1B3ZA

Xylanase from penicillium simplicissimum, complex with xylopentaose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 128
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3zA00
4PMZA 4PMRA 3A4XA 4FMVA 4FLRA 2PF0A 3QHOA 4NF7A 3BLKA 1M03A 4AW7A 3AIVA 3DYOA 1UHVA 4HMEA 3M7SA 1OINA 1HKJA 2DH3A 4U2YA 4CCDA 3PTKA 2YL6A 4QLKA 5CLTA 3O6AA 2JIEA 2YDQA 1OGGA 1E40A 2E8ZA 4AD2A 2WC3A 4BQ2A 2G3NA 1GZJA 2D0GA 2X0YA 1QNSA 2VL4A 1MYRA 2XSAA 4PTWA 2CBVA 4AC1X 1V0MA 1QHPA 1E0WA 4TUFA 1UZ1A 3WL0A 2CBUA 1W1TA 4B9ZA 5A69A 2WB5A 1XYZA 1OIFA 4LPCA 4MAVA 2WVVA 1B30A 1VFFA 2Y8VA 1B31A 1DTUA 1XH2A 7CGTA 1UQZA 2WZHA 3D3AA 3GH4A 1M53A 4PN2A 4HOXA 4XV0A 1UKTA 2VZSA 2X2YA 2OWXA 4MNJA 4BQ5A 2W92A 5DEZA 2VO5A 1V0KA 2GDUA 2OYKA 4JFSA 4Z2IA 1YHTA 2DT3A 1UKQA 3OGRA 3CLWA 3L2MA 5EFDA 1QNOA 4GKLA 5I79A 1TFVA 4RE2A 4LQ1A 3N15A 4QFUA 4NSBA 1M7XA 1ZL1A 2VZOA 2YDSA 2QPSA 4CU7A 4CCEA 4WLCA 3VIHA 2J8GA 3FN9A 2EPLX 3LPGA 4M82A 3MANA 1BG4A 1KQZA 3AJ7A 4K68A 3N9KA 3OZOA 2BY2A 1VB9A 5KEZA 1KB3A 3VILA 2VZTA 4J3TA 3KL3A 4MDOA 1E15A 1UD4A 5GNXA 4V28A 1H11A 1EOKA 5LYRA 5D8ZA 3CZEA 1UD6A 4ATWA 4GQQA 2YJQA 1Q6GA 1MW0A 1QW8A 3AYSA 3CHEA 3WH5A 5JBEA 2ZWZA 2O9TA 2WSKA 2VX4A 3ZO9A 2GDVA 2JFEX 2G3IA 4J3WA 2VQTA 4AWEA 3BSHA 3WQVA 1UH2A 3W29A 2WYSA 4PUDA 2J62A 3CMJA 1JNDA 2Y8KA 1UR0A 4L4OA 1R7AA 1XD0A 3IK2A 1G1YA 1LG2A 1B90A 1J18A 1LJYA 5F7UA 1I75A 1OIMA 3BMVA 1CXEA 4FLSA 2D2OA 3ZR6A 2EXOA 3UETA 4AZ5A 4QAWA 3SUUA 5A6KA 4KRUA 4IISA 1VEPA 2BNJA 4JKKA 2J25A 1E4IA 1BGAA 1W2PA 1BVZA 4W89A 2QHAA 5ABHA 1BSIA 2W67A 2XTKA 1UG6A 2G41A 4DM2A 8CGTA 4J28A 2NW0A 3VX0A 2WMFA 1E1FA 1GOQA 2J7HA 3AS3A 4AZCA 2BVYA 3AOFA 4XZWA 4TX8A 3UG3A 1UWUA 3UG5A 2WHJA 2DQXA 5BXRA 1EA9C 1PBGA 5E6ZA 3BLPX 1TG7A 5FKYA 4AMCA 1TMQA 2WVSA 4GI6A 3MSGA 2OLHA 4JFWA 1BPLB 3ARWA 2FHCA 3L4XA 3VD7A 3WH9A 4Z2GA 2D3LA 4Z2HA 3EYPA 1VEMA 1FH9A 2YL5A 3L4WA 2WMIA 1H0GA 4FLOA 2WW5A 2WZEA 2YA2A 1XH0A 1HP5A 3ARTA 1ISVA 4W7VA 3CUHA 5E09A 4P8XA 4PSRA 4AY1A 1V6YA 1JD9A 3E1F1 3PZUA 1MW2A 1CGUA 3AMGA 5CG0A 3GDBA 1UR2A 4CD4A 4TVCA 5IFPA 2BHZA 4BQ3A 4TVDA 4CD7A 2QLYA 2J7DA 1QOXA 3BAIA 3AZSA 4EKJA 4C7FA 1IV8A 3AHZA 4PCSA 2W5FA 1V6VA 4UQDA 3ZOAA 4BA0A 3CTTA 1JXKA 1JXJA 2FH6A 2TAAA 3WF1A 1VIWA 1CLVA 1W1VA 1JG9A 2DT1A 2VVNA 1XYFA 1GHRA 1NP2A 1KGXA 2FGZA 3OLDA 4GI8A 1ZBCA 4W5UA 4FK9A 5DT7A 1UWRA 5M5DA 1UH3A 3VGBA 4XZBA 3ZQ9A 1CBGA 1JF5A 2EJ1A 1PZ3A 4CN1A 1XSKA 3CH9A 3KE0A 3ARSA 3N1AA 4PMUA 1C3FA 3MUAA 4M80A 3PZ9A 3U7BA 1NM9A 5I24A 1QI0A 3F5KA 1L8NA 2J7EA 3B9AA 3ARZA 1EDQA 3WMBA 1MQQA 3WDQA 1F4AA 4CCCA 4PMVA 4ZXLA 4MPKA 3OBAA 2XSBA 4PBGA 2YIHA 2CCRA 2UY3A 4M24A 2QV4A 1MWOA 1H0IA 1G5AA 5CLWA 2EBNA 4H8VA 4QDMA 3WF4A 2XM2A 2G4FA 3KL0A 4ML4A 4PTXA 2GSJA 1JYVA 4GO8A 3L4VA 5AY7A 4WKFA 3WN6A 1W1PA 2YKKA 4M81A 1E56A 1EH9A 2E0PA 3VTRA 1E0XA 3ZT6A 1I1XA 1ISYA 1V02A 1HL9A 3WEZA 5DT5A 1UR9A 3PZQA 2X1IA 3ALGA 3VMOA 1YQ2A 3MUY1 1B3VA 5D9MA 1GJWA 3ARRA 2OSXA 4MJ2A 3WMSA 3VIMA 2O9OA 4KGJA 1BYDA 1DWJM 3QR3A 3WF3A 3AIRA 2EPKX 2XPKA 4AD1A 5BXSA 4QCEA 3HN3A 1B3ZA 1JI1A 1XH1A 3W38A 3WUEA 1W9PA 2BHUA 3L4UA 1HKMA 1JI2A 1FH8A 2WMKA 5CGMA 4GXPA 3PTQA 5DO8A 3K8MA 1DWAM 4LYPA 1CZ1A 4AIOA 4PCTA 1FP9A 3NSNA 4H2CA 3AZRA 3SCWA 5D8WA 2UWFA 3WBEA 1OWQA 3SCNA 1K6AA 4M1RA 3D5HA 4A3YA 4JCLA 1CLXA 1R7OA 4H8HA 1XCWA 2V5DA 3AS0A 4QLJA 7A3HA 4B16A 1LL4A 4W86A 1VBRA 4JFTA 2V3FA 4PTVA 3WNMA 4KRTA 1OGBA 3PZIA 1UR1A 3VNZA 3ZJ7A 2BY3A 2IXUA 1WDQA 5GNZA 4JFUA 1E5NA 3WF2A 1NQ6A 1CEOA 2DT2A 3NIYA 3GXDA 1WE5A 1GCYA 2YLAA 2CKRA 3VIIA 2EO7A 1J0HA 1VRXA 1OD8A 1GOIA 1ZBKA 3PZNA 2E4TA 4MTVA 1OM0A 4NZCA 2VUYA 2ZX7A 4J7RA 3RILA 1EQPA 2CPUA 2VR4A 2VURA 4BS0A 3BGAA 5CQ1A 4UQEA 1HL8A 1CGTA 5A6BA 5CPSA 1HJXA 1UWTA 3BCFA 3GNRA 3MMWA 5M03A 5TD4A 5E0FA 2XFFA 2YDRA 2QPUA 1CECA 1W1YA 3A47A 3VUPA 1BFNA 1D7FA 1HIZA 1R87A 1MW1A 1NOUA 3WQ6A 1W9BM 4P7OA 1SFSA 4AZGA 4OOZA 3CPUA 3WQ8A 2ZWYA 4B9YA 4HP5A 3GBDA 3RJXA 1GHSA 3VMNA 3CZKA 3KL5A 3AIEA 2VX7A 1TUXA 3W6LA 4Z2JA 2DEPA 3ARYA 3VMPA 3BAJA 3K46A 4JIEA 1XSJA 1WAWA 4DUXA 3IJ7A 3MV11 3AS1A 3BSGA 4WK9A 3AMDA 1BHGA 3WFZA 2CYGA 4X9YA 4B3LA 4JCMA 2G3MA 2XFRA 4AISA 2GUYA 3CZJA 4X0NA 3WDRA 3T08A 4TXEA 2DSWA 3SUSA 1JAEA 2XVKA 1W3HA 4PMOA 4P7NA 4UQBA 2VCCA 4E2OA 1E4NA 1BVNP 3AQUA 1F4HA 3IAPA 3OA5A 1OCQA 1W32A 4UR9A 2XWDA 2D22A 1A3HA 3WL1A 4XUYA 5BCAA 3VGGA 1ISZA 1CXIA 1GOOA 2BV9A 3W0KA 1AQMA 4JZ5A 3WEOA 5A1AA 1Q6DA 1SYTA 2B31A 2WSPA 3NSMA 2O9RA 3M46A 4HA3A 3K4AA 4PTMA 4LYQA 1UOKA 3NDYA 5C70A 3L4YA 2WC7A 1MW3A 2DT0A 5ECUA 4QCFA 4HU8A 3QOMA 3LPFA 3VIOA 4E4PA 4E8DA 3VDCA 2JF6A 4GINA 4YN5A 1E6SM 3CZGA 2CXGA 1TZ7A 1RPKA 3AHVA 4W88A 1KXHA 3EDFA 3BAWA 1UA7A 1BGGA 1K9EA 5I77A 2QF8A 1RP8A 3N18A 3VDHA 3WH7A 1ESWA 4ATLA 1U30A 3MSDA 1NH6A 3VIJA 7TAAA 1E55A 3SCVA 1V3MA 1GPFA 3WQ4A 1CDGA 2BVDA 3ZR5A 4CD6A 2W4XA 4DUWA 3VD4A 2OWCA 3K4DA 1P6WA 3GXIA 1O6IA 1HX0A 4HMDA 3CHCA 1NOFA 1XGZA 2XUCA 3GTNA 1UKSA 1SMAA 2JF7A 1AQHA 1W9DM 2BS9A 1IZKA 1RH9A 2E40A 4W93A 1HVXA 1CWYA 1ODZA 2WCAA 3NCOA 3WNNA 4W8AA 4TOQA 1HJWA 2WPGA 4U5KA 1K9DA 3DECA 1UD5A 3VGDA 