1B3ZA

Xylanase from penicillium simplicissimum, complex with xylopentaose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
total genus 128
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3zA00
4RE2A 3ALFA 3MV11 1JZ7A 4PEEA 1FFQA 3WF2A 4UFJA 4C7DA 3THDA 4JAWA 3MSGA 1W9BM 3WL0A 3BGAA 4B16A 1J10A 2G41A 2J8FA 4AD2A 2J47A 2O92A 3SUSA 4AEFA 3VX1A 1E71M 3CZJA 3AICA 1NM9A 5M5DA 2J74A 5FCZA 1MFVA 1P6WA 3WUBA 4UOJA 4ZE4A 2BVDA 4U5IA 2G3JA 3VIKA 4M81A 2PWDA 1V3KA 2VZVA 3T08A 3CTTA 4D6IA 1HP4A 3VNZA 1BLIA 2WAGA 3VIFA 5M17A 1ZBCA 1JDAA 7TAAA 4OKDA 4PTXA 4JCLA 4MNLA 8A3HA 1EOKA 4FLSA 2X8RA 1EQCA 3LPGA 1QI2A 1VAHA 4PUDA 2MANA 2WZEA 1ECEA 3OGVA 4TTGA 2X1IA 1ISVA 1GNXA 1UA7A 4H41A 4MB3A 4IPNB 4JFSA 3TP4A 3SCSA 4U31A 2WHKA 1GOWA 2ZUVA 4FLRA 1UR8A 1DP0A 1PIGA 1DWIM 3VU2A 3OIHA 1B2YA 1DWGM 4B9YA 1IT0A 1WCGA 1UOKA 5EFDA 4Z2HA 1QNPA 1RPKA 2J78A 2WC7A 1QI4A 1UR2A 3ECQA 1CGUA 1NWTA 1JD7A 1E0WA 4WKFA 1Q6EA 4JFWA 3AMGA 1NWSA 2WKLA 6TAAA 5I23A 3KE0A 1AMYA 4ZXLA 1C93A 4HA3A 4CUCA 2ZWYA 1GW1A 2VR5A 4J27A 2NT1A 4D6EA 4CN1A 2DT3A 4V2XA 4TX8A 1UZ4A 1K6AA 3PHAA 4J3WA 4DUWA 4F66A 4N42A 2YA0A 4DM2A 2VJXA 1B30A 4H8UA 1BGGA 4TVCA 4HMDA 1Q6CA 1RH9A 4W84A 1CWYA 4UTFA 1B3XA 1WDPA 4PCSA 2ZUUA 1KQZA 3ALGA 3D5HA 4W8BA 2ZICA 1IV8A 1VJSA 1E3XA 2BY1A 2XFFA 3WQ8A 4HOXA 2FH8A 3CPUA 2VZSA 5BXSA 2PWFA 2OSWA 2O9PA 3K8LA 3F4VA 2CBJA 4FLOA 3WNLA 5A6MA 3ARZA 1YHTA 1C7TA 1E72M 4QFUA 3VIIA 2J75A 1BG9A 1E1EA 2UY2A 5EB8A 1J9YA 1L0PA 4JIEA 2WC4A 4W86A 4D72A 3WQ6A 1UQZA 2D23A 3CHCA 4CU6A 3U7BA 1JZ2A 1LQ0A 1VIWA 1MQQA 1ISXA 2DIEA 3PZVA 1KB3A 4R5EA 1K9EA 3VGGA 1PAMA 3ARPA 3EDFA 3PZNA 5A3HA 1R87A 4RL3A 4PMZA 5GPRA 4UOZA 4LYQA 3L4ZA 3RM4A 3ZT7A 2ZXDA 2W5FA 3L4UA 5D9OA 4XUYA 5CLWA 3WMCA 4MDPA 4H04A 3POCA 3BAKA 2XVPA 3U7VA 4DWSA 3CH9A 1QVBA 2BNJA 4GI9A 4CD8A 4D6FA 2WHLA 5E6YA 2DSZA 2EPOA 3PN8A 3HN3A 1BVZA 1OGBA 4P8WA 1GONA 4PTMA 3BAWA 2W4XA 2XSBA 2GJRA 4CCDA 1M53A 3WENA 1CECA 2BXYA 3ZJ8A 1E4NA 1UUQA 1JZ5A 1GPFA 1JXKA 3VDCA 3WUFA 3SCWA 3GNOA 3K4DA 2NT0A 1GORA 1UR0A 7CGTA 3AXIA 4KRUA 1V3IA 1NARA 4M24A 3VIMA 5D8WA 3T0AA 1B3ZA 3VGHA 2O9OA 1X6LA 1UWQA 3TTYA 2W66A 2A3BA 1HVXA 2ZUTA 1XC6A 1E56A 2F2HA 1WZLA 2WMJA 2F8QA 5FOOA 3VIOA 4GQQA 1XD0A 1IZKA 2PF0A 1AQ0A 3I3BA 1JD9A 5A2AA 1KWKA 2WYSA 3SIMA 1FH8A 1GOKA 1VENA 2J7FA 3PZTA 4L4OA 2JIEA 2CERA 3L4VA 3ZJ6A 2V3GA 3GM8A 4XV0A 5D9MA 3AMLA 3FHQA 2VNCA 1KR1A 1UD2A 3AOFA 3NUKA 4PMVA 5D9NA 3ZOAA 1UWSA 2RGMA 4HZ8A 3SUWA 2CITA 3VGEA 3CUFA 3QR3A 4TUFA 3AS2A 3A47A 1BPLB 1MW3A 5EFFA 5D9PA 1JDDA 3J7HA 1ZJAA 4MB1A 1UH4A 3AIEA 3FN9A 2VURA 4M56A 3APGA 5AC4A 2VQUA 4UFLA 1TVNA 1JXJA 2WCGA 4AY1A 4OIFA 2IXVA 2OLHA 1E6PA 2EJ1A 2VMFA 3LMYA 2Y8VA 1K9TA 1US2A 1HJVA 2C7FA 3BC9A 5I5RA 1OBAA 1D7FA 3U5YA 2XIBA 3PBGA 1V08A 1NWRA 4EK7A 4AZHA 4BQ3A 4UQDA 4W89A 1ISZA 5CZKA 1CXIA 3IJ9A 1XHGA 2G3NA 1WZKA 1DWJM 3OA5A 4MTVA 3UG3A 1C8QA 3UEQA 1U33A 2XGBA 1I1XA 2YBUA 4NRSA 1TA3A 3WDRA 1US3A 3S6TA 3CZEA 3K1DA 2DEPA 2WVSA 3T0BA 3L4YA 3DYOA 3TOPA 1C3FA 1JFHA 1EO5A 1VBRA 2WHJA 2BVTA 3WNOA 4HA1A 4PYSA 2ZX5A 4M82A 4AMCA 3IANA 1VRXA 2Y8KA 2DGAA 1CGTA 3THCA 5BRQA 3AIUA 4DM1A 3VIHA 1E4IA 3MMDA 1CZ1A 2XFYA 1E73M 4J3VA 1DWAM 1DHKA 3WDIA 4PUEA 3QOMA 5FD0A 4C7GA 1EDQA 2EPKX 3RDKA 2YL5A 2WMIB 1MQPA 1QBAA 1OGGA 2DSWA 3A4AA 1CLVA 2ZOXA 1JG9A 4CCCA 1KXVA 2ZXBA 2BVYA 2EQDA 1E1FA 4PRWA 1GVIA 4DWSC 4UNIA 2ESCA 1MVYA 1MYRA 3LPPA 5A94A 1LL4A 4CU7A 3CUHA 3SEPA 2JF7A 5A8QA 2GJXB 1GQJA 4AZ7A 4UFMA 4OOUA 2C0HA 1AVAA 3N17A 3AS1A 3ZQ9A 2VT0A 2JFEX 2WBGA 2VX4A 3MO4A 1VFOA 1B3WA 1C8XA 4GZIA 5LA2A 4E4PA 2J79A 2YLLA 4MJ4A 3MMWA 2FHCA 1BGAA 3GH7A 5C70A 1XD1A 2GDUA 1W1VA 3KEHA 3A3HA 2J8GA 2VOTA 2QPUA 2VQTA 2YLAA 1HVQA 4MADA 5LA0A 1V0LA 1PEZA 1WPCA 4AWEA 2V5DA 3AIQA 2PWEA 2V5CA 4LGXA 2WSPA 3K8KA 1HN1A 1ZB5A 6CGTA 2Y24A 1W1PA 1UZ1A 4BQ4A 4AIEA 3I3DA 4H7VA 3ZT5A 3I3EA 3MUIA 2WANA 5A2BA 4CD7A 4JL1A 1WZMA 2BFGA 2UY5A 3QHOA 3MUY1 4D6JA 5DO8A 4OBSA 1C92A 5CSYA 3SCPA 3PTMA 3WN6A 2G8ZA 2ZXAA 1U2YA 3OLIA 2ZUWA 5BXTA 1V3LA 5IHRA 3BMVA 1GUVA 2DSUA 1E6XM 3GTNA 4FLQA 4JFVA 4W5ZA 2J7DA 4DWSD 4WIWA 1JI1A 3TTQA 1H1NA 2RGLA 3EMCA 3ZIZA 4W8LA 3WUGA 2ZXQA 5I0DA 2YIHA 2D3NA 3SCRA 1JIBA 2Y5EA 2YA1A 3DHPA 1LWHA 2XHYA 1JZ3A 2XJ7A 2E8ZA 2XVLA 3VGDA 1PX4A 2W67A 3DHUA 1ZJBA 2G3MA 1OINA 3GXMA 2ZIDA 4Q7NA 3W25A 3ZO9A 4MB4A 3VIJA 3RJXA 2IUZA 3MV01 3EDKA 2AMGA 4AD4A 4AZCB 1TUXA 2BHUA 3W38A 3NDZA 1Y7VA 3PZMA 4JFUA 1FOBA 3IJ8A 4E8CA 2WVVB 3WH7A 4P7OA 1H5VA 4E2OA 4TXEA 3F5JA 3IJ7A 1KXTA 3GH4A 4E8DA 3CZLA 5A6BD 2ZX7A 3CHDA 1IZJA 4X0NA 3T09A 2JF6A 2OWCA 2VRQA 3BLKA 4A4AA 2E9BA 4GINA 2XSAA 1KR0A 1NH6A 1UR9A 3VD5A 3QHNA 1CIUA 1R86A 2WSKA 4WSJA 1E4LA 2FHFA 2Z1SA 2CCRA 4WSKA 3DYMA 3NSMA 3WEZA 3AS3A 1KGWA 2DSKA 3LPFA 3GH5A 3VDBA 3EDDA 1NQ6A 1X6NA 4GO9A 1UH3A 3UR8A 1HL9A 2W91A 4MJ2A 1GVYA 1CGWA 3WH5A 3WMBA 1V3JA 3WEOA 3VD9A 4YPJA 3VMNA 4ATDA 3GBEA 3OB8A 2ZUSA 3PZUA 3ARVA 3CUIA 3BAIA 1QW9A 1UHVA 1JL8A 4ACYA 2D1ZA 6A3HA 1CXEA 4KGJA 5AY7A 4K68A 4HMCA 4W88A 2DIJA 3ZSTA 1E6QM 4P8UA 4WK9A 4YHGA 4PMNA 1UR1A 1CYGA 4H8VA 