1B3ZA

Xylanase from penicillium simplicissimum, complex with xylopentaose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 128
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3zA00
1NOFA 1GPFA 4HPGA 3HMCA 4WK9A 3CUFA 2W63A 5EBAA 2JE8A 1CBGA 1Q6CA 3MSDA 1US2A 3K4DA 1YHTA 3KZSA 4ACZB 2VMFA 2DEPA 1GZJA 2XHYA 2XYLA 3OG2A 3BCDA 4W93A 4H8HA 3MUIA 2E40A 4RL3A 5I6SA 3G6MA 4BQ4A 5IFTA 4AXNA 1VJZA 1CLVA 5M3WA 3RMEA 4D72A 2J7FA 4CU6A 1M01A 4LGXA 2VZOA 4YHGA 1I1WA 1JDDA 3I3BA 1KXTA 3ZM8A 4D6FA 4PRWA 1EOKA 5BXRA 3LPGA 3UETA 1MQQA 2G3NA 1E55A 3PTMA 3AZSA 3CHDA 3VDBA 3WEMA 1H1NA 2WZIA 5A94A 1W3LA 3BSHA 4GIAA 2XSBA 2DH3A 3AS1A 4NRRA 5A8PA 3FHAA 4UNIA 1R7OA 1UR9A 2BNJA 3WQ8A 1JL8A 1Q6EA 1JYWA 4JHZA 5FOOA 1E0XA 3DC0A 4UQ9A 3A6OA 5D9PA 1HJWA 1V3HA 4UZSA 5HBFA 3IAPA 1BG4A 1UZ4A 1V03A 4XV0A 1TFVA 5LA2A 1W1PA 4RE4A 3UG5A 1B30A 3SCRA 3WDRA 1UD2A 3SEPA 3ZT5A 1VBRA 2E3ZA 2PBGA 1F4HA 4GQRA 3SIMA 5ABGA 1ODUA 3AJ7A 1LLOA 1R7AA 1VF8A 2BHZA 3NJ3A 4JFUA 5A6BD 2J74A 1CZ1A 1V08A 2WVUA 3OBAA 4UOJA 4E2OA 4GZEA 4J3WA 3KL3A 4HMCA 3IJ9A 1E40A 1KXQA 3WNNA 2DGAA 2PBOA 4NSBA 1HXJA 5JBDA 2VVNA 4GI9A 5M17A 3POHA 3VMOA 3WH7A 5ABFB 1V0LA 3WKZA 1LWJA 3WQWA 4QAWA 1UH3A 4NZCA 1XSJA 4M80A 3AS2A 2E0PA 3EMQA 1ECEA 2ZE0A 7CGTA 3IK2A 3LPOA 1EHNA 1E72M 1ZBWA 1PIGA 2DIEA 1CNVA 2EPNA 4TTGA 1QNQA 1ZU8A 2WHLA 1WDSA 3OLGA 2AAAA 4Z2HA 1QW8A 3AXXA 1VB9A 3L2MA 4P7QA 3O2LA 4E8DA 3APGA 3UCQA 3WL0A 1LF1A 3QGVA 4ML4A 5HPCA 3AICA 1OIFA 3WSUA 4CD8A 2YA1A 4EKJA 2DT2A 1U2YA 4HA1A 2FH8A 3WUFA 1J0KA 4CU8A 3VINA 4LX4A 4XX6A 5E6ZA 1RH9A 4PSRA 4Q22A 1KGUA 3W6LA 4HOWA 2WMGA 2VO5A 4ZE4A 2ZICA 1Q6DA 1J01A 2WAGA 1B3XA 2VUYA 4W86A 1V3MA 3RM4A 2VL4A 3B9AA 2YL5A 2DSUA 4B3LA 4JKMA 3GNRA 3T2OA 4HMEA 5TD4A 3K4AA 4P7RA 1I1XA 1L8NA 3UERA 2BXZA 3VM5A 3VMPA 2RGMA 5IHSA 2E8YA 1J0YA 2W91A 4OIFA 2VTFA 5D8ZA 1J10A 1PAMA 1J0ZA 2WYSA 1E9LA 3WN6A 2WC7A 2FGZA 1CLXA 2YL8A 3CHEA 4HOZA 3TA9A 4URIA 1E43A 1M03A 5BRQA 4Z2KA 1DEDA 4JFSA 1C8XA 3VX1A 5DFAA 3WF2A 5FCZA 3WNPA 4L4PA 1K9DA 4J3TA 2WC4A 1E0WA 2WLZA 1H0IA 1KR0A 3CTTA 4R27A 2PWGA 3WUBA 4PMYA 2CKRA 3EDDA 4AZ7A 2QHAA 1UKQA 4OOUA 1K9EA 4A3HA 4F79A 3WD4A 3WEZA 1EA9C 1QHZA 2TAAA 2G8ZA 3MSGA 1DWFM 3QHNA 3GNOA 1E3XA 1SMAA 3K8LA 3WIJA 3CMJA 4X9YA 5A8QA 1MQPA 4Z2JA 2OLHA 2ZX8A 2V3EA 3ARRA 1MXDA 2AOSA 1QOXA 5DMYA 4TX8A 3ZO9A 1XH0A 3W28A 1ZB5A 3WBEA 1QNOA 4PMRA 2XVKA 3ZIZA 4AIUA 5BXPA 1MW0A 2W92A 3OLEA 1B3YA 4AC1X 1W3KA 3MS8A 1QI0A 2VR5A 5CPQA 3N18A 3II1A 2CIPA 5A2BA 1VEPA 3A47A 3WD0A 1ISXA 1G94A 4PSPA 4UCFA 5A8NA 1MYRA 1AMYA 2XVPA 1V02A 1JD7A 2XVLA 4OUEA 2J78A 5M03A 2CITA 3WD1A 1H41A 1UWIA 1CECA 3ZT6A 2ZXDA 1LJYA 1EQCA 3U7VA 2A3AA 3AYRA 4B16A 1X6LA 4UTFA 1J11A 1GNXA 1RPKA 2VZVA 4AZCB 3W25A 1FH9A 3DYMA 5KEZA 4UQAA 4W84A 1LL6A 4P7OA 1B1YA 3CUHA 5A6SA 1RD6A 2DSKA 1AQHA 5LYRA 2J7GA 3SCSA 3OA5A 4GPNA 5CGTA 1D7FA 1TA3B 3FN9A 5M5DA 1VEOA 1XCXA 5HPOA 3ZJ7A 4V27A 4FLQA 2D24A 3DHUA 2E9LA 4QCEA 1FFRA 1UWRA 4PMNA 3TTOA 1TUXA 3WQVA 2CESA 1M7XA 4KGJA 1GOIA 1H4PA 3IJ7A 4WIWA 4AZGA 3MUY1 3M7SA 3WDPP 3GXMA 4OBRA 1CGTA 4MNLA 2BHYA 1CGVA 3VM7A 3VDCA 4D6IA 1CEOA 4QLKA 4HU8A 1HKJA 1E4NA 1OGSA 3AHXA 5FD0A 2PI6A 4B9ZA 2DT0A 4GZJA 3CGTA 3WMCA 4HZ8A 2GJRA 2XFRA 6A3HA 2DPEA 3DYPA 1JAKA 4BQ5A 5BWFA 3E1F1 2EPLX 4W7WA 4GI6A 2C0HA 1BF2A 3VPLA 4CN4A 5IFPA 5CSUA 1KQZA 3ZJKA 2OSXA 4WSKA 1U33A 5BROA 3VIOA 1IZKA 1E71M 2WKGA 5DO8A 3TTYA 1CWYA 2ZXAA 2BS9A 5E09A 1JZ8A 2YLLA 1BFNA 1OGGA 1HNYA 1E1FA 3SCQA 4PMVA 4PMQA 3VGGA 5FKYA 3U57A 4UFJA 3VIIA 4OKDA 4U33A 4AISA 1QPKA 1BAGA 2BVTA 2FHFA 3AIWA 1L0PA 4CD7A 3VTRA 3QHOA 4WKHA 1ESWA 4W7VA 2CKSA 1CXKA 4MADA 1W9DM 2ZUSA 3EDEA 1XHGA 1BTCA 1XRVA 4WKAA 5HDRA 5A6AA 3VOCA 5D9OA 1FP8A 3PTKA 3WY1A 1HL8A 1V0KA 2WVTA 5LA1A 2YA2A 5JBEA 1GHSA 3AMCA 3AMLA 4W89A 1NM9A 3L4ZA 3A4AA 1KXVA 5CXPA 3MUAA 1JG9A 2O92A 2BXYA 2YDQA 3SCWA 1GQLA 4HA3A 2EJ1A 1NWRA 1AQMA 5D8WA 3ARYA 2WMFA 1B0IA 2XM2A 1HP4A 3CZLA 4KGLA 4D6HA 1XYFA 4ACYA 1E56A 1XV8A 3BGAA 4PMZA 3F5LA 1CIUA 3D3AA 1WPCA 4TOQA 2VX7A 4M56A 4M1RA 4A4AA 5D9NA 1WAWA 1MFUA 3WBAA 4CD4A 2FH6A 1CYGA 2X1IA 2WMIA 1NOWA 1DP0A 2ZUMA 2DT3A 4W5UA 2V5DA 1I75A 4AD4A 5D4YA 3W24A 2D1ZA 4AD2A 3PZUA 3UEQA 3DHPA 1SYTA 2VCBA 3VDHA 1LG2A 3BAXA 4DWSC 2CYGA 3GBEA 3MMWA 3MUZ1 1W3JA 1ITXA 1H11A 3ZT7A 1J0IA 2WM0A 7A3HA 4D1JA 3AHYA 2D20A 2PB1A 3O6AA 1LG1A 1XCWA 3AHTA 1E6XM 1C3FA 3F4VA 1E70M 3SCVA 4F66A 3CUGA 4CU7A 5CPSA 3AXIA 2GFTA 3WH6A 1WB0A 5CPTA 1GOMA 1ZJAA 3K8MA 2J79A 1ZS2A 2Y2WA 1JYXA 3GXFA 3N9KA 5GQBA 3ARPA 5HNNA 3RO8A 4OJYA 3L4YA 2J77A 8A3HA 4MJ4A 4U2YA 1E6RA 1B3VA 3RPMA 4JZ5A 5CGMA 2WMJA 3VIHA 1D3CA 2VZSA 4HOXA 2CBIA 4HU0A 3BCFA 3W38A 3CPUA 3KE0A 1WZLA 3AISA 3CHCA 5I78A 1V6WA 4CCEA 2Y4SA 4Z2GA 1QNPA 4UR9A 4N0RA 3VIPA 2ZWYA 2VI0A 1W1TA 1OT1A 3EMCA 2YBUA 2JEPA 3VGFA 2BY1A 2OSYA 4MNJA 3AOFA 3I3DA 2X05A 2YOCA 1FHDA 5A69A 2X09A 3N13A 2UY4A 4U31A 2A3EA 2WW5A 2BY0A 1KBKA 1TA3A 2WWCA 4Q7NA 4AZBA 3W6MA 3U7BA 2EPMX 4GQQA 4AD1A 4R5EA 2MANA 4C7GA 3GH5A 3A4XA 2V3DA 2PF0A 3NIYA 2XWEA 1WDPA 4AD3A 2W61A 3ZMRA 3OIHA 3WNLA 3UESA 