2TSYA

Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
262
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE
total genus 91
structure length 262
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1997-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2tsyA00
1KFJA 2OZ0A 2ZYFA 5I3KA 1EWDA 2D73A 4CQAA 5AYZA 3CWOX 1XBZA 2FPTA 5KINA 2QAPA 3M0ZA 3FS2A 2C13A 2X1RA 3GZ3A 4JDYA 1YTEA 2VFEA 2GVGA 1OABA 1TREA 4OBTA 3C52A 3LBCA 3ZS4A 1X1OA 3CQ0A 3EX4A 3DI1A 1KM5A 3W7HA 3M5XA 4QAIA 2VFIA 1VCFA 3N2MA 4OHQA 3KXQA 1YTDA 4PFMA 3G1DA 3LTYA 2V82A 5AC7A 3A5VA 2NZLA 3PB0A 3N9SA 4IX2A 5C55A 3KRUA 2CLEA 4WXYA 2H6RA 1TMHA 2H3DA 2JGYA 1Z41A 3C4UA 3P61A 5K4ZA 2ISSA 4OQVA 3RFAA 3LXBA 1TJPA 4Q32A 3TV8A 2CLKA 1XC4A 4DF2A 5HWNA 4UXDA 4TR9A 4DBEA 2ISVA 1DJQA 3ANYA 2J9ZA 2QEZA 1SFLA 3C2OA 1CW2A 4M6PA 2VFDA 4UIOA 5AHLA 2VEPA 1A53A 2RDTA 3UXDA 4MJZA 2C3ZA 5HNRA 1VHNA 1AL8A 3P82A 3NL5A 4FHAA 4O52A 5D04C 3LGEA 2X1SA 1YPFA 5TIMA 1R2SA 5I3FA 3OVPA 3YPIA 3DXIA 1X6UA 2LLEA 3LLFA 2TMDA 4N4PA 4S2BA 1B9BA 2RKXA 8TIMA 2C0AA 5KTLA 3EWBX 4WX2A 3LCFA 1H7PA 3M44A 3DKJA 3W7CA 2A0NA 1D9EA 4MFEA 5DXYA 2V2CA 4KWVA 1X7FA 4POCA 2RH9A 5LNWA 1O94A 4P61A 5G1TA 4JTSA 3INPA 1WX0A 3HG4A 3H55A 3GIYA 2G97A 4UMBA 2DZUA 1SO3A 4HT3A 5LNSA 1V5XA 2J88A 4HNVA 1XUUA 1O95A 3IRDA 4LS0A 4UTLA 1UBSA 4HPJA 5C5YA 1O5XA 1LLZA 3W1NA 3USBA 3MO7A 2QUUA 3PBVA 4HHPA 1XBVA 3BGGA 5HUPA 4K39A 3DFOA 1RQEA 5AC6A 4ADTA 4O53A 1KM2A 2WPBA 3M5ZA 4DPPA 1Q6OA 3QMRA 1OF6A 3W22A 1AW2A 5T26A 3V1PA 5F2LA 4GE8A 3S5OA 2V2DA 1LOQA 4YWIA 3MI3A 1KBJA 3P5YA 1YXYA 4TX9A 1PL9A 2W79A 4RLIA 1EP1A 2Y7GA 1C8VA 2DZWA 3S1WA 3NQAA 1D3HA 2CWNA 4JY9A 5AYXA 4KKXA 4JTKA 3W2MA 1U5JA 2Y88A 1MSSA 1W37A 1W3IA 2JKPA 1IIHA 1Q45A 5H2ZA 5F4SA 4AVFA 3SFKA 3W1UA 3SSJA 3W74A 1TV5A 4UTMA 3PSWA 1TRIA 1KTNA 2C18A 4JTFA 1SZNA 4MZ1A 3GAYA 3SGUA 3EX3A 1H61A 2Y7FA 3S1VA 3FOKA 1WBHA 4UCGA 4ALDA 3BG3A 5LNUA 3UWQA 5AHMA 3A21A 2QDHA 5CPMA 2QCGA 5HQEA 3TMQA 1WA3A 1NSJA 1KFKA 3SR7A 1W1ZA 3TNOA 2Y85A 2ZRXA 1JRBA 5G2IA 4O14A 3G1VA 1SO4A 1WBJA 1RQHA 2J9XA 2JK2A 3T55A 2GJLA 2QAFA 5I3GA 2Y6ZA 3IIZA 2I14A 1PS9A 3NVTA 1K03A 4QISA 2A1YA 4N2YA 1ME9A 1KLZA 3GDTA 5DBTA 4OU1A 1KV8A 1YTKA 3W2LA 5CPLA 1SR9A 3SW6A 1TCDA 1MEHA 3P60A 3W72A 5DY3A 2V0TA 1GVRA 4AWUA 5KZMA 3W86A 2R94A 5KZDA 3VE9A 4K38A 4MVAA 1OX4B 2C19A 4B5NA 1L9WA 3W7MA 1AW5A 1W0MA 1T8XA 3R2GA 3L9CA 1OFAA 5FI8A 3EKZA 1GEQA 2B7QA 4MZYA 4WOZA 3A23A 3W7GA 4MY8A 5AFDA 4UFJA 3SGZA 4UTWC 3GR7A 3JRKA 3NG3A 3MYPA 2YDAA 3PSVA 5DN1A 4MZ8A 2GJNA 3K30A 1OX4A 3ABOA 2XFWA 1LBLA 3P8IA 2E1DA 3G8EA 3L68A 4WXZA 4M6VA 1LRTA 1LRNA 4N6EA 4IOTA 5G1YA 3VE7A 3I7QA 3N2XA 2GQ9A 4JD4A 5F2MA 3TX9A 1GZGA 2EKCA 2QCHA 4S1FA 4H6KA 4Z0JA 2YGYA 3NZRA 4CNPA 3KFTA 4UMCA 3W7QA 3QM3A 1BWKA 4NJJA 4MLJA 1K8YA 2E6YA 1W56A 1FX6A 4JYEA 1VYRA 3S5YA 3W2KA 3M43A 1ZAHA 3UNDA 2X30A 3BLFA 1HUVA 2RDWA 1JCXA 3I6RA 3R89A 4UMAA 1RV8A 3LM7A 3TJLA 3QPZA 1T99A 2QCDB 4TU1A 1VRDA 1K7EA 3SZ8A 4E2BA 5DXXA 2PCQA 4M7TA 3TR2A 3S1XA 3W87A 1LP6A 3OVRA 3MHUA 3BW2A 4OT7A 1GPWA 3C3NA 2VC6A 2JBMA 3EB2A 1O60A 3Q37A 4R7JA 5DCDA 1KM6A 1X8FA 1O4UA 3ELFA 3T40A 2Y89A 1PVNA 1R2RA 2B4GA 4WY0B 3QC3A 2WKJA 3I65A 1PHQA 2VENA 3UXAA 4JIPA 1VC4A 2NXIA 3O06A 2OX1A 4NNAA 3AJXA 3M5YA 5FEXA 5DY2A 3ZWTA 2E5BA 1DVJA 1I2PA 3IVSA 1LORA 3QSTA 3FFSA 1A50A 1EWEA 4NJIA 3VFLA 3W1TA 3MP5A 4K8HA 3TW7A 1PCKA 2C1HA 4MIMA 2ABAA 3EX6A 4HPXA 5E1QA 4OWGA 3Q94A 1W54A 4GC4A 2J6XA 2C15A 1FCBA 4IWWA 2WSRA 4AHPA 4UTTA 3HIJA 4ADUA 3KVMA 1IXNA 4O28A 1DBTA 1ZAJA 5DLCA 1LBMA 1FXQA 3GNNA 1JUBA 3HOJA 2HMCA 1LTDA 3W76A 4KFNA 3IEBA 5BNKA 4M5PA 3MHFA 1OF8A 4MJMA 2YCEA 3BPWA 1HG3A 5G2HA 4RCXA 3JS3A 3KX6A 5FF7A 4Z08A 3P7YA 1FQ0A 1P1XA 2R14A 1EP2A 3GLCA 1XL9A 5SWUA 3WJZA 1H63A 1BWLA 3L66A 5D38A 1GT8A 4UFKA 1QFEA 5CKSA 1T96A 3BG5A 3NOEA 3BW4A 2DZTA 2X2GA 5BMXA 1UASA 1KFBA 4NNCA 2ZFAA 3GXTA 1XKYA 4NXKA 1DQWA 4E0CA 1H7XA 3UPWA 4GNJA 2H8ZA 1OYCA 3W1RA 4YLWA 5CSRA 4WY0A 1J4EA 4JXCA 4UTHA 4FEZA 5D30A 3HPSA 5FF0A 4JTEA 2J24A 4XBKA 5H91A 5F1UA 3HMJG 1W3TA 2WNQA 4ADSA 1EUAA 4ZQNA 1FY6A 3WJXA 3TAKA 4O0KA 2G96A 3HGRA 4Z1DA 1P5BA 3NPXA 4QSHA 4HNTA 3O15A 1NF7A 3L21A 3LHVA 1SPQA 4DPQA 1GVSA 4NVTA 2R8WA 4MLRA 3LCLA 2ZA2A 1KTCA 2EAWA 3VKJA 3M16A 2B0MA 4FNUA 3QFEA 1FWRA 4IUOA 3U6WA 2OCZA 5CZ0A 1P0NA 3UWYA 2G95A 1OK4A 1A5BA 3A9IA 3HF3A 3LTPA 4XKYB 4TMCA 1GTEA 1QPQA 7TIMA 4NUWA 4Z1CA 1OYBA 1NEYA 3QMSA 3UWZA 4DELA 5D03A 3NO5A 1H60A 4CCCA 4ONVA 2FTPA 3C6CA 4ZQPA 4UC5A 4ZQRA 3NQFA 2GOUA 3TW6A 2YPIA 2Z2UA 5ABTA 1TPDA 1PV8A 2Y63A 4HSNA 2ZZ1A 4CCEA 1Z42A 5K4XA 3PWAA 1OX5A 4N6FA 4WZHA 3NPVA 1TTIA 4O8RA 1LZOA 4CNNA 4FNTA 3EX2A 3QQ1A 1TB3A 4MPQA 4CQ9A 5I3HA 2JKEA 2YYUA 5CZTA 1B4KA 3M9YA 3NQGA 4GJ1A 3FYPA 4MOZA 1D3GA 1DKWA 5AC8A 2YW4A 1IF2A 3TCEA 5BMWA 1JR1A 1B4EA 3L5LA 4AHOA 3G8RA 2WO5A 5D2XA 4JIQA 3G1FA 1G7UA 1I2NA 1XM3A 1QNVA 3CIWA 4D2JA 4IX0A 1LM1A 4DO6A 2A85A 3E49A 1KBIA 1F76A 1LBFA 4QQ3A 3BLIA 4UFLA 2C16A 3LB0A 4X9SA 4MY1A 1J5TA 3PG9A 2FPVA 1LDCA 3IVTA 4DO5A 2FFCA 3WK2A 2I9EA 3BO9A 3W1MA 4LVAA 5HMSA 5J5DA 3UPBA 