1Q4NX 4HPHA 5KEZA 1TCMA 3PZGA 5D4YA 3WSUA 2JALA 3WF3A 1BHGA 2J62A 4CVUA 1H4PA 2FHBA 1JGIA 3OGRA 3W0KA 1BF2A 1HNYA 1MWOA 3N04A 2F61A 1UWUA 2VCAA 3TA9A 4PMXA 4RE3A 1H3GA 2Q8XA 3KZSA 1BQCA 5KZ6A 1V6WA 1V02A 5A6SA 3W6LA 4IPLA 3AXHA 4TVDA 5E09A 5JIWA 4W85A 4D1IA 3PZQA 2GSJA 3MUAA 4UR9A 5DFAA 1UH2A 2C8NA 1W3LA 2E3ZA 2GK1B 1BG4A 4WKHA 5BROA 2ZX6A 3AZSA 4H2CA 4C7FA 3WNNA 2XVGA 4TTUA 4BCEA 2D3LA 3VNYA 3OG2A 4ZENA 3ZJ7A 3OLDA 4UQBA 5BYWA 2QV4A 2CKRA 5I2UA 2YJQA 2HVMA 2VX5A 5JBDA 1C8YA 1J0ZA 1QI5A 2YL8A 3BSGA 5CJ5A 2CPUA 3OGSA 1V0MA 2E9LA 2VX7A 1KBKA 4AXNA 3VILA 1SFSA 1BSIA 2NW0A 3AYRA 1QHZA 2D0GA 5E0CA 4P8VA 4U33A 2WBKA 1GOOA 4AC1X 4XB3A 1OSEA 1C91A 4CD4A 4TX6A 1RP8A 5CPTA 1XSIA 2WKGA 3BCFA 1R85A 1JF5A 4NF7A 4F79A 5TD4A 1CNVA 3CZKA 8CGTA 4AEEA 1H09A 1HJWA 1GQLA 1YQ2A 2D24A 3VD3A 3SURA 2GJXA 3RM9A 5A6AA 3AQUA 4J28A 2XWDA 1FP9A 3ZSSA 4UOQA 5GNZA 1LF1A 1BYAA 3AFBA 4W8AA 1M7XA 2PWGA 4JHZA 1W1YA 4N0RA 1HX0A 2DT0A 1JNEA 3AIRA 4URIA 1QNOA 1E4MM 5DT7A 1HL8A 1WB0A 1G1YA 2Y4SA 1AQHA 1J0KA 1FA2A 4D1JA 4A3YA 4AIOA 1OB0A 1BYBA 1CXHA 3GZAA 2A3EA 1LJYA 3K4AA 2X0YA 1KXQA 2FDMA 1FFRA 5M3WA 1XCXA 4PMOA 3GBDA 2VZTA 4AZ5A 1E0VA 4GIAA 1LG2A 3G6MA 4HTYA 5IFPA 3CHEA 4CD6A 3AIWA 4GQRA 3B9AA 1O7AA 1UD6A 1VFUA 5ECUA 5CQ1A 1J11A 2OSXA 1E6NA 3ZR6A 5CGMA 3JUGA 2BY2A 1B3VA 2VVSA 1BYCA 3L4WA 1ITCA 4BQ2A 5CLTA 4QLKA 4ZE5A 3N13A 3ZJKA 1NOFA 3WFZA 1Q6DA 5A6BA 5ABEA 1QHPA 2VUYA 2GFTA 1ZS2A 3RJYA 4MNJA 3VMOA 3EBVA 2G4FA 3SUVA 4W7WA 4S3KA 4UQAA 4DUXA 1GHRA 4GPNA 4JFTA 2VRJA 1VJZA 4M29A 4QAWA 2FGLA 2J7BA 1EGZA 4CVWA 1CENA 4R27A 4CGTA 4V28A 3VX0A 1B90A 1E15A 3FY1A 3WF0A 5DT5A 2QMJA 4AIUA 1E9LA 3GNPA 4NSBA 5ABFB 2V38A 3VO0A 1LL6A 1W9PA 2XFRA 4J3XA 4ZEPA 4AZCA 4X0VA 3WDQA 2ZWZA 4J3TA 3CZ8A 1N82A 1EQPA 4U2ZA 2WVVA 4AZBA 4PCTA 1UKSA 1GOQA 2VRKA 1V0KA 2J7CA 2WNWA 1HKIA 2PBOA 5I24A 3MUZ1 1OWQA 2Y2WA 3BCDA 1ZBVA 3PZ9A 1MQRA 1VB9A 3KWXA 4ZXOA 4WJXA 3WH6A 3TTOA 2CXGA 3UESA 2YBTA 4P7LA 1G5AA 3WH8A 3BXWA 4D6CA 1UKQA 2DT2A 2YDQA 5A8NA 5BRPA 3KL5A 4F9JA 4TVUA 3WEMA 3FAXA 4HP5A 1MXGA 5HBFA 4Z2IA 1QW8A 3AZRA 3M6DA 4PMRA 4S3JA 2WCAA 3AYSA 2WPGA 1KGXA 2WC3A 3W82A 1MW2A 4FMVA 4J7RA 3ZR5A 3GYCA 1J0YA 3T2OA 1JNDA 3ZMRA 4CN6A 2XUCA 1I1WA 3UCQA 3BAYA 2JEQA 2WMHA 2CKSA 3BAJA 3CGTA 3RILA 3CMGA 4GXPA 4MDOA 2WMFA 3W6MA 1QNRA 1H49A 1X1NA 1XRVA 3WD1A 3RO8A 3GXDA 5A95A 4XZBA 3W27A 1WAWA 1DWFM 1W91A 4YHEA 3W4RA 1W9UA 3B9EA 3FNDA 3WD4A 5LA1A 2YA2A 3EDJA 1RD6A 3AIBA 3GXIA 1OIMA 3W81A 2YL6A 1EHAA 3N9KA 1VEOA 5C71A 1NP2A 4LYPA 3NSNA 2XPKA 3BLPX 2ZE0A 1KGUA 3II1A 1L8NA 2D0FA 4BZYA 1XSJA 3FAWA 4LQ1A 2GK1A 4B15A 5JUVA 1OT2A 2DH3A 5I79A 4V27A 5BCAA 5IXEA 1KBBA 2BXZA 3AHYA 2BV9A 4CD5A 5AYBA 3SCTA 5FL1A 1XSKA 3AHTA 2VC9A 3GDBA 3WIJA 3ARSA 4HOWA 4ML4A 4HU0A 1A3HA 3T2QA 4OBRA 1A47A 3EMZA 4J3SA 5JIPA 1U30A 3ARYA 4GZJA 4AZIA 1H0GA 4U2YA 4X9YA 3TONA 3VUPA 5JBEA 2VZOA 2VL4A 3T2PA 3TTSA 1FP8A 2DH2A 3KL3A 1CGXA 4PSPA 1UD5A 3SCOA 4U5KA 1G9HA 1GQKA 1B9ZA 4GO8A 1XYFA 1ZL1A 1GOMA 4IISA 2CIPA 2XWEA 4QLJA 5AYIA 2D2OA 4LYRA 4UFIA 2PC8A 2GUYA 5EMYA 2ZUNA 1HJUA 1HKJA 1E6SM 2UWFA 3AZTA 1HF6A 1OIFA 2AOSA 3N1AA 1CTNA 4QCEA 1VEPA 3ARUA 5D8ZA 1WDSA 1XH1A 3CMJA 5A6KA 3DYPA 3RIKA 3M46A 3WQ5A 1WKYA 2WB5A 1HIZA 4WKAA 3PZOA 1G94A 1B31A 4M80A 1JYVA 1PX3A 5E6ZA 1LWJA 4LX4A 1M03A 2VX6A 1GJUA 1CGYA 3WD0A 5AC5A 3F5KA 2DPEA 1BVNP 1J01A 1KXHA 2EPMX 3OBAA 2NSXA 1E70M 4BQ5A 2XIIA 2E8YA 1HT6A 1WDQA 3U57A 3L4XA 2CESA 2W61A 1EOMA 2HISA 2XVKA 2D0HA 4M8UA 3FW6A 5GNXA 2V3DA 4QP0A 1EDTA 4ZFMA 5A69A 4Z2LA 1I75A 1HP5A 3HMCA 1OM0A 1HJXA 4XZWA 3IK2A 2XTKA 1DEDA 1UWIA 4W7VA 4EE9A 1H41A 1LLOA 1J0HA 3CUGA 3QHMA 1V0NA 4NI3A 4PMUA 3K46A 1NWUA 3VOCA 1WZAA 2XVNA 2EPNA 2VCCA 2GDVA 4PTVA 4AD3A 5CSUA 1PBGA 1W32A 5A8MA 2WMKA 2OYMA 5BWFA 4P7RA 1B1YA 2UY4A 4JKKA 2WZIA 3T0DA 2WVTA 2X2YA 2CBUA 2X05A 1BFNA 4PN2A 3W26A 4AZ6A 4GI6A 3CIVA 1EH9A 4MB5A 3N15A 4PMDA 5ABFA 1KCLA 5I77A 1HKMA 4JHOA 3IAPA 1KCKA 4UQ9A 3MU7A 4NZCA 3WNKA 1E0XA 1QI0A 4BA0A 3OZPA 3FXYA 3WY1A 5GNYA 5C8BB 2X0HA 4HZ7A 3NYDA 2EPLX 4U3AA 4PMQA 3WQ4A 2WZHA 3BSHA 2EEXA 4YN5A 5FIPA 4ATWA 1GHSA 3VD7A 1PPIA 3BH4A 2WK2A 5A8OA 3SCUA 1FHLA 3K8MA 1K9FA 1MW0A 1O6IA 2VTFA 5CPQA 3VGFA 4B3KA 1PZ2A 7A3HA 1JYWA 3AMKA 1F4AA 2JEPA 1QPKA 1JFXA 1FH7A 3M7SA 4Q22A 1UWTA 3EMQA 3SCVA 4LPCA 1TA3B 3WNMA 4OUEA 4AYSA 2OYLA 1CEOA 4JL2A 1E6RA 2GJPA 2CHNA 5CXPA 3NJ3A 1M01A 2GVYA 3L4TA 3WD2A 1W2VA 3GXFA 4EKJA 4DUVA 3OZOA 5E0FA 3AMCA 3WL1A 1XGZA 2QLYA 2XYLA 4OJYA 2CHOA 4PTWA 1EXPA 1KFWA 5DEZA 4XX6A 1M04A 2E9MA 5A6LA 2V3FA 3POHA 5FKYA 4M1RA 2D22A 1UA3A 1V6UA 4Z2GA 1JF6A 1CLXA 1PIFA 3IAQA 1B0IA 3MS8A 1FH9A 3NSXA 1DWHM 2CBIA 2PWHA 3B8SA 3GNRA 2BS9A 1OCQA 2XM1A 3RMEA 2A3HA 4OOZA 4MAZA 1UQYA 3UERA 5EBAA 1W2PA 5CPSA 2J25A 1W1TA 2WVUA 3MKKA 2WMIA 3ZM8A 2E0PA 1AQMA 1UWRA 5I78A 2O9RA 1EHNA 1W9DM 5DMYA 3VIPA 5A8PA 1V6XA 2VR4A 4ACZB 2WLZA 3WQVA 3B9DA 1HXJA 1BYDA 3RM8A 3CUJA 1V3MA 3HJEA 4D6DA 4F8XA 3NIYA 2BHZA 4D6HA 1S46A 4BS0A 2WW5A 2FGZA 3LPOA 4UCFA 2ZUMA 1SYTA 2YDSA 3PTKA 2OSYA 1NOUA 1SMDA 2PBGA 4GZEA 4MAVA 4UFHA 4KMQA 