2TSYA

Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
262
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 91
structure length 262
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1997-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2tsyA00
2FJKA 3U2OA 1G4PA 4N4QA 4FXRA 2RDWA 5CPNA 5CZTA 4S1FA 1JCYA 2ZRYA 3A21A 1KW1A 1AW5A 2QJGA 5KINA 3P82A 3V1PA 4QIUA 1BWLA 1OFPA 4UTLA 1J5TA 1CX9A 3MHUA 3S6DA 3UY8A 3VKJA 3UXDA 1G7VA 1P4CA 3AO0A 5C5YA 3W7QA 1QPOA 5LKYA 5HUPA 4X2RA 1XBYA 5FF7A 2EGZA 4IJBA 3QPZA 4FNPA 5AHMA 2GVJA 1ZAHA 5LNUA 3STGA 5AHFA 3TXVA 2HMCA 3HG5A 3QQ0A 1MEIA 3W7LA 3UZJA 4Z1CA 3SZ8A 3HGJA 1A53A 4H3DA 4Y9AA 3M6YA 3UNDA 2VEMA 1SPQA 4K36A 3W1TA 3GYEA 4QNEA 5H2ZA 1SO3A 4WXYA 4A2RA 3R2GA 3W1NA 3HPZA 3W3OA 1TPEA 4JEQA 5EYWA 1NAL1 4IMDA 3TC7A 2NX3A 2FTPA 3WK3A 4ZL1A 4ZZ9A 3A23A 3NPXA 5T26A 1Q6OA 3TE9A 5TQLA 3S0CA 3Q58A 3G1VA 5F4WA 3P74A 1QWGA 4JYEA 2C19A 3S5YA 5EMUA 2NWSA 2C15A 4TIMA 1DJNA 3LERA 3GR7A 1N8FA 3G0XA 2FPVA 3BG9A 4PCFA 3W7CA 3P84A 3WJXA 1TSIA 4LU0A 3W7EA 4LS0A 3P7YA 3S5OA 1EIXA 1LM1A 3IRDA 3RLUA 3W2UA 3G0UA 2Q3RA 1RR2A 1IXOA 1N55A 1TPVA 3P62A 5I3IA 1VYRA 5AHLA 2ZCGA 3DFTA 3FIGA 1Z48A 4R53A 1FUYA 3FYPA 1WOBA 1RQEA 1VR6A 4BI6A 1T0OA 1ZCOA 3E96A 3DI1A 1L6YA 4RV8A 2VFGA 5K3VA 4ONVA 4KKXA 5DCEA 2A7RA 3FYOA 1XUZA 3PB2A 3SSJA 3PBVA 5E0KA 4O15A 2NXHA 4IMFA 2WSQA 1W56A 5DLCA 3F4NA 1OG0A 1MSSA 3DXIA 5C55A 3M0ZA 3C2RA 4MFDA 4WY0A 3ZS4A 4DO6A 2TSYA 2QAPA 3N2MA 3VE9A 1A5SA 5HQEA 4GUHA 3T55A 1XL9A 3EWYA 4UTWA 3NPUA 1ZALA 4L4MA 1GJPA 2YXGA 2QCFA 4EIVA 4LUJA 5I3KA 1K8XA 3PUDA 3LTPA 4O4VA 5IBXA 1GZGA 4NU7A 4CCEA 1GPWA 5D38A 3NQMA 3G8RA 3T7VA 2J88A 3EWXA 3W7KA 1P0NA 5CSSA 1OVDA 2CLKA 3TU9A 4FX8A 4XKYA 4LVBA 4HKPA 2CZ5A 3B0PA 3BW2A 2PE4A 3A5VA 1LLWA 2WV8A 1NF7A 3NQDA 3C56A 2B7OA 2R94A 3LHZA 2P10A 3CIXA 3QSTA 1FDJA 3D0CA 3LB0A 2QCDA 3PUEA 4FNUA 5KITA 1QOQA 1FQ0A 2YFOA 3A24A 2G96A 3KXQA 4OT7A 4TMCA 2YPIA 3CLMA 4UR7A 1TPB1 3G8EA 1XFBA 2V2CA 4ZQNA 4FEZA 3OBKA 5CPOA 5CPLA 2C6QA 1AK5A 1GTEA 4XQ6A 5AC6A 6TIMA 2OX1A 1L6SA 3IGSA 2KZHA 1G4TA 5D05A 4AEOA 1LZOA 2I9EA 2Y61A 2Y7EA 3QSRA 4YXGA 3KX6A 2CWNA 5K2ZA 5HR6A 2QUUA 4YCPA 2A7PA 3C61A 1KM1A 4PL2A 4RXFA 4Y96A 4I7UA 4IMGA 3PG9A 2A2IA 1KV5A 3VFLA 2PCQA 4FNSA 1JCXA 1KM5A 3OVQA 4BWLA 1G69A 3MP5A 3ZR4A 3O16A 4WOZA 3NQ2A 3F1QA 3O6DA 3QMTA 3NPVA 4UFKA 5KZEA 2WKJA 1K7FA 3GAKA 1C29A 3IIZA 2Y85A 2CZEA 4GXMA 2Q8ZA 1R46A 4O19A 3LXBA 1DQXA 4PH6A 2ZQ0A 1JRBA 5CGQA 3CPRA 1GT8A 3I7RA 3MYOA 3DFPA 3LXAA 4O10A 3WK1A 2Q8LA 1NSJA 3R12A 3MYPA 5KTLA 3LV5A 1I2PA 4TX9A 2B4GA 4AHQA 1H1YA 1Z41A 2AQWA 3W84A 4XTDA 3GVGA 4JTSA 5AYYA 3N19B 1EA0A 3CU2A 4MY8A 2VEKA 2WNZA 2JKPA 3NEVA 2QDGA 3N73A 2XFWA 1V7YA 5LGZA 4AVFA 2C3ZA 3QRHA 1YXCA 2E5DA 3FS2A 1ME9A 1K7EA 3NZRA 2X16A 2ZTJA 4M5PA 3NXFA 4EF8A 4NJGA 3KRZA 1LRTA 3B0UX 3OA3A 4CCCA 2B7QA 5EA9A 5D2VA 4Y6GA 3TKFA 2A21A 5LNSA 3HPSA 1F6KA 4MZYA 1AW1A 5EKYA 3MWAA 3TSDA 2VKZG 1G7UA 2QF7A 3NGJA 4HIBA 4HT3A 3GXTA 1QO2A 3CC1A 1L6WA 5BMWA 1OX6A 4NX0A 2A4AA 2C1HA 3RMJA 3M47A 4MFEA 3DKLA 4ZQPA 2DZWA 3GKFA 1RZMA 2CLLA 5CZSA 3M44A 2J24A 3DGRA 1XBZA 2GOUA 4TO8A 3KHJA 3UYCA 2ZA2A 3UWQA 4JYFA 1S3HA 3KRSA 3NM1A 3W1PA 4CQAA 1OJXA 4ZMGA 4D2JA 1Q6QA 4JX6A 4KFOA 3LTSA 2JKAA 3B8DA 1TREA 1VH7A 4MJMA 3EX2A 3UXAA 2DZPA 1X6UA 5AB3A 3OHIA 3NM3A 3GAYA 1KM6A 3IIPA 4NNCA 3R5EA 4IX0A 1K03A 4O50A 2NUWA 3E12A 3HB9A 5LZLA 4JS3A 1K02A 2I14A 2OJPA 4UFJA 3W2JA 1LORA 4YLWA 3GR8A 5BW6A 2NLIA 2EF9A 5D02A 4OBTA 3FFSA 5H91A 4MKNA 4GBUA 2OT1A 4QJ1A 4XUGA 1DBTA 3ZWSA 4K39A 3QMRA 5G5IA 5DXYA 1I2OA 1OFRA 3HIJA 4C1KA 1RQHA 3G18A 4HPXA 1KBIA 4DXVA 2ZZ3A 2Y7FA 4LUIA 2CU0A 4OV9A 2DZTA 3G1HA 2J9XA 1T8XA 1OK6A 8TIMA 1NFBA 2FPYA 1GVQA 4O1DA 5CG7A 3H53A 1THFD 2NX9A 1QPQA 1W5MA 1TTPA 1U5JA 4ZVJA 1FWTA 3JR2A 5F4XA 3TFXA 5LHEA 2QAFA 4DPQA 1MO0A 1Q45A 4U28A 4AMAA 1SZNA 3YPIA 4QSHA 3G3MA 1SZGA 3O6CA 1H7XA 1Q6RA 4UMCA 3CM4A 1KFCA 2WO5A 5MHBA 2QCNA 3PSVA 4WOQA 5FF4A 1CW2A 1YXDA 2E09A 3MBDA 4P2VA 3T78A 3QMSA 4O1CA 1DL3A 4JTTA 1H7RA 4JX4A 1QO5A 2BTMA 2QCEA 3S9YA 1TTJA 2ZRWA 1SW7A 4UFLA 1H51A 1OFBA 3GDLA 4BF9A 1UJPA 3C2OA 4R7JA 2V2DA 4JYDA 1KM3A 1OF6A 1H5YA 4FO4A 3P8JA 2JKEA 2E1DA 1VLWA 4R34A 4MZ8A 4PFMA 1KV8A 1H7NA 1FWNA 3W6YA 4DF2A 1QNVA 4UMBA 1LBMA 4ICNA 1G6CA 3LTYA 4IX2A 3PULA 1X1OA 5FF3A 3W7OA 1A5AA 5DY2A 2GJLA 1JUKA 1L2UA 3GNDA 4M6QA 3W72A 1XBVA 1W5NA 4RLIA 2NWRA 3PM6A 2E5CA 2Z0IA 1OFDA 3HG4A 3TH6A 1TQJA 1YXYA 4QQ3A 1DOSA 1T96A 2C14A 4GUFA 4OQVA 2B7NA 3GB6A 5FESA 2YYUA 5IM51 3OG3A 1QMLA 5F2IA 5AHIA 3VNDA 1PL9A 1KFKA 3KVJA 4CQ8A 3O8AA 4AHPA 2V2HA 1WXJA 3ELFA 3GDMA 1NF0A 4RZ4A 2A7NA 4E2BA 3EB2A 3W7PA 3R13A 3SGUA 3HJZA 3G3DA 4PA8A 4GE8A 1VC4A 3UZ5A 3P5ZA 3MI3A 1TTIA 4FXSA 4UXDA 2P0OA 5KSWA 4WY0B 2F7FA 1YYAA 4NXSA 3W83A 4UTHA 3LCHA 4UFMA 1ZNNA 3G1FA 4LWWA 3UWVA 4A29A 4ORIA 4GUJA 2YW3A 1SO5A 3ABOA 3TC6A 3L68A 5CZ0A 1WA3A 2ZA3A 4OHQA 1FDYA 3RFAA 5CSRA 1AMKA 2CZFA 3O63A 3TW7A 5EPDA 3M5XA 4UFHA 1KFLA 1WBJA 3EX1A 4NJJA 4O1AA 1XXXA 2DJLA 2C0AA 5FEXA 3W1XA 1W1ZA 3CEPA 4CNNA 1ZY9A 2G97A 3NQGA 