3NQCA 1FDYA 3UZ5A 3TC6A 5LKYA 1VQTA 3PUOA 3CEPA 1ZAIA 2WOQA 2YFNA 3U2OA 3EXSA 3WJYA 5K9DA 1ME7A 2OT1A 3R8RA 2E77A 4IPIA 4ZQCA 1GG1A 2GVJA 3G22A 3STCA 5J5RA 4WY0F 1KTBA 4Z0SA 1XI3A 3N73A 5AYYA 1L6YA 5D02A 3ABQA 4FXSA 3DAQA 3QF0A 4CNOA 1WOBA 1S5TA 3M41A 3GVGA 2B7PA 4C1LA 3PBUA 3WK0A 2P10A 4GUGA 3DFPA 3PR2A 5LGZA 4EOUA 1W5PA 2UV8G 2CW6A 2YYTA 3N19B 3A5FA 4O4WA 4Y8FA 3UWUA 4IGHA 1JQXA 4N9EA 3LHYA 3O6YX 1PIIA 4JYFA 1OFEA 4IXXA 3F4NA 3TSDA 1ZY9A 3HO8A 4QITA 4JS3A 3MP4A 1KFLA 1H7OA 1MZHA 1RQBA 2ZRWA 4Y90A 3B4UA 5CSSA 4NX0A 4IQLA 2HSAA 4KFOA 1M7PA 3MW7A 1WOAA 4BFAA 3THQA 1F6PA 1OFBA 2YX0A 2Z6IA 4M7SA 5F2IA 3SIZA 3TA6A 4YXGA 3IIVA 3B0VC 4FNRA 2E09A 1DL3A 3LERA 3T78A 5MHBA 4E38A 1N7KA 1X1ZA 3G1AA 3B0PA 2QCEA 4NU7A 4PL1A 1N8FA 4NJKA 1UCWA 5C2XA 3N34A 4O1CA 4QNEA 4UFMA 1ZNNA 5HWJA 1EUNA 1L6WA 5KSWA 2FLIA 1KLYA 1MEIA 2E5CA 3B06A 4EWND 4IMGA 5FF2A 2AQWA 2QCDA 3W84A 2DP3A 2HTMA 1JCNA 4HIBA 1GJPA 3KVKA 4ML9A 1VZWA 2H3BA 4LS2A 2R91A 1FWNA 3CLMA 2QJGA 2Z1BA 1TPEA 3LHWA 4O12A 1YADA 4RK8A 3E12A 2ZZ3A 3GKAA 5HJLA 1GQNA 4UUIA 4A3UA 4NJHA 3UD6A 1QO5A 2EHHA 3PB2A 3QEZA 2Q8LA 2ZDRA 1ZALA 1GVQA 5A5WA 5D33A 1MO0A 2DJXA 1WYIA 1OFPA 5IBXC 1WDWA 1I45A 1VHCA 5FF3A 5HULA 3W7NA 3WJSA 4LTSA 5EBUA 1G69A 4K8EA 1OHLA 4TIMA 3A24A 3W23A 5FESA 4ZVJA 2OT0A 1AW1A 3W7KA 4JICA 2FJKA 3N9RA 3CEUA 1XFBA 5EMUA 3W85A 3FKRA 1R47A 1OFQA 5U7SA 3U8GA 4N4QA 2FIQA 4DO4A 2QUTA 4PC8A 4RZ4A 4P2VA 3ZWSA 1ICPA 1T0OA 5HR6A 3PY2A 3M5VA 3A22A 1RR2A 4UR8A 4NX5A 2A4AA 2CZ5A 5AHNA 2DJLA 5AB3A 3T7VA 4YCOA 1SSDA 3NR0A 4MYXA 4N9CA 1KW1A 3W88A 3TXZA 3PF3A 2QCCA 1SSGA 2XN1A 4O10A 1ICSA 4XUGA 4K7VA 5L9FA 1M5WA 3LTSA 2FB3A 3QSRA 4RV8A 2ZTJA 5EL1A 2NV2A 4NQ1A 1IGSA 1VGAA 1K7FA 1OFRA 3LXCA 3L65A 3WJWA 1SW7A 3G0UA 4IJBA 3C61A 4O54A 2GQ8A 3GXNA 4LOCA 4YMZA 5IBXA 4LY8A 5DELA 3F4WA 4UR7A 2Z6JA 3F1QA 3W2NA 1GVFA 4FO4A 4QJ1A 4K7YA 2O7SA 4IPJA 1P0KA 3O63A 3F03K 2CZEA 4O11A 1H1YA 2DZSA 1H1ZA 4ZL1A 4O50A 3DHDA 4JN6A 5AHEA 1B3OA 1LLWA 1QOPA 1Y0EA 3FJ6A 1KM1A 5D2YA 3NQMA 5BRBA 1V7YA 2F7FA 3UWWA 1PCWA 3FIGA 2QJHA 3E02A 3G1YA 4A2RA 3DFSA 5AOUA 4O19A 4A29A 2JKAA 1TPUA 4A21A 2O7QA 4HKPA 2Q8ZA 3P84A 4LV9A 4AMAA 4LNYA 2NX1A 1F7BA 4JEQA 5HUOA 2A5HA 1Z48A 2Z0IA 4WD0A 5C6MA 1G4SA 3TFXA 3L0NA 3LI0A 5CZSA 2A7RA 3THAA 3H54A 2BLEA 3NZ1A 5I3JA 1W5OA 4LC8A 3NM1A 4LU0A 1RVGA 2JGQA 3KVJA 4ZMGA 5LGXA 3G1XA 4NNBA 1K8XA 1L2UA 3MWAA 1WAUA 4EF8A 3W7OA 1OFOA 3GX9A 2PRLA 5BOOA 3P67A 1PHWA 1QR7A 3L0KA 3TXVA 2EPHA 4R34A 2FB2A 3CB8A 1VR6A 3B05A 3TJXA 3W7RA 1LRQA 1VYPX 3TSMA 1QMLA 1F74A 3DENA 1EB3A 1R46A 4JDBA 3RK8A 4X3ZA 3S5ZA 2QCLA 4LV4A 1EA0A 1VH7A 3KRSA 3TH6A 3LX9A 3NQ7A 3W70A 3L0GA 2ZZ4A 2HS8A 4JTGA 1KM3A 4OV4A 5EKYA 4ZQMA 4XTIA 2HS6A 3ABRA 1DHPA 2TPSA 3HGOA 2ZQ0A 1UUOA 4FXRA 5CGQA 4AH7A 3W2JA 4JR5A 4DF1A 1R2TA 3B8DA 3JR2A 1W5MA 5F1VA 2ZZ7A 1GG0A 3FJLA 3WFAA 3MYOA 1FWTA 3G0XA 2QUVA 1MEWA 1K7XA 4HSOA 2GPTA 3O16A 1KFCA 3L67A 2C6QA 3GYEA 1TPB1 4DXVA 3I7RA 1TSIA 3QW3A 4Q33A 5HINA 4LT9A 3S0CA 2VEMA 4FIRA 4JYDA 3B0UX 3NXFA 4JTLA 3W1PA 4H4IA 3HPXA 2WV8A 3GKFA 2FDSA 3NL6A 3LHUA 4HNNA 3CWNA 1XCFA 2B7OA 1YXCA 1KM4A 3PG8A 1TPH1 5LHEA 1WQ5A 4IMEA 3G0SA 1EPXA 6TIMA 3V75A 1H7WA 4RJEA 3MHGA 5K2ZA 2E5DA 3EWZA 3TQKA 2G5WA 3UYCA 1AMKA 4GRSA 4KWWA 3HGSA 1B57A 2E6DA 4FX6M 4R53A 4JTJA 2ZA3A 1KA9F 2PC4A 1FCUA 1CX9A 1TTPA 2GUUA 4OV9A 1N55A 5EY5A 3M47A 3NL3A 2ZZ5A 1I2OA 4W9TA 3PM6A 3HG2A 3CT7A 4NJGA 3VI2A 1SW3A 2QJIA 1P4CA 4CCDA 2Y7EA 3NQVA 3BK0A 4DF0A 2WSYA 2OJPA 3TU9A 2NV1A 4UTJA 5D37A 2DZPA 1NF0A 1JVNA 4IXHA 2VFGA 1G67A 3PS7A 4AWSA 5KITA 2H90A 1FWWA 3EEGA 5U4NA 4GUFA 2CLMA 1QCWA 3GK0A 1GVOA 5HR7A 3ATYA 1W3NA 4I7VA 3HBLA 2NWRA 2J27A 2GVLA 4L4MA 1ZENA 4C1KA 5K3VA 4EF9A 3LHZA 3MI2A 4NXSA 3W6YA 4AHQA 3ZFHA 1FDJA 4GUJA 3RLVA 4JNMA 5CPNA 4Y9AA 3MI6A 3DI0A 2WQPA 3LDVA 3EWUA 3DH7A 2QCNA 1JJKA 4LUIA 4MKNA 5D2WA 1BKSA 1TV7A 3C56A 2A6LA 1FCVA 3DU0A 1OX6A 4IMDA 2A7NA 3KAOA 1A5SA 1J2WA 1I8JA 3OBKA 4WUIA 1XBYA 1HL2A 4RZ5A 3C2EA 2TSYA 4XZ9A 2XN2A 4MFDA 3HQ1A 3W1LA 1E51A 3G18A 6ALDA 3LRLA 1JUKA 2NX3A 2DZVA 4LS1A 4XWUA 3W1XA 5G5IA 1TQJA 1ONRA 4RXFA 4UTTC 5EA9A 1SZEA 1JCLA 1ME8A 3LXAA 3BVJA 3HG5A 5G2WA 1OJXA 4PTNA 1TTQA 1TRDA 4FB7A 2V2HA 1AG1O 1I4NA 3GAKA 5F2GA 4FNSA 3M7WA 3FYOA 1BTMA 3IGSA 3HG3A 5GVJA 5DCBA 5F4XA 2AGKA 4IMCA 4XBSA 1TPC1 4XTDA 1FCQA 1LROA 3T4CA 3L5AA 4KFPA 1TPWA 2QCMA 3WK1A 2E68A 3EWWA 4FNPA 3DHFA 5IM51 3S1UA 3W7EA 3LRKA 3R13A 4GXMA 1W5QA 1TPVA 1PE1A 5D2VA 3NQ6A 1F05A 1QO2A 3OHIA 4AF0B 4BI5A 3L2IA 4JGDA 1K3UA 4MY9A 3P5ZA 2OMAA 1NVMA 1S5VA 4HN4A 1O5KA 1VS1A 2PRHA 4LRSA 3QYQA 2ZBTA 3I68A 3M1ZA 3PUDA 4O15A 1YYAA 5G4EA 1A5CA 5KZEA 1TQXA 3QZEA 1XDMA 2VELA 1FDZA 2ATSA 2CLLA 1OYAA 3TE9A 2NUWA 5AHFA 1TTJA 3CIXA 1UB3A 1VLIA 1XXXA 5CG7A 2CZDA 4ORMA 3C2VA 2ISWA 4FIQA 4MYAA 3O1NA 2VFFA 4UTUA 1HO4A 4XKYA 2IQTA 5D32A 1LYXA 3I7SA 1QPRA 3VCRA 4AWTA 3DBPA 4AB4A 1W8SA 1VLWA 3IGXA 3LHTA 3QW4B 5FEPA 1SZFA 4PH6A 3TC7A 4BI6A 1OFDA 3KOFA 4K37A 3KVLA 5TBOA 4QM1A 3BGJA 2Y61A 4Y96A 3STFA 5LNRA 2W0UA 2EGZA 3RU6A 4QNWA 1Q6LA 3NPUA 1C29A 2VEKA 3NGJA 