2TSYA

Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
262
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 91
structure length 262
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1997-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2tsyA00
3L5LA 4M19A 5G2IA 3TFCA 2ZFAA 5DCEA 3CC1A 1QR7A 1YXCA 2CZFA 4TMCA 1MEHA 5LKYA 3VKJA 3EX4A 3PG9A 3W7EA 4WZHA 1UUOA 3H55A 4YWIA 3MW7A 2IQTA 3K30A 3EWBX 1K3UA 1T96A 3O6CA 3W2MA 3HO8A 3OVRA 1JCNA 3KVLA 1SU5A 2E09A 4EIVA 3P5ZA 3UYCA 4A3UA 1B4KA 3F1QA 1GQNA 4OHQA 2ZRXA 4ZQNA 3THAA 4Z1BA 2FB2A 2Y89A 5IBXC 1OFQA 2WNNA 3E02A 4ZQMA 4LC8A 1OYCA 4EOUA 3HGSA 2ZZ1A 3CWOX 4IMCA 1RVGA 3I65A 2PE4A 1RQEA 1EUNA 5GVJA 4MFDA 5LNSA 1A53A 2EKCA 2A5HA 1O95A 2VFIA 4FNTA 1NAL1 2V30A 5G4WA 4QITA 3GZ3A 3TK7A 1GVRA 4ML9A 3W84A 2NZLA 3NL2A 3W9ZA 5HR6A 3G1FA 1YTKA 5CZTA 3TW6A 2C0AA 4W9TA 3RF9A 3R12A 4UFJA 2A6LA 1XC4A 2A21A 3TCEA 4EF9A 4JTLA 1MZHA 3LHWA 1WV2A 1JCMP 1YXYA 4NZFA 3TKFA 3S5NA 5DCDA 3T7VA 1X1ZA 3MI6A 4PL1A 3OA3A 2QR6A 1LOQA 4DF1A 2ATSA 2VFEA 5FEXA 1WBJA 2B7OA 2QJGA 4ZZ9A 2J9YA 1YDOA 3U8GA 1HTIA 1LBLA 3P60A 2YCEA 5HMSA 3HJZA 1VJIA 3WK1A 3QF0A 1AMKA 3RFAA 2AAMA 1JUKA 1WQ5A 1NVMA 1MSSA 3MHFA 2C3ZA 2ZA1A 4PL2A 5LNRA 3SIZA 3W7OA 1AG1O 1I2OA 1X1OA 2FPYA 2I1OA 1XKYA 2VEPA 3GDMA 3W73A 2FQIA 2QAPA 2DZXA 3Q2DA 3VNDA 1SUXA 1SFJA 4K36A 4UXDA 3LCHA 3SW6A 3S5OA 2E6AA 5KMYA 3P74A 2WNZA 2R91A 1ICSA 2NUYA 3BGGA 2FLIA 5C54A 3CIXA 3FJLA 3W7RA 5CGQA 2NV1A 5TQLA 4O10A 3TX9A 1H63A 3L68A 2ABAA 1BTMA 1HG3A 5IM51 1DBTA 3CPRA 3NGJA 3A9IA 3M16A 2C19A 4IPIA 4E2BA 2OMAA 3FYPA 4YCOA 3CU2A 1K8ZA 3LB0A 1Z48A 2VEMA 2NUXA 4IJBA 2VEKA 1FWNA 1OVDA 3P62A 3BARA 3BG5A 2V5LA 1TSIA 2YXGA 3B06A 2W79A 1FWTA 3F4WA 1AL7A 3GLCA 4UFIA 4LTSA 4X22A 3CIWA 3T4CA 3O06A 3DFNA 3SGZA 3O8AA 1DV7A 1JVNA 1QCWA 3TUUA 1H61A 2QUTA 4CNOA 1HO4A 5G5IA 2ZTJA 4IPJA 4RXFA 3TV8A 3PB2A 5I3GA 2NWSA 3W1PA 1UB3A 1H7RA 4AMAA 3W88A 1IF2A 3W7DA 3HGJA 1WOBA 2DU2A 3DU0A 3P67A 5D30A 3NYZA 4JIPA 3MBFA 4UR8A 3W76A 3QM3A 3TQKA 3C56A 4R7JA 1XUZA 4UFLA 2Y88A 3KAOA 3LM7A 2ISSA 2ZRWA 4XQ6A 1SFLA 1YTDA 2QCHA 3EXSA 3TC7A 2FJKA 1KFKA 1NEYA 3EKZA 1VRDA 1JQXA 1SO3A 3C2VA 4ZQOA 5CPNA 2V82A 4FNRA 3GDLA 4BK9A 3HIJA 3LHZA 6ALDA 5AHEA 1E51A 5HULA 4FNQA 3SFKA 2QF7A 3TMLA 3VE7A 4MFEA 2G95A 5F1VA 3B0PA 2Y7FA 3UY7A 1L6YA 3OHIA 3R5EA 3N34A 2H3BA 4MLRA 1IXQA 4N4QA 1MEWA 4MZYA 3FS2A 1RQBA 3O05A 5LZLA 2VFDA 5FF0A 1M5WA 1QPRA 4WUIA 1F05A 4X2RA 2BX7A 1TV5A 3C2EA 2QCFA 1TPUA 4IMFA 3OEXA 3FYOA 3DI0A 2ABBA 3B05A 4LUJA 2OX1A 3MHUA 4R53A 3HG2A 1DJQA 1TPEA 2QJHA 1R2SA 4CCCA 1OFOA 4H6KA 3P61A 3JS3A 4UTJA 4JICA 4AHOA 2CFFA 3G1VA 4DPPA 1SO5A 1FY6A 4Z1AA 3LXCA 1LYXA 3UZJA 2OZ0A 5AHLA 1FCBA 4UTTA 3QQ1A 4A29A 2I14A 3A21A 5EYWA 4DO4A 2EAWA 3HG3A 1JCXA 5D02A 2QCMA 3KX6A 3Q94A 1N7KA 2X16A 4Q32A 3ZFHA 1SSGA 1WXJA 5DBTA 3LHUA 4EVZA 4O53A 1NF0A 4ZL1A 1UUMA 1EX5A 1GOXA 1GVOA 2YX0A 1ZJIA 5CKSA 1KLZA 1ZFJA 2WPBA 4Y9AA 1XDLA 4N6EA 3PBUA 2XFWA 2CLKA 3GX9A 4ZQRA 3W2UA 1OYBA 1W31A 2NV2A 4MOZA 5TBOA 4O17A 1M7OA 1VCGA 3NQFA 3IVTA 5G2WA 1TPH1 4JTEA 1G4EA 1S5WA 3QFEA 5MHBA 3TAOA 5AHFA 3GYEA 1ZNNA 4HNNA 4HPJA 4MYAA 3QSRA 3MYOA 1EWEA 1JR1A 5SWUA 5K2ZA 4FIQA 3NQMA 2BSLA 1JULA 3WK3A 4O28A 4PH6A 2ZRYA 1B57A 4P2VA 1TJPA 1G4SA 1VQTA 3W6YA 2Y7DA 4MPQA 2C1HA 4NNCA 3OVPA 3STGA 3BG3A 3TIMA 5I3IA 1W8SA 2WSYA 4M6VA 2QDGA 3FFSA 2Z6IA 4NJJA 2WSRA 1VC4A 3RMJA 1F2JA 3W74A 4KWWA 3NEVA 4YL2A 4O19A 3GXPA 5L9FA 5IBXA 3WJZA 5K9DA 2ZBTA 2OT1A 4O1CA 5AYXA 2W6RA 3VE9A 2YSWA 3EEGA 3GNNA 1TPFA 3PUOA 4AWTA 5K4ZA 4OGZA 5FI8A 1ALDA 3DFOA 3CB8A 1BWKA 1A50A 3LCLA 3QPYA 2E5CA 1EB3A 5DELA 4IQLA 4LV9A 3EXRA 3KHJA 2DJXA 1O5XA 2VEIA 2WSQA 5T26A 2R14A 1YTEA 4S2CA 1WAUA 2G97A 3L9CA 4N02A 4LNYA 2CZDA 3SGUA 1EP3A 1K7FA 4QJ1A 4BF9A 4OT7A 1VGAA 1H1ZA 3EWWA 4LC6A 3CHVA 4GUIA 5AHNA 1DQWA 2NLIA 4MJMA 1FCUA 1QOQA 1IXNA 4IMGA 2ALDA 1Q6QA 1GYNA 1H60A 1IXOA 3CWNA 3A24A 1F5ZA 3PWAA 4JXCA 3N2MA 5CSSA 1JCYA 1TREA 2V0TA 3W1LA 4TMBA 1X7FA 3DH7A 4O1BA 4S2BA 3TAKA 3PM6A 3L67A 4JY8A 3KOFA 1ME7A 4JTSA 3DXIA 5BMXA 4QQ3A 3T44A 4Z1DA 2LLEA 4ICNA 3UPBA 5HWNA 4AHPA 3L0NA 1F6KA 5CZ0A 2J6XA 3LV5A 1Z42A 1VH7A 3ABSA 1PVNA 4ORMA 1G67A 5C5YA 2ZRUA 3ANYA 1G4PA 1EA0A 2WNQA 5DBUA 4ZQCA 2Y7GA 3R89A 3IIZA 3E49A 3HPZA 2HS8A 3UZ5A 3EXTA 3A5VA 4ALDA 3HB9A 1OABA 1TO3A 2J24A 3FIGA 2WKJA 1KFEA 1TTQA 1L9WA 2DP3A 1KFJA 1H50A 2VENA 1TRIA 3E12A 3T40A 4PCFA 4YLWA 1O60A 1F76A 1UASA 3PBWA 1TTJA 2GQ9A 3M9YA 3RLVA 2D73A 1OJXA 5F4XA 3IIVA 3W7GA 4AVFA 1DL3A 3S5YA 3UQNA 1WYIA 4JR5A 3QJAA 1BWLA 1W3TA 4CQ9A 4L4LA 3W1AA 1VHNA 4N4PA 3IV3A 5D03A 5DXYA 3BPWA 3W2NA 1HL2A 2ISVA 2GUUA 4GFSA 2RDWA 3TC6A 1H7XA 5E93A 2FDSA 5EA9A 4WY0F 3GB6A 5CSRA 2E6FA 2GOUA 1YPIA 3GNDA 5D2TA 2AQWA 4E2DA 4K7YA 2NXIA 2R94A 3M5ZA 1W5OA 3KVMA 3GAYA 3I7SA 4FXRA 1R2RA 2CW6A 2A2IA 4ZQPA 1KFLA 3LOTA 1W5PA 1IGSA 1B4EA 4BWLC 5K9CA 4UUIA 5G1TA 6TIMA 2E5BA 3TE9A 4YXGA 2V5BA 4N9DA 1WOAA 4TIMA 1O94A 1KTBA 3LTYA 4BR1A 1P5BA 3HBLA 4NXSA 3HPXA 1QWGA 1KM0A 2TPSA 1AW2A 3R13A 3TW7A 3WJYA 3W7QA 4O57A 1VCFA 4NZJA 3N2XA 5D2XA 