1U5JA

Propionibacterium shermanii transcarboxylase 5s subunit, met186ile
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
471
structure length
470
Chain Sequence
REIEVSEPREVGITELVLRDAHQSLMATRMAMEDMVGACADIDAAGYWSVECWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNLLGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTISPVHTVEGYVKLAGQLLDMGADSIALDIAALLKPQPAYDIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAIEAGVDVVDTAISSMSLGPGHNPTESVAEMLEGTGYTTNLDYDRLHKIRDHFKAIRPKYKKFESKTLVDTSIFKSQIPGGMLSNMESQLRAQGAEDKMDEVMAEVPRVRKAAGFPPLVTPSSQIVGTQAVFNVMMGEYKRMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQRPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVAPVFFEHRAEGPHSVALTDAQLKAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords transcarboxylase 5S subunit
publication title Transcarboxylase 5S structures: assembly and catalytic mechanism of a multienzyme complex subunit.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
total genus 185
structure length 470
sequence length 471
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF02436 PYC_OADA Conserved carboxylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1u5jA01
3NPUA 1P0KA 4P61A 3UNDA 2QCNA 4O53A 1GVFA 3N34A 2OZ0A 3TR2A 1R2TA 4JEQA 3S0CA 3ZR4A 3W1RA 4DF0A 3GDKA 3TQVA 1JVNA 3PBUA 1W8SA 1GTEA 1JRCA 4LVDA 4NJKA 3M5YA 3EEGA 3KVJA 5L9FA 1UBSA 3GXNA 4O1CA 3P84A 1MO0A 3W7EA 4WZHA 3W73A 4O13A 4UTHA 4XUGA 4MY9A 3L0GA 3MJYA 1V7YA 4UFHA 3LCXA 3W75A 5IM51 2JKEA 3EX1A 1MXSA 3C3NA 5DBUA 5TIMA 3QRHA 1VRDA 1KTBA 2GVLA 3G24A 3L0NA 4IWWA 4UFKA 2XFWA 1GVSA 2Y62A 2X30A 4NJIA 2WSQA 2ZFAA 5G1YA 3Q94A 1IIHA 4CCCA 1LZOA 1GVQA 1VGAA 1V5XA 2GUUA 1B4KA 3TH6A 3HGRA 3ZWSA 1GTHA 3EX2A 3FA5A 2CW6A 4DEFA 1K03A 2FFCA 3ABQA 2B7NA 3PBWA 3QMTA 5TQLA 5G2IA 4XBSA 1I2RA 2H3BA 3DAQA 4IMFA 5DCEA 4UR8A 1XDMA 1F73A 4QNEA 5LSMA 1DOSA 5BMXA 1AL8A 2WSRA 3NQEA 1X1ZA 4TU1A 3S1UA 4JX6A 1SZNA 5FF4A 1FBAA 2DZUA 3G1DA 1T0OA 2ATMA 4GUJA 2NLIA 4ZQMA 5F4SA 1AG1O 3OVPA 3LHVA 5F4XA 5HQEA 5BRBA 3PVFA 3STEA 2V82A 3FOKA 5FEPA 4K8HA 1TRDA 5I3FA 3TJLA 2EKCA 4FHAA 1DKWA 2WPBA 4UTWA 1VYPX 4K6AA 1QCWA 1RQBA 1I2NA 3S5NA 3W83A 2B7QA 1QPRA 3EB2A 3I65A 4DPPA 1D3GA 3WK2A 1VLIA 5T26A 2F84A 1XBVA 4JTLA 2QF7A 4MYXA 3PB0A 1H7WA 1IXOA 3DU0A 3LRMA 4LWWA 3BLFA 1X8FA 3KRZA 3IGXA 4Y90A 2Y85A 5HWMA 1OFOA 1QWGA 1TSIA 4RV8A 3RK8A 4LVFA 4Q4KA 3E0IA 1NVMA 5CGQA 3NZRA 5C6MA 3EX6A 3L68A 3E12A 4QAIA 5HR6A 3LI1A 3QMRA 2X2GA 3CU2A 3NPWA 3ELFA 2G95A 5I3JA 3ATYA 4OBTA 3G22A 3TW6A 3TUUA 1Z48A 1PE1A 3HPXA 5FI8A 2WNNA 1Z44A 3T4CA 4JTGA 3QFEA 1TTJA 3ZS4A 3NL6A 3WJYA 1F7BA 5F4WA 3W85A 4EF8A 1B4EA 3G1HA 4N9DA 1F76A 1LOQA 5D2YA 3M9YA 4UTMA 1AW2A 3YPIA 2E1DA 1TTIA 3BW3A 1WX0A 3BLIA 1EWEA 3W2LA 1HFBA 3NQ7A 3E49A 3PSVA 2A7NA 5C2XA 1ZENA 3D0CA 4TO8A 2V8ZA 2DP3A 2O7SA 1GYNA 4JDBA 1O60A 4MY1A 1L2UA 1H7PA 1OFBA 1W56A 3DGRA 3A21A 3TDFA 3TX9A 3IGUA 1QDSA 3STCA 3T44A 3NQMA 1RQHA 2DZVA 5D02A 1G7UA 3NQGA 3CIWA 3MW7A 3R5EA 1GJPA 1OHLA 1IIGA 3GAYA 3KHJA 1CX9A 2CZFA 1ADOA 3IVUA 2NV1A 5FEZA 1G67A 4MOZA 1VHCA 3W7RA 1K8YA 3P74A 4M6PA 1EP2A 1HTIA 5J5DA 3TROA 1IGSA 1TREA 1XKYA 1H61A 1W5NA 3FYPA 1OX4A 3LRKA 3LCLA 3C2RA 3HIJA 1OFRA 4JX4A 2QJHA 1PV8A 3O06A 3W70A 1OF8A 3HQ1A 3L21A 1YLVA 3DI0A 1ZALA 2NV2A 4O28A 2E6FA 3PUEA 3NQ8A 4GBUA 4DBEA 4UNLA 6TIMA 3TC7A 1TMHA 3BLEA 1CI1A 3NL5A 1ZFJA 3UXAA 2E5BA 5HMSA 2C3ZA 4IXHA 1S3HA 4O54A 3PBYA 2Y63A 3KRSA 3NQAA 3WJWA 4UTKA 2KZHA 2R14A 1K8ZA 4QSHA 3QH2A 1R2RA 1GQNA 2X16A 2E6DA 1OVDA 1GPWA 1VQTA 4EVZA 5FEWA 5FF0A 4IPJA 3TC6A 2PCQA 4GFSA 1N7KA 3OBKA 3ZFHA 1QFEA 3EXTA 1RZMA 2JBMA 2Y7EA 3TFXA 1LRTA 1EUNA 2FDSA 3OG3A 2VFDA 1GYLA 3NM3A 3GB6A 1TPB1 1ALDA 1XUZA 2Y61A 2VXNA 2X1UA 3U8GA 2GVJA 4RXGA 4H6KA 4JTKA 5H91A 2X1TA 1W3NA 4OU1A 4WXZA 2DZTA 1Q6QA 2TRSA 1PCWA 2FPYA 3PULA 2VEKA 1SZFA 4O18A 3QM3A 3LB0A 4JD4A 4IJBA 2OT1A 4N4PA 2ZZ3A 1K7EA 1SW3A 2QCGA 1U5JA 3STFA 3FJLA 1A50A 2W79A 2I1OA 4XTIA 1KLYA 1WDWA 3UWYA 3MI6A 3DFSA 3HO8A 4MZ1A 4ZQRA 1Z42A 3CB8A 1KM3A 1O94A 1RVGA 1DORA 3HBLA 4AMAA 5E1QA 1F2JA 1R47A 3LCFA 2C0AA 5D30A 1W3IA 4DQWA 3FLUA 5AHEA 3IGSA 4GUFA 5DXYA 1TPUA 4POCA 2CZDA 1ZAHA 3A22A 1VCFA 3SGUA 3P80A 4GWEA 4OV4A 3HOJA 4FIRA 4N6EA 3HG4A 3I6RA 1A5BA 4AHOA 3DZ1A 4A21A 4LC6A 1GVOA 4WUIA 4PH6A 2B7OA 4FNQA 2ZRZA 4TMCA 1YTDA 3LV6A 4Z0JA 3IRDA 3IV3A 3EWXA 4ALDA 5EBUA 4UFLA 3VE7A 3MHFA 4R33A 4M7SA 1FUYA 1QO2A 3O05A 4PODA 3OHIA 2W6RA 2NUXA 3G1FA 3DFPA 3O16A 5DBTA 3BK0A 3NXFA 2I9EA 2ZTJA 2Z0IA 3MP4A 1F6KA 3NYZA 3QSTA 1Q45A 5CPOA 3THAA 3M5XA 1VLWA 4WQ6A 1FWWA 3A24A 5C5YA 3FS2A 3N9SA 5KITA 1VYRA 3DHFA 3TSDA 4O10A 2NX9A 3V1PA 1J5TA 2H6RA 4RJEA 4RZ5A 4K37A 4QJ1A 3UXDA 4JTTA 8TIMA 1OFPA 5AHIA 3CPRA 1YPIA 1DV7A 4AH7A 5F2GA 2IQTA 3A23A 1AW5A 2LLEA 1KFEA 1ZHAA 3T7VA 5DY2A 4PTNA 2ZZ2A 2VENA 4I7VA 1S5VA 1DBTA 1XDLA 2VKZG 1YTEA 2ZTKA 3UPWA 2EPHA 1HL2A 4LV4A 4LOCA 2BWGA 4QITA 3SECA 4XBKA 3NL2A 4GE8A 3RFAA 2WO5A 2WV8A 2UV8G 1CW2A 1FXPA 3W1QA 1SFJA 2WSYA 1FWTA 1LOLA 2E5DA 2C1HA 4DXVA 2VFHA 4XWUA 2Q3OA 3G0UA 5I3HA 1EA0A 3CEUA 1TPWA 2E77A 1K8XA 3IVSA 5K4ZA 2Y89A 1WAUA 1P5BA 4EF9A 3SY5A 4O11A 3GDMA 1D3HA 3VE9A 3DKJA 3KXQA 4XTDA 2XN0A 