A 1UBPC 2R1NA 2GGHA 2DT3A 5AC4A 3NVDA 3IIZA 4GVHA 2BHUA 1GJUA 3WSUA 3CL6A 2DZAA 1CI1A 1I2PA 4AWEA 4M5PA 5D8WA 2IPJA 4BQ5A 2A0NA 2BHZA 3SO7A 2WANA 3EA3A 1FP8A 3A47A 1V51A 1GCYA 3T44A 1LBMA 3H2FA 5HPOA 7TAAA 1JCLA 2J66A 3NQBA 4TVDA 3HO8A 3NZPA 2XIOA 3OBAA 2A2IA 1UR2A 4FSAA 3N2TA 4JFWA 3BLFA 4ATLA 2WLZA 3G6MA 1KO0A 3M0XA 4DJFD 2G8ZA 1UJPA 3PS7A 3HJEA 5DXXA 2J13A 4P8XA 3N1AA 1V6UA 5AVNA 2PLKA 2ABAA 3PY2A 1RSCA 1M7XA 1W5OA 4UMBA 1EJUC 3PFRA 3MV11 2I9UA 3NGFA 4JKKA 4MTVA 1R46A 4O57A 3HGSA 3KP0A 4AIEA 2FMNA 3CZKA 5H8PA 4UTTA 3O6CA 4TV5A 1AH3A 3MP3A 4NHVA 4AZIA 2AAAA 4L61A 3CMFA 4BS0A 4FALA 3M0KA 4ZOCA 3O63A 2A79A 3DYPA 2NW0A 4IXHA 1Y0EA 2OQHA 3QC0A 4J3SA 1QPRA 4N9CA 3WQVA 2PGFA 3C0LA 2D2OA 2JGYA 4XZLX 3ZR5A 4QJ1A 1HKWA 1XBZA 2C79A 3IIPA 4AZ5A 5AYZA 2WVVB 4KCWA 1LWJA 1Z6KA 2WBGA 2VYOA 1UD2A 5I6SA 2A5HA 1QPNA 3EWBX 2VGFA 1BF2A 4RXFA 5G4EA 2GVJA 5LNUA 2VJXA 2YCKX 1EKOA 2PS2A 3C2FA 2HS6A 4YN5A 1R3YA 1Q6OA 3CYJA 2J7GA 4F0RA 4Z17A 1J96A 5GPRA 1ZTVA 4XSMA 1F3TA 4JNYA 2C1GA 4PCSA 1C7TA 5BU9A 4D2JA 3QM3A 1JZ3A 3U2OA 2ZUVA 3S8HA 3UZXA 2PURA 3EPOA 3SR7A 4JIHA 5LZLA 3GXTA 3SFKA 5JVLA 3ALFA 2QJJA 3STFA 3GVRA 3R0KA 3FHQA 2X1SA 3IVTA 5E5CA 3LD5A 1HNYA 5LKYA 1E9YB 3VX1A 4DBUA 2D2HA 3NO1A 1E6QM 4PMQA 1PDYA 4E6MA 3OVQA 4ZB5A 3ZVIA 3VXGA 4QR6A 4AX6A 3HG3A 1J93A 1RBAA 4MWAB 5E70A 4KEMA 4LSBA 3BL3A 1QNPA 4JIPA 2ZA2A 4HZMA 4Q4SA 4ZB0A 4HOWA 4Q8UA 1H7XA 4LAMA 3BJSA 2Y4SA 3M6YA 1JZ7A 1W9VA 3LX9A 3W7RA 2XIBA 1KCKA 5KSWA 1OC7A 3GB6A 1D7KA 3L5LA 5CLWA 1FWRA 1GKPA 1OCJA 1UROA 3B04A 4X2RA 4ZQPA 3SEPA 3T8QA 3GTXA 4NRRA 4ZB2A 2UY5A 5HOSA 2FHBA 4PBFA 1RD6A 