1DORA 1TIMA 3G3MA 3NAVA 4PL2A 2P1FA 1ICQA 1SW0A 1QWGA 1YDOA 2XN0A 2CLFA 3NQ2A 4O1BA 1AK5A 2WJZA 3CTLA 2BZNA 1H51A 2ZRVA 4BI7A 5DBUA 2RHGA 3DZ1A 4NT0A 2CZFA 1CI1A 1FXPA 2C14A 4WOQA 1QPOA 1RD5A 4AEOA 1SUXA 3R12A 4N9BA 3W7PA 5K7JA 3TROA 1TO3A 1F2JA 3HB9A 1H7RA 4PA8A 4TMBA 1ZCOA 2ZA1A 3WK3A 4M6QA 1NAL1 4JTIA 1XUZA 3C8FA 3O6DA 4CLMA 3TIMA 2WNNA 4ICNA 4RKAA 3OG3A 1SO6A 5D09A 4O16A 2J9YA 1I2RA 4BWLC 3C2FA 3PVFA 3ABSA 3OA3A 1SU5A 2TRSA 1OVDA 5G4WA 1Q3NA 1QAPA 1VCVA 3BW3A 3GDKA 2ATMA 3GDRA 5LNVA 3CM4A 3G3DA 4O18A 4UTWA 3NYZA 1QPNA 4UNLA 1ZHAA 4JX5A 3RLUA 2ABBA 1EEPA 3TKFA 1XBXA 3LCWA 3W3OA 3MMTA 4RZ6A 5A8GA 3IIOA 1WV2A 3LRMA 3N3MA 1HFBA 2CLOA 3UZJA 4I9AA 1ZJIA 4LVBA 4G1KA 3S8HA 1YDNA 3NA8A 3EWXA 2GQAA 2Y62A 4O57A 4YCPA 1GTHA 3DFQA 2CLHA 1JCMP 1Q6QA 4AF0A 3W83A 3UQNA 4EVZA 3IGUA 3T44A 1H62A 1F5ZA 1XDLA 2BSLA 1YPIA 2V8ZA 1JCJA 3LV6A 2NXGA 2CFFA 3QQ0A 1VPXA 1G4PA 1AL7A 5BW6A 1IXPA 4O0ZA 2F84A 3G24A 3NL2A 4GUHA 3W7DA 2VXNA 3TQ0A 4LUJA 4CQ8A 3NQDA 5C54A 2VKZG 4Y6GA 3LLDA 2YSWA 5L6UA 4BR1A 2V5LA 4BWLA 3MP3A 2A21A 1GOXA 1GYLA 3SJ3A 3HGJA 3N14A 3C0JA 3B03A 2FPYA 3W2UA 3NQEA 1QOQA 4LVGA 2X1UA 3LV5A 4DQWA 1K8ZA 4H3DA 1IIGA 1JUEA 3IIPA 3EXTA 3E9AA 4I7WA 4GFSA 3NDOA 3Q58A 2H8XA 1YLVA 4ZZ9A 2QCFA 4FX8A 5EYWA 1QDSA 3NEVA 3DKLA 3E0IA 3MUXA 2CU0A 4O1AA 3EWYA 3Q2DA 4GWEA 4ZQOA 2ZZ2A 1UUMA 2QR6A 3GXPA 4Q4KA 2X1TA 1EX5A 3PULA 3QJAA 1KFEA 1L6SA 3CU2A 1FBAA 4N02A 2NX9A 4IMFA 4Z1BA 1DV7A 3FEMA 1U83A 4X2RA 2V30A 1M6JA 2YZRA 5I3IA 2RDUA 2CLIA 1EP3A 3RMJA 3S42A 3BV4A 1ALDA 3ZR4A 1HO1A 1YXDA 3C2RA 3GB6A 2FQIA 3CC1A 2ZCGA 1I2QA 3LI1A 3PBWA 3HPZA 1BEUA 1C9DA 3DFTA 3P8JA 1H50A 3BLEA 3P81A 1SZGA 4TO8A 4JTUA 1W31A 3IVUA 4XQ6A 2NXHA 1TV8A 5D05A 1KM0A 4GBUA 1H5YA 1TJRA 5K9XA 2V81A 5E93A 3SI9A 4WJEA 2I1OA 5FF4A 3STGA 3GDLA 3W7JA 4NZJA 2YXGA 1SO5A 3BG9A 1WXJA 2NWSA 4DEFA 3O05A 4N9DA 4FX7A 4O17A 2TYSA 5E0KA 1TPFA 2DZXA 1F73A 4K6AA 3KHJA 4U4MA 4YL2A 3TDFA 1THFD 3FA5A 4U28A 3QMTA 5HWMA 5KMYA 4DBDA 2ALDA 2Q3OA 1SFJA 1ZFJA 4X22A 4MUZA 1W5NA 2ZRYA 3PBYA 4J9JA 2DU2A 4LW7A 4A2SA 2B7NA 4FNQA 1DJNA 1SQ7A 2YR1A 3DFNA 2RFGA 2PRMA 2PURA 2AAMA 3KRZA 4PEKA 4A22A 2PE4A 1KV5A 4O13A 5D2TA 4O1DA 5F4WA 4LRTA 2NLIA 4FF7A 2NUYA 2ZRUA 3OEXA 3W71A 1G7VA 3O8AA 3E96A 4PODA 3W1QA 4AXKA 3TUUA 2BWGA 1VJIA 3EKLA 4I7UA 3VNDA 4HNUA 1JCYA 3NQ8A 3MBFA 1EIXA 5LSMA 4Z1AA 3S5NA 2QKFA 4S2CA 4QIUA 3W7LA 2V9DA 1JULA 2BX7A 1UJPA 3LCXA 4K36A 4JTTA 1RZMA 1VYSX 1S3HA 3TAOA 1RPXA 1OG0A 3FKKA 1IXQA 3W75A 1OK6A 2DORA 4UFIA 3QH2A 1Q6RA 3R5EA 1G4EA 3OIXA 2ZTKA 3STEA 1LOLA 1JQVA 3G1SA 3PC0A 4JY8A 4OGZA 3M6YA 2W6RA 2Y7DA 3NPWA 1NFBA 1VCGA 3OVQA 5K9CA 3GNDA 3TFCA 3S9YA 3MJYA 3P74A 3CPRA 2VFHA 4ORIA 1A5AA 4M19A 3DGRA 4JX4A 5AN7A 3TMLA 4E2DA 3NM3A 1GYNA 4RX0A 3SY5A 3G1HA 3LOTA 1S5WA 3EX1A 1H7NA 2YFOA 3LBMA 4LWWA 5LZLA 3PAJA 3TK7A 4OE7A 4UTKA 3O6CA 4UTIA 5CZJA 3S6DA 2E6AA 1YDVA 2P0OA 3O07A 4PCFA 4WQ6A 3LCGA 4UNKA 3LCIA 2ZZ6A 3D0CA 1FUYA 3P62A 3QRHA 5LHFA 4O4VA 1LCOA 3W9ZA 1ADOA 1MXSA 2Y70A 1R30A 2WSQA 2A2IA 3PUEA 3EXRA 3UWVA 3TQVA 1M7OA 2A6NA 3CHVA 4BF9A 2V5BA 3BARA 4L4LA 1Z44A 3RNDA 3W7IA 2Q3RA 3RF9A 5AHIA 3H53A 2ZRZA 4EIVA 3B04A 2VEIA 3W07A 3W73A 2WNZA 5FEWA 3ATZA 3AO0A 4BK9A 4AAJA 1LOSA 1G6CA 1JRCA 4GUIA 3HJZA 5CPOA 3UY8A 3SECA 3FLUA 2QDGA 3L5MA 3TSBA 1TYGA 2A7PA 3UY7A 1K02A 1G4TA 4UFHA 4JTHA 4LVDA 5EPDA 2BTMA 2KZHA 1HTIA 2QF7A 3LCHA 4RR4A 2NUXA 3GR8A 4RXGA 1ML1A 1F6KA 3NNTA 4LVFA 3QPYA 3IIXA 2E6FA 2BXVA 3MBDA 1IXOA 3IV3A 1DQXA 3GDMA 2X16A 1GWJA 3W1AA 1DOSA 2YW3A 4R33A 3P80A 4NZFA 5FEZA 4LC6A 5DCEA 1FWSA 5TQLA 2EF9A 4JX6A 2VOMA
chains in the Genus database with same CATH superfamily
1KFJA 1NOWA 3ICJA 4U3CA 2D73A 2AL2B 4ERIA 4INFA 3FS2A 3OZMA 2FGZA 1KXQA 1YTEA 1V3IA 3OZOA 4OBTA 6ENLA 3EX4A 3WF1A 2OQHA 4QAIA 2VFIA 3KXQA 3G1DA 5AC7A 1XIGA 1WNOA 3PB0A 1SMDA 1T5AA 3IS4A 3N9SA 5CJNA 2CLEA 2H6RA 2QJMA 1TMHA 2H3DA 2V67A 4WIWA 3P61A 2ISSA 1HKMA 1VBJA 4W7UA 2D0GA 4Q32A 1XC4A 4DF2A 4TR9A 2ISVA 3WDRA 2PCEA 2QEZA 1SFLA 2IKJA 3C2OA 3IARA 1E4MM 3VGGA 2RDTA 2X42A 5I77A 2BHUA 3UXDA 4PMJA 5T9CE 4MJZA 1GJWA 3P82A 5D04C 4PB5A 1LQ2A 1YPFA 4AUBA 1HQTA 1Q7ZA 3NVDA 1B9BA 2RKXA 2PWFA 3DYMA 3TTYA 4M82A 3LCFA 3DKJA 1UH4A 2A0NA 1C91A 2A3EA 4GX9A 4HZ8A 3RCMA 1H09A 4LYQA 1OADA 4ZCWA 2W3ZA 2G97A 4AZIA 2DZUA 1SO3A 2XSBA 1TZ7A 1V5XA 3UZZA 4UTLA 4GMEA 2POTA 4HPJA 1LLZA 2VGFA 2BVWA 3W1NA 3USBA 3QQWA 3PBVA 1L0PA 1XBVA 2VO5A 4JQ2A 2XH0A 1RQEA 2XH7A 4N0RA 1KM2A 4DPPA 1R3WA 1RPKA 4AZHA 4GE8A 2ADAA 1US3A 4EPKA 1YXYA 1MYRA 5A94A 2PB1A 2W79A 3PJTA 3BUVA 4IIHA 2EPLX 1E72M 2EPKX 2CWNA 4AISA 5A2BA 4HN8A 2Y88A 4MNLA 4IP7A 4GCAA 5HQLA 3MMWA 1Z6KA 1M41A 3W1UA 3W74A 3S9IA 4GI4A 1QI5A 3S3GA 4JTFA 4HB7A 3TOYA 1ONEA 3EX3A 4EANA 1H61A 3AJ7A 3FOKA 3BG3A 5LNUA 2EO7A 2PDHA 4NYYA 1I0DA 2QDHA 3VDAA 4M1RA 5CPMA 1EGMA 2VEGA 3TMQA 3NO1A 2DGAA 2NQLA 4O14A 4F0KA 5LIUX 1WBJA 2JK2A 2GJLA 1TG7A 3S4TA 4A8IA 1GVYA 4YS1A 4N2YA 3EDDA 2VCAA 4OU1A 1KV8A 5HNTA 4PUKA 4IGSA 3RLGA 1PKLA 1TCDA 1GVRA 2WVVA 4AWEA 2R94A 1L2QA 4Y9NA 2NSXA 1XRFA 2C19A 3WEMA 1UHVA 1EEXA 