1XCFA 3TU9A 2QCDB 3L2IA 1G4PA 2GQ9A 2VFFA 2YCEA 2R94A 3DXIA 4YLWA 2RKXA 3L9CA 3S5OA 2HTMA 4MLRA 4Q33A 1RPXA 4RZ4A 3M0ZA 4EWND 1QPNA 2CLMA 3SIZA 4M6QA 3EWUA 3NG3A 3W1UA 1JCNA 1PIIA 1OYBA 2B7PA 4JDYA 2ZRWA 4ADSA 3UQNA 5AYZA 5F1VA 1PCKA 2I14A 3P5ZA 2A0NA 4FNPA 3LCGA 1F74A 2V81A 1PS9A 2C15A 4KFPA 5AHNA 1MZHA 1RR2A 5AB3A 1VZWA 2J9YA 3CTLA 3GZ3A 3W2KA 1SO3A 3LOTA 4X2RA 3TXZA 4A2SA 1KM4A 4R7JA 3PAJA 2BX7A 4YCPA 3B0UX 3DH7A 1ZJIA 4YL2A 3W9ZA 1ZAIA 5FEXA 3W71A 3TNOA 1KBIA 1TPEA 4HNTA 1LTDA 1C8VA 3LHZA 4U28A 4G1KA 3MI3A 4JGDA 3GK0A 1FCUA 1W5OA 1VS1A 3SSJA 1H7NA 2Z6IA 3M1ZA 3IEBA 3UD6A 2ZYFA 5D37A 4FNTA 3WJZA 1G6CA 3TAKA 2DZWA 1WA3A 2CWNA 4K39A 1L6WA 1ME7A 4AAJA 2V0TA 4N4QA 3GNNA 1FCBA 1FQ0A 1TPDA 3WFAA 1N55A 5L6UA 1YXYA 3OIXA 2OCZA 5AC7A 5D04C 2Y7GA 4JX5A 3GXTA 3OA3A 4IGHA 5K2ZA 2WOQA 4HN4A 4BFAA 3GKFA 3WK3A 4JTEA 5EPDA 3NPXA 4I9AA 4JTHA 3KVMA 1LBFA 1SU5A 3KVKA 4O17A 4NUWA 1JQXA 3PM6A 3M6YA 1A53A 2RDWA 3NQFA 4WOZA 5AYXA 3P62A 2A2IA 3W2MA 2XN2A 4B5NA 3W7HA 5CZSA 3NPVA 2CLEA 4GUGA 3C2EA 2VFEA 1VH7A 1EWDA 2QAFA 4I7WA 3M43A 2P0OA 3DFOA 4QISA 1AW1A 3HGJA 5AYYA 4XKYB 1FDYA 2NWRA 5AHFA 1L9WA 3ANYA 1DQWA 2DZXA 4P2VA 2J27A 2ZRXA 2ISSA 7TIMA 4LRSA 1KTNA 1W5PA 4O0ZA 4K7VA 3B0VC 4UTTA 4UR7A 1TPVA 1DVJA 2VEPA 1PHQA 4UFIA 4MFEA 3PBVA 3FIGA 4UTWC 3E96A 4S2CA 1ZY9A 2HS6A 4MZYA 4NNCA 3G0XA 3PSWA 3W86A 3TW7A 4FXSA 3SW6A 2RDUA 3B4UA 3O6DA 2A7PA 1NSJA 3TE9A 2R91A 3C2OA 4NNBA 1X1OA 5K9XA 2A85A 4NNAA 4AB4A 1LP6A 1LORA 1ME8A 2CZEA 5A8GA 2ISWA 5KMYA 1KM2A 3MO7A 1XBXA 2Q8LA 1OFDA 4JY8A 5J5RA 3GIYA 4GXMA 3CC1A 3MWAA 1SO4A 4Y9AA 3P67A 4NJGA 5HULA 1W37A 3R8RA 4HIBA 1PL9A 2V2DA 4O0KA 2A7RA 4S2BA 4O12A 1QAPA 3W07A 4A22A 1YTKA 5CG7A 5A5WA 2Z6JA 4K36A 3QPZA 1JUEA 2E09A 3LGEA 3O15A 3A9IA 2P1FA 4NXSA 3W7CA 4MPQA 1VPXA 3LCIA 2QEZA 4OHQA 1H60A 4BI5A 2YSWA 2A4AA 1ZCOA 4CCEA 3GAKA 4IX2A 1BWLA 2F7FA 2PC4A 1D9EA 1KFCA 1M5WA 5DY3A 4KWVA 1LDCA 5HR7A 3B03A 4ZQCA 4UFJA 1I8JA 3W74A 4HPJA 4JYFA 4BI7A 1FWSA 1EPXA 2H8ZA 2ZRYA 4GUHA 3PC0A 4IMCA 4Y96A 4OV9A 1K7XA 4UFMA 1TQJA 4Z08A 2BLEA 5G2HA 3G3DA 4Z1BA 5AN7A 2BTMA 5CZJA 4CQ9A 2ZZ4A 1TPC1 4E38A 4UTUA 1C29A 2QCFA 3M41A 4DO6A 1K02A 3F4NA 1FX6A 3G1VA 3EKZA 3W6YA 2CLFA 1G7VA 3P7YA 3W7JA 4X22A 4MYAA 5EYWA 3QSRA 1NFBA 1FDJA 2ZRUA 2J6XA 3G1SA 1JULA 1H62A 1WBJA 3ZWTA 3GDTA 3KAOA 4N6FA 4N9EA 4H3DA 3TCEA 1XBYA 4CQAA 3LX9A 4MVAA 1I45A 4JTFA 1X6UA 3GKAA 2V2CA 1TV5A 1K3UA 4R53A 1XL9A 4JN6A 4WX2A 2TMDA 2V30A 4RX0A 3CLMA 3G8RA 4Z0SA 2E6AA 5LHFA 1TB3A 5KZDA 2DZSA 1Q6OA 4DELA 3TQKA 1JR1A 2QDHA 5F2LA 1FXQA 3BVJA 2C19A 1LBLA 1GWJA 1TIMA 3NZ1A 1W31A 4L4LA 3R12A 1YADA 1TPH1 1XC4A 1YXCA 2G96A 3BW2A 3QC3A 3V75A 3INPA 3LTSA 2A1YA 1I2OA 3TIMA 2YDAA 4ZQOA 1FWNA 2A21A 2J24A 4JXCA 3H53A 3SJ3A 3NO5A 2PRMA 3O8AA 3QYQA 3QEZA 5AOUA 4IQLA 3ABRA 3MUXA 1J4EA 3U6WA 4A29A 3CEPA 3BGGA 3MYPA 3QW4B 3R2GA 3NR0A 1O5XA 4O52A 2FPTA 2RFGA 3W2UA 2QAPA 4RLIA 3USBA 2O7QA 3W2NA 1VC4A 2V5LA 4Y6GA 2YFNA 3W1NA 2YW3A 3LLDA 3M5VA 1PVNA 3OVQA 1BTMA 3W7LA 2ATSA 1LOSA 3PUOA 2A6LA 1SFLA 1JCMP 3W1LA 5D2WA 4ZZ9A 4WD0A 3HF3A 3O6CA 1SO6A 2DJLA 3NNTA 5K9CA 3DENA 2ZZ6A 3LXCA 3B06A 3CT7A 5I3IA 3R13A 3MMTA 5DLCA 1W5MA 3HB9A 4LC8A 4MKNA 5CKSA 3JS3A 5F2IA 5HUPA 4PL2A 1W1ZA 3S5ZA 3I68A 4YMZA 1Z41A 5D05A 3CIXA 2ZZ1A 1EIXA 1C9DA 4Z1CA 5F2MA 1YDVA 3W1TA 3C6CA 3LLFA 4UMBA 3M44A 4QQ3A 4NX0A 4ZVJA 2FJKA 2CLLA 3NAVA 1KM6A 1H1YA 2H3DA 5HUOA 1X7FA 1OFQA 3GX9A 3C8FA 4Q32A 3W87A 3VNDA 2CLKA 3N9RA 1R30A 2GVGA 5GVJA 4LV9A 3RF9A 4AF0B 2YGYA 2BSLA 3GLCA 1VCVA 6ALDA 1EX5A 4BI6A 2QCEA 1F5ZA 3N2MA 3L65A 2Z2UA 4TX9A 3DBPA 4GNJA 2G97A 4LT9A 3W7GA 1XBZA 5BW6A 3SI9A 3G1YA 1GG1A 2YYTA 4O4WA 2FIQA 3P5YA 5I3GA 2VC6A 4JICA 3N19B 4MJZA 1H1ZA 1TPFA 5BNKA 4OWGA 2YFOA 2CLHA 3LBCA 3HGSA 3DKLA 4JR5A 2VELA 2QR6A 3Q58A 3STGA 3MBFA 4WXYA 3LM7A 1HO4A 1SR9A 3NQ2A 3R89A 4UTJA 1M6JA 2Y88A 3M5ZA 2C16A 4PEKA 3PB2A 2Y7FA 5KTLA 1QOPA 1ME9A 2ZCGA 3S1XA 3GVGA 3PWAA 3IIXA 4DO4A 4WOQA 1H50A 4GJ1A 4QM1A 3W1MA 2GJNA 3O07A 4FX8A 3RLVA 1OK6A 5DN1A 2B4GA 2RDTA 4K38A 3FJ6A 3Q2DA 2BZNA 1ONRA 4HPXA 4PC8A 1SSGA 4N02A 2Y70A 1WQ5A 3T55A 3E02A 2ZA3A 2NUWA 4LY8A 4RR4A 3F4WA 2ABAA 2C18A 1SW7A 1ZNNA 2ISVA 2ZDRA 2OMAA 1L6SA 1Q6LA 3NVTA 3W7PA 3FKKA 1KFJA 4BF9A 1XXXA 3IIVA 3PY2A 1AK5A 2CFFA 4TMBA 5D2TA 3KRUA 3NGJA 4OE7A 3HMJG 3GXPA 1R46A 3TSBA 4TR9A 1A5AA 5E0KA 4S1FA 2Y7DA 2OX1A 4YCOA 3LBMA 4KWWA 1NEYA 3W7KA 2TPSA 1LLWA 2TSYA 3LTPA 4FIQA 3LXBA 1SW0A 4JIQA 3GYEA 4LVBA 2GQAA 4LNYA 4AWSA 1OK4A 1MEHA 2VFIA 1YYAA 1B3OA 2W0UA 5D38A 1RD5A 4I7UA 4UXDA 3UY7A 1P4CA 1J2WA 1XFBA 3TA6A 2NUYA 3S5YA 5LNWA 5K7JA 4R34A 3PS7A 2DZPA 4LS0A 1QR7A 2Z1BA 1KLZA 1HUVA 3G1AA 5G1TA 4RKAA 1S5WA 5LGZA 3IVTA 4N9BA 1TRIA 1TTPA 2QDGA 4ZQPA 5KSWA 2YW4A 1MEWA 1W0MA 3PG9A 5K4XA 4UTLA 2PE4A 4LW7A 2AGKA 3P61A 3QF0A 3QQ1A 4CNNA 1LBMA 3HG2A 2FQIA 4UNKA 3W7OA 4NZJA 3M7WA 4M5PA 1TV7A 3A5FA 3W7QA 2HMCA 4TIMA 3G3MA 2HS8A 2GJLA 5EA9A 5AC6A 5CSSA 2YX0A 4OGZA 5D32A 1BWKA 3W2JA 5AHLA 4FNRA 2EHHA 4IMDA 1E51A 3P81A 5KINA 1DHPA 4IX0A 5EY5A 2PRLA 5D2XA 2WJZA 2V9DA 4O1AA 3JR2A 4PL1A 3O6YX 1F6PA 4QNWA 3W76A 3S8HA 4BWLA 1M7OA 3QMSA 1QNVA 2RH9A 1KV8A 2CLIA 4BWLC 3DFNA 3UWUA 3G1XA 4LRTA 4NJHA 3B8DA 1I2PA 