1U83A 5DCBA 3VFLA 1D3GA 3C61A 4Y6GA 4QIUA 3W85A 3OIXA 2JGQA 3M43A 1AW1A 2H90A 4AHQA 4BI6A 3M7WA 3GDTA 5KZEA 3W87A 3LCIA 5D09A 3DHDA 4IX0A 2JK2A 4JEQA 3NZRA 3HF3A 3KVJA 5LGZA 5AFDA 4KFPA 3GKFA 3LCGA 3W7IA 3A22A 2DZWA 1O5KA 1ZENA 4ORIA 5F4SA 1A5SA 3V1PA 4ADUA 2QCNA 4E0CA 4FB7A 1AK5A 4UC5A 2OT0A 3ABQA 3NOEA 3IGUA 2A7RA 1FBAA 1L6SA 3DKLA 1C9DA 3S8HA 2P10A 1V5XA 5D38A 3SR7A 3G3DA 1OX5A 1TRDA 2ZRVA 2DZTA 3KRSA 3L5AA 5G1YA 2VXNA 2W0UA 2CLHA 4AH7A 3W7LA 4DO6A 2E68A 3THQA 2V2DA 4NU7A 3TSDA 4Q33A 2J27A 5AHMA 3EWZA 3BLFA 4EWND 2VC6A 4WJEA 3SSJA 4LVFA 4N2YA 5FF2A 3QH2A 4MYXA 3WJSA 2C16A 3FJ6A 1G4TA 1EUAA 1JCLA 2GJLA 3G8EA 4LW7A 3NQEA 1SPQA 3RLUA 1QO5A 3U6WA 4JDBA 4Z08A 5K7JA 2C6QA 4AXKA 4XZ9A 2TYSA 3NPUA 3KXQA 3TJXA 4GNJA 3VI2A 3PY2A 3STFA 1GG0A 3M6YA 5CPOA 5E1QA 3EWUA 1VYRA 4JS3A 3O07A 3YPIA 1K02A 3TQ0A 1VCVA 4NT0A 1B9BA 1ZAHA 3E96A 4S1FA 5AB3A 2UV8G 2C18A 2CWNA 2BXVA 3A5FA 2H3DA 4TU1A 2X1RA 2R8WA 1SW3A 2Y62A 4X9SA 1XBXA 3TXVA 4O15A 2F7FA 3DFQA 1YLVA 1PV8A 1H7WA 5HUOA 1ME8A 1T8XA 5LNUA 2V2HA 2JBMA 2B0MA 5C2XA 3G1XA 4I7WA 1OK6A 1QMLA 3ZR4A 1ME9A 3IIXA 5D37A 4HN4A 5C55A 2B4GA 1JRBA 1TCDA 3OVQA 1M6JA 4JYEA 4QNWA 4FX7A 3MP4A 7TIMA 3P5YA 4IXHA 1A5AA 1QAPA 1YPFA 3I6RA 3G1AA 1SZNA 3W70A 4QNEA 1X6UA 3LRMA 1TQJA 3TDFA 1TYGA 1TTPA 1QDSA 1XUUA 1LLZA 4MKNA 4N9EA 2EGZA 4XUGA 5A5WA 1XM3A 3S42A 4YCPA 2QUUA 1W0MA 1SO4A 5BOOA 4RZ5A 2YW3A 2A85A 3P82A 1LCOA 2E6YA 3C4UA 3PSVA 1DORA 5HJLA 4UTKA 1THFD 3PR2A 4FF7A 1G69A 1LORA 1EWDA 4FHAA 1GJPA 2E77A 1ICPA 2HMCA 3O6YX 3ZWTA 1J4EA 1IIGA 4JX5A 4GUGA 3M5XA 1J2WA 4WY0B 3UPWA 4O52A 1TPC1 3PUDA 4O14A 4LS1A 3WJXA 4RZ4A 3RNDA 4WY0A 4NXKA 4FNUA 4NNBA 3UWVA 3NL6A 3UWWA 4JTKA 3S0CA 4JX6A 1AL8A 3W7KA 1IXPA 4H4IA 3SJ3A 4TX9A 3F03K 3O15A 3B0VC 1LM1A 1J5TA 2QUVA 3S1VA 3NQAA 3CEUA 1TJRA 2NX3A 1JJKA 3C52A 3W1XA 4JYFA 3QQ0A 3G18A 3NPXA 3MI2A 3PVFA 5DLCA 4UFHA 1W54A 2Z2UA 3TFXA 3PC0A 3W1TA 3ABRA 3CT7A 3FOKA 1UBSA 3BG9A 4LV4A 5HWMA 3EX6A 4LT9A 2DORA 2P0OA 2Y85A 3S1WA 2HS6A 1A5BA 4HNVA 3WJWA 2WJZA 1LLWA 3CEPA 2A7NA 1S5TA 4NJKA 1SZFA 1X8FA 2Y70A 2FFCA 5D2WA 2NX1A 5D33A 1LRQA 3GXNA 4NUWA 1KM6A 4BI7A 2F84A 1LZOA 2H8ZA 2ZYFA 1PIIA 3MYPA 1XDMA 1JCJA 1LBMA 4IXXA 3PBVA 1LTDA 3W3OA 3C2RA 2PURA 1P1XA 3GXTA 4O8RA 3VCRA 3IGSA 3G22A 3PS7A 1OFDA 3NQGA 1KFCA 5TIMA 3N73A 3FKRA 5H91A 2CZEA 4HSOA 3EKLA 5EPDA 3EB2A 4M7SA 3W7PA 4FNPA 4HIBA 1OFEA 2PC4A 1G6CA 5EBUA 5LHEA 3MP3A 4BWLA 3H54A 4RXGA 3N3MA 2BWGA 1WX0A 2NWRA 2WO5A 3HG4A 3UXDA 3S5ZA 2C13A 3NDOA 3NQVA 2H6RA 1OFBA 2RDUA 3GDRA 1T0OA 4R34A 1PCKA 3M1ZA 1LROA 3N9RA 3DENA 3MP5A 1EIXA 3CQ0A 2TMDA 1FQ0A 1QFEA 4XBSA 4GRSA 4MUZA 3EX2A 5F2MA 2CU0A 2TRSA 4FEZA 1SSDA 3RK8A 3BLIA 1RR2A 1MEIA 1S3HA 3LI1A 3W2JA 1VR6A 4O4WA 1WDWA 2X2GA 4O12A 5A8GA 1VHCA 5HWJA 5I3FA 3HG5A 1FDZA 1GG1A 4G1KA 5AC8A 4RR4A 5DXXA 3NQ8A 4CQ8A 1R46A 3QMSA 5HINA 1D9EA 2GVLA 4OV9A 4QISA 4UTWC 3B03A 1L2UA 2JKAA 3NPWA 1VYSX 4DBDA 1Z44A 2BTMA 4U4MA 1XFBA 1NF7A 4TR9A 1H7PA 1W1ZA 1YADA 4WX2A 4RJEA 3LI0A 1DHPA 1GVSA 4HNUA 1F73A 2CLOA 1G7VA 1PS9A 1QNVA 1KM5A 4HNTA 1VZWA 1ZCOA 2ZZ5A 2FTPA 4LVBA 2AGKA 4LRTA 3OG3A 1LP6A 1F74A 2ZCGA 1PHWA 2HSAA 2A6NA 4UNKA 2DZSA 3WK2A 2PRHA 2CLFA 4UMBA 2RFGA 3INPA 3BGJA 2ZZ7A 1SQ7A 3NQ2A 1XL9A 3P8IA 1H7NA 5K4XA 1KM1A 4O54A 3DFTA 2DJLA 1FXQA 2YFNA 3NM1A 4B5NA 3D0CA 3NO5A 2YGYA 4O0KA 1M7PA 3S9YA 4K37A 2JKPA 5FEPA 1LBFA 3KVKA 5FF7A 4KKXA 4QSHA 1W3IA 2QDHA 2E5DA 4QM1A 3W22A 1NFBA 3AJXA 4DF2A 1WBHA 3V75A 3PF3A 2KZHA 4PTNA 1RQHA 4XTIA 2GQ8A 3G1HA 4JN6A 4RZ6A 3NL5A 3LCXA 3NVTA 4UTMA 4MY9A 4HSNA 1K8YA 4I9AA 1KLYA 2ZZ4A 2VFGA 1K03A 4YMZA 3R8RA 3CLMA 5F4WA 3EWYA 1NSJA 3NNTA 1UJPA 2YFOA 3KFTA 3UNDA 3H53A 1KTCA 2V8ZA 4A21A 3UD6A 3P81A 1I4NA 2GPTA 4UTHA 2C14A 1OF8A 1LRTA 1ZY9A 3MWAA 4AWUA 1EP2A 4IMEA 4JTUA 3UXAA 4UMAA 1W5NA 4K39A 3LERA 4FIRA 1TIMA 3G1YA 4WOZA 5AYZA 1K8XA 4JIQA 3LGEA 3TSMA 3UWQA 1SW7A 4LVGA 3N14A 1MO0A 1Q3NA 3GR8A 5EMUA 4O50A 3BV4A 8TIMA 4UTLA 5L6UA 4K8EA 3L5MA 3GDKA 4I7VA 1QPQA 4HT3A 1SO6A 1T99A 3P84A 4AAJA 4OQVA 3SZ8A 1H7OA 3L0KA 2ZZ2A 3LTPA 4O13A 2ISWA 3TA6A 4UFKA 4H3DA 4NQ1A 1H1YA 4ADSA 5F2GA 4RX0A 1I8JA 2A4AA 1OFRA 4POCA 1HFBA 3BLEA 3DI1A 1R2TA 4OE7A 3O16A 2BLEA 4E38A 2PRLA 3JR2A 4UNLA 1DOSA 4NVTA 3OBKA 2NXHA 4HKPA 1XBVA 4DELA 2V81A 3M47A 1UCWA 1G7UA 1VPXA 2HTMA 3G0UA 2NUWA 1YYAA 3NXFA 3QYQA 1FCQA 1GTHA 2QAFA 4LU0A 4IUOA 1XBZA 4FX8A 5FESA 4LOCA 3LV6A 4JTTA 4LS2A 5AOUA 2B7PA 3BK0A 1FDYA 3NQDA 2G5WA 3GIYA 2P1FA 1VLIA 3G8RA 4JYDA 3QMTA 4LUIA 3TROA 3T55A 2Y63A 4O1DA 3DBPA 3QW3A 3ABOA 2QCLA 4K6AA 4OU1A 4R33A 3UWUA 2G96A 4DQWA 1YXDA 1W3NA 3GAKA 2YYUA 2CZ5A 1TB3A 4DPQA 4MZ1A 3G0XA 1EP1A 3LHYA 1KW1A 3T78A 2X1UA 5CG7A 3USBA 2Y61A 4LVDA 4CCDA 5D2VA 3PB0A 3GK0A 4RKAA 2B7NA 1U5JA 2XN1A 5D2YA 3W1QA 2A7PA 2QCEA 5DY3A 1V7YA 5CPLA 1MXSA 3W2KA 2H8XA 1FX6A 1QOPA 4MLJA 3FKKA 2YDAA 1GEQA 2J88A 2YPIA 3LBMA 3LXBA 1HUVA 3O1NA 3S1UA 1FCVA 3IVUA 4U28A 4CNPA 3C3NA 5DN1A 3NQ7A 1TV8A 5FF4A 4MIMA 1RV8A 3W7HA 5AYYA 3IRDA 2NX9A 4O4VA 3HQ1A 4DXVA 5K9XA 4TO8A 2RDTA 1KV8A 3W1MA 1WA3A 4DO5A 2Y7EA 5KZMA 3QRHA 