5CJ5A 4P8WA 3DYMA 3S2CA 1ZU8A 1KCLA 5JIPA 5C71A 1E0VA 3MKKA 6TAAA 1HXJA 3OLGA 1XD1A 2W61A 2WWDA 2A3HA 3CUIA 4N42A 4JFVA 5BWFA 3ARQA 4DWSD 1ZBVA 2F8QA 2RGMA 2ZE0A 3VD9A 1GORA 2J74A 5M17A 4OUEA 3CBWA 3AIQA 4MB3A 1UZ4A 1VF8A 5BRPA 1ITXA 1KR0A 2CITA 4GO9A 5A8PA 4UFKA 4UFHA 1BYBA 4QLLA 4D1JA 1X6LA 1LQ0A 3EDDA 1VFUA 1QBBA 3GM8A 1WB0A 3FHAA 4AD0A 3AZTA 2J7BA 3WF0A 2UY2A 1FP8A 6A3HA 5A6MA 3OLIA 2YA0A 1HF6A 2ZXBA 5D9OA 1WKYA 4WSJA 3ZJKA 1V0NA 2Z1SA 4OJYA 1PIFA 3EMZA 3KEHA 1EDGA 1FHLA 2DIJA 1UR8A 1Y7VA 4V2XA 2QMKA 2WAGA 2JIWA 1B2YA 3OZPA 4J3XA 1WDPA 4H04A 4AZ6A 1HJVA 1EGZA 3M6DA 3EMQA 4HOZA 3VGEA 1UD3A 3N17A 2G8ZA 2W63A 1V02E 4AD3A 4D1IA 6CGTA 2BFGA 1HJQA 4U31A 1FA2A 5FIPA 3EBVA 3WDHA 4DWSC 3MV01 4Z2KA 4JHZA 2VRKA 2WHKA 2WWCA 5BYWA 5AYIA 3W4RA 3TTQA 4GI9A 1GQKA 5A2CA 3ZT5A 2WMGA 4A3HA 4U33A 4A4AA 4UFJA 4OZOA 1E4MM 3MU7A 2ZUVA 3QHMA 1JAKA 1R8LA 3ZM8A 3CMGA 1J0JA 4H41A 3CIVA 4OBSA 3RM8A 1JZ4A 1HJUA 3W28A 2VI0A 2WBGA 1JDAA 4HA1A 1E4LA 3U57A 1LLOA 3PZMA 3N13A 1XSIA 5A8MA 1CGXA 1CGVA 4MB5A 3GH7A 1UWIA 2WHLA 2HISA 3ZJ6A 4Y7EA 1NWRA 2VJXA 5AYBA 5A2BA 4GQRA 3I3DA 2WVTA 4RE4A 1QPKA 1CXHA 3WD1A 1KWKA 3AIWA 1QHZA 5ABEA 4B15A 3BMWA 3HU7A 2YL8A 1HN1A 1LF1A 4P7RA 3SCQA 1FOBA 1CXKA 2OYMA 3OLEA 2ZXDA 1WZMA 4MJ4A 5HBFA 3VIKA 5A6AA 5M3WA 2XGIA 4YHGA 2O92A 4FLQA 5JUVA 1J10A 1E6QM 1GW1A 3AS2A 1NWSA 3F4VA 3W37A 2W66A 2VVSA 5FL0A 5HXMA 1IT0A 5CSYA 3KWXA 3RDKA 1W9XA 4CVWA 3WD4A 2PBGA 1JZ8A 1GOWA 3LMYA 1FH7A 4ZEPA 4LGXA 2XIBA 1H4PA 3U5UA 4BF7A 2CIPA 4GIAA 4HU0A 1B3XA 3UR8A 1ZS2A 1WZKA 4HPHA 5A8QA 2VRQA 2CETA 2XVLA 2ZUSA 2ESCA 1W91A 3M07A 2DH2A 2QMJA 1TCMA 1OD0A 2A3CA 3CHFA 4EANA 4CD8A 4F9JA 2J47A 3WD3A 1PEZA 4WF7A 4D6HA 1CGYA 4AZBA 4UCFA 4TTUA 3NDZA 4ZENA 1ZJAA 4GPNA 2YLLA 3RM4A 5CZKA 1M01A 4EE9A 2EQDA 4W5ZA 4TTGA 5CPQA 1O7AA 4ACZB 4OOUA 3AHXA 1MQRA 3WUGA 1WDRA 1JZ5A 1V03A 1PPIA 1I1WA 2CNCA 3VNYA 3CUFA 4KWUA 4C7GA 4D6JA 1CNVA 3RIKA 5I2UA 1Q6CA 4J3UA 1E6XM 1NWTA 1Z32X 3ARPA 3GXMA 4LYRA 1JGIA 1VEOA 1JF6A 4RE3A 3CHDA 2HVMA 3AYRA 4ATDA 2VX5A 3SCTA 2VZVA 3WNOA 1R85A 1JYWA 4HZ7A 4CU6A 3TONA 3OG2A 1VAHA 3QOKA 2JALA 2YBUA 1A47A 3CUGA 3I3EA 2A3BA 4UFIA 2YOCA 1ECEA 2ZUMA 4W8BA 3NJ3A 3AIBA 1GQIA 3ZIZA 1ISWA 5A2AA 5AC4A 3RM9A 2CBIA 1EO7A 3AISA 3K1DA 3N04A 1S46A 1BQCA 2PWEA 3SUVA 5JBFA 5I5RA 1QVBA 5CXPA 5FL1A 2GJXB 3SUWA 3BAKA 1H3GA 2FHFA 2WMJA 3PZTA 1UD2A 3PTMA 1CTNA 1GVYA 4AXNA 1C93A 4YHEA 4AEFA 1H1NA 1N82A 1C90A 4U3AA 5A6JA 1KBKA 3QGVA 5EBAA 4OBRA 4UQAA 1FFRA 2ZIDA 3WDIA 3HMCA 5DF0A 4UNIA 2J79A 2DIEA 4HA4A 2J8FA 1OT2A 2CBJA 1BAGA 3SCSA 1KGWA 3WD2A 3ZMRA 5IHRA 3WNPA 1HP4A 1TA3B 4QP0A 4CGTA 3A3HA 2NSXA 1C91A 2XIIA 1J01A 1NWUA 3SURA 1QI3A 2OSYA 3VO0A 2ZUWA 9CGTA 4UFLA 3FXYA 1JNEA 2FDMA 1TVPA 1JYNA 1V3KA 2XGBA 2OSWA 1NP0A 2OYLA 4AD4A 1K9FA 5GPRA 4BQ4A 1XCXA 4WKHA 4NI3A 4MB4A 1LWJA 4P7QA 3BH4A 4AYSA 1RD6A 5JBDA 1QI4A 4F79A 3RPMA 2GK1B 1WDSA 2PI6A 1C8QA 3UEQA 1DWFM 3FAXA 3FNDA 3W82A 1KCKA 3S6TA 4W84A 3CO4A 1R86A 3VIPA 4CD5A 1VJZA 3U7VA 4WIWA 1US3A 2F2HA 3KZSA 3VPLA 1HNYA 3WKZA 4HOWA 1TVNA 4UOZA 1UYQA 1OBAA 3T2OA 2E8YA 2PWDA 2ZX9A 3O2LA 4AZIA 4DM1A 4D71A 4EAMA 4D6GA 2FHBA 1ZBWA 2EPNA 2WNWA 3BC9A 4JKMA 3VU2A 4P8UA 1JFHA 3IJ9A 3CZLA 1FFQA 1B3WA 3T09A 3PHAA 2BY0A 1WNOA 2V5CA 2WM0A 4JKLA 4JAWA 4XB3A 3OIHA 3OGVA 5EB8A 2PC8A 3TTSA 1HKIA 1NARA 1V3JA 3T2QA 2UY5A 2WLZA 5E70A 5CGTA 4TX6A 1V3IA 2VCBA 3SIMA 1H49A 1U2YA 1WP6A 2VT0A 1QNPA 5DFAA 4D6CA 2D3NA 3HJEA 5C8BB 2X09A 4P8VA 1UH4A 3RJYA 5LA2A 1E43A 8A3HA 1J11A 1LL6A 4AZ7A 4AZHA 3POCA 3WENA 5I78A 2Y24A 2BXZA 1PX3A 5I3DA 1J0YA 4Q22A 1Q6EA 4U2ZA 2BXYA 3WELA 1EIBA 1GONA 3THCA 5FD0A 3WUFA 3UCQA 4IPNB 5A6SA 2NT1A 3VDAA 4D6IA 2WK2A 3WNKA 3A6OA 3WFLA 1K9TA 3BCDA 2J78A 3MMUA 1KXVA 5LA1A 5CSUA 3WH6A 3EMCA 4PUEA 2X05A 1M04A 3A4AA 1D2KA 3N12A 3PBGA 1BYCA 1V6XA 2GFTA 1IZJA 3T2PA 1CXLA 1JFXA 1LL7A 2WCGA 1QW9A 2X8RA 1H09A 3GH5A 1DWIM 4PMNA 3UR7A 5BXTA 4E8CA 1KR1A 3UESA 3PZOA 4W7WA 1GOKA 1E5JA 2ZX8A 4CU8A 3L2LA 2DPEA 4BZYA 4N0RA 1OT1A 1OSEA 5HPOA 3U5YA 4KGLA 3WMCA 1E73M 2E9MA 5E9AA 2WBKA 3SEPA 2A3EA 1SMDA 1HT6A 5D4YA 1EQCA 3VKKA 4KMQA 1E3ZA 2XFYA 2DSVA 3WBAA 2OWWA 1PJ9A 1KWGA 3NSXA 3FY1A 1AQ0A 2ZXAA 1E9LA 2XVPA 1E6RA 1MXDA 1E72M 5EMYA 4HZ8A 1MVYA 1E3XA 4UQ9A 3AIUA 1DWHM 5A95A 1TE1A 3SCRA 4RL3A 4YPJA 1NOWA 5KZ6A 1VJSA 4UOQA 1W3KA 3VVGA 1J0KA 3ZJ8A 2WLYA 3L4TA 3PZGA 1JZ7A 2WXDM 1CIUA 3GXFA 4PMDA 1L0PA 1C7TA 3WEMA 1U33A 4W87A 3ALFA 3MS8A 4MAZA 4XX6A 1V6WA 1UD8A 1C8XA 1UA3A 2ZUTA 4DUVA 3T0DA 3W6MA 3K8KA 3WD0A 2V3EA 1CYGA 5ABFB 2EPOA 1HVQA 4CN4A 1GJUA 4U3CA 4URIA 3GZAA 4AZCB 5JIWA 1BLIA 4DWSB 2XM1A 4F8XA 2O9PA 3TTYA 1G9HA 2DDXA 1EOMA 1UWSA 3UERA 1XC6A 2XVGA 3UG4A 2E9LA 2NT0A 4MNKA 4W8LA 3VIGA 5IFTA 1XHGA 2V3DA 3JUGA 2F61A 1EHAA 4AIEA 4LXFA 3CGTA 2RGLA 3GNPA 1VFMA 4OKDA 3O9NA 3VM5A 2WMIB 3FAWA 2UY4A 1GVIA 4HTYA 1XRVA 1DEDA 3SCUA 4R27A 1PX8A 4J27A 3W27A 1RP9A 4IM4A 2VOTA 4X0VA 5A94A 2YL9A 2D0FA 4D6FA 3LPPA 3I3BA 1E1EA 2XYLA 5A8OA 4KH2A 1GUVA 1WCGA 2VNCA 1MXGA 3APGA 3B9DA 3AMLA 3W24A 5E6YA 2ZX6A 4JHOA 3GNOA 2J77A 2E3ZA 