1B3ZA

Xylanase from penicillium simplicissimum, complex with xylopentaose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
total genus 128
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3zA00
1SMDA 1UWUA 2CESA 3OGSA 1UKTA 2VVSA 3FAXA 1JDDA 3I3DA 2BS9A 1W1TA 3B9AA 2BVYA 5CZKA 4ATWA 2CERA 2VJXA 2BV9A 4QLLA 3TONA 2GDUA 3CUFA 3FXYA 3W38A 5HBFA 1VRXA 1QPKA 2JIEA 1SYTA 3MU7A 1CDGA 1D7FA 1I1WA 5HPOA 4OUEA 1V3MA 3BC9A 3FW6A 1J11A 5E9AA 4OBSA 4P8VA 3A4AA 3AJ7A 2WW5A 4W7UA 3BXWA 4XB3A 2GUYA 5DFAA 4D6GA 3BCDA 3RJXA 4OOUA 3CUGA 4BQ5A 3ALFA 3UG5A 3KL3A 3U57A 5FIPA 2WSPA 4PMNA 4P7QA 2WB5A 2D24A 2UY4A 1JZ4A 1MXGA 2DDXA 5BCAA 1CECA 2G3IA 2F8QA 3OLGA 4HMEA 3VIMA 4J3XA 3WH7A 1LQ0A 1EDGA 4HZ7A 4W87A 5CJ5A 1EOKA 1PX3A 2J74A 1EQCA 4IM4A 2UY5A 4MDOA 3W6MA 3RIKA 2G41A 4HA1A 1W3LA 1MW0A 2GJRA 4PMXA 3WNLA 4KRUA 4HOZA 4J3WA 2A3CA 4IPNB 9CGTA 2WMJA 1MW1A 4W5UA 1UG6A 4CD7A 3VMNA 1H4PA 3M07A 5EBAA 4TOQA 1TCMA 2FHCA 3WDPP 1UKSA 2J47A 1SFSA 1V0KA 4NF7A 4WKHA 1TFVA 3K4DA 1EXPA 1ZBVA 1EDTA 1TA3A 1WB0A 2D0GA 2EEXA 4FMVA 5BYWA 3VIJA 4AEEA 3PZVA 4P8XA 1H49A 3ARSA 3MSGA 3AXHA 4AD0A 4J3TA 1Q6EA 1UR8A 3ARPA 1BYAA 3WD2A 3BGAA 2VZOA 5I24A 3WNPA 2J7DA 4AD2A 2YKKA 5EB8A 1VFMA 1E9LA 3VGBA 3QHNA 1B3VA 1RH9A 4P8UA 3PZGA 2WSKA 1KWKA 4P7OA 3PZQA 1V6VA 3SCOA 2OWCA 2YA2A 4AD3A 1KGUA 1WDRA 4AZHA 3WQWA 3MUIA 1R85A 1H3GA 1KQZA 3WUFA 1C93A 1ODUA 1PIGA 4AZ5A 1C8YA 4ZE4A 1E70M 3VDBA 3VU2A 2VQTA 1EO5A 5CPSA 5GNXA 2XM1A 3VMPA 1OT1A 2E3ZA 1PZ2A 3BLKA 3WH8A 5ABFA 1NOUA 1CXLA 2GFTA 4AD4A 4W88A 3N1AA 3QHMA 4GQQA 2F2HA 3K8MA 1ITXA 3CTTA 3GXIA 5CXPA 1OCQA 4PRWA 4BS0A 5LA1A 3RCNA 2WANA 2WCAA 4D6FA 3VX0A 4MB4A 3MUZ1 5DEZA 1XYFA 5M03A 4GQRA 4AZIA 1H0GA 1NOFA 2YL6A 1G5AA 2VQUA 3CUJA 5E0CA 5E70A 3OG2A 2EPNA 4TXEA 1NWTA 1E72M 1FP9A 3DHPA 5A8NA 3CUHA 4QFUA 3VD4A 3L4ZA 3GBEA 2PF0A 1GOMA 4PMOA 1K9TA 1EO7A 1UZ1A 4CVWA 1ISWA 1B31A 5LA0A 1GONA 1U33A 1B3YA 4RL3A 3BAYA 2VX6A 2EPMX 1HXJA 4GINA 2GVYA 1QHPA 1AQMA 4M29A 1HP4A 2VVNA 3PZNA 5JBFA 2BVTA 4PEEA 4DUVA 3ARUA 3A4WA 3IAPA 1GJUA 4DWSB 5CPQA 3U5YA 5D9OA 3GH4A 3VILA 1B1YA 2WCSA 3NJ3A 1TUXA 2CETA 3ZSSA 4W86A 4L4OA 1E6NA 1CIUA 2X0YA 2VRQA 4JKMA 4U2ZA 2FHFA 4Z2GA 3WF3A 5DF0A 3AZTA 1PEZA 6CGTA 3PZOA 4ZEPA 4YHEA 5FCZA 2DIJA 4ACZA 1HJXA 1N82A 1EHNA 5A6MA 4GZIA 5GNZA 3WEOA 3POHA 3WF0A 1V02A 4M56A 4NI3A 1VFOA 3GNOA 4M82A 1DWFM 1E6PA 3LPFA 3AIRA 2OWXA 2JE8A 4AISA 1XD1A 2QF8A 2GJXB 3ARRA 1VB9A 4TUFA 2WMHA 5AYIA 2XIBA 1QBAA 1GCYA 3AS3A 1LL4A 4CCCA 4M1RA 2XPKA 3WIJA 2WHKA 1NWUA 2YA0A 1OM0A 2Z1KA 2TAAA 1UR2A 1MXDA 4W8LA 1XGZA 4HMCA 2EQDA 8CGTA 2QMKA 1NWRA 3TTSA 2CKRA 1E5NA 4UOZA 5HOSA 4F8XA 1KB3A 3CZ8A 3ZOAA 3RO8A 1WZKA 3K46A 4MB3A 2ZXBA 3VNYA 4OBRA 2W91A 3CMGA 3BMVA 4ZFMA 5A6KA 1JZ2A 1UA3A 2OYMA 3ARQA 3CMJA 3VD3A 5I3DA 3D3AA 2NW0A 4QP0A 2OSYA 7TAAA 2WKGA 2VMFA 5BWFA 2V3EA 4D1IA 2XFYA 1V0LA 3GXMA 4PTWA 4CD5A 1KGWA 3ARZA 2OYKA 4E8CA 1RP9A 5JBDA 3IJ9A 3AIBA 3EDKA 3B8SA 3ARYA 1WAWA 3SCUA 3UEQA 3I3EA 1XH2A 2CEQA 2QLYA 1HL8A 3AYRA 4W89A 4JFWA 5A2BA 1QNQA 4P8WA 1GVYA 3W0KA 5D4YA 2FH8A 3MUAA 2A3BA 1J0KA 1H1NA 3WENA 1UWSA 1C92A 1GHRA 1BPLB 1Z32X 3UR8A 1UH3A 2E9BA 1EA9C 1XRVA 1CENA 1W3JA 4OKDA 3W37A 5AC5A 4OOZA 1DP0A 4BF7A 3WUBA 5JUVA 3L2LA 4GZEA 3WQ6A 3VKKA 1WDPA 3WDJA 4ZXOA 2WWDA 3RM8A 2WMGA 2DSZA 2WHMA 3W81A 1JF6A 2JF7A 2WVVB 2NT1A 1FHDA 4D1JA 3VD7A 2XM2A 1ZBCA 2WVVA 3OA5A 3F4VA 4Z2JA 6A3HA 2VR4A 4S3KA 1E43A 2X8RA 1LLOA 1MFVA 1BGGA 4UCFA 3VIOA 1M04A 2A3EA 4FF5A 5DT5A 2G3NA 4LYQA 4TVCA 3T0AA 2PWGA 1NQ6A 1ZB5A 3OZPA 1B3ZA 3WMSA 4D6IA 1FOBA 3ZR6A 2DT0A 5CQ1A 1FFQA 4H7VA 5IHSA 1UR0A 2X2YA 1VAHA 1CGWA 2J79A 3RM4A 4OIFA 1RD6A 1JYVA 2VX7A 3PZTA 3BAKA 1VFFA 3SCRA 3AMDA 1JZ8A 1E56A 4Y7EA 4X0VA 1TR1A 3WQ4A 3WD3A 2J77A 4PMVA 3WEZA 4DUWA 1V08A 3WFLA 5TD4A 3SCTA 1CGTA 4D6EA 4GKLA 2QV4A 1J0ZA 2PWDA 5E09A 3WD1A 5BXSA 3SCPA 1LWJA 1UWTA 4PCTA 1QW9A 3TTQA 2BY2A 3WH9A 1HP5A 1QI2A 1UQYA 3BAIA 3B9EA 2WMIB 3VGHA 3WQVA 4TVDA 4NZCA 1ISVA 4KRTA 1HX0A 2CBJA 5A6JA 2O9RA 1K9DA 4HU8A 1HVQA 5IHRA 1NP0A 2ZICA 2VR5A 2WM0A 2ZUWA 4KMQA 2DIEA 3KE0A 2IXUA 2O9OA 3GTNA 1V02E 3WNOA 1V6YA 1W3KA 2BNJA 1ZL1A 4D6CA 1ISZA 5LYRA 4JL2A 3AMLA 3IAQA 4YN5A 3KWXA 3AIUA 3PHAA 1BYBA 2B31A 2OSWA 4YPJA 4ZE5A 4GO8A 3I3BA 1XSIA 3HJEA 2W62A 4R27A 1HJUA 2Z1SA 1UD3A 1J0YA 2V3GA 1KBBA 1R86A 3RM9A 1JYXA 3AQUA 4N42A 1GQLA 5I77A 4Q22A 3WUEA 1GOKA 3GH5A 4NRSA 2D1ZA 4FLQA 5I2UA 4AXNA 3QOMA 1ODZA 1QI3A 2J7HA 2DQXA 2J78A 4AZ6A 2J25A 4AW7A 2VZSA 3S6TA 4AZ7A 1BSIA 2QHAA 4FLSA 4X0NA 1CLVA 2XFFA 5ABHA 1QBBA 1W32A 2CCRA 3WF1A 1HKMA 1UD8A 4WJXA 2FDMA 3CBWA 1UYQA 3T0BA 4GZJA 4V27A 3SUVA 4RE2A 3CH9A 1E1FA 4HA4A 4PBGA 1F4AA 1HJWA 1UH2A 5A6AA 1KQYA 1BYDA 1CXHA 1WDSA 2W67A 2ZX9A 5F7UA 1C8XA 2RGMA 4CD8A 3GNPA 3ARWA 4J3VA 2J7GA 1QI0A 3SUTA 2D3LA 2ZUUA 3WD4A 3ZT6A 4Z2KA 1MWOA 1G9HA 4W8AA 1UWRA 3L4UA 1HKIA 2D3NA 1ISXA 1JZ7A 1K6AA 3VIFA 1JXJA 5CG0A 3VIIA 1E15A 2PBOA 3EMQA 4PUDA 3IJ8A 3L4YA 2J8GA 2CITA 4PN2A 1JYWA 2VTFA 3VIKA 1OGGA 1GZJA 2X09A 3K8KA 2A3AA 4XZWA 4KGJA 1BF2A 2VZUA 3E1F1 4E8DA 2YA1A 3FAWA 