2ZRZA 1XCFA 4EF8A 4XWUA 1FWWA 3W86A 2QCCA 4O1AA 2Q3RA 3G1DA 3NM3A 4Z0SA 1N8FA 4JTFA 2EHHA 3P8JA 1P0KA 4O11A 5AC7A 4QAIA 3DKJA 4NJHA 3QSTA 3EX3A 1KM2A 1GTEA 2WOQA 3BW2A 4IOTA 1SR9A 4JX4A 2EPHA 3L66A 2ZZ6A 3P7YA 3Q58A 4FO4A 3NA8A 4GBUA 1XBYA 3P80A 3TR2A 3CM4A 3G24A 4PA8A 4ZVJA 3C2FA 1GWJA 5KZDA 2C15A 1I2PA 3PULA 2V9DA 2FB3A 3M41A 2VKZG 3W23A 4M5PA 3SECA 3DAQA 2TSYA 3L21A 4XBKA 1CW2A 1P4CA 3M44A 1W56A 4WXYA 3W7CA 3KRZA 4IWWA 1LRNA 4C1LA 3TU9A 3STEA 1IIHA 3LLFA 1B3OA 3LTSA 4Z0JA 2VOMA 4OWGA 5DY2A 2FIQA 4AF0B 5HUPA 3QW4B 1GPWA 1N55A 2RH9A 2NXGA 3W7MA 1Q6OA 5BW6A 1KA9F 3I7RA 5EL1A 2YYTA 1GVQA 4AF0A 1H62A 3N9SA 3LCFA 4UTUA 3R2GA 4WOQA 5AN7A 1LDCA 3C2OA 3LXAA 1F7BA 1LOSA 5BMWA 3NQCA 4PFMA 1VYPX 4FXSA 4OBTA 2X1SA 2QCDB 3QMRA 3TNOA 2J9ZA 2ZDRA 1RD5A 2X1TA 4PODA 2GQAA 2X30A 4UTWA 5LGXA 4GE8A 4M6PA 1W37A 3WFAA 5F2IA 4FX6M 3WK0A 2QCDA 3W83A 4MJZA 1BKSA 5BRBA 1CX9A 5I3JA 2B7QA 2ATMA 4N9BA 2JKEA 2E1DA 4UTIA 2Z6JA 3G1SA 5FEWA 1LOLA 2CLMA 1KTNA 3SI9A 1A5CA 4GWEA 4GJ1A 4P61A 1EPXA 1H5YA 3DFSA 1TMHA 3NPVA 4NJIA 2PCQA 4MY8A 3MUXA 4KFNA 4J9JA 3W2LA 1RPXA 5D32A 2V2CA 3M5YA 3UWYA 1Y0EA 3S1XA 2YZRA 3LDVA 3FLUA 1O4UA 4N9CA 2O7SA 1R30A 3NZ1A 3LHVA 1JRCA 1OG0A 2I9EA 4O18A 3HGOA 1Q45A 5EY5A 4RK8A 3EWXA 5K3VA 4CCEA 2DZPA 3STCA 3UY8A 2J9XA 5CPMA 3L2IA 2FPVA 2QKFA 1Z41A 3PAJA 2JGYA 2Q3OA 3LX9A 3QC3A 1YDNA 4JTJA 5EKYA 3O63A 4WXZA 3MBDA 3I68A 4K38A 3TQVA 4JTIA 2ZA2A 3B8DA 3Q37A 4FNSA 5HNRA 5F2LA 1R47A 1K7XA 4CQAA 3ATZA 3LLDA 3IIOA 3DGRA 1OHLA 4N6FA 4Y90A 3DZ1A 4RV8A 5I3HA 4A2SA 3B0UX 1PHQA 2QEZA 4XKYB 1BEUA 4D2JA 1PL9A 1P0NA 2OCZA 4RLIA 4K8HA 3MI3A 1K7EA 3UWZA 4MZ8A 3N19B 3FA5A 3JRKA 1QO2A 3MHGA 4PEKA 2CLLA 3TXZA 1Q6RA 4XKYA 1GVFA 1GZGA 2DZUA 3S6DA 4DBEA 5LNVA 4UFMA 4KFOA 3TH6A 5J5RA 5G4EA 2QJIA 1OX4B 3BVJA 3ZS4A 3HPSA 3MO7A 1SW0A 2Y6ZA 2Q8ZA 1OFAA 5LSMA 3PG8A 3B04A 3PUEA 1OX4A 3QZEA 5LHFA 4K7VA 1KBJA 2BZNA 2Q8LA 2VFHA 4GUJA 1W5QA 1ML1A 4M6QA 1VS1A 3EX1A 3GKAA 3FEMA 3LBCA 3W07A 2GJNA 1KBIA 1KFBA 2CLIA 4IMDA 3QPZA 3TJLA 1OK4A 2ZA3A 3ZWSA 1TPB1 4JD4A 1L6WA 5J5DA 4AEOA 1FWSA 3BW3A 4WD0A 4Y8FA 2A0NA 4UCGA 3C6CA 5AC6A 3NAVA 3O6DA 1JUBA 4M7TA 3BO9A 4GC4A 5AHIA 4C1KA 5CZJA 3DHFA 1H51A 4HPXA 4LS0A 4GXMA 4LRSA 4O16A 4DF0A 1OX6A 1XXXA 1SZGA 1DKWA 2RKXA 3MJYA 1YDVA 3M0ZA 4JNMA 2XN0A 3LRKA 1C8VA 1HO1A 4NX5A 4DEFA 4JY9A 5U4NA 3W71A 1ZAJA 1PE1A 3DFPA 5U7SA 5HR7A 1ZHAA 5CZSA 1KV5A 2WV8A 2PRMA 3HOJA 3RU6A 3IIPA 5HQEA 2ZZ3A 5D04C 1OF6A 4HHPA 4IGHA 2QCGA 4ZMGA 3W1RA 3C8FA 1I2QA 4LWWA 2YW4A 1JUEA 3IVSA 5F1UA 3TSBA 4JTGA 4BI5A 3ELFA 5KTLA 4X3ZA 3W1NA 2A1YA 5LNWA 3IEBA 1ONRA 1KM3A 1C29A 4WQ6A 3LCWA 4UMCA 4AWSA 3GR7A 1OYAA 4L4MA 4IX2A 4O0ZA 4PC8A 5BNKA 5E0KA 5KITA 2E6DA 3NG3A 2ZQ0A 4ADTA 1FWRA 4KWVA 3HGRA 3F4NA 2EF9A 4A2RA 2Z1BA 4BFAA 4LVAA 4ONVA 3NQ6A 5G2HA 1SZEA 3NR0A 3TMQA 3LHTA 1GYLA 3HMJG 4GUHA 4I7UA 4LY8A 3G0SA 3C0JA 4MY1A 1TTIA 1ZAIA 1QPOA 1XI3A 3LRLA 4NNAA 5FF3A 2O7QA 3GVGA 5C6MA 4RCXA 5ABTA 1ZALA 1TPVA 1Q6LA 4NJGA 1S5VA 3PSWA 3PBYA 2CLEA 1I2RA 4JTHA 2FPTA 3SY5A 3W1UA 1D3HA 2GVGA 1DVJA 1RZMA 1JQVA 3W7JA 3KRUA 1OFPA 2Z0IA 3CTLA 5H2ZA 3E0IA 3B4UA 2WQPA 3NL3A 2OJPA 5D05A 3A23A 3W75A 3MMTA 3AO0A 4MVAA 1GT8A 1AW5A 3W7NA 4Y96A 1FXPA 4XTDA 1VLWA 3I7QA 4JGDA 3G3MA 4UR7A 1TV7A 3U2OA 4UTTC 1TQXA 1ICQA 1FUYA 4CLMA 4AB4A 1TPDA 2DZVA 3QEZA 1KM4A 1EEPA 3E9AA 2XN2A 1FDJA 4A22A 1F6PA 3M5VA 4CNNA 1ADOA 3L65A 2YR1A 5I3KA 3W72A 1DQXA 1CI1A 5KSWA 1I45A 5KINA 1I2NA 2VELA 4GUFA 3L0GA 1W5MA 2GVJA 4JDYA 4Z1CA 4NX0A 3BW4A 2VFFA 4OV4A 4Q4KA 2RHGA 5FEZA 1PCWA 1DJNA 1QPNA 1TPWA 4UIOA 2ZTKA 3IGXA 3ATYA
chains in the Genus database with same CATH superfamily
4WF7A 3QOMA 5LYRA 3A3HA 2ZFAA 3U5UA 4EKJA 1MFVA 5DCEA 3GFYA 2D3LA 4AY7A 4DM1A 4TMCA 1MEHA 2WSKA 3PG9A 4WZHA 1AD1A 4A8LA 3VPLA 1EFZA 2QDEA 3W2MA 1JCNA 4Q7NA 2E09A 2P8CA 1LT8A 2MANA 4AD4A 1XICA 3F1QA 4W5UA 1GQNA 2HBVA 2OKOA 5LIWX 2ZRXA 1PTGA 4QR6A 3O7UA 1O66A 2WNNA 3V18A 4LC8A 4EOUA 5A8QA 3TYCA 2RUSA 4YTUA 2FZBA 1RQEA 4WJXA 4LYKA 1EUNA 1SMDA 4MFDA 4M80A 1A53A 2EKCA 2A5HA 5RUBA 2VEFA 3LPPA 2XPKA 1O95A 4Q4PA 3MU7A 4I5UA 2ZC8A 3TK7A 1UQYA 4XAFA 3DC8A 4IP5A 4AY8A 3TW6A 5CZTA 2C0AA 3VZXA 4C7GA 1W9DM 3VIIA 2A6LA 1RLCL 1XC4A 3S2CA 1XINA 4JTLA 2BASA 1MZHA 2WKGA 1EO7A 1JCMP 1YXYA 3OQ8A 3MI6A 3VD5A 1KWKA 2QR6A 3OBEA 3V16A 3H2EA 4XSMA 2BVTA 1WBJA 3B0YA 4HU8A 2QJGA 2PF8A 4ZZ9A 1PB0A 3Q45A 4A4AA 1IT0A 3GR4A 2SFPA 3TR9A 4F2TA 1JYNA 5HMSA 1VJIA 3GW3A 1AQMA 2AAMA 2NQ9A 1BYBA 3AICA 1NVMA 1A5KC 1VF8A 1PPIA 2ZA1A 4PL2A 2VHLA 3SIZA 4R9XA 1ONWA 4CQBA 1I2OA 2VEPA 2I1OA 1RAKA 2QAPA 2ZX7A 3URQA 3PZ9A 1HXJA 1SFJA 4XO7A 3S5OA 3EEZA 1CPUA 1QOXA 4EPKA 5CXPA 1R87A 1EJVC 4IP4A 3W7RA 2NSOA 2G8ZA 4O10A 1H63A 1O5RA 1KKOA 4JN7A 1BTMA 5IM51 4M1RA 3PN8A 4JIIX 2L5HA 2C19A 1QU4A 4YCOA 1BAGA 3RYSA 3N6JA 4UQ9A 3LB0A 1UKOA 2WWDA 3QZAA 1FWEC 2OB3A 1V4YA 3GH5A 1FWNA 1OVDA 4F4RA 5LA1A 1TSIA 3B06A 1PAMA 2YL6A 1WNOA 3TN6A 2DW6A 3TC3A 3F4WA 3AXHA 3CIWA 2EO7A 1V6YA 2IXUA 3O06A 3TUUA 4XVEA 3VKCA 1RBAA 1GZ1A 4DBUA 1QK0A 2IKIA 3TV8A 4CUCA 3W1PA 5JUVA 4AMAA 3W88A 1R7AA 