2BOEX 1OD0A 1W0MA 3L9CA 1OFAA 2VEFA 3GTXA 1GEQA 4CD6A 3PUGA 3K5XA 3A23A 2E9LA 1HKJA 2VURA 1LQAA 2Y0FA 1YKWA 2CKRA 3SGZA 4UTWC 3PZOA 2PDNA 5CLWA 3JRKA 3NG3A 2OWXA 3MYPA 5DN1A 3KEHA 3KP0A 2OEMA 3ABOA 4B2DA 4MGGA 3EDJA 4P8WA 3CH9A 3ZJ7A 3MCOA 4QLJA 1LRTA 5A8OA 4QAWA 1LRNA 3H2AA 3U5UA 4DI8A 3VX0A 1XYBA 2GQ9A 5C9ZA 5F2MA 2YL6A 3AALA 2EKCA 2ZX8A 4QLLA 3NZRA 4DWSC 3KFTA 4UMCA 3H4WA 1V77A 4DUXA 4MM1A 1K8YA 2FHFA 2E6YA 1W56A 2ACUA 3S5YA 1PJ9A 3QTGA 1E6XM 4QR6A 3I6RA 2BOFX 1VRDA 4AEEA 2FZ9A 5DXXA 3S1XA 3W87A 4XZBA 1E4NA 3UXIA 3BW2A 1UD5A 4IQEA 2JF7A 3CLWA 3NSNA 3V3WA 1O60A 4NZ4A 3Q37A 2HNEA 3B4YA 4R7JA 3ELFA 1R9XA 2Y89A 1AZ1A 3WD4A 3QLLA 1JDDA 3QC3A 2C1GA 1UBPC 1AJZA 3UXAA 4JIPA 3FVMA 4AC7C 2ZUVA 3ZT6A 2PGFA 3AJXA 3M5YA 5FEXA 3WDPP 4IHCA 4DLFA 1R8LA 3MCNA 1W1A1 3IVSA 4I9TA 2ACQA 3DC0A 1XSJA 2C1HA 3EX6A 1GUVA 1W54A 3BLKA 3NGFA 4AHPA 2YDQA 1JZ4A 4UTTA 2YL9A 3BSMA 3DG7A 4PUJA 4C6PA 3KCLA 1RA0A 1LBMA 1FXQA 2XFFA 4R5EA 2HMCA 1XGZA 1A0DA 3IEBA 3MHFA 4FPSA 3GC4A 1C90A 1XICA 4PBFA 2YCLA 2O4MA 3MUY1 3PNZA 1M3UA 4CD7A 1XPGA 3WEZA 4YIWA 1NP0A 4Z08A 2BS9A 3PFRA 1SGJA 3KLKA 3PPHA 5BWAA 3L66A 4MKVA 4DZHA 3VABA 4GZIA 1T96A 3BG5A 2QJJA 3BW4A 1UASA 4NNCA 3GXTA 4NXKA 3UPWA 5DF0A 1JZ8A 4KEUA 2H8ZA 4KPLA 3OVGA 4YLWA 4GXWA 4RDWA 1F3WA 2BASA 3URBA 1V08A 1S46A 3NZPA 1X96A 5F1UA 3K1DA 1HP4A 2WNQA 3USZA 5FACA 5A6LA 1FY6A 1KXTA 1H49A 3N13A 1LF1A 3JW7A 3RX3A 4O0KA 3FX4A 4D1IA 1HKWA 2CZVA 3WLQA 2FKPA 1O12A 3O15A 2YL5A 4NVTA 2BXZA 4GINA 4RUBA 3CZLA 4QJ5B 4JFTA 3ID7A 5ABFB 3IAQA 3K8KA 5C71A 3KM8A 3UWYA 1VJSA 1XYLA 1D8CA 3LTPA 1QPQA 1PYMA 1PYFA 2C79A 4Z1CA 1UOKA 2IQDA 3NO5A 4A8NA 5A6MA 2FTPA 4UC5A 1KCLA 2GOUA 3T05A 4S3FA 2DSWA 2Z2UA 4HVXA 1RHCA 1OC7A 1TPDA 1G1YA 3AWNA 4HSNA 2ZZ1A 4B3KA 1Z42A 3WNOA 4WZHA 1DJZA 1W2VA 4CQ9A 1K9TA 1CXEA 4AX7A 4BEUA 2VVNA 3M9YA 1AD4A 1AH3A 3DX5A 1D3GA 5AC8A 2E1WA 4I8YA 1CWYA 2IKGA 2WLYA 4ZOEA 3VD3A 4GJJA 1J01A 3DHUA 1OC6A 4IX0A 1LM1A 5CAKA 1AMYA 1LBFA 4LCQA 4MDOA 3WUEA 2C16A 1KFWA 4MY1A 2PWHA 3AOFA 3VUSA 2VX4A 3AIUA 4MADA 4DO5A 2CHRA 2FFCA 2GGHA 1HJUA 3W1MA 3GTIA 2DSUA 4LVAA 5HMSA 4AZCA 4GIRA 1V3JA 1OEPA 3NQCA 1VQTA 3H26A 2QS8A 1JGMA 1TMLA 3E0FA 4IP4A 3HFYA 3Q45A 1EBGA 4X60A 1GG1A 3VD4A 4BF7A 3VMOA 1F3TA 1KTBA 4Z0SA 5AYYA 1H4PA 5D02A 3DAQA 3F2BA 4OVXA 1WOBA 1OSEA 1S5TA 1QUMA 4MSSA 3GVGA 1PBGA 1I1WA 3PBUA 4FP1A 3I4EA 3PTQA 2ON3A 5HDRA 3N19B 4Y8FA 2BY0A 1VIZA 5GJPA 5M03A 4QS5A 4MKSA 3KOWA 3LHYA 3O6YX 1PIIA 4JYFA 3R8GA 1OFEA 1DJHA 3AIWA 5I7GA 2BY1A 4QG6A 2J4GA 2PSNA 3MP4A 1IV8A 2BVYA 4PCSA 5FJIA 2OZ3A 2ZRWA 2INZA 1FKXA 3SY1A 2JEPA 1PB0A 1NQ6A 1GORA 2EBNA 1OFBA 4PR4A 3B8UA 1U1HA 3E2QA 3AZSA 3TA6A 5DMMA 1WPCA 3IIVA 4YTUA 4F0HA 1JG9A 4TX8A 4CD5A 2G3NA 4UQEA 3PANA 5MHBA 4E38A 3MSGA 1GKQA 4G8TA 1QRQA 1Z8AA 1E1CA 4GA8A 1UCWA 3T8LA 5HWJA 3FAXA 2PGRA 2FLIA 4XZHA 1KLYA 4PTVA 3B06A 3KVKA 1ZBCA 4QG9A 2R91A 1R3RA 1FWNA 4O12A 3FHQA 2A3BA 1OQFA 4IGNA 2J7HA 1TV2A 2C91A 4R3UA 3UD6A 3A12A 4AY1A 1XD0A 2D0HA 4D6EA 5MKGB 3AMKA 1JPHA 2ZDRA 1GVQA 1S2CA 2DJXA 1WYIA 3ARTA 3SJNA 3TN5A 5FF3A 5HULA 5LYRA 4LTSA 4ZA0A 3FA3A 1UH3A 4TIMA 4PMZA 3VYLA 2J79A 3U48A 4JICA 1JZ6A 3V5CA 1N8IA 1AJ2A 1AQFA 2PS2A 4NILA 1OFQA 5U7SA 3NYDA 2VC7A 3S2LA 3GTFA 2WW5A 3ZJ6A 3MTWA 3M5VA 5HATA 2R1NA 3H7UA 3TTQA 4H9YA 2FVMA 2DJLA 1GOWA 5CSYA 1SSDA 1H5VA 4MYXA 4PCPA 3V4BA 5GNXA 3PTDA 3SURA 3TXZA 3PPCA 3G5EA 3VXGA 4L6OA 5AC4A 3TOPA 5T8GA 1PDYA 1RJRA 4QFUA 3WH9A 3N6QA 1POJA 3LUTA 4RV8A 2FTWA 2ZTJA 5CZKA 3VIJA 3BOFA 4HPGA 2GJRA 3ARWA 4O54A 4HU0A 4LY8A 3F4WA 4A3YA 3I3DA 4RW3A 1GVFA 3N2BA 4QJ1A 2O7SA 4OOUA 3LQGA 3VO0A 3O63A 4Y9OA 3F03K 4L6HA 1FWIC 3N11A 3C2YA 4DJEC 4JN6A 5AHEA 4HCLA 1TE6A 1QOPA 4HSHA 5DX7A 3UWWA 3S46A 3E02A 1TKKA 3QV7A 2WWDA 3AHYA 1WKFA 4W93A 3WNMA 4HKPA 3P84A 2PMQA 1Q4NX 1BPLB 3IWPA 2V3EA 4AMAA 4QDPA 4LNYA 4BY3A 2CNCA 1W17A 4JEQA 1CB7B 2O9PA 3EA1A 5CG0A 1V79A 3THAA 3H54A 2BLEA 2DY3A 2NLYA 1W5OA 3NM1A 3W81A 5LGXA 3G1XA 3SCTA 1K8XA 1L2UA 3P0WA 3H2NA 1QPKA 4XVDA 3M4HA 2OEJA 2PRLA 3EPNA 3G6MA 3P67A 2AOSA 1X39A 2X7VA 4R34A 3AC0A 2BBFA 1G01A 3CB8A 1PTDA 1EOMA 1US2A 5XIMA 1LRQA 1VYPX 3Q67A 1E4IA 4JKMA 4HYVA 1FHVA 3DENA 1EB3A 4X3ZA 3S5ZA 1A5MC 1XP3A 3W25A 4UQCA 2WZHA 1Z32X 4HNOA 3NQ7A 2HS8A 4JTGA 5I3DA 4HMDA 1GGOA 4ZQMA 2L5HA 2WVSA 2ZQ0A 3HGOA 1WKDA 4TVCA 4OBRA 1B0IA 2PTZA 3JR2A 1UPMB 4MAVA 3MYOA 5M2FX 4HYRA 2IPWA 4FOJA 4HSOA 1T6MA 3WN6A 3CPUA 4ICMA 3XIMA 3S0CA 1YDYA 3K4AA 4I5RA 2W62A 3W1PA 1OGSA 2BHYA 4H4IA 1H2JA 2WV8A 1O1ZA 3MKVA 3WDHA 3MS8A 3LHUA 4HNNA 3UF9A 4BJHA 3N4AA 5A6BD 1V3MA 2PC8A 4XUYA 1EJ7L 1WQ5A 1QW9A 3LYEA 4CGTA 3LPGA 5K2ZA 3BAWA 5CCZA 2VDGA 2VT0A 4HU8A 1GHSA 3GNPA 3OW1A 2WANA 4D6JA 1B57A 3VC5A 4R53A 4FX6M 4JTJA 5A2CA 3C8NA 4MWAD 2OKTA 2HEJA 1CBGA 2GUUA 1EKOA 5EY5A 2ZZ5A 1JI1A 1I2OA 3PM6A 2JEQA 4W4QA 3CT7A 1SW3A 2QJIA 1OCNA 2BNJA 4CCDA 1OY0A 4LB3A 4S3BA 1JDCA 2DZPA 5A6BA 1NF0A 1XIFA 2E67A 4Y2WA 1FWWA 4GUFA 5CBJA 1YNYA 3GK0A 1DWAM 4I7VA 2NWRA 5CXPA 2CWXA 4C1KA 2Y5EA 4NXSA 4AHQA 2Q09A 5JBFA 1FDJA 4JNMA 2ZWYA 3H6OA 4MHBA 5D2WA 4WGHA 2YXXA 1BKSA 