4MNMA 3W24A 4JCMA 4CKQA 2TAAA 1R7AA 2DQXA 3D3AA 3O6AA 1JYNA 2WM0A 4B9ZA 3ARRA 1HKKA 2WHMA 4AISA 2CBVA 1EDGA 1VEMA 4PMYA 4W7UA 1CGVA 4D71A 3O2LA 1W3KA 2QPSA 3VVGA 5CG0A 1BTCA 1GJWA 4UQEA 3VDHA 5M03A 4EANA 3VINA 3AISA 3UETA 1ODUA 4HA4A 1MFUA 3BAXA 3AI0A 3A4XA 1VF8A 2O9TA 4JKLA 3NCOA 2BY0A 1ISYA 3WKZA 3AS0A 2E40A 3ARXA 3UG4A 3VGBA 1KWGA 3WBEA 3MMUA 3NDYA 3RCNA 2X09A 3BMWA 3VD4A 2YKKA 5LYRA 3PZIA 4W87A 4UZSA 2W62A 1WNOA 2EXOA 3MANA 2W92A 1SMAA 2JIWA 2IXUA 3L2MA 2WWCA 4D6GA 1QOXA 4HPGA 1TVPA 2DSVA 3SCNA 4H8HA 2CETA 1E55A 3G6LA 1UR4A 2BY3A 1E5NA 1W3HA 3W53A 1MXDA 4UQCA 3M07A 1JYXA 1UD8A 1WO2A 2PB1A 1OD0A 3SUUA 2J7EA 1WP6A 4Z2KA 1TE1A 3SUTA 1TMQA 1LL7A 1JZ8A 3WELA 2V3EA 4KH2A 1QHOA 4AZGA 2QMKA 5A1AA 1JZ6A 1V6VA 3FHAA 1ZU8A 2JE8A 5FL0A 1DTUA 1W9XA 4P8XA 3OLEA 2VZUA 3N11A 4L4PA 4HOZA 2OWXA 1PJ9A 4A3HA 4JKMA 4GKLA 3ZT6A 4J3UA 5HOSA 2B31A 1C7SA 1B3YA 5IHSA 1UKOA 1CXLA 5HNNA 4IM4A 3UG5A 4JZ5A 3VM5A 1ESWA 3ARWA 3QOKA 4HMEA 5DF0A 2E4TA 3CHFA 1UD3A 1Z32X 3WD3A 3AHZA 3E1F1 5I3DA 2ZX9A 3AXXA 3OLGA 2YL9A 1QNQA 4CU8A 2YOCA 1UKTA 5A2CA 1GOIA 3F5LA 4P7NA 1E5JA 2PI6A 5HDRA 3WDJA 2J7HA 1E3ZA 5CGTA 1W9VA 4AW7A 1V03A 2J77A 3N12A 2BHYA 3WF4A 1J0JA 4HZ6A 4KWUA 4WF7A 2WCSA 1KQYA 1UYQA 5F7UA 2J4GA 4MPKA 2EO7A 4W93A 5ABGA 1JAEA 3AHVA 2WWDA 4LXFA 1H2JA 1ITXA 2OWWA 2ZX8A 3WF1A 3WQWA 1GCYA 4QLLA 3CBWA 3W37A 1CXKA 3AROA 1BAGA 4P7QA 3EYPA 1EO7A 4PSRA 2AAAA 1F4HA 5HPCA 3KL0A 2W63A 5IDIA 2XM2A 4GI8A 5IFTA 2VCBA 3VDAA 4Z2JA 4AD5A 1H0IA 4B3LA 2FH6A 1JI2A 4AD1A 5E9AA 1G0CA 4BF7A 4TOQA 9CGTA 3MSDA 4CN4A 1J18A 3WNPA 1JAKA 4NRRA 1E43A 4PBGA 1D2KA 1Q6GA 1TFVA 2DT1A 3VMPA 3N18A 3RPMA 4FK9A 1GZJA 2CYGA 1XV8A 4F9DA 3A6OA 3WDHA 1G01A 3WUEA 2A3AA 1UD4A 3QGVA 1RP9A 5E70A 4CCEA 3CO4A 1EIBA 4WLCA 1NOWA 1W3JA 1TG7A 2VO5A 1J12A 1NP0A 3ARQA 2YDRA 2Z1KA 2XG9A 3WMSA 1XCWA 1XYZA 3ARTA 2A3CA 3CLWA 3W28A 5A6JA 2WXDM 1XH0A 1CPUA 1PX8A 4QCFA 3VTRA 4ACZA 4AD0A 1H11A 2WMGA 5BXRA 3DC0A 3WH9A 1V02E 4DWSB 4HU8A 4RE4A 1GQIA 1ODZA 1ZBKA 3HU7A 4Y7EA 1HJQA 3VM7A 4QDMA 2VI0A 1OGSA 2WLYA 3WDPP 3L2LA 5HXMA 3DECA 1HJSA 2VVNA 2XGIA 3EDEA 3VPLA 3PTQA 1JDCA 2QF8A 3VIGA 4UZUA 1OT1A 3CZGA 1V3HA 1QNSA 1SR0A 5I6SA 1TZ7A 1CXFA 2EBNA 4KGLA 1E40A 1ISWA 3UR7A 1UG6A 1Q6FA 2QHAA 3W29A 1R7OA 4MNKA 3S2CA 1MW1A 1E6ZA 1WDRA 1UKPA 1R8LA 1LG1A 3O9NA 1VFFA 2UY3A 1TR1A 1VBUA 1XH2A 5BXPA 2OYKA 1K9DA 2J7GA 1QI3A 1D3CA 2D20A 4UFKA 1VFMA 1WE5A 4W5UA 2G3IA 4FF5A 1V6YA 3A4WA 5JBFA 2CNCA 3AHXA 4IUGA 1CBGA 2DDXA 3U5UA 3WFLA 1PZ3A 4KRTA 3AIVA 5HPOA 1CDGA 3AMDA 3WBAA 1FHDA 1ZBWA 1EA9C 5GQBA 4EAMA 5ABHA 4ATLA 1OD8A 1JZ4A 3AJ7A 1C90A 4U3CA 1J0IA 1QBBA 2CEQA 3SCQA 4OZOA 3VKKA
chains in the Genus database with same CATH superfamily
3ALFA 1BSLA 2EKGA 1POKA 1GT8A 3L9CA 3LGDA 3THDA 4HT3A 2QIIA 4JAWA 2QR6A 4NQ1A 4GD0A 4AD2A 3C3UA 4UBPC 4PTNA 3SAZA 3NA8A 2ZRVA 3OYZA 3FYYA 3AICA 4DI9A 2J74A 2V6AA 3WUBA 1ICPA 1GVRA 2QCFA 2BVDA 5AHEA 2G3JA 4Q8TA 1FWFC 3T08A 3S47A 3E3HA 4LBSA 1HKVA 1GW9A 3BOFA 3CIWA 3WLTA 1Q2RA 1JDAA 2CLEA 1E9IA 1XDJA 4PTXA 8A3HA 1IXPA 4XZMX 4FLSA 4AWSA 1QI2A 4ZB2A 2ISSA 3AWNA 4ZSUA 3SW6A 3QMSA 1UA7A 3VA8A 3SCSA 4U31A 3HPZA 2QGYA 2E77A 4B4HA 1DWIM 1KD0A 2Y61A 3COTA 3EWDA 3PTDA 3UWWA 1B2YA 5AC8A 3W9ZA 1WCGA 1UOKA 3GX9A 1VLIA 4Z2HA 1RPKA 1CGUA 2V5JA 4GQBA 3TXZA 1JD7A 2AL1A 3DFYA 4WKFA 2HVNA 1Q6EA 1PKMA 2P0OA 2V9DA 2V67A 4TV5A 3URNA 4QJ4B 6TAAA 2A5HA 4F0RA 3PVFA 4ZXLA 4FXRA 1C93A 4O17A 3UD6A 4RPQA 3S5OA 4D6EA 3CV6A 2DT3A 4XWUA 3RMJA 2PDLA 3LA4A 3LRMA 1RA5A 4DM2A 8TIMA 1OQFA 3SRFA 2NWSA 4G7EB 1BGGA 4DLMA 1Z69A 3TUUA 2PTYA 3QYSA 1A5OC 4W8BA 1Q45A 2PGRA 1YIXA 4R34A 3WQ8A 1N8FA 2HV5A 2VZSA 4DXXA 1KCZA 2OSWA 1TV3A 2O9PA 2H9AA 3K8LA 1RJPA 1OX4B 3VIIA 1BG9A 1VBHA 3GLCA 8RUCA 1J9YA 1MUCA 2Z1XA 3S2NA 2D23A 3CHCA 4BFAA 2NV2A 3U7BA 1JZ2A 1VIWA 4ZZ9A 3PZVA 2HPIA 3TEVA 3ARPA 1JEZA 3DOPA 4RDWA 5A3HA 1TE6A 5GPRA 4UOZA 3A9BA 4LYQA 3L4ZA 4KWWA 3ZT7A 5LIWX 2RDXA 2XZ7A 1DIOA 2G50A 3RCMA 4JTLA 1QVBA 3EOUA 2BNJA 4AHQA 1XLEA 4L6HA 4D6FA 5E6YA 2KZHA 1OGBA 1L6SA 3N4EA 3QW3A 4PTMA 1W31A 5MKGB 3E5BA 2A6LA 4N9DA 4KF1A 1LRNA 4KW2A 1UUQA 1QAPA 3VDCA 2SFPA 3WUFA 3SCWA 2FPYA 3K4DA 1I2RA 3LS9A 4KRUA 1NARA 3VIMA 2QF7A 3QGKC 1EJUC 4ZB5A 1X6LA 5D2XA 4L65A 3N14A 3B06A 1HVXA 4QGCA 1KLYA 1WZLA 2WMJA 2F8QA 4GQQA 4QTGA 1YTKA 1AQ0A 1KWKA 3DFHA 5A2AA 1O95A 4ZB0A 4FNTA 1FH8A 1NY1A 2CERA 3L4VA 3ZJ6A 3TYCA 2XSXA 3N2XA 4E2BA 3S1UA 3A64A 3FEMA 2FZMA 1SZGA 3AOFA 5D9NA 4OWGA 3PJUA 4ML9A 3W2UA 5D05A 3G3DA 1Q7MA 3VGEA 2OU4A 4E38A 4XD6A 3LEPA 3R0UA 4US6A 2VGFA 4HHMA 3AS2A 1MW3A 5D9PA 3J7HA 4JTIA 1UH4A 2VXNA 3FVMA 3IK4A 3N34A 4M56A 3W7NA 4FSAA 4JX5A 1G69A 3Q65A 1ZFJA 4LFYA 3OODA 3VOGA 2IXVA 2OLHA 3BURA 3GDTA 1K9TA 1DJNA 3BG9A 4KCUA 5I5RA 1IGWA 2HROA 4Y6GA 4C91A 3H70A 4UQDA 4W89A 4IUOA 4FXSA 2P0IA 3OU8A 4AXKA 4UTWC 2G3NA 3BJTA 3GW3A 1TV8A 2AGTA 9XIAA 2YBUA 3W2NA 4S39A 5FJOA 2BGQA 3CZEA 3T0BA 4FS9A 4FP1A 2PC4A 3DYOA 1C3FA 1EO5A 2BVTA 2QUMA 4HA1A 2Y5JA 3WJWA 2NLYA 1VFHA 4PYSA 3PWAA 1NFGA 3IANA 1L6YA 5ENLA 2PFHA 5T9BG 3NEVA 4AC7C 5BRQA 3U2OA 3RX3A 