1B3ZA

Xylanase from penicillium simplicissimum, complex with xylopentaose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 128
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3zA00
1VJSA 1HF6A 1Q4NX 3T2PA 2ZX5A 4DM2A 6CGTA 1GQKA 4E2OA 3AJ7A 1DWIM 1W9VA 4URIA 1EDGA 4PMUA 3AIBA 4PEEA 2WCGA 4HOZA 1QNRA 3MMDA 1V3LA 3WDIA 1UWTA 1W1VA 3UR8A 1JI2A 1JXKA 1JD7A 5AYBA 4ACZB 4C7GA 1GQJA 3ALGA 2QMJA 2WVVB 1HP4A 3SURA 3W38A 1WKYA 1V02A 4JHZA 3CMJA 1EA9C 3VIJA 4L4PA 3CUIA 4PSPA 4XUYA 5JIWA 2QPUA 3VKKA 1GOWA 4QP0A 5A1AA 2CBJA 1OIMA 1XH0A 4JKKA 3SUTA 3ALFA 2J7GA 3GH4A 2WHMA 1QHZA 3KL5A 3MSDA 1BTCA 5C8BB 4YN5A 3W26A 1BYDA 5D8ZA 1MXDA 4BA0A 2VNCA 3T2OA 3DYPA 2G4FA 2WM0A 1LL4A 2VTFA 4BQ4A 2ZE0A 5CGMA 5I5RA 2BVDA 1CLXA 1KR1A 2XGBA 4X0NA 4AZIA 1WZAA 4CVWA 3ZO9A 1GNXA 3AHVA 4XZWA 4BF7A 3GXIA 4MAZA 3TOPA 3AFBA 2XSAA 2PB1A 4UFHA 3AI0A 2JF7A 1E4LA 5ABFB 4ZXOA 4EK7A 2J7DA 4F79A 2W5FA 5HPOA 2VCCA 5FKYA 3GXFA 2MANA 1E71M 3RJYA 3WD2A 3WD1A 1UD2A 4MTVA 3UG5A 3SCVA 4QCFA 2CESA 1NWSA 2VCBA 1M03A 3RM9A 3N11A 3WN6A 1MQPA 3MV11 3PZVA 1Z32X 4AIEA 3FNDA 1MWOA 1MW1A 2X0YA 4QLLA 1E4IA 1XGZA 1MXGA 1MFUA 2FGZA 2XG9A 4H8VA 1UUQA 4MB5A 1UOKA 3UCQA 5AYIA 5LA2A 7CGTA 1V3KA 5I3DA 1Y7VA 2DT1A 3CIVA 3IANA 3ZJKA 3EDEA 3ARRA 3SCOA 3WNOA 2E8YA 2GDUA 2WHLA 2FH8A 3MMWA 3SCNA 6A3HA 3THCA 5CJ5A 1H5VA 1JYXA 1W1TA 2CHOA 3VILA 3PZNA 1E1FA 2D3NA 2O9RA 3UEQA 5IFPA 3KE0A 5ABHA 2ZUSA 1AMYA 2ZUNA 1JDDA 2C7FA 1KXHA 2CETA 1CIUA 3AXIA 1VRXA 4CU7A 2DPEA 4UFMA 3B9EA 4MDOA 4QLJA 2VX4A 1KXTA 1V03A 4GI9A 4X0VA 3VIOA 3U7VA 3VD5A 1CNVA 3THDA 1NOUA 1VIWA 1EQCA 1UR4A 2J74A 4QCEA 1QHPA 2YLLA 2DDXA 1K9DA 1JZ4A 2J77A 3ZJ8A 3PZQA 1LQ0A 5D4YA 4WKHA 4D6DA 5HXMA 2XFFA 3GBDA 4M24A 3HU7A 4OKDA 3IJ7A 3WBAA 2CHNA 3BAXA 2V5CA 1HJQA 2D2OA 1BPLB 2J8FA 4JL1A 3B9DA 4HU0A 1HKKA 3BAIA 2W92A 3AMGA 3WF1A 3SUWA 2G3JA 3LPGA 5CPSA 2V38A 1KR0A 3I3BA 5CLWA 2F61A 1LF1A 2DT0A 4M29A 1B3VA 1TVNA 4AYSA 4KRUA 3WUEA 4FMVA 4UQDA 1PX3A 3BAKA 1V02E 3AYSA 3CHDA 3BMVA 1UKOA 2G41A 4PRWA 1W1YA 4JCLA 1UH2A 4JHOA 5D9NA 3RCNA 4OZOA 3AYRA 4UR9A 3VGBA 3AMLA 1GOMA 1WAWA 2DH3A 3VU2A 1M53A 3A4WA 5A2CA 4N42A 1ZBCA 4TXEA 1PEZA 4BS0A 4AZHA 3VGEA 3RM8A 2CXGA 5FL1A 3BCFA 1CLVA 5E6YA 1H11A 2RGMA 3AS2A 5BXRA 4EAMA 2EPOA 2VVSA 1XV8A 1VJZA 1RH9A 3N1AA 1AQMA 3ARZA 4WF7A 5M3WA 3M46A 3T0AA 4J3TA 2DEPA 5DF0A 1B3YA 1FA2A 3CTTA 4AZCA 1CBGA 4OBRA 1C7TA 3G6LA 4D6EA 1EHNA 2IXVA 1UD4A 4W5UA 3WKZA 3GDBA 2NT0A 5BXSA 1JXJA 3T0BA 4RL3A 4LQ1A 3ZR6A 1HN1A 4U5KA 3ZQ9A 3AS3A 4H41A 4HP5A 1MW0A 4D6FA 4GZIA 2DT2A 1WO2A 1XSIA 3L4UA 1LL6A 3QR3A 1VFOA 1GVIA 1GHSA 4MB3A 1QVBA 4P7OA 3I3DA 2VQUA 1J0HA 2YDSA 1KBBA 3FHQA 4D6CA 1US3A 3WNLA 3VDBA 1PJ9A 1NARA 3AHXA 3K8MA 5D9PA 3AHTA 4ZE5A 3S6TA 1JZ2A 2WZHA 2ZIDA 1E5NA 1ZU8A 1C92A 4MJ4A 4W7WA 5BRPA 2Q8XA 1CGXA 2E9MA 1G0CA 2EJ1A 2WZIA 1ZBWA 1U2YA 1X6NA 1J0IA 3TTOA 3CUFA 1ECEA 1QOXA 1IZJA 1CGUA 4HMCA 4UZSA 4W7UA 1XH1A 1GOKA 2WSKA 4BQ5A 2PWDA 3L4ZA 3W53A 3B8SA 2JEQA 3APGA 3N17A 3WL1A 4FF5A 1H09A 1UWRA 1W9PA 5IFTA 1KGXA 2DSWA 2WW5A 3WQVA 1H49A 1VFFA 4UQCA 2WNWA 5E0CA 1CGVA 2VR4A 1CECA 2XGIA 1KB3A 4QLKA 3OLDA 3AOFA 3PTQA 1XD0A 3WMBA 2NT1A 1QI3A 2DQXA 5CSYA 2O92A 4DM1A 1VBUA 1GW1A 3WELA 3EDDA 3TP4A 1Q6DA 4BZYA 4UZUA 3MO4A 4DWSB 4HTYA 3BSHA 5GNYA 2EEXA 1PBGA 2EQDA 3FHAA 3NDYA 1H1NA 3VD3A 3GTNA 4M81A 3BMWA 4ATLA 2XM2A 2XFRA 2XIBA 1VF8A 4OOUA 1CZ1A 2PWFA 2WMJA 3RIKA 4CGTA 1W1PA 5I0DA 3EDKA 2D23A 4TTGA 4S3KA 2J25A 2GUYA 4W86A 1JD9A 1G1YA 1W91A 2D20A 2VRKA 5KZ6A 1J12A 3MU7A 2GK1A 5D9MA 5BYWA 3WUBA 4V28A 5A8QA 4P7NA 4D1IA 3FY1A 1V3MA 2CEQA 1GONA 5TD4A 2BXZA 1V6XA 2GJRA 1B30A 1CEOA 3OLEA 1HJSA 4B3LA 1TA3A 4GIAA 3LPFA 4GZEA 4JL2A 5A6LA 5E9AA 1R87A 3VUPA 2EPNA 4EANA 1IV8A 3PZGA 3ZR5A 3TTQA 4XB3A 4GZJA 3DHPA 1LL7A 2WHJA 1GVYA 2D3LA 4CN1A 2A3AA 3TA9A 4U5IA 2AOSA 2BY0A 1J18A 1JZ7A 1HIZA 3WEOA 1H0GA 1TVPA 4J3XA 1NWRA 3W37A 3ZJ7A 4PMXA 8A3HA 1TUXA 1KQZA 4JFUA 5DT7A 2XVGA 3ZSTA 5BCAA 3ZIZA 1HNYA 1W3HA 1E1EA 3AHYA 1Q6GA 4F8XA 1OWQA 5C71A 3NSMA 3PZ9A 1E4NA 1QPKA 4PUDA 1WB0A 1CGYA 4ZE4A 1UD5A 5A6KA 2BV9A 2YA2A 1B3XA 3KZSA 3OG2A 2V3FA 4HA4A 3AQUA 1PPIA 5CLTA 2HISA 2VR5A 1R7AA 2UWFA 1JNDA 1YQ2A 2XPKA 3AXHA 1HJVA 1J0YA 1CXKA 1ITCA 4AD5A 5I77A 4JFSA 1QNQA 3AMKA 2CNCA 4ACZA 3OLGA 4P7QA 1WZKA 1UR1A 3BAYA 3CMGA 1JAEA 2BS9A 4CVUA 3GXMA 4TVCA 2PF0A 4W88A 2WBKA 4F9JA 3SCQA 3WIJA 3MUAA 1K9FA 2WHKA 1V3IA 2D0FA 1W32A 3OZOA 4J7RA 2Y4SA 3WENA 1XC6A 1JYNA 5ABGA 4W5ZA 3ZJ6A 5CXPA 2QF8A 4CU8A 1IT0A 1QI4A 4KH2A 4U3CA 1L0PA 1WNOA 2C8NA 4JZ5A 1OT2A 4Q7NA 5IDIA 4D1JA 4PMDA 1LWHA 3OBAA 1W2VA 1V0NA 2OYMA 4MAVA 1ODUA 5A8MA 1TR1A 3ARUA 1BGGA 1VFMA 4HPGA 1KCKA 1V3HA 2V3GA 1NOFA 1FOBA 1BQCA 3PZUA 2VX5A 2QPSA 1ISXA 4PSRA 2FHBA 3J7HA 4KMQA 4AD2A 4B9YA 2HVMA 4XV0A 5D8WA 1A3HA 4UCFA 4EKJA 4KGLA 1JIBA 4GQQA 3A47A 3FN9A 3QOMA 1GOIA 1HJUA 1AVAA 1WZMA 4P7LA 1E6NA 3A4AA 1VEMA 3CO4A 2CBIA 1V0KA 2VQTA 1SFSA 1WDSA 2JIEA 4V27A 4GI6A 3VIHA 5EB8A 1KWGA 4B16A 4W7VA 1OB0A 3GH5A 3IJ9A 3WD4A 3ARWA 1LWJA 3FW6A 2EPKX 3ARVA 3W6MA 3WH5A 2CBVA 4CCDA 3ZMRA 3AICA 