1P43A 3H2CA 1J0ZA 2MNRA 3HGJA 4ZOAA 2DU2A 2ZOXA 2O4QA 4M24A 3MBFA 3IARA 3Q4DA 2HBXA 4R7JA 3GHUA 1XUZA 4FA3A 2UY3A 2Y88A 3VUPA 3KAOA 4YS1A 3L12A 2ZRWA 3F4VA 4B4FA 3EKZA 3H12A 1OC5A 2Q02A 2V82A 4KEVA 3K46A 3QGAC 2YLAA 2BGNE 3PJUA 3LHZA 2GGJA 1RVKA 1ZP3A 4UR9A 4IL0A 3SFKA 4UWMA 3VE7A 3WQWA 1M9HA 9XIMA 1B3VA 3WDQA 3TJ4A 4H6EA 4NG3A 4WKAA 1TVPA 4GZEA 1OCJA 3K8MA 4N4QA 2X0HA 3AFBA 3FS2A 4DYKA 3B9DA 1RQBA 4F2UA 5FF0A 2HPMA 1QPRA 1TA3B 1XIGA 2BX7A 2FVLA 3ZJ6A 4X0NA 3CQHA 3OEXA 1XYCA 1DIKA 1TA3A 3UZZA 3DERA 1OFOA 3V5OA 1RUSA 3QYSA 3UZJA 5AHLA 3QQ1A 1RJQA 1WDPA 3OGSA 1ZBCA 5C71A 4RE3A 1JCXA 5D02A 2QCMA 4AFYA 3KX6A 4E3TA 1N7KA 1LWJA 3FCPA 3CMJA 1KCZA 5TAOA 1NF0A 1GVOA 2JF6A 3O9NA 1KCLA 2WPBA 1Z89A 3EDJA 1YHTA 1W1A1 5CG0A 3PBUA 3NO3A 2CLKA 4ZQRA 1W31A 3BLKA 4MOZA 1ZLPA 4O17A 1QNSA 5G2WA 1HZYA 4H6QA 1V0NA 4JTEA 5MHBA 1P0EA 3TAOA 4Q6JA 5CC7A 3MYOA 1UQZA 1JR1A 5ABEA 5K2ZA 3H4WA 3SURA 4MPKA 1BD0A 4PH6A 2DIJA 4H9MA 1XRSA 2OWCA 1P0BA 4NZ5A 1I1WA 2ZE0A 1W8SA 1PYFA 2QDGA 3VMPA 1L6FA 3UPMA 1EQCA 3PZOA 4AD1A 4NJJA 1BRLB 1WDRA 1F2JA 3RMJA 3RX4A 3W74A 3NEVA 1I0DA 1TWWA 3WJZA 1HL9A 4JHZA 4O1CA 3IV8A 1BRLA 2W6RA 3L2MA 1UD6A 2YBTA 3GNNA 3K13A 4C6MA 5A8NA 3U7BA 4HCDA 1U1HA 1UH3A 1XP3A 1MQQA 1KXTA 3CB8A 1A4LA 1BWKA 3BLOA 4Q8WA 3LCLA 2POTA 3SUWA 3GH7A 1S5MA 1VFHA 1EB3A 5DELA 4A8NA 4LV9A 1U33A 4KMQA 2DJXA 1NM9A 2VRKA 1XW8A 3ZM8A 3T09A 3WNKA 1S1RA 1YTEA 5B7ZA 4BQ4A 1Q6DA 5M1TA 3RM9A 3SGUA 1EP3A 4GPNA 4OT7A 1H1ZA 5REQB 3CHVA 1KCKA 3QR0A 4PUUA 1QOQA 1IXNA 1RPKA 3WLKX 4YYCA 2ALDA 3GBEA 3CWNA 5REQA 2GSJA 2CBVA 4EANA 2GVEA 1OD8A 1P6WA 3M0IA 1JCYA 1PIGA 4TMBA 4AZ6A 2HK1A 3DH7A 4S2BA 4C6BA 5EBAA 3W28A 5BMXA 3T44A 1F6KA 1Z42A 4DLMA 1ZUAX 2QJMA 3KTCA 1UD8A 1VH7A 4F3HA 3B8IA 3SN1A 4OUIA 4ORMA 1TJ2A 5TNVA 5C5YA 4AD0A 4LPCA 3WX7A 2WMIB 4IIFA 3IIZA 3ORWA 4DZIA 5CC5A 3A5VA 4GBDA 1TO3A 4JTRA 4DJEC 2WMIA 3N11A 3FIGA 3HFTA 1KFEA 4H8UA 3B4YA 3O0FA 4PMUA 1L9WA 2DP3A 2WMKA 1TRIA 5HOSA 3H23A 3RJXA 4GY0A 3WMBA 3NFUA 2D73A 3W7GA 3S5YA 3Q67A 4CKQA 4MNJA 3UQNA 4JR5A 3QJAA 5D9PA 1XLJA 1W3TA 4L4LA 3W1AA 3VM5A 3ARRA 4ZCWA 1U5HA 2YLLA 3IV3A 3DYOA 2PWVA 1CLVA 1HL2A 3VX0A 1WE5A 2ISVA 3EOEA 1T7LA 2FHBA 5EA9A 3WDPP 3KTXA 1E56A 4RE4A 2E6FA 3GNDA 3UG5A 4LYRA 3BOFA 3GHTA 2W4XA 5FL1A 4DWSD 3QY6A 1L2QA 3M5ZA 4GOAA 1IE7C 4HA4A 1W5OA 2FZ8A 2CW6A 3EPOA 3LOTA 1W5PA 2J75A 2YL5A 4MSSA 4BWLC 5G1TA 6TIMA 2GJXB 1DJWA 3TN5A 1QUMA 2CITA 2A3BA 2V5BA 4N9DA 4A8RA 2GJXA 4W7WA 1UD5A 4MMWA 1HGYA 1P5BA 4BCEA 1XIIA 1KM0A 3ZOAA 1XLMA 1OC7A 4GYFA 2E40A 3TW7A 2WVTA 2VZUA 3ITOA 3NEHA 4E3VA 3WNOA 1FH7A 5JBFA 1QNRA 3SEPA 1D3GA 3C61A 3EDKA 3VIGA 4V1YA 4XZHA 5I02A 3TTEA 3KWXA 2NT1A 3ZVHB 2JGQA 3VGHA 1V08A 3M43A 1ODUA 2WZIA 1KBBA 1PDZA 4BI6A 3EZ4A 3O0KA 3GDTA 1K1DA 3LCIA 5D09A 3DHDA 3T8QA 3ZVHA 4KCUA 3NZRA 4XZWA 3W27A 2VUYA 1E55A 3WKZA 3WQFA 4ZENA 5LGZA 1V6UA 1CLKA 3ANVA 3RITA 3W7IA 1OGBA 2HROA 4GQBA 4AZCB 4UZUA 4JZ5A 4C7FA 1AK5A 2OT0A 4JFVA 1YPXA 3AS1A 1C9DA 4AZCA 1EJXC 1ZB5A 3W29A 4IUGA 1V5XA 2IPJA 2ZRVA 2DZTA 4KBXA 2QNEA 3K1DA 1H1NA 4AH7A 3W7LA 2NQ5A 2AL1A 1H0IA 3BLFA 3MUIA 5E6YA 1XH0A 4N2YA 5FF2A 4BHYA 3GG8A 1G4TA 4W88A 2XH4A 1EUAA 2GJLA 1FVPA 5FL0A 3OODA 4DJFA 3FW6A 4Z08A 2OWXA 2C6QA 5EMYA 1B5TA 4XZ9A 1S2WA 3XIMA 3NPUA 3S46A 1BXBA 2I56A 3KZSA 5CPOA 5E1QA 4P7RA 4JS3A 3S3GA 3NSNA 4C7DA 1VCVA 4ZR8A 1SJAA 4S1FA 2C18A 2CWNA 2X1RA 2VC7A 3I3EA 2NQLA 2ESCA 4O15A 1R9XA 1PIFA 1BVNP 1YLVA 1GOWA 1V7AA 3VXGA 4J3ZA 5HUOA 2R6OA 2GGIA 1JDCA 2B0MA 3CXOA 4Q8OA 1YNQA 3G1XA 5C2XA 1G9HA 4TOQA 1ZBVA 3GFZA 2W67A 1FWAC 1QAPA 1YPFA 3I6RA 3G1AA 1SZNA 3W70A 3AMKA 3E1F1 3WF3A 4Q4OA 4RZBA 1IR2A 1XUUA 1O7AA 4MKNA 4N9EA 2EGZA 1GW9A 5A5WA 1B30A 3GSMA 1I9CB 4B15A 1W0MA 5BOOA 2CNCA 4Q8MA 3LSCA 4ZO6A 1LCOA 2E6YA 1HL8A 3F4CA 3VNLA 1NJJA 5HJLA 1IWAA 4FF7A 1RA5A 1G69A 1LORA 3T4WA 4DVOA 1Q4WA 1EBHA 2VOTA 1XLDA 4ZSTA 4QQUA 3O6YX 4L64A 3ZWTA 1V51A 1C3FA 1E1CB 1ITUA 4I9TA 3PUDA 4IP7A 4LS1A 1EGMA 3WJXA 4MWAB 4LSBA 1E1CA 3SCTA 3SCUA 3WFLA 2W3ZA 4FP1A 3UWWA 3S0CA 4JX6A 4MWAA 4NIRA 1TZZA 4IGMA 3SJ3A 2C0HA 4Q8VA 4IIEA 4ERAA 3PUGA 1J5TA 3NOYA 3VGDA 3G77A 3CEUA 1TJRA 4US5D 1JJKA 3C52A 3SY1A 4JYFA 2PF0A 4J2MA 5BU9A 4WDWA 2ZKMX 3C0QA 2VYOA 4UFHA 3WLNA 2Z2UA 2VGFA 4A35A 5CJMA 1FFRA 2PC8A 2CEQA 1AMYA 1XRTA 3KCOA 4J35A 3U48A 2PB1A 3W1TA 3CT7A 3FOKA 1UBSA 1M04A 1JAKA 2G0WA 3DYPA 4LV4A 2Y85A 1A5BA 4WR3A 1UR3M 2C71A 1PKLA 3WJWA 1LLWA 3SUUA 1OIFA 2A7NA 1S5TA 2E4TA 3IWPA 1WZLA 2FFCA 3VIKA 3GXNA 3H4GA 4HZ7A 4HA3A 1BQGA 1LZOA 1K9DA 4WLCA 1TE6A 1PIIA 3MUAA 2Y0FA 1LBMA 4B5UA 1UPMB 3RLGA 4AC7C 3UT0A 1LTDA 1J11A 1ZSXA 3GXTA 4HPGA 3G22A 4LNCA 4JQ2A 2IQ0A 5TIMA 3UETA 1M1BA 2YCKX 3EKLA 1YRRA 4JTCA 4FNPA 2PC4A 5CLWA 1ZZMA 5IDIA 5HA7A 2WO5A 3HG4A 1WXYA 4QP0A 2W92A 1Q8JA 2NSXA 2RDUA 3UZWA 1O6IA 4LF1A 4HMDA 4HU4A 1QI4A 3QHNA 4L6OA 3SRHA 3N9RA 4MKSA 2VVNA 1W1TA 2DPEA 4IIHA 3U4AA 3CQ0A 4GZIA 2AKMA 1FQ0A 1QFEA 2XM2A 2BG5A 2QPUA 5CPQA 3T2PA 1XSJA 4MUZA 6XIAA 2MUCA 4AC1X 2CU0A 1SSDA 3CMFA 3RK8A 2WWCA 3EWCA 3LI1A 3W2JA 1TV3A 1WDWA 5I3FA 1MDLA 4G1KA 5JBDA 5IFPA 