1KA9F 1EUAA 2E6YA 3EWBX 1YDNA 4IXXA 1UB3A 3NQDA 1EEPA 3BW4A 4EIVA 1TTQA 2ZRVA 3SR7A 3RNDA 3VFLA 2D73A 3Q37A 1W5QA 2QUTA 1O4UA 2E5CA 2G5WA 4KFOA 5CPNA 4GC4A 4O8RA 3M16A 4AVFA 3MP5A 2NXHA 4K8EA 1H7RA 3FFSA 4DF2A 4QIUA 3KX6A 3BGJA 5K3VA 3WJSA 4ADTA 4CCDA 1L6YA 2BXVA 3BV4A 3QQ0A 5LNSA 4RK8A 5CPMA 2NWSA 1GOXA 3W7IA 5DCDA 2RHGA 1WOAA 4KFNA 4N9CA 4NVTA 5D33A 1KM5A 4HT3A 1THFD 4C1LA 4UIOA 1WXJA 5LHEA 2E68A 1G4EA 2NZLA 3C4UA 4AWUA 1T96A 4FNSA 2R8WA 1I4NA 4O4VA 2WNQA 1OG0A 3L5LA 4ML9A 5D09A 2Y6ZA 2VEIA 2ZA2A 5LNUA 2OJPA 4X9SA 4JY9A 2WKJA 3LDVA 1NAL1 4PCFA 4UTTC 3C61A 2HSAA 1P0NA 5G5IA 4YWIA 1SSDA 1AL7A 2GQ8A 4IUOA 3GDRA 4JYDA 2AAMA 2Q8ZA 3W7MA 1F05A 3TJXA 4WY0B 4BK9A 3I7QA 1G69A 3KFTA 3SFKA 3EKLA 4LS1A 3MYOA 5DXXA 5DELA 4AF0A 1RQEA 3PUDA 2A5HA 4NX5A 4UTIA 4AHQA 4UC5A 2VEMA 2QCMA 3S9YA 1TJRA 4E0CA 4AHPA 2OT0A 1H51A 1W3TA 3TKFA 2A6NA 3LHUA 1FCQA 3EX4A 4FO4A 2YYUA 4ZQNA 3BPWA 1KFBA 3EX3A 2QJGA 3C2FA 1UCWA 4HSOA 2H8XA 3W7DA 4X3ZA 4M7TA 4XQ6A 5H2ZA 4E2DA 5LKYA 1OJXA 1OF6A 3DHDA 3BARA 2QUUA 1I2QA 1XI3A 5EKYA 3W23A 1ICSA 1LRNA 1OX6A 3C0JA 4IOTA 4O1DA 1PHWA 1KW1A 4O14A 1S5TA 3B04A 5F1UA 5LGXA 4ORMA 3W3OA 1N8FA 1YXDA 2EGZA 3F1QA 1EP1A 1TCDA 5FESA 1SZGA 4DBDA 5HINA 4HSNA 1IXNA 2AQWA 3CWNA 4M19A 3LHTA 4ORIA 5KZEA 4LU0A 4JTJA 1KM0A 3DFTA 3N73A 4MY8A 2JGYA 3TK7A 5G2WA 3NDOA 1QPOA 3VI2A 2EAWA 1K7FA 1R2SA 4BR1A 2Q3RA 4L4MA 4DO5A 4AEOA 5K9DA 1IXQA 1DL3A 5EMUA 1LM1A 5MHBA 1FWRA 2JKAA 1TQXA 2DJXA 5CPLA 2JK2A 3P82A 4ONVA 5D2VA 2V5BA 5TBOA 1WYIA 3P8JA 4ZMGA 4HKPA 1FY6A 3L5AA 3C52A 3QJAA 2QCLA 3UY8A 1LROA 2ZQ0A 5FF7A 3PR2A 2DORA 2GOUA 5HNRA 1G4SA 3UWVA 3H55A 1QO5A 1O95A 2ZZ5A 3VCRA 3TQ0A 5HWNA 4FX7A 2FB3A 3LXAA 5FF3A 4HHPA 3RLUA 1OABA 4CQ8A 3CQ0A 1B9BA 3L67A 4UUIA 4U4MA 1BKSA 1LYXA 1VHNA 5LZLA 5BOOA 1VR6A 3PG8A 3LCWA 4HNVA 1SQ7A 1P1XA 4O1BA 5IBXA 3OEXA 2QCCA 3EWWA 3NA8A 3FYOA 2QCDA 3B05A 4MLJA 5IBXC 4UMCA 3G0SA 1EB3A 4O57A 5BMWA 5HJLA 3W1AA 1LLZA 5C54A 1WBHA 3T78A 4MJMA 3DFQA 3L0KA 1BEUA 3KVLA 3S1WA 5CZTA 3U2OA 1JRBA 3EXRA 3QZEA 3H54A 5ABTA 3I7SA 1SUXA 1G4TA 1LCOA 1ICQA 3LHWA 1JCJA 3NQ6A 1GEQA 3EWYA 1Q6RA 4A3UA 1LRQA 3NL3A 3L66A 4AWTA 1GVRA 3K30A 1JCXA 4N2YA 5D03A 1TJPA 4OQVA 4FB7A 5E93A 4FEZA 4JTIA 1Q3NA 3GNDA 3JRKA 2JGQA 5FF2A 3UWWA 3W72A 1SZEA 3N2XA 2P10A 3BG9A 4LUJA 1U83A 1QMLA 2V2HA 4JIPA 3WK0A 3LV5A 3TAOA 1JQVA 2YR1A 4RCXA 4O19A 3HPSA 3LCHA 4DPQA 4DF1A 4O50A 3MP3A 3IIZA 2ALDA 2TYSA 1RV8A 1JJKA 4RXFA 1T99A 4FF7A 1O5KA 4O16A 1TV8A 4E2BA 3UYCA 1UUMA 2J9ZA 4JYEA 3ABSA 2WNZA 3IIOA 2XN1A 3RMJA 3GR7A 2CZ5A 5EL1A 3UZJA 1ZAJA 4JS3A 4Y8FA 4WJEA 3CM4A 4PA8A 4IMGA 1M7PA 3G18A 4NT0A 3SZ8A 3PF3A 4IPIA 4NQ1A 2NXGA 3S6DA 1Y0EA 4LUIA 2PRHA 3W88A 1ML1A 4LTSA 3T40A 1VYSX 4JNMA 3ATZA 4KKXA 1W54A 2C6QA 3F03K 1UJPA 3HPZA 4LVGA 3UWQA 3CWOX 5KZMA 1QPQA 1GZGA 3HGOA 1HG3A 4JTSA 1JCYA 1EP3A 3W1PA 1WOBA 1IXPA 4XKYA 2ZZ7A 1XUUA 1TYGA 2B0MA 4J9JA 2YXGA 3S42A 3MI2A 3TXVA 5G4EA 1GT8A 1TO3A 1GG0A 3A5VA 3W7NA 3QW3A 3VKJA 2X1SA 1DQXA 2C13A 4ADUA 1KV5A 1OX5A 3HG5A 5CSRA 4HNUA 2DU2A 3NOEA 4LS2A 3O1NA 2EF9A 3UWZA 3S1VA 4A2RA 1KTCA 1IF2A 1SO5A 3SGZA 1JCLA 3N14A 2NX3A 4FX6M 5DCBA 4WY0A 3TV8A 2ABBA 2NX1A 4AXKA 2NXIA 1MSSA 1NF7A 5AFDA 1H63A 1OFEA 4ICNA 4CNOA 2FLIA 3FEMA 3L5MA 2YZRA 4WY0F 1KM1A 2J9XA 3ABOA 3C56A 3LI0A 5AHMA 4W9TA 2QKFA 5C55A 3HG3A 4UCGA 3NEVA 5G4WA 1DJNA 5SWUA 3RU6A 3NM1A 4OT7A 4Z1DA 3UPBA 3CHVA 1WV2A 4O15A 3EXSA 1KBJA 5I3KA 4UMAA 3GDLA 3MBDA 4HNNA 3AJXA 4JTUA 1JUKA 4NJJA 5LNRA 3W22A 3TMQA 1A5SA 4MZ8A 3BO9A 3N3MA 2ZBTA 4GRSA 4GUIA 2H90A 2WQPA 4LVAA 1XM3A 2QUVA 4NZFA 5LNVA 2QJIA 2GPTA 1DJQA 4NXKA 1KFKA 2FB2A 1ICPA 1QOQA 3NQCA 1T8XA 3P8IA 1YPFA 4MUZA 2C14A 2FTPA 5AC8A 1SPQA 3LHYA 2J88A 3OVRA 3P60A 4PFMA 4C1KA 3TSMA 4M6VA 3TFCA 1OYCA 1B57A 5CZ0A 3NQVA 3E9AA 3UZ5A 4FXRA 3THQA 2YPIA 4MFDA 4NU7A 3WJXA 1UUOA 2QCHA 3LERA 3G8EA 1NF0A 3W1XA 1AMKA 4ZL1A 4H4IA 3IIPA 2JKPA 4CLMA 1H5YA 3FKRA 2CU0A 1OYAA 2PURA 3QPYA 3AO0A 3GR8A 4K7YA 3I7RA 5U4NA 1H7XA 1UASA 1HO1A 5HWJA 1VCGA 5U7SA 2FPVA 3LRLA 1YDOA 1KFLA 3BG5A 3BG3A 4EOUA 3O63A 4FNUA 2CLOA 4CNPA 2VFGA 3M47A 3KOFA 4MIMA 3B0PA 3MHUA 1OFAA 1H7OA 2ZA1A 3TMLA 3WK1A 4Z1AA 3W84A 3C2VA 4IMEA 4XZ9A 1OX4B 3HJZA 4RZ6A 1FDZA 3DI1A 3EWZA 4YXGA 3LTYA 1A5CA 1JUBA 3MHGA 2VOMA 1VJIA 1MEIA 1FCVA 2X1RA 4D2JA
chains in the Genus database with same CATH superfamily
1DP0A 1JXKA 1SJBA 4P61A 2RGLA 3BC9A 1EO5A 3R10A 3CZJA 1OIFA 1R2TA 4DI9A 2VDGA 2PDLA 3W1RA 4O1FA 3GDKA 3TQVA 2AQVA 3PBUA 2V5DA 3PZ9A 4LVDA 4XIAA 2W62A 2OWWA 1UR2A 1UBSA 4O1CA 3W7EA 3AISA 4X61A 4BJHA 4JQ2A 2W3ZA 4MY9A 4XUYA 3L0GA 2R6OA 4UFHA 4Q4MA 3U48A 2JKEA 1MXSA 2WMIB 3B9EA 2GQ3A 3GHSA 2F2KA 3WUFA 2JFEX 4CCCA 5JIWA 2GUUA 3I6EA 1K03A 2FFCA 2ZX8A 3B4YA 5G1MA 3R11A 3PBWA 3QMTA 2PCEA 4RE2A 4HPHA 3H4GA 3LBOA 2H3BA 1KRCC 3UERA 1JI1A 3W53A 2W27A 4IMFA 4UR8A 3CL7A 1AL8A 1BGGA 4ICCX 2WSRA 3NQEA 3GNOA 2XZ7A 1SZNA 4PMOA 5FF4A 5FOOA 4ATLA 3BOXA 3G1DA 1T0OA 5HANA 3LLXA 2E25A 2WMHA 5A8OA 1AG1O 3T2OA 5H8PA 2FGZA 5F4XA 5HQEA 2FZ9A 3CUIA 3FOKA 4K8HA 1WUEA 3K4AA 2WZEA 1FFQA 4UTWA 2BXZA 1VYPX 4MUPA 4ILSA 4DNHA 1GQIA 1QCWA 1RQBA 1I2NA 3CUXA 4DWSC 3W83A 4XAZA 9XIAA 1NIUA 3S2CA 1V79A 3ABZA 4V27A 3FHAA 2DSZA 