4M1RA 1RD6A 1VENA 1B9ZA 2QMKA 3T09A 4PTVA 1QI2A 1X6LA 3W24A 1FH8A 3VM7A 1B3WA 3CUJA 2OWWA 5I24A 1HJWA 4ZXLA 1OIFA 3UESA 3WUFA 1HP5A 5CQ1A 5DT5A 3CLWA 1SMAA 5A6JA 1KWKA 4Z2IA 3ARXA 2X8RA 1BYCA 4ATWA 3SCWA 3FAWA 2XVNA 2W91A 4HZ7A 3N04A 5EFFA 5D9OA 2G3IA 5FOOA 3HMCA 3VX0A 3GXDA 1UKSA 2TAAA 5AC4A 1HKIA 3NIYA 4AW7A 2VCAA 1RP9A 1O6IA 2CIPA 2X09A 3WY1A 1FH9A 5AY7A 1H2JA 4GKLA 1GORA 3AZTA 4WSJA 1LG1A 3WQ8A 4Q22A 3CHCA 1OGGA 2IUZA 4GINA 4BQ3A 1OSEA 3WEMA 3ARSA 5E09A 4MNMA 5I2UA 1UH4A 4LGXA 4RE3A 2DH2A 3PZMA 3W82A 1VEOA 1OM0A 5CPQA 3SCSA 4AZCB 2EBNA 2WCSA 1QI5A 3CUGA 4U2ZA 1UA7A 2CERA 1C7SA 3VVGA 1BAGA 3II1A 5CZKA 4UFIA 4C7DA 3BC9A 1Q6CA 4AEFA 4E8DA 2O9OA 1EDQA 4CN6A 4AZBA 3W0KA 5F7UA 4J3SA 2A3CA 1I1XA 2QLYA 1EXPA 1E43A 3UETA 1KCLA 1NQ6A 5CGTA 1UZ1A 2FDMA 7TAAA 1AQ0A 2WZEA 3W25A 4TTUA 1JG9A 1V6WA 4JFWA 4WLCA 4JFTA 5BXPA 3L2LA 1GOOA 4MB1A 5GQBA 2BY3A 3KWXA 2ZWZA 4PMQA 2WLZA 2GFTA 5A6SA 5HBFA 3OGRA 3WUGA 2GK1B 1FFRA 3BSGA 4FK9A 3CZEA 1W9DM 1WCGA 1O7AA 2VZSA 3DHUA 1TMQA 2J7HA 2AAAA 2BHZA 3K1DA 2YL5A 1J0ZA 1C3FA 3HJEA 1UR9A 2OWCA 4NF7A 2WMHA 4C7FA 3WNKA 1MFVA 3SUVA 4HZ8A 2WMFA 4OUEA 2YBUA 1C93A 5GPRA 3MKKA 2W61A 3EMQA 1HL8A 1QW8A 4GO8A 3AIQA 3VIFA 1JFHA 4AZ6A 2Z1KA 2ZXDA 9CGTA 4J27A 1J9YA 1OINA 1E56A 3SCPA 1UR2A 4IISA 3N12A 4PN2A 4AD0A 1QNPA 3VD7A 2ZUMA 1FP8A 1CXEA 4HMEA 4CD6A 5A6AA 2YOCA 2BVTA 2XM1A 4DWSA 4UQAA 4IUGA 1G9HA 2OWXA 2XUCA 1UQYA 4TVUA 1TFVA 1U30A 4HOWA 5A6BA 1D3CA 2WBGA 5FL0A 5JUVA 2X05A 4CD5A 1E9LA 1MW3A 1VEPA 2UY2A 2WKGA 3AZSA 4WIWA 5E6ZA 4NI3A 3LPPA 1CYGA 1E0WA 2F2HA 2VMFA 3EDFA 2GJPA 4UQEA 4P8UA 3OZPA 2YBTA 3QGVA 4LX4A 2DSUA 4P8VA 4W84A 1TZ7A 2XFYA 4UFLA 3JUGA 1OD0A 4TOQA 4PMVA 3ZT5A 3WQ4A 1ZJBA 3L4VA 3ZM8A 4AD3A 3VNYA 3U5YA 1OD8A 2FH6A 3BH4A 4ZENA 1EIBA 2WXDM 3DECA 1E15A 3K46A 4AD1A 4JKLA 4M82A 1CGWA 2EXOA 1CXLA 5KEZA 3WF2A 3VIIA 4A4AA 1UH3A 4A3YA 1MQRA 3T0DA 4NSBA 3ZSSA 4J3UA 4B15A 1HVXA 1UD6A 2UY3A 3VMOA 4F66A 3S2CA 4GO9A 5GNZA 4D71A 3WH6A 5I23A 4D6HA 5BROA 2QV4A 7A3HA 3NJ3A 4PYSA 3WMCA 3ZT7A 2ZXAA 4W87A 5BRQA 2PWHA 2YL6A 3TTSA 3D5HA 2XSBA 3POHA 5A8OA 1FP9A 4HU8A 1G01A 3NCOA 4Z2KA 1E6QM 2VOTA 4UTFA 1ISWA 1FHDA 4PCTA 5A8PA 1KXVA 3GZAA 4AWEA 2UY5A 3VD4A 5EFDA 1XSKA 3BGAA 3AIUA 4E4PA 2GSJA 2WC4A 2GJXA 2V5DA 4MADA 4AISA 2J7CA 3TTYA 1Q6EA 3U7BA 2VZOA 5JBFA 3MUIA 3KEHA 4V2XA 4MNLA 2W63A 3T2QA 4PMZA 3GYCA 1UZ4A 1JDCA 2FHFA 3CHEA 1CDGA 4R27A 1TE1A 1EH9A 4LYRA 1CXIA 1CXFA 2G3MA 3D3AA 1KGUA 1TG7A 1GHRA 2YLAA 2VVNA 1E3ZA 4AEEA 3WMSA 3L4WA 1PX4A 1OGBA 4PTMA 8CGTA 1Q6FA 3OB8A 5A8NA 5JIPA 1DWGM 1C8XA 2YDQA 2XVLA 4GI8A 3SEPA 2J8GA 3U57A 4JIEA 1E40A 3UG3A 3ECQA 3OLIA 1C91A 3ZOAA 3GM8A 1V6VA 1X1NA 4UNIA 2VL4A 1V0MA 1ISVA 2E40A 4NRSA 4ZEPA 5C70A 1E3XA 3PZIA 3UR7A 1E5JA 4RE2A 2ZX7A 2WB5A 1GQLA 2W62A 2BNJA 3SCUA 5CSUA 3RILA 3WH7A 2BXYA 2GJXB 3NYDA 4U33A 4TX6A 1W3KA 5FCZA 1WDPA 4LPCA 2XIIA 1D7FA 2V3EA 4F9DA 3RJXA 1UQZA 4HA3A 2WANA 3EDJA 1KXQA 3SCTA 5ECUA 3CZLA 4UOZA 2EPMX 1ZL1A 4GXPA 4YHEA 4FLSA 1GCYA 1BVNP 2WVVA 2D0HA 3SCRA 1WDRA 2G8ZA 3CUHA 1WPCA 1XD1A 2CCRA 2XWDA 5ABEA 4X9YA 1BF2A 1GPFA 3AHZA 2Y2WA 2J75A 2Y8VA 3AIEA 3LPOA 2WVTA 2WWCA 3O6AA 3SIMA 2PWEA 2ZX6A 5A3HA 4JAWA 4WSKA 1UD8A 3WF0A 2WSPA 1MW2A 3MV01 1DWAM 5HOSA 5M03A 4UFKA 1EGZA 1U33A 3K4AA 1XYFA 1M01A 2XTKA 3CZ8A 1B2YA 1QW9A 1SR0A 3EMCA 3OIHA 3WDHA 2BY1A 1PZ3A 1S46A 2DSVA 3WQWA 4M80A 1E73M 4CCCA 2ESCA 5DFAA 3RO8A 3W4RA 4LYQA 2O9TA 1DHKA 3WSUA 4P8WA 4P8XA 5LA1A 2BVYA 3GNOA 3WEZA 2J78A 2WVSA 2ZX9A 4CUCA 3AMCA 1E0VA 1KBKA 4K68A 2VUYA 1ISZA 1J01A 1N82A 1XHGA 1QNOA 1XSJA 1JZ5A 1ISYA 1BYAA 5A94A 1LLOA 3F5JA 1PZ2A 3EYPA 1NH6A 1UWSA 3VM5A 1A47A 1BG4A 3RDKA 4BCEA 5A6MA 5A95A 2WC3A 3VO0A 4UFJA 3VDHA 1V0LA 4LYPA 2GVYA 2ZXBA 4HA1A 3WD3A 4HPHA 2J79A 3AIRA 4J3WA 3BCDA 4OIFA 3ARYA 2WYSA 2RGLA 1F4AA 1UD3A 3ARPA 1G94A 1J0KA 5E0FA 1H4PA 4DUVA 1NM9A 1CPUA 1GUVA 4YHGA 5JBEA 1P6WA 4UOQA 1EO5A 4J3VA 4AZGA 1DP0A 4H8HA 4AD4A 3FXYA 1CENA 4AY1A 4NRRA 3VIMA 4CN4A 1I75A 4KGJA 2A3EA 1M04A 2DSKA 1HJXA 1M7XA 2PBOA 2CPUA 4B3KA 3PZTA 4MNJA 2G3NA 3AS1A 1E6XM 3DC0A 3WFLA 4JCMA 1XCWA 4D6JA 3K8LA 1ZBKA 3TONA 3WDRA 1UR0A 1V6YA 2QHAA 4IPLA 2WPGA 6TAAA 1K9TA 2D22A 1E70M 1JNEA 4CKQA 4N0RA 1VBRA 2GDVA 2Y24A 2VZTA 3AISA 2DIJA 2NW0A 4M8UA 3L2MA 1FHLA 2J47A 2E9LA 5JBDA 1E72M 2UY4A 3BAWA 3EMZA 5A6BD 3W6LA 3A6OA 4MJ2A 5HNNA 2OLHA 1DWFM 1LJYA 3BLPX 4KWUA 2WMIB 3EBVA 4R5EA 3CH9A 1UA3A 4M56A 3T08A 1DEDA 1CGTA 2PBGA 5CPTA 3U5UA 5A69A 4CCEA 1UWQA 2WVUA 2JALA 1DTUA 1PIGA 3WFZA 4JKMA 4E8CA 1B3ZA 4KRTA 4D6IA 3NUKA 3IAQA 3VMPA 5DO8A 1C8YA 1MYRA 3WL0A 3F5LA 1W2PA 2FGLA 4W8LA 4CD7A 4DUWA 1JL8A 4YPJA 2D1ZA 3W27A 3L4XA 5LYRA 1NWTA 3OGSA 3CZGA 2OSYA 2DT3A 4LXFA 1US2A 4UQBA 4MDPA 1V08A 2YKKA 1ITXA 2BY2A 3VNZA 1CTNA 3VIPA 3WD0A 3WF4A 1L8NA 2E9BA 3MSGA 3ARTA 1H41A 1GQIA 2EPLX 1RP8A 5M17A 2EO7A 1UYQA 2CYGA 3VIGA 4QFUA 3WNMA 1V3JA 4XX6A 4CU6A 4PMYA 2XYLA 3VTRA 3WQ5A 2ZOXA 1V6UA 2JEPA 2XVKA 5BXTA 3WDQA 3PTKA 2ZWYA 2PC8A 4RE4A 4U31A 2XVPA 3MUY1 3VD9A 5BWFA 1WDQA 1JGIA 5FD0A 4GQRA 1R8LA 2VO5A 1VFUA 1GZJA 1XRVA 