3BV7A 1NOUA 3W37A 3WLIA 4CQ9A 1G1YA 1B9BA 2R14A 5DCBA 4L65A 3W83A 1K9FA 1TJ0A 1HTIA 2JE8A 2VDHA 3I3DA 5D9PA 4QJ3B 5CZSA 2Z00A 4IPNB 4KF1A 4QE4A 4HPHA 3R8RA 2QZRA 2ZX7A 3CMGA 4XX6A 4HCLA 1K03A 2ZUTA 1H7OA 1UH2A 5TD4A 3APTA 3T2QA 1E0WA 1ONEA 2QF8A 5HAOA 1EOMA 4G8TA 3FA4A 1IEVA 1Q13A 4TR9A 3P6LA 1W9PA 4H8HA 4EPDC 1B2YA 4YYCA 4LUIA 2FDSA 2CWNA 4Q4PA 1UUQA 4GVGA 1DL3A 5AFDA 4V27A 3C61A 2YL8A 5AB3A 4JYDA 3W7KA 3UPWA 3W7HA 2BSLA 1POJA 1S2VA 1SR0A 4AHOA 2UWFA 2DZPA 2ZZ3A 2WWCA 4Z2JA 4MF4A 3AUOA 2EPOA 5T26A 3RO8A 1V6VA 1EZ2A 1NIUA 3N2MA 1G0CA 4UQAA 3ABRA 1XYZA 2DZUA 2OO0A 5H8MA 3FAWA 1VHNA 3HPZA 2XG9A 1GKRA 1LLZA 4J7RA 4QEHA 1VJSA 1CTNA 1XKJA 2GWNA 2VRQA 3KS5A 1EH9A 4P61A 1K7XA 1FFQA 4ZGYA 3HBLA 4FX8A 6CGTA 1G94A 1UCWA 5CCZA 1F8IA 3WFLA 1TX2A 4LB3A 1UWAA 3DN5A 3W88A 4GD0A 4IZGA 4AIOA 2FZNA 1IXQA 4S39A 2Y0FA 1W3JA 3ZOAA 3DFTA 1VBHA 4AZCB 2Y7FA 3S5SA 1X1ZA 4GYFA 1TPB1 2Z7GA 1B3VA 1TIMA 1HKIA 1WZLA 4I8YA 3VIKA 3H4GA 4S1FA 4RZBA 3QY7A 1HJXA 2XFFA 4YPJA 4EKJA 3CXOA 3VDBA 4H9XA 4JL1A 3V4BA 3NFUA 3MV01 1S3HA 2GUBA 3W71A 4U28A 4AYGA 2TPSA 4JFSA 1W1ZA 3HGJA 4UFHA 4M24A 3TWBA 4YTTA 3M64A 4DQWA 1E4IA 1TA3A 4C1NB 1ZJHA 3F5KA 4KH2A 1TWIA 4UIOA 4PGLA 4N9BA 4GUFA 1M03A 2WC4A 2PBOA 1BHGA 4CQAA 4XTIA 5G1TA 4ACYA 1PZ2A 4OHQA 1OZMA 4B3ZA 4Q4OA 4AD3A 3W22A 4WVXA 4GYKA 4IMCA 4TQTA 1XDJA 1SJBA 5A8GA 4ZR8A 1FWGC 5C9UA 1IZJA 4F2TA 4JTFA 3OODA 3P81A 1SFLA 1A4MA 3B8IA 3HPSA 3SZ8A 1N8WA 1L6YA 3V1PA 1F4AA 2E8ZA 4LALA 5A94A 3E2RA 2ZUNA 1TCDA 3F1QA 3WLTA 4XZBA 3KTXA 3CUIA 3PSVA 3W2MA 5M3WA 3QZAA 1FHDA 2W6RA 5FF4A 1DKWA 3CZJA 5D9OA 3EX4A 1GTHA 5D2VA 3LMZA 4J3VA 