3GBEA 4W85A 3TP4A 1MFVA 4Z2LA 5ABFA 2ZUUA 1OGSA 4OIFA 5IDIA 2J7FA 4DWSA 1E6NA 3B9EA 4UZUA 3IJ8A 4MDPA 4F9DA 1CGWA 1SR0A 1JDCA 1B3YA 4J3SA 1ZJBA 1QHOA 2V38A 2J7GA 1DHKA 1WZLA 3LPOA 2IXVA 1PZ2A 1C92A 5I23A 3K8LA 4CVUA 4L4PA 1BF2A 2GJPA 4IPLA 1E6ZA 1HJSA 3WNLA 1V3HA 4PMYA 5GQBA 4AEEA 2CKSA 3TA9A 1VENA 2Z1KA 4C7DA 3VD5A 1TR1A 2A3AA 1CENA 2D0HA 1UKOA 2GVYA 3VDBA 1G0CA 2BY1A 2PWGA 4ZE4A 2VZUA 3AHYA 3ZSSA 3RCNA 1H41A 3ZT7A 3NYDA 3VGHA 3SUTA 4F66A 3WQWA 2FGLA 2XVNA 2VX6A 1PAMA 2D24A 1KFWA 2J4GA 4V27A 1MFUA 3F5JA 4CKQA 3AXIA 3THDA 4PSPA 1XV8A 3T0BA 5BROA 2EEXA 2WKGA 3FHQA 1JYXA 5IHSA 2JEQA 4MNMA 4UTFA 1KXTA 3VM7A 1AMYA 2Y5EA 2ZUNA 1VBUA 2WZIA 1KGUA 1V08A 2GJRA 2ZOXA 1WO2A 1GNXA 2JEPA 1DWGM 1GOMA 4TVUA 4S3KA 3WQ5A 5E0CA 4U5IA 5HPCA 4NRRA 3B8SA 4ZE5A 1X6NA 3NUKA 4PYSA 2DGAA 3ARUA 4HPGA 1BYAA 3AICA 3AROA 1ODUA 2ZXQA 2VCAA 1B1YA 3CUJA 1J0ZA 3G6LA 5ABGA 1G94A 3WSUA 3IANA 5I0DA 3AFBA 3CZ8A 1EDTA 1UUQA 1PX4A 4P7LA 3L4ZA 1US2A 1DP0A 2CERA 3WIJA 2VTFA 3WH8A 5I6SA 1Q4NX 1W3JA 2J7CA 4J3VA 5BRQA 3VGFA 3VX1A 3PZVA 3DYPA 1WPCA 1JZ6A 1W2VA 3WY1A 4WJXA 4UOJA 5CPTA 3ECQA 5A6LA 2VR5A 4Q7NA 2DSKA 2WVUA 1G01A 1E70M 3PN8A 1QI2A 4PEEA 3W53A 4UZSA 3QHNA 4PMXA 1Q6FA 2XG9A 5GNYA 1UWQA 2WANA 4FF5A 3AXXA 1KXQA 4B3KA 4BCEA 1W3LA 4MB1A 3EDEA 5A8NA 1QBAA 4S3JA 4ZXOA 4R5EA 1FHDA 2CESA 1KQYA 1LG1A 3POHA 2BHYA 3W81A 2CEQA 2XHYA 4GZEA 1D3CA 5A6BD 1QNQA 5BXPA 1W9VA 3J7HA 1ITCA 3MUIA 2FH8A 2JE8A 1BTCA 3AI0A 2WCSA 4UQCA 1UKPA 3TOPA 3A4WA 1BG9A 2ZX5A 4D6EA 2WMHA 4ACZA 4JL1A 3AHTA 5HDRA 3WUBA 1C7SA 1H5VA 4JL2A 1C8YA 1EHNA 3DC0A 4CUCA 4PRWA 2XWEA 5FCZA 1B0IA 5HOSA 2AAAA 1JDDA 1AVAA 3ARVA 2Y4SA 2BVTA 1QI5A 3T0AA 1W9UA 2Y2WA 3IAQA 5LA0A 2YBTA 1J0IA 1EO5A 3SCOA 4WKAA 2VQUA 5EFFA 3EDKA 3VIFA 2X0HA 3RO8A 4EK7A 2ZICA 4M8UA 2E9BA 1LWHA 5A3HA 3TTOA 1V0LA 4MADA 1UQYA 4UFMA 1JD7A 1V6UA 4M56A 1V3LA 1X1NA 1WZAA 2PWFA 3DHPA 4CN6A 2GJXA 3EDJA 3AMKA 1E6PA 4D6DA 3VD3A 3F5LA 3AXHA 2C8NA 4H8UA 3ZSTA 1CXFA 3FW6A 2VC9A 4WSKA 3GYCA 5DMYA 2C0HA 2WHMA 4HZ6A 1UR4A 3ARXA 2DSZA 4ACYA 4NRSA 4LX4A 5D9NA 3MO4A 3BAYA 5D9PA 2G3JA 5HNNA 4AD5A 2PBOA 2J75A 1QNRA 1KBBA 4MNLA 4W7UA 3VOCA 1ISXA 2D20A 2W91A 2D1ZA 3MUZ1 3OGSA 1H2JA 5FOOA 4IUGA 3BXWA 1TA3A 3N11A 3WDPP 4GZIA 4AIUA 3AMCA 1GQJA 2PWHA 1PIGA 4GZJA 3MMDA 4ZFMA 1JZ2A 2AMGA 2DSUA 2MANA 2WC4A 3BAXA 2C7FA 3G6MA 2PB1A 2AOSA 3WDJA 1MQPA 4D72A 2YA1A 1B9ZA 1J9YA 2CHOA 2WVVB 3W25A 3VINA 1CPUA 2GK1A 3SCPA 1GQLA 3OB8A 2W62A 4M29A 4PMQA 1ZB5A 5IXEA 2CHNA 3RMEA 1HKKA 2EPMX 2Q8XA 1E71M 2XJ7A 3DHUA 2IUZA 1EXPA 1VFOA 2D23A 1JZ3A 1OB0A 2VMFA 4H7VA 4HMCA 5AC5A 3W26A 1JIBA 1J12A 1JL8A 3II1A 2VRJA 2WKLA 2V3GA
chains in the Genus database with same CATH superfamily
2B4GA 4PMRA 4LEQA 3A4XA 1WUEA 4WY0F 3V0TA 2MUCA 2GQ8A 2P0OA 3PK7A 2PDCA 3LLFA 1DJHA 3M7SA 3DX5A 4U2YA 4GIEA 4CCDA 1VP5A 3U8GA 3ME3A 3U4AA 2B7OA 5CLTA 2FVMA 2YL6A 3IARA 3KCJA 4HTBA 4YMZA 1H51A 3OP2A 3KBWA 2WC3A 4BQ2A 2G3NA 3WLRA 2D0GA 3MDWA 1HO4A 2ZDRA 2IPFA 3MWCA 1D9EA 4NXKA 3M4HA 5T91A 3RU8X 1QHPA 2VEFA 3M5YA 4LJ3A 1W1TA 5TQLA 4NX0A 2QGHA 1P6CA 2YCEA 3PC0A 2POZA 4LPCA 2ICSA 2WVVA 5CH9A 1SZEA 1XH2A 4V33A 3RMJA 4JX4A 4XO7A 1UQZA 3D3AA 1M53A 1VIZA 3D47A 3P93A 2VZSA 1YXCA 4M3PA 2BWGA 3CMFA 5AHNA 1W56A 4Q32A 4REQA 1KCXA 3RX3A 4DBUA 4LVBA 4GKLA 1TFVA 4LQ1A 4QFUA 2A85A 2YDSA 4FXJA 3BGJA 3GQYA 2DZPA 4WLCA 3E0WA 3VIHA 3NZRA 2EPLX 4IJCA 2C1IA 4M82A 1BG4A 3M64A 1O4UA 3PUDA 2A79A 1IGWA 1LTDA 5KEZA 2V9DA 3NVTA 1A5NC 5CC5A 1UD4A 4KS0A 4PUKA 4RZ6A 1I60A 1H11A 1EOKA 1M68A 2Y62A 3N29A 3LN3A 3ITTA 2D73A 3GTXA 4R7OA 1MW0A 3CHEA 3N3TA 2PDHA 4Z1AA 1GKPA 3WH5A 5JBEA 3QV9A 4B5NA 1OFRA 3A9IA 4J3WA 2G3IA 2JKPA 4AWEA 3S2MA 4LAUA 5ABTA 2J62A 4EPKA 1I45A 1UR0A 4L4OA 3QVQA 1XD0A 4GY0A 2G97A 4LB4A 2TPSA 1J18A 1U1UA 5AHFA 3B40A 1TIMA 3E49A 3BMVA 4N4PA 5AHEA 3B8WA 4GE8A 4FLSA 1EJVC 3W7DA 3UETA 3DG6A 1ZAJA 3SUUA 3L66A 1OZQA 5A6KA 3TXVA 2CC0A 3JVAA 4LVGA 4QX4A 4NJIA 5C7HA 3CL8A 3W02A 5ABHA 2A1YA 4QHRA 2XTKA 1JDEA 1L6SA 3BG9A 4I5XA 1E1FA 1SW3A 1VZWA 3TKFA 3TQ0A 4AZCA 5C7VA 3APTA 4FIRA 5F2LA 4LNYA 4IFRA 4REQB 3IIOA 1PBGA 1TG7A 2WVSA 3UZ5A 3MSGA 3T40A 1LOQA 1BPLB 3TVAA 3EYPA 3NO5A 1A50A 3H24A 2QIWA 3ARTA 4W7VA 1ISVA 5E09A 4TV5A 4MJMA 1V6YA 6ENLA 1MW2A 1KLZA 1CGUA 1QTWA 3W72A 1XI3A 1UR2A 3MP5A 3RRAA 3M6YA 2VGGA 5IFPA 4DXXA 5H8UA 2QLYA 4AF0A 3PUEA 4TV6A 3C2OA 3CQ0A 4C7FA 4O10A 1KBIA 3PSWA 1KFCA 1V6VA 3K1GA 2Z6IA 4UQDA 3ZOAA 1JXKA 3M5VA 3CWNA 1FTXA 1CLVA 3EB3A 1JG9A 2VVNA 1NP2A 3LQLA 1H7RA 2J9YA 3QMTA 1S2TA 4GI8A 1P0KA 1DTNA 1UWRA 3G0UA 1UH3A 3BGGA 3VGBA 2EJ1A 4LW7A 2OB3A 1MNSA 4O18A 3P5ZA 1JULA 4HK7A 1XSKA 3IUHA 1FXPA 4UR8A 1Q6QA 3U7BA 5I24A 1YXDA 1L8NA 3F5KA 1K6WA 3ARZA 1MQQA 1RK5A 5MHBA 1BQGA 3BOXA 3L68A 4LCRA 1F4AA 4CCCA 3PPCA 4PMVA 4O1DA 2CCRA 2UY3A 2FB3A 2PDUA 4H8VA 1XQLA 1ZNNA 2GLKA 4QDMA 3C0JA 1A5MC 1KRCC 3R13A 1JYVA 3S1UA 1CT5A 3DIPA 5D04C 3V5CA 3O63A 4UTIA 4ASTA 3MHGA 1V02A 1HL9A 4MIMA 3PJUA 4QE5A 1N8IA 1UR9A 3PZQA 2E1DA 3VMOA 3MUY1 9XIAA 3W2JA 3ARRA 4MJ2A 4N9CA 2B0MA 2O9OA 3GDMA 1BYDA 1DWJM 1GVOA 1F2JA 