4J28A 1WE5A 3RMEA 1W9XA 4PMNA 4L4OA 4D6GA 1H0IA 2YA0A 2ZICA 2JF6A 2VT0A 3NSXA 2AMGA 1B1YA 1OGSA 1UG6A 3WDJA 3VDCA 3PN8A 1BGAA 1NWUA 3CHFA 1BLIA 2DGAA 3OGVA 4PTWA 5EBAA 3IAPA 1UHVA 4AXNA 3GNRA 3AZRA 3VGGA 2E4TA 4AMCA 4TVDA 2WLYA 2WKLA 2OYLA 3O2LA 1KGWA 1PAMA 1NP0A 3CGTA 1B31A 4DUXA 2ZUVA 1BVZA 4AIUA 1PX8A 1YHTA 2JFEX 2W4XA 4PMRA 3I3EA 4UQ9A 3PHAA 2V3DA 4ML4A 3O9NA 1J11A 1OT1A 3RM4A 3N18A 3F5KA 1E6SM 2ZXQA 2VRQA 1HXJA 5A2AA 1W3JA 4PTXA 3CZJA 3AS0A 1HX0A 1UKQA 1J10A 1B0IA 4IPNB 5IHSA 1I1WA 1FH7A 1GJUA 3ARQA 2VC9A 3NDZA 4W8BA 1W9UA 3GBEA 4CD4A 1W3LA 4HMDA 2YDRA 2ZUWA 4BQ2A 1QHOA 4P7RA 3QHMA 1BFNA 4W8AA 5I79A 1B90A 4AZ5A 3M07A 1UWUA 2E0PA 1CWYA 1QNSA 1K6AA 1TA3B 1BYBA 3CPUA 4WKFA 2J4GA 2JIWA 3KL0A 4FLOA 1NOWA 4WKAA 1WZLA 2WCAA 3IK2A 1G5AA 2DSZA 1HVQA 4MB4A 3N13A 3WH9A 4QAWA 1EOMA 1GJWA 1FFQA 3VINA 3E1F1 3GNPA 1UWIA 3MANA 3W28A 4DWSC 2FHCA 3BAJA 1JZ6A 4Z2LA 2E3ZA 3POCA 3BLKA 2OSWA 3L4TA 4H8UA 5I6SA 3W81A 3VMNA 4AZ7A 2VURA 5LA0A 4MPKA 4W93A 2WMKA 1XH2A 3WH8A 2XJ7A 3ZT6A 4DWSD 2D24A 1R7OA 1EHAA 2D0GA 3DYOA 2Z1SA 3GH7A 3WNNA 1C8QA 2J7BA 1ZS2A 3NSNA 4H2CA 4PMOA 3WBEA 3IJ8A 1KFWA 1QBBA 4HOXA 2X1IA 4UOJA 2IXUA 3PZOA 3VGFA 4H04A 2W67A 3W29A 2X2YA 5IHRA 1H3GA 4Z2JA 3A3HA 3VIKA 2J62A 4U2YA 2VJXA 4HZ6A 1TCMA 3N15A 2ZUTA 3CZKA 1JF5A 1VB9A 2CBUA 3CBWA 1ZB5A 2VI0A 3AMDA 3SUUA 4PBGA 5GNXA 5ABFA 2J7FA 4OBSA 1IZKA 1JI1A 3SUSA 4A3HA 1CXHA 5AC5A 1AQHA 1EOKA 4W89A 1E6ZA 1LG2A 1JYVA 4TX8A 3VGHA 3FAXA 1WP6A 4MNKA 4TUFA 5DMYA 1C90A 2OSXA 2YL9A 1MQQA 2ZUUA 2Y8KA 2F8QA 1XYZA 2VRJA 1UKTA 1EO7A 1UKPA 3QOKA 1BHGA 4ACYA 2CITA 3M7SA 1JFXA 2VX6A 1OBAA 2YL8A 1R86A 3VGDA 3WQ6A 1E55A 5E70A 1K9EA 2NSXA 4EE9A 1DWHM 4FLQA 3WDPP 2Y5EA 3AROA 4FLRA 3LMYA 3OA5A 3M6DA 3RPMA 3UERA 1D2KA 1XCXA 4XZBA 2WMGA 1F4HA 4Z2HA 1HKJA 2WAGA 4JFVA 3VDAA 4B9ZA 4PUEA 1ZBVA 4OOZA 5DEZA 2VZVA 1J0JA 1BG9A 1BSIA 1W9BM 2BFGA 4OJYA 1VAHA 1EQPA 4IM4A 1E6RA 4ATDA 5HPCA 2WK2A 3L4YA 2JE8A 5CG0A 4GPNA 3QHOA 3K8KA 4U3AA 1JZ3A 2B31A 2W66A 5IXEA 1SMDA 1ESWA 1DWJM 1JZ8A 3PTMA 2WC7A 2ZX8A 1PIFA 4AIOA 4CD8A 3A4XA 5M5DA 2VX7A 1JF6A 1JDAA 1RPKA 3AIWA 2XWEA 5EMYA 1EDTA 4ZFMA 4WK9A 2YJQA 3AXXA 1R85A 3KL3A 3PBGA 3F4VA 3QHNA 2VZUA 3VX1A 4W85A 1JAKA 1GOQA 2PWGA 3UG4A 1HKMA 2DIEA 3MUZ1 3MS8A 1MVYA 2OYKA 3WNPA 2WWDA 1OCQA 3MMUA 2PI6A 3BXWA 2X0HA 3DYMA 1UR8A 1NP2A 3G6MA 5I78A 3AIVA 1E0XA 1JYWA 2J7EA 1KQYA 4Y7EA 5FIPA 1QI0A 2A3BA 2XHYA 1E6PA 2CKSA 1ZJAA 2C0HA 1HL9A 2O9PA 4S3JA 4AC1X 5A2BA 4PCSA 1SYTA 2WMIA 3VOCA 2CKRA 3VPLA 3HN3A 1QBAA 2BHUA 2YA1A 2E8ZA 2A3HA 2BHYA 4Z2GA 5HDRA 2YIHA 4QDMA 1E4MM 3K4DA 3N9KA 4NZCA 4WJXA 4H7VA 3WF3A 3B9AA 1ODZA 1HT6A 4D72A
chains in the Genus database with same CATH superfamily
2FMNA 3D46A 1Q4NX 2ZX5A 3AALA 3AJ7A 1DJNA 4URIA 3AIBA 2ZRZA 4HOZA 1QNRA 3MMDA 1K1DA 4JQ2A 4A22A 3UR8A 1TWSA 1JD7A 1MI3A 4MWAE 3O0FA 1GQJA 4HHPA 1V02A 3VIJA 4JTEA 1SW3A 3CUIA 4XUYA 1NVMA 2QPUA 1NFGA 2W79A 2NQ9A 1GOWA 4QJ4B 3U9IA 4IFOA 1OIMA 1IEWA 3V3WA 2WHMA 1QHZA 3KL5A 4YL2A 3NQVA 1MXDA 4BA0A 2VNCA 3T2OA 1NFPA 3KRUA 1P0EA 4C5YA 1VFTA 2ZE0A 4HB7A 5CGMA 3MI6A 4KS0A 3WK3A 1XPGA 4WY0A 3HQ1A 4X0NA 3PBYA 1WZAA 5K2ZA 2ZKMX 3LCWA 5XINA 1O66A 3CL7A 3GXIA 4FXJA 3AFBA 3WQOA 3TN5A 4LS0A 4XBJA 2OO0A 1E4LA 5ABFB 1LLZA 4ZXOA 2OG9A 1XJBA 3B0VC 3N4FA 4IQLA 1AH3A 5HPOA 2CC0A 3O15A 4M6PA 3VXGA 4V33A 2E1WA 2PRLA 3SCVA 1RPXA 2CESA 5FEWA 1M03A 2QCFA 2X30A 1Z32X 1AG1O 2IW0A 1MWOA 2NV1A 4DZ5A 1XGZA 2QIWA 4MB5A 4S3AA 4F0HA 1WKEA 3UCQA 5CH9A 5AYIA 5LA2A 3QW3A 5J5DA 3EXRA 1V3KA 2BSLA 5I3DA 1Y7VA 3CIVA 1H60A 3EDEA 2E8YA 2C19A 4F40A 3SCNA 3KFTA 4IUOA 1JYXA 3VILA 3PZNA 1Q3NA 2OFJA 2O9RA 5ABHA 2ZUNA 1I2RA 1HZYA 1KXHA 1VRXA 4CU7A 4UTTA 2DPEA 2O7SA 3B9EA 4Q4QA 4XZMX 3M0IA 2PDJA 3NQFA 3MC5A 3VIOA 4GIRA 1CNVA 3GB6A 1NOUA 1VQTA 3VOIA 1EQCA 4IICA 3NZ1A 3MKCA 4L1XA 2DDXA 5FJRA 7TIMA 1JZ4A 2VGFA 2HTMA 2J77A 2BODX 4O8AA 2Z1WA 3HU7A 3LZ5A 4OKDA 3GK0A 5MKGB 2CHNA 3BAXA 1RQHA 1SZNA 3G1VA 2D2OA 1BPLB 2J8FA 1JVNA 3RU6A 4M7TA 2WV8A 2NLIA 3SUWA 1G7VA 3LPGA 1KR0A 4CQCA 3VOJA 4DNMA 2ZE3A 1B3VA 1TVNA 4AYSA 4UQDA 1WV2A 1AJ0A 3TU9A 3BAKA 1V02E 1GVOA 5D37A 2YSWA 3TWBA 3U6WA 4PRWA 4PH6A 2BGSA 5TF0A 4C1NA 3EGJA 3Q37A 2WNQA 4JIIX 2J6XA 3VC5A 4UR9A 1ONWA 3VGBA 3D47A 3GG7A 2DH3A 4NAEA 3HOJA 3REQA 5ABTA 1M53A 5A2CA 2PZ0A 3KDNA 3SIZA 5G4HC 4FIRA 2E5CA 2PWUA 3CNYA 4FX7A 1AZ2A 1CLVA 1H11A 2EPOA 1VJZA 1RH9A 2PDYA 5M3WA 2PTWA 4O1AA 1GGOA 2E6FA 1RR2A 1FA2A 4K7YA 1MEIA 2JBMA 1FWHC 3TN4A 1C7TA 2OODA 3E5PA 3G6LA 2IXVA 4AU0A 3DHDA 4XAYA 3H7RA 3AJXA 2P0IA 4F2TA 3FOKA 3SGUA 3ME3A 3RLVA 1YYAA 2PCQA 1HN1A 3AS3A 3LLDA 4HP5A 1MW0A 2ZRYA 1OYCA 3QR3A 3HPAA 1GHSA 2IKHA 3QQ1A 1EPXA 2FZBA 4JYEA 2Q6ZA 4ICCX 1TTPA 4BEQA 3WNLA 1S3TC 4XZLX 4RKAA 1NARA 5D9PA 2ZIDA 5D05A 3PPFA 1KLYA 3EAUA 4R7JA 4JN7A 5EPDA 2HSAA 3LUTA 2EJ1A 3CPGA 4WY0F 4Z1DA 3COTA 1J0IA 1H63A 3M7WA 5KTLA 1M68A 4PFHA 2ZTJA 3CUZA 4BWLC 4PEKA 4TMBA 1IZJA 1CGUA 4HMCA 5TBOA 4TV5A 4K7VA 5AHLA 3W1UA 3W23A 3LCGA 3T8LA 2JEQA 3APGA 3KCJA 2FZNA 3G3DA 1H09A 1FWTA 3HM7A 1UWRA 2A7PA 3TSBA 3DGRA 2BB0A 1H49A 