1JFXA 3PZUA 2Y8KA 3N17A 1ZU8A 1DWIM 2J62A 5GNYA 1DWGM 3APGA 1FH9A 3UG4A 3RPMA 3VGFA 1US3A 3W25A 1LL7A 3ZM8A 1BHGA 4H8HA 3N15A 3UCQA 5JBEA 1C7SA 4KGLA 3SIMA 4V2XA 4CUCA 1B2YA 4M8UA 2AAAA 2VL4A 4AY1A 1EGZA 3AOFA 1GOWA 2WLZA 3AISA 3N13A 4M24A 1UQZA 4A4AA 5FKYA 5CPTA 1RPKA 2UY3A 3BAXA 5I5RA 4HZ6A 3AYSA 2WYSA 2ZUSA 3EDJA 3GZAA 4UFIA 1JFHA 1B3XA 3O6AA 2WVUA 4JFSA 2EBNA 3W27A 3OZOA 2VZVA 2F61A 4HA3A 3NIYA 2Y2WA 5DO8A 2PWHA 1HJVA 1TMQA 4LYPA 1JNEA 4WIWA 1Q6GA 1VEPA 2C0HA 1TZ7A 4MPKA 1U2YA 8A3HA 4EKJA 4M80A 3EDDA 2XFRA 3LPPA 1O7AA 4UFHA 4BQ2A 2WZEA 1W1YA 1ESWA 4WK9A 2OWWA 4U5KA 2CHNA 3TOPA 5EFFA 3AS2A 3AZRA 1ITCA 1VFUA 2JALA 3AIVA 3UERA 1CWYA 1JF5A 1UD2A 2CXGA 2O92A 3FHQA 4GPNA 1V03A 3WBEA 1R87A 2FHBA 2BY1A 1JGIA 1E4IA 1GQJA 3MMUA 2ZX8A 4F79A 1HKJA 3FNDA 4EAMA 4D6HA 1E6ZA 3BH4A 5CLTA 1EQPA 2Y5EA 1JIBA 3WNKA 5I79A 2ZUMA 4Z2HA 1CPUA 4QCFA 2J8FA 3VD9A 2QPSA 4R5EA 4U2YA 1BLIA 4JIEA 4JFUA 5AYBA 3N9KA 4UFJA 2YJQA 5EFDA 1BFNA 1M03A 3AXIA 3F5JA 3VIPA 1KXVA 3M7SA 3VGEA 3WN6A 5M5DA 2GJPA 2QPUA 3M46A 4AC1X 1XYZA 1V6XA 3WNNA 3VO0A 3CHFA 3ARVA 4JFTA 4F66A 5CLWA 2XTKA 1R7AA 2D0HA 3ZJ6A 4RE3A 3HMCA 3DYOA 4H8UA 4FLRA 3T0DA 2WC4A 1D2KA 1QNSA 1WCGA 1ISYA 3GH7A 2WC7A 2EPLX 3A3HA 3CZEA 5BXPA 3T2OA 2BY3A 2E4TA 3SCWA 4XUYA 2WAGA 3EMCA 3VMOA 3G6MA 1E6QM 4BQ3A 1QHZA 2JF6A 2XIIA 2DEPA 5A6SA 3LPOA 2HISA 3II1A 5A8QA 1GUVA 4U3CA 3SCVA 4Z2LA 3DC0A 2CYGA 2ZXDA 2BVDA 3WY1A 4IISA 4HTYA 3QOKA 3AXXA 3VX1A 3AI0A 4PTMA 1JI1A 3N11A 3ARTA 5DMYA 1OSEA 3MSDA 4WLCA 1IZJA 4S3JA 1OWQA 4MNLA 3CO4A 5HDRA 3VTRA 1MW3A 2WVTA 5HXMA 3WMCA 1V0NA 4NRRA 1V3HA 2DH3A 2VI0A 5IDIA 2BXZA 1CXFA 2WMKA 2BHYA 1W9BM 2HVMA 1LL6A 4YHGA 4CN4A 3WSUA 3PTQA 4KWUA 3KL0A 2A3HA 5AC4A 2VZTA 4WKFA 4GI6A 4HU0A 3BSGA 3BCFA 1H11A 4ACYA 1B0IA 2ZOXA 3CZLA 2O9TA 3AMKA 3MS8A 3ALGA 1MQPA 4AMCA 3IK2A 5D8WA 1PAMA 1L8NA 3AHZA 2XSBA 4UZSA 3U5UA 3SCQA 2NSXA 2XVNA 1Q6CA 1YQ2A 1DWAM 3WQ8A 2XJ7A 1HIZA 1XCXA 3UG3A 2W66A 2VO5A 3ZJKA 3NSMA 4AZCB 4WKAA 3QR3A 1JG9A 4PMQA 3GBDA 4MNKA 1C8QA 4HMDA 4B9YA 3KL5A 2D20A 1R8LA 7CGTA 2CBVA 2Y24A 2RGLA 3WMBA 3VPLA 4OJYA 2UY2A 2CBIA 2E8YA 4W7WA 4MJ4A 2ZWZA 1BVZA 5HPCA 1E0WA 3AHVA 2W5FA 4B9ZA 3G6LA 3GM8A 3L4WA 3SCNA 5HNNA 1ZJBA 1DTUA 1XD0A 1WZMA 2W63A 1E4NA 2ZE0A 3WUGA 1L0PA 1EDQA 5A95A 1XSJA 2EJ1A 2DGAA 3QHOA 2XG9A 1E3XA 1G1YA 4MAZA 1CTNA 3T09A 2GK1A 1WE5A 2VCAA 1OIFA 2PI6A 4BZYA 2PWEA 2ESCA 2WZHA 4ZENA 3AHTA 1B9ZA 3L2MA 4PSPA 4N0RA 2PBGA 1J0HA 1FP8A 1M01A 3W4RA 4EE9A 5ABEA 1UR9A 5A2CA 3AMGA 5AY7A 1JNDA 4CU8A 4XZBA 1DWJM 3KEHA 3POCA 4PMYA 5I0DA 3MO4A 3B9DA 1OBAA 1HT6A 3W82A 4CD4A 4CU7A 1E0XA 3DECA 1ZBKA 4HOXA 4HOWA 3LPGA 1W9VA 1XSKA 1MW2A 4JCLA 3U7VA 1TVPA 1K9EA 2YDRA 4AYSA 2W4XA 5BRPA 1QNPA 4AZBA 3N04A 3AROA 1IT0A 3THDA 3AHYA 1UR1A 1UOKA 1MQQA 2XVGA 2CBUA 3RJYA 4IPLA 1KBKA 1ECEA 2VX4A 4CVUA 5A8MA 3WL0A 1ZS2A 1VEMA 5GPRA 2DSKA 4MDPA 1JYNA 1OB0A 2BY0A 4ML4A 4CCEA 4PTVA 3MV01 3WF2A 2ZX7A 2YIHA 1A47A 3WH5A 2E0PA 2X0HA 2D0FA 3F5LA 1LF1A 6TAAA 3IJ7A 3VGGA 5A6BD 1HKKA 5BRQA 2CKSA 5GQBA 1V0MA 3OLEA 1EOMA 1E4LA 3CPUA 5FL0A 1AQHA 3VM7A 1CGUA 1OT2A 3WF4A 4C7DA 4GO9A 4Z2IA 5JIWA 3WFZA 1CBGA 1BG9A 2VX5A 2WVSA 2V38A 4GI8A 2WBKA 3AIWA 3MUY1 2VRJA 4W8BA 1J18A 3VDHA 3WD0A 3DYMA 1XV8A 3MMDA 4CGTA 2Q8XA 3OGVA 3AS1A 1VBUA 3W28A 1UWQA 1B30A 3TTOA 5BXTA 1J01A 2G3MA 4URIA 4TX8A 3DHUA 3LMYA 4OZOA 3WQ5A 4PUEA 4HPHA 2WK2A 3ZJ7A 2YDSA 4MNJA 4B3KA 5E6ZA 3ZIZA 2YLAA 2XHYA 4B3LA 2XSAA 4JCMA 1GPFA 1E0VA 2UWFA 3ZO9A 4HZ8A 2VOTA 3GNRA 1QNOA 5CGTA 1VENA 1PZ3A 3HU7A 1YHTA 2XGBA 1XC6A 4LQ1A 3MMWA 3EYPA 4PMUA 1KCLA 1MFUA 4W93A 2WMFA 1E6SM 3CZKA 3N18A 4GI9A 3WDQA 3MANA 3PTKA 2WZIA 3ZR5A 1A3HA 4WSJA 2GDVA 3WDRA 2YL8A 5ABGA 4UZUA 4AZCA 2D22A 3L4TA 3NDYA 4UFKA 1NWSA 2G8ZA 4QDMA 4AIUA 3EMZA 1VEOA 1U30A 1GVIA 1W1VA 2G4FA 4JHZA 4CU6A 4AWEA 1W91A 2PC8A 3UR7A 3VGDA 3EDEA 4PMDA 1E3ZA 1KXQA 4ZXLA 2Y4SA 1PJ9A 4DWSA 1BG4A 1GQIA 4QAWA 1JZ5A 1V3JA 2J7BA 4V28A 1V6WA 4AZGA 1WO2A 4UR9A 1DWHM 3BLPX 4TX6A 2C7FA 1Q6DA 2ZIDA 1OIMA 1KXTA 1G0CA 4EANA 1UKPA 4X9YA 1KR1A 4DUXA 1WZLA 2OLHA 2OSXA 1KXHA 1D3CA 4NSBA 1IV8A 2XWEA 2DSWA 2D2OA 1WPCA 2XVLA 3DYPA 4QLKA 1ZJAA 5ABFB 5JIPA 1NH6A 1HL9A 3D5HA 1PBGA 1LG2A 2WCGA 2NT0A 1WZAA 2DPEA 3ECQA 3AICA 2X05A 1W9XA 4MB1A 1E55A 1JD9A 3SCSA 4MADA 5FOOA 4MNMA 2DT1A 1KWGA 1NP2A 5C71A 1EHAA 1ZBWA 1GQKA 1QI4A 3K4AA 2YL9A 1V6UA 3O9NA 4TTGA 4JZ5A 4D72A 2ZXQA 1JI2A 1GOOA 3WL1A 4TTUA 2BXYA 1J10A 2G3JA 4JKLA 2ZUVA 4HPGA 3PZ9A 1LG1A 4CCDA 3WKZA 3A6OA 1OGSA 4H2CA 3K1DA 5A69A 3A47A 3L4XA 5I6SA 2WXDM 3WBAA 4BQ4A 3AIQA 2EO7A 3VUPA 1JZ3A 4DM2A 3AS0A 3GXDA 3O2LA 3VDAA 4Q7NA 4QLJA 3M6DA 1TE1A 4AIOA 1UKOA 5CSYA 3TP4A 4E2OA 3SUUA 1H09A 2O9PA 2YOCA 2VRKA 1HJSA 1BTCA 3MKKA 3K8LA 1GW1A 4MTVA 4C7GA 1QW8A 1KFWA 4IUGA 4W84A 3ZJ8A 1CYGA 1VJSA 2WPGA 4U5IA 2YBUA 3HN3A 1UUQA 3A4XA 2DSVA 3NDZA 1MVYA 2BHZA 1VJZA 2CHOA 2VUYA 1P6WA 3SEPA 2EPKX 4PSRA 1OINA 2E8ZA 5A94A 1C90A 3T08A 1UD4A 3WELA 1XHGA 4JHOA 1UR4A 2J4GA 1QHOA 1CGXA 4J3UA 3RDKA 4LGXA 5M17A 2VURA 1NOWA 3T2PA 2WHLA 5D8ZA 2XYLA 4U31A 2OYLA 4LXFA 4H8VA 4J7RA 