2DW7A 3I65A 3DFHA 4DPPA 1D3GA 2J7FA 4WIWA 4S3GA 4KEUA 4JTAA 4C6BA 3MQTA 3QTGA 1HKMA 3IJ6A 2HBVA 3PB0A 5BWFA 1H7WA 3DU0A 2DSVA 5C71A 3BLFA 1UP0A 3IGXA 4Y90A 1UKSA 3BCFA 2OSWA 1OEPA 2I57A 3RK8A 5CGQA 4GHRA 2J7DA 3MB9A 3EX6A 4QAWA 3MSGA 1Q7QA 3IARA 3QMRA 3VDCA 5HOSA 3CU2A 2XWEA 3MZNA 2G95A 5I3JA 4Q6JA 1R3WA 3TW6A 1PE1A 1R5YA 2XJ7A 1RSCA 3T4CA 5HBFA 1KFWA 4C6KA 1P0DA 3CO4A 3K8LA 3G1HA 4QXIA 4XKMA 3K8KA 2Y1HA 4AD0A 3UA3A 4R7OA 4UTMA 3VIGA 2WZMA 2EQDA 4LYKA 4RZBA 5CJMA 2BVWA 5CC5A 1TTIA 1PZ3A 3CAKA 5LA0A 1EZ2A 2XVNA 2DT2A 1XC6A 3VMPA 1HFBA 3RR1A 2V3FA 1OT1A 3R0KA 3DESA 1ZENA 4TO8A 2V8ZA 1GZ1A 4G8TA 2O7SA 3LSCA 4D71A 1OIMA 1J5SA 1QI2A 2OELA 4JCMA 5GQBA 4NZ4A 3PWIA 2FH6A 3IGUA 4DBWA 2Z2AA 2CBIA 3T44A 5CC6A 4A6GA 3AOFA 1OHLA 1IIGA 4NZ1A 4QG8A 1ADOA 1XLGA 3E0VA 3IVUA 1ZB5A 3BJFA 3OLIA 3SIMA 4GZ7A 2PA6A 3P74A 1XLJA 5J5DA 4D1IA 1VIZA 3LNMA 4DUWA 1W5NA 4RNFA 1OX4A 1U1JA 1V3KA 4NL1A 3XINA 5CLTA 3NO1A 1OFRA 3CT2A 2QJHA 3AU2A 5CQ1A 3W70A 3AZTA 4UNIA 1UZDA 3GE7A 1JD9A 3CLWA 1YLVA 1MDRA 4Q4QA 3NQ8A 4DBEA 1EBGA 3TC7A 1TMHA 1CI1A 5KZ6A 3AIUA 3UXAA 2C3ZA 4U2YA 3BMXA 1REQB 4LANA 2BHUA 3W4RA 4KWUA 3GYCA 1DJXA 2Y63A 1XIBA 1MRAA 4HVXA 4OUEA 3D3AA 1GK8A 4UTKA 3V4BA 1AJ0A 4M82A 1R9YA 1R2RA 1GQNA 4AU0A 2X16A 2E6DA 1GPWA 4EVZA 4RV3A 4IPJA 4IFRA 4AD2A 4IG2B 4MF4A 3H24A 5BXTA 1KKRA 3EXTA 1RZMA 2JBMA 3UR8A 1GYLA 3NM3A 3ZSSA 4AG0A 2VXNA 2X1UA 3EOOA 3OYXA 4JTKA 3CS2A 1W3NA 3H2EA 3VKDA 3N13A 1Q6QA 2GLKA 3PBGA 3SUUA 1CGWA 1SZFA 2VI0A 3GW0A 3LB0A 4Q8WA 1E72M 4N4PA 1E15A 1SW3A 1FKXA 2QCGA 1B54A 4DBUA 1N8WA 4XTIA 1KLYA 4Q8PA 4H6RA 5I24A 4MZ1A 4ZQRA 1Z42A 1DORA 4DN1A 1TWSA 3QV7A 5E1QA 3VOGA 3LCFA 2C0AA 1W2PA 3M0IA 1W3IA 2E9MA 3ZOAA 2XSXA 5AHEA 2QJJA 4GUFA 2AOSA 3EWDA 3SGUA 3P80A 4FXFA 5HQLA 1UW9A 3BJTA 1TIWA 3CIVA 3DZ1A 4L1GA 2BVTA 4A21A 1XYMA 4TMCA 5A95A 4NAEB 3LV6A 3LQGA 3OA5A 5A3HA 3IRDA 4FS9A 3GC4A 3W6LA 1DIOA 2G3FA 4ALDA 2HVMA 3SSZA 1UD5A 2JIEA 2I9UA 3JUGA 2J62A 4PODA 5A6KA 3FAWA 1R87A 3NXFA 1HGYA 2OOFA 4JFWA 3GVQA 1Q45A 5JIPA 1UWIA 1UD4A 1A3WA 4XO6A 8XIAA 5C5YA 5HMEA 5E09A 1ZRQA 1VYRA 4O10A 1E9LA 2I5QA 4RZ5A 4K37A 1OFPA 1CTNA 2YB1A 2V6AA 3VGEA 1YPIA 2GK1A 4PMXA 5F2GA 4GQ0A 4KRZA 1OBAA 2LLEA 3JZUA 2J6VA 3AXHA 2ZZ2A 4I7VA 4URIA 1XDLA 2ZWZA 4CN6A 1EQPA 4GE8A 1GQLA 3L4XA 2WV8A 1GOWA 4KMQA 1FXPA 3WLKX 1RP9A 1UKQA 2GL5A 2WSYA 2E5DA 3WH8A 3MJMA 2VFHA 2Q3OA 2BVDA 1KWKA 5I3HA 1EA0A 1K8XA 4A3QA 4Z1YA 1P5BA 3DC8A 1O7AA 4ZENA 5BU9A 3DKJA 5I6SA 4WGXA 1XCFA 4V15A 2QCDB 3DXIA 4YYCA 2R94A 2VZUA 4U5KA 3L9CA 4XD6A 2ACQA 3S5OA 4QE1A 1K4HA 1UR4A 2PP3A 1FWHC 1CIUA 4M6QA 4IM4A 2B7PA 4I5RA 4DI8A 3P5ZA 3TYDA 1F74A 4KFPA 3SCSA 3STPA 1HVXA 1ZJHA 1MZHA 1RR2A 3CTLA 3W2KA 1SO3A 3LOTA 4A2SA 3TOPA 3B0UX 2PDPA 2P76A 1EDGA 3W9ZA 3W71A 4PGLA 3UYIA 1TPEA 4HNTA 1C8VA 3AI0A 4JGDA 1W5OA 4PTWA 1R3TA 3WX7A 1OSEA 5T9BG 4ACZA 1MQQA 4KW2A 3V5OA 2ZYFA 3TAKA 5DT5A 4FP1A 4LAUA 1C90A 1DJIA 1E9IA 1I60A 2OLHA 1AA1B 2DT1A 2BBFA 4N4QA 2PLJA 3N11A 1TPDA 1FQ0A 3VD3A 1OWQA 2WMKA 5L6UA 3OIXA 5JXQA 5EGRA 4IF2A 2HISA 3BLPX 4CD8A 4KWSA 5I0DA 2JEQA 4R9XA 4BFAA 3BWWA 4JTEA 2BVYA 5EPDA 1JZ3A 5CBIA 2J7EA 4K68A 4IICA 1J6PA 1LBFA 1SU5A 1CECA 5D9PA 4O17A 2J4GA 1EXBA 3PM6A 1A53A 2RDWA 3NQFA 5AYXA 2A2IA 4KEVA 3W7HA 4ENLA 2CLEA 4MNLA 4GUGA 4GKLA 1E1CA 2G50A 3ANVA 2OEJA 1VH7A 3WLLA 4I7WA 1W9BM 2AAAA 4X9YA 3SCPA 1ENUA 2P0OA 4GA8A 3DFOA 4AYGA 6ENLA 2D3NA 1BVNP 1DXEA 4J3SA 2DZXA 1KGWA 5EBAA 7TIMA 2GDQA 3B8UA 3BSHA 3B0VC 4UR7A 3WH9A 3F5KA 3R43A 1K9EA 4UFIA 3PBVA 3FIGA 1ZY9A 4LEFA 4ES4A 3W86A 3SW6A 4HJFA 2A7PA 3AMCA 4E4PA 4UTFA 3TE9A 2A85A 3H7RA 5AZ0A 4M6UA 3AIRA 1LORA 1ME8A 3WEMA 1HZYA 3O0KA 5LIXX 3MO7A 2Q8LA 2CBVA 3L4YA 2CXGA 3TTQA 4DJDA 3CC1A 2DPEA 2V3DA 2UWFA 4DJDC 1F6YA 5HULA 3R8RA 1X6LA 4P7QA 5FJUA 4HIBA 2A7RA 4AC7C 4GC3A 2WB5A 1PZ2A 5A5WA 2DVUA 1JUEA 2YCJA 3A9IA 2P1FA 4NXSA 2VD9A 2QEZA 4R5EA 1ZCOA 2F7FA 3C0SA 5JBEA 4MADA 1LDCA 5HR7A 4GQRA 2GSEA 3U7VA 1ECEA 3GFYA 4U3AA 3W74A 4JYFA 2H8ZA 4GUHA 4OV9A 1W3LA 3WH7A 4Z1BA 1LQ2A 1U5HA 5CZJA 2ZZ4A 4CQ9A 4E38A 1UH2A 3H21A 3PPFA 3EKZA 4WDXA 4YN5A 4XAGA 2VNCA 3W7JA 5EYWA 3MU7A 2VDIA 3XISA 1JULA 1H62A 1WBJA 3KAOA 2IW0A 4N6FA 1WDSA 1A5KC 1KCKA 4F0LA 3TZFA 4MNJA 2WMFA 1ZJBA 5IHRA 1WCGA 3WF0A 3BAJA 3NSNA 1LWJA 1L8PA 5ABHA 2RJHA 1P48A 3GNRA 3OLGA 1FTXA 4NI3A 2FZDA 1UOKA 3TYUA 3PJWA 2VWSA 4DJDD 3CLMA 4Z0SA 3AIWA 2DZBA 3DEQA 1Q6OA 5I77A 3MUCA 5GPRA 4UQEA 2QDHA 1OCBA 4CUCA 1FXQA 3W81A 2C19A 4TX8A 1TIMA 4Z2LA 5BCAA 5I03A 1JDEA 4KEMA 4ZGYA 2FHBA 5CPSA 4W7VA 1UWAA 2PP1A 1I2OA 2ZE0A 3TIMA 2YDAA 3PJUA 3M0JA 2J24A 4JXCA 1FP9A 2W4XA 4WGHA 1WZKA 1R3SA 3EDDA 3WNMA 1J2BA 1VBGA 2JE8A 5AVNA 3OPSA 2POZA 2CHRA 2PODA 2GSJA 2QZRA 4RLIA 4GX8A 4A05A 3APGA 3W2NA 4DNMA 4H7CA 4H8VA 3W1NA 2YW3A 3AHYA 3LLDA 3M5VA 3OVQA 4GH1A 1BTMA 5CAKA 1CGXA 3WNOA 1Q6FA 4HCDA 4ZZ9A 4WD0A 4FOJA 4Q4PA 4M0XA 4CNTA 4ZTXA 2TAAA 1XV8A 3R13A 3PJTA 1I1WA 1S2AA 3AXXA 5CKSA 4MTVA 1JZ7A 2CITA 3S5ZA 3EBVA 4YMZA 1EIXA 1GVEA 1ISWA 3HQNA 4I3GA 3IAPA 4JHMA 3W1TA 3LLFA 3M44A 1EOMA 4EX4A 3ZT5A 5CLWA 2CLLA 1TJ2A 1GZJA 4JQ4A 3TN6A 4R3UA 1UA7A 5LIKX 3KP0A 4WJ8A 3VNDA 2CLKA 4AX7A 4DWSB 2ZXAA 4YVXA 4JIHA 4D1JA 3HURA 1PPIA 3UR2A 3DBPA 1VFOA 