4NP7A 5D2TA 1E4IA 1CCWB 3A22A 3LXBA 2XFYA 1REQA 1DHKA 3ERPA 4D8LA 4ZBCA 1EDQA 1YTEA 3RDKA 2TMDA 2WMIB 4KT2A 1P1MA 3HG5A 3MQTA 3GVGA 3FSUA 3ZS4A 4L9XA 4UNIA 1RVGA 1DQWA 5D09A 1V4YA 1MYRA 2OMAA 5C55A 4QJ3B 4CU7A 3CT7A 3CUHA 3S5YA 3SEPA 3A21A 4AZ7A 4OOUA 3O0KA 3P61A 1XBVA 3F03K 1QWKA 2WBGA 1SVDA 3EX6A 3V5FA 2O4QA 3TXVA 3MMWA 1TWDA 3TSMA 4PRTA 4AIBA 3R7MA 4GK8A 2NVDA 4XAYA 4GY1A 3KEHA 2J8GA 1UPMB 2NZLA 1HVQA 5LA0A 1WPCA 4AWEA 2QCMA 2Z6IA 1JCMP 3UGRA 2ZDSA 3IJQA 6CGTA 1W1PA 4GNKB 4IX2A 4BQ4A 3LI1A 4I5UA 4H7VA 3KRZA 5BU6A 1XP3A 1XDMA 5AHMA 2BFGA 1XLBA 1UJPA 3W73A 4GCAA 3LTPA 4Z17A 3OVPA 5DO8A 1DJYA 2C0AA 1I2QA 3GE7A 1U2YA 3C2VA 4F4RA 4A8LA 2QUNA 1E6XM 4W5ZA 3TYDA 2J7DA 3BLFA 1W17A 2RGLA 1D9EA 2OJPA 3NGFA 4JXCA 2YA1A 3DHPA 3WQCA 1ZTVA 4AAJA 4IQDA 2XJ7A 3M5VA 2W67A 1J2BA 4DUOA 1QK2A 3M0VA 5F1UA 1H63A 4LEFA 2BDQA 4Q7NA 1PVNA 3W25A 2DZWA 2PWUA 4MB4A 4LAOA 1RJRA 3RYSA 3MV01 4KEUA 3NQFA 3I65A 2AMGA 3CAWA 4AZCB 1TUXA 1JUKA 2OTDA 3W38A 3TKFA 3UY7A 3EA1A 2WNQA 4E8CA 3TLQA 3NR0A 3GH4A 1R30A 5LZLA 2ZX7A 4TU1A 2OWCA 5CC3A 1FWEC 3E0VA 3M0XA 3RPDA 1R86A 4ZL1A 1J79A 2FHFA 1E0TA 3DYMA 3NSMA 2BOGX 3WEZA 4GVHA 2A3LA 3ZWTA 2DSKA 4F0MA 2VUNA 3MJMA 1X6NA 3KFTA 5FSDC 2W91A 1GVYA 1A5UA 1R3VA 3WEOA 3VD9A 4YPJA 3T42A 3GBEA 4XBKA 2ZUSA 5DMNA 1THFD 3BAIA 3HFYA 4ONVA 2WJFA 4JY9A 6A3HA 1P7TA 3CYVA 4C6FA 3Q2DA 3JZUA 4KGJA 4K68A 1SM9A 2DIJA 4YU1A 1UR1A 4PUJA 1V8EA 4O1EA 1ELSA 2JALA 4CVUA 2FHBA 3OGRA 3W0KA 4MM1A 1BF2A 1HNYA 2ZZ1A 1WBJA 2FVKA 2E5BA 2VCAA 4LC8A 1QWGA 1LUCB 4J9JA 1T8QA 3GTIA 2VWTA 2OLAA 3LYEA 3K13A 1V02A 1R3RA 1TJRA 3AXHA 3KBVA 5JIWA 1D3GA 3PZQA 2GSJA 4JQ2A 1KBJA 3S6OA 1B57A 1OVDA 2E3ZA 4K1WA 3B0VC 3OG3A 3AZSA 4F0HA 4WDTA 1MEWA 3HGOA 4TTUA 3C86A 1UPPA 1GQNA 1UZDA 4ZODA 2D3LA 1YBQB 3MCMA 3EEGA 1OF6A 3DDMA 3ZJ7A 3FVDA 5BYWA 3O63A 4LAZA 2HVMA 2VX5A 5JBDA 3CL8A 1YX1A 1F73A 3OGSA 1TMHA 1Q4WA 2YYUA 2E9LA 1KBKA 5AVNA 4AXNA 4BI7A 4H9VA 1EZ2A 4O15A 3HG4A 4Q7BA 3MMTA 4JQ4A 3DU0A 5E0CA 4HHLA 1AG1O 3DERA 4U33A 1DL3A 3CWNA 3W76A 2Y89A 1OSEA 2IKGA 1RP8A 2VP8A 3FLUA 3BCFA 1R85A 3IGUA 4JIPA 1FDJA 3IRSA 3CZKA 1EJXC 4AEEA 1HJWA 1LQAA 1GQLA 3W83A 4ZO6A 2V69A 1ZJHA 1FP9A 5HUOA 4NNAA 1DVJA 2QCDA 1XYBA 2IW0A 2PU1A 3AIRA 1E4MM 3B0XA 1HL8A 4A2RA 1FBAA 3ITGA 2Z26A 2P76A 2FTYA 2J27A 1BYBA 1OG6A 5AB3A 1OFPA 2X0YA 3CQKA 3K4AA 1KXQA 4REQB 4PMOA 2VZTA 4K37A 3RO6A 4AZ5A 1E0VA 1F05A 2PDHA 4CD6A 3NEHA 2IKJA 1O7AA 7REQB 5CQ1A 4M7SA 5CGMA 1B3VA 3AU2A 1RXOB 4QE4A 1ITCA 4QLKA 2C18A 4ZQPA 3WFZA 5ABEA 1QHPA 2VUYA 1WOAA 4L6OA 1LOQA 1W8GA 1XR2A 4S3KA 1A0DA 2FVLA 4UQAA 4B5TA 1GHRA 4GPNA 2VRJA 1S5VA 2J7BA 3MVIA 4CVWA 4AWTA 1CENA 3WQGA 3VX0A 5TQLA 4GXMA 4MPQA 3FY1A 3QFEA 3FEQA 2QMJA 4WVXA 2R82A 3PBYA 4K8EA 3RUBL 5DCEA 4AF0B 4L7ZA 1VHCA 3IGSA 3VO0A 5KITA 3P0XA 3LHUA 1XLCA 1SUXA 3OHMB 2ZWZA 1NELA 3SM0A 3HO8A 4LV4A 1GOQA 2VRKA 2OO6A 3VNLA 1RVKA 1OWQA 1J8VA 4RDVA 1K77A 1ZBVA 1DE6A 1F76A 3KWXA 4P2VA 2XH0A 5DX7A 4QDPA 3TTOA 4Q8MA 1ALDA 3U2ZA 3BXWA 1UIPA 3EB3A 2DT2A 3VCCA 5A8NA 5BRPA 4JIIX 4RPPA 4S23A 3T9PA 4F9JA 3QPYA 4Q8VA 2QAFA 4NX5A 2NV1A 1MXGA 4QS6A 3FA3A 4NXSA 4AHPA 1K1DA 3DN5A 3DC8A 4LWWA 3FCPA 4A21A 2JK2A 4E3TA 4QQ3A 3SJ3A 2Z0IA 4NYYA 3VOJA 5K3VA 3RILA 4GXPA 1X96A 4MDOA 1AMKA 2F9RA 4KWOA 1S38A 4HKPA 1SW7A 4OUIA 3XINA 4JNYA 3RO8A 4KWVA 1WAWA 1KTCA 3WD4A 1W5PA 2QEZA 2JGQA 4IJRA 1L6GA 3W81A 2YL6A 4H2HA 1XIDA 2UV8G 5LNUA 1IR2A 1EP1A 3P84A 1VR6A 3M41A 1NP2A 4LYPA 3B8VA 1EJVC 1XYLA 2Z27A 5AHFA 4GUGA 2FGBA 1XIEA 4MWAE 4IGSA 1XSJA 4Q4QA 3RRXA 1BEUA 4B15A 5JUVA 3DEQA 3ANUA 3V3WA 2BXZA 4GIRA 3P8JA 4C90A 4M3PA 2BV9A 4CD5A 3LERA 1AJZA 4QSFA 1XG4A 1GVOA 2VC9A 1OC5A 3GDBA 3WIJA 4DF1A 3NQ2A 3P74A 5JIPA 3UJ2A 1TPB1 3VUPA 5JBEA 4HCLA 3BW3A 1H7XA 3TTSA 2GQAA 2DH2A 3FDKA 3BARA 4AMAA 1CGXA 4BWLA 4O0QA 3V0UA 1KBLA 4PSPA 2VC5A 3SCOA 4FF7A 2VEIA 1B9ZA 1OX4A 4DQWA 3F2BA 3G0UA 3T81A 2FFIA 5H8UA 4HIBA 2R94A 3CH0A 1FCVA 4QLJA 4JOMA 2QPXA 5EYWA 2OXNA 4C60A 5EMYA 2OZ8A 4PUKA 2XDFA 4I8DA 3KBNA 1Z44A 3D6NA 3PNZA 3R43A 1HKJA 1E6SM 1TPC1 3N1AA 3QY8A 3ARUA 1WDSA 3EOEA 3G1YA 1LTDA 3EEZA 5A6KA 1S2VA 1O5XA 1NDYA 1S2TA 2QJMA 4LS2A 3M46A 3NQ7A 3W74A 5AECA 3KHJA 4B5WA 4UTLA 4YYFA 4LYKA 1AD4A 1JYVA 3NOYA 4LX4A 4LSBA 3M5XA 1G7UA 5AC5A 1K8XA 2VFHA 4LVBA 3N2CA 1J01A 1V79A 1IWPA 3GWQA 5E1QA 1R3TA 4PUNA 2NSXA 4H9XA 2E8YA 2DFAA 1WDQA 3L4XA 2PSNA 2CESA 2W61A 2Y1HA 4BK9A 3N2BA 2IKHA 1XX1A 3GXNA 3PSWA 2V3DA 3W1MA 3NQMA 1XLMA 1VYPX 5EMMA 3B4UA 1FHVA 3L65A 3W7DA 3CU2A 5KZDA 3W01A 4C5YA 4XZWA 1VS1A 1UWIA 4NNBA 4NI3A 1KM3A 4OFCA 1WZAA 2P88A 2CWNA 4PTVA 4AD3A 5CSUA 1IEVA 1OFEA 1EGVA 3BLIA 1VPXA 1Z48A 3WJSA 3R79A 3LZ3A 4F2BA 1O68A 4JKKA 4MYAA 2X05A 4LUTB 1BFNA 1Q66A 4ZQCA 2YX0A 1EH9A 4MB5A 3N15A 2QCLA 5FAJA 5DRCA 5HR7A 5E0KA 3BZGA 3AWOA 1E0XA 1NFPA 4BA0A 3FXYA 5C8BB 2V81A 3NYDA 2EPLX 3PB2A 3AUOA 3MYPA 1K3UA 3FX4A 1I0BA 3GY1A 4DZHA 4CQDA 1GHSA 3VD7A 1PPIA 2V63A 1ZZMA 3BH4A 1SSDA 2WK2A 3MC5A 4LVDA 5D33A 3UWQA 3IJ6A 1MW0A 4DZAA 2JKPA 3NZQA 3LM7A 4HNNA 3DAQA 5G2HA 7A3HA 5JU6A 3R5EA 4Q22A 3SCVA 3R8RA 1GEHA 5H8PA 