4LPCA 4W5ZA 4EK7A 4DWSD 1M53A 1UH4A 2V5CA 3GXFA 3CLWA 3CHCA 1W9DM 3GDBA 4F9JA 4CD6A 3PTMA 1LWHA 3SURA 1V3LA 4JL1A 1MYRA 1BAGA 1BQCA 4DM1A 1UD5A 2WBGA 3OB8A 2VNCA 4H41A 2WHJA 4LYRA 1QOXA 3F5KA 4MJ2A 4PYSA 3UESA 5BROA 1HNYA 2J7FA 1AMYA 4PCSA 1E73M 1F4HA 3VM5A 1FFRA 5I23A 3NUKA 1G01A 1E6RA 3ZT7A 2CNCA 4B15A 4RE4A 4ATLA 5EMYA 1KCKA 2EPOA 3OIHA 2V3DA 1CXEA 2MANA 1FH8A 1PIFA 1XH1A 5C70A 5FD0A 2J7CA 1H0IA 1XCWA 4QCEA 5A6LA 2JFEX 1G94A 2VCCA 2JEPA 4H04A 2W92A 3W24A 4E4PA 4ATDA 3VINA 3VDCA 1AVAA 2GK1B 4UTFA 1H2JA 1VIWA 1TG7A 1K9FA 3VD5A 4W7VA 2XVKA 3FHAA 5DT7A 3N12A 1W2VA 2WKLA 2PWFA 1B3WA 2DT3A 2ZWYA 1V3IA 2X1IA 2W61A 4MAVA 5IXEA 4GXPA 1J9YA 2WNWA 1TA3B 1JZ6A 4C7FA 1KR0A 3RILA 1J0IA 2AMGA 3GYCA 3RMEA 2WMIA 3W26A 1JXKA 4AD5A 4A3YA 1QNRA 1J12A 1UA7A 3QGVA 4MB5A 4JAWA 1CLXA 4XX6A 5E0FA 2IUZA 2ZX6A 3CGTA 3KZSA 4D6JA 1VF8A 2YL5A 4U3AA 2J7EA 2V3FA 1CGVA 4A3HA 1OD0A 2YLLA 5CSUA 5A8PA 4UQBA 4BA0A 4LX4A 2ZUNA 3OLDA 2FGLA 1V3KA 1JAEA 3WDIA 3AHXA 1JL8A 4D6DA 1UKQA 2E40A 4TVUA 5M3WA 2JEQA 4UQCA 5KEZA 2V5DA 1GJWA 1DEDA 4UFMA 1QI5A 2WLYA 3BSHA 3SUWA 3NSNA 1W3HA 4AD1A 2FH6A 5I78A 1FA2A 4UQDA 3U7BA 1GNXA 1GOIA 2AOSA 1Q6FA 3CZJA 3PZMA 4FK9A 4P7RA 1C91A 1CEOA 2E9LA 2YDQA 1JDCA 5A1AA 1H5VA 4BCEA 3TTYA 1E4MM 3T2QA 4JFVA 5LA2A 1E1EA 4UOQA 4UQ9A 1W1PA 4U33A 4KH2A 4PMRA 3NYDA 1X6LA 2VT0A 3UETA 1CXIA 4D71A 3JUGA 3PN8A 3W6LA 1EIBA 2PB1A 5A8OA 1H41A 1OGBA 3WEMA 5A2AA 1WP6A 1BGAA 1E71M 4W85A 3OBAA 3W53A 1KGXA 5CGMA 5A3HA 1HF6A 1B90A 1WNOA 3WH6A 3ZMRA 4WSKA 4WF7A 4J28A 1UZ4A 2XWDA 1JD7A 1GOQA 2QMJA 1TVNA 4UNIA 1BYCA 1OD8A 4UOJA 1UWIA 1DHKA 4PTXA 4AEFA 1S46A 2XUCA 2ZUTA 3TA9A 2CPUA 3SUSA 1RP8A 3ZSTA 1HN1A 3BAWA 2WC3A 5E6YA 1VBRA 4L4PA 5BXRA 4CKQA 3CUIA 4UFLA 1W9PA 1E5JA 3VIGA 2EXOA 5IFPA 2CIPA 3CZGA 3FY1A 3IANA 3AZSA 1NM9A 1EH9A 1CZ1A 3NCOA 1LJYA 3OLIA 1X1NA 1AQ0A 1C3FA 3VOCA 4ACZB 4GIAA 1IZKA 3THCA 2YBTA 2DH2A 5C8BB 1GORA 4P7NA 1FH7A 1SR0A 3AIEA 5A6BA 2VCBA 3VIHA 1PX8A 3L4VA 2J75A 1PX4A 1JAKA 5KZ6A 3S2CA 1WKYA 3OGRA 1CNVA 1Q4NX 1W9UA 3J7HA 7A3HA 2E9MA 1Y7VA 3WNMA 2DT2A 4PMZA 3EBVA 3VVGA 5D9PA 2JIWA 4P7LA 3ZT5A 4HP5A 2Y8VA 2C8NA 2FGZA 4J3SA 5IFTA 4UQEA 1XH0A 1HJQA 2ZXAA 3BMWA 1CGYA 1QVBA 3ARXA 2IXVA 3CHEA 4K68A 4B16A 1BVNP 4M81A 5ECUA 1UD6A 1JDAA 2ZX5A 2VC9A 1I1XA 3AMCA 2GSJA 1MQRA 1WDQA 3EDFA 5D9NA 1I75A 1R7OA 3PBGA 1NARA 4J27A 1O6IA 3BAJA 1US2A 5FL1A 3ZQ9A 4FLOA 1UHVA 2BFGA 3CHDA 1W2PA 3W29A 1CXKA 3WDHA 3PZIA 1J0JA 4AIEA 1M7XA 2XGIA 4JKKA 4UQAA 3VNZA 2GJXA 4CN1A 1SMAA 1C7TA 4XV0A 1E40A 3AFBA 3NSXA 3FN9A 1X6NA 2DSUA 1GHSA 4DWSC 5D9MA 2BHUA 3MV11 2XVPA 2WWCA 4CN6A 1HVXA 4F9DA 1E6XM 1FHLA 2D23A 3CIVA 1PPIA
chains in the Genus database with same CATH superfamily
4Q4SA 4JY9A 1UWUA 3N25A 3OGSA 2NQHA 2VVSA 3FAXA 1YBQA 4WY0A 2CERA 1XICA 2GDUA 3CUFA 3W38A 4ASTA 1J8VA 3FSUA 1QPKA 2VFEA 3CV6A 3S1GA 4MG4A 3MU7A 2Y61A 1B3OA 4HKPA 1UP3A 2PCEA 1T0OA 3CNYA 4NNAA 1V3MA 3A5FA 5E9AA 4P8VA 1C29A 3GVRA 3BXWA 1JQXA 3BOFA 5DFAA 1XISA 4D6GA 2R94A 2BWGA 4OOUA 3CUGA 3RX3A 1VHCA 3U57A 4UCGA 4PMNA 1JPIA 1PKYA 2WB5A 2D24A 4G7FA 2UY4A 1H60A 1JZ4A 2Y89A 1EB3A 3ITVA 3OLGA 5DY2A 4J3XA 3WH7A 1LQ0A 4ERGA 1JEZA 1ZHAA 1QO5A 1EOKA 1PX3A 2J74A 3BLIA 4O16A 4IM4A 2Z1WA 5HQEA 2ZCGA 2A0NA 3LNPA 4HA1A 1W3LA 1HZYA 3WNLA 2NUYA 1U1JA 4KRUA 3H54A 4IPNB 2V30A 1MW1A 4CD7A 4F2BA 1H4PA 2OU4A 1UKSA 2XIOA 3TSBA 1SFSA 1TPFA 3G0SA 3RX4A 3K4DA 1EJXC 3G0UA 3C2YA 2P50A 1TA3A 2EJAA 1XRSA 4GVIA 1RJRA 3W6YA 3CL8A 5CCZA 3DFOA 2V8ZA 1Q6EA 3BGAA 3Q37A 4Q8QA 4AHOA 2NVAA 4GOAA 4ZO7A 4JN8A 3ABXA 2YKKA 2I57A 3OODA 4XG1A 4GYPA 2FTPA 3QHNA 1T5AA 3PZGA 1KWKA 3SCOA 9XIAA 3BGGA 2Z26A 2KZHA 1ELSA 3WQWA 4BKNA 1KQZA 3WUFA 2JK2A 2EGZA 2DVTA 4AZ5A 4PULA 4M7SA 3EB2A 1TX2A 4GG9A 4GJJA 3TYDA 2XM1A 1PZ2A 1EBHA 3WH8A 4DJFD 2E1WA 1CXLA 4W88A 2FB2A 3QW4B 3K8MA 3C2VA 4J2MA 4GH1A 3PY2A 5LA1A 1JGMA 2I5IA 2WCAA 3M5YA 3HOJA 3MP4A 3SFWA 2Z7GA 1G5AA 1MRAA 2B7NA 4HIBA 4LEQA 3TOYA 4ICNA 2DUXA 4GE8A 3H70A 2O4MA 2B4GA 1NWTA 1Q6LA 5A8NA 3SY1A 4IMEA 3UWYA 3MSYA 4XZHA 2QCHA 2PP3A 3GBEA 5LSMA 5I3HA 1Q7QA 6ENLA 3E0WA 1ISWA 1F8MA 5LA0A 3IV3A 4GINA 4M29A 3PZNA 4DWDA 1QR7A 4RNJA 3B8WA 3KW3A 2YCLB 3CWOX 4MWAD 4GNKB 3GH4A 1TUXA 3WJXA 1MEIA 2HZGA 1A5UA 1CIUA 3MWAA 3ABQA 4U2ZA 1YLVA 3PWAA 3UA4A 3WF3A 3N73A 4B91A 5A8GA 1TJ1A 2P88A 4ZEPA 3WK1A 5G5IA 4YHEA 1ZGDA 1KRCC 3S3GA 3TN6A 4MKSA 2CZDA 2VEMA 1N82A 1JDEA 3H2FA 4C5ZA 5DCEA 5LNWA 3E3HA 4M56A 1H7OA 1VFOA 3BV7A 3GNOA 5CBJA 1NTHA 1UP2A 2OWXA 2JE8A 3LNMA 3NL5A 1KM0A 5FEXA 2DZPA 1VBHA 5HJLA 1XD1A 5DELA 5HINA 1XLLA 2WMHA 2CZFA 5AYIA 3NQBA 3SJ3A 1LL4A 5HQMA 3MDUA 2ZRYA 4O8RA 4CNPA 1ZP4A 2YCKX 1NWUA 3G3DA 3H6OA 3QQWA 4PFMA 4Q8OA 1R5YA 1UR2A 1MXDA 3U4FA 2J8TA 1XLAA 2EQDA 5K4XA 3H4GA 2QCEA 4WHBA 3UNDA 1E5NA 3NL2A 4O1FA 5TQLA 3I4KA 5HOSA 3MCNA 5BW6A 3OVQA 1Y5VA 3CZ8A 4M7TA 3C86A 4OBRA 3CMGA 3BMVA 1PWMA 1UJQA 2DUZA 5I3DA 3D3AA 2PFHA 5DQPA 1I4NA 3LG3A 4D1IA 3DFYA 3W1NA 1WX0A 1V0LA 3GXMA 5MKGB 4OGZA 3ARZA 4MY8A 3WLTA 3ITLA 4FNRA 3HIJA 2VR2A 1X98A 1XS2A 3EDKA 1MMFA 5D2VA 3W1LA 4IQJA 3UEQA 2QLYA 