4LT9A 3B9OA 3JZEA 4RNIA 3RO6A 3W7GA 4C6LA 3SI9A 1YHTA 2OLSA 1DJHA 3ISIX 2F61A 3P5YA 3VUSA 4JICA 3N19B 1H1ZA 1TPFA 4XIMA 4OWGA 3BLLA 4XISA 4HNOA 4LYRA 3HGSA 3DKLA 3T08A 4K8GA 4S3KA 5CG0A 2C91A 4WXYA 1TUFA 3LM7A 1SR9A 3DYPA 2HNHA 3EOEA 3I10A 3LMZA 4UTJA 3R89A 1E0UA 3L7RA 3F7JA 3MCOA 3IUHA 5KETA 5CC3A 2QLYA 3WDQA 4DRSA 4J3ZA 3W1MA 2OYLA 3SURA 1NFPA 1CGUA 2RDTA 2XVKA 3R58A 1JI2A 4PC8A 3BV7A 1SSGA 2ZUSA 2Y70A 3TW9A 1XR2A 3SQLA 3PTKA 2NUWA 4RR4A 1EFZA 1JYNA 1Z8AA 2ZDRA 1IE7C 3FNDA 3NVTA 3A3HA 2AL1A 1EHAA 1PUDA 4LYQA 4TMBA 2D1ZA 3GXPA 3TSBA 1J79A 4TR9A 2WKLA 2XWDA 5A2CA 3ZJ7A 2OX1A 4KWWA 2HWGA 1XP3A 4FIQA 4HK5A 1SW0A 2OO0A 2NVCA 2GQAA 2E9BA 4LNYA 1MEHA 2W0UA 1YYAA 5D38A 3IJ9A 4UXDA 3UY7A 1J2WA 1OZQA 3USZA 5K7JA 2IPFA 4R34A 1QNRA 4E8GA 2VURA 2FHCA 3LSBA 3CHFA 1K77A 3S2NA 1HUVA 3MCNA 2ZOXA 4RKAA 2PF0A 1S5WA 2Q02A 2YW4A 4AIBA 3PG9A 4H8NA 3FSTA 4LW7A 3NJ3A 1LBMA 1DQUA 3EPOA 4EPKA 2R1MA 4IQDA 5E9XA 1M41A 4NZJA 1UH4A 3WBAA 2Z4GA 3MWCA 4ZODA 4QCFA 1FHUA 3A5FA 4GXPA 2HMCA 3G3MA 2GJLA 3CAVA 3VIMA 1H0IA 3R1ZA 5EA9A 5CSSA 4OGZA 4F0MA 4FNRA 2UY3A 1E51A 3P81A 1XLHA 4IJCA 4IX0A 3MZ2A 4E4FA 2OG9A 4V28A 2IKGA 2VQTA 4XB3A 3GY1A 2JF7A 2NQ5A 3G1RA 1WKDA 3MSYA 4PL1A 1NQKA 3VNJA 1SMDA 1PWMA 4BWLA 1QRQA 4F48A 1QNVA 2RH9A 5CJNA 4BWLC 3FY1A 3UWUA 5DEZA 3U2ZA 3A4AA 2FH8A 2GWGA 3VIHA 1KA9F 3OQEA 4PCNA 1F61A 3W29A 7PTDA 4V2XA 3VFLA 2WC3A 5JU6A 3Q37A 1RJQA 2QUTA 1PB0A 4EE9A 1NDVA 2E5CA 2G5WA 1US3A 4XSLA 3MP5A 2NXHA 3FFSA 4DF2A 3VNYA 4PUEA 2BP1A 3GVVA 3IWPA 4HNCA 3WJSA 1AODA 2NQHA 2NWSA 1PYMA 4N9CA 4NVTA 5D33A 4HT3A 1KRMA 2P50A 3MUZ1 1XIGA 1BG4A 1XF0A 1G4EA 3PZOA 4C1NA 2R8WA 1I4NA 4U2ZA 1OG0A 3LQLA 3KOXA 4ML9A 2FGLA 4X9SA 3T9PA 3FEQA 1J12A 1E56A 1NAL1 3VZXA 3AS2A 4UTTC 1JF6A 3WH6A 4M29A 2ZUNA 3D3FA 1AL7A 3PZQA 2AAMA 2Q8ZA 3BZGA 1YDYA 3FYYA 1BLIA 3KFTA 5DXXA 4MJ4A 4AF0A 4DX3A 2GVYA 3VOJA 3TONA 2IPWA 1OY0A 1ZBVA 4NX5A 4UTIA 6XIAA 1VEPA 2XG9A 2A3CA 1QK2A 1TJRA 5A6SA 4E0CA 2PLCA 2OT0A 1EF3A 1XCXA 4FO4A 2QJGA 1FH7A 3ARWA 3VU2A 3FVDA 3CBWA 3W7DA 4X3ZA 4M7TA 4XQ6A 5H2ZA 4E2DA 3OJGA 1MXGA 3C5QA 4DJFA 3DHDA 4INFA 4CKQA 4I8DA 1XI3A 4DJFC 3W23A 1LRNA 1OX6A 1MVYA 4O1DA 1PHWA 1KW1A 1RJPA 3SM0A 4O14A 3CGTA 4Q8NA 1QW8A 4LAMA 5A6BA 3B04A 2QQ6A 5LGXA 1WZLA 4UB9A 1YXDA 3F1QA 1DWIM 1TCDA 3KUMA 5FESA 3FGCA 5HINA 1M03A 1BYDA 3GR4A 1GPFA 3LHTA 2OVLA 5KZEA 4BF7A 3N73A 4ML4A 5I78A 3C0LA 4G7EB 3UGVA 2PWHA 5XIMA 5J04A 1K7FA 3E0LA 1R2SA 4XAPA 4F2BA 3AALA 3SUTA 4QS5A 5IRPA 1WPCA 2CC0A 2JK2A 3ITOA 2V5BA 1WYIA 1ISXA 3P8JA 4HOZA 4ZMGA 4JQAA 4HKPA 3QJAA 5A94A 2ZQ0A 5FF7A 4RW3A 1DWHM 4GNKB 5FSDC 4C6CA 4TUFA 1OINA 1IEVA 4FX7A 4AIUA 4J27A 1QBAA 1VBHA 3C86A 3RO8A 3VNIA 3L67A 3WN6A 3OO2A 4E6MA 1LYXA 1Q66A 2YXXA 3PG8A 3MKVA 1RK5A 5IBXA 4WSKA 3QKEA 2QCCA 4C6IA 4A35A 4B91A 2NT1A 4M1BA 3B05A 1MW0A 2FHFA 5IBXC 5GJNA 2EKGA 1EB3A 3G0SA 4DJFD 4O57A 3W1AA 3WNPA 5C54A 5ABFA 3T78A 4MJMA 3L0KA 1BEUA 4IQEA 2BHZA 3QY8A 3KVLA 2YL5A 5A6BD 1JRBA 3A13A 3QZEA 3H54A 2CETA 3I7SA 1PSCA 3S6OA 1G4TA 1J96A 3NQ6A 1O12A 1Q6RA 1LRQA 3RDKA 4AWTA 2VRQA 1I6NA 5D03A 5E93A 4KBXA 4JTIA 3GNDA 4ACZB 3L4WA 3JRKA 1UWQA 3UWWA 3W72A 1SZEA 5AC5A 3ANUA 2A3EA 2NQJA 3OYZA 3A12A 4JIPA 2RDXA 2WCSA 3WLNA 2O56A 3MKCA 3QOMA 3NUKA 1JJKA 1T99A 4JCLA 4H9VA 4W5UA 4EPEC 2X09A 4W93A 4HN8A 1JEZA 1AD4A 3GR7A 4AIOA 2J7CA 1ZAJA 2VCAA 3BL3A 4IL0A 4IMGA 1F3TA 4W8LA 4NT0A 3SZ8A 2EO7A 4IPIA 1ITXA 2GDVA 3H26A 3WMLA 3S6DA 1V02A 2E1WA 3W88A 3T40A 4RPQA 3ATZA 2C6QA 2F38A 3F03K 1RLCL 2ZVIA 1V6TA 4QTGA 2PDNA 3HV8A 3HPZA 3UWQA 4Y8EA 3NOYA 1F3WA 3UETA 1P43A 5A1AA 1GZGA 1EP3A 3CYJA 1IXPA 4XKYA 1KQZA 1XUUA 2X0HA 2B0MA 3S42A 5G4EA 1IWBA 4CN1A 1XLCA 4W89A 2GGGA 1R86A 3VC5A 1Y5WA 4MB4A 1DQXA 1MZRA 3QFWA 1EH9A 3WBWA 1KV5A 3LPFA 1OX5A 1YEYA 3P6LA 2UY4A 3V16A 3O1NA 2EF9A 3ONCA 1A0CA 1QI0A 3TJIA 1EDQA 3B9NA 3SGZA 4X60A 3RM4A 3KBMA 1G9HA 3DDMA 2NX1A 2NXIA 1MSSA 3W37A 1OFEA 2P5NA 4ICNA 2PGFA 4FK9A 2YZRA 5A6MA 1O5RA 2E3ZA 1V7AA 5C55A 4ASTA 3GIQA 3SBFA 1LL4A 4C6EA 3DGBA 4N0RA 1QI4A 3NM1A 3MUIA 4OT7A 3OQ8A 3VDGA 5JUVA 4HPGA 5H6HA 2VGGA 5AZ1A 3GDLA 4BEQA 1CEOA 3KEHA 3AJXA 1JUKA 3PWGA 3W22A 3FA3A 4AZCB 2Q09A 4ZA0A 3VKKA 4GUIA 2XHYA 3FAXA 4C6QA 2QUVA 4FAMA 2GPTA 1Z69A 4AZ5A 3T07A 3JU2A 1ZJAA 3LS9A 4Q4RA 1DWGM 3M0MA 3RLHA 1HP4A 3P60A 5AC8A 3OVRA 1KC7A 1TZZA 2XVGA 4IP5A 5C9ZA 1H09A 5CZ0A 5FD0A 3NQVA 3E9AA 3UZ5A 3VINA 1PYFA 3G8EA 3W1XA 3T4WA 3NZQA 1XLMA 2INFA 3GZAA 4XD5A 1FP8A 4AZHA 3VDHA 3PNUA 2CU0A 7ENLA 3NURA 2PURA 3QHOA 1NJJA 1R6WA 1UASA 3PN8A 4K3ZA 3VAVA 4EOUA 5DMYA 3ZJ8A 2VFGA 4W8BA 2OFJA 2Q8XA 1OFAA 2BG5A 3GHUA 4ZOAA 4WDWA 3TMLA 1AD1A 4EPDC 3GVWA 4ECLA 1K70A 1S39A 3W84A 1C91A 1YBQA 3VVGA 4XZ9A 1V08A 1FDZA 4I9TA 2G3NA 3RX4A 3A4JA 1MEIA 4DAIA 1OB0A 4MWAC 2PGWA 1P0KA 3UNDA 4GYFA 4O53A 3AYVA 1J0ZA 4R9OA 4G9PA 3DOPA 3BAYA 1UA3A 2JIWA 4OKDA 1GQKA 1KBKA 1DHKA 2G3MA 4FPSA 4PULA 4JN7A 1GTEA 1JRCA 1E3ZA 2PWVA 2HNEA 3M5YA 3EEGA 1JDFA 3ABXA 5H8UA 3BAIA 3P84A 3RG6A 2DW6A 3MJYA 4S3FA 3LCXA 3VC6A 5JVLA 5TIMA 3GH7A 3G24A 1VPQA 3JVAA 4WKAA 2XFWA 1GVSA 2Y62A 5GJMA 3WEZA 2ZFAA 4N7QA 5G1YA 3Q94A 4LUSA 3SEPA 1VB9A 1VGAA 3WLIA 1B4KA 3TH6A 3HGRA 2NV9A 3EX2A 3EGJA 2CW6A 4GKTA 1ZL1A 3RYSA 3L12A 