1B3ZA

Xylanase from penicillium simplicissimum, complex with xylopentaose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 128
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3zA00
4ACYA 4YHGA 3SCRA 2GJXB 2WHLA 1WNOA 1BHGA 3L4YA 3VGBA 4QAWA 1E6XM 1OT2A 3IAQA 4UOQA 3VIHA 2VVSA 3AIUA 4AISA 2GVYA 4AC1X 2CBIA 2DH2A 1FOBA 3UETA 1CXHA 1W1YA 1E3ZA 2D0GA 1ESWA 3T08A 4PMXA 1V3HA 3FHQA 1CXKA 1CGXA 1ITCA 1HKKA 3UG3A 4P7NA 1GHSA 4UTFA 1XCWA 2FHBA 1K9EA 1UZ4A 1UQZA 1C91A 4JKKA 4W87A 4AD4A 1PEZA 2WBGA 1HIZA 1WE5A 3EDDA 2QV4A 1QW9A 2JE8A 2VRJA 4C7FA 1JFXA 6A3HA 4CN6A 3KL5A 4LYRA 4A4AA 4HA3A 4MNJA 1XC6A 2PWHA 2WK2A 1ITXA 5DMYA 4EANA 5HBFA 5CG0A 2ZUVA 4L4PA 4L4OA 2OSWA 3S2CA 3BAIA 4LGXA 4GXPA 1VBUA 1CECA 1R87A 3CLWA 3WF3A 3CTTA 3WY1A 3VX0A 3O6AA 1QHZA 3WDRA 3ZOAA 3GBEA 1KR1A 4H04A 1BQCA 4KGJA 1BG9A 1JF5A 1V03A 2VR4A 3F5LA 1KBBA 1LWJA 5BXRA 4AZGA 1FH7A 5JIWA 1W1TA 1GUVA 1PJ9A 3UR8A 5BCAA 5HXMA 1VF8A 1SYTA 1R85A 2JF7A 8A3HA 4Y7EA 1W9XA 3PTQA 4LX4A 5FKYA 1CYGA 1LQ0A 4J7RA 1G94A 4P7LA 1E0XA 2CNCA 2WHMA 3AS1A 4J3XA 4MTVA 2X0HA 4FLOA 4ATDA 4DM2A 1EO7A 1HL9A 3K1DA 1NWUA 1Q4NX 1JNEA 2UY4A 5KEZA 5A6BA 2ZOXA 4W8BA 1VENA 3CZJA 4U2YA 4A3YA 5FL1A 1B30A 1QBBA 4QLKA 2JIEA 2XVLA 3VM7A 3W29A 1TMQA 3POCA 4FK9A 3W81A 3ZT7A 2A3CA 5I23A 1J10A 1UD6A 3NDZA 3VO0A 2J8GA 3LPOA 1MYRA 3VDBA 3VIKA 2E9LA 1UD2A 4PYSA 4WF7A 3VU2A 2OWXA 4LYQA 4R27A 3AIBA 2Y24A 3WDJA 2D3LA 3L4TA 2UWFA 1UZ1A 5LA0A 4W85A 2VNCA 3AXXA 2C7FA 3FAXA 3DHUA 3SCVA 4GZIA 1CXEA 2XVPA 2CKRA 1KGXA 2W66A 2YL9A 3N11A 4JCLA 2TAAA 6CGTA 1G1YA 4GQRA 1JYWA 1V3KA 2ESCA 1AQ0A 3GXMA 4UQAA 3UG5A 3DYPA 2VJXA 5A8NA 3SEPA 1WCGA 4NSBA 5A6JA 2DSVA 4HA4A 2CERA 2CYGA 1E6NA 4HMDA 3K4DA 3N15A 3FN9A 1SFSA 2IUZA 1C90A 1V6XA 1ISXA 1B3WA 1YQ2A 4AZCB 1H41A 1MXGA 1UWSA 2RGLA 1E0VA 3VD9A 2VR5A 1W3KA 2YIHA 5BXSA 4HZ7A 2WC7A 3TONA 5ABFA 4H8UA 3CZEA 3QOMA 2OLHA 2YLAA 3RM4A 1V02A 3M6DA 4J3WA 3VDCA 1GONA 3F5KA 3BC9A 2WZIA 1JDCA 2J8FA 2XM1A 3SCQA 7A3HA 1Q6FA 3AMGA 5AY7A 4CU6A 5HOSA 5FIPA 4PTWA 4OJYA 3UESA 4RE4A 2GDVA 1QVBA 3GXFA 3O9NA 4M24A 4P7RA 2PI6A 2DGAA 1GQLA 1VJSA 5JBFA 1EOKA 1GOKA 3WEMA 4C7DA 1QOXA 3MANA 1V3LA 2QPSA 2WC3A 2EBNA 4UNIA 1CGYA 3T0DA 3ARPA 3WQ4A 3WH7A 3I3DA 1DWHM 2CKSA 3PZMA 3RO8A 2FGZA 3WH9A 3J7HA 1M7XA 1GJWA 1Q6EA 1C8XA 4BQ4A 4HA1A 1I75A 1EQCA 2YDSA 3U7BA 3CUHA 2PWDA 3B8SA 4TXEA 4ATLA 1JZ2A 1HJXA 1B3XA 3OGSA 3GNRA 2JIWA 5GPRA 4RE2A 3BCDA 5A8PA 1JYNA 1C92A 5IHSA 4N42A 1E0WA 1UH4A 3SCNA 1UWQA 5FD0A 2DPEA 3OZOA 5I2UA 4KRTA 1H3GA 1NOWA 4D71A 2BY0A 1FP8A 4YN5A 3U7VA 1AQHA 1EGZA 2F61A 5EFFA 4TVUA 1KBKA 3T0AA 3NIYA 4P8WA 4PMRA 4NZCA 3DHPA 2PWGA 1QHPA 1JAEA 2ZX7A 5HPCA 4AWEA 4IPNB 3ARRA 1PPIA 2FDMA 3PZNA 1K9FA 4IPLA 3OLDA 3AS2A 4YPJA 2WVTA 1DWJM 4X9YA 1H5VA 4PUDA 2PF0A 3BH4A 4CU8A 1OSEA 5M03A 2WM0A 3WMBA 3FXYA 1GQIA 4PUEA 3ZIZA 3SURA 1KXTA 3WNMA 3NYDA 1JGIA 1E56A 3M46A 4ZXOA 1TA3B 2WNWA 5CLWA 3BLKA 1FHLA 3PZIA 1FFQA 1JI2A 2GDUA 1J0KA 1FA2A 3CIVA 4AD3A 3ARUA 1EHNA 3TTSA 2OWWA 1KFWA 4EK7A 1UR2A 2EXOA 2GUYA 4MAZA 2WZHA 1W2VA 5I78A 5I5RA 3ZSTA 1CEOA 1XGZA 3MMUA 4MAVA 2DT2A 9CGTA 1CLVA 3WQ6A 5AC5A 2WMIB 3L4VA 3GTNA 1GOMA 3M7SA 4W88A 3OG2A 1DHKA 4F9JA 3A4AA 4UFLA 5DO8A 2A3EA 3CZKA 1UWUA 1UWIA 2VQUA 2ZUSA 3ZT6A 1CGTA 5E70A 1W3LA 4WJXA 5E6ZA 3AZTA 2FH6A 2VZTA 1MQPA 3AXHA 3O2LA 2JF6A 1VAHA 2V3GA 3BSGA 1RD6A 3OB8A 3NDYA 1JAKA 2FH8A 3MU7A 3PTKA 4AIUA 5A95A 2YBUA 4H8HA 1E5JA 1J0YA 4PTXA 3L2MA 1ISVA 2WVVA 1CENA 4MADA 3AISA 2UY2A 2J62A 1E55A 1UOKA 3ZJKA 4DWSB 2Y4SA 5HPOA 3VNZA 5GNYA 3WFLA 3UERA 5DF0A 3N9KA 3KL0A 1CBGA 4F8XA 5AC4A 3VIFA 3OZPA 4JKMA 4B16A 3VUPA 3NJ3A 3RDKA 1CPUA 1LF1A 3RILA 4B3KA 1Q6DA 4B3LA 4NF7A 2BVTA 1KGWA 1XSKA 2QHAA 4UQCA 1E73M 3QOKA 5CJ5A 1LJYA 2E9MA 1DWFM 1BG4A 2W61A 3LMYA 3WNNA 5D8ZA 1VJZA 1I1WA 3UG4A 1RP9A 4W7UA 3AJ7A 4P7QA 1UWTA 2DT0A 1DWGM 2GJRA 1UG6A 3A3HA 1NWRA 1V02E 2XIIA 3AMKA 5ABGA 2DSKA 1UR4A 2XG9A 4AEEA 4E8CA 3OLIA 4QDMA 3VIMA 4D6GA 4UQBA 2D2OA 2PWFA 4MDOA 3KZSA 3MSDA 2J75A 1E4MM 4UQ9A 3VNYA 2EQDA 2QF8A 1M03A 3QR3A 1CNVA 3AS0A 2ZUTA 1DWAM 1GOQA 3WD4A 1JD7A 4M56A 1TFVA 5BXPA 4W7VA 3AMCA 4MNMA 1QI4A 4CGTA 1FFRA 1HJVA 2NSXA 2WAGA 4KH2A 1R7OA 2YA1A 1DTUA 1OD0A 1WDPA 2HISA 4JAWA 1UR9A 1CGVA 3CGTA 2X0YA 3SCWA 1W2PA 3TP4A 4U3AA 2D24A 1XSIA 3IAPA 1OIFA 5A6MA 4MJ4A 4GI8A 5EBAA 1R86A 3VIJA 1O6IA 2DH3A 1H0GA 3CMGA 4LQ1A 1GNXA 3CUIA 3UR7A 1BVNP 3WF4A 3WNOA 1QW8A 3SCTA 1G0CA 1W3HA 2GJXA 1QNQA 4M29A 3JUGA 3ARYA 3W82A 4D6DA 1TCMA 3WF1A 1C7TA 3TOPA 5BRPA 4ML4A 1OD8A 4PRWA 2WMFA 1B9ZA 4D1IA 1PX3A 3ARVA 2XGBA 1E6RA 2V5DA 4PN2A 3OLEA 1W1VA 4FMVA 2EPLX 4XZWA 2VUYA 1EHAA 3WNPA 1VFMA 2YDQA 3ZJ7A 5DT5A 1XH0A 1UUQA 5M5DA 3N1AA 4E4PA 1E4NA 1UA3A 1LL7A 3BMWA 4JFWA 2XUCA 4LPCA 4HU8A 4EKJA 1E5NA 1JNDA 1PZ3A 4HPGA 3VMNA 5A94A 1UH2A 1BLIA 5GNZA 3PZ9A 5F7UA 1NQ6A 1ODUA 1LL6A 4CKQA 3K4AA 1J0ZA 1RH9A 2HVMA 4BQ2A 4ACZB 2NT0A 1B3VA 1UD3A 2BHUA 4CVWA 3RCNA 1ZL1A 5HNNA 3WSUA 3SIMA 2E40A 3W38A 2QMKA 3FHAA 1KB3A 1HP4A 2AOSA 1MQQA 2BVYA 2VVNA 4KRUA 4PMNA 4DWSD 2ZX9A 5A6SA 2VI0A 4N0RA 2J7FA 3EBVA 