2CEQA 4AVOA 1HL8A 2ZRUA 2Z1VA 3N6JA 1P0DA 4P8WA 2Y8UA 1LRQA 1YRRA 1J0KA 1LRTA 5IOBA 3PB0A 1Z32X 2C79A 1W3JA 5B80A 1TREA 2O7QA 1S2VA 3WUBA 2PDLA 4GZEA 3VKKA 3RM8A 2WMGA 2WHMA 1V77A 4C65A 4YVVA 2FZNA 3PK7A 1CLKA 1P7TA 3WLIA 4ZTYA 2WVVA 3F4VA 4Z2JA 4S3KA 4OWGA 4TV5A 1MUMA 2X8RA 1U1HA 1M04A 5DT5A 1DJYA 5MKGA 1R3SA 2PEVA 5FJIA 3R11A 3TJIA 4ENLA 3D46A 5T26A 4QGCA 1JDFA 3GXPA 2Q09A 2DT0A 3TSMA 1NIUA 1NDYA 1WBJA 3JZEA 1UR0A 1RY8A 1V93A 3QPYA 1POJA 1VAHA 1A80A 2D2JA 2J79A 4D8ZA 1UW9A 3UXDA 1F07A 3QFWA 1I0BA 2J77A 4PMVA 4KCVA 1R47A 3OBEA 5F2GA 4NY2A 3BJFA 4JTDA 3LXBA 4KFNA 4MY1A 2QV4A 1J0ZA 2PWDA 1YTKA 3MDWA 3TWAA 3W7EA 3WD1A 3JR2A 1DOSA 3EEZA 3ZWSA 3MBFA 1TPB1 4Z17A 4HYWA 3V36A 1ZAJA 3WH9A 4LVGA 5AHNA 3B9EA 3LV5A 4KWWA 4NZCA 1B54A 1ISVA 3T8LA 1AZ2A 3CAWA 1NELA 2CBJA 2DJLA 4IWWA 4HU8A 1BD0A 4QJ1A 3UY7A 5DN1A 5IHRA 1N55A 2VFDA 2ZICA 1A0CA 4C6OA 2ZUWA 3E5PA 4UUIA 3QR1A 3CAKA 1FWFC 1YPFA 2IXUA 3B8DA 1GKRA 4Y9PA 1LZOA 2BNJA 1F8IA 2F7FA 4YIWA 3AMLA 1TMHA 4JDYA 3KWXA 3AIUA 2PDYA 1UMLA 1ECQA 1WA3A 3G2GA 6REQB 2CXEA 3S46A 4JX6A 2W62A 4JQAA 3GKFA 2Z1SA 1T40A 5HMEA 2PTXA 3T42A 4WOZA 3DH7A 3IVSA 1JYXA 4GKTA 3AQUA 3IGHX 4DI9A 3QC3A 4H7ZA 3WUEA 2D1ZA 5D05A 4IL0A 1I2NA 2ZTJA 3QOMA 1ODZA 4C6IA 4G1KA 2BLEA 1O68A 3A22A 4RDVA 4AZ7A 1BSIA 1CLVA 3T0TA 5ABHA 1W32A 1HKMA 1UD8A 2VHLA 3AWOA 3UR5A 3UZZA 2OEJA 2E77A 4V27A 3B4YA 4EACA 4RE2A 5EMLA 3W2JA 4WDWA 1KQYA 2ZYFA 2ZX9A 1C8XA 3S9ZA 5I03A 3ARWA 5K3VA 2D3LA 4IP4A 2QVHA 4Z2KA 3CASA 2NQ9A 1CT5A 1HKIA 2E6YA 2QXWA 3FVDA 3VIIA 3IS4A 4QXIA 1DJGA 2ZC1A 3UA3A 1YW1A 5KZDA 2J8GA 3E5BA 3LUTA 3KHDA 1JYWA 3RO6A 3GDKA 5I7GA 3GAKA 3QV7A 4DJFA 1H63A 3W85A 1BF2A 4GUHA 3ZLGA 4JYFA 1Q65A 3PZUA 1G4SA 4E3VA 3QMTA 2Y8KA 1ZU8A 4E4FA 5GNYA 2NZLA 4GZ7A 1TTJA 1KV8A 3RPMA 4JTEA 4RX0A 3ZM8A 1L6YA 3GSMA 3W1UA 1H1YA 2IKHA 3DBNA 5JBEA 3LA4A 1C7SA 3NZ1A 3SIMA 5AFDA 3UBPC 3H12A 2HS6A 4AY1A 3OIXA 3VCRA 3AOFA 1GOWA 1VKFA 1R3YA 3UVAA 3T9PA 2A1YA 3GQYA 3C61A 3TE9A 1UQZA 3MBDA 3SJNA 1UIOA 5CPTA 1RPKA 5I5RA 4KKXA 2YXGA 4GVGA 4HZ6A 4QG6A 2QCCA 3H2OA 2WYSA 2ZUSA 1OF8A 4LF2A 3GZAA 4UFIA 1XYLA 2UZ9A 2WVUA 4XWUA 1Q7MA 5T91A 2WO5A 2F61A 2GVLA 4HA3A 3LMZA 1TMQA 2Z25A 4O0QA 1GKPA 3APYA 3G8EA 2C0HA 4H6RA 2W79A 2Z0IA 3EDDA 3LERA 4Q8PA 2NLYA 1F6PA 3RU8X 3PM6A 4U5KA 3AZRA 1ITCA 3HPAA 3RXZA 1JF5A 1S38A 4HK6A 2O92A 3PWIA 4CQDA 2F6UA 3TWBA 3UPWA 5LIWX 3PUDA 4V1XA 3PG9A 4HHMA 4E5TA 3MMUA 2JKPA 3IVTA 1PVNA 2QEZA 5CLTA 1VLWA 2IKGA 1JIBA 1UBSA 4HNTA 5TBOA 2J8FA 4UMBA 3VD9A 3M0XA 3BO9A 4U2YA 1K8ZA 1FDZA 3N9KA 3CM4A 1M03A 3AXIA 3E74A 5T9CE 3FJLA 3VIPA 5I00A 1Z89A 3QV9A 1IYXA 3WN6A 5M5DA 2NV2A 3PBWA 5DANA 4F66A 2XTKA 1W54A 1K1DA 1JRBA 1R7AA 1X1OA 3DYOA 4FLRA 2SFPA 4H8UA 2WC4A 1D2KA 4I9JA 1WCGA 1A3WA 2YW3A 2QAFA 2BY3A 2ZRXA 4JNYA 2ZA2A 3SCWA 4XUYA 1AW2A 3EMCA 4BQ3A 3NZGA 3SSJA 3RLGA 2I5GA 1S5MA 2XIIA 4ORIA 5A6SA 2FFCA 1TZZA 4FOKA 2B7PA 2HISA 1KRBC 4XAPA 3M64A 2OOGA 3UYIA 3W71A 4M1BA 4FXFA 3IIPA 3FJ4A 3UZYA 1UIPA 3LN3A 2QV5A 4QE5A 4WLCA 1RBOB 2ZZ5A 4MNLA 3L23A 3CO4A 5HDRA 3FLUA 5C2CA 4JTTA 1DYSA 3QM3A 1GQNA 3WMCA 4WOQA 1GZ1A 2DH3A 5HR7A 1BSLA 2BXZA 2WQPA 2GDQA 2O0TA 2HVMA 1XRFA 3S9YA 2D2HA 2OPJA 4YHGA 3W7PA 4CN4A 2IKJA 4DQWA 2GOKA 1TE6A 2VXNA 3RUBL 3KBNA 1Q8AA 4PCFA 3G1FA 2PDFA 3BSGA 1K3UA 5D2YA 3CYJA 3PUGA 4A3UA 4ACYA 1H61A 2HROA 3IACA 4ZMGA 5HK4A 2QJJA 1BWLA 3ALGA 1N8IA 3UYCA 1L8NA 5EL1A 3ABZA 1YQ2A 1DWAM 4HU3A 2XJ7A 1EPVA 4H3DA 1XCXA 1S2AA 3STEA 2HS8A 3BZGA 3TW6A 4JPGA 3NSMA 2F2KA 4XO7A 4FSAA 4IPJA 3E02A 5LGZA 2GGGA 4DJED 7CGTA 5DCDA 2DZTA 1K8CA 1RVKA 2QPXA 3E2SA 4MMWA 4MJ4A 1JVNA 4W7WA 3TYBA 4ADTA 1E0WA 1DQUA 4QTGA 3G6LA 4LUSA 1DTUA 4Y9OA 1DTNA 2W63A 2NUWA 1E4NA 2ZE0A 4WRHA 3FJ6A 1SUXA 1EDQA 1LOSA 1XSJA 1AMKA 2HNHA 1PE1A 3QHOA 4AY7A 3T09A 5H8PA 3P0WA 3DHFA 4JTLA 5I02A 3IV8A 1B9ZA 1QPQA 3R8GA 1XG4A 1ENUA 3LGEA 3KHJA 4WQ6A 3CTLA 2ATMA 3OW1A 4LC8A 4OQVA 1M01A 3W4RA 2I1OA 2WSYA 3EX4A 1KM2A 5A2CA 3V5OA 4CU8A 3REQB 4JYDA 3MO4A 3A21A 3HO8A 2WQDA 2NLIA 1HT6A 3UJFA 4I6KA 1TMLA 1QASA 3QYQA 4JTQA 1XSKA 3H4WA 2W4XA 4H83A 5BRPA 4AZBA 3C0JA 2ZADA 3HF3A 2XISA 2CZVA 4PL1A 1MQQA 3T05A 3EOOA 3RJYA 3OYXA 4IPLA 1KLZA 1V79A 4M6QA 2VX4A 4HK7A 4CVUA 3WL0A 3G1SA 4L6HA 4MDPA 2JGYA 3ANVA 5CC7A 1QPOA 1AD4A 3LLDA 4QS6A 1RBAA 3NEVA 4PUUA 4BHYA 1DE6A 6TAAA 3PJUA 4S3AA 4DIAA 4IG2A 1HO4A 2VWTA 3VNJA 5BRQA 3AXMA 1EOMA 3OEXA 2Q8LA 3VM7A 3RHGA 4CQ9A 4Z2IA 1MUCA 3UXKA 3WFZA 4HHPA 4YS1A 1CBGA 3S4TA 2IQTA 4LTSA 2WVSA 2V38A 4GI8A 3XIMA 7TIMA 1J18A 3STCA 2PDBA 3MHGA 3MMDA 1VLIA 4N9EA 4RW5A 3OGVA 4IL2A 1VBUA 4JN6A 3SADA 1WUFA 5BXTA 3UWWA 3S9IA 4K2SA 3LMYA 5ENLA 3RU6A 1GYNA 1VPXA 4C1LA 3VKAA 3WQ5A 1FWRA 4DELA 4HPHA 2V5BA 1RQHA 3KZPA 1S2CA 2UWFA 4GNJA 4I9TA 3BLLA 3EZ4A 4JIQA 4ZO9A 4IOTA 1XL9A 1PZ3A 1XC6A 2P10A 4W93A 1LTDA 3N18A 4L65A 2XU2A 2WZIA 1A3HA 4WSJA 3KVJA 3UW6A 1A5AA 3NDYA 3MVTA 4FPSA 4AIUA 3BGJA 1ZPTA 3Q4DA 1VEOA 1YPIA 3K1GA 5G4EA 1N7KA 5B7YA 4YWSA 2GQ9A 3TXVA 5C7HA 4AWEA 2PS2A 1QPNA 3UR7A 4HPXA 5K9DA 1A5LC 4CCZA 1TPUA 2V6AA 4ZXLA 2Y4SA 1GJPA 1GQIA 1MDLA 4AZGA 