1AL7A 4XKYB 4FNQA 1BEUA 3HBLA 5KMYA 1LOLA 3BO9A 1XI3A 2ISVA 4HHPA 2PRMA 3L66A 3PF3A 3USBA 4C1LA 3NAVA 1TPDA 3FA5A 2QCDB 5K9DA 4TMBA 3UQNA 1EP3A 1LRNA 1XM3A 3MP4A 1KFBA 2O7QA 5G1YA 3E0IA 4DO4A 3QZEA 2W6RA 3QQ1A 4ML9A 3WK0A 1PHWA 1FCUA 4O28A 5AYXA 2X30A 3PUOA 2V82A 2ZZ4A 4FIRA 4O57A 5FF2A 2Q3OA 3W7HA 1GWJA 2HSAA 3PSWA 3LX9A 1KLYA 5BOOA 4GJ1A 1W3TA 3E9AA 1RPXA 1VCFA 3C8FA 4JNMA 1EWEA 1O94A 1EB3A 3W7NA 4LC8A 3T40A 3FLUA 5GVJA 1R2TA 3LCIA 2TYSA 1PV8A 4K6AA 3A5FA 4IUOA 2YX0A 4OGZA 4DQWA 2JK2A 4I9AA 1HO4A 2VFEA 4JR5A 1SZEA 5HMSA 1WQ5A 4BR1A 4NVTA 3W85A 4ADUA 3NL2A 4N9BA 1FX6A 5U7SA 1V5XA 1W31A 4LNYA 4JTUA 2YYTA 2X2GA 5L9FA 1M6JA 1B4KA 3PS7A 1J2WA 3B06A 2OZ0A 4JY9A 3TQVA 5BNKA 4X3ZA 4O11A 1OX4A 1KFEA 2GVGA 1YPIA 2BZNA 1VS1A 3B05A 4UTIA 1FXQA 4KFNA 3STEA 5AOUA 1QPNA 1SQ7A 2W0UA 3LBCA 2I1OA 3NDOA 1EP2A 3O6YX 1UBSA 4HSNA 1VJIA 4JIPA 5ABTA 3GLCA 3W86A 2JGYA 3S8HA 4XWUA 3I7QA 4O52A 5D2XA 4Q33A 4RZ5A 5F1VA 3W2NA 3PBUA 1QR7A 1M5WA 4MOZA 2CLHA 3HO8A 4EVZA 3GZ3A 1H7WA 3W88A 4IPIA 1WYIA 3F4WA 2DZVA 3LCWA 4JTEA 3ZWTA 1SSDA 1O5KA 1AL8A 2A6LA 1ZHAA 1R2RA 5I3FA 3HGRA 1GVOA 1SR9A 1WAUA 1ICQA 1KM2A 2NUXA 3LLFA 4LVGA 5HUOA 2WOQA 4G1KA 1S5VA 3W1MA 3SIZA 4Z0SA 3K30A 5D09A 1EUNA 2XN0A 1FY6A 1G67A 1T99A 2QUVA 3GDKA 5HWJA 3BG5A 3LM7A 3STFA 3TAOA 3B04A 2GVLA 3DFQA 3P60A 4IXXA 4JY8A 5K4ZA 4DEFA 2HS8A 1H7OA 2ZA1A 5D32A 2GQAA 3VCRA 2GQ9A 1PHQA 1F6PA 1ADOA 3W22A 1W0MA 3NL3A 4A3UA 1QDSA 2V5LA 3N9SA 4JN6A 3W7IA 3W70A 2E6FA 4O17A 1ZAIA 1YLVA 4FF7A 3GXNA 3W1QA 1SU5A 4MLJA 3QPYA 3TSBA 1VCGA 3W1UA 1W5PA 3UWYA 4LT9A 1MXSA 1TPUA 4GC4A 2YDAA 3BARA 5C6MA 1P1XA 2D73A 3EX4A 5G2WA 3DHFA 5C2XA 1OF8A 1OFEA 1KBJA 4GUGA 1VGAA 3L67A 4O54A 3QYQA 2R8WA 1FWRA 4JD4A 4MJZA 3Q37A 5D30A 5DCDA 4N02A 2C16A 2Y7DA 3FEMA 5TBOA 3EX3A 1QOPA 1W54A 3MI2A 1W3IA 1YPFA 1KM0A 3GDTA 4PTNA 2E77A 1A5CA 3TCEA 1HTIA 1XKYA 3W23A 2FQIA 2JGQA 3OVRA 3O15A 3NVTA 3IGUA 1SO6A 3HG2A 3DENA 1F2JA 3I6RA 3NQVA 4NZJA 4AH7A 1ML1A 3FJLA 1HL2A 1O5XA 1TRDA 4JTHA 3DU0A 2Z1BA 4K8EA 4MLRA 2CLIA 3IV3A 3W07A 5KZMA 3ATZA 1TJPA 4JDYA 2H3BA 1Z44A 4YWIA 3G1AA 2J9YA 3OEXA 3C2FA 4O18A 3KAOA 1R30A 1PE1A 3LCGA 4WX2A 5DXXA 4XZ9A 4DELA 1I2NA 1GVSA 3M43A 1OK4A 3EKZA 2QJIA 1SZFA 1P0KA 3M5VA 2WQPA 5EBUA 3NL6A 2ZZ7A 1LLZA 4OU1A 4TR9A 1RV8A 1KM4A 3LGEA 4EWND 4WUIA 3PBWA 3L9CA 3RU6A 5U4NA 1TPFA 1IF2A 3BGJA 3IIVA 1GG1A 4I7VA 4MYAA 3GNNA 2YSWA 3ATYA 1H62A 4CNPA 3QW3A 1KTBA 4Z08A 2ZZ2A 3UY7A 5I3GA 4KWVA 1B3OA 4PL1A 1CI1A 5DY3A 4DO5A 4AXKA 3M41A 1VRDA 2YZRA 4M6VA 5D33A 4K37A 3SW6A 4AWUA 4JICA 2P1FA 4RK8A 1WV2A 4CCDA 3NL5A 1XUUA 1EEPA 4LV4A 4GNJA 1DHPA 3CTLA 2ZDRA 3OIXA 1LROA 3G1YA 1YTKA 2XN1A 1RVGA 2IQTA 4LVFA 3S42A 4WQ6A 5HULA 4UNLA 3T4CA 3W76A 3MI6A 2DP3A 2PURA 3LCLA 1QPRA 1C9DA 1KLZA 1ZFJA 2AGKA 3MJYA 4OE7A 4UIOA 3WJSA 4TU1A 4A2SA 3GIYA 1FBAA 3W7DA 5G4EA 1LTDA 5HR7A 3PB0A 3GXPA 3W7RA 1TQXA 3BW3A 4H6KA 4XBSA 4QM1A 3TMLA 1D3GA 4GRSA 5DELA 3RNDA 1MZHA 3HF3A 1F5ZA 1DV7A 3O1NA 1TJRA 2YW4A 2CLMA 3LCFA 1D3HA 2RDTA 1OHLA 5AHEA 5C54A 1DORA 2J27A 3FKKA 4HNUA 3CEUA 4MVAA 1SW0A 1K8ZA 4S2CA 4DPPA 2R14A 2WSYA 3TJLA 5CPMA 3C4UA 4E0CA 3EKLA 5FEPA 3B4UA 4LVAA 1UUOA 2BLEA 1Y0EA 3DBPA 4I7WA 4NNAA 4RZ6A 4UTTC 5LGXA 3G1DA 4RKAA 3TNOA 1WOAA 3PR2A 2W79A 4AF0A 1X7FA 4FX7A 4HN4A 3I68A 3EWZA 2A1YA 1TMHA 3SY5A 5K4XA 2V5BA 2Z6JA 1XC4A 1JRCA 1OYBA 3S5ZA 2RFGA 3BPWA 4E38A 1JUEA 3LHVA 1IXPA 3MHGA 5AHNA 3BG3A 1E51A 3KVMA 4O0ZA 2DZXA 1KFJA 4QNWA 1ZAJA 4ZQRA 2PRHA 4K7VA 4PEKA 3P61A 3LHWA 2Y89A 4NJIA 1XCFA 5CZJA 1PVNA 3ABQA 1JCJA 4WXZA 4A22A 1ZJIA 3EXTA 1VHNA 2Y63A 5K7JA 3KVKA 2JBMA 4AWTA 3L2IA 3MO7A 1YTEA 1G4SA 2WJZA 3TSMA 5D04C 3GDRA 2PRLA 4N6FA 2A5HA 1TPH1 3SFKA 5F1UA 1J4EA 2NV1A 3A22A 4IWWA 4RX0A 4ALDA 1FWSA 3LI1A 4N9DA 4KFPA 2A0NA 4R33A 4DBDA 3M5ZA 3JS3A 3I65A 3QM3A 2RHGA 4LVDA 1OFAA 5FI8A 4O14A 2X1RA 1SFLA 1I2QA 4JXCA 1W5QA 3L5AA 3N9RA 1EP1A 3S1UA 3VE7A 3WK2A 5D37A 3WJZA 3AJXA 3THAA 1OX4B 3C52A 3L21A 1TPWA 3IIOA 3CT7A 3LV6A 3TJXA 3NOEA 5L6UA 3W2KA 3L0KA 2FDSA 2WNNA 3W87A 2H8XA 3C0JA 3THQA 1JCMP 3IEBA 1WX0A 3BV4A 2LLEA 3MW7A 4ZQOA 1H7PA 1BWKA 3EWUA 3C2VA 1DQWA 3IVUA 2J6XA 5A5WA 2WNQA 4LRSA 4ADSA 4MUZA 3I7SA 3IIXA 3RF9A 3NG3A 1U83A 1KTNA 3UPWA 3PVFA 4ORMA 3BVJA 4HSOA 4KWWA 5FF0A 2E6DA 1HO1A 4UUIA 3P67A 3ABRA 2QDHA 4XBKA 2XN2A 1M7PA 4JX5A 2ZZ6A 2X1SA 4NJHA 3EXRA 5LNVA 3NQCA 5D2TA 2DU2A 4NQ1A 1UUMA 4MY1A 3DFOA 4U4MA 3MHFA 1W8SA 2B0MA 5AC7A 2RDUA 4YL2A 3HG3A 4QAIA 1Q6LA 4UNKA 4X9SA 4Q32A 2VOMA 3TUUA 3UWWA 2E5BA 4RCXA 3BW4A 3P80A 1JUBA 4RJEA 4O53A 3PBYA 3WJYA 4UFIA 4GWEA 5HJLA 5HWNA 1DVJA 4MIMA 5J5RA 1X1ZA 4QISA 4N2YA 5EY5A 3M16A 3UWUA 4WD0A 1OX5A 4JTGA 4Y8FA 1OFQA 1AW2A 5G2IA 2FLIA 1VPXA 2Z6IA 4GFSA 3L0GA 4LTSA 3M5YA 4UTJA 1SW3A 3DKJA 3NQEA 4M6PA 2Y70A 4AAJA 1TB3A 4HNVA 1QCWA 3TFCA 4FHAA 1WDWA 2V9DA 1GQNA 1B57A 4UCGA 5I3JA 3LHUA 1VCVA 3C3NA 1C8VA 1GEQA 1D9EA 4NZFA 4JGDA 1KA9F 2RKXA 4Z1DA 1JR1A 1F76A 1VQTA 1NVMA 1XBXA 1DJQA 3LHYA 3Q2DA 4JTLA 4JIQA 4CNOA 1SSGA 4IMCA 2ATSA 2VFFA 4UC5A 4JTFA 1PCWA 4Y90A 4Z1BA 3MMTA 3PC0A 2CLEA 1P5BA 5HINA 4YCOA 