3W24A 3GYCA 1RPKA 2Z1KA 3CUGA 1ZBKA 4OZOA 2VRQA 4AD2A 4JCMA 1V6YA 1OIMA 3W6MA 2WLYA 4CD4A 1Q6CA 3AFBA 4D6FA 1BSIA 1UQYA 3OBAA 3K46A 5EB8A 3WD3A 1I1XA 3MS8A 2PB1A 4S3JA 1H09A 1ECEA 4Q22A 1D2KA 3ZJ8A 2ZUMA 3WQWA 3ARQA 4CD7A 5I77A 1NWSA 2XVNA 5D9NA 1W9UA 2D23A 3W6LA 2B31A 4OKDA 3L2LA 5A6KA 4CU7A 1CTNA 2WSKA 1JDAA 4HZ8A 3BXWA 4CN1A 4JFTA 4W89A 4D6HA 4M1RA 2X09A 3CBWA 1U33A 1PX8A 2ZIDA 3AHXA 1E70M 3G6MA 3S6TA 3DYOA 4ZE4A 5LYRA 4AZ7A 2FHCA 4FLSA 5LA2A 4E2OA 2X2YA 3AHYA 4PMUA 4RE3A 5AYBA 1QI3A 2IXVA 3ZQ9A 2G3IA 5GNXA 1U30A 1PAMA 1G01A 3DC0A 4F9DA 3BMVA 2WW5A 2WMGA 1WZKA 3II1A 3BAYA 1N82A 1B31A 2OSYA 5A6AA 3HN3A 2PBGA 2VZSA 1JZ6A 4PMVA 3SCSA 3WEZA 3WNLA 4GKLA 4B9ZA 1KQZA 3N18A 2G8ZA 2WCSA 5A6LA 1MW1A 1V0LA 1GVIA 3GXIA 1A47A 3HJEA 1QI2A 3WH8A 1HL8A 1UKOA 2J7DA 2E8YA 4AZ6A 4AMCA 4TOQA 1GHRA 4TUFA 1BGGA 4WKHA 4AZCA 4WIWA 3WF0A 1FH9A 3GNOA 2VOTA 3PZVA 5I6SA 4UZSA 2XIBA 3F4VA 1ZJAA 3HMCA 2XSAA 3MV11 4XUYA 1IZKA 1J18A 3ECQA 5BRQA 2WBKA 4AZHA 1AMYA 1W91A 2O92A 3OGRA 4OBSA 1H49A 2CXGA 1H11A 3A4XA 2CBVA 3MO4A 1VBRA 3CUFA 1E6SM 4UQEA 4C7GA 3VDHA 1B3ZA 3BAXA 2ZXAA 4DUWA 2ZUUA 1RP8A 1ODZA 5D9MA 1ZB5A 1UR8A 1R8LA 1VIWA 4U31A 3KEHA 1HJSA 1BYBA 1TVPA 4Z2KA 1W9PA 1KQYA 4HZ6A 2WMJA 3N17A 1EIBA 4H41A 1E9LA 4BS0A 3WMCA 1XYZA 3AXIA 4AD0A 5M17A 1CZ1A 3WUFA 2W92A 1LG2A 3W25A 3NSXA 2D0FA 1GCYA 3M07A 5A8MA 3TA9A 1HKMA 3WUBA 2EEXA 3VDAA 4ZXLA 1QNRA 3MMWA 2VTFA 2ZWYA 3MMDA 1OBAA 4Z2IA 3PN8A 1G9HA 4GO9A 2E3ZA 4YHEA 3WEOA 2CESA 2JALA 5DEZA 2D1ZA 2DEPA 3LPGA 3LPFA 4J3SA 3AS3A 3BGAA 5CQ1A 1JZ8A 4AIOA 3N12A 4J27A 1MW3A 1B1YA 2EPKX 3CH9A 1JYXA 1E40A 3AI0A 3HU7A 4B15A 4Q7NA 1PX4A 4D6IA 4PCSA 2VZUA 2VX5A 7CGTA 2DT1A 1YHTA 2O9PA 1E71M 3IK2A 5C71A 4FLQA 4UFMA 3CMJA 1IT0A 2VC9A 1JXKA 2E8ZA 2WKGA 5JBEA 3BLPX 1H4PA 2W91A 5A6BD 1NH6A 3I3BA 4CVUA 3WD1A 3LPPA 4ZE5A 2CBJA 1TA3A 1KWKA 3WF2A 4F66A 5A8QA 1MFUA 1HJQA 5CGMA 2OYLA 1MW0A 1BF2A 3EDKA 1WKYA 1GQJA 3VMPA 3CHFA 4W84A 2OSXA 3WNKA 4J28A 1DP0A 1KR0A 4MB3A 2AAAA 5FCZA 2WXDM 3ZJ6A 3WBEA 2UY5A 3AZSA 3ZT5A 1ZS2A 1B90A 4JL2A 1PIFA 4HP5A 4TVDA 2XGIA 3VD7A 3SUSA 2WMIA 3WENA 1D7FA 3W26A 1W1PA 3GH4A 1ISWA 4K68A 5I3DA 2BHZA 2EPNA 3AROA 4R5EA 4MB5A 1HP5A 2BV9A 3N04A 3VOCA 1ZJBA 1VEMA 3ARSA 3MUY1 2XVGA 5D9PA 1J0JA 2YL5A 1GOOA 4W8AA 4NRRA 2V3EA 4E8DA 2XPKA 1CWYA 4AZBA 1CXLA 3L4WA 3AMLA 1WP6A 1EQPA 1HX0A 4TVCA 2BXYA 2YDRA 4DWSC 3GBDA 1OM0A 5A8OA 2YA0A 4IISA 1CXIA 1D3CA 1UR1A 4PMYA 1JZ5A 1JZ7A 2ZXBA 4D1JA 2GK1B 1WAWA 3APGA 2WVSA 1J01A 2V3FA 3QGVA 4J3UA 2DDXA 4NI3A 5EFDA 4DWSA 2CBUA 2WMHA 2Y5EA 2VRKA 2C0HA 5AYIA 2WHKA 1XSJA 4U3CA 1JL8A 1LWHA 2IXUA 4HOZA 1NP2A 3TTYA 5A2BA 1AVAA 4D6EA 1HKIA 3POHA 1EH9A 3WMSA 3L4XA 1DEDA 2W63A 1QHOA 5A2AA 2A3HA 1OT1A 4BQ3A 1KCKA 3QHMA 1US3A 3PBGA 2E0PA 4AW7A 2ZE0A 2CETA 1KGUA 1VFUA 2CPUA 3CHDA 1CDGA 1ZBWA 2V5CA 4JHZA 1E72M 5I79A 3VD4A 2ZICA 1XD0A 3GM8A 4JKLA 5M3WA 3F5JA 3ZMRA 3WBAA 3AOFA 4CD8A 1WZAA 1E15A 2W4XA 2J25A 1EDQA 3UEQA 1F4AA 1TZ7A 2XYLA 3I3EA 2J7EA 3KE0A 4EE9A 3W28A 4TTGA 1W9DM 4BA0A 4W93A 1MQRA 3FW6A 1VEPA 3WQ8A 1NOFA 3QHNA 4X0VA 2J4GA 2DSZA 3MSGA 5E6YA 4M82A 1ZBCA 2XFFA 1HKJA 4JFUA 3E1F1 1CGWA 1KXVA 4MB1A 1C93A 2XFRA 2WB5A 2XHYA 4U5IA 3AYRA 3AMDA 4ZENA 5CPQA 1BFNA 2X1IA 3CHEA 2BFGA 3PZQA 1J0HA 4M80A 4PMQA 4V27A 4U33A 1XH2A 1JG9A 4JHOA 5A69A 3GZAA 5CXPA 2JFEX 2CHOA 3BSHA 1UKSA 2PBOA 3T2OA 4CCDA 2Z1SA 3VGDA 1WZMA 3CZLA 3ARZA 3PZGA 1US2A 3WUEA 1S46A 5IFTA 5ECUA 2EO7A 2W62A 1HVQA 3VILA 1XCXA 4CCCA 2D22A 2DIEA 3PZTA 2ZX8A 5IDIA 2OYMA 5A2CA 4H8VA 2VCBA 3PZOA 1EO5A 4BF7A 4Z2LA 4GIAA 1CGUA 5CSUA 3WFZA 1X6NA 3B9DA 1TVNA 2G3JA 2VMFA 5FL0A 3VD3A 4HPHA 5DFAA 8CGTA 2VURA 2A3AA 4PCTA 3QHOA 2YA2A 3N13A 7TAAA 1E1EA 1L8NA 3RMEA 1SR0A 1WO2A 2XM2A 1EDTA 4UOJA 3CUJA 3SCUA 3AIVA 2F8QA 1OB0A 2J7HA 4EAMA 4GI9A 4UR9A 4GO8A 4A3HA 4WK9A 1OGBA 2A3BA 2EPMX 4V2XA 2QLYA 4UFIA 5CLTA 4CUCA 1UYQA 1MXDA 2C8NA 1E1FA 3AICA 4LXFA 2X8RA 1B3YA 3TTQA 1CXFA 4PSPA 2YJQA 3UCQA 1JZ3A 4OUEA 1ISZA 3GH5A 5IFPA 5BXTA 3IANA 3CZGA 4KMQA 2J77A 3PTMA 2GSJA 4ACZA 2J7BA 1EOMA 2ZX5A 2WWDA 3B9EA 1Q6GA 1HJUA 3RJXA 1GORA 4HOWA 3WH6A 2J74A 2XVKA 4CD6A 3K8LA 2ZWZA 3D5HA 1JDDA 5E09A 3CHCA 2CEQA 4WSKA 1GZJA 1W9BM 1K9TA 2E9BA 3AHZA 1UKPA 3WIJA 1BTCA 1KCLA 3WH5A 2X05A 1A3HA 4MPKA 1IZJA 1MWOA 1B2YA 3NSNA 2NT1A 1GPFA 3VVGA 3VTRA 4Z2HA 4X0NA 4W5ZA 3WQ5A 2XFYA 4M81A 1OGGA 1UHVA 4QP0A 2CIPA 2BHYA 2CCRA 3WKZA 1XD1A 4DM1A 5ABEA 3SCOA 1HJWA 4QCEA 1UKQA 4OOUA 1MW2A 1UWRA 2BY3A 3WL1A 2QMJA 2V3DA 1OINA 4XZBA 5DT7A 5A3HA 4QLLA 5E0FA 2XWEA 1QNSA 3W53A 5TD4A 3AQUA 3THDA 4GQQA 1HVXA 1FP9A 3NSMA 4W86A 4XV0A 3A47A 2ZUNA 3MUIA 3U5YA 4WSJA 4GINA 5IXEA 1FHDA 4JFVA 3U5UA 4UQDA 3W27A 2O9RA 3WDQA 2BY1A 3IJ9A 1E4LA 3VIPA 4AD1A 1JI1A 4MB4A 3DYMA 2F2HA 3SCPA 3AIEA 3THCA 1GVYA 2DIJA 2WSPA 3T0BA 2VCAA 3PHAA 4JZ5A 3MUAA 2NW0A 4CD5A 1LG1A 1WDQA 1BGAA 1QNOA 2G4FA 5C70A 4PMOA 6TAAA 1K6AA 1V0MA 4KWUA 4AD5A 3ZO9A 4P8UA 3MV01 4GZEA 3KWXA 3AIWA 1GW1A 1AQMA 2Y2WA 5D9OA 5CZKA 2AMGA 2YLLA 1V6UA 5D8WA 4PEEA 3ZR5A 2BVDA 5CPTA 2MANA 1XYFA 4UZUA 2D20A 2WHJA 4MNKA 