3E49A 2HBVA 2HE5A 3TYEA 1DWHM 3LY0A 4JQ2A 2ZIDA 1IWAA 3SGGA 1G0CA 2XFWA 1KR1A 1W5OA 3NPWA 4DUXA 2I14A 1IV8A 2J27A 3NQ8A 3OQ8A 2XWEA 1T6MA 2P8BA 2XINA 1J2BA 3HV8A 2ZTKA 4RJEA 2FPTA 4HVXA 5CZTA 3D5HA 3GU9A 3IJIA 1IXQA 3VCCA 1Z69A 4FXRA 3AICA 2VDGA 2X05A 4MB1A 3IIZA 3M44A 4JNMA 5FOOA 3L65A 2DT1A 2WZTA 4ZO6A 3P67A 1Z6KA 5C71A 1ZBWA 1GQKA 5MF5A 1F3EA 5F4WA 4N9DA 2XSXA 1XLEA 4QAIA 4D72A 4IMFA 3XINA 1JI2A 1GOOA 2HWGA 4X63A 3NQ7A 3FYYA 4JNZA 3RN6A 3D47A 3NQVA 2G3JA 5MHBA 2CWNA 3G24A 2ZUVA 1A5OC 2ZVIA 3WKZA 2IKIA 4PEKA 4LSBA 1KO0A 3A6OA 4WVXA 4DRSA 1K7FA 4DF0A 1TKKA 3O2LA 1IEQA 3VDAA 1TE1A 3LCLA 1UKOA 5CSYA 3A12A 3SUUA 2IS7A 1BWVA 4B5VA 3LM3A 2VRKA 2PRHA 2TPSA 3F2BA 1HJSA 3HGJA 1GW1A 4MTVA 1KFWA 1XG3A 1OCBA 4RV3A 3ZJ8A 1CYGA 1PTGA 5DRIA 2WPGA 1TPVA 1UUQA 3LHZA 1YMYA 3KRSA 1RQBA 3QVQA 2BHZA 4IGMA 1M7OA 2CHOA 4WGXA 3BJTA 1LM1A 1IR1A 1TCDA 5FAJA 4BEUA 3K2GA 2ZRZA 3T08A 4NYYA 1UD4A 3N3TA 4NXKA 4AH7A 3OZMA 3AYVA 3MYOA 4UNKA 3I68A 4IJRA 1NOWA 1P0NA 2CLPA 3T2PA 4B5SA 4XD4A 3REQA 2C71A 2QQ6A 4LXFA 3LHUA 3P8JA 1XUZA 2GUBA 4J7RA 4LPCA 4WY0B 4EF9A 4XBJA 4EK7A 3TSDA 4DWSD 1AQFA 1UH4A 1XP3A 2V5CA 2VC5A 3V0UA 5CZ0A 3CLWA 1I6NA 3CHCA 3GDBA 3MYPA 3SURA 1FWHC 3L0KA 3QN3A 3DIPA 4MUZA 1M9HA 1SM9A 4XO6A 1NF7A 1Y65A 4UTIA 1F4HA 3VM5A 3NDOA 3NUKA 1E6RA 3ZT7A 4B15A 4RE4A 4ORMA 1KCKA 5AYZA 3S2JA 4POCA 2MANA 1FH8A 3SRFA 1MNZA 3DGBA 4HGXA 1L9WA 3BTNA 2JFEX 2HPIA 1G94A 4KEZA 4F0MA 4ATDA 4KWSA 2GK1B 1H2JA 1VIWA 4WSHA 3W88A 3ZXWA 4E8GA 4AX6A 1NQKA 3GRIA 4W7VA 4Q8UA 5HMFA 3E0VA 2A6LA 4L5ZA 4B92A 3O6YX 4QJ5B 3L5AA 3N12A 3OU8A 2WKLA 2GGHA 4PCNA 2V82A 4R85A 4BY3A 3UXAA 2I17A 1KRAC 1V3IA 4LVAA 1V5XA 4GXPA 2CLHA 3RILA 3R6IA 1CB7B 3E12A 3W26A 1C9WA 1OG0A 2X1SA 4FR1A 4AD5A 1DV7A 3NO5A 4RPPA 4A3YA 3M0KA 3BLOA 1UA7A 3KVMA 5E0FA 4B5UA 2IUZA 4D6JA 3E96A 4C6EA 2QT3A 4A3HA 5CSUA 1Q66A 4HTBA 4Q6XA 3WLMA 2C15A 2YR1A 3B40A 3NQ6A 1X1ZA 3QZEA 3VCNA 3NO1A 4GACA 2GJNA 3WDIA 4D2JA 3N2OA 1QK0A 4LEFA 2H90A 4AVNA 5M3WA 3Q58A 3WLQA 4GJ1A 2E5CA 2WSRA 2C3ZA 4US5D 1QI5A 3NSNA 3W2NA 3D3FA 3GTFA 4LNYA 3WLHA 1GNXA 1EPXA 1RBLA 1MRQA 2AOSA 3EB4A 1Q6FA 1JJKA 1IT7A 1TTIA 4FK9A 4P7RA 2A21A 3QC0A 1Q85A 3T2QA 4JFVA 4N4PA 4Q4MA 1SSGA 3AWNA 1E1EA 2YW4A 4UQ9A 3OG3A 4KH2A 4PMRA 3BOXA 4Z1CA 5CBBA 1IEVA 4D71A 3W6LA 4WR3A 4PTNA 4O52A 3GXNA 2PB1A 4LT9A 4L61A 4ADSA 3S5YA 1OCJA 4O1CA 3P6LA 4R7WA 1OGBA 1WP6A 5BMXA 4W85A 5SWUA 4ZQNA 5CGMA 1R2RA 2BOGX 4MKNA 4WSKA 1PV8A 5C6MA 2QMJA 3GG1A 1BYCA 3W7OA 4GJIA 2PA6A 2PRMA 1F76A 3TA9A 2CPUA 2J13A 5C5YA 4NZFA 4R88A 2ACUA 4JTCA 4HZMA 3ZSTA 3WLSA 2X0SA 5E6YA 4XBKA 1MUWA 3CQ0A 1JUBA 4JX4A 4A8RA 2EXOA 1RV8A 3LV6A 2AKZA 3FY1A 2QCDA 3H23A 1W8SA 3E2QA 1EH9A 4Y8EA 5AECA 3JU2A 3MCMA 2PE4A 5I3KA 4KEUA 2FPYA 2YBTA 4L1XA 3P81A 3A24A 2RDTA 3BL3A 3ES7A 2R1KA 1JAKA 3RPTA 3LCIA 3OGRA 1CNVA 2PGEA 1VH7A 1Q4NX 3IEBA 2E9MA 1Y7VA 6XIAA 3WNMA 3EBVA 3TLLA 3VVGA 1DJIA 5D9PA 1J96A 3DKJA 4OT7A 2Y8VA 5IFTA 3BWWA 4GUIA 1HG3A 4G7EA 3R43A 1WDDA 4FNQA 2CHRA 1KFCA 1NFBA 4HCHA 3SO7A 3EDFA 3NM3A 7REQA 3QQ0A 1I75A 3HGSA 4IFRA 1U83A 3VZXA 1O6IA 3QEZA 3NYZA 1US2A 3W87A 5FL1A 3JVAA 4FLOA 2BFGA 2P3EA 1ICSA 4IPPA 1IE7C 3KCJA 3W29A 3EWCA 4ZZ9A 1RCQA 4F0KA 3VNZA 1KM3A 1YADA 2E68A 1CCWB 1PYMA 1IR2A 4LUIA 4XZIA 5LNUA 3FN9A 3VE9A 2W6RA 3WJWA 2GGEA 3NPXA 5TIMA 3QR0A 3K13A 4F2TA 2PAJA 2YBVA 4WCJA 2BHUA 4B4HA 5CSSA 2FMNA 1HVXA 1KFBA 3CIVA 3FXGA 5CZJA 1P1XA 3BE7A 3F2CA 3W2KA 3BW2A 2BOFX 3TQ0A 5FF4A 1AD1A 1NDVA 5DY3A 1W1TA 3B9AA 2BVYA 4K8EA 5CZKA 2VJXA 2BV9A 3TONA 3FXYA 5HBFA 2YYUA 2CLOA 1EX1A 4GHRA 1CDGA 4OHQA 1I1WA 4AF0B 4OUEA 5E9XA 3U2ZA 4OBSA 4DBWA 2QCDB 2FKPA 3G77A 4LV9A 3P5ZA 1W1A1 2I56A 2GSHA 2Z2UA 2Y7DA 4BQ5A 2E1DA 3KL3A 4ZSTA 4MZ1A 1DKWA 1EEXA 3PJXA 2TMDA 1M68A 4KETA 1MXGA 8RUCA 3O6DA 3LBOA 3VIMA 3H55A 1EDGA 4H2HA 3EA1A 3VXGA 3HTWA 2UY5A 5C7VA 4MDOA 3W6MA 3QZ6A 3E2RA 2QUVA 2G41A 3HV9A 1MW0A 2HQAA 4J3WA 2A3CA 1VJIA 1US0A 4E4UA 3VMNA 5IBXC 1KA9F 3DAQA 2ODOA 4LBSA 3W7KA 2FHCA 4LV4A 3U6WA 2PLCA 4FNPA 1TFVA 5TF0A 1WB0A 3BPWA 2D0GA 2FGBA 4JOMA 5PTDA 2C1IA 3VIJA 3H26A 2HTMA 3ARSA 3MSGA 3STFA 4B5NA 3VDGA 3ARPA 4REQB 1W5QA 5I24A 3GIQA 3C0LA 2PLJA 2J7DA 2ISFA 4G5DA 4R34A 2QZRA 4V33A 3QTGA 3WLKX 1GZGA 5M1TA 3P0XA 2V67A 3TQPA 1B3VA 1M65A 4P7OA 3PZQA 4FAMA 1P4CA 2OWCA 4AD3A 3EEGA 1WDRA 2VD9A 5IM51 1R85A 1C93A 3N4AA 1DXFA 3CC1A 3W7JA 1EL3A 4JDBA 1C8YA 4ZE4A 1E70M 4MFEA 2PTYA 1OT1A 2E3ZA 3BLKA 1NOUA 3N1AA 2O7SA 3QHMA 4GQQA 4HNNA 1R3QA 3CTTA 4CQBA 1GYLA 1T8XA 4MYAA 4BS0A 2WANA 2C19A 3DZ1A 3VX0A 2JBMA 4MB4A 5DEZA 5HULA 2EKGA 4H9UA 4GQRA 1H0GA 1NOFA 2YL6A 1VPQA 3OO2A 3BLEA 5E70A 1ZSXA 1W1IE 2QCNA 2V69A 2X42A 4IGHA 1FP9A 1HO1A 3ZFHA 1MEWA 4LOCA 3UG8A 3H7UA 4QHRA 3L4ZA 1Q13A 1KBLA 4YTSA 3W7QA 2Y1HA 1GOMA 4PMOA 1K9TA 1UZ1A 2HXUA 4GY0A 3WLNA 9RUBA 3R0KA 1B3YA 5AC6A 3OA3A 3W86A 1HXJA 1HP4A 3FIGA 3S5OA 1OFQA 3VKCA 4PEEA 4DUVA 2FQIA 5LIUX 5TNVA 2XIJA 1KC7A 1UJPA 3U5YA 4O0ZA 2WCSA 7XIMA 3VC5A 3ZSSA 5CZSA 3N2BA 4W86A 4ZQOA 4DBDA 2WV8A 1WUEA 3P7YA 1PEZA 6CGTA 5H1WA 3SGZA 4D9PA 4NL1A 4J3ZA 1AODA 1DIKA 