1HT6A 2XH2A 3QLDA 2R1KA 3VCCA 1XLIA 2HPMA 1NWSA 3MKKA 4J3XA 3RPTA 5HMDA 1UZHA 3V18A 1KGUA 1M3UA 4KCTA 1JPDX 4ZQMA 4MGGA 3CYVA 4DUXA 2PLMA 3OVPA 2ALRA 1HJXA 2PZNA 4H9TA 2V82A 5AYIA 4D6JA 3IJ8A 1UWSA 3MMUA 1DKWA 3Q65A 3U3HA 4K6AA 1OCJA 3PP7A 3V0TA 4NZCA 4ICMA 4PRRA 1BSLA 4M8UA 1VLIA 1S2VA 3LZ3A 1TX0A 4JTLA 4B5TA 1UD6A 1IXOA 4H2CA 1X8FA 2PWFA 5CC7A 5HWMA 1QWGA 3K8MA 4P7OA 1QNPA 4RV8A 1GOMA 4LVFA 4Q4KA 3TP4A 2I16A 1QWKA 4C6DA 4PMNA 3GFXA 3H4XA 3L68A 3GRIA 1KR0A 5H1WA 3L4UA 3E12A 1LJYA 1QTWA 3AMKA 4IHCA 3NPWA 3OZOA 3ELFA 3PZNA 4F9JA 3ATYA 3KTSA 3RU8X 4XD4A 3HPXA 5FI8A 3WNKA 2V38A 4ZE5A 3QFEA 1TTJA 3WJYA 4JTRA 1F7BA 5F4WA 3W85A 3AHVA 1B4EA 4N9DA 1XQKA 1F76A 4D8LA 1OC6A 1AW2A 1XG4A 4ZO9A 5C7HA 3PPHA 3SCNA 2E1DA 3SFWA 1ZBCA 5J8LA 2QMKA 2YL8A 3E49A 5A6AA 4FZIA 3HFTA 2YA1A 5BOEA 2DP3A 1GYNA 1R7OA 4JDBA 4JL2A 4KCWA 1WDPA 3WL1A 1CXIA 2XH0A 4GX9A 1H7PA 1EGMA 4HTBA 4IIHA 4PSRA 3FHQA 1MW1A 2CERA 1E0TA 3QC0A 1IEWA 5FJIA 1QDSA 2IMRA 4H6QA 3DG3A 1TA3B 1UWUA 1XLKA 2XSBA 5D02A 3PZTA 3CIWA 3D5HA 3GU2A 2CZFA 1SVDA 3AIQA 3W27A 2NV1A 4XO7A 3IK4A 2QYGA 5EMYA 2GJXA 4PRTA 1G67A 3RMEA 1K8YA 1NP2A 3WLOA 1B90A 5EMMA 1CLVA 3CPUA 1IT8A 5E6YA 3C2RA 1BYAA 1CXLA 3HIJA 1PIFA 3WF4A 4JBRA 4PUKA 4GCAA 1PKMA 4HA1A 5D8WA 1UUQA 1UR3M 3IPWA 4F4RA 3EDKA 2NV2A 4GXWA 2E6FA 4S3BA 4GBUA 4DZ5A 6TIMA 1NP0A 4OECA 3UXLA 3NL5A 2QUNA 2E5BA 1UJQA 2AL2B 4JL1A 1I0DA 4WKHA 4NKCA 4JKKA 3BAXA 4DYKA 3E5BA 4HU4A 1GVYA 2WVVB 3QVQA 1MFVA 3OVGA 4RDVA 1W8GA 2O4MA 2VGIA 5FF0A 4AFYA 4GFSA 1N7KA 3TYAA 3CZGA 5KEZA 2Y7EA 5AY7A 3EOLA 2NSXA 4ZO8A 1EUNA 3HMCA 4WEVX 2A3BA 4QQUA 3U8GA 3NO3A 1KWGA 1LT8A 1F8MA 2PDBA 3A9BA 1FFRA 2R9RA 2X1TA 4YVVA 3VM7A 2INEA 5LA1A 2VZSA 4OU1A 4LX4A 4WXZA 3P2VA 1M1BA 2FPYA 3PULA 2VEKA 3T05A 3PBMA 1XSIA 3REQB 4O18A 1XFCA 1KRBC 4JD4A 1XRFA 2WM0A 3A6OA 1DWAM 1U5JA 4AY1A 3STFA 3FJLA 2C1IA 2W79A 1J93A 2I1OA 4YU1A 3FJNA 4ZTYA 4KERA 2Z1WA 4QP0A 2ZUMA 3VTRA 1ADSA 1BTCA 1WDWA 1V3LA 3HO8A 4J4KA 1RVGA 1XICA 1UR0A 1DXIA 1R47A 4C6MA 4GD0A 3V36A 4RUBA 2ZWYA 4GZJA 2ADAA 3SRHA 3ZYZA 2NQZA 3IGSA 4PTXA 1TPUA 4Z2IA 2YBTA 5JH2A 4GWEA 5HMFA 3FXYA 3OOQA 3HG4A 3QV8A 1A5BA 3EMCA 4PTMA 4IH3A 4LC6A 3LY0A 2OEKA 2ZRZA 2HK0A 1YTDA 2GOKA 2P8BA 4NASA 3TNBA 4FI4A 3MHFA 1JXJA 1JFXA 5CZKA 1PWLA 1LQ0A 1Q6CA 3CZKA 3OHIA 2W6RA 2NUXA 5JBDA 3O16A 3BK0A 2ZTJA 4F8XA 1H49A 1PBGA 2WJEA 3QSTA 5GNXA 5CPOA 3DYMA 3THAA 3M5XA 4GINA 2BY2A 1YW1A 4WQ6A 3A24A 3AU6A 5KITA 1P6CA 3DHFA 1BHGA 3TSDA 2NX9A 3V1PA 4QJ1A 4JTTA 6CGTA 4I90A 3WH5A 5AHIA 4NYUA 1KNWA 1DV7A 3QKZA 4I6KA 9CGTA 1HX0A 3A23A 4Q7IA 2X05A 1KFEA 4KESA 1VJSA 1EPVA 1QI3A 3BANA 4LGXA 1S5VA 5CSUA 3CZLA 3CQHA 2VKZG 1YTEA 2ZTKA 4QITA 2ZC8A 4BZYA 3EPNA 2WO5A 2UV8G 3LUTA 1C93A 2PBGA 2AMXA 4QJ5B 1ITQA 3N1AA 1GGOA 1SFJA 1FWTA 1LOLA 1QT1A 3N4EA 4XWUA 4UQAA 3N15A 7ODCA 3G0UA 3K2GA 3CEUA 1JZ8A 1MFUA 2XFYA 3OGSA 2ZUTA 3TLLA 4QDMA 2Y89A 3T81A 4EF9A 2D24A 4GJJA 1D3HA 3DC0A 4IZGA 3KXQA 1IYXA 3VYLA 4PB5A 2YCEA 1V51A 1FH8A 4MLRA 4Q33A 1RPXA 3MANA 3SIZA 3EWUA 2O4QA 5A6LA 4W8AA 2ZRWA 3UW6A 5F1VA 3Q45A 1PCKA 1GKPA 2A0NA 2OQHA 2HK1A 2DUZA 1PS9A 2C15A 1MWOA 5AHNA 3GZ3A 4X2RA 2NLYA 3PAJA 4LUTB 3VGFA 3C8NA 2WZHA 2OU4A 3TNOA 3BMWA 4G1KA 3MI3A 1FCUA 2RJGA 4IIDA 5A8MA 1HL8A 3IEBA 1GKRA 3WJZA 1G6CA 3VOCA 3IV8A 2D3LA 1L6WA 3R4IA 4UR9A 3ITTA 3ZM8A 4AAJA 1REQA 1DJWA 3GNNA 4B16A 1FCBA 1GJWA 1GOKA 1E3XA 4GNVA 5D04C 4JX5A 2G8ZA 2P3ZA 3HZ3A 3TTOA 4IGHA 5K2ZA 3XIMA 4GGBA 3UCQA 1QJWA 4JTHA 3KVMA 4IG2A 3KVKA 1JQXA 1XYFA 5DMLA 3KOYA 2OOGA 4WOZA 1UIPA 1OC7A 3TN5A 3ARYA 2ZUVA 5C9WA 1W32A 4H9ZA 3H4WA 1TZ7A 2C7FA 4JFVA 4ZB5A 1EWDA 1PO9A 2QAFA 1JPIA 3EOUA 4XKYB 2VDHA 8RUCA 1KCXA 2NWRA 4D6IA 2C71A 1L9WA 2D0HA 4P2VA 2ZRXA 1E5NA 2ISSA 4O0ZA 4RDWA 1ONXA 2VEPA 1PHQA 5DFAA 4KIEA 1DJYA 3NYDA 4KPLA 3W01A 5M2FX 3E96A 3ZVHA 2EG6A 1EEXA 3EA1A 3U2CA 4NNCA 4GY1A 3QGVA 4AD3A 4F2UA 3WUGA 1NSJA 2E8ZA 1RHCA 4L80A 4NNBA 4F0RA 4A3YA 1L6FA 1E4MM 1LP6A 4YTSA 3T0TA 2WLYA 4IIGA 3PZMA 5A8GA 1S3TC 2E8YA 5KMYA 1XBXA 3EDFA 1E1FA 2PI6A 4JY8A 3MWAA 1JYXA 4CGTA 1XWYA 2FFIA 3GFZA 4PUNA 2QXWA 5HJXA 5BYWA 4D72A 1D8CA 4PBEA 4O12A 1QAPA 3W07A 2Z6JA 3DERA 5CJ5A 4QRNA 4C91A 3LGEA 3S1GA 4WRHA 5AVHA 2Z24A 3QR3A 1QHOA 4L4PA 4I6VA 3BLKA 2YSWA 2A4AA 4KCVA 4IX2A 1D9EA 1KFCA 4KWVA 1GVIA 3H2NA 3B03A 1QBBA 4DBSA 3ES8A 1EXPA 1FWSA 4R88A 4Q4SA 1D7FA 3PC0A 5TF0A 3E2VA 4Y96A 1AVAA 5I07A 2PDGA 1XINA 3LN3A 3BAWA 2J66A 4PN2A 4J35A 1C29A 1ZGDA 2DVTA 4DO6A 3NZPA 3BTNA 3CL8A 2GJPA 4MYAA 1NFBA 1FDJA 1TWIA 2X41A 2XIBA 4MPKA 3ZWTA 2PTZA 4N9EA 2B81A 3W6MA 3LX9A 3IRSA 3C2YA 1UD8A 4JTFA 1X6UA 1FWFC 1XRTA 3AXKA 2V30A 3EZ4A 4OUIA 1JZ4A 2ON3A 1IZKA 5LHFA 2E6AA 4IT1A 4G7FA 4MWAB 2WK2A 3PK7A 1BD0A 3TQKA 2BV9A 3C3UA 4UOQA 2XSAA 3VXGA 4BEUA 1ZBKA 4NG3A 1ZLPA 3GW3A 3NFUA 3CTTA 1YADA 3DCPA 3HQPA 1Q8AA 3ECQA 4F0KA 4FA3A 1GOIA 3U2EA 2G96A 2H9AA 4UZSA 3QC3A 1FWIC 3V75A 3LTSA 3S9ZA 2A1YA 1PZ1A 4ZQOA 2A21A 1V03A 3H53A 4BS0A 3NO5A 1SM9A 7CGTA 3O8AA 5A6JA 3URAA 3QEZA 2FMNA 4IQLA 1V77A 4HMDA 1A5NC 3AIEA 1GONA 2O9TA 3BGGA 5IDZA 4OOZA 3OP2A 3QW4B 4EK7A 1EJVC 3R2GA 4QBXA 4NZ5A 1O5XA 4O52A 2FPTA 2WPGA 2QAPA 2O7QA 1WUFA 1VC4A 3WBEA 1EJUC 1XYBA 1OADA 3DG6A 1A5OC 3S47A 1LOSA 