2V2CA 4GJIA 4F40A 1HW6A 1TA3B 3WLHA 2IPWA 2C13A 5E9XA 2JKEA 3FIGA 3CAVA 1EYWA 1TX2A 5E0FA 1ITQA 1YEYA 1WX0A 3WL1A 1GK8A 2E5CA 5C5YA 4PTWA 1E9ZB 2V8ZA 4I3GA 2DJLA 5XIMA 1XQLA 2PA6A 3UF9A 2CLHA 2V3FA 4XZ9A 3TE9A 1PCWA 1UA3A 1R3WA 1H5YA 4AVFA 1JF6A 1CLXA 1IXNA 1PIFA 1B0IA 3MS8A 4UTHA 2DVXA 3UW6A 1FH9A 1QXLA 1DWHM 4MYXA 3B8SA 3A4JA 3GNRA 2XU2A 1OCQA 1GYMA 4OOZA 1VCGA 3UERA 5EBAA 5CPSA 1JCXA 3QMRA 3MKKA 2WMIA 1FWIC 3UR2A 3ZM8A 1AQMA 1SGJA 5CSSA 3GTXA 4JNZA 4Z0JA 1K7XA 5A8PA 3LBCA 1OCNA 3ONCA 3QMTA 3WQVA 1R6WA 2DZUA 4NVTA 3CUJA 4PH6A 3HJEA 5HMSA 5LNVA 3G2GA 2NVAA 3NIYA 5G5IA 2Z28A 2HCVA 3GC2A 4ILSA 3B4YA 3UWVA 1JQXA 1SYTA 1G4PA 2YDSA 3O3RA 1Q7QA 4KRZA 1NOUA 4MAVA 1VGAA 3H2MA 2Y6ZA 4RUBA 4KMQA 4KBXA 3BO9A 2BG5A 4DO4A 1ADOA 2TAAA 3TIMA 2YXXA 2DQXA 4EOUA 2YDAA 3RLUA 3W7CA 5CPNA 1DJGA 3OBEA 5HINA 3MSYA 3ARRA 1G4EA 3G5EA 2UBPC 2W3ZA 2QS8A 4PZVA 2G0WA 3STPA 2HBXA 2CBVA 3GK0A 3MP3A 1V7AA 4HZMA 2PF8A 4D71A 5CZ0A 4ZGYA 3BJFA 1CX9A 3S1VA 4H4IA 5M03A 4B92A 4MUPA 3QLLA 5CPLA 1ODUA 1I8JA 2ZZ2A 5CPOA 1SJCA 4O52A 5CC7A 1XLGA 1SFJA 2BY0A 1V6TA 1RLDA 2BWGA 3ARXA 3VZXA 1WKFA 2YKKA 3PZIA 4W87A 3N2TA 4UZSA 3R4IA 4KQNA 2W62A 1XM3A 1QPQA 3UJRA 3WCZA 2EXOA 2I9EA 3EGJA 1E0UA 2IXUA 2JIWA 3SI9A 3L2MA 3M9YA 4GYPA 3ZLFA 1E55A 3LD5A 3QKEA 1X7FA 5DMMA 3LQGA 1WO2A 4I6VA 1Q3NA 3V7PA 3PY2A 4Z2KA 1YKWA 4Q32A 2GDQA 4RCXA 4DEFA 4KH2A 4EWJA 1P1XA 3UA3A 1TJ2A 5A1AA 5D37A 1V6VA 4J40A 4PBEA 3KUMA 3EOOA 1DTUA 1W9XA 4P8XA 3OLEA 2VZUA 3V36A 4L4PA 3G18A 3R2GA 1U1UA 1PJ9A 1EL3A 4GKLA 3WBWA 1PUDA 3ZT6A 4J3UA 2A85A 3PJTA 2B31A 2WQDA 1SW0A 4DF2A 3WBYA 5LNSA 3ARWA 3QOKA 3SQMA 4HMEA 5DF0A 1RLCL 1VLWA 1Z32X 3UXLA 1TWIA 3AHZA 3G0XA 1FWGC 4JBRA 2GWGA 2ZA3A 1PTAA 4WX2A 1Q6RA 2IPFA 1XICA 2LLEA 1M7PA 1UKTA 1AW1A 2XINA 5A2CA 1GOIA 3PUOA 3F5LA 1E5JA 2RFGA 2PI6A 3TYEA 3PNUA 1JQVA 4RNIA 3WF4A 2BHYA 5J5RA 1UYQA 5F7UA 1NF7A 4YVXA 3U9IA 4W93A 1XW8A 3MWAA 3VFCA 4I9AA 1Q8AA 4ZR8A 2QIWA 4FNUA 4LXFA 3U2EA 2F6UA 3P81A 1AJ2A 1EC9A 3THQA 3W7PA 3CBWA 4ZQNA 3C2FA 1EO7A 1LBMA 4PSRA 2NQLA 3S1XA 1BXBA 3GD6A 1RBLA 2NX9A 2XM2A 4IQLA 3K2GA 4MIMA 4KCWA 4K7YA 5IFTA 2CWXA 2VCBA 5BOOA 3IJIA 4Z2JA 3M0LA 1KFKA 1A5NC 4RZ4A 5E9AA 4LAUA 4IJCA 4TOQA 3W7OA 4C1KA 9CGTA 1WDWA 1HFBA 1JAKA 2I16A 4XZHA 1TFVA 5HNUA 4WOQA 4QBXA 3M6YA 4MOZA 1W8SA 4NZ5A 3N18A 3P8IA 3PJWA 3VNJA 3IUIA 4JTSA 4LVFA 3F4DA 3JS3A 4H83A 5DBTA 4QROA 3G1DA 3TJIA 3W1LA 3CO4A 4CCEA 2ZC8A 3ITXA 3RR4A 1J6PA 2VO5A 2PZ0A 1JRBA 3BWWA 3ARQA 4DYKA 2YDRA 4K1GA 1F74A 4U28A 4QE5A 1PKNA 3ABZA 3W28A 4IIHA 4B91A 1XH0A 4HCHA 2IPJA 2A79A 1OG0A 6REQA 4AD0A 1H11A 2WMGA 3DC0A 3IARA 4DWSB 4RE4A 1NQKA 1TTIA 2AMXA 3KTSA 1HJQA 3TN6A 3H4WA 3Q94A 3H2CA 3GHUA 1VPYA 1XC4A 4TQTA 2AL2A 1AFSA 5I3KA 2Q8ZA 2VVNA 2XGIA 3VPLA 4GVFA 3VIGA 2OX1A 1OT1A 3QSTA 4I5XA 1SR0A 2AAMA 2B7QA 1G4TA 1CXFA 1T0OA 1Z3NA 1E40A 3LRKA 1KM1A 2VD8A 4IFKB 5AFDA 2I5GA 1Q6FA 3W29A 1DBTA 5I07A 1A5LC 5HAOA 1I45A 3UJEA 2V2HA 2XH7A 3U4AA 4HN4A 5G4EA 2UY3A 4UB9A 5BXPA 3OA3A 1OFQA 1Q8JA 1WE5A 2BOFX 1A5CA 1V6YA 2CNCA 1Y5XA 4N9EA 3M5YA 4YWIA 4GIEA 2BX7A 1KFLA 2DDXA 4KRTA 2Z29A 1IWAA 1PZ1A 4FA3A 3LOTA 3AMDA 1FHDA 1ZBWA 2J13A 2HS8A 4Y96A 3RF9A 1X1OA 1XXXA 1OD8A 1AW5A 4U3CA 1J0IA 1QBBA 2QCNA 3VKKA 4YXGA 4AY8A 3FJ4A 5D03A 4UTIA 3OZMA 2VEPA 4L4LA 4PUUA 3A3WA 1YADA 3UPWA 4FNSA 1OADA 3IV3A 4C7DA 4LVGA 1LRTA 5TF0A 1D8CA 1W9BM 3BGAA 1J10A 2J8FA 2Q8LA 2O92A 1R2RA 3VX1A 1YNPA 2HBVA 1OEPA 1E71M 4HNUA 5G2WA 5K9CA 3TAKA 5FCZA 3RLGA 4UWMA 2PWDA 4MWAA 4D6IA 1XYMA 1HP4A 2HMCA 1JCYA 3GNXA 4X2PA 3THAA 2DV0A 4IG2A 5AYZA 2GGIA 4OKDA 3YPIA 4X63A 5H8MA 3KAOA 4AVOA 3P6LA 1EQCA 3IVUA 3LPGA 4M6VA 1VAHA 5EBUA 4PUDA 2RUSA 1C9DA 2WZEA 3EKZA 3OGVA 4TTGA 4OE7A 3OZYA 3UXDA 1GNXA 4IPNB 3TP4A 2ZUVA 4FLRA 1F3WA 5J5DA 3VU2A 4Q3MA 1DWGM 1HKWA 2QCEA 1IT0A 3DG3A 2REQA 1N2VA 1QI4A 4JFWA 4B5XA 5CPMA 2QDDA 1LQ2A 1QPNA 1SU5A 5CJNA 5XIAA 3ABRA 3KE0A 4DJFC 3NOEA 1GW1A 4J27A 1JPHA 4OVXA 2OKTA 4V2XA 4Q8UA 4TX8A 1K6AA 3PHAA 4J3WA 3LBMA 4V1YA 3P0WA 5JH1A 2YB4A 4H8UA 1RALA 1Q6CA 4UTFA 2GGHA 3PBWA 3D5HA 3CO8A 4MLJA 1IV8A 1VJSA 4NAFA 3L23A 3LCHA 4AB4A 3MBFA 3OPSA 4H6KA 4KCVA 2FH8A 4JX6A 1A53A 1JCJA 3SADA 2QVNA 5A6MA 3H2FA 3TC6A 4PCFA 2DVUA 1SO4A 1CT5A 4JIEA 2DZTA 2WC4A 4W86A 4D72A 3KHDA 1UQZA 4XZNX 1DJHA 2DIKA 2DIEA 4JDBA 3LRLA 3UGVA 3VGGA 3TJ4A 1PAMA 4DO7A 1EX1A 5AN7A 4DBSA 3HM7A 3LK6A 1UP0A 3TZFA 1KM4A 4DJFD 3GG0A 1EP2A 3BUVA 4MDPA 4H04A 3BAKA 3M0IA 3WLIA 1KM5A 3FGCA 4ENLA 3GR4A 1OK6A 3CH9A 4Q4PA 4R9XA 3STGA 2QUVA 4S3DA 2AQOA 2YR1A 4CD8A 4R9OA 2WHLA 1O1HA 5C54A 3QH2A 1BVZA 3W1PA 3HV9A 1GONA 1T6MA 3BAWA 3UZYA 1SFTA 4P61A 4DJDD 2XSBA 1M53A 1VYSX 4IGMA 2HZGA 3SR7A 2X41A 1CECA 4ALDA 1XISA 4US5D 4HCDA 3ZJ8A 1R9ZA 3SN4A 1W1IE 5KINA 1UR0A 4M5PA 4LF1A 1V3IA 4M24A 2J66A 1I9CB 5CBIA 4FX6M 1OF8A 2DORA 1EF3A 2ZTJA 1V7YA 2A3BA 1TVLA 2ZUTA 1E56A 3R10A 4MJZA 5FOOA 3D47A 2PF0A 3PAOA 3I3BA 1B4KA 3SFKA 1UBPC 3UXKA 2HDJA 1LT8A 4U10A 2VEMA 1GOKA 2J7FA 1XIHA 1TTQA 2JIEA 4RNHA 1PZ0A 2OGJA 1KKOA 3W7KA 3GM8A 4QISA 4QNWA 4JTTA 3CEUA 3ZOAA 4Q8OA 4ROQA 2R1MA 