4BY3A 2WNWA 3PC0A 3EPOA 4IPIA 1F74A 2I14A 1CECA 2XGIA 3KVKA 3VE7A 1KB3A 3NURA 4HNOA 4QLKA 4JX5A 1ZJHA 3TUUA 5K4ZA 4HMNA 3HIJA 4IJRA 1YBQA 2QS8A 3QY8A 3KTSA 2QDHA 3UG8A 3S2MA 1VBUA 4RZ6A 5LKYA 6XIAA 1KBIA 4BZYA 1O68A 3B0XA 1XGDA 4J2MA 3HGRA 4M81A 3FXGA 4ATLA 4OOUA 3QW4B 2I9UA 1O60A 2PWFA 5I0DA 1CB2A 3I68A 5LIWX 2GUYA 4JX4A 2D20A 2GVLA 3OQ8A 4LU0A 5BYWA 4KQNA 5DN1A 4JIHA 3ZVHB 4V28A 4KETA 5A8QA 1N8FA 3BG5A 3FA4A 4NUWA 1V3MA 1CCWB 2DJXA 1GONA 3NEVA 4C5ZA 2BXZA 1V6XA 3BL3A 3LHWA 3WFAA 1B30A 2VR2A 2OCZA 5E0KA 1KO0A 1LLWA 4GIAA 1ZALA 2GYIA 1F3TA 3MW7A 3W7CA 5E9AA 1XDJA 5CZJA 4EANA 4YVPA 2HEJA 4XB3A 2OZ3A 1LL7A 3QQ0A 1BRLB 3VKDA 3RLHA 4CN1A 1PE1A 4ZOCA 2AOSA 4X60A 3VUSA 2BY0A 4LVDA 1TPFA 1TTQA 3CT7A 4E3VA 3NFUA 4LB3A 3O8AA 4JTIA 4J3XA 1TPDA 3TA6A 3ZJ7A 3P62A 5D32A 1DJIA 3W2MA 4PMXA 2B7OA 2Z28A 3KBJA 3LK6A 5DT7A 5XIMA 5BCAA 2D69A 2PWVA 1HNYA 2WSRA 4QIUA 1RLCL 3V35A 4Y9OA 3TAOA 3W7GA 4NASA 3NA8A 5M2FX 3NSMA 2Z0IA 4PUDA 1Z42A 1Q2RA 1CGYA 4A35A 5DLCA 4X2PA 1A4LA 3UYCA 2BV9A 3WLKX 5LIUX 4CNPA 1B3XA 2J9ZA 2V3FA 4HA4A 3AQUA 1PPIA 2VR5A 1R7AA 2CZ5A 4M6UA 4AD5A 3KZPA 2R1NA 4WD0A 2CNCA 4ACZA 4P7QA 1WZKA 5CSSA 1YPIA 3BAYA 3ATYA 3MUCA 4EPDC 2FDSA 3GXMA 4TVCA 3XIMA 1H1YA 1M6JA 4F9JA 4MSSA 4MWAD 1V3IA 2FKPA 2H90A 3L21A 3HJZA 1XQLA 1JYNA 1YXDA 5ABGA 3ZFHA 4CU8A 3D6NA 1UROA 1L0PA 1WNOA 2YXGA 4IGNA 3W1LA 1AUSL 4TR9A 4QJ3B 2OLAA 5IDIA 1ME9A 4PMDA 3OBAA 1V0NA 3TYAA 5B7YA 3ARUA 1BGGA 3W00A 5I07A 3S6OA 1RBLA 3O3RA 4JTKA 3BARA 2P3EA 3PJTA 3HQNA 1J6PA 2BG5A 3PZUA 5F4XA 2D2HA 3LQGA 4B9YA 4AHPA 2G0WA 1OX6A 1A3HA 1X97A 1J5SA 5LIXX 3BV7A 3A47A 3NVDA 4P7LA 4PB4A 1KA9F 1VEMA 3WLRA 4YNGA 5BNKA 2WKJA 5HK4A 1IEIA 2JIEA 2PGRA 2VQTA 4V27A 4F2UA 2QGYA 3VIHA 5EB8A 2QGHA 1OB0A 4L6OA 2EPKX 3GFXA 4CCDA 3ZMRA 4ZB0A 1VENA 1EF3A 2PODA 1B9ZA 3NPWA 5SWUA 1OABA 4PTVA 2QAFA 4XD3A 4GJ1A 4F3HA 3CUJA 4JPGA 3IV8A 1SZRA 2FB2A 2ISFA 4QS5A 5TAOA 4B90A 4DJED 4FOKA 3WUFA 3M0XA 2VWTA 3CLWA 3FVMA 1KRMA 4DQWA 4L61A 4KF1A 4DXVA 3GNNA 1Q6LA 4TV6A 5DELA 4BF9A 2JKEA 1YW1A 1IEXA 3FAWA 2W91A 3S6DA 2DP3A 3I65A 3ZLHA 2XFWA 3E12A 4MY9A 4DJFD 3HO8A 5CC6A 3NQ2A 4RPPA 4GYKA 3W1PA 3G1SA 1W54A 4AW7A 3ITTA 3RMJA 1FXQA 1O6IA 4WXZA 3P81A 3GC4A 1W56A 3LLXA 4H9XA 1H2JA 4OTKA 3AZTA 4AMAA 1LG1A 4ZO8A 3A9IA 4GBDA 1OGGA 3WLSA 1BTMA 4BQ3A 3WEMA 1YEYA 5E09A 1OVDA 4MNMA 3BICA 1R2TA 1EB3A 4LGXA 4RE3A 3PZMA 1FHVA 4BHYA 4GUGA 2Y61A 4C6OA 1OM0A 5CPQA 2EKGA 1QI5A 3CUGA 5I3GA 3V75A 5U4NA 1TCDA 1ZCOA 4M5PA 1LOLA 1VHNA 1C7SA 1TMLA 4HCHA 2POTA 5CZKA 2Q8LA 3ANYA 4UFIA 2VEIA 3LBCA 4WEVX 4CN6A 3IIPA 4B5XA 1OEPA 2AKZA 1H7XA 4I6VA 1YRRA 5BW6A 4AIBA 3ABRA 5I3HA 5CGTA 1UZ1A 5FJTA 4L56A 3E0LA 3QLDA 1AL7A 1SZEA 4YCOA 3B04A 3LD5A 3I6TA 1QPRA 3W25A 4TTUA 4JFWA 1V93A 3VOHA 2NX9A 5BXPA 5GQBA 4HHMA 5EYWA 2WLZA 1DL3A 2GFTA 4H1ZA 2Y5JA 3OGRA 2GK1B 1FFRA 3BSGA 4JN6A 5BOFA 1G4PA 2VZSA 1TMQA 4DO7A 2J7HA 2OO6A 3V5OA 3EX6A 4HNUA 1Q66A 3A21A 2WMHA 1MFVA 4L4LA 1XR2A 4NZFA 2YB4A 4Y8EA 4YCPA 2YCLB 7XIMA 2ZZ1A 3P0XA 4UTJA 1KCXA 3OPSA 1R3TA 2PAJA 2RDUA 1YBQB 1JFHA 1Q4WA 5LNWA 1A5UA 9CGTA 1OINA 2XU2A 1UR2A 4MJMA 4ZOBA 5HQMA 1QNPA 7ENLA 1CXEA 4OHQA 5A6AA 4JTUA 2YBVA 2YOCA 2BVTA 3UR5A 3PSWA 1SSDA 1P0NA 4GY7A 4UQAA 2HQAA 2OWXA 1UQYA 1XW8A 1XPYA 4B5UA 2ATMA 1K8YA 2UY2A 3AZSA 1L2UA 3C8FA 5HMDA 2WSQA 4NI3A 1CYGA 2QVNA 3CQ0A 3BCJA 1HO1A 3F7JA 2GJPA 4UQEA 2Y8UA 3OZPA 2WNNA 3QGVA 1IYXA 3LRLA 5G4EA 3LHYA 3S9IA 3CQHA 4XSLA 4R85A 1OD0A 1TMHA 1XLBA 4LF2A 1ZJBA 3UPWA 4J3ZA 4RJEA 1J6OA 4AD3A 3VNYA 3U5YA 3BH4A 1XG3A 3MBDA 1NQKA 4AD1A 4M82A 1CXLA 1ONEA 1RZMA 2NWRA 3WF2A 2OX4A 2GQ9A 3NG3A 3ERPA 4I5RA 3R11A 4A3YA 1UP2A 1A5KC 4V15A 3T0DA 4QR6A 3ZSSA 4J3UA 3VMOA 2VFDA 4GO9A 1FDZA 4FB7A 5GNZA 3B0UX 3GZ3A 5I23A 4D6HA 1VCFA 5J5RA 3DU0A 2HK0A 2IKGA 3ZT7A 1MXSA 1TPB1 4W87A 1PDZA 2I16A 3D5HA 3EWUA 3EWYA 1R6WA 1JGMA 2HV5A 1G01A 4UTFA 1E6QM 1ISWA 2ASHA 4X3ZA 5AFDA 1KXVA 3UPBA 3KRBA 4AWEA 2QUTA 2Y7FA 1XSKA 3BGAA 1BF6A 2V5DA 2OQHA 4UTTC 1S2AA 2J7CA 3TTYA 3U7BA 5JBFA 2C14A 4MNLA 3T2QA 4PMZA 2FHFA 3CHEA 4YVXA 1CDGA 1GG0A 4JTJA 1G69A 1CXIA 1CXFA 3D3AA 1KGUA 1XUZA 2VVNA 2YX0A 2ANUA 4RCXA 4F0SA 1DKWA 1DWGM 2YDQA 3CUXA 4JIEA 3ECQA 4XK2A 3OLIA 4Q8MA 3ZOAA 2I57A 4AY7A 3GHUA 4PUJA 1XLMA 3P5YA 1ISVA 2E40A 3LMZA 1E3XA 3UR7A 1TQXA 3QH2A 2BNJA 2P0OA 3RILA 4IGMA 2BXYA 3RG6A 2GJXB 1VBHA 4U33A 2I5IA 4TX6A 3L0NA 4Q8PA 4HNVA 2QCLA 1XKJA 2X0SA 3S5NA 1QRQA 3OYZA 3L7RA 3FDKA 4GXPA 3S1UA 3LEPA 1GCYA 2WVVA 4Q4MA 4CEXC 5FSDC 1FCUA 3CUHA 5C6MA 3QKZA 1OFAA 2BOFX 4CEUC 3KP1A 4X9YA 3CL8A 4E2VA 3AHZA 4PODA 3M4HA 3IVUA 2J75A 1F73A 4ENLA 2I17A 3RX4A 5L9FA 4HT3A 5A3HA 3RPDA 1W3TA 2XH7A 2QDEA 2WSPA 3HPZA 3ABQA 3GUWA 2HROA 3GC5A 1EGZA 2V69A 4RNFA 4QDWA 1UIPA 1XYFA 3DEQA 3AUJA 2XGZA 2WJEA 2XTKA 1B2YA 1QW9A 2R91A 1SW7A 4XVEA 3WLIA 3BG9A 3N14A 1KTBA 4WR3A 4JEQA 2QCCA 5DFAA 1VBGA 2O9TA 4P8WA 4IFKB 3D3FA 3GNOA 2Z25A 1Q6QA 2DW6A 4X22A 2ZX9A 3QR0A 2NQHA 3UF9A 2GQ3A 4K68A 2R94A 1W3NA 3M0VA 2P88A 3A9BA 1O5XA 3TJXA 1BYAA 3NQGA 1PZ2A 3T81A 1NH6A 1A47A 1BG4A 1UW9A 2HVNA 2DZTA 3S1WA 3H12A 