3JRKA 1A50A 4EF9A 1ONRA 3TW6A 2ABAA 2VFDA 2X1UA 3WJWA 5F2LA 1EX5A 1R47A 4GUIA 4LS1A 4O1BA 2WPBA 1XDMA 5LHFA 5E1QA 2DZUA 4ADTA 4UR8A 5CKSA 3W1RA 3LLDA 2BSLA 4LW7A 1WBHA 2EKCA 3SECA 2NZLA 1IXNA 5G1TA 4IMEA 1RQBA 2TPSA 3U6WA 1DKWA 1EWDA 3B0VC 2QKFA 2VFHA 2UV8G 3UPBA 2CW6A 3LCXA 1VZWA 1O4UA 2OT0A 2BX7A 3LRKA 5A8GA 1GYNA 4JTIA 1MEWA 2Y6ZA 3BLIA 3DZ1A 3PY2A 4HPJA 3HGOA 3QF0A 4POCA 1ZENA 1EPXA 1ME7A 2FB3A 2QJHA 3NQFA 3EEGA 3TIMA 2OMAA 2G95A 3F03K 4CLMA 4UTWC 4N6EA 4DF1A 4HNNA 2ZTKA 1YDVA 3QC3A 5I3HA 4ZQCA 4AWSA 1ALDA 1PS9A 4FNTA 3NQ8A 4O4WA 1PCKA 4DF0A 3HQ1A 1K8YA 5IBXC 4K8HA 3C2EA 3H54A 4LC6A 2BWGA 4N4PA 1KTCA 1TO3A 3LRMA 3ABSA 3G22A 4Z1AA 2ZYFA 3NA8A 1AG1O 3NQ6A 4IGHA 4B5NA 1ICSA 2H3DA 5E93A 2EAWA 3TA6A 2CLOA 1IXQA 2Y88A 3R8RA 3CWNA 3KRUA 1SO4A 3PG8A 4NT0A 4WZHA 2EPHA 3VI2A 2DZSA 2YCEA 2E68A 3CB8A 3KFTA 1OYAA 1H61A 3UWZA 3BLFA 4J9JA 2GUUA 2X1TA 2ZRVA 3G1SA 4E2DA 3SI9A 2GQ8A 1LCOA 4N9CA 4EOUA 3NQAA 3CHVA 2TRSA 1I4NA 2V81A 2QR6A 5D03A 2VXNA 7TIMA 1GG0A 4O16A 5F2GA 2QCGA 4BFAA 3TQ0A 2ZZ1A 3A9IA 4AHOA 3DI0A 3NZ1A 1B4EA 4Q4KA 5J5DA 1F7BA 3DFNA 3Q94A 2FIQA 3W73A 1L9WA 1GYLA 3EX6A 1RD5A 4K7YA 2YGYA 2QCCA 1QAPA 4ZQMA 1Q3NA 4O0KA 4UTMA 1TRIA 1BTMA 1FCQA 1LOSA 3PWAA 2H8ZA 4IOTA 1YDNA 3CQ0A 1LOQA 2GPTA 1TV8A 1TV5A 3P5YA 4BWLC 2QEZA 3CWOX 2CFFA 5LNRA 3DH7A 3NR0A 1TTQA 2EHHA 2VELA 3LI0A 4LS2A 4OV4A 4BK9A 3HMJG 3MUXA 2VEPA 4CQ9A 4HNTA 5HWMA 3FJ6A 4JDBA 3S5NA 1FCBA 4YMZA 3LXCA 1I8JA 1B9BA 2ALDA 3QJAA 1ME8A 4IPJA 3EWBX 1H63A 3SJ3A 1NEYA 3TROA 2NXGA 4FNRA 1LBLA 4W9TA 5FEZA 1BKSA 4AF0B 1IIGA 4H4IA 5AC8A 3SGZA 4RXGA 2ZRXA 3QW4B 3EXSA 1H60A 3C6CA 4N9EA 3G24A 4BI7A 4P61A 3LBMA 1G4EA 3GK0A 4Z0JA 4FB7A 2R91A 2F84A 5G4WA 5BMXA 5G2HA 4QITA 3E49A 2A6NA 3QFEA 2G5WA 2WSRA 1GTHA 3L0NA 3TAKA 1GVFA 5HNRA 1FCVA 1HUVA 2VEIA 4LV9A 5KZDA 1R2SA 2QCHA 4NX5A 3TMQA 1W5OA 1K7XA 4PODA 4MY9A 4DBEA 2B7PA 4PC8A 3TV8A 3IVSA 1F05A 2ZRUA 2J9ZA 3EWWA 3CIWA 3NYZA 1X8FA 2TMDA 1JQVA 3LDVA 3W1AA 4IQLA 2QCLA 3HOJA 2YR1A 4NUWA 4UMAA 3FOKA 5BRBA 3DHDA 1VHCA 4NXKA 2ZFAA 3BK0A 3DFSA 3W75A 2CZDA 1VYPX 3NO5A 2NUYA 1F73A 5LSMA 4RR4A 3W2MA 1TYGA 3HGSA 3ZFHA 3N34A 1S5TA 3QEZA 2HS6A 2ABBA 1W3NA 2RH9A 2NX1A 4LOCA 4L4LA 5DBUA 3M7WA 3NNTA 1F74A 3LRLA 2AAMA 3BLEA 3KVLA 4FIQA 3MBFA 2Z2UA 2Y62A 1O95A 2ZZ5A 2VFIA 3STCA 1TIMA 5LNWA 3P81A 5D2WA 3FKRA 3V75A 3TR2A 4MPQA 1S5WA 3W7JA 5F4SA 4O12A 3W9ZA 3W1LA 4WY0F 5DN1A 3HPXA 1GOXA 3P8IA 4X22A 1XDLA 1UB3A 5EL1A 2ZBTA 3TK7A 2VENA 2C18A 2V30A 4BI5A 4WJEA 1IIHA 2C13A 4UTUA 3H55A 5AFDA 3W71A 2Y7GA 3ANYA 1K3UA 3S1XA 4O13A 3B03A 5DBTA 3DAQA 1TCDA 1YTDA 3WFAA 2ATMA 3NQ7A 3RLVA 2V8ZA 2BXVA 2VC6A 4JTJA 1O60A 3L5LA 4UTTA 1LRQA 4NNBA 3BGGA 3L65A 1ICPA 3U8GA 3UD6A 1LBFA 3QH2A 3PAJA 5FEWA 4O8RA 2ISSA 3LOTA 3GX9A 5AYZA 3M1ZA 3S1VA 3IGXA 4IXHA 1H1ZA 2QCMA 3OVPA 1JCNA 4LRTA 1LYXA 1JULA 1HFBA 2E6AA 1OFOA 1EUAA 4FX6M 1HG3A 2HTMA 1N7KA 3W7GA 2GJNA 5TIMA 3KOFA 1TV7A 4A21A 1W37A 4NJKA 1VYSX 3E02A 3RK8A 3W7MA 4JTKA 1FDZA 4MZ1A 4MYXA 5K9CA 2QUTA 1A5BA 4S2BA 2FPTA 3N2XA 1OYCA 1FWWA 1I45A 1QFEA 1YADA 2DJXA 2DORA 1I2RA 1IGSA 2O7SA 5SWUA 3W2LA 3GKAA 3IVTA 3G1XA 3S1WA 1JCLA 2A85A 2CLFA 3W74A 3LHTA 3TDFA 2H90A 3O07A 1LP6A 2FFCA 1LDCA 3TQKA 2NXIA 1UCWA 5AN7A 3T44A 2FB2A 6ALDA 4AB4A 4OWGA 5DCBA 4M7TA 4XTIA 1JQXA 1Z42A 3INPA 3N14A 3O06A 1MEHA 1YDOA 3G0SA 4K38A 4M7SA 5D2YA 2OCZA 4UTKA 5K9XA 2E6YA 1UASA 3TX9A 3L5MA 2H6RA 2ISWA 1JVNA 2YFNA 1PIIA 2ZRZA 1H50A 3R89A 3TXZA 1GVRA 3O05A 3N3MA 4M19A 1M7OA 2V0TA 1VLIA 2PC4A 2NV2A 1TPC1 5F2MA 3M9YA 4LY8A 1OABA 3NPWA 1SUXA 3SR7A 1SFJA 3MP3A 1JJKA 1FXPA
chains in the Genus database with same CATH superfamily
3OU8A 3SRHA 3II1A 4N4QA 2VJXA 3RO8A 2RDWA 5CZTA 1M3UA 1ZS2A 1PEZA 1B1YA 2P0IA 1JCYA 1GQIA 4AZ5A 1JD7A 2ZRYA 1Q6EA 5KINA 3I3DA 1Q7QA 2OQHA 4IFKA 1OFPA 4H9VA 1J5TA 1T7LA 2IUZA 4H19A 3OBAA 2WZIA 3AO0A 1NDVA 1G0CA 4M56A 3VKKA 1QPOA 5HUPA 2VGIA 4FNPA 1IEIA 1B3YA 3CQHA 2GVJA 1JGIA 1ZAHA 2NW0A 3E38A 3STGA 1MEIA 3CQKA 1EQPA 3SZ8A 3WEZA 4IG2B 1YX1A 3TYZA 1KQZA 3UNDA 1RJQA 2J13A 2VEMA 3GYEA 1SO3A 2WKGA 4UQBA 1XYLA 2DV0A 4A2RA 1JZ8A 3KZSA 3O9NA 5EYWA 1NAL1 1ZCCA 2NX3A 2FTPA 3A23A 4W93A 2OQYA 4J3WA 5TQLA 2A3BA 1Q65A 1QW9A 4PBEA 5F4WA 1XW8A 4DYEA 3GXMA 2BP1A 3F4VA 5EMUA 4WJ8A 2NWSA 1U5VA 4C6EA 1DJNA 1A5NC 3R0DA 1H09A 3G0XA 3NUKA 1NP2A 1AJZA 3W7CA 2VCCA 2J62A 3TA9A 3WEMA 1NIUA 4LS0A 1TUXA 1FWAC 4MWAD 1LM1A 3RLUA 5I06A 3W2UA 3AIQA 4M6UA 2PLCA 3AOFA 2Q3RA 1RR2A 1TPVA 1CB7B 1WDDA 4V28A 3VOHA 3EDFA 4R53A 1FUYA 1HXJA 5EMJA 1ZCOA 4NP7A 3VKDA 4RV8A 5K3VA 2J7BA 4KKXA 4P5UA 2CHNA 1OZMA 1XUZA 2OWCA 1FWIC 2PTYA 3RLGA 2WSQA 1J8VA 5D9OA 2Z1XA 2W66A 1OG0A 1MSSA 2Q8XA 1WKEA 1EF3A 1EX1A 1L6FA 3OB8A 2OR2A 4J3ZA 1ZP4A 1S1RA 5JIWA 4QDWA 5HQEA 1KBLA 5ABEA 1J93A 3F7JA 4S39A 1XL9A 3IJIA 3UR8A 5HQLA 1UPPA 3BLOA 2W4XA 4YVVA 1H0IA 3L7RA 4LUJA 3IK4A 4X0VA 1LF1A 2QXWA 1K8XA 3VUSA 3LTPA 4O4VA 4IG2A 3CL7A 4L6DA 4Q8VA 4GC3A 2DT3A 1ITXA 3G8RA 4A4AA 4KT2A 1H49A 5C9UA 3OLDA 1WP6A 1KB3A 2VD9A 5FOOA 3E2QA 2WV8A 2B7OA 1MW2A 4NZ3A 4DXXA 3QSTA 1XINA 1FDJA 2JIEA 3ZYZA 