4AD0A 1BYAA 2O9RA 1OM0A 2J7HA 2VCCA 2WBKA 2XPKA 3ZOAA 3PBGA 1CENA 2GVYA 1PX3A 3OGSA 3IAQA 4AEEA 1P6WA 1TZ7A 2J7CA 1XSKA 4JFVA 1A47A 3SCOA 2GJPA 3W0KA 3SCTA 5A6KA 2BFGA 1BHGA 3FAXA 3OGRA 2E4TA 4UOQA 4J3SA 3VO0A 2WVSA 5DEZA 4PCTA 2EXOA 7TAAA 1PIFA 3RJYA 4AIEA 1H2JA 3SCNA 1H09A 3SUSA 1N82A 3UR8A 3QOMA 5A6BA 3ALGA 3OLDA 4PMDA 2VRKA 3DYOA 2GJXA 3WF0A 1HIZA 4GXPA 5CLTA 1BGGA 3JUGA 3WF3A 1PZ3A 1DWHM 4HZ6A 3SUWA 4MAVA 4EAMA 4IM4A 2IUZA 5EMYA 2PWHA 4ATLA 2WBGA 1GJWA 3D5HA 2WXDM 2G4FA 3L4UA 2NT1A 2E8ZA 1NARA 3S6TA 2OWXA 1GQIA 4PTWA 4WJXA 1QHOA 2D23A 3VIJA 1W9VA 4J3UA 4M82A 3GDBA 5A2CA 3GH4A 1V3KA 4UFIA 4JAWA 5DF0A 1Q6FA 4H2CA 5AYIA 4F9JA 4YPJA 1G1YA 1JYVA 4H8VA 1CXLA 2DSZA 4GO9A 1V6XA 3WH8A 1UKSA 1UWTA 1W91A 1WZAA 1PEZA 3EDFA 2VNCA 1E5NA 1NOUA 1E6QM 1CGYA 3VVGA 1LQ0A 1ZBVA 2WSPA 1W9XA 5JIWA 4UQDA 2YA0A 2XVNA 1G01A 1W9BM 3SUTA 4W88A 2GK1A 2ZWZA 3BLKA 3HN3A 3ARUA 1GW1A 4MAZA 3T0AA 2JEQA 4UFKA 4V2XA 1B3ZA 5FIPA 3AHZA 3VDAA 1R87A 3GXIA 3FW6A 1M53A 1WCGA 2JALA 4P8WA 5BRPA 1W1VA 4HA4A 1VBUA 1HJSA 2W5FA 1JD9A 4LYRA 1C7SA 3WH9A 1E6PA 1NWSA 4MB3A 2XIIA 3ECQA 4GZIA 1SMDA 3L4XA 1KFWA 1OB0A 5A8OA 1NQ6A 2QMKA 1Q6GA 1W3HA 4CVWA 1OCQA 1GORA 1IZJA 2OYKA 1UQYA 4D6DA 4EK7A 4PMOA 4QCFA 4DWSA 2O9TA 2OYMA 3KWXA 1UKPA 1E15A 2DSVA 1JZ5A 1C8YA 2WVVB 3THCA 1CGWA 1V0NA 1R86A 5A8MA 1JAEA 2WWDA 1XYZA 4ATWA 4WSJA 2D0HA 1NP0A 4WKFA 2Z1SA 4J27A 1VFOA 2CBVA 2Q8XA 2WK2A 1US3A 2QMJA 3FHQA 5A6JA 3PZNA 2ZUTA 1NWUA 1XC6A 1C8QA 1H0GA 1JZ7A 1LL7A 1GOKA 5BXTA 5JUVA 3AMGA 1ODZA 4XUYA 4U3CA 1BYBA 1LWHA 4MB1A 1HJUA 2NW0A 2EBNA 4ZE5A 4W8AA 5CZKA 1BSIA 2WKLA 2WZEA 5ABHA 4J28A 1QI2A 4D6EA 1JF5A 2UY2A 4MTVA 1WKYA 2OWWA 1DTUA 4E8CA 2HISA 4F8XA 4DWSB 3B9DA 1QBAA 4KRUA 4M24A 2YJQA 1GCYA 1ITCA 4KH2A 2XSAA 1ISZA 4JCLA 1VIWA 1VFUA 2G3JA 1UWUA 3F5JA 3EDKA 5CQ1A 2CPUA 1BQCA 1WZKA 2Y8KA 1S46A 3QR3A 1TMQA 4AZ5A 4MPKA 1TVPA 2JF6A 2ZOXA 2E9BA 2GJXB 3U5YA 1KCLA 3BAJA 1NH6A 1HP5A 3BC9A 3MANA 2YLAA 3AHVA 2XGIA 4PEEA 2OSWA 4C7FA 5AYBA 5I5RA 1KQYA 4AMCA 3T08A 2D0GA 1LL4A 3WUGA 3W37A 3N15A 4UZUA 3FXYA 2CHOA 4PMUA 2V5CA 3GXDA 4JL1A 3VGDA 5I23A 4A3YA 3AMDA 4LPCA 5A2AA 4D6JA 2YIHA 2DIJA 4JKLA 3EBVA 2VVSA 1HL9A 1UR1A 1HKIA 1PX8A 1O6IA 1AQ0A 2G3MA 1IV8A 2BY2A 4B9YA 2JIEA 2Y8VA 2EQDA 3CO4A 2C7FA 4UQEA 3WQ4A 2D2OA 2DH2A 4GINA 1E4IA 2ZX5A 4KRTA 4AZIA 2UWFA 4RE3A 1ZBCA 4JHOA 2BV9A 3OLIA 3WQ5A 3WDIA 5ECUA 2ZX6A 2D3LA 4MB5A 3WD2A 4JIEA 1WDRA 1KB3A 4W8BA 1C7TA 1B31A 2Y24A 3WH5A 2DQXA 4OOZA 1QI4A 4FLOA 4PCSA 1DWIM 1BVNP 4S3JA 2VR4A 3K8KA 1KCKA 4CN6A 4UQBA 3IANA 1JXKA 1VAHA 3WNMA 2WSKA 1UWSA 4H04A 1V6VA 2BVDA 2A3BA 3PZIA 1IT0A 1FH8A 1C92A 5JBFA 1ZJBA 1K6AA 4M8UA 1B2YA 1HVQA 2QPUA 1GQKA 3CH9A 2DT1A 3LMYA 3PZGA 1DWGM 1W9UA 5LA0A 5A95A 1V0MA 2VRQA 2G3IA 4AZ6A 1UR0A 4GKLA 4N42A 4TX6A 4BA0A 2IXUA 1EDGA 3RILA 2JIWA 2J8FA 4W5ZA 1H5VA 4PBGA 3AIVA 4FMVA 2X0HA 2QLYA 5A3HA 5E70A 3ZSTA 3WFLA 4X0NA 5CSYA 1EHAA 5IHRA 4DWSD 3A4WA 4J3XA 1NP2A 3VIGA 3W26A 4BF7A 4WF7A 3TTSA 1EDQA 3PN8A 4GI8A 1JFHA 5D9MA 3PZVA 3VIMA 2YBTA 4IPLA 1CPUA 5I2UA 5GNZA 2XVGA 1Y7VA 2VQUA 2J7EA 3I3EA 1UWQA 5I3DA 1WNOA 2WPGA 3HJEA 5C70A 3CZGA 3PTQA 3SCUA 3AXHA 1O7AA 1UKOA 1W9PA 4S3KA 3VGEA 4H7VA 5C71A 1VENA 4QP0A 1V6UA 3ARZA 1CXHA 1FHLA 4AW7A 4DUVA 1HVXA 3ALFA 3UG3A 4AY1A 1KWGA 4P8XA 5I77A 1K9FA 4ZXLA 4QFUA 4ZXOA 3FY1A 4W8LA 3WNKA 3UR7A 4CD6A 1EIBA 4P8UA 1TVNA 2PWDA 2FDMA 1KR1A 1GVYA 1JDCA 3MKKA 3L2LA 4HZ7A 3W4RA 3VNZA 2PC8A 1KGXA 1MW2A 3W82A 2GUYA 4PYSA 4NRSA 1E1EA 5BXSA 3VGHA 1J18A 1V3IA 1TCMA 1H49A 1EOMA 5EFFA 1CGUA 3CMGA 3ARVA 1WE5A 1W1YA 4PUDA 1KGWA 2A3HA 2W4XA 1EH9A 4LQ1A 1QI3A 4C7DA 2O9PA 1TR1A 2XFYA 4X0VA 5DT7A 1JYNA 5E0CA 1GUVA 4TVDA 3J7HA 3WF1A 1JZ2A 2BY3A 3L4WA 2CERA 3CBWA 5E6YA 2UY3A 2VCAA 1UOKA 1X6NA 3WENA 1E6NA 1J9YA 3PZ9A 3WMBA 3DECA 1E73M 4JKKA 4JFTA 2WCSA 4AEFA 1MVYA 3WDJA 3T0BA 3AIEA 4D6GA 1NWTA 3WEOA 5A1AA 4MDOA 3RDKA 1WP6A 3AZTA 1OT2A 1QVBA 1UD4A 2WNWA 1B9ZA 2VZTA 4PTVA 1PPIA 2WHJA 2WMKA 2IXVA 4HPHA 3SUVA 2J4GA 3NDZA 1EDTA 2DDXA 1WDQA 2WC3A 1C90A 3M07A 3ZJ6A 2XJ7A 1VFFA 3K1DA 4NI3A 5AC5A 3AZRA 1BPLB 2J62A 3NSNA 1D2KA 4IUGA 1MFVA 2GSJA 2WMIB 3CUJA 1CGXA 3GM8A 4HTYA 1EO5A 1OD0A 2WZHA 3W29A 3VD3A 5BYWA 1K9TA 9CGTA 4H8UA 1B3WA 2WMHA 5GNXA 3OZOA 1XH1A 2CCRA 3B9EA 3IJ8A 3VKKA 2FHBA 1JI1A 1RP9A 2FHCA 4CCDA 1UD5A 4TVCA 3MMUA 1FP9A 2E9MA 3B8SA 3WELA 3WDQA 4NF7A 4XZWA 2DSWA 1UHVA 1UQZA 5F7UA 4FLRA 4UOZA 5ABFA 4ATDA 4TUFA 1MQRA 4M81A 3WDHA 2C8NA 2VT0A 4V28A 3AIBA 4PMXA 4LYQA 1Z32X 3MV11 3O9NA 3POCA 2W62A 4U2ZA 3GYCA 3CZJA 3ARTA 4P7LA 4XZBA 4DM2A 1MWOA 1UA3A 2W66A 4B15A 2ZUNA 2VX4A 3OZPA 2RGLA 3MO4A 1JDAA 2XWDA 2ESCA 2D3NA 1GONA 1SFSA 1HN1A 2OWCA 6CGTA 1BG9A 1UG6A 3L4TA 2CHNA 4GO8A 1OGBA 3U5UA 3T09A 3BMVA 4OZOA 3KL0A 4P8VA 1UUQA 2GK1B 1GQJA 4BQ3A 1QI5A 5BCAA 1F4AA 1ISYA 3G6LA 2PWEA 3ZSSA 2J75A 4TVUA 1PBGA 1V6YA 4W87A 3WUEA 3BAYA 3WD3A 4BCEA 5I24A 3GBDA 3TP4A 2J7BA 1UD3A 3EMZA 3LPPA 3RCNA 2Y5EA 3WF4A 3K46A 1MW3A 3UG4A 2ZIDA 3NDYA 3VNYA 1HX0A 5EFDA 3WNOA 1V3LA 4MNMA 4KMQA 1QBBA 4MB4A 1E4LA 1GOQA 3BH4A 3AS0A 4HMDA 