1PYFA 1ICPA 1FWRA 4B91A 4YTTA 2ZXBA 3E9AA 1LBLA 4HPHA 3BW4A 4OIFA 1S5NA 3N73A 5H1WA 3ARPA 1J0KA 4O1FA 2PGFA 1NELA 3V0TA 3LTSA 3RU8X 3URQA 5AVHA 1YLVA 2V5LA 1YTDA 1EC8A 2J27A 4DF1A 3MBFA 1CENA 3PBUA 2RUSA 3M6YA 1TB3A 3UY7A 3VIMA 4AH7A 4K38A 2DSKA 1OY0A 3MP4A 2NXHA 2AL2B 3PZTA 2PC4A 2H9AA 4MNJA 3QV7A 4GZ7A 3O06A 4JQAA 4MKSA 3WFLA 1XCWA 3CHVA 3BUVA 1OC5A 2WPGA 2ALDA 4CKQA 3L5MA 3QFEA 1OG6A 3L2MA 2VC5A 1FHLA 4XIMA 3H7VA 3WK0A 4I7VA 1SJDA 2ZZ4A 4UTUA 5A6BD 2CLFA 2CFFA 1ML1A 3A6OA 3EOLA 5HNNA 5E9XA 2OOGA 3MYPA 4M56A 4HYWA 4S1FA 4Q6XA 3T08A 1DEDA 1CGTA 2PBGA 4IJCA 4H83A 3U5UA 3N4AA 2FZ8A 3HURA 4LOCA 1XGEA 3ITOA 3H53A 3EOEA 2JALA 1PIGA 4M1BA 4LY4A 3HGSA 3NUKA 3LRKA 1F05A 1MYRA 2DJLA 3WL0A 2GQ8A 1H7RA 4WDWA 3DBNA 1CLKA 4YPJA 3W27A 4A21A 3L4XA 3A24A 3GTFA 2EG7A 6TIMA 3CL6A 3CMFA 4MDPA 2WQPA 3TROA 2BZNA 5LIYX 1ITQA 1W5QA 1OJXA 1ITXA 3LHUA 3KS6A 1KV5A 3VIPA 3WD0A 3WF4A 3TLQA 4O18A 1L8NA 2E9BA 5FJIA 3HFYA 4R34A 4WJEA 4LUSB 1S38A 4DYKA 3W1QA 4QJ5B 3VIGA 1SO3A 1V51A 1UJQA 5F4SA 1OCBA 1RK5A 2XYLA 2Z1BA 4L64A 2BLEA 1BWKA 4GBUA 3DGBA 1AODA 4XZHA 2HS8A 9XIAA 5FA5A 2DUAA 4IH3A 4U31A 5C9WA 4I9MA 4GC4A 1D7KA 1R8LA 1CB7B 1GZJA 4P5UA 3RMEA 1W9XA 3UYIA 4WGHA 4EVZA 1H7OA 5AC7A 1UB3A 1K8ZA 3YPIA 4LBSA 4KWWA 3SR7A 2YA0A 4O13A 8TIMA 1OGSA 1UG6A 4K8EA 1XBVA 1OFQA 1NWUA 1BLIA 3OGVA 3GHTA 4C6IA 4RDZA 3IAPA 4HA0A 3IV3A 4AXNA 4Z17A 3VGGA 2E4TA 3TR2A 2WKLA 2Y85A 1KGWA 1NP0A 3CGTA 3P7YA 2ZUVA 4B5SA 4QBXA 1OX5A 3O63A 1PX8A 1YHTA 2W4XA 3I3EA 1BXBA 4A2SA 2RH9A 2QUVA 3QTPA 1P43A 3C56A 3KW3A 3ABOA 3SY1A 5F2IA 4RV8A 4C6JA 2Y88A 3L68A 3CZJA 1NJJA 3CB3A 2P76A 1WOAA 5HUOA 5AYYA 5FESA 4O16A 1GJUA 5LNRA 1Q7ZA 1PKNA 4W8BA 3GBEA 1W3LA 4AWTA 5D38A 1QHOA 1BFNA 1QDSA 5I79A 1FWNA 3D0CA 3DBPA 3M07A 1GZ1A 1TA3B 4RZ5A 1I45A 1JPHA 3TC7A 3VNJA 4H9MA 3KL0A 4WKAA 1B5TA 1WZLA 1G5AA 3KLLA 3P6LA 4M0XA 2YDAA 1TRDA 1G67A 5LGXA 4QAWA 3KWSA 3GNPA 3W28A 5A6TC 2IPWA 1PKYA 3POCA 2PGEA 2BDQA 4XQ6A 3MY9A 4PB5A 2V63A 3MMTA 2RDWA 3K5XA 4YJ5A 1YE6A 3ZT6A 2R6OA 3C2RA 1X1ZA 3F4DA 3EWZA 3GH7A 3VCCA 1H7WA 4KWVA 4PMOA 4FR6A 1PCKA 4GX8A 4O0QA 1KFWA 4GYPA 3KBWA 1S1RA 3N2XA 3NQCA 3QBUA 2W67A 2X2YA 1GYLA 5BMWA 4Z2JA 5D2VA 1R3SA 4H01A 3EA2A 3LXBA 5FJOA 4LWWA 4LH8A 3CZKA 1I9CB 4ZQOA 5GNXA 5ABFA 3CJPA 3STCA 1IZKA 3SUSA 4A3HA 1LWIA 2KX9A 3LHVA 1LYXA 2ZADA 1AQHA 2A7RA 1EOKA 1O95A 1JYVA 2F2KA 4TX8A 1WP6A 4MNKA 1EF2A 3KBSA 3BJTA 2Y8KA 4IL2A 2VRJA 1EJ7L 1UPMB 1UKPA 2C0AA 3V16A 2A85A 3H23A 3DKJA 3TAKA 2DVXA 4LW7A 1OBAA 1ICSA 3G8RA 1E55A 3PUEA 3LCXA 1GEHA 1EZ2A 1THFD 3VNLA 3QEZA 5XIAA 3WDPP 2Y5EA 3ELFA 4FLRA 2WZTA 3N34A 5CBJA 2Z29A 1D2KA 4XZBA 4B5TA 1O94A 3IGXA 4LC6A 2WAGA 5HMSA 2FVMA 3ABXA 3P84A 4B9ZA 4PUEA 3R2GA 1KFBA 1J0JA 1W9BM 2BFGA 2VOMA 1VAHA 1YDYA 4IM4A 3TSDA 5HPCA 3IGUA 3QPYA 4GH3A 5CG0A 4K8HA 3QHOA 1W31A 3PWIA 4QISA 2B31A 5IXEA 1SMDA 4UMBA 1FWSA 4B3ZA 1T5AA 1WYIA 2ZX8A 3DERA 3AIWA 5EMYA 1X8CA 2WJFA 3EWXA 1SQ7A 1O5KA 3PBGA 3HGOA 2BX7A 3UJRA 2A79A 4N6FA 1PYMA 3MDWA 3R13A 1RAKA 4IMFA 3MS8A 4KESA 3WNPA 5AHMA 1PTGA 1OCQA 3MMUA 2PI6A 3BXWA 3DYMA 2GUBA 1NP2A 3G22A 2Y62A 4GVHA 1QI0A 4HK7A 2A3BA 4WRHA 4RR4A 3VKBA 2CKRA 3VPLA 4NY2A 3MVIA 2V5BA 2BHYA 4Z2GA 3E0WA 1F9CA 4WJXA 4UTLA 4QG6A 3LERA 5F1UA 3GFYA 1M65A 4G1NA 1VJSA 3C8NA 3DCPA 4DM2A 2D2JA 6CGTA 4E2OA 4JN8A 4E4UA 2VFIA 1EDGA 4PMUA 3OVQA 4I5XA 2WCGA 4WVXA 1UWTA 1JQXA 1W1VA 1JXKA 3GC2A 4ACZB 3OVRA 3ALGA 1XF0A 5EGRA 1S2UA 3SURA 2R1LA 4JHZA 1EA9C 2WSYA 1P6BA 2BGQA 3A12A 3TZFA 3L5AA 3UZZA 5CCZA 5A1AA 3AU2A 2A3LA 3H2FA 3ALFA 3SSJA 2J7GA 2IPFA 5CAKA 3EXSA 1G6CA 1VPXA 3LM7A 3DYPA 2G4FA 4GISA 2WM0A 4LANA 1LL4A 1PIIA 4C60A 3UZWA 2BVDA 1CLXA 4C65A 2XGBA 4JDBA 4CVWA 1TTIA 3ZO9A 3AHVA 4XZWA 4BF7A 4MAZA 3TOPA 1FWDC 2D2GA 4UTWA 1JPMA 2PB1A 4JY9A 4DBUA 4EK7A 2E25A 4R7WA 2WPBA 2J7DA 3GW0A 2VCCA 3CASA 5FKYA 1Z89A 4HK5A 3W7EA 2MANA 3RJYA 4BF5A 3H8AA 1A0DA 1A5AA 1UD2A 4IX2A 4GVIA 4C90A 3UG5A 2HDJA 1EWDA 1NWSA 3N11A 3WN6A 3T7VA 2C16A 3MV11 3PZVA 1IR1A 1REQB 3LV6A 4AIEA 3E49A 4NT0A 3CEPA 3FNDA 1JPKA 1O1ZA 2VEGA 1AL8A 1UUQA 1FKXA 4HD5A 1JPIA 7CGTA 2ZQ0A 2VD8A 4N2YA 5HNTA 1M1BA 3ZJKA 3ARRA 3RAOA 4A8IA 5T91A 3MMWA 3THCA 4Z42C 5CJ5A 3R94A 4ZSUA 3PNUA 1W1TA 3TJLA 3UP8A 1RQEA 2D3NA 4US5D 3EPMA 3KE0A 4I9AA 1Q7MA 4UFMA 4CQAA 1W8GA 1TV7A 2YW4A 1A0EA 4NXSA 3NEHA 2VX4A 4GI9A 4LYKA 4X0VA 1WDDA 3THDA 3U8GA 1N8WA 4QCEA 3W7JA 1MUWA 1OX4B 2YLLA 4REQB 1KM5A 2DVUA 5D4YA 1LQ0A 1P0DA 4WKHA 1I0BA 4Y8FA 2XFFA 2VWSA 2CLKA 3MHFA 5T9CE 1S5MA 3L0KA 3CQKA 4B92A 4HU0A 3EKLA 2W92A 4UR8A 2ZC1A 2V5KA 2V38A 5CLWA 1F8MA 3V18A 3KCOA 4EPEC 4KRUA 3FV9A 3KBVA 3BLEA 4S3BA 5HQEA 4JHOA 3C2YA 1GEQA 3LENA 1XIGA 3RCNA 3KTXA 3C2OA 3W2NA 2Z1XA 4O50A 4A2RA 3VU2A 4F0KA 4DZIA 3O16A 3VGEA 4ZODA 2WNZA 2CXGA 3NOEA 5U7SA 2XIQA 4EXBA 1KFLA 3C52A 2QR6A 3BCFA 5FEZA 5BZAA 2XINA 4UTWC 2QJNA 4A05A 2VVSA 1LDCA 4JTHA 2IQTA 1AQMA 3T0AA 1P1MA 3A5VA 3MHGA 1TJRA 3HMJG 5DF0A 2A1YA 2QIIA 3UBPC 4AF0B 2B81A 5REQA 3UY8A 2UBPC 1UD4A 1M41A 5BXSA 3T0BA 5TIMA 3V1HA 1V7YA 4LQ1A 1SO6A 4U5KA 4EAYA 4H41A 3O6CA 1WO2A 1XSIA 