5B7YA 3PUEA 3FJ4A 5C0QA 4QRNA 1ONEA 4FNUA 2Z00A 1QOQA 5CAKA 1FQ0A 3D3FA 3BICA 1T6MA 3A24A 2G96A 4TMCA 4UR7A 1TPB1 3G8EA 1XFBA 4HK7A 2PMQA 4FEZA 5CPLA 1XISA 6TIMA 3K46A 5M1TA 2KZHA 3QKZA 4WR3A 2DEPA 4YXGA 2CWNA 5K2ZA 1V6TA 3I6TA 2E1WA 4PCSA 5LYRA 3QY8A 2WLYA 4RXFA 4IMGA 2A2IA 3IANA 2PCQA 3TYDA 1UD6A 4K1WA 2CXEA 4BWLA 4JKKA 2HNEA 4HPNA 2Z7GA 3VOCA 3F1QA 4KEUA 4UFKA 5KZEA 1K7FA 1V79A 1JDEA 2Y85A 2CZEA 3GVVA 3OLIA 1R46A 4O19A 3T8LA 1MNZA 1WE5A 5CGQA 1J01A 3F2DA 1TIWA 3LXAA 1ZJHA 4O10A 1E6NA 3WK1A 2Q8LA 1MW0A 3UR7A 5KTLA 2YCIX 2PGRA 4NZ1A 1H1YA 4ZTYA 5LIKX 3LGDA 4LFYA 4OFCA 3L4VA 2QDGA 2JQXA 4QTGA 1SVDA 4B9ZA 1YE6A 3SSZA 3QRHA 2AQOA 4M5PA 1X6NA 4EF8A 3WMSA 3KRZA 1Q7ZA 4PRRA 3B0UX 1XQLA 1E73M 4FK9A 4IPLA 3E2SA 3BTNA 4AYGA 1AW1A 5EKYA 3TSDA 3V18A 4HIBA 4LQ1A 2CNCA 3GXTA 2PDXA 3CC1A 3WQWA 3RR4A 1TELA 2BNJA 4AD0A 2CLLA 5AECA 4C65A 1XBZA 1QT1A 3BAIA 3UYCA 2PTDA 2PDNA 1W3JA 3KRSA 3NM1A 3W1PA 1OM0A 1OJXA 4AVNA 1RP9A 3NJ3A 4D2JA 4JX6A 3N2OA 3UCCA 1Y65A 4WSKA 2PWVA 2Z28A 3EX2A 3UXAA 1XYBA 1RVKA 2V6AA 3OHIA 1OCQA 3AS0A 5FJOA 4MAVA 4IX0A 3OO2A 1AZ2A 1EIBA 4O50A 1F3XA 4D8LA 2AMGA 1XSIA 2GWNA 5D02A 5TNVA 3AAMA 4IL2A 3GUGA 3ZWSA 3QTGA 2BY3A 5D8ZA 4WKHA 4LSBA 3W81A 4P8VA 2F61A 5EMLA 1P43A 1RQHA 5AKQA 2ZZ3A 3GW3A 4J28A 3BV7A 2J9XA 1OK6A 3MKCA 8TIMA 1GVQA 4CD8A 1THFD 1W5MA 2NQHA 5H6HA 4ZVJA 4AIBA 1KR0A 4V1YA 1R8LA 4KBXA 2C91A 4PBFA 1MO0A 4L80A 4U28A 4AMAA 2WZHA 2DH3A 4J3SA 4QSHA 3YPIA 4BQ2A 3NOYA 3I3EA 1KFCA 4QEHA 1CW2A 4P7NA 3QMSA 4O1CA 4JQ2A 4JTTA 4MPKA 1H7RA 5AY7A 2BTMA 4QXIA 4RNIA 4TV5A 3GDLA 4BF9A 4CD4A 1UJPA 4IFRA 4TX8A 2X41A 2V2DA 4MB5A 5JBFA 1KM3A 3MZNA 1QBBA 2EJAA 3QY6A 1DWIM 4B2DA 3A3WA 3UXKA 4QE5A 1YBQB 2JKEA 2NVCA 2E1DA 1VLWA 3B0YA 3B0XA 1TUFA 1ZBKA 4MNKA 4DF2A 2AKZA 3PZOA 4M80A 1G6CA 3CWHA 3ZSSA 1X1OA 1JPMA 7A3HA 4MTVA 4ZE4A 5FF3A 3QVQA 2PP3A 1XHGA 4PTMA 1XBVA 3PM6A 4HN8A 2EPLX 4DZAA 3RPMA 1T96A 3H7VA 3LZ5A 2ZXDA 1VFTA 2GSHA 5FESA 1S3TC 3PPCA 1KFKA 4PMUA 4CQ8A 2BY1A 1JF5A 2XH0A 4JBRA 4RZ4A 3SCTA 4IICA 4E2BA 3QTPA 1QXLA 4BQ3A 1B90A 3SQMA 4Y8EA 2PF8A 3EOSA 3MI3A 4DVOA 1H5VA 1BF6A 5KSWA 4QJ5B 1UD5A 2D2OA 1WUFA 1IE7C 1QI5A 4LWWA 5CPSA 4HJFA 5XINA 5FCZA 4F0LA 4D8ZA 2CZVA 4OHQA 3RFAA 2GQ3A 4GXPA 5I0DA 1AMKA 2CZFA 2GWGA 3C0LA 3M5XA 2AMXA 2YA0A 2DZAA 2OO6A 5FEXA 3CEPA 2OEMA 1R3WA 3NQGA 1AL7A 4JCMA 2ADAA 4XKYB 2WMGA 4AD1A 2D22A 2VDGA 3MSDA 3QOKA 3B9DA 3M0YA 1DWHM 4HHPA 3CAKA 2PRMA 4TX6A 3BAWA 1IYXA 3OTRA 3ZT7A 1LRNA 1ENUA 2PWDA 5G1YA 4RPQA 3E3HA 3ARPA 3Q65A 4ZO8A 3SCQA 5AYXA 2GDUA 2X30A 3PUOA 2ZDSA 1HVXA 2BODX 4JTAA 1EOKA 2JE8A 2HSAA 1SZRA 3PSWA 1KLYA 5LA2A 2WNWA 2X42A 1W3TA 3GBEA 1VCFA 5H8MA 4L9XA 2X8RA 4GGBA 1BRLA 2NV9A 1EB3A 1K8CA 1DE5A 4TOQA 1XLHA 4IUOA 4OGZA 4I9AA 2VFEA 4CN6A 1OY0A 5HMSA 3QR0A 1V5XA 4PR4A 3V5FA 4L5ZA 3TQVA 4X3ZA 1OX4A 1KFEA 2HROA 2BZNA 1VS1A 4GYJA 1FXQA 3STEA 3CZ8A 1QPNA 1SQ7A 3EPMA 5FL0A 3RYSA 4CD7A 4HSNA 5ENLA 1HJQA 1US0A 1Z69A 2BY0A 3IUHA 4F0HA 3I7QA 3KL0A 3W2NA 3PBUA 1QR7A 1M5WA 5IHRA 4F79A 3AXKA 5T91A 3QC0A 1VP5A 2NQ5A 1SFTA 1X6LA 5G1MA 3V1HA 1J0YA 1H7WA 1AQFA 1S2WA 2DZVA 4JTEA 1C8YA 1SSDA 1O5KA 4JNYA 3LNMA 5D8WA 3V16A 1AL8A 1ZHAA 1R2RA 3H4XA 1ZSXA 5I3FA 3APYA 3HGRA 1CNVA 1SR9A 4KQNA 3BURA 3LLFA 3BAXA 4LAZA 1RD6A 4GXWA 4G1KA 2PDGA 3WLRA 1S5VA 3W1MA 3R8HA 4Z0SA 1EUNA 2MANA 3FCPA 3GDKA 2PAJA 4UBPC 1M65A 2EKGA 3KOZA 5I3DA 4IXXA 1C7TA 4C6OA 4C6MA 2INEA 2E40A 3TTSA 4QP0A 2ODOA 5HOSA 3MUY1 4KIRA 3WDPP 2FH8A 5FD0A 3AIVA 3BWWA 5IDIA 5CXPA 4US5D 2VX5A 3KBVA 2XTKA 1B2YA 1A49A 1LQ0A 4JN6A 1LWJA 4QROA 3TSBA 1VCGA 1UPMB 2CWXA 4DIAA 1MXSA 1O1HA 3CPUA 4I6VA 2D73A 4DJFC 4E8DA 2GVYA 5C2XA 4HSHA 1OF8A 2J7FA 1BG4A 4HU3A 4H41A 2UY3A 3QYQA 2R8WA 5D30A 2C16A 1YPFA 4HHMA 3GDTA 2C71A 2E77A 1A5CA 4HCHA 2FZ8A 2JGQA 1UWIA 1SO6A 1JD9A 1UMYA 2PCEA 3SCPA 4LUSB 5EFDA 4JTHA 4IGNA 2Y8VA 4MLRA 2CLIA 3W07A 4ZOBA 2V69A 1CTNA 3Q4DA 4CNTA 1TJPA 3UXIA 2ZXQA 3I3BA 4G7FA 2E25A 4EPEC 3PAOA 1Z44A 2O9TA 4C6DA 1C91A 1L0PA 2J9YA 2PC8A 4O18A 1EKOA 1EGMA 1PE1A 3HJEA 1JGMA 1IZJA 4WX2A 5E09A 3SAZA 4YHGA 1XRTA 4DELA 1XH1A 3EKZA 3N11A 1EH9A 4K8GA 3WDHA 1FWHC 3PBWA 2PDFA 3RU6A 3TR9A 1SJCA 3PPGA 3IIVA 2PF0A 3V5OA 4MYAA 2XWEA 1DWJM 4B3KA 2R1LA 2YSWA 1H62A 3C0QA 1EF2A 4DM2A 1KTBA 2VEGA 5A6BA 3CYJA 3KOYA 5I3GA 4RNHA 4PL1A 1KRBC 1WXYA 4XAPA 1WZAA 1VRDA 2YZRA 4H2HA 3GU1A 3PK7A 1L6GA 4KEZA 2PDBA 4YTQA 3QGKC 1VFLA 3N17A 3Q67A 4MKSA 3UW6A 1Q8AA 4A3QA 2Z26A 5BYWA 4RK8A 3E6EA 3NL5A 1TV2A 2VMFA 1MRAA 3S42A 1YTKA 2XN1A 1RVGA 5A8QA 4WQ6A 3W76A 5CJ5A 2DP3A 4NI3A 1C9DA 5BU9A 1ZFJA 1K70A 2AGTA 4UIOA 4TU1A 3S3GA 1FBAA 4GYKA 3GVRA 4C6KA 1T40A 4JHZA 5HR7A 3GC5A 3W7RA 2HQAA 3BW3A 2X0SA 1UYQA 4HNCA 4DZ5A 1X8CA 5DELA 1MZHA 2QMJA 5G4HC 4I9TA 3IK2A 1EYEA 3MUAA 4WDWA 1TJRA 4P7QA 4WGXA 3K4WA 1ZRQA 1D3HA 1TV3A 1PYMA 3TYBA 1V51A 5AHEA 1BF2A 2EQDA 1SW0A 1K8ZA 4S2CA 4NASA 2WVSA 3AISA 3PPFA 2WSYA 4E0CA 2HZGA 1UUOA 2W63A 1Y0EA 3EOEA 2FHFA 4I7WA 2JFEX 2PDQA 6ENLA 5LGXA 3TNOA 1WOAA 1P7TA 3GY1A 3ZJ7A 1X7FA 2AL2A 2PPGA 4D9PA 3I68A 3EWZA 2A1YA 3OP2A 5K4XA 2BY2A 2OLSA 4JKLA 