1HJXA 1XIDA 3H21A 3IJQA 4GZIA 4K1WA 4W9TA 1KW1A 3WF0A 3SW6A 1V02A 3H2NA 5B7ZA 5EBUA 1E6PA 3O16A 1YPXA 4QBXA 4AISA 3MMTA 3GTXA 1VB9A 1PIIA 4Z0SA 1Z42A 2XIBA 3NQMA 2RJGA 3NTYA 2WPBA 4CCCA 3WJZA 3WK2A 3QKEA 3VUSA 1VBJA 4JTAA 2PDKA 4QNWA 3URQA 3SM0A 1FWEC 2OZTA 4IMDA 1XGZA 4G56A 3UWUA 1FWNA 1JUKA 2ZA3A 3QJAA 2IPFA 4A8LA 1ONEA 8CGTA 4HHHA 1NWRA 2CKRA 3QMRA 3LHVA 1I45A 3S1WA 1AJZA 4UOZA 4QS5A 3CAVA 3W7LA 2NVCA 1XPYA 5EKYA 4TMCA 2ZXBA 1L6SA 2PDIA 4DPQA 5A6KA 2OYMA 3ARQA 3QV6A 3M0IA 4IT1A 5D33A 2NW0A 2OSYA 2CC0A 2Z27A 2BGQA 1UC5A 2WKGA 2V3EA 1XYMA 4NJHA 1BRLB 4CD5A 1LT7A 1RP9A 3AIBA 3M0JA 1Y0EA 4E2DA 1R0MA 2O4QA 5GVJA 3SCUA 4EXBA 2IPGA 1C9DA 1QNQA 1Z9AA 2QUUA 4MM1A 3TLQA 1GVYA 3W0KA 3LGDA 5D4YA 1P48A 4LVDA 2A3BA 1H1NA 1UWSA 1C92A 3GYEA 1UH3A 1XRVA 2A4AA 2DIKA 2FJKA 4BF7A 1XFCA 3L2LA 3WQ6A 1WDPA 3WDJA 1BWKA 1Q5MA 2DSZA 3G3MA 4XVDA 4PH6A 3W1XA 2XM2A 4Q4QA 3OA5A 1W5PA 1SZNA 1RA0A 4L6OA 1MFVA 4NT0A 4FF5A 3GO2A 2G3NA 3ELFA 3TUUA 3SI9A 3T0AA 3AYTA 1NQ6A 1ZB5A 1M6JA 4JS3A 4YCPA 3OZPA 4Q3MA 4US6A 1PDZA 4LCRA 1SU5A 1FFQA 4H7VA 5IHSA 3QPEA 1EIXA 4H9MA 4ES4A 2X7WA 1RD6A 4RE0A 4DX3A 2Z28A 2VX7A 2INZA 3BAKA 1VFFA 3PNUA 4P61A 3SCRA 1JZ8A 2REQA 3S5SA 1E56A 2E6FA 4Y7EA 3WQCA 1TR1A 1LWIA 1OFEA 1V08A 1GGOA 1VYPX 2PDCA 1ZP3A 4OBTA 5BOEA 5TD4A 3SCTA 1CB2A 5F4XA 1W0MA 1IEIA 3URAA 1RZMA 3SCPA 1Q2RA 3QGKC 5FEPA 4PCTA 5G4WA 3W1PA 3WJYA 3FOKA 2BY2A 4O15A 1QI2A 4TO8A 1ONXA 2AAMA 3N9SA 5A5WA 5A6JA 2A6NA 5BWAA 1TV4A 1T99A 2J9YA 3AC0A 1NP0A 3NQAA 4M5PA 4F0LA 3W7DA 2J6VA 4NAEA 2ALDA 1HUVA 1V02E 4HNVA 3WNOA 2V0TA 1V6YA 1W3KA 3SECA 1ISZA 3R10A 5M2FX 3PAOA 4JL2A 4LNCA 4YN5A 4DNHA 3NZQA 1LROA 3QF0A 1SO6A 1BYBA 2B31A 3SZ8A 3V75A 1X38A 3HJEA 2OLAA 4N02A 1HJUA 3LHYA 1UD3A 3S83A 1KBBA 1SGJA 3EXSA 3THUA 4MGGA 1G69A 1U5HA 4FS9A 4Q22A 1XIGA 5HATA 3FA4A 2PGFA 1OG6A 1T7LA 2J7HA 2J78A 4QG9A 5KITA 4L64A 2QHAA 4X0NA 2XFFA 4C6BA 2W0UA 2XH7A 4NILA 2DZBA 4G1NA 4LUTB 1ONRA 3WF1A 3LCGA 2BP1A 3CBWA 4FX8A 3F2DA 3SUVA 3NZPA 3F4DA 3K4WA 1BYDA 1D3GA 2W67A 2ZFAA 4HPJA 3R94A 5F7UA 1X97A 3OPSA 4DHGA 2FTWA 1K4HA 3AXKA 1CX9A 3NM1A 1I2QA 5CPMA 2C14A 2J7GA 1YE4A 3MHUA 3GU2A 4W8AA 4PB4A 4ZQCA 2D3NA 1ISXA 1YBQB 1JXJA 1H51A 1IQ8A 2REQB 2PSNA 4Q4OA 1XKYA 3GTIA 1XLJA 3JW7A 4YLWA 5C55A 3IJ8A 3RCYA 3ITCA 3L4YA 1W3IA 1D9EA 2A5HA 3VIKA 1OGGA 1GZJA 2X09A 2CZ5A 2A3AA 3L5LA 4XZWA 2BB0A 3KOWA 3URBA 2AKMA 5AZ1A 4E8DA 4C6CA 3FAWA 5BNKA 2A7RA 1EJVC 2TSYA 3C56A 4RDYA 2XZ7A 4AQLA 4H19A 3LXCA 1OC6A 3L68A 1DWGM 4FXSA 1G4PA 4IUOA 3UNTA 3B0VC 2H8ZA 4XAZA 2R14A 1US3A 4ILSA 3W25A 2QDGA 2R24A 4H8HA 3W7IA 1XM3A 4Y90A 3IJLA 4O4WA 4YVXA 2CW6A 4EPEC 4N6EA 3E0LA 4M24A 4U10A 3LQLA 4UC5A 4B5WA 4A4AA 1PKMA 8XIMA 4UIOA 5K4ZA 3BQ5A 3AYSA 1HKWA 4DF1A 4XVEA 4ROPA 2VGFA 1ME7A 1W37A 3O6AA 1FHVA 1UC4A 4GYPC 2RKXA 3SRDA 3PF3A 2Y2WA 2B7OA 3G0XA 4X60A 2PWHA 2WNNA 1AJ0A 4LYPA 1E1CA 4WIWA 1Q6GA 3OJGA 1VEPA 1YDOA 4MPKA 2P5NA 3MVIA 1O7AA 1SJCA 4UFHA 2RJHA 2WZEA 3L2IA 2OWWA 1X8FA 4B90A 3TOPA 3RR4A 1XYBA 1L6WA 1LORA 3E6EA 5EY5A 1CWYA 1MO0A 1UD2A 3FHQA 3WBEA 2BY1A 6ALDA 4LJ3A 2VP8A 4LS2A 1HKJA 3SFKA 3WK3A 4FZIA 4MJZA 1E6ZA 1EQPA 3CIWA 1G7UA 1EP2A 2ZUMA 4QCFA 1NFPA 2WJEA 5KTLA 2QPSA 1IGWA 3ATZA 1W5NA 2B7QA 4ZOEA 4RDWA 2YCLA 4DXKA 3DFHA 1BXBA 1PS9A 2YJQA 4HJFA 1AW1A 3AAMA 4GABA 3F5JA 3O1NA 1W1B1 6XIMA 1KXVA 3M7SA 1YDNA 1UOZA 2GJPA 3M47A 2QPUA 3M46A 3PSWA 4JFTA 3ARVA 1EF3A 2WZMA 2PP0A 4P5UA 3ZJ6A 4RE3A 1UB3A 1XLDA 3EX2A 1HKVA 1XC4A 4HHLA 3TQVA 1QNSA 3HFTA 7ENLA 4IP7A 3R4IA 3CZEA 1TYGA 5CBIA 3LCXA 4RNFA 2C13A 1J5SA 3EB3A 4MUPA 5RUBA 2WAGA 5C9RA 1O95A 1QHZA 2QUTA 4DBSA 1EJWC 3T40A 3LTPA 4U28A 5A8QA 5KETA 3HA1A 4NAFA 5C9WA 3DC0A 4QM1A 4WGHA 4IISA 1K77A 4HSNA 4HTYA 3AXXA 3B9OA 3AI0A 4NX0A 1WYIA 4QJ3B 3PNZA 3ARTA 2CLFA 3T78A 1IZJA 2V68A 4NX5A 1OWQA 3DENA 2ICSA 4F40A 2GL5A 4WDUA 4H9YA 1V0NA 3CT7A 1X96A 2YPIA 1A50A 3EWYA 1IHIA 4YNGA 3PWGA 2DFAA 3IWPA 3OTRA 3PTQA 1D7KA 1IWPA 1AUSL 4KWUA 5K9CA 5AC4A 1TJ0A 3H2CA 5AC8A 4GI6A 7REQB 4PR4A 3ABSA 1XGEA 1JULA 2ZOXA 3M43A 3RRAA 1XIEA 1MQPA 2INEA 4AMCA 3AHZA 1LCOA 4UZSA 3U5UA 4ZB5A 2PLKA 2XVNA 1Q6CA 4N6FA 4RPQA 1M7JA 1VBGA 1Z8AA 5U7SA 3WQ8A 2AQWA 2HNEA 2VO5A 4GBDA 4PMQA 3GBDA 2G4JA 1IEXA 2VGBA 3RX2A 3QV8A 4DO7A 4XTIA 1R8LA 2CBVA 2Y24A 2RGLA 2B0MA 1SJAA 2E8YA 3T55A 3V7PA 3L4WA 3GC5A 3MI2A 5LGXA 1RCXB 4JHMA 5HNNA 1ZJBA 1XD0A 3NL6A 2X16A 2PDNA 3C6CA 3L9CA 1L0PA 3CV7A 3I7RA 3V0SA 1GVOA 2EJ1A 1IEWA 1QK2A 2XG9A 3R5EA 5D2XA 3GHTA 4MAZA 3COTA 3QXBA 5E93A 4OU1A 2QF7A 4BZYA 3O05A 3CQHA 3V3WA 1MXSA 1UMYA 3AHTA 2I9UA 4PSPA 3TW7A 3FKKA 3DHDA 3IIOA 1UROA 4F0RA 1UZDA 2PBGA 2G37A 4LAOA 1TPH1 1UR9A 2JGQA 4XZBA 1DWJM 3TV8A 1PXGA 1OYBA 2QUMA 1PO9A 3EWDA 1A4MA 3W82A 4I5XA 4CU7A 1E0XA 4JTJA 1FCBA 3NPVA 4MOZA 3DECA 3MW7A 4ZO8A 1VQTA 4HOWA 3LPGA 1MW2A 4AYSA 1GVRA 5AYXA 3AHYA 1MSSA 1TJRA 4GQGA 2CBUA 3TMQA 1OZQA 1ECEA 5A8MA 5GPRA 4UXDA 1MI3A 1OB0A 3CU2A 4PTVA 3WF2A 2E0PA 3LGGA 4ECLA 2D0FA 3F5LA 4AG0A 2NQ5A 3IJ7A 3CL6A 1AG1O 1D3HA 3NGJA 2ZC8A 2ACQA 3V5FA 2X40A 4WY0F 1CGUA 3WF4A 3GY1A 5JIWA 3W83A 4AXKA 