4S38A 3WYZA 3QR3A 3WF3A 1Q5MA 2D2GA 4QCEA 5BXSA 1XH1A 5DBTA 4O53A 4NYYA 1VJIA 1W9PA 1HKMA 1XW8A 2C1GA 3EAUA 4LYPA 1K8YA 3EWUA 3EWXA 3SCWA 2UWFA 4GACA 4FXSA 3BPWA 4QJ1A 1VPQA 4US5A 5CJMA 1VPXA 5HINA 4DX3A 4DJEA 1A5UA 1GPWA 2V5DA 3AS0A 4JGDA 2AGTA 7A3HA 4W86A 4UNKA 3ZS4A 4JFTA 2X1TA 4HYVA 3EXSA 4PTVA 1FDJA 1OGBA 4GJIA 2ZZ1A 4RXFA 4YS1A 4L1XA 3FIGA 4P2VA 5GNZA 1E5NA 2DT2A 1SR9A 1YBQA 3W7QA 2E25A 1KFEA 2CKRA 3VIIA 3DFYA 1G4SA 2FGBA 4LT9A 2NXIA 1OD8A 1GOIA 2E4TA 4MTVA 1AJZA 1AMKA 4J7RA 5AVHA 1VYPX 1ME8A 1JRCA 2ABBA 3SRKA 2V8ZA 4XZIA 5HWJA 5K9CA 3QQ1A 3UWWA 1H5YA 4AWTA 5CQ1A 1JUBA 4L65A 1HQTA 5CPSA 3BCFA 1UWTA 4QAIA 4IMFA 2F7FA 3LD5A 2HCVA 3QGKC 1MW1A 1N8WA 1THFD 2A3LA 3H22A 4M51A 4H19A 1PCWA 2ZWYA 4EX4A 5E1QA 2VELA 5FEWA 2WNZA 1WYIA 3VMNA 4C91A 2FQIA 4JTGA 1IWBA 3E9AA 4E2VA 1GW9A 1TUXA 3A13A 3EOEA 4NJGA 2QF7A 3H7VA 3P2VA 4JIIX 1TWWA 1WAWA 4S2CA 2QJIA 3KDNA 2CYGA 3BLLA 1OABA 4AISA 3TYAA 3WDRA 3T08A 4TXEA 3LZ3A 1W3HA 1YEYA 1ONRA 1E4NA 1SGJA 1EX5A 3C2RA 3B0PA 4FR1A 1OCQA 3S8HA 1Q6RA 2XWDA 2HE5A 3WFAA 5FI8A 2EF9A 5BCAA 3MJMA 3VGGA 4AMAA 1CXIA 3S83A 1GOOA 3AWNA 2BV9A 1MEWA 3WEOA 4IP4A 4CEXC 1LQAA 2BOGX 3HMJG 3NSMA 3FDKA 5DXYA 4UTLA 4PA8A 2PDNA 4HBKA 4GFIA 4QCFA 4TR9A 4HPXA 3P60A 1RY8A 4YN5A 1NAL1 3B3DA 4KQNA 2CXGA 1RPKA 2XFWA 3AHVA 3TJLA 3GVGA 1Q7QA 1SO6A 3B0VC 4M0XA 4RKAA 4R9OA 3ITXA 5EMMA 1WDDA 1TPWA 5HNTA 2R1LA 4X2PA 2O4QA 1EP3A 4HD5A 2CLLA 5I77A 2PTZA 4QSFA 1R9XA 1RP8A 3N18A 3VDHA 4BI6A 4Q7BA 3U6WA 1QDSA 1EZWA 1U30A 4RW3A 3UCDA 2A6NA 4GNVA 4AWUA 4MFEA 1UUOA 4G6CA 2V6AA 5I3FA 1CDGA 2OFJA 3NQDA 3NXLA 2OWCA 3HF3A 4YTUA 3K4DA 2PRMA 3GXIA 4X60A 1HX0A 4HMDA 1EIXA 2EHHA 4MF4A 2PC4A 1XGZA 3GTNA 5DRIA 1R3SA 2HK0A 2OGYA 2BS9A 2FPTA 3DFHA 1RK6A 3AXMA 1W1B1 2E6FA 4POCA 2E40A 3QXBA 1ODZA 2O7SA 3G3MA 3FA3A 1OFEA 1K3UA 3S5YA 1YNQA 3DYMA 3S2CA 4JTQA 1KCLA 1M5WA 3UP8A 3MKKA 2CU0A 3KFTA 2WWDA 3LSBA 1NTHA 4N42A 4N02A 5BWFA 1ZBVA 1NDZA 2J74A 5M17A 4OUEA 2ZRZA 3AIQA 2QDEA 4MB3A 1VYSX 2CITA 1OFBA 5A8PA 4D1JA 4DBEA 5C6MA 1I8JA 3NOEA 1WB0A 3W2LA 2ACQA 3WLHA 1ZAIA 3LLDA 2ZC1A 2UY2A 1FP8A 3URNA 1H1YA 2OLSA 1JCYA 2ZXBA 4LC8A 3ZJKA 2Z1SA 4OJYA 4MWAD 3WBYA 1Y7VA 1XJBA 2GVLA 3TLQA 4H04A 4AZ6A 5CKSA 3W1PA 3BOFA 4HOZA 2G8ZA 4D1IA 2BFGA 1TPDA 1YMYA 2WNNA 5FIPA 5G4EA 3EBVA 3MV01 1SZNA 1XINA 2VRKA 2WWCA 3IEBA 3OZMA 1P4CA 4LY8A 3BJSA 3UVAA 1VFHA 2WMGA 2ZKMX 2ZZ2A 4U33A 3H54A 4A4AA 1E4MM 2Z1VA 3QYQA 2ZUVA 1VKFA 2RDWA 1R8LA 3ZM8A 3F03K 4A3QA 1J0JA 4JIRA 1AJ0A 2OVLA 1JZ4A 3ZVIA 4GX8A 2VI0A 5FF3A 2PDGA 4WY0B 3L23A 5D30A 3M16A 1XSIA 5A8MA 1GEQA 3U2EA 2X40A 1CGVA 4AH7A 1PUDA 1NWRA 3ORWA 5AYBA 5HQLA 3QLDA 4RE4A 1QPKA 1CXHA 3WD1A 1D3GA 4HKPA 2AQOA 5ABEA 4IWWA 4B15A 3BMWA 1F6PA 3HU7A 4P7RA 3LHVA 1UBPC 3IRSA 2H8XA 2OYMA 2P53A 2QVHA 1FWAC 3G8RA 5HBFA 1Q8JA 5T26A 2JQXA 4YHGA 2O92A 4FNPA 1O66A 3AS2A 4KIRA 4C6DA 4UCGA 2AQWA 1IT0A 3GNXA 3RDKA 2Z1XA 2ZTKA 5EKYA 2PBGA 1JZ8A 3ABSA 1FH7A 3GRIA 1GGOA 4AU0A 2IW0A 5I3IA 2DUAA 2QDHA 2CIPA 1GZGA 4GIAA 4HU0A 4BEUA 1ZS2A 3BZGA 2IMRA 3FFSA 4XWUA 1W91A 3M07A 2QMJA 4Z0SA 2DZXA 3A4JA 4EANA 4F9JA 3WD3A 1PEZA 2NQZA 4IZGA 4WR3A 1TTJA 3RITA 3NDZA 4ZENA 2YLLA 3GD6A 3RM4A 1M01A 3CK5A 4W5ZA 3EA2A 3AHXA 1R3VA 3WUGA 2OU4A 3KUMA 3CUFA 4KWUA 4C7GA 4B4FA 1VCVA 2QIIA 5C2CA 1CNVA 3NQFA 1NWTA 1VEOA 2HRWA 3ABOA 5HWNA 4GVGA 4RE3A 2XH0A 2DW6A 4ATDA 3H2EA 1XP3A 4LU0A 4J1OA 1ZP4A 3Q4DA 1R85A 2ZFAA 1TJ0A 1VAHA 5D05A 2JALA 1Y5VA 1A47A 3MP3A 1KRBC 1BTMA 4UFIA 4XTDA 5LIXX 5C9UA 4IGHA 3ZIZA 3O7UA 5AC4A 1F5ZA 5LHEA 2CBIA 1R3YA 4UTUA 1PKYA 3AISA 2PWEA 4FI4A 4JS3A 5I5RA 5CXPA 2AQVA 4XZ9A 5BWAA 4NT0A 4OFCA 3R0UA 3VAVA 3CAQA 2FZNA 2WMJA 3THUA 3UWQA 1CTNA 4XBJA 4BF9A 4DJEC 5IOBA 3GTIA 1V7AA 3WDIA 4FX6M 1CLKA 2PDWA 3ENLA 2J79A 2J8FA 1BAGA 2CLPA 3SCSA 3H70A 5IHRA 2DV0A 5LHFA 2VR2A 1MEIA 1O5RA 3A3HA 4CNTA 2PDPA 1C91A 3SURA 1J01A 1A4MA 1QI3A 1UWAA 4O28A 4KCWA 3FXYA 3GIPA 3F4CA 1TVPA 1V3KA 2XGBA 2OSWA 1ELSA 1NP0A 2OYLA 4DELA 1ENUA 3MI2A 3CUXA 5C5YA 5GPRA 1XCXA 4MB4A 4P7QA 3BH4A 1QXLA 1IXNA 1OC7A 4R9XA 1YDOA 4KEVA 2GK1B 3LY0A 3UEQA 2QJHA 1EUNA 4W84A 2ZC8A 3QC3A 4W4QA 3USZA 1F3XA 1TPH1 3U7VA 5AB3A 1US3A 3TSMA 2QCCA 3KZSA 1HNYA 3VNLA 3RNDA 1UYQA 1CI1A 1R0MA 3V1PA 3CAVA 4GBDA 1OBAA 1VR6A 1SUXA 3LS9A 4DPPA 4DM1A 1XS2A 4D6GA 3AUJA 3KOFA 1EJXC 3MA8A 4C1KA 4ADUA 4P8UA 2I16A 1TTQA 5AHLA 3PHAA 4JKLA 3V5FA 4YYFA 4LBRA 2A4AA 4M6UA 1W5OA 3TTSA 2WZTA 5JXQA 3JZUA 5CGTA 4P5UA 3OG3A 1JUEA 3SIMA 3FJLA 4IX2A 1AK5A 3UZXA 3MVIA 3WK1A 4QITA 6XIMA 2VYOA 1M3UA 5DFAA 4BFAA 2D3NA 3TNBA 1A5LC 5C8BB 4P8VA 2Q8LA 3TC7A 1VBGA 1E43A 8A3HA 1O94A 1EJRC 3TEVA 1SO3A 5FF0A 1Q4WA 2Y24A 2BXZA 3QW3A 1J0YA 4U2ZA 1Q6EA 4AX7A 2HNHA 1RZMA 2GYIA 4CNUA 3BANA 1IEWA 4IPNB 3N2CA 1JPMA 5CAHA 3LCWA 1OX5A 1XRSA 3BCDA 3VZYA 3UWYA 5LA1A 1V4YA 4HNOA 2P50A 3M1ZA 2XN1A 4DJDA 4O16A 4PUEA 3A4AA 2W3ZA 3UY8A 3QLLA 3PBGA 2R6OA 1BYCA 1V6XA 4MKNA 2YXOA 3TAOA 1CXLA 1LL7A 1H09A 2I17A 4PMNA 3UR7A 3CC1A 2OGJA 5I7GA 1ITQA 4LCQA 1MZRA 3B8DA 3CM4A 4LRSA 1GOKA 4ERAA 3EOUA 3P84A 4N0RA 1OSEA 4KGLA 1K7FA 1E73M 5D02A 