3GD6A 1LROA 1KC7A 3DZ1A 1TTPA 2ZZ7A 5CQ1A 4C6DA 1FWTA 4OFCA 3R10A 3CAVA 2Y8VA 1JL8A 3I4EA 1CDGA 1OQFA 2CFFA 2REQA 1FCVA 1SPQA 3EDJA 2VWTA 4PULA 1K7FA 1FX6A 1OIFA 2BVYA 1NEYA 5GVJA 3SRKA 2VC7A 4XIMA 2WMGA 2B7QA 2NXHA 4OIFA 2OZ3A 2YGYA 1TV3A 3S1VA 4D8AA 2DZSA 2OWCA 4IFKB 4X60A 4UQBA 4PB5A 2PWVA 3C8FA 1CGYA 2CLOA 4E38A 3PB0A 3SY5A 2JBMA 1R3QA 1TV5A 5HNTA 1XLEA 3P62A 2AKZA 2PU1A 2QJNA 2V5BA 5HWJA 1GOMA 4IPPA 4V15A 2IS7A 2VTFA 1SQ7A 2V5CA 1SO4A 2OQLA 2VR5A 2PDPA 5KEZA 3URBA 3VD9A 4JIEA 3RRAA 2W5FA 3NYDA 5DQPA 5G4HC 4F8XA 2PDHA 4B90A 4IIFA 1V6YA 1DJZA 2I17A 3SDOA 2J9ZA 3WF4A 5HXMA 3NQAA 1KTCA 3BLLA 2A7PA 3MUY1 2QCEA 1EDQA 3VOFA 2NUWA 4LYKA 3TU9A 1S2AA 3WMSA 4A2SA 3I7RA 1V3IA 3WFZA 3TIMA 1OFQA 5C7VA 3U48A 3HGRA 3KCLA 2DZXA 3MHFA 4L5ZA 1S2WA 5M17A 3B05A 2EPLX 1CYGA 2PWDA 2Y62A 1C92A 3TTOA 3LM3A 3LOTA 3E0WA 2V9DA 3NPVA 4U2YA 3NXFA 3N6JA 1IIGA 3P14A 4G7EA 3IGXA 4R33A 3USBA 1J10A 3W01A 3QPEA 2QMKA 3T05A 4B4FA 2QIIA 4JTAA 2JKEA 3LNMA 4X61A 4S3AA 1N8IA 2DH3A 1QNVA 5D37A 2BVDA 1Q63A 1M68A 5JBFA 1E40A 1LUCA 3ZSSA 4K7VA 3B9NA 1KTBA 1JCYA 1W1A1 4MJ4A 1BPLB 4A05A 2O55A 4S3DA 3GDTA 4IJCA 2FVKA 3PZUA 8XIMA 4AC7C 3GDKA 4P8WA 1B57A 2Z26A 2VDGA 3TJLA 4HNLA 4GY0A 3QR1A 4B5UA 4FOUA 1Q66A 1ADOA 7ENLA 4IIHA 3WLOA 2ZFAA 5BZAA 1LRNA 4ERAA 3ZT5A 4KFOA 1B90A 4YMZA 4LAKA 3MCMA 5HUPA 1KBIA 4TMBA 1KV5A 4Z0SA 3PBWA 1R30A 1QI4A 3G1FA 3W2UA 1ONWA 5K9DA 1P48A 3L12A 3QR3A 1UJQA 4WY0B 2PC4A 4MFEA 5M1TA 2OSYA 4U2ZA 4GGHA 5DO8A 1QNQA 2HBXA 1A3XA 3PJXA 3ITOA 4RE0A 1E73M 1MRAA 1MXDA 3RAOA 4NASA 2NXIA 4LAZA 5AYIA 3D5HA 3PPGA 2BOEX 1F3EA 1XCWA 4BR1A 2B81A 1V0MA 