1JD9A 1TR1A 2EPOA 2RGMA 5E9AA 1V3JA 1XHGA 2QPUA 1EA9C 5E0CA 4RL3A 2OWCA 4U2ZA 3SUTA 1QPKA 1C8YA 3VGGA 4WKFA 4QFUA 3EDJA 4MJ2A 4GPNA 3A4WA 1G5AA 3FY1A 5CGTA 4AEFA 1LL4A 1V3MA 4ZEPA 1WZLA 3SUUA 4Z2JA 1XRVA 4PSRA 4UFHA 3EDFA 2ZUWA 2YL8A 4LYPA 5ABFB 1E6QM 4S3KA 3D3AA 1V08A 4P8VA 4FLRA 1H2JA 1GQKA 3EYPA 2DQXA 3IJ8A 3OIHA 3GDBA 4W8LA 4WLCA 2XWDA 3BCFA 1X1NA 3NUKA 3ARWA 2WVUA 3L4ZA 1R7AA 1TG7A 3SUWA 4GZJA 1QNPA 4JIEA 5EMYA 2GFTA 2VQTA 1J9YA 1PZ2A 4B9YA 3CPUA 3ARTA 1TE1A 2W5FA 4UOZA 2D3NA 2CHNA 4QCFA 4D6JA 4IUGA 3EDEA 4QLJA 4AZ5A 4TX8A 1HNYA 2JEPA 3EMCA 1PBGA 3ZM8A 1O7AA 2WYSA 4AY1A 3VX1A 4PTVA 1E4IA 1VFFA 1NWTA 4P7OA 1J0IA 3ZSSA 3GNPA 1VB9A 2JEQA 2ZX6A 4OBRA 3VPLA 4JFSA 1MVYA 2WCGA 2WKLA 3VKKA 5JIPA 4WKAA 1L0PA 2OYKA 5JBDA 3WD0A 3AIQA 3VINA 2XTKA 2J47A 3WQVA 2E4TA 2BS9A 4ZFMA 2FGLA 4MDPA 2G3MA 2Y8VA 2O9TA 2EJ1A 3T2QA 3RM8A 2ZXQA 1XV8A 2XSBA 1EDGA 3AYSA 3WDHA 1V6WA 1WDSA 1VEOA 3OLGA 1B0IA 2VZVA 4URIA 4Z2GA 2XJ7A 2YKKA 2YL6A 2WANA 3ARXA 4PMDA 1GOWA 4DUXA 1HT6A 3A6OA 3RJYA 2WZEA 3FNDA 3AHVA 1J11A 3WUGA 2VX6A 1UD4A 1JZ4A 1M53A 1HF6A 2CITA 4NRSA 1KXHA 3CZ8A 2VO5A 3AZRA 1JFHA 1H0IA 3AIRA 2VL4A 3EMQA 5I0DA 3DECA 3VIIA 2ZXDA 4JL1A 4M8UA 1VRXA 1SMDA 3MUZ1 2WLZA 4AZIA 4TX6A 1WB0A 3ZR6A 4BCEA 1V0KA 1QBAA 1H1NA 1C8QA 1XH1A 4HMEA 3FAWA 1OCQA 2VCCA 2Q8XA 3VM5A 3IJ7A 2DT3A 3GH7A 1PIGA 5KZ6A 3BAJA 2YBTA 1KXQA 2YOCA 2O9OA 2PWEA 4MNLA 1W32A 5CPSA 4V28A 3T2PA 3K8KA 3TTOA 2VZOA 2BY2A 1GJUA 3VIOA 4U5KA 1J12A 3NCOA 3VMOA 2GJPA 2D0HA 4FF5A 1BPLB 1NP0A 3PZUA 1ISYA 2DSUA 4OIFA 3G6LA 3VIGA 1ZBVA 1TUXA 3RPMA 1C7SA 4HMCA 2G41A 4P8XA 1DWIM 1CIUA 2WMKA 2GK1A 4AIEA 1WDRA 4F79A 3SUVA 5C8BB 5BWFA 4DUVA 5CSYA 1Y7VA 5LA1A 1M04A 3B9AA 2WVVB 5I24A 4W7WA 1M01A 1VFOA 2DSWA 5BYWA 1F4HA 2J78A 4IM4A 3T09A 4BQ5A 1HN1A 4PTMA 5BROA 1QI5A 5FOOA 5JUVA 4CCEA 1UD8A 2VX4A 3WELA 4AXNA 2VT0A 1JF6A 3K8MA 3ALFA 1CLXA 4W5UA 3WDPP 3L4UA 1EXPA 1UD5A 1NOUA 1IV8A 2UY3A 3MKKA 1V3IA 4HTYA 3W0KA 4HU0A 3OA5A 1JXJA 1W9VA 5A1AA 5HDRA 1KWGA 4GI6A 2WCAA 4OOZA 3GXDA 3WD2A 1X6LA 2Y8KA 4XX6A 5D4YA 3EMZA 4H2CA 1FH8A 3KL3A 1HXJA 1GOIA 1WPCA 4XB3A 4D6CA 1E3XA 3BAKA 3U57A 1UR0A 1Z32X 1E43A 1V6VA 1QI0A 2V38A 4TTUA 2J79A 2WC4A 2WPGA 1K9DA 3WL0A 1W3JA 2W67A 4UCFA 3RM9A 3CO4A 4D72A 1JYVA 5ABHA 1NARA 4J3VA 1LLOA 1NM9A 4BZYA 1V0NA 1UA7A 3VD5A 3VGFA 3WDIA 2FHFA 3ALGA 4AYSA 1U2YA 4UFJA 5GQBA 1JIBA 3VGEA 5IHRA 2VX7A 1BVZA 4ATWA 4PBGA 3RIKA 3AHTA 2BNJA 1BYAA 1E6PA 3W4RA 2J7GA 1OGSA 1P6WA 4CN4A 4HOXA 1UKTA 2G3NA 2J7CA 1BAGA 1BYDA 3VGHA 3WN6A 1SMAA 1E6ZA 4UFKA 1BYCA 2WWCA 3BAWA 1UH3A 4KGLA 1MFVA 1C3FA 4PMZA 4H7VA 2PC8A 3W37A 4J3TA 2BXZA 1ZU8A 1OWQA 3OGVA
chains in the Genus database with same CATH superfamily
4IH3A 5G1TA 3MI3A 2PZ0A 2B4GA 1BF6A 2WHLA 1WNOA 1BHGA 1M7OA 3VGBA 2X1SA 3PJTA 2D2JA 3D0CA 3Q65A 4Q7IA 1W5OA 1OF6A 3BANA 2BB0A 3BL3A 4IHCA 4B91A 4E4UA 1GYMA 1CXHA 2D0GA 4KKXA 3R12A 3VI2A 3DKJA 3FHQA 1K8YA 1A5KC 1CGXA 3CEUA 1ITCA 2QAFA 3KXQA 4P7NA 1ALDA 5E1QA 1XCWA 3U3HA 2FHBA 1UZ4A 3IGUA 1UQZA 4JQ3A 5I3IA 4JKKA 3M5VA 4AD4A 1PEZA 1HIZA 2V5KA 3W2KA 4MF4A 3R58A 4Q8WA 3EDDA 3V0UA 1K4GA 3S3GA 1Q13A 1YRRA 4C7FA 5K9CA 1IE7C 4CN6A 3W7PA 3WBYA 4QSHA 2P3EA 1T7LA 2Z1VA 4XWUA 4MNJA 3UWYA 2W0UA 5FESA 5H2ZA 3EAUA 3IWPA 5CG0A 1ME7A 3S2CA 2Z2BA 4RZ4A 4GXPA 3WF3A 2TMDA 2PDHA 3CTTA 3REQA 1TV2A 3G77A 3OHMB 4KGJA 4NVTA 4QXIA 2QJNA 1A5CA 4IGMA 4GUGA 2G37A 4MWAE 3NQMA 2IW0A 3W1TA 2GSEA 1FH7A 3CQJA 4MZ8A 3O6CA 5JIWA 1W1TA 4AWSA 1PJ9A 1GVFA 5BCAA 1SYTA 2JF7A 4QEHA 4AX7A 1QU4A 1W9XA 3SRKA 5FKYA 4LY8A 9XIAA 4P7LA 3SSZA 2X0HA 3SQSA 1AUSL 1HL9A 3S1XA 2VFIA 1EJWC 3NOYA 1VENA 1O95A 1B30A 2DZUA 2Y1HA 4QLKA 3W29A 3W7KA 3LCGA 4Q6XA 1Q3NA 3ONCA 4L6OA 3GDTA 3W6YA 5JQ9A 4NT0A 3MB9A 3E2RA 3VXGA 1UD6A 2J8GA 5KINA 1MYRA 4HKPA 5F2MA 4MKSA 2ADAA 1ZSXA 4WF7A 3VU2A 1NVMA 1LWIA 4LYQA 4R27A 5F4XA 3EA2A 2Y24A 1A49A 4ZQPA 3UVIA 3WDJA 2QCHA 1FWSA 2YR1A 4AEOA 1AZ2A 2O7SA 1BD0A 2UWFA 3BLDA 2NVAA 3SCVA 3CUXA 1CXEA 1ADSA 2XVPA 5EMUA 1KGXA 2ZC8A 4B5XA 3N11A 4LBRA 3OVGA 2TAAA 1G1YA 1XIEA 4POCA 4UQAA 1F7BA 2ISFA 1R3SA 1WCGA 2Y63A 2DSVA 2CERA 2CYGA 3QYSA 4HMDA 4JYFA 5IBXC 1VIZA 3AAMA 3NQ7A 4UTWA 2VUNA 4UR7A 2P5NA 1H7NA 2PCQA 1OEPA 4XISA 4WJ8A 2RGLA 1W3KA 5BXSA 3TONA 3BUVA 3M5YA 3CQKA 2HQAA 3M7WA 2YLAA 3RM4A 3M6DA 3GNXA 4J3WA 3JZUA 4L6DA 4F4RA 1X7FA 2WZIA 1RBLA 3EEZA 1NDVA 4GY0A 2GGEA 1J6OA 2WM1A 2GDVA 3GXFA 4M24A 3CT7A 2DGAA 3WLQA 1GOKA 5CC7A 4C7DA 4RR4A 1V3LA 2EBNA 4PRTA 2BODX 4UNIA 4OT7A 4N6EA 4LNCA 1XLIA 1BWKA 5AB3A 4NZ4A 3RO8A 1SFJA 4KPLA 2VFHA 3PB2A 4DJED 1OYAA 4QNEA 4BQ4A 4TO8A 4HYRA 1NAL1 3F4DA 4F2BA 3URBA 4AHPA 1EPVA 1RJPA 3B8SA 4TXEA 4ATLA 1JZ2A 5GPRA 1JYNA 1UCWA 4FXSA 3W85A 1E0WA 1UH4A 1A80A 3TE9A 2XGZA 3OZOA 4KRTA 1KKOA 4YCPA 2YXOA 1V79A 3EOEA 4D71A 1EA0A 3V0TA 1WAUA 5CPNA 4FA3A 3LY0A 1BXCA 4DBWA 3Q67A 4TVUA 4P8WA 2XIMA 3OJGA 4PMRA 3AALA 3S2LA 4RPQA 2PWGA 1JAEA 3RITA 1IXNA 3H55A 4GH1A 3MVIA 1MSSA 4QDWA 4YIWA 1K9FA 2HBVA 7TIMA 3WCZA 4YPJA 4FNQA 3N14A 1I45A 4X9YA 2PF0A 3BH4A 2V81A 1I0BA 2JKAA 1VBGA 4LUTA 1R3QA 3STCA 3W1QA 