4LAKA 1O60A 3L0NA 3QSTA 1YTEA 4N9BA 2WBKA 1DOSA 3KDOA 4G1NA 1EQCA 5CCZA 1JGMA 3WBAA 1KWGA 2Y89A 3C2VA 4M6VA 2ATMA 1E72M 5EMYA 2HPMA 3C6CA 4XZHA 1MVYA 1WXYA 3MCOA 4K7YA 1E3XA 3N6JA 4UQ9A 3UWZA 1DWHM 4LWWA 3R8GA 1NOWA 1WXZA 3VDGA 1AZ1A 1W3KA 3VVGA 2TSYA 1OYAA 3SQMA 3OVRA 4AIBA 3LYEA 4DO4A 1PKNA 3PANA 1OVDA 1UUMA 2WXDM 4PMDA 4UR7A 1NF7A 1VS1A 3S1XA 4KWWA 1V6WA 3IV8A 8XIMA 1C8XA 5DX7A 3T0DA 3W6MA 3K8KA 2V3EA 1TJPA 5XINA 5ABFB 2EPOA 4URIA 4UTKA 3GZAA 3V35A 4RCXA 2PLJA 1PYFA 3Q37A 1UP3A 4DWSB 2P5NA 1RSCA 3W2UA 2OEJA 3STEA 1G9HA 4GC4A 1MDLA 3UYIA 1X98A 2NT0A 1SZGA 2PGWA 3G3DA 4CCZA 5IFTA 1PZ0A 3GXNA 3H7UA 2OOGA 2RGLA 3GNPA 4OKDA 4FOUA 2UY4A 1PYMA 4HTYA 1S5VA 3LBCA 4LFYA 4MKVA 5A6TC 3W27A 1YDNA 4LUSB 3KLKA 3QPZA 4X0VA 1UBSA 2YL9A 2CLFA 5A8OA 3UZZA 1GUVA 3TN4A 3AMLA 3OO2A 3MI3A 2J77A 2PCQA 4W85A 5CC3A 1QFEA 1MFVA 3QM3A 3O05A 1RAKA 1RBAA 5ABFA 1TPFA 3M9YA 2QCEA 2F6XA 3EWYA 2C13A 2BGQA 4DWSA 1R2RA 2PLCA 5EMUA 4UZUA 3LV6A 3IJ8A 3M0MA 3BLFA 4MDPA 5D32A 4C6QA 1JDCA 4K8HA 1B3YA 1XLBA 4J3SA 2QCFA 1ZJBA 4XG1A 4XZMX 1DHKA 1WZLA 1P7TB 1C92A 3K8LA 3V7PA 3LK6A 3H4WA 1WUFA 1F8MA 1A5CA 3E5BA 1OY0A 2ZDSA 3WNLA 4HPJA 4FP1A 1V3HA 4PMYA 2QYGA 3RXZA 3D46A 4AEEA 3FOKA 2Z1KA 2ZZ7A 1N7KA 4QS6A 4LUSA 3KVKA 4JYDA 4H4IA 1TR1A 4GIRA 1W1IE 3ATZA 2CLIA 2J66A 1WBHA 3W1AA 2D0HA 2GVYA 5DCDA 5HQMA 3KP1A 2PWGA 4ZE4A 3XIMA 2VZUA 2VC6A 3EX6A 3RAOA 1TV7A 3RCNA 3NYDA 3SB0A 2Q71A 5DCEA 5HMEA 1KFWA 4V27A 1R9ZA 2FZ8A 2WPBA 3R6IA 2V2DA 3CIWA 3G1HA 3E02A 4NG3A 5CC6A 4AFYA 1XLKA 3GYEA 1JYXA 2JEQA 4ERGA 3I6EA 1AMYA 2Y5EA 2ZUNA 3UZWA 1WXJA 1P7TA 2ZOXA 2JEPA 4ALDA 4S3KA 1LROA 4HIBA 2VC7A 1NDVA 3B8SA 3HGOA 3NUKA 4PYSA 2DY3A 2O4MA 4S3AA 3ARUA 1XFCA 3WLNA 4IICA 1WKEA 1XIGA 4O4WA 4A6GA 5G1TA 1DP0A 2CERA 4YJ5A 4ZOAA 3TYDA 2VTFA 4OU1A 1W3JA 1Z8AA 2NLYA 2J7CA 3VGFA 1L2UA 3LM3A 3HGJA 1WA3A 3M41A 1W2VA 3WY1A 4WJXA 5F4XA 4UOJA 3QYSA 2POTA 4IOTA 3ECQA 3S2NA 3SBFA 2WVUA 4Q6JA 4I6KA 2I9UA 3FXGA 1T40A 4O1FA 4HCDA 5AHIA 2H3BA 3UPWA 4QJ4B 3SY8A 3P74A 3T8QA 3QHNA 4PMXA 4HU4A 3P3BA 3HG2A 4WJEA 3MHUA 4FF5A 1W5PA 3R11A 1VPYA 1UW9A 1W3LA 4UTTA 2Y5JA 4GVFA 4DB7A 3I7QA 1T96A 5CGQA 1IT8A 3CJPA 2QCGA 3W81A 2BHYA 4Y8FA 3SQSA 4MUPA 2XHYA 5MF5A 4GZEA 1IIHA 1ITCA 1ONWA 1FKXA 2FH8A 2R1MA 2JE8A 4EWJA 5CZ0A 1EA0A 1UKPA 3A4WA 2Z29A 1AH0A 4JL1A 2WJZA 1H5VA 4HJWA 1C8YA 4ECLA 3DC0A 4CUCA 3G2GA 4H01A 5EPDA 1XXXA 1F61A 2QCLA 3H2AA 2F2KA 3ARVA 2Y4SA 3T0AA 5LA0A 1E9ZB 3SCOA 4WKAA 1I2PA 3EDKA 2NV9A 4C65A 1AL8A 2X0HA 2XN0A 3QZ6A 2Z0IA 4M8UA 2E9BA 3TTOA 1V0LA 2OT1A 1ZLPA 4DRSA 1UQYA 4QTGA 3R25A 1V6UA 4M56A 3FVDA 1Q66A 4K1WA 1L2QA 1BXNA 4GX9A 2GJXA 3KRZA 2DU2A 3AMKA 2GSEA 3HG5A 3K5XA 5C54A 3F5LA 2C8NA 4H8UA 4Y9NA 3USBA 3BICA 1TV5A 4LVFA 5DMYA 3ZYZA 1UR4A 3L9CA 3NQAA 2Y61A 2BLEA 2DVUA 3IS4A 5D9PA 2PMQA 3S5NA 5FESA 4DF2A 1QNRA 4MNLA 4ZFCA 3QQWA 1X8FA 4EVZA 2D20A 1KM3A 3ES8A 2D1ZA 3VE7A 4F2BA 2CXEA 1H2JA 1MZHA 5FOOA 3BXWA 1TA3A 2GQAA 1P0EA 2YZ5A 1AJ2A 4F3HA 2OZ8A 2PAJA 3URQA 4C6NA 2C79A 1GQJA 3FEQA 3WZ0E 4UTMA 1PIGA 2C91A 5F4SA 3B97A 5HANA 5BNKA 1FWCC 2AMGA 4QRNA 2ZRXA 1JPDX 4ZOCA 3GU1A 2C7FA 4WDXA 3G6MA 1LOSA 1NU5A 2AOSA 1MQPA 3KS5A 1J9YA 2WO5A 1IEXA 1GQLA 3OB8A 4M29A 3LCLA 3W2NA 2IQDA 3H4GA 4LRTA 3B9OA 3KBVA 3S3GA 4NZJA 4H7CA 5AC5A 4C6KA 1MRAA 3VOHA 3NA8A 2QULA 1S2WA 3AIVA 4HNVA 1RJPA 4HMEA 4XK2A 4DJDC 3H8AA 4QLKA 4Q8PA 1EJSC 2B7QA 1DKWA 3O6AA 1UB3A 1E40A 4AD2A 4IIHA 2P76A 1Q85A 1FKWA 2NUXA 1GZJA 2X0YA 4BR1A 4I7UA 2XSAA 2FZMA 2CBVA 3PR2A 4AC1X 1V0MA 1AH3A 3KWSA 1E0WA 4AVOA 1UZ1A 2CBUA 3EEZA 4HZMA 3OHMB 4B9ZA 3T4CA 2QQ6A 3A9BA 4E8GA 1XYZA 4CLMA 1PV8A 1ME7A 4YCPA 1BD0A 2QJGA 1N55A 1DTUA 3IJIA 4RUBA 1KRAC 2RJHA 3CB8A 1NDWA 3EKLA 3HGRA 4XV0A 2IKHA 1BEUA 3NQ2A 2ZVIA 2PTYA 4MNJA 1DL3A 2W92A 4BQ5A 1KFKA 3LERA 4KFOA 3UYCA 1V0KA 2OYKA 1TCDA 3PY2A 4WZHA 2YZRA 3OGRA 1SO5A 3PWAA 3G1RA 4LH8A 3L2MA 3QZEA 3W7LA 1BKHA 1QNOA 4NSBA 3R5EA 1M7XA 1ZL1A 1XRTA 6REQB 3TX9A 4CCEA 2J8GA 4X9SA 3MANA 4A8LA 2PDXA 3N9KA 3OZOA 4G7EB 3HIJA 3QW4B 2O0TA 4GGHA 3P82A 2VP8A 3PJXA 4J3TA 4MDOA 5D33A 3FYYA 2Z28A 5GNXA 3VCNA 3DBNA 3TYBA 5D8ZA 2ISVA 2D2HA 1AW5A 3WMLA 2Z00A 3GX9A 4UTJA 2YJQA 1Q6GA 1K4GA 2NXGA 3UXIA 2KX9A 1YE4A 3VKDA 4FXRA 2O9TA 3ZO9A 2GDVA 4WDTA 3GC2A 2VQTA 3BSHA 3MZ2A 2WYSA 3N2OA 4L4MA 3CMJA 1JNDA 4ZO8A 4QEHA 3IK2A 2XH7A 1TTPA 4RLIA 3RN6A 4S1FA 6REQA 5CG7A 2GJLA 4PUUA 3MT1A 3HOJA 2OMAA 3ZR6A 4KT2A 4G7EA 4S23A 3ONBA 1ZCOA 4AY7A 1MO0A 2ATSA 1TPVA 1GQNA 2BNJA 1GKRA 3GAKA 4U4MA 2GWGA 3DDMA 2QHAA 3RCYA 2RDUA 1YPXA 4MY9A 4UMAA 4OGZA 1JJKA 1GOQA 5U7SA 2QXWA 5BXRA 1EA9C 3EB4A 1OK6A 1VC4A 3NDOA 3BLPX 4G9PA 4NNBA 3GG0A 1PDZA 3W1TA 4GHRA 4GI6A 3VXGA 3WLQA 2OLHA 3ARWA 3WLTA 2D3LA 1UJQA 3S5SA 2Y0FA 1NF0A 1LLWA 2WMIA 1H0GA 4F0MA 5FF4A 2Q01A 4FLOA 1H63A 2WW5A 4WDWA 1XH0A 1HP5A 3CUHA 2VGIA 1H60A 4GH3A 4KW2A 5BOFA 4AY1A 2DVXA 1HZYA 3AMGA 2VWTA 2FTYA 4OHQA 1G7UA 3NGFA 1IWAA 4TVCA 3LHUA 5GJNA 1Q2SA 4QS5A 1PHWA 3WQEA 4TQTA 2Q3RA 1L6WA 1M7OA 1TPB1 2J7DA 1QOXA 2FJUB 4HT3A 1E0TA 4HN8A 4PULA 1KCZA 1XBZA 1ITUA 3CTTA 2JGYA 1XL9A 1JXJA 