1F05A 1MNZA 3W07A 3NZ1A 2EPKX 2WVUA 2QCDB 2FJUB 1LG2A 1DV7A 1P6CA 4B9YA 3LSBA 3R8GA 1TPWA 3UESA 4DAFA 2QIWA 5TAOA 1OIMA 1VHCA 1VS1A 3QN3A 4BKNA 3WH6A 2WSRA 4QBXA 4C91A 4EVZA 1DWGM 2EJAA 2PD5A 3FGCB 4AMCA 4WJEA 3FDGA 4QLKA 1TYGA 3TJ4A 1J01A 3NL2A 4CLMA 3BZGA 1IGWA 3KX6A 3GH5A 5J8LA 3S2JA 5LA0A 3RGTA 4JAWA 4QE1A 3HOJA 1XCXA 3B9AA 5E6ZA 4JFTA 2DQXA 1F4HA 4FF5A 1SW3A 2OOFA 2VRJA 3LXAA 3PVFA 4H3DA 1LTDA 1KWKA 2HWGA 3KXQA 3P0XA 1W2VA 2QAFA 1UQYA 4UTMA 2J7DA 4CU7A 1Y8BA 1MDLA 1ISYA 1FFRA 3S5OA 2HE8A 3W86A 4L6DA 3RX2A 4INFA 1PCKA 3OHIA 3QGAC 3LERA 1W8SA 2FIQA 1GPFA 2OLHA 1VENA 1G7UA 4PMUA 4W4QA 3NQEA 3QLLA 3T81A 1NFGA 8CGTA 1IT0A 2P5NA 3PZTA 3EA2A 2GK1B 3BWWA 1C8YA 3MCNA 2WMIA 3RHGA 3ENLA 3WJZA 2X0YA 2P0OA 1UD8A 5EA9A 2YL6A 1CNVA 4DO7A 3KAOA 3Q67A 4RE3A 1HW6A 3DGRA 2X30A 4AB4A 5CBIA 4PB3A 1PIFA 1ITXA 1H4PA 3L66A 3WQGA 4WOZA 3CQHA 2VFGA 3LLDA 5EL1A 3SI9A 2YIHA 4S3CA 5F4SA 1LJYA 1XDMA 3N3MA 2PMQA 2WHMA 2QCFA 2VUYA 4UMAA 2DVTA 5FKYA 2BVWA 1JZ8A 4KCUA 4A3RA 3WJWA 4C65A 4KQNA 3RLVA 5CSSA 1TWSA 4ML4A 4UNLA 1QU4A 1Z44A 2E09A 2OCZA 4R9OA 2C91A 4BHYA 4ADUA 1ZBCA 2X05A 4CGTA 3VCCA 3WIJA 3BGJA 4WSHA 4YIWA 3UERA 3T42A 4MPQA 3HTWA 2YDQA 3LHUA 1FXPA 1CXLA 3QV6A 3EOEA 2VCBA 3L4YA 3CIWA 4PCPA 2MUCA 4XZNX 1U5JA 1KFWA 2QULA 4PL1A 3C2YA 4L6HA 1XYFA 1GVEA 3TQ0A 4GH1A 3EWCA 4ZOBA 4ZVJA 4H9MA 1GPWA 1E1EA 4JTQA 3YPIA 1DBTA 2WLYA 3GZAA 2JIEA 3SSJA 1KW1A 4PYSA 4QQ3A 4XAPA 1PHWA 4P7RA 5CZKA 5FACA 3WNMA 1D8CA 3GFYA 2NXGA 3RILA 3G5EA 1ZQ5A 5K4XA 3EWYA 4JX4A 3SCTA 4A3QA 2WB5A 3FYOA 3NM3A 4KRUA 4UQCA 3REQB 3UJSA 3B0PA 2O7QA 4MPKA 2ZUWA 1KGWA 2FZDA 2CXEA 4XKMA 