4CNTA 4QSHA 1BG9A 3NQCA 4ZQPA 2Z24A 4NQ1A 4K1GA 3AIWA 1W5MA 3AUOA 4W8BA 3VDHA 3WD0A 3I65A 1FWTA 1SQ7A 5EMJA 3G1YA 4LB3A 3O0KA 4HCDA 4LS0A 1SFTA 4PZVA 4XK2A 1GG1A 3LK6A 4GVFA 3H24A 3NQFA 3DDMA 3TQKA 3FA3A 2WK2A 3ZJ7A 2Q71A 2Q8ZA 4B3KA 1CI1A 5E6ZA 3ZIZA 5LZLA 1PTDA 1GPFA 4CNUA 4EP8C 1E0VA 2IW0A 3ZO9A 5LIKX 3VK5A 1AW5A 4O1EA 1R3VA 5CGTA 4KWVA 4L56A 2QDHA 2XGBA 4LQ1A 4N2YA 4XSMA 4PMUA 1KCLA 1MFUA 3MANA 3RGTA 1FBAA 3ZR5A 2PTWA 3CB8A 1XIIA 4OV9A 2Q3OA 1NWSA 5T9BG 3GNXA 3V35A 1U30A 1GVIA 3N3MA 4GI4A 1R2SA 3IARA 3CV1A 1TV2A 3UXLA 3PPHA 1M41A 3UJRA 4GXWA 1DJZA 1PJ9A 4DWSA 3LQGA 4H6EA 4V28A 4A35A 1WO2A 1S1RA 4TX6A 2C7FA 3WG6A 2X30A 5EMMA 1OIMA 1KXTA 2YCIX 1JCMP 2XH4A 3W7CA 1GT8A 1UKPA 4IIGA 4HA0A 3MQTA 4RXFA 4I9MA 4H1ZA 4NSBA 2I9EA 2OLHA 2FVKA 1FCQA 1S5VA 3CUXA 2G96A 2ABAA 3DYPA 4QLKA 1ZJAA 4ONVA 2Q01A 1NH6A 1HL9A 3L67A 1YNQA 1WZAA 3A9IA 2YX0A 4DAIA 1I2PA 5F2MA 2DPEA 4YJ5A 5XIAA 5ECVA 1W9XA 3SCSA 1LDCA 5FAGA 4MADA 2CWXA 1IWBA 4GIRA 1QI4A 3NVDA 1GOXA 1SFLA 2DU2A 4JZ5A 4JTRA 4GUJA 2ZXQA 3LBMA 3CJPA 3V4BA 4UTUA 1WKEA 1T8QA 1BTMA 4MIMA 2OGYA 2OLSA 3WZ0E 1TIWA 3DI0A 4DYJA 4CCDA 1DJWA 5CPLA 5G2HA 3LYEA 1OGSA 4GC3A 3A47A 5I6SA 3M0YA 4O14A 4BQ4A 2GWGA 4V15A 2EO7A 5A6TC 3V1HA 3AS0A 4G6CA 4QQ3A 3SY8A 3CWHA 1EKOA 4E2OA 1H09A 2NQLA 4M0XA 5HR6A 2VEPA 1KM4A 4Y9AA 1WKFA 3KDOA 2DP3A 4QIUA 4C7GA 1QW8A 3IUHA 4W84A 1FKXA 4IUGA 3G5EA 3HN3A 3A4XA 1OF6A 5HA7A 3IIVA 2Y7GA 1VD6A 5I3GA 1XDMA 3GU1A 1VJZA 1NDWA 1GEHA 3HG2A 1BRLA 3KRZA 4BI6A 1W56A 2H9AB 4EF8A 2EPKX 4PSRA 4GK8A 3WELA 1XHGA 5CEWA 3TDFA 1CGXA 4ML9A 1RXOB 2ZBTA 3S5NA 3QKZA 2WHLA 1DPMA 3I6TA 1ITQA 1Q6RA 4XQ6A 3NOYA 3H7RA 3P5YA 4O28A 3LM7A 3DBPA 1J6PA 4AB4A 2DV0A 1M53A 1JPDX 3PB2A 4EVZA 1HFBA 2NQZA 3O15A 2VM8A 2YYTA 4CD6A 4OECA 3G1AA 1LWHA 4IX0A 2UV8G 5GJMA 4JL1A 1MYRA 1BAGA 1BQCA 4DM1A 5JQ9A 2WBGA 2NVDA 4NG3A 1QOXA 2R8WA 3UESA 4NJJA 2PDXA 4M6PA 1FWGC 3G8RA 2XN2A 1AMYA 5BOFA 1PZ1A 2Y7EA 1AH3A 3Q2DA 4NJIA 3EKZA 1SO3A 2YB1A 1G01A 1VP5A 4KWOA 3RMJA 3GIYA 2V3DA 1CXEA 1XF0A 2OGJA 2ZZ2A 3TN4A 1XH1A 2J7CA 3I7SA 3V18A 2V81A 4GQBA 4DLFA 1JPKA 3PG8A 1XJBA 3ITTA 2VCCA 4IQLA 3VINA 3USBA 2WJZA 2QCLA 1TG7A 4Q32A 2XVKA 4O1DA 5DT7A 2RUSA 3GB6A 1QT1A 2RDUA 1TPEA 1B3WA 1UUOA 2WJDA 1HW6A 2X1IA 3JZUA 2FFIA 2WNWA 3PJTA 1TA3B 1KR0A 1FKWA 5KSWA 3RMEA 5GJPA 2QJNA 2WMIA 4C60A 4DZIA 4WDXA 3LZ3A 4L4MA 1ZLPA 4MB5A 1CLXA 4JAWA 3FGCB 2ZX6A 3KZSA 1CGVA 1OD0A 5A8PA 3QPZA 4UQBA 2Z4GA 3KS5A 1QO2A 4BR1A 2ZUNA 2H6RA 3B06A 3FCPA 2R82A 4RK8A 1V3KA 3UJSA 3SN1A 2BGNE 2OKOA 5I3JA 4UQCA 5KEZA 2V5DA 3Q67A 1DEDA 2VGGA 2A2IA 2YFOA 3DFSA 1ALDA 3LZ5A 1YTDA 3PULA 4EWJA 1GG0A 2WM1A 1I60A 4R7OA 1PB0A 2VOMA 2C91A 2GQ8A 3CZJA 3W76A 3SQLA 2YDQA 3M0ZA 1JDCA 4CNOA 4BCEA 3UWQA 3O06A 3TTYA 2PLMA 3S6DA 1GVSA 1J93A 2BGSA 3GR4A 1O1HA 1TIMA 5D04C 2E28A 3PN8A 4N4QA 1EIBA 1KCZA 1H41A 6PTDA 1EJSC 3LHTA 5A2AA 3WEMA 1XLFA 1ME9A 1P43A 4QRNA 1FWSA 3W2MA 3W53A 4E3TA 4FX7A 3B0PA 2VGIA 4M19A 4N7QA 2OCZA 3N29A 2ZZ4A 1Z48A 4UNIA 1OD8A 4XIMA 1UWIA 4QSFA 5H6HA 3DFQA 5HJYA 4YXGA 2IPWA 2Z6IA 5G1TA 3LOTA 3SUSA 4C1NA 3BMXA 4EXAA 1RP8A 5U4NA 1KD0A 4KERA 1TWDA 1KTBA 3OHMB 1W9PA 5IFPA 3M1ZA 1XFBA 4XAFA 2E6AA 3V16A 4XKMA 3AZSA 5FF2A 3W73A 1F05A 1CZ1A 1LJYA 1YYAA 1X1NA 1LBLA 1AQ0A 2DH2A 3ZVHB 5C8BB 1E1CB 4P7NA 1IXOA 1FH7A 4QROA 1KTCA 2KAUC 2VCBA 3LD5A 4F3HA 4IXHA 1PX8A 3HG4A 2I7GA 1PX4A 5KZ6A 2OZ3A 3C2RA 3WQFA 5FJOA 3M6YA 3U2OA 2BTMA 3MKCA 3QYSA 4P7LA 3ZT5A 1JCXA 4IFKA 2FGZA 4J3SA 4RZBA 1F9CA 1W3NA 3PFRA 1HJQA 5FJPA 3BMWA 4K68A 4A3RA 3V0TA 2HK1A 3ZVHA 5K7JA 4M81A 1W1ZA 5ECUA 2ZX5A 1EFZA 3O3RA 2VC9A 1I1XA 1X39A 4PBFA 4OV4A 1RHCA 5L9FA 3PBGA 1NARA 3CUZA 3BAJA 3W01A 4BI7A 2YGYA 3BV4A 3WDHA 4A22A 5H8UA 2ON3A 3PC0A 2XGIA 4JKKA 4Q4KA 3HQPA 4XV0A 4NNBA 3NSXA 4B4FA 3S47A 3LHWA 1R6WA 4IJBA 1YXDA 4DWSC 5D9MA 1R9XA 4UTMA 3SDOA 1R30A 3MV11 2PTDA 1JCJA 5AC7A 4F9DA 1E6XM 2D23A 3QGAC 2HV5A 1K7EA 3DC8A 2XZ9A 1SMDA 2CESA 4DNMA 1RQEA 1JDDA 3I3DA 1TUFA 2GWNA 1RVGA 2V63A 1VRXA 9XIMA 4MYXA 4HNUA 4S3EA 4RZ4A 5HPOA 3BC9A 3LSBA 4LUTA 2OXNA 5HWMA 5HNUA 3T44A 4A3QA 2YXXA 2WW5A 1XINA 2Y70A 5G2IA 4XB3A 4RNHA 4MZ8A 4FA3A 2ZVRA 4A05A 3CS2A 4MKVA 3BCDA 3RJXA 3R58A 3HGRA 4IPIA 2C16A 3M0HA 5FIPA 2WSPA 2ZE3A 1RR2A 2DDXA 3STPA 3BARA 1CECA 3TX9A 3KBMA 4GIEA 1PCKA 2G3IA 4HMEA 3G1XA 3BCJA 4HZ7A 4W87A 5CJ5A 3CQJA 2QKFA 3RIKA 2Y63A 3O6CA 1TV8A 3NGFA 4PMXA 1QAPA 3QBUA 9CGTA 1DIEA 2PUZA 4YCOA 5EPDA 5EBAA 4TOQA 4MWAA 4XKYA 4QISA 2NV1A 3LI0A 3FVMA 1AL7A 2EKCA 4TR9A 4WKHA 1EXPA 3TJXA 1H50A 4EPKA 3N9RA 1EDTA 1V6TA 3WLJA 4FMVA 2ABBA 1KM5A 5BYWA 4AEEA 3PZVA 3TZFA 4P8XA 1H49A 2BX7A 3KX6A 3AXHA 3ORWA 4QQUA 4AD0A 4W4QA 4J3TA 1UR8A 3RLVA 3WD2A 3WNPA 1EJRC 2QW5A 3MTWA 4M3PA 4E2VA 4NAEB 1E9LA 3MPGA 2OEMA 4FP1A 3VGBA 4G9PA 2QYGA 5AKQA 2RH9A 4GMEA 4P8UA 1GPWA 4FNTA 3PJWA 3GVGA 2GYIA 3LU2A 4AZHA 1WOAA 1NDZA 3MUIA 1ODUA 3QH2A 4JQ1A 4DBEA 1PIGA 1XKJA 5HWJA 3CPGA 3W70A 3VU2A 2VQTA 1EO5A 2DW7A 5GNXA 1OK6A 1X8CA 4AD4A 2VDIA 3HPSA 1ITXA 4YTRA 4IH3A 3GXIA 5CXPA 1G4TA 1OCQA 1PKLA 3RCNA 4H9TA 4AVFA 3B9NA 4AZIA 5CC3A 