3EA3A 1KQYA 5E5CA 2XH2A 3RILA 1ISZA 2ON3A 3APTA 1MFUA 3AHZA 1AQHA 3GH4A 1SFSA 2RDXA 1PXGA 1NWRA 3SDOA 2NT1A 3VKBA 1KFJA 4YS1A 4W85A 4IF2A 2PRHA 4K7VA 2O9RA 4F2UA 3P61A 1XCFA 1BSIA 5CZJA 3GH7A 3W82A 1JCJA 3UYIA 1ZJIA 5K7JA 2DVTA 2VR4A 4AWTA 2HISA 3MO7A 1YTEA 1B3XA 5D04C 3U4AA 4WSHA 4C60A 3QV7A 1J0ZA 3A22A 4IWWA 4RX0A 3N15A 3THDA 2QF8A 4R33A 4HZ6A 2A3HA 3H22A 3B3DA 2RHGA 2D23A 3KLKA 4GBDA 3WH8A 1X38A 1EP1A 3ZVHB 2WSKA 4J3XA 4Q4MA 4DJFD 1OQFA 4GK8A 1EZ2A 3NOEA 2DVUA 4J4KA 2FDSA 2E7FA 4W4QA 3THQA 1EC8A 4KCUA 3ITTA 3ZJKA 1ISWA 4ZQOA 4NF7A 1BWKA 2FJUB 1TZ9A 5A5WA 4ACYA 4AIUA 3IIXA 3RF9A 4DI9A 3WQGA 3G77A 1UOZA 2GFTA 4DAIA 3DUGA 4URIA 3RAOA 4BEUA 3PVFA 4ORMA 4UQAA 2X7VA 4HSOA 4XBKA 2XN2A 5A8OA 1KCZA 1REQA 3UF9A 3W02A 5I7GA 3GTHA 3UETA 5LNVA 1GK8A 4MY1A 1ZQ5A 2IPGA 1W8SA 3M0KA 3HG3A 1OIMA 1VFOA 3TUUA 2ZWYA 2DUXA 4RJEA 3WH7A 4CU8A 4QISA 3M16A 2R1NA 3VIIA 3LEPA 3A13A 4QLJA 1PB0A 3H4WA 3L0GA 4IISA 4UTJA 4G5DA 2V5KA 5CGMA 2Y70A 3M6DA 4AAJA 3N13A 3DFYA 4HNVA 4FHAA 2V9DA 4LCQA 1UC4A 1K6AA 5I3JA 4AY1A 1GEQA 1DE6A 2PLMA 1U22A 1KA9F 1A0EA 4Z1DA 1JR1A 4H6QA 1P6WA 1M7JA 3DERA 1VBUA 2QS8A 1DJQA 2VT0A 4JTLA 4XK2A 3PJXA 1XSKA 1Q13A 2ATSA 3VKCA 4B5UA 2PWFA 4NHVA 1A50A 2DSVA 1ONRA 3TW6A 2ABAA 2VFDA 1EX5A 4LS1A 4JIEA 2WPBA 1XDMA 4C6FA 1HQTA 2DZUA 1XLGA 2E67A 4MHBA 4KRTA 1MYRA 2EKCA 3HV8A 2W92A 1NH6A 2NZLA 4DBSA 2TPSA 4FPSA 3TCSA 2QLYA 4QQUA 2VFHA 3LCXA 4F66A 2PP0A 2CCRA 3V3WA 3LY0A 4CKQA 5A8GA 4Z2GA 1MEWA 3OVGA 4HPJA 5DRIA 2WC7A 3HGOA 5T9CE 2XHYA 1DEDA 4D6FA 2GJXB 3U9IA 4G2DA 3GFXA 2Z1SA 2G95A 4CLMA 3GD6A 1UUQA 4N6EA 1KC7A 1D3CA 1E70M 2ZTKA 5AYBA 3QC3A 5BU6A 5I3HA 4ZQCA 4AWSA 4O4WA 3NQ8A 1LL4A 1P48A 4DF0A 1ZJAA 3HQ1A 3JVAA 4K8HA 4XKMA 3H54A 3GG1A 4LC6A 2BWGA 1KTCA 1TO3A 4LH8A 3G22A 3VXGA 5FJPA 1AG1O 4EACA 2KAUC 4JIRA 4WSJA 3VMNA 1QBAA 2Y88A 4WZHA 2EPHA 4XO7A 1E0VA 3KFTA 3UWZA 2QGYA 2OYMA 4E2DA 1YIXA 1IZKA 4JFSA 3GTNA 4JNZA 4N9CA 4UOZA 3NQAA 4IL0A 1J6PA 1V3JA 3B8VA 3HPAA 4L64A 4O16A 4D6GA 1E9ZB 1H3GA 3W4RA 4GPNA 4XUYA 4AHOA 1T41A 3BJTA 4AEEA 3S47A 4HHHA 3DFNA 2FIQA 2CESA 3HFTA 3SQSA 3W73A 1L9WA 4K7YA 2VRQA 4GZ7A 1Q3NA 3WQ4A 1BTMA 1LOSA 3CQ0A 3K5XA 3E2VA 3LQLA 1DJZA 3HZ3A 5FAJA 1GORA 5EMMA 4BWLC 7REQA 4QCFA 4TVDA 3ARQA 4RNJA 1RAKA 2Q6ZA 1W1A1 2R1MA 4Z42C 2E9MA 5IDZA 3LI0A 4LS2A 1FVPA 3HMJG 3MUXA 2VEPA 4CQ9A 4JDBA 1RALA 1I8JA 3EA1A 3ES7A 2ALDA 3QJAA 4NRSA 1MW3A 4DUVA 2WVVB 2IW0A 1IR1A 1FTXA 1H63A 2PFHA 3RLHA 3SJ3A 4Q7IA 4GZIA 2NXGA 5FEZA 4W9TA 1HT6A 4H4IA 1IIGA 4AF0B 3O6AA 3WFZA 1ITQA 5TAOA 2GJXA 1UD2A 2J8TA 2I5GA 2BGSA 5REQB 1O5RA 4N9EA 4BI7A 5J04A 3M0MA 3LBMA 1FKWA 1G4EA 3GK0A 4FB7A 1E1CB 3AFBA 3QFEA 2WSRA 4PUKA 1MZRA 2D2HA 4U10A 3VGFA 1HUVA 5KZDA 2G4FA 3KBNA 2QCHA 5MF5A 1OWQA 1W5OA 4PC8A 3RCYA 2DQXA 3DDMA 3SRKA 3EGJA 4KRZA 2J9ZA 1TCMA 1XG4A 4H9ZA 3SUUA 1GQKA 3HOJA 2YR1A 1VBRA 2C0HA 4W5UA 3RO6A 1JYWA 4UMAA 5BRBA 1GONA 2J6VA 2Y5JA 2ZFAA 3BK0A 3DFSA 4H9TA 2Y0FA 2NUYA 3N2CA 4G8TA 2ZE0A 3HGSA 4Q6JA 3S2CA 3ZFHA 3N34A 3M0IA 2E9LA 3QEZA 5HBFA 2NVDA 1JIBA 2RH9A 4M0XA 4XSMA 4B92A 1F74A 3LRLA 3AXHA 1IWPA 4HPGA 4UOQA 4FIQA 2Z2UA 2PDHA 2Y62A 2FGLA 2VFIA 4MAZA 1U33A 5LNWA 3LNPA 3PTDA 3VIMA 1S5WA 1LT8A 3SURA 1TWDA 3EPNA 4JFUA 4BCEA 3WNLA 3WL0A 3VDAA 5D4YA 1AUSL 2VYOA 4Q4PA 4WJEA 2INFA 3KWXA 5AFDA 1EQCA 2XFFA 3EYPA 4ATLA 2Y7GA 3S1XA 1FWJC 3ENLA 3WFAA 1NQ6A 2OKOA 3SQLA 2WXDM 4A6GA 1CPUA 2Y8KA 4C7DA 1QATA 2BXVA 1A5MC 3S2NA 3RUBL 3FX4A 2BFGA 5JXQA 1RY8A 3VM7A 2J8FA 1J0KA 2H9AA 3VNLA 4E2OA 1S46A 2ISSA 4U2ZA 3WLLA 1UOKA 3KBJA 3S1VA 1OD0A 4IFOA 5REQA 3AMDA 1EUAA 4FX6M 4B16A 1HG3A 2HTMA 4HVXA 4XZBA 1MNSA 1FWEC 3KHDA 3M0JA 3LPFA 3CO8A 4XAFA 3S6OA 2WPGA 1IEXA 3RK8A 2G3JA 3TTOA 4MJ4A 4S3CA 1A5BA 3WZ0E 3N2XA 4I8YA 3TN5A 2D2JA 2VM8A 2DJXA 2DORA 1RCXB 2WANA 4WHBA 4UWMA 1CLKA 3ARZA 2VDHA 3ITGA 2CLFA 2HE8A 7CGTA 1OIFA 1LP6A 3QXBA 4H9XA 3LLXA 2DH2A 4JL2A 3TQKA 2NXIA 2WHMA 3T44A 4Z1YA 2VRJA 2OELA 3N14A 1MEHA 1YDOA 1EA9C 4XZMX 3ZT5A 4M7SA 4UTKA 4S23A 3PFRA 3VD9A 1ISVA 2Z1WA 1OCBA 1PIIA 3TXZA 1GVRA 3O05A 4F8XA 4HTBA 2XVKA 3WCZA 5I79A 1R0MA 3RCMA 3ZIZA 5F2MA 1RUSA 3CV2A 4HMCA 5KZ6A 4FLSA 3MP3A 2FJKA 1G4PA 1PTDA 5CPNA 3POCA 2WCAA 4EAMA 2ZKMX 4AD4A 1KW1A 4H83A 1AW5A 1F3TA 2QJGA 3P82A 3AYVA 3T9PA 5BWAA 3BCDA 4UTLA 1E0XA 4L1XA 3S6DA 3UY8A 2TAAA 1A5LC 3W6LA 3QKEA 1HKIA 1Z32X 5C5YA 1RCOB 4JZ5A 4MB1A 2EGZA 2ZX6A 5DO8A 3QPZA 4KGJA 3NEHA 5CEWA 5M03A 3TXVA 1XR2A 3HG5A 3UZJA 2OKTA 4W5ZA 5HAOA 3G2GA 3HGJA 1A53A 4OOUA 1ISXA 2V38A 4J2MA 1F4HA 1SPQA 4K36A 3W1TA 4WXYA 1MQPA 1D7FA 2O55A 5A2CA 1R86A 1V03A 3N6JA 1ADDA 4EXBA 4IMDA 1W9XA 5A2AA 3H21A 4TV6A 4HJWA 2BOEX 1Q6OA 3WH9A 1J9YA 1FWFC 5CJNA 2CBIA 3R10A 3VABA 5FSEC 1WUEA 4B91A 4NRRA 3P74A 1J0IA 4JYEA 4D6HA 3S5YA 3VA8A 2ACRA 4RDVA 4KIEA 4ACZB 4TIMA 4IP5A 3LERA 2XINA 5FIPA 2X40A 2XIJA 1J10A 3BG9A 4CEUC 3XISA 1KWKA 1B54A 3REQB 3BZGA 2QUMA 3W7EA 1PZ3A 4HYVA 3LZ3A 3H23A 4I9MA 1DXFA 3BSMA 2XGIA 4ZO6A 3UERA 1IXOA 1N55A 3VK5A 4S3DA 5AHLA 3H2NA 5HDRA 3MMDA 5EBAA 4AQLA 4G56A 1Z48A 4A8IA 1LLOA 3FYPA 1WOBA 1R9YA 1DJGA 3K8MA 3E96A 