4F9DA 2D22A 2GDUA 5KZ6A 5IXEA 3TONA 3SUUA 4QLJA 2W67A 3AI0A 1GJUA 1B90A 3VILA 4YN5A 1MW1A 3MV01 3PZTA 1ISWA 3MMDA 5E0FA 1CXFA 1X1NA 1EQPA 3A3HA 4AWEA 3ZR5A 3GTNA 3W81A 1G0CA 4CVUA 1CTNA 1EXPA 1BVZA 2ZXBA 3CHFA 3VD5A 4WLCA 4B3KA 1FOBA 2ZUUA 3VD4A 1E0VA 1UR2A 4UFHA 1HF6A 1OSEA 2ZX9A 2YDRA 3NSXA 1UR8A 1XSIA 1A3HA 1UH2A 2D0FA 5I0DA 4W7UA 2X0YA 3THDA 3RJXA 1OBAA 1QHPA 4UFLA 2VC9A 3NUKA 2YDSA 4L4OA 3WMSA 1JNEA 3BLPX 1BYCA 2YKKA 1JF6A 4ZFMA 5E9AA 4CN1A 4ZEPA 2EPOA 1HKMA 3AIUA 1PX4A 1J0JA 2WHMA 2CETA 4AZCA 3W27A 3L4VA 3VU2A 3AS3A 1UYQA 1H3GA 1QW9A 3PZMA 3ARSA 4CGTA 4QLLA 2VOTA 1E4MM 2AMGA 4P7NA 1RP8A 3AIQA 3NYDA 1E6ZA 3VD9A 2J47A 5CJ5A 2WB5A 3QHMA 2X2YA 3BAKA 3M46A 2NSXA 3GH7A 4DM1A 1TE1A 1Q4NX 3PZQA 5FL1A 3SURA 1W2VA 4LYPA 2PWFA 3CIVA 2J7DA 4PTXA 2WHKA 3VD7A 5DT5A 2VZUA 1VEMA 2VX5A 3HU7A 1QNSA 4J3VA 2WLYA 3ARWA 4U3AA 2ZUWA 3F5KA 5A6MA 4XB3A 4UFMA 3ARXA 1AVAA 2VQTA 2XM1A 3CZEA 1UA7A 5A6LA 1CXEA 1OINA 1FH7A 4W85A 1GOOA 4EANA 1BGAA 3AFBA 2Z1KA 3W53A 1GVIA 3NCOA 8CGTA 4Z2IA 3FAWA 1JGIA 5ABEA 1JNDA 4PTMA 1KBBA 1HJQA 4UQCA 2FGLA 1V3JA 4YHEA 5JIPA 1CDGA 4Z2LA 1JZ3A 1U30A 4H41A 1EGZA 3CUIA 1GHRA 3N17A 2OYLA 4DUWA 5I79A 3AMKA 3PHAA 1J0HA 1FFQA 1WO2A 1ZL1A 3N04A 1DWJM 1R85A 5HXMA 2V38A 4ZENA 4CD5A 2WVVA 3VGBA 3FNDA 1UD6A 1HJXA 2QPSA 4FK9A 2EO7A 4OBSA 2QV4A 5EB8A 2V3GA 3NSMA 2F2HA 2XIBA 3ZQ9A 2O9OA 4E4PA 3KL5A 5GPRA 3WQ6A 1DHKA 3ZJ8A 3CZKA 2JFEX 1C93A 1E5JA 4U5KA 4MNKA 1JXJA 3BMWA 3RM8A 2HVMA 3WL1A 2CXGA 1ISVA 1CXIA 1QNRA 4RE2A 2VJXA 3ZR6A 3OGVA 1OWQA 1XH2A 3BAIA 2XFFA 4AZHA 2QF8A 4D71A 3T2PA 3GZAA 3VX0A 1R8LA 2F61A 3WFZA 4BZYA 3EDJA 5CLWA 1BYDA 2J25A 2XG9A 1SR0A 4K68A 1JZ6A 1HKKA 1OD8A 4AYSA 3AIRA 4QDMA 1ZBKA 4LXFA 1J12A 4MDPA 3AROA 3EYPA 3MU7A 2EPKX 3ARQA 3VIKA 4IPNB 5C8BB 1HT6A 3N1AA 2BHUA 2WANA 3RIKA 6TAAA 3AYSA 4D6CA 3OB8A 2V3FA 3M6DA 4AIOA 2X8RA 2EEXA 2ZXQA 5GNYA 2B31A 2XTKA 1JZ4A 5HOSA 1UR4A 1VRXA 4BS0A 3VIFA 5AC4A 1E6SM 4CCCA 2G41A 3GNPA 2JF7A 1KXHA 3SCPA 4EE9A 3VMNA 4JFWA 1W2PA 3T2QA 1XD0A 4KWUA 3BAWA 1TG7A 4HP5A 4JL2A 4AD5A 2A3CA 1GOWA 4PN2A 4TTUA 1PZ2A 3LPFA 2ZUVA 2CBJA 1JI2A 1HJVA 2XUCA 4M29A 3TTQA 1DWAM 1OIMA 1M04A 2ZX7A 1G9HA 5CG0A 1UKTA 2BVYA 1JFXA 3N11A 1VFMA 1UD8A 4FF5A 2NT0A 4DUXA 2YL6A 4TXEA 1KWKA 5FL0A 2VURA 2XGBA 4JCMA 4ACZA 1UH4A 3S2CA 1C91A 1XGZA 2CBUA 1EO7A 1XD1A 2CEQA 1G5AA 3AQUA 4IISA 3BXWA 4MJ2A 4FLSA 1FA2A 3CZ8A 3VUPA 2F8QA 3QOKA 2WCAA 3N12A 2VRJA 2UY5A 4D1IA 2J8GA 1UZ1A 2CNCA 3KEHA 4PUEA 1YQ2A 1W32A 1BLIA 4CUCA 5IDIA 1JIBA 1VJSA 4J7RA 1MXGA 4U5IA 3T0DA 2VX6A 1WZMA 3TOPA 3BSGA 4CKQA 1V02E 1PJ9A 2GDVA 1E3ZA 4BQ2A 2WCGA 3PZOA 4Y7EA 5AY7A 3CLWA 2YL9A 3RM9A
chains in the Genus database with same CATH superfamily
1WA3A 3HMCA 2EAWA 4GCXA 1VC4A 1BF6A 2FPVA 1YHTA 4ACZB 2VMFA 3NA8A 2DEPA 1HQTA 2ZRVA 1V4YA 3Q58A 3BO9A 1G7UA 2FKPA 2E40A 3M0XA 5HATA 3DHDA 5IFTA 3LERA 1L6YA 3FYYA 3T55A 1UB3A 1FWFC 1RY0A 3NZGA 3RMEA 5M3WA 1ZCOA 1XG4A 2J7FA 4CU6A 5I7GA 3BCJA 4WUIA 1W5QA 3TC3A 1I1WA 1FWNA 3ZM8A 1QOQA 3UETA 3C0JA 1MQQA 2G3NA 3ABOA 1E55A 4L1GA 3USBA 3SY5A 3E2VA 1AZ2A 1BRLB 3QSRA 5A94A 1F7BA 3GUGA 3BW3A 2FZBA 4NRRA 4FALA 2HBVA 3N14A 4HMNA 2GWNA 5TF0A 1TPUA 4XZ9A 3R8GA 1HJWA 3P60A 5LA2A 2RDXA 2Y1HA 2OTDA 3PB2A 2RAGA 3SEPA 3SR7A 3W88A 1KKOA 3TLQA 3SIMA 5ABGA 1LLOA 1QRQA 3NJ3A 4N9EA 1XX1A 4FNPA 4JFUA 4XQ6A 1CZ1A 3OO2A 2G4JA 5DCEA 1KTCA 1QK2A 4HMCA 1E40A 2PBOA 1HXJA 4C6JA 5JBDA 2VVNA 3POHA 3VMOA 1LWJA 4NZCA 2ISWA 1EHNA 1E72M 4RDVA 1X97A 1CNVA 3N9SA 4TTGA 1Z44A 2F6UA 4U10A 3OLGA 4NZ3A 3RF9A 2AAAA 4Z2HA 1VB9A 1XPYA 2YZ5A 2BGNE 3APGA 1KV5A 3VZYA 3W07A 1X8FA 4IFOA 4ZQMA 4EIVA 2QCDB 1LF1A 3WL0A 2ZE3A 3LX9A 4HCHA 2PCEA 5HPCA 1OIFA 3IIXA 3RG6A 1XLBA 3ZXWA 3MI2A 1K8XA 4LX4A 4BK9A 3HQPA 1CLKA 3FYOA 5E6ZA 4Q22A 3VUSA 2VO5A 4D2JA 1Q6DA 4W86A 2QIWA 1HZYA 3PJWA 4LVBA 2W9MA 4ZFCA 3B9AA 2DY3A 2YL5A 4ZBCA 3S1GA 4B3LA 3GNRA 5TD4A 5FEPA 2E8YA 4UMCA 2VTFA 1J10A 1J0ZA 2I17A 1FCUA 3WN6A 4WHBA 4AX6A 2Z24A 4RKAA 4QS5A 2ZZ2A 3TA9A 3SGUA 3UZ5A 1E1CA 1DEDA 4JFSA 4GH3A 3VX1A 4QG9A 4OGZA 3WF2A 5FCZA 2YBVA 1P4CA 2B4GA 3W23A 1K9DA 3CAQA 2ZFAA 2OGYA 1E0WA 4GFIA 2WLZA 3NQ6A 1XLLA 1H0IA 1AZ1A 4R27A 2PWGA 4PMYA 4AZ7A 3SFKA 3PJUA 1TPFA 1K9EA 3LGGA 3WD4A 4E8GA 1DWFM 3QFWA 1ML1A 3W7PA 2DIKA 2QCGA 1GVSA 1EC8A 1IR1A 1MQPA 2ZX8A 3ARRA 2Z6IA 2PDCA 4Y9NA 4K6AA 3QYSA 4LNCA 1XH0A 3W28A 4DUOA 1RA5A 4PFHA 3PNUA 4PMRA 5BMXA 1K8CA 2ZRYA 3IVSA 3NZ1A 3ATZA 1TIWA 4XISA 4LTSA 4D8AA 3W2NA 1OVDA 1FWGC 4B5UA 1CW2A 3T7VA 4RPQA 3RRXA 3G0XA 4DJFC 2VDIA 5TAOA 3IIPA 3N18A 1IEVA 3W2LA 3II1A 5A2BA 4IF2A 3KRSA 3LLXA 1G94A 4UCFA 5A8NA 1MYRA 1AMYA 2XVLA 4Q8NA 1JDEA 1C9WA 3T07A 1YPXA 3WD1A 5AYYA 5DANA 1CECA 3LYEA 3SADA 3AYRA 3RX2A 3TJ4A 4B16A 1O5QA 1X6LA 1J11A 4I5RA 1RPKA 4E3TA 3S1WA 4LC6A 3W25A 2PDJA 1FH9A 3EA2A 5KEZA 4C1NB 1B1YA 1VH7A 3CUHA 5A6SA 2QCEA 3SCSA 5CGTA 1G6CA 4PCNA 4KCWA 3RLUA 2QUNA 1P6CA 4NNAA 4UTLA 2R94A 5HPOA 3UJRA 4GC4A 3DHUA 1FFRA 3RU6A 4NVTA 1EWDA 3ERPA 5AZ0A 2GYIA 1J8VA 5HA7A 3NQCA 3HPXA 1M7XA 4NHVA 4LV4A 1GOIA 1H4PA 4WIWA 4HSNA 3C56A 4XIAA 3GXMA 