1KCZA 3CUGA 5D04C 3B9EA 3S1WA 2VM8A 4CNOA 1S39A 2PCEA 1X39A 2VOMA 3UA4A 3ZJ7A 4EAMA 3QPZA 4A8LA 1AFSA 3WQ6A 3IVUA 2FFIA 4Z2GA 3CAKA 4FR1A 3G24A 3SCUA 1R38A 1GVSA 1NARA 1TCMA 4GC3A 3ZJKA 2J88A 3AROA 2XIIA 1GORA 4J4KA 1VZWA 1TMLA 3NOYA 3RITA 1P0EA 2GGJA 2VZVA 1ELSA 3BAIA 1Z42A 3PBGA 1A5AA 5BOFA 4Q7BA 1A5NC 3CLMA 2EG7A 1O1HA 3CHDA 1H7PA 4GCXA 2HVNA 3EYPA 3VIMA 5C54A 3QYSA 4UQ9A 2F6XA 2WBKA 4MDOA 4QNEA 4KIRA 1GOKA 4JCMA 4B9ZA 3MUCA 2X0HA 1UZ4A 3ICJA 2XYLA 1Q4WA 1KTNA 1O1ZA 3GSMA 3ZXWA 5TIMA 1J6OA 5D2XA 4K39A 4Q8QA 1PE1A 1DWFM 2FH8A 4BI5A 4EE9A 1L6WA 1V4YA 3KOYA 3OZPA 1LRQA 3URQA 1Z8AA 2AMGA 1XJBA 5FJUA 1GVFA 3MUIA 1DXIA 4DJDA 2EKGA 2J8GA 3W7EA 4WEVX 2Y5JA 4GA8A 5CKSA 3QEZA 4FLSA 5BROA 3CJPA 1DHKA 4C6IA 3LCWA 3WH8A 5L9FA 1A50A 3CTLA 4E0CA 3SRHA 4R27A 4M19A 2E6AA 2V81A 2OYMA 3RU6A 4K37A 4GYPA 3GWQA 2ZDSA 3WQWA 3WLKX 2JEPA 2BWGA 1LOLA 3GX9A 3VIJA 4UCGA 4WKHA 1ZLPA 5DMYA 4QAIA 1PTAA 3CK5A 2PWGA 4DJDD 3G1AA 5I3GA 2UY4A 1EEXA 3WF1A 2WZMA 1K9EA 2BXZA 1UA7A 2J7FA 1XYLA 1JD7A 3HIJA 2XGBA 4BA0A 4QITA 1JPHA 5A1AA 2VEKA 5CPOA 3G1SA 3LHVA 1ZGDA 3IV8A 4PSPA 5D2WA 1JZ5A 2O92A 4NP7A 2OEMA 3IJQA 2VKZG 4D6GA 4EF8A 3KBWA 1M6JA 3LBOA 3N3TA 1I0DA 2ON3A 1GVRA 3RX3A 1TQJA 4WZHA 2YCIX 1ZCCA 4GVFA 5T91A 3VC6A 3HF3A 5U7SA 4HPGA 1EPVA 3PPHA 1K4HA 4L1WA 3BJFA 2ZIDA 1CXKA 4O15A 1KFLA 4JFUA 1EUAA 4Y9NA 1UWRA 4W88A 1P1XA 2DP3A 2VGGA 2IXUA 2XVNA 1OBAA 4OBRA 3TTYA 4BI6A 5F2MA 4O28A 1LQ0A 4NJGA 3QZEA 1H3GA 4IJBA 4OBTA 1WZKA 1WDRA 3GZ3A 4W7WA 1E4NA 3G1RA 2QDDA 4D9PA 4I9JA 2H90A 1Q6LA 3IJLA 1UH4A 5IOBA 2CLLA 3EWWA 1LWIA 1AH4A 4GLEA 1V5XA 1I0BA 2RAGA 4JN6A 