1BXCA 3C56A 1QWKA 4LYKA 3KAOA 1J2WA 2E9BA 1I8JA 3OBKA 3QZ6A 4RZ5A 4L5ZA 1SZRA 1IE7C 2DW7A 4MFDA 3HQ1A 3VTRA 2QUNA 1DWGM 2DZVA 3OU8A 3SCPA 1MQQA 4YTQA 2J66A 4XWUA 1M04A 2D0FA 3KWXA 7ODCA 1TQJA 1SZEA 1JCLA 1ME8A 1CXHA 4HMEA 4DYEA 5GPRA 1KB3A 1TRDA 1EBHA 1AG1O 1I4NA 4FNSA 2WWCA 2IS7A 4B92A 3FYOA 3IGSA 3HG3A 5GVJA 4LB4A 5DCBA 1F4HA 4GVIA 3OZPA 3M7SA 3ZJKA 2EJ1A 3T4CA 4JBRA 2QCMA 3WK1A 4FNPA 5EFFA 4AD1A 2BY2A 4HYWA 1PE1A 3KHDA 2OVLA 1F05A 1S39A 4O8AA 3IJ9A 3L2IA 4JGDA 5HNUA 3P5ZA 4P7RA 1NVMA 3IUDA 3T0CA 2WMIB 4H6RA 2PRHA 3RM9A 4DWDA 3BICA 4LRSA 5EGRA 2IKIA 3RO8A 2W67A 1PKYA 1GOIA 1JDFA 5JIWA 1FDZA 3CYVA 3VGEA 1OYAA 2NUWA 3ZO9A 1XXXA 1T41A 2ISWA 3RX2A 2QGYA 3A3HA 4UTUA 1HO4A 4ASTA 3WLKX 1XRVA 1XH2A 2HZGA 3I7SA 1QPRA 2CETA 2E25A 1VLWA 3LENA 4PH6A 1OFDA 4MB5A 3T2OA 3KOFA 4MJ4A 3BGJA 3BSGA 3CWHA 1FWEC 3W4RA 5FOOA 4NZ1A 2EGZA 4CN6A 3U7BA 1Q6LA 3L4UA 3BQ5A 1C29A 2VEKA 3NGJA 4GK8A 2RUSA 4J35A 1EYWA 3AHTA 1OT2A 1UR0A 2P1FA 5EB8A 1ICQA 1PZ3A 1FRBA 3P6LA 4FF5A 2XN0A 2CLFA 3GFXA 3EA3A 3WLNA 4O1BA 2ZXAA 1AK5A 2PDMA 2WJZA 2ZRVA 4L56A 5DBUA 4NI8A 1QXLA 3IRSA 1QI4A 5D9MA 1FXPA 2C71A 4XD3A 4MJ2A 1ADDA 1TVLA 1ZCOA 2ZA1A 4M6QA 4P7LA 2ZUMA 3UVAA 4E4UA 2NW0A 4CLMA 3TIMA 3MVIA 4ICNA 4JHMA 1PZ2A 3WQOA 2BB0A 1SO6A 4O16A 4ZFMA 3CO4A 3OA3A 3D6NA 5A8MA 1SU5A 2YJQA 1Q8JA 2TRSA 1OVDA 1YPXA 1W1YA 1QAPA 2GZXA 3BW3A 3GDRA 2ATMA 3HQPA 1SMAA 6TAAA 4D9PA 4IFRA 3CUZA 2GUBA 4J3SA 1QPNA 4UNLA 2HNHA 3ZOAA 3LCWA 3MMTA 1UJQA 2G3IA 3IIOA 3SRFA 3VINA 1VAHA 2R9RA 2WK2A 1OIMA 5T91A 3S8HA 4ZOCA 3QY8A 1QVBA 2Q6ZA 3E0LA 3E2SA 3H24A 4Q8PA 4AF0A 3W83A 4EVZA 1PWLA 3IGUA 2X0YA 1H62A 1UD6A 3WQ6A 1YPIA 1TVPA 3LSBA 4CEUC 1F4AA 1VPXA 2DSZA 1IXPA 3G24A 3NL2A 4GUHA 1Z9AA 4CQ8A 3N04A 1BGGA 1CNVA 1IWAA 1R7AA 4UZSA 4BWLA 2GVEA 4RW5A 4DXXA 1GYLA 3SJ3A 2OGJA 3C0JA 3B03A 1JF5A 3CNYA 2FPYA 1FHLA 2CPUA 1BHGA 2HBXA 1EOKA 3SCUA 1V7AA 3IK2A 4M29A 4WK9A 4H3DA 1IIGA 2POZA 4GBDA 1WDDA 3EXTA 1PSCA 3E9AA 4I7WA 1TWDA 2QCFA 1VFOA 4FX8A 1J0IA 1Y5VA 1RK5A 5EYWA 1QDSA 3E0IA 4AX6A 3GBEA 4F0MA 2CU0A 1UKPA 2TODA 2G3JA 4ZQOA 1UUMA 3EWDA 3NEHA 3PULA 5A95A 1FOBA 4FA3A 2WC7A 1FP8A 4Z1BA 1DV7A 3FEMA 5M1TA 1JNEA 1TUXA 1B3ZA 2ZXQA 4P7NA 1HO1A 3EDKA 3IJ7A 2AMXA 3GB6A 5BXSA 1I2QA 3HPZA 3MO4A 4WCJA 3DFTA 1C8XA 3P8JA 1H50A 4HMCA 3A4JA 4E4PA 3P81A 4DBUA 4TO8A 4JTUA 2WMIA 1V6VA 1IEVA 1AH4A 3WLTA 3CO8A 1GZJA 2NXHA 1HIZA 4AZ6A 2XFYA 5K9XA 2I1OA 4EP8C 5E0CA 2YL8A 4UZUA 4NZJA 3W7JA 1SO5A 2ZE3A 1WXJA 2NWSA 2SFPA 4NIRA 5JVLA 2WSKA 4FX7A 4RV3A 3B97A 1V0NA 4O17A 3MKCA 1DJIA 4ZODA 5E0KA 1TPFA 4M51A 5DRIA 1UPPA 1CCWB 2V5KA 3ZR5A 4W8LA 2OYKA 4L1GA 3KHJA 1J0ZA 3ZVHB 4C6EA 4R9XA 1XKJA 4C6KA 4DBDA 4HTBA 3PZUA 1POKA 4X22A 4MUZA 1W5NA 1XISA 2DU2A 2FHBA 4LF1A 2YR1A 2PRMA 1EC8A 2Z1SA 2PURA 3KRZA 1XFCA 3EWCA 2PE4A 2OYLA 5FSEC 4O13A 3NDZA 3WBXA 3RG6A 2NLIA 2NUYA 5EMYA 3O8AA 2VJXA 3R94A 4AXKA 5GNZA 3V7PA 3TUUA 1VPYA 4V1YA 1E71M 3CHEA 4W7VA 1EIXA 5LSMA 3PZGA 4WDXA 1EDTA 3UCDA 3ARXA 4QIUA 4M0XA 3W7LA 1ISYA 4H7ZA 1FH7A 1QW8A 2BX7A 1UJPA 1RZMA 1VYSX 3TAOA 1RPXA 3M46A 3E5BA 1OG0A 2XVPA 2X41A 3UG3A 3W75A 1OK6A 2X09A 2XVGA 1ZBVA 3UA3A 3OIXA 4H6QA 1A3HA 4H00A 1LOLA 1XS2A 1V0LA 2FTYA 4CU7A 4JY8A 1G94A 1R3YA 2W6RA 3SSZA 1VFMA 1F3EA 4PTXA 1XQKA 5A3HA 1ITCA 3CPRA 3L4ZA 2QJNA 2OZTA 3DGRA 3LPOA 3TQPA 4S3DA 3PBMA 1P43A 3GG1A 3G1HA 3HPAA 3LBMA 4LWWA 1KGXA 2HPIA 3PAJA 3TK7A 3H12A 2WLZA 3TYCA 3EPOA 1S2UA 3OA5A 3S6DA 4WQ6A 5DQPA 2FZMA 2I5QA 2FDMA 2GDQA 4W7WA 2Z00A 3LCIA 4W87A 1QTWA 3QRHA 5LIXX 1EZWA 4PSRA 1XIIA 2D3NA 4GCXA 3W27A 3U4AA 4WSKA 3QLDA 3PUEA 3EXRA 3UWVA 2YBVA 1UWQA 1RY8A 3WL0A 1GPFA 1YW1A 3RNDA 2VD9A 1K4GA 3RF9A 1E6NA 3EB4A 3H53A 3OBAA 4EIVA 2C1IA 2VEIA 7XIMA 3CQIA 1ZBWA 3QOMA 5FEWA 3VIFA 4BK9A 1JRCA 3HJZA 4GJIA 4WKFA 4MUPA 5M3WA 1KWKA 3R25A 3FLUA 4UQBA 1X6NA 3IK4A 4LXFA 4D71A 4US5A 4ZB2A 1SR0A 4JKLA 5JBEA 2A7PA 3O7UA 2P88A 5EPDA 2KZHA 1NWUA 3QGKC 1MNSA 1ML1A 4F9JA 4AD3A 5FAJA 2OU4A 1AFSA 4MPKA 3VIPA 3W01A 3MBDA 3EAUA 4M81A 1H3GA 4R33A 3P80A 4NZFA 5H8MA 4LAKA 2OZ0A 1US0A 1Q65A 4CQAA 5AYZA 5KINA 3E38A 3M0ZA 3OHMB 4QDMA 4JDYA 2GVGA 2DIEA 1OABA 4F2TA 1TREA 4I8DA 3ZS4A 3DI1A 3M5XA 5IDZA 5HMFA 3N2MA 1VCFA 4W88A 4OHQA 3PPFA 3HJEA 4DWSD 4PFMA 1K8CA 1PKMA 4LAZA 4D6IA 3BE7A 2VRJA 3AWOA 1F3XA 3CIVA 1Z41A 3CV7A 4OQVA 2W63A 1NP2A 1XYZA 4UXDA 3ANYA 1CECA 4M6PA 5AHLA 2VEPA 5G4HC 3HMCA 1J12A 2C3ZA 3TVAA 4O52A 3LGEA 2X1SA 1E43A 5TIMA 5CQ1A 5LIYX 4PTWA 3DXIA 5MKGA 1X6UA 1U30A 2YCLB 1QJWA 3LLFA 2TMDA 2YA0A 3U4FA 8TIMA 2J74A 1VEOA 4H8VA 3BCJA 1MRAA 4KH2A 2YCJA 4HCDA 3EWBX 3UERA 1NTHA 4WSJA 3B0XA 1Q6DA 4Y9PA 3W7CA 4GGBA 4KWVA 2PDGA 5CC6A 4IUGA 4POCA 1Q5MA 4U31A 4AW7A 5LNWA 3L23A 3NURA 2JF6A 1O94A 4P61A 4JTSA 1WX0A 4DJED 3GIYA 1Y65A 1EFZA 4AYSA 4HT3A 3MKKA 5LNSA 4HNVA 2WHLA 4RDYA 4LS0A 5C5YA 1O5XA 1J0JA 1PAMA 4ATLA 4HHPA 1CZ1A 1P1MA 2VCCA 1EJRC 3AZRA 5AZ1A 1IZKA 4K39A 4ADTA 4O53A 2XWEA 4U2ZA 1JZ2A 2Q8XA 3W22A 3H4GA 4AZ7A 3S5OA 1VP5A 4YWIA 1KBJA 4JHZA 1IGWA 1PL9A 2WZTA 4JL1A 1EP1A 4ZR8A 2Y7GA 4PSPA 1EO5A 3NQAA 4AZ5A 1DIOA 4JTKA 3W2MA 1W3IA 2JKPA 