3PUOA 4QE5A 2VEGA 2A6LA 4FXJA 3ZZ1A 2VR5A 2INZA 2EPLX 1BFNA 3W28A 1EJ7L 5K9CA 4ATWA 3DENA 3LXCA 3B06A 1XHGA 5I3IA 1OCQA 1W5MA 3HB9A 4LC8A 5F2IA 5HUPA 3EKGA 4GZIA 4PFHA 1D7KA 1Z41A 5D05A 1WAWA 1EKOA 5XINA 2ZZ1A 4Z1CA 3KW3A 1H0GA 5F2MA 1YDVA 3C6CA 4L65A 3MVTA 4NX0A 3VGGA 4J3WA 5HUOA 5TNVA 3C8FA 4Q32A 3W87A 1PKYA 5ECVA 3RF9A 3V35A 2AKMA 3URNA 2BSLA 6ALDA 1EX5A 3VIFA 2QCEA 1F5ZA 4BI6A 3L65A 3EOSA 3KBWA 4TX9A 3GIPA 5IOBA 2G97A 1XBZA 4M24A 1C8YA 4US5A 1GG1A 4O4WA 4IL2A 5I3GA 4S3JA 2VC6A 1OT2A 1OGBA 2YFOA 3LBCA 3UZYA 3CMJA 1NTHA 4J3TA 3F2CA 2PDIA 3SY8A 3PUGA 4AC1X 4LSBA 3RJYA 2C16A 3A3XA 4PEKA 3EDEA 5FACA 2ZCGA 3MS8A 4EPBC 4DO4A 1XYAA 3ONBA 3BJSA 4WOQA 4ZBCA 1H50A 3WQ4A 1BXNA 3O07A 3RM8A 3BCDA 3RLVA 4BCEA 1NDZA 3GSMA 1OK6A 2D2HA 4PR4A 2B4GA 4ERGA 1YE4A 1E6ZA 1ONRA 2OSXA 3OB8A 2XIMA 4N02A 3T55A 2HRWA 3GH5A 3E02A 1FWEC 1K4GA 4H41A 2C18A 1SW7A 3KLKA 3AYRA 1TWWA 4MNKA 3I3BA 4PCPA 3FKKA 1KFJA 1XXXA 4GH3A 5D2TA 4OE7A 3WDPP 3WD3A 1R46A 1MUWA 4S1FA 2Y7DA 4YCOA 5EMJA 1NEYA 2TPSA 2TSYA 5C2GA 1TZ9A 3GU9A 4WF7A 2ZICA 1OK4A 1B3OA 3VK5A 3F2DA 5G4HC 5LXEA 1IWPA 4UQBA 1FWBC 3TA6A 3S5YA 1UZ4A 3W00A 4US5D 3PS7A 3UG4A 3PTQA 2DZPA 4LS0A 1CCWB 3IVTA 4N9BA 3PAOA 2OWXA 2NQ9A 2QDGA 4ZQPA 4KF1A 3GG0A 1R85A 2I5GA 1PZ0A 3B0YA 1ZP4A 1TELA 4UTLA 2PE4A 2GJXB 4IGMA 1J0JA 3HA1A 3W24A 4CNNA 2FQIA 4WK9A 1DEDA 2BMBA 1BQGA 4AUBA 4UNKA 3W7OA 2ISFA 4GZEA 5LXXA 4DXKA 1TV7A 4R85A 1E6PA 3W7QA 2PDJA 2HZGA 2F6KA 2EBNA 3PPCA 3GQYA 4L5ZA 5AC6A 4IMDA 5C70A 3GG7A 3KL3A 5EY5A 1XLBA 4KH2A 1CWYA 3WNLA 3SADA 3VD4A 4REQA 1RPKA 3NTYA 2G37A 3WQ5A 1Q13A 1ESWA 1TV4A 4ROQA 3BH4A 3AMDA 4IIEA 3S8HA 1IHIA 2HEJA 3EB4A 1M9HA 1KV8A 2CLIA 3DFNA 4Q8OA 3G1XA 4LRTA 4NJHA 1B3WA 5FJJA 1EUAA 2A3AA 3RPMA 4IXXA 4XG1A 3W82A 2O9PA 5I23A 1CB7B 2IPGA 5D8ZA 3BW4A 1Q6GA 2HXUA 3SR7A 2A3LA 2D73A 4QG9A 4DYEA 3MC5A 1U1UA 1HP5A 4KFOA 4ATDA 1TFVA 4AVFA 2VUYA 2Y5SA 5K3VA 4GO9A 4Y7EA 3GNXA 1WOAA 1VBJA 4TVUA 4C1LA 4UIOA 1WXJA 3TC3A 4M56A 3GC2A 2XIJA 3G5EA 2WNWA 2PC8A 1KCLA 1H3GA 5C0QA 4FNSA 1UPMB 2PZ0A 4O4VA 5M1TA 3UJEA 4FSAA 1UMYA 2PDWA 5D09A 2OKTA 2Y6ZA 2J75A 7A3HA 3GHTA 1W9PA 2QT3A 4PCFA 4H9UA 3C61A 1U22A 3RGTA 1DTNA 4NILA 3AQUA 3MV01 1FHDA 1XGDA 3NDYA 4UCFA 4OOUA 1F05A 2DIJA 3I7QA 3N4AA 4DWSA 1RQEA 3PUDA 2A5HA 4DJEA 4AHQA 2PSNA 1B1YA 4DJEC 4GMEA 2PGEA 3T8QA 7XIMA 1W3TA 3ZXWA 2C0HA 3TKFA 3LHUA 4ZQNA 2YYUA 3BPWA 4ZXOA 1XIMA 1OGSA 1BAGA 3C2FA 1UCWA 2XPKA 4HSOA 1W91A 2H8XA 1OCNA 1OF6A 4LALA 1V0KA 4ZE4A 1GCYA 3ARXA 4JNYA 2IUZA 1QK0A 3AIBA 1ICSA 2YL6A 3C0JA 3F5LA 1OQFA 3RCYA 1S5TA 4H01A 2XIQA 4GVIA 3H7UA 5IDIA 2C1GA 2EGZA 1WKFA 3VDAA 1UWTA 1DIEA 3M4HA 4GCXA 4B9YA 1LG1A 1IXNA 1X96A 4NI8A 4LU0A 4JTJA 1BXBA 5G2WA 1E6SM 3WF2A 1A4LA 2GZXA 1QPOA 1AZ1A 1TV3A 1GNXA 4AEOA 4ZOCA 5K9DA 3M0LA 5MHBA 1TE6A 1LM1A 5CPLA 3A64A 4ONVA 3P82A 1MRQA 2CEQA 3UY8A 1EC7A 1LROA 3R7MA 3PR2A 2DORA 3HFYA 2GOUA 1O6IA 3M0YA 1AQFA 2ZZ5A 3VCRA 7REQA 5HWNA 4HHPA 4DWSD 2AMGA 1V3MA 1EGZA 5B80A 4DJED 2G0WA 4C90A 8XIMA 3BQ6A 4UUIA 2PF8A 3CZEA 4U4MA 1RLDA 1VHNA 1VRXA 1BVWA 3W26A 2DIKA 4TV6A 1VR6A 3CHEA 3LCWA 4HNVA 2EPMX 1P1XA 4O1BA 3SQMA 4CU6A 1SFTA 3K5XA 3VKAA 4MLJA 3AHXA 2YOCA 2XISA 5BMWA 1MI3A 3UU0A 3ZLGA 1BQCA 3DFQA 1JPHA 4XSMA 3RIKA 3ZR6A 2ZIDA 5CZTA 1JFHA 2RGMA 3U2OA 1WDDA 1E4NA 5ABTA 2WXDM 3GTHA 3LHWA 3TR9A 3POHA 1O5QA 3WQWA 3PTMA 4F0HA 1JGIA 1GVRA 4F66A 4FMVA 2P3EA 2V5CA 2GVEA 3ITVA 3CAWA 1FWGC 4NRSA 2POTA 4LUJA 2D20A 1U83A 2V2HA 3VILA 1JQVA 2YR1A 3SRKA 3ARUA 2YDRA 2NW0A 4IPPA 1UBPC 2WSPA 1R9XA 2ALDA 2PTYA 4MMWA 4A8IA 3PFMA 3TWAA 4O16A 3VMOA 1UUMA 3L4ZA 2J9ZA 4JYEA 4FLSA 3RMJA 4JKMA 2D2JA 1T5AA 5HNTA 1VFLA 1T41A 2HQAA 1QNOA 3G18A 2VX6A 2WSKA 4NQ1A 2NXGA 2OTDA 3SCRA 5M5DA 2IS7A 1F3EA 2IXUA 3NSMA 1LT7A 4DIAA 1W1YA 3DUGA 3KL5A 1VYSX 1B3XA 3KBVA 1TE1A 3N25A 1UJPA 4LVGA 3CWOX 3HGOA 4JTSA 1JCYA 1WOBA 1U2YA 1TYGA 2VTFA 2W63A 4GIEA 2YXGA 4GVHA 4B5WA 1GT8A 2ESCA 3GBDA 2GFTA 2VP8A 1DJGA 3VKJA 4JZ5A 1UKOA 2C13A 1HNYA 4QX4A 4DY1A 1JF5A 3ZVHB 4M3PA 5CGTA 3HG5A 4HNUA 3LK6A 3WNNA 3NOEA 4LS2A 3LZ5A 2DH2A 1KTCA 1IF2A 2ZVRA 4ZSTA 2AGTA 2NX3A 3P93A 3O7UA 1YX1A 4UOJA 1W9XA 2BFGA 3TV8A 1ITCA 4AXKA 3B40A 1NF7A 1H63A 4GIYA 4E8CA 2YA2A 2FGBA 3L5MA 4L4OA 3C56A 5AHMA 4CD7A 4W9TA 2QKFA 3GHRA 3HG3A 4UCGA 1W9DM 1XGEA 4L9YA 1DJNA 1E71M 3RU6A 3KHDA 3AZRA 1EBHA 1GHRA 4GK8A 4W84A 4XZLX 4O15A 5EU9A 2GWNA 1G01A 1F4HA 4PBGA 3AICA 4QSFA 5A8NA 4S39A 3WQ6A 1K9DA 1JAKA 5LNRA 1AH0A 1A5SA 4MZ8A 3LPOA 3BO9A 1WKYA 2DT0A 2WQPA 4UBPC 3V5CA 3BGAA 3MT1A 1BVZA 1I0BA 4NXKA 2DQXA 4QS6A 5DQPA 1QOQA 4ZFMA 1YPFA 4MUZA 2FTPA 3WY1A 2J88A 4LAZA 4PFMA 2EEXA 4PCSA 3THCA 2Z00A 5CH9A 1B57A 4G7EA 3ITCA 2HBXA 3OW1A 2XH7A 2YPIA 4MFDA 1UUOA 2PU1A 2VJXA 3BOFA 1NF0A 5BRQA 1AMKA 4FLQA 3WDJA 4RPPA 2JKPA 4CLMA 1IZJA 4AISA 3AO0A 3EMZA 1H7XA 2JEPA 4GO8A 3A3WA 4HHHA 1VCGA 5HWJA 2BOGX 2ZX5A 5U7SA 2FPVA 3LRLA 3O63A 4FNUA 4CQDA 1E9YB 1YNPA 1X6NA 4MIMA 3MHUA 1Q4NX 4MAZA 1X97A 3WK1A 2WVTA 1AMYA 2WBKA 3C2VA 3ORWA 2PDHA 3B97A 4F2TA 2JF6A 4QR6A 3LTYA 4MJ2A 2PBOA 1A5CA 4XK2A 1JUBA 3MHGA 3NDZA 4LAKA 2J7BA 5JMUA 1VEMA 1J6OA 3NPUA 4NZ3A 4PUWA 3ID7A 1AZ2A 4YTUA 2XYLA 3N34A 2H9AB 2OZ0A 3GTXA 2ACRA 5FJPA 3VABA 4HMEA 4S3CA 