1OSEA 3I4EA 1O68A 3NO3A 3QY7A 3H8AA 1PKLA 2OMAA 4PCNA 4PA8A 2E6AA 1AODA 5CC5A 5CLWA 5HMSA 2GDUA 1WXJA 1OADA 2CLEA 3QF0A 1RHCA 3R79A 4QG6A 4O14A 3U2EA 1Q7QA 4LCQA 1GK8A 3A22A 5AVHA 1O60A 3CIVA 4S3DA 4AD3A 3P14A 2IPGA 4WOQA 4MAZA 2WZHA 2OGJA 5I78A 5I5RA 1XGZA 4V15A 2DT2A 3U0HA 1CLVA 1VCVA 4HJFA 1JJKA 4MOZA 5AC5A 3UGRA 3AU6A 2NX9A 5DX7A 3L4VA 4W88A 1ME8A 1UP3A 3VA8A 4XBKA 1DHKA 4F9JA 4GYPA 3A4AA 3UFYA 3LUTA 2RHGA 2ZUSA 5DRIA 3NEHA 3CIXA 5E6ZA 3T1GA 2VZTA 3AXHA 1MXSA 1ONRA 2JF6A 3BSGA 3M0YA 4HSHA 4FAMA 4NYYA 4O18A 2WJZA 1PS9A 4JX4A 1GOXA 3F4NA 3UWQA 1ISVA 2UY2A 1A53A 3BJFA 1E55A 1W1IE 4XSMA 4DWSB 1DJHA 3HGSA 2O0TA 3UERA 3UZZA 3S9YA 1XRSA 1OZMA 4IIHA 2DZWA 3OZPA 4JKMA 4B16A 3T0CA 5EPDA 4R33A 2NQLA 3EA3A 1CB7B 3WQEA 4B3LA 1BKHA 2XDFA 2AAMA 4C6QA 3KRZA 1XSKA 3TQKA 1LRTA 4CLMA 3G2GA 2CLPA 3QOKA 2WQDA 4UNKA 3WNNA 2PUZA 4H9TA 1UP0A 3UG4A 1ML1A 1RP9A 4W7UA 4CNSA 4P7QA 2DT0A 1KBIA 3B04A 3NAVA 2VC5A 1QNVA 3A3HA 1O5QA 1QTWA 5ABGA 2DSKA 1QPQA 2HXUA 4UQBA 3TMLA 4S1FA 3PFMA 1NDYA 1QPOA 3SRDA 4XAZA 4GACA 3KZSA 2J75A 2E28A 3V4BA 3VNYA 2QF8A 1LT8A 1DJWA 1GOQA 2HS8A 4FALA 1JD7A 3IGHX 4C60A 1JRCA 3AMCA 5LXXA 1Y0EA 4Z17A 1SW7A 4AU0A 2WAGA 3SY5A 3I6EA 3ONBA 4F40A 5AZ1A 3GVWA 1HGYA 5EMLA 5MHBA 3ZFHA 3DFHA 4JAWA 4NU7A 3TYAA 3CGTA 3SCWA 3TFCA 2ZRYA 3TQ0A 4PZVA 2HNHA 3R10A 4Q4QA 4MJ4A 1H7XA 1XFBA 3ITTA 1IQ8A 1H0GA 5AC7A 3OG3A 5CBIA 4C6LA 1OCNA 5KETA 4K1WA 4XIAA 2IS7A 1UMYA 4NJIA 4N9EA 3VFLA 1OCJA 3JUGA 3ARYA 1TCMA 3TFXA 4ADSA 3CASA 4ZOEA 2PRLA 4GX8A 2V63A 2R91A 3ARVA 2XGBA 3S0CA 3TVAA 4QHRA 1ZLPA 2QDHA 3EB2A 3S9ZA 3B0UX 3VNKA 2POZA 5FAGA 5F2IA 4FR6A 1VLWA 3ZJ7A 3O7UA 5HMEA 1E1CB 2Y5SA 1TWDA 4E4PA 2GL5A 1E4NA 1UA3A 1LL7A 2CLMA 2RFGA 3GHTA 3GS6A 2UBPC 4YCOA 4HHPA 3FLUA 3BWWA 3CL8A 5F7UA 1I0DA 2DVXA 5DBUA 4YNGA 1RH9A 2NT0A 4FXRA 1RLDA 4XZHA 2ZQ0A 5LXEA 3ZZ1A 3G22A 1ZL1A 3SRHA 3M4HA 2QMKA 4ILSA 2FZBA 5U7SA 3ZVHA 2WJFA 3E0VA 4XBSA 4DWSD 4O4VA 2IKIA 1ITQA 1OC7A 3EBVA 3W24A 3GYCA 3MJMA 5HJYA 1ZBKA 1KRBC 3FSUA 4OZOA 4AD2A 5ABTA 3BG5A 5EBUA 1OIMA 1Z42A 3W6MA 3PULA 4L9XA 4CD4A 4K7YA 3AFBA 4D6FA 2OG9A 3TAKA 3H7RA 3MS8A 4QRNA 3BVJA 1H09A 3GIYA 4C6BA 2BZNA 4MG4A 5I77A 4WGXA 5D9NA 1W9UA 2SFPA 3TLQA 2B31A 2O4QA 3P5YA 1X6UA 4M19A 4B3ZA 1CTNA 1JDAA 3LGGA 2X1RA 3F2BA 3C56A 2HPIA 1FCQA 2X09A 3PPHA 1U33A 3AHXA 5MKGA 3S6TA 3PWAA 1XFCA 5SWUA 3S83A 5FJTA 4BEQA 4JXCA 1EZ2A 1T40A 4FLSA 3HQNA 3HZ3A 4AXKA 1K70A 2TYSA 1MEHA 3BLOA 4FF7A 2WOQA 3ZQ9A 4PULA 1U30A 1PAMA 3STFA 1G01A 1XDLA 4KCTA 5C9WA 2WMGA 1WZKA 4GXWA 2V8ZA 3HN3A 2PEVA 2VZSA 3SCSA 4GKLA 4B9ZA 1KQZA 3N18A 5A6LA 2IKGA 3H2OA 3WQOA 5BZAA 4HA0A 1HL8A 1UKOA 4AMCA 2E8YA 5EU9A 4AZCA 1FWIC 3WF0A 2PP1A 3PZVA 4IG2B 2FMOA 5I6SA 3R8RA 4GA8A 2Y88A 2FMNA 3LXAA 2OVLA 3MV11 4XUYA 5T8GA 4DI9A 1J18A 3V5FA 1A3WA 3ECQA 5BRQA 5LNVA 2O92A 4RDZA 1FWTA 3TQPA 4LF2A 2CXGA 3TJ4A 3W7HA 4ZTYA 1VBRA 3ABRA 3NQ6A 3QJAA 4C7GA 2ZE3A 7XIMA 3BAXA 3LCLA 3UJSA 3L66A 1VIWA 2GQ9A 3BO9A 3NFUA 1TVPA 3BGGA 4CCZA 4HZ6A 1VD6A 4FOKA 3GIPA 3R0KA 1F8IA 3IIZA 3DGRA 3QQ0A 1X98A 3S2NA 4J5NA 1Q2SA 2W92A 4L6HA 4X63A 5LIKX 3KM8A 3NSXA 3LD5A 4B5UA 1PTDA 3TA9A 3TWAA 3VDAA 4ZXLA 2VTFA 3MMDA 3C2YA 4Z2IA 1G9HA 2VEPA 2E3ZA 4XAYA 4WZHA 4YTQA 4G6CA 4KF1A 2QCEA 4NJJA 5CBBA 4LTSA 4S3FA 3H2FA 3U8GA 3O05A 3BGAA 3H4GA 1TIMA 1LUCA 3G8RA 4FR1A 4EPDC 1RVKA 3QFWA 4JR5A 1JYXA 3C2OA 4QX4A 1WXZA 4IF2A 2E7FA 4Q7NA 4GK8A 2CXEA 2F6XA 3UF9A 2VZUA 3EXSA 3IVTA 7ODCA 1E71M 5CGQA 3TR2A 4C6NA 5C71A 4LCRA 4OUIA 3GYEA 5D2WA 2BG5A 3TAOA 5HWNA 2VC9A 1NFGA 5HWMA 1A5MC 1TKKA 5CPMA 5CEWA 4EAYA 3E9AA 3QR0A 4KERA 1AJ2A 1H4PA 2ZRXA 1EGMA 3I3BA 2F84A 2PWVA 5C9UA 3WD1A 1YBQA 3ABQA 4ZE5A 3NZ1A 4F66A 5A8QA 4LYKA 1MFUA 3GHUA 1ICSA 1MW0A 4GKTA 1KM6A 3EDKA 1WOBA 2UZ9A 4ZO7A 4Q8MA 1BSLA 3G1SA 3CHFA 4O13A 3SY1A 5J5RA 4J28A 4MB3A 5FCZA 4DAFA 1MEIA 3WBEA 3AZSA 1T6MA 1B90A 4PCFA 5DXYA 5AN7A 1JDEA 2XGIA 3VD7A 3SUSA 2NX1A 2WMIA 3WENA 1EWEA 3GH4A 5HA7A 3OODA 1W56A 4GFSA 5LNUA 2E1DA 3VOCA 2MNRA 3OW1A 2XVGA 3H54A 1ITUA 2E77A 2V3EA 2XPKA 1CXLA 1EJTC 3L4WA 1WP6A 1EQPA 3TNBA 3C2FA 2BXYA 5BMXA 3A64A 2GJLA 4PUJA 4GBUA 1PSCA 3APGA 3QGVA 2V30A 1EB3A 2FPYA 4K6AA 2Q6ZA 4I8DA 2VRKA 1KTNA 3U9IA 3HURA 1JL8A 3RF9A 1NP2A 3TTYA 1JQVA 2E1WA 2TODA 3QYQA 4A22A 4D6EA 3TW7A 3WMSA 1TJ2A 4PTNA 1S2VA 1R6WA 2G5WA 4J1OA 1US3A 3C2VA 3CPGA 4NYUA 3CHDA 1ZBWA 4GYJA 4XZMX 4HBKA 2G0WA 4HCLA 4JKLA 5I3GA 4LRSA 3F5JA 3WBAA 4IQEA 2W4XA 1H61A 3B06A 5DCEA 2I56A 1NU5A 3G1VA 3UEQA 3OEXA 4JTTA 4EXBA 1DIKA 2QT3A 3NL6A 4EE9A 4BA0A 2PS2A 1W0MA 3HV8A 3RHGA 1NOFA 4MIMA 2DSZA 3MSGA 4I7UA 1ZBCA 4EACA 1X8FA 3URNA 4Q8NA 4E2BA 1CGWA 1GG0A 3OVRA 4HHLA 2B0MA 1G4SA 4MUPA 1FWGC 2Y70A 4HVXA 3JVAA 4ZENA 2PTDA 3EPNA 3S46A 2ASHA 4JIQA 3GAKA 2YPIA 2HVNA 3SW6A 3FDGA 4V27A 4DJDC 2CZ5A 1JG9A 1NQKA 4JHOA 3T6CA 4DZHA 5LIXX 2VEIA 3DEQA 4CCDA 3O1NA 3WUEA 1F73A 5IFTA 4LALA 4B92A 2D22A 2G4JA 1FRBA 2QJHA 2OYMA 2H9AA 5A2CA 4H8VA 3PZOA 4I7WA 4H83A 2Z2UA 4GIAA 1IIHA 1CGUA 3W75A 2OOGA 5CSUA 2GWNA 1X6NA 3U2OA 2VD8A 5FF7A 1Z8AA 5FL0A 2QUVA 2A3AA 4PCTA 2QIIA 1P6CA 