3EWWA 1CGTA 3N2MA 4ZB5A 2Q71A 2BHYA 2PDIA 1CGVA 3MCMA 3VM7A 4MGGA 1S39A 3MUCA 2A3LA 2PI6A 2DT0A 4GZJA 5EL1A 2YX0A 5M1TA 2DPEA 3I68A 3E1F1 2EPLX 2QCHA 5IFPA 5D2XA 3ES8A 3QGKC 1IZKA 4IQDA 4JX4A 3UNTA 1E71M 4Q8PA 2NX1A 2RJHA 1G4EA 3P80A 1JZ8A 4LY8A 2YLLA 4AXKA 5G1TA 5KMYA 6REQA 3CK5A 1OGGA 3AYTA 1E1FA 1Z69A 4GXWA 3GIYA 1A0DA 4PMQA 1B5TA 4RNIA 3VGGA 3G0SA 4G1KA 1EB3A 1MRAA 3T4CA 3HZ3A 4WDUA 2BVTA 4CD7A 2PP3A 3A12A 3T6CA 2E5BA 2ZUSA 3EDEA 1BTCA 1XRVA 2QPXA 3OBKA 3MKCA 4CLMA 2WVTA 5JBEA 4G7FA 4W89A 1NM9A 3STCA 1KXVA 4AX7A 3SGGA 3MUAA 4DWDA 3PVFA 3GO2A 3GKAA 2VC5A 3MI6A 2YDQA 3SCWA 4HA3A 2EJ1A 3JW7A 1BWKA 4MF4A 1AQMA 5D8WA 3NPXA 3ARYA 2XM2A 3TYZA 2NX9A 1K8ZA 3RK8A 4ONVA 1O12A 1XR2A 4ACYA 3CIXA 4NZ4A 4LUSB 3GHTA 5IRPA 1UR3M 3E0WA 3BL3A 3F5LA 3WX7A 4X63A 1WX0A 4G2DA 2YCIX 4XBJA 4TOQA 3NZRA 2VX7A 4XAFA 1U1JA 3R0UA 3M9YA 2DVXA 3WLTA 1WAWA 4L4MA 2X30A 1W5NA 2C15A 4HB7A 2NQLA 1CYGA 4MYXA 5CEWA 3BPWA 1I75A 5REQB 2I56A 3H7UA 4GLEA 3DHPA 3C2YA 3REQB 1AODA 1LG2A 3W1PA 2CYGA 2PE4A 3MUZ1 3PANA 2PP1A 1H11A 2WM0A 3LS9A 3AHYA 4JQ4A 4D8LA 3T05A 1XCWA 3AHTA 1E70M 4CU7A 3E3HA 3TOYA 3Q65A 5H2ZA 4E2DA 1DJZA 4AAJA 1TPEA 1OZQA 1GOMA 4UUIA 1JYXA 2R1KA 3GXFA 5GQBA 3HBLA 2AQVA 3RO8A 2GDQA 2GOUA 1E6RA 3RPMA 4JZ5A 2P50A 1TVLA 1DBTA 4UNKA 6XIAA 3BCFA 3RAOA 4GIYA 2ATSA 3CV1A 3W7LA 4N9BA 3GDTA 1OT1A 4O0ZA 3W1UA 2QJJA 2BY1A 3AOFA 5A69A 1EJTC 3UWQA 1SFLA 1VFSA 1EEPA 4PL1A 1KFBA 1IR2A 2WWCA 4S2CA 2ZQ0A 4AZBA 3COTA 4GQQA 4R5EA 4BI7A 3GH5A 3NIYA 3RGTA 3L23A 1AFSA 1KM1A 3TYEA 1T7LA 3JVAA 5C5YA 2O9RA 1LP6A 4DPQA 3EX1A 4KT2A 1PX3A 1PUDA 3IAQA 3HPFA 2RFGA 4AEEA 1PCWA 2J7CA 3LCFA 3SCOA 1XIBA 3S5OA 1MXSA 4FXFA 3W0KA 4AVFA 2LLEA 2D2GA 2HROA 1N8IA 3H12A 1R9YA 4DN1A 2A1YA 2BFGA 1TX0A 1Q85A 3FAXA 2DZSA 3KLLA 3GZ3A 5HR6A 3FSUA 4J3SA 4FA3A 2BWGA 2ZZ4A 5KZEA 1E9ZB 2UV8G 1H09A 3CEPA 3BG5A 3G24A 2A21A 2VRKA 3DYOA 2YXOA 3TW9A 4AC7C 1F74A 5T91A 2JKPA 4DXVA 1W3TA 4GXPA 1BGGA 4HZ6A 5H8PA 2AL2B 4ZTYA 1R46A 1FUYA 2G95A 4DJDC 1PSCA 1U5JA 2IUZA 2YW4A 3MBDA 3D5HA 3O6DA 3DERA 3E0IA 4QQUA 4C6NA 2E8ZA 3S6TA 2ANUA 1OC6A 1GQIA 2V5LA 4JYEA 4IFRA 4C6IA 4YIWA 4CQDA 1MSSA 3PBWA 4LWWA 3LZ5A 4M82A 4OV9A 3GH4A 1V3KA 1NU5A 2YDAA 5DF0A 1VJIA 4M0XA 3G8EA 1P7TA 1UOZA 3PF3A 5AHMA 3SN1A 1UKSA 4S3GA 1PEZA 4NAFA 1I45A 1NOUA 1KLYA 1XIHA 3R43A 4M6UA 1CGYA 1V51A 1LQ0A 2GSHA 3CMFA 1W9XA 1W0MA 3SUTA 3HA1A 3C3UA 2ZWZA 1A5BA 2J6XA 3C61A 3BLKA 2BTMA 3E2QA 5AYXA 3TV8A 4WD0A 3ENLA 5FJTA 3N6HA 4V2XA 3AHZA 3RYSA 1OFQA 2TPSA 1R87A 3GXIA 3FW6A 4NNBA 5HMDA 2JALA 4US6A 2O7SA 4RDWA 3TAKA 1VBUA 2W5FA 2ZDSA 1JD9A 1C7SA 1E6PA 1NWSA 2YR1A 3L4XA 1NQ6A 1K4HA 4C65A 1GK8A 2CZDA 3AO0A 4ZSUA 1IZJA 3MVTA 3H2FA 3SW6A 2WNQA 1X39A 4DWSA 4PODA 1E15A 1JZ5A 1C8YA 1CGWA 1RQEA 4XBKA 1IEWA 2ZC1A 3UY8A 3DFHA 1OC7A 2XH7A 1FWHC 1RR2A 2CBVA 2Q8XA 2WK2A 5CH9A 4HNUA 5E0KA 3PZNA 1XC6A 3DI0A 1JPMA 2I9EA 3AMGA 1AW2A 3HPAA 3KVKA 1ZZMA 2EBNA 1Q6OA 2FFIA 1DQUA 5CZKA 1EZ2A 2QJHA 3MI3A 3H70A 1SSDA 3LNMA 3HO8A 2Y7GA 1DTUA 5I00A 3B9DA 4KRUA 2YJQA 1GCYA 1ITCA 2QDEA 4PBFA 2GJNA 3HQ1A 3BGGA 5GVJA 4L9ZA 2WQDA 4IG2B 5FAGA 3F5JA 2PTDA 5CQ1A 2OEMA 2HK0A 1UUMA 3O06A 3QR3A 4AZ5A 2WOQA 1TVPA 2JF6A 2PDWA 3L0GA 4Y9OA 3BC9A 3CV6A 3H6OA 1VP5A 3MANA 2YLAA 3AHVA 2XGIA 4UTUA 3A3XA 4M19A 1LL4A 4HSOA 3N15A 5HUPA 3FXYA 1JJKA 2CW6A 1SGJA 4JL1A 1RCOB 4A3YA 5A2AA 4YYFA 3IEBA 4IT1A 2VVSA 1UR1A 1XG3A 1O6IA 2G3MA 1IV8A 3V35A 1XLMA 4JDBA 1S3TC 3CO4A 4NG3A 2YB4A 4B5TA 4FR1A 2RJGA 2ZX5A 4DJFD 3CASA 3M0YA 1F76A 3VOHA 1R6WA 4JHOA 2QJIA 3OLIA 2FLIA 2E1WA 2P0IA 2Q09A 4MZ8A 4GWEA 1ADOA 1WDRA 2CC0A 4W8BA 1B31A 3MZNA 1D3HA 2DZWA 1U5VA 2P53A 3LRKA 4DO4A 1NEYA 3W73A 4FLOA 1YTEA 2ISFA 4MG4A 3RO6A 1V7AA 1O60A 1P43A 4LV9A 4CN6A 2IKHA 2BVDA 2A3BA 3PZIA 3M0VA 3ZLHA 1C92A 1TJPA 4LAOA 4QEHA 3LMYA 4N7QA 3RMJA 3B06A 3TJLA 2F38A 3QF0A 3H2OA 6TIMA 4N42A 4XD5A 2CLFA 2JIWA 1N8FA 4W5ZA 3L65A 3AIVA 2INEA 3DFTA 3GHRA 1UC5A 4NXKA 1RCXB 3UFYA 5IHRA 4DWSD 1GG1A 1NP2A 4WF7A 3TTSA 1K7EA 3PN8A 4GI8A 1US0A 5CSSA 3S9YA 1RK5A 3WQCA 5FEXA 5GNZA 4MMWA 2VQUA 3H4GA 1UWQA 2HK1A 2WPGA 4C6QA 5C70A 5AYZA 3TDFA 4WX2A 4LVAA 5I09A 1NFPA 2FVMA 2E5DA 3W3OA 5C71A 1JDFA 3B8UA 4QE1A 1TJ0A 1FBAA 1V6UA 1CXHA 4XD6A 3L68A 1QJWA 1UROA 4YVPA 2HPMA 3INPA 1K9FA 3WJSA 1NDWA 4ZXOA 3FY1A 3WNKA 3SSZA 3IS4A 5CC3A 4D9PA 1TVNA 3OU8A 2PWDA 3CWNA 1JCLA 3MKKA 4HZ7A 1FWDC 1KGXA 1RALA 1E1EA 5BXSA 1X1OA 2TYSA 3HG4A 2MNRA 5DN1A 1TJ1A 3NDOA 4IFKA 1NFBA 3ARVA 3CMGA 1KW1A 2QCCA 3TWBA 4YTTA 2OODA 3UG8A 4QNEA 2IPJA 4HCDA 1TR1A 5DT7A 5E0CA 4C6BA 3A13A 3MBFA 3J7HA 3PPHA 2GWGA 4QAIA 3WF1A 1FHVA 4Q32A 4GIRA 1BKSA 3KFTA 2CERA 4NILA 5E6YA 4FXRA 1WXZA 2UY3A 2VCAA 1UOKA 2R1MA 3NGJA 1B3OA 4O12A 4I7UA 1B4KA 2BASA 2BP1A 3WMBA 1E73M 4FPSA 4JKKA 4AHPA 3WDJA 3T0BA 4F0KA 4HQVA 3WEOA 5A1AA 4E4FA 3RDKA 2QULA 3AZTA 1OX5A 4PULA 4AFYA 1B9ZA 2X41A 3TQ0A 2HS6A 4CNSA 2HXTA 4XAYA 1V6TA 2IXVA 1TB3A 3ES7A 1EDTA 3M07A 4EP8C 3PY2A 4XZIA 3NGFA 3ID7A 5G5IA 5AC5A 4HK5A 1UBPC 1D2KA 1MFVA 3OG3A 3W29A 4XAPA 3FJ6A 4EACA 1X38A 2WMHA 5GNXA 1ITUA 2CCRA 2R1PA 3B9EA 