3N1AA 1VIZA 1R46A 3AI0A 4Q4MA 3E3HA 2QGHA 4UTWC 4DBDA 1Z44A 1QNQA 3KZPA 4L65A 4Y9OA 4WX2A 4RJEA 3D5HA 1DHPA 1QNVA 4J3WA 1UW9A 4HU3A 2YDSA 2OOGA 1VZWA 2FTPA 2Z4GA 1E6ZA 4YJ5A 3GTIA 2HVOA 1PX8A 4D6DA 1H2JA 3PPCA 3FVDA 3APGA 4V28A 1PHWA 4FPSA 3BSMA 5EFFA 4J1OA 2PRHA 4OOUA 2CLFA 3T1GA 3ZJ8A 4UMBA 2VCBA 3BGJA 3P8IA 4GZJA 2CESA 4H00A 3TW9A 4M56A 3MKVA 1QBAA 4O54A 3U57A 1B2YA 1FXQA 3NM1A 1XD0A 2YGYA 4O0KA 1JI1A 1M7PA 1UPPA 1AJ2A 4GQQA 4S3DA 5A8PA 3WEZA 1BHGA 1Q13A 4HTYA 1TKKA 4ATWA 3W4RA 1HVQA 2XVGA 4QM1A 3AJXA 5ECUA 4DF2A 2Q6ZA 1FHLA 1WBHA 2KZHA 1SR0A 3B8VA 3I10A 1JPMA 3G1RA 4XTIA 3WQ6A 3V0SA 1UWTA 2GQ8A 2XJ7A 3LA4A 3OW1A 4HSNA 2J6VA 2PGWA 3EWYA 1UJPA 3ITGA 3UNDA 3H53A 4DHGA 2PWHA 2FTYA 4PMVA 3NZQA 3EOSA 1I4NA 5A2BA 2C14A 1BTCA 4IFKB 1C7TA 4GVFA 5J04A 4X2PA 1ZY9A 3IUDA 3HQNA 2XVKA 2QIIA 4JTUA 1QT1A 4IFKA 3LERA 3G1YA 4JBRA 3TSMA 1SW7A 2WHJA 3R0UA 1Q3NA 1XS2A 3BV4A 1OWQA 3DCPA 5JH1A 4I7VA 2BY2A 3ZJ7A 4HT3A 1P7TB 4GLEA 2HK0A 3LTPA 3GXMA 4MDOA 1E4IA 3TA6A 4UFKA 1H1YA 4FLOA 5XIMA 1E4NA 4RX0A 3NDYA 2WLZA 1OFRA 1P7TA 3BLEA 4OE7A 5H6HA 4PMXA 3KTSA 1V02A 2OX4A 1Y5XA 4HKPA 7A3HA 4KT2A 2FMOA 2V81A 4A3HA 4KWSA 3G0UA 1YYAA 1HP5A 2WBKA 1PX3A 3PAOA 1NOUA 3WG6A 5FJOA 4EXBA 3UEQA 3T07A 5FA5A 1XBZA 1XIFA 4U2YA 1V93A 4QE5A 5F7UA 1J0HA 1X6LA 3F2CA 2YA1A 3BK0A 4LCSA 3U0HA 2Z00A 3NZGA 3UNTA 3RLHA 3V35A 4JFWA 2Y63A 4OU1A 4K6AA 3AMDA 2G96A 2QULA 3GNXA 1TB3A 2XTKA 3TTYA 3EMCA 4GI9A 4MZ1A 3T78A 4LVDA 5JVLA 5T9CE 2XN1A 3W1QA 2QCEA 4QBXA 1MXSA 2H8XA 4JN8A 1GEQA 3RXZA 2E28A 2NLYA 3LXBA 1ELSA 4U10A 3IVUA 4U28A 5DN1A 4PSRA 3DG6A 1E9LA 4S3FA 4RUBA 2JF7A 1GPFA 4C6IA 2ASHA 3LNPA 4TO8A 3O3RA 4F8XA 3SUVA 3DUGA 3QRHA 1XCFA 4HA0A 3W86A 2QCCA 3WH9A 3TEVA 1TZ9A 5BXTA 1NDZA 2EHHA 1TUXA 3MMUA 3MKCA 3E0VA 1NELA 2DQXA 3N2TA 2G41A 4NJHA 3FAXA 3EX3A 1GTEA 1F3WA 3RMEA 3GU9A 4J3VA 2ZZ6A 1S2CA 3G2GA 1KR1A 3C2FA 2C15A 5C9ZA 1EC8A 3WLJA 2FB3A 1ODZA 3UU0A 3R1ZA 2TSYA 3VAVA 3OB8A 3HJEA 1W56A 4LF2A 6ENLA 4Q7BA 1GOOA 3KRZA 3WD2A 4C1LA 3PK7A 1IIHA 3LLFA 3LTSA 1C9WA 1VBGA 4Z0JA 2FIQA 3V0UA 3UJRA 2QMKA 2JQXA 2XDFA 1LG1A 3GU1A 3IJLA 1Q2RA 1N55A 2RH9A 4B3ZA 3I7RA 4AWEA 2Y8UA 1A4MA 4PMZA 3W00A 4UTUA 4LGXA 3RUBL 4HNOA 3LXAA 5BMWA 2W61A 2D20A 4C5YA 4S3JA 1S2VA 4FXSA 4XB3A 5HMFA 4KEMA 1Z8AA 1JGIA 3SRFA 1TJ1A 2X30A 4FR6A 2YL8A 4X63A 2V5CA 3FXYA 2Q09A 2C1IA 2PI6A 5F2IA 3WFAA 3E2RA 1GEHA 2D2GA 1JNDA 3QN3A 4MJZA 3QR1A 3G1SA 3NO1A 4GWEA 3PWGA 3EYPA 3CNYA 1K70A 3DFSA 1J10A 1J2BA 4MNKA 2YL9A 4MJ4A 2QV5A 4NJIA 3RRXA 3WLPA 3CTTA 4KFNA 1CGUA 2PUZA 4H8HA 3MDUA 2OELA 3RPMA 5M5DA 3S1XA 3LDVA 5I6SA 5DO8A 4E6MA 1R30A 1JXJA 5LIXX 1QI0A 1UC5A 3K4AA 3M0KA 3LHVA 5LXXA 4LBSA 3VMNA 4H6RA 1RJRA 3EWXA 5EU9A 3ANUA 3UCDA 1J93A 1E5JA 2QKFA 3FK4A 4NY2A 2CCRA 1UZDA 3O63A 1X8CA 2ZA2A 5HNRA 1AQ0A 4JHOA 4MB1A 1K7XA 3LLDA 5LXEA 3DGRA 3EBVA 2WMGA 4N6FA 1E6SM 3T0AA 3B0UX 3CV2A 4D2JA 1PKYA 1P0NA 3KLKA 2OCZA 3S2JA 4K8HA 4W8BA 4PYSA 5D8ZA 1QO2A 2CLLA 3WO8A 3USZA 1GZGA 2DZUA 4DBEA 1EGZA 1D2KA 5E0CA 1JZ7A 4MB5A 3R94A 2QJIA 3BVJA 1EDTA 2I17A 3VABA 3CZLA 2GFTA 1UD4A 1HJUA 1JIBA 4TX6A 2BZNA 3BLPX 4L80A 3EX1A 4KGLA 3LBCA 1UMLA 1WXZA 2XGBA 5EMMA 1KFBA 3TJLA 1IGWA 4ZTYA 4AEOA 5BXPA 2CHRA 4UQDA 3NSXA 1IEVA 2A0NA 3IUHA 4RPQA 3C6CA 1Q6FA 3NAVA 1B9ZA 5CSYA 4HPXA 1XH2A 1C93A 1ZU8A 4LRSA 4DF0A 2ADAA 3QKZA 3SADA 1YDVA 3QLDA 1PO9A 2R1MA 3VOHA 3MSRA 1XDJA 1T6MA 4DEFA 2AMGA 1PE1A 2ZX9A 2PZNA 3LPGA 1ZHAA 5CZSA 1UG6A 4DZHA 2CIPA 5A69A 3KCLA 4DI8A 5D04C 4BQ5A 4L9ZA 1HP4A 1UROA 2AL2B 5LIUX 3GG7A 4JTGA 4NZCA 1OADA 3CPGA 4C6QA 5KZ6A 4BZYA 3N6HA 2A1YA 3ZJKA 1ONRA 3Q65A 2AL2A 1KM3A 3QTGA 1JF5A 4AWSA 1JF6A 3OTRA 3UFYA 4IX2A 2AQOA 4PC8A 1LL4A 3VINA 2E6DA 2ZQ0A 1UA7A 1M68A 3HGRA 3F4NA 2XU2A 3F5LA 1BPLB 2EF9A 2OLAA 2V6AA 4QS6A 1MUMA 3CQKA 1V3MA 1G01A 4GA8A 4ERGA 3L4TA 4MY1A 3DIPA 4FK9A 4NNAA 4P8UA 4ACZB 4R9OA 3H2OA 1EEXA 3DOPA 3WH8A 1S5VA 2CLEA 2A3LA 4GD0A 4DJDA 3CJPA 3SY5A 3W1UA 1D3HA 1DJIA 4GYKA 2GVGA 4K1WA 1JQVA 4NAFB 3W7JA 1OFPA 2WBGA 4ZXOA 1GQJA 4ILSA 3VFCA 3ARQA 4NAFA 1AW5A 4Y96A 1EKOA 4C6CA 5LA2A 4JGDA 5XIAA 3G3MA 1BVWA 4P7NA 3AIWA 1ICQA 1DWAM 1VBJA 3R10A 1X97A 3P14A 1KC7A 1UJQA 1F6PA 4GY7A 4CNNA 1DXIA 3L65A 1UD2A 2YR1A 3P6LA 3W72A 2REQB 1AH0A 3OLDA 2XH0A 4GQGA 1OZQA 1I2NA 5A6TC 1UWIA 3ES8A 4GUFA 3UJEA 4JDYA 1XYMA 4Z1CA 2BDQA 2R1KA 2REQA 5CZKA 1DP0A 1W3HA 2RHGA 1PCWA 4L1XA 1PXGA 2P76A 2ZTKA 1QHZA 3V4BA 1EJ7L 4PTMA 1BSIA 5EFDA 4RNIA 1YX1A 4JFUA 2DDXA 1E0UA 5HATA 3T81A 2HJPA 2GDVA 5LKYA 4AW7A 3W7EA 1UUOA 2Y8KA 3H55A 3MW7A 3OZPA 2BODX 1J0KA 2PDYA 3RILA 3EWBX 1K3UA 2Y24A 2Z27A 3EGJA 3T0DA 2OKTA 3RG6A 1SU5A 4EIVA 3P5ZA 1HVXA 4A3UA 3R8HA 4Q4RA 3UXIA 4PBEA 2FGLA 2ANUA 2Y89A 2ZUWA 3IAQA 3NTYA 3H8AA 1PWMA 2ZZ1A 2VDGA 5FSEC 4IMCA 1RVGA 3I65A 4GINA 4HZ6A 5LNSA 1UIOA 1JG9A 4FNTA 3ZR5A 2V30A 1S2TA 2D69A 3S6OA 2NZLA 3VNJA 3W9ZA 5HR6A 2VGGA 1YTKA 4JCLA 3RF9A 1XCWA 3R12A 4UFJA 1NIUA 3CWHA 2XVLA 2WJDA 3BAKA 3WUEA 2CHOA 3R8GA 4PTDA 3LHWA 1DTNA 3SBFA 3OG2A 4KF1A 4NZFA 1J18A 1ESWA 3S5NA 1GJUA 2V63A 5DCDA 3T7VA 1X1ZA 1VKFA 3VKAA 4LANA 2JIEA 