3MYOA 2YA2A 1P0NA 3GKFA 1L8NA 2A7NA 3NURA 1XPGA 4JTSA 3W2UA 1EDTA 4UOJA 3CUJA 3NOEA 3SCUA 3PG9A 1RY0A 4DN1A 1P1MA 1S39A 2P10A 4GI9A 2IKJA 4WK9A 2A3BA 4WR3A 2EPMX 4IFRA 1LOQA 4CUCA 3KAOA 2C8NA 3AICA 4NL1A 3KS5A 5CZSA 2IQ0A 3P8IA 4R85A 3DI0A 3UCQA 3KHJA 1QOQA 1ZQ5A 3CZGA 3UR2A 3PTMA 4ACZA 4IIDA 2J6VA 1PHQA 3B9EA 3Q58A 3KBJA 3EWDA 2QCFA 2I5QA 3T07A 2J74A 3UY7A 1JDDA 4WSKA 4O54A 1K9TA 2YB1A 1ZAJA 3OVQA 4LS0A 1W1ZA 2YZ5A 3WH5A 4IPIA 4RXGA 1THFD 3NQGA 3NSNA 3QLDA 2A79A 1GPFA 3G0XA 2E25A 3LBCA 1PDZA 1RA5A 4QP0A 2DUZA 2CIPA 1K7EA 5AHMA 2YCKX 4I5XA 5DMNA 3WKZA 4R7JA 4DZ5A 3SCOA 2JGYA 3OQ8A 3TMQA 3LQGA 1MW2A 1JPMA 5FEPA 1O12A 3O6YX 3WLJA 2AL1A 3HPFA 1QCWA 2V3DA 4XZBA 5A3HA 4RZ5A 5E0FA 4H7CA 1O5KA 1I2OA 2QCMA 2XWEA 4MLJA 3MBDA 3HO8A 5H6HA 1HVXA 3WLIA 1OCBA 3ENLA 1AH4A 3MUIA 3U5YA 1RVGA 2EG7A 3U5UA 2PLJA 3UJFA 1JI1A 1A5BA 3PWGA 3T0BA 3MUAA 2BX7A 3H7VA 3UNTA 3N4AA 5FJIA 1LG1A 3QV9A 5C70A 3WJYA 2PDLA 1K6AA 1UB3A 1V0MA 4AD5A 3LZ3A 1LBFA 2V2HA 3MV01 1Q85A 1GW1A 2ZDSA 3TDFA 1P48A 1RK6A 1LLWA 3EPMA 2AMGA 5D8WA 3DFTA 2NWRA 3ZR5A 2BVDA 4J2PA 1EF2A 1XYFA 1J93A 3QSTA 3CB8A 2FZ9A 3I6RA 1JD9A 2RGMA 3B8VA 4PEKA 1EA9C 3NL5A 3UZ5A 1FWJC 4C65A 1ONXA 2Q09A 4GVHA 3C2RA 1C8VA 2OX1A 4LT9A 2HE8A 4WY0B 2G50A 3DFYA 4E8GA 1F07A 2ZUWA 2YL8A 3PUEA 3K4WA 5ABFB 5HUOA 2CLIA 3D3AA 4FLRA 1H2JA 5CAKA 1X97A 1R5YA 5F4WA 4DYJA 4Y9AA 3GDBA 4W8LA 1X1NA 3NUKA 2ZYFA 4YYFA 1J96A 1R3YA 3FJ6A 2J13A 1A0DA 3TX9A 2VQTA 3MZNA 1FXPA 1JUKA 3INPA 3DFNA 1G4EA 2VEFA 3EWUA 6REQB 4IUGA 5LKYA 1OFDA 3EMCA 3YPIA 4NJGA 1TX2A 4NX5A 3VX1A 4PTVA 2PTXA 3USZA 1NDZA 3ZSSA 4N4PA 3G1RA 1EYEA 1BXNA 1VB9A 4OBRA 1JGMA 2A0NA 3VPLA 1MVYA 4HJWA 1OFQA 3KBMA 4WKAA 4R3UA 4A05A 1Z41A 1KA9F 1L0PA 2X7WA 2HPMA 3VINA 1Q2RA 1GVQA 2EGZA 4JQ4A 4UTIA 2DV0A 2G3MA 4A8IA 1VYPX 3H2NA 1LUCB 3V75A 2EJ1A 4QJ1A 2ATMA 3W71A 3L0NA 4HQVA 1EDGA 1S3HA 4REQB 1WDSA 4Q8PA 3V1PA 4Y8EA 2PRMA 3LG3A 3R7MA 3ELFA 3C61A 3GUWA 4DUXA 1GOWA 4PR4A 3JW7A 5B80A 3NQDA 3MW7A 2RUSA 3WUGA 3UZXA 2YB4A 3KOFA 4GQGA 1HF6A 4NRSA 3BSMA 1HFBA 3FFSA 1GKRA 3AZRA 4S23A 3LRMA 2HZGA 3NWRA 5C2GA 3IV8A 1VHCA 3CQ0A 7REQB 2CLKA 1PWLA 3VIIA 5GJPA 4M8UA 3G8EA 3MUZ1 3GRIA 3PBMA 1QRQA 4Y90A 5HATA 4N4QA 5IRPA 1KLZA 4G7EB 3FAWA 3S47A 2QR6A 3LN3A 2YYTA 2Y0FA 1PIGA 4GUHA 3W7CA 3BAJA 2YBTA 4FIQA 2YOCA 2PWEA 3SQMA 1SO3A 1U1UA 3T2PA 4PBFA 3NGJA 3B8TA 1GJUA 2GVEA 3VIOA 1S5NA 3NCOA 1OFPA 2GJPA 3G24A 2Z26A 1QO5A 2DSUA 2PTYA 1NDWA 1J4EA 1WDDA 4MYXA 2P50A 4WXYA 4Z1AA 4KS0A 4HMCA 4EPBC 1CIUA 3HTWA 2GK1A 1WDRA 1AD4A 4F79A 5BWFA 4GJIA 3TA6A 1X8CA 3TSBA 2VELA 3GK0A 4MGGA 3AYVA 2NQJA 1G7UA 2DJLA 3EPOA 4IM4A 1HN1A 4PTMA 3IUDA 3M5XA 2C18A 2X0SA 2QCDB 1QJWA 4AXNA 5LIUX 2WSQA 2A6NA 2Z4GA 1CLXA 2OO0A 1GVRA 3WDPP 4Z0SA 3JS3A 1L6GA 2JGQA 2AGKA 1AL7A 4HTYA 1GVSA 4HU0A 3S5SA 1KWGA 5A1AA 5HDRA 4NNCA 4US5A 3GXDA 3WD2A 1O1HA 4RE0A 4O8AA 2V2CA 2Y8KA 3CHVA 4XX6A 3FJLA 4H2CA 4LNYA 3KRBA 3QXBA 3L5LA 1EGVA 3BAKA 4XO6A 1E43A 1V6VA 1ECQA 3LCIA 1K9DA 1W3JA 4H3DA 1PYFA 4KCVA 1KM2A 3RM9A 1JYVA 1FX6A 5ABHA 5ECVA 3WBWA 1V0NA 3H12A 1FTXA 4AC7C 3VGFA 5AKQA 1BVWA 3ALGA 4HB7A 4MSSA 4O0QA 9XIMA 3UGVA 3C8FA 2HCVA 4C6EA 5IHRA 1KRAC 3P81A 4AF0B 3AHTA 1WBJA 3G1AA 2BNJA 3KDNA 3TZFA 4Y96A 1EIXA 4P2VA 2BLEA 1P6WA 4KCWA 1UKTA 4HOXA 3EOOA 2A3LA 1IEIA 1SMAA 3R1ZA 3UWUA 4F0RA 4EWND 1MFVA 1W5PA 1B4EA 4PMZA 3E2QA 3FA5A 4J3TA 3KTCA 1QO2A 2R14A 3OGVA 2CLHA 3PJXA 3QBUA 3SCRA 2GJXB 4Q8OA 2WKJA 5C6MA 1E6XM 1BXBA 1OT2A 3IAQA 1T8QA 3T81A 3CUZA 3AIUA 2C15A 1B4KA 1DL3A 4KEUA 2DH2A 1ESWA 3T08A 4O1EA 4PMXA 1V3HA 4L1XA 4XD3A 1CXKA 4HNNA 4W9TA 1XKYA 2NZLA 3PPCA 1HKKA 3V3WA 1ZAIA 5EYWA 4UTFA 1H1ZA 1GWJA 1K1DA 3OPSA 1W17A 2WBGA 4DJFA 1Z44A 2CU0A 2D2HA 1QW9A 3ID7A 4XKYB 5F1VA 3GG7A 3OZYA 2D73A 3JR2A 4A4AA 1FWDC 3UBPC 2YYUA 3D3FA 3WLKX 3HM7A 4QQUA 3HV9A 2ZUVA 4L4OA 2OSWA 4TMCA 2PPGA 2VD9A 4GH3A 4IJRA 1EUNA 3VX0A 4PFMA 3EOLA 1QHZA 3ZOAA 3LTYA 1KR1A 4S2CA 4HMNA 1BQCA 2GJNA 4F0SA 2Q3OA 1S1RA 1LRNA 3PSVA 1V03A 1KBBA 1LWJA 1WQ5A 1HQTA 4S3EA 3UYIA 1B9BA 4AAJA 1TWZA 4Q4MA 1R85A 3NZPA 2J9XA 3UQNA 4WDWA 4LX4A 1F6KA 1LQ0A 5CZJA 3NM1A 4C6MA 1MUMA 3R2GA 1LDCA 1Q8JA 2CNCA 4UTJA 4MTVA 1NELA 2AKMA 4ATDA 4GWEA 1IR1A 1LOSA 3H6OA 1JNEA 3D47A 4U2YA 4A3YA 5FL1A 1F61A 3GDLA 3N2BA 1AFSA 1GVEA 2AMXA 2WJEA 3U48A 2XVLA 1TMQA 4TV5A 3UCDA 4WHBA 1IYXA 2A3CA 3K2GA 1A5SA 3VDBA 3VIKA 2E9LA 4Y2WA 1UD2A 4PYSA 3W70A 3R89A 3E5PA 3RLUA 1EXBA 3LV5A 3P0XA 1VFTA 1BRLA 3AXXA 3FAXA 3DHUA 1UJQA 5FEXA 4EXAA 2W66A 4JCLA 1BTMA 3TZNA 4GVIA 4WX2A 4ZO8A 4FPSA 4L80A 4GQRA 1CW2A 4GVFA 4GBDA 1JYWA 1V3KA 4UTWC 1AQ0A 3GXMA 5H8MA 2A4AA 3SR7A 3UG5A 3OOQA 3DYPA 1XLMA 2AL2A 2C71A 4HA4A 3RU6A 1IIGA 3SBFA 4N7QA 1SFSA 2DY3A 4MMWA 4RZ6A 2B7OA 2QUUA 1ISXA 3L68A 4NILA 3SZ8A 1B3WA 4KIRA 3WO8A 1U5HA 1GKPA 1YQ2A 5M1TA 4AYGA 1GEHA 3TC7A 1UWSA 1K8CA 3LX9A 1TR9A 4HZ7A 4JX5A 4H8UA 2GUBA 4XZ9A 5TAOA 3ABXA 1FBAA 2BASA 3F5KA 1SO6A 3BC9A 3PF3A 1TPEA 3C5QA 2J8FA 2PGWA 4OECA 5AY7A 5HOSA 1EJ7L 3K5XA 5FIPA 3OZMA 1XLFA 3RR1A 3TC3A 1VJSA 5JBFA 2Q8ZA 4QGCA 1QOXA 1R3RA 5REQA 2YDAA 2WC3A 