3RXZA 3SUWA 3GYEA 3RITA 4Q4RA 4Z1CA 3CUFA 3QR3A 3W1RA 1O94A 2C1GA 3VOFA 5I02A 5EFFA 2QUTA 2P5NA 3TNBA 1ZJAA 2YFOA 4FR6A 4F48A 2VQUA 4JYFA 2CLFA 2ZRZA 3O6CA 2F6XA 2Z4GA 4O1AA 2WCGA 2CW6A 3KOYA 2ZBTA 4GHRA 1GG1A 1X97A 3GUGA 2VHLA 4OIFA 3MTWA 4H01A 1E6PA 4Q4KA 1HJVA 2C7FA 1KCXA 4RJEA 2OOFA 1K7FA 1XPYA 4PODA 3MA8A 4BQ3A 5FESA 5CZKA 1CXIA 4M6UA 1IEWA 3IJ9A 2ZC1A 1XHGA 1FXQA 4PCPA 2QV5A 1C8QA 3NQCA 5C6MA 4YCPA 1XDLA 3VKCA 1I1XA 3W1XA 3HIJA 3CQ0A 3Q58A 1TA3A 5A5WA 1US3A 3S6TA 2DEPA 2WVSA 1FWSA 4RNJA 4FX8A 1I4NA 1XBXA 4O11A 4XAGA 1WOBA 3L4YA 3TOPA 2E1WA 4H00A 3V0SA 4LB3A 4RZ5A 3E0WA 2CXEA 2QJIA 4M82A 4AMCA 2Y8KA 1EB3A 2VENA 3UQNA 1CGTA 4HTBA 2YCEA 2FTPA 4NT0A 2DP3A 5EMKA 3OJGA 3WQOA 1TQXA 4J3VA 3WDIA 2Q3RA 4PUEA 4C7GA 3KVLA 2PDXA 1QBAA 3WQDA 4QQUA 2FZBA 1JG9A 1CLVA 1FQ0A 1A3XA 2EQDA 2TYSA 1E1FA 4PRWA 4DWSC 1RR2A 5G1MA 5TAOA 3DX5A 4O4VA 4DBUA 1MVYA 3LPPA 5A94A 3G1VA 3GXPA 1Z89A 5HR6A 2X7VA 3TMQA 3MHGA 5BWAA 2I5IA 1AL8A 4J35A 2C0HA 4OT7A 1EUNA 4I6KA 3S9ZA 3N17A 3VYLA 3MO4A 1VFOA 4H9YA 3RNDA 1B3WA 2VC6A 5LA2A 1A0CA 4E4PA 2J79A 2YLLA 1Z6KA 3FS2A 4KIEA 3EPMA 1DJIA 3S8HA 1V5XA 3GH7A 5C70A 6PTDA 1XD1A 2GDUA 5AHNA 4DJDA 4GVGA 1KA9F 4YL2A 2VOTA 2QPUA 2FQIA 2EHHA 4JYEA 4MF4A 2YLAA 4GC4A 2YCLA 1PEZA 2PWEA 4LGXA 1AUSL 3A24A 3K8KA 1HN1A 3TN3A 4PBFA 3A23A 2DZPA 1YLVA 5CZTA 3XIMA 2DW7A 4FZIA 3GVVA 1E1CB 3W23A 1FDYA 2CLMA 1DOSA 4D6JA 4LANA 5CSYA 3U8GA 2G8ZA 5G1TA 2XN1A 4LS0A 3BLLA 3OLIA 2ZUWA 1PYFA 2ALDA 2Z2UA 3PAJA 3F2CA 1GUVA 3MZ2A 3LY0A 4DWSD 4WIWA 1JI1A 1LYXA 1H1NA 3ZIZA 2ZXQA 3E9AA 2YIHA 1M65A 3SRDA 1OJXA 1XIMA 5HANA 1PX4A 3DHUA 1ZJBA 3SO7A 2C71A 4UC5A 1TZ9A 4MY9A 1OINA 3GXMA 2VWSA 3TQKA 3VIJA 1VRDA 3CPRA 3R11A 1A3WA 4AD4A 3KX6A 2BHUA 3T4WA 3NDZA 1Y7VA 2WVVB 3WH7A 4CNNA 1H5VA 4TXEA 1EZWA 1PKYA 3C0LA 1YMYA 3VOIA 1WUEA 2O55A 4M51A 2JF6A 3BLKA 3UFYA 1NH6A 3GFZA 3QHNA 4NYUA 4AU0A 2ACSA 1ZAIA 4WDWA 1E4LA 3WLMA 5C0QA 3STEA 5HUPA 2Z1SA 3VNDA 1WYIA 2OEJA 7ENLA 2VEKA 4RW5A 1PTGA 5LGZA 3EDDA 1YDYA 2B0MA 2OQHA 5I7GA 4C5ZA 2ZQ0A 3UR8A 3REQB 5BOFA 3I7QA 3E74A 1CGWA 3WH5A 3WMBA 3S46A 3OYXA 4OV9A 3VMNA 3PBUA 3NPVA 3OB8A 4G7FA 3MB9A 3TSDA 4C1LA 1QW9A 1M41A 1JL8A 1JDEA 5AY7A 1RUSA 3QKZA 5EKYA 2Z2BA 4HMCA 4W88A 4HPJA 4PMNA 5HWMA 2FTWA 5IRPA 4H8VA 3W7MA 4DN1A 4HPHA 1I6NA 5KEZA 4RXFA 2E68A 1BHGA 1RBAA 2AGKA 2J62A 1Z41A 1MWOA 1UWUA 3EKGA 4Q4OA 4J5NA 4PMXA 2Y63A 4RE3A 5H91A 1H3GA 1BQCA 5KZ6A 1V6WA 2ISWA 4KKXA 4TVDA 5GJPA 4Q4MA 4XAFA 3EWZA 4Y9MA 2POZA 3MUAA 4UR9A 1UOZA 2ZDRA 2GK1B 2QDEA 4WKHA 4H2CA 4MLRA 3DFSA 4F0SA 2XVGA 4BCEA 1A4LA 5FA5A 2CFFA 3OG2A 2R1KA 4ZENA 1IE7C 1LP6A 6TIMA 4J1OA 2YJQA 5C9WA 2VD9A 3GAKA 4WXZA 1C8YA 1AD1A 1QI5A 1X1ZA 2YL8A 3CYJA 1UMLA 1GVEA 2V2DA 3L5LA 5EY5A 2VX7A 2EGZA 3G1FA 3PP7A 1X39A 4MHBA 3MJYA 1SFLA 3VC5A 1MSSA 4A8IA 1TV2A 1BSIA 2QKFA 1EEXA 3SY5A 2D0GA 3W84A 2WBKA 4TX6A 4EPEC 3ES7A 4NF7A 5AZ1A 4F79A 5AYYA 3AALA 2PDUA 5LSMA 1MDRA 1Z42A 1H09A 1YQ2A 3SURA 2GJXA 4XSMA 3INPA 3RM9A 2HE5A 3AQUA 2C14A 1LF1A 3S3GA 5BZAA 2DT0A 1JNEA 3HV8A 4URIA 5DT7A 2H8XA 2Y4SA 4XKYA 5FF7A 4A3YA 3ITOA 5DMLA 2A3EA 4L64A 5CEWA 5HNRA 2PDCA 2C1HA 4HPNA 4DNHA 1LG2A 2E5DA 5FJJA 1J5SA 4HTYA 4JTQA 5IFPA 2XH4A 1KFEA 3BK0A 3FDGA 3AIWA 4NJIA 1UD6A 5HQMA 1VFUA 5SWUA 1E6NA 3WJYA 2BSLA 1ZP4A 2PDYA 2BASA 1BYCA 2GUBA 3EB2A 4J2MA 1Q6DA 4WY0B 3RPTA 3LENA 3N4AA 2GFTA 1H50A 1S1RA 3EBVA 1XIJA 1WV2A 3O6DA 2E7FA 4W7WA 4YTRA 3DI0A 5FJPA 3KDOA 4QAWA 2FGLA 1EGZA 4B2DD 3CTLA 3ES8A 4R27A 4V28A 1E15A 4L80A 3MDUA 3C2RA 3WF0A 1J4EA 2OG9A 1GEQA 3GNPA 1ZHAA 4FB7A 3QFWA 1LL6A 4J3XA 4C6JA 3S1GA 3P7YA 4MKNA 1YNYA 4H6QA 4S3FA 3KBJA 1TWWA 1S2AA 4U2ZA 3Q45A 1U5JA 1V0KA 2PCQA 5HATA 1SW3A 2J7CA 2WNWA 3GQYA 2PBOA 3BCDA 1PCKA 3SSZA 5HNTA 1AK5A 4ZXOA 4WJXA 2CXGA 3NL6A 2R8WA 1MNSA 4P7LA 1K6WA 1G5AA 1BTMA 5DELA 1R2TA 5F4WA 4DBWA 3DFOA 2YDQA 2ONEA 3KL5A 4NY2A 3E2VA 4NASA 3E02A 3Q67A 1AH4A 5HBFA 3MSRA 5IOBA 3H2EA 4PUWA 3M6DA 1SPQA 1IGSA 4BF9A 5H1WA 2WCAA 2HPMA 1S5NA 2V30A 2Q3OA 3TFXA 3R1ZA 4HBKA 1MW2A 2YFNA 4GKTA 4X3ZA 1U1JA 4JTKA 4Z1YA 3GYCA 3QJAA 3VKAA 3UCQA 3BAYA 3HPXA 3CV2A 1Q13A 2I1OA 1GVSA 2GVGA 3W07A 1EX5A 3WD1A 1DKWA 3TWAA 1OZQA 1DWFM 1W91A 2E6AA 3JZEA 3FNDA 1XIIA 1QASA 5BOEA 3RLVA 4ORMA 3WLLA 1EUAA 3USZA 3N73A 3N3TA 1YPFA 5F2MA 4UTTA 4DI8A 5MHBA 4IHCA 1VQTA 2OCZA 4E3VA 2WSQA 1P6CA 2J24A 2D0FA 3FAWA 1N7KA 2MUCA 5AC7A 2DH3A 5I79A 1KBBA 3OHIA 3FJ6A 4Z1DA 1KM0A 3SCTA 4MKVA 3ARSA 4ML4A 4O1FA 2XN2A 4HU0A 4JTRA 3CWOX 1A47A 1TIWA 3EMZA 3H24A 3ARYA 4AZIA 4X9YA 3VFLA 1KRCC 2QT3A 3UNTA 3IPWA 2VL4A 3W2LA 4FAMA 4EACA 3ISIX 3O7UA 3L0NA 1GQKA 4GO8A 4IISA 4UNLA 1MO0A 2CIPA 1OCBA 2XWEA 1Q6LA 5AYIA 2WSRA 4LYRA 4UFIA 2PC8A 3TC7A 2GUYA 2J6XA 2PWVA 2ZVRA 4PR4A 3RAOA 1YXCA 1HJUA 1TPVA 1OIFA 2AOSA 4TMBA 3TAOA 1GVFA 1VEPA 5D8ZA 5J8LA 3KBMA 3DYPA 4IJBA 3N9SA 4GUIA 2EF9A 2HJPA 3PG8A 4QEHA 2R1LA 2OZTA 2OT0A 1PKLA 5L6UA 3B8TA 3WFAA 3F5KA 3LNPA 4B2DA 1BVNP 1IHIA 4ERAA 4Q8QA 1XRFA 4GH1A 3DG7A 1KXHA 3KVMA 3OBAA 2CLLA 3WLSA 1LM1A 3RN6A 4A2SA 4LUJA 1XL9A 4LS1A 1RHCA 2C3ZA 1EOMA 2D0HA 2FJUB 1R3SA 