1VFOA 2GVEA 1QVBA 1Y5VA 2VQUA 5FACA 1KBBA 1T6MA 4ORIA 3UWUA 4H6KA 3GR8A 1MEHA 5DCEA 4QE1A 3K8MA 3CAKA 4ZE5A 4AY8A 1E5NA 1Y8BA 4FNUA 3CAVA 1TE6A 3UPMA 3ITYA 4MJ4A 4W7WA 2E7FA 3TYDA 2YB1A 3TYCA 3SN0A 1G0CA 3QY7A 2MUCA 2WZIA 1JDEA 3BQ6A 2OT1A 3EKZA 3TQPA 2P5NA 5G2IA 2FZ9A 2O7QA 1ECEA 3AWNA 3VZXA 3EOUA 4UZSA 4Q8TA 4IIDA 1XH1A 1GOKA 3SI9A 1VBJA 1AA1B 3GFZA 3B8SA 3N17A 3WL1A 4FF5A 1W9PA 1P5BA 1KGXA 2X41A 2WW5A 2FYMA 4JTFA 1CGVA 2VR4A 4JXCA 3AYTA 1IIHA 1XD0A 4INFA 5D09A 5CEWA 3WMBA 2H8XA 4A3UA 1B9BA 4S23A 1QI3A 2DQXA 5CSYA 2HBVA 2O92A 4DM1A 4XG1A 4UZUA 4HTYA 1UP3A 4ADTA 2EEXA 1PBGA 3CH0A 3NDYA 2CLMA 1TSIA 2NQLA 3QVQA 1TV8A 1EJWC 1PCWA 3RLUA 3BZGA 2XFRA 3U2OA 1CZ1A 2PP0A 1Q8AA 3RIKA 3MZNA 4DBSA 4GUFA 2D23A 3EWBX 4S3KA 2J25A 4DYJA 3CK5A 3LBOA 1JD9A 4OGZA 3UR2A 1KRAC 1XWYA 5KZ6A 3MU7A 2GK1A 3VE9A 2PPGA 3WUBA 4P7NA 3LV5A 3VYLA 3FY1A 4D1IA 4GCXA 3UT0A 2OPJA 3FEMA 1IXPA 2WM1A 2GJRA 5HAOA 3PP7A 2VEKA 3S4TA 1ZZMA 5CC5A 4B3LA 1TA3A 4IGSA 4JQ3A 4E5TA 3A23A 3LPFA 1S5WA 5DCDA 3VI2A 3PZGA 4R9OA 3TTQA 3ZR5A 2PDKA 4GZJA 5C0QA 4MY1A 3R7MA 3PBVA 4X9SA 2A3AA 3TA9A 4QDPA 1U1HA 3W85A 1JZ7A 5KZMA 3NZRA 1W6TA 2E09A 3CT2A 1H0GA 1NWRA 4LUSA 3IUDA 4IGHA 4QNWA 2XZ9A 8A3HA 1WUEA 1LOSA 1RK6A 4DI8A 1KQZA 3TDFA 3TFCA 3ES7A 4IMEA 3ZSTA 2QCEA 4GVFA 3ZWSA 3N2OA 1Q6GA 4F8XA 4C6MA 3IIOA 1QK2A 3MJMA 4YTRA 3PZ9A 1OX4A 4UB9A 3FKKA 3W1TA 5BU9A 1WB0A 2JQXA 3MWCA 3N3TA 4GLEA 1TWIA 1UD5A 4NG3A 2CWNA 4U10A 3V7PA 4C6KA 1FWWA 1JQVA 3HTWA 3KZSA 3OG2A 3M16A 1SUXA 2HISA 2GVJA 3PK7A 3SFKA 1JNDA 4EPKA 3AXHA 3WBXA 1PHQA 3N2MA 4JFSA 3BVJA 1JAEA 1F8IA 3C3NA 1G7UA 4RZ4A 3LRMA 2V82A 4A8LA 3SCQA 3MUAA 3OZYA 1YTKA 4MLRA 1PL9A 1O4UA 3OZOA 1DJHA 4I5UA 3QMTA 3IUHA 4W5ZA 3BLDA 2QF8A 1K8XA 3TFXA 1IT0A 1QI4A 4WDTA 2A2IA 4JZ5A 4KEZA 3TQ0A 3GKAA 3KRSA 1ODUA 1F6KA 1LM1A 4HPGA 1VFMA 1EYWA 2PDGA 4WSHA 2V3GA 1NOFA 2HPMA 1BQCA 1F3XA 1ISXA 3N2CA 3J7HA 3T0TA 3N4EA 3P80A 3CYJA 2HVMA 4DXKA 5D8WA 2E6YA 4JNMA 4EF8A 4MYAA 4UCFA 4EKJA 1JIBA 1DQXA 1HJUA 1AVAA 3EWWA 3A4AA 4M19A 3CO4A 1T96A 1V0KA 1TUFA 3NXLA 1WDSA 2PSNA 3DH7A 3LXAA 3GHSA 3DKLA 3VFCA 1DXEA 5CPOA 3WD4A 1PWLA 3GH5A 3ARWA 1LWJA 3W6MA 2OB3A 1XX1A 1ZSXA 1RD6A 3CAQA 4G7FA 3ENLA 4DBEA 4IG2A 2EG8A 3T09A 1B3WA 1S5VA 4S3GA 2PTDA 2OWWA 1HJWA 5D04C 3SADA 4NZ1A 5CQ1A 4B5WA 1S3HA 4DJFC 1J8VA 1RY8A 1VPYA 5K9XA 1SMAA 3KS5A 4L7ZA 2GJNA 1Q7QA 5A6JA 4E4FA 1A5CA 5FEPA 4I90A 4AVOA 3R0UA 1ADSA 4O1BA 2XVNA 5EFFA 3UWVA 3I6EA 5D9OA 3HMCA 4DZHA 1GVFA 4WZHA 3VX0A 3GXDA 3G77A 3JZEA 1HKIA 3NIYA 3NNTA 3PBWA 1RP9A 4DUOA 3M43A 2IQ0A 3WY1A 4YTSA 1FH9A 5MF5A 4DEFA 5CBBA 4GKLA 1GORA 3WQ8A 3DDMA 4Q22A 3CHCA 1WXJA 2IUZA 4GINA 1HFBA 3ARSA 4S3EA 2X2GA 4ZQPA 2DH2A 3CQIA 3F4WA 3SN4A 3FGCA 1FWEC 1U22A 3BLFA 3P82A 3WQGA 5AYXA 2BOEX 4QTGA 2ODOA 3N2BA 5D30A 4GGHA 3GY1A 4GXMA 4U2ZA 2VELA 4QQ3A 4DAIA 2O4MA 1FXPA 4ZOAA 3A22A 4AEFA 4TO8A 4IF2A 1EDQA 3BWWA 1OFPA 2QYGA 3WO8A 3RR4A 1YDVA 5I03A 5F7UA 3ZWTA 4WUIA 4HNCA 1I1XA 1PHWA 3PG8A 4DZAA 1KCLA 5C9UA 2A7NA 1QOQA 2R9RA 2FDMA 3GG0A 1AQ0A 2CZDA 3NGJA 1IGSA 3FYPA 1XIEA 4H7ZA 5J04A 2KAUC 1JG9A 4WLCA 3B06A 4FPSA 2FZMA 3L2LA 4MB1A 3LM3A 4KCVA 4NJIA 3Q65A 4IHCA 2PLMA 1FUYA 2G97A 1IWAA 2XH4A 5A6SA 3LU2A 4Y2WA 4AHQA 2ZRWA 3DN5A 4FK9A 1WCGA 2ZZ7A 3O07A 3W2LA 3K1DA 3W01A 1J0ZA 4L9XA 3B40A 3S9ZA 4NF7A 3PF3A 4WGXA 3TNOA 1JJKA 4ZO9A 2NV2A 2WMFA 2HXTA 2VENA 1XICA 1FBAA 4KCTA 1C93A 5GPRA 2Y1HA 3FA5A 3MKKA 4HU4A 4CNNA 3R0DA 4GO8A 4WDXA 1AW2A 3VIFA 2ZXDA 2ABBA 2IS7A 1FDJA 3LB0A 4J27A 1XINA 1J9YA 1QO5A 3GDTA 4IISA 3N12A 4PN2A 3CV1A 3MPGA 3VD7A 4PCFA 3NAVA 1MDLA 3LNMA 4E0CA 2XM1A 1DXFA 3TVAA 4FNTA 2H3BA 3WK2A 2INFA 3CS2A 2WBGA 2V5JA 3KVLA 5FL0A 5HUPA 4CD5A 1MW3A 2WO5A 1VEPA 3UZJA 1EJVC 2XN2A 2F2HA 2VMFA 3EA3A 1T8QA 4P8UA 1MNZA 3AUOA 4P8VA 2OQLA 4W84A 1GKRA 3IVTA 3W70A 4GA8A 3RR1A 3DG3A 4UFLA 1MSSA 4UNLA 1US0A 3QRHA 3URBA 2NQJA 3L4VA 5LNSA 5KMYA 2ZRVA 2AQVA 4ZENA 1E15A 2FFCA 1T41A 3NR0A 2O56A 4GIEA 4ZR8A 3SRHA 1KKOA 3LZ3A 4S2BA 1K02A 2V0TA 4FXRA 1KNWA 4A4AA 3GVGA 1OADA 1MQRA 1TPWA 2UY3A 1C9DA 4F66A 1ZAHA 3H4WA 5BU6A 4DNHA 4AFYA 1TX0A 2QV4A 3NJ3A 3GIYA 3CIWA 1A5OC 2PDLA 4PYSA 3EEGA 2ZXAA 1TWZA 1XLLA 3AC0A 5AZ0A 2PU0A 3TKFA 3QR1A 1JCYA 2YCLA 4MYXA 4PCTA 2QKFA 5A8PA 3GZAA 8XIMA 3W74A 3MQTA 2W27A 3AIUA 3W2KA 1BXNA 4E4PA 5E1QA 2WC4A 2GJXA 3GE7A 1HG3A 3KVJA 1AFSA 3NDOA 3MUIA 5AKQA 3KEHA 3RX2A 3USZA 3GYCA 2XIMA 1KW1A 1TE1A 1EH9A 1X38A 4M7SA 3S5OA 2G3MA 3P93A 4HCLA 2ZTKA 5BWAA 2YLAA 1K70A 2V30A 3WMSA 1D3HA 3PY2A 4PTMA 5EMLA 1Q6FA 1WXZA 3IGSA 1C8XA 4FOJA 4GI8A 1ZAIA 3SEPA 2J8GA 3MUXA 1E1CA 4MLJA 1C91A 1SFJA 3CWHA 1ELSA 4ONVA 3G0SA 2ICSA 3IIZA 5LXEA 1ZRQA 4ZB2A 2WZMA 4Z0JA 5C70A 4C1LA 2EKCA 3DUGA 1E5JA 4WQ6A 2E1DA 3S5SA 2W62A 4AXKA 3B97A 1RVGA 3WH7A 3B03A 2WQDA 3NYDA 4JTSA 4K39A 2QUUA 1WDPA 1DQUA 4XBSA 2ZZ2A 2XIIA 3HBLA 3SQMA 4QSFA 4F9DA 3FA3A 3LS9A 1Z8AA 1JCLA 1UQZA 1JCNA 4NKCA 3SCTA 5ECUA 3CZLA 1E9ZB 3PFMA 3QN3A 1O5RA 3C2EA 4M51A 2DORA 1W1ZA 1ZL1A 3BOXA 1RY0A 3R0KA 2E6DA 5DQPA 2D0HA 2F6XA 2EGZA 3DOPA 3M0ZA 2G8ZA 3DIPA 3HG3A 2CCRA 5DRCA 