3C0QA 2VQUA 5E0CA 5DMNA 2EPNA 1E72M 4JEJA 4UTKA 5E0KA 2PURA 5JMUA 3F4CA 1EP1A 3IGSA 3GD6A 1FTXA 4F48A 2QGYA 4MLJA 2PF0A 1EO7A 5HMSA 3TJ4A 1GONA 1U33A 2OG9A 1XLGA 4RL3A 3BAYA 1ZUAX 2EPMX 1QHPA 1AQMA 5J5RA 2BVTA 4K37A 4O53A 2V5JA 3BG5A 1EEPA 3CIXA 3A4WA 3IAPA 1GJUA 2DJXA 4DWSB 1X6UA 1SSDA 4WXYA 1XLBA 4C90A 4LVFA 4ERIA 4DY1A 1B1YA 3NJ3A 2R6OA 1H7NA 1UR3M 2CETA 1QJWA 4L4OA 3FS2A 2A79A 1V8EA 3T1GA 2X0YA 1EF2A 2VRQA 3B8TA 3MP5A 4Z2GA 3UGRA 5DF0A 3AZTA 5FSEC 1TVLA 3PZOA 3N2XA 4A8IA 3VFLA 2DW6A 3W7NA 2DIJA 2V9DA 4ACZA 4XD6A 1EHNA 4IFOA 2ZA1A 3WEOA 3POHA 3ITGA 4EPBC 1PSCA 1XXXA 3UF9A 1XQKA 3N14A 1DWFM 3LPFA 3AIRA 5FSDC 4MSSA 2QF8A 2VWSA 3GE7A 3ARRA 4TUFA 4FB7A 2NWRA 2PZ0A 3W07A 2AQVA 1QBAA 1QRQA 1OCNA 1GCYA 1YNPA 3AS3A 4H00A 1ZCOA 3A5VA 2O55A 1OM0A 1NAL1 2Z1KA 3QZAA 4ZOAA 3BDKA 3MZNA 5BU6A 1RCOB 5D32A 2QMKA 3MUCA 5KINA 4J4KA 4YMZA 3TTSA 3QMSA 3ZZ1A 5FJUA 3TKFA 1LP6A 1TR9A 1XDJA 1TJPA 2P8CA 5CKSA 3GAYA 4F8XA 2D69A 3RO8A 1P5BA 1WZKA 4HD5A 4MB3A 3VNYA 1N8FA 2W91A 4ZFMA 2HPMA 4NNCA 4QP0A 7TAAA 1NEYA 3W84A 2VMFA 2EG8A 4IIBA 3R8HA 5BWFA 2XFYA 5CJMA 1K4GA 4PTWA 3ICJA 1KGWA 2OYKA 4E8CA 5JBDA 3IJ9A 2FIQA 2R1MA 3SGUA 3T7VA 3TFXA 2C0AA 3B8SA 3ARYA 3QFEA 3I3EA 3AYRA 1JCNA 4A29A 4JQ4A 5A2BA 1TWSA 1Y8BA 2F9RA 1KLYA 1BXCA 1FY6A 2OOFA 3WLRA 1XBXA 4WZHA 4GCAA 2GGJA 5HMDA 1GHRA 3UR8A 2ZDRA 5EMUA 5I07A 1CENA 4OKDA 1AK5A 3W37A 2FJUB 5AC5A 3U48A 1VYRA 1LYXA 3RK8A 1YX1A 4Y9NA 5JUVA 4BF5A 4XSLA 2WWDA 1GYMA 3W81A 2WVVB 2OTDA 4HBKA 1WXYA 3H22A 3VD7A 1FWJC 3CLMA 1ZBCA 6A3HA 4S2CA 2VR4A 5EGRA 1OHLA 3BICA 4LU0A 4UTWA 4UCFA 4Q8MA 1EWDA 4O18A 3C5QA 4LYQA 4AEOA 3PP7A 1GTEA 3ZYZA 1B3ZA 2IQDA 4D6IA 1FOBA 2HDJA 1O5QA 1AZ1A 2PD5A 3WCZA 4BEQA 5CQ1A 3Q45A 5DX7A 1CGWA 3CK5A 2BMBA 4JTUA 2Z7KA 4WEVX 3PZTA 3MJYA 5C0QA 4NUWA 4PA8A 3KOXA 3AUJA 1O12A 4X0VA 3WQ4A 3WD3A 4HT3A 1I2RA 1XYCA 3WFLA 2XN1A 1CGTA 4A6GA 1GVFA 4D6EA 4GKLA 4H01A 2A7PA 3R13A 4WJEA 4E2BA 3NG3A 1LWJA 3NURA 1UWTA 3CEUA 4FF7A 8XIAA 1DJXA 3ABRA 4FNSA 1HP5A 2CLIA 3BAIA 1XLMA 2WMIB 3VGHA 3GXTA 3DCPA 4LVBA 1DJNA 1HX0A 3OP2A 4BWLA 3HQ1A 4O0KA 2O9RA 1K9DA 3WLOA 1HVQA 1MZHA 2IMRA 2DZUA 2VR5A 1OFPA 2J9XA 1N8WA 4KMQA 3KE0A 1E0TA 2BOEX 3FDGA 3QY6A 2O9OA 3GTNA 2X1RA 3GW0A 2POZA 1ZL1A 3UCDA 4D6CA 3B03A 1R9YA 1XLHA 3W1AA 3THAA 3IAQA 3PHAA 4YPJA 4ZE5A 5AHFA 2ACSA 3MY9A 5DBTA 1YDVA 4Z1YA 4Z08A 3NPUA 2V3GA 4IMGA 1R86A 1ITUA 3KVKA 1Z3NA 2ISDA 1W6TA 2VEKA 4IIEA 3VOHA 5FF0A 4FLQA 1OX6A 4AXNA 1T41A 1TWZA 1FWCC 1QI3A 4QNEA 3GG7A 3NQDA 3KVLA 4AW7A 4PRRA 3U8GA 1QBBA 1HTIA 4G8TA 1EJ7L 2CCRA 2PZNA 4WJXA 3PUOA 3UWVA 2VKZG 2FDMA 4GNVA 5EU9A 3T0BA 1DXIA 4GZJA 5CAKA 1RPXA 5FJTA 5K9XA 3WMLA 1F4AA 1HJWA 2YZRA 1UH2A 3DFTA 5A6AA 3PAJA 4GA8A 1RALA 3GG8A 3S1UA 4LAKA 4LBUA 5CJNA 3G22A 1QW7A 2OKTA 1QI0A 1LBMA 4Q33A 1S2WA 1NSJA 2ZUUA 3ZT6A 3UZXA 1MWOA 1FWAC 3CH0A 3L4UA 1JZ7A 3AU2A 2VENA 4JTKA 4ROQA 5CG0A 1E15A 4PUDA 3EMQA 4YVPA 1PHWA 1KV5A 2W9MA 1OYCA 2CITA 4XAYA 2Z00A 1V7AA 3ZR4A 4GXMA 4KGJA 3E1F1 3U9IA 2NUXA 1P6CA 2YA1A 1QTWA 1TRIA 1N2VA 1VRDA 3WK0A 1EYWA 1XWYA 3N17A 1DWIM 1IIHA 3MP3A 2J62A 4IZGA 3DEQA 4Q8NA 3APGA 3UG4A 4US5A 2Q3RA 1EZ2A 3EXRA 1TX0A 3VGFA 1LL7A 3WBWA 3MI6A 4KGLA 1AH4A 1ICQA 1B2YA 3TYZA 4M8UA 2VL4A 2HXTA 1EGZA 3AISA 5EMKA 3ISIX 3F4WA 2QCMA 1XPGA 3EDJA 4I7UA 2QGHA 4GH3A 3TYUA 1B3XA 2INFA 5I09A 4JFSA 2EBNA 4HYVA 2FZDA 4ERAA 1EJUC 3OZOA 1OZMA 2VZVA 4R33A 1UCWA 2PP1A 5AN7A 2FVLA 1HJVA 1VIZA 3RR1A 3LEPA 2G95A 1TZ7A 1H62A 1U2YA 8A3HA 4EKJA 1A5KC 4M80A 3FYOA 2IPJA 3P8IA 3ANYA 3LPPA 1W1YA 1P0BA 4WK9A 1K02A 5AOUA 2HMCA 5EFFA 3LENA 4BF9A 4DN1A 1VFUA 2JALA 3W74A 3UERA 3F1QA 4ZBCA 2CXGA 3NQGA 1VPYA 2X1UA 1OC5A 2GQAA 4Q7IA 4GPNA 1V03A 1R87A 2WNQA 4RXGA 1JGIA 1E4IA 3WO8A 1GQJA 4DI8A 1VGAA 2ZX8A 3GFYA 4F79A 1SO4A 3KAOA 1IZCA 4UTLA 3W22A 1DE5A 3HG3A 3WNKA 5I79A 3N2CA 4IF2A 2HRWA 2V2HA 3R25A 4R5EA 1XDLA 4DF2A 1BLIA 4J35A 5J04A 4UMAA 3UU0A 2ISVA 2R91A 4J1OA 1PYFA 3E0FA 3UFYA 4AC1X 4NZ5A 1XYZA 3LRKA 3M7WA 1PDYA 3WNNA 5FEZA 2ZZ3A 5CLWA 3TR9A 4KRZA 3TIMA 3S2LA 3EOLA 2AGKA 3DUGA 3VNLA 3HBLA 5C9ZA 1S3TC 2EPLX 3A3HA 2FTYA 3WYZA 5C2GA 5BXPA 4R9XA 4PGLA 2OT0A 1UZHA 3DOPA 3LCHA 4DJEC 3KOZA 4A2RA 3VMOA 4BK9A 1E6QM 1ZAHA 4KFOA 4LC6A 2JF6A 4DAFA 2HK0A 3HURA 3LPOA 3II1A 1GUVA 3SCVA 3ITOA 4Z2LA 2NXHA 2BVDA 3RITA 4CEXC 3QOKA 1XBZA 4TIMA 1EUNA 4PTMA 1JI1A 4OUIA 1OSEA 3MSDA 1J2WA 4Z1DA 3P84A 3TVAA 4LWWA 2OEKA 1K03A 1OFRA 3B8UA 3OVRA 1B4KA 5D02A 4I7WA 4ZB2A 3VTRA 1VFLA 5HXMA 5FEWA 5IDIA 1V3HA 4JIRA 3B05A 5HAOA 2WMKA 2BHYA 1W9BM 4IGSA 2NWSA 1LL6A 5CGQA 3A13A 4D8LA 1F3WA 4XZLX 2Y85A 3E9AA 3KL0A 2EAWA 4WKFA 1L2UA 2E67A 2BBFA 3UZ5A 3EX3A 3OOQA 4XZ9A 3GVWA 4DYKA 3BCFA 1H11A 3O63A 3W1RA 5E5CA 3LXAA 3AMKA 3WFAA 3MS8A 2TYSA 4NJGA 3TH6A 3T8QA 4I3GA 3IK2A 2VD8A 3O0FA 1ZALA 2XSBA 4DO4A 3M9YA 2QNEA 2NSXA 3ZJKA 4K7YA 4WKAA 3QR3A 3I4EA 2VFIA 1KFEA 4MNKA 3TCEA 4B9YA 3KL5A 2D20A 1DXEA 2VDHA 4H9XA 1EWEA 1SZRA 3GHRA 2CBIA 2ZWZA 2WKJA 1I2OA 3VOJA 3TROA 2PGRA 3IRSA 2W5FA 4B9ZA 3GM8A 3TNOA 4IP5A 3SCNA 1XIJA 6REQA 3S5ZA 3C8NA 3TN5A 3WUGA 1GVQA 3UCCA