1XLBA 4DF1A 1Q6GA 1KBKA 5FEXA 2IKHA 3E74A 3U8GA 3MA8A 4OECA 2BGSA 3SCNA 1T41A 4HYVA 4L9XA 3E0WA 2R24A 3B9AA 4PN2A 1DWJM 1YBQB 1MSSA 1LG2A 3MSGA 3L2LA 2GSHA 3W73A 1VFLA 4MAZA 3GDMA 3WQCA 1YBQA 2FQIA 2D2JA 4B5VA 5HPOA 2DZXA 3Q2DA 1XSIA 1SUXA 3PZMA 1YMYA 1ENUA 3LCHA 3E38A 1SFTA 4FOJA 4ZO8A 3P74A 2WNZA 3E0FA 1ICSA 3WQOA 2NUYA 3BGGA 2XVNA 5C54A 2VX7A 3WQVA 2W27A 3NYDA 2VDIA 1UR2A 3FA3A 2PGFA 3MJMA 3LENA 1DBTA 5CC6A 3M16A 3TTQA 3AHTA 4QAWA 4IPIA 1HJXA 4PRWA 2OMAA 3FYPA 1GHSA 2GL5A 5B80A 3LNMA 2F6KA 2WAGA 3WDJA 4H1ZA 3P62A 3BARA 1NP0A 3BG5A 2V5LA 2PCEA 3L4XA 1J6PA 2W79A 1UHVA 4TXEA 4L1WA 3SB0A 1AL7A 3GLCA 4UFIA 4X22A 3T4CA 3SGZA 3O8AA 1DV7A 2OG9A 2ISDA 4NILA 2QUTA 1PZ1A 2WVUA 1W1B1 1EH9A 1XX1A 4RXFA 1Q6EA 2X41A 4YTTA 1V3LA 4GVHA 2AQVA 3PB2A 1ZBKA 3RCMA 1PKMA 4NAEB 1XLEA 1IF2A 3W7DA 1RCQA 2GSEA 1K8CA 3M0VA 1JD7A 2OSXA 5IFTA 1MFUA 5D30A 3UYIA 1K9FA 4JNYA 2OFJA 4NAEA 3C56A 3TQKA 1EIBA 1A5UA 3EA2A 3EMZA 1V02E 4XQ6A 1YTDA 2QCHA 1K4HA 3TC7A 1NEYA 1NARA 1A3HA 4H8NA 4ZQOA 5CPNA 2WLYA 2XGIA 3MANA 2VZTA 1FWIC 1EOMA 1I60A 3KS5A 6ALDA 3PZVA 1E51A 2XH7A 5DT7A 1B3XA 2QF7A 4EPBC 3TMLA 4MFEA 4BF7A 3MTWA 4GK8A 3GWQA 2Y7FA 4GH1A 5A6BA 3UCCA 3HA1A 5GNXA 1A5LC 4JIEA 1FWDC 4MZYA 4YN5A 4XIAA 1M5WA 5A6AA 3V5FA 4IMFA 3C2EA 3UVAA 1TPUA 1OM0A 4BKNA 3B05A 4LUJA 1XLFA 4XSLA 2QJHA 1VPQA 3ITXA 3GIPA 3V1HA 4UTJA 4HK7A 4JICA 4AHOA 3G1VA 1CZ1A 2YZ5A 4Z1AA 3LXCA 1AH4A 1LYXA 1E9YB 2WC4A 3W01A 3ISIX 3A21A 1VEPA 4QCFA 1EJSC 3BMXA 4HBKA 2X16A 3ZFHA 3WLRA 3RN6A 3TN3A 3UG3A 1V3KA 2CXGA 1EL3A 2JEQA 1O5QA 4O53A 1GOXA 4JL1A 3PTMA 4XD5A 4Y9AA 2CYGA 1UOZA 3EOUA 1TVLA 4S3CA 3LMZA 3GX9A 2NV2A 3ZQ9A 1VCGA 5ABGA 3WENA 3KBVA 1TPH1 3GVWA 3QFEA 4BEQA 1CXHA 3GYEA 3DESA 2EEXA 3VOGA 4GVGA 1EWEA 3GHSA 3F2DA 2J62A 2BSLA 4WKFA 3IJ7A 1B57A 4P2VA 1TJPA 1VQTA 3VDHA 1A0DA 1EO5A 1IWPA 3HU7A 5I3IA 4DJED 4M6VA 4PCNA 3TONA 3H6OA 1DXFA 2WSRA 1VC4A 1KFWA 2ZXQA 1JDEA 3VOFA 3SUTA 2WCGA 5IBXA 2PDIA 4PGLA 2ZBTA 4JKKA 2F38A 1E6RA 1AUSL 5ABHA 4AWTA 3GQYA 1UZ1A 2AOSA 4OGZA 1E6XM 3AU2A 1A50A 4ZFMA 3QPYA 2Y8VA 4RDVA 2E5CA 3ARUA 3EXRA 4S3GA 1O5XA 2VEIA 4D6GA 3SY8A 1HKMA 2G97A 1DJXA 4N02A 5ENLA 2CZDA 3KOXA 1VGAA 4HN8A 3GU2A 4MUPA 4MDPA 4IMGA 1UWRA 3A24A 1GVYA 4HYRA 3CL7A 1TREA 4H04A 2V0TA 4GXPA 3W1LA 3ARSA 1UIPA 2C1GA 3TAKA 3PM6A 3L67A 2ZXBA 3KOFA 1AD4A 3BAJA 4GY1A 5A6SA 2PWEA 4HD5A 4QQ3A 1C90A 1CB2A 3VDAA 5TF0A 4ZFCA 3LBOA 5HWNA 4AHPA 3L0NA 2Z28A 1CGTA 3LV5A 3DG3A 3UWEA 2IMRA 3FJ4A 1PVNA 2WPGA 1G67A 1GOQA 3KP1A 2XFYA 3ZSTA 1G4PA 4J3XA 2WNQA 5DBUA 4ZQCA 1GZJA 1MNSA 3I6EA 4S3AA 1E1FA 2HS8A 3UZ5A 3PFMA 3S1GA 3HB9A 2J24A 2XIQA 4F0MA 3UZYA 2ZDSA 2WKJA 1TTQA 1R0MA 4GVIA 4HGXA 4YLWA 1D7FA 4M29A 1UASA 1QHPA 1TTJA 4EWJA 1NOFA 3N2BA 3TLLA 3GRIA 3IIVA 4AVFA 3WQ4A 1WYIA 1J0JA 7ODCA 4UOJA 2O9PA 3BPWA 1TCMA 4GFSA 1H7XA 4WY0F 2DH2A 3GTXA 3VVGA 1OQFA 3E5BA 5CSRA 1YPIA 4J2PA 1EF2A 7XIMA 4E2DA 4R88A 2NXIA 1JZ2A 2R94A 3BURA 4GHRA 2ON3A 3I7SA 1R2RA 1TV4A 2A2IA 3AJ7A 1MUCA 1E0TA 2O55A 4HZMA 5K9CA 4UUIA 2E5BA 3E2QA 4P7LA 1QJWA 2PEVA 3RPDA 3LS9A 4JNZA 3VC6A 3CZJA 3M0JA 4NXSA 2TPSA 3W38A 3R13A 4FLRA 3WJYA 1MDRA 1NDYA 1EBGA 1Y7VA 3CBWA 2GK1B 4LXFA 4NZJA 1BVZA 3N2XA 3GTNA 3SCVA 2INEA 1RP9A 1U83A 4J3SA 3AHXA 3VD9A 3BCFA 1OGGA 3N2CA 2AMXA 3ZR6A 2GK1A 3W85A 2QXWA 2QJJA 1S3TC 2H90A 4B3KA 5KZEA 2JK2A 3MSYA 2CETA 5EMLA 1GVEA 2DT3A 3BMWA 3O2LA 4GMEA 2O4MA 3HF3A 1PZ0A 3LCGA 4CVUA 1ZRQA 4ZE5A 3TWBA 3WMSA 2VC5A 5F4SA 3S2NA 1A5SA 1KXHA 2FZDA 3V1PA 4LEQA 4FB7A 1BSLA 3ABQA 2UZ9A 3PZIA 3S8HA 1GOKA 2P10A 1TWDA 1MI3A 4C6KA 3GVVA 1TRDA 3KRSA 3L5AA 3RX2A 1CLXA 2VXNA 4L6HA 2CLHA 4DO6A 2E68A 3TYAA 3W37A 1XRVA 4Q33A 3A47A 3EWZA 1V3JA 4KWOA 2VC6A 4WJEA 4G2DA 2YDQA 1XV8A 1WO2A 2WMFA 3LZ5A 2VDHA 3EB4A 3WJSA 4K3ZA 3AC0A 4BA0A 1K9EA 4I9MA 1JCLA 2E1WA 1GOIA 3G8EA 1CGVA 1X96A 5FJJA 1SPQA 4HSHA 1DWGM 3RLUA 3LGDA 3ZLGA 3KL5A 3QPEA 1W6TA 2O9TA 1DEDA 2WNWA 2VTFA 1PSCA 3WQ8A 1Q7QA 1QVBA 3STFA 4FS9A 4F9DA 2W9MA 4NRSA 4PCPA 3VDBA 3O07A 1N82A 5M2FX 1V3IA 4NT0A 1VJSA 3E96A 2R8WA 4LALA 1TMLA 5HDRA 2HE8A 4X9SA 1GQLA 4C1NB 5JIPA 1IZKA 3S2MA 1CYGA 2OEJA 3DFQA 3P0WA 3WL0A 3BZJA 4Z42C 3OA5A 1H7WA 4IL2A 4ICCX 3SFWA 3VCCA 4C1NA 5HNTA 2V2HA 4XAZA 1OK6A 1VBHA 3ZR4A 1ME9A 1F3XA 3IIXA 1J01A 4HN4A 3OVQA 1XLHA 5C9XA 3AU6A 1N8IA 3P5YA 4IXHA 3OGRA 2BHZA 3KWSA 3R0KA 3N2OA 2QPXA 3F7JA 1X6UA 4QNEA 1L6GA 1NWUA 1DJHA 4QLJA 3GW0A 1TQJA 4JQAA 1TYGA 2P0IA 1QDSA 3QV7A 1XM3A 5FAGA 3S42A 3FSUA 3UA4A 3VKDA 3AUJA 3PTKA 3CAKA 3P82A 3M0HA 2WKLA 3VU2A 3C4UA 3WL1A 3PSVA 1VBRA 3FNDA 4HMEA 3B8TA 1E3XA 4UTKA 1THFD 3GTFA 4XD6A 2QMJA 1TVNA 4FHAA 1GJPA 1FP9A 2HMCA 1J4EA 2J8FA 1FKWA 4GUGA 3SCOA 2DIKA 4WY0B 3CASA 1VFMA 1RXOB 3GUGA 1XWYA 4TTGA 4IQDA 3M0LA 3WNMA 4WY0A 4FNUA 3UWVA 3NL6A 3RHGA 3G5EA 4BY3A 1W91A 2X0SA 4AZHA 1AL8A 3W7KA 4RNFA 3S9ZA 1RD6A 4H4IA 3D3FA 1QNPA 3F03K 2WANA 5M03A 1LM1A 3S1VA 1T8QA 3WQGA 3SCPA 4TV5A 3NQAA 4CQCA 2J7FA 1RY0A 2QVNA 4AXNA 3W0KA 3G18A 1FKXA 3NPXA 3DYMA 5DLCA 2CBUA 3IPWA 5DFAA 1W54A 3TFXA 3PC0A 4TQTA 4X0VA 3BQ5A 5GPRA 3VKKA 5E70A 3BLLA 3EX6A 2QYGA 