4Q4PA 1XIMA 5KSWA 1I6NA 1SFTA 3QSTA 1BF2A 3H2NA 3BG3A 5IBXC 2F6UA 2Y2WA 3FSTA 2PDNA 2Y8VA 3AIEA 3SRFA 2WVTA 1GVRA 3SIMA 2PWEA 4JAWA 3WF0A 1DVJA 5HOSA 1DWAM 1ZP4A 4JDYA 2FPTA 1U33A 3S42A 1BKSA 2P8CA 4JX6A 1ITUA 2INEA 3EB2A 3NQ6A 1M01A 1PUDA 1RCQA 3CZ8A 3W7IA 3EMCA 2G50A 2BY1A 4DPPA 3EPNA 1S46A 2DSVA 1DYSA 2PLJA 3RX3A 2RJHA 4CCCA 3W4RA 2JKAA 2VP8A 1K4HA 3KLKA 2CU0A 1DHKA 2NUYA 4P8XA 2BVYA 3WEZA 1REQA 1EJXC 2J78A 2WVSA 1VFHA 2UZ9A 4FP1A 4CUCA 1MNSA 3NTYA 1E0VA 4JQ4A 3UXLA 4LAZA 1DHPA 1KBKA 2X1SA 3ZVHA 1KKRA 1Z3NA 4POCA 3I4EA 3IIXA 1KM1A 3F5JA 1LBFA 1VLIA 3GDLA 1UWSA 2IPGA 4EPBC 3RDKA 4NZ5A 6REQA 5DMNA 3VZZA 4UFJA 3VDHA 1JCXA 5B7ZA 4E6MA 5H2ZA 1R2RA 1KFEA 3AIRA 4J3WA 1BRLA 3BCDA 1XCFA 3M44A 3RXZA 3KTCA 3OZMA 5FF0A 2RGLA 3IS4A 3RNDA 1TIMA 1G94A 5K7JA 3U2ZA 4DUVA 1VH7A 1N55A 1GUVA 4YHGA 2DIKA 3LNPA 4G6CA 1P6WA 1JUEA 2AL1A 4L5ZA 2PGWA 4XZ9A 2BOGX 4AD4A 3FXYA 4NAFA 4AY1A 1MEWA 4CNTA 2FQIA 4GWEA 4CN4A 1S2VA 1R47A 3W73A 4KGJA 1Q85A 1M04A 4LBUA 1HJXA 1TO3A 1Q63A 4PBFA 3W7DA 5HWMA 4LUYA 1E6XM 1ADDA 3DC0A 3NQ8A 2QCDB 3K8LA 3NQ7A 1FY6A 3TONA 3WDRA 1UR0A 1V6YA 2D22A 2W9MA 1JNEA 3O0KA 1VBRA 2GDVA 3XISA 1FWJC 4KIEA 3TQKA 2DIJA 1Q6OA 2E9LA 4A29A 3HG5A 3EMZA 4C6NA 4JHMA 3MO7A 2OLHA 1W1A1 3DZ1A 3CWNA 4O1CA 1EL3A 5T8GA 1UA3A 2Y89A 5IBXA 1DJGA 4I7WA 4XAGA 4LV4A 4DJDA 4O4VA 3G1DA 3K30A 3WJXA 3TV8A 1ZY9A 3DI0A 1A3WA 3GXNA 4QG8A 1DTUA 4JKMA 3TX9A 4E8CA 5BRBA 2Y7GA 3IAQA 1QAPA 4QRNA 5DO8A 1C8YA 4N7QA 3F5LA 1XYBA 4D9PA 3PFRA 4DUWA 1JL8A 1QW7A 5LYRA 1F76A 3H2MA 4PB3A 1VGAA 3HG4A 5LZLA 3ZLGA 4DBDA 4GGBA 2YKKA 1AW5A 4XWUA 2GVGA 1RQBA 3JVAA 1MRAA 4GFIA 4Y9NA 3MSGA 3ARTA 1M5WA 3RCYA 2EO7A 2OEJA 4Z1YA 4RXFA 3TMQA 1J2BA 4NJKA 3WNMA 6ALDA 3VOFA 1EEPA 5C9XA 1ZGDA 4CU6A 4PMYA 2V2HA 3BK0A 1RJRA 1U1UA 2XVKA 5BXTA 2VUNA 2BVWA 3WDQA 2ZWYA 4FNSA 4Y9AA 1V5XA 1X6UA 9RUBA 1KM4A 4J1OA 4RE4A 3NM1A 1DTNA 3WG6A 1VR6A 1JUKA 3GR4A 1WE5A 4DJEC 2XIJA 4JYFA 4XSMA 3ZXWA 1ZTVA 1XYCA 2OX1A 3PSVA 3TSMA 4AYGA 3WQEA 4PUWA 1OZQA 1W3IA 4PL1A 4Q3MA 2JF6A 3DESA 2Z26A 4IP5A 1EP2A 3NSXA 4QEHA 1NSJA 3VDCA 3PN8A 1YTEA 3CHFA 1NF0A 4AEOA 4DX3A 2X1TA 4IMDA 3IARA 3GVRA 4PUMA 1UHVA 4HSOA 1UZHA 4MY8A 2R24A 3GNRA 4NX5A 3TCSA 3H6OA 2NQ5A 4FSAA 5HNUA 2Z6IA 1BWVA 1JUBA 4AIUA 4DPQA 4UQ9A 4M6QA 1P1XA 1POJA 2OR2A 5D2TA 1J11A 4JTTA 4YVVA 2REQA 2BBFA 3N18A 1NAL1 4PUUA 1EYEA 1P6CA 1E6SM 4FIQA 3QC3A 1HXJA 1K03A 3CWOX 1UC5A 1VYPX 4O4WA 3XINA 1J10A 1B0IA 1EUNA 5IHSA 3CYVA 1I1WA 3STGA 2Z1VA 4U28A 3UGVA 2VFHA 4MWAC 4CD4A 4P7RA 4W8AA 1XLKA 4E38A 1IE7C 4PRTA 3T8QA 4DJDC 4K1GA 3CPUA 3WLTA 7REQA 2FPVA 2E67A 1NOWA 3QZAA 5FI8A 4N9EA 4NU7A 1YNQA 3OJGA 2BMBA 4MB4A 4GNJA 3N13A 1EOMA 3K1GA 2TMDA 3DXIA 3E1F1 2ZCGA 1UWIA 4Q32A 3MANA 2EG6A 3S9YA 2X16A 3UWQA 3BAJA 4MM1A 4Z2LA 3UZXA 4LFYA 4I6KA 5K9CA 5E93A 5EA9A 1AD4A 3BOLA 3M9YA 5I6SA 3W81A 1XBYA 3VMNA 1RHCA 3NL6A 4AZ7A 2VURA 3G1XA 3I7SA 3W1NA 2VEFA 4MPKA 4ALDA 4D8ZA 4W93A 1DE6A 1XH2A 1VD6A 4LRTA 4XTIA 2XJ7A 4ZCWA 2P10A 2D24A 1GJPA 3P3BA 1EHAA 2D0GA 3HA1A 3TC3A 2J7BA 4US6A 3C0QA 1ZS2A 3NSNA 5A5WA 1MZHA 3UFYA 5FAGA 2PTYA 3WBEA 6ENLA 3S1XA 2YGYA 3IJ8A 1RJPA 4L6DA 1JCJA 4UOJA 5DBUA 2IXUA 3M0KA 4H04A 3W29A 2X1UA 5IHRA 3OODA 1H3GA 1FKWA 1ZJIA 3NQDA 1A50A 2J62A 4U2YA 2VJXA 4DB7A 1EX5A 4HZ6A 4PTNA 3N15A 4ZQRA 4HU3A 2CBUA 3SUUA 1ZB5A 4YU1A 2VI0A 3AMDA 3MCMA 4OVXA 4PBGA 3GU9A 4XKYA 1CXHA 5C7VA 2QW5A 1XYAA 4LUTB 5DY3A 1C90A 1QUMA 1MQQA 3PANA 1LTDA 1XYZA 2C13A 4FAMA 5F2MA 4RX0A 2VM8A 4ACYA 4XBKA 3M7SA 2PMQA 4Q8NA 4R53A 3NZPA 3BGGA 3WQ6A 2C15A 3FJ4A 4EE9A 4FLQA 1JCTA 4ERGA 3LLFA 3B9NA 3W87A 3LMYA 3OA5A 1A4MA 1KBJA 4K36A 3UERA 1GYMA 1XCXA 4O54A 2JGQA 2WMGA 3R79A 1EGVA 4NJGA 4Q7IA 4XKMA 3BTNA 1QASA 2FIQA 1ZBVA 2ZA1A 4OOZA 3PUDA 4DO4A 1FRBA 1E0UA 5DMLA 2WK2A 1GVSA 4IMCA 3L4YA 3A13A 1CT5A 4GY1A 3PG9A 3K8KA 1OHLA 4U3AA 1XBXA 4QSHA 1JZ3A 1IEVA 4REQA 3PTMA 2G37A 4CD8A 3A4XA 4H9UA 3UXAA 4Q8WA 2C18A 1IR2A 4KFNA 1JDAA 4ZFMA 2YJQA 2Y0FA 3GU2A 3TXVA 1R9XA 3QHNA 2VZUA 1OYBA 3MVTA 2FTWA 2OYKA 2ATSA 3W75A 2HJPA 3WQDA 4AG0A 3E3HA 2EF9A 1MO0A 1XLIA 1KQYA 4Y7EA 1F61A 4PE8A 5C2XA 3SN1A 2V68A 5A2BA 3VOCA 4GH1A 5C9ZA 3AU6A 4KEVA 4ZZ9A 2YA1A 3USBA 4PZVA 2A3HA 3C0SA 1PWMA 1KM2A 1OG0A 2E28A 4QDMA 4OECA 4H7VA 3B9AA 1HT6A 3W7NA 3W7MA 4GUJA 3SRKA 3N9RA 3OHIA 3BANA 2PD5A 1DWIM 1W9VA 4PEEA 4JTDA 1PKLA 2OKTA 4PCNA 4C7GA 3N25A 2QMJA 3W38A 2NX1A 3G8EA 2QCMA 5JIWA 3E0VA 3GVVA 4NI8A 3VKKA 4ICMA 4ICNA 3EZ4A 3BLIA 2EHHA 5H6HA 3HB9A 1BTCA 5C8BB 3WJYA 4YN5A 3W26A 4ZMGA 1BYDA 5D8ZA 1Z9AA 5DXXA 4K37A 4BQ4A 2VTFA 4MZ8A 3IACA 3LX9A 3M0JA 1GVQA 5FEXA 4TU1A 2HNEA 2F84A 4AZIA 3IJLA 1GNXA 4A3QA 2JF7A 4I8YA 3SJ3A 5GJPA 4L9YA 4F79A 2W5FA 3T1GA 4NQ1A 3GXFA 1KM6A 1OCJA 3WD1A 4MTVA 4ZL1A 2NX3A 3BPWA 1QCWA 2IQDA 3W7KA 1OYAA 3RM9A 4FHAA 2B4GA 1EA0A 1XIFA 3BLLA 4H8NA 2X0YA 3N2TA 1E4IA 2FGZA 3T0CA 4H8VA 3E0IA 3NL2A 2PDIA 3ANUA 3EX1A 4H2HA 3KOWA 1FWAC 1KM3A 2DT1A 4KRZA 3QC0A 4L1GA 5CZSA 1OZMA 2FH8A 3KRZA 1FWFC 1H5VA 1ZNNA 3GX9A 3ZZ1A 1E1FA 1RCXB 3I7QA 3FS2A 5HWJA 2ZUSA 1JDDA 2CETA 3KHJA 4IQEA 3W3OA 3HPSA 