3IJ8A 3L0KA 3O8AA 4X2RA 1F3EA 2Q3RA 3CJPA 4O52A 1KCZA 1ONXA 3DFNA 4LC8A 4NJGA 1RSCA 2QIIA 3WMLA 2ALRA 3TMLA 4UOZA 4CNPA 4AWUA 4M7TA 1QASA 2DORA 2NVCA 4YWIA 1Y8BA 2C19A 1ZTVA 3LQLA 2GQAA 2YCEA 3POCA 4AHOA 3GYCA 3CH0A 4LS2A 4BI6A 3ARTA 4XZBA 1T6MA 1ZAHA 2V69A 1QWGA 3H7RA 2SFPA 3ISIX 3OZPA 4L9YA 2BX7A 3L5MA 3N29A 1JDAA 1UMYA 4XSMA 4LALA 4V1XA 1YXCA 2YPIA 1IWPA 3GG0A 2CHNA 4JQ3A 4JTGA 3T09A 3ZVHB 1S5WA 4DF2A 3NYZA 5HJXA 3KL0A 1TPDA 2J9YA 3SQLA 4BQ3A 3WZ0E 3IWPA 1PBGA 4BCEA 3GAKA 4XKYA 2PDYA 3EMZA 3RCNA 2Y5EA 1SO3A 4FO4A 4LW7A 3UG4A 5EFDA 2H6RA 1QBBA 2DW7A 4NZJA 5C2CA 3AS0A 1AD4A 2GDUA 5IXEA 2B7PA 3QZAA 2QYGA 2XH0A 3AI0A 1XGEA 3VILA 1IYXA 4B4HA 2VFIA 3PZTA 3FDGA 6ALDA 3S3GA 4NU7A 1CXFA 1PE1A 3SJNA 2HE5A 3A3HA 4AWEA 3GDLA 1G0CA 1EXPA 5C2XA 2ZXBA 3CHFA 1OF6A 2PU0A 1GVEA 4TX9A 4UFHA 2V63A 5D02A 3T42A 2GGHA 4IMGA 5LZLA 1UR8A 1XSIA 1A3HA 1YDOA 4IQEA 2J24A 1UZDA 5L6UA 1Q13A 9XIAA 4WGHA 3RJXA 1KA9F 3S2MA 3P67A 4UFLA 1PS9A 4L4OA 1ONWA 1PDZA 1JNEA 2YKKA 4O19A 4QSFA 1JF6A 3MMTA 1D7KA 1HKMA 5FF7A 1J0JA 5G4HC 3LENA 3UY7A 4M5PA 2DZBA 5D04C 1QW9A 2F84A 3R2GA 3CPGA 2Y70A 3PZMA 4CGTA 4H1ZA 1E4MM 1F9CA 3LB0A 1AL8A 1GGOA 2QR6A 3AIQA 3NYDA 3B0YA 3VD9A 5H91A 4FIRA 5C9UA 5CJ5A 2WB5A 3KVJA 3QHMA 2NSXA 2ZC8A 3SURA 4P5UA 3QZ6A 1W2VA 2PWFA 4IIFA 3ZS4A 1YX1A 3EXSA 4PTXA 2WHKA 4TQTA 2VZUA 3HU7A 1QNSA 4J3VA 1KRBC 2ZUWA 2CLKA 4XB3A 4J2PA 4BHYA 1MRQA 3LCXA 4B4FA 3T0CA 1YNPA 2Y61A 1F5ZA 2VQTA 2XM1A 1JQVA 1UA7A 1CXEA 1W1B1 2WPBA 2NSOA 3LM7A 3V0SA 7XIMA 4IMEA 4W85A 2Z1KA 3W53A 3HQNA 1CB2A 3FAWA 1W5OA 4O1FA 1JNDA 4MKNA 4XD4A 4XVEA 3TNOA 3UBPC 4CNNA 5JIPA 2WSRA 1U30A 4H41A 3T81A 3VKAA 3N04A 5F2GA 1DWJM 1R85A 1H7RA 2V38A 4ZENA 3G77A 3E49A 3GU1A 3FNDA 3VOFA 3PC0A 1UD6A 2IKGA 1RZMA 3N73A 2I57A 2XINA 1R3YA 4H2HA 2XSXA 4JX6A 3GUWA 3WQ6A 1OFDA 2V30A 3CZKA 2YSWA 3KS6A 3I4KA 4U5KA 3HV8A 2A5HA 3RM8A 3WL1A 4KKXA 2GVLA 1P6BA 4NNCA 4RE2A 3GTXA 1SJCA 1OWQA 1XH2A 2XFFA 4AZHA 5A5WA 1XKJA 1R8LA 4S3DA 5KINA 5AVNA 4FNSA 4WJEA 1JZ6A 3LBMA 3BTNA 1K03A 4QDMA 4WZHA 3E2RA 3AWOA 1EC7A 2P3ZA 5GJNA 4MUPA 1ZBKA 3T78A 4W9TA 4MDPA 3EYPA 2EPKX 3CWHA 3IGHX 3RFAA 3AYSA 2V3FA 3M6DA 3KBNA 4AIOA 2X8RA 2EEXA 1JZ4A 1VRXA 4CCCA 2KAUC 2IKIA 2UZ9A 2XN0A 3QRHA 2HE8A 3VMNA 1W2PA 1XD0A 5G2IA 5AB3A 1U83A 2NVDA 1TG7A 1WUEA 4QROA 4PZVA 3RU8X 2RDUA 1GOWA 4PN2A 1GZGA 4YNGA 4PUJA 1WKDA 3LPFA 3A64A 1DJYA 1KFEA 3MDUA 4YTRA 1HJVA 3O0FA 3THQA 3PBVA 2DUAA 1M04A 3W7OA 2BVYA 3N11A 1VFMA 2NT0A 3UZXA 3BVJA 4LRTA 2XGBA 1UP3A 4JCMA 1NSJA 4F40A 1SZFA 5HWNA 1UH4A 2O55A 1DTNA 3NOEA 3W1MA 4LBRA 4HIBA 1XD1A 3OBEA 1IXOA 3AQUA 4IISA 3IPWA 4HJFA 1JPKA 1TWIA 3GVRA 2F8QA 3W2MA 3QOKA 2VWSA 1LRNA 2FZ9A 3MUXA 3NQAA 4AY7A 1W8SA 1BLIA 3N4FA 4AVNA 3A5FA 3GR8A 3IV8A 3P7YA 1SJDA 2KX9A 5H8UA 3QC3A 1WZMA 2OFJA 3BSGA 3TOPA 4CKQA 3WBWA 1FWEC 4AF0B 1EUNA 2GDVA 1KTNA 4OWGA 1OCJA 3VOIA 1M3UA 1OCNA 1JCJA 5I3GA 1ZENA 2YL9A 4H9ZA 4HPGA 1BTMA 1CBGA 1Q6CA 2NXHA 3MSDA 3ZLFA 1SPQA 4DLMA 3H7VA 5T26A 1Q5MA 4W93A 3UQNA 3VKBA 3C2FA 4H8HA 1IIHA 4RL3A 1B4EA 5I6SA 4K8HA 2DV0A 5K9CA 3JRKA 2VM8A 2MUCA 1CLVA 1ICSA 3O07A 4Q4OA 1M01A 2GOKA 4LGXA 3KLKA 3O3RA 4YHGA 3I3BA 1KXTA 3CL8A 2CLEA 3PTMA 3AZSA 1J96A 3VDBA 4RJEA 2QW5A 1L6FA 1XIJA 2WZIA 3TLLA 1W3LA 3LI0A 4GIAA 1SR9A 1Z9AA 3R5EA 4JEJA 4IGNA 5G2WA 4G5DA 3W7DA 3WQ8A 8XIMA 1ALDA 4U4MA 3CC1A 3TU9A 5D9PA 1VLIA 3MCOA 4MYAA 1V3HA 5HBFA 3IAPA 1W3IA 1BG4A 3LK6A 1GEQA 1V03A 4PH6A 1TFVA 5CZ0A 1B30A 1EBGA 1UD2A 1OX6A 4IICA 1VBRA 1F4HA 3TCSA 4GQRA 3WK3A 1ZRQA 4XKYB 4INFA 3LY0A 4S38A 3S83A 4DBWA 2V67A 3EWXA 4B5WA 3OBAA 4OQVA 4GZEA 1H62A 4JNZA 3EGJA 3WNNA 1EJRC 4KBXA 5HAOA 5G4EA 2R1NA 1V0LA 3WKZA 4X2PA 3WQWA 4XD3A 2E0PA 1BXCA 4YLWA 4Y96A 1ADDA 1ZBWA 3GTFA 4I8YA 5J8LA 2HVNA 2WHLA 1WDSA 1F05A 1OK4A 1ZJIA 4R9XA 3H2NA 1MI3A 2P3EA 3MDWA 4P7QA 5JH2A 2H8ZA 4WGXA 4XTIA 3UCQA 3C0LA 2X1TA 1IEIA 4M1BA 3QGVA 3HQOA 4GX9A 3NQFA 1YYAA 3F4CA 2YA1A 4EKJA 3GC2A 3W71A 3W2KA 1U2YA 1J0KA 3UW6A 1EPXA 3VINA 4MUZA 1R2RA 4XX6A 1RH9A 3W7EA 1HKWA 4HOWA 4ZE4A 2ZICA 1B3XA 3IIVA 4DXKA 4I5UA 2RDWA 4JTEA 3RLHA 4K39A 3T2OA 3U9IA 4IP4A 2Y5SA 4P7RA 1I1XA 2RHGA 3DFQA 4ROPA 1J0YA 1H7OA 2W91A 1WQ5A 2Z29A 5D8ZA 5AKQA 1SZNA 1E9LA 5MF5A 3M5VA 4HVXA 2WC7A 1CLXA 2R82A 3LLFA 1YKWA 4J1OA 5AN7A 1DJWA 4CQ9A 1M03A 1TREA 5BRQA 4Z2KA 5KTLA 1XINA 1VIZA 1VHCA 3NOYA 4C1KA 3NZQA 4GNKB 3K1GA 4JTIA 2W6RA 2BBFA 3TEVA 3B97A 4RXFA 3TW7A 1KR0A 5IBXC 3EDDA 2R91A 3D0CA 4OOUA 2CLPA 3M5ZA 1JPDX 3WEZA 1EA9C 1QHZA 1VHNA 1W8GA 2G8ZA 2HJPA 1T5AA 2WO5A 3MSGA 2XDFA 3L67A 2A4AA 1LRTA 3EB2A 2PS2A 5CBBA 3FGCB 1XBYA 2VD9A 5LNSA 2VC7A 3TQVA 1YDNA 2AOSA 1FKWA 3ZO9A 4FP1A 1ZB5A 3TSBA 3OJGA 3SJ3A 1DXIA 4Y9AA 5LIUX 2X7WA 1PKYA 4GQGA 3DKLA 4MKVA 4ERIA 4ALDA 2VENA 1XRTA 1QI0A 2VR5A 1XRSA 4N6FA 5CPQA 1DJXA 2Y0FA 5LNVA 4Y8EA 3WD0A 4PSPA 1V02A 1XDLA 4O1AA 4LS0A 4MPQA 3EOLA 3PUGA 4C5YA 3GDMA 1DVJA 2QVNA 8RUCA 1UWIA 2I7GA 5HNTA 4GJ1A 3TE9A 2ZRUA 4YL2A 4N2YA 2OOGA 3VDGA 4XG1A 4DHGA 1LJYA 1EQCA 2A3AA 2PZ0A 3UU0A 1HL2A 3STPA 1E9YB 1GQNA 3PUDA 4GFSA 3ANYA 4MWAC 3TNBA 4B2DA 4W84A 