2TAAA 3EPOA 3UNTA 3WF1A 3MVTA 3E0VA 2A0NA 1TWZA 2Y70A 1KGXA 3OLDA 3T55A 4W5UA 3EOLA 2RHGA 3GG8A 2NVCA 4LS0A 4XZBA 4ZL1A 4R88A 1JF5A 2BZNA 2HEJA 5F2GA 3UQNA 3CH9A 2V67A 3B03A 2A7RA 4KEMA 4DBDA 4H6EA 1H62A 6XIAA 1RD5A 3PZ9A 1NM9A 4KCUA 3WLOA 4INFA 3UBPC 2J7EA 1ZJIA 4TX9A 3KOWA 1ZGDA 3VNDA 4HU3A 4ZO6A 5D2WA 2BBFA 1JCNA 3E0LA 3OTRA 3W7GA 4MM1A 3T78A 4H9XA 4L9YA 1GG1A 4ORIA 4F4RA 3V5OA 1H0IA 4NJHA 5CLWA 4PUNA 3LTSA 4I5UA 2HVNA 1TZZA 3P8JA 4HCHA 4XSMA 2XM2A 1NFGA 4IXXA 4NX5A 3A3XA 4Y9OA 3HPXA 3EZ4A 4GO8A 3E0FA 5AY7A 1W1PA 3G1AA 1E56A 1E0XA 3ZT6A 1OQFA 1JQXA 1ISYA 3SFKA 3JZEA 3BURA 3PNUA 3KBMA 3ALGA 4UTTC 4RZBA 5CPOA 1Y65A 1B3VA 3WLMA 5KETA 5D9MA 2OSXA 1E9YB 1VCFA 3GS6A 2GSHA 4Q8MA 3AIRA 4JX5A 2DZWA 4AD1A 4PBFA 4JTKA 3W38A 3WUEA 2BHUA 4GYPA 3F1QA 5DY3A 3W85A 3ZFHA 1OFOA 3EB2A 3H23A 3GHTA 3K8MA 2GVEA 2QCNA 1FP9A 3NSNA 4H2CA 5AC6A 5AVNA 4M1RA 3H4XA 1EP2A 4FX8A 2Z2AA 3ZZ1A 1R7OA 1J79A 2NV1A 4YVXA 5AC7A 4B16A 1J2WA 1LL4A 4RNHA 2PDIA 3TOYA 2VGFA 2G0WA 1UR1A 2C0AA 3ZJ7A 4AWSA 5G1YA 3L12A 4F0RA 1WDWA 4DO6A 2HBXA 4QXIA 3NIYA 3HV9A 4XD6A 1EB3A 1WE5A 1W54A 5HMFA 1GCYA 3ATYA 2EO7A 1J0HA 1G4PA 1EF2A 1AW2A 4NZCA 5FSDC 3IIPA 2ZX7A 3N9SA 1MUMA 3W00A 2CPUA 5G4HC 4BS0A 4UQEA 1M41A 3UJ2A 1HJXA 3BG5A 5H1WA 4LALA 5TD4A 2XFFA 4TMCA 3DGBA 3LNPA 1CECA 1BFNA 4IQDA 3KHDA 1YTDA 1DJZA 1HO1A 2AL1A 3LZ5A 1EYEA 3C0SA 5KITA 4Q8OA 1W9BM 1SFSA 1XQKA 4ZQRA 4OOZA 3QPEA 3LBMA 1TYGA 1X7FA 1ECQA 3BJFA 4Z1CA 1GHSA 2R1PA 4GJJA 3CZKA 2IPWA 2ON3A 2VWSA 4JBRA 2NSOA 3SJ3A 3A12A 5HR7A 3G1XA 2VX7A 3W6LA 4WD0A 3U2CA 1R6WA 3BAJA 1H7PA 4JIEA 1XSJA 5I07A 4DZAA 3BQ5A 1RQEA 3BSGA 2XISA 2PDYA 3AMDA 1BHGA 3KVLA 5FEPA 4X9YA 3Q2DA 4JCMA 2G3MA 4R33A 3CZJA 4X0NA 3MW7A 2DSWA 4DZ5A 4WDUA 2EG8A 1W1ZA 2VCCA 4E2OA 1BVNP 3H2MA 3AQUA 3N4AA 1F4HA 5JMUA 3IAPA 2R94A 1W32A 2PPGA 2X30A 4UR9A 1KTCA 1A4LA 1A3HA 3WL1A 1EF3A 4Q8NA 4JTUA 1ISZA 4LAOA 1QR7A 3TJXA 2ACRA 1PKMA 1LRTA 3W0KA 3TFXA 3B8VA 5A1AA 2Y8UA 5FF7A 3CTLA 1TVLA 3CT7A 2GVGA 3K4AA 1Q13A 3NGJA 3NDYA 1U1JA 1O5KA 1MW3A 1YTKA 5DN1A 5ECUA 2ISWA 1S1PA 4E4PA 3VDCA 3R10A 1E6SM 1EJWC 3CZGA 1TZ7A 2H6RA 4WRHA 1CX9A 4W88A 1KXHA 3EDFA 4LVDA 3BAWA 1BGGA 3HTWA 4B4HA 4WVXA 1Q7ZA 2C18A 2V2HA 2NVDA 1WV2A 1JPIA 1ESWA 1QNVA 1WQ5A 3ZR4A 5AYXA 2OPJA 3FJ4A 3SCVA 1QWKA 2YYTA 4OBTA 3KX6A 3G1YA 1GPFA 2OG9A 3E12A 3SY1A 1KM0A 1O12A 3ZR5A 1V6TA 4NAEB 4DUWA 3OVQA 1KM6A 3B04A 4ZO9A 4JQ4A 3VUSA 3CHCA 1NOFA 1YPFA 1SW7A 3LCIA 2NQLA 1ALDA 5C9RA 3PVFA 2NQJA 3W7KA 3KP0A 3GDLA 1IZKA 1RQHA 1XLJA 1HVXA 2NQHA 4GXMA 3CPRA 3RYSA 4TOQA 4U5KA 3EKZA 3VGDA 3ERPA 2Q02A 1ZU8A 4CNNA 3G77A 2HVOA 4IJRA 1E0VA 3OLGA 1XIDA 1XD1A 2L5HA 3CUIA 4BK9A 3B8IA 1K8ZA 2RGMA 4JR5A 1GORA 4D8ZA 3CBWA 3WLKX 1VF8A 3W6YA 3W7CA 4UFHA 1QPNA 2W27A 1X6LA 1LQ0A 4NAEA 3GM8A 4XSLA 3TZNA 3DKJA 2J7BA 5IDZA 2E1WA 4RPQA 2XZ7A 1VFTA 4RE0A 3ABQA 3AU6A 6A3HA 1W3TA 3VNMA 2E6AA 2OODA 2YFNA 1IXQA 3EMZA 1EDGA 1U5VA 4JTJA 2DIJA 2Y6ZA 1J93A 4JQAA 3BQ6A 2V2CA 4BHYA 4KETA 3LGEA 2QMKA 4EIVA 4JNMA 1TPUA 1X38A 5J5RA 1HJVA 1EGZA 3VGEA 2W63A 4AD3A 2HK1A 2OKTA 3WDHA 4Z2KA 3N2BA 3WLJA 8TIMA 4JHZA 1PTAA 1XLLA 1JPKA 3ZT5A 3LMZA 4A3HA 1ML1A 3UJEA 4JN8A 1HFBA 2ADAA 4E3VA 2NVAA 3CQHA 3QHMA 4D9PA 1SVDA 3GVRA 4FOJA 5DELA 4H41A 3O1NA 4YYCA 3MB9A 1HJUA 2WOQA 3W28A 1T41A 1O68A 1JDAA 3CEPA 4B5WA 2BSLA 4IGSA 1D7KA 4LF1A 1BXCA 1LLOA 1UP0A 4MWAC 3U57A 5BOEA 3N13A 3CT2A 2DZTA 1Y5WA 1CGXA 2PUZA 1GJPA 4HHMA 4MB5A 1UWIA 1DXFA 3ZJ6A 3COTA 3UY7A 1ADDA 2W0UA 2XINA 5DMNA 3L7RA 4NVTA 3PUGA 1PDYA 3KHJA 3I3DA 5J8LA 3S46A 3AIWA 2VHLA 5AC8A 3NQ8A 5FSEC 2EKGA 2ASHA 5SWUA 3SCQA 4B90A 1HW6A 4MJ4A 4OE7A 3BK0A 1ZTVA 5A6AA 3LLXA 3QRHA 1J2BA 4LS1A 3LX9A 2YCLA 1PB0A 2HMCA 5JUVA 3W37A 3VZZA 3GU2A 2W66A 3INPA 3WBXA 5FL0A 5HXMA 2HTMA 5CSYA 1V7YA 3PJTA 3ITLA 1GVFA 4CVWA 1GOWA 3LMYA 4LV4A 4ZEPA 3AWOA 2XIBA 3U5UA 1EWDA 1YDVA 4IX0A 1OFAA 3UR8A 4Q7IA 3CEUA 4HPHA 2VRQA 4Z08A 4Y96A 1NDYA 2CETA 4HN4A 5T9CE 2PDKA 2ZUSA 3GNDA 3NL6A 1E1CB 3RO6A 3CHFA 3CV2A 4IGMA 4FA3A 4WF7A 3NZ1A 1CGYA 4AZBA 4UCFA 2Z1WA 5EMJA 4UBPC 4TTUA 3A21A 3GKFA 1FBAA 2EG6A 3BLDA 5CZKA 3ZLHA 4EE9A 3Q94A 4TTGA 4CQCA 4MZ1A 1AUSL 3BSMA 5FEXA 3G0XA 4QSHA 2CNCA 3VNYA 4PUMA 3OW1A 4J3UA 2I7GA 1PVNA 3ZWSA 1BVWA 1JF6A 4C1NB 2Z25A 4QE1A 4LANA 4PTNA 3CHDA 3GE7A 2IPGA 2HVMA 2VZVA 1G6CA 4IQEA 1FWBC 2ZADA 1XF0A 3V3WA 2XU2A 4CU6A 1KM4A 1H50A 3U9IA 1O5XA 3NXFA 2A3BA 3SY5A 4JOMA 1TV8A 2FB2A 3AIBA 1GQIA 1ISWA 4KESA 5A2AA 2GVJA 2YXXA 2QUNA 1A0EA 3KVMA 3K1DA 1E1CA 3SUVA 5JBFA 1F73A 2CWXA 1SFJA 4FNQA 3UZJA 1KKRA 1MSSA 2V30A 2JKAA 1EBHA 1UD2A 4YHEA 1LT7A 5A6JA 4IG2B 1KBKA 5EBAA 3GVWA 3AJXA 4ICMA 2E5CA 1FFRA 3BE7A 4ILSA 4UNIA 1MNZA 1KBJA 1QPRA 3TXZA 1KW1A 1SM9A 3SO7A 2CBJA 3GFYA 3N9RA 4JTSA 1KGWA 2QNEA 3WD2A 3ZMRA 4F48A 3E5PA 1LWIA 4CGTA 1X6UA 1MRQA 2XIIA 1S1RA 4GUGA 2OSYA 9CGTA 4KBXA 4UFLA 4QQ3A 5G4WA 4LF2A 4RPPA 4B2DA 4AD4A 4BQ4A 2BVWA 1LWJA 5C9ZA 5CAKA 3LRKA 1QI4A 1ADSA 1WDSA 2PI6A 3N19B 4DBWA 1DQXA 2OZ3A 4PUJA 1DXIA 2PF8A 3QZAA 4YLWA 3S6TA 4D8AA 3CO4A 1R86A 3VIPA 4CD5A 3PB2A 1P48A 1QWGA 2HV5A 1DJIA 