4JTRA 3N3MA 3ARPA 3I3DA 1DWHM 4V1YA 4PFHA 3PZMA 3P5ZA 2A1YA 1VPXA 3H2MA 2FGZA 3WH9A 3BW3A 4I8YA 4JIIX 4O19A 2NX3A 1I75A 1EQCA 2YXXA 1IT8A 3U7BA 1XIDA 4DO7A 3R11A 1B3XA 2W27A 3GNRA 2JIWA 4FNUA 3BCDA 5A8PA 1C92A 4ERIA 5IHSA 5CC6A 4RPPA 3RU8X 1D3HA 5FD0A 2DPEA 3BG3A 3FGCB 3L5MA 1M5WA 1TIWA 4JPGA 3NM3A 4L64A 2GOUA 5CCZA 3NGFA 1H7OA 1K02A 5B7ZA 1SZEA 1AQHA 4U28A 2Q3RA 2OT1A 2BMBA 1UC5A 3T0AA 4B5NA 4NKCA 4NZCA 3NQBA 1QHPA 2F9RA 3E49A 5HPCA 4IPNB 4RNJA 3PZNA 3KOWA 4IPLA 4EWJA 3AS2A 2WVTA 3FEMA 1H5VA 2CLLA 4HN4A 3BQ5A 3G1HA 4Z42C 3MP4A 3OBEA 1GQIA 3ZIZA 3QEZA 5TNVA 5I3FA 2P3ZA 1VRDA 2DZBA 3VZYA 2TPSA 1E56A 4GI4A 2WNWA 1YPIA 3BLKA 1OFRA 1FFQA 1MNSA 1JI2A 1J0KA 1QWKA 3ME3A 3N34A 2FJKA 1PVNA 1OK4A 4Q8QA 3NL2A 1QATA 1M1BA 3TTSA 4E6MA 4EK7A 2VOMA 2HWGA 1W2VA 1REQB 4GYPC 1S1PA 1XYCA 4L4MA 3ITGA 1G4PA 3GR8A 2Z6IA 3GTNA 1TJ1A 4PCPA 2NQ5A 4J4KA 3AYTA 4MJMA 4X2PA 5DO8A 4JTLA 3T42A 1XBVA 5T26A 2VQUA 3HGJA 5E70A 4LVBA 2A7RA 3AZTA 5EKYA 5I07A 3O2LA 2V3GA 1RD6A 3O07A 3OB8A 3B8IA 4HU4A 1H51A 1JAKA 1DJZA 1Q6OA 2FH8A 2YBUA 4NNAA 1J0YA 3H53A 1CENA 3L7RA 5K3VA 1Y5XA 3LSCA 3NL3A 3SSJA 4ZSUA 4DIAA 3CJPA 1UOKA 3ZJKA 3PY2A 3VNZA 5GNYA 4UMCA 3WFLA 1IEQA 1FCVA 5I03A 4F2TA 3KL0A 4F8XA 1H1YA 1JR1A 3UR5A 4ZOCA 1RUSA 2BWGA 3F2CA 4JQAA 4R7WA 2QV5A 9RUBA 3PSWA 3UZYA 4B3KA 4BY3A 1UW9A 5FJOA 1A5NC 2I9EA 2QHAA 1E73M 4NZ1A 5CJ5A 1YPXA 2JK2A 1DWFM 1BG4A 3LMYA 1H50A 1VJZA 5FEZA 4QR6A 4IGNA 4BHYA 4RX0A 3L23A 2J88A 6XIMA 8TIMA 3ZXWA 1R2RA 1XLKA 7ENLA 1TPFA 3EX3A 5AC6A 3LCXA 5E0KA 2O55A 1UR4A 3T44A 4E8CA 3CAVA 3FDKA 2PWFA 3CAKA 1WV2A 4I9MA 3RYSA 1P0EA 1JRBA 4LY4A 4DNHA 2EQDA 1TUFA 1IXQA 3QR3A 1CNVA 4DF2A 3CQHA 1V6TA 3KCJA 4M56A 4W7VA 4NAEA 4I9TA 1PE1A 1QI4A 1OVDA 1FFRA 3WJZA 4YU1A 1R7OA 4TMBA 1OD0A 3F4WA 4OBTA 5T91A 3R4IA 1UR9A 1CGVA 2X0YA 5FJPA 2XN0A 1EP3A 3S1GA 1OIFA 4GI8A 5C7HA 1A5OC 4MYAA 2B7NA 4ZZ9A 2H8ZA 1GNXA 3CUIA 3G1YA 4RW3A 3UR7A 1A0CA 3WNOA 1FKWA 3P3BA 2HEJA 4O1FA 1G0CA 1W3HA 5D02A 2PCEA 3SI9A 4M29A 4JTUA 3L5AA 4JTFA 3WF1A 4PRWA 4AFYA 3ES8A 3FX4A 2WMFA 3H26A 1I2PA 5AHNA 1YADA 2INZA 2ZZ4A 3Q37A 1YNYA 4LW7A 4JIPA 3OQEA 4FXJA 3OLEA 1UZDA 3W83A 4S38A 2VUYA 2I17A 1V93A 2GVGA 1VFMA 4E0CA 4IQLA 2QF7A 1XKJA 1AA1B 3N1AA 3DHFA 3TUUA 2ZRWA 4JFWA 2XUCA 4HU8A 3RFAA 1PZ3A 1W5MA 1TTIA 2C91A 3FYYA 1T41A 1LL6A 4H6KA 3GDKA 4IICA 2W6RA 1LORA 2HVMA 3QR1A 4BQ2A 3MKCA 4A3QA 4DJEA 1L6SA 1B3VA 2BHUA 4CVWA 3LI0A 4XO7A 1TPDA 1RZMA 5HNNA 4LCSA 3VOFA 3WSUA 2VYOA 4QNWA 3FHAA 1BWVA 3FVMA 2ALRA 1TPUA 4KWVA 4KWOA 4F3HA 3HG2A 2CLOA 4IGSA 2VI0A 3VE9A 1GTHA 1L6WA 3N2XA 2J7FA 4MZ1A 2QAPA 4KEZA 1TWSA 2FTWA 3TW6A 1Z89A 3SGGA 3ZS4A 3GQYA 1KM0A 4DPQA 4JCMA 1S2AA 2D69A 1Q8AA 3BZJA 3EWZA 2PZNA 1BSIA 1VQTA 1LLZA 4MY1A 1ELSA 4IQJA 4Q32A 4US5D 1XS2A 1D2KA 4KEVA 2ZUMA 3ICJA 1NFBA 3ARQA 3KFTA 4CD7A 2XVNA 4HNCA 3MJYA 3W6LA 3B8DA 3L2LA 3GD6A 3QRHA 4HTBA 3M41A 4CU7A 4E38A 1R3TA 1Y8BA 3GG8A 2DUXA 4A8NA 3BXWA 5H8PA 3H2EA 3NDOA 1QW7A 4M1RA 3CBWA 1MZHA 1PX8A 3TV8A 1W54A 5D30A 3RN6A 3TJLA 4ICNA 4AZ7A 4JX6A 2VGBA 4MY9A 2HS6A 4E2OA 1CX9A 1SO4A 4PUUA 3HQ1A 2IXVA 4ZA0A 4IOTA 5XINA 2XN1A 4LAMA 3EX4A 3ORWA 3N2MA 2J24A 4F9DA 1MZRA 1B31A 4H1ZA 5C55A 2OSYA 2CW6A 4PMVA 2Z28A 1KM1A 3N25A 1W37A 2G8ZA 2WCSA 3O16A 3BZGA 1JDFA 4IMAA 4KCUA 1V0LA 5IBXA 4K8HA 1CI1A 4XAGA 3HJEA 1KFLA 3VFCA 2J7DA 4YTTA 1EP1A 4TUFA 4WKHA 2VWTA 1FCUA 3GNOA 1UC4A 4IMGA 4UZSA 1O5RA 2CZVA 2NUYA 3GXPA 3HMCA 1JULA 2XSAA 4B5SA 3GY1A 3QSRA 3R43A 1PL9A 3M47A 1TV8A 1XQKA 1OFEA 2WBKA 4AZHA 3MUCA 4C1NB 3E3HA 1AMYA 4JTGA 1W91A 4U4MA 5E93A 1H49A 3C86A 3I7QA 3GDMA 4C6OA 3A4XA 3QQ1A 2Y6ZA 3CUFA 4QEEA 1XIFA 3VOGA 2XU2A 4HGXA 5K9DA 4AY7A 1VLIA 2Q71A 1UASA 2ZXAA 2C1HA 3A24A 4DUWA 2ZUUA 3T8LA 5D09A 4K1GA 1R8LA 4U31A 3UVAA 2PLMA 1KM4A 3W7EA 5D05A 1BYBA 4Z2KA 3TC6A 3K1GA 1ADDA 2NUWA 3W02A 2WMJA 4DJFD 1WUEA 4PTDA 3AXIA 4CNUA 1PHWA 3WUFA 3BMXA 3W7JA 1J2BA 5KMYA 1IEWA 2D0FA 1RQEA 3M07A 5A8MA 1G7VA 3WUBA 3FA4A 2YW4A 4RNHA 3MMWA 2V68A 4UMAA 1DORA 4Q8VA 3WEOA 1SGJA 4N02A 1XLJA 4J3SA 1XG4A 4ZOBA 3ISIX 1JZ8A 3HGOA 2EPKX 3SN4A 1E40A 2WSRA 3AI0A 2RJGA 3HU7A 1W6TA 4O1AA 2PU1A 2QDDA 2PDUA 1PX4A 4H4IA 1XLBA 2VENA 4BKNA 1I60A 3W88A 2DT1A 5HANA 3V36A 3RLGA 4DXVA 3TYCA 2EG6A 3IK2A 1MRAA 3H21A 4UFMA 3CMJA 4ENLA 2OT0A 1IT0A 2ABBA 3LCFA 5G4WA 1NEYA 1K8XA 4H9VA 1JPKA 2E8ZA 3H2CA 2WKGA 2B81A 5JBEA 3BLPX 4HNTA 3LLXA 3E5BA 1NH6A 4CVUA 2V2DA 2XSXA 4N9CA 2X1UA 3CXOA 1KWKA 2XH2A 3CQIA 5CH9A 4S3AA 1QPNA 4GY7A 2GDQA 5AFDA 3B03A 4B5TA 4C6KA 2Y61A 1XW8A 1U5VA 1Z3NA 4X3ZA 1E51A 1PCKA 1KR0A 1VFSA 2WXDM 1R47A 4CEXC 2Y8UA 2UY5A 3IEBA 4LUSB 1PIFA 1N2VA 3DG7A 4IGHA 4M51A 2ICSA 1YTEA 1EJSC 1W1PA 3HJZA 2QJJA 4K68A 4O15A 5I3DA 4MZYA 2GGIA 2EPNA 2ZDRA 4MWAB 4HNLA 4PUWA 3MBFA 4MB5A 4XZLX 1HP5A 1VEMA 1VS1A 3ARSA 5D9PA 4DEFA 2YL5A 3MWCA 1GOOA 4YTRA 4NRRA 4E8DA 4F0HA 1VYSX 3WLLA 4AZBA 4DWDA 3WLRA 3GNNA 1N8FA 5D2TA 1OX5A 2FTYA 2YDRA 3GBDA 2YA0A 1YMYA 4DBSA 1JZ5A 3DERA 4D1JA 3S5YA 1WAWA 2WVSA 1J01A 4J3UA 4DWSA 2CBUA 3W76A 4QBXA 2REQB 3DU0A 1XSJA 1CLKA 4HK5A 3C52A 4QE5A 4O11A 1HKIA 