3OZYA 3AUOA 1AQHA 2NUXA 3V4BA 3OW1A 5C9RA 4GPNA 2E09A 2PTZA 3N19B 1D7FA 3U6WA 1TA3B 3F03K 3QQWA 4ZQNA 3E6EA 3FN9A 2OG9A 1AD1A 1NIUA 1VEOA 2YYUA 4QQ3A 4EAYA 4FLQA 4UR7A 2ZZ7A 4A35A 2VFEA 4MSSA 1UWRA 2I5GA 3C6CA 4C6CA 1TUXA 4DNMA 1LWIA 3ZVHA 4GQ0A 3SY1A 4W4QA 3HMJG 3SRDA 3IRDA 2GPTA 3W70A 3U2ZA 1YTKA 2PDKA 3VI2A 1WXJA 3EWBX 4FXJA 4ZO7A 3RCYA 4QLKA 1YNYA 2BVWA 3LHTA 1E4NA 1TQJA 3AHXA 2OR2A 4MOZA 3CGTA 4L6DA 4XZLX 2GJRA 2XFRA 3TZFA 2YGYA 2V2CA 4BQ5A 4DZ5A 4GI6A 4CN4A 4R7WA 1YPIA 4TV6A 3MQTA 2OSXA 1MUWA 3VIOA 2Z2AA 3LQGA 5DO8A 4GE8A 2ZXAA 2BS9A 1DORA 3O7UA 3UZYA 4XWUA 1BFNA 1C8VA 1HNYA 3ITOA 1GEHA 5B80A 5FKYA 3U57A 4UFJA 4PR4A 4JTSA 4U33A 1T99A 3L66A 4AISA 4DJDD 1BAGA 5DCBA 3VTRA 5AHIA 1EP3A 2FMOA 3GVQA 3QHOA 4WKHA 1CXKA 1RXOB 4TO8A 4UCGA 4IPIA 2FTPA 1XHGA 4KERA 3UJEA 1Q6RA 2Q8LA 3UWEA 3PTKA 4UR8A 2G0WA 1W1ZA 1V0KA 5HR7A 2YA2A 4S3FA 4F0MA 1FWAC 4H00A 1H7WA 3AMLA 3H24A 3UXDA 5DLCA 3UXLA 1G67A 4RV3A 1JG9A 3AU2A 1H7XA 1PCKA 2BXYA 3H21A 4JNMA 1XICA 3FGCA 1HP4A 4FEZA 2P76A 4DF0A 3NURA 3DAQA 3DI1A 2OELA 1XYBA 1E56A 3RHGA 4PB5A 5DXXA 1JGMA 3P82A 1XYAA 4LY4A 1PV8A 4A4AA 5D9NA 2V2HA 1MFUA 1VLWA 2QXWA 2R8WA 4CD4A 1MNSA 2QCFA 3T1GA 4A8RA 1G4SA 2X1IA 4IWWA 3GNXA 2WMIA 1DJIA 3S5SA 4W5UA 2V5DA 5D4YA 2TSYA 3IJQA 2D1ZA 2FYMA 3PZUA 2VCBA 2J27A 3BAXA 1QPNA 3P6LA 2GUUA 1BKHA 3UA3A 2D20A 2PB1A 2KZHA 4RNHA 4LB3A 1JCYA 4YVVA 3SCVA 5HWJA 1GJPA 4A2SA 1WB0A 4O0KA 4ZQOA 4MZYA 4GBUA 4PRTA 3ICJA 2J79A 4UMAA 1O5KA 3B05A 2Y2WA 3IRSA 4JR5A 3IV3A 3N9KA 4IXHA 5HNNA 4OJYA 2J77A 8A3HA 4U2YA 2FZNA 2NLIA 4H3DA 1XRFA 2WMJA 3CQHA 3GQYA 2J9ZA 2VZSA 3VFLA 2CBIA 3CT7A 3Q2DA 3CPUA 2PDMA 3KE0A 2CU0A 2PCQA 1WZLA 1XLHA 3AISA 3CHCA 4FS9A 1V6WA 1OQFA 2Y4SA 1V77A 4QEEA 2ZWYA 1JRCA 3KVMA 1W1TA 3EMCA 2QCMA 4B5NA 2OSYA 3VK5A 2V2DA 5AOUA 2YOCA 3FJNA 2RDTA 1TWZA 2PDPA 4U31A 4E2BA 2WW5A 1VFLA 2BY0A 4AD1A 2Y7EA 4DJED 3W83A 3A4XA 1Z42A 4MY9A 5LNUA 3LTSA 2W61A 3R58A 2QUVA 3UESA 1R3QA 4L6HA 4Q8QA 1U1HA 1OM0A 1FXQA 1DYSA 1KFCA 1GKPA 2QJMA 2WBKA 2XPKA 3VAVA 4S3BA 1CENA 1I0BA 3VNLA 4TMBA 1HG3A 3TA6A 2CLIA 3RX4A 4DY1A 3MHGA 2R24A 2PRLA 4I8DA 2R6OA 2EJAA 3OYZA 4DAFA 3BV7A 3W7QA 5A6KA 2ZZ3A 3L7RA 3MSYA 3S2NA 3TK7A 2WVSA 2Y62A 2EXOA 1FXPA 3H53A 7TAAA 1H2JA 3C2RA 3TXVA 4E4UA 2OX1A 2ICSA 5A6BA 3SM0A 5H6HA 4ZOAA 3WF0A 3WLIA 4J3ZA 4BEQA 1NQKA 1LTDA 3WF3A 3A9BA 4EAMA 1PTGA 4IM4A 4ATLA 4GMEA 2WBGA 1N7KA 3UXAA 5LHEA 2G4FA 4ECLA 1NARA 4WJXA 4HPXA 3VIJA 2FMNA 5CBIA 5A2CA 1EJSC 4UFIA 2O7QA 4JAWA 4H2CA 4H8VA 1V6XA 5FSDC 4CEUC 5LIWX 2O56A 1UWTA 1W91A 4ERGA 5I02A 3V75A 5BU9A 2W3ZA 4A3RA 3LHVA 3OVRA 4KCVA 3VVGA 4XO7A 3PNZA 4JTKA 4K8EA 4JIHA 2OKOA 5JVLA 5JH1A 4QM1A 2PDNA 3CTLA 2GK1A 1JUBA 4HYRA 4MVAA 5KZMA 3HN3A 4MAZA 3DGRA 5ENLA 4S39A 2JEQA 5SWUA 4Z17A 4LCRA 1B3ZA 3RRAA 5FIPA 3EWZA 5IBXA 1OF8A 1W1VA 3ANVA 3PWAA 4HA4A 1HJSA 3QBUA 3PTDA 1VBHA 4DZAA 4LYRA 3WH9A 2PZNA 3RUBL 2W27A 3EX3A 1XFCA 3M5XA 1KFWA 4BF5A 1EYWA 2QMKA 2E6FA 1Q6GA 2OYKA 1UQYA 4JQAA 4Q4KA 4JTRA 2WNNA 3LEPA 3THCA 3LRLA 4PL2A 4R85A 2HCVA 1DJGA 5A8MA 4RPPA 1F6KA 5D2VA 5HMEA 4BY3A 2D0HA 4WKFA 4IHCA 4Z42C 1TUFA 5BU6A 1VYRA 5A6JA 2PLCA 3F2CA 5GJPA 5FEZA 1NWUA 3QV9A 3B0UX 3W84A 3CLMA 1ODZA 3KOXA 4U3CA 2ZYFA 2IPGA 1XLGA 4OU1A 3BICA 3UR2A 4IIEA 2WKJA 1Q63A 4O1EA 5G4WA 3KDOA 2Y88A 4D6EA 3QY8A 4GUIA 4DI9A 4ENLA 2HISA 4GQBA 3W1LA 4DWSB 3PS7A 2OKTA 1R5YA 1VIWA 2ZBTA 1UWAA 2G3JA 3CIWA 1UWUA 2QDDA 2HRWA 5CAHA 1KV8A 3EDKA 1SFJA 4KEZA 4LUTA 5HULA 3VFCA 5BW6A 2Y8KA 4NAFB 4MPKA 2ZOXA 2E9BA 4NQ1A 3TZNA 1KCLA 1LORA 1MEWA 3BAJA 4B2DD 5BOFA 4FNQA 1LUCA 1AJ0A 5CG7A 1P0NA 2I16A 2OSWA 2IS7A 3F2DA 1T96A 4C7FA 3BE7A 1R3TA 5I5RA 1KQYA 2QEZA 3WUGA 1L2UA 2CHOA 4PMUA 1EWEA 2QAPA 3GD6A 3GXDA 3VGDA 3EKGA 5DXYA 2YIHA 4NJIA 2DIJA 5CCZA 3W6YA 1L6SA 3M47A 1REQB 1HL9A 3OVGA 1PX8A 1AQ0A 3VKCA 2BY2A 4ICMA 4UWMA 1DJQA 3A21A 1OC5A 2EQDA 4UQEA 4B3ZA 3WQ4A 3ZVIA 2D2OA 2DH2A 4RDYA 4WVXA 1E4IA 2OU4A 1KBLA 2DZPA 4IG2A 4AZIA 2FQIA 4RE3A 1ZBCA 3G1AA 2VP8A 3C86A 1XIMA 4XBSA 5D37A 4LJ3A 3WDIA 3CU2A 1KFLA 3CYJA 1KM0A 5ECUA 3SQMA 5LIKX 4I5XA 2D3LA 1TE6A 3L5AA 4F2UA 3QSTA 4NJKA 4OOZA 3DFSA 1SZRA 3FSTA 3K8KA 1DPMA 3WNMA 4H04A 2H3BA 3S0CA 2VFHA 5LIYX 3N3TA 4G1NA 1IT0A 1G4PA 1ZJBA 4X9SA 4AVOA 1B2YA 1XKYA 3E9AA 2QPUA 1GQKA 3PZGA 2DT1A 1XYMA 4DNHA 2PPGA 3V5OA 4R33A 4AZ6A 1TKKA 1UR0A 1LYXA 4BA0A 2Y8UA 1XF0A 2IXUA 3B04A 3HFYA 4FI4A 4AWSA 4HU3A 7REQB 1OX4B 2J8FA 3W7RA 3V16A 2PTWA 5T9CE 4HNNA 5E70A 4GVHA 4IL0A 3ZSTA 3IJIA 1OHLA 1VPXA 4NX5A 4X0NA 1EHAA 5C9WA 3I7QA 3A4WA 1BVWA 3OPSA 2VWTA 2C0AA 2NQ9A 1EDQA 3CPRA 5D38A 1M6JA 2REQB 3PZVA 1KRCC 1CPUA 5I2UA 2XVGA 1Y7VA 3I3EA 4L7ZA 1NDZA 4V15A 4HSHA 1PTAA 2GGIA 3WJXA 2Y7DA 3FJLA 2B0MA 4MLRA 3CZGA 3EA3A 1E51A 1XL9A 3CL7A 3SCUA 3W1AA 3E12A 2QUMA 4CQCA 3V5FA 1S2WA 1W9PA 4S3KA 1HO1A 1VENA 2VR2A 4QP0A 4QE4A 2EG8A 3CQ0A 4JTLA 3L5LA 1LDCA 1QOPA 4AW7A 4DUVA 2QDHA 5CPMA 3NO3A 3ALFA 1AW1A 1AL7A 2FFCA 1UJQA 4P8XA 2GSEA 2OZ3A 1F3TA 1EIBA 2FDMA 1KR1A 3C2EA 3CUZA 2Z1XA 3W4RA 4O53A 2PC8A 2GUYA 4O8RA 4DQWA 3M5YA 1GW9A 3ITXA 1J18A 1SSGA 3MYOA 