2W91A 2VFGA 1I6NA 4ONVA 2A7RA 2WMIB 1ONXA 3LENA 3TVAA 3PBVA 5E0KA 4O15A 1W1VA 1NOWA 2XFRA 4IMFA 1W56A 3T0TA 1GEHA 1KWGA 5CSYA 3DXIA 5C55A 3V5CA 4MFDA 4GINA 2QDDA 4DO6A 2VEFA 3N2MA 4PMDA 3AZTA 4NY2A 3QHMA 2YLLA 4W7UA 1GVEA 3L4UA 3IS4A 4UTWA 2IKJA 2OOGA 4H7CA 1K9FA 1GJPA 2ICSA 4EIVA 5I3KA 1OADA 4U2YA 1Y7VA 4K2SA 2XGZA 3UESA 1GZGA 3RCNA 1UA3A 3OGSA 4YNGA 1B5TA 4NU7A 1GPWA 3B8SA 3BAKA 1R5YA 1V02A 1P0NA 5CSSA 2PDIA 2CLKA 3WLQA 4LVBA 4HKPA 2CZ5A 2IS7A 3A5VA 3NQDA 3C56A 1HKMA 2V3EA 1TZ7A 2EPMX 3GHUA 3LHZA 4AIEA 5FSDC 3M0XA 4H6RA 1XX1A 4F3HA 1EC9A 2QCDA 4MM1A 3L23A 1XLCA 3QV8A 4J40A 5DRCA 2G8ZA 4QAWA 1BFNA 3TYUA 2ZUMA 2YPIA 2VO5A 5CPOA 3OBKA 3ZSTA 2C6QA 1AK5A 5AC6A 2PDMA 3ITXA 3MV11 1KD0A 2QVHA 1L6SA 3V0TA 1LZOA 2Y61A 1UIPA 3U48A 4DX3A 5HMFA 1FH9A 3M4HA 3W24A 3REQA 1KBBA 4PEEA 1QVBA 2QUUA 4KERA 4YCPA 1NOFA 3C61A 4Y96A 4PMJA 3PG9A 1JCXA 2YCLA 2GZXA 3AYSA 3NFUA 3OVQA 4MKVA 2J4GA 3MP5A 3ZR4A 3N2BA 1XGEA 1E9IA 1C29A 4M81A 1E55A 2O56A 4G7EA 4CD6A 1HJVA 1P0EA 3CPRA 1W1YA 3MYOA 5FJUA 3BL3A 2P3ZA 4C6NA 1NFPA 4XSLA 3R12A 1IWBA 1DYSA 5GQBA 1I2PA 4TX9A 4AHQA 1YPXA 3UZWA 4RDYA 2AQWA 1EJTC 2PSNA 3N19B 1ZU8A 4QG8A 2WNZA 3NEVA 1WZLA 1V7YA 1QNRA 1WDQA 4QS6A 4DJEA 5LGZA 4AVFA 1UWAA 2IPJA 2ZWZA 4LJ3A 1YXCA 2E5DA 2E8ZA 3WUEA 1ADSA 1P1MA 1ME9A 3NZRA 3FNDA 2ZTJA 4ZO9A 3C86A 3KW3A 3S46A 4IQEA 4CCCA 2B7QA 5EA9A 4WKFA 5D2VA 1V3IA 4Y6GA 3TKFA 5LNSA 1F6KA 4MZYA 3MDUA 2VKZG 1G7UA 4WIWA 3PWIA 4B4HA 1R3RA 5BMWA 1NWTA 2A4AA 1J96A 2C1HA 3VNKA 1NJJA 3M47A 1EOMA 4ZQPA 2DZWA 1JI1A 3AZSA 1RZMA 2J24A 1CEOA 2RJGA 3ZLGA 3R25A 2DVXA 4A8NA 4W87A 4CQAA 2GGJA 1XLFA 3NZGA 4MWAE 1Q6QA 4KFOA 2ZXAA 3ZM8A 1VFHA 1V3MA 5AC4A 1IHIA 1TREA 1AQMA 3FDKA 4NYUA 3LMYA 1UH3A 3DC8A 3IIPA 1EBHA 4AY8A 3U7VA 1GYMA 3WLIA 4JS3A 1GOQA 3W2JA 4N42A 1TG7A 2PD9A 2J7HA 3WEOA 3T2PA 4E6MA 4C6CA 3VD4A 1CECA 5BZAA 4MKNA 4GBUA 4NZ5A 1ZGDA 2O9PA 4K39A 3ORWA 1W17A 4EX4A 4I3GA 5G5IA 5CH9A 1OFRA 1W9BM 4C1KA 2PUZA 3G18A 1KBIA 5BRPA 3C8NA 2Y7FA 3RRXA 1V0LA 4OV9A 2DZTA 3V7PA 1B9ZA 3RN6A 4Q8PA 4RDWA 3RITA 1F9CA 3URQA 2BASA 4JQ3A 2FPYA 1M01A 1WPCA 1L8PA 1QPQA 1TTPA 4XZHA 3JR2A 1XGDA 3GXIA 3IJ8A 2QAFA 4IHCA 1Q45A 3QLLA 3WYZA 3FAXA 1W3HA 2D2GA 2BXYA 3RIKA 3G3MA 2ZUVA 2C1GA 1SZGA 1CXIA 1MUMA 5HJYA 2FFIA 3VIKA 1C9WA 4A05A 3CM4A 3WLJA 4U5IA 2WO5A 1MI3A 3PSVA 2WMKA 4WOQA 4AWEA 2E09A 1D8CA 1DL3A 3NZQA 2EPKX 1QO5A 3S9YA 2HCVA 3T1GA 3TZNA 3PZNA 1EJXC 5RUBA 4LANA 5GNYA 4PRWA 1V77A 3FHQA 2DT2A 2EXOA 1MMFA 1XWYA 1OF6A 2V3FA 3GNXA 3T2OA 3CV6A 4KWOA 4YVPA 4ZGYA 1CGYA 4MZ8A 4PFMA 1KV8A 3SUTA 4KCVA 2QZRA 1SJAA 3BDKA 2Z7KA 3O2LA 1LBMA 4ICNA 5CG0A 4IX2A 3DN5A 2C7FA 3PANA 1X1NA 4JTQA 1MQQA 3W72A 4LYQA 3ITOA 1W5NA 3AUOA 2Z0IA 1CLXA 3TH6A 4C6BA 1YXYA 3BJSA 5ABFB 3AXMA 4ZFCA 5IM51 2Y24A 5F2IA 3VNDA 4I9JA 2ZC8A 3DECA 2V2HA 4DWDA 3ELFA 1C93A 3OOQA 3EB2A 1EJRC 3G3DA 2PP1A 4DN1A 3EMQA 3UZ5A 3FEQA 4UXDA 4WY0B 3G1RA 4X63A 1ECEA 3LCHA 4UFMA 4GABA 2XDFA 1GVYA 3GZAA 2WLZA 8A3HA 3L68A 3AMLA 4RPPA 1XRSA 4W84A 3N25A 1Q8JA 7ODCA 4ZA0A 5C2CA 5A6KA 3TW7A 3T4WA 1K9DA 5EPDA 3TC3A 1BVZA 1J2BA 1GOKA 3EX1A 1XXXA 2DJLA 1OGGA 1A3HA 5DMLA 4LBUA 3F5KA 3HQPA 1W1ZA 4CNNA 4HCLA 4J7RA 4Z17A 2G97A 1JPKA 3E5PA 4FNQA 4PTDA 1AA1B 1CWYA 4IPPA 2KX9A 2XIIA 4IJRA 1TPDA 3FA5A 5K9DA 3UQNA 1EP3A 3W28A 2YCJA 1XM3A 2DIJA 3UPMA 4ML9A 1GW9A 2V82A 1DQUA 1PWLA 3LUTA 3IV8A 4JN7A 4X0NA 2O9OA 4CVUA 3S6TA 3W7HA 3AHVA 3TN4A 3NGFA 2BBFA 5BOOA 4GJ1A 3RRAA 4HHLA 3LMZA 5A6BD 3URNA 4JNMA 2VX7A 3TW9A 1TMQA 3W7NA 3ITVA 4HZ8A 2OOFA 3DYPA 3FLUA 2HEJA 5GVJA 2PTZA 1R2TA 2TYSA 4K6AA 2YX0A 1A3WA 4DQWA 4GCAA 2G3FA 2FGZA 4JR5A 4ZODA 2CC0A 1WQ5A 1DIDA 5LA1A 4ADUA 2VZUA 3WMBA 4LNYA 4JTUA 5L9FA 1M6JA 1W3KA 1P6BA 3B06A 2OZ0A 1N82A 4KPLA 1Y5WA 3L2MA 3U5UA 1YPIA 3BSGA 3B05A 4UTIA 1TX0A 4KFNA 3S9ZA 2WSPA 3T2QA 1W9VA 3NDOA 1EP2A 2CKRA 4LGXA 1W32A 4WDUA 3VC6A 1Z6KA 1VJIA 3FA3A 3MO4A 1UWSA 3GC2A 3S8HA 4XWUA 1CB2A 1BXCA 4A3RA 4L56A 3PZIA 1QNSA 2XJ7A 1R6WA 1WYIA 3F4WA 3LCWA 7ENLA 5GNXA 3ZWTA 3DX5A 3W53A 1KCXA 2C8NA 2NUXA 2QQ6A 1MFVA 5HUOA 2OB3A 3T08A 4LAMA 2D0FA 4E5TA 4MUPA 3ME3A 1VEOA 3NCOA 2XN0A 3MZ2A 4I5RA 1H2JA 4GY7A 4ZR8A 4DBWA 5HWJA 2QMKA 3LM7A 3STFA 3B04A 5HMEA 4JY8A 4OKDA 4H6EA 5E0FA 4DEFA 2F2HA 2GQAA 3VNIA 1WDRA 3HTWA 1F6PA 2CIPA 3W22A 4KWUA 1RBOB 3NL3A 4HA1A 3ARVA 3PZVA 3CZKA 2YKKA 1XLLA 3PPHA 5DANA 3MT1A 3W7IA 3WL1A 2NQZA 1ZAIA 3AZRA 4O17A 4FF7A 2HRWA 1SU5A 3QPYA 3BLPX 1W8GA 1CBGA 1H11A 2YDAA 3V0UA 1YHTA 5G2WA 1EEXA 1U5HA 4S3BA 1OFEA 1KBJA 2Y8UA 3ZLFA 2ZICA 4JD4A 5DCDA 3Q37A 5DX7A 1LQAA 1DIKA 1QOPA 3VZYA 5BXPA 2YL9A 1XKYA 3W23A 2FQIA 5E6YA 3NSNA 3OVRA 3GFYA 3O15A 2PBGA 3GNPA 3TOPA 1GVIA 3RU8X 3TEVA 5A6AA 3NDYA 1R7OA 4AH7A 5EMYA 3FJLA 4ZBCA 1TJ0A 1K9EA 1XCWA 3VOJA 3M0LA 2AQVA 1WAWA 3WMCA 3TLLA 4Q8UA 2NVAA 3TWBA 3KAOA 3QHNA 3LCGA 4Z2IA 1IT0A 5XIMA 4XZ9A 1RA5A 3TN6A 2DSZA 3KOXA 5BOFA 3M43A 4C6LA 1NDZA 3TJ4A 1OK4A 3QFWA 2QJIA 1SZFA 1P0KA 3ZOAA 4C1NB 1QI2A 5EBUA 3MKKA 4TR9A 1CLVA 5A8PA 4ERIA 1TPFA 1IF2A 3BGJA 3J7HA 4LUTA 2WWDA 3ATYA 1IGWA 1TR9A 2VUNA 1R7AA 4Z2LA 2CXGA 4CNPA 