3NQEA 4IG2A 4X3ZA 4HOWA 1TVNA 4NI8A 3BDKA 4E5TA 1LP6A 2KZHA 1ZJHA 1UP2A 1GTHA 2ZX9A 3TV8A 2ISFA 1X97A 4EAMA 4Y9PA 2QAFA 4PR4A 2VEMA 2Z27A 3U4FA 3QMSA 2EPNA 2WNWA 4L9ZA 3MYPA 2BB0A 4JKMA 1JFHA 3CZLA 1FFQA 3VABA 1MMFA 3QEZA 2V5CA 2WM0A 4XB3A 4ADSA 3OIHA 2Z7GA 3FSUA 1D8CA 3F4NA 1VCGA 3T2QA 5B80A 1ME9A 2GGIA 4GUFA 5E70A 3URAA 3GLCA 4TX6A 1V3IA 5F1VA 1C8VA 3KTSA 4DZHA 1RLDA 1U2YA 2VT0A 3Q67A 4D6CA 4MYXA 1TV3A 2X09A 3C2FA 3LTYA 5LA2A 1Q6OA 4GNKB 1LL6A 4AZ7A 3POCA 5I78A 1PX3A 2O7QA 1VD6A 3C86A 1EIBA 3WELA 3AXKA 3STPA 3QY6A 1GONA 1RCXB 5FD0A 3WUFA 5A6SA 2NT1A 3GDKA 3QJAA 4RDWA 3WK0A 5JU6A 3URBA 3M0YA 3MMUA 2E28A 4G7FA 2NLIA 4F0LA 2EAWA 3N25A 3SR7A 5FJRA 3LEPA 1AL7A 2OELA 4RZ5A 3ITGA 4NHVA 2CZFA 2WSRA 3UXAA 1M7PA 3V4BA 3QBUA 3OYZA 1IZJA 3T2PA 3NZGA 4YCOA 1VLIA 3TQPA 2HQAA 1VFSA 3GH5A 3M5XA 5D2YA 5DLCA 2VEPA 2AL2B 3DFQA 3DG7A 1F07A 3M0HA 4W7WA 1E5JA 3OBEA 5HQEA 1EKOA 3CWHA 2PS2A 1EJTC 1FCQA 2DZSA 3LV5A 3IGSA 5F4WA 4JQ3A 4FSAA 5I3JA 3KOYA 5D4YA 3LCFA 2XFYA 4OVXA 4YVPA 4IMAA 4IMEA 5DRCA 3NQGA 4RR4A 1TKKA 2ZXAA 1KM2A 1MI3A 1E9LA 2XVPA 4IPIA 3DOPA 1E6RA 1B4EA 3IUDA 2DZAA 4OTKA 2YYUA 1GKQA 1F6KA 1I2OA 3NPXA 3GR7A 4I8YA 5A95A 3SCRA 4RL3A 4IL0A 4XKYA 1TR9A 4UOQA 3MY9A 1J0KA 3EEGA 3BZJA 3OA3A 3FSTA 3L4TA 2AL2A 4JQ2A 3WEMA 1U33A 3VKAA 4MAZA 4XX6A 1UD8A 1XYCA 3IJDA 2ZUTA 4DUVA 1J5SA 4Q4RA 4F2UA 1X96A 3WD0A 1GJUA 4U3CA 4ONVA 4AZCB 3GW0A 1BLIA 5G2IA 2XM1A 5I00A 2O9PA 3TTYA 1POJA 2DDXA 3FA5A 3UERA 5AN7A 2PFHA 2XVGA 4NY2A 4ZTYA 1OJXA 1BWVA 3R0KA 2E9LA 4GABA 3VIGA 4ORMA 3LXAA 2PTXA 5B7YA 1GG0A 4LXFA 3CGTA 1K70A 1P1MA 4NKCA 3P61A 3SN1A 3SCUA 4FHAA 1PX8A 1EBGA 3MMTA 3M0LA 4QROA 3BO9A 3LPPA 3I3BA 2Q6ZA 1WCGA 2VNCA 1MXGA 5CZTA 3APGA 2PZ0A 4N7QA 3W24A 2VDHA 4DLMA 5F2MA 4MKSA 2ZA1A 5KZDA 4DXKA 4AF0B 2C71A 4AYGA 3N6HA 4LUYA 3NQMA 9RUBA 3W7NA 2V82A 3DCPA 3QGAC 4IQJA 1YRRA 2RH9A 3REQB 3NPWA 1M7JA 4O15A 4RW5A 1KO0A 4ZOBA 3PS7A 1IE7C 3FVMA 3DI0A 1RBOB 5DMLA 4C6BA 3WK2A 4AQLA 2IQTA 3KCLA 1EFZA 2P8CA 4L4PA 1BF2A 2GJPA 4IPLA 1G7VA 3W1UA 3E2VA 4QE4A 5GQBA 3TA9A 1R3QA 4ROQA 2R14A 5EBUA 1VENA 4NUWA 1P5BA 4GUJA 3VC6A 2Y63A 3VK5A 2GJNA 2OEKA 4JEJA 3RPTA 1UKOA 2BY1A 4I5RA 3AHYA 5HJLA 3KM8A 1BSLA 1H41A 3ZT7A 1PWLA 3S1GA 4JY8A 4DUOA 1PAMA 2D24A 4R7WA 3CO8A 1FCUA 3AALA 3THDA 1XV8A 3T0BA 2DW7A 1GK8A 2EEXA 3REQA 1H61A 4XTIA 3FHQA 5IHSA 3Q58A 4MNMA 4UTFA 3VM7A 3F2DA 2VFHA 3CV7A 1WO2A 3QR1A 4TVUA 1GOMA 5CSRA 4GYFA 4HK5A 3DEQA 4LBSA 5EMKA 3PG9A 4U5IA 5LXXA 4NRRA 4CQ8A 4ZE5A 3SDOA 2DGAA 1BYAA 1F3WA 2ZXQA 3CUJA 1J0ZA 3G6LA 5ABGA 3IANA 3AFBA 2X1RA 3B9NA 3U48A 1KBLA 4TMBA 3B05A 4P7LA 3L4ZA 1XIBA 1US2A 5DMMA 3WIJA 4BI7A 5IBXA 4JN6A 5JH2A 4US5D 3WH8A 3M0XA 1Q4NX 2G4JA 1V93A 3W7OA 4DJED 3TYEA 3PZVA 3DG3A 4RNIA 1WPCA 1JZ6A 2BASA 5A6LA 2DSKA 1R47A 1E70M 3T81A 5JH1A 3IRDA 3LUTA 3MKVA 3M0JA 1KFJA 4Q8WA 5EA9A 4UZSA 2XG9A 5GNYA 3V75A 3PPFA 5FA5A 3HM7A 1UWQA 2WANA 5J5DA 1QCWA 3AXXA 1KXQA 4BCEA 1YBQB 4I9AA 4MB1A 3O0FA 3PULA 5A8NA 5C2XA 4S3JA 4ZXOA 5D03A 4ZB5A 2CESA 1KQYA 4JN7A 3POHA 4FALA 2CEQA 4L1WA 3W23A 3WJWA 3FDGA 1ADOA 1QNQA 5BXPA 3J7HA 4QQUA 1O1ZA 2XSXA 3KW3A 1PSCA 3AI0A 4UQCA 2INZA 3ITCA 3TN3A 1BG9A 3NQCA 4UIOA 1YE6A 4YL2A 4D6EA 3WQFA 4ACZA 4ZZ9A 2J6VA 3M43A 1JR1A 4NZ4A 3TH6A 1C7SA 3W7JA 4YU1A 3O6CA 2YBVA 5HOSA 1NEYA 2PDMA 3VKJA 2WJFA 3PFRA 1X7IA 1QI5A 1S3TC 2GUBA 5F1UA 2XIOA 4DO5A 5D2VA 3IAQA 2YBTA 1M6JA 1C29A 2F9RA 3BJTA 3IJQA 1WX0A 4Z0JA 3BWWA 3VIFA 1G67A 1QK0A 1T6MA 4EK7A 1O5QA 2ZICA 1FY6A 5BRBA 2ONEA 2W9MA 3PPHA 5A3HA 4PZVA 4GY7A 4X63A 3RLGA 5GJMA 4GY1A 3PBUA 1BWLA 1V3LA 1X1NA 2BGSA 4HB7A 3NEVA 4GK8A 5CJNA 4DI8A 3EDJA 1EZ2A 4D6DA 3UD6A 3NO3A 4B3ZA 4G2DA 3AXHA 3ZSTA 4FX7A 1I2RA 1REQB 5ENLA 1XLCA 2ZA2A 5LNWA 3TFCA 4HZ6A 4IXHA 2BOEX 1LBMA 4NRSA 5D9NA 3MO4A 3BAYA 2G3JA 4AD5A 2PBOA 2QS8A 2J75A 3W1QA 2PEVA 1LM1A 3BCJA 2FKPA 5LNSA 3PF3A 3G8EA 4WOQA 5AFDA 4IIFA 4IMGA 3TLLA 1X1OA 4IUGA 1FDZA 3NZQA 3LGGA 3N11A 1T99A 3WDPP 5J04A 2YB1A 2YB4A 4GZJA 1GYLA 3OQEA 4ZFMA 4ADTA 1IGSA 1TO3A 1OF6A 3ONCA 4EWND 4JTIA 1EEPA 2C3ZA 1B9BA 3SSZA 2MANA 3BAXA 3DFOA 5BMXA 4GIYA 5LIYX 1JVNA 3PBWA 1JDFA 3W25A 1Q8AA 4XZLX 3VINA 1CPUA 1LBLA 2ZRYA 1W37A 4PMQA 5IXEA 2CHNA 2DFAA 1LUCB 4ZBCA 2QPXA 2EPMX 1E71M 1REQA 2XJ7A 3PTDA 4H6RA 2IUZA 2BX7A 1JZ3A 1QOPA 1J12A 4NNCA 1QW7A 3II1A 2WKLA 4L5ZA 3GVQA 2V3GA 4QG9A 4FMVA 4FLRA 2PF0A 3W74A 1DPMA 1YX1A 4NF7A 2QEZA 4AW7A 3W71A 4FR6A 4J5NA 3DYOA 1OX4B 4YWSA 3TYZA 1OINA 4BF5A 2DH3A 2JK2A 4EPDC 4MSSA 3IACA 3K30A 3PWGA 4IQLA 3MQTA 2JIEA 5M2FX 3CU2A 2GGGA 3TYCA 1QNSA 3I6TA 4PTWA 4TUFA 4MFDA 2VXNA 1QO2A 3MCNA 1OIFA 1NELA 1DE5A 1VFFA 2XZ9A 7CGTA 1A49A 4NU7A 3E38A 1RR2A 2WZHA 1Y0EA 3LHYA 2Z2UA 4HOXA 1LUCA 3W86A 1AA1B 2RJGA 4HHPA 3OPSA 2XH2A 2X2YA 2VO5A 2PGEA 4J4KA 1UC4A 4HNUA 2DT3A 1UKQA 1UPMB 3A5FA 1SU5A 3D0CA 3EGJA 1IEQA 2FVLA 3N15A 5LGXA 1OX4A 3G5EA 1P1XA 4GGBA 2PRLA 4QM1A 3O6YX 3FN9A 4ML9A 1GOXA 2QZRA 1KQZA 3AJ7A 3BLIA 2VEKA 1EGMA 4DAIA 1VB9A 3RR1A 4CQAA 3VILA 2VZTA 3KL3A 3AAMA 4PFHA 2HZGA 4XD4A 5KTLA 1U1HA 1IR1A 4ATWA 3HFTA 4OWGA 4XIAA 4DEFA 