1Q45A 3WD0A 4GX8A 2XFRA 3H7VA 1Q7QA 1TV5A 3EBVA 4H9ZA 8XIMA 2PDLA 3UWEA 4E5TA 2C18A 3N6HA 4MZ1A 2WSPA 2EPNA 3PK7A 3UPMA 3ZIZA 4ML4A 1WBHA 4ALDA 1CLKA 3UWQA 4CKQA 5C7HA 2QGHA 2QCGA 5IDIA 2WPGA 1WA3A 1NSJA 1B3XA 4AQLA 1W1ZA 5CGMA 4HNLA 1JXJA 3G1VA 1SO4A 2J9XA 2EG6A 5E6ZA 3T55A 4LUTA 3CB3A 3IIZA 1RUSA 1PS9A 1VFLA 1K03A 1SVDA 3ITCA 1ME9A 5DBTA 2BVDA 1K9EA 3UFYA 5CPLA 1FWHC 2A79A 1MW3A 4F0LA 3W72A 2V0TA 3WFLA 3W86A 2REQB 3WNPA 3WF3A 3VE9A 5HK4A 3T4WA 4B5NA 4A8RA 5XINA 3W7MA 1X38A 4PB3A 3PBGA 3OIHA 2CKSA 3CH0A 5ABEA 1V6XA 3VM5A 4WOZA 3W7GA 1MXGA 2I56A 4FOKA 1OCQA 4MY8A 1Q6GA 4PBEA 2I7GA 1V0KA 4TVDA 1XPYA 3GYCA 3GR7A 1B31A 2P53A 2WMJA 2YDAA 3PSVA 4Q4OA 2GJNA 2YZ5A 3K30A 2XFWA 1LBLA 3P8IA 3G8EA 1J0HA 4QBXA 3L68A 2AMGA 4WXZA 3MPGA 3WLIA 1NOUA 2J77A 4N6EA 3FY1A 1RA5A 2GJPA 4JD4A 4S23A 4FR6A 3TX9A 1FHDA 3OTRA 4S1FA 4H6KA 2YGYA 4CNPA 2J47A 3HV9A 1QU4A 4HHLA 1BWKA 2EEXA 2J62A 3LG3A 3ZZ1A 1ZQ5A 4JYEA 1VYRA 1W1TA 2DV0A 4XD5A 4OZOA 1FH9A 2E8ZA 3UNDA 2R1LA 1O68A 2X30A 1HUVA 2RDWA 2FVKA 4JTQA 4UMAA 5ECUA 2QCDB 3VZZA 2HISA 4TU1A 1BSIA 1G9HA 4E2BA 1SYTA 2XWDA 4M7TA 1TVNA 2QIWA 2W61A 1GPWA 2O9TA 3ITYA 4AVNA 1A80A 4NY2A 2EXOA 4DJFC 2V68A 3EB2A 1ELSA 1XLKA 2VMFA 1ITUA 1NY1A 1X8FA 1VFHA 1RLDA 1PVNA 3E0WA 3WLRA 3SB0A 4WY0B 1ZUAX 1UD3A 1BYDA 1C3FA 2ODOA 3WLPA 3BJTA 3WFZA 1WKYA 1WO2A 2FVLA 4M56A 4ZO9A 1C93A 1JPKA 3FFSA 3W0KA 2BGNE 1VIWA 3UU0A 3VFLA 3W1TA 3TW7A 3R79A 1PCKA 1UQZA 2ABAA 4HPXA 6REQA 3BCFA 4GC4A 1W32A 2J6XA 3RRXA 3O6AA 3VGDA 4WR3A 4F4RA 4WGXA 4GQ0A 3HIJA 7TAAA 4ADUA 3KVMA 3DERA 8RUCA 1TWZA 1JYVA 1C8YA 1BKHA 2EG7A 4HCHA 3ANUA 4DB7A 3KS5A 1UP0A 3QFWA 4KFNA 2PU1A 5BNKA 4L61A 5H6HA 1OF8A 7REQA 1DWIM 3BPWA 1I0BA 1HG3A 4RCXA 1U5VA 3JS3A 4GFIA 3II1A 3JU2A 3GVRA 4PUEA 2XYLA 2J7DA 4ZFCA 4A3RA 2R14A 1EP2A 5A69A 5AVHA 2CXGA 2ZUUA 1W6TA 1GT8A 4UFKA 1QFEA 5CKSA 4HTYA 2DFAA 3NOEA 4RE2A 2X2GA 1W1IE 2ZFAA 1XKYA 1M01A 1AUSL 4R85A 2J6VA 2Z1XA 4E0CA 1XHGA 1H7XA 4TTGA 3R58A 3GNRA 5AKQA 4WY0A 3GH7A 3QR3A 5D30A 1EJXC 3HPSA 4JTEA 3HMJG 3WQ5A 2GOKA 2W5FA 2OX4A 1SM9A 5JH2A 3WJXA 5F7UA 4WF7A 3TAKA 2XGZA 7ENLA 1VFFA 4Z1DA 1P5BA 1R86A 4XD4A 2FH8A 3NPXA 4LBUA 4S39A 1PO9A 2P0IA 3LA4A 2V38A 4I3GA 1GVSA 4DNHA 3AMDA 4Y7EA 2ZA2A 2G3MA 3D47A 2EAWA 3AUJA 3M16A 4YYFA 2GK1A 2B0MA 1XH0A 1FWRA 3N6JA 4IUOA 3U6WA 3KS6A 2QPSA 2OCZA 1HGYA 4Z42C 2FGLA 4ILSA 3WQFA 2FMOA 3SY8A 2UY3A 5REQB 1CXIA 4DM1A 1AODA 1OYBA 3UWZA 4G7EB 5D03A 5FIPA 4CCCA 3SUSA 3C6CA 1J6OA 3TW9A 1JD7A 2IXUA 4F66A 3TW6A 3CMFA 3PZTA 1MW2A 3F2CA 1W1PA 1CXKA 4CCEA 2ZX5A 3IJ6A 5K4XA 4N6FA 3NPVA 1TTIA 4O8RA 3QQ1A 4MPQA 4Q7IA 2X8RA 2GGGA 1XW8A 2G4JA 1CXFA 1B4KA 2P76A 4YHEA 1CLXA 3ABZA 3QVQA 5BU6A 3NQGA 4RPQA 3QBUA 3V16A 1VF8A 3TYAA 2O0TA 2AL1A 3FDKA 2OELA 4JIQA 4F2UA 1G7UA 1QNVA 3CIWA 3KBMA 1YRRA 1F76A 1QHPA 3BLIA 4AD4A 1NDVA 3LB0A 3HM7A 4DBSA 3PG9A 4YPJA 3UJFA 5JUVA 3BQ6A 1KCXA 3VU2A 3WK2A 2I9EA 3BO9A 3TLQA 2WMKA 5EMMA 5J5DA 4J28A 3GG8A 1FDYA 3UZ5A 4LX4A 4XAGA 1E3ZA 1WZKA 3K13A 1S3TC 3RPTA 3WLJA 2WOQA 2YFNA 3K2GA 1Y8BA 3ALFA 3OG2A 3H2FA 1VBUA 2E8YA 3G22A 3GIPA 5J5RA 1QHZA 2VZOA 1F07A 1Q13A 4L4PA 3WBWA 3ABQA 1OB0A 5FJRA 2X0SA 4GPNA 3L4XA 4D8AA 4F0SA 5A6SA 5EFDA 3WLSA 2UV8G 2CW6A 5CSUA 2YYTA 3ITTA 3A5FA 3UWUA 4HJWA 3VD7A 1JQXA 5D9OA 1LJYA 3B9OA 2HRWA 3F4NA 2ALRA 4QITA 4JS3A 1H7OA 2BG5A 1MZHA 1BQCA 1RQBA 1PWMA 3GQYA 5CSSA 2JALA 1RAKA 1RJPA 2AAAA 4PMUA 1BWVA 1KRMA 1UD8A 4NX0A 3WUBA 4KIEA 3PPGA 4IQLA 2HSAA 4RDVA 3I6EA 3THQA 1F6PA 5IOBA 3CAWA 1XIJA 4M7SA 3TYZA 2Y2WA 3SUVA 3B8TA 5F2IA 3SIZA 4YXGA 1KC7A 1OC5A 3KLLA 2W92A 3O9NA 2E09A 1DL3A 3B9AA 3T78A 2KX9A 3MSYA 4XBJA 3COTA 1EO7A 1U1JA 4KETA 1M7JA 2OOFA 2VZUA 4NJKA 5TF0A 4L1WA 1R0MA 1ZNNA 3WBAA 2YBTA 3T2QA 4YNGA 5KSWA 4WDUA 1KCZA 3ZVIA 3KRBA 3LGGA 2AQWA 5AZ0A 3HU7A 3W84A 2DP3A 3VOFA 1JCNA 1BYCA 4HIBA 5GQBA 4ML9A 1VZWA 4LS2A 3ITVA 3RILA 4ERAA 2VZVA 2Z1BA 3CLMA 1TPEA 3LHWA 2RDXA 2I17A 2OXNA 1O5RA 3GKAA 5HJLA 2MUCA 1QO5A 1Q6CA 3FV9A 1IT0A 2X05A 4GI6A 4P8UA 4CVUA 1ZALA 5A5WA 1EL3A 2PGWA 1OFPA 3UZWA 1I45A 1GVEA 3VIMA 5A8NA 3WJSA 5FCZA 5EBUA 2PDCA 1G69A 4IIGA 1KR1A 3EYPA 4YTTA 5FESA 1ISVA 3W7KA 3IJDA 4L65A 3CEUA 1XFBA 3DG3A 3AQUA 4FALA 1R47A 4XZMX 1UW9A 2QXWA 1FWJC 3QYSA 2D20A 4PRRA 3MUIA 5HNNA 1A49A 4KCWA 1S2WA 1ICPA 2WJFA 4F9DA 1T0OA 3A3XA 2F61A 4PMVA 1S1RA 2V5DA 2GUYA 5AB3A 2FH6A 3T7VA 4N9CA 3WH7A 3QTPA 1SSGA 3ZSSA 1ICSA 4K7VA 4DYKA 2HCVA 4KCUA 1HKVA 3AYRA 2DT0A 2FB3A 3QSRA 1XWYA 3GBDA 5EL1A 1IGSA 1OFRA 3BLPX 4W84A 3WJWA 3C61A 2GQ8A 3GXNA 1DE6A 4A4AA 4LOCA 4YMZA 2GWGA 4M8UA 5DELA 1E1EA 2YDRA 3MUAA 4LAUA 4GIEA 4MNKA 4OKDA 4IPJA 4C5YA 4HA3A 4C6DA 3V0SA 1H1ZA 2OQYA 1UA7A 3SFWA 4O50A 3DHDA 3AIEA 1B3OA 2OO0A 1A47A 1LLWA 3FJ6A 4Q4SA 5TD4A 2FYMA 1V7YA 4ZSUA 4ACYA 3G1YA 3GM8A 2JKAA 1TPUA 2O7QA 4K1GA 2AL2A 2IQ0A 4JHOA 1B30A 3LU2A 4F2BA 4C65A 1F7BA 3C0SA 5LIKX 2PAJA 4UTFA 4AC1X 1W9DM 3NSXA 5HUOA 2A5HA 4DHGA 2Z0IA 1TWIA 2QDDA 4WD0A 2WZEA 5HQMA 3AS0A 3TFXA 3L0NA 5D9NA 4IFOA 5I3JA 2QHAA 2NQ5A 1RVGA 2JGQA 2VP8A 4ZMGA 3IV8A 3VNKA 4PULA 4EF8A 4IIDA 2YXOA 3GX9A 2Y1HA 