1VBHA 2A3LA 2ZZ2A 4H04A 4KWVA 4EKJA 3QR1A 4AXKA 4M6VA 5D33A 1E4NA 1LT7A 3RX3A 3SW6A 3O3RA 1A0CA 4F9JA 3H2OA 4JICA 3OGRA 5I5RA 4MB3A 1X98A 1EEPA 4LV4A 4GNJA 3VNMA 1KFWA 1WDSA 3LBOA 3OIXA 1AH4A 2JF6A 4UNLA 3MI6A 3TOYA 1UD3A 2PURA 1V7AA 1O5QA 5HJXA 5FJIA 1KRAC 3MJYA 4A2SA 2C79A 1DP0A 5CAHA 2EJ1A 5CZKA 1LTDA 1V4YA 4B9YA 1TWSA 3QZ6A 3WD1A 1XLMA 4H6KA 4XO6A 4QM1A 1D3GA 3T42A 2HXUA 4C6PA 3HF3A 3WNNA 1AODA 1E0WA 2FZMA 3N29A 4MADA 1JF6A 5M2FX 2RDTA 1IEVA 3OYZA 3FGCA 1D2KA 1VENA 3C4UA 5FEPA 1BHGA 3TYEA 2BLEA 1FWDC 3LPPA 3VDCA 3CZLA 3PR2A 4UQCA 2W79A 2XGBA 5I78A 1O1ZA 4GVIA 4JEJA 4C1NA 2JIWA 5PTDA 2HPIA 1OYBA 4PCTA 2RFGA 3LHVA 3MSRA 1ZL1A 1RXOB 1XDJA 3KVMA 2D1ZA 3ZLHA 2DZXA 3MVIA 4ASTA 1W1PA 1ZAJA 4BKNA 3EMZA 5CC6A 2XVLA 4UZUA 3N4FA 1XIBA 1XIDA 1PVNA 4WXZA 2TODA 3EXTA 4OTKA 3L2IA 4H8VA 4PMYA 1EHAA 2WJZA 3GDRA 2PRLA 3SFKA 5F1UA 2IMRA 4R7WA 1FWSA 4N9DA 2QVNA 3JS3A 4M29A 3I65A 1BSLA 1JAKA 3A9BA 4ROPA 3WK2A 2UY2A 2ZC1A 4PMZA 1JPDX 2XPKA 3THAA 3C52A 1M7XA 1F61A 1TE6A 5L6UA 3OQEA 3C0JA 3IEBA 2VI0A 2D0GA 6TAAA 1H7PA 1P0BA 4B5TA 1DQWA 1LUCA 4LRSA 4ADSA 3LG3A 3I7SA 4H8NA 3PNZA 5JBEA 4DY1A 1PJ9A 2OGYA 4G9PA 1LWHA 4KWWA 1HO1A 4UUIA 3B8WA 3P67A 3ABRA 3PJUA 3WLSA 2ZZ6A 5LA0A 1TMLA 3CMGA 3BUVA 2X1SA 1B3ZA 2J7CA 1TA3A 1F3WA 1W91A 1QNQA 3UP8A 3SCNA 3SJNA 1GZJA 2NLYA 4PGLA 1JZ2A 1EDGA 2B0MA 3GW0A 3JZEA 4QAIA 4X9SA 3VGGA 3UWWA 4XBJA 2E5BA 2CHOA 3BW4A 4ZFMA 1JUBA 4O53A 2W27A 4UFIA 4GWEA 5HWNA 1DVJA 4M82A 5IOBA 2WYSA 3UWUA 2QT3A 1VPYA 5AYIA 1QPKA 4F0KA 1AW2A 1QI0A 2A79A 1H41A 6XIAA 1VPXA 2Z6IA 4GFSA 1DIOA 4HTYA 3M5YA 4QCEA 1SW3A 3ONBA 1JZ7A 4IPNB 4M6PA 2WJEA 3E1F1 3UZZA 2EEXA 1QCWA 3TFCA 3L12A 1WDWA 2BOFX 1GQNA 2WZMA 1O68A 3LHUA 1VCVA 5IFTA 1C8VA 1XSJA 3DYOA 5A6LA 2OLHA 4MJ2A 4NZFA 4HA4A 4FOJA 3TTQA 3L2LA 4U5KA 1CENA 1PO9A 4ZO7A 1XBXA 1QNOA 3LHYA 2VD8A 1XD1A 5MKGB 3BMWA 3U2ZA 1UZHA 2XM2A 3UCDA 1P5BA 1P6CA 5HINA 2HBXA 3GYCA 1VKFA 4L61A 2X1UA 3WJWA 5F2LA 4RW5A 4GUIA 1XJBA 4LCRA 2XIOA 5D9PA 2ZUUA 1NARA 3SECA 3LA4A 4IMEA 3U6WA 1DKWA 1EWDA 4NIRA 1LG2A 3UBPC 4JOMA 2XISA 1O4UA 2OT0A 4GYPA 2GJPA 1DJYA 3P6LA 1XIIA 2BMBA 1QRQA 2ZUTA 4Y9MA 3BLIA 3PY2A 4F48A 3GHSA 3MJMA 3TTEA 1JL8A 1GCYA 1ZENA 1ME7A 4HMEA 2I16A 1GGOA 1WKFA 2V3DA 1A4LA 3SCWA 3FSUA 3NQFA 2E28A 2QJHA 3BH4A 4PBGA 2OMAA 4UTWC 1YDVA 1JXJA 2PLJA 2EPOA 5KETA 4Q8NA 3M07A 3FDGA 1PS9A 3UGRA 2ZE3A 4WCJA 4RUBA 2DSKA 3LPGA 2FH6A 1I75A 3CUIA 3C2EA 4MDPA 1DTUA 3LRMA 5FACA 4DUOA 1HP5A 4Z1AA 1IV8A 5JH1A 4YTTA 4Q8WA 2H3DA 2CLOA 3NYDA 1IXQA 1U2YA 3RM4A 1JPHA 3ITYA 2GYIA 1SO4A 2HXTA 1UKSA 1CCWB 3KRUA 4NT0A 1E5NA 4L6OA 4ZTXA 3BLFA 4J9JA 2X1TA 1G94A 2ZRVA 3EPOA 3MMUA 4XAYA 1IEQA 3SI9A 1KCKA 1U30A 1K4HA 3WF3A 2TRSA 3BCJA 5D03A 3WDJA 5F2GA 1E4LA 4L6HA 2ZZ1A 1E6XM 4ATWA 2PWUA 3MCMA 4F40A 2BVWA 3VIOA 3WDIA 1AMYA 1GYLA 1QHPA 1RD5A 4ZQMA 4ZXOA 1TRIA 4E3TA 3PWAA 2H8ZA 5CJMA 2Z29A 1GOWA 1TV8A 2NQJA 2PLKA 2QEZA 3DH7A 3NR0A 4P7OA 1KKOA 4W7VA 3T81A 4OBSA 1HJXA 1H1NA 2IPFA 1UC5A 4OV4A 5C70A 3VTRA 1UBPC 2J78A 2PI6A 4HNTA 5HWMA 3S5NA 2QV4A 2WHKA 1RJRA 3SGGA 2QJNA 2OQLA 1GKRA 4B5VA 1JZ5A 5CPTA 4JTCA 1LBLA 2QPXA 3R1ZA 1DJWA 4RXGA 3QW4B 3CV7A 2VC5A 1H60A 4FXFA 3C6CA 3MU7A 4CN1A 1E6SM 2QIIA 4DJEC 1HNYA 4Z0JA 5BMXA 5G4WA 3E49A 2BXZA 4ICCX 1GVFA 9XIAA 5HNRA 4CQCA 1ISYA 1R87A 4P8UA 4KWSA 2FVMA 2VEIA 3JZUA 1OZQA 1R2SA 3TMQA 3IWPA 1K7XA 3R0KA 4PODA 3FHAA 4JFWA 1H0GA 3TV8A 3IVSA 1M1BA 2ZRUA 4U31A 4F4RA 3CIWA 3NYZA 4PUMA 1X8FA 2AAAA 2WB5A 3SCRA 3PFMA 4ILSA 1G1YA 4TTUA 2DIKA 4NXKA 3WD3A 4Q4RA 2CZDA 4C90A 5LSMA 3BAJA 3A47A 3MS8A 4AFYA 1F8MA 1Q7MA 3AIEA 3ALGA 1PX4A 1W3NA 1S2CA 4FS9A 4HQVA 2ISDA 4ZXLA 3PN8A 1BYBA 5DBUA 3M7WA 3NNTA 4C6QA 3ARSA 1G01A 1XLAA 3B97A 3RX4A 3STCA 3N04A 1TIMA 3VVGA 4Q6XA 5CC7A 5D2WA 4NKCA 4PB3A 1EZWA 2FTWA 5F4SA 4O12A 3EMCA 2B81A 2FKPA 4D6CA 4WY0F 7XIMA 2F8QA 4QEEA 4XB3A 5AC5A 3HV9A 1XDLA 3BMVA 1PKNA 2ONEA 2VENA 2C18A 4PUWA 2VZTA 3UVIA 3H55A 3B40A 1S2UA 1S5NA 3ANYA 3B03A 3WQFA 1DJHA 1TCDA 3CMFA 3RLVA 3OQ8A 2VC6A 3CZEA 1O60A 1AZ1A 1GUVA 1I9CB 4B4FA 4UTTA 2CERA 5C9WA 1LBFA 3U3HA 4GX9A 5FEWA 2OSYA 4O8RA 3GX9A 5AYZA 3RGTA 1F4AA 2Y4SA 1HGWA 2OU4A 4BS0A 4IXHA 4B3ZA 1JCNA 1YNQA 1JULA 3OPSA 2J79A 3QBUA 4A8LA 1PKLA 3SM0A 4UB9A 3E02A 4IIGA 3W7MA 4MZ1A 4MYXA 2FPTA 1OYCA 1QOXA 1I45A 3V4BA 4K3ZA 5SWUA 2O7SA 3P14A 1TX2A 3VDGA 3W38A 4EXAA 4IM4A 3LHTA 3QHOA 4ZEPA 3OLEA 1DIEA 3CUZA 1UR4A 4NL1A 3MB9A 4AB4A 4OWGA 4AC7C 4M7TA 4XTIA 3INPA 2BHYA 3O06A 3G0SA 4K38A 1Q4NX 5K9XA 3W37A 3WQVA 3TX9A 3L5MA 2ISWA 1UD8A 4M19A 2V0TA 2WZEA 5ECUA 1NM9A 4XIMA 3LSBA 3NPWA 1B3VA 4PMVA 1MDRA 4GA8A 4FXRA 6REQB 4S1FA 3N9KA 1KR1A 5GNZA 4MF4A 3V1PA 1W1B1 4GQQA 3A12A 3VNYA 2GK1B 4GFIA 4DYJA 1CX9A 3VKJA 2XIMA 3OGVA 4G6CA 4M51A 2QV5A 3OIHA 3WLTA 4MNJA 4WVXA 3W7QA 4AMCA 1XBYA 5FF7A 5EB8A 3B9OA 1EYWA 1V6UA 1YDYA 3PZUA 2PWHA 2ANUA 4DLMA 4HU8A 5LNUA 1A47A 3U7BA 4UNIA 2Q09A 3QQ0A 4FLQA 3W7LA 4Y9AA 3M6YA 4H00A 2PDJA 3B8TA 5I03A 3N1AA 4Y9PA 4QNEA 3GO2A 2ZADA 1S1PA 4DJED 2FYMA 1XPGA 3R2GA 2VR2A 3PNUA 5GJMA 3W3OA 1Q63A 4JEQA 1XYZA 3WK3A 4GG9A 4ZL1A 