2QVHA 1M53A 3UGRA 3B3DA 3OBKA 1XIDA 3UBPC 1ECEA 1TPUA 1E71M 2R1PA 3GAKA 2X1IA 3P7YA 1XRVA 4I7WA 4MYAA 4AY1A 1XSIA 2PFHA 4AVOA 5KMYA 2AL1A 3DGBA 1VKFA 4WJXA 2VL4A 2E8YA 3T0TA 1W5QA 1UD5A 4ZSUA 2GJPA 4LF2A 2G4JA 4CD7A 2OELA 4HNUA 2X0SA 2XM1A 3MJYA 4C6PA 1K7EA 1R47A 5CGQA 3FVMA 4L80A 4O53A 2CWXA 4HK7A 1U33A 5AHIA 2ZTJA 2G37A 3C52A 3LQGA 3DESA 3TYAA 2CIPA 4XK2A 1P7TB 3GAYA 3ANYA 2W91A 3GBDA 3AICA 2NV9A 1W1VA 3DG7A 4FXRA 5A6LA 2CLHA 2FFCA 3KS6A 2V3FA 1WDSA 4P7NA 1K9TA 1UZHA 3OYZA 4LYPA 3FS2A 1DQWA 3K8MA 5HBFA 1XP3A 4ONVA 1YPIA 4MSSA 3ZYZA 3MP5A 1HJQA 1D3GA 3ECQA 1KCLA 2ATMA 4W5ZA 1BKHA 2WSPA 4CD8A 2CC0A 4UTHA 4AD5A 3OA5A 3WBWA 1PCWA 2E67A 4IICA 1FXQA 2YCJA 2ONEA 1HG3A 1KGUA 4Q22A 1BWKA 5BWFA 2DFAA 3O16A 2Z4GA 3WYZA 4AZBA 3HZ3A 4J1OA 1AD4A 3W27A 4HCDA 2G3FA 1DWIM 4AXKA 2QDEA 4NAFB 4V33A 2WJZA 3RM4A 2XN1A 1LZOA 1GQKA 1X97A 2C16A 4IGHA 3WQEA 1R9XA 1OEPA 1WAUA 2XHYA 4TU1A 1Y5WA 1FWCC 2E40A 1LWHA 1IZCA 2XSAA 3LI0A 2O4MA 1T6MA 4PTWA 2VELA 1Y5XA 3PUGA 1TPC1 2VFHA 3N6QA 2VR2A 3TZNA 3VKJA 4B5XA 1UMLA 3O06A 3VFLA 4QXIA 3W85A 4R3UA 3IPWA 2AQWA 5AECA 3WELA 2VEIA 3SFWA 3TYDA 4O8AA 3JS3A 4PUMA 3AS1A 3ITLA 6REQB 2VP8A 3OHMB 2PI6A 3M47A 5CPLA 2OZ8A 1UIPA 4WOQA 2V6AA 1XLDA 3G0SA 4OV9A 3MZNA 3IIVA 3GXMA 4ZMGA 2QJIA 3OIXA 4ORMA 1W1PA 2G96A 3VGEA 3C86A 4TVUA 1VPXA 2YXXA 4TXEA 3DERA 2WZTA 3BAYA 1OX4A 2X40A 4ZQMA 1FWWA 3GXNA 4GUGA 1TVNA 4YVVA 1WAWA 4M3PA 1DORA 3NO5A 1B31A 2ZYFA 3WX7A 3S5ZA 2WSKA 5ECVA 1QDSA 4POCA 3RUBL 1WZAA 3AHXA 3PJTA 3PK7A 3ABZA 4W87A 2V2HA 4EPKA 2VO5A 3DHDA 3IK4A 3K4WA 5DMLA 1VFUA 4PL2A 1H60A 3SN4A 5ECUA 5ABFA 4S3FA 1EJTC 4H8NA