5BOOA 1PHWA 3L0KA 1XYMA 4MWAA 4IMAA 6XIAA 4HA1A 5CPTA 3H2MA 4FOUA 3UNTA 3TJXA 1JL8A 2GJXB 3TN3A 4AIOA 1F74A 3RK8A 2QIIA 2QCLA 1EA0A 1VH7A 2QYGA 2WHKA 3LX9A 3ZR6A 3M0MA 4IQJA 3CUIA 3VZXA 2ZZ4A 5I0DA 4OV4A 2HE8A 5EKYA 3DECA 4PN2A 2YB1A 1YX1A 4XTIA 3CQHA 3VIOA 3AYSA 2HS6A 3ABRA 4XVEA 2V5JA 4Q8UA 5CGQA 1XLCA 4EWJA 4K68A 2VGBA 1ZRQA 1FWTA 3G0XA 1W91A 4WDWA 2QUVA 3EMQA 2IPFA 2GPTA 3PHAA 1HP5A 2J7BA 3BSHA 3GYEA 3MVTA 3A4AA 3UXKA 4DXVA 4Q33A 1TSIA 3QW3A 3CMGA 4LT9A 2VEMA 3ARPA 3NXFA 2HVMA 2R6OA 1XIDA 4JTLA 4DAIA 1MQPA 4C6LA 3GKFA 1SFSA 4GY1A 1XV8A 5BU9A 5HMEA 2VGIA 1XCFA 1KM4A 5LHEA 2W91A 1R3VA 3G0SA 3VUPA 3KZPA 1RSCA 2E5DA 2BGQA 1MMFA 4E8GA 3TQKA 4GRSA 2J78A 3HGSA 1E1CB 3P2VA 4ZENA 4KGJA 1DQUA 1KA9F 3ARRA 2PC4A 1FCUA 3UZYA 1CX9A 5H8PA 3M47A 3NL3A 2PBOA 4W9TA 4NJGA 3D5HA 4G2DA 2WSYA 2NV1A 4UTJA 4EX4A 4IXHA 2VFGA 3PS7A 2CCRA 3N1AA 5KITA 3EEGA 4MDPA 3FGCB 3MV11 1E6PA 1W3NA 3ATYA 1RD6A 4XAYA 4L4MA 5K3VA 3U3HA 3PTKA 4Q4RA 3RR4A 5A8PA 3RLVA 4GUJA 4I9JA 3MI6A 3DI0A 3N17A 2WQPA 2QCNA 4LUIA 5CAHA 2Y8VA 1TV7A 4C7DA 1FCVA 1XD1A 3FDGA 1OX6A 2A7NA 4RE3A 4NRSA 2VX7A 4LUSA 4WVXA 4PMRA 3TZFA 4QE1A 1KO0A 2B81A 4PCTA 2QQ6A 3NWRA 4CQBA 5GJNA 2TSYA 3LS9A 3AIBA 3W1LA 1E51A 5DEZA 3LRLA 3W53A 4IF2A 1ZPTA 1EGZA 2J7FA 3S47A 1RCOB 4HU3A 5G5IA 4LUYA 1V02E 3M0JA 4UTTC 5EA9A 5G2WA 2GSEA 1OJXA 2WMFA 3ABXA 4FB7A 2PLCA 2QDEA 1CGVA 3BLDA 4AEFA 1A5NC 3CQKA 5F4XA 2AGKA 4IMCA 4XBSA 4EXQA 3H2OA 4XTDA 4PRWA 4KCTA 4XV0A 1C8QA 3GW0A 1S5MA 4XAZA 1FCQA 4KFPA 1TPWA 1R3QA 4C6JA 2GSJA 3QOKA 1CXLA 2VNCA 3DHFA 3VK5A 4MG4A 1BXBA 3W7EA 3R13A 1W5QA 3CPGA 1TPVA 5D2VA 1J9YA 4K3ZA 1MI3A 4BS0A 3ONCA 1QO2A 4EKJA 3KL5A 4HOZA 3WMSA 2D69A 2X2YA 4MY9A 2Z7GA 3AS3A 3AHZA 2PDXA 4C6NA 3HFTA 4HHHA 4FLQA 1VS1A 4GYPC 1X6LA 1TE1A 3I68A 3M1ZA 4R27A 3PUDA 2G50A 1YYAA 1BVWA 4X9YA 5G4EA 1V6UA 4FLRA 4CCZA 4J3XA 4JKKA 1XDMA 3CL7A 3LLXA 3KTXA 1S2VA 2CLLA 1E3XA 3TE9A 1TTJA 2HQAA 4NF7A 3UXLA 5JBDA 3AROA 1SJBA 1UB3A 3GVVA 2CZDA 2UY2A 4US6A 4UCFA 2WC4A 4U3AA 3O1NA 1AZ2A 3GO2A 3FXGA 4B5TA 3TYUA 4NHVA 4L6DA 4AWTA 2YA1A 1DEDA 2YDSA 5LXXA 3DHPA 6PTDA 4AB4A 1EQCA 3B8WA 3IGXA 3LHTA 5FEPA 3TC7A 1E6QM 4DZIA 4UNIA 4DRSA 3K8LA 2Y61A 4Y96A 3STFA 3T0DA 4P8VA 2XIQA 1PIFA 1TJ0A 3L4WA 4QNWA 3WBYA 3IAPA 3TZNA 1ODUA 2OKOA 1XH1A 4AG0A 5C0QA 1DORA 1R3TA 4KWUA 4QEHA 3G3MA 3B9EA 1KQZA 3UJ2A 5XIAA 2XGIA 2PTXA 1SW0A 3E1F1 1JDEA 1UH2A 3LD5A 1OG6A 3WQCA 4HU4A 1K70A 2E7FA 1FWGC 4WOQA 4JTDA 3R12A 3GXIA 4J2PA 2AKZA 1WKEA 4ZGYA 1E56A 3N29A 5FSDC 4TMBA 1MQRA 2PD9A 4JTIA 5CC5A 3OG3A 5HOSA 3SCNA 2O56A 2WM1A 5D09A 5I23A 4JN8A 4F79A 1WDSA 4CVWA 1Q7MA 3WUFA 3ZXWA 1SJCA 3CM4A 4GABA 4O18A 1P6CA 4JCLA 3H2EA 4IG2B 1AA1B 5A8GA 2PEVA 1WV2A 3LRMA 1P6WA 2QPXA 3UZJA 4LVBA 2WKGA 3BZGA 1V3HA 3EWXA 3S6TA 4Z2JA 3QKEA 3CAQA 4JNYA 1JCMP 1Q6QA 2ESCA 3T44A 3IACA 1GW9A 1XDLA 5A6AA 1JCJA 1PTAA 2ZE0A 3QQ0A 3AICA 2F84A 3R0UA 2VKZG 4QLKA 1OZMA 1ZU8A 3LLDA 5L6UA 2V5LA 1TIWA 1KXHA 1ZJHA 1JYNA 3HQOA 2Z26A 1UKSA 3D3AA 4UWMA 3T9PA 3FJ4A 2DZBA 1K8ZA 3FA4A 3LEPA 3VKKA 3MC5A 5LXEA 3M0YA 1YLVA 4ZZ9A 1E9IA 3BDKA 2CITA 2OSXA 3DKLA 3GHSA 1E5JA 3MUXA 3FAWA 2VQTA 4KF1A 2DSVA 3EWYA 1VEPA 4E2VA 1A4LA 2QR6A 3GXPA 4Q4KA 4Z17A 3QN3A 5CLTA 1EX5A 3QJAA 3SM0A 5I06A 4JTCA 3CU2A 4IPPA 2BY3A 2NX9A 4PB4A 4EE9A 3RCNA 2OZ8A 1WB0A 3AI0A 4C1NB 3CV1A 3QPEA 3ZR4A 1W9PA 3S2NA 4O1FA 3LI1A 3PBWA 2FFIA 1JAKA 4QROA 3VNMA 3WNLA 1GW1A 1SZGA 3CHCA 1YNQA 2WC3A 1TV8A 5D05A 1KM0A 4GBUA 2IMRA 3B8VA 3VVGA 3KL0A 1CLVA 5CEWA 2WVUA 1CEOA 4S3KA 4JFSA 3E2VA 3GDLA 3BG9A 4H8NA 4DEFA 3O0KA 1E0UA 4Q8VA 4GVGA 4J3WA 4UQDA 4PE8A 2XH2A 3EKGA 5IFPA 4A8LA 2DZXA 1F73A 1P48A 3VOHA 1THFD 4E8CA 5KMYA 4KRZA 1ZFJA 4X2PA 3ARZA 4S3AA 3BV7A 2W9MA 3PBYA 1N8WA 4KMQA 4LW7A 2VX6A 4FNQA 3OOQA 3BANA 2RFGA 1O5QA 3MQTA 1VENA 4A22A 2V63A 5D2TA 1EF2A 2ZRUA 2YBUA 1MFVA 3OGSA 4BKNA 1UWUA 1EPVA 4OUEA 3RM8A 2BWGA 3VNIA 3CAKA 1EDGA 1E6ZA 4I7UA 2O9RA 4PZVA 2DIJA 1E40A 3MBFA 4Z1AA 3S5NA 2BGSA 3GXFA 3TA9A 4HNCA 2V9DA 4CUCA 4K36A 1S3HA 1VFUA 2PDYA 2PF0A 1IXQA 3O3RA 3PZQA 2INEA 2DORA 4UFIA 3R5EA 5BRPA 1JGIA 4Q4MA 1S38A 1WUEA 3PC0A 3M6YA 3EZ4A 1NFBA 2UWFA 1VCGA 4J27A 1MFUA 3R8HA 2PWVA 1NH6A 3AIVA 3TFCA 3P74A 4J1OA 4GI8A 3GH5A 1MRQA 2VFHA 1E0XA 4ORIA 4JX4A 1KXVA 5AN7A 5CBIA 3DUGA 1UOZA 4IGMA 3VGFA 4RX0A 2JFEX 4F8XA 3LOTA 1DJGA 4E4FA 2VDIA 4UTKA 5CZJA 5FL1A 2D1ZA 3SN4A 1YEYA 2E6AA 4HK6A 3ITOA 1A5UA 4PUDA 3N4EA 1K9DA 1H0IA 2ZZ6A 5LHFA 3DYPA 3W9ZA 4TQTA 1MXSA 2XVLA 1R30A 1BTCA 9XIMA 3WLHA 3TQVA 4J40A 4CNSA 4NZ5A 4BF9A 4ZB0A 4ATDA 2V5BA 1Z44A 3OYXA 3TEVA 5AHIA 1I6NA 3M6DA 1A3WA 3W07A 1PZ0A 3W73A 3ATZA 1GKRA 3WQGA 1LOSA 8CGTA 4DO7A 4Q8QA 3UY8A 5BXRA 3L5MA 4QEEA 5IFTA 2WVVB 3TSBA 2OTDA 4KIRA 3UY7A 1K02A 2OLAA 1IR1A 2BTMA 2QF7A 3CMJA 5D4YA 2NUXA 3NSMA 4IT1A 3NNTA 3EB3A 4DI9A 3OZYA 5LA0A 1IXOA 3IV3A 3GDMA 4LYRA 2CERA 3CK5A 5DCEA 4YU1A 3ENLA 3SO7A 2HXTA 4JX6A 3AXIA 4V28A 2EF9A 2OSWA 4B5XA 2D24A 1MUWA 5I3KA 1R7OA 1BAGA 3CWOX 1XBZA 2QAPA 1YBQA 4C6MA 1M7XA 2X1RA 2VFEA 3TCSA 4BHYA 3CZGA 3VD9A 3M0IA 1KM5A 1ZP3A 2VDHA 1OWQA 3W7HA 1CGTA 1K9FA 