1DIOA 3GXIA 1RY8A 4HNVA 3ZZ1A 3FDKA 2PMQA 1X8FA 5D2WA 2NX1A 4PUWA 1CTNA 2WQDA 1KM6A 4BI7A 3MYPA 1NTHA 3QFWA 4IXXA 3PBVA 4A3YA 3QHMA 2JALA 3W3OA 2XSXA 1P6CA 1P1XA 3VCRA 3A64A 3NQGA 4PMJA 3N73A 3URAA 3QY7A 5H91A 4HSOA 4M7SA 3B40A 1UKSA 4HIBA 3W7PA 1OFEA 1G6CA 1R3SA 3H54A 4NASA 3AMLA 5I77A 4S3KA 1X6NA 1B3ZA 3TZFA 4TX8A 2C13A 5LIYX 3PZTA 3NQVA 1OFBA 4QS5A 3GDRA 1T0OA 4GO9A 1PCKA 1YE6A 4LBRA 3KOYA 1Q63A 1XF0A 3DENA 2P5NA 1EIXA 3CUFA 4KESA 4A8IA 1HKKA 3KCJA 5CJNA 4U31A 3EX2A 4OOZA 3E5PA 4MJ2A 3WY1A 4I5XA 4Y9PA 1RR2A 3UVIA 4IFRA 1RBLA 1JEZA 3QV9A 1VR6A 5G4HC 5CAHA 5A8GA 3W6MA 1VHCA 1GG1A 4V15A 4RR4A 6REQB 2UY5A 3QMSA 3DHUA 4IZGA 2GVLA 3M0XA 4QISA 6XIMA 3ITLA 2JKAA 3NPWA 3AMCA 3WUGA 6REQA 1H7PA 1W1ZA 1LF1A 1DJGA 1CNVA 3H2MA 3I4EA 3SCSA 3T08A 1G7VA 1SGJA 1EHAA 5CGMA 1ADDA 3QV8A 4LVBA 4LEFA 2DH3A 4DNHA 2OTDA 2EPNA 2VQUA 1W17A 1HJVA 4NZ4A 4XZIA 2UWFA 4DWSB 4ERIA 4LAOA 3AOFA 3T8LA 1E40A 5I3DA 4DWSA 4I6VA 4UCFA 1EXBA 1KM1A 1Q5MA 2W5FA 5DMNA 5GQBA 2DJLA 2YFNA 4G7EB 5C9UA 2IS7A 3D0CA 3ZVIA 4B2DD 2A3HA 3S9YA 1JZ3A 2PTYA 4K37A 3WYZA 1TE1A 1LBFA 2IQDA 4G7EA 2BGQA 1M65A 4W5ZA 2I16A 1BKHA 4KKXA 3PP7A 4PUNA 1W3IA 2QDHA 3W22A 5I07A 3AHYA 1X38A 2GGEA 3PF3A 4R27A 1DJZA 4JL2A 3AHVA 4RZ6A 5CGTA 3LCXA 1UKPA 3NVTA 4I9AA 2WYSA 3M64A 4FMVA 4YMZA 1BWVA 4G56A 1DWHM 2YFOA 3GTHA 4NP7A 1HX0A 2V8ZA 5EMKA 3EOLA 3KEHA 5GJPA 4DXXA 4QJ4B 3SM0A 2XIBA 4PMDA 4CN6A 4AWUA 3NSMA 1HT6A 3CV6A 3TYZA 3RRAA 2O0TA 4YNGA 4FIRA 3GS6A 1F9CA 2PS2A 3JZEA 3AQUA 4JIQA 5FIPA 1ONXA 1QPQA 2OYLA 2WZHA 8RUCA 1H7OA 3L0KA 1DTUA 4H3DA 5F2GA 1I8JA 4OIFA 1R2TA 2YB1A 2FFIA 2E3ZA 1DOSA 4UNLA 4XAYA 3OBKA 1W32A 3WD1A 1UCWA 1XIEA 1G7UA 3NXFA 2HPIA 3QYQA 2BXYA 1GTHA 2QAFA 4LU0A 3BAXA 5DMMA 2FKPA 3LV6A 4JTTA 4LS2A 1FA2A 2I57A 2XUCA 1R38A 4EP8C 4F48A 5HJXA 4O8AA 2G5WA 1JYXA 2P1FA 2KX9A 5KEZA 1E71M 1AZ1A 3CAQA 4WKHA 3T55A 1ITQA 5C2GA 4O1DA 4D6IA 1LQ2A 3DBPA 4XBJA 4HA1A 4JTAA 1JCTA 1W3NA 3GAKA 3HTWA 2Q01A 2VZVA 2CZ5A 2PDXA 2VWSA 1NDVA 1EA9C 1ZL1A 3LHYA 4CCDA 2Y61A 1MMFA 4WIWA 3BV7A 5CBBA 4E8CA 3GK0A 1NY1A 4RKAA 4PMNA 1TR9A 3HFYA 3GE7A 5D2YA 5DY3A 3W2KA 3P0XA 2YDAA 3LBMA 3O1NA 5LIKX 1QBBA 3S1UA 5D9OA 3C3NA 5AC4A 5KETA 3BAWA 3NQ7A 3DFHA 5FF4A 3JVAA 3L23A 5AYYA 7ENLA 2NX9A 3JU2A 3HQ1A 4DXVA 3DDMA 2FGZA 1KV8A 3W1MA 1W1VA 4REQB 1QHOA 1TV2A 4RNHA 2D23A 3BICA 3K4DA 4X60A 1ONEA 4C6PA 3G1DA 4Z0SA 4REQA 3N4EA 4IIBA 4MF4A 5HQLA 4EACA 1G0CA 3QSTA 2VEGA 4IOTA 2ONEA 4C6OA 2R1PA 1W3KA 2OQLA 4JX4A 3BL3A 3L66A 4OTKA 4FO4A 3NA8A 4GBUA 2OYKA 3P80A 3CM4A 3G24A 5KZDA 3PULA 1TIWA 2VKZG 1QW9A 1R3RA 5CH9A 3L21A 1KGUA 1JYWA 1P4CA 3M44A 2ZWZA 3AXXA 4M0XA 2HV5A 4LX4A 4IWWA 3TU9A 2D1ZA 1SYTA 4XZMX 1B3OA 4FF5A 4OWGA 5DY2A 5C9RA 4AF0B 5HUPA 1AQHA 3SDOA 1RSCA 1SJDA 1WKYA 4GYPA 2VMFA 3B8SA 1GQKA 5EL1A 4IIGA 4US5A 4AF0A 1H62A 3WUFA 4IF2A 3S4TA 1HJSA 1EOKA 3R2GA 5AN7A 1LDCA 2ZVRA 1V6WA 1F7BA 2CKRA 2WHLA 2X42A 4N7QA 1VYPX 2TAAA 4OBTA 2X1SA 2QCDB 4PODA 5AY7A 3AIBA 5LGXA 1H11A 5FOOA 1W37A 2PWFA 2QCDA 1BKSA 3RO6A 4FAMA 4LAUA 5I3JA 2B7QA 3DECA 1TX2A 4GIYA 2Z6JA 1LOLA 2CLMA 3BH4A 1REQB 4UOQA 1WZKA 4PBGA 5M17A 3DEQA 2OWWA 2JIWA 1GHRA 4IMAA 1TMQA 1REQA 2Y5JA 3NPVA 5MKGB 4HB7A 4UQAA 4MY8A 4AD3A 4RDZA 4URIA 2ZX5A 3WF0A 5MKGA 1RPXA 5D32A 2V2CA 3M5YA 2F6XA 2OEMA 1O4UA 3DBNA 4BQ2A 5CQ1A 2ACSA 4WRHA 4O18A 1DXEA 1EPVA 3VOJA 2DUZA 2PGEA 2GUYA 5K3VA 3F2BA 4QE4A 1C92A 8XIAA 2DW7A 4KERA 3PTDA 5CPMA 2FPVA 3PAJA 3QC3A 1YDNA 4GI4A 4AYSA 2DFAA 5EKYA 4ZBCA 2BBFA 3I68A 3B8DA 4FNSA 6TAAA 2HNHA 3ATZA 2ISFA 1OHLA 4Y90A 1FH9A 3DZ1A 4RV8A 5I3HA 4A2SA 1PEZA 3PBGA 4XKYB 2QEZA 3KL0A 1KWGA 1PL9A 2D22A 3ZO9A 1MRAA 4I9JA 1YE4A 1K7EA 2DSUA 3UWZA 3N19B 1E0VA 3FA5A 3JRKA 1Q6RA 4XKYA 1DJYA 1GVFA 3UJSA 5LNVA 3WZ0E 3TH6A 5J5RA 1RCXB 2Z26A 3WLHA 2WCSA 3OYZA 3VGEA 2EXOA 2PDPA 2Y6ZA 2Q8ZA 5LSMA 3OJGA 5CSUA 7PTDA 3PUEA 4W84A 1ZP4A 2ACQA 4UZSA 3IK2A 2Q8LA 5CPTA 3SO7A 4M6QA 1ML1A 5I5RA 3GUWA 4PULA 4CD8A 3B9NA 2X09A 1JPKA 1OK4A 2ZA3A 3ZWSA 3LLXA 1TPB1 4L56A 3SIMA 1KBLA 1FWSA 2Z7KA 1HIZA 4WD0A 4Y8FA 1XGZA 2HEJA 3KOZA 1NWTA 3O6DA 1JUBA 4U5KA 1L8NA 5BWAA 3LSBA 5AHIA 4C1KA 5A2CA 3V36A 1H51A 1NWSA 4FOKA 3WH7A 1GOMA 3KW3A 1YNPA 4O16A 1XLAA 2EJAA 1XXXA 2RKXA 3MJYA 5DT5A 3UZXA 3M0ZA 5A8MA 2XN0A 2Y5SA 4NX5A 4UNIA 2J66A 1ZAJA 3DFPA 3GYCA 3UR2A 3APTA 3CT2A 1KV5A 3PPHA 4ROQA 3BCDA 1R3TA 4FXFA 5D4YA 1RH9A 4HHPA 4IGHA 1NP2A 2QCGA 4ZMGA 4MADA 3W1RA 3C8FA 4JHMA 3OPSA 4LWWA 3WBWA 3IVSA 3TSBA 2CBIA 4KS0A 1OSEA 1HF6A 3KHDA 4FZIA 2PAJA 3IEBA 2E25A 1LWHA 4XK2A 4CU8A 3LCWA 5BXRA 2NQHA 1GW1A 2XZ7A 3B97A 4XD3A 4IG2B 1ZCCA 2VX5A 1B31A 4BFAA 4LVAA 1H41A 4GO8A 2INZA 1GYLA 4IG2A 3HMJG 3BQ6A 3G0SA 3C0JA 1F6YA 1OB0A 1ZAIA 1QPOA 3LRLA 5FF3A 4PTVA 4B9YA 4Q22A 3PSWA 4GCAA 4R7WA 3SCRA 3NUKA 1V6TA 4JTHA 4PUJA 5I24A 1EZ2A 2R82A 3KRUA 2E8YA 3NL3A 5AYBA 2OJPA 4HNLA 3A23A 1UH2A 3W75A 8CGTA 4M3PA 1UR8A 1XGEA 1FXPA 4YHGA 3I7QA 4V33A 3U2OA 1TQXA 4ES4A 3N13A 2EPLX 3I4KA 1TPDA 1KM4A 3RX3A 3VGBA 1UC4A 2XISA 1EEPA 4A22A 2XN2A 2J25A 2PBGA 3M5VA 3RM8A 1ADOA 1ZQ5A 2X2YA 5BU6A 2EPKX 4F9JA 3R7MA 4DBWA 