2VFDA 4QP0A 1EDTA 1H62A 5K9XA 5A69A 1I75A 2BTMA 1HJXA 1O5KA 2PMQA 1DEDA 1WBHA 4FNQA 4W7VA 4ERGA 5T91A 3CUGA 2DVTA 3QHMA 3VOCA 3LM3A 3HQOA 2EPNA 1IQ8A 3IJDA 4LBUA 5LIYX 4X61A 5A8MA 2FJKA 1M5WA 3TN5A 3UWZA 3CNYA 3VZYA 4DAFA 4MKSA 1B1YA 1UR3M 1IR1A 2UY4A 3QPZA 3S2LA 4WGHA 2WM1A 4DO5A 4R3UA 1S5TA 3K4WA 4IMCA 3CIVA 3TCSA 4LVAA 5ABFA 4JHOA 1TPWA 1JUBA 4IGNA 3H55A 1TJ0A 2P53A 3CXOA 4UQ9A 1TELA 3VOHA 1R47A 5KMYA 3WNKA 5LNWA 1QI0A 4IP7A 4JIQA 1XLHA 3R13A 3WQ4A 2D69A 2CC0A 5D32A 1RA0A 2WZHA 4D8ZA 3PM6A 5IDZA 2PDFA 3UY8A 2EKCA 2YXGA 4EXAA 1MI3A 4HK5A 2NUXA 4YTQA 1K9FA 4YJ5A 4E4UA 3VGFA 1PZ2A 4M6QA 3BW2A 3LI0A 1IT7A 1S3TC 1JYWA 4WHBA 1FH7A 3M7SA 3EMQA 3TA6A 3O06A 4R88A 3EZ4A 4OUEA 1CEOA 2Z1WA 2GJPA 3S5NA 3NJ3A 3V16A 2GVYA 3KOWA 4L1GA 2I57A 3H26A 1B4EA 1W2VA 3B8WA 3GXFA 3M47A 4K2SA 1XGZA 4LRSA 3P5YA 3TW6A 4JTGA 4FIRA 1DV7A 5DEZA 2QJHA 3E38A 3HGJA 4M1BA 3LHZA 2D22A 2V5KA 4I7WA 3HPSA 1QTWA 5K4XA 2H90A 3NL5A 3MHFA 3D46A 1BKHA 4OQVA 4TV6A 4N6FA 4TR9A 2ZA1A 5CBJA 2XM1A 4GGHA 3W71A 2J25A 3T1GA 3B97A 2CZ5A 4YVPA 5FJTA 2E0PA 2QJJA 1UWRA 2QAPA 4A22A 3LTYA 3A5VA 5DMYA 3VCRA 1V6XA 4TMCA 4UMBA 5REQB 3PUGA 4DO6A 3B9DA 4BKNA 4G5DA 1V3MA 1XUUA 4BY3A 2YBVA 2VDIA 4F8XA 1HL2A 4D6HA 1S46A 4BS0A 2FGZA 2OKOA 3LPOA 3PTKA 1TZZA 4GWEA 2J6VA 2PZNA 2PBGA 4GZEA 4ADTA 4CNUA 1OCJA 2C19A 2DUZA 3ITVA 4MNMA 4XD3A 5F2LA 1XS2A 4JCMA 1PDYA 4C6IA 5KZEA 1R7AA 4S38A 5HMFA 4R7WA 2IMRA 1IEIA 5DLCA 1TPEA 4UTKA 1BWVA 4CNOA 2Y70A 2WM0A 3KM8A 4UTUA 3M43A 4B9ZA 1ADDA 1HKKA 1ZPTA 3JVAA 2HXUA 2WHMA 4AISA 4H8NA 2V68A 3F2DA 3WK3A 1TIMA 4ZA0A 2QPSA 5CG0A 4IIGA 4UQEA 5EPDA 1SO6A 2GJLA 3VINA 1N55A 2YZRA 4GNVA 3O0FA 1MFUA 3A4XA 1VF8A 2R1PA 2CLKA 2O9TA 3HPFA 1GPWA 3CWHA 6XIMA 2PLJA 3AS0A 5DANA 3UJFA 3MDWA 1KWGA 3WBEA 5CZJA 1FDZA 2P8BA 4FO4A 4A6GA 2NLIA 4LC6A 3W7RA 3QR0A 2ICSA 3ID7A 1HO4A 3SQLA 4Y9OA 1KBIA 1WNOA 3EB4A 1RY0A 4GMEA 1VJIA 3AU6A 1Z7AA 1W5MA 1TVPA 2DSVA 5GVJA 3SCNA 4Q6XA 3WQFA 4CNPA 1IT8A 4DY1A 2ZADA 4IQEA 2I5QA 2PB1A 1OD0A 1OABA 1MUMA 4PE8A 2J7EA 1EYEA 5FF2A 1UC5A 1TE1A 2D2HA 3SUTA 1TMQA 1TPUA 1FTXA 3UPBA 1WDDA 2V3EA 4AZGA 2QMKA 1QO5A 1FWHC 1W1A1 5DRIA 2PLKA 3E0LA 2DUXA 4HOZA 2OWXA 1FCQA 1PYMA 4JKMA 5K4ZA 2ON3A 1O5QA 3QXBA 1MMFA 5HOSA 2YYTA 2ATMA 1C7SA 1B3YA 4UMCA 1UKOA 2NWRA 5HNNA 1CB7B 3KVKA 3VM5A 2ABBA 2E4TA 1KFBA 1IXQA 1NFBA 2PP3A 1IIGA 4G6CA 3WD3A 3V18A 3E1F1 2ACQA 5I3DA 2P3EA 4Z1AA 1FWRA 3ITTA 2VDHA 2YB1A 3AXXA 3OLGA 4CU8A 2YOCA 1RQHA 4W9TA 3SGZA 2WSYA 3CLMA 5HDRA 4CNSA 3WDJA 3G0SA 1E3ZA 3MUXA 3ATZA 1EJWC 1V03A 4QDWA 5E93A 4WF7A 2WCSA 1TTPA 1I0DA 2J4GA 4XQ6A 4MPKA 1GYLA 2CZEA 1ZLPA 1NDVA 5I3HA 1JPIA 3C52A 4S3AA 4JQAA 1H2JA 3QV9A 3URAA 1TR9A 2OWWA 4E8GA 3OO2A 2Y7DA 4PB3A 4MGGA 4WJEA 2C79A 3BANA 3VZZA 4LBRA 5HPCA 4C65A 4GI8A 2E28A 4O19A 4JD4A 4GUFA 4O4WA 3H7VA 5H6HA 4R53A 2BBFA 4IT1A 2YSWA 3C0SA 2PDMA 1J18A 2H9AB 2X40A 3WNPA 4NRRA 2Y7GA 1TWZA 4KWSA 1P0KA 1Q6GA 3K1GA 4NJGA 2DZVA 1XV8A 4F9DA 1KLZA 4C1NA 4DHGA 3A12A 2A3AA 4BEQA 4M6PA 2RJGA 2VELA 4EPDC 1EIBA 4NL1A 1NOWA 1TG7A 5FEXA 3GVRA 3WBXA 1J12A 1A5BA 4IIEA 4LEQA 4GA8A 3VK5A 1XFBA 3TV8A 1XLJA 3WMSA 5CC6A 4XTIA 3ARTA 1OYCA 2A3CA 5A6JA 1CPUA 1PX8A 4JN7A 2RHGA 4QCFA 4ACZA 4LOCA 5BXRA 3WH9A 3NGJA 4HU8A 5DY2A 3GXTA 1GQIA 2X0SA 1ZBKA 3P14A 2P10A 2VI0A 1SZFA 3R8GA 5I06A 1XJBA 5K2ZA 2ZRYA 4JR5A 3ZXWA 2ZZ7A 2A4AA 3DECA 1HJSA 3B05A 1E51A 4TIMA 1IEQA 1QNSA 4O14A 2PDIA 1UJQA 1T99A 2EBNA 4JEJA 1F07A 3DFQA 5AOUA 2QZRA 1HTIA 1ISWA 4RW3A 3UR7A 1FWNA 3P2VA 4H9MA 1UG6A 2QHAA 1R7OA 4MNKA 5G1YA 3P80A 1EBHA 4Q4SA 2Z6JA 5I00A 1LG1A 3UP8A 3NPUA 1VFFA 3GU1A 3I6RA 3L0KA 3GG7A 1TR1A 1XH2A 3GFXA 2FZNA 1ONRA 2WNNA 1D3CA 1EFZA 5FEZA 4JQ1A 5B80A 4W5UA 4OBTA 4FF5A 3A4WA 5JBFA 3CMFA 4IUGA 3TVAA 1LT7A 3WFLA 3AIVA 3N29A 1KC7A 2OGYA 1CDGA 3UBPC 4XK2A 2G37A 3WBAA 3ABQA 1BRLA 2GGEA 5GQBA 5ABHA 4ATLA 3RU8X 1Y8BA 5XINA 3AJ7A 3S9IA 4OZOA 4RE2A 5EMUA 2NUYA 3MV11 1JZ7A 1ONEA 1TTJA 1HUVA 4PEEA 3VABA 4UFJA 3TK7A 3MSGA 3GDRA 1VD6A 4AQLA 3N9RA 4HVXA 1A80A 1M7OA 3CZJA 1QT1A 1S3HA 3LXAA 5M5DA 2P1FA 4IXXA 1MFVA 3W7GA 4EIVA 3CEPA 2ZZ6A 3VIKA 1V3KA 2G5WA 1TRDA 1ICSA 1BLIA 2WAGA 3VIFA 3ZZ1A 2JGYA 4ZMGA 5M17A 1ZBCA 2HEJA 7TAAA 1YPXA 4UTTC 3H2OA 4MNLA 3DI1A 4IMFA 1P6BA 3KOFA 3R25A 2X8RA 1YE4A 3QV8A 4HSHA 2PDGA 1ECEA 4FX7A 3TN4A 4WY0F 5GJMA 3BQ6A 4MB3A 4JFSA 4KEZA 3KZPA 1FWWA 1DP0A 1PIGA 3ANVA 3HURA 4HU4A 3OIHA 1O5RA 1AH0A 2PEVA 2Z7KA 3BDKA 1FCUA 3BMXA 3MWCA 4RE0A 2FZ8A 3JW7A 1ZALA 2WC7A 1UR2A 2GVLA 1NWTA 4EX4A 4ORIA 1E0WA 4GFSA 5BMXA 4QHRA 3AMGA 3SFWA 2WKLA 3PULA 3VKJA 1UZHA 1ZY9A 1AMYA 1REQB 1CW2A 4JN6A 4HA3A 4CUCA 1MXSA 2ZWYA 3W75A 4XIMA 2NT1A 1DQXA 1FWAC 4CN1A 2PD5A 1UZ4A 5IBXC 2L5HA 4NXKA 4DUWA 4F66A 3BPWA 2YA0A 3FYPA 2VJXA 1OK4A 2MNRA 3M0JA 2Q71A 1K7EA 1L6WA 2QYGA 1RH9A 4W84A 1CWYA 4PCSA 3ALGA 4Z42C 3ZVHB 2ZICA 2FB3A 1H7RA 1NVMA 1E3XA 2VGGA 2XFFA 2QULA 3U48A 3CPUA 3BLDA 3H7UA 1LWIA 2PWFA 1GWJA 1VFSA 3GKAA 4FLOA 3WNLA 1YHTA 4QFUA 1E72M 3ELFA 3GFYA 5EB8A 1QFEA 1CB2A 4CU6A 5TNVA 1MQQA 3U0HA 1KB3A 4R5EA 4A8RA 2OB3A 2D2JA 1S5MA 3HA1A 2C15A 4PA8A 