3E0IA 2CLEA 3OODA 4QBXA 1QW8A 3AYSA 2CWNA 1NJJA 3WQPA 4K1GA 2ZWZA 2JFEX 4NJJA 3WQVA 1UH2A 1Y5XA 4MVAA 1SZRA 3IK4A 1RBLA 1DJWA 4GQBA 1XBXA 1R7AA 4DYKA 2A21A 1B3OA 3WK3A 2JKEA 5U4NA 2DIKA 4C5ZA 4DN1A 4WHBA 4PH6A 1IXOA 1LJYA 5F7UA 4IUOA 1I75A 4GOAA 2D2OA 2EXOA 3GHRA 1KNWA 3EOOA 4KWSA 4MZYA 3QV6A 2FZDA 4KRUA 4IISA 1VEPA 4E4UA 4JKKA 2J25A 1E4IA 1BGAA 4O0ZA 4M7TA 2W67A 4Z17A 3QFWA 1UG6A 2G41A 3HBLA 2WMFA 2J7HA 3AS3A 2BVYA 3AOFA 4TX8A 3UG3A 3E74A 2WHJA 3CS2A 1DJQA 2DP3A 1FWEC 5E6ZA 2YW3A 3C4UA 5FKYA 1TWDA 4ZA0A 3DHFA 4JFWA 1J8VA 2FHCA 1TRDA 1VEMA 1FH9A 2YL5A 3B06A 3L4WA 1GWJA 1FWTA 3IVUA 2WZEA 2LLEA 5DXXA 3H7RA 3GFZA 4R85A 4P8XA 2FMOA 1PXGA 5H91A 3PZUA 3E96A 2Y7DA 4YWIA 2E5DA 3TUUA 4FNSA 5CG0A 3R0DA 3KAOA 4RK8A 3GDBA 4IIBA 1N2VA 2Q8ZA 2RAGA 1T8XA 3HQNA 4C6JA 3TMLA 2BHZA 4BQ3A 4TVDA 4CD7A 4QNWA 2OQHA 3B0XA 3SRFA 2UBPC 3QC0A 4HNLA 4EKJA 1F3TA 1GVQA 1IV8A 4DWDA 4PCSA 2W5FA 3M0VA 3GAYA 4ENLA 2QVNA 3GU9A 2CLHA 2E77A 4DZIA 1YLVA 3BV7A 3EA1A 2AKZA 1XYLA 1W1VA 2NWRA 3NQ6A 2FGZA 4GQGA 1SJAA 2NZLA 4ZMGA 2HPIA 1ZBCA 4FK9A 2TYSA 3UA4A 3O15A 2DZUA 5LSMA 4GISA 4H6KA 3ZQ9A 1CBGA 1RCOB 3P81A 1JCLA 5I3GA 1PZ3A 4O1EA 3VKCA 1JCXA 3ARSA 4Q4PA 4PMUA 1VBJA 1CB7B 4NNAA 1C3FA 1D3HA 1FCBA 4Y2WA 4A21A 3HG3A 1QI0A 2TMDA 3ZXWA 3B9AA 2ZRUA 1KLYA 3WMBA 3N2MA 2P0IA 3WDQA 5IBXC 2XSBA 2YIHA 3W7HA 4O1BA 4PB5A 1X8CA 3NL2A 2G5WA 2F6KA 3Q45A 1H7WA 2PE4A 3WF4A 1W8SA 1B5TA 2WNQA 4L6DA 3KL0A 5TAOA 4RNFA 4M1BA 2NQ9A 4PTXA 5I3HA 2P3ZA 3CUZA 3DFTA 4WKFA 3AC0A 2NWSA 2YKKA 4JTDA 4I6VA 1I1XA 1DBTA 2I1OA 4KWOA 3WEZA 5K4ZA 4DO7A 4O13A 5EGRA 2I57A 2X16A 3UXLA 4GRSA 3ANYA 4ZB0A 1Y8BA 3LA4A 3HG4A 3WMSA 4KGJA 3MI6A 3BW2A 2XPKA 3FV9A 3I65A 3APYA 3NQVA 3TK7A 1S2VA 1FH8A 5CGMA 2HJPA 5DO8A 1JCJA 1CZ1A 4PCTA 4C6FA 4HYRA 3WBEA 2FYMA 3TJ4A 4DF1A 3D5HA 2EKCA 4JCLA 1CLXA 1UPPA 1XCWA 4QLJA 1YDYA 4L7ZA 4JTCA 2E67A 2V3FA 3WNMA 4KRTA 4H9ZA 7ENLA 3VNZA 2VFGA 2BY3A 3H2CA 4JFUA 4GQ0A 5LNRA 1M1BA 1OEPA 1CEOA 3RFAA 4AVNA 4LVAA 2C14A 5D37A 3PBYA 3UU0A 2YLAA 2OX1A 4IP5A 4A3UA 3PZNA 1RALA 1XM3A 3RILA 3GR8A 3HPFA 3N6QA 1EQPA 4JDYA 1SSGA 2VR4A 3QTGA 2VURA 3KOZA 4PGLA 3RF9A 1HL8A 2ZRWA 5A6BA 2YDAA 3E2QA 3IIVA 5M03A 3VOIA 3QSRA 5E0FA 3GFXA 3I7RA 2XDFA 3A47A 1D7FA 3EWCA 4DJFA 8RUCA 3N2XA 3CLMA 4AZGA 5HAOA 3WQ8A 4B9YA 1VH7A 1A80A 4HP5A 3LB0A 3GBDA 3RJXA 2DJXA 4DJDD 1TWIA 3A24A 3KL5A 3DXIA 5HWMA 3L5MA 2QUMA 3YPIA 1HKWA 2FFCA 1YKWA 1V77A 4PE8A 2CZ5A 2DEPA 3ARYA 3K46A 1TJ2A 3KRUA 2R24A 3GVVA 3AS1A 4GWEA 1VBHA 3GTFA 2HWGA 5CPMA 5I03A 3WFZA 3LNMA 4FPSA 4GXWA 2INEA 2UZ9A 4AHQA 2GUYA 3LHWA 3I4EA 4IH3A 1Q7MA 5JQ9A 3TQKA 1JAEA 2XVKA 4PMOA 4I3GA 4P7NA 1GVEA 4UQBA 4QDPA 1KM1A 4KKXA 3OA5A 3W83A 5DCBA 5HUOA 3L0KA 4ZQPA 3T44A 1R38A 3H2NA 1FWSA 1FWRA 3M0IA 2GGJA 1Q6DA 2Y7EA 1Q6LA 3PNZA 2B31A 2WSPA 4Z1DA 4I90A 3QY8A 3L2IA 1XDMA 4LYQA 3B4YA 3GKAA 3W1MA 3L4YA 3RX4A 3QOMA 4MPQA 1YXYA 4E8DA 4GINA 2PLKA 3T42A 3LG3A 2F38A 2WV8A 3BL3A 2V68A 5M1TA 1QATA 3VE9A 3M47A 4E4FA 1RQBA 3C8FA 3MCMA 1K9EA 1PHQA 1TZ9A 1XPYA 4W9TA 4GVIA 5G2WA 3VOJA 4H7ZA 4L4LA 4XD3A 3ITYA 2QF8A 4O1AA 1SJBA 1N8FA 1XX1A 4BI5A 3GB6A 3WH7A 4XBSA 4E2BA 1EP1A 1K4HA 1VHNA 4ATLA 4NXSA 1GZ1A 1OHLA 1NH6A 7TAAA 1DJGA 3GTHA 2VUNA 3BV4A 2R8WA 1DVJA 1TE6A 2W4XA 3DN5A 4NZ3A 5BOOA 3GXTA 1H7NA 3DENA 1P6WA 4DQWA 3DUGA 4V15A 4IMCA 3HGSA 3S9IA 5EL1A 3WQDA 2QCDB 3I10A 1OYBA 3VCCA 1UKSA 1FWHC 1AQHA 3WJYA 3JRKA 5CZJA 4AAJA 3T8LA 3K13A 3DC8A 4W93A 3LCHA 1EXBA 3VYLA 3T1GA 2WCAA 5T9BG 3E6EA 4W8AA 4JYEA 2YPIA 4ZQCA 3W7PA 4DY1A 1HJWA 1K9DA 4UNLA 3B4UA 3PPGA 4P8WA 3U0HA 2GZXA 1JUKA 6TAAA 1ZHAA 4R53A 1HXJA 4XBKA 1FHUA 3T6CA 4DWSD 2ZE0A 4AC7C 2FTPA 4FO4A 3TDFA 1YW1A 2G37A 5BRPA 4QR6A 1ITXA 1PCKA 4GO9A 4UFKA 3P62A 3EDDA 4BWLA 1JPHA 4JIHA 1VFUA 2OZTA 3O3RA 2G96A 5I02A 4AD0A 3FHAA 4WGHA 5KINA 2ZE3A 1I0DA 3FLUA 2DZVA 2VFDA 1TQJA 5A6MA 3OLIA 2QCDA 2CLKA 1DXEA 5D9OA 3W73A 1WKYA 1V0NA 1WBJA 3ZWTA 4KCVA 1FHLA 4Q4OA 2TODA 3A3WA 3KCOA 3QMRA 2RUSA 1LOLA 2WAGA 2JIWA 3CHVA 3EWDA 2VOMA 1B2YA 3MDUA 1FWFC 1F7BA 3M6DA 3EMQA 3IGHX 3I68A 5DBUA 1UD3A 3N17A 5C0QA 2A5HA 3RG6A 1V02E 3S1WA 3KTCA 1I9CB 1HJQA 1XR2A 1SFLA 4DBSA 4H2HA 4WJ8A 4C1LA 4JX6A 1A3WA 3NWRA 4C60A 1FWWA 1G69A 2WHKA 5BYWA 5AYIA 3N73A 1GQKA 5A2CA 4K8GA 4UFJA 4OZOA 1LQ2A 3MU7A 4O1CA 5RUBA 2J13A 1JAKA 3MTWA 4PUWA 3G22A 1P0BA 4XAFA 4NILA 1XC4A 3MO7A 3CIVA 1VYRA 3HFYA 4H9YA 4OBSA 4PCNA 4CQBA 1EGVA 1KV8A 1Q45A 4G1KA 2X0SA 1E4LA 4CNSA 3W1RA 3ZVHB 2X1SA 3PZMA 4F0KA 4IHCA 5MKGB 3GH7A 4V1YA 2WHLA 3EX2A 2VJXA 4GNJA 1TJ1A 5A2BA 4QDWA 2DQWA 3R94A 4IGNA 1SSDA 2FTWA 1TX0A 5H6HA 1KWKA 4JTHA 5BU9A 3TWBA 3DGRA 3VCRA 3NVDA 2YL8A 1HN1A 1LF1A 4GCAA 1AQFA 3C61A 4Q8TA 1XDJA 3ABXA 4YVVA 5I06A 2H90A 1WZMA 2ZXDA 2E09A 3SJNA 3LRMA 2XGIA 3P67A 9XIMA 4FLQA 1I2QA 1GW1A 1VLWA 1NWSA 1NFBA 4S3EA 1UMLA 4JTRA 4FNUA 3EXRA 1OFQA 4DIAA 1I4NA 4BF7A 5C9XA 1DIKA 2VFIA 1YNYA 3PB0A 3EA3A 4GUIA 4PTDA 3ZVHA 2ESCA 2XIQA 4LC6A 4TO8A 1AD1A 5MKGA 2A3CA 4QNEA 2OEMA 4CD8A 2J47A 2R9RA 1S5TA 5REQB 5E9XA 1XRFA 3UWVA 1ZJAA 4GPNA 3PJWA 2RDXA 3FYPA 2EQDA 2HXTA 4ZCWA