1DQXA 5KSWA 1RK6A 4WEVX 5KINA 2VELA 1W5MA 2OZTA 1EJRC 3GXDA 4NX0A 3BW4A 4HTBA 3WQPA 1XLKA 2HDJA 1TPWA 4H01A 2J78A 3L5LA 4M19A 3M6DA 3BSHA 5G2IA 4JFSA 5DRCA 3TVAA 1POKA 2Z1KA 1FTXA 3A4JA 3ZIZA 3CUJA 3VKJA 3EX4A 4ATLA 4H9UA 4YWIA 2IQTA 3K30A 1KQZA 3LK6A 3FYYA 3L4VA 4G8TA 3OVRA 3T05A 1XC6A 3K8LA 2C91A 3SUSA 1B4KA 1L8PA 1GNXA 1EJWC 4OHQA 4ZQNA 3THAA 4GISA 1RJPA 1NFGA 2FB2A 4HJFA 1FHDA 5IDZA 1OFQA 3E02A 4ZQMA 1ADSA 1OYCA 4AZ7A 3VD7A 4UB9A 4CEUC 3MDWA 4GQ0A 1V6VA 3CL6A 3FGCB 3UBPC 1SJCA 4DUVA 1GYMA 1M53A 3N4AA 1GVRA 2P8BA 4S23A 2AKZA 3FGCA 1Q7ZA 2Z1XA 2DSWA 4H83A 1BFNA 3GY1A 2V3EA 3JW7A 4TV6A 4EF9A 3J7HA 4WVXA 1WV2A 1E0XA 1S46A 3UR7A 4HOZA 2X7VA 3GM8A 4F0HA 1GK8A 4Z1YA 2BHUA 1BXCA 3OA3A 2OQYA 1LOQA 2PTWA 2ATSA 2VFEA 4KCWA 2B7OA 3A4WA 2XFRA 2OXNA 4QEEA 2CLPA 1TWSA 3P60A 2YCEA 4HCLA 1I6NA 3WK1A 1ZTVA 3QF0A 4WDUA 4AG0A 1AMKA 2YA0A 4K2SA 3UJ2A 4L4OA 3ABZA 4NZ1A 1EYEA 3CH9A 3RCNA 4JQ1A 2Q8XA 1AG1O 1IYXA 1X1OA 4C91A 2FPYA 1TELA 4DYEA 3VNDA 3AXKA 4K36A 4UXDA 3UESA 3ICJA 3M0MA 3SW6A 3CHDA 1KRBC 3CK5A 3L4ZA 2GWGA 5KMYA 1L0PA 1OY0A 2R91A 4TVUA 2FLIA 3CIXA 2DVTA 1KR0A 1XLGA 3MQTA 2ABAA 1HG3A 2IW0A 3N3TA 3CPRA 3A9IA 2WHMA 1F07A 4XKMA 2INFA 2WB5A 2A3CA 2O9OA 3QVQA 3IK4A 4K1GA 4NRRA 1K8ZA 2GGGA 2XIOA 4M1BA 3IANA 5MF5A 2NUXA 2VEKA 3OZYA 2YXGA 1TWZA 1FWTA 4FALA 4LTSA 2VGBA 3QR3A 3WF1A 1H61A 3CPUA 3KP0A 3AUOA 1HO4A 4IPJA 3WBEA 2YJQA 2NWSA 1JFHA 1UB3A 1H7RA 3H21A 3ONBA 2V67A 1Y5WA 2ZUNA 3WBYA 1ZPTA 3ENLA 3NYZA 3A9BA 4JIPA 3ZSSA 3STPA 4MB3A 4UR8A 3W76A 3QM3A 3VNKA 4UFLA 2PA6A 5BCAA 1SFLA 3EXSA 3ITCA 1EX1A 4Z2IA 3W6LA 1VRDA 3VZZA 3P2VA 1SO3A 3C2VA 2A79A 3THCA 4GC3A 4IPPA 4QLKA 1SZRA 3VD4A 2QUMA 4LJ3A 3HIJA 5AHEA 5HULA 4DXKA 1A0EA 4FNQA 2G95A 2I5GA 3AROA 5F1VA 2D0GA 4ACYA 3H7RA 4AISA 3UY7A 4PBFA 1LT7A 3SSZA 4ZGYA 3OHIA 3N34A 4L7ZA 4MLRA 2J7HA 1MEWA 2WMJA 4IQJA 3CYVA 3TZNA 3O05A 5LZLA 1AA1B 2ZUTA 3BUVA 2VFDA 3DGBA 2PDGA 1F05A 3I6TA 1TV5A 3EWDA 3I3DA 3ARXA 3FYOA 3DI0A 3BSGA 1K77A 2OX1A 2VC9A 1BGGA 1E6QM 3HG2A 1DJQA 2PLKA 2PDMA 1R2SA 4HNCA 3S47A 4H6KA 1CEOA 1MUWA 5C8BB 3JS3A 2UBPC 4D6EA 2CFFA 1SO5A 1R8LA 1FY6A 3MSDA 4GZ7A 2OZ0A 4UTTA 4A29A 1XIHA 1SFSA 5EYWA 4DO4A 2EAWA 4GJJA 4Q32A 1WXJA 5DBTA 4FLSA 5GJMA 1UUMA 5I03A 5IRPA 2YX0A 1KLZA 4HK6A 1Q66A 4DJFC 5AVNA 2XFWA 5AZ0A 3VA8A 3W2UA 1KGWA 1UBPC 1M7OA 3IVTA 3IAPA 3H4XA 1C7SA 2DSZA 3CV7A 4KIRA 1ISWA 4IQEA 2DT2A 5AHFA 4YPJA 1ZNNA 3U9IA 1PYMA 1IT7A 3HV9A 1Z69A 4HPJA 4MYAA 3QSRA 1E9ZB 1JULA 3WK3A 4O28A 1GUVA 3T2QA 2ZRYA 1G4SA 4M6UA 2Y7DA 4F66A 3STGA 3TIMA 3ALFA 2WSYA 1E1EA 3NQBA 2NQZA 3GVQA 2HZGA 3C2YA 8A3HA 2Z6IA 1CXFA 5DRIA 4UOZA 3U2EA 4PR4A 4KWWA 3BLDA 4YL2A 3GXPA 5L9FA 2PDJA 5FJTA 3OBAA 3OZOA 1DE5A 2NQJA 1TPFA 3PUOA 1KB3A 3P93A 1D8WA 5K4ZA 5FI8A 1ALDA 3DFOA 3THDA 3UW6A 4DY1A 3RU8X 7REQB 2I7GA 1J96A 4IQLA 3KHJA 3OGVA 2WSQA 4J40A 2R14A 1T5AA 2V3FA 7REQA 2HXUA 1WAUA 1JNEA 1K7FA 4QJ1A 4BF9A 4LC6A 2DZBA 5GNZA 5AHNA 1DQWA 4MJMA 4WGHA 2WC7A 3W25A 1Q6QA 1GYNA 1H60A 1MNZA 1IXOA 2PWDA 1X39A 3PWAA 4JXCA 1KKRA 1VFSA 1XFCA 2RGLA 5CSSA 2XSAA 1CCWB 1ME7A 4A3RA 1TFVA 4JTSA 3DXIA 1BLIA 3VDGA 4Z1DA 2LLEA 3UPBA 3N6QA 2FHCA 1V0MA 4UQBA 3FHAA 4MWAC 4DAIA 4F40A 4CCZA 2IKJA 4KRUA 1V3HA 4NSBA 5D9NA 3R89A 3F5KA 4ALDA 1V8EA 1TR1A 4QEHA 4PTXA 1U1UA 3W53A 2P3EA 2VENA 2CERA 4QGCA 1FH8A 3E12A 3T40A 2EJ1A 1O60A 2GQ9A 4QDPA 3RLVA 1XIJA 3MV01 1DL3A 4GKTA 4LAMA 4P7QA 3EDFA 1IQ8A 4Q7IA 1MW1A 4PE8A 4CQ9A 4EAYA 1N2VA 4H7ZA 1VHNA 2DUAA 4N4PA 4RDWA 3S6TA 5DXYA 3W2NA 3AZTA 3TC6A 3JUGA 2V3DA 1R85A 3OLIA 1A0CA 4HHMA 1I75A 2AQWA 2E9BA 3K1GA 3MV11 2I5QA 3AS0A 3WDRA 3ZLHA 3BJFA 3GAYA 5M3WA 2PLCA 1GJWA 4LUTB 3CUIA 1CDGA 4LB3A 1M7XA 4LH8A 4W93A 4YXGA 2X40A 4XZLX 4D72A 4LUTA 3GNRA 3VIHA 1WOAA 2ZX8A 1O94A 1R3YA 4Q8NA 3LD5A 4BR1A 3HPXA 1QWGA 2NT0A 1AW2A 2XINA 3CUZA 3C0SA 4FR1A 1US3A 5A3HA 3FHQA 2ZUUA 5DCBA 3VFLA 2VVSA 4ZOEA 2J7BA 2OGJA 1GKPA 3AMGA 4AYGA 3RGTA 1AW1A 3A3WA 3GZAA 5I79A 4AHQA 2YIHA 3M7WA 3W87A 4JEQA 5AZ1A 3AYTA 3KVJA 1S5NA 5AFDA 2QIWA 3GKFA 4KFPA 5AECA 1VBUA 3ONCA 3A22A 2F9RA 1ZENA 2WSPA 3AXIA 4ADUA 4DO7A 2D0HA 4E0CA 2GDQA 3HQPA 4IPLA 2BHYA 4O1EA 4B5XA 5FCZA 1R86A 2QZRA 1CXKA 2A7RA 1FBAA 1L6SA 3DKLA 3PANA 1KRAC 3R11A 2PSNA 5D38A 3G3DA 1OX5A 1OT1A 5G1YA 2W0UA 4P8VA 4NU7A 3VDCA 3NDZA 3IJQA 1IT8A 2C79A 1XIDA 4G1NA 4INFA 4WCJA 5HQMA 2F2HA 4MYXA 3R79A 1P1MA 5JIWA 4LAZA 2PD5A 4LW7A 4CN4A 2D24A 1J12A 1QK2A 1QO5A 4W7UA 4JDBA 2X05A 2D2HA 1CXIA 4AXKA 4CEXC 3GC2A 5FKYA 3QHOA 4GI6A 5JMUA 1EXPA 4G7FA 1P48A 3KXQA 1EC9A 3TJXA 3VI2A 3PY2A 1GG0A 3M6YA 3ZT6A 3KS6A 1VYRA 3VX1A 3PPGA 3YPIA 3TQ0A 1UYQA 4TVCA 1ZAHA 4WSKA 2H3DA 4TU1A 1IV8A 1Q7MA 2BOEX 2C8NA 1MYRA 2WVVB 4RE2A 2VX6A 1XBXA 3TXVA 3TYDA 2F7FA 3URBA 3RJYA 1ME8A 2WVVA 3SCWA 1AFSA 4I7WA 2PDKA 5IHRA 1XKJA 2W91A 5D37A 5C55A 1JD9A 1JRBA 1TCDA 3SCQA 4JYEA 4QNWA 3SRKA 4FX7A 2E9LA 3MP4A 1PZ2A 4DRSA 2WVSA 1DWFM 2QF8A 1ZGDA 1JI2A 2ZE3A 2DVXA 3CZEA 1X7IA 3LRMA 5PTDA 3TDFA 2J13A 4AIEA 2QHAA 5JBEA 1LLZA 2BOFX 3S5SA 2VR4A 3A12A 4YU1A 4PRRA 2QUUA 1SO4A 4RZ5A 3TTSA 3QZ6A 3BAIA 1DORA 1W3LA