2NZLA 3L0GA 4MDOA 3S2NA 4QLJA 1KXTA 5CZTA 3U7VA 1BVWA 5H91A 1UR4A 2J74A 1QHPA 4KCUA 3OVGA 3QV8A 4HHLA 3UZYA 3ZJ8A 3LG3A 5HA7A 2OEMA 3LCLA 1AH4A 4HBKA 5HXMA 1LUCA 3GBDA 1MRQA 4M24A 4EWJA 1T99A 2W6RA 3V0UA 1PZ1A 1UZDA 1LQAA 1RBOB 5C2CA 3W84A 1HKKA 4AB4A 3WF1A 2G3JA 4J5NA 5CPSA 3DHFA 2AQOA 2YYUA 4M29A 3Q94A 3PAJA 4FMVA 1PX3A 3AYSA 3RCMA 4CLMA 2G41A 3SECA 1W1YA 2UV8G 5C2GA 3FYOA 1XG4A 5D9NA 4OZOA 3AYRA 4QNEA 4KIRA 1OFRA 1CW2A 3H70A 1GOMA 3A4WA 1L9WA 1DIEA 1ZBCA 4TXEA 3EWCA 4GQ0A 3OQEA 4BS0A 4XUGA 3RM8A 3CLMA 3V4BA 1K6WA 3TN6A 5RUBA 3N6QA 2QCDA 3THUA 4B5VA 3VABA 3T55A 1QFEA 3GG1A 3H26A 4EAMA 1TR9A 3B9OA 3C61A 3N1AA 3ARZA 4WF7A 3M46A 3F2BA 3IGHX 1F3EA 2I5GA 4J3TA 2DEPA 1B3YA 3CTTA 4AZCA 3IIVA 4OBRA 2YR1A 2VFGA 1KCZA 3ANVA 2J88A 5FF2A 1EHNA 3L23A 3WKZA 5GJMA 2DY3A 4KT2A 4RL3A 3GDRA 3SJNA 3ZR6A 3ZQ9A 1YDNA 4GZIA 3CAWA 3GVQA 3UGRA 4MB3A 4FF7A 4P7OA 3GLCA 3I3DA 3S3GA 1XFBA 1J0HA 1US3A 4MIMA 5EKYA 2EJAA 2OZTA 1PJ9A 4MPQA 3S6TA 2WZHA 2Z7GA 3W76A 3FSUA 1CGXA 2E9MA 3E2SA 3UJSA 3BDKA 4N9DA 2X42A 4P2VA 3W2UA 3OO2A 1QO2A 3R12A 1TV2A 3T44A 1I2OA 4W7UA 3U4AA 4GUIA 4BQ5A 2GGIA 4I9JA 3A3WA 3L4ZA 4HGXA 4A6GA 5IFTA 2DSWA 3G2GA 3WQVA 1VFFA 3C0JA 4UQCA 3R6IA 5E0CA 4UCGA 1XLCA 4EP8C 3OLDA 3GTHA 2FLIA 4LVGA 5I09A 2H6RA 1BQGA 2PDFA 3W6YA 3P61A 1GW1A 3SRDA 3EDDA 1Q6DA 2X1RA 2NUXA 3MO4A 3R1ZA 3APYA 5GNYA 2EQDA 2NQZA 2QQ6A 1H1NA 4RDWA 3GTNA 4BWLA 2DW7A 3BMWA 3F03K 5AECA 1PO9A 1I60A 4H6EA 4CGTA 3EDKA 1XRTA 4TTGA 3H7UA 2CLOA 2BASA 4J35A 1W91A 2VRKA 2OTDA 3RFAA 1E9IA 4Q7BA 2HZGA 2QV5A 4PFMA 3N19B 1OCNA 1PKMA 2CEQA 4FEZA 4IT1A 4XO7A 4IMAA 1ONXA 1HJSA 1S2TA 4HKPA 2F9RA 3KVMA 1KD0A 1TWWA 3BW3A 5A6LA 4GZEA 1R87A 3VUPA 1IV8A 3QF0A 3KBMA 3UWWA 7ODCA 3KP0A 4NYUA 3DHPA 1R9YA 2WHJA 1GVYA 4GKTA 1XXXA 3MWAA 4U5IA 2X7WA 3ITGA 1HIZA 2I9EA 2HXUA 4OFCA 3EOSA 1HGYA 2QEZA 4DI9A 2XZ7A 1ZUAX 3EEZA 3M5YA 3FFSA 2YXOA 2XVGA 2PDWA 4ROPA 4YIWA 5IM51 3ZIZA 1W3HA 1E1EA 5TNVA 4NL1A 2X7VA 1OWQA 1R3YA 3N29A 1XLJA 1QWGA 4ZQNA 3RO6A 5C71A 2OZ8A 4FNQA 4YTQA 1E4NA 1MZRA 4DIAA 4H9ZA 6PTDA 4YXGA 4H7CA 2Z7KA 5A6KA 3UJEA 3B4UA 3GTIA 1M7OA 1W0MA 3L65A 4C6CA 2UWFA 1YQ2A 1TZ9A 1NDYA 4NZJA 1HJVA 1J0YA 3W1MA 3IRSA 5I77A 3AMKA 1LBMA 3OLGA 1UBPC 5K4XA 1UR1A 3CMGA 4O28A 2BS9A 4UUIA 4CVUA 3BURA 3STFA 4LAOA 2PF0A 4W88A 4KW2A 4J2PA 4E2BA 4AVFA 4ZVJA 1K9FA 3S2LA 3E38A 2WHKA 1UMLA 1W32A 1SW0A 1VIZA 2Y4SA 3I7RA 3ZJ6A 3H54A 4KH2A 2VFFA 3M1ZA 3JW7A 1FHUA 2QAPA 4XTDA 4XAZA 2C8NA 1IIGA 3BGJA 1LWHA 1W2VA 2DUXA 2OYMA 3A4JA 3TYUA 5A8MA 4TMCA 1R3VA 1TR1A 5CKSA 1KCKA 4RNJA 3HPXA 3RYSA 1V3HA 4PMJA 2QPSA 3H4GA 2FHBA 4PCPA 4AD2A 4XV0A 3PPCA 4IG2B 3MZ2A 4KGLA 4GQQA 3FN9A 3M5ZA 1GOIA 2QJJA 2J6VA 4HK6A 2B7QA 4P61A 2CLIA 2OKOA 3BO9A 4I3GA 4RDYA 3DC8A 4GI6A 1OFOA 2CLLA 3NL5A 4IX0A 3MCNA 4PGLA 2NXIA 1KWGA 4W7VA 3FW6A 2FJKA 3M0HA 1B54A 3MHUA 1J79A 1MDRA 2Z6JA 3WCZA 3AICA 3TW6A 1H61A 2DVTA 4ZTXA 3W24A 3PJXA 1NEYA 3M47A 3PPHA 4Q4SA 4MFDA 2BWGA 5AHEA 3WJWA 2J8TA 3H2AA 1R9ZA 3ICJA 4CQ9A 3MTWA 5DT5A 4MG4A 3NZGA 5JH1A 3PJWA 4C6BA 1XLAA 5DX7A 4B2DD 3P8JA 3TZNA 4Z2IA 4E3TA 1TQJA 1BYCA 2YCKX 1UMYA 4HZ7A 4N02A 4TIMA 3LOTA 1A0CA 5JMUA 3HPFA 1UKSA 1L6WA 2TAAA 3UVIA 2A21A 2DZBA 2VCAA 2NUWA 2CIPA 2VFEA 1V79A 4WSJA 3KCLA 4ERAA 2HE8A 4KERA 3W7PA 3NQMA 2OELA 5I2UA 3VOGA 1RJQA 4MWAB 3U2EA 3UZ5A 3W82A 1VEOA 1XDLA 5HR6A 4XD5A 2G95A 4B2DA 1UASA 1I2QA 4AZCB 1DIKA 2EBNA 2WCSA 4Q4KA 4G8TA 1UA7A 4JD4A 3W7OA 2PFHA 3FK4A 3SFWA 5DBTA 3OG3A 3VVGA 4LUTA 4C7DA 3BC9A 1Q6CA 2O9OA 2EAWA 4Y6GA 4AZBA 2TSYA 3E96A 3W0KA 4EACA 2C3ZA 2QDGA 4J3SA 3P2VA 4CCZA 1UPPA 1GTEA 2A3CA 1X7IA 5LNUA 3T07A 1E43A 1NQ6A 1V77A 4K8GA 2B7NA 1JCMP 1VJIA 4HSNA 2NSOA 2FVLA 4WJ8A 4IIGA 1UOZA 2YXXA 4JFTA 5ECVA 2CLHA 3KWXA 1DJQA 2ZWZA 3UXDA 5FF7A 4HTBA 1L6YA 4RE0A 1TPUA 2KZHA 5HBFA 4HPXA 2VDGA 3DHUA 2AAAA 2BHZA 1RA0A 3HJEA 3OW1A 3WBYA 2ZRUA 1VCGA 2J13A 3GTXA 3WNKA 5DXYA 2C1HA 2Y5SA 3LQLA 1QTWA 3T6CA 1RBAA 3PM6A 1L2QA 3VZYA 1H7NA 3DX5A 3GHRA 2W61A 3EMQA 4Q8OA 1QW8A 1RUSA 1PDYA 3LSCA 4UIOA 2PD9A 3KDOA 3AIQA 3BSMA 3LN3A 4LY8A 4ZA0A 2Z1KA 4PA8A 1AZ1A 1YDOA 3C2VA 5F1VA 1E56A 3SCPA 1Z48A 1UWAA 3LDVA 4Y96A 2ZZ6A 1FP8A 4HMEA 4IPJA 1QPNA 3FEQA 3LTPA 5CBIA 1Q65A 1NDVA 1LT8A 3INPA 4IUGA 1TFVA 5A6BA 1GK8A 3GU1A 1E9LA 4C6DA 4WIWA 3P5ZA 4KBXA 4YYFA 2VGIA 5E6ZA 1ZP3A 3LPPA 3H55A 4BI6A 3PBMA 2VC6A 3KM8A 4ZGYA 4RW5A 3HV9A 4LX4A 4DLFA 2DV0A 4GX9A 2Z4GA 2NWSA 5EMUA 2XFYA 3WLMA 3JUGA 1T8XA 3QY6A 4TOQA 2DZPA 3ZM8A 1OD8A 3VCRA 1EIBA 3DECA 3K46A 4O8RA 3ZR4A 2PRMA 3DFSA 2PS2A 2CLEA 4OT7A 2B7PA 5CJMA 1U83A 1UJPA 1SGJA 1P4CA 4NSBA 1YXCA 2AMXA 2GGEA 4B15A 1UD6A 3Q45A 2OGJA 1W8SA 3CC1A 3LBMA 3SAZA 4D71A 7A3HA 4A8NA 2PP1A 1L6GA 1KTCA 4DF2A 2XISA 4MWAA 5BRQA 2PWHA 3TTSA 4YS1A 2XSBA 3POHA 1G4EA 4Y9MA 4FNRA 4LVAA 1Q2SA 3BJSA 3NCOA 5AZ1A 3KOXA 2VOTA 3H4XA 1Y5WA 1AJZA 3LCFA 2V8ZA 2UY5A 1LRNA 3WQFA 2E6AA 3PNZA 1DJWA 4LVBA 1P0BA 3PR2A 4JBRA 4O57A 1ECQA 2VZOA 4V2XA 1YPXA 2W63A 1UZ4A 4GK8A 2C79A 4LYRA 2I1OA 3UWYA 3E74A 2OGYA 1GHRA 2RHGA 3UNTA 2HBXA 2VGGA 5HULA 1E3ZA 4AEEA 3KBNA 3L4WA 1PX4A