1G69A 4B5SA 3TIMA 5EFFA 1EOMA 3W7GA 4O11A 3STGA 1WE5A 4L64A 4UTMA 4IP5A 4Y9MA 1RCQA 2XFYA 1JYNA 1P0EA 1GUVA 4QRNA 1H7NA 2BY3A 2H8XA 5REQA 3CBWA 1QT1A 2ZCGA 3ME3A 4RX0A 1TSIA 2QVHA 4LYKA 3EB4A 3KHDA 1K1DA 3WENA 1J9YA 4MM1A 2Z28A 3ANUA 1LLWA 4XZMX 2FDSA 4JFTA 4JICA 1OY0A 4C6OA 3UWYA 3AIEA 5KSWA 4DEFA 1REQA 2FZMA 3M1ZA 2ZA3A 1WP6A 4J9JA 1TX2A 3AALA 2GZXA 3IUHA 3GK0A 4E38A 2QJGA 4MLJA 5CJNA 3GTIA 2J4GA 3S2LA 2DDXA 1C90A 4RZBA 2X40A 1DHPA 4HHPA 1VFFA 5K4XA 4J2MA 3QLDA 4NI3A 1ZP4A 4IIDA 1CGXA 2HVOA 1LBLA 1RBLA 4HTYA 1EO5A 1OD0A 2E5CA 4MKSA 4KF1A 2QV5A 4AG0A 3WJYA 3DUGA 1XH1A 1R3VA 5LXEA 3REQA 1RP9A 2FHCA 2NWSA 3NTYA 1VCFA 4TVCA 3MMUA 4GXMA 4BEUA 3EOSA 1HGWA 4GJJA 4JTFA 2DZVA 3WELA 4GBDA 5F2LA 1UQZA 3RCMA 1ITQA 4MWAB 3VA8A 3GVGA 4ATDA 3R8HA 1JVNA 3SN4A 4AWTA 4GH1A 1R9XA 4EPDC 3UGVA 2Z7KA 1F8IA 1S2CA 2XZ9A 3UXIA 3WDHA 2VT0A 3MV11 4A8IA 4O10A 4ZCWA 2W62A 2A6LA 4U2ZA 4XUGA 1JUEA 3RLGA 1EA0A 1UA3A 4EWJA 3WBXA 2VX4A 3MHUA 2RGLA 2ESCA 1NDYA 1GONA 1SFSA 1HN1A 4NYYA 4G9PA 1M7JA 4HBKA 4RNJA 1BG9A 2HQAA 3GR7A 2J88A 4Q6XA 3NQMA 3BMVA 5F1VA 5TNVA 1W17A 1I6NA 4MFEA 4TR9A 3B40A 1A3WA 1QI5A 4UTJA 1ISYA 3G6LA 3WLLA 3WLHA 2J75A 4W87A 3QTGA 3MY9A 2PLKA 1XDJA 2Z0IA 1DXEA 5HUOA 3O0KA 1AJ2A 1UD3A 3N4AA 1W31A 3M7WA 3VNYA 4KEVA 4FNUA 4H7CA 2V81A 4MNMA 4KMQA 5C2GA 4ZL1A 1E4LA 2CWXA 5EMLA 3B8VA 4F9DA 4RZ5A 4R88A 2D22A 5KZ6A 3TONA 4HN8A 3JZUA 1SFTA 4Q4SA 1B90A 1GT8A 4KIEA 1MW1A 3MV01 3PFMA 1UCWA 2V9DA 3CV2A 3TKFA 2Q02A 1EQPA 3E38A 3GTNA 5DELA 2QCNA 1CTNA 3NL2A 3YPIA 4B3KA 1A53A 3S1XA 3KW3A 4C60A 1K7XA 1EEXA 2YDRA 5B7ZA 3URNA 1R3WA 2D0FA 3W87A 1VR6A 3EXTA 2FTWA 4W7UA 4FZIA 2POTA 2B81A 1OBAA 1QHPA 3NUKA 2YDSA 3TAOA 3BLPX 1J2BA 3HM7A 1BYCA 2QQ6A 3R1ZA 2P10A 5E9AA 4KEMA 4CN1A 1PX4A 5I3IA 2DJLA 2HNHA 4AZCA 4I9AA 2I1OA 3GG7A 4QJ3B 1F6PA 3WJZA 3HFTA 2I14A 3ARSA 3OVPA 2VOTA 1XLIA 2AMGA 3QEZA 4KWVA 3KHJA 3NPWA 3DH7A 2DW6A 5CBJA 4P7NA 1RP8A 5EMKA 2NV1A 2WJEA 3OIXA 4IGSA 2BSLA 3AXMA 1E6ZA 3R25A 2X2YA 3GH7A 4DM1A 3PZQA 2R1LA 3USZA 4GNJA 3FYPA 4GGBA 3HGOA 4L1XA 5DT5A 3ARWA 1Q65A 1KTBA 4JGDA 3APTA 1JPIA 5D03A 4Q33A 4ICNA 5FJRA 3WLNA 1JCTA 3KRZA 4HPNA 3ARXA 1AVAA 4WDTA 5CPNA 5A6LA 3ZYZA 4K36A 2CZ5A 2GGEA 1OINA 2DUZA 4UTWC 1K77A 3AFBA 4LNYA 2CLHA 3S6DA 1IXNA 3TN5A 1TZ9A 1JGIA 3EAUA 1KBBA 1R3SA 1HJQA 4GIEA 1F07A 4WR3A 1KM6A 2WJZA 5F1UA 4YHEA 4AUBA 1I4NA 1RVGA 4WOZA 1GHRA 3N17A 2OYLA 3AMKA 1J0HA 1WO2A 1ZL1A 1I2RA 3MA8A 4GYKA 4CD5A 3P5ZA 3BGJA 1HJXA 1YTDA 1XIEA 3FVDA 4FK9A 5EB8A 4GVIA 2V3GA 2F2HA 3W7HA 4ZB0A 2BODX 5DCDA 1XISA 4H4IA 2FJKA 4JD4A 3LBCA 3ZJ8A 2JFEX 2Z1WA 3EOUA 1E5JA 2B7QA 4MNKA 4BKNA 4BFAA 2PWVA 1ISVA 1QNRA 2VJXA 3G1FA 3OGVA 1U1UA 2BGSA 3S46A 4QISA 3GZAA 3VX0A 2HSAA 3XIMA 4A22A 3WFZA 4NI8A 1YLVA 4BZYA 4KFPA 3H55A 2INFA 2C1HA 2J25A 3A3WA 1SR0A 4K68A 4AYSA 3N4EA 4HNLA 1KKRA 4E6MA 5HQLA 4IX2A 4LXFA 4C90A 4L6OA 1J12A 4Q4QA 1ZSXA 3UGRA 1PO9A 1TPC1 3GXPA 3MU7A 3VIKA 3APYA 1ZJHA 3T40A 2BHUA 3RIKA 3BJTA 2AAMA 5IOBA 1IWAA 1S5NA 4J40A 3VCCA 1T41A 2E67A 1UR4A 2Z2BA 1FQ0A 2G41A 2WSQA 2JF7A 3KM8A 3MSRA 2Z4GA 1V8EA 5EMMA 3SCPA 4JFWA 3T2QA 1C29A 1VFHA 2C13A 3H2MA 4EF8A 1TZZA 1O94A 4JL2A 1JCMP 1PZ2A 2HZGA 2CBJA 2NQZA 1ZALA 1JI2A 4RNFA 2PC4A 4QBXA 2GVJA 2XUCA 1NELA 4M29A 1OIMA 1KNWA 2ZX7A 1G9HA 4KESA 1OYAA 5L9FA 1KM3A 3Q45A 1UP2A 2VURA 4S3EA 1XM3A 1C91A 3E5PA 4Z0JA 4PRRA 2CBUA 2NQHA 3C5QA 3CYVA 2ZVRA 3LSCA 2HWGA 2EGZA 3BXWA 5EBUA 5CKSA 3TH6A 1IF2A 1PWLA 2GLKA 3PBYA 2C1GA 3VUPA 2PDBA 2C18A 2OEKA 5HQMA 3B8TA 1AG1O 3CAWA 2WCAA 3O15A 2VRJA 2UY5A 2J8GA 4KCTA 2CNCA 3KEHA 4PUEA 3SBFA 4ZOBA 1YQ2A 1W32A 4E2VA 3BLLA 2JKEA 5IDIA 1JIBA 4I7WA 2P8CA 1GVFA 4MHBA 4YTSA 1VJSA 5BMWA 4J7RA 4U5IA 1EGMA 2VX6A 1EP2A 3GC5A 3VC5A 1E3ZA 1Z6KA 4Y7EA 3CLWA 3N25A 5ECVA 1SU5A 3FCPA 2DVTA 3AXKA 2OXNA 4WK9A 4CEXC 3C8NA 1YW1A 4HU4A 3KCOA 3K4DA 3HB9A 3KZSA 3PBMA 1Y5XA 1GZJA 2XYLA 3OG2A 4JN6A 1FY6A 3TFXA 1QWKA 4FX7A 3MUIA 1EP1A 1A5SA 2Z27A 7ENLA 2Z2UA 4DELA 1EJUC 3PG9A 4AXNA 1G4TA 3BOFA 1QU4A 4PEKA 4D72A 1LLZA 1QATA 3WLSA 3FEMA 1JDDA 1YE6A 4PRWA 1EOKA 3URQA 3LPGA 2X42A 2DZAA 3H23A 3TYDA 2VFDA 4PCFA 3AS1A 1NTHA 3FHAA 4KWWA 4UNIA 1R7OA 1UR9A 3V18A 3SY8A 2BNJA 1H61A 4IOTA 5FOOA 5TBOA 4UQ9A 3E0VA 4OUIA 1HW6A 3QPYA 4IL2A 4N4PA 2VXNA 1J2WA 3PBUA 4RE4A 3UG5A 3WDRA 4H9MA 2PBGA 2NUYA 3S9IA 4GY7A 4DYJA 1ODUA 3BJSA 3M0LA 2ZZ1A 3DFYA 1R7AA 2J74A 4UOJA 2INZA 3LV5A 1K02A 4J3WA 4EXBA 3SRKA 3IJ9A 3ATYA 3R79A 5ABFB 4OBTA 3GG1A 3LXAA 1UH3A 4M80A 3AS2A 3C0QA 2ZE0A 3QR1A 5LIXX 3IK2A 3LPOA 2HMCA 1PIGA 2DIEA 2XIJA 2EPNA 1QNQA 1ZU8A 3O63A 2FTYA 4I6KA 3G1YA 1M41A 2XGZA 3AXXA 3HPZA 4CNUA 3GFYA 3L2MA 4O0QA 2YCLA 3CQIA 3M44A 4E8DA 2OQHA 3ABRA 1J5TA 4ML4A 1ZUAX 3AICA 5FA5A 3BG3A 4CD8A 2QNEA 4NZ1A 1NF7A 2DT2A 4HA1A 1EBHA 3GNNA 1RA0A 1VPQA 4NJJA 4PSRA 3UWVA 2WMGA 3W1QA 1J01A 2VUYA 3TMQA 4GOAA 3EEZA 2J8TA 1BWVA 4L4LA 2VL4A 1LOSA 1UIPA 4IMFA 4HMEA 3K4AA 3VM5A 1L8NA 3UERA 1JR1A 1P5BA 3VMPA 2RGMA 3FEQA 1X1ZA 3UR5A 2PEVA 2QCLA 1SVDA 3KOWA 1TTJA 2WYSA 4GISA 5EA9A 2YL8A 4PC8A 4HNOA 1EX5A 1AK5A 4URIA 1E43A 2NQ5A 