1R87A 4G56A 3HG2A 4RL3A 4ES4A 2QW5A 3RM4A 2ZXDA 1VPQA 2W5FA 3L4UA 1H1YA 4L56A 4XUYA 1YYAA 3G1RA 5I3FA 2XVPA 1DE5A 3U7VA 1TYGA 1Y65A 3W1NA 1FHUA 3UCDA 3XISA 4DJEC 3NZPA 3HG3A 2R6OA 4GI9A 1ML1A 2BP1A 3PN8A 2EPOA 2GOUA 2X1UA 4AY7A 4BHYA 3UWEA 3NQDA 1EXBA 3GVWA 4YCOA 2EAWA 5HWJA 2GJRA 2HSAA 4CCDA 3LCIA 4PC8A 3WENA 1JULA 1YW1A 3M4HA 5G4WA 1EWEA 1GPFA 1JZ5A 2Q01A 3HB9A 2VM8A 1XCFA 1R3QA 1J6OA 1TPDA 1GJPA 2NT0A 3NFUA 7CGTA 4LNCA 3M1ZA 4HGXA 2A0NA 5ABTA 3QYQA 3T0AA 4HHHA 3VGHA 2H6RA 4JTJA 4F3HA 3UVAA 4C6MA 3H8AA 1KNWA 3HTWA 1UW9A 3IEBA 3A13A 3PPFA 4XD5A 2ZVIA 4JHMA 3VIOA 1IZKA 1JD9A 4AG0A 2WYSA 4KETA 3SIMA 3C56A 4GUHA 1VENA 1B54A 3PZTA 1FCBA 4UTJA 2WO5A 4DRSA 3MCOA 4ADUA 5IM51 1QUMA 3WK0A 3N6HA 1EC7A 2F7FA 5D9MA 1OHLA 3FHQA 4Y90A 2YW3A 1KR1A 3NUKA 4HD5A 4PMVA 4LNYA 4QG9A 3K30A 3LLXA 1S5WA 1UWSA 4B4FA 1ZQ5A 5TIMA 4HZ8A 3WK2A 3A9IA 3V1HA 2VDGA 2CITA 4IMGA 3PBMA 4XD4A 1US0A 3TZNA 1UP3A 4TUFA 3ENLA 1J96A 3TW9A 2XIMA 2ZZ5A 1JDDA 2TRSA 4OTKA 5FEPA 4WD0A 5HQEA 3FN9A 2ODOA 3PUDA 1TVNA 4MY1A 4I9JA 3KLKA 3O05A 1P7TB 3P60A 1PB0A 2PTZA 5C9XA 2INFA 4YIWA 2E25A 2YZ5A 2WV8A 3KOXA 1BWLA 1EBGA 3BGJA 1FWDC 2Y8VA 4C6LA 3GC4A 1U83A 4ZSTA 2GSEA 1US2A 2YXOA 3U5YA 1D7FA 2O4MA 1V08A 4K3ZA 3QV6A 4RZBA 4WXYA 1NWRA 4EK7A 3EX4A 4A8NA 3GHRA 4LU0A 1X8FA 1ISZA 3H4GA 3DBNA 3L67A 5DXXA 1YRRA 3C0QA 4JTUA 4E0CA 7XIMA 1POJA 1WZKA 1DWJM 3OA5A 4MTVA 3UG3A 1ZNNA 1IWBA 4DPPA 1KRMA 1VBJA 1SQ7A 1W3IA 1YTDA 2XGBA 3T07A 2ACUA 4NRSA 3WDRA 4DLFA 3K1DA 1F7BA 2V0TA 3WX7A 4YTSA 4MG4A 4PULA 4HYVA 4N7QA 2ZX5A 3B8UA 1GKQA 7PTDA 3U2CA 4WZHA 4PL2A 3NQEA 3SECA 3AIUA 4DM1A 2I7GA 1KM2A 2I56A 1XRSA 3SRKA 3TH6A 4IF2A 3MMDA 3MZNA 3SDOA 1EC8A 1KM6A 3WK1A 1PHWA 1OGGA 4DPQA 4AEOA 3A4AA 2FB2A 4GVIA 3W1AA 2FLIA 4YTTA 1LLZA 2ZXBA 2BVYA 2GWNA 1XLLA 4G7EA 3M7WA 3AXMA 2OVLA 2GPTA 1NF0A 1RCXB 1LL4A 2C91A 3OTRA 3LU2A 3NPXA 3O07A 2JF7A 5A8QA 5AC6A 2F38A 5KTLA 2X1RA 4UFMA 3LQLA 3UA4A 3ZQ9A 3O8AA 5CCZA 2QCDB 4PGLA 1C8XA 4GZIA 5REQA 1B5TA 4O0ZA 4MJ4A 4MUZA 2A21A 2FHCA 1DPMA 4TX9A 4NJJA 3E2SA 1TRIA 3C8NA 5CGQA 2VQTA 1VIZA 3R0DA 1V0LA 4Q8WA 3W7EA 3BW4A 2Y24A 1UZ1A 1AZ1A 3GHTA 3I3DA 2WZMA 3ZT5A 3MUIA 2WANA 4CD7A 2QGHA 1PL9A 1WZMA 3IWPA 2UY5A 3QHOA 4PCNA 3U6WA 4W4QA 3MUY1 3S1WA 3NZ1A 3DGBA 1MZRA 4OBSA 3SCPA 5U7SA 2ZXAA 3OIXA 4IMAA 5D2VA 4ZO7A 5BXTA 1V3LA 3GAYA 2A7RA 5IHRA 3BMVA 3W72A 3GDLA 1Y5WA 4FLQA 4JFVA 2RDWA 1RK5A 3C4UA 4A05A 3EMCA 3LUTA 5MKGA 2C16A 5I0DA 3H53A 3RR1A 3HJZA 4I7UA 1JIBA 2Y5EA 4FIQA 1LWHA 2XHYA 2E8ZA 2Y7FA 3VGDA 4H9TA 4IFOA 1KTNA 1MZHA 1DIEA 3DFPA 2PS2A 1W3NA 4LW7A 3EDKA 4ICMA 4JDYA 1ITUA 1FOBA 3IJ8A 4AH7A 1GYNA 4CNTA 3GKFA 4P7OA 4E2OA 5D2WA 3IJ7A 4K39A 3IV8A 4O13A 1IZJA 4X0NA 4IZGA 1ZP3A 2FFCA 3THUA 1KR0A 2IQTA 1CIUA 3E5PA 4HNVA 4H9ZA 2CCRA 4WSKA 1TUFA 3AS3A 3KW3A 4R7JA 3F7JA 1KGWA 3GH5A 2YCIX 5KZMA 4ZOCA 2BXVA 1X38A 3CS2A 4C6KA 1NQ6A 1UH3A 4V33A 4MZYA 4NKCA 4MJ2A 1OFDA 1V3JA 2ZA2A 3KXQA 3PZUA 1UHVA 3H4XA 4ACYA 3QW4B 3SQSA 5FAGA 4WGXA 1O4UA 2B81A 2RJHA 3ZSTA 1E6QM 1FVPA 3G1HA 4P8UA 3MI2A 1RAKA 1ADSA 3PZGA 3LV6A 5D4YA 4DWDA 3WSUA 3MP4A 3KCLA 3WF3A 1H4PA 1JGIA 1U22A 6ALDA 3S5SA 1Z8AA 5DQPA 3QF0A 1UP2A 1RCQA 1UWAA 5A6SA 3LV5A 5DBUA 4IPLA 5HMEA 5DY3A 5EMLA 1WQ5A 3EA3A 2EG8A 1DXEA 5DFAA 2ZRWA 5I09A 2ZRUA 2C8NA 1W3LA 1M68A 2ZX6A 1FWTA 4GE8A 3NDOA 1GGOA 1VH7A 2E6YA 3WO8A 3FFSA 5C2XA 4B5NA 2TSYA 4F2UA 2QV4A 3CQJA 1H1ZA 1FY6A 2ASHA 4IPJA 4B90A 1J0ZA 4UTMA 3MKVA 1VFLA 3L68A 4XISA 2CPUA 2B7NA 3H54A 4LY8A 1TJPA 2CZFA 3W7IA 3EOSA 3EWCA 3GO2A 3DFTA 3NO3A 3CQIA 3VILA 3TCEA 1XQKA 1FWBC 1DYSA 1QHZA 3IUHA 1RSCA 5C7HA 4P8VA 2E6DA 1GOOA 1N8IA 4XB3A 1C91A 3UXAA 4CD4A 1OYAA 2GQ3A 2G97A 4O54A 1JF5A 1KV8A 8CGTA 3E2RA 3MY9A 2DUAA 5A6AA 2B4GA 1SZNA 4J28A 4UOQA 5GNZA 1BYAA 1UUOA 4W8AA 4JHZA 1W1YA 3UCCA 3W2JA 2OODA 3WLNA 1QNOA 1OYBA 1WB0A 1T96A 1YXYA 2NX3A 1LCOA 3FA5A 1BQGA 1G67A 4ZFCA 1J0KA 1OFAA 4D1JA 3LXCA 1XUZA 1OB0A 4LALA 2VC7A 4HPXA 1CXHA 4ZOBA 3GZAA 2FDMA 1FFRA 2NVCA 1XCXA 2OQYA 3G6MA 2NQZA 2VGIA 1TV4A 3CHEA 5HA7A 3KRSA 3G1XA 5ECUA 5AYXA 2OSXA 3A3XA 4QJ1A 5LXEA 3JUGA 2BY2A 3DENA 3N3MA 5T9CE 4ZTXA 1EIXA 3L4WA 4ZE5A 3N13A 2PGFA 1NOFA 3CAQA 3SGGA 1MRAA 2XFWA 2CU0A 2BGNE 3GS6A 3QQWA 3DHDA 3SUVA 4KERA 5AVHA 1VJZA 3GIPA 3NQAA 4EF8A 3IIZA 4IH3A 3HQ1A 1B90A 2J9XA 2PP1A 5DT5A 4GH3A 1XIGA 2V38A 3LMZA 4NI8A 3VKBA 4LCSA 2XFRA 3MYOA 4JX4A 4AZCA 3WDQA 1J2WA 4IMDA 2W9MA 3ME3A 3CZ8A 4QS5A 4YLWA 4WQ6A 3L7RA 3Q4DA 4AZBA 4PCTA 2ALRA 4Y8EA 3QN3A 1O12A 1EWDA 4LTSA 3MUZ1 1R2SA 1H7NA 1XKJA 4DYJA 4C6DA 2Y2WA 1WKDA 2CLOA 1VB9A 3URBA 3ANYA 1WXJA 3UESA 3DKJA 1VHNA 4S1FA 1LDCA 3WH8A 1UC4A 1ME8A 4D6CA 3O1NA 1UKQA 3W00A 1BWKA 4TVUA 1SO5A 1QPOA 2E1DA 4DF0A 3FAXA 4HP5A 1QW8A 4X9SA 3KTCA 3AZRA 3DXIA 4S2BA 3NQ8A 4AFYA 4S3JA 2H3BA 3O6YX 2WPGA 3N6JA 4AX7A 1KGXA 1Y5VA 4FMVA 4KEVA 1Q7ZA 2DJXA 3EWYA 3ZR5A 2A1YA 3B0UX 2JBMA 3ZMRA 4CN6A 1I1WA 2JEQA 4OV4A 2OPJA 3BAJA 2EJAA 3B8DA 3CMGA 3W6MA 4N02A 3TLLA 3KVJA 1X1NA 1XRVA 5CH9A 3GXDA 4QNEA 3W27A 3WMLA 3FOKA 1KKRA 4ADSA 3W4RA 1W9UA 3B9EA 4FOKA 1QR7A 3ABSA 3AIBA 1Q2SA