3CQJA 3NPXA 3TE9A 3K1DA 3WQDA 3S0CA 3ABXA 2YL8A 4DZIA 3VX1A 2IKHA 3BOLA 2FVKA 1YBQA 2INZA 2C19A 2P3EA 3AHYA 4E4FA 3NSXA 1V3HA 5E9AA 3GR7A 3KWSA 3GC4A 1V6WA 4HK6A 4ZOEA 2ZUNA 3MMWA 3WJXA 1TSIA 4H8UA 4LU0A 4LALA 2FVLA 3S5OA 1M41A 1TWZA 3L4WA 1RBLA 3GVWA 3G0UA 3MQTA 1T5AA 4DAFA 2OZ3A 2ZCGA 4GO8A 3FIGA 3URBA 4NAEB 2QUNA 2F9RA 1JZ6A 1RQEA 1VR6A 1T0OA 2XSXA 3D46A 4HOWA 1L6YA 4AIOA 3LN3A 5ABHA 2YA1A 2I57A 3FYOA 3NURA 3PB2A 3SSJA 2WWCA 3BGAA 1WXZA 2NXHA 3N2TA 5KEZA 6REQA 3F4NA 1W3LA 4YN5A 3M0ZA 3ZS4A 4O0QA 2QAPA 2OG9A 4QX4A 1A5SA 3FAWA 4GUHA 4R88A 3UG8A 1Q5MA 1XS2A 3AMGA 1UHVA 3T55A 3THUA 1RK6A 1ZALA 2XZ9A 4L4MA 2VCAA 2YXGA 3WQ8A 2QCFA 4EPKA 1RA0A 3PUDA 5I77A 2VWSA 4EE9A 3ZXWA 5IHSA 3P0XA 3ZR5A 5D38A 3O0FA 4HYRA 2J88A 2CEQA 2VVNA 2WVTA 2J8GA 1HVQA 3KEHA 1OVDA 2UZ9A 4XKYA 1C90A 3BW2A 1MUCA 2PE4A 1NF7A 3ARXA 2R94A 1QUMA 3CIXA 3EDEA 2WHJA 4REQB 2MUCA 2GVEA 4HK5A 1ECQA 5KITA 1GOIA 4D1IA 1S2AA 4IIHA 2YFOA 4OT7A 3D6NA 1K1DA 3ALFA 3VIFA 2Z1VA 2V2CA 4XQ6A 4Q7BA 4IJCA 2QGHA 3VIGA 1WKYA 1VIZA 4KGLA 2I9EA 3W25A 4LEQA 3KX6A 3SN4A 2NQLA 2I5QA 2A7PA 1KM1A 1BYDA 4PL2A 3H7RA 3SRDA 3ZT6A 1KV5A 4C7GA 4HMNA 1G69A 3O16A 3I10A 3NQ2A 3O6DA 1BQCA 3QMTA 3NPVA 4D6IA 2IQ0A 2WKJA 3GAKA 1EBGA 2L5HA 1WNOA 2Q8ZA 4W8AA 1TR1A 1DQXA 1TWWA 3RG6A 3VILA 1JDFA 2BHUA 4F0SA 2ZQ0A 3CS2A 1HN1A 5DMYA 1GT8A 3GTIA 2J66A 3I7RA 3DFPA 2VZOA 2RGMA 3VNZA 3VMOA 2NQ9A 3MYPA 1NQKA 1JYXA 1E3ZA 2B4GA 1WB0A 4NAFB 3BLLA 5AYYA 3CU2A 2HVMA 4MY8A 2VEKA 3CHFA 1TZZA 1N8WA 1Y5VA 3ICJA 4AC1X 3FS2A 3MY9A 2HBVA 2BVYA 4DHGA 4NJGA 4EPDC 1JAEA 3GHRA 1N8IA 1QK2A 2A21A 3HPSA 4RE3A 4CQDA 2PDKA 4O1EA 3MWAA 2I7GA 3R58A 2QF7A 2DPEA 3NGJA 4HT3A 3UFYA 6XIMA 3KRBA 1IZCA 4IGMA 3C0SA 4NX0A 1OB0A 3AS2A 3USZA 2VURA 3NZPA 2X2YA 4INFA 3GKFA 2B31A 3M44A 2FMNA 3DGRA 5IFPA 4TO8A 1VPQA 3LD5A 2VRKA 2ZA2A 3UWQA 4JYFA 4XD5A 1RK5A 1S3HA 5I24A 1KNWA 2E0PA 3W00A 4ZMGA 2OODA 3E5BA 3R94A 5H1WA 1DPMA 3WQOA 2V63A 2JKAA 1E9YB 1VH7A 1EJ7L 2VWTA 2Y1HA 3AIUA 3PUGA 2DZPA 4MG4A 4AW7A 3NM3A 3GAYA 1KM6A 3V35A 4NNCA 4MDOA 4ZB0A 3KL5A 3AROA 1EFZA 3S5SA 2GOKA 3U57A 3OA5A 3MVTA 1XFCA 3E12A 4D6EA 3HB9A 5LZLA 3NWRA 1R9XA 2I14A 3EAUA 3R11A 4GVHA 4UFJA 1UZ4A 2OZ8A 3FFSA 5FJTA 3WY1A 1CXFA 4XUGA 3QQWA 3VINA 4XD6A 1I2OA 3GWQA 3HIJA 1EGVA 1JDCA 4HPXA 4DXVA 4LUIA 2CU0A 1GQLA 3G1HA 4KMQA 1T8XA 2GLKA 1J12A 4GH3A 4O1DA 5CG7A 4LUSA 4M3PA 1U5JA 5JH2A 1FWTA 4XVEA 5F4XA 1M68A 1Z7AA 2P8BA 3S2MA 1SZNA 4F0MA 4WEVX 4J3UA 3DFHA 3H26A 4I5UA 2VX6A 3O6CA 1PUDA 2O92A 3F4DA 4DLFA 3GG0A 1Q6RA 2AOSA 2QCNA 2OYKA 3MBDA 2QCEA 3CTTA 2VOTA 1TTJA 4GI8A 2ZRWA 1SW7A 4FOKA 3A4JA 2VX4A 3ITLA 5A6JA 4R7JA 3T0BA 4GD0A 4JYDA 4IUGA 2DY3A 4F2BA 1H5YA 3M7SA 2I9UA 1KKRA 1XGZA 1O7AA 3AMKA 1FWNA 1OBAA 3W6YA 1V6YA 3AALA 1QNVA 3H7UA 3EDDA 3WLNA 3PULA 4GOAA 3W7OA 1A5AA 1GHSA 2DSUA 3WNPA 1AH0A 5DY2A 2UBPC 1PDZA 3R8GA 2GJLA 4Q8MA 1JUKA 1L2UA 1UR1A 3GNDA 3TYCA 1AH3A 1TVLA 2CLPA 4RLIA 5HMDA 2NWRA 3HG4A 4QQ3A 1DOSA 4GUFA 4OQVA 3HU7A 2B7NA 1V0NA 3GB6A 2DZBA 2YYUA 3OG3A 1QMLA 3VD5A 2J7DA 3ARWA 1PL9A 3I6EA 2X09A 4CCZA 1JI2A 1EJUC 3O8AA 4AHPA 2OFJA 1WXJA 1RSCA 2CBUA 4FLRA 1LG1A 2A7NA 3KCOA 3AIWA 3JUGA 3SGUA 3QZAA 3OBEA 4E8GA 4GE8A 1PDYA 8XIAA 1K9TA 5LIXX 4YPJA 4QE1A 2P0OA 4GI6A 1S38A 4GISA 3VCCA 3W26A 1YYAA 1AD4A 2MNRA 2X0HA 3K8LA 3UWVA 1W9UA 1UA7A 3R7MA 3ABOA 3TC6A 3IJLA 3UG3A 1CZ1A 4B90A 2GSEA 4R5EA 5CZ0A 3CH9A 3BSHA 4PMXA 2W62A 1FDYA 3CUGA 3SCOA 2ESCA 3O63A 1SGJA 2XUCA 4HYWA 3A3XA 3KDOA 2NSOA 3S2JA 1KFLA 4O1AA 2ZVRA 5FAGA 2C0AA 5TF0A 3ERPA 2P76A 3IJ6A 1ZY9A 4Q8OA 3H24A 2YA2A 4PB4A 3HBLA 1XICA 1EJSC 1LOLA 3DYMA 3WX7A 3PF3A 2CKSA 4C1LA 2G4JA 3NAVA 2FHBA 1O12A 4JQ4A 1CGVA 4OJYA 2PS2A 3N4EA 3MP4A 4NZ4A 4DO4A 2O7QA 4RW3A 2W6RA 3QQ1A 3T8QA 3WK0A 3TLQA 1PHWA 3U2CA 1SMDA 1O66A 3DEQA 3L4TA 1US3A 2ZZ4A 5FF2A 4E4PA 1GPFA 1FHLA 1RBAA 4GJIA 3AXIA 1OCNA 2PDLA 3E9AA 1RPXA 3C8FA 4QBXA 2C1IA 1EWEA 2YJQA 3VKAA 1O94A 3BOXA 3T40A 3RJYA 3LCIA 1BVNP 3A5FA 3KE0A 4A35A 8RUCA 1HO4A 4WDXA 1SZEA 4O8AA 4IIDA 4GO9A 1LWIA 4MNLA 3CK5A 2A3EA 4N9BA 2VC7A 4PUNA 1W31A 4V2XA 3IJ9A 1OT2A 4PE8A 3PS7A 3PJWA 1J2WA 3ZVHA 1UROA 4JY9A 2PDUA 5DQPA 1C8QA 3AMCA 3IACA 4O11A 3WQ5A 4LAKA 3D3AA 4GQGA 4LAOA 3S4TA 3LBCA 1TJ1A 3RM9A 1KGWA 1EJWC 5ABTA 4HGXA 4TXEA 4O52A 3CQIA 4Q33A 2GUBA 3WBYA 1KO0A 3DC0A 4RZ5A 4XG1A 5F1VA 4PFHA 3DG3A 3HO8A 1BG9A 3W0KA 1HP4A 4GYPC 4GVFA 3W88A 3G5EA 4HMDA 4IPIA 2YIHA 3RMEA 5I00A 3UXLA 1UZDA 3VCNA 3UR5A 3CHDA 4ERAA 1E71M 3VDHA 3H12A 5ECVA 4HBKA 1ICQA 5JBDA 4LVGA 2GGHA 3W6MA 4R85A 3WMLA 2VGFA 1VB9A 3K30A 3CAQA 1FY6A 1G67A 2FGBA 1HKJA 2OTDA 3EOUA 3BG5A 3TAOA 4CQBA 1JPIA 2GVLA 4AZ7A 3P60A 3CT2A 1W9DM 5K4ZA 3E74A 2HS8A 3DOPA 4V1XA 1H7OA 1EJVC 2ZA1A 5D32A 4HCDA 3E2RA 2GQ9A 1UR9A 3BE7A 5A2BA 1W0MA 3WBWA 4HZMA 1POJA 4DJDA 3WH6A 1QDSA 5C2GA 3PP7A 3T0DA 2E6FA 4D71A 3W1QA 1UKTA 5JUVA 2A3CA 2DT0A 4MLJA 3W1UA 7PTDA 3VGHA 4HNOA 1TPUA 1E9LA 3VD3A 2Z24A 4V15A 1XCXA 3BARA 3MSGA 3EX4A 2WBGA 4GY1A 1VGAA 2VNCA 3L67A 3AIRA 2G37A 4I8DA 4EWJA 1FHDA 4AYSA 1FWRA 1VF8A 5TBOA 3EX3A 1QHZA 5A6TC 2YL6A 5A8NA 1W3IA