2Q6ZA 3AC0A 1XIJA 4DF0A 1VEOA 2AQOA 4JQ1A 1NWRA 2Z1XA 5FSEC 4H83A 3KVJA 5L9FA 5A69A 1IR1A 3KZSA 3GXNA 2ANUA 5T9CE 4WZHA 3TOYA 2X40A 3TYZA 4O13A 2W5FA 3D47A 4GY7A 3BUVA 1PJ9A 2ZXBA 4AVOA 1UIOA 1PTAA 4DZIA 5IM51 3EX1A 3C3NA 5DBUA 4RE0A 1KTBA 4IWWA 3NGFA 4UFKA 2X30A 4NJIA 2WSQA 4PCTA 4OTKA 1HXJA 4EANA 1V5XA 3AROA 2QIWA 3GO2A 3ZWSA 3KWXA 1GTHA 4HNLA 2BY3A 5JH1A 4ZFCA 4KRTA 2UBPC 4AMCA 1EF2A 1AQHA 4CNUA 5TQLA 5G2IA 3ZQ9A 3RITA 2PUZA 3BSMA 1JGMA 1RCQA 1Q2SA 3ARRA 1XDMA 1DOSA 5BMXA 5BOFA 4EWJA 5HNUA 5BZAA 4TU1A 3S1UA 2VZTA 1TR1A 1HKWA 2ATMA 2O9RA 2BDQA 4MKVA 5BRBA 4CD6A 5FEPA 4XAYA 1W2VA 1TJ1A 4FHAA 5CSYA 2R1PA 3L4TA 8CGTA 3UBPC 4NRRA 1U33A 2G3IA 4WJXA 4H19A 2BS9A 3LPPA 2IQ0A 4Y9PA 3OG2A 4HZ8A 5E5CA 1B3YA 3OODA 3VGDA 4YIWA 1FOBA 2VEFA 3KRZA 1OFOA 1XH0A 3APYA 1PKLA 1W1TA 1TSIA 8A3HA 1NVMA 3NZRA 2XFFA 3AHTA 1N2VA 3WSUA 1I75A 4JN8A 4ZO6A 1W1VA 3LI1A 2F6UA 3NXLA 4QG6A 4GPNA 4EP8C 3G22A 1YMYA 1EJTC 1K8CA 1Z44A 1VPYA 4EXAA 4HU0A 2PEVA 3ZS4A 3NL6A 1SJCA 4NYYA 2XU2A 4AZCA 1V02E 3HJEA 1J0KA 3M9YA 2YLLA 1PTDA 4PRWA 2CYGA 2WC7A 2Y0FA 3YPIA 1FVPA 3VNLA 2VR2A 4B5SA 3BW3A 1WX0A 4IQJA 4S3AA 1EWEA 3O0FA 4IPLA 3W2LA 1U1HA 3NQ7A 4Q8TA 5A2AA 3AHZA 5C2XA 1QUMA 3D0CA 1O60A 3KCOA 4HQVA 1GQJA 1OFBA 1W56A 3A21A 3TX9A 5EB8A 1Q85A 4C60A 3NVDA 3MDWA 3STCA 5IHSA 4PMDA 4Q4OA 3NQMA 2DZVA 4H9XA 1G7UA 3OLDA 3NQGA 3R5EA 3MW7A 1GJPA 3GAYA 6A3HA 5TD4A 3SCVA 4H6EA 4L6DA 2EJ1A 1IR2A 1XYCA 5FEZA 4AD5A 4MOZA 1VHCA 4CEXC 4M6PA 1EP2A 1HTIA 1W1A1 1MQPA 1BPLB 1TREA 1XKYA 1HN1A 1VJZA 3KCJA 4LPCA 1QHPA 1JDCA 3LRKA 2GYIA 3LCLA 2FZNA 4H1ZA 4A3HA 1B3VA 3O06A 2WHMA 1OF8A 1E6XM 5FJRA 4REQB 1ZALA 4O28A 2XGIA 3BLEA 1ZFJA 5MKGB 1A4MA 3IK2A 4IXHA 1S3HA 2DY3A 3CV7A 4HU3A 4J3UA 4GIRA 1IQ8A 4PB3A 1X38A 3VZYA 3KRSA 3NQAA 1G5AA 4HBKA 2R14A 1P6WA 4XZBA 1XIFA 1BSIA 1E0WA 4QSHA 3QH2A 2O9OA 4KIRA 1H4PA 5FKYA 1E0XA 1OVDA 1VQTA 1XKJA 5FEWA 1VBUA 3TC6A 2PCQA 3OBKA 1QFEA 3FA4A 1LRTA 2UZ9A 2FJUB 3MDUA 3OG3A 2VFDA 2CHOA 1NDYA 3V7PA 1XUZA 2CIPA 1O66A 4RXGA 4H6KA 4BQ5A 5H91A 3TQPA 2DZTA 4B90A 4NP7A 4HZ7A 2ZUUA 4LH8A 4M1RA 1VIWA 5DRCA 3N6HA 4BY3A 1W9UA 2HDJA 4DYJA 3CUGA 3WEOA 2KAUC 4GI6A 4IJBA 2OT1A 5T8GA 3TN3A 1WZMA 3O6AA 3K1GA 4B92A 1ELSA 3E74A 3U9IA 3LD5A 3UWYA 1O94A 1DIDA 3HBLA 1I9CB 2VCCA 4Z17A 2OR2A 3SDOA 5D30A 5GNZA 3RX2A 4DQWA 2YL9A 3F4DA 4POCA 2CZDA 4JTDA 5HNNA 3A22A 4AD1A 4NF7A 3EPMA 4OV4A 3HOJA 4N6EA 4AHOA 1GVOA 4WUIA 4OBRA 2B7OA 3VNZA 1KXVA 4FNQA 4H04A 4XV0A 2ACSA 2BGSA 1YNYA 3R8GA 1NU5A 3EWXA 1Q4WA 5EBUA 3FN9A 1ISYA 4UFLA 2D2GA 4PUDA 4KS0A 2OODA 4R33A 1UH3A 4M7SA 3P3BA 1QO2A 3O05A 2P0IA 5AC4A 1TWZA 1UROA 4WVXA 4C6PA 3DFPA 4QLLA 4DVOA 3CAQA 3HM7A 2Z0IA 3MP4A 1F6KA 2F2HA 3NYZA 4FLOA 4H00A 1TV2A 2XFRA 4E5TA 4WDUA 1LLOA 1V0NA 1R0MA 1YPXA 2VZVA 4PUUA 4AZIA 2FVKA 3FS2A 4IUGA 4JPGA 3CK5A 4RJEA 1ZU8A 1RP8A 8TIMA 1AJZA 3VX0A 1E9ZB 4QJ4B 4PYSA 3IJIA 5HPOA 5FL0A 4AH7A 4BKNA 2IQTA 2FTYA 3FDKA 1AW5A 5H8MA 3DG7A 2VC5A 2Z1VA 5DY2A 1XDJA 3DIPA 3NQBA 3TA9A 3LU2A 3UPWA 2EPHA 1HL2A 4LV4A 3SECA 3BQ5A 4XBKA 3E6EA 3WFLA 1OC5A 5CBJA 4H2HA 1CW2A 7REQB 3CB3A 4S3DA 3LPGA 3CUJA 3RRAA 2C1HA 3WCZA 1TPWA 3EAUA 2OYKA 1WAUA 2FZ8A 1GHSA 2V3GA 2EXOA 3H22A 1RBOB 4M51A 4X0VA 5BXSA 5A8QA 3VE9A 4XTDA 2XN0A 4JFTA 2GQ9A 2VFFA 1TA3A 2RKXA 2HTMA 7TAAA 4EWND 1QPNA 3OLEA 4PTVA 1PIIA 5BU6A 4W7WA 1LL6A 3BLOA 1UHVA 4FNPA 2ZX6A 5HJYA 3ICJA 2VUNA 2QV5A 3RR4A 5AB3A 1VZWA 2J9YA 9XIMA 1KBLA 3TXZA 1KM4A 3H2FA 4PMZA 4YCPA 3KOZA 1Q63A 1ZAIA 5FEXA 5DMNA 4U28A 1IEQA 2PGRA 3GK0A 1K1DA 3I4EA 2QUMA 3BAKA 1H7NA 2Z6IA 3F4CA 1RBAA 3M1ZA 3UD6A 4JFUA 2DZWA 4XBJA 1WA3A 2CWNA 4K39A 4MAVA 3K13A 1ME7A 4MB3A 2AL2A 2V0TA 4PBFA 4YHGA 4Q8UA 5CPQA 2WANA 4PMJA 1XJBA 1RK6A 4OVXA 1RA5A 5B7YA 1YXYA 1O1ZA 2WVVA 3TZNA 5AC7A 2Y7GA 3GXTA 3MSDA 3OA3A 2PTWA 4W7UA 1DPMA 4HN4A 3VFCA 4CN4A 3WK3A 1Y5VA 4XZNX 2PFHA 4ZXLA 4I9AA 5ENLA 4CU8A 3CHCA 4HYWA 3E2SA 4NUWA 2Y8VA 1WP6A 3P62A 4B5NA 4GYJA 4MG4A 3NPVA 5CZSA 4BQ4A 1L0PA 1Z7AA 4FOUA 3QR0A 2WZIA 2X7WA 4L1WA 3R94A 3WIJA 3M43A 2ZX7A 4QISA 3REQA 3HGJA 5AYYA 1FDYA 3WLPA 4HCHA 1UOZA 3ANYA 4KETA 2UY5A 3KM8A 3N4FA 4GI8A 2PWUA 2PAJA 4LRSA 2OX4A 1W5PA 4UTTA 1ONEA 1EJXC 5M3WA 3EMQA 1RVKA 1S2CA 4UTWC 1K6AA 1Q2RA 4S2CA 2R1LA 2HS6A 3PZVA 1X39A 4MZYA 3G0XA 3PSWA 1MQRA 1BRLB 2RDUA 1E6RA 1A80A 3LGGA 3C2OA 5I2UA 1X1OA 2VGFA 4QEEA 3IJ7A 2ZE3A 2CZEA 2ISWA 2RAGA 4WSHA 2DGAA 3CMFA 3GIYA 3AMGA 3CUZA 4QJ3B 3P67A 3MPGA 2V2DA 4DAFA 1E40A 1YTKA 3RHGA 3QPZA 4W5ZA 4ZB2A 1EYEA 3CO8A 3W7CA 4MPQA 1VPXA 1GJUA 3B9DA 3LCIA 1XX1A 3HTWA 3KTXA 2XTKA 1ZSXA 4OHQA 4BI5A 4LBUA 3GU1A 1H41A 3GAKA 1BWLA 4HCLA 2PC4A 2Y8KA 1B2YA 1M5WA 2ZDSA 5DY3A 5HXMA 4AX6A 4ZQCA 4UFJA 2ZXQA 4L61A 1I8JA 1EPXA 1V6VA 2Z1KA 2ZRYA 1ZBWA 5CAHA 1TQJA 4Z08A 2BLEA 3G3DA 1RJRA 5C2CA 2BTMA 1ZZMA 4Q6XA 1TPC1 3M41A 3WD1A 5HDRA 3F4NA 1FX6A 3VGBA 3W6YA 5LIYX 1G7VA 3GNPA 3P7YA 4X22A 5BXRA 1V8EA 3CV2A 2J6XA 3G1SA 4HMNA 1JPMA 2REQA 4HMCA 3OTRA 3IAQA 3TCEA 1XBYA 1CXFA 4CQAA 3ZJKA 3GKAA 4EKJA 3GM8A 1K3UA 4R53A 2X7VA 4JN6A 4MKSA 4WX2A 2TMDA 1XH1A 3L4VA 1TB3A 4B4HA 1C3FA 3SO7A 3M6DA 5F2LA 3M0HA 1UZ1A 4GBDA 3WD2A 1LBLA 4X2PA 3QXBA 4L4LA 3DBNA 2CZVA 2DEPA 1ZTVA 3QV6A 3H2OA 4PUJA 1MW2A 2JQXA 3UCCA <