3O16A 1C8XA 3CQKA 3JS3A 4H9XA 4PCPA 2PGRA 2ZADA 2X1SA 4YYCA 3NQ8A 4LUIA 3U48A 3HGSA 3WUBA 2VFGA 2CKRA 4XSLA 5EU9A 2QHAA 3T44A 3WLKX 5FAJA 3CS2A 3VABA 4A3HA 4F79A 3WG6A 4O14A 3QHNA 3QV7A 3GNOA 1E3XA 4NP7A 1SMAA 2PDFA 4GI4A 4X9YA 3SDOA 5A8QA 3DX5A 4YS1A 3S2JA 1MXDA 4C6PA 2VKZG 4H9UA 5DMYA 3UPWA 2C79A 1GTEA 3CXOA 3WBEA 3P81A 1QNOA 3ZIZA 4AIUA 2OJPA 5BXPA 4H8NA 4PB4A 3ORWA 4H9YA 4C6EA 2W92A 2WV8A 3OLEA 3M0KA 1Y0EA 4AC1X 3U2CA 3WFAA 2Z00A 4G6CA 5F2MA 4MWAD 3A47A 2XVPA 5C55A 2J78A 5M03A 2CITA 1H41A 2OT1A 3V5CA 2ZZ5A 1FDYA 4H6RA 3DESA 4DIAA 2ZXDA 4FR6A 1PB0A 1OFPA 5G1YA 3UNDA 3B9NA 4FX6M 4DZHA 3B0XA 1EIXA 1A50A 2VZVA 1UMLA 1E0UA 1RK6A 1HO4A 1RD6A 1D8CA 8TIMA 4UTIA 3DEQA 4Z1BA 1I0DA 4LAMA 3GXNA 4H19A 4UXDA 5AVHA 1IEQA 5M5DA 3DG7A 1YE4A 3ZJ7A 4V27A 2D24A 4BWLC 2E9LA 4QCEA 4NL1A 5B7YA 1A5OC 3PSVA 4LCSA 4PMNA 1MMFA 3TTOA 2IPFA 3AUJA 3IJ7A 2FZ8A 4WCJA 4AZGA 1LQ2A 3MUY1 2PDXA 4EXAA 1I2NA 4D6IA 3P2VA 1CEOA 1RHCA 3BLOA 1HKJA 3DG3A 1OGSA 5HANA 3EWDA 3WMCA 2ZA1A 3UYIA 1SW7A 4HZ8A 6A3HA 3DYPA 1JAKA 1BXNA 1P0DA 4W7WA 2C0HA 1BF2A 4N9CA 2E25A 1I8JA 5CSUA 1KQZA 3ZJKA 3TQKA 3C0SA 4RZ6A 3DN5A 3TYUA 3QV8A 3PPGA 3SCQA 3LHYA 1A5CA 3VIIA 4ZQCA 4OKDA 3LUTA 1PDYA 1QPKA 2FHFA 3KTXA 3UPBA 3AIWA 1L0PA 1XYCA 3EA1A 3QZEA 2O0TA 3U8GA 1ESWA 4W7VA 2C14A 4MADA 3QLLA 1OADA 1QO5A 4JIPA 4WKAA 3VOCA 5D9OA 1ZLPA 5CPOA 4LAUA 1HL8A 2C6QA 4F0SA 2FB3A 1NFGA 3AMCA 2E6YA 2VELA 3N34A 5CXPA 3U3HA 1S5MA 1GQLA 4AQLA 1AA1B 2EPHA 2VHLA 2WMFA 1B0IA 1WKFA 1WXYA 4KGLA 3TWAA 2Z6JA 1XV8A 3BGAA 4Q8MA 4H6QA 5DX7A 2TRSA 3D3AA 5E5CA 2ISVA 4M56A 3UZWA 3NO1A 5PTDA 1Y5VA 2NLYA 1G7VA 4IQLA 2FH6A 3DIPA 3S47A 3RLVA 1NOWA 4AD4A 2P8BA 1ZCCA 4GVGA 3KBMA 3W24A 4C6DA 4AD2A 2OQYA 5D2YA 1WYIA 4RK8A 3UJ2A 1A5UA 4DWSC 2ACQA 2ALDA 1W3JA 5HINA 7A3HA 1V93A 1C3FA 1W54A 3H8AA 3VNDA 4DLFA 3F4VA 3CUGA 4MY8A 1H51A 5CPSA 2GFTA 1T8XA 1GYNA 3A23A 1XI3A 2VGFA 1JEZA 1RJRA 2V5BA 4ZQRA 1ZS2A 4LF1A 3FX4A 3VXGA 3WQPA 4CQAA 1P1XA 4GUGA 1EXBA 2E68A 3W7NA 3L4YA 3E0FA 4MJ4A 4XVDA 5LSMA 1I9CB 1QCWA 3BOXA 3S42A 1D3CA 1XIDA 3QYQA 4HOXA 3RITA 3AC0A 3W38A 3EOOA 1WBJA 5I78A 2YW3A 3M0HA 4PUNA 4CCEA 1FKXA 4Z2GA 1P0KA 1QNPA 4UR9A 1QW7A 2VI0A 1FDZA 4IJRA 1S5TA 3TSDA 4C1NA 1SZGA 3LZ3A 1FHDA 3XINA 3N13A 2UY4A 3GR4A 3G1DA 1KBKA 4GUFA 4FXSA 4H6EA 1CI1A 3GIPA 3DENA 3U7BA 2EPMX 2V3DA 3UD6A 1W5MA 3CEUA 1EX1A 1TYGA 1WDPA 4AD3A 4IIGA 1DE6A 1Z89A 4AD0A 2X0SA 3QFEA 1BYAA 5CZTA 2J7HA 4H9VA 5IDZA 2Y85A 3S1VA 4LRSA 2GVYA 2Q8ZA 4KETA 1XFBA 3OYXA 2VUNA 4NXSA 1XSKA 2WSYA 1A47A 1RUSA 2GJPA 1FX6A 1IEXA 3KP1A 4K38A 1B9BA 1J4EA 4DBUA 1RPXA 1XUZA 2HNEA 3EX4A 4UOQA 1XPGA 1TTPA 2YZRA 2P1FA 4PCTA 4B91A 1YEYA 3MO7A 4NJHA 2WZMA 4K7YA 3TW6A 1TPB1 3SUSA 1N82A 3UR8A 4UB9A 1F3WA 3ALGA 3BWWA 5E9XA 4PMDA 2GJXA 3RR4A 3CM4A 3P84A 1X8CA 4O1DA 4H6KA 2GGGA 3I6RA 2VGGA 2NWRA 4OTKA 3W1RA 4JTDA 3JUGA 1PZ3A 1DWHM 1O5XA 4RZ4A 5HNRA 1R47A 3UF9A 4BJHA 1GJWA 4LH8A 3HURA 1AH4A 2CFFA 1SO6A 2NT1A 1OZMA 2D23A 4FOKA 1W9VA 3RX3A 3GDBA 1FWSA 3LU2A 1Q6FA 2PWUA 4YPJA 2XIOA 3FXGA 3R0DA 1CXLA 3V1HA 1ZHAA 4GO9A 3WH8A 4IJCA 1YIXA 3TN3A 5C0QA 3PSWA 1WZAA 5BWAA 1KM2A 3BW2A 4J5NA 3EDFA 2PDQA 1LQAA 3MC5A 5D09A 1TO3A 1PVNA 4JIRA 3T0TA 1E6QM 5FJOA 3NEHA 4JTUA 4QS6A 3CL6A 2WSPA 4O57A 3BZGA 3LXBA 4UQDA 2YA0A 4W88A 2Y6ZA 4LANA 1M65A 2ACSA 3WQOA 5DMLA 4GA8A 2YCJA 3ARUA 3UWWA 3T0AA 5FF0A 1X98A 1K4GA 3M0IA 4UFKA 4PUMA 5EPDA 3KWSA 3KVLA 2V0TA 4OVXA 3W1NA 1M53A 4MWAE 4PUUA 3ELFA 4F2BA 4JHMA 1EGVA 4ZO6A 4KRZA 4Q4MA 3MW7A 4RR4A 4MB3A 2XIIA 3WBYA 4DJEC 3KDNA 4GZIA 1SMDA 5A8OA 4A8LA 3ONBA 1W3HA 4JYDA 2H90A 4IP7A 4LB4A 1TPH1 3IARA 3PPCA 4PMOA 4QCFA 2OLAA 4Q3MA 1IWBA 1XLDA 3ABXA 3KWXA 1IGSA 3VC6A 3V36A 5FESA 1UBSA 4K1WA 1EUAA 2DSVA 4LUYA 2WVVB 1V0NA 4WXZA 5FF4A 2WWDA 2ABBA 1XYZA 3G5EA 4ATWA 4D8ZA 2YB1A 5CZJA 5EMUA 1NP0A 2Z1SA 2XISA 4J27A 1XC4A 5TIMA 1QUMA 2OMAA 3FHQA 4JTAA 4G56A 2HV5A 2ZUTA 1C8QA 2ACUA 1JZ7A 1LL7A 3BUVA 4NAEB 3GDRA 5BXTA 5JUVA 1PZ1A 1LOLA 3DFPA 4HCLA 1BYBA 1LWHA 4P61A 3NR0A 1HJUA 5HJLA 3B9OA 5T9BG 4JTQA 1TELA 3KP0A 4FAMA 1LROA 2HPIA 2WZEA 4C6FA 2A6NA 5J5DA 4DI8A 2H9AA 4J28A 1QI2A 4US5D 1JF5A 7PTDA 2UY2A 4WY0A 4MTVA 1WKYA 1RBOB 4R34A 4F8XA 5XINA 3B8IA 4M24A 5HJYA 3B0PA 3W7KA 3KBSA 4JCLA 1ZFJA 3GS6A 1L8PA 4IMAA 2ZTJA 2BOEX 3IIZA 4PUKA 1VFUA 5JXQA 4JN8A 3W9ZA 2NVAA 3STEA 2CPUA 1WZKA 1QPRA 4WRHA 4EWND 1S46A 5CSRA 4NKCA 2GJXB 3ITLA 3GYEA 1HP5A 3OP2A 5EKYA 4WDXA 4PEEA 2X1UA 4Z1YA 5AYBA 1EZWA 4AMCA 3NEVA 3T08A 4PE8A 4JOMA 2V5CA 4ADTA 4C91A 1VKFA 3GFXA 4RUBA 3R89A 4D6JA 2GQ3A 3EBVA 3IGUA 3OODA 4AH7A 1HKIA 4G8TA 3W2UA 1WAUA 1F61A 4DBDA 4B9YA 2C16A 1UIOA 2IQDA 2Y8VA 3TUUA 3T8QA 4GINA 3QY6A 3URBA 3JR2A 3NPUA 3QVQA 1S1PA 2NV9A 3UZZA 5AC8A 5C9XA 3WQ5A 4DJEA 4KW2A 1WBHA 4MB5A 3WD2A 3IIOA 1C7TA 2J66A 3GNDA 3WH5A 3QMTA 1GWJA 5C7HA 1QI4A 5AHFA 2Q01A 4MZ1A 4PCSA 3W7MA 1DWIM 4Y8FA 2OEJA 3FJ4A 2HXUA 4S3JA 2VR4A 3EPOA 1KCKA 2NUWA 3KS5A 2EG6A 1VAHA 2WSKA 1VS1A 5DQPA 1FH8A 1P7TB 5JBFA 4M8UA 1K6AA 1Z41A 1F3XA 1KM5A 1T8QA 3GVVA 1VGAA 1DWGM 1Q7ZA 1J6OA 5D32A 1LBFA 3M6YA 3EOEA 1V0MA