1YTDA 4DUOA 4J2MA 4EAYA 2V82A 1NDZA 3A5VA 1IHIA 1UMYA 3KBWA 3F4DA 3EGJA 3EDEA 5C55A 3N18A 3KRUA 4AIEA 4WXYA 2ZX6A 4QX4A 2F6UA 2JGYA 3C4UA 4L9XA 2C8NA 5E0FA 3RFAA 3WD2A 8XIAA 5B80A 3GR4A 4PMDA 1ENUA 2CLKA 2O4QA 3UBPC 3GTHA 2J9ZA 1CW2A 2VFDA 3CUFA 3LBOA 9XIAA 3M07A 1IEQA 4QRNA 1VHNA 1AL8A 3NL5A 5I3FA 3H23A 3OVPA 3GH4A 4DBWA 2Q02A 5BWFA 1VJZA 4N4PA 1W1VA 3POCA 1F9CA 4CQDA 2C0AA 4LAOA 1IQ8A 4WX2A 3AHVA 4EXBA 5CJ5A 3GTNA 4NL1A 2V2CA 1X7FA 3AS2A 3RR1A 3HG4A 3H55A 3VNYA 1X8CA 4UMBA 4HGXA 3VOIA 3QY6A 1O95A 3IRDA 2JIWA 4GZEA 1UBSA 3WDJA 4G9PA 2X1IA 2PWUA 3RYSA 3UR2A 3RIKA 3MO7A 2QUUA 3A4XA 3DBNA 1JF6A 2FZDA 3BGGA 3BGAA 5HUPA 5ABGA 4LCSA 1XIEA 4KQNA 3G6LA 3LSCA 1UZDA 2WPBA 3M5ZA 4L64A 3SCRA 3QMRA 3JVAA 5F2LA 2V2DA 1LOQA 3PZ9A 3WELA 4AIBA 4TX9A 3PZNA 1HL8A 4L80A 3KWSA 4ZOAA 2DZWA 2XH4A 2BFGA 4Q8NA 4H9MA 2ANUA 1HKKA 3LN3A 1U5JA 1MSSA 1W37A 5H2ZA 4S3EA 1L6FA 4KRUA 5F4SA 2A3AA 1A3XA 4AVFA 3SFKA 4XZIA 1TA3B 2RJHA 3JZUA 2BXYA 3PSWA 1TRIA 1KTNA 3WQDA 1IZCA 3SGUA 3GRIA 3S1VA 4OECA 4UCGA 4GNVA 3ZMRA 5AHMA 3A21A 5TAOA 3URAA 5HQEA 3SR7A 3TNOA 5C2GA 1JRBA 5G2IA 2PDFA 3VIGA 1RQHA 2ZC1A 4CNTA 1ZJAA 4HP5A 2Y6ZA 5I3GA 2I14A 3GG7A 3SUUA 4QISA 1FA2A 3GDTA 1XGEA 1D7KA 5EMJA 1SR9A 3WF4A 3SW6A 1MEHA 2E40A 3P60A 5C70A 4KWOA 4AWUA 5KZMA 2GVYA 4ZE5A 1WXZA 2REQA 5H1WA 3B3DA 3VDGA 4K38A 1OX4B 1AW5A 3B40A 1T8XA 7REQB 5AYIA 5FI8A 3EKZA 2B7QA 4MB1A 1QK0A 2PP1A 4G7EA 2XIIA 4EXAA 3SAZA 2XVKA 4DWSB 5JIPA 1NWTA 5AFDA 4JEJA 4UFJA 4HPNA 1B3YA 3UR8A 4LSBA 1KBKA 4ZOBA 6XIMA 2DEPA 4RZBA 3FNDA 2E1DA 2GK1B 4ROQA 4M6VA 2ZUWA 2QMKA 3DGBA 4TV6A 4C7FA 4IOTA 3VE7A 3UT0A 4PEEA 4K1WA 1EF3A 3N2XA 2EPOA 3ALGA 1PEZA 3EMZA 4PUWA 3I4KA 2OR2A 2QCHA 1GOMA 4Z0JA 5D8ZA 2J75A 3W7QA 3U7VA 3QM3A 4GHRA 4MLJA 4DJFD 3THCA 3RAOA 2EPMX 3W2KA 4D6FA 3REQB 4GO9A 4UR9A 3BLFA 1P6BA 2PBGA 3MMUA 2VYOA 3R89A 4ECLA 4HOWA 3CS2A 1A4MA 4NZCA 4GXPA 3LM7A 1HJWA 4HBKA 4LUSB 4M80A 3TJLA 1T99A 2ZWZA 4EPDC 3ZT5A 3UESA 1K7EA 2VCBA 3TR2A 1XG3A 4LJ3A 3RN6A 3FHAA 1LP6A 3OVRA 3TWBA 3MHUA 4OT7A 3C3NA 4H8UA 2VC6A 1I75A 1RALA 2JBMA 1EDQA 4BZYA 5CJMA 1KM6A 3T40A 1XX1A 2XINA 1R2RA 3RRAA 4A3HA 4PYSA 2B4GA 3L2MA 2WKJA 3I65A 2PGEA 2F8QA 2DIKA 4C90A 1FWCC 4REQA 3RDKA 3CT2A 1VC4A 2ACSA 4GVHA 3O06A 1ZZMA 2OX1A 4DWSA 5DY2A 3ZWTA 2E5BA 4IPLA 1DVJA 3ANVA 3KBSA 3QSTA 2P8CA 1EWEA 4TOQA 3MP5A 2PDUA 2OQLA 1ISXA 1YQ2A 2PPGA 1PKNA 3Q94A 6REQB 1WZLA 3WH8A 4B16A 1FCBA 1LT7A 3VKDA 2PDWA 1IXNA 5HA7A 4O28A 3QR1A 5E9XA 4KEMA 1QOXA 5DLCA 3KOXA 3GNNA 3W76A 4XX6A 3WX7A 4M5PA 5DMYA 2DT2A 1DXFA 3WQ4A 1WE5A 2E9MA 4B4FA 1WDRA 3VMPA 1QASA 5G2HA 2FMNA 2I16A 1JFXA 2NT1A 3OGVA 4L7ZA 3S2MA 3RXZA 1P1XA 3GLCA 5SWUA 1HKIA 1YE6A 4GY0A 1ISZA 1V6TA 4DJEA 5D38A 4C6CA 5CBBA 1J79A 2XIMA 3CASA 5BMXA 2GQ3A 2EQDA 2DVUA 1Y7VA 4UQAA 2QW5A 5I03A 1DQWA 1KKOA 3SCVA 4D8LA 2OODA 3W1RA 3RMEA 2QVNA 4JIIX 5FF0A 4ZSTA 3T6CA 2J24A 4H9TA 3Q65A 3W28A 4ADSA 1EUAA 4J3VA 4ZQNA 2Y5JA 4IL2A 1U22A 3SRDA 5KETA 4MF4A 2G96A 3HGRA 2WCGA 1XGDA 4Z2HA 3EOOA 1FWFC 1OT1A 4QSHA 4QP0A 1NF7A 1SPQA 1R3SA 4MLRA 3LCLA 4IQDA 1KTCA 1CGWA 3VKJA 2XVNA 4GIAA 2PLKA 3GG0A 1XCXA 4CQCA 2PLMA 3QFEA 4AU0A 1CB2A 2XIBA 4GKTA 5CZ0A 1Q66A 1E4LA 3ZM8A 5AY7A 4WRHA 2G95A 2ZX7A 3A9IA 4XKYB 2V5CA 3SN0A 7TIMA 3KL3A 2XDFA 2QV5A 1NEYA 4DELA 3AMCA 1SFTA 4RE4A 1ZTVA 4ZXLA 4ZQRA 3NQFA 3URNA 4D72A 5ABTA 3KE0A 2XSXA 1FTXA 1K6WA 5BOFA 4KT2A 3PWAA 2D3LA 1LZOA 4CNNA 2J7CA 4HZMA 4FNTA 4MAZA 3SCWA 5I3HA 1B1YA 2YYUA 1J0YA 1G0CA 3FYPA 3TYDA 1HF6A 2YW4A 3N2CA 1IF2A 3TCEA 3ARSA 5BMWA 2I5GA 2YLLA 1JR1A 3L5LA 3G8RA 3G1FA 1I2NA 4GH1A 4D6CA 2A85A 3BJSA 3E49A 4H01A 1Z69A 3VPLA 5D9PA 1GOOA 1J5TA 3TN6A 4LGXA 4FXJA 5MF5A 1LDCA 2YB4A 4CN4A 2RGLA 3ZQ9A 4B5VA 3ONBA 2CYGA 4M3PA 4HK7A 5A6TC 2CHNA 4TUFA 4PGLA 1VBRA 3TC3A 3WKZA 4C1NA 3J7HA 2UBPC 3ZLFA 1GEHA 2NVDA 4V27A 2OWCA 2CBUA 1GOKA 1XRTA 3WJYA 3WH6A 3RU8X 5K9DA 4V2XA 4ZQCA 3GS6A 2ZADA 2Z29A 3VKBA 1XI3A 1A5LC 3NZGA 4FXSA 1JCTA 1E55A 3HA1A 2OOGA 3M41A 1EIBA 2P3ZA 1H11A 4C1LA 3WK0A 4GUGA 3DFPA 3CTTA 5LGZA 1I9CB 3KP1A 2VUYA 3VNLA 4XO6A 2PZ0A 4JIRA 4O4WA 3VILA 4IGHA 4N9EA 1JNDA 1RLCL 1P0BA 4CD4A 3TSDA 3CZKA 3R0KA 3HO8A 5I24A 3DYOA 1KFLA 1UP2A 4MWAC 4Q8TA 1XRSA 1DIDA 1MUMA 4Y90A 3B4UA 2GDUA 1MVYA 4KFOA 3E6EA 1GONA 1M7PA 1EYEA 1WOAA 4PMQA 2I57A 1HVXA 1X98A 4FNRA 3SRKA 3V18A 2WVTA 3GUGA 1N7KA 3IUIA 3B0PA 2QCEA 2GGJA 4Z2KA 2PU0A 1GYMA 5RUBA 4QNEA 4UFMA 2WXDM 1U2YA 3BWWA 3ECQA 2J25A 1QNPA 1MEIA 3BL3A 4I9MA 1DWHM 2Y5SA 1TJ1A 4EWND 2HTMA 3SEPA 1DXIA 1GJPA 2H3BA 4OJYA 1UQYA 2HK1A 2QJGA 1BSLA 1REQB 2Y8KA 1E1FA 1GQLA 3M64A 3E12A 4W5ZA 4P8XA 3V1HA 1DYSA 4A3UA 4NJHA 1TV3A 2EKGA 4OBSA 3PB2A 4ES4A 4OFCA 1TR1A 1WP6A 3N4FA 4C6QA 3KTSA 5D33A 1MO0A 5IBXC 1WDWA 1VHCA 1LL7A 5B7ZA 3W7NA 2FJUB 3DIPA 3HN3A 4K8EA 3P14A 2VUNA 1EJUC 3A24A 3EOSA 2OT0A 1HJVA 1AW1A 2FJKA 2OGYA 3N9RA 4FZIA 1HZYA 3AYTA 3T81A 3W85A 4PRTA 1TWSA 1CYGA 3U8GA 1PZ1A 4DO4A 2QUTA 1V0MA 5HR6A 3PY2A 3A22A 1YIXA 4NI3A 3WD1A 2CZ5A 4YCOA 1D8WA 1KW1A 1UR1A 3A3WA 3UG4A 2ZXBA 2QCCA 3PF3A 4NRRA 3CAVA 5M17A 4AXNA 5CH9A 5L9FA 4PUUA 5EBAA</