3P93A 4H6EA 2CC0A 2HDJA 2C19A 3L4XA 4A2RA 2W63A 5AECA 2A3HA 6XIAA 1S2WA 4BQ3A 3QHMA 3LSBA 2PRHA 2XZ9A 4AW7A 1T0OA 4MFEA 4WCJA 2BOFX 2V5CA 4JHZA 5CJMA 1UIOA 5I79A 2QDEA 2ZICA 4XAFA 3GM8A 4DUOA 1PIIA 5M3WA 3EXRA 3ZMRA 1PKMA 1YYAA 1WZAA 3CV1A 4IFOA 2NQZA 4LANA 3TXZA 1TZ7A 4X22A 3I3EA 1RQHA 1MDRA 4M6VA 5HJLA 3GKAA 2HBXA 2V5LA 4X0VA 1EC7A 3W7DA 3O06A 5B7YA 5EGRA 1KXVA 1VC4A 1C93A 2XFRA 4NP7A 1EKOA 2NVCA 3MP3A 4NAEB 1M7PA 3PZQA 1J0HA 4M80A 3H4XA 2ACUA 1WDWA 3IIPA 1V4YA 3LENA 5A69A 5CXPA 3CT2A 2PGEA 3KS6A 1J6PA 3VGDA 3CZLA 2A6LA 3PZGA 3NNTA 1S46A 1PTAA 2FLIA 1GG1A 3VKDA 1X96A 3GIQA 4CNTA 4ZVJA 3URAA 2VCBA 1SZFA 4BF7A 3HMJG 4Z2LA 4O53A 3VAVA 1L6FA 2Z2AA 2G3JA 1HO4A 3HFTA 3GG0A 4ZCWA 2VMFA 3R94A 5DFAA 2VURA 3MI6A 3N13A 4NZ5A 1SR0A 1AJZA 2VR2A 3BCJA 2HVOA 3AIVA 1QK2A 1E1CA 1A5AA 4EAMA 4MWAD 4UR9A 4UFIA 3ZLHA 1UYQA 1DVJA 2X8RA 1R2SA 1CXFA 3LHVA 2L5HA 3GU9A 3LOTA 3LU2A 1EJRC 5BXTA 3IANA 5AYYA 4KMQA 2J77A 4IP4A 2ONEA 2MUCA 4GGBA 2OX4A 4Z1YA 1NF0A 1HO1A 1T96A 2J8TA 3CHCA 2E09A 1W9BM 3DCPA 4DQWA 4K38A 2QJIA 1ZHAA 3P7YA 1WOAA 1WKFA 3WIJA 3U4AA 1MRQA 2OQHA 4QTGA 1GQNA 2Z00A 1A3HA 1IZJA 2RKXA 1UBPC 4C6IA 1PZ0A 3DUGA 2Z7GA 4EIVA 2NT1A 3VVGA 4Z2HA 3AC0A 4IFKB 1LZOA 4M81A 1OGGA 4CQ9A 1UHVA 4WOZA 1TQJA 2DZSA 3N19B 1EEXA 3P2VA 3NZRA 3SO7A 4DM1A 1XDMA 4QCEA 1US0A 1UKQA 1UWRA 3TJIA 4O50A 1GTEA 2BY3A 1E9ZB 1FY6A 4IUOA 4MPQA 5DT7A 4CNNA 3M0KA 3UCCA 2I7GA 3RG6A 1Q6LA 1U5JA 1PXGA 5TD4A 3P6LA 1XIBA 5C54A 3FJNA 3W84A 3NSMA 4GNJA 1TMLA 1BKSA 4WDTA 4PH6A 3QPZA 4JQ1A 4JTDA 4JFVA 4GCAA 2Z29A 3W27A 2J66A 5BW6A 3DHDA 1XICA 3WDQA 3IJ9A 1FDZA 3CL6A 1M68A 4LVFA 4AD1A 2F2HA 2P8BA 4UR8A 1JUEA 4YVXA 1GVYA 1YIXA 2DIJA 2WSPA 3PHAA 5CPLA 4KT2A 3V0SA 1WDQA 4L9ZA 3TEVA 1QNOA 5FF0A 2GVJA 4UNLA 4PMOA 6TAAA 3KP1A 3PPGA 3MCNA 3KWSA 1AQMA 4A8RA 1SPQA 1YE4A 4ERAA 2YLLA 3IJQA 1V6UA 2INEA 1P43A 1LQ2A 2WZMA 4UZUA 4C6PA 2WHJA 3U6WA 5E9AA 4J2MA 4DYEA 2QPUA 2F6UA 5E0CA 4RL3A 2OWCA 4U2ZA 1C8YA 4UTTA 4WKFA 4M6QA 3NPUA 4MJ2A 3PG8A 2PAJA 5FSDC 4IG2A 5CGTA 3B05A 1LL4A 3HFYA 1R38A 1WZLA 3NYZA 1UUOA 4PSRA 3EDFA 3RCMA 2FVKA 2PURA 2R6OA 4P8VA 1ZNNA 3OIHA 2HMCA 4WLCA 2XWDA 4QS6A 3VOJA 1RLCL 1OX4B 1EL3A 1R7AA 3SUWA 4GZJA 4DHGA 2QPXA 2GFTA 3F2DA 3W1UA 3Q2DA 1TZ9A 4IQDA 1J9YA 3W1MA 1WBHA 4B9YA 1XINA 3ARTA 1IR2A 1TE1A 3E0IA 2W5FA 3WK3A 2D3NA 2CHNA 3G1XA 2RDXA 3EDEA 1HNYA 2JEPA 3H70A 3ZM8A 1T5AA 2WYSA 1V7YA 1UIPA 1E4IA 1NWTA 4X2RA 5A8GA 4ZB5A 3TSDA 4RKAA 4IMEA 3GNPA 4JFSA 3ATZA 3STEA 2WCGA 2WKLA 1TJPA 3EKZA 2OYKA 1FUYA 3MKVA 4QS5A 4L56A 3EX2A 2QVNA 2XTKA 3I10A 3UW6A 3WQVA 2E4TA 4ZFMA 1XGDA 2FGLA 3MVTA 1N7KA 2C79A 4W4QA 4U10A 3H24A 2Y8VA 4LS1A 3BICA 4JOMA 3DC8A 1XV8A 3IARA 2G95A 5H1WA 2PDYA 1LTDA 3NQCA 3OLGA 3IVSA 2VWSA 4Z2GA 3MSYA 1PDYA 2XJ7A 1F6PA 1XBZA 2WANA 3WQFA 3EGJA 3A6OA 3NPWA 2WZEA 3DG6A 3AHVA 3WK0A 1TTQA 1R9ZA 2VX6A 2YBVA 4LU0A 1UD4A 4H2HA 2ISSA 3C3NA 3LM7A 1M53A 3GTXA 1KXHA 3CZ8A 4LVAA 1JFHA 4JY9A 3CAQA 2BGSA 2VL4A 4QE1A 4AVOA 3KOYA 2FFCA 5HULA 1GT8A 4EF9A 3ERPA 4C6DA 1VRXA 3A3WA 1D7KA 1S2TA 4TX6A 3F7JA 5C9XA 4BCEA 1R3WA 1V0KA 4HSNA 1TX0A 3WFAA 1RCOB 2BVWA 2PGFA 3IJ7A 4LEQA 1L9WA 1XBYA 3QMTA 3UWVA 1DIEA 4H7ZA 2O9OA 1W32A 5CPSA 1P6BA 4UB9A 3K8KA 4H9MA 3NXFA 2VZOA 2BY2A 4LUJA 3BE7A 3UA3A 5AVNA 3VC6A 1DV7A 4AG0A 1BPLB 1NP0A 4ZL1A 1ISYA 1UZHA 4E4FA 3MDUA 3VIGA 1ZBVA 3WJWA 1QK0A 1MDLA 1R9YA 1C7SA 4N9BA 5DBTA 1VGAA 3VCCA 4B4FA 3SUVA 4ZFCA 1NF7A 3TYEA 1M04A 2C1GA 4MLRA 2WVVB 4W7WA 1WKDA 1M01A 1VFOA 5AHEA 3VE7A 1F4HA 3C3UA 2ABAA 3UXIA 5BROA 1QI5A 1YDYA 4RDWA 1GZ1A 1GYLA 5XIMA 1GW9A 3FV9A 3CU2A 3ALFA 2H90A 1XIJA 3L4UA 4G7FA 3OTRA 3CM4A 2UY3A 3W0KA 4M6UA 3OA5A 1QAPA 4GI6A 2WCAA 1TWIA 4NASA 4IL0A 4OOZA 4FI4A 1C9WA 5FAJA 5D4YA 4X61A 4GNKB 3EMZA 3M0IA 2ZVIA 5LNWA 3LI1A 1GOIA 1WPCA 4D6CA 4FHAA 1VKFA 2VGFA 1UR0A 1Z32X 2V38A 2B7QA 3UPBA 4DRSA 3WL0A 3C0LA 1SU5A 5AYZA 4D72A 3GU1A 3NPXA 4NG3A 3JZEA 3BURA 3GDRA 1R46A 4AUBA 4BZYA 1UA7A 4H00A 3VD5A 1TREA 2OZ8A 3WDIA 5A5WA 4AYSA 3GFXA 5HQLA 1KFEA 1JIBA 3KTSA 1IWPA 2VX7A 5LHEA 3W1RA 1BVZA 1XRFA 4ATWA 1RALA 3F03K 4IP7A 4GHRA 3WK2A 1KCXA 2J7GA 3UWWA 4CN4A 4JHMA 1BYDA 3VGHA 4DJDA 2QCNA 1BYCA 1I4NA 3TWBA 3BAWA 1UH3A 1ICQA 4XD6A 4ADUA 1PKNA 4KGLA 1C3FA 4H7VA 4LV9A 3W37A 5H8UA 4TR9A 1Q45A 1ZU8A 2FJUB 4D8AA 5KZDA 3A5VA 3GR7A 3WYZA 1RQBA 1QASA 1Z7AA 3BLLA 4B5WA 2GZXA 1H5YA 4UOQA 2VVSA 4NJKA 4O1BA 4AISA 2GVYA 3EOUA 4AC1X 2CBIA 5M2FX 4NZFA 2OB3A 3UETA 1E3ZA 2KAUC 4DXKA 1J8VA 4WXZA 2V0TA 3ANUA 3M1ZA 4HU3A 3IGSA 3M0MA 4AWTA 3M0ZA 2PA6A 2VFDA 1K9EA 1C91A 1I2NA 4J40A 4GE8A 4O12A 1Q63A 2BOEX 1NY1A 1GKQA 2VRJA 4BI5A 1JFXA 5LGXA 3KL5A 3G5EA 2QDGA 3T7VA 3ABZA 3K13A 2WK2A 1ITXA 4EANA 1KFKA 5HBFA 4L4PA 3BAIA 3I6TA 3W01A 3ITLA 3CLWA 1CECA 1R87A 4PL1A 1A0EA 3KRUA 3KVMA 3WY1A 4G8TA 5CG7A 4AVNA 3O6AA 3DKLA 3UXKA 2Z1XA 3GBEA 4DB7A 4H04A 3ITYA 4MVAA 1BG9A 2R1NA 2FZDA 4A21A 3S5NA 1JF5A 4G1KA 2VR4A 4Z1BA 4EPKA 3KBVA 3FSTA 3WLNA 3UR8A 4FX8A 1ONEA 4HT3A 8A3HA 1W5QA 1DBTA 2C13A 4J7RA 1K03A 1G94A 3CH0A 3NQ2A 1E0XA 3DIPA 2WHMA 3AS1A 4FLOA 1OC5A 1A5UA 1DTNA 1L8PA 4NAFB 1TV7A 2DFAA 3K1DA 5DCDA 1NWUA 1Q4NX 4FO4A 2PDWA 2UY4A 5KEZA 1F5ZA 3BPWA 4GG9A 2GLKA 4N2YA 1QBBA 4V1XA 1V7AA 1O4UA 4HNOA 3VM7A 4OVXA 3POCA 2XH0A 3N9RA 4G9PA 3IVUA 3W81A 2DORA 1J10A 5LSMA 4ROQA 3LPOA 3BK0A 4LB3A 3B40A 1LYXA 2OWXA 3AIBA 2PODA 1YDVA 3B9OA 3OO2A 3MA8A 3P82A 2D3LA 3L4TA 3W7GA 1UZ1A 5LA0A 2C7FA 1V8EA 4GZIA 2YL9A 1ZRQA 3CB3A 1Q7MA 4GIRA 5G2IA 5C9RA 3A9IA 2EKCA 1E0TA 3L9CA 4GY1A 3BGJA 2PD5A 4LUIA 2QJGA 2ESCA 3BV4A 4I5UA 1JCYA 5DY3A 4NSBA 3KZPA 1E6NA 3K4DA 2DUAA 3N15A 4O0KA 2IUZA 2FB2A 3LERA 5I7GA 1XLEA 4X9SA 3A5FA 1H41A 1MXGA 4WY0A 4LAKA 1P7TB 2R1MA 2VR5A 2YIHA 5ABFA 3M0HA 4K36A 3QOMA 2OLHA 1V02A 2OR2A 4ORIA 3WG6A 1S5TA 5H91A 3SCQA 3T0TA 3AMGA 4CU6A 1ZENA 1P0KA 2OODA 1EUAA 3UESA 4B4HA 1BEUA 5CAHA 4P7RA 1IZCA 2CFFA 3KOXA 4O57A 4GCXA 3MANA 4ZQOA 2ACRA 3ZR4A 1A50A 1OK6A 2AQOA 3AWNA 2BGNE 6REQA 5AYXA 3UYCA 1B54A 1M7XA 2RJHA 1GJWA 5AC8A 1AH3A 3W00A 3ITXA 2PWDA 3HIJA 1HJXA 3UWZA 3OGSA 2NXHA 4RE2A 4N42A 4WDUA 4OTKA 3ANVA 1KTBA 3NQVA 2FPVA 4LRTA 5KITA 3O63A 5I2UA 3T40A 3SAZA 3UZJA 3KDOA 3TCSA 1H3GA 1NOWA 1KM3A 2BY0A 1FP8A 1S5VA 3GXTA 1G6CA 4YN5A 4BK9A 3W72A 3RX4A 1H60A 4NXKA 3B4YA 3V35A 1KBKA 3NIYA 3DHPA 1QFEA 4REQA 4GVGA 3PBWA 2ZX7A 3B0XA 3CIWA 3ARRA 3MI2A 3A13A 2GQAA 1N8WA 2ISDA 5M03A 1OX6A 5TBOA 3WMBA 3FXYA 3GLCA 3L21A 3SURA 4TIMA 1KXTA 1W1B1 3WNMA 4LBUA 2ZA1A 1IWAA 3NYDA 1JGIA 4H9UA 3B97A 2FB3A 3M46A 1TA3B 3QY8A 7REQA 1FHLA 3PZIA 3WLSA 3TSMA 2ZCGA 1OJXA 4I7VA 3LCWA 1XYMA 3AXMA 2NVDA 3IPWA 3IIOA 1XBXA 1EHNA 4XIMA 3RNDA 4G7EA 1KFWA 2EXOA 2GUYA 5G1MA 5K4XA 3RXZA 4NXSA 1XC4A 1CEOA 3MMUA 4MAVA 3MHUA 2OZ3A 3WQ6A 1EC8A 3IGXA 2FZMA 1EJXC 3PBUA 1GOMA 3SB0A 3OG2A 5HWJA 3VNDA 4I9JA 4RW5A 4YVPA 3I7SA 1UWUA 2OELA 4ML9A 5HQMA 1CGTA 1W3LA 1XWYA 4WJXA 5AZ0A 4NNBA 3GVVA 1SO5A 1MQPA 3E6EA 1DXEA 2V69A 2FYMA 2NQHA 5K4ZA 3NDYA 3ES7A 4JTAA 3PTKA 5A95A 4H8HA 1E5JA 5I02A 4PTXA 4NJHA 3QVQA 4MADA 1DKWA 4JDBA 4MHBA 3AISA 2J62A 4F0KA 5HPOA 2Q01A 1TRDA 3XIMA 2QCDA 1KFBA 3PP7A 1D8WA 2FZ8A 4AH7A 1O5XA 2E5DA 2IMRA 3NJ3A 3N3TA 3PVFA 3RILA 1Q6DA 2P8CA 1VFLA 4HSOA 3GSMA 1QPRA 1K8ZA 4UQCA 3O3RA 4DX3A 4DPPA 1QMLA 2E9MA 3DFOA 4XUGA 5D8ZA 4ZBCA 2P1FA 5LIWX 1K4HA 1YPFA 2YW3A 4C90A 1UG6A 4KFNA 4V33A 3W1XA 2XIIA 2XG9A 4AEEA 1M6JA 3OLIA 3SGZA 4D6GA 4DI8A 3C2EA 2D2OA 3MSDA 4FNRA 2OLSA 3CYVA 1OFAA 3DI1A 2RDWA 4GIEA 1TFVA 2QXWA 5BXPA 2FIQA 4GNVA 3E12A 5FF3A 4MNMA 1Y5VA 3GAYA 4H6RA 4CGTA 1HJVA 3N6HA 3NVTA 4O16A 4KH2A 2YX0A 2PU0A 2YA1A 4AF0A 3AO0A 4DYKA 5TQLA 1S2UA 3ITVA 3DBNA 2R94A 3DFQA 3TP4A 1W2PA 2F38A 3KBSA 1EP2A 4U3AA 3TNOA 4JN7A 1XSIA 3W86A 2PD9A 2X41A 1H7PA 4O10A 1R86A 3ITCA 3VIJA 2CHRA 1RA0A 3CMGA 3MYPA 2OGYA 4WJEA 1F9CA 3RX3A 4R34A 3SCTA 2ZFAA 2HV5A 2NXIA 5FA5A 3ZWTA 2GJXA 1QNQA 5IM51 2FGBA 4D6DA 3TR9A 7PTDA 4FZIA 4LC6A 1C7TA 3TOPA 4HYWA 1OD8A 3ZLGA 4YWIA 2X30A 2V5DA 1XIIA 4PN2A 1W1VA 3MZ2A 4XZWA 3WNPA 3FIGA 4IX0A 3M0LA 4WGHA 2YDQA 4MM1A 3M9YA 3CMFA 5M5DA 3C4UA 1WUFA 3IV3A 4DJEC 1E5NA 4EKJA 2DZXA 4QG8A 4HPGA 1SSDA 1PB0A 2V6AA 3PZ9A 4XKYA 4CKQA 2QS8A 3UJEA 3R8GA 3W7QA 5HMFA 3IUIA 4XG1A 3ZLFA 2VGGA 1KV8A 4RLIA 2E40A 4CNOA 1TV3A 3W38A 2HROA 1MQQA 2VVNA 4KRUA 4PMNA 3RPDA 5A6SA 4XD5A 2KZHA 3LYEA 2Y7FA 4LS2A 3UWEA 4N9DA 3MY9A 4NHVA 2W79A 2VRQA 2V5JA 2Y5JA 4Y9PA 4M1BA 1A5LC 1ZJHA 3W1PA 3DGBA 2OQLA 1Q6CA 3QKZA 2Y7DA 3OBAA 8RUCA 4JYDA 5EB8A 1RCQA 2X42A 3WD3A 1I1XA 4S3JA 4XTIA 3NTYA 2I5IA 2J9ZA 4HN8A 1ECEA 4Q22A 3ZJ8A 3CV7A 1IWBA 1XI3A 2D23A 3A9BA 3TN6A 1F8MA 4KFOA 4OKDA 3W7MA 4HYVA 4GXMA 3G1FA 3N2TA 1TJRA 3UNDA 4HZ8A 3SJNA 5HJXA 4W89A 4N6FA 4D6HA 5AHLA 4QITA 1OFBA 2R1KA 1E70M 3I68A 3DXIA 5K9XA 4ZE4A 1XLCA 4IWWA 5LYRA 1GPWA 5I09A 1AW1A 4I5RA 2FHCA 5LA2A 1L2QA 1OG0A 3CEPA 4JN8A 4PMUA 4RE3A 5AYBA 3LNPA 1QI3A 3HF3A 2G3IA 5GNXA 3CC1A 1LM1A 2QKFA 2VFEA 2OZ0A 3DC0A 4LFYA 4IZGA 3BAYA 4ALDA 4DJDD 2PBGA 1JZ6A 3EX1A 3GXNA 3CPRA 4HHHA 3WNLA 2GSHA 1MW1A 3FEQA 4G56A 3FOKA 3GXIA 1XM3A 1A47A 2ANUA 1MEWA 1QI2A 4AZ6A 3LHUA 1BGGA 1RBOB 1ZGDA 5LHFA 1FH9A 2VOTA 1DHPA 2XIBA 3F4VA 3UT0A 1J79A 2X40A 2G97A 3M0VA 4JTEA 1ZJAA 2AGTA 1IZKA 4GUJA 3T78A 3SQLA 3SFKA 4HNVA 3OGRA 4OBSA 5DELA 4HK7A 1E6SM 1ZALA 1WXYA 4UQEA 4R53A 3VDHA 1B3ZA 5J5DA 2PC4A 5JVLA 1ODZA 5D9MA 4PODA 1ZB5A 4GISA 1LROA 2R24A 4BF9A 1W9PA 2OEKA 4DO6A 3LS9A 3PS7A 2OEMA 1EIBA 3S4TA 1E9LA 3QW3A 3R13A 3WMCA 4EOUA 1XYZA 3EEGA 3THAA 4AD0A 5M17A 1TJ0A 3R0UA 4QROA 2FQIA 1SVDA 4YVVA 4O8RA 3W25A 1GCYA 2EG8A 3EA1A 4L65A 1HKMA 2DP3A 3PWIA 1A3XA 1QNRA 4XQ6A 4LOCA 2ZWYA 1WKEA 5C7VA 3HPAA 1EJVC 1TE6A 4GO9A 3FGCA 4ICCX 4YHEA 1QT1A 2JALA 2D1ZA 2DEPA 3LPGA 1W5NA 4PUKA 4O28A 5LNRA 4AIOA 3N12A 4J27A 3W73A 1I8JA 2Y89A 1B1YA 1LOLA 1RXOB 5CSSA 4B15A 3VYLA 4D8LA 2YCLB 3L2IA 6ENLA 1P5BA 3CK5A 2VX5A 3FA3A 1YHTA 1JPDX 1XQLA 4QDPA 4G1NA 1JCLA 4JTJA 4FLQA 3TTEA 1OY0A 3GZ3A 3STGA 4E2VA 3TYBA 3Q94A 1PUDA 1LT7A 3C0QA 4HD5A 2AQWA 2W91A 4ZR8A 4BEUA 1H62A 2FVMA 1XYAA 4FXFA 1PTGA 3WF2A 4RCXA 4UBPC 5MF5A 1HJQA 1BF2A 4OV4A 1WKYA 5C2XA 3GVQA 3ABSA